2D07B

Crystal structure of sumo-3-modified thymine-dna glycosylase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G/T mismatch-specific thymine DNA glycosylase
publication title Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d07B00
3EHVA 2G45B 4GMVA 2BWES 2NS5A 3RCZA 2D3GA 3EC8A 1JRUA 4IUMB 2DYBA 2RR9A 2RD0A 5J2RA 3ENEA 3BY4B 2GBRA 4EUTA 3KVFB 2HD5B 4LDTD 1KJTA 1E8YA 4JQWC 4KVGB 3WIMA 1M94A 3DBHI 3W1SC 2N4FA 2ZPNA 4GDKA 2ZNVB 2KNBA 4HWIB 3X0WA 2C9WB 2PE6B 1EF1A 1WGGA 2MLBA 4XC2A 3UINB 3ZTDA 1WJ4A 3ZDTA 4TQ0A 1YD8U 3ALBA 3VVWB 2CU1A 3DVGY 4E3CA 2IY1B 4MM3A 3BINA 3DBLI 4YL8A 4DDGD 1RAXA 2KMAA 4MGZE 4NJ6A 4EFOA 3QAQA 5CHFA 3DVGX 4HLEA 2C7MB 2IY0B 2LGDA 2MW5A 3PPAA 4PS8A 4FLHA 1ZW7A 2BPSA 2Z0EB 4ICUA 4PYZA 4PS3A 4BBNC 2IO0B 3VHTC 2KDEB 3H7SA 2RPQA 1WXAA 3PSEB 2NBWB 1S1QB 4KIKA 1Q1OA 2DYOA 3DVNV 5AZFA 3ZLZA 4A3OA 4ANXA 4ANUA 2CS4A 3DBSA 3ZNGC 4ZDVA 1R4MI 4W9FA 2LRUA 1KM7A 4E74A 3K9PB 2DAJA 3IG3A 5D2MB 4KSLC 3Q3FA 5AZHA 1WI0A 3EFUA 3U7DA 2EKEC 3PTFC 1FXTB 3RYTA 2ZZPB 2LWPA 5JZEB 2AWTA 2DHZA 2O6VB 1I42A 1OEYA 2BKRB 2KO3A 4ZRKA 3VH4B 4OVUA 2ZPYA 5DPRA 3ZW3A 2IO2B 3CSTA 2R2OA 2KK8A 1V9JA 2KTRA 4RM8A 1J19A 5HKHA 2BYVE 1SIFA 4HXDA 2IYDB 1WXSA 2IO1B 3ML8A 1BT0A 2IZVB 1V81A 2YLMA 4IWOA 1V86A 2UYZB 4IM3A 2CHZA 3TCAA 3IHPC 4MSMB 4P7IA 3HIZA 3ONSA 3A9JB 2EMSA 3PHXB 4FBJB 4HDQA 3ZRFA 2I1JA 1X1MA 4LJOB 3V61A 4HK2A 4BVUC 3AI5A 4DK5A 2MP2A 2LGYA 2ZJDA 3H7PA 2G4DB 4IC7B 2O6VD 1UD7A 2KKCA 3KUZA 2N1WA 5G55A 1Q0WB 2OJRA 4GGQA 4JGHB 2MX2A 3RUIB 2B3AA 2FNJB 1VD2A 4IWPA 2L05A 4NNJB 2XEWA 4IWQA 3R7RA 4FJYA 1KOTA 4M8NA 2DYMA 2KWVB 4ICVA 3QCAA 4IM0A 3RZFA 4AJWA 4II3B 1WE7A 4I6LB 5CTRC 1EF5A 3V6EB 4KV2A 4MDKE 3DVNU 3RT3B 4WAAA 1TZ1A 2L76A 2KJ6A 2K39A 5DPTA 2N9PC 3KYDD 3PHWB 5D7GA 4G3XB 4W9DA 4DDID 3SU8X 2JF5A 5J17A 4HDOA 1WF9A 2LD9A 5DPSA 3JSVA 4NY0A 4AUQC 3OLMD 4BKSD 2DZJA 3OJ4B 3RZWC 1WGDA 2HJ8A 3UF8A 5D6JB 3QHTA 5JHAA 2R2QA 4TKNA 2KX3A 3PREA 3QC8B 4HCNB 3UGBB 3PLUA 3PGEA 3NOBA 1XQQA 4TUUA 2WDTB 2G4SA 4M8MA 1WGYA 3EECA 5G2NA 4EKUA 1E8XA 2AL3A 2K6QA 4WJOA 1CMXB 2KHWB 2KLGA 3D32A 4PYUA 3QA8A 4HPMB 1V6EA 4RM9A 1P3QU 3A9KB 1UELA 3OAWA 2FCMA 4FJZA 5GMVA 4F1SA 2I1KA 2J0KA 1GNUA 2NBVB 4NPNA 1C1YB 3L17A 2K25A 2PEAA 2GBNA 2KDIA 3A9KA 5KHOA 1H4RA 2ZCCA 3QX1A 4GB9A 3S2AA 3PRMB 1SGHA 3MJWA 4G11A 2V1YA 3PT2B 2KOXA 2IBIB 3TBLD 1GC6A 1VCBA 4FJVB 1WH3A 2HE7A 1T0YA 3GZNI 4B9KA 2NPTB 2KJHB 1S3SG 2D11A 2DZMA 1ZKHA 2M17A 2ZVNA 4EZJA 1L2NA 1P98A 1P1AA 4KDLB 1IP9A 1WX9A 4GOCA 4X57B 2MWSB 1E90A 2N9EB 3V62A 4OVVA 3ZNHB 1WYWB 2A5UA 2KC1A 5LXHA 5D94A 2O2VB 1I35A 3WALA 2KDFB 4FN2A 2BGFA 3QARA 1A5RA 1F9JA 4F8CB 2YVCA 2LGXA 2MBQA 2MBEA 5BO4B 2FIDA 2RGFA 4KSKC 3SDLC 4W9HA 4B95A 4LCDE 1RFAA 2Z59B 2MA9B 1WGHA 2AEHA 2KVRA 3N32A 2KFKB 1LFDA 2LJ5A 3VUWA 3KYCD 3OJ3A 2JWZA 3HM3A 3MHSD 3WAOA 4BFRA 2JZZA 5KHQA 3JYUA 2D2QA 4K1RB 4B6WA 3VFKA 1IYFA 4ANWA 2KDBA 2WYQA 4EOYA 5J18A 2GBKA 1WXVA 1E5WA 4K7SA 3V60A 5E6NA 4HPLB 4IM2A 3PRZA 1GUAB 2O6VA 1ZGUB 2MBOA 3RULA 4JLCA 1UZXB 1NDDA 4WJQA 4DHZE 1H8CA 2WX1A 4ASWC 2NVUI 3H9DA 3SD5A 2LZ6A 3QIJA 3H6NA 5LLIA 2LI5A 2N1VA 2KLCA 2MSED 3X23A 2L3ZA 3PVLA 2KC2A 4BKTA 1WX8A 3WA0A 4W9CA 2C7NB 3VXWA 2BYFA 4G50A 1U4AA 1E7VA 2Y5BB 2BKFA 1LM8B 2REXA 3HM6X 2ZVOA 4DWFA 2AYOB 1WIAA 2KFJA 2KWUB 3A9JA 2WX0A 2W9NA 2FIFA 2C5LC 4BKSA 3L54A 3U8ZA 2KXJA 1E8ZA 1L7YA 2NCNA 1J0GA 4DHZB 2QHOA 4GU2A 3DDCB 4K7UA 1WX7A 4IW0A 1WM3A 4GIVA 4W9EA 2KTFA 1WZ0A 4KZ0A 1Z2MA 3PLVA 2JZ3B 3VDZA 2N9XA 2JXXA 2M8SA 3JVZX 1IPGA 3K9OB 4MGKE 1UBIA 2N7EA 3TJPA 5EDSA 3M63B 5CHVC 1EUVB 4II2B 4GDLB 2JT4B 4NAWB 1YQBA 1YX6B 2MBHA 4KZCA 2D10A 1WMHB 3WAMA 4ZRJA 4BKGA 4MELA 4I6PA 2DZIA 1P0RA 4KDIC 5E6OA 2OOBB 1LXDA 3R7QA 1WGRA 1Z5SB 3AULA 1TBEA 2DX5B 4GN1A 3RD2A 4WWPA 3O65B 4AWJA 4I6NB 3AXCA 1E8WA 4FHKA 4CYEA 2KD0A 4ANVA 2LXAA 5JH5C 3T9LA 1YX5B 2FCSA 4K7WA 1E7UA 4TV3A 2L00B 2FCQA 4GXBA 1OGWA 3GOEA 4MJSB 5CX3A 4A20A 2MBBB 4GSWA 2LVOA 3PRPB 1RRBA 3A1QB 3NZSA 2V4LA 3L13A 3ZO5B 1WE6A 2CHXA 3CF6E 2GBMA 2ASQA 3APCA 1HE8A 1TGZB 3ZVVA 2LVPA 2KN5A 2GBJA 3TIXA 3ZNID 4CO7A 4DXAB 3UQBA 3VTWA 4HJKA 2ZNVC 3UIOB 2LASA 3VUXA 1UH6A 3ZDMC 2JVCA 2N7DA 3QWZB 2LRWA 4DHJB 1GG3A 3AU5A 3IVFA 4GDKB 4RMAA 2VRRB 3M3JA 4W9LA 1SE9A 4FADA 3VAWA 4NJ7A 1R4NI 5L95C 2NR2A 1OEYJ 2M1MA 1ISNA 2NPTA 1Y8RC 1WJUA 4XX5A 4F7ZA 3ECIA 1OTRB 4M0WB 3VUYA 2GMIC 3ML9A 4A3PA 3NHEB 3KW5B 2FAZA 5DCNA 4MEMA 3W1SA 3Q3JA 2RSUA 4CHKA 2O2VA 3L10B 3N3KB 1KLVA 1WFYA 4KIKB 3ZIMA 3PS6A 5AEKB 3APDA 2PE9A 1C3TA 2C60A 3TMPB 3I3TB 2BWFA 3PV1A 3QJZA 4WWNA 1J8CA 1YIWA 3KH0A 1RLFA 5FR6A 4MGYE 1PQSA 3R66C 1EO6A 3KUDB 1XD3B 4DHJD 3IFWB 2KFKA 4J6IA 3DBRI 2M4NA 4PS7A 4ZYNA 4EZLA 2XBBC 5JHBA 1XT9B 1WR6E 5E6PA 3B08A 2A4ZA 3DQVA 2Z0DB 2ZCBA 3JW0X 2FCNA 2M0XA 2PJHA 4HCPB 3SHQA 2KTRB 3A33B 3N30A 1UBQA 3UIPB 2D07B 4W9GA 3M95A 3NY5A 4WJPA 2J0MA 4AP4C 2JUOA 1WZ3A 4WWOA 4NQKE 4ZRIA 2KZRA 4TQ1A 3LDZE 2KMCA 1YJ1A 3APFA 3U30A 2L7RA 1V2YA 1WXMA 2G3QB 2MQJA 3VTUA 2KQSA 1AARA 2KQ7A 2CR5A 2LVQA 3AU4A 3T8MA 4IG7B 4URKA 3B0AA 3IBEA 2MP2B 2JRIB 2BYEA 3L08A 3H7PB 3A4RA 3DPDA 3P2BA 4NQLB 4WJNA 2JY6A 1NBFC 1TTNA 4BOSC 3LJ3A 1MG8A 2ZEQA 3A4SC 1OQYA 5CHWA 1QZEA 2L8JA 2L0TA 3NZUA 3VTVA 4HVBA 3VQIA 3TL5A 3V6CB 3W1YA 2BF8B 1WRDB 4W9IA 5TR5A 5IAAC 3WAPA 3MTNB 5LXIB 2DZKA 2GOWA 3L16A 5C1ZA 1UGMA 2IO3B 2KJRA 2LUEA 2V3SA 2WWZA 2CKHB 3B1LX 5IA7A 2K6DB 2J0JA 3CMMB 2AL6A 2UWQA 3HK0A 4MGIE 1G6JA 3C0RB 3QQ8B 2K8BA 4GDLA 5C23A 3JSVB 4NAWA 2JRHA 3UQAA 5L83A 2FUHB 1GC7A 4FULA 4W9JA 2DENB 1WY8A 1WMHA 1V5TA 2CHWA 4EEWA 3ZNZB 3KUCB 1V5OA 2C7HA 3HHMA 3H1UA 4E71A 4WQOB 1Q5WB 4BOZB 1WM2A 2EMTA 3L0WB 2XK5B 4FHJA 2MCNB 4FA6A 1V80A 2KX0A 2LXCA 4G0NB 5DPWA 1WJNA 1D3ZA 4MSQB 3CSFA 5AZGA 1WR1A 2J7QB 4N9F4 3ZKJC 1V49A 4LDTB 1K8RB 4LJPB 3PZDA 4XZ4A 3ZRCA 1NI2A 2L0FA 1GJZA 4K81A 3NS8A 2XK5A 2PPHA 1WJ6A 2K1FA 3DCGA 4EZKA 2KANA 2K8CA 1LQBA 2HTHA 3M62B 2K8HA 3R3MA 4JIOU 4MJSA 4BBNF 3VH3B 2JPHA 2KWCA 3A1QA 3WANA 4W9KA 4JL9A 2DAFA 4DBGA 4MH0E 4AJYB 3DOWA 2NBUA 1P9DU 3ZUNA 3ZTCA 2MRPA 3QK0A 4AOFA
chains in the Genus database with same CATH superfamily
