1ENFA

Crystal structure of staphylococcal enterotoxin h determined to 1.69 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
212
structure length
212
Chain Sequence
b'DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN H
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 71
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2000-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1enfA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1enfA02
1STEA 1HQRD 1BCPF 1CK1A 1PZID 1SJHD 1DJRD 5FK9C 1RF2D 1M4VA 1S5DD 3DWAA 1HTLD 3O13A 2TSSA 2RDGA 1SE2A 4ZYSA 1CHPD 1PRTF 4NZLB 1BCPD 5ELEA 1LLRD 1YN5A 1BCPC 1SE4A 1JWSD 1LT4D 1HXYD 1I4HA 2J4XA 2RDHA 3EA6A 1B44D 1CHQD 3OWEB 2WV6D 5D3DA 1TS4A 1XTCD 5ELCA 5ELBA 2NTTA 1AW7A 5D3IB 1PRTD 1V1OA 2R61A 3DWQA 1FD7D 1LTTD 4RCOA 3BVMA 1PRTC 1HA5A 1PTOD 2CHBD 3R2IA 4Z9CB 1D5ZC 1TS5A 2ICIA 1UUPA 1L0XB 3KLSX 5ELDA 3TSSA 2QILA 1JWUD 4TSSA 1ET9A 1FNWA 1PTOH 1ET6A 1LTAD 5ELFA 4L63B 1I4QA 1MD2D 2AQ2B 1EU4A 1LT6D 4BWGB 1YN3A 1L0YB 1PTOF 2Z8LA 3BVGA 1BCPB 1SEBD 1LT3D 1SE3A 2O2LD 3BYTB 2QEJC 2G9HD 3BYYB 1EEID 1JR0D 1D5MC 1KLUD 4RGMA 1PZJD 1I4PA 1SXTA 1BXTA 2NTSA 1PRTB 3MC0B 3BVZA 1TY2A 1S5FD 5I4DA 1PTOC 2XRSD 1LTID 1PTOB 1RCVD 1FNUA 1SJED 3URYA 1KTKA 4UDUC 1S5ED 1TS3A 5FKAC 1PYWD 1PZKD 1LT5D 3R8BA 1YN4A 1FGBD 1EFID 1JQYD 1GOZA 1KLGD 1XXGA 2AQ3B 2IPKD 1FNVA 4RH6A 1AN8A 4RFBA 5TSSA 1D5XC 1CT1D 3EFXD 3MFGA 4RHSA 4RGNA 4RHRA 1B1ZA 4C56C 1TS2A 2XRQD 1LTBD 1RDPD 1EEFD 4RGOS 1D6EC 1DYQA 4L6TB 3R2TA 3SEBA 4DXFA 2AQ1B 1LTRD 1ESFA 1I4GA 1T5XD 3V05A 2XNAC 1I4RA 1JWMD 1F77A 2SEBD 4DXGA 4OHJA 1CQVA 1G8ZD 3CHBD 1RD9D 1QILA 1I4XA 1S5CD 3GP7A 4RGTA 1JCKB 1LO5D 2XN9C 1SBBB 1LTSD 2IJ0A 1EU3A 1TY0A 3DWPA 4O1NA 1UNSA 1LTGD 1S5BD 1V1PA 4K6LA 1EWCA 1V1PB 3BZDB 1ENFA 3W2DA
chains in the Genus database with same CATH superfamily
