2D07B

Crystal structure of sumo-3-modified thymine-dna glycosylase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
b'NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G/T mismatch-specific thymine DNA glycosylase
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase
pubmed doi rcsb
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d07B00
2KANA 2KJ6A 2UYZB 3ZIMA 1V6EA 3R7RA 4MM3A 2Z0EB 1EUVB 1WZ3A 4EKUA 4N9F4 4M0WB 3UQAA 5G55A 4JGHB 4A3OA 4BKTA 2ZNVC 1XD3B 1WX9A 3W1SC 3D32A 3KYDD 2C9WB 2LGXA 2RR9A 2L3ZA 4HXDA 3ZRCA 2AWTA 2UWQA 2FIFA 2BF8B 3RZFA 2DZJA 4RM9A 3BY4B 4XC2A 4IM0A 2C60A 3NOBA 2I1JA 3QX1A 1XQQA 3APCA 4W9HA 3HK0A 4MELA 4W9CA 2V1YA 4ICUA 3JW0X 4K81A 4DDID 3UQBA 4FJZA 3Q3FA 2BKFA 2Y5BB 2XEWA 4RMAA 1S3SG 2MBBB 2FCSA 1TBEA 2M4NA 1GC7A 2DYMA 4AP4C 2R2QA 4HDOA 4TV3A 3DBHI 3PZDA 2J0MA 2YLMA 4FULA 5GMVA 4NPNA 1WGYA 1WXSA 5FR6A 2LUEA 3VTUA 3VFKA 3A1QB 1D3ZA 2O2VA 3VVWB 5JHAA 3RCZA 2KC1A 2IZVB 3AULA 5CHWA 5EDSA 1LFDA 1UGMA 5LXHA 3KYCD 4WJPA 5G2NA 3DVGX 3M62B 1E8YA 2AL6A 1TGZB 2Z59B 2N9XA 2ZVOA 4FJYA 3VAWA 2XK5A 5J17A 1H8CA 4LCDE 3VUXA 5JH5C 2O6VB 4MGYE 3ZNZB 3W1SA 3X0WA 4ZRJA 3NZSA 2KJRA 4NJ7A 3KUZA 4MSMB 2QHOA 1RFAA 4FN2A 2R2OA 2LRUA 3ZO5B 1GG3A 4GN1A 4KZ0A 2M1MA 4EZJA 3DVGY 1P0RA 1OGWA 2KX3A 1I35A 2ZVNA 3VTWA 2KK8A 5J2RA 2JVCA 3TJPA 2FCQA 2CU1A 3ZDTA 3NZUA 3QAQA 3PRZA 2OOBB 5DPTA 4X57B 1OQYA 1A5RA 4LDTB 3TL5A 1WR1A 1WM3A 2D3GA 2V4LA 5AZHA 5L83A 3T8MA 1V81A 1JRUA 2BYFA 2LVOA 3V60A 2KQ7A 3B08A 3TMPB 4KIKB 3IG3A 4KDLB 4MJSA 4I6LB 1P98A 1RAXA 1WE6A 1ZW7A 1WI0A 3A4SC 4AOFA 4II3B 4WJQA 5D2MB 2ASQA 4I6PA 3ZTCA 3K9OB 4PS7A 5JZEB 1RRBA 4MH0E 2MWSB 5E6NA 3VH3B 3ZRFA 2N7DA 4YL8A 2HE7A 4RM8A 2WX0A 3L16A 4GOCA 2G45B 3CF6E 1PQSA 2NS5A 3EECA 1WIAA 3PGEA 1OTRB 2IY1B 4HK2A 3QC8B 2GBRA 2VRRB 3U7DA 4DHZE 4FLHA 4HWIB 4NJ6A 4GDKB 2O6VA 3ONSA 4G0NB 2IYDB 4CHKA 1AARA 4BBNC 4MGZE 2ZPYA 3ZUNA 3TBLD 2IBIB 2CHZA 2GOWA 1F9JA 3DPDA 3DBSA 4FHKA 1WGHA 4NAWA 2LJ5A 3APDA 3DQVA 1YIWA 4ZDVA 1J19A 2WDTB 1V5OA 3VXWA 4BKSD 3PSEB 4ICVA 2BWFA 2G4DB 2DX5B 2HJ8A 4EOYA 4PS8A 1GJZA 3QJZA 2MA9B 4HPMB 3DBRI 2PPHA 3RULA 2NBVB 2J0JA 3AU4A 1K8RB 3VUWA 2L8JA 2C7NB 4M8MA 1V86A 2KX0A 4MJSB 1IYFA 2W9NA 2AEHA 2N1VA 1WZ0A 4CYEA 1WGRA 2C7HA 4FHJA 5IAAC 5LXIB 4KIKA 3QWZB 3C0RB 4LJOB 2KNBA 2JPHA 2KTRB 3VH4B 4EEWA 2KXJA 1LM8B 2K6QA 2LZ6A 2MLBA 3DVNU 3O65B 3X23A 4BOZB 1IP9A 2PE6B 1SE9A 1BT0A 3WAMA 2M17A 4KVGB 3V6EB 2LI5A 1VCBA 2CR5A 4GXBA 4BBNF 2PJHA 1L2NA 2B3AA 2D10A 3A9JA 3OJ4B 3TCAA 2MP2A 3H7SA 4HVBA 4OVVA 2LXAA 3NY5A 1UD7A 4K7WA 5D6JB 3PS6A 2ZNVB 4KV2A 1WH3A 3PHWB 4XX5A 2BYVE 2PEAA 4NAWB 2KFKA 2KTFA 2DAFA 1WXMA 2D07B 3AU5A 3HM6X 4NNJB 3UIPB 5CHFA 2FAZA 3ECIA 3U30A 2K6DB 2KJHB 4F1SA 3DCGA 4KSKC 2YVCA 3TIXA 2MBHA 2ZJDA 3A4RA 2O2VB 3M95A 2JUOA 2KFJA 3R3MA 3PTFC 3CSTA 2GBMA 1Y8RC 2RPQA 3ZW3A 1XT9B 1TTNA 3IVFA 2EKEC 2LVPA 4DHJB 1GUAB 4ZYNA 1Z2MA 2KZRA 2MP2B 4IUMB 5LLIA 1WXVA 4A20A 1E8WA 3AXCA 1KJTA 2K8CA 4IM3A 4K1RB 3V6CB 3I3TB 1YQBA 1WX8A 4WWOA 1Q5WB 4WJOA 2A4ZA 4W9LA 1HE8A 2MSED 4WWNA 2KWUB 2JRHA 2NCNA 2REXA 3B1LX 3IBEA 3QIJA 1WGGA 4ASWC 2GMIC 2DYOA 4FBJB 2KTRA 2KDFB 1YJ1A 3UINB 1V80A 2JRIB 2CS4A 2NVUI 4G50A 2FNJB 2IO2B 3WANA 4E71A 3UGBB 4GDLB 2IY0B 4ZRIA 2LD9A 3PRMB 1C1YB 4GU2A 1QZEA 3RUIB 4AUQC 1NI2A 2NR2A 4ANVA 1KLVA 2JWZA 1Q0WB 2FCNA 2KFKB 3M3JA 1P9DU 2LVQA 3OLMD 4JIOU 3VQIA 4B6WA 2K8HA 3KW5B 4DDGD 4W9IA 4TUUA 2M8SA 2LASA 3QHTA 4PS3A 4FJVB 2KKCA 3U8ZA 3ZVVA 4EFOA 1L7YA 4NQKE 2KQSA 2IO0B 3N30A 2D2QA 3PREA 4IG7B 2BGFA 3WA0A 4FADA 1ZGUB 2KMCA 1NBFC 4K7UA 2A5UA 2N1WA 3WAOA 3HIZA 1WY8A 2L0FA 1RLFA 2L0TA 5AZGA 4GIVA 3EFUA 4HCPB 4EZKA 2XK5B 3VDZA 3WALA 1WGDA 3JSVA 1V9JA 1OEYA 5E6OA 3A9KA 1MG8A 5CHVC 1H4RA 1EF5A 4G3XB 2ZEQA 4A3PA 4ZRKA 1ISNA 2EMSA 3H7PA 2RD0A 3H6NA 3RZWC 1YX6B 2J7QB 2ZZPB 2KD0A 5BO4B 2NPTA 2NBUA 2ZPNA 2FCMA 4HPLB 3R66C 3ZNID 1SGHA 1IPGA 1E90A 2N9EB 5AZFA 1WJ6A 2G4SA 3PLUA 4PYUA 2KLGA 2EMTA 5KHQA 4WAAA 2KC2A 2WWZA 3MJWA 3JYUA 3S2AA 4II2B 3LJ3A 2DZKA 2XBBC 1E7UA 1WJ4A 2KOXA 4KDIC 1UH6A 1GC6A 3JVZX 4IM2A 1V49A 4MGKE 1G6JA 1R4NI 4GDKA 3QCAA 2Z0DB 1U4AA 3HHMA 3L10B 2L05A 2K25A 4BKSA 2BWES 1NDDA 2JZ3B 2MRPA 2KN5A 4GSWA 2D11A 4AWJA 2K1FA 3OJ3A 1P1AA 1YD8U 1WRDB 3WAPA 4IWQA 4TKNA 2CHWA 2JT4B 5D94A 5E6PA 3ZDMC 4W9DA 2MCNB 5C1ZA 2DZIA 2KMAA 2C7MB 2G3QB 3PLVA 3L17A 2GBKA 4W9EA 4CO7A 1FXTB 5DPWA 1J8CA 2KLCA 3KUDB 3H7PB 1M94A 2LXCA 4HJKA 4NY0A 3OAWA 1WJUA 4HCNB 2C5LC 3ZLZA 2KDIA 4WQOB 2L7RA 4W9FA 4BVUC 4LJPB 1KOTA 2FIDA 4BFRA 3DVNV 1WE7A 3A1QA 2M0XA 1UELA 4XZ4A 3JSVB 2CHXA 1E7VA 4MGIE 2JY6A 3ZNGC 4JL9A 1LQBA 5HKHA 4BOSC 1WM2A 1GNUA 2WYQA 1P3QU 2KVRA 4LDTD 3PV1A 4KSLC 3KUCB 1OEYJ 4W9GA 2LGYA 3B0AA 4URKA 2PE9A 2DZMA 3L0WB 3A9JB 2NPTB 2DENB 3QARA 4IC7B 3UF8A 4E3CA 3SD5A 1WMHA 4PYZA 3T9LA 3MHSD 3ALBA 3H9DA 1S1QB 1SIFA 3CSFA 4TQ1A 4B9KA 1ZKHA 3ENEA 4E74A 5L95C 2RSUA 1UZXB 3QA8A 1CMXB 1WF9A 3N3KB 4P7IA 2NBWB 2K8BA 2KDEB 4B95A 4ANWA 5AEKB 1EF1A 5J18A 4GGQA 3LDZE 4GDLA 3ZNHB 4W9JA 4DK5A 2O6VD 3PRPB 4JLCA 3SU8X 2IO3B 1WR6E 1Q1OA 1E8ZA 4MEMA 3DBLI 2AL3A 4MSQB 2KWVB 2RGFA 5DCNA 4HDQA 4J6IA 3QQ8B 5D7GA 3DDCB 3UIOB 5IA7A 4DBGA 4TQ0A 4MDKE 3AI5A 1Z5SB 3P2BA 2DHZA 3BINA 4I6NB 2LGDA 1V5TA 3APFA 4ANUA 3RT3B 2FUHB 3V61A 1J0GA 1TZ1A 2MX2A 2AYOB 1WMHB 3PVLA 5JHBA 5CX3A 4G11A 2KDBA 2BPSA 2MW5A 2JXXA 2ZCBA 4DHZB 3RYTA 2N9PC 4DHJD 3NHEB 2I1KA 4IWPA 2N7EA 2IO1B 3ZKJC 3PT2B 3PPAA 2JZZA 3V62A 4WJNA 2HTHA 5CTRC 4DWFA 1VD2A 4HLEA 3IFWB 4OVUA 3N32A 1YX5B 1WXAA 3GZNI 3L08A 3QK0A 3SDLC 3R7QA 4M8NA 1E5WA 2GBJA 5C23A 4IWOA 5KHOA 3CMMB 4JQWC 3GOEA 4EZLA 1EO6A 2L76A 2LRWA 3WIMA 4BKGA 1C3TA 1T0YA 1V2YA 2V3SA 4AJWA 4FA6A 3VHTC 2DYBA 2DAJA 2MBEA 4GB9A 3NS8A 1WX7A 1WYWB 2MBQA 3Q3JA 4KZCA 4WWPA 2CKHB 2N4FA 2WX1A 1WFYA 2BKRB 2JF5A 3PHXB 3W1YA 2LWPA 4W9KA 5DPSA 3SHQA 4F7ZA 2J0KA 1X1MA 5DPRA 2ZCCA 1UBIA 3VUYA 1UBQA 3A33B 2KHWB 3ZTDA 3DOWA 3EC8A 4F8CB 2HD5B 3KH0A 3HM3A 3ML9A 2KO3A 1E8XA 3A9KB 3KVFB 2K39A 3IHPC 3RD2A 3VTVA 2GBNA 3EHVA 4ANXA 4EUTA 1LXDA 3L13A 4AJYB 3H1UA 2L00B 3L54A 3MTNB 1R4MI 2MBOA 2OJRA 1KM7A 1WJNA 4IW0A 1I42A 4GMVA 4NQLB 3ML8A 2BYEA 3K9PB 5TR5A 3M63B 2MQJA 4K7SA 2KWCA 4DXAB
chains in the Genus database with same CATH superfamily