3RCZA 4RF1A 2D3GA 4IUMB 2RR9A 4LNFA 2HD5B 2WU2B 1E8YA 3WIMA 1M94A 3X0WA 2ZNVB 5LXHA 4HWIB 1WGGA 4XC2A 3UINB 1RWSA 1YD8U 3I57A 2IY1B 4YL8A 2IGDA 4DDGD 1SE2A 1RAXA 3FKYA 2MW5A 5H92C 2IO0B 4AS1A 2KDEB 1WXAA 4KKJA 4S17A 4KIKA 1TYGB 3SEBA 2CS4A 3DBSA 4D2KA 3Q3FA 2YEPF 3IAM1 3AE1B 2ZZPB 5C2TB 1I42A 2BW2A 4ZRKA 3CSTA 1V9JA 5C3JB 4A55A 5HKHA 1PGBA 4HXDA 2LMCA 2IO1B 4KGSA 4IM3A 4MSMB 1JROA 4P7IA 3PHXB 3BYYB 4LJOB 4RGOS 4HK2A 3AI5A 4WAFA 2ZJDA 2N1WA 1NVID 4GGQA 3RNGC 3Q3MC 3R7RA 1KOTA 3QCAA 4IM0A 3HRDD 1EF5A 4KV2A 3DWMA 3DVNU 3RNBC 3RT3B 4RH6A 2KJ6A 2W3SA 3NG0A 5D7GA 4W9DA 1FNVA 2JF5A 5J17A 4HDOA 2D3BA 2YEPB 3JSVA 5D6JB 3PREA 3QC8B 4C4VA 3FILA 1FCCC 3PGEA 2G4SA 4M8MA 4WJOA 3CWIA 1L0YB 2EKIA 2KHWB 2V9HA 2KLGA 3D32A 3QA8A 1V6EA 3OAWA 3AE8B 2K0PA 2G9HD 3SR6A 1GNUA 1HA5A 2IGGA 2IJ0A 2PEAA 2KDIA 1D6EC 3KQ4A 5EE1A 4GB9A 1P7FA 1SGHA 1T5XD 1GC6A 2X8XX 4FJVB 3GZNI 1ROEA 4B9KA 2NPTB 1R4NB 1S3SG 2DZMA 1KRHA 3J9CA 1P98A 3CIRB 1GB1A 1WX9A 1E0ZA 5G5HA 4OVVA 3ZNHB 3T3NA 2BGFA 3QARA 2YVCA 2LGXA 5BO4B 2RGFA 3BVGA 2WXHA 4C7YA 3U7ZA 4WH4A 4B95A 4LCDE 2Z59B 4USAA 2ON8A 2KT7A 2KVRA 3Q8CA 1J7CA 2PKOA 3JYUA 4K1RB 5KHQA 1IYFA 2WDQB 4EOYA 2WYQA 2GBKA 1TS4A 4YT0B 3RNCC 5E6NA 3MHZA 1N60A 2J53A 1ZGUB 4AQ7A 1KLUD 1QT9A 1UZXB 2M0AA 4WJQA 2GI9A 2WX1A 4ASWC 2N9KA 1FD6A 3H6NA 2NTSA 2MSED 3AE7B 1N61A 1KTKA 2L3ZA 2KC2A 2C7NB 4B0EA 1U4AA 2BKFA 1LM8B 4DWFA 3A9JA 2J42A 2C5LC 3L54A 3FAHA 1L7YA 2NCNA 3H8HA 4K7UA 2LUMA 2OJWA 2KTFA 4KZ0A 4JE3B 1SSNA 4JPSA 3VDZA 4A8XC 2M8SA 1PFDA 2X38A 5EDSA 1YJIA 2QMTA 4GDLB 1DOYA 2W3RA 1ZP0B 1XO3A 3U2SC 1WMHB 1FXAA 2V4IB 4I6PA 4ZHOA 4BAXA 1LXDA 1VZ7A 2KYWA 2B76B 2DX5B 3B2GA 2JZPA 3RD2A 3GB1A 4O1NA 3O65B 1FIQA 2KACA 3GOEA 5CX3A 1XLNA 3RFZB 2CHXA 2GBMA 2LVPA 5FK9C 3ZNID 3UQBA 2ZNVC 3VUXA 1UH6A 4W9LA 1L5PA 1KF6B 2M1MA 4FXCA 1ISNA 1TS5A 1C76A 4XX5A 4HKQA 1WXQA 5HHDG 4K3BA 1FO4A 3ML9A 4A3PA 1JWMD 1MVKA 4YTNB 1KLVA 3AEGB 5AEKB 4PK1A 1C3TA 2C60A 2BWFA 3PV1A 3BVMA 1I4XA 1YIWA 3DBRB 4XWWA 1NEKB 3I5JC 5EE9A 3DBRI 4EZLA 3TEWA 2XBBC 2M0XA 5EE0A 1I4RA 2KTRB 3A33B 4OW0A 1UBQA 2RDHA 3NY5A 1I4QA 4PT5A 1XXGA 1TKYA 2KZRA 1IGDA 3U30A 2L7RA 1V2YA 3AE5B 3Q3NC 3O13A 2IPKD 3VTUA 2KQSA 1AARA 2KQ7A 2LVQA 3AU4A 2D3AA 4RGTA 1V1PB 1OQQA 2PVOD 3LXFA 2JRIB 3A4RA 4Q2JA 4NQLB 3BK1A 1TS2A 1NBFC 5I4DA 5BYSA 1T0SC 3A4SC 1B1ZA 1OQYA 5FR3A 3VTVA 3TL5A 1NYQA 4ZRQA 2BF8B 2WXFA 4OZBA 3WAPA 3MTNB 5LXIB 2WXGA 2DZKA 3L16A 1UGMA 2LUEA 4JX1C 2K6DB 2J0JA 2UWQA 5IKCM 3C0RB 1SJED 3AV8A 5C23A 2JRHA 1SE3A 1T3QA 1WM2A 4N58A 4MSQB 3CSFA 2J7QB 4LDTB 1CQVA 3PZDA 2WXRA 1WJ6A 3AN1A 3Q8EA 3R3MA 4BBNF 2L52A 4W9KA 4JL9A 2DAFA 4MH0E 1MG4A 2N7JA 3ZUNA 1L0VB 2MRPA 1TZOA 3AM9A 3QK0A 4KX6B 3HUIA 4GMVA 1C77A 3EC8A 3MC0B 5J2RA 2GBRA 3AE9B 4LDTD 3DBHI 2N4FA 4GDKA 2C9WB 2PE6B 3ZTDA 2MLBA 1WJ4A 5D3IB 4TQ0A 4E3CA 1ZE3D 3DBLI 1SF0A 4MGZE 4EFOA 3DVGX 2NTTA 3AE3B 4ARCA 1HZ5A 3PPAA 2BPSA 2KMMA 3VHTC 3H7SA 2RPQA 2NBWB 3GE8C 3MFGA 5AZFA 1M4VA 2LRUA 4E74A 3K9PB 2JYEA 4REZA 1BMLC 1WI0A 3EFUA 1FXTB 2AWTA 2O6VB 2DLBA 3VH4B 1CJEA 3BZDB 4OVUA 3ZW3A 2TSSA 2IO2B 2R2OA 2WDRB 4RM8A 1Y56A 1I4HA 1XLOA 2RDBC 2LHEA 2IYDB 1BT0A 2BB6A 1V86A 2CHZA 3TCAA 3IHPC 2DBYA 2VZKB 2PTLA 1T0RC 3ONSA 3GP7A 2IDYA 3ZRFA 1X1MA 3V61A 4NAMA 2MP2A 4OZCA 2WXMA 3H7PA 2O6VD 2H88B 3RUIB 4JGHB 2MX2A 3P4RB 2B3AA 1XEEA 1MFWA 4IWPA 4NNJB 3BYTB 1ZDXA 2JU6X 1SB3C 2WXNA 4WAAA 1TZ1A 2L76A 2INPE 3Q8BA 5JXVA 3PHWB 1JW9D 3SU8X 1QOGA 3BWUD 2VZKD 1OFFA 3N1YC 1R7SA 4NY0A 3OLMD 4IKGA 2CU3A 3UF8A 4TSSA 2ACZB 1F52A 3C19A 3PLUA 1XQQA 1PYWD 2WHIA 1WGYA 4EKUA 2K6QA 4PYUA 2MEKA 2WXOA 2ONQA 4RM9A 3A9KB 2FCMA 4F1SA 1QOBA 2I1KA 2VH2A 2LJIA 4NPNA 3V05A 2K25A 4IOIE 3A9KA 1ZXIA 4XE0A 1H4RA 4US8A 3PRMB 1E9MA 3MJWA 2V1YA 2KOXA 2K5PA 2KJHB 2QJLA 3U4EG 2XNAC 4GOCA 1SJHD 2N9EB 1WSPA 2AQ3B 1XCTL 2A5UA 2KC1A 5D94A 2O2VB 3BVZA 2KDFB 1A5RA 4XWTA 4F8CB 5IN7A 2MA9B 2D5GA 2AEHA 3N32A 1LFDA 3VUWA 3HM3A 1TY2A 3HVDA 1FCLA 4K7SA 3V60A 3NVVA 4IM2A 4YWGG 4JLCA 1FFUA 3SD5A 4M01A 2LI5A 4DXGA 3EFCA 1T0QC 1EU3A 3PVLA 4W9CA 3U52E 3VXWA 4G50A 3HM6X 1C9FA 1YQ4B 1N62A 2WX0A 3U8ZA 3Q8AA 5IO9A 2HDEA 4DHZB 2AX5A 3DDCB 1WX7A 4L23A 4W9EA 1F0ZA 2JZ3B 1V8CA 3PZ8A 3SFEB 3VRAB 4HKZE 2QIEB 2N7EA 3TJPA 1P7EA 3Q3OC 1ZXHA 2JT4B 4NAWB 1YQBA 2L83A 4OHJA 2MBHA 2D10A 2MJDA 3WAMA 2BS2B 1TS3A 4BKGA 4KDIC 3RMKC 5E6OA 1WGRA 1SXTA 1VZ8A 2LFIA 1TBEA 4GN1A 3AXCA 2DWQA 4R3DA 1V97A 4ANVA 3T9LA 1YX5B 2OHFA 3E56A 4LLGM 1E7UA 4TV3A 1OGWA 2MH7A 4A20A 2Y3AA 2MBBB 2LVOA 4N6EB 4KKIA 4P6VF 5HI1A 3ZO5B 1WE6A 3CF6E 1UGJA 3APCA 3LB8C 2GLSA 4WURA 1TGZB 3MP9A 2GBJA 1VDVA 4DXAB 5BYRA 3AE2B 2RDGA 2LASA 3ZDMC 3Q6BA 3QWZB 2LRWA 4YTMB 1GG3A 2ICIA 2VRRB 3VAWA 4NJ7A 1R4NI 3P63A 1CK1A 5L95C 2NR2A 4LK0M 1OEYJ 2NPTA 3ECIA 4M0WB 2GMIC 3P4QB 3KW5B 4MT5A 4P1CC 2RMMA 2RSUA 4M0WA 4ITKA 3APDA 3DHGC 1FMAD 1J8CA 1RLFA 5FR6A 4MGYE 1PQSA 1R4MB 3KUDB 4PS7A 2W54A 5JHBA 1WR6E 3DQVA 2Z0DB 2ZCBA 2BVCA 3JW0X 2FCNA 1SIJA 2PJHA 1ZUD2 3SHQA 2Z8LA 4W9GA 3M95A 1JWAD 2BQQA 2FUG1 2J0MA 3NZ3A 4AP4C 2JUOA 3DHHC 4WWOA 4NQKE 1HTOA 1EU4A 3LDZE 4C80A 3GS2A 3URYA 4HEA1 1WXMA 2MQJA 2CR5A 3L08A 2BYEA 4US9A 4WJNA 2JXTA 1AYFA 2R61A 3LJ3A 1MG8A 2E3TA 2ZEQA 1QZEA 2L8JA 4RFBA 3W5UB 1L0XB 3VQIA 1WRDB 4HJGE 4W9IA 5TR5A 3NRZA 2V3SA 1YN5A 2OEDA 1ACCA 2Y5PA 4GDLA 2JYTA 3UQAA 2DENB 1WY8A 1WMHA 1V5TA 2CHWA 1E10A 3FC4A 3KUCB 1V5OA 1I4PA 3H1UA 4C7ZA 2EMTA 3L0WB 1V80A 1D3ZA 1OQRA 1WR1A 3AB5A 3ZKJC 2BYTA 3ZRCA 4UDUC 1D5ZC 1FM0D 2K1FA 2PLPA 1LQBA 3DWGC 3MC9A 3NUHB 4JIOU 3VH3B 3TEXA 5BYQA 1F1HA 3WANA 2M56B 3ZGZA 3AE6B 1F2RC 1PGXA 1QF6A 3HVZA 4JWSC 1EWYC 2PIAA 1K52A 1JRUA 2DYBA 2QDFA 2RD0A 3ENEA 4EUTA 4ZYSA 4MM3B 1KJTA 1V1OA 4KVGB 1MJDA 3W1SC 2ZPNA 5E6JA 2KNBA 4A3OA 1EF1A 1KFYB 3ZDTA 3ALBA 2CU1A 3DVGY 4MM3A 1YQ3B 2KMAA 4HLEA 1ET9A 2V3PA 1QILA 1XLPA 2LGDA 4PS8A 1SE4A 4H2AA 3T3OA 2Z0EB 4PYZA 4PS3A 3P4SB 1S1QB 1Q1OA 3ZLZA 1I7HA 4ANUA 3ZNGC 4W9FA 3W9CB 2M19A 5AZHA 2WQYB 3IXSA 3U7DA 2GB1A 3NVZA 5JZEB 2DHZA 1JRPA 1CZPA 4RF0A 2N0SB 2KTRA 2BYVE 3BK2A 4LNIA 1SIFA 1WXSA 3ML8A 2IZVB 1V81A 4IWOA 3RNFC 2UYZB 2FE8A 3HIZA 3NJTA 2EMSA 4FBJB 3E9SA 2I1JA 1V1PA 4TMAB 4DK5A 2KQ4X 3KLSX 2LGYA 2CJOA 2G4DB 3KUZA 1VD2A 2L05A 2XEWA 2VH1A 2BB5A 4AJWA 3RZFA 4I6LB 3ZNZB 4MDKE 1HZ6A 3MC8A 4A90A 4P1BC 4HROA 5DPTA 1JWSD 1WF9A 1C4AA 1N5XA 4AUQC 4BKSD 1SBBB 2DZJA 3RN9C 3RZWC 1YMHE 1HEZE 3BIID 3OWEB 1WGDA 1FEHA 4XDCA 2R2QA 4TKNA 3NOBA 2WDTB 1CMXB 4N59A 3P42A 4S0RA 2XN9C 4HPMB 3OG5A 1UUPA 1N5WA 1UELA 5GMVA 3ZJUA 2J0KA 2ZW0A 2K22A 3L17A 2NMQA 2AQ1B 5KHOA 3QX1A 1JQ4A 3S2AA 1EWCA 1NYRA 4YTPB 1T0YA 3KWVA 2WLBA 3RPFC 2D11A 3IT4B 2ZVNA 1D5XC 4X57B 1HQRD 1E90A 4XGAB 1J7BA 3WALA 5BMHA 1TY0A 4KSKC 3SDLC 4W9HA 1WGHA 1ET6A 2I38A 2KFKB 1AWDA 4BFRA 2WS3B 3ZYYX 3WAOA 2JZZA 4B6WA 1L4DB 2KDBA 2GRIA 3Q69A 1WXVA 1Q10A 2LEKA 4HPLB 1TIFA 3PRZA 2O6VA 3RULA 3VRBB 1NDDA 1H8CA 4WQMA 1JMLA 3TUOA 2WXKA 3H9DA 2N1VA 3IT6B 1L4ZB 3ZJTA 1IUEA 4BKTA 1WX8A 4DQOC 2PW9A 1E7VA 2REXA 2ZVOA 2AYOB 1WIAA 2KWDA 2W9NA 2QC8A 4L1BA 4GU2A 2L32A 1YNTE 1WM3A 4GIVA 1XLQA 2BT6A 1Z2MA 3PLVA 3JVZX 1IPGA 5IP4D 1ZOYB 1UBIA 5CHVC 1EUVB 1RM6C 4M00A 1YX6B 4KZCA 4ZRJA 5LNK1 2DZIA 3MJ5A 4YXDB 3R7QA 1Z5SB 3EA6A 2INDC 4AWJA 4I6NB 4FHKA 1TKEA 1L6UA 5JH5C 2FCSA 4K7WA 3ZXVA 3DHIC 2FCQA 4WIPA 4XYCA 4MJSB 1HTQA 2JX5A 2J52A 3A1QB 3N20C 3L13A 1K51A 2KN5A 4IDIA 2N9LA 4CO7A 3VTWA 4HJKA 1XF5L 2JVCA 1YN4A 4DHJB 1F2RI 3IVFA 4RCOA 3M3JA 1SE9A 3NVWA 1VZ6A 5GXGB 1GAQB 2JSVX 1Y8RC 3VUYA 1B9RA 3W2DA 4MEMA 3W1SA 2K9XA 2O2VA 1WFYA 4KIKB 1WWTA 3PS6A 1JALA 3TMPB 3QJZA 2KVZA 4MACA 1QOAA 1UF0A 1XD3B 4DHJD 1GB4A 3N1ZC 3PO0A 4ZYNA 1STEA 2SEBD 1XT9B 2LGSA 2A4ZA 3WCQA 1QOFA 4P16A 4HCPB 3N30A 3UIPB 2D07B 2BTEA 3P4PB 1C4CA 4WJPA 2KN4A 1WZ3A 3AH7A 1YJ1A 3RNEC 4YSYB 3T8MA 3B0AA 4OZAA 1FFVA 3DPDA 3P2BA 4A6QA 2JY6A 2EELA 5HFYA 5CHWA 3AEDB 2WXQA 3NZUA 3V6CB 4GLSC 5IAAC 2WXIA 2GOWA 4K3CA 2CKHB 2KAJA 1BXTA 2AL6A 4MGIE 3QQ8B 3JSVB 4NAWA 4M02A 5L83A 4W9JA 1GC7A 1VLBA 4EEWA 4BOZB 4FHJA 4C4VB 3FILB 2WXLA 2MCNB 2KX0A 1FNUA 2LXCA 3Q2AC 3ZJVA 1J7AA 1N6ZA 4HRSA 1FXIA 3TEYA 4N9F4 1V49A 2WNMA 2L0FA 1GJZA 3NS8A 3DCGA 1ESFA 4ARIA 2K8HA 2JPHA 2KWCA 4WWMA 1A70A 4DBGA 4DXFA 4AJYB 3DOWA 5MPOA 4LNNA 4OVZA 1D5MC 3AE4B 4AOFA 2ZW1A 3EHVA 4YSXB 2G45B 2BWES 2NS5A 