4MJSA

Crystal structure of a pb1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
89
structure length
88
Chain Sequence
b'PHMRVRLKAHYGGDILITSVDTTTFQDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLACQGRDEVLIIHVFPSIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C zeta type
publication title Structural and biochemical insights into the homotypic PB1-PB1 complex between PKC zeta and p62
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/protein binding
total genus 21
structure length 88
sequence length 89
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4mjsA00
2M1MA 3WIMA 5E6PA 3ZRFA 2C5LC 1V2YA 3R7QA 4ICVA 4AP4C 4FULA 4ZRKA 4A20A 2JRHA 3IFWB 1SE9A 2LGDA 1WE6A 3HHMA 4WAAA 3KH0A 4GDLB 1Q0WB 2PE6B 2LRWA 2O6VA 3ZUNA 1JRUA 2IO0B 2MW5A 1P98A 3ZTDA 3VDZA 2KFKA 3SDLC 3TMPB 4MSMB 4W9HA 1KJTA 1WIAA 2K6QA 4PYUA 2MWSB 2KC2A 5AZGA 3R3MA 1K8RB 2J0MA 3R7RA 2M4NA 2G45B 3M63B 4HPLB 4XC2A 1E8YA 4MGZE 2FCQA 2LUEA 1P9DU 3L17A 1VCBA 3X0WA 2LJ5A 1H8CA 1WGDA 2DAFA 3QARA 4IUMB 3PT2B 3V62A 4WWOA 3IG3A 4DHJD 1A5RA 3PVLA 1TGZB 2JF5A 4ASWC 4WWPA 2FNJB 2IY0B 3QIJA 2KK8A 2KLCA 2L8JA 3CSTA 4FJYA 4HCPB 4W9FA 3HK0A 2FUHB 4DDGD 4E3CA 5LLIA 2DZJA 2CKHB 2UWQA 3DQVA 3GOEA 4NJ7A 4I6LB 3PTFC 1WJNA 2KX3A 4II3B 1WX9A 3ZKJC 3AULA 4EZKA 2D3GA 1WYWB 3C0RB 3K9PB 3N30A 3V6CB 4E71A 2PJHA 4ZRIA 2AL3A 2MP2A 4YL8A 2GBNA 4AOFA 2L05A 1E90A 4FHKA 5E6OA 1OGWA 4KDIC 3DBHI 1AARA 4ANUA 1I35A 2GBJA 3A33B 1MG8A 2HTHA 1X1MA 2KDBA 3H6NA 2NBVB 4WJOA 4HVBA 4W9DA 5D7GA 3OJ3A 5D2MB 1WX7A 2PPHA 2C7HA 3DVGY 4JIOU 4TQ1A 5AZHA 3NZSA 4MJSB 2ZNVC 4IM0A 4ANVA 3KUZA 3M95A 2JPHA 3ZVVA 2L3ZA 3TBLD 4GOCA 2R2QA 4GMVA 1F9JA 2DYOA 2O6VD 2ZPYA 1I42A 2LD9A 4BFRA 3L10B 2A5UA 3PRMB 1U4AA 1E7VA 4HCNB 1OQYA 4NAWA 2K8CA 3D32A 4ANXA 4MGKE 2KTRB 3PPAA 4JLCA 4A3PA 2V4LA 3B08A 2IYDB 3A1QB 2AYOB 2LWPA 4KZCA 5G2NA 3RULA 1IYFA 2JZZA 3APCA 4DBGA 1E8XA 1TZ1A 2KN5A 1NBFC 3TCAA 2MLBA 5AEKB 1V6EA 2CU1A 2LVQA 1UBIA 5KHQA 5LXHA 3PRPB 4CYEA 3JSVA 3H7SA 1LM8B 2IZVB 4KV2A 2ZVNA 2AEHA 4M8NA 4CHKA 1ZGUB 3DVGX 1WE7A 2FAZA 2I1JA 4GGQA 4ZRJA 2FCSA 2ZZPB 2Z0EB 3TIXA 2ZCCA 3H1UA 2WX0A 1R4MI 2M8SA 1WF9A 3PREA 2HD5B 3EHVA 2KJ6A 3HM6X 3ML9A 1C3TA 4HJKA 4EZJA 3VTVA 2NR2A 2GBKA 3W1SA 2O2VB 1RRBA 2FIDA 2CHZA 3B1LX 2D10A 4GSWA 4DHJB 4KSLC 1WRDB 4GDLA 2KWCA 2KX0A 4KIKB 5G55A 3VUXA 2MCNB 2LXAA 5DPSA 3ZNZB 1EF1A 2DZMA 4M0WB 4XX5A 2REXA 3R66C 3AU4A 2KDEB 1YQBA 2NPTB 4BBNC 2EMTA 2K8HA 4TQ0A 5JH5C 2BKFA 2DENB 1C1YB 3PGEA 1V5TA 4W9EA 1E8WA 4BOSC 2JZ3B 4K1RB 1WGGA 4F8CB 2KHWB 4I6PA 3BINA 3NHEB 4FN2A 1XD3B 2BKRB 2D2QA 2KMCA 2PE9A 3PZDA 3DBSA 2L7RA 4CO7A 4EZLA 2MRPA 3QC8B 3PSEB 1UELA 2C7NB 3PLUA 3Q3JA 4NY0A 3QWZB 1WM3A 2LGYA 3QJZA 4RM9A 3UIPB 1P0RA 4JQWC 2JUOA 3NS8A 1IPGA 4MGYE 1RFAA 5DPRA 3L54A 4FBJB 2KO3A 1J8CA 2KJRA 3DBLI 3EC8A 1LXDA 1J19A 1WH3A 2WX1A 4GU2A 4G0NB 2D11A 2MBEA 2RSUA 3WA0A 2KDIA 5DPWA 4AUQC 4EFOA 2KC1A 1ZW7A 3VQIA 1L7YA 1UH6A 3RYTA 1SIFA 3B0AA 3Q3FA 1NDDA 1YJ1A 1J0GA 4PS7A 2KWUB 1XQQA 3PRZA 2JWZA 2VRRB 3VUYA 3TL5A 3UQBA 5JZEB 4ZYNA 2LI5A 1OEYJ 2DZIA 4AJYB 1WJ4A 5JHBA 4DWFA 2D07B 3VAWA 4AWJA 3U30A 2BWFA 4DHZB 4LDTB 1Y8RC 2MBQA 3A4RA 1P1AA 2LVPA 4GXBA 1WI0A 2KOXA 4G3XB 4MEMA 2I1KA 3KUDB 4MJSA 4PS8A 1KOTA 3WAOA 3PHXB 1XT9B 2KDFB 2MBHA 4J6IA 4GDKB 3NZUA 4BKTA 2ZEQA 4DHZE 3IHPC 3IVFA 3UIOB 1Q1OA 3V6EB 2NS5A 3IBEA 2J0JA 3DPDA 3QHTA 2CHWA 2LASA 5EDSA 2IO1B 2RPQA 2K1FA 3UQAA 1GUAB 2ZNVB 1YX5B 3AU5A 1OEYA 1E5WA 2N4FA 2KJHB 2N1VA 3KYDD 3WANA 1V86A 4K7SA 5L95C 4TUUA 2KNBA 4MELA 3VVWB 4FADA 1PQSA 1S3SG 4KSKC 1WMHB 1YD8U 3MHSD 4NJ6A 5FR6A 5GMVA 2ZPNA 2KTRA 4W9KA 2BGFA 2OOBB 4NPNA 1WGHA 2KD0A 2KZRA 1WXVA 2G3QB 3A1QA 2LGXA 1D3ZA 4HDOA 2RGFA 3PHWB 2XK5B 4RM8A 3JW0X 4HXDA 1LFDA 2KWVB 1GC6A 4G11A 2RD0A 2N9XA 4X57B 5CHWA 1E8ZA 1M94A 3DOWA 2OJRA 3WAMA 1WJ6A 2JRIB 4JGHB 2KKCA 3RZFA 2BYFA 1L2NA 5E6NA 2EKEC 4II2B 4BKSA 2FCMA 2GBRA 4FJVB 5J17A 2G4SA 3ECIA 1WR1A 3AI5A 3RT3B 1WR6E 3QX1A 3U8ZA 2N9EB 3HIZA 3L13A 4EOYA 2KFJA 3M3JA 3OLMD 3BY4B 3AXCA 1YX6B 2IY1B 1WY8A 4HDQA 3QK0A 1V49A 2BYVE 3WAPA 2AWTA 2IO3B 2O2VA 3RD2A 1V9JA 3A9JB 1H4RA 3APDA 4KIKA 2JT4B 2YLMA 3ENEA 2W9NA 4K7UA 3QAQA 2N9PC 1QZEA 2KANA 5C1ZA 2NPTA 2AL6A 2Z59B 1EF5A 1E7UA 1WFYA 2CHXA 4F1SA 1WZ0A 5BO4B 2DHZA 2FCNA 2MBOA 2DYMA 2ZVOA 4KZ0A 3TJPA 4ZDVA 1TTNA 2LVOA 4OVUA 2IBIB 3H7PB 3ZLZA 3ZW3A 2NBUA 3LDZE 4IWPA 3SHQA 3VUWA 4HPMB 4MGIE 3WALA 4MDKE 3VH4B 2MSED 4W9CA 1WGYA 3RCZA 2B3AA 2G4DB 2XBBC 4BKGA 5IA7A 2CS4A 1CMXB 2K8BA 3ALBA 4F7ZA 4GIVA 2ZCBA 1Z2MA 4JL9A 4HK2A 3GZNI 2YVCA 3ONSA 2KTFA 2V1YA 5J18A 3ZIMA 3MTNB 3H9DA 4W9JA 1UZXB 2KQ7A 4WQOB 4NQLB 4W9LA 2WYQA 4N9F4 1HE8A 4BOZB 5KHOA 3JVZX 1GC7A 3L08A 4IM2A 1NI2A 3A9KB 4IW0A 3ZNID 3QCAA 3VFKA 3W1SC 4E74A 2IO2B 1KM7A 3K9OB 4FJZA 4LJPB 4RMAA 4URKA 3S2AA 1KLVA 2GMIC 3PV1A 4GN1A 3ZDTA 4HWIB 3DVNV 2J0KA 2BYEA 1GNUA 1LQBA 4WWNA 4BKSD 4BVUC 4GB9A 5DCNA 2K25A 2O6VB 3QA8A 4MH0E 3UINB 3A4SC 3EECA 4FHJA 2LRUA 4TV3A 2DZKA 1YIWA 3VTWA 5L83A 3ML8A 5HKHA 2JY6A 2KFKB 2KVRA 1OTRB 2M0XA 4WJQA 4GDKA 1V80A 4EUTA 1EUVB 5TR5A 1ISNA 2JXXA 1ZKHA 4XZ4A 2A4ZA 5J2RA 2MQJA 2PEAA 4DDID 4P7IA 3CF6E 1T0YA 1UGMA 1WJUA 3O65B 4TKNA 3ZTCA 3W1YA 2Z0DB 1GG3A 4PS3A 4I6NB 4PYZA 3VTUA 3LJ3A 3PS6A 1WMHA 2FIFA 2ZJDA 3EFUA 4IM3A 2NVUI 4W9GA 4EEWA 5LXIB 2CR5A 4M8MA 4ICUA 2K39A 2K6DB 4OVVA 4LJOB 4B95A 1WM2A 2WDTB 1RLFA 2N1WA 5IAAC 1EO6A 5CTRC 2XK5A 3KW5B 3SD5A 3T9LA 3VXWA 1S1QB 2BPSA 3ZO5B 2WWZA 3MJWA 2J7QB 4EKUA 3DBRI 2NCNA 2C7MB 4G50A 2MP2B 3V60A 3NOBA 5AZFA 1Q5WB 2R2OA 4FLHA 3RUIB 4KDLB 4B6WA 1WZ3A 2QHOA 3DDCB 4IG7B 4IWQA 3UF8A 4IWOA 1FXTB 3KUCB 1UD7A 3UGBB 2UYZB 1WX8A 4A3OA 3I3TB 4K7WA 3PLVA 4K81A 1SGHA 3X23A 5CX3A 3OJ4B 2DX5B 2GOWA 5D94A 3A9JA 5CHFA 2C60A 1VD2A 3RZWC 1G6JA 2JVCA 2L0FA 4NNJB 1GJZA 4MM3A 4AJWA 1RAXA 4LDTD 2BF8B 2KLGA 3QQ8B 4IC7B 2KQSA 4WJNA 3V61A 1WXAA 3NY5A 3P2BA 2MBBB 4WJPA 3M62B 2KXJA 3OAWA 3N3KB 2RR9A 2NBWB 3KYCD 3VH3B 3ZNGC 2DAJA 2LZ6A 3H7PA 2C9WB 3VHTC 2L76A 4NAWB 5CHVC 3ZDMC 3ZNHB 4BBNF 4DXAB 2N7EA 4B9KA 3ZRCA 4HLEA 3CSFA 4NQKE 2KMAA 2Y5BB 2M17A 1IP9A 3U7DA 3KVFB 3L0WB 1R4NI 2HE7A 2ASQA 2GBMA 3APFA 4MSQB 2MX2A 1TBEA 4FA6A 2MA9B 1UBQA 1WGRA 2L0TA 3JYUA 4W9IA 5C23A 2LXCA 3T8MA 4DK5A 2BWES 3N32A 2N7DA 2DYBA 1V81A 1Z5SB 2HJ8A 1V5OA 1WXMA 3HM3A 3JSVB 3L16A 3SU8X 2EMSA 5D6JB 1BT0A 4LCDE 3DVNU 2V3SA 3DCGA 1P3QU 4ANWA 2L00B 5DPTA 5JHAA 1WXSA 3A9KA 2XEWA 3CMMB 4KVGB
chains in the Genus database with same CATH superfamily
