2D07B

Crystal structure of sumo-3-modified thymine-dna glycosylase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords G/T mismatch-specific thymine DNA glycosylase
publication title Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d07B00
5E6PA 3RYTA 1WJ4A 3QWZB 4DWFA 2V3SA 2WX0A 4AUQC 2EKEC 2HD5B 3QC8B 4PYZA 4XC2A 4RMAA 1UELA 2O2VA 4PYUA 1P9DU 3VUYA 1UBQA 4W9KA 3A9JA 3JW0X 1OQYA 4BKGA 5AZGA 3ZLZA 4BOSC 4WWNA 4ZRIA 2KXJA 3VTVA 3U30A 1EF1A 1OGWA 5AZFA 4HCPB 4BKSA 3VUWA 3DVGY 2JRIB 2NS5A 1SIFA 3KUZA 3QA8A 3QX1A 1V6EA 3ZUNA 5JH5C 4NQLB 4RM9A 4NAWB 2M8SA 4W9CA 3ZNZB 2KOXA 3EECA 4BFRA 5TR5A 1UH6A 1SGHA 3ZRCA 3KW5B 1WGHA 1WIAA 4W9EA 3IVFA 1WGYA 2KMCA 2IY1B 2O6VB 1G6JA 5CHFA 2K39A 1GC6A 1L7YA 2L00B 1YX6B 3UQAA 2KLCA 2C7MB 3CF6E 3PRPB 4DDID 3QAQA 1TZ1A 2AL6A 4DBGA 1WI0A 3APFA 1NI2A 3IHPC 5BO4B 1UBIA 3IBEA 2KFKB 3V62A 5J2RA 3ENEA 1MG8A 3ZDTA 2FIDA 1WXMA 2MBBB 2K8CA 3NY5A 1HE8A 3TBLD 4MEMA 4MGYE 2LJ5A 3L54A 4IUMB 4HK2A 2ZZPB 5D7GA 3UINB 2K1FA 2DYMA 3RZWC 3WAOA 3CMMB 3SDLC 5FR6A 1OEYA 3AU4A 2M4NA 2ZVNA 2MBEA 4F1SA 3KYCD 2AYOB 1E8WA 1T0YA 2WDTB 3A4RA 1WX7A 4GXBA 3TMPB 3VQIA 3MTNB 1QZEA 5DPSA 2A5UA 3A9JB 2KN5A 4WJNA 1WXSA 3TCAA 3X23A 4BBNC 2LXAA 4FADA 4NNJB 4AOFA 3CSFA 3PHWB 2CU1A 4KZCA 4IWPA 2XK5A 4CYEA 4FJVB 2NR2A 1TGZB 4ICVA 4W9IA 4FLHA 4GIVA 4LJOB 2KQSA 3QCAA 4ZRJA 4ASWC 4W9LA 2PE9A 3PRZA 4AWJA 2DENB 4ZDVA 1RAXA 3PTFC 4FA6A 3PV1A 4CHKA 4NY0A 2JT4B 3JSVB 3DOWA 4WWPA 4F7ZA 2ZNVC 3PPAA 3SU8X 3M3JA 4XX5A 3GOEA 3PVLA 4AP4C 3WANA 2MBOA 5JHAA 5E6OA 4EEWA 2JWZA 2JXXA 1L2NA 3W1YA 2OOBB 4EZLA 1LFDA 3QQ8B 4LDTD 4PS3A 2KO3A 2J0JA 4HPMB 4MGZE 4KVGB 5GMVA 3A33B 3MHSD 2ZCBA 1WZ3A 3A9KA 4KDIC 5C23A 1BT0A 2GBNA 2N1WA 1IP9A 1KLVA 5JZEB 3L17A 4IWQA 3S2AA 2GMIC 1E5WA 1GG3A 4FULA 1V9JA 3ZRFA 3H7PB 1TTNA 1XD3B 3ZKJC 4I6PA 3RD2A 1ZGUB 3U8ZA 1RLFA 3EC8A 3IG3A 2DZIA 1WGRA 2KMAA 4A3PA 4G3XB 4AJYB 4EZKA 1YD8U 2KKCA 4HJKA 2ZNVB 5J17A 3H7SA 3QJZA 3KUDB 1WE7A 2N9XA 2RR9A 4MSMB 2DYOA 1H8CA 2BWFA 2OJRA 1Y8RC 1Z2MA 3W1SA 5DPTA 2KLGA 2ZEQA 3EHVA 2FCSA 3ML8A 4BKSD 1LQBA 4TUUA 2XK5B 2N7DA 2IYDB 3TJPA 4NJ6A 2D10A 2HJ8A 2DHZA 3DVNV 1LXDA 3R66C 1YQBA 4K1RB 1V81A 3ZIMA 1WH3A 4EKUA 4TQ0A 2LGYA 3PLVA 3B08A 3ECIA 4FJZA 2MP2A 4ANWA 4HDOA 1GJZA 2KC2A 2BPSA 4HPLB 2CKHB 2Y5BB 2ZJDA 5HKHA 2LGXA 1GNUA 4ZYNA 1EUVB 2JPHA 2KWVB 5G2NA 3UIPB 1YX5B 4NQKE 2B3AA 2NCNA 3NOBA 4IM3A 5J18A 3R3MA 4ANUA 1YIWA 2IZVB 4BVUC 3PGEA 3HIZA 2GBRA 3X0WA 2Z0DB 3W1SC 3APCA 3I3TB 4GDKB 4BBNF 1E90A 1EF5A 2R2QA 2XBBC 3VVWB 4ANVA 3A9KB 1XT9B 3N32A 4DXAB 2ZPNA 1RFAA 1WJUA 2K6DB 3VAWA 2MA9B 2C60A 4FJYA 3SHQA 1Q1OA 2LVOA 4II2B 1Z5SB 2BWES 2MCNB 5L83A 5IAAC 2FUHB 3VTUA 2FCNA 4DDGD 3U7DA 3DCGA 1WJNA 2J7QB 2LGDA 2ZCCA 3KUCB 4RM8A 2G3QB 2K25A 1V5TA 2YVCA 3ML9A 4LJPB 2MRPA 4GU2A 3HK0A 1WJ6A 3NZUA 3V61A 2V1YA 4MELA 2NPTA 1WM2A 3V60A 4EOYA 4WJOA 4W9DA 4TQ1A 2REXA 4IW0A 3BY4B 1P98A 2MBQA 4II3B 2G4SA 3WAMA 2BKRB 4ANXA 5EDSA 1E8XA 2WX1A 1Q5WB 1J19A 2I1JA 2MSED 2DAFA 3EFUA 1TBEA 1A5RA 2L3ZA 2NBUA 2MP2B 5LLIA 3KVFB 2FIFA 2Z0EB 3V6EB 2EMSA 2KDIA 2JVCA 3CSTA 3AXCA 1ZW7A 4ZRKA 3VH4B 1WR6E 3IFWB 3VFKA 4GN1A 2O2VB 5D6JB 1I42A 1WF9A 4MDKE 2ZPYA 1LM8B 3N30A 4WJPA 1WRDB 4OVVA 1WXVA 4G11A 3L08A 2BYVE 2AL3A 4EUTA 2M0XA 1CMXB 1GUAB 3B0AA 2C5LC 2JF5A 2KHWB 3DDCB 3HM6X 1ISNA 3PT2B 2Z59B 4HDQA 2DZKA 4IWOA 1V80A 1ZKHA 2KK8A 3A1QA 1JRUA 3DPDA 1YJ1A 3QIJA 3ONSA 3OJ4B 5C1ZA 5AZHA 4BOZB 2O6VD 3RCZA 1I35A 2DZMA 3WA0A 4KDLB 1F9JA 5JHBA 2LWPA 5D2MB 3HHMA 1P1AA 4KIKA 4MH0E 2IO0B 1R4MI 2BYEA 4TV3A 4FHJA 3ZNID 4HLEA 2PJHA 2NPTB 2K8BA 1WXAA 1Q0WB 1SE9A 4PS7A 4N9F4 1M94A 3P2BA 3WIMA 3DBHI 3V6CB 3HM3A 2IO2B 2J0KA 2V4LA 4E71A 4X57B 2LI5A 4G50A 3T8MA 3UQBA 2JZ3B 2N1VA 3PRMB 1V2YA 5IA7A 1UZXB 3M62B 4WJQA 1AARA 1R4NI 2LUEA 1IYFA 3PS6A 2W9NA 4F8CB 4K7WA 1FXTB 2N9EB 2VRRB 3L0WB 2IO3B 4W9JA 4B6WA 2LD9A 1U4AA 2AWTA 1WYWB 4GGQA 2GBJA 2JUOA 2GOWA 4JGHB 4TKNA 2KD0A 2ASQA 2KDEB 2LRWA 2N4FA 1X1MA 2DYBA 3A4SC 3B1LX 1S1QB 4YL8A 4KSLC 4A20A 5G55A 4JQWC 3ZNGC 3LJ3A 2D07B 3QK0A 1E7VA 3A1QB 1WX9A 1V5OA 1GC7A 4IG7B 2L0FA 3ALBA 4I6NB 4DHZB 2JZZA 3DBSA 4HWIB 4JLCA 2NVUI 4MGIE 4NAWA 2KWCA 4B9KA 2AEHA 2PEAA 5AEKB 3T9LA 2DX5B 1NBFC 1S3SG 4HXDA 3WAPA 1WR1A 1OEYJ 5CTRC 4JIOU 4BKTA 3MJWA 2D11A 2BKFA 3AU5A 3M63B 3N3KB 3RT3B 4DHZE 3AULA 2UWQA 2GBKA 4URKA 1WE6A 2FCMA 2KDBA 5DPWA 4DHJB 2DZJA 4M8NA 2NBVB 4K7SA 2KFKA 4M0WB 5DCNA 3GZNI 2L7RA 3PSEB 4MM3A 1D3ZA 1WM3A 3VDZA 4CO7A 2XEWA 2IO1B 5D94A 3UF8A 2K6QA 2FCQA 4OVUA 4GMVA 1OTRB 4FBJB 4K81A 5CHVC 2KDFB 5CX3A 1E8YA 1P0RA 2PE6B 2R2OA 1WGDA 1WY8A 3C0RB 3PREA 3K9PB 2CHXA 4XZ4A 2G45B 3RUIB 4EZJA 4IC7B 3R7RA 2I1KA 2KC1A 1V86A 3DQVA 2FNJB 1WZ0A 2UYZB 4GOCA 1NDDA 1KM7A 2D2QA 3OAWA 2M1MA 3QARA 3ZTDA 4GDLB 2C7NB 1KJTA 2KWUB 3PZDA 3UGBB 2HE7A 2CS4A 2RD0A 2RPQA 3QHTA 1VD2A 1P3QU 2M17A 3ZW3A 3ZO5B 3JSVA 1J8CA 2J0MA 1H4RA 2WYQA 1WGGA 3K9OB 2N7EA 4I6LB 2RSUA 4DHJD 2C9WB 3DBRI 4EFOA 2RGFA 2YLMA 3APDA 4MGKE 3VUXA 4G0NB 2KQ7A 3M95A 5DPRA 1WX8A 3DVNU 2MBHA 2KJ6A 3JVZX 2KFJA 4DK5A 4LDTB 4NPNA 3RULA 2DAJA 2K8HA 2KJRA 2LRUA 4AJWA 1WFYA 4W9FA 3SD5A 2KX3A 2MX2A 1V49A 3Q3FA 3H7PA 4WQOB 1WMHA 3WALA 2L8JA 5E6NA 2CHWA 2QHOA 2KTFA 4GSWA 2LVQA 2L0TA 4FN2A 4WWOA 3ZVVA 1K8RB 3L13A 1XQQA 2MLBA 3NHEB 4FHKA 4E3CA 2D3GA 4E74A 4PS8A 3BINA 4GB9A 2KZRA 4J6IA 2A4ZA 1E7UA 4P7IA 4K7UA 4MJSA 2NBWB 4IM0A 2KVRA 4LCDE 2KNBA 3H1UA 4W9HA 2IBIB 4HVBA 3JYUA 2WWZA 3LDZE 1E8ZA 2KJHB 3AI5A 2KTRA 1C3TA 2HTHA 3VH3B 3ZDMC 1UGMA 3Q3JA 4GDLA 1C1YB 2L76A 2BGFA 2G4DB 2JRHA 3TL5A 2BYFA 4WAAA 1PQSA 3ZNHB 4KZ0A 2KX0A 2C7HA 3DVGX 4MSQB 3PHXB 1VCBA 4NJ7A 4A3OA 4ICUA 2MWSB 2LVPA 1KOTA 2MQJA 3D32A 4GDKA 2BF8B 2FAZA 5CHWA 5KHOA 2IY0B 3H6NA 3RZFA 4JL9A 3PLUA 2CR5A 1RRBA 2LXCA 2L05A 5LXHA 2ZVOA 3H9DA 3NS8A 5KHQA 3L10B 3ZTCA 5L95C 3TIXA 1UD7A 3L16A 3DBLI 1WMHB 4HCNB 4M8MA 3KH0A 3VXWA 3UIOB 4KIKB 4B95A 2PPHA 4W9GA 4IM2A 4KV2A 2MW5A 2CHZA 2O6VA 3NZSA 4MJSB 3OJ3A 4KSKC 2KANA 2GBMA 3VTWA 1IPGA 2LZ6A 2KTRB 3KYDD 2EMTA 1EO6A 3R7QA 2LASA 2N9PC 2JY6A 3OLMD 3O65B 5LXIB 1J0GA 3VHTC
chains in the Genus database with same CATH superfamily