1WZ3A 4M0WB 3TEYA 2ZNVC 2WHIA 3D32A 2C9WB 4HXDA 2M0AA 3NOBA 2BB6A 4ICUA 4K81A 3JW0X 4FJZA 3I63C 1CZPA 2PMVA 2WXQA 1S3SG 1TBEA 4L1BA 3PZ7A 3CWIA 1GC7A 2DYMA 2HJ1A 4TV3A 1WSPA 1TS4A 5BMIA 5H8YE 1F2RC 3VTUA 1K50A 1KRHA 3BVZA 3VFKA 3A1QB 2IZVB 3BK2A 3BVMA 5CHWA 5HHDG 1UGMA 2H89B 2Z59B 3W5UB 2BW2A 2N9XA 1NYQA 5H92C 4LCDE 3VUXA 3ZNZB 4ZRJA 3NZSA 2KJRA 4NJ7A 1CQVA 3AE6B 1L5PA 3P4SB 2LRUA 3ZO5B 4GN1A 3VR9B 3DVGY 1I35A 1LGRA 1ZXHA 2KK8A 2JVCA 3ZDTA 5DPTA 3ABVB 1OQYA 3NZ3A 3TUOA 4KGSA 3BYTB 2KQ7A 4KIKB 1BMLC 1YN5A 4KDLB 1WE6A 1ZW7A 4WJQA 1UF0A 1L6UA 1RRBA 1HEZE 5E6NA 1DOIA 3PGEA 1D5XC 3ONSA 1K51A 2MJEA 2IBIB 3DPDA 2TSSA 4NAWA 1F1HA 2WU5B 2DX5B 4WH4A 4PS8A 2MA9B 2LEKA 2KACA 4BAXA 5IO9A 3AV8A 3RULA 1K8RB 1E7PB 4UDUC 1V86A 2KX0A 5EE1A 1IYFA 2QJLA 1FNWA 2AEHA 1C4CA 4FHJA 5IAAC 5LXIB 3QWZB 1E6EB 1WGKA 2KTRB 4EEWA 1LM8B 3X23A 1MHXA 1BT0A 1MPEA 2M17A 4KVGB 2CR5A 4ZRQA 2VH2A 3A9JA 2D10A 3OJ4B 3TCAA 3H7SA 4OVVA 1D5MC 3PHWB 4LNIA 2PEAA 2WDVB 1WYGA 3HM6X 3U30A 4YSZB 2E6XA 4USAA 2EELA 4A9AA 1I7HA 2ZJDA 3A4RA 2LFIA 1KFYB 1TT5B 3ZW3A 1Y8RC 2EKEC 4ZYNA 4REZA 1Z2MA 4P1BC 3AXCA 1STEA 1WX8A 2L83A 4WWOA 1FCCC 1ACCA 4RGMA 2A4ZA 2KWUB 4JPSA 3OG5A 4ASWC 5G5HA 3CIRB 2KDFB 1L0VB 2OHFA 1UWXA 3ZYYX 2IO2B 2D3BA 3UGBB 3RNBC 1E0ZA 1ZXIA 2LD9A 4ANVA 2V3NA 4RCOA 1P9DU 3OLMD 3HRDD 4DDGD 3KW5B 3BVGA 3U8ZA 4FJVB 2KKCA 4NQKE 2KQSA 2D2QA 3PREA 4IG7B 2RDHA 4YSXB 4YSYB 1ET9A 4MM3B 3VDZA 2INNE 4RGTA 3JSVA 1ZDXA 1QOBA 1A70A 2ZEQA 4ZRKA 1ISNA 2RMMA 3N9YC 1FO4A 2BQQA 2ZZPB 5BO4B 3U52E 3R66C 3ZNID 1SGHA 2N9EB 4N58A 3EA6A 1C76A 2GLSA 4AQ7A 5EE3A 3E9SA 3S2AA 3V3XA 4KDIC 3JVZX 1TYGB 1G6JA 2BT6A 1YNTE 1D6EC 1R4NI 1UNSA 1ZUD2 3P4RB 2K25A 4OZAA 1NDDA 2JZ3B 4C4VA 2MRPA 1XLOA 2KT7A 1YD8U 2JT4B 2E3TA 1DGJA 1I4XA 1L0YB 1IGCA 1PDXA 2G3QB 5LNK1 4ARCA 3MC0B 2KLCA 2RDBC 3R2TA 4PT5A 2KDIA 4WQOB 4BVUC 2FIDA 3UI3A 2WXHA 4BFRA 1FM0D 1WE7A 1EWCA 3JSVB 2CHXA 1LQBA 1YN3A 1WM2A 3LXFA 3PV1A 5EE9A 1TZOA 4URKA 3L0WB 2NPTB 4IC7B 3SD5A 4PYZA 1SSNA 3T9LA 3MHSD 2SAKA 1M4VA 1S1QB 1LO5D 1JWSD 3ENEA 4E74A 5L95C 2RSUA 1XCQL 2NBWB 3AM9A 3LDZE 3ZNHB 4W9JA 2G9HD 2IO3B 1WR6E 1Q1OA 1FFUA 1ROEA 1AYFA 4QAYA 3QQ8B 3C19A 3UIOB 2NTSA 4TQ0A 1Z5SB 3P2BA 2DHZA 2FUHB 3V61A 1TZ1A 1WMHB 1V1PB 2KDBA 2BPSA 1OQQA 3DHIC 4DHZB 2N9PC 1SE4A 1F77A 3ZKJC 3PT2B 2V9HA 2HTHA 1YMHE 4HLEA 4OVUA 1WXAA 1FXIA 3GZNI 3QK0A 4XWTA 5BYRA 3R7QA 1V1OA 5C23A 3ZJUA 3CMMB 3WIMA 3P4PB 3H8HA 2DYBA 2DAJA 4JE3B 1WX7A 4KZCA 2CKHB 3HVZA 2N4FA 1EM7A 2WX1A 4YTPB 3PHXB 4W9KA 2J0KA 3DHHC 2ZCCA 1UBIA 1UBQA 3T3OA 2RDGA 2FUG1 4LNNA 2BS3B 1KH0A 2HD5B 3ML9A 3EHVA 1HXYD 3L13A 3L54A 2MBOA 1WJNA 3DWGC 1SB3C 1ZPSA 2BYEA 3K9PB 3M63B 2MQJA 2QC8A 2UYZB 3R7RA 4MM3A 1K52A 1EUVB 4N9F4 1HA5A 1PGBA 1RFKA 1I4PA 1WX9A 3KYDD 2JXTA 1T0QC 3AMZA 2J42A 2BF8B 3RZFA 3QX1A 4W9HA 4MELA 3KWVA 1HQRD 4W9CA 2INPE 2WXPA 3EFCA 3UQBA 1PGAA 3IT6B 2MBBB 1PGXA 2M4NA 3AEDB 4AP4C 3Q8FA 3DBHI 3PZDA 4FULA 2DNFA 1WXSA 4WIPA 3FILB 2UU7A 4M01A 3C8YA 3AULA 3KYCD 1P7EA 2AL6A 2ZVOA 2WLBA 2KYWA 3NVZA 1NI3A 3VRAB 3KUZA 4MSMB 1YN4A 4FN2A 1SF0A 1E10A 2R2OA 1GG3A 1C77A 4LNFA 1P0RA 1OGWA 1N61A 1B1ZA 3NZUA 4X57B 4OVZA 1ZOYB 1A5RA 3I57A 4C7ZA 2V4LA 1JWBD 1JRUA 2BYFA 4P6VF 3V60A 4N6EB 2B76B 1P98A 1RAXA 1F2RI 2WXRA 2MH7A 4I6PA 3NG0A 5JZEB 4MH0E 2MWSB 1QOAA 4A55A 1TKEA 2WX0A 3CF6E 1C79A 3EECA 1WIAA 2IY1B 4HK2A 2GBRA 2W3RA 4NJ6A 5FKAC 1N62A 2O6VA 4CHKA 1AARA 3ZUNA 3TBLD 2CHZA 4DXGA 2JYTA 4FHKA 1WGHA 1R4NB 3O13A 1J19A 2WDTB 3VXWA 3PSEB 4ICVA 3EGRA 2BWFA 2JZPA 1J7BA 4HPMB 3DBRI 2KVZA 3P42A 4Q2JA 3AU4A 3VUWA 2L8JA 4MJSB 5MPOA 4YWGG 2N1VA 3GE3C 4HPPA 1WZ0A 3R8BA 1J7AA 2C7HA 3RMKC 2QEJC 1MFWA 5AUIA 4LJOB 2KNBA 1IUEA 3VH4B 2KXJA 1CJEA 2K6QA 3DVNU 3O65B 4BOZB 3WCQA 1VR9A 3WAMA 2YEPF 1PFDA 4K3CA 4LLGM 1ESFA 1JRPA 1L2NA 5IP4D 2LXAA 3NY5A 1UD7A 5BYQA 3PS6A 1WH3A 3FC4A 3UINB 4NAWB 2D07B 2LUMA 4NNJB 2LMCA 2FAZA 1EU3A 3DCGA 4CQNA 4KSKC 2WNMA 2O2VB 2JUOA 3CSTA 2RPQA 1XT9B 3IVFA 1FMAD 4DHJB 2KZRA 1WXVA 2WDRB 4K1RB 5T8IA 2WQYB 4W9LA 4JWSC 2REXA 2JRHA 1WGGA 2DYOA 4FBJB 2KTRA 1T0RC 2YEPB 3AB5A 1V80A 2AX5A 2V3PA 2FNJB 3WANA 4E71A 1C9FA 4KKIA 3KLSX 2IY0B 4ZRIA 1QZEA 1KLVA 2JWZA 2DBYA 2FCNA 2ACZB 4JIOU 4HRSA 3VQIA 1RM6C 3NJTA 4W9IA 2LASA 3AEEB 3QHTA 4PS3A 3FILA 3AE2B 1SE3A 2WXJA 2WU2B 4FADA 2QILA 1HTQA 2KMCA 4BZAA 2N1WA 3WAOA 3HIZA 1TS5A 2VZKD 2L0TA 2LHEA 2KMMA 2XK5B 3MP9A 2L32A 4XDDA 1V9JA 1OEYA 3A9KA 5CHVC 1H4RA 4A3PA 1SIJA 2PLPA 1YX6B 1XCTL 2ZPNA 2FCMA 3Q3OC 1QLBB 1E90A 5AZFA 1T5XD 4PYUA 2KLGA 4HJGE 3JYUA 2WXLA 3LJ3A 3RNGC 2XBBC 2KOXA 1WJ4A 2JU6X 3E56A 4IM2A 4MGKE 2V4IB 4GDKA 3QCAA 3Q8AA 3HHMA 2L05A 2BWES 4MH8A 3AE3B 1TKYA 2KN5A 4AWJA 4D2KA 4IWQA 4TKNA 5E6PA 3ZDMC 3L17A 5DPWA 1J8CA 1KLGD 1ZE3D 3H7PB 1M94A 4NY0A 3OAWA 1WJUA 2L7RA 4LJPB 3TEZA 2QMTA 3FKYA 1UELA 3P1MA 2OJWA 4XZ4A 4MGIE 1YJIA 4JL9A 5HKHA 1GNUA 2WYQA 3RN9C 5D3IB 4KSLC 3KUCB 2NMQA 2Y5CA 3TEWA 4W9GA 2LGYA 3B0AA 1QT9A 2DZMA 2WP9B 2K5PA 3QARA 3LYYA 2PVGC 4E3CA 2IGHA 3B9JA 1WMHA 2XN9C 3R2IA 4RF1A 1ZKHA 1UUPA 3MC9A 3GS2A 4P7IA 2KDEB 3U7ZA 4GGQA 1DOYA 2KN4A 3PO0A 2O6VD 4JLCA 1E8ZA 4MEMA 2AL3A 4B0MA 4L2YA 2N7JA 5D7GA 5IA7A 1VJKA 4MDKE 4I6NB 2LGDA 4ANUA 3L4PA 3MJ5A 2AYOB 3PVLA 5JHBA 1XLNA 2MW5A 3AE1B 1VZ7A 1XO3A 2JXXA 1SE2A 1WXQA 1VZ8A 2IO1B 1UWMA 3SEBA 4DWFA 3N32A 4US8A 4ITKA 1OQRA 3L08A 4M8NA 1E5WA 2JQRB 5KHOA 1T0SC 4XDCA 2K0PA 1EO6A 2L76A 1C3TA 1JQ4A 1V2YA 2MBEA 2JX5A 3AH7A 2L52A 2JF5A 3W1YA 4ZHPA 3AE5B 3ZGZA 1ZDVA 2KHWB 3ZTDA 5AUKA 1Y56A 4F8CB 3KH0A 3SFDB 3KVFB 2K39A 3IHPC 3RD2A 3PZ8A 2GBNA 2ON8A 3DWMA 4AJYB 1T3QA 4US9A 1KM7A 4TMAB 5TR5A 2KWCA 4S0RA 2ZW0A 3ZIMA 1V6EA 2WXIA 3I9V1 4EKUA 1L4ZB 3UQAA 1B9RA 4BKTA 1XD3B 1UGJA 3W1SC 2RR9A 4C00A 4RFBA 3ZRCA 2AWTA 4K3BA 2UWQA 2DZJA 4RM9A 2I1JA 3APCA 3HK0A 2IGGA 1VLBA 2V1YA 1D4BA 3Q3FA 2BKFA 2Y5BB 4RMAA 5D3DA 2FCSA 4HDOA 4NZLB 5FR6A 1VZ6A 2LUEA 3P63A 1D3ZA 2Z8LA 3VVWB 5JHAA 4XWWA 3RCZA 1LFDA 1JROA 3BWUD 1SBBB 2N0SB 1C4AA 1GB1A 4M02A 1T6BX 2J4XA 3KWLA 5G2NA 3M62B 3VAWA 3BYYB 3Q3MC 4ACFA 3W1SA 3X0WA 2BYTA 4NAMA 4WAFA 3Q6BA 2QHOA 2Y3AA 2WGSA 4KZ0A 2QSDA 4EZJA 2KX3A 2D3CA 5J2RA 3TJPA 2FCQA 2CU1A 5C3JB 3PRZA 2BB5A 1WR1A 1NEKB 1C78A 1WM3A 1I4HA 5AZHA 2RPVA 3T8MA 5L83A 1AWDA 3TMPB 1EU4A 4I6LB 3A4SC 3P4QB 2K3UA 4II3B 2ASQA 3ZTCA 3K9OB 3AE7B 1TY0A 1EWYC 3VH3B 1XLQA 3ZRFA 4YL8A 2HE7A 3L16A 1PQSA 2NS5A 1OTRB 1XLPA 3QC8B 3B2FA 2KAJA 4DHZE 1QILA 4FLHA 4HWIB 4GDKB 1RWSA 3Q2AC 4MGZE 1NVID 3DBSA 5BMGA 3DQVA 4ZDVA 2CJOA 3GB1A 3W5VB 1V5OA 4BKSD 2PW9A 2G4DB 1YJJA 1FNUA 3AE8B 2HJ8A 4KKJA 1GJZA 3QJZA 3AN1A 2LGIA 3ZXVA 4M0WA 4YTNB 2QCZA 2NBVB 2J0JA 2OEDA 3HUIA 2C7NB 4M8MA 1ET6A 3B2GA 4CYEA 1MI0A 1WGRA 3NVVA 4KIKA 3C0RB 2JPHA 4RF0A 1FIQA 4R3DA 4WURA 2PJHA 3GP7A 2B3AA 2MP2A 2INCC 3ZJVA 4K7WA 5D6JB 2VH1A 2ZNVB 4KV2A 3AU5A 2KTFA 2DAFA 5CHFA 3ECIA 2KJHB 2YVCA 2MBHA 4OZBA 3MC8A 2KFJA 1J7CA 2BVCA 3PTFC 2GBMA 3Q8BA 1L4DB 1VRAB 2IJ0A 4A20A 1E8WA 2K8CA 3NUHB 4IM3A 2L1AA 3DHGC 1FD6A 4WJOA 4LK0M 2X38A 1HE8A 2MSED 2WS3B 3Q14C 3B1LX 2NCNA 1JWMD 2GMIC 5IN7A 2VZKB 1YJ1A 2CS4A 4NJCA 4GDLB 1Q10A 1N5WA 2NR2A 1OFFA 1Q0WB 2KFKB 2W55A 3VR8B 1V1PA 3AEAB 4EFOA 3IXSA 3N30A 1F52A 4IOIE 4DQOC 2AQ1B 1ZGUB 1BUIC 2DLBA 2KDMA 1WY8A 5FR3A 1RLFA 5AZGA 4GIVA 3EFUA 4HCPB 3WALA 2EKIA 2QIEB 4P1CC 1XF5L 3U4EG 4RH6A 2RD0A 3RZWC 2J7QB 1WRIA 2NPTA 4ZHOA 2NBUA 4HPLB 2PKOA 3BZDB 1WJ6A 2G4SA 3GZNB 1FXAA 4RGNA 1JCKB 2DZKA 1E7UA 1I4RA 1GC6A 3Q3NC 1V49A 4OHJA 2Z0DB 1U4AA 3ZXRA 4BKSA 2AQ3B 3LB8C 3OJ3A 4HROA 2CHWA 3NRZA 4W9DA 2MCNB 5C1ZA 2C7MB 1R4MB 1NYRA 4IKGA 1YQ4B 4CO7A 3BIID 3KUDB 4HJKA 2I38A 4W9FA 3RPFC 1KOTA 1I4QA 3OWEB 1E7VA 1PYWD 3ZNGC 2WXGA 5HFYA 1P3QU 2KVRA 1KLUD 4HKZE 4ZYSA 2BS4B 1IGDA 2K9XA 4HEA1 5JXVA 4GLSC 1AW7A 2H88B 3ALBA 2CJNA 2DWQA 4XE0A 4LNOA 3N3KB 2WXFA 2K8BA 4B95A 5J18A 1EF1A 2LGSA 1DOXA 4GDLA 2BS2B 2QDFA 4DK5A 3PRPB 1XXGA 3DBLI 4MSQB 2RGFA 4HDQA 2GB1A 3AI5A 1V5TA 3APFA 3AE9B 3RT3B 1JW9D 1J0GA 1IBXA 2MX2A 1BXTA 3AEBB 4XGAB 5CX3A 3RYTA 2W3SA 2I1KA 3N1YC 4TSSA 2Y5PA 1P7FA 2JZZA 4WJNA 5CTRC 1VD2A 3IFWB 1YX5B 3SDLC 2GBJA 3AEGB 3W2DA 4JQWC 3GOEA 2D5GA 4BKGA 2LRWA 4S17A 1FRRA 4AJWA 4FA6A 2R61A 1MVKA 2GI9A 3VHTC 3NS8A 2MBQA 