4MJSA

Crystal structure of a pb1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
89
structure length
88
Chain Sequence
PHMRVRLKAHYGGDILITSVDTTTFQDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLACQGRDEVLIIHVFPSIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/protein binding
molecule keywords Protein kinase C zeta type
publication title Structural and biochemical insights into the homotypic PB1-PB1 complex between PKC zeta and p62
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 88
sequence length 89
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4mjsA00
2LRUA 2G4SA 2KJRA 2KVRA 3RCZA 4A3PA 2LGYA 2QHOA 2Z0DB 2CHZA 4W9IA 4WJQA 5KHOA 4AWJA 1UBQA 3A9JA 2KFJA 1EF1A 1WZ0A 4BBNC 3NZSA 2N9PC 2RR9A 2KTRA 2R2OA 1WXMA 4IWOA 2FCMA 3UF8A 4KV2A 5AEKB 2N9XA 3PVLA 3CMMB 3V6CB 3ZLZA 2KFKA 4DDID 2C5LC 2KC2A 2N1WA 5CHWA 1FXTB 3WALA 2NCNA 5FR6A 2IY0B 2DAJA 2ZZPB 1L2NA 1P98A 2ZVNA 1WE7A 1G6JA 3VH4B 4GOCA 3HHMA 2M1MA 4NQLB 3CF6E 1EUVB 2KK8A 3ZIMA 3APDA 2L0TA 4G3XB 3PGEA 4M0WB 4OVVA 4W9JA 3VTWA 5C1ZA 4AOFA 2N4FA 4FJVB 3RULA 2JUOA 1VD2A 4HPLB 2A4ZA 3CSTA 3PZDA 1WI0A 2AWTA 3KYCD 3PS6A 2Z59B 4AP4C 2LJ5A 2J0MA 3ALBA 1KLVA 1WYWB 2JF5A 5CX3A 4A3OA 4KIKA 4IWPA 3DVNU 4W9KA 2KN5A 2KDFB 2L05A 4IG7B 4G50A 1E8WA 1XQQA 4ZDVA 5LXHA 2C9WB 1E8ZA 1IP9A 1WJ6A 2LD9A 3VVWB 4HXDA 4PYZA 4MH0E 4JIOU 4NJ7A 4EEWA 4URKA 3OJ3A 3U30A 2K25A 2LGXA 3R7QA 1Q1OA 1WX9A 4CHKA 1WGDA 4WJNA 4WJPA 2I1KA 5DPRA 5D6JB 5J2RA 1CMXB 4PS7A 1X1MA 3OLMD 2YLMA 3UQBA 3IG3A 1Q5WB 2N7EA 2WWZA 2KWUB 4G0NB 1BT0A 1P0RA 1Z2MA 4DK5A 2DENB 2KKCA 2EMSA 4K1RB 2KANA 2KX0A 5BO4B 2XK5A 5AZGA 2KZRA 1WIAA 2MQJA 4JGHB 2BYEA 1WJNA 5DCNA 3V62A 4DXAB 2KFKB 2L7RA 1WXSA 3W1SC 3W1YA 4WJOA 2BYVE 2XEWA 1WM2A 2V1YA 1GJZA 2UYZB 3SD5A 4ASWC 3VFKA 2ZPNA 3LJ3A 5L83A 2K8BA 4IUMB 4HLEA 3NOBA 2FIDA 3PLVA 1WGHA 3V61A 3BY4B 3PRPB 2HJ8A 4GIVA 3NY5A 2KMCA 2LVOA 3UIPB 3SDLC 2L00B 3U8ZA 2KX3A 1IYFA 1TBEA 3TIXA 3ZW3A 3HM3A 3A1QB 1WGGA 4M8NA 3GOEA 2KWVB 1WF9A 2CR5A 2GOWA 2KNBA 2V4LA 3KVFB 3RD2A 2WX0A 4BOSC 3DBLI 2WYQA 4ANVA 4EOYA 3VAWA 4B9KA 3AXCA 4KIKB 1TGZB 2MX2A 4PS3A 2ZNVB 4BOZB 4ANWA 4KZCA 3T8MA 4MELA 3WAMA 1XT9B 2KTFA 2GBRA 1EO6A 2MRPA 3VHTC 1UGMA 1ZKHA 2WDTB 2DAFA 1Z5SB 3TMPB 3L17A 4ZRKA 4MGKE 2KHWB 3EC8A 2JZZA 3AU5A 4KSLC 4FJZA 3QCAA 2LI5A 2BWES 3UQAA 3PHWB 4ICUA 4TKNA 2O2VA 3PT2B 2AYOB 4HCPB 4KDIC 4I6PA 5J17A 3MJWA 2JRHA 3WAPA 1WFYA 4W9LA 3M62B 4GB9A 5DPWA 2L8JA 4MM3A 2MA9B 4HJKA 2D3GA 3SHQA 4B95A 1LM8B 1WJUA 1P1AA 4RM9A 2KLCA 1UD7A 1WJ4A 3DVGY 1E8XA 1H4RA 4IW0A 2XK5B 3APCA 3QC8B 3KW5B 1E8YA 2OJRA 4HWIB 2FAZA 3ZDMC 2JXXA 3QAQA 4XC2A 4II2B 1V49A 1SE9A 4KDLB 1YD8U 1AARA 4BFRA 5JHBA 1S1QB 4HDQA 2FUHB 2C7HA 1KOTA 2IO3B 4NAWA 4HVBA 3W1SA 1I35A 1UELA 2V3SA 2ZJDA 3SU8X 5KHQA 4K81A 2IO1B 1WRDB 2KWCA 1P3QU 1J8CA 3A9KA 2MBEA 2GBNA 1R4MI 4MGZE 2LXAA 1WR1A 3OJ4B 4RMAA 2HD5B 1WX7A 2DX5B 3A1QA 2I1JA 1WGYA 1P9DU 4ANUA 3Q3JA 1WM3A 4YL8A 2NBWB 2LRWA 1RAXA 4WQOB 4HK2A 3ZVVA 2KJ6A 4DBGA 1V80A 4PYUA 4XZ4A 2K1FA 3S2AA 2G3QB 2GBKA 3QARA 3AU4A 3QWZB 2CHWA 1MG8A 1JRUA 4X57B 5D7GA 4DHJD 3DBRI 3JVZX 2MWSB 1KJTA 4W9HA 2UWQA 2CHXA 1V5TA 4ICVA 3ML9A 2MBHA 3DVNV 2L0FA 3BINA 2HE7A 3K9OB 4N9F4 2K8HA 2KDIA 1UZXB 3ML8A 4JL9A 4MJSA 2LVPA 3L08A 1V2YA 3TJPA 2J7QB 3C0RB 2XBBC 4LDTB 5AZHA 1LFDA 4GDKB 5G55A 4W9DA 3WIMA 3QA8A 4E3CA 3LDZE 3Q3FA 2O2VB 3ZUNA 4DWFA 1SGHA 2JRIB 3ZO5B 4MSMB 3PPAA 1OEYA 2PJHA 4IM0A 5IA7A 1M94A 2FNJB 4FLHA 3B1LX 4MSQB 3EFUA 3VDZA 3IFWB 5CTRC 2C60A 2NBVB 3PLUA 1OQYA 1A5RA 4W9FA 1K8RB 1T0YA 4AJYB 4LCDE 1Q0WB 3TBLD 3VXWA 2REXA 3RZWC 2DZIA 4IC7B 3DVGX 3NHEB 1RFAA 4IM3A 1E90A 1V81A 4J6IA 1Y8RC 2KO3A 3M95A 3H1UA 4FN2A 4K7WA 4NAWB 2JY6A 2RSUA 1YQBA 2MP2A 3B08A 5JZEB 3N3KB 3WA0A 2M8SA 2NR2A 3PRZA 3A9KB 3EECA 3H7PB 4NNJB 4NPNA 3V60A 3ZNGC 2MLBA 4GMVA 5TR5A 1WY8A 3IBEA 3MTNB 3UINB 2ZCBA 2N1VA 4TUUA 3ONSA 1V9JA 3PRMB 3DBHI 2D2QA 2RPQA 2M17A 4ZRIA 4GU2A 3KUCB 4MGYE 3N30A 3ZNID 3KH0A 1C3TA 1YX5B 3PV1A 3NS8A 2AL3A 2KLGA 3RUIB 3RZFA 2PPHA 3AULA 4I6NB 3TL5A 2MBOA 4G11A 2JT4B 4MJSB 2BPSA 3RYTA 2DHZA 5E6OA 3QIJA 2FCNA 1NI2A 4GDKA 4K7UA 3U7DA 5L95C 2K8CA 2M4NA 5DPSA 3X23A 2JPHA 3O65B 1GC6A 4W9CA 2L76A 2LXCA 4E74A 4NJ6A 4II3B 5LXIB 4DHJB 1WR6E 2AEHA 4TQ1A 3VUWA 2LASA 2CU1A 2ZPYA 3DDCB 4DHZB 2FCQA 4MEMA 3M3JA 3R7RA 2FCSA 4M8MA 4NQKE 2PE6B 3DCGA 2KD0A 3QK0A 2CKHB 3ZNHB 1I42A 4GN1A 4ZRJA 2AL6A 4AUQC 4DHZE 1HE8A 2MBQA 2G45B 3I3TB 1D3ZA 4FA6A 4IWQA 2GBMA 4B6WA 5JHAA 2DZKA 4GXBA 1UBIA 3WAOA 4F8CB 2B3AA 1GC7A 3DBSA 4RM8A 2WX1A 4GSWA 4ANXA 2MBBB 3ZTCA 2Z0EB 2MP2B 1XD3B 3KUZA 2C7NB 3ENEA 3QJZA 4FJYA 4PS8A 3H7PA 1WXVA 3QHTA 3ZKJC 3PTFC 4FHKA 3X0WA 4FADA 1VCBA 3UGBB 2IY1B 5D2MB 1RRBA 1OEYJ 2BYFA 2IBIB 1WX8A 4GDLA 2ASQA 2G4DB 1WZ3A 2LGDA 3L0WB 3VUYA 5LLIA 2NVUI 4XX5A 5DPTA 4WWOA 4EFOA 2KQSA 4HCNB 4FBJB 2EKEC 3IVFA 2LUEA 4EZKA 3L13A 5CHFA 1V86A 4IM2A 3DOWA 3KYDD 2CS4A 3PSEB 2C7MB 3EHVA 3R3MA 4JQWC 4A20A 2GMIC 2O6VD 1NBFC 2ZVOA 3CSFA 3TCAA 2JVCA 3ZNZB 3D32A 3APFA 4TQ0A 2NBUA 2PE9A 3M63B 2KQ7A 4MGIE 1NDDA 2PEAA 2BGFA 4P7IA 2IZVB 1R4NI 2K6QA 3WANA 2MCNB 1ISNA 2JWZA 1OTRB 3H7SA 3OAWA 2IO2B 1WGRA 3NZUA 4FHJA 3ZTDA 2M0XA 5D94A 4BBNF 3JSVA 1F9JA 2KDBA 1WMHA 3ZRCA 1TTNA 2BF8B 2KXJA 3N32A 1GG3A 1KM7A 2O6VA 3RT3B 1YJ1A 5JH5C 3QX1A 1GNUA 5G2NA 1E7UA 1YIWA 1OGWA 2K39A 4BKGA 2D11A 4TV3A 4LJOB 1WXAA 2DYMA 2NPTB 3T9LA 3B0AA 4OVUA 4EZJA 3KUDB 2W9NA 4W9GA 2Y5BB 3R66C 2MW5A 2L3ZA 2RGFA 1E5WA 2D07B 4DDGD 1GUAB 3K9PB 1LQBA 2BKFA 2A5UA 3PREA 1SIFA 2KJHB 2JZ3B 4HDOA 1ZGUB 4KVGB 1PQSA 1L7YA 1QZEA 2RD0A 3A9JB 1C1YB 2NS5A 3A33B 4KZ0A 4CYEA 4WWNA 3GZNI 2KTRB 1V5OA 4MDKE 4BKSD 1S3SG 1V6EA 3DQVA 2KDEB 3VH3B 2KC1A 2EMTA 3HIZA 4GDLB 3PHXB 5HKHA 4AJWA 3JYUA 2HTHA 2DYBA 1E7VA 3UIOB 5C23A 1LXDA 3QQ8B 4W9EA 5E6NA 1UH6A 4EKUA 2LWPA 4CO7A 3JW0X 2DZMA 2LVQA 4EZLA 5AZFA 3L54A 2K6DB 1TZ1A 3A4RA 4HPMB 2FIFA 2BWFA 2J0JA 3L10B 3L16A 3ZDTA 4NY0A 4BKSA 4F1SA 1H8CA 1J19A 2ZNVC 1EF5A 2IO0B 3H6NA 4LDTD 4WAAA 1U4AA 2D10A 2BKRB 2OOBB 4FULA 2ZEQA 2J0KA 2ZCCA 3V6EB 4BKTA 4JLCA 3ZRFA 5EDSA 5GMVA 2KOXA 3ECIA 4LJPB 1YX6B 5E6PA 2DYOA 3VTUA 4E71A 2IYDB 3VUXA 4WWPA 2YVCA 2MSED 5IAAC 2VRRB 4BVUC 2LZ6A 4EUTA 1J0GA 2N9EB 3JSVB 1WMHB 4K7SA 2R2QA 4GGQA 1WH3A 4KSKC 2O6VB 2KMAA 3HM6X 3IHPC 3HK0A 4F7ZA 3H9DA 2GBJA 1WE6A 2N7DA 2NPTA 3AI5A 3DPDA 1IPGA 3A4SC 1ZW7A 3P2BA 3VTVA 1RLFA 4I6LB 3VQIA 5CHVC 5J18A 4ZYNA 2DZJA 3MHSD
chains in the Genus database with same CATH superfamily
