1NVID

Orthorhombic crystal form of molybdopterin synthase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
MVKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Molybdopterin converting factor subunit 1
publication title Structural Studies of Molybdopterin Synthase Provide Insights into its Catalytic Mechanism
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2003-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1nviD00
3NRZA 1CZPA 2BT6A 4A9AA 2DBYA 1N62A 4YSXB 1FM0D 1RM6C 1L5PA 1FRRA 1CJEA 5C2TB 1N5WA 3BIID 3NVZA 3P4SB 1XLOA 3AEGB 1L6VA 1JRPA 3AEDB 1WRIA 3AH7A 3HVZA 4P6VF 2KMMA 5EE9A 3VRBB 1FO4A 1J7BA 1N5XA 2OHFA 1TYGB 1XLPA 1RWSA 1ZUD2 4YTPB 2N0SB 1IUEA 3B2GA 2HTME 2ACZB 2JX5A 1WGKA 2LEKA 1TJEA 3AEAB 3AE9B 3HRDD 4WWMA 5H8YE 2FBWB 1JWBD 1QOBA 1DOIA 2L52A 3AM9A 4ZHOA 1DOXA 3RPFC 1RFKA 3B9JA 1RYJA 1YJJA 1JALA 2Q5WD 1J7CA 3P4RB 3AB5A 2MJ3A 5AUIA 1E7PB 4C7YA 4YSZB 2MH7A 4C7ZA 1FIQA 3NVVA 2QJLA 3AEEB 3KWLA 1JROA 2L83A 3AE1B 2E3TA 2H88B 3AN1A 2AX5A 2WQYB 3NVWA 4US8A 2CJNA 3P4PB 1ROEA 3AE2B 3CIRB 5G5HA 1PFDA 3ETRA 1SF0A 5MPOA 1KF6B 4YTMB 1PDXA 1XO3A 3AV8A 3CWIA 1DOYA 1VLBA 1A70A 1NEKB 1JWAD 1V97A 2WS3B 4JWSC 1JQ4A 5EE3A 1T3QA 1XLNA 1KFYB 2K22A 3AE4B 2WDVB 3EUB2 1ZOYB 1DGJA 1SIJA 2BS3B 3AECB 3B2FA 4USAA 3AEBB 1QT9A 3FC4A 3LB8C 2WU5B 5C3JB 1L0VB 1NYRA 3ZYYX 3AE7B 2JQRB 2PKOA 3W9CB 4YTNB 2WU2B 3AEFB 5G5GA 1AYFA 1FFVA 1PUTA 4KX6B 4N59A 2MJEA 2Y5CA 1VDVA 3NVYA 4JX1C 1N63A 3W5VB 2DWQA 3VRAB 5AUKA 2K9XA 1F0ZA 1NI3A 3FAHA 2W3RA 3P63A 2G1EA 1EWYC 1B9RA 1NVID 2K5PA 4C80A 3VR8B 1SB3C 1KRHA 2PIAA 5EE0A 1I7HA 1OQRA 1WXQA 2PVGC 4YT0B 5EE1A 1WYGA 1WWTA 2M56B 3P1MA 2WDQB 3P4QB 1ZP0B 1AWDA 5GXGB 2BS2B 4ZOHC 2CU3A 1OFFA 1YQ4B 3LXFA 1FXIA 1FXAA 3HUIA 1QOAA 4N6EB 1N60A 1R7SA 1N61A 3VR9B 2W55A 1QOFA 2H89B 4ZHPA 1E10A 2B76B 1QF6A 1TKEA 1YQ3B 4US9A 1ZXIA 4JWUC 3L4PA 2EKIA 4ITKA 2WDRB 1YJIA 3W5UB 1JW9D 1QLBB 4IDIA 1E6EB 4N58A 3WCQA 2BS4B 3SFEB 4YXDB 1E0ZA 1GPXA 1FFUA 3DWGC 1V8CA 3SFDB 4FXCA 1FMAD 1XLQA 3ABVB 4LTUA 1L6UA 1FRDA 4HROA 2PVOD 2W54A 2CJOA 3AE3B 1VJKA 2KAJA 2M19A 2W3SA 1NENB 3DWMA 4WQMA 4YSYB 3SR6A 1UWMA 2WP9B 3AE5B 1E9MA 3AMZA 1J7AA 1QOGA 3PO0A 2QIEB 1OQQA 1TKYA 4HRSA 1GAQB 2WLBA 3AE6B 3NS1A 5H92C 1TKGA 3AE8B 1NYQA 2MJDA
chains in the Genus database with same CATH superfamily
4IC7B 1FM0D 5BYRA 1L5PA 2JSVX 4KIKB 5C2TB 1H8CA 4ACFA 2AQ3B 3KQ4A 3SEBA 4M00A 1LXDA 1WGGA 4HCNB 2A4ZA 4TV3A 3WA0A 4MSQB 2N1WA 2Z59B 1BMLC 3B9JA 4TUUA 3Q3JA 3ZRCA 2J53A 4ZDVA 1TS3A 4NY0A 4FLHA 4LNKA 1UUPA 4KDLB 1D5XC 5J18A 4A6QA 4ANWA 1TT5B 5G5HA 4I6PA 1SXTA 2BKRB 2LUMA 1X1MA 4WQOB 2WXRA 2D3GA 1GB1A 2QHOA 2OEDA 2C7MB 4IG7B 2WDVB 1P7EA 2EKEC 2IZVB 3ZUNA 1T0SC 1MI0A 3KYDD 1WGRA 4JIOU 1T0YA 5HKHA 2MA9B 1TS5A 3ZNZB 1B9RA 1WF9A 1EWYC 3V60A 4M02A 2PJHA 4EZJA 4RGOS 3RNBC 4WWNA 1WX8A 3VTWA 1ET9A 1P9DU 1ZP0B 4W9LA 3K9PB 4ZOHC 1YQ4B 3PZDA 2HJ1A 2J0MA 1N61A 1SE3A 3NUHB 4FADA 3IT4B 1JWUD 2HJ8A 5D3DA 5FKAC 1J0GA 2RPVA 3V3XA 3GP7A 2RDHA 3NZSA 3BVZA 3DWGC 4CHKA 5E6NA 1TBEA 1WXAA 2BWES 4R3DA 4JWUC 2RGFA 2WLBA 2X8XX 4K7UA 3N1ZC 3AE8B 4M8MA 1WGYA 2KFKA 5E6PA 4CO7A 3W1SA 3NHEB 1ESFA 4ZRQA 1LQBA 1JRPA 2JZ3B 1N5XA 2XN9C 1D5ZC 3I9V1 3Q14C 1WGKA 1TJEA 2MHJA 3O65B 1JWBD 4II3B 2RDGA 3RPFC 1ISNA 3P4RB 2LI5A 2JT4B 3MHZA 4C7ZA 4JPSA 2G4SA 2E3TA 3ECIA 4LNIA 2JYEA 4A20A 2MCNB 2K39A 1SF0A 2ZNVC 2QEJC 1F52A 3LDZE 3R66C 1ZW7A 1IPGA 4ZRKA 2ZW1A 3IAM1 1PQSA 4K3BA 4DHJB 5J17A 3PLUA 2C5LC 4GDKA 3W9CB 1YNTE 2L0TA 4QAYA 2Y5CA 4JX1C 2JRHA 4O1NA 4NAMA 2FUG1 2L0FA 1SE4A 1QILA 2Y5PA 3FAHA 1V1PB 1VRAB 3DBLI 4C00A 4MM3B 3ZJUA 2DZIA 1PGBA 4BOZB 2WDQB 5J2RA 3AU5A 4CQNA 4N6EB 2JXTA 2HE7A 4OZCA 4ZHPA 2KQSA 5HHDG 3BVMA 3X23A 1WJUA 4K7WA 2LGXA 4MGYE 1Q0WB 2N9EB 1RFAA 2MBBB 2BS4B 3CMMB 1J8CA 3MP9A 3ZXVA 3ZNHB 4L2YA 4WWPA 1WYWB 1WR1A 5LXHA 3N30A 4NPNA 4HRSA 1P0RA 3A33B 3H8HA 4JLCA 4IW0A 4EKUA 3W2DA 3NVZA 1L7YA 3Q3MC 4P6VF 2QDFA 4IWQA 1YQBA 2GOWA 4YTPB 2N0SB 3Q6BA 2ACZB 2JX5A 5H8YE 4KKIA 4FJVB 2DZJA 2V4LA 1UGJA 1WJ6A 2NPTB 4PYUA 5JXVA 4IUMB 2FE8A 2YEPB 1J7CA 2WXOA 2GBRA 2GBKA 3IFWB 3ZW3A 3ML8A 2IBIB 3AN1A 1Y8RC 2CJNA 2FCNA 1F77A 1TY2A 4FJZA 2C9WB 4YTMB 2KDEB 5CHFA 1N6ZA 1U4AA 4URKA 2KXJA 1K53A 1B1ZA 4P16A 2INNE 5IA7A 3LB8C 2KLCA 3L16A 5C3JB 4AJWA 2WXHA 4P1CC 1UZXB 4GXBA 3BYTB 2IO1B 3SDLC 3A9JA 3WANA 2NBWB 3DDCB 3KWVA 3VRAB 5AUKA 2G1EA 1ZDVA 1KRHA 4W9IA 3BK1A 2LJ5A 3L10B 2M56B 1K52A 3PT2B 4IM3A 4KGTA 3MC0B 3K9OB 3URYA 3H6NA 4FHKA 4LLGM 4EOYA 1E8YA 2EKIA 4ASWC 2WDRB 2MBEA 3Q8CA 3PGEA 1FFUA 4FXCA 4LTUA 2M0AA 1V5TA 1XD3B 2NTSA 1GB4A 4ANUA 4MGIE 5H92C 2BBCA 2JUOA 3QHTA 1ACCA 4RNAA 2WNMA 1NDDA 2INCC 3DCGA 2JZZA 1WM3A 4DQOC 2C7HA 2ZNVB 2M17A 4JGHB 1ZUD2 1H4RA 5AZFA 3QARA 3M3JA 5IOIA 1IP9A 2DNFA 1WGHA 4A3PA 3EFCA 2JU6X 3UQAA 2LVQA 3AEEB 4KSKC 3SU8X 3ZKJC 2IO0B 1JROA 5JHAA 3A9KA 2PPHA 4MACA 4M8NA 1WY8A 2LXCA 4BKSD 4W9FA 3AV8A 3T3NA 4WJNA 3LYYA 3R7RA 4RCOA 4KKJA 2ZPNA 3KW5B 5C1ZA 1AN8A 4C4VA 1C3TA 2KTRA 4AJYB 3L54A 2KVRA 4DK5A 2MBOA 1JWMD 1ENFA 4AOFA 4GOCA 2LGIA 3FKYA 1I35A 3VDZA 2BPSA 2KN5A 2NCNA 4HJGE 2MX2A 3VXWA 4A90A 1C4PA 3RN9C 1WMHA 1Q5WB 1R7SA 3TMPB 1D6EC 2I1JA 4HDOA 4ITKA 1JW9D 4ZYNA 3IG3A 1C77A 1SBBB 2KNBA 1FPYA 1QOGA 4AQ7A 4WJPA 3TEYA 5BMIA 1T5XD 2J4XA 2J52A 2IYDB 3TCAA 3AEAB 2N9XA 4LDTB 2D5GA 2C60A 3BVGA 3M63B 4NNJB 2MJ3A 2V1YA 4GLSC 2MH7A 2MQJA 2QJLA 1I42A 4L1BA 4TMAB 2V3PA 3V6EB 3QWZB 4H2AA 3DHIC 3ZXRA 1EF5A 4RFBA 4WH4A 1XT9B 3L17A 2BB6A 1DOYA 3NG0A 2O2VA 4K3CA 1PGXA 1E7VA 1KFYB 2Z0EB 2BW2A 4GB9A 2K6DB 3NZUA 1QT9A 2EMSA 1UBIA 4YL8A 2WU5B 1GC6A 3AE7B 1AYFA 4KX6B 2KMAA 1N63A 4MDKE 4HPLB 1SJHD 