2QSDA

Crystal structure of a protein il1583 from idiomarina loihiensis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
146
Chain Sequence
DNKLFLVYVGGTAPGANIELHDIRFVVGPSMEETYPAIRKGWFGTQKGLHLDSFVHLHHVDGYRIHLTSEAPEEKRLYFVNFGEYHDFTVVVADSPQSAKQLARAQFSVDDCLCVDLVDNHYVTLEFDGEQQPLVPDWKGYQPLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized conserved protein
publication title Crystal Structure of a Protein Il1583 from Idiomarina loihiensis.
rcsb
source organism Idiomarina loihiensis
total genus 29
structure length 146
sequence length 174
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07566 DUF1543 Domain of Unknown Function (DUF1543)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qsdA01
3.50.100.10 Alpha Beta 3-Layer(bba) Sandwich protein il1583 fold protein il1583 domain 2qsdA02
2J53A 2QSDA 1XCTL 1FCCC 2JXTA 1Q10A 2NMQA 1P7FA 1EM7A 1XF5L 2N9LA 1KH0A 1MPEA 4HKZE 3V3XA 2I38A 2JU6X 1FCLA 1IGCA 1ZXHA 5BMHA 1IGDA 5HI1A 2RPVA 1HEZE 3FILA 4OZCA 2KDMA 1MHHE 1GB1A 2EELA 2GB1A 2K0PA 2LGIA 3FILB 2N7JA 2KN4A 2PTLA 4OZBA 1P7EA 2J52A 2LHDA 2IGHA 1D4BA 4MACA 5HG2A 2ZW0A 1PGBA 1JMLA 2JSVX 4IOIE 2GI9A 2JZPA 2ONQA 2RMMA 2KACA 4HJGE 5HHDG 1GB4A 1XCQL 5BMIA 2JWUA 1HZ6A 1PGXA 1HZ5A 1QKZA 2LUMA 1K52A 4WH4A 1PGAA 1K51A 1C9FA 2PW9A 5JXVA 1K53A 2IGGA 4KGTA 1K50A 1YMHE 4KGSA 5HFYA 1IBXA 1FD6A 2LHEA 2ZW1A 4D2KA 2OEDA 3MP9A 1IBXB 2ON8A 1YNTE 2PLPA 5BMGA 2QMTA 2I2YA 1F2RC 4OZAA 2KQ4X 1UWXA 1F2RI 2IGDA 2KWDA 3UI3A 1MHXA 4KGRA 4IKGA 1MVKA 2N9KA 1MI0A 4GLSC 3GB1A
chains in the Genus database with same CATH superfamily
1FNVA 3R2IA 2NCNA 1RYJA 1FCCC 1IP9A 4KSKC 2KDBA 4IM3A 4I6NB 1H8CA 2BKRB 2HTHA 2DENB 4BKSD 1SIJA 1P7FA 1X1MA 2MJ3A 3W1SA 4YXDB 1CMXB 2G45B 3AEAB 3A4RA 2H88B 2LWPA 1S1QB 3P63A 4FHJA 5JZEB 1UGJA 4MELA 2KX0A 1ZE3D 3RNBC 1JRPA 2PTLA 2FBWB 2D3BA 1TJEA 2EMTA 3U8ZA 5KHQA 3VTWA 2DYMA 2KO3A 1V97A 1HA5A 3NZSA 2ACZB 2FNJB 1UF0A 2Y3AA 1E7UA 2MBQA 1QOBA 1YJ1A 2JQRB 1WIAA 2DLBA 1PFDA 1V8CA 2LUMA 1K52A 1XLOA 1V1PB 1K51A 5DPTA 1A70A 5JXVA 2INNE 3OWEB 2PE9A 2XEWA 1VZ7A 1I4GA 4BOSC 2AX5A 3WANA 1IUEA 1RAXA 4TV3A 1UELA 3GP7A 4GDLB 1D3ZA 3BYYB 3MTNB 4L2YA 3IAM1 5D3DA 2WQYB 3A4SC 4WJQA 3KWVA 4EE2A 2IPKD 3DWMA 3QX1A 4EZJA 5TSSA 4YWGG 1MHXA 2YLMA 2MW5A 4XDDA 3AI5A 3BY4B 4EZLA 2C60A 4C7ZA 2L83A 2DYBA 2FUG1 3P4QB 1N63A 1ZGUB 4IWQA 4GXBA 2ZPNA 4LNFA 3DBSA 2J4XA 4NAMA 3HM3A 1XO3A 4B0EA 1L2NA 1AYFA 3ZO5B 1WJUA 3AMZA 1FNWA 1GC6A 2MBBB 1R4NB 2HJ8A 2KTRA 1XF5L 3T9LA 2KFKA 1BMLC 3WAOA 4PS7A 2ZEQA 3RFZB 3M3JA 3N3KB 2K6DB 4RF0A 3KLSX 3A9KA 1OEYA 3EFUA 2LRUA 2KN4A 2LASA 2KT7A 4DXAB 4MH0E 1YQBA 1RFKA 2M17A 3ZNZB 2KVZA 2KJ6A 4ASWC 2LI5A 2ZW0A 1QZEA 2N9XA 1JWBD 4I6PA 2C9WB 2G1EA 2GBJA 2KWUB 2BB5A 2NTSA 3UIOB 2M0AA 5G5GA 1P3QU 3P4PB 4WQMA 4RGTA 1WZ3A 4LJPB 1E10A 2LGXA 2K1FA 2PJHA 4A3PA 2KMAA 2M0XA 2WNMA 1N61A 3OJ4B 2CHXA 4RNAA 3U52E 1EUVB 4A6QA 2L0FA 1UGMA 4M00A 1N62A 1FRRA 3U7DA 5G55A 4WJOA 4WWMA 2IZVB 4RF1A 3PS6A 3Q3FA 1D5MC 4FBJB 2W3RA 3Q3OC 2M8SA 4C7YA 3KUZA 1Q0WB 2LUEA 3IG3A 3SFEB 3EGRA 2D2QA 1WXMA 4DDID 3HVZA 5IN7A 1N60A 5L83A 1WR6E 4OVUA 3WCQA 3UQAA 2L00B 1TS4A 2MEKA 3FAHA 3SD5A 1SF0A 4XGAB 1WJ6A 4HK2A 3FKYA 1HTOA 2GRIA 5FKAC 4WAAA 3L16A 1UUPA 3NVVA 2SEBD 2KTRB 3AH7A 2WS3B 3QK0A 4EKUA 4KVGB 4XE0A 2AWTA 2KFKB 3HK0A 1FXTB 4Q2JA 1KLGD 3V60A 4J6IA 2MA9B 1F1HA 2C7HA 1Q1OA 3A9KB 2GOWA 1CZPA 1V9JA 3L10B 2WXQA 5LXHA 2RR9A 2GBMA 1R4MB 1A5RA 3W1YA 2K6QA 2IDYA 3I5JC 3VH3B 3WA0A 3H7PA 2REXA 2WX1A 2C5LC 3DBHB 4ZRKA 1WGGA 2AYOB 3MC0B 1NI2A 1TKYA 2LD9A 3H8HA 1SXTA 1MG4A 3NVWA 1PGAA 3S2AA 3KQ4A 1TY0A 1M4VA 3AEEB 2N0SB 1RLFA 4YTMB 2UYZB 1YX6B 2PIAA 4LLGM 1U4AA 4K3CA 4W9EA 1SB3C 1L7YA 4NQLB 3DVNV 1V5TA 2BYTA 2LXAA 1WJ4A 4MGKE 3HHMA 2J0KA 1KLUD 1F2RC 3U4EG 3CSFA 1E5WA 4B0MA 4M8NA 5G2NA 2QHOA 3AM9A 3PZ7A 4XWWA 4TUUA 2WXFA 4P7IA 3NHEB 4GN1A 3P1MA 2Y5PA 1FIQA 4LNNA 2WP9B 4YSZB 1WM2A 1ZDVA 4TQ0A 3APDA 3L13A 3EUB2 3PTFC 5AUIA 4FJVB 3KW5B 3MHSD 4WQOB 3C8YA 2VRRB 1TYGB 2BWFA 3URYA 1JROA 3DQVA 2MBHA 1IGDA 1AW7A 2OJRA 1WXAA 2JPHA 1WWTA 1WRIA 2DX5B 4KKIA 2A5UA 1T6BX 2GB1A 2N7JA 4OZBA 4GOCA 3B2GA 1SE2A 2PE6B 2XK5A 2FCQA 3AE7B 1TKGA 2Y5CA 5FK9C 3Q8AA 1TTNA 4XX5A 4DWFA 3H7PB 5BYSA 2DZIA 1WGRA 4KZ0A 3JYUA 2YEPF 5LXIB 3HM6X 5C2TB 4EEWA 2N9EB 4IUMB 2V3NA 1OEYJ 5DCNA 2LRWA 5E6OA 2O6VD 1R4MI 1Z5SB 2MJDA 3MP9A 4LTUA 1VJKA 2TSSA 3AE3B 4IM2A 3DBHI 3V62A 1FFUA 2KQ4X 3QQ8B 1UH6A 3I63C 1ACCA 2UU7A 2LJIA 4KGRA 4FJYA 3U7ZA 4KX6B 1Y8RC 3T3NA 1MI0A 2GBNA 2KHWB 1YN5A 2IO2B 2KQSA 2JVCA 1TKEA 2DWQA 3VTVA 3R7RA 2ZPYA 4G0NB 3ENEA 1WJNA 1STEA 2AQ2B 5J2RA 1C4AA 1WE6A 3MHZA 2NBUA 4W9FA 5D6JB 3RULA 2KC2A 4MT5A 4LNIA 3V3XA 2I38A 3Q14C 3AXCA 4RFBA 3OLMD 4BFRA 2DNFA 2BS2B 1IPGA 2LJ5A 3PZ8A 4PYZA 1HEZE 4G11A 3VDZA 5DPRA 1J8CA 2FIDA 4PT5A 1PQSA 1WX9A 4JIOU 5H8YE 1J0GA 2LHDA 2KMMA 2XK5B 2KJRA 4LNOA 3NUHB 2X8XX 2KLGA 5C3JB 1TBEA 2JWZA 3CSTA 3VUXA 1HE8A 4NQKE 3NG0A 2WDQB 1JW9D 4RGMA 5E6JA 3W2DA 3ZNID 1DOIA 4KIKA 4IM0A 1TT5B 3RI7C 2MRPA 3H7SA 4N59A 3TEZA 4IG7B 1RFAA 3ZNGC 1VRAB 2X38A 1KOTA 4KDIC 1UNSA 2K8BA 2JX5A 2KAJA 3NZUA 2ON8A 4LCDE 3ZW3A 1WGHA 1QOFA 1V49A 4HCNB 1XLPA 1WRDB 2MP2A 2J42A 3R2TA 4ZOHC 2BB6A 1ISNA 1JWSD 1Z2MA 4EZKA 3GE3C 4FJZA 3LYYA 5AEKB 2OJWA 1WZ0A 2QIEB 4FN2A 5IA7A 4BAXA 3PV1A 1TS3A 2H89B 2K39A 1EU3A 3O13A 