1ENFA

Crystal structure of staphylococcal enterotoxin h determined to 1.69 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
212
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN H
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 71
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2000-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1enfA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1enfA02
1FGBD 1SJHD 1LTSD 1PRTD 1SE4A 1TY2A 1PTOC 5TSSA 4RHSA 3OWEB 2G9HD 2XRQD 2RDHA 1HTLD 2AQ1B 1PTOF 5D3DA 3MC0B 5D3IB 1BCPC 3O13A 1MD2D 1SXTA 1I4PA 1I4GA 1LTBD 3W2DA 1ESFA 1LO5D 1LTID 1JQYD 2QILA 5ELCA 3BVZA 1BCPF 3DWAA 1FNWA 1PTOH 1LTRD 3TSSA 4DXGA 1TS4A 1L0YB 1S5DD 3BZDB 2SEBD 5ELDA 1JWSD 1DJRD 1LTGD 1EFID 2RDGA 3DWQA 5ELEA 3R8BA 1PTOD 2AQ2B 1BXTA 1LTTD 3EFXD 1QILA 1S5CD 1F77A 1D5ZC 1LT3D 1LLRD 1V1OA 3BVGA 3KLSX 3R2TA 1PRTB 1PZKD 1BCPD 1ENFA 1ET9A 1JCKB 1SE3A 2CHBD 1D6EC 1D5XC 4RGMA 1LT4D 3DWPA 2AQ3B 1KLUD 1CT1D 3R2IA 2WV6D 2J4XA 1EU3A 4K6LA 1FNUA 1JWMD 1T5XD 3V05A 1EU4A 1SEBD 1RDPD 5FK9C 1HA5A 5I4DA 4ZYSA 1PZJD 1S5ED 1G8ZD 5ELFA 4NZLB 2XN9C 1HQRD 1KTKA 2TSSA 4BWGB 3SEBA 5FKAC 2NTTA 5ELBA 1PZID 2Z8LA 4RHRA 1LT6D 1LTAD 2R61A 1SJED 1PTOB 3URYA 1CHPD 1B44D 1M4VA 1TS3A 4L6TB 1V1PB 1ET6A 2IJ0A 2XNAC 1RD9D 1UUPA 1TY0A 1CK1A 1L0XB 1SBBB 3GP7A 4OHJA 3EA6A 1PYWD 4O1NA 3BYYB 3BVMA 1S5BD 1I4QA 1SE2A 1V1PA 4TSSA 1I4RA 3MFGA 2NTSA 1LT5D 1XTCD 1AN8A 1S5FD 1D5MC 4RGTA 4RGOS 4L63B 1RF2D 1XXGA 1JWUD 4DXFA 1YN5A 4UDUC 1UNSA 1EEFD 1KLGD 1I4HA 1PRTC 1I4XA 1JR0D 1TS5A 1EWCA 1STEA 1FD7D 1FNVA 1HXYD 1B1ZA 1EEID 1TS2A 1PRTF 4Z9CB 4RCOA 2ICIA 4C56C 1BCPB 2QEJC 4RGNA 1RCVD 1DYQA 1YN3A 1CHQD 2XRSD 1GOZA 1AW7A 4RFBA 4RH6A 2O2LD 1CQVA 1YN4A 3CHBD 3BYTB 2IPKD
chains in the Genus database with same CATH superfamily
1FGBD 2ALYB 4JK1C 4F7ZA 3P2BA 2GB1A 3GDEA 2Q5WD 2N9XA 3K5LA 1SE4A 3DEOA 3S1RB 1U4RA 3F1ZA 4BY1B 3N6RA 2B2UA 1N60A 4G7OC 3OWEB 2O6VB 3AM9A 4HPMB 1XEEA 1CSPA 5C44H 2VNUD 2DY8A 3J81L 4B9WA 3I57A 1BOSA 1P7EA 5CX3A 1EY4A 4ASWC 4B6WA 4DV1Q 4YTPB 2MGSA 3P1HA 3KH0A 3W2DA 4WJWA 4Y52H 3A74A 1V5TA 4G50A 1OQYA 2OJRA 4JV5L 4JI5Q 1VF5C 2J0TD 3VTVA 1UD7A 1TS4A 1LM0A 4LK1C 4DR3Q 1IBXA 2B2TC 3C3LA 3JSVA 1SYCA 4YCWA 1WTPA 4OW0A 1E7VA 3M62B 1F2ZA 3IBEA 3ZJYC 4JBWA 4X57B 1OTRB 1WI5A 3HOZH 4A3GH 3DHIC 5I6WA 3B9JA 3SHQA 3S2HH 2ZCBA 1YHBA 4DV3Q 4A3BB 1PZKD 1XLPA 4KMUC 2JK8A 4DR6L 3PO2G 4RWSC 3S1MB 1LT4D 2KOXA 4J15A 4OX9L 1JRPA 2KQ4X 5IOCA 3HOVH 2K14A 1IXRA 4A93G 4EQPA 2DZMA 2CJNA 4WJ4A 1TWGH 2J52A 3B2FA 4S0RA 1TXYA 2KEDA 1HNXL 2JQRB 3WALA 3ONSA 1YZ6A 4ZYSA 3L2PA 3Q2AC 1PZJD 1I6VC 3OHXC 3QJYA 1AZQA 3KUCB 4DAPA 4ARCA 2X69A 2CCZA 3Q14C 4GDKA 3RULA 4MH8A 5EBCA 3E9SA 3AEDB 4M8AA 1TU2B 3T4AC 1Y8PB 3UE0A 4IJLA 3PIPA 3QO2A 2IBIB 1D1IA 2EMSA 2A69D 4R4CA 5I2XA 4DV4L 2JZPA 5GMVA 2PMZE 3ZXVA 3S9WA 1CHPD 1M4VA 1S40A 1T0RC 5E3FA 3F2BA 4WWNA 1ET6A 2HT1A 1B53A 3HRDD 3A1QA 3PTFC 1KLVA 1L0XB 4OWXB 1CZWA 4C1NI 5C0XJ 1OXTA 4IUTA 4CO7A 2MFIA 3RNAC 3QQ8B 5AJ3Q 3G4SA 2VS1A 1CKNB 1Q8IA 1SMXA 1AN8A 2EJFC 4E6IA 3RT3B 3CRKC 4QJFA 4WAAA 3CQZB 2JA8H 2KHJA 3VUXA 4KD3A 1QOGA 1K8RB 2R7ZH 5G5GA 3M7NA 5JJIA 4W9FA 3HRZC 4JI8Q 1STEA 4OEMB 4H7BA 1CA5A 5IP9G 1SMYD 3JAMi 4HK2A 1EY9A 3D31A 4WIPA 4JI6Q 2E2HB 1ILPA 4HPLB 1Q3LA 4EGVA 1PHJA 2ICIA 3CAMA 2K33A 3VAWA 2O5IC 2A6ED 1YN3A 4AP4C 2MUYA 1ONLA 2KYWA 4K8JA 3CPWA 1KQSA 3K0XA 2GVBA 4JC0A 3FMCA 1ESRA 1VQ5A 5IGGA 3JAME 1WYDA 3RNCC 1TWHH 3PV1A 2ASBA 2KCMA 2K03A 3ITPA 1MFWA 1FJGQ 3NEMA 2WXQA 3DUZA 4HLEA 1Q10A 2WB1B 2CJOA 3VR8B 4DV1L 1W2BA 4HR7B 1VQKA 2L1BA 4H13C 4DV6Q 1V81A 4RMAA 2CHWA 4KV6A 5J3BA 4CJ0B 2MBHA 2JUOA 3ZNGC 1WRIA 4JI5L 3A9JA 3HFZB 5CV9A 3VDYA 1Y14B 4M0WA 4DR3L 4BKGA 2IGHA 1WRDB 5IGBA 3J81c 1DD2A 1PH4A 1EL0A 4KHVA 2BDOA 3UI3A 1CFMA 1V43A 1FGUA 3OMGA 1CTMA 1LTRD 5E1FA 3TSSA 2LKVA 1UAPA 4CDCC 1K73C 4WJ3M 3PUYA 1FCCC 1ENAA 1S5DD 2KTRB 1G6PA 3AH7A 3FHWA 4LNIA 2PZUA 2B39A 5HGQA 4DV3L 2L0FA 1TKEA 2NBWB 3ZJUA 3HVZA 1PUTA 3W5UB 1HRJA 1PGBA 3TEZA 3R2TA 3V96A 4BY1G 2K5DA 2E2IH 2NVXB 2HDLA 5CHVC 2YLMA 4ABNA 3EQLC 1WTOA 1SE3A 3U4VA 5C4XG 2KFKA 5DPRA 1D1KA 4HPPA 3TJPA 3K5OA 4LF4Q 1J9OA 1TGZB 2BS3B 3HOXH 2HTHA 3AU5A 3PIP3 5HGTA 3NRZA 2FMMA 4GKJQ 1JWMD 1R4MI 1RL2A 3TMEA 2M8SA 3R66C 2MBBB 1E2WA 4LF6Q 1SAPA 5IGFA 3X0WA 2BWFA 4NZLB 4LF9Q 1PH8A 2C5LC 3U8ZA 2YV5A 3MC9A 2AUJD 1J7CA 3RZOH 2J53A 2ZPYA 1STAA 4XTCS 4C4VB 1JJCB 2FMCA 2JJQA 2KECA 1IBKQ 1J7AA 1UF0A 2DYBA 3NVVA 3PPAA 1SYFA 1IW7C 3FKIH 3NY5A 1EFWA 1EF1A 1NDDA 4L6TB 1JB3A 3I72A 4GLAC 2F0VA 3T13A 4K7UA 2ZVNA 4A3BG 2AUKA 1JOQA 5AJ3L 1SBBB 4X64L 3UDIA 5FO9B 3JYUA 3H3VI 5D7GA 4IO9A 4DN4M 3NZUA 2KZRA 2R93B 5JAVA 3ULPA 3ABVB 2L52A 3VYRA 2I5LX 5FLMH 5CGKA 1VJKA 2AKWB 2WS3B 2W3RA 3A4SC 2K1BA 4RGTA 1NE3A 4KV2A 1RF2D 2F0QA 2DNCA 2Q2UA 4IFDH 1PFNA 4LWCA 4RMFA 1LYLA 4LF5L 3BS1A 1E6EB 2LFNA 2BCOA 1TS5A 3GTJB 3NUCA 3GTMB 1KRHA 1N6ZA 3QG1A 1Y1VB 1TS2A 4BKSA 4XWWA 3D0FA 3WOEA 1B70B 1C1YB 4JW0A 4ULLA 2JZZA 2D9UA 3ZNZB 3HOYB 1WXQA 3ZYYX 3R3OA 4HWIB 4WURA 3QC8B 1SYGA 4HDQA 2BKFA 1MHHE 2EKIA 2JY6A 3Q8FA 2A6EC 