2BTEA 4DXGA 2KVRA 4WJQA 1EF1A 3NZSA 3UI3A 3UF8A 3ZJUA 2FCMA 3PVLA 2YEPB 1E0ZA 5CHWA 2WXRA 1YMHE 2INDC 1DGJA 1JROA 3VH4B 2M1MA 4UDUC 1MFWA 3APDA 1XXGA 4M0WB 1FFUA 4W9JA 3HVZA 1XLPA 2LJ5A 2J0MA 2WXFA 5BMGA 2WXNA 3BIID 4P6VF 3LXFA 3LYYA 3DVNU 3Q8AA 2KDFB 3NS1A 1E8WA 2WXMA 1MPEA 2LD9A 3U2SC 3MC8A 4EEWA 4URKA 1NI3A 3TEWA 3W2DA 3NUHB 4RF1A 1Q1OA 2N9KA 2I1KA 1CMXB 2WWZA 1BT0A 1SJHD 2KKCA 3AE7B 1SIJA 2XK5A 1TT5B 3AEEB 1WIAA 2MQJA 2INCC 4DXAB 4OZBA 1J7CA 4R3DA 2BYVE 1WM2A 1GJZA 1KH0A 4N58A 3LJ3A 5L83A 3Q2AC 3BY4B 3N20C 4GIVA 3UIPB 3SDLC 2L00B 3ZW3A 2WGSA 2KT7A 1WF9A 2CR5A 2GOWA 3RD2A 2WX0A 2WYQA 4PS3A 5AUIA 2QILA 2MHJA 5IN7A 4MELA 3WAMA 2LGSA 1MHHE 2MRPA 1J7AA 1Z5SB 3L17A 4MGKE 1VZ7A 1TKYA 1BUIC 4RH6A 3PHWB 3Q3MC 1AWDA 4YTMB 5DPWA 3M62B 4MM3A 3SHQA 1XCTL 1WJUA 1EWCA 1UD7A 2AX5A 3DVGY 2XK5B 1RYJA 2FAZA 3ZDMC 4L2YA 4A9AA 4RGTA 1SE9A 1E10A 4BFRA 1Q10A 1S1QB 1MI0A 1NVID 4O1NA 2Y5CA 4USAA 3TUOA 2V4IB 4ZHPA 1I35A 5G5GA 1WRDB 1WWTA 1QKZA 3A9KA 2GBNA 2LXAA 1WR1A 3OJ4B 4XYCA 5G5HA 3A1QA 1WGYA 3Q3JA 1SB3C 1ZOYB 1C9FA 3GE3C 5TSSA 3W9CB 3AU4A 1MG8A 4EOYA 4X57B 5D7GA 4W9HA 2UWQA 3R2IA 4ICVA 2R61A 2MBHA 3DVNV 2HE7A 1WRIA 4N9F4 2K8HA 4JWSC 1NEKB 3L08A 2LGIA 3C0RB 5AZHA 4LDTB 4GDKB 5G55A 4W9DA 3ZYYX 3RI7C 2JRIB 2RPVA 5IA7A 2V0GA 4MM3B 3EFUA 2C60A 1A5RA 3B2FA 2IPKD 3VRAB 2B76B 2LHEA 4AJYB 2D3CA 1L0YB 3RZWC 3DVGX 4IM3A 2DBYA 1V81A 3M95A 4FN2A 3OWEB 2JY6A 3B08A 3RN9C 5JZEB 1DOIA 3N3KB 2RMMA 2K22A 3A9KB 5FKAC 3V60A 3ZNGC 5E6JA 3W5UB 2KAJA 3DBHI 4RF0A 3BVGA 4US8A 2RPQA 4ZRIA 3GE8C 3ZNID 1C3TA 3PV1A 3RUIB 4I6NB 3AULA 4OZCA 1ZUD2 1NENB 4YT0B 4GLSC 2PVGC 2LXCA 3AE8B 3AH7A 4REZA 4NJ6A 3MHZA 3IT6B 3VUWA 3VRBB 3C8YA 2IGGA 2M56B 3M3JA 3R7RA 4NQKE 2PE6B 3DCGA 3ZNHB 3ZXVA 4ZRJA 4RNAA 2MBQA 1AN8A 2INNE 4F8CB 1NYQA 1FMAD 1EM7A 2WX1A 2Z0EB 2KWDA 3H7PA 2TSSA 3X0WA 2L32A 4XWWA 2IGDA 4LNIA 1RRBA 1DOXA 1OEYJ 2BYFA 1WX8A 1WZ3A 2FE8A 5LLIA 2BS2B 2L1AA 4DQOC 2PTLA 4EE2A 2LUEA 3L13A 1F0ZA 5IO9A 1PUTA 3RNCC 3PSEB 5BYRA 4JQWC 3R3MA 4QAYA 1NBFC 1DOYA 2QIEB 1E7PB 3PO0A 2KQ7A 2BGFA 3R2TA 2LFIA 1F77A 2MCNB 4BAXA 4LK0M 3OAWA 2IGHA 2IO2B 2YEPF 2BBCA 1FXIA 1JWBD 1TY0A 1WMHA 3DWGC 4A90A 3N32A 4LNKA 1GNUA 2NTTA 1E9MA 2K39A 3I63C 2DYMA 4ZRPA 2LUMA 2JXTA 2NPTB 4EZJA 3BVZA 2W9NA 3P4RB 1STEA 2MW5A 1JWAD 3R8BA 4DDGD 3NVVA 2HJ1A 2BKFA 1SIFA 2KJHB 4MH8A 1L7YA 1QZEA 2RD0A 1C1YB 1OFFA 4DXFA 2KTRB 1KFYB 4KX6B 4JX1C 2KDEB 1N60A 3HIZA 3PHXB 1YQ4B 4AJWA 2ON8A 3MFGA 5C23A 3JW0X 2L52A 2DZMA 3C19A 1FM0D 3L4PA 1D5ZC 3L10B 2WXGA 1J19A 3ZXRA 4KKJA 4WAAA 1U4AA 4FULA 2ZEQA 4JLCA 4LJPB 3VTUA 2DYOA 4E71A 2IYDB 3URYA 2MSED 2JX5A 1J0GA 1SJED 1WMHB 4K7SA 3BYYB 5EE1A 3HM6X 3IHPC 4YSZB 4XDCA 1WE6A 2N7DA 2L83A 3Q69A 1ZW7A 5CHVC 4ZYNA 2DZJA 3MHSD 3ETRA 2JYEA 3RCZA 4ARIA 2QHOA 1T5XD 1HZ5A 2CHZA 4AWJA 4C7ZA 2KFJA 3I5JC 1AW7A 1WZ0A 2ZW1A 2R2OA 1WXMA 5AEKB 2H88B 4DDID 2C5LC 2KC2A 3V3XA 4TSSA 1FXTB 3WALA 2IY0B 5FR3A 1WE7A 1WGKA 1V1OA 4A6QA 3PGEA 3VTWA 5C1ZA 3P4SB 5C3JB 4FJVB 1K50A 4HPLB 3CSTA 1WI0A 2AWTA 3KYCD 3PS6A 2WDRB 1KLVA 1WYWB 3U4EG 3AEDB 4W9KA 4LNNA 1XQQA 4ZDVA 5LXHA 3AE4B 1IP9A 2WS3B 1SE3A 3VVWB 4HXDA 4PYZA 4NJ7A 3OJ3A 2LGXA 1WGDA 4Q2JA 1TS5A 2KDMA 4HEA1 1FRDA 1FNWA 1Q5WB 2KWUB 3B9JA 4DK5A 1Z2MA 2DENB 2EMSA 2WXOA 3MP9A 5DCNA 4XE0A 1WJNA 4A55A 2IJ0A 4WJOA 1JCKB 3SD5A 1N61A 1PGBA 3Q8BA 2K8BA 3NOBA 2FIDA 3PLVA 1WGHA 3Q3NC 4HPPA 4XDDA 3SEBA 3V61A 3AE9B 4M0WA 3PRPB 3NY5A 3U8ZA 2BS4B 4C7YA 2KNBA 4BOSC 2I38A 3VAWA 3AXCA 2MX2A 3AB5A 1XT9B 2GBRA 2WDTB 1T0RC 4ACFA 2KHWB 3EC8A 2JZZA 3UQAA 2LI5A 2WLBA 4ICUA 4TKNA 3EGRA 1HEZE 5IP4D 3WAPA 1WFYA 4GB9A 2MA9B 4WWMA 4B95A 1TKEA 1LM8B 4RM9A 1E8XA 4IW0A 2PLPA 3APCA 2OJRA 2JXXA 2AQ3B 4II2B 4HDQA 1RM6C 4NAWA 2JQRB 5BYSA 2ZJDA 1J8CA 3AV8A 2MBEA 3AE3B 1ZDXA 1XCQL 2HD5B 1ZDVA 1ET9A 1P9DU 4ANUA 2W54A 2NBWB 1RAXA 3ZVVA 4DBGA 4XZ4A 1MJDA 4PYUA 1ZP0B 2CHWA 3P4QB 4MACA 2CHXA 3W5VB 1V5TA 2L0FA 4K3CA 2KDIA 4KGTA 3ZJVA 4JL9A 2ACZB 4MJSA 4C00A 3FILA 2LVPA 4P1BC 3AM9A 1LFDA 4E3CA 4DWFA 3ZO5B 2GI9A 4WAFA 3PPAA 4IM0A 4US9A 4MSQB 3AE6B 3CWIA 2INPE 1IUEA 1QOAA 3E56A 4NJCA 4LCDE 3FAHA 3VXWA 1Y8RC 3H1UA 2J42A 4NAWB 1C4CA 2RDBC 2OEDA 4OVZA 3U7ZA 3PRZA 3EECA 4NNJB 4NPNA 4C80A 4YWGG 1BMLC 5TR5A 1WY8A 3RNEC 1I4GA 3N1YC 3UINB 2ZCBA 4NZLB 2N1VA 1IBXB 4M00A 2H89B 4ZRQA 2D2QA 4GU2A 3KUCB 4MGYE 3KH0A 2MJDA 3NS8A 1YJJA 2KLGA 3RZFA 5H92C 2MEKA 3TL5A 3GP7A 4YXDB 4LNOA 2JZPA 1MHXA 3GB1A 3Q14C 4MJSB 3FILB 2DHZA 2FCNA 2XN9C 4GDKA 4K7UA 3U7DA 3X23A 1L0VB 4WH4A 2JPHA 1JQ4A 1GC6A 4II3B 1WR6E 2AEHA 1FNUA 2LASA 3FC4A 1L4ZB 4DHZB 2FCSA 2NMQA 4M8MA 1I42A 4GN1A 3I3TB 1D3ZA 4FA6A 2E6XA 4IWQA 2GBMA 2BS3B 4RGNA 4C56C 2DZKA 4GXBA 2B3AA 1GC7A 3DBSA 2MBBB 3OG5A 1AYFA 1WXVA 4HROA 3PTFC 2W82A 1YN5A 2GLSA 1D6EC 3UGBB 2IY1B 1JMLA 2IBIB 3AECB 4GDLA 2G4DB 5DPTA 4FBJB 3IVFA 1CQVA 2QMTA 1R7SA 2JSVX 1SEBD 2C7MB 4LTUA 2MJEA 1KLGD 3CSFA 3TCAA 4TQ0A 3NZ3A 4MGIE 1NDDA 4N59A 2K6QA 2JWZA 3NZUA 4FHJA 3ZTDA 1QOFA 5D94A 1UWMA 3JSVA 3FKYA 3ZRCA 1TTNA 2BF8B 3RNFC 2KXJA 2D3BA 5JH5C 3QX1A 1YIWA 4BKGA 4TV3A 4WURA 1FCCC 4OVUA 3T3NA 3KUDB 2L3ZA 2RGFA 2J53A 1I7HA 2D07B 1GUAB 3K9PB 3TEXA 2WXLA 1KLUD 2A5UA 3PREA 4HDOA 2Y3AA 1C78A 1PQSA 1PGXA 3A9JB 4KVGB 1HTOA 2NS5A 3ZQ4A 4KZ0A 1YN4A 4BKSD 3BK1A 4PT5A 1TS4A 1D5MC 1B9RA 2XNAC 4OW0A 1FRRA 2EMTA 4GDLB 1E6EB 1C76A 1XLQA 2W3RA 3JYUA 2DYBA 3UIOB 1EU4A 3E9SA 1LXDA 1M4VA 4EZLA 5AZFA 4E74A 4HPMB 3A4RA 2BWFA 5AUKA 1A70A 2AQ2B 4NY0A 4BKSA 4F1SA 1H8CA 2ZNVC 1EF5A 1QOGA 4BKTA 1WXQA 1JRPA 5GMVA 2KOXA 2Q5WD 2YVCA 2NTSA 5IAAC 2N9EB 3JSVB 4ZHOA 1TY2A 2R2QA 4IKGA 3V05A 4KSKC 3ABVB 2N7JA 4F7ZA 2NPTA 4I6LB 3VQIA 2LRUA 2KJRA 4A3PA 1D4BA 1HQRD 2J52A 2Z0DB 3BZDB 1UBQA 2KTRA 4IWOA 4KV2A 2N9XA 3CMMB 1P7EA 3ZLZA 1C77A 4D2KA 2N1WA 4S17A 3KWLA 1L2NA 1ZPSA 1P98A 1I4PA 3RMKC 2BB6A 2QEJC 1UGJA 4NQLB 2KK8A 2L0TA 4OVVA 3RULA 1HZ6A 3PZDA 1YNTE 3ALBA 2HTME 2JF5A 5CX3A 4AS1A 2KN5A 4JPSA 3RFZB 1E8ZA 2VH2A 1WJ6A 3NJTA 4JIOU 2K25A 5EE0A 2OHFA 4OZAA 1FPYA 4CHKA 2K0PA 2M19A 5D6JB 5J2RA 4PS7A 1X1MA 3UQBA 3HVDA 4G0NB 1P0RA 1KTKA 3IXSA 2KX0A 5AZGA 2KZRA 1VZ6A 3V62A 2L7RA 1WXSA 3W1SC 3W1YA 2WXKA 2V1YA 4ASWC 4PK1A 4HLEA 3TEYA 1N62A 3KLSX 1YN3A 5JXVA 1ZE3D 4C4VB 2KX3A 1XLNA 1WGGA 2V4LA 1JALA 3KVFB 4JE3B 4ANVA 4B9KA 4ANWA 2LHDA 1K53A 3T8MA 3AEFB 5BMIA 2KTFA 1EO6A 3VHTC 2DAFA 2WP9B 1VZ8A 3WCQA 4ZRKA 2BB5A 2FBWB 3KWVA 3AEGB 4YTPB 1F2RC 3EFCA 3PT2B 2AYOB 4KDIC 4I6PA 5J17A 1JWSD 3MJWA 1QLBB 4W9LA 1WYGA 2L8JA 1YJIA 1TYGB 3SFDB 5BYQA 4XC2A 2PMVA 4KDLB 5JHBA 3Q8FA 3KQ4A 2FUHB 1KOTA 4HVBA 1UELA 2V3SA 3SU8X 4K81A 4P16A 4FXCA 4WIPA 2KWCA 1R4MI 4MGZE 1WX7A 2I1JA 1FFVA 1WM3A 1T0QC 4YL8A 1F1HA 1N63A 1V80A 4HRSA 3SR6A 1L6VA 2K1FA 2G3QB 2WNMA 2GBKA 1P7FA 3QWZB 1JRUA 1L5PA 3DBRI 4L1BA 2EKIA 3ML9A 2JU6X 2BT6A 1N5XA 4JWUC 3TJPA 2XBBC 3QA8A 3LDZE 4OHJA 3Q3FA 3ZUNA 2WDVB 2PJHA 3P42A 1M94A 2FNJB 1CK1A 2IDYA 1QOBA 3IFWB 5CTRC 3PLUA 4KKIA 4W9FA 1K8RB 1HXYD 3TBLD 2REXA 4IC7B 3Q8CA 1OQRA 3NHEB 1I4HA 1RFAA 3N9YC 2KO3A 2K3UA 4K7WA 1SSNA 1YQBA 2MH7A 1I4QA 1GOZA 3N1ZC 4GMVA 5IOIA 3IBEA 2VH1A 3NVWA 3MTNB 1DYQA 2X38A 4TUUA 3ONSA 3PRMB 2M17A 2GRIA 2K9XA 3N30A 4ITKA 1YX5B 2AL3A 4L23A 2MBOA 1K51A 1NI2A 2JYTA 1BXTA 3NVZA 1RWSA 4ZYSA 2CJNA 4TQ1A 4RGMA 2CU1A 4MEMA 3DHHC 2QDFA 3QK0A 4DHZE 2AL6A 2AQ1B 2G45B 3VR9B 4B6WA 2UU7A 3Q6BA 4IOIE 4RM8A 4ANXA 5H8YE 1XD3B 1WSPA 3KUZA 3ENEA 4FJYA 2SAKA 3QHTA 4FHKA 1V8CA 1ZXHA 4B0EA 1VCBA 1FNVA 1T6BX 2WU5B 4MT5A 1IBXA 2ASQA 3VUYA 1SF0A 3AE5B 2NVUI 2KQSA 2EKEC 3J9CA 4EZKA 1IGCA 5CHFA 4IM2A 2LMCA 3KYDD 3EHVA 5HI1A 4A20A 2BQQA 2ZVOA 1R4MB 5EE9A 1FXAA 2JVCA 3ZNZB 3CIRB 2NBUA 2PE9A 2Z8LA 1N5WA 2W55A 4P7IA 2IZVB 3WANA 3H7SA 1WGRA 2BYTA 3DBRB 1UWXA 1GG3A 2J4XA 2BVCA 1E7UA 1OGWA 1TJEA 4H2AA 2D11A 4LJOB 1WXAA 3T9LA 3LB8C 2PKOA 3SFEB 1R4NB 1E5WA 2KMMA 1T0SC 1VRAB 1JW9D 1LQBA 4HKZE 4M02A 1ZGUB 2ONQA 4CYEA 3IAS1 4WWNA 3GZNI 1V5OA 3ZJTA 3HRDD 1S3SG 3DQVA 3VH3B 1FEHA 1MG4A 2KACA 3H8HA 1QQRA 4EKUA 1UH6A 1JWMD 1QILA 3AE2B 3L54A 