1C4PA 4C56C 1DOIA 1JWBD 3BY4B 3KVFB 3GZNB 3P1MA 2SAKA 4JQWC 2G1EA 3VVWB 1FNWA 1EM7A 3BINA 2Q5WD 4NJ6A 3QAQA 1BUIC 5CHFA 1XCQL 1HXYD 1MHXA 2C7MB 2IY0B 2LGIA 3C8YA 4FLHA 1ZW7A 4J3OD 4ICUA 4BZAA 4BBNC 3PSEB 3VR9B 2DYOA 3DVNV 4ANXA 2WDVB 4ZDVA 1R4MI 1MPEA 3TSSA 1KM7A 2DAJA 3IG3A 5D2MB 4KSLC 4CQNA 2EKEC 3PTFC 3RYTA 1GPXA 1QLBB 2LWPA 3GE3C 1OEYA 2BKRB 2FBWB 2KO3A 3UI3A 1VRAB 2ZPYA 1YJJA 5DPRA 2KK8A 1D4BA 1J19A 4NZLB 4ACFA 2Y5CA 2YLMA 2HTME 4A9AA 1F77A 5T8IA 3A9JB 4LTUA 4HDQA 3B9JA 3RNAC 2WXJA 4BVUC 1TKGA 3AEAB 1NENB 4IC7B 1UD7A 2KKCA 5G55A 1Q0WB 2OJRA 2FNJB 4IWQA 4FJYA 4M8NA 2DYMA 2KWVB 4ICVA 1DOXA 4II3B 3VR8B 3AEEB 1WE7A 1C78A 5CTRC 3V6EB 1DGJA 3R8BA 2MJEA 2H89B 2K39A 2N9PC 3KYDD 4G3XB 1LO5D 4DDID 2L1AA 2LD9A 5DPSA 2W55A 3OJ4B 1N63A 4LNKA 2HJ8A 3B2FA 3QHTA 5JHAA 2KX3A 3RI7C 4HCNB 2J4XA 3UGBB 1AW7A 4TUUA 1UNSA 3PZ7A 3ZXRA 3EECA 5G2NA 3N9YC 1E8XA 2AL3A 3AEBB 3ABVB 2QILA 4RGMA 1P3QU 4FJZA 1SEBD 2JQRB 2NBVB 1C1YB 4ZHPA 2GBNA 2ZCCA 4G11A 3PT2B 3TBLD 2IBIB 1VCBA 1WH3A 2HE7A 2M17A 1ZKHA 4EZJA 1L2NA 1P1AA 4KDLB 1IP9A 2MWSB 2PVGC 4JWUC 2BBCA 3V62A 3EUB2 1WYWB 2BS4B 1QQRA 1I35A 4FN2A 5D3DA 3AMZA 1F9JA 3IAS1 2MBQA 2MBEA 2FIDA 2CJNA 1NI3A 1UWMA 3L4PA 1E7PB 1RFAA 2LJ5A 4CHKA 3KYCD 3OJ3A 2JWZA 3I9V1 2KDMA 3MHSD 1WYGA 1FRDA 2D2QA 3VFKA 3N1XC 1ZPSA 5H8YE 4ANWA 5J18A 1E5WA 4YSZB 1T6BX 1GUAB 2MBOA 4DHZE 1FRRA 2NVUI 3NS1A 2LZ6A 4KGTA 3QIJA 5LLIA 5IOIA 2KLCA 3X23A 3KWLA 3WA0A 1PGAA 2BYFA 2INNE 3ZQ4A 2Y5BB 2KFJA 1KLGD 2KWUB 4ZOHC 2FIFA 4BKSA 2D3CA 2KXJA 1E8ZA 1J0GA 1RYJA 2QHOA 1TJEA 4IW0A 1JWUD 1WZ0A 2N9XA 2JXXA 1YN3A 3K9OB 4MGKE 3M63B 1PDXA 2MJ3A 4II2B 1L6VA 4MELA 1P0RA 2OOBB 2HJ1A 3AULA 2WGSA 4WWPA 2V0GA 2AQ2B 3Q14C 1WGKA 1E8WA 4CYEA 2KD0A 4RNAA 2LXAA 5EE3A 2RPVA 2L00B 3LYYA 4GXBA 4C00A 3I63C 4GSWA 3PRPB 1RRBA 3NZSA 2V4LA 1YOVB 2ASQA 1AN8A 1GOZA 2JWUA 2V3NA 1HE8A 3ZVVA 3TIXA 3ETRA 1MHHE 3UIOB 3Q8FA 4MH8A 2N7DA 1WRIA 5TSSA 3AU5A 5BMIA 4GDKB 4RMAA 4FADA 3DBHB 5FKAC 1WJUA 4F7ZA 1OTRB 3R2TA 3DBLB 3NHEB 2FAZA 5DCNA 3Q3JA 3L10B 3N3KB 3ZIMA 2PE9A 1FPYA 3I3TB 4RGNA 4WWNA 1TT5B 3KH0A 1C79A 3R66C 1EO6A 3V3XA 2E6XA 4KGRA 3IFWB 4EE2A 1ENFA 4LNOA 2KFKA 4J6IA 2IGHA 1LGRA 2M4NA 1PUTA 2BS3B 1KH0A 1K50A 5E6PA 3B08A 3SFDB 1K53A 4ZRIA 5BMGA 1DYQA 2WXPA 4TQ1A 2KMCA 4XDDA 3APFA 2WU5B 2G3QB 2QCZA 2DNFA 4IG7B 4URKA 4ZRPA 4B0MA 1VJKA 3IBEA 2MP2B 3H7PB 1VR9A 3R2IA 1TTNA 1QKZA 4BOSC 2INCC 2L0TA 1JCKB 4HVBA 3W1YA 5AUKA 1RFKA 2QSDA 2UU7A 3AECB 5C1ZA 2IO3B 2KJRA 2WWZA 3B1LX 5IA7A 2QEJC 3CMMB 2I2YA 3HK0A 1G6JA 1UWXA 2K8BA 2MHJA 2FUHB 4FULA 1ZDVA 4QAYA 3AEFB 1IGCA 1MI0A 2LHDA 2C7HA 3HHMA 1IBXB 4E71A 4WQOB 5AUIA 1Q5WB 4FA6A 2XK5B 4G0NB 4L2YA 5DPWA 1WJNA 5AZGA 3TEZA 2WP9B 5HG2A 1I4GA 1K8RB 4LJPB 4XZ4A 5G5GA 1NI2A 1IBXA 4K81A 2XK5A 4HPPA 2K3UA 2PPHA 3W5VB 3EGRA 4EZKA 2KANA 2K8CA 2HTHA 3M62B 4MJSA 3A1QA 4NJCA 1E6EB 3NVYA 2PMVA 2NBUA 1P9DU 3ZTCA 2W82A
chains in the Genus database with same CATH topology
3EHVA 2G45B 4GMVA 2BWES 2NS5A 3RCZA 2D3GA 3EC8A 1JRUA 4IUMB 2DYBA 2RR9A 2RD0A 5J2RA 3ENEA 3BY4B 2GBRA 4EUTA 3KVFB 2HD5B 4LDTD 1KJTA 1E8YA 4JQWC 4KVGB 3WIMA 1M94A 3DBHI 3W1SC 2N4FA 2ZPNA 4GDKA 2ZNVB 2KNBA 4HWIB 3X0WA 2C9WB 2PE6B 1EF1A 1WGGA 2MLBA 4XC2A 3UINB 3ZTDA 1WJ4A 3ZDTA 4TQ0A 1YD8U 3ALBA 3VVWB 2CU1A 3DVGY 4E3CA 2IY1B 4MM3A 3BINA 3DBLI 4YL8A 4DDGD 1RAXA 2KMAA 4MGZE 4NJ6A 4EFOA 3QAQA 5CHFA 3DVGX 4HLEA 2C7MB 2IY0B 2LGDA 2MW5A 3PPAA 4PS8A 4FLHA 1ZW7A 2BPSA 2Z0EB 4ICUA 4PYZA 4PS3A 4BBNC 2IO0B 3VHTC 2KDEB 3H7SA 2RPQA 1WXAA 3PSEB 2NBWB 1S1QB 4KIKA 1Q1OA 2DYOA 3DVNV 5AZFA 3ZLZA 4A3OA 4ANXA 4ANUA 2CS4A 3DBSA 3ZNGC 4ZDVA 1R4MI 4W9FA 2LRUA 1KM7A 4E74A 3K9PB 2DAJA 3IG3A 5D2MB 4KSLC 3Q3FA 5AZHA 1WI0A 3EFUA 3U7DA 2EKEC 3PTFC 1FXTB 3RYTA 2ZZPB 2LWPA 5JZEB 2AWTA 2DHZA 2O6VB 1I42A 1OEYA 2BKRB 2KO3A 4ZRKA 3VH4B 4OVUA 2ZPYA 5DPRA 3ZW3A 2IO2B 3CSTA 2R2OA 2KK8A 1V9JA 2KTRA 4RM8A 1J19A 5HKHA 2BYVE 1SIFA 4HXDA 2IYDB 1WXSA 2IO1B 3ML8A 1BT0A 2IZVB 1V81A 2YLMA 4IWOA 1V86A 2UYZB 4IM3A 2CHZA 3TCAA 3IHPC 4MSMB 4P7IA 3HIZA 3ONSA 3A9JB 2EMSA 3PHXB 4FBJB 4HDQA 3ZRFA 2I1JA 1X1MA 4LJOB 3V61A 4HK2A 4BVUC 3AI5A 4DK5A 2MP2A 2LGYA 2ZJDA 3H7PA 2G4DB 4IC7B 2O6VD 1UD7A 2KKCA 3KUZA 2N1WA 5G55A 1Q0WB 2OJRA 4GGQA 4JGHB 2MX2A 3RUIB 2B3AA 2FNJB 1VD2A 4IWPA 2L05A 4NNJB 2XEWA 4IWQA 3R7RA 4FJYA 1KOTA 4M8NA 2DYMA 2KWVB 4ICVA 3QCAA 4IM0A 3RZFA 4AJWA 4II3B 1WE7A 4I6LB 5CTRC 1EF5A 3V6EB 4KV2A 4MDKE 3DVNU 3RT3B 4WAAA 1TZ1A 2L76A 2KJ6A 2K39A 5DPTA 2N9PC 3KYDD 3PHWB 5D7GA 4G3XB 4W9DA 4DDID 3SU8X 2JF5A 5J17A 4HDOA 1WF9A 2LD9A 5DPSA 3JSVA 4NY0A 4AUQC 3OLMD 4BKSD 2DZJA 3OJ4B 3RZWC 1WGDA 2HJ8A 3UF8A 5D6JB 3QHTA 5JHAA 2R2QA 4TKNA 2KX3A 3PREA 3QC8B 4HCNB 3UGBB 3PLUA 3PGEA 3NOBA 1XQQA 4TUUA 2WDTB 2G4SA 4M8MA 1WGYA 3EECA 5G2NA 4EKUA 1E8XA 2AL3A 2K6QA 4WJOA 1CMXB 2KHWB 2KLGA 3D32A 4PYUA 3QA8A 4HPMB 1V6EA 4RM9A 1P3QU 3A9KB 1UELA 3OAWA 2FCMA 4FJZA 5GMVA 4F1SA 2I1KA 2J0KA 1GNUA 2NBVB 4NPNA 1C1YB 3L17A 2K25A 2PEAA 2GBNA 2KDIA 3A9KA 5KHOA 1H4RA 2ZCCA 3QX1A 4GB9A 3S2AA 3PRMB 1SGHA 3MJWA 4G11A 2V1YA 3PT2B 2KOXA 2IBIB 3TBLD 1GC6A 1VCBA 4FJVB 1WH3A 2HE7A 1T0YA 3GZNI 4B9KA 2NPTB 2KJHB 1S3SG 2D11A 2DZMA 1ZKHA 2M17A 2ZVNA 4EZJA 1L2NA 1P98A 1P1AA 4KDLB 1IP9A 1WX9A 4GOCA 4X57B 2MWSB 1E90A 2N9EB 3V62A 4OVVA 3ZNHB 1WYWB 2A5UA 2KC1A 5LXHA 5D94A 2O2VB 1I35A 3WALA 2KDFB 4FN2A 2BGFA 3QARA 1A5RA 1F9JA 4F8CB 2YVCA 2LGXA 2MBQA 2MBEA 5BO4B 2FIDA 2RGFA 4KSKC 3SDLC 4W9HA 4B95A 4LCDE 1RFAA 2Z59B 2MA9B 1WGHA 2AEHA 2KVRA 3N32A 2KFKB 1LFDA 2LJ5A 3VUWA 3KYCD 3OJ3A 2JWZA 3HM3A 3MHSD 3WAOA 4BFRA 2JZZA 5KHQA 3JYUA 2D2QA 4K1RB 4B6WA 3VFKA 1IYFA 4ANWA 2KDBA 2WYQA 4EOYA 5J18A 2GBKA 1WXVA 1E5WA 4K7SA 3V60A 5E6NA 4HPLB 4IM2A 3PRZA 1GUAB 2O6VA 1ZGUB 2MBOA 3RULA 4JLCA 1UZXB 1NDDA 4WJQA 4DHZE 1H8CA 2WX1A 4ASWC 2NVUI 3H9DA 3SD5A 2LZ6A 3QIJA 3H6NA 5LLIA 2LI5A 2N1VA 2KLCA 2MSED 3X23A 2L3ZA 3PVLA 2KC2A 4BKTA 1WX8A 3WA0A 4W9CA 2C7NB 3VXWA 2BYFA 4G50A 1U4AA 1E7VA 2Y5BB 2BKFA 1LM8B 2REXA 3HM6X 2ZVOA 4DWFA 2AYOB 1WIAA 2KFJA 2KWUB 3A9JA 2WX0A 2W9NA 2FIFA 2C5LC 4BKSA 3L54A 3U8ZA 2KXJA 1E8ZA 1L7YA 2NCNA 1J0GA 4DHZB 2QHOA 4GU2A 3DDCB 4K7UA 1WX7A 4IW0A 1WM3A 4GIVA 4W9EA 2KTFA 1WZ0A 4KZ0A 1Z2MA 3PLVA 2JZ3B 3VDZA 2N9XA 2JXXA 2M8SA 3JVZX 1IPGA 3K9OB 4MGKE 1UBIA 2N7EA 3TJPA 5EDSA 3M63B 5CHVC 1EUVB 4II2B 4GDLB 2JT4B 4NAWB 1YQBA 1YX6B 2MBHA 4KZCA 2D10A 1WMHB 3WAMA 4ZRJA 4BKGA 4MELA 4I6PA 2DZIA 1P0RA 4KDIC 5E6OA 2OOBB 1LXDA 3R7QA 1WGRA 1Z5SB 3AULA 1TBEA 2DX5B 4GN1A 3RD2A 4WWPA 3O65B 4AWJA 4I6NB 3AXCA 1E8WA 4FHKA 4CYEA 2KD0A 4ANVA 2LXAA 5JH5C 3T9LA 1YX5B 2FCSA 4K7WA 1E7UA 4TV3A 2L00B 2FCQA 4GXBA 1OGWA 3GOEA 4MJSB 5CX3A 4A20A 2MBBB 4GSWA 2LVOA 3PRPB 1RRBA 3A1QB 3NZSA 2V4LA 3L13A 3ZO5B 1WE6A 2CHXA 3CF6E 2GBMA 2ASQA 3APCA 1HE8A 1TGZB 3ZVVA 2LVPA 2KN5A 2GBJA 3TIXA 3ZNID 4CO7A 4DXAB 3UQBA 3VTWA 4HJKA 2ZNVC 3UIOB 2LASA 3VUXA 1UH6A 3ZDMC 2JVCA 2N7DA 3QWZB 2LRWA 4DHJB 1GG3A 3AU5A 3IVFA 4GDKB 4RMAA 2VRRB 3M3JA 4W9LA 1SE9A 4FADA 3VAWA 4NJ7A 1R4NI 5L95C 2NR2A 1OEYJ 2M1MA 1ISNA 2NPTA 1Y8RC 1WJUA 4XX5A 4F7ZA 3ECIA 1OTRB 4M0WB 3VUYA 2GMIC 3ML9A 4A3PA 3NHEB 3KW5B 2FAZA 5DCNA 4MEMA 3W1SA 3Q3JA 2RSUA 4CHKA 2O2VA 3L10B 3N3KB 1KLVA 1WFYA 4KIKB 