2QILA 1M4VA 1SGHA 2K5PA 2PMVA 5EE0A 4HCPB 4YT0B 1WWTA 2TSSA 4XC2A 2NVUI 1WZ0A 2V3SA 1AWDA 3PV1A 2FUHB 1WH3A 1V1OA 3TEWA 2GBMA 2KK8A 2WXQA 4RM9A 2W55A 1WE6A 1YN5A 3B0AA 2NR2A 5JHBA 1XEEA 2MRPA 4IWPA 3WAMA 2IPKD 4MJSA 4YXDB 2KACA 4EZKA 1IBXB 3QCAA 4TSSA 1I4PA 2PVOD 2W54A 3RZFA 3HHMA 1T0RC 3RCZA 2XBBC 2MSED 3P4SB 5EE9A 2DAFA 2XNAC 1E8WA 4MGKE 4HDQA 2KHWB 2WGSA 2BYEA 4WWOA 3JSVA 3Q69A 4KDIC 3QA8A 3H9DA 3SFEB 4WWMA 1OQYA 3PTFC 1I4GA 2PE9A 2L52A 1YJJA 5IAAC 1OTRB 1JRUA 3ZTCA 2M1MA 2L83A 3AE1B 2ICIA 2YVCA 4RF0A 2LVOA 5G55A 4LJOB 3A1QA 2BGFA 2RDBC 3TBLD 1I4QA 4OVZA 2PE6B 2R2QA 1SEBD 1KF6B 1WI0A 2NBVB 4HPPA 3A4SC 5DPRA 5EE3A 1CMXB 1XLNA 2NTTA 4OHJA 4KGSA 2I38A 2KQ7A 3W1YA 4W9CA 2BYFA 1YN3A 1HEZE 2WU2B 3AEFB 1F2RI 3WAPA 2YEPF 3KLSX 1S3SG 1QQRA 1V49A 1WXVA 1FNVA 1R4MB 1KTKA 2WXIA 3L0WB 3RULA 4JL9A 1V86A 3DBLB 5L95C 4DDID 5CX3A 3NS8A 1TKEA 3IVFA 3PRMB 4HK2A 3L4PA 1V5OA 2KJHB 3W5UB 3WCQA 3DOWA 2CHZA 2J0KA 3SFDB 1FMAD 2MEKA 2D07B 3MJ5A 3M95A 1Z2MA 4YSYB 3AMZA 1J7AA 4WJOA 1L0YB 1TY0A 4W9KA 2KDIA 1TKGA 2GBNA 2D11A 2GBJA 2FIFA 3OAWA 4REZA 4NJ7A 2ONQA 2OHFA 1J7BA 2J0JA 4IWOA 1UF0A 3AE9B 2IJ0A 1QOBA 3C19A 2KD0A 3EC8A 5AZHA 1WZ3A 1YJ1A 1EU3A 1GG3A 3EFUA 5IP4D 1FIQA 3KWLA 5FR3A 2KJ6A 1XF5L 2EMTA 2AX5A 1WXMA 3AE2B 3QQ8B 2AQ2B 4DWFA 3M62B 2N4FA 4KGRA 3V6CB 4HPMB 2HTHA 1JWAD 1F9JA 3AE4B 1QZEA 2SEBD 1L2NA 1FEHA 1SIJA 2ZVOA 3CSFA 3KVFB 4A3OA 4ZYSA 3TSSA 3ALBA 4X57B 2NS5A 3KH0A 2L8JA 4LNOA 3GOEA 3ZO5B 3QIJA 2PIAA 1UELA 1WXQA 2B3AA 2RMMA 1BUIC 2O6VA 1V80A 4FBJB 2KKCA 3OWEB 4HWIB 5G2NA 3NY5A 4GDLA 1HTQA 1QOFA 2JWZA 3UGBB 4B95A 2CU1A 4NAWA 1K50A 2CHWA 3QC8B 4GMVA 1R4MI 1UH6A 1Y56A 2KANA 2LASA 4FHJA 2D3BA 4G0NB 2W3SA 2QCZA 2V0GA 1SE9A 1TKYA 2DYBA 5CHWA 4RM8A 3ZJVA 1KH0A 2JPHA 2ZJDA 2MJDA 3PZ8A 1ZKHA 1FNUA 4A9AA 3ZNID 3KYCD 5FR6A 4KIKA 3BIID 3RNCC 3RNFC 3ZGZA 1FO4A 2DHZA 2WXJA 4L23A 3VQIA 3ZVVA 3L13A 4E3CA 4HVBA 4PT5A 2LXAA 1RFKA 3AB5A 2AEHA 2KT7A 4P7IA 4WAFA 4W9GA 2H88B 4OZAA 2L76A 3P4PB 4LDTD 5KHOA 3O13A 3N32A 1V2YA 3EUB2 3ZDMC 4DXAB 1NBFC 3B2FA 2BQQA 3AECB 1VZ8A 4NJ6A 2PLPA 1YX6B 3KUCB 4YTNB 5G5GA 3R7QA 2QSDA 4N59A 2DZKA 3IXSA 4BZAA 3W5VB 3PLVA 3CSTA 4ARCA 2HDEA 1C9FA 2NBUA 5C23A 2BYTA 2AL6A 3VAWA 1EU4A 1SB3C 3LJ3A 2ZEQA 3DBSA 3RI7C 3TIXA 3RT3B 3P4QB 3IBEA 1IGDA 1FXAA 3VHTC 5GMVA 1SJED 4E71A 2MW5A 4US9A 2K3UA 1V81A 1ZXIA 4G50A 4FULA 2RD0A 3U4EG 2R61A 3V05A 3FILB 4YWGG 1FD6A 2LHDA 1SE2A 3AE3B 1MPEA 2N9KA 1TIFA 3AE5B 1F2RC 4IM2A 1GNUA 2JXXA 4LNFA 1MVKA 2PW9A 4K1RB 2K8CA 3DPDA 2IY0B 5DPWA 2KYWA 4GSWA 2XK5A 2JYTA 4DXFA 2C7NB 2YLMA 4N9F4 3H7PB 4F7ZA 2LZ6A 2WDTB 2KWDA 1RYJA 3VH4B 1K51A 5AUIA 5D6JB 2KQ4X 2M8SA 2MLBA 5CTRC 2MP2B 1XO3A 5CHVC 2I1KA 1EO6A 2MWSB 4PK1A 1ZOYB 3R3MA 4G3XB 3AEBB 2D2QA 2L00B 1C4AA 1WRDB 1TZOA 1KJTA 5BO4B 4G11A 4KZCA 1HZ5A 2WXFA 2K0PA 2AL3A 4GU2A 4MM3A 5D7GA 4P1BC 4PS7A 2N7DA 4DBGA 3BYYB 3ZTDA 2IGHA 5D3IB 2KVZA 4JE3B 3I57A 3DBRB 3RNGC 4EE2A 1XQQA 2BB5A 4N58A 2DLBA 2AWTA 2ASQA 3OJ3A 1JCKB 5HI1A 4DHZB 2M19A 4M0WB 1TZ1A 1UWMA 2CHXA 3A4RA 4NQLB 1GAQB 1E90A 3IHPC 3NRZA 3E56A 2M4NA 1D4BA 2WWZA 1DYQA 1YX5B 4ZRJA 3A1QB 4XZ4A 4HJKA 1HXYD 1L4ZB 2LHEA 1GOZA 1STEA 1ZE3D 2G3QB 2IDYA 3PVLA 2KN4A 4BAXA 3AULA 2J7QB 4C7YA 3P42A 3APCA 1CQVA 4DXGA 2IO3B 4E74A 3DVGY 1YD8U 2REXA 3TUOA 1ZGUB 3UIOB 2Y3AA 1V6EA 3HM6X 5MPOA 5LNK1 3HK0A 3H1UA 3VVWB 2WS3B 5IN7A 2K22A 5IKCM 2BS3B 2ZPYA 1RLFA 3I5JC 3GB1A 1J19A 4RMAA 3Q3FA 3NVYA 2PEAA 4LJPB 1VCBA 1NI3A 2INDC 5BMHA 5BMGA 3UI3A 1A5RA 5AEKB 3WALA 4II2B 4EFOA 3HIZA 3D32A 2L1AA 3HUIA 2JWUA 4S0RA 2B76B 3DVNV 2G45B 3B08A 3U2SC 2MBQA 1G6JA 1QLBB 2KX0A 2X38A 4XDDA 4BKGA 2W82A 2KMCA 2D3AA 4HROA 4WQMA 1LGRA 2V9HA 1C1YB 3DBRI 2WXNA 4OW0A 2DBYA 3N20C 1FRRA 2KFKB 5AZGA 2L05A 1L6VA 2RSUA 4BOSC 3TL5A 1TYGB 2LVPA 1R4NB 1KLUD 4IOIE 2LEKA 3U7ZA 5DPSA 4HLEA 2KLGA 3T9LA 2LD9A 3V61A 4EEWA 3WAOA 5EDSA 1E7PB 4ZRPA 3DHHC 5JZEB 1ZPSA 1AARA 1JMLA 2WQYB 3PPAA 3GE8C 4RH6A 3ZNGC 1PFDA 3UIPB 1Q1OA 3N3KB 1PDXA 1LO5D 4MSMB 2UU7A 3MFGA 2I2YA 1YIWA 1D5MC 2GRIA 2LGYA 2N9PC 4ICUA 3N1YC 3Q8AA 3Q8EA 4GIVA 3PHWB 3HVDA 1QKZA 4USAA 3KUZA 4B0MA 4GDKB 2JQRB 2PKOA 3N9YC 3JYUA 4JQWC 1FFVA 4RGNA 2XEWA 1HQRD 2VRRB 4GGQA 2K9XA 3BZDB 3OLMD 3PZ7A 1E8XA 3UINB 3VR8B 3JVZX 3BWUD 5EE1A 1WYGA 1VR9A 2W9NA 3AXCA 3U8ZA 5GXGB 1WX9A 1NI2A 2VH2A 4NZLB 1T0QC 1UD7A 4AP4C 1YQ3B 1JWSD 1YN4A 1ZXHA 1WFYA 4IDIA 1VZ7A 3ABVB 4FA6A 4BBNC 1L6UA 1VZ6A 3ZQ4A 2CJOA 1WJ4A 1NENB 1WSPA 2LJIA 2M0XA 3PO0A 2QIEB 2D10A 2WX0A 2BT6A 5E6OA 2QMTA 1BT0A 2WXPA 3E9SA 4OZBA 4ANXA 2LMCA 1FCCC 3AH7A 4ZRIA 2KMMA 1HA5A 4A55A 2WYQA 1C4CA 3B2GA 3DVGX 5L83A 4PS3A 3HRDD 3RNAC 2BKFA 1C76A 1IYFA 4TQ0A 3R8BA 4WJQA 1GUAB 2OJRA 1JALA 2IO2B 2ZCBA 5E6JA 1SIFA 1R4NI 3I3TB 3HM3A 1XCQL 3V62A 2N1VA 3IAS1 1P1AA 4MT5A 1FNWA 3OG5A 5I4DA 1EWCA 1EUVB 1EM7A 3ZDTA 5HG2A 1WIAA 2FAZA 3H7SA 1HE8A 1IGCA 4DHZE 4MH0E 3DBHB 3ZJTA 2ZCCA 3A9JB 3U52E 2D3CA 1WX7A 3L08A 1M94A 2PVGC 3AI5A 2KOXA 3ZRFA 1WM2A 2BS2B 4NQKE 3ONSA 3EECA 3DVNU 2KDBA 4K7SA 2XK5B 1E6EB 1IBXA 4MEMA 1XLQA 2KC1A 4XDCA 5FK9C 1VJKA 2KAJA 4MELA 3UF8A 4LCDE 1TS2A 3MTNB 4W9HA 4HXDA 2ZVNA 5BYQA 4AUQC 4C56C 1C79A 4XWTA 1CJEA 3GE3C 1KLGD 1D3ZA 2LRUA 3DQVA 3HVZA 3BY4B 5D94A 1IUEA 1C78A 2A5UA 1DOIA 4RGMA 1T6BX 2MBHA 2KDFB 4YSZB 3A9KB 5JH5C 1HTOA 3TJPA 2L7RA 3SHQA 4F1SA 4WAAA 4B9KA 4UDUC 1JQ4A 4D2KA 3Q8FA 2JVCA 4BKSA 2BWFA 3FC4A 1BXTA 3C0RB 4C4VB 1VDVA 2KTRB 2DWQA 4KV2A 2FIDA 4FJYA 3TEZA 2Y5BB 1F0ZA 3B1LX 3OJ4B 1WJNA 2V4IB 2ZW0A 3T3OA 3P1MA 2KDMA 1P98A 3DBHI 3VUWA 2SAKA 1QOAA 1WMHB 3VR9B 2CKHB 2N7JA 1QF6A 2BF8B 4HKZE 3CF6E 2CS4A 3QAQA 2ON8A 4ARIA 3NJTA 1WR6E 