3IAS1 4AUQC 1FCCC 4PYZA 1IUEA 4RH6A 2JZPA 4W9KA 1VZ8A 3A9JA 3JW0X 2JSVX 4BOSC 2KXJA 3VTVA 2J52A 4BKSA 2JRIB 3KUZA 1XF5L 2AX5A 3AE7B 4W9CA 3ZNZB 3EECA 4BFRA 3ZRCA 4W9EA 3IVFA 3SR6A 4ITKA 2C7MB 3QAQA 3VR8B 2AL6A 2WXLA 1WI0A 3ZJTA 3ZDTA 1WXMA 3NY5A 4MGYE 1FD6A 3B2FA 1V1PA 5D7GA 2W3RA 3B9JA 4DXGA 4OW0A 2WXOA 2GI9A 2ZVNA 1MHHE 1UWXA 2AYOB 3A4RA 3TMPB 1QZEA 3A9JB 2INCC 2KN5A 3IXSA 3P42A 1PDXA 3CSFA 1CZPA 5AUIA 4FLHA 4K3BA 2KQSA 2XNAC 2QMTA 4ZDVA 2WXQA 4XDCA 1RAXA 4FA6A 3PV1A 4N59A 4CHKA 4NY0A 3NJTA 4P1BC 2ZNVC 5E6OA 2JWZA 2OOBB 4PS3A 1T0SC 2KO3A 1N5XA 2J0JA 5GMVA 3DBRB 3MHSD 3A9KA 1WZ3A 3EUB2 4KDIC 1FIQA 1BT0A 2GBNA 5JZEB 2E3TA 3O13A 3S2AA 1E5WA 1GG3A 1V9JA 3H7PB 3RD2A 1RLFA 3IG3A 2QEJC 1WGRA 1Q10A 4EZKA 1YD8U 1L6UA 4HJKA 1YJJA 2Y5CA 4S0RA 2RR9A 4C7YA 1N60A 2IGDA 4PK1A 3EHVA 4TUUA 3TJPA 5FR3A 3RMKC 2HJ8A 2DBYA 1LXDA 3ZIMA 3DBHB 4A9AA 3ECIA 4FJZA 4ANWA 3FKYA 2KC2A 4LNIA 2Y5BB 2ZJDA 3P63A 4ZOHC 1EUVB 2KWVB 3UIPB 1YX5B 2B3AA 2NCNA 3R3MA 1STEA 1R4NB 4BVUC 2KVZA 4GDKB 4BBNF 1ZP0B 3A9KB 2WLBA 1YN5A 1HTQA 3U52E 2AQ1B 1Z5SB 2MCNB 2JU6X 3DCGA 2ZCCA 4RM8A 5LNK1 3IT4B 2K25A 1JRPA 1V5TA 2MRPA 4GU2A 3HK0A 2ZW1A 1TYGB 1SB3C 3BY4B 1P98A 2PTLA 3WAMA 2BKRB 4ANXA 1Q5WB 1J19A 1A5RA 1Y56A 2NBUA 1K50A 2Z0EB 1EU4A 2EMSA 1VRAB 2QC8A 4JX1C 1K51A 4ZRKA 1C4PA 3VH4B 1WR6E 4GN1A 5D6JB 2VH1A 1I42A 1WF9A 1N62A 1WXVA 3BWUD 2V3PA 2AL3A 4EUTA 2M0XA 1CMXB 2L1AA 2C5LC 2KHWB 3AE2B 2LGIA 1C77A 1FPYA 3A1QA 2PLPA 2QIEB 4RCOA 2O6VD 3P4QB 3WA0A 3HHMA 4KIKA 2UU7A 4HROA 2CJOA 2IGHA 3ZNID 4HLEA 3AV8A 3MFGA 1WXAA 4N9F4 3DBHI 3V6CB 3HM3A 1M4VA 2PVGC 2V3NA 4G50A 2QDFA 4M0WA 2WNMA 1FNWA 1V2YA 1UZXB 1R4NI 1IYFA 2LUEA 3PS6A 1JWSD 4F8CB 4B6WA 1U4AA 4C00A 1QF6A 3MC0B 4JGHB 2LRWA 3A4SC 2LGSA 2L52A 3A1QB 2L0FA 1F77A 2JZZA 3DBSA 1DYQA 2NVUI 2PEAA 4BAXA 5AEKB 1NBFC 3DWGC 1WR1A 4BKTA 3MJWA 2BB6A 2UWQA 4M02A 1CQVA 1T0RC 4ZHPA 1GPXA 2NBVB 4M0WB 4MM3A 1QQRA 3TEYA 4CO7A 4LNFA 4FBJB 2KDFB 1WGDA 1WYGA 3C0RB 3PREA 3K9PB 2INNE 1VZ7A 3DBLB 3KWVA 4EZJA 3RN9C 3Q3MC 4IC7B 2I1KA 1V86A 1KM7A 3OAWA 5FK9C 1YNTE 1KJTA 2KWUB 2HE7A 3CWIA 2RD0A 1OQRA 3QHTA 5G5HA 1P3QU 4JWUC 3JSVA 1WSPA 1WGGA 3OWEB 2INPE 2BYTA 4EFOA 3AMZA 4A6QA 2JX5A 3M95A 1QOGA 1WX8A 3DVNU 2Y5PA 4WAFA 3JVZX 2IJ0A 2MJ3A 4LDTB 1P7FA 3FILA 2DAJA 3Q3FA 3NUHB 1WMHA 2L8JA 2QHOA 4GSWA 4FN2A 4WWOA 1XQQA 2X38A 4E3CA 4GB9A 5IP4D 1B9RA 4MJSA 3EGRA 4IM0A 2KNBA 4HVBA 2PVOD 3KWLA 4RGMA 3VH3B 2QILA 2VZKD 1XO3A 2L76A 2G4DB 3ETRA 4KZ0A 4RF1A 2BQQA 2C7HA 1E6EB 4HPPA 4ICUA 2MWSB 3RZFA 4R3DA 3PLUA 1TKYA 1QOFA 1L0YB 3FILB 2L05A 5LXHA 3H9DA 1P7EA 4KGRA 2QSDA 2RPVA 3L16A 3DBLI 1WMHB 3RFZB 3UIOB 3B2GA 4C56C 4B95A 1VR9A 4KV2A 1L0VB 1ZXHA 3SFDB 4MJSB 2KANA 2LJIA 1L6VA 1IPGA 1FEHA 2KAJA 2EMTA 1EO6A 2LASA 2K5PA 4REZA 4DWFA 1EU3A 2WX0A 1SSNA 2EKEC 3J9CA 4XC2A 1F1HA 4RMAA 2O2VA 1F2RC 5AZGA 4ZRIA 1GOZA 4AS1A 2LMCA 1OGWA 3Q6BA 5AZFA 3VUWA 2NS5A 3AE6B 4NQLB 4NAWB 4XDDA 2KWDA 4ARCA 1WGHA 2GRIA 1WIAA 4WIPA 2K39A 2BW2A 2WXHA 1OFFA 5BO4B 2KFKB 1FFVA 1JALA 1HE8A 4MEMA 3L54A 2W55A 3GZNB 3RNFC 3WAOA 3SDLC 5FR6A 1C9FA 1OEYA 2M4NA 4LNOA 3KYCD 3Q8EA 2WQYB 4L2YA 4GXBA 3MTNB 4WJNA 1WXSA 4B0EA 2LXAA 1SXTA 2CU1A 2LEKA 2NR2A 1TGZB 5E6JA 4LJOB 4ZRJA 2DENB 1XXGA 4HRSA 3W5UB 1A70A 1LO5D 2WXFA 3M3JA 3GOEA 3PVLA 3BVMA 3WANA 5JHAA 1L2NA 4OZCA 1XLPA 4CQNA 2BS4B 4KVGB 2ZCBA 4RGOS 1IP9A 3L17A 4IWQA 2GMIC 4FULA 1XD3B 3DHHC 3EC8A 4D2KA 3V3XA 2OJWA 4Q2JA 2JXTA 3FC4A 4US8A 4C4VA 2N9XA 1H8CA 4MSMB 2BWFA 2OJRA 1Z2MA 3W1SA 5DPTA 4BZAA 1F52A 4BKSD 1I4PA 1D5XC 4NJ6A 2D10A 3DVNV 4PT5A 5G5GA 4TQ0A 4US9A 2K22A 2CKHB 3I9V1 1GNUA 2WXMA 5G2NA 3IAM1 1QLBB 3P4SB 4ANUA 1T5XD 1YIWA 3X0WA 3APCA 3I3TB 3U7ZA 1E7PB 4C7ZA 2R2QA 1TKEA 2XBBC 4RNAA 1C79A 3N32A 2FE8A 2ZPNA 1CK1A 4RGNA 1WGKA 2MA9B 1Q1OA 2BWES 5L83A 4ZRQA 3U7DA 1DOYA 4HJGE 1J7CA 4C4VB 2G3QB 4LJPB 3ML9A 3NZUA 3V61A 2V1YA 4WJOA 1NEKB 4IW0A 5I4DA 1YN4A 2G4SA 3MC9A 3AE5B 1VDVA 5LLIA 1OQQA 2KDIA 2JVCA 3CSTA 3AXCA 1ZW7A 1EWYC 4LNKA 2JYEA 4KKJA 3N30A 1FRRA 4G11A 4P6VF 3V05A 3ZYYX 3NVZA 3T3OA 1GUAB 3NS1A 3TEXA 3DDCB 3HM6X 2Z59B 4HDQA 1NENB 3TEWA 1V80A 2KK8A 3Q8CA 1YJ1A 4N6EB 3ONSA 3AEFB 1N61A 5JHBA 2LWPA 4KX6B 5D2MB 1P1AA 2BYEA 3AEEB 2PJHA 2HDEA 4DQOC 1SE9A 1YQ4B 4PS7A 1M94A 1D4BA 1FNUA 2LI5A 1HXYD 3UQBA 1ZXIA 2N1VA 3SFEB 3AE1B 3BK1A 1V1PB 1AARA 1FXTB 2IDYA 2N9EB 3L0WB 4W9JA 2IO3B 2JYTA 4GGQA 1E9MA 2ASQA 2N4FA 1X1MA 4YSZB 1TY2A 4KSLC 5HG2A 1YMHE 2D07B 2PMVA 3C19A 1V5OA 4I6NB 5EE9A 1AW7A 4JLCA 2ONQA 2SEBD 2KWCA 4B9KA 1N63A 3Q3OC 3T9LA 5CTRC 4JIOU 2QCZA 3RT3B 3AU5A 1KTKA 3U2SC 4DHZE 1KF6B 3C8YA 3AULA 1WE6A 3I63C 1FXIA 5DPWA 4DHJB 2DZJA 4QAYA 2B76B 2EELA 4KKIA 1D3ZA 2IO1B 4RFBA 1TS5A 2K0PA 3UF8A 4OVUA 4IDIA 5CX3A 1P0RA 5TSSA 2R2OA 1R7SA 3RUIB 2EKIA 3R7RA 3AE9B 1FMAD 1NDDA 1I4GA 3QARA 3ZTDA 1PUTA 2C7NB 1MPEA 5H8YE 4B0MA 2IPKD 2RPQA 4FXCA 2M17A 1QILA 1DGJA 1I4RA 2RSUA 3DBRI 3APDA 3VUXA 2DNFA 4YTNB 2MBHA 2KJ6A 1SEBD 3ZQ4A 4NPNA 1WFYA 4W9FA 1V49A 2KTFA 2LVQA 3ZVVA 3NRZA 3NHEB 3RI7C 2D3GA 1QOBA 3DWMA 3BINA 5EE3A 2A4ZA 2M56B 1E7UA 2HJ1A 4P7IA 4K7UA 2NBWB 4LCDE 2KVRA 4W9HA 3AH7A 4OVZA 3JYUA 3LDZE 2HTHA 3EFCA 4YSYB 2JRHA 4NAMA 2KX0A 3BVGA 1ZE3D 3N1YC 1HZ6A 2G9HD 5HFYA 3MHZA 1KH0A 4USAA 2LVPA 1KOTA 2BT6A 2MQJA 2BF8B 5CHWA 2IY0B 2WDRB 3NS8A 1JCKB 2WXNA 1K52A 4HCNB 2ON8A 1LGRA 4M8MA 1DOIA 3W5VB 4KIKB 4IM2A 2CHZA 4XWTA 1E0ZA 2O6VA 1IBXA 3OJ3A 1IGCA 2N9PC 2WGSA 3PHWB 2JY6A 5LXIB 2DLBA 5D3DA 1J0GA 5E6PA 1WJ4A 2V3SA 2HD5B 2V0GA 5MPOA 1UELA 3HRDD 3LXFA 1P9DU 3VUYA 3NVWA 1C76A 1OQYA 1C4AA 1TKGA 3AM9A 4WWNA 1HZ5A 3DVGY 1SIFA 3QA8A 1BMLC 4RM9A 3TUOA 5TR5A 1UH6A 3KW5B 1ET9A 2KMCA 2IY1B 2O6VB 1G6JA 1IBXB 3NG0A 1L7YA 1YX6B 2KLCA 3IHPC 1NI2A 4MH8A 1T6BX 1DOXA 1QT9A 3ENEA 1ENFA 1FM0D 2FIDA 4MM3B 2MBBB 2K8CA 3TBLD 1FO4A 4HK2A 3UINB 1ESFA 3AU4A 3IT6B 4F1SA 2Q5WD 1E8WA 2WDTB 3VQIA 3X23A 4BBNC 4AOFA 4KZCA 4IWPA 1SE3A 4CYEA 5BMIA 4FJVB 4UDUC 4W9IA 2SAKA 4GIVA 4WQMA 4LK0M 3QCAA 2PE9A 4AWJA 2PW9A 3Q14C 3P4RB 2JT4B 3JSVB 1SF0A 4F7ZA 2I38A 4XX5A 4AP4C 2MBOA 3W1YA 4EZLA 1LFDA 3QQ8B 5IN7A 5BYRA 3SEBA 3E56A 4MGZE 2BTEA 2K9XA 3KQ4A 5T8IA 1NVID 4A8XC 1JWAD 3ZJVA 1XLQA 4I6PA 4A3PA 4G3XB 2WXGA 2ZNVB 3H7SA 3EA6A 3KUDB 1WE7A 2DYOA 1Y8RC 4O1NA 1MFWA 2ZEQA 3ML8A 2FCSA 1LQBA 1XCQL 1GB4A 1NYQA 2N7DA 1R4MB 1TT5B 2IYDB 4K1RB 5AUKA 1WH3A 2BVCA 2LGYA 3B08A 2BPSA 1ZDVA 5HKHA 1T0QC 2LGXA 3LYYA 4NQKE 2ICIA 1RWSA 3NOBA 4IM3A 3RNGC 2IZVB 2BBCA 2GBRA 2Z0DB 2H89B 1E90A 1EF5A 4ANVA 2N9LA 2JWUA 1RFAA 2CJNA 2K6DB 3Q69A 2WU5B 4A90A 2LVOA 1ACCA 4II2B 2FUHB 3T3NA 2FCNA 3AEBB 1WJNA 1N6ZA 2R61A 1YN3A 2NTTA 2J7QB 3DHGC 2LGDA 2YVCA 1WJ6A 4JE3B 4MELA 2NPTA 3V60A 3ZXRA 4EOYA 2RDBC 2V9HA 1KLGD 2WXKA 2IGGA 4II3B 3W2DA 4ZYSA 3UI3A 1BXTA 2V4IB 2DAFA 3EFUA 1SIJA 1TBEA 3RPFC 2L3ZA 2FIFA 3V6EB 3RNEC 1WXQA 1JMLA 2O2VB 1QOAA 4MDKE 2VH2A 4WJPA 1WRDB 2I2YA 4L1BA 3L08A 2BYVE 1JROA 1ISNA 4WURA 2MH7A 1ZKHA 4RF0A 3LB8C 1JRUA 3QIJA 2WXJA 3OJ4B 3VR9B 1AN8A 2LUMA 4BOZB 1TS4A 1FCLA 4MH0E 2IO0B 1R4MI 4FHJA 2NPTB 3BYTB 2K8BA 1Q0WB 3WIMA 4YXDB 2IO2B 2J0KA 2ZW0A 2WDQB 1L4DB 2JZ3B 2AQ3B 3P1MA 4C80A 3M62B 2E6XA 2W9NA 1HEZE 4K7WA 4WWMA 2VRRB 3NVVA 2AWTA 2LHEA 1AWDA 1TIFA 4XE0A 3AE8B 2JUOA 4MT5A 3B1LX 1S1QB 4YL8A 4YT0B 4A20A 5G55A 3LJ3A 1PGBA 1TZOA 1E7VA 2FUG1 2J42A 3H8HA 3QK0A 1V1OA 3ALBA 4DHZB 1I4HA 4HWIB 2MHJA 3WAPA 2DWQA 1OEYJ 1I4QA 2D11A 2BKFA 3R8BA 2GBKA 2KDBA 3CIRB 4M8NA 3GZNI 1KFYB 1WM3A 3VDZA 3VRBB 1OTRB 5CHVC 2GB1A 4KGTA 1WY8A 1FNVA 2G45B 4IKGA 5FKAC 3DQVA 5HHDG 4ARIA 2FNJB 4GOCA 2UYZB 3PO0A 3UGBB 3KLSX 2CS4A 1D5ZC 3BK2A 1VD2A 3ZXVA 3ZW3A 1TY0A 3ZO5B 2WYQA 1ET6A 2N7EA 4I6LB 4DHJD 5IKCM 1CJEA 2YLMA 5GXGB 4M00A 4MGKE 2J53A 4WH4A 3AEDB 1XCTL 2KFJA 2K8HA 3GP7A 3MC8A 1HQRD 3SD5A 2KX3A 2MX2A 3H7PA 4WQOB 1K53A 2L0TA 1GB1A 2MLBA 4FHKA 1PFDA 3AE3B 4PS8A 5JXVA 3H1UA 2IBIB 4K3CA 4YWGG 1E8ZA 3AI5A 2KTRA 3DHIC 4ZRPA 3ZGZA 3Q3JA 1C1YB 1ROEA 3TL5A 4KGSA 3FAHA 1PGXA 2BYFA 3ZNHB 1PQSA 1VJKA 3DVGX 4MSQB 3PHXB 1VCBA 3ZJUA 2PKOA 4NJ7A 4A3OA 4NJCA 1L0XB 2RMMA 3I57A 3D32A 4GDKA 2FAZA 2CR5A 2LXCA 3L10B 4HEA1 1UD7A 1FFUA 2N7JA 3RNBC 3KH0A 2N9KA 3L4PA 2FBWB 2PPHA 3BVZA 3PZ8A 4J3OD 3URYA 1HA5A 4P1CC 3NZSA 2WHIA 1YJIA 4KSKC 2LZ6A 2KTRB 3KYDD 2G1EA 2OEDA 3O65B 2YEPB 1D6EC 3RYTA 3QWZB 2NMQA 