4NAWA

Crystal structure of human atg12~atg5-atg16n in complex with a fragment of atg3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
88
structure length
88
Chain Sequence
b'KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ATG12
publication title Structural basis of ATG3 recognition by the autophagic ubiquitin-like protein ATG12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/ligase
total genus 20
structure length 88
sequence length 88
chains with identical sequence E, I, M
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4nawA00
4WWPA 1P0RA 4KVGB 2XK5B 2DYOA 4BKGA 3V6CB 2R2OA 2LGXA 4NNJB 1MG8A 4MGZE 3O65B 4DHZE 5HKHA 5C23A 3PS6A 4XZ4A 2KMAA 2IO3B 4I6LB 2DZMA 3R7RA 5D7GA 2KWUB 2CHZA 4WAAA 1NI2A 3HIZA 4K7UA 3TMPB 4WQOB 1UBIA 4G3XB 2BPSA 3VXWA 4TUUA 5JHBA 1C3TA 3DVGX 1I35A 4GIVA 4DDGD 3A33B 5DCNA 3VVWB 4ZRKA 3W1YA 3H6NA 2K8HA 2MWSB 4AJYB 2LGYA 1KOTA 2ZVNA 2DHZA 2ASQA 1TBEA 3DOWA 2L0TA 3QQ8B 2D10A 3CMMB 3DVNV 4A3OA 2CR5A 2MX2A 1E7UA 2ZNVC 3GOEA 2LI5A 3L17A 1G6JA 3B1LX 2IYDB 1RFAA 1Q0WB 4OVUA 4K7WA 5G2NA 2MBOA 4HXDA 2O6VA 3B08A 4NJ6A 1YX5B 4AUQC 3NY5A 3NZUA 1WR1A 3KUDB 1WZ3A 4RM8A 5AZHA 5C1ZA 2JRHA 3PPAA 3R3MA 2BYVE 3U30A 3L10B 4HCNB 4DHJD 4LJOB 2IO1B 3EECA 4DXAB 4IW0A 1WM3A 3KH0A 4W9EA 4ANWA 3A1QA 1WXMA 2IZVB 4HPLB 4F8CB 5BO4B 3QJZA 1H4RA 3QCAA 3H9DA 2MW5A 1XT9B 2MBBB 2BYFA 1Y8RC 3DBLI 3DQVA 1UZXB 4HCPB 4W9CA 2DZIA 1KLVA 2RR9A 4FULA 1C1YB 1I42A 3ONSA 3QARA 1NDDA 1LXDA 3AU5A 3N32A 4ICVA 2JPHA 3A1QB 1PQSA 2KDEB 2DX5B 2R2QA 4IM0A 2JVCA 2M4NA 1V2YA 2J0KA 2K6DB 2C5LC 1V86A 2KC2A 2CU1A 2V3SA 3APDA 3A4SC 2KDBA 4HJKA 3QAQA 2C7NB 2MSED 4EUTA 5EDSA 4EZKA 1UD7A 2Y5BB 3VHTC 4MJSA 2AL6A 2ZCBA 2HE7A 3JW0X 1WGGA 2DZJA 2RGFA 3ENEA 3IHPC 4GDLB 1WJ6A 4NQKE 3OAWA 5JZEB 1WGRA 5CTRC 1XQQA 2RD0A 2KN5A 2ZVOA 2DYMA 3JVZX 5CHWA 1IYFA 4G50A 4MJSB 2FUHB 4K1RB 2KQ7A 2K1FA 3PZDA 4NY0A 1A5RA 4WJOA 4W9DA 3ZNHB 3ZW3A 3UGBB 4MSMB 3RD2A 3HHMA 4RM9A 3ZRCA 2NS5A 3KYCD 2D11A 3ZNZB 4DK5A 5DPRA 3VTVA 4WJPA 2RSUA 1TTNA 2JY6A 4BOZB 2KFKB 1WGYA 3WALA 4CHKA 2KWCA 2LVPA 1BT0A 1OEYA 1VCBA 1LFDA 2G4DB 2LVQA 2G4SA 2WX0A 4JIOU 3TBLD 1RLFA 2OOBB 3C0RB 4PS3A 5E6OA 1E8ZA 3U8ZA 3TCAA 3KUCB 4M8NA 2NBUA 3ALBA 2ZJDA 2KDIA 2MA9B 2IY0B 2V4LA 4GN1A 4MGKE 2XBBC 3VH3B 3EFUA 3JSVB 1E90A 2REXA 3ZNGC 4FJVB 3H7SA 4IUMB 3RCZA 4G11A 3Q3JA 4E3CA 1WX9A 1WF9A 3R7QA 2BWES 4FJZA 3V6EB 3EC8A 2GMIC 2PPHA 3A9JA 4ZYNA 1GJZA 3TIXA 1V49A 5CHFA 2QHOA 4BKSD 2N9EB 4HK2A 2CHXA 5DPSA 4J6IA 3S2AA 1FXTB 2CS4A 3B0AA 4AWJA 4FADA 4IG7B 4HPMB 2AWTA 5CX3A 3M63B 1SIFA 4IWQA 4FN2A 3K9OB 4G0NB 3SDLC 1GNUA 2N1VA 2MCNB 3DDCB 4TQ0A 3PLUA 1X1MA 2J7QB 2MP2A 2KC1A 2V1YA 2NCNA 5L95C 2BF8B 2LD9A 1E7VA 2ZPNA 4RMAA 4NAWA 2I1JA 4FA6A 1P98A 2WDTB 2L8JA 2GBMA 2GBNA 4HLEA 3VDZA 2NBVB 4AP4C 3M95A 3QK0A 3AU4A 1ZKHA 3PRZA 3X23A 2LVOA 2DZKA 2MP2B 2LASA 4FJYA 2WX1A 4DWFA 1E5WA 1EUVB 2GBRA 1EF1A 3MJWA 1GUAB 2D07B 1U4AA 2C7MB 2GOWA 3PT2B 1WXVA 2DAJA 2JRIB 1WI0A 4LCDE 2NVUI 4NPNA 3VUWA 4A20A 2KD0A 4W9GA 4XC2A 5GMVA 2LZ6A 1L2NA 2K8CA 3ZLZA 3PVLA 4I6NB 1SE9A 2PJHA 1CMXB 1UGMA 3RYTA 3UIOB 4W9KA 2KMCA 2JF5A 1LM8B 5AZGA 3N30A 3PREA 2O6VB 4JL9A 2RPQA 2MRPA 4HWIB 1WMHA 4PS8A 5AZFA 1YIWA 5G55A 1WJUA 3W1SA 2AEHA 4IWPA 1V9JA 4DHZB 2FIDA 4JGHB 2KTRA 1RRBA 3TL5A 4ASWC 2K8BA 3IFWB 2KFJA 3NZSA 4DBGA 2KLCA 1WYWB 2L7RA 4F1SA 2OJRA 2AYOB 3WAPA 1GG3A 1SGHA 2GBJA 4MGIE 2ZCCA 1J8CA 4XX5A 2GBKA 4KZ0A 2DAFA 3VH4B 4IC7B 2L00B 3RUIB 3OJ4B 2MQJA 4K81A 2J0JA 4TQ1A 4URKA 4FLHA 5KHQA 5J2RA 2C9WB 5D6JB 4B95A 4DHJB 2UWQA 2BKRB 4KV2A 4KDLB 4ZDVA 4MSQB 3Q3FA 2LWPA 2BKFA 4EZJA 2KK8A 2M0XA 1WJ4A 2LXAA 3RT3B 3UINB 2K39A 4KIKA 3DBHI 2Z59B 1JRUA 2KNBA 3QA8A 5TR5A 3WAOA 1D3ZA 4LDTB 5D94A 2JT4B 2FNJB 2JZZA 4ZRIA 4PS7A 2IO0B 2D2QA 1P1AA 1ISNA 2B3AA 1WRDB 4W9LA 4ANXA 5L83A 1WIAA 2L3ZA 1IPGA 3H7PA 1UELA 4JQWC 3PV1A 3U7DA 3KW5B 3M3JA 4YL8A 4BVUC 5JH5C 2WYQA 2KX0A 3A9KA 2YLMA 5KHOA 2KOXA 3ZTCA 2MBQA 1P9DU 4PYUA 4B6WA 3L08A 1UH6A 4ANVA 1V81A 1YJ1A 2FCQA 4M8MA 4W9FA 1EO6A 4HVBA 2KLGA 3RZWC 4KSKC 1OQYA 1AARA 4E71A 3K9PB 3RULA 4OVVA 3A9KB 3QHTA 4KSLC 2K25A 3VUYA 2L0FA 2KDFB 3VUXA 3ZDMC 4AOFA 3DBSA 3APFA 4MDKE 3LDZE 2A4ZA 2IO2B 2N7EA 3CSFA 2KQSA 2IBIB 4EOYA 2EMTA 4KZCA 4MEMA 1S1QB 1S3SG 3OLMD 4GB9A 4WWOA 2KZRA 3TJPA 3PHWB 2XK5A 2EKEC 3KYDD 1F9JA 2CKHB 2NPTA 1Z5SB 3BY4B 4BKTA 4GMVA 3WANA 4EEWA 4IM2A 3QC8B 4ANUA 3A9JB 2XEWA 3N3KB 2JXXA 3PHXB 4KDIC 3M62B 3NOBA 2W9NA 3V61A 3QX1A 3V60A 1HE8A 3DPDA 1WZ0A 2N4FA 1WJNA 2O2VA 3L16A 4GXBA 2MBHA 5D2MB 2N9PC 3APCA 4TKNA 3UF8A 3UQAA 3HM3A 2NPTB 4GU2A 1E8XA 1UBQA 3PRMB 4W9JA 3I3TB 4BKSA 4F7ZA 3ZDTA 1NBFC 3GZNI 1WE7A 2Z0DB 3IG3A 1WE6A 3PLVA 3VTUA 2HJ8A 3ZUNA 2O2VB 2M17A 4ZRJA 1WH3A 2HTHA 3ZTDA 2NR2A 3L13A 4EZLA 2Z0EB 5DPTA 4GOCA 2LRWA 4NAWB 2LRUA 3HK0A 1E8YA 3KVFB 2C60A 4CYEA 2KXJA 3RZFA 2O6VD 2KJ6A 1P3QU 2HD5B 4HDQA 5E6NA 5J17A 3A4RA 3ML8A 2M8SA 2G3QB 1OGWA 2A5UA 3JYUA 1RAXA 3PSEB 4II3B 3LJ3A 3PRPB 4JLCA 4BBNF 4E74A 2JZ3B 1KM7A 1J0GA 4W9HA 2BGFA 2VRRB 2N9XA 3SHQA 5LXIB 3DCGA 1KJTA 3PTFC 4GGQA 1Q5WB 3T9LA 3VAWA 3WIMA 3SD5A 3X0WA 1V5TA 1E8WA 2KJRA 1WY8A 4BBNC 2LUEA 3QIJA 5CHVC 5IAAC 2YVCA 4HDOA 3W1SC 1L7YA 3ZIMA 1TZ1A 1XD3B 4W9IA 2KJHB 2L05A 3P2BA 4BOSC 1H8CA 3VFKA 4GDKA 1GC7A 3H1UA 4TV3A 4ICUA 3CSTA 3UIPB 4WJQA 2ZNVB 1WMHB 2FCSA 2FIFA 4WWNA 2PEAA 3SU8X 2ZEQA 4GSWA 4I6PA 1R4NI 3AI5A 2KTRB 2LJ5A 3AXCA 4FHKA 4LDTD 3L0WB 2LXCA 2UYZB 4K7SA 1YX6B 2DENB 5LLIA 4GDKB 4B9KA 4CO7A 3DVNU 3L54A 1YQBA 1YD8U 2KVRA 3ZO5B 1T0YA 5IA7A 2C7HA 2KANA 3DVGY 5E6PA 1VD2A 3HM6X 4GDLA 1IP9A 1WM2A 2DYBA 2J0MA 4LJPB 3CF6E 5J18A 5AEKB 2FAZA 3T8MA 2BYEA 1V80A 1WR6E 3AULA 3NS8A 4MGYE 3V62A 5DPWA 4II2B 2D3GA 1WX7A 1WGHA 4X57B 4EKUA 1Q1OA 2IY1B 3EHVA 1QZEA 1WGDA 3MHSD 2KO3A 4WJNA 1K8RB 2M1MA 4KIKB 2LGDA 2JUOA 1WFYA 3IBEA 3ZNID 2MLBA 2KFKA 3WA0A 2KWVB 1M94A 4EFOA 4FHJA 3DBRI 3VTWA 2N7DA 4MM3A 2K6QA 3MTNB 3QWZB 5LXHA 3NHEB 3H7PB 2ZZPB 2KTFA 3WAMA 3KUZA 1ZGUB 2N1WA 4M0WB 3ML9A 4IM3A 2WWZA 2MBEA 2FCMA 1J19A 1V5OA 3JSVA 2EMSA 1GC6A 1LQBA 1EF5A 2AL3A 2KKCA 2ZPYA 3OJ3A 3ZRFA 4A3PA 3D32A 1WX8A 1R4MI 2L76A 4DDID 4PYZA 2JWZA 3UQBA 2I1KA 1ZW7A 4P7IA 4AJWA 4BFRA 5JHAA 2CHWA 3VQIA 3BINA 2BWFA 3ZVVA 1WXAA 2KX3A 3PGEA 3R66C 4IWOA 4MH0E 4FBJB 1OTRB 3ECIA 1WXSA 1Z2MA 2FCNA 2NBWB 2PE6B 2PE9A 1V6EA 4NJ7A 4NQLB 2G45B 5FR6A 3ZKJC 1OEYJ 4N9F4 1TGZB 4MELA 2KHWB 3IVFA
chains in the Genus database with same CATH superfamily
