1NVID

Orthorhombic crystal form of molybdopterin synthase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
MVKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin converting factor subunit 1
publication title Structural Studies of Molybdopterin Synthase Provide Insights into its Catalytic Mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2003-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1nviD00
1KF6B 3AEEB 3P4QB 1GAQB 2BT6A 5G5HA 1QF6A 3AV8A 1JROA 1V8CA 2WU5B 4YTPB 2N0SB 3L4PA 1L5PA 2PIAA 3AE7B 1AWDA 1R7SA 3SFDB 2PVGC 4YSXB 4US8A 1TJEA 1FXIA 1XLPA 3AE4B 1L0VB 3P4RB 1FIQA 1QOAA 3P4SB 1I7HA 1N63A 3AE3B 5GXGB 1CJEA 3AEGB 4N59A 4YXDB 1VLBA 2JQRB 3RPFC 1WWTA 1N62A 2WLBA 1FFUA 3CWIA 1FRRA 1N61A 5EE3A 2MJDA 1OQQA 2M56B 3BIID 1JQ4A 1WGKA 5EE0A 1JRPA 1ZUD2 1ROEA 1DOIA 3AE2B 1EWYC 1PUTA 2W54A 1DGJA 1N5XA 4US9A 4YT0B 1IUEA 3AE1B 4HRSA 1FO4A 2HTME 3ETRA 1E9MA 1VJKA 5C3JB 2H88B 3EUB2 1J7CA 1JWAD 1E0ZA 4ZOHC 1PFDA 2K5PA 4C7ZA 5H92C 3AEAB 5G5GA 1JALA 3AEBB 1NYRA 3AEDB 4YSYB 1TYGB 3LB8C 4ZHOA 2W3RA 1XLQA 1L6UA 3HUIA 4WQMA 1XLNA 3DWGC 1L6VA 4C80A 1FXAA 5AUIA 3AE8B 4YTNB 3AE9B 4USAA 2MJ3A 2MH7A 2WP9B 3W5VB 1AYFA 1RFKA 3NRZA 2QIEB 1RM6C 1KFYB 1DOYA 1QT9A 3AM9A 3B2GA 2PVOD 3ABVB 1J7BA 1QOBA 5C2TB 4C7YA 2MJEA 2ACZB 2L52A 1V97A 3SR6A 3FC4A 3AH7A 3DWMA 2Y5CA 1ZP0B 3NVZA 4P6VF 2QJLA 1T3QA 3CIRB 1RYJA 3P4PB 5AUKA 4A9AA 2W55A 3LXFA 4JWUC 1JWBD 2B76B 2K22A 2WS3B 3AMZA 2JX5A 4FXCA 4N6EB 3PO0A 1WYGA 1WRIA 1NVID 2KAJA 4JX1C 1RWSA 1ZOYB 2DBYA 1TKYA 3VR9B 1B9RA 1SF0A 1SIJA 3NVVA 1KRHA 2G1EA 1JW9D 2LEKA 3P63A 4LTUA 1WXQA 2BS3B 3VRBB 3ZYYX 3B2FA 3P1MA 2WQYB 3AE6B 2WDRB 4YSZB 1NENB 1CZPA 1FMAD 1J7AA 3FAHA 1FRDA 2CJNA 2WDQB 3AEFB 2W3SA 1NYQA 1QLBB 2BS4B 1SB3C 2PKOA 3HRDD 1QOGA 1NI3A 1N60A 1YJJA 1GPXA 3NVYA 3KWLA 1FFVA 1YJIA 2CJOA 4N58A 5EE1A 3AB5A 2M19A 1ZXIA 2CU3A 2Q5WD 3HVZA 4KX6B 3AECB 3WCQA 1PDXA 2FBWB 3NS1A 1XO3A 5MPOA 1N5WA 1TKGA 4JWSC 1XLOA 4HROA 5EE9A 1VDVA 1NEKB 3VRAB 1A70A 3AN1A 2EKIA 2OHFA 1YQ3B 3VR8B 2WDVB 4IDIA 3AE5B 2K9XA 3B9JA 1F0ZA 1E7PB 3NVWA 2L83A 1QOFA 1OFFA 1TKEA 1OQRA 3W5UB 1YQ4B 2AX5A 2E3TA 5H8YE 4YTMB 1E6EB 4WWMA 2DWQA 2BS2B 2WU2B 4ITKA 1FM0D 2H89B 2KMMA 3SFEB 3W9CB 4ZHPA 1UWMA 1E10A 1DOXA
chains in the Genus database with same CATH superfamily
2D3GA 1V9JA 2GBKA 1Y8RC 1V8CA 2LRWA 2M0AA 3AE7B 2IGGA 1FIQA 3N20C 4KKIA 2J0JA 2OEDA 5EE3A 2NS5A 2JT4B 1T5XD 2WXGA 3H8HA 3AE2B 1OEYJ 1N5XA 1KLGD 3RNCC 3ZNGC 3IVFA 1VZ8A 2KJ6A 2IO3B 4MELA 3TEZA 4W9KA 4B95A 2G3QB 5D7GA 2JPHA 1L6VA 2KN4A 3RZWC 3PPAA 1WM2A 1RFKA 4PS8A 4WAFA 3ONSA 2KOXA 2JXXA 4XYCA 3TEYA 4AWJA 2GRIA 1PGAA 2J7QB 2N1VA 4W9GA 3MFGA 3V3XA 2D3BA 2ZCBA 3RNAC 3GE3C 4K81A 1YJ1A 3PHXB 3VUXA 2O2VA 5AZGA 3V62A 4EOYA 1B9RA 3NVVA 4KV2A 1C4AA 1LQBA 2L7RA 2ON8A 1SB3C 2PKOA 3NVYA 3T3NA 1D3ZA 4JQWC 4KX6B 2Y3AA 1FD6A 2K6DB 2REXA 3DDCB 3T9LA 2MBBB 5EE9A 1TKGA 1XEEA 2EKIA 1I42A 1V80A 2KQSA 2KDIA 3DVGY 3TL5A 2DZJA 1UGJA 4RFBA 3PRMB 1QF6A 2MBQA 3MC0B 3QA8A 2J53A 2OJWA 3P4SB 1T0SC 3S2AA 5E6OA 1HZ5A 1YX5B 2DYMA 3DVGX 1KJTA 1R4MB 3RNEC 2BB6A 5LLIA 2W54A 4EE2A 4MACA 5HI1A 1T0QC 1MHHE 4RMAA 4B0EA 4YSYB 1JMLA 4G0NB 2W3RA 2LI5A 2XEWA 1Z2MA 4GIVA 2KX0A 3I3TB 3RNFC 4BKSA 4F8CB 3HK0A 1SEBD 2MBEA 3E56A 1WSPA 4PK1A 3NRZA 2MJEA 4M02A 2DZMA 2BQQA 1WR1A 2X8XX 5DCNA 3VDZA 3QCAA 1ISNA 3C19A 3PO0A 2DHZA 3DBHB 3JVZX 4WQOB 3PREA 3A1QB 3VRBB 1I35A 4NAWA 4M8NA 2ZPYA 3JSVA 3LJ3A 2KWUB 4L23A 1KLUD 5EE1A 3AB5A 4FULA 1XO3A 2IDYA 2JWZA 2MBHA 2YVCA 3BWUD 5FR3A 2N7EA 1CQVA 3A9KB 1VR9A 4ZRJA 2L83A 4C00A 1HE8A 2KLCA 2C5LC 4YTMB 2RGFA 3W9CB 5CHWA 4K7SA 1UWMA 3P4QB 1SE4A 1F2RI 3A1QA 2WU5B 3ZJTA 3ZW3A 3GOEA 2FAZA 3P4RB 1WR6E 2KACA 3R8BA 3W2DA 4WJQA 2WX1A 2WXNA 1ZE3D 2N9XA 1WM3A 1VJKA 1AW7A 3ZQ4A 3PTFC 3I5JC 3ZJVA 5KHOA 1XLNA 3VTUA 2D07B 2MH7A 4URKA 1KFYB 2RPQA 4C7YA 4LNIA 2L52A 4M0WB 2VH1A 2O6VA 2WXIA 2W55A 4FXCA 3U30A 2GBRA 3B1LX 1MJDA 1M4VA 1SIJA 3PRZA 1DYQA 2KT7A 1QQRA 1UUPA 2Z8LA 4B0MA 4WJNA 3AE6B 2EMSA 1S1QB 4HJGE 1J8CA 4KIKA 4WH4A 1KOTA 1P9DU 4ANXA 4WWOA 2IGHA 3RFZB 4LK0M 1A70A 2AQ3B 2OHFA 3U8ZA 5I4DA 4BKGA 4IDIA 3B9JA 1I4XA 1YQ4B 2WNMA 2DWQA 3B0AA 3APDA 2LZ6A 3L4PA 2QEJC 3AEEB 1YNTE 1R4MI 2KQ4X 2MEKA 5IP4D 4K1RB 3ZXVA 2PEAA 3C0RB 4HEA1 4P16A 4FHKA 2CKHB 3CSFA 4XE0A 3MJWA 3UQBA 4NQLB 1BXTA 1FFUA 3UINB 4W9JA 1JQ4A 1TIFA 3ZJUA 3QHTA 3DBLB 3IAS1 1WFYA 4IM0A 1GG3A 4LNKA 3AEAB 3NZSA 2K8CA 4DXFA 4ZHOA 1RRBA 1SGHA 2PMVA 2C60A 1XF5L 4LNNA 3AE8B 3WALA 4MT5A 2FCNA 4LJOB 2N4FA 2LRUA 4JGHB 1DOYA 3AM9A 4ZRPA 2K39A 2KDBA 3P4PB 4HPMB 1VZ6A 3EHVA 1IBXB 1XCQL 2WS3B 1YN3A 1WYGA 4XWTA 2RD0A 4BVUC 2EMTA 1MHXA 1Q0WB 5C23A 4PYUA 1JW9D 2JYEA 1PGXA 2DAFA 2GLSA 2JRIB 2CJNA 3EA6A 2BS4B 3ML8A 3A33B 2RSUA 2D2QA 2KX3A 5JXVA 5C1ZA 3Q3JA 1QZEA 1WRDB 2Y5BB 1VDVA 4FBJB 3IBEA 1IBXA 1YQ3B 1YIWA 4DQOC 2INCC 3MP9A 4KDIC 3J9CA 3RT3B 4AJYB 3VH4B 2DZKA 2E3TA 3TIXA 2INDC 2ZZPB 3SDLC 1K50A 2D11A 1BT0A 4GDLA 5IO9A 3VH3B 3IG3A 2N0SB 4BAXA 4YSXB 4OZBA 4RCOA 3BYYB 4AJWA 3EECA 2IO2B 5L83A 2VRRB 2GOWA 4MJSB 1S3SG 2ZVOA 1MPEA 3PT2B 4WAAA 2CU1A 1JRPA 2DYOA 4IUMB 2KO3A 2RPVA 3PSEB 3ZKJC 2FIFA 3DHHC 4YT0B 3Q3FA 3ETRA 3ZNID 2KNBA 1FPYA 5E6NA 1JALA 5AZFA 1NYRA 4ACFA 2FNJB 3HUIA 2QCZA 2C9WB 3KLSX 1UBQA 3AE9B 1RM6C 2G45B 1NDDA 4HDQA 2ZPNA 3M62B 1P0RA 2KFKB 1MG4A 2CR5A 1IGCA 4WIPA 4MSMB 3U2SC 2N9EB 3ZTCA 1M94A 2KAJA 4S0RA 1RWSA 4E71A 2L00B 3UGBB 4D2KA 4DDGD 1T0YA 2WWZA 1B1ZA 4GGQA 1KM7A 3VUYA 3ZIMA 1NENB 1ACCA 5CHFA 5LXHA 1SJHD 2L8JA 4FJVB 2M19A 1JWUD 4IM3A 4AUQC 4EZLA 1WGHA 1N5WA 1NEKB 3RD2A 2KFKA 4JIOU 4PS7A 3SEBA 1E7PB 2E6XA 1TKEA 1OQRA 4WWMA 