3OWEB 2M1MA 3N1ZC 1N60A 3ZRFA 2JSVX 1L6UA 4YTPB 5G5HA 1HZ6A 1NENB 1YOVB 4ICVA 4AP4C 2BQQA 3IFWB 1SE9A 2LGDA 3HHMA 4GDLB 2LRWA 2PMVA 1JRUA 2MW5A 1P98A 3ZTDA 2KFKA 3TMPB 5EE3A 1WIAA 2K6QA 3L4PA 4YT0B 1ET6A 3MHZA 4HPLB 1E8YA 1P9DU 3L17A 3SFDB 4YXDB 2DAFA 3QARA 1VZ6A 1SE2A 1IBXB 3IG3A 4DHJD 3P4SB 2KK8A 3HK0A 3GP7A 2DZJA 3LYYA 2J53A 2OJWA 1J7BA 1RM6C 3AULA 3C0RB 4E71A 2PJHA 4YL8A 3NUHB 4AOFA 5E6OA 3NVVA 1I35A 1ACCA 1ZOYB 3PO0A 2HTHA 1UWMA 3OJ3A 2HTME 5AZHA 3BVMA 3U2SC 5IN7A 4MJSB 4ANVA 3R2IA 5H92C 3DWGC 3M95A 4GMVA 1F9JA 2DYOA 2O6VD 2ZPYA 1JROA 5BYRA 4BFRA 1YMHE 1ZUD2 4WIPA 1K51A 3D32A 3BVGA 4ANXA 4MGKE 2K22A 3TEWA 2AYOB 3RULA 3APCA 1E8XA 1NBFC 1PYWD 3TCAA 3EFCA 1AYFA 3H7SA 4M01A 3RNAC 4M8NA 2I1JA 4XYCA 4ZRJA 2Z0EB 4BZAA 1JWMD 3PREA 3EHVA 1BUIC 3ML9A 3VTVA 2INNE 2NR2A 3HVDA 3ABVB 2I2YA 4GDLA 2KX0A 1EF1A 4XX5A 4M0WB 2RDGA 4YSYB 2NPTB 4TQ0A 4K3BA 2DENB 4W9EA 1HEZE 1TY0A 1WGGA 1VZ7A 2PE9A 2KMCA 4RGMA 2BVCA 2L7RA 2MJEA 2C7NB 2WDQB 1WM3A 3QJZA 3UIPB 3AEEB 1IBXA 4BAXA 2QDFA 5DPRA 1K53A 3BYTB 1DOXA 3BK2A 3DBLI 3MC0B 4G0NB 2D11A 2MBEA 1AW7A 3WA0A 1SEBD 3HVZA 1J0GA 1YJ1A 2KWUB 1XQQA 2JXTA 2JWZA 2BYTA 4YTMB 3UQBA 5JZEB 3GE8C 5EE1A 4A55A 3Q3MC 3RFZB 3VAWA 4WURA 1SE4A 3VR8B 3U30A 2M19A 2LVPA 2KOXA 2I1KA 4M00A 4MJSA 3DBRB 3WAOA 1XT9B 2KDFB 2MBHA 3IHPC 3IVFA 2KWDA 1F77A 2WGSA 3QHTA 2CHWA 2K1FA 3UQAA 2N4FA 2N1VA 4K7SA 1DOYA 5IKCM 4LNFA 4OVZA 2KNBA 3VVWB 4LNIA 1S3SG 3TEXA 3MHSD 4NJ6A 5GMVA 3TUOA 4JE3B 2RMMA 2G3QB 4XE0A 2RGFA 2LGSA 1N62A 3RNFC 1GC6A 4X57B 1E8ZA 2JX5A 4JGHB 3RZFA 2BYFA 5E6NA 2EKEC 4II2B 2FCMA 4FJVB 2EELA 2PVGC 3ECIA 3U8ZA 3P1MA 3RNEC 1WY8A 2PTLA 3DHGC 1AWDA 2BYVE 2AWTA 1H4RA 1EWYC 2YLMA 4REZA 4N59A 4M0WA 1WRIA 2NPTA 2YEPF 4F1SA 4WAFA 2FCNA 3ZJVA 4KZ0A 1GAQB 3O13A 3ZLZA 2NBUA 5G5GA 3V3XA 4BKGA 1Z2MA 1FFVA 4HKZE 5FR3A 3ZIMA 2WYQA 1HE8A 1NVID 1QQRA 2IDYA 3JVZX 3A9KB 3VR9B 3DBLB 2M0AA 3S2AA 1GB4A 3DVNV 2PLPA 1GNUA 1LQBA 4BKSD 3B2FA 1XLNA 4FHJA 2LRUA 2VZKB 4TV3A 3Q8AA 4LNNA 2KVRA 1IGDA 1EUVB 2N0SB 2K3UA 2JXXA 4XZ4A 2A4ZA 3AB5A 2PEAA 4P7IA 1WJUA 4TKNA 4US8A 2NTTA 1NYQA 4PYZA 4AQ7A 1JWUD 3LJ3A 4GLSC 2FIFA 2ZJDA 5LXIB 4W9GA 2K39A 1WM2A 1V1OA 5IAAC 1EO6A 1SXTA 5CTRC 3PZ7A 2JZPA 3H8HA 3FILA 3ZO5B 1FO4A 1AN8A 3RPFC 4DQOC 4OHJA 2MP2B 4N6EB 2V3PA 1Q5WB 4FLHA 2QCZA 4KDLB 4B6WA 4TMAB 2QHOA 2WXNA 3DDCB 4IWQA 4YSZB 1WX8A 1QOBA 1TKEA 3PLVA 5D3DA 5CX3A 3OJ4B 5CHFA 3VRBB 1VD2A 3RZWC 2L0FA 1RAXA 2WQYB 1WXAA 2NBWB 3VH3B 4K3CA 2C9WB 2GRIA 4YTNB 1TS4A 2HJ1A 2Y5BB 1IP9A 3KVFB 3NZ3A 2OHFA 3L0WB 2HE7A 1UBQA 1WWTA 4LK0M 1M4VA 1Z5SB 3SU8X 3HM3A 4OZAA 3AE1B 1BT0A 3N1XC 2QSDA 4LCDE 5AUIA 3DVNU 1SIJA 2H88B 1WXSA 3A9KA 4RNAA 4W9KA 3WIMA 4DXGA 5E6PA 2C5LC 4ZRKA 2JRHA 3NJTA 4USAA 2KYWA 2RDBC 4L1BA 4JWUC 3VDZA 4MSMB 4C56C 1ZXIA 2KC2A 5AZGA 3R3MA 3M63B 1GOZA 4XC2A 2LUEA 4P1BC 4IUMB 2PVOD 1I4GA 1SBBB 1TGZB 2Y5PA 1TKYA 3PVLA 2FNJB 1CJEA 3AMZA 3SR6A 3IXSA 5HI1A 5LLIA 4XDCA 4I6LB 1WJNA 1DOIA 4EZKA 3K9PB 3N30A 3EGRA 4ZRIA 2AL3A 2MP2A 1CZPA 2L05A 4FHKA 4DXFA 4KDIC 2J4XA 3DBHI 4HJGE 4P1CC 1DGJA 1X1MA 2KDBA 2Y5CA 3H6NA 4WJOA 4RH6A 4HVBA 5D7GA 5D2MB 1MHXA 3DVGY 4JIOU 4TQ1A 4ZRPA 2JPHA 3T3NA 4YSXB 3L10B 2BS4B 1U4AA 3AM9A 4HCNB 1YN4A 3TEYA 4RCOA 4ZHOA 4A3PA 3A1QB 4KZCA 1I4HA 1IYFA 2JZZA 1STEA 4DBGA 1VJKA 2ON8A 2W3RA 1TS5A 1SJHD 5KHQA 4RGTA 3PRPB 1T6BX 1LM8B 2FAZA 1I4PA 2ZZPB 1HQRD 2WX0A 1R4MI 2WXKA 3DWMA 1EM7A 4DHJB 2KWCA 5G55A 4C7ZA 4J3OD 5DPSA 3ZNZB 3ZXVA 3R66C 3AU4A 3W2DA 1I4XA 2KDEB 1TZOA 1WGKA 2K8HA 2BKFA 3FAHA 1C1YB 3URYA 1WYGA 4C80A 1UUPA 4K1RB 2KHWB 3BINA 1XD3B 2D2QA 3DBSA 5C2TB 1TYGB 2MRPA 2DNFA 3QC8B 1RWSA 3PLUA 3Q3JA 1PGAA 3GB1A 4NY0A 1XCQL 1WXQA 1P0RA 4JQWC 3NS8A 2E3TA 1IPGA 1L0YB 3BYYB 3L54A 4FBJB 3BK1A 3PZ8A 1C4PA 2PIAA 1XLQA 2KJRA 2ZW0A 3Q69A 1J19A 2WX1A 3E56A 2RSUA 2WDVB 4EFOA 1T0SC 1ZW7A 3RYTA 1KTKA 1PGBA 1E7PB 3I5JC 1UWXA 2VRRB 4HPPA 4XGAB 4ZYNA 2LI5A 1OEYJ 2D07B 2WXIA 3P42A 2LGIA 1HXYD 2N9LA 5TSSA 4LTUA 1IGCA 1OQQA 2L1AA 3DBHB 4GXBA 4MEMA 2J52A 4HRSA 1KOTA 4BKTA 4US9A 1N5WA 5JXVA 1Q1OA 3V6EB 2XNAC 2J0JA 1QILA 5EDSA 2IO1B 1GPXA 1J7CA 1YX5B 3HUIA 2WXQA 2KJHB 5L95C 1ENFA 5BYQA 2NMQA 4MELA 3AEDB 4FADA 1WMHB 2BGFA 1V97A 1TKGA 1EU3A 2KD0A 2KZRA 3MC9A 1WXVA 1FNVA 3A1QA 2LGXA 1MI0A 2XK5B 2WXGA 4RM8A 1LFDA 4G11A 4N58A 2N9XA 1KH0A 1M94A 1SSNA 3WAMA 1WJ6A 1L2NA 1NI3A 2W55A 2GBRA 2G4SA 1V8CA 3AI5A 1QT9A 2DLBA 2BB5A 1F2RI 3L13A 3ZJUA 2IY1B 2G1EA 4HDQA 3E9SA 1V49A 3WAPA 2IO3B 1V9JA 3QAQA 2BW2A 2N9PC 2KANA 2Z59B 1E7UA 1WFYA 2CHXA 3C19A 3Q8CA 5BO4B 2FBWB 2V9HA 3TJPA 1BXTA 3ZW3A 3H7PB 3LDZE 3SHQA 4MDKE 2GB1A 2JYEA 2B3AA 2G4DB 3V05A 3EUB2 4RF1A 1KRHA 5IA7A 2K8BA 2ZCBA 4R3DA 2YVCA 4HROA 2KTFA 2V1YA 3H9DA 1KF6B 4W9LA 4N9F4 1NI2A 3ZNID 2M56B 3W1SC 4E74A 3K9OB 1K52A 4FJZA 4LJPB 1HA5A 4URKA 3WCQA 3MC8A 1ESFA 1P7EA 4GB9A 5DCNA 1A70A 3BZDB 3OG5A 4MH0E 2RPVA 3A4SC 1XLOA 1E10A 3ML8A 2JY6A 2X8XX 1OTRB 2M0XA 2INPE 2V3NA 5TR5A 3AH7A 2MQJA 3ZGZA 4H2AA 4ZYSA 3PS6A 4ZOHC 1WMHA 4EEWA 2CR5A 2WDRB 4WWMA 4OVVA 4LJOB 2KVZA 2Z8LA 2SEBD 4NAMA 2N1WA 2XK5A 1CQVA 1MG4A 4TSSA 2BPSA 1NYRA 4EKUA 2NTSA 1R7SA 4G50A 1FCCC 1YJIA 5AZFA 3FILB 1WZ3A 1XF5L 1N61A 4IG7B 4ITKA 1FXTB 2X38A 5I4DA 1SGHA 3X23A 1LO5D 5D94A 4XWTA 2C60A 3BIID 2JVCA 4NNJB 1OFFA 1ET9A 1Q10A 3IAM1 1ZDVA 3QQ8B 4RFBA 3NY5A 4WJPA 3P4RB 2RR9A 2LZ6A 3H7PA 3ZDMC 4NAWB 2N7EA 4B9KA 3ZRCA 1XXGA 2V0GA 2OEDA 1MPEA 3AEGB 1RYJA 5D3IB 1R4NI 1UGJA 2MX2A 1TBEA 2MA9B 4DK5A 3NVZA 3N32A 1V81A 2B76B 2WP9B 1V5OA 1WXMA 3JSVB 4QAYA 5D6JB 2V3SA 1FXAA 4S0RA 5LNK1 2XEWA 3CMMB 3R8BA 2D3AA 4L23A 1P7FA 3CIRB 4FULA 4A20A 1WE6A 2Y3AA 2QJLA 2PE6B 1QOAA 1ZP0B 3KWLA 3UI3A 2IO0B 1B1ZA 2FE8A 2JU6X 2L83A 5MPOA 4W9HA 4PYUA 2M4NA 3U4EG 1NEKB 1XEEA 4MH8A 1JWAD 4MGZE 1VCBA 2LJ5A 1HTQA 1WGDA 4IKGA 3V62A 1UF0A 4WWOA 2AX5A 4WWPA 2IY0B 3CSTA 3I9V1 4FJYA 4HCPB 1SE3A 4E3CA 3DQVA 3GOEA 3PTFC 2INCC 2SAKA 1WYWB 4RGOS 2FUG1 1I4RA 3W5UB 2GBNA 2ACZB 4A9AA 1OGWA 1AARA 4ANUA 2CJOA 1MG8A 1FEHA 5IO9A 2J42A 2NBVB 4MACA 1LGRA 1YQ3B 1WX7A 2C7HA 4LNKA 2ZNVC 1JWBD 4XDDA 5FK9C 2W82A 3ZVVA 2L3ZA 3TBLD 1TS2A 1FD6A 2H89B 2VZKD 3PRMB 1QOGA 4KGTA 1T5XD 4NAWA 3AE2B 2BS2B 2V4LA 3B08A 2LWPA 2DWQA 5G2NA 3P63A 2KN5A 1T0RC 2WXRA 1F0ZA 4PK1A 5AEKB 1V6EA 2LVQA 1UBIA 3KWVA 4OW0A 1C78A 4CYEA 3JSVA 2IZVB 4KV2A 2ZVNA 4CHKA 1WE7A 1QKZA 1EWCA 1MVKA 4GGQA 1FXIA 2LHDA 2L32A 3ZYYX 1WF9A 2HD5B 2KJ6A 3HM6X 4HJKA 4EZJA 3B9JA 3W1SA 2O2VB 2CHZA 1PGXA 2WS3B 1WRDB 4KSLC 4JX1C 2MCNB 2DZMA 2REXA 2KMMA 1YQBA 5JH5C 3I63C 3TEZA 3PGEA 4BOSC 1E8WA 2JZ3B 4FN2A 3PZDA 3AE4B 3PSEB 1UELA 3QWZB 2LGYA 4RM9A 4OZBA 2JUOA 1SJED 1J8CA 5IOIA 1XO3A 3EC8A 1LXDA 4GU2A 4KGSA 4KKIA 2KDIA 5DPWA 4AUQC 1VLBA 1UH6A 5BYSA 1RFKA 1SIFA 3MJ5A 3B0AA 3Q3FA 1KLGD 4UDUC 4PS7A 2LHEA 3PRZA 1D5XC 3VUYA 3CWIA 1YJJA 2MHJA 2WXFA 2MJ3A 5JHBA 2BWFA 4DHZB 4LDTB 5IP4D 2MBQA 1K50A 3KQ4A 4GDKB 3NZUA 4DHZE 4LNOA 3RI7C 2NS5A 2LASA 2RPQA 1GUAB 3J9CA 2ZNVB 3AU5A 1C9FA 2VH2A 3KYDD 3WANA 1V86A 4TUUA 1PQSA 1PDXA 1BMLC 4KSKC 1L4ZB 3GE3C 2ZPNA 2N9KA 4NPNA 1WGHA 1L5PA 1D3ZA 4HDOA 3PHWB 3JW0X 4HXDA 4RGNA 2OJRA 2KT7A 2KKCA 1FM0D 2BBCA 1FCLA 4HKQA 1JMLA 2K9XA 1YN5A 3BY4B 3RNCC 1E0ZA 1N5XA 3QK0A 2WXHA 2O2VA 3ENEA 2ZW1A 2W9NA 4K7UA 4WQMA 3LB8C 2AL6A 3AN1A 2AQ1B 2DHZA 2ZVOA 2W54A 4OVUA 2IBIB 2KN4A 4IWPA 3X0WA 3VH4B 2MSED 4W9CA 3RCZA 2XBBC 1MFWA 5T8IA 1CMXB 1FRDA 4F7ZA 4JL9A 3IT6B 2JWUA 3GZNI 4IOIE 5J18A 3MTNB 3FKYA 1JQ4A 3C8YA 1OQRA 5KHOA 3Q3NC 4IM2A 4ARCA 3TSSA 1VDVA 1JRPA 3QCAA 3VFKA 1Y56A 2L52A 2IO2B 3AEFB 3ZJTA 1FRRA 2KACA 4C7YA 4HWIB 2J0KA 2BYEA 4WWNA 4NJCA 2O6VB 3UINB 1DYQA 3EECA 5EE0A 2DZKA 1YIWA 2BS3B 5L83A 5HKHA 4WJQA 4GDKA 4EUTA 1D5ZC 1D4BA 1ISNA 1XCTL 5BMIA 5J2RA 1TT5B 3ETRA 3RNBC 1T0YA 1UGMA 2Z0DB 1GG3A 3AECB 4IM3A 2AQ3B 2NVUI 4M8MA 4ICUA 2K6DB 3GS2A 4B95A 2WDTB 1RLFA 3MP9A 2D3BA 3KW5B 3SD5A 3VXWA 2BTEA 1S1QB 2WWZA 3NS1A 3DBRI 4YWGG 2NCNA 1HZ5A 5FKAC 2XN9C 1XLPA 2QMTA 3KUCB 4ACFA 2UYZB 2QIEB 1YN3A 1D6EC 4K81A 3W5VB 5BMGA 3IT4B 4D2KA 2DX5B 