2KC2A 1WGDA 1SSNA 3DWMA 2LWPA 1E9MA 1OEYA 3GZNB 4CYEA 2Z0DB 1CZPA 1N62A 4LNNA 2V3NA 1N5WA 4I6LB 2JY6A 1L0XB 5IO9A 2K25A 2LFIA 3Q8BA 4BVUC 1RWSA 4B6WA 1E7UA 4HKQA 1GJZA 3PS6A 5DPTA 4I6NB 3AM9A 1UGMA 4W9EA 1Z5SB 2DENB 3VUYA 4PYZA 3QJZA 1RRBA 2WHIA 1KOTA 2WXGA 3VFKA 1P7FA 3VH3B 4XWWA 5TSSA 3APDA 3NZ3A 3CIRB 2LUEA 2RR9A 2KWCA 2IY1B 3KUDB 1CK1A 3CWIA 4JWSC 3P2BA 2O2VB 3Q3OC 4PS8A 1DGJA 4Q2JA 4OVUA 1L4DB 1MG8A 2K8HA 3J9CA 1PUTA 2Z8LA 2PTLA 2L32A 4M01A 2O6VD 3W1SC 1NVID 1KLVA 3PHXB 3IT6B 3RFZB 4NJCA 2IGDA 3VUXA 2CU3A 2VZKD 4GN1A 1UWXA 4W9JA 1EF1A 2H89B 5DCNA 1XCTL 3BINA 5T8IA 1AW7A 3GS2A 3EA6A 4IM0A 4LK0M 4XYCA 1UBQA 1E0ZA 4MJSB 1V1PA 2N9LA 1Q10A 1K8RB 4WURA 2JRIB 3PSEB 3Q2AC 3NS1A 3X0WA 2GB1A 4J3OD 1MHXA 4K81A 2KZRA 3EHVA 4ICVA 1RM6C 2DX5B 4RF1A 1WXSA 1XLOA 3RD2A 3AEGB 3S2AA 3AEDB 2INPE 4A8XC 4AS1A 3VRBB 4KZ0A 1E8ZA 2J42A 3I63C 3MC9A 4ANVA 3GZNI 4S17A 3JSVB 3VTUA 2FBWB 2VH1A 1LFDA 3Q3NC 4ZHOA 1DOXA 1OGWA 2Q5WD 2FCSA 2WXLA 4MGZE 3R2IA 4IKGA 4W9DA 2ZZPB 2AYOB 2FCMA 2R2OA 4US8A 1FCLA 2G4DB 4TQ1A 1VLBA 1A70A 1KM7A 3QX1A 3QK0A 2NPTA 2G9HD 3VTVA 2QC8A 5TR5A 2NMQA 4KVGB 3ZLZA 2RPQA 3DHGC 1PGAA 2GLSA 4WIPA 4KSLC 1WE7A 2K6QA 1VD2A 2KTFA 5KHQA 3C8YA 1XXGA 2LRWA 3P63A 4C80A 5HFYA 2KWVB 3ENEA 1E5WA 1ZDXA 1OQRA 1UNSA 4B0EA 3BK2A 1GC7A 4BKTA 2WXMA 1OFFA 2KX3A 3LXFA 1FXIA 2FNJB 1N60A 1FXTB 2KWUB 1YMHE 1V9JA 1PYWD 3FILA 2GI9A 3MHSD 2EELA 4J6IA 1V8CA 1I4XA 1FRDA 4F8CB 3SR6A 2JZPA 2WP9B 3NOBA 1MFWA 1OQQA 2JF5A 3AE6B 2DAJA 3APFA 3SD5A 4OVVA 2BVCA 4YSXB 1TGZB 2WX1A 2WXKA 2K8BA 2KO3A 3UQBA 1WRIA 1XLPA 2K1FA 3TEXA 1HZ6A 3PREA 2HTME 4MH8A 3H7PA 3ZIMA 1TS4A 1P3QU 2KFJA 3AU4A 3N1XC 1YOVB 3WIMA 3NVVA 3RMKC 3NVWA 2FCQA 2DYMA 1I4RA 1ROEA 2HD5B 5LXIB 3RNEC 3ETRA 2N7EA 4DHJD 2MP2A 2LGSA 4EZLA 1NEKB 1V97A 1T3QA 2BTEA 5LLIA 2IGGA 4AWJA 4XGAB 1S1QB 2OOBB 3U30A 1F1HA 1TTNA 3T8MA 1L0VB 1NYRA 3ZYYX 3RZWC 2AQ1B 2MJEA 3EGRA 2LGDA 3JW0X 4EUTA 3PRZA 5BYSA 2W3RA 2DZMA 1I7HA 3RYTA 2DYOA 1ET6A 4DDGD 1MG4A 2L3ZA 2OJWA 1MHHE 1RAXA 2O6VB 3MJWA 3U7DA 2UWQA 5D2MB 4GDLB 4TKNA 1E10A 1LM8B 3R2TA 2KJRA 4NAWB 1OEYJ 2CR5A 2BYVE 1I4HA 3ML9A 2UYZB 2VZKB 1YJIA 4XX5A 3PRPB 1GPXA 1MJDA 4XE0A 3RUIB 4M0WA 4RGTA 4BFRA 3MC8A 2GMIC 4BBNF 4HEA1 4FN2A 1NYQA 2E6XA
chains in the Genus database with same CATH topology
4C56C 1MVKA 3TEYA 1C79A 1FM0D 4XWTA 2PW9A 5BYRA 1L5PA 5BMIA 1CJEA 2JSVX 1KLGD 5C2TB 1T5XD 2J4XA 2J52A 3HVZA 2JYTA 2AQ3B 3KQ4A 3SEBA 4DXFA 1IUEA 1C78A 3AEAB 1DOIA 4RGMA 1BMLC 1T6BX 2D5GA 2KWDA 3B9JA 1RYJA 3BVGA 1K51A 2MJ3A 5AUIA 4GLSC 4YSZB 2MH7A 2KQ4X 2J53A 2QJLA 1TS3A 4L1BA 1UUPA 4TMAB 1D5XC 2V3PA 4A6QA 4H2AA 5G5HA 4RFBA 1SXTA 2LUMA 4WH4A 1XO3A 2BB6A 1DOYA 2WXRA 4UDUC 1JQ4A 1GB1A 1PGXA 4D2KA 3Q8FA 2OEDA 1KFYB 2WDVB 1P7EA 2BW2A 1ZOYB 3AEBB 1QT9A 3FC4A 2WU5B 3AE7B 1MI0A 1C4AA 1BXTA 1TZOA 1AYFA 4KX6B 1VDVA 1N63A 2DWQA 3TEZA 1TS5A 1F0ZA 1HZ5A 1SJHD 2QILA 1M4VA 1B9RA 1EWYC 2WXFA 2K5PA 2K0PA 2PMVA 5EE0A 5D7GA 4RGOS 4YT0B 2V4IB 1WWTA 2TSSA 2ZW0A 3T3OA 3P1MA 1ET9A 1ZP0B 1AWDA 2KDMA 1V1OA 3BYYB 4ZOHC 1YQ4B 3TEWA 2SAKA 1QOAA 2IGHA 2WXQA 5D3IB 1N61A 4JE3B 2W55A 3VR9B 1SE3A 3NUHB 2N7JA 3IT4B 1QF6A 1YN5A 4HKZE 1JWUD 3I57A 5D3DA 5FKAC 2RPVA 1XEEA 3V3XA 3GP7A 4EE2A 2RDHA 2BB5A 2ON8A 4N58A 2DLBA 4ARIA 2IPKD 4YXDB 2KACA 3BVZA 1IBXB 3DWGC 4TSSA 1JCKB 1I4PA 5HI1A 2PVOD 2W54A 2M19A 1SSNA 3DWMA 4R3DA 1UWMA 4JWUC 1E9MA 1GAQB 2WLBA 3AE8B 3NRZA 3E56A 1CZPA 1D4BA 1N62A 2V3NA 1DYQA 1N5WA 3P4SB 3W1SA 1ESFA 4ZRQA 1JRPA 1L0XB 5EE9A 2XNAC 1HXYD 1L4ZB 2LFIA 1N5XA 2XN9C 3Q8BA 2LHEA 1RWSA 1D5ZC 1GOZA 3I9V1 3Q69A 3SFEB 4HKQA 1WGKA 1TJEA 4WWMA 1STEA 1JWBD 1I4GA 1ZE3D 2IDYA 2RDGA 2L52A 3AM9A 3RPFC 2KN4A 1YJJA 3P4RB 3MHZA 4C7YA 3P42A 4C7ZA 1CQVA 4DXGA 2WXGA 2L83A 1P7FA 2ICIA 3AE1B 4JPSA 4RF0A 2E3TA 4XWWA 5TSSA 3TUOA 3NZ3A 2JYEA 1I4QA 4OVZA 3CIRB 1SEBD 2Y3AA 1SF0A 5MPOA 1KF6B 5LNK1 2QEJC 1CK1A 3CWIA 4JWSC 2WS3B 5EE3A 2K22A 1XLNA 2ZW1A 2NTTA 3IAM1 4OHJA 4KGSA 1DGJA 2BS3B 4Q2JA 1L4DB 2I38A 1YN3A 3J9CA 1HEZE 3GB1A 3W9CB 2WU2B 1YNTE 3AEFB 1PUTA 3NVYA 1F2RI 2Y5CA 2Z8LA 4JX1C 2YEPF 4O1NA 2PTLA 4NAMA 2L32A 2FUG1 1SE4A 1NI3A 3KLSX 1QILA 2Y5PA 3FAHA 1V1PB 1VRAB 5BMHA 1NVID 1QQRA 5BMGA 3IT6B 4MM3B 1FNVA 3UI3A 3RFZB 3ZJUA 4NJCA 1PGBA 2IGDA 1KTKA 2WDQB 2WXIA 2CU3A 4CQNA 2VZKD 2L1AA 3HUIA 1UWXA 2JWUA 2JXTA 4N6EB 4OZCA 2H89B 4ZHPA 5HHDG 1XCTL 2B76B 3BVMA 1TKEA 3L4PA 5T8IA 1AW7A 3U2SC 3GS2A 3EA6A 3W5UB 4LK0M 1QLBB 3WCQA 2BS4B 2X38A 4XDDA 1E0ZA 1V1PA 3MP9A 3SFDB 1FMAD 2N9LA 2MEKA 1Q10A 2W82A 4HROA 4L2YA 4WURA 4WQMA 3MJ5A 4YSYB 3AMZA 1J7AA 4HRSA 1L0YB 1TY0A 3NS1A 2GB1A 1TKGA 4J3OD 1MHXA 2WXNA 4OW0A 3H8HA 2DBYA 1RM6C 1FRRA 4REZA 3W2DA 3NVZA 4RF1A 1XLOA 3AEGB 1L6VA 3AEDB 2INPE 2ONQA 4P6VF 4A8XC 3VRBB 4AS1A 1J7BA 2OHFA 1TYGB 2J42A 4YTPB 2N0SB 1KLUD 2ACZB 2JX5A 4IOIE 2LEKA 4KKIA 5H8YE 3AE9B 3U7ZA 2IJ0A 2FBWB 1UGJA 1QOBA 4ZHOA 1DOXA 5JXVA 2FE8A 2Q5WD 2YEPB 1J7CA 1EU3A 2WXLA 2WXOA 3R2IA 1E7PB 4IKGA 4ZRPA 1ZPSA 1FIQA 3KWLA 5FR3A 1XF5L 1JMLA 2AX5A 2WQYB 3AN1A 4US8A 1FCLA 2CJNA 1F77A 1TY2A 3AE2B 4RH6A 1PFDA 2AQ2B 4TQ1A 4KGRA 4YTMB 1PDXA 1LO5D 1VLBA 1A70A 1JWAD 3MFGA 2I2YA 1K53A 3AE4B 1D5MC 2GRIA 1B1ZA 4P16A 2SEBD 1FEHA 2NMQA 3Q8AA 3Q8EA 1SIJA 2INNE 3HVDA 1QKZA 3LB8C 4USAA 4B0MA 5C3JB 4GDKB 2JQRB 2PKOA 3TSSA 3N9YC 1PGAA 4ZYSA 2WXHA 4WIPA 1FFVA 3BYTB 4RGNA 1HQRD 3C8YA 3VRAB 3KWVA 5AUKA 2K9XA 3BZDB 1XXGA 3P63A 2G1EA 3PZ7A 4C80A 5HFYA 1ZDVA 3VR8B 1KRHA 2PIAA 3BK1A 1ZDXA 3BWUD 1OQRA 1WXQA 2RMMA 5EE1A 1WYGA 1UNSA 2M56B 4B0EA 1BUIC 1VR9A 1K52A 3BK2A 4KGTA 5GXGB 3OWEB 2WXMA 1OFFA 3LXFA 3MC0B 1FXIA 4NZLB 1N60A 3URYA 1QOFA 4LLGM 1YQ3B 