1TZ1A 3ZDTA 3EUB2 3AN1A 2QSDA 2QJLA 2IO0B 4LDTD 1SXTA 1RFKA 2OOBB 2D10A 1VR9A 2J0KA 3V6EB 5EDSA 4HJGE 1VLBA 2ICIA 3VR8B 3VUXA 4WWPA 2VRRB 4BVUC 1KRHA 1CZPA 5IKCM 2D5GA 1WH3A 3AEBB 3HK0A 5HG2A 4LNFA 1ESFA 1VJKA 1V1PA 1V97A 3PZ7A 3A4SC 1RLFA 4TMAB 5E6PA 5BMHA 2G4SA 1HA5A 2LGYA 4S0RA 4W9IA 5KHOA 3A9JA 4BBNC 2SEBD 2N9PC 2RR9A 1XF5L 2WXJA 3V6CB 2KFKA 2OJWA 1FIQA 2NCNA 5FR6A 2DAJA 2ZZPB 1SE2A 2ZVNA 1G6JA 3AE1B 1VDVA 4GOCA 1C4AA 3HHMA 2K5PA 1LO5D 3CF6E 1EUVB 3ZIMA 2WHIA 2QC8A 4G3XB 5GXGB 4AOFA 1UF0A 3T3OA 2N4FA 2JUOA 1VD2A 2A4ZA 5HHDG 2Z59B 3BVMA 3P63A 4AP4C 3IT4B 4A3OA 4KIKA 4IWPA 2HDEA 2L05A 2JWUA 4IG7B 4G50A 2WXHA 4N6EB 2C9WB 2N9LA 4MH0E 1EWYC 3U30A 3R7QA 2ZW0A 1Y56A 1L6UA 1T3QA 1WX9A 4WJNA 1V1PB 2V3PA 4WJPA 5DPRA 4B0MA 1XEEA 3OLMD 2YLMA 3GS2A 1FD6A 3IG3A 2N7EA 4K1RB 1GB1A 2KANA 5BO4B 3DWMA 4BZAA 4JGHB 2BYEA 1D5XC 2KFKB 2XEWA 1OQQA 2UYZB 1C79A 2KN4A 3VFKA 2ZPNA 4IUMB 2DNFA 2M0AA 2GB1A 2HJ8A 1TIFA 2KMCA 2LVOA 1IYFA 1C4PA 1TBEA 3TIXA 3HM3A 3A1QB 4M8NA 3GOEA 1ET6A 2KWVB 3GZNB 1TZOA 4HKQA 3DBLI 3MC9A 2WXQA 3PZ8A 2DLBA 4KIKB 1TGZB 3NVYA 2LJIA 2D3AA 2ZNVB 5EE3A 4BOZB 1F2RI 4KZCA 1YOVB 4P1CC 2EELA 1UGMA 1ZKHA 3TMPB 2V3NA 3AU5A 4KSLC 4FJZA 3QCAA 2BWES 1L4DB 2O2VA 4HCPB 2KYWA 2MJ3A 2JRHA 4IDIA 4HJKA 2D3GA 1I4RA 1P1AA 2KLCA 1WJ4A 1H4RA 3QC8B 3AEAB 1E8YA 3KW5B 4HWIB 3QAQA 2X8XX 1V49A 1YD8U 1AARA 2N0SB 4M01A 2C7HA 2IO3B 5D3DA 1UUPA 3W1SA 5KHQA 2IO1B 1P3QU 1K52A 4C4VA 1KF6B 4RMAA 2DX5B 2PVOD 2WQYB 3RNBC 2LRWA 4WQOB 4HK2A 2KJ6A 3S2AA 3IAM1 3QARA 3AMZA 4DHJD 3JVZX 2MWSB 1KJTA 3BINA 2W3SA 3K9OB 1LGRA 1UZXB 3ML8A 2WU2B 1ACCA 1EU3A 1V2YA 2J7QB 4KGSA 3WIMA 2I2YA 2O2VB 2VZKD 1SGHA 4MSMB 1OEYA 4FLHA 3B1LX 3VDZA 1PDXA 2NBVB 1OQYA 3P1MA 1T0YA 1MVKA 1Q0WB 3RPFC 3MC0B 1YQ3B 2DZIA 2CU3A 1TKGA 1SBBB 1E90A 1XO3A 4J6IA 4RCOA 2RSUA 2MP2A 3WA0A 2M8SA 2NR2A 3H7PB 1PYWD 2MLBA 2PW9A 1V9JA 3BYTB 2PPHA 1PFDA 3I57A 3NRZA 4G11A 2JT4B 5T8IA 2BPSA 3RYTA 5E6OA 1PGAA 3QIJA 5L95C 2K8CA 2M4NA 5DPSA 1TS3A 3DBLB 3O65B 4W9CA 2L76A 2WDQB 1QT9A 4YSYB 3DBHB 5D3IB 1TS2A 5LXIB 4DHJB 1FCLA 1CJEA 3TEZA 2ZPYA 3DDCB 2FCQA 1I4XA 4ARCA 3EA6A 2KD0A 2CKHB 2WXPA 4AUQC 1HE8A 2Y5PA 5JHAA 1UBIA 3WAOA 3P4PB 4GSWA 3ZTCA 2VZKB 2MP2B 2C7NB 3QJZA 1ZXIA 2G9HD 4PS8A 2KQ4X 4ZOHC 5HFYA 3ZKJC 3RNAC 4FADA 2QCZA 2LEKA 1NYRA 3HUIA 5D2MB 1JWUD 4K3BA 2LGDA 3L0WB 4XX5A 1SE4A 4WWOA 4EFOA 3NG0A 4HCNB 3Q3OC 1V86A 5C2TB 2CJOA 3DOWA 4YSXB 2CS4A 3Q8EA 4LLGM 4YTNB 2GMIC 2O6VD 1B1ZA 2RDGA 2V9HA 4RGOS 4J3OD 4NAMA 3U52E 3D32A 3APFA 3M63B 2PEAA 3B2GA 1J7BA 1R4NI 1ISNA 1OTRB 1FO4A 2M0XA 3RNGC 2PIAA 4BBNF 1F9JA 2KDBA 4XWTA 1KM7A 2O6VA 3RT3B 1YJ1A 1L0XB 3DHGC 5LNK1 3I9V1 5G2NA 5I4DA 3O13A 3B0AA 4KGRA 2FUG1 4W9GA 2Y5BB 3R66C 2E3TA 4XGAB 2JZ3B 1GAQB 4WQMA 3A33B 4MDKE 1IGDA 1QF6A 2DWQA 1V6EA 1ROEA 1ENFA 2KC1A 4RFBA 5HKHA 3TSSA 2RDHA 2HTHA 1E7VA 1F52A 3QQ8B 4W9EA 5E6NA 2LWPA 2BW2A 4CO7A 2LVQA 1N6ZA 2K6DB 2KVZA 1UNSA 2FIFA 2J0JA 3L16A 1GPXA 3H6NA 3BWUD 2BKRB 1XLOA 1GB4A 2ZCCA 3DHIC 5MPOA 2G1EA 3ZRFA 3ECIA 1YX6B 5FK9C 2WXIA 3N1XC 2LZ6A 4EUTA 1HTQA 4GGQA 2O6VB 3ZGZA 2KMAA 3BK2A 3H9DA 4CQNA 2GBJA 3AI5A 4A8XC 3DPDA 1IPGA 3P2BA 3VTVA 4AQ7A 5J18A 3MJ5A
chains in the Genus database with same CATH topology
2LRUA 2G4SA 2KJRA 2KVRA 3RCZA 4A3PA 2LGYA 2QHOA 2Z0DB 2CHZA 4W9IA 4WJQA 5KHOA 4AWJA 1UBQA 3A9JA 2KFJA 1EF1A 1WZ0A 4BBNC 3NZSA 2N9PC 2RR9A 2KTRA 2R2OA 1WXMA 4IWOA 2FCMA 3UF8A 4KV2A 5AEKB 2N9XA 3PVLA 3CMMB 3V6CB 3ZLZA 2KFKA 4DDID 2C5LC 2KC2A 2N1WA 5CHWA 1FXTB 3WALA 2NCNA 5FR6A 2IY0B 2DAJA 2ZZPB 1L2NA 1P98A 2ZVNA 1WE7A 1G6JA 3VH4B 4GOCA 3HHMA 2M1MA 4NQLB 3CF6E 1EUVB 2KK8A 3ZIMA 3APDA 2L0TA 4G3XB 3PGEA 4M0WB 4OVVA 4W9JA 3VTWA 5C1ZA 4AOFA 2N4FA 4FJVB 3RULA 2JUOA 1VD2A 4HPLB 2A4ZA 3CSTA 3PZDA 1WI0A 2AWTA 3KYCD 3PS6A 2Z59B 4AP4C 2LJ5A 2J0MA 3ALBA 1KLVA 1WYWB 2JF5A 5CX3A 4A3OA 4KIKA 4IWPA 3DVNU 4W9KA 2KN5A 2KDFB 2L05A 4IG7B 4G50A 1E8WA 1XQQA 4ZDVA 5LXHA 2C9WB 1E8ZA 1IP9A 1WJ6A 2LD9A 3VVWB 4HXDA 4PYZA 4MH0E 4JIOU 4NJ7A 4EEWA 4URKA 3OJ3A 3U30A 2K25A 2LGXA 3R7QA 1Q1OA 1WX9A 4CHKA 1WGDA 4WJNA 4WJPA 2I1KA 5DPRA 5D6JB 5J2RA 1CMXB 4PS7A 1X1MA 3OLMD 2YLMA 3UQBA 3IG3A 1Q5WB 2N7EA 2WWZA 2KWUB 4G0NB 1BT0A 1P0RA 1Z2MA 4DK5A 2DENB 2KKCA 2EMSA 4K1RB 2KANA 2KX0A 5BO4B 2XK5A 5AZGA 2KZRA 1WIAA 2MQJA 4JGHB 2BYEA 1WJNA 5DCNA 3V62A 4DXAB 2KFKB 2L7RA 1WXSA 3W1SC 3W1YA 4WJOA 2BYVE 2XEWA 1WM2A 2V1YA 1GJZA 2UYZB 3SD5A 4ASWC 3VFKA 2ZPNA 3LJ3A 5L83A 2K8BA 4IUMB 4HLEA 3NOBA 2FIDA 3PLVA 1WGHA 3V61A 3BY4B 3PRPB 2HJ8A 4GIVA 3NY5A 2KMCA 2LVOA 3UIPB 3SDLC 2L00B 3U8ZA 2KX3A 1IYFA 1TBEA 3TIXA 3ZW3A 3HM3A 3A1QB 1WGGA 4M8NA 3GOEA 2KWVB 1WF9A 2CR5A 2GOWA 2KNBA 2V4LA 3KVFB 3RD2A 2WX0A 4BOSC 3DBLI 2WYQA 4ANVA 4EOYA 3VAWA 4B9KA 3AXCA 4KIKB 1TGZB 2MX2A 4PS3A 2ZNVB 4BOZB 4ANWA 4KZCA 3T8MA 4MELA 3WAMA 1XT9B 2KTFA 2GBRA 1EO6A 2MRPA 3VHTC 1UGMA 1ZKHA 2WDTB 2DAFA 1Z5SB 3TMPB 3L17A 4ZRKA 4MGKE 2KHWB 3EC8A 2JZZA 3AU5A 4KSLC 4FJZA 3QCAA 2LI5A 2BWES 3UQAA 3PHWB 4ICUA 4TKNA 2O2VA 3PT2B 2AYOB 4HCPB 4KDIC 4I6PA 5J17A 3MJWA 2JRHA 3WAPA 1WFYA 4W9LA 3M62B 4GB9A 5DPWA 2L8JA 4MM3A 2MA9B 4HJKA 2D3GA 3SHQA 4B95A 1LM8B 1WJUA 1P1AA 4RM9A 2KLCA 1UD7A 1WJ4A 3DVGY 1E8XA 1H4RA 4IW0A 2XK5B 3APCA 3QC8B 3KW5B 1E8YA 2OJRA 4HWIB 2FAZA 3ZDMC 2JXXA 3QAQA 4XC2A 4II2B 1V49A 1SE9A 4KDLB 1YD8U 1AARA 4BFRA 5JHBA 1S1QB 4HDQA 2FUHB 2C7HA 1KOTA 2IO3B 4NAWA 4HVBA 3W1SA 1I35A 1UELA 2V3SA 2ZJDA 3SU8X 5KHQA 4K81A 2IO1B 1WRDB 2KWCA 1P3QU 1J8CA 3A9KA 2MBEA 2GBNA 1R4MI 4MGZE 2LXAA 1WR1A 3OJ4B 4RMAA 2HD5B 1WX7A 2DX5B 3A1QA 2I1JA 1WGYA 1P9DU 4ANUA 3Q3JA 1WM3A 4YL8A 2NBWB 2LRWA 1RAXA 4WQOB 4HK2A 3ZVVA 2KJ6A 4DBGA 1V80A 4PYUA 4XZ4A 2K1FA 3S2AA 2G3QB 2GBKA 3QARA 3AU4A 3QWZB 2CHWA 1MG8A 1JRUA 4X57B 5D7GA 4DHJD 3DBRI 3JVZX 2MWSB 1KJTA 4W9HA 2UWQA 2CHXA 1V5TA 4ICVA 3ML9A 2MBHA 3DVNV 2L0FA 3BINA 2HE7A 3K9OB 4N9F4 2K8HA 2KDIA 1UZXB 3ML8A 4JL9A 4MJSA 2LVPA 3L08A 1V2YA 3TJPA 2J7QB 3C0RB 2XBBC 4LDTB 5AZHA 1LFDA 4GDKB 5G55A 4W9DA 3WIMA 3QA8A 4E3CA 3LDZE 3Q3FA 2O2VB 3ZUNA 4DWFA 1SGHA 2JRIB 3ZO5B 4MSMB 3PPAA 1OEYA 2PJHA 4IM0A 5IA7A 1M94A 2FNJB 4FLHA 3B1LX 4MSQB 3EFUA 3VDZA 3IFWB 5CTRC 2C60A 2NBVB 3PLUA 1OQYA 1A5RA 4W9FA 1K8RB 1T0YA 4AJYB 4LCDE 1Q0WB 3TBLD 3VXWA 2REXA 3RZWC 2DZIA 4IC7B 3DVGX 3NHEB 1RFAA 4IM3A 1E90A 1V81A 4J6IA 1Y8RC 2KO3A 3M95A 3H1UA 4FN2A 4K7WA 4NAWB 2JY6A 2RSUA 1YQBA 2MP2A 3B08A 5JZEB 3N3KB 3WA0A 2M8SA 2NR2A 3PRZA 3A9KB 3EECA 3H7PB 4NNJB 4NPNA 3V60A 3ZNGC 2MLBA 4GMVA 5TR5A 1WY8A 3IBEA 3MTNB 3UINB 2ZCBA 2N1VA 4TUUA 3ONSA 1V9JA 3PRMB 3DBHI 2D2QA 2RPQA 2M17A 4ZRIA 4GU2A 3KUCB 4MGYE 3N30A 3ZNID 3KH0A 1C3TA 1YX5B 3PV1A 3NS8A 2AL3A 2KLGA 3RUIB 3RZFA 2PPHA 3AULA 4I6NB 3TL5A 2MBOA 4G11A 2JT4B 4MJSB 2BPSA 3RYTA 2DHZA 5E6OA 3QIJA 2FCNA 1NI2A 4GDKA 4K7UA 3U7DA 5L95C 2K8CA 2M4NA 5DPSA 3X23A 2JPHA 3O65B 1GC6A 4W9CA 2L76A 2LXCA 4E74A 4NJ6A 4II3B 5LXIB 4DHJB 1WR6E 2AEHA 4TQ1A 3VUWA 2LASA 2CU1A 2ZPYA 3DDCB 4DHZB 2FCQA 4MEMA 3M3JA 3R7RA 2FCSA 4M8MA 4NQKE 2PE6B 3DCGA 2KD0A 3QK0A 2CKHB 3ZNHB 1I42A 4GN1A 4ZRJA 2AL6A 4AUQC 4DHZE 1HE8A 2MBQA 2G45B 3I3TB 1D3ZA 4FA6A 4IWQA 2GBMA 4B6WA 5JHAA 2DZKA 4GXBA 1UBIA 3WAOA 4F8CB 2B3AA 1GC7A 3DBSA 4RM8A 2WX1A 4GSWA 4ANXA 2MBBB 3ZTCA 2Z0EB 2MP2B 1XD3B 3KUZA 2C7NB 3ENEA 