1WXMA 1WXSA 3TMPB 1WJNA 4G50A 2L05A 2IY1B 2J42A 3IT4B 3I63C 3Q3NC 3AE4B 1YMHE 4RF1A 2QDFA 4MSQB 4NQKE 2CS4A 1C1YB 3Q2AC 2KTRB 5TSSA 1V81A 1OEYA 2N1WA 1Q5WB 2XK5A 1ENFA 3H1UA 2Z59B 4IKGA 4ZYNA 1KH0A 1GJZA 1EUVB 4MEMA 2KXJA 2J4XA 1TYGB 1C79A 4GDKB 5DPRA 1I4PA 2V3NA 5EDSA 2VH2A 2JY6A 1WGDA 5DPWA 2MP2A 5BYRA 2PW9A 5BMGA 3R7RA 2M4NA 1X1MA 4RF0A 2PTLA 3DPDA 3IAM1 4ICVA 2ZVNA 1KTKA 1UBIA 1VD2A 1JWSD 4A9AA 2AQ1B 3OG5A 4BKSD 3PZ8A 3VVWB 1J0GA 2CHXA 1PGBA 3N1ZC 4XC2A 3EGRA 4LTUA 4DDID 1VCBA 4GDKA 4E3CA 3DBSA 4KGSA 3WA0A 3KUZA 1WH3A 3R3MA 1YJJA 2N7JA 3NJTA 2LHDA 3IT6B 1Q10A 1T6BX 2FBWB 1TBEA 3CF6E 3I9V1 2LHEA 1P1AA 3OJ3A 1GB1A 2WXJA 2H89B 2JQRB 1FCLA 4WJPA 1TJEA 1F2RC 3VTVA 3TUOA 3ZLZA 1QOAA 4BOSC 1YN5A 3RULA 4CO7A 2LMCA 3APFA 1PQSA 2KMCA 2QSDA 1N61A 3HVDA 5BYQA 3V61A 1P98A 4I6LB 4QAYA 4US9A 4LDTD 4DXAB 1XD3B 2BBCA 1BUIC 2M17A 2PLPA 3W1SC 3LB8C 1CK1A 2V3SA 1SE9A 4WQMA 2KFJA 2KLGA 5TR5A 4JE3B 1AYFA 3OAWA 3NZ3A 3RNBC 2HJ8A 2NPTB 4RGNA 1ZPSA 2ACZB 3UIPB 2KC1A 3ZNZB 1AN8A 5LXIB 1C3TA 1LFDA 4DHJB 2KN5A 3RI7C 4PS3A 2QILA 1XQQA 3VFKA 2MHJA 3I57A 3VHTC 2BTEA 3ALBA 1EU3A 1K53A 2O6VD 2ZW0A 4BOZB 5JHBA 1HZ6A 1J19A 1NBFC 1J7AA 3HRDD 3DBRI 4K7UA 4GXBA 4XX5A 2CJOA 4C56C 4HPLB 4RNAA 1Y56A 3BY4B 3RMKC 3WCQA 1PDXA 5GMVA 2KWVB 4FJZA 2XN9C 2HDEA 3AE5B 4AS1A 4JL9A 3RCZA 2HTHA 4GLSC 1OQYA 2HD5B 1I4QA 1R4NB 4CYEA 1C76A 1WMHB 2KWCA 1P3QU 2PVGC 2BVCA 3H7PB 3KWVA 1E8YA 1I7HA 3N30A 3GE8C 2FE8A 3RPFC 3DOWA 3R66C 2IZVB 2L0TA 2PJHA 2W82A 3CWIA 1D6EC 3BIID 4J6IA 4XGAB 4NNJB 3BVMA 4EZJA 2XNAC 1E90A 1WX9A 4OVZA 3N1XC 2WXKA 5C3JB 2DAJA 2K1FA 1OTRB 2GBMA 3AXCA 2MW5A 3Q8FA 3U52E 1WE7A 3NG0A 2AEHA 3Q8CA 4WWNA 1L6UA 3A4RA 1UH6A 3ZTDA 3PS6A 5AUIA 4YTNB 2I38A 3DQVA 3ZO5B 3ABVB 4MH0E 2KD0A 1RAXA 1UWXA 3FC4A 3Q69A 3A9KA 3TCAA 3VQIA 2K22A 3C8YA 3OLMD 1C77A 2WDTB 2WXLA 1E8ZA 3FILB 4IM2A 4TQ0A 2BS3B 3ZYYX 3AI5A 1F77A 5IA7A 4YWGG 4M01A 1VZ7A 1YX6B 2WDQB 4HJKA 1NYQA 3PHWB 5FK9C 4RGTA 1GPXA 2L3ZA 1ZXIA 4OW0A 4RM9A 1U4AA 2M8SA 1UF0A 3AN1A 3N9YC 1EF1A 2JYTA 1F9JA 2MWSB 2WDVB 4NPNA 3IHPC 2WXOA 3V6EB 1XXGA 1TT5B 4W9HA 2MLBA 2WGSA 3WANA 2FIDA 3KYCD 1LXDA 3KYDD 5E6PA 3H6NA 2KZRA 2N9LA 1FEHA 2BYEA 2BB5A 2DNFA 2FCQA 1LGRA 4M0WA 3NZUA 5J18A 1ZKHA 2KDFB 2LGIA 2LVOA 3OJ4B 5E6JA 1WGKA 4HKZE 4R3DA 1TY2A 2EKEC 4BZAA 2WX0A 4PYZA 2K5PA 4MM3B 3AEBB 1D5XC 5BMIA 1Q1OA 1XLQA 2JWUA 3A9JB 4USAA 1FNVA 3WAMA 2AWTA 2NMQA 1QT9A 2K6QA 4P7IA 4A6QA 2CHZA 1FNWA 3PLVA 2JZZA 2Z0EB 3DHIC 2NBWB 4P6VF 2OJRA 2LGXA 2B76B 4ZDVA 1NVID 2NTTA 4JX1C 1ZOYB 1SF0A 2LEKA 1ZXHA 3ML9A 3ZDMC 2JZPA 2I1JA 1AARA 2W9NA 1FRDA 1F1HA 4OVVA 5KHQA 2D3AA 1QLBB 3VXWA 1WGRA 4MGIE 3V6CB 2Q5WD 1R4NI 4GMVA 3QK0A 2K9XA 1MI0A 1EWCA 3NVWA 3URYA 1GC7A 1OFFA 2R2QA 4LJPB 2BS2B 2BWFA 1E5WA 4W9EA 4KDLB 1E7VA 4XDCA 2LUEA 2JXTA 1TZ1A 4JLCA 1TS4A 1AWDA 2FUG1 2MA9B 4G3XB 2PE9A 3X23A 5AEKB 1H8CA 4GB9A 5G55A 3AEGB 3PRPB 3LYYA 3NOBA 2MJDA 3L54A 3Q14C 4NZLB 4GOCA 3AE1B 1E8WA 1TTNA 2RDHA 3MHSD 4TV3A 2INNE 4KSKC 3AEDB 3O65B 4CHKA 2D10A 5JHAA 4A3PA 2A5UA 2MQJA 3LDZE 2BWES 1C78A 4B6WA 3NY5A 1LO5D 3QARA 3ZVVA 3DWMA 2XBBC 2Y5CA 3HIZA 4K3BA 2IJ0A 4NAMA 3QAQA 2Y5PA 4A8XC 3AMZA 4N6EB 3RZFA 3KQ4A 4JPSA 1XT9B 1V1PB 3QC8B 1WYWB 4HXDA 2BGFA 1QKZA 1WJ6A 1KLVA 3BK2A 2WQYB 4E74A 1UZXB 2LVQA 3IXSA 1CZPA 3RUIB 4MJSA 2NBUA 1YJIA 3ENEA 4EZKA 4F7ZA 3L08A 3Q8AA 1D4BA 1L0XB 2K25A 2L76A 3T8MA 1H4RA 3GS2A 3VRAB 1TS2A 1SXTA 3NUHB 2ZW1A 1GC6A 3DHGC 1WGGA 1WJUA 2AX5A 2K3UA 1E10A 3SHQA 1KF6B 4EKUA 2R61A 5G5HA 3ZXRA 1V5TA 4YTPB 3V60A 2RDBC 4HKQA 5IN7A 4DXGA 4M8MA 2ZJDA 4DHZB 3L16A 3AE3B 3NS8A 5GXGB 1UNSA 4N59A 4NJ6A 1F52A 2M56B 2BYVE 3DBRB 1DGJA 2LFIA 2LVPA 1E9MA 4LNFA 5CHVC 1JWAD 3GZNI 4GSWA 2KJRA 3U4EG 3VUWA 3PLUA 4WURA 4RH6A 3UI3A 1IYFA 4BFRA 4A90A 2WXPA 4YL8A 4IWOA 1P7FA 1MVKA 5IKCM 3B2GA 2M1MA 3SR6A 2SAKA 3NVZA 2WXRA 2FCMA 1T3QA 1RYJA 1WX7A 2ZEQA 3PZDA 2IPKD 3UIOB 1JWBD 2IBIB 1STEA 3ZUNA 3L13A 4OZCA 1A5RA 2NBVB 4A3OA 4LNOA 2L0FA 2LJ5A 3JYUA 1KRHA 1L4DB 1WXQA 3QQ8B 3P1MA 5BMHA 1C9FA 4ASWC 2JZ3B 2HJ1A 2KDEB 5CTRC 2JU6X 2WHIA 3KUCB 3M95A 4A55A 3WAOA 2KTRA 4AOFA 1L4ZB 4F1SA 4ARCA 2VZKB 3W1YA 4XDDA 3L10B 2WXQA 1WJ4A 2WXMA 3B08A 1F0ZA 4KVGB 3PV1A 4I6PA 2KMMA 5J17A 5H92C 2MSED 2O2VB 1JROA 3KW5B 1L5PA 1UELA 3ZRFA 4DHJD 2AL6A 3TEWA 2GMIC 3EFCA 2WLBA 3N1YC 1FCCC 3KUDB 1ROEA 1JWMD 3AULA 3D32A 2GI9A 5DPSA 2HTME 3M63B 3EUB2 3AU4A 2K8HA 1WXVA 3W1SA 3ZDTA 2LXCA 2KC2A 4W9CA 2LXAA 1I4RA 2MJ3A 4K3CA 1MG8A 3BZDB 1HTOA 5J2RA 1QOBA 5C2TB 1PYWD 2KK8A 5HG2A 5JH5C 2UU7A 2UYZB 5AUKA 3ZGZA 4JWUC 3GP7A 4Q2JA 4ZRKA 2LD9A 3UF8A 1L0YB 4XZ4A 4C4VB 2BKFA 5BO4B 3TEXA 4DHZE 3VR9B 5HKHA 1TY0A 1D5ZC 4FHJA 1TS3A 2KDMA 2KWDA 3B2FA 1D5MC 4YSZB 2IYDB 4II2B 4WJOA 2X38A 1K52A 2BF8B 1FFVA 2G9HD 1ZW7A 2R2OA 3DCGA 3HVZA 4HPPA 2MRPA 3CSTA 3KVFB 3EC8A 4N9F4 4IG7B 3VR8B 4MGZE 1HA5A 3H9DA 4B9KA 3X0WA 4C4VA 4TSSA 1YD8U 1E6EB 4ITKA 1QILA 1FM0D 4N58A 4MGYE 3PZ7A 4TMAB 4NJCA 3AV8A 2PPHA 5BYSA 2NPTA 1BMLC 1WX8A 2LJIA 2D5GA 2ICIA 4BBNC 4NAWB 2UWQA 1IPGA 1NI2A 4REZA 2KHWB 3JSVB 1XCTL 4DK5A 1VLBA 4ANUA 2DLBA 5G2NA 1LM8B 5HFYA 1OQQA 2RMMA 4BKTA 1DOIA 3MJ5A 1EO6A 1IUEA 4KZCA 3Q8EA 2H88B 4IWPA 1PFDA 5G5GA 3QWZB 2DZIA 4W9DA 1WZ3A 4W9IA 3RN9C 1GOZA 4HCPB 1HXYD 3OWEB 4MH8A 2V4LA 2KANA 2NCNA 3W5VB 2KVRA 1V1OA 1N6ZA 3FKYA 4LDTB 4EEWA 1HQRD 2C7MB 2RDGA 4YXDB 4A20A 1J7BA 5HHDG 1SJED 3AH7A 1WY8A 1ZP0B 3ECIA 3LXFA 4II3B 3APCA 1UGMA 2KYWA 4X57B 1E7UA 1ET6A 1WZ0A 2LGDA 1JCKB 3R7QA 1TKYA 1WMHA 2DYBA 2NR2A 5AZHA 5IOIA 3ZRCA 1WXAA 3H7PA 2ZNVB 1K51A 2L32A 5D94A 2AYOB 1EU4A 1C4CA 2W3SA 5IAAC 1QOGA 1GNUA 4H2AA 3KWLA 2A4ZA 3AECB 4FA6A 2N9KA 