1ZDXA 3QC8B 4A55A 1MI0A 4PYUA 3RNCC 1MJDA 1T3QA 1MHXA 1UBQA 2INDC 4BKGA 3ZLZA 3N1ZC 2MJEA 3WCQA 3U30A 1EF1A 2KACA 4HCPB 3ZUNA 5JH5C 3QX1A 1V6EA 3TEZA 2M8SA 4LLGM 2AQ2B 2KOXA 1SGHA 3AEGB 2LHDA 1GAQB 4JPSA 1WGYA 4P16A 5CHFA 3R2TA 4TMAB 1GC6A 2L00B 3AB5A 3UQAA 3CF6E 2Z8LA 3PRPB 3Q8AA 4DDID 1TZ1A 3MJ5A 5D3IB 4DBGA 3APFA 1EM7A 1UBIA 3I5JC 3IBEA 3V62A 1UWMA 5J2RA 3HVDA 2MEKA 2W54A 1MG8A 1RM6C 2LJ5A 2K3UA 2ACZB 1MG4A 2YEPF 4IUMB 2ZZPB 4XWWA 2W82A 2K1FA 2DYMA 3RZWC 3CMMB 1XEEA 2MBEA 2PIAA 4ZHOA 1T0YA 3AE4B 3N9YC 1WX7A 4LTUA 5DPSA 2A5UA 2CU3A 3TCAA 2D3BA 3GE3C 4OHJA 4FADA 4NNJB 2BS3B 2XK5A 1TS2A 1F0ZA 1IGDA 4ICVA 4ASWC 4W9LA 3PRZA 5BMGA 3PTFC 1I4XA 4H2AA 3DOWA 4WWPA 3PPAA 3E9SA 3SU8X 1PGAA 4XGAB 4EEWA 2JXXA 4LDTD 1UGJA 4HPMB 3BIID 3A33B 5C23A 2N1WA 1TJEA 1KLVA 3R2IA 1YQ3B 4IOIE 3ZRFA 1TTNA 3ZKJC 3U8ZA 2GLSA 1ZGUB 2DZIA 2KMAA 4AJYB 2KKCA 5J17A 3Q8FA 3QJZA 1E10A 2X8XX 4N58A 2KLGA 2XK5B 2WS3B 2DHZA 3R66C 1YQBA 5IO9A 1ZOYB 3N1XC 1V81A 2L32A 4EKUA 3PLVA 2MP2A 1XLNA 4HDOA 1GJZA 4HPLB 2H88B 1F2RI 4ZYNA 2JPHA 5J18A 4LNNA 1ZPSA 4HKZE 3HVZA 3PGEA 3HIZA 2KYWA 3W1SC 1NI3A 1ZUD2 3VVWB 1XT9B 4DXAB 3Q2AC 2WXIA 1WJUA 3VAWA 2C60A 4FJYA 3SHQA 1UUPA 5IAAC 4YTPB 1AYFA 1BUIC 4RGTA 3VTUA 1FXAA 4DDGD 2N0SB 3AEAB 3KUCB 3GE8C 4XYCA 1HTOA 1L4ZB 1JWBD 2KQ4X 1WM2A 3AECB 2NTSA 4W9DA 1RYJA 4TQ1A 2XN9C 5EE1A 2REXA 4YSXB 1TS3A 2MBQA 5EDSA 1V97A 1E8XA 2WX1A 2I1JA 1UF0A 2MSED 3BZDB 4OZAA 4MACA 2MP2B 3KVFB 3IFWB 3VFKA 1C4CA 2D3CA 2M19A 3VRAB 2ZPYA 3TSSA 1UNSA 1LM8B 4OVVA 3B0AA 2JF5A 3PT2B 4HKQA 2DZKA 4IWOA 1NYRA 3DPDA 5C1ZA 5AZHA 3RCZA 1I35A 2DZMA 4KDLB 1F9JA 3N20C 4TV3A 1B1ZA 4DXFA 2TSSA 2KN4A 3P2BA 2V4LA 4E71A 4X57B 3T8MA 3PRMB 5EE0A 3W9CB 5IA7A 4WJQA 2D3AA 2WDVB 3MP9A 1XLOA 2RDGA 2J4XA 2LD9A 1JQ4A 1KRHA 1WYWB 2GBJA 2GOWA 4TKNA 2KD0A 2KDEB 5H92C 1FRDA 2DYBA 4JQWC 3ZNGC 2KMMA 3RNAC 1WX9A 1GC7A 4IG7B 2D5GA 3NVYA 4M01A 4MGIE 4NAWA 4GLSC 2AEHA 4AQ7A 1YOVB 2DX5B 2JQRB 1S3SG 4HXDA 2KT7A 3M63B 3N3KB 1QKZA 4URKA 2FCMA 4YTMB 3GB1A 5C3JB 4K7SA 2KFKA 5DCNA 1D5MC 1VLBA 1I7HA 2L7RA 3PSEB 2WU2B 2RDHA 2XEWA 3BYYB 5D94A 2K6QA 2FCQA 4GMVA 4K81A 1E8YA 2PE6B 2CHXA 4XZ4A 3PZ7A 1C78A 4NZLB 2KC1A 1VZ6A 1WZ0A 2D2QA 5HI1A 2M1MA 2W3SA 4L23A 3PZDA 1MVKA 4ACFA 1RFKA 3GS2A 1L5PA 2OHFA 4JWSC 1J7AA 1WWTA 1J8CA 2J0MA 1H4RA 3K9OB 2VZKB 5IOIA 2C9WB 2HTME 2WXPA 2RGFA 4TSSA 4G0NB 2KQ7A 5BYQA 5DPRA 4DK5A 2LFIA 3RULA 2LRUA 2KJRA 4AJWA 2M0AA 1EWCA 2QJLA 3OG5A 3WALA 5E6NA 3Q8BA 1N5WA 1KLUD 2CHWA 1K8RB 3L13A 4E74A 1JWUD 2WXRA 4J6IA 2KZRA 1JW9D 2WWZA 2KJHB 2Y3AA 1C3TA 1SE4A 3ZDMC 1UGMA 1SE2A 1PYWD 4GDLA 2BGFA 5BYSA 3U4EG 4WAAA 1V8CA 3NZ3A 3P4PB 3ABVB 5KHOA 2KDMA 3H6NA 4JL9A 2BS2B 1RRBA 2MJDA 3HUIA 2ZVOA 5KHQA 3ZTCA 5L95C 3TIXA 1SBBB 3Q3NC 1WRIA 3VXWA 2L83A 5C2TB 4EE2A 4W9GA 1JWMD 1SJHD 2MW5A 4OZBA 5BMHA 2BB5A 2GBMA 3VTWA 4S17A 1J7BA 2WP9B 3R7QA 3OLMD 4GDLB 1SJED 3AN1A 3VHTC
chains in the Genus database with same CATH topology
5E6PA 3RYTA 1WJ4A 3QWZB 4DWFA 2V3SA 2WX0A 4AUQC 2EKEC 2HD5B 3QC8B 4PYZA 4XC2A 4RMAA 1UELA 2O2VA 4PYUA 1P9DU 3VUYA 1UBQA 4W9KA 3A9JA 3JW0X 1OQYA 4BKGA 5AZGA 3ZLZA 4BOSC 4WWNA 4ZRIA 2KXJA 3VTVA 3U30A 1EF1A 1OGWA 5AZFA 4HCPB 4BKSA 3VUWA 3DVGY 2JRIB 2NS5A 1SIFA 3KUZA 3QA8A 3QX1A 1V6EA 3ZUNA 5JH5C 4NQLB 4RM9A 4NAWB 2M8SA 4W9CA 3ZNZB 2KOXA 3EECA 4BFRA 5TR5A 1UH6A 1SGHA 3ZRCA 3KW5B 1WGHA 1WIAA 4W9EA 3IVFA 1WGYA 2KMCA 2IY1B 2O6VB 1G6JA 5CHFA 2K39A 1GC6A 1L7YA 2L00B 1YX6B 3UQAA 2KLCA 2C7MB 3CF6E 3PRPB 4DDID 3QAQA 1TZ1A 2AL6A 4DBGA 1WI0A 3APFA 1NI2A 3IHPC 5BO4B 1UBIA 3IBEA 2KFKB 3V62A 5J2RA 3ENEA 1MG8A 3ZDTA 2FIDA 1WXMA 2MBBB 2K8CA 3NY5A 1HE8A 3TBLD 4MEMA 4MGYE 2LJ5A 3L54A 4IUMB 4HK2A 2ZZPB 5D7GA 3UINB 2K1FA 2DYMA 3RZWC 3WAOA 3CMMB 3SDLC 5FR6A 1OEYA 3AU4A 2M4NA 2ZVNA 2MBEA 4F1SA 3KYCD 2AYOB 1E8WA 1T0YA 2WDTB 3A4RA 1WX7A 4GXBA 3TMPB 3VQIA 3MTNB 1QZEA 5DPSA 2A5UA 3A9JB 2KN5A 4WJNA 1WXSA 3TCAA 3X23A 4BBNC 2LXAA 4FADA 4NNJB 4AOFA 3CSFA 3PHWB 2CU1A 4KZCA 4IWPA 2XK5A 4CYEA 4FJVB 2NR2A 1TGZB 4ICVA 4W9IA 4FLHA 4GIVA 4LJOB 2KQSA 3QCAA 4ZRJA 4ASWC 4W9LA 2PE9A 3PRZA 4AWJA 2DENB 4ZDVA 1RAXA 3PTFC 4FA6A 3PV1A 4CHKA 4NY0A 2JT4B 3JSVB 3DOWA 4WWPA 4F7ZA 2ZNVC 3PPAA 3SU8X 3M3JA 4XX5A 3GOEA 3PVLA 4AP4C 3WANA 2MBOA 5JHAA 5E6OA 4EEWA 2JWZA 2JXXA 1L2NA 3W1YA 2OOBB 4EZLA 1LFDA 3QQ8B 4LDTD 4PS3A 2KO3A 2J0JA 4HPMB 4MGZE 4KVGB 5GMVA 3A33B 3MHSD 2ZCBA 1WZ3A 3A9KA 4KDIC 5C23A 1BT0A 2GBNA 2N1WA 1IP9A 1KLVA 5JZEB 3L17A 4IWQA 3S2AA 2GMIC 1E5WA 1GG3A 4FULA 1V9JA 3ZRFA 3H7PB 1TTNA 1XD3B 3ZKJC 4I6PA 3RD2A 1ZGUB 3U8ZA 1RLFA 3EC8A 3IG3A 2DZIA 1WGRA 2KMAA 4A3PA 4G3XB 4AJYB 4EZKA 1YD8U 2KKCA 4HJKA 2ZNVB 5J17A 3H7SA 3QJZA 3KUDB 1WE7A 2N9XA 2RR9A 4MSMB 2DYOA 1H8CA 2BWFA 2OJRA 1Y8RC 1Z2MA 3W1SA 5DPTA 2KLGA 2ZEQA 3EHVA 2FCSA 3ML8A 4BKSD 1LQBA 4TUUA 2XK5B 2N7DA 2IYDB 3TJPA 4NJ6A 2D10A 2HJ8A 2DHZA 3DVNV 1LXDA 3R66C 1YQBA 4K1RB 1V81A 3ZIMA 1WH3A 4EKUA 4TQ0A 2LGYA 3PLVA 3B08A 3ECIA 4FJZA 2MP2A 4ANWA 4HDOA 1GJZA 2KC2A 2BPSA 4HPLB 2CKHB 2Y5BB 2ZJDA 5HKHA 2LGXA 1GNUA 4ZYNA 1EUVB 2JPHA 2KWVB 5G2NA 3UIPB 1YX5B 4NQKE 2B3AA 2NCNA 3NOBA 4IM3A 5J18A 3R3MA 4ANUA 1YIWA 2IZVB 4BVUC 3PGEA 3HIZA 2GBRA 3X0WA 2Z0DB 3W1SC 3APCA 3I3TB 4GDKB 4BBNF 1E90A 1EF5A 2R2QA 2XBBC 3VVWB 4ANVA 3A9KB 1XT9B 3N32A 4DXAB 2ZPNA 1RFAA 1WJUA 2K6DB 3VAWA 2MA9B 2C60A 4FJYA 3SHQA 1Q1OA 2LVOA 4II2B 1Z5SB 2BWES 2MCNB 5L83A 5IAAC 2FUHB 3VTUA 2FCNA 4DDGD 3U7DA 3DCGA 1WJNA 2J7QB 2LGDA 2ZCCA 3KUCB 4RM8A 2G3QB 2K25A 1V5TA 2YVCA 3ML9A 4LJPB 2MRPA 4GU2A 3HK0A 1WJ6A 3NZUA 3V61A 2V1YA 4MELA 2NPTA 1WM2A 3V60A 4EOYA 4WJOA 4W9DA 4TQ1A 2REXA 4IW0A 3BY4B 1P98A 2MBQA 4II3B 2G4SA 3WAMA 2BKRB 4ANXA 5EDSA 1E8XA 2WX1A 1Q5WB 1J19A 2I1JA 2MSED 2DAFA 3EFUA 1TBEA 1A5RA 2L3ZA 2NBUA 2MP2B 5LLIA 3KVFB 2FIFA 2Z0EB 3V6EB 2EMSA 2KDIA 2JVCA 3CSTA 3AXCA 1ZW7A 4ZRKA 3VH4B 1WR6E 3IFWB 3VFKA 4GN1A 2O2VB 5D6JB 1I42A 1WF9A 4MDKE 2ZPYA 1LM8B 3N30A 4WJPA 1WRDB 4OVVA 1WXVA 4G11A 3L08A 2BYVE 2AL3A 4EUTA 2M0XA 1CMXB 1GUAB 3B0AA 2C5LC 2JF5A 2KHWB 3DDCB 3HM6X 1ISNA 3PT2B 2Z59B 4HDQA 2DZKA 4IWOA 1V80A 1ZKHA 2KK8A 3A1QA 1JRUA 3DPDA 1YJ1A 3QIJA 3ONSA 3OJ4B 5C1ZA 5AZHA 4BOZB 2O6VD 3RCZA 1I35A 2DZMA 3WA0A 4KDLB 1F9JA 5JHBA 2LWPA 5D2MB 3HHMA 1P1AA 4KIKA 4MH0E 2IO0B 1R4MI 2BYEA 4TV3A 4FHJA 3ZNID 4HLEA 2PJHA 2NPTB 2K8BA 1WXAA 1Q0WB 1SE9A 4PS7A 4N9F4 1M94A 3P2BA 3WIMA 3DBHI 3V6CB 3HM3A 2IO2B 2J0KA 2V4LA 4E71A 4X57B 2LI5A 4G50A 3T8MA 3UQBA 2JZ3B 2N1VA 3PRMB 1V2YA 5IA7A 1UZXB 3M62B 4WJQA 1AARA 1R4NI 2LUEA 1IYFA 3PS6A 2W9NA 4F8CB 4K7WA 1FXTB 2N9EB 2VRRB 3L0WB 2IO3B 4W9JA 4B6WA 2LD9A 1U4AA 2AWTA 1WYWB 4GGQA 2GBJA 2JUOA 2GOWA 4JGHB 4TKNA 2KD0A 2ASQA 2KDEB 2LRWA 2N4FA 1X1MA 2DYBA 3A4SC 3B1LX 1S1QB 4YL8A 4KSLC 4A20A 5G55A 4JQWC 3ZNGC 3LJ3A 2D07B 3QK0A 1E7VA 3A1QB 1WX9A 1V5OA 1GC7A 4IG7B 2L0FA 3ALBA 4I6NB 4DHZB 2JZZA 3DBSA 4HWIB 4JLCA 2NVUI 4MGIE 4NAWA 2KWCA 4B9KA 2AEHA 2PEAA 5AEKB 3T9LA 2DX5B 1NBFC 1S3SG 4HXDA 3WAPA 1WR1A 1OEYJ 5CTRC 4JIOU 4BKTA 3MJWA 2D11A 2BKFA 3AU5A 3M63B 3N3KB 3RT3B 4DHZE 3AULA 2UWQA 2GBKA 4URKA 1WE6A 2FCMA 2KDBA 5DPWA 4DHJB 2DZJA 4M8NA 2NBVB 4K7SA 2KFKA 4M0WB 5DCNA 3GZNI 2L7RA 3PSEB 4MM3A 1D3ZA 1WM3A 3VDZA 4CO7A 2XEWA 2IO1B 5D94A 3UF8A 