3Q2AC 4C00A 1F2RC 1GJZA 2BF8B 3V61A 4WJNA 1FNUA 4PT5A 2MBBB 3M62B 2KXJA 3OAWA 3N3KB 3KYCD 1R4MB 2DAJA 2DBYA 1MJDA 3VHTC 5E6JA 4HLEA 1PUTA 4NQKE 1V1PB 3U7DA 2ASQA 2GBMA 3APFA 2G9HD 4FA6A 4JWSC 1WGRA 2L0TA 3JYUA 3SEBA 4JPSA 2CU3A 1L6VA 2HJ8A 3L16A 1N63A 2LMCA 3GZNB 1ZDXA 3DCGA 4HEA1 4ANWA 2L00B 5DPTA 4C4VB 4KVGB 2QC8A 4P6VF 1V2YA 3R7QA 3MFGA 2BT6A 4A90A 2YEPB 4OZCA 4WAAA 3KH0A 1Q0WB 1TS3A 2O6VA 1FFUA 3ZUNA 3NG0A 4IDIA 3SDLC 3AV8A 1N6ZA 1KJTA 3AEAB 1YQ4B 2MWSB 1JWSD 1K8RB 2J0MA 3R7RA 2N7JA 2G45B 3SFEB 2LUMA 2FCQA 3U7ZA 4CQNA 1H8CA 2MEKA 2RDHA 3PT2B 1A5RA 2JF5A 4ASWC 1FNWA 3QIJA 2KLCA 2L8JA 3RMKC 4W9FA 4DDGD 2FUHB 2UWQA 2CKHB 4O1NA 5H8YE 4NJ7A 2AQ2B 3T3OA 2KX3A 4II3B 1WX9A 3ZKJC 2D3GA 3V6CB 4ZHPA 3Q8FA 1E90A 3I57A 3R2TA 2GBJA 3A33B 4W9DA 2MH7A 2PPHA 3VRAB 1QF6A 3NZSA 1B9RA 4IM0A 1T3QA 3KUZA 4GOCA 2R2QA 1I42A 2LD9A 3Q6BA 2A5UA 2WXJA 1E7VA 2IGDA 2GLSA 1SF0A 2WXPA 1OQYA 2K8CA 2KTRB 2PKOA 2D5GA 3PPAA 1V1PA 4JLCA 4AS1A 4FXCA 2IYDB 2GI9A 3DHIC 1TZ1A 4L2YA 4EE2A 2IPKD 2MLBA 3AE9B 2CU1A 5LXHA 1IUEA 2R61A 3P4PB 2AEHA 3ZXRA 1C76A 1ZGUB 3DVGX 4C4VA 3AE6B 2FCSA 1FMAD 3TIXA 2ZCCA 1C79A 3H1UA 3HRDD 2M8SA 4M02A 1C3TA 3Q14C 1JCKB 1ZXHA 1CK1A 2GBKA 1RRBA 2FIDA 3B1LX 4GSWA 2D10A 1QOFA 3IAS1 4KIKB 3RNGC 3VUXA 2LXAA 3FC4A 2WNMA 4BBNC 2EMTA 1I7HA 1V5TA 2WXOA 3ZQ4A 4F8CB 4I6PA 4ARIA 3N1YC 3NHEB 4CO7A 2BKRB 4EZLA 1VZ8A 2K5PA 2HDEA 2PW9A 1J7AA 2QILA 5HHDG 4MGYE 1RFAA 2KO3A 4Q2JA 1WH3A 3NRZA 2K0PA 5GXGB 2KC1A 4B0EA 3VQIA 3AE8B 1L7YA 1JW9D 1NDDA 3W9CB 1E6EB 3TL5A 1D5MC 1I4QA 2EKIA 2BB6A 2DZIA 4AJYB 1WJ4A 1KFYB 4DWFA 4A8XC 4AWJA 3U52E 2TSSA 1Y8RC 4P16A 3A4RA 1P1AA 1FPYA 2LEKA 1WI0A 4G3XB 3KUDB 4PS8A 1KLUD 3PHXB 4J6IA 2ZEQA 3UIOB 4S17A 3EA6A 1L4DB 3IBEA 4B0MA 3DPDA 1OEYA 1E5WA 4KKJA 3AEBB 1YD8U 2IJ0A 3AE5B 5FR6A 2KTRA 2OOBB 1VRAB 2LFIA 1ZE3D 2KWVB 1FIQA 2RD0A 5CHWA 3DOWA 4XWWA 2JRIB 1YNTE 4BKSA 5J17A 1WR1A 3NVYA 3RT3B 1WR6E 3Q8BA 3QX1A 2N9EB 3HIZA 2QEJC 4EOYA 1T0QC 2KFJA 3M3JA 3OLMD 1R4NB 3AXCA 1YX6B 4WH4A 1JALA 3RD2A 3A9JB 3APDA 4KIKA 2JT4B 1GB1A 2JYTA 2Q5WD 2IGHA 1QZEA 4MM3B 2KQ4X 5C1ZA 1C77A 1EF5A 2WLBA 2WU2B 3N9YC 1WZ0A 1HTOA 2MBOA 2DYMA 4ZDVA 1TTNA 2LVOA 3VUWA 3WALA 4HPMB 4MGIE 1WGYA 1C4CA 2JQRB 2CS4A 3RN9C 3ALBA 4RF0A 4GIVA 5BMHA 4HK2A 3ONSA 1ZPSA 3Q8EA 4NZLB 2ICIA 2VH1A 1UZXB 4W9JA 2KQ7A 4WQOB 4NQLB 2ONQA 4BOZB 1EU4A 1GC7A 4KX6B 3L08A 2INDC 4IW0A 1PFDA 3NVWA 1L0XB 1KM7A 4RMAA 1KLVA 3BVZA 5AUKA 2GMIC 3PV1A 4KGRA 4GN1A 3ZDTA 2WXLA 3N20C 1VR9A 4BVUC 2K25A 3Q3OC 3BWUD 3QA8A 3DHHC 1L0VB 3VTWA 3LXFA 4LLGM 2KFKB 1TJEA 1V80A 1WSPA 2E6XA 2KAJA 1ZKHA 1C4AA 4DDID 5HG2A 1TY2A 3CF6E 3O65B 3ZTCA 3W1YA 2IGGA 2W3SA 4PS3A 4I6NB 3VTUA 3EFUA 1MHHE 3B2GA 1ROEA 3AE7B 3T9LA 3MJWA 2J7QB 3KLSX 4ZRQA 2C7MB 3V60A 3NOBA 2R2OA 3RUIB 3UF8A 4IWOA 5EE9A 3UGBB 1UD7A 5HFYA 4A3OA 2KDMA 2UU7A 2D3CA 3I3TB 4K7WA 2MJDA 2GOWA 3A9JA 1G6JA 2V4IB 1E9MA 4MM3A 4AJWA 2LJIA 4LDTD 2KLGA 4IC7B 2CJNA 2KQSA 3P2BA 5C3JB 3ZNGC 4DXAB 2L76A 5CHVC 4BBNF 3ZNHB 1SB3C 1TIFA 2WU5B 3CSFA 2KMAA 2M17A 2I38A 1QLBB 1UNSA 4MSQB 4A6QA 4MT5A 3T8MA 3AE3B 5C23A 4W9IA 2LXCA 2BWES 1F52A 2WXMA 1F1HA 2DYBA 2N7DA 3P4QB 2EMSA 1P3QU 5JHAA 2WHIA
chains in the Genus database with same CATH topology
2M1MA 3WIMA 5E6PA 3ZRFA 2C5LC 1V2YA 3R7QA 4ICVA 4AP4C 4FULA 4ZRKA 4A20A 2JRHA 3IFWB 1SE9A 2LGDA 1WE6A 3HHMA 4WAAA 3KH0A 4GDLB 1Q0WB 2PE6B 2LRWA 2O6VA 3ZUNA 1JRUA 2IO0B 2MW5A 1P98A 3ZTDA 3VDZA 2KFKA 3SDLC 3TMPB 4MSMB 4W9HA 1KJTA 1WIAA 2K6QA 4PYUA 2MWSB 2KC2A 5AZGA 3R3MA 1K8RB 2J0MA 3R7RA 2M4NA 2G45B 3M63B 4HPLB 4XC2A 1E8YA 4MGZE 2FCQA 2LUEA 1P9DU 3L17A 1VCBA 3X0WA 2LJ5A 1H8CA 1WGDA 2DAFA 3QARA 4IUMB 3PT2B 3V62A 4WWOA 3IG3A 4DHJD 1A5RA 3PVLA 1TGZB 2JF5A 4ASWC 4WWPA 2FNJB 2IY0B 3QIJA 2KK8A 2KLCA 2L8JA 3CSTA 4FJYA 4HCPB 4W9FA 3HK0A 2FUHB 4DDGD 4E3CA 5LLIA 2DZJA 2CKHB 2UWQA 3DQVA 3GOEA 4NJ7A 4I6LB 3PTFC 1WJNA 2KX3A 4II3B 1WX9A 3ZKJC 3AULA 4EZKA 2D3GA 1WYWB 3C0RB 3K9PB 3N30A 3V6CB 4E71A 2PJHA 4ZRIA 2AL3A 2MP2A 4YL8A 2GBNA 4AOFA 2L05A 1E90A 4FHKA 5E6OA 1OGWA 4KDIC 3DBHI 1AARA 4ANUA 1I35A 2GBJA 3A33B 1MG8A 2HTHA 1X1MA 2KDBA 3H6NA 2NBVB 4WJOA 4HVBA 4W9DA 5D7GA 3OJ3A 5D2MB 1WX7A 2PPHA 2C7HA 3DVGY 4JIOU 4TQ1A 5AZHA 3NZSA 4MJSB 2ZNVC 4IM0A 4ANVA 3KUZA 3M95A 2JPHA 3ZVVA 2L3ZA 3TBLD 4GOCA 2R2QA 4GMVA 1F9JA 2DYOA 2O6VD 2ZPYA 1I42A 2LD9A 4BFRA 3L10B 2A5UA 3PRMB 1U4AA 1E7VA 4HCNB 1OQYA 4NAWA 2K8CA 3D32A 4ANXA 4MGKE 2KTRB 3PPAA 4JLCA 4A3PA 2V4LA 3B08A 2IYDB 3A1QB 2AYOB 2LWPA 4KZCA 5G2NA 3RULA 1IYFA 2JZZA 3APCA 4DBGA 1E8XA 1TZ1A 2KN5A 1NBFC 3TCAA 2MLBA 5AEKB 1V6EA 2CU1A 2LVQA 1UBIA 5KHQA 5LXHA 3PRPB 4CYEA 3JSVA 3H7SA 1LM8B 2IZVB 4KV2A 2ZVNA 2AEHA 4M8NA 4CHKA 1ZGUB 3DVGX 1WE7A 2FAZA 2I1JA 4GGQA 4ZRJA 2FCSA 2ZZPB 2Z0EB 3TIXA 2ZCCA 3H1UA 2WX0A 1R4MI 2M8SA 1WF9A 3PREA 2HD5B 3EHVA 2KJ6A 3HM6X 3ML9A 1C3TA 4HJKA 4EZJA 3VTVA 2NR2A 2GBKA 3W1SA 2O2VB 1RRBA 2FIDA 2CHZA 3B1LX 2D10A 4GSWA 4DHJB 4KSLC 1WRDB 4GDLA 2KWCA 2KX0A 4KIKB 5G55A 3VUXA 2MCNB 2LXAA 5DPSA 3ZNZB 1EF1A 2DZMA 4M0WB 4XX5A 2REXA 3R66C 3AU4A 2KDEB 1YQBA 2NPTB 4BBNC 2EMTA 2K8HA 4TQ0A 5JH5C 2BKFA 2DENB 1C1YB 3PGEA 1V5TA 4W9EA 1E8WA 4BOSC 2JZ3B 4K1RB 1WGGA 4F8CB 2KHWB 4I6PA 3BINA 3NHEB 4FN2A 1XD3B 2BKRB 2D2QA 2KMCA 2PE9A 3PZDA 3DBSA 2L7RA 4CO7A 4EZLA 2MRPA 3QC8B 3PSEB 1UELA 2C7NB 3PLUA 3Q3JA 4NY0A 3QWZB 1WM3A 2LGYA 3QJZA 4RM9A 3UIPB 1P0RA 4JQWC 2JUOA 3NS8A 1IPGA 4MGYE 1RFAA 5DPRA 3L54A 4FBJB 2KO3A 1J8CA 2KJRA 3DBLI 3EC8A 1LXDA 1J19A 1WH3A 2WX1A 4GU2A 4G0NB 2D11A 2MBEA 2RSUA 3WA0A 2KDIA 5DPWA 4AUQC 4EFOA 2KC1A 1ZW7A 3VQIA 1L7YA 1UH6A 3RYTA 1SIFA 3B0AA 3Q3FA 1NDDA 1YJ1A 1J0GA 4PS7A 2KWUB 1XQQA 3PRZA 2JWZA 2VRRB 3VUYA 3TL5A 3UQBA 5JZEB 4ZYNA 2LI5A 1OEYJ 2DZIA 4AJYB 1WJ4A 5JHBA 4DWFA 2D07B 3VAWA 4AWJA 3U30A 2BWFA 4DHZB 4LDTB 1Y8RC 2MBQA 3A4RA 1P1AA 2LVPA 4GXBA 1WI0A 2KOXA 4G3XB 4MEMA 2I1KA 3KUDB 4MJSA 4PS8A 1KOTA 3WAOA 3PHXB 1XT9B 2KDFB 2MBHA 4J6IA 4GDKB 3NZUA 4BKTA 2ZEQA 4DHZE 3IHPC 3IVFA 3UIOB 1Q1OA 3V6EB 2NS5A 3IBEA 2J0JA 3DPDA 3QHTA 2CHWA 2LASA 5EDSA 2IO1B 2RPQA 2K1FA 3UQAA 1GUAB 2ZNVB 1YX5B 3AU5A 1OEYA 1E5WA 2N4FA 2KJHB 2N1VA 3KYDD 3WANA 1V86A 4K7SA 5L95C 4TUUA 2KNBA 4MELA 3VVWB 4FADA 1PQSA 1S3SG 4KSKC 1WMHB 1YD8U 3MHSD 4NJ6A 5FR6A 5GMVA 2ZPNA 2KTRA 4W9KA 2BGFA 2OOBB 4NPNA 1WGHA 2KD0A 2KZRA 1WXVA 2G3QB 3A1QA 2LGXA 1D3ZA 4HDOA 2RGFA 3PHWB 2XK5B 4RM8A 3JW0X 4HXDA 1LFDA 2KWVB 1GC6A 4G11A 2RD0A 2N9XA 4X57B 5CHWA 1E8ZA 1M94A 3DOWA 2OJRA 3WAMA 1WJ6A 2JRIB 4JGHB 2KKCA 3RZFA 2BYFA 1L2NA 5E6NA 2EKEC 4II2B 4BKSA 2FCMA 2GBRA 4FJVB 5J17A 2G4SA 3ECIA 1WR1A 3AI5A 3RT3B 1WR6E 3QX1A 3U8ZA 2N9EB 3HIZA 3L13A 4EOYA 2KFJA 3M3JA 3OLMD 3BY4B 3AXCA 1YX6B 2IY1B 1WY8A 4HDQA 3QK0A 1V49A 2BYVE 3WAPA 2AWTA 2IO3B 2O2VA 3RD2A 1V9JA 3A9JB 1H4RA 3APDA 4KIKA 2JT4B 2YLMA 3ENEA 2W9NA 4K7UA 3QAQA 2N9PC 1QZEA 2KANA 5C1ZA 2NPTA 2AL6A 2Z59B 1EF5A 1E7UA 1WFYA 2CHXA 4F1SA 1WZ0A 5BO4B 2DHZA 2FCNA 2MBOA 2DYMA 2ZVOA 4KZ0A 3TJPA 4ZDVA 1TTNA 2LVOA 4OVUA 2IBIB 3H7PB 3ZLZA 3ZW3A 2NBUA 3LDZE 4IWPA 3SHQA 3VUWA 4HPMB 4MGIE 3WALA 4MDKE 3VH4B 2MSED 4W9CA 1WGYA 3RCZA 2B3AA 2G4DB 2XBBC 4BKGA 5IA7A 2CS4A 1CMXB 2K8BA 3ALBA 4F7ZA 4GIVA 2ZCBA 1Z2MA 4JL9A 4HK2A 3GZNI 2YVCA 3ONSA 2KTFA 2V1YA 5J18A 3ZIMA 3MTNB 3H9DA 4W9JA 