4NAWA

Crystal structure of human atg12~atg5-atg16n in complex with a fragment of atg3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
88
structure length
88
Chain Sequence
KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/ligase
molecule keywords Ubiquitin-like protein ATG12
publication title Structural basis of ATG3 recognition by the autophagic ubiquitin-like protein ATG12.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 88
sequence length 88
chains with identical sequence E, I, M
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4nawA00
1WM3A 2C7HA 2KQ7A 3N32A 3Q3JA 2KMCA 4M0WB 2RSUA 2CS4A 1WR6E 3DPDA 5HKHA 5DPTA 4EOYA 3M62B 3VFKA 3R3MA 4W9IA 4DDID 4EKUA 2V1YA 3L16A 3VUYA 4G0NB 4B6WA 1LXDA 1OEYJ 2JRHA 2LI5A 3DQVA 4PS8A 5D94A 2EMSA 3EECA 1E8WA 3IVFA 2BWFA 3PS6A 3QJZA 4OVUA 1LFDA 3A9KB 4GU2A 5C23A 4KSKC 2KXJA 2FCMA 2K6QA 4NJ6A 1U4AA 2LXCA 2J0MA 4IM3A 2MBHA 4E3CA 3L08A 2KFKB 4BVUC 1Q0WB 3OAWA 4TQ0A 3R7QA 3S2AA 5CHVC 2JPHA 1E7UA 5LXIB 1Y8RC 4W9JA 3VXWA 1R4NI 3NZUA 3WA0A 1J19A 3RCZA 4BKTA 2N9XA 1BT0A 2GBKA 3PHWB 4ANWA 2DZIA 4WQOB 1V86A 2FCNA 5D6JB 2L3ZA 3N3KB 2AYOB 1E5WA 2LJ5A 2JT4B 2ZZPB 3IFWB 5CHFA 1KM7A 1LM8B 2DZJA 2LD9A 3DVNV 3ZKJC 3X0WA 3NOBA 1V5TA 2L0FA 3PGEA 2G4DB 2FCQA 1LQBA 2O6VA 4GDLA 1Z5SB 2KK8A 1V81A 5AZHA 4KSLC 4P7IA 4IUMB 4I6LB 4AJYB 4II2B 3PLUA 3W1SC 5L95C 1R4MI 4BBNC 2K8BA 4X57B 1WY8A 4II3B 4IWPA 4W9KA 4LJOB 1UH6A 1XT9B 2WX1A 4XX5A 2KLGA 3OLMD 2CR5A 1J8CA 2LGDA 4JGHB 2JWZA 3ZDTA 3ZRFA 3ML8A 3RT3B 2KKCA 4KZ0A 1ZW7A 2A5UA 2N9EB 1WRDB 4ZRJA 2IY0B 2JRIB 1YJ1A 2ZVOA 1V2YA 4MJSA 2K25A 5C1ZA 2OOBB 4RMAA 4DDGD 3JSVA 3QWZB 1NDDA 3QK0A 1GC7A 2LXAA 1OEYA 2J0JA 2YLMA 2BPSA 4WJQA 2JY6A 1YX6B 4WJNA 4M8MA 2REXA 4FA6A 1GNUA 1L7YA 2ZCCA 5J17A 1GJZA 3I3TB 2LVOA 3K9PB 5BO4B 2ZPNA 1FXTB 2NVUI 2D07B 2M1MA 4PYZA 2LZ6A 3ZRCA 1SGHA 1M94A 2NPTA 4K81A 1WMHA 3ZUNA 1GUAB 3A1QB 3QA8A 3H7SA 3VQIA 2M8SA 2J0KA 3VTVA 3HK0A 3ZO5B 4EUTA 1UBIA 3DBLI 3UINB 1WJNA 2PE6B 2IO0B 3AI5A 2AL3A 3EFUA 2KC2A 2LVPA 3B1LX 3DBRI 4F1SA 3OJ4B 4W9GA 1UELA 2IYDB 3UQBA 2I1JA 2MWSB 4WWPA 2G3QB 3CSFA 3R7RA 1IP9A 1RFAA 1T0YA 2BGFA 2MX2A 3H7PB 1KLVA 1WXSA 4GDKA 3RUIB 2DENB 3A9JB 2KTRA 4XC2A 4MSMB 2BF8B 3V61A 1VCBA 1P0RA 2DAFA 2MP2A 1OGWA 2O6VD 3ZNZB 1L2NA 3L0WB 5LLIA 1WX9A 2MCNB 5CX3A 1SIFA 2LWPA 3T9LA 5L83A 3LDZE 4AWJA 1S1QB 3APCA 3M3JA 2NBVB 3DBSA 3GZNI 1QZEA 2JF5A 2MBOA 4NPNA 4EZKA 2MW5A 3BINA 2BYVE 2RR9A 4FHJA 4TKNA 4BFRA 3PRMB 1WX8A 2C5LC 2ZJDA 3HM3A 3KH0A 3KYCD 4J6IA 1WFYA 3ZIMA 2L76A 3TBLD 1WZ0A 3DVGX 2LGYA 5E6OA 3V6EB 1VD2A 3AULA 1WI0A 4XZ4A 4MEMA 1IPGA 3DOWA 1WX7A 2WX0A 2KWUB 2MLBA 4I6NB 2WDTB 4HXDA 4LDTD 2NBWB 2K8HA 4MGZE 1RRBA 3ONSA 4LCDE 2D11A 2Z0EB 2MRPA 4G50A 3X23A 3VHTC 3RULA 2AEHA 4MELA 2FUHB 3B08A 4KZCA 4TV3A 4IWOA 1ZGUB 2MA9B 3QHTA 4JLCA 4NNJB 3P2BA 3ALBA 1C1YB 2IBIB 3VDZA 4KVGB 5D2MB 1WIAA 4HDQA 3DDCB 5JZEB 3WIMA 1WGYA 3DBHI 2DYMA 2O6VB 5G55A 3MTNB 4GDLB 4KIKB 2M4NA 3DCGA 2YVCA 2Y5BB 2DYBA 4BOSC 4KDIC 2NBUA 4FADA 3MJWA 2XEWA 2XK5A 4EEWA 2L8JA 2ZNVB 3WAMA 2MBEA 4BKSA 4HLEA 3HIZA 4ANUA 1S3SG 3NS8A 4E74A 3QAQA 3VUWA 3JVZX 4GN1A 3ZTCA 2L7RA 1Q5WB 1YD8U 3PT2B 4OVVA 2FIFA 4YL8A 1I35A 4AUQC 1YX5B 2KX0A 4HPMB 5TR5A 2KWVB 2KMAA 5KHQA 4MH0E 3PSEB 1WF9A 1X1MA 2G4SA 2JZZA 3GOEA 4NQKE 4FN2A 4FHKA 2PPHA 4DHZE 2C9WB 2KANA 4KDLB 4CO7A 4GGQA 4FULA 4MJSB 4FJZA 2W9NA 3O65B 1TGZB 2ZEQA 3JSVB 3WAPA 3KYDD 2O2VA 1P3QU 2KD0A 2FNJB 1V5OA 3HM6X 4LDTB 3IG3A 2RPQA 5KHOA 4DHZB 2QHOA 4JL9A 4FBJB 4HCNB 2R2OA 3SD5A 3NZSA 1WE6A 4PYUA 2PJHA 2K8CA 3L10B 4BOZB 2JZ3B 2KHWB 1WXAA 2NPTB 5IAAC 1WMHB 2KX3A 1EF1A 4W9HA 2VRRB 1OTRB 3TMPB 2N7DA 5E6NA 1GG3A 2AL6A 2ZPYA 3BY4B 4NAWA 2GBMA 2ZCBA 2WWZA 5E6PA 2KDBA 2M17A 3VTWA 3H1UA 3PRPB 2HTHA 3LJ3A 4NQLB 1E8ZA 3PRZA 1A5RA 4ANVA 2LRWA 4NY0A 4W9EA 2XBBC 1NBFC 2HD5B 2ZVNA 3UGBB 2OJRA 3A4SC 2G45B 1EF5A 2NCNA 3ZW3A 4KV2A 1WZ3A 4GDKB 3L17A 4HWIB 2KTRB 4I6PA 2KJ6A 1WXVA 5DPRA 2MP2B 3PTFC 1TTNA 3TCAA 4K7WA 1EUVB 4MGYE 2UWQA 3RYTA 4IWQA 2LUEA 3UIPB 3V6CB 1MG8A 4ASWC 3D32A 2J7QB 5JHBA 3VTUA 5G2NA 3KUCB 2KWCA 1KOTA 2ZNVC 4BKSD 2PE9A 2KDFB 2Z0DB 4A20A 2N4FA 4G3XB 2D2QA 4GXBA 4W9FA 3TL5A 4B95A 4EFOA 3U7DA 3KUZA 1WJ6A 3JW0X 4M8NA 4WAAA 4F7ZA 2CHWA 2IY1B 1E8XA 1I42A 2GBRA 2GOWA 3NY5A 5D7GA 2R2QA 4HPLB 4ZYNA 2GBJA 3QARA 4DK5A 1Q1OA 1WGGA 4CYEA 1CMXB 2FAZA 3W1SA 2MSED 1EO6A 4AOFA 4ICVA 4PS3A 4IG7B 4B9KA 2A4ZA 1WXMA 2DZMA 5GMVA 1E90A 2ASQA 1PQSA 3L54A 4MM3A 1G6JA 3EHVA 3Q3FA 1AARA 3CF6E 2K39A 3DVGY 2JVCA 4TQ1A 1OQYA 4KIKA 3AU5A 4N9F4 4BBNF 2K6DB 2KVRA 2BYFA 4F8CB 1H8CA 3B0AA 3RZWC 5J18A 2M0XA 4DWFA 3WANA 2LRUA 1WGDA 2IO3B 2BKRB 2LGXA 1WH3A 2I1KA 4GB9A 3IBEA 2DYOA 3L13A 3A4RA 3M63B 1WM2A 5EDSA 2KC1A 3ENEA 3TIXA 4WWOA 2EMTA 1WE7A 2L00B 2MBQA 4DHJD 1V6EA 3PREA 4W9LA 3VH3B 3VVWB 4WJPA 4K7UA 4A3OA 1RAXA 3A9KA 3AU4A 5DPWA 2V4LA 4HCPB 2CHZA 2N9PC 2C7MB 2XK5B 3SHQA 3PV1A 2JXXA 4URKA 2KTFA 3UF8A 4TUUA 4JQWC 4IM2A 2KFKA 2D10A 2FIDA 1K8RB 3V60A 3SU8X 4E71A 3SDLC 3V62A 3ZLZA 3KW5B 3ZNHB 1V80A 2DX5B 4GOCA 2KNBA 1JRUA 4PS7A 1P9DU 3VUXA 1C3TA 3H9DA 3ZTDA 3ECIA 2MQJA 2KOXA 2KLCA 3QIJA 2N7EA 3EC8A 2KDIA 4HJKA 4NJ7A 4HVBA 2KJRA 1UZXB 2KJHB 4AP4C 2O2VB 1F9JA 1WR1A 2NR2A 5CTRC 2CKHB 3T8MA 3IHPC 1P1AA 4ZRKA 3UIOB 4FJYA 3ZDMC 2PEAA 3CSTA 3A33B 3QC8B 4AJWA 1ZKHA 2RD0A 3U30A 1RLFA 2BYEA 3K9OB 2NS5A 3QX1A 4MGKE 3MHSD 2D3GA 3CMMB 1TBEA 3VH4B 3C0RB 3OJ3A 2KFJA 3ZNID 2JUOA 2CU1A 2V3SA 2C60A 2UYZB 4HDOA 4W9DA 5JH5C 1HE8A 4NAWB 1XQQA 2KZRA 4K7SA 4ANXA 3ZVVA 1D3ZA 1WGRA 3RD2A 4DHJB 1WGHA 1SE9A 2KQSA 3PZDA 2AWTA 2DHZA 1P98A 4EZJA 5AEKB 4MDKE 4HK2A 1J0GA 2WYQA 3DVNU 1Z2MA 5AZFA 2EKEC 2B3AA 4MSQB 2KN5A 3RZFA 1UD7A 3H6NA 4IC7B 2K1FA 4WWNA 1UGMA 2DZKA 1IYFA 5J2RA 1YIWA 3TJPA 4CHKA 2HE7A 3ZNGC 1XD3B 4GIVA 4BKGA 1V49A 4JIOU 2KDEB 4ICUA 1TZ1A 3N30A 4GMVA 4RM8A 4G11A 3APFA 4MGIE 4ZRIA 4FLHA 2L05A 4LJPB 5IA7A 5JHAA 4ZDVA 1WYWB 3JYUA 4K1RB 4IM0A 1E7VA 3UQAA 3U8ZA 4FJVB 2GBNA 2L0TA 2IO1B 2DAJA 3A1QA 4RM9A 3ML9A 3WALA 2LASA 3R66C 2LVQA 1E8YA 2HJ8A 3PHXB 5FR6A 1UBQA 4EZLA 2KO3A 3PVLA 3HHMA 3PPAA 4WJOA 5DPSA 3APDA 2CHXA 3QCAA 5DCNA 4DBGA 3QQ8B 2MBBB 3AXCA 3PLVA 2N1WA 1NI2A 1H4RA 2GMIC 5LXHA 4IW0A 4DXAB 2RGFA 3H7PA 3W1YA 3KUDB 1V9JA 1YQBA 1WJ4A 3A9JA 1KJTA 2FCSA 4A3PA 3M95A 4W9CA 2BKFA 5CHWA 1GC6A 1WJUA 2BWES 2IO2B 4GSWA 3VAWA 2C7NB 3KVFB 1ISNA 2N1VA 3WAOA 3NHEB 2Z59B 5AZGA 2IZVB
chains in the Genus database with same CATH superfamily