3ZIMA 3PS6A 5AEKB 3APDA 2PE9A 1C3TA 2C60A 3TMPB 3I3TB 2BWFA 3PV1A 3QJZA 4WWNA 1J8CA 1YIWA 3KH0A 1RLFA 5FR6A 4MGYE 1PQSA 3R66C 1EO6A 3KUDB 1XD3B 4DHJD 3IFWB 2KFKA 4J6IA 3DBRI 2M4NA 4PS7A 4ZYNA 4EZLA 2XBBC 5JHBA 1XT9B 1WR6E 5E6PA 3B08A 2A4ZA 3DQVA 2Z0DB 2ZCBA 3JW0X 2FCNA 2M0XA 2PJHA 4HCPB 3SHQA 2KTRB 3A33B 3N30A 1UBQA 3UIPB 2D07B 4W9GA 3M95A 3NY5A 4WJPA 2J0MA 4AP4C 2JUOA 1WZ3A 4WWOA 4NQKE 4ZRIA 2KZRA 4TQ1A 3LDZE 2KMCA 1YJ1A 3APFA 3U30A 2L7RA 1V2YA 1WXMA 2G3QB 2MQJA 3VTUA 2KQSA 1AARA 2KQ7A 2CR5A 2LVQA 3AU4A 3T8MA 4IG7B 4URKA 3B0AA 3IBEA 2MP2B 2JRIB 2BYEA 3L08A 3H7PB 3A4RA 3DPDA 3P2BA 4NQLB 4WJNA 2JY6A 1NBFC 1TTNA 4BOSC 3LJ3A 1MG8A 2ZEQA 3A4SC 1OQYA 5CHWA 1QZEA 2L8JA 2L0TA 3NZUA 3VTVA 4HVBA 3VQIA 3TL5A 3V6CB 3W1YA 2BF8B 1WRDB 4W9IA 5TR5A 5IAAC 3WAPA 3MTNB 5LXIB 2DZKA 2GOWA 3L16A 5C1ZA 1UGMA 2IO3B 2KJRA 2LUEA 2V3SA 2WWZA 2CKHB 3B1LX 5IA7A 2K6DB 2J0JA 3CMMB 2AL6A 2UWQA 3HK0A 4MGIE 1G6JA 3C0RB 3QQ8B 2K8BA 4GDLA 5C23A 3JSVB 4NAWA 2JRHA 3UQAA 5L83A 2FUHB 1GC7A 4FULA 4W9JA 2DENB 1WY8A 1WMHA 1V5TA 2CHWA 4EEWA 3ZNZB 3KUCB 1V5OA 2C7HA 3HHMA 3H1UA 4E71A 4WQOB 1Q5WB 4BOZB 1WM2A 2EMTA 3L0WB 2XK5B 4FHJA 2MCNB 4FA6A 1V80A 2KX0A 2LXCA 4G0NB 5DPWA 1WJNA 1D3ZA 4MSQB 3CSFA 5AZGA 1WR1A 2J7QB 4N9F4 3ZKJC 1V49A 4LDTB 1K8RB 4LJPB 3PZDA 4XZ4A 3ZRCA 1NI2A 2L0FA 1GJZA 4K81A 3NS8A 2XK5A 2PPHA 1WJ6A 2K1FA 3DCGA 4EZKA 2KANA 2K8CA 1LQBA 2HTHA 3M62B 2K8HA 3R3MA 4JIOU 4MJSA 4BBNF 3VH3B 2JPHA 2KWCA 3A1QA 3WANA 4W9KA 4JL9A 2DAFA 4DBGA 4MH0E 4AJYB 3DOWA 2NBUA 1P9DU 3ZUNA 3ZTCA 2MRPA 3QK0A 4AOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHV A;  2G45 B;  4GMV A;  2BWE S;  2NS5 A;  3RCZ A;  2D3G A;  3EC8 A;  1JRU A;  4IUM B;  2DYB A;  2RR9 A;  2RD0 A;  5J2R A;  3ENE A;  3BY4 B;  2GBR A;  4EUT A;  3KVF B;  2HD5 B;  4LDT D;  1KJT A;  1E8Y A;  4JQW C;  4KVG B;  3WIM A;  1M94 A;  3DBH I;  3W1S C;  2N4F A;  2ZPN A;  4GDK A;  2ZNV B;  2KNB A;  4HWI B;  3X0W A;  2C9W B;  2PE6 B;  1EF1 A;  1WGG A;  2MLB A;  4XC2 A;  3UIN B;  3ZTD A;  1WJ4 A;  3ZDT A;  4TQ0 A;  1YD8 U;  3ALB A;  3VVW B;  2CU1 A;  3DVG Y;  4E3C A;  2IY1 B;  4MM3 A;  3BIN A;  3DBL I;  4YL8 A;  4DDG D;  1RAX A;  2KMA A;  4MGZ E;  4NJ6 A;  4EFO A;  3QAQ A;  5CHF A;  3DVG X;  4HLE A;  2C7M B;  2IY0 B;  2LGD A;  2MW5 A;  3PPA A;  4PS8 A;  4FLH A;  1ZW7 A;  2BPS A;  2Z0E B;  4ICU A;  4PYZ A;  4PS3 A;  4BBN C;  2IO0 B;  3VHT C;  2KDE B;  3H7S A;  2RPQ A;  1WXA A;  3PSE B;  2NBW B;  1S1Q B;  4KIK A;  1Q1O A;  2DYO A;  3DVN V;  5AZF A;  3ZLZ A;  4A3O A;  4ANX A;  4ANU A;  2CS4 A;  3DBS A;  3ZNG C;  4ZDV A;  1R4M I;  4W9F A;  2LRU A;  1KM7 A;  4E74 A;  3K9P B;  2DAJ A;  3IG3 A;  5D2M B;  4KSL C;  3Q3F A;  5AZH A;  1WI0 A;  3EFU A;  3U7D A;  2EKE C;  3PTF C;  1FXT B;  3RYT A;  2ZZP B;  2LWP A;  5JZE B;  2AWT A;  2DHZ A;  2O6V B;  1I42 A;  1OEY A;  2BKR B;  2KO3 A;  4ZRK A;  3VH4 B;  4OVU A;  2ZPY A;  5DPR A;  3ZW3 A;  2IO2 B;  3CST A;  2R2O A;  2KK8 A;  1V9J A;  2KTR A;  4RM8 A;  1J19 A;  5HKH A;  2BYV E;  1SIF A;  4HXD A;  2IYD B;  1WXS A;  2IO1 B;  3ML8 A;  1BT0 A;  2IZV B;  1V81 A;  2YLM A;  4IWO A;  1V86 A;  2UYZ B;  4IM3 A;  2CHZ A;  3TCA A;  3IHP C;  4MSM B;  4P7I A;  3HIZ A;  3ONS A;  3A9J B;  2EMS A;  3PHX B;  4FBJ B;  4HDQ A;  3ZRF A;  2I1J A;  1X1M A;  4LJO B;  3V61 A;  4HK2 A;  4BVU C;  3AI5 A;  4DK5 A;  2MP2 A;  2LGY A;  2ZJD A;  3H7P A;  2G4D B;  4IC7 B;  2O6V D;  1UD7 A;  2KKC A;  3KUZ A;  2N1W A;  5G55 A;  1Q0W B;  2OJR A;  4GGQ A;  4JGH B;  2MX2 A;  3RUI B;  2B3A A;  2FNJ B;  1VD2 A;  4IWP A;  2L05 A;  4NNJ B;  2XEW A;  4IWQ A;  3R7R A;  4FJY A;  1KOT A;  4M8N A;  2DYM A;  2KWV B;  4ICV A;  3QCA A;  4IM0 A;  3RZF A;  4AJW A;  4II3 B;  1WE7 A;  4I6L B;  5CTR C;  1EF5 A;  3V6E B;  4KV2 A;  4MDK E;  3DVN U;  3RT3 B;  4WAA A;  1TZ1 A;  2L76 A;  2KJ6 A;  2K39 A;  5DPT A;  2N9P C;  3KYD D;  3PHW B;  5D7G A;  4G3X B;  4W9D A;  4DDI D;  3SU8 X;  2JF5 A;  5J17 A;  4HDO A;  1WF9 A;  2LD9 A;  5DPS A;  3JSV A;  4NY0 A;  4AUQ C;  3OLM D;  4BKS D;  2DZJ A;  3OJ4 B;  3RZW C;  1WGD A;  2HJ8 A;  3UF8 A;  5D6J B;  3QHT A;  5JHA A;  2R2Q A;  4TKN A;  2KX3 A;  3PRE A;  3QC8 B;  4HCN B;  3UGB B;  3PLU A;  3PGE A;  3NOB A;  1XQQ A;  4TUU A;  2WDT B;  2G4S A;  4M8M A;  1WGY A;  3EEC A;  5G2N A;  4EKU A;  1E8X A;  2AL3 A;  2K6Q A;  4WJO A;  1CMX B;  2KHW B;  2KLG A;  3D32 A;  4PYU A;  3QA8 A;  4HPM B;  1V6E A;  4RM9 A;  1P3Q U;  3A9K B;  1UEL A;  3OAW A;  2FCM A;  4FJZ A;  5GMV A;  4F1S A;  2I1K A;  2J0K A;  1GNU A;  2NBV B;  4NPN A;  1C1Y B;  3L17 A;  2K25 A;  2PEA A;  2GBN A;  2KDI A;  3A9K A;  5KHO A;  1H4R A;  2ZCC A;  3QX1 A;  4GB9 A;  3S2A A;  3PRM B;  1SGH A;  3MJW A;  4G11 A;  2V1Y A;  3PT2 B;  2KOX A;  2IBI B;  3TBL D;  1GC6 A;  1VCB A;  4FJV B;  1WH3 A;  2HE7 A;  1T0Y A;  3GZN I;  4B9K A;  2NPT B;  2KJH B;  1S3S G;  2D11 A;  2DZM A;  1ZKH A;  2M17 A;  2ZVN A;  4EZJ A;  1L2N A;  1P98 A;  1P1A A;  4KDL B;  1IP9 A;  1WX9 A;  4GOC A;  4X57 B;  2MWS B;  1E90 A;  2N9E B;  3V62 A;  4OVV A;  3ZNH B;  1WYW B;  2A5U A;  2KC1 A;  5LXH A;  5D94 A;  2O2V B;  1I35 A;  3WAL A;  2KDF B;  4FN2 A;  2BGF A;  3QAR A;  1A5R A;  1F9J A;  4F8C B;  2YVC A;  2LGX A;  2MBQ A;  2MBE A;  5BO4 B;  2FID A;  2RGF A;  4KSK C;  3SDL C;  4W9H A;  4B95 A;  4LCD E;  1RFA A;  2Z59 B;  2MA9 B;  1WGH A;  2AEH A;  2KVR A;  3N32 A;  2KFK B;  1LFD A;  2LJ5 A;  3VUW A;  3KYC D;  3OJ3 A;  2JWZ A;  3HM3 A;  3MHS D;  3WAO A;  4BFR A;  2JZZ A;  5KHQ A;  3JYU A;  2D2Q A;  4K1R B;  4B6W A;  3VFK A;  1IYF A;  4ANW A;  2KDB A;  2WYQ A;  4EOY A;  5J18 A;  2GBK A;  1WXV A;  1E5W A;  4K7S A;  3V60 A;  5E6N A;  4HPL B;  4IM2 A;  3PRZ A;  1GUA B;  2O6V A;  1ZGU B;  2MBO A;  3RUL A;  4JLC A;  1UZX B;  1NDD A;  4WJQ A;  4DHZ E;  1H8C A;  2WX1 A;  4ASW C;  2NVU I;  3H9D A;  3SD5 A;  2LZ6 A;  3QIJ A;  3H6N A;  5LLI A;  2LI5 A;  2N1V A;  2KLC A;  2MSE D;  3X23 A;  2L3Z A;  3PVL A;  2KC2 A;  4BKT A;  1WX8 A;  3WA0 A;  4W9C A;  2C7N B;  3VXW A;  2BYF A;  4G50 A;  1U4A A;  1E7V A;  2Y5B B;  2BKF A;  1LM8 B;  2REX A;  3HM6 X;  2ZVO A;  4DWF A;  2AYO B;  1WIA A;  2KFJ A;  2KWU B;  3A9J A;  2WX0 A;  2W9N A;  2FIF A;  2C5L C;  4BKS A;  3L54 A;  3U8Z A;  2KXJ A;  1E8Z A;  1L7Y A;  2NCN A;  1J0G A;  4DHZ B;  2QHO A;  4GU2 A;  3DDC B;  4K7U A;  1WX7 A;  4IW0 A;  1WM3 A;  4GIV A;  4W9E A;  2KTF A;  1WZ0 A;  4KZ0 A;  1Z2M A;  3PLV A;  2JZ3 B;  3VDZ A;  2N9X A;  2JXX A;  2M8S A;  3JVZ X;  1IPG A;  3K9O B;  4MGK E;  1UBI A;  2N7E A;  3TJP A;  5EDS A;  3M63 B;  5CHV C;  1EUV B;  4II2 B;  4GDL B;  2JT4 B;  4NAW B;  1YQB A;  1YX6 B;  2MBH A;  4KZC A;  2D10 A;  1WMH B;  3WAM A;  4ZRJ A;  4BKG A;  4MEL A;  4I6P A;  2DZI A;  1P0R A;  4KDI C;  5E6O A;  2OOB B;  1LXD A;  3R7Q A;  1WGR A;  1Z5S B;  3AUL A;  1TBE A;  2DX5 B;  4GN1 A;  3RD2 A;  4WWP A;  3O65 B;  4AWJ A;  4I6N B;  3AXC A;  1E8W A;  4FHK A;  4CYE A;  2KD0 A;  4ANV A;  2LXA A;  5JH5 C;  3T9L A;  1YX5 B;  2FCS A;  4K7W A;  1E7U A;  4TV3 A;  2L00 B;  2FCQ A;  4GXB A;  1OGW A;  3GOE A;  4MJS B;  5CX3 A;  4A20 A;  2MBB B;  4GSW A;  2LVO A;  3PRP B;  1RRB