4NAWA

Crystal structure of human atg12~atg5-atg16n in complex with a fragment of atg3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
88
structure length
88
Chain Sequence
KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ATG12
publication title Structural basis of ATG3 recognition by the autophagic ubiquitin-like protein ATG12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/ligase
total genus 20
structure length 88
sequence length 88
chains with identical sequence E, I, M
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4nawA00
3CSFA 3DBLI 1K8RB 2CHWA 2M4NA 2NCNA 2CU1A 2KWUB 3JW0X 4IM0A 2KJHB 2IYDB 2BWFA 4WWPA 2IO3B 4TKNA 1JRUA 3ZKJC 4BKSD 4G11A 2BF8B 2MBEA 1WGRA 3TJPA 4LDTB 2KC1A 5E6OA 1NBFC 4MJSA 2Y5BB 3HM3A 2WWZA 4NQLB 5J2RA 4ZDVA 1BT0A 2GBRA 1J19A 2JF5A 4K81A 1QZEA 4M0WB 3HIZA 3V61A 3V60A 2KO3A 4ZRJA 2KHWB 3X0WA 4CHKA 2LWPA 2BWES 4WQOB 2CKHB 4EUTA 3P2BA 4HVBA 1V49A 2K8CA 4GDLB 1EF1A 3AI5A 1WGYA 2LGXA 2ZPNA 3A1QB 4NQKE 3DCGA 4FN2A 1PQSA 3UGBB 4DHJB 2J0KA 5L83A 1UELA 3PRPB 4MGIE 4W9EA 2FCSA 4KDIC 3A9KA 2KDEB 5BO4B 4K1RB 3H1UA 2KMCA 4BVUC 3BY4B 2MBQA 2KXJA 2KZRA 2CS4A 3X23A 2DZIA 3QWZB 4HDOA 4MGZE 3A4SC 4WJQA 1GC7A 4W9CA 2KN5A 1V6EA 1WXVA 3AXCA 1WX8A 3EFUA 4GU2A 4PS7A 4DWFA 3VUWA 3ZRFA 2M8SA 1OGWA 1VCBA 1R4MI 3A9JB 4RM8A 1WX7A 2L05A 4MSQB 4W9HA 3PPAA 2RGFA 3PGEA 2NBUA 3EC8A 3ZNGC 2DZMA 4ANVA 1C1YB 5CHFA 2NVUI 3H7SA 3IVFA 1IP9A 3RCZA 2KWVB 2XBBC 2Z59B 1WZ0A 4KVGB 2GBKA 2JPHA 4MDKE 5TR5A 1WGGA 3LJ3A 3KUZA 4PS3A 3M62B 3ZIMA 2K39A 3R66C 1WMHB 2IO1B 2LD9A 3DVGX 2C60A 2HTHA 2C7NB 5LXIB 4ZRIA 4BOSC 1P3QU 2KVRA 4F7ZA 1XQQA 1J0GA 4WJPA 4MEMA 3OJ3A 4ICVA 5CHVC 1V81A 1LQBA 2N1VA 3ZDMC 2YLMA 3DVGY 3SU8X 3KYDD 2LVQA 4AP4C 3O65B 1V5TA 3V6CB 2AYOB 4HXDA 2L3ZA 2AEHA 2FCQA 1TBEA 3DOWA 1E5WA 4NJ7A 5GMVA 1E8YA 5EDSA 2MA9B 2ZEQA 3IFWB 2G45B 3JSVB 1WJ4A 2PE6B 1GUAB 1YX5B 3B08A 4GIVA 3ZRCA 4M8NA 4CYEA 1WH3A 3NOBA 2MCNB 4IWQA 2PPHA 2JZ3B 3W1SA 3UQAA 1WE6A 3GZNI 3PLUA 4LCDE 4W9LA 3VFKA 2C9WB 1KM7A 2KMAA 3OLMD 2V1YA 3U8ZA 4HCNB 2K6DB 4KDLB 4F1SA 4IW0A 4E74A 1XD3B 4I6LB 3ZNHB 4EZKA 2DYMA 3Q3JA 2K6QA 4BBNF 4GOCA 1UBQA 2MWSB 3RULA 2NS5A 1WM2A 3QIJA 3PV1A 4JIOU 2JVCA 4IC7B 2GBMA 2KDFB 5JZEB 3QCAA 2MBBB 2HE7A 2NPTB 1SGHA 4I6NB 2ZVOA 2D07B 4HDQA 1E8WA 5AZHA 3WAOA 1UD7A 2KFKB 2JZZA 3BINA 3WANA 3WIMA 3APCA 4HWIB 2RR9A 3VTUA 5D6JB 3RUIB 3ZW3A 1S3SG 2LGYA 2N9EB 2O6VA 3IHPC 5DPSA 3SDLC 4OVUA 3VHTC 1E7UA 1GC6A 4MGYE 4ASWC 3N3KB 3ZO5B 1M94A 2J0JA 2BKFA 3MHSD 2NR2A 2Z0DB 3QQ8B 2B3AA 3PLVA 2N9XA 3NY5A 4EFOA 5JH5C 2JY6A 3ENEA 1P0RA 3KW5B 3QK0A 4YL8A 1U4AA 1V5OA 3APDA 2MX2A 2XK5A 3DQVA 4ANUA 1RLFA 3DBRI 3TBLD 4II3B 2KTFA 1WY8A 3UIOB 2KX3A 4GDLA 2KJ6A 3W1YA 4ZYNA 3A1QA 3D32A 2KFJA 2YVCA 1WXMA 2KKCA 2REXA 2ZVNA 2ZPYA 3EECA 1TGZB 4EOYA 3K9PB 3OJ4B 2K25A 3C0RB 2BKRB 4TUUA 4MM3A 2DHZA 2IO0B 2N7EA 5AZGA 2BYEA 2PJHA 4P7IA 2LXAA 2O2VA 4KIKA 4FA6A 4RM9A 1ZKHA 3DVNV 3LDZE 1Z5SB 3B0AA 2G4SA 3GOEA 3PVLA 2OOBB 4HPLB 3RYTA 3H7PB 4XC2A 1AARA 4DHZB 4BOZB 1OEYJ 2KJRA 2KNBA 3L16A 3PHWB 3QARA 4PS8A 5CX3A 1YQBA 4BKGA 4NJ6A 5CHWA 5HKHA 5DPTA 1WI0A 3DPDA 3L08A 3PREA 5J17A 2IY1B 1ISNA 3QJZA 4HJKA 4W9IA 3T8MA 2KQ7A 4G50A 1HE8A 2MBOA 4GGQA 4PYUA 3A33B 4RMAA 1WR1A 1Z2MA 4DHZE 2IY0B 3RZWC 2N7DA 2LVOA 2C7MB 4LJPB 2A5UA 1OQYA 4AJWA 4MGKE 4NY0A 4B9KA 1Q1OA 1WGDA 2ASQA 2LGDA 4JLCA 2R2QA 3IG3A 1WMHA 4HPMB 1H4RA 1E90A 2MLBA 3U30A 4A3OA 1D3ZA 1Q0WB 4B6WA 4K7UA 2O6VD 3S2AA 3VUXA 2J0MA 2J7QB 1KOTA 3NZSA 2M17A 4GDKB 3N32A 1ZGUB 4GXBA 5IA7A 4EKUA 4EEWA 3ZTCA 2A4ZA 1WRDB 1GG3A 2DENB 3HK0A 4W9FA 2IBIB 1SE9A 2FCNA 4MELA 4URKA 4EZLA 5DCNA 3HM6X 2ZZPB 2W9NA 4BKTA 2LVPA 3MJWA 1WGHA 2MP2B 3PTFC 3APFA 2MBHA 4FJYA 4AUQC 3UIPB 2K8BA 2WDTB 3Q3FA 4M8MA 2AL6A 5G55A 2RSUA 1P9DU 3AU5A 3AU4A 2C7HA 3RD2A 4DHJD 2AL3A 2CHXA 2N1WA 2ZNVC 2XEWA 1YIWA 2ZNVB 2ZCCA 3R7RA 2VRRB 4OVVA 2IZVB 1EF5A 2JT4B 2MRPA 3DBHI 4G3XB 2JXXA 2LXCA 2HJ8A 4XZ4A 3AULA 5E6PA 2D3GA 2KANA 1WXSA 2G4DB 4K7SA 3L13A 5C23A 2L0FA 1WYWB 1X1MA 2KTRB 5DPWA 2FNJB 3KH0A 2MSED 3DBSA 3CSTA 2L76A 3MTNB 2N4FA 4AWJA 2UYZB 4KV2A 1E7VA 2I1JA 2HD5B 3UQBA 2KQSA 1EUVB 3N30A 2BYFA 5CTRC 1FXTB 1LFDA 4G0NB 2D11A 1I35A 4J6IA 3KUDB 4I6PA 4TQ1A 5AEKB 4BBNC 2CR5A 2FIFA 4BFRA 2D2QA 1VD2A 3PZDA 2KC2A 4W9GA 2D10A 3ZNZB 3VXWA 3PSEB 1IPGA 3M63B 5D2MB 1R4NI 5AZFA 4B95A 2IO2B 4NNJB 2WX0A 2KLCA 4DBGA 4IWPA 4W9KA 1I42A 5C1ZA 1A5RA 2QHOA 2KFKA 4JL9A 2MW5A 4WWOA 2V4LA 2L0TA 4A3PA 4AOFA 1SIFA 2JUOA 1RAXA 3EHVA 1F9JA 4EZJA 2L00B 3JYUA 1YX6B 2KOXA 5L95C 1TTNA 3OAWA 4GB9A 4AJYB 2KK8A 2WYQA 3ZVVA 3ML8A 2EKEC 1WIAA 1KJTA 3VDZA 2EMSA 1V86A 3ONSA 1CMXB 3QC8B 2GBJA 4FBJB 5LLIA 4NAWB 1WJNA 4HK2A 2M0XA 2JRIB 4FJZA 4WJOA 3SD5A 3VVWB 4ZRKA 3NS8A 3L54A 4K7WA 4KSLC 4F8CB 1P98A 3ZTDA 2FUHB 2M1MA 3NZUA 1LM8B 3VUYA 2CHZA 1OEYA 2O6VB 1GJZA 2DZJA 5FR6A 3B1LX 4CO7A 1J8CA 4IWOA 3RT3B 4MJSB 1WE7A 1XT9B 3L0WB 4KSKC 2LASA 4KZCA 2JWZA 3VAWA 1IYFA 2FAZA 1RRBA 2I1KA 4ICUA 2ZJDA 4N9F4 3VTWA 2XK5B 3H7PA 2PE9A 1UH6A 3H9DA 4IM3A 4WWNA 1E8XA 2G3QB 2WX1A 3A9JA 1V80A 3NHEB 4DDID 5LXHA 4DDGD 2C5LC 1T0YA 1YD8U 1OTRB 2JRHA 4TV3A 4E3CA 2OJRA 4HLEA 4FLHA 2KDIA 3H6NA 3TIXA 1TZ1A 3A9KB 3K9OB 2BGFA 1V9JA 3QAQA 4JGHB 5JHAA 4PYZA 2PEAA 2N9PC 4A20A 2O2VB 4KIKB 1WJUA 3ZDTA 4ANXA 3UINB 2DAJA 4FULA 2KWCA 2BYVE 2MQJA 3T9LA 1WZ3A 2LUEA 3V62A 4MSMB 3IBEA 4LDTD 5G2NA 3WAPA 2NBVB 3L10B 4GDKA 2KDBA 4TQ0A 2K8HA 1Y8RC 1UZXB 1EO6A 2Z0EB 4MH0E 4X57B 2DX5B 2DYOA 3V6EB 5JHBA 1H8CA 3PS6A 1MG8A 3U7DA 3CMMB 4HCPB 2LRUA 1RFAA 4FADA 2FIDA 1L7YA 3UF8A 2GBNA 2DZKA 3CF6E 3VH4B 4W9DA 2KLGA 2V3SA 4NPNA 3TMPB 2MP2A 1WFYA 4WAAA 1WR6E 3SHQA 3ALBA 3PHXB 2KD0A 3JSVA 3ZLZA 1NDDA 1V2YA 2R2OA 1WXAA 4BKSA 3ML9A 1YJ1A 2DYBA 4JQWC 3PRMB 2NBWB 4IUMB 4E71A 4IG7B 1LXDA 1NI2A 1S1QB 1Q5WB 1G6JA 3A4RA 4IM2A 5J18A 2KTRA 4FHKA 3I3TB 3QX1A 2K1FA 2LJ5A 3RZFA 1E8ZA 4DXAB 5D94A 1WX9A 4ANWA 4GN1A 3M3JA 1GNUA 1WM3A 3R3MA 3KYCD 4KZ0A 3PRZA 2LZ6A 2RD0A 3KVFB 2EMTA 4FJVB 3W1SC 5IAAC 3ZNID 4DK5A 2L8JA 3KUCB 1WJ6A 3PT2B 4II2B 3VQIA 1P1AA 3R7QA 3QA8A 2NPTA 5DPRA 5KHOA 3M95A 4LJOB 1ZW7A 2GMIC 5E6NA 2UWQA 3JVZX 1L2NA 3DVNU 2RPQA 4XX5A 3VTVA 3HHMA 1C3TA 2L7RA 4WJNA 4GSWA 3WAMA 3WA0A 5KHQA 2AWTA 1KLVA 3WALA 1UGMA 4FHJA 1WF9A 3ECIA 3L17A 3TL5A 2BPSA 3DDCB 3VH3B 3ZUNA 5D7GA 2DAFA 4GMVA 2ZCBA 2LRWA 2LI5A 4W9JA 3QHTA 2GOWA 3TCAA 1UBIA 2KX0A 2FCMA 4NAWA
chains in the Genus database with same CATH superfamily