2K0PA 1HA5A 2BS4B 3BYTB 4M0WB 2CS4A 3DPDA 5IN7A 3VFKA 3U4EG 2V1YA 1HEZE 1LXDA 1MVKA 3IT4B 4XE0A 3EECA 1AW7A 3QJZA 3A9KB 4GU2A 5C23A 4KSKC 3LYYA 2KXJA 4XWTA 2LXCA 4E3CA 3SR6A 3L08A 2KFKB 1MJDA 3OAWA 1VZ6A 2JWUA 4KGTA 1E7UA 4N59A 1J19A 1NYRA 2N9XA 1BT0A 2GBKA 3PHWB 1AN8A 1R4NB 4WQOB 2BB6A 4S17A 3IAS1 1KM7A 1P7EA 2XN9C 3B2GA 1LQBA 3NVZA 1Z5SB 2KK8A 1V81A 4KSLC 2ZW0A 3PLUA 4XDDA 2JX5A 1XEEA 5L95C 3EFCA 4IWPA 4II3B 1XT9B 2KLGA 2CR5A 1J8CA 2JWZA 4HRSA 1ZW7A 2N9EB 3ZXVA 2D3CA 1NENB 4MJSA 2K25A 1WXQA 4ZHOA 1T3QA 3RNCC 2INDC 4M8MA 3Q3NC 3I3TB 3K9PB 2D07B 5BYRA 2M19A 5BMIA 1VZ7A 4OZBA 1WMHA 3B2FA 3N1YC 1LGRA 1UBIA 1WJNA 1WRIA 2AL3A 3EFUA 2LVPA 3B1LX 3DBLB 2J42A 4S0RA 2MX2A 1T0YA 1KLVA 4JX1C 2KTRA 4MSMB 3V61A 3P4QB 2MP2A 2O6VD 1STEA 1OGWA 4YTMB 4HPPA 4WAFA 2L52A 2LWPA 3EGRA 3Q8AA 5L83A 4AWJA 1S1QB 3GZNI 2OEDA 4BFRA 1SE4A 2C5LC 3KH0A 4RGTA 2L76A 2PVOD 1L5PA 2QIEB 3AULA 4XZ4A 1WX7A 3GE8C 2WX0A 1IUEA 3IAM1 4LDTD 1RRBA 1PYWD 1L4DB 3RULA 2G9HD 4MELA 3B08A 1XLOA 1JMLA 2FBWB 4WURA 4C00A 4YXDB 2W82A 3B9JA 4KVGB 5D2MB 5JZEB 3WIMA 1WGYA 3DBHI 5JXVA 5G55A 2VH2A 4GDLB 1F2RI 2WDVB 3MJWA 1DYQA 1C77A 1UNSA 4L1BA 4HLEA 3HIZA 3NS8A 4E74A 2EELA 3ZTCA 2L7RA 1Q5WB 3PT2B 2FIFA 4IKGA 4AUQC 2PVGC 4HPMB 1QILA 2KWVB 1WWTA 3PSEB 1X1MA 3GOEA 2PPHA 1XLQA 3W2DA 4KDLB 3JSVB 5G5HA 2O2VA 1P3QU 2D3BA 2KD0A 3E56A 4JL9A 4HCNB 3SD5A 3U52E 4PYUA 2PJHA 2ONQA 2KHWB 1WXAA 2MJDA 1OTRB 1D5MC 2N7DA 1GG3A 3MC8A 2GBMA 4NAWA 2ICIA 3PRPB 2WQYB 1JWUD 3HUIA 2HD5B 4C7ZA 2ZVNA 3T3OA 1B9RA 1FCCC 1F77A 1JALA 3L17A 4I6PA 1TKYA 1YQ4B 3TCAA 1EUVB 1FFVA 2UWQA 4YTPB 4IWQA 3RYTA 3NVVA 1JWBD 3V6CB 2LHEA 2IGHA 2J7QB 3D32A 3VTUA 1T6BX 2KWCA 3FKYA 4M00A 2N4FA 3TL5A 1KRHA 3AN1A 2IY1B 1E8XA 1SIJA 5D7GA 2R2QA 1C76A 4HPLB 2WDQB 5G5GA 4OVZA 4LTUA 4AOFA 1EU4A 2ZW1A 1E90A 4C4VA 3EHVA 1AARA 3CF6E 2K39A 1I4GA 3P63A 2JVCA 1OQYA 4N9F4 4F8CB 4B0EA 3RZWC 4ZRQA 3CWIA 2LGXA 5EDSA 3ENEA 3AB5A 2VH1A 3TIXA 2JYTA 2L00B 2OHFA 4N6EB 3P1MA 2AQ1B 3KLSX 4WJPA 1VDVA 3IXSA 1HZ5A 4HCPB 2CHZA 2W3SA 5BMGA 1KLUD 4TSSA 3SU8X 1F0ZA 4LNFA 3WCQA 3R8BA 5LNK1 4D2KA 1JWAD 1I4QA 1C3TA 2WXMA 3ZTDA 1NI3A 3EC8A 2KJRA 3AM9A 3RMKC 1HZ6A 2RMMA 4ZRKA 1IGDA 3DHHC 3QX1A 5MPOA 1TBEA 3ZNID 2V3SA 2UYZB 2Q5WD 4HDOA 4W9DA 2QMTA 5JH5C 1HE8A 3Q8CA 3ZVVA 1SSNA 3MJ5A 1XCQL 1N62A 2EKIA 2BW2A 5H92C 4HK2A 2KT7A 1IBXA 3NRZA 4UDUC 1JWMD 1AYFA 3KWVA 2DZKA 2HE7A 1XD3B 4ICUA 3AE1B 4RM8A 4MGIE 3RNAC 4ZRIA 4KKJA 4ZDVA 1WYWB 4K1RB 1E7VA 3UQAA 3U8ZA 2J53A 2L0TA 2IO1B 2H89B 3R66C 2HJ8A 3PHXB 2E6XA 3SFDB 5IO9A 2VZKD 3PVLA 4WJOA 1SJED 2LJIA 3APDA 2CHXA 2J52A 5LXHA 1MPEA 3H7PA 1L4ZB 1TKGA 1V9JA 1WJ4A 1V1PB 4A55A 4A3PA 3M95A 5I4DA 2WLBA 2WS3B 1GC6A 2IO2B 4MH8A 3VAWA 1MFWA 2N1VA 2L83A 3R7RA 2IZVB 3N32A 3AE5B 3N20C 2RSUA 2LGIA 2JQRB 1WR6E 1GB1A 1HQRD 3R3MA 4EKUA 3VR8B 1QOGA 2WNMA 2WXGA 1SJHD 3H8HA 2JRHA 3DQVA 1FPYA 2EMSA 2LMCA 3HVDA 3IVFA 2BWFA 3Q3OC 4OVUA 1Y56A 1CQVA 4RGMA 2FCMA 4NJ6A 4O1NA 2MBHA 4BVUC 4TQ0A 4ARCA 3R7QA 3S2AA 5CHVC 2JPHA 2NTTA 4W9JA 3NZUA 3WA0A 4BKTA 4ANWA 2DZIA 4L2YA 3N3KB 2AYOB 3IFWB 4B0MA 2LD9A 2DZJA 3DVNV 3AMZA 1PGBA 1V5TA 3OG5A 3R2IA 1HTOA 2L32A 1VRAB 4HROA 4II2B 3MFGA 5D3DA 1SXTA 1TYGB 1R4MI 4W9KA 4IOIE 1UH6A 3GE3C 3OLMD 4RFBA 2KKCA 4KZ0A 1E6EB 1T0RC 4Q2JA 2PMVA 2IY0B 2ZVOA 1V2YA 2OOBB 3RNGC 4RMAA 4DDGD 4ARIA 1FNWA 3QK0A 1GC7A 2YLMA 1OEYA 4WJQA 2BPSA 2JY6A 2REXA 1L7YA 2KN4A 1K53A 5BO4B 1FXTB 3ZRCA 1SGHA 4HJGE 1N61A 2NPTA 4US9A 3ABVB 3QA8A 3VQIA 2M8SA 3VTVA 3ZO5B 4P1CC 2WXLA 2IO0B 3AI5A 3V05A 2KC2A 3I57A 3DBRI 1FO4A 3OJ4B 4R3DA 1UELA 2QILA 3CSFA 1J7BA 1IP9A 1RFAA 2BGFA 1WXSA 4GDKA 3RUIB 2DENB 3A9JB 2BF8B 2DAFA 1P0RA 1YQ3B 4RNAA 2RDBC 1C4AA 1WX9A 1E9MA 1SIFA 3T9LA 4LK0M 2MJ3A 2NBVB 3DBSA 1QZEA 1PGXA 1I4RA 1ZDVA 3BINA 2RR9A 4FHJA 4TKNA 4GLSC 3PRMB 3HM3A 1WFYA 1NVID 3ZIMA 3TBLD 1ZXIA 1WZ0A 1WI0A 1WGKA 3Q69A 4FXCA 3DOWA 2KWUB 2MLBA 4I6NB 1UUPA 4HXDA 2WHIA 1FCLA 4LCDE 3ZQ4A 2D11A 1PUTA 3VHTC 2FUHB 1I7HA 4TV3A 4IWOA 1ZGUB 4JLCA 3P2BA 1ZXHA 3BWUD 2IBIB 3Q8FA 2YEPF 3DDCB 5AUKA 1N63A 2GRIA 2DYMA 2O6VB 3DCGA 3DHGC 2DYBA 1TIFA 2NBUA 4FADA 2XEWA 2GI9A 2XK5A 3MHZA 2ZNVB 4ITKA 1B1ZA 3BZDB 1S3SG 3J9CA 3VUWA 2WXPA 1CJEA 3DWGC 1BMLC 2WU5B 4DHZE 4NQKE 4FN2A 1Q10A 4JWUC 1YOVB 3NG0A 2JZPA 4GGQA 2LEKA 2W9NA 3KYDD 5E6JA 4LDTB 4WH4A 4DHZB 2R2OA 1WE6A 5HG2A 1XLPA 4BOZB 2KACA 5IAAC 2BTEA 2KX3A 4YT0B 1GOZA 3TMPB 3BY4B 4JWSC 2WWZA 1SEBD 3ZJTA 2GLSA 3LJ3A 3PRZA 4QAYA 4ZRPA 4W9EA 3V3XA 3UGBB 3A4SC 3AE9B 1TS4A 2NCNA 4KV2A 1TT5B 3N9YC 1WSPA 5DPRA 3PTFC 4K7WA 3TUOA 3AE3B 2PLPA 3UIPB 2Z0DB 4A20A 3AEFB 4B95A 4W9FA 4C56C 4EFOA 1XXGA 1WJ6A 2SAKA 2SEBD 2V0GA 2GOWA 3IT6B 3NY5A 2V3PA 4ZYNA 3QARA 2WXQA 3ZYYX 1BXTA 1EO6A 4ICVA 5BYQA 1GPXA 5HHDG 1P7FA 1PQSA 5FR3A 3AECB 1F1HA 2BYFA 2M0XA 3GS2A 4DWFA 4M0WA 1WH3A 3L13A 3M63B 4WWOA 2EMTA 4K7UA 4A3OA 1I4PA 1RAXA 3A9KA 3AU4A 5DPWA 2N9PC 3SHQA 3PV1A 4DXFA 2KTFA 3UF8A 4TUUA 4RCOA 4YSXB 2KFKA 3DWMA 4AS1A 1XCTL 3V60A 4N58A 3ZLZA 3NS1A 1V80A 1QQRA 2KNBA 4PS7A 3H9DA 1MHXA 4HVBA 1UZXB 5D3IB 1F9JA 5IOIA 3AEDB 2CKHB 4WIPA 1A70A 1EWYC 3NUHB 3ZDMC 2PEAA 3CSTA 4AJWA 1ZKHA 1RLFA 2BYEA 3K9OB 4MGKE 3RNBC 3MHSD 3C0RB 4MACA 4P6VF 2KFJA 1XQQA 3P4SB 2AX5A 4ANXA 1D3ZA 3RD2A 3ETRA 1SE9A 2BB5A 5HI1A 1P98A 4EZJA 5AEKB 1DOYA 3DVNU 1NEKB 1RM6C 3AE8B 2B3AA 3RZFA 1UD7A 4HEA1 5J2RA 4GIVA 1D5ZC 4G11A 3APFA 4LJPB 3AV8A 1V97A 3ML9A 5EE3A 2LVQA 4K3CA 1UBQA 3UI3A 2KO3A 3AEBB 3U7ZA 3PPAA 4DBGA 4PK1A 3RNEC 3QQ8B 2MBBB 1NI2A 2GMIC 4ZOHC 4IW0A 4DXAB 3VRAB 1XF5L 4CQNA 1KJTA 2FCSA 4OW0A 4W9CA 2BKFA 4MM3B 1WJUA 3BVZA 4GSWA 1UWXA 1ISNA 3NHEB 2Z59B 4KIKB 5AZGA 2C7HA 2KQ7A 1ZE3D 2KMCA 3NJTA 2X38A 4EOYA 5IP4D 3M62B 3FILB 2QC8A 4W9IA 2KMMA 3L16A 4G0NB 4ZHPA 1K51A 2R61A 2LI5A 4PS8A 1D6EC 5BYSA 4KKIA 1FIQA 3BK2A 1E8WA 1RFKA 1TKEA 2H88B 1CZPA 3SEBA 1U4AA 1KLGD 2J0MA 4IM3A 5FKAC 5EE9A 5LXIB 4REZA 1VR9A 4BAXA 4YWGG 3VXWA 1N5WA 1R4NI 1OQRA 1TZOA 1XLNA 2WXRA 1C79A 5EE1A 2L3ZA 1ENFA 1E5WA 1VZ8A 2JT4B 2K5PA 1FM0D 3ZKJC 3LXFA 2L0FA 3PGEA 2G4DB 4GDLA 5AZHA 4P7IA 4IUMB 2AQ3B 1J7CA 4I6LB 3W1SC 1OQQA 1HTQA 3N1ZC 4BBNC 2CU3A 2K8BA 4EE2A 2BS2B 4LJOB 2LGDA 3RT3B 3NZ3A 1WRDB 4ZRJA 2LFIA 2JRIB 5GXGB 3O13A 3JSVA 4RF1A 4OZCA 1GB4A 1FRRA 1ZP0B 3Q8BA 4MT5A 1YX6B 4WJNA 1AWDA 4FA6A 2ZCCA 4M01A 2XNAC 2Y5PA 2AQ2B 2NVUI 1JQ4A 1E7PB 2LZ6A 4PYZA 1L6VA 1PDXA 1M94A 4K81A 2LUMA 1GUAB 3A1QB 3RNFC 3H7SA 1SF0A 2J0KA 3HK0A 4DQOC 4EUTA 2WU2B 3DBLI 2PE6B 3UINB 4P1BC 4H2AA 1FXIA 4F1SA 1QKZA 3Q3MC 2IYDB 3AEAB 2I1JA 2MWSB 2LHDA 1IGCA 1MG4A 2I2YA 3MP9A 3P42A 1L0XB 3C19A 4XC2A 1DOXA 1VCBA 1ET9A 1L2NA 3ZNZB 1JROA 1F2RC 3L0WB 4OHJA 1SBBB 5LLIA 3RN9C 1EU3A 1WYGA 1QLBB 3NVWA 3LDZE 1ET6A 1EM7A 3PO0A 3APCA 2MBOA 4EZKA 3GZNB 1YNTE 1HXYD 2BYVE 4US8A 1UF0A 2N9LA 1WX8A 3KYCD 4OZAA 3DVGX 1TY0A 5E6OA 1VD2A 1YJJA 4MEMA 1IPGA 2WDRB 1YN4A 2KWDA 2K8HA 4MGZE 3X23A 2AEHA 2K3UA 4KZCA 2MA9B 3QHTA 4NNJB 2N0SB 1C1YB 3VDZA 2X8XX 1WIAA 4HDQA 3BVGA 3AEGB 2OJWA 3VRBB 2BBCA 4YTNB 4C7YA 1V8CA 2M4NA 3DBHB 3R2TA 3HVZA 2YVCA 3N1XC 4BOSC 2KVZA 3E9SA 4KDIC 4EEWA 2L8JA 2MBEA 4BKSA 3SFEB 1NYQA 3JVZX 4GN1A 1YD8U 1I35A 4YL8A 1YX5B 4M02A 2WGSA 5TR5A 5KHQA 4MH0E 2G4SA 2NMQA 2Z8LA 3P4PB 4CO7A 4ACFA 4MJSB 1TGZB 2ZEQA 3WAPA 4LLGM 2V4IB 2W55A 3NVYA 3HM6X 2IGGA 2RPQA 5KHOA 4A6QA 4P16A 1CK1A 1C4PA 2JZ3B 2M0AA 1QF6A 1WMHB 4WQMA 1EF1A 2VRRB 2AL6A 2ZPYA 1KFYB 5E6PA 2M17A 4NQLB 1A5RA 2D3AA 4ANVA 2WXIA 4NY0A 4XDCA 2WXHA 2JXTA 4LNNA 2OJRA 3ZW3A 1WZ3A 1TJEA 2KTRB 1WXVA 1ESFA 2MP2B 3U2SC 1TTNA 2W3RA 2W54A 4WWMA 4ASWC 2E3TA 2ZNVC 2QDFA 2KQ4X 4G3XB 4GXBA 3KUZA 4WAAA 3JW0X 4F7ZA 4JPSA 1SB3C 1TS5A 2CHWA 2INPE 1I42A 1ROEA 1ACCA 2BT6A 2N9KA 5HFYA 4DK5A 2GBJA 1WGGA 2PIAA 4CYEA 1CMXB 2FAZA 1FRDA 3W1SA 4PS3A 4IG7B 3EUB2 2A4ZA 1WXMA 1V1PA 2RDGA 1TS2A 2ASQA 1E0ZA 2Y3AA 3Q3FA 1QOAA 3DVGY 3AU5A 4BBNF 2K6DB 1H8CA 4TMAB 5J18A 1YJIA 3WANA 1WGDA 2IO3B 4A8XC 3IBEA 1K50A 3A4RA 2KC1A 1WE7A 2MBQA 4DHJD 4W9LA 3VVWB 1M4VA 3TEYA 1V1OA 2KAJA 2C7MB 2JXXA 4URKA 5AUIA 4J3OD 4JQWC 1YN5A 