3QJZA 4FJYA 4PS8A 3H7PA 1WXVA 3QHTA 3ZKJC 3PTFC 4FHKA 3X0WA 4FADA 1VCBA 3UGBB 2IY1B 5D2MB 1RRBA 1OEYJ 2BYFA 2IBIB 1WX8A 4GDLA 2ASQA 2G4DB 1WZ3A 2LGDA 3L0WB 3VUYA 5LLIA 2NVUI 4XX5A 5DPTA 4WWOA 4EFOA 2KQSA 4HCNB 4FBJB 2EKEC 3IVFA 2LUEA 4EZKA 3L13A 5CHFA 1V86A 4IM2A 3DOWA 3KYDD 2CS4A 3PSEB 2C7MB 3EHVA 3R3MA 4JQWC 4A20A 2GMIC 2O6VD 1NBFC 2ZVOA 3CSFA 3TCAA 2JVCA 3ZNZB 3D32A 3APFA 4TQ0A 2NBUA 2PE9A 3M63B 2KQ7A 4MGIE 1NDDA 2PEAA 2BGFA 4P7IA 2IZVB 1R4NI 2K6QA 3WANA 2MCNB 1ISNA 2JWZA 1OTRB 3H7SA 3OAWA 2IO2B 1WGRA 3NZUA 4FHJA 3ZTDA 2M0XA 5D94A 4BBNF 3JSVA 1F9JA 2KDBA 1WMHA 3ZRCA 1TTNA 2BF8B 2KXJA 3N32A 1GG3A 1KM7A 2O6VA 3RT3B 1YJ1A 5JH5C 3QX1A 1GNUA 5G2NA 1E7UA 1YIWA 1OGWA 2K39A 4BKGA 2D11A 4TV3A 4LJOB 1WXAA 2DYMA 2NPTB 3T9LA 3B0AA 4OVUA 4EZJA 3KUDB 2W9NA 4W9GA 2Y5BB 3R66C 2MW5A 2L3ZA 2RGFA 1E5WA 2D07B 4DDGD 1GUAB 3K9PB 1LQBA 2BKFA 2A5UA 3PREA 1SIFA 2KJHB 2JZ3B 4HDOA 1ZGUB 4KVGB 1PQSA 1L7YA 1QZEA 2RD0A 3A9JB 1C1YB 2NS5A 3A33B 4KZ0A 4CYEA 4WWNA 3GZNI 2KTRB 1V5OA 4MDKE 4BKSD 1S3SG 1V6EA 3DQVA 2KDEB 3VH3B 2KC1A 2EMTA 3HIZA 4GDLB 3PHXB 5HKHA 4AJWA 3JYUA 2HTHA 2DYBA 1E7VA 3UIOB 5C23A 1LXDA 3QQ8B 4W9EA 5E6NA 1UH6A 4EKUA 2LWPA 4CO7A 3JW0X 2DZMA 2LVQA 4EZLA 5AZFA 3L54A 2K6DB 1TZ1A 3A4RA 4HPMB 2FIFA 2BWFA 2J0JA 3L10B 3L16A 3ZDTA 4NY0A 4BKSA 4F1SA 1H8CA 1J19A 2ZNVC 1EF5A 2IO0B 3H6NA 4LDTD 4WAAA 1U4AA 2D10A 2BKRB 2OOBB 4FULA 2ZEQA 2J0KA 2ZCCA 3V6EB 4BKTA 4JLCA 3ZRFA 5EDSA 5GMVA 2KOXA 3ECIA 4LJPB 1YX6B 5E6PA 2DYOA 3VTUA 4E71A 2IYDB 3VUXA 4WWPA 2YVCA 2MSED 5IAAC 2VRRB 4BVUC 2LZ6A 4EUTA 1J0GA 2N9EB 3JSVB 1WMHB 4K7SA 2R2QA 4GGQA 1WH3A 4KSKC 2O6VB 2KMAA 3HM6X 3IHPC 3HK0A 4F7ZA 3H9DA 2GBJA 1WE6A 2N7DA 2NPTA 3AI5A 3DPDA 1IPGA 3A4SC 1ZW7A 3P2BA 3VTVA 1RLFA 4I6LB 3VQIA 5CHVC 5J18A 4ZYNA 2DZJA 3MHSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRU A;  2G4S A;  2KJR A;  2KVR A;  3RCZ A;  4A3P A;  2LGY A;  2QHO A;  2Z0D B;  2CHZ A;  4W9I A;  4WJQ A;  5KHO A;  4AWJ A;  1UBQ A;  3A9J A;  2KFJ A;  1EF1 A;  1WZ0 A;  4BBN C;  3NZS A;  2N9P C;  2RR9 A;  2KTR A;  2R2O A;  1WXM A;  4IWO A;  2FCM A;  3UF8 A;  4KV2 A;  5AEK B;  2N9X A;  3PVL A;  3CMM B;  3V6C B;  3ZLZ A;  2KFK A;  4DDI D;  2C5L C;  2KC2 A;  2N1W A;  5CHW A;  1FXT B;  3WAL A;  2NCN A;  5FR6 A;  2IY0 B;  2DAJ A;  2ZZP B;  1L2N A;  1P98 A;  2ZVN A;  1WE7 A;  1G6J A;  3VH4 B;  4GOC A;  3HHM A;  2M1M A;  4NQL B;  3CF6 E;  1EUV B;  2KK8 A;  3ZIM A;  3APD A;  2L0T A;  4G3X B;  3PGE A;  4M0W B;  4OVV A;  4W9J A;  3VTW A;  5C1Z A;  4AOF A;  2N4F A;  4FJV B;  3RUL A;  2JUO A;  1VD2 A;  4HPL B;  2A4Z A;  3CST A;  3PZD A;  1WI0 A;  2AWT A;  3KYC D;  3PS6 A;  2Z59 B;  4AP4 C;  2LJ5 A;  2J0M A;  3ALB A;  1KLV A;  1WYW B;  2JF5 A;  5CX3 A;  4A3O A;  4KIK A;  4IWP A;  3DVN U;  4W9K A;  2KN5 A;  2KDF B;  2L05 A;  4IG7 B;  4G50 A;  1E8W A;  1XQQ A;  4ZDV A;  5LXH A;  2C9W B;  1E8Z A;  1IP9 A;  1WJ6 A;  2LD9 A;  3VVW B;  4HXD A;  4PYZ A;  4MH0 E;  4JIO U;  4NJ7 A;  4EEW A;  4URK A;  3OJ3 A;  3U30 A;  2K25 A;  2LGX A;  3R7Q A;  1Q1O A;  1WX9 A;  4CHK A;  1WGD A;  4WJN A;  4WJP A;  2I1K A;  5DPR A;  5D6J B;  5J2R A;  1CMX B;  4PS7 A;  1X1M A;  3OLM D;  2YLM A;  3UQB A;  3IG3 A;  1Q5W B;  2N7E A;  2WWZ A;  2KWU B;  4G0N B;  1BT0 A;  1P0R A;  1Z2M A;  4DK5 A;  2DEN B;  2KKC A;  2EMS A;  4K1R B;  2KAN A;  2KX0 A;  5BO4 B;  2XK5 A;  5AZG A;  2KZR A;  1WIA A;  2MQJ A;  4JGH B;  2BYE A;  1WJN A;  5DCN A;  3V62 A;  4DXA B;  2KFK B;  2L7R A;  1WXS A;  3W1S C;  3W1Y A;  4WJO A;  2BYV E;  2XEW A;  1WM2 A;  2V1Y A;  1GJZ A;  2UYZ B;  3SD5 A;  4ASW C;  3VFK A;  2ZPN A;  3LJ3 A;  5L83 A;  2K8B A;  4IUM B;  4HLE A;  3NOB A;  2FID A;  3PLV A;  1WGH A;  3V61 A;  3BY4 B;  3PRP B;  2HJ8 A;  4GIV A;  3NY5 A;  2KMC A;  2LVO A;  3UIP B;  3SDL C;  2L00 B;  3U8Z A;  2KX3 A;  1IYF A;  1TBE A;  3TIX A;  3ZW3 A;  3HM3 A;  3A1Q B;  1WGG A;  4M8N A;  3GOE A;  2KWV B;  1WF9 A;  2CR5 A;  2GOW A;  2KNB A;  2V4L A;  3KVF B;  3RD2 A;  2WX0 A;  4BOS C;  3DBL I;  2WYQ A;  4ANV A;  4EOY A;  3VAW A;  4B9K A;  3AXC A;  4KIK B;  1TGZ B;  2MX2 A;  4PS3 A;  2ZNV B;  4BOZ B;  4ANW A;  4KZC A;  3T8M A;  4MEL A;  3WAM A;  1XT9 B;  2KTF A;  2GBR A;  1EO6 A;  2MRP A;  3VHT C;  1UGM A;  1ZKH A;  2WDT B;  2DAF A;  1Z5S B;  3TMP B;  3L17 A;  4ZRK A;  4MGK E;  2KHW B;  3EC8 A;  2JZZ A;  3AU5 A;  4KSL C;  4FJZ A;  3QCA A;  2LI5 A;  2BWE S;  3UQA A;  3PHW B;  4ICU A;  4TKN A;  2O2V A;  3PT2 B;  2AYO B;  4HCP B;  4KDI C;  4I6P A;  5J17 A;  3MJW A;  2JRH A;  3WAP A;  1WFY A;  4W9L A;  3M62 B;  4GB9 A;  5DPW A;  2L8J A;  4MM3 A;  2MA9 B;  4HJK A;  2D3G A;  3SHQ A;  4B95 A;  1LM8 B;  1WJU A;  1P1A A;  4RM9 A;  2KLC A;  1UD7 A;  1WJ4 A;  3DVG Y;  1E8X A;  1H4R A;  4IW0 A;  2XK5 B;  3APC A;  3QC8 B;  3KW5 B;  1E8Y A;  2OJR A;  4HWI B;  2FAZ A;  3ZDM C;  2JXX A;  3QAQ A;  4XC2 A;  4II2 B;  1V49 A;  1SE9 A;  4KDL B;  1YD8 U;  1AAR A;  4BFR A;  5JHB A;  1S1Q B;  4HDQ A;  2FUH B;  2C7H A;  1KOT A;  2IO3 B;  4NAW A;  4HVB A;  3W1S A;  1I35 A;  1UEL A;  2V3S A;  2ZJD A;  3SU8 X;  5KHQ A;  4K81 A;  2IO1 B;  1WRD B;  2KWC A;  1P3Q U;  1J8C A;  3A9K A;  2MBE A;  2GBN A;  1R4M I;  4MGZ E;  2LXA A;  1WR1 A;  3OJ4 B;  4RMA A;  2HD5 B;  1WX7 A;  2DX5 B;  3A1Q A;  2I1J A;  1WGY A;  1P9D U;  4ANU A;  3Q3J A;  1WM3 A;  4YL8 A;  2NBW B;  2LRW A;  1RAX A;  4WQO B;  4HK2 A;  3ZVV A;  2KJ6 A;  4DBG A;  1V80 A;  4PYU A;  4XZ4 A;  2K1F A;  3S2A A;  2G3Q B;  2GBK A;  3QAR A;  3AU4 A;  3QWZ B;  2CHW A;  1MG8 A;  1JRU A;  4X57 B;  5D7G A;  4DHJ D;  3DBR I;  3JVZ X;  2MWS B;  1KJT A;  4W9H A;  2UWQ A;  2CHX A;  1V5T A;  4ICV A;  3ML9 A;  2MBH A;  3DVN V;  2L0F A;  3BIN A;  2HE7 A;  3K9O B;  4N9F 4;  2K8H A;  2KDI A;  1UZX B;  3ML8 A;  4JL9 A;  4MJS A;  2LVP A;  3L08 A;  1V2Y A;  3TJP A;  2J7Q B;  3C0R B;  2XBB C;  4LDT B;  5AZH A;  1LFD A;  4GDK B;  5G55 A;  4W9D A;  3WIM A;  3QA8 A;  4E3C A;  3LDZ E;  3Q3F A;  2O2V B;  3ZUN A;  4DWF A;  1SGH A;  2JRI B;  3ZO5 B;  4MSM B;  3PPA A;  1OEY A;  2PJH A;  4IM0 A;  5IA7 A;  1M94 A;  2FNJ B;  4FLH A;  3B1L X;  4MSQ B;  3EFU A;  3VDZ A;  3IFW B;  5CTR C;  2C60 A;  2NBV B;  3PLU A;  1OQY A;  1A5R A;  4W9F A;  1K8R B;  1T0Y A;  4AJY B;  4LCD E;  1Q0W B;  3TBL D;  3VXW A;  2REX A;  3RZW C;  2DZI A;  4IC7 B;  3DVG X;  3NHE B;  1RFA A;  4IM3 A;  1E90 A;  1V81 A;  4J6I A;  1Y8R C;  2KO3 A;  3M95 A;  3H1U A;  4FN2 A;  4K7W A;  4NAW B;  2JY6 A;  2RSU A;  1YQB A;  2MP2 A;  3B08 A;  5JZE B;  3N3K B;  3WA0 A;  2M8S A;  2NR2 A;  3PRZ A;  3A9K B;  3EEC A;  3H7P B;  4NNJ B;  4NPN A;  3V60 A;  3ZNG C;  2MLB A;  4GMV A;  5TR5 A;  1WY8 A;  3IBE A;  3MTN B;  3UIN B;  2ZCB A;  2N1V A;  4TUU A;  3ONS A;  1V9J A;  3PRM B;  3DBH I;  2D2Q A;  2RPQ A;  2M17 A;  4ZRI A;  4GU2 A;  3KUC B;  4MGY E;  3N30 A;  3ZNI D;  3KH0 A;  1C3T A;  1YX5 B;  3PV1 A;  3NS8 A;  2AL3 A;  2KLG A;  3RUI B;  3RZF A;  2PPH A;  3AUL A;  4I6N B;  3TL5 A;  2MBO A;  4G11 A;  2JT4 B;  4MJS B;  2BPS A;  3RYT A;  2DHZ A;  5E6O A;  3QIJ A;  2FCN A;  1NI2 A;  4GDK A;  4K7U A;  3U7D A;  5L95 C;  2K8C A;  2M4N A;  5DPS A;  3X23 A;  2JPH A;  3O65 B;  1GC6 A;  4W9C A;  2L76 A;  