2VY3A 1STEA 5E4XA 5FJ8H 3C19A 1P8LA 2LFNA 2WU5B 3MC8A 3PHWB 2OQKA 4REZA 2EE1A 4A4IA 3DWAA 2KJRA 3J81c 4K5WA 3HKZE 1BKBA 4DR5Q 4KN7C 2DYOA 4FVMA 1PV4A 1C1YB 2ZVOA 2KCNA 2XK5A 3HRDD 3NZUA 5AUIA 2L0CA 3RCZA 1FO4A 2M0XA 2OT2A 5M3FH 1JB3A 4K0KQ 3CAMA 1J8IA 2UUAL 5KGUA 1P7EA 1ZDVA 5K36G 5EE9A 2IO1B 1EY4A 1EIGA 1TWGH 1XWEA 4PZ6A 4S17A 1XX8A 1JICA 1XNRL 2WXHA 4DUZL 1D3ZA 2F0HA 2NWGA 5J17A 3ONSA 2NN6H 4A3EB 1FJGL 4OGQC 1ZGUB 1PTOD 4JW0A 4C3JG 3AECB 2EYLA 1RLFA 3NUHB 3RPFC 2EY5A 4RF1A 3K9PB 1OXTA 1KDAA 2M17A 3HVDA 5EE3A 3WCQA 4A3PA 3I90A 3T13A 4HJ7A 1B9NA 1A0IA 1X32A 1MI0A 4PG3A 2FCMA 4ZOHC 3I5JC 5ELFA 5KYIA 1SRUA 1L2FA 3ONAB 4HJAA 2W9NA 3IAS1 1BBUA 2XIWA 3S1MH 2F0MA 2N9LA 3ZKJC 4A20A 2WP8J 3ZRFA 2RCNA 1WRIA 2INPE 2X6LA 1U4MA 3K80C 1X3FA 4JPBW 1T5EA 1TWFB 4A93G 4BY7B 3PGEA 3RNCC 1Q7YC 1ZDXA 4NXML 1PVOA 2ZTDA 3OW2A 1G2SA 1XCQL 1EQTA 4DR3L 3JSVA 2N1VA 3AE1B 3P1HA 3MXUA 2BBCA 3A55A 3D0FA 2C7HA 4LJOB 1CZPA 1HZ6A 3KF6A 3URYA 1KTKA 4GN4B 4F1SA 1H8CA 1TIID 2L83A 2XGTA 4KK7A 4IDIA 1EY7A 2AQ3B 1C9FA 4AYBB 1L7YA 3AB5A 4O2DA 3VVWB 2JQRB 2LJIA 3SHLA 3B1LX 4A3DH 2M19A 4IJHA 5AEKB 4RHRA 2GBRA 3P75A 3CRLC 4HJ9A 1ZPSA 3TN2A 1H9SA 3KLRA 2CHZA 2WXNA 3E9SA 2F0TA 4MT5A 4EQNA 1D6EC 2D3AA 1A63A 2K5NA 1HPCA 4DXFA 2F0PA 4NDXA 4RG1A 3PQIA 1LTRD 4KSLC 2Z0EB 4DNRB 2E5LQ 3IT6B 4BKSA 2Z6KC 3GE3C 2RGFA 1Y69U 4TQ1A 4XGAB 4M8AA 2DY7A 1O7IA 2GBNA 4LF4Q 4U673 2BA0A 3S2HH 3U4VA 1WGGA 1WRDB 1HZAA 2FMMA 2JWZA 1XNQL 1A3TA 4S3SA 4BXXG 3H0GB 2KO3A 4BFRA 1GHJA 5D7GA 1P3QU 3ML8A 4CKCA 4HEA1 3GTOB 2B2TA 1XD3B 3HM3A 1C9OA 2V3SA 1FCLA 1K83H 1EWCA 1NENB 5GAEC 3DVNV 3VXWA 3FILA 3QR8A 4G7OC 1STAA 3V6EB 5C4XG 1C79A 1WZ0A 2MNAA 3G6EA 1TYGB 2YU9B 3ITPA 2JJQA 2NS5A 5DPWA 1U4PA 1GXDC 3O13A 3VR3A 2K75A 1VQ9A 4AP4C 5COYA 2W82A 1NBWA 5J39A 1C76A 1KAAA 4XX5A 4A3FH 2IT1A 5HG2A 5CV5A 5J22A 3A7AB 4DV5Q 2FAZA 4ULLA 5IP7G 2IO0B 2Y0SG 2BW2A 1Y1WG 2MJDA 2K25A 3ZDMC 3RZWC 1Z9FA 5BMIA 2K32A 3NUCA 1EY9A 3OWEB 5DLQE 2E2IH 1YZ6A 4GDLA 4V0BA 5HFYA 2KFJA 3NBIA 5ELBA 1IYVA 2RSNA 3V96A 4JI7Q 1ONLA 1E8WA 2VZKD 1AW7A 3QB3A 3DWQA 2F0KA 1FD7D 3TP5A 2RDFA 1SYGA 3W1SA 3D4DA 2PCFB 5C44H 4A3IB 3NQIA 2HHHQ 3CCQA 1C4QA 3PZ8A 4W9GA 5IA7A 1YX6B 3I55A 3A0JA 3I2ZA 3NSWA 4JI1Q 2DN8A 4DAYA 1XMOQ 2X6GA 2ZJPA 4K5XA 3DVGX 2O5JC 1GJXA 1ZXTA 3SR6A 4DWFA 1HRJA 5AJ3Q 4M00A 3RT3B 5EPKA 2DZKA 1U4LA 1ET9A 2OTLA 1WJ4A 2AEHA 4OWTB 2MEKA 2MRPA 2O6VB 1EYDA 3H09A 1HUNA 1P9DU 2ZTCA 2JY6A 2EDGA 3T51B 3GTGB 3VTVA 2K6DB 4POFA 1EZ8A 5DM63 1SEBD 2SDFA 4A3CH 1K8MA 1OXVA 2JEAI 2GBKA 4PMWA 2RHQB 2KDMA 4WWOA 4EQ5A 1CTMA 2BOSA 1F0ZA 1V5OA 1Q81C 3NXWA 4MN3A 2WU2B 4CJ1B 4O42A 3WWVA 2BDOA 3ABVB 5C5LA 3QOLA 1NSNS 4GLVB 1WYGA 4GIVA 4BKSD 1CM9A 4B95A 1XTDA 4G50A 1PTOC 3A5ZB 4PZ8A 1BF4A 1QB5D 4APVA 3VH4B 3M4QA 4AQ7A 1WJNA 3MEHA 1GHKA 3S17B 4DR7L 3R8BA 1X9NA 4BY1B 2KK8A 2QIEB 2N3SA 1SYBA 3EQLC 3PCOB 4JBJA 3K0YA 3L7ZC 2UXBQ 2B2UA 5L83A 1G6ZA 4JV5L 2MBEA 4CDDC 4DN4M 5KEEA 4BBRG 2PW5A 1P16A 2E76C 2ATWA 2KOLA 4DV4L 2GOWA 3RR5A 3V2TA 2WX0A 4KX6B 3BZCA 3A5UA 1T6BX 1UF0A 1GUTA 4GLSC 1FRRA 1SSNA 1I42A 2EIFA 3BJUA 4DV1Q 3BINA 4JI6Q 3OHXC 3ZQ4A 3UDGA 4LFAL 2O6VD 4AJWA 4FULA 3HOVG 1MFWA 5IGBA 3CCRA 3I4MH 4EZKA 5IYDH 1G8ZD 2HQEA 4EQPA 3HOUH 3I4NG 4A3BB 1DGJA 4YWLA 1YIJA 1N61A 4MH0E 2MSED 1GC6A 2VQEL 5IP4D 1QLBB 1VF5C 2FJ2A 1R4NB 2BYFA 2D3GA 4H0LC 3IKJA 3NTKA 3KYHC 2VQFL 1JE4A 2ZXRA 1PFSA 1CJEA 2KHIA 4KDLB 4PT5A 1JJCB 2H89B 4PYUA 2WXKA 1E2WA 2MJ3A 3GTJB 5G3LD 1XO3A 2K5QA 4DR1L 3KFUA 3UE0A 1RODA 1F2ZA 2FIFA 1WGRA 4OO1H 3ZXRA 1TWHB 4WWNA 3FRPB 1GUGA 1LM8B 2N4FA 3Q69A 2TSSA 2CHXA 3BWUD 2R92G 1U9RA 2RDGA 1Q1OA 3L17A 3MC9A 4KIKA 1Z6HA 1WXQA 4CQNA 1CHPD 1E3PA 2KUMA 5C5MA 3S1RH 2WXOA 5BYRA 4EFOA 4N9PA 3AE8B 1YN5A 1SE4A 3SDZA 1LT4D 3M85A 5CBEE 