1P0RA 2DYOA 1FIQA 4OZAA 1BXTA 3V6CB 4MT5A 2LGXA 4NNJB 3AE2B 1JQ4A 4L2YA 2JWUA 4DHZE 5C23A 2K3UA 4WAAA 1E6EB 4ZHOA 3AE4B 4L23A 3AE3B 3VXWA 1C3TA 1V1PA 3DVGX 4DDGD 1K52A 2LGYA 2WDQB 3NZ3A 2ASQA 1VZ8A 1ZDXA 3AECB 2L0TA 4O1NA 2CR5A 3L17A 2WXMA 1QQRA 1Q0WB 4OVUA 2MBOA 3B08A 1YX5B 4AUQC 3Q6BA 3R3MA 4REZA 1K51A 1WM3A 1WXMA 4IKGA 3QJZA 3Q8AA 3QCAA 3T3OA 4HKQA 3H9DA 1Y8RC 1UZXB 3Q69A 1AN8A 2DZIA 2RR9A 3QARA 3N32A 3A1QB 4IM0A 2JVCA 2CU1A 2C7NB 4EZKA 2Y5BB 2ZCBA 3SR6A 2DZJA 4GDLB 1HTOA 3OAWA 1N62A 5JZEB 1WGRA 5CTRC 2BB5A 2DYMA 1IYFA 4G50A 3P63A 2KQ7A 4K1RB 2K1FA 1A5RA 4WJOA 2JZPA 4W9DA 2MJDA 3UGBB 3ZRCA 3HHMA 4RM9A 1YOVB 5JXVA 2D11A 3VTVA 3DBLB 2RSUA 1HZ5A 1MFWA 2LVPA 2WX0A 2G4DB 1RLFA 2OOBB 1V1OA 4PS3A 1I4HA 2IGDA 1JROA 2PW9A 3U4EG 2MA9B 2V4LA 4J3OD 1F77A 3ZNGC 3H7SA 3RCZA 1UWMA 2IGHA 1VR9A 3P1MA 2PPHA 3O13A 5CHFA 2N9EB 3P4QB 4HK2A 2CHXA 3B0AA 4AWJA 3M63B 4JWUC 5EE3A 2INDC 2N1VA 2W3RA 2GLSA 2ON8A 3PLUA 2MP2A 4ZOHC 2LD9A 1E7VA 3DWMA 2I1JA 2WDTB 2L8JA 2NBVB 2H89B 3PRZA 1GUAB 2D07B 3ZXRA 2JRIB 3KQ4A 2NVUI 3I9V1 2WXQA 4A20A 2GRIA 2LZ6A 2K8CA 3ZLZA 4IOIE 2PJHA 3BVZA 1FCCC 4M00A 2O6VB 3R2TA 1OQQA 3GP7A 4HWIB 4PS8A 3W9CB 4ZRQA 4ASWC 1WRIA 4CQNA 4OHJA 2Z8LA 5FKAC 3BIID 3NZSA 2V0GA 1C79A 2L7RA 1HA5A 3VR8B 2DWQA 2ZCCA 1D5XC 1T3QA 4TQ1A 2AX5A 2W3SA 5D6JB 5TSSA 4WURA 4WH4A 4ZDVA 3Q3FA 1FXAA 3DBHI 4OZBA 5D94A 2JT4B 4ARCA 2WXPA 4PS7A 5C2TB 1ISNA 1WRDB 2N0SB 2KT7A 4RGOS 3U7DA 4M0WA 2YEPB 2WYQA 3A9KA 1V8CA 2YLMA 2MBQA 4PYUA 1V81A 2FCQA 1FNUA 1ZP0B 1OQYA 1C76A 3KWVA 3RNCC 1AARA 4E71A 3RULA 4OVVA 1UNSA 3VUYA 1C9FA 2L0FA 3ZDMC 5HI1A 1K50A 3NJTA 3PHWB 1A70A 4ANUA 2XEWA 2W9NA 3V61A 1CQVA 1WZ0A 1T5XD 1WJNA 4JWSC 3ZQ4A 3RNEC 3APCA 3TEWA 1RWSA 2NPTB 1UBQA 4F7ZA 3ZDTA 4YSZB 4LNNA 2V9HA 3EA6A 3IG3A 3VTUA 4DXFA 2O2VB 2M17A 4ZRJA 2HTHA 2NR2A 5DPTA 5EE1A 5H8YE 2LRUA 3KVFB 1RM6C 2KXJA 1N5WA 4C80A 3MHZA 3JYUA 3PSEB 3N9YC 1KM7A 3GE3C 2N9XA 5LXIB 3WIMA 3SD5A 3IAM1 1V5TA 3X0WA 1NI3A 2KJRA 1AYFA 4FXCA 3P42A 1QOBA 1XD3B 4W9IA 3B9JA 2L05A 3P2BA 1YNTE 3MJ5A 1SIJA 4ICUA 4YSYB 2FCSA 2VZKD 2PEAA 4XWTA 4K7SA 4M02A 1YX6B 2DENB 4B9KA 4GDKB 4CO7A 3DVNU 3L54A 3ZO5B 2KANA 4US8A 5E6PA 1VD2A 4GDLA 1ENFA 2DYBA 1KLUD 2FAZA 2AQ1B 3TEYA 3NS8A 3AULA 3FILB 5DPWA 1WGHA 3OG5A 4EKUA 1QZEA 5EE9A 1K8RB 2M1MA 4KIKB 3MC9A 1KTKA 2LGDA 3IBEA 4KKJA 2MLBA 3WCQA 3WA0A 4EFOA 3DBRI 2N7DA 1L0XB 3UI3A 3QWZB 5LXHA 3NHEB 3AE1B 2ZZPB 3FAHA 2MBEA 1J19A 3OJ3A 2ZPYA 1LQBA 2WXJA 2BQQA 4A3PA 3IAS1 1YN4A 2L76A 1FD6A 4PYZA 3UQBA 2I1KA 4AJWA 5JHAA 2CHWA 3ZVVA 4IWOA 4MH0E 3AM9A 2PE6B 2NBWB 1F2RI 2KHWB 1ACCA 4BKGA 2WLBA 2WDRB 1L5PA 1C78A 1ZUD2 3O65B 5HKHA 4XZ4A 1ZDVA 4K7UA 1SSNA 3V05A 2BPSA 3BYTB 2BS4B 1WYGA 5DCNA 2Q5WD 3GB1A 1R4MB 2MHJA 2ZVNA 2M19A 3RNAC 3MFGA 4RNAA 1TBEA 3QQ8B 1Y56A 2D10A 3DVNV 4C7ZA 2MX2A 1E7UA 3GOEA 2LI5A 2WU5B 2IYDB 4K7WA 2O6VA 1B9RA 4NJ6A 5BMHA 3NZUA 3KUDB 5C1ZA 2JRHA 3U30A 2BYVE 1NENB 1C4CA 3KH0A 5LNK1 4DQOC 2BYTA 3ZJTA 5BO4B 1H4RA 2MW5A 3Q8EA 4KX6B 2BYFA 3DQVA 4HCPB 4W9CA 3Q3OC 2QIEB 1L6VA 2WXKA 1I42A 4ICVA 1SE2A 1PQSA 2IDYA 2M4NA 2KVZA 2KC2A 2V3SA 2KDBA 2MSED 4EUTA 1UD7A 5I4DA 4MJSA 2AL6A 2M0AA 2HE7A 3JW0X 4C56C 4LNOA 3ENEA 2UU7A 4XYCA 2FUHB 2VZKB 3PZDA 3ZNHB 2FBWB 3KYCD 5MPOA 3ZNZB 2QDFA 2KFKB 2KWCA 1VCBA 2G4SA 3FKYA 4MM3B 3U8ZA 3KUCB 3ALBA 5G5GA 4YXDB 4GN1A 3MC0B 2ONQA 3JSVB 1RFKA 1ROEA 1QOAA 4E3CA 4TSSA 1WF9A 1TYGB 2BWES 3Q14C 1GJZA 3C8YA 1GB1A 2QMTA 5DPSA 5AUKA 4IG7B 4M01A 5CX3A 3R8BA 4IWQA 2BB6A 3K9OB 1JRPA 1C4AA 2CU3A 3DDCB 1YQ4B 1XLOA 1YN5A 2JX5A 1TS5A 1X1MA 2J7QB 2RPVA 2GBNA 4HLEA 1ZOYB 3M95A 3QK0A 2D3AA 3R2IA 2RMMA 4ITKA 2PKOA 3AEEB 2DZKA 3RNGC 2FE8A 1E5WA 2KYWA 1EF1A 2OJWA 2GOWA 1WI0A 3HUIA 4LCDE 3VUWA 2KD0A 1L2NA 4YSXB 1CMXB 3RYTA 3TEZA 3UIOB 4W9KA 1EM7A 1JWUD 3DHHC 3TEXA 5G55A 3W1SA 3NS1A 2PLPA 1RRBA 1L4ZB 2MH7A 2KFJA 4DBGA 2KLCA 1IBXB 3WAPA 2AYOB 1GG3A 1SGHA 2KMMA 2GBJA 3B2GA 4MGIE 4XX5A 2L00B 3OJ4B 2MQJA 4FLHA 5KHQA 1DGJA 4B95A 2BKRB 4KDLB 1KH0A 1QILA 4C7YA 2K5PA 2KK8A 1XCTL 2LXAA 1JWMD 4KIKA 4P1BC 5TR5A 3RNBC 1D3ZA 3WAOA 2FNJB 4ZRIA 2B3AA 3AE6B 3AEGB 2L3ZA 1IPGA 1CZPA 3AB5A 4JQWC 4BVUC 1D5MC 5KHOA 2KOXA 2BT6A 1XLPA 1UH6A 2PVGC 1VDVA 2KLGA 4KSKC 4YT0B 2WXNA 3VUXA 2IJ0A 3APFA 2IO2B 1XEEA 2IBIB 5E6JA 1T0QC 4WWMA 3AMZA 2HTME 2KZRA 4BKTA 4N59A 3QC8B 2NTSA 3A9JB 5D3DA 2JXXA 4KDIC 4GXBA 4LLGM 5D2MB 1YJIA 1PYWD 3UQAA 1AW7A 3HM3A 1STEA 4BKSA 1L6UA 4US9A 3GZNI 1QKZA 2Z0DB 4Q2JA 1E10A 3PLVA 3EUB2 2HJ8A 1N63A 2WXIA 3ZTDA 4OW0A 1C4PA 2ICIA 2JU6X 3HK0A 1E8YA 2C60A 4OZCA 1ET6A 3BVGA 1XXGA 4HDQA 1ZPSA 5J17A 3A4RA 2M8SA 2G3QB 2A5UA 4E74A 4BBNF 4HEA1 2JZ3B 4PT5A 1MHXA 2BGFA 3T9LA 4KGTA 1D6EC 2LUEA 3QIJA 5IAAC 1NEKB 2XNAC 4HDOA 3GE8C 4RFBA 4RH6A 1L7YA 1KFYB 1H8CA 3SEBA 3H1UA 3UIPB 1WMHB 1TIFA 2ZEQA 4GSWA 1R4NI 1F0ZA 2KTRB 2LJ5A 2V4IB 3AXCA 3MP9A 4LDTD 1MI0A 3L0WB 1SE4A 2UYZB 3RFZB 4N6EB 3DVGY 3U2SC 2QJLA 1IP9A 2J0MA 2WXRA 2WXFA 4XWWA 5J18A 2W54A 4B0EA 2CJNA 3T8MA 4D2KA 1DYQA 3V62A 4II2B 1WX7A 2PIAA 3I5JC 1VZ7A 1WFYA 3IXSA 3AH7A 2KFKA 1N5XA 4MM3A 3MTNB 3H7PB 4AS1A 2B76B 3WAMA 2N1WA 3JSVA 1V5OA 2KKCA 1JW9D 4DDID 1JMLA 2JWZA 4QAYA 1HQRD 1ZW7A 4P7IA 4RF1A 1WXAA 3R66C 2FCNA 3KLSX 1FNWA 4UDUC 2ZW1A 5FR3A 2PMVA 4N9F4 5HHDG 1TGZB 2G9HD 2BS3B 3IVFA 1ESFA 4WWPA 2XK5B 1YN3A 2QSDA 1KLGD 2R2OA 1MG8A 3AEAB 1I4QA 3PS6A 2DZMA 3R7RA 2KWUB 1EWCA 1UBIA 3PZ8A 5JHBA 1I35A 3VVWB 4ZRKA 3W1YA 1PGXA 2K8HA 2MWSB 4AJYB 1KOTA 1HEZE 1I4PA 1SBBB 3DOWA 4KGSA 1QOFA 3CMMB 4A3OA 3ABVB 2ZNVC 2W55A 2INCC 3NY5A 1WR1A 4LNFA 3L10B 1TKGA 4HCNB 3RMKC 1JWAD 2IO1B 3I63C 4DXAB 4W9EA 3A1QA 4F8CB 3ZJVA 2HDEA 5BYSA 3DBLI 5IO9A 1LGRA 1KLVA 3TSSA 2LGSA 3DHGC 1PGAA 3ONSA 1FFVA 1NDDA 2JPHA 2DX5B 3ZXVA 2K6DB 2C5LC 1V86A 3Q3MC 5EDSA 1HXYD 3HVZA 1XO3A 3VHTC 4B0MA 1WGGA 2KN4A 2RGFA 3E56A 3IHPC 1WJ6A 4NQKE 1FM0D 1L4DB 2QILA 2KN5A 2RD0A 2ZVOA 4A90A 3EGRA 2XN9C 3ZW3A 1TS4A 1I4XA 3Q8FA 4WJPA 4BOZB 4CHKA 2M56B 3WALA 1BT0A 1OEYA 3TBLD 1LFDA 2LVQA 1NYRA 1E8ZA 3SFEB 1JWBD 3TCAA 3NVWA 4M8NA 2KDIA 1TZOA 3VH3B 3ETRA 4USAA 1T0RC 3EFUA 4P1CC 2REXA 4FJVB 2WDVB 1T6BX 4G11A 3Q3JA 5AUIA 1UUPA 3R7QA 3V6EB 3ZYYX 3EC8A 4P6VF 3A9JA 4ZYNA 2NTTA 4HPPA 1V49A 2IPKD 3S2AA 1L0YB 1K53A 4HPMB 4NJCA 2R61A 5BMIA 3AV8A 4G0NB 3SDLC 3NG0A 2MCNB 4L1BA 3Q8CA 1UWXA 2V1YA 2NCNA 2BF8B 4RMAA 2GBMA 1F2RC 2WS3B 4AP4C 3RPFC 1HZ6A 2LVOA 2MP2B 2WX1A 5BYQA 3MJWA 3PT2B 1U4AA 1FEHA 2DAJA 5FK9C 5EE0A 2N9KA 2WHIA 4NPNA 2G1EA 3AE7B 2E3TA 3BZDB 4EE2A 2JXTA 3PVLA 1NYQA 4I6NB 3N1XC 3U52E 3C19A 1UGMA 3Q8BA 1BUIC 1MVKA 1WSPA 2KMCA 3AE9B 2JF5A 3GS2A 5AZGA 3NVZA 2N9LA 3PREA 3BYYB 4JL9A 2RPQA 4KKIA 1WWTA 2MRPA 3AE5B 1WMHA 5AZFA 3LB8C 2LHDA 4BZAA 2AEHA 1V9JA 4DHZB 3SFDB 4JGHB 5GXGB 2KTRA 5BYRA 3TL5A 1IGDA 3NUHB 4PK1A 1VZ6A 4F1SA 1KRHA 2OJRA 4AQ7A 1J8CA 2GBKA 4KZ0A 2DAFA 3VH4B 4K81A 3RN9C 4URKA 1ZE3D 2C9WB 3BVMA 1JCKB 2UWQA 4KV2A 4MSQB 2BKFA 3AN1A 3RT3B 4LNIA 1FRDA 3ZGZA 2Z59B 1JRUA 2KNBA 3QA8A 2IO0B 1C77A 3H7PA 3L4PA 2WXGA 4KGRA 3KW5B 3M3JA 3N1ZC 3ZTCA 1F52A 1P9DU 3KWLA 1L0VB 1UF0A 1ZXHA 1TKYA 3HRDD 3RZWC 3K9PB 3A9KB 3QHTA 4KSLC 3VR9B 4H2AA 4AOFA 4MDKE 3LDZE 2A4ZA 2LEKA 4ARIA 2JSVX 4C00A 3CSFA 4A6QA 2I38A 1S1QB 1GOZA 3OLMD 1FNVA 3DBHB 3TJPA 2XK5A 3KYDD 5IOIA 1F9JA 2NPTA 1Z5SB 4EEWA 4IM2A 3N3KB 3NOBA 1HTQA 3QX1A 1HE8A 2O2VA 2MBHA 2Y3AA 3PRMB 4S17A 3I3TB 4HJGE 4NAMA 1PUTA 2RDHA 3RI7C 2SAKA 1WE7A 1FFUA 1WE6A 4YTPB 3AEFB 4WIPA 1WH3A 2LUMA 4EZLA 5HG2A 2Z0EB 1QLBB 4GOCA 4NAWB 4CYEA 2EKIA 3RZFA 2O6VD 1SB3C 3BWUD 1MJDA 5E6NA 1OGWA 1RAXA 3J9CA 3PRPB 3NRZA 2VRRB 3HVDA 3SHQA 1KJTA 3PTFC 4GGQA 3VAWA 3AEDB 4BBNC 1FCLA 4HRSA 3W1SC 3ZIMA 1TZ1A 2IGGA 2KJHB 4BOSC 4LK0M 3CWIA 4K3CA 4GDKA 3CSTA 2ZNVB 3AEBB 4WWNA 1V97A 4I6PA 4TMAB 2INNE 1YJJA 2LXCA 5LLIA 4R3DA 1GPXA 2PVOD 2YEPF 5BMGA 3FILA 1FRRA 1YQBA 1XCQL 2KVRA 1T0YA 1E0ZA 2SEBD 2VH1A 5D3IB 2WP9B 3CF6E 1J7AA 2WXOA 2BYEA 1WR6E 1SE3A 2D3GA 1Q1OA 1SF0A 3EHVA 4WQMA 1WGDA 4WJNA 1DOYA 2JUOA 3ZNID 2K9XA 4ZYSA 3VRAB 1QF6A 1GB4A 1M94A 3AE8B 3VTWA 3T3NA 2K6QA 2KWDA 