2QSDA

Crystal structure of a protein il1583 from idiomarina loihiensis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
146
Chain Sequence
DNKLFLVYVGGTAPGANIELHDIRFVVGPSMEETYPAIRKGWFGTQKGLHLDSFVHLHHVDGYRIHLTSEAPEEKRLYFVNFGEYHDFTVVVADSPQSAKQLARAQFSVDDCLCVDLVDNHYVTLEFDGEQQPLVPDWKGYQPLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized conserved protein
publication title Crystal Structure of a Protein Il1583 from Idiomarina loihiensis.
rcsb
source organism Idiomarina loihiensis
molecule tags Structural genomics, unknown function
total genus 29
structure length 146
sequence length 174
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07566 DUF1543 Domain of Unknown Function (DUF1543)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qsdA01
3.50.100.10 Alpha Beta 3-Layer(bba) Sandwich protein il1583 fold protein il1583 domain 2qsdA02
1PGBA 3FILA 2LGIA 1K51A 2J52A 2IGGA 1MI0A 2JWUA 2PLPA 4OZCA 5BMHA 5HFYA 5JXVA 4HJGE 2PW9A 2KDMA 1FD6A 1F2RI 2JXTA 1XF5L 2JSVX 1K53A 1FCCC 1F2RC 2I38A 2KQ4X 3UI3A 4D2KA 1K52A 3FILB 5HI1A 1UWXA 4WH4A 1XCQL 5BMIA 3V3XA 2GB1A 2N9LA 1XCTL 1K50A 1D4BA 2KWDA 1PGXA 1P7FA 2KACA 1Q10A 2RPVA 2LHEA 1QKZA 2JU6X 3GB1A 2QMTA 4MACA 2LUMA 4HKZE 2EELA 4IOIE 1IBXA 1KH0A 2QSDA 1IGDA 2LHDA 2N7JA 5HG2A 2NMQA 2GI9A 2RMMA 5HHDG 1GB4A 1YMHE 4OZAA 4GLSC 2ZW1A 1HZ5A 1FCLA 1HZ6A 2JZPA 1EM7A 2KN4A 2OEDA 2I2YA 1MPEA 1ZXHA 2PTLA 1YNTE 3MP9A 1C9FA 2K0PA 4IKGA 4OZBA 1GB1A 1IBXB 2J53A 2ZW0A 2IGHA 1PGAA 4KGSA 1IGCA 4KGTA 2N9KA 1MVKA 1MHXA 2IGDA 2ON8A 5BMGA 2ONQA 4KGRA 1P7EA 1MHHE 1JMLA 1HEZE
chains in the Genus database with same CATH superfamily
2JRHA 1DOXA 3WCQA 2UU7A 1Y8RC 2E6XA 2NBWB 5H8YE 2WQYB 1MI0A 3K9PB 3JVZX 3AV8A 4TKNA 2AQ2B 1XD3B 4G0NB 1CJEA 2WXMA 3DBLI 4LNFA 3U30A 4RGTA 2JQRB 4RM9A 3FILB 5HI1A 2JZZA 2D3CA 2CR5A 2N7DA 3ZNGC 5GMVA 4HCPB 3WAPA 1PUTA 2BKFA 3AE9B 4F7ZA 1YQBA 2GLSA 5D7GA 4M02A 2Y5BB 1VCBA 1F52A 4KX6B 3KQ4A 2R2OA 2KMAA 1LM8B 4P16A 1AARA 2LHDA 3Q3JA 2MBHA 1GC7A 1GB4A 1ACCA 4WIPA 1E5WA 4BOSC 1LQBA 2KLGA 3L16A 4BOZB 2L7RA 5TR5A 3V62A 1B9RA 2KN4A 1ESFA 3X23A 2QCZA 1BXTA 3ZNHB 3Q2AC 4JIOU 1WR6E 3MP9A 1OQYA 2DAJA 5D6JB 2KDBA 3NZ3A 2B3AA 3RULA 2AL3A 2ZW0A 2ZVOA 3P2BA 3VVWB 1TZ1A 3U7DA 1F0ZA 1SXTA 4W9HA 3H6NA 5D94A 2AWTA 1T5XD 3AXCA 2HTME 3VR9B 2K9XA 4BKSA 1XLQA 1TKEA 3T9LA 3PO0A 5IN7A 5C2TB 4NQLB 1R4NB 1X1MA 4A90A 1VD2A 2BF8B 1V1PA 4EZLA 4ZRJA 3I57A 1VR9A 4KVGB 3PLVA 2LWPA 1V2YA 4K7UA 2L00B 4OVVA 4I6NB 2K8HA 1YQ3B 4GU2A 1WZ3A 1JWSD 1UGJA 2Y5PA 4TV3A 3H1UA 1FO4A 3V05A 5CHVC 3AE2B 1EWYC 4HJKA 1ET9A 2RGFA 3V3XA 3SD5A 2N0SB 4P1BC 4RF1A 1D4BA 2ZEQA 4PK1A 2RPVA 2M0XA 2MLBA 4E74A 2KJRA 2PMVA 2QMTA 1P0RA 3MHZA 4HDQA 2JT4B 3PV1A 1JALA 3ZVVA 1KH0A 5FKAC 1QOAA 4IUMB 3ZTDA 1SIJA 4MH0E 2NTTA 1IPGA 3PRPB 2G9HD 2BWFA 3W1YA 1R4NI 5D3IB 4NJ7A 2L83A 2WXIA 4FLHA 5AEKB 1IP9A 2KOXA 4KV2A 4RFBA 2DENB 2E3TA 2BS3B 3AEBB 1C4AA 2JXXA 3AEEB 1A70A 1WM2A 2H89B 3AH7A 4MGKE 3ZRFA 4MM3A 1DYQA 1L2NA 3P4RB 2N4FA 3ZO5B 2MW5A 4YTMB 5KHOA 3GZNB 1TKYA 1WX8A 1V1OA 2CKHB 4MELA 2ZPYA 5AUKA 1WY8A 4YTNB 4JGHB 4NZLB 3GOEA 2B76B 4A3OA 3W1SA 2BS2B 4YSZB 3WANA 2WXNA 1IYFA 4RCOA 5G2NA 3KYCD 1NI3A 2V9HA 2XK5A 2MBQA 2FUHB 1DGJA 3AE5B 2BWES 2GBRA 2M4NA 3Q69A 2LI5A 3PZDA 2EKIA 2M8SA 3W5VB 5IKCM 5C1ZA 4HEA1 4ARIA 5EE0A 5AUIA 3QJZA 4S0RA 5G5GA 2GOWA 2L0TA 3OJ3A 3PZ8A 2LUEA 2HE7A 3APFA 2JUOA 1V80A 2BYFA 1QOGA 4IW0A 3RMKC 3A1QB 3V6CB 3GZNI 4YXDB 3HVDA 2L52A 2J0JA 2YVCA 3ZRCA 1WYGA 2X8XX 3B9JA 2WXLA 3U4EG 1WIAA 1KOTA 1QLBB 1N6ZA 4M00A 2D07B 2FCQA 3KWVA 1I4HA 3ZJTA 3WAOA 4TQ0A 1J8CA 1PGBA 3AULA 1I4XA 3TUOA 3AU4A 1LFDA 2JY6A 3AEAB 3JSVA 2BBCA 3N1ZC 4W9DA 4LNNA 4PYZA 5FK9C 3P63A 4B6WA 1YJJA 1LXDA 4TMAB 2BPSA 2O2VA 1UGMA 2RR9A 3TMPB 4A6QA 2LVOA 3V61A 1KFYB 1RAXA 2MWSB 1EF1A 2KWDA 2KACA 2SEBD 2LVPA 4RH6A 2NTSA 1FNUA 4MACA 3N30A 1AW7A 1ET6A 1TGZB 4IM0A 1IUEA 1IGDA 2NPTA 4XWTA 5LXHA 5HHDG 1LGRA 1KLUD 2ZCCA 2HTHA 4YSXB 1WGHA 4CYEA 4DHJD 2W3SA 2OEDA 4K81A 1BUIC 1QILA 1KM7A 4KDIC 1N61A 5DPRA 2IO3B 2KZRA 1J7CA 3VRAB 2BGFA 1G6JA 3ZYYX 3AE3B 4RMAA 3Q8BA 1HTOA 1TY0A 1AN8A 4G50A 3DVNU 1WZ0A 3A4SC 3I3TB 3PSEB 3SEBA 1HEZE 2LXAA 3CMMB 1D5MC 4LK0M 4NY0A 1HXYD 3HUIA 4C7ZA 1C79A 3UF8A 3N20C 1D5ZC 1ZXIA 1R7SA 2VZKD 1ZUD2 2WX0A 3E56A 3URYA 3DHGC 2KYWA 4KIKA 1E7VA 1UELA 2O6VD 2PW9A 1WXMA 1E8YA 3IAS1 1I4QA 4EUTA 4MM3B 1XF5L 4BAXA 3H7PA 4AWJA 2LFIA 2N9PC 3C19A 1C3TA 1V6EA 2LJ5A 3AEGB 3PZ7A 5J17A 2LD9A 3GE3C 5E6NA 4ANXA 2KTRA 5DPTA 3RNAC 1M4VA 3P4QB 4FHKA 3R7RA 1C78A 2LHEA 3AMZA 4Q2JA 3HVZA 3R2IA 2WGSA 4N9F4 2NVUI 4GGQA 3ABVB 4E3CA 4WJPA 2Z59B 1HZ6A 2JZPA 3CSFA 5LNK1 1E8XA 2JPHA 1KLVA 4HXDA 1J0GA 2M0AA 1WGGA 3CF6E 4PS7A 2KK8A 1NVID 1FXTB 3L54A 4WJOA 3BVMA 2NBVB 1PGAA 4W9LA 4KGSA 3V60A 2KXJA 1GG3A 3BWUD 2KN5A 2REXA 5BMGA 2KC1A 2L3ZA 4JQWC 4OVZA 2LJIA 4ANWA 2PE9A 4BBNF 1BT0A 4XGAB 4GN1A 5EE9A 3ZTCA 2D11A 4HPLB 1WMHB 2LGIA 1WYWB 2D5GA 3KVFB 3VTWA 4ZYSA 4GDLA 4BKSD 2LMCA 2DYMA 1CK1A 2LRUA 2AYOB 4HDOA 4ZRKA 3B2FA 1PYWD 3PTFC 1TKGA 4N6EB 2C7NB 4IM3A 1WI0A 3ECIA 3UQBA 5E6OA 3P1MA 4ZDVA 3RT3B 2MQJA 5JZEB 3L08A 3NVYA 3O13A 1E10A 4HKZE 1JRUA 3LJ3A 4ITKA 3MC0B 2O2VB 4LLGM 4WAAA 2KJ6A 4OHJA 4RGNA 2ZW1A 1QOFA 3ZQ4A 4HKQA 1KLGD 3MFGA 4NAWA 2WHIA 3GS2A 1F1HA 1P9DU 1JWUD 3ZNZB 3AI5A 1XO3A 4W9CA 3MC8A 1EWCA 4ASWC 