2QSDA

Crystal structure of a protein il1583 from idiomarina loihiensis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
146
Chain Sequence
DNKLFLVYVGGTAPGANIELHDIRFVVGPSMEETYPAIRKGWFGTQKGLHLDSFVHLHHVDGYRIHLTSEAPEEKRLYFVNFGEYHDFTVVVADSPQSAKQLARAQFSVDDCLCVDLVDNHYVTLEFDGEQQPLVPDWKGYQPLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized conserved protein
publication title Crystal Structure of a Protein Il1583 from Idiomarina loihiensis.
rcsb
source organism Idiomarina loihiensis
molecule tags Structural genomics, unknown function
total genus 29
structure length 146
sequence length 174
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07566 DUF1543 Domain of Unknown Function (DUF1543)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qsdA01
3.50.100.10 Alpha Beta 3-Layer(bba) Sandwich protein il1583 fold protein il1583 domain 2qsdA02
1Q10A 1HZ6A 5HHDG 2ZW0A 3FILA 1MVKA 1P7EA 1QKZA 4KGRA 1IGDA 1IBXB 1F2RC 2GB1A 3V3XA 2I2YA 1XCQL 2KWDA 4IKGA 1UWXA 1MHHE 1K50A 4OZBA 2LUMA 1PGXA 1MHXA 2N9KA 4OZAA 4D2KA 1IGCA 3GB1A 1K51A 2LHEA 4KGSA 1MPEA 1KH0A 2RPVA 2RMMA 5HG2A 1XF5L 4HKZE 2N9LA 5BMHA 2J52A 1K52A 1PGAA 4GLSC 2NMQA 2I38A 4MACA 1IBXA 4WH4A 2JSVX 2QMTA 2PLPA 3MP9A 5HI1A 4IOIE 2JZPA 2IGGA 1HEZE 1PGBA 1P7FA 1YNTE 2KN4A 2IGHA 1JMLA 2JWUA 2LGIA 4OZCA 5BMGA 2KQ4X 4HJGE 2N7JA 2ZW1A 1F2RI 3FILB 1ZXHA 2OEDA 2KDMA 1GB4A 1D4BA 2PTLA 1EM7A 2PW9A 1GB1A 1FCCC 2EELA 2J53A 5BMIA 1FCLA 2ONQA 4KGTA 2ON8A 2QSDA 1C9FA 1K53A 2JU6X 2JXTA 2K0PA 5JXVA 5HFYA 3UI3A 2LHDA 1XCTL 1MI0A 1HZ5A 2IGDA 2KACA 1FD6A 1YMHE 2GI9A
chains in the Genus database with same CATH superfamily
3ZTCA 3TUOA 3IHPC 2WDQB 3AN1A 1YX5B 2OOBB 4HDOA 2LXCA 3SFEB 1IGDA 1TS5A 1IBXB 5AUKA 1L2NA 3QAQA 1WRDB 3P42A 2K8CA 2ZPNA 3PSEB 1VLBA 2HD5B 1ZGUB 4ZHPA 3UF8A 1WH3A 2PIAA 1FPYA 4MELA 1SSNA 2UWQA 5TSSA 2HJ1A 2R2QA 1QILA 2DHZA 3DWMA 4GDLA 4FJZA 2MLBA 4W9KA 2MP2A 1YQBA 2L0FA 1WGHA 3U7DA 1V8CA 1XEEA 2YLMA 2MSED 4J3OD 1IP9A 2PLPA 2AEHA 5E6NA 2MBBB 1OQRA 2JZPA 3BK1A 1F9JA 2NBUA 2RDHA 2CS4A 4NNJB 1V9JA 2CHXA 4EKUA 2IYDB 1WM2A 4MGYE 4YTNB 3RUIB 4M02A 2DENB 2MBEA 4K7SA 5E6JA 3EECA 4I6PA 1GPXA 2ASQA 2ON8A 3T9LA 2LVOA 1T0SC 1PFDA 2FCSA 3AE1B 3ZQ4A 4LDTD 2J7QB 1JROA 4EZJA 2TSSA 4P1CC 2IGDA 3W1YA 1WI0A 1ET6A 3ALBA 3W5VB 3O13A 3P4RB 4GDLB 3EUB2 1CK1A 5IAAC 2I1KA 1ZE3D 1B9RA 1EUVB 2N4FA 2MP2B 1RWSA 4MEMA 3TL5A 1TZ1A 3BY4B 1OEYA 2BTEA 2NPTA 4WAFA 2K3UA 4PK1A 1WJ4A 3V3XA 5E6OA 2K25A 1J7AA 2KZRA 1HQRD 2HE7A 1DYQA 1XCQL 1WGYA 1WE7A 1KLUD 4KZCA 2PPHA 2LXAA 2KDIA 4NZLB 1SIJA 3K9PB 2IJ0A 2BYEA 1MPEA 2QIEB 3GE8C 1LFDA 3DPDA 4HKZE 3OJ3A 4A90A 1XT9B 2ZNVC 2BYTA 3SDLC 3BYYB 3R2IA 2KJRA 3ABVB 3P63A 4LNNA 1QLBB 2WXLA 3L10B 2LUEA 3C0RB 1DOYA 3VTWA 3V6EB 2Y3AA 4ZRIA 2IBIB 1ENFA 1ZXIA 3A1QA 3WIMA 3U4EG 1VJKA 3Q69A 2M0XA 3R7QA 1XXGA 2IO1B 2WXGA 2NPTB 2KTRA 3QQ8B 3TEZA 2DAFA 2AWTA 1D5XC 3APFA 2G1EA 5BMIA 3P4SB 4WAAA 1NYRA 4S0RA 1QQRA 4LK0M 4HROA 3ZO5B 1E8ZA 1LO5D 1I7HA 2GRIA 4CQNA 4HVBA 1FNWA 1I4XA 3Q8AA 1WJNA 4GLSC 2GI9A 3MJ5A 2KQ7A 1WXSA 5HHDG 2GBKA 1S3SG 3JVZX 3T3OA 3ZJUA 4WWPA 2KAJA 4BVUC 1MVKA 3NHEB 2BT6A 4KGRA 2KC2A 4A9AA 3L16A 3AEGB 3T3NA 3VVWB 1WE6A 4IW0A 4ZRJA 3HRDD 1XLOA 1QF6A 3IAS1 3KWLA 1ZW7A 4ZYSA 2K39A 4LDTB 3WAMA 3A1QB 4S17A 4TMAB 1V5OA 2FNJB 2MW5A 1WY8A 4M8NA 1FXAA 3U52E 4BBNF 2KTRB 4BKGA 2LGYA 2Z8LA 3B2GA 3AULA 2RSUA 2BB5A 3GS2A 4B6WA 2G3QB 4ICVA 2CKHB 2LMCA 1UNSA 1ZDVA 2LD9A 2MJ3A 2RPQA 5IO9A 4JIOU 3I57A 4RM9A 1P7FA 1YNTE 2KN4A 1XLPA 5JZEB 2J0KA 3QARA 2J0MA 2LZ6A 1FMAD 3NZSA 1WZ3A 3JSVA 2B76B 2WNMA 2WYQA 2OEDA 3R3MA 4JLCA 1I35A 4XWWA 2DYBA 2LVPA 2MCNB 4HDQA 2R2OA 2RGFA 3C8YA 4XX5A 3AE6B 3H9DA 3RD2A 3ZTDA 5JH5C 2MJEA 2N7EA 4TQ0A 3L17A 1LGRA 4WWMA 1T5XD 4DHZB 2WDRB 2LJ5A 4WJNA 3LYYA 3DVNV 4QAYA 4PS7A 5DCNA 1TS2A 4E3CA 1P3QU 2J0JA 4PS8A 4TV3A 4BOZB 1JWAD 3DBSA 3VH4B 2FCMA 4DQOC 1RLFA 2LGDA 2BW2A 4DHJD 4M00A 2BVCA 3IG3A 3NZ3A 3JSVB 2FAZA 2O6VB 4JL9A 2N9KA 3CSFA 4NJ6A 3X23A 4GMVA 1ZOYB 4A3PA 3U8ZA 1WJUA 1JWUD 1XF5L 3AE7B 1SB3C 4C56C 5CHVC 2BYVE 1QT9A 2XBBC 2W82A 3RZWC 3ETRA 2LJIA 3MFGA 4N6EB 4K81A 3MP9A 5EE3A 2MEKA 1Q5WB 3IFWB 2JXXA 2IGHA 4JX1C 4AP4C 2DZJA 3ZW3A 4C7YA 2QCZA 2R61A 3QX1A 2NBVB 2RDBC 3A4SC 3HM6X 3R7RA 1JALA 4KDIC 1HE8A 2PW9A 3IT4B 4NQKE 2WP9B 3R8BA 4K1RB 5JHAA 3PGEA 3KVFB 4ARIA 4B9KA 3KWVA 3P2BA 1XCTL 5D7GA 2WLBA 4REZA 3NUHB 2MA9B 1F52A 2JZ3B 1HTQA 4LNFA 4F7ZA 2JRHA 2AQ3B 3MC8A 1E90A 1V1PA 3N1XC 1L0VB 2MRPA 2I2YA 3RULA 1UBQA 4TQ1A 2N9PC 3V05A 3ZXVA 2M1MA 2LEKA 3KH0A 3IT6B 2BS4B 2K1FA 3IVFA 4GGQA 1SE3A 5HKHA 1YD8U 3HK0A 1E10A 1PYWD 3RCZA 1TY0A 2JQRB 1KLVA 2N9XA 1EU3A 2KXJA 3EC8A 1STEA 3PZ7A 4WWNA 2KLGA 3KYCD 1ET9A 1UZXB 2KKCA 1WR6E 3TSSA 4DBGA 1PDXA 4WH4A 3L54A 2AYOB 1VZ8A 5HI1A 3AB5A 3ZLZA 1ACCA 1KJTA 1MJDA 2Y5CA 3RI7C 4XZ4A 2GMIC 3A33B 5IP4D 2ZW1A 2KOXA 1FNUA 2KDMA 3NZUA 4AUQC 1QOAA 2IZVB 4BBNC 1CZPA 3N20C 1V1PB 4EFOA 1V1OA 4HEA1 1VRAB 1P1AA 2L00B 1FCLA 2KJ6A 2KD0A 4W9FA 1C4CA 2ZVOA 2WXMA 2WXOA 4LNOA 3TIXA 1HZ5A 2W9NA 3Q8CA 2KACA 1RFAA 1YJIA 1GUAB 2J4XA 2GBJA 2MBOA 1WRIA 5CHFA 4XE0A 3ZNID 1LXDA 2WHIA 2CR5A 4IWOA 3GP7A 4RH6A 2JZZA 2BS2B 2RD0A 1ZPSA 3PHXB 1WXVA 4MSQB 3ZNGC 2NVUI 3UQBA 1WXMA 2LGXA 3ZVVA 2V3NA 3SR6A 2DYOA 3PZ8A 5DPWA 2REXA 5C23A 4ZRQA 3W1SC 1E8YA 3BYTB 1EF1A 3CF6E 1K51A 4IC7B 4Q2JA 