A;  3A1Q B;  3NZS A;  2V4L A;  3L13 A;  3ZO5 B;  1WE6 A;  2CHX A;  3CF6 E;  2GBM A;  2ASQ A;  3APC A;  1HE8 A;  1TGZ B;  3ZVV A;  2LVP A;  2KN5 A;  2GBJ A;  3TIX A;  3ZNI D;  4CO7 A;  4DXA B;  3UQB A;  3VTW A;  4HJK A;  2ZNV C;  3UIO B;  2LAS A;  3VUX A;  1UH6 A;  3ZDM C;  2JVC A;  2N7D A;  3QWZ B;  2LRW A;  4DHJ B;  1GG3 A;  3AU5 A;  3IVF A;  4GDK B;  4RMA A;  2VRR B;  3M3J A;  4W9L A;  1SE9 A;  4FAD A;  3VAW A;  4NJ7 A;  1R4N I;  5L95 C;  2NR2 A;  1OEY J;  2M1M A;  1ISN A;  2NPT A;  1Y8R C;  1WJU A;  4XX5 A;  4F7Z A;  3ECI A;  1OTR B;  4M0W B;  3VUY A;  2GMI C;  3ML9 A;  4A3P A;  3NHE B;  3KW5 B;  2FAZ A;  5DCN A;  4MEM A;  3W1S A;  3Q3J A;  2RSU A;  4CHK A;  2O2V A;  3L10 B;  3N3K B;  1KLV A;  1WFY A;  4KIK B;  3ZIM A;  3PS6 A;  5AEK B;  3APD A;  2PE9 A;  1C3T A;  2C60 A;  3TMP B;  3I3T B;  2BWF A;  3PV1 A;  3QJZ A;  4WWN A;  1J8C A;  1YIW A;  3KH0 A;  1RLF A;  5FR6 A;  4MGY E;  1PQS A;  3R66 C;  1EO6 A;  3KUD B;  1XD3 B;  4DHJ D;  3IFW B;  2KFK A;  4J6I A;  3DBR I;  2M4N A;  4PS7 A;  4ZYN A;  4EZL A;  2XBB C;  5JHB A;  1XT9 B;  1WR6 E;  5E6P A;  3B08 A;  2A4Z A;  3DQV A;  2Z0D B;  2ZCB A;  3JW0 X;  2FCN A;  2M0X A;  2PJH A;  4HCP B;  3SHQ A;  2KTR B;  3A33 B;  3N30 A;  1UBQ A;  3UIP B;  2D07 B;  4W9G A;  3M95 A;  3NY5 A;  4WJP A;  2J0M A;  4AP4 C;  2JUO A;  1WZ3 A;  4WWO A;  4NQK E;  4ZRI A;  2KZR A;  4TQ1 A;  3LDZ E;  2KMC A;  1YJ1 A;  3APF A;  3U30 A;  2L7R A;  1V2Y A;  1WXM A;  2G3Q B;  2MQJ A;  3VTU A;  2KQS A;  1AAR A;  2KQ7 A;  2CR5 A;  2LVQ A;  3AU4 A;  3T8M A;  4IG7 B;  4URK A;  3B0A A;  3IBE A;  2MP2 B;  2JRI B;  2BYE A;  3L08 A;  3H7P B;  3A4R A;  3DPD A;  3P2B A;  4NQL B;  4WJN A;  2JY6 A;  1NBF C;  1TTN A;  4BOS C;  3LJ3 A;  1MG8 A;  2ZEQ A;  3A4S C;  1OQY A;  5CHW A;  1QZE A;  2L8J A;  2L0T A;  3NZU A;  3VTV A;  4HVB A;  3VQI A;  3TL5 A;  3V6C B;  3W1Y A;  2BF8 B;  1WRD B;  4W9I A;  5TR5 A;  5IAA C;  3WAP A;  3MTN B;  5LXI B;  2DZK A;  2GOW A;  3L16 A;  5C1Z A;  1UGM A;  2IO3 B;  2KJR A;  2LUE A;  2V3S A;  2WWZ A;  2CKH B;  3B1L X;  5IA7 A;  2K6D B;  2J0J A;  3CMM B;  2AL6 A;  2UWQ A;  3HK0 A;  4MGI E;  1G6J A;  3C0R B;  3QQ8 B;  2K8B A;  4GDL A;  5C23 A;  3JSV B;  4NAW A;  2JRH A;  3UQA A;  5L83 A;  2FUH B;  1GC7 A;  4FUL A;  4W9J A;  2DEN B;  1WY8 A;  1WMH A;  1V5T A;  2CHW A;  4EEW A;  3ZNZ B;  3KUC B;  1V5O A;  2C7H A;  3HHM A;  3H1U A;  4E71 A;  4WQO B;  1Q5W B;  4BOZ B;  1WM2 A;  2EMT A;  3L0W B;  2XK5 B;  4FHJ A;  2MCN B;  4FA6 A;  1V80 A;  2KX0 A;  2LXC A;  4G0N B;  5DPW A;  1WJN A;  1D3Z A;  4MSQ B;  3CSF A;  5AZG A;  1WR1 A;  2J7Q B;  4N9F 4;  3ZKJ C;  1V49 A;  4LDT B;  1K8R B;  4LJP B;  3PZD A;  4XZ4 A;  3ZRC A;  1NI2 A;  2L0F A;  1GJZ A;  4K81 A;  3NS8 A;  2XK5 A;  2PPH A;  1WJ6 A;  2K1F A;  3DCG A;  4EZK A;  2KAN A;  2K8C A;  1LQB A;  2HTH A;  3M62 B;  2K8H A;  3R3M A;  4JIO U;  4MJS A;  4BBN F;  3VH3 B;  2JPH A;  2KWC A;  3A1Q A;  3WAN A;  4W9K A;  4JL9 A;  2DAF A;  4DBG A;  4MH0 E;  4AJY B;  3DOW A;  2NBU A;  1P9D U;  3ZUN A;  3ZTC A;  2MRP A;  3QK0 A;  4AOF A; 
#chains in the Genus database with same CATH topology
 3RCZ A;  4RF1 A;  2D3G A;  4IUM B;  2RR9 A;  4LNF A;  2HD5 B;  2WU2 B;  1E8Y A;  3WIM A;  1M94 A;  3X0W A;  2ZNV B;  5LXH A;  4HWI B;  1WGG A;  4XC2 A;  3UIN B;  1RWS A;  1YD8 U;  3I57 A;  2IY1 B;  4YL8 A;  2IGD A;  4DDG D;  1SE2 A;  1RAX A;  3FKY A;  2MW5 A;  5H92 C;  2IO0 B;  4AS1 A;  2KDE B;  1WXA A;  4KKJ A;  4S17 A;  4KIK A;  1TYG B;  3SEB A;  2CS4 A;  3DBS A;  4D2K A;  3Q3F A;  2YEP F;  3IAM 1;  3AE1 B;  2ZZP B;  5C2T B;  1I42 A;  2BW2 A;  4ZRK A;  3CST A;  1V9J A;  5C3J B;  4A55 A;  5HKH A;  1PGB A;  4HXD A;  2LMC A;  2IO1 B;  4KGS A;  4IM3 A;  4MSM B;  1JRO A;  4P7I A;  3PHX B;  3BYY B;  4LJO B;  4RGO S;  4HK2 A;  3AI5 A;  4WAF A;  2ZJD A;  2N1W A;  1NVI D;  4GGQ A;  3RNG C;  3Q3M C;  3R7R A;  1KOT A;  3QCA A;  4IM0 A;  3HRD D;  1EF5 A;  4KV2 A;  3DWM A;  3DVN U;  3RNB C;  3RT3 B;  4RH6 A;  2KJ6 A;  2W3S A;  3NG0 A;  5D7G A;  4W9D A;  1FNV A;  2JF5 A;  5J17 A;  4HDO A;  2D3B A;  2YEP B;  3JSV A;  5D6J B;  3PRE A;  3QC8 B;  4C4V A;  3FIL A;  1FCC C;  3PGE A;  2G4S A;  4M8M A;  4WJO A;  3CWI A;  1L0Y B;  2EKI A;  2KHW B;  2V9H A;  2KLG A;  3D32 A;  3QA8 A;  1V6E A;  3OAW A;  3AE8 B;  2K0P A;  2G9H D;  3SR6 A;  1GNU A;  1HA5 A;  2IGG A;  2IJ0 A;  2PEA A;  2KDI A;  1D6E C;  3KQ4 A;  5EE1 A;  4GB9 A;  1P7F A;  1SGH A;  1T5X D;  1GC6 A;  2X8X X;  4FJV B;  3GZN I;  1ROE A;  4B9K A;  2NPT B;  1R4N B;  1S3S G;  2DZM A;  1KRH A;  3J9C A;  1P98 A;  3CIR B;  1GB1 A;  1WX9 A;  1E0Z A;  5G5H A;  4OVV A;  3ZNH B;  3T3N A;  2BGF A;  3QAR A;  2YVC A;  2LGX A;  5BO4 B;  2RGF A;  3BVG A;  2WXH A;  4C7Y A;  3U7Z A;  4WH4 A;  4B95 A;  4LCD E;  2Z59 B;  4USA A;  2ON8 A;  2KT7 A;  2KVR A;  3Q8C A;  1J7C A;  2PKO A;  3JYU A;  4K1R B;  5KHQ A;  1IYF A;  2WDQ B;  4EOY A;  2WYQ A;  2GBK A;  1TS4 A;  4YT0 B;  3RNC C;  5E6N A;  3MHZ A;  1N60 A;  2J53 A;  1ZGU B;  4AQ7 A;  1KLU D;  1QT9 A;  1UZX B;  2M0A A;  4WJQ A;  2GI9 A;  2WX1 A;  4ASW C;  2N9K A;  1FD6 A;  3H6N A;  2NTS A;  2MSE D;  3AE7 B;  1N61 A;  1KTK A;  2L3Z A;  2KC2 A;  2C7N B;  4B0E A;  1U4A A;  2BKF A;  1LM8 B;  4DWF A;  3A9J A;  2J42 A;  2C5L C;  3L54 A;  3FAH A;  1L7Y A;  2NCN A;  3H8H A;  4K7U A;  2LUM A;  2OJW A;  2KTF A;  4KZ0 A;  4JE3 B;  1SSN A;  4JPS A;  3VDZ A;  4A8X C;  2M8S A;  1PFD A;  2X38 A;  5EDS A;  1YJI A;  2QMT A;  4GDL B;  1DOY A;  2W3R A;  1ZP0 B;  1XO3 A;  3U2S C;  1WMH B;  1FXA A;  2V4I B;  4I6P A;  4ZHO A;  4BAX A;  1LXD A;  1VZ7 A;  2KYW A;  2B76 B;  2DX5 B;  3B2G A;  2JZP A;  3RD2 A;  3GB1 A;  4O1N A;  3O65 B;  1FIQ A;  2KAC A;  3GOE A;  5CX3 A;  1XLN A;  3RFZ B;  2CHX A;  2GBM A;  2LVP A;  5FK9 C;  3ZNI D;  3UQB A;  2ZNV C;  3VUX A;  1UH6 A;  4W9L A;  1L5P A;  1KF6 B;  2M1M A;  4FXC A;  1ISN A;  1TS5 A;  1C76 A;  4XX5 A;  4HKQ A;  1WXQ A;  5HHD G;  4K3B A;  1FO4 A;  3ML9 A;  4A3P A;  1JWM D;  1MVK A;  4YTN B;  1KLV A;  3AEG B;  5AEK B;  4PK1 A;  1C3T A;  2C60 A;  2BWF A;  3PV1 A;  3BVM A;  1I4X A;  1YIW A;  3DBR B;  4XWW A;  1NEK B;  3I5J C;  5EE9 A;  3DBR I;  4EZL A;  3TEW A;  2XBB C;  2M0X A;  5EE0 A;  1I4R A;  2KTR B;  3A33 B;  4OW0 A;  1UBQ A;  2RDH A;  3NY5 A;  1I4Q A;  4PT5 A;  1XXG A;  1TKY A;  2KZR A;  1IGD A;  3U30 A;  2L7R A;  1V2Y A;  3AE5 B;  3Q3N C;  3O13 A;  2IPK D;  3VTU A;  2KQS A;  1AAR A;  2KQ7 A;  2LVQ A;  3AU4 A;  2D3A A;  4RGT A;  1V1P B;  1OQQ A;  2PVO D;  3LXF A;  2JRI B;  3A4R A;  4Q2J A;  4NQL B;  3BK1 A;  1TS2 A;  1NBF C;  5I4D A;  5BYS A;  1T0S C;  3A4S C;  1B1Z A;  1OQY A;  5FR3 A;  3VTV A;  3TL5 A;  1NYQ A;  4ZRQ A;  2BF8 B;  2WXF A;  4OZB A;  3WAP A;  3MTN B;  5LXI B;  2WXG A;  2DZK A;  3L16 A;  1UGM A;  2LUE A;  4JX1 C;  2K6D B;  2J0J A;  2UWQ A;  5IKC M;  3C0R B;  1SJE D;  3AV8 A;  5C23 A;  2JRH A;  1SE3 A;  1T3Q A;  1WM2 A;  4N58 A;  4MSQ B;  3CSF A;  2J7Q B;  4LDT B;  1CQV A;  3PZD A;  2WXR A;  1WJ6 A;  3AN1 A;  3Q8E A;  3R3M A;  4BBN F;  2L52 A;  4W9K A;  4JL9 A;  2DAF A;  4MH0 E;  1MG4 A;  2N7J