3ETRA 4OZBA 1GB1A 4LNKA 1KTKA 4ANVA 3W2DA 1SE3A 4FN2A 4FULA 2I1JA 2NPTB 3JYUA 2X38A 3UIPB 4K3BA 3PHWB 2K5PA 1OGWA 1P3QU 4KSLC 1XT9B 3RUIB 2Z0EB 2CHWA 1SJED 1SGHA 2CHZA 4ZYNA 1UD7A 3Q3MC 1PFDA 1YX6B 3DHHC 3KUCB 4WWOA 3N1YC 2DAFA 2ZZPB 3LYYA 1FD6A 3L13A 1FM0D 3W9CB 3PRMB 4XC2A 2RDGA 3QA8A 3T3OA 4IC7B 2FE8A 3QC8B 3DQVA 4W9GA 4D2KA 1XLNA 2MEKA 3IXSA 2INPE 3DVGY 2FIDA 2LGDA 3EA6A 4CHKA 3N32A 4ZHOA 2RD0A 4WJNA 3AU5A 5IAAC 3JW0X 1V5TA 4KIKB 1QQRA 3NS8A 1GAQB 2NR2A 1P98A 1UZXB 3NHEB 5H92C 2N9EB 3VTUA 5IO9A 1U4AA 3CWIA 1H8CA 2EELA 1SB3C 3H7PB 4IWQA 5EDSA 1YMHE 1V49A 3AM9A 1WJUA 4BKGA 5BYQA 2K25A 2KTRB 4B0MA 2G4DB 2IO2B 2KO3A 2QIEB 3I9V1 3Q6BA 4P7IA 3SDLC 4A55A 4DBGA 3C0RB 4HROA 2KVRA 3NG0A 4GXBA 1EUVB 1RLFA 1OQRA 3TEYA 2V4LA 2CJNA 1L7YA 2LEKA 2RPQA 3ZXRA 3R7QA 3PREA 3DBSA 5CX3A 4MH8A 1WGRA 3AE1B 1UNSA 1UBQA 1ZW7A 4C4VB 2D3BA 2GMIC 4DHJB 5G5HA 1GNUA 4TSSA 3A9KA 3B0AA 2BS4B 4AUQC 3TEWA 2CS4A 2L8JA 2ASQA 4OZCA 2VH2A 2K39A 4LDTB 1F77A 3EECA 5IOIA 1WXSA 3E9SA 5C3JB 3UQAA 1TS4A 1T6BX 3TIXA 4EKUA 3HK0A 4NQKE 3VH3B 1UBIA 1UWXA 1XCQL 2GB1A 2XN9C 5I4DA 3PS6A 3ZJUA 4G11A 1YQ4B 3A4RA 2VZKB 5HKHA 1E8WA 4WJQA 2OHFA 1RFAA 1HA5A 3DVNV 4GDLB 2C5LC 3M95A 2O6VB 3IG3A 3EFCA 4PS8A 4M8NA 4EZKA 5JHBA 4ANUA 4MT5A 2KNBA 3NUHB 2FCMA 4BKTA 1OEYA 1ZE3D 2MJDA 4JWSC 1L0XB 2D3GA 2ZVNA 1WX7A 3SFEB 2V1YA 2AEHA 3VRBB 2KFKA 4LTUA 4XDDA 2XNAC 4EOYA 3IT6B 3KYDD 4LCDE 3N1XC 3R8BA 4FBJB 2M1MA 2UWQA 1PQSA 2ON8A 4FJZA 4NAWB 2VH1A 1P1AA 1UUPA 4HPPA 2MRPA 2CJOA 4ZRQA 1XXGA 1WGKA 2QDFA 4CO7A 1KF6B 3L10B 5FR6A 2J7QB 3HHMA 4J6IA 1K51A 1FMAD 2L0FA 2J52A 2IO0B 1I4GA 3B2GA 3RNGC 1YN3A 2JWUA 4F8CB 4GSWA 4K7SA 1ROEA 3AE6B 5TSSA 3RCZA 3VDZA 5JXVA 4HJGE 2RDBC 2WDTB 4HWIB 4WQMA 5DPWA 3W1SC 2GBKA 3P4SB 5T8IA 4WWMA 2LGYA 4P6VF 5L95C 1K8RB 2PVOD 3IHPC 4RM8A 3ALBA 3UIOB 1WRDB 3PRZA 5BMIA 4B95A 4IG7B 1FNVA 1P7FA 3BIID 3U8ZA 3KW5B 1V5OA 4US9A 3M63B 2ZCBA 1TT5B 1ENFA 3QWZB 3O65B 2D3AA 1L0YB 4AQ7A 2FUG1 4ICUA 2MHJA 2M17A 1V1PB 2BYTA 1YD8U 3EUB2 5J18A 3ML9A 2KANA 4IM2A 3L4PA 1J7AA 1NYRA 1V9JA 2KWUB 2M19A 1QT9A 3X0WA 2KDIA 3H7SA 4NJCA 2PTLA 2IDYA 3APCA 2L1AA 4C00A 3VUWA 4BVUC 1HTQA 3I5JC 2XBBC 2KX0A 4LNOA 2FCNA 4W9IA 2GBMA 4KGTA 2OJRA 1ZPSA 1JQ4A 2LASA 1GOZA 2QJLA 4XWWA 1P7EA 2JYTA 3Q3FA 4AP4C 1VDVA 1JRPA 1WE6A 1T0QC 3H9DA 4HCNB 4A3PA 3VQIA 3APDA 4LDTD 1GJZA 2EMSA 1QOBA 3VXWA 2K8CA 2PLPA 2WXKA 1STEA 2GBNA 5JH5C 2MBBB 3MJWA 3H8HA 2DZJA 2EMTA 3DDCB 2QHOA 2JXTA 1C4PA 3NZUA 4AOFA 2IBIB 1V8CA 4X57B 1RWSA 1FCCC 1WM3A 2KQ4X 3A9KB 5KHQA 4M0WA 3C8YA 4L2YA 4REZA 2D10A 1PGXA 2LXCA 1Q10A 3U2SC 1E90A 4NAMA 2K8BA 1HQRD 2ZNVB 4DXFA 1WR1A 2HJ1A 4TQ1A 2IY0B 5CHWA 2NBUA 1L4ZB 2K22A 3TSSA 2KVZA 1IBXA 2QSDA 3Q14C 2NMQA 3NOBA 4NPNA 1NI2A 5EE3A 1UWMA 3A9JA 2TSSA 5E6JA 1L4DB 2DZMA 1WJ6A 1AWDA 3VTVA 2C7MB 4ICVA 1NBFC 1LO5D 4IDIA 2WXRA 5AZFA 2QEJC 2Y3AA 4FADA 4MJSA 3PVLA 4K1RB 3NVZA 1GC6A 1Q0WB 1WXQA 2XK5B 3DCGA 2KQ7A 2ZPNA 2EKEC 1B1ZA 2H88B 1IGCA 2N9KA 5D3DA 1MVKA 4B0EA 4OW0A 3ZJVA 1EU3A 1YOVB 3RI7C 3WAMA 2GBJA 3QX1A 4MGIE 4JX1C 1V97A 1JMLA 3TEXA 3Q8AA 3BZDB 4L1BA 3BYTB 2KFKB 3PLUA 1YJ1A 1MJDA 3FC4A 3N9YC 2WNMA 2W54A 2QILA 1ZP0B 4G3XB 5E6PA 2BQQA 2W82A 2IO1B 3VFKA 1PDXA 1QZEA 1WE7A 1WXVA 3KLSX 1SJHD 2HJ8A 2D2QA 3T8MA 3Q3NC 3RYTA 3ONSA 2A4ZA 4UDUC 1FIQA 2G3QB 1K52A 2FNJB 2KDEB 3ZNID 2N9LA 1Y56A 3ZW3A 1XCTL 1JWMD 3IT4B 4KKIA 2DYOA 3IAM1 4C80A 2Z0DB 3ZGZA 3GB1A 1UF0A 2WU5B 2C9WB 1SEBD 3ZLZA 3RNEC 1E0ZA 2WS3B 2MP2A 2K6DB 1EM7A 3JSVB 4DHZE 4FJVB 2DZKA 4J3OD 4AJYB 3DBHB 1NENB 4JE3B 2KMCA 3W5UB 1YJIA 4C7YA 2KQSA 1OFFA 2FCSA 5BYSA 2N9XA 3AE8B 3UGBB 4A8XC 4HPMB 1I35A 1M94A 1V81A 2KX3A 3OLMD 3KUDB 1EU4A 4KZ0A 3LB8C 2CU1A 2DZIA 1TZOA 3P4PB 4GMVA 2LVQA 4RNAA 3EGRA 2WU2B 4MGZE 2R2QA 3NY5A 1FFUA 3MTNB 3T3NA 2RDHA 4WWNA 3A1QA 3KWLA 3QCAA 4A20A 4DHZB 1FRRA 4F1SA 1L6UA 1XLPA 2LGXA 2PPHA 2LZ6A 5FR3A 2YEPF 4K3CA 2KT7A 4HVBA 3AE4B 2JSVX 3S2AA 2DNFA 4W9FA 3GP7A 2Y5CA 1JWAD 2INCC 5IP4D 3KH0A 2Z8LA 3ZKJC 1XQQA 2FIFA 5CTRC 3DBHI 2INDC 3TJPA 3D32A 2PEAA 1GUAB 1D5XC 1CZPA 1WGDA 5LXIB 4TUUA 4YL8A 3NS1A 3AECB 3DWGC 1MG4A 4IOIE 4GDKA 2N7JA 3HRDD 4FHJA 1WWTA 2W9NA 1FFVA 2KWVB 4EE2A 3BVZA 4DXGA 5JHAA 3ZUNA 2N1VA 3BINA 4M0WB 2KHWB 2A5UA 3FAHA 3DOWA 2V3PA 3IBEA 1QF6A 2JX5A 3AN1A 1EO6A 4HRSA 3I63C 1OTRB 1YNTE 1ZDXA 2N1WA 2WXFA 1WRIA 1RFKA 2JRIB 1R4MB 2NS5A 3PT2B 3QHTA 4FXCA 2JVCA 4ZOHC 1IBXB 4ZHPA 4MSMB 4BFRA 2MCNB 2VRRB 4OVUA 3SR6A 3QARA 1YX5B 3OG5A 4MSQB 4N59A 4WAFA 2ONQA 3A9JB 3AEDB 1F9JA 4GB9A 1TJEA 1WX9A 2C7HA 4IWOA 4M01A 4YWGG 4MJSB 2V0GA 2NCNA 4FJYA 2IPKD 1TS2A 3Q3OC 1N62A 4II2B 3BVGA 2FAZA 1TY2A 4XE0A 4MDKE 2KDFB 3ZDTA 3BY4B 1RM6C 4PS3A 1F2RI 1HE8A 1A5RA 4URKA 3RFZB 2I38A 1VRAB 2KFJA 4WWPA 1FPYA 4XYCA 1SE2A 4W9JA 1K50A 4W9EA 4WQOB 3U52E 3NVWA 4USAA 2J0MA 3U7ZA 1T0RC 2HDEA 3SFDB 4M8MA 1R4MI 1FNWA 4DQOC 2YEPB 3DVGX 1RYJA 1Z2MA 1TBEA 2AL6A 2L32A 2WDRB 2GI9A 2WDVB 1N60A 2WXQA 3ZIMA 5C23A 1NYQA 2IY1B 2KAJA 1NEKB 1WGYA 3BK2A 1CQVA 2WXHA 4FA6A 4H2AA 2JWZA 3DWMA 1MPEA 3VHTC 1D3ZA 2MA9B 1WXAA 4LJOB 1WJNA 1YIWA 1ZDVA 1V86A 1T0SC 2J53A 4DWFA 3RNFC 1E7UA 3P42A 4DDID 1ISNA 2PJHA 1RRBA 2MP2B 4JPSA 1XEEA 5IA7A 2IGDA 3RNBC 5L83A 3NVVA 3RPFC 1L0VB 1VZ7A 5DCNA 2BT6A 3QAQA 1N5WA 2V3SA 3B08A 1JCKB 2IGGA 3NJTA 3Q8FA 5AZHA 5BMHA 5HFYA 3MC9A 2MJ3A 3ENEA 5BYRA 1E7PB 4KDLB 2BB5A 