1GJZA 5G2NA 5IKCM 2HDEA 1P98A 2L1AA 4HWIB 3M62B 2D3GA 1J8CA 4G3XB 1L4ZB 3DCGA 1EWCA 4RCOA 1Q1OA 1V49A 1PGAA 2CHWA 2WDTB 3UIPB 2MHJA 5G5GA 3AV8A 1DGJA 1WJ6A 1VCBA 4W9LA 2Y5BB 4L2YA 2XK5A 4UDUC 2Z59B 1OQYA 2BKFA 5D6JB 3DQVA 3VUYA 2N7JA 1F2RI 2JF5A 1OEYJ 2VZKD 2FCQA 3A9KA 2IO2B 1CQVA 2WU2B 3AEDB 4RMAA 1NYQA 3WAPA 4C7ZA 2KN5A 1P0RA 1PQSA 5KHOA 3URYA 4IWPA 4KGTA 5D2MB 5IOIA 1WGRA 4G50A 4LLGM 1GG3A 2BF8B 4ZOHC 3OWEB 2KNBA 1FD6A 4GOCA 4ANWA 5LNK1 1YQ3B 2MBQA 4GB9A 3IXSA 2KDEB 4B95A 1KF6B 2K6DB 3NJTA 1WF9A 1TS4A 4PS3A 1SJHD 2WGSA 3SEBA 3U7ZA 2W3RA 2XK5B 3MC9A 1WGDA 3BVMA 3DHIC 4OZBA 3MJWA 4YSYB 2KDFB 4KSLC 2KFJA 2BWES 1IGCA 2KWUB 3A9KB 3RFZB 1TKGA 4L1BA 1JWSD 3AECB 5C2TB 4K7WA 1DOXA 4A20A 1N61A 2YEPB 3DBRB 4FXCA 2FUG1 1M4VA 2KMAA 2LGSA 3ZRCA 5BMHA 3NVVA 1Z5SB 3ML8A 1A5RA 1JCKB 5E6PA 3EFUA 2ZEQA 4FHKA 1NEKB 4AWJA 5LXHA 4BKSA 3AXCA 1UBIA 3VR9B 5G55A 2QJLA 1JMLA 5D94A 3BVZA 3HUIA 1D4BA 2O2VA 2INDC 2KDBA 4RF0A 3L0WB 2EELA 2J53A 3EFCA 4BAXA 3TJPA 2BKRB 2WXPA 1FO4A 2J42A 2V1YA 3OLMD 2D10A 2JXTA 1V2YA 1OTRB 5EE9A 3CMMB 1ROEA 3L4PA 5AZGA 1WGGA 1RRBA 2PEAA 1QOFA 2C9WB 1RFKA 3RN9C 5AEKB 2AQ2B 1Q10A 4DDID 2VZKB 2E6XA 2ZW0A 1P7EA 2CHZA 4BKTA 3LDZE 1WWTA 2CU3A 3IBEA 1BMLC 4JE3B 2O6VD 3VUXA 4P1BC 1GNUA 3PLVA 4ANXA 1N62A 4HJKA 4OHJA 3B2FA 1L0YB 2KVZA 2AQ1B 3RNCC 1WFYA 2FBWB 2L3ZA 4A55A 4NAWA 4XWTA 2G4SA 2INPE 4DXAB 2O2VB 4EOYA 4YXDB 2KMMA 2AX5A 2WS3B 4IDIA 2N0SB 2NBWB 1SF0A 4XC2A 1K52A 3A9JA 5GXGB 3CWIA 4AQ7A 1E5WA 3DHHC 1WX9A 1T0YA 2QMTA 2WXKA 2KLCA 3FAHA 2A4ZA 1SJED 4IOIE 1WR1A 4W9CA 5C1ZA 4IM3A 2K9XA 1C79A 1E7PB 3PVLA 2FIDA 4XDCA 3I5JC 2D07B 5DPTA 4FJYA 3DOWA 4K3CA 1M94A 4OVVA 1EM7A 4FADA 2EMTA 5H8YE 1I4GA 3Q6BA 3PRZA 1FRDA 4W9DA 1WYGA 2JUOA 1N6ZA 3B9JA 2WXHA 1RAXA 4USAA 2D3CA 3W9CB 3NG0A 4RF1A 3NRZA 4RGOS 4NAWB 1FEHA 4ARCA 3AE3B 2LVQA 1NDDA 2C7MB 2O6VA 3DBHB 1TBEA 1TT5B 1FRRA 4C00A 2C7NB 1UF0A 3QWZB 4ZYNA 3RNBC 1HZ6A 3RNEC 4WIPA 3V60A 4DDGD 3A9JB 3WANA 4B0MA 1UGJA 1QKZA 4C80A 1H4RA 2INCC 3BINA 3P4QB 4MJSA 4P7IA 2L05A 2WX0A 1R4MB 1V81A 4N59A 1ISNA 3Q8BA 4EZLA 1WIAA 1YN3A 2LUMA 3J9CA 3VDZA 2LI5A 4KKJA 2HTME 3ZRFA 4G11A 3ZDMC 2LHEA 1J0GA 3PLUA 2IO0B 2Y5PA 3NVYA 2W55A 5HG2A 5TR5A 3EHVA 3VUWA 2N9LA 4J6IA 4NY0A 2V3PA 3S2AA 2AL3A 2NTTA 2WQYB 2GBNA 1TKYA 4KIKA 4KX6B 4NAMA 1JRPA 2WXIA 3ZIMA 2ACZB 1KFYB 3RT3B 1T0QC 1TGZB 4G0NB 3JYUA 4YWGG 3VFKA 3HHMA 2BGFA 4HJGE 4AS1A 2E3TA 3AEFB 1I42A 2AL6A 4WWOA 4CO7A 3APDA 3GZNB 3Q3FA 3AEEB 4WJOA 4MJSB 3APCA 3V61A 4FN2A 1SE9A 2G4DB 2QSDA 4RM8A 1U4AA 1C78A 4IWQA 2QEJC 3AH7A 1L6UA 2KTFA 3WCQA 1J7CA 3N1ZC 1AW7A 3ZJTA 3VTVA 2LFIA 2JT4B 5EE1A 3MC0B 3U2SC 4IG7B 1D5MC 2DWQA 3AE2B 1C3TA 1F2RC 3UIOB 2D3BA 1F77A 5FKAC 4HLEA 3P4PB 4KIKB 4MGZE 3AE8B 2WXRA 2KO3A 1QOGA 2FIFA 1K50A 1I4HA 1KRHA 4LNIA 3MHSD 4HPPA 4KGSA 3OJ4B 2N9EB 4LCDE 3PO0A 2RMMA 2M17A 4URKA 3VQIA 1P9DU 5J2RA 1Y8RC 4YSZB 3B08A 4MACA 2RDGA 2CU1A 3R66C 2XN9C 2SEBD 4XDDA 4HCPB 1ZKHA 1PGBA 4MH8A 4EE2A 5DPRA 1FM0D 4JWUC 3QK0A 4F8CB 3SFDB 3VXWA 1I4RA 3QA8A 2M0AA 4DHZE 1SE2A 4PT5A 3PS6A 2CJOA 4TKNA 1GB1A 1V5TA 3PT2B 3KYDD 5I4DA 1YIWA 5AZHA 3VTUA 4OVZA 1WMHA 2WXJA 2C7HA 1R4NB 4W9GA 1B1ZA 4B0EA 4AOFA 4ANUA 4DXGA 3ENEA 4RFBA 1JW9D 2HJ8A 5J18A 1YN5A 1E7VA 4MH0E 4MM3A 4W9HA 1BXTA 4F1SA 3NS1A 1S1QB 2C60A 3WALA 1Y56A 3BWUD 3FC4A 4YTPB 3DBRI 2GB1A 2JVCA 1SBBB 4I6NB 4IUMB 2UYZB 1QOBA 2V4LA 1RYJA 4WJQA 4EUTA 2D11A 4IKGA 1MHHE 2H89B 4YTMB 2PE6B 4ACFA 2JYEA 3JW0X 1NI3A 2A5UA 1WXQA 3TEYA 4OVUA 3RNGC 3CSTA 3HVDA 4DXFA 3I9V1 3PZDA 2JPHA 4JPSA 4E71A 2BWFA 4HRSA 2OHFA 1WMHB 5KHQA 1NVID 1X1MA 2W3SA 5EDSA 1L7YA 1Q0WB 3RMKC 2KC1A 4US9A 1C76A 2QC8A 1IYFA 3DDCB 1FNVA 3ML9A 5G5HA 3D32A 4NJCA 3AEBB 4W9EA 1H8CA 3WA0A 4MDKE 2M8SA 3A4RA 4MM3B 1AARA 2GOWA 2KX0A 2GBMA 2ZCCA 1GOZA 1WM3A 3PTFC 1JWMD 1UGMA 3O65B 1D3ZA 3VAWA 1OQQA 2BBCA 2BPSA 2NCNA 3UQAA 2V0GA 4K3BA 2PTLA 2L0TA 4K7UA 4E74A 2GBRA 1FCCC 1N5XA 2DX5B 1MG8A 1C1YB 1K53A 2KWCA 1ZUD2 4BOSC 2CJNA 2ZJDA 5D3IB 4HPMB 4BFRA 1L4DB 4LJOB 2LWPA 4FJVB 3DBLB 2K8BA 2GLSA 5MPOA 4P6VF 2VRRB 1VZ6A 3ZGZA 4O1NA 3ZYYX 2VH1A 5H92C 2LRWA 4BKSD 3VRBB 4ZDVA 1UELA 4L23A 3E56A 4R3DA 4LTUA 5GMVA 2L32A 2DZIA 4KDLB 1TJEA 2YEPF 3Q3OC 1HTOA 1T0RC 1JQ4A 3KUZA 3NY5A 1MHXA 2IY1B 2H88B 2KHWB 5AUIA 4RGMA 1C77A 3TEXA 2DNFA 5DPSA 3M95A 2RPVA 3NVWA 1R7SA 4X57B 2KYWA 3ZJVA 5JHBA 3R2TA 2KX3A 2NMQA 1FFUA 4CHKA 3RNAC 2DZMA 3DVGX 3H8HA 2K5PA 3AE5B 4HPLB 3I63C 2WX1A 5BYQA 2D3AA 4GXBA 4GDKA 1TS3A 1Z2MA 2X38A 1RM6C 1KLGD 1EWYC 5BMGA 2WXQA 2MWSB 2JWZA 3E9SA 3W2DA 3KW5B 3DBHI 1TZOA 2EKEC 2MQJA 5BYRA 1FIQA 1NI2A 1TIFA 2K6QA 2IO3B 4PYZA 4US8A 2FE8A 3N30A 1E6EB 2K0PA 1N60A 2W54A 5JXVA 3M63B 4C4VA 2LHDA 2OJWA 5FR3A 1R4MI 2JY6A 2WWZA 1PUTA 2OJRA 1XQQA 2NR2A 3P1MA 3VH3B 4OW0A 1L6VA 4A6QA 2M4NA 2BB6A 3PRPB 2EMSA 3EA6A 2WDVB 3VHTC 4LJPB 2MJDA 3ZNHB 1UWMA 1WZ0A 4GDKB 2WXFA 1BUIC 1UUPA 1J19A 4JWSC 1ZP0B 1UWXA 4M01A 1F0ZA 2KJHB 3T8MA 2KQSA 4OZAA 2VH2A 5CHWA 4FLHA 1XLNA 5EE0A 1G6JA 3BIID 1I4QA 3X0WA 1V6EA 1FXIA 2SAKA 2XNAC 1FXTB 1AN8A 4CYEA 3WAOA 2J52A 3GZNI 2ZCBA 2MH7A 2I38A 4C4VB 4DWFA 1V80A 1OFFA 3SD5A 1YN4A 1AYFA 1XO3A 2DLBA 3PV1A 4WQOB 1DOIA 1HEZE 1YQ4B 2HTHA 1EF5A 2X8XX 1F1HA 1TY2A 2LGIA 4WJPA 1V97A 2KQ4X 2ZZPB 1YJJA 1D5ZC 2IPKD 4ZRKA 1SEBD 3ZUNA 1KOTA 5CTRC 2L7RA 3AU5A 5IN7A 3HIZA 4FHJA 2KT7A 4WQMA 1L5PA 