4MJSA

Crystal structure of a pb1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
89
structure length
88
Chain Sequence
PHMRVRLKAHYGGDILITSVDTTTFQDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLACQGRDEVLIIHVFPSIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C zeta type
publication title Structural and biochemical insights into the homotypic PB1-PB1 complex between PKC zeta and p62
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/protein binding
total genus 21
structure length 88
sequence length 89
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4mjsA00
1WZ3A 1IP9A 2CKHB 2A4ZA 2PEAA 1GUAB 3X0WA 1WGRA 2K25A 2V4LA 4OVUA 4AJYB 4WWPA 2MSED 3RULA 3VDZA 5CHWA 2MBBB 2YLMA 2LGXA 3QJZA 3V61A 3MJWA 4NQKE 3PRPB 4WJOA 4XC2A 1V5OA 1VD2A 1WFYA 3QX1A 1TTNA 2MLBA 3R3MA 5CHVC 2ZVNA 1Q1OA 3SHQA 3PPAA 5E6OA 1WIAA 3UINB 2CR5A 1TZ1A 3JW0X 2KTRB 1X1MA 3DDCB 4GOCA 3IFWB 5D2MB 3PV1A 2M0XA 3ZNID 4JLCA 3W1YA 4PS8A 5JZEB 4XX5A 2K8HA 2KX3A 2C7HA 2Z0DB 2L7RA 3WAMA 4LDTD 2ZZPB 3PLVA 4RM9A 1V81A 4IM2A 2RD0A 4IG7B 3WIMA 3A9JB 2JT4B 2K1FA 4GIVA 5BO4B 3ZDTA 1EF1A 2L76A 2FIDA 3HHMA 3ZRFA 1C3TA 3M63B 2KJRA 2DENB 2LD9A 3JSVA 2J0KA 1K8RB 2MA9B 4IM0A 4WJNA 4ZDVA 5JHBA 2LVPA 1WM3A 2D2QA 3ONSA 1OGWA 3V60A 3UIPB 3A9KA 3AULA 2DYBA 4W9IA 2IO3B 2KDIA 3PT2B 1Q0WB 1P3QU 5IA7A 4K7WA 2M8SA 4BKTA 2KWCA 3KW5B 5DPSA 2IZVB 1V80A 3BY4B 4GN1A 3N32A 3NHEB 4F8CB 3EC8A 3QWZB 3PVLA 3AXCA 3WAPA 3PREA 1NDDA 4GMVA 1CMXB 5E6NA 3UGBB 3CMMB 1SIFA 2MX2A 1YD8U 2O2VA 1ZW7A 1UBIA 2PE6B 3HIZA 3VUYA 4EZKA 1UELA 4YL8A 5D94A 2CHZA 4NAWA 3KVFB 1V49A 3PHXB 3SD5A 5LXIB 2KZRA 4E71A 1SE9A 1KLVA 3ML8A 1WRDB 3OJ4B 2G45B 1GJZA 2KDFB 2V3SA 4JGHB 5HKHA 2BYFA 3WA0A 4HWIB 3ZNZB 4ANXA 3QA8A 4HPLB 2IBIB 2MQJA 3B0AA 1UGMA 1BT0A 2JUOA 2KX0A 2ZVOA 1OEYJ 2AL3A 4ZRKA 4ANUA 3ENEA 2KOXA 2REXA 1WJ6A 2XEWA 2DHZA 2CHWA 3H6NA 4ICVA 3TCAA 3VTVA 2DAJA 3KH0A 4ZYNA 3ZW3A 2W9NA 1LM8B 2EMTA 2BPSA 3H7PA 4I6PA 3APCA 3L10B 3L16A 5LXHA 2KDBA 2DZIA 3L13A 1WYWB 5EDSA 2BF8B 2KVRA 3NZSA 4JQWC 3RUIB 1NBFC 2GBJA 1PQSA 1V9JA 1Z2MA 2KMAA 2MP2A 3IG3A 4M8NA 2DAFA 5G55A 4W9CA 3RYTA 3DPDA 1XD3B 4EUTA 2MW5A 4BVUC 1G6JA 4HDQA 2GOWA 2EMSA 3N3KB 5CHFA 1ISNA 4GDLA 1NI2A 3TBLD 2WX0A 2D10A 3QARA 3M3JA 3S2AA 2CU1A 4NNJB 2EKEC 4M8MA 3VXWA 1L7YA 4MJSB 4LJOB 3KUZA 3X23A 2IY0B 2LWPA 5D6JB 3HK0A 3NOBA 2N1VA 3HM6X 3VAWA 2ZCCA 4P7IA 4DWFA 2J0JA 1E8ZA 3VTUA 4FULA 1KOTA 2XK5A 2FNJB 1J19A 2GBNA 2DYOA 2KXJA 4KV2A 2KFKA 2KK8A 2LI5A 2L0FA 3OJ3A 3Q3JA 1C1YB 4CO7A 4PYZA 2UWQA 1Z5SB 3DBLI 2L0TA 2NR2A 2DX5B 1IPGA 4BBNF 1WM2A 2AYOB 3DVNU 2JRHA 4KVGB 2JWZA 5DPWA 1WXMA 3NZUA 3I3TB 5CTRC 1UZXB 1GG3A 1WR1A 1WE6A 2FCNA 2C60A 4N9F4 1TGZB 4WAAA 2KNBA 2PJHA 3RZFA 3K9OB 3JSVB 1V5TA 1WF9A 5KHOA 1YIWA 1R4NI 1WGDA 2K8BA 2O6VD 4DHZE 3DBHI 5L83A 2BGFA 2WWZA 1J8CA 1AARA 5FR6A 3A9KB 5LLIA 2KJ6A 3CSTA 3EHVA 3TIXA 5DPTA 4URKA 1WX8A 1R4MI 4A3PA 1GNUA 4CHKA 1WMHA 1EF5A 2NPTA 1WR6E 2IO0B 3VH3B 3ALBA 2MBEA 4HVBA 2O2VB 2HD5B 1IYFA 3APFA 2NCNA 1Y8RC 2M1MA 4MDKE 3AU4A 2FIFA 4NAWB 2QHOA 4MGKE 1WJNA 2I1KA 4G3XB 4E3CA 4K7SA 3A1QB 1S3SG 2LVQA 2NBWB 3H1UA 4KSLC 2N4FA 4NQLB 2K8CA 3ZNGC 2MBHA 4HK2A 3ZRCA 4G50A 5AZFA 2ZJDA 1GC7A 3L0WB 5AZGA 4ASWC 4WWOA 1I42A 4KIKB 2N7EA 3APDA 2KWUB 5DCNA 2C7MB 2KLGA 4FN2A 3V6CB 3B08A 4JIOU 3M95A 3PRMB 2BKFA 4HDOA 3ZDMC 1D3ZA 3H7PB 4W9LA 2PE9A 3V62A 5J17A 4DK5A 2GBMA 3VUWA 2FUHB 1E8YA 1U4AA 2I1JA 3PLUA 2KQ7A 3JVZX 2L8JA 3Q3FA 4I6NB 4W9KA 5J18A 2DZKA 1WX9A 2R2OA 2JZ3B 4II3B 2DYMA 3OLMD 2PPHA 1YX6B 1YQBA 1V2YA 2N9XA 1WY8A 4GDKB 4MGZE 2GBRA 1WGGA 4X57B 3ZKJC 4FADA 4GDLB 4KZCA 4HCNB 1T0YA 2D11A 2K6DB 1F9JA 2KDEB 4II2B 4W9DA 1KJTA 4DHJB 4FJVB 3TMPB 3ZVVA 2NVUI 1RAXA 1E5WA 3EFUA 4IWOA 3PRZA 3DVGY 4EZJA 1L2NA 3RZWC 2G4DB 5L95C 3A4RA 3QIJA 5D7GA 3ECIA 1WXSA 2XK5B 4TQ1A 2N7DA 3GZNI 2J7QB 2KC2A 4KDIC 3AU5A 1I35A 3ZO5B 2G3QB 2FCSA 1SGHA 3UQAA 3VFKA 3WANA 4JL9A 2HJ8A 1E7UA 3L08A 4G11A 4AP4C 4IWQA 3W1SC 1P0RA 3K9PB 3PHWB 1LFDA 4BKSD 4FHKA 3TJPA 1J0GA 2JXXA 2MRPA 3W1SA 2K39A 2ASQA 2V1YA 3PZDA 5J2RA 4FHJA 2IO2B 2M17A 2L05A 3CSFA 2LGDA 1A5RA 3RD2A 1EUVB 1EO6A 1YJ1A 2LRUA 2BWFA 4KZ0A 5AZHA 2HE7A 3KUCB 4WJQA 2FAZA 1E8XA 3U8ZA 4DDGD 3KYCD 2CHXA 4GGQA 2GBKA 1V6EA 1WGYA 4XZ4A 2RSUA 3PSEB 4IUMB 3JYUA 2KMCA 4TUUA 2KHWB 3DBSA 3BINA 2L00B 1WXVA 3B1LX 2LZ6A 2C9WB 1OEYA 2N1WA 3VHTC 1XQQA 4ANWA 4MEMA 3L17A 3IVFA 2Z0EB 4WWNA 1UH6A 5E6PA 1ZKHA 3VTWA 1ZGUB 2HTHA 1WMHB 1S1QB 3MHSD 2ZNVC 2NPTB 4W9JA 3UF8A 1GC6A 4TKNA 3ML9A 3U7DA 2FCQA 2C7NB 2KD0A 4FJYA 3QCAA 4G0NB 5IAAC 4B95A 4LDTB 2JVCA 4MJSA 1YX5B 2IYDB 4W9FA 4EFOA 4NJ6A 5TR5A 4LCDE 4GU2A 4BOZB 1P1AA 3UQBA 2WX1A 5C23A 3VVWB 4ZRJA 3KUDB 3UIOB 4EOYA 3DOWA 2MBOA 4MM3A 2FCMA 3VQIA 2ZCBA 1RRBA 1OQYA 4DBGA 2O6VA 2B3AA 2Y5BB 2ZEQA 5C1ZA 4IWPA 4FLHA 4HXDA 2N9PC 3ZLZA 2IO1B 3DBRI 3DVGX 2KO3A 3ZTCA 5KHQA 2KJHB 4LJPB 3MTNB 4WJPA 3RT3B 1Q5WB 3R66C 2BYVE 4K1RB 1WGHA 4PS7A 4IM3A 4M0WB 4DHZB 1WXAA 2RGFA 4MH0E 2LRWA 4OVVA 3V6EB 2R2QA 4CYEA 4RMAA 4HJKA 2RPQA 2AWTA 2UYZB 2Z59B 3QHTA 3T9LA 1QZEA 2JZZA 1E7VA 3PTFC 4B6WA 2KTRA 2LXAA 3ZUNA 4IC7B 4NJ7A 4EEWA 3M62B 1XT9B 3D32A 2JPHA 2A5UA 2OOBB 2WYQA 3SDLC 2JRIB 1WH3A 2VRRB 2M4NA 3GOEA 3QC8B 3DVNV 1LQBA 1WJUA 4PYUA 1JRUA 2KQSA 4AOFA 1WJ4A 4ANVA 4DDID 3R7RA 1FXTB 4TV3A 3WALA 4MSQB 3A9JA 1UD7A 3ZTDA 5CX3A 2GMIC 1WI0A 4BBNC 3CF6E 3A4SC 2MP2B 3P2BA 4GXBA 2KN5A 2LASA 1P98A 1P9DU 3C0RB 1HE8A 1WZ0A 4PS3A 4RM8A 2MCNB 2NBUA 2BWES 2LUEA 2LJ5A 2CS4A 2NBVB 2YVCA 4K7UA 3PGEA 3WAOA 2WDTB 2G4SA 1WE7A 3QQ8B 1H4RA 4FBJB 2IY1B 3PS6A 3HM3A 1KM7A 3QK0A 3R7QA 3SU8X 4IW0A 2DZJA 2J0MA 4W9EA 1WX7A 3A1QA 4KDLB 4FA6A 1E90A 4MGYE 3TL5A 2K6QA 5JH5C 4W9GA 2ZPYA 4BKGA 4NPNA 4KSKC 2MWSB 2DZMA 3LDZE 3L54A 4KIKA 5DPRA 2KWVB 4E74A 1V86A 2JF5A 4ZRIA 3U30A 2L3ZA 4K81A 2AL6A 2KLCA 3LJ3A 3NS8A 1VCBA 4HCPB 2KFKB 2KTFA 4GB9A 4AWJA 2BKRB 1MG8A 2LVOA 2KC1A 4HLEA 4DXAB 5GMVA 3VUXA 3A33B 4MGIE 3T8MA 3NY5A 2KKCA 3KYDD 2KANA 2N9EB 4BFRA 4I6LB 4DHJD 4MELA 5G2NA 3IHPC 1TBEA 3H9DA 2RR9A 4FJZA 4B9KA 4EKUA 4GDKA 5AEKB 2XBBC 3DQVA 3VH4B 4A20A 4TQ0A 4BOSC 4AUQC 4AJWA 1UBQA 4F7ZA 1E8WA 3OAWA 4HPMB 2LXCA 4BKSA 2D3GA 1RFAA 3EECA 4GSWA 2C5LC 4WQOB 1OTRB 2ZPNA 2ZNVB 4F1SA 1H8CA 2JY6A 2MBQA 3AI5A 3O65B 5JHAA 2D07B 2KFJA 3DCGA 4A3OA 4J6IA 3ZNHB 3QAQA 2NS5A 4MSMB 3RCZA 4EZLA 2LGYA 3IBEA 1RLFA 1M94A 4NY0A 2BYEA 3ZIMA 1LXDA 4ICUA 2AEHA 2O6VB 4W9HA 2OJRA 3H7SA 3N30A
chains in the Genus database with same CATH superfamily