4WWPA 3Q3JA 1WFYA 2BKRB 2LWPA 4F7ZA 1JMLA 1X1MA 2GRIA 5DPRA 5I4DA 3VUYA 4A8XC 3Q69A 1TS3A 4FXCA 3HM3A 2KO3A 1E8XA 3A9KB 5IOIA 4WQMA 4ANXA 1GB4A 3AE4B 3MTNB 2L00B 1R4MI 4OZCA 3DBHB 4NQLB 4MACA 3MHZA 2KANA 2KJ6A 2Z0EB 5G55A 1TIFA 3Q8CA 4JGHB 3ZQ4A 4A3OA 2BBCA 2MEKA 2LGXA 2L3ZA 1KF6B 2V0GA 1WWTA 4ZRPA 2FIFA 3BY4B 1D5ZC 4XC2A 4IM0A 2C60A 3DBLB 1F0ZA 1XQQA 3T3NA 5EE0A 3TSSA 1JALA 1FFVA 2XEWA 2LJIA 4A6QA 2R2QA 1MJDA 1FEHA 2J0MA 2YLMA 5GMVA 3ZJTA 4NPNA 3TEXA 1WGYA 3DBRB 2IPKD 1DYQA 2O2VA 4WWMA 2KC1A 2PVOD 2XNAC 1N63A 5EDSA 5BMHA 5LXHA 4JX1C 4WJPA 3DVGX 1E8YA 1TGZB 2ICIA 4FJYA 2XK5A 1QOGA 5J17A 1H8CA 4O1NA 3ETRA 5JH5C 2O6VB 4MGYE 4MT5A 4PK1A 1RFAA 4N59A 2M1MA 1FNVA 2ZVNA 3VTWA 1SXTA 2N9LA 3QAQA 3Q8EA 2OOBB 4LDTB 3TL5A 2D3GA 3NS1A 1V81A 4C7YA 2LVOA 3B08A 3IG3A 4MJSA 1WI0A 1HZ5A 4AOFA 5D2MB 4PS7A 3RNAC 3RI7C 2N7DA 4RM8A 2KWDA 4GOCA 2G45B 3NVYA 2VRRB 3N1ZC 5FK9C 3U7DA 2FE8A 1QKZA 4G0NB 2IYDB 4BBNC 2ZPYA 4ZOHC 2GOWA 4YTMB 1F9JA 2WXOA 2LJ5A 3APDA 1YIWA 5C2TB 4OW0A 5E6JA 4EOYA 5BYSA 2PPHA 2K22A 4RNAA 1QF6A 4J3OD 2AQ2B 2WXMA 2W9NA 3AECB 3IAM1 1HTOA 1V97A 3RNFC 3AEFB 3MFGA 2J53A 3URYA 2LZ6A 2MLBA 1IP9A 2W54A 4YXDB 1MHHE 2PE6B 1SE9A 3V6EB 2LI5A 3RNCC 1VCBA 4GXBA 4EE2A 4BBNF 3V05A 3SR6A 2MJ3A 2WXKA 1XEEA 4HVBA 2INDC 4IDIA 4XX5A 4C80A 2BYVE 4DDID 2KFKA 3J9CA 1WXMA 3UIPB 2K6DB 4F1SA 1FRDA 3TIXA 2I2YA 3GE8C 3M95A 3R3MA 1SJED 4KX6B 1TTNA 2KQ4X 2LVPA 1GUAB 1TJEA 1C4PA 2MP2B 4IUMB 5LLIA 2JWUA 1KJTA 1R7SA 3V6CB 3I3TB 1YQBA 3N1XC 1I4GA 1Q5WB 1TY2A 3HVDA 4WWNA 3IBEA 3QIJA 3W9CB 3IAS1 3N20C 1TKGA 2JRIB 4KGTA 2NVUI 4G50A 1L6VA 3PRMB 4GU2A 1C1YB 1QQRA 3RUIB 4AUQC 1NI2A 2BTEA 5HG2A 3M3JA 2LVQA 4B6WA 2K8HA 1YOVB 2ONQA 4TUUA 2M8SA 3U2SC 1PUTA 5HI1A 1YQ3B 3ZVVA 1L7YA 2IO0B 4RGOS 2BGFA 2Q5WD 4M00A 5G5GA 3WA0A 2SEBD 2WDQB 1FPYA 1NBFC 4K7UA 2A5UA 2CU3A 4XYCA 1ENFA 2L0FA 3VRBB 2WXNA 4EZKA 1KTKA 1WGDA 5GXGB 5E6OA 1MG8A 4ARIA 1EF5A 4G3XB 4LNKA 3H7PA 2EMSA 3H6NA 3IT4B 2KD0A 1N60A 1K53A 1HZ6A 1IPGA 2M56B 3PLUA 1GAQB 3I5JC 3SFEB 2EMTA 3RNEC 4WAAA 2KC2A 2WWZA 5KHQA 2W82A 4DXFA 2M19A 3MJWA 2J52A 4KGRA 4II2B 4YT0B 1UH6A 2MHJA 1AN8A 3L10B 4GSWA 2D11A 2K1FA 1P1AA 1WRDB 3WAPA 4H2AA 1RYJA 5D94A 5TSSA 2DZIA 1E9MA 2KMAA 5IKCM 3PLVA 2GBKA 4W9EA 1L0XB 1FXTB 1TS2A 2LXCA 4HCNB 1FCLA 2C5LC 3ZLZA 2PTLA 2G1EA 3DVNV 3A1QA 2M0XA 2JYEA 2N9KA 2JY6A 4LTUA 2MJDA 4BOSC 4LDTD 4P16A 1OEYJ 3KQ4A 2PE9A 3A9JB 2DENB 3UF8A 2IGDA 3H9DA 1SIFA 3CSFA 4TQ1A 2D3AA 4B9KA 1SJHD 4C56C 4AS1A 1UZXB 3QA8A 1CMXB 1WF9A 1ZP0B 5AEKB 4ANWA 3SU8X 1QOFA 2KWVB 1VDVA 1GOZA 4JWUC 5DCNA 1N5XA 4J6IA 4L23A 3DDCB 4DBGA 2HTME 1CK1A 3BINA 2HDEA 3FAHA 4C4VB 2ZW1A 4G11A 2ZCBA 1SEBD 4DHJD 3NHEB 4IWPA 2N7EA 4A90A 3EUB2 3PPAA 3V62A 3BK1A 2NTTA 4IWOA 2LHDA 4EZLA 1V8CA 1IBXB 1T0YA 2V3SA 3RFZB 4GB9A 1WYWB 2X8XX 1MG4A 1JWUD 1JWAD 5DPSA 3SHQA 3A33B 3DOWA 4B0EA 3EC8A 2FBWB 3VTVA 4HKQA 1NENB 4EUTA 1LXDA 3H1UA 1GPXA 2OJRA 2PIAA 4IW0A 2IDYA 1I42A 4GMVA 3ML8A 2JSVX 4K7SA 1N6ZA 3NVWA 4DXAB
chains in the Genus database with same CATH topology
2KANA 2KJ6A 2UYZB 3ZIMA 1V6EA 3R7RA 4MM3A 2Z0EB 1EUVB 1WZ3A 4EKUA 4N9F4 4M0WB 3UQAA 5G55A 4JGHB 4A3OA 4BKTA 2ZNVC 1XD3B 1WX9A 3W1SC 3D32A 3KYDD 2C9WB 2LGXA 2RR9A 2L3ZA 4HXDA 3ZRCA 2AWTA 2UWQA 2FIFA 2BF8B 3RZFA 2DZJA 4RM9A 3BY4B 4XC2A 4IM0A 2C60A 3NOBA 2I1JA 3QX1A 1XQQA 3APCA 4W9HA 3HK0A 4MELA 4W9CA 2V1YA 4ICUA 3JW0X 4K81A 4DDID 3UQBA 4FJZA 3Q3FA 2BKFA 2Y5BB 2XEWA 4RMAA 1S3SG 2MBBB 2FCSA 1TBEA 2M4NA 1GC7A 2DYMA 4AP4C 2R2QA 4HDOA 4TV3A 3DBHI 3PZDA 2J0MA 2YLMA 4FULA 5GMVA 4NPNA 1WGYA 1WXSA 5FR6A 2LUEA 3VTUA 3VFKA 3A1QB 1D3ZA 2O2VA 3VVWB 5JHAA 3RCZA 2KC1A 2IZVB 3AULA 5CHWA 5EDSA 1LFDA 1UGMA 5LXHA 3KYCD 4WJPA 5G2NA 3DVGX 3M62B 1E8YA 2AL6A 1TGZB 2Z59B 2N9XA 2ZVOA 4FJYA 3VAWA 2XK5A 5J17A 1H8CA 4LCDE 3VUXA 5JH5C 2O6VB 4MGYE 3ZNZB 3W1SA 3X0WA 4ZRJA 3NZSA 2KJRA 4NJ7A 3KUZA 4MSMB 2QHOA 1RFAA 4FN2A 2R2OA 2LRUA 3ZO5B 1GG3A 4GN1A 4KZ0A 2M1MA 4EZJA 3DVGY 1P0RA 1OGWA 2KX3A 1I35A 2ZVNA 3VTWA 2KK8A 5J2RA 2JVCA 3TJPA 2FCQA 2CU1A 3ZDTA 3NZUA 3QAQA 3PRZA 2OOBB 5DPTA 4X57B 1OQYA 1A5RA 4LDTB 3TL5A 1WR1A 1WM3A 2D3GA 2V4LA 5AZHA 5L83A 3T8MA 1V81A 1JRUA 2BYFA 2LVOA 3V60A 2KQ7A 3B08A 3TMPB 4KIKB 3IG3A 4KDLB 4MJSA 4I6LB 1P98A 1RAXA 1WE6A 1ZW7A 1WI0A 3A4SC 4AOFA 4II3B 4WJQA 5D2MB 2ASQA 4I6PA 3ZTCA 3K9OB 4PS7A 5JZEB 1RRBA 4MH0E 2MWSB 5E6NA 3VH3B 3ZRFA 2N7DA 4YL8A 2HE7A 4RM8A 2WX0A 3L16A 4GOCA 2G45B 3CF6E 1PQSA 2NS5A 3EECA 1WIAA 3PGEA 1OTRB 2IY1B 4HK2A 3QC8B 2GBRA 2VRRB 3U7DA 4DHZE 4FLHA 4HWIB 4NJ6A 4GDKB 2O6VA 3ONSA 4G0NB 2IYDB 4CHKA 1AARA 4BBNC 4MGZE 2ZPYA 3ZUNA 3TBLD 2IBIB 2CHZA 2GOWA 1F9JA 3DPDA 3DBSA 4FHKA 1WGHA 4NAWA 2LJ5A 3APDA 3DQVA 1YIWA 4ZDVA 1J19A 2WDTB 1V5OA 3VXWA 4BKSD 3PSEB 4ICVA 2BWFA 2G4DB 2DX5B 2HJ8A 4EOYA 4PS8A 1GJZA 3QJZA 2MA9B 4HPMB 3DBRI 2PPHA 3RULA 2NBVB 2J0JA 3AU4A 1K8RB 3VUWA 2L8JA 2C7NB 4M8MA 1V86A 2KX0A 4MJSB 1IYFA 2W9NA 2AEHA 2N1VA 1WZ0A 4CYEA 1WGRA 2C7HA 4FHJA 5IAAC 5LXIB 4KIKA 3QWZB 3C0RB 4LJOB 2KNBA 2JPHA 2KTRB 3VH4B 4EEWA 2KXJA 1LM8B 2K6QA 2LZ6A 2MLBA 3DVNU 3O65B 3X23A 4BOZB 1IP9A 2PE6B 1SE9A 1BT0A 3WAMA 2M17A 4KVGB 3V6EB 2LI5A 1VCBA 2CR5A 4GXBA 4BBNF 2PJHA 1L2NA 2B3AA 2D10A 3A9JA 3OJ4B 3TCAA 2MP2A 3H7SA 4HVBA 4OVVA 2LXAA 3NY5A 1UD7A 4K7WA 5D6JB 3PS6A 2ZNVB 4KV2A 1WH3A 3PHWB 4XX5A 2BYVE 2PEAA 4NAWB 2KFKA 2KTFA 2DAFA 1WXMA 2D07B 3AU5A 3HM6X 4NNJB 3UIPB 5CHFA 2FAZA 3ECIA 3U30A 2K6DB 2KJHB 4F1SA 3DCGA 4KSKC 2YVCA 3TIXA 2MBHA 2ZJDA 3A4RA 2O2VB 3M95A 2JUOA 2KFJA 3R3MA 3PTFC 3CSTA 2GBMA 1Y8RC 2RPQA 3ZW3A 1XT9B 1TTNA 3IVFA 2EKEC 2LVPA 4DHJB 1GUAB 4ZYNA 1Z2MA 2KZRA 2MP2B 4IUMB 5LLIA 1WXVA 4A20A 1E8WA 3AXCA 1KJTA 2K8CA 4IM3A 4K1RB 3V6CB 3I3TB 1YQBA 1WX8A 4WWOA 1Q5WB 4WJOA 2A4ZA 4W9LA 1HE8A 2MSED 4WWNA 2KWUB 2JRHA 2NCNA 2REXA 3B1LX 3IBEA 3QIJA 1WGGA 4ASWC 2GMIC 2DYOA 4FBJB 2KTRA 2KDFB 1YJ1A 3UINB 1V80A 2JRIB 2CS4A 2NVUI 4G50A 2FNJB 2IO2B 3WANA 4E71A 3UGBB 4GDLB 2IY0B 4ZRIA 2LD9A 3PRMB 1C1YB 4GU2A 1QZEA 3RUIB 4AUQC 1NI2A 2NR2A 4ANVA 1KLVA 2JWZA 1Q0WB 2FCNA 2KFKB 3M3JA 1P9DU 2LVQA 3OLMD 4JIOU 3VQIA 4B6WA 2K8HA 3KW5B 4DDGD 4W9IA 4TUUA 2M8SA 2LASA 3QHTA 4PS3A 4FJVB 2KKCA 3U8ZA 3ZVVA 4EFOA 1L7YA 4NQKE 2KQSA 2IO0B 3N30A 2D2QA 3PREA 4IG7B 2BGFA 3WA0A 4FADA 1ZGUB 2KMCA 1NBFC 4K7UA 2A5UA 2N1WA 3WAOA 3HIZA 1WY8A 2L0FA 1RLFA 2L0TA 5AZGA 4GIVA 3EFUA 4HCPB 4EZKA 2XK5B 3VDZA 3WALA 1WGDA 3JSVA 1V9JA 1OEYA 5E6OA 3A9KA 1MG8A 5CHVC 1H4RA 1EF5A 4G3XB 2ZEQA 4A3PA 4ZRKA 1ISNA 2EMSA 3H7PA 2RD0A 3H6NA 3RZWC 1YX6B 2J7QB 2ZZPB 2KD0A 5BO4B 2NPTA 2NBUA 2ZPNA 2FCMA 4HPLB 3R66C 3ZNID 1SGHA 1IPGA 1E90A 2N9EB 5AZFA 1WJ6A 2G4SA 3PLUA 4PYUA 2KLGA 2EMTA 5KHQA 4WAAA 2KC2A 2WWZA 3MJWA 3JYUA 3S2AA 4II2B 3LJ3A 2DZKA 2XBBC 1E7UA 1WJ4A 2KOXA 4KDIC 1UH6A 1GC6A 3JVZX 4IM2A 1V49A 4MGKE 1G6JA 1R4NI 4GDKA 3QCAA 2Z0DB 1U4AA 3HHMA 3L10B 2L05A 2K25A 4BKSA 2BWES 1NDDA 2JZ3B 2MRPA 2KN5A 4GSWA 2D11A 4AWJA 2K1FA 3OJ3A 1P1AA 1YD8U 1WRDB 3WAPA 4IWQA 4TKNA 2CHWA 2JT4B 5D94A 5E6PA 3ZDMC 4W9DA 2MCNB 5C1ZA 2DZIA 2KMAA 2C7MB 2G3QB 3PLVA 3L17A 2GBKA 4W9EA 4CO7A 1FXTB 5DPWA 1J8CA 2KLCA 3KUDB 3H7PB 1M94A 2LXCA 4HJKA 4NY0A 3OAWA 1WJUA 4HCNB 2C5LC 3ZLZA 2KDIA 4WQOB 2L7RA 4W9FA 4BVUC 4LJPB 1KOTA 2FIDA 4BFRA 