1TKEA 2PJHA 2BQQA 1JWBD 3FKYA 2N1VA 1GAQB 2PE9A 4HK2A 1YMHE 1NENB 4GSWA 4P16A 5LLIA 1E8WA 4ANVA 3FILA 2KMCA 2QILA 2V9HA 1HXYD 3ZXRA 2PMVA 4MT5A 2V4IB 1BT0A 3M3JA 2KWDA 4W9JA 3RZFA 3KQ4A 2JX5A 3PRMB 2PVOD 1T6BX 4W9IA 4D2KA 4FA6A 2V3SA 4EZKA 2MBHA 4TUUA 2KVRA 1N5WA 3H7SA 1FFVA 2G9HD 4IM2A 2Q5WD 1D6EC 3DVNU 2D2QA 2I1JA 2JRIB 4HCNB 2XEWA 3W1SA 4XYCA 1R4NI 1WX7A 2IGGA 4A8XC 2DYMA 4RGNA 3KUDB 2L8JA 1CMXB 2JWUA 3MHZA 2NS5A 1A70A 2M56B 1WSPA 4II3B 3GE3C 1KM7A 4NQLB 2BYFA 3FILB 1ZXHA 3ONSA 4JGHB 5CX3A 1T3QA 4FULA 3N9YC 4DK5A 3BZDB 1NBFC 1VR9A 1WYWB 5D3DA 1WGKA 1CJEA 4ZRPA 4HXDA 3GOEA 1C9FA 1SIFA 3AMZA 3EGRA 4FBJB 1KTKA 2L76A 3RPFC 3SHQA 1MI0A 2FUHB 1YJ1A 1I4PA 2NTSA 1XLQA 1E8XA 1SE4A 5L83A 3V62A 3AM9A 3KLSX 1WXAA 3ECIA 4IM0A 3SU8X 3K9OB 4PYUA 3AU4A 1C4AA 3UGBB 5LXIB 4GU2A 4KSKC 3PPAA 1K8RB 3TCAA 3I3TB 2D5GA 1UD7A 3UINB 3Q2AC 3N32A 4M8MA 2KK8A 2M19A 3KUCB 4RNAA 3LXFA 3QCAA 3LJ3A 3RYTA 4KKIA 3VRAB 3NVZA 4MGIE 1C4PA 3BVGA 2PKOA 1KH0A 1WX8A 4KV2A 1TTNA 2INNE 3OG5A 1YOVB 1ESFA 3MTNB 5FK9C 4GIVA 3ZDTA 3L13A 4AJYB 3HM3A 2KFKA 3NOBA 4BZAA 1N63A 2JSVX 3AI5A 2QHOA 4KVGB 3H1UA 1UH6A 4YL8A 3PHWB 1ZDXA 2N1WA 2L52A 3L08A 3Q8FA 2RR9A 2K22A 2DBYA 3H6NA 3C19A 1TYGB 1YX6B 2KANA 3DBLI 2JYTA 4A3OA 2MX2A 4ZHOA 1GC7A 1IPGA 3Q3NC 1OGWA 1QZEA 3TMPB 3Q8EA 3QC8B 3AE9B 3RNFC 2N7DA 1EU4A 4I6LB 2UU7A 3UI3A 2IY0B 4NJ7A 2ZVNA 2QDFA 2ZPYA 2YVCA 1MFWA 3PREA 2K8HA 4AJWA 3OAWA 2WU5B 1E7UA 3B0AA 3AE4B 1V86A 2KFKB 4RGTA 1GC6A 1SXTA 4KZ0A 1VD2A 1E0ZA 2BS3B 2FCNA 4ICUA 1SGHA 2WXNA 3TEWA 4MSMB 3V6CB 1AWDA 3H7PA 3Q3JA 4WURA 3ZKJC 1E9MA 3BK2A 1HA5A 3HVZA 2PVGC 5C3JB 4JQWC 1PGXA 3QIJA 2Z0EB 4DHJB 3IAM1 3ZNZB 3DHGC 1J7BA 1VDVA 2C5LC 3LB8C 3GB1A 3N3KB 5J17A 1MG4A 4EEWA 2ICIA 4M0WA 5BYSA 3QJZA 3TBLD 3Q14C 2Z0DB 2L83A 3DVGY 2B3AA 5L95C 4HKQA 1VZ7A 1XD3B 2DZKA 2KWVB 1IBXA 1JRUA 4N58A 2ZNVB 2IDYA 2DAJA 1IUEA 3W5UB 3AEAB 4TSSA 2LRUA 4OZCA 1LQBA 5FR6A 3CIRB 1L0XB 4ITKA 4YT0B 1LM8B 4MGKE 1GB4A 5IA7A 3B1LX 4NPNA 4N9F4 4XGAB 5BO4B 3H7PB 2ONQA 2LASA 3Q3MC 4ASWC 1EO6A 5T8IA 2EKIA 3QHTA 3VR8B 4GN1A 2JU6X 4LNKA 5HFYA 4II2B 2G45B 4H2AA 5AZFA 4YSXB 3NS8A 3DWGC 4M0WB 3N1YC 3U30A
chains in the Genus database with same CATH topology
4OW0A 1FRRA 2WLBA 3TUOA 1L6VA 4A6QA 4REZA 1HZ6A 3NUHB 4WIPA 2WDQB 3AN1A 4B0MA 2BB6A 1UGJA 2AQ3B 1QKZA 3EA6A 2WDVB 3SFEB 1IGDA 1TS5A 1IBXB 4C80A 1V1PA 5AUKA 2MJDA 3P42A 1L0VB 3P4QB 1UWMA 4GDKB 2I2YA 2WXFA 4N59A 1BUIC 3Q8BA 1UUPA 4TQ1A 3V05A 1VLBA 4JWSC 1ZP0B 1UWXA 1YN3A 2LEKA 2LUMA 3J9CA 4ZHPA 3IT6B 2BS4B 1F0ZA 2PIAA 4KKJA 2HTME 4OZAA 1SE3A 1SSNA 1XLNA 5EE0A 5TSSA 2LHEA 3BIID 1I4QA 1QILA 2Y5PA 3DWMA 3NVYA 1FXIA 2SAKA 2W55A 1PYWD 1E10A 2XNAC 1TY0A 1AN8A 3DWGC 5HG2A 2N9LA 1EU3A 2J52A 1STEA 3PZ7A 2V3PA 1ET9A 2MH7A 1V8CA 2I38A 1XEEA 3TSSA 1PDXA 4WH4A 2NTTA 4J3OD 1OFFA 2PLPA 1VZ8A 2WQYB 1OQRA 1YN4A 1AYFA 5HI1A 1XO3A 1TKYA 2DLBA 2JZPA 1DOIA 3BK1A 1HEZE 1YQ4B 1ACCA 1JRPA 3AB5A 2WXIA 4KX6B 2Y5CA 4NAMA 2RDHA 2ACZB 1TY2A 1KFYB 2LGIA 1V97A 4YTNB 4YWGG 2KQ4X 4HJGE 2ZW1A 4AS1A 2E3TA 3AEFB 1FNUA 2KDMA 1QOAA 1YJJA 1CZPA 5E6JA 1V1PB 1D5ZC 3AEEB 1V1OA 2IPKD 4HEA1 1SEBD 1VRAB 1FCLA 1GPXA 2ON8A 2QSDA 4WQMA 1L5PA 1TKEA 1PFDA 3AE1B 1C78A 1C4CA 3ZQ4A 1JROA 2WXMA 2TSSA 2WXOA 1JWBD 1HZ5A 2IGDA 2QEJC 3AH7A 3Q8CA 2KACA 1ET6A 1GAQB 1L6UA 3WCQA 3W5VB 1YMHE 3O13A 3P4RB 1J7CA 3EUB2 1CK1A 4GDLB 1ZE3D 1B9RA 1AW7A 1NENB 1YJIA 2J4XA 3ZJTA 1WRIA 4P16A 4XE0A 2LFIA 1RWSA 3FILA 5EE1A 2QILA 3MC0B 3U2SC 1D5MC 1HXYD 2DWQA 3AE2B 3GP7A 1F2RC 4RH6A 2BTEA 2PMVA 4WAFA 2K3UA 1F77A 2BS2B 1ZPSA 2V4IB 4MT5A 5FKAC 3V3XA 1J7AA 3P4PB 3AE8B 1HQRD 2WXRA 1DYQA 1XCQL 1QOGA 2KWDA 1KLUD 1K50A 2V3NA 1I4HA 3SR6A 2DYOA 1KRHA 3KQ4A 3PZ8A 4ZRQA 2JX5A 4NZLB 1SIJA 2PVOD 1T6BX 3BYTB 4D2KA 1K51A 2IJ0A 4KGSA 4Q2JA 1MPEA 3PO0A 2QIEB 2HDEA 2RMMA 2L1AA 3VQIA 1N5WA 4HKZE 4A90A 1FFVA 2G9HD 2Q5WD 1L4ZB 1EWCA 4RCOA 2BYTA 1D6EC 4YSZB 1PGAA 3BYYB 3R2IA 3W1SA 4MACA 2RDGA 5G5GA 3AV8A 1DGJA 3ABVB 3P63A 2XN9C 1QLBB 2SEBD 2WXLA 4XDDA 2IGGA 4L2YA 1PGBA 4MH8A 4EE2A 4A8XC 1DOYA 2DYMA 4RGNA 1FM0D 4UDUC 4JWUC 2JWUA 3MHZA 1A70A 2Y3AA 2M56B 3SFDB 1ENFA 1I4RA 1WSPA 1ZXIA 3U4EG 1VJKA 2N7JA 3Q69A 1F2RI 3FILB 2M0AA 1ZXHA 2VZKD 1XXGA 2WXGA 1SE2A 4PT5A 2CJOA 1GB1A 1T3QA 3TEZA 3N9YC 1CQVA 3BZDB 2WU2B 1D5XC 1VR9A 1NYQA 1WGKA 3AEDB 4OVZA 2G1EA 5D3DA 4C7ZA 1CJEA 2WXJA 5BMIA 3URYA 4ZRPA 4KGTA 3P4SB 1NYRA 1B1ZA 1QQRA 4LK0M 1C9FA 4HROA 4B0EA 4LLGM 3AMZA 3EGRA 4DXGA 1LO5D 1I7HA 1KTKA 4RFBA 4ZOHC 3RPFC 1JW9D 1MI0A 2GRIA 3OWEB 4CQNA 1FNWA 1I4XA 1I4PA 3Q8AA 1YN5A 2NTSA 1XLQA 1FD6A 4GLSC 2GI9A 1SE4A 3MJ5A 5LNK1 1YQ3B 1BXTA 3AM9A 3KLSX 5HHDG 3NS1A 3T3OA 3ZJUA 2KAJA 3IXSA 1MVKA 2BT6A 4KGRA 1C4AA 4A9AA 1KF6B 3AEGB 3T3NA 1Y56A 3BWUD 3FC4A 3HRDD 4YTPB 2GB1A 1XLOA 1QF6A 1TS4A 5I4DA 1SBBB 3IAS1 3KWLA 1SJHD 2D5GA 3SEBA 1QOBA 4ZYSA 3U7ZA 2W3RA 1RYJA 3BVMA 4IKGA 1MHHE 2H89B 4OZBA 4YTMB 4YSYB 2M19A 2JYEA 4RNAA 1NI3A 4TMAB 3LXFA 1WXQA 3TEYA 4KKIA 3HVDA 3VRAB 1FXAA 1IGCA 3NVZA 3U52E 4DXFA 3RFZB 1TKGA 3I9V1 1C4PA 3BVGA 4L1BA 2PKOA 1KH0A 1JWSD 3AECB 5C2TB 4JPSA 1DOXA 4HRSA 2INNE 2OHFA 2Z8LA 1NVID 1N61A 2YEPB 3B2GA 1ESFA 4FXCA 2FUG1 1M4VA 5BMHA 2BB5A 3GS2A 3NVVA 5FK9C 2W3SA 1JCKB 2LMCA 1UNSA 1ZDVA 2MJ3A 4US9A 1C76A 1NEKB 3I57A 1N63A 2JSVX 1FNVA 5G5HA 4NJCA 3AEBB 3VR9B 1ZDXA 1P7FA 1YNTE 2KN4A 1XLPA 