1K50A 1YMHE 2EKIA 1JWSD 1YN4A 2WDRB 1ZXHA 1Y56A 4IDIA 3Q8CA 1PYWD 3FILA 2GI9A 2EELA 1FFUA 1V8CA 1I4XA 1VZ7A 4FXCA 3ABVB 4LTUA 1L6UA 1VZ6A 1FRDA 3ZQ4A 2CJOA 2M0AA 2W3SA 1NENB 2V0GA 1WSPA 2NTSA 1GB4A 2LJIA 3SR6A 2JZPA 2WP9B 4A55A 3PO0A 2QIEB 1OQQA 1TKYA 2BBCA 5H92C 3AE6B 3ZJVA 1KH0A 2MJDA 3PZ8A 2BT6A 1FNUA 4A9AA 2QMTA 4YSXB 2WXPA 3E9SA 1ACCA 4OZBA 4RNAA 2WXKA 2WNMA 3BIID 2LMCA 1FCCC 4DQOC 1WRIA 3AH7A 2KMMA 3ZGZA 1FO4A 1HA5A 1XLPA 1ZUD2 2WXJA 4L23A 3TEXA 1HZ6A 1C4CA 3B2GA 2HTME 4MH8A 3VQIA 3HRDD 1C76A 1TS4A 4PT5A 3R8BA 4TQ0A 1RFKA 1JALA 3AB5A 2JU6X 5E6JA 3NVVA 3AEEB 1JROA 4WAFA 1XCQL 4MACA 2H88B 3NVWA 4OZAA 2DYMA 1I4RA 3P4PB 1ROEA 3IAS1 4MT5A 3O13A 1FNWA 3ETRA 5I4DA 3AV8A 3T3NA 1NEKB 1V97A 1EWCA 3LYYA 1T3QA 3EUB2 4RCOA 2BTEA 2IGGA 4KKJA 1EM7A 3B2FA 3AECB 1AN8A 1VZ8A 5HG2A 2PLPA 1L0VB 1NYRA 3ZYYX 4YTNB 5G5GA 2QSDA 1IGCA 2AQ1B 4N59A 2MJEA 3EGRA 3IXSA 3ZJTA 3W5VB 5BYSA 4ARCA 2HDEA 1C9FA 1JWMD 2W3RA 3U52E 1ENFA 2BYTA 1EU4A 1SB3C 1I7HA 2LGIA 2PVGC 2DYOA 1ET6A 3P4QB 1MHHE 4HJGE 1IGDA 2BS2B 4A90A 1C4PA 1FXAA 1SJED 1R7SA 4GDLB 1E10A 3R2TA 1D6EC 4NAWB 4US9A 2K3UA 1ZXIA 1I4HA 4ITKA 2VZKB 1YJIA 3U4EG 1JW9D 2R61A 1E6EB 1IBXA 3V05A 3FILB 4YWGG 1FD6A 1GPXA 4XE0A 1XLQA 1C77A 1SBBB 2LHDA 4M0WA 4XDCA 1SE2A 3AE3B 1VJKA 2KAJA 4RGTA 1MPEA 5FK9C 2N9KA 3AE5B 1TS2A 1QOGA 4AQ7A 4HEA1 1F2RC 2G9HD 1NYQA 2E6XA 5BYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRZ A;  1CZP A;  2BT6 A;  4A9A A;  2DBY A;  1N62 A;  4YSX B;  1FM0 D;  1RM6 C;  1L5P A;  1FRR A;  1CJE A;  5C2T B;  1N5W A;  3BII D;  3NVZ A;  3P4S B;  1XLO A;  3AEG B;  1L6V A;  1JRP A;  3AED B;  1WRI A;  3AH7 A;  3HVZ A;  4P6V F;  2KMM A;  5EE9 A;  3VRB B;  1FO4 A;  1J7B A;  1N5X A;  2OHF A;  1TYG B;  1XLP A;  1RWS A;  1ZUD 2;  4YTP B;  2N0S B;  1IUE A;  3B2G A;  2HTM E;  2ACZ B;  2JX5 A;  1WGK A;  2LEK A;  1TJE A;  3AEA B;  3AE9 B;  3HRD D;  4WWM A;  5H8Y E;  2FBW B;  1JWB D;  1QOB A;  1DOI A;  2L52 A;  3AM9 A;  4ZHO A;  1DOX A;  3RPF C;  1RFK A;  3B9J A;  1RYJ A;  1YJJ A;  1JAL A;  2Q5W D;  1J7C A;  3P4R B;  3AB5 A;  2MJ3 A;  5AUI A;  1E7P B;  4C7Y A;  4YSZ B;  2MH7 A;  4C7Z A;  1FIQ A;  3NVV A;  2QJL A;  3AEE B;  3KWL A;  1JRO A;  2L83 A;  3AE1 B;  2E3T A;  2H88 B;  3AN1 A;  2AX5 A;  2WQY B;  3NVW A;  4US8 A;  2CJN A;  3P4P B;  1ROE A;  3AE2 B;  3CIR B;  5G5H A;  1PFD A;  3ETR A;  1SF0 A;  5MPO A;  1KF6 B;  4YTM B;  1PDX A;  1XO3 A;  3AV8 A;  3CWI A;  1DOY A;  1VLB A;  1A70 A;  1NEK B;  1JWA D;  1V97 A;  2WS3 B;  4JWS C;  1JQ4 A;  5EE3 A;  1T3Q A;  1XLN A;  1KFY B;  2K22 A;  3AE4 B;  2WDV B;  3EUB 2;  1ZOY B;  1DGJ A;  1SIJ A;  2BS3 B;  3AEC B;  3B2F A;  4USA A;  3AEB B;  1QT9 A;  3FC4 A;  3LB8 C;  2WU5 B;  5C3J B;  1L0V B;  1NYR A;  3ZYY X;  3AE7 B;  2JQR B;  2PKO A;  3W9C B;  4YTN B;  2WU2 B;  3AEF B;  5G5G A;  1AYF A;  1FFV A;  1PUT A;  4KX6 B;  4N59 A;  2MJE A;  2Y5C A;  1VDV A;  3NVY A;  4JX1 C;  1N63 A;  3W5V B;  2DWQ A;  3VRA B;  5AUK A;  2K9X A;  1F0Z A;  1NI3 A;  3FAH A;  2W3R A;  3P63 A;  2G1E A;  1EWY C;  1B9R A;  1NVI D;  2K5P A;  4C80 A;  3VR8 B;  1SB3 C;  1KRH A;  2PIA A;  5EE0 A;  1I7H A;  1OQR A;  1WXQ A;  2PVG C;  4YT0 B;  5EE1 A;  1WYG A;  1WWT A;  2M56 B;  3P1M A;  2WDQ B;  3P4Q B;  1ZP0 B;  1AWD A;  5GXG B;  2BS2 B;  4ZOH C;  2CU3 A;  1OFF A;  1YQ4 B;  3LXF A;  1FXI A;  1FXA A;  3HUI A;  1QOA A;  4N6E B;  1N60 A;  1R7S A;  1N61 A;  3VR9 B;  2W55 A;  1QOF A;  2H89 B;  4ZHP A;  1E10 A;  2B76 B;  1QF6 A;  1TKE A;  1YQ3 B;  4US9 A;  1ZXI A;  4JWU C;  3L4P A;  2EKI A;  4ITK A;  2WDR B;  1YJI A;  3W5U B;  1JW9 D;  1QLB B;  4IDI A;  1E6E B;  4N58 A;  3WCQ A;  2BS4 B;  3SFE B;  4YXD B;  1E0Z A;  1GPX A;  1FFU A;  3DWG C;  1V8C A;  3SFD B;  4FXC A;  1FMA D;  1XLQ A;  3ABV B;  4LTU A;  1L6U A;  1FRD A;  4HRO A;  2PVO D;  2W54 A;  2CJO A;  3AE3 B;  1VJK A;  2KAJ A;  2M19 A;  2W3S A;  1NEN B;  3DWM A;  4WQM A;  4YSY B;  3SR6 A;  1UWM A;  2WP9 B;  3AE5 B;  1E9M A;  3AMZ A;  1J7A A;  1QOG A;  3PO0 A;  2QIE B;  1OQQ A;  1TKY A;  4HRS A;  1GAQ B;  2WLB A;  3AE6 B;  3NS1 A;  5H92 C;  1TKG A;  3AE8 B;  1NYQ A;  2MJD A; 
#chains in the Genus database with same CATH topology
 4IC7 B;  1FM0 D;  5BYR A;  1L5P A;  2JSV X;  4KIK B;  5C2T B;  1H8C A;  4ACF A;  2AQ3 B;  3KQ4 A;  3SEB A;  4M00 A;  1LXD A;  1WGG A;  4HCN B;  2A4Z A;  4TV3 A;  3WA0 A;  4MSQ B;  2N1W A;  2Z59 B;  1BML C;  3B9J A;  4TUU A;  3Q3J A;  3ZRC A;  2J53 A;  4ZDV A;  1TS3 A;  4NY0 A;  4FLH A;  4LNK A;  1UUP A;  4KDL B;  1D5X C;  5J18 A;  4A6Q A;  4ANW A;  1TT5 B;  5G5H A;  4I6P A;  1SXT A;  2BKR B;  2LUM A;  1X1M A;  4WQO B;  2WXR A;  2D3G A;  1GB1 A;  2QHO A;  2OED A;  2C7M B;  4IG7 B;  2WDV B;  1P7E A;  2EKE C;  2IZV B;  3ZUN A;  1T0S C;  1MI0 A;  3KYD D;  1WGR A;  4JIO U;  1T0Y A;  5HKH A;  2MA9 B;  1TS5 A;  3ZNZ B;  1B9R A;  1WF9 A;  1EWY C;  3V60 A;  4M02 A;  2PJH A;  4EZJ A;  4RGO S;  3RNB C;  4WWN A;  1WX8 A;  3VTW A;  1ET9 A;  1P9D U;  1ZP0 B;  4W9L A;  3K9P B;  4ZOH C;  1YQ4 B;  3PZD A;  2HJ1 A;  2J0M A;  1N61 A;  1SE3 A;  3NUH B;  4FAD A;  3IT4 B;  1JWU D;  2HJ8 A;  5D3D A;  5FKA C;  1J0G A;  2RPV A;  3V3X A;  3GP7 A;  2RDH A;  3NZS A;  3BVZ A;  3DWG C;  4CHK A;  5E6N A;  1TBE A;  1WXA A;  2BWE S;  4R3D A;  4JWU C;  2RGF A;  2WLB A;  2X8X X;  4K7U A;  3N1Z C;  3AE8 B;  4M8M A;  1WGY A;  2KFK A;  5E6P A;  4CO7 A;  3W1S A;  3NHE B;  1ESF A;  4ZRQ A;  1LQB A;  1JRP A;  2JZ3 B;  1N5X A;  2XN9 C;  1D5Z C;  3I9V 1;  3Q14 C;  1WGK A;  1TJE A;  2MHJ A;  3O65 B;  1JWB D;  4II3 B;  2RDG A;  3RPF C;  1ISN