3DVNV 1WE7A 3A1QA 2M0XA 1UELA 4XZ4A 3JSVB 2CHXA 1E7VA 4MGIE 2JY6A 3ZNGC 4JL9A 1LQBA 5HKHA 4BOSC 1WM2A 1GNUA 2WYQA 1P3QU 2KVRA 4LDTD 3PV1A 4KSLC 3KUCB 1OEYJ 4W9GA 2LGYA 3B0AA 4URKA 2PE9A 2DZMA 3L0WB 3A9JB 2NPTB 2DENB 3QARA 4IC7B 3UF8A 4E3CA 3SD5A 1WMHA 4PYZA 3T9LA 3MHSD 3ALBA 3H9DA 1S1QB 1SIFA 3CSFA 4TQ1A 4B9KA 1ZKHA 3ENEA 4E74A 5L95C 2RSUA 1UZXB 3QA8A 1CMXB 1WF9A 3N3KB 4P7IA 2NBWB 2K8BA 2KDEB 4B95A 4ANWA 5AEKB 1EF1A 5J18A 4GGQA 3LDZE 4GDLA 3ZNHB 4W9JA 4DK5A 2O6VD 3PRPB 4JLCA 3SU8X 2IO3B 1WR6E 1Q1OA 1E8ZA 4MEMA 3DBLI 2AL3A 4MSQB 2KWVB 2RGFA 5DCNA 4HDQA 4J6IA 3QQ8B 5D7GA 3DDCB 3UIOB 5IA7A 4DBGA 4TQ0A 4MDKE 3AI5A 1Z5SB 3P2BA 2DHZA 3BINA 4I6NB 2LGDA 1V5TA 3APFA 4ANUA 3RT3B 2FUHB 3V61A 1J0GA 1TZ1A 2MX2A 2AYOB 1WMHB 3PVLA 5JHBA 5CX3A 4G11A 2KDBA 2BPSA 2MW5A 2JXXA 2ZCBA 4DHZB 3RYTA 2N9PC 4DHJD 3NHEB 2I1KA 4IWPA 2N7EA 2IO1B 3ZKJC 3PT2B 3PPAA 2JZZA 3V62A 4WJNA 2HTHA 5CTRC 4DWFA 1VD2A 4HLEA 3IFWB 4OVUA 3N32A 1YX5B 1WXAA 3GZNI 3L08A 3QK0A 3SDLC 3R7QA 4M8NA 1E5WA 2GBJA 5C23A 4IWOA 5KHOA 3CMMB 4JQWC 3GOEA 4EZLA 1EO6A 2L76A 2LRWA 3WIMA 4BKGA 1C3TA 1T0YA 1V2YA 2V3SA 4AJWA 4FA6A 3VHTC 2DYBA 2DAJA 2MBEA 4GB9A 3NS8A 1WX7A 1WYWB 2MBQA 3Q3JA 4KZCA 4WWPA 2CKHB 2N4FA 2WX1A 1WFYA 2BKRB 2JF5A 3PHXB 3W1YA 2LWPA 4W9KA 5DPSA 3SHQA 4F7ZA 2J0KA 1X1MA 5DPRA 2ZCCA 1UBIA 3VUYA 1UBQA 3A33B 2KHWB 3ZTDA 3DOWA 3EC8A 4F8CB 2HD5B 3KH0A 3HM3A 3ML9A 2KO3A 1E8XA 3A9KB 3KVFB 2K39A 3IHPC 3RD2A 3VTVA 2GBNA 3EHVA 4ANXA 4EUTA 1LXDA 3L13A 4AJYB 3H1UA 2L00B 3L54A 3MTNB 1R4MI 2MBOA 2OJRA 1KM7A 1WJNA 4IW0A 1I42A 4GMVA 4NQLB 3ML8A 2BYEA 3K9PB 5TR5A 3M63B 2MQJA 4K7SA 2KWCA 4DXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAN A;  2KJ6 A;  2UYZ B;  3ZIM A;  1V6E A;  3R7R A;  4MM3 A;  2Z0E B;  1EUV B;  1WZ3 A;  4EKU A;  4N9F 4;  4M0W B;  3UQA A;  5G55 A;  4JGH B;  4A3O A;  4BKT A;  2ZNV C;  1XD3 B;  1WX9 A;  3W1S C;  3D32 A;  3KYD D;  2C9W B;  2LGX A;  2RR9 A;  2L3Z A;  4HXD A;  3ZRC A;  2AWT A;  2UWQ A;  2FIF A;  2BF8 B;  3RZF A;  2DZJ A;  4RM9 A;  3BY4 B;  4XC2 A;  4IM0 A;  2C60 A;  3NOB A;  2I1J A;  3QX1 A;  1XQQ A;  3APC A;  4W9H A;  3HK0 A;  4MEL A;  4W9C A;  2V1Y A;  4ICU A;  3JW0 X;  4K81 A;  4DDI D;  3UQB A;  4FJZ A;  3Q3F A;  2BKF A;  2Y5B B;  2XEW A;  4RMA A;  1S3S G;  2MBB B;  2FCS A;  1TBE A;  2M4N A;  1GC7 A;  2DYM A;  4AP4 C;  2R2Q A;  4HDO A;  4TV3 A;  3DBH I;  3PZD A;  2J0M A;  2YLM A;  4FUL A;  5GMV A;  4NPN A;  1WGY A;  1WXS A;  5FR6 A;  2LUE A;  3VTU A;  3VFK A;  3A1Q B;  1D3Z A;  2O2V A;  3VVW B;  5JHA A;  3RCZ A;  2KC1 A;  2IZV B;  3AUL A;  5CHW A;  5EDS A;  1LFD A;  1UGM A;  5LXH A;  3KYC D;  4WJP A;  5G2N A;  3DVG X;  3M62 B;  1E8Y A;  2AL6 A;  1TGZ B;  2Z59 B;  2N9X A;  2ZVO A;  4FJY A;  3VAW A;  2XK5 A;  5J17 A;  1H8C A;  4LCD E;  3VUX A;  5JH5 C;  2O6V B;  4MGY E;  3ZNZ B;  3W1S A;  3X0W A;  4ZRJ A;  3NZS A;  2KJR A;  4NJ7 A;  3KUZ A;  4MSM B;  2QHO A;  1RFA A;  4FN2 A;  2R2O A;  2LRU A;  3ZO5 B;  1GG3 A;  4GN1 A;  4KZ0 A;  2M1M A;  4EZJ A;  3DVG Y;  1P0R A;  1OGW A;  2KX3 A;  1I35 A;  2ZVN A;  3VTW A;  2KK8 A;  5J2R A;  2JVC A;  3TJP A;  2FCQ A;  2CU1 A;  3ZDT A;  3NZU A;  3QAQ A;  3PRZ A;  2OOB B;  5DPT A;  4X57 B;  1OQY A;  1A5R A;  4LDT B;  3TL5 A;  1WR1 A;  1WM3 A;  2D3G A;  2V4L A;  5AZH A;  5L83 A;  3T8M A;  1V81 A;  1JRU A;  2BYF A;  2LVO A;  3V60 A;  2KQ7 A;  3B08 A;  3TMP B;  4KIK B;  3IG3 A;  4KDL B;  4MJS A;  4I6L B;  1P98 A;  1RAX A;  1WE6 A;  1ZW7 A;  1WI0 A;  3A4S C;  4AOF A;  4II3 B;  4WJQ A;  5D2M B;  2ASQ A;  4I6P A;  3ZTC A;  3K9O B;  4PS7 A;  5JZE B;  1RRB A;  4MH0 E;  2MWS B;  5E6N A;  3VH3 B;  3ZRF A;  2N7D A;  4YL8 A;  2HE7 A;  4RM8 A;  2WX0 A;  3L16 A;  4GOC A;  2G45 B;  3CF6 E;  1PQS A;  2NS5 A;  3EEC A;  1WIA A;  3PGE A;  1OTR B;  2IY1 B;  4HK2 A;  3QC8 B;  2GBR A;  2VRR B;  3U7D A;  4DHZ E;  4FLH A;  4HWI B;  4NJ6 A;  4GDK B;  2O6V A;  3ONS A;  4G0N B;  2IYD B;  4CHK A;  1AAR A;  4BBN C;  4MGZ E;  2ZPY A;  3ZUN A;  3TBL D;  2IBI B;  2CHZ A;  2GOW A;  1F9J A;  3DPD A;  3DBS A;  4FHK A;  1WGH A;  4NAW A;  2LJ5 A;  3APD A;  3DQV A;  1YIW A;  4ZDV A;  1J19 A;  2WDT B;  1V5O A;  3VXW A;  4BKS D;  3PSE B;  4ICV A;  2BWF A;  2G4D B;  2DX5 B;  2HJ8 A;  4EOY A;  4PS8 A;  1GJZ A;  3QJZ A;  2MA9 B;  4HPM B;  3DBR I;  2PPH A;  3RUL A;  2NBV B;  2J0J A;  3AU4 A;  1K8R B;  3VUW A;  2L8J A;  2C7N B;  4M8M A;  1V86 A;  2KX0 A;  4MJS B;  1IYF A;  2W9N A;  2AEH A;  2N1V A;  1WZ0 A;  4CYE A;  1WGR A;  2C7H A;  4FHJ A;  5IAA C;  5LXI B;  4KIK A;  3QWZ B;  3C0R B;  4LJO B;  2KNB A;  2JPH A;  2KTR B;  3VH4 B;  4EEW A;  2KXJ A;  1LM8 B;  2K6Q A;  2LZ6 A;  2MLB A;  3DVN U;  3O65 B;  3X23 A;  4BOZ B;  1IP9 A;  2PE6 B;  1SE9 A;  1BT0 A;  3WAM A;  2M17 A;  4KVG B;  3V6E B;  2LI5 A;  1VCB A;  2CR5 A;  4GXB A;  4BBN F;  2PJH A;  1L2N A;  2B3A A;  2D10 A;  3A9J A;  3OJ4 B;  3TCA A;  2MP2 A;  3H7S A;  4HVB A;  4OVV A;  2LXA A;  3NY5 A;  1UD7 A;  4K7W A;  5D6J B;  3PS6 A;  2ZNV B;  4KV2 A;  1WH3 A;  3PHW B;  4XX5 A;  2BYV E;  2PEA A;  4NAW B;  2KFK A;  2KTF A;  2DAF A;  1WXM A;  2D07 B;  3AU5 A;  3HM6 X;  4NNJ B;  3UIP B;  5CHF A;  2FAZ A;  3ECI A;  3U30 A;  2K6D B;  2KJH B;  4F1S A;  3DCG A;  4KSK C;  2YVC A;  3TIX A;  2MBH A;  2ZJD A;  3A4R A;  2O2V B;  3M95 A;  2JUO A;  2KFJ A;  3R3M A;  3PTF C;  3CST A;  2GBM A;  1Y8R C;  2RPQ A;  3ZW3 A;  1XT9 B;  1TTN A;  3IVF A;  2EKE C;  2LVP A;  4DHJ B;  1GUA B;  4ZYN A;  1Z2M A;  2KZR A;  2MP2 B;  4IUM B;  5LLI A;  1WXV A;  4A20 A;  1E8W A;  3AXC A;  1KJT A;  2K8C A;  4IM3 A;  4K1R B;  3V6C B;  3I3T B;  1YQB A;  1WX8 A;  4WWO A;  1Q5W B;  4WJO A;  2A4Z A;  4W9L A;  1HE8 A;  2MSE D;  4WWN A;  2KWU B;  2JRH A;  2NCN A;  2REX A;  3B1L X;  3IBE A;  3QIJ A;  1WGG A;  4ASW C;  2GMI C;  2DYO A;  4FBJ B;  2KTR A;  2KDF B;  1YJ1 A;  3UIN B;  1V80 A;  2JRI B;  2CS4 A;  2NVU I;  4G50 A;  2FNJ B;  2IO2 B;  3WAN A;  4E71 A;  3UGB B;  4GDL B;  2IY0 B;  4ZRI A;  2LD9 A;  3PRM B;  1C1Y B;  4GU2 A;  1QZE A;  3RUI B;  4AUQ C;  1NI2 A;  2NR2 A;  4ANV A;  1KLV A;  2JWZ A;  1Q0W B;  2FCN A;  2KFK B;  3M3J A;  1P9D U;  2LVQ A;  3OLM D;  4JIO U;  3VQI A;  4B6W A;  2K8H A;  3KW5 B;  4DDG D;  4W9I A;  4TUU A;  2M8S A;  2LAS A;  3QHT A;  4PS3 A;  4FJV B;  2KKC A;  3U8Z A;  3ZVV A;  4EFO A;  1L7Y A;  4NQK E;  2KQS A;  2IO0 B;  3N30 A;  2D2Q A;  3PRE A;  4IG7 B;  2BGF A;  3WA0 A;  4FAD A;  1ZGU B;  2KMC A;  1NBF C;  4K7U A;  2A5U A;  2N1W A;  3WAO A;  3HIZ A;  1WY8 A;  2L0F A;  1RLF A;  2L0T A;  5AZG A;  4GIV A;  3EFU A;  4HCP B;  4EZK A;  2XK5 B;  3VDZ A;  3WAL A;  1WGD A;  3JSV A;  1V9J A;  1OEY A;  5E6O A;  3A9K A;  1MG8 A;  5CHV C;  1H4R A;  1EF5 A;  4G3X B;  2ZEQ A;  4A3P A;  4ZRK A;  1ISN A;  2EMS A;  3H7P A;  2RD0 A;  3H6N A;  3RZW C;  1YX6 B;  2J7Q B;  2ZZP B;  2KD0 A;  5BO4 B;  2NPT A;  2NBU A;  2ZPN A;  2FCM A;  4HPL B;  3R66 C;  3ZNI D;  1SGH A;  1IPG A;  1E90 A;  2N9E B;  5AZF A;  1WJ6 A;  2G4S A;  3PLU A;  4PYU A;  2KLG A;  2EMT A;  5KHQ A;  4WAA A;  2KC2 A;  2WWZ A;  3MJW A;  3JYU A;  3S2A A;  4II2 B;  3LJ3 A;  2DZK A;  2XBB C;  1E7U A;  1WJ4 A;  2KOX A;  