3BYYB 1TYGB 2ZNVC 2G4SA 1TS3A 2BKRB 1ZGUB 3OAWA 2MH7A 1E9MA 4MGYE 4XX5A 4PYUA 3QQ8B 1WFYA 3HM6X 2CHXA 2J4XA 2KC2A 1I4PA 1TIFA 3WIMA 4PT5A 1WMHA 3RN9C 1WF9A 2DX5B 3LDZE 1Q1OA 2WLBA 2WWZA 3OJ4B 2JZ3B 3VUXA 5HG2A 2AQ1B 5D2MB 3BK1A 4A9AA 1S3SG 5EE1A 1HZ5A 1L5PA 1FCLA 3TL5A 3PGEA 1WH3A 3A33B 5CHFA 2YLMA 2MJEA 1MFWA 1OQQA 2I2YA 2PKOA 2I1KA 3R2TA 1FEHA 2BVCA 1C9FA 3DPDA 2Q5WD 4YT0B 3GE8C 3IFWB 3MJ5A 1WSPA 1SBBB 4GDKB 2KD0A 1JROA 4RGMA 1FXIA 1T3QA 2WYQA 3EHVA 3Q8CA 4II3B 4CQNA 4ZRPA 3PPAA 1MHXA 5GXGB 3SU8X 2BYEA 4JWUC 2KLCA 1I7HA 3AE7B 4JL9A 3PHXB 3VR8B 1SE4A 3VH4B 2WXOA 3FILA 1NDDA 4US8A 2AX5A 1I42A 3WA0A 4K7WA 1KRHA 5G55A 3RNCC 2L76A 2G1EA 5AZGA 3HM3A 3IVFA 2LGSA 2MBOA 3L17A 2WXPA 2DYBA 1CMXB 2KDMA 5J2RA 1SSNA 3NZSA 1KJTA 1YN5A 5BO4B 3EFUA 3VUYA 3Q8EA 1EF5A 1JW9D 1VZ6A 3MHSD 2BB6A 4HLEA 2DHZA 3UI3A 1N63A 4E71A 4GOCA 1C77A 2OOBB 1E6EB 2L05A 3HIZA 4I6PA 2J42A 4P1CC 2J0KA 4EZJA 3L0WB 4MEMA 3AB5A 2C60A 4XZ4A 2HD5B 2KJHB 2JYEA 2XEWA 1DOIA 1S1QB 3K9OB 4QAYA 3R3MA 4EFOA 4HK2A 3RD2A 2BTEA 1N5XA 4OZAA 4GLSC 3TEZA 4L23A 2DLBA 5MPOA 4ZRIA 2FBWB 4ACFA 3DBRB 3RZFA 2MX2A 2LRWA 2JF5A 2PIAA 2K0PA 2W55A 4DXAB 2KMMA 4EEWA 1BMLC 3TBLD 3B1LX 2OJWA 1C1YB 1I4RA 2QC8A 4W9KA 2RSUA 1H4RA 2IJ0A 3ZXVA 1J7BA 2WXGA 4RGOS 1C76A 1Z5SB 2BW2A 1J19A 4JLCA 2UYZB 2WX1A 2MSED 3LXFA 4KGRA 4DDGD 3DHIC 4C56C 2ACZB 1MHHE 4XDCA 2R61A 3FKYA 1T0YA 3VAWA 3CSTA 1SE9A 1SF0A 3OWEB 2IYDB 2ICIA 4B9KA 1D6EC 2WP9B 2ZJDA 1WJ4A 4WURA 1XLOA 2DWQA 1OEYJ 2N7EA 4DK5A 4KKJA 2K1FA 2WXJA 4R3DA 5DPSA 4ARCA 4YSYB 3M62B 4KSKC 2PVGC 4LNIA 4BBNC 2IZVB 4AJWA 1VLBA 4YTPB 1K53A 3ZDMC 1F2RC 3AEFB 1VZ8A 3ML8A 3R66C 1UH6A 2M56B 1Q5WB 4WH4A 2W3RA 1YN4A 3DBRI 2INNE 3QIJA 2BYVE 4C4VA 1QKZA 1C4CA 2JU6X 4S17A 3V6EB 2K3UA 3J9CA 2AQ3B 4IWPA 3KUZA 4RF0A 2MBEA 1ZOYB 2V3NA 2LUMA 2GRIA 3CIRB 4KZCA 1E8ZA 1ZKHA 4AS1A 2RMMA 3DBLB 1JWBD 4LJPB 1AYFA 1TTNA 4BZAA 3WALA 2V4IB 1FRDA 5LLIA 1L6VA 3SHQA 1VJKA 3RZWC 2DBYA 1ZXHA 4N58A 3M3JA 4NNJB 2K6QA 2KKCA 4IKGA 2WDQB 2KWCA 1GPXA 1DOYA 2IGHA 4GIVA 3EC8A 2G45B 3QK0A 3TCAA 2KTFA 3NRZA 2SAKA 4O1NA 2CU3A 2O6VA 1TS5A 3UINB 1FXAA 4I6LB 1SIFA 4NJ6A 3N3KB 2PE6B 1MG8A
chains in the Genus database with same CATH topology
1DOXA 1D5MC 3WCQA 1K51A 4LK0M 4YWGG 1FMAD 1HXYD 2E6XA 3HUIA 4C7ZA 2J52A 2V0GA 1C79A 4B0EA 5H8YE 1D5ZC 2WQYB 1I4GA 1R7SA 1ZXIA 1MI0A 1YN3A 1ZUD2 2JWUA 2IPKD 1TS2A 2VZKD 3E56A 3URYA 3B2GA 1N62A 1ROEA 3AE6B 3BVGA 5TSSA 5JXVA 3AV8A 4HJGE 1TY2A 2PW9A 3IAS1 1I4QA 2AQ2B 4XE0A 4WQMA 4MM3B 1RM6C 1F2RI 1CJEA 1XF5L 2WXMA 3P4SB 5T8IA 4WWMA 4P6VF 4RGTA 2JQRB 2PVOD 3RFZB 2I38A 2LFIA 3FILB 1VRAB 5HI1A 5BMIA 3AEGB 3PZ7A 1SE2A 1K50A 1FNVA 3U52E 3NVWA 4USAA 1P7FA 1M4VA 1PUTA 3BIID 3P4QB 2HDEA 3SFDB 3U7ZA 3AE9B 1C78A 4US9A 2LHEA 5D7GA 3AMZA 4KX6B 3KQ4A 1FNWA 4DQOC 4Q2JA 2YEPB 3HVZA 1RYJA 1ENFA 4P16A 3R2IA 2WDRB 2L32A 1L0YB 4AQ7A 2LHDA 2FUG1 2GI9A 2WDVB 1GB4A 1N60A 1ACCA 3ABVB 4WIPA 2WXQA 1V1PB 2BYTA 3EUB2 1HZ6A 2JZPA 1NYQA 3L4PA 2KAJA 1NEKB 1J7AA 1NYRA 5LNK1 2M19A 1QT9A 3BK2A 1CQVA 1B9RA 2KN4A 1ESFA 2WXHA 4H2AA 4NJCA 1BXTA 3DWMA 1MPEA 2M0AA 2IDYA 2PTLA 3MP9A 2L1AA 3NZ3A 1NVID 1ZDVA 2J53A 2ZW0A 3BVMA 1PGAA 3P42A 4KGSA 4KGTA 1F0ZA 3BWUD 4JPSA 1XEEA 1ZPSA 2IGDA 1SXTA 5BMGA 1JQ4A 1T5XD 3NVVA 4OVZA 2LJIA 3RPFC 1GOZA 2QJLA 4XWWA 1P7EA 2JYTA 2HTME 3VR9B 2K9XA 1XLQA 1L0VB 5EE9A 1VDVA 1JRPA 1TKEA 1VZ7A 3PO0A 2BT6A 5C2TB 2LGIA 4A90A 1N5WA 1V1PA 1JCKB 3I57A 3VQIA 1VR9A 2IGGA 3Q8FA 1QOBA 2D5GA 2PLPA 5BMHA 2WXKA 5HFYA 2MJ3A 1STEA 5BYRA 1E7PB 4ZYSA 2BB5A 3BYYB 1TYGB 1YQ3B 2LMCA 1TS3A 3H8HA 1JWSD 1UGJA 2DYMA 2Y5PA 1CK1A 2JXTA 1FO4A 1C4PA 3V05A 2MH7A 3B2FA 1E9MA 1V8CA 1PYWD 1RWSA 1FCCC 1TKGA 3AE2B 4N6EB 2KQ4X 1EWYC 1ET9A 4M0WA 3C8YA 4L2YA 3V3XA 2N0SB 2J4XA 4RF1A 1I4PA 4REZA 1D4BA 1PGXA 3P1MA 1Q10A 2RPVA 3U2SC 4NAMA 1HQRD 4DXFA 4PT5A 2PMVA 2QMTA 4TQ1A 3MHZA 3NVYA 3O13A 1E10A 2WLBA 1L4ZB 4HKZE 2K22A 1JALA 3TSSA 1IBXA 1KH0A 5FKAC 2QSDA 1QOAA 4ITKA 5HG2A 3MC0B 2NMQA 2AQ1B 4LLGM 3BK1A 4A9AA 1SIJA 4OHJA 4RGNA 5EE3A 2ZW1A 1QOFA 5EE1A 1HZ5A 1KLGD 1L5PA 1UWMA 3MFGA 3ZQ4A 2NTTA 1FCLA 2TSSA 3GS2A 5E6JA 1L4DB 1AWDA 1JWUD 2G9HD 2MJEA 1LO5D 1OQQA 4IDIA 2I2YA 1XO3A 2PKOA 2WXRA 2QEJC 2Y3AA 3R2TA 1FEHA 5D3IB 1C9FA 2L83A 2Q5WD 4YT0B 2WXIA 1EWCA 3NVZA 3MJ5A 3ETRA 1WXQA 1WSPA 4OZBA 1GB1A 1KTKA 1SBBB 3W2DA 1SE3A 4GDKB 1JROA 4RFBA 4RGMA 1B1ZA 1FXIA 1T3QA 2H88B 2E3TA 3Q8CA 1IGCA 2BS3B 2N9KA 3AEBB 1C4AA 1MVKA 2X38A 3AEEB 5D3DA 1A70A 4ZRPA 2H89B 4OW0A 3ZJVA 4CQNA 1EU3A 3AH7A 1MHXA 2K5PA 1DYQA 5GXGB 3P4RB 4YTMB 4JWUC 1I7HA 3AE7B 4JX1C 1V97A 1JMLA 3VR8B 3TEXA 1SE4A 3Q8AA 3BZDB 2WXOA 1TKYA 4L1BA 3FILA 4US8A 2AX5A 1SJED 3BYTB 1KRHA 1V1OA 3FC4A 3N9YC 2WNMA 2W54A 2G1EA 5AUKA 2QILA 4YTNB 1ZP0B 1PFDA 4NZLB 2W82A 2B76B 2WXPA 4HKQA 3LYYA 1PDXA 2KDMA 3W1SA 2BS2B 1SSNA 1FD6A 1FM0D 1SJHD 3KLSX 3W9CB 1YN5A 4YSZB 2WXNA 3Q8EA 2RDGA 4RCOA 1JW9D 1NI3A 1VZ6A 3T3OA 1DGJA 2FE8A 3AE5B 4UDUC 2BB6A 1FIQA 3UI3A 4D2KA 1N63A 1K52A 1XLNA 2MEKA 3IXSA 1C77A 2INPE 1E6EB 3EA6A 3Q69A 2N9LA 1Y56A 1XCTL 1JWMD 2EKIA 3IT4B 4ZHOA 4KKIA 3W5VB 2DYOA 2J42A 3IAM1 4C80A 4HEA1 1QQRA 3ZGZA 1GAQB 3GB1A 3AB5A 4ARIA 2WU5B 5EE0A 5AUIA 5H92C 5G5GA 1SEBD 2JYEA 3CWIA 3PZ8A 1DOIA 2EELA 1E0ZA 1SB3C 2WS3B 1N5XA 2BTEA 1YMHE 3AM9A 4OZAA 4GLSC 3TEZA 1QOGA 5BYQA 1EM7A 4L23A 2DLBA 5MPOA 2FBWB 