A;  3ZUN A;  1L0V B;  2MRP A;  1TZO A;  3AM9 A;  3QK0 A;  4KX6 B;  3HUI A;  4GMV A;  1C77 A;  3EC8 A;  3MC0 B;  5J2R A;  2GBR A;  3AE9 B;  4LDT D;  3DBH I;  2N4F A;  4GDK A;  2C9W B;  2PE6 B;  3ZTD A;  2MLB A;  1WJ4 A;  5D3I B;  4TQ0 A;  4E3C A;  1ZE3 D;  3DBL I;  1SF0 A;  4MGZ E;  4EFO A;  3DVG X;  2NTT A;  3AE3 B;  4ARC A;  1HZ5 A;  3PPA A;  2BPS A;  2KMM A;  3VHT C;  3H7S A;  2RPQ A;  2NBW B;  3GE8 C;  3MFG A;  5AZF A;  1M4V A;  2LRU A;  4E74 A;  3K9P B;  2JYE A;  4REZ A;  1BML C;  1WI0 A;  3EFU A;  1FXT B;  2AWT A;  2O6V B;  2DLB A;  3VH4 B;  1CJE A;  3BZD B;  4OVU A;  3ZW3 A;  2TSS A;  2IO2 B;  2R2O A;  2WDR B;  4RM8 A;  1Y56 A;  1I4H A;  1XLO A;  2RDB C;  2LHE A;  2IYD B;  1BT0 A;  2BB6 A;  1V86 A;  2CHZ A;  3TCA A;  3IHP C;  2DBY A;  2VZK B;  2PTL A;  1T0R C;  3ONS A;  3GP7 A;  2IDY A;  3ZRF A;  1X1M A;  3V61 A;  4NAM A;  2MP2 A;  4OZC A;  2WXM A;  3H7P A;  2O6V D;  2H88 B;  3RUI B;  4JGH B;  2MX2 A;  3P4R B;  2B3A A;  1XEE A;  1MFW A;  4IWP A;  4NNJ B;  3BYT B;  1ZDX A;  2JU6 X;  1SB3 C;  2WXN A;  4WAA A;  1TZ1 A;  2L76 A;  2INP E;  3Q8B A;  5JXV A;  3PHW B;  1JW9 D;  3SU8 X;  1QOG A;  3BWU D;  2VZK D;  1OFF A;  3N1Y C;  1R7S A;  4NY0 A;  3OLM D;  4IKG A;  2CU3 A;  3UF8 A;  4TSS A;  2ACZ B;  1F52 A;  3C19 A;  3PLU A;  1XQQ A;  1PYW D;  2WHI A;  1WGY A;  4EKU A;  2K6Q A;  4PYU A;  2MEK A;  2WXO A;  2ONQ A;  4RM9 A;  3A9K B;  2FCM A;  4F1S A;  1QOB A;  2I1K A;  2VH2 A;  2LJI A;  4NPN A;  3V05 A;  2K25 A;  4IOI E;  3A9K A;  1ZXI A;  4XE0 A;  1H4R A;  4US8 A;  3PRM B;  1E9M A;  3MJW A;  2V1Y A;  2KOX A;  2K5P A;  2KJH B;  2QJL A;  3U4E G;  2XNA C;  4GOC A;  1SJH D;  2N9E B;  1WSP A;  2AQ3 B;  1XCT L;  2A5U A;  2KC1 A;  5D94 A;  2O2V B;  3BVZ A;  2KDF B;  1A5R A;  4XWT A;  4F8C B;  5IN7 A;  2MA9 B;  2D5G A;  2AEH A;  3N32 A;  1LFD A;  3VUW A;  3HM3 A;  1TY2 A;  3HVD A;  1FCL A;  4K7S A;  3V60 A;  3NVV A;  4IM2 A;  4YWG G;  4JLC A;  1FFU A;  3SD5 A;  4M01 A;  2LI5 A;  4DXG A;  3EFC A;  1T0Q C;  1EU3 A;  3PVL A;  4W9C A;  3U52 E;  3VXW A;  4G50 A;  3HM6 X;  1C9F A;  1YQ4 B;  1N62 A;  2WX0 A;  3U8Z A;  3Q8A A;  5IO9 A;  2HDE A;  4DHZ B;  2AX5 A;  3DDC B;  1WX7 A;  4L23 A;  4W9E A;  1F0Z A;  2JZ3 B;  1V8C A;  3PZ8 A;  3SFE B;  3VRA B;  4HKZ E;  2QIE B;  2N7E A;  3TJP A;  1P7E A;  3Q3O C;  1ZXH A;  2JT4 B;  4NAW B;  1YQB A;  2L83 A;  4OHJ A;  2MBH A;  2D10 A;  2MJD A;  3WAM A;  2BS2 B;  1TS3 A;  4BKG A;  4KDI C;  3RMK C;  5E6O A;  1WGR A;  1SXT A;  1VZ8 A;  2LFI A;  1TBE A;  4GN1 A;  3AXC A;  2DWQ A;  4R3D A;  1V97 A;  4ANV A;  3T9L A;  1YX5 B;  2OHF A;  3E56 A;  4LLG M;  1E7U A;  4TV3 A;  1OGW A;  2MH7 A;  4A20 A;  2Y3A A;  2MBB B;  2LVO A;  4N6E B;  4KKI A;  4P6V F;  5HI1 A;  3ZO5 B;  1WE6 A;  3CF6 E;  1UGJ A;  3APC A;  3LB8 C;  2GLS A;  4WUR A;  1TGZ B;  3MP9 A;  2GBJ A;  1VDV A;  4DXA B;  5BYR A;  3AE2 B;  2RDG A;  2LAS A;  3ZDM C;  3Q6B A;  3QWZ B;  2LRW A;  4YTM B;  1GG3 A;  2ICI A;  2VRR B;  3VAW A;  4NJ7 A;  1R4N I;  3P63 A;  1CK1 A;  5L95 C;  2NR2 A;  4LK0 M;  1OEY J;  2NPT A;  3ECI A;  4M0W B;  2GMI C;  3P4Q B;  3KW5 B;  4MT5 A;  4P1C C;  2RMM A;  2RSU A;  4M0W A;  4ITK A;  3APD A;  3DHG C;  1FMA D;  1J8C A;  1RLF A;  5FR6 A;  4MGY E;  1PQS A;  1R4M B;  3KUD B;  4PS7 A;  2W54 A;  5JHB A;  1WR6 E;  3DQV A;  2Z0D B;  2ZCB A;  2BVC A;  3JW0 X;  2FCN A;  1SIJ A;  2PJH A;  1ZUD 2;  3SHQ A;  2Z8L A;  4W9G A;  3M95 A;  1JWA D;  2BQQ A;  2FUG 1;  2J0M A;  3NZ3 A;  4AP4 C;  2JUO A;  3DHH C;  4WWO A;  4NQK E;  1HTO A;  1EU4 A;  3LDZ E;  4C80 A;  3GS2 A;  3URY A;  4HEA 1;  1WXM A;  2MQJ A;  2CR5 A;  3L08 A;  2BYE A;  4US9 A;  4WJN A;  2JXT A;  1AYF A;  2R61 A;  3LJ3 A;  1MG8 A;  2E3T A;  2ZEQ A;  1QZE A;  2L8J A;  4RFB A;  3W5U B;  1L0X B;  3VQI A;  1WRD B;  4HJG E;  4W9I A;  5TR5 A;  3NRZ A;  2V3S A;  1YN5 A;  2OED A;  1ACC A;  2Y5P A;  4GDL A;  2JYT A;  3UQA A;  2DEN B;  1WY8 A;  1WMH A;  1V5T A;  2CHW A;  1E10 A;  3FC4 A;  3KUC B;  1V5O A;  1I4P A;  3H1U A;  4C7Z A;  2EMT A;  3L0W B;  1V80 A;  1D3Z A;  1OQR A;  1WR1 A;  3AB5 A;  3ZKJ C;  2BYT A;  3ZRC A;  4UDU C;  1D5Z C;  1FM0 D;  2K1F A;  2PLP A;  1LQB A;  3DWG C;  3MC9 A;  3NUH B;  4JIO U;  3VH3 B;  3TEX A;  5BYQ A;  1F1H A;  3WAN A;  2M56 B;  3ZGZ A;  3AE6 B;  1F2R C;  1PGX A;  1QF6 A;  3HVZ A;  4JWS C;  1EWY C;  2PIA A;  1K52 A;  1JRU A;  2DYB A;  2QDF A;  2RD0 A;  3ENE A;  4EUT A;  4ZYS A;  4MM3 B;  1KJT A;  1V1O A;  4KVG B;  1MJD A;  3W1S C;  2ZPN A;  5E6J A;  2KNB A;  4A3O A;  1EF1 A;  1KFY B;  3ZDT A;  3ALB A;  2CU1 A;  3DVG Y;  4MM3 A;  1YQ3 B;  2KMA A;  4HLE A;  1ET9 A;  2V3P A;  1QIL A;  1XLP A;  2LGD A;  4PS8 A;  1SE4 A;  4H2A A;  3T3O A;  2Z0E B;  4PYZ A;  4PS3 A;  3P4S B;  1S1Q B;  1Q1O A;  3ZLZ A;  1I7H A;  4ANU A;  3ZNG C;  4W9F A;  3W9C B;  2M19 A;  5AZH A;  2WQY B;  3IXS A;  3U7D A;  2GB1 A;  3NVZ A;  5JZE B;  2DHZ A;  1JRP A;  1CZP A;  4RF0 A;  2N0S B;  2KTR A;  2BYV E;  3BK2 A;  4LNI A;  1SIF A;  1WXS A;  3ML8 A;  2IZV B;  1V81 A;  4IWO A;  3RNF C;  2UYZ B;  2FE8 A;  3HIZ A;  3NJT A;  2EMS A;  4FBJ B;  3E9S A;  2I1J A;  1V1P A;  4TMA B;  4DK5 A;  2KQ4 X;  3KLS X;  2LGY A;  2CJO A;  2G4D B;  3KUZ A;  1VD2 A;  2L05 A;  2XEW A;  2VH1 A;  2BB5 A;  4AJW A;  3RZF A;  4I6L B;  3ZNZ B;  4MDK E;  1HZ6 A;  3MC8 A;  4A90 A;  4P1B C;  4HRO A;  5DPT A;  1JWS D;  1WF9 A;  1C4A A;  1N5X A;  4AUQ C;  4BKS D;  1SBB B;  2DZJ A;  3RN9 C;  3RZW C;  1YMH E;  1HEZ E;  3BII D;  3OWE B;  1WGD A;  1FEH A;  4XDC A;  2R2Q A;  4TKN A;  3NOB A;  2WDT B;  1CMX B;  4N59 A;  3P42 A;  4S0R A;  2XN9 C;  4HPM B;  3OG5 A;  1UUP A;  1N5W A;  1UEL A;  5GMV A;  3ZJU A;  2J0K A;  2ZW0 A;  2K22 A;  3L17 A;  2NMQ A;  2AQ1 B;  5KHO A;  3QX1 A;  1JQ4 A;  3S2A A;  1EWC A;  1NYR A;  4YTP B;  1T0Y A;  3KWV A;  2WLB A;  3RPF C;  2D11 A;  3IT4 B;  2ZVN A;  1D5X C;  4X57 B;  1HQR D;  1E90 A;  4XGA B;  1J7B A;  3WAL A;  5BMH A;  1TY0 A;  4KSK C;  3SDL C;  4W9H A;  1WGH A;  1ET6 A;  2I38 A;  2KFK B;  1AWD A;  4BFR A;  2WS3 B;  3ZYY X;  3WAO A;  2JZZ A;  4B6W A;  1L4D B;  2KDB A;  2GRI A;  3Q69 A;  1WXV A;  1Q10 A;  2LEK A;  4HPL B;  1TIF A;  3PRZ A;  2O6V A;  3RUL A;  3VRB B;  1NDD A;  1H8C A;  4WQM A;  1JML A;  3TUO A;  2WXK A;  3H9D A;  2N1V A;  3IT6 B;  1L4Z B;  3ZJT A;  1IUE A;  4BKT A;  1WX8 A;  4DQO C;  2PW9 A;  1E7V A;  2REX A;  2ZVO A;  2AYO B;  1WIA A;  2KWD A;  2W9N A;  2QC8 A;  4L1B A;  4GU2 A;  2L32 A;  1YNT E;  1WM3 A;  4GIV A;  1XLQ A;  2BT6 A;  1Z2M A;  3PLV A;  3JVZ X;  1IPG A;  5IP4 D;  1ZOY B;  1UBI A;  5CHV C;  1EUV B;  1RM6 C;  4M00 A;  1YX6 B;  4KZC A;  4ZRJ A;  5LNK 1;  2DZI A;  3MJ5 A;  4YXD B;  3R7Q A;  1Z5S B;  3EA6 A;  2IND C;  4AWJ A;  4I6N B;  4FHK A;  1TKE A;  1L6U A;  5JH5 C;  2FCS A;  4K7W A;  3ZXV A;  3DHI C;  2FCQ A;  4WIP A;  4XYC A;  4MJS B;  1HTQ A;  2JX5 A;  2J52 A;  3A1Q B;  3N20 C;  3L13 A;  1K51 A;  2KN5 A;  4IDI A;  2N9L A;  4CO7 A;  3VTW A;  4HJK A;  1XF5 L;  2JVC A;  1YN4 A;  4DHJ B;  1F2R I;  3IVF A;  4RCO A;  3M3J A;  1SE9 A;  3NVW A;  1VZ6 A;  5GXG B;  1GAQ B;  2JSV X;  1Y8R C;  