3RNGC 2TSSA 4ANWA 3QJZA 1XLOA 4HROA 2MBOA 2O6VB 3T3OA 2BYTA 3QX1A 3WAPA 2LGYA 2J0KA 1YQBA 4G11A 4ZHPA 1P7EA 1V5OA 1GAQB 2LASA 2YLMA 3MC9A 2PIAA 1GB4A 2QC8A 4GN1A 4US8A 3BK1A 1FXIA 1XLPA 4HDOA 2IGDA 3TJPA 4KIKB 1CJEA 4W9FA 2N9PC 1RLFA 4FJYA 3L0WB 5EE0A 1ZUD2 2KQ7A 1Z5SB 1FO4A 3FILA 3Q8BA 4ZOHC 4I6NB 2C7HA 2ZNVC 2WYQA 3Q3OC 3JW0X 2IY0B 2INPE 5FKAC 4BBNF 4K7WA 2ONQA 2ASQA 3MHZA 2K0PA 2N7DA 1HTQA 4RM8A 2PVOD 4KSLC 2ZCCA 3U7ZA 3MTNB 4L1BA 2B3AA 2WXHA 2J0MA 2OOBB 2KKCA 5D3DA 2J52A 1GUAB 3H7SA 2IO0B 3BVGA 2DX5B 2YEPB 5FR6A 1YN4A 3AU5A 4HVBA 3CMMB 1FMAD 3GZNB 1E8XA 2BYFA 2KVZA 5D6JB 2JF5A 3P2BA 1SE3A 1WI0A 1HEZE 2KJHB 2V0GA 3KH0A 3L17A 2KTFA 3IFWB 1OGWA 3BVZA 1TGZB 2CU3A 3SU8X 5JZEB 2BW2A 1SE2A 4FADA 4MGKE 1V86A 4MM3A 2JRHA 5CX3A 2GBJA 4OHJA 4WWPA 4AP4C 3A9JA 4ZRQA 2WXFA 2BT6A 4NY0A 2JVCA 1IP9A 4TKNA 3ZNHB 4RGMA 4HWIB 3VAWA 3EFUA 1EF5A 1WWTA 1N62A 2IO1B 3DBHI 2I1KA 4FLHA 1SBBB 4P1CC 1EWYC 1PUTA 3DVNU 3R2IA 4DWFA 3GB1A 4M00A 4IWQA 1RFAA 1J7CA 2FCSA 1ZGUB 3SD5A 4C7ZA 1K8RB 1L2NA 3PVLA 4ARIA 3PGEA 4C80A 2EELA 4GDLB 4KGRA 2WP9B 2BPSA 3UQAA 3M3JA 2QIEB 4L2YA 4IOIE 3NHEB 4ZYSA 2LUMA 1G6JA 1JRUA 4DBGA 4FN2A 1ZDVA 4NJ7A 2V9HA 1WRIA 4J3OD 1TS5A 2I2YA 2FUHB 2G1EA 3HM6X 3P63A 4LCDE 2AQ2B 4W9LA 2V1YA 2WDRB 1FXTB 4OZAA 5D3IB 3N32A 3FAHA 1V6EA 3AEFB 1I4HA 1FNUA 1NI3A 3V05A 4EFOA 2RR9A 3O13A 2HE7A 1T0RC 3NS1A 2C7NB 4JWSC 3VTWA 1ESFA 2G4DB 4KKJA 1QOFA 3TSSA 3W5UB 3WIMA 2KMAA 5H8YE 1WIAA 2WU2B 2NVUI 1MFWA 1DOXA 2K8BA 1V2YA 3QIJA 1ET9A 3Q6BA 1SSNA 3TBLD 4ANVA 1IGDA 4IW0A 1R7SA 3SFDB 2Z0DB 2DENB 1L0VB 2NTSA 4HLEA 1N63A 4EUTA 2V4IB 1YOVB 1FRRA 3U7DA 1C4PA 2D3CA 4LLGM 3MC8A 5DPTA 3RYTA 4TQ1A 2L1AA 1V1PA 4HRSA 2LGSA 1E0ZA 1L7YA 4ZRIA 2JUOA 2V3PA 4UDUC 4TUUA 1TZOA 2CHWA 2GBNA 3DWGC 1FXAA 2VZKD 2MCNB 2BKRB 4P1BC 2MX2A 4HCNB 3HM3A 2M0XA 5L95C 5T8IA 2PE6B 4AQ7A 1UD7A 1V97A 4MDKE 2QJLA 3CIRB 4GU2A 3R2TA 4CQNA 3DVNV 1VRAB 2JSVX 3N3KB 2LWPA 1WF9A 2JX5A 2XK5B 2DBYA 4KZ0A 2YEPF 2GB1A 4S17A 3BINA 2QHOA 4IC7B 4KGTA 3K9PB 4O1NA 4OVUA 1WGYA 5D2MB 2SEBD 4RGOS 1N60A 1EM7A 1I4GA 3DBLI 2G4SA 2MP2B 4XWWA 1SIFA 3BYTB 4ICUA 4HK2A 5LNK1 5MPOA 1V49A 1ZDXA 1WE6A 3K9OB 1CMXB 3A4SC 2QMTA 4PT5A 3HHMA 3P42A 3Q3MC 3E9SA 2AL3A 3SFEB
chains in the Genus database with same CATH topology
3PZ7A 4TMAB 4NJCA 3AV8A 1V8CA 2N0SB 5BYSA 2M0AA 3AE7B 1BMLC 2N9LA 1FEHA 2LJIA 2D5GA 2ICIA 4YSXB 4OZBA 2IGGA 2BB5A 3BYYB 4NAWB 4RCOA 1FIQA 4M0WA 4REZA 1XCTL 1VLBA 2LGIA 4KKIA 2DLBA 1MPEA 2OEDA 5E6JA 5EE3A 5HFYA 1OQQA 1WGKA 4HKZE 1JRPA 2DYOA 1T5XD 2RMMA 2WXGA 4R3DA 2RPVA 3H8HA 1DOIA 3AE2B 3MJ5A 1N5XA 1TY2A 4YT0B 1IUEA 1KLGD 3ETRA 3Q8EA 2H88B 1PFDA 2K5PA 1VZ8A 4MM3B 5G5GA 1JALA 3AEBB 1NYRA 1D5XC 3TEZA 1GOZA 1HXYD 5BMIA 1XLQA 3HUIA 3OWEB 5D7GA 2JWUA 1L6VA 2KN4A 4MH8A 3KLSX 3AE9B 4USAA 1FNVA 3W5VB 1RFKA 1V1OA 1RM6C 4WAFA 1HQRD 2NMQA 2RDGA 1QT9A 4YXDB 1J7BA 5HHDG 4A6QA 1SJED 1FNWA 3TEYA 3AH7A 1ZP0B 4P6VF 2GRIA 1PGAA 3LXFA 1IGCA 3MFGA 2B76B 4WIPA 3V3XA 3U2SC 1ET6A 1NVID 2KAJA 2NTTA 4JX1C 1JCKB 1RWSA 1ZOYB 1TKYA 1B9RA 1SF0A 3NVVA 2LEKA 1C4AA 4D2KA 1ZXHA 1B1ZA 2JZPA 1K51A 2L32A 1NENB 2ON8A 1EU4A 1ACCA 1FRDA 1C4CA 2W3SA 1QLBB 1SB3C 1SJHD 2PKOA 1QOGA 3NVYA 4H2AA 3KWLA 3T3NA 2M19A 1JWUD 2Q5WD 4KX6B 2Y3AA 3AECB 1FD6A 2N9KA 2TSSA 1N5WA 1TKGA 5EE9A 1XLOA 4HROA 1NEKB 3T3OA 1XEEA 2EKIA 2BYTA 2K9XA 1MI0A 1EWCA 1E7PB 2E6XA 3NVWA 3SEBA 3URYA 1OFFA 1TKEA 1OQRA 4WWMA 2BS2B 4ZHPA 1P7EA 1UGJA 4RFBA 4XDCA 1GAQB 1QF6A 3MC0B 2JXTA 2J42A 2J53A 2PIAA 1TS4A 1AWDA 2FUG1 1GB4A 3IT4B 4US8A 3BK1A 1FXIA 1XLPA 3AE4B 1YMHE 4RF1A 2IGDA 3P4SB 1CJEA 3AEGB 1HZ5A 2DYMA 3LYYA 2MJDA 5TSSA 5EE0A 1ZUD2 2BB6A 4NZLB 1ENFA 2W54A 3AE1B 4EE2A 4MACA 1FO4A 5HI1A 3FILA 2RDHA 4IKGA 3Q8BA 2INNE 1KH0A 4ZOHC 1MHHE 4B0EA 2J4XA 3AEDB 1JMLA 1TYGB 4YSYB 2W3RA 1C79A 4GDKB 1I4PA 2V3NA 1SEBD 2INPE 5FKAC 3E56A 1WSPA 1C78A 2ONQA 3MHZA 3NRZA 2K0PA 5BYRA 2PW9A 5BMGA 2PVOD 1LO5D 2MJEA 4RF0A 3U7ZA 2PTLA 3IAM1 3DWMA 1KTKA 2Y5CA 2IJ0A 1JWSD 4A9AA 4L1BA 2AQ1B 4NAMA 2WXHA 2Y5PA 4A8XC 3AMZA 3PZ8A 5D3DA 4N6EB 3KQ4A 3PO0A 2J52A 1PGBA 3BVGA 4JPSA 1V1PB 3EGRA 1QKZA 4LTUA 3VRBB 2YEPB 3BK2A 1YN4A 2WQYB 3IXSA 1CZPA 1FMAD 4KGSA 1SE3A 1HEZE 4L23A 1YJJA 1KLUD 2N7JA 2V0GA 2LHDA 1YJIA 5EE1A 3AB5A 3BVZA 3IT6B 2CU3A 3Q8AA 1Q10A 1T6BX 1L0XB 2FBWB 1D4BA 1XO3A 2IDYA 2BW2A 1SE2A 3BWUD 3GS2A 3VRAB 1TS2A 1SXTA 3NUHB 3I9V1 5FR3A 2LHEA 2ZW1A 1CQVA 1VR9A 2L83A 1GB1A 4OHJA 2AX5A 2WXJA 2K3UA 4YTMB 3W9CB 1E10A 2H89B 2JQRB 1UWMA 4ZRQA 1FCLA 1KF6B 2WXFA 3P4QB 2R61A 1SE4A 2BT6A 1F2RI 5G5HA 2WU5B 4YTPB 3ZJTA 4HKQA 4DXGA 1TJEA 1F2RC 3P4RB 3TUOA 1QOAA 4RGMA 1YN5A 3AE3B 5GXGB 2KACA 3R8BA 1UNSA 4N59A 2LMCA 3W2DA 1WWTA 1N62A 2QSDA 1N61A 1SBBB 2M56B 3HVDA 5BYQA 2WXNA 1ZE3D 1EWYC 1PUTA 4US9A 1DGJA 3R2IA 2LFIA 3GB1A 1E9MA 1VJKA 1AW7A 2BBCA 3ZQ4A 1J7CA 1JWAD 1BUIC 4C7ZA 2PLPA 3U4EG 3ZJVA 3LB8C 4WURA 1CK1A 4RH6A 3UI3A 4ARIA 4WQMA 1XLNA 4C80A 4A90A 2EELA 2WXPA 4GDLB 4KGRA 1P7FA 2MH7A 2WP9B 1AYFA 4JE3B 2QIEB 3NZ3A 1MVKA 1KFYB 4C7YA 3B2GA 4RGNA 1ZPSA 2ACZB 4L2YA 2L52A 3SR6A 2WXIA 4IOIE 4ZYSA 2SAKA 2LUMA 3NVZA 1AN8A 2WXRA 1T3QA 1RYJA 2W55A 2IPKD 1JWBD 1ZDVA 1STEA 4FXCA 1WRIA 4J3OD 2QILA 4OZCA 1TS5A 2I2YA 1M4VA 1SIJA 1KRHA 2G1EA 3I57A 2BTEA 1DYQA 1QQRA 1L4DB 3P63A 1WXQA 1EU3A 1K53A 1UUPA 2Z8LA 4B0MA 2ZW0A 3P1MA 5BMHA 1HZ6A 2AQ2B 3AE6B 1C9FA 2WDRB 4OZAA 5D3IB 2JU6X 4HJGE 1J7AA 3FAHA 3AEFB 4WH4A 1I4HA 3HRDD 4A55A 1FNUA 1NI3A 3V05A 2CJOA 4C56C 1L4ZB 2IGHA 3O13A 4RNAA 4ARCA 1Y56A 2VZKB 3WCQA 1PDXA 3NS1A 3RFZB 4XDDA 4JWSC 4LK0M 2WXQA 1A70A 2AQ3B 2OHFA 5I4DA 1ESFA 2XN9C 4IDIA 2WXMA 2HDEA 3AE5B 3B9JA 4KKJA 