1K8RB 2M4NA 2WP9B 2KWUB 2L52A 2EELA 4TKNA 1OQRA 4OVZA 2WDQB 1C4CA 2FE8A 4US8A 3MC0B 5E6OA 3AB5A 1BT0A 3RMKC 3GB1A 3X0WA 3V60A 2KHWB 4IKGA 4CHKA 2CKHB 4EUTA 3AI5A 1FNVA 4DHJB 3P42A 2J0KA 1UELA 1FMAD 3AN1A 4FXCA 2KXJA 2KZRA 2CS4A 3X23A 1KLUD 2DZIA 3QWZB 4HDOA 4WJQA 2QCZA 1V6EA 3AXCA 4PS7A 1WX8A 2XN9C 3VUWA 4NZLB 3DHGC 3AE3B 2BB6A 3RNAC 1SSNA 4W9HA 3PPAA 2RGFA 1NYQA 2NBUA 5H92C 3ZNGC 4ANVA 1ZXIA 3RCZA 3EA6A 2KWVB 2WXHA 1ZPSA 2JQRB 3Q3MC 1L6VA 2KACA 2WXKA 2JPHA 5TR5A 3KUZA 4PS3A 3ZIMA 3DVGX 4ZRIA 4C56C 2J53A 2IGHA 4RFBA 4F7ZA 4HKQA 1SE4A 3OJ3A 1E9MA 2JYEA 4PT5A 1TS4A 3SU8X 3HVZA 3MHZA 4AP4C 2WLBA 1K50A 4HXDA 2AEHA 2FCQA 1TBEA 2HTME 1E8YA 4RNAA 2G45B 1V8CA 1VJKA 1WJ4A 1GB1A 4GIVA 3ZRCA 1WH3A 2MCNB 3W1SA 3PLUA 3GZNI 5HI1A 2K22A 4W9LA 3VFKA 3OLMD 2WNMA 2K6DB 4KDLB 4L23A 1XD3B 3ZNHB 1TZOA 3Q3JA 1PDXA 4LLGM 1OFFA 1T0QC 4BBNF 1UBQA 3QIJA 1N60A 2JVCA 3AEGB 1UNSA 2ZVOA 1UD7A 3IXSA 3WIMA 3APCA 1QILA 1S3SG 2LGYA 5EE9A 1P7FA 4ASWC 2BKFA 2Y5PA 3BYYB 2B3AA 3KW5B 1N63A 1IBXA 1V5OA 2XK5A 4M0WA 4ANUA 1RLFA 3TBLD 4II3B 1WY8A 2VZKD 4GDLA 2KJ6A 3A1QA 3D32A 3AM9A 4XGAB 2ZVNA 2ZPYA 4EOYA 1TGZB 2BKRB 4TUUA 5AZGA 3P1MA 2PJHA 2O2VA 4KIKA 1ZKHA 3DVNV 2OOBB 4HPLB 1AARA 4P1BC 3MFGA 2KNBA 3L16A 2KDMA 5J17A 1L5PA 1ISNA 1TJEA 3QJZA 4W9IA 3T8MA 1SE2A 3A33B 4DHZE 5L83A 2LVOA 4LJPB 1MVKA 4AJWA 1FNUA 4MGKE 4NY0A 4Q2JA 2ASQA 1HZ6A 1MJDA 4C80A 4KGSA 2R2QA 2OEDA 2PKOA 3IG3A 1H4RA 1XXGA 3TUOA 1Q0WB 4ZRQA 1TYGB 5D3DA 3VUXA 4KX6B 1UGJA 2M17A 2ZW0A 3N32A 1AN8A 4GXBA 5IA7A 4EKUA 3ZTCA 3AMZA 1GG3A 4W9FA 2QIEB 2I2YA 2W9NA 1HZ5A 1WGHA 2MP2B 3BVZA 3APFA 1F77A 4M8MA 3AU5A 1XLPA 3DHHC 2AX5A 3R7RA 5BMIA 4JX1C 2BW2A 1F2RC 2JXXA 3LXFA 1J7AA 1UWMA 2L0FA 2WXLA 3KH0A 4HEA1 2MEKA 2HD5B 2HDEA 1FXTB 4G0NB 1I35A 2D11A 5MPOA 4I6PA 1XCQL 2CR5A 2K0PA 1ZUD2 2KC2A 3VXWA 1IPGA 2WX0A 4IWPA 5C1ZA 2KFKA 4WH4A 4AOFA 2JUOA 3KQ4A 4C4VA 5BYRA 4GB9A 2H89B 1JWUD 2WU5B 4XE0A 3ML8A 3NZ3A 1WIAA 1HXYD 3AV8A 2WGSA 3GZNB 3ONSA 3I57A 4NAWB 4WJOA 4FJZA 1F0ZA 3NS8A 3I63C 3L54A 4MACA 1P98A 1N62A 1E7PB 2M1MA 3N20C 1GJZA 1C4AA 1HTQA 4CO7A 2WDVB 2WXIA 3L0WB 1IYFA 2FAZA 3UI3A 1RRBA 4N9F4 3DBLB 2I38A 1NI3A 1PFDA 1V80A 5LXHA 4WIPA 4FLHA 2KDIA 4N6EB 1FRDA 2BGFA 1V9JA 4JGHB 2N9PC 2RDBC 1QOGA 1JALA 1SE3A 4YTNB 1DOXA 4ANXA 2SEBD 2GLSA 1FCLA 4FULA 1AWDA 2BYVE 1WZ3A 4RF1A 2LUEA 2BVCA 4P16A 2IJ0A 4LDTD 3WAPA 2BB5A 3L10B 2JYTA 3R8BA 4TQ0A 1Y8RC 1UZXB 4JWUC 3RNEC 1L6UA 3U7DA 3CMMB 1ENFA 1AYFA 1RFAA 1WWTA 4W9DA 2KLGA 4NPNA 4WAAA 1GB4A 1K53A 3SHQA 2SAKA 3JSVA 3ZLZA 2WS3B 2MHJA 3ML9A 1YJ1A 3R2IA 4A6QA 1S1QB 1G6JA 2DNFA 1IGCA 2K1FA 3FKYA 1E8ZA 4B0MA 4TSSA 2LHEA 2LGSA 1FEHA 3BK1A 3R3MA 3KYCD 1WXQA 4C7ZA 4II2B 3R7QA 3LYYA 2NMQA 3M95A 4KGTA 3P63A 3AEBB 2NTTA 3EGRA 3JVZX 3IT6B 3DVNU 3HHMA 1C3TA 2L7RA 4WJNA 3WAMA 1LO5D 1TS3A 3WA0A 3WALA 1UGMA 1WF9A 3VH3B 3ZUNA 2LRWA 4H2AA 2W3SA 4RGOS 4W9JA 3W1YA 3WCQA 3BVGA 1XCTL 1K52A 2LJIA 2M56B 2IO3B 3PZ7A 1JRUA 3ZJTA 1MI0A 2WWZA 5J2RA 4ZDVA 2GBRA 2JF5A 4HPPA 3V61A 4HRSA 1V49A 2DLBA 4A90A 3N9YC 3W5VB 1WGYA 2LGXA 2INCC 2ZPNA 3DCGA 1PQSA 4MGIE 4KDIC 3A9KA 5BO4B 2KMCA 4J3OD 4BVUC 3RNGC 1GC7A 4GU2A 1I4RA 3BIID 3VRAB 4JWSC 5HFYA 3ZRFA 1VCBA 1R4MI 4RM8A 2UU7A 4ZHPA 3PGEA 2JXTA 3EC8A 2DZMA 5CHFA 2NVUI 1XF5L 1WGKA 1WZ0A 4MDKE 3W5UB 4LNOA 2C60A 5LXIB 2C7NB 3Q14C 1XQQA 4WJPA 2JWUA 2FBWB 1V81A 1TKGA 1LQBA 4AQ7A 2YLMA 3DVGY 1N6ZA 2LVQA 2AYOB 3DOWA 4QAYA 3ZGZA 4NJ7A 2MA9B 1EWYC 2M0AA 1GUAB 4AS1A 3FILA 4ARIA 4M8NA 3ZQ4A 3NOBA 1IUEA 2BTEA 4IWQA 2YEPF 2OJWA 4WURA 2RDGA 5C3JB 2KMAA 3AE1B 3B2GA 3O13A 4IW0A 4E74A 4I6LB 3AECB 5AUKA 4HJGE 2DYMA 1KRHA 2NS5A 3PV1A 1TS5A 3MJ5A 4IC7B 3DBHB 2KDFB 1FXAA 3QCAA 2HE7A 1SGHA 1JRPA 5AZHA 2KMMA 1ESFA 3WANA 4XWTA 3VTUA 2V9HA 3GE8C 2N9EB 2O6VA 3VHTC 2PTLA 3E9SA 2PLPA 3ZO5B 3MHSD 3FC4A 2NR2A 3PLVA 5JH5C 3RNBC 3QK0A 2X8XX 4YL8A 1U4AA 2MX2A 2MH7A 2GRIA 3UIOB 2KX3A 2WXQA 2LHDA 1WXMA 5IO9A 3ZXRA 2K25A 3C0RB 1B1ZA 4FA6A 3LDZE 1Z5SB 3B0AA 2G4SA 3H7PB 1JROA 4DHZB 3AE6B 3KWLA 4PS8A 3AEAB 1YQBA 1SF0A 4BKGA 5CHWA 4LTUA 1HTOA 1WI0A 4R3DA 2WDRB 1N5XA 2MBOA 4PYUA 3Q8FA 2MJDA 1JQ4A 4JE3B 4D2KA 2LGDA 1V1OA 4HPMB 2LUMA 5FR3A 1D3ZA 4B6WA 1FPYA 2O6VD 2W82A 4K7UA 2J7QB 2KT7A 2WHIA 2G9HD 3BVMA 2DENB 3HK0A 2FCNA 4URKA 2ZZPB 4RF0A 2KYWA 3PTFC 2LFIA 2MBHA 4AUQC 1R4MB 1VLBA 2WDTB 4UDUC 1VZ7A 1ZP0B 2RSUA 3NRZA 5HHDG 2C7HA 4DHJD 2CHXA 2N1WA 2ZNVC 2XEWA 1DYQA 4OVVA 4G3XB 2IZVB 1EF5A 2JT4B 3J9CA 2YEPB 2LXCA 4XZ4A 3B2FA 1D5MC 5E6PA 4K7SA 2G4DB 5C23A 2MJ3A 3NUHB 3DBSA 2FUG1 4S17A 2W54A 5IKCM 2VZKB 2KQSA 5D3IB 1LFDA 5AEKB 2FIFA 1SEBD 2D2QA 1C76A 1NENB 1VD2A 3N1YC 3SFEB 3EFCA 3ZNZB 3PSEB 1R4NI 5AZFA 1C77A 4W9KA 2PIAA 5IOIA 2MW5A 3W9CB 2V4LA 4C00A 2L0TA 1SIFA 1RAXA 3EHVA 5BMHA 4EZJA 5IN7A 2KOXA 5L95C 3OAWA 4KGRA 1HQRD 4HKZE 3TEZA 1MHHE 2AQ3B 4FBJB 5LLIA 4LNFA 1WJNA 2M0XA 3VVWB 4ZRKA 1ACCA 1FO4A 3I9V1 2PVGC 3ZTDA 1EM7A 1N61A 2FUHB 1LM8B 3VUYA 2CHZA 3VR8B 5FR6A 3B1LX 1T6BX 1J8CA 4LNNA 3RT3B 4MJSB 1BXTA 4KZCA 1ET6A 3LB8C 3RNCC 2XK5B 1OQQA 5BMGA 2PE9A 3RPFC 4IM3A 1UUPA 2G3QB 3A9JA 2M19A 1V1PB 4MH8A 1T0YA 1YD8U 1I4XA 4PK1A 4E3CA 3H6NA 3TIXA 3BYTB 4PYZA 1TIFA 3ZXVA 2O2VB 4KIKB 1QQRA 1WJUA 1SIJA 1B9RA 3ZDTA 2WXOA 1YN5A 2MQJA 1XO3A 3V05A 5G2NA 2NBVB 3RFZB 2K8HA 5C2TB 2Z0EB 1H8CA 2DX5B 2BBCA 1MG8A 2LRUA 4FADA 1I4PA 3UF8A 4L2YA 4RH6A 2V3SA 5H8YE 3TMPB 2MP2A 1E6EB 3SFDB 1WXAA 4BKSA 2DYBA 3PRMB 4IG7B 1LXDA 2H88B 4WWMA 1TT5B 3I3TB 2V3NA 1C4PA 1WSPA 3U7ZA 5D94A 4ANWA 1UF0A 4CQNA 1XLOA 3M3JA 2D5GA 3IT4B 4YSYB 2RDHA 4KZ0A 3PRZA 1QOBA 2LZ6A 2KWDA 2EMTA 3W1SC 2L8JA 3VQIA 1NVID 3QA8A 2NPTA 5DPRA 3AEEB 3T3NA 2ACZB 3ZJUA 3TSSA 4LJOB 5E6NA 1L2NA 3VTVA 4XX5A 3MC9A 4FHJA 3ECIA 3L17A 2BPSA 3DDCB 5D7GA 2K9XA 4GMVA 1PGXA 3QHTA 3KWVA 4K3BA 4DQOC 1UBIA 2KX0A 1XLQA 4NAWA 3CSFA 2CHWA 4DXFA 3JW0X 1ROEA 2IYDB 5TSSA 4WWPA 1C79A 4BKSD 2MBEA 1WGRA 5HG2A 3TJPA 1GPXA 4LDTB 2KC1A 2BYTA 3NVWA 1NBFC 2INDC 2Y5BB 3HM3A 3AE9B 4NQLB 1FXIA 4ZHOA 4KKJA 1J19A 4K81A 3Q3NC 2KO3A 4ZRJA 4LK0M 2LWPA 2BWES 3P2BA 2K8CA 4NQKE 3AE7B 3UGBB 3PRPB 4W9EA 2FCSA 3PO0A 4K1RB 1WRIA 4MM3B 2WXJA 3Q8EA 2KN4A 2MBQA 4ZYSA 4NJCA 2W3RA 3A4SC 2LGIA 4W9CA 1WXVA 1T5XD 4DWFA 2Y3AA 2RPVA 1WX7A 2L05A 3MC8A 2Z59B 1FCCC 1F52A 1CZPA 2GBKA 4WAFA 1WGGA 2K39A 1WMHB 2JSVX 3TEYA 2HTHA 1UWXA 4BOSC 2KVRA 1J0GA 1SJED 3TEXA 5CHVC 3OG5A 4YTPB 2KVZA 2NTSA 3ZDMC 4TMAB 2ONQA 3KYDD 3O65B 2Z8LA 3V6CB 4YT0B 1E5WA 3HRDD 5EDSA 3IFWB 3JSVB 1JWAD 4XDCA 1YX5B 3Q6BA 3I5JC 2PPHA 2JZ3B 3ZJVA 4A8XC 1KM7A 1Q10A 2ON8A 4HCNB 2AQ2B 4F1SA 2HJ1A 1FFUA 2EKIA 1MHXA 2K6QA 1J7BA 4GOCA 3RULA 1L4DB 1QOFA 2GBMA 4OZBA 2N9KA 4I6NB 4HDQA 1E8WA 4REZA 3NS1A 5D6JB 4LNIA 3ZW3A 2PW9A 1PYWD 3SDLC 5DPSA 1CQVA 1E7UA 1GC6A 2ZW1A 3RI7C 1M94A 2Z0DB 3QQ8B 3NY5A 3ENEA 1P0RA 1I4HA 1ET9A 1SXTA 2KTFA 1CJEA 1FNWA 1VR9A 2KFJA 2YVCA 2KKCA 2REXA 2R61A 1CK1A 1T0SC 3EECA 3K9PB 4OZAA 5AUIA 2DHZA 2IO0B 2N7EA 3VRBB 2BYEA 4BZAA 4IDIA 4RM9A 3TEWA 3PVLA 3AE4B 3ZYYX 1OEYJ 2KJRA 3HVDA 5HKHA 5DPTA 4RGNA 2J42A 3DPDA 3L08A 2IY1B 2GB1A 2OHFA 1SJHD 4YWGG 4XWWA 3RZWC 2N7DA 2C7MB 1OQYA 1QKZA 1Q1OA 1WGDA 1MG4A 1RYJA 3T3OA 1E90A 3U2SC 5GXGB 3NVVA 3S2AA 3NZSA 2INNE 4GDKB 4JPSA 1L0XB 1ZGUB 2IBIB 1SE9A 5DCNA 1QF6A 4BKTA 2LVPA 4FJYA 2K8BA 2AL6A 3Q8AA 3U4EG 3AU4A 3RD2A 1TS2A 1MPEA 1YIWA 2ZNVB 1BUIC 1L0YB 2ZCCA 2VRRB 2IDYA 2PMVA 3AULA 2D3GA 2QMTA 1WYWB 2KTRB 4LNKA 3CSTA 2L76A 1GOZA 5T8IA 3MTNB 4DXGA 1R7SA 3AH7A 4KV2A 1E7VA 2I1JA 2D3BA 1TKYA 2J4XA 5EE1A 3IAS1 1EUVB 5CTRC 4TQ1A 1RFKA 3FILB 3R2TA 3E56A 3PZDA 3EUB2 2D10A 1DOYA 3M63B 4RCOA 4B95A 2IO2B 1ZDVA 4DBGA 1A5RA 2QHOA 3N1XC 2V0GA 5EE3A 4JL9A 4WWOA 2GI9A 1F9JA 1YJJA 2L00B 2N7JA 2KK8A 3BZDB 1YOVB 3ZVVA 1V86A 5G5HA 2XNAC 2GBJA 4OZCA 5G5GA 4HK2A 2JRIB 2TSSA 3URYA 4F8CB 2L1AA 1I4GA 2QDFA 3NZUA 1FD6A 2O6VB 2DZJA 2CU3A 1WE7A 2QEJC 2LASA 1D6EC 2JWZA 4S0RA 2I1KA 4ICUA 2ZJDA 1K51A 3P4PB 3H7PA 1DGJA 2J52A 2QSDA 3H9DA 4WWNA 1E8XA 4DDID 4DDGD 2G1EA 1OTRB 2JRHA 4TV3A 1VZ6A 3N1ZC 1TZ1A 1PUTA 3VR9B 3K9OB 5JHAA 1AW7A 3AEDB 