2NPTA 3TBLD 2NMQA 2ZNVC 3WAPA 3UF8A 2N1VA 1FCLA 4YTNB 1V81A 1EF5A 3LXFA 4HEA1 2PEAA 4P16A 3M62B 4GMVA 4RCOA 1P9DU 2BWES 4MSMB 3VQIA 2Q5WD 1WGYA 1RRBA 4DBGA 4GSWA 3NS1A 2ZJDA 2BS3B 4JLCA 5GXGB 1E7PB 2KQ7A 1JMLA 2JSVX 4RM9A 1MG8A 1KM7A 2JZPA 3J9CA 4MJSA 2KACA 4WJNA 5EE3A 5LNK1 4REZA 3R3MA 1J7BA 4HPPA 1VCBA 3AECB 4LDTB 1F52A 1QKZA 4TMAB 3BK1A 5AZHA 4ANWA 4CO7A 4BKTA 5LLIA 1I4QA 2Z59B 3B2FA 4LJOB 1OFFA 4KZCA 2AQ1B 4KIKB 1ZPSA 5IOIA 3E56A 4ANUA 5HFYA 2WGSA 3A9JA 1ZP0B 1RWSA 3H6NA 4XWTA 2J0MA 2W82A 1YOVB 2WXLA 3SEBA 4OVVA 4H2AA 2ZCBA 1QILA 2BTEA 3APCA 5IP4D 2MP2B 2QC8A 2XNAC 1QT9A 4HDQA 1WX7A 4MGZE 1ROEA 2W9NA 3RCZA 4PK1A 2ZZPB 3MFGA 3ZVVA 2QDFA 1T5XD 1MFWA 4S0RA 3MJ5A 1L6UA 4LK0M 3VR9B 2WDVB 3ZGZA 2WXPA 2WU5B 2NPTB 2VH1A 3LDZE 1E6EB 1JRUA 4F8CB 4F7ZA 4ZYNA 1JCKB 1WFYA 4KKJA 2INPE 3GE8C 2JZZA 1AN8A 1VZ6A 4OZCA 2AL6A 1YQ3B 3KYDD 2W3SA 1T0SC 4W9GA 2Y5BB 4ICUA 1JWAD 1K8RB 3IAS1 1WH3A 1OGWA 2Z0EB 3RNEC 2IGHA 1YQ4B 2FCMA 4ZYSA 1ZXIA 2CU3A 3KVFB 4NY0A 1KTKA 4HJGE 4DHZE 3RZFA 1GB4A 1F0ZA 2MCNB 2JWUA 4MJSB 2KC1A 1HZ6A 2KMCA 1PGXA 4P1CC 3JVZX 5E6PA 2XBBC 2WWZA 5T8IA 1L0VB 4NZLB 3B08A 1ZDXA 3VTUA 5G5HA 1BUIC 5BO4B 4W9JA 2BKFA 3A9JB 4DXGA 4HCPB 5DPSA 2CHWA 1XXGA 3IVFA 5AZFA 1WXQA 1YX5B 4OZAA 3OG5A 3N1XC 4WWOA 1WGDA 1E8YA 4C80A 1I7HA 3UI3A 5C1ZA 4I6LB 1KLVA 1N5XA 3IXSA 4TSSA 2RDBC 4FA6A 3PRPB 2OOBB 2PMVA 1SGHA 1UZXB 2RDHA 4TQ1A 1FPYA 3BWUD 2O6VA 3NRZA 3ZRCA 5EE1A 2KNBA 3PHXB 1D6EC 4OHJA 4GDKA 3D32A 3TCAA 1KH0A 5CX3A 4WURA 2BW2A 1IGCA 1L0XB 1MJDA 1YD8U 3DBRB 3IT4B 4ZRQA 2L7RA 1FNUA 3Q6BA 2LVOA 3KYCD 3LB8C 3CIRB 1GB1A 1WMHA 3DPDA 4KV2A 1P7EA 2W54A 3VAWA 3IHPC 1XT9B 3A33B 5AUKA 1P1AA 2BVCA 4QAYA 1ET6A 3AU5A 3TJPA 2GI9A 3W1SC 3WAMA 2ONQA 4K7WA 4KSLC 3IT6B 2KN5A 4K3BA 3CMMB 4A9AA 2V3SA 3P4SB 4NPNA 1S3SG 1GC7A 2KDIA 4NNJB 1E7VA 1SE9A 2PW9A 2IGGA 2KANA 3Q2AC 2HE7A 1FRDA 2L0TA 4YT0B 4RGNA 1Y56A 3KUCB 4II3B 1WSPA 3OJ3A 1L4DB 1YJIA 1SE3A 2G9HD 3BYTB 1V80A 2MLBA 3RPFC 5I4DA 1WXSA 2JZ3B 3ZDTA 1KJTA 3BVMA 2Z8LA 3PZDA 1E8ZA 4C56C 2MHJA 3ZTCA 5L95C 1T0RC 2AL3A 1LXDA 2K3UA 2GBKA 3M95A 2K22A 4ZRPA 2LFIA 4DQOC 2O6VB 4ITKA 4J3OD 2L05A 4HVBA 1KF6B 4GDKB 2BYFA 3SR6A 5BMHA 1LFDA 2GMIC 2C7NB 4BZAA 4US8A 2G4SA 1EF1A 2V1YA 2EMSA 2N7DA 4YTPB 4W9KA 1WMHB 3V6CB 3N9YC 3JSVA 2JUOA 3EA6A 4AJYB 3V05A 5HG2A 1V86A 1DOXA 2BS4B 1GG3A 1FXIA 3PSEB 3DBRI 2WXIA 4US9A 1XCQL 2HJ1A 1L4ZB 2JXXA 1NI3A 2CJOA 1K53A 3DBLB 5BYQA 5JH5C 2WU2B 4HKQA 3KUDB 3RNCC 3SFDB 2V4LA 2LHEA 1DOYA 3Q3JA 4ANVA 4BKSA 1YNTE 2QMTA 2WXMA 2KWCA 3M63B 3IFWB 3QCAA 3RT3B 4K7SA 2KD0A 4B95A 2LEKA 4AJWA 1MVKA 3RN9C 2N9KA 1L0YB 2N7EA 4UDUC 4DDGD 3KH0A 2IY1B 4WWPA 3T8MA 2K5PA 1XCTL 2ICIA 3OAWA 2JXTA 1F9JA 1GNUA 3PPAA 3TEYA 3IBEA 2OHFA 2B3AA 2I1JA 5FR3A 1NEKB 3ZTDA 4EOYA 1ZXHA 2N4FA 3AU4A 3RMKC 1I42A 1C77A 4ZRIA 1QLBB 5CTRC 3AE2B 3AEDB 2EKEC 2WXRA 2L3ZA 2K8HA 4JQWC 4DHZB 4ACFA 1UBQA 2L76A 2Z0DB 1TS5A 2CHZA 3JSVB 3I57A 4JL9A 4B6WA 4WWNA 2EKIA 2UWQA 4M02A 4P6VF 4WAFA 2JY6A 3K9OB 2B76B 2CJNA 3UIPB 2DYOA 1B9RA 2RGFA 1C4PA 3NY5A 4HRSA 5CHWA 4NJ6A 4WH4A 5CHFA 2J7QB 1TIFA 4M0WA 3RD2A 3I3TB 3ZYYX 1JWUD 4C4VA 3MC8A 2NBWB 2W55A 2MBOA 3NVZA 3ZQ4A 2IO3B 2MSED 4IW0A 4BBNC 2WXGA 2M4NA 2PLPA 1WGKA 3BIID 3QAQA 4YSYB 1FXAA 2BGFA 2GLSA 4PS8A 4IWPA 1BXTA 4DXFA 3T3OA 2FUHB 3P4RB 1YJJA 3ABVB 1C1YB 1V1OA 2WHIA 4CQNA 2PKOA 4OVZA 3NZ3A 1NVID 4A90A 3DBLI 2WYQA 4ARCA 3H1UA 4MGIE 3MC9A 2BQQA 3ONSA 4GIVA 2VZKD 1ZOYB 4W9HA 1AWDA 1T3QA 4HROA 4DHJD 2NR2A 3PLUA 4MH8A 3VRAB 3AEFB 1N6ZA 3BINA 4B9KA 3ETRA 3MJWA 1SSNA 3VUWA 3QHTA 4RMAA 1WE7A 3VUYA 1UD7A 3GZNI 4ZDVA 4M8MA 2ZVOA 1C3TA 4C00A 1MHHE 1L5PA 4N9F4 1BT0A 4DK5A 2LVQA 3CWIA 1ZUD2 3E9SA 1J7CA 2D3CA 1SIFA 1SJED 3N30A 3WALA 2IYDB 3UINB 3VFKA 3AEGB 5JHAA 1V5OA 1J7AA 2AQ3B 1G6JA 2KDFB 4JX1C 3PVLA 4FLHA 2IO0B 3HRDD 3DHGC 3R7QA 1ZW7A 3EHVA 2K8CA 2QCZA 3ZJUA 2CR5A 4RGOS 3KWLA 4BOZB 4M0WB 3UQBA 1YMHE 1WM3A 4JWUC 5IAAC 1FM0D 4FULA 4C4VB 3RNGC 4PS3A 4AUQC 2HDEA 2QJLA 1WXVA 1V2YA 2KYWA 2D07B 1B1ZA 3DOWA 4W9LA 3DHIC 4BVUC 1QOAA 5GMVA 4IWOA 2LGYA 3ZJVA 5MPOA 3FC4A 3SDLC 2HD5B 1FO4A 3QC8B 2N9PC 3EFCA 3V61A 2FCNA 1KFYB 1GUAB 4G3XB 3HIZA 1OTRB 3X23A 5J18A 1ZKHA 2BYVE 3QIJA 5D94A 3QARA 4E3CA 4W9IA 2DBYA 2PVGC 2LZ6A 3GOEA 3HVDA 3RZWC 2KDMA 4K1RB 1AARA 1JWMD 3TEWA 1N5WA 4FHKA 3NOBA 3TIXA 2ZVNA 2KOXA 2N1WA 3Q3MC 2J0JA 4YL8A 2RMMA 2JT4B 5EDSA 2C7MB 1XLQA 2MBEA 1EU4A 4G50A 5D3IB 1P0RA 4KDLB 3LJ3A 1XEEA 1D5XC 1C9FA 2FAZA 3PLVA 3AE1B 3L54A 1EWYC 2DAJA 4NAWA 3BVGA 3NS8A 2MJEA 2PVOD 4WJPA 5KHOA 1FD6A 2MWSB 3L17A 4ZHOA 3ZDMC 2ZW1A 4MSQB 4D2KA 2FCSA 3VRBB 3K9PB 2E6XA 3ZLZA 4W9DA 5TR5A 4A3OA 2I2YA 3Q3NC 1EO6A 1UWXA 2KZRA 2CS4A 2JRIB 4LDTD 3B1LX 1YN4A 5H92C 1CK1A 5JHBA 2V3PA 3AE9B 4K81A 1WX8A 3SU8X 2DZMA 3WIMA 1WYWB 4MGYE 3RYTA 3GB1A 4ANXA 4NJ7A 2K25A 4PYUA 5BYRA 1Q10A 1SEBD 3BK2A 4S17A 5DPWA 2BYEA 1I35A 1EM7A 3DVNU 2AEHA 3N20C 4XC2A 4JGHB 1VD2A 2LVPA 4ZHPA 3RNAC 4IC7B 1RM6C 4TKNA 5EE0A 4HXDA 3V6EB 2L8JA 2J52A 1E9MA 2DZJA 2PPHA 2D5GA 2V0GA 1GAQB 3N1ZC 1ESFA 3AN1A 3Q69A 2NVUI 2A4ZA 3P42A 1WR1A 3QA8A 3ZIMA 3EC8A 2K9XA 3QJZA 1WYGA 2D11A 2RD0A 2BT6A 2KDEB 4KGTA 1E90A 3ZXVA 1K50A 4NAWB 1OQYA 3PHWB 3ZJTA 3L4PA 3I9V1 3HUIA 2L1AA 3PRMB 5BMGA 3AEBB 1GOZA 3Q8EA 4BKGA 1T0QC 3ZNHB 1HTQA 3ML9A 3TSSA 4K7UA 2R61A 1WI0A 2WLBA 2KWDA 2WXKA 3H9DA 1VLBA 