4AS1A 1F0ZA 1QOFA 3TSSA 1I4XA 3W5UB 1YQ4B 2WNMA 5H8YE 2DWQA 2WU2B 4GLSC 2KMMA 3L4PA 5H92C 2QEJC 1DOXA 1I4QA 3AEEB 1JROA 1ET9A 1YNTE 2KQ4X 1SSNA 1C76A 1IGDA 1L5PA 2MEKA 1R7SA 3SFDB 2PVGC 4P16A 4HEA1 1L0VB 3KWVA 2NTSA 1I7HA 1N63A 2V4IB 3TEWA 4XE0A 2FE8A 3RPFC 1BXTA 2WLBA 1FFUA 3CWIA 1FRRA 2W82A 1JQ4A 1D6EC 3BIID 1C4PA 1FCCC 4LLGM 3ZJUA 1ROEA 3BVMA 1JWMD 4TQ1A 2GI9A 2XNAC 2L1AA 1V1PA 4HRSA 2HTME 4OVZA 2WXKA 5C3JB 3EUB2 3IAS1 1E0ZA 3AEAB 3W1SA 3Q8FA 3U52E 4DXFA 4ZHOA 3Q8CA 2V3PA 4UDUC 1L6UA 2PMVA 1TZOA 3DWGC 1XF5L 1FXAA 2VZKD 3AE8B 5AUIA 4YTNB 1I4RA 2MJ3A 2I38A 4MT5A 3BZDB 1DOYA 3AM9A 4ZRPA 3ABVB 1QOBA 5C2TB 1PYWD 5HG2A 5T8IA 4AQ7A 1V97A 1UWXA 3FC4A 2QJLA 3CIRB 3P4PB 5AUKA 3ZGZA 3R2TA 1VZ6A 4CQNA 3Q69A 1IBXB 1XCQL 1VRAB 4JWUC 3GP7A 3VQIA 4Q2JA 2JSVX 2K22A 2WS3B 3C8YA 1C77A 1YN3A 2JX5A 1WYGA 2WXLA 1L0YB 4XWTA 3TEXA 1MHXA 2DBYA 3VR9B 2YEPF 3FILB 4TQ0A 1JW9D 1TY0A 2JYEA 1D5ZC 1PGXA 2BS3B 1TS3A 2KDMA 2GB1A 2KWDA 3ZYYX 3B2FA 1D5MC 1F77A 4YSZB 4KGTA 4YWGG 4O1NA 1VZ7A 2CJNA 2WDQB 3EA6A 1NYQA 2BS4B 2SEBD 4RGOS 5FK9C 1N60A 2X38A 4RGTA 1EM7A 1I4GA 1K52A 5JXVA 1GPXA 1FFVA 2G9HD 4XWWA 1ZXIA 3BYTB 3HVZA 4OW0A 5LNK1 5MPOA 1ZDXA 1VDVA 3AN1A 2QMTA 3N9YC 1IBXA 2JYTA 1YQ3B 4PT5A 3VR8B 4DQOC 1HA5A 2WDVB 3MP9A 3P42A 3J9CA 2WXOA 1XXGA 3E9SA 2E3TA 4TSSA 1E6EB 4ITKA 1QILA 3SFEB 1FM0D 4N58A 1K50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KF6 B;  3AEE B;  3P4Q B;  1GAQ B;  2BT6 A;  5G5H A;  1QF6 A;  3AV8 A;  1JRO A;  1V8C A;  2WU5 B;  4YTP B;  2N0S B;  3L4P A;  1L5P A;  2PIA A;  3AE7 B;  1AWD A;  1R7S A;  3SFD B;  2PVG C;  4YSX B;  4US8 A;  1TJE A;  1FXI A;  1XLP A;  3AE4 B;  1L0V B;  3P4R B;  1FIQ A;  1QOA A;  3P4S B;  1I7H A;  1N63 A;  3AE3 B;  5GXG B;  1CJE A;  3AEG B;  4N59 A;  4YXD B;  1VLB A;  2JQR B;  3RPF C;  1WWT A;  1N62 A;  2WLB A;  1FFU A;  3CWI A;  1FRR A;  1N61 A;  5EE3 A;  2MJD A;  1OQQ A;  2M56 B;  3BII D;  1JQ4 A;  1WGK A;  5EE0 A;  1JRP A;  1ZUD 2;  1ROE A;  1DOI A;  3AE2 B;  1EWY C;  1PUT A;  2W54 A;  1DGJ A;  1N5X A;  4US9 A;  4YT0 B;  1IUE A;  3AE1 B;  4HRS A;  1FO4 A;  2HTM E;  3ETR A;  1E9M A;  1VJK A;  5C3J B;  2H88 B;  3EUB 2;  1J7C A;  1JWA D;  1E0Z A;  4ZOH C;  1PFD A;  2K5P A;  4C7Z A;  5H92 C;  3AEA B;  5G5G A;  1JAL A;  3AEB B;  1NYR A;  3AED B;  4YSY B;  1TYG B;  3LB8 C;  4ZHO A;  2W3R A;  1XLQ A;  1L6U A;  3HUI A;  4WQM A;  1XLN A;  3DWG C;  1L6V A;  4C80 A;  1FXA A;  5AUI A;  3AE8 B;  4YTN B;  3AE9 B;  4USA A;  2MJ3 A;  2MH7 A;  2WP9 B;  3W5V B;  1AYF A;  1RFK A;  3NRZ A;  2QIE B;  1RM6 C;  1KFY B;  1DOY A;  1QT9 A;  3AM9 A;  3B2G A;  2PVO D;  3ABV B;  1J7B A;  1QOB A;  5C2T B;  4C7Y A;  2MJE A;  2ACZ B;  2L52 A;  1V97 A;  3SR6 A;  3FC4 A;  3AH7 A;  3DWM A;  2Y5C A;  1ZP0 B;  3NVZ A;  4P6V F;  2QJL A;  1T3Q A;  3CIR B;  1RYJ A;  3P4P B;  5AUK A;  4A9A A;  2W55 A;  3LXF A;  4JWU C;  1JWB D;  2B76 B;  2K22 A;  2WS3 B;  3AMZ A;  2JX5 A;  4FXC A;  4N6E B;  3PO0 A;  1WYG A;  1WRI A;  1NVI D;  2KAJ A;  4JX1 C;  1RWS A;  1ZOY B;  2DBY A;  1TKY A;  3VR9 B;  1B9R A;  1SF0 A;  1SIJ A;  3NVV A;  1KRH A;  2G1E A;  1JW9 D;  2LEK A;  3P63 A;  4LTU A;  1WXQ A;  2BS3 B;  3VRB B;  3ZYY X;  3B2F A;  3P1M A;  2WQY B;  3AE6 B;  2WDR B;  4YSZ B;  1NEN B;  1CZP A;  1FMA D;  1J7A A;  3FAH A;  1FRD A;  2CJN A;  2WDQ B;  3AEF B;  2W3S A;  1NYQ A;  1QLB B;  2BS4 B;  1SB3 C;  2PKO A;  3HRD D;  1QOG A;  1NI3 A;  1N60 A;  1YJJ A;  1GPX A;  3NVY A;  3KWL A;  1FFV A;  1YJI A;  2CJO A;  4N58 A;  5EE1 A;  3AB5 A;  2M19 A;  1ZXI A;  2CU3 A;  2Q5W D;  3HVZ A;  4KX6 B;  3AEC B;  3WCQ A;  1PDX A;  2FBW B;  3NS1 A;  1XO3 A;  5MPO A;  1N5W A;  1TKG A;  4JWS C;  1XLO A;  4HRO A;  5EE9 A;  1VDV A;  1NEK B;  3VRA B;  1A70 A;  3AN1 A;  2EKI A;  2OHF A;  1YQ3 B;  3VR8 B;  2WDV B;  4IDI A;  3AE5 B;  2K9X A;  3B9J A;  1F0Z A;  1E7P B;  3NVW A;  2L83 A;  1QOF A;  1OFF A;  1TKE A;  1OQR A;  3W5U B;  1YQ4 B;  2AX5 A;  2E3T A;  5H8Y E;  4YTM B;  1E6E B;  4WWM A;  2DWQ A;  2BS2 B;  2WU2 B;  4ITK A;  1FM0 D;  2H89 B;  2KMM A;  3SFE B;  3W9C B;  4ZHP A;  1UWM A;  1E10 A;  1DOX A; 
#chains in the Genus database with same CATH topology
 2D3G A;  1V9J A;  2GBK A;  1Y8R C;  1V8C A;  2LRW A;  2M0A A;  3AE7 B;  2IGG A;  1FIQ A;  3N20 C;  4KKI A;  2J0J A;  2OED A;  5EE3 A;  2NS5 A;  2JT4 B;  1T5X D;  2WXG A;  3H8H A;  3AE2 B;  1OEY J;  1N5X A;  1KLG D;  3RNC C;  3ZNG C;  3IVF A;  1VZ8 A;  2KJ6 A;  2IO3 B;  4MEL A;  3TEZ A;  4W9K A;  4B95 A;  2G3Q B;  5D7G A;  2JPH A;  1L6V A;  2KN4 A;  3RZW C;  3PPA A;  1WM2 A;  1RFK A;  4PS8 A;  4WAF A;  3ONS A;  2KOX A;  2JXX A;  4XYC A;  3TEY A;  4AWJ A;  2GRI A;  1PGA A;  2J7Q B;  2N1V A;  4W9G A;  3MFG A;  3V3X A;  2D3B A;  2ZCB A;  3RNA C;  3GE3 C;  4K81 A;  1YJ1 A;  3PHX B;  3VUX A;  2O2V A;  5AZG A;  3V62 A;  4EOY A;  1B9R A;  3NVV A;  4KV2 A;  1C4A A;  1LQB A;  2L7R A;  2ON8 A;  1SB3 C;  2PKO A;  3NVY A;  3T3N A;  1D3Z A;  4JQW C;  4KX6 B;  2Y3A A;  1FD6 A;  2K6D B;  2REX A;  3DDC B;  3T9L A;  2MBB B;  5EE9 A;  1TKG A;  1XEE A;  2EKI A;  1I42 A;  1V80 A;  2KQS A;  2KDI A;  3DVG Y;  3TL5 A;  2DZJ A;  1UGJ A;  4RFB A;  3PRM B;  1QF6 A;  2MBQ A;  3MC0 B;  3QA8 A;  2J53 A;  2OJW A;  3P4S B;  1T0S C;  3S2A A;  5E6O A;  1HZ5 A;  1YX5 B;  2DYM A;  3DVG X;  1KJT A;  1R4M B;  3RNE C;  2BB6 A;  5LLI A;  2W54 A;  4EE2 A;  4MAC A;  5HI1 A;  1T0Q C;  1MHH E;  4RMA A;  4B0E A;  4YSY B;  1JML A;  4G0N B;  2W3R A;  2LI5 A;  2XEW A;  1Z2M A;  4GIV A;  2KX0 A;  3I3T B;  3RNF C;  4BKS A;  4F8C B;  3HK0 A;  1SEB D;  2MBE