2E75C 5ISRA 1OXSC 1N5XA 1TZOA 2DY8A 4JBKA 3GTMH 2RPQA 3KF8B 1OXUA 5D3IB 4M01A 4KI0A 3J81j 1AZQA 1VZ6A 2ICEC 1JWAD 3M95A 3HM6X 5IE8A 1PFBA 1WCMB 2GN5A 3HP3A 2F0UA 3KUPA 3TEXA 2YTYA 1XYIA 2LSSA 4V190 2JZZA 2ICIA 2BGFA 2WXJA 3U9SA 4TMAB 1A2UA 5CHFA 3SGIA 4FF1A 4HROA 4BOZB 3I91A 3EC8A 4GOCA 4JOIA 1LTAD 3GD7A 4EX5A 3WANA 4EEWA 3H7PB 2DGYA 3Q3NC 5M9OA 2FINB 4KJOA 3AULA 1TKGA 2K5DA 3GZNI 3OOCA 5JEAH 3LWUA 3OJ4B 2O2LD 2V0GA 3ZJVA 1VR9A 2OQ0A 1F9PA 4GDKB 1EUVB 2UU9L 3RI7C 1KLUD 1VD2A 2NCNA 4OWWB 2F4VL 2R93H 1G2TA 1RTOA 2OJRA 2F0VA 3N9YC 1VQOA 4P73A 4AQYL 1J19A 1FL0A 2ZJQA 4X57B 4TVAB 2JA7B 3FKYA 2PZUA 3OPOA 4JWSC 4BS9A 1GOZA 2A5HA 1MJCA 1KRSA 4A3MB 3VUWA 5IOIA 4X66L 4IUUA 2JYTA 1KABA 4X3TA 3HOWG 3S2DH 3GV6A 3ZLZA 4DA2A 4DV2Q 2BKFA 2KHWB 2UUCQ 1LM0A 2KACA 3IVFA 3PIOA 3BDCA 2MO1A 4FHJA 1SYEA 5IT9E 2D5GA 1SNMA 1XCTL 4G3XB 3UGBB 1N34Q 1GC7A 3WALA 1RL2A 2D9UA 2LXKA 2JA8H 4MJSA 4OZCA 2G9DA 2XNAC 3RNUA 3O65B 1TVXA 1WYDA 3FP9A 4KHPQ 4OHJA 1K9MC 2KLGA 5M5YH 3GTKH 2JXTA 3ICEA 3GP7A 3RNBC 2RMMA 3PO2G 1I6HB 3PTFC 4OVZA 3MEFA 1L6UA 3OSOA 3LDZE 5A2QE 3QAQA 3D4RA 3K58A 2WB1G 3S14H 4J1MA 2IX0A 1NY4A 5C3EG 2B63B 2F0WA 1J8CA 4QIWB 2JSOA 1VS0A 3T16A 2E6XA 3CKIB 3CMEA 4AUQC 1XLNA 5IWAQ 4KN4C 1WD1A 1QQRA 4X3SA 5CX3A 1HFGA 4C3IG 2KTRA 4IUPA 3JAML 2Y5BB 3PHXB 4C3HH 2CQAA 2WAQE 2BYEA 5L95C 2A68D 4XTCS 3TS0A 1KIXA 1EFWA 2NVQB 4X62Q 2XWBB 2DZJA 1MKHA 3PF4A 2VUMH 3GE8C 4R4IA 5C4XH 5FJ8G 1GUOA 5C4JH 2K52A 2N9PC 3KJPA 2VH1A 2JA5B 3VR4A 2YTXA 1EUJA 3PUYA 3N32A 4NPSA 1ENCA 3OLMD 1I4HA 2J4XA 5D3DA 1KOTA 1MSHA 1OEYJ 2N49A 4X3UA 1IKMA 2GA4B 1F2RC 1WOCA 3Q3OC 4ZQ3A 4A3GG 2KDEB 5EE0A 1X55A 3MZ5A 2ZJDA 3VH3B 2AL6A 2KKCA 1PLFA 5M3FG 3BVMA 1HA5A 1B50A 3K0XA 1KDCA 1AZPA 4YCWA 4DV6Q 2E8GA 5IODA 1V9JA 1KDBA 1E7UA 5M5WB 2MP2B 2UUBL 2SAKA 2MBHA 4IOIE 5EKLA 3T53B 3A54A 2OEOA 3J81i 1LQBA 1IKLA 2INDC 