2YVCA 2KK8A 2WDTB 5FR6A 4AOFA 3C0RB 1NDDA 4GLSC 2QEJC 1C4CA 2DHZA 4JWSC 3U2SC 2J53A 2QSDA 3ZRFA 2WXJA 2D3AA 2RSUA 2MQJA 3EECA 2JYTA 1UWMA 3L0WB 2N9LA 4HKZE 1R4NI 4YSXB 3U30A 2JU6X 1ET9A 5J17A 3AE4B 2RPVA 3PREA 5IKCM 2IBIB 1IYFA 4P1BC 5IO9A 3UGBB 3B0AA 3DWGC 4FXCA 3N32A 3PRZA 3L08A 1TGZB 2NBVB 4XDCA 1XQQA 2RDGA 4LNKA 3A1QA 3VVWB 4RH6A 1JALA 1D4BA 4MACA 4BBNF 3P2BA 2HTME 4AS1A 4X57B 4GB9A 1I4HA 4RM8A 1HZ5A 3W9CB 1LM8B 1L6VA 3ECIA 1HQRD 4OW0A 3DVGX 5CHVC 2FIFA 1GPXA 2QILA 1NYQA 1XLNA 3AE5B 5D7GA 1NENB 1M94A 3B9JA 4GGQA 3BZDB 3W5UB 3PO0A 5HKHA 4A20A 3Q8CA 5D2MB 1VR9A 1YN3A 2LXCA 4MM3A 1Q5WB 4HPMB 1R7SA 1F2RI 1QOGA 1SE4A 3TEXA 1QQRA 1OQQA 1TS2A 2WX0A 4WIPA 3QWZB 4HPLB 4L23A 4II2B 4HDOA 3C19A 1EWCA 3AE6B 1PDXA 4IDIA 3N1YC 1E0ZA 1E8XA 1I4RA 4CYEA 2G4DB 2ASQA 1LGRA 2M1MA 3ZXRA 2VH2A 4CHKA 2IJ0A 3TUOA 2SAKA 3GZNB 1VDVA 3DDCB 3SHQA 5HI1A 4EUTA 2L52A 3W5VB 3TL5A 4A8XC 2MX2A 2KXJA 3FILA 2KKCA 3VXWA 2LGIA 2K0PA 2INCC 2LMCA 3APFA 1C79A 1PUTA 2O2VA 3ALBA 3AULA 3O65B 4HJKA 1C76A 3A1QB 1PGBA 2VZKB 3NJTA 4IOIE 5E6NA 3BVZA 4DHJB 4JPSA 5BMIA 4R3DA 2CKHB 1TY2A 4N58A 4N6EB 1VZ8A 2R2OA 2MH7A 4W9CA 2V4IB 1C78A 4URKA 1OQRA 2KLCA 2DAFA 4AQ7A 1NYRA 2I1KA 4ARIA 1IBXA 3Q8FA 2INDC 2JF5A 3NVYA 4AWJA 1WY8A 4ICVA 4MDKE 2IGDA 2ZNVB 4FADA 3GS2A 4MM3B 2E3TA 3DCGA 5EE9A 3VH4B 2YEPB 4USAA 2RPQA 1UBIA 3CF6E 2JRHA 5AZGA 1DGJA 4GU2A 4EFOA 1GJZA 2JYEA 4HLEA 3DHHC 4HWIB 2FE8A 1T0YA 3AB5A 3ML8A 1CJEA 4NJCA 2KX3A 1I4XA 4AP4C 2IY0B 2KTFA 3R66C 1MPEA 2LGDA 2R2QA 1ENFA 3PT2B 2G3QB 2WXHA 1FMAD 1FEHA 1CQVA 3DVGY 1NBFC 1XD3B 1J19A 2EELA 2WDRB 2M19A 3FILB 3JW0X 1E8WA 2BBCA 3TMPB 2NS5A 1HXYD 1I4PA 1SBBB 2D10A 1P98A 2KJHB 1FFVA 3Q8BA 3VHTC 2O2VB 1TZOA 3VR8B 3AV8A 1H4RA 3R8BA 3RUIB 2WXNA 5HHDG 2ZCCA 2BF8B 3ZKJC 1F77A 4MEMA 1V1PA 3PGEA 3RNFC 4E71A 2KWVB 2V9HA 1D5ZC 1DYQA 5C23A 3X0WA 2D3GA 2BPSA 4XYCA 4GDLA 2WXOA 1V6EA 4KGSA 2KFJA 1YIWA 2OEDA 2DZKA 2L32A 1IBXB 4ZRJA 1SJHD 2CU1A 4O1NA 3ZUNA 1KRHA 2XN9C 4A55A 1WF9A 1JQ4A 1PYWD 1LO5D 1TZ1A 1QF6A 4M01A 2NTTA 2KVRA 2M56B 4XZ4A 4F1SA 4JE3B 1LQBA 4IKGA 2LGSA 4E74A 2GBRA 4L1BA 3AE8B 2IO1B
chains in the Genus database with same CATH topology
1FNVA 1TKEA 2DWQA 3R2IA 1RYJA 1FCCC 1STEA 2AQ2B 2K22A 4ZRPA 1C4AA 2LFIA 5BYRA 1Q10A 3MHZA 4DQOC 1SEBD 3BK2A 4ITKA 4J3OD 1SIJA 1P7FA 1EM7A 4MT5A 2MJ3A 3V3XA 2I38A 3W1SA 4YXDB 1KF6B 4GDKB 4RFBA 5BMHA 3SR6A 3AEAB 2BS2B 2H88B 3PZ8A 1HEZE 4ZHPA 3P63A 1UGJA 4PT5A 4US8A 1ZE3D 1JRPA 1RM6C 2PTLA 2FBWB 4YTPB 1TJEA 5EE0A 5H8YE 3N9YC 2J52A 1E9MA 3EA6A 2DYMA 2LHDA 3V05A 2D5GA 2KMMA 2V0GA 5HG2A 1GAQB 1V97A 1HA5A 1DOXA 3NUHB 1ESFA 2BS4B 2ACZB 3AN1A 3Q69A 5C3JB 1FXIA 2Y3AA 3P42A 2WXIA 4US9A 1XCQL 1QOBA 2K9XA 2WDQB 2JQRB 1L4ZB 2DLBA 1PFDA 1V8CA 1JW9D 2LUMA 1K52A 1NI3A 1XLOA 4RGMA 2CJOA 5E6JA 1V1PB 3W2DA 1K51A 1A70A 5JXVA 1DOIA 1WYGA 2INNE 3OWEB 1K53A 5BYQA 2BT6A 1VZ7A 1I4GA 4KGTA 4N59A 3TEZA 2AX5A 1K50A 2WU2B 4NAWB 4HKQA 1IUEA 3SFDB 1VRAB 2X38A 3ZJTA 2LHEA 3GP7A 4GDLB 3L4PA 1UNSA 3I9V1 2JX5A 2KAJA 3HUIA 2L1AA 3BYYB 2ON8A 1YNTE 4L2YA 5BMGA 2QMTA 2WXMA 3AEBB 3IAM1 5D3DA 1GOZA 2WQYB 3Q8EA 1QOFA 3TSSA 1XLPA 3KWVA 4EE2A 2J42A 2IPKD 2R61A 3DWMA 2WLBA 2KWDA 5TSSA 2WXKA 3R2TA 4ZOHC 2BB6A 4YWGG 1MHXA 2LEKA 1JWSD 1VLBA 4XDDA 1MVKA 2N9KA 1L0YB 4C7ZA 2L83A 1DOYA 2FUG1 3P4QB 4UDUC 1N63A 3LYYA 4GLSC 2QEJC 1C4CA 4JWSC 2QIEB 3U2SC 2J53A 2QSDA 2J4XA 4NAMA 2K5PA 1XCTL 2ICIA 1TS3A 2H89B 2JXTA 1EU3A 1XO3A 2WXJA 4B0EA 3O13A 1AYFA 3AMZA 1FNWA 2JYTA 3TEYA 2NMQA 1UWMA 2OHFA 1XF5L 2N9LA 4HKZE 4YSXB 5FR3A 1NEKB 2JU6X 1FCLA 1ET9A 4YTNB 1BMLC 1ZXHA 3AE4B 3LXFA 4HEA1 3RFZB 2RPVA 4P16A 1C77A 4RCOA 4RF0A 3KLSX 3VQIA 2Q5WD 1QLBB 3AE2B 3AEDB 3DWGC 4FXCA 2KN4A 2WXRA 3NS1A 4XDCA 1RFKA 2BS3B 2RDGA 5GXGB 4RH6A 1JALA 1D4BA 1E7PB 1TS5A 4MACA 2ZW0A 3I57A 1JWBD 1JMLA 2EKIA 2G1EA 2JSVX 2BB5A 2NTSA 2HTME 2M0AA 2JZPA 3J9CA 5G5GA 2KACA 4AS1A 5EE3A 4P6VF 3P4PB 4WQMA 4WAFA 4RGTA 1I4HA 5LNK1 4REZA 2B76B 1J7BA 1E10A 2CJNA 2DYOA 3AECB 1HZ5A 3W9CB 1B9RA 1L6VA 1QKZA 1C4PA 4HRSA 1HQRD 4OW0A 4TMAB 3BK1A 4WH4A 2WNMA 4M0WA 1GPXA 2QILA 1N61A 1I4QA 1NYQA 1XLNA 3AE5B 1JWUD 3B2FA 4RNAA 1OFFA 5D7GA 2AQ1B 3U52E 3ZYYX 4A6QA 1NENB 3B9JA 1ZPSA 3E56A 2W55A 1N62A 5HFYA 1FRRA 3BZDB 3NVZA 3ZQ4A 4WWMA 3W5UB 3PO0A 1ZP0B 1RWSA 2WXGA 2PLPA 4RF1A 4XWTA 1WGKA 3BIID 4YSYB 1D5MC 1FXAA 2W82A 3Q8CA 1VR9A 1YN3A 2W3RA 2WXLA 3SEBA 1BXTA 4H2AA 4DXFA 1QILA 3T3OA 3P4RB 1YJJA 2BTEA 1R7SA 3ABVB 4C7YA 1F2RI 1QOGA 1V1OA 4CQNA 2PKOA 4OVZA 2XNAC 3NZ3A 1NVID 1SE4A 3TEXA 1QQRA 4A90A 1OQQA 1TS2A 4ARCA 1QT9A 4WIPA 3EGRA 3SFEB 4L23A 1ROEA 3HVZA 3MFGA 1EWCA 1N60A 2VZKD 3AE6B 1PDXA 1ZOYB 1AWDA 1T3QA 4HROA 4IDIA 1T5XD 3WCQA 1E0ZA 1I4RA 3MJ5A 1L6UA 4LK0M 1TS4A 2MEKA 2WDVB 2WXPA 3FAHA 3VR9B 3ZGZA 1SF0A 2WU5B 4MH8A 3VRAB 3AEFB 2IJ0A 3TUOA 2GRIA 5FKAC 3ETRA 1E6EB 1UUPA 3NVVA 1JCKB 2SAKA 2SEBD 1SSNA 3AH7A 1VDVA 2WS3B 4KKJA 2INPE 4XE0A 5HI1A 2L52A 3W5VB 4A8XC 4Q2JA 3FILA 1AN8A 1KLGD 1VZ6A 4OZCA 1MHHE 2LGIA 2K0PA 1YQ3B 1L5PA 2W3SA 2LMCA 1CZPA 3CWIA 1JWAD 3IAS1 1C79A 1PUTA 1ZUD2 2WXQA 3E9SA 1J7CA 2IGHA 1YQ4B 1C76A 1SJED 2IDYA 1PGBA 4ZYSA 2VZKB 4IOIE 1ZXIA 2CU3A 3BVZA 3AEGB 1KTKA 1J7AA 4HJGE 1GB4A 4JPSA 1F0ZA 2AQ3B 4R3DA 5BMIA 2JWUA 3MC0B 1TKYA 1HZ6A 4JX1C 1PGXA 3H8HA 1SXTA 1TY2A 4N58A 3NVWA 1VZ8A 3HRDD 4N6EB 1PGAA 2MH7A 3KQ4A 