A;  3E56 A;  1WSP A;  4PK1 A;  3NRZ A;  2MJE A;  4M02 A;  2DZM A;  2BQQ A;  1WR1 A;  2X8X X;  5DCN A;  3VDZ A;  3QCA A;  1ISN A;  3C19 A;  3PO0 A;  2DHZ A;  3DBH B;  3JVZ X;  4WQO B;  3PRE A;  3A1Q B;  3VRB B;  1I35 A;  4NAW A;  4M8N A;  2ZPY A;  3JSV A;  3LJ3 A;  2KWU B;  4L23 A;  1KLU D;  5EE1 A;  3AB5 A;  4FUL A;  1XO3 A;  2IDY A;  2JWZ A;  2MBH A;  2YVC A;  3BWU D;  5FR3 A;  2N7E A;  1CQV A;  3A9K B;  1VR9 A;  4ZRJ A;  2L83 A;  4C00 A;  1HE8 A;  2KLC A;  2C5L C;  4YTM B;  2RGF A;  3W9C B;  5CHW A;  4K7S A;  1UWM A;  3P4Q B;  1SE4 A;  1F2R I;  3A1Q A;  2WU5 B;  3ZJT A;  3ZW3 A;  3GOE A;  2FAZ A;  3P4R B;  1WR6 E;  2KAC A;  3R8B A;  3W2D A;  4WJQ A;  2WX1 A;  2WXN A;  1ZE3 D;  2N9X A;  1WM3 A;  1VJK A;  1AW7 A;  3ZQ4 A;  3PTF C;  3I5J C;  3ZJV A;  5KHO A;  1XLN A;  3VTU A;  2D07 B;  2MH7 A;  4URK A;  1KFY B;  2RPQ A;  4C7Y A;  4LNI A;  2L52 A;  4M0W B;  2VH1 A;  2O6V A;  2WXI A;  2W55 A;  4FXC A;  3U30 A;  2GBR A;  3B1L X;  1MJD A;  1M4V A;  1SIJ A;  3PRZ A;  1DYQ A;  2KT7 A;  1QQR A;  1UUP A;  2Z8L A;  4B0M A;  4WJN A;  3AE6 B;  2EMS A;  1S1Q B;  4HJG E;  1J8C A;  4KIK A;  4WH4 A;  1KOT A;  1P9D U;  4ANX A;  4WWO A;  2IGH A;  3RFZ B;  4LK0 M;  1A70 A;  2AQ3 B;  2OHF A;  3U8Z A;  5I4D A;  4BKG A;  4IDI A;  3B9J A;  1I4X A;  1YQ4 B;  2WNM A;  2DWQ A;  3B0A A;  3APD A;  2LZ6 A;  3L4P A;  2QEJ C;  3AEE B;  1YNT E;  1R4M I;  2KQ4 X;  2MEK A;  5IP4 D;  4K1R B;  3ZXV A;  2PEA A;  3C0R B;  4HEA 1;  4P16 A;  4FHK A;  2CKH B;  3CSF A;  4XE0 A;  3MJW A;  3UQB A;  4NQL B;  1BXT A;  1FFU A;  3UIN B;  4W9J A;  1JQ4 A;  1TIF A;  3ZJU A;  3QHT A;  3DBL B;  3IAS 1;  1WFY A;  4IM0 A;  1GG3 A;  4LNK A;  3AEA B;  3NZS A;  2K8C A;  4DXF A;  4ZHO A;  1RRB A;  1SGH A;  2PMV A;  2C60 A;  1XF5 L;  4LNN A;  3AE8 B;  3WAL A;  4MT5 A;  2FCN A;  4LJO B;  2N4F A;  2LRU A;  4JGH B;  1DOY A;  3AM9 A;  4ZRP A;  2K39 A;  2KDB A;  3P4P B;  4HPM B;  1VZ6 A;  3EHV A;  1IBX B;  1XCQ L;  2WS3 B;  1YN3 A;  1WYG A;  4XWT A;  2RD0 A;  4BVU C;  2EMT A;  1MHX A;  1Q0W B;  5C23 A;  4PYU A;  1JW9 D;  2JYE A;  1PGX A;  2DAF A;  2GLS A;  2JRI B;  2CJN A;  3EA6 A;  2BS4 B;  3ML8 A;  3A33 B;  2RSU A;  2D2Q A;  2KX3 A;  5JXV A;  5C1Z A;  3Q3J A;  1QZE A;  1WRD B;  2Y5B B;  1VDV A;  4FBJ B;  3IBE A;  1IBX A;  1YQ3 B;  1YIW A;  4DQO C;  2INC C;  3MP9 A;  4KDI C;  3J9C A;  3RT3 B;  4AJY B;  3VH4 B;  2DZK A;  2E3T A;  3TIX A;  2IND C;  2ZZP B;  3SDL C;  1K50 A;  2D11 A;  1BT0 A;  4GDL A;  5IO9 A;  3VH3 B;  3IG3 A;  2N0S B;  4BAX A;  4YSX B;  4OZB A;  4RCO A;  3BYY B;  4AJW A;  3EEC A;  2IO2 B;  5L83 A;  2VRR B;  2GOW A;  4MJS B;  1S3S G;  2ZVO A;  1MPE A;  3PT2 B;  4WAA A;  2CU1 A;  1JRP A;  2DYO A;  4IUM B;  2KO3 A;  2RPV A;  3PSE B;  3ZKJ C;  2FIF A;  3DHH C;  4YT0 B;  3Q3F A;  3ETR A;  3ZNI D;  2KNB A;  1FPY A;  5E6N A;  1JAL A;  5AZF A;  1NYR A;  4ACF A;  2FNJ B;  3HUI A;  2QCZ A;  2C9W B;  3KLS X;  1UBQ A;  3AE9 B;  1RM6 C;  2G45 B;  1NDD A;  4HDQ A;  2ZPN A;  3M62 B;  1P0R A;  2KFK B;  1MG4 A;  2CR5 A;  1IGC A;  4WIP A;  4MSM B;  3U2S C;  2N9E B;  3ZTC A;  1M94 A;  2KAJ A;  4S0R A;  1RWS A;  4E71 A;  2L00 B;  3UGB B;  4D2K A;  4DDG D;  1T0Y A;  2WWZ A;  1B1Z A;  4GGQ A;  1KM7 A;  3VUY A;  3ZIM A;  1NEN B;  1ACC A;  5CHF A;  5LXH A;  1SJH D;  2L8J A;  4FJV B;  2M19 A;  1JWU D;  4IM3 A;  4AUQ C;  4EZL A;  1WGH A;  1N5W A;  1NEK B;  3RD2 A;  2KFK A;  4JIO U;  4PS7 A;  3SEB A;  1E7P B;  2E6X A;  1TKE A;  1OQR A;  4WWM A;  1WXM A;  1WXS A;  3TMP B;  1WJN A;  4G50 A;  2L05 A;  2IY1 B;  2J42 A;  3IT4 B;  3I63 C;  3Q3N C;  3AE4 B;  1YMH E;  4RF1 A;  2QDF A;  4MSQ B;  4NQK E;  2CS4 A;  1C1Y B;  3Q2A C;  2KTR B;  5TSS A;  1V81 A;  1OEY A;  2N1W A;  1Q5W B;  2XK5 A;  1ENF A;  3H1U A;  2Z59 B;  4IKG A;  4ZYN A;  1KH0 A;  1GJZ A;  1EUV B;  4MEM A;  2KXJ A;  2J4X A;  1TYG B;  1C79 A;  4GDK B;  5DPR A;  1I4P A;  2V3N A;  5EDS A;  2VH2 A;  2JY6 A;  1WGD A;  5DPW A;  2MP2 A;  5BYR A;  2PW9 A;  5BMG A;  3R7R A;  2M4N A;  1X1M A;  4RF0 A;  2PTL A;  3DPD A;  3IAM 1;  4ICV A;  2ZVN A;  1KTK A;  1UBI A;  1VD2 A;  1JWS D;  4A9A A;  2AQ1 B;  3OG5 A;  4BKS D;  3PZ8 A;  3VVW B;  1J0G A;  2CHX A;  1PGB A;  3N1Z C;  4XC2 A;  3EGR A;  4LTU A;  4DDI D;  1VCB A;  4GDK A;  4E3C A;  3DBS A;  4KGS A;  3WA0 A;  3KUZ A;  1WH3 A;  3R3M A;  1YJJ A;  2N7J A;  3NJT A;  2LHD A;  3IT6 B;  1Q10 A;  1T6B X;  2FBW B;  1TBE A;  3CF6 E;  3I9V 1;  2LHE A;  1P1A A;  3OJ3 A;  1GB1 A;  2WXJ A;  2H89 B;  2JQR B;  1FCL A;  4WJP A;  1TJE A;  1F2R C;  3VTV A;  3TUO A;  3ZLZ A;  1QOA A;  4BOS C;  1YN5 A;  3RUL A;  4CO7 A;  2LMC A;  3APF A;  1PQS A;  2KMC A;  2QSD A;  1N61 A;  3HVD A;  5BYQ A;  3V61 A;  1P98 A;  4I6L B;  4QAY A;  4US9 A;  4LDT D;  4DXA B;  1XD3 B;  2BBC A;  1BUI C;  2M17 A;  2PLP A;  3W1S C;  3LB8 C;  1CK1 A;  2V3S A;  1SE9 A;  4WQM A;  2KFJ A;  2KLG A;  5TR5 A;  4JE3 B;  1AYF A;  3OAW A;  3NZ3 A;  3RNB C;  2HJ8 A;  2NPT B;  4RGN A;  1ZPS A;  2ACZ B;  3UIP B;  2KC1 A;  3ZNZ B;  1AN8 A;  5LXI B;  1C3T A;  1LFD A;  4DHJ B;  2KN5 A;  3RI7 C;  4PS3 A;  2QIL A;  1XQQ A;  3VFK A;  2MHJ A;  3I57 A;  3VHT C;  2BTE A;  3ALB A;  1EU3 A;  1K53 A;  2O6V D;  2ZW0 A;  4BOZ B;  5JHB A;  1HZ6 A;  1J19 A;  1NBF C;  1J7A A;  3HRD D;  3DBR I;  4K7U A;  4GXB A;  4XX5 A;  2CJO A;  4C56 C;  4HPL B;  4RNA A;  1Y56 A;  3BY4 B;  3RMK C;  3WCQ A;  1PDX A;  5GMV A;  2KWV B;  4FJZ A;  2XN9 C;  2HDE A;  3AE5 B;  4AS1 A;  4JL9 A;  3RCZ A;  2HTH A;  4GLS C;  1OQY A;  2HD5 B;  1I4Q A;  1R4N B;  4CYE A;  1C76 A;  1WMH