2L52A 4MM3B 3Q8FA 2K22A 1JMLA 2QJLA 2DBYA 1FMAD 1GOZA 3BVZA 1JWMD 1TYGB 1OQQA 2BBCA 3HUIA 2B76B 2WNMA 2OEDA 4XWWA 2JYTA 2V0GA 1D4BA 2PTLA 4ZHOA 4RF0A 1FCCC 2EELA 2J53A 3C8YA 3AE6B 1N5XA 2WXPA 1FO4A 2J42A 3Q8EA 1K53A 2JXTA 1ZUD2 2MJEA 5EE9A 1ROEA 2CJNA 3L4PA 5D3IB 4TQ0A 3AE9B 1L4DB 1EU4A 4WWMA 1T5XD 1QOFA 2WDRB 1RFKA 3UI3A 3LYYA 5MPOA 2AQ2B 4P6VF 1Q10A 1VZ6A 3ZGZA 4O1NA 3ZYYX 1TS2A 2VZKB 2E6XA 5H92C 2WU5B 2ZW0A 1P7EA 1JWAD 3VRBB 3AE4B 4RGTA 1SXTA 1E0ZA 1WWTA 2BS3B 4L23A 2CU3A 4DQOC 3E56A 2WXNA 3TEWA 1BMLC 4JE3B 4R3DA 4LTUA 1AWDA 2L32A 2BW2A 1TJEA 4WURA 2YEPF 1E9MA 3BK2A 1HA5A 3HVZA 2PVGC 5C3JB 1PGXA 1N62A 3NZ3A 4OHJA 1JQ4A 1L0YB 3B2FA 1MHXA 2AQ1B 2FBWB 2H88B 4A55A 2N9KA 3IAM1 4XWTA 2INPE 5AUIA 4RGMA 1J7BA 1VDVA 1C77A 3LB8C 3TEXA 3GB1A 1ZOYB 4YXDB 2KMMA 2AX5A 2ICIA 2WS3B 4M0WA 5BYSA 2RPVA 3NVWA 1R7SA 1JWUD 2L83A 4IDIA 1XF5L 3AE7B 2N0SB 1SB3C 3ZJVA 1SF0A 4C56C 1K52A 3R2TA 1QT9A 2NMQA 1FFUA 4HKQA 5GXGB 2W82A 1VZ7A 3CWIA 4AQ7A 3ETRA 3H8HA 1IBXA 2K5PA 3AE5B 2LJIA 3MFGA 2QMTA 2WXKA 4N6EB 4N58A 3MP9A 3FAHA 5EE3A 5BYQA 2MEKA 1SJED 4IOIE 1TS3A 2IDYA 2X38A 1IUEA 2IGHA 3W5UB 3AEAB 1RM6C 4JX1C 1KLGD 4TSSA 1EWYC 2K9XA 1C79A 4OZCA 4C7YA 1E7PB 5BMGA 2WXQA 4XDCA 2R61A 3CIRB 1L0XB 4ITKA 3E9SA 3W2DA 4YT0B 1JALA 1GB4A 1TZOA 1EM7A 2PW9A 3IT4B 2WP9B 5H8YE 3R8BA 5BYRA 1I4GA 1FIQA 3P1MA 1FRDA 1WYGA 2ONQA 3B9JA 4US8A 4ARIA 2FE8A 2WXHA 5T8IA 2EKIA 1E6EB 4USAA 3VR8B 3W9CB 2JU6X 2K0PA 1N60A 2W54A 3KWVA 5JXVA 4RF1A 5HFYA 3NRZA 2LHDA 4NAWB 1XCTL 4RGOS 1FEHA 5FR3A 4ARCA 3AE3B 1PUTA 4H2AA 4YSXB 2JQRB 5D7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q10 A;  1HZ6 A;  5HHD G;  2ZW0 A;  3FIL A;  1MVK A;  1P7E A;  1QKZ A;  4KGR A;  1IGD A;  1IBX B;  1F2R C;  2GB1 A;  3V3X A;  2I2Y A;  1XCQ L;  2KWD A;  4IKG A;  1UWX A;  1MHH E;  1K50 A;  4OZB A;  2LUM A;  1PGX A;  1MHX A;  2N9K A;  4OZA A;  4D2K A;  1IGC A;  3GB1 A;  1K51 A;  2LHE A;  4KGS A;  1MPE A;  1KH0 A;  2RPV A;  2RMM A;  5HG2 A;  1XF5 L;  4HKZ E;  2N9L A;  5BMH A;  2J52 A;  1K52 A;  1PGA A;  4GLS C;  2NMQ A;  2I38 A;  4MAC A;  1IBX A;  4WH4 A;  2JSV X;  2QMT A;  2PLP A;  3MP9 A;  5HI1 A;  4IOI E;  2JZP A;  2IGG A;  1HEZ E;  1PGB A;  1P7F A;  1YNT E;  2KN4 A;  2IGH A;  1JML A;  2JWU A;  2LGI A;  4OZC A;  5BMG A;  2KQ4 X;  4HJG E;  2N7J A;  2ZW1 A;  1F2R I;  3FIL B;  1ZXH A;  2OED A;  2KDM A;  1GB4 A;  1D4B A;  2PTL A;  1EM7 A;  2PW9 A;  1GB1 A;  1FCC C;  2EEL A;  2J53 A;  5BMI A;  1FCL A;  2ONQ A;  4KGT A;  2ON8 A;  2QSD A;  1C9F A;  1K53 A;  2JU6 X;  2JXT A;  2K0P A;  5JXV A;  5HFY A;  3UI3 A;  2LHD A;  1XCT L;  1MI0 A;  1HZ5 A;  2IGD A;  2KAC A;  1FD6 A;  1YMH E;  2GI9 A; 
#chains in the Genus database with same CATH topology
 3ZTC A;  3TUO A;  3IHP C;  2WDQ B;  3AN1 A;  1YX5 B;  2OOB B;  4HDO A;  2LXC A;  3SFE B;  1IGD A;  1TS5 A;  1IBX B;  5AUK A;  1L2N A;  3QAQ A;  1WRD B;  3P42 A;  2K8C A;  2ZPN A;  3PSE B;  1VLB A;  2HD5 B;  1ZGU B;  4ZHP A;  3UF8 A;  1WH3 A;  2PIA A;  1FPY A;  4MEL A;  1SSN A;  2UWQ A;  5TSS A;  2HJ1 A;  2R2Q A;  1QIL A;  2DHZ A;  3DWM A;  4GDL A;  4FJZ A;  2MLB A;  4W9K A;  2MP2 A;  1YQB A;  2L0F A;  1WGH A;  3U7D A;  1V8C A;  1XEE A;  2YLM A;  2MSE D;  4J3O D;  1IP9 A;  2PLP A;  2AEH A;  5E6N A;  2MBB B;  1OQR A;  2JZP A;  3BK1 A;  1F9J A;  2NBU A;  2RDH A;  2CS4 A;  4NNJ B;  1V9J A;  2CHX A;  4EKU A;  2IYD B;  1WM2 A;  4MGY E;  4YTN B;  3RUI B;  4M02 A;  2DEN B;  2MBE A;  4K7S A;  5E6J A;  3EEC A;  4I6P A;  1GPX A;  2ASQ A;  2ON8 A;  3T9L A;  2LVO A;  1T0S C;  1PFD A;  2FCS A;  3AE1 B;  3ZQ4 A;  4LDT D;  2J7Q B;  1JRO A;  4EZJ A;  2TSS A;  4P1C C;  2IGD A;  3W1Y A;  1WI0 A;  1ET6 A;  3ALB A;  3W5V B;  3O13 A;  3P4R B;  4GDL B;  3EUB 2;  1CK1 A;  5IAA C;  2I1K A;  1ZE3 D;  1B9R A;  1EUV B;  2N4F A;  2MP2 B;  1RWS A;  4MEM A;  3TL5 A;  1TZ1 A;  3BY4 B;  1OEY A;  2BTE A;  2NPT A;  4WAF A;  2K3U A;  4PK1 A;  1WJ4 A;  3V3X A;  5E6O A;  2K25 A;  1J7A A;  2KZR A;  1HQR D;  2HE7 A;  1DYQ A;  1XCQ L;  1WGY A;  1WE7 A;  1KLU D;  4KZC A;  2PPH A;  2LXA A;  2KDI A;  4NZL B;  1SIJ A;  3K9P B;  2IJ0 A;  2BYE A;  1MPE A;  2QIE B;  3GE8 C;  1LFD A;  3DPD A;  4HKZ E;  3OJ3 A;  4A90 A;  1XT9 B;  2ZNV C;  2BYT A;  3SDL C;  3BYY B;  3R2I A;  2KJR A;  3ABV B;  3P63 A;  4LNN A;  1QLB B;  2WXL A;  3L10 B;  2LUE A;  3C0R B;  1DOY A;  3VTW A;  3V6E B;  2Y3A A;  4ZRI A;  2IBI B;  1ENF A;  1ZXI A;  3A1Q A;  3WIM A;  3U4E G;  1VJK A;  3Q69 A;  2M0X A;  3R7Q A;  1XXG A;  2IO1 B;  2WXG A;  2NPT B;  2KTR A;  3QQ8 B;  3TEZ A;  2DAF A;  2AWT A;  1D5X C;  3APF A;  2G1E A;  5BMI A;  3P4S B;  4WAA A;  1NYR A;  4S0R A;  1QQR A;  4LK0 M;  4HRO A;  3ZO5 B;  1E8Z A;  1LO5 D;  1I7H A;  2GRI A;  4CQN A;  4HVB A;  1FNW A;  1I4X A;  3Q8A A;  1WJN A;  4GLS C;  2GI9 A;  3MJ5 A;  2KQ7 A;  1WXS A;  5HHD G;  2GBK A;  1S3S G;  3JVZ X;  3T3O A;  3ZJU A;  4WWP A;  2KAJ A;  4BVU C;  1MVK A;  3NHE B;  2BT6 A;  4KGR A;  2KC2 A;  4A9A A;  3L16 A;  3AEG B;  3T3N A;  3VVW B;  1WE6 A;  4IW0 A;  4ZRJ A;  3HRD D;  1XLO A;  1QF6 A;  3IAS 1;  3KWL A;  1ZW7 A;  4ZYS A;  2K39 A;  4LDT B;  3WAM A;  3A1Q B;  4S17 A;  4TMA B;  1V5O A;  2FNJ B;  2MW5 A;  1WY8 A;  4M8N A;  1FXA A;  3U52 E;  4BBN F;  2KTR B;  4BKG A;  2LGY A;  2Z8L A;  3B2G A;  