1TY0A 2V4IB 1M4VA 3ZJUA 1C78A 3AEEB 4RGOS 2N0SB 3KWLA 1OQRA 4YTMB 2PIAA 4LLGM 5T8IA 4AQ7A 1L0VB 1NYRA 1YMHE 4JWUC 1FM0D 1SB3C 4NZLB 4ARIA 1IBXA 3Q8FA 1ZDXA 5G5HA 1BUIC 2BYTA 3NVYA 4DXGA 2HDEA 1XXGA 2QJLA 1WXQA 1KLUD 1F2RC 4OZAA 3U4EG 1B1ZA 4C80A 4B0MA 2IGDA 1I7HA 3GS2A 3AM9A 2E3TA 3PZ7A 4MM3B 3UI3A 4XWWA 5EE9A 2WXFA 1N5XA 3IXSA 4TSSA 1QOAA 2YEPB 4USAA 3P1MA 1DGJA 2Y5PA 1FIQA 2PMVA 2JYEA 2RDHA 2WP9B 4YSZB 3ZJVA 5MPOA 4TQ1A 2FE8A 3FC4A 3BWUD 1ZDVA 3NRZA 4TQ0A 1FO4A 5AUIA 3EUB2 3AB5A 5EE1A 1CJEA 1D6EC 3C8YA 4NJCA 1I4XA 4OHJA 1KFYB 1TYGB 3URYA 1KH0A 1MPEA 1ENFA 1JROA 4WURA 2BW2A 1IGCA 1L0XB 3IT4B 4ZRQA 1IGDA 1AW7A 2DBYA 2PVGC 1FNUA 2WXHA 3HVDA 1WWTA 1FMAD 3LB8C 1FEHA 1CQVA 1WRIA 2KDMA 3CIRB 4KKIA 1GB1A 1T6BX 2EELA 2GB1A 2WDRB 2M19A 3FILB 2N7JA 1JWMD 3TEWA 4OZBA 1N5WA 2BBCA 1HXYD 1SE2A 3B2GA 1P7EA 2W54A 1I4PA 1SBBB 5AUKA 1FFVA 1ET6A 3Q8BA 3AE7B 1TKGA 1TZOA 2Y5CA 5FK9C 3Q8AA 2GI9A 3VR8B 3AV8A 3R8BA 2ONQA 2RMMA 2WXNA 5HHDG 3IT6B 1XLQA 1EU4A 4A9AA 5BYSA 1F77A 5D3IB 1V1PA 3P4SB 1XEEA 1D5XC 2YEPF 1C9FA 2PW9A 1D5ZC 1DYQA 5C2TB 3AE1B 2IGGA 1EWYC 2V3NA 3BVGA 1FRDA 4YT0B 4RGNA 1Y56A 2MJEA 1WSPA 2PVOD 2WXOA 1L4DB 4KGSA 1FD6A 4ZHOA 2MJDA 2ZW1A 1YJIA 4D2KA 1SE3A 2OEDA 3VRBB 3MP9A 2L32A 1IBXB 2G9HD 1SJHD 2E6XA 3BYTB 4O1NA 1KRHA 4LTUA 1VJKA 2TSSA 2XN9C 3RPFC 4A55A 3AE3B 2I2YA 5I4DA 1JQ4A 1PYWD 1LO5D 1QF6A 1FFUA 2KQ4X 2NTTA 1UWXA 2M56B 1ACCA 3BVMA 2LJIA 4JE3B 4IKGA 1YN4A 2Z8LA 1CK1A 4KGRA 2V3PA 5H92C 3AE9B 3U7ZA 4KX6B 4C56C 4L1BA 3T3NA 1MI0A 1YN5A 3AE8B 2K3UA 3GB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J53 A;  2QSD A;  1XCT L;  1FCC C;  2JXT A;  1Q10 A;  2NMQ A;  1P7F A;  1EM7 A;  1XF5 L;  2N9L A;  1KH0 A;  1MPE A;  4HKZ E;  3V3X A;  2I38 A;  2JU6 X;  1FCL A;  1IGC A;  1ZXH A;  5BMH A;  1IGD A;  5HI1 A;  2RPV A;  1HEZ E;  3FIL A;  4OZC A;  2KDM A;  1MHH E;  1GB1 A;  2EEL A;  2GB1 A;  2K0P A;  2LGI A;  3FIL B;  2N7J A;  2KN4 A;  2PTL A;  4OZB A;  1P7E A;  2J52 A;  2LHD A;  2IGH A;  1D4B A;  4MAC A;  5HG2 A;  2ZW0 A;  1PGB A;  1JML A;  2JSV X;  4IOI E;  2GI9 A;  2JZP A;  2ONQ A;  2RMM A;  2KAC A;  4HJG E;  5HHD G;  1GB4 A;  1XCQ L;  5BMI A;  2JWU A;  1HZ6 A;  1PGX A;  1HZ5 A;  1QKZ A;  2LUM A;  1K52 A;  4WH4 A;  1PGA A;  1K51 A;  1C9F A;  2PW9 A;  5JXV A;  1K53 A;  2IGG A;  4KGT A;  1K50 A;  1YMH E;  4KGS A;  5HFY A;  1IBX A;  1FD6 A;  2LHE A;  2ZW1 A;  4D2K A;  2OED A;  3MP9 A;  1IBX B;  2ON8 A;  1YNT E;  2PLP A;  5BMG A;  2QMT A;  2I2Y A;  1F2R C;  4OZA A;  2KQ4 X;  1UWX A;  1F2R I;  2IGD A;  2KWD A;  3UI3 A;  1MHX A;  4KGR A;  4IKG A;  1MVK A;  2N9K A;  1MI0 A;  4GLS C;  3GB1 A; 
#chains in the Genus database with same CATH topology
 1FNV A;  3R2I A;  2NCN A;  1RYJ A;  1FCC C;  1IP9 A;  4KSK C;  2KDB A;  4IM3 A;  4I6N B;  1H8C A;  2BKR B;  2HTH A;  2DEN B;  4BKS D;  1SIJ A;  1P7F A;  1X1M A;  2MJ3 A;  3W1S A;  4YXD B;  1CMX B;  2G45 B;  3AEA B;  3A4R A;  2H88 B;  2LWP A;  1S1Q B;  3P63 A;  4FHJ A;  5JZE B;  1UGJ A;  4MEL A;  2KX0 A;  1ZE3 D;  3RNB C;  1JRP A;  2PTL A;  2FBW B;  2D3B A;  1TJE A;  2EMT A;  3U8Z A;  5KHQ A;  3VTW A;  2DYM A;  2KO3 A;  1V97 A;  1HA5 A;  3NZS A;  2ACZ B;  2FNJ B;  1UF0 A;  2Y3A A;  1E7U A;  2MBQ A;  1QOB A;  1YJ1 A;  2JQR B;  1WIA A;  2DLB A;  1PFD A;  1V8C A;  2LUM A;  1K52 A;  1XLO A;  1V1P B;  1K51 A;  5DPT A;  1A70 A;  5JXV A;  2INN E;  3OWE B;  2PE9 A;  2XEW A;  1VZ7 A;  1I4G A;  4BOS C;  2AX5 A;  3WAN A;  1IUE A;  1RAX A;  4TV3 A;  1UEL A;  3GP7 A;  4GDL B;  1D3Z A;  3BYY B;  3MTN B;  4L2Y A;  3IAM 1;  5D3D A;  2WQY B;  3A4S C;  4WJQ A;  3KWV A;  4EE2 A;  2IPK D;  3DWM A;  3QX1 A;  4EZJ A;  5TSS A;  4YWG G;  1MHX A;  2YLM A;  2MW5 A;  4XDD A;  3AI5 A;  3BY4 B;  4EZL A;  2C60 A;  4C7Z A;  2L83 A;  2DYB A;  2FUG 1;  3P4Q B;  1N63 A;  1ZGU B;  4IWQ A;  4GXB A;  2ZPN A;  4LNF A;  3DBS A;  2J4X A;  4NAM A;  3HM3 A;  1XO3 A;  4B0E A;  1L2N A;  1AYF A;  3ZO5 B;  1WJU A;  3AMZ A;  1FNW A;  1GC6 A;  2MBB B;  1R4N B;  2HJ8 A;  2KTR A;  1XF5 L;  3T9L A;  2KFK A;  1BML C;  3WAO A;  4PS7 A;  2ZEQ A;  3RFZ B;  3M3J A;  3N3K B;  2K6D B;  4RF0 A;  3KLS X;  3A9K A;  1OEY A;  3EFU A;  2LRU A;  2KN4 A;  2LAS A;  2KT7 A;  4DXA B;  4MH0 E;  1YQB A;  1RFK A;  2M17 A;  3ZNZ B;  2KVZ A;  2KJ6 A;  4ASW C;  2LI5 A;  2ZW0 A;  1QZE A;  2N9X A;  1JWB D;  4I6P A;  2C9W B;  2G1E A;  2GBJ A;  2KWU B;  2BB5 A;  2NTS A;  3UIO B;  2M0A A;  5G5G A;  1P3Q U;  3P4P B;  4WQM A;  4RGT A;  1WZ3 A;  4LJP B;  1E10 A;  2LGX A;  2K1F A;  2PJH A;  4A3P A;  2KMA A;  2M0X A;  2WNM A;  1N61 A;  3OJ4 B;  2CHX A;  4RNA A;  3U52 E;  1EUV B;  4A6Q A;  2L0F A;  1UGM A;  4M00 A;  1N62 A;  1FRR A;  3U7D A;  5G55 A;  4WJO A;  4WWM A;  2IZV B;  4RF1 A;  3PS6 A;  3Q3F A;  1D5M C;  4FBJ B;  2W3R A;  3Q3O C;  2M8S A;  4C7Y A;  3KUZ A;  1Q0W B;  2LUE A;  3IG3 A;  3SFE B;  3EGR A;  2D2Q A;  1WXM A;  4DDI D;  3HVZ A;  5IN7 A;  1N60 A;  5L83 A;  1WR6 E;  4OVU A;  3WCQ A;  3UQA A;  2L00 B;  1TS4 A;  2MEK A;  3FAH A;  3SD5 A;  1SF0 A;  4XGA B;  1WJ6 A;  4HK2 A;  3FKY A;  1HTO A;  2GRI A;  5FKA C;  4WAA A;  3L16 A;  1UUP A;  3NVV A;  2SEB D;  2KTR B;  3AH7 A;  2WS3 B;  3QK0 A;  4EKU A;  4KVG B;  4XE0 A;  2AWT A;  2KFK B;  3HK0 A;  1FXT B;  4Q2J A;  1KLG D;  3V60 A;  