2PEAA 4AJYB 3FILB 1M4VA 4JWSC 2LGXA 4CQNA 3MJWA 2QSDA 2MLBA 2AQ3B 3BYTB 2GI9A 3SHQA 3PPAA 5E6OA 3IFWB 2K5PA 3PV1A 4KGSA 2UU7A 1PGXA 1YOVB 1E9MA 1JROA 3WAMA 4LDTD 2MH7A 1Q10A 1V81A 4GIVA 1C9FA 3ZRFA 2FIDA 2N9KA 2KJRA 5JHBA 4WJNA 2LVPA 1T0SC 2D2QA 2DLBA 1ACCA 3AULA 1F0ZA 3PT2B 4K7WA 2NTSA 3HUIA 4BKTA 3KW5B 3P4QB 1V80A 1D6EC 4UDUC 3QWZB 3WAPA 1NDDA 1CMXB 1SIFA 4RGNA 2O2VA 3ZJUA 1UBIA 2PE6B 1B9RA 5D94A 3SD5A 2VZKB 2KZRA 1KLVA 3ML8A 1WRDB 2PMVA 4A6QA 2GRIA 3B0AA 1BT0A 1DGJA 3N1ZC 1HQRD 3KQ4A 4ANUA 1T6BX 2KOXA 2REXA 1WJ6A 3H6NA 2CHWA 4C56C 3RPFC 2LJIA 2W9NA 1LM8B 2BPSA 3NVYA 5LXHA 2DZIA 3L13A 1WYWB 2BF8B 4JQWC 4NJCA 3RUIB 3IG3A 3DPDA 1XD3B 1G6JA 4HDQA 2GOWA 2EMSA 3N1YC 2PVGC 1NI2A 3AE6B 1TY2A 1JCKB 5H92C 4TSSA 2CU1A 2BB6A 2EELA 1HA5A 4MJSB 4LJOB 2XNAC 3P63A 4US9A 2LWPA 3HM6X 4DWFA 2J0JA 2WNMA 1E8ZA 2ZW1A 1T0QC 2LMCA 1WYGA 3Q8FA 2KFKA 2KK8A 3OJ3A 1VZ8A 1STEA 2UWQA 1TY0A 3SR6A 4RF1A 2AYOB 2JRHA 3NZUA 3WCQA 4C00A 2PJHA 3K9OB 1V5TA 2BQQA 3NVZA 4BAXA 1WGDA 2K8BA 4ITKA 3DBHI 2BGFA 1AARA 5MPOA 1EWCA 5FR6A 3A9KB 2RDGA 2KJ6A 5DPTA 1WX8A 4RF0A 4A3PA 4CHKA 1GNUA 3AEAB 3SFEB 1L6UA 3ALBA 2MBEA 3Q6BA 3E56A 1IYFA 4IKGA 2NCNA 1Y8RC 2KVZA 2RDBC 2FIFA 3AU4A 2I1KA 1N6ZA 1L4DB 3MC8A 2JU6X 2NBWB 5E6JA 2ZJDA 1GC7A 3L0WB 5AZGA 4WWOA 1I42A 1WWTA 2N7EA 2CJNA 2KWUB 3APDA 3V3XA 4DQOC 3DHIC 3NZ3A 4HDOA 3ZDMC 2BS3B 3H7PB 1D3ZA 2FUHB 1D5MC 1NYRA 1U4AA 3JVZX 2L8JA 4D2KA 4I6NB 1ESFA 4II3B 2JZ3B 2WXHA 1SF0A 3OLMD 2PPHA 1YX6B 4HKZE 3AE7B 3C8YA 1T0YA 1L6VA 2D11A 2K6DB 4II2B 4TMAB 3TMPB 2FE8A 1E5WA 1RAXA 4IWOA 1L2NA 3RZWC 3A4RA 5D7GA 3VR9B 3MFGA 4XDDA 2J7QB 3ZO5B 2G3QB 2M0AA 4WURA 3UQAA 3VFKA 1RYJA 3FKYA 2HJ8A 4IWQA 3W1SC 2J42A 3PZ8A 3PHWB 2E3TA 4KKJA 4BKSD 1J0GA 2K39A 2V1YA 2IO2B 2M17A 2L05A 3CSFA 1XLQA 1YJ1A 4O1NA 4KZ0A 2WDRB 4WJQA 1E8XA 1L5PA 4XZ4A 1HXYD 2RSUA 3PSEB 4P1BC 2K0PA 3DBSA 4ARCA 2N1WA 1XQQA 4ANWA 3IVFA 1ZKHA 3MHSD 1GC6A 3ML9A 4FJYA 1QLBB 1YX5B 2MEKA 3UIOB 2V3PA 2WXIA 4EOYA 2ZCBA 1KLGD 4DBGA 1I4QA 5JXVA 3PO0A 5C3JB 2IO1B 3DBRI 3ZTCA 2X8XX 3MTNB 2MJDA 3RT3B 4XE0A 1HTOA 5HI1A 3DWMA 1FNWA 4DHZB 1HZ5A 1WXAA 3J9CA 3V6EB 4CYEA 2RPQA 2Z59B 1QZEA 1E7VA 2KTRA 4L1BA 3HRDD 4IC7B 1KTKA 3GS2A 1J7CA 2JPHA 1F77A 2D3CA 2JRIB 1WH3A 3GOEA 3KLSX 3NJTA 3QC8B 3DVNV 4PYUA 1JRUA 2OJWA 4ANVA 2HJ1A 2I38A 4DDID 3P4SB 4TV3A 1F1HA 4M01A 4NAMA 3ZTDA 2BB5A 3CF6E 2IGGA 1K51A 4RM8A 2BWES 2I2YA 3PGEA 3WAOA 1WE7A 2HTME 3QK0A 2DZJA 4ZRQA 2J0MA 5HFYA 1WX7A 4KDLB 4FA6A 4YTNB 3TL5A 1FPYA 4ZHPA 4NPNA 4KSKC 1TS5A 5DPRA 2GB1A 1YMHE 4E74A 3U30A 4HCPB 1VCBA 4GB9A 1MG8A 2KC1A 3E9SA 2GLSA 3VUXA 4MGIE 2M19A 2KKCA 4DHJD 4I6LB 3IHPC 2Y5PA 4YSXB 1GOZA 1EWYC 4FJZA 4B9KA 1I4HA 2XBBC 3VH4B 4A20A 1K52A 1FFUA 4BOSC 4AJWA 1E8WA 4BKSA 4GLSC 1XXGA 2ZPNA 1NI3A 5JHAA 2D07B 4HJGE 2WU5B 1ZDXA 2QDFA 1VLBA 3RCZA 4HROA 2LGYA 1M94A 3PZ7A 4ICUA 1K53A 4YTPB 1FEHA 1ZPSA 1WZ3A 2CKHB 1I7HA 2MSED 2MBBB 2YLMA 4QAYA 1RM6C 2L52A 3GE3C 1ZUD2 1V5OA 3GB1A 2KACA 1TTNA 3QX1A 4RFBA 5CHVC 3ZXVA 1FXIA 3DHGC 4RGTA 4IDIA 1TZ1A 3SEBA 4EE2A 3NVVA 5D2MB 3ZNID 3AN1A 4JLCA 3W1YA 2BT6A 3RN9C 2K8HA 4XDCA 2KX3A 2C7HA 2ACZB 5I4DA 2ZZPB 1L0VB 3RI7C 3PLVA 4RM9A 1LGRA 2JYEA 2RDHA 2RD0A 4IG7B 4KGRA 3A9JB 4C80A 3R8BA 2L76A 3HHMA 3DBHB 3JSVA 2J0KA 2MA9B 4IM0A 3U4EG 4ZDVA 1R7SA 1WM3A 4MACA 3ONSA 3UIPB 2IDYA 2KDIA 1Q0WB 2R61A 5IA7A 2M8SA 4OW0A 2KWCA 3T3NA 5DPSA 2IZVB 3BY4B 3NHEB 2JX5A 3PVLA 3PREA 3Q8EA 4JX1C 4GMVA 2MX2A 5TSSA 1SJED 4YL8A 2CHZA 2WXOA 1V49A 2Q5WD 1GAQB 2KDMA 1SBBB 4E71A 1SE9A 5HKHA 2BYFA 3WA0A 2YEPF 4HWIB 3ZNZB 4ANXA 1OQQA 1ET6A 2MQJA 1UGMA 3Q14C 1IBXB 3ENEA 2W54A 1V1PB 1PDXA 2DAJA 3KH0A 2EKIA 4B0MA 2EMTA 2Y3AA 3ZJTA 1V97A 3NZSA 1NBFC 5FR3A 1PQSA 2MP2A 5G55A 2DAFA 4W9CA 3RYTA 3LXFA 1SB3C 4DXFA 4EUTA 2MW5A 3N3KB 4K3CA 1ISNA 4NNJB 3AV8A 4M8MA 1L7YA 2W3SA 3X23A 1Y56A 4XYCA 1XCQL 4FULA 1KOTA 1J19A 2KXJA 4KV2A 2MJEA 2LI5A 1C1YB 4BBNF 3DVNU 3AE5B 1WXMA 3I3TB 5AUIA 1WE6A 2JWUA 2FUG1 1IUEA 4N9F4 4ZYSA 5BYQA 5BYRA 1A70A 5KHOA 1TKEA 1R4NI 2O6VD 3NS1A 4DHZE 3Q69A 1J8CA 3RNAC 1OQRA 2JXTA 3MC9A 1YN3A 3TIXA 2INNE 2V9HA 1L4ZB 4PT5A 1WMHA 2IO0B 2V4IB 2O2VB 2HD5B 3APFA 2J53A 1I4XA 4G3XB 1HZ6A 3H1UA 2N4FA 3DBRB 2MBHA 4RGMA 4AQ7A 2J4XA 4KIKB 2IJ0A 3V6CB 3B08A 2QEJC 3PRMB 2N0SB 4LK0M 2PIAA 3VUWA 2LFIA 2ZW0A 1YQ3B 2I1JA 2IGDA 4W9KA 2H88B 1WX9A 4C4VB 1WY8A 4GDKB 2WXGA 3AMZA 3FAHA 2CJOA 2KDEB 5EE1A 3Q3MC 1KJTA 1WRIA 5EE0A 3ZVVA 1SEBD 2INPE 4EZJA 5EE3A 2G4DB 1ROEA 4S0RA 2KC2A 2D5GA 1JMLA 3AE4B 5T8IA 4JL9A 2JQRB 3LB8C 5BMHA 3AB5A 5J2RA 2ASQA 3PZDA 2IPKD 1EUVB 2BWFA 1C4CA 2QJLA 2HE7A 3TEZA 2RMMA 2CHXA 4GGQA 1WGYA 4J3OD 2SAKA 3TSSA 1ENFA 3JYUA 2KMCA 3B1LX 2C9WB 2L1AA 3VHTC 2PTLA 4MEMA 4WWMA 2Z0EB 1MVKA 1UH6A 3NUHB 3AE1B 2ZNVC 4A55A 4OVZA 1TKGA 3U7DA 4XWTA 5IAAC 3KWLA 4B95A 1L0XB 4LDTB 4MJSA 1GB4A 2IYDB 1E6EB 4BOZB 4C7YA 4A8XC 3UQBA 2WX1A 2MBOA 4N59A 4MM3A 2JSVX 2O6VA 1FNUA 2B3AA 2ZEQA 4KX6B 4FLHA 1WGKA 4HXDA 2N9PC 3ZLZA 3AEBB 1JW9D 5D3IB 1DOYA 4K1RB 4PS7A 3B2GA 2AX5A 2RGFA 2KWDA 4OVVA 4ARIA 4HJKA 2E6XA 1SXTA 2AWTA 2KQ4X 3MJ5A 3QHTA 3T9LA 2JZZA 1OFFA 3IT6B 3PTFC 3AE8B 2LXAA 2QC8A 4NJ7A 3M62B 3D32A 2OOBB 1UNSA 5G5GA 1ZE3D 2VRRB 2M4NA 3BYYB 1JALA 3BZDB 2LUMA 1FXTB 3R7RA 1TYGB 1VDVA 3TEXA 3A4SC 4GXBA 2G9HD 2LASA 1E0ZA 4US8A 3R2IA 1UWMA 4NZLB 2CS4A 4OZAA 4K7UA 4FBJB 1H4RA 2IY1B 3R7QA 1KM7A 2K9XA 1P7FA 1K50A 3ZYYX 2BYTA 3UI3A 2XN9C 2DZMA 3RNGC 4FXCA 1V86A 2JF5A 2L3ZA 2KTFA 4HKQA 4DXAB 2PW9A 3NY5A 3U2SC 2N9EB 2PKOA 5G2NA 1TBEA 3H9DA 1VRAB 4EKUA 1B1ZA 5AEKB 1VZ6A 1C76A 1UBQA 1TJEA 1GPXA 3EECA 4F1SA 2ZNVB 3I57A 2JY6A 2MBQA 3AI5A 3AM9A 4YXDB 3URYA 2SEBD 3NG0A 4J6IA 5G5HA 3QAQA 3HVZA 3TUOA 3IBEA 5IP4D 1FCLA 4REZA 2BYEA 4P16A 1PFDA 3H7SA 3HVDA 4OZBA 1MHXA 2A4ZA 1GUAB 1WGRA 4OVUA 3FC4A 3VDZA 1TT5B 5CHWA 3V61A 3B2FA 4NQKE 4WJOA 4XC2A 2K22A 1N62A 3R3MA 2ZVNA 1CJEA 3Q2AC 1WIAA 3JW0X 2KTRB 4KGTA 4B0EA 1X1MA 4LNIA 2W3RA 5JZEB 4XX5A 2Z0DB 2L7RA 4LNNA 2DNFA 3WIMA 5BO4B 2K1FA 3ZDTA 1R4NB 1EF1A 2ICIA 1C3TA 3M63B 2DENB 1K8RB 4BZAA 1NYQA 3V60A 1OGWA 1UGJA 4W9IA 1P3QU 4GN1A 3N32A 1NVID 3IT4B 3EC8A 5AUKA 5E6NA 3UGBB 1JWBD 1D5ZC 3CMMB 1YD8U 3HIZA 3VUYA 1UELA 2MJ3A 4NAWA 3BVMA 2KYWA 4WIPA 5LXIB 1EM7A 3OJ4B 1GJZA 4JGHB 2JZPA 3QA8A 1N63A 4HPLB 4HPPA 1N5XA 4Q2JA 2JUOA 2KX0A 4ZRKA 1OEYJ 2AL3A 3TCAA 1XEEA 5D3DA 5IKCM 3L16A 3RFZB 5EDSA 1FMAD 2KVRA 1CK1A 2GBJA 4M8NA 1V9JA 1Z2MA 2KMAA 3SFDB 1FD6A 4LTUA 5CHFA 2WXJA 4GDLA 1TIFA 3TBLD 2WX0A 1AN8A 3VXWA 3KUZA 4AS1A 2QIEB 3W2DA 3HK0A 3NOBA 3ZGZA 3VAWA 1I4GA 4P7IA 3VTUA 2XK5A 1HEZE 2FNJB 3Q3JA 4PYZA 1UWXA 1KLUD 1Z5SB 3DBLI 2L0TA 2DX5B 3AE9B 1WM2A 1FCCC 5DPWA 1N61A 1RFKA 1UF0A 2D3BA 2FCNA 1VR9A 3RNFC 1TGZB 1JWSD 1PGBA 3P4PB 4WAAA 2AQ1B 3JSVB 1F52A 2V3NA 1YIWA 3I9V1 2WWZA 3RNBC 4N58A 4ZOHC 3CSTA 4P1CC 3EHVA 3GE8C 1R4MI 1EF5A 2NPTA 4L2YA 4HVBA 2QHOA 4MGKE 1WJNA 3EFCA 4K7SA 2PLPA 3TEYA 3A1QB 2NMQA 1S3SG 2LVQA 5IO9A 2HDEA 4NQLB 3ZNGC 4LLGM 4HK2A 3ZRCA 3ZXRA 4RNAA 4ASWC 4ZRPA 5DCNA 2KLGA 1ZOYB 4KKIA 4JIOU 2LHDA 2J52A 1AW7A 5BMIA 2H89B 1FXAA 3T3OA 4M0WA 2PE9A 4W9LA 3V62A 5J17A 1E8YA 3PLUA 2IGHA 2R2OA 2DYMA 2N9XA 1BXTA 3U52E 1JWAD 1WGGA 2VH1A 4X57B 3ZKJC 4KZCA 1CZPA 1F9JA 4MH8A 2RPVA 4DHJB 1QILA 4FJVB 2VZKD 1MG4A 4LNFA 2JYTA 1ZDVA 2NVUI 2LEKA 3EFUA 3NRZA 3PRZA 3DVGY 4M02A 5EE9A 3AEGB 3ECIA 1C77A 2N7DA 3GZNI 4KDIC 1I35A 2L83A 2INDC 4LNKA 2FCSA 1EU4A 3WANA 3L08A 3MHZA 2G1EA 1P0RA 1P7EA 2OHFA 4FHKA 1HTQA 2MRPA 1IBXA 3DHHC 2LGDA 1EO6A 3RNEC 5AZHA 3KUCB 2FAZA 1RWSA 1L0YB 4DDGD 3KYCD 1GB1A 1V6EA 2KHWB 3OWEB 2L00B 2LZ6A 2Z8LA 1QF6A 4WWNA 1ZGUB 2HTHA 1WMHB 1S1QB 4W9JA 1PUTA 4TKNA 3BVZA 2C7NB 2KD0A 3CIRB 3QCAA 4G0NB 2PVOD 1XO3A 1QOAA 4WH4A 3VVWB 3KUDB 3AH7A 5H8YE 3VQIA 3EA6A 1RRBA 1OQYA 2KAJA 3DWGC 2LGIA 1DOIA 2Y5BB 5C1ZA 4IWPA 3FILA 1I4PA 2QMTA 3R66C 2BYVE 1WSPA 4JWUC 4HRSA 2ON8A 1YNTE 1I4RA 4RMAA 2M56B 3W9CB 2WXPA 2BVCA 4B6WA 3MP9A 2LGSA 4EEWA 3EUB2 1SE2A 1V8CA 2A5UA 2WYQA 3SDLC 1LQBA 2FBWB 2KQSA 4AOFA 1WJ4A 3L4PA 4MSQB 1UD7A 