3AUL A;  2RSU A;  2BB5 A;  3GS2 A;  4B6W A;  2G3Q B;  4ICV A;  2CKH B;  2LMC A;  1UNS A;  1ZDV A;  2LD9 A;  2MJ3 A;  2RPQ A;  5IO9 A;  4JIO U;  3I57 A;  4RM9 A;  1P7F A;  1YNT E;  2KN4 A;  1XLP A;  5JZE B;  2J0K A;  3QAR A;  2J0M A;  2LZ6 A;  1FMA D;  3NZS A;  1WZ3 A;  3JSV A;  2B76 B;  2WNM A;  2WYQ A;  2OED A;  3R3M A;  4JLC A;  1I35 A;  4XWW A;  2DYB A;  2LVP A;  2MCN B;  4HDQ A;  2R2O A;  2RGF A;  3C8Y A;  4XX5 A;  3AE6 B;  3H9D A;  3RD2 A;  3ZTD A;  5JH5 C;  2MJE A;  2N7E A;  4TQ0 A;  3L17 A;  1LGR A;  4WWM A;  1T5X D;  4DHZ B;  2WDR B;  2LJ5 A;  4WJN A;  3LYY A;  3DVN V;  4QAY A;  4PS7 A;  5DCN A;  1TS2 A;  4E3C A;  1P3Q U;  2J0J A;  4PS8 A;  4TV3 A;  4BOZ B;  1JWA D;  3DBS A;  3VH4 B;  2FCM A;  4DQO C;  1RLF A;  2LGD A;  2BW2 A;  4DHJ D;  4M00 A;  2BVC A;  3IG3 A;  3NZ3 A;  3JSV B;  2FAZ A;  2O6V B;  4JL9 A;  2N9K A;  3CSF A;  4NJ6 A;  3X23 A;  4GMV A;  1ZOY B;  4A3P A;  3U8Z A;  1WJU A;  1JWU D;  1XF5 L;  3AE7 B;  1SB3 C;  4C56 C;  5CHV C;  2BYV E;  1QT9 A;  2XBB C;  2W82 A;  3RZW C;  3ETR A;  2LJI A;  3MFG A;  4N6E B;  4K81 A;  3MP9 A;  5EE3 A;  2MEK A;  1Q5W B;  3IFW B;  2JXX A;  2IGH A;  4JX1 C;  4AP4 C;  2DZJ A;  3ZW3 A;  4C7Y A;  2QCZ A;  2R61 A;  3QX1 A;  2NBV B;  2RDB C;  3A4S C;  3HM6 X;  3R7R A;  1JAL A;  4KDI C;  1HE8 A;  2PW9 A;  3IT4 B;  4NQK E;  2WP9 B;  3R8B A;  4K1R B;  5JHA A;  3PGE A;  3KVF B;  4ARI A;  4B9K A;  3KWV A;  3P2B A;  1XCT L;  5D7G A;  2WLB A;  4REZ A;  3NUH B;  2MA9 B;  1F52 A;  2JZ3 B;  1HTQ A;  4LNF A;  4F7Z A;  2JRH A;  2AQ3 B;  3MC8 A;  1E90 A;  1V1P A;  3N1X C;  1L0V B;  2MRP A;  2I2Y A;  3RUL A;  1UBQ A;  4TQ1 A;  2N9P C;  3V05 A;  3ZXV A;  2M1M A;  2LEK A;  3KH0 A;  3IT6 B;  2BS4 B;  2K1F A;  3IVF A;  4GGQ A;  1SE3 A;  5HKH A;  1YD8 U;  3HK0 A;  1E10 A;  1PYW D;  3RCZ A;  1TY0 A;  2JQR B;  1KLV A;  2N9X A;  1EU3 A;  2KXJ A;  3EC8 A;  1STE A;  3PZ7 A;  4WWN A;  2KLG A;  3KYC D;  1ET9 A;  1UZX B;  2KKC A;  1WR6 E;  3TSS A;  4DBG A;  1PDX A;  4WH4 A;  3L54 A;  2AYO B;  1VZ8 A;  5HI1 A;  3AB5 A;  3ZLZ A;  1ACC A;  1KJT A;  1MJD A;  2Y5C A;  3RI7 C;  4XZ4 A;  2GMI C;  3A33 B;  5IP4 D;  2ZW1 A;  2KOX A;  1FNU A;  2KDM A;  3NZU A;  4AUQ C;  1QOA A;  2IZV B;  4BBN C;  1CZP A;  3N20 C;  1V1P B;  4EFO A;  1V1O A;  4HEA 1;  1VRA B;  1P1A A;  2L00 B;  1FCL A;  2KJ6 A;  2KD0 A;  4W9F A;  1C4C A;  2ZVO A;  2WXM A;  2WXO A;  4LNO A;  3TIX A;  1HZ5 A;  2W9N A;  3Q8C A;  2KAC A;  1RFA A;  1YJI A;  1GUA B;  2J4X A;  2GBJ A;  2MBO A;  1WRI A;  5CHF A;  4XE0 A;  3ZNI D;  1LXD A;  2WHI A;  2CR5 A;  4IWO A;  3GP7 A;  4RH6 A;  2JZZ A;  2BS2 B;  2RD0 A;  1ZPS A;  3PHX B;  1WXV A;  4MSQ B;  3ZNG C;  2NVU I;  3UQB A;  1WXM A;  2LGX A;  3ZVV A;  2V3N A;  3SR6 A;  2DYO A;  3PZ8 A;  5DPW A;  2REX A;  5C23 A;  4ZRQ A;  3W1S C;  1E8Y A;  3BYT B;  1EF1 A;  3CF6 E;  1K51 A;  4IC7 B;  4Q2J A;  1GJZ A;  5G2N A;  5IKC M;  2HDE A;  1P98 A;  2L1A A;  4HWI B;  3M62 B;  2D3G A;  1J8C A;  4G3X B;  1L4Z B;  3DCG A;  1EWC A;  4RCO A;  1Q1O A;  1V49 A;  1PGA A;  2CHW A;  2WDT B;  3UIP B;  2MHJ A;  5G5G A;  3AV8 A;  1DGJ A;  1WJ6 A;  1VCB A;  4W9L A;  2Y5B B;  4L2Y A;  2XK5 A;  4UDU C;  2Z59 B;  1OQY A;  2BKF A;  5D6J B;  3DQV A;  3VUY A;  2N7J A;  1F2R I;  2JF5 A;  1OEY J;  2VZK D;  2FCQ A;  3A9K A;  2IO2 B;  1CQV A;  2WU2 B;  3AED B;  4RMA A;  1NYQ A;  3WAP A;  4C7Z A;  2KN5 A;  1P0R A;  1PQS A;  5KHO A;  3URY A;  4IWP A;  4KGT A;  5D2M B;  5IOI A;  1WGR A;  4G50 A;  4LLG M;  1GG3 A;  2BF8 B;  4ZOH C;  3OWE B;  2KNB A;  1FD6 A;  4GOC A;  4ANW A;  5LNK 1;  1YQ3 B;  2MBQ A;  4GB9 A;  3IXS A;  2KDE B;  4B95 A;  1KF6 B;  2K6D B;  3NJT A;  1WF9 A;  1TS4 A;  4PS3 A;  1SJH D;  2WGS A;  3SEB A;  3U7Z A;  2W3R A;  2XK5 B;  3MC9 A;  1WGD A;  3BVM A;  3DHI C;  4OZB A;  3MJW A;  4YSY B;  2KDF B;  4KSL C;  2KFJ A;  2BWE S;  1IGC A;  2KWU B;  3A9K B;  3RFZ B;  1TKG A;  4L1B A;  1JWS D;  3AEC B;  5C2T B;  4K7W A;  1DOX A;  4A20 A;  1N61 A;  2YEP B;  3DBR B;  4FXC A;  2FUG 1;  1M4V A;  2KMA A;  2LGS A;  3ZRC A;  5BMH A;  3NVV A;  1Z5S B;  3ML8 A;  1A5R A;  1JCK B;  5E6P A;  3EFU A;  2ZEQ A;  4FHK A;  1NEK B;  4AWJ A;  5LXH A;  4BKS A;  3AXC A;  1UBI A;  3VR9 B;  5G55 A;  2QJL A;  1JML A;  5D94 A;  3BVZ A;  3HUI A;  1D4B A;  2O2V A;  2IND C;  2KDB A;  4RF0 A;  3L0W B;  2EEL A;  2J53 A;  3EFC A;  4BAX A;  3TJP A;  2BKR B;  2WXP A;  1FO4 A;  2J42 A;  2V1Y A;  3OLM D;  2D10 A;  2JXT A;  1V2Y A;  1OTR B;  5EE9 A;  3CMM B;  1ROE A;  3L4P A;  5AZG A;  1WGG A;  1RRB A;  2PEA A;  1QOF A;  2C9W B;  1RFK A;  3RN9 C;  5AEK B;  2AQ2 B;  1Q10 A;  4DDI D;  2VZK B;  2E6X A;  2ZW0 A;  1P7E A;  2CHZ A;  4BKT A;  3LDZ E;  1WWT A;  2CU3 A;  3IBE A;  1BML C;  4JE3 B;  2O6V D;  3VUX A;  4P1B C;  1GNU A;  3PLV A;  4ANX A;  1N62 A;  4HJK A;  4OHJ A;  3B2F A;  1L0Y B;  2KVZ A;  2AQ1 B;  3RNC C;  1WFY A;  2FBW B;  2L3Z A;  4A55 A;  4NAW A;  4XWT A;  2G4S A;  2INP E;  4DXA B;  2O2V B;  4EOY A;  4YXD B;  2KMM A;  2AX5 A;  2WS3 B;  4IDI A;  2N0S B;  2NBW B;  1SF0 A;  4XC2 A;  1K52 A;  3A9J A;  5GXG B;  3CWI A;  4AQ7 A;  1E5W A;  3DHH C;  1WX9 A;  1T0Y A;  2QMT A;  2WXK A;  2KLC A;  3FAH A;  2A4Z A;  1SJE D;  4IOI E;  1WR1 A;  4W9C A;  5C1Z A;  4IM3 A;  2K9X A;  1C79 A;  1E7P B;  