3NVZA 4L1BA 2JX5A 1RWSA 1V97A 2KWCA 2W55A 1YN4A 3V62A 1YN3A 2N0SB 1M4VA 1HEZE 3IBEA 3L4PA 2WXRA 2KDBA 3V3XA 3V6EB 3HUIA 1TKEA 2DYOA 4HROA 3PS6A 4K3CA 4HCPB 3H8HA 2RMMA 2FIDA 2E3TA 1L7YA 2GBNA 3CF6E 3VH4B 3ALBA 1C78A 2DWQA 5E6JA 4M01A 1VDVA 2QJLA 2BQQA 4JQWC 3CIRB 4IUMB 4E71A 5IP4D 1KTKA 5J18A 1YJIA 2Q5WD 3QX1A 4DXAB 1WX9A 3SR6A 4GN1A 2BS3B 1YQ4B 1GNUA 2WXFA 1WM3A 4XYCA 2RD0A 3KVFB 1I4QA 3ZNID 3ABVB 3KUCB 2B76B 4ACFA 1P1AA 4A55A 1ZW7A 1QT9A 1JWSD 2AWTA 1KLVA 2D3AA 1YNTE 2DAFA 1EWCA 2LI5A 4ARCA 2MJEA 4KSLC 2WQYB 1YQ3B 3DBLI 2NCNA 1I7HA 2N9LA 2CU1A 3NJTA 1IGDA 4IM0A 2KJHB 4MT5A 3W2DA 2BWFA 3ZKJC 2DBYA 4G11A 2BF8B 4EE2A 4MJSA 1TY2A 4BAXA 5FK9C 1IBXB 1QZEA 4M0WB 3HIZA 4WQOB 4HVBA 4O1NA 4GDLB 1EF1A 4USAA 1V1PA 3A1QB 1L0VB 4FN2A 2KDEB 4IOIE 3H1UA 3BY4B 3DHIC 4MGZE 4N58A 2KN5A 3EFUA 1YMHE 1KF6B 1VZ8A 1VRAB 2M8SA 1OGWA 3A9JB 3KLSX 4MSQB 1C1YB 3AE5B 3H7SA 3BWUD 3IVFA 1IP9A 2XBBC 3Q2AC 1D5ZC 2Y5CA 4KVGB 1P7EA 5BYSA 3LJ3A 3M62B 2L83A 3R66C 1GAQB 3P4RB 2IO1B 1DOIA 2LD9A 1P3QU 2IGGA 4MEMA 4YSXB 4ICVA 2N1VA 4YTMB 1V5TA 2L3ZA 5GMVA 3MP9A 2ZEQA 1ZDXA 2LEKA 4ITKA 2PE6B 3B08A 1JW9D 4CYEA 1LGRA 3UQAA 1WE6A 4LCDE 1L4ZB 2C9WB 1D5XC 2V1YA 3U8ZA 1KFYB 1T3QA 1D4BA 4EZKA 2BS4B 2MWSB 1WM2A 4JIOU 2WXPA 1QLBB 5JZEB 2MBBB 1T0RC 1E0ZA 2NPTB 2D07B 3Q8CA 3WAOA 2KFKB 2JZZA 3BINA 4M00A 4HWIB 4US9A 2RR9A 2QILA 3RUIB 4C4VB 1JWMD 1N5WA 3IHPC 3C8YA 4OVUA 4MGYE 3N3KB 2J0JA 3NG0A 1R4NB 2N9XA 4EFOA 2JY6A 4GLSC 2V4IB 3APDA 1NYRA 2AQ1B 3DQVA 3DBRI 3U52E 1KH0A 3DWGC 4ZYNA 1BMLC 3OJ4B 1EU3A 2K5PA 4MM3A 4P6VF 4P7IA 2LXAA 3Q8BA 4N59A 1RM6C 3GOEA 3RYTA 4XC2A 4BOZB 3PHWB 3QARA 5CX3A 4NJ6A 3PREA 2QC8A 3C19A 4HJKA 1XLNA 4GGQA 1HE8A 2KQ7A 4G50A 4RMAA 1XEEA 1WR1A 1Z2MA 2IPKD 2IY0B 1SBBB 2A5UA 4B9KA 1STEA 3CWIA 2D3CA 2WXNA 4WQMA 3RN9C 4P1CC 4JLCA 1WMHA 1FIQA 2MLBA 3U30A 4A3OA 1QOAA 3BK2A 4XDDA 2J0MA 2WXGA 1KOTA 2LMCA 2IGDA 2KAJA 1J7CA 1FM0D 4EEWA 2A4ZA 1WRDB 1JMLA 5JXVA 4MELA 3DWMA 4EZLA 2BT6A 1WYGA 2INPE 2VH1A 2L32A 3HM6X 4ZOHC 4YSZB 3MJWA 3GE3C 3UIPB 3PZ8A 3Q3FA 5G55A 1P9DU 2WXMA 1KLGD 2ICIA 2JU6X 2AL3A 2JZPA 2MRPA 3DBHI 2HJ8A 2KANA 1WXSA 3L13A 5EE0A 1X1MA 5DPWA 2FNJB 3P4QB 2MSED 1TY0A 2N4FA 4AWJA 2UYZB 3UQBA 4KKIA 3N30A 2BYFA 3Q69A 4J6IA 3KUDB 4BBNC 4BFRA 3AE2B 2WU2B 4W9GA 3RNFC 5D2MB 4NNJB 2KLCA 1PGBA 1I42A 1EU4A 4A3PA 3ETRA 3JYUA 1YX6B 4ZRPA 1TTNA 4AJYB 4RGTA 4A9AA 2WYQA 5BYQA 2EKEC 3GP7A 1KJTA 5FKAC 3VDZA 2EMSA 5I4DA 1CMXB 3QC8B 3SEBA 1Y56A 3SD5A 4C7YA 4OW0A 4K7WA 1OEYA 3B9JA 4IWOA 4B0EA 1JWBD 4RGMA 1XT9B 1MFWA 3VAWA 4KSKC 3VTWA 2KQ4X 1UH6A 2WX1A 3AEFB 3NHEB 2C5LC 2CJOA 2OJRA 4HLEA 2E6XA 1F1HA 1ZOYB 2V3PA 3A9KB 3QAQA 2PEAA 4A20A 1FFVA 1C9FA 3Q3OC 3DBRB 3UINB 2DAJA 3OWEB 3IAM1 3GS2A 3T9LA 1FRRA 2K3UA 4MSMB 4GDKA 3AE8B 1EO6A 5JHBA 1F2RI 4MH0E 4X57B 1ZXHA 2DZKA 3P4SB 1WFYA 1WR6E 3PHXB 2KD0A 3NVYA 1NDDA 1V2YA 2R2OA 1E10A 2VH2A 2NBWB 4OHJA 1NI2A 1Q5WB 3A4RA 4IM2A 2KTRA 4FHKA 3FAHA 2LJ5A 3RZFA 4YXDB 2CJNA 2X38A 1ZE3D 2BS2B 1SB3C 5LNK1 4FJVB 5IAAC 4DK5A 1JCKB 1WJ6A 3PT2B 1HA5A 4M02A 5KHOA 2GMIC 2PVOD 2UWQA 2RPQA 4GSWA 5KHQA 4NAMA 1NEKB 3TL5A 1A70A 2ZCBA 2GOWA 3TCAA 2FCMA 1PGAA
chains in the Genus database with same CATH topology
3CSFA 3DBLI 1K8RB 2CHWA 2M4NA 2NCNA 2CU1A 2KWUB 3JW0X 4IM0A 2KJHB 2IYDB 2BWFA 4WWPA 2IO3B 4TKNA 1JRUA 3ZKJC 4BKSD 4G11A 2BF8B 2MBEA 1WGRA 3TJPA 4LDTB 2KC1A 5E6OA 1NBFC 4MJSA 2Y5BB 3HM3A 2WWZA 4NQLB 5J2RA 4ZDVA 1BT0A 2GBRA 1J19A 2JF5A 4K81A 1QZEA 4M0WB 3HIZA 3V61A 3V60A 2KO3A 4ZRJA 2KHWB 3X0WA 4CHKA 2LWPA 2BWES 4WQOB 2CKHB 4EUTA 3P2BA 4HVBA 1V49A 2K8CA 4GDLB 1EF1A 3AI5A 1WGYA 2LGXA 2ZPNA 3A1QB 4NQKE 3DCGA 4FN2A 1PQSA 3UGBB 4DHJB 2J0KA 5L83A 1UELA 3PRPB 4MGIE 4W9EA 2FCSA 4KDIC 3A9KA 2KDEB 5BO4B 4K1RB 3H1UA 2KMCA 4BVUC 3BY4B 2MBQA 2KXJA 2KZRA 2CS4A 3X23A 2DZIA 3QWZB 4HDOA 4MGZE 3A4SC 4WJQA 1GC7A 4W9CA 2KN5A 1V6EA 1WXVA 3AXCA 1WX8A 3EFUA 4GU2A 4PS7A 4DWFA 3VUWA 3ZRFA 2M8SA 1OGWA 1VCBA 1R4MI 3A9JB 4RM8A 1WX7A 2L05A 4MSQB 4W9HA 3PPAA 2RGFA 3PGEA 2NBUA 3EC8A 3ZNGC 2DZMA 4ANVA 1C1YB 5CHFA 2NVUI 3H7SA 3IVFA 1IP9A 3RCZA 2KWVB 2XBBC 2Z59B 1WZ0A 4KVGB 2GBKA 2JPHA 4MDKE 5TR5A 1WGGA 3LJ3A 3KUZA 4PS3A 3M62B 3ZIMA 2K39A 3R66C 1WMHB 2IO1B 2LD9A 3DVGX 2C60A 2HTHA 2C7NB 5LXIB 4ZRIA 4BOSC 1P3QU 2KVRA 4F7ZA 1XQQA 1J0GA 4WJPA 4MEMA 3OJ3A 4ICVA 5CHVC 1V81A 1LQBA 2N1VA 3ZDMC 2YLMA 3DVGY 3SU8X 3KYDD 2LVQA 4AP4C 3O65B 1V5TA 3V6CB 2AYOB 4HXDA 2L3ZA 2AEHA 2FCQA 1TBEA 3DOWA 1E5WA 4NJ7A 5GMVA 1E8YA 5EDSA 2MA9B 2ZEQA 3IFWB 2G45B 3JSVB 1WJ4A 2PE6B 1GUAB 1YX5B 3B08A 4GIVA 3ZRCA 4M8NA 4CYEA 1WH3A 3NOBA 2MCNB 4IWQA 2PPHA 2JZ3B 3W1SA 3UQAA 1WE6A 3GZNI 3PLUA 4LCDE 4W9LA 3VFKA 2C9WB 1KM7A 2KMAA 3OLMD 2V1YA 3U8ZA 4HCNB 2K6DB 4KDLB 4F1SA 4IW0A 4E74A 1XD3B 4I6LB 3ZNHB 4EZKA 2DYMA 3Q3JA 2K6QA 4BBNF 4GOCA 1UBQA 2MWSB 3RULA 2NS5A 1WM2A 3QIJA 3PV1A 4JIOU 2JVCA 4IC7B 2GBMA 2KDFB 5JZEB 3QCAA 2MBBB 2HE7A 2NPTB 1SGHA 4I6NB 2ZVOA 2D07B 4HDQA 1E8WA 5AZHA 3WAOA 1UD7A 2KFKB 2JZZA 3BINA 3WANA 3WIMA 3APCA 4HWIB 2RR9A 3VTUA 5D6JB 3RUIB 3ZW3A 1S3SG 2LGYA 2N9EB 2O6VA 3IHPC 5DPSA 3SDLC 4OVUA 3VHTC 1E7UA 1GC6A 4MGYE 4ASWC 3N3KB 3ZO5B 1M94A 2J0JA 2BKFA 3MHSD 2NR2A 2Z0DB 3QQ8B 2B3AA 3PLVA 2N9XA 3NY5A 4EFOA 5JH5C 2JY6A 3ENEA 1P0RA 3KW5B 3QK0A 4YL8A 1U4AA 1V5OA 3APDA 2MX2A 2XK5A 3DQVA 4ANUA 1RLFA 3DBRI 3TBLD 4II3B 2KTFA 1WY8A 3UIOB 2KX3A 4GDLA 2KJ6A 3W1YA 4ZYNA 3A1QA 3D32A 2KFJA 2YVCA 1WXMA 2KKCA 2REXA 2ZVNA 2ZPYA 3EECA 1TGZB 4EOYA 3K9PB 3OJ4B 2K25A 3C0RB 2BKRB 4TUUA 4MM3A 2DHZA 2IO0B 2N7EA 5AZGA 2BYEA 2PJHA 4P7IA 2LXAA 2O2VA 4KIKA 4FA6A 4RM9A 1ZKHA 3DVNV 3LDZE 1Z5SB 3B0AA 2G4SA 3GOEA 3PVLA 2OOBB 4HPLB 3RYTA 3H7PB 4XC2A 1AARA 4DHZB 4BOZB 1OEYJ 2KJRA 2KNBA 3L16A 3PHWB 3QARA 4PS8A 5CX3A 1YQBA 4BKGA 4NJ6A 5CHWA 5HKHA 5DPTA 1WI0A 3DPDA 3L08A 3PREA 5J17A 2IY1B 1ISNA 3QJZA 4HJKA 4W9IA 3T8MA 2KQ7A 4G50A 1HE8A 2MBOA 4GGQA 4PYUA 3A33B 4RMAA 1WR1A 1Z2MA 4DHZE 2IY0B 3RZWC 2N7DA 2LVOA 2C7MB 4LJPB 2A5UA 1OQYA 4AJWA 4MGKE 4NY0A 4B9KA 1Q1OA 1WGDA 2ASQA 2LGDA 4JLCA 2R2QA 3IG3A 1WMHA 4HPMB 1H4RA 1E90A 2MLBA 3U30A 4A3OA 1D3ZA 1Q0WB 4B6WA 4K7UA 2O6VD 3S2AA 3VUXA 2J0MA 2J7QB 1KOTA 3NZSA 2M17A 4GDKB 3N32A 1ZGUB 4GXBA 5IA7A 4EKUA 4EEWA 3ZTCA 2A4ZA 1WRDB 1GG3A 2DENB 3HK0A 4W9FA 2IBIB 1SE9A 2FCNA 4MELA 4URKA 4EZLA 5DCNA 3HM6X 2ZZPB 2W9NA 4BKTA 2LVPA 3MJWA 1WGHA 2MP2B 3PTFC 3APFA 2MBHA 4FJYA 4AUQC 3UIPB 2K8BA 2WDTB 3Q3FA 4M8MA 2AL6A 5G55A 2RSUA 1P9DU 3AU5A 3AU4A 2C7HA 3RD2A 4DHJD 2AL3A 2CHXA 2N1WA 2ZNVC 2XEWA 1YIWA 2ZNVB 2ZCCA 3R7RA 2VRRB 4OVVA 2IZVB 1EF5A 2JT4B 2MRPA 3DBHI 4G3XB 2JXXA 2LXCA 2HJ8A 4XZ4A 3AULA 5E6PA 2D3GA 2KANA 1WXSA 2G4DB 4K7SA 3L13A 5C23A 2L0FA 1WYWB 1X1MA 2KTRB 5DPWA 2FNJB 3KH0A 2MSED 3DBSA 3CSTA 2L76A 3MTNB 2N4FA 4AWJA 2UYZB 4KV2A 1E7VA 2I1JA 2HD5B 3UQBA 2KQSA 1EUVB 3N30A 2BYFA 5CTRC 1FXTB 1LFDA 4G0NB 2D11A 1I35A 4J6IA 3KUDB 4I6PA 4TQ1A 5AEKB 4BBNC 2CR5A 2FIFA 4BFRA 2D2QA 1VD2A 3PZDA 2KC2A 4W9GA 2D10A 3ZNZB 3VXWA 3PSEB 1IPGA 3M63B 5D2MB 1R4NI 5AZFA 4B95A 2IO2B 4NNJB 2WX0A 2KLCA 4DBGA 4IWPA 4W9KA 1I42A 5C1ZA 1A5RA 2QHOA 2KFKA 4JL9A 2MW5A 4WWOA 2V4LA 2L0TA 4A3PA 4AOFA 1SIFA 2JUOA 1RAXA 3EHVA 1F9JA 4EZJA 2L00B 3JYUA 1YX6B 2KOXA 5L95C 1TTNA 3OAWA 4GB9A 4AJYB 2KK8A 2WYQA 3ZVVA 3ML8A 2EKEC 