5CX3A 3ETRA 2WXKA 1JWUD 2Y5CA 1P98A 2MCNB 3AE2B 4L23A 1TKYA 4YT0B 2LUEA 1SIJA 2YVCA 2G4SA 2WQYB 3R2TA 3ABVB 3SU8X 1KRHA 3EGRA 4USAA 2K6QA 1CQVA 5JH5C 4W9GA 2ZPYA 3AEFB 2MWSB 1ZXIA 3LDZE 3L54A 4KIKA 4H2AA 2DWQA 3VRAB 4ZRIA 4K81A 2AL6A 3NS8A 2KFKB 1FO4A 2BKRB 2BTEA 1EU3A 1FRRA 1TZOA 3AEEB 3T8MA 3KWVA 3KYDD 2KANA 4BFRA 4MELA 4C4VA 2VH2A 4GDKA 3DQVA 3IXSA 3IAS1 4HPMB 2LXCA 4ZHOA 2D3GA 4WQOB 4GSWA 2ONQA 4A3OA 5C2TB 2NS5A 4MSMB 5LNK1 4EZLA 4A9AA 3AE3B 4MM3B 2AEHA 1IGDA 2O6VB 2OJRA 2K3UA 1YJIA 3N30A 4W9HA 4DXGA 1IP9A 3X0WA 2K25A 2V4LA 4WWPA 3RULA 2QILA 3QJZA 2WXMA 3PRPB 4ACFA 1VD2A 1WFYA 1Q1OA 4RGOS 3UINB 3DBLB 1MPEA 2CR5A 2WDQB 3DDCB 4YSZB 4GOCA 2M0XA 4PS8A 2BW2A 1V1OA 2D3AA 1SE4A 4PK1A 5HHDG 4IM2A 2X38A 2JT4B 1KF6B 2LD9A 4M00A 3P4RB 1YN5A 3A9KA 1R4MB 5IOIA 2DYBA 2IO3B 3C19A 5HG2A 1MFWA 4F8CB 3AXCA 1AYFA 1T0RC 1QT9A 4XWWA 1ZW7A 3N1XC 5BMGA 3V05A 4EZKA 3KVFB 1ZXHA 2LHEA 3PHXB 2KN4A 2G45B 2KDFB 2V3SA 1SE3A 1YN4A 1MHHE 2IBIB 3BK2A 1XCTL 2ZVOA 4N6EB 2XEWA 4ICVA 2DHZA 3VTVA 4ZYNA 3ZW3A 1WXQA 4YTMB 2W82A 4I6PA 3H7PA 3APCA 3L10B 2KDBA 3BK1A 3Q3NC 5FK9C 1JRPA 3LYYA 2BS4B 4BVUC 3O13A 4MT5A 3I5JC 1QOGA 1KH0A 2D10A 3QARA 3M3JA 3S2AA 2EKEC 2B76B 3RNCC 2WXQA 2IY0B 3GZNB 5D6JB 2N1VA 2ZCCA 3B9JA 3RMKC 1F2RI 1JQ4A 1XLNA 1KFYB 2WS3B 2GBNA 2DYOA 2L0FA 4CO7A 2NR2A 4HEA1 1IPGA 1YJJA 3BWUD 4KVGB 2JWZA 1N60A 5CTRC 1UZXB 1XLOA 1GG3A 1WR1A 2KT7A 2C60A 3IAM1 2KNBA 4YSYB 3RZFA 3NVWA 1WF9A 2BBCA 5L83A 5LLIA 2W55A 3Q3OC 4URKA 4RH6A 2WXFA 3P1MA 1WR6E 3VH3B 3CWIA 1FFVA 3N20C 4OHJA 2M1MA 1PYWD 4MDKE 2WU2B 4K3BA 4NAWB 3MC0B 1MI0A 4E3CA 3U7ZA 1UUPA 1J7AA 1ZP0B 1C4PA 4KSLC 2WHIA 2K8CA 4G50A 5AZFA 4JPSA 2WDVB 4JE3B 1QKZA 2C7MB 4FN2A 1SJHD 3M95A 2BKFA 3AECB 4YWGG 4DK5A 2GBMA 4R3DA 2KQ7A 3Q3FA 1D4BA 5J18A 2DZKA 1SSNA 1LO5D 1FNVA 2OEDA 1YQBA 1V2YA 4MGZE 2GBRA 5IN7A 4FADA 4GDLB 4HCNB 4W9DA 3W5UB 4WQMA 2TSSA 2INCC 1IGCA 2AQ2B 5L95C 3QIJA 1WXSA 2XK5B 4TQ1A 3AU5A 3VRBB 1SGHA 1XLPA 1E7UA 4G11A 4AP4C 1C4AA 3K9PB 1LFDA 1C78A 3TJPA 1MJDA 1J7BA 2JXXA 1BUIC 3W1SA 4FHJA 4LNOA 1NENB 1A5RA 3RD2A 2LRUA 3BVGA 2WP9B 3U8ZA 2GBKA 4IUMB 1XF5L 4WAFA 1DOXA 4TUUA 1PGAA 1T3QA 3BINA 1WXVA 4A90A 4P6VF 2N7JA 1OEYA 3L17A 2KMMA 2BS2B 1VJKA 5E6PA 3VTWA 2CU3A 3Q8BA 3ZJVA 2NPTB 3UF8A 2WGSA 3VR8B 4OZCA 3OG5A 2FCQA 2JVCA 4W9FA 4EFOA 2QCZA 4NJ6A 5TR5A 4LCDE 4GU2A 1FM0D 1P1AA 5C23A 4ZRJA 3DOWA 2FCMA 4IOIE 1F2RC 3DVGX 2KO3A 5KHQA 2KJHB 4LJPB 4WJPA 1Q5WB 1TS4A 1WGHA 5FKAC 1E10A 4IM3A 4M0WB 2WXRA 3GP7A 2NTTA 1TS2A 4MH0E 2LRWA 3TEWA 2R2QA 2WXLA 3Q8CA 4S17A 2UYZB 3ZUNA 1JWMD 1XT9B 4XGAB 1FIQA 1QOBA 1WJUA 3W5VB 3WALA 3A9JA 1AWDA 2N9LA 1FRDA 4C7ZA 2GMIC 1WI0A 4BBNC 3P2BA 2MP2B 2KN5A 1P9DU 3C0RB 1HE8A 1WZ0A 1YQ4B 4PS3A 2NBUA 2LJ5A 2NBVB 2WDTB 3QQ8B 3PS6A 1ET9A 3HM3A 4IW0A 4W9EA 3A1QA 1E90A 4MGYE 3Q8AA 1D5XC 4BKGA 1DYQA 3N9YC 1VZ7A 2KWVB 2KLCA 3LJ3A 1BMLC 4AWJA 2DBYA 2LVOA 3H8HA 5GMVA 3A33B 2L32A 1QOFA 5GXGB 2WLBA 1C79A 3AEDB 1TS3A 2MHJA 2RR9A 3ZQ4A 1V1PA 4TQ0A 4F7ZA 4AUQC 3OAWA 3I63C 1QQRA 1E7PB 1T5XD 4HLEA 1RFAA 2WXNA 2C5LC 2YEPB 1OTRB 1H8CA 3O65B 2KFJA 3DCGA 2V0GA 4RCOA 3ZNHB 1N5WA 3P42A 3BIID 1RLFA 4NY0A 3ZIMA 1LXDA 5BYSA 1NEKB
chains in the Genus database with same CATH topology
1WZ3A 1IP9A 2CKHB 2A4ZA 2PEAA 1GUAB 3X0WA 1WGRA 2K25A 2V4LA 4OVUA 4AJYB 4WWPA 2MSED 3RULA 3VDZA 5CHWA 2MBBB 2YLMA 2LGXA 3QJZA 3V61A 3MJWA 4NQKE 3PRPB 4WJOA 4XC2A 1V5OA 1VD2A 1WFYA 3QX1A 1TTNA 2MLBA 3R3MA 5CHVC 2ZVNA 1Q1OA 3SHQA 3PPAA 5E6OA 1WIAA 3UINB 2CR5A 1TZ1A 3JW0X 2KTRB 1X1MA 3DDCB 4GOCA 3IFWB 5D2MB 3PV1A 2M0XA 3ZNID 4JLCA 3W1YA 4PS8A 5JZEB 4XX5A 2K8HA 2KX3A 2C7HA 2Z0DB 2L7RA 3WAMA 4LDTD 2ZZPB 3PLVA 4RM9A 1V81A 4IM2A 2RD0A 4IG7B 3WIMA 3A9JB 2JT4B 2K1FA 4GIVA 5BO4B 3ZDTA 1EF1A 2L76A 2FIDA 3HHMA 3ZRFA 1C3TA 3M63B 2KJRA 2DENB 2LD9A 3JSVA 2J0KA 1K8RB 2MA9B 4IM0A 4WJNA 4ZDVA 5JHBA 2LVPA 1WM3A 2D2QA 3ONSA 1OGWA 3V60A 3UIPB 3A9KA 3AULA 2DYBA 4W9IA 2IO3B 2KDIA 3PT2B 1Q0WB 1P3QU 5IA7A 4K7WA 2M8SA 4BKTA 2KWCA 3KW5B 5DPSA 2IZVB 1V80A 3BY4B 4GN1A 3N32A 3NHEB 4F8CB 3EC8A 3QWZB 3PVLA 3AXCA 3WAPA 3PREA 1NDDA 4GMVA 1CMXB 5E6NA 3UGBB 3CMMB 1SIFA 2MX2A 1YD8U 2O2VA 1ZW7A 1UBIA 2PE6B 3HIZA 3VUYA 4EZKA 1UELA 4YL8A 5D94A 2CHZA 4NAWA 3KVFB 1V49A 3PHXB 3SD5A 5LXIB 2KZRA 4E71A 1SE9A 1KLVA 3ML8A 1WRDB 3OJ4B 2G45B 1GJZA 2KDFB 2V3SA 4JGHB 5HKHA 2BYFA 3WA0A 4HWIB 3ZNZB 4ANXA 3QA8A 4HPLB 2IBIB 2MQJA 3B0AA 1UGMA 1BT0A 2JUOA 2KX0A 2ZVOA 1OEYJ 2AL3A 4ZRKA 4ANUA 3ENEA 2KOXA 2REXA 1WJ6A 2XEWA 2DHZA 2CHWA 3H6NA 4ICVA 3TCAA 3VTVA 2DAJA 3KH0A 4ZYNA 3ZW3A 2W9NA 1LM8B 2EMTA 2BPSA 3H7PA 4I6PA 3APCA 3L10B 3L16A 5LXHA 2KDBA 2DZIA 3L13A 1WYWB 5EDSA 2BF8B 2KVRA 3NZSA 4JQWC 3RUIB 1NBFC 2GBJA 1PQSA 1V9JA 1Z2MA 2KMAA 2MP2A 3IG3A 4M8NA 2DAFA 5G55A 4W9CA 3RYTA 3DPDA 1XD3B 4EUTA 2MW5A 4BVUC 1G6JA 4HDQA 2GOWA 2EMSA 3N3KB 5CHFA 1ISNA 4GDLA 1NI2A 3TBLD 2WX0A 2D10A 3QARA 3M3JA 3S2AA 2CU1A 4NNJB 2EKEC 4M8MA 3VXWA 1L7YA 4MJSB 4LJOB 3KUZA 3X23A 2IY0B 2LWPA 5D6JB 3HK0A 3NOBA 2N1VA 3HM6X 3VAWA 2ZCCA 4P7IA 4DWFA 2J0JA 1E8ZA 3VTUA 4FULA 1KOTA 2XK5A 2FNJB 1J19A 2GBNA 2DYOA 2KXJA 4KV2A 2KFKA 2KK8A 2LI5A 2L0FA 3OJ3A 3Q3JA 1C1YB 4CO7A 4PYZA 2UWQA 1Z5SB 3DBLI 2L0TA 2NR2A 2DX5B 1IPGA 4BBNF 1WM2A 2AYOB 3DVNU 2JRHA 4KVGB 2JWZA 5DPWA 1WXMA 3NZUA 3I3TB 5CTRC 1UZXB 1GG3A 1WR1A 1WE6A 2FCNA 2C60A 4N9F4 1TGZB 4WAAA 2KNBA 2PJHA 3RZFA 3K9OB 3JSVB 1V5TA 1WF9A 5KHOA 1YIWA 1R4NI 1WGDA 2K8BA 2O6VD 4DHZE 3DBHI 5L83A 2BGFA 2WWZA 1J8CA 1AARA 5FR6A 3A9KB 5LLIA 2KJ6A 3CSTA 3EHVA 3TIXA 5DPTA 4URKA 1WX8A 1R4MI 4A3PA 1GNUA 4CHKA 1WMHA 1EF5A 2NPTA 1WR6E 2IO0B 3VH3B 3ALBA 2MBEA 4HVBA 2O2VB 2HD5B 1IYFA 3APFA 2NCNA 1Y8RC 2M1MA 4MDKE 3AU4A 2FIFA 4NAWB 2QHOA 4MGKE 1WJNA 2I1KA 4G3XB 4E3CA 4K7SA 3A1QB 1S3SG 2LVQA 2NBWB 3H1UA 4KSLC 2N4FA 4NQLB 2K8CA 3ZNGC 2MBHA 4HK2A 3ZRCA 4G50A 5AZFA 2ZJDA 1GC7A 3L0WB 5AZGA 4ASWC 4WWOA 1I42A 4KIKB 2N7EA 3APDA 2KWUB 5DCNA 2C7MB 2KLGA 4FN2A 3V6CB 3B08A 4JIOU 3M95A 3PRMB 2BKFA 4HDOA 3ZDMC 1D3ZA 3H7PB 4W9LA 2PE9A 3V62A 5J17A 4DK5A 2GBMA 3VUWA 2FUHB 1E8YA 1U4AA 2I1JA 3PLUA 2KQ7A 3JVZX 2L8JA 3Q3FA 4I6NB 4W9KA 5J18A 2DZKA 1WX9A 2R2OA 2JZ3B 4II3B 2DYMA 3OLMD 2PPHA 1YX6B 1YQBA 1V2YA 2N9XA 1WY8A 4GDKB 4MGZE 2GBRA 1WGGA 4X57B 3ZKJC 4FADA 4GDLB 4KZCA 4HCNB 1T0YA 2D11A 2K6DB 1F9JA 2KDEB 4II2B 4W9DA 1KJTA 4DHJB 4FJVB 3TMPB 3ZVVA 2NVUI 1RAXA 1E5WA 3EFUA 4IWOA 3PRZA 3DVGY 4EZJA 1L2NA 3RZWC 2G4DB 5L95C 3A4RA 3QIJA 5D7GA 3ECIA 1WXSA 2XK5B 4TQ1A 2N7DA 3GZNI 2J7QB 2KC2A 4KDIC 3AU5A 1I35A 3ZO5B 2G3QB 2FCSA 1SGHA 3UQAA 3VFKA 3WANA 4JL9A 2HJ8A 1E7UA 3L08A 4G11A 4AP4C 4IWQA 3W1SC 1P0RA 3K9PB 3PHWB 1LFDA 4BKSD 4FHKA 3TJPA 1J0GA 2JXXA 2MRPA 3W1SA 2K39A 2ASQA 2V1YA 3PZDA 5J2RA 4FHJA 2IO2B 2M17A 2L05A 3CSFA 2LGDA 1A5RA 3RD2A 1EUVB 1EO6A 1YJ1A 2LRUA 2BWFA 4KZ0A 5AZHA 2HE7A 3KUCB 4WJQA 2FAZA 1E8XA 3U8ZA 4DDGD 3KYCD 2CHXA 4GGQA 2GBKA 1V6EA 1WGYA 4XZ4A 2RSUA 3PSEB 4IUMB 3JYUA 2KMCA 4TUUA 2KHWB 3DBSA 3BINA 2L00B 1WXVA 3B1LX 2LZ6A 2C9WB 1OEYA 2N1WA 3VHTC 1XQQA 4ANWA 4MEMA 3L17A 3IVFA 2Z0EB 4WWNA 1UH6A 5E6PA 1ZKHA 3VTWA 1ZGUB 2HTHA 1WMHB 1S1QB 3MHSD 2ZNVC 2NPTB 4W9JA 3UF8A 1GC6A 4TKNA 3ML9A 3U7DA 2FCQA 2C7NB 2KD0A 4FJYA 3QCAA 4G0NB 5IAAC 4B95A 4LDTB 2JVCA 4MJSA 1YX5B 2IYDB 4W9FA 4EFOA 