4IM2A 1FD6A 2FIDA 3RPFC 2WXKA 3CIRB 3V62A 3KW5B 3TEWA 4HKQA 1JRUA 1P9DU 1L0VB 2MQJA 2KOXA 2G1EA 2N7EA 2O2VB 1FMAD 1WR1A 3IHPC 3A33B 2K9XA 3U30A 1EWCA 2ACZB 3BIID 3CMMB 3VR9B 3VH4B 5TSSA 3OJ3A 4RGOS 2JUOA 3AE2B 2C60A 4NAWB 1MI0A 4K7SA 4A90A 2KQSA 3PZDA 3PZ8A 4MDKE 1J0GA 1J7AA 2BS3B 2EKEC 1VLBA 3I63C 4IC7B 3H6NA 4WWNA 2K1FA 1IYFA 3TJPA 2KDEB 1TZ1A 3N30A 1XO3A 4GMVA 4FLHA 4PT5A 3JYUA 4IM0A 4FJVB 2GBNA 2DAJA 4RM9A 3WALA 1FNUA 1E8YA 3HHMA 5DPSA 1FNVA 5DCNA 3W5UB 3PLVA 4ZYSA 2N1WA 2PW9A 1H4RA 4LNOA 2B76B 4LNIA 2RGFA 1K52A 3W1YA 3KUDB 3A9JA 2FUG1 1TY2A 1VJKA 4C4VB 5CHWA 2BWES 2BYTA 3Q2AC 3KVFB 3WAOA 1WM3A 3Q3JA 1DGJA 5HKHA 5DPTA 4DDID 4XGAB 3VUYA 4B6WA 1OEYJ 5D94A 2BQQA 2IGDA 3PS6A 1LFDA 3TEZA 3Q8EA 2JYEA 3GP7A 2K6QA 1T5XD 1Q0WB 2JSVX 3ZGZA 1Y8RC 2INCC 3RCZA 2GB1A 4KGSA 1V86A 2FCNA 5IKCM 5D6JB 5BMHA 1C9FA 2LJ5A 2ZZPB 5CHFA 3X0WA 1LM8B 4NJCA 4USAA 3NOBA 2WXFA 3T3NA 2FCQA 2O6VA 1ZPSA 4AJYB 3P4RB 4X57B 1WY8A 1R4MB 4XX5A 2J4XA 2WX1A 5H8YE 4JGHB 3KWLA 3ZDTA 3ZRFA 1C4CA 3ML8A 2A5UA 2QCZA 2K22A 2IDYA 2HTME 2PTLA 1YJ1A 1IBXB 3FC4A 5C1ZA 3QWZB 1C78A 1NDDA 1OFFA 2MJEA 2LXAA 2J0JA 3AH7A 1D4BA 1GNUA 2V9HA 5J17A 1GJZA 2LVOA 3OWEB 2ZPNA 2M1MA 2IPKD 4NZLB 3ZUNA 3BYYB 3FAHA 2CJOA 3C8YA 3AE7B 2DNFA 4W9GA 3DBRB 3UQBA 4YSYB 4WWPA 2G3QB 2LGSA 3H7PB 2I38A 4RGNA 3L4PA 4L23A 2MH7A 4KX6B 1MHHE 2MCNB 5CX3A 1LO5D 2INNE 2DWQA 3TSSA 4YSZB 3DHIC 3M3JA 2RPVA 2NTSA 2DLBA 2JF5A 4NPNA 1E10A 1QT9A 2MW5A 1T0QC 2WXJA 5T8IA 2ZJDA 4J6IA 3W5VB 3LB8C 4IDIA 2LGYA 3V6EB 4A9AA 1L0YB 1UWMA 2FE8A 2WDTB 2UU7A 2NBWB 2QEJC 3ONSA 2Z0EB 2MRPA 2VZKB 4G50A 4C80A 2IJ0A 3ALBA 2Y5CA 3RFZB 3MTNB 3I5JC 1R7SA 3W9CB 2Y5BB 2DBYA 1QOBA 4HKZE 3WAMA 3MC9A 4ANUA 3QAQA 1BUIC 2JU6X 4OVVA 4NAMA 2KX0A 2V3NA 2HDEA 3PZ7A 2KMAA 1WF9A 1D5XC 2JZZA 2TSSA 4FHKA 2C9WB 1FXAA 4BZAA 2KANA 4FULA 4FJZA 3O65B 5C3JB 2FNJB 1V5OA 1RWSA 2QSDA 3IG3A 1T0SC 2QHOA 4FBJB 2ON8A 1UGJA 3NZSA 2WP9B 2K8CA 3L10B 1KTKA 1GAQB 2NPTB 3Q6BA 2WXOA 4W9HA 5E6NA 2ZCBA 3VTWA 2KDBA 3H1UA 2HTHA 3HRDD 1E8ZA 3URYA 2LRWA 2XBBC 1NBFC 2BVCA 3KQ4A 4DXGA 3TEXA 4KGRA 2G45B 1EF5A 1QOFA 3AEEB 4GDKB 4HWIB 2KJ6A 1N5XA 2M56B 1N60A 4MGYE 2LUEA 2N7JA 3ZXRA 1MG8A 5JHBA 5G2NA 3KUCB 1KOTA 1KH0A 4BKSD 2PE9A 2KDFB 2D2QA 3U7DA 4M8NA 1L6UA 1KF6B 1I4XA 2GBRA 2HJ1A 1Q1OA 1RYJA 4XYCA 2D5GA 2MSED 3Q14C 3BVMA 1F52A 4B9KA 1I4HA 2DZMA 5GMVA 1SE3A 3L54A 4MM3A 1G6JA 2QJLA 2YEPB 2WXNA 1JWSD 1FEHA 1ZUD2 3AE6B 4TQ1A 4KIKA 2KVRA 3B0AA 2LRUA 2BKRB 3FILA 4GB9A 2I1KA 2DYOA 1WM2A 5FK9C 1JRPA 1V6EA 3PREA 3VH3B 2V4LA 1ZDXA 2XK5B 1PGAA 3BK1A 2D10A 1K8RB 2CJNA 4E71A 3SDLC 3ZNHB 2DX5B 4GOCA 3VUXA 4JE3B 1YN3A 3ECIA 4LNKA 2KLCA 3QIJA 4HJKA 4NJ7A 2KDIA 3EA6A 3ZJVA 2KJHB 4AP4C 1ZOYB 2NR2A 5CTRC 3T8MA 2MEKA 1P1AA 3UIOB 4FJYA 4AQ7A 3QC8B 2RD0A 2NS5A 2D3GA 5EE0A 1PFDA 2CU1A 3I9V1 1N6ZA 2KZRA 1YMHE 3RI7C 1WGRA 4DHJB 1WGHA 2AWTA 2DHZA 2WYQA 4RF0A 1Z2MA 5AZFA 1DOIA 4MSQB 2KN5A 1UGMA 1YIWA 4CHKA 1JCKB 3ZNGC 2KDMA 4BKGA 1V49A 4JIOU 2KYWA 2L05A 5IA7A 4K3BA 1TS3A 5JHAA 3GB1A 2L1AA 2MHJA 3AE4B 3A1QA 2LASA 3MC0B 1JW9D 5FR6A 2RDHA 4EZLA 3ZJUA 3QCAA 4RH6A 2PKOA 3AXCA 4XWWA 5C2TB 1FFUA 1SE2A 1YQBA 2C7NB
chains in the Genus database with same CATH topology
1WM3A 2C7HA 2KQ7A 3N32A 3Q3JA 2KMCA 4M0WB 2RSUA 2CS4A 1WR6E 3DPDA 5HKHA 5DPTA 4EOYA 3M62B 3VFKA 3R3MA 4W9IA 4DDID 4EKUA 2V1YA 3L16A 3VUYA 4G0NB 4B6WA 1LXDA 1OEYJ 2JRHA 2LI5A 3DQVA 4PS8A 5D94A 2EMSA 3EECA 1E8WA 3IVFA 2BWFA 3PS6A 3QJZA 4OVUA 1LFDA 3A9KB 4GU2A 5C23A 4KSKC 2KXJA 2FCMA 2K6QA 4NJ6A 1U4AA 2LXCA 2J0MA 4IM3A 2MBHA 4E3CA 3L08A 2KFKB 4BVUC 1Q0WB 3OAWA 4TQ0A 3R7QA 3S2AA 5CHVC 2JPHA 1E7UA 5LXIB 1Y8RC 4W9JA 3VXWA 1R4NI 3NZUA 3WA0A 1J19A 3RCZA 4BKTA 2N9XA 1BT0A 2GBKA 3PHWB 4ANWA 2DZIA 4WQOB 1V86A 2FCNA 5D6JB 2L3ZA 3N3KB 2AYOB 1E5WA 2LJ5A 2JT4B 2ZZPB 3IFWB 5CHFA 1KM7A 1LM8B 2DZJA 2LD9A 3DVNV 3ZKJC 3X0WA 3NOBA 1V5TA 2L0FA 3PGEA 2G4DB 2FCQA 1LQBA 2O6VA 4GDLA 1Z5SB 2KK8A 1V81A 5AZHA 4KSLC 4P7IA 4IUMB 4I6LB 4AJYB 4II2B 3PLUA 3W1SC 5L95C 1R4MI 4BBNC 2K8BA 4X57B 1WY8A 4II3B 4IWPA 4W9KA 4LJOB 1UH6A 1XT9B 2WX1A 4XX5A 2KLGA 3OLMD 2CR5A 1J8CA 2LGDA 4JGHB 2JWZA 3ZDTA 3ZRFA 3ML8A 3RT3B 2KKCA 4KZ0A 1ZW7A 2A5UA 2N9EB 1WRDB 4ZRJA 2IY0B 2JRIB 1YJ1A 2ZVOA 1V2YA 4MJSA 2K25A 5C1ZA 2OOBB 4RMAA 4DDGD 3JSVA 3QWZB 1NDDA 3QK0A 1GC7A 2LXAA 1OEYA 2J0JA 2YLMA 2BPSA 4WJQA 2JY6A 1YX6B 4WJNA 4M8MA 2REXA 4FA6A 1GNUA 1L7YA 2ZCCA 5J17A 1GJZA 3I3TB 2LVOA 3K9PB 5BO4B 2ZPNA 1FXTB 2NVUI 2D07B 2M1MA 4PYZA 2LZ6A 3ZRCA 1SGHA 1M94A 2NPTA 4K81A 1WMHA 3ZUNA 1GUAB 3A1QB 3QA8A 3H7SA 3VQIA 2M8SA 2J0KA 3VTVA 3HK0A 3ZO5B 4EUTA 1UBIA 3DBLI 3UINB 1WJNA 2PE6B 2IO0B 3AI5A 2AL3A 3EFUA 2KC2A 2LVPA 3B1LX 3DBRI 4F1SA 3OJ4B 4W9GA 1UELA 2IYDB 3UQBA 2I1JA 2MWSB 4WWPA 2G3QB 3CSFA 3R7RA 1IP9A 1RFAA 1T0YA 2BGFA 2MX2A 3H7PB 1KLVA 1WXSA 4GDKA 3RUIB 2DENB 3A9JB 2KTRA 4XC2A 4MSMB 2BF8B 3V61A 1VCBA 1P0RA 2DAFA 2MP2A 1OGWA 2O6VD 3ZNZB 1L2NA 3L0WB 5LLIA 1WX9A 2MCNB 5CX3A 1SIFA 2LWPA 3T9LA 5L83A 3LDZE 4AWJA 1S1QB 3APCA 3M3JA 2NBVB 3DBSA 3GZNI 1QZEA 2JF5A 2MBOA 4NPNA 4EZKA 2MW5A 3BINA 2BYVE 2RR9A 4FHJA 4TKNA 4BFRA 3PRMB 1WX8A 2C5LC 2ZJDA 3HM3A 3KH0A 3KYCD 4J6IA 1WFYA 3ZIMA 2L76A 3TBLD 1WZ0A 3DVGX 2LGYA 5E6OA 3V6EB 1VD2A 3AULA 1WI0A 4XZ4A 4MEMA 1IPGA 3DOWA 1WX7A 2WX0A 2KWUB 2MLBA 4I6NB 2WDTB 4HXDA 4LDTD 2NBWB 2K8HA 4MGZE 1RRBA 3ONSA 4LCDE 2D11A 2Z0EB 2MRPA 4G50A 3X23A 3VHTC 3RULA 2AEHA 4MELA 2FUHB 3B08A 4KZCA 4TV3A 4IWOA 1ZGUB 2MA9B 3QHTA 4JLCA 4NNJB 3P2BA 3ALBA 1C1YB 2IBIB 3VDZA 4KVGB 5D2MB 1WIAA 4HDQA 3DDCB 5JZEB 3WIMA 1WGYA 3DBHI 2DYMA 2O6VB 5G55A 3MTNB 4GDLB 4KIKB 2M4NA 3DCGA 2YVCA 2Y5BB 2DYBA 4BOSC 4KDIC 2NBUA 4FADA 3MJWA 2XEWA 2XK5A 4EEWA 2L8JA 2ZNVB 3WAMA 2MBEA 4BKSA 4HLEA 3HIZA 4ANUA 1S3SG 3NS8A 4E74A 3QAQA 3VUWA 3JVZX 4GN1A 3ZTCA 2L7RA 1Q5WB 1YD8U 3PT2B 4OVVA 2FIFA 4YL8A 1I35A 4AUQC 1YX5B 2KX0A 4HPMB 5TR5A 2KWVB 2KMAA 5KHQA 4MH0E 3PSEB 1WF9A 1X1MA 2G4SA 2JZZA 3GOEA 4NQKE 4FN2A 4FHKA 2PPHA 4DHZE 2C9WB 2KANA 4KDLB 4CO7A 4GGQA 4FULA 4MJSB 4FJZA 2W9NA 3O65B 1TGZB 2ZEQA 3JSVB 3WAPA 3KYDD 2O2VA 1P3QU 2KD0A 2FNJB 1V5OA 3HM6X 4LDTB 3IG3A 2RPQA 5KHOA 4DHZB 2QHOA 4JL9A 4FBJB 4HCNB 2R2OA 3SD5A 3NZSA 1WE6A 4PYUA 2PJHA 2K8CA 3L10B 4BOZB 2JZ3B 2KHWB 1WXAA 2NPTB 5IAAC 1WMHB 2KX3A 1EF1A 4W9HA 2VRRB 1OTRB 3TMPB 2N7DA 5E6NA 1GG3A 2AL6A 2ZPYA 3BY4B 4NAWA 2GBMA 2ZCBA 2WWZA 5E6PA 2KDBA 2M17A 3VTWA 3H1UA 3PRPB 2HTHA 3LJ3A 4NQLB 1E8ZA 3PRZA 1A5RA 4ANVA 2LRWA 4NY0A 4W9EA 2XBBC 1NBFC 2HD5B 2ZVNA 3UGBB 2OJRA 3A4SC 2G45B 1EF5A 2NCNA 3ZW3A 4KV2A 1WZ3A 4GDKB 3L17A 4HWIB 2KTRB 4I6PA 2KJ6A 1WXVA 5DPRA 2MP2B 3PTFC 1TTNA 3TCAA 4K7WA 1EUVB 4MGYE 2UWQA 3RYTA 4IWQA 2LUEA 3UIPB 3V6CB 1MG8A 4ASWC 3D32A 2J7QB 5JHBA 3VTUA 5G2NA 3KUCB 2KWCA 1KOTA 2ZNVC 4BKSD 2PE9A 2KDFB 2Z0DB 4A20A 2N4FA 4G3XB 2D2QA 4GXBA 4W9FA 3TL5A 4B95A 4EFOA 3U7DA 3KUZA 1WJ6A 3JW0X 4M8NA 4WAAA 4F7ZA 2CHWA 2IY1B 1E8XA 1I42A 2GBRA 2GOWA 3NY5A 5D7GA 2R2QA 4HPLB 4ZYNA 2GBJA 3QARA 4DK5A 1Q1OA 1WGGA 4CYEA 1CMXB 2FAZA 3W1SA 2MSED 1EO6A 4AOFA 4ICVA 4PS3A 4IG7B 4B9KA 2A4ZA 1WXMA 2DZMA 5GMVA 1E90A 2ASQA 1PQSA 3L54A 4MM3A 1G6JA 3EHVA 3Q3FA 1AARA 3CF6E 2K39A 3DVGY 2JVCA 4TQ1A 1OQYA 4KIKA 3AU5A 4N9F4 4BBNF 2K6DB 2KVRA 2BYFA 4F8CB 1H8CA 3B0AA 3RZWC 5J18A 