3VUY A;  1B9R A;  3W2D A;  4MEM A;  3W1S A;  2K9X A;  2O2V A;  1WFY A;  4KIK B;  1WWT A;  3PS6 A;  1JAL A;  3TMP B;  3QJZ A;  2KVZ A;  4MAC A;  1QOA A;  1UF0 A;  1XD3 B;  4DHJ D;  1GB4 A;  3N1Z C;  3PO0 A;  4ZYN A;  1STE A;  2SEB D;  1XT9 B;  2LGS A;  2A4Z A;  3WCQ A;  1QOF A;  4P16 A;  4HCP B;  3N30 A;  3UIP B;  2D07 B;  2BTE A;  3P4P B;  1C4C A;  4WJP A;  2KN4 A;  1WZ3 A;  3AH7 A;  1YJ1 A;  3RNE C;  4YSY B;  3T8M A;  3B0A A;  4OZA A;  1FFV A;  3DPD A;  3P2B A;  4A6Q A;  2JY6 A;  2EEL A;  5HFY A;  5CHW A;  3AED B;  2WXQ A;  3NZU A;  3V6C B;  4GLS C;  5IAA C;  2WXI A;  2GOW A;  4K3C A;  2CKH B;  2KAJ A;  1BXT A;  2AL6 A;  4MGI E;  3QQ8 B;  3JSV B;  4NAW A;  4M02 A;  5L83 A;  4W9J A;  1GC7 A;  1VLB A;  4EEW A;  4BOZ B;  4FHJ A;  4C4V B;  3FIL B;  2WXL A;  2MCN B;  2KX0 A;  1FNU A;  2LXC A;  3Q2A C;  3ZJV A;  1J7A A;  1N6Z A;  4HRS A;  1FXI A;  3TEY A;  4N9F 4;  1V49 A;  2WNM A;  2L0F A;  1GJZ A;  3NS8 A;  3DCG A;  1ESF A;  4ARI A;  2K8H A;  2JPH A;  2KWC A;  4WWM A;  1A70 A;  4DBG A;  4DXF A;  4AJY B;  3DOW A;  5MPO A;  4LNN A;  4OVZ A;  1D5M C;  3AE4 B;  4AOF A;  2ZW1 A;  3EHV A;  4YSX B;  2G45 B;  2BWE S;  2NS5 A;  1C4P A;  4C56 C;  1DOI A;  1JWB D;  3BY4 B;  3KVF B;  3GZN B;  3P1M A;  2SAK A;  4JQW C;  2G1E A;  3VVW B;  1FNW A;  1EM7 A;  3BIN A;  2Q5W D;  4NJ6 A;  3QAQ A;  1BUI C;  5CHF A;  1XCQ L;  1HXY D;  1MHX A;  2C7M B;  2IY0 B;  2LGI A;  3C8Y A;  4FLH A;  1ZW7 A;  4J3O D;  4ICU A;  4BZA A;  4BBN C;  3PSE B;  3VR9 B;  2DYO A;  3DVN V;  4ANX A;  2WDV B;  4ZDV A;  1R4M I;  1MPE A;  3TSS A;  1KM7 A;  2DAJ A;  3IG3 A;  5D2M B;  4KSL C;  4CQN A;  2EKE C;  3PTF C;  3RYT A;  1GPX A;  1QLB B;  2LWP A;  3GE3 C;  1OEY A;  2BKR B;  2FBW B;  2KO3 A;  3UI3 A;  1VRA B;  2ZPY A;  1YJJ A;  5DPR A;  2KK8 A;  1D4B A;  1J19 A;  4NZL B;  4ACF A;  2Y5C A;  2YLM A;  2HTM E;  4A9A A;  1F77 A;  5T8I A;  3A9J B;  4LTU A;  4HDQ A;  3B9J A;  3RNA C;  2WXJ A;  4BVU C;  1TKG A;  3AEA B;  1NEN B;  4IC7 B;  1UD7 A;  2KKC A;  5G55 A;  1Q0W B;  2OJR A;  2FNJ B;  4IWQ A;  4FJY A;  4M8N A;  2DYM A;  2KWV B;  4ICV A;  1DOX A;  4II3 B;  3VR8 B;  3AEE B;  1WE7 A;  1C78 A;  5CTR C;  3V6E B;  1DGJ A;  3R8B A;  2MJE A;  2H89 B;  2K39 A;  2N9P C;  3KYD D;  4G3X B;  1LO5 D;  4DDI D;  2L1A A;  2LD9 A;  5DPS A;  2W55 A;  3OJ4 B;  1N63 A;  4LNK A;  2HJ8 A;  3B2F A;  3QHT A;  5JHA A;  2KX3 A;  3RI7 C;  4HCN B;  2J4X A;  3UGB B;  1AW7 A;  4TUU A;  1UNS A;  3PZ7 A;  3ZXR A;  3EEC A;  5G2N A;  3N9Y C;  1E8X A;  2AL3 A;  3AEB B;  3ABV B;  2QIL A;  4RGM A;  1P3Q U;  4FJZ A;  1SEB D;  2JQR B;  2NBV B;  1C1Y B;  4ZHP A;  2GBN A;  2ZCC A;  4G11 A;  3PT2 B;  3TBL D;  2IBI B;  1VCB A;  1WH3 A;  2HE7 A;  2M17 A;  1ZKH A;  4EZJ A;  1L2N A;  1P1A A;  4KDL B;  1IP9 A;  2MWS B;  2PVG C;  4JWU C;  2BBC A;  3V62 A;  3EUB 2;  1WYW B;  2BS4 B;  1QQR A;  1I35 A;  4FN2 A;  5D3D A;  3AMZ A;  1F9J A;  3IAS 1;  2MBQ A;  2MBE A;  2FID A;  2CJN A;  1NI3 A;  1UWM A;  3L4P A;  1E7P B;  1RFA A;  2LJ5 A;  4CHK A;  3KYC D;  3OJ3 A;  2JWZ A;  3I9V 1;  2KDM A;  3MHS D;  1WYG A;  1FRD A;  2D2Q A;  3VFK A;  3N1X C;  1ZPS A;  5H8Y E;  4ANW A;  5J18 A;  1E5W A;  4YSZ B;  1T6B X;  1GUA B;  2MBO A;  4DHZ E;  1FRR A;  2NVU I;  3NS1 A;  2LZ6 A;  4KGT A;  3QIJ A;  5LLI A;  5IOI A;  2KLC A;  3X23 A;  3KWL A;  3WA0 A;  1PGA A;  2BYF A;  2INN E;  3ZQ4 A;  2Y5B B;  2KFJ A;  1KLG D;  2KWU B;  4ZOH C;  2FIF A;  4BKS A;  2D3C A;  2KXJ A;  1E8Z A;  1J0G A;  1RYJ A;  2QHO A;  1TJE A;  4IW0 A;  1JWU D;  1WZ0 A;  2N9X A;  2JXX A;  1YN3 A;  3K9O B;  4MGK E;  3M63 B;  1PDX A;  2MJ3 A;  4II2 B;  1L6V A;  4MEL A;  1P0R A;  2OOB B;  2HJ1 A;  3AUL A;  2WGS A;  4WWP A;  2V0G A;  2AQ2 B;  3Q14 C;  1WGK A;  1E8W A;  4CYE A;  2KD0 A;  4RNA A;  2LXA A;  5EE3 A;  2RPV A;  2L00 B;  3LYY A;  4GXB A;  4C00 A;  3I63 C;  4GSW A;  3PRP B;  1RRB A;  3NZS A;  2V4L A;  1YOV B;  2ASQ A;  1AN8 A;  1GOZ A;  2JWU A;  2V3N A;  1HE8 A;  3ZVV A;  3TIX A;  3ETR A;  1MHH E;  3UIO B;  3Q8F A;  4MH8 A;  2N7D A;  1WRI A;  5TSS A;  3AU5 A;  5BMI A;  4GDK B;  4RMA A;  4FAD A;  3DBH B;  5FKA C;  1WJU A;  4F7Z A;  1OTR B;  3R2T A;  3DBL B;  3NHE B;  2FAZ A;  5DCN A;  3Q3J A;  3L10 B;  3N3K B;  3ZIM A;  2PE9 A;  1FPY A;  3I3T B;  4RGN A;  4WWN A;  1TT5 B;  3KH0 A;  1C79 A;  3R66 C;  1EO6 A;  3V3X A;  2E6X A;  4KGR A;  3IFW B;  4EE2 A;  1ENF A;  4LNO A;  2KFK A;  4J6I A;  2IGH A;  1LGR A;  2M4N A;  1PUT A;  2BS3 B;  1KH0 A;  1K50 A;  5E6P A;  3B08 A;  3SFD B;  1K53 A;  4ZRI A;  5BMG A;  1DYQ A;  2WXP A;  4TQ1 A;  2KMC A;  4XDD A;  3APF A;  2WU5 B;  2G3Q B;  2QCZ A;  2DNF A;  4IG7 B;  4URK A;  4ZRP A;  4B0M A;  1VJK A;  3IBE A;  2MP2 B;  3H7P B;  1VR9 A;  3R2I A;  1TTN A;  1QKZ A;  4BOS C;  2INC C;  2L0T A;  1JCK B;  4HVB A;  3W1Y A;  5AUK A;  1RFK A;  2QSD A;  2UU7 A;  3AEC B;  5C1Z A;  2IO3 B;  2KJR A;  2WWZ A;  3B1L X;  5IA7 A;  2QEJ C;  3CMM B;  2I2Y A;  3HK0 A;  1G6J A;  1UWX A;  2K8B A;  2MHJ A;  2FUH B;  4FUL A;  1ZDV A;  4QAY A;  3AEF B;  1IGC A;  1MI0 A;  2LHD A;  2C7H A;  3HHM A;  1IBX B;  4E71 A;  4WQO B;  5AUI A;  1Q5W B;  4FA6 A;  2XK5 B;  4G0N B;  4L2Y A;  5DPW A;  1WJN A;  5AZG A;  3TEZ A;  2WP9 B;  5HG2 A;  1I4G A;  1K8R B;  4LJP B;  4XZ4 A;  5G5G A;  1NI2 A;  1IBX A;  4K81 A;  2XK5 A;  4HPP A;  2K3U A;  2PPH A;  3W5V B;  3EGR A;  4EZK A;  2KAN A;  2K8C A;  2HTH A;  3M62 B;  4MJS A;  3A1Q A;  4NJC A;  1E6E B;  3NVY A;  2PMV A;  2NBU A;  1P9D U;  3ZTC A;  2W82 A; 
#chains in the Genus database with same CATH homology
 3EHV A;  2G45 B;  4GMV A;  2BWE S;  2NS5 A;  3RCZ A;  2D3G A;  3EC8 A;  1JRU A;  4IUM B;  2DYB A;  2RR9 A;  2RD0 A;  5J2R A;  3ENE A;  3BY4 B;  2GBR A;  4EUT A;  3KVF B;  2HD5 B;  4LDT D;  1KJT A;  1E8Y A;  4JQW C;  4KVG B;  3WIM A;  1M94 A;  3DBH I;  3W1S C;  2N4F A;  2ZPN A;  4GDK A;  2ZNV B;  2KNB A;  4HWI B;  3X0W A;  2C9W B;  2PE6 B;  1EF1 A;  1WGG A;  2MLB A;  4XC2 A;  3UIN B;  3ZTD A;  1WJ4 A;  3ZDT A;  4TQ0 A;  1YD8 U;  3ALB A;  3VVW B;  2CU1 A;  3DVG Y;  4E3C A;  2IY1 B;  4MM3 A;  3BIN A;  3DBL I;  4YL8 A;  4DDG D;  1RAX A;  2KMA A;  4MGZ E;  4NJ6 A;  4EFO A;  3QAQ A;  5CHF A;  3DVG X;  4HLE A;  2C7M B;  2IY0 B;  2LGD A;  2MW5 A;  3PPA A;  4PS8 A;  4FLH A;  1ZW7 A;  2BPS A;  2Z0E B;  4ICU A;  4PYZ A;  4PS3 A;  4BBN C;  2IO0 B;  3VHT C;  2KDE B;  3H7S A;  2RPQ A;  1WXA A;  3PSE B;  2NBW B;  1S1Q B;  4KIK A;  1Q1O A;  2DYO A;  3DVN V;  5AZF A;  3ZLZ A;  4A3O A;  4ANX A;  4ANU A;  2CS4 A;  3DBS A;  3ZNG C;  4ZDV A;  1R4M I;  4W9F A;  2LRU A;  1KM7 A;  4E74 A;  3K9P B;  2DAJ A;  3IG3 A;  5D2M B;  4KSL C;  3Q3F A;  5AZH A;  1WI0 A;  3EFU A;  3U7D A;  2EKE C;  3PTF C;  1FXT B;  3RYT A;  2ZZP B;  2LWP A;  5JZE B;  2AWT A;  2DHZ A;  2O6V B;  1I42 A;  1OEY A;  2BKR B;  2KO3 A;  4ZRK A;  3VH4 B;  4OVU A;  2ZPY A;  5DPR A;  3ZW3 A;  2IO2 B;  3CST A;  2R2O A;  2KK8 A;  1V9J A;  2KTR A;  4RM8 A;  1J19 A;  5HKH A;  2BYV E;  1SIF A;  4HXD A;  2IYD B;  1WXS A;  2IO1 B;  3ML8 A;  1BT0 A;  2IZV B;  1V81 A;  2YLM A;  4IWO A;  1V86 A;  2UYZ B;  4IM3 A;  