4KDI C;  1UH6 A;  1GC6 A;  3JVZ X;  4IM2 A;  1V49 A;  4MGK E;  1G6J A;  1R4N I;  4GDK A;  3QCA A;  2Z0D B;  1U4A A;  3HHM A;  3L10 B;  2L05 A;  2K25 A;  4BKS A;  2BWE S;  1NDD A;  2JZ3 B;  2MRP A;  2KN5 A;  4GSW A;  2D11 A;  4AWJ A;  2K1F A;  3OJ3 A;  1P1A A;  1YD8 U;  1WRD B;  3WAP A;  4IWQ A;  4TKN A;  2CHW A;  2JT4 B;  5D94 A;  5E6P A;  3ZDM C;  4W9D A;  2MCN B;  5C1Z A;  2DZI A;  2KMA A;  2C7M B;  2G3Q B;  3PLV A;  3L17 A;  2GBK A;  4W9E A;  4CO7 A;  1FXT B;  5DPW A;  1J8C A;  2KLC A;  3KUD B;  3H7P B;  1M94 A;  2LXC A;  4HJK A;  4NY0 A;  3OAW A;  1WJU A;  4HCN B;  2C5L C;  3ZLZ A;  2KDI A;  4WQO B;  2L7R A;  4W9F A;  4BVU C;  4LJP B;  1KOT A;  2FID A;  4BFR A;  3DVN V;  1WE7 A;  3A1Q A;  2M0X A;  1UEL A;  4XZ4 A;  3JSV B;  2CHX A;  1E7V A;  4MGI E;  2JY6 A;  3ZNG C;  4JL9 A;  1LQB A;  5HKH A;  4BOS C;  1WM2 A;  1GNU A;  2WYQ A;  1P3Q U;  2KVR A;  4LDT D;  3PV1 A;  4KSL C;  3KUC B;  1OEY J;  4W9G A;  2LGY A;  3B0A A;  4URK A;  2PE9 A;  2DZM A;  3L0W B;  3A9J B;  2NPT B;  2DEN B;  3QAR A;  4IC7 B;  3UF8 A;  4E3C A;  3SD5 A;  1WMH A;  4PYZ A;  3T9L A;  3MHS D;  3ALB A;  3H9D A;  1S1Q B;  1SIF A;  3CSF A;  4TQ1 A;  4B9K A;  1ZKH A;  3ENE A;  4E74 A;  5L95 C;  2RSU A;  1UZX B;  3QA8 A;  1CMX B;  1WF9 A;  3N3K B;  4P7I A;  2NBW B;  2K8B A;  2KDE B;  4B95 A;  4ANW A;  5AEK B;  1EF1 A;  5J18 A;  4GGQ A;  3LDZ E;  4GDL A;  3ZNH B;  4W9J A;  4DK5 A;  2O6V D;  3PRP B;  4JLC A;  3SU8 X;  2IO3 B;  1WR6 E;  1Q1O A;  1E8Z A;  4MEM A;  3DBL I;  2AL3 A;  4MSQ B;  2KWV B;  2RGF A;  5DCN A;  4HDQ A;  4J6I A;  3QQ8 B;  5D7G A;  3DDC B;  3UIO B;  5IA7 A;  4DBG A;  4TQ0 A;  4MDK E;  3AI5 A;  1Z5S B;  3P2B A;  2DHZ A;  3BIN A;  4I6N B;  2LGD A;  1V5T A;  3APF A;  4ANU A;  3RT3 B;  2FUH B;  3V61 A;  1J0G A;  1TZ1 A;  2MX2 A;  2AYO B;  1WMH B;  3PVL A;  5JHB A;  5CX3 A;  4G11 A;  2KDB A;  2BPS A;  2MW5 A;  2JXX A;  2ZCB A;  4DHZ B;  3RYT A;  2N9P C;  4DHJ D;  3NHE B;  2I1K A;  4IWP A;  2N7E A;  2IO1 B;  3ZKJ C;  3PT2 B;  3PPA A;  2JZZ A;  3V62 A;  4WJN A;  2HTH A;  5CTR C;  4DWF A;  1VD2 A;  4HLE A;  3IFW B;  4OVU A;  3N32 A;  1YX5 B;  1WXA A;  3GZN I;  3L08 A;  3QK0 A;  3SDL C;  3R7Q A;  4M8N A;  1E5W A;  2GBJ A;  5C23 A;  4IWO A;  5KHO A;  3CMM B;  4JQW C;  3GOE A;  4EZL A;  1EO6 A;  2L76 A;  2LRW A;  3WIM A;  4BKG A;  1C3T A;  1T0Y A;  1V2Y A;  2V3S A;  4AJW A;  4FA6 A;  3VHT C;  2DYB A;  2DAJ A;  2MBE A;  4GB9 A;  3NS8 A;  1WX7 A;  1WYW B;  2MBQ A;  3Q3J A;  4KZC A;  4WWP A;  2CKH B;  2N4F A;  2WX1 A;  1WFY A;  2BKR B;  2JF5 A;  3PHX B;  3W1Y A;  2LWP A;  4W9K A;  5DPS A;  3SHQ A;  4F7Z A;  2J0K A;  1X1M A;  5DPR A;  2ZCC A;  1UBI A;  3VUY A;  1UBQ A;  3A33 B;  2KHW B;  3ZTD A;  3DOW A;  3EC8 A;  4F8C B;  2HD5 B;  3KH0 A;  3HM3 A;  3ML9 A;  2KO3 A;  1E8X A;  3A9K B;  3KVF B;  2K39 A;  3IHP C;  3RD2 A;  3VTV A;  2GBN A;  3EHV A;  4ANX A;  4EUT A;  1LXD A;  3L13 A;  4AJY B;  3H1U A;  2L00 B;  3L54 A;  3MTN B;  1R4M I;  2MBO A;  2OJR A;  1KM7 A;  1WJN A;  4IW0 A;  1I42 A;  4GMV A;  4NQL B;  3ML8 A;  2BYE A;  3K9P B;  5TR5 A;  3M63 B;  2MQJ A;  4K7S A;  2KWC A;  4DXA B; 
#chains in the Genus database with same CATH topology
 1WZ3 A;  4M0W B;  3TEY A;  2ZNV C;  2WHI A;  3D32 A;  2C9W B;  4HXD A;  2M0A A;  3NOB A;  2BB6 A;  4ICU A;  4K81 A;  3JW0 X;  4FJZ A;  3I63 C;  1CZP A;  2PMV A;  2WXQ A;  1S3S G;  1TBE A;  4L1B A;  3PZ7 A;  3CWI A;  1GC7 A;  2DYM A;  2HJ1 A;  4TV3 A;  1WSP A;  1TS4 A;  5BMI A;  5H8Y E;  1F2R C;  3VTU A;  1K50 A;  1KRH A;  3BVZ A;  3VFK A;  3A1Q B;  2IZV B;  3BK2 A;  3BVM A;  5CHW A;  5HHD G;  1UGM A;  2H89 B;  2Z59 B;  3W5U B;  2BW2 A;  2N9X A;  1NYQ A;  5H92 C;  4LCD E;  3VUX A;  3ZNZ B;  4ZRJ A;  3NZS A;  2KJR A;  4NJ7 A;  1CQV A;  3AE6 B;  1L5P A;  3P4S B;  2LRU A;  3ZO5 B;  4GN1 A;  3VR9 B;  3DVG Y;  1I35 A;  1LGR A;  1ZXH A;  2KK8 A;  2JVC A;  3ZDT A;  5DPT A;  3ABV B;  1OQY A;  3NZ3 A;  3TUO A;  4KGS A;  3BYT B;  2KQ7 A;  4KIK B;  1BML C;  1YN5 A;  4KDL B;  1WE6 A;  1ZW7 A;  4WJQ A;  1UF0 A;  1L6U A;  1RRB A;  1HEZ E;  5E6N A;  1DOI A;  3PGE A;  1D5X C;  3ONS A;  1K51 A;  2MJE A;  2IBI B;  3DPD A;  2TSS A;  4NAW A;  1F1H A;  2WU5 B;  2DX5 B;  4WH4 A;  4PS8 A;  2MA9 B;  2LEK A;  2KAC A;  4BAX A;  5IO9 A;  3AV8 A;  3RUL A;  1K8R B;  1E7P B;  4UDU C;  1V86 A;  2KX0 A;  5EE1 A;  1IYF A;  2QJL A;  1FNW A;  2AEH A;  1C4C A;  4FHJ A;  5IAA C;  5LXI B;  3QWZ B;  1E6E B;  1WGK A;  2KTR B;  4EEW A;  1LM8 B;  3X23 A;  1MHX A;  1BT0 A;  1MPE A;  2M17 A;  4KVG B;  2CR5 A;  4ZRQ A;  2VH2 A;  3A9J A;  2D10 A;  3OJ4 B;  3TCA A;  3H7S A;  4OVV A;  1D5M C;  3PHW B;  4LNI A;  2PEA A;  2WDV B;  1WYG A;  3HM6 X;  3U30 A;  4YSZ B;  2E6X A;  4USA A;  2EEL A;  4A9A A;  1I7H A;  2ZJD A;  3A4R A;  2LFI A;  1KFY B;  1TT5 B;  3ZW3 A;  1Y8R C;  2EKE C;  4ZYN A;  4REZ A;  1Z2M A;  4P1B C;  3AXC A;  1STE A;  1WX8 A;  2L83 A;  4WWO A;  1FCC C;  1ACC A;  4RGM A;  2A4Z A;  2KWU B;  4JPS A;  3OG5 A;  4ASW C;  5G5H A;  3CIR B;  2KDF B;  1L0V B;  2OHF A;  1UWX A;  3ZYY X;  2IO2 B;  2D3B A;  3UGB B;  3RNB C;  1E0Z A;  1ZXI A;  2LD9 A;  4ANV A;  2V3N A;  4RCO A;  1P9D U;  3OLM D;  3HRD D;  4DDG D;  3KW5 B;  3BVG A;  3U8Z A;  4FJV B;  2KKC A;  4NQK E;  2KQS A;  2D2Q A;  3PRE A;  4IG7 B;  2RDH A;  4YSX B;  4YSY B;  1ET9 A;  4MM3 B;  3VDZ A;  2INN E;  4RGT A;  3JSV A;  1ZDX A;  1QOB A;  1A70 A;  2ZEQ A;  4ZRK A;  1ISN A;  2RMM A;  3N9Y C;  1FO4 A;  2BQQ A;  2ZZP B;  5BO4 B;  3U52 E;  3R66 C;  3ZNI D;  1SGH A;  2N9E B;  4N58 A;  3EA6 A;  1C76 A;  2GLS A;  4AQ7 A;  5EE3 A;  3E9S A;  3S2A A;  3V3X A;  4KDI C;  3JVZ X;  1TYG B;  1G6J A;  2BT6 A;  1YNT E;  1D6E C;  1R4N I;  1UNS A;  1ZUD 2;  3P4R B;  2K25 A;  4OZA A;  1NDD A;  2JZ3 B;  4C4V A;  2MRP A;  1XLO A;  2KT7 A;  1YD8 U;  2JT4 B;  2E3T A;  1DGJ A;  1I4X A;  1L0Y B;  1IGC A;  1PDX A;  2G3Q B;  5LNK 1;  4ARC A;  3MC0 B;  2KLC A;  2RDB C;  3R2T A;  4PT5 A;  2KDI A;  4WQO B;  4BVU C;  2FID A;  3UI3 A;  2WXH A;  4BFR A;  1FM0 D;  1WE7 A;  1EWC A;  3JSV B;  2CHX A;  1LQB A;  1YN3 A;  1WM2 A;  3LXF A;  3PV1 A;  5EE9 A;  1TZO A;  4URK A;  3L0W B;  2NPT B;  4IC7 B;  3SD5 A;  4PYZ A;  1SSN A;  3T9L A;  3MHS D;  2SAK A;  1M4V A;  1S1Q B;  1LO5 D;  1JWS D;  3ENE A;  4E74 A;  5L95 C;  2RSU A;  1XCQ L;  2NBW B;  3AM9 A;  3LDZ E;  3ZNH B;  4W9J A;  2G9H D;  2IO3 B;  1WR6 E;  1Q1O A;  1FFU A;  1ROE A;  1AYF A;  4QAY A;  3QQ8 B;  3C19 A;  3UIO B;  2NTS A;  4TQ0 A;  1Z5S B;  3P2B A;  2DHZ A;  2FUH B;  3V61 A;  1TZ1 A;  1WMH B;  1V1P B;  2KDB A;  2BPS A;  1OQQ A;  3DHI C;  4DHZ B;  2N9P C;  1SE4 A;  1F77 A;  3ZKJ C;  3PT2 B;  2V9H A;  2HTH A;  1YMH E;  4HLE A;  4OVU A;  1WXA A;  1FXI A;  3GZN I;  3QK0 A;  4XWT A;  5BYR A;  3R7Q A;  1V1O A;  5C23 A;  3ZJU A;  3CMM B;  3WIM A;  3P4P B;  3H8H A;  2DYB A;  2DAJ A;  4JE3 B;  1WX7 A;  4KZC A;  2CKH B;  3HVZ A;  2N4F A;  1EM7 A;  2WX1 A;  4YTP B;  3PHX B;  4W9K A;  2J0K A;  3DHH C;  2ZCC A;  1UBI A;  1UBQ A;  3T3O A;  2RDG A;  2FUG 1;  4LNN A;  2BS3 B;  1KH0 A;  2HD5 B;  3ML9 A;  3EHV A;  1HXY D;  3L13 A;  3L54 A;  