2K6QA 2FCQA 4OVUA 4GMVA 1OTRB 4FBJB 4K81A 5CHVC 2KDFB 5CX3A 1E8YA 1P0RA 2PE6B 2R2OA 1WGDA 1WY8A 3C0RB 3PREA 3K9PB 2CHXA 4XZ4A 2G45B 3RUIB 4EZJA 4IC7B 3R7RA 2I1KA 2KC1A 1V86A 3DQVA 2FNJB 1WZ0A 2UYZB 4GOCA 1NDDA 1KM7A 2D2QA 3OAWA 2M1MA 3QARA 3ZTDA 4GDLB 2C7NB 1KJTA 2KWUB 3PZDA 3UGBB 2HE7A 2CS4A 2RD0A 2RPQA 3QHTA 1VD2A 1P3QU 2M17A 3ZW3A 3ZO5B 3JSVA 1J8CA 2J0MA 1H4RA 2WYQA 1WGGA 3K9OB 2N7EA 4I6LB 2RSUA 4DHJD 2C9WB 3DBRI 4EFOA 2RGFA 2YLMA 3APDA 4MGKE 3VUXA 4G0NB 2KQ7A 3M95A 5DPRA 1WX8A 3DVNU 2MBHA 2KJ6A 3JVZX 2KFJA 4DK5A 4LDTB 4NPNA 3RULA 2DAJA 2K8HA 2KJRA 2LRUA 4AJWA 1WFYA 4W9FA 3SD5A 2KX3A 2MX2A 1V49A 3Q3FA 3H7PA 4WQOB 1WMHA 3WALA 2L8JA 5E6NA 2CHWA 2QHOA 2KTFA 4GSWA 2LVQA 2L0TA 4FN2A 4WWOA 3ZVVA 1K8RB 3L13A 1XQQA 2MLBA 3NHEB 4FHKA 4E3CA 2D3GA 4E74A 4PS8A 3BINA 4GB9A 2KZRA 4J6IA 2A4ZA 1E7UA 4P7IA 4K7UA 4MJSA 2NBWB 4IM0A 2KVRA 4LCDE 2KNBA 3H1UA 4W9HA 2IBIB 4HVBA 3JYUA 2WWZA 3LDZE 1E8ZA 2KJHB 3AI5A 2KTRA 1C3TA 2HTHA 3VH3B 3ZDMC 1UGMA 3Q3JA 4GDLA 1C1YB 2L76A 2BGFA 2G4DB 2JRHA 3TL5A 2BYFA 4WAAA 1PQSA 3ZNHB 4KZ0A 2KX0A 2C7HA 3DVGX 4MSQB 3PHXB 1VCBA 4NJ7A 4A3OA 4ICUA 2MWSB 2LVPA 1KOTA 2MQJA 3D32A 4GDKA 2BF8B 2FAZA 5CHWA 5KHOA 2IY0B 3H6NA 3RZFA 4JL9A 3PLUA 2CR5A 1RRBA 2LXCA 2L05A 5LXHA 2ZVOA 3H9DA 3NS8A 5KHQA 3L10B 3ZTCA 5L95C 3TIXA 1UD7A 3L16A 3DBLI 1WMHB 4HCNB 4M8MA 3KH0A 3VXWA 3UIOB 4KIKB 4B95A 2PPHA 4W9GA 4IM2A 4KV2A 2MW5A 2CHZA 2O6VA 3NZSA 4MJSB 3OJ3A 4KSKC 2KANA 2GBMA 3VTWA 1IPGA 2LZ6A 2KTRB 3KYDD 2EMTA 1EO6A 3R7QA 2LASA 2N9PC 2JY6A 3OLMD 3O65B 5LXIB 1J0GA 3VHTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6P A;  3RYT A;  1WJ4 A;  3QWZ B;  4DWF A;  2V3S A;  2WX0 A;  4AUQ C;  2EKE C;  2HD5 B;  3QC8 B;  4PYZ A;  4XC2 A;  4RMA A;  1UEL A;  2O2V A;  4PYU A;  1P9D U;  3VUY A;  1UBQ A;  4W9K A;  3A9J A;  3JW0 X;  1OQY A;  4BKG A;  5AZG A;  3ZLZ A;  4BOS C;  4WWN A;  4ZRI A;  2KXJ A;  3VTV A;  3U30 A;  1EF1 A;  1OGW A;  5AZF A;  4HCP B;  4BKS A;  3VUW A;  3DVG Y;  2JRI B;  2NS5 A;  1SIF A;  3KUZ A;  3QA8 A;  3QX1 A;  1V6E A;  3ZUN A;  5JH5 C;  4NQL B;  4RM9 A;  4NAW B;  2M8S A;  4W9C A;  3ZNZ B;  2KOX A;  3EEC A;  4BFR A;  5TR5 A;  1UH6 A;  1SGH A;  3ZRC A;  3KW5 B;  1WGH A;  1WIA A;  4W9E A;  3IVF A;  1WGY A;  2KMC A;  2IY1 B;  2O6V B;  1G6J A;  5CHF A;  2K39 A;  1GC6 A;  1L7Y A;  2L00 B;  1YX6 B;  3UQA A;  2KLC A;  2C7M B;  3CF6 E;  3PRP B;  4DDI D;  3QAQ A;  1TZ1 A;  2AL6 A;  4DBG A;  1WI0 A;  3APF A;  1NI2 A;  3IHP C;  5BO4 B;  1UBI A;  3IBE A;  2KFK B;  3V62 A;  5J2R A;  3ENE A;  1MG8 A;  3ZDT A;  2FID A;  1WXM A;  2MBB B;  2K8C A;  3NY5 A;  1HE8 A;  3TBL D;  4MEM A;  4MGY E;  2LJ5 A;  3L54 A;  4IUM B;  4HK2 A;  2ZZP B;  5D7G A;  3UIN B;  2K1F A;  2DYM A;  3RZW C;  3WAO A;  3CMM B;  3SDL C;  5FR6 A;  1OEY A;  3AU4 A;  2M4N A;  2ZVN A;  2MBE A;  4F1S A;  3KYC D;  2AYO B;  1E8W A;  1T0Y A;  2WDT B;  3A4R A;  1WX7 A;  4GXB A;  3TMP B;  3VQI A;  3MTN B;  1QZE A;  5DPS A;  2A5U A;  3A9J B;  2KN5 A;  4WJN A;  1WXS A;  3TCA A;  3X23 A;  4BBN C;  2LXA A;  4FAD A;  4NNJ B;  4AOF A;  3CSF A;  3PHW B;  2CU1 A;  4KZC A;  4IWP A;  2XK5 A;  4CYE A;  4FJV B;  2NR2 A;  1TGZ B;  4ICV A;  4W9I A;  4FLH A;  4GIV A;  4LJO B;  2KQS A;  3QCA A;  4ZRJ A;  4ASW C;  4W9L A;  2PE9 A;  3PRZ A;  4AWJ A;  2DEN B;  4ZDV A;  1RAX A;  3PTF C;  4FA6 A;  3PV1 A;  4CHK A;  4NY0 A;  2JT4 B;  3JSV B;  3DOW A;  4WWP A;  4F7Z A;  2ZNV C;  3PPA A;  3SU8 X;  3M3J A;  4XX5 A;  3GOE A;  3PVL A;  4AP4 C;  3WAN A;  2MBO A;  5JHA A;  5E6O A;  4EEW A;  2JWZ A;  2JXX A;  1L2N A;  3W1Y A;  2OOB B;  4EZL A;  1LFD A;  3QQ8 B;  4LDT D;  4PS3 A;  2KO3 A;  2J0J A;  4HPM B;  4MGZ E;  4KVG B;  5GMV A;  3A33 B;  3MHS D;  2ZCB A;  1WZ3 A;  3A9K A;  4KDI C;  5C23 A;  1BT0 A;  2GBN A;  2N1W A;  1IP9 A;  1KLV A;  5JZE B;  3L17 A;  4IWQ A;  3S2A A;  2GMI C;  1E5W A;  1GG3 A;  4FUL A;  1V9J A;  3ZRF A;  3H7P B;  1TTN A;  1XD3 B;  3ZKJ C;  4I6P A;  3RD2 A;  1ZGU B;  3U8Z A;  1RLF A;  3EC8 A;  3IG3 A;  2DZI A;  1WGR A;  2KMA A;  4A3P A;  4G3X B;  4AJY B;  4EZK A;  1YD8 U;  2KKC A;  4HJK A;  2ZNV B;  5J17 A;  3H7S A;  3QJZ A;  3KUD B;  1WE7 A;  2N9X A;  2RR9 A;  4MSM B;  2DYO A;  1H8C A;  2BWF A;  2OJR A;  1Y8R C;  1Z2M A;  3W1S A;  5DPT A;  2KLG A;  2ZEQ A;  3EHV A;  2FCS A;  3ML8 A;  4BKS D;  1LQB A;  4TUU A;  2XK5 B;  2N7D A;  2IYD B;  3TJP A;  4NJ6 A;  2D10 A;  2HJ8 A;  2DHZ A;  3DVN V;  1LXD A;  3R66 C;  1YQB A;  4K1R B;  1V81 A;  3ZIM A;  1WH3 A;  4EKU A;  4TQ0 A;  2LGY A;  3PLV A;  3B08 A;  3ECI A;  4FJZ A;  2MP2 A;  4ANW A;  4HDO A;  1GJZ A;  2KC2 A;  2BPS A;  4HPL B;  2CKH B;  2Y5B B;  2ZJD A;  5HKH A;  2LGX A;  1GNU A;  4ZYN A;  1EUV B;  2JPH A;  2KWV B;  5G2N A;  3UIP B;  1YX5 B;  4NQK E;  2B3A A;  2NCN A;  3NOB A;  4IM3 A;  5J18 A;  3R3M A;  4ANU A;  1YIW A;  2IZV B;  4BVU C;  3PGE A;  3HIZ A;  2GBR A;  3X0W A;  2Z0D B;  3W1S C;  3APC A;  3I3T B;  4GDK B;  4BBN F;  1E90 A;  1EF5 A;  2R2Q A;  2XBB C;  3VVW B;  4ANV A;  3A9K B;  1XT9 B;  3N32 A;  4DXA B;  2ZPN A;  1RFA A;  1WJU A;  2K6D B;  3VAW A;  2MA9 B;  2C60 A;  4FJY A;  3SHQ A;  1Q1O A;  2LVO A;  4II2 B;  1Z5S B;  2BWE S;  2MCN B;  5L83 A;  5IAA C;  2FUH B;  3VTU A;  2FCN A;  4DDG D;  3U7D A;  3DCG A;  1WJN A;  2J7Q B;  2LGD A;  2ZCC A;  3KUC B;  4RM8 A;  2G3Q B;  2K25 A;  1V5T A;  2YVC A;  3ML9 A;  4LJP B;  2MRP A;  4GU2 A;  3HK0 A;  1WJ6 A;  3NZU A;  3V61 A;  2V1Y A;  4MEL A;  2NPT A;  1WM2 A;  3V60 A;  4EOY A;  4WJO A;  4W9D A;  4TQ1 A;  2REX A;  4IW0 A;  3BY4 B;  1P98 A;  2MBQ A;  4II3 B;  2G4S A;  3WAM A;  2BKR B;  4ANX A;  5EDS A;  1E8X A;  2WX1 A;  1Q5W B;  1J19 A;  2I1J A;  2MSE D;  2DAF A;  3EFU A;  1TBE A;  1A5R A;  2L3Z A;  2NBU A;  2MP2 B;  5LLI A;  3KVF B;  2FIF A;  2Z0E B;  3V6E B;  2EMS A;  2KDI A;  2JVC A;  3CST A;  3AXC A;  1ZW7 A;  4ZRK A;  3VH4 B;  1WR6 E;  3IFW B;  3VFK A;  4GN1 A;  2O2V B;  5D6J B;  1I42 A;  1WF9 A;  4MDK E;  2ZPY A;  1LM8 B;  3N30 A;  4WJP A;  1WRD B;  4OVV A;  1WXV A;  4G11 A;  3L08 A;  2BYV E;  2AL3 A;  4EUT A;  2M0X A;  1CMX B;  1GUA B;  3B0A A;  2C5L C;  2JF5 A;  2KHW B;  3DDC B;  3HM6 X;  1ISN A;  3PT2 B;  2Z59 B;  4HDQ A;  2DZK A;  4IWO A;  1V80 A;  1ZKH A;  2KK8 A;  3A1Q A;  1JRU A;  3DPD A;  1YJ1 A;  3QIJ A;  3ONS A;  3OJ4 B;  5C1Z A;  5AZH A;  4BOZ B;  2O6V D;  3RCZ A;  1I35 A;  2DZM A;  3WA0 A;  4KDL B;  1F9J A;  5JHB A;  2LWP A;  5D2M B;  3HHM A;  1P1A A;  4KIK A;  4MH0 E;  2IO0 B;  1R4M I;  2BYE A;  4TV3 A;  4FHJ A;  3ZNI D;  4HLE A;  2PJH A;  2NPT B;  2K8B A;  1WXA A;  1Q0W B;  1SE9 A;  4PS7 A;  4N9F 4;  1M94 A;  3P2B A;  3WIM A;  3DBH I;  3V6C B;  3HM3 A;  2IO2 B;  2J0K A;  2V4L A;  4E71 A;  4X57 B;  2LI5 A;  4G50 A;  3T8M A;  3UQB A;  2JZ3 B;  2N1V A;  3PRM B;  1V2Y A;  5IA7 A;  1UZX B;  3M62 B;  4WJQ A;  1AAR A;  1R4N I;  2LUE A;  1IYF A;  3PS6 A;  2W9N A;  4F8C B;  4K7W A;  1FXT B;  2N9E B;  2VRR B;  3L0W B;  2IO3 B;  4W9J A;  4B6W A;  2LD9 A;  1U4A A;  2AWT A;  1WYW B;  4GGQ A;  2GBJ A;  2JUO A;  2GOW A;  4JGH B;  4TKN A;  2KD0 A;  2ASQ A;  2KDE B;  2LRW A;  2N4F A;  1X1M A;  2DYB A;  