1WIAA 1KJTA 3VDZA 2EMSA 1V86A 3ONSA 1CMXB 3QC8B 2GBJA 4FBJB 5LLIA 4NAWB 1WJNA 4HK2A 2M0XA 2JRIB 4FJZA 4WJOA 3SD5A 3VVWB 4ZRKA 3NS8A 3L54A 4K7WA 4KSLC 4F8CB 1P98A 3ZTDA 2FUHB 2M1MA 3NZUA 1LM8B 3VUYA 2CHZA 1OEYA 2O6VB 1GJZA 2DZJA 5FR6A 3B1LX 4CO7A 1J8CA 4IWOA 3RT3B 4MJSB 1WE7A 1XT9B 3L0WB 4KSKC 2LASA 4KZCA 2JWZA 3VAWA 1IYFA 2FAZA 1RRBA 2I1KA 4ICUA 2ZJDA 4N9F4 3VTWA 2XK5B 3H7PA 2PE9A 1UH6A 3H9DA 4IM3A 4WWNA 1E8XA 2G3QB 2WX1A 3A9JA 1V80A 3NHEB 4DDID 5LXHA 4DDGD 2C5LC 1T0YA 1YD8U 1OTRB 2JRHA 4TV3A 4E3CA 2OJRA 4HLEA 4FLHA 2KDIA 3H6NA 3TIXA 1TZ1A 3A9KB 3K9OB 2BGFA 1V9JA 3QAQA 4JGHB 5JHAA 4PYZA 2PEAA 2N9PC 4A20A 2O2VB 4KIKB 1WJUA 3ZDTA 4ANXA 3UINB 2DAJA 4FULA 2KWCA 2BYVE 2MQJA 3T9LA 1WZ3A 2LUEA 3V62A 4MSMB 3IBEA 4LDTD 5G2NA 3WAPA 2NBVB 3L10B 4GDKA 2KDBA 4TQ0A 2K8HA 1Y8RC 1UZXB 1EO6A 2Z0EB 4MH0E 4X57B 2DX5B 2DYOA 3V6EB 5JHBA 1H8CA 3PS6A 1MG8A 3U7DA 3CMMB 4HCPB 2LRUA 1RFAA 4FADA 2FIDA 1L7YA 3UF8A 2GBNA 2DZKA 3CF6E 3VH4B 4W9DA 2KLGA 2V3SA 4NPNA 3TMPB 2MP2A 1WFYA 4WAAA 1WR6E 3SHQA 3ALBA 3PHXB 2KD0A 3JSVA 3ZLZA 1NDDA 1V2YA 2R2OA 1WXAA 4BKSA 3ML9A 1YJ1A 2DYBA 4JQWC 3PRMB 2NBWB 4IUMB 4E71A 4IG7B 1LXDA 1NI2A 1S1QB 1Q5WB 1G6JA 3A4RA 4IM2A 5J18A 2KTRA 4FHKA 3I3TB 3QX1A 2K1FA 2LJ5A 3RZFA 1E8ZA 4DXAB 5D94A 1WX9A 4ANWA 4GN1A 3M3JA 1GNUA 1WM3A 3R3MA 3KYCD 4KZ0A 3PRZA 2LZ6A 2RD0A 3KVFB 2EMTA 4FJVB 3W1SC 5IAAC 3ZNID 4DK5A 2L8JA 3KUCB 1WJ6A 3PT2B 4II2B 3VQIA 1P1AA 3R7QA 3QA8A 2NPTA 5DPRA 5KHOA 3M95A 4LJOB 1ZW7A 2GMIC 5E6NA 2UWQA 3JVZX 1L2NA 3DVNU 2RPQA 4XX5A 3VTVA 3HHMA 1C3TA 2L7RA 4WJNA 4GSWA 3WAMA 3WA0A 5KHQA 2AWTA 1KLVA 3WALA 1UGMA 4FHJA 1WF9A 3ECIA 3L17A 3TL5A 2BPSA 3DDCB 3VH3B 3ZUNA 5D7GA 2DAFA 4GMVA 2ZCBA 2LRWA 2LI5A 4W9JA 3QHTA 2GOWA 3TCAA 1UBIA 2KX0A 2FCMA 4NAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSF A;  3DBL I;  1K8R B;  2CHW A;  2M4N A;  2NCN A;  2CU1 A;  2KWU B;  3JW0 X;  4IM0 A;  2KJH B;  2IYD B;  2BWF A;  4WWP A;  2IO3 B;  4TKN A;  1JRU A;  3ZKJ C;  4BKS D;  4G11 A;  2BF8 B;  2MBE A;  1WGR A;  3TJP A;  4LDT B;  2KC1 A;  5E6O A;  1NBF C;  4MJS A;  2Y5B B;  3HM3 A;  2WWZ A;  4NQL B;  5J2R A;  4ZDV A;  1BT0 A;  2GBR A;  1J19 A;  2JF5 A;  4K81 A;  1QZE A;  4M0W B;  3HIZ A;  3V61 A;  3V60 A;  2KO3 A;  4ZRJ A;  2KHW B;  3X0W A;  4CHK A;  2LWP A;  2BWE S;  4WQO B;  2CKH B;  4EUT A;  3P2B A;  4HVB A;  1V49 A;  2K8C A;  4GDL B;  1EF1 A;  3AI5 A;  1WGY A;  2LGX A;  2ZPN A;  3A1Q B;  4NQK E;  3DCG A;  4FN2 A;  1PQS A;  3UGB B;  4DHJ B;  2J0K A;  5L83 A;  1UEL A;  3PRP B;  4MGI E;  4W9E A;  2FCS A;  4KDI C;  3A9K A;  2KDE B;  5BO4 B;  4K1R B;  3H1U A;  2KMC A;  4BVU C;  3BY4 B;  2MBQ A;  2KXJ A;  2KZR A;  2CS4 A;  3X23 A;  2DZI A;  3QWZ B;  4HDO A;  4MGZ E;  3A4S C;  4WJQ A;  1GC7 A;  4W9C A;  2KN5 A;  1V6E A;  1WXV A;  3AXC A;  1WX8 A;  3EFU A;  4GU2 A;  4PS7 A;  4DWF A;  3VUW A;  3ZRF A;  2M8S A;  1OGW A;  1VCB A;  1R4M I;  3A9J B;  4RM8 A;  1WX7 A;  2L05 A;  4MSQ B;  4W9H A;  3PPA A;  2RGF A;  3PGE A;  2NBU A;  3EC8 A;  3ZNG C;  2DZM A;  4ANV A;  1C1Y B;  5CHF A;  2NVU I;  3H7S A;  3IVF A;  1IP9 A;  3RCZ A;  2KWV B;  2XBB C;  2Z59 B;  1WZ0 A;  4KVG B;  2GBK A;  2JPH A;  4MDK E;  5TR5 A;  1WGG A;  3LJ3 A;  3KUZ A;  4PS3 A;  3M62 B;  3ZIM A;  2K39 A;  3R66 C;  1WMH B;  2IO1 B;  2LD9 A;  3DVG X;  2C60 A;  2HTH A;  2C7N B;  5LXI B;  4ZRI A;  4BOS C;  1P3Q U;  2KVR A;  4F7Z A;  1XQQ A;  1J0G A;  4WJP A;  4MEM A;  3OJ3 A;  4ICV A;  5CHV C;  1V81 A;  1LQB A;  2N1V A;  3ZDM C;  2YLM A;  3DVG Y;  3SU8 X;  3KYD D;  2LVQ A;  4AP4 C;  3O65 B;  1V5T A;  3V6C B;  2AYO B;  4HXD A;  2L3Z A;  2AEH A;  2FCQ A;  1TBE A;  3DOW A;  1E5W A;  4NJ7 A;  5GMV A;  1E8Y A;  5EDS A;  2MA9 B;  2ZEQ A;  3IFW B;  2G45 B;  3JSV B;  1WJ4 A;  2PE6 B;  1GUA B;  1YX5 B;  3B08 A;  4GIV A;  3ZRC A;  4M8N A;  4CYE A;  1WH3 A;  3NOB A;  2MCN B;  4IWQ A;  2PPH A;  2JZ3 B;  3W1S A;  3UQA A;  1WE6 A;  3GZN I;  3PLU A;  4LCD E;  4W9L A;  3VFK A;  2C9W B;  1KM7 A;  2KMA A;  3OLM D;  2V1Y A;  3U8Z A;  4HCN B;  2K6D B;  4KDL B;  4F1S A;  4IW0 A;  4E74 A;  1XD3 B;  4I6L B;  3ZNH B;  4EZK A;  2DYM A;  3Q3J A;  2K6Q A;  4BBN F;  4GOC A;  1UBQ A;  2MWS B;  3RUL A;  2NS5 A;  1WM2 A;  3QIJ A;  3PV1 A;  4JIO U;  2JVC A;  4IC7 B;  2GBM A;  2KDF B;  5JZE B;  3QCA A;  2MBB B;  2HE7 A;  2NPT B;  1SGH A;  4I6N B;  2ZVO A;  2D07 B;  4HDQ A;  1E8W A;  5AZH A;  3WAO A;  1UD7 A;  2KFK B;  2JZZ A;  3BIN A;  3WAN A;  3WIM A;  3APC A;  4HWI B;  2RR9 A;  3VTU A;  5D6J B;  3RUI B;  3ZW3 A;  1S3S G;  2LGY A;  2N9E B;  2O6V A;  3IHP C;  5DPS A;  3SDL C;  4OVU A;  3VHT C;  1E7U A;  1GC6 A;  4MGY E;  4ASW C;  3N3K B;  3ZO5 B;  1M94 A;  2J0J A;  2BKF A;  3MHS D;  2NR2 A;  2Z0D B;  3QQ8 B;  2B3A A;  3PLV A;  2N9X A;  3NY5 A;  4EFO A;  5JH5 C;  2JY6 A;  3ENE A;  1P0R A;  3KW5 B;  3QK0 A;  4YL8 A;  1U4A A;  1V5O A;  3APD A;  2MX2 A;  2XK5 A;  3DQV A;  4ANU A;  1RLF A;  3DBR I;  3TBL D;  4II3 B;  2KTF A;  1WY8 A;  3UIO B;  2KX3 A;  4GDL A;  2KJ6 A;  3W1Y A;  4ZYN A;  3A1Q A;  3D32 A;  2KFJ A;  2YVC A;  1WXM A;  2KKC A;  2REX A;  2ZVN A;  2ZPY A;  3EEC A;  1TGZ B;  4EOY A;  3K9P B;  3OJ4 B;  2K25 A;  3C0R B;  2BKR B;  4TUU A;  4MM3 A;  2DHZ A;  2IO0 B;  2N7E A;  5AZG A;  2BYE A;  2PJH A;  4P7I A;  2LXA A;  2O2V A;  4KIK A;  4FA6 A;  4RM9 A;  1ZKH A;  3DVN V;  3LDZ E;  1Z5S B;  3B0A A;  2G4S A;  3GOE A;  3PVL A;  2OOB B;  4HPL B;  3RYT A;  3H7P B;  4XC2 A;  1AAR A;  4DHZ B;  4BOZ B;  1OEY J;  2KJR A;  2KNB A;  3L16 A;  3PHW B;  3QAR A;  4PS8 A;  5CX3 A;  1YQB A;  4BKG A;  4NJ6 A;  5CHW A;  5HKH A;  5DPT A;  1WI0 A;  3DPD A;  3L08 A;  3PRE A;  5J17 A;  2IY1 B;  1ISN A;  3QJZ A;  4HJK A;  4W9I A;  3T8M A;  2KQ7 A;  4G50 A;  1HE8 A;  2MBO A;  4GGQ A;  4PYU A;  3A33 B;  4RMA A;  1WR1 A;  1Z2M A;  4DHZ E;  2IY0 B;  3RZW C;  2N7D A;  2LVO A;  2C7M B;  4LJP B;  2A5U A;  1OQY A;  4AJW A;  4MGK E;  4NY0 A;  4B9K A;  1Q1O A;  1WGD A;  2ASQ A;  2LGD A;  4JLC A;  2R2Q A;  3IG3 A;  1WMH A;  4HPM B;  1H4R A;  1E90 A;  2MLB A;  3U30 A;  4A3O A;  1D3Z A;  1Q0W B;  4B6W A;  4K7U A;  2O6V D;  3S2A A;  3VUX A;  2J0M A;  2J7Q B;  1KOT A;  3NZS A;  2M17 A;  4GDK B;  3N32 A;  1ZGU B;  4GXB A;  5IA7 A;  4EKU A;  4EEW A;  3ZTC A;  2A4Z A;  1WRD B;  1GG3 A;  2DEN B;  3HK0 A;  4W9F A;  2IBI B;  1SE9 A;  2FCN A;  4MEL A;  4URK A;  4EZL A;  5DCN A;  3HM6 X;  2ZZP B;  2W9N A;  4BKT A;  2LVP A;  3MJW A;  1WGH A;  2MP2 B;  3PTF C;  3APF A;  2MBH A;  4FJY A;  4AUQ C;  3UIP B;  2K8B A;  2WDT B;  3Q3F A;  4M8M A;  2AL6 A;  5G55 A;  2RSU A;  1P9D U;  3AU5 A;  3AU4 A;  2C7H A;  3RD2 A;  4DHJ D;  2AL3 A;  2CHX A;  2N1W A;  2ZNV C;  2XEW A;  1YIW A;  2ZNV B;  2ZCC A;  3R7R A;  2VRR B;  4OVV A;  2IZV B;  1EF5 A;  2JT4 B;  2MRP A;  3DBH I;  4G3X B;  2JXX A;  2LXC A;  2HJ8 A;  4XZ4 A;  3AUL A;  5E6P A;  2D3G A;  2KAN A;  1WXS A;  2G4D B;  4K7S A;  3L13 A;  5C23 A;  2L0F A;  1WYW B;  1X1M A;  2KTR B;  5DPW A;  2FNJ B;  3KH0 A;  2MSE D;  3DBS A;  3CST A;  2L76 A;  3MTN B;  2N4F A;  4AWJ A;  2UYZ B;  4KV2 A;  1E7V A;  2I1J A;  2HD5 B;  3UQB A;  2KQS A;  1EUV B;  3N30 A;  2BYF A;  5CTR C;  1FXT B;  1LFD A;  