4NJ6A 5TR5A 4LCDE 4GU2A 4BOZB 1P1AA 3UQBA 2WX1A 5C23A 3VVWB 4ZRJA 3KUDB 3UIOB 4EOYA 3DOWA 2MBOA 4MM3A 2FCMA 3VQIA 2ZCBA 1RRBA 1OQYA 4DBGA 2O6VA 2B3AA 2Y5BB 2ZEQA 5C1ZA 4IWPA 4FLHA 4HXDA 2N9PC 3ZLZA 2IO1B 3DBRI 3DVGX 2KO3A 3ZTCA 5KHQA 2KJHB 4LJPB 3MTNB 4WJPA 3RT3B 1Q5WB 3R66C 2BYVE 4K1RB 1WGHA 4PS7A 4IM3A 4M0WB 4DHZB 1WXAA 2RGFA 4MH0E 2LRWA 4OVVA 3V6EB 2R2QA 4CYEA 4RMAA 4HJKA 2RPQA 2AWTA 2UYZB 2Z59B 3QHTA 3T9LA 1QZEA 2JZZA 1E7VA 3PTFC 4B6WA 2KTRA 2LXAA 3ZUNA 4IC7B 4NJ7A 4EEWA 3M62B 1XT9B 3D32A 2JPHA 2A5UA 2OOBB 2WYQA 3SDLC 2JRIB 1WH3A 2VRRB 2M4NA 3GOEA 3QC8B 3DVNV 1LQBA 1WJUA 4PYUA 1JRUA 2KQSA 4AOFA 1WJ4A 4ANVA 4DDID 3R7RA 1FXTB 4TV3A 3WALA 4MSQB 3A9JA 1UD7A 3ZTDA 5CX3A 2GMIC 1WI0A 4BBNC 3CF6E 3A4SC 2MP2B 3P2BA 4GXBA 2KN5A 2LASA 1P98A 1P9DU 3C0RB 1HE8A 1WZ0A 4PS3A 4RM8A 2MCNB 2NBUA 2BWES 2LUEA 2LJ5A 2CS4A 2NBVB 2YVCA 4K7UA 3PGEA 3WAOA 2WDTB 2G4SA 1WE7A 3QQ8B 1H4RA 4FBJB 2IY1B 3PS6A 3HM3A 1KM7A 3QK0A 3R7QA 3SU8X 4IW0A 2DZJA 2J0MA 4W9EA 1WX7A 3A1QA 4KDLB 4FA6A 1E90A 4MGYE 3TL5A 2K6QA 5JH5C 4W9GA 2ZPYA 4BKGA 4NPNA 4KSKC 2MWSB 2DZMA 3LDZE 3L54A 4KIKA 5DPRA 2KWVB 4E74A 1V86A 2JF5A 4ZRIA 3U30A 2L3ZA 4K81A 2AL6A 2KLCA 3LJ3A 3NS8A 1VCBA 4HCPB 2KFKB 2KTFA 4GB9A 4AWJA 2BKRB 1MG8A 2LVOA 2KC1A 4HLEA 4DXAB 5GMVA 3VUXA 3A33B 4MGIE 3T8MA 3NY5A 2KKCA 3KYDD 2KANA 2N9EB 4BFRA 4I6LB 4DHJD 4MELA 5G2NA 3IHPC 1TBEA 3H9DA 2RR9A 4FJZA 4B9KA 4EKUA 4GDKA 5AEKB 2XBBC 3DQVA 3VH4B 4A20A 4TQ0A 4BOSC 4AUQC 4AJWA 1UBQA 4F7ZA 1E8WA 3OAWA 4HPMB 2LXCA 4BKSA 2D3GA 1RFAA 3EECA 4GSWA 2C5LC 4WQOB 1OTRB 2ZPNA 2ZNVB 4F1SA 1H8CA 2JY6A 2MBQA 3AI5A 3O65B 5JHAA 2D07B 2KFJA 3DCGA 4A3OA 4J6IA 3ZNHB 3QAQA 2NS5A 4MSMB 3RCZA 4EZLA 2LGYA 3IBEA 1RLFA 1M94A 4NY0A 2BYEA 3ZIMA 1LXDA 4ICUA 2AEHA 2O6VB 4W9HA 2OJRA 3H7SA 3N30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WZ3 A;  1IP9 A;  2CKH B;  2A4Z A;  2PEA A;  1GUA B;  3X0W A;  1WGR A;  2K25 A;  2V4L A;  4OVU A;  4AJY B;  4WWP A;  2MSE D;  3RUL A;  3VDZ A;  5CHW A;  2MBB B;  2YLM A;  2LGX A;  3QJZ A;  3V61 A;  3MJW A;  4NQK E;  3PRP B;  4WJO A;  4XC2 A;  1V5O A;  1VD2 A;  1WFY A;  3QX1 A;  1TTN A;  2MLB A;  3R3M A;  5CHV C;  2ZVN A;  1Q1O A;  3SHQ A;  3PPA A;  5E6O A;  1WIA A;  3UIN B;  2CR5 A;  1TZ1 A;  3JW0 X;  2KTR B;  1X1M A;  3DDC B;  4GOC A;  3IFW B;  5D2M B;  3PV1 A;  2M0X A;  3ZNI D;  4JLC A;  3W1Y A;  4PS8 A;  5JZE B;  4XX5 A;  2K8H A;  2KX3 A;  2C7H A;  2Z0D B;  2L7R A;  3WAM A;  4LDT D;  2ZZP B;  3PLV A;  4RM9 A;  1V81 A;  4IM2 A;  2RD0 A;  4IG7 B;  3WIM A;  3A9J B;  2JT4 B;  2K1F A;  4GIV A;  5BO4 B;  3ZDT A;  1EF1 A;  2L76 A;  2FID A;  3HHM A;  3ZRF A;  1C3T A;  3M63 B;  2KJR A;  2DEN B;  2LD9 A;  3JSV A;  2J0K A;  1K8R B;  2MA9 B;  4IM0 A;  4WJN A;  4ZDV A;  5JHB A;  2LVP A;  1WM3 A;  2D2Q A;  3ONS A;  1OGW A;  3V60 A;  3UIP B;  3A9K A;  3AUL A;  2DYB A;  4W9I A;  2IO3 B;  2KDI A;  3PT2 B;  1Q0W B;  1P3Q U;  5IA7 A;  4K7W A;  2M8S A;  4BKT A;  2KWC A;  3KW5 B;  5DPS A;  2IZV B;  1V80 A;  3BY4 B;  4GN1 A;  3N32 A;  3NHE B;  4F8C B;  3EC8 A;  3QWZ B;  3PVL A;  3AXC A;  3WAP A;  3PRE A;  1NDD A;  4GMV A;  1CMX B;  5E6N A;  3UGB B;  3CMM B;  1SIF A;  2MX2 A;  1YD8 U;  2O2V A;  1ZW7 A;  1UBI A;  2PE6 B;  3HIZ A;  3VUY A;  4EZK A;  1UEL A;  4YL8 A;  5D94 A;  2CHZ A;  4NAW A;  3KVF B;  1V49 A;  3PHX B;  3SD5 A;  5LXI B;  2KZR A;  4E71 A;  1SE9 A;  1KLV A;  3ML8 A;  1WRD B;  3OJ4 B;  2G45 B;  1GJZ A;  2KDF B;  2V3S A;  4JGH B;  5HKH A;  2BYF A;  3WA0 A;  4HWI B;  3ZNZ B;  4ANX A;  3QA8 A;  4HPL B;  2IBI B;  2MQJ A;  3B0A A;  1UGM A;  1BT0 A;  2JUO A;  2KX0 A;  2ZVO A;  1OEY J;  2AL3 A;  4ZRK A;  4ANU A;  3ENE A;  2KOX A;  2REX A;  1WJ6 A;  2XEW A;  2DHZ A;  2CHW A;  3H6N A;  4ICV A;  3TCA A;  3VTV A;  2DAJ A;  3KH0 A;  4ZYN A;  3ZW3 A;  2W9N A;  1LM8 B;  2EMT A;  2BPS A;  3H7P A;  4I6P A;  3APC A;  3L10 B;  3L16 A;  5LXH A;  2KDB A;  2DZI A;  3L13 A;  1WYW B;  5EDS A;  2BF8 B;  2KVR A;  3NZS A;  4JQW C;  3RUI B;  1NBF C;  2GBJ A;  1PQS A;  1V9J A;  1Z2M A;  2KMA A;  2MP2 A;  3IG3 A;  4M8N A;  2DAF A;  5G55 A;  4W9C A;  3RYT A;  3DPD A;  1XD3 B;  4EUT A;  2MW5 A;  4BVU C;  1G6J A;  4HDQ A;  2GOW A;  2EMS A;  3N3K B;  5CHF A;  1ISN A;  4GDL A;  1NI2 A;  3TBL D;  2WX0 A;  2D10 A;  3QAR A;  3M3J A;  3S2A A;  2CU1 A;  4NNJ B;  2EKE C;  4M8M A;  3VXW A;  1L7Y A;  4MJS B;  4LJO B;  3KUZ A;  3X23 A;  2IY0 B;  2LWP A;  5D6J B;  3HK0 A;  3NOB A;  2N1V A;  3HM6 X;  3VAW A;  2ZCC A;  4P7I A;  4DWF A;  2J0J A;  1E8Z A;  3VTU A;  4FUL A;  1KOT A;  2XK5 A;  2FNJ B;  1J19 A;  2GBN A;  2DYO A;  2KXJ A;  4KV2 A;  2KFK A;  2KK8 A;  2LI5 A;  2L0F A;  3OJ3 A;  3Q3J A;  1C1Y B;  4CO7 A;  4PYZ A;  2UWQ A;  1Z5S B;  3DBL I;  2L0T A;  2NR2 A;  2DX5 B;  1IPG A;  4BBN F;  1WM2 A;  2AYO B;  3DVN U;  2JRH A;  4KVG B;  2JWZ A;  5DPW A;  1WXM A;  3NZU A;  3I3T B;  5CTR C;  1UZX B;  1GG3 A;  1WR1 A;  1WE6 A;  2FCN A;  2C60 A;  4N9F 4;  1TGZ B;  4WAA A;  2KNB A;  2PJH A;  3RZF A;  3K9O B;  3JSV B;  1V5T A;  1WF9 A;  5KHO A;  1YIW A;  1R4N I;  1WGD A;  2K8B A;  2O6V D;  4DHZ E;  3DBH I;  5L83 A;  2BGF A;  2WWZ A;  1J8C A;  1AAR A;  5FR6 A;  3A9K B;  5LLI A;  2KJ6 A;  3CST A;  3EHV A;  3TIX A;  5DPT A;  4URK A;  1WX8 A;  1R4M I;  4A3P A;  1GNU A;  4CHK A;  1WMH A;  1EF5 A;  2NPT A;  1WR6 E;  2IO0 B;  3VH3 B;  3ALB A;  2MBE A;  4HVB A;  2O2V B;  2HD5 B;  1IYF A;  3APF A;  2NCN A;  1Y8R C;  2M1M A;  4MDK E;  3AU4 A;  2FIF A;  4NAW B;  2QHO A;  4MGK E;  1WJN A;  2I1K A;  4G3X B;  4E3C A;  4K7S A;  3A1Q B;  1S3S G;  2LVQ A;  2NBW B;  3H1U A;  4KSL C;  2N4F A;  4NQL B;  2K8C A;  3ZNG C;  2MBH A;  4HK2 A;  3ZRC A;  4G50 A;  5AZF A;  2ZJD A;  1GC7 A;  3L0W B;  5AZG A;  4ASW C;  4WWO A;  1I42 A;  4KIK B;  2N7E A;  3APD A;  2KWU B;  5DCN A;  2C7M B;  2KLG A;  4FN2 A;  3V6C B;  3B08 A;  4JIO U;  3M95 A;  3PRM B;  2BKF A;  4HDO A;  3ZDM C;  1D3Z A;  3H7P B;  4W9L A;  2PE9 A;  3V62 A;  5J17 A;  4DK5 A;  2GBM A;  3VUW A;  2FUH B;  1E8Y A;  1U4A A;  2I1J A;  3PLU A;  2KQ7 A;  3JVZ X;  2L8J A;  3Q3F A;  4I6N B;  4W9K A;  5J18 A;  2DZK A;  1WX9 A;  2R2O A;  2JZ3 B;  4II3 B;  2DYM A;  3OLM D;  2PPH A;  1YX6 B;  1YQB A;  1V2Y A;  2N9X A;  1WY8 A;  4GDK B;  4MGZ E;  2GBR A;  1WGG A;  4X57 B;  3ZKJ C;  4FAD A;  4GDL B;  4KZC A;  4HCN B;  1T0Y A;  2D11 A;  2K6D B;  1F9J A;  2KDE B;  4II2 B;  4W9D A;  1KJT A;  4DHJ B;  4FJV B;  3TMP B;  3ZVV A;  2NVU I;  1RAX A;  1E5W A;  3EFU A;  4IWO A;  3PRZ A;  3DVG Y;  4EZJ A;  1L2N A;  3RZW C;  2G4D B;  5L95 C;  3A4R A;  3QIJ A;  5D7G A;  3ECI A;  1WXS A;  2XK5 B;  4TQ1 A;  2N7D A;  3GZN I;  2J7Q B;  2KC2 A;  4KDI C;  3AU5 A;  1I35 A;  3ZO5 B;  2G3Q B;  2FCS A;  1SGH A;  3UQA A;  3VFK A;  3WAN A;  4JL9 A;  2HJ8 A;  1E7U A;  3L08 A;  4G11 A;  4AP4 C;  4IWQ A;  3W1S C;  1P0R A;  3K9P B;  3PHW B;  1LFD A;  4BKS D;  4FHK A;  3TJP A;  1J0G A;  2JXX A;  2MRP A;  3W1S A;  2K39 A;  2ASQ A;  2V1Y A;  3PZD A;  5J2R A;  4FHJ A;  2IO2 B;  2M17 A;  2L05 A;  3CSF A;  2LGD A;  1A5R A;  3RD2 A;  1EUV B;  1EO6 A;  1YJ1 A;  2LRU A;  2BWF A;  4KZ0 A;  5AZH A;  2HE7 A;  3KUC B;  4WJQ A;  2FAZ A;  1E8X A;  3U8Z A;  