2LXC A;  4E74 A;  4NJ6 A;  4II3 B;  5LXI B;  4DHJ B;  1WR6 E;  2AEH A;  4TQ1 A;  3VUW A;  2LAS A;  2CU1 A;  2ZPY A;  3DDC B;  4DHZ B;  2FCQ A;  4MEM A;  3M3J A;  3R7R A;  2FCS A;  4M8M A;  4NQK E;  2PE6 B;  3DCG A;  2KD0 A;  3QK0 A;  2CKH B;  3ZNH B;  1I42 A;  4GN1 A;  4ZRJ A;  2AL6 A;  4AUQ C;  4DHZ E;  1HE8 A;  2MBQ A;  2G45 B;  3I3T B;  1D3Z A;  4FA6 A;  4IWQ A;  2GBM A;  4B6W A;  5JHA A;  2DZK A;  4GXB A;  1UBI A;  3WAO A;  4F8C B;  2B3A A;  1GC7 A;  3DBS A;  4RM8 A;  2WX1 A;  4GSW A;  4ANX A;  2MBB B;  3ZTC A;  2Z0E B;  2MP2 B;  1XD3 B;  3KUZ A;  2C7N B;  3ENE A;  3QJZ A;  4FJY A;  4PS8 A;  3H7P A;  1WXV A;  3QHT A;  3ZKJ C;  3PTF C;  4FHK A;  3X0W A;  4FAD A;  1VCB A;  3UGB B;  2IY1 B;  5D2M B;  1RRB A;  1OEY J;  2BYF A;  2IBI B;  1WX8 A;  4GDL A;  2ASQ A;  2G4D B;  1WZ3 A;  2LGD A;  3L0W B;  3VUY A;  5LLI A;  2NVU I;  4XX5 A;  5DPT A;  4WWO A;  4EFO A;  2KQS A;  4HCN B;  4FBJ B;  2EKE C;  3IVF A;  2LUE A;  4EZK A;  3L13 A;  5CHF A;  1V86 A;  4IM2 A;  3DOW A;  3KYD D;  2CS4 A;  3PSE B;  2C7M B;  3EHV A;  3R3M A;  4JQW C;  4A20 A;  2GMI C;  2O6V D;  1NBF C;  2ZVO A;  3CSF A;  3TCA A;  2JVC A;  3ZNZ B;  3D32 A;  3APF A;  4TQ0 A;  2NBU A;  2PE9 A;  3M63 B;  2KQ7 A;  4MGI E;  1NDD A;  2PEA A;  2BGF A;  4P7I A;  2IZV B;  1R4N I;  2K6Q A;  3WAN A;  2MCN B;  1ISN A;  2JWZ A;  1OTR B;  3H7S A;  3OAW A;  2IO2 B;  1WGR A;  3NZU A;  4FHJ A;  3ZTD A;  2M0X A;  5D94 A;  4BBN F;  3JSV A;  1F9J A;  2KDB A;  1WMH A;  3ZRC A;  1TTN A;  2BF8 B;  2KXJ A;  3N32 A;  1GG3 A;  1KM7 A;  2O6V A;  3RT3 B;  1YJ1 A;  5JH5 C;  3QX1 A;  1GNU A;  5G2N A;  1E7U A;  1YIW A;  1OGW A;  2K39 A;  4BKG A;  2D11 A;  4TV3 A;  4LJO B;  1WXA A;  2DYM A;  2NPT B;  3T9L A;  3B0A A;  4OVU A;  4EZJ A;  3KUD B;  2W9N A;  4W9G A;  2Y5B B;  3R66 C;  2MW5 A;  2L3Z A;  2RGF A;  1E5W A;  2D07 B;  4DDG D;  1GUA B;  3K9P B;  1LQB A;  2BKF A;  2A5U A;  3PRE A;  1SIF A;  2KJH B;  2JZ3 B;  4HDO A;  1ZGU B;  4KVG B;  1PQS A;  1L7Y A;  1QZE A;  2RD0 A;  3A9J B;  1C1Y B;  2NS5 A;  3A33 B;  4KZ0 A;  4CYE A;  4WWN A;  3GZN I;  2KTR B;  1V5O A;  4MDK E;  4BKS D;  1S3S G;  1V6E A;  3DQV A;  2KDE B;  3VH3 B;  2KC1 A;  2EMT A;  3HIZ A;  4GDL B;  3PHX B;  5HKH A;  4AJW A;  3JYU A;  2HTH A;  2DYB A;  1E7V A;  3UIO B;  5C23 A;  1LXD A;  3QQ8 B;  4W9E A;  5E6N A;  1UH6 A;  4EKU A;  2LWP A;  4CO7 A;  3JW0 X;  2DZM A;  2LVQ A;  4EZL A;  5AZF A;  3L54 A;  2K6D B;  1TZ1 A;  3A4R A;  4HPM B;  2FIF A;  2BWF A;  2J0J A;  3L10 B;  3L16 A;  3ZDT A;  4NY0 A;  4BKS A;  4F1S A;  1H8C A;  1J19 A;  2ZNV C;  1EF5 A;  2IO0 B;  3H6N A;  4LDT D;  4WAA A;  1U4A A;  2D10 A;  2BKR B;  2OOB B;  4FUL A;  2ZEQ A;  2J0K A;  2ZCC A;  3V6E B;  4BKT A;  4JLC A;  3ZRF A;  5EDS A;  5GMV A;  2KOX A;  3ECI A;  4LJP B;  1YX6 B;  5E6P A;  2DYO A;  3VTU A;  4E71 A;  2IYD B;  3VUX A;  4WWP A;  2YVC A;  2MSE D;  5IAA C;  2VRR B;  4BVU C;  2LZ6 A;  4EUT A;  1J0G A;  2N9E B;  3JSV B;  1WMH B;  4K7S A;  2R2Q A;  4GGQ A;  1WH3 A;  4KSK C;  2O6V B;  2KMA A;  3HM6 X;  3IHP C;  3HK0 A;  4F7Z A;  3H9D A;  2GBJ A;  1WE6 A;  2N7D A;  2NPT A;  3AI5 A;  3DPD A;  1IPG A;  3A4S C;  1ZW7 A;  3P2B A;  3VTV A;  1RLF A;  4I6L B;  3VQI A;  5CHV C;  5J18 A;  4ZYN A;  2DZJ A;  3MHS D; 
#chains in the Genus database with same CATH topology
 2BTE A;  4DXG A;  2KVR A;  4WJQ A;  1EF1 A;  3NZS A;  3UI3 A;  3UF8 A;  3ZJU A;  2FCM A;  3PVL A;  2YEP B;  1E0Z A;  5CHW A;  2WXR A;  1YMH E;  2IND C;  1DGJ A;  1JRO A;  3VH4 B;  2M1M A;  4UDU C;  1MFW A;  3APD A;  1XXG A;  4M0W B;  1FFU A;  4W9J A;  3HVZ A;  1XLP A;  2LJ5 A;  2J0M A;  2WXF A;  5BMG A;  2WXN A;  3BII D;  4P6V F;  3LXF A;  3LYY A;  3DVN U;  3Q8A A;  2KDF B;  3NS1 A;  1E8W A;  2WXM A;  1MPE A;  2LD9 A;  3U2S C;  3MC8 A;  4EEW A;  4URK A;  1NI3 A;  3TEW A;  3W2D A;  3NUH B;  4RF1 A;  1Q1O A;  2N9K A;  2I1K A;  1CMX B;  2WWZ A;  1BT0 A;  1SJH D;  2KKC A;  3AE7 B;  1SIJ A;  2XK5 A;  1TT5 B;  3AEE B;  1WIA A;  2MQJ A;  2INC C;  4DXA B;  4OZB A;  1J7C A;  4R3D A;  2BYV E;  1WM2 A;  1GJZ A;  1KH0 A;  4N58 A;  3LJ3 A;  5L83 A;  3Q2A C;  3BY4 B;  3N20 C;  4GIV A;  3UIP B;  3SDL C;  2L00 B;  3ZW3 A;  2WGS A;  2KT7 A;  1WF9 A;  2CR5 A;  2GOW A;  3RD2 A;  2WX0 A;  2WYQ A;  4PS3 A;  5AUI A;  2QIL A;  2MHJ A;  5IN7 A;  4MEL A;  3WAM A;  2LGS A;  1MHH E;  2MRP A;  1J7A A;  1Z5S B;  3L17 A;  4MGK E;  1VZ7 A;  1TKY A;  1BUI C;  4RH6 A;  3PHW B;  3Q3M C;  1AWD A;  4YTM B;  5DPW A;  3M62 B;  4MM3 A;  3SHQ A;  1XCT L;  1WJU A;  1EWC A;  1UD7 A;  2AX5 A;  3DVG Y;  2XK5 B;  1RYJ A;  2FAZ A;  3ZDM C;  4L2Y A;  4A9A A;  4RGT A;  1SE9 A;  1E10 A;  4BFR A;  1Q10 A;  1S1Q B;  1MI0 A;  1NVI D;  4O1N A;  2Y5C A;  4USA A;  3TUO A;  2V4I B;  4ZHP A;  1I35 A;  5G5G A;  1WRD B;  1WWT A;  1QKZ A;  3A9K A;  2GBN A;  2LXA A;  1WR1 A;  3OJ4 B;  4XYC A;  5G5H A;  3A1Q A;  1WGY A;  3Q3J A;  1SB3 C;  1ZOY B;  1C9F A;  3GE3 C;  5TSS A;  3W9C B;  3AU4 A;  1MG8 A;  4EOY A;  4X57 B;  5D7G A;  4W9H A;  2UWQ A;  3R2I A;  4ICV A;  2R61 A;  2MBH A;  3DVN V;  2HE7 A;  1WRI A;  4N9F 4;  2K8H A;  4JWS C;  1NEK B;  3L08 A;  2LGI A;  3C0R B;  5AZH A;  4LDT B;  4GDK B;  5G55 A;  4W9D A;  3ZYY X;  3RI7 C;  2JRI B;  2RPV A;  5IA7 A;  2V0G A;  4MM3 B;  3EFU A;  2C60 A;  1A5R A;  3B2F A;  2IPK D;  3VRA B;  2B76 B;  2LHE A;  4AJY B;  2D3C A;  1L0Y B;  3RZW C;  3DVG X;  4IM3 A;  2DBY A;  1V81 A;  3M95 A;  4FN2 A;  3OWE B;  2JY6 A;  3B08 A;  3RN9 C;  5JZE B;  1DOI A;  3N3K B;  2RMM A;  2K22 A;  3A9K B;  5FKA C;  3V60 A;  3ZNG C;  5E6J A;  3W5U B;  2KAJ A;  3DBH I;  4RF0 A;  3BVG A;  4US8 A;  2RPQ A;  4ZRI A;  3GE8 C;  3ZNI D;  1C3T A;  3PV1 A;  3RUI B;  4I6N B;  3AUL A;  4OZC A;  1ZUD 2;  1NEN B;  4YT0 B;  4GLS C;  2PVG C;  2LXC A;  3AE8 B;  3AH7 A;  4REZ A;  4NJ6 A;  3MHZ A;  3IT6 B;  3VUW A;  3VRB B;  3C8Y A;  2IGG A;  2M56 B;  3M3J A;  3R7R A;  4NQK E;  2PE6 B;  3DCG A;  3ZNH B;  3ZXV A;  4ZRJ A;  4RNA A;  2MBQ A;  1AN8 A;  2INN E;  4F8C B;  1NYQ A;  1FMA D;  1EM7 A;  2WX1 A;  2Z0E B;  2KWD A;  3H7P A;  2TSS A;  3X0W A;  2L32 A;  4XWW A;  2IGD A;  4LNI A;  1RRB A;  1DOX A;  1OEY J;  2BYF A;  1WX8 A;  1WZ3 A;  2FE8 A;  5LLI A;  2BS2 B;  2L1A A;  4DQO C;  2PTL A;  4EE2 A;  2LUE A;  3L13 A;  1F0Z A;  5IO9 A;  1PUT A;  3RNC C;  3PSE B;  5BYR A;  4JQW C;  3R3M A;  4QAY A;  1NBF C;  1DOY A;  2QIE B;  1E7P B;  3PO0 A;  2KQ7 A;  2BGF A;  3R2T A;  2LFI A;  1F77 A;  2MCN B;  4BAX A;  4LK0 M;  3OAW A;  2IGH A;  2IO2 B;  2YEP F;  2BBC A;  1FXI A;  1JWB D;  1TY0 A;  1WMH A;  3DWG C;  4A90 A;  3N32 A;  4LNK A;  1GNU A;  2NTT A;  1E9M A;  2K39 A;  3I63 C;  2DYM A;  4ZRP A;  2LUM A;  2JXT A;  2NPT B;  4EZJ A;  3BVZ A;  2W9N A;  3P4R B;  1STE A;  2MW5 A;  1JWA D;  3R8B A;  4DDG D;  3NVV A;  2HJ1 A;  2BKF A;  1SIF A;  2KJH B;  4MH8 A;  1L7Y A;  1QZE A;  2RD0 A;  1C1Y B;  1OFF A;  4DXF A;  2KTR B;  1KFY B;  4KX6 B;  4JX1 C;  2KDE B;  1N60 A;  3HIZ A;  3PHX B;  1YQ4 B;  4AJW A;  2ON8 A;  3MFG A;  5C23 A;  3JW0 X;  2L52 A;  2DZM A;  3C19 A;  1FM0 D;  3L4P A;  1D5Z C;  3L10 B;  2WXG A;  1J19 A;  3ZXR A;  4KKJ A;  4WAA A;  1U4A A;  