4G0N B;  2D11 A;  1I35 A;  4J6I A;  3KUD B;  4I6P A;  4TQ1 A;  5AEK B;  4BBN C;  2CR5 A;  2FIF A;  4BFR A;  2D2Q A;  1VD2 A;  3PZD A;  2KC2 A;  4W9G A;  2D10 A;  3ZNZ B;  3VXW A;  3PSE B;  1IPG A;  3M63 B;  5D2M B;  1R4N I;  5AZF A;  4B95 A;  2IO2 B;  4NNJ B;  2WX0 A;  2KLC A;  4DBG A;  4IWP A;  4W9K A;  1I42 A;  5C1Z A;  1A5R A;  2QHO A;  2KFK A;  4JL9 A;  2MW5 A;  4WWO A;  2V4L A;  2L0T A;  4A3P A;  4AOF A;  1SIF A;  2JUO A;  1RAX A;  3EHV A;  1F9J A;  4EZJ A;  2L00 B;  3JYU A;  1YX6 B;  2KOX A;  5L95 C;  1TTN A;  3OAW A;  4GB9 A;  4AJY B;  2KK8 A;  2WYQ A;  3ZVV A;  3ML8 A;  2EKE C;  1WIA A;  1KJT A;  3VDZ A;  2EMS A;  1V86 A;  3ONS A;  1CMX B;  3QC8 B;  2GBJ A;  4FBJ B;  5LLI A;  4NAW B;  1WJN A;  4HK2 A;  2M0X A;  2JRI B;  4FJZ A;  4WJO A;  3SD5 A;  3VVW B;  4ZRK A;  3NS8 A;  3L54 A;  4K7W A;  4KSL C;  4F8C B;  1P98 A;  3ZTD A;  2FUH B;  2M1M A;  3NZU A;  1LM8 B;  3VUY A;  2CHZ A;  1OEY A;  2O6V B;  1GJZ A;  2DZJ A;  5FR6 A;  3B1L X;  4CO7 A;  1J8C A;  4IWO A;  3RT3 B;  4MJS B;  1WE7 A;  1XT9 B;  3L0W B;  4KSK C;  2LAS A;  4KZC A;  2JWZ A;  3VAW A;  1IYF A;  2FAZ A;  1RRB A;  2I1K A;  4ICU A;  2ZJD A;  4N9F 4;  3VTW A;  2XK5 B;  3H7P A;  2PE9 A;  1UH6 A;  3H9D A;  4IM3 A;  4WWN A;  1E8X A;  2G3Q B;  2WX1 A;  3A9J A;  1V80 A;  3NHE B;  4DDI D;  5LXH A;  4DDG D;  2C5L C;  1T0Y A;  1YD8 U;  1OTR B;  2JRH A;  4TV3 A;  4E3C A;  2OJR A;  4HLE A;  4FLH A;  2KDI A;  3H6N A;  3TIX A;  1TZ1 A;  3A9K B;  3K9O B;  2BGF A;  1V9J A;  3QAQ A;  4JGH B;  5JHA A;  4PYZ A;  2PEA A;  2N9P C;  4A20 A;  2O2V B;  4KIK B;  1WJU A;  3ZDT A;  4ANX A;  3UIN B;  2DAJ A;  4FUL A;  2KWC A;  2BYV E;  2MQJ A;  3T9L A;  1WZ3 A;  2LUE A;  3V62 A;  4MSM B;  3IBE A;  4LDT D;  5G2N A;  3WAP A;  2NBV B;  3L10 B;  4GDK A;  2KDB A;  4TQ0 A;  2K8H A;  1Y8R C;  1UZX B;  1EO6 A;  2Z0E B;  4MH0 E;  4X57 B;  2DX5 B;  2DYO A;  3V6E B;  5JHB A;  1H8C A;  3PS6 A;  1MG8 A;  3U7D A;  3CMM B;  4HCP B;  2LRU A;  1RFA A;  4FAD A;  2FID A;  1L7Y A;  3UF8 A;  2GBN A;  2DZK A;  3CF6 E;  3VH4 B;  4W9D A;  2KLG A;  2V3S A;  4NPN A;  3TMP B;  2MP2 A;  1WFY A;  4WAA A;  1WR6 E;  3SHQ A;  3ALB A;  3PHX B;  2KD0 A;  3JSV A;  3ZLZ A;  1NDD A;  1V2Y A;  2R2O A;  1WXA A;  4BKS A;  3ML9 A;  1YJ1 A;  2DYB A;  4JQW C;  3PRM B;  2NBW B;  4IUM B;  4E71 A;  4IG7 B;  1LXD A;  1NI2 A;  1S1Q B;  1Q5W B;  1G6J A;  3A4R A;  4IM2 A;  5J18 A;  2KTR A;  4FHK A;  3I3T B;  3QX1 A;  2K1F A;  2LJ5 A;  3RZF A;  1E8Z A;  4DXA B;  5D94 A;  1WX9 A;  4ANW A;  4GN1 A;  3M3J A;  1GNU A;  1WM3 A;  3R3M A;  3KYC D;  4KZ0 A;  3PRZ A;  2LZ6 A;  2RD0 A;  3KVF B;  2EMT A;  4FJV B;  3W1S C;  5IAA C;  3ZNI D;  4DK5 A;  2L8J A;  3KUC B;  1WJ6 A;  3PT2 B;  4II2 B;  3VQI A;  1P1A A;  3R7Q A;  3QA8 A;  2NPT A;  5DPR A;  5KHO A;  3M95 A;  4LJO B;  1ZW7 A;  2GMI C;  5E6N A;  2UWQ A;  3JVZ X;  1L2N A;  3DVN U;  2RPQ A;  4XX5 A;  3VTV A;  3HHM A;  1C3T A;  2L7R A;  4WJN A;  4GSW A;  3WAM A;  3WA0 A;  5KHQ A;  2AWT A;  1KLV A;  3WAL A;  1UGM A;  4FHJ A;  1WF9 A;  3ECI A;  3L17 A;  3TL5 A;  2BPS A;  3DDC B;  3VH3 B;  3ZUN A;  5D7G A;  2DAF A;  4GMV A;  2ZCB A;  2LRW A;  2LI5 A;  4W9J A;  3QHT A;  2GOW A;  3TCA A;  1UBI A;  2KX0 A;  2FCM A;  4NAW A; 
#chains in the Genus database with same CATH topology
 1K8R B;  2M4N A;  2WP9 B;  2KWU B;  2L52 A;  2EEL A;  4TKN A;  1OQR A;  4OVZ A;  2WDQ B;  1C4C A;  2FE8 A;  4US8 A;  3MC0 B;  5E6O A;  3AB5 A;  1BT0 A;  3RMK C;  3GB1 A;  3X0W A;  3V60 A;  2KHW B;  4IKG A;  4CHK A;  2CKH B;  4EUT A;  3AI5 A;  1FNV A;  4DHJ B;  3P42 A;  2J0K A;  1UEL A;  1FMA D;  3AN1 A;  4FXC A;  2KXJ A;  2KZR A;  2CS4 A;  3X23 A;  1KLU D;  2DZI A;  3QWZ B;  4HDO A;  4WJQ A;  2QCZ A;  1V6E A;  3AXC A;  4PS7 A;  1WX8 A;  2XN9 C;  3VUW A;  4NZL B;  3DHG C;  3AE3 B;  2BB6 A;  3RNA C;  1SSN A;  4W9H A;  3PPA A;  2RGF A;  1NYQ A;  2NBU A;  5H92 C;  3ZNG C;  4ANV A;  1ZXI A;  3RCZ A;  3EA6 A;  2KWV B;  2WXH A;  1ZPS A;  2JQR B;  3Q3M C;  1L6V A;  2KAC A;  2WXK A;  2JPH A;  5TR5 A;  3KUZ A;  4PS3 A;  3ZIM A;  3DVG X;  4ZRI A;  4C56 C;  2J53 A;  2IGH A;  4RFB A;  4F7Z A;  4HKQ A;  1SE4 A;  3OJ3 A;  1E9M A;  2JYE A;  4PT5 A;  1TS4 A;  3SU8 X;  3HVZ A;  3MHZ A;  4AP4 C;  2WLB A;  1K50 A;  4HXD A;  2AEH A;  2FCQ A;  1TBE A;  2HTM E;  1E8Y A;  4RNA A;  2G45 B;  1V8C A;  1VJK A;  1WJ4 A;  1GB1 A;  4GIV A;  3ZRC A;  1WH3 A;  2MCN B;  3W1S A;  3PLU A;  3GZN I;  5HI1 A;  2K22 A;  4W9L A;  3VFK A;  3OLM D;  2WNM A;  2K6D B;  4KDL B;  4L23 A;  1XD3 B;  3ZNH B;  1TZO A;  3Q3J A;  1PDX A;  4LLG M;  1OFF A;  1T0Q C;  4BBN F;  1UBQ A;  3QIJ A;  1N60 A;  2JVC A;  3AEG B;  1UNS A;  2ZVO A;  1UD7 A;  3IXS A;  3WIM A;  3APC A;  1QIL A;  1S3S G;  2LGY A;  5EE9 A;  1P7F A;  4ASW C;  2BKF A;  2Y5P A;  3BYY B;  2B3A A;  3KW5 B;  1N63 A;  1IBX A;  1V5O A;  2XK5 A;  4M0W A;  4ANU A;  1RLF A;  3TBL D;  4II3 B;  1WY8 A;  2VZK D;  4GDL A;  2KJ6 A;  3A1Q A;  3D32 A;  3AM9 A;  4XGA B;  2ZVN A;  2ZPY A;  4EOY A;  1TGZ B;  2BKR B;  4TUU A;  5AZG A;  3P1M A;  2PJH A;  2O2V A;  4KIK A;  1ZKH A;  3DVN V;  2OOB B;  4HPL B;  1AAR A;  4P1B C;  3MFG A;  2KNB A;  3L16 A;  2KDM A;  5J17 A;  1L5P A;  1ISN A;  1TJE A;  3QJZ A;  4W9I A;  3T8M A;  1SE2 A;  3A33 B;  4DHZ E;  5L83 A;  2LVO A;  4LJP B;  1MVK A;  4AJW A;  1FNU A;  4MGK E;  4NY0 A;  4Q2J A;  2ASQ A;  1HZ6 A;  1MJD A;  4C80 A;  4KGS A;  2R2Q A;  2OED A;  2PKO A;  3IG3 A;  1H4R A;  1XXG A;  3TUO A;  1Q0W B;  4ZRQ A;  1TYG B;  5D3D A;  3VUX A;  4KX6 B;  1UGJ A;  2M17 A;  2ZW0 A;  3N32 A;  1AN8 A;  4GXB A;  5IA7 A;  4EKU A;  3ZTC A;  3AMZ A;  1GG3 A;  4W9F A;  2QIE B;  2I2Y A;  2W9N A;  1HZ5 A;  1WGH A;  2MP2 B;  3BVZ A;  3APF A;  1F77 A;  4M8M A;  3AU5 A;  1XLP A;  3DHH C;  2AX5 A;  3R7R A;  5BMI A;  4JX1 C;  2BW2 A;  1F2R C;  2JXX A;  3LXF A;  1J7A A;  1UWM A;  2L0F A;  2WXL A;  3KH0 A;  4HEA 1;  2MEK A;  2HD5 B;  2HDE A;  1FXT B;  4G0N B;  1I35 A;  2D11 A;  5MPO A;  4I6P A;  1XCQ L;  2CR5 A;  2K0P A;  1ZUD 2;  2KC2 A;  3VXW A;  1IPG A;  2WX0 A;  4IWP A;  5C1Z A;  2KFK A;  4WH4 A;  4AOF A;  2JUO A;  3KQ4 A;  4C4V A;  5BYR A;  4GB9 A;  2H89 B;  1JWU D;  2WU5 B;  4XE0 A;  3ML8 A;  3NZ3 A;  1WIA A;  1HXY D;  3AV8 A;  2WGS A;  3GZN B;  3ONS A;  3I57 A;  4NAW B;  4WJO A;  4FJZ A;  1F0Z A;  3NS8 A;  3I63 C;  3L54 A;  4MAC A;  1P98 A;  1N62 A;  1E7P B;  2M1M A;  3N20 C;  1GJZ A;  1C4A A;  1HTQ A;  4CO7 A;  2WDV B;  2WXI A;  3L0W B;  1IYF A;  2FAZ A;  3UI3 A;  1RRB A;  4N9F 4;  3DBL B;  2I38 A;  1NI3 A;  1PFD A;  1V80 A;  5LXH A;  4WIP A;  4FLH A;  2KDI A;  4N6E B;  1FRD A;  2BGF A;  1V9J A;  4JGH B;  2N9P C;  2RDB C;  1QOG A;  1JAL A;  1SE3 A;  4YTN B;  1DOX A;  4ANX A;  2SEB D;  2GLS A;  1FCL A;  4FUL A;  1AWD A;  2BYV E;  1WZ3 A;  4RF1 A;  2LUE A;  2BVC A;  4P16 A;  2IJ0 A;  4LDT D;  3WAP A;  2BB5 A;  3L10 B;  2JYT A;  3R8B A;  4TQ0 A;  1Y8R C;  1UZX B;  4JWU C;  3RNE C;  1L6U A;  3U7D A;  3CMM B;  1ENF A;  1AYF A;  1RFA A;  1WWT A;  4W9D A;  2KLG A;  4NPN A;  4WAA A;  1GB4 A;  1K53 A;  3SHQ A;  2SAK A;  3JSV A;  3ZLZ A;  2WS3 B;  2MHJ A;  3ML9 A;  1YJ1 A;  3R2I