4B0MA 4J3OD 4YXDB 3HVDA 2QIEB 2L52A 3I9V1 4A55A 1NENB 4JE3B 4HROA 1YJIA 2PIAA 3W5UB 4C7YA 2K0PA 2W55A 2KMMA 1BMLC 1OFFA 5BYSA 1WYGA 3AE8B 4A8XC 1I4RA 1OQRA 3TEYA 2CJNA 3B9JA 2IJ0A 2LEKA 2WXLA 1J7BA 2WXGA 4RGOS 3U4EG 1C76A 1EU4A 2BW2A 3LB8C 1QLBB 1TZOA 3P4PB 3LXFA 4KGRA 4RNAA 4C56C 4MH8A 3KWVA 3AE1B 1I4HA 2ACZB 1MHHE 1UNSA 4XDCA 3EGRA 2R61A 2WU2B 3ZJTA 4TQ0A 5G5HA 1PGBA 4TSSA 1I4XA 1SF0A 2BS4B 3OWEB 1FFUA 2ICIA 3TUOA 3T3NA 2RDHA 1D6EC 2WP9B 3TEWA 4WURA 3AEAB 1XLOA 2DWQA 2BBCA 4KKJA 3KWLA 2WXJA 4R3DA 4OZCA 4ARCA 4YSYB 1FRRA 5FK9C 1L6UA 1XLPA 1F77A 3P63A 2YEPF 5FR3A 2PVGC 3E9SA 5C3JB 1TS4A 1T6BX 3AE4B 1YJJA 1VLBA 2JSVX 4TMAB 4YTPB 1K53A 1F2RC 3AEFB 3GP7A 2Y5CA 1VZ8A 2M56B 1JWAD 4A6QA 1UWXA 4WH4A 1XCQL 1KFYB 2Z8LA 2GB1A 2W3RA 2XN9C 1YN4A 5I4DA 2KWDA 2KACA 3ZJUA 2INNE 2SEBD 1YQ4B 2VZKB 1D5XC 4RH6A 1QKZA 1C4CA 1CZPA 2JU6X 2NTSA 2OHFA 1HA5A 2K3UA 3J9CA 4GDLB 1FNUA 2AQ3B 4MACA 4RF0A 1ZOYB 1AW7A 2LUMA 2V3NA 3NS1A 3AECB 2GRIA 3CIRB 3DWGC 1ET6A 4IOIE 1IUEA 1IGDA 4MT5A 2N7JA 3NUHB 4XWTA 4AS1A 2RMMA 3HRDD 5HHDG 1WWTA 1FFVA 1JWBD 1KLUD 4EE2A 3BVZA 4DXGA 4YSXB 1ZE3D 2MJDA 1AYFA 3FAHA 4JWSC 1L0XB 2V3PA 2V4IB 1FRDA 1L6VA 2W3SA 1VJKA 3SFEB 1QF6A 2DBYA 2OEDA 2JX5A 1BUIC 1QILA 3AN1A 1ZXHA 4HRSA 3VRBB 1ZDXA 1YNTE 1N61A 4N58A 2WXFA 4LTUA 4XDDA 1WRIA 1J7CA 2XNAC 1RFKA 4IKGA 4FXCA 3VRAB 3IT6B 2WDQB 3ZYYX 4ZOHC 3AE3B 1IBXB 4ZHPA 1GPXA 1DOYA 2IGHA 3Q8BA 3R8BA 3SR6A 1TY0A 1AN8A 2ON8A 3NRZA 2SAKA 4N59A 4NAWB 2ONQA 4O1NA 4WAFA 1UUPA 3AEDB 2CU3A 2CJOA 1TS5A 4ZRQA 1FXAA 1XXGA 1WGKA 1TJEA 1KF6B 3SEBA 1HEZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGB A;  3FIL A;  2LGI A;  1K51 A;  2J52 A;  2IGG A;  1MI0 A;  2JWU A;  2PLP A;  4OZC A;  5BMH A;  5HFY A;  5JXV A;  4HJG E;  2PW9 A;  2KDM A;  1FD6 A;  1F2R I;  2JXT A;  1XF5 L;  2JSV X;  1K53 A;  1FCC C;  1F2R C;  2I38 A;  2KQ4 X;  3UI3 A;  4D2K A;  1K52 A;  3FIL B;  5HI1 A;  1UWX A;  4WH4 A;  1XCQ L;  5BMI A;  3V3X A;  2GB1 A;  2N9L A;  1XCT L;  1K50 A;  1D4B A;  2KWD A;  1PGX A;  1P7F A;  2KAC A;  1Q10 A;  2RPV A;  2LHE A;  1QKZ A;  2JU6 X;  3GB1 A;  2QMT A;  4MAC A;  2LUM A;  4HKZ E;  2EEL A;  4IOI E;  1IBX A;  1KH0 A;  2QSD A;  1IGD A;  2LHD A;  2N7J A;  5HG2 A;  2NMQ A;  2GI9 A;  2RMM A;  5HHD G;  1GB4 A;  1YMH E;  4OZA A;  4GLS C;  2ZW1 A;  1HZ5 A;  1FCL A;  1HZ6 A;  2JZP A;  1EM7 A;  2KN4 A;  2OED A;  2I2Y A;  1MPE A;  1ZXH A;  2PTL A;  1YNT E;  3MP9 A;  1C9F A;  2K0P A;  4IKG A;  4OZB A;  1GB1 A;  1IBX B;  2J53 A;  2ZW0 A;  2IGH A;  1PGA A;  4KGS A;  1IGC A;  4KGT A;  2N9K A;  1MVK A;  1MHX A;  2IGD A;  2ON8 A;  5BMG A;  2ONQ A;  4KGR A;  1P7E A;  1MHH E;  1JML A;  1HEZ E; 
#chains in the Genus database with same CATH topology
 2JRH A;  1DOX A;  3WCQ A;  2UU7 A;  1Y8R C;  2E6X A;  2NBW B;  5H8Y E;  2WQY B;  1MI0 A;  3K9P B;  3JVZ X;  3AV8 A;  4TKN A;  2AQ2 B;  1XD3 B;  4G0N B;  1CJE A;  2WXM A;  3DBL I;  4LNF A;  3U30 A;  4RGT A;  2JQR B;  4RM9 A;  3FIL B;  5HI1 A;  2JZZ A;  2D3C A;  2CR5 A;  2N7D A;  3ZNG C;  5GMV A;  4HCP B;  3WAP A;  1PUT A;  2BKF A;  3AE9 B;  4F7Z A;  1YQB A;  2GLS A;  5D7G A;  4M02 A;  2Y5B B;  1VCB A;  1F52 A;  4KX6 B;  3KQ4 A;  2R2O A;  2KMA A;  1LM8 B;  4P16 A;  1AAR A;  2LHD A;  3Q3J A;  2MBH A;  1GC7 A;  1GB4 A;  1ACC A;  4WIP A;  1E5W A;  4BOS C;  1LQB A;  2KLG A;  3L16 A;  4BOZ B;  2L7R A;  5TR5 A;  3V62 A;  1B9R A;  2KN4 A;  1ESF A;  3X23 A;  2QCZ A;  1BXT A;  3ZNH B;  3Q2A C;  4JIO U;  1WR6 E;  3MP9 A;  1OQY A;  2DAJ A;  5D6J B;  2KDB A;  3NZ3 A;  2B3A A;  3RUL A;  2AL3 A;  2ZW0 A;  2ZVO A;  3P2B A;  3VVW B;  1TZ1 A;  3U7D A;  1F0Z A;  1SXT A;  4W9H A;  3H6N A;  5D94 A;  2AWT A;  1T5X D;  3AXC A;  2HTM E;  3VR9 B;  2K9X A;  4BKS A;  1XLQ A;  1TKE A;  3T9L A;  3PO0 A;  5IN7 A;  5C2T B;  4NQL B;  1R4N B;  1X1M A;  4A90 A;  1VD2 A;  2BF8 B;  1V1P A;  4EZL A;  4ZRJ A;  3I57 A;  1VR9 A;  4KVG B;  3PLV A;  2LWP A;  1V2Y A;  4K7U A;  2L00 B;  4OVV A;  4I6N B;  2K8H A;  1YQ3 B;  4GU2 A;  1WZ3 A;  1JWS D;  1UGJ A;  2Y5P A;  4TV3 A;  3H1U A;  1FO4 A;  3V05 A;  5CHV C;  3AE2 B;  1EWY C;  4HJK A;  1ET9 A;  2RGF A;  3V3X A;  3SD5 A;  2N0S B;  4P1B C;  4RF1 A;  1D4B A;  2ZEQ A;  4PK1 A;  2RPV A;  2M0X A;  2MLB A;  4E74 A;  2KJR A;  2PMV A;  2QMT A;  1P0R A;  3MHZ A;  4HDQ A;  2JT4 B;  3PV1 A;  1JAL A;  3ZVV A;  1KH0 A;  5FKA C;  1QOA A;  4IUM B;  3ZTD A;  1SIJ A;  4MH0 E;  2NTT A;  1IPG A;  3PRP B;  2G9H D;  2BWF A;  3W1Y A;  1R4N I;  5D3I B;  4NJ7 A;  2L83 A;  2WXI A;  4FLH A;  5AEK B;  1IP9 A;  2KOX A;  4KV2 A;  4RFB A;  2DEN B;  2E3T A;  2BS3 B;  3AEB B;  1C4A A;  2JXX A;  3AEE B;  1A70 A;  1WM2 A;  2H89 B;  3AH7 A;  4MGK E;  3ZRF A;  4MM3 A;  1DYQ A;  1L2N A;  3P4R B;  2N4F A;  3ZO5 B;  2MW5 A;  4YTM B;  5KHO A;  3GZN B;  1TKY A;  1WX8 A;  1V1O A;  2CKH B;  4MEL A;  2ZPY A;  5AUK A;  1WY8 A;  4YTN B;  4JGH B;  4NZL B;  3GOE A;  2B76 B;  4A3O A;  3W1S A;  2BS2 B;  4YSZ B;  3WAN A;  2WXN A;  1IYF A;  4RCO A;  5G2N A;  3KYC D;  1NI3 A;  2V9H A;  2XK5 A;  2MBQ A;  2FUH B;  1DGJ A;  3AE5 B;  2BWE S;  2GBR A;  2M4N A;  3Q69 A;  2LI5 A;  3PZD A;  2EKI A;  2M8S A;  3W5V B;  5IKC M;  5C1Z A;  4HEA 1;  4ARI A;  5EE0 A;  5AUI A;  3QJZ A;  4S0R A;  5G5G A;  2GOW A;  2L0T A;  3OJ3 A;  3PZ8 A;  