4DDG D;  3KYC D;  2CHX A;  4GGQ A;  2GBK A;  1V6E A;  1WGY A;  4XZ4 A;  2RSU A;  3PSE B;  4IUM B;  3JYU A;  2KMC A;  4TUU A;  2KHW B;  3DBS A;  3BIN A;  2L00 B;  1WXV A;  3B1L X;  2LZ6 A;  2C9W B;  1OEY A;  2N1W A;  3VHT C;  1XQQ A;  4ANW A;  4MEM A;  3L17 A;  3IVF A;  2Z0E B;  4WWN A;  1UH6 A;  5E6P A;  1ZKH A;  3VTW A;  1ZGU B;  2HTH A;  1WMH B;  1S1Q B;  3MHS D;  2ZNV C;  2NPT B;  4W9J A;  3UF8 A;  1GC6 A;  4TKN A;  3ML9 A;  3U7D A;  2FCQ A;  2C7N B;  2KD0 A;  4FJY A;  3QCA A;  4G0N B;  5IAA C;  4B95 A;  4LDT B;  2JVC A;  4MJS A;  1YX5 B;  2IYD B;  4W9F A;  4EFO A;  4NJ6 A;  5TR5 A;  4LCD E;  4GU2 A;  4BOZ B;  1P1A A;  3UQB A;  2WX1 A;  5C23 A;  3VVW B;  4ZRJ A;  3KUD B;  3UIO B;  4EOY A;  3DOW A;  2MBO A;  4MM3 A;  2FCM A;  3VQI A;  2ZCB A;  1RRB A;  1OQY A;  4DBG A;  2O6V A;  2B3A A;  2Y5B B;  2ZEQ A;  5C1Z A;  4IWP A;  4FLH A;  4HXD A;  2N9P C;  3ZLZ A;  2IO1 B;  3DBR I;  3DVG X;  2KO3 A;  3ZTC A;  5KHQ A;  2KJH B;  4LJP B;  3MTN B;  4WJP A;  3RT3 B;  1Q5W B;  3R66 C;  2BYV E;  4K1R B;  1WGH A;  4PS7 A;  4IM3 A;  4M0W B;  4DHZ B;  1WXA A;  2RGF A;  4MH0 E;  2LRW A;  4OVV A;  3V6E B;  2R2Q A;  4CYE A;  4RMA A;  4HJK A;  2RPQ A;  2AWT A;  2UYZ B;  2Z59 B;  3QHT A;  3T9L A;  1QZE A;  2JZZ A;  1E7V A;  3PTF C;  4B6W A;  2KTR A;  2LXA A;  3ZUN A;  4IC7 B;  4NJ7 A;  4EEW A;  3M62 B;  1XT9 B;  3D32 A;  2JPH A;  2A5U A;  2OOB B;  2WYQ A;  3SDL C;  2JRI B;  1WH3 A;  2VRR B;  2M4N A;  3GOE A;  3QC8 B;  3DVN V;  1LQB A;  1WJU A;  4PYU A;  1JRU A;  2KQS A;  4AOF A;  1WJ4 A;  4ANV A;  4DDI D;  3R7R A;  1FXT B;  4TV3 A;  3WAL A;  4MSQ B;  3A9J A;  1UD7 A;  3ZTD A;  5CX3 A;  2GMI C;  1WI0 A;  4BBN C;  3CF6 E;  3A4S C;  2MP2 B;  3P2B A;  4GXB A;  2KN5 A;  2LAS A;  1P98 A;  1P9D U;  3C0R B;  1HE8 A;  1WZ0 A;  4PS3 A;  4RM8 A;  2MCN B;  2NBU A;  2BWE S;  2LUE A;  2LJ5 A;  2CS4 A;  2NBV B;  2YVC A;  4K7U A;  3PGE A;  3WAO A;  2WDT B;  2G4S A;  1WE7 A;  3QQ8 B;  1H4R A;  4FBJ B;  2IY1 B;  3PS6 A;  3HM3 A;  1KM7 A;  3QK0 A;  3R7Q A;  3SU8 X;  4IW0 A;  2DZJ A;  2J0M A;  4W9E A;  1WX7 A;  3A1Q A;  4KDL B;  4FA6 A;  1E90 A;  4MGY E;  3TL5 A;  2K6Q A;  5JH5 C;  4W9G A;  2ZPY A;  4BKG A;  4NPN A;  4KSK C;  2MWS B;  2DZM A;  3LDZ E;  3L54 A;  4KIK A;  5DPR A;  2KWV B;  4E74 A;  1V86 A;  2JF5 A;  4ZRI A;  3U30 A;  2L3Z A;  4K81 A;  2AL6 A;  2KLC A;  3LJ3 A;  3NS8 A;  1VCB A;  4HCP B;  2KFK B;  2KTF A;  4GB9 A;  4AWJ A;  2BKR B;  1MG8 A;  2LVO A;  2KC1 A;  4HLE A;  4DXA B;  5GMV A;  3VUX A;  3A33 B;  4MGI E;  3T8M A;  3NY5 A;  2KKC A;  3KYD D;  2KAN A;  2N9E B;  4BFR A;  4I6L B;  4DHJ D;  4MEL A;  5G2N A;  3IHP C;  1TBE A;  3H9D A;  2RR9 A;  4FJZ A;  4B9K A;  4EKU A;  4GDK A;  5AEK B;  2XBB C;  3DQV A;  3VH4 B;  4A20 A;  4TQ0 A;  4BOS C;  4AUQ C;  4AJW A;  1UBQ A;  4F7Z A;  1E8W A;  3OAW A;  4HPM B;  2LXC A;  4BKS A;  2D3G A;  1RFA A;  3EEC A;  4GSW A;  2C5L C;  4WQO B;  1OTR B;  2ZPN A;  2ZNV B;  4F1S A;  1H8C A;  2JY6 A;  2MBQ A;  3AI5 A;  3O65 B;  5JHA A;  2D07 B;  2KFJ A;  3DCG A;  4A3O A;  4J6I A;  3ZNH B;  3QAQ A;  2NS5 A;  4MSM B;  3RCZ A;  4EZL A;  2LGY A;  3IBE A;  1RLF A;  1M94 A;  4NY0 A;  2BYE A;  3ZIM A;  1LXD A;  4ICU A;  2AEH A;  2O6V B;  4W9H A;  2OJR A;  3H7S A;  3N30 A; 
#chains in the Genus database with same CATH topology
 2PEA A;  4AJY B;  3FIL B;  1M4V A;  4JWS C;  2LGX A;  4CQN A;  3MJW A;  2QSD A;  2MLB A;  2AQ3 B;  3BYT B;  2GI9 A;  3SHQ A;  3PPA A;  5E6O A;  3IFW B;  2K5P A;  3PV1 A;  4KGS A;  2UU7 A;  1PGX A;  1YOV B;  1E9M A;  1JRO A;  3WAM A;  4LDT D;  2MH7 A;  1Q10 A;  1V81 A;  4GIV A;  1C9F A;  3ZRF A;  2FID A;  2N9K A;  2KJR A;  5JHB A;  4WJN A;  2LVP A;  1T0S C;  2D2Q A;  2DLB A;  1ACC A;  3AUL A;  1F0Z A;  3PT2 B;  4K7W A;  2NTS A;  3HUI A;  4BKT A;  3KW5 B;  3P4Q B;  1V80 A;  1D6E C;  4UDU C;  3QWZ B;  3WAP A;  1NDD A;  1CMX B;  1SIF A;  4RGN A;  2O2V A;  3ZJU A;  1UBI A;  2PE6 B;  1B9R A;  5D94 A;  3SD5 A;  2VZK B;  2KZR A;  1KLV A;  3ML8 A;  1WRD B;  2PMV A;  4A6Q A;  2GRI A;  3B0A A;  1BT0 A;  1DGJ A;  3N1Z C;  1HQR D;  3KQ4 A;  4ANU A;  1T6B X;  2KOX A;  2REX A;  1WJ6 A;  3H6N A;  2CHW A;  4C56 C;  3RPF C;  2LJI A;  2W9N A;  1LM8 B;  2BPS A;  3NVY A;  5LXH A;  2DZI A;  3L13 A;  1WYW B;  2BF8 B;  4JQW C;  4NJC A;  3RUI B;  3IG3 A;  3DPD A;  1XD3 B;  1G6J A;  4HDQ A;  2GOW A;  2EMS A;  3N1Y C;  2PVG C;  1NI2 A;  3AE6 B;  1TY2 A;  1JCK B;  5H92 C;  4TSS A;  2CU1 A;  2BB6 A;  2EEL A;  1HA5 A;  4MJS B;  4LJO B;  2XNA C;  3P63 A;  4US9 A;  2LWP A;  3HM6 X;  4DWF A;  2J0J A;  2WNM A;  1E8Z A;  2ZW1 A;  1T0Q C;  2LMC A;  1WYG A;  3Q8F A;  2KFK A;  2KK8 A;  3OJ3 A;  1VZ8 A;  1STE A;  2UWQ A;  1TY0 A;  3SR6 A;  4RF1 A;  2AYO B;  2JRH A;  3NZU A;  3WCQ A;  4C00 A;  2PJH A;  3K9O B;  1V5T A;  2BQQ A;  3NVZ A;  4BAX A;  1WGD A;  2K8B A;  4ITK A;  3DBH I;  2BGF A;  1AAR A;  5MPO A;  1EWC A;  5FR6 A;  3A9K B;  2RDG A;  2KJ6 A;  5DPT A;  1WX8 A;  4RF0 A;  4A3P A;  4CHK A;  1GNU A;  3AEA B;  3SFE B;  1L6U A;  3ALB A;  2MBE A;  3Q6B A;  3E56 A;  1IYF A;  4IKG A;  2NCN A;  1Y8R C;  2KVZ A;  2RDB C;  2FIF A;  3AU4 A;  2I1K A;  1N6Z A;  1L4D B;  3MC8 A;  2JU6 X;  2NBW B;  5E6J A;  2ZJD A;  1GC7 A;  3L0W B;  5AZG A;  4WWO A;  1I42 A;  1WWT A;  2N7E A;  2CJN A;  2KWU B;  3APD A;  3V3X A;  4DQO C;  3DHI C;  3NZ3 A;  4HDO A;  3ZDM C;  2BS3 B;  3H7P B;  1D3Z A;  2FUH B;  1D5M C;  1NYR A;  1U4A A;  3JVZ X;  2L8J A;  4D2K A;  4I6N B;  1ESF A;  4II3 B;  2JZ3 B;  2WXH A;  1SF0 A;  3OLM D;  2PPH A;  1YX6 B;  4HKZ E;  3AE7 B;  3C8Y A;  1T0Y A;  1L6V A;  2D11 A;  2K6D B;  4II2 B;  4TMA B;  3TMP B;  2FE8 A;  1E5W A;  1RAX A;  4IWO A;  1L2N A;  3RZW C;  3A4R A;  5D7G A;  3VR9 B;  3MFG A;  4XDD A;  2J7Q B;  3ZO5 B;  2G3Q B;  2M0A A;  4WUR A;  3UQA A;  3VFK A;  1RYJ A;  3FKY A;  2HJ8 A;  4IWQ A;  3W1S C;  2J42 A;  3PZ8 A;  3PHW B;  2E3T A;  4KKJ A;  4BKS D;  1J0G A;  2K39 A;  2V1Y A;  2IO2 B;  2M17 A;  2L05 A;  3CSF A;  1XLQ A;  1YJ1 A;  4O1N A;  4KZ0 A;  2WDR B;  4WJQ A;  1E8X A;  1L5P A;  4XZ4 A;  1HXY D;  2RSU A;  3PSE B;  4P1B C;  2K0P A;  3DBS A;  4ARC A;  2N1W A;  1XQQ A;  4ANW A;  3IVF A;  1ZKH A;  3MHS D;  1GC6 A;  3ML9 A;  4FJY A;  1QLB B;  1YX5 B;  2MEK A;  3UIO B;  2V3P A;  2WXI A;  4EOY A;  2ZCB A;  1KLG D;  4DBG A;  1I4Q A;  5JXV A;  3PO0 A;  5C3J B;  2IO1 B;  3DBR I;  3ZTC A;  2X8X X;  3MTN B;  2MJD A;  3RT3 B;  4XE0 A;  1HTO A;  5HI1 A;  3DWM A;  1FNW A;  4DHZ B;  1HZ5 A;  1WXA A;  3J9C A;  3V6E B;  4CYE A;  2RPQ A;  2Z59 B;  1QZE A;  1E7V A;  2KTR A;  4L1B A;  3HRD D;  4IC7 B;  1KTK A;  3GS2 A;  1J7C A;  2JPH A;  1F77 A;  2D3C A;  2JRI B;  1WH3 A;  3GOE A;  3KLS X;  3NJT A;  3QC8 B;  3DVN V;  4PYU A;  1JRU A;  2OJW A;  4ANV A;  2HJ1 A;  2I38 A;  4DDI D;  3P4S B;  4TV3 A;  1F1H A;  4M01 A;  4NAM A;  3ZTD A;  2BB5 A;  3CF6 E;  2IGG A;  1K51 A;  4RM8 A;  2BWE S;  2I2Y A;  3PGE A;  3WAO A;  1WE7 A;  2HTM E;  3QK0 A;  2DZJ A;  4ZRQ A;  2J0M A;  5HFY A;  1WX7 A;  4KDL B;  4FA6 A;  4YTN B;  3TL5 A;  1FPY A;  4ZHP A;  4NPN A;  4KSK C;  1TS5 A;  5DPR A;  2GB1 A;  1YMH E;  4E74 A;  3U30 A;  4HCP B;  