2H88B 1ZGUB 3ML9A 1E7PB 2Y5PA 3B2FA 2DBYA 5H92C 3Q3NC 3D32A 1WX8A 3W5VB 1R4MI 4RGMA 1D5ZC 1TT5B 4BFRA 3BINA 2BWFA 2ZW0A 1DOIA 3PZ7A 3PGEA 4FBJB 1FMAD 1OTRB 2W82A 1Z2MA 4NJ7A 3N20C 3P4RB 1OEYJ 1N60A 2WGSA 1P7FA 4KVGB 2N7JA 2JYEA 4YTMB 4MGZE 2JQRB 3DBRB 2KMAA 2IO3B 4I6LB 2K22A 5D7GA 1TS3A 4LTUA 2CHZA 2J53A 1NI2A 1EU4A 3HIZA 4BAXA 3TMPB 3BK1A 4WQOB 4G3XB 1IUEA 4TUUA 4GIVA 3A33B 1PDXA 2BTEA 1JALA 2FUG1 2DNFA 3U7ZA 3H6NA 4NZLB 2DHZA 4RGNA 4ZRPA 3P4PB 4C4VB 2JYTA 2QEJC 1G6JA 3B1LX 1OQRA 1RFAA 2K0PA 2X8XX 5G2NA 4HXDA 3VRBB 4IDIA 1WZ3A 4RM8A 5AZHA 3PPAA 4DHJD 4LJOB 3EECA 2V3NA 4IW0A 2BW2A 4ANWA 2IZVB 3OWEB 4HPLB 4HKZE 5G5HA 3E9SA 4WAFA 1XT9B 2MBBB 2Y5CA 3PO0A 2NMQA 4FULA 1SJHD 5T8IA 2LMCA 4JE3B 1FO4A 1C1YB 1E9MA 2RDBC 2V3PA 2WNMA 2BVCA 1LXDA 3AU5A 2KDEB 2TSSA 1WGKA 4K3BA 2R2QA 1V2YA 2J0KA 4HJKA 3APDA 3A4SC 3QAQA 4RCOA 1I7HA 1XQQA 5CHWA 5C3JB 3JVZX 3Q2AC 4MJSB 3LXFA 4NY0A 2L32A 4MSMB 3RD2A 1D4BA 2NS5A 2WU2B 2GI9A 4DK5A 5DPRA 2QC8A 4ZHPA 2KQ4X 2L52A 1TTNA 2JY6A 1WGYA 4XE0A 4JIOU 2J42A 3NVVA 3C0RB 5E6OA 3DHIC 2WXLA 2WXHA 2NBUA 2ZJDA 1UGJA 4XDCA 2IY0B 3BK2A 4MGKE 2XBBC 1E90A 1PGBA 4IUMB 4HROA 4RGTA 4YTNB 1MG4A 1WX9A 1EWYC 3MC8A 1I4RA 4FJZA 1VRAB 2GMIC 2LGIA 3TIXA 5HFYA 2QHOA 4BKSD 4J6IA 1FXTB 2CS4A 2LHEA 4FADA 1XLQA 2LFIA 2AWTA 1R7SA 1SIFA 2J4XA 4FN2A 4A9AA 2J52A 1GNUA 3IT4B 4TQ0A 2KC1A 5L95C 3URYA 2ZPNA 4NAWA 4FA6A 1P98A 3VDZA 4LNKA 3AU4A 1ZKHA 3X23A 2LASA 4FJYA 1V1PB 4DWFA 1EUVB 1FPYA 2GBRA 4JX1C 2C7MB 2MJEA 1WXVA 5IN7A 4W9GA 4XC2A 5GMVA 2E6XA 2CJOA 2D3BA 1SE9A 4ACFA 1LM8B 3N30A 3W2DA 2D5GA 1QOGA 1IBXA 1YIWA 1WJUA 4IWPA 1SJED 2FIDA 2L1AA 2K8BA 3IFWB 4P16A 2BS2B 1N6ZA 1T0SC 1WYWB 3LYYA 1OFFA 4MACA 1AWDA 4IC7B 1TS2A 4YWGG 3RNFC 3RUIB 2J0JA 1XLNA 5J2RA 4DHJB 2LWPA 4EZJA 2M0XA 1WJ4A 3UINB 1Q10A 2K39A 2KACA 1MPEA 1ZXIA 4LDTB 1YMHE 2JZZA 2D2QA 1P1AA 2HJ1A 2VH2A 1P7EA 4W9LA 4ANXA 5L83A 1RYJA 1WIAA 3ZJUA 1UELA 3PV1A 5JH5C 4YL8A 2ACZB 2KX0A 4A8XC 1KF6B 3IT6B 4GLSC 1NVID 4B6WA 3L08A 4ANVA 1YJ1A 4M8MA 4W9FA 1FXIA 1EO6A 2L83A 4HVBA 2K25A 2KDFB 1CK1A 3DBSA 1CJEA 2KAJA 4MH8A 2N7EA 2KQSA 1TKEA 4EOYA 2EMTA 4KZCA 4MEMA 1S3SG 2GB1A 4GB9A 4WWOA 4A55A 4N58A 2EKEC 2CKHB 1QT9A 3BY4B 4GMVA 3WANA 1XF5L 2OHFA 3PHXB 1IGCA 3M62B 4S0RA 2OEDA 3V60A 3DPDA 1WXQA 2N4FA 4XDDA 3L16A 2I2YA 2EELA 1TY0A 2X38A 2N9PC 4TKNA 4XGAB 3UF8A 4GU2A 1E8XA 4W9JA 1NBFC 2AQ3B 2RDGA 3ZUNA 3L13A 2AQ2B 2LRWA 3V3XA 4DXGA 2KJ6A 4C4VA 1PFDA 1P3QU 2HD5B 3ML8A 3W5UB 4II3B 3LJ3A 4JLCA 3NVYA 1J0GA 4W9HA 1TY2A 2MEKA 3DCGA 1Q5WB 1F1HA 1E8WA 1WY8A 2KDMA 5CHVC 2YVCA 1I4GA 4JPSA 1YQ3B 1DOXA 3FC4A 1EU3A 3VFKA 1GC7A 2LJIA 4TV3A 3GZNB 4WJQA 1ET9A 2FIFA 1TJEA 3SU8X 3AI5A 4FHKA 1GAQB 3CIRB 3H8HA 1YD8U 5IA7A 2C7HA 3HM6X 1SXTA 2BBCA 3EFCA 1J7BA 1WM2A 4LJPB 1JWSD 5AEKB 1V80A 4MGYE 1N61A 1VJKA 4X57B 1M4VA 2D3CA 2IY1B 1MHHE 3MHSD 2QCZA 2KO3A 2DLBA 5IKCM 4RF0A 2KWVB 4FHJA 1B1ZA 1J7CA 3P4SB 5IP4D 1R4NB 2KTFA 3KUZA 4M0WB 4IM3A 2WWZA 3DWGC 2FCMA 2EMSA 1GC6A 3N1YC 1EF5A 1SEBD 2AL3A 3ZRFA 1VLBA 2INPE 1BMLC 2WQYB 1LO5D 3VQIA 2KX3A 3TUOA 3ECIA 1WXSA 2PE9A 4NQLB 1V6EA 2G45B 2MJ3A 4OVZA 5FR6A 3ZKJC 2PTLA 4MELA 3I57A
chains in the Genus database with same CATH topology
4WWPA 1P0RA 4KVGB 2XK5B 2DYOA 4BKGA 3V6CB 2R2OA 2LGXA 4NNJB 1MG8A 4MGZE 3O65B 4DHZE 5HKHA 5C23A 3PS6A 4XZ4A 2KMAA 2IO3B 4I6LB 2DZMA 3R7RA 5D7GA 2KWUB 2CHZA 4WAAA 1NI2A 3HIZA 4K7UA 3TMPB 4WQOB 1UBIA 4G3XB 2BPSA 3VXWA 4TUUA 5JHBA 1C3TA 3DVGX 1I35A 4GIVA 4DDGD 3A33B 5DCNA 3VVWB 4ZRKA 3W1YA 3H6NA 2K8HA 2MWSB 4AJYB 2LGYA 1KOTA 2ZVNA 2DHZA 2ASQA 1TBEA 3DOWA 2L0TA 3QQ8B 2D10A 3CMMB 3DVNV 4A3OA 2CR5A 2MX2A 1E7UA 2ZNVC 3GOEA 2LI5A 3L17A 1G6JA 3B1LX 2IYDB 1RFAA 1Q0WB 4OVUA 4K7WA 5G2NA 2MBOA 4HXDA 2O6VA 3B08A 4NJ6A 1YX5B 4AUQC 3NY5A 3NZUA 1WR1A 3KUDB 1WZ3A 4RM8A 5AZHA 5C1ZA 2JRHA 3PPAA 3R3MA 2BYVE 3U30A 3L10B 4HCNB 4DHJD 4LJOB 2IO1B 3EECA 4DXAB 4IW0A 1WM3A 3KH0A 4W9EA 4ANWA 3A1QA 1WXMA 2IZVB 4HPLB 4F8CB 5BO4B 3QJZA 1H4RA 3QCAA 3H9DA 2MW5A 1XT9B 2MBBB 2BYFA 1Y8RC 3DBLI 3DQVA 1UZXB 4HCPB 4W9CA 2DZIA 1KLVA 2RR9A 4FULA 1C1YB 1I42A 3ONSA 3QARA 1NDDA 1LXDA 3AU5A 3N32A 4ICVA 2JPHA 3A1QB 1PQSA 2KDEB 2DX5B 2R2QA 4IM0A 2JVCA 2M4NA 1V2YA 2J0KA 2K6DB 2C5LC 1V86A 2KC2A 2CU1A 2V3SA 3APDA 3A4SC 2KDBA 4HJKA 3QAQA 2C7NB 2MSED 4EUTA 5EDSA 4EZKA 1UD7A 2Y5BB 3VHTC 4MJSA 2AL6A 2ZCBA 2HE7A 3JW0X 1WGGA 2DZJA 2RGFA 3ENEA 3IHPC 4GDLB 1WJ6A 4NQKE 3OAWA 5JZEB 1WGRA 5CTRC 1XQQA 2RD0A 2KN5A 2ZVOA 2DYMA 3JVZX 5CHWA 1IYFA 4G50A 4MJSB 2FUHB 4K1RB 2KQ7A 2K1FA 3PZDA 4NY0A 1A5RA 4WJOA 4W9DA 3ZNHB 3ZW3A 3UGBB 4MSMB 3RD2A 3HHMA 4RM9A 3ZRCA 2NS5A 3KYCD 2D11A 3ZNZB 4DK5A 5DPRA 3VTVA 4WJPA 2RSUA 1TTNA 2JY6A 4BOZB 2KFKB 1WGYA 3WALA 4CHKA 2KWCA 2LVPA 1BT0A 1OEYA 1VCBA 1LFDA 2G4DB 2LVQA 2G4SA 2WX0A 4JIOU 3TBLD 1RLFA 2OOBB 3C0RB 4PS3A 5E6OA 1E8ZA 3U8ZA 3TCAA 3KUCB 4M8NA 2NBUA 3ALBA 2ZJDA 2KDIA 2MA9B 2IY0B 2V4LA 4GN1A 4MGKE 2XBBC 3VH3B 3EFUA 3JSVB 1E90A 2REXA 3ZNGC 4FJVB 3H7SA 4IUMB 3RCZA 4G11A 3Q3JA 4E3CA 1WX9A 1WF9A 3R7QA 2BWES 4FJZA 3V6EB 3EC8A 2GMIC 2PPHA 3A9JA 4ZYNA 1GJZA 3TIXA 1V49A 5CHFA 2QHOA 4BKSD 2N9EB 4HK2A 2CHXA 5DPSA 4J6IA 3S2AA 1FXTB 2CS4A 3B0AA 4AWJA 4FADA 4IG7B 4HPMB 2AWTA 5CX3A 3M63B 1SIFA 4IWQA 4FN2A 3K9OB 4G0NB 3SDLC 1GNUA 2N1VA 2MCNB 3DDCB 4TQ0A 3PLUA 1X1MA 2J7QB 2MP2A 2KC1A 2V1YA 2NCNA 5L95C 2BF8B 2LD9A 1E7VA 2ZPNA 4RMAA 4NAWA 2I1JA 4FA6A 1P98A 2WDTB 2L8JA 2GBMA 2GBNA 4HLEA 3VDZA 2NBVB 4AP4C 3M95A 3QK0A 3AU4A 1ZKHA 3PRZA 3X23A 2LVOA 2DZKA 2MP2B 2LASA 4FJYA 2WX1A 4DWFA 1E5WA 1EUVB 2GBRA 1EF1A 3MJWA 1GUAB 2D07B 1U4AA 2C7MB 2GOWA 3PT2B 1WXVA 2DAJA 2JRIB 1WI0A 4LCDE 2NVUI 4NPNA 3VUWA 4A20A 2KD0A 4W9GA 4XC2A 5GMVA 2LZ6A 1L2NA 2K8CA 3ZLZA 3PVLA 4I6NB 1SE9A 2PJHA 1CMXB 1UGMA 3RYTA 3UIOB 4W9KA 2KMCA 2JF5A 1LM8B 5AZGA 3N30A 3PREA 2O6VB 4JL9A 2RPQA 2MRPA 4HWIB 1WMHA 4PS8A 5AZFA 1YIWA 5G55A 1WJUA 3W1SA 2AEHA 4IWPA 1V9JA 4DHZB 2FIDA 4JGHB 2KTRA 1RRBA 3TL5A 4ASWC 2K8BA 3IFWB 2KFJA 3NZSA 4DBGA 2KLCA 1WYWB 2L7RA 4F1SA 2OJRA 2AYOB 3WAPA 1GG3A 1SGHA 2GBJA 4MGIE 2ZCCA 1J8CA 4XX5A 2GBKA 4KZ0A 2DAFA 3VH4B 4IC7B 2L00B 3RUIB 3OJ4B 2MQJA 4K81A 2J0JA 4TQ1A 4URKA 4FLHA 5KHQA 5J2RA 2C9WB 5D6JB 4B95A 4DHJB 2UWQA 2BKRB 4KV2A 4KDLB 4ZDVA 4MSQB 3Q3FA 2LWPA 2BKFA 4EZJA 2KK8A 2M0XA 1WJ4A 2LXAA 3RT3B 3UINB 2K39A 4KIKA 3DBHI 2Z59B 1JRUA 2KNBA 3QA8A 5TR5A 3WAOA 1D3ZA 4LDTB 5D94A 2JT4B 2FNJB 2JZZA 4ZRIA 4PS7A 2IO0B 2D2QA 1P1AA 1ISNA 2B3AA 1WRDB 4W9LA 4ANXA 5L83A 1WIAA 2L3ZA 1IPGA 3H7PA 1UELA 4JQWC 3PV1A 3U7DA 3KW5B 3M3JA 4YL8A 4BVUC 5JH5C 2WYQA 2KX0A 3A9KA 2YLMA 5KHOA 2KOXA 3ZTCA 2MBQA 1P9DU 4PYUA 4B6WA 3L08A 1UH6A 4ANVA 1V81A 1YJ1A 2FCQA 4M8MA 4W9FA 1EO6A 4HVBA 2KLGA 3RZWC 4KSKC 1OQYA 1AARA 4E71A 3K9PB 3RULA 4OVVA 3A9KB 3QHTA 4KSLC 2K25A 3VUYA 2L0FA 2KDFB 3VUXA 3ZDMC 4AOFA 3DBSA 3APFA 4MDKE 3LDZE 2A4ZA 2IO2B 2N7EA 3CSFA 2KQSA 2IBIB 4EOYA 2EMTA 4KZCA 4MEMA 1S1QB 1S3SG 3OLMD 4GB9A 4WWOA 2KZRA 3TJPA 3PHWB 2XK5A 2EKEC 3KYDD 1F9JA 2CKHB 2NPTA 1Z5SB 3BY4B 4BKTA 4GMVA 3WANA 4EEWA 4IM2A 3QC8B 4ANUA 3A9JB 2XEWA 3N3KB 2JXXA 3PHXB 4KDIC 3M62B 3NOBA 2W9NA 3V61A 3QX1A 3V60A 1HE8A 3DPDA 1WZ0A 2N4FA 1WJNA 2O2VA 3L16A 4GXBA 2MBHA 5D2MB 2N9PC 3APCA 4TKNA 3UF8A 3UQAA 3HM3A 2NPTB 4GU2A 1E8XA 1UBQA 