2LUE A;  2HE7 A;  3APF A;  2JUO A;  1V80 A;  2BYF A;  1QOG A;  4IW0 A;  3RMK C;  3A1Q B;  3V6C B;  3GZN I;  4YXD B;  3HVD A;  2L52 A;  2J0J A;  2YVC A;  3ZRC A;  1WYG A;  2X8X X;  3B9J A;  2WXL A;  3U4E G;  1WIA A;  1KOT A;  1QLB B;  1N6Z A;  4M00 A;  2D07 B;  2FCQ A;  3KWV A;  1I4H A;  3ZJT A;  3WAO A;  4TQ0 A;  1J8C A;  1PGB A;  3AUL A;  1I4X A;  3TUO A;  3AU4 A;  1LFD A;  2JY6 A;  3AEA B;  3JSV A;  2BBC A;  3N1Z C;  4W9D A;  4LNN A;  4PYZ A;  5FK9 C;  3P63 A;  4B6W A;  1YJJ A;  1LXD A;  4TMA B;  2BPS A;  2O2V A;  1UGM A;  2RR9 A;  3TMP B;  4A6Q A;  2LVO A;  3V61 A;  1KFY B;  1RAX A;  2MWS B;  1EF1 A;  2KWD A;  2KAC A;  2SEB D;  2LVP A;  4RH6 A;  2NTS A;  1FNU A;  4MAC A;  3N30 A;  1AW7 A;  1ET6 A;  1TGZ B;  4IM0 A;  1IUE A;  1IGD A;  2NPT A;  4XWT A;  5LXH A;  5HHD G;  1LGR A;  1KLU D;  2ZCC A;  2HTH A;  4YSX B;  1WGH A;  4CYE A;  4DHJ D;  2W3S A;  2OED A;  4K81 A;  1BUI C;  1QIL A;  1KM7 A;  4KDI C;  1N61 A;  5DPR A;  2IO3 B;  2KZR A;  1J7C A;  3VRA B;  2BGF A;  1G6J A;  3ZYY X;  3AE3 B;  4RMA A;  3Q8B A;  1HTO A;  1TY0 A;  1AN8 A;  4G50 A;  3DVN U;  1WZ0 A;  3A4S C;  3I3T B;  3PSE B;  3SEB A;  1HEZ E;  2LXA A;  3CMM B;  1D5M C;  4LK0 M;  4NY0 A;  1HXY D;  3HUI A;  4C7Z A;  1C79 A;  3UF8 A;  3N20 C;  1D5Z C;  1ZXI A;  1R7S A;  2VZK D;  1ZUD 2;  2WX0 A;  3E56 A;  3URY A;  3DHG C;  2KYW A;  4KIK A;  1E7V A;  1UEL A;  2O6V D;  2PW9 A;  1WXM A;  1E8Y A;  3IAS 1;  1I4Q A;  4EUT A;  4MM3 B;  1XF5 L;  4BAX A;  3H7P A;  4AWJ A;  2LFI A;  2N9P C;  3C19 A;  1C3T A;  1V6E A;  2LJ5 A;  3AEG B;  3PZ7 A;  5J17 A;  2LD9 A;  3GE3 C;  5E6N A;  4ANX A;  2KTR A;  5DPT A;  3RNA C;  1M4V A;  3P4Q B;  4FHK A;  3R7R A;  1C78 A;  2LHE A;  3AMZ A;  4Q2J A;  3HVZ A;  3R2I A;  2WGS A;  4N9F 4;  2NVU I;  4GGQ A;  3ABV B;  4E3C A;  4WJP A;  2Z59 B;  1HZ6 A;  2JZP A;  3CSF A;  5LNK 1;  1E8X A;  2JPH A;  1KLV A;  4HXD A;  1J0G A;  2M0A A;  1WGG A;  3CF6 E;  4PS7 A;  2KK8 A;  1NVI D;  1FXT B;  3L54 A;  4WJO A;  3BVM A;  2NBV B;  1PGA A;  4W9L A;  4KGS A;  3V60 A;  2KXJ A;  1GG3 A;  3BWU D;  2KN5 A;  2REX A;  5BMG A;  2KC1 A;  2L3Z A;  4JQW C;  4OVZ A;  2LJI A;  4ANW A;  2PE9 A;  4BBN F;  1BT0 A;  4XGA B;  4GN1 A;  5EE9 A;  3ZTC A;  2D11 A;  4HPL B;  1WMH B;  2LGI A;  1WYW B;  2D5G A;  3KVF B;  3VTW A;  4ZYS A;  4GDL A;  4BKS D;  2LMC A;  2DYM A;  1CK1 A;  2LRU A;  2AYO B;  4HDO A;  4ZRK A;  3B2F A;  1PYW D;  3PTF C;  1TKG A;  4N6E B;  2C7N B;  4IM3 A;  1WI0 A;  3ECI A;  3UQB A;  5E6O A;  3P1M A;  4ZDV A;  3RT3 B;  2MQJ A;  5JZE B;  3L08 A;  3NVY A;  3O13 A;  1E10 A;  4HKZ E;  1JRU A;  3LJ3 A;  4ITK A;  3MC0 B;  2O2V B;  4LLG M;  4WAA A;  2KJ6 A;  4OHJ A;  4RGN A;  2ZW1 A;  1QOF A;  3ZQ4 A;  4HKQ A;  1KLG D;  3MFG A;  4NAW A;  2WHI A;  3GS2 A;  1F1H A;  1P9D U;  1JWU D;  3ZNZ B;  3AI5 A;  1XO3 A;  4W9C A;  3MC8 A;  1EWC A;  4ASW C;  3ETR A;  4OZB A;  1GB1 A;  4LNK A;  1KTK A;  4ANV A;  3W2D A;  1SE3 A;  4FN2 A;  4FUL A;  2I1J A;  2NPT B;  3JYU A;  2X38 A;  3UIP B;  4K3B A;  3PHW B;  2K5P A;  1OGW A;  1P3Q U;  4KSL C;  1XT9 B;  3RUI B;  2Z0E B;  2CHW A;  1SJE D;  1SGH A;  2CHZ A;  4ZYN A;  1UD7 A;  3Q3M C;  1PFD A;  1YX6 B;  3DHH C;  3KUC B;  4WWO A;  3N1Y C;  2DAF A;  2ZZP B;  3LYY A;  1FD6 A;  3L13 A;  1FM0 D;  3W9C B;  3PRM B;  4XC2 A;  2RDG A;  3QA8 A;  3T3O A;  4IC7 B;  2FE8 A;  3QC8 B;  3DQV A;  4W9G A;  4D2K A;  1XLN A;  2MEK A;  3IXS A;  2INP E;  3DVG Y;  2FID A;  2LGD A;  3EA6 A;  4CHK A;  3N32 A;  4ZHO A;  2RD0 A;  4WJN A;  3AU5 A;  5IAA C;  3JW0 X;  1V5T A;  4KIK B;  1QQR A;  3NS8 A;  1GAQ B;  2NR2 A;  1P98 A;  1UZX B;  3NHE B;  5H92 C;  2N9E B;  3VTU A;  5IO9 A;  1U4A A;  3CWI A;  1H8C A;  2EEL A;  1SB3 C;  3H7P B;  4IWQ A;  5EDS A;  1YMH E;  1V49 A;  3AM9 A;  1WJU A;  4BKG A;  5BYQ A;  2K25 A;  2KTR B;  4B0M A;  2G4D B;  2IO2 B;  2KO3 A;  2QIE B;  3I9V 1;  3Q6B A;  4P7I A;  3SDL C;  4A55 A;  4DBG A;  3C0R B;  4HRO A;  2KVR A;  3NG0 A;  4GXB A;  1EUV B;  1RLF A;  1OQR A;  3TEY A;  2V4L A;  2CJN A;  1L7Y A;  2LEK A;  2RPQ A;  3ZXR A;  3R7Q A;  3PRE A;  3DBS A;  5CX3 A;  4MH8 A;  1WGR A;  3AE1 B;  1UNS A;  1UBQ A;  1ZW7 A;  4C4V B;  2D3B A;  2GMI C;  4DHJ B;  5G5H A;  1GNU A;  4TSS A;  3A9K A;  3B0A A;  2BS4 B;  4AUQ C;  3TEW A;  2CS4 A;  2L8J A;  2ASQ A;  4OZC A;  2VH2 A;  2K39 A;  4LDT B;  1F77 A;  3EEC A;  5IOI A;  1WXS A;  3E9S A;  5C3J B;  3UQA A;  1TS4 A;  1T6B X;  3TIX A;  4EKU A;  3HK0 A;  4NQK E;  3VH3 B;  1UBI A;  1UWX A;  1XCQ L;  2GB1 A;  2XN9 C;  5I4D A;  3PS6 A;  3ZJU A;  4G11 A;  1YQ4 B;  3A4R A;  2VZK B;  5HKH A;  1E8W A;  4WJQ A;  2OHF A;  1RFA A;  1HA5 A;  3DVN V;  4GDL B;  2C5L C;  3M95 A;  2O6V B;  3IG3 A;  3EFC A;  4PS8 A;  4M8N A;  4EZK A;  5JHB A;  4ANU A;  4MT5 A;  2KNB A;  3NUH B;  2FCM A;  4BKT A;  1OEY A;  1ZE3 D;  2MJD A;  4JWS C;  1L0X B;  2D3G A;  2ZVN A;  1WX7 A;  3SFE B;  2V1Y A;  2AEH A;  3VRB B;  2KFK A;  4LTU A;  4XDD A;  2XNA C;  4EOY A;  3IT6 B;  3KYD D;  4LCD E;  3N1X C;  3R8B A;  4FBJ B;  2M1M A;  2UWQ A;  1PQS A;  2ON8 A;  4FJZ A;  4NAW B;  2VH1 A;  1P1A A;  1UUP A;  4HPP A;  2MRP A;  2CJO A;  4ZRQ A;  1XXG A;  1WGK A;  2QDF A;  4CO7 A;  1KF6 B;  3L10 B;  5FR6 A;  2J7Q B;  3HHM A;  4J6I A;  1K51 A;  1FMA D;  2L0F A;  