2MBO A;  1WJN A;  3DWG C;  1SB3 C;  1ZPS A;  2BYE A;  3K9P B;  3M63 B;  2MQJ A;  2QC8 A;  2UYZ B;  3R7R A;  4MM3 A;  1K52 A;  1EUV B;  4N9F 4;  1HA5 A;  1PGB A;  1RFK A;  1I4P A;  1WX9 A;  3KYD D;  2JXT A;  1T0Q C;  3AMZ A;  2J42 A;  2BF8 B;  3RZF A;  3QX1 A;  4W9H A;  4MEL A;  3KWV A;  1HQR D;  4W9C A;  2INP E;  2WXP A;  3EFC A;  3UQB A;  1PGA A;  3IT6 B;  2MBB B;  1PGX A;  2M4N A;  3AED B;  4AP4 C;  3Q8F A;  3DBH I;  3PZD A;  4FUL A;  2DNF A;  1WXS A;  4WIP A;  3FIL B;  2UU7 A;  4M01 A;  3C8Y A;  3AUL A;  3KYC D;  1P7E A;  2AL6 A;  2ZVO A;  2WLB A;  2KYW A;  3NVZ A;  1NI3 A;  3VRA B;  3KUZ A;  4MSM B;  1YN4 A;  4FN2 A;  1SF0 A;  1E10 A;  2R2O A;  1GG3 A;  1C77 A;  4LNF A;  1P0R A;  1OGW A;  1N61 A;  1B1Z A;  3NZU A;  4X57 B;  4OVZ A;  1ZOY B;  1A5R A;  3I57 A;  4C7Z A;  2V4L A;  1JWB D;  1JRU A;  2BYF A;  4P6V F;  3V60 A;  4N6E B;  2B76 B;  1P98 A;  1RAX A;  1F2R I;  2WXR A;  2MH7 A;  4I6P A;  3NG0 A;  5JZE B;  4MH0 E;  2MWS B;  1QOA A;  4A55 A;  1TKE A;  2WX0 A;  3CF6 E;  1C79 A;  3EEC A;  1WIA A;  2IY1 B;  4HK2 A;  2GBR A;  2W3R A;  4NJ6 A;  5FKA C;  1N62 A;  2O6V A;  4CHK A;  1AAR A;  3ZUN A;  3TBL D;  2CHZ A;  4DXG A;  2JYT A;  4FHK A;  1WGH A;  1R4N B;  3O13 A;  1J19 A;  2WDT B;  3VXW A;  3PSE B;  4ICV A;  3EGR A;  2BWF A;  2JZP A;  1J7B A;  4HPM B;  3DBR I;  2KVZ A;  3P42 A;  4Q2J A;  3AU4 A;  3VUW A;  2L8J A;  4MJS B;  5MPO A;  4YWG G;  2N1V A;  3GE3 C;  4HPP A;  1WZ0 A;  3R8B A;  1J7A A;  2C7H A;  3RMK C;  2QEJ C;  1MFW A;  5AUI A;  4LJO B;  2KNB A;  1IUE A;  3VH4 B;  2KXJ A;  1CJE A;  2K6Q A;  3DVN U;  3O65 B;  4BOZ B;  3WCQ A;  1VR9 A;  3WAM A;  2YEP F;  1PFD A;  4K3C A;  4LLG M;  1ESF A;  1JRP A;  1L2N A;  5IP4 D;  2LXA A;  3NY5 A;  1UD7 A;  5BYQ A;  3PS6 A;  1WH3 A;  3FC4 A;  3UIN B;  4NAW B;  2D07 B;  2LUM A;  4NNJ B;  2LMC A;  2FAZ A;  1EU3 A;  3DCG A;  4CQN A;  4KSK C;  2WNM A;  2O2V B;  2JUO A;  3CST A;  2RPQ A;  1XT9 B;  3IVF A;  1FMA D;  4DHJ B;  2KZR A;  1WXV A;  2WDR B;  4K1R B;  5T8I A;  2WQY B;  4W9L A;  4JWS C;  2REX A;  2JRH A;  1WGG A;  2DYO A;  4FBJ B;  2KTR A;  1T0R C;  2YEP B;  3AB5 A;  1V80 A;  2AX5 A;  2V3P A;  2FNJ B;  3WAN A;  4E71 A;  1C9F A;  4KKI A;  3KLS X;  2IY0 B;  4ZRI A;  1QZE A;  1KLV A;  2JWZ A;  2DBY A;  2FCN A;  2ACZ B;  4JIO U;  4HRS A;  3VQI A;  1RM6 C;  3NJT A;  4W9I A;  2LAS A;  3AEE B;  3QHT A;  4PS3 A;  3FIL A;  3AE2 B;  1SE3 A;  2WXJ A;  2WU2 B;  4FAD A;  2QIL A;  1HTQ A;  2KMC A;  4BZA A;  2N1W A;  3WAO A;  3HIZ A;  1TS5 A;  2VZK D;  2L0T A;  2LHE A;  2KMM A;  2XK5 B;  3MP9 A;  2L32 A;  4XDD A;  1V9J A;  1OEY A;  3A9K A;  5CHV C;  1H4R A;  4A3P A;  1SIJ A;  2PLP A;  1YX6 B;  1XCT L;  2ZPN A;  2FCM A;  3Q3O C;  1QLB B;  1E90 A;  5AZF A;  1T5X D;  4PYU A;  2KLG A;  4HJG E;  3JYU A;  2WXL A;  3LJ3 A;  3RNG C;  2XBB C;  2KOX A;  1WJ4 A;  2JU6 X;  3E56 A;  4IM2 A;  4MGK E;  2V4I B;  4GDK A;  3QCA A;  3Q8A A;  3HHM A;  2L05 A;  2BWE S;  4MH8 A;  3AE3 B;  1TKY A;  2KN5 A;  4AWJ A;  4D2K A;  4IWQ A;  4TKN A;  5E6P A;  3ZDM C;  3L17 A;  5DPW A;  1J8C A;  1KLG D;  1ZE3 D;  3H7P B;  1M94 A;  4NY0 A;  3OAW A;  1WJU A;  2L7R A;  4LJP B;  3TEZ A;  2QMT A;  3FKY A;  1UEL A;  3P1M A;  2OJW A;  4XZ4 A;  4MGI E;  1YJI A;  4JL9 A;  5HKH A;  1GNU A;  2WYQ A;  3RN9 C;  5D3I B;  4KSL C;  3KUC B;  2NMQ A;  2Y5C A;  3TEW A;  4W9G A;  2LGY A;  3B0A A;  1QT9 A;  2DZM A;  2WP9 B;  2K5P A;  3QAR A;  3LYY A;  2PVG C;  4E3C A;  2IGH A;  3B9J A;  1WMH A;  2XN9 C;  3R2I A;  4RF1 A;  1ZKH A;  1UUP A;  3MC9 A;  3GS2 A;  4P7I A;  2KDE B;  3U7Z A;  4GGQ A;  1DOY A;  2KN4 A;  3PO0 A;  2O6V D;  4JLC A;  1E8Z A;  4MEM A;  2AL3 A;  4B0M A;  4L2Y A;  2N7J A;  5D7G A;  5IA7 A;  1VJK A;  4MDK E;  4I6N B;  2LGD A;  4ANU A;  3L4P A;  3MJ5 A;  2AYO B;  3PVL A;  5JHB A;  1XLN A;  2MW5 A;  3AE1 B;  1VZ7 A;  1XO3 A;  2JXX A;  1SE2 A;  1WXQ A;  1VZ8 A;  2IO1 B;  1UWM A;  3SEB A;  4DWF A;  3N32 A;  4US8 A;  4ITK A;  1OQR A;  3L08 A;  4M8N A;  1E5W A;  2JQR B;  5KHO A;  1T0S C;  4XDC A;  2K0P A;  1EO6 A;  2L76 A;  1C3T A;  1JQ4 A;  1V2Y A;  2MBE A;  2JX5 A;  3AH7 A;  2L52 A;  2JF5 A;  3W1Y A;  4ZHP A;  3AE5 B;  3ZGZ A;  1ZDV A;  2KHW B;  3ZTD A;  5AUK A;  1Y56 A;  4F8C B;  3KH0 A;  3SFD B;  3KVF B;  2K39 A;  3IHP C;  3RD2 A;  3PZ8 A;  2GBN A;  2ON8 A;  3DWM A;  4AJY B;  1T3Q A;  4US9 A;  1KM7 A;  4TMA B;  5TR5 A;  2KWC A;  4S0R A;  2ZW0 A;  3ZIM A;  1V6E A;  2WXI A;  3I9V 1;  4EKU A;  1L4Z B;  3UQA A;  1B9R A;  4BKT A;  1XD3 B;  1UGJ A;  3W1S C;  2RR9 A;  4C00 A;  4RFB A;  3ZRC A;  2AWT A;  4K3B A;  2UWQ A;  2DZJ A;  4RM9 A;  2I1J A;  3APC A;  3HK0 A;  2IGG A;  1VLB A;  2V1Y A;  1D4B A;  3Q3F A;  2BKF A;  2Y5B B;  4RMA A;  5D3D A;  2FCS A;  4HDO A;  4NZL B;  5FR6 A;  1VZ6 A;  2LUE A;  3P63 A;  1D3Z A;  2Z8L A;  3VVW B;  5JHA A;  4XWW A;  3RCZ A;  1LFD A;  1JRO A;  3BWU D;  1SBB B;  2N0S B;  1C4A A;  1GB1 A;  4M02 A;  1T6B X;  2J4X A;  3KWL A;  5G2N A;  3M62 B;  3VAW A;  3BYY B;  3Q3M C;  4ACF A;  3W1S A;  3X0W A;  2BYT A;  4NAM A;  4WAF A;  3Q6B A;  2QHO A;  2Y3A A;  2WGS A;  4KZ0 A;  2QSD A;  4EZJ A;  2KX3 A;  2D3C A;  5J2R A;  3TJP A;  2FCQ A;  2CU1 A;  5C3J B;  3PRZ A;  2BB5 A;  1WR1 A;  1NEK B;  1C78 A;  1WM3 A;  1I4H A;  5AZH A;  2RPV A;  3T8M A;  5L83 A;  1AWD A;  3TMP B;  1EU4 A;  4I6L B;  3A4S C;  3P4Q B;  2K3U A;  4II3 B;  2ASQ A;  3ZTC A;  3K9O B;  3AE7 B;  1TY0 A;  1EWY C;  3VH3 B;  1XLQ A;  3ZRF A;  4YL8 A;  2HE7 A;  3L16 A;  1PQS A;  2NS5 A;  1OTR B;  1XLP A;  3QC8 B;  3B2F A;  2KAJ A;  4DHZ E;  1QIL A;  4FLH A;  4HWI B;  4GDK B;  1RWS A;  3Q2A C;  4MGZ E;  1NVI D;  3DBS A;  5BMG A;  3DQV A;  4ZDV A;  2CJO A;  3GB1 A;  3W5V B;  1V5O A;  4BKS D;  2PW9 A;  2G4D B;  1YJJ A;  1FNU A;  3AE8 B;  2HJ8 A;  4KKJ A;  1GJZ A;  3QJZ A;  3AN1 A;  2LGI A;  3ZXV A;  4M0W A;  4YTN B;  2QCZ A;  2NBV B;  2J0J A;  2OED A;  3HUI A;  2C7N B;  4M8M A;  1ET6 A;  3B2G A;  4CYE A;  1MI0 A;  1WGR A;  3NVV A;  4KIK A;  3C0R B;  2JPH A;  4RF0 A;  1FIQ A;  4R3D A;  4WUR A;  2PJH A;  3GP7 A;  2B3A A;  2MP2 A;  2INC C;  3ZJV A;  4K7W A;  5D6J B;  2VH1 A;  2ZNV B;  4KV2 A;  3AU5 A;  2KTF A;  2DAF A;  5CHF A;  3ECI A;  2KJH B;  2YVC A;  2MBH A;  4OZB A;  3MC8 A;  2KFJ A;  1J7C A;  2BVC A;  3PTF C;  2GBM A;  3Q8B A;  1L4D B;  1VRA B;  2IJ0 A;  4A20 A;  1E8W A;  2K8C A;  3NUH B;  4IM3 A;  2L1A A;  3DHG C;  1FD6 A;  4WJO A;  4LK0 M;  2X38 A;  1HE8 A;  2MSE D;  2WS3 B;  3Q14 C;  3B1L X;  2NCN A;  1JWM D;  2GMI C;  5IN7 A;  2VZK B;  1YJ1 A;  2CS4 A;  4NJC A;  4GDL B;  1Q10 A;  1N5W A;  2NR2 A;  1OFF A;  1Q0W B;  2KFK B;  2W55 A;  3VR8 B;  1V1P A;  3AEA B;  4EFO A;  3IXS A;  3N30 A;  1F52 A;  4IOI E;  4DQO C;  2AQ1 B;  1ZGU B;  1BUI C;  2DLB A;  2KDM A;  1WY8 A;  5FR3 A;  1RLF A;  5AZG A;  4GIV A;  3EFU A;  4HCP B;  3WAL A;  2EKI A;  2QIE B;  4P1C C;  1XF5 L;  3U4E G;  4RH6 A;  2RD0 A;  3RZW C;  2J7Q B;  1WRI A;  2NPT A;  4ZHO A;  2NBU A;  4HPL B;  2PKO A;  3BZD B;  1WJ6 A;  2G4S A;  3GZN B;  1FXA A;  4RGN A;  1JCK B;  2DZK A;  1E7U A;  1I4R A;  1GC6 A;  3Q3N C;  1V49 A;  4OHJ A;  