3PRMB 4W9JA 3I3TB 4BKSA 4F7ZA 3ZDTA 1NBFC 3GZNI 1WE7A 2Z0DB 3IG3A 1WE6A 3PLVA 3VTUA 2HJ8A 3ZUNA 2O2VB 2M17A 4ZRJA 1WH3A 2HTHA 3ZTDA 2NR2A 3L13A 4EZLA 2Z0EB 5DPTA 4GOCA 2LRWA 4NAWB 2LRUA 3HK0A 1E8YA 3KVFB 2C60A 4CYEA 2KXJA 3RZFA 2O6VD 2KJ6A 1P3QU 2HD5B 4HDQA 5E6NA 5J17A 3A4RA 3ML8A 2M8SA 2G3QB 1OGWA 2A5UA 3JYUA 1RAXA 3PSEB 4II3B 3LJ3A 3PRPB 4JLCA 4BBNF 4E74A 2JZ3B 1KM7A 1J0GA 4W9HA 2BGFA 2VRRB 2N9XA 3SHQA 5LXIB 3DCGA 1KJTA 3PTFC 4GGQA 1Q5WB 3T9LA 3VAWA 3WIMA 3SD5A 3X0WA 1V5TA 1E8WA 2KJRA 1WY8A 4BBNC 2LUEA 3QIJA 5CHVC 5IAAC 2YVCA 4HDOA 3W1SC 1L7YA 3ZIMA 1TZ1A 1XD3B 4W9IA 2KJHB 2L05A 3P2BA 4BOSC 1H8CA 3VFKA 4GDKA 1GC7A 3H1UA 4TV3A 4ICUA 3CSTA 3UIPB 4WJQA 2ZNVB 1WMHB 2FCSA 2FIFA 4WWNA 2PEAA 3SU8X 2ZEQA 4GSWA 4I6PA 1R4NI 3AI5A 2KTRB 2LJ5A 3AXCA 4FHKA 4LDTD 3L0WB 2LXCA 2UYZB 4K7SA 1YX6B 2DENB 5LLIA 4GDKB 4B9KA 4CO7A 3DVNU 3L54A 1YQBA 1YD8U 2KVRA 3ZO5B 1T0YA 5IA7A 2C7HA 2KANA 3DVGY 5E6PA 1VD2A 3HM6X 4GDLA 1IP9A 1WM2A 2DYBA 2J0MA 4LJPB 3CF6E 5J18A 5AEKB 2FAZA 3T8MA 2BYEA 1V80A 1WR6E 3AULA 3NS8A 4MGYE 3V62A 5DPWA 4II2B 2D3GA 1WX7A 1WGHA 4X57B 4EKUA 1Q1OA 2IY1B 3EHVA 1QZEA 1WGDA 3MHSD 2KO3A 4WJNA 1K8RB 2M1MA 4KIKB 2LGDA 2JUOA 1WFYA 3IBEA 3ZNID 2MLBA 2KFKA 3WA0A 2KWVB 1M94A 4EFOA 4FHJA 3DBRI 3VTWA 2N7DA 4MM3A 2K6QA 3MTNB 3QWZB 5LXHA 3NHEB 3H7PB 2ZZPB 2KTFA 3WAMA 3KUZA 1ZGUB 2N1WA 4M0WB 3ML9A 4IM3A 2WWZA 2MBEA 2FCMA 1J19A 1V5OA 3JSVA 2EMSA 1GC6A 1LQBA 1EF5A 2AL3A 2KKCA 2ZPYA 3OJ3A 3ZRFA 4A3PA 3D32A 1WX8A 1R4MI 2L76A 4DDID 4PYZA 2JWZA 3UQBA 2I1KA 1ZW7A 4P7IA 4AJWA 4BFRA 5JHAA 2CHWA 3VQIA 3BINA 2BWFA 3ZVVA 1WXAA 2KX3A 3PGEA 3R66C 4IWOA 4MH0E 4FBJB 1OTRB 3ECIA 1WXSA 1Z2MA 2FCNA 2NBWB 2PE6B 2PE9A 1V6EA 4NJ7A 4NQLB 2G45B 5FR6A 3ZKJC 1OEYJ 4N9F4 1TGZB 4MELA 2KHWB 3IVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WWP A;  1P0R A;  4KVG B;  2XK5 B;  2DYO A;  4BKG A;  3V6C B;  2R2O A;  2LGX A;  4NNJ B;  1MG8 A;  4MGZ E;  3O65 B;  4DHZ E;  5HKH A;  5C23 A;  3PS6 A;  4XZ4 A;  2KMA A;  2IO3 B;  4I6L B;  2DZM A;  3R7R A;  5D7G A;  2KWU B;  2CHZ A;  4WAA A;  1NI2 A;  3HIZ A;  4K7U A;  3TMP B;  4WQO B;  1UBI A;  4G3X B;  2BPS A;  3VXW A;  4TUU A;  5JHB A;  1C3T A;  3DVG X;  1I35 A;  4GIV A;  4DDG D;  3A33 B;  5DCN A;  3VVW B;  4ZRK A;  3W1Y A;  3H6N A;  2K8H A;  2MWS B;  4AJY B;  2LGY A;  1KOT A;  2ZVN A;  2DHZ A;  2ASQ A;  1TBE A;  3DOW A;  2L0T A;  3QQ8 B;  2D10 A;  3CMM B;  3DVN V;  4A3O A;  2CR5 A;  2MX2 A;  1E7U A;  2ZNV C;  3GOE A;  2LI5 A;  3L17 A;  1G6J A;  3B1L X;  2IYD B;  1RFA A;  1Q0W B;  4OVU A;  4K7W A;  5G2N A;  2MBO A;  4HXD A;  2O6V A;  3B08 A;  4NJ6 A;  1YX5 B;  4AUQ C;  3NY5 A;  3NZU A;  1WR1 A;  3KUD B;  1WZ3 A;  4RM8 A;  5AZH A;  5C1Z A;  2JRH A;  3PPA A;  3R3M A;  2BYV E;  3U30 A;  3L10 B;  4HCN B;  4DHJ D;  4LJO B;  2IO1 B;  3EEC A;  4DXA B;  4IW0 A;  1WM3 A;  3KH0 A;  4W9E A;  4ANW A;  3A1Q A;  1WXM A;  2IZV B;  4HPL B;  4F8C B;  5BO4 B;  3QJZ A;  1H4R A;  3QCA A;  3H9D A;  2MW5 A;  1XT9 B;  2MBB B;  2BYF A;  1Y8R C;  3DBL I;  3DQV A;  1UZX B;  4HCP B;  4W9C A;  2DZI A;  1KLV A;  2RR9 A;  4FUL A;  1C1Y B;  1I42 A;  3ONS A;  3QAR A;  1NDD A;  1LXD A;  3AU5 A;  3N32 A;  4ICV A;  2JPH A;  3A1Q B;  1PQS A;  2KDE B;  2DX5 B;  2R2Q A;  4IM0 A;  2JVC A;  2M4N A;  1V2Y A;  2J0K A;  2K6D B;  2C5L C;  1V86 A;  2KC2 A;  2CU1 A;  2V3S A;  3APD A;  3A4S C;  2KDB A;  4HJK A;  3QAQ A;  2C7N B;  2MSE D;  4EUT A;  5EDS A;  4EZK A;  1UD7 A;  2Y5B B;  3VHT C;  4MJS A;  2AL6 A;  2ZCB A;  2HE7 A;  3JW0 X;  1WGG A;  2DZJ A;  2RGF A;  3ENE A;  3IHP C;  4GDL B;  1WJ6 A;  4NQK E;  3OAW A;  5JZE B;  1WGR A;  5CTR C;  1XQQ A;  2RD0 A;  2KN5 A;  2ZVO A;  2DYM A;  3JVZ X;  5CHW A;  1IYF A;  4G50 A;  4MJS B;  2FUH B;  4K1R B;  2KQ7 A;  2K1F A;  3PZD A;  4NY0 A;  1A5R A;  4WJO A;  4W9D A;  3ZNH B;  3ZW3 A;  3UGB B;  4MSM B;  3RD2 A;  3HHM A;  4RM9 A;  3ZRC A;  2NS5 A;  3KYC D;  2D11 A;  3ZNZ B;  4DK5 A;  5DPR A;  3VTV A;  4WJP A;  2RSU A;  1TTN A;  2JY6 A;  4BOZ B;  2KFK B;  1WGY A;  3WAL A;  4CHK A;  2KWC A;  2LVP A;  1BT0 A;  1OEY A;  1VCB A;  1LFD A;  2G4D B;  2LVQ A;  2G4S A;  2WX0 A;  4JIO U;  3TBL D;  1RLF A;  2OOB B;  3C0R B;  4PS3 A;  5E6O A;  1E8Z A;  3U8Z A;  3TCA A;  3KUC B;  4M8N A;  2NBU A;  3ALB A;  2ZJD A;  2KDI A;  2MA9 B;  2IY0 B;  2V4L A;  4GN1 A;  4MGK E;  2XBB C;  3VH3 B;  3EFU A;  3JSV B;  1E90 A;  2REX A;  3ZNG C;  4FJV B;  3H7S A;  4IUM B;  3RCZ A;  4G11 A;  3Q3J A;  4E3C A;  1WX9 A;  1WF9 A;  3R7Q A;  2BWE S;  4FJZ A;  3V6E B;  3EC8 A;  2GMI C;  2PPH A;  3A9J A;  4ZYN A;  1GJZ A;  3TIX A;  1V49 A;  5CHF A;  2QHO A;  4BKS D;  2N9E B;  4HK2 A;  2CHX A;  5DPS A;  4J6I A;  3S2A A;  1FXT B;  2CS4 A;  3B0A A;  4AWJ A;  4FAD A;  4IG7 B;  4HPM B;  2AWT A;  5CX3 A;  3M63 B;  1SIF A;  4IWQ A;  4FN2 A;  3K9O B;  4G0N B;  3SDL C;  1GNU A;  2N1V A;  2MCN B;  3DDC B;  4TQ0 A;  3PLU A;  1X1M A;  2J7Q B;  2MP2 A;  2KC1 A;  2V1Y A;  2NCN A;  5L95 C;  2BF8 B;  2LD9 A;  1E7V A;  2ZPN A;  4RMA A;  4NAW A;  2I1J A;  4FA6 A;  1P98 A;  2WDT B;  2L8J A;  2GBM A;  2GBN A;  4HLE A;  3VDZ A;  2NBV B;  4AP4 C;  3M95 A;  3QK0 A;  3AU4 A;  1ZKH A;  3PRZ A;  3X23 A;  2LVO A;  2DZK A;  2MP2 B;  2LAS A;  4FJY A;  2WX1 A;  4DWF A;  1E5W A;  1EUV B;  2GBR A;  1EF1 A;  3MJW A;  1GUA B;  2D07 B;  1U4A A;  2C7M B;  2GOW A;  3PT2 B;  1WXV A;  2DAJ A;  2JRI B;  1WI0 A;  4LCD E;  2NVU I;  4NPN A;  3VUW A;  4A20 A;  2KD0 A;  4W9G A;  4XC2 A;  5GMV A;  2LZ6 A;  1L2N A;  2K8C A;  3ZLZ A;  3PVL A;  4I6N B;  1SE9 A;  2PJH A;  1CMX B;  1UGM A;  3RYT A;  3UIO B;  4W9K A;  2KMC A;  2JF5 A;  1LM8 B;  5AZG A;  3N30 A;  3PRE A;  2O6V B;  4JL9 A;  2RPQ A;  2MRP A;  4HWI B;  1WMH A;  4PS8 A;  5AZF A;  1YIW A;  5G55 A;  1WJU A;  3W1S A;  2AEH A;  4IWP A;  1V9J A;  4DHZ B;  2FID A;  4JGH B;  2KTR A;  1RRB A;  3TL5 A;  4ASW C;  2K8B A;  3IFW B;  2KFJ A;  3NZS A;  4DBG A;  2KLC A;  1WYW B;  2L7R A;  4F1S A;  2OJR A;  2AYO B;  3WAP A;  1GG3 A;  1SGH A;  2GBJ A;  4MGI E;  2ZCC A;  1J8C A;  4XX5 A;  2GBK A;  4KZ0 A;  2DAF A;  3VH4 B;  4IC7 B;  2L00 B;  3RUI B;  3OJ4 B;  2MQJ A;  4K81 A;  2J0J A;  4TQ1 A;  4URK A;  4FLH A;  5KHQ A;  5J2R A;  2C9W B;  5D6J B;  4B95 A;  4DHJ B;  2UWQ A;  2BKR B;  4KV2 A;  4KDL B;  4ZDV A;  4MSQ B;  3Q3F A;  2LWP A;  2BKF A;  4EZJ A;  2KK8 A;  2M0X A;  1WJ4 A;  2LXA A;  3RT3 B;  3UIN B;  2K39 A;  4KIK A;  3DBH I;  2Z59 B;  1JRU A;  2KNB A;  3QA8 A;  5TR5 A;  3WAO A;  1D3Z A;  4LDT B;  5D94 A;  2JT4 B;  2FNJ B;  2JZZ A;  4ZRI A;  4PS7 A;  2IO0 B;  2D2Q A;  1P1A A;  1ISN A;  2B3A A;  1WRD B;  4W9L A;  4ANX A;  5L83 A;  1WIA A;  2L3Z A;  1IPG A;  3H7P A;  1UEL A;  4JQW C;  3PV1 A;  3U7D A;  3KW5 B;  3M3J A;  4YL8 A;  4BVU C;  5JH5 C;  2WYQ A;  2KX0 A;  3A9K A;  2YLM A;  5KHO A;  2KOX A;  3ZTC A;  2MBQ A;  1P9D U;  4PYU A;  4B6W A;  3L08 A;  1UH6 A;  4ANV A;  1V81 A;  1YJ1 A;  2FCQ A;  4M8M A;  4W9F A;  1EO6 A;  4HVB A;  2KLG A;  3RZW C;  4KSK C;  1OQY A;  1AAR A;  4E71 A;  3K9P B;  3RUL A;  4OVV A;  3A9K B;  3QHT A;  4KSL C;  2K25 A;  3VUY A;  2L0F A;  2KDF B;  3VUX A;  3ZDM C;  4AOF A;  3DBS A;  3APF A;  4MDK E;  3LDZ E;  