4J6I A;  2MA9 B;  1F1H A;  2C7H A;  1Q1O A;  3A9K B;  2GOW A;  1CZP A;  1V9J A;  3L10 B;  2WXQ A;  5LXH A;  2RR9 A;  2GBM A;  1R4M B;  1A5R A;  3W1Y A;  2K6Q A;  2IDY A;  3I5J C;  3VH3 B;  3WA0 A;  3H7P A;  2REX A;  2WX1 A;  2C5L C;  3DBH B;  4ZRK A;  1WGG A;  2AYO B;  3MC0 B;  1NI2 A;  1TKY A;  2LD9 A;  3H8H A;  1SXT A;  1MG4 A;  3NVW A;  1PGA A;  3S2A A;  3KQ4 A;  1TY0 A;  1M4V A;  3AEE B;  2N0S B;  1RLF A;  4YTM B;  2UYZ B;  1YX6 B;  2PIA A;  4LLG M;  1U4A A;  4K3C A;  4W9E A;  1SB3 C;  1L7Y A;  4NQL B;  3DVN V;  1V5T A;  2BYT A;  2LXA A;  1WJ4 A;  4MGK E;  3HHM A;  2J0K A;  1KLU D;  1F2R C;  3U4E G;  3CSF A;  1E5W A;  4B0M A;  4M8N A;  5G2N A;  2QHO A;  3AM9 A;  3PZ7 A;  4XWW A;  4TUU A;  2WXF A;  4P7I A;  3NHE B;  4GN1 A;  3P1M A;  2Y5P A;  1FIQ A;  4LNN A;  2WP9 B;  4YSZ B;  1WM2 A;  1ZDV A;  4TQ0 A;  3APD A;  3L13 A;  3EUB 2;  3PTF C;  5AUI A;  4FJV B;  3KW5 B;  3MHS D;  4WQO B;  3C8Y A;  2VRR B;  1TYG B;  2BWF A;  3URY A;  1JRO A;  3DQV A;  2MBH A;  1IGD A;  1AW7 A;  2OJR A;  1WXA A;  2JPH A;  1WWT A;  1WRI A;  2DX5 B;  4KKI A;  2A5U A;  1T6B X;  2GB1 A;  2N7J A;  4OZB A;  4GOC A;  3B2G A;  1SE2 A;  2PE6 B;  2XK5 A;  2FCQ A;  3AE7 B;  1TKG A;  2Y5C A;  5FK9 C;  3Q8A A;  1TTN A;  4XX5 A;  4DWF A;  3H7P B;  5BYS A;  2DZI A;  1WGR A;  4KZ0 A;  3JYU A;  2YEP F;  5LXI B;  3HM6 X;  5C2T B;  4EEW A;  2N9E B;  4IUM B;  2V3N A;  1OEY J;  5DCN A;  2LRW A;  5E6O A;  2O6V D;  1R4M I;  1Z5S B;  2MJD A;  3MP9 A;  4LTU A;  1VJK A;  2TSS A;  3AE3 B;  4IM2 A;  3DBH I;  3V62 A;  1FFU A;  2KQ4 X;  3QQ8 B;  1UH6 A;  3I63 C;  1ACC A;  2UU7 A;  2LJI A;  4KGR A;  4FJY A;  3U7Z A;  4KX6 B;  1Y8R C;  3T3N A;  1MI0 A;  2GBN A;  2KHW B;  1YN5 A;  2IO2 B;  2KQS A;  2JVC A;  1TKE A;  2DWQ A;  3VTV A;  3R7R A;  2ZPY A;  4G0N B;  3ENE A;  1WJN A;  1STE A;  2AQ2 B;  5J2R A;  1C4A A;  1WE6 A;  3MHZ A;  2NBU A;  4W9F A;  5D6J B;  3RUL A;  2KC2 A;  4MT5 A;  4LNI A;  3V3X A;  2I38 A;  3Q14 C;  3AXC A;  4RFB A;  3OLM D;  4BFR A;  2DNF A;  2BS2 B;  1IPG A;  2LJ5 A;  3PZ8 A;  4PYZ A;  1HEZ E;  4G11 A;  3VDZ A;  5DPR A;  1J8C A;  2FID A;  4PT5 A;  1PQS A;  1WX9 A;  4JIO U;  5H8Y E;  1J0G A;  2LHD A;  2KMM A;  2XK5 B;  2KJR A;  4LNO A;  3NUH B;  2X8X X;  2KLG A;  5C3J B;  1TBE A;  2JWZ A;  3CST A;  3VUX A;  1HE8 A;  4NQK E;  3NG0 A;  2WDQ B;  1JW9 D;  4RGM A;  5E6J A;  3W2D A;  3ZNI D;  1DOI A;  4KIK A;  4IM0 A;  1TT5 B;  3RI7 C;  2MRP A;  3H7S A;  4N59 A;  3TEZ A;  4IG7 B;  1RFA A;  3ZNG C;  1VRA B;  2X38 A;  1KOT A;  4KDI C;  1UNS A;  2K8B A;  2JX5 A;  2KAJ A;  3NZU A;  2ON8 A;  4LCD E;  3ZW3 A;  1WGH A;  1QOF A;  1V49 A;  4HCN B;  1XLP A;  1WRD B;  2MP2 A;  2J42 A;  3R2T A;  4ZOH C;  2BB6 A;  1ISN A;  1JWS D;  1Z2M A;  4EZK A;  3GE3 C;  4FJZ A;  3LYY A;  5AEK B;  2OJW A;  1WZ0 A;  2QIE B;  4FN2 A;  5IA7 A;  4BAX A;  3PV1 A;  1TS3 A;  2H89 B;  2K39 A;  1EU3 A;  3O13 A;  2NPT A;  3TBL D;  2NMQ A;  2ZNV C;  3WAP A;  3UF8 A;  2N1V A;  1FCL A;  4YTN B;  1V81 A;  1EF5 A;  3LXF A;  4HEA 1;  2PEA A;  4P16 A;  3M62 B;  4GMV A;  4RCO A;  1P9D U;  2BWE S;  4MSM B;  3VQI A;  2Q5W D;  1WGY A;  1RRB A;  4DBG A;  4GSW A;  3NS1 A;  2ZJD A;  2BS3 B;  4JLC A;  5GXG B;  1E7P B;  2KQ7 A;  1JML A;  2JSV X;  4RM9 A;  1MG8 A;  1KM7 A;  2JZP A;  3J9C A;  4MJS A;  2KAC A;  4WJN A;  5EE3 A;  5LNK 1;  4REZ A;  3R3M A;  1J7B A;  4HPP A;  1VCB A;  3AEC B;  4LDT B;  1F52 A;  1QKZ A;  4TMA B;  3BK1 A;  5AZH A;  4ANW A;  4CO7 A;  4BKT A;  5LLI A;  1I4Q A;  2Z59 B;  3B2F A;  4LJO B;  1OFF A;  4KZC A;  2AQ1 B;  4KIK B;  1ZPS A;  5IOI A;  3E56 A;  4ANU A;  5HFY A;  2WGS A;  3A9J A;  1ZP0 B;  1RWS A;  3H6N A;  4XWT A;  2J0M A;  2W82 A;  1YOV B;  2WXL A;  3SEB A;  4OVV A;  4H2A A;  2ZCB A;  1QIL A;  2BTE A;  3APC A;  5IP4 D;  2MP2 B;  2QC8 A;  2XNA C;  1QT9 A;  4HDQ A;  1WX7 A;  4MGZ E;  1ROE A;  2W9N A;  3RCZ A;  4PK1 A;  2ZZP B;  3MFG A;  3ZVV A;  2QDF A;  1T5X D;  1MFW A;  4S0R A;  3MJ5 A;  1L6U A;  4LK0 M;  3VR9 B;  2WDV B;  3ZGZ A;  2WXP A;  2WU5 B;  2NPT B;  2VH1 A;  3LDZ E;  1E6E B;  1JRU A;  4F8C B;  4F7Z A;  4ZYN A;  1JCK B;  1WFY A;  4KKJ A;  2INP E;  3GE8 C;  2JZZ A;  1AN8 A;  1VZ6 A;  4OZC A;  2AL6 A;  1YQ3 B;  3KYD D;  2W3S A;  1T0S C;  4W9G A;  2Y5B B;  4ICU A;  1JWA D;  1K8R B;  3IAS 1;  1WH3 A;  1OGW A;  2Z0E B;  3RNE C;  2IGH A;  1YQ4 B;  2FCM A;  4ZYS A;  1ZXI A;  2CU3 A;  3KVF B;  4NY0 A;  1KTK A;  4HJG E;  4DHZ E;  3RZF A;  1GB4 A;  1F0Z A;  2MCN B;  2JWU A;  4MJS B;  2KC1 A;  1HZ6 A;  2KMC A;  1PGX A;  4P1C C;  3JVZ X;  5E6P A;  2XBB C;  2WWZ A;  5T8I A;  1L0V B;  4NZL B;  3B08 A;  1ZDX A;  3VTU A;  5G5H A;  1BUI C;  5BO4 B;  4W9J A;  2BKF A;  3A9J B;  4DXG A;  4HCP B;  5DPS A;  2CHW A;  1XXG A;  3IVF A;  5AZF A;  1WXQ A;  1YX5 B;  4OZA A;  3OG5 A;  3N1X C;  4WWO A;  1WGD A;  1E8Y A;  4C80 A;  1I7H A;  3UI3 A;  5C1Z A;  4I6L B;  1KLV A;  1N5X A;  3IXS A;  4TSS A;  2RDB C;  4FA6 A;  3PRP B;  2OOB B;  2PMV A;  1SGH A;  1UZX B;  2RDH A;  4TQ1 A;  1FPY A;  3BWU D;  2O6V A;  3NRZ A;  3ZRC A;  5EE1 A;  2KNB A;  3PHX B;  1D6E C;  4OHJ A;  4GDK A;  3D32 A;  3TCA A;  1KH0 A;  5CX3 A;  4WUR A;  2BW2 A;  1IGC A;  1L0X B;  1MJD A;  1YD8 U;  3DBR B;  3IT4 B;  4ZRQ A;  2L7R A;  1FNU A;  