2Z0D B;  1U4A A;  3ZXR A;  4BKS A;  2AQ3 B;  3LB8 C;  3OJ3 A;  4HRO A;  2CHW A;  3NRZ A;  4W9D A;  2MCN B;  5C1Z A;  2C7M B;  1R4M B;  1NYR A;  4IKG A;  1YQ4 B;  4CO7 A;  3BII D;  3KUD B;  4HJK A;  2I38 A;  4W9F A;  3RPF C;  1KOT A;  1I4Q A;  3OWE B;  1E7V A;  1PYW D;  3ZNG C;  2WXG A;  5HFY A;  1P3Q U;  2KVR A;  1KLU D;  4HKZ E;  4ZYS A;  2BS4 B;  1IGD A;  2K9X A;  4HEA 1;  5JXV A;  4GLS C;  1AW7 A;  2H88 B;  3ALB A;  2CJN A;  2DWQ A;  4XE0 A;  4LNO A;  3N3K B;  2WXF A;  2K8B A;  4B95 A;  5J18 A;  1EF1 A;  2LGS A;  1DOX A;  4GDL A;  2BS2 B;  2QDF A;  4DK5 A;  3PRP B;  1XXG A;  3DBL I;  4MSQ B;  2RGF A;  4HDQ A;  2GB1 A;  3AI5 A;  1V5T A;  3APF A;  3AE9 B;  3RT3 B;  1JW9 D;  1J0G A;  1IBX A;  2MX2 A;  1BXT A;  3AEB B;  4XGA B;  5CX3 A;  3RYT A;  2W3S A;  2I1K A;  3N1Y C;  4TSS A;  2Y5P A;  1P7F A;  2JZZ A;  4WJN A;  5CTR C;  1VD2 A;  3IFW B;  1YX5 B;  3SDL C;  2GBJ A;  3AEG B;  3W2D A;  4JQW C;  3GOE A;  2D5G A;  4BKG A;  2LRW A;  4S17 A;  1FRR A;  4AJW A;  4FA6 A;  2R61 A;  1MVK A;  2GI9 A;  3VHT C;  3NS8 A;  2MBQ A;  4WWP A;  3Q3J A;  1WFY A;  2BKR B;  2LWP A;  4F7Z A;  1JML A;  1X1M A;  2GRI A;  5DPR A;  5I4D A;  3VUY A;  4A8X C;  3Q69 A;  1TS3 A;  4FXC A;  3HM3 A;  2KO3 A;  1E8X A;  3A9K B;  5IOI A;  4WQM A;  4ANX A;  1GB4 A;  3AE4 B;  3MTN B;  2L00 B;  1R4M I;  4OZC A;  3DBH B;  4NQL B;  4MAC A;  3MHZ A;  2KAN A;  2KJ6 A;  2Z0E B;  5G55 A;  1TIF A;  3Q8C A;  4JGH B;  3ZQ4 A;  4A3O A;  2BBC A;  2MEK A;  2LGX A;  2L3Z A;  1KF6 B;  2V0G A;  1WWT A;  4ZRP A;  2FIF A;  3BY4 B;  1D5Z C;  4XC2 A;  4IM0 A;  2C60 A;  3DBL B;  1F0Z A;  1XQQ A;  3T3N A;  5EE0 A;  3TSS A;  1JAL A;  1FFV A;  2XEW A;  2LJI A;  4A6Q A;  2R2Q A;  1MJD A;  1FEH A;  2J0M A;  2YLM A;  5GMV A;  3ZJT A;  4NPN A;  3TEX A;  1WGY A;  3DBR B;  2IPK D;  1DYQ A;  2O2V A;  4WWM A;  2KC1 A;  2PVO D;  2XNA C;  1N63 A;  5EDS A;  5BMH A;  5LXH A;  4JX1 C;  4WJP A;  3DVG X;  1E8Y A;  1TGZ B;  2ICI A;  4FJY A;  2XK5 A;  1QOG A;  5J17 A;  1H8C A;  4O1N A;  3ETR A;  5JH5 C;  2O6V B;  4MGY E;  4MT5 A;  4PK1 A;  1RFA A;  4N59 A;  2M1M A;  1FNV A;  2ZVN A;  3VTW A;  1SXT A;  2N9L A;  3QAQ A;  3Q8E A;  2OOB B;  4LDT B;  3TL5 A;  2D3G A;  3NS1 A;  1V81 A;  4C7Y A;  2LVO A;  3B08 A;  3IG3 A;  4MJS A;  1WI0 A;  1HZ5 A;  4AOF A;  5D2M B;  4PS7 A;  3RNA C;  3RI7 C;  2N7D A;  4RM8 A;  2KWD A;  4GOC A;  2G45 B;  3NVY A;  2VRR B;  3N1Z C;  5FK9 C;  3U7D A;  2FE8 A;  1QKZ A;  4G0N B;  2IYD B;  4BBN C;  2ZPY A;  4ZOH C;  2GOW A;  4YTM B;  1F9J A;  2WXO A;  2LJ5 A;  3APD A;  1YIW A;  5C2T B;  4OW0 A;  5E6J A;  4EOY A;  5BYS A;  2PPH A;  2K22 A;  4RNA A;  1QF6 A;  4J3O D;  2AQ2 B;  2WXM A;  2W9N A;  3AEC B;  3IAM 1;  1HTO A;  1V97 A;  3RNF C;  3AEF B;  3MFG A;  2J53 A;  3URY A;  2LZ6 A;  2MLB A;  1IP9 A;  2W54 A;  4YXD B;  1MHH E;  2PE6 B;  1SE9 A;  3V6E B;  2LI5 A;  3RNC C;  1VCB A;  4GXB A;  4EE2 A;  4BBN F;  3V05 A;  3SR6 A;  2MJ3 A;  2WXK A;  1XEE A;  4HVB A;  2IND C;  4IDI A;  4XX5 A;  4C80 A;  2BYV E;  4DDI D;  2KFK A;  3J9C A;  1WXM A;  3UIP B;  2K6D B;  4F1S A;  1FRD A;  3TIX A;  2I2Y A;  3GE8 C;  3M95 A;  3R3M A;  1SJE D;  4KX6 B;  1TTN A;  2KQ4 X;  2LVP A;  1GUA B;  1TJE A;  1C4P A;  2MP2 B;  4IUM B;  5LLI A;  2JWU A;  1KJT A;  1R7S A;  3V6C B;  3I3T B;  1YQB A;  3N1X C;  1I4G A;  1Q5W B;  1TY2 A;  3HVD A;  4WWN A;  3IBE A;  3QIJ A;  3W9C B;  3IAS 1;  3N20 C;  1TKG A;  2JRI B;  4KGT A;  2NVU I;  4G50 A;  1L6V A;  3PRM B;  4GU2 A;  1C1Y B;  1QQR A;  3RUI B;  4AUQ C;  1NI2 A;  2BTE A;  5HG2 A;  3M3J A;  2LVQ A;  4B6W A;  2K8H A;  1YOV B;  2ONQ A;  4TUU A;  2M8S A;  3U2S C;  1PUT A;  5HI1 A;  1YQ3 B;  3ZVV A;  1L7Y A;  2IO0 B;  4RGO S;  2BGF A;  2Q5W D;  4M00 A;  5G5G A;  3WA0 A;  2SEB D;  2WDQ B;  1FPY A;  1NBF C;  4K7U A;  2A5U A;  2CU3 A;  4XYC A;  1ENF A;  2L0F A;  3VRB B;  2WXN A;  4EZK A;  1KTK A;  1WGD A;  5GXG B;  5E6O A;  1MG8 A;  4ARI A;  1EF5 A;  4G3X B;  4LNK A;  3H7P A;  2EMS A;  3H6N A;  3IT4 B;  2KD0 A;  1N60 A;  1K53 A;  1HZ6 A;  1IPG A;  2M56 B;  3PLU A;  1GAQ B;  3I5J C;  3SFE B;  2EMT A;  3RNE C;  4WAA A;  2KC2 A;  2WWZ A;  5KHQ A;  2W82 A;  4DXF A;  2M19 A;  3MJW A;  2J52 A;  4KGR A;  4II2 B;  4YT0 B;  1UH6 A;  2MHJ A;  1AN8 A;  3L10 B;  4GSW A;  2D11 A;  2K1F A;  1P1A A;  1WRD B;  3WAP A;  4H2A A;  1RYJ A;  5D94 A;  5TSS A;  2DZI A;  1E9M A;  2KMA A;  5IKC M;  3PLV A;  2GBK A;  4W9E A;  1L0X B;  1FXT B;  1TS2 A;  2LXC A;  4HCN B;  1FCL A;  2C5L C;  3ZLZ A;  2PTL A;  2G1E A;  3DVN V;  3A1Q A;  2M0X A;  2JYE A;  2N9K A;  2JY6 A;  4LTU A;  2MJD A;  4BOS C;  4LDT D;  4P16 A;  1OEY J;  3KQ4 A;  2PE9 A;  3A9J B;  2DEN B;  3UF8 A;  2IGD A;  3H9D A;  1SIF A;  3CSF A;  4TQ1 A;  2D3A A;  4B9K A;  1SJH D;  4C56 C;  4AS1 A;  1UZX B;  3QA8 A;  1CMX B;  1WF9 A;  1ZP0 B;  5AEK B;  4ANW A;  3SU8 X;  1QOF A;  2KWV B;  1VDV A;  1GOZ A;  4JWU C;  5DCN A;  1N5X A;  4J6I A;  4L23 A;  3DDC B;  4DBG A;  2HTM E;  1CK1 A;  3BIN A;  2HDE A;  3FAH A;  4C4V B;  2ZW1 A;  4G11 A;  2ZCB A;  1SEB D;  4DHJ D;  3NHE B;  4IWP A;  2N7E A;  4A90 A;  3EUB 2;  3PPA A;  3V62 A;  3BK1 A;  2NTT A;  4IWO A;  2LHD A;  4EZL A;  1V8C A;  1IBX B;  1T0Y A;  2V3S A;  3RFZ B;  4GB9 A;  1WYW B;  2X8X X;  1MG4 A;  1JWU D;  1JWA D;  5DPS A;  3SHQ A;  3A33 B;  3DOW A;  4B0E A;  3EC8 A;  2FBW B;  3VTV A;  4HKQ A;  1NEN B;  4EUT A;  1LXD A;  3H1U A;  1GPX A;  2OJR A;  2PIA A;  4IW0 A;  2IDY A;  1I42 A;  4GMV A;  3ML8 A;  2JSV X;  4K7S A;  1N6Z A;  3NVW A;  4DXA B; 
#chains in the Genus database with same CATH homology
 2KAN A;  2KJ6 A;  2UYZ B;  3ZIM A;  1V6E A;  3R7R A;  4MM3 A;  2Z0E B;  1EUV B;  1WZ3 A;  4EKU A;  4N9F 4;  4M0W B;  3UQA A;  5G55 A;  4JGH B;  4A3O A;  4BKT A;  2ZNV C;  1XD3 B;  1WX9 A;  3W1S C;  3D32 A;  3KYD D;  2C9W B;  2LGX A;  2RR9 A;  2L3Z A;  4HXD A;  3ZRC A;  2AWT A;  2UWQ A;  2FIF A;  2BF8 B;  3RZF A;  2DZJ A;  4RM9 A;  3BY4 B;  4XC2 A;  4IM0 A;  2C60 A;  3NOB A;  2I1J A;  3QX1 A;  1XQQ A;  3APC A;  4W9H A;  3HK0 A;  4MEL A;  4W9C A;  2V1Y A;  4ICU A;  3JW0 X;  4K81 A;  4DDI D;  3UQB A;  4FJZ A;  3Q3F A;  2BKF A;  2Y5B B;  2XEW A;  4RMA A;  1S3S G;  2MBB B;  2FCS A;  1TBE A;  2M4N A;  1GC7 A;  2DYM A;  4AP4 C;  2R2Q A;  4HDO A;  4TV3 A;  3DBH I;  3PZD A;  2J0M A;  2YLM A;  4FUL A;  5GMV A;  4NPN A;  1WGY A;  1WXS A;  5FR6 A;  2LUE A;  3VTU A;  3VFK A;  3A1Q B;  1D3Z A;  2O2V A;  3VVW B;  5JHA A;  3RCZ A;  2KC1 A;  2IZV B;  3AUL A;  5CHW A;  5EDS A;  1LFD A;  1UGM A;  5LXH A;  3KYC D;  4WJP A;  5G2N A;  3DVG X;  3M62 B;  1E8Y A;  2AL6 A;  1TGZ B;  2Z59 B;  2N9X A;  2ZVO A;  4FJY A;  3VAW A;  2XK5 A;  5J17 A;  1H8C A;  4LCD E;  3VUX A;  5JH5 C;  2O6V B;  4MGY E;  3ZNZ B;  3W1S A;  3X0W A;  4ZRJ A;  3NZS A;  2KJR A;  4NJ7 A;  3KUZ A;  4MSM B;  2QHO A;  1RFA A;  4FN2 A;  2R2O A;  2LRU A;  3ZO5 B;  1GG3 A;  4GN1 A;  4KZ0 A;  2M1M A;  4EZJ A;  3DVG Y;  1P0R A;  1OGW A;  2KX3 A;  1I35 A;  2ZVN A;  3VTW A;  2KK8 A;  5J2R A;  2JVC A;  3TJP A;  2FCQ A;  2CU1 A;  3ZDT A;  3NZU A;  3QAQ A;  3PRZ A;  2OOB B;  5DPT A;  4X57 B;  1OQY