3A4S C;  3B1L X;  1S1Q B;  4YL8 A;  4KSL C;  4A20 A;  5G55 A;  4JQW C;  3ZNG C;  3LJ3 A;  2D07 B;  3QK0 A;  1E7V A;  3A1Q B;  1WX9 A;  1V5O A;  1GC7 A;  4IG7 B;  2L0F A;  3ALB A;  4I6N B;  4DHZ B;  2JZZ A;  3DBS A;  4HWI B;  4JLC A;  2NVU I;  4MGI E;  4NAW A;  2KWC A;  4B9K A;  2AEH A;  2PEA A;  5AEK B;  3T9L A;  2DX5 B;  1NBF C;  1S3S G;  4HXD A;  3WAP A;  1WR1 A;  1OEY J;  5CTR C;  4JIO U;  4BKT A;  3MJW A;  2D11 A;  2BKF A;  3AU5 A;  3M63 B;  3N3K B;  3RT3 B;  4DHZ E;  3AUL A;  2UWQ A;  2GBK A;  4URK A;  1WE6 A;  2FCM A;  2KDB A;  5DPW A;  4DHJ B;  2DZJ A;  4M8N A;  2NBV B;  4K7S A;  2KFK A;  4M0W B;  5DCN A;  3GZN I;  2L7R A;  3PSE B;  4MM3 A;  1D3Z A;  1WM3 A;  3VDZ A;  4CO7 A;  2XEW A;  2IO1 B;  5D94 A;  3UF8 A;  2K6Q A;  2FCQ A;  4OVU A;  4GMV A;  1OTR B;  4FBJ B;  4K81 A;  5CHV C;  2KDF B;  5CX3 A;  1E8Y A;  1P0R A;  2PE6 B;  2R2O A;  1WGD A;  1WY8 A;  3C0R B;  3PRE A;  3K9P B;  2CHX A;  4XZ4 A;  2G45 B;  3RUI B;  4EZJ A;  4IC7 B;  3R7R A;  2I1K A;  2KC1 A;  1V86 A;  3DQV A;  2FNJ B;  1WZ0 A;  2UYZ B;  4GOC A;  1NDD A;  1KM7 A;  2D2Q A;  3OAW A;  2M1M A;  3QAR A;  3ZTD A;  4GDL B;  2C7N B;  1KJT A;  2KWU B;  3PZD A;  3UGB B;  2HE7 A;  2CS4 A;  2RD0 A;  2RPQ A;  3QHT A;  1VD2 A;  1P3Q U;  2M17 A;  3ZW3 A;  3ZO5 B;  3JSV A;  1J8C A;  2J0M A;  1H4R A;  2WYQ A;  1WGG A;  3K9O B;  2N7E A;  4I6L B;  2RSU A;  4DHJ D;  2C9W B;  3DBR I;  4EFO A;  2RGF A;  2YLM A;  3APD A;  4MGK E;  3VUX A;  4G0N B;  2KQ7 A;  3M95 A;  5DPR A;  1WX8 A;  3DVN U;  2MBH A;  2KJ6 A;  3JVZ X;  2KFJ A;  4DK5 A;  4LDT B;  4NPN A;  3RUL A;  2DAJ A;  2K8H A;  2KJR A;  2LRU A;  4AJW A;  1WFY A;  4W9F A;  3SD5 A;  2KX3 A;  2MX2 A;  1V49 A;  3Q3F A;  3H7P A;  4WQO B;  1WMH A;  3WAL A;  2L8J A;  5E6N A;  2CHW A;  2QHO A;  2KTF A;  4GSW A;  2LVQ A;  2L0T A;  4FN2 A;  4WWO A;  3ZVV A;  1K8R B;  3L13 A;  1XQQ A;  2MLB A;  3NHE B;  4FHK A;  4E3C A;  2D3G A;  4E74 A;  4PS8 A;  3BIN A;  4GB9 A;  2KZR A;  4J6I A;  2A4Z A;  1E7U A;  4P7I A;  4K7U A;  4MJS A;  2NBW B;  4IM0 A;  2KVR A;  4LCD E;  2KNB A;  3H1U A;  4W9H A;  2IBI B;  4HVB A;  3JYU A;  2WWZ A;  3LDZ E;  1E8Z A;  2KJH B;  3AI5 A;  2KTR A;  1C3T A;  2HTH A;  3VH3 B;  3ZDM C;  1UGM A;  3Q3J A;  4GDL A;  1C1Y B;  2L76 A;  2BGF A;  2G4D B;  2JRH A;  3TL5 A;  2BYF A;  4WAA A;  1PQS A;  3ZNH B;  4KZ0 A;  2KX0 A;  2C7H A;  3DVG X;  4MSQ B;  3PHX B;  1VCB A;  4NJ7 A;  4A3O A;  4ICU A;  2MWS B;  2LVP A;  1KOT A;  2MQJ A;  3D32 A;  4GDK A;  2BF8 B;  2FAZ A;  5CHW A;  5KHO A;  2IY0 B;  3H6N A;  3RZF A;  4JL9 A;  3PLU A;  2CR5 A;  1RRB A;  2LXC A;  2L05 A;  5LXH A;  2ZVO A;  3H9D A;  3NS8 A;  5KHQ A;  3L10 B;  3ZTC A;  5L95 C;  3TIX A;  1UD7 A;  3L16 A;  3DBL I;  1WMH B;  4HCN B;  4M8M A;  3KH0 A;  3VXW A;  3UIO B;  4KIK B;  4B95 A;  2PPH A;  4W9G A;  4IM2 A;  4KV2 A;  2MW5 A;  2CHZ A;  2O6V A;  3NZS A;  4MJS B;  3OJ3 A;  4KSK C;  2KAN A;  2GBM A;  3VTW A;  1IPG A;  2LZ6 A;  2KTR B;  3KYD D;  2EMT A;  1EO6 A;  3R7Q A;  2LAS A;  2N9P C;  2JY6 A;  3OLM D;  3O65 B;  5LXI B;  1J0G A;  3VHT C; 
#chains in the Genus database with same CATH topology
 3IAS 1;  4AUQ C;  1FCC C;  4PYZ A;  1IUE A;  4RH6 A;  2JZP A;  4W9K A;  1VZ8 A;  3A9J A;  3JW0 X;  2JSV X;  4BOS C;  2KXJ A;  3VTV A;  2J52 A;  4BKS A;  2JRI B;  3KUZ A;  1XF5 L;  2AX5 A;  3AE7 B;  4W9C A;  3ZNZ B;  3EEC A;  4BFR A;  3ZRC A;  4W9E A;  3IVF A;  3SR6 A;  4ITK A;  2C7M B;  3QAQ A;  3VR8 B;  2AL6 A;  2WXL A;  1WI0 A;  3ZJT A;  3ZDT A;  1WXM A;  3NY5 A;  4MGY E;  1FD6 A;  3B2F A;  1V1P A;  5D7G A;  2W3R A;  3B9J A;  4DXG A;  4OW0 A;  2WXO A;  2GI9 A;  2ZVN A;  1MHH E;  1UWX A;  2AYO B;  3A4R A;  3TMP B;  1QZE A;  3A9J B;  2INC C;  2KN5 A;  3IXS A;  3P42 A;  1PDX A;  3CSF A;  1CZP A;  5AUI A;  4FLH A;  4K3B A;  2KQS A;  2XNA C;  2QMT A;  4ZDV A;  2WXQ A;  4XDC A;  1RAX A;  4FA6 A;  3PV1 A;  4N59 A;  4CHK A;  4NY0 A;  3NJT A;  4P1B C;  2ZNV C;  5E6O A;  2JWZ A;  2OOB B;  4PS3 A;  1T0S C;  2KO3 A;  1N5X A;  2J0J A;  5GMV A;  3DBR B;  3MHS D;  3A9K A;  1WZ3 A;  3EUB 2;  4KDI C;  1FIQ A;  1BT0 A;  2GBN A;  5JZE B;  2E3T A;  3O13 A;  3S2A A;  1E5W A;  1GG3 A;  1V9J A;  3H7P B;  3RD2 A;  1RLF A;  3IG3 A;  2QEJ C;  1WGR A;  1Q10 A;  4EZK A;  1YD8 U;  1L6U A;  4HJK A;  1YJJ A;  2Y5C A;  4S0R A;  2RR9 A;  4C7Y A;  1N60 A;  2IGD A;  4PK1 A;  3EHV A;  4TUU A;  3TJP A;  5FR3 A;  3RMK C;  2HJ8 A;  2DBY A;  1LXD A;  3ZIM A;  3DBH B;  4A9A A;  3ECI A;  4FJZ A;  4ANW A;  3FKY A;  2KC2 A;  4LNI A;  2Y5B B;  2ZJD A;  3P63 A;  4ZOH C;  1EUV B;  2KWV B;  3UIP B;  1YX5 B;  2B3A A;  2NCN A;  3R3M A;  1STE A;  1R4N B;  4BVU C;  2KVZ A;  4GDK B;  4BBN F;  1ZP0 B;  3A9K B;  2WLB A;  1YN5 A;  1HTQ A;  3U52 E;  2AQ1 B;  1Z5S B;  2MCN B;  2JU6 X;  3DCG A;  2ZCC A;  4RM8 A;  5LNK 1;  3IT4 B;  2K25 A;  1JRP A;  1V5T A;  2MRP A;  4GU2 A;  3HK0 A;  2ZW1 A;  1TYG B;  1SB3 C;  3BY4 B;  1P98 A;  2PTL A;  3WAM A;  2BKR B;  4ANX A;  1Q5W B;  1J19 A;  1A5R A;  1Y56 A;  2NBU A;  1K50 A;  2Z0E B;  1EU4 A;  2EMS A;  1VRA B;  2QC8 A;  4JX1 C;  1K51 A;  4ZRK A;  1C4P A;  3VH4 B;  1WR6 E;  4GN1 A;  5D6J B;  2VH1 A;  1I42 A;  1WF9 A;  1N62 A;  1WXV A;  3BWU D;  2V3P A;  2AL3 A;  4EUT A;  2M0X A;  1CMX B;  2L1A A;  2C5L C;  2KHW B;  3AE2 B;  2LGI A;  1C77 A;  1FPY A;  3A1Q A;  2PLP A;  2QIE B;  4RCO A;  2O6V D;  3P4Q B;  3WA0 A;  3HHM A;  4KIK A;  2UU7 A;  4HRO A;  2CJO A;  2IGH A;  3ZNI D;  4HLE A;  3AV8 A;  3MFG A;  1WXA A;  4N9F 4;  3DBH I;  3V6C B;  3HM3 A;  1M4V A;  2PVG C;  2V3N A;  4G50 A;  2QDF A;  4M0W A;  2WNM A;  1FNW A;  1V2Y A;  1UZX B;  1R4N I;  1IYF A;  2LUE A;  3PS6 A;  1JWS D;  4F8C B;  4B6W A;  1U4A A;  4C00 A;  1QF6 A;  3MC0 B;  4JGH B;  2LRW A;  3A4S C;  2LGS A;  2L52 A;  3A1Q B;  2L0F A;  1F77 A;  2JZZ A;  3DBS A;  1DYQ A;  2NVU I;  2PEA A;  4BAX A;  5AEK B;  1NBF C;  3DWG C;  1WR1 A;  4BKT A;  3MJW A;  2BB6 A;  2UWQ A;  4M02 A;  1CQV A;  1T0R C;  4ZHP A;  1GPX A;  2NBV B;  4M0W B;  4MM3 A;  1QQR A;  3TEY A;  4CO7 A;  4LNF A;  4FBJ B;  2KDF B;  1WGD A;  1WYG A;  3C0R B;  3PRE A;  3K9P B;  2INN E;  1VZ7 A;  3DBL B;  3KWV A;  4EZJ A;  3RN9 C;  3Q3M C;  4IC7 B;  2I1K A;  1V86 A;  1KM7 A;  3OAW A;  5FK9 C;  1YNT E;  1KJT A;  2KWU B;  2HE7 A;  3CWI A;  2RD0 A;  1OQR A;  3QHT A;  5G5H A;  1P3Q U;  4JWU C;  3JSV A;  1WSP A;  1WGG A;  3OWE B;  2INP E;  2BYT A;  4EFO A;  3AMZ A;  4A6Q A;  2JX5 A;  3M95 A;  1QOG A;  1WX8 A;  3DVN U;  2Y5P A;  4WAF A;  3JVZ X;  2IJ0 A;  2MJ3 A;  4LDT B;  1P7F A;  3FIL A;  2DAJ A;  3Q3F A;  3NUH B;  1WMH A;  2L8J A;  2QHO A;  4GSW A;  4FN2 A;  4WWO A;  1XQQ A;  2X38 A;  4E3C A;  4GB9 A;  5IP4 D;  1B9R A;  4MJS A;  3EGR A;  4IM0 A;  2KNB A;  4HVB A;  2PVO D;  3KWL A;  4RGM A;  3VH3 B;  2QIL A;  2VZK D;  1XO3 A;  2L76 A;  2G4D B;  3ETR A;  4KZ0 A;  4RF1 A;  2BQQ A;  2C7H A;  1E6E B;  4HPP A;  4ICU A;  2MWS B;  3RZF A;  4R3D A;  3PLU A;  1TKY A;  1QOF A;  1L0Y B;  3FIL B;  2L05 A;  5LXH A;  3H9D A;  1P7E A;  4KGR A;  2QSD A;  2RPV A;  3L16 A;  3DBL I;  1WMH B;  3RFZ B;  3UIO B;  3B2G A;  4C56 