4FUL A;  2ZEQ A;  4JLC A;  4LJP B;  3VTU A;  2DYO A;  4E71 A;  2IYD B;  3URY A;  2MSE D;  2JX5 A;  1J0G A;  1SJE D;  1WMH B;  4K7S A;  3BYY B;  5EE1 A;  3HM6 X;  3IHP C;  4YSZ B;  4XDC A;  1WE6 A;  2N7D A;  2L83 A;  3Q69 A;  1ZW7 A;  5CHV C;  4ZYN A;  2DZJ A;  3MHS D;  3ETR A;  2JYE A;  3RCZ A;  4ARI A;  2QHO A;  1T5X D;  1HZ5 A;  2CHZ A;  4AWJ A;  4C7Z A;  2KFJ A;  3I5J C;  1AW7 A;  1WZ0 A;  2ZW1 A;  2R2O A;  1WXM A;  5AEK B;  2H88 B;  4DDI D;  2C5L C;  2KC2 A;  3V3X A;  4TSS A;  1FXT B;  3WAL A;  2IY0 B;  5FR3 A;  1WE7 A;  1WGK A;  1V1O A;  4A6Q A;  3PGE A;  3VTW A;  5C1Z A;  3P4S B;  5C3J B;  4FJV B;  1K50 A;  4HPL B;  3CST A;  1WI0 A;  2AWT A;  3KYC D;  3PS6 A;  2WDR B;  1KLV A;  1WYW B;  3U4E G;  3AED B;  4W9K A;  4LNN A;  1XQQ A;  4ZDV A;  5LXH A;  3AE4 B;  1IP9 A;  2WS3 B;  1SE3 A;  3VVW B;  4HXD A;  4PYZ A;  4NJ7 A;  3OJ3 A;  2LGX A;  1WGD A;  4Q2J A;  1TS5 A;  2KDM A;  4HEA 1;  1FRD A;  1FNW A;  1Q5W B;  2KWU B;  3B9J A;  4DK5 A;  1Z2M A;  2DEN B;  2EMS A;  2WXO A;  3MP9 A;  5DCN A;  4XE0 A;  1WJN A;  4A55 A;  2IJ0 A;  4WJO A;  1JCK B;  3SD5 A;  1N61 A;  1PGB A;  3Q8B A;  2K8B A;  3NOB A;  2FID A;  3PLV A;  1WGH A;  3Q3N C;  4HPP A;  4XDD A;  3SEB A;  3V61 A;  3AE9 B;  4M0W A;  3PRP B;  3NY5 A;  3U8Z A;  2BS4 B;  4C7Y A;  2KNB A;  4BOS C;  2I38 A;  3VAW A;  3AXC A;  2MX2 A;  3AB5 A;  1XT9 B;  2GBR A;  2WDT B;  1T0R C;  4ACF A;  2KHW B;  3EC8 A;  2JZZ A;  3UQA A;  2LI5 A;  2WLB A;  4ICU A;  4TKN A;  3EGR A;  1HEZ E;  5IP4 D;  3WAP A;  1WFY A;  4GB9 A;  2MA9 B;  4WWM A;  4B95 A;  1TKE A;  1LM8 B;  4RM9 A;  1E8X A;  4IW0 A;  2PLP A;  3APC A;  2OJR A;  2JXX A;  2AQ3 B;  4II2 B;  4HDQ A;  1RM6 C;  4NAW A;  2JQR B;  5BYS A;  2ZJD A;  1J8C A;  3AV8 A;  2MBE A;  3AE3 B;  1ZDX A;  1XCQ L;  2HD5 B;  1ZDV A;  1ET9 A;  1P9D U;  4ANU A;  2W54 A;  2NBW B;  1RAX A;  3ZVV A;  4DBG A;  4XZ4 A;  1MJD A;  4PYU A;  1ZP0 B;  2CHW A;  3P4Q B;  4MAC A;  2CHX A;  3W5V B;  1V5T A;  2L0F A;  4K3C A;  2KDI A;  4KGT A;  3ZJV A;  4JL9 A;  2ACZ B;  4MJS A;  4C00 A;  3FIL A;  2LVP A;  4P1B C;  3AM9 A;  1LFD A;  4E3C A;  4DWF A;  3ZO5 B;  2GI9 A;  4WAF A;  3PPA A;  4IM0 A;  4US9 A;  4MSQ B;  3AE6 B;  3CWI A;  2INP E;  1IUE A;  1QOA A;  3E56 A;  4NJC A;  4LCD E;  3FAH A;  3VXW A;  1Y8R C;  3H1U A;  2J42 A;  4NAW B;  1C4C A;  2RDB C;  2OED A;  4OVZ A;  3U7Z A;  3PRZ A;  3EEC A;  4NNJ B;  4NPN A;  4C80 A;  4YWG G;  1BML C;  5TR5 A;  1WY8 A;  3RNE C;  1I4G A;  3N1Y C;  3UIN B;  2ZCB A;  4NZL B;  2N1V A;  1IBX B;  4M00 A;  2H89 B;  4ZRQ A;  2D2Q A;  4GU2 A;  3KUC B;  4MGY E;  3KH0 A;  2MJD A;  3NS8 A;  1YJJ A;  2KLG A;  3RZF A;  5H92 C;  2MEK A;  3TL5 A;  3GP7 A;  4YXD B;  4LNO A;  2JZP A;  1MHX A;  3GB1 A;  3Q14 C;  4MJS B;  3FIL B;  2DHZ A;  2FCN A;  2XN9 C;  4GDK A;  4K7U A;  3U7D A;  3X23 A;  1L0V B;  4WH4 A;  2JPH A;  1JQ4 A;  1GC6 A;  4II3 B;  1WR6 E;  2AEH A;  1FNU A;  2LAS A;  3FC4 A;  1L4Z B;  4DHZ B;  2FCS A;  2NMQ A;  4M8M A;  1I42 A;  4GN1 A;  3I3T B;  1D3Z A;  4FA6 A;  2E6X A;  4IWQ A;  2GBM A;  2BS3 B;  4RGN A;  4C56 C;  2DZK A;  4GXB A;  2B3A A;  1GC7 A;  3DBS A;  2MBB B;  3OG5 A;  1AYF A;  1WXV A;  4HRO A;  3PTF C;  2W82 A;  1YN5 A;  2GLS A;  1D6E C;  3UGB B;  2IY1 B;  1JML A;  2IBI B;  3AEC B;  4GDL A;  2G4D B;  5DPT A;  4FBJ B;  3IVF A;  1CQV A;  2QMT A;  1R7S A;  2JSV X;  1SEB D;  2C7M B;  4LTU A;  2MJE A;  1KLG D;  3CSF A;  3TCA A;  4TQ0 A;  3NZ3 A;  4MGI E;  1NDD A;  4N59 A;  2K6Q A;  2JWZ A;  3NZU A;  4FHJ A;  3ZTD A;  1QOF A;  5D94 A;  1UWM A;  3JSV A;  3FKY A;  3ZRC A;  1TTN A;  2BF8 B;  3RNF C;  2KXJ A;  2D3B A;  5JH5 C;  3QX1 A;  1YIW A;  4BKG A;  4TV3 A;  4WUR A;  1FCC C;  4OVU A;  3T3N A;  3KUD B;  2L3Z A;  2RGF A;  2J53 A;  1I7H A;  2D07 B;  1GUA B;  3K9P B;  3TEX A;  2WXL A;  1KLU D;  2A5U A;  3PRE A;  4HDO A;  2Y3A A;  1C78 A;  1PQS A;  1PGX A;  3A9J B;  4KVG B;  1HTO A;  2NS5 A;  3ZQ4 A;  4KZ0 A;  1YN4 A;  4BKS D;  3BK1 A;  4PT5 A;  1TS4 A;  1D5M C;  1B9R A;  2XNA C;  4OW0 A;  1FRR A;  2EMT A;  4GDL B;  1E6E B;  1C76 A;  1XLQ A;  2W3R A;  3JYU A;  2DYB A;  3UIO B;  1EU4 A;  3E9S A;  1LXD A;  1M4V A;  4EZL A;  5AZF A;  4E74 A;  4HPM B;  3A4R A;  2BWF A;  5AUK A;  1A70 A;  2AQ2 B;  4NY0 A;  4BKS A;  4F1S A;  1H8C A;  2ZNV C;  1EF5 A;  1QOG A;  4BKT A;  1WXQ A;  1JRP A;  5GMV A;  2KOX A;  2Q5W D;  2YVC A;  2NTS A;  5IAA C;  2N9E B;  3JSV B;  4ZHO A;  1TY2 A;  2R2Q A;  4IKG A;  3V05 A;  4KSK C;  3ABV B;  2N7J A;  4F7Z A;  2NPT A;  4I6L B;  3VQI A;  2LRU A;  2KJR A;  4A3P A;  1D4B A;  1HQR D;  2J52 A;  2Z0D B;  3BZD B;  1UBQ A;  2KTR A;  4IWO A;  4KV2 A;  2N9X A;  3CMM B;  1P7E A;  3ZLZ A;  1C77 A;  4D2K A;  2N1W A;  4S17 A;  3KWL A;  1L2N A;  1ZPS A;  1P98 A;  1I4P A;  3RMK C;  2BB6 A;  2QEJ C;  1UGJ A;  4NQL B;  2KK8 A;  2L0T A;  4OVV A;  3RUL A;  1HZ6 A;  3PZD A;  1YNT E;  3ALB A;  2HTM E;  2JF5 A;  5CX3 A;  4AS1 A;  2KN5 A;  4JPS A;  3RFZ B;  1E8Z A;  2VH2 A;  1WJ6 A;  3NJT A;  4JIO U;  2K25 A;  5EE0 A;  2OHF A;  4OZA A;  1FPY A;  4CHK A;  2K0P A;  2M19 A;  5D6J B;  5J2R A;  4PS7 A;  1X1M A;  3UQB A;  3HVD A;  4G0N B;  1P0R A;  1KTK A;  3IXS A;  2KX0 A;  5AZG A;  2KZR A;  1VZ6 A;  3V62 A;  2L7R A;  1WXS A;  3W1S C;  3W1Y A;  2WXK A;  2V1Y A;  4ASW C;  4PK1 A;  4HLE A;  3TEY A;  1N62 A;  3KLS X;  1YN3 A;  5JXV A;  1ZE3 D;  4C4V B;  2KX3 A;  1XLN A;  1WGG A;  2V4L A;  1JAL A;  3KVF B;  4JE3 B;  4ANV A;  4B9K A;  4ANW A;  2LHD A;  1K53 A;  3T8M A;  3AEF B;  5BMI A;  2KTF A;  1EO6 A;  3VHT C;  2DAF A;  2WP9 B;  1VZ8 A;  3WCQ A;  4ZRK A;  2BB5 A;  2FBW B;  3KWV A;  3AEG B;  4YTP B;  1F2R C;  3EFC A;  3PT2 B;  2AYO B;  4KDI C;  4I6P A;  5J17 A;  1JWS D;  3MJW A;  1QLB B;  4W9L A;  1WYG A;  2L8J A;  1YJI A;  1TYG B;  3SFD B;  5BYQ A;  4XC2 A;  2PMV A;  4KDL B;  5JHB A;  3Q8F A;  3KQ4 A;  2FUH B;  1KOT A;  4HVB A;  1UEL A;  2V3S A;  3SU8 X;  4K81 A;  4P16 A;  4FXC A;  4WIP A;  2KWC A;  1R4M I;  4MGZ E;  1WX7 A;  2I1J A;  1FFV A;  1WM3 A;  1T0Q C;  4YL8 A;  1F1H A;  1N63 A;  1V80 A;  4HRS A;  3SR6 A;  1L6V A;  2K1F A;  2G3Q B;  2WNM A;  2GBK A;  1P7F A;  3QWZ B;  1JRU A;  1L5P A;  3DBR I;  4L1B A;  2EKI A;  3ML9 A;  2JU6 X;  2BT6 A;  1N5X A;  4JWU C;  3TJP A;  2XBB C;  3QA8 A;  3LDZ E;  4OHJ A;  3Q3F A;  3ZUN A;  2WDV B;  2PJH A;  3P42 A;  1M94 A;  2FNJ B;  1CK1 A;  2IDY A;  1QOB A;  3IFW B;  5CTR C;  3PLU A;  4KKI A;  4W9F A;  1K8R B;  1HXY D;  3TBL D;  2REX A;  4IC7 B;  3Q8C A;  1OQR A;  3NHE B;  1I4H A;  1RFA A;  3N9Y C;  2KO3 A;  2K3U A;  4K7W A;  1SSN A;  1YQB A;  2MH7 A;  1I4Q A;  1GOZ A;  3N1Z C;  4GMV A;  5IOI A;  3IBE A;  2VH1 A;  3NVW A;  3MTN B;  1DYQ A;  2X38 A;  4TUU A;  3ONS A;  3PRM B;  2M17 A;  2GRI A;  2K9X A;  3N30 A;  4ITK A;  1YX5 B;  2AL3 A;  4L23 A;  2MBO A;  1K51 A;  1NI2 A;  2JYT A;  1BXT A;  3NVZ A;  1RWS A;  4ZYS A;  2CJN A;  4TQ1 A;  4RGM A;  2CU1 A;  4MEM A;  3DHH C;  2QDF A;  3QK0 A;  4DHZ E;  2AL6 A;  2AQ1 B;  2G45 B;  3VR9 B;  4B6W A;  2UU7 A;  3Q6B A;  4IOI E;  4RM8 A;  4ANX A;  5H8Y E;  1XD3 B;  1WSP A;  3KUZ A;  3ENE A;  4FJY A;  2SAK A;  3QHT A;  4FHK A;  1V8C