A;  4A6Q A;  1S1Q B;  1G6J A;  2DNF A;  1IGC A;  2K1F A;  3FKY A;  1E8Z A;  4B0M A;  4TSS A;  2LHE A;  2LGS A;  1FEH A;  3BK1 A;  3R3M A;  3KYC D;  1WXQ A;  4C7Z A;  4II2 B;  3R7Q A;  3LYY A;  2NMQ A;  3M95 A;  4KGT A;  3P63 A;  3AEB B;  2NTT A;  3EGR A;  3JVZ X;  3IT6 B;  3DVN U;  3HHM A;  1C3T A;  2L7R A;  4WJN A;  3WAM A;  1LO5 D;  1TS3 A;  3WA0 A;  3WAL A;  1UGM A;  1WF9 A;  3VH3 B;  3ZUN A;  2LRW A;  4H2A A;  2W3S A;  4RGO S;  4W9J A;  3W1Y A;  3WCQ A;  3BVG A;  1XCT L;  1K52 A;  2LJI A;  2M56 B;  2IO3 B;  3PZ7 A;  1JRU A;  3ZJT A;  1MI0 A;  2WWZ A;  5J2R A;  4ZDV A;  2GBR A;  2JF5 A;  4HPP A;  3V61 A;  4HRS A;  1V49 A;  2DLB A;  4A90 A;  3N9Y C;  3W5V B;  1WGY A;  2LGX A;  2INC C;  2ZPN A;  3DCG A;  1PQS A;  4MGI E;  4KDI C;  3A9K A;  5BO4 B;  2KMC A;  4J3O D;  4BVU C;  3RNG C;  1GC7 A;  4GU2 A;  1I4R A;  3BII D;  3VRA B;  4JWS C;  5HFY A;  3ZRF A;  1VCB A;  1R4M I;  4RM8 A;  2UU7 A;  4ZHP A;  3PGE A;  2JXT A;  3EC8 A;  2DZM A;  5CHF A;  2NVU I;  1XF5 L;  1WGK A;  1WZ0 A;  4MDK E;  3W5U B;  4LNO A;  2C60 A;  5LXI B;  2C7N B;  3Q14 C;  1XQQ A;  4WJP A;  2JWU A;  2FBW B;  1V81 A;  1TKG A;  1LQB A;  4AQ7 A;  2YLM A;  3DVG Y;  1N6Z A;  2LVQ A;  2AYO B;  3DOW A;  4QAY A;  3ZGZ A;  4NJ7 A;  2MA9 B;  1EWY C;  2M0A A;  1GUA B;  4AS1 A;  3FIL A;  4ARI A;  4M8N A;  3ZQ4 A;  3NOB A;  1IUE A;  2BTE A;  4IWQ A;  2YEP F;  2OJW A;  4WUR A;  2RDG A;  5C3J B;  2KMA A;  3AE1 B;  3B2G A;  3O13 A;  4IW0 A;  4E74 A;  4I6L B;  3AEC B;  5AUK A;  4HJG E;  2DYM A;  1KRH A;  2NS5 A;  3PV1 A;  1TS5 A;  3MJ5 A;  4IC7 B;  3DBH B;  2KDF B;  1FXA A;  3QCA A;  2HE7 A;  1SGH A;  1JRP A;  5AZH A;  2KMM A;  1ESF A;  3WAN A;  4XWT A;  3VTU A;  2V9H A;  3GE8 C;  2N9E B;  2O6V A;  3VHT C;  2PTL A;  3E9S A;  2PLP A;  3ZO5 B;  3MHS D;  3FC4 A;  2NR2 A;  3PLV A;  5JH5 C;  3RNB C;  3QK0 A;  2X8X X;  4YL8 A;  1U4A A;  2MX2 A;  2MH7 A;  2GRI A;  3UIO B;  2KX3 A;  2WXQ A;  2LHD A;  1WXM A;  5IO9 A;  3ZXR A;  2K25 A;  3C0R B;  1B1Z A;  4FA6 A;  3LDZ E;  1Z5S B;  3B0A A;  2G4S A;  3H7P B;  1JRO A;  4DHZ B;  3AE6 B;  3KWL A;  4PS8 A;  3AEA B;  1YQB A;  1SF0 A;  4BKG A;  5CHW A;  4LTU A;  1HTO A;  1WI0 A;  4R3D A;  2WDR B;  1N5X A;  2MBO A;  4PYU A;  3Q8F A;  2MJD A;  1JQ4 A;  4JE3 B;  4D2K A;  2LGD A;  1V1O A;  4HPM B;  2LUM A;  5FR3 A;  1D3Z A;  4B6W A;  1FPY A;  2O6V D;  2W82 A;  4K7U A;  2J7Q B;  2KT7 A;  2WHI A;  2G9H D;  3BVM A;  2DEN B;  3HK0 A;  2FCN A;  4URK A;  2ZZP B;  4RF0 A;  2KYW A;  3PTF C;  2LFI A;  2MBH A;  4AUQ C;  1R4M B;  1VLB A;  2WDT B;  4UDU C;  1VZ7 A;  1ZP0 B;  2RSU A;  3NRZ A;  5HHD G;  2C7H A;  4DHJ D;  2CHX A;  2N1W A;  2ZNV C;  2XEW A;  1DYQ A;  4OVV A;  4G3X B;  2IZV B;  1EF5 A;  2JT4 B;  3J9C A;  2YEP B;  2LXC A;  4XZ4 A;  3B2F A;  1D5M C;  5E6P A;  4K7S A;  2G4D B;  5C23 A;  2MJ3 A;  3NUH B;  3DBS A;  2FUG 1;  4S17 A;  2W54 A;  5IKC M;  2VZK B;  2KQS A;  5D3I B;  1LFD A;  5AEK B;  2FIF A;  1SEB D;  2D2Q A;  1C76 A;  1NEN B;  1VD2 A;  3N1Y C;  3SFE B;  3EFC A;  3ZNZ B;  3PSE B;  1R4N I;  5AZF A;  1C77 A;  4W9K A;  2PIA A;  5IOI A;  2MW5 A;  3W9C B;  2V4L A;  4C00 A;  2L0T A;  1SIF A;  1RAX A;  3EHV A;  5BMH A;  4EZJ A;  5IN7 A;  2KOX A;  5L95 C;  3OAW A;  4KGR A;  1HQR D;  4HKZ E;  3TEZ A;  1MHH E;  2AQ3 B;  4FBJ B;  5LLI A;  4LNF A;  1WJN A;  2M0X A;  3VVW B;  4ZRK A;  1ACC A;  1FO4 A;  3I9V 1;  2PVG C;  3ZTD A;  1EM7 A;  1N61 A;  2FUH B;  1LM8 B;  3VUY A;  2CHZ A;  3VR8 B;  5FR6 A;  3B1L X;  1T6B X;  1J8C A;  4LNN A;  3RT3 B;  4MJS B;  1BXT A;  4KZC A;  1ET6 A;  3LB8 C;  3RNC C;  2XK5 B;  1OQQ A;  5BMG A;  2PE9 A;  3RPF C;  4IM3 A;  1UUP A;  2G3Q B;  3A9J A;  2M19 A;  1V1P B;  4MH8 A;  1T0Y A;  1YD8 U;  1I4X A;  4PK1 A;  4E3C A;  3H6N A;  3TIX A;  3BYT B;  4PYZ A;  1TIF A;  3ZXV A;  2O2V B;  4KIK B;  1QQR A;  1WJU A;  1SIJ A;  1B9R A;  3ZDT A;  2WXO A;  1YN5 A;  2MQJ A;  1XO3 A;  3V05 A;  5G2N A;  2NBV B;  3RFZ B;  2K8H A;  5C2T B;  2Z0E B;  1H8C A;  2DX5 B;  2BBC A;  1MG8 A;  2LRU A;  4FAD A;  1I4P A;  3UF8 A;  4L2Y A;  4RH6 A;  2V3S A;  5H8Y E;  3TMP B;  2MP2 A;  1E6E B;  3SFD B;  1WXA A;  4BKS A;  2DYB A;  3PRM B;  4IG7 B;  1LXD A;  2H88 B;  4WWM A;  1TT5 B;  3I3T B;  2V3N A;  1C4P A;  1WSP A;  3U7Z A;  5D94 A;  4ANW A;  1UF0 A;  4CQN A;  1XLO A;  3M3J A;  2D5G A;  3IT4 B;  4YSY B;  2RDH A;  4KZ0 A;  3PRZ A;  1QOB A;  2LZ6 A;  2KWD A;  2EMT A;  3W1S C;  2L8J A;  3VQI A;  1NVI D;  3QA8 A;  2NPT A;  5DPR A;  3AEE B;  3T3N A;  2ACZ B;  3ZJU A;  3TSS A;  4LJO B;  5E6N A;  1L2N A;  3VTV A;  4XX5 A;  3MC9 A;  4FHJ A;  3ECI A;  3L17 A;  2BPS A;  3DDC B;  5D7G A;  2K9X A;  4GMV A;  1PGX A;  3QHT A;  3KWV A;  4K3B A;  4DQO C;  1UBI A;  2KX0 A;  1XLQ A;  4NAW A;  3CSF A;  2CHW A;  4DXF A;  3JW0 X;  1ROE A;  2IYD B;  5TSS A;  4WWP A;  1C79 A;  4BKS D;  2MBE A;  1WGR A;  5HG2 A;  3TJP A;  1GPX A;  4LDT B;  2KC1 A;  2BYT A;  3NVW A;  1NBF C;  2IND C;  2Y5B B;  3HM3 A;  3AE9 B;  4NQL B;  1FXI A;  4ZHO A;  4KKJ A;  1J19 A;  4K81 A;  3Q3N C;  2KO3 A;  4ZRJ A;  4LK0 M;  2LWP A;  2BWE S;  3P2B A;  2K8C A;  4NQK E;  3AE7 B;  3UGB B;  3PRP B;  4W9E A;  2FCS A;  3PO0 A;  4K1R B;  1WRI A;  4MM3 B;  2WXJ A;  3Q8E A;  2KN4 A;  2MBQ A;  4ZYS A;  4NJC A;  2W3R A;  3A4S C;  2LGI A;  4W9C A;  1WXV A;  1T5X D;  4DWF A;  2Y3A A;  2RPV A;  1WX7 A;  2L05 A;  3MC8 A;  2Z59 B;  1FCC C;  1F52 A;  1CZP A;  2GBK A;  4WAF A;  1WGG A;  2K39 A;  1WMH B;  2JSV X;  3TEY A;  2HTH A;  1UWX A;  4BOS C;  2KVR A;  1J0G A;  1SJE D;  3TEX A;  5CHV C;  3OG5 A;  4YTP B;  2KVZ A;  2NTS A;  3ZDM C;  4TMA B;  2ONQ A;  3KYD D;  3O65 B;  2Z8L A;  3V6C B;  4YT0 B;  1E5W A;  3HRD D;  5EDS A;  3IFW B;  3JSV B;  1JWA D;  4XDC A;  1YX5 B;  3Q6B A;  3I5J C;  2PPH A;  2JZ3 B;  3ZJV A;  4A8X C;  1KM7 A;  1Q10 A;  2ON8 A;  4HCN B;  2AQ2 B;  4F1S A;  2HJ1 A;  1FFU A;  2EKI A;  1MHX A;  2K6Q A;  1J7B A;  4GOC A;  3RUL A;  1L4D B;  1QOF A;  2GBM A;  4OZB A;  2N9K A;  4I6N B;  4HDQ A;  1E8W A;  4REZ A;  3NS1 A;  5D6J B;  4LNI A;  3ZW3 A;  2PW9 A;  1PYW D;  3SDL C;  5DPS A;  1CQV A;  1E7U A;  1GC6 A;  2ZW1 A;  3RI7 C;  1M94 A;  2Z0D B;  3QQ8 B;  3NY5 A;  3ENE A;  1P0R A;  1I4H A;  1ET9 A;  1SXT A;  2KTF A;  1CJE A;  1FNW A;  1VR9 A;  2KFJ A;  2YVC A;  2KKC A;  2REX A;  2R61 A;  1CK1 A;  1T0S C;  3EEC A;  3K9P B;  4OZA A;  5AUI A;  2DHZ A;  2IO0 B;  2N7E A;  3VRB B;  2BYE A;  4BZA A;  4IDI A;  4RM9 A;  3TEW A;  3PVL A;  3AE4 B;  3ZYY X;  1OEY J;  2KJR A;  3HVD A;  5HKH A;  5DPT A;  4RGN A;  2J42 A;  3DPD A;  3L08 A;  2IY1 B;  2GB1 A;  2OHF A;  1SJH D;  4YWG G;  4XWW A;  3RZW C;  2N7D A;  2C7M B;  1OQY A;  1QKZ A;  1Q1O A;  1WGD A;  1MG4 A;  1RYJ A;  3T3O A;  1E90 A;  3U2S C;  5GXG B;  3NVV A;  3S2A A;  3NZS A;  2INN E;  4GDK B;  4JPS A;  1L0X B;  1ZGU B;  2IBI B;  1SE9 A;  5DCN A;  1QF6 A;  4BKT A;  2LVP A;  4FJY A;  2K8B A;  2AL6 A;  3Q8A A;  3U4E G;  3AU4 A;  3RD2 A;  1TS2 A;  1MPE A;  1YIW A;  2ZNV B;  1BUI C;  1L0Y B;  2ZCC A;  2VRR B;  2IDY A;  2PMV A;  3AUL A;  2D3G A;  2QMT A;  1WYW B;  2KTR B;  4LNK A;  3CST A;  2L76 A;  1GOZ A;  5T8I A;  3MTN B;  4DXG