A;  3P4R B;  2LI5 A;  2JT4 B;  3MHZ A;  4C7Z A;  4JPS A;  2G4S A;  2E3T A;  3ECI A;  4LNI A;  2JYE A;  4A20 A;  2MCN B;  2K39 A;  1SF0 A;  2ZNV C;  2QEJ C;  1F52 A;  3LDZ E;  3R66 C;  1ZW7 A;  1IPG A;  4ZRK A;  2ZW1 A;  3IAM 1;  1PQS A;  4K3B A;  4DHJ B;  5J17 A;  3PLU A;  2C5L C;  4GDK A;  3W9C B;  1YNT E;  2L0T A;  4QAY A;  2Y5C A;  4JX1 C;  2JRH A;  4O1N A;  4NAM A;  2FUG 1;  2L0F A;  1SE4 A;  1QIL A;  2Y5P A;  3FAH A;  1V1P B;  1VRA B;  3DBL I;  4C00 A;  4MM3 B;  3ZJU A;  2DZI A;  1PGB A;  4BOZ B;  2WDQ B;  5J2R A;  3AU5 A;  4CQN A;  4N6E B;  2JXT A;  2HE7 A;  4OZC A;  4ZHP A;  2KQS A;  5HHD G;  3BVM A;  3X23 A;  1WJU A;  4K7W A;  2LGX A;  4MGY E;  1Q0W B;  2N9E B;  1RFA A;  2MBB B;  2BS4 B;  3CMM B;  1J8C A;  3MP9 A;  3ZXV A;  3ZNH B;  4L2Y A;  4WWP A;  1WYW B;  1WR1 A;  5LXH A;  3N30 A;  4NPN A;  4HRS A;  1P0R A;  3A33 B;  3H8H A;  4JLC A;  4IW0 A;  4EKU A;  3W2D A;  3NVZ A;  1L7Y A;  3Q3M C;  4P6V F;  2QDF A;  4IWQ A;  1YQB A;  2GOW A;  4YTP B;  2N0S B;  3Q6B A;  2ACZ B;  2JX5 A;  5H8Y E;  4KKI A;  4FJV B;  2DZJ A;  2V4L A;  1UGJ A;  1WJ6 A;  2NPT B;  4PYU A;  5JXV A;  4IUM B;  2FE8 A;  2YEP B;  1J7C A;  2WXO A;  2GBR A;  2GBK A;  3IFW B;  3ZW3 A;  3ML8 A;  2IBI B;  3AN1 A;  1Y8R C;  2CJN A;  2FCN A;  1F77 A;  1TY2 A;  4FJZ A;  2C9W B;  4YTM B;  2KDE B;  5CHF A;  1N6Z A;  1U4A A;  4URK A;  2KXJ A;  1K53 A;  1B1Z A;  4P16 A;  2INN E;  5IA7 A;  3LB8 C;  2KLC A;  3L16 A;  5C3J B;  4AJW A;  2WXH A;  4P1C C;  1UZX B;  4GXB A;  3BYT B;  2IO1 B;  3SDL C;  3A9J A;  3WAN A;  2NBW B;  3DDC B;  3KWV A;  3VRA B;  5AUK A;  2G1E A;  1ZDV A;  1KRH A;  4W9I A;  3BK1 A;  2LJ5 A;  3L10 B;  2M56 B;  1K52 A;  3PT2 B;  4IM3 A;  4KGT A;  3MC0 B;  3K9O B;  3URY A;  3H6N A;  4FHK A;  4LLG M;  4EOY A;  1E8Y A;  2EKI A;  4ASW C;  2WDR B;  2MBE A;  3Q8C A;  3PGE A;  1FFU A;  4FXC A;  4LTU A;  2M0A A;  1V5T A;  1XD3 B;  2NTS A;  1GB4 A;  4ANU A;  4MGI E;  5H92 C;  2BBC A;  2JUO A;  3QHT A;  1ACC A;  4RNA A;  2WNM A;  1NDD A;  2INC C;  3DCG A;  2JZZ A;  1WM3 A;  4DQO C;  2C7H A;  2ZNV B;  2M17 A;  4JGH B;  1ZUD 2;  1H4R A;  5AZF A;  3QAR A;  3M3J A;  5IOI A;  1IP9 A;  2DNF A;  1WGH A;  4A3P A;  3EFC A;  2JU6 X;  3UQA A;  2LVQ A;  3AEE B;  4KSK C;  3SU8 X;  3ZKJ C;  2IO0 B;  1JRO A;  5JHA A;  3A9K A;  2PPH A;  4MAC A;  4M8N A;  1WY8 A;  2LXC A;  4BKS D;  4W9F A;  3AV8 A;  3T3N A;  4WJN A;  3LYY A;  3R7R A;  4RCO A;  4KKJ A;  2ZPN A;  3KW5 B;  5C1Z A;  1AN8 A;  4C4V A;  1C3T A;  2KTR A;  4AJY B;  3L54 A;  2KVR A;  4DK5 A;  2MBO A;  1JWM D;  1ENF A;  4AOF A;  4GOC A;  2LGI A;  3FKY A;  1I35 A;  3VDZ A;  2BPS A;  2KN5 A;  2NCN A;  4HJG E;  2MX2 A;  3VXW A;  4A90 A;  1C4P A;  3RN9 C;  1WMH A;  1Q5W B;  1R7S A;  3TMP B;  1D6E C;  2I1J A;  4HDO A;  4ITK A;  1JW9 D;  4ZYN A;  3IG3 A;  1C77 A;  1SBB B;  2KNB A;  1FPY A;  1QOG A;  4AQ7 A;  4WJP A;  3TEY A;  5BMI A;  1T5X D;  2J4X A;  2J52 A;  2IYD B;  3TCA A;  3AEA B;  2N9X A;  4LDT B;  2D5G A;  2C60 A;  3BVG A;  3M63 B;  4NNJ B;  2MJ3 A;  2V1Y A;  4GLS C;  2MH7 A;  2MQJ A;  2QJL A;  1I42 A;  4L1B A;  4TMA B;  2V3P A;  3V6E B;  3QWZ B;  4H2A A;  3DHI C;  3ZXR A;  1EF5 A;  4RFB A;  4WH4 A;  1XT9 B;  3L17 A;  2BB6 A;  1DOY A;  3NG0 A;  2O2V A;  4K3C A;  1PGX A;  1E7V A;  1KFY B;  2Z0E B;  2BW2 A;  4GB9 A;  2K6D B;  3NZU A;  1QT9 A;  2EMS A;  1UBI A;  4YL8 A;  2WU5 B;  1GC6 A;  3AE7 B;  1AYF A;  4KX6 B;  2KMA A;  1N63 A;  4MDK E;  4HPL B;  1SJH D;  2QIL A;  1M4V A;  1SGH A;  2K5P A;  2PMV A;  5EE0 A;  4HCP B;  4YT0 B;  1WWT A;  2TSS A;  4XC2 A;  2NVU I;  1WZ0 A;  2V3S A;  1AWD A;  3PV1 A;  2FUH B;  1WH3 A;  1V1O A;  3TEW A;  2GBM A;  2KK8 A;  2WXQ A;  4RM9 A;  2W55 A;  1WE6 A;  1YN5 A;  3B0A A;  2NR2 A;  5JHB A;  1XEE A;  2MRP A;  4IWP A;  3WAM A;  2IPK D;  4MJS A;  4YXD B;  2KAC A;  4EZK A;  1IBX B;  3QCA A;  4TSS A;  1I4P A;  2PVO D;  2W54 A;  3RZF A;  3HHM A;  1T0R C;  3RCZ A;  2XBB C;  2MSE D;  3P4S B;  5EE9 A;  2DAF A;  2XNA C;  1E8W A;  4MGK E;  4HDQ A;  2KHW B;  2WGS A;  2BYE A;  4WWO A;  3JSV A;  3Q69 A;  4KDI C;  3QA8 A;  3H9D A;  3SFE B;  4WWM A;  1OQY A;  3PTF C;  1I4G A;  2PE9 A;  2L52 A;  1YJJ A;  5IAA C;  1OTR B;  1JRU A;  3ZTC A;  2M1M A;  2L83 A;  3AE1 B;  2ICI A;  2YVC A;  4RF0 A;  2LVO A;  5G55 A;  4LJO B;  3A1Q A;  2BGF A;  2RDB C;  3TBL D;  1I4Q A;  4OVZ A;  2PE6 B;  2R2Q A;  1SEB D;  1KF6 B;  1WI0 A;  2NBV B;  4HPP A;  3A4S C;  5DPR A;  5EE3 A;  1CMX B;  1XLN A;  2NTT A;  4OHJ A;  4KGS A;  2I38 A;  2KQ7 A;  3W1Y A;  4W9C A;  2BYF A;  1YN3 A;  1HEZ E;  2WU2 B;  3AEF B;  1F2R I;  3WAP A;  2YEP F;  3KLS X;  1S3S G;  1QQR A;  1V49 A;  1WXV A;  1FNV A;  1R4M B;  1KTK A;  2WXI A;  3L0W B;  3RUL A;  4JL9 A;  1V86 A;  3DBL B;  5L95 C;  4DDI D;  5CX3 A;  3NS8 A;  1TKE A;  3IVF A;  3PRM B;  4HK2 A;  3L4P A;  1V5O A;  2KJH B;  3W5U B;  3WCQ A;  3DOW A;  2CHZ A;  2J0K A;  3SFD B;  1FMA D;  2MEK A;  2D07 B;  3MJ5 A;  3M95 A;  1Z2M A;  4YSY B;  3AMZ A;  1J7A A;  4WJO A;  1L0Y B;  1TY0 A;  4W9K A;  2KDI A;  1TKG A;  2GBN A;  2D11 A;  2GBJ A;  2FIF A;  3OAW A;  4REZ A;  4NJ7 A;  2ONQ A;  2OHF A;  1J7B A;  2J0J A;  4IWO A;  1UF0 A;  3AE9 B;  2IJ0 A;  1QOB A;  3C19 A;  2KD0 A;  3EC8 A;  5AZH A;  1WZ3 A;  1YJ1 A;  1EU3 A;  1GG3 A;  3EFU A;  5IP4 D;  1FIQ A;  3KWL A;  5FR3 A;  2KJ6 A;  1XF5 L;  2EMT A;  2AX5 A;  1WXM A;  3AE2 B;  3QQ8 B;  2AQ2 B;  4DWF A;  3M62 B;  2N4F A;  4KGR A;  3V6C B;  4HPM B;  2HTH A;  1JWA D;  1F9J A;  3AE4 B;  1QZE A;  2SEB D;  1L2N A;  1FEH A;  1SIJ A;  2ZVO A;  