A;  1ZXH A;  4B0E A;  1VCB A;  1FNV A;  1T6B X;  2WU5 B;  4MT5 A;  1IBX A;  2ASQ A;  3VUY A;  1SF0 A;  3AE5 B;  2NVU I;  2KQS A;  2EKE C;  3J9C A;  4EZK A;  1IGC A;  5CHF A;  4IM2 A;  2LMC A;  3KYD D;  3EHV A;  5HI1 A;  4A20 A;  2BQQ A;  2ZVO A;  1R4M B;  5EE9 A;  1FXA A;  2JVC A;  3ZNZ B;  3CIR B;  2NBU A;  2PE9 A;  2Z8L A;  1N5W A;  2W55 A;  4P7I A;  2IZV B;  3WAN A;  3H7S A;  1WGR A;  2BYT A;  3DBR B;  1UWX A;  1GG3 A;  2J4X A;  2BVC A;  1E7U A;  1OGW A;  1TJE A;  4H2A A;  2D11 A;  4LJO B;  1WXA A;  3T9L A;  3LB8 C;  2PKO A;  3SFE B;  1R4N B;  1E5W A;  2KMM A;  1T0S C;  1VRA B;  1JW9 D;  1LQB A;  4HKZ E;  4M02 A;  1ZGU B;  2ONQ A;  4CYE A;  3IAS 1;  4WWN A;  3GZN I;  1V5O A;  3ZJT A;  3HRD D;  1S3S G;  3DQV A;  3VH3 B;  1FEH A;  1MG4 A;  2KAC A;  3H8H A;  1QQR A;  4EKU A;  1UH6 A;  1JWM D;  1QIL A;  3AE2 B;  3L54 A;  1TZ1 A;  3ZDT A;  3EUB 2;  3AN1 A;  2QSD A;  2QJL A;  2IO0 B;  4LDT D;  1SXT A;  1RFK A;  2OOB B;  2D10 A;  1VR9 A;  2J0K A;  3V6E B;  5EDS A;  4HJG E;  1VLB A;  2ICI A;  3VR8 B;  3VUX A;  4WWP A;  2VRR B;  4BVU C;  1KRH A;  1CZP A;  5IKC M;  2D5G A;  1WH3 A;  3AEB B;  3HK0 A;  5HG2 A;  4LNF A;  1ESF A;  1VJK A;  1V1P A;  1V97 A;  3PZ7 A;  3A4S C;  1RLF A;  4TMA B;  5E6P A;  5BMH A;  2G4S A;  1HA5 A;  2LGY A;  4S0R A;  4W9I A;  5KHO A;  3A9J A;  4BBN C;  2SEB D;  2N9P C;  2RR9 A;  1XF5 L;  2WXJ A;  3V6C B;  2KFK A;  2OJW A;  1FIQ A;  2NCN A;  5FR6 A;  2DAJ A;  2ZZP B;  1SE2 A;  2ZVN A;  1G6J A;  3AE1 B;  1VDV A;  4GOC A;  1C4A A;  3HHM A;  2K5P A;  1LO5 D;  3CF6 E;  1EUV B;  3ZIM A;  2WHI A;  2QC8 A;  4G3X B;  5GXG B;  4AOF A;  1UF0 A;  3T3O A;  2N4F A;  2JUO A;  1VD2 A;  2A4Z A;  5HHD G;  2Z59 B;  3BVM A;  3P63 A;  4AP4 C;  3IT4 B;  4A3O A;  4KIK A;  4IWP A;  2HDE A;  2L05 A;  2JWU A;  4IG7 B;  4G50 A;  2WXH A;  4N6E B;  2C9W B;  2N9L A;  4MH0 E;  1EWY C;  3U30 A;  3R7Q A;  2ZW0 A;  1Y56 A;  1L6U A;  1T3Q A;  1WX9 A;  4WJN A;  1V1P B;  2V3P A;  4WJP A;  5DPR A;  4B0M A;  1XEE A;  3OLM D;  2YLM A;  3GS2 A;  1FD6 A;  3IG3 A;  2N7E A;  4K1R B;  1GB1 A;  2KAN A;  5BO4 B;  3DWM A;  4BZA A;  4JGH B;  2BYE A;  1D5X C;  2KFK B;  2XEW A;  1OQQ A;  2UYZ B;  1C79 A;  2KN4 A;  3VFK A;  2ZPN A;  4IUM B;  2DNF A;  2M0A A;  2GB1 A;  2HJ8 A;  1TIF A;  2KMC A;  2LVO A;  1IYF A;  1C4P A;  1TBE A;  3TIX A;  3HM3 A;  3A1Q B;  4M8N A;  3GOE A;  1ET6 A;  2KWV B;  3GZN B;  1TZO A;  4HKQ A;  3DBL I;  3MC9 A;  2WXQ A;  3PZ8 A;  2DLB A;  4KIK B;  1TGZ B;  3NVY A;  2LJI A;  2D3A A;  2ZNV B;  5EE3 A;  4BOZ B;  1F2R I;  4KZC A;  1YOV B;  4P1C C;  2EEL A;  1UGM A;  1ZKH A;  3TMP B;  2V3N A;  3AU5 A;  4KSL C;  4FJZ A;  3QCA A;  2BWE S;  1L4D B;  2O2V A;  4HCP B;  2KYW A;  2MJ3 A;  2JRH A;  4IDI A;  4HJK A;  2D3G A;  1I4R A;  1P1A A;  2KLC A;  1WJ4 A;  1H4R A;  3QC8 B;  3AEA B;  1E8Y A;  3KW5 B;  4HWI B;  3QAQ A;  2X8X X;  1V49 A;  1YD8 U;  1AAR A;  2N0S B;  4M01 A;  2C7H A;  2IO3 B;  5D3D A;  1UUP A;  3W1S A;  5KHQ A;  2IO1 B;  1P3Q U;  1K52 A;  4C4V A;  1KF6 B;  4RMA A;  2DX5 B;  2PVO D;  2WQY B;  3RNB C;  2LRW A;  4WQO B;  4HK2 A;  2KJ6 A;  3S2A A;  3IAM 1;  3QAR A;  3AMZ A;  4DHJ D;  3JVZ X;  2MWS B;  1KJT A;  3BIN A;  2W3S A;  3K9O B;  1LGR A;  1UZX B;  3ML8 A;  2WU2 B;  1ACC A;  1EU3 A;  1V2Y A;  2J7Q B;  4KGS A;  3WIM A;  2I2Y A;  2O2V B;  2VZK D;  1SGH A;  4MSM B;  1OEY A;  4FLH A;  3B1L X;  3VDZ A;  1PDX A;  2NBV B;  1OQY A;  3P1M A;  1T0Y A;  1MVK A;  1Q0W B;  3RPF C;  3MC0 B;  1YQ3 B;  2DZI A;  2CU3 A;  1TKG A;  1SBB B;  1E90 A;  1XO3 A;  4J6I A;  4RCO A;  2RSU A;  2MP2 A;  3WA0 A;  2M8S A;  2NR2 A;  3H7P B;  1PYW D;  2MLB A;  2PW9 A;  1V9J A;  3BYT B;  2PPH A;  1PFD A;  3I57 A;  3NRZ A;  4G11 A;  2JT4 B;  5T8I A;  2BPS A;  3RYT A;  5E6O A;  1PGA A;  3QIJ A;  5L95 C;  2K8C A;  2M4N A;  5DPS A;  1TS3 A;  3DBL B;  3O65 B;  4W9C A;  2L76 A;  2WDQ B;  1QT9 A;  4YSY B;  3DBH B;  5D3I B;  1TS2 A;  5LXI B;  4DHJ B;  1FCL A;  1CJE A;  3TEZ A;  2ZPY A;  3DDC B;  2FCQ A;  1I4X A;  4ARC A;  3EA6 A;  2KD0 A;  2CKH B;  2WXP A;  4AUQ C;  1HE8 A;  2Y5P A;  5JHA A;  1UBI A;  3WAO A;  3P4P B;  4GSW A;  3ZTC A;  2VZK B;  2MP2 B;  2C7N B;  3QJZ A;  1ZXI A;  2G9H D;  4PS8 A;  2KQ4 X;  4ZOH C;  5HFY A;  3ZKJ C;  3RNA C;  4FAD A;  2QCZ A;  2LEK A;  1NYR A;  3HUI A;  5D2M B;  1JWU D;  4K3B A;  2LGD A;  3L0W B;  4XX5 A;  1SE4 A;  4WWO A;  4EFO A;  3NG0 A;  4HCN B;  3Q3O C;  1V86 A;  5C2T B;  2CJO A;  3DOW A;  4YSX B;  2CS4 A;  3Q8E A;  4LLG M;  4YTN B;  2GMI C;  2O6V D;  1B1Z A;  2RDG A;  2V9H A;  4RGO S;  4J3O D;  4NAM A;  3U52 E;  3D32 A;  3APF A;  3M63 B;  2PEA A;  3B2G A;  1J7B A;  1R4N I;  1ISN A;  1OTR B;  1FO4 A;  2M0X A;  3RNG C;  2PIA A;  4BBN F;  1F9J A;  2KDB A;  4XWT A;  1KM7 A;  2O6V A;  3RT3 B;  1YJ1 A;  1L0X B;  3DHG C;  5LNK 1;  3I9V 1;  5G2N A;  5I4D A;  3O13 A;  3B0A A;  4KGR A;  2FUG 1;  4W9G A;  2Y5B B;  3R66 C;  2E3T A;  4XGA B;  2JZ3 B;  1GAQ B;  4WQM A;  3A33 B;  4MDK E;  1IGD A;  1QF6 A;  2DWQ A;  1V6E A;  1ROE A;  1ENF A;  2KC1 A;  4RFB A;  5HKH A;  3TSS A;  2RDH A;  2HTH A;  1E7V A;  1F52 A;  3QQ8 B;  4W9E A;  5E6N A;  2LWP A;  2BW2 A;  4CO7 A;  2LVQ A;  1N6Z A;  2K6D B;  2KVZ A;  1UNS A;  2FIF A;  2J0J A;  3L16 A;  1GPX A;  3H6N A;  3BWU D;  2BKR B;  1XLO A;  1GB4 A;  2ZCC A;  3DHI C;  5MPO A;  2G1E A;  3ZRF A;  3ECI A;  1YX6 B;  5FK9 C;  2WXI A;  3N1X C;  2LZ6 A;  4EUT A;  1HTQ A;  4GGQ A;  2O6V B;  3ZGZ A;  2KMA A;  3BK2 A;  3H9D A;  4CQN A;  2GBJ A;  3AI5 A;  4A8X C;  3DPD A;  1IPG A;  3P2B A;  3VTV A;  4AQ7 A;  5J18 A;  3MJ5 A; 
#chains in the Genus database with same CATH homology
 2LRU A;  2G4S A;  2KJR A;  2KVR A;  3RCZ A;  4A3P A;  2LGY A;  2QHO A;  2Z0D B;  2CHZ A;  4W9I A;  4WJQ A;  5KHO A;  4AWJ A;  1UBQ A;  3A9J A;  2KFJ A;  1EF1 A;  1WZ0 A;  4BBN C;  3NZS A;  2N9P C;  2RR9 A;  2KTR A;  2R2O A;  1WXM A;  4IWO A;  2FCM A;  3UF8 A;  4KV2 A;  5AEK B;  2N9X A;  3PVL A;  3CMM B;  3V6C B;  3ZLZ A;  2KFK A;  4DDI D;  2C5L C;  2KC2 A;  2N1W A;  5CHW A;  1FXT B;  3WAL A;  2NCN A;  5FR6 A;  2IY0 B;  2DAJ A;  2ZZP B;  1L2N A;  1P98 A;  2ZVN A;  1WE7 A;  1G6J A;  3VH4 B;  4GOC A;  3HHM A;  2M1M A;  4NQL B;  3CF6 E;  1EUV B;  2KK8 A;  3ZIM A;  3APD A;  2L0T A;  4G3X B;  3PGE A;  4M0W B;  4OVV A;  4W9J A;  3VTW A;  5C1Z A;  4AOF A;  2N4F A;  4FJV B;  3RUL A;  2JUO A;  1VD2 A;  4HPL B;  2A4Z A;  3CST A;  3PZD A;  1WI0 A;  2AWT A;  3KYC D;  3PS6 A;  2Z59 B;  4AP4 C;  2LJ5 A;  2J0M A;  3ALB A;  1KLV A;  1WYW B;  2JF5 A;  5CX3 A;  4A3O A;  4KIK A;  4IWP A;  3DVN U;  4W9K A;  2KN5 A;  2KDF B;  2L05 A;  4IG7 B;  4G50 A;  1E8W A;  1XQQ A;  4ZDV A;  5LXH A;  2C9W B;  1E8Z A;  1IP9 A;  1WJ6 A;  2LD9 A;  3VVW B;  4HXD A;  4PYZ A;  4MH0 E;  4JIO U;  4NJ7 A;  4EEW A;  4URK A;  3OJ3 A;  3U30 A;  2K25 A;  2LGX A;  3R7Q A;  1Q1O A;  1WX9 A;  4CHK A;  1WGD A;  4WJN A;  4WJP A;  2I1K A;  5DPR A;  5D6J B;  5J2R A;  1CMX B;  4PS7 A;  1X1M A;  3OLM D;  2YLM A;  3UQB A;  3IG3 A;  1Q5W B;  2N7E A;  2WWZ A;  2KWU B;  4G0N B;  1BT0 A;  1P0R A;  1Z2M A;  4DK5 A;  2DEN B;  2KKC A;  2EMS A;  4K1R B;  2KAN A;  2KX0 