1UZXB 2KQ7A 4WQOB 4NQLB 4W9LA 2WYQA 4N9F4 1HE8A 4BOZB 5KHOA 3JVZX 1GC7A 3L08A 4IM2A 1NI2A 3A9KB 4IW0A 3ZNID 3QCAA 3VFKA 3W1SC 4E74A 2IO2B 1KM7A 3K9OB 4FJZA 4LJPB 4RMAA 4URKA 3S2AA 1KLVA 2GMIC 3PV1A 4GN1A 3ZDTA 4HWIB 3DVNV 2J0KA 2BYEA 1GNUA 1LQBA 4WWNA 4BKSD 4BVUC 4GB9A 5DCNA 2K25A 2O6VB 3QA8A 4MH0E 3UINB 3A4SC 3EECA 4FHJA 2LRUA 4TV3A 2DZKA 1YIWA 3VTWA 5L83A 3ML8A 5HKHA 2JY6A 2KFKB 2KVRA 1OTRB 2M0XA 4WJQA 4GDKA 1V80A 4EUTA 1EUVB 5TR5A 1ISNA 2JXXA 1ZKHA 4XZ4A 2A4ZA 5J2RA 2MQJA 2PEAA 4DDID 4P7IA 3CF6E 1T0YA 1UGMA 1WJUA 3O65B 4TKNA 3ZTCA 3W1YA 2Z0DB 1GG3A 4PS3A 4I6NB 4PYZA 3VTUA 3LJ3A 3PS6A 1WMHA 2FIFA 2ZJDA 3EFUA 4IM3A 2NVUI 4W9GA 4EEWA 5LXIB 2CR5A 4M8MA 4ICUA 2K39A 2K6DB 4OVVA 4LJOB 4B95A 1WM2A 2WDTB 1RLFA 2N1WA 5IAAC 1EO6A 5CTRC 2XK5A 3KW5B 3SD5A 3T9LA 3VXWA 1S1QB 2BPSA 3ZO5B 2WWZA 3MJWA 2J7QB 4EKUA 3DBRI 2NCNA 2C7MB 4G50A 2MP2B 3V60A 3NOBA 5AZFA 1Q5WB 2R2OA 4FLHA 3RUIB 4KDLB 4B6WA 1WZ3A 2QHOA 3DDCB 4IG7B 4IWQA 3UF8A 4IWOA 1FXTB 3KUCB 1UD7A 3UGBB 2UYZB 1WX8A 4A3OA 3I3TB 4K7WA 3PLVA 4K81A 1SGHA 3X23A 5CX3A 3OJ4B 2DX5B 2GOWA 5D94A 3A9JA 5CHFA 2C60A 1VD2A 3RZWC 1G6JA 2JVCA 2L0FA 4NNJB 1GJZA 4MM3A 4AJWA 1RAXA 4LDTD 2BF8B 2KLGA 3QQ8B 4IC7B 2KQSA 4WJNA 3V61A 1WXAA 3NY5A 3P2BA 2MBBB 4WJPA 3M62B 2KXJA 3OAWA 3N3KB 2RR9A 2NBWB 3KYCD 3VH3B 3ZNGC 2DAJA 2LZ6A 3H7PA 2C9WB 3VHTC 2L76A 4NAWB 5CHVC 3ZDMC 3ZNHB 4BBNF 4DXAB 2N7EA 4B9KA 3ZRCA 4HLEA 3CSFA 4NQKE 2KMAA 2Y5BB 2M17A 1IP9A 3U7DA 3KVFB 3L0WB 1R4NI 2HE7A 2ASQA 2GBMA 3APFA 4MSQB 2MX2A 1TBEA 4FA6A 2MA9B 1UBQA 1WGRA 2L0TA 3JYUA 4W9IA 5C23A 2LXCA 3T8MA 4DK5A 2BWES 3N32A 2N7DA 2DYBA 1V81A 1Z5SB 2HJ8A 1V5OA 1WXMA 3HM3A 3JSVB 3L16A 3SU8X 2EMSA 5D6JB 1BT0A 4LCDE 3DVNU 2V3SA 3DCGA 1P3QU 4ANWA 2L00B 5DPTA 5JHAA 1WXSA 3A9KA 2XEWA 3CMMB 4KVGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1M A;  3WIM A;  5E6P A;  3ZRF A;  2C5L C;  1V2Y A;  3R7Q A;  4ICV A;  4AP4 C;  4FUL A;  4ZRK A;  4A20 A;  2JRH A;  3IFW B;  1SE9 A;  2LGD A;  1WE6 A;  3HHM A;  4WAA A;  3KH0 A;  4GDL B;  1Q0W B;  2PE6 B;  2LRW A;  2O6V A;  3ZUN A;  1JRU A;  2IO0 B;  2MW5 A;  1P98 A;  3ZTD A;  3VDZ A;  2KFK A;  3SDL C;  3TMP B;  4MSM B;  4W9H A;  1KJT A;  1WIA A;  2K6Q A;  4PYU A;  2MWS B;  2KC2 A;  5AZG A;  3R3M A;  1K8R B;  2J0M A;  3R7R A;  2M4N A;  2G45 B;  3M63 B;  4HPL B;  4XC2 A;  1E8Y A;  4MGZ E;  2FCQ A;  2LUE A;  1P9D U;  3L17 A;  1VCB A;  3X0W A;  2LJ5 A;  1H8C A;  1WGD A;  2DAF A;  3QAR A;  4IUM B;  3PT2 B;  3V62 A;  4WWO A;  3IG3 A;  4DHJ D;  1A5R A;  3PVL A;  1TGZ B;  2JF5 A;  4ASW C;  4WWP A;  2FNJ B;  2IY0 B;  3QIJ A;  2KK8 A;  2KLC A;  2L8J A;  3CST A;  4FJY A;  4HCP B;  4W9F A;  3HK0 A;  2FUH B;  4DDG D;  4E3C A;  5LLI A;  2DZJ A;  2CKH B;  2UWQ A;  3DQV A;  3GOE A;  4NJ7 A;  4I6L B;  3PTF C;  1WJN A;  2KX3 A;  4II3 B;  1WX9 A;  3ZKJ C;  3AUL A;  4EZK A;  2D3G A;  1WYW B;  3C0R B;  3K9P B;  3N30 A;  3V6C B;  4E71 A;  2PJH A;  4ZRI A;  2AL3 A;  2MP2 A;  4YL8 A;  2GBN A;  4AOF A;  2L05 A;  1E90 A;  4FHK A;  5E6O A;  1OGW A;  4KDI C;  3DBH I;  1AAR A;  4ANU A;  1I35 A;  2GBJ A;  3A33 B;  1MG8 A;  2HTH A;  1X1M A;  2KDB A;  3H6N A;  2NBV B;  4WJO A;  4HVB A;  4W9D A;  5D7G A;  3OJ3 A;  5D2M B;  1WX7 A;  2PPH A;  2C7H A;  3DVG Y;  4JIO U;  4TQ1 A;  5AZH A;  3NZS A;  4MJS B;  2ZNV C;  4IM0 A;  4ANV A;  3KUZ A;  3M95 A;  2JPH A;  3ZVV A;  2L3Z A;  3TBL D;  4GOC A;  2R2Q A;  4GMV A;  1F9J A;  2DYO A;  2O6V D;  2ZPY A;  1I42 A;  2LD9 A;  4BFR A;  3L10 B;  2A5U A;  3PRM B;  1U4A A;  1E7V A;  4HCN B;  1OQY A;  4NAW A;  2K8C A;  3D32 A;  4ANX A;  4MGK E;  2KTR B;  3PPA A;  4JLC A;  4A3P A;  2V4L A;  3B08 A;  2IYD B;  3A1Q B;  2AYO B;  2LWP A;  4KZC A;  5G2N A;  3RUL A;  1IYF A;  2JZZ A;  3APC A;  4DBG A;  1E8X A;  1TZ1 A;  2KN5 A;  1NBF C;  3TCA A;  2MLB A;  5AEK B;  1V6E A;  2CU1 A;  2LVQ A;  1UBI A;  5KHQ A;  5LXH A;  3PRP B;  4CYE A;  3JSV A;  3H7S A;  1LM8 B;  2IZV B;  4KV2 A;  2ZVN A;  2AEH A;  4M8N A;  4CHK A;  1ZGU B;  3DVG X;  1WE7 A;  2FAZ A;  2I1J A;  4GGQ A;  4ZRJ A;  2FCS A;  2ZZP B;  2Z0E B;  3TIX A;  2ZCC A;  3H1U A;  2WX0 A;  1R4M I;  2M8S A;  1WF9 A;  3PRE A;  2HD5 B;  3EHV A;  2KJ6 A;  3HM6 X;  3ML9 A;  1C3T A;  4HJK A;  4EZJ A;  3VTV A;  2NR2 A;  2GBK A;  3W1S A;  2O2V B;  1RRB A;  2FID A;  2CHZ A;  3B1L X;  2D10 A;  4GSW A;  4DHJ B;  4KSL C;  1WRD B;  4GDL A;  2KWC A;  2KX0 A;  4KIK B;  5G55 A;  3VUX A;  2MCN B;  2LXA A;  5DPS A;  3ZNZ B;  1EF1 A;  2DZM A;  4M0W B;  4XX5 A;  2REX A;  3R66 C;  3AU4 A;  2KDE B;  1YQB A;  2NPT B;  4BBN C;  2EMT A;  2K8H A;  4TQ0 A;  5JH5 C;  2BKF A;  2DEN B;  1C1Y B;  3PGE A;  1V5T A;  4W9E A;  1E8W A;  4BOS C;  2JZ3 B;  4K1R B;  1WGG A;  4F8C B;  2KHW B;  4I6P A;  3BIN A;  3NHE B;  4FN2 A;  1XD3 B;  2BKR B;  2D2Q A;  2KMC A;  2PE9 A;  3PZD A;  3DBS A;  2L7R A;  4CO7 A;  4EZL A;  2MRP A;  3QC8 B;  3PSE B;  1UEL A;  2C7N B;  3PLU A;  3Q3J A;  4NY0 A;  3QWZ B;  1WM3 A;  2LGY A;  3QJZ A;  4RM9 A;  3UIP B;  1P0R A;  4JQW C;  2JUO A;  3NS8 A;  1IPG A;  4MGY E;  1RFA A;  5DPR A;  3L54 A;  4FBJ B;  2KO3 A;  1J8C A;  2KJR A;  3DBL I;  3EC8 A;  1LXD A;  1J19 A;  1WH3 A;  2WX1 A;  4GU2 A;  4G0N B;  2D11 A;  2MBE A;  2RSU A;  3WA0 A;  2KDI A;  5DPW A;  4AUQ C;  4EFO A;  2KC1 A;  1ZW7 A;  3VQI A;  1L7Y A;  1UH6 A;  3RYT A;  1SIF A;  3B0A A;  3Q3F A;  1NDD A;  1YJ1 A;  1J0G A;  4PS7 A;  2KWU B;  1XQQ A;  3PRZ A;  2JWZ A;  2VRR B;  3VUY A;  3TL5 A;  3UQB A;  5JZE B;  4ZYN A;  2LI5 A;  1OEY J;  2DZI A;  4AJY B;  1WJ4 A;  5JHB A;  4DWF A;  2D07 B;  3VAW A;  4AWJ A;  3U30 A;  2BWF A;  4DHZ B;  4LDT B;  1Y8R C;  2MBQ A;  3A4R A;  1P1A A;  2LVP A;  4GXB A;  1WI0 A;  2KOX A;  4G3X B;  4MEM A;  2I1K A;  3KUD B;  4MJS A;  4PS8 A;  1KOT A;  3WAO A;  3PHX B;  1XT9 B;  2KDF B;  2MBH A;  4J6I A;  4GDK B;  3NZU A;  4BKT A;  2ZEQ A;  4DHZ E;  3IHP C;  3IVF A;  3UIO B;  1Q1O A;  3V6E B;  2NS5 A;  3IBE A;  2J0J A;  3DPD A;  3QHT A;  2CHW A;  2LAS A;  5EDS A;  2IO1 B;  2RPQ A;  2K1F A;  3UQA A;  1GUA B;  2ZNV B;  1YX5 B;  3AU5 A;  1OEY A;  1E5W A;  2N4F A;  2KJH B;  2N1V A;  3KYD D;  3WAN A;  1V86 A;  4K7S A;  5L95 C;  4TUU A;  2KNB A;  4MEL A;  3VVW B;  4FAD A;  1PQS A;  1S3S G;  4KSK C;  1WMH B;  1YD8 U;  3MHS D;  4NJ6 A;  5FR6 A;  5GMV A;  2ZPN A;  2KTR A;  4W9K A;  2BGF A;  2OOB B;  4NPN A;  1WGH A;  2KD0 A;  2KZR A;  1WXV A;  2G3Q B;  3A1Q A;  2LGX A;  1D3Z A;  4HDO A;  2RGF A;  3PHW B;  2XK5 B;  4RM8 A;  3JW0 X;  4HXD A;  1LFD A;  2KWV B;  1GC6 A;  4G11 A;  2RD0 A;  2N9X A;  4X57 B;  5CHW A;  1E8Z A;  1M94 A;  3DOW A;  2OJR A;  3WAM A;  1WJ6 A;  2JRI B;  4JGH B;  2KKC A;  3RZF A;  2BYF A;  1L2N A;  5E6N A;  2EKE C;  4II2 B;  4BKS A;  2FCM A;  2GBR A;  4FJV B;  5J17 A;  2G4S A;  3ECI A;  1WR1 A;  3AI5 A;  3RT3 B;  1WR6 E;  3QX1 A;  3U8Z A;  2N9E B;  3HIZ A;  3L13 A;  4EOY A;  2KFJ A;  3M3J A;  3OLM D;  3BY4 B;  3AXC A;  1YX6 B;  2IY1 B;  1WY8 A;  4HDQ A;  3QK0 A;  1V49 A;  2BYV E;  3WAP A;  2AWT A;  2IO3 B;  2O2V A;  3RD2 A;  1V9J A;  3A9J B;  1H4R A;  3APD A;  4KIK A;  2JT4 B;  2YLM A;  3ENE A;  2W9N A;  4K7U A;  3QAQ A;  2N9P C;  1QZE A;  2KAN A;  5C1Z A;  