3CSF A;  3KVF B;  4A3O A;  4ZYS A;  3TSS A;  3ALB A;  4X57 B;  2NS5 A;  3KH0 A;  2L8J A;  4LNO A;  3GOE A;  3ZO5 B;  3QIJ A;  2PIA A;  1UEL A;  1WXQ A;  2B3A A;  2RMM A;  1BUI C;  2O6V A;  1V80 A;  4FBJ B;  2KKC A;  3OWE B;  4HWI B;  5G2N A;  3NY5 A;  4GDL A;  1HTQ A;  1QOF A;  2JWZ A;  3UGB B;  4B95 A;  2CU1 A;  4NAW A;  1K50 A;  2CHW A;  3QC8 B;  4GMV A;  1R4M I;  1UH6 A;  1Y56 A;  2KAN A;  2LAS A;  4FHJ A;  2D3B A;  4G0N B;  2W3S A;  2QCZ A;  2V0G A;  1SE9 A;  1TKY A;  2DYB A;  5CHW A;  4RM8 A;  3ZJV A;  1KH0 A;  2JPH A;  2ZJD A;  2MJD A;  3PZ8 A;  1ZKH A;  1FNU A;  4A9A A;  3ZNI D;  3KYC D;  5FR6 A;  4KIK A;  3BII D;  3RNC C;  3RNF C;  3ZGZ A;  1FO4 A;  2DHZ A;  2WXJ A;  4L23 A;  3VQI A;  3ZVV A;  3L13 A;  4E3C A;  4HVB A;  4PT5 A;  2LXA A;  1RFK A;  3AB5 A;  2AEH A;  2KT7 A;  4P7I A;  4WAF A;  4W9G A;  2H88 B;  4OZA A;  2L76 A;  3P4P B;  4LDT D;  5KHO A;  3O13 A;  3N32 A;  1V2Y A;  3EUB 2;  3ZDM C;  4DXA B;  1NBF C;  3B2F A;  2BQQ A;  3AEC B;  1VZ8 A;  4NJ6 A;  2PLP A;  1YX6 B;  3KUC B;  4YTN B;  5G5G A;  3R7Q A;  2QSD A;  4N59 A;  2DZK A;  3IXS A;  4BZA A;  3W5V B;  3PLV A;  3CST A;  4ARC A;  2HDE A;  1C9F A;  2NBU A;  5C23 A;  2BYT A;  2AL6 A;  3VAW A;  1EU4 A;  1SB3 C;  3LJ3 A;  2ZEQ A;  3DBS A;  3RI7 C;  3TIX A;  3RT3 B;  3P4Q B;  3IBE A;  1IGD A;  1FXA A;  3VHT C;  5GMV A;  1SJE D;  4E71 A;  2MW5 A;  4US9 A;  2K3U A;  1V81 A;  1ZXI A;  4G50 A;  4FUL A;  2RD0 A;  3U4E G;  2R61 A;  3V05 A;  3FIL B;  4YWG G;  1FD6 A;  2LHD A;  1SE2 A;  3AE3 B;  1MPE A;  2N9K A;  1TIF A;  3AE5 B;  1F2R C;  4IM2 A;  1GNU A;  2JXX A;  4LNF A;  1MVK A;  2PW9 A;  4K1R B;  2K8C A;  3DPD A;  2IY0 B;  5DPW A;  2KYW A;  4GSW A;  2XK5 A;  2JYT A;  4DXF A;  2C7N B;  2YLM A;  4N9F 4;  3H7P B;  4F7Z A;  2LZ6 A;  2WDT B;  2KWD A;  1RYJ A;  3VH4 B;  1K51 A;  5AUI A;  5D6J B;  2KQ4 X;  2M8S A;  2MLB A;  5CTR C;  2MP2 B;  1XO3 A;  5CHV C;  2I1K A;  1EO6 A;  2MWS B;  4PK1 A;  1ZOY B;  3R3M A;  4G3X B;  3AEB B;  2D2Q A;  2L00 B;  1C4A A;  1WRD B;  1TZO A;  1KJT A;  5BO4 B;  4G11 A;  4KZC A;  1HZ5 A;  2WXF A;  2K0P A;  2AL3 A;  4GU2 A;  4MM3 A;  5D7G A;  4P1B C;  4PS7 A;  2N7D A;  4DBG A;  3BYY B;  3ZTD A;  2IGH A;  5D3I B;  2KVZ A;  4JE3 B;  3I57 A;  3DBR B;  3RNG C;  4EE2 A;  1XQQ A;  2BB5 A;  4N58 A;  2DLB A;  2AWT A;  2ASQ A;  3OJ3 A;  1JCK B;  5HI1 A;  4DHZ B;  2M19 A;  4M0W B;  1TZ1 A;  1UWM A;  2CHX A;  3A4R A;  4NQL B;  1GAQ B;  1E90 A;  3IHP C;  3NRZ A;  3E56 A;  2M4N A;  1D4B A;  2WWZ A;  1DYQ A;  1YX5 B;  4ZRJ A;  3A1Q B;  4XZ4 A;  4HJK A;  1HXY D;  1L4Z B;  2LHE A;  1GOZ A;  1STE A;  1ZE3 D;  2G3Q B;  2IDY A;  3PVL A;  2KN4 A;  4BAX A;  3AUL A;  2J7Q B;  4C7Y A;  3P42 A;  3APC A;  1CQV A;  4DXG A;  2IO3 B;  4E74 A;  3DVG Y;  1YD8 U;  2REX A;  3TUO A;  1ZGU B;  3UIO B;  2Y3A A;  1V6E A;  3HM6 X;  5MPO A;  5LNK 1;  3HK0 A;  3H1U A;  3VVW B;  2WS3 B;  5IN7 A;  2K22 A;  5IKC M;  2BS3 B;  2ZPY A;  1RLF A;  3I5J C;  3GB1 A;  1J19 A;  4RMA A;  3Q3F A;  3NVY A;  2PEA A;  4LJP B;  1VCB A;  1NI3 A;  2IND C;  5BMH A;  5BMG A;  3UI3 A;  1A5R A;  5AEK B;  3WAL A;  4II2 B;  4EFO A;  3HIZ A;  3D32 A;  2L1A A;  3HUI A;  2JWU A;  4S0R A;  2B76 B;  3DVN V;  2G45 B;  3B08 A;  3U2S C;  2MBQ A;  1G6J A;  1QLB B;  2KX0 A;  2X38 A;  4XDD A;  4BKG A;  2W82 A;  2KMC A;  2D3A A;  4HRO A;  4WQM A;  1LGR A;  2V9H A;  1C1Y B;  3DBR I;  2WXN A;  4OW0 A;  2DBY A;  3N20 C;  1FRR A;  2KFK B;  5AZG A;  2L05 A;  1L6V A;  2RSU A;  4BOS C;  3TL5 A;  1TYG B;  2LVP A;  1R4N B;  1KLU D;  4IOI E;  2LEK A;  3U7Z A;  5DPS A;  4HLE A;  2KLG A;  3T9L A;  2LD9 A;  3V61 A;  4EEW A;  3WAO A;  5EDS A;  1E7P B;  4ZRP A;  3DHH C;  5JZE B;  1ZPS A;  1AAR A;  1JML A;  2WQY B;  3PPA A;  3GE8 C;  4RH6 A;  3ZNG C;  1PFD A;  3UIP B;  1Q1O A;  3N3K B;  1PDX A;  1LO5 D;  4MSM B;  2UU7 A;  3MFG A;  2I2Y A;  1YIW A;  1D5M C;  2GRI A;  2LGY A;  2N9P C;  4ICU A;  3N1Y C;  3Q8A A;  3Q8E A;  4GIV A;  3PHW B;  3HVD A;  1QKZ A;  4USA A;  3KUZ A;  4B0M A;  4GDK B;  2JQR B;  2PKO A;  3N9Y C;  3JYU A;  4JQW C;  1FFV A;  4RGN A;  2XEW A;  1HQR D;  2VRR B;  4GGQ A;  2K9X A;  3BZD B;  3OLM D;  3PZ7 A;  1E8X A;  3UIN B;  3VR8 B;  3JVZ X;  3BWU D;  5EE1 A;  1WYG A;  1VR9 A;  2W9N A;  3AXC A;  3U8Z A;  5GXG B;  1WX9 A;  1NI2 A;  2VH2 A;  4NZL B;  1T0Q C;  1UD7 A;  4AP4 C;  1YQ3 B;  1JWS D;  1YN4 A;  1ZXH A;  1WFY A;  4IDI A;  1VZ7 A;  3ABV B;  4FA6 A;  4BBN C;  1L6U A;  1VZ6 A;  3ZQ4 A;  2CJO A;  1WJ4 A;  1NEN B;  1WSP A;  2LJI A;  2M0X A;  3PO0 A;  2QIE B;  2D10 A;  2WX0 A;  2BT6 A;  5E6O A;  2QMT A;  1BT0 A;  2WXP A;  3E9S A;  4OZB A;  4ANX A;  2LMC A;  1FCC C;  3AH7 A;  4ZRI A;  2KMM A;  1HA5 A;  4A55 A;  2WYQ A;  1C4C A;  3B2G A;  3DVG X;  5L83 A;  4PS3 A;  3HRD D;  3RNA C;  2BKF A;  1C76 A;  1IYF A;  4TQ0 A;  3R8B A;  4WJQ A;  1GUA B;  2OJR A;  1JAL A;  2IO2 B;  2ZCB A;  5E6J A;  1SIF A;  1R4N I;  3I3T B;  3HM3 A;  1XCQ L;  3V62 A;  2N1V A;  3IAS 1;  1P1A A;  4MT5 A;  1FNW A;  3OG5 A;  5I4D A;  1EWC A;  1EUV B;  1EM7 A;  3ZDT A;  5HG2 A;  1WIA A;  2FAZ A;  3H7S A;  1HE8 A;  1IGC A;  4DHZ E;  4MH0 E;  3DBH B;  3ZJT A;  2ZCC A;  3A9J B;  3U52 E;  2D3C A;  1WX7 A;  3L08 A;  1M94 A;  2PVG C;  3AI5 A;  2KOX A;  3ZRF A;  1WM2 A;  2BS2 B;  4NQK E;  3ONS A;  3EEC A;  3DVN U;  2KDB A;  4K7S A;  2XK5 B;  1E6E B;  1IBX A;  4MEM A;  1XLQ A;  2KC1 A;  4XDC A;  5FK9 C;  1VJK A;  2KAJ A;  4MEL A;  3UF8 A;  4LCD E;  1TS2 A;  3MTN B;  4W9H A;  4HXD A;  2ZVN A;  5BYQ A;  4AUQ C;  4C56 C;  1C79 A;  4XWT A;  