C;  4B95 A;  1VR9 A;  4KV2 A;  1L0V B;  1ZXH A;  3SFD B;  4MJS B;  2KAN A;  2LJI A;  1L6V A;  1IPG A;  1FEH A;  2KAJ A;  2EMT A;  1EO6 A;  2LAS A;  2K5P A;  4REZ A;  4DWF A;  1EU3 A;  2WX0 A;  1SSN A;  2EKE C;  3J9C A;  4XC2 A;  1F1H A;  4RMA A;  2O2V A;  1F2R C;  5AZG A;  4ZRI A;  1GOZ A;  4AS1 A;  2LMC A;  1OGW A;  3Q6B A;  5AZF A;  3VUW A;  2NS5 A;  3AE6 B;  4NQL B;  4NAW B;  4XDD A;  2KWD A;  4ARC A;  1WGH A;  2GRI A;  1WIA A;  4WIP A;  2K39 A;  2BW2 A;  2WXH A;  1OFF A;  5BO4 B;  2KFK B;  1FFV A;  1JAL A;  1HE8 A;  4MEM A;  3L54 A;  2W55 A;  3GZN B;  3RNF C;  3WAO A;  3SDL C;  5FR6 A;  1C9F A;  1OEY A;  2M4N A;  4LNO A;  3KYC D;  3Q8E A;  2WQY B;  4L2Y A;  4GXB A;  3MTN B;  4WJN A;  1WXS A;  4B0E A;  2LXA A;  1SXT A;  2CU1 A;  2LEK A;  2NR2 A;  1TGZ B;  5E6J A;  4LJO B;  4ZRJ A;  2DEN B;  1XXG A;  4HRS A;  3W5U B;  1A70 A;  1LO5 D;  2WXF A;  3M3J A;  3GOE A;  3PVL A;  3BVM A;  3WAN A;  5JHA A;  1L2N A;  4OZC A;  1XLP A;  4CQN A;  2BS4 B;  4KVG B;  2ZCB A;  4RGO S;  1IP9 A;  3L17 A;  4IWQ A;  2GMI C;  4FUL A;  1XD3 B;  3DHH C;  3EC8 A;  4D2K A;  3V3X A;  2OJW A;  4Q2J A;  2JXT A;  3FC4 A;  4US8 A;  4C4V A;  2N9X A;  1H8C A;  4MSM B;  2BWF A;  2OJR A;  1Z2M A;  3W1S A;  5DPT A;  4BZA A;  1F52 A;  4BKS D;  1I4P A;  1D5X C;  4NJ6 A;  2D10 A;  3DVN V;  4PT5 A;  5G5G A;  4TQ0 A;  4US9 A;  2K22 A;  2CKH B;  3I9V 1;  1GNU A;  2WXM A;  5G2N A;  3IAM 1;  1QLB B;  3P4S B;  4ANU A;  1T5X D;  1YIW A;  3X0W A;  3APC A;  3I3T B;  3U7Z A;  1E7P B;  4C7Z A;  2R2Q A;  1TKE A;  2XBB C;  4RNA A;  1C79 A;  3N32 A;  2FE8 A;  2ZPN A;  1CK1 A;  4RGN A;  1WGK A;  2MA9 B;  1Q1O A;  2BWE S;  5L83 A;  4ZRQ A;  3U7D A;  1DOY A;  4HJG E;  1J7C A;  4C4V B;  2G3Q B;  4LJP B;  3ML9 A;  3NZU A;  3V61 A;  2V1Y A;  4WJO A;  1NEK B;  4IW0 A;  5I4D A;  1YN4 A;  2G4S A;  3MC9 A;  3AE5 B;  1VDV A;  5LLI A;  1OQQ A;  2KDI A;  2JVC A;  3CST A;  3AXC A;  1ZW7 A;  1EWY C;  4LNK A;  2JYE A;  4KKJ A;  3N30 A;  1FRR A;  4G11 A;  4P6V F;  3V05 A;  3ZYY X;  3NVZ A;  3T3O A;  1GUA B;  3NS1 A;  3TEX A;  3DDC B;  3HM6 X;  2Z59 B;  4HDQ A;  1NEN B;  3TEW A;  1V80 A;  2KK8 A;  3Q8C A;  1YJ1 A;  4N6E B;  3ONS A;  3AEF B;  1N61 A;  5JHB A;  2LWP A;  4KX6 B;  5D2M B;  1P1A A;  2BYE A;  3AEE B;  2PJH A;  2HDE A;  4DQO C;  1SE9 A;  1YQ4 B;  4PS7 A;  1M94 A;  1D4B A;  1FNU A;  2LI5 A;  1HXY D;  3UQB A;  1ZXI A;  2N1V A;  3SFE B;  3AE1 B;  3BK1 A;  1V1P B;  1AAR A;  1FXT B;  2IDY A;  2N9E B;  3L0W B;  4W9J A;  2IO3 B;  2JYT A;  4GGQ A;  1E9M A;  2ASQ A;  2N4F A;  1X1M A;  4YSZ B;  1TY2 A;  4KSL C;  5HG2 A;  1YMH E;  2D07 B;  2PMV A;  3C19 A;  1V5O A;  4I6N B;  5EE9 A;  1AW7 A;  4JLC A;  2ONQ A;  2SEB D;  2KWC A;  4B9K A;  1N63 A;  3Q3O C;  3T9L A;  5CTR C;  4JIO U;  2QCZ A;  3RT3 B;  3AU5 A;  1KTK A;  3U2S C;  4DHZ E;  1KF6 B;  3C8Y A;  3AUL A;  1WE6 A;  3I63 C;  1FXI A;  5DPW A;  4DHJ B;  2DZJ A;  4QAY A;  2B76 B;  2EEL A;  4KKI A;  1D3Z A;  2IO1 B;  4RFB A;  1TS5 A;  2K0P A;  3UF8 A;  4OVU A;  4IDI A;  5CX3 A;  1P0R A;  5TSS A;  2R2O A;  1R7S A;  3RUI B;  2EKI A;  3R7R A;  3AE9 B;  1FMA D;  1NDD A;  1I4G A;  3QAR A;  3ZTD A;  1PUT A;  2C7N B;  1MPE A;  5H8Y E;  4B0M A;  2IPK D;  2RPQ A;  4FXC A;  2M17 A;  1QIL A;  1DGJ A;  1I4R A;  2RSU A;  3DBR I;  3APD A;  3VUX A;  2DNF A;  4YTN B;  2MBH A;  2KJ6 A;  1SEB D;  3ZQ4 A;  4NPN A;  1WFY A;  4W9F A;  1V49 A;  2KTF A;  2LVQ A;  3ZVV A;  3NRZ A;  3NHE B;  3RI7 C;  2D3G A;  1QOB A;  3DWM A;  3BIN A;  5EE3 A;  2A4Z A;  2M56 B;  1E7U A;  2HJ1 A;  4P7I A;  4K7U A;  2NBW B;  4LCD E;  2KVR A;  4W9H A;  3AH7 A;  4OVZ A;  3JYU A;  3LDZ E;  2HTH A;  3EFC A;  4YSY B;  2JRH A;  4NAM A;  2KX0 A;  3BVG A;  1ZE3 D;  3N1Y C;  1HZ6 A;  2G9H D;  5HFY A;  3MHZ A;  1KH0 A;  4USA A;  2LVP A;  1KOT A;  2BT6 A;  2MQJ A;  2BF8 B;  5CHW A;  2IY0 B;  2WDR B;  3NS8 A;  1JCK B;  2WXN A;  1K52 A;  4HCN B;  2ON8 A;  1LGR A;  4M8M A;  1DOI A;  3W5V B;  4KIK B;  4IM2 A;  2CHZ A;  4XWT A;  1E0Z A;  2O6V A;  1IBX A;  3OJ3 A;  1IGC A;  2N9P C;  2WGS A;  3PHW B;  2JY6 A;  5LXI B;  2DLB A;  5D3D A;  1J0G A;  5E6P A;  1WJ4 A;  2V3S A;  2HD5 B;  2V0G A;  5MPO A;  1UEL A;  3HRD D;  3LXF A;  1P9D U;  3VUY A;  3NVW A;  1C76 A;  1OQY A;  1C4A A;  1TKG A;  3AM9 A;  4WWN A;  1HZ5 A;  3DVG Y;  1SIF A;  3QA8 A;  1BML C;  4RM9 A;  3TUO A;  5TR5 A;  1UH6 A;  3KW5 B;  1ET9 A;  2KMC A;  2IY1 B;  2O6V B;  1G6J A;  1IBX B;  3NG0 A;  1L7Y A;  1YX6 B;  2KLC A;  3IHP C;  1NI2 A;  4MH8 A;  1T6B X;  1DOX A;  1QT9 A;  3ENE A;  1ENF A;  1FM0 D;  2FID A;  4MM3 B;  2MBB B;  2K8C A;  3TBL D;  1FO4 A;  4HK2 A;  3UIN B;  1ESF A;  3AU4 A;  3IT6 B;  4F1S A;  2Q5W D;  1E8W A;  2WDT B;  3VQI A;  3X23 A;  4BBN C;  4AOF A;  4KZC A;  4IWP A;  1SE3 A;  4CYE A;  5BMI A;  4FJV B;  4UDU C;  4W9I A;  2SAK A;  4GIV A;  4WQM A;  4LK0 M;  3QCA A;  2PE9 A;  4AWJ A;  2PW9 A;  3Q14 C;  3P4R B;  2JT4 B;  3JSV B;  1SF0 A;  4F7Z A;  2I38 A;  4XX5 A;  4AP4 C;  2MBO A;  3W1Y A;  4EZL A;  1LFD A;  3QQ8 B;  5IN7 A;  5BYR A;  3SEB A;  3E56 A;  4MGZ E;  2BTE A;  2K9X A;  3KQ4 A;  5T8I A;  1NVI D;  4A8X C;  1JWA D;  3ZJV A;  1XLQ A;  4I6P A;  4A3P A;  4G3X B;  2WXG A;  2ZNV B;  3H7S A;  3EA6 A;  3KUD B;  1WE7 A;  2DYO A;  1Y8R C;  4O1N A;  1MFW A;  2ZEQ A;  3ML8 A;  2FCS A;  1LQB A;  1XCQ L;  1GB4 A;  1NYQ A;  2N7D A;  1R4M B;  1TT5 B;  2IYD B;  4K1R B;  5AUK A;  1WH3 A;  2BVC A;  2LGY A;  3B08 A;  2BPS A;  1ZDV A;  5HKH A;  1T0Q C;  2LGX A;  3LYY A;  4NQK E;  2ICI A;  1RWS A;  3NOB A;  4IM3 A;  3RNG C;  2IZV B;  2BBC A;  2GBR A;  2Z0D B;  2H89 B;  1E90 A;  1EF5 A;  4ANV A;  2N9L A;  2JWU A;  1RFA A;  2CJN A;  2K6D B;  3Q69 A;  2WU5 B;  4A90 A;  2LVO A;  1ACC A;  4II2 B;  2FUH B;  3T3N A;  2FCN A;  3AEB B;  1WJN A;  1N6Z A;  2R61 A;  1YN3 A;  2NTT A;  2J7Q B;  3DHG C;  2LGD A;  2YVC A;  1WJ6 A;  4JE3 B;  4MEL A;  2NPT A;  3V60 A;  3ZXR A;  4EOY A;  2RDB C;  2V9H A;  1KLG D;  2WXK A;  2IGG A;  4II3 B;  3W2D A;  4ZYS A;  3UI3 A;  1BXT A;  2V4I B;  2DAF A;  3EFU A;  1SIJ A;  1TBE A;  3RPF C;  2L3Z A;  2FIF A;  3V6E B;  3RNE C;  1WXQ A;  1JML A;  2O2V B;  1QOA A;  4MDK E;  2VH2 A;  4WJP A;  1WRD B;  2I2Y A;  4L1B A;  3L08 A;  2BYV E;  1JRO A;  1ISN A;  4WUR A;  2MH7 A;  1ZKH A;  4RF0 A;  3LB8 C;  1JRU A;  3QIJ A;  2WXJ A;  3OJ4 B;  3VR9 B;  1AN8 A;  2LUM A;  4BOZ B;  1TS4 A;  1FCL A;  4MH0 E;  2IO0 B;  1R4M I;  4FHJ A;  2NPT B;  3BYT B;  2K8B A;  1Q0W B;  3WIM A;  4YXD B;  2IO2 B;  2J0K A;  2ZW0 A;  2WDQ B;  1L4D B;  2JZ3 B;  2AQ3 B;  3P1M A;  4C80 A;  3M62 B;  2E6X A;  2W9N A;  1HEZ E;  4K7W A;  4WWM A;  2VRR B;  3NVV A;  2AWT A;  2LHE A;  1AWD A;  1TIF A;  4XE0 A;  3AE8 B;  2JUO A;  4MT5 A;  3B1L X;  1S1Q B;  4YL8 A;  4YT0 B;  4A20 A;  5G55 A;  3LJ3 A;  1PGB A;  1TZO A;  1E7V A;  2FUG 1;  2J42 A;  3H8H A;  3QK0 A;  1V1O A;  3ALB A;  4DHZ B;  1I4H A;  4HWI B;  2MHJ A;  3WAP A;  2DWQ A;  1OEY J;  1I4Q A;  2D11 A;  2BKF A;  3R8B A;  2GBK A;  2KDB A;  3CIR B;  4M8N A;  3GZN I;  1KFY B;  1WM3 A;  3VDZ A;  3VRB B;  1OTR B;  5CHV C;  2GB1 A;  4KGT A;  