2J52 A;  2IO0 B;  1I4G A;  3B2G A;  3RNG C;  1YN3 A;  2JWU A;  4F8C B;  4GSW A;  4K7S A;  1ROE A;  3AE6 B;  5TSS A;  3RCZ A;  3VDZ A;  5JXV A;  4HJG E;  2RDB C;  2WDT B;  4HWI B;  4WQM A;  5DPW A;  3W1S C;  2GBK A;  3P4S B;  5T8I A;  4WWM A;  2LGY A;  4P6V F;  5L95 C;  1K8R B;  2PVO D;  3IHP C;  4RM8 A;  3ALB A;  3UIO B;  1WRD B;  3PRZ A;  5BMI A;  4B95 A;  4IG7 B;  1FNV A;  1P7F A;  3BII D;  3U8Z A;  3KW5 B;  1V5O A;  4US9 A;  3M63 B;  2ZCB A;  1TT5 B;  1ENF A;  3QWZ B;  3O65 B;  2D3A A;  1L0Y B;  4AQ7 A;  2FUG 1;  4ICU A;  2MHJ A;  2M17 A;  1V1P B;  2BYT A;  1YD8 U;  3EUB 2;  5J18 A;  3ML9 A;  2KAN A;  4IM2 A;  3L4P A;  1J7A A;  1NYR A;  1V9J A;  2KWU B;  2M19 A;  1QT9 A;  3X0W A;  2KDI A;  3H7S A;  4NJC A;  2PTL A;  2IDY A;  3APC A;  2L1A A;  4C00 A;  3VUW A;  4BVU C;  1HTQ A;  3I5J C;  2XBB C;  2KX0 A;  4LNO A;  2FCN A;  4W9I A;  2GBM A;  4KGT A;  2OJR A;  1ZPS A;  1JQ4 A;  2LAS A;  1GOZ A;  2QJL A;  4XWW A;  1P7E A;  2JYT A;  3Q3F A;  4AP4 C;  1VDV A;  1JRP A;  1WE6 A;  1T0Q C;  3H9D A;  4HCN B;  4A3P A;  3VQI A;  3APD A;  4LDT D;  1GJZ A;  2EMS A;  1QOB A;  3VXW A;  2K8C A;  2PLP A;  2WXK A;  1STE A;  2GBN A;  5JH5 C;  2MBB B;  3MJW A;  3H8H A;  2DZJ A;  2EMT A;  3DDC B;  2QHO A;  2JXT A;  1C4P A;  3NZU A;  4AOF A;  2IBI B;  1V8C A;  4X57 B;  1RWS A;  1FCC C;  1WM3 A;  2KQ4 X;  3A9K B;  5KHQ A;  4M0W A;  3C8Y A;  4L2Y A;  4REZ A;  2D10 A;  1PGX A;  2LXC A;  1Q10 A;  3U2S C;  1E90 A;  4NAM A;  2K8B A;  1HQR D;  2ZNV B;  4DXF A;  1WR1 A;  2HJ1 A;  4TQ1 A;  2IY0 B;  5CHW A;  2NBU A;  1L4Z B;  2K22 A;  3TSS A;  2KVZ A;  1IBX A;  2QSD A;  3Q14 C;  2NMQ A;  3NOB A;  4NPN A;  1NI2 A;  5EE3 A;  1UWM A;  3A9J A;  2TSS A;  5E6J A;  1L4D B;  2DZM A;  1WJ6 A;  1AWD A;  3VTV A;  2C7M B;  4ICV A;  1NBF C;  1LO5 D;  4IDI A;  2WXR A;  5AZF A;  2QEJ C;  2Y3A A;  4FAD A;  4MJS A;  3PVL A;  4K1R B;  3NVZ A;  1GC6 A;  1Q0W B;  1WXQ A;  2XK5 B;  3DCG A;  2KQ7 A;  2ZPN A;  2EKE C;  1B1Z A;  2H88 B;  1IGC A;  2N9K A;  5D3D A;  1MVK A;  4B0E A;  4OW0 A;  3ZJV A;  1EU3 A;  1YOV B;  3RI7 C;  3WAM A;  2GBJ A;  3QX1 A;  4MGI E;  4JX1 C;  1V97 A;  1JML A;  3TEX A;  3Q8A A;  3BZD B;  4L1B A;  3BYT B;  2KFK B;  3PLU A;  1YJ1 A;  1MJD A;  3FC4 A;  3N9Y C;  2WNM A;  2W54 A;  2QIL A;  1ZP0 B;  4G3X B;  5E6P A;  2BQQ A;  2W82 A;  2IO1 B;  3VFK A;  1PDX A;  1QZE A;  1WE7 A;  1WXV A;  3KLS X;  1SJH D;  2HJ8 A;  2D2Q A;  3T8M A;  3Q3N C;  3RYT A;  3ONS A;  2A4Z A;  4UDU C;  1FIQ A;  2G3Q B;  1K52 A;  2FNJ B;  2KDE B;  3ZNI D;  2N9L A;  1Y56 A;  3ZW3 A;  1XCT L;  1JWM D;  3IT4 B;  4KKI A;  2DYO A;  3IAM 1;  4C80 A;  2Z0D B;  3ZGZ A;  3GB1 A;  1UF0 A;  2WU5 B;  2C9W B;  1SEB D;  3ZLZ A;  3RNE C;  1E0Z A;  2WS3 B;  2MP2 A;  2K6D B;  1EM7 A;  3JSV B;  4DHZ E;  4FJV B;  2DZK A;  4J3O D;  4AJY B;  3DBH B;  1NEN B;  4JE3 B;  2KMC A;  3W5U B;  1YJI A;  4C7Y A;  2KQS A;  1OFF A;  2FCS A;  5BYS A;  2N9X A;  3AE8 B;  3UGB B;  4A8X C;  4HPM B;  1I35 A;  1M94 A;  1V81 A;  2KX3 A;  3OLM D;  3KUD B;  1EU4 A;  4KZ0 A;  3LB8 C;  2CU1 A;  2DZI A;  1TZO A;  3P4P B;  4GMV A;  2LVQ A;  4RNA A;  3EGR A;  2WU2 B;  4MGZ E;  2R2Q A;  3NY5 A;  1FFU A;  3MTN B;  3T3N A;  2RDH A;  4WWN A;  3A1Q A;  3KWL A;  3QCA A;  4A20 A;  4DHZ B;  1FRR A;  4F1S A;  1L6U A;  1XLP A;  2LGX A;  2PPH A;  2LZ6 A;  5FR3 A;  2YEP F;  4K3C A;  2KT7 A;  4HVB A;  3AE4 B;  2JSV X;  3S2A A;  2DNF A;  4W9F A;  3GP7 A;  2Y5C A;  1JWA D;  2INC C;  5IP4 D;  3KH0 A;  2Z8L A;  3ZKJ C;  1XQQ A;  2FIF A;  5CTR C;  3DBH I;  2IND C;  3TJP A;  3D32 A;  2PEA A;  1GUA B;  1D5X C;  1CZP A;  1WGD A;  5LXI B;  4TUU A;  4YL8 A;  3NS1 A;  3AEC B;  3DWG C;  1MG4 A;  4IOI E;  4GDK A;  2N7J A;  3HRD D;  4FHJ A;  1WWT A;  2W9N A;  1FFV A;  2KWV B;  4EE2 A;  3BVZ A;  4DXG A;  5JHA A;  3ZUN A;  2N1V A;  3BIN A;  4M0W B;  2KHW B;  2A5U A;  3FAH A;  3DOW A;  2V3P A;  3IBE A;  1QF6 A;  2JX5 A;  3AN1 A;  1EO6 A;  4HRS A;  3I63 C;  1OTR B;  1YNT E;  1ZDX A;  2N1W A;  2WXF A;  1WRI A;  1RFK A;  2JRI B;  1R4M B;  2NS5 A;  3PT2 B;  3QHT A;  4FXC A;  2JVC A;  4ZOH C;  1IBX B;  4ZHP A;  4MSM B;  4BFR A;  2MCN B;  2VRR B;  4OVU A;  3SR6 A;  3QAR A;  1YX5 B;  3OG5 A;  4MSQ B;  4N59 A;  4WAF A;  2ONQ A;  3A9J B;  3AED B;  1F9J A;  4GB9 A;  1TJE A;  1WX9 A;  2C7H A;  4IWO A;  4M01 A;  4YWG G;  4MJS B;  2V0G A;  2NCN A;  4FJY A;  2IPK D;  1TS2 A;  3Q3O C;  1N62 A;  4II2 B;  3BVG A;  2FAZ A;  1TY2 A;  4XE0 A;  4MDK E;  2KDF B;  3ZDT A;  3BY4 B;  1RM6 C;  4PS3 A;  1F2R I;  1HE8 A;  1A5R A;  4URK A;  3RFZ B;  2I38 A;  1VRA B;  2KFJ A;  4WWP A;  1FPY A;  4XYC A;  1SE2 A;  4W9J A;  1K50 A;  4W9E A;  4WQO B;  3U52 E;  3NVW A;  4USA A;  2J0M A;  3U7Z A;  1T0R C;  2HDE A;  3SFD B;  4M8M A;  1R4M I;  1FNW A;  4DQO C;  2YEP B;  3DVG X;  1RYJ A;  1Z2M A;  1TBE A;  2AL6 A;  2L32 A;  2WDR B;  2GI9 A;  2WDV B;  1N60 A;  2WXQ A;  3ZIM A;  5C23 A;  1NYQ A;  2IY1 B;  2KAJ A;  1NEK B;  1WGY A;  3BK2 A;  1CQV A;  2WXH A;  4FA6 A;  4H2A A;  2JWZ A;  3DWM A;  1MPE A;  3VHT C;  1D3Z A;  2MA9 B;  1WXA A;  4LJO B;  1WJN A;  1YIW A;  1ZDV A;  1V86 A;  1T0S C;  2J53 A;  4DWF A;  3RNF C;  1E7U A;  3P42 A;  4DDI D;  1ISN A;  2PJH A;  1RRB A;  2MP2 B;  4JPS A;  1XEE A;  5IA7 A;  2IGD