1CJE A;  3GE3 C;  1KLG D;  1D3Z A;  2LRU A;  3DQV A;  3HVZ A;  3BY4 B;  5D94 A;  1IUE A;  1C78 A;  2A5U A;  1DOI A;  4RGM A;  1T6B X;  2MBH A;  2KDF B;  4YSZ B;  3A9K B;  5JH5 C;  1HTO A;  3TJP A;  2L7R A;  3SHQ A;  4F1S A;  4WAA A;  4B9K A;  4UDU C;  1JQ4 A;  4D2K A;  3Q8F A;  2JVC A;  4BKS A;  2BWF A;  3FC4 A;  1BXT A;  3C0R B;  4C4V B;  1VDV A;  2KTR B;  2DWQ A;  4KV2 A;  2FID A;  4FJY A;  3TEZ A;  2Y5B B;  1F0Z A;  3B1L X;  3OJ4 B;  1WJN A;  2V4I B;  2ZW0 A;  3T3O A;  3P1M A;  2KDM A;  1P98 A;  3DBH I;  3VUW A;  2SAK A;  1QOA A;  1WMH B;  3VR9 B;  2CKH B;  2N7J A;  1QF6 A;  2BF8 B;  4HKZ E;  3CF6 E;  2CS4 A;  3QAQ A;  2ON8 A;  4ARI A;  3NJT A;  1WR6 E;  2KC2 A;  1WGD A;  1SSN A;  3DWM A;  2LWP A;  1E9M A;  1OEY A;  3GZN B;  4CYE A;  2Z0D B;  1CZP A;  1N62 A;  4LNN A;  2V3N A;  1N5W A;  4I6L B;  2JY6 A;  1L0X B;  5IO9 A;  2K25 A;  2LFI A;  3Q8B A;  4BVU C;  1RWS A;  4B6W A;  1E7U A;  4HKQ A;  1GJZ A;  3PS6 A;  5DPT A;  4I6N B;  3AM9 A;  1UGM A;  4W9E A;  1Z5S B;  2DEN B;  3VUY A;  4PYZ A;  3QJZ A;  1RRB A;  2WHI A;  1KOT A;  2WXG A;  3VFK A;  1P7F A;  3VH3 B;  4XWW A;  5TSS A;  3APD A;  3NZ3 A;  3CIR B;  2LUE A;  2RR9 A;  2KWC A;  2IY1 B;  3KUD B;  1CK1 A;  3CWI A;  4JWS C;  3P2B A;  2O2V B;  3Q3O C;  4PS8 A;  1DGJ A;  4Q2J A;  4OVU A;  1L4D B;  1MG8 A;  2K8H A;  3J9C A;  1PUT A;  2Z8L A;  2PTL A;  2L32 A;  4M01 A;  2O6V D;  3W1S C;  1NVI D;  1KLV A;  3PHX B;  3IT6 B;  3RFZ B;  4NJC A;  2IGD A;  3VUX A;  2CU3 A;  2VZK D;  4GN1 A;  1UWX A;  4W9J A;  1EF1 A;  2H89 B;  5DCN A;  1XCT L;  3BIN A;  5T8I A;  1AW7 A;  3GS2 A;  3EA6 A;  4IM0 A;  4LK0 M;  4XYC A;  1UBQ A;  1E0Z A;  4MJS B;  1V1P A;  2N9L A;  1Q10 A;  1K8R B;  4WUR A;  2JRI B;  3PSE B;  3Q2A C;  3NS1 A;  3X0W A;  2GB1 A;  4J3O D;  1MHX A;  4K81 A;  2KZR A;  3EHV A;  4ICV A;  1RM6 C;  2DX5 B;  4RF1 A;  1WXS A;  1XLO A;  3RD2 A;  3AEG B;  3S2A A;  3AED B;  2INP E;  4A8X C;  4AS1 A;  3VRB B;  4KZ0 A;  1E8Z A;  2J42 A;  3I63 C;  3MC9 A;  4ANV A;  3GZN I;  4S17 A;  3JSV B;  3VTU A;  2FBW B;  2VH1 A;  1LFD A;  3Q3N C;  4ZHO A;  1DOX A;  1OGW A;  2Q5W D;  2FCS A;  2WXL A;  4MGZ E;  3R2I A;  4IKG A;  4W9D A;  2ZZP B;  2AYO B;  2FCM A;  2R2O A;  4US8 A;  1FCL A;  2G4D B;  4TQ1 A;  1VLB A;  1A70 A;  1KM7 A;  3QX1 A;  3QK0 A;  2NPT A;  2G9H D;  3VTV A;  2QC8 A;  5TR5 A;  2NMQ A;  4KVG B;  3ZLZ A;  2RPQ A;  3DHG C;  1PGA A;  2GLS A;  4WIP A;  4KSL C;  1WE7 A;  2K6Q A;  1VD2 A;  2KTF A;  5KHQ A;  3C8Y A;  1XXG A;  2LRW A;  3P63 A;  4C80 A;  5HFY A;  2KWV B;  3ENE A;  1E5W A;  1ZDX A;  1OQR A;  1UNS A;  4B0E A;  3BK2 A;  1GC7 A;  4BKT A;  2WXM A;  1OFF A;  2KX3 A;  3LXF A;  1FXI A;  2FNJ B;  1N60 A;  1FXT B;  2KWU B;  1YMH E;  1V9J A;  1PYW D;  3FIL A;  2GI9 A;  3MHS D;  2EEL A;  4J6I A;  1V8C A;  1I4X A;  1FRD A;  4F8C B;  3SR6 A;  2JZP A;  2WP9 B;  3NOB A;  1MFW A;  1OQQ A;  2JF5 A;  3AE6 B;  2DAJ A;  3APF A;  3SD5 A;  4OVV A;  2BVC A;  4YSX B;  1TGZ B;  2WX1 A;  2WXK A;  2K8B A;  2KO3 A;  3UQB A;  1WRI A;  1XLP A;  2K1F A;  3TEX A;  1HZ6 A;  3PRE A;  2HTM E;  4MH8 A;  3H7P A;  3ZIM A;  1TS4 A;  1P3Q U;  2KFJ A;  3AU4 A;  3N1X C;  1YOV B;  3WIM A;  3NVV A;  3RMK C;  3NVW A;  2FCQ A;  2DYM A;  1I4R A;  1ROE A;  2HD5 B;  5LXI B;  3RNE C;  3ETR A;  2N7E A;  4DHJ D;  2MP2 A;  2LGS A;  4EZL A;  1NEK B;  1V97 A;  1T3Q A;  2BTE A;  5LLI A;  2IGG A;  4AWJ A;  4XGA B;  1S1Q B;  2OOB B;  3U30 A;  1F1H A;  1TTN A;  3T8M A;  1L0V B;  1NYR A;  3ZYY X;  3RZW C;  2AQ1 B;  2MJE A;  3EGR A;  2LGD A;  3JW0 X;  4EUT A;  3PRZ A;  5BYS A;  2W3R A;  2DZM A;  1I7H A;  3RYT A;  2DYO A;  1ET6 A;  4DDG D;  1MG4 A;  2L3Z A;  2OJW A;  1MHH E;  1RAX A;  2O6V B;  3MJW A;  3U7D A;  2UWQ A;  5D2M B;  4GDL B;  4TKN A;  1E10 A;  1LM8 B;  3R2T A;  2KJR A;  4NAW B;  1OEY J;  2CR5 A;  2BYV E;  1I4H A;  3ML9 A;  2UYZ B;  2VZK B;  1YJI A;  4XX5 A;  3PRP B;  1GPX A;  1MJD A;  4XE0 A;  3RUI B;  4M0W A;  4RGT A;  4BFR A;  3MC8 A;  2GMI C;  4BBN F;  4HEA 1;  4FN2 A;  1NYQ A;  2E6X A; 
#chains in the Genus database with same CATH homology
 4C56 C;  1MVK A;  3TEY A;  1C79 A;  1FM0 D;  4XWT A;  2PW9 A;  5BYR A;  1L5P A;  5BMI A;  1CJE A;  2JSV X;  1KLG D;  5C2T B;  1T5X D;  2J4X A;  2J52 A;  3HVZ A;  2JYT A;  2AQ3 B;  3KQ4 A;  3SEB A;  4DXF A;  1IUE A;  1C78 A;  3AEA B;  1DOI A;  4RGM A;  1BML C;  1T6B X;  2D5G A;  2KWD A;  3B9J A;  1RYJ A;  3BVG A;  1K51 A;  2MJ3 A;  5AUI A;  4GLS C;  4YSZ B;  2MH7 A;  2KQ4 X;  2J53 A;  2QJL A;  1TS3 A;  4L1B A;  1UUP A;  4TMA B;  1D5X C;  2V3P A;  4A6Q A;  4H2A A;  5G5H A;  4RFB A;  1SXT A;  2LUM A;  4WH4 A;  1XO3 A;  2BB6 A;  1DOY A;  2WXR A;  4UDU C;  1JQ4 A;  1GB1 A;  1PGX A;  4D2K A;  3Q8F A;  2OED A;  1KFY B;  2WDV B;  1P7E A;  2BW2 A;  1ZOY B;  3AEB B;  1QT9 A;  3FC4 A;  2WU5 B;  3AE7 B;  1MI0 A;  1C4A A;  1BXT A;  1TZO A;  1AYF A;  4KX6 B;  1VDV A;  1N63 A;  2DWQ A;  3TEZ A;  1TS5 A;  1F0Z A;  1HZ5 A;  1SJH D;  2QIL A;  1M4V A;  1B9R A;  1EWY C;  2WXF A;  2K5P A;  2K0P A;  2PMV A;  5EE0 A;  5D7G A;  4RGO S;  4YT0 B;  2V4I B;  1WWT A;  2TSS A;  2ZW0 A;  3T3O A;  3P1M A;  1ET9 A;  1ZP0 B;  1AWD A;  2KDM A;  1V1O A;  3BYY B;  4ZOH C;  1YQ4 B;  3TEW A;  2SAK A;  1QOA A;  2IGH A;  2WXQ A;  5D3I B;  1N61 A;  4JE3 B;  2W55 A;  3VR9 B;  1SE3 A;  3NUH B;  2N7J A;  3IT4 B;  1QF6 A;  1YN5 A;  4HKZ E;  1JWU D;  3I57 A;  5D3D A;  5FKA C;  2RPV A;  1XEE A;  3V3X A;  3GP7 A;  4EE2 A;  2RDH A;  2BB5 A;  2ON8 A;  4N58 A;  2DLB A;  4ARI A;  2IPK D;  4YXD B;  2KAC A;  3BVZ A;  1IBX