1WY8 A;  1FNV A;  2G45 B;  4IKG A;  5FKA C;  3DQV A;  5HHD G;  4ARI A;  2FNJ B;  4GOC A;  2UYZ B;  3PO0 A;  3UGB B;  3KLS X;  2CS4 A;  1D5Z C;  3BK2 A;  1VD2 A;  3ZXV A;  3ZW3 A;  1TY0 A;  3ZO5 B;  2WYQ A;  1ET6 A;  2N7E A;  4I6L B;  4DHJ D;  5IKC M;  1CJE A;  2YLM A;  5GXG B;  4M00 A;  4MGK E;  2J53 A;  4WH4 A;  3AED B;  1XCT L;  2KFJ A;  2K8H A;  3GP7 A;  3MC8 A;  1HQR D;  3SD5 A;  2KX3 A;  2MX2 A;  3H7P A;  4WQO B;  1K53 A;  2L0T A;  1GB1 A;  2MLB A;  4FHK A;  1PFD A;  3AE3 B;  4PS8 A;  5JXV A;  3H1U A;  2IBI B;  4K3C A;  4YWG G;  1E8Z A;  3AI5 A;  2KTR A;  3DHI C;  4ZRP A;  3ZGZ A;  3Q3J A;  1C1Y B;  1ROE A;  3TL5 A;  4KGS A;  3FAH A;  1PGX A;  2BYF A;  3ZNH B;  1PQS A;  1VJK A;  3DVG X;  4MSQ B;  3PHX B;  1VCB A;  3ZJU A;  2PKO A;  4NJ7 A;  4A3O A;  4NJC A;  1L0X B;  2RMM A;  3I57 A;  3D32 A;  4GDK A;  2FAZ A;  2CR5 A;  2LXC A;  3L10 B;  4HEA 1;  1UD7 A;  1FFU A;  2N7J A;  3RNB C;  3KH0 A;  2N9K A;  3L4P A;  2FBW B;  2PPH A;  3BVZ A;  3PZ8 A;  4J3O D;  3URY A;  1HA5 A;  4P1C C;  3NZS A;  2WHI A;  1YJI A;  4KSK C;  2LZ6 A;  2KTR B;  3KYD D;  2G1E A;  2OED A;  3O65 B;  2YEP B;  1D6E C;  3RYT A;  3QWZ B;  2NMQ A;  1ZDX A;  3QC8 B;  4A55 A;  1MI0 A;  4PYU A;  3RNC C;  1MJD A;  1T3Q A;  1MHX A;  1UBQ A;  2IND C;  4BKG A;  3ZLZ A;  3N1Z C;  2MJE A;  3WCQ A;  3U30 A;  1EF1 A;  2KAC A;  4HCP B;  3ZUN A;  5JH5 C;  3QX1 A;  1V6E A;  3TEZ A;  2M8S A;  4LLG M;  2AQ2 B;  2KOX A;  1SGH A;  3AEG B;  2LHD A;  1GAQ B;  4JPS A;  1WGY A;  4P16 A;  5CHF A;  3R2T A;  4TMA B;  1GC6 A;  2L00 B;  3AB5 A;  3UQA A;  3CF6 E;  2Z8L A;  3PRP B;  3Q8A A;  4DDI D;  1TZ1 A;  3MJ5 A;  5D3I B;  4DBG A;  3APF A;  1EM7 A;  1UBI A;  3I5J C;  3IBE A;  3V62 A;  1UWM A;  5J2R A;  3HVD A;  2MEK A;  2W54 A;  1MG8 A;  1RM6 C;  2LJ5 A;  2K3U A;  2ACZ B;  1MG4 A;  2YEP F;  4IUM B;  2ZZP B;  4XWW A;  2W82 A;  2K1F A;  2DYM A;  3RZW C;  3CMM B;  1XEE A;  2MBE A;  2PIA A;  4ZHO A;  1T0Y A;  3AE4 B;  3N9Y C;  1WX7 A;  4LTU A;  5DPS A;  2A5U A;  2CU3 A;  3TCA A;  2D3B A;  3GE3 C;  4OHJ A;  4FAD A;  4NNJ B;  2BS3 B;  2XK5 A;  1TS2 A;  1F0Z A;  1IGD A;  4ICV A;  4ASW C;  4W9L A;  3PRZ A;  5BMG A;  3PTF C;  1I4X A;  4H2A A;  3DOW A;  4WWP A;  3PPA A;  3E9S A;  3SU8 X;  1PGA A;  4XGA B;  4EEW A;  2JXX A;  4LDT D;  1UGJ A;  4HPM B;  3BII D;  3A33 B;  5C23 A;  2N1W A;  1TJE A;  1KLV A;  3R2I A;  1YQ3 B;  4IOI E;  3ZRF A;  1TTN A;  3ZKJ C;  3U8Z A;  2GLS A;  1ZGU B;  2DZI A;  2KMA A;  4AJY B;  2KKC A;  5J17 A;  3Q8F A;  3QJZ A;  1E10 A;  2X8X X;  4N58 A;  2KLG A;  2XK5 B;  2WS3 B;  2DHZ A;  3R66 C;  1YQB A;  5IO9 A;  1ZOY B;  3N1X C;  1V81 A;  2L32 A;  4EKU A;  3PLV A;  2MP2 A;  1XLN A;  4HDO A;  1GJZ A;  4HPL B;  2H88 B;  1F2R I;  4ZYN A;  2JPH A;  5J18 A;  4LNN A;  1ZPS A;  4HKZ E;  3HVZ A;  3PGE A;  3HIZ A;  2KYW A;  3W1S C;  1NI3 A;  1ZUD 2;  3VVW B;  1XT9 B;  4DXA B;  3Q2A C;  2WXI A;  1WJU A;  3VAW A;  2C60 A;  4FJY A;  3SHQ A;  1UUP A;  5IAA C;  4YTP B;  1AYF A;  1BUI C;  4RGT A;  3VTU A;  1FXA A;  4DDG D;  2N0S B;  3AEA B;  3KUC B;  3GE8 C;  4XYC A;  1HTO A;  1L4Z B;  1JWB D;  2KQ4 X;  1WM2 A;  3AEC B;  2NTS A;  4W9D A;  1RYJ A;  4TQ1 A;  2XN9 C;  5EE1 A;  2REX A;  4YSX B;  1TS3 A;  2MBQ A;  5EDS A;  1V97 A;  1E8X A;  2WX1 A;  2I1J A;  1UF0 A;  2MSE D;  3BZD B;  4OZA A;  4MAC A;  2MP2 B;  3KVF B;  3IFW B;  3VFK A;  1C4C A;  2D3C A;  2M19 A;  3VRA B;  2ZPY A;  3TSS A;  1UNS A;  1LM8 B;  4OVV A;  3B0A A;  2JF5 A;  3PT2 B;  4HKQ A;  2DZK A;  4IWO A;  1NYR A;  3DPD A;  5C1Z A;  5AZH A;  3RCZ A;  1I35 A;  2DZM A;  4KDL B;  1F9J A;  3N20 C;  4TV3 A;  1B1Z A;  4DXF A;  2TSS A;  2KN4 A;  3P2B A;  2V4L A;  4E71 A;  4X57 B;  3T8M A;  3PRM B;  5EE0 A;  3W9C B;  5IA7 A;  4WJQ A;  2D3A A;  2WDV B;  3MP9 A;  1XLO A;  2RDG A;  2J4X A;  2LD9 A;  1JQ4 A;  1KRH A;  1WYW B;  2GBJ A;  2GOW A;  4TKN A;  2KD0 A;  2KDE B;  5H92 C;  1FRD A;  2DYB A;  4JQW C;  3ZNG C;  2KMM A;  3RNA C;  1WX9 A;  1GC7 A;  4IG7 B;  2D5G A;  3NVY A;  4M01 A;  4MGI E;  4NAW A;  4GLS C;  2AEH A;  4AQ7 A;  1YOV B;  2DX5 B;  2JQR B;  1S3S G;  4HXD A;  2KT7 A;  3M63 B;  3N3K B;  1QKZ A;  4URK A;  2FCM A;  4YTM B;  3GB1 A;  5C3J B;  4K7S A;  2KFK A;  5DCN A;  1D5M C;  1VLB A;  1I7H A;  2L7R A;  3PSE B;  2WU2 B;  2RDH A;  2XEW A;  3BYY B;  5D94 A;  2K6Q A;  2FCQ A;  4GMV A;  4K81 A;  1E8Y A;  2PE6 B;  2CHX A;  4XZ4 A;  3PZ7 A;  1C78 A;  4NZL B;  2KC1 A;  1VZ6 A;  1WZ0 A;  2D2Q A;  5HI1 A;  2M1M A;  2W3S A;  4L23 A;  3PZD A;  1MVK A;  4ACF A;  1RFK A;  3GS2 A;  1L5P A;  2OHF A;  4JWS C;  1J7A A;  1WWT A;  1J8C A;  2J0M A;  1H4R A;  3K9O B;  2VZK B;  5IOI A;  2C9W B;  2HTM E;  2WXP A;  2RGF A;  4TSS A;  4G0N B;  2KQ7 A;  5BYQ A;  5DPR A;  4DK5 A;  2LFI A;  3RUL A;  2LRU A;  2KJR A;  4AJW A;  2M0A A;  1EWC A;  2QJL A;  3OG5 A;  3WAL A;  5E6N A;  3Q8B A;  1N5W A;  1KLU D;  2CHW A;  1K8R B;  3L13 A;  4E74 A;  1JWU D;  2WXR A;  4J6I A;  2KZR A;  1JW9 D;  2WWZ A;  2KJH B;  2Y3A A;  1C3T A;  1SE4 A;  3ZDM C;  1UGM A;  1SE2 A;  1PYW D;  4GDL A;  2BGF A;  5BYS A;  3U4E G;  4WAA A;  1V8C A;  3NZ3 A;  3P4P B;  3ABV B;  5KHO A;  2KDM A;  3H6N A;  4JL9 A;  2BS2 B;  1RRB A;  2MJD A;  3HUI A;  2ZVO A;  5KHQ A;  3ZTC A;  5L95 C;  3TIX A;  1SBB B;  3Q3N C;  1WRI A;  3VXW A;  2L83 A;  5C2T B;  4EE2 A;  4W9G A;  1JWM D;  1SJH D;  2MW5 A;  4OZB A;  5BMH A;  2BB5 A;  2GBM A;  3VTW A;  4S17 A;  1J7B A;  2WP9 B;  3R7Q A;  3OLM D;  4GDL B;  1SJE D;  3AN1 A;  3VHT C; 
#chains in the Genus database with same CATH homology
 5E6P A;  3RYT A;  1WJ4 A;  3QWZ B;  4DWF A;  2V3S A;  2WX0 A;  4AUQ C;  2EKE C;  2HD5 B;  3QC8 B;  4PYZ A;  4XC2 A;  4RMA A;  1UEL A;  2O2V A;  4PYU A;  1P9D U;  3VUY A;  1UBQ A;  4W9K A;  3A9J A;  3JW0 X;  1OQY A;  4BKG A;  5AZG A;  3ZLZ A;  4BOS C;  4WWN A;  4ZRI A;  2KXJ A;  3VTV A;  3U30 A;  1EF1 A;  1OGW A;  5AZF A;  4HCP B;  4BKS A;  3VUW A;  3DVG Y;  2JRI B;  2NS5 A;  1SIF A;  3KUZ A;  3QA8 A;  3QX1 A;  1V6E A;  3ZUN A;  5JH5 C;  4NQL B;  4RM9 A;  4NAW B;  2M8S A;  4W9C A;  3ZNZ B;  2KOX A;  3EEC A;  4BFR A;  5TR5 A;  1UH6 A;  1SGH A;  3ZRC A;  3KW5 B;  1WGH A;  1WIA A;  4W9E A;  3IVF A;  1WGY A;  2KMC A;  2IY1 B;  2O6V B;  1G6J A;  5CHF A;  2K39 A;  1GC6 A;  1L7Y A;  2L00 B;  1YX6 B;  3UQA A;  2KLC A;  2C7M B;  3CF6 E;  3PRP B;  4DDI D;  3QAQ A;  1TZ1 A;  2AL6 A;  4DBG A;  1WI0 A;  3APF A;  1NI2 A;  3IHP C;  5BO4 B;  1UBI A;  3IBE A;  2KFK B;  3V62 A;  5J2R A;  3ENE A;  1MG8 A;  3ZDT A;  2FID A;  1WXM A;  2MBB B;  2K8C A;  3NY5 A;  1HE8 A;  3TBL D;  4MEM A;  4MGY E;  2LJ5 A;  3L54 A;  4IUM B;  4HK2 A;  2ZZP B;  5D7G A;  3UIN B;  2K1F A;  2DYM A;  3RZW C;  3WAO A;  3CMM B;  3SDL C;  5FR6 A;  1OEY A;  3AU4 A;  2M4N A;  2ZVN A;  2MBE A;  4F1S A;  3KYC D;  2AYO B;  1E8W A;  1T0Y A;  2WDT B;  3A4R A;  1WX7 A;  4GXB A;  3TMP B;  3VQI A;  3MTN B;  1QZE A;  5DPS A;  2A5U A;  3A9J B;  2KN5 A;  4WJN A;  1WXS A;  3TCA A;  3X23 A;  4BBN C;  2LXA A;  4FAD A;  4NNJ B;  4AOF A;  3CSF A;  3PHW B;  2CU1 A;  4KZC A;  4IWP A;  2XK5 A;  4CYE A;  4FJV B;  