2NPT A;  2AL6 A;  2Z59 B;  1EF5 A;  1E7U A;  1WFY A;  2CHX A;  4F1S A;  1WZ0 A;  5BO4 B;  2DHZ A;  2FCN A;  2MBO A;  2DYM A;  2ZVO A;  4KZ0 A;  3TJP A;  4ZDV A;  1TTN A;  2LVO A;  4OVU A;  2IBI B;  3H7P B;  3ZLZ A;  3ZW3 A;  2NBU A;  3LDZ E;  4IWP A;  3SHQ A;  3VUW A;  4HPM B;  4MGI E;  3WAL A;  4MDK E;  3VH4 B;  2MSE D;  4W9C A;  1WGY A;  3RCZ A;  2B3A A;  2G4D B;  2XBB C;  4BKG A;  5IA7 A;  2CS4 A;  1CMX B;  2K8B A;  3ALB A;  4F7Z A;  4GIV A;  2ZCB A;  1Z2M A;  4JL9 A;  4HK2 A;  3GZN I;  2YVC A;  3ONS A;  2KTF A;  2V1Y A;  5J18 A;  3ZIM A;  3MTN B;  3H9D A;  4W9J A;  1UZX B;  2KQ7 A;  4WQO B;  4NQL B;  4W9L A;  2WYQ A;  4N9F 4;  1HE8 A;  4BOZ B;  5KHO A;  3JVZ X;  1GC7 A;  3L08 A;  4IM2 A;  1NI2 A;  3A9K B;  4IW0 A;  3ZNI D;  3QCA A;  3VFK A;  3W1S C;  4E74 A;  2IO2 B;  1KM7 A;  3K9O B;  4FJZ A;  4LJP B;  4RMA A;  4URK A;  3S2A A;  1KLV A;  2GMI C;  3PV1 A;  4GN1 A;  3ZDT A;  4HWI B;  3DVN V;  2J0K A;  2BYE A;  1GNU A;  1LQB A;  4WWN A;  4BKS D;  4BVU C;  4GB9 A;  5DCN A;  2K25 A;  2O6V B;  3QA8 A;  4MH0 E;  3UIN B;  3A4S C;  3EEC A;  4FHJ A;  2LRU A;  4TV3 A;  2DZK A;  1YIW A;  3VTW A;  5L83 A;  3ML8 A;  5HKH A;  2JY6 A;  2KFK B;  2KVR A;  1OTR B;  2M0X A;  4WJQ A;  4GDK A;  1V80 A;  4EUT A;  1EUV B;  5TR5 A;  1ISN A;  2JXX A;  1ZKH A;  4XZ4 A;  2A4Z A;  5J2R A;  2MQJ A;  2PEA A;  4DDI D;  4P7I A;  3CF6 E;  1T0Y A;  1UGM A;  1WJU A;  3O65 B;  4TKN A;  3ZTC A;  3W1Y A;  2Z0D B;  1GG3 A;  4PS3 A;  4I6N B;  4PYZ A;  3VTU A;  3LJ3 A;  3PS6 A;  1WMH A;  2FIF A;  2ZJD A;  3EFU A;  4IM3 A;  2NVU I;  4W9G A;  4EEW A;  5LXI B;  2CR5 A;  4M8M A;  4ICU A;  2K39 A;  2K6D B;  4OVV A;  4LJO B;  4B95 A;  1WM2 A;  2WDT B;  1RLF A;  2N1W A;  5IAA C;  1EO6 A;  5CTR C;  2XK5 A;  3KW5 B;  3SD5 A;  3T9L A;  3VXW A;  1S1Q B;  2BPS A;  3ZO5 B;  2WWZ A;  3MJW A;  2J7Q B;  4EKU A;  3DBR I;  2NCN A;  2C7M B;  4G50 A;  2MP2 B;  3V60 A;  3NOB A;  5AZF A;  1Q5W B;  2R2O A;  4FLH A;  3RUI B;  4KDL B;  4B6W A;  1WZ3 A;  2QHO A;  3DDC B;  4IG7 B;  4IWQ A;  3UF8 A;  4IWO A;  1FXT B;  3KUC B;  1UD7 A;  3UGB B;  2UYZ B;  1WX8 A;  4A3O A;  3I3T B;  4K7W A;  3PLV A;  4K81 A;  1SGH A;  3X23 A;  5CX3 A;  3OJ4 B;  2DX5 B;  2GOW A;  5D94 A;  3A9J A;  5CHF A;  2C60 A;  1VD2 A;  3RZW C;  1G6J A;  2JVC A;  2L0F A;  4NNJ B;  1GJZ A;  4MM3 A;  4AJW A;  1RAX A;  4LDT D;  2BF8 B;  2KLG A;  3QQ8 B;  4IC7 B;  2KQS A;  4WJN A;  3V61 A;  1WXA A;  3NY5 A;  3P2B A;  2MBB B;  4WJP A;  3M62 B;  2KXJ A;  3OAW A;  3N3K B;  2RR9 A;  2NBW B;  3KYC D;  3VH3 B;  3ZNG C;  2DAJ A;  2LZ6 A;  3H7P A;  2C9W B;  3VHT C;  2L76 A;  4NAW B;  5CHV C;  3ZDM C;  3ZNH B;  4BBN F;  4DXA B;  2N7E A;  4B9K A;  3ZRC A;  4HLE A;  3CSF A;  4NQK E;  2KMA A;  2Y5B B;  2M17 A;  1IP9 A;  3U7D A;  3KVF B;  3L0W B;  1R4N I;  2HE7 A;  2ASQ A;  2GBM A;  3APF A;  4MSQ B;  2MX2 A;  1TBE A;  4FA6 A;  2MA9 B;  1UBQ A;  1WGR A;  2L0T A;  3JYU A;  4W9I A;  5C23 A;  2LXC A;  3T8M A;  4DK5 A;  2BWE S;  3N32 A;  2N7D A;  2DYB A;  1V81 A;  1Z5S B;  2HJ8 A;  1V5O A;  1WXM A;  3HM3 A;  3JSV B;  3L16 A;  3SU8 X;  2EMS A;  5D6J B;  1BT0 A;  4LCD E;  3DVN U;  2V3S A;  3DCG A;  1P3Q U;  4ANW A;  2L00 B;  5DPT A;  5JHA A;  1WXS A;  3A9K A;  2XEW A;  3CMM B;  4KVG B; 
#chains in the Genus database with same CATH topology
 3OWE B;  2M1M A;  3N1Z C;  1N60 A;  3ZRF A;  2JSV X;  1L6U A;  4YTP B;  5G5H A;  1HZ6 A;  1NEN B;  1YOV B;  4ICV A;  4AP4 C;  2BQQ A;  3IFW B;  1SE9 A;  2LGD A;  3HHM A;  4GDL B;  2LRW A;  2PMV A;  1JRU A;  2MW5 A;  1P98 A;  3ZTD A;  2KFK A;  3TMP B;  5EE3 A;  1WIA A;  2K6Q A;  3L4P A;  4YT0 B;  1ET6 A;  3MHZ A;  4HPL B;  1E8Y A;  1P9D U;  3L17 A;  3SFD B;  4YXD B;  2DAF A;  3QAR A;  1VZ6 A;  1SE2 A;  1IBX B;  3IG3 A;  4DHJ D;  3P4S B;  2KK8 A;  3HK0 A;  3GP7 A;  2DZJ A;  3LYY A;  2J53 A;  2OJW A;  1J7B A;  1RM6 C;  3AUL A;  3C0R B;  4E71 A;  2PJH A;  4YL8 A;  3NUH B;  4AOF A;  5E6O A;  3NVV A;  1I35 A;  1ACC A;  1ZOY B;  3PO0 A;  2HTH A;  1UWM A;  3OJ3 A;  2HTM E;  5AZH A;  3BVM A;  3U2S C;  5IN7 A;  4MJS B;  4ANV A;  3R2I A;  5H92 C;  3DWG C;  3M95 A;  4GMV A;  1F9J A;  2DYO A;  2O6V D;  2ZPY A;  1JRO A;  5BYR A;  4BFR A;  1YMH E;  1ZUD 2;  4WIP A;  1K51 A;  3D32 A;  3BVG A;  4ANX A;  4MGK E;  2K22 A;  3TEW A;  2AYO B;  3RUL A;  3APC A;  1E8X A;  1NBF C;  1PYW D;  3TCA A;  3EFC A;  1AYF A;  3H7S A;  4M01 A;  3RNA C;  4M8N A;  2I1J A;  4XYC A;  4ZRJ A;  2Z0E B;  4BZA A;  1JWM D;  3PRE A;  3EHV A;  1BUI C;  3ML9 A;  3VTV A;  2INN E;  2NR2 A;  3HVD A;  3ABV B;  2I2Y A;  4GDL A;  2KX0 A;  1EF1 A;  4XX5 A;  4M0W B;  2RDG A;  4YSY B;  2NPT B;  4TQ0 A;  4K3B A;  2DEN B;  4W9E A;  1HEZ E;  1TY0 A;  1WGG A;  1VZ7 A;  2PE9 A;  2KMC A;  4RGM A;  2BVC A;  2L7R A;  2MJE A;  2C7N B;  2WDQ B;  1WM3 A;  3QJZ A;  3UIP B;  3AEE B;  1IBX A;  4BAX A;  2QDF A;  5DPR A;  1K53 A;  3BYT B;  1DOX A;  3BK2 A;  3DBL I;  3MC0 B;  4G0N B;  2D11 A;  2MBE A;  1AW7 A;  3WA0 A;  1SEB D;  3HVZ A;  1J0G A;  1YJ1 A;  2KWU B;  1XQQ A;  2JXT A;  2JWZ A;  2BYT A;  4YTM B;  3UQB A;  5JZE B;  3GE8 C;  5EE1 A;  4A55 A;  3Q3M C;  3RFZ B;  3VAW A;  4WUR A;  1SE4 A;  3VR8 B;  3U30 A;  2M19 A;  2LVP A;  2KOX A;  2I1K A;  4M00 A;  4MJS A;  3DBR B;  3WAO A;  1XT9 B;  2KDF B;  2MBH A;  3IHP C;  3IVF A;  2KWD A;  1F77 A;  2WGS A;  3QHT A;  2CHW A;  2K1F A;  3UQA A;  2N4F A;  2N1V A;  4K7S A;  1DOY A;  5IKC M;  4LNF A;  4OVZ A;  2KNB A;  3VVW B;  4LNI A;  1S3S G;  3TEX A;  3MHS D;  4NJ6 A;  5GMV A;  3TUO A;  4JE3 B;  2RMM A;  2G3Q B;  4XE0 A;  2RGF A;  2LGS A;  1N62 A;  3RNF C;  1GC6 A;  4X57 B;  1E8Z A;  2JX5 A;  4JGH B;  3RZF A;  2BYF A;  5E6N A;  2EKE C;  4II2 B;  2FCM A;  4FJV B;  2EEL A;  2PVG C;  3ECI A;  3U8Z A;  3P1M A;  3RNE C;  1WY8 A;  2PTL A;  3DHG C;  1AWD A;  2BYV E;  2AWT A;  1H4R A;  1EWY C;  2YLM A;  4REZ A;  4N59 A;  4M0W A;  1WRI A;  2NPT A;  2YEP F;  4F1S A;  4WAF A;  2FCN A;  3ZJV A;  4KZ0 A;  1GAQ B;  3O13 A;  3ZLZ A;  2NBU A;  5G5G A;  3V3X A;  4BKG A;  1Z2M A;  1FFV A;  4HKZ E;  5FR3 A;  3ZIM A;  2WYQ A;  1HE8 A;  1NVI D;  1QQR A;  2IDY A;  3JVZ X;  3A9K B;  3VR9 B;  3DBL B;  2M0A A;  3S2A A;  1GB4 A;  3DVN V;  2PLP A;  1GNU A;  1LQB A;  4BKS D;  3B2F A;  1XLN A;  4FHJ A;  2LRU A;  2VZK B;  4TV3 A;  3Q8A A;  4LNN A;  2KVR A;  1IGD A;  1EUV B;  2N0S B;  2K3U A;  2JXX A;  4XZ4 A;  2A4Z A;  3AB5 A;  2PEA A;  4P7I A;  1WJU A;  4TKN A;  4US8 A;  2NTT A;  1NYQ A;  4PYZ A;  4AQ7 A;  1JWU D;  3LJ3 A;  4GLS C;  2FIF A;  2ZJD A;  5LXI B;  4W9G A;  2K39 A;  1WM2 A;  1V1O A;  5IAA C;  1EO6 A;  1SXT A;  5CTR C;  3PZ7 A;  2JZP A;  3H8H A;  3FIL A;  3ZO5 B;  1FO4 A;  1AN8 A;  3RPF C;  4DQO C;  4OHJ A;  2MP2 B;  4N6E B;  2V3P A;  1Q5W B;  4FLH A;  2QCZ A;  4KDL B;  4B6W A;  4TMA B;  2QHO A;  2WXN A;  3DDC B;  4IWQ A;  4YSZ B;  1WX8 A;  1QOB A;  1TKE A;  3PLV A;  5D3D A;  5CX3 A;  3OJ4 B;  5CHF A;  3VRB B;  1VD2 A;  3RZW C;  2L0F A;  1RAX A;  2WQY B;  1WXA A;  2NBW B;  3VH3 B;  4K3C A;  2C9W B;  2GRI A;  4YTN B;  1TS4 A;  2HJ1 A;  2Y5B B;  1IP9 A;  3KVF B;  3NZ3 A;  2OHF A;  3L0W B;  2HE7 A;  1UBQ A;  1WWT A;  