3PVL A;  2FID A;  4XDC A;  3I5J C;  2D07 B;  5DPT A;  4FJY A;  3DOW A;  4K3C A;  1M94 A;  4OVV A;  1EM7 A;  4FAD A;  2EMT A;  5H8Y E;  1I4G A;  3Q6B A;  3PRZ A;  1FRD A;  4W9D A;  1WYG A;  2JUO A;  1N6Z A;  3B9J A;  2WXH A;  1RAX A;  4USA A;  2D3C A;  3W9C B;  3NG0 A;  4RF1 A;  3NRZ A;  4RGO S;  4NAW B;  1FEH A;  4ARC A;  3AE3 B;  2LVQ A;  1NDD A;  2C7M B;  2O6V A;  3DBH B;  1TBE A;  1TT5 B;  1FRR A;  4C00 A;  2C7N B;  1UF0 A;  3QWZ B;  4ZYN A;  3RNB C;  1HZ6 A;  3RNE C;  4WIP A;  3V60 A;  4DDG D;  3A9J B;  3WAN A;  4B0M A;  1UGJ A;  1QKZ A;  4C80 A;  1H4R A;  2INC C;  3BIN A;  3P4Q B;  4MJS A;  4P7I A;  2L05 A;  2WX0 A;  1R4M B;  1V81 A;  4N59 A;  1ISN A;  3Q8B A;  4EZL A;  1WIA A;  1YN3 A;  2LUM A;  3J9C A;  3VDZ A;  2LI5 A;  4KKJ A;  2HTM E;  3ZRF A;  4G11 A;  3ZDM C;  2LHE A;  1J0G A;  3PLU A;  2IO0 B;  2Y5P A;  3NVY A;  2W55 A;  5HG2 A;  5TR5 A;  3EHV A;  3VUW A;  2N9L A;  4J6I A;  4NY0 A;  2V3P A;  3S2A A;  2AL3 A;  2NTT A;  2WQY B;  2GBN A;  1TKY A;  4KIK A;  4KX6 B;  4NAM A;  1JRP A;  2WXI A;  3ZIM A;  2ACZ B;  1KFY B;  3RT3 B;  1T0Q C;  1TGZ B;  4G0N B;  3JYU A;  4YWG G;  3VFK A;  3HHM A;  2BGF A;  4HJG E;  4AS1 A;  2E3T A;  3AEF B;  1I42 A;  2AL6 A;  4WWO A;  4CO7 A;  3APD A;  3GZN B;  3Q3F A;  3AEE B;  4WJO A;  4MJS B;  3APC A;  3V61 A;  4FN2 A;  1SE9 A;  2G4D B;  2QSD A;  4RM8 A;  1U4A A;  1C78 A;  4IWQ A;  2QEJ C;  3AH7 A;  1L6U A;  2KTF A;  3WCQ A;  1J7C A;  3N1Z C;  1AW7 A;  3ZJT A;  3VTV A;  2LFI A;  2JT4 B;  5EE1 A;  3MC0 B;  3U2S C;  4IG7 B;  1D5M C;  2DWQ A;  3AE2 B;  1C3T A;  1F2R C;  3UIO B;  2D3B A;  1F77 A;  5FKA C;  4HLE A;  3P4P B;  4KIK B;  4MGZ E;  3AE8 B;  2WXR A;  2KO3 A;  1QOG A;  2FIF A;  1K50 A;  1I4H A;  1KRH A;  4LNI A;  3MHS D;  4HPP A;  4KGS A;  3OJ4 B;  2N9E B;  4LCD E;  3PO0 A;  2RMM A;  2M17 A;  4URK A;  3VQI A;  1P9D U;  5J2R A;  1Y8R C;  4YSZ B;  3B08 A;  4MAC A;  2RDG A;  2CU1 A;  3R66 C;  2XN9 C;  2SEB D;  4XDD A;  4HCP B;  1ZKH A;  1PGB A;  4MH8 A;  4EE2 A;  5DPR A;  1FM0 D;  4JWU C;  3QK0 A;  4F8C B;  3SFD B;  3VXW A;  1I4R A;  3QA8 A;  2M0A A;  4DHZ E;  1SE2 A;  4PT5 A;  3PS6 A;  2CJO A;  4TKN A;  1GB1 A;  1V5T A;  3PT2 B;  3KYD D;  5I4D A;  1YIW A;  5AZH A;  3VTU A;  4OVZ A;  1WMH A;  2WXJ A;  2C7H A;  1R4N B;  4W9G A;  1B1Z A;  4B0E A;  4AOF A;  4ANU A;  4DXG A;  3ENE A;  4RFB A;  1JW9 D;  2HJ8 A;  5J18 A;  1YN5 A;  1E7V A;  4MH0 E;  4MM3 A;  4W9H A;  1BXT A;  4F1S A;  3NS1 A;  1S1Q B;  2C60 A;  3WAL A;  1Y56 A;  3BWU D;  3FC4 A;  4YTP B;  3DBR I;  2GB1 A;  2JVC A;  1SBB B;  4I6N B;  4IUM B;  2UYZ B;  1QOB A;  2V4L A;  1RYJ A;  4WJQ A;  4EUT A;  2D11 A;  4IKG A;  1MHH E;  2H89 B;  4YTM B;  2PE6 B;  4ACF A;  2JYE A;  3JW0 X;  1NI3 A;  2A5U A;  1WXQ A;  3TEY A;  4OVU A;  3RNG C;  3CST A;  3HVD A;  4DXF A;  3I9V 1;  3PZD A;  2JPH A;  4JPS A;  4E71 A;  2BWF A;  4HRS A;  2OHF A;  1WMH B;  5KHQ A;  1NVI D;  1X1M A;  2W3S A;  5EDS A;  1L7Y A;  1Q0W B;  3RMK C;  2KC1 A;  4US9 A;  1C76 A;  2QC8 A;  1IYF A;  3DDC B;  1FNV A;  3ML9 A;  5G5H A;  3D32 A;  4NJC A;  3AEB B;  4W9E A;  1H8C A;  3WA0 A;  4MDK E;  2M8S A;  3A4R A;  4MM3 B;  1AAR A;  2GOW A;  2KX0 A;  2GBM A;  2ZCC A;  1GOZ A;  1WM3 A;  3PTF C;  1JWM D;  1UGM A;  3O65 B;  1D3Z A;  3VAW A;  1OQQ A;  2BBC A;  2BPS A;  2NCN A;  3UQA A;  2V0G A;  4K3B A;  2PTL A;  2L0T A;  4K7U A;  4E74 A;  2GBR A;  1FCC C;  1N5X A;  2DX5 B;  1MG8 A;  1C1Y B;  1K53 A;  2KWC A;  1ZUD 2;  4BOS C;  2CJN A;  2ZJD A;  5D3I B;  4HPM B;  4BFR A;  1L4D B;  4LJO B;  2LWP A;  4FJV B;  3DBL B;  2K8B A;  2GLS A;  5MPO A;  4P6V F;  2VRR B;  1VZ6 A;  3ZGZ A;  4O1N A;  3ZYY X;  2VH1 A;  5H92 C;  2LRW A;  4BKS D;  3VRB B;  4ZDV A;  1UEL A;  4L23 A;  3E56 A;  4R3D A;  4LTU A;  5GMV A;  2L32 A;  2DZI A;  4KDL B;  1TJE A;  2YEP F;  3Q3O C;  1HTO A;  1T0R C;  1JQ4 A;  3KUZ A;  3NY5 A;  1MHX A;  2IY1 B;  2H88 B;  2KHW B;  5AUI A;  4RGM A;  1C77 A;  3TEX A;  2DNF A;  5DPS A;  3M95 A;  2RPV A;  3NVW A;  1R7S A;  4X57 B;  2KYW A;  3ZJV A;  5JHB A;  3R2T A;  2KX3 A;  2NMQ A;  1FFU A;  4CHK A;  3RNA C;  2DZM A;  3DVG X;  3H8H A;  2K5P A;  3AE5 B;  4HPL B;  3I63 C;  2WX1 A;  5BYQ A;  2D3A A;  4GXB A;  4GDK A;  1TS3 A;  1Z2M A;  2X38 A;  1RM6 C;  1KLG D;  1EWY C;  5BMG A;  2WXQ A;  2MWS B;  2JWZ A;  3E9S A;  3W2D A;  3KW5 B;  3DBH I;  1TZO A;  2EKE C;  2MQJ A;  5BYR A;  1FIQ A;  1NI2 A;  1TIF A;  2K6Q A;  2IO3 B;  4PYZ A;  4US8 A;  2FE8 A;  3N30 A;  1E6E B;  2K0P A;  1N60 A;  2W54 A;  5JXV A;  3M63 B;  4C4V A;  2LHD A;  2OJW A;  5FR3 A;  1R4M I;  2JY6 A;  2WWZ A;  1PUT A;  2OJR A;  1XQQ A;  2NR2 A;  3P1M A;  3VH3 B;  4OW0 A;  1L6V A;  4A6Q A;  2M4N A;  2BB6 A;  3PRP B;  2EMS A;  3EA6 A;  2WDV B;  3VHT C;  4LJP B;  2MJD A;  3ZNH B;  1UWM A;  1WZ0 A;  4GDK B;  2WXF A;  1BUI C;  1UUP A;  1J19 A;  4JWS C;  1ZP0 B;  1UWX A;  4M01 A;  1F0Z A;  2KJH B;  3T8M A;  2KQS A;  4OZA A;  2VH2 A;  5CHW A;  4FLH A;  1XLN A;  5EE0 A;  1G6J A;  3BII D;  1I4Q A;  3X0W A;  1V6E A;  1FXI A;  2SAK A;  2XNA C;  1FXT B;  1AN8 A;  4CYE A;  3WAO A;  2J52 A;  3GZN I;  2ZCB A;  2MH7 A;  2I38 A;  4C4V B;  4DWF A;  1V80 A;  1OFF A;  3SD5 A;  1YN4 A;  1AYF A;  1XO3 A;  2DLB A;  3PV1 A;  4WQO B;  1DOI A;  1HEZ E;  1YQ4 