2NR2 A;  1TGZ B;  4ICV A;  4W9I A;  4FLH A;  4GIV A;  4LJO B;  2KQS A;  3QCA A;  4ZRJ A;  4ASW C;  4W9L A;  2PE9 A;  3PRZ A;  4AWJ A;  2DEN B;  4ZDV A;  1RAX A;  3PTF C;  4FA6 A;  3PV1 A;  4CHK A;  4NY0 A;  2JT4 B;  3JSV B;  3DOW A;  4WWP A;  4F7Z A;  2ZNV C;  3PPA A;  3SU8 X;  3M3J A;  4XX5 A;  3GOE A;  3PVL A;  4AP4 C;  3WAN A;  2MBO A;  5JHA A;  5E6O A;  4EEW A;  2JWZ A;  2JXX A;  1L2N A;  3W1Y A;  2OOB B;  4EZL A;  1LFD A;  3QQ8 B;  4LDT D;  4PS3 A;  2KO3 A;  2J0J A;  4HPM B;  4MGZ E;  4KVG B;  5GMV A;  3A33 B;  3MHS D;  2ZCB A;  1WZ3 A;  3A9K A;  4KDI C;  5C23 A;  1BT0 A;  2GBN A;  2N1W A;  1IP9 A;  1KLV A;  5JZE B;  3L17 A;  4IWQ A;  3S2A A;  2GMI C;  1E5W A;  1GG3 A;  4FUL A;  1V9J A;  3ZRF A;  3H7P B;  1TTN A;  1XD3 B;  3ZKJ C;  4I6P A;  3RD2 A;  1ZGU B;  3U8Z A;  1RLF A;  3EC8 A;  3IG3 A;  2DZI A;  1WGR A;  2KMA A;  4A3P A;  4G3X B;  4AJY B;  4EZK A;  1YD8 U;  2KKC A;  4HJK A;  2ZNV B;  5J17 A;  3H7S A;  3QJZ A;  3KUD B;  1WE7 A;  2N9X A;  2RR9 A;  4MSM B;  2DYO A;  1H8C A;  2BWF A;  2OJR A;  1Y8R C;  1Z2M A;  3W1S A;  5DPT A;  2KLG A;  2ZEQ A;  3EHV A;  2FCS A;  3ML8 A;  4BKS D;  1LQB A;  4TUU A;  2XK5 B;  2N7D A;  2IYD B;  3TJP A;  4NJ6 A;  2D10 A;  2HJ8 A;  2DHZ A;  3DVN V;  1LXD A;  3R66 C;  1YQB A;  4K1R B;  1V81 A;  3ZIM A;  1WH3 A;  4EKU A;  4TQ0 A;  2LGY A;  3PLV A;  3B08 A;  3ECI A;  4FJZ A;  2MP2 A;  4ANW A;  4HDO A;  1GJZ A;  2KC2 A;  2BPS A;  4HPL B;  2CKH B;  2Y5B B;  2ZJD A;  5HKH A;  2LGX A;  1GNU A;  4ZYN A;  1EUV B;  2JPH A;  2KWV B;  5G2N A;  3UIP B;  1YX5 B;  4NQK E;  2B3A A;  2NCN A;  3NOB A;  4IM3 A;  5J18 A;  3R3M A;  4ANU A;  1YIW A;  2IZV B;  4BVU C;  3PGE A;  3HIZ A;  2GBR A;  3X0W A;  2Z0D B;  3W1S C;  3APC A;  3I3T B;  4GDK B;  4BBN F;  1E90 A;  1EF5 A;  2R2Q A;  2XBB C;  3VVW B;  4ANV A;  3A9K B;  1XT9 B;  3N32 A;  4DXA B;  2ZPN A;  1RFA A;  1WJU A;  2K6D B;  3VAW A;  2MA9 B;  2C60 A;  4FJY A;  3SHQ A;  1Q1O A;  2LVO A;  4II2 B;  1Z5S B;  2BWE S;  2MCN B;  5L83 A;  5IAA C;  2FUH B;  3VTU A;  2FCN A;  4DDG D;  3U7D A;  3DCG A;  1WJN A;  2J7Q B;  2LGD A;  2ZCC A;  3KUC B;  4RM8 A;  2G3Q B;  2K25 A;  1V5T A;  2YVC A;  3ML9 A;  4LJP B;  2MRP A;  4GU2 A;  3HK0 A;  1WJ6 A;  3NZU A;  3V61 A;  2V1Y A;  4MEL A;  2NPT A;  1WM2 A;  3V60 A;  4EOY A;  4WJO A;  4W9D A;  4TQ1 A;  2REX A;  4IW0 A;  3BY4 B;  1P98 A;  2MBQ A;  4II3 B;  2G4S A;  3WAM A;  2BKR B;  4ANX A;  5EDS A;  1E8X A;  2WX1 A;  1Q5W B;  1J19 A;  2I1J A;  2MSE D;  2DAF A;  3EFU A;  1TBE A;  1A5R A;  2L3Z A;  2NBU A;  2MP2 B;  5LLI A;  3KVF B;  2FIF A;  2Z0E B;  3V6E B;  2EMS A;  2KDI A;  2JVC A;  3CST A;  3AXC A;  1ZW7 A;  4ZRK A;  3VH4 B;  1WR6 E;  3IFW B;  3VFK A;  4GN1 A;  2O2V B;  5D6J B;  1I42 A;  1WF9 A;  4MDK E;  2ZPY A;  1LM8 B;  3N30 A;  4WJP A;  1WRD B;  4OVV A;  1WXV A;  4G11 A;  3L08 A;  2BYV E;  2AL3 A;  4EUT A;  2M0X A;  1CMX B;  1GUA B;  3B0A A;  2C5L C;  2JF5 A;  2KHW B;  3DDC B;  3HM6 X;  1ISN A;  3PT2 B;  2Z59 B;  4HDQ A;  2DZK A;  4IWO A;  1V80 A;  1ZKH A;  2KK8 A;  3A1Q A;  1JRU A;  3DPD A;  1YJ1 A;  3QIJ A;  3ONS A;  3OJ4 B;  5C1Z A;  5AZH A;  4BOZ B;  2O6V D;  3RCZ A;  1I35 A;  2DZM A;  3WA0 A;  4KDL B;  1F9J A;  5JHB A;  2LWP A;  5D2M B;  3HHM A;  1P1A A;  4KIK A;  4MH0 E;  2IO0 B;  1R4M I;  2BYE A;  4TV3 A;  4FHJ A;  3ZNI D;  4HLE A;  2PJH A;  2NPT B;  2K8B A;  1WXA A;  1Q0W B;  1SE9 A;  4PS7 A;  4N9F 4;  1M94 A;  3P2B A;  3WIM A;  3DBH I;  3V6C B;  3HM3 A;  2IO2 B;  2J0K A;  2V4L A;  4E71 A;  4X57 B;  2LI5 A;  4G50 A;  3T8M A;  3UQB A;  2JZ3 B;  2N1V A;  3PRM B;  1V2Y A;  5IA7 A;  1UZX B;  3M62 B;  4WJQ A;  1AAR A;  1R4N I;  2LUE A;  1IYF A;  3PS6 A;  2W9N A;  4F8C B;  4K7W A;  1FXT B;  2N9E B;  2VRR B;  3L0W B;  2IO3 B;  4W9J A;  4B6W A;  2LD9 A;  1U4A A;  2AWT A;  1WYW B;  4GGQ A;  2GBJ A;  2JUO A;  2GOW A;  4JGH B;  4TKN A;  2KD0 A;  2ASQ A;  2KDE B;  2LRW A;  2N4F A;  1X1M A;  2DYB A;  3A4S C;  3B1L X;  1S1Q B;  4YL8 A;  4KSL C;  4A20 A;  5G55 A;  4JQW C;  3ZNG C;  3LJ3 A;  2D07 B;  3QK0 A;  1E7V A;  3A1Q B;  1WX9 A;  1V5O A;  1GC7 A;  4IG7 B;  2L0F A;  3ALB A;  4I6N B;  4DHZ B;  2JZZ A;  3DBS A;  4HWI B;  4JLC A;  2NVU I;  4MGI E;  4NAW A;  2KWC A;  4B9K A;  2AEH A;  2PEA A;  5AEK B;  3T9L A;  2DX5 B;  1NBF C;  1S3S G;  4HXD A;  3WAP A;  1WR1 A;  1OEY J;  5CTR C;  4JIO U;  4BKT A;  3MJW A;  2D11 A;  2BKF A;  3AU5 A;  3M63 B;  3N3K B;  3RT3 B;  4DHZ E;  3AUL A;  2UWQ A;  2GBK A;  4URK A;  1WE6 A;  2FCM A;  2KDB A;  5DPW A;  4DHJ B;  2DZJ A;  4M8N A;  2NBV B;  4K7S A;  2KFK A;  4M0W B;  5DCN A;  3GZN I;  2L7R A;  3PSE B;  4MM3 A;  1D3Z A;  1WM3 A;  3VDZ A;  4CO7 A;  2XEW A;  2IO1 B;  5D94 A;  3UF8 A;  2K6Q A;  2FCQ A;  4OVU A;  4GMV A;  1OTR B;  4FBJ B;  4K81 A;  5CHV C;  2KDF B;  5CX3 A;  1E8Y A;  1P0R A;  2PE6 B;  2R2O A;  1WGD A;  1WY8 A;  3C0R B;  3PRE A;  3K9P B;  2CHX A;  4XZ4 A;  2G45 B;  3RUI B;  4EZJ A;  4IC7 B;  3R7R A;  2I1K A;  2KC1 A;  1V86 A;  3DQV A;  2FNJ B;  1WZ0 A;  2UYZ B;  4GOC A;  1NDD A;  1KM7 A;  2D2Q A;  3OAW A;  2M1M A;  3QAR A;  3ZTD A;  4GDL B;  2C7N B;  1KJT A;  2KWU B;  3PZD A;  3UGB B;  2HE7 A;  2CS4 A;  2RD0 A;  2RPQ A;  3QHT A;  1VD2 A;  1P3Q U;  2M17 A;  3ZW3 A;  3ZO5 B;  3JSV A;  1J8C A;  2J0M A;  1H4R A;  2WYQ A;  1WGG A;  3K9O B;  2N7E A;  4I6L B;  2RSU A;  4DHJ D;  2C9W B;  3DBR I;  4EFO A;  2RGF A;  2YLM A;  3APD A;  4MGK E;  3VUX A;  4G0N B;  2KQ7 A;  3M95 A;  5DPR A;  1WX8 A;  3DVN U;  2MBH A;  2KJ6 A;  3JVZ X;  2KFJ A;  4DK5 A;  4LDT B;  4NPN A;  3RUL A;  2DAJ A;  2K8H A;  2KJR A;  2LRU A;  4AJW A;  1WFY A;  4W9F A;  3SD5 A;  2KX3 A;  2MX2 A;  1V49 A;  3Q3F A;  3H7P A;  4WQO B;  1WMH A;  3WAL A;  2L8J A;  5E6N A;  2CHW A;  2QHO A;  2KTF A;  4GSW A;  2LVQ A;  2L0T A;  4FN2 A;  4WWO A;  3ZVV A;  1K8R B;  3L13 A;  1XQQ A;  2MLB A;  3NHE B;  4FHK A;  4E3C A;  2D3G A;  4E74 A;  4PS8 A;  3BIN A;  4GB9 A;  2KZR A;  4J6I A;  2A4Z A;  1E7U A;  4P7I A;  4K7U A;  4MJS A;  2NBW B;  4IM0 A;  2KVR A;  4LCD E;  2KNB A;  3H1U A;  4W9H A;  2IBI B;  4HVB A;  3JYU A;  2WWZ A;  3LDZ E;  1E8Z A;  2KJH B;  3AI5 A;  2KTR A;  1C3T A;  2HTH A;  3VH3 B;  3ZDM C;  1UGM A;  3Q3J A;  4GDL A;  1C1Y B;  2L76 A;  2BGF A;  2G4D B;  2JRH A;  3TL5 A;  2BYF A;  4WAA A;  1PQS A;  3ZNH B;  4KZ0 A;  2KX0 A;  2C7H A;  3DVG X;  4MSQ B;  3PHX B;  1VCB A;  4NJ7 A;  4A3O A;  4ICU A;  2MWS B;  2LVP A;  1KOT A;  2MQJ A;  3D32 A;  4GDK A;  2BF8 B;  2FAZ A;  5CHW A;  5KHO A;  2IY0 B;  3H6N A;  3RZF A;  4JL9 A;  3PLU A;  2CR5 A;  1RRB A;  2LXC A;  2L05 A;  5LXH A;  2ZVO A;  3H9D A;  3NS8 A;  5KHQ A;  3L10 B;  3ZTC A;  5L95 C;  3TIX A;  1UD7 A;  3L16 A;  3DBL I;  1WMH B;  4HCN B;  4M8M A;  3KH0 A;  3VXW A;  3UIO B;  4KIK B;  4B95 A;  2PPH A;  4W9G A;  4IM2 A;  4KV2 A;  2MW5 A;  2CHZ A;  2O6V A;  3NZS A;  4MJS B;  3OJ3 A;  4KSK C;  2KAN A;  2GBM A;  3VTW A;  1IPG A;  2LZ6 A;  2KTR B;  3KYD D;  2EMT A;  1EO6 A;  3R7Q A;  2LAS A;  2N9P C;  2JY6 A;  3OLM D;  3O65 B;  5LXI B;  1J0G A;  3VHT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...