2L11A 1YNTE 3QJZA 2K6DB 2BYVE 2CKZB 1MSGA 1B9NA 2EXZA 3RR5A 5BO4B 4XGAB 4A3MB 5J17A 4XT3B 4AH6A 2L8JA 1MPEA 5EJWA 3HS0C 1FL0A 1JB7A 1OEYJ 3M4OH 4LNOA 1EQRA 5DNFA 2CW0C 3MAQA 3I4LA 4EX5A 3RUIB 3OLMD 2IZVB 1B9RA 1RFKA 1IZ6A 4FJVB 3O13A 5A2QE 4NJ7A 1EIFA 2RSNA 4POFA 4A3KH 2ON8A 4FHKA 2KN4A 2ZEQA 3AI5A 5KHQA 1ASZA 4JI2Q 4PZ7A 1F2RC 1A6XA 2O5JC 2N1VA 4MGYE 1TT2A 2N9LA 3EC8A 2BVCA 4JBJA 4L8JA 4A3CH 2KDMA 1B4OA 5BYSA 1VQ7A 2C7HA 4KDIC 4XC2A 1PTOD 1TZ1A 4ACFA 2F3VA 3KWLA 1F77A 5LXHA 5NUCA 2C7MB 3K57A 4JBMA 2PTLA 4ANUA 2PCFB 2WB1G 1HHVA 3BK1A 4GKJL 2KC2A 3DVGX 1IBXB 3TBLD 1KOTA 2B76B 1P1AA 2KHWB 1VQPA 1VMCA 2KTFA 2PMZB 3NE5B 3DOWA 5E4WC 3KOJA 1SROA 2LRUA 3DBSA 4LF6L 1T5XD 2PPHA 3EFCA 4WQOB 4KSLC 1EU4A 5K36G 4DV5Q 4LF9L 1LXDA 1A3TA 1UZXB 2JSVX 3PO3B 2KT7A 1EIYB 4YIJA 1X3FA 2KENA 4POGA 2ZM6L 1C76A 3H7PA 3UQAA 4LFBQ 1PMRA 2BKRB 3I9V1 4OGQC 3HUIA 3QIJA 1HQRD 2Y5PA 3ZUNA 3VYUA 1P9DU 1L1OC 4KY6A 3KJPA 1FM0D 3BDCA 3IFTA 2BA1A 3U50C 1K28A 5IKCM 2F0LA 3KBXA 3L7ZC 2CHXA 3E5SA 3JVZX 3KYHC 3IT6B 2QC8A 5G2NA 4R8NA 1KNEA 5EE3A 3VR2A 3U4ZA 3T51B 1NR2A 2WXJA 4JOIC 1RD9D 1L4DB 4A3JG 4XE0A 4HJGE 2A5HA 4X66Q 4GDKB 1E8YA 1OEYA 3UDGA 4RKLA 2N9KA 4M8MA 1D4BA 4CGYB 2ZZPB 2FINB 1EQTA 5AFWA 4B3RL 2F52A 3BYYB 3NQTA 5EPKA 2CR5A 1ZYRC 3NVWA 4BKSD 3SVMA 4II3B 5M3FB 3Q8AA 1WXMA 3NUHB 1UGMA 3WOFA 2RSOA 1GHJA 3UI2A 2KHSA 4DNTB 3AULA 1S1QB 4GNXC 4NP5A 1A0IA 5IT9L 3A1QB 3TL5A 3EJIA 3STBD 3NENA 3HOUH 1Q8KA 1K53A 4K14A 4MT5A 2L1AA 3WDNA 5FLXL 4FHJA 2KVRA 2F4IA 1GUNA 1CM9A 1MBYA 2EOTA 2FIDA 1WX9A 1U9RA 1TIFA 4C56C 1IBML 1BCPB 1WCMH 3VA7A 1V5OA 5C23A 5FR3A 4GKKQ 3W9CB 1CHQD 2W54A 2EYFA 4HCNB 1NI3A 2Z6KA 3M4PA 2BOSA 1C8CA 2LRWA 3PRPB 1HPCA 1HZ5A 2O2LD 1FRRA 2MX2A 5CMDA 2R93G 1Y1WH 1UBIA 2F0DA 4XXEA 1V8CA 2HTME 5G3LF 4C3HH 2JP1A 1TWFH 1EY7A 2A5UA 2RSUA 4BY7B 1A15A 1HUNA 2D10A 2G4DB 4LF8Q 2LHDA 5C4HA 1KH0A 5E6OA 2INNE 2P5ZX 1JJ2A 4II2B 4EZJA 1UE6A 2FUHB 1FO4A 1HTPA 1AP0A 4DDID 4C3IB 2TMPA 2VL6A 1YITA 1E9MA 3EN2A 4JI2L 4QGUA 1A3VA 1VDVA 2L05A 1Y1VG 3AB5A 3AE9B 2OQKA 4HN7A 4X62L 5EBDA 3K0YA 3GTGB 2R92B 1CUKA 4A8XC 2E3TA 3K6OA 3H91A 3HOYG 4DAYB 4S3SA 3FP9A 3HK0A 4C3JB 3MVVA 2ZJRA 2G45B 2WIIB 3HIZA 1DJRD 1LGRA 3QK0A 2V4DA 5M5WH 4A3FH 1NCVA 2K32A 3A9JB 4DHJD 1WM2A 1A62A 1LT3D 3AE3B 1HZCA 4A3MG 5EKKA 4NXMQ 1FXIA 4BBRB 3L54A 3GTOH 2G9DA 2KNBA 2NVQH 1D3ZA 4I7ZC 1WTVA 3E9IA 1F9PA 3CCMA 1JCKB 2SNSA 4IFDJ 1UE5A 4HCSA 2WXPA 2K01A 2N9EB 2SAKA 3DWPA 4APVA 3OWFA 4DUZQ 2RPQA 5BMIA 3EFUA 1W3SA 3UINB 4LFBL 5LL6S 2JT4B 1NBWA 5IGEA 4ZRIA 3MHSD 2BT6A 5I4DA 1KIXA 2LGYA 1QCBD 3SGIA 4JGHB 1J8CA 1S5ED 4UP7A 1QE6A 5IP7H 4A75A 1N36Q 3A8IE 5DM73 1KTKA 1EYAA 4FP5D 4REZA 5C1ZA 3S2DH 2KFKB 3CC2A 1RRBA 4OONA 4RA8A 3A9KA 1O7YA 2M0XA 2D62A 3Q6BA 3B1LX 4QB4A 5KEEA 3LNNA 1X6OA 2LS01 5KNBA 1PTOB 3SDLC 3L16A 3CF6E 2M00A 5KYLA 3CCSA 3URYA 2FE8A 3P1MA 4AQ7A 2LGDA 3RFZB 1TS3A 2WXIA 4XYCA 1KL9A 2NN6H 5DM63 2K5HA 1TY0A 1CK1A 4IPGA 4YCUA 4DK6C 4A3DB 1HEZE 3BDOA 2WXMA 4G11A 3APCA 3UGBB 5JPNC 2I07B 4JI4L 2EKEC 2KMCA 1HE8A 2HD5B 3KFUA 4RM9A 4ZCKA 2B8FA 4GLXA 4WJOA 3J7AF 2ZTEA 4I6NB 1GUAB 1WE6A 4L63B 3DLLA 3PO3G 3MEHA 5JZEB 2D5DA 3IAYA 5CV8A 4UPAA 4P6VF 1N8RC 4UDUC 1BBUA 4A3PA 2ZCCA 5FR6A 1O80A 3RMHA 1CKNA 2AL3A 1HXYD 3GTPH 1K50A 3STBC 4JX1C 3AMZA 3NP8A 4ZKBB 2X6GA 2KHIA 2F4VQ 3OMCA 4N9PA 3RI7C 1ZDXA 1RM6C 3TS2A 1O7IA 4DK1A 5IGCA 5FLXc 1N63A 1B3AA 1NYRA 5JOBA 4R4QA 3RMKC 1W6KA 4W9CA 5GXGB 3SK6A 2WDTB 2YU9B 1PYBA 1BDOA 2GBKA 3VRBB 1WJNA 5M5XH 4LF8L 4IKGA 2EYOA 1EUVB 4IM2A 2R2QA 1XMOQ 5CV6A 4BKTA 1NTGA 5EPLA 5M3FG 1VQ6A 3DBLB 4P7IA 4BXXG 5M3MH 2EE1A 4I65A 2B2VA 4NNJB 1UE1A 3X23A 1SDFA 2JEAI 2XEWA 3NZSA 1GM5A 5C5LA 2WKDA 2HHHQ 5CV5A 4LDTD 4X3SA 1MD2D 4ZLTF 3S15B 2E6XA 4P75A 3TP6A 3BG3A 2KJ6A 3P4RB 1WGKA 1WTHA 4GN5A 5C3XA 4MEMA 1DXMA 2IY1B 2O4XA 4FNFA 3PZ8A 3W1SC 3ICEA 1F2MA 2VQFQ 2VZAA 3PS6A 3U30A 1HR0W 1N33Q 4FXGC 1QOFA 2Y0SG 1G6ZA 3AE5B 1BXTA 2VRRB 2Z4IA 1L6UA 2WGSA 4K5VA 1QZGA 1K3RA 1S5CD 3A55A 2XBBC 3HHMA 2K0PA 1HNWQ 3V2TA 1WTWA 2YEPB 4EE2A 4BY7G 1EWIA 2MCNB 1C79A 3RCZA 1ET9A 4DUZL 1FRDA 4EZLA 3I4MG 2LXAA 4B0MA 1WFYA 1PFSA 2RPVA 1E0ZA 2M9VA 1YX5B 1K8GA 1MG8A 1VQ4A 2WV6D 4L23A 3MXGA 4C3IG 1EYDA 4K6LA 3AEBB 2A6HC 4WJNA 5C6AA 4JI3L 2EY1A 1STBA 2LJ5A 1N36L 5C44B 2L3ZA 3DM1A 4RF0A 1E5WA 2R92G 1IYFA 1UH6A 2I46A 2WU5B 4JV5Q 4GSWA 2WQYB 5C2TB 5ELBA 3TCAA 1L4ZB 2MBOA 4GS3A 1F1HA 1SJED 2IO0B 3ZRFA 2K8CA 2EXDA 2XIWA 5CORA 4A3LH 2I38A 4L1BA 2GA4B 3DPDA 4DHJB 2WXFA 4KKJA 1E1OA 4BBRG 2MP2B 3Q3OC 2WXHA 1ZE3D 2VQEQ 2OWOA 3GTLH 3F2CA 2LVOA 1JROA 2HCIA 2H5XA 3HOZB 2D07B 5G55A 3NS8A 4C4VA 1E1TA 3K80C 2UUBQ 3S1NH 3S2HB 1H9RA 3AE7B 4ZYNA 2EMTA 2ZXOA 2L76A 3ZJTA 4OX9Q 3MFGA 3LWUA 4CJ1B 5C0XG 5FJ8G 1DGSA 2N49A 4R4TA 2IX3A 3HOVB 1WJUA 3MWYW 2G3QB 3ZNHB 1I4HA 1TWGB 3I4NH 1T3QA 5JXVA 3EVQA 2A1AA 2Z0DB 2F4VL 3NELA 1NMFA 4ZRQA 4XYQA 2BPSA 3HKZE 3NSWA 2I1KA 2RKSA 1H8CA 3R7QA 4JQWC 4JWUC 1BF4A 1WD1A 4HKZE 3SDZA 1FXAA 3RPFC 4ME3A 1XWEA 3CSFA 3ER0A 4A3DG 1X3GA 3CCRA 3H0GH 3BY4B 4CJ2C 4NPNA 4IALA 4X3UA 1XMOL 5IO9A 2PEAA 2EJMA 2SOBA 4F7XA 2LASA 