B;  2HTH A;  1EF5 A;  2X8X X;  1F1H A;  1TY2 A;  2LGI A;  4WJP A;  1V97 A;  2KQ4 X;  2ZZP B;  1YJJ A;  1D5Z C;  2IPK D;  4ZRK A;  1SEB D;  3ZUN A;  1KOT A;  5CTR C;  2L7R A;  3AU5 A;  5IN7 A;  3HIZ A;  4FHJ A;  2KT7 A;  4WQM A;  1L5P A;  1TKE A;  2PJH A;  2BQQ A;  1JWB D;  3FKY A;  2N1V A;  1GAQ B;  2PE9 A;  4HK2 A;  1YMH E;  1NEN B;  4GSW A;  4P16 A;  5LLI A;  1E8W A;  4ANV A;  3FIL A;  2KMC A;  2QIL A;  2V9H A;  1HXY D;  3ZXR A;  2PMV A;  4MT5 A;  2V4I B;  1BT0 A;  3M3J A;  2KWD A;  4W9J A;  3RZF A;  3KQ4 A;  2JX5 A;  3PRM B;  2PVO D;  1T6B X;  4W9I A;  4D2K A;  4FA6 A;  2V3S A;  4EZK A;  2MBH A;  4TUU A;  2KVR A;  1N5W A;  3H7S A;  1FFV A;  2G9H D;  4IM2 A;  2Q5W D;  1D6E C;  3DVN U;  2D2Q A;  2I1J A;  2JRI B;  4HCN B;  2XEW A;  3W1S A;  4XYC A;  1R4N I;  1WX7 A;  2IGG A;  4A8X C;  2DYM A;  4RGN A;  3KUD B;  2L8J A;  1CMX B;  2JWU A;  3MHZ A;  2NS5 A;  1A70 A;  2M56 B;  1WSP A;  4II3 B;  3GE3 C;  1KM7 A;  4NQL B;  2BYF A;  3FIL B;  1ZXH A;  3ONS A;  4JGH B;  5CX3 A;  1T3Q A;  4FUL A;  3N9Y C;  4DK5 A;  3BZD B;  1NBF C;  1VR9 A;  1WYW B;  5D3D A;  1WGK A;  1CJE A;  4ZRP A;  4HXD A;  3GOE A;  1C9F A;  1SIF A;  3AMZ A;  3EGR A;  4FBJ B;  1KTK A;  2L76 A;  3RPF C;  3SHQ A;  1MI0 A;  2FUH B;  1YJ1 A;  1I4P A;  2NTS A;  1XLQ A;  1E8X A;  1SE4 A;  5L83 A;  3V62 A;  3AM9 A;  3KLS X;  1WXA A;  3ECI A;  4IM0 A;  3SU8 X;  3K9O B;  4PYU A;  3AU4 A;  1C4A A;  3UGB B;  5LXI B;  4GU2 A;  4KSK C;  3PPA A;  1K8R B;  3TCA A;  3I3T B;  2D5G A;  1UD7 A;  3UIN B;  3Q2A C;  3N32 A;  4M8M A;  2KK8 A;  2M19 A;  3KUC B;  4RNA A;  3LXF A;  3QCA A;  3LJ3 A;  3RYT A;  4KKI A;  3VRA B;  3NVZ A;  4MGI E;  1C4P A;  3BVG A;  2PKO A;  1KH0 A;  1WX8 A;  4KV2 A;  1TTN A;  2INN E;  3OG5 A;  1YOV B;  1ESF A;  3MTN B;  5FK9 C;  4GIV A;  3ZDT A;  3L13 A;  4AJY B;  3HM3 A;  2KFK A;  3NOB A;  4BZA A;  1N63 A;  2JSV X;  3AI5 A;  2QHO A;  4KVG B;  3H1U A;  1UH6 A;  4YL8 A;  3PHW B;  1ZDX A;  2N1W A;  2L52 A;  3L08 A;  3Q8F A;  2RR9 A;  2K22 A;  2DBY A;  3H6N A;  3C19 A;  1TYG B;  1YX6 B;  2KAN A;  3DBL I;  2JYT A;  4A3O A;  2MX2 A;  4ZHO A;  1GC7 A;  1IPG A;  3Q3N C;  1OGW A;  1QZE A;  3TMP B;  3Q8E A;  3QC8 B;  3AE9 B;  3RNF C;  2N7D A;  1EU4 A;  4I6L B;  2UU7 A;  3UI3 A;  2IY0 B;  4NJ7 A;  2ZVN A;  2QDF A;  2ZPY A;  2YVC A;  1MFW A;  3PRE A;  2K8H A;  4AJW A;  3OAW A;  2WU5 B;  1E7U A;  3B0A A;  3AE4 B;  1V86 A;  2KFK B;  4RGT A;  1GC6 A;  1SXT A;  4KZ0 A;  1VD2 A;  1E0Z A;  2BS3 B;  2FCN A;  4ICU A;  1SGH A;  2WXN A;  3TEW A;  4MSM B;  3V6C B;  1AWD A;  3H7P A;  3Q3J A;  4WUR A;  3ZKJ C;  1E9M A;  3BK2 A;  1HA5 A;  3HVZ A;  2PVG C;  5C3J B;  4JQW C;  1PGX A;  3QIJ A;  2Z0E B;  4DHJ B;  3IAM 1;  3ZNZ B;  3DHG C;  1J7B A;  1VDV A;  2C5L C;  3LB8 C;  3GB1 A;  3N3K B;  5J17 A;  1MG4 A;  4EEW A;  2ICI A;  4M0W A;  5BYS A;  3QJZ A;  3TBL D;  3Q14 C;  2Z0D B;  2L83 A;  3DVG Y;  2B3A A;  5L95 C;  4HKQ A;  1VZ7 A;  1XD3 B;  2DZK A;  2KWV B;  1IBX A;  1JRU A;  4N58 A;  2ZNV B;  2IDY A;  2DAJ A;  1IUE A;  3W5U B;  3AEA B;  4TSS A;  2LRU A;  4OZC A;  1LQB A;  5FR6 A;  3CIR B;  1L0X B;  4ITK A;  4YT0 B;  1LM8 B;  4MGK E;  1GB4 A;  5IA7 A;  3B1L X;  4NPN A;  4N9F 4;  4XGA B;  5BO4 B;  3H7P B;  2ONQ A;  2LAS A;  3Q3M C;  4ASW C;  1EO6 A;  5T8I A;  2EKI A;  3QHT A;  3VR8 B;  4GN1 A;  2JU6 X;  4LNK A;  5HFY A;  4II2 B;  2G45 B;  4H2A A;  5AZF A;  4YSX B;  3NS8 A;  3DWG C;  4M0W B;  3N1Y C;  3U30 A; 
#chains in the Genus database with same CATH homology
 4OW0 A;  1FRR A;  2WLB A;  3TUO A;  1L6V A;  4A6Q A;  4REZ A;  1HZ6 A;  3NUH B;  4WIP A;  2WDQ B;  3AN1 A;  4B0M A;  2BB6 A;  1UGJ A;  2AQ3 B;  1QKZ A;  3EA6 A;  2WDV B;  3SFE B;  1IGD A;  1TS5 A;  1IBX B;  4C80 A;  1V1P A;  5AUK A;  2MJD A;  3P42 A;  1L0V B;  3P4Q B;  1UWM A;  4GDK B;  2I2Y A;  2WXF A;  4N59 A;  1BUI C;  3Q8B A;  1UUP A;  4TQ1 A;  3V05 A;  1VLB A;  4JWS C;  1ZP0 B;  1UWX A;  1YN3 A;  2LEK A;  2LUM A;  3J9C A;  4ZHP A;  3IT6 B;  2BS4 B;  1F0Z A;  2PIA A;  4KKJ A;  2HTM E;  4OZA A;  1SE3 A;  1SSN A;  1XLN A;  5EE0 A;  5TSS A;  2LHE A;  3BII D;  1I4Q A;  1QIL A;  2Y5P A;  3DWM A;  3NVY A;  1FXI A;  2SAK A;  2W55 A;  1PYW D;  1E10 A;  2XNA C;  1TY0 A;  1AN8 A;  3DWG C;  5HG2 A;  2N9L A;  1EU3 A;  2J52 A;  1STE A;  3PZ7 A;  2V3P A;  1ET9 A;  2MH7 A;  1V8C A;  2I38 A;  1XEE A;  3TSS A;  1PDX A;  4WH4 A;  2NTT A;  4J3O D;  1OFF A;  2PLP A;  1VZ8 A;  2WQY B;  1OQR A;  1YN4 A;  1AYF A;  5HI1 A;  1XO3 A;  1TKY A;  2DLB A;  2JZP A;  1DOI A;  3BK1 A;  1HEZ E;  1YQ4 B;  1ACC A;  1JRP A;  3AB5 A;  2WXI A;  4KX6 B;  2Y5C A;  4NAM A;  2RDH A;  2ACZ B;  1TY2 A;  1KFY B;  2LGI A;  1V97 A;  4YTN B;  4YWG G;  2KQ4 X;  4HJG E;  2ZW1 A;  4AS1 A;  2E3T A;  3AEF B;  1FNU A;  2KDM A;  1QOA A;  1YJJ A;  1CZP A;  5E6J A;  1V1P B;  1D5Z C;  3AEE B;  1V1O A;  2IPK D;  4HEA 1;  1SEB D;  1VRA B;  1FCL A;  1GPX A;  2ON8 A;  2QSD A;  4WQM A;  1L5P A;  1TKE A;  1PFD A;  3AE1 B;  1C78 A;  1C4C A;  3ZQ4 A;  1JRO A;  2WXM A;  2TSS A;  2WXO A;  1JWB D;  1HZ5 A;  2IGD A;  2QEJ C;  3AH7 A;  3Q8C A;  2KAC A;  1ET6 A;  1GAQ B;  1L6U A;  3WCQ A;  3W5V B;  1YMH E;  3O13 A;  3P4R B;  1J7C A;  3EUB 2;  1CK1 A;  4GDL B;  1ZE3 D;  1B9R A;  1AW7 A;  1NEN B;  1YJI A;  