B;  2KWC A;  1P3Q U;  2PVG C;  2BVC A;  3H7P B;  3KWV A;  1E8Y A;  1I7H A;  3N30 A;  3GE8 C;  2FE8 A;  3RPF C;  3DOW A;  3R66 C;  2IZV B;  2L0T A;  2PJH A;  2W82 A;  3CWI A;  1D6E C;  3BII D;  4J6I A;  4XGA B;  4NNJ B;  3BVM A;  4EZJ A;  2XNA C;  1E90 A;  1WX9 A;  4OVZ A;  3N1X C;  2WXK A;  5C3J B;  2DAJ A;  2K1F A;  1OTR B;  2GBM A;  3AXC A;  2MW5 A;  3Q8F A;  3U52 E;  1WE7 A;  3NG0 A;  2AEH A;  3Q8C A;  4WWN A;  1L6U A;  3A4R A;  1UH6 A;  3ZTD A;  3PS6 A;  5AUI A;  4YTN B;  2I38 A;  3DQV A;  3ZO5 B;  3ABV B;  4MH0 E;  2KD0 A;  1RAX A;  1UWX A;  3FC4 A;  3Q69 A;  3A9K A;  3TCA A;  3VQI A;  2K22 A;  3C8Y A;  3OLM D;  1C77 A;  2WDT B;  2WXL A;  1E8Z A;  3FIL B;  4IM2 A;  4TQ0 A;  2BS3 B;  3ZYY X;  3AI5 A;  1F77 A;  5IA7 A;  4YWG G;  4M01 A;  1VZ7 A;  1YX6 B;  2WDQ B;  4HJK A;  1NYQ A;  3PHW B;  5FK9 C;  4RGT A;  1GPX A;  2L3Z A;  1ZXI A;  4OW0 A;  4RM9 A;  1U4A A;  2M8S A;  1UF0 A;  3AN1 A;  3N9Y C;  1EF1 A;  2JYT A;  1F9J A;  2MWS B;  2WDV B;  4NPN A;  3IHP C;  2WXO A;  3V6E B;  1XXG A;  1TT5 B;  4W9H A;  2MLB A;  2WGS A;  3WAN A;  2FID A;  3KYC D;  1LXD A;  3KYD D;  5E6P A;  3H6N A;  2KZR A;  2N9L A;  1FEH A;  2BYE A;  2BB5 A;  2DNF A;  2FCQ A;  1LGR A;  4M0W A;  3NZU A;  5J18 A;  1ZKH A;  2KDF B;  2LGI A;  2LVO A;  3OJ4 B;  5E6J A;  1WGK A;  4HKZ E;  4R3D A;  1TY2 A;  2EKE C;  4BZA A;  2WX0 A;  4PYZ A;  2K5P A;  4MM3 B;  3AEB B;  1D5X C;  5BMI A;  1Q1O A;  1XLQ A;  2JWU A;  3A9J B;  4USA A;  1FNV A;  3WAM A;  2AWT A;  2NMQ A;  1QT9 A;  2K6Q A;  4P7I A;  4A6Q A;  2CHZ A;  1FNW A;  3PLV A;  2JZZ A;  2Z0E B;  3DHI C;  2NBW B;  4P6V F;  2OJR A;  2LGX A;  2B76 B;  4ZDV A;  1NVI D;  2NTT A;  4JX1 C;  1ZOY B;  1SF0 A;  2LEK A;  1ZXH A;  3ML9 A;  3ZDM C;  2JZP A;  2I1J A;  1AAR A;  2W9N A;  1FRD A;  1F1H A;  4OVV A;  5KHQ A;  2D3A A;  1QLB B;  3VXW A;  1WGR A;  4MGI E;  3V6C B;  2Q5W D;  1R4N I;  4GMV A;  3QK0 A;  2K9X A;  1MI0 A;  1EWC A;  3NVW A;  3URY A;  1GC7 A;  1OFF A;  2R2Q A;  4LJP B;  2BS2 B;  2BWF A;  1E5W A;  4W9E A;  4KDL B;  1E7V A;  4XDC A;  2LUE A;  2JXT A;  1TZ1 A;  4JLC A;  1TS4 A;  1AWD A;  2FUG 1;  2MA9 B;  4G3X B;  2PE9 A;  3X23 A;  5AEK B;  1H8C A;  4GB9 A;  5G55 A;  3AEG B;  3PRP B;  3LYY A;  3NOB A;  2MJD A;  3L54 A;  3Q14 C;  4NZL B;  4GOC A;  3AE1 B;  1E8W A;  1TTN A;  2RDH A;  3MHS D;  4TV3 A;  2INN E;  4KSK C;  3AED B;  3O65 B;  4CHK A;  2D10 A;  5JHA A;  4A3P A;  2A5U A;  2MQJ A;  3LDZ E;  2BWE S;  1C78 A;  4B6W A;  3NY5 A;  1LO5 D;  3QAR A;  3ZVV A;  3DWM A;  2XBB C;  2Y5C A;  3HIZ A;  4K3B A;  2IJ0 A;  4NAM A;  3QAQ A;  2Y5P A;  4A8X C;  3AMZ A;  4N6E B;  3RZF A;  3KQ4 A;  4JPS A;  1XT9 B;  1V1P B;  3QC8 B;  1WYW B;  4HXD A;  2BGF A;  1QKZ A;  1WJ6 A;  1KLV A;  3BK2 A;  2WQY B;  4E74 A;  1UZX B;  2LVQ A;  3IXS A;  1CZP A;  3RUI B;  4MJS A;  2NBU A;  1YJI A;  3ENE A;  4EZK A;  4F7Z A;  3L08 A;  3Q8A A;  1D4B A;  1L0X B;  2K25 A;  2L76 A;  3T8M A;  1H4R A;  3GS2 A;  3VRA B;  1TS2 A;  1SXT A;  3NUH B;  2ZW1 A;  1GC6 A;  3DHG C;  1WGG A;  1WJU A;  2AX5 A;  2K3U A;  1E10 A;  3SHQ A;  1KF6 B;  4EKU A;  2R61 A;  5G5H A;  3ZXR A;  1V5T A;  4YTP B;  3V60 A;  2RDB C;  4HKQ A;  5IN7 A;  4DXG A;  4M8M A;  2ZJD A;  4DHZ B;  3L16 A;  3AE3 B;  3NS8 A;  5GXG B;  1UNS A;  4N59 A;  4NJ6 A;  1F52 A;  2M56 B;  2BYV E;  3DBR B;  1DGJ A;  2LFI A;  2LVP A;  1E9M A;  4LNF A;  5CHV C;  1JWA D;  3GZN I;  4GSW A;  2KJR A;  3U4E G;  3VUW A;  3PLU A;  4WUR A;  4RH6 A;  3UI3 A;  1IYF A;  4BFR A;  4A90 A;  2WXP A;  4YL8 A;  4IWO A;  1P7F A;  1MVK A;  5IKC M;  3B2G A;  2M1M A;  3SR6 A;  2SAK A;  3NVZ A;  2WXR A;  2FCM A;  1T3Q A;  1RYJ A;  1WX7 A;  2ZEQ A;  3PZD A;  2IPK D;  3UIO B;  1JWB D;  2IBI B;  1STE A;  3ZUN A;  3L13 A;  4OZC A;  1A5R A;  2NBV B;  4A3O A;  4LNO A;  2L0F A;  2LJ5 A;  3JYU A;  1KRH A;  1L4D B;  1WXQ A;  3QQ8 B;  3P1M A;  5BMH A;  1C9F A;  4ASW C;  2JZ3 B;  2HJ1 A;  2KDE B;  5CTR C;  2JU6 X;  2WHI A;  3KUC B;  3M95 A;  4A55 A;  3WAO A;  2KTR A;  4AOF A;  1L4Z B;  4F1S A;  4ARC A;  2VZK B;  3W1Y A;  4XDD A;  3L10 B;  2WXQ A;  1WJ4 A;  2WXM A;  3B08 A;  1F0Z A;  4KVG B;  3PV1 A;  4I6P A;  2KMM A;  5J17 A;  5H92 C;  2MSE D;  2O2V B;  1JRO A;  3KW5 B;  1L5P A;  1UEL A;  3ZRF A;  4DHJ D;  2AL6 A;  3TEW A;  2GMI C;  3EFC A;  2WLB A;  3N1Y C;  1FCC C;  3KUD B;  1ROE A;  1JWM D;  3AUL A;  3D32 A;  2GI9 A;  5DPS A;  2HTM E;  3M63 B;  3EUB 2;  3AU4 A;  2K8H A;  1WXV A;  3W1S A;  3ZDT A;  2LXC A;  2KC2 A;  4W9C A;  2LXA A;  1I4R A;  2MJ3 A;  4K3C A;  1MG8 A;  3BZD B;  1HTO A;  5J2R A;  1QOB A;  5C2T B;  1PYW D;  2KK8 A;  5HG2 A;  5JH5 C;  2UU7 A;  2UYZ B;  5AUK A;  3ZGZ A;  4JWU C;  3GP7 A;  4Q2J A;  4ZRK A;  2LD9 A;  3UF8 A;  1L0Y B;  4XZ4 A;  4C4V B;  2BKF A;  5BO4 B;  3TEX A;  4DHZ E;  3VR9 B;  5HKH A;  1TY0 A;  1D5Z C;  4FHJ A;  1TS3 A;  2KDM A;  2KWD A;  3B2F A;  1D5M C;  4YSZ B;  2IYD B;  4II2 B;  4WJO A;  2X38 A;  1K52 A;  2BF8 B;  1FFV A;  2G9H D;  1ZW7 A;  2R2O A;  3DCG A;  3HVZ A;  4HPP A;  2MRP A;  3CST A;  3KVF B;  3EC8 A;  4N9F 4;  4IG7 B;  3VR8 B;  4MGZ E;  1HA5 A;  3H9D A;  4B9K A;  3X0W A;  4C4V A;  4TSS A;  1YD8 U;  1E6E B;  4ITK A;  1QIL A;  1FM0 D;  4N58 A;  4MGY E;  3PZ7 A;  4TMA B;  4NJC A;  3AV8 A;  2PPH A;  5BYS A;  2NPT A;  1BML C;  1WX8 A;  2LJI A;  2D5G A;  2ICI A;  4BBN C;  4NAW B;  2UWQ A;  1IPG A;  1NI2 A;  4REZ A;  2KHW B;  3JSV B;  1XCT L;  4DK5 A;  1VLB A;  4ANU A;  2DLB A;  5G2N A;  1LM8 B;  5HFY A;  1OQQ A;  2RMM A;  4BKT A;  1DOI A;  3MJ5 A;  1EO6 A;  1IUE A;  4KZC