4LK0 M;  1M4V A;  1Z5S B;  3SU8 X;  3HM3 A;  4OZA A;  3AE1 B;  1BT0 A;  3N1X C;  2QSD A;  4LCD E;  5AUI A;  3DVN U;  1SIJ A;  2H88 B;  1WXS A;  3A9K A;  4RNA A;  4W9K A;  3WIM A;  4DXG A;  5E6P A;  2C5L C;  4ZRK A;  2JRH A;  3NJT A;  4USA A;  2KYW A;  2RDB C;  4L1B A;  4JWU C;  3VDZ A;  4MSM B;  4C56 C;  1ZXI A;  2KC2 A;  5AZG A;  3R3M A;  3M63 B;  1GOZ A;  4XC2 A;  2LUE A;  4P1B C;  4IUM B;  2PVO D;  1I4G A;  1SBB B;  1TGZ B;  2Y5P A;  1TKY A;  3PVL A;  2FNJ B;  1CJE A;  3AMZ A;  3SR6 A;  3IXS A;  5HI1 A;  5LLI A;  4XDC A;  4I6L B;  1WJN A;  1DOI A;  4EZK A;  3K9P B;  3N30 A;  3EGR A;  4ZRI A;  2AL3 A;  2MP2 A;  1CZP A;  2L05 A;  4FHK A;  4DXF A;  4KDI C;  2J4X A;  3DBH I;  4HJG E;  4P1C C;  1DGJ A;  1X1M A;  2KDB A;  2Y5C A;  3H6N A;  4WJO A;  4RH6 A;  4HVB A;  5D7G A;  5D2M B;  1MHX A;  3DVG Y;  4JIO U;  4TQ1 A;  4ZRP A;  2JPH A;  3T3N A;  4YSX B;  3L10 B;  2BS4 B;  1U4A A;  3AM9 A;  4HCN B;  1YN4 A;  3TEY A;  4RCO A;  4ZHO A;  4A3P A;  3A1Q B;  4KZC A;  1I4H A;  1IYF A;  2JZZ A;  1STE A;  4DBG A;  1VJK A;  2ON8 A;  2W3R A;  1TS5 A;  1SJH D;  5KHQ A;  4RGT A;  3PRP B;  1T6B X;  1LM8 B;  2FAZ A;  1I4P A;  2ZZP B;  1HQR D;  2WX0 A;  1R4M I;  2WXK A;  3DWM A;  1EM7 A;  4DHJ B;  2KWC A;  5G55 A;  4C7Z A;  4J3O D;  5DPS A;  3ZNZ B;  3ZXV A;  3R66 C;  3AU4 A;  3W2D A;  1I4X A;  2KDE B;  1TZO A;  1WGK A;  2K8H A;  2BKF A;  3FAH A;  1C1Y B;  3URY A;  1WYG A;  4C80 A;  1UUP A;  4K1R B;  2KHW B;  3BIN A;  1XD3 B;  2D2Q A;  3DBS A;  5C2T B;  1TYG B;  2MRP A;  2DNF A;  3QC8 B;  1RWS A;  3PLU A;  3Q3J A;  1PGA A;  3GB1 A;  4NY0 A;  1XCQ L;  1WXQ A;  1P0R A;  4JQW C;  3NS8 A;  2E3T A;  1IPG A;  1L0Y B;  3BYY B;  3L54 A;  4FBJ B;  3BK1 A;  3PZ8 A;  1C4P A;  2PIA A;  1XLQ A;  2KJR A;  2ZW0 A;  3Q69 A;  1J19 A;  2WX1 A;  3E56 A;  2RSU A;  2WDV B;  4EFO A;  1T0S C;  1ZW7 A;  3RYT A;  1KTK A;  1PGB A;  1E7P B;  3I5J C;  1UWX A;  2VRR B;  4HPP A;  4XGA B;  4ZYN A;  2LI5 A;  1OEY J;  2D07 B;  2WXI A;  3P42 A;  2LGI A;  1HXY D;  2N9L A;  5TSS A;  4LTU A;  1IGC A;  1OQQ A;  2L1A A;  3DBH B;  4GXB A;  4MEM A;  2J52 A;  4HRS A;  1KOT A;  4BKT A;  4US9 A;  1N5W A;  5JXV A;  1Q1O A;  3V6E B;  2XNA C;  2J0J A;  1QIL A;  5EDS A;  2IO1 B;  1GPX A;  1J7C A;  1YX5 B;  3HUI A;  2WXQ A;  2KJH B;  5L95 C;  1ENF A;  5BYQ A;  2NMQ A;  4MEL A;  3AED B;  4FAD A;  1WMH B;  2BGF A;  1V97 A;  1TKG A;  1EU3 A;  2KD0 A;  2KZR A;  3MC9 A;  1WXV A;  1FNV A;  3A1Q A;  2LGX A;  1MI0 A;  2XK5 B;  2WXG A;  4RM8 A;  1LFD A;  4G11 A;  4N58 A;  2N9X A;  1KH0 A;  1M94 A;  1SSN A;  3WAM A;  1WJ6 A;  1L2N A;  1NI3 A;  2W55 A;  2GBR A;  2G4S A;  1V8C A;  3AI5 A;  1QT9 A;  2DLB A;  2BB5 A;  1F2R I;  3L13 A;  3ZJU A;  2IY1 B;  2G1E A;  4HDQ A;  3E9S A;  1V49 A;  3WAP A;  2IO3 B;  1V9J A;  3QAQ A;  2BW2 A;  2N9P C;  2KAN A;  2Z59 B;  1E7U A;  1WFY A;  2CHX A;  3C19 A;  3Q8C A;  5BO4 B;  2FBW B;  2V9H A;  3TJP A;  1BXT A;  3ZW3 A;  3H7P B;  3LDZ E;  3SHQ A;  4MDK E;  2GB1 A;  2JYE A;  2B3A A;  2G4D B;  3V05 A;  3EUB 2;  4RF1 A;  1KRH A;  5IA7 A;  2K8B A;  2ZCB A;  4R3D A;  2YVC A;  4HRO A;  2KTF A;  2V1Y A;  3H9D A;  1KF6 B;  4W9L A;  4N9F 4;  1NI2 A;  3ZNI D;  2M56 B;  3W1S C;  4E74 A;  3K9O B;  1K52 A;  4FJZ A;  4LJP B;  1HA5 A;  4URK A;  3WCQ A;  3MC8 A;  1ESF A;  1P7E A;  4GB9 A;  5DCN A;  1A70 A;  3BZD B;  3OG5 A;  4MH0 E;  2RPV A;  3A4S C;  1XLO A;  1E10 A;  3ML8 A;  2JY6 A;  2X8X X;  1OTR B;  2M0X A;  2INP E;  2V3N A;  5TR5 A;  3AH7 A;  2MQJ A;  3ZGZ A;  4H2A A;  4ZYS A;  3PS6 A;  4ZOH C;  1WMH A;  4EEW A;  2CR5 A;  2WDR B;  4WWM A;  4OVV A;  4LJO B;  2KVZ A;  2Z8L A;  2SEB D;  4NAM A;  2N1W A;  2XK5 A;  1CQV A;  1MG4 A;  4TSS A;  2BPS A;  1NYR A;  4EKU A;  2NTS A;  1R7S A;  4G50 A;  1FCC C;  1YJI A;  5AZF A;  3FIL B;  1WZ3 A;  1XF5 L;  1N61 A;  4IG7 B;  4ITK A;  1FXT B;  2X38 A;  5I4D A;  1SGH A;  3X23 A;  1LO5 D;  5D94 A;  4XWT A;  2C60 A;  3BII D;  2JVC A;  4NNJ B;  1OFF A;  1ET9 A;  1Q10 A;  3IAM 1;  1ZDV A;  3QQ8 B;  4RFB A;  3NY5 A;  4WJP A;  3P4R B;  2RR9 A;  2LZ6 A;  3H7P A;  3ZDM C;  4NAW B;  2N7E A;  4B9K A;  3ZRC A;  1XXG A;  2V0G A;  2OED A;  1MPE A;  3AEG B;  1RYJ A;  5D3I B;  1R4N I;  1UGJ A;  2MX2 A;  1TBE A;  2MA9 B;  4DK5 A;  3NVZ A;  3N32 A;  1V81 A;  2B76 B;  2WP9 B;  1V5O A;  1WXM A;  3JSV B;  4QAY A;  5D6J B;  2V3S A;  1FXA A;  4S0R A;  5LNK 1;  2XEW A;  3CMM B;  3R8B A;  2D3A A;  4L23 A;  1P7F A;  3CIR B;  4FUL A;  4A20 A;  1WE6 A;  2Y3A A;  2QJL A;  2PE6 B;  1QOA A;  1ZP0 B;  3KWL A;  3UI3 A;  2IO0 B;  1B1Z A;  2FE8 A;  2JU6 X;  2L83 A;  5MPO A;  4W9H A;  4PYU A;  2M4N A;  3U4E G;  1NEK B;  1XEE A;  4MH8 A;  1JWA D;  4MGZ E;  1VCB A;  2LJ5 A;  1HTQ A;  1WGD A;  4IKG A;  3V62 A;  1UF0 A;  4WWO A;  2AX5 A;  4WWP A;  2IY0 B;  3CST A;  3I9V 1;  4FJY A;  4HCP B;  1SE3 A;  4E3C A;  3DQV A;  3GOE A;  3PTF C;  2INC C;  2SAK A;  1WYW B;  4RGO S;  2FUG 1;  1I4R A;  3W5U B;  2GBN A;  2ACZ B;  4A9A A;  1OGW A;  1AAR A;  4ANU A;  2CJO A;  1MG8 A;  1FEH A;  5IO9 A;  2J42 A;  2NBV B;  4MAC A;  1LGR A;  1YQ3 B;  1WX7 A;  2C7H A;  4LNK A;  2ZNV C;  1JWB D;  4XDD A;  5FK9 C;  2W82 A;  3ZVV A;  2L3Z A;  3TBL D;  1TS2 A;  1FD6 A;  2H89 B;  2VZK D;  3PRM B;  1QOG A;  4KGT A;  1T5X D;  4NAW A;  3AE2 B;  2BS2 B;  2V4L A;  3B08 A;  2LWP A;  2DWQ A;  5G2N A;  3P63 A;  2KN5 A;  1T0R C;  2WXR A;  1F0Z A;  4PK1 A;  5AEK B;  1V6E A;  2LVQ A;  1UBI A;  3KWV A;  4OW0 A;  1C78 A;  4CYE A;  3JSV A;  2IZV B;  4KV2 A;  2ZVN A;  4CHK A;  1WE7 A;  1QKZ A;  1EWC A;  1MVK A;  4GGQ A;  1FXI A;  2LHD A;  2L32 A;  3ZYY X;  1WF9 A;  2HD5 B;  2KJ6 A;  3HM6 X;  4HJK A;  4EZJ A;  3B9J A;  3W1S A;  2O2V B;  2CHZ A;  1PGX A;  2WS3 B;  1WRD B;  4KSL C;  4JX1 C;  2MCN B;  2DZM A;  2REX A;  2KMM A;  1YQB A;  5JH5 C;  3I63 C;  3TEZ A;  3PGE A;  4BOS C;  1E8W A;  2JZ3 B;  4FN2 A;  3PZD A;  3AE4 B;  3PSE B;  1UEL A;  3QWZ B;  2LGY A;  4RM9 A;  4OZB A;  2JUO A;  1SJE D;  1J8C A;  5IOI A;  1XO3 A;  3EC8 A;  1LXD A;  4GU2 A;  4KGS A;  4KKI A;  2KDI A;  5DPW A;  4AUQ C;  1VLB A;  1UH6 A;  5BYS A;  1RFK A;  1SIF A;  3MJ5 A;  3B0A A;  3Q3F A;  1KLG D;  4UDU C;  4PS7 A;  2LHE A;  3PRZ A;  1D5X C;  3VUY A;  3CWI A;  1YJJ A;  2MHJ A;  2WXF A;  2MJ3 A;  5JHB A;  2BWF A;  4DHZ B;  4LDT B;  5IP4 D;  2MBQ A;  1K50 A;  3KQ4 A;  4GDK B;  3NZU A;  4DHZ E;  4LNO A;  3RI7 C;  2NS5 A;  2LAS A;  2RPQ A;  1GUA B;  3J9C A;  2ZNV B;  3AU5 A;  1C9F A;  2VH2 A;  3KYD D;  3WAN A;  1V86 A;  4TUU A;  1PQS A;  1PDX A;  1BML C;  4KSK C;  1L4Z B;  3GE3 C;  2ZPN A;  2N9K A;  4NPN A;  1WGH A;  1L5P A;  1D3Z A;  4HDO A;  3PHW B;  3JW0 X;  4HXD A;  4RGN A;  2OJR A;  2KT7 A;  2KKC A;  1FM0 D;  2BBC A;  1FCL A;  4HKQ A;  1JML A;  2K9X A;  1YN5 A;  3BY4 B;  3RNC C;  1E0Z A;  1N5X A;  3QK0 A;  2WXH A;  2O2V A;  3ENE A;  2ZW1 A;  2W9N A;  4K7U A;  4WQM A;  3LB8 C;  2AL6 A;  3AN1 A;  2AQ1 B;  2DHZ A;  2ZVO A;  2W54 A;  4OVU A;  2IBI B;  2KN4 A;  4IWP A;  3X0W A;  3VH4 B;  2MSE D;  4W9C A;  3RCZ A;  2XBB C;  1MFW A;  5T8I A;  1CMX B;  1FRD A;  4F7Z A;  4JL9 A;  3IT6 B;  2JWU A;  3GZN I;  4IOI E;  5J18 A;  3MTN