2A4Z A;  2IO2 B;  2N7E A;  3CSF A;  2KQS A;  2IBI B;  4EOY A;  2EMT A;  4KZC A;  4MEM A;  1S1Q B;  1S3S G;  3OLM D;  4GB9 A;  4WWO A;  2KZR A;  3TJP A;  3PHW B;  2XK5 A;  2EKE C;  3KYD D;  1F9J A;  2CKH B;  2NPT A;  1Z5S B;  3BY4 B;  4BKT A;  4GMV A;  3WAN A;  4EEW A;  4IM2 A;  3QC8 B;  4ANU A;  3A9J B;  2XEW A;  3N3K B;  2JXX A;  3PHX B;  4KDI C;  3M62 B;  3NOB A;  2W9N A;  3V61 A;  3QX1 A;  3V60 A;  1HE8 A;  3DPD A;  1WZ0 A;  2N4F A;  1WJN A;  2O2V A;  3L16 A;  4GXB A;  2MBH A;  5D2M B;  2N9P C;  3APC A;  4TKN A;  3UF8 A;  3UQA A;  3HM3 A;  2NPT B;  4GU2 A;  1E8X A;  1UBQ A;  3PRM B;  4W9J A;  3I3T B;  4BKS A;  4F7Z A;  3ZDT A;  1NBF C;  3GZN I;  1WE7 A;  2Z0D B;  3IG3 A;  1WE6 A;  3PLV A;  3VTU A;  2HJ8 A;  3ZUN A;  2O2V B;  2M17 A;  4ZRJ A;  1WH3 A;  2HTH A;  3ZTD A;  2NR2 A;  3L13 A;  4EZL A;  2Z0E B;  5DPT A;  4GOC A;  2LRW A;  4NAW B;  2LRU A;  3HK0 A;  1E8Y A;  3KVF B;  2C60 A;  4CYE A;  2KXJ A;  3RZF A;  2O6V D;  2KJ6 A;  1P3Q U;  2HD5 B;  4HDQ A;  5E6N A;  5J17 A;  3A4R A;  3ML8 A;  2M8S A;  2G3Q B;  1OGW A;  2A5U A;  3JYU A;  1RAX A;  3PSE B;  4II3 B;  3LJ3 A;  3PRP B;  4JLC A;  4BBN F;  4E74 A;  2JZ3 B;  1KM7 A;  1J0G A;  4W9H A;  2BGF A;  2VRR B;  2N9X A;  3SHQ A;  5LXI B;  3DCG A;  1KJT A;  3PTF C;  4GGQ A;  1Q5W B;  3T9L A;  3VAW A;  3WIM A;  3SD5 A;  3X0W A;  1V5T A;  1E8W A;  2KJR A;  1WY8 A;  4BBN C;  2LUE A;  3QIJ A;  5CHV C;  5IAA C;  2YVC A;  4HDO A;  3W1S C;  1L7Y A;  3ZIM A;  1TZ1 A;  1XD3 B;  4W9I A;  2KJH B;  2L05 A;  3P2B A;  4BOS C;  1H8C A;  3VFK A;  4GDK A;  1GC7 A;  3H1U A;  4TV3 A;  4ICU A;  3CST A;  3UIP B;  4WJQ A;  2ZNV B;  1WMH B;  2FCS A;  2FIF A;  4WWN A;  2PEA A;  3SU8 X;  2ZEQ A;  4GSW A;  4I6P A;  1R4N I;  3AI5 A;  2KTR B;  2LJ5 A;  3AXC A;  4FHK A;  4LDT D;  3L0W B;  2LXC A;  2UYZ B;  4K7S A;  1YX6 B;  2DEN B;  5LLI A;  4GDK B;  4B9K A;  4CO7 A;  3DVN U;  3L54 A;  1YQB A;  1YD8 U;  2KVR A;  3ZO5 B;  1T0Y A;  5IA7 A;  2C7H A;  2KAN A;  3DVG Y;  5E6P A;  1VD2 A;  3HM6 X;  4GDL A;  1IP9 A;  1WM2 A;  2DYB A;  2J0M A;  4LJP B;  3CF6 E;  5J18 A;  5AEK B;  2FAZ A;  3T8M A;  2BYE A;  1V80 A;  1WR6 E;  3AUL A;  3NS8 A;  4MGY E;  3V62 A;  5DPW A;  4II2 B;  2D3G A;  1WX7 A;  1WGH A;  4X57 B;  4EKU A;  1Q1O A;  2IY1 B;  3EHV A;  1QZE A;  1WGD A;  3MHS D;  2KO3 A;  4WJN A;  1K8R B;  2M1M A;  4KIK B;  2LGD A;  2JUO A;  1WFY A;  3IBE A;  3ZNI D;  2MLB A;  2KFK A;  3WA0 A;  2KWV B;  1M94 A;  4EFO A;  4FHJ A;  3DBR I;  3VTW A;  2N7D A;  4MM3 A;  2K6Q A;  3MTN B;  3QWZ B;  5LXH A;  3NHE B;  3H7P B;  2ZZP B;  2KTF A;  3WAM A;  3KUZ A;  1ZGU B;  2N1W A;  4M0W B;  3ML9 A;  4IM3 A;  2WWZ A;  2MBE A;  2FCM A;  1J19 A;  1V5O A;  3JSV A;  2EMS A;  1GC6 A;  1LQB A;  1EF5 A;  2AL3 A;  2KKC A;  2ZPY A;  3OJ3 A;  3ZRF A;  4A3P A;  3D32 A;  1WX8 A;  1R4M I;  2L76 A;  4DDI D;  4PYZ A;  2JWZ A;  3UQB A;  2I1K A;  1ZW7 A;  4P7I A;  4AJW A;  4BFR A;  5JHA A;  2CHW A;  3VQI A;  3BIN A;  2BWF A;  3ZVV A;  1WXA A;  2KX3 A;  3PGE A;  3R66 C;  4IWO A;  4MH0 E;  4FBJ B;  1OTR B;  3ECI A;  1WXS A;  1Z2M A;  2FCN A;  2NBW B;  2PE6 B;  2PE9 A;  1V6E A;  4NJ7 A;  4NQL B;  2G45 B;  5FR6 A;  3ZKJ C;  1OEY J;  4N9F 4;  1TGZ B;  4MEL A;  2KHW B;  3IVF A; 
#chains in the Genus database with same CATH topology
 1P0R A;  2DYO A;  1FIQ A;  4OZA A;  1BXT A;  3V6C B;  4MT5 A;  2LGX A;  4NNJ B;  3AE2 B;  1JQ4 A;  4L2Y A;  2JWU A;  4DHZ E;  5C23 A;  2K3U A;  4WAA A;  1E6E B;  4ZHO A;  3AE4 B;  4L23 A;  3AE3 B;  3VXW A;  1C3T A;  1V1P A;  3DVG X;  4DDG D;  1K52 A;  2LGY A;  2WDQ B;  3NZ3 A;  2ASQ A;  1VZ8 A;  1ZDX A;  3AEC B;  2L0T A;  4O1N A;  2CR5 A;  3L17 A;  2WXM A;  1QQR A;  1Q0W B;  4OVU A;  2MBO A;  3B08 A;  1YX5 B;  4AUQ C;  3Q6B A;  3R3M A;  4REZ A;  1K51 A;  1WM3 A;  1WXM A;  4IKG A;  3QJZ A;  3Q8A A;  3QCA A;  3T3O A;  4HKQ A;  3H9D A;  1Y8R C;  1UZX B;  3Q69 A;  1AN8 A;  2DZI A;  2RR9 A;  3QAR A;  3N32 A;  3A1Q B;  4IM0 A;  2JVC A;  2CU1 A;  2C7N B;  4EZK A;  2Y5B B;  2ZCB A;  3SR6 A;  2DZJ A;  4GDL B;  1HTO A;  3OAW A;  1N62 A;  5JZE B;  1WGR A;  5CTR C;  2BB5 A;  2DYM A;  1IYF A;  4G50 A;  3P63 A;  2KQ7 A;  4K1R B;  2K1F A;  1A5R A;  4WJO A;  2JZP A;  4W9D A;  2MJD A;  3UGB B;  3ZRC A;  3HHM A;  4RM9 A;  1YOV B;  5JXV A;  2D11 A;  3VTV A;  3DBL B;  2RSU A;  1HZ5 A;  1MFW A;  2LVP A;  2WX0 A;  2G4D B;  1RLF A;  2OOB B;  1V1O A;  4PS3 A;  1I4H A;  2IGD A;  1JRO A;  2PW9 A;  3U4E G;  2MA9 B;  2V4L A;  4J3O D;  1F77 A;  3ZNG C;  3H7S A;  3RCZ A;  1UWM A;  2IGH A;  1VR9 A;  3P1M A;  2PPH A;  3O13 A;  5CHF A;  2N9E B;  3P4Q B;  4HK2 A;  2CHX A;  3B0A A;  4AWJ A;  3M63 B;  4JWU C;  5EE3 A;  2IND C;  2N1V A;  2W3R A;  2GLS A;  2ON8 A;  3PLU A;  2MP2 A;  4ZOH C;  2LD9 A;  1E7V A;  3DWM A;  2I1J A;  2WDT B;  2L8J A;  2NBV B;  2H89 B;  3PRZ A;  1GUA B;  2D07 B;  3ZXR A;  2JRI B;  3KQ4 A;  2NVU I;  3I9V 1;  2WXQ A;  4A20 A;  2GRI A;  2LZ6 A;  2K8C A;  3ZLZ A;  4IOI E;  2PJH A;  3BVZ A;  1FCC C;  4M00 A;  2O6V B;  3R2T A;  1OQQ A;  3GP7 A;  4HWI B;  4PS8 A;  3W9C B;  4ZRQ A;  4ASW C;  1WRI A;  4CQN A;  4OHJ A;  2Z8L A;  5FKA C;  3BII D;  3NZS A;  2V0G A;  1C79 A;  2L7R A;  1HA5 A;  3VR8 B;  2DWQ A;  2ZCC A;  1D5X C;  1T3Q A;  4TQ1 A;  2AX5 A;  2W3S A;  5D6J B;  5TSS A;  4WUR A;  4WH4 A;  4ZDV A;  3Q3F A;  1FXA A;  3DBH I;  4OZB A;  5D94 A;  2JT4 B;  4ARC A;  2WXP A;  4PS7 A;  5C2T B;  1ISN A;  1WRD B;  2N0S B;  2KT7 A;  4RGO S;  3U7D A;  4M0W A;  2YEP B;  2WYQ A;  3A9K A;  1V8C A;  2YLM A;  2MBQ A;  4PYU A;  1V81 A;  2FCQ A;  1FNU A;  1ZP0 B;  1OQY A;  1C76 A;  3KWV A;  3RNC C;  1AAR A;  4E71 A;  3RUL A;  4OVV A;  1UNS A;  3VUY A;  1C9F A;  2L0F A;  3ZDM C;  5HI1 A;  1K50 A;  3NJT A;  3PHW B;  1A70 A;  4ANU A;  2XEW A;  2W9N A;  3V61 A;  1CQV A;  1WZ0 A;  1T5X D;  1WJN A;  4JWS C;  3ZQ4 A;  3RNE C;  3APC A;  3TEW A;  1RWS A;  2NPT B;  1UBQ A;  4F7Z A;  3ZDT A;  4YSZ B;  4LNN A;  2V9H A;  3EA6 A;  3IG3 A;  3VTU A;  4DXF A;  2O2V B;  2M17 A;  4ZRJ A;  2HTH A;  2NR2 A;  5DPT A;  5EE1 A;  5H8Y E;  2LRU A;  3KVF B;  1RM6 C;  2KXJ A;  1N5W A;  4C80 A;  3MHZ A;  3JYU A;  3PSE B;  3N9Y C;  1KM7 A;  3GE3 C;  2N9X A;  5LXI B;  3WIM A;  3SD5 A;  3IAM 1;  1V5T A;  3X0W A;  1NI3 A;  2KJR A;  1AYF A;  4FXC A;  3P42 A;  1QOB A;  1XD3 B;  4W9I A;  3B9J A;  2L05 A;  3P2B A;  1YNT E;  3MJ5 A;  1SIJ A;  4ICU A;  4YSY B;  2FCS A;  2VZK D;  2PEA A;  4XWT A;  4K7S A;  4M02 A;  1YX6 B;  2DEN B;  4B9K A;  4GDK B;  4CO7 A;  3DVN U;  3L54 A;  3ZO5 B;  2KAN A;  4US8 A;  5E6P A;  1VD2 A;  4GDL A;  1ENF A;  2DYB A;  1KLU D;  2FAZ A;  2AQ1 B;  3TEY A;  3NS8 A;  3AUL A;  3FIL B;  5DPW A;  1WGH A;  3OG5 A;  4EKU A;  1QZE A;  5EE9 A;  1K8R B;  2M1M A;  4KIK B;  3MC9 A;  1KTK A;  2LGD A;  3IBE A;  4KKJ A;  2MLB A;  3WCQ A;  3WA0 A;  4EFO A;  3DBR I;  2N7D A;  1L0X B;  3UI3 A;  3QWZ B;  5LXH A;  3NHE B;  3AE1 B;  2ZZP B;  3FAH A;  2MBE A;  1J19 A;  3OJ3 A;  2ZPY A;  1LQB A;  2WXJ A;  2BQQ A;  4A3P A;  3IAS 1;  1YN4 A;  2L76 A;  1FD6 A;  4PYZ A;  3UQB A;  2I1K A;  4AJW A;  5JHA A;  2CHW A;  3ZVV A;  4IWO A;  4MH0 E;  3AM9 A;  2PE6 