2M0XA 4DWFA 3WANA 2LRUA 1WGDA 2IO3B 2BKRB 2LGXA 1WH3A 2I1KA 4GB9A 3IBEA 2DYOA 3L13A 3A4RA 3M63B 1WM2A 5EDSA 2KC1A 3ENEA 3TIXA 4WWOA 2EMTA 1WE7A 2L00B 2MBQA 4DHJD 1V6EA 3PREA 4W9LA 3VH3B 3VVWB 4WJPA 4K7UA 4A3OA 1RAXA 3A9KA 3AU4A 5DPWA 2V4LA 4HCPB 2CHZA 2N9PC 2C7MB 2XK5B 3SHQA 3PV1A 2JXXA 4URKA 2KTFA 3UF8A 4TUUA 4JQWC 4IM2A 2KFKA 2D10A 2FIDA 1K8RB 3V60A 3SU8X 4E71A 3SDLC 3V62A 3ZLZA 3KW5B 3ZNHB 1V80A 2DX5B 4GOCA 2KNBA 1JRUA 4PS7A 1P9DU 3VUXA 1C3TA 3H9DA 3ZTDA 3ECIA 2MQJA 2KOXA 2KLCA 3QIJA 2N7EA 3EC8A 2KDIA 4HJKA 4NJ7A 4HVBA 2KJRA 1UZXB 2KJHB 4AP4C 2O2VB 1F9JA 1WR1A 2NR2A 5CTRC 2CKHB 3T8MA 3IHPC 1P1AA 4ZRKA 3UIOB 4FJYA 3ZDMC 2PEAA 3CSTA 3A33B 3QC8B 4AJWA 1ZKHA 2RD0A 3U30A 1RLFA 2BYEA 3K9OB 2NS5A 3QX1A 4MGKE 3MHSD 2D3GA 3CMMB 1TBEA 3VH4B 3C0RB 3OJ3A 2KFJA 3ZNID 2JUOA 2CU1A 2V3SA 2C60A 2UYZB 4HDOA 4W9DA 5JH5C 1HE8A 4NAWB 1XQQA 2KZRA 4K7SA 4ANXA 3ZVVA 1D3ZA 1WGRA 3RD2A 4DHJB 1WGHA 1SE9A 2KQSA 3PZDA 2AWTA 2DHZA 1P98A 4EZJA 5AEKB 4MDKE 4HK2A 1J0GA 2WYQA 3DVNU 1Z2MA 5AZFA 2EKEC 2B3AA 4MSQB 2KN5A 3RZFA 1UD7A 3H6NA 4IC7B 2K1FA 4WWNA 1UGMA 2DZKA 1IYFA 5J2RA 1YIWA 3TJPA 4CHKA 2HE7A 3ZNGC 1XD3B 4GIVA 4BKGA 1V49A 4JIOU 2KDEB 4ICUA 1TZ1A 3N30A 4GMVA 4RM8A 4G11A 3APFA 4MGIE 4ZRIA 4FLHA 2L05A 4LJPB 5IA7A 5JHAA 4ZDVA 1WYWB 3JYUA 4K1RB 4IM0A 1E7VA 3UQAA 3U8ZA 4FJVB 2GBNA 2L0TA 2IO1B 2DAJA 3A1QA 4RM9A 3ML9A 3WALA 2LASA 3R66C 2LVQA 1E8YA 2HJ8A 3PHXB 5FR6A 1UBQA 4EZLA 2KO3A 3PVLA 3HHMA 3PPAA 4WJOA 5DPSA 3APDA 2CHXA 3QCAA 5DCNA 4DBGA 3QQ8B 2MBBB 3AXCA 3PLVA 2N1WA 1NI2A 1H4RA 2GMIC 5LXHA 4IW0A 4DXAB 2RGFA 3H7PA 3W1YA 3KUDB 1V9JA 1YQBA 1WJ4A 3A9JA 1KJTA 2FCSA 4A3PA 3M95A 4W9CA 2BKFA 5CHWA 1GC6A 1WJUA 2BWES 2IO2B 4GSWA 3VAWA 2C7NB 3KVFB 1ISNA 2N1VA 3WAOA 3NHEB 2Z59B 5AZGA 2IZVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WM3 A;  2C7H A;  2KQ7 A;  3N32 A;  3Q3J A;  2KMC A;  4M0W B;  2RSU A;  2CS4 A;  1WR6 E;  3DPD A;  5HKH A;  5DPT A;  4EOY A;  3M62 B;  3VFK A;  3R3M A;  4W9I A;  4DDI D;  4EKU A;  2V1Y A;  3L16 A;  3VUY A;  4G0N B;  4B6W A;  1LXD A;  1OEY J;  2JRH A;  2LI5 A;  3DQV A;  4PS8 A;  5D94 A;  2EMS A;  3EEC A;  1E8W A;  3IVF A;  2BWF A;  3PS6 A;  3QJZ A;  4OVU A;  1LFD A;  3A9K B;  4GU2 A;  5C23 A;  4KSK C;  2KXJ A;  2FCM A;  2K6Q A;  4NJ6 A;  1U4A A;  2LXC A;  2J0M A;  4IM3 A;  2MBH A;  4E3C A;  3L08 A;  2KFK B;  4BVU C;  1Q0W B;  3OAW A;  4TQ0 A;  3R7Q A;  3S2A A;  5CHV C;  2JPH A;  1E7U A;  5LXI B;  1Y8R C;  4W9J A;  3VXW A;  1R4N I;  3NZU A;  3WA0 A;  1J19 A;  3RCZ A;  4BKT A;  2N9X A;  1BT0 A;  2GBK A;  3PHW B;  4ANW A;  2DZI A;  4WQO B;  1V86 A;  2FCN A;  5D6J B;  2L3Z A;  3N3K B;  2AYO B;  1E5W A;  2LJ5 A;  2JT4 B;  2ZZP B;  3IFW B;  5CHF A;  1KM7 A;  1LM8 B;  2DZJ A;  2LD9 A;  3DVN V;  3ZKJ C;  3X0W A;  3NOB A;  1V5T A;  2L0F A;  3PGE A;  2G4D B;  2FCQ A;  1LQB A;  2O6V A;  4GDL A;  1Z5S B;  2KK8 A;  1V81 A;  5AZH A;  4KSL C;  4P7I A;  4IUM B;  4I6L B;  4AJY B;  4II2 B;  3PLU A;  3W1S C;  5L95 C;  1R4M I;  4BBN C;  2K8B A;  4X57 B;  1WY8 A;  4II3 B;  4IWP A;  4W9K A;  4LJO B;  1UH6 A;  1XT9 B;  2WX1 A;  4XX5 A;  2KLG A;  3OLM D;  2CR5 A;  1J8C A;  2LGD A;  4JGH B;  2JWZ A;  3ZDT A;  3ZRF A;  3ML8 A;  3RT3 B;  2KKC A;  4KZ0 A;  1ZW7 A;  2A5U A;  2N9E B;  1WRD B;  4ZRJ A;  2IY0 B;  2JRI B;  1YJ1 A;  2ZVO A;  1V2Y A;  4MJS A;  2K25 A;  5C1Z A;  2OOB B;  4RMA A;  4DDG D;  3JSV A;  3QWZ B;  1NDD A;  3QK0 A;  1GC7 A;  2LXA A;  1OEY A;  2J0J A;  2YLM A;  2BPS A;  4WJQ A;  2JY6 A;  1YX6 B;  4WJN A;  4M8M A;  2REX A;  4FA6 A;  1GNU A;  1L7Y A;  2ZCC A;  5J17 A;  1GJZ A;  3I3T B;  2LVO A;  3K9P B;  5BO4 B;  2ZPN A;  1FXT B;  2NVU I;  2D07 B;  2M1M A;  4PYZ A;  2LZ6 A;  3ZRC A;  1SGH A;  1M94 A;  2NPT A;  4K81 A;  1WMH A;  3ZUN A;  1GUA B;  3A1Q B;  3QA8 A;  3H7S A;  3VQI A;  2M8S A;  2J0K A;  3VTV A;  3HK0 A;  3ZO5 B;  4EUT A;  1UBI A;  3DBL I;  3UIN B;  1WJN A;  2PE6 B;  2IO0 B;  3AI5 A;  2AL3 A;  3EFU A;  2KC2 A;  2LVP A;  3B1L X;  3DBR I;  4F1S A;  3OJ4 B;  4W9G A;  1UEL A;  2IYD B;  3UQB A;  2I1J A;  2MWS B;  4WWP A;  2G3Q B;  3CSF A;  3R7R A;  1IP9 A;  1RFA A;  1T0Y A;  2BGF A;  2MX2 A;  3H7P B;  1KLV A;  1WXS A;  4GDK A;  3RUI B;  2DEN B;  3A9J B;  2KTR A;  4XC2 A;  4MSM B;  2BF8 B;  3V61 A;  1VCB A;  1P0R A;  2DAF A;  2MP2 A;  1OGW A;  2O6V D;  3ZNZ B;  1L2N A;  3L0W B;  5LLI A;  1WX9 A;  2MCN B;  5CX3 A;  1SIF A;  2LWP A;  3T9L A;  5L83 A;  3LDZ E;  4AWJ A;  1S1Q B;  3APC A;  3M3J A;  2NBV B;  3DBS A;  3GZN I;  1QZE A;  2JF5 A;  2MBO A;  4NPN A;  4EZK A;  2MW5 A;  3BIN A;  2BYV E;  2RR9 A;  4FHJ A;  4TKN A;  4BFR A;  3PRM B;  1WX8 A;  2C5L C;  2ZJD A;  3HM3 A;  3KH0 A;  3KYC D;  4J6I A;  1WFY A;  3ZIM A;  2L76 A;  3TBL D;  1WZ0 A;  3DVG X;  2LGY A;  5E6O A;  3V6E B;  1VD2 A;  3AUL A;  1WI0 A;  4XZ4 A;  4MEM A;  1IPG A;  3DOW A;  1WX7 A;  2WX0 A;  2KWU B;  2MLB A;  4I6N B;  2WDT B;  4HXD A;  4LDT D;  2NBW B;  2K8H A;  4MGZ E;  1RRB A;  3ONS A;  4LCD E;  2D11 A;  2Z0E B;  2MRP A;  4G50 A;  3X23 A;  3VHT C;  3RUL A;  2AEH A;  4MEL A;  2FUH B;  3B08 A;  4KZC A;  4TV3 A;  4IWO A;  1ZGU B;  2MA9 B;  3QHT A;  4JLC A;  4NNJ B;  3P2B A;  3ALB A;  1C1Y B;  2IBI B;  3VDZ A;  4KVG B;  5D2M B;  1WIA A;  4HDQ A;  3DDC B;  5JZE B;  3WIM A;  1WGY A;  3DBH I;  2DYM A;  2O6V B;  5G55 A;  3MTN B;  4GDL B;  4KIK B;  2M4N A;  3DCG A;  2YVC A;  2Y5B B;  2DYB A;  4BOS C;  4KDI C;  2NBU A;  4FAD A;  3MJW A;  2XEW A;  2XK5 A;  4EEW A;  2L8J A;  2ZNV B;  3WAM A;  2MBE A;  4BKS A;  4HLE A;  3HIZ A;  4ANU A;  1S3S G;  3NS8 A;  4E74 A;  3QAQ A;  3VUW A;  3JVZ X;  4GN1 A;  3ZTC A;  2L7R A;  1Q5W B;  1YD8 U;  3PT2 B;  4OVV A;  2FIF A;  4YL8 A;  1I35 A;  4AUQ C;  1YX5 B;  2KX0 A;  4HPM B;  5TR5 A;  2KWV B;  2KMA A;  5KHQ A;  4MH0 E;  3PSE B;  1WF9 A;  1X1M A;  2G4S A;  2JZZ A;  3GOE A;  4NQK E;  4FN2 A;  4FHK A;  2PPH A;  4DHZ E;  2C9W B;  2KAN A;  4KDL B;  4CO7 A;  4GGQ A;  4FUL A;  4MJS B;  4FJZ A;  2W9N A;  3O65 B;  1TGZ B;  2ZEQ A;  3JSV B;  3WAP A;  3KYD D;  2O2V A;  1P3Q U;  2KD0 A;  2FNJ B;  1V5O A;  3HM6 X;  4LDT B;  3IG3 A;  2RPQ A;  5KHO A;  4DHZ B;  2QHO A;  4JL9 A;  4FBJ B;  4HCN B;  2R2O A;  3SD5 A;  3NZS A;  1WE6 A;  4PYU A;  2PJH A;  2K8C A;  3L10 B;  4BOZ B;  2JZ3 B;  2KHW B;  1WXA A;  2NPT B;  5IAA C;  1WMH B;  2KX3 A;  1EF1 A;  4W9H A;  2VRR B;  1OTR B;  3TMP B;  2N7D A;  5E6N A;  1GG3 A;  2AL6 A;  2ZPY A;  3BY4 B;  4NAW A;  2GBM A;  2ZCB A;  2WWZ A;  5E6P A;  2KDB A;  2M17 A;  3VTW A;  3H1U A;  3PRP B;  2HTH A;  3LJ3 A;  4NQL B;  1E8Z A;  3PRZ A;  1A5R A;  4ANV A;  2LRW A;  4NY0 A;  4W9E A;  2XBB C;  1NBF C;  2HD5 B;  2ZVN A;  3UGB B;  2OJR A;  3A4S C;  2G45 B;  1EF5 A;  2NCN A;  3ZW3 A;  4KV2 A;  1WZ3 A;  4GDK B;  3L17 A;  4HWI B;  2KTR B;  4I6P A;  2KJ6 A;  1WXV A;  5DPR A;  2MP2 B;  3PTF C;  1TTN A;  3TCA A;  4K7W A;  1EUV B;  4MGY E;  2UWQ A;  3RYT A;  4IWQ A;  2LUE A;  3UIP B;  3V6C B;  1MG8 A;  4ASW C;  3D32 A;  2J7Q B;  5JHB A;  3VTU A;  5G2N A;  3KUC B;  2KWC A;  1KOT A;  2ZNV C;  4BKS D;  2PE9 A;  2KDF B;  2Z0D B;  4A20 A;  2N4F A;  4G3X B;  2D2Q A;  4GXB A;  4W9F A;  3TL5 A;  4B95 A;  4EFO