A;  3RNB C;  5L83 A;  3NVV A;  3RPF C;  1L0V B;  1VZ7 A;  5DCN A;  2BT6 A;  3QAQ A;  1N5W A;  2V3S A;  3B08 A;  1JCK B;  2IGG A;  3NJT A;  3Q8F A;  5AZH A;  5BMH A;  5HFY A;  3MC9 A;  2MJ3 A;  3ENE A;  5BYR A;  1E7P B;  4KDL B;  2BB5 A;  3BYY B;  1TYG B;  2ZNV C;  2G4S A;  1TS3 A;  2BKR B;  1ZGU B;  3OAW A;  2MH7 A;  1E9M A;  4MGY E;  4XX5 A;  4PYU A;  3QQ8 B;  1WFY A;  3HM6 X;  2CHX A;  2J4X A;  2KC2 A;  1I4P A;  1TIF A;  3WIM A;  4PT5 A;  1WMH A;  3RN9 C;  1WF9 A;  2DX5 B;  3LDZ E;  1Q1O A;  2WLB A;  2WWZ A;  3OJ4 B;  2JZ3 B;  3VUX A;  5HG2 A;  2AQ1 B;  5D2M B;  3BK1 A;  4A9A A;  1S3S G;  5EE1 A;  1HZ5 A;  1L5P A;  1FCL A;  3TL5 A;  3PGE A;  1WH3 A;  3A33 B;  5CHF A;  2YLM A;  2MJE A;  1MFW A;  1OQQ A;  2I2Y A;  2PKO A;  2I1K A;  3R2T A;  1FEH A;  2BVC A;  1C9F A;  3DPD A;  2Q5W D;  4YT0 B;  3GE8 C;  3IFW B;  3MJ5 A;  1WSP A;  1SBB B;  4GDK B;  2KD0 A;  1JRO A;  4RGM A;  1FXI A;  1T3Q A;  2WYQ A;  3EHV A;  3Q8C A;  4II3 B;  4CQN A;  4ZRP A;  3PPA A;  1MHX A;  5GXG B;  3SU8 X;  2BYE A;  4JWU C;  2KLC A;  1I7H A;  3AE7 B;  4JL9 A;  3PHX B;  3VR8 B;  1SE4 A;  3VH4 B;  2WXO A;  3FIL A;  1NDD A;  4US8 A;  2AX5 A;  1I42 A;  3WA0 A;  4K7W A;  1KRH A;  5G55 A;  3RNC C;  2L76 A;  2G1E A;  5AZG A;  3HM3 A;  3IVF A;  2LGS A;  2MBO A;  3L17 A;  2WXP A;  2DYB A;  1CMX B;  2KDM A;  5J2R A;  1SSN A;  3NZS A;  1KJT A;  1YN5 A;  5BO4 B;  3EFU A;  3VUY A;  3Q8E A;  1EF5 A;  1JW9 D;  1VZ6 A;  3MHS D;  2BB6 A;  4HLE A;  2DHZ A;  3UI3 A;  1N63 A;  4E71 A;  4GOC A;  1C77 A;  2OOB B;  1E6E B;  2L05 A;  3HIZ A;  4I6P A;  2J42 A;  4P1C C;  2J0K A;  4EZJ A;  3L0W B;  4MEM A;  3AB5 A;  2C60 A;  4XZ4 A;  2HD5 B;  2KJH B;  2JYE A;  2XEW A;  1DOI A;  1S1Q B;  3K9O B;  4QAY A;  3R3M A;  4EFO A;  4HK2 A;  3RD2 A;  2BTE A;  1N5X A;  4OZA A;  4GLS C;  3TEZ A;  4L23 A;  2DLB A;  5MPO A;  4ZRI A;  2FBW B;  4ACF A;  3DBR B;  3RZF A;  2MX2 A;  2LRW A;  2JF5 A;  2PIA A;  2K0P A;  2W55 A;  4DXA B;  2KMM A;  4EEW A;  1BML C;  3TBL D;  3B1L X;  2OJW A;  1C1Y B;  1I4R A;  2QC8 A;  4W9K A;  2RSU A;  1H4R A;  2IJ0 A;  3ZXV A;  1J7B A;  2WXG A;  4RGO S;  1C76 A;  1Z5S B;  2BW2 A;  1J19 A;  4JLC A;  2UYZ B;  2WX1 A;  2MSE D;  3LXF A;  4KGR A;  4DDG D;  3DHI C;  4C56 C;  2ACZ B;  1MHH E;  4XDC A;  2R61 A;  3FKY A;  1T0Y A;  3VAW A;  3CST A;  1SE9 A;  1SF0 A;  3OWE B;  2IYD B;  2ICI A;  4B9K A;  1D6E C;  2WP9 B;  2ZJD A;  1WJ4 A;  4WUR A;  1XLO A;  2DWQ A;  1OEY J;  2N7E A;  4DK5 A;  4KKJ A;  2K1F A;  2WXJ A;  4R3D A;  5DPS A;  4ARC A;  4YSY B;  3M62 B;  4KSK C;  2PVG C;  4LNI A;  4BBN C;  2IZV B;  4AJW A;  1VLB A;  4YTP B;  1K53 A;  3ZDM C;  1F2R C;  3AEF B;  1VZ8 A;  3ML8 A;  3R66 C;  1UH6 A;  2M56 B;  1Q5W B;  4WH4 A;  2W3R A;  1YN4 A;  3DBR I;  2INN E;  3QIJ A;  2BYV E;  4C4V A;  1QKZ A;  1C4C A;  2JU6 X;  4S17 A;  3V6E B;  2K3U A;  3J9C A;  2AQ3 B;  4IWP A;  3KUZ A;  4RF0 A;  2MBE A;  1ZOY B;  2V3N A;  2LUM A;  2GRI A;  3CIR B;  4KZC A;  1E8Z A;  1ZKH A;  4AS1 A;  2RMM A;  3DBL B;  1JWB D;  4LJP B;  1AYF A;  1TTN A;  4BZA A;  3WAL A;  2V4I B;  1FRD A;  5LLI A;  1L6V A;  3SHQ A;  1VJK A;  3RZW C;  2DBY A;  1ZXH A;  4N58 A;  3M3J A;  4NNJ B;  2K6Q A;  2KKC A;  4IKG A;  2WDQ B;  2KWC A;  1GPX A;  1DOY A;  2IGH A;  4GIV A;  3EC8 A;  2G45 B;  3QK0 A;  3TCA A;  2KTF A;  3NRZ A;  2SAK A;  4O1N A;  2CU3 A;  2O6V A;  1TS5 A;  3UIN B;  1FXA A;  4I6L B;  1SIF A;  4NJ6 A;  3N3K B;  2PE6 B;  1MG8 A; 
#chains in the Genus database with same CATH homology
 1DOX A;  1D5M C;  3WCQ A;  1K51 A;  4LK0 M;  4YWG G;  1FMA D;  1HXY D;  2E6X A;  3HUI A;  4C7Z A;  2J52 A;  2V0G A;  1C79 A;  4B0E A;  5H8Y E;  1D5Z C;  2WQY B;  1I4G A;  1R7S A;  1ZXI A;  1MI0 A;  1YN3 A;  1ZUD 2;  2JWU A;  2IPK D;  1TS2 A;  2VZK D;  3E56 A;  3URY A;  3B2G A;  1N62 A;  1ROE A;  3AE6 B;  3BVG A;  5TSS A;  5JXV A;  3AV8 A;  4HJG E;  1TY2 A;  2PW9 A;  3IAS 1;  1I4Q A;  2AQ2 B;  4XE0 A;  4WQM A;  4MM3 B;  1RM6 C;  1F2R I;  1CJE A;  1XF5 L;  2WXM A;  3P4S B;  5T8I A;  4WWM A;  4P6V F;  4RGT A;  2JQR B;  2PVO D;  3RFZ B;  2I38 A;  2LFI A;  3FIL B;  1VRA B;  5HI1 A;  5BMI A;  3AEG B;  3PZ7 A;  1SE2 A;  1K50 A;  1FNV A;  3U52 E;  3NVW A;  4USA A;  1P7F A;  1M4V A;  1PUT A;  3BII D;  3P4Q B;  2HDE A;  3SFD B;  3U7Z A;  3AE9 B;  1C78 A;  4US9 A;  2LHE A;  5D7G A;  3AMZ A;  4KX6 B;  3KQ4 A;  1FNW A;  4DQO C;  4Q2J A;  2YEP B;  3HVZ A;  1RYJ A;  1ENF A;  4P16 A;  3R2I A;  2WDR B;  2L32 A;  1L0Y B;  4AQ7 A;  2LHD A;  2FUG 1;  2GI9 A;  2WDV B;  1GB4 A;  1N60 A;  1ACC A;  3ABV B;  4WIP A;  2WXQ A;  1V1P B;  2BYT A;  3EUB 2;  1HZ6 A;  2JZP A;  1NYQ A;  3L4P A;  2KAJ A;  1NEK B;  1J7A A;  1NYR A;  5LNK 1;  2M19 A;  1QT9 A;  3BK2 A;  1CQV A;  1B9R A;  2KN4 A;  1ESF A;  2WXH A;  4H2A A;  4NJC A;  1BXT A;  3DWM A;  1MPE A;  2M0A A;  2IDY A;  2PTL A;  3MP9 A;  2L1A A;  3NZ3 A;  1NVI D;  1ZDV A;  2J53 A;  2ZW0 A;  3BVM A;  1PGA A;  3P42 A;  4KGS A;  4KGT A;  1F0Z A;  3BWU D;  4JPS A;  1XEE A;  1ZPS A;  2IGD A;  1SXT A;  5BMG A;  1JQ4 A;  1T5X D;  3NVV A;  4OVZ A;  2LJI A;  3RPF C;  1GOZ A;  2QJL A;  4XWW A;  1P7E A;  2JYT A;  2HTM E;  3VR9 B;  2K9X A;  1XLQ A;  1L0V B;  5EE9 A;  1VDV A;  1JRP A;  1TKE A;  1VZ7 A;  3PO0 A;  2BT6 A;  5C2T B;  