B;  2NBW B;  1F2R I;  2KHW B;  1ACC A;  4BKG A;  2WLB A;  2WDR B;  1L5P A;  1C78 A;  1ZUD 2;  3O65 B;  5HKH A;  4XZ4 A;  1ZDV A;  4K7U A;  1SSN A;  3V05 A;  2BPS A;  3BYT B;  2BS4 B;  1WYG A;  5DCN A;  2Q5W D;  3GB1 A;  1R4M B;  2MHJ A;  2ZVN A;  2M19 A;  3RNA C;  3MFG A;  4RNA A;  1TBE A;  3QQ8 B;  1Y56 A;  2D10 A;  3DVN V;  4C7Z A;  2MX2 A;  1E7U A;  3GOE A;  2LI5 A;  2WU5 B;  2IYD B;  4K7W A;  2O6V A;  1B9R A;  4NJ6 A;  5BMH A;  3NZU A;  3KUD B;  5C1Z A;  2JRH A;  3U30 A;  2BYV E;  1NEN B;  1C4C A;  3KH0 A;  5LNK 1;  4DQO C;  2BYT A;  3ZJT A;  5BO4 B;  1H4R A;  2MW5 A;  3Q8E A;  4KX6 B;  2BYF A;  3DQV A;  4HCP B;  4W9C A;  3Q3O C;  2QIE B;  1L6V A;  2WXK A;  1I42 A;  4ICV A;  1SE2 A;  1PQS A;  2IDY A;  2M4N A;  2KVZ A;  2KC2 A;  2V3S A;  2KDB A;  2MSE D;  4EUT A;  1UD7 A;  5I4D A;  4MJS A;  2AL6 A;  2M0A A;  2HE7 A;  3JW0 X;  4C56 C;  4LNO A;  3ENE A;  2UU7 A;  4XYC A;  2FUH B;  2VZK B;  3PZD A;  3ZNH B;  2FBW B;  3KYC D;  5MPO A;  3ZNZ B;  2QDF A;  2KFK B;  2KWC A;  1VCB A;  2G4S A;  3FKY A;  4MM3 B;  3U8Z A;  3KUC B;  3ALB A;  5G5G A;  4YXD B;  4GN1 A;  3MC0 B;  2ONQ A;  3JSV B;  1RFK A;  1ROE A;  1QOA A;  4E3C A;  4TSS A;  1WF9 A;  1TYG B;  2BWE S;  3Q14 C;  1GJZ A;  3C8Y A;  1GB1 A;  2QMT A;  5DPS A;  5AUK A;  4IG7 B;  4M01 A;  5CX3 A;  3R8B A;  4IWQ A;  2BB6 A;  3K9O B;  1JRP A;  1C4A A;  2CU3 A;  3DDC B;  1YQ4 B;  1XLO A;  1YN5 A;  2JX5 A;  1TS5 A;  1X1M A;  2J7Q B;  2RPV A;  2GBN A;  4HLE A;  1ZOY B;  3M95 A;  3QK0 A;  2D3A A;  3R2I A;  2RMM A;  4ITK A;  2PKO A;  3AEE B;  2DZK A;  3RNG C;  2FE8 A;  1E5W A;  2KYW A;  1EF1 A;  2OJW A;  2GOW A;  1WI0 A;  3HUI A;  4LCD E;  3VUW A;  2KD0 A;  1L2N A;  4YSX B;  1CMX B;  3RYT A;  3TEZ A;  3UIO B;  4W9K A;  1EM7 A;  1JWU D;  3DHH C;  3TEX A;  5G55 A;  3W1S A;  3NS1 A;  2PLP A;  1RRB A;  1L4Z B;  2MH7 A;  2KFJ A;  4DBG A;  2KLC A;  1IBX B;  3WAP A;  2AYO B;  1GG3 A;  1SGH A;  2KMM A;  2GBJ A;  3B2G A;  4MGI E;  4XX5 A;  2L00 B;  3OJ4 B;  2MQJ A;  4FLH A;  5KHQ A;  1DGJ A;  4B95 A;  2BKR B;  4KDL B;  1KH0 A;  1QIL A;  4C7Y A;  2K5P A;  2KK8 A;  1XCT L;  2LXA A;  1JWM D;  4KIK A;  4P1B C;  5TR5 A;  3RNB C;  1D3Z A;  3WAO A;  2FNJ B;  4ZRI A;  2B3A A;  3AE6 B;  3AEG B;  2L3Z A;  1IPG A;  1CZP A;  3AB5 A;  4JQW C;  4BVU C;  1D5M C;  5KHO A;  2KOX A;  2BT6 A;  1XLP A;  1UH6 A;  2PVG C;  1VDV A;  2KLG A;  4KSK C;  4YT0 B;  2WXN A;  3VUX A;  2IJ0 A;  3APF A;  2IO2 B;  1XEE A;  2IBI B;  5E6J A;  1T0Q C;  4WWM A;  3AMZ A;  2HTM E;  2KZR A;  4BKT A;  4N59 A;  3QC8 B;  2NTS A;  3A9J B;  5D3D A;  2JXX A;  4KDI C;  4GXB A;  4LLG M;  5D2M B;  1YJI A;  1PYW D;  3UQA A;  1AW7 A;  3HM3 A;  1STE A;  4BKS A;  1L6U A;  4US9 A;  3GZN I;  1QKZ A;  2Z0D B;  4Q2J A;  1E10 A;  3PLV A;  3EUB 2;  2HJ8 A;  1N63 A;  2WXI A;  3ZTD A;  4OW0 A;  1C4P A;  2ICI A;  2JU6 X;  3HK0 A;  1E8Y A;  2C60 A;  4OZC A;  1ET6 A;  3BVG A;  1XXG A;  4HDQ A;  1ZPS A;  5J17 A;  3A4R A;  2M8S A;  2G3Q B;  2A5U A;  4E74 A;  4BBN F;  4HEA 1;  2JZ3 B;  4PT5 A;  1MHX A;  2BGF A;  3T9L A;  4KGT A;  1D6E C;  2LUE A;  3QIJ A;  5IAA C;  1NEK B;  2XNA C;  4HDO A;  3GE8 C;  4RFB A;  4RH6 A;  1L7Y A;  1KFY B;  1H8C A;  3SEB A;  3H1U A;  3UIP B;  1WMH B;  1TIF A;  2ZEQ A;  4GSW A;  1R4N I;  1F0Z A;  2KTR B;  2LJ5 A;  2V4I B;  3AXC A;  3MP9 A;  4LDT D;  1MI0 A;  3L0W B;  1SE4 A;  2UYZ B;  3RFZ B;  4N6E B;  3DVG Y;  3U2S C;  2QJL A;  1IP9 A;  2J0M A;  2WXR A;  2WXF A;  4XWW A;  5J18 A;  2W54 A;  4B0E A;  2CJN A;  3T8M A;  4D2K A;  1DYQ A;  3V62 A;  4II2 B;  1WX7 A;  2PIA A;  3I5J C;  1VZ7 A;  1WFY A;  3IXS A;  3AH7 A;  2KFK A;  1N5X A;  4MM3 A;  3MTN B;  3H7P B;  4AS1 A;  2B76 B;  3WAM A;  2N1W A;  3JSV A;  1V5O A;  2KKC A;  1JW9 D;  4DDI D;  1JML A;  2JWZ A;  4QAY A;  1HQR D;  1ZW7 A;  4P7I A;  4RF1 A;  1WXA A;  3R66 C;  2FCN A;  3KLS X;  1FNW A;  4UDU C;  2ZW1 A;  5FR3 A;  2PMV A;  4N9F 4;  5HHD G;  1TGZ B;  2G9H D;  2BS3 B;  3IVF A;  1ESF A;  4WWP A;  2XK5 B;  1YN3 A;  2QSD A;  1KLG D;  2R2O A;  1MG8 A;  3AEA B;  1I4Q A;  3PS6 A;  2DZM A;  3R7R A;  2KWU B;  1EWC A;  1UBI A;  3PZ8 A;  5JHB A;  1I35 A;  3VVW B;  4ZRK A;  3W1Y A;  1PGX A;  2K8H A;  2MWS B;  4AJY B;  1KOT A;  1HEZ E;  1I4P A;  1SBB B;  3DOW A;  4KGS A;  1QOF A;  3CMM B;  4A3O A;  3ABV B;  2ZNV C;  2W55 A;  2INC C;  3NY5 A;  1WR1 A;  4LNF A;  3L10 B;  1TKG A;  4HCN B;  3RMK C;  1JWA D;  2IO1 B;  3I63 C;  4DXA B;  4W9E A;  3A1Q A;  4F8C B;  3ZJV A;  2HDE A;  5BYS A;  3DBL I;  5IO9 A;  1LGR A;  1KLV A;  3TSS A;  2LGS A;  3DHG C;  1PGA A;  3ONS A;  1FFV A;  1NDD A;  2JPH A;  2DX5 B;  3ZXV A;  2K6D B;  2C5L C;  1V86 A;  3Q3M C;  5EDS A;  1HXY D;  3HVZ A;  1XO3 A;  3VHT C;  4B0M A;  1WGG A;  2KN4 A;  2RGF A;  3E56 A;  3IHP C;  1WJ6 A;  4NQK E;  1FM0 D;  1L4D B;  2QIL A;  2KN5 A;  2RD0 A;  2ZVO A;  4A90 A;  3EGR A;  2XN9 C;  3ZW3 A;  1TS4 A;  1I4X A;  3Q8F A;  4WJP A;  4BOZ B;  4CHK A;  2M56 B;  3WAL A;  1BT0 A;  1OEY A;  3TBL D;  1LFD A;  2LVQ A;  1NYR A;  1E8Z A;  3SFE B;  1JWB D;  3TCA A;  3NVW A;  4M8N A;  2KDI A;  1TZO A;  3VH3 B;  3ETR A;  4USA A;  1T0R C;  3EFU A;  4P1C C;  2REX A;  4FJV B;  2WDV B;  1T6B X;  4G11 A;  3Q3J A;  5AUI A;  1UUP A;  3R7Q A;  3V6E B;  3ZYY X;  3EC8 A;  4P6V F;  3A9J A;  4ZYN A;  2NTT A;  4HPP A;  1V49 A;  2IPK D;  3S2A A;  1L0Y B;  1K53 A;  4HPM B;  4NJC A;  2R61 A;  5BMI A;  3AV8 A;  4G0N B;  3SDL C;  3NG0 A;  2MCN B;  4L1B A;  3Q8C A;  1UWX A;  2V1Y A;  2NCN A;  2BF8 B;  4RMA A;  2GBM A;  1F2R C;  2WS3 B;  4AP4 C;  3RPF C;  1HZ6 A;  2LVO A;  2MP2 B;  2WX1 A;  5BYQ A;  3MJW A;  3PT2 B;  1U4A A;  1FEH A;  2DAJ A;  5FK9 C;  5EE0 A;  2N9K A;  2WHI A;  4NPN A;  2G1E A;  3AE7 B;  2E3T A;  3BZD B;  4EE2 A;  2JXT A;  3PVL A;  1NYQ A;  4I6N B;  3N1X C;  3U52 E;  3C19 A;  1UGM A;  3Q8B A;  1BUI C;  1MVK A;  1WSP A;  2KMC A;  3AE9 B;  2JF5 A;  3GS2 A;  5AZG A;  3NVZ A;  2N9L A;  3PRE A;  3BYY B;  4JL9 A;  2RPQ A;  4KKI A;  1WWT A;  2MRP A;  3AE5 B;  1WMH A;  5AZF A;  3LB8 C;  2LHD A;  4BZA A;  2AEH A;  1V9J A;  4DHZ B;  3SFD B;  4JGH B;  5GXG B;  2KTR A;  5BYR A;  3TL5 A;  1IGD A;  3NUH B;  4PK1 A;  1VZ6 A;  4F1S A;  1KRH A;  2OJR A;  4AQ7 A;  1J8C A;  2GBK A;  4KZ0 A;  2DAF A;  3VH4 B;  4K81 A;  3RN9 C;  4URK A;  1ZE3 D;  2C9W B;  3BVM A;  1JCK B;  2UWQ A;  4KV2 A;  4MSQ B;  2BKF A;  3AN1 A;  3RT3 B;  4LNI A;  1FRD A;  3ZGZ A;  2Z59 B;  1JRU A;  2KNB A;  3QA8 A;  2IO0 B;  1C77 A;  3H7P A;  3L4P A;  2WXG A;  4KGR A;  3KW5 B;  3M3J A;  3N1Z C;  3ZTC A;  1F52 A;  1P9D U;  3KWL A;  1L0V B;  1UF0 A;  1ZXH A;  1TKY A;  3HRD D;  3RZW C;  3K9P B;  3A9K B;  3QHT A;  4KSL C;  3VR9 B;  4H2A A;  4AOF A;  4MDK E;  3LDZ E;  2A4Z A;  2LEK A;  4ARI A;  2JSV X;  4C00 A;  3CSF A;  4A6Q A;  2I38 A;  1S1Q B;  1GOZ A;  3OLM D;  1FNV A;  3DBH B;  3TJP A;  2XK5 A;  3KYD D;  5IOI A;  1F9J A;  2NPT A;  1Z5S B;  4EEW A;  4IM2 A;  3N3K B;  3NOB A;  1HTQ A;  3QX1 A;  1HE8 A;  2O2V A;  2MBH A;  2Y3A A;  3PRM B;  4S17 A;  3I3T B;  4HJG E;  4NAM A;  1PUT A;  2RDH A;  3RI7 C;  2SAK A;  1WE7 A;  1FFU A;  1WE6 A;  4YTP B;  3AEF B;  4WIP A;  