1VCB A;  4GB9 A;  1MG8 A;  2KC1 A;  3E9S A;  2GLS A;  3VUX A;  4MGI E;  2M19 A;  2KKC A;  4DHJ D;  4I6L B;  3IHP C;  2Y5P A;  4YSX B;  1GOZ A;  1EWY C;  4FJZ A;  4B9K A;  1I4H A;  2XBB C;  3VH4 B;  4A20 A;  1K52 A;  1FFU A;  4BOS C;  4AJW A;  1E8W A;  4BKS A;  4GLS C;  1XXG A;  2ZPN A;  1NI3 A;  5JHA A;  2D07 B;  4HJG E;  2WU5 B;  1ZDX A;  2QDF A;  1VLB A;  3RCZ A;  4HRO A;  2LGY A;  1M94 A;  3PZ7 A;  4ICU A;  1K53 A;  4YTP B;  1FEH A;  1ZPS A;  1WZ3 A;  2CKH B;  1I7H A;  2MSE D;  2MBB B;  2YLM A;  4QAY A;  1RM6 C;  2L52 A;  3GE3 C;  1ZUD 2;  1V5O A;  3GB1 A;  2KAC A;  1TTN A;  3QX1 A;  4RFB A;  5CHV C;  3ZXV A;  1FXI A;  3DHG C;  4RGT A;  4IDI A;  1TZ1 A;  3SEB A;  4EE2 A;  3NVV A;  5D2M B;  3ZNI D;  3AN1 A;  4JLC A;  3W1Y A;  2BT6 A;  3RN9 C;  2K8H A;  4XDC A;  2KX3 A;  2C7H A;  2ACZ B;  5I4D A;  2ZZP B;  1L0V B;  3RI7 C;  3PLV A;  4RM9 A;  1LGR A;  2JYE A;  2RDH A;  2RD0 A;  4IG7 B;  4KGR A;  3A9J B;  4C80 A;  3R8B A;  2L76 A;  3HHM A;  3DBH B;  3JSV A;  2J0K A;  2MA9 B;  4IM0 A;  3U4E G;  4ZDV A;  1R7S A;  1WM3 A;  4MAC A;  3ONS A;  3UIP B;  2IDY A;  2KDI A;  1Q0W B;  2R61 A;  5IA7 A;  2M8S A;  4OW0 A;  2KWC A;  3T3N A;  5DPS A;  2IZV B;  3BY4 B;  3NHE B;  2JX5 A;  3PVL A;  3PRE A;  3Q8E A;  4JX1 C;  4GMV A;  2MX2 A;  5TSS A;  1SJE D;  4YL8 A;  2CHZ A;  2WXO A;  1V49 A;  2Q5W D;  1GAQ B;  2KDM A;  1SBB B;  4E71 A;  1SE9 A;  5HKH A;  2BYF A;  3WA0 A;  2YEP F;  4HWI B;  3ZNZ B;  4ANX A;  1OQQ A;  1ET6 A;  2MQJ A;  1UGM A;  3Q14 C;  1IBX B;  3ENE A;  2W54 A;  1V1P B;  1PDX A;  2DAJ A;  3KH0 A;  2EKI A;  4B0M A;  2EMT A;  2Y3A A;  3ZJT A;  1V97 A;  3NZS A;  1NBF C;  5FR3 A;  1PQS A;  2MP2 A;  5G55 A;  2DAF A;  4W9C A;  3RYT A;  3LXF A;  1SB3 C;  4DXF A;  4EUT A;  2MW5 A;  3N3K B;  4K3C A;  1ISN A;  4NNJ B;  3AV8 A;  4M8M A;  1L7Y A;  2W3S A;  3X23 A;  1Y56 A;  4XYC A;  1XCQ L;  4FUL A;  1KOT A;  1J19 A;  2KXJ A;  4KV2 A;  2MJE A;  2LI5 A;  1C1Y B;  4BBN F;  3DVN U;  3AE5 B;  1WXM A;  3I3T B;  5AUI A;  1WE6 A;  2JWU A;  2FUG 1;  1IUE A;  4N9F 4;  4ZYS A;  5BYQ A;  5BYR A;  1A70 A;  5KHO A;  1TKE A;  1R4N I;  2O6V D;  3NS1 A;  4DHZ E;  3Q69 A;  1J8C A;  3RNA C;  1OQR A;  2JXT A;  3MC9 A;  1YN3 A;  3TIX A;  2INN E;  2V9H A;  1L4Z B;  4PT5 A;  1WMH A;  2IO0 B;  2V4I B;  2O2V B;  2HD5 B;  3APF A;  2J53 A;  1I4X A;  4G3X B;  1HZ6 A;  3H1U A;  2N4F A;  3DBR B;  2MBH A;  4RGM A;  4AQ7 A;  2J4X A;  4KIK B;  2IJ0 A;  3V6C B;  3B08 A;  2QEJ C;  3PRM B;  2N0S B;  4LK0 M;  2PIA A;  3VUW A;  2LFI A;  2ZW0 A;  1YQ3 B;  2I1J A;  2IGD A;  4W9K A;  2H88 B;  1WX9 A;  4C4V B;  1WY8 A;  4GDK B;  2WXG A;  3AMZ A;  3FAH A;  2CJO A;  2KDE B;  5EE1 A;  3Q3M C;  1KJT A;  1WRI A;  5EE0 A;  3ZVV A;  1SEB D;  2INP E;  4EZJ A;  5EE3 A;  2G4D B;  1ROE A;  4S0R A;  2KC2 A;  2D5G A;  1JML A;  3AE4 B;  5T8I A;  4JL9 A;  2JQR B;  3LB8 C;  5BMH A;  3AB5 A;  5J2R A;  2ASQ A;  3PZD A;  2IPK D;  1EUV B;  2BWF A;  1C4C A;  2QJL A;  2HE7 A;  3TEZ A;  2RMM A;  2CHX A;  4GGQ A;  1WGY A;  4J3O D;  2SAK A;  3TSS A;  1ENF A;  3JYU A;  2KMC A;  3B1L X;  2C9W B;  2L1A A;  3VHT C;  2PTL A;  4MEM A;  4WWM A;  2Z0E B;  1MVK A;  1UH6 A;  3NUH B;  3AE1 B;  2ZNV C;  4A55 A;  4OVZ A;  1TKG A;  3U7D A;  4XWT A;  5IAA C;  3KWL A;  4B95 A;  1L0X B;  4LDT B;  4MJS A;  1GB4 A;  2IYD B;  1E6E B;  4BOZ B;  4C7Y A;  4A8X C;  3UQB A;  2WX1 A;  2MBO A;  4N59 A;  4MM3 A;  2JSV X;  2O6V A;  1FNU A;  2B3A A;  2ZEQ A;  4KX6 B;  4FLH A;  1WGK A;  4HXD A;  2N9P C;  3ZLZ A;  3AEB B;  1JW9 D;  5D3I B;  1DOY A;  4K1R B;  4PS7 A;  3B2G A;  2AX5 A;  2RGF A;  2KWD A;  4OVV A;  4ARI A;  4HJK A;  2E6X A;  1SXT A;  2AWT A;  2KQ4 X;  3MJ5 A;  3QHT A;  3T9L A;  2JZZ A;  1OFF A;  3IT6 B;  3PTF C;  3AE8 B;  2LXA A;  2QC8 A;  4NJ7 A;  3M62 B;  3D32 A;  2OOB B;  1UNS A;  5G5G A;  1ZE3 D;  2VRR B;  2M4N A;  3BYY B;  1JAL A;  3BZD B;  2LUM A;  1FXT B;  3R7R A;  1TYG B;  1VDV A;  3TEX A;  3A4S C;  4GXB A;  2G9H D;  2LAS A;  1E0Z A;  4US8 A;  3R2I A;  1UWM A;  4NZL B;  2CS4 A;  4OZA A;  4K7U A;  4FBJ B;  1H4R A;  2IY1 B;  3R7Q A;  1KM7 A;  2K9X A;  1P7F A;  1K50 A;  3ZYY X;  2BYT A;  3UI3 A;  2XN9 C;  2DZM A;  3RNG C;  4FXC A;  1V86 A;  2JF5 A;  2L3Z A;  2KTF A;  4HKQ A;  4DXA B;  2PW9 A;  3NY5 A;  3U2S C;  2N9E B;  2PKO A;  5G2N A;  1TBE A;  3H9D A;  1VRA B;  4EKU A;  1B1Z A;  5AEK B;  1VZ6 A;  1C76 A;  1UBQ A;  1TJE A;  1GPX A;  3EEC A;  4F1S A;  2ZNV B;  3I57 A;  2JY6 A;  2MBQ A;  3AI5 A;  3AM9 A;  4YXD B;  3URY A;  2SEB D;  3NG0 A;  4J6I A;  5G5H A;  3QAQ A;  3HVZ A;  3TUO A;  3IBE A;  5IP4 D;  1FCL A;  4REZ A;  2BYE A;  4P16 A;  1PFD A;  3H7S A;  3HVD A;  4OZB A;  1MHX A;  2A4Z A;  1GUA B;  1WGR A;  4OVU A;  3FC4 A;  3VDZ A;  1TT5 B;  5CHW A;  3V61 A;  3B2F A;  4NQK E;  4WJO A;  4XC2 A;  2K22 A;  1N62 A;  3R3M A;  2ZVN A;  1CJE A;  3Q2A C;  1WIA A;  3JW0 X;  2KTR B;  4KGT A;  4B0E A;  1X1M A;  4LNI A;  2W3R A;  5JZE B;  4XX5 A;  2Z0D B;  2L7R A;  4LNN A;  2DNF A;  3WIM A;  5BO4 B;  2K1F A;  3ZDT A;  1R4N B;  1EF1 A;  2ICI A;  1C3T A;  3M63 B;  2DEN B;  1K8R B;  4BZA A;  1NYQ A;  3V60 A;  1OGW A;  1UGJ A;  4W9I A;  1P3Q U;  4GN1 A;  3N32 A;  1NVI D;  3IT4 B;  3EC8 A;  5AUK A;  5E6N A;  3UGB B;  1JWB D;  1D5Z C;  3CMM B;  1YD8 U;  3HIZ A;  3VUY A;  1UEL A;  2MJ3 A;  4NAW A;  3BVM A;  2KYW A;  4WIP A;  5LXI B;  1EM7 A;  3OJ4 B;  1GJZ A;  4JGH B;  2JZP A;  3QA8 A;  1N63 A;  4HPL B;  4HPP A;  1N5X A;  4Q2J A;  2JUO A;  2KX0 A;  4ZRK A;  1OEY J;  2AL3 A;  3TCA A;  1XEE A;  5D3D A;  5IKC M;  3L16 A;  3RFZ B;  5EDS A;  1FMA D;  2KVR A;  1CK1 A;  2GBJ A;  4M8N A;  1V9J A;  1Z2M A;  2KMA A;  3SFD B;  1FD6 A;  4LTU A;  5CHF A;  2WXJ A;  4GDL A;  1TIF A;  3TBL D;  2WX0 A;  1AN8 A;  3VXW A;  3KUZ A;  4AS1 A;  2QIE B;  3W2D A;  3HK0 A;  3NOB A;  3ZGZ A;  3VAW A;  1I4G A;  4P7I A;  3VTU A;  2XK5 A;  1HEZ E;  2FNJ B;  3Q3J A;  4PYZ A;  1UWX A;  1KLU D;  1Z5S B;  3DBL I;  2L0T A;  2DX5 B;  3AE9 B;  1WM2 A;  1FCC C;  5DPW A;  1N61 A;  1RFK A;  1UF0 A;  2D3B A;  2FCN A;  1VR9 A;  3RNF C;  1TGZ B;  1JWS D;  1PGB A;  3P4P B;  4WAA A;  2AQ1 B;  3JSV B;  1F52 A;  2V3N A;  1YIW A;  3I9V 1;  2WWZ A;  3RNB C;  4N58 A;  4ZOH C;  3CST A;  4P1C C;  3EHV A;  3GE8 C;  1R4M I;  1EF5 A;  2NPT A;  4L2Y A;  4HVB A;  2QHO A;  4MGK E;  1WJN A;  3EFC A;  4K7S A;  2PLP A;  3TEY A;  3A1Q B;  2NMQ A;  1S3S G;  2LVQ A;  5IO9 A;  2HDE A;  4NQL B;  3ZNG C;  4LLG M;  4HK2 A;  3ZRC A;  3ZXR A;  4RNA A;  4ASW C;  4ZRP A;  5DCN A;  2KLG A;  1ZOY B;  4KKI A;  4JIO U;  2LHD A;  2J52 A;  1AW7 A;  5BMI A;  2H89 B;  1FXA A;  3T3O A;  4M0W A;  2PE9 A;  4W9L A;  3V62 A;  5J17 A;  1E8Y A;  3PLU A;  2IGH A;  2R2O A;  2DYM A;  2N9X A;  1BXT A;  3U52 E;  1JWA D;  1WGG A;  2VH1 A;  4X57 B;  3ZKJ C;  4KZC A;  1CZP A;  1F9J A;  4MH8 A;  2RPV A;  4DHJ B;  1QIL A;  4FJV B;  2VZK D;  1MG4 A;  4LNF A;  2JYT A;  1ZDV A;  2NVU I;  2LEK A;  3EFU A;  3NRZ A;  3PRZ A;  3DVG Y;  4M02 A;  5EE9 A;  3AEG B;  3ECI A;  1C77 A;  2N7D A;  3GZN I;  4KDI C;  1I35 A;  2L83 A;  2IND C;  4LNK A;  2FCS A;  1EU4 A;  3WAN A;  3L08 A;  3MHZ A;  2G1E A;  1P0R