3Q6B A;  2LVO A;  3KYC D;  3LB8 C;  3CIR B;  1GB1 A;  1WMH A;  3DPD A;  4KV2 A;  1P7E A;  2W54 A;  3VAW A;  3IHP C;  1XT9 B;  3A33 B;  5AUK A;  1P1A A;  2BVC A;  4QAY A;  1ET6 A;  3AU5 A;  3TJP A;  2GI9 A;  3W1S C;  3WAM A;  2ONQ A;  4K7W A;  4KSL C;  3IT6 B;  2KN5 A;  4K3B A;  3CMM B;  4A9A A;  2V3S A;  3P4S B;  4NPN A;  1S3S G;  1GC7 A;  2KDI A;  4NNJ B;  1E7V A;  1SE9 A;  2PW9 A;  2IGG A;  2KAN A;  3Q2A C;  2HE7 A;  1FRD A;  2L0T A;  4YT0 B;  4RGN A;  1Y56 A;  3KUC B;  4II3 B;  1WSP A;  3OJ3 A;  1L4D B;  1YJI A;  1SE3 A;  2G9H D;  3BYT B;  1V80 A;  2MLB A;  3RPF C;  5I4D A;  1WXS A;  2JZ3 B;  3ZDT A;  1KJT A;  3BVM A;  2Z8L A;  3PZD A;  1E8Z A;  4C56 C;  2MHJ A;  3ZTC A;  5L95 C;  1T0R C;  2AL3 A;  1LXD A;  2K3U A;  2GBK A;  3M95 A;  2K22 A;  4ZRP A;  2LFI A;  4DQO C;  2O6V B;  4ITK A;  4J3O D;  2L05 A;  4HVB A;  1KF6 B;  4GDK B;  2BYF A;  3SR6 A;  5BMH A;  1LFD A;  2GMI C;  2C7N B;  4BZA A;  4US8 A;  2G4S A;  1EF1 A;  2V1Y A;  2EMS A;  2N7D A;  4YTP B;  4W9K A;  1WMH B;  3V6C B;  3N9Y C;  3JSV A;  2JUO A;  3EA6 A;  4AJY B;  3V05 A;  5HG2 A;  1V86 A;  1DOX A;  2BS4 B;  1GG3 A;  1FXI A;  3PSE B;  3DBR I;  2WXI A;  4US9 A;  1XCQ L;  2HJ1 A;  1L4Z B;  2JXX A;  1NI3 A;  2CJO A;  1K53 A;  3DBL B;  5BYQ A;  5JH5 C;  2WU2 B;  4HKQ A;  3KUD B;  3RNC C;  3SFD B;  2V4L A;  2LHE A;  1DOY A;  3Q3J A;  4ANV A;  4BKS A;  1YNT E;  2QMT A;  2WXM A;  2KWC A;  3M63 B;  3IFW B;  3QCA A;  3RT3 B;  4K7S A;  2KD0 A;  4B95 A;  2LEK A;  4AJW A;  1MVK A;  3RN9 C;  2N9K A;  1L0Y B;  2N7E A;  4UDU C;  4DDG D;  3KH0 A;  2IY1 B;  4WWP A;  3T8M A;  2K5P A;  1XCT L;  2ICI A;  3OAW A;  2JXT A;  1F9J A;  1GNU A;  3PPA A;  3TEY A;  3IBE A;  2OHF A;  2B3A A;  2I1J A;  5FR3 A;  1NEK B;  3ZTD A;  4EOY A;  1ZXH A;  2N4F A;  3AU4 A;  3RMK C;  1I42 A;  1C77 A;  4ZRI A;  1QLB B;  5CTR C;  3AE2 B;  3AED B;  2EKE C;  2WXR A;  2L3Z A;  2K8H A;  4JQW C;  4DHZ B;  4ACF A;  1UBQ A;  2L76 A;  2Z0D B;  1TS5 A;  2CHZ A;  3JSV B;  3I57 A;  4JL9 A;  4B6W A;  4WWN A;  2EKI A;  2UWQ A;  4M02 A;  4P6V F;  4WAF A;  2JY6 A;  3K9O B;  2B76 B;  2CJN A;  3UIP B;  2DYO A;  1B9R A;  2RGF A;  1C4P A;  3NY5 A;  4HRS A;  5CHW A;  4NJ6 A;  4WH4 A;  5CHF A;  2J7Q B;  1TIF A;  4M0W A;  3RD2 A;  3I3T B;  3ZYY X;  1JWU D;  4C4V A;  3MC8 A;  2NBW B;  2W55 A;  2MBO A;  3NVZ A;  3ZQ4 A;  2IO3 B;  2MSE D;  4IW0 A;  4BBN C;  2WXG A;  2M4N A;  2PLP A;  1WGK A;  3BII D;  3QAQ A;  4YSY B;  1FXA A;  2BGF A;  2GLS A;  4PS8 A;  4IWP A;  1BXT A;  4DXF A;  3T3O A;  2FUH B;  3P4R B;  1YJJ A;  3ABV B;  1C1Y B;  1V1O A;  2WHI A;  4CQN A;  2PKO A;  4OVZ A;  3NZ3 A;  1NVI D;  4A90 A;  3DBL I;  2WYQ A;  4ARC A;  3H1U A;  4MGI E;  3MC9 A;  2BQQ A;  3ONS A;  4GIV A;  2VZK D;  1ZOY B;  4W9H A;  1AWD A;  1T3Q A;  4HRO A;  4DHJ D;  2NR2 A;  3PLU A;  4MH8 A;  3VRA B;  3AEF B;  1N6Z A;  3BIN A;  4B9K A;  3ETR A;  3MJW A;  1SSN A;  3VUW A;  3QHT A;  4RMA A;  1WE7 A;  3VUY A;  1UD7 A;  3GZN I;  4ZDV A;  4M8M A;  2ZVO A;  1C3T A;  4C00 A;  1MHH E;  1L5P A;  4N9F 4;  1BT0 A;  4DK5 A;  2LVQ A;  3CWI A;  1ZUD 2;  3E9S A;  1J7C A;  2D3C A;  1SIF A;  1SJE D;  3N30 A;  3WAL A;  2IYD B;  3UIN B;  3VFK A;  3AEG B;  5JHA A;  1V5O A;  1J7A A;  2AQ3 B;  1G6J A;  2KDF B;  4JX1 C;  3PVL A;  4FLH A;  2IO0 B;  3HRD D;  3DHG C;  3R7Q A;  1ZW7 A;  3EHV A;  2K8C A;  2QCZ A;  3ZJU A;  2CR5 A;  4RGO S;  3KWL A;  4BOZ B;  4M0W B;  3UQB A;  1YMH E;  1WM3 A;  4JWU C;  5IAA C;  1FM0 D;  4FUL A;  4C4V B;  3RNG C;  4PS3 A;  4AUQ C;  2HDE A;  2QJL A;  1WXV A;  1V2Y A;  2KYW A;  2D07 B;  1B1Z A;  3DOW A;  4W9L A;  3DHI C;  4BVU C;  1QOA A;  5GMV A;  4IWO A;  2LGY A;  3ZJV A;  5MPO A;  3FC4 A;  3SDL C;  2HD5 B;  1FO4 A;  3QC8 B;  2N9P C;  3EFC A;  3V61 A;  2FCN A;  1KFY B;  1GUA B;  4G3X B;  3HIZ A;  1OTR B;  3X23 A;  5J18 A;  1ZKH A;  2BYV E;  3QIJ A;  5D94 A;  3QAR A;  4E3C A;  4W9I A;  2DBY A;  2PVG C;  2LZ6 A;  3GOE A;  3HVD A;  3RZW C;  2KDM A;  4K1R B;  1AAR A;  1JWM D;  3TEW A;  1N5W A;  4FHK A;  3NOB A;  3TIX A;  2ZVN A;  2KOX A;  2N1W A;  3Q3M C;  2J0J A;  4YL8 A;  2RMM A;  2JT4 B;  5EDS A;  2C7M B;  1XLQ A;  2MBE A;  1EU4 A;  4G50 A;  5D3I B;  1P0R A;  4KDL B;  3LJ3 A;  1XEE A;  1D5X C;  1C9F A;  2FAZ A;  3PLV A;  3AE1 B;  3L54 A;  1EWY C;  2DAJ A;  4NAW A;  3BVG A;  3NS8 A;  2MJE A;  2PVO D;  4WJP A;  5KHO A;  1FD6 A;  2MWS B;  3L17 A;  4ZHO A;  3ZDM C;  2ZW1 A;  4MSQ B;  4D2K A;  2FCS A;  3VRB B;  3K9P B;  2E6X A;  3ZLZ A;  4W9D A;  5TR5 A;  4A3O A;  2I2Y A;  3Q3N C;  1EO6 A;  1UWX A;  2KZR A;  2CS4 A;  2JRI B;  4LDT D;  3B1L X;  1YN4 A;  5H92 C;  1CK1 A;  5JHB A;  2V3P A;  3AE9 B;  4K81 A;  1WX8 A;  3SU8 X;  2DZM A;  3WIM A;  1WYW B;  4MGY E;  3RYT A;  3GB1 A;  4ANX A;  4NJ7 A;  2K25 A;  4PYU A;  5BYR A;  1Q10 A;  1SEB D;  3BK2 A;  4S17 A;  5DPW A;  2BYE A;  1I35 A;  1EM7 A;  3DVN U;  2AEH A;  3N20 C;  4XC2 A;  4JGH B;  1VD2 A;  2LVP A;  4ZHP A;  3RNA C;  4IC7 B;  1RM6 C;  4TKN A;  5EE0 A;  4HXD A;  3V6E B;  2L8J A;  2J52 A;  1E9M A;  2DZJ A;  2PPH A;  2D5G A;  2V0G A;  1GAQ B;  3N1Z C;  1ESF A;  3AN1 A;  3Q69 A;  2NVU I;  2A4Z A;  3P42 A;  1WR1 A;  3QA8 A;  3ZIM A;  3EC8 A;  2K9X A;  3QJZ A;  1WYG A;  2D11 A;  2RD0 A;  2BT6 A;  2KDE B;  