2L4NA 3MTSA 1EWHA 4W9HA 1JQ4A 2Q8TA 4CDDC 1ZGUB 1CSQA 5EKLA 1C0AA 1U5KA 4FXKC 1TY2A 2MPMA 4DAMA 4EQ5A 4NB3A 2HHHL 2KJRA 3P63A 1LACA 1YEZA 3PGZA 4TKNA 1L7YA 1SFOH 5CV4A 1N34Q 4OZBA 2MJ8A 1EUJA 1H9KA 1C9OA 2K04A 1RODA 3GTKH 1IYUA 2JA8B 3L0WB 4XDCA 3VVWB 2DUDA 3BZCA 3D4WA 2FCMA 1XNRQ 3VR3A 2BA0A 2VQFL 1TWCH 1BBWA 2REXA 2R7ZB 5C3EH 1N33L 2XWBB 2ZVOA 4MTNA 3KF8A 5FLXE 5BYRA 1A3UA 4DV2Q 2ENBA 1ENCA 2G4SA 3R7RA 5E6NA 4I7AA 1WGDA 4HJKA 2AX5A 1X54A 3L9AX 5GADC 2W9NA 2WINB 4LNQA 3QX1A 2QCPX 1I6HH 1VD2A 4A3IH 4JPSA 1LLRD 4KIKA 3B2GA 1ICWA 1NUCA 2D2CC 3BVGA 4A3EH 1JMCA 1TZOA 1AYFA 2BBCA 2H89B 4N58A 1SR3A 5C4XB 1F2YA 1E3PA 1DZ1A 1TWHB 1SSOA 1WOCA 2BDNA 1VCBA 5BN5A 1VQOA 2NVTH 4LNKA 4HVBA 1FVIA 1OXVA 3MA2B 3E6ZX 2EQSA 1SEBD 2BF8B 2WAQE 1EF5A 1UWXA 3LDZE 2JPHA 2CS4A 3T56B 3P7JA 3KUPA 2K5PA 3SEBA 4CKBA 2UUCQ 3AV8A 4NJ6A 5DLQE 1GAQB 1A8VA 3GE3C 4I6PA 1I3QH 4O2DA 5C3EG 2VQEL 1Q7YC 1NENB 4IG7B 1FR3A 1EM7A 4M8NA 3H7SA 3IT4B 2UUBL 1KC8C 1HA6A 2XNAC 4YSZB 4NMZA 4DKAC 1V2YA 5HKHA 4HCPB 4A20A 1NEKB 2B2WA 2E2DC 1Q86C 2MBEA 3A9KB 1QKZA 4QIWE 4O1NA 3A7AB 2E2IB 2OCEA 3KUDB 4X6AH 4JBKA 2VB3X 3V3XA 5C44G 1S5FD 2LZ6A 1VZ7A 1XXGA 1SLJA 2YTVA 5IY0A 2DJFC 1JWUD 1I94Q 1B50A 3HOXB 3F8TA 3OG5A 2X38A 1OO9B 1UNSA 3GO5A 1PH9A 3ZDTA 2V4LA 4GDLA 3PLUA 2VZKD 1IW7D 4TV3A 5DCNA 1W6JA 5IN7A 3VTUA 4KHZA 4ICVA 3FVQA 5TR5A 1E7ZA 1JW9D 3CXCA 3RZOB 4C2MH 1L1OA 3N30A 4IUPA 1E0BA 2QEJC 4PZ6A 5CBAE 2JXMB 3JW0X 3V61A 1ACCA 2MEKA 2QW7A 3HOZG 3BU2A 4A3GG 1V8QA 2PE9A 3FKIB 1VS0A 1SNPA 3QR8A 2AEHA 3W1YA 4X64Q 1YBYA 1HQMC 2NVYH 3CHBD 4CHTB 3NVYA 3KDFB 1EYCA 3TRZA 4JOIA 4QL5A 2Y3AA 3ZNID 1SYDA 4E74A 3J7YW 1EQQA 1N34L 4WQMA 1H95A 2X8XX 5G5HA 3HOVG 5BR8Q 3OAWA 1VRAB 2MQHA 5J39A 4WWPA 1XF5L 1XNRL 3IXSA 5J1ZA 2N55A 1WH3A 2Q8IB 1IPGA 2KWDA 1DOLA 4LF5Q 2E76C 1HFNA 1FIQA 1AWDA 4WJQA 4K7WA 3MZ5A 4DV2L 2F0KA 1LTID 1R4QB 4PG3A 4GNXA 5ELCA 3A56A 2WP9B 3N1ZC 4GLSC 3WA0A 1I35A 2EY6A 5EE1A 3SU8X 1R9TH 2F0IA 4DXGA 2R2OA 2RMMA 4ZUJA 4NAWA 3T3NA 4GN1A 4JL9A 2XWJB 2NMQA 3S17B 4YTNB 4F1SA 2AQ2B 3D3RA 5C4JH 1PH3A 4TKOB 4DR2Q 1XCTL 1QILA 2CW0D 2GRIA 2N4FA 1D5ZC 2B63H 2MH7A 3M3JA 1IBLQ 4DAYA 1B3QA 4B9XA 3A0JA 1ENFA 2EYJA 2AL6A 1YNJC 1PLFA 3QB3A 2CHBD 4KKSA 2GBJA 3A8KE 1D5XC 4L5TA 4RGMA 3Q24A 5IP4D 4J1MA 2JZ3B 3WANA 2Y0SE 3S1RH 3M4OB 2DHZA 2K8BA 4WJPA 5IYBH 2JA8G 2R3ZA 3MJ5A 4KKIA 3ZTCA 2K3UA 1Q82C 4K6DA 4KJNA 2UUCL 3I90A 3C46A 1KD1C 2R7ZG 1GB4A 2A68D 1IHZA 5KIXA 1KDCA 5CYUA 3RN2A 1G8ZD 3PIO3 4FBJB 4JI0L 2WDQB 1EIHA 2ICEC 3BWUD 4KN4C 1Y56A 4UY8C 1CZPA 3C2PA 1PZID 4A3KB 2PJHA 2WXLA 3KUZA 3Q69A 4YSXB 5CHFA 3B08A 1SB3C 1V9JA 2RCNA 3S2AA 4GOPA 1Z7TA 2EELA 1ZXTA 5A35A 3I3CA 3DHGC 3RD2A 2HCCA 3KQ4A 4WFN3 1EO6A 4A3OA 4A3JB 2GMIC 2PI2A 3IAM1 3Q23A 2VXWA 4OXPA 1UBQA 1IYVA 4MHEA 4YWLA 4LFAQ 3M3YH 1XCQL 3APDA 3VFKA 2I2YA 4IN3A 1HTQA 3HKZB 3K81C 1RJTA 1PDXA 4K1RB 1I94L 3PUZA 3TS0A 2J42A 2Y5CA 1PV4A 1NR4A 4EKUA 3RD4A 3UDXA 3EBEA 2KAJA 4MGIE 1C4CA 5HURA 1V49A 4DXFA 2BGFA 3FRPB 1GJXA 3ML9A 1VZ6A 5E7NA 4HROA 3VTWA 1VQFA 2ZM6Q 1WI0A 1Q12A 3E3XA 1A63A 2JA6H 2KVZA 2PO4A 5HY6A 1FNVA 1K0SA 1SNOA 1VCIA 1ZPSA 3MC8A 5MPOA 1XLOA 4LNFA 2YYZA 1BQQT 3ZQ4A 1DM0B 1NMGA 1HNWL 2PW9A 2EVBA 1O7LA 2O2VA 1ZYRD 4U68A 1C7YA 4YSYB 2N3SA 4QQBX 4RKBA 2PI2E 4G0NB 2PQEA 4RFBA 5JJZA 4JLCA 2KLGA 1K8MA 4OL7A 5BR8L 4DK0A 2IWHA 1M94A 2YTYA 4B3RQ 3M7GA 3P4QB 3MP9A 4FVMA 2VUMH 4BAXA 3PUXA 4ZRJA 1ICFB 3OYYA 5TSSA 3MTNB 3HOXG 4NPSA 1C3TA 2BTEA 2G9HD 4B3TQ 1HR0L 1FXTB 2NPTB 2RDHA 2AQ1B 4A55A 4IDIA 2B2YC 4MZ9A 5M5YH 3TREA 3AXCA 2JXXA 3A5ZB 4N9F4 1JE5A 2M17A 1T6BX 1BVSA 2VH2A 3MEFA 4KSKC 5G3LD 4H44C 1CMXB 4XQJA 3C19A 3LX0A 2PVGC 3N20C 2IGGA 2JN4A 4DQOC 2KOLA 2LGSA 4XIGS 3GQBA 4N8X1 4DR2L 4K2LA 1FMAD 1Q1OA 1IBMQ 3RLFA 3L3OC 2ID0A 1IBLL 3PF4A 3R8BA 3FKIG 1OFFA 3J7AV 2V3NA 2W82A 2WAQB 1BUVT 2A73B 3OOCA 1PFMA 4X65Q 4YWGG 3KLRA 1V1OA 3MFYA 1ZOYB 3J81j 2OJWA 1YI2A 3OIQA 1WYWB 4B0EA 2CVRA 1HZBA 3KF8B 5FLMG 4MJSB 4C3HB 2N8NA 1TWFB 2RBMA 1CI3M 2PZWA 2ZTCA 5IYDH 1E8WA 1SE9A 4H02A 2DNFA 1DOXA 3R2IA 5JPMC 2LVQA 3UE1A 2B2UC 2J4XA 2KMMA 3DXJC 3W1GA 4IFDG 1WXAA 2OHFA 2I1JA 3IAS1 5KGUA 5JEAH 1YJ1A 4XX5A 4HKQA 4B3MQ 2BH2A 2RDBC 4KIKB 1WXSA 3NXWA 3RZDH 4X62Q 1CQFA 4IZ8A 3OTOL 4BBNC 2A68C 4QIWB 3PRMB 5H92C 4G7HC 1J8IA 5FOBB 3U7ZA 3H1UA 5FO7B 2NUCA 1V6EA 4BBNF 2OQ0A 1UWVA 3W5VB 3E56A 1VQIA 2EDGA 1F9RA 4DR7Q 4HSVA 3TIXA 3N52A 4LFAL 1SIFA 2VH1A 2IJ0A 2HQLA 3P4PB 1SNQA 5JJKA 5M5WB 1ZKOA 4A3FB 3H8HA 4G3XB 4OVZA 1SNDA 5FO8B 2MHJA 2F0GA 3GTOB 3J9CA 2IX0A 2KN5A 2Z1CA 4QUFA 4LJOB 2NVQB 1J19A 3BVMA 1F2RI 4PMWA 4ZUIA 4PQXA 1VQAA 2MP2A 1WJJA 3LJ3A 4HXDA 1D5MC 3ND9A 1YJJA 3MXNA 2M19A 5HI1A 2QKIC 1EOTA 4EUTA 4TRDA 3CMEA 2V3SA 1EQVA 4RF1A 1I4XA 4YHHL 1YNXA 2LXCA 3P4SB 1EWCA 4A3KG 2MSED 5IWAL 1HTOA 1TT5B 3EGRA 4KZCA 2UXBQ 1JORA 2A19A 1ML0D 3OW7A 3S2DB 1LFDA 4A3CG 1TTNA 1TWAH 2WU2B 4C7YA 2F0EA 1BKBA 3RLOA 3K9PB 1L2NA 2KCTA 5IE8A 1XT9B 2GBMA 3J7ZC 3SK4A 4GDLB 3CMAA 4IM0A 1SE8A 2QA4A 2E8GA 4MGZE 3HKZG 2KVMA 5C3WA 4KJOA 1XD3B 4JI4Q 2RDFA 2V9HA 4TUUA 3AYHB 4US8A 3L10B 2HQEA 4B3TL 1LTSD 3QOLA 