A;  1P7E A;  2OHF A;  4FHK A;  1HTQ A;  2MRP A;  1IBX A;  3DHH C;  2LGD A;  1EO6 A;  3RNE C;  5AZH A;  3KUC B;  2FAZ A;  1RWS A;  1L0Y B;  4DDG D;  3KYC D;  1GB1 A;  1V6E A;  2KHW B;  3OWE B;  2L00 B;  2LZ6 A;  2Z8L A;  1QF6 A;  4WWN A;  1ZGU B;  2HTH A;  1WMH B;  1S1Q B;  4W9J A;  1PUT A;  4TKN A;  3BVZ A;  2C7N B;  2KD0 A;  3CIR B;  3QCA A;  4G0N B;  2PVO D;  1XO3 A;  1QOA A;  4WH4 A;  3VVW B;  3KUD B;  3AH7 A;  5H8Y E;  3VQI A;  3EA6 A;  1RRB A;  1OQY A;  2KAJ A;  3DWG C;  2LGI A;  1DOI A;  2Y5B B;  5C1Z A;  4IWP A;  3FIL A;  1I4P A;  2QMT A;  3R66 C;  2BYV E;  1WSP A;  4JWU C;  4HRS A;  2ON8 A;  1YNT E;  1I4R A;  4RMA A;  2M56 B;  3W9C B;  2WXP A;  2BVC A;  4B6W A;  3MP9 A;  2LGS A;  4EEW A;  3EUB 2;  1SE2 A;  1V8C A;  2A5U A;  2WYQ A;  3SDL C;  1LQB A;  2FBW B;  2KQS A;  4AOF A;  1WJ4 A;  3L4P A;  4MSQ B;  1UD7 A;  5CX3 A;  3ETR A;  2WXK A;  1JWU D;  2Y5C A;  1P98 A;  2MCN B;  3AE2 B;  4L23 A;  1TKY A;  4YT0 B;  2LUE A;  1SIJ A;  2YVC A;  2G4S A;  2WQY B;  3R2T A;  3ABV B;  3SU8 X;  1KRH A;  3EGR A;  4USA A;  2K6Q A;  1CQV A;  5JH5 C;  4W9G A;  2ZPY A;  3AEF B;  2MWS B;  1ZXI A;  3LDZ E;  3L54 A;  4KIK A;  4H2A A;  2DWQ A;  3VRA B;  4ZRI A;  4K81 A;  2AL6 A;  3NS8 A;  2KFK B;  1FO4 A;  2BKR B;  2BTE A;  1EU3 A;  1FRR A;  1TZO A;  3AEE B;  3T8M A;  3KWV A;  3KYD D;  2KAN A;  4BFR A;  4MEL A;  4C4V A;  2VH2 A;  4GDK A;  3DQV A;  3IXS A;  3IAS 1;  4HPM B;  2LXC A;  4ZHO A;  2D3G A;  4WQO B;  4GSW A;  2ONQ A;  4A3O A;  5C2T B;  2NS5 A;  4MSM B;  5LNK 1;  4EZL A;  4A9A A;  3AE3 B;  4MM3 B;  2AEH A;  1IGD A;  2O6V B;  2OJR A;  2K3U A;  1YJI A;  3N30 A;  4W9H A;  4DXG A;  1IP9 A;  3X0W A;  2K25 A;  2V4L A;  4WWP A;  3RUL A;  2QIL A;  3QJZ A;  2WXM A;  3PRP B;  4ACF A;  1VD2 A;  1WFY A;  1Q1O A;  4RGO S;  3UIN B;  3DBL B;  1MPE A;  2CR5 A;  2WDQ B;  3DDC B;  4YSZ B;  4GOC A;  2M0X A;  4PS8 A;  2BW2 A;  1V1O A;  2D3A A;  1SE4 A;  4PK1 A;  5HHD G;  4IM2 A;  2X38 A;  2JT4 B;  1KF6 B;  2LD9 A;  4M00 A;  3P4R B;  1YN5 A;  3A9K A;  1R4M B;  5IOI A;  2DYB A;  2IO3 B;  3C19 A;  5HG2 A;  1MFW A;  4F8C B;  3AXC A;  1AYF A;  1T0R C;  1QT9 A;  4XWW A;  1ZW7 A;  3N1X C;  5BMG A;  3V05 A;  4EZK A;  3KVF B;  1ZXH A;  2LHE A;  3PHX B;  2KN4 A;  2G45 B;  2KDF B;  2V3S A;  1SE3 A;  1YN4 A;  1MHH E;  2IBI B;  3BK2 A;  1XCT L;  2ZVO A;  4N6E B;  2XEW A;  4ICV A;  2DHZ A;  3VTV A;  4ZYN A;  3ZW3 A;  1WXQ A;  4YTM B;  2W82 A;  4I6P A;  3H7P A;  3APC A;  3L10 B;  2KDB A;  3BK1 A;  3Q3N C;  5FK9 C;  1JRP A;  3LYY A;  2BS4 B;  4BVU C;  3O13 A;  4MT5 A;  3I5J C;  1QOG A;  1KH0 A;  2D10 A;  3QAR A;  3M3J A;  3S2A A;  2EKE C;  2B76 B;  3RNC C;  2WXQ A;  2IY0 B;  3GZN B;  5D6J B;  2N1V A;  2ZCC A;  3B9J A;  3RMK C;  1F2R I;  1JQ4 A;  1XLN A;  1KFY B;  2WS3 B;  2GBN A;  2DYO A;  2L0F A;  4CO7 A;  2NR2 A;  4HEA 1;  1IPG A;  1YJJ A;  3BWU D;  4KVG B;  2JWZ A;  1N60 A;  5CTR C;  1UZX B;  1XLO A;  1GG3 A;  1WR1 A;  2KT7 A;  2C60 A;  3IAM 1;  2KNB A;  4YSY B;  3RZF A;  3NVW A;  1WF9 A;  2BBC A;  5L83 A;  5LLI A;  2W55 A;  3Q3O C;  4URK A;  4RH6 A;  2WXF A;  3P1M A;  1WR6 E;  3VH3 B;  3CWI A;  1FFV A;  3N20 C;  4OHJ A;  2M1M A;  1PYW D;  4MDK E;  2WU2 B;  4K3B A;  4NAW B;  3MC0 B;  1MI0 A;  4E3C A;  3U7Z A;  1UUP A;  1J7A A;  1ZP0 B;  1C4P A;  4KSL C;  2WHI A;  2K8C A;  4G50 A;  5AZF A;  4JPS A;  2WDV B;  4JE3 B;  1QKZ A;  2C7M B;  4FN2 A;  1SJH D;  3M95 A;  2BKF A;  3AEC B;  4YWG G;  4DK5 A;  2GBM A;  4R3D A;  2KQ7 A;  3Q3F A;  1D4B A;  5J18 A;  2DZK A;  1SSN A;  1LO5 D;  1FNV A;  2OED A;  1YQB A;  1V2Y A;  4MGZ E;  2GBR A;  5IN7 A;  4FAD A;  4GDL B;  4HCN B;  4W9D A;  3W5U B;  4WQM A;  2TSS A;  2INC C;  1IGC A;  2AQ2 B;  5L95 C;  3QIJ A;  1WXS A;  2XK5 B;  4TQ1 A;  3AU5 A;  3VRB B;  1SGH A;  1XLP A;  1E7U A;  4G11 A;  4AP4 C;  1C4A A;  3K9P B;  1LFD A;  1C78 A;  3TJP A;  1MJD A;  1J7B A;  2JXX A;  1BUI C;  3W1S A;  4FHJ A;  4LNO A;  1NEN B;  1A5R A;  3RD2 A;  2LRU A;  3BVG A;  2WP9 B;  3U8Z A;  2GBK A;  4IUM B;  1XF5 L;  4WAF A;  1DOX A;  4TUU A;  1PGA A;  1T3Q A;  3BIN A;  1WXV A;  4A90 A;  4P6V F;  2N7J A;  1OEY A;  3L17 A;  2KMM A;  2BS2 B;  1VJK A;  5E6P A;  3VTW A;  2CU3 A;  3Q8B A;  3ZJV A;  2NPT B;  3UF8 A;  2WGS A;  3VR8 B;  4OZC A;  3OG5 A;  2FCQ A;  2JVC A;  4W9F A;  4EFO A;  2QCZ A;  4NJ6 A;  5TR5 A;  4LCD E;  4GU2 A;  1FM0 D;  1P1A A;  5C23 A;  4ZRJ A;  3DOW A;  2FCM A;  4IOI E;  1F2R C;  3DVG X;  2KO3 A;  5KHQ A;  2KJH B;  4LJP B;  4WJP A;  1Q5W B;  1TS4 A;  1WGH A;  5FKA C;  1E10 A;  4IM3 A;  4M0W B;  2WXR A;  3GP7 A;  2NTT A;  1TS2 A;  4MH0 E;  2LRW A;  3TEW A;  2R2Q A;  2WXL A;  3Q8C A;  4S17 A;  2UYZ B;  3ZUN A;  1JWM D;  1XT9 B;  4XGA B;  1FIQ A;  1QOB A;  1WJU A;  3W5V B;  3WAL A;  3A9J A;  1AWD A;  2N9L A;  1FRD A;  4C7Z A;  2GMI C;  1WI0 A;  4BBN C;  3P2B A;  2MP2 B;  2KN5 A;  1P9D U;  3C0R B;  1HE8 A;  1WZ0 A;  1YQ4 B;  4PS3 A;  2NBU A;  2LJ5 A;  2NBV B;  2WDT B;  3QQ8 B;  3PS6 A;  1ET9 A;  3HM3 A;  4IW0 A;  4W9E A;  3A1Q A;  1E90 A;  4MGY E;  3Q8A A;  1D5X C;  4BKG A;  1DYQ A;  3N9Y C;  1VZ7 A;  2KWV B;  2KLC A;  3LJ3 A;  1BML C;  4AWJ A;  2DBY A;  2LVO A;  3H8H A;  5GMV A;  3A33 B;  2L32 A;  1QOF A;  5GXG B;  2WLB A;  1C79 A;  3AED B;  1TS3 A;  2MHJ A;  2RR9 A;  3ZQ4 A;  1V1P A;  4TQ0 A;  4F7Z A;  4AUQ C;  3OAW A;  3I63 C;  1QQR A;  1E7P B;  1T5X D;  4HLE A;  1RFA A;  2WXN A;  2C5L C;  2YEP B;  1OTR B;  1H8C A;  3O65 B;  2KFJ A;  3DCG A;  2V0G A;  4RCO A;  3ZNH B;  1N5W A;  3P42 A;  3BII D;  1RLF A;  4NY0 A;  3ZIM A;  1LXD A;  5BYS A;  1NEK B; 
#chains in the Genus database with same CATH homology
 1WZ3 A;  1IP9 A;  2CKH B;  2A4Z A;  2PEA A;  1GUA B;  3X0W A;  1WGR A;  2K25 A;  2V4L A;  4OVU A;  4AJY B;  4WWP A;  2MSE D;  3RUL A;  3VDZ A;  5CHW A;  2MBB B;  2YLM A;  2LGX A;  3QJZ A;  3V61 A;  3MJW A;  4NQK E;  3PRP B;  4WJO A;  4XC2 A;  1V5O A;  1VD2 A;  1WFY A;  3QX1 A;  1TTN A;  2MLB A;  3R3M A;  5CHV C;  2ZVN A;  1Q1O A;  3SHQ A;  3PPA A;  5E6O A;  1WIA A;  3UIN B;  2CR5 A;  1TZ1 A;  3JW0 X;  2KTR B;  1X1M A;  3DDC B;  4GOC A;  3IFW B;  5D2M B;  3PV1 A;  2M0X A;  3ZNI D;  4JLC A;  3W1Y A;  4PS8 A;  5JZE B;  4XX5 A;  2K8H A;  2KX3 A;  2C7H A;  2Z0D B;  2L7R A;  3WAM A;  4LDT D;  2ZZP B;  3PLV A;  4RM9 A;  1V81 A;  4IM2 A;  2RD0 A;  4IG7 B;  3WIM A;  3A9J B;  2JT4 B;  2K1F A;  4GIV A;  5BO4 B;  3ZDT A;  1EF1 A;  2L76 A;  2FID A;  3HHM A;  3ZRF A;  1C3T A;  3M63 B;  2KJR A;  2DEN B;  2LD9 A;  3JSV A;  2J0K A;  1K8R B;  2MA9 B;  4IM0 A;  4WJN A;  4ZDV A;  5JHB A;  2LVP A;  1WM3 A;  2D2Q A;  3ONS A;  1OGW A;  3V60 A;  3UIP B;  3A9K A;  3AUL A;  2DYB A;  4W9I A;  2IO3 B;  2KDI A;  3PT2 B;  1Q0W B;  1P3Q U;  5IA7 A;  4K7W A;  2M8S A;  4BKT A;  2KWC A;  3KW5 B;  5DPS A;  2IZV B;  1V80 A;  3BY4 B;  4GN1 A;  3N32 A;  3NHE B;  4F8C B;  3EC8 A;  3QWZ B;  3PVL A;  3AXC A;  3WAP A;  3PRE A;  1NDD A;  4GMV A;  1CMX B;  5E6N A;  3UGB B;  3CMM B;  1SIF A;  2MX2 A;  1YD8 U;  2O2V A;  1ZW7 A;  1UBI A;  2PE6 B;  3HIZ A;  3VUY A;  4EZK A;  1UEL A;  4YL8 A;  5D94 A;  2CHZ A;  4NAW A;  3KVF B;  1V49 A;  3PHX B;  3SD5 