A;  3Q8E A;  2H88 B;  4IWP A;  1PFD A;  5G5G A;  3QWZ B;  2DZI A;  4W9D A;  1WZ3 A;  4W9I A;  3RN9 C;  1GOZ A;  4HCP B;  1HXY D;  3OWE B;  4MH8 A;  2V4L A;  2KAN A;  2NCN A;  3W5V B;  2KVR A;  1V1O A;  1N6Z A;  3FKY A;  4LDT B;  4EEW A;  1HQR D;  2C7M B;  2RDG A;  4YXD B;  4A20 A;  1J7B A;  5HHD G;  1SJE D;  3AH7 A;  1WY8 A;  1ZP0 B;  3ECI A;  3LXF A;  4II3 B;  3APC A;  1UGM A;  2KYW A;  4X57 B;  1E7U A;  1ET6 A;  1WZ0 A;  2LGD A;  1JCK B;  3R7Q A;  1TKY A;  1WMH A;  2DYB A;  2NR2 A;  5AZH A;  5IOI A;  3ZRC A;  1WXA A;  3H7P A;  2ZNV B;  1K51 A;  2L32 A;  5D94 A;  2AYO B;  1EU4 A;  1C4C A;  2W3S A;  5IAA C;  1QOG A;  1GNU A;  4H2A A;  3KWL A;  2A4Z A;  3AEC B;  4FA6 A;  2N9K A;  3RNG C;  2TSS A;  4ANW A;  3QJZ A;  1XLO A;  4HRO A;  2MBO A;  2O6V B;  3T3O A;  2BYT A;  3QX1 A;  3WAP A;  2LGY A;  2J0K A;  1YQB A;  4G11 A;  4ZHP A;  1P7E A;  1V5O A;  1GAQ B;  2LAS A;  2YLM A;  3MC9 A;  2PIA A;  1GB4 A;  2QC8 A;  4GN1 A;  4US8 A;  3BK1 A;  1FXI A;  1XLP A;  4HDO A;  2IGD A;  3TJP A;  4KIK B;  1CJE A;  4W9F A;  2N9P C;  1RLF A;  4FJY A;  3L0W B;  5EE0 A;  1ZUD 2;  2KQ7 A;  1Z5S B;  1FO4 A;  3FIL A;  3Q8B A;  4ZOH C;  4I6N B;  2C7H A;  2ZNV C;  2WYQ A;  3Q3O C;  3JW0 X;  2IY0 B;  2INP E;  5FKA C;  4BBN F;  4K7W A;  2ONQ A;  2ASQ A;  3MHZ A;  2K0P A;  2N7D A;  1HTQ A;  4RM8 A;  2PVO D;  4KSL C;  2ZCC A;  3U7Z A;  3MTN B;  4L1B A;  2B3A A;  2WXH A;  2J0M A;  2OOB B;  2KKC A;  5D3D A;  2J52 A;  1GUA B;  3H7S A;  2IO0 B;  3BVG A;  2DX5 B;  2YEP B;  5FR6 A;  1YN4 A;  3AU5 A;  4HVB A;  3CMM B;  1FMA D;  3GZN B;  1E8X A;  2BYF A;  2KVZ A;  5D6J B;  2JF5 A;  3P2B A;  1SE3 A;  1WI0 A;  1HEZ E;  2KJH B;  2V0G A;  3KH0 A;  3L17 A;  2KTF A;  3IFW B;  1OGW A;  3BVZ A;  1TGZ B;  2CU3 A;  3SU8 X;  5JZE B;  2BW2 A;  1SE2 A;  4FAD A;  4MGK E;  1V86 A;  4MM3 A;  2JRH A;  5CX3 A;  2GBJ A;  4OHJ A;  4WWP A;  4AP4 C;  3A9J A;  4ZRQ A;  2WXF A;  2BT6 A;  4NY0 A;  2JVC A;  1IP9 A;  4TKN A;  3ZNH B;  4RGM A;  4HWI B;  3VAW A;  3EFU A;  1EF5 A;  1WWT A;  1N62 A;  2IO1 B;  3DBH I;  2I1K A;  4FLH A;  1SBB B;  4P1C C;  1EWY C;  1PUT A;  3DVN U;  3R2I A;  4DWF A;  3GB1 A;  4M00 A;  4IWQ A;  1RFA A;  1J7C A;  2FCS A;  1ZGU B;  3SD5 A;  4C7Z A;  1K8R B;  1L2N A;  3PVL A;  4ARI A;  3PGE A;  4C80 A;  2EEL A;  4GDL B;  4KGR A;  2WP9 B;  2BPS A;  3UQA A;  3M3J A;  2QIE B;  4L2Y A;  4IOI E;  3NHE B;  4ZYS A;  2LUM A;  1G6J A;  1JRU A;  4DBG A;  4FN2 A;  1ZDV A;  4NJ7 A;  2V9H A;  1WRI A;  4J3O D;  1TS5 A;  2I2Y A;  2FUH B;  2G1E A;  3HM6 X;  3P63 A;  4LCD E;  2AQ2 B;  4W9L A;  2V1Y A;  2WDR B;  1FXT B;  4OZA A;  5D3I B;  3N32 A;  3FAH A;  1V6E A;  3AEF B;  1I4H A;  1FNU A;  1NI3 A;  3V05 A;  4EFO A;  2RR9 A;  3O13 A;  2HE7 A;  1T0R C;  3NS1 A;  2C7N B;  4JWS C;  3VTW A;  1ESF A;  2G4D B;  4KKJ A;  1QOF A;  3TSS A;  3W5U B;  3WIM A;  2KMA A;  5H8Y E;  1WIA A;  2WU2 B;  2NVU I;  1MFW A;  1DOX A;  2K8B A;  1V2Y A;  3QIJ A;  1ET9 A;  3Q6B A;  1SSN A;  3TBL D;  4ANV A;  1IGD A;  4IW0 A;  1R7S A;  3SFD B;  2Z0D B;  2DEN B;  1L0V B;  2NTS A;  4HLE A;  1N63 A;  4EUT A;  2V4I B;  1YOV B;  1FRR A;  3U7D A;  1C4P A;  2D3C A;  4LLG M;  3MC8 A;  5DPT A;  3RYT A;  4TQ1 A;  2L1A A;  1V1P A;  4HRS A;  2LGS A;  1E0Z A;  1L7Y A;  4ZRI A;  2JUO A;  2V3P A;  4UDU C;  4TUU A;  1TZO A;  2CHW A;  2GBN A;  3DWG C;  1FXA A;  2VZK D;  2MCN B;  2BKR B;  4P1B C;  2MX2 A;  4HCN B;  3HM3 A;  2M0X A;  5L95 C;  5T8I A;  2PE6 B;  4AQ7 A;  1UD7 A;  1V97 A;  4MDK E;  2QJL A;  3CIR B;  4GU2 A;  3R2T A;  4CQN A;  3DVN V;  1VRA B;  2JSV X;  3N3K B;  2LWP A;  1WF9 A;  2JX5 A;  2XK5 B;  2DBY A;  4KZ0 A;  2YEP F;  2GB1 A;  4S17 A;  3BIN A;  2QHO A;  4IC7 B;  4KGT A;  3K9P B;  4O1N A;  4OVU A;  1WGY A;  5D2M B;  2SEB D;  4RGO S;  1N60 A;  1EM7 A;  1I4G A;  3DBL I;  2G4S A;  2MP2 B;  4XWW A;  1SIF A;  3BYT B;  4ICU A;  4HK2 A;  5LNK 1;  5MPO A;  1V49 A;  1ZDX A;  1WE6 A;  3K9O B;  1CMX B;  3A4S C;  2QMT A;  4PT5 A;  3HHM A;  3P42 A;  3Q3M C;  3E9S A;  2AL3 A;  3SFE B; 
#chains in the Genus database with same CATH homology
 3PZ7 A;  4TMA B;  4NJC A;  3AV8 A;  1V8C A;  2N0S B;  5BYS A;  2M0A A;  3AE7 B;  1BML C;  2N9L A;  1FEH A;  2LJI A;  2D5G A;  2ICI A;  4YSX B;  4OZB A;  2IGG A;  2BB5 A;  3BYY B;  4NAW B;  4RCO A;  1FIQ A;  4M0W A;  4REZ A;  1XCT L;  1VLB A;  2LGI A;  4KKI A;  2DLB A;  1MPE A;  2OED A;  5E6J A;  5EE3 A;  5HFY A;  1OQQ A;  1WGK A;  4HKZ E;  1JRP A;  2DYO A;  1T5X D;  2RMM A;  2WXG A;  4R3D A;  2RPV A;  3H8H A;  1DOI A;  3AE2 B;  3MJ5 A;  1N5X A;  1TY2 A;  4YT0 B;  1IUE A;  1KLG D;  3ETR A;  3Q8E A;  2H88 B;  1PFD A;  2K5P A;  1VZ8 A;  4MM3 B;  5G5G A;  1JAL A;  3AEB B;  1NYR A;  1D5X C;  3TEZ A;  1GOZ A;  1HXY D;  5BMI A;  1XLQ A;  3HUI A;  3OWE B;  5D7G A;  2JWU A;  1L6V A;  2KN4 A;  4MH8 A;  3KLS X;  3AE9 B;  4USA A;  1FNV A;  3W5V B;  1RFK A;  1V1O A;  1RM6 C;  4WAF A;  1HQR D;  2NMQ A;  2RDG A;  1QT9 A;  4YXD B;  1J7B A;  5HHD G;  4A6Q A;  1SJE D;  1FNW A;  3TEY A;  3AH7 A;  1ZP0 B;  4P6V F;  2GRI A;  1PGA A;  3LXF A;  1IGC A;  3MFG A;  2B76 B;  4WIP A;  3V3X A;  3U2S C;  1ET6 A;  1NVI D;  2KAJ A;  2NTT A;  4JX1 C;  1JCK B;  1RWS A;  1ZOY B;  1TKY A;  1B9R A;  1SF0 A;  3NVV A;  2LEK A;  1C4A A;  4D2K A;  1ZXH A;  1B1Z A;  2JZP A;  1K51 A;  2L32 A;  1NEN B;  2ON8 A;  1EU4 A;  1ACC A;  1FRD A;  1C4C A;  2W3S A;  1QLB B;  1SB3 C;  1SJH D;  2PKO A;  1QOG A;  3NVY A;  4H2A A;  3KWL A;  3T3N A;  2M19 A;  1JWU D;  2Q5W D;  4KX6 B;  2Y3A A;  3AEC B;  1FD6 A;  2N9K A;  2TSS