3QWZB 1IW7D 2KCTA 4TSSA 1VQLA 4WJ3M 2NN6G 3VRBB 1PTOH 4GS3A 2I5HA 4LUOA 3D3RA 2GBMA 1WGDA 2EKEC 1W3SA 4JIOU 1B8AA 5C23A 2QKIC 3AEBB 1PTOF 1L2NA 1TWCH 4CHTB 5JH5C 2DYBA 4G7HC 1J9OA 1HNZQ 2A6ED 3MTNB 2D62A 1EEID 1N63A 4BBSB 1LACA 3HOZB 4HAEA 1D5MC 1NYRA 2X69A 2ZNVB 2BQQA 1H9JA 4QUFA 4M02A 4L5RC 3CCVA 4A3KB 2EXDA 1SXTA 1WX7A 1WM2A 3NBHB 1E2VA 3ZJUA 3D32A 4FA6A 4JE3B 1S5FD 1A6XA 2VNUD 1Q82C 4GN3B 1G91A 4KKSA 2PTLA 4B3ML 1SNOA 4UP8A 1R7SA 1MHWC 3A9KB 1I5FA 2LRUA 2JSVX 1YN4A 2K0PA 3V60A 2D3CA 3RUZA 2W54A 2CU1A 1KQSA 2F0JA 3HOXH 2LD9A 4GKJL 4W9HA 4HR7B 4ZKBB 2K7VA 3APFA 4CO7A 5C2TB 4MZ9A 4I6NB 1A62A 3AU7A 3CC7A 4JI5L 3U50C 1C8CA 5DM73 5ELOA 2K39A 3DWMA 3ND9A 3RZFA 2JPHA 5D6JB 5HGQA 1EEFD 2WXQA 2J7ZA 4L6TB 1VRAB 1V9PA 1IBKQ 3J80L 3UIPB 2HE7A 4ARIA 4LFBQ 3KK7A 4A3DG 1R4MI 3W3AA 2W3RA 2RA4A 5IYCG 1AFPA 2FNJB 3CCMA 1LTLA 4USAA 1I4XA 4OIJA 4JC0A 4UPAA 4FXGC 4ZCKA 5FO8B 3GOEA 1SSOA 2L55A 5IGGA 4JI0L 2F0LA 3LNNA 2UXDQ 4X65L 4GMVA 5JJIA 2E2DC 2UXCQ 2QGQA 3MXNA 3LWEA 3N30A 3A9JA 4K14A 1BUIC 4K6LA 1XLPA 4EZJA 4PZ7A 2LGIA 4X64L 1XF5L 1B7YB 4Y7NH 2WLBA 2C7NB 3MHZA 4ITKA 2D2CC 2QMTA 3TEYA 4OZBA 1SIFA 4KY5A 4NMZA 1F52A 2R7ZB 2ZCCA 1QKZA 3DBRB 4KDIC 5L37A 2KANA 2Z6KA 1JW9D 4KHZA 2E3TA 1NYQA 3V62A 3PMFA 2JRHA 3OMCA 2KDIA 1GO3E 1SE2A 2MBBB 1HR0L 2ZJRA 3T56B 5C0XH 5LMUQ 1G291 4P7IA 5IO9A 5ELEA 1LLRD 1PYSB 2LY7A 1B44D 1CHQD 3P7JA 3LGJA 4G0NB 4MACA 1TS4A 2KX3A 3TREA 2LMCB 2YTVA 3RLFA 2WFWA 4A3FG 4LF7Q 2YV5A 4C2MH 2PW9A 3GS2A 1PH4A 5LXHA 3DVGY 2B76B 1G6JA 5EDSA 1VQDA 2PNHA 4KKTA 1DXMA 2MBOA 3AU5A 4PS3A 3AE4B 3CIRB 4DR4L 1S3SG 3TSSA 4C3JB 2BWFA 2IHEA 1JRPA 1RFKA 2EYMA 3AB9A 5E7NA 4LNQA 3K7AH 1SE8A 5E4WC 3KYCD 3H3VH 2I5MX 3D8GA 1WSPA 2F0GA 1SDFA 5JJLA 1GUAB 3AH7A 1EU4A 1LT6D 2B2YC 3NJTA 2D3BA 2VW9A 4JI4L 1K51A 2L5TA 1SMXA 4I7ZC 1IBXB 5H1SE 2LKVA 2Q2UA 1RHPA 2RVLA 2ZXPA 3S16H 