A;  5LXI B;  2KZR A;  4E71 A;  1SE9 A;  1KLV A;  3ML8 A;  1WRD B;  3OJ4 B;  2G45 B;  1GJZ A;  2KDF B;  2V3S A;  4JGH B;  5HKH A;  2BYF A;  3WA0 A;  4HWI B;  3ZNZ B;  4ANX A;  3QA8 A;  4HPL B;  2IBI B;  2MQJ A;  3B0A A;  1UGM A;  1BT0 A;  2JUO A;  2KX0 A;  2ZVO A;  1OEY J;  2AL3 A;  4ZRK A;  4ANU A;  3ENE A;  2KOX A;  2REX A;  1WJ6 A;  2XEW A;  2DHZ A;  2CHW A;  3H6N A;  4ICV A;  3TCA A;  3VTV A;  2DAJ A;  3KH0 A;  4ZYN A;  3ZW3 A;  2W9N A;  1LM8 B;  2EMT A;  2BPS A;  3H7P A;  4I6P A;  3APC A;  3L10 B;  3L16 A;  5LXH A;  2KDB A;  2DZI A;  3L13 A;  1WYW B;  5EDS A;  2BF8 B;  2KVR A;  3NZS A;  4JQW C;  3RUI B;  1NBF C;  2GBJ A;  1PQS A;  1V9J A;  1Z2M A;  2KMA A;  2MP2 A;  3IG3 A;  4M8N A;  2DAF A;  5G55 A;  4W9C A;  3RYT A;  3DPD A;  1XD3 B;  4EUT A;  2MW5 A;  4BVU C;  1G6J A;  4HDQ A;  2GOW A;  2EMS A;  3N3K B;  5CHF A;  1ISN A;  4GDL A;  1NI2 A;  3TBL D;  2WX0 A;  2D10 A;  3QAR A;  3M3J A;  3S2A A;  2CU1 A;  4NNJ B;  2EKE C;  4M8M A;  3VXW A;  1L7Y A;  4MJS B;  4LJO B;  3KUZ A;  3X23 A;  2IY0 B;  2LWP A;  5D6J B;  3HK0 A;  3NOB A;  2N1V A;  3HM6 X;  3VAW A;  2ZCC A;  4P7I A;  4DWF A;  2J0J A;  1E8Z A;  3VTU A;  4FUL A;  1KOT A;  2XK5 A;  2FNJ B;  1J19 A;  2GBN A;  2DYO A;  2KXJ A;  4KV2 A;  2KFK A;  2KK8 A;  2LI5 A;  2L0F A;  3OJ3 A;  3Q3J A;  1C1Y B;  4CO7 A;  4PYZ A;  2UWQ A;  1Z5S B;  3DBL I;  2L0T A;  2NR2 A;  2DX5 B;  1IPG A;  4BBN F;  1WM2 A;  2AYO B;  3DVN U;  2JRH A;  4KVG B;  2JWZ A;  5DPW A;  1WXM A;  3NZU A;  3I3T B;  5CTR C;  1UZX B;  1GG3 A;  1WR1 A;  1WE6 A;  2FCN A;  2C60 A;  4N9F 4;  1TGZ B;  4WAA A;  2KNB A;  2PJH A;  3RZF A;  3K9O B;  3JSV B;  1V5T A;  1WF9 A;  5KHO A;  1YIW A;  1R4N I;  1WGD A;  2K8B A;  2O6V D;  4DHZ E;  3DBH I;  5L83 A;  2BGF A;  2WWZ A;  1J8C A;  1AAR A;  5FR6 A;  3A9K B;  5LLI A;  2KJ6 A;  3CST A;  3EHV A;  3TIX A;  5DPT A;  4URK A;  1WX8 A;  1R4M I;  4A3P A;  1GNU A;  4CHK A;  1WMH A;  1EF5 A;  2NPT A;  1WR6 E;  2IO0 B;  3VH3 B;  3ALB A;  2MBE A;  4HVB A;  2O2V B;  2HD5 B;  1IYF A;  3APF A;  2NCN A;  1Y8R C;  2M1M A;  4MDK E;  3AU4 A;  2FIF A;  4NAW B;  2QHO A;  4MGK E;  1WJN A;  2I1K A;  4G3X B;  4E3C A;  4K7S A;  3A1Q B;  1S3S G;  2LVQ A;  2NBW B;  3H1U A;  4KSL C;  2N4F A;  4NQL B;  2K8C A;  3ZNG C;  2MBH A;  4HK2 A;  3ZRC A;  4G50 A;  5AZF A;  2ZJD A;  1GC7 A;  3L0W B;  5AZG A;  4ASW C;  4WWO A;  1I42 A;  4KIK B;  2N7E A;  3APD A;  2KWU B;  5DCN A;  2C7M B;  2KLG A;  4FN2 A;  3V6C B;  3B08 A;  4JIO U;  3M95 A;  3PRM B;  2BKF A;  4HDO A;  3ZDM C;  1D3Z A;  3H7P B;  4W9L A;  2PE9 A;  3V62 A;  5J17 A;  4DK5 A;  2GBM A;  3VUW A;  2FUH B;  1E8Y A;  1U4A A;  2I1J A;  3PLU A;  2KQ7 A;  3JVZ X;  2L8J A;  3Q3F A;  4I6N B;  4W9K A;  5J18 A;  2DZK A;  1WX9 A;  2R2O A;  2JZ3 B;  4II3 B;  2DYM A;  3OLM D;  2PPH A;  1YX6 B;  1YQB A;  1V2Y A;  2N9X A;  1WY8 A;  4GDK B;  4MGZ E;  2GBR A;  1WGG A;  4X57 B;  3ZKJ C;  4FAD A;  4GDL B;  4KZC A;  4HCN B;  1T0Y A;  2D11 A;  2K6D B;  1F9J A;  2KDE B;  4II2 B;  4W9D A;  1KJT A;  4DHJ B;  4FJV B;  3TMP B;  3ZVV A;  2NVU I;  1RAX A;  1E5W A;  3EFU A;  4IWO A;  3PRZ A;  3DVG Y;  4EZJ A;  1L2N A;  3RZW C;  2G4D B;  5L95 C;  3A4R A;  3QIJ A;  5D7G A;  3ECI A;  1WXS A;  2XK5 B;  4TQ1 A;  2N7D A;  3GZN I;  2J7Q B;  2KC2 A;  4KDI C;  3AU5 A;  1I35 A;  3ZO5 B;  2G3Q B;  2FCS A;  1SGH A;  3UQA A;  3VFK A;  3WAN A;  4JL9 A;  2HJ8 A;  1E7U A;  3L08 A;  4G11 A;  4AP4 C;  4IWQ A;  3W1S C;  1P0R A;  3K9P B;  3PHW B;  1LFD A;  4BKS D;  4FHK A;  3TJP A;  1J0G A;  2JXX A;  2MRP A;  3W1S A;  2K39 A;  2ASQ A;  2V1Y A;  3PZD A;  5J2R A;  4FHJ A;  2IO2 B;  2M17 A;  2L05 A;  3CSF A;  2LGD A;  1A5R A;  3RD2 A;  1EUV B;  1EO6 A;  1YJ1 A;  2LRU A;  2BWF A;  4KZ0 A;  5AZH A;  2HE7 A;  3KUC B;  4WJQ A;  2FAZ A;  1E8X A;  3U8Z A;  4DDG D;  3KYC D;  2CHX A;  4GGQ A;  2GBK A;  1V6E A;  1WGY A;  4XZ4 A;  2RSU A;  3PSE B;  4IUM B;  3JYU A;  2KMC A;  4TUU A;  2KHW B;  3DBS A;  3BIN A;  2L00 B;  1WXV A;  3B1L X;  2LZ6 A;  2C9W B;  1OEY A;  2N1W A;  3VHT C;  1XQQ A;  4ANW A;  4MEM A;  3L17 A;  3IVF A;  2Z0E B;  4WWN A;  1UH6 A;  5E6P A;  1ZKH A;  3VTW A;  1ZGU B;  2HTH A;  1WMH B;  1S1Q B;  3MHS D;  2ZNV C;  2NPT B;  4W9J A;  3UF8 A;  1GC6 A;  4TKN A;  3ML9 A;  3U7D A;  2FCQ A;  2C7N B;  2KD0 A;  4FJY A;  3QCA A;  4G0N B;  5IAA C;  4B95 A;  4LDT B;  2JVC A;  4MJS A;  1YX5 B;  2IYD B;  4W9F A;  4EFO A;  4NJ6 A;  5TR5 A;  4LCD E;  4GU2 A;  4BOZ B;  1P1A A;  3UQB A;  2WX1 A;  5C23 A;  3VVW B;  4ZRJ A;  3KUD B;  3UIO B;  4EOY A;  3DOW A;  2MBO A;  4MM3 A;  2FCM A;  3VQI A;  2ZCB A;  1RRB A;  1OQY A;  4DBG A;  2O6V A;  2B3A A;  2Y5B B;  2ZEQ A;  5C1Z A;  4IWP A;  4FLH A;  4HXD A;  2N9P C;  3ZLZ A;  2IO1 B;  3DBR I;  3DVG X;  2KO3 A;  3ZTC A;  5KHQ A;  2KJH B;  4LJP B;  3MTN B;  4WJP A;  3RT3 B;  1Q5W B;  3R66 C;  2BYV E;  4K1R B;  1WGH A;  4PS7 A;  4IM3 A;  4M0W B;  4DHZ B;  1WXA A;  2RGF A;  4MH0 E;  2LRW A;  4OVV A;  3V6E B;  2R2Q A;  4CYE A;  4RMA A;  4HJK A;  2RPQ A;  2AWT A;  2UYZ B;  2Z59 B;  3QHT A;  3T9L A;  1QZE A;  2JZZ A;  1E7V A;  3PTF C;  4B6W A;  2KTR A;  2LXA A;  3ZUN A;  4IC7 B;  4NJ7 A;  4EEW A;  3M62 B;  1XT9 B;  3D32 A;  2JPH A;  2A5U A;  2OOB B;  2WYQ A;  3SDL C;  2JRI B;  1WH3 A;  2VRR B;  2M4N A;  3GOE A;  3QC8 B;  3DVN V;  1LQB A;  1WJU A;  4PYU A;  1JRU A;  2KQS A;  4AOF A;  1WJ4 A;  4ANV A;  4DDI D;  3R7R A;  1FXT B;  4TV3 A;  3WAL A;  4MSQ B;  3A9J A;  1UD7 A;  3ZTD A;  5CX3 A;  2GMI C;  1WI0 A;  4BBN C;  3CF6 E;  3A4S C;  2MP2 B;  3P2B A;  4GXB A;  2KN5 A;  2LAS A;  1P98 A;  1P9D U;  3C0R B;  1HE8 A;  1WZ0 A;  4PS3 A;  4RM8 A;  2MCN B;  2NBU A;  2BWE S;  2LUE A;  2LJ5 A;  2CS4 A;  2NBV B;  2YVC A;  4K7U A;  3PGE A;  3WAO A;  2WDT B;  2G4S A;  1WE7 A;  3QQ8 B;  1H4R A;  4FBJ B;  2IY1 B;  3PS6 A;  3HM3 A;  1KM7 A;  3QK0 A;  3R7Q A;  3SU8 X;  4IW0 A;  2DZJ A;  2J0M A;  4W9E A;  1WX7 A;  3A1Q A;  4KDL B;  4FA6 A;  1E90 A;  4MGY E;  3TL5 A;  2K6Q A;  5JH5 C;  4W9G A;  2ZPY A;  4BKG A;  4NPN A;  4KSK C;  2MWS B;  2DZM A;  3LDZ E;  3L54 A;  4KIK A;  5DPR A;  2KWV B;  4E74 A;  1V86 A;  2JF5 A;  4ZRI A;  3U30 A;  2L3Z A;  4K81 A;  2AL6 A;  2KLC A;  3LJ3 A;  3NS8 A;  1VCB A;  4HCP B;  2KFK B;  2KTF A;  4GB9 A;  4AWJ A;  2BKR B;  1MG8 A;  2LVO A;  2KC1 A;  4HLE A;  4DXA B;  5GMV A;  3VUX A;  3A33 B;  4MGI E;  3T8M A;  3NY5 A;  2KKC A;  3KYD D;  2KAN A;  2N9E B;  4BFR A;  4I6L B;  4DHJ D;  4MEL A;  5G2N A;  3IHP C;  1TBE A;  3H9D A;  2RR9 A;  4FJZ A;  4B9K A;  4EKU A;  4GDK A;  5AEK B;  2XBB C;  3DQV A;  3VH4 B;  4A20 A;  4TQ0 A;  4BOS C;  4AUQ C;  4AJW A;  1UBQ A;  4F7Z A;  1E8W A;  3OAW A;  4HPM B;  2LXC A;  4BKS A;  2D3G A;  1RFA A;  3EEC A;  4GSW A;  2C5L C;  4WQO B;  1OTR B;  2ZPN A;  2ZNV B;  4F1S A;  1H8C A;  2JY6 A;  2MBQ A;  3AI5 A;  3O65 B;  5JHA A;  2D07 B;  2KFJ A;  3DCG A;  4A3O A;  4J6I A;  3ZNH B;  3QAQ A;  2NS5 A;  4MSM B;  3RCZ A;  4EZL A;  2LGY A;  3IBE A;  1RLF A;  1M94 A;  4NY0 A;  2BYE A;  3ZIM A;  1LXD A;  4ICU A;  2AEH A;  2O6V B;  4W9H A;  2OJR A;  3H7S A;  3N30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...