A;  3U7D A;  3KUZ A;  1WJ6 A;  3JW0 X;  4M8N A;  4WAA A;  4F7Z A;  2CHW A;  2IY1 B;  1E8X A;  1I42 A;  2GBR A;  2GOW A;  3NY5 A;  5D7G A;  2R2Q A;  4HPL B;  4ZYN A;  2GBJ A;  3QAR A;  4DK5 A;  1Q1O A;  1WGG A;  4CYE A;  1CMX B;  2FAZ A;  3W1S A;  2MSE D;  1EO6 A;  4AOF A;  4ICV A;  4PS3 A;  4IG7 B;  4B9K A;  2A4Z A;  1WXM A;  2DZM A;  5GMV A;  1E90 A;  2ASQ A;  1PQS A;  3L54 A;  4MM3 A;  1G6J A;  3EHV A;  3Q3F A;  1AAR A;  3CF6 E;  2K39 A;  3DVG Y;  2JVC A;  4TQ1 A;  1OQY A;  4KIK A;  3AU5 A;  4N9F 4;  4BBN F;  2K6D B;  2KVR A;  2BYF A;  4F8C B;  1H8C A;  3B0A A;  3RZW C;  5J18 A;  2M0X A;  4DWF A;  3WAN A;  2LRU A;  1WGD A;  2IO3 B;  2BKR B;  2LGX A;  1WH3 A;  2I1K A;  4GB9 A;  3IBE A;  2DYO A;  3L13 A;  3A4R A;  3M63 B;  1WM2 A;  5EDS A;  2KC1 A;  3ENE A;  3TIX A;  4WWO A;  2EMT A;  1WE7 A;  2L00 B;  2MBQ A;  4DHJ D;  1V6E A;  3PRE A;  4W9L A;  3VH3 B;  3VVW B;  4WJP A;  4K7U A;  4A3O A;  1RAX A;  3A9K A;  3AU4 A;  5DPW A;  2V4L A;  4HCP B;  2CHZ A;  2N9P C;  2C7M B;  2XK5 B;  3SHQ A;  3PV1 A;  2JXX A;  4URK A;  2KTF A;  3UF8 A;  4TUU A;  4JQW C;  4IM2 A;  2KFK A;  2D10 A;  2FID A;  1K8R B;  3V60 A;  3SU8 X;  4E71 A;  3SDL C;  3V62 A;  3ZLZ A;  3KW5 B;  3ZNH B;  1V80 A;  2DX5 B;  4GOC A;  2KNB A;  1JRU A;  4PS7 A;  1P9D U;  3VUX A;  1C3T A;  3H9D A;  3ZTD A;  3ECI A;  2MQJ A;  2KOX A;  2KLC A;  3QIJ A;  2N7E A;  3EC8 A;  2KDI A;  4HJK A;  4NJ7 A;  4HVB A;  2KJR A;  1UZX B;  2KJH B;  4AP4 C;  2O2V B;  1F9J A;  1WR1 A;  2NR2 A;  5CTR C;  2CKH B;  3T8M A;  3IHP C;  1P1A A;  4ZRK A;  3UIO B;  4FJY A;  3ZDM C;  2PEA A;  3CST A;  3A33 B;  3QC8 B;  4AJW A;  1ZKH A;  2RD0 A;  3U30 A;  1RLF A;  2BYE A;  3K9O B;  2NS5 A;  3QX1 A;  4MGK E;  3MHS D;  2D3G A;  3CMM B;  1TBE A;  3VH4 B;  3C0R B;  3OJ3 A;  2KFJ A;  3ZNI D;  2JUO A;  2CU1 A;  2V3S A;  2C60 A;  2UYZ B;  4HDO A;  4W9D A;  5JH5 C;  1HE8 A;  4NAW B;  1XQQ A;  2KZR A;  4K7S A;  4ANX A;  3ZVV A;  1D3Z A;  1WGR A;  3RD2 A;  4DHJ B;  1WGH A;  1SE9 A;  2KQS A;  3PZD A;  2AWT A;  2DHZ A;  1P98 A;  4EZJ A;  5AEK B;  4MDK E;  4HK2 A;  1J0G A;  2WYQ A;  3DVN U;  1Z2M A;  5AZF A;  2EKE C;  2B3A A;  4MSQ B;  2KN5 A;  3RZF A;  1UD7 A;  3H6N A;  4IC7 B;  2K1F A;  4WWN A;  1UGM A;  2DZK A;  1IYF A;  5J2R A;  1YIW A;  3TJP A;  4CHK A;  2HE7 A;  3ZNG C;  1XD3 B;  4GIV A;  4BKG A;  1V49 A;  4JIO U;  2KDE B;  4ICU A;  1TZ1 A;  3N30 A;  4GMV A;  4RM8 A;  4G11 A;  3APF A;  4MGI E;  4ZRI A;  4FLH A;  2L05 A;  4LJP B;  5IA7 A;  5JHA A;  4ZDV A;  1WYW B;  3JYU A;  4K1R B;  4IM0 A;  1E7V A;  3UQA A;  3U8Z A;  4FJV B;  2GBN A;  2L0T A;  2IO1 B;  2DAJ A;  3A1Q A;  4RM9 A;  3ML9 A;  3WAL A;  2LAS A;  3R66 C;  2LVQ A;  1E8Y A;  2HJ8 A;  3PHX B;  5FR6 A;  1UBQ A;  4EZL A;  2KO3 A;  3PVL A;  3HHM A;  3PPA A;  4WJO A;  5DPS A;  3APD A;  2CHX A;  3QCA A;  5DCN A;  4DBG A;  3QQ8 B;  2MBB B;  3AXC A;  3PLV A;  2N1W A;  1NI2 A;  1H4R A;  2GMI C;  5LXH A;  4IW0 A;  4DXA B;  2RGF A;  3H7P A;  3W1Y A;  3KUD B;  1V9J A;  1YQB A;  1WJ4 A;  3A9J A;  1KJT A;  2FCS A;  4A3P A;  3M95 A;  4W9C A;  2BKF A;  5CHW A;  1GC6 A;  1WJU A;  2BWE S;  2IO2 B;  4GSW A;  3VAW A;  2C7N B;  3KVF B;  1ISN A;  2N1V A;  3WAO A;  3NHE B;  2Z59 B;  5AZG A;  2IZV B; 
#chains in the Genus database with same CATH topology
 2K0P A;  1HA5 A;  2BS4 B;  3BYT B;  4M0W B;  2CS4 A;  3DPD A;  5IN7 A;  3VFK A;  3U4E G;  2V1Y A;  1HEZ E;  1LXD A;  1MVK A;  3IT4 B;  4XE0 A;  3EEC A;  1AW7 A;  3QJZ A;  3A9K B;  4GU2 A;  5C23 A;  4KSK C;  3LYY A;  2KXJ A;  4XWT A;  2LXC A;  4E3C A;  3SR6 A;  3L08 A;  2KFK B;  1MJD A;  3OAW A;  1VZ6 A;  2JWU A;  4KGT A;  1E7U A;  4N59 A;  1J19 A;  1NYR A;  2N9X A;  1BT0 A;  2GBK A;  3PHW B;  1AN8 A;  1R4N B;  4WQO B;  2BB6 A;  4S17 A;  3IAS 1;  1KM7 A;  1P7E A;  2XN9 C;  3B2G A;  1LQB A;  3NVZ A;  1Z5S B;  2KK8 A;  1V81 A;  4KSL C;  2ZW0 A;  3PLU A;  4XDD A;  2JX5 A;  1XEE A;  5L95 C;  3EFC A;  4IWP A;  4II3 B;  1XT9 B;  2KLG A;  2CR5 A;  1J8C A;  2JWZ A;  4HRS A;  1ZW7 A;  2N9E B;  3ZXV A;  2D3C A;  1NEN B;  4MJS A;  2K25 A;  1WXQ A;  4ZHO A;  1T3Q A;  3RNC C;  2IND C;  4M8M A;  3Q3N C;  3I3T B;  3K9P B;  2D07 B;  5BYR A;  2M19 A;  5BMI A;  1VZ7 A;  4OZB A;  1WMH A;  3B2F A;  3N1Y C;  1LGR A;  1UBI A;  1WJN A;  1WRI A;  2AL3 A;  3EFU A;  2LVP A;  3B1L X;  3DBL B;  2J42 A;  4S0R A;  2MX2 A;  1T0Y A;  1KLV A;  4JX1 C;  2KTR A;  4MSM B;  3V61 A;  3P4Q B;  2MP2 A;  2O6V D;  1STE A;  1OGW A;  4YTM B;  4HPP A;  4WAF A;  2L52 A;  2LWP A;  3EGR A;  3Q8A A;  5L83 A;  4AWJ A;  1S1Q B;  3GZN I;  2OED A;  4BFR A;  1SE4 A;  2C5L C;  3KH0 A;  4RGT A;  2L76 A;  2PVO D;  1L5P A;  2QIE B;  3AUL A;  4XZ4 A;  1WX7 A;  3GE8 C;  2WX0 A;  1IUE A;  3IAM 1;  4LDT D;  1RRB A;  1PYW D;  1L4D B;  3RUL A;  2G9H D;  4MEL A;  3B08 A;  1XLO A;  1JML A;  2FBW B;  4WUR A;  4C00 A;  4YXD B;  2W82 A;  3B9J A;  4KVG B;  5D2M B;  5JZE B;  3WIM A;  1WGY A;  3DBH I;  5JXV A;  5G55 A;  2VH2 A;  4GDL B;  1F2R I;  2WDV B;  3MJW A;  1DYQ A;  1C77 A;  1UNS A;  4L1B A;  4HLE A;  3HIZ A;  3NS8 A;  4E74 A;  2EEL A;  3ZTC A;  2L7R A;  1Q5W B;  3PT2 B;  2FIF A;  4IKG A;  4AUQ C;  2PVG C;  4HPM B;  1QIL A;  2KWV B;  1WWT A;  3PSE B;  1X1M A;  3GOE A;  2PPH A;  1XLQ A;  3W2D A;  4KDL B;  3JSV B;  5G5H A;  2O2V A;  1P3Q U;  2D3B A;  2KD0 A;  3E56 A;  4JL9 A;  4HCN B;  3SD5 A;  3U52 E;  4PYU A;  2PJH A;  2ONQ A;  2KHW B;  1WXA A;  2MJD A;  1OTR B;  1D5M C;  2N7D A;  1GG3 A;  3MC8 A;  2GBM A;  4NAW A;  2ICI A;  3PRP B;  2WQY B;  1JWU D;  3HUI A;  2HD5 B;  4C7Z A;  2ZVN A;  3T3O A;  1B9R A;  1FCC C;  1F77 A;  1JAL A;  3L17 A;  4I6P A;  1TKY A;  1YQ4 B;  3TCA A;  1EUV B;  1FFV A;  2UWQ A;  4YTP B;  4IWQ A;  3RYT A;  3NVV A;  1JWB D;  3V6C B;  2LHE A;  2IGH A;  2J7Q B;  3D32 A;  3VTU A;  1T6B X;  2KWC A;  3FKY A;  4M00 A;  2N4F A;  3TL5 A;  1KRH A;  3AN1 A;  2IY1 B;  1E8X A;  1SIJ A;  5D7G A;  2R2Q A;  1C76 A;  4HPL B;  2WDQ B;  5G5G A;  4OVZ A;  4LTU A;  4AOF A;  1EU4 A;  2ZW1 A;  1E90 A;  4C4V A;  3EHV A;  1AAR A;  3CF6 E;  2K39 A;  1I4G A;  3P63 A;  2JVC A;  1OQY A;  4N9F 4;  4F8C B;  4B0E A;  3RZW C;  4ZRQ A;  3CWI A;  2LGX A;  5EDS A;  3ENE A;  3AB5 A;  2VH1 A;  3TIX A;  2JYT A;  2L00 B;  2OHF A;  4N6E B;  3P1M A;  2AQ1 B;  3KLS X;  4WJP A;  1VDV A;  3IXS A;  1HZ5 A;  4HCP B;  2CHZ A;  2W3S A;  5BMG A;  1KLU D;  4TSS A;  3SU8 X;  1F0Z A;  4LNF A;  3WCQ A;  3R8B A;  5LNK 1;  4D2K A;  1JWA D;  1I4Q A;  1C3T A;  2WXM A;  3ZTD A;  1NI3 A;  3EC8 A;  2KJR A;  3AM9 A;  3RMK C;  1HZ6 A;  2RMM A;  4ZRK A;  1IGD A;  3DHH C;  3QX1 A;  5MPO A;  1TBE A;  3ZNI D;  2V3S A;  2UYZ B;  2Q5W D;  4HDO A;  4W9D A;  2QMT A;  5JH5 C;  1HE8 A;  3Q8C A;  3ZVV A;  1SSN A;  3MJ5 A;  1XCQ L;  1N62 A;  2EKI A;  2BW2 A;  5H92 C;  4HK2 A;  2KT7 A;  1IBX A;  3NRZ A;  4UDU C;  1JWM D;  1AYF A;  3KWV A;  2DZK A;  2HE7 A;  1XD3 B;  4ICU A;  3AE1 B;  4RM8 A;  4MGI E;  3RNA C;  4ZRI A;  4KKJ A;  4ZDV A;  1WYW B;  4K1R B;  1E7V A;  3UQA A;  3U8Z A;  2J53 A;  2L0T A;  2IO1 B;  2H89 B;  3R66 C;  2HJ8 A;  3PHX B;  2E6X A;  3SFD B;  5IO9 A;  2VZK D;  3PVL A;  4WJO A;  