A;  5BO4 B;  2XK5 A;  5AZG A;  2KZR A;  1WIA A;  2MQJ A;  4JGH B;  2BYE A;  1WJN A;  5DCN A;  3V62 A;  4DXA B;  2KFK B;  2L7R A;  1WXS A;  3W1S C;  3W1Y A;  4WJO A;  2BYV E;  2XEW A;  1WM2 A;  2V1Y A;  1GJZ A;  2UYZ B;  3SD5 A;  4ASW C;  3VFK A;  2ZPN A;  3LJ3 A;  5L83 A;  2K8B A;  4IUM B;  4HLE A;  3NOB A;  2FID A;  3PLV A;  1WGH A;  3V61 A;  3BY4 B;  3PRP B;  2HJ8 A;  4GIV A;  3NY5 A;  2KMC A;  2LVO A;  3UIP B;  3SDL C;  2L00 B;  3U8Z A;  2KX3 A;  1IYF A;  1TBE A;  3TIX A;  3ZW3 A;  3HM3 A;  3A1Q B;  1WGG A;  4M8N A;  3GOE A;  2KWV B;  1WF9 A;  2CR5 A;  2GOW A;  2KNB A;  2V4L A;  3KVF B;  3RD2 A;  2WX0 A;  4BOS C;  3DBL I;  2WYQ A;  4ANV A;  4EOY A;  3VAW A;  4B9K A;  3AXC A;  4KIK B;  1TGZ B;  2MX2 A;  4PS3 A;  2ZNV B;  4BOZ B;  4ANW A;  4KZC A;  3T8M A;  4MEL A;  3WAM A;  1XT9 B;  2KTF A;  2GBR A;  1EO6 A;  2MRP A;  3VHT C;  1UGM A;  1ZKH A;  2WDT B;  2DAF A;  1Z5S B;  3TMP B;  3L17 A;  4ZRK A;  4MGK E;  2KHW B;  3EC8 A;  2JZZ A;  3AU5 A;  4KSL C;  4FJZ A;  3QCA A;  2LI5 A;  2BWE S;  3UQA A;  3PHW B;  4ICU A;  4TKN A;  2O2V A;  3PT2 B;  2AYO B;  4HCP B;  4KDI C;  4I6P A;  5J17 A;  3MJW A;  2JRH A;  3WAP A;  1WFY A;  4W9L A;  3M62 B;  4GB9 A;  5DPW A;  2L8J A;  4MM3 A;  2MA9 B;  4HJK A;  2D3G A;  3SHQ A;  4B95 A;  1LM8 B;  1WJU A;  1P1A A;  4RM9 A;  2KLC A;  1UD7 A;  1WJ4 A;  3DVG Y;  1E8X A;  1H4R A;  4IW0 A;  2XK5 B;  3APC A;  3QC8 B;  3KW5 B;  1E8Y A;  2OJR A;  4HWI B;  2FAZ A;  3ZDM C;  2JXX A;  3QAQ A;  4XC2 A;  4II2 B;  1V49 A;  1SE9 A;  4KDL B;  1YD8 U;  1AAR A;  4BFR A;  5JHB A;  1S1Q B;  4HDQ A;  2FUH B;  2C7H A;  1KOT A;  2IO3 B;  4NAW A;  4HVB A;  3W1S A;  1I35 A;  1UEL A;  2V3S A;  2ZJD A;  3SU8 X;  5KHQ A;  4K81 A;  2IO1 B;  1WRD B;  2KWC A;  1P3Q U;  1J8C A;  3A9K A;  2MBE A;  2GBN A;  1R4M I;  4MGZ E;  2LXA A;  1WR1 A;  3OJ4 B;  4RMA A;  2HD5 B;  1WX7 A;  2DX5 B;  3A1Q A;  2I1J A;  1WGY A;  1P9D U;  4ANU A;  3Q3J A;  1WM3 A;  4YL8 A;  2NBW B;  2LRW A;  1RAX A;  4WQO B;  4HK2 A;  3ZVV A;  2KJ6 A;  4DBG A;  1V80 A;  4PYU A;  4XZ4 A;  2K1F A;  3S2A A;  2G3Q B;  2GBK A;  3QAR A;  3AU4 A;  3QWZ B;  2CHW A;  1MG8 A;  1JRU A;  4X57 B;  5D7G A;  4DHJ D;  3DBR I;  3JVZ X;  2MWS B;  1KJT A;  4W9H A;  2UWQ A;  2CHX A;  1V5T A;  4ICV A;  3ML9 A;  2MBH A;  3DVN V;  2L0F A;  3BIN A;  2HE7 A;  3K9O B;  4N9F 4;  2K8H A;  2KDI A;  1UZX B;  3ML8 A;  4JL9 A;  4MJS A;  2LVP A;  3L08 A;  1V2Y A;  3TJP A;  2J7Q B;  3C0R B;  2XBB C;  4LDT B;  5AZH A;  1LFD A;  4GDK B;  5G55 A;  4W9D A;  3WIM A;  3QA8 A;  4E3C A;  3LDZ E;  3Q3F A;  2O2V B;  3ZUN A;  4DWF A;  1SGH A;  2JRI B;  3ZO5 B;  4MSM B;  3PPA A;  1OEY A;  2PJH A;  4IM0 A;  5IA7 A;  1M94 A;  2FNJ B;  4FLH A;  3B1L X;  4MSQ B;  3EFU A;  3VDZ A;  3IFW B;  5CTR C;  2C60 A;  2NBV B;  3PLU A;  1OQY A;  1A5R A;  4W9F A;  1K8R B;  1T0Y A;  4AJY B;  4LCD E;  1Q0W B;  3TBL D;  3VXW A;  2REX A;  3RZW C;  2DZI A;  4IC7 B;  3DVG X;  3NHE B;  1RFA A;  4IM3 A;  1E90 A;  1V81 A;  4J6I A;  1Y8R C;  2KO3 A;  3M95 A;  3H1U A;  4FN2 A;  4K7W A;  4NAW B;  2JY6 A;  2RSU A;  1YQB A;  2MP2 A;  3B08 A;  5JZE B;  3N3K B;  3WA0 A;  2M8S A;  2NR2 A;  3PRZ A;  3A9K B;  3EEC A;  3H7P B;  4NNJ B;  4NPN A;  3V60 A;  3ZNG C;  2MLB A;  4GMV A;  5TR5 A;  1WY8 A;  3IBE A;  3MTN B;  3UIN B;  2ZCB A;  2N1V A;  4TUU A;  3ONS A;  1V9J A;  3PRM B;  3DBH I;  2D2Q A;  2RPQ A;  2M17 A;  4ZRI A;  4GU2 A;  3KUC B;  4MGY E;  3N30 A;  3ZNI D;  3KH0 A;  1C3T A;  1YX5 B;  3PV1 A;  3NS8 A;  2AL3 A;  2KLG A;  3RUI B;  3RZF A;  2PPH A;  3AUL A;  4I6N B;  3TL5 A;  2MBO A;  4G11 A;  2JT4 B;  4MJS B;  2BPS A;  3RYT A;  2DHZ A;  5E6O A;  3QIJ A;  2FCN A;  1NI2 A;  4GDK A;  4K7U A;  3U7D A;  5L95 C;  2K8C A;  2M4N A;  5DPS A;  3X23 A;  2JPH A;  3O65 B;  1GC6 A;  4W9C A;  2L76 A;  2LXC A;  4E74 A;  4NJ6 A;  4II3 B;  5LXI B;  4DHJ B;  1WR6 E;  2AEH A;  4TQ1 A;  3VUW A;  2LAS A;  2CU1 A;  2ZPY A;  3DDC B;  4DHZ B;  2FCQ A;  4MEM A;  3M3J A;  3R7R A;  2FCS A;  4M8M A;  4NQK E;  2PE6 B;  3DCG A;  2KD0 A;  3QK0 A;  2CKH B;  3ZNH B;  1I42 A;  4GN1 A;  4ZRJ A;  2AL6 A;  4AUQ C;  4DHZ E;  1HE8 A;  2MBQ A;  2G45 B;  3I3T B;  1D3Z A;  4FA6 A;  4IWQ A;  2GBM A;  4B6W A;  5JHA A;  2DZK A;  4GXB A;  1UBI A;  3WAO A;  4F8C B;  2B3A A;  1GC7 A;  3DBS A;  4RM8 A;  2WX1 A;  4GSW A;  4ANX A;  2MBB B;  3ZTC A;  2Z0E B;  2MP2 B;  1XD3 B;  3KUZ A;  2C7N B;  3ENE A;  3QJZ A;  4FJY A;  4PS8 A;  3H7P A;  1WXV A;  3QHT A;  3ZKJ C;  3PTF C;  4FHK A;  3X0W A;  4FAD A;  1VCB A;  3UGB B;  2IY1 B;  5D2M B;  1RRB A;  1OEY J;  2BYF A;  2IBI B;  1WX8 A;  4GDL A;  2ASQ A;  2G4D B;  1WZ3 A;  2LGD A;  3L0W B;  3VUY A;  5LLI A;  2NVU I;  4XX5 A;  5DPT A;  4WWO A;  4EFO A;  2KQS A;  4HCN B;  4FBJ B;  2EKE C;  3IVF A;  2LUE A;  4EZK A;  3L13 A;  5CHF A;  1V86 A;  4IM2 A;  3DOW A;  3KYD D;  2CS4 A;  3PSE B;  2C7M B;  3EHV A;  3R3M A;  4JQW C;  4A20 A;  2GMI C;  2O6V D;  1NBF C;  2ZVO A;  3CSF A;  3TCA A;  2JVC A;  3ZNZ B;  3D32 A;  3APF A;  4TQ0 A;  2NBU A;  2PE9 A;  3M63 B;  2KQ7 A;  4MGI E;  1NDD A;  2PEA A;  2BGF A;  4P7I A;  2IZV B;  1R4N I;  2K6Q A;  3WAN A;  2MCN B;  1ISN A;  2JWZ A;  1OTR B;  3H7S A;  3OAW A;  2IO2 B;  1WGR A;  3NZU A;  4FHJ A;  3ZTD A;  2M0X A;  5D94 A;  4BBN F;  3JSV A;  1F9J A;  2KDB A;  1WMH A;  3ZRC A;  1TTN A;  2BF8 B;  2KXJ A;  3N32 A;  1GG3 A;  1KM7 A;  2O6V A;  3RT3 B;  1YJ1 A;  5JH5 C;  3QX1 A;  1GNU A;  5G2N A;  1E7U A;  1YIW A;  1OGW A;  2K39 A;  4BKG A;  2D11 A;  4TV3 A;  4LJO B;  1WXA A;  2DYM A;  2NPT B;  3T9L A;  3B0A A;  4OVU A;  4EZJ A;  3KUD B;  2W9N A;  4W9G A;  2Y5B B;  3R66 C;  2MW5 A;  2L3Z A;  2RGF A;  1E5W A;  2D07 B;  4DDG D;  1GUA B;  3K9P B;  1LQB A;  2BKF A;  2A5U A;  3PRE A;  1SIF A;  2KJH B;  2JZ3 B;  4HDO A;  1ZGU B;  4KVG B;  1PQS A;  1L7Y A;  1QZE A;  2RD0 A;  3A9J B;  1C1Y B;  2NS5 A;  3A33 B;  4KZ0 A;  4CYE A;  4WWN A;  3GZN I;  2KTR B;  1V5O A;  4MDK E;  4BKS D;  1S3S G;  1V6E A;  3DQV A;  2KDE B;  3VH3 B;  2KC1 A;  2EMT A;  3HIZ A;  4GDL B;  3PHX B;  5HKH A;  4AJW A;  3JYU A;  2HTH A;  2DYB A;  1E7V A;  3UIO B;  5C23 A;  1LXD A;  3QQ8 B;  4W9E A;  5E6N A;  1UH6 A;  4EKU A;  2LWP A;  4CO7 A;  3JW0 X;  2DZM A;  2LVQ A;  4EZL A;  5AZF A;  3L54 A;  2K6D B;  1TZ1 A;  3A4R A;  4HPM B;  2FIF A;  2BWF A;  2J0J A;  3L10 B;  3L16 A;  3ZDT A;  4NY0 A;  4BKS A;  4F1S A;  1H8C A;  1J19 A;  2ZNV C;  1EF5 A;  2IO0 B;  3H6N A;  4LDT D;  4WAA A;  1U4A A;  2D10 A;  2BKR B;  2OOB B;  4FUL A;  2ZEQ A;  2J0K A;  2ZCC A;  3V6E B;  4BKT A;  4JLC A;  3ZRF A;  5EDS A;  5GMV A;  2KOX A;  3ECI A;  4LJP B;  1YX6 B;  5E6P A;  2DYO A;  3VTU A;  4E71 A;  2IYD B;  3VUX A;  4WWP A;  2YVC A;  2MSE D;  5IAA C;  2VRR B;  4BVU C;  2LZ6 A;  4EUT A;  1J0G A;  2N9E B;  3JSV B;  1WMH B;  4K7S A;  2R2Q A;  4GGQ A;  1WH3 A;  4KSK C;  2O6V B;  2KMA A;  3HM6 X;  3IHP C;  3HK0 A;  4F7Z A;  3H9D A;  2GBJ A;  1WE6 A;  2N7D A;  2NPT A;  3AI5 A;  3DPD A;  1IPG A;  3A4S C;  1ZW7 A;  3P2B A;  3VTV A;  1RLF A;  4I6L B;  3VQI A;  5CHV C;  5J18 A;  4ZYN A;  2DZJ A;  3MHS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...