2Y5PA 4HKZE 3MVVA 4OONA 3M3YH 3ZJYC 1JR0D 4J3OD 2JN4A 4JQWC 4NXMQ 2SNMA 4MDKE 1N62A 3G71A 5KYLA 1WGHA 3GTPB 1ZKOA 4A93B 4AIMA 1NMFA 3K6OA 1TY2A 5E6OA 1WFYA 1Z5SB 3NENA 1WX8A 2AKWB 3ECIA 4HDQA 3CMMB 3L10B 5BR8L 4IG7B 2MA9B 3V61A 2QJLA 2BS4B 4ZLTF 2VB2X 1ILPA 3WIMA 3M7GA 1KLGD 3KBGA 3N1YC 2PVOD 2L0FA 2H5XA 2B39A 4RFBA 4LTUA 1OQQA 2MPMA 4E6IA 1ZYRC 3OTOL 2L12A 3KOJA 2KOXA 1GNUA 2WP9B 5LHY1 3R3OA 5C4HA 4K3CA 2LS01 1UELA 4NJ7A 3PRMB 1CKNB 3CWIA 4ABNA 3U30A 3H6MA 2N78A 1X3QA 1L1OC 3EROA 2A6EC 2JQOA 1Z7TA 2EYPA 4MNOA 2LRWA 4DV3L 3F2BA 3VDYA 5GMVA 3EVQA 1F1HA 1BQQT 2LGSA 1SMYD 1ESFA 5EBDA 3CQZH 3S9WA 4H44C 1V6EA 5GXGB 4C4VA 2EYJA 3NELA 1JROA 3AI5A 3PZDA 2KBNA 4AYBE 1E22A 1EY0A 1EIYB 3EUB2 3TIXA 1XNQQ 1VZ7A 2O2VB 2BS3B 1EQVA 1EZ6A 2RD0A 4R1JA 2WWZA 4N9TA 1GVPA 4ARCA 4K8IA 1GD7A 2WNMA 1OXXK 2HDLA 2WXIA 3U7DA 3X23A 3I4LA 5E1FA 5IGFA 5IYDG 2KCMA 5C0XI 3HOUG 3I4MG 3C8YA 1RFAA 2IX3A 3RZDH 1CK1A 4F7ZA 2K28A 1RF2D 2NPTB 2DJFC 2BYTA 3BK1A 3ZTDA 5EAYA 1TIFA 2B8GA 5IAAC 4B0MA 1NDDA 3S15B 3H1UA 3KLWA 2YYZA 2AWNA 5G3LF 3CC4A 1I3QB 5GAHC 2B2VC 4WJ4A 2Q2TA 4L23A 3Q3FA 3TS2A 4OO1G 3GTQB 4B3TL 1WMHB 1Y1VH 2A74C 3A74A 3SE0A 5HGTA 1HXYD 1QOBA 1XQQA 2BB6A 3U52E 1CKOA 1OTCA 1Y8RC 4PQXA 2Y0SB 1Y1WB 1HJPA 4KY7A 1LV9A 2K50A 2M1MA 2ZNVC 4XWTA 3H3VI 3A4RA 1SAPA 3NTIA 3I3TB 2R7FA 2K05A 1AYFA 3SK4A 2LHEA 2ALYB 3GV3A 2Z0SA 2JRIB 2MLBA 5IGCA 1FM0D 3F2CA 1J0GA 1D5ZC 1AE3A 2PEAA 1I94L 2CWAA 1EQQA 2O4XA 1TKYA 4PV1C 1UUPA 3J81E 2LI5A 3QIJA 5ELDA 3CPWA 1Q46A 1ASYA 4A3GH 2V4LA 5MPOA 2KWDA 4E71A 3LJ3A 1V43A 2EYFA 1JMCA 3DUZA 1TWAB 5EJWA 4NPNA 3SDLC 1QE6A 2YEPB 4DHJD 3WDNA 4MM3B 1PH3A 4YL8A 1NBFC 2X38A 2A6HC 2DJGC 4JG2A 1UBIA 2M8SA 2MCNB 1VQJA 1EYCA 1YVCA 2AX5A 4XQNA 1ZXIA 2K8CA 3NS8A 4KKIA 5DAUA 5C4ZA 1F2YA 2PQAB 1Q1EA 1FVIA 2N8NA 3CMAA 2JA6H 1VQ8A 3BVZA 2XWJB 1O7ZA 5JEAG 1CUKA 2CS4A 3AE5B 