1SJE D;  2LJI A;  3APD A;  2CHX A;  2J52 A;  5LXH A;  1MPE A;  3H7P A;  1L4Z B;  1TKG A;  1V9J A;  1WJ4 A;  1V1P B;  4A55 A;  4A3P A;  3M95 A;  5I4D A;  2WLB A;  2WS3 B;  1GC6 A;  2IO2 B;  4MH8 A;  3VAW A;  1MFW A;  2N1V A;  2L83 A;  3R7R A;  2IZV B;  3N32 A;  3AE5 B;  3N20 C;  2RSU A;  2LGI A;  2JQR B;  1WR6 E;  1GB1 A;  1HQR D;  3R3M A;  4EKU A;  3VR8 B;  1QOG A;  2WNM A;  2WXG A;  1SJH D;  3H8H A;  2JRH A;  3DQV A;  1FPY A;  2EMS A;  2LMC A;  3HVD A;  3IVF A;  2BWF A;  3Q3O C;  4OVU A;  1Y56 A;  1CQV A;  4RGM A;  2FCM A;  4NJ6 A;  4O1N A;  2MBH A;  4BVU C;  4TQ0 A;  4ARC A;  3R7Q A;  3S2A A;  5CHV C;  2JPH A;  2NTT A;  4W9J A;  3NZU A;  3WA0 A;  4BKT A;  4ANW A;  2DZI A;  4L2Y A;  3N3K B;  2AYO B;  3IFW B;  4B0M A;  2LD9 A;  2DZJ A;  3DVN V;  3AMZ A;  1PGB A;  1V5T A;  3OG5 A;  3R2I A;  1HTO A;  2L32 A;  1VRA B;  4HRO A;  4II2 B;  3MFG A;  5D3D A;  1SXT A;  1TYG B;  1R4M I;  4W9K A;  4IOI E;  1UH6 A;  3GE3 C;  3OLM D;  4RFB A;  2KKC A;  4KZ0 A;  1E6E B;  1T0R C;  4Q2J A;  2PMV A;  2IY0 B;  2ZVO A;  1V2Y A;  2OOB B;  3RNG C;  4RMA A;  4DDG D;  4ARI A;  1FNW A;  3QK0 A;  1GC7 A;  2YLM A;  1OEY A;  4WJQ A;  2BPS A;  2JY6 A;  2REX A;  1L7Y A;  2KN4 A;  1K53 A;  5BO4 B;  1FXT B;  3ZRC A;  1SGH A;  4HJG E;  1N61 A;  2NPT A;  4US9 A;  3ABV B;  3QA8 A;  3VQI A;  2M8S A;  3VTV A;  3ZO5 B;  4P1C C;  2WXL A;  2IO0 B;  3AI5 A;  3V05 A;  2KC2 A;  3I57 A;  3DBR I;  1FO4 A;  3OJ4 B;  4R3D A;  1UEL A;  2QIL A;  3CSF A;  1J7B A;  1IP9 A;  1RFA A;  2BGF A;  1WXS A;  4GDK A;  3RUI B;  2DEN B;  3A9J B;  2BF8 B;  2DAF A;  1P0R A;  1YQ3 B;  4RNA A;  2RDB C;  1C4A A;  1WX9 A;  1E9M A;  1SIF A;  3T9L A;  4LK0 M;  2MJ3 A;  2NBV B;  3DBS A;  1QZE A;  1PGX A;  1I4R A;  1ZDV A;  3BIN A;  2RR9 A;  4FHJ A;  4TKN A;  4GLS C;  3PRM B;  3HM3 A;  1WFY A;  1NVI D;  3ZIM A;  3TBL D;  1ZXI A;  1WZ0 A;  1WI0 A;  1WGK A;  3Q69 A;  4FXC A;  3DOW A;  2KWU B;  2MLB A;  4I6N B;  1UUP A;  4HXD A;  2WHI A;  1FCL A;  4LCD E;  3ZQ4 A;  2D11 A;  1PUT A;  3VHT C;  2FUH B;  1I7H A;  4TV3 A;  4IWO A;  1ZGU B;  4JLC A;  3P2B A;  1ZXH A;  3BWU D;  2IBI B;  3Q8F A;  2YEP F;  3DDC B;  5AUK A;  1N63 A;  2GRI A;  2DYM A;  2O6V B;  3DCG A;  3DHG C;  2DYB A;  1TIF A;  2NBU A;  4FAD A;  2XEW A;  2GI9 A;  2XK5 A;  3MHZ A;  2ZNV B;  4ITK A;  1B1Z A;  3BZD B;  1S3S G;  3J9C A;  3VUW A;  2WXP A;  1CJE A;  3DWG C;  1BML C;  2WU5 B;  4DHZ E;  4NQK E;  4FN2 A;  1Q10 A;  4JWU C;  1YOV B;  3NG0 A;  2JZP A;  4GGQ A;  2LEK A;  2W9N A;  3KYD D;  5E6J A;  4LDT B;  4WH4 A;  4DHZ B;  2R2O A;  1WE6 A;  5HG2 A;  1XLP A;  4BOZ B;  2KAC A;  5IAA C;  2BTE A;  2KX3 A;  4YT0 B;  1GOZ A;  3TMP B;  3BY4 B;  4JWS C;  2WWZ A;  1SEB D;  3ZJT A;  2GLS A;  3LJ3 A;  3PRZ A;  4QAY A;  4ZRP A;  4W9E A;  3V3X A;  3UGB B;  3A4S C;  3AE9 B;  1TS4 A;  2NCN A;  4KV2 A;  1TT5 B;  3N9Y C;  1WSP A;  5DPR A;  3PTF C;  4K7W A;  3TUO A;  3AE3 B;  2PLP A;  3UIP B;  2Z0D B;  4A20 A;  3AEF B;  4B95 A;  4W9F A;  4C56 C;  4EFO A;  1XXG A;  1WJ6 A;  2SAK A;  2SEB D;  2V0G A;  2GOW A;  3IT6 B;  3NY5 A;  2V3P A;  4ZYN A;  3QAR A;  2WXQ A;  3ZYY X;  1BXT A;  1EO6 A;  4ICV A;  5BYQ A;  1GPX A;  5HHD G;  1P7F A;  1PQS A;  5FR3 A;  3AEC B;  1F1H A;  2BYF A;  2M0X A;  3GS2 A;  4DWF A;  4M0W A;  1WH3 A;  3L13 A;  3M63 B;  4WWO A;  2EMT A;  4K7U A;  4A3O A;  1I4P A;  1RAX A;  3A9K A;  3AU4 A;  5DPW A;  2N9P C;  3SHQ A;  3PV1 A;  4DXF A;  2KTF A;  3UF8 A;  4TUU A;  4RCO A;  4YSX B;  2KFK A;  3DWM A;  4AS1 A;  1XCT L;  3V60 A;  4N58 A;  3ZLZ A;  3NS1 A;  1V80 A;  1QQR A;  2KNB A;  4PS7 A;  3H9D A;  1MHX A;  4HVB A;  1UZX B;  5D3I B;  1F9J A;  5IOI A;  3AED B;  2CKH B;  4WIP A;  1A70 A;  1EWY C;  3NUH B;  3ZDM C;  2PEA A;  3CST A;  4AJW A;  1ZKH A;  1RLF A;  2BYE A;  3K9O B;  4MGK E;  3RNB C;  3MHS D;  3C0R B;  4MAC A;  4P6V F;  2KFJ A;  1XQQ A;  3P4S B;  2AX5 A;  4ANX A;  1D3Z A;  3RD2 A;  3ETR A;  1SE9 A;  2BB5 A;  5HI1 A;  1P98 A;  4EZJ A;  5AEK B;  1DOY A;  3DVN U;  1NEK B;  1RM6 C;  3AE8 B;  2B3A A;  3RZF A;  1UD7 A;  4HEA 1;  5J2R A;  4GIV A;  1D5Z C;  4G11 A;  3APF A;  4LJP B;  3AV8 A;  1V97 A;  3ML9 A;  5EE3 A;  2LVQ A;  4K3C A;  1UBQ A;  3UI3 A;  2KO3 A;  3AEB B;  3U7Z A;  3PPA A;  4DBG A;  4PK1 A;  3RNE C;  3QQ8 B;  2MBB B;  1NI2 A;  2GMI C;  4ZOH C;  4IW0 A;  4DXA B;  3VRA B;  1XF5 L;  4CQN A;  1KJT A;  2FCS A;  4OW0 A;  4W9C A;  2BKF A;  4MM3 B;  1WJU A;  3BVZ A;  4GSW A;  1UWX A;  1ISN A;  3NHE B;  2Z59 B;  4KIK B;  5AZG A;  2C7H A;  2KQ7 A;  1ZE3 D;  2KMC A;  3NJT A;  2X38 A;  4EOY A;  5IP4 D;  3M62 B;  3FIL B;  2QC8 A;  4W9I A;  2KMM A;  3L16 A;  4G0N B;  4ZHP A;  1K51 A;  2R61 A;  2LI5 A;  4PS8 A;  1D6E C;  5BYS A;  4KKI A;  1FIQ A;  3BK2 A;  1E8W A;  1RFK A;  1TKE A;  2H88 B;  1CZP A;  3SEB A;  1U4A A;  1KLG D;  2J0M A;  4IM3 A;  5FKA C;  5EE9 A;  5LXI B;  4REZ A;  1VR9 A;  4BAX A;  4YWG G;  3VXW A;  1N5W A;  1R4N I;  1OQR A;  1TZO A;  1XLN A;  2WXR A;  1C79 A;  5EE1 A;  2L3Z A;  1ENF A;  1E5W A;  1VZ8 A;  2JT4 B;  2K5P A;  1FM0 D;  3ZKJ C;  3LXF A;  2L0F A;  3PGE A;  2G4D B;  4GDL A;  5AZH A;  4P7I A;  4IUM B;  2AQ3 B;  1J7C A;  4I6L B;  3W1S C;  1OQQ A;  1HTQ A;  3N1Z C;  4BBN C;  2CU3 A;  2K8B A;  4EE2 A;  2BS2 B;  4LJO B;  2LGD A;  3RT3 B;  3NZ3 A;  1WRD B;  4ZRJ A;  2LFI A;  2JRI B;  5GXG B;  3O13 A;  3JSV A;  4RF1 A;  4OZC A;  1GB4 A;  1FRR A;  1ZP0 B;  3Q8B A;  4MT5 A;  1YX6 B;  4WJN A;  1AWD A;  4FA6 A;  2ZCC A;  4M01 A;  2XNA C;  2Y5P A;  2AQ2 B;  2NVU I;  1JQ4 A;  1E7P B;  2LZ6 A;  4PYZ A;  1L6V A;  1PDX A;  1M94 A;  4K81 A;  2LUM A;  1GUA B;  3A1Q B;  3RNF C;  3H7S A;  1SF0 A;  2J0K A;  3HK0 A;  4DQO C;  4EUT A;  2WU2 B;  3DBL I;  2PE6 B;  3UIN B;  4P1B C;  4H2A A;  1FXI A;  4F1S A;  1QKZ A;  3Q3M C;  2IYD B;  3AEA B;  2I1J A;  2MWS B;  2LHD A;  1IGC A;  1MG4 A;  2I2Y A;  3MP9 A;  3P42 A;  1L0X B;  3C19 A;  4XC2 A;  1DOX A;  1VCB A;  1ET9 A;  1L2N A;  3ZNZ B;  1JRO A;  1F2R C;  3L0W B;  4OHJ A;  1SBB B;  5LLI A;  3RN9 C;  1EU3 A;  1WYG A;  1QLB B;  3NVW A;  3LDZ E;  1ET6 A;  1EM7 A;  3PO0 A;  3APC A;  2MBO A;  4EZK A;  3GZN B;  1YNT E;  1HXY D;  2BYV E;  4US8 A;  1UF0 A;  2N9L A;  1WX8 A;  3KYC D;  4OZA A;  3DVG X;  1TY0 A;  5E6O A;  1VD2 A;  1YJJ A;  4MEM A;  1IPG A;  2WDR B;  1YN4 A;  2KWD A;  2K8H A;  4MGZ E;  3X23 A;  2AEH A;  2K3U A;  4KZC A;  2MA9 B;  3QHT A;  4NNJ B;  2N0S B;  1C1Y B;  3VDZ A;  2X8X X;  1WIA A;  4HDQ A;  3BVG A;  3AEG B;  2OJW A;  3VRB B;  2BBC A;  4YTN B;  4C7Y A;  1V8C A;  2M4N A;  3DBH B;  3R2T A;  3HVZ A;  2YVC A;  3N1X C;  4BOS C;  2KVZ A;  3E9S A;  4KDI C;  4EEW A;  2L8J A;  2MBE A;  4BKS A;  3SFE B;  1NYQ A;  3JVZ X;  4GN1 A;  1YD8 U;  1I35 A;  4YL8 A;  1YX5 B;  4M02 A;  2WGS A;  5TR5 A;  5KHQ A;  4MH0 E;  2G4S A;  2NMQ A;  2Z8L A;  3P4P B;  4CO7 A;  4ACF A;  4MJS B;  1TGZ B;  2ZEQ A;  3WAP A;  4LLG M;  2V4I B;  2W55 A;  3NVY A;  3HM6 X;  2IGG A;  2RPQ A;  5KHO A;  4A6Q A;  4P16 A;  1CK1 A;  1C4P A;  2JZ3 B;  2M0A A;  1QF6 A;  1WMH B;  4WQM A;  1EF1 A;  2VRR B;  2AL6 A;  2ZPY A;  1KFY B;  5E6P A;  2M17 A;  4NQL B;  1A5R A;  2D3A A;  4ANV A;  