B;  3FKY A;  1JQ4 A;  3C8Y A;  1OQR A;  5KHO A;  3Q3N C;  4IM2 A;  4ARC A;  3TSS A;  1VDV A;  1JRP A;  3QCA A;  3VFK A;  1Y56 A;  2L52 A;  2IO2 B;  3AEF B;  3ZJT A;  1FRR A;  2KAC A;  4C7Y A;  4HWI B;  2J0K A;  2BYE A;  4WWN A;  4NJC A;  2O6V B;  3UIN B;  1DYQ A;  3EEC A;  5EE0 A;  2DZK A;  1YIW A;  2BS3 B;  5L83 A;  5HKH A;  4WJQ A;  4GDK A;  4EUT A;  1D5Z C;  1D4B A;  1ISN A;  1XCT L;  5BMI A;  5J2R A;  1TT5 B;  3ETR A;  3RNB C;  1T0Y A;  1UGM A;  2Z0D B;  1GG3 A;  3AEC B;  4IM3 A;  2AQ3 B;  2NVU I;  4M8M A;  4ICU A;  2K6D B;  3GS2 A;  4B95 A;  2WDT B;  1RLF A;  3MP9 A;  2D3B A;  3KW5 B;  3SD5 A;  3VXW A;  2BTE A;  1S1Q B;  2WWZ A;  3NS1 A;  3DBR I;  4YWG G;  2NCN A;  1HZ5 A;  5FKA C;  2XN9 C;  1XLP A;  2QMT A;  3KUC B;  4ACF A;  2UYZ B;  2QIE B;  1YN3 A;  1D6E C;  4K81 A;  3W5V B;  5BMG A;  3IT4 B;  4D2K A;  2DX5 B;  3Q2A C;  4C00 A;  1F2R C;  1GJZ A;  2BF8 B;  3V61 A;  4WJN A;  1FNU A;  4PT5 A;  2MBB B;  3M62 B;  2KXJ A;  3OAW A;  3N3K B;  3KYC D;  1R4M B;  2DAJ A;  2DBY A;  1MJD A;  3VHT C;  5E6J A;  4HLE A;  1PUT A;  4NQK E;  1V1P B;  3U7D A;  2ASQ A;  2GBM A;  3APF A;  2G9H D;  4FA6 A;  4JWS C;  1WGR A;  2L0T A;  3JYU A;  3SEB A;  4JPS A;  2CU3 A;  1L6V A;  2HJ8 A;  3L16 A;  1N63 A;  2LMC A;  3GZN B;  1ZDX A;  3DCG A;  4HEA 1;  4ANW A;  2L00 B;  5DPT A;  4C4V B;  4KVG B;  2QC8 A;  4P6V F;  1V2Y A;  3R7Q A;  3MFG A;  2BT6 A;  4A90 A;  2YEP B;  4OZC A;  4WAA A;  3KH0 A;  1Q0W B;  1TS3 A;  2O6V A;  1FFU A;  3ZUN A;  3NG0 A;  4IDI A;  3SDL C;  3AV8 A;  1N6Z A;  1KJT A;  3AEA B;  1YQ4 B;  2MWS B;  1JWS D;  1K8R B;  2J0M A;  3R7R A;  2N7J A;  2G45 B;  3SFE B;  2LUM A;  2FCQ A;  3U7Z A;  4CQN A;  1H8C A;  2MEK A;  2RDH A;  3PT2 B;  1A5R A;  2JF5 A;  4ASW C;  1FNW A;  3QIJ A;  2KLC A;  2L8J A;  3RMK C;  4W9F A;  4DDG D;  2FUH B;  2UWQ A;  2CKH B;  4O1N A;  5H8Y E;  4NJ7 A;  2AQ2 B;  3T3O A;  2KX3 A;  4II3 B;  1WX9 A;  3ZKJ C;  2D3G A;  3V6C B;  4ZHP A;  3Q8F A;  1E90 A;  3I57 A;  3R2T A;  2GBJ A;  3A33 B;  4W9D A;  2MH7 A;  2PPH A;  3VRA B;  1QF6 A;  3NZS A;  1B9R A;  4IM0 A;  1T3Q A;  3KUZ A;  4GOC A;  2R2Q A;  1I42 A;  2LD9 A;  3Q6B A;  2A5U A;  2WXJ A;  1E7V A;  2IGD A;  2GLS A;  1SF0 A;  2WXP A;  1OQY A;  2K8C A;  2KTR B;  2PKO A;  2D5G A;  3PPA A;  1V1P A;  4JLC A;  4AS1 A;  4FXC A;  2IYD B;  2GI9 A;  3DHI C;  1TZ1 A;  4L2Y A;  4EE2 A;  2IPK D;  2MLB A;  3AE9 B;  2CU1 A;  5LXH A;  1IUE A;  2R61 A;  3P4P B;  2AEH A;  3ZXR A;  1C76 A;  1ZGU B;  3DVG X;  4C4V A;  3AE6 B;  2FCS A;  1FMA D;  3TIX A;  2ZCC A;  1C79 A;  3H1U A;  3HRD D;  2M8S A;  4M02 A;  1C3T A;  3Q14 C;  1JCK B;  1ZXH A;  1CK1 A;  2GBK A;  1RRB A;  2FID A;  3B1L X;  4GSW A;  2D10 A;  1QOF A;  3IAS 1;  4KIK B;  3RNG C;  3VUX A;  2LXA A;  3FC4 A;  2WNM A;  4BBN C;  2EMT A;  1I7H A;  1V5T A;  2WXO A;  3ZQ4 A;  4F8C B;  4I6P A;  4ARI A;  3N1Y C;  3NHE B;  4CO7 A;  2BKR B;  4EZL A;  1VZ8 A;  2K5P A;  2HDE A;  2PW9 A;  1J7A A;  2QIL A;  5HHD G;  4MGY E;  1RFA A;  2KO3 A;  4Q2J A;  1WH3 A;  3NRZ A;  2K0P A;  5GXG B;  2KC1 A;  4B0E A;  3VQI A;  3AE8 B;  1L7Y A;  1JW9 D;  1NDD A;  3W9C B;  1E6E B;  3TL5 A;  1D5M C;  1I4Q A;  2EKI A;  2BB6 A;  2DZI A;  4AJY B;  1WJ4 A;  1KFY B;  4DWF A;  4A8X C;  4AWJ A;  3U52 E;  2TSS A;  1Y8R C;  4P16 A;  3A4R A;  1P1A A;  1FPY A;  2LEK A;  1WI0 A;  4G3X B;  3KUD B;  4PS8 A;  1KLU D;  3PHX B;  4J6I A;  2ZEQ A;  3UIO B;  4S17 A;  3EA6 A;  1L4D B;  3IBE A;  4B0M A;  3DPD A;  1OEY A;  1E5W A;  4KKJ A;  3AEB B;  1YD8 U;  2IJ0 A;  3AE5 B;  5FR6 A;  2KTR A;  2OOB B;  1VRA B;  2LFI A;  1ZE3 D;  2KWV B;  1FIQ A;  2RD0 A;  5CHW A;  3DOW A;  4XWW A;  2JRI B;  1YNT E;  4BKS A;  5J17 A;  1WR1 A;  3NVY A;  3RT3 B;  1WR6 E;  3Q8B A;  3QX1 A;  2N9E B;  3HIZ A;  2QEJ C;  4EOY A;  1T0Q C;  2KFJ A;  3M3J A;  3OLM D;  1R4N B;  3AXC A;  1YX6 B;  4WH4 A;  1JAL A;  3RD2 A;  3A9J B;  3APD A;  4KIK A;  2JT4 B;  1GB1 A;  2JYT A;  2Q5W D;  2IGH A;  1QZE A;  4MM3 B;  2KQ4 X;  5C1Z A;  1C77 A;  1EF5 A;  2WLB A;  2WU2 B;  3N9Y C;  1WZ0 A;  1HTO A;  2MBO A;  2DYM A;  4ZDV A;  1TTN A;  2LVO A;  3VUW A;  3WAL A;  4HPM B;  4MGI E;  1WGY A;  1C4C A;  2JQR B;  2CS4 A;  3RN9 C;  3ALB A;  4RF0 A;  4GIV A;  5BMH A;  4HK2 A;  3ONS A;  1ZPS A;  3Q8E A;  4NZL B;  2ICI A;  2VH1 A;  1UZX B;  4W9J A;  2KQ7 A;  4WQO B;  4NQL B;  2ONQ A;  4BOZ B;  1EU4 A;  1GC7 A;  4KX6 B;  3L08 A;  2IND C;  4IW0 A;  1PFD A;  3NVW A;  1L0X B;  1KM7 A;  4RMA A;  1KLV A;  3BVZ A;  5AUK A;  2GMI C;  3PV1 A;  4KGR A;  4GN1 A;  3ZDT A;  2WXL A;  3N20 C;  1VR9 A;  4BVU C;  2K25 A;  3Q3O C;  3BWU D;  3QA8 A;  3DHH C;  1L0V B;  3VTW A;  3LXF A;  4LLG M;  2KFK B;  1TJE A;  1V80 A;  1WSP A;  2E6X A;  2KAJ A;  1ZKH A;  1C4A A;  4DDI D;  5HG2 A;  1TY2 A;  3CF6 E;  3O65 B;  3ZTC A;  3W1Y A;  2IGG A;  2W3S A;  4PS3 A;  4I6N B;  3VTU A;  3EFU A;  1MHH E;  3B2G A;  1ROE A;  3AE7 B;  3T9L A;  3MJW A;  2J7Q B;  3KLS X;  4ZRQ A;  2C7M B;  3V60 A;  3NOB A;  2R2O A;  3RUI B;  3UF8 A;  4IWO A;  5EE9 A;  3UGB B;  1UD7 A;  5HFY A;  4A3O A;  2KDM A;  2UU7 A;  2D3C A;  3I3T B;  4K7W A;  2MJD A;  2GOW A;  3A9J A;  1G6J A;  2V4I B;  1E9M A;  4MM3 A;  4AJW A;  2LJI A;  4LDT D;  2KLG A;  4IC7 B;  2CJN A;  2KQS A;  3P2B A;  5C3J B;  3ZNG C;  4DXA B;  2L76 A;  5CHV C;  4BBN F;  3ZNH B;  1SB3 C;  1TIF A;  2WU5 B;  3CSF A;  2KMA A;  2M17 A;  2I38 A;  1QLB B;  1UNS A;  4MSQ B;  4A6Q A;  4MT5 A;  3T8M A;  3AE3 B;  5C23 A;  4W9I A;  2LXC A;  2BWE S;  1F52 A;  2WXM A;  1F1H A;  2DYB A;  2N7D A;  3P4Q B;  2EMS A;  1P3Q U;  5JHA A;  2WHI A; 
#chains in the Genus database with same CATH homology
 2M1M A;  3WIM A;  5E6P A;  3ZRF A;  2C5L C;  1V2Y A;  3R7Q A;  4ICV A;  4AP4 C;  4FUL A;  4ZRK A;  4A20 A;  2JRH A;  3IFW B;  1SE9 A;  2LGD A;  1WE6 A;  3HHM A;  4WAA A;  3KH0 A;  4GDL B;  1Q0W B;  2PE6 B;  2LRW A;  2O6V A;  3ZUN A;  1JRU A;  2IO0 B;  2MW5 A;  1P98 A;  3ZTD A;  3VDZ A;  2KFK A;  3SDL C;  3TMP B;  4MSM B;  4W9H A;  1KJT A;  1WIA A;  2K6Q A;  4PYU A;  2MWS B;  2KC2 A;  5AZG A;  3R3M A;  1K8R B;  2J0M A;  3R7R A;  2M4N A;  2G45 B;  3M63 B;  4HPL B;  4XC2 A;  1E8Y A;  4MGZ E;  2FCQ A;  2LUE A;  1P9D U;  3L17 A;  1VCB A;  3X0W A;  2LJ5 A;  1H8C A;  1WGD A;  2DAF A;  3QAR A;  4IUM B;  3PT2 B;  3V62 A;  4WWO A;  3IG3 A;  4DHJ D;  1A5R A;  3PVL A;  1TGZ B;  2JF5 A;  4ASW C;  4WWP A;  2FNJ B;  2IY0 B;  3QIJ A;  2KK8 A;  2KLC A;  2L8J A;  3CST A;  4FJY A;  4HCP B;  4W9F A;  3HK0 A;  2FUH B;  4DDG D;  4E3C A;  5LLI A;  2DZJ A;  2CKH B;  2UWQ A;  3DQV A;  3GOE A;  4NJ7 A;  4I6L B;  3PTF C;  1WJN A;  2KX3 A;  4II3 B;  1WX9 A;  3ZKJ C;  3AUL A;  4EZK A;  2D3G A;  1WYW B;  3C0R B;  3K9P B;  3N30 A;  3V6C B;  4E71 A;  2PJH A;  4ZRI A;  2AL3 A;  2MP2 A;  4YL8 A;  2GBN A;  4AOF A;  2L05 A;  1E90 A;  4FHK A;  5E6O A;  1OGW A;  4KDI C;  3DBH I;  1AAR A;  4ANU A;  1I35 A;  2GBJ A;  3A33 B;  1MG8 A;  2HTH A;  1X1M A;  2KDB A;  3H6N A;  2NBV B;  4WJO A;  4HVB A;  4W9D A;  5D7G A;  3OJ3 A;  5D2M B;  1WX7 A;  2PPH A;  2C7H A;  3DVG Y;  4JIO U;  4TQ1 A;  5AZH A;  3NZS A;  4MJS B;  2ZNV C;  4IM0 A;  4ANV A;  3KUZ A;  3M95 A;  2JPH A;  3ZVV A;  2L3Z A;  3TBL D;  4GOC A;  2R2Q A;  4GMV A;  1F9J A;  2DYO A;  2O6V D;  2ZPY A;  1I42 A;  2LD9 A;  4BFR A;  3L10 B;  2A5U A;  3PRM B;  1U4A A;  1E7V A;  4HCN B;  1OQY A;  4NAW A;  2K8C A;  3D32 A;  4ANX A;  4MGK E;  2KTR B;  3PPA A;  4JLC A;  4A3P A;  2V4L A;  3B08 A;  2IYD B;  3A1Q B;  2AYO B;  2LWP A;  4KZC A;  5G2N A;  3RUL A;  1IYF A;  2JZZ A;  3APC A;  4DBG A;  1E8X A;  1TZ1 A;  2KN5 A;  1NBF C;  3TCA A;  2MLB A;  5AEK B;  1V6E A;  2CU1 A;  2LVQ A;  1UBI A;  5KHQ A;  5LXH A;  3PRP B;  4CYE A;  3JSV A;  3H7S A;  1LM8 B;  2IZV B;  4KV2 A;  2ZVN A;  2AEH A;  4M8N A;  4CHK A;  1ZGU B;  3DVG X;  1WE7 A;  2FAZ A;  2I1J A;  4GGQ A;  4ZRJ A;  2FCS A;  2ZZP B;  2Z0E B;  3TIX A;  2ZCC A;  3H1U A;  2WX0 A;  1R4M I;  2M8S A;  1WF9 A;  3PRE A;  2HD5 B;  3EHV A;  2KJ6 A;  3HM6 X;  3ML9 A;  1C3T A;  4HJK A;  4EZJ A;  3VTV A;  2NR2 A;  2GBK A;  3W1S A;  2O2V B;  1RRB A;  2FID A;  2CHZ A;  3B1L X;  2D10 A;  4GSW A;  4DHJ B;  4KSL C;  1WRD B;  4GDL A;  2KWC A;  2KX0 A;  4KIK B;  5G55 A;  3VUX A;  2MCN B;  2LXA A;  5DPS A;  3ZNZ B;  1EF1 A;  2DZM A;  4M0W B;  4XX5 A;  2REX A;  3R66 C;  3AU4 A;  2KDE B;  1YQB A;  2NPT B;  4BBN C;  2EMT A;  2K8H A;  4TQ0 A;  5JH5 C;  2BKF A;  2DEN B;  1C1Y B;  3PGE A;  1V5T A;  4W9E A;  1E8W A;  4BOS C;  2JZ3 B;  4K1R B;  1WGG A;  4F8C B;  2KHW B;  4I6P A;  3BIN A;  3NHE B;  4FN2 A;  1XD3 B;  2BKR B;  2D2Q A;  2KMC A;  2PE9 A;  3PZD A;  3DBS A;  2L7R A;  4CO7 A;  4EZL A;  2MRP A;  3QC8 B;  3PSE B;  1UEL A;  2C7N B;  3PLU A;  3Q3J A;  4NY0 A;  3QWZ B;  1WM3 A;  2LGY A;  3QJZ A;  4RM9 A;  3UIP B;  1P0R A;  4JQW C;  2JUO A;  3NS8 A;  1IPG A;  4MGY E;  1RFA A;  5DPR A;  3L54 A;  4FBJ B;  2KO3 A;  1J8C A;  2KJR A;  3DBL I;  3EC8 A;  1LXD A;  1J19 A;  1WH3 A;  2WX1 A;  4GU2 A;  4G0N B;  2D11 A;  2MBE A;  2RSU A;  3WA0 A;  2KDI A;  5DPW A;  4AUQ C;  4EFO A;  2KC1 A;  1ZW7 A;  3VQI A;  1L7Y A;  1UH6 A;  3RYT A;  1SIF A;  3B0A A;  3Q3F A;  1NDD A;  1YJ1 A;  1J0G A;  4PS7 A;  2KWU B;  1XQQ A;  3PRZ A;  2JWZ A;  2VRR B;  3VUY A;  3TL5 A;  3UQB A;  5JZE B;  4ZYN A;  2LI5 A;  1OEY J;  2DZI A;  4AJY B;  1WJ4 A;  5JHB A;  4DWF A;  2D07 B;  3VAW A;  4AWJ A;  3U30 A;  2BWF A;  4DHZ B;  4LDT B;  1Y8R C;  2MBQ A;  3A4R A;  1P1A A;  2LVP A;  4GXB A;  1WI0 A;  2KOX A;  4G3X B;  4MEM A;  2I1K A;  3KUD B;  4MJS A;  4PS8 A;  1KOT A;  3WAO A;  3PHX B;  1XT9 B;  2KDF B;  2MBH A;  4J6I A;  4GDK B;  3NZU A;  4BKT A;  2ZEQ A;  4DHZ E;  3IHP C;  3IVF A;  3UIO B;  1Q1O A;  3V6E B;  2NS5 A;  3IBE A;  2J0J A;  3DPD A;  3QHT A;  2CHW A;  2LAS A;  5EDS A;  2IO1 B;  2RPQ A;  2K1F A;  3UQA A;  1GUA B;  2ZNV B;  1YX5 B;  3AU5 A;  1OEY A;  1E5W A;  2N4F A;  2KJH B;  2N1V A;  3KYD D;  3WAN A;  1V86 A;  4K7S A;  5L95 C;  4TUU A;  2KNB A;  4MEL A;  3VVW B;  4FAD A;  1PQS A;  1S3S G;  4KSK C;  1WMH B;  1YD8 U;  3MHS D;  4NJ6 A;  5FR6 A;  5GMV A;  2ZPN A;  2KTR A;  4W9K A;  2BGF A;  2OOB B;  4NPN A;  1WGH A;  2KD0 A;  2KZR A;  1WXV A;  2G3Q B;  3A1Q A;  2LGX A;  1D3Z A;  4HDO A;  2RGF A;  3PHW B;  2XK5 B;  4RM8 A;  3JW0 X;  4HXD A;  1LFD A;  2KWV B;  1GC6 A;  4G11 A;  2RD0 A;  2N9X A;  4X57 B;  5CHW A;  1E8Z A;  1M94 A;  3DOW A;  2OJR A;  3WAM A;  1WJ6 A;  2JRI B;  4JGH B;  2KKC A;  3RZF A;  2BYF A;  1L2N A;  5E6N A;  2EKE C;  4II2 B;  4BKS A;  2FCM A;  2GBR A;  4FJV B;  5J17 A;  2G4S A;  3ECI A;  1WR1 A;  3AI5 A;  3RT3 B;  1WR6 E;  3QX1 A;  3U8Z A;  2N9E B;  3HIZ A;  3L13 A;  4EOY A;  2KFJ A;  3M3J A;  3OLM D;  3BY4 B;  3AXC A;  1YX6 B;  2IY1 B;  1WY8 A;  4HDQ A;  3QK0 A;  1V49 A;  2BYV E;  3WAP A;  2AWT A;  2IO3 B;  2O2V A;  3RD2 A;  1V9J A;  3A9J B;  1H4R A;  3APD A;  4KIK A;  2JT4 B;  2YLM A;  3ENE A;  2W9N A;  4K7U A;  3QAQ A;  2N9P C;  1QZE A;  2KAN A;  5C1Z A;  2NPT A;  2AL6 A;  2Z59 B;  1EF5 A;  1E7U A;  1WFY A;  2CHX A;  4F1S A;  1WZ0 A;  5BO4 B;  2DHZ A;  2FCN A;  2MBO A;  2DYM A;  2ZVO A;  4KZ0 A;  3TJP A;  4ZDV A;  1TTN A;  2LVO A;  4OVU A;  2IBI B;  3H7P B;  3ZLZ A;  3ZW3 A;  2NBU A;  3LDZ E;  4IWP A;  3SHQ A;  3VUW A;  4HPM B;  4MGI E;  3WAL A;  4MDK E;  3VH4 B;  2MSE D;  4W9C A;  1WGY A;  3RCZ A;  2B3A A;  2G4D B;  2XBB C;  4BKG A;  5IA7 A;  2CS4 A;  1CMX B;  2K8B A;  3ALB A;  4F7Z A;  4GIV A;  2ZCB A;  1Z2M A;  4JL9 A;  4HK2 A;  3GZN I;  2YVC A;  3ONS A;  2KTF A;  2V1Y A;  5J18 A;  3ZIM A;  3MTN B;  3H9D A;  4W9J A;  1UZX B;  2KQ7 A;  4WQO B;  4NQL B;  4W9L A;  2WYQ A;  4N9F 4;  1HE8 A;  4BOZ B;  5KHO A;  3JVZ X;  1GC7 A;  3L08 A;  4IM2 A;  1NI2 A;  3A9K B;  4IW0 A;  3ZNI D;  3QCA A;  3VFK A;  3W1S C;  4E74 A;  2IO2 B;  1KM7 A;  3K9O B;  4FJZ A;  4LJP B;  4RMA A;  4URK A;  3S2A A;  1KLV A;  2GMI C;  3PV1 A;  4GN1 A;  3ZDT A;  4HWI B;  3DVN V;  2J0K A;  2BYE A;  1GNU A;  1LQB A;  4WWN A;  4BKS D;  4BVU C;  4GB9 A;  5DCN A;  2K25 A;  2O6V B;  3QA8 A;  4MH0 E;  3UIN B;  3A4S C;  3EEC A;  4FHJ A;  2LRU A;  4TV3 A;  2DZK A;  1YIW A;  3VTW A;  5L83 A;  3ML8 A;  5HKH A;  2JY6 A;  2KFK B;  2KVR A;  1OTR B;  2M0X A;  4WJQ A;  4GDK A;  1V80 A;  4EUT A;  1EUV B;  5TR5 A;  1ISN A;  2JXX A;  1ZKH A;  4XZ4 A;  2A4Z A;  5J2R A;  2MQJ A;  2PEA A;  4DDI D;  4P7I A;  3CF6 E;  1T0Y A;  1UGM A;  1WJU A;  3O65 B;  4TKN A;  3ZTC A;  3W1Y A;  2Z0D B;  1GG3 A;  4PS3 A;  4I6N B;  4PYZ A;  3VTU A;  3LJ3 A;  3PS6 A;  1WMH A;  2FIF A;  2ZJD A;  3EFU A;  4IM3 A;  2NVU I;  4W9G A;  4EEW A;  5LXI B;  2CR5 A;  4M8M A;  4ICU A;  2K39 A;  2K6D B;  4OVV A;  4LJO B;  4B95 A;  1WM2 A;  2WDT B;  1RLF A;  2N1W A;  5IAA C;  1EO6 A;  5CTR C;  2XK5 A;  3KW5 B;  3SD5 A;  3T9L A;  3VXW A;  1S1Q B;  2BPS A;  3ZO5 B;  2WWZ A;  3MJW A;  2J7Q B;  4EKU A;  3DBR I;  2NCN A;  2C7M B;  4G50 A;  2MP2 B;  3V60 A;  3NOB A;  5AZF A;  1Q5W B;  2R2O A;  4FLH A;  3RUI B;  4KDL B;  4B6W A;  1WZ3 A;  2QHO A;  3DDC B;  4IG7 B;  4IWQ A;  3UF8 A;  4IWO A;  1FXT B;  3KUC B;  1UD7 A;  3UGB B;  2UYZ B;  1WX8 A;  4A3O A;  3I3T B;  4K7W A;  3PLV A;  4K81 A;  1SGH A;  3X23 A;  5CX3 A;  3OJ4 B;  2DX5 B;  2GOW A;  5D94 A;  3A9J A;  5CHF A;  2C60 A;  1VD2 A;  3RZW C;  1G6J A;  2JVC A;  2L0F A;  4NNJ B;  1GJZ A;  4MM3 A;  4AJW A;  1RAX A;  4LDT D;  2BF8 B;  2KLG A;  3QQ8 B;  4IC7 B;  2KQS A;  4WJN A;  3V61 A;  1WXA A;  3NY5 A;  3P2B A;  2MBB B;  4WJP A;  3M62 B;  2KXJ A;  3OAW A;  3N3K B;  2RR9 A;  2NBW B;  3KYC D;  3VH3 B;  3ZNG C;  2DAJ A;  2LZ6 A;  3H7P A;  2C9W B;  3VHT C;  2L76 A;  4NAW B;  5CHV C;  3ZDM C;  3ZNH B;  4BBN F;  4DXA B;  2N7E A;  4B9K A;  3ZRC A;  4HLE A;  3CSF A;  4NQK E;  2KMA A;  2Y5B B;  2M17 A;  1IP9 A;  3U7D A;  3KVF B;  3L0W B;  1R4N I;  2HE7 A;  2ASQ A;  2GBM A;  3APF A;  4MSQ B;  2MX2 A;  1TBE A;  4FA6 A;  2MA9 B;  1UBQ A;  1WGR A;  2L0T A;  3JYU A;  4W9I A;  5C23 A;  2LXC A;  3T8M A;  4DK5 A;  2BWE S;  3N32 A;  2N7D A;  2DYB A;  1V81 A;  1Z5S B;  2HJ8 A;  1V5O A;  1WXM A;  3HM3 A;  3JSV B;  3L16 A;  3SU8 X;  2EMS A;  5D6J B;  1BT0 A;  4LCD E;  3DVN U;  2V3S A;  3DCG A;  1P3Q U;  4ANW A;  2L00 B;  5DPT A;  5JHA A;  1WXS A;  3A9K A;  2XEW A;  3CMM B;  4KVG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...