A;  1N5W A;  1TKG A;  5EE9 A;  1XLO A;  4HRO A;  1NEK B;  3T3O A;  1XEE A;  2EKI A;  2BYT A;  2K9X A;  1MI0 A;  1EWC A;  1E7P B;  2E6X A;  3NVW A;  3SEB A;  3URY A;  1OFF A;  1TKE A;  1OQR A;  4WWM A;  2BS2 B;  4ZHP A;  1P7E A;  1UGJ A;  4RFB A;  4XDC A;  1GAQ B;  1QF6 A;  3MC0 B;  2JXT A;  2J42 A;  2J53 A;  2PIA A;  1TS4 A;  1AWD A;  2FUG 1;  1GB4 A;  3IT4 B;  4US8 A;  3BK1 A;  1FXI A;  1XLP A;  3AE4 B;  1YMH E;  4RF1 A;  2IGD A;  3P4S B;  1CJE A;  3AEG B;  1HZ5 A;  2DYM A;  3LYY A;  2MJD A;  5TSS A;  5EE0 A;  1ZUD 2;  2BB6 A;  4NZL B;  1ENF A;  2W54 A;  3AE1 B;  4EE2 A;  4MAC A;  1FO4 A;  5HI1 A;  3FIL A;  2RDH A;  4IKG A;  3Q8B A;  2INN E;  1KH0 A;  4ZOH C;  1MHH E;  4B0E A;  2J4X A;  3AED B;  1JML A;  1TYG B;  4YSY B;  2W3R A;  1C79 A;  4GDK B;  1I4P A;  2V3N A;  1SEB D;  2INP E;  5FKA C;  3E56 A;  1WSP A;  1C78 A;  2ONQ A;  3MHZ A;  3NRZ A;  2K0P A;  5BYR A;  2PW9 A;  5BMG A;  2PVO D;  1LO5 D;  2MJE A;  4RF0 A;  3U7Z A;  2PTL A;  3IAM 1;  3DWM A;  1KTK A;  2Y5C A;  2IJ0 A;  1JWS D;  4A9A A;  4L1B A;  2AQ1 B;  4NAM A;  2WXH A;  2Y5P A;  4A8X C;  3AMZ A;  3PZ8 A;  5D3D A;  4N6E B;  3KQ4 A;  3PO0 A;  2J52 A;  1PGB A;  3BVG A;  4JPS A;  1V1P B;  3EGR A;  1QKZ A;  4LTU A;  3VRB B;  2YEP B;  3BK2 A;  1YN4 A;  2WQY B;  3IXS A;  1CZP A;  1FMA D;  4KGS A;  1SE3 A;  1HEZ E;  4L23 A;  1YJJ A;  1KLU D;  2N7J A;  2V0G A;  2LHD A;  1YJI A;  5EE1 A;  3AB5 A;  3BVZ A;  3IT6 B;  2CU3 A;  3Q8A A;  1Q10 A;  1T6B X;  1L0X B;  2FBW B;  1D4B A;  1XO3 A;  2IDY A;  2BW2 A;  1SE2 A;  3BWU D;  3GS2 A;  3VRA B;  1TS2 A;  1SXT A;  3NUH B;  3I9V 1;  5FR3 A;  2LHE A;  2ZW1 A;  1CQV A;  1VR9 A;  2L83 A;  1GB1 A;  4OHJ A;  2AX5 A;  2WXJ A;  2K3U A;  4YTM B;  3W9C B;  1E10 A;  2H89 B;  2JQR B;  1UWM A;  4ZRQ A;  1FCL A;  1KF6 B;  2WXF A;  3P4Q B;  2R61 A;  1SE4 A;  2BT6 A;  1F2R I;  5G5H A;  2WU5 B;  4YTP B;  3ZJT A;  4HKQ A;  4DXG A;  1TJE A;  1F2R C;  3P4R B;  3TUO A;  1QOA A;  4RGM A;  1YN5 A;  3AE3 B;  5GXG B;  2KAC A;  3R8B A;  1UNS A;  4N59 A;  2LMC A;  3W2D A;  1WWT A;  1N62 A;  2QSD A;  1N61 A;  1SBB B;  2M56 B;  3HVD A;  5BYQ A;  2WXN A;  1ZE3 D;  1EWY C;  1PUT A;  4US9 A;  1DGJ A;  3R2I A;  2LFI A;  3GB1 A;  1E9M A;  1VJK A;  1AW7 A;  2BBC A;  3ZQ4 A;  1J7C A;  1JWA D;  1BUI C;  4C7Z A;  2PLP A;  3U4E G;  3ZJV A;  3LB8 C;  4WUR A;  1CK1 A;  4RH6 A;  3UI3 A;  4ARI A;  4WQM A;  1XLN A;  4C80 A;  4A90 A;  2EEL A;  2WXP A;  4GDL B;  4KGR A;  1P7F A;  2MH7 A;  2WP9 B;  1AYF A;  4JE3 B;  2QIE B;  3NZ3 A;  1MVK A;  1KFY B;  4C7Y A;  3B2G A;  4RGN A;  1ZPS A;  2ACZ B;  4L2Y A;  2L52 A;  3SR6 A;  2WXI A;  4IOI E;  4ZYS A;  2SAK A;  2LUM A;  3NVZ A;  1AN8 A;  2WXR A;  1T3Q A;  1RYJ A;  2W55 A;  2IPK D;  1JWB D;  1ZDV A;  1STE A;  4FXC A;  1WRI A;  4J3O D;  2QIL A;  4OZC A;  1TS5 A;  2I2Y A;  1M4V A;  1SIJ A;  1KRH A;  2G1E A;  3I57 A;  2BTE A;  1DYQ A;  1QQR A;  1L4D B;  3P63 A;  1WXQ A;  1EU3 A;  1K53 A;  1UUP A;  2Z8L A;  4B0M A;  2ZW0 A;  3P1M A;  5BMH A;  1HZ6 A;  2AQ2 B;  3AE6 B;  1C9F A;  2WDR B;  4OZA A;  5D3I B;  2JU6 X;  4HJG E;  1J7A A;  3FAH A;  3AEF B;  4WH4 A;  1I4H A;  3HRD D;  4A55 A;  1FNU A;  1NI3 A;  3V05 A;  2CJO A;  4C56 C;  1L4Z B;  2IGH A;  3O13 A;  4RNA A;  4ARC A;  1Y56 A;  2VZK B;  3WCQ A;  1PDX A;  3NS1 A;  3RFZ B;  4XDD A;  4JWS C;  4LK0 M;  2WXQ A;  1A70 A;  2AQ3 B;  2OHF A;  5I4D A;  1ESF A;  2XN9 C;  4IDI A;  2WXM A;  2HDE A;  3AE5 B;  3B9J A;  4KKJ A;  4AS1 A;  1F0Z A;  1QOF A;  3TSS A;  1I4X A;  3W5U B;  1YQ4 B;  2WNM A;  5H8Y E;  2DWQ A;  2WU2 B;  4GLS C;  2KMM A;  3L4P A;  5H92 C;  2QEJ C;  1DOX A;  1I4Q A;  3AEE B;  1JRO A;  1ET9 A;  1YNT E;  2KQ4 X;  1SSN A;  1C76 A;  1IGD A;  1L5P A;  2MEK A;  1R7S A;  3SFD B;  2PVG C;  4P16 A;  4HEA 1;  1L0V B;  3KWV A;  2NTS A;  1I7H A;  1N63 A;  2V4I B;  3TEW A;  4XE0 A;  2FE8 A;  3RPF C;  1BXT A;  2WLB A;  1FFU A;  3CWI A;  1FRR A;  2W82 A;  1JQ4 A;  1D6E C;  3BII D;  1C4P A;  1FCC C;  4LLG M;  3ZJU A;  1ROE A;  3BVM A;  1JWM D;  4TQ1 A;  2GI9 A;  2XNA C;  2L1A A;  1V1P A;  4HRS A;  2HTM E;  4OVZ A;  2WXK A;  5C3J B;  3EUB 2;  3IAS 1;  1E0Z A;  3AEA B;  3W1S A;  3Q8F A;  3U52 E;  4DXF A;  4ZHO A;  3Q8C A;  2V3P A;  4UDU C;  1L6U A;  2PMV A;  1TZO A;  3DWG C;  1XF5 L;  1FXA A;  2VZK D;  3AE8 B;  5AUI A;  4YTN B;  1I4R A;  2MJ3 A;  2I38 A;  4MT5 A;  3BZD B;  1DOY A;  3AM9 A;  4ZRP A;  3ABV B;  1QOB A;  5C2T B;  1PYW D;  5HG2 A;  5T8I A;  4AQ7 A;  1V97 A;  1UWX A;  3FC4 A;  2QJL A;  3CIR B;  3P4P B;  5AUK A;  3ZGZ A;  3R2T A;  1VZ6 A;  4CQN A;  3Q69 A;  1IBX B;  1XCQ L;  1VRA B;  4JWU C;  3GP7 A;  3VQI A;  4Q2J A;  2JSV X;  2K22 A;  2WS3 B;  3C8Y A;  1C77 A;  1YN3 A;  2JX5 A;  1WYG A;  2WXL A;  1L0Y B;  4XWT A;  3TEX A;  1MHX A;  2DBY A;  3VR9 B;  2YEP F;  3FIL B;  4TQ0 A;  1JW9 D;  1TY0 A;  2JYE A;  1D5Z C;  1PGX A;  2BS3 B;  1TS3 A;  2KDM A;  2GB1 A;  2KWD A;  3ZYY X;  3B2F A;  1D5M C;  1F77 A;  4YSZ B;  4KGT A;  4YWG G;  4O1N A;  1VZ7 A;  2CJN A;  2WDQ B;  3EA6 A;  1NYQ A;  2BS4 B;  2SEB D;  4RGO S;  5FK9 C;  1N60 A;  2X38 A;  4RGT A;  1EM7 A;  1I4G A;  1K52 A;  5JXV A;  1GPX A;  1FFV A;  2G9H D;  4XWW A;  1ZXI A;  3BYT B;  3HVZ A;  4OW0 A;  5LNK 1;  5MPO A;  1ZDX A;  1VDV A;  3AN1 A;  2QMT A;  3N9Y C;  1IBX A;  2JYT A;  1YQ3 B;  4PT5 A;  3VR8 B;  4DQO C;  1HA5 A;  2WDV B;  3MP9 A;  3P42 A;  3J9C A;  2WXO A;  1XXG A;  3E9S A;  2E3T A;  4TSS A;  1E6E B;  4ITK A;  1QIL A;  3SFE B;  1FM0 D;  4N58 A;  1K50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...