1TKGA 2IDYA 1SNMA 1L1OB 1Z47A 5KNDA 2NBFA 1XQQA 1C77A 1N5WA 4AUQC 2VB2X 3NG0A 3HZXA 1YIJA 2WP8J 4DNIA 2HIXA 2DLBA 1BCPC 1WFQA 2NBUA 2KQ3A 1NAPA 5E4XA 3SFEB 4PYUA 4HMJA 4USAA 5D2MB 1SYEA 5CR3A 3DBHB 1GB1A 3BVZA 4XDXA 5ELNA 1BCPF 2KFJA 1CJEA 3GTMH 3ZJVA 1OXSC 3NTIA 2N7EA 3T1HL 4XT1B 2F0UA 4J6HA 3VRAB 2F0NA 1HJPA 2LY7A 2Y0SB 3BZDB 1QNUA 2WLBA 4X65L 1ZP0B 2FXQA 4IPCA 4P16A 2WKCA 1XYIA 3EFXD 4L2YA 3SK5A 4DR5Q 3GTQH 3TN2A 1MHWC 2ATWA 4GNXB 3E0JA 3I4MB 3ONAB 1WX8A 4J6IA 5M5XB 2KDBA 3IVFA 4NAWB 2RVLA 1KF6B 2BB5A 3H09A 1WWTA 4ITKA 2ZJDA 5LL6X 4B3ML 1G6JA 2WDRB 3P20A 1IL8A 3VR5A 5M3MB 2KA7A 2MWSB 1GKHA 1T9HA 1PH1A 3NBIA 1GVPA 4OWWB 4ZHOA 5DPWA 3Q6SA 1LTLA 3HOUG 2QDBA 1DOIA 1JRUA 2L0TA 5ISRA 2TSSA 1R4PB 4EQOA 1L5PA 1TBEA 1QNKA 1UEBA 2LI5A 4FN2A 2DYMA 4HJAA 3IHPC 4DR7L 3RN5A 4E3CA 3Q8DA 2F0TA 1WCMG 1A2UA 2WAQG 4GN4B 2MW5A 5KRUA 2FJ2A 3BJUA 4FO2A 2F0FA 1I7HA 2A6HD 3KLWA 2Z6BA 1Y1WG 2E2JH 4OVUA 4ANVA 4LW1A 4ANWA 4C3HG 4ZDVA 1UGJA 4AJWA 4BA1I 1X56A 5C0XI 1J7BA 2L5TA 1NVID 5D6JB 2K6QA 4G4KA 4IWOA 2WFWA 3FPUB 2V1CC 2MBQA 3D6WA 3NWSA 3GB1A 1XTCD 4GOPB 1JT8A 3U4EG 3M95A 5AUKA 4JI3Q 3AEAB 1YN5A 1QT9A 2D3GA 3VH3B 3PZDA 1KAAA 1XLNA 2UXBL 1PFBA 3AB9A 1PRTC 3LXFA 5H1SE 3Q3FA 2MNAA 4M01A 2IHFA 4QAYA 3K7UC 1FD7D 5IYCH 3PGEA 2B2TA 1K8AC 4MGKE 1PRTF 5C5MA 4GOCA 1SGHA 1D8LA 2A4ZA 2JA5H 3PCOB 3U9OA 1N32Q 2D3CA 2CU1A 4K8IA 1RCVD 4BA2I 3ZRCA 4IURA 4A3FG 1RTNA 1U4LA 2D0OA 1BO0A 1C4AA 1YVCA 1PGXA 4ID6A 4NXNQ 1L0VB 1QZEA 2WYQA 5BMGA 3I56A 2HIVA 4RH6A 3TMPB 1PA6A 1YN4A 3GOEA 2ZW0A 3AE1B 2C60A 4I6LB 1SJHD 3GTLB 3G48A 2B3AA 1SIJA 2FFKB 1N62A 3SHLA 3ML8A 4DF7A 1EY0A 1WSPA 1MKHA 2LGIA 5JEAJ 4C00A 2K6AA 3S1NB 2D0PA 3CKIB 3S24A 3BK2A 1YX6B 2O2VB 1T0YA 1MG4A 2FUG1 3V62A 3KDFA 4AS1A 3BIID 3MC0B 3NOBA 3NTHA 4ZKCB 1GPXA 1SXTA 3HEJA 5IP7G 3LGJA 1TVXA 2UUAQ 3WIMA 3I4NB 1JQYD 5E6PA 1A2TA 3CCUA 2WXRA 4LLGM 2K75A 2IW3A 1VQCA 4UP9A 4HCEA 3H6NA 4UP8A 1WVLA 4BBSH 3QIAA 4KY7A 3I63C 4TQUS 2KJHB 1LTGD 4DR5L 1EY5A 3I73A 4LJZC 4RCNA 3TEHB 2GBRA 2WDVB 2EYPA 2NN6G 2I0QA 1P7FA 3DBLI 4GGQA 1FFVA 2WWZA 4L5SA 3H0GB 3NBHA 3GD7A 4G7ZC 2RCFA 3D8GA 1K0RA 1Z5SB 1H9SA 3DQVA 1YOVB 4KTAA 1KJTA 4KVGB 4G57A 4URKA 1BMLC 1G2SA 5LHY1 5CV7A 2GN5A 1GG3A 4LFCL 1EU3A 3SR1A 4JI7Q 1VF7A 3VHTC 4HIMA 5COYA 3FKYA 1OXXK 4JI1Q 1SFOB 3M63B 2YTXA 2DBYA 2OTLA 1X32A 4OZCA 4DV0Q 2L00B 1GUOA 3GTKB 2JVCA 2QJLA 1MJEA 2UXDQ 2NVUI 2O6VD 1K83B 4OELB 2K4KA 2XN9C 2CH4W 1NYQA 5FKAC 2JA7H 1TWCB 2Z59B 4QY7A 4R4OA 5C3EB 1E7UA 5IA7A 3S1QH 3CC4A 3Q3JA 1VQBA 1DCZA 2MP1A 4DDGD 2YEPF 4C3JH 2K5VA 4XDDA 5EAYA 3M4YA 4AYBE 1V1PB 1WYGA 5LMUL 4LTUA 4YXDB 1MGSA 1J5EL 4HTHA 4KD4A 3M85A 4LCDE 2M56B 4KK7A 3RLNA 1I6HB 4A3IB 2ACZB 2XSCA 4KGRA 3WAOA 1P0RA 2K05A 4A3EB 4A9AA 4NDXA 3PO0A 3X3MA 2QMTA 3U7DA 5M3MG 2LUEA 3U58A 5CC4A 2ZXRA 1ASYA 2RR9A 1X65A 2NVTB 2CHZA 3AECB 3VH4B 3B6YA 2PPBC 3A5UA 4DV7L 1PH6A 2KCNA 1YQ3B 2KQ7A 3I70A 4OO1H 1HZ6A 2CQAA 3F2DA 3A8JE 4RAUC 1F9JA 3VYTA 1N32L 3SXHA 2DZIA 2K8HA 1EEID 2L7RA 3ULLA 3VXWA 2DJGC 4HIDA 1JJGA 4NXNL 1EOVA 1SRUA 3MXNB 2CKHB 3TQYA 4DK5A 4A3GB 3RNEC 1HNZL 4WRDA 3TDQA 1I3QB 2HDMA 5C4ZA 1B2TA 2C35B 5HHDG 2DGYA 3I91A 3NHEB 1YNNC 1AW7A 1GHKA 2IPKD 3T16A 1KRTA 2GLSA 2K9XA 2QDLA 2JU6X 2PIAA 3KBGA 3L0OA 4N6EB 2EYMA 3AN1A 3ERSX 1LM8B 1S72A 2YVCA 1VQLA 5LMNW 1GUTA 2UUAL 3L08A 3N32A 3WWVA 1ZEQX 2LFIA 1UE7A 3CP0A 3C0RB 2BB6A 1A5RA 4FJZA 3DMUA 5HG2A 1ESFA 1M8AA 2QEXA 2E75C 2QILA 4TMAB 3RZFA 4EFOA 4KHPQ 1VQDA 3AQQA 3FILA 5J22A 2NPTA 3N1YC 3PHXB 3PF5A 4OO1G 4A3LG 5ELEA 2Q2HA 2RDGA 1K52A 4WAFA 1SN8A 1MHXA 1O7ZA 5GROA 1JE4A 2NBVB 1AARA 2UU7A 1B9MA 4K3CA 4KDLB 1IP9A 3I7FA 2Z6KC 4YWMA 3AE8B 1XX8A 1YQBA 2ZNVC 1K51A 1STYA 2KXJA 3AEEB 1YD8U 2YU9H 3U52E 1XPRA 2NVYB 3RNUA 3E9HA 3T3OA 4JI7L 3U2SC 4K3BA 1V9PA 2BW2A 1FPYA 2D3BA 4P2CB 4H0LC 4JI1L 1VLBA 1CT1D 3KK7A 2VW9A 1WJ6A 4DV0L 2H88B 3EROA 3CSTA 2R7DA 1EY8A 2UXDL 4PMBA 4TVAB 4HJ7A 4MIUA 2M1MA 3CU7A 3I4NG 4MJSA 4HJ5A 4IM3A 5ELFA 2G1EA 2OT2A 1CKMA 4DNRB 3W3AA 4LNNA 3ZGZA 4MNOA 4OIJA 1JWBD 4BWGB 4YCVA 5JJLA 1ILQA 4QF4A 4XQQA 1S4ZA 1XJVA 5EE0A 2K52A 3W1BA 1R9TB 1YNJD 3PMFA 1BUIC 2DWQA 3L13A 1B44D 1ZDVA 2ZPNA 3H0GG 3KLSA 1NI2A 1WGRA 3DWGC 2PQAB 3I8ZA 3Q8CA 1KNAA 4ZRZA 5C4JB 2MO1A 1X3QA 1WZ0A 1JMLA 1IKLA 1I50H 4FF3A 2LD9A 3NVZA 4EEWA 3AFQA 1WTRA 2B63B 3Q3NC 1R4NB 5H8YE 4KLKA 4A4IA 2KANA 1TIID 4OHJA 4LDTB 2Q8RE 5BYQA 1L2FA 1O78A 4XQNA 3I55A 2JA9A 2Q2TA 3PO2H 3MJWA 3TEWA 1HCZA 4A93H 3VQIA 1HFGA 1JOOA 2IT1A 4BVUC 1GNUA 1XNQQ 4KGSA 2CWAA 4JI0Q 2MJ3A 2L83A 2RF4A 3DHQA 3ENEA 1FEHA 3PHWB 4V0BA 4OZAA 5CHWA 4PNYA 1TYGB 2HDEA 1QLBB 3PIOA 5KNCA 4Y7NH 3S16H 1ZW7A 3UDFA 1ZXHA 1QF6A 4NW2A 1WXVA 3TUOA 4C80A 2LUMA 4BOSC 4XZ4A 2KK8A 2G5DA 3NS1A 4EZKA 1Z6HA 4A3IG 3UF8A 4U673 3S14H 4FULA 4Q5VA 3AU7A 1EWYC 2LMCA 4A3EG 4ZHPA 5T1GA 1VQNA 3PQIA 1NBFC 1STNA 3LWEA 3W5OA 2D3AA 3MHBA 5I9PA 3ZO5B 4B95A 2IL8A 3M3YB 2N9PC 2PW5A 3VYSA 4CHKA 4R9WA 1MIUA 3HOWH 2KDEB 4R3DA 1WZ3A 1HZ9A 1WIAA 2LJIA 4HDOA 4IOIE 4CYEA 2M0AA 3OPOA 1HTLD 1PH7A 4B3SL 4EVOA 4P71A 2RGFA 3K7AH 3LB8C 4ME5A 1XPUA 2LWPA 4KHPL 3VUWA 3H15A 