1WH3 A;  2LUM A;  4EZL A;  5HG2 A;  2Z0E B;  1QLB B;  4GOC A;  4NAW B;  4CYE A;  2EKI A;  3RZF A;  2O6V D;  1SB3 C;  3BWU D;  1MJD A;  5E6N A;  1OGW A;  1RAX A;  3J9C A;  3PRP B;  3NRZ A;  2VRR B;  3HVD A;  3SHQ A;  1KJT A;  3PTF C;  4GGQ A;  3VAW A;  3AED B;  4BBN C;  1FCL A;  4HRS A;  3W1S C;  3ZIM A;  1TZ1 A;  2IGG A;  2KJH B;  4BOS C;  4LK0 M;  3CWI A;  4K3C A;  4GDK A;  3CST A;  2ZNV B;  3AEB B;  4WWN A;  1V97 A;  4I6P A;  4TMA B;  2INN E;  1YJJ A;  2LXC A;  5LLI A;  4R3D A;  1GPX A;  2PVO D;  2YEP F;  5BMG A;  3FIL A;  1FRR A;  1YQB A;  1XCQ L;  2KVR A;  1T0Y A;  1E0Z A;  2SEB D;  2VH1 A;  5D3I B;  2WP9 B;  3CF6 E;  1J7A A;  2WXO A;  2BYE A;  1WR6 E;  1SE3 A;  2D3G A;  1Q1O A;  1SF0 A;  3EHV A;  4WQM A;  1WGD A;  4WJN A;  1DOY A;  2JUO A;  3ZNI D;  2K9X A;  4ZYS A;  3VRA B;  1QF6 A;  1GB4 A;  1M94 A;  3AE8 B;  3VTW A;  3T3N A;  2K6Q A;  2KWD A;  2H88 B;  1ZGU B;  3ML9 A;  1E7P B;  2Y5P A;  3B2F A;  2DBY A;  5H92 C;  3Q3N C;  3D32 A;  1WX8 A;  3W5V B;  1R4M I;  4RGM A;  1D5Z C;  1TT5 B;  4BFR A;  3BIN A;  2BWF A;  2ZW0 A;  1DOI A;  3PZ7 A;  3PGE A;  4FBJ B;  1FMA D;  1OTR B;  2W82 A;  1Z2M A;  4NJ7 A;  3N20 C;  3P4R B;  1OEY J;  1N60 A;  2WGS A;  1P7F A;  4KVG B;  2N7J A;  2JYE A;  4YTM B;  4MGZ E;  2JQR B;  3DBR B;  2KMA A;  2IO3 B;  4I6L B;  2K22 A;  5D7G A;  1TS3 A;  4LTU A;  2CHZ A;  2J53 A;  1NI2 A;  1EU4 A;  3HIZ A;  4BAX A;  3TMP B;  3BK1 A;  4WQO B;  4G3X B;  1IUE A;  4TUU A;  4GIV A;  3A33 B;  1PDX A;  2BTE A;  1JAL A;  2FUG 1;  2DNF A;  3U7Z A;  3H6N A;  4NZL B;  2DHZ A;  4RGN A;  4ZRP A;  3P4P B;  4C4V B;  2JYT A;  2QEJ C;  1G6J A;  3B1L X;  1OQR A;  1RFA A;  2K0P A;  2X8X X;  5G2N A;  4HXD A;  3VRB B;  4IDI A;  1WZ3 A;  4RM8 A;  5AZH A;  3PPA A;  4DHJ D;  4LJO B;  3EEC A;  2V3N A;  4IW0 A;  2BW2 A;  4ANW A;  2IZV B;  3OWE B;  4HPL B;  4HKZ E;  5G5H A;  3E9S A;  4WAF A;  1XT9 B;  2MBB B;  2Y5C A;  3PO0 A;  2NMQ A;  4FUL A;  1SJH D;  5T8I A;  2LMC A;  4JE3 B;  1FO4 A;  1C1Y B;  1E9M A;  2RDB C;  2V3P A;  2WNM A;  2BVC A;  1LXD A;  3AU5 A;  2KDE B;  2TSS A;  1WGK A;  4K3B A;  2R2Q A;  1V2Y A;  2J0K A;  4HJK A;  3APD A;  3A4S C;  3QAQ A;  4RCO A;  1I7H A;  1XQQ A;  5CHW A;  5C3J B;  3JVZ X;  3Q2A C;  4MJS B;  3LXF A;  4NY0 A;  2L32 A;  4MSM B;  3RD2 A;  1D4B A;  2NS5 A;  2WU2 B;  2GI9 A;  4DK5 A;  5DPR A;  2QC8 A;  4ZHP A;  2KQ4 X;  2L52 A;  1TTN A;  2JY6 A;  1WGY A;  4XE0 A;  4JIO U;  2J42 A;  3NVV A;  3C0R B;  5E6O A;  3DHI C;  2WXL A;  2WXH A;  2NBU A;  2ZJD A;  1UGJ A;  4XDC A;  2IY0 B;  3BK2 A;  4MGK E;  2XBB C;  1E90 A;  1PGB A;  4IUM B;  4HRO A;  4RGT A;  4YTN B;  1MG4 A;  1WX9 A;  1EWY C;  3MC8 A;  1I4R A;  4FJZ A;  1VRA B;  2GMI C;  2LGI A;  3TIX A;  5HFY A;  2QHO A;  4BKS D;  4J6I A;  1FXT B;  2CS4 A;  2LHE A;  4FAD A;  1XLQ A;  2LFI A;  2AWT A;  1R7S A;  1SIF A;  2J4X A;  4FN2 A;  4A9A A;  2J52 A;  1GNU A;  3IT4 B;  4TQ0 A;  2KC1 A;  5L95 C;  3URY A;  2ZPN A;  4NAW A;  4FA6 A;  1P98 A;  3VDZ A;  4LNK A;  3AU4 A;  1ZKH A;  3X23 A;  2LAS A;  4FJY A;  1V1P B;  4DWF A;  1EUV B;  1FPY A;  2GBR A;  4JX1 C;  2C7M B;  2MJE A;  1WXV A;  5IN7 A;  4W9G A;  4XC2 A;  5GMV A;  2E6X A;  2CJO A;  2D3B A;  1SE9 A;  4ACF A;  1LM8 B;  3N30 A;  3W2D A;  2D5G A;  1QOG A;  1IBX A;  1YIW A;  1WJU A;  4IWP A;  1SJE D;  2FID A;  2L1A A;  2K8B A;  3IFW B;  4P16 A;  2BS2 B;  1N6Z A;  1T0S C;  1WYW B;  3LYY A;  1OFF A;  4MAC A;  1AWD A;  4IC7 B;  1TS2 A;  4YWG G;  3RNF C;  3RUI B;  2J0J A;  1XLN A;  5J2R A;  4DHJ B;  2LWP A;  4EZJ A;  2M0X A;  1WJ4 A;  3UIN B;  1Q10 A;  2K39 A;  2KAC A;  1MPE A;  1ZXI A;  4LDT B;  1YMH E;  2JZZ A;  2D2Q A;  1P1A A;  2HJ1 A;  2VH2 A;  1P7E A;  4W9L A;  4ANX A;  5L83 A;  1RYJ A;  1WIA A;  3ZJU A;  1UEL A;  3PV1 A;  5JH5 C;  4YL8 A;  2ACZ B;  2KX0 A;  4A8X C;  1KF6 B;  3IT6 B;  4GLS C;  1NVI D;  4B6W A;  3L08 A;  4ANV A;  1YJ1 A;  4M8M A;  4W9F A;  1FXI A;  1EO6 A;  2L83 A;  4HVB A;  2K25 A;  2KDF B;  1CK1 A;  3DBS A;  1CJE A;  2KAJ A;  4MH8 A;  2N7E A;  2KQS A;  1TKE A;  4EOY A;  2EMT A;  4KZC A;  4MEM A;  1S3S G;  2GB1 A;  4GB9 A;  4WWO A;  4A55 A;  4N58 A;  2EKE C;  2CKH B;  1QT9 A;  3BY4 B;  4GMV A;  3WAN A;  1XF5 L;  2OHF A;  3PHX B;  1IGC A;  3M62 B;  4S0R A;  2OED A;  3V60 A;  3DPD A;  1WXQ A;  2N4F A;  4XDD A;  3L16 A;  2I2Y A;  2EEL A;  1TY0 A;  2X38 A;  2N9P C;  4TKN A;  4XGA B;  3UF8 A;  4GU2 A;  1E8X A;  4W9J A;  1NBF C;  2AQ3 B;  2RDG A;  3ZUN A;  3L13 A;  2AQ2 B;  2LRW A;  3V3X A;  4DXG A;  2KJ6 A;  4C4V A;  1PFD A;  1P3Q U;  2HD5 B;  3ML8 A;  3W5U B;  4II3 B;  3LJ3 A;  4JLC A;  3NVY A;  1J0G A;  4W9H A;  1TY2 A;  2MEK A;  3DCG A;  1Q5W B;  1F1H A;  1E8W A;  1WY8 A;  2KDM A;  5CHV C;  2YVC A;  1I4G A;  4JPS A;  1YQ3 B;  1DOX A;  3FC4 A;  1EU3 A;  3VFK A;  1GC7 A;  2LJI A;  4TV3 A;  3GZN B;  4WJQ A;  1ET9 A;  2FIF A;  1TJE A;  3SU8 X;  3AI5 A;  4FHK A;  1GAQ B;  3CIR B;  3H8H A;  1YD8 U;  5IA7 A;  2C7H A;  3HM6 X;  1SXT A;  2BBC A;  3EFC A;  1J7B A;  1WM2 A;  4LJP B;  1JWS D;  5AEK B;  1V80 A;  4MGY E;  1N61 A;  1VJK A;  4X57 B;  1M4V A;  2D3C A;  2IY1 B;  1MHH E;  3MHS D;  2QCZ A;  2KO3 A;  2DLB A;  5IKC M;  4RF0 A;  2KWV B;  4FHJ A;  1B1Z A;  1J7C A;  3P4S B;  5IP4 D;  1R4N B;  2KTF A;  3KUZ A;  4M0W B;  4IM3 A;  2WWZ A;  3DWG C;  2FCM A;  2EMS A;  1GC6 A;  3N1Y C;  1EF5 A;  1SEB D;  2AL3 A;  3ZRF A;  1VLB A;  2INP E;  1BML C;  2WQY B;  1LO5 D;  3VQI A;  2KX3 A;  3TUO A;  3ECI A;  1WXS A;  2PE9 A;  4NQL B;  1V6E A;  2G45 B;  2MJ3 A;  4OVZ A;  5FR6 A;  3ZKJ C;  2PTL A;  4MEL A;  3I57 A; 
#chains in the Genus database with same CATH homology
 4WWP A;  1P0R A;  4KVG B;  2XK5 B;  2DYO A;  4BKG A;  3V6C B;  2R2O A;  2LGX A;  4NNJ B;  1MG8 A;  4MGZ E;  3O65 B;  4DHZ E;  5HKH A;  5C23 A;  3PS6 A;  4XZ4 A;  2KMA A;  2IO3 B;  4I6L B;  2DZM A;  3R7R A;  5D7G A;  2KWU B;  2CHZ A;  4WAA A;  1NI2 A;  3HIZ A;  4K7U A;  3TMP B;  4WQO B;  1UBI A;  4G3X B;  2BPS A;  3VXW A;  4TUU A;  5JHB A;  1C3T A;  3DVG X;  1I35 A;  4GIV A;  4DDG D;  3A33 B;  5DCN A;  3VVW B;  4ZRK A;  3W1Y A;  3H6N A;  2K8H A;  2MWS B;  4AJY B;  2LGY A;  1KOT A;  2ZVN A;  2DHZ A;  2ASQ A;  1TBE A;  3DOW A;  2L0T A;  3QQ8 B;  2D10 A;  3CMM B;  3DVN V;  4A3O A;  2CR5 A;  2MX2 A;  1E7U A;  2ZNV C;  3GOE A;  2LI5 A;  3L17 A;  1G6J A;  3B1L X;  2IYD B;  1RFA A;  1Q0W B;  4OVU A;  4K7W A;  5G2N A;  2MBO A;  4HXD A;  2O6V A;  3B08 A;  4NJ6 A;  1YX5 B;  4AUQ C;  3NY5 A;  3NZU A;  1WR1 A;  3KUD B;  1WZ3 A;  4RM8 A;  5AZH A;  5C1Z A;  2JRH A;  3PPA A;  3R3M A;  2BYV E;  3U30 A;  3L10 B;  4HCN B;  4DHJ D;  4LJO B;  2IO1 B;  3EEC A;  4DXA B;  4IW0 A;  1WM3 A;  3KH0 A;  4W9E A;  4ANW A;  3A1Q A;  1WXM A;  2IZV B;  4HPL B;  4F8C B;  5BO4 B;  3QJZ A;  1H4R A;  3QCA A;  3H9D A;  2MW5 A;  1XT9 B;  2MBB B;  2BYF A;  1Y8R C;  3DBL I;  3DQV A;  1UZX B;  4HCP B;  4W9C A;  2DZI A;  1KLV A;  2RR9 A;  4FUL A;  1C1Y B;  1I42 A;  3ONS A;  3QAR A;  1NDD A;  1LXD A;  3AU5 A;  3N32 A;  4ICV A;  2JPH A;  3A1Q B;  1PQS A;  2KDE B;  2DX5 B;  2R2Q A;  4IM0 A;  2JVC A;  2M4N A;  1V2Y A;  2J0K A;  2K6D B;  2C5L C;  1V86 A;  