2CHZ A;  3TCA A;  3IHP C;  4MSM B;  4P7I A;  3HIZ A;  3ONS A;  3A9J B;  2EMS A;  3PHX B;  4FBJ B;  4HDQ A;  3ZRF A;  2I1J A;  1X1M A;  4LJO B;  3V61 A;  4HK2 A;  4BVU C;  3AI5 A;  4DK5 A;  2MP2 A;  2LGY A;  2ZJD A;  3H7P A;  2G4D B;  4IC7 B;  2O6V D;  1UD7 A;  2KKC A;  3KUZ A;  2N1W A;  5G55 A;  1Q0W B;  2OJR A;  4GGQ A;  4JGH B;  2MX2 A;  3RUI B;  2B3A A;  2FNJ B;  1VD2 A;  4IWP A;  2L05 A;  4NNJ B;  2XEW A;  4IWQ A;  3R7R A;  4FJY A;  1KOT A;  4M8N A;  2DYM A;  2KWV B;  4ICV A;  3QCA A;  4IM0 A;  3RZF A;  4AJW A;  4II3 B;  1WE7 A;  4I6L B;  5CTR C;  1EF5 A;  3V6E B;  4KV2 A;  4MDK E;  3DVN U;  3RT3 B;  4WAA A;  1TZ1 A;  2L76 A;  2KJ6 A;  2K39 A;  5DPT A;  2N9P C;  3KYD D;  3PHW B;  5D7G A;  4G3X B;  4W9D A;  4DDI D;  3SU8 X;  2JF5 A;  5J17 A;  4HDO A;  1WF9 A;  2LD9 A;  5DPS A;  3JSV A;  4NY0 A;  4AUQ C;  3OLM D;  4BKS D;  2DZJ A;  3OJ4 B;  3RZW C;  1WGD A;  2HJ8 A;  3UF8 A;  5D6J B;  3QHT A;  5JHA A;  2R2Q A;  4TKN A;  2KX3 A;  3PRE A;  3QC8 B;  4HCN B;  3UGB B;  3PLU A;  3PGE A;  3NOB A;  1XQQ A;  4TUU A;  2WDT B;  2G4S A;  4M8M A;  1WGY A;  3EEC A;  5G2N A;  4EKU A;  1E8X A;  2AL3 A;  2K6Q A;  4WJO A;  1CMX B;  2KHW B;  2KLG A;  3D32 A;  4PYU A;  3QA8 A;  4HPM B;  1V6E A;  4RM9 A;  1P3Q U;  3A9K B;  1UEL A;  3OAW A;  2FCM A;  4FJZ A;  5GMV A;  4F1S A;  2I1K A;  2J0K A;  1GNU A;  2NBV B;  4NPN A;  1C1Y B;  3L17 A;  2K25 A;  2PEA A;  2GBN A;  2KDI A;  3A9K A;  5KHO A;  1H4R A;  2ZCC A;  3QX1 A;  4GB9 A;  3S2A A;  3PRM B;  1SGH A;  3MJW A;  4G11 A;  2V1Y A;  3PT2 B;  2KOX A;  2IBI B;  3TBL D;  1GC6 A;  1VCB A;  4FJV B;  1WH3 A;  2HE7 A;  1T0Y A;  3GZN I;  4B9K A;  2NPT B;  2KJH B;  1S3S G;  2D11 A;  2DZM A;  1ZKH A;  2M17 A;  2ZVN A;  4EZJ A;  1L2N A;  1P98 A;  1P1A A;  4KDL B;  1IP9 A;  1WX9 A;  4GOC A;  4X57 B;  2MWS B;  1E90 A;  2N9E B;  3V62 A;  4OVV A;  3ZNH B;  1WYW B;  2A5U A;  2KC1 A;  5LXH A;  5D94 A;  2O2V B;  1I35 A;  3WAL A;  2KDF B;  4FN2 A;  2BGF A;  3QAR A;  1A5R A;  1F9J A;  4F8C B;  2YVC A;  2LGX A;  2MBQ A;  2MBE A;  5BO4 B;  2FID A;  2RGF A;  4KSK C;  3SDL C;  4W9H A;  4B95 A;  4LCD E;  1RFA A;  2Z59 B;  2MA9 B;  1WGH A;  2AEH A;  2KVR A;  3N32 A;  2KFK B;  1LFD A;  2LJ5 A;  3VUW A;  3KYC D;  3OJ3 A;  2JWZ A;  3HM3 A;  3MHS D;  3WAO A;  4BFR A;  2JZZ A;  5KHQ A;  3JYU A;  2D2Q A;  4K1R B;  4B6W A;  3VFK A;  1IYF A;  4ANW A;  2KDB A;  2WYQ A;  4EOY A;  5J18 A;  2GBK A;  1WXV A;  1E5W A;  4K7S A;  3V60 A;  5E6N A;  4HPL B;  4IM2 A;  3PRZ A;  1GUA B;  2O6V A;  1ZGU B;  2MBO A;  3RUL A;  4JLC A;  1UZX B;  1NDD A;  4WJQ A;  4DHZ E;  1H8C A;  2WX1 A;  4ASW C;  2NVU I;  3H9D A;  3SD5 A;  2LZ6 A;  3QIJ A;  3H6N A;  5LLI A;  2LI5 A;  2N1V A;  2KLC A;  2MSE D;  3X23 A;  2L3Z A;  3PVL A;  2KC2 A;  4BKT A;  1WX8 A;  3WA0 A;  4W9C A;  2C7N B;  3VXW A;  2BYF A;  4G50 A;  1U4A A;  1E7V A;  2Y5B B;  2BKF A;  1LM8 B;  2REX A;  3HM6 X;  2ZVO A;  4DWF A;  2AYO B;  1WIA A;  2KFJ A;  2KWU B;  3A9J A;  2WX0 A;  2W9N A;  2FIF A;  2C5L C;  4BKS A;  3L54 A;  3U8Z A;  2KXJ A;  1E8Z A;  1L7Y A;  2NCN A;  1J0G A;  4DHZ B;  2QHO A;  4GU2 A;  3DDC B;  4K7U A;  1WX7 A;  4IW0 A;  1WM3 A;  4GIV A;  4W9E A;  2KTF A;  1WZ0 A;  4KZ0 A;  1Z2M A;  3PLV A;  2JZ3 B;  3VDZ A;  2N9X A;  2JXX A;  2M8S A;  3JVZ X;  1IPG A;  3K9O B;  4MGK E;  1UBI A;  2N7E A;  3TJP A;  5EDS A;  3M63 B;  5CHV C;  1EUV B;  4II2 B;  4GDL B;  2JT4 B;  4NAW B;  1YQB A;  1YX6 B;  2MBH A;  4KZC A;  2D10 A;  1WMH B;  3WAM A;  4ZRJ A;  4BKG A;  4MEL A;  4I6P A;  2DZI A;  1P0R A;  4KDI C;  5E6O A;  2OOB B;  1LXD A;  3R7Q A;  1WGR A;  1Z5S B;  3AUL A;  1TBE A;  2DX5 B;  4GN1 A;  3RD2 A;  4WWP A;  3O65 B;  4AWJ A;  4I6N B;  3AXC A;  1E8W A;  4FHK A;  4CYE A;  2KD0 A;  4ANV A;  2LXA A;  5JH5 C;  3T9L A;  1YX5 B;  2FCS A;  4K7W A;  1E7U A;  4TV3 A;  2L00 B;  2FCQ A;  4GXB A;  1OGW A;  3GOE A;  4MJS B;  5CX3 A;  4A20 A;  2MBB B;  4GSW A;  2LVO A;  3PRP B;  1RRB A;  3A1Q B;  3NZS A;  2V4L A;  3L13 A;  3ZO5 B;  1WE6 A;  2CHX A;  3CF6 E;  2GBM A;  2ASQ A;  3APC A;  1HE8 A;  1TGZ B;  3ZVV A;  2LVP A;  2KN5 A;  2GBJ A;  3TIX A;  3ZNI D;  4CO7 A;  4DXA B;  3UQB A;  3VTW A;  4HJK A;  2ZNV C;  3UIO B;  2LAS A;  3VUX A;  1UH6 A;  3ZDM C;  2JVC A;  2N7D A;  3QWZ B;  2LRW A;  4DHJ B;  1GG3 A;  3AU5 A;  3IVF A;  4GDK B;  4RMA A;  2VRR B;  3M3J A;  4W9L A;  1SE9 A;  4FAD A;  3VAW A;  4NJ7 A;  1R4N I;  5L95 C;  2NR2 A;  1OEY J;  2M1M A;  1ISN A;  2NPT A;  1Y8R C;  1WJU A;  4XX5 A;  4F7Z A;  3ECI A;  1OTR B;  4M0W B;  3VUY A;  2GMI C;  3ML9 A;  4A3P A;  3NHE B;  3KW5 B;  2FAZ A;  5DCN A;  4MEM A;  3W1S A;  3Q3J A;  2RSU A;  4CHK A;  2O2V A;  3L10 B;  3N3K B;  1KLV A;  1WFY A;  4KIK B;  3ZIM A;  3PS6 A;  5AEK B;  3APD A;  2PE9 A;  1C3T A;  2C60 A;  3TMP B;  3I3T B;  2BWF A;  3PV1 A;  3QJZ A;  4WWN A;  1J8C A;  1YIW A;  3KH0 A;  1RLF A;  5FR6 A;  4MGY E;  1PQS A;  3R66 C;  1EO6 A;  3KUD B;  1XD3 B;  4DHJ D;  3IFW B;  2KFK A;  4J6I A;  3DBR I;  2M4N A;  4PS7 A;  4ZYN A;  4EZL A;  2XBB C;  5JHB A;  1XT9 B;  1WR6 E;  5E6P A;  3B08 A;  2A4Z A;  3DQV A;  2Z0D B;  2ZCB A;  3JW0 X;  2FCN A;  2M0X A;  2PJH A;  4HCP B;  3SHQ A;  2KTR B;  3A33 B;  3N30 A;  1UBQ A;  3UIP B;  2D07 B;  4W9G A;  3M95 A;  3NY5 A;  4WJP A;  2J0M A;  4AP4 C;  2JUO A;  1WZ3 A;  4WWO A;  4NQK E;  4ZRI A;  2KZR A;  4TQ1 A;  3LDZ E;  2KMC A;  1YJ1 A;  3APF A;  3U30 A;  2L7R A;  1V2Y A;  1WXM A;  2G3Q B;  2MQJ A;  3VTU A;  2KQS A;  1AAR A;  2KQ7 A;  2CR5 A;  2LVQ A;  3AU4 A;  3T8M A;  4IG7 B;  4URK A;  3B0A A;  3IBE A;  2MP2 B;  2JRI B;  2BYE A;  3L08 A;  3H7P B;  3A4R A;  3DPD A;  3P2B A;  4NQL B;  4WJN A;  2JY6 A;  1NBF C;  1TTN A;  4BOS C;  3LJ3 A;  1MG8 A;  2ZEQ A;  3A4S C;  1OQY A;  5CHW A;  1QZE A;  2L8J A;  2L0T A;  3NZU A;  3VTV A;  4HVB A;  3VQI A;  3TL5 A;  3V6C B;  3W1Y A;  2BF8 B;  1WRD B;  4W9I A;  5TR5 A;  5IAA C;  3WAP A;  3MTN B;  5LXI B;  2DZK A;  2GOW A;  3L16 A;  5C1Z A;  1UGM A;  2IO3 B;  2KJR A;  2LUE A;  2V3S A;  2WWZ A;  2CKH B;  3B1L X;  5IA7 A;  2K6D B;  2J0J A;  3CMM B;  2AL6 A;  2UWQ A;  3HK0 A;  4MGI E;  1G6J A;  3C0R B;  3QQ8 B;  2K8B A;  4GDL A;  5C23 A;  3JSV B;  4NAW A;  2JRH A;  3UQA A;  5L83 A;  2FUH B;  1GC7 A;  4FUL A;  4W9J A;  2DEN B;  1WY8 A;  1WMH A;  1V5T A;  2CHW A;  4EEW A;  3ZNZ B;  3KUC B;  1V5O A;  2C7H A;  3HHM A;  3H1U A;  4E71 A;  4WQO B;  1Q5W B;  4BOZ B;  1WM2 A;  2EMT A;  3L0W B;  2XK5 B;  4FHJ A;  2MCN B;  4FA6 A;  1V80 A;  2KX0 A;  2LXC A;  4G0N B;  5DPW A;  1WJN A;  1D3Z A;  4MSQ B;  3CSF A;  5AZG A;  1WR1 A;  2J7Q B;  4N9F 4;  3ZKJ C;  1V49 A;  4LDT B;  1K8R B;  4LJP B;  3PZD A;  4XZ4 A;  3ZRC A;  1NI2 A;  2L0F A;  1GJZ A;  4K81 A;  3NS8 A;  2XK5 A;  2PPH A;  1WJ6 A;  2K1F A;  3DCG A;  4EZK A;  2KAN A;  2K8C A;  1LQB A;  2HTH A;  3M62 B;  2K8H A;  3R3M A;  4JIO U;  4MJS A;  4BBN F;  3VH3 B;  2JPH A;  2KWC A;  3A1Q A;  3WAN A;  4W9K A;  4JL9 A;  2DAF A;  4DBG A;  4MH0 E;  4AJY B;  3DOW A;  2NBU A;  1P9D U;  3ZUN A;  3ZTC A;  2MRP A;  3QK0 A;  4AOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...