A;  1R7S A;  3AH7 A;  4KV2 A;  1E7V A;  2I1J A;  2D3B A;  1TKY A;  2J4X A;  5EE1 A;  3IAS 1;  1EUV B;  5CTR C;  4TQ1 A;  1RFK A;  3FIL B;  3R2T A;  3E56 A;  3PZD A;  3EUB 2;  2D10 A;  1DOY A;  3M63 B;  4RCO A;  4B95 A;  2IO2 B;  1ZDV A;  4DBG A;  1A5R A;  2QHO A;  3N1X C;  2V0G A;  5EE3 A;  4JL9 A;  4WWO A;  2GI9 A;  1F9J A;  1YJJ A;  2L00 B;  2N7J A;  2KK8 A;  3BZD B;  1YOV B;  3ZVV A;  1V86 A;  5G5H A;  2XNA C;  2GBJ A;  4OZC A;  5G5G A;  4HK2 A;  2JRI B;  2TSS A;  3URY A;  4F8C B;  2L1A A;  1I4G A;  2QDF A;  3NZU A;  1FD6 A;  2O6V B;  2DZJ A;  2CU3 A;  1WE7 A;  2QEJ C;  2LAS A;  1D6E C;  2JWZ A;  4S0R A;  2I1K A;  4ICU A;  2ZJD A;  1K51 A;  3P4P B;  3H7P A;  1DGJ A;  2J52 A;  2QSD A;  3H9D A;  4WWN A;  1E8X A;  4DDI D;  4DDG D;  2G1E A;  1OTR B;  2JRH A;  4TV3 A;  1VZ6 A;  3N1Z C;  1TZ1 A;  1PUT A;  3VR9 B;  3K9O B;  5JHA A;  1AW7 A;  3AED B;  3NVZ A;  4L1B A;  2JX5 A;  1RWS A;  1V97 A;  2KWC A;  2W55 A;  1YN4 A;  3V62 A;  1YN3 A;  2N0S B;  1M4V A;  1HEZ E;  3IBE A;  3L4P A;  2WXR A;  2KDB A;  3V3X A;  3V6E B;  3HUI A;  1TKE A;  2DYO A;  4HRO A;  3PS6 A;  4K3C A;  4HCP B;  3H8H A;  2RMM A;  2FID A;  2E3T A;  1L7Y A;  2GBN A;  3CF6 E;  3VH4 B;  3ALB A;  1C78 A;  2DWQ A;  5E6J A;  4M01 A;  1VDV A;  2QJL A;  2BQQ A;  4JQW C;  3CIR B;  4IUM B;  4E71 A;  5IP4 D;  1KTK A;  5J18 A;  1YJI A;  2Q5W D;  3QX1 A;  4DXA B;  1WX9 A;  3SR6 A;  4GN1 A;  2BS3 B;  1YQ4 B;  1GNU A;  2WXF A;  1WM3 A;  4XYC A;  2RD0 A;  3KVF B;  1I4Q A;  3ZNI D;  3ABV B;  3KUC B;  2B76 B;  4ACF A;  1P1A A;  4A55 A;  1ZW7 A;  1QT9 A;  1JWS D;  2AWT A;  1KLV A;  2D3A A;  1YNT E;  2DAF A;  1EWC A;  2LI5 A;  4ARC A;  2MJE A;  4KSL C;  2WQY B;  1YQ3 B;  3DBL I;  2NCN A;  1I7H A;  2N9L A;  2CU1 A;  3NJT A;  1IGD A;  4IM0 A;  2KJH B;  4MT5 A;  3W2D A;  2BWF A;  3ZKJ C;  2DBY A;  4G11 A;  2BF8 B;  4EE2 A;  4MJS A;  1TY2 A;  4BAX A;  5FK9 C;  1IBX B;  1QZE A;  4M0W B;  3HIZ A;  4WQO B;  4HVB A;  4O1N A;  4GDL B;  1EF1 A;  4USA A;  1V1P A;  3A1Q B;  1L0V B;  4FN2 A;  2KDE B;  4IOI E;  3H1U A;  3BY4 B;  3DHI C;  4MGZ E;  4N58 A;  2KN5 A;  3EFU A;  1YMH E;  1KF6 B;  1VZ8 A;  1VRA B;  2M8S A;  1OGW A;  3A9J B;  3KLS X;  4MSQ B;  1C1Y B;  3AE5 B;  3H7S A;  3BWU D;  3IVF A;  1IP9 A;  2XBB C;  3Q2A C;  1D5Z C;  2Y5C A;  4KVG B;  1P7E A;  5BYS A;  3LJ3 A;  3M62 B;  2L83 A;  3R66 C;  1GAQ B;  3P4R B;  2IO1 B;  1DOI A;  2LD9 A;  1P3Q U;  2IGG A;  4MEM A;  4YSX B;  4ICV A;  2N1V A;  4YTM B;  1V5T A;  2L3Z A;  5GMV A;  3MP9 A;  2ZEQ A;  1ZDX A;  2LEK A;  4ITK A;  2PE6 B;  3B08 A;  1JW9 D;  4CYE A;  1LGR A;  3UQA A;  1WE6 A;  4LCD E;  1L4Z B;  2C9W B;  1D5X C;  2V1Y A;  3U8Z A;  1KFY B;  1T3Q A;  1D4B A;  4EZK A;  2BS4 B;  2MWS B;  1WM2 A;  4JIO U;  2WXP A;  1QLB B;  5JZE B;  2MBB B;  1T0R C;  1E0Z A;  2NPT B;  2D07 B;  3Q8C A;  3WAO A;  2KFK B;  2JZZ A;  3BIN A;  4M00 A;  4HWI B;  4US9 A;  2RR9 A;  2QIL A;  3RUI B;  4C4V B;  1JWM D;  1N5W A;  3IHP C;  3C8Y A;  4OVU A;  4MGY E;  3N3K B;  2J0J A;  3NG0 A;  1R4N B;  2N9X A;  4EFO A;  2JY6 A;  4GLS C;  2V4I B;  3APD A;  1NYR A;  2AQ1 B;  3DQV A;  3DBR I;  3U52 E;  1KH0 A;  3DWG C;  4ZYN A;  1BML C;  3OJ4 B;  1EU3 A;  2K5P A;  4MM3 A;  4P6V F;  4P7I A;  2LXA A;  3Q8B A;  4N59 A;  1RM6 C;  3GOE A;  3RYT A;  4XC2 A;  4BOZ B;  3PHW B;  3QAR A;  5CX3 A;  4NJ6 A;  3PRE A;  2QC8 A;  3C19 A;  4HJK A;  1XLN A;  4GGQ A;  1HE8 A;  2KQ7 A;  4G50 A;  4RMA A;  1XEE A;  1WR1 A;  1Z2M A;  2IPK D;  2IY0 B;  1SBB B;  2A5U A;  4B9K A;  1STE A;  3CWI A;  2D3C A;  2WXN A;  4WQM A;  3RN9 C;  4P1C C;  4JLC A;  1WMH A;  1FIQ A;  2MLB A;  3U30 A;  4A3O A;  1QOA A;  3BK2 A;  4XDD A;  2J0M A;  2WXG A;  1KOT A;  2LMC A;  2IGD A;  2KAJ A;  1J7C A;  1FM0 D;  4EEW A;  2A4Z A;  1WRD B;  1JML A;  5JXV A;  4MEL A;  3DWM A;  4EZL A;  2BT6 A;  1WYG A;  2INP E;  2VH1 A;  2L32 A;  3HM6 X;  4ZOH C;  4YSZ B;  3MJW A;  3GE3 C;  3UIP B;  3PZ8 A;  3Q3F A;  5G55 A;  1P9D U;  2WXM A;  1KLG D;  2ICI A;  2JU6 X;  2AL3 A;  2JZP A;  2MRP A;  3DBH I;  2HJ8 A;  2KAN A;  1WXS A;  3L13 A;  5EE0 A;  1X1M A;  5DPW A;  2FNJ B;  3P4Q B;  2MSE D;  1TY0 A;  2N4F A;  4AWJ A;  2UYZ B;  3UQB A;  4KKI A;  3N30 A;  2BYF A;  3Q69 A;  4J6I A;  3KUD B;  4BBN C;  4BFR A;  3AE2 B;  2WU2 B;  4W9G A;  3RNF C;  5D2M B;  4NNJ B;  2KLC A;  1PGB A;  1I42 A;  1EU4 A;  4A3P A;  3ETR A;  3JYU A;  1YX6 B;  4ZRP A;  1TTN A;  4AJY B;  4RGT A;  4A9A A;  2WYQ A;  5BYQ A;  2EKE C;  3GP7 A;  1KJT A;  5FKA C;  3VDZ A;  2EMS A;  5I4D A;  1CMX B;  3QC8 B;  3SEB A;  1Y56 A;  3SD5 A;  4C7Y A;  4OW0 A;  4K7W A;  1OEY A;  3B9J A;  4IWO A;  4B0E A;  1JWB D;  4RGM A;  1XT9 B;  1MFW A;  3VAW A;  4KSK C;  3VTW A;  2KQ4 X;  1UH6 A;  2WX1 A;  3AEF B;  3NHE B;  2C5L C;  2CJO A;  2OJR A;  4HLE A;  2E6X A;  1F1H A;  1ZOY B;  2V3P A;  3A9K B;  3QAQ A;  2PEA A;  4A20 A;  1FFV A;  1C9F A;  3Q3O C;  3DBR B;  3UIN B;  2DAJ A;  3OWE B;  3IAM 1;  3GS2 A;  3T9L A;  1FRR A;  2K3U A;  4MSM B;  4GDK A;  3AE8 B;  1EO6 A;  5JHB A;  1F2R I;  4MH0 E;  4X57 B;  1ZXH A;  2DZK A;  3P4S B;  1WFY A;  1WR6 E;  3PHX B;  2KD0 A;  3NVY A;  1NDD A;  1V2Y A;  2R2O A;  1E10 A;  2VH2 A;  2NBW B;  4OHJ A;  1NI2 A;  1Q5W B;  3A4R A;  4IM2 A;  2KTR A;  4FHK A;  3FAH A;  2LJ5 A;  3RZF A;  4YXD B;  2CJN A;  2X38 A;  1ZE3 D;  2BS2 B;  1SB3 C;  5LNK 1;  4FJV B;  5IAA C;  4DK5 A;  1JCK B;  1WJ6 A;  3PT2 B;  1HA5 A;  4M02 A;  5KHO A;  2GMI C;  2PVO D;  2UWQ A;  2RPQ A;  4GSW A;  5KHQ A;  4NAM A;  1NEK B;  3TL5 A;  1A70 A;  2ZCB A;  2GOW A;  3TCA A;  2FCM A;  1PGA A; 
#chains in the Genus database with same CATH homology
 3CSF A;  3DBL I;  1K8R B;  2CHW A;  2M4N A;  2NCN A;  2CU1 A;  2KWU B;  3JW0 X;  4IM0 A;  2KJH B;  2IYD B;  2BWF A;  4WWP A;  2IO3 B;  4TKN A;  1JRU A;  3ZKJ C;  4BKS D;  4G11 A;  2BF8 B;  2MBE A;  1WGR A;  3TJP A;  4LDT B;  2KC1 A;  5E6O A;  1NBF C;  4MJS A;  2Y5B B;  3HM3 A;  2WWZ A;  4NQL B;  5J2R A;  4ZDV A;  1BT0 A;  2GBR A;  1J19 A;  2JF5 A;  4K81 A;  1QZE A;  4M0W B;  3HIZ A;  3V61 A;  3V60 A;  2KO3 A;  4ZRJ A;  2KHW B;  3X0W A;  4CHK A;  2LWP A;  2BWE S;  4WQO B;  2CKH B;  4EUT A;  3P2B A;  4HVB A;  1V49 A;  2K8C A;  4GDL B;  1EF1 A;  3AI5 A;  1WGY A;  2LGX A;  2ZPN A;  3A1Q B;  4NQK E;  3DCG A;  4FN2 A;  1PQS A;  3UGB B;  4DHJ B;  2J0K A;  5L83 A;  1UEL A;  3PRP B;  4MGI E;  4W9E A;  2FCS A;  4KDI C;  3A9K A;  2KDE B;  5BO4 B;  4K1R B;  3H1U A;  2KMC A;  4BVU C;  3BY4 B;  2MBQ A;  2KXJ A;  2KZR A;  2CS4 A;  3X23 A;  2DZI A;  3QWZ B;  4HDO A;  4MGZ E;  3A4S C;  4WJQ A;  1GC7 A;  4W9C A;  2KN5 A;  1V6E A;  1WXV A;  3AXC A;  1WX8 A;  3EFU A;  4GU2 A;  4PS7 A;  4DWF A;  3VUW A;  3ZRF A;  2M8S A;  1OGW A;  1VCB A;  1R4M I;  3A9J B;  4RM8 A;  1WX7 A;  2L05 A;  4MSQ B;  4W9H A;  3PPA A;  2RGF A;  3PGE A;  2NBU A;  3EC8 A;  3ZNG C;  2DZM A;  4ANV A;  1C1Y B;  5CHF A;  2NVU I;  3H7S A;  3IVF A;  1IP9 A;  3RCZ A;  2KWV B;  2XBB C;  2Z59 B;  1WZ0 A;  4KVG B;  2GBK A;  2JPH A;  4MDK E;  5TR5 A;  1WGG A;  3LJ3 A;  3KUZ A;  4PS3 A;  3M62 B;  3ZIM A;  2K39 A;  3R66 C;  1WMH B;  2IO1 B;  2LD9 A;  3DVG X;  2C60 A;  