4KGT A;  1E90 A;  3ZXV A;  1K50 A;  4NAW B;  1OQY A;  3PHW B;  3ZJT A;  3L4P A;  3I9V 1;  3HUI A;  2L1A A;  3PRM B;  5BMG A;  3AEB B;  1GOZ A;  3Q8E A;  4BKG A;  1T0Q C;  3ZNH B;  1HTQ A;  3ML9 A;  3TSS A;  4K7U A;  2R61 A;  1WI0 A;  2WLB A;  2KWD A;  2WXK A;  3H9D A;  1VLB A;  2YVC A;  2KK8 A;  2WDT B;  5FR6 A;  4AOF A;  3C0R B;  1NDD A;  4GLS C;  2QEJ C;  1C4C A;  2DHZ A;  4JWS C;  3U2S C;  2J53 A;  2QSD A;  3ZRF A;  2WXJ A;  2D3A A;  2RSU A;  2MQJ A;  3EEC A;  2JYT A;  1UWM A;  3L0W B;  2N9L A;  4HKZ E;  1R4N I;  4YSX B;  3U30 A;  2JU6 X;  1ET9 A;  5J17 A;  3AE4 B;  2RPV A;  3PRE A;  5IKC M;  2IBI B;  1IYF A;  4P1B C;  5IO9 A;  3UGB B;  3B0A A;  3DWG C;  4FXC A;  3N32 A;  3PRZ A;  3L08 A;  1TGZ B;  2NBV B;  4XDC A;  1XQQ A;  2RDG A;  4LNK A;  3A1Q A;  3VVW B;  4RH6 A;  1JAL A;  1D4B A;  4MAC A;  4BBN F;  3P2B A;  2HTM E;  4AS1 A;  4X57 B;  4GB9 A;  1I4H A;  4RM8 A;  1HZ5 A;  3W9C B;  1LM8 B;  1L6V A;  3ECI A;  1HQR D;  4OW0 A;  3DVG X;  5CHV C;  2FIF A;  1GPX A;  2QIL A;  1NYQ A;  1XLN A;  3AE5 B;  5D7G A;  1NEN B;  1M94 A;  3B9J A;  4GGQ A;  3BZD B;  3W5U B;  3PO0 A;  5HKH A;  4A20 A;  3Q8C A;  5D2M B;  1VR9 A;  1YN3 A;  2LXC A;  4MM3 A;  1Q5W B;  4HPM B;  1R7S A;  1F2R I;  1QOG A;  1SE4 A;  3TEX A;  1QQR A;  1OQQ A;  1TS2 A;  2WX0 A;  4WIP A;  3QWZ B;  4HPL B;  4L23 A;  4II2 B;  4HDO A;  3C19 A;  1EWC A;  3AE6 B;  1PDX A;  4IDI A;  3N1Y C;  1E0Z A;  1E8X A;  1I4R A;  4CYE A;  2G4D B;  2ASQ A;  1LGR A;  2M1M A;  3ZXR A;  2VH2 A;  4CHK A;  2IJ0 A;  3TUO A;  2SAK A;  3GZN B;  1VDV A;  3DDC B;  3SHQ A;  5HI1 A;  4EUT A;  2L52 A;  3W5V B;  3TL5 A;  4A8X C;  2MX2 A;  2KXJ A;  3FIL A;  2KKC A;  3VXW A;  2LGI A;  2K0P A;  2INC C;  2LMC A;  3APF A;  1C79 A;  1PUT A;  2O2V A;  3ALB A;  3AUL A;  3O65 B;  4HJK A;  1C76 A;  3A1Q B;  1PGB A;  2VZK B;  3NJT A;  4IOI E;  5E6N A;  3BVZ A;  4DHJ B;  4JPS A;  5BMI A;  4R3D A;  2CKH B;  1TY2 A;  4N58 A;  4N6E B;  1VZ8 A;  2R2O A;  2MH7 A;  4W9C A;  2V4I B;  1C78 A;  4URK A;  1OQR A;  2KLC A;  2DAF A;  4AQ7 A;  1NYR A;  2I1K A;  4ARI A;  1IBX A;  3Q8F A;  2IND C;  2JF5 A;  3NVY A;  4AWJ A;  1WY8 A;  4ICV A;  4MDK E;  2IGD A;  2ZNV B;  4FAD A;  3GS2 A;  4MM3 B;  2E3T A;  3DCG A;  5EE9 A;  3VH4 B;  2YEP B;  4USA A;  2RPQ A;  1UBI A;  3CF6 E;  2JRH A;  5AZG A;  1DGJ A;  4GU2 A;  4EFO A;  1GJZ A;  2JYE A;  4HLE A;  3DHH C;  4HWI B;  2FE8 A;  1T0Y A;  3AB5 A;  3ML8 A;  1CJE A;  4NJC A;  2KX3 A;  1I4X A;  4AP4 C;  2IY0 B;  2KTF A;  3R66 C;  1MPE A;  2LGD A;  2R2Q A;  1ENF A;  3PT2 B;  2G3Q B;  2WXH A;  1FMA D;  1FEH A;  1CQV A;  3DVG Y;  1NBF C;  1XD3 B;  1J19 A;  2EEL A;  2WDR B;  2M19 A;  3FIL B;  3JW0 X;  1E8W A;  2BBC A;  3TMP B;  2NS5 A;  1HXY D;  1I4P A;  1SBB B;  2D10 A;  1P98 A;  2KJH B;  1FFV A;  3Q8B A;  3VHT C;  2O2V B;  1TZO A;  3VR8 B;  3AV8 A;  1H4R A;  3R8B A;  3RUI B;  2WXN A;  5HHD G;  2ZCC A;  2BF8 B;  3ZKJ C;  1F77 A;  4MEM A;  1V1P A;  3PGE A;  3RNF C;  4E71 A;  2KWV B;  2V9H A;  1D5Z C;  1DYQ A;  5C23 A;  3X0W A;  2D3G A;  2BPS A;  4XYC A;  4GDL A;  2WXO A;  1V6E A;  4KGS A;  2KFJ A;  1YIW A;  2OED A;  2DZK A;  2L32 A;  1IBX B;  4ZRJ A;  1SJH D;  2CU1 A;  4O1N A;  3ZUN A;  1KRH A;  2XN9 C;  4A55 A;  1WF9 A;  1JQ4 A;  1PYW D;  1LO5 D;  1TZ1 A;  1QF6 A;  4M01 A;  2NTT A;  2KVR A;  2M56 B;  4XZ4 A;  4F1S A;  4JE3 B;  1LQB A;  4IKG A;  2LGS A;  4E74 A;  2GBR A;  4L1B A;  3AE8 B;  2IO1 B; 
#chains in the Genus database with same CATH homology
 1FNV A;  1TKE A;  2DWQ A;  3R2I A;  1RYJ A;  1FCC C;  1STE A;  2AQ2 B;  2K22 A;  4ZRP A;  1C4A A;  2LFI A;  5BYR A;  1Q10 A;  3MHZ A;  4DQO C;  1SEB D;  3BK2 A;  4ITK A;  4J3O D;  1SIJ A;  1P7F A;  1EM7 A;  4MT5 A;  2MJ3 A;  3V3X A;  2I38 A;  3W1S A;  4YXD B;  1KF6 B;  4GDK B;  4RFB A;  5BMH A;  3SR6 A;  3AEA B;  2BS2 B;  2H88 B;  3PZ8 A;  1HEZ E;  4ZHP A;  3P63 A;  1UGJ A;  4PT5 A;  4US8 A;  1ZE3 D;  1JRP A;  1RM6 C;  2PTL A;  2FBW B;  4YTP B;  1TJE A;  5EE0 A;  5H8Y E;  3N9Y C;  2J52 A;  1E9M A;  3EA6 A;  2DYM A;  2LHD A;  3V05 A;  2D5G A;  2KMM A;  2V0G A;  5HG2 A;  1GAQ B;  1V97 A;  1HA5 A;  1DOX A;  3NUH B;  1ESF A;  2BS4 B;  2ACZ B;  3AN1 A;  3Q69 A;  5C3J B;  1FXI A;  2Y3A A;  3P42 A;  2WXI A;  4US9 A;  1XCQ L;  1QOB A;  2K9X A;  2WDQ B;  2JQR B;  1L4Z B;  2DLB A;  1PFD A;  1V8C A;  1JW9 D;  2LUM A;  1K52 A;  1NI3 A;  1XLO A;  4RGM A;  2CJO A;  5E6J A;  1V1P B;  3W2D A;  1K51 A;  1A70 A;  5JXV A;  1DOI A;  1WYG A;  2INN E;  3OWE B;  1K53 A;  5BYQ A;  2BT6 A;  1VZ7 A;  1I4G A;  4KGT A;  4N59 A;  3TEZ A;  2AX5 A;  1K50 A;  2WU2 B;  4NAW B;  4HKQ A;  1IUE A;  3SFD B;  1VRA B;  2X38 A;  3ZJT A;  2LHE A;  3GP7 A;  4GDL B;  3L4P A;  1UNS A;  3I9V 1;  2JX5 A;  2KAJ A;  3HUI A;  2L1A A;  3BYY B;  2ON8 A;  1YNT E;  4L2Y A;  5BMG A;  2QMT A;  2WXM A;  3AEB B;  3IAM 1;  5D3D A;  1GOZ A;  2WQY B;  3Q8E A;  1QOF A;  3TSS A;  1XLP A;  3KWV A;  4EE2 A;  2J42 A;  2IPK D;  2R61 A;  3DWM A;  2WLB A;  2KWD A;  5TSS A;  2WXK A;  3R2T A;  4ZOH C;  2BB6 A;  4YWG G;  1MHX A;  2LEK A;  1JWS D;  1VLB A;  4XDD A;  1MVK A;  2N9K A;  1L0Y B;  4C7Z A;  2L83 A;  1DOY A;  2FUG 1;  3P4Q B;  4UDU C;  1N63 A;  3LYY A;  4GLS C;  2QEJ C;  1C4C A;  4JWS C;  2QIE B;  3U2S