B;  3DWG C;  4TSS A;  1JCK B;  1I4P A;  5HI1 A;  2PVO D;  2W54 A;  2M19 A;  1SSN A;  3DWM A;  4R3D A;  1UWM A;  4JWU C;  1E9M A;  1GAQ B;  2WLB A;  3AE8 B;  3NRZ A;  3E56 A;  1CZP A;  1D4B A;  1N62 A;  2V3N A;  1DYQ A;  1N5W A;  3P4S B;  3W1S A;  1ESF A;  4ZRQ A;  1JRP A;  1L0X B;  5EE9 A;  2XNA C;  1HXY D;  1L4Z B;  2LFI A;  1N5X A;  2XN9 C;  3Q8B A;  2LHE A;  1RWS A;  1D5Z C;  1GOZ A;  3I9V 1;  3Q69 A;  3SFE B;  4HKQ A;  1WGK A;  1TJE A;  4WWM A;  1STE A;  1JWB D;  1I4G A;  1ZE3 D;  2IDY A;  2RDG A;  2L52 A;  3AM9 A;  3RPF C;  2KN4 A;  1YJJ A;  3P4R B;  3MHZ A;  4C7Y A;  3P42 A;  4C7Z A;  1CQV A;  4DXG A;  2WXG A;  2L83 A;  1P7F A;  2ICI A;  3AE1 B;  4JPS A;  4RF0 A;  2E3T A;  4XWW A;  5TSS A;  3TUO A;  3NZ3 A;  2JYE A;  1I4Q A;  4OVZ A;  3CIR B;  1SEB D;  2Y3A A;  1SF0 A;  5MPO A;  1KF6 B;  5LNK 1;  2QEJ C;  1CK1 A;  3CWI A;  4JWS C;  2WS3 B;  5EE3 A;  2K22 A;  1XLN A;  2ZW1 A;  2NTT A;  3IAM 1;  4OHJ A;  4KGS A;  1DGJ A;  2BS3 B;  4Q2J A;  1L4D B;  2I38 A;  1YN3 A;  3J9C A;  1HEZ E;  3GB1 A;  3W9C B;  2WU2 B;  1YNT E;  3AEF B;  1PUT A;  3NVY A;  1F2R I;  2Y5C A;  2Z8L A;  4JX1 C;  2YEP F;  4O1N A;  2PTL A;  4NAM A;  2L32 A;  2FUG 1;  1SE4 A;  1NI3 A;  3KLS X;  1QIL A;  2Y5P A;  3FAH A;  1V1P B;  1VRA B;  5BMH A;  1NVI D;  1QQR A;  5BMG A;  3IT6 B;  4MM3 B;  1FNV A;  3UI3 A;  3RFZ B;  3ZJU A;  4NJC A;  1PGB A;  2IGD A;  1KTK A;  2WDQ B;  2WXI A;  2CU3 A;  4CQN A;  2VZK D;  2L1A A;  3HUI A;  1UWX A;  2JWU A;  2JXT A;  4N6E B;  4OZC A;  2H89 B;  4ZHP A;  5HHD G;  1XCT L;  2B76 B;  3BVM A;  1TKE A;  3L4P A;  5T8I A;  1AW7 A;  3U2S C;  3GS2 A;  3EA6 A;  3W5U B;  4LK0 M;  1QLB B;  3WCQ A;  2BS4 B;  2X38 A;  4XDD A;  1E0Z A;  1V1P A;  3MP9 A;  3SFD B;  1FMA D;  2N9L A;  2MEK A;  1Q10 A;  2W82 A;  4HRO A;  4L2Y A;  4WUR A;  4WQM A;  3MJ5 A;  4YSY B;  3AMZ A;  1J7A A;  4HRS A;  1L0Y B;  1TY0 A;  3NS1 A;  2GB1 A;  1TKG A;  4J3O D;  1MHX A;  2WXN A;  4OW0 A;  3H8H A;  2DBY A;  1RM6 C;  1FRR A;  4REZ A;  3W2D A;  3NVZ A;  4RF1 A;  1XLO A;  3AEG B;  1L6V A;  3AED B;  2INP E;  2ONQ A;  4P6V F;  4A8X C;  3VRB B;  4AS1 A;  1J7B A;  2OHF A;  1TYG B;  2J42 A;  4YTP B;  2N0S B;  1KLU D;  2ACZ B;  2JX5 A;  4IOI E;  2LEK A;  4KKI A;  5H8Y E;  3AE9 B;  3U7Z A;  2IJ0 A;  2FBW B;  1UGJ A;  1QOB A;  4ZHO A;  1DOX A;  5JXV A;  2FE8 A;  2Q5W D;  2YEP B;  1J7C A;  1EU3 A;  2WXL A;  2WXO A;  3R2I A;  1E7P B;  4IKG A;  4ZRP A;  1ZPS A;  1FIQ A;  3KWL A;  5FR3 A;  1XF5 L;  1JML A;  2AX5 A;  2WQY B;  3AN1 A;  4US8 A;  1FCL A;  2CJN A;  1F77 A;  1TY2 A;  3AE2 B;  4RH6 A;  1PFD A;  2AQ2 B;  4TQ1 A;  4KGR A;  4YTM B;  1PDX A;  1LO5 D;  1VLB A;  1A70 A;  1JWA D;  3MFG A;  2I2Y A;  1K53 A;  3AE4 B;  1D5M C;  2GRI A;  1B1Z A;  4P16 A;  2SEB D;  1FEH A;  2NMQ A;  3Q8A A;  3Q8E A;  1SIJ A;  2INN E;  3HVD A;  1QKZ A;  3LB8 C;  4USA A;  4B0M A;  5C3J B;  4GDK B;  2JQR B;  2PKO A;  3TSS A;  3N9Y C;  1PGA A;  4ZYS A;  2WXH A;  4WIP A;  1FFV A;  3BYT B;  4RGN A;  1HQR D;  3C8Y A;  3VRA B;  3KWV A;  5AUK A;  2K9X A;  3BZD B;  1XXG A;  3P63 A;  2G1E A;  3PZ7 A;  4C80 A;  5HFY A;  1ZDV A;  3VR8 B;  1KRH A;  2PIA A;  3BK1 A;  1ZDX A;  3BWU D;  1OQR A;  1WXQ A;  2RMM A;  5EE1 A;  1WYG A;  1UNS A;  2M56 B;  4B0E A;  1BUI C;  1VR9 A;  1K52 A;  3BK2 A;  4KGT A;  5GXG B;  3OWE B;  2WXM A;  1OFF A;  3LXF A;  3MC0 B;  1FXI A;  4NZL B;  1N60 A;  3URY A;  1QOF A;  4LLG M;  1YQ3 B;  1K50 A;  1YMH E;  2EKI A;  1JWS D;  1YN4 A;  2WDR B;  1ZXH A;  1Y56 A;  4IDI A;  3Q8C A;  1PYW D;  3FIL A;  2GI9 A;  2EEL A;  1FFU A;  1V8C A;  1I4X A;  1VZ7 A;  4FXC A;  3ABV B;  4LTU A;  1L6U A;  1VZ6 A;  1FRD A;  3ZQ4 A;  2CJO A;  2M0A A;  2W3S A;  1NEN B;  2V0G A;  1WSP A;  2NTS A;  1GB4 A;  2LJI A;  3SR6 A;  2JZP A;  2WP9 B;  4A55 A;  3PO0 A;  2QIE B;  1OQQ A;  1TKY A;  2BBC A;  5H92 C;  3AE6 B;  3ZJV A;  1KH0 A;  2MJD A;  3PZ8 A;  2BT6 A;  1FNU A;  4A9A A;  2QMT A;  4YSX B;  2WXP A;  3E9S A;  1ACC A;  4OZB A;  4RNA A;  2WXK A;  2WNM A;  3BII D;  2LMC A;  1FCC C;  4DQO C;  1WRI A;  3AH7 A;  2KMM A;  3ZGZ A;  1FO4 A;  1HA5 A;  1XLP A;  1ZUD 2;  2WXJ A;  4L23 A;  3TEX A;  1HZ6 A;  1C4C A;  3B2G A;  2HTM E;  4MH8 A;  3VQI A;  3HRD D;  1C76 A;  1TS4 A;  4PT5 A;  3R8B A;  4TQ0 A;  1RFK A;  1JAL A;  3AB5 A;  2JU6 X;  5E6J A;  3NVV A;  3AEE B;  1JRO A;  4WAF A;  1XCQ L;  4MAC A;  2H88 B;  3NVW A;  4OZA A;  2DYM A;  1I4R A;  3P4P B;  1ROE A;  3IAS 1;  4MT5 A;  3O13 A;  1FNW A;  3ETR A;  5I4D A;  3AV8 A;  3T3N A;  1NEK B;  1V97 A;  1EWC A;  3LYY A;  1T3Q A;  3EUB 2;  4RCO A;  2BTE A;  2IGG A;  4KKJ A;  1EM7 A;  3B2F A;  3AEC B;  1AN8 A;  1VZ8 A;  5HG2 A;  2PLP A;  1L0V B;  1NYR A;  3ZYY X;  4YTN B;  5G5G A;  2QSD A;  1IGC A;  2AQ1 B;  4N59 A;  2MJE A;  3EGR A;  3IXS A;  3ZJT A;  3W5V B;  5BYS A;  4ARC A;  2HDE A;  1C9F A;  1JWM D;  2W3R A;  3U52 E;  1ENF A;  2BYT A;  1EU4 A;  1SB3 C;  1I7H A;  2LGI A;  2PVG C;  2DYO A;  1ET6 A;  3P4Q B;  1MHH E;  4HJG E;  1IGD A;  2BS2 B;  4A90 A;  1C4P A;  1FXA A;  1SJE D;  1R7S A;  4GDL B;  1E10 A;  3R2T A;  1D6E C;  4NAW B;  4US9 A;  2K3U A;  1ZXI A;  1I4H A;  4ITK A;  2VZK B;  1YJI A;  3U4E G;  1JW9 D;  2R61 A;  1E6E B;  1IBX A;  3V05 A;  3FIL B;  4YWG G;  1FD6 A;  1GPX A;  4XE0 A;  1XLQ A;  1C77 A;  1SBB B;  2LHD A;  4M0W A;  4XDC A;  1SE2 A;  3AE3 B;  1VJK A;  2KAJ A;  4RGT A;  1MPE A;  5FK9 C;  2N9K A;  3AE5 B;  1TS2 A;  1QOG A;  4AQ7 A;  4HEA 1;  1F2R C;  2G9H D;  1NYQ A;  2E6X A;  5BYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...