2WXI A;  4NY0 A;  4XDC A;  2WXH A;  2JXT A;  4LNN A;  2OJR A;  3ZW3 A;  1WZ3 A;  1TJE A;  2KTR B;  1WXV A;  1ESF A;  2MP2 B;  3U2S C;  1TTN A;  2W3R A;  2W54 A;  4WWM A;  4ASW C;  2E3T A;  2ZNV C;  2QDF A;  2KQ4 X;  4G3X B;  4GXB A;  3KUZ A;  4WAA A;  3JW0 X;  4F7Z A;  4JPS A;  1SB3 C;  1TS5 A;  2CHW A;  2INP E;  1I42 A;  1ROE A;  1ACC A;  2BT6 A;  2N9K A;  5HFY A;  4DK5 A;  2GBJ A;  1WGG A;  2PIA A;  4CYE A;  1CMX B;  2FAZ A;  1FRD A;  3W1S A;  4PS3 A;  4IG7 B;  3EUB 2;  2A4Z A;  1WXM A;  1V1P A;  2RDG A;  1TS2 A;  2ASQ A;  1E0Z A;  2Y3A A;  3Q3F A;  1QOA A;  3DVG Y;  3AU5 A;  4BBN F;  2K6D B;  1H8C A;  4TMA B;  5J18 A;  1YJI A;  3WAN A;  1WGD A;  2IO3 B;  4A8X C;  3IBE A;  1K50 A;  3A4R A;  2KC1 A;  1WE7 A;  2MBQ A;  4DHJ D;  4W9L A;  3VVW B;  1M4V A;  3TEY A;  1V1O A;  2KAJ A;  2C7M B;  2JXX A;  4URK A;  5AUI A;  4J3O D;  4JQW C;  1YN5 A;  4IM2 A;  1FD6 A;  2FID A;  3RPF C;  2WXK A;  3CIR B;  3V62 A;  3KW5 B;  3TEW A;  4HKQ A;  1JRU A;  1P9D U;  1L0V B;  2MQJ A;  2KOX A;  2G1E A;  2N7E A;  2O2V B;  1FMA D;  1WR1 A;  3IHP C;  3A33 B;  2K9X A;  3U30 A;  1EWC A;  2ACZ B;  3BII D;  3CMM B;  3VR9 B;  3VH4 B;  5TSS A;  3OJ3 A;  4RGO S;  2JUO A;  3AE2 B;  2C60 A;  4NAW B;  1MI0 A;  4K7S A;  4A90 A;  2KQS A;  3PZD A;  3PZ8 A;  4MDK E;  1J0G A;  1J7A A;  2BS3 B;  2EKE C;  1VLB A;  3I63 C;  4IC7 B;  3H6N A;  4WWN A;  2K1F A;  1IYF A;  3TJP A;  2KDE B;  1TZ1 A;  3N30 A;  1XO3 A;  4GMV A;  4FLH A;  4PT5 A;  3JYU A;  4IM0 A;  4FJV B;  2GBN A;  2DAJ A;  4RM9 A;  3WAL A;  1FNU A;  1E8Y A;  3HHM A;  5DPS A;  1FNV A;  5DCN A;  3W5U B;  3PLV A;  4ZYS A;  2N1W A;  2PW9 A;  1H4R A;  4LNO A;  2B76 B;  4LNI A;  2RGF A;  1K52 A;  3W1Y A;  3KUD B;  3A9J A;  2FUG 1;  1TY2 A;  1VJK A;  4C4V B;  5CHW A;  2BWE S;  2BYT A;  3Q2A C;  3KVF B;  3WAO A;  1WM3 A;  3Q3J A;  1DGJ A;  5HKH A;  5DPT A;  4DDI D;  4XGA B;  3VUY A;  4B6W A;  1OEY J;  5D94 A;  2BQQ A;  2IGD A;  3PS6 A;  1LFD A;  3TEZ A;  3Q8E A;  2JYE A;  3GP7 A;  2K6Q A;  1T5X D;  1Q0W B;  2JSV X;  3ZGZ A;  1Y8R C;  2INC C;  3RCZ A;  2GB1 A;  4KGS A;  1V86 A;  2FCN A;  5IKC M;  5D6J B;  5BMH A;  1C9F A;  2LJ5 A;  2ZZP B;  5CHF A;  3X0W A;  1LM8 B;  4NJC A;  4USA A;  3NOB A;  2WXF A;  3T3N A;  2FCQ A;  2O6V A;  1ZPS A;  4AJY B;  3P4R B;  4X57 B;  1WY8 A;  1R4M B;  4XX5 A;  2J4X A;  2WX1 A;  5H8Y E;  4JGH B;  3KWL A;  3ZDT A;  3ZRF A;  1C4C A;  3ML8 A;  2A5U A;  2QCZ A;  2K22 A;  2IDY A;  2HTM E;  2PTL A;  1YJ1 A;  1IBX B;  3FC4 A;  5C1Z A;  3QWZ B;  1C78 A;  1NDD A;  1OFF A;  2MJE A;  2LXA A;  2J0J A;  3AH7 A;  1D4B A;  1GNU A;  2V9H A;  5J17 A;  1GJZ A;  2LVO A;  3OWE B;  2ZPN A;  2M1M A;  2IPK D;  4NZL B;  3ZUN A;  3BYY B;  3FAH A;  2CJO A;  3C8Y A;  3AE7 B;  2DNF A;  4W9G A;  3DBR B;  3UQB A;  4YSY B;  4WWP A;  2G3Q B;  2LGS A;  3H7P B;  2I38 A;  4RGN A;  3L4P A;  4L23 A;  2MH7 A;  4KX6 B;  1MHH E;  2MCN B;  5CX3 A;  1LO5 D;  2INN E;  2DWQ A;  3TSS A;  4YSZ B;  3DHI C;  3M3J A;  2RPV A;  2NTS A;  2DLB A;  2JF5 A;  4NPN A;  1E10 A;  1QT9 A;  2MW5 A;  1T0Q C;  2WXJ A;  5T8I A;  2ZJD A;  4J6I A;  3W5V B;  3LB8 C;  4IDI A;  2LGY A;  3V6E B;  4A9A A;  1L0Y B;  1UWM A;  2FE8 A;  2WDT B;  2UU7 A;  2NBW B;  2QEJ C;  3ONS A;  2Z0E B;  2MRP A;  2VZK B;  4G50 A;  4C80 A;  2IJ0 A;  3ALB A;  2Y5C A;  3RFZ B;  3MTN B;  3I5J C;  1R7S A;  3W9C B;  2Y5B B;  2DBY A;  1QOB A;  4HKZ E;  3WAM A;  3MC9 A;  4ANU A;  3QAQ A;  1BUI C;  2JU6 X;  4OVV A;  4NAM A;  2KX0 A;  2V3N A;  2HDE A;  3PZ7 A;  2KMA A;  1WF9 A;  1D5X C;  2JZZ A;  2TSS A;  4FHK A;  2C9W B;  1FXA A;  4BZA A;  2KAN A;  4FUL A;  4FJZ A;  3O65 B;  5C3J B;  2FNJ B;  1V5O A;  1RWS A;  2QSD A;  3IG3 A;  1T0S C;  2QHO A;  4FBJ B;  2ON8 A;  1UGJ A;  3NZS A;  2WP9 B;  2K8C A;  3L10 B;  1KTK A;  1GAQ B;  2NPT B;  3Q6B A;  2WXO A;  4W9H A;  5E6N A;  2ZCB A;  3VTW A;  2KDB A;  3H1U A;  2HTH A;  3HRD D;  1E8Z A;  3URY A;  2LRW A;  2XBB C;  1NBF C;  2BVC A;  3KQ4 A;  4DXG A;  3TEX A;  4KGR A;  2G45 B;  1EF5 A;  1QOF A;  3AEE B;  4GDK B;  4HWI B;  2KJ6 A;  1N5X A;  2M56 B;  1N60 A;  4MGY E;  2LUE A;  2N7J A;  3ZXR A;  1MG8 A;  5JHB A;  5G2N A;  3KUC B;  1KOT A;  1KH0 A;  4BKS D;  2PE9 A;  2KDF B;  2D2Q A;  3U7D A;  4M8N A;  1L6U A;  1KF6 B;  1I4X A;  2GBR A;  2HJ1 A;  1Q1O A;  1RYJ A;  4XYC A;  2D5G A;  2MSE D;  3Q14 C;  3BVM A;  1F52 A;  4B9K A;  1I4H A;  2DZM A;  5GMV A;  1SE3 A;  3L54 A;  4MM3 A;  1G6J A;  2QJL A;  2YEP B;  2WXN A;  1JWS D;  1FEH A;  1ZUD 2;  3AE6 B;  4TQ1 A;  4KIK A;  2KVR A;  3B0A A;  2LRU A;  2BKR B;  3FIL A;  4GB9 A;  2I1K A;  2DYO A;  1WM2 A;  5FK9 C;  1JRP A;  1V6E A;  3PRE A;  3VH3 B;  2V4L A;  1ZDX A;  2XK5 B;  1PGA A;  3BK1 A;  2D10 A;  1K8R B;  2CJN A;  4E71 A;  3SDL C;  3ZNH B;  2DX5 B;  4GOC A;  3VUX A;  4JE3 B;  1YN3 A;  3ECI A;  4LNK A;  2KLC A;  3QIJ A;  4HJK A;  4NJ7 A;  2KDI A;  3EA6 A;  3ZJV A;  2KJH B;  4AP4 C;  1ZOY B;  2NR2 A;  5CTR C;  3T8M A;  2MEK A;  1P1A A;  3UIO B;  4FJY A;  4AQ7 A;  3QC8 B;  2RD0 A;  2NS5 A;  2D3G A;  5EE0 A;  1PFD A;  2CU1 A;  3I9V 1;  1N6Z A;  2KZR A;  1YMH E;  3RI7 C;  1WGR A;  4DHJ B;  1WGH A;  2AWT A;  2DHZ A;  2WYQ A;  4RF0 A;  1Z2M A;  5AZF A;  1DOI A;  4MSQ B;  2KN5 A;  1UGM A;  1YIW A;  4CHK A;  1JCK B;  3ZNG C;  2KDM A;  4BKG A;  1V49 A;  4JIO U;  2KYW A;  2L05 A;  5IA7 A;  4K3B A;  1TS3 A;  5JHA A;  3GB1 A;  2L1A A;  2MHJ A;  3AE4 B;  3A1Q A;  2LAS A;  3MC0 B;  1JW9 D;  5FR6 A;  2RDH A;  4EZL A;  3ZJU A;  3QCA A;  4RH6 A;  2PKO A;  3AXC A;  4XWW A;  5C2T B;  1FFU A;  1SE2 A;  1YQB A;  2C7N B; 
#chains in the Genus database with same CATH homology
 1WM3 A;  2C7H A;  2KQ7 A;  3N32 A;  3Q3J A;  2KMC A;  4M0W B;  2RSU A;  2CS4 A;  1WR6 E;  3DPD A;  5HKH A;  5DPT A;  4EOY A;  3M62 B;  3VFK A;  3R3M A;  4W9I A;  4DDI D;  4EKU A;  2V1Y A;  3L16 A;  3VUY A;  4G0N B;  4B6W A;  1LXD A;  1OEY J;  2JRH A;  2LI5 A;  3DQV A;  4PS8 A;  5D94 A;  2EMS A;  3EEC A;  1E8W A;  3IVF A;  2BWF A;  3PS6 A;  3QJZ A;  4OVU A;  1LFD A;  3A9K B;  4GU2 A;  5C23 A;  4KSK C;  2KXJ A;  2FCM A;  2K6Q A;  4NJ6 A;  1U4A A;  2LXC A;  2J0M A;  4IM3 A;  2MBH A;  4E3C A;  3L08 A;  2KFK B;  4BVU C;  1Q0W B;  3OAW A;  4TQ0 A;  3R7Q A;  3S2A A;  5CHV C;  2JPH A;  1E7U A;  5LXI B;  1Y8R C;  4W9J A;  3VXW A;  1R4N I;  3NZU A;  3WA0 A;  1J19 A;  3RCZ A;  4BKT A;  2N9X A;  1BT0 A;  2GBK A;  3PHW B;  4ANW A;  2DZI A;  4WQO B;  1V86 A;  2FCN A;  5D6J B;  2L3Z A;  3N3K B;  2AYO B;  1E5W A;  2LJ5 A;  2JT4 B;  2ZZP B;  3IFW B;  5CHF A;  1KM7 A;  1LM8 B;  2DZJ A;  2LD9 A;  3DVN V;  3ZKJ C;  3X0W A;  3NOB A;  1V5T A;  2L0F A;  3PGE A;  2G4D B;  2FCQ A;  1LQB A;  2O6V A;  4GDL A;  1Z5S B;  2KK8 A;  1V81 A;  5AZH A;  4KSL C;  4P7I A;  4IUM B;  4I6L B;  4AJY B;  4II2 B;  3PLU A;  3W1S C;  5L95 C;  1R4M I;  4BBN C;  2K8B A;  4X57 B;  1WY8 A;  4II3 B;  4IWP A;  4W9K A;  4LJO B;  1UH6 A;  1XT9 B;  2WX1 A;  4XX5 A;  2KLG A;  3OLM D;  2CR5 A;  1J8C A;  2LGD A;  4JGH B;  2JWZ A;  3ZDT A;  3ZRF A;  3ML8 A;  3RT3 B;  2KKC A;  4KZ0 A;  1ZW7 A;  2A5U A;  2N9E B;  1WRD B;  4ZRJ A;  2IY0 B;  2JRI B;  1YJ1 A;  2ZVO A;  