2LGI A;  4A90 A;  1N5W A;  1V1P A;  1JCK B;  3I57 A;  3VQI A;  1VR9 A;  2IGG A;  3Q8F A;  1QOB A;  2D5G A;  2PLP A;  5BMH A;  2WXK A;  5HFY A;  2MJ3 A;  1STE A;  5BYR A;  1E7P B;  4ZYS A;  2BB5 A;  3BYY B;  1TYG B;  1YQ3 B;  2LMC A;  1TS3 A;  3H8H A;  1JWS D;  1UGJ A;  2DYM A;  2Y5P A;  1CK1 A;  2JXT A;  1FO4 A;  1C4P A;  3V05 A;  2MH7 A;  3B2F A;  1E9M A;  1V8C A;  1PYW D;  1RWS A;  1FCC C;  1TKG A;  3AE2 B;  4N6E B;  2KQ4 X;  1EWY C;  1ET9 A;  4M0W A;  3C8Y A;  4L2Y A;  3V3X A;  2N0S B;  2J4X A;  4RF1 A;  1I4P A;  4REZ A;  1D4B A;  1PGX A;  3P1M A;  1Q10 A;  2RPV A;  3U2S C;  4NAM A;  1HQR D;  4DXF A;  4PT5 A;  2PMV A;  2QMT A;  4TQ1 A;  3MHZ A;  3NVY A;  3O13 A;  1E10 A;  2WLB A;  1L4Z B;  4HKZ E;  2K22 A;  1JAL A;  3TSS A;  1IBX A;  1KH0 A;  5FKA C;  2QSD A;  1QOA A;  4ITK A;  5HG2 A;  3MC0 B;  2NMQ A;  2AQ1 B;  4LLG M;  3BK1 A;  4A9A A;  1SIJ A;  4OHJ A;  4RGN A;  5EE3 A;  2ZW1 A;  1QOF A;  5EE1 A;  1HZ5 A;  1KLG D;  1L5P A;  1UWM A;  3MFG A;  3ZQ4 A;  2NTT A;  1FCL A;  2TSS A;  3GS2 A;  5E6J A;  1L4D B;  1AWD A;  1JWU D;  2G9H D;  2MJE A;  1LO5 D;  1OQQ A;  4IDI A;  2I2Y A;  1XO3 A;  2PKO A;  2WXR A;  2QEJ C;  2Y3A A;  3R2T A;  1FEH A;  5D3I B;  1C9F A;  2L83 A;  2Q5W D;  4YT0 B;  2WXI A;  1EWC A;  3NVZ A;  3MJ5 A;  3ETR A;  1WXQ A;  1WSP A;  4OZB A;  1GB1 A;  1KTK A;  1SBB B;  3W2D A;  1SE3 A;  4GDK B;  1JRO A;  4RFB A;  4RGM A;  1B1Z A;  1FXI A;  1T3Q A;  2H88 B;  2E3T A;  3Q8C A;  1IGC A;  2BS3 B;  2N9K A;  3AEB B;  1C4A A;  1MVK A;  2X38 A;  3AEE B;  5D3D A;  1A70 A;  4ZRP A;  2H89 B;  4OW0 A;  3ZJV A;  4CQN A;  1EU3 A;  3AH7 A;  1MHX A;  2K5P A;  1DYQ A;  5GXG B;  3P4R B;  4YTM B;  4JWU C;  1I7H A;  3AE7 B;  4JX1 C;  1V97 A;  1JML A;  3VR8 B;  3TEX A;  1SE4 A;  3Q8A A;  3BZD B;  2WXO A;  1TKY A;  4L1B A;  3FIL A;  4US8 A;  2AX5 A;  1SJE D;  3BYT B;  1KRH A;  1V1O A;  3FC4 A;  3N9Y C;  2WNM A;  2W54 A;  2G1E A;  5AUK A;  2QIL A;  4YTN B;  1ZP0 B;  1PFD A;  4NZL B;  2W82 A;  2B76 B;  2WXP A;  4HKQ A;  3LYY A;  1PDX A;  2KDM A;  3W1S A;  2BS2 B;  1SSN A;  1FD6 A;  1FM0 D;  1SJH D;  3KLS X;  3W9C B;  1YN5 A;  4YSZ B;  2WXN A;  3Q8E A;  2RDG A;  4RCO A;  1JW9 D;  1NI3 A;  1VZ6 A;  3T3O A;  1DGJ A;  2FE8 A;  3AE5 B;  4UDU C;  2BB6 A;  1FIQ A;  3UI3 A;  4D2K A;  1N63 A;  1K52 A;  1XLN A;  2MEK A;  3IXS A;  1C77 A;  2INP E;  1E6E B;  3EA6 A;  3Q69 A;  2N9L A;  1Y56 A;  1XCT L;  1JWM D;  2EKI A;  3IT4 B;  4ZHO A;  4KKI A;  3W5V B;  2DYO A;  2J42 A;  3IAM 1;  4C80 A;  4HEA 1;  1QQR A;  3ZGZ A;  1GAQ B;  3GB1 A;  3AB5 A;  4ARI A;  2WU5 B;  5EE0 A;  5AUI A;  5H92 C;  5G5G A;  1SEB D;  2JYE A;  3CWI A;  3PZ8 A;  1DOI A;  2EEL A;  1E0Z A;  1SB3 C;  2WS3 B;  1N5X A;  2BTE A;  1YMH E;  3AM9 A;  4OZA A;  4GLS C;  3TEZ A;  1QOG A;  5BYQ A;  1EM7 A;  4L23 A;  2DLB A;  5MPO A;  2FBW B;  4B0M A;  4J3O D;  4YXD B;  3HVD A;  2QIE B;  2L52 A;  3I9V 1;  4A55 A;  1NEN B;  4JE3 B;  4HRO A;  1YJI A;  2PIA A;  3W5U B;  4C7Y A;  2K0P A;  2W55 A;  2KMM A;  1BML C;  1OFF A;  5BYS A;  1WYG A;  3AE8 B;  4A8X C;  1I4R A;  1OQR A;  3TEY A;  2CJN A;  3B9J A;  2IJ0 A;  2LEK A;  2WXL A;  1J7B A;  2WXG A;  4RGO S;  3U4E G;  1C76 A;  1EU4 A;  2BW2 A;  3LB8 C;  1QLB B;  1TZO A;  3P4P B;  3LXF A;  4KGR A;  4RNA A;  4C56 C;  4MH8 A;  3KWV A;  3AE1 B;  1I4H A;  2ACZ B;  1MHH E;  1UNS A;  4XDC A;  3EGR A;  2R61 A;  2WU2 B;  3ZJT A;  4TQ0 A;  5G5H A;  1PGB A;  4TSS A;  1I4X A;  1SF0 A;  2BS4 B;  3OWE B;  1FFU A;  2ICI A;  3TUO A;  3T3N A;  2RDH A;  1D6E C;  2WP9 B;  3TEW A;  4WUR A;  3AEA B;  1XLO A;  2DWQ A;  2BBC A;  4KKJ A;  3KWL A;  2WXJ A;  4R3D A;  4OZC A;  4ARC A;  4YSY B;  1FRR A;  5FK9 C;  1L6U A;  1XLP A;  1F77 A;  3P63 A;  2YEP F;  5FR3 A;  2PVG C;  3E9S A;  5C3J B;  1TS4 A;  1T6B X;  3AE4 B;  1YJJ A;  1VLB A;  2JSV X;  4TMA B;  4YTP B;  1K53 A;  1F2R C;  3AEF B;  3GP7 A;  2Y5C A;  1VZ8 A;  2M56 B;  1JWA D;  4A6Q A;  1UWX A;  4WH4 A;  1XCQ L;  1KFY B;  2Z8L A;  2GB1 A;  2W3R A;  2XN9 C;  1YN4 A;  5I4D A;  2KWD A;  2KAC A;  3ZJU A;  2INN E;  2SEB D;  1YQ4 B;  2VZK B;  1D5X C;  4RH6 A;  1QKZ A;  1C4C A;  1CZP A;  2JU6 X;  2NTS A;  2OHF A;  1HA5 A;  2K3U A;  3J9C A;  4GDL B;  1FNU A;  2AQ3 B;  4MAC A;  4RF0 A;  1ZOY B;  1AW7 A;  2LUM A;  2V3N A;  3NS1 A;  3AEC B;  2GRI A;  3CIR B;  3DWG C;  1ET6 A;  4IOI E;  1IUE A;  1IGD A;  4MT5 A;  2N7J A;  3NUH B;  4XWT A;  4AS1 A;  2RMM A;  3HRD D;  5HHD G;  1WWT A;  1FFV A;  1JWB D;  1KLU D;  4EE2 A;  3BVZ A;  4DXG A;  4YSX B;  1ZE3 D;  2MJD A;  1AYF A;  3FAH A;  4JWS C;  1L0X B;  2V3P A;  2V4I B;  1FRD A;  1L6V A;  2W3S A;  1VJK A;  3SFE B;  1QF6 A;  2DBY A;  2OED A;  2JX5 A;  1BUI C;  1QIL A;  3AN1 A;  1ZXH A;  4HRS A;  3VRB B;  1ZDX A;  1YNT E;  1N61 A;  4N58 A;  2WXF A;  4LTU A;  4XDD A;  1WRI A;  1J7C A;  2XNA C;  1RFK A;  4IKG A;  4FXC A;  3VRA B;  3IT6 B;  2WDQ B;  3ZYY X;  4ZOH C;  3AE3 B;  1IBX B;  4ZHP A;  1GPX A;  1DOY A;  2IGH A;  3Q8B A;  3R8B A;  3SR6 A;  1TY0 A;  1AN8 A;  2ON8 A;  3NRZ A;  2SAK A;  4N59 A;  4NAW B;  2ONQ A;  4O1N A;  4WAF A;  1UUP A;  3AED B;  2CU3 A;  2CJO A;  1TS5 A;  4ZRQ A;  1FXA A;  1XXG A;  1WGK A;  1TJE A;  1KF6 B;  3SEB A;  1HEZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...