1EZ8A 3TP8A 3IG3A 1SYBA 2IGDA 1WE7A 3I4OA 5I6YA 3DVNV 2SDFA 1E8XA 1V80A 3ETRA 5IP9H 2WNMA 2F1MA 2M2LA 2JA6B 4K7SA 3PSEB 4QUCA 2ZJQA 1Q90A 4WWOA 3DM3A 2K1FA 2MJDA 4N9TA 2FCSA 3TEYA 3IL8A 1I5FA 4K81A 2PZTA 4W9IA 3ZDMC 4FADA 2CWPA 5K5PA 2KDIA 2ZW1A 5ELOA 3ND8A 4QCLA 2Z4HA 3QHTA 4DWFA 1E2VA 2DNEA 1P8LA 3QCAA 1AFPA 4NQKE 4M00A 2BYFA 3R93A 4IFDI 4GMVA 3M9BA 3RUZA 2VUMB 1U0LA 1HR0Q 4L5RC 3KW5B 3ZXRA 1VMPA 3ULJA 4AYBB 1S3OA 2UXCQ 2B2VC 3EIVA 1QZHA 3TEXA 5LXIB 3QWNA 3HOWG 1Z9FA 2MRPA 2VY3A 3K8AA 3NBHB 3Q22A 5M5YB 1Q46A 1H9SB 4FXDA 3CW2C 2J7ZA 2CFMA 1NNXA 4DA2A 1IGCA 1P98A 4QMGA 1VQ9A 1VQHA 2R61A 4P1BC 1E10A 1WM3A 2JE6I 1KHIA 3HGBA 4LUVA 1G91A 1WR6E 4DXAB 4IUNA 2INDC 1B7YB 4NAMA 2DZJA 3KYCD 3CIRB 3HVDA 1IL2A 2OEOA 3QA8A 1N61A 4BY1H 4JWSC 1PYWD 4V190 1F0ZA 1QUQB 4HMIA 5C4XH 1YQ4B 1I4QA 1SE2A 2PMVA 2C7NB 2L32A 1RIPA 1LT5D 1K3BC 3TP7A 4IW0A 1Q1EA 1XNQL 2UWQA 2A74C 3J80i 1A70A 4D2KA 3T53B 4KGTA 1TQOA 1Y69U 1EZ6A 2WHIA 2ZTDA 1T0QC 3WAMA 3OTOQ 4DHZE 2JQOA 4F8CB 4X3TA 3RZDB 4ARIA 1B1ZA 2GBNA 2DY7A 2KBNA 2L9HA 4MDKE 1OTCA 3EUB2 3KF6B 3VR6A 3DDCB 3J80E 5EPJA 1XO3A 3AEGB 1DYQA 1GUWA 3P75A 3KYDD 3O65B 4N59A 2XRSD 1TJEA 5CTRC 2MO0A 2B63G 4IUQA 5D94A 4A3BH 2J0KA 3K59A 1WGGA 4PS3A 2J7QB 4IUVA 3DVNU 5LMNQ 1XPOA 1D2BA 2F0JA 5GAGC 3S1MH 2V1YA 4R1JA 2Z0SA 3WAPA 1TKYA 3CCVA 1R7SA 2KX3A 2HJ8A 1E90A 1IGDA 3FC4A 3VDZA 5IYBG 2F0PA 4M1UB 1SF0A 4FF4A 1V86A 3ZW3A 1G2TA 1BNZA 1SNCA 5D3IB 2H1EA 4W9JA 2JSOA 4BZAA 4YHHQ 4H2AA 4DU9A 3R3MA 1I4PA 3JC66 3H3VC 2I5MX 4MSQB 5IWAQ 3RNGC 5D65A 1WF9A 2IY0B 3DWAA 1R4MB 4JE3B 1FNWA 2PLPA 1J0GA 4ZK9B 1VDZA 1L0YB 2WXKA 3OSOA 4CDEC 3DWQA 1RYJA 2KWVB 2QCZA 1TWAB 4JIOU 1LTTD 3MXPA 3DCGA 4YT0B 4IPHA 4ZRPA 4EQNA 2AWTA 1UWMA 1GO3E 1E22A 1MJCA 4HIKA 4TQ1A 1STGA 5E6JA 1BCPD 2A69C 4HIOA 1X3EA 5GQOA 4HJ9A 3FILB 4MACA 2FNJB 5GAHC 4MH0E 4NKLA 2AWNA 1AZPA 5KHOA 2UXCL 2VZKB 3BDLA 3D4DA 1EY6A 2QSDA 3VR9B 4A6QA 1KLUD 3CQZH 2LHEA 4KY5A 4LUZA 5JHAA 3CWIA 4X3KA 1PGAA 3HOUB 2DN8A 2JWUA 1VQMA 2JA6G 2E2HH 2MA9B 1IYJB 4JI8L 5EQ0A 4KX6B 3T1HQ 2X6LA 4DR4Q 3OJ4B 1WCMB 4PV1C 4IQZA 4JI6L 1WGHA 1LTAD 2N1WA 5DPSA 3ZKJC 3ZLZA 2NZOA 4A90A 1Q5WB 4GU2A 3SE0A 3FEWX 2RA4A 4ILWA 1RFAA 2FCNA 3AEFB 3I5JC 4HAEA 1QOAA 4KZ0A 4AIMA 4F87A 1WJ4A 1Y1WB 3S17H 1SMYC 1PQSA 4NQLB 1UUPA 2NCNA 1C48A 1QG7A 1Y8OB 2XTIA 1QB5D 3CCJA 1E8ZA 1WX7A 3GP7A 5IIFA 1WMHA 3GTQB 4DAVA 3LYYA 1UELA 2VUMG 3PREA 1IUEA 3NWTA 4W9LA 2PW7A 1FJGL 3E0EA 1V1PA 4TSSA 4AYBG 1I4RA 2WX1A 2NTSA 3SR6A 2EY5A 2EPBA 2AYOB 2AWOA 3NK9A 2BS4B 2PKOA 2XK5B 3AE6B 4DV6L 3PRZA 5K36H 3V6EB 1CZGA 1CKOA 1EEFD 2WX0A 2DYOA 5L83A 1M90C 3C8YA 2QGQA 3VA5A 3ZVVA 4NY0A 1RHPA 2BYTA 3ERQA 2KMAA 3W1SA 3N3KB 2SNMA 2K7VA 4AQYQ 2WACA 2F0WA 4Z9CB 4ALPA 3H9DA 3IFDA 4DK3C 4MELA 1HZAA 1VZ8A 4LJPB 2AHOB 1FD6A 1KAWA 4M02A 5AUIA 5LMNL 1DGJA 4B08A 3N1XC 3CC7A 1QQRA 3RN9C 1XLQA 2GOWA 3AFPA 3TZUA 2NVXH 1C78A 3ZTDA 4A3JH 2F0SA 3RYTA 3BYTB 3SD5A 3VR4A 1MI0A 2E2JB 1GD7A 1PH2A 1PRTD 2K22A 5IYDG 4R8IA 2B2WC 4O42A 3NJTA 4AWJA 3J81i 4RHSA 2BH8A 4CKEA 3A54A 4LF4L 2HJ1A 1PVOA 2LXKA 1FCLA 4KI0A 1WR1A 4GXBA 3GE8C 1L0WA 4PYZA 2CQOA 5JEAG 3JSVB 1JWAD 3CF5A 1K9MC 4K2KA 1RWSA 4K5XA 2LMCB 2NB0A 2HD3A 2F3WA 2ZT9C 3CMMB 4UAIA 4DFAA 1KXLA 3J81E 1YJIA 4Q2JA 2MQJA 1UEAB 2MHVA 1RTOA 2K5WA 1GUGA 2NN6I 2SEBD 5ELDA 1JWSD 4HEDA 1EFID 1IBKL 3HM3A 2JA5B 4DBGA 2C9OA 4FJYA 4ANXA 4YWKA 3Q3MC 4FXCA 4CQNA 1Q1BA 1PDQA 3H3VH 2F0HA 2R93H 3KLSX 3PVLA 1RAXA 1KABA 2HUGA 2EY2A 4YTMB 4IOAA 4C7ZA 3PV0A 4K5WA 3X3NA 4KKTA 1K8OA 4GN3B 3IFWB 2K50A 3NHHA 1BBXC 1VR9A 2KDFB 5I9OA 3DBHI 2ES2A 1L6VA 1ZXIA 5T1IA 2RHQB 3G7LA 2RD0A 4R4IA 4MM3A 3EECA 3T8MA 1AEXA 3GTJH 4B9KA 2AMCB 2DX5B 4OVVA 4BFRA 2R7FA 1MJDA 4DR4L 3GTPB 3DWMA 5JVG3 1H4RA 1WGYA 1AH9A 1Y1VH 4J3OD 1V97A 4RNAA 2K28A 2L0CA 3CCLA 1QVGA 2KD0A 2KWCA 1C4QA 2NTTA 5AEKB 4RHRA 3HOYH 2L15A 4ODGA 1D7QA 2JX5A 3Q8EA 2KKCA 1AE2A 3OJ3A 2PVOD 2EJGC 4BBSB 3A4RA 3IKJA 3OIPA 2JWZA 2UYZB 5J2RA 1PXUA 1QJOA 1GC6A 3WCQA 4A3MH 4DHZB 4IJHA 3CCEA 4LF7Q 4IC7B 3QARA 4DUYQ 3H6MA 2B29A 3TZDA 1U4AA 2LXJA 4RM8A 3EA6A 2KJXA 1GJZA 1YHAA 5F2DA 1S5BD 3MXUA 2Z9HA 3RZWC 3GV6A 2PQAA 4LFCQ 1JC7A 3CRLC 3ALBA 2RHSB 4J8QA 4LMQD 1X1MA 3I3TB 5D14A 4XYOA 2L12A 2BQQA 4GB9A 3VUYA 4BS9A 2QF7A 4AQYL 4GIVA 4P72A 4O0AA 3DHHC 3Q0AA 2CU3A 4ZAIA 5L95C 3NQIA 3OW2A 2JA7B 1G291 3C1EA 2O6VA 5AZGA 3S1QB 4YL8A 5LMUQ 4GOPC 1S3SG 1J5EQ 3GV3A 2ZJPA 3GZNI 1CQVA 5LLIA 1KM7A 2JF5A 4FYDA 3GZNB 4KKUA 4DR1Q 2KO3A 3TP5A 3APFA 2KLCA 2NZ1D 1PTOC 1VQJA 2OXPA 3NZ3A 4IUMB 2J0MA 2N88A 4P74A 2UU9Q 4M0WB 3SFDB 1YJ9A 5M9OA 3DEPA 2JRIB 5J18A 3PO3H 1JOKA 5BMHA 1PTOF 4DV7Q 2LVPA 4DV5L 3TBIB 4FF2A 2EIFA 2XVSA 3CD6A 2V3PA 4MN3A 1I4GA 2B8GA 2QHOA 4AJYB 4OO1I 1LO5D 3KWVA 2GVAA 4C1NK 1YNND 4ICUA 4ZOHC 5BN4A 1YHQA 1WD0A 2R6GA 3ECIA 1E7PB 4GZYC 1N9WA 3I2ZA 3BINA 1HNZQ 2F0MA 1XTDA 1NY4A 4IUUA 1MSHA 3AEVA 1ZUD2 1HUMA 2B3GA 1B8AA 3H94A 4GLVB 2D11A 1Q81C 1H9JA 3AMUA 2HE7A 3PT2B 2DAJA 4US9A 4X66L 1PRTB 1GXDC 2K5QA 1VQ8A 3NPPA 3RNFC 4W9KA 1Y8RC 5HFYA 4PMCA 2INPE 5M3FH 1QOHA 3V60A 2CH4A 4DGZA 2AQ3B 2V0GA 1OXUA 4BXXH 4PS8A 