1V2Y A;  4MJS A;  2K25 A;  5C1Z A;  2OOB B;  4RMA A;  4DDG D;  3JSV A;  3QWZ B;  1NDD A;  3QK0 A;  1GC7 A;  2LXA A;  1OEY A;  2J0J A;  2YLM A;  2BPS A;  4WJQ A;  2JY6 A;  1YX6 B;  4WJN A;  4M8M A;  2REX A;  4FA6 A;  1GNU A;  1L7Y A;  2ZCC A;  5J17 A;  1GJZ A;  3I3T B;  2LVO A;  3K9P B;  5BO4 B;  2ZPN A;  1FXT B;  2NVU I;  2D07 B;  2M1M A;  4PYZ A;  2LZ6 A;  3ZRC A;  1SGH A;  1M94 A;  2NPT A;  4K81 A;  1WMH A;  3ZUN A;  1GUA B;  3A1Q B;  3QA8 A;  3H7S A;  3VQI A;  2M8S A;  2J0K A;  3VTV A;  3HK0 A;  3ZO5 B;  4EUT A;  1UBI A;  3DBL I;  3UIN B;  1WJN A;  2PE6 B;  2IO0 B;  3AI5 A;  2AL3 A;  3EFU A;  2KC2 A;  2LVP A;  3B1L X;  3DBR I;  4F1S A;  3OJ4 B;  4W9G A;  1UEL A;  2IYD B;  3UQB A;  2I1J A;  2MWS B;  4WWP A;  2G3Q B;  3CSF A;  3R7R A;  1IP9 A;  1RFA A;  1T0Y A;  2BGF A;  2MX2 A;  3H7P B;  1KLV A;  1WXS A;  4GDK A;  3RUI B;  2DEN B;  3A9J B;  2KTR A;  4XC2 A;  4MSM B;  2BF8 B;  3V61 A;  1VCB A;  1P0R A;  2DAF A;  2MP2 A;  1OGW A;  2O6V D;  3ZNZ B;  1L2N A;  3L0W B;  5LLI A;  1WX9 A;  2MCN B;  5CX3 A;  1SIF A;  2LWP A;  3T9L A;  5L83 A;  3LDZ E;  4AWJ A;  1S1Q B;  3APC A;  3M3J A;  2NBV B;  3DBS A;  3GZN I;  1QZE A;  2JF5 A;  2MBO A;  4NPN A;  4EZK A;  2MW5 A;  3BIN A;  2BYV E;  2RR9 A;  4FHJ A;  4TKN A;  4BFR A;  3PRM B;  1WX8 A;  2C5L C;  2ZJD A;  3HM3 A;  3KH0 A;  3KYC D;  4J6I A;  1WFY A;  3ZIM A;  2L76 A;  3TBL D;  1WZ0 A;  3DVG X;  2LGY A;  5E6O A;  3V6E B;  1VD2 A;  3AUL A;  1WI0 A;  4XZ4 A;  4MEM A;  1IPG A;  3DOW A;  1WX7 A;  2WX0 A;  2KWU B;  2MLB A;  4I6N B;  2WDT B;  4HXD A;  4LDT D;  2NBW B;  2K8H A;  4MGZ E;  1RRB A;  3ONS A;  4LCD E;  2D11 A;  2Z0E B;  2MRP A;  4G50 A;  3X23 A;  3VHT C;  3RUL A;  2AEH A;  4MEL A;  2FUH B;  3B08 A;  4KZC A;  4TV3 A;  4IWO A;  1ZGU B;  2MA9 B;  3QHT A;  4JLC A;  4NNJ B;  3P2B A;  3ALB A;  1C1Y B;  2IBI B;  3VDZ A;  4KVG B;  5D2M B;  1WIA A;  4HDQ A;  3DDC B;  5JZE B;  3WIM A;  1WGY A;  3DBH I;  2DYM A;  2O6V B;  5G55 A;  3MTN B;  4GDL B;  4KIK B;  2M4N A;  3DCG A;  2YVC A;  2Y5B B;  2DYB A;  4BOS C;  4KDI C;  2NBU A;  4FAD A;  3MJW A;  2XEW A;  2XK5 A;  4EEW A;  2L8J A;  2ZNV B;  3WAM A;  2MBE A;  4BKS A;  4HLE A;  3HIZ A;  4ANU A;  1S3S G;  3NS8 A;  4E74 A;  3QAQ A;  3VUW A;  3JVZ X;  4GN1 A;  3ZTC A;  2L7R A;  1Q5W B;  1YD8 U;  3PT2 B;  4OVV A;  2FIF A;  4YL8 A;  1I35 A;  4AUQ C;  1YX5 B;  2KX0 A;  4HPM B;  5TR5 A;  2KWV B;  2KMA A;  5KHQ A;  4MH0 E;  3PSE B;  1WF9 A;  1X1M A;  2G4S A;  2JZZ A;  3GOE A;  4NQK E;  4FN2 A;  4FHK A;  2PPH A;  4DHZ E;  2C9W B;  2KAN A;  4KDL B;  4CO7 A;  4GGQ A;  4FUL A;  4MJS B;  4FJZ A;  2W9N A;  3O65 B;  1TGZ B;  2ZEQ A;  3JSV B;  3WAP A;  3KYD D;  2O2V A;  1P3Q U;  2KD0 A;  2FNJ B;  1V5O A;  3HM6 X;  4LDT B;  3IG3 A;  2RPQ A;  5KHO A;  4DHZ B;  2QHO A;  4JL9 A;  4FBJ B;  4HCN B;  2R2O A;  3SD5 A;  3NZS A;  1WE6 A;  4PYU A;  2PJH A;  2K8C A;  3L10 B;  4BOZ B;  2JZ3 B;  2KHW B;  1WXA A;  2NPT B;  5IAA C;  1WMH B;  2KX3 A;  1EF1 A;  4W9H A;  2VRR B;  1OTR B;  3TMP B;  2N7D A;  5E6N A;  1GG3 A;  2AL6 A;  2ZPY A;  3BY4 B;  4NAW A;  2GBM A;  2ZCB A;  2WWZ A;  5E6P A;  2KDB A;  2M17 A;  3VTW A;  3H1U A;  3PRP B;  2HTH A;  3LJ3 A;  4NQL B;  1E8Z A;  3PRZ A;  1A5R A;  4ANV A;  2LRW A;  4NY0 A;  4W9E A;  2XBB C;  1NBF C;  2HD5 B;  2ZVN A;  3UGB B;  2OJR A;  3A4S C;  2G45 B;  1EF5 A;  2NCN A;  3ZW3 A;  4KV2 A;  1WZ3 A;  4GDK B;  3L17 A;  4HWI B;  2KTR B;  4I6P A;  2KJ6 A;  1WXV A;  5DPR A;  2MP2 B;  3PTF C;  1TTN A;  3TCA A;  4K7W A;  1EUV B;  4MGY E;  2UWQ A;  3RYT A;  4IWQ A;  2LUE A;  3UIP B;  3V6C B;  1MG8 A;  4ASW C;  3D32 A;  2J7Q B;  5JHB A;  3VTU A;  5G2N A;  3KUC B;  2KWC A;  1KOT A;  2ZNV C;  4BKS D;  2PE9 A;  2KDF B;  2Z0D B;  4A20 A;  2N4F A;  4G3X B;  2D2Q A;  4GXB A;  4W9F A;  3TL5 A;  4B95 A;  4EFO A;  3U7D A;  3KUZ A;  1WJ6 A;  3JW0 X;  4M8N A;  4WAA A;  4F7Z A;  2CHW A;  2IY1 B;  1E8X A;  1I42 A;  2GBR A;  2GOW A;  3NY5 A;  5D7G A;  2R2Q A;  4HPL B;  4ZYN A;  2GBJ A;  3QAR A;  4DK5 A;  1Q1O A;  1WGG A;  4CYE A;  1CMX B;  2FAZ A;  3W1S A;  2MSE D;  1EO6 A;  4AOF A;  4ICV A;  4PS3 A;  4IG7 B;  4B9K A;  2A4Z A;  1WXM A;  2DZM A;  5GMV A;  1E90 A;  2ASQ A;  1PQS A;  3L54 A;  4MM3 A;  1G6J A;  3EHV A;  3Q3F A;  1AAR A;  3CF6 E;  2K39 A;  3DVG Y;  2JVC A;  4TQ1 A;  1OQY A;  4KIK A;  3AU5 A;  4N9F 4;  4BBN F;  2K6D B;  2KVR A;  2BYF A;  4F8C B;  1H8C A;  3B0A A;  3RZW C;  5J18 A;  2M0X A;  4DWF A;  3WAN A;  2LRU A;  1WGD A;  2IO3 B;  2BKR B;  2LGX A;  1WH3 A;  2I1K A;  4GB9 A;  3IBE A;  2DYO A;  3L13 A;  3A4R A;  3M63 B;  1WM2 A;  5EDS A;  2KC1 A;  3ENE A;  3TIX A;  4WWO A;  2EMT A;  1WE7 A;  2L00 B;  2MBQ A;  4DHJ D;  1V6E A;  3PRE A;  4W9L A;  3VH3 B;  3VVW B;  4WJP A;  4K7U A;  4A3O A;  1RAX A;  3A9K A;  3AU4 A;  5DPW A;  2V4L A;  4HCP B;  2CHZ A;  2N9P C;  2C7M B;  2XK5 B;  3SHQ A;  3PV1 A;  2JXX A;  4URK A;  2KTF A;  3UF8 A;  4TUU A;  4JQW C;  4IM2 A;  2KFK A;  2D10 A;  2FID A;  1K8R B;  3V60 A;  3SU8 X;  4E71 A;  3SDL C;  3V62 A;  3ZLZ A;  3KW5 B;  3ZNH B;  1V80 A;  2DX5 B;  4GOC A;  2KNB A;  1JRU A;  4PS7 A;  1P9D U;  3VUX A;  1C3T A;  3H9D A;  3ZTD A;  3ECI A;  2MQJ A;  2KOX A;  2KLC A;  3QIJ A;  2N7E A;  3EC8 A;  2KDI A;  4HJK A;  4NJ7 A;  4HVB A;  2KJR A;  1UZX B;  2KJH B;  4AP4 C;  2O2V B;  1F9J A;  1WR1 A;  2NR2 A;  5CTR C;  2CKH B;  3T8M A;  3IHP C;  1P1A A;  4ZRK A;  3UIO B;  4FJY A;  3ZDM C;  2PEA A;  3CST A;  3A33 B;  3QC8 B;  4AJW A;  1ZKH A;  2RD0 A;  3U30 A;  1RLF A;  2BYE A;  3K9O B;  2NS5 A;  3QX1 A;  4MGK E;  3MHS D;  2D3G A;  3CMM B;  1TBE A;  3VH4 B;  3C0R B;  3OJ3 A;  2KFJ A;  3ZNI D;  2JUO A;  2CU1 A;  2V3S A;  2C60 A;  2UYZ B;  4HDO A;  4W9D A;  5JH5 C;  1HE8 A;  4NAW B;  1XQQ A;  2KZR A;  4K7S A;  4ANX A;  3ZVV A;  1D3Z A;  1WGR A;  3RD2 A;  4DHJ B;  1WGH A;  1SE9 A;  2KQS A;  3PZD A;  2AWT A;  2DHZ A;  1P98 A;  4EZJ A;  5AEK B;  4MDK E;  4HK2 A;  1J0G A;  2WYQ A;  3DVN U;  1Z2M A;  5AZF A;  2EKE C;  2B3A A;  4MSQ B;  2KN5 A;  3RZF A;  1UD7 A;  3H6N A;  4IC7 B;  2K1F A;  4WWN A;  1UGM A;  2DZK A;  1IYF A;  5J2R A;  1YIW A;  3TJP A;  4CHK A;  2HE7 A;  3ZNG C;  1XD3 B;  4GIV A;  4BKG A;  1V49 A;  4JIO U;  2KDE B;  4ICU A;  1TZ1 A;  3N30 A;  4GMV A;  4RM8 A;  4G11 A;  3APF A;  4MGI E;  4ZRI A;  4FLH A;  2L05 A;  4LJP B;  5IA7 A;  5JHA A;  4ZDV A;  1WYW B;  3JYU A;  4K1R B;  4IM0 A;  1E7V A;  3UQA A;  3U8Z A;  4FJV B;  2GBN A;  2L0T A;  2IO1 B;  2DAJ A;  3A1Q A;  4RM9 A;  3ML9 A;  3WAL A;  2LAS A;  3R66 C;  2LVQ A;  1E8Y A;  2HJ8 A;  3PHX B;  5FR6 A;  1UBQ A;  4EZL A;  2KO3 A;  3PVL A;  3HHM A;  3PPA A;  4WJO A;  5DPS A;  3APD A;  2CHX A;  3QCA A;  5DCN A;  4DBG A;  3QQ8 B;  2MBB B;  3AXC A;  3PLV A;  2N1W A;  1NI2 A;  1H4R A;  2GMI C;  5LXH A;  4IW0 A;  4DXA B;  2RGF A;  3H7P A;  3W1Y A;  3KUD B;  1V9J A;  1YQB A;  1WJ4 A;  3A9J A;  1KJT A;  2FCS A;  4A3P A;  3M95 A;  4W9C A;  2BKF A;  5CHW A;  1GC6 A;  1WJU A;  2BWE S;  2IO2 B;  4GSW A;  3VAW A;  2C7N B;  3KVF B;  1ISN A;  2N1V A;  3WAO A;  3NHE B;  2Z59 B;  5AZG A;  2IZV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...