2HTH A;  2C7N B;  5LXI B;  4ZRI A;  4BOS C;  1P3Q U;  2KVR A;  4F7Z A;  1XQQ A;  1J0G A;  4WJP A;  4MEM A;  3OJ3 A;  4ICV A;  5CHV C;  1V81 A;  1LQB A;  2N1V A;  3ZDM C;  2YLM A;  3DVG Y;  3SU8 X;  3KYD D;  2LVQ A;  4AP4 C;  3O65 B;  1V5T A;  3V6C B;  2AYO B;  4HXD A;  2L3Z A;  2AEH A;  2FCQ A;  1TBE A;  3DOW A;  1E5W A;  4NJ7 A;  5GMV A;  1E8Y A;  5EDS A;  2MA9 B;  2ZEQ A;  3IFW B;  2G45 B;  3JSV B;  1WJ4 A;  2PE6 B;  1GUA B;  1YX5 B;  3B08 A;  4GIV A;  3ZRC A;  4M8N A;  4CYE A;  1WH3 A;  3NOB A;  2MCN B;  4IWQ A;  2PPH A;  2JZ3 B;  3W1S A;  3UQA A;  1WE6 A;  3GZN I;  3PLU A;  4LCD E;  4W9L A;  3VFK A;  2C9W B;  1KM7 A;  2KMA A;  3OLM D;  2V1Y A;  3U8Z A;  4HCN B;  2K6D B;  4KDL B;  4F1S A;  4IW0 A;  4E74 A;  1XD3 B;  4I6L B;  3ZNH B;  4EZK A;  2DYM A;  3Q3J A;  2K6Q A;  4BBN F;  4GOC A;  1UBQ A;  2MWS B;  3RUL A;  2NS5 A;  1WM2 A;  3QIJ A;  3PV1 A;  4JIO U;  2JVC A;  4IC7 B;  2GBM A;  2KDF B;  5JZE B;  3QCA A;  2MBB B;  2HE7 A;  2NPT B;  1SGH A;  4I6N B;  2ZVO A;  2D07 B;  4HDQ A;  1E8W A;  5AZH A;  3WAO A;  1UD7 A;  2KFK B;  2JZZ A;  3BIN A;  3WAN A;  3WIM A;  3APC A;  4HWI B;  2RR9 A;  3VTU A;  5D6J B;  3RUI B;  3ZW3 A;  1S3S G;  2LGY A;  2N9E B;  2O6V A;  3IHP C;  5DPS A;  3SDL C;  4OVU A;  3VHT C;  1E7U A;  1GC6 A;  4MGY E;  4ASW C;  3N3K B;  3ZO5 B;  1M94 A;  2J0J A;  2BKF A;  3MHS D;  2NR2 A;  2Z0D B;  3QQ8 B;  2B3A A;  3PLV A;  2N9X A;  3NY5 A;  4EFO A;  5JH5 C;  2JY6 A;  3ENE A;  1P0R A;  3KW5 B;  3QK0 A;  4YL8 A;  1U4A A;  1V5O A;  3APD A;  2MX2 A;  2XK5 A;  3DQV A;  4ANU A;  1RLF A;  3DBR I;  3TBL D;  4II3 B;  2KTF A;  1WY8 A;  3UIO B;  2KX3 A;  4GDL A;  2KJ6 A;  3W1Y A;  4ZYN A;  3A1Q A;  3D32 A;  2KFJ A;  2YVC A;  1WXM A;  2KKC A;  2REX A;  2ZVN A;  2ZPY A;  3EEC A;  1TGZ B;  4EOY A;  3K9P B;  3OJ4 B;  2K25 A;  3C0R B;  2BKR B;  4TUU A;  4MM3 A;  2DHZ A;  2IO0 B;  2N7E A;  5AZG A;  2BYE A;  2PJH A;  4P7I A;  2LXA A;  2O2V A;  4KIK A;  4FA6 A;  4RM9 A;  1ZKH A;  3DVN V;  3LDZ E;  1Z5S B;  3B0A A;  2G4S A;  3GOE A;  3PVL A;  2OOB B;  4HPL B;  3RYT A;  3H7P B;  4XC2 A;  1AAR A;  4DHZ B;  4BOZ B;  1OEY J;  2KJR A;  2KNB A;  3L16 A;  3PHW B;  3QAR A;  4PS8 A;  5CX3 A;  1YQB A;  4BKG A;  4NJ6 A;  5CHW A;  5HKH A;  5DPT A;  1WI0 A;  3DPD A;  3L08 A;  3PRE A;  5J17 A;  2IY1 B;  1ISN A;  3QJZ A;  4HJK A;  4W9I A;  3T8M A;  2KQ7 A;  4G50 A;  1HE8 A;  2MBO A;  4GGQ A;  4PYU A;  3A33 B;  4RMA A;  1WR1 A;  1Z2M A;  4DHZ E;  2IY0 B;  3RZW C;  2N7D A;  2LVO A;  2C7M B;  4LJP B;  2A5U A;  1OQY A;  4AJW A;  4MGK E;  4NY0 A;  4B9K A;  1Q1O A;  1WGD A;  2ASQ A;  2LGD A;  4JLC A;  2R2Q A;  3IG3 A;  1WMH A;  4HPM B;  1H4R A;  1E90 A;  2MLB A;  3U30 A;  4A3O A;  1D3Z A;  1Q0W B;  4B6W A;  4K7U A;  2O6V D;  3S2A A;  3VUX A;  2J0M A;  2J7Q B;  1KOT A;  3NZS A;  2M17 A;  4GDK B;  3N32 A;  1ZGU B;  4GXB A;  5IA7 A;  4EKU A;  4EEW A;  3ZTC A;  2A4Z A;  1WRD B;  1GG3 A;  2DEN B;  3HK0 A;  4W9F A;  2IBI B;  1SE9 A;  2FCN A;  4MEL A;  4URK A;  4EZL A;  5DCN A;  3HM6 X;  2ZZP B;  2W9N A;  4BKT A;  2LVP A;  3MJW A;  1WGH A;  2MP2 B;  3PTF C;  3APF A;  2MBH A;  4FJY A;  4AUQ C;  3UIP B;  2K8B A;  2WDT B;  3Q3F A;  4M8M A;  2AL6 A;  5G55 A;  2RSU A;  1P9D U;  3AU5 A;  3AU4 A;  2C7H A;  3RD2 A;  4DHJ D;  2AL3 A;  2CHX A;  2N1W A;  2ZNV C;  2XEW A;  1YIW A;  2ZNV B;  2ZCC A;  3R7R A;  2VRR B;  4OVV A;  2IZV B;  1EF5 A;  2JT4 B;  2MRP A;  3DBH I;  4G3X B;  2JXX A;  2LXC A;  2HJ8 A;  4XZ4 A;  3AUL A;  5E6P A;  2D3G A;  2KAN A;  1WXS A;  2G4D B;  4K7S A;  3L13 A;  5C23 A;  2L0F A;  1WYW B;  1X1M A;  2KTR B;  5DPW A;  2FNJ B;  3KH0 A;  2MSE D;  3DBS A;  3CST A;  2L76 A;  3MTN B;  2N4F A;  4AWJ A;  2UYZ B;  4KV2 A;  1E7V A;  2I1J A;  2HD5 B;  3UQB A;  2KQS A;  1EUV B;  3N30 A;  2BYF A;  5CTR C;  1FXT B;  1LFD A;  4G0N B;  2D11 A;  1I35 A;  4J6I A;  3KUD B;  4I6P A;  4TQ1 A;  5AEK B;  4BBN C;  2CR5 A;  2FIF A;  4BFR A;  2D2Q A;  1VD2 A;  3PZD A;  2KC2 A;  4W9G A;  2D10 A;  3ZNZ B;  3VXW A;  3PSE B;  1IPG A;  3M63 B;  5D2M B;  1R4N I;  5AZF A;  4B95 A;  2IO2 B;  4NNJ B;  2WX0 A;  2KLC A;  4DBG A;  4IWP A;  4W9K A;  1I42 A;  5C1Z A;  1A5R A;  2QHO A;  2KFK A;  4JL9 A;  2MW5 A;  4WWO A;  2V4L A;  2L0T A;  4A3P A;  4AOF A;  1SIF A;  2JUO A;  1RAX A;  3EHV A;  1F9J A;  4EZJ A;  2L00 B;  3JYU A;  1YX6 B;  2KOX A;  5L95 C;  1TTN A;  3OAW A;  4GB9 A;  4AJY B;  2KK8 A;  2WYQ A;  3ZVV A;  3ML8 A;  2EKE C;  1WIA A;  1KJT A;  3VDZ A;  2EMS A;  1V86 A;  3ONS A;  1CMX B;  3QC8 B;  2GBJ A;  4FBJ B;  5LLI A;  4NAW B;  1WJN A;  4HK2 A;  2M0X A;  2JRI B;  4FJZ A;  4WJO A;  3SD5 A;  3VVW B;  4ZRK A;  3NS8 A;  3L54 A;  4K7W A;  4KSL C;  4F8C B;  1P98 A;  3ZTD A;  2FUH B;  2M1M A;  3NZU A;  1LM8 B;  3VUY A;  2CHZ A;  1OEY A;  2O6V B;  1GJZ A;  2DZJ A;  5FR6 A;  3B1L X;  4CO7 A;  1J8C A;  4IWO A;  3RT3 B;  4MJS B;  1WE7 A;  1XT9 B;  3L0W B;  4KSK C;  2LAS A;  4KZC A;  2JWZ A;  3VAW A;  1IYF A;  2FAZ A;  1RRB A;  2I1K A;  4ICU A;  2ZJD A;  4N9F 4;  3VTW A;  2XK5 B;  3H7P A;  2PE9 A;  1UH6 A;  3H9D A;  4IM3 A;  4WWN A;  1E8X A;  2G3Q B;  2WX1 A;  3A9J A;  1V80 A;  3NHE B;  4DDI D;  5LXH A;  4DDG D;  2C5L C;  1T0Y A;  1YD8 U;  1OTR B;  2JRH A;  4TV3 A;  4E3C A;  2OJR A;  4HLE A;  4FLH A;  2KDI A;  3H6N A;  3TIX A;  1TZ1 A;  3A9K B;  3K9O B;  2BGF A;  1V9J A;  3QAQ A;  4JGH B;  5JHA A;  4PYZ A;  2PEA A;  2N9P C;  4A20 A;  2O2V B;  4KIK B;  1WJU A;  3ZDT A;  4ANX A;  3UIN B;  2DAJ A;  4FUL A;  2KWC A;  2BYV E;  2MQJ A;  3T9L A;  1WZ3 A;  2LUE A;  3V62 A;  4MSM B;  3IBE A;  4LDT D;  5G2N A;  3WAP A;  2NBV B;  3L10 B;  4GDK A;  2KDB A;  4TQ0 A;  2K8H A;  1Y8R C;  1UZX B;  1EO6 A;  2Z0E B;  4MH0 E;  4X57 B;  2DX5 B;  2DYO A;  3V6E B;  5JHB A;  1H8C A;  3PS6 A;  1MG8 A;  3U7D A;  3CMM B;  4HCP B;  2LRU A;  1RFA A;  4FAD A;  2FID A;  1L7Y A;  3UF8 A;  2GBN A;  2DZK A;  3CF6 E;  3VH4 B;  4W9D A;  2KLG A;  2V3S A;  4NPN A;  3TMP B;  2MP2 A;  1WFY A;  4WAA A;  1WR6 E;  3SHQ A;  3ALB A;  3PHX B;  2KD0 A;  3JSV A;  3ZLZ A;  1NDD A;  1V2Y A;  2R2O A;  1WXA A;  4BKS A;  3ML9 A;  1YJ1 A;  2DYB A;  4JQW C;  3PRM B;  2NBW B;  4IUM B;  4E71 A;  4IG7 B;  1LXD A;  1NI2 A;  1S1Q B;  1Q5W B;  1G6J A;  3A4R A;  4IM2 A;  5J18 A;  2KTR A;  4FHK A;  3I3T B;  3QX1 A;  2K1F A;  2LJ5 A;  3RZF A;  1E8Z A;  4DXA B;  5D94 A;  1WX9 A;  4ANW A;  4GN1 A;  3M3J A;  1GNU A;  1WM3 A;  3R3M A;  3KYC D;  4KZ0 A;  3PRZ A;  2LZ6 A;  2RD0 A;  3KVF B;  2EMT A;  4FJV B;  3W1S C;  5IAA C;  3ZNI D;  4DK5 A;  2L8J A;  3KUC B;  1WJ6 A;  3PT2 B;  4II2 B;  3VQI A;  1P1A A;  3R7Q A;  3QA8 A;  2NPT A;  5DPR A;  5KHO A;  3M95 A;  4LJO B;  1ZW7 A;  2GMI C;  5E6N A;  2UWQ A;  3JVZ X;  1L2N A;  3DVN U;  2RPQ A;  4XX5 A;  3VTV A;  3HHM A;  1C3T A;  2L7R A;  4WJN A;  4GSW A;  3WAM A;  3WA0 A;  5KHQ A;  2AWT A;  1KLV A;  3WAL A;  1UGM A;  4FHJ A;  1WF9 A;  3ECI A;  3L17 A;  3TL5 A;  2BPS A;  3DDC B;  3VH3 B;  3ZUN A;  5D7G A;  2DAF A;  4GMV A;  2ZCB A;  2LRW A;  2LI5 A;  4W9J A;  3QHT A;  2GOW A;  3TCA A;  1UBI A;  2KX0 A;  2FCM A;  4NAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...