4HSPA 2NWGA 2N7DA 2ONQA 2IO2B 3J7A5 3FAHA 4BOZB 4K0KQ 3V05A 5L37A 4Q0FA 5FK9C 5I2YA 3FDTA 1FFUA 2JYTA 5JVH3 2JEBI 2FHTA 5IYCG 2KCCA 3T1YQ 1GC7A 5JH5C 1CA6A 2WXOA 5EKIA 2IYDB 2IY5B 4F8MA 1RLFA 4CDFC 2JA5G 1TKWB 4NJCA 1Z2MA 4FA6A 1WTXA 3K5NA 1F52A 4LF7L 4GKKL 2N0SB 2Z0EB 4DUYL 5IT9c 3JAML 1QVCA 3D6CA 1AE3A 2PE6B 3K58A 2BWES 2DAFA 4L5QA 1KDAA 4BY7H 2V4IB 2K39A 1RKNA 2BE5D 1F2LA 1OQQA 5LNK1 2GI9A 3I4MH 1LQBA 1PYSB 2PNRC 1C9FA 4RGOS 1BT0A 4C3IH 2OTJA 2MJEA 1IKMA 4W9GA 1NJIC 1WTQA 1ZKHA 3FPPA 1QOBA 2EYHA 1LV9A 4P1CC 1PFDA 4JYAQ 3J80L 3GTGH 2BS2B 2W55A 3HM6X 2R92H 1QUQA 2M4NA 3G71A 1DOMA 1LABA 2PNHA 1WMHB 3DBRI 2Q2IA 3A7LA 1E24A 3G6JB 5EGTA 2E5LQ 4IWPA 3DBRB 4N8FA 3AE2B 3UQBA 1NSNS 2W3SA 4RCOA 4BBSG 1ISNA 3MHZA 2N7JA 1QVFA 3CPFA 3UIOB 4PT5A 1OQRA 3L17A 2F03A 1T5EA 2F3IA 4DR1L 2MLBA 3B0AA 3BZKA 4BBRH 3NTKA 2EZVA 3KJOA 2C9WB 1JICA 1II3A 2I5HA 2NS5A 2D2QA 2IO3B 4NXML 2IHEA 2UU9L 5EE9A 2KC1A 1DOYA 3KF6A 1I50B 3GS2A 2H4OA 1VQEA 1XMQQ 3U9SA 2LSSA 4FDBA 2KUMA 2NYZD 2K25A 2KWUB 4OIKA 4YY3Q 4JCVE 2J0JA 3PLVA 4OWTB 2L55A 2FBWB 3F2UA 2QDFA 5CBEE 3PO2B 2D5GA 2KTRA 5C0XH 2XRQD 3G6EA 5FJ8H 1T0SC 4A93B 5D3DA 2KEEA 2DZKA 3DVGY 1X55A 1PH5A 4JVZA 4A76A 3K9OB 3L4PA 3QOJA 1LTBD 3P42A 3PSIA 2NR2A 2FAZA 4LAAA 2JA7G 1EIGA 5JHBA 4JG2A 1H9MA 4WORA 3IRBA 4DPGA 1PTOH 1KRSA 2KACA 3AE4B 1MI2A 5C3JB 5IODA 2WB1E 3Q8BA 1LUZA 2WXNA 2K5NA 4Y7NB 2XGTA 3S16B 4C3JG 3PZ7A 4S17A 2C5CA 1SSNA 2IX1A 4A3DH 3T9LA 4W9EA 1I42A 1KFYB 2FIFA 3RNBC 3CCQA 1P3QU 1YIWA 2INCC 1V1QA 3S14B 4AOFA 2PYKA 3KVFB 1J6QA 5BN3A 4UHVA 4WH4A 4K0KL 3H7PB 5DPTA 3M4QA 1D6EC 1VQGA 2KX0A 1M1KC 4JPBW 1EYGA 4PS7A 4PZ8A 2FCQA 1HH2P 4HEA1 4B3SQ 1FNUA 2EYLA 3HOWB 4DR6Q 3A33B 4FLHA 5IAAC 1RDPD 5DAUA 4F88A 3T1YL 4IWQA 4ZRKA 4PK1A 4TQ0A 1HA5A 5AZHA 2JXTA 3N9YC 1F9QA 3K7AB 3SK8A 4FF1A 1JALA 3D32A 1HNXQ 4EOYA 2ASQA 3C1FA 4C2MB 1DOKA 4P73A 4IPDA 2Y5BB 2Z8LA 3HKSA 1YJWA 1LT6D 5GAEC 4HRSA 4LK0M 4XWTA 3PUVA 1MVKA 2DENB 4MM3B 2WXGA 3ZIMA 3D4RA 3V6CB 1N5XA 1GUSA 3AU4A 4DV4Q 1QWYA 4RG1A 1YJNA 1C4PA 5IGDA 3HP3A 2LEKA 4WWMA 1FYCA 1DONA 1U4PA 1TR5A 3QAQA 3JAMc 3UIPB 2BE5C 1Y8NB 2RQXA 4CBVA 2IO1B 3HG9A 2B2YA 3PUWA 2E74C 2NZHA 4ZQ3A 4HJ8A 1X9NA 4JYAL 2KQSA 1X3PA 2F0OA 1KDBA 2E5LL 3S15H 1Q0WB 2JYEA 1KLGD 5A2QL 2LGXA 1JR0D 5KYIA 3EHVA 5AZFA 2BYEA 1P16A 2ZNVB 4E71A 5IOIA 3K5MA 1E2ZA 5DEHA 1BR9A 1U4MA 5T8IA 2OOBB 2XK5A 4LUOA 1K83H 2ZXPA 4MSMB 3J80c 2N78A 1WY8A 1YMHE 5IT9E 1R4NI 1OGWA 3QWZB 4RGNA 1G51A 1STHA 2OF1A 4KN7C 1F9SA 2JRHA 2A8VA 1XMQL 1GOZA 4MTKA 1ROEA 4IOCA 2OEDA 4CKCA 2QIEB 4YY3L 5EDSA 2JYOA 4W9DA
chains in the Genus database with same CATH topology
1FGBD 4JK1C 2GB1A 2Q5WD 3K5LA 1SE4A 3DEOA 3S1RB 1U4RA 4BY1B 1N60A 3N6RA 2B2UA 4G7OC 3OWEB 3AM9A 1XEEA 2VNUD 2DY8A 3J81L 4B9WA 3I57A 1BOSA 1P7EA 1EY4A 4YTPB 2MGSA 3P1HA 3W2DA 4WJWA 1VF5C 2J0TD 1TS4A 1IBXA 4LK1C 2B2TC 3C3LA 1SYCA 1WTPA 4OW0A 1F2ZA 4JBWA 5I6WA 3B9JA 4A3BB 1PZKD 1XLPA 4KMUC 4RWSC 3S1MB 1LT4D 1JRPA 2KQ4X 5IOCA 4EQPA 2CJNA 2J52A 3B2FA 2KEDA 2JQRB 4ZYSA 1PZJD 1I6VC 3OHXC 3QJYA 1AZQA 4DAPA 4ARCA 2X69A 4MH8A 5EBCA 3E9SA 3AEDB 4M8AA 1TU2B 3T4AC 1Y8PB 3QO2A 1D1IA 2A69D 5I2XA 2JZPA 3S9WA 1CHPD 1M4VA 5E3FA 1ET6A 1B53A 3HRDD 1L0XB 1CZWA 4C1NI 5C0XJ 1OXTA 4IUTA 4E6IA 1Q8IA 2EJFC 1AN8A 3CRKC 3CQZB 4KD3A 1QOGA 5G5GA 3M7NA 3HRZC 1STEA 4H7BA 1CA5A 1SMYD 1EY9A 3D31A 4WIPA 2E2HB 1ILPA 1Q3LA 4EGVA 2ICIA 2K33A 2A6ED 1YN3A 2MUYA 1ONLA 4K8JA 3FMCA 1ESRA 5IGGA 3JAME 2K03A 3ITPA 2WXQA 3DUZA 1Q10A 2WB1B 2CJOA 3VR8B 4HR7B 2L1BA 4H13C 4KV6A 4CJ0B 1WRIA 5CV9A 4M0WA 2IGHA 5IGBA 1DD2A 1EL0A 4KHVA 2BDOA 3UI3A 5E1FA 1CFMA 1V43A 3OMGA 1CTMA 1LTRD 3TSSA 2LKVA 1UAPA 1FCCC 3PUYA 1ENAA 1S5DD 3AH7A 2PZUA 2B39A 3ZJUA 1TKEA 3HVZA 1PUTA 3W5UB 1HRJA 1PGBA 3TEZA 3R2TA 3V96A 2NVXB 2K5DA 2HDLA 4ABNA 3EQLC 1WTOA 1SE3A 1D1KA 3K5OA 1J9OA 2BS3B 3NRZA 3PIP3 5HGTA 2FMMA 1JWMD 3TMEA 1E2WA 1SAPA 5IGFA 4NZLB 2AUJD 1J7CA 2J53A 1STAA 4XTCS 2FMCA 2KECA 1J7AA 3NVVA 1SYFA 1IW7C 4L6TB 1JB3A 3I72A 3T13A 2F0VA 2AUKA 1JOQA 1SBBB 5FO9B 5D7GA 4DN4M 2R93B 5JAVA 3ABVB 2L52A 3VYRA 5CGKA 1VJKA 2WS3B 2W3RA 2K1BA 4RGTA 1RF2D 2F0QA 2DNCA 4IFDH 1PFNA 3BS1A 1E6EB 2LFNA 2BCOA 1TS5A 3GTJB 3NUCA 3GTMB 1KRHA 3QG1A 1Y1VB 1TS2A 4XWWA 3WOEA 4ULLA 2D9UA 3HOYB 1WXQA 3ZYYX 3R3OA 4WURA 1SYGA 1MHHE 2EKIA 3Q8FA 2A6EC 2L11A 1YNTE 1MSGA 1B9NA 2EXZA 4A3MB 4XT3B 1MPEA 5EJWA 3HS0C 5DNFA 2CW0C 3MAQA 3I4LA 1B9RA 1RFKA 3O13A 5A2QE 2RSNA 2ON8A 2KN4A 1F2RC 1A6XA 2O5JC 1TT2A 2N9LA 4L8JA 2KDMA 1B4OA 5BYSA 1PTOD 2F3VA 3KWLA 1F77A 5NUCA 3K57A 2PTLA 2PCFB 3BK1A 1HHVA 1IBXB 2B76B 1VMCA 2PMZB 3NE5B 5E4WC 1T5XD 1EU4A 5K36G 2JSVX 1A3TA 3PO3B 4YIJA 1C76A 1PMRA 3I9V1 4OGQC 3HUIA 1HQRD 2Y5PA 3VYUA 4KY6A 1FM0D 3BDCA 3IFTA 2BA1A 2F0LA 3KBXA 3L7ZC 3E5SA 3IT6B 4R8NA 1KNEA 5EE3A 3VR2A 3T51B 1NR2A 2WXJA 4XE0A 1RD9D 1L4DB 4HJGE 2A5HA 4GDKB 4RKLA 2N9KA 1D4BA 4CGYB 2FINB 1EQTA 5AFWA 3BYYB 3NQTA 5EPKA 1ZYRC 3NVWA 3SVMA 5M3FB 3Q8AA 3NUHB 3WOFA 2RSOA 1GHJA 3UI2A 2KHSA 4DNTB 4NP5A 5IT9L 3EJIA 1K53A 4K14A 4MT5A 2L1AA 3WDNA 5FLXL 2F4IA 1GUNA 1CM9A 1MBYA 2EOTA 1U9RA 4C56C 