C;  2J53 A;  2QSD A;  2J4X A;  4NAM A;  2K5P A;  1XCT L;  2ICI A;  1TS3 A;  2H89 B;  2JXT A;  1EU3 A;  1XO3 A;  2WXJ A;  4B0E A;  3O13 A;  1AYF A;  3AMZ A;  1FNW A;  2JYT A;  3TEY A;  2NMQ A;  1UWM A;  2OHF A;  1XF5 L;  2N9L A;  4HKZ E;  4YSX B;  5FR3 A;  1NEK B;  2JU6 X;  1FCL A;  1ET9 A;  4YTN B;  1BML C;  1ZXH A;  3AE4 B;  3LXF A;  4HEA 1;  3RFZ B;  2RPV A;  4P16 A;  1C77 A;  4RCO A;  4RF0 A;  3KLS X;  3VQI A;  2Q5W D;  1QLB B;  3AE2 B;  3AED B;  3DWG C;  4FXC A;  2KN4 A;  2WXR A;  3NS1 A;  4XDC A;  1RFK A;  2BS3 B;  2RDG A;  5GXG B;  4RH6 A;  1JAL A;  1D4B A;  1E7P B;  1TS5 A;  4MAC A;  2ZW0 A;  3I57 A;  1JWB D;  1JML A;  2EKI A;  2G1E A;  2JSV X;  2BB5 A;  2NTS A;  2HTM E;  2M0A A;  2JZP A;  3J9C A;  5G5G A;  2KAC A;  4AS1 A;  5EE3 A;  4P6V F;  3P4P B;  4WQM A;  4WAF A;  4RGT A;  1I4H A;  5LNK 1;  4REZ A;  2B76 B;  1J7B A;  1E10 A;  2CJN A;  2DYO A;  3AEC B;  1HZ5 A;  3W9C B;  1B9R A;  1L6V A;  1QKZ A;  1C4P A;  4HRS A;  1HQR D;  4OW0 A;  4TMA B;  3BK1 A;  4WH4 A;  2WNM A;  4M0W A;  1GPX A;  2QIL A;  1N61 A;  1I4Q A;  1NYQ A;  1XLN A;  3AE5 B;  1JWU D;  3B2F A;  4RNA A;  1OFF A;  5D7G A;  2AQ1 B;  3U52 E;  3ZYY X;  4A6Q A;  1NEN B;  3B9J A;  1ZPS A;  3E56 A;  2W55 A;  1N62 A;  5HFY A;  1FRR A;  3BZD B;  3NVZ A;  3ZQ4 A;  4WWM A;  3W5U B;  3PO0 A;  1ZP0 B;  1RWS A;  2WXG A;  2PLP A;  4RF1 A;  4XWT A;  1WGK A;  3BII D;  4YSY B;  1D5M C;  1FXA A;  2W82 A;  3Q8C A;  1VR9 A;  1YN3 A;  2W3R A;  2WXL A;  3SEB A;  1BXT A;  4H2A A;  4DXF A;  1QIL A;  3T3O A;  3P4R B;  1YJJ A;  2BTE A;  1R7S A;  3ABV B;  4C7Y A;  1F2R I;  1QOG A;  1V1O A;  4CQN A;  2PKO A;  4OVZ A;  2XNA C;  3NZ3 A;  1NVI D;  1SE4 A;  3TEX A;  1QQR A;  4A90 A;  1OQQ A;  1TS2 A;  4ARC A;  1QT9 A;  4WIP A;  3EGR A;  3SFE B;  4L23 A;  1ROE A;  3HVZ A;  3MFG A;  1EWC A;  1N60 A;  2VZK D;  3AE6 B;  1PDX A;  1ZOY B;  1AWD A;  1T3Q A;  4HRO A;  4IDI A;  1T5X D;  3WCQ A;  1E0Z A;  1I4R A;  3MJ5 A;  1L6U A;  4LK0 M;  1TS4 A;  2MEK A;  2WDV B;  2WXP A;  3FAH A;  3VR9 B;  3ZGZ A;  1SF0 A;  2WU5 B;  4MH8 A;  3VRA B;  3AEF B;  2IJ0 A;  3TUO A;  2GRI A;  5FKA C;  3ETR A;  1E6E B;  1UUP A;  3NVV A;  1JCK B;  2SAK A;  2SEB D;  1SSN A;  3AH7 A;  1VDV A;  2WS3 B;  4KKJ A;  2INP E;  4XE0 A;  5HI1 A;  2L52 A;  3W5V B;  4A8X C;  4Q2J A;  3FIL A;  1AN8 A;  1KLG D;  1VZ6 A;  4OZC A;  1MHH E;  2LGI A;  2K0P A;  1YQ3 B;  1L5P A;  2W3S A;  2LMC A;  1CZP A;  3CWI A;  1JWA D;  3IAS 1;  1C79 A;  1PUT A;  1ZUD 2;  2WXQ A;  3E9S A;  1J7C A;  2IGH A;  1YQ4 B;  1C76 A;  1SJE D;  2IDY A;  1PGB A;  4ZYS A;  2VZK B;  4IOI E;  1ZXI A;  2CU3 A;  3BVZ A;  3AEG B;  1KTK A;  1J7A A;  4HJG E;  1GB4 A;  4JPS A;  1F0Z A;  2AQ3 B;  4R3D A;  5BMI A;  2JWU A;  3MC0 B;  1TKY A;  1HZ6 A;  4JX1 C;  1PGX A;  3H8H A;  1SXT A;  1TY2 A;  4N58 A;  3NVW A;  1VZ8 A;  3HRD D;  4N6E B;  1PGA A;  2MH7 A;  3KQ4 A;  1TY0 A;  2V4I B;  1M4V A;  3ZJU A;  1C78 A;  3AEE B;  4RGO S;  2N0S B;  3KWL A;  1OQR A;  4YTM B;  2PIA A;  4LLG M;  5T8I A;  4AQ7 A;  1L0V B;  1NYR A;  1YMH E;  4JWU C;  1FM0 D;  1SB3 C;  4NZL B;  4ARI A;  1IBX A;  3Q8F A;  1ZDX A;  5G5H A;  1BUI C;  2BYT A;  3NVY A;  4DXG A;  2HDE A;  1XXG A;  2QJL A;  1WXQ A;  1KLU D;  1F2R C;  4OZA A;  3U4E G;  1B1Z A;  4C80 A;  4B0M A;  2IGD A;  1I7H A;  3GS2 A;  3AM9 A;  2E3T A;  3PZ7 A;  4MM3 B;  3UI3 A;  4XWW A;  5EE9 A;  2WXF A;  1N5X A;  3IXS A;  4TSS A;  1QOA A;  2YEP B;  4USA A;  3P1M A;  1DGJ A;  2Y5P A;  1FIQ A;  2PMV A;  2JYE A;  2RDH A;  2WP9 B;  4YSZ B;  3ZJV A;  5MPO A;  4TQ1 A;  2FE8 A;  3FC4 A;  3BWU D;  1ZDV A;  3NRZ A;  4TQ0 A;  1FO4 A;  5AUI A;  3EUB 2;  3AB5 A;  5EE1 A;  1CJE A;  1D6E C;  3C8Y A;  4NJC A;  1I4X A;  4OHJ A;  1KFY B;  1TYG B;  3URY A;  1KH0 A;  1MPE A;  1ENF A;  1JRO A;  4WUR A;  2BW2 A;  1IGC A;  1L0X B;  3IT4 B;  4ZRQ A;  1IGD A;  1AW7 A;  2DBY A;  2PVG C;  1FNU A;  2WXH A;  3HVD A;  1WWT A;  1FMA D;  3LB8 C;  1FEH A;  1CQV A;  1WRI A;  2KDM A;  3CIR B;  4KKI A;  1GB1 A;  1T6B X;  2EEL A;  2GB1 A;  2WDR B;  2M19 A;  3FIL B;  2N7J A;  1JWM D;  3TEW A;  4OZB A;  1N5W A;  2BBC A;  1HXY D;  1SE2 A;  3B2G A;  1P7E A;  2W54 A;  1I4P A;  1SBB B;  5AUK A;  1FFV A;  1ET6 A;  3Q8B A;  3AE7 B;  1TKG A;  1TZO A;  2Y5C A;  5FK9 C;  3Q8A A;  2GI9 A;  3VR8 B;  3AV8 A;  3R8B A;  2ONQ A;  2RMM A;  2WXN A;  5HHD G;  3IT6 B;  1XLQ A;  1EU4 A;  4A9A A;  5BYS A;  1F77 A;  5D3I B;  1V1P A;  3P4S B;  1XEE A;  1D5X C;  2YEP F;  1C9F A;  2PW9 A;  1D5Z C;  1DYQ A;  5C2T B;  3AE1 B;  2IGG A;  1EWY C;  2V3N A;  3BVG A;  1FRD A;  4YT0 B;  4RGN A;  1Y56 A;  2MJE A;  1WSP A;  2PVO D;  2WXO A;  1L4D B;  4KGS A;  1FD6 A;  4ZHO A;  2MJD A;  2ZW1 A;  1YJI A;  4D2K A;  1SE3 A;  2OED A;  3VRB B;  3MP9 A;  2L32 A;  1IBX B;  2G9H D;  1SJH D;  2E6X A;  3BYT B;  4O1N A;  1KRH A;  4LTU A;  1VJK A;  2TSS A;  2XN9 C;  3RPF C;  4A55 A;  3AE3 B;  2I2Y A;  5I4D A;  1JQ4 A;  1PYW D;  1LO5 D;  1QF6 A;  1FFU A;  2KQ4 X;  2NTT A;  1UWX A;  2M56 B;  1ACC A;  3BVM A;  2LJI A;  4JE3 B;  4IKG A;  1YN4 A;  2Z8L A;  1CK1 A;  4KGR A;  2V3P A;  5H92 C;  3AE9 B;  3U7Z A;  4KX6 B;  4C56 C;  4L1B A;  3T3N A;  1MI0 A;  1YN5 A;  3AE8 B;  2K3U A;  3GB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...