2KC2 A;  2CU1 A;  2V3S A;  3APD A;  3A4S C;  2KDB A;  4HJK A;  3QAQ A;  2C7N B;  2MSE D;  4EUT A;  5EDS A;  4EZK A;  1UD7 A;  2Y5B B;  3VHT C;  4MJS A;  2AL6 A;  2ZCB A;  2HE7 A;  3JW0 X;  1WGG A;  2DZJ A;  2RGF A;  3ENE A;  3IHP C;  4GDL B;  1WJ6 A;  4NQK E;  3OAW A;  5JZE B;  1WGR A;  5CTR C;  1XQQ A;  2RD0 A;  2KN5 A;  2ZVO A;  2DYM A;  3JVZ X;  5CHW A;  1IYF A;  4G50 A;  4MJS B;  2FUH B;  4K1R B;  2KQ7 A;  2K1F A;  3PZD A;  4NY0 A;  1A5R A;  4WJO A;  4W9D A;  3ZNH B;  3ZW3 A;  3UGB B;  4MSM B;  3RD2 A;  3HHM A;  4RM9 A;  3ZRC A;  2NS5 A;  3KYC D;  2D11 A;  3ZNZ B;  4DK5 A;  5DPR A;  3VTV A;  4WJP A;  2RSU A;  1TTN A;  2JY6 A;  4BOZ B;  2KFK B;  1WGY A;  3WAL A;  4CHK A;  2KWC A;  2LVP A;  1BT0 A;  1OEY A;  1VCB A;  1LFD A;  2G4D B;  2LVQ A;  2G4S A;  2WX0 A;  4JIO U;  3TBL D;  1RLF A;  2OOB B;  3C0R B;  4PS3 A;  5E6O A;  1E8Z A;  3U8Z A;  3TCA A;  3KUC B;  4M8N A;  2NBU A;  3ALB A;  2ZJD A;  2KDI A;  2MA9 B;  2IY0 B;  2V4L A;  4GN1 A;  4MGK E;  2XBB C;  3VH3 B;  3EFU A;  3JSV B;  1E90 A;  2REX A;  3ZNG C;  4FJV B;  3H7S A;  4IUM B;  3RCZ A;  4G11 A;  3Q3J A;  4E3C A;  1WX9 A;  1WF9 A;  3R7Q A;  2BWE S;  4FJZ A;  3V6E B;  3EC8 A;  2GMI C;  2PPH A;  3A9J A;  4ZYN A;  1GJZ A;  3TIX A;  1V49 A;  5CHF A;  2QHO A;  4BKS D;  2N9E B;  4HK2 A;  2CHX A;  5DPS A;  4J6I A;  3S2A A;  1FXT B;  2CS4 A;  3B0A A;  4AWJ A;  4FAD A;  4IG7 B;  4HPM B;  2AWT A;  5CX3 A;  3M63 B;  1SIF A;  4IWQ A;  4FN2 A;  3K9O B;  4G0N B;  3SDL C;  1GNU A;  2N1V A;  2MCN B;  3DDC B;  4TQ0 A;  3PLU A;  1X1M A;  2J7Q B;  2MP2 A;  2KC1 A;  2V1Y A;  2NCN A;  5L95 C;  2BF8 B;  2LD9 A;  1E7V A;  2ZPN A;  4RMA A;  4NAW A;  2I1J A;  4FA6 A;  1P98 A;  2WDT B;  2L8J A;  2GBM A;  2GBN A;  4HLE A;  3VDZ A;  2NBV B;  4AP4 C;  3M95 A;  3QK0 A;  3AU4 A;  1ZKH A;  3PRZ A;  3X23 A;  2LVO A;  2DZK A;  2MP2 B;  2LAS A;  4FJY A;  2WX1 A;  4DWF A;  1E5W A;  1EUV B;  2GBR A;  1EF1 A;  3MJW A;  1GUA B;  2D07 B;  1U4A A;  2C7M B;  2GOW A;  3PT2 B;  1WXV A;  2DAJ A;  2JRI B;  1WI0 A;  4LCD E;  2NVU I;  4NPN A;  3VUW A;  4A20 A;  2KD0 A;  4W9G A;  4XC2 A;  5GMV A;  2LZ6 A;  1L2N A;  2K8C A;  3ZLZ A;  3PVL A;  4I6N B;  1SE9 A;  2PJH A;  1CMX B;  1UGM A;  3RYT A;  3UIO B;  4W9K A;  2KMC A;  2JF5 A;  1LM8 B;  5AZG A;  3N30 A;  3PRE A;  2O6V B;  4JL9 A;  2RPQ A;  2MRP A;  4HWI B;  1WMH A;  4PS8 A;  5AZF A;  1YIW A;  5G55 A;  1WJU A;  3W1S A;  2AEH A;  4IWP A;  1V9J A;  4DHZ B;  2FID A;  4JGH B;  2KTR A;  1RRB A;  3TL5 A;  4ASW C;  2K8B A;  3IFW B;  2KFJ A;  3NZS A;  4DBG A;  2KLC A;  1WYW B;  2L7R A;  4F1S A;  2OJR A;  2AYO B;  3WAP A;  1GG3 A;  1SGH A;  2GBJ A;  4MGI E;  2ZCC A;  1J8C A;  4XX5 A;  2GBK A;  4KZ0 A;  2DAF A;  3VH4 B;  4IC7 B;  2L00 B;  3RUI B;  3OJ4 B;  2MQJ A;  4K81 A;  2J0J A;  4TQ1 A;  4URK A;  4FLH A;  5KHQ A;  5J2R A;  2C9W B;  5D6J B;  4B95 A;  4DHJ B;  2UWQ A;  2BKR B;  4KV2 A;  4KDL B;  4ZDV A;  4MSQ B;  3Q3F A;  2LWP A;  2BKF A;  4EZJ A;  2KK8 A;  2M0X A;  1WJ4 A;  2LXA A;  3RT3 B;  3UIN B;  2K39 A;  4KIK A;  3DBH I;  2Z59 B;  1JRU A;  2KNB A;  3QA8 A;  5TR5 A;  3WAO A;  1D3Z A;  4LDT B;  5D94 A;  2JT4 B;  2FNJ B;  2JZZ A;  4ZRI A;  4PS7 A;  2IO0 B;  2D2Q A;  1P1A A;  1ISN A;  2B3A A;  1WRD B;  4W9L A;  4ANX A;  5L83 A;  1WIA A;  2L3Z A;  1IPG A;  3H7P A;  1UEL A;  4JQW C;  3PV1 A;  3U7D A;  3KW5 B;  3M3J A;  4YL8 A;  4BVU C;  5JH5 C;  2WYQ A;  2KX0 A;  3A9K A;  2YLM A;  5KHO A;  2KOX A;  3ZTC A;  2MBQ A;  1P9D U;  4PYU A;  4B6W A;  3L08 A;  1UH6 A;  4ANV A;  1V81 A;  1YJ1 A;  2FCQ A;  4M8M A;  4W9F A;  1EO6 A;  4HVB A;  2KLG A;  3RZW C;  4KSK C;  1OQY A;  1AAR A;  4E71 A;  3K9P B;  3RUL A;  4OVV A;  3A9K B;  3QHT A;  4KSL C;  2K25 A;  3VUY A;  2L0F A;  2KDF B;  3VUX A;  3ZDM C;  4AOF A;  3DBS A;  3APF A;  4MDK E;  3LDZ E;  2A4Z A;  2IO2 B;  2N7E A;  3CSF A;  2KQS A;  2IBI B;  4EOY A;  2EMT A;  4KZC A;  4MEM A;  1S1Q B;  1S3S G;  3OLM D;  4GB9 A;  4WWO A;  2KZR A;  3TJP A;  3PHW B;  2XK5 A;  2EKE C;  3KYD D;  1F9J A;  2CKH B;  2NPT A;  1Z5S B;  3BY4 B;  4BKT A;  4GMV A;  3WAN A;  4EEW A;  4IM2 A;  3QC8 B;  4ANU A;  3A9J B;  2XEW A;  3N3K B;  2JXX A;  3PHX B;  4KDI C;  3M62 B;  3NOB A;  2W9N A;  3V61 A;  3QX1 A;  3V60 A;  1HE8 A;  3DPD A;  1WZ0 A;  2N4F A;  1WJN A;  2O2V A;  3L16 A;  4GXB A;  2MBH A;  5D2M B;  2N9P C;  3APC A;  4TKN A;  3UF8 A;  3UQA A;  3HM3 A;  2NPT B;  4GU2 A;  1E8X A;  1UBQ A;  3PRM B;  4W9J A;  3I3T B;  4BKS A;  4F7Z A;  3ZDT A;  1NBF C;  3GZN I;  1WE7 A;  2Z0D B;  3IG3 A;  1WE6 A;  3PLV A;  3VTU A;  2HJ8 A;  3ZUN A;  2O2V B;  2M17 A;  4ZRJ A;  1WH3 A;  2HTH A;  3ZTD A;  2NR2 A;  3L13 A;  4EZL A;  2Z0E B;  5DPT A;  4GOC A;  2LRW A;  4NAW B;  2LRU A;  3HK0 A;  1E8Y A;  3KVF B;  2C60 A;  4CYE A;  2KXJ A;  3RZF A;  2O6V D;  2KJ6 A;  1P3Q U;  2HD5 B;  4HDQ A;  5E6N A;  5J17 A;  3A4R A;  3ML8 A;  2M8S A;  2G3Q B;  1OGW A;  2A5U A;  3JYU A;  1RAX A;  3PSE B;  4II3 B;  3LJ3 A;  3PRP B;  4JLC A;  4BBN F;  4E74 A;  2JZ3 B;  1KM7 A;  1J0G A;  4W9H A;  2BGF A;  2VRR B;  2N9X A;  3SHQ A;  5LXI B;  3DCG A;  1KJT A;  3PTF C;  4GGQ A;  1Q5W B;  3T9L A;  3VAW A;  3WIM A;  3SD5 A;  3X0W A;  1V5T A;  1E8W A;  2KJR A;  1WY8 A;  4BBN C;  2LUE A;  3QIJ A;  5CHV C;  5IAA C;  2YVC A;  4HDO A;  3W1S C;  1L7Y A;  3ZIM A;  1TZ1 A;  1XD3 B;  4W9I A;  2KJH B;  2L05 A;  3P2B A;  4BOS C;  1H8C A;  3VFK A;  4GDK A;  1GC7 A;  3H1U A;  4TV3 A;  4ICU A;  3CST A;  3UIP B;  4WJQ A;  2ZNV B;  1WMH B;  2FCS A;  2FIF A;  4WWN A;  2PEA A;  3SU8 X;  2ZEQ A;  4GSW A;  4I6P A;  1R4N I;  3AI5 A;  2KTR B;  2LJ5 A;  3AXC A;  4FHK A;  4LDT D;  3L0W B;  2LXC A;  2UYZ B;  4K7S A;  1YX6 B;  2DEN B;  5LLI A;  4GDK B;  4B9K A;  4CO7 A;  3DVN U;  3L54 A;  1YQB A;  1YD8 U;  2KVR A;  3ZO5 B;  1T0Y A;  5IA7 A;  2C7H A;  2KAN A;  3DVG Y;  5E6P A;  1VD2 A;  3HM6 X;  4GDL A;  1IP9 A;  1WM2 A;  2DYB A;  2J0M A;  4LJP B;  3CF6 E;  5J18 A;  5AEK B;  2FAZ A;  3T8M A;  2BYE A;  1V80 A;  1WR6 E;  3AUL A;  3NS8 A;  4MGY E;  3V62 A;  5DPW A;  4II2 B;  2D3G A;  1WX7 A;  1WGH A;  4X57 B;  4EKU A;  1Q1O A;  2IY1 B;  3EHV A;  1QZE A;  1WGD A;  3MHS D;  2KO3 A;  4WJN A;  1K8R B;  2M1M A;  4KIK B;  2LGD A;  2JUO A;  1WFY A;  3IBE A;  3ZNI D;  2MLB A;  2KFK A;  3WA0 A;  2KWV B;  1M94 A;  4EFO A;  4FHJ A;  3DBR I;  3VTW A;  2N7D A;  4MM3 A;  2K6Q A;  3MTN B;  3QWZ B;  5LXH A;  3NHE B;  3H7P B;  2ZZP B;  2KTF A;  3WAM A;  3KUZ A;  1ZGU B;  2N1W A;  4M0W B;  3ML9 A;  4IM3 A;  2WWZ A;  2MBE A;  2FCM A;  1J19 A;  1V5O A;  3JSV A;  2EMS A;  1GC6 A;  1LQB A;  1EF5 A;  2AL3 A;  2KKC A;  2ZPY A;  3OJ3 A;  3ZRF A;  4A3P A;  3D32 A;  1WX8 A;  1R4M I;  2L76 A;  4DDI D;  4PYZ A;  2JWZ A;  3UQB A;  2I1K A;  1ZW7 A;  4P7I A;  4AJW A;  4BFR A;  5JHA A;  2CHW A;  3VQI A;  3BIN A;  2BWF A;  3ZVV A;  1WXA A;  2KX3 A;  3PGE A;  3R66 C;  4IWO A;  4MH0 E;  4FBJ B;  1OTR B;  3ECI A;  1WXS A;  1Z2M A;  2FCN A;  2NBW B;  2PE6 B;  2PE9 A;  1V6E A;  4NJ7 A;  4NQL B;  2G45 B;  5FR6 A;  3ZKJ C;  1OEY J;  4N9F 4;  1TGZ B;  4MEL A;  2KHW B;  3IVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...