1BCPB 5FR3A 3VA7A 3W9CB 1CHQD 2W54A 2EYFA 1NI3A 2BOSA 1C8CA 1HPCA 1HZ5A 2O2LD 1FRRA 5CMDA 4XXEA 2F0DA 1V8CA 2HTME 5G3LF 2JP1A 1EY7A 4BY7B 1A15A 1HUNA 2LHDA 5C4HA 1KH0A 2INNE 1FO4A 1HTPA 1AP0A 4C3IB 2TMPA 1E9MA 1A3VA 1VDVA 3AB5A 3AE9B 4HN7A 3GTGB 5EBDA 3K0YA 4A8XC 2R92B 2E3TA 3K6OA 3H91A 4S3SA 4C3JB 3MVVA 2WIIB 1DJRD 2V4DA 1NCVA 2K32A 1LT3D 3AE3B 5EKKA 1FXIA 4BBRB 2G9DA 4I7ZC 1WTVA 1F9PA 1JCKB 2SNSA 4IFDJ 4HCSA 2WXPA 2K01A 2SAKA 3DWPA 3OWFA 5BMIA 5LL6S 5IGEA 2BT6A 5I4DA 1QCBD 1S5ED 1QE6A 3A8IE 5DM73 1KTKA 1EYAA 4FP5D 4REZA 4RA8A 1O7YA 2D62A 4QB4A 5KEEA 3LNNA 2LS01 5KNBA 1PTOB 2M00A 5KYLA 2FE8A 3URYA 3P1MA 4AQ7A 3RFZB 1TS3A 2WXIA 2NN6H 5DM63 4A3DB 1TY0A 1CK1A 1HEZE 2WXMA 3BDOA 5JPNC 2I07B 2B8FA 3J7AF 4L63B 3MEHA 2D5DA 3IAYA 5CV8A 4P6VF 4UDUC 1O80A 3RMHA 1HXYD 1K50A 4JX1C 3AMZA 3NP8A 4ZKBB 2X6GA 3OMCA 4N9PA 1ZDXA 1RM6C 4DK1A 5IGCA 1N63A 1NYRA 1B3AA 5JOBA 1W6KA 5GXGB 3SK6A 2YU9B 1BDOA 3VRBB 4IKGA 2EYOA 5CV6A 5EPLA 2EE1A 4I65A 2B2VA 1SDFA 2JEAI 5C5LA 2WKDA 5CV5A 4X3SA 1MD2D 4ZLTF 3S15B 2E6XA 3TP6A 3P4RB 3BG3A 1WGKA 5C3XA 1DXMA 2O4XA 4FNFA 3PZ8A 1F2MA 4FXGC 1QOFA 1G6ZA 3AE5B 1BXTA 2Z4IA 1L6UA 4K5VA 1S5CD 3A55A 2K0PA 3V2TA 1WTWA 2YEPB 4EE2A 1C79A 1ET9A 1FRDA 4B0MA 2RPVA 1E0ZA 2M9VA 4L23A 2WV6D 3MXGA 4C3IG 1EYDA 4K6LA 3AEBB 2A6HC 5C6AA 2EY1A 1STBA 5C44B 3DM1A 4RF0A 2I46A 2WU5B 2WQYB 5C2TB 5ELBA 1L4ZB 1SJED 2XIWA 5CORA 2I38A 4L1BA 2GA4B 2WXFA 4KKJA 2WXHA 1ZE3D 1JROA 2HCIA 3HOZB 3S2HB 1H9RA 3AE7B 2ZXOA 3ZJTA 3MFGA 3LWUA 4CJ1B 5C0XG 2IX3A 3HOVB 3MWYW 1I4HA 1TWGB 1T3QA 5JXVA 3EVQA 4ZRQA 4XYQA 3NSWA 2RKSA 4JWUC 1BF4A 1WD1A 4HKZE 3SDZA 1FXAA 3RPFC 1XWEA 4CJ2C 4IALA 4X3UA 2EJMA 2SOBA 4F7XA 2L4NA 3MTSA 1EWHA 1JQ4A 2Q8TA 5EKLA 4FXKC 1TY2A 2MPMA 3P63A 1LACA 5CV4A 4OZBA 2MJ8A 1H9KA 2K04A 1RODA 1IYUA 2JA8B 4XDCA 3D4WA 3VR3A 2BA0A 2R7ZB 2XWBB 5BYRA 3KF8A 5FLXE 1A3UA 2ENBA 1ENCA 2AX5A 3L9AX 2WINB 2QCPX 4JPSA 1LLRD 3B2GA 1ICWA 1NUCA 2D2CC 3BVGA 1TZOA 2BBCA 2H89B 1AYFA 4N58A 5C4XB 1F2YA 1DZ1A 1TWHB 1SSOA 2BDNA 5BN5A 1OXVA 3MA2B 3E6ZX 1SEBD 1UWXA 3T56B 3P7JA 3KUPA 2K5PA 3SEBA 4CKBA 3AV8A 1GAQB 1NENB 1FR3A 1EM7A 3IT4B 1HA6A 2XNAC 4YSZB 4NMZA 1NEKB 2B2WA 2E2DC 1QKZA 4O1NA 3A7AB 2E2IB 2VB3X 3V3XA 1S5FD 1VZ7A 1XXGA 1B50A 1JWUD 3HOXB 2X38A 1OO9B 1UNSA 3GO5A 2VZKD 1IW7D 1W6JA 4KHZA 3FVQA 1JW9D 3RZOB 4IUPA 1E0BA 2QEJC 5CBAE 2JXMB 1ACCA 2MEKA 1V8QA 3FKIB 1SNPA 1HQMC 3CHBD 4CHTB 3NVYA 1EYCA 2Y3AA 1SYDA 3J7YW 4WQMA 5G5HA 1VRAB 5J39A 1XF5L 3IXSA 5J1ZA 2N55A 2Q8IB 2KWDA 1DOLA 1HFNA 2E76C 1FIQA 1AWDA 3MZ5A 2F0KA 1LTID 1R4QB 2WP9B 4GLSC 5ELCA 3A56A 2EY6A 5EE1A 2F0IA 4DXGA 2RMMA 4ZUJA 3T3NA 2XWJB 2NMQA 3S17B 4YTNB 2AQ2B 3D3RA 4TKOB 1XCTL 1QILA 2CW0D 2GRIA 1D5ZC 2MH7A 4DAYA 4B9XA 1ENFA 2EYJA 1YNJC 1PLFA 3QB3A 2CHBD 4KKSA 3A8KE 1D5XC 4RGMA 3Q24A 4J1MA 3M4OB 2R3ZA 3MJ5A 4KKIA 2K3UA 4K6DA 4KJNA 3I90A 3C46A 1GB4A 2A68D 1IHZA 5KIXA 1KDCA 5CYUA 1G8ZD 3PIO3 2WDQB 1EIHA 2ICEC 3BWUD 4KN4C 1Y56A 1CZPA 3C2PA 1PZID 4A3KB 2WXLA 3Q69A 4YSXB 1SB3C 1Z7TA 2EELA 1ZXTA 5A35A 3I3CA 2HCCA 3KQ4A 4WFN3 4A3JB 3IAM1 3Q23A 2VXWA 1IYVA 4MHEA 2I2YA 1XCQL 4IN3A 3HKZB 1RJTA 1PDXA 3PUZA 2J42A 2Y5CA 1NR4A 3RD4A 2KAJA 1C4CA 5HURA 4DXFA 3FRPB 1GJXA 1VZ6A 4HROA 1Q12A 2PO4A 1FNVA 1SNOA 1VCIA 1ZPSA 5MPOA 1XLOA 2YYZA 1BQQT 3ZQ4A 1DM0B 2PW9A 2EVBA 1O7LA 1ZYRD 4U68A 4YSYB 4RKBA 2PQEA 4RFBA 5JJZA 1K8MA 4OL7A 4DK0A 2IWHA 3M7GA 3P4QB 3MP9A 4FVMA 3PUXA 5TSSA 2BTEA 2G9HD 2RDHA 2AQ1B 4A55A 4IDIA 2B2YC 1T6BX 5G3LD 4H44C 4XQJA 3LX0A 2PVGC 2IGGA 4DQOC 2KOLA 4XIGS 3GQBA 4K2LA 1FMAD 3RLFA 3L3OC 2ID0A 3R8BA 1OFFA 3J7AV 2V3NA 2W82A 2WAQB 1BUVT 2A73B 3OOCA 1PFMA 4YWGG 3KLRA 1V1OA 3MFYA 1ZOYB 3OIQA 4B0EA 2CVRA 4C3HB 1TWFB 2RBMA 1CI3M 2PZWA 1DOXA 3R2IA 5JPMC 2B2UC 2J4XA 2KMMA 3DXJC 2OHFA 4IFDG 3IAS1 5KGUA 5JEAH 4HKQA 3NXWA 1CQFA 4IZ8A 2A68C 4QIWB 5H92C 4G7HC 1J8IA 5FOBB 3U7ZA 5FO7B 2NUCA 3W5VB 3E56A 2EDGA 1F9RA 4HSVA 3N52A 2IJ0A 3P4PB 1SNQA 5M5WB 1ZKOA 4A3FB 3H8HA 4OVZA 1SNDA 5FO8B 2F0GA 3GTOB 3J9CA 2IX0A 2Z1CA 4QUFA 2NVQB 3BVMA 1F2RI 4PMWA 4ZUIA 4PQXA 1D5MC 3ND9A 1YJJA 3MXNA 2M19A 5HI1A 2QKIC 1EOTA 4TRDA 1EQVA 4RF1A 1I4XA 3P4SB 1EWCA 3EGRA 1JORA 3S2DB 1ML0D 3OW7A 4C7YA 2WU2B 2F0EA 3SK4A 4GDLB 2KVMA 5C3WA 4KJOA 2RDFA 4US8A 2HQEA 1LTSD 3QOLA 1TKGA 2IDYA 1SNMA 1Z47A 5KNDA 2NBFA 1C77A 1N5WA 2VB2X 3HZXA 2WP8J 2DLBA 1BCPC 2KQ3A 1NAPA 5E4XA 3SFEB 4USAA 4HMJA 1SYEA 5CR3A 1GB1A 3BVZA 4XDXA 1BCPF 3ZJVA 1CJEA 1OXSC 3NTIA 4XT1B 2F0UA 4J6HA 3VRAB 2F0NA 2LY7A 2Y0SB 3BZDB 1QNUA 2WLBA 1ZP0B 4P16A 2WKCA 1XYIA 3EFXD 4L2YA 3SK5A 3TN2A 3E0JA 3I4MB 3ONAB 5M5XB 4NAWB 2RVLA 1KF6B 2BB5A 3H09A 1WWTA 4ITKA 5LL6X 2WDRB 3P20A 1IL8A 3VR5A 5M3MB 2KA7A 3NBIA 4ZHOA 3Q6SA 2QDBA 1DOIA 5ISRA 2TSSA 1R4PB 4EQOA 1L5PA 1QNKA 2DYMA 2F0TA 1A2UA 5KRUA 2FJ2A 4FO2A 2F0FA 1I7HA 2A6HD 4C3HG 1UGJA 4BA1I 5C0XI 1J7BA 2L5TA 1NVID 4G4KA 3FPUB 3D6WA 3NWSA 3GB1A 1XTCD 3U4EG 5AUKA 3AEAB 1YN5A 1QT9A 1KAAA 1XLNA 1PFBA 3AB9A 1PRTC 3LXFA 1FD7D 2B2TA 1PRTF 5C5MA 3U9OA 4K8IA 1RCVD 4BA2I 4IURA 1C4AA 1RTNA 1U4LA 4RNAA 1BO0A 1PGXA 4ID6A 1L0VB 5BMGA 4RH6A 1YN4A 2ZW0A 3AE1B 