A;  1A5R A;  4LDT B;  3TL5 A;  1WR1 A;  1WM3 A;  2D3G A;  2V4L A;  5AZH A;  5L83 A;  3T8M A;  1V81 A;  1JRU A;  2BYF A;  2LVO A;  3V60 A;  2KQ7 A;  3B08 A;  3TMP B;  4KIK B;  3IG3 A;  4KDL B;  4MJS A;  4I6L B;  1P98 A;  1RAX A;  1WE6 A;  1ZW7 A;  1WI0 A;  3A4S C;  4AOF A;  4II3 B;  4WJQ A;  5D2M B;  2ASQ A;  4I6P A;  3ZTC A;  3K9O B;  4PS7 A;  5JZE B;  1RRB A;  4MH0 E;  2MWS B;  5E6N A;  3VH3 B;  3ZRF A;  2N7D A;  4YL8 A;  2HE7 A;  4RM8 A;  2WX0 A;  3L16 A;  4GOC A;  2G45 B;  3CF6 E;  1PQS A;  2NS5 A;  3EEC A;  1WIA A;  3PGE A;  1OTR B;  2IY1 B;  4HK2 A;  3QC8 B;  2GBR A;  2VRR B;  3U7D A;  4DHZ E;  4FLH A;  4HWI B;  4NJ6 A;  4GDK B;  2O6V A;  3ONS A;  4G0N B;  2IYD B;  4CHK A;  1AAR A;  4BBN C;  4MGZ E;  2ZPY A;  3ZUN A;  3TBL D;  2IBI B;  2CHZ A;  2GOW A;  1F9J A;  3DPD A;  3DBS A;  4FHK A;  1WGH A;  4NAW A;  2LJ5 A;  3APD A;  3DQV A;  1YIW A;  4ZDV A;  1J19 A;  2WDT B;  1V5O A;  3VXW A;  4BKS D;  3PSE B;  4ICV A;  2BWF A;  2G4D B;  2DX5 B;  2HJ8 A;  4EOY A;  4PS8 A;  1GJZ A;  3QJZ A;  2MA9 B;  4HPM B;  3DBR I;  2PPH A;  3RUL A;  2NBV B;  2J0J A;  3AU4 A;  1K8R B;  3VUW A;  2L8J A;  2C7N B;  4M8M A;  1V86 A;  2KX0 A;  4MJS B;  1IYF A;  2W9N A;  2AEH A;  2N1V A;  1WZ0 A;  4CYE A;  1WGR A;  2C7H A;  4FHJ A;  5IAA C;  5LXI B;  4KIK A;  3QWZ B;  3C0R B;  4LJO B;  2KNB A;  2JPH A;  2KTR B;  3VH4 B;  4EEW A;  2KXJ A;  1LM8 B;  2K6Q A;  2LZ6 A;  2MLB A;  3DVN U;  3O65 B;  3X23 A;  4BOZ B;  1IP9 A;  2PE6 B;  1SE9 A;  1BT0 A;  3WAM A;  2M17 A;  4KVG B;  3V6E B;  2LI5 A;  1VCB A;  2CR5 A;  4GXB A;  4BBN F;  2PJH A;  1L2N A;  2B3A A;  2D10 A;  3A9J A;  3OJ4 B;  3TCA A;  2MP2 A;  3H7S A;  4HVB A;  4OVV A;  2LXA A;  3NY5 A;  1UD7 A;  4K7W A;  5D6J B;  3PS6 A;  2ZNV B;  4KV2 A;  1WH3 A;  3PHW B;  4XX5 A;  2BYV E;  2PEA A;  4NAW B;  2KFK A;  2KTF A;  2DAF A;  1WXM A;  2D07 B;  3AU5 A;  3HM6 X;  4NNJ B;  3UIP B;  5CHF A;  2FAZ A;  3ECI A;  3U30 A;  2K6D B;  2KJH B;  4F1S A;  3DCG A;  4KSK C;  2YVC A;  3TIX A;  2MBH A;  2ZJD A;  3A4R A;  2O2V B;  3M95 A;  2JUO A;  2KFJ A;  3R3M A;  3PTF C;  3CST A;  2GBM A;  1Y8R C;  2RPQ A;  3ZW3 A;  1XT9 B;  1TTN A;  3IVF A;  2EKE C;  2LVP A;  4DHJ B;  1GUA B;  4ZYN A;  1Z2M A;  2KZR A;  2MP2 B;  4IUM B;  5LLI A;  1WXV A;  4A20 A;  1E8W A;  3AXC A;  1KJT A;  2K8C A;  4IM3 A;  4K1R B;  3V6C B;  3I3T B;  1YQB A;  1WX8 A;  4WWO A;  1Q5W B;  4WJO A;  2A4Z A;  4W9L A;  1HE8 A;  2MSE D;  4WWN A;  2KWU B;  2JRH A;  2NCN A;  2REX A;  3B1L X;  3IBE A;  3QIJ A;  1WGG A;  4ASW C;  2GMI C;  2DYO A;  4FBJ B;  2KTR A;  2KDF B;  1YJ1 A;  3UIN B;  1V80 A;  2JRI B;  2CS4 A;  2NVU I;  4G50 A;  2FNJ B;  2IO2 B;  3WAN A;  4E71 A;  3UGB B;  4GDL B;  2IY0 B;  4ZRI A;  2LD9 A;  3PRM B;  1C1Y B;  4GU2 A;  1QZE A;  3RUI B;  4AUQ C;  1NI2 A;  2NR2 A;  4ANV A;  1KLV A;  2JWZ A;  1Q0W B;  2FCN A;  2KFK B;  3M3J A;  1P9D U;  2LVQ A;  3OLM D;  4JIO U;  3VQI A;  4B6W A;  2K8H A;  3KW5 B;  4DDG D;  4W9I A;  4TUU A;  2M8S A;  2LAS A;  3QHT A;  4PS3 A;  4FJV B;  2KKC A;  3U8Z A;  3ZVV A;  4EFO A;  1L7Y A;  4NQK E;  2KQS A;  2IO0 B;  3N30 A;  2D2Q A;  3PRE A;  4IG7 B;  2BGF A;  3WA0 A;  4FAD A;  1ZGU B;  2KMC A;  1NBF C;  4K7U A;  2A5U A;  2N1W A;  3WAO A;  3HIZ A;  1WY8 A;  2L0F A;  1RLF A;  2L0T A;  5AZG A;  4GIV A;  3EFU A;  4HCP B;  4EZK A;  2XK5 B;  3VDZ A;  3WAL A;  1WGD A;  3JSV A;  1V9J A;  1OEY A;  5E6O A;  3A9K A;  1MG8 A;  5CHV C;  1H4R A;  1EF5 A;  4G3X B;  2ZEQ A;  4A3P A;  4ZRK A;  1ISN A;  2EMS A;  3H7P A;  2RD0 A;  3H6N A;  3RZW C;  1YX6 B;  2J7Q B;  2ZZP B;  2KD0 A;  5BO4 B;  2NPT A;  2NBU A;  2ZPN A;  2FCM A;  4HPL B;  3R66 C;  3ZNI D;  1SGH A;  1IPG A;  1E90 A;  2N9E B;  5AZF A;  1WJ6 A;  2G4S A;  3PLU A;  4PYU A;  2KLG A;  2EMT A;  5KHQ A;  4WAA A;  2KC2 A;  2WWZ A;  3MJW A;  3JYU A;  3S2A A;  4II2 B;  3LJ3 A;  2DZK A;  2XBB C;  1E7U A;  1WJ4 A;  2KOX A;  4KDI C;  1UH6 A;  1GC6 A;  3JVZ X;  4IM2 A;  1V49 A;  4MGK E;  1G6J A;  1R4N I;  4GDK A;  3QCA A;  2Z0D B;  1U4A A;  3HHM A;  3L10 B;  2L05 A;  2K25 A;  4BKS A;  2BWE S;  1NDD A;  2JZ3 B;  2MRP A;  2KN5 A;  4GSW A;  2D11 A;  4AWJ A;  2K1F A;  3OJ3 A;  1P1A A;  1YD8 U;  1WRD B;  3WAP A;  4IWQ A;  4TKN A;  2CHW A;  2JT4 B;  5D94 A;  5E6P A;  3ZDM C;  4W9D A;  2MCN B;  5C1Z A;  2DZI A;  2KMA A;  2C7M B;  2G3Q B;  3PLV A;  3L17 A;  2GBK A;  4W9E A;  4CO7 A;  1FXT B;  5DPW A;  1J8C A;  2KLC A;  3KUD B;  3H7P B;  1M94 A;  2LXC A;  4HJK A;  4NY0 A;  3OAW A;  1WJU A;  4HCN B;  2C5L C;  3ZLZ A;  2KDI A;  4WQO B;  2L7R A;  4W9F A;  4BVU C;  4LJP B;  1KOT A;  2FID A;  4BFR A;  3DVN V;  1WE7 A;  3A1Q A;  2M0X A;  1UEL A;  4XZ4 A;  3JSV B;  2CHX A;  1E7V A;  4MGI E;  2JY6 A;  3ZNG C;  4JL9 A;  1LQB A;  5HKH A;  4BOS C;  1WM2 A;  1GNU A;  2WYQ A;  1P3Q U;  2KVR A;  4LDT D;  3PV1 A;  4KSL C;  3KUC B;  1OEY J;  4W9G A;  2LGY A;  3B0A A;  4URK A;  2PE9 A;  2DZM A;  3L0W B;  3A9J B;  2NPT B;  2DEN B;  3QAR A;  4IC7 B;  3UF8 A;  4E3C A;  3SD5 A;  1WMH A;  4PYZ A;  3T9L A;  3MHS D;  3ALB A;  3H9D A;  1S1Q B;  1SIF A;  3CSF A;  4TQ1 A;  4B9K A;  1ZKH A;  3ENE A;  4E74 A;  5L95 C;  2RSU A;  1UZX B;  3QA8 A;  1CMX B;  1WF9 A;  3N3K B;  4P7I A;  2NBW B;  2K8B A;  2KDE B;  4B95 A;  4ANW A;  5AEK B;  1EF1 A;  5J18 A;  4GGQ A;  3LDZ E;  4GDL A;  3ZNH B;  4W9J A;  4DK5 A;  2O6V D;  3PRP B;  4JLC A;  3SU8 X;  2IO3 B;  1WR6 E;  1Q1O A;  1E8Z A;  4MEM A;  3DBL I;  2AL3 A;  4MSQ B;  2KWV B;  2RGF A;  5DCN A;  4HDQ A;  4J6I A;  3QQ8 B;  5D7G A;  3DDC B;  3UIO B;  5IA7 A;  4DBG A;  4TQ0 A;  4MDK E;  3AI5 A;  1Z5S B;  3P2B A;  2DHZ A;  3BIN A;  4I6N B;  2LGD A;  1V5T A;  3APF A;  4ANU A;  3RT3 B;  2FUH B;  3V61 A;  1J0G A;  1TZ1 A;  2MX2 A;  2AYO B;  1WMH B;  3PVL A;  5JHB A;  5CX3 A;  4G11 A;  2KDB A;  2BPS A;  2MW5 A;  2JXX A;  2ZCB A;  4DHZ B;  3RYT A;  2N9P C;  4DHJ D;  3NHE B;  2I1K A;  4IWP A;  2N7E A;  2IO1 B;  3ZKJ C;  3PT2 B;  3PPA A;  2JZZ A;  3V62 A;  4WJN A;  2HTH A;  5CTR C;  4DWF A;  1VD2 A;  4HLE A;  3IFW B;  4OVU A;  3N32 A;  1YX5 B;  1WXA A;  3GZN I;  3L08 A;  3QK0 A;  3SDL C;  3R7Q A;  4M8N A;  1E5W A;  2GBJ A;  5C23 A;  4IWO A;  5KHO A;  3CMM B;  4JQW C;  3GOE A;  4EZL A;  1EO6 A;  2L76 A;  2LRW A;  3WIM A;  4BKG A;  1C3T A;  1T0Y A;  1V2Y A;  2V3S A;  4AJW A;  4FA6 A;  3VHT C;  2DYB A;  2DAJ A;  2MBE A;  4GB9 A;  3NS8 A;  1WX7 A;  1WYW B;  2MBQ A;  3Q3J A;  4KZC A;  4WWP A;  2CKH B;  2N4F A;  2WX1 A;  1WFY A;  2BKR B;  2JF5 A;  3PHX B;  3W1Y A;  2LWP A;  4W9K A;  5DPS A;  3SHQ A;  4F7Z A;  2J0K A;  1X1M A;  5DPR A;  2ZCC A;  1UBI A;  3VUY A;  1UBQ A;  3A33 B;  2KHW B;  3ZTD A;  3DOW A;  3EC8 A;  4F8C B;  2HD5 B;  3KH0 A;  3HM3 A;  3ML9 A;  2KO3 A;  1E8X A;  3A9K B;  3KVF B;  2K39 A;  3IHP C;  3RD2 A;  3VTV A;  2GBN A;  3EHV A;  4ANX A;  4EUT A;  1LXD A;  3L13 A;  4AJY B;  3H1U A;  2L00 B;  3L54 A;  3MTN B;  1R4M I;  2MBO A;  2OJR A;  1KM7 A;  1WJN A;  4IW0 A;  1I42 A;  4GMV A;  4NQL B;  3ML8 A;  2BYE A;  3K9P B;  5TR5 A;  3M63 B;  2MQJ A;  4K7S A;  2KWC A;  4DXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...