2J4X A;  3ZJT A;  1WRI A;  4P16 A;  4XE0 A;  2LFI A;  1RWS A;  3FIL A;  5EE1 A;  2QIL A;  3MC0 B;  3U2S C;  1D5M C;  1HXY D;  2DWQ A;  3AE2 B;  3GP7 A;  1F2R C;  4RH6 A;  2BTE A;  2PMV A;  4WAF A;  2K3U A;  1F77 A;  2BS2 B;  1ZPS A;  2V4I B;  4MT5 A;  5FKA C;  3V3X A;  1J7A A;  3P4P B;  3AE8 B;  1HQR D;  2WXR A;  1DYQ A;  1XCQ L;  1QOG A;  2KWD A;  1KLU D;  1K50 A;  2V3N A;  1I4H A;  3SR6 A;  2DYO A;  1KRH A;  3KQ4 A;  3PZ8 A;  4ZRQ A;  2JX5 A;  4NZL B;  1SIJ A;  2PVO D;  1T6B X;  3BYT B;  4D2K A;  1K51 A;  2IJ0 A;  4KGS A;  4Q2J A;  1MPE A;  3PO0 A;  2QIE B;  2HDE A;  2RMM A;  2L1A A;  3VQI A;  1N5W A;  4HKZ E;  4A90 A;  1FFV A;  2G9H D;  2Q5W D;  1L4Z B;  1EWC A;  4RCO A;  2BYT A;  1D6E C;  4YSZ B;  1PGA A;  3BYY B;  3R2I A;  3W1S A;  4MAC A;  2RDG A;  5G5G A;  3AV8 A;  1DGJ A;  3ABV B;  3P63 A;  2XN9 C;  1QLB B;  2SEB D;  2WXL A;  4XDD A;  2IGG A;  4L2Y A;  1PGB A;  4MH8 A;  4EE2 A;  4A8X C;  1DOY A;  2DYM A;  4RGN A;  1FM0 D;  4UDU C;  4JWU C;  2JWU A;  3MHZ A;  1A70 A;  2Y3A A;  2M56 B;  3SFD B;  1ENF A;  1I4R A;  1WSP A;  1ZXI A;  3U4E G;  1VJK A;  2N7J A;  3Q69 A;  1F2R I;  3FIL B;  2M0A A;  1ZXH A;  2VZK D;  1XXG A;  2WXG A;  1SE2 A;  4PT5 A;  2CJO A;  1GB1 A;  1T3Q A;  3TEZ A;  3N9Y C;  1CQV A;  3BZD B;  2WU2 B;  1D5X C;  1VR9 A;  1NYQ A;  1WGK A;  3AED B;  4OVZ A;  2G1E A;  5D3D A;  4C7Z A;  1CJE A;  2WXJ A;  5BMI A;  3URY A;  4ZRP A;  4KGT A;  3P4S B;  1NYR A;  1B1Z A;  1QQR A;  4LK0 M;  1C9F A;  4HRO A;  4B0E A;  4LLG M;  3AMZ A;  3EGR A;  4DXG A;  1LO5 D;  1I7H A;  1KTK A;  4RFB A;  4ZOH C;  3RPF C;  1JW9 D;  1MI0 A;  2GRI A;  3OWE B;  4CQN A;  1FNW A;  1I4X A;  1I4P A;  3Q8A A;  1YN5 A;  2NTS A;  1XLQ A;  1FD6 A;  4GLS C;  2GI9 A;  1SE4 A;  3MJ5 A;  5LNK 1;  1YQ3 B;  1BXT A;  3AM9 A;  3KLS X;  5HHD G;  3NS1 A;  3T3O A;  3ZJU A;  2KAJ A;  3IXS A;  1MVK A;  2BT6 A;  4KGR A;  1C4A A;  4A9A A;  1KF6 B;  3AEG B;  3T3N A;  1Y56 A;  3BWU D;  3FC4 A;  3HRD D;  4YTP B;  2GB1 A;  1XLO A;  1QF6 A;  1TS4 A;  5I4D A;  1SBB B;  3IAS 1;  3KWL A;  1SJH D;  2D5G A;  3SEB A;  1QOB A;  4ZYS A;  3U7Z A;  2W3R A;  1RYJ A;  3BVM A;  4IKG A;  1MHH E;  2H89 B;  4OZB A;  4YTM B;  4YSY B;  2M19 A;  2JYE A;  4RNA A;  1NI3 A;  4TMA B;  3LXF A;  1WXQ A;  3TEY A;  4KKI A;  3HVD A;  3VRA B;  1FXA A;  1IGC A;  3NVZ A;  3U52 E;  4DXF A;  3RFZ B;  1TKG A;  3I9V 1;  1C4P A;  3BVG A;  4L1B A;  2PKO A;  1KH0 A;  1JWS D;  3AEC B;  5C2T B;  4JPS A;  1DOX A;  4HRS A;  2INN E;  2OHF A;  2Z8L A;  1NVI D;  1N61 A;  2YEP B;  3B2G A;  1ESF A;  4FXC A;  2FUG 1;  1M4V A;  5BMH A;  2BB5 A;  3GS2 A;  3NVV A;  5FK9 C;  2W3S A;  1JCK B;  2LMC A;  1UNS A;  1ZDV A;  2MJ3 A;  4US9 A;  1C76 A;  1NEK B;  3I57 A;  1N63 A;  2JSV X;  1FNV A;  5G5H A;  4NJC A;  3AEB B;  3VR9 B;  1ZDX A;  1P7F A;  1YNT E;  2KN4 A;  1XLP A;  2L52 A;  4MM3 B;  3Q8F A;  2K22 A;  1JML A;  2QJL A;  2DBY A;  1FMA D;  1GOZ A;  3BVZ A;  1JWM D;  1TYG B;  1OQQ A;  2BBC A;  3HUI A;  2B76 B;  2WNM A;  2OED A;  4XWW A;  2JYT A;  2V0G A;  1D4B A;  2PTL A;  4ZHO A;  4RF0 A;  1FCC C;  2EEL A;  2J53 A;  3C8Y A;  3AE6 B;  1N5X A;  2WXP A;  1FO4 A;  2J42 A;  3Q8E A;  1K53 A;  2JXT A;  1ZUD 2;  2MJE A;  5EE9 A;  1ROE A;  2CJN A;  3L4P A;  5D3I B;  4TQ0 A;  3AE9 B;  1L4D B;  1EU4 A;  4WWM A;  1T5X D;  1QOF A;  2WDR B;  1RFK A;  3UI3 A;  3LYY A;  5MPO A;  2AQ2 B;  4P6V F;  1Q10 A;  1VZ6 A;  3ZGZ A;  4O1N A;  3ZYY X;  1TS2 A;  2VZK B;  2E6X A;  5H92 C;  2WU5 B;  2ZW0 A;  1P7E A;  1JWA D;  3VRB B;  3AE4 B;  4RGT A;  1SXT A;  1E0Z A;  1WWT A;  2BS3 B;  4L23 A;  2CU3 A;  4DQO C;  3E56 A;  2WXN A;  3TEW A;  1BML C;  4JE3 B;  4R3D A;  4LTU A;  1AWD A;  2L32 A;  2BW2 A;  1TJE A;  4WUR A;  2YEP F;  1E9M A;  3BK2 A;  1HA5 A;  3HVZ A;  2PVG C;  5C3J B;  1PGX A;  1N62 A;  3NZ3 A;  4OHJ A;  1JQ4 A;  1L0Y B;  3B2F A;  1MHX A;  2AQ1 B;  2FBW B;  2H88 B;  4A55 A;  2N9K A;  3IAM 1;  4XWT A;  2INP E;  5AUI A;  4RGM A;  1J7B A;  1VDV A;  1C77 A;  3LB8 C;  3TEX A;  3GB1 A;  1ZOY B;  4YXD B;  2KMM A;  2AX5 A;  2ICI A;  2WS3 B;  4M0W A;  5BYS A;  2RPV A;  3NVW A;  1R7S A;  1JWU D;  2L83 A;  4IDI A;  1XF5 L;  3AE7 B;  2N0S B;  1SB3 C;  3ZJV A;  1SF0 A;  4C56 C;  1K52 A;  3R2T A;  1QT9 A;  2NMQ A;  1FFU A;  4HKQ A;  5GXG B;  2W82 A;  1VZ7 A;  3CWI A;  4AQ7 A;  3ETR A;  3H8H A;  1IBX A;  2K5P A;  3AE5 B;  2LJI A;  3MFG A;  2QMT A;  2WXK A;  4N6E B;  4N58 A;  3MP9 A;  3FAH A;  5EE3 A;  5BYQ A;  2MEK A;  1SJE D;  4IOI E;  1TS3 A;  2IDY A;  2X38 A;  1IUE A;  2IGH A;  3W5U B;  3AEA B;  1RM6 C;  4JX1 C;  1KLG D;  4TSS A;  1EWY C;  2K9X A;  1C79 A;  4OZC A;  4C7Y A;  1E7P B;  5BMG A;  2WXQ A;  4XDC A;  2R61 A;  3CIR B;  1L0X B;  4ITK A;  3E9S A;  3W2D A;  4YT0 B;  1JAL A;  1GB4 A;  1TZO A;  1EM7 A;  2PW9 A;  3IT4 B;  2WP9 B;  5H8Y E;  3R8B A;  5BYR A;  1I4G A;  1FIQ A;  3P1M A;  1FRD A;  1WYG A;  2ONQ A;  3B9J A;  4US8 A;  4ARI A;  2FE8 A;  2WXH A;  5T8I A;  2EKI A;  1E6E B;  4USA A;  3VR8 B;  3W9C B;  2JU6 X;  2K0P A;  1N60 A;  2W54 A;  3KWV A;  5JXV A;  4RF1 A;  5HFY A;  3NRZ A;  2LHD A;  4NAW B;  1XCT L;  4RGO S;  1FEH A;  5FR3 A;  4ARC A;  3AE3 B;  1PUT A;  4H2A A;  4YSX B;  2JQR B;  5D7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...