1SJHD 3GTLB 1SIJA 2FFKB 1N62A 3SHLA 4DF7A 1EY0A 1WSPA 2LGIA 5JEAJ 2K6AA 3S1NB 3CKIB 3BK2A 2FUG1 4AS1A 3BIID 3MC0B 3NTHA 4ZKCB 1SXTA 3HEJA 1TVXA 3I4NB 1JQYD 1A2TA 2WXRA 4LLGM 2IW3A 4HCEA 1WVLA 3QIAA 4KY7A 4TQUS 1LTGD 1EY5A 3I73A 4LJZC 4RCNA 2WDVB 2EYPA 2NN6G 1P7FA 1FFVA 3H0GB 3NBHA 3GD7A 4G7ZC 3D8GA 1H9SA 4KTAA 4G57A 1BMLC 1G2SA 5LHY1 5CV7A 1EU3A 3SR1A 1VF7A 5COYA 1OXXK 1SFOB 2DBYA 1X32A 4OZCA 1GUOA 3GTKB 2QJLA 1K83B 2XN9C 1NYQA 5FKAC 1TWCB 5C3EB 1DCZA 2MP1A 2YEPF 4XDDA 3M4YA 1WYGA 1V1PB 4LTUA 4YXDB 1MGSA 4HTHA 4KD4A 3M85A 2M56B 4KK7A 1I6HB 4A3IB 2ACZB 2XSCA 4KGRA 2K05A 4A3EB 4A9AA 4NDXA 3PO0A 3X3MA 2QMTA 5CC4A 2ZXRA 2NVTB 3AECB 2PPBC 2KCNA 1YQ3B 3I70A 4OO1H 1HZ6A 2CQAA 3A8JE 4RAUC 3VYTA 3SXHA 1EEID 4A3GB 4WRDA 3TDQA 1I3QB 2HDMA 5C4ZA 1B2TA 5HHDG 3I91A 1YNNC 1AW7A 1GHKA 2IPKD 3T16A 2K9XA 2PIAA 2JU6X 3KBGA 4N6EB 2EYMA 3AN1A 1GUTA 1ZEQX 2LFIA 2BB6A 3DMUA 5HG2A 1ESFA 1M8AA 2E75C 2QILA 4TMAB 3FILA 5J22A 4OO1G 5ELEA 1K52A 2RDGA 4WAFA 1MHXA 1O7ZA 1JE4A 1B9MA 3AE8B 1XX8A 1K51A 1STYA 3AEEB 3U52E 2NVYB 3T3OA 3U2SC 2BW2A 4P2CB 4H0LC 1VLBA 1CT1D 3KK7A 2H88B 3EROA 1EY8A 4PMBA 4MIUA 3CU7A 5ELFA 2G1EA 2OT2A 4DNRB 3ZGZA 3W3AA 4OIJA 1JWBD 4BWGB 1ILQA 4QF4A 4XQQA 1S4ZA 5EE0A 1R9TB 1YNJD 3PMFA 1BUIC 2DWQA 1B44D 1ZDVA 3KLSA 3DWGC 3I8ZA 3Q8CA 1KNAA 4ZRZA 5C4JB 1X3QA 1JMLA 1IKLA 4FF3A 3NVZA 1WTRA 2B63B 5H8YE 1TIID 4OHJA 2Q8RE 5BYQA 1O78A 4XQNA 3TEWA 1HCZA 3VQIA 1HFGA 1JOOA 2IT1A 4KGSA 2MJ3A 2L83A 3DHQA 1FEHA 4V0BA 4OZAA 4PNYA 1TYGB 2HDEA 1QLBB 1ZXHA 5KNCA 1QF6A 4NW2A 3TUOA 4C80A 2LUMA 3NS1A 1Z6HA 4U673 4Q5VA 3AU7A 1EWYC 2LMCA 4ZHPA 5T1GA 1STNA 3LWEA 3MHBA 5I9PA 2IL8A 3M3YB 2PW5A 3VYSA 4R9WA 4R3DA 2LJIA 4IOIE 2M0AA 3OPOA 1HTLD 4EVOA 3LB8C 4ME5A 1EZ8A 3TP8A 1SYBA 2IGDA 5I6YA 2SDFA 3ETRA 2WNMA 2F1MA 2M2LA 2JA6B 4QUCA 1Q90A 2MJDA 4N9TA 3TEYA 3IL8A 2PZTA 5K5PA 2ZW1A 3ND8A 4QCLA 2Z4HA 1E2VA 2DNEA 1AFPA 3R93A 4IFDI 3RUZA 2VUMB 1VMPA 4AYBB 3TEXA 2B2VC 3QWNA 3Q22A 5M5YB 1H9SB 4FXDA 2J7ZA 4DA2A 1IGCA 4QMGA 2R61A 1E10A 2JE6I 3HGBA 1G91A 4IUNA 4NAMA 3CIRB 3HVDA 2OEOA 1N61A 4JWSC 1PYWD 4V190 1F0ZA 4HMIA 1YQ4B 1I4QA 1SE2A 2PMVA 2L32A 1LT5D 3TP7A 1Q1EA 2A74C 1A70A 4D2KA 3T53B 4KGTA 1TQOA 1Y69U 1EZ6A 4X3TA 3RZDB 4ARIA 1B1ZA 2DY7A 2L9HA 3EUB2 3VR6A 3J80E 5EPJA 1XO3A 3AEGB 1DYQA 1GUWA 3P75A 4N59A 2XRSD 1TJEA 4IUQA 3K59A 4IUVA 1D2BA 2F0JA 1TKYA 1R7SA 1IGDA 3FC4A 2F0PA 4M1UB 1SF0A 4FF4A 1G2TA 1BNZA 1SNCA 5D3IB 2H1EA 2JSOA 4H2AA 4DU9A 1I4PA 3H3VC 5D65A 3DWAA 4JE3B 1FNWA 2PLPA 4ZK9B 1VDZA 1L0YB 2WXKA 3OSOA 3DWQA 1RYJA 1TWAB 4YT0B 1LTTD 3MXPA 4ZRPA 4EQNA 1UWMA 4TQ1A 1STGA 5E6JA 1BCPD 2A69C 3FILB 4MACA 4NKLA 2AWNA 1AZPA 2VZKB 3BDLA 3D4DA 1EY6A 2QSDA 3VR9B 4A6QA 1KLUD 2LHEA 4KY5A 3CWIA 4X3KA 1PGAA 3HOUB 2DN8A 2JWUA 5EQ0A 4KX6B 2X6LA 1WCMB 4PV1C 4IQZA 1LTAD 4A90A 3SE0A 3FEWX 2RA4A 4ILWA 3AEFB 4HAEA 1QOAA 4F87A 1Y1WB 1SMYC 1UUPA 1C48A 1QG7A 1Y8OB 1QB5D 3GP7A 5IIFA 3GTQB 4DAVA 3LYYA 1IUEA 3NWTA 2PW7A 4TSSA 1V1PA 1I4RA 2NTSA 3SR6A 2EY5A 2EPBA 2BS4B 2AWOA 3NK9A 2PKOA 3AE6B 5K36H 1CZGA 1EEFD 2DYOA 3C8YA 3VA5A 1RHPA 2BYTA 3ERQA 3W1SA 2SNMA 2K7VA 2WACA 2F0WA 4Z9CB 3IFDA 1VZ8A 1FD6A 5AUIA 1DGJA 4B08A 1QQRA 1XLQA 3TZUA 1C78A 2F0SA 3BYTB 3VR4A 1MI0A 2E2JB 1PRTD 2K22A 4R8IA 2B2WC 4O42A 4RHSA 4CKEA 3A54A 1FCLA 4KI0A 5JEAG 1JWAD 4K2KA 1RWSA 4K5XA 2LMCB 2NB0A 2F3WA 2ZT9C 4UAIA 4DFAA 4Q2JA 3J81E 1YJIA 1UEAB 2MHVA 1RTOA 2K5WA 1GUGA 2NN6I 2SEBD 5ELDA 1JWSD 4HEDA 1EFID 2JA5B 2C9OA 4FXCA 4CQNA 1Q1BA 1PDQA 2F0HA 3KLSX 1KABA 2HUGA 2EY2A 4YTMB 4C7ZA 3PV0A 4K5WA 3X3NA 4KKTA 1K8OA 3NHHA 1BBXC 1VR9A 5I9OA 1L6VA 1ZXIA 5T1IA 3G7LA 1AEXA 3DWMA 3GTPB 5JVG3 4J3OD 1V97A 2K28A 2L0CA 1C4QA 2NTTA 4RHRA 4ODGA 2JX5A 3Q8EA 2PVOD 2EJGC 4BBSB 3IKJA 3OIPA 1PXUA 1QJOA 3WCQA 3H6MA 3TZDA 3EA6A 2KJXA 5F2DA 1S5BD 3MXUA 3GV6A 1JC7A 3CRLC 4J8QA 4LMQD 5D14A 4XYOA 2L12A 4BS9A 2QF7A 3Q0AA 2CU3A 4ZAIA 3NQIA 2JA7B 1G291 3C1EA 3S1QB 3GV3A 1CQVA 4FYDA 4KKUA 3TP5A 2NZ1D 1PTOC 2OXPA 3NZ3A 1GPXA 2N88A 3SFDB 5M9OA 3DEPA 1JOKA 5BMHA 1PTOF 3TBIB 4FF2A 2XVSA 2V3PA 4MN3A 1I4GA 2B8GA 4OO1I 1LO5D 3KWVA 4C1NK 1YNND 4ZOHC 5BN4A 1WD0A 2R6GA 1E7PB 4GZYC 2F0MA 4IUUA 1MSHA 1ZUD2 1HUMA 3H94A 1H9JA 3AMUA 4US9A 1PRTB 1GXDC 2K5QA 3NPPA 5HFYA 4PMCA 2INPE 1QOHA 4DGZA 2AQ3B 2V0GA 1OXUA 4HSPA 2NWGA 2ONQA 3FAHA 3V05A 4Q0FA 5FK9C 5I2YA 3FDTA 1FFUA 2JYTA 5JVH3 2JEBI 2FHTA 2KCCA 1CA6A 2WXOA 5EKIA 4F8MA 1TKWB 4NJCA 1WTXA 3K5NA 2N0SB 3JAML 3D6CA 3K58A 1KDAA 2V4IB 1RKNA 2BE5D 1F2LA 1OQQA 5LNK1 2GI9A 2PNRC 1C9FA 4RGOS 2MJEA 1IKMA 1WTQA 3FPPA 1QOBA 2EYHA 1LV9A 1PFDA 2BS2B 3J80L 2W55A 1DOMA 1LABA 3A7LA 3G6JB 5EGTA 3AE2B 1NSNS 2W3SA 4RCOA 3MHZA 2N7JA 4PT5A 1OQRA 2F03A 1T5EA 3NTKA 2EZVA 1JICA 1II3A 5EE9A 1DOYA 1I50B 3GS2A 2H4OA 3U9SA 2KUMA 2NYZD 4OIKA 2L55A 2FBWB 3F2UA 5CBEE 3PO2B 2D5GA 5C0XH 2XRQD 4A93B 5D3DA 2KEEA 3L4PA 3QOJA 1LTBD 3P42A 4LAAA 1EIGA 4WORA 1H9MA 3AE4B 2KACA 1PTOH 1MI2A 5C3JB 5IODA 3Q8BA 2WXNA 3S16B 4Y7NB 3PZ7A 4C3JG 2C5CA 1SSNA 2IX1A 1KFYB 3S14B 2PYKA 5BN3A 4WH4A 1D6EC 4HEA1 3HOWB 1FNUA 2EYLA 1RDPD 5DAUA 4F88A 4TQ0A 1HA5A 2JXTA 3N9YC