3RYTA 2BPSA 2WDRB 1EY5A 3DHGC 1YJ9A 1Y8OB 5JVG3 3I56A 3D6CA 2E2JB 1K8AC 4IQZA 4LNKA 1XXGA 1N33Q 3A56A 2AWTA 4Q0FA 2AL3A 2R93G 3KUZA 2NVTH 3AN1A 4JV5Q 2WXMA 2JWUA 3MFGA 1I35A 1R4PB 3RN2A 2JVCA 1B1ZA 4JVZA 3GQBA 1NEKB 3TRZA 2JZ3B 4KZCA 3G48A 1WJJA 2K6AA 1BVSA 2CJOA 5DPRA 1IBMQ 1VQKA 4BBRB 2KT7A 4OW0A 5IKCM 2HTME 2KJHB 3NG0A 2XVSA 4P71A 1C48A 1AWDA 5CYUA 1T0QC 2ZW0A 4LFAQ 2DHZA 4WAAA 4HJGE 1ZKHA 3R7RA 4BVUC 2MJ8A 1N60A 5HKHA 1QVFA 2PMZB 2DAJA 3FC4A 2VQEQ 3HOVB 4ZUJA 3I4NB 1WR1A 4PMCA 2VQFQ 4AWJA 2JA8G 3EFCA 4W9DA 1E6EB 4XYOA 1D1KA 3BK2A 2ZEQA 2KDBA 4IKGA 3NPPA 5IYCH 1X3EA 4DR1Q 4NNJB 5FOBB 3ZO5B 1QJOA 2G4DB 4MGZE 1A2TA 3QA8A 4DK5A 2SOBA 2MHJA 1PDQA 1F9QA 4B3SQ 1XPRA 1KNEA 1WTOA 4KMUC 2W55A 3E56A 2CH4W 2FHTA 1V8CA 2J0JA 3I63C 4XQQA 2M9VA 3Q22A 4LFCL 3NWSA 5G5GA 1SMYC 1VQ5A 1BR9A 3HGBA 4LCDE 4CKBA 2RCFA 2IGHA 1F2MA 2JA7H 2A69C 2R92B 2PMVA 2NZ1D 3PSEB 5T8IA 4CJ0B 5FLXL 4C3HG 1YIWA 3J9CA 1J5EQ 3NP8A 3GTLH 1EF5A 4DAPA 3QJZA 1CKMA 2MGSA 3DMUA 5FLMH 1GPXA 4FF4A 3BY4B 2VUMG 4DXAB 5ELNA 4YHHQ 3DQVA 4GKKQ 1TKWB 2MBQA 2ZW1A 1F2LA 1P7FA 2K4KA 3DBLI 4Q2JA 1J7CA 2PO4A 4ANVA 1J7BA 2PIAA 1PGXA 3A33B 4OWXB 4J6IA 2KJXA 4B08A 1E2ZA 4ZKCB 1B4OA 3M7NA 4O0AA 2O6VA 3I4OA 3TUOA 1FD6A 2NN6I 1FNWA 4R4QA 5KNDA 4YY3Q 4FADA 4BBNC 4CHKA 2M0AA 4LWCA 4C7ZA 1QUQB 3A8KE 2L4NA 1BCPB 5I6WA 1L4DB 3PRPB 3AV8A 3T3NA 5M5XB 1N32L 1MSGA 2IO3B 2QF7A 4WQMA 4GN5A 2IL8A 3W9CB 1I50H 3RN5A 3L0OA 3BDOA 1EYAA 1CSPA 5IY0A 2UU9Q 3CXCA 4Q5VA 1TU2B 2OTJA 1ESRA 3H91A 4OEMB 2KYWA 2ZM6Q 4N9F4 4R4TA 3P2BA 2K1FA 1KJTA 1IYJB 4ASWC 2JXMB 1AEXA 3TDQA 4K8JA 1LGRA 3JYUA 3RNAC 3QIAA 5CGKA 3QG1A 2E2HB 1FGBD 4DKAC 3R93A 3ZNID 3I3CA 3TL5A 3B9JA 2CQOA 2HQLA 3ZGZA 4UY8C 2JA5H 3L3OC 4RHSA 4BOSC 4FDBA 4XDXA 3NRZA 2K5VA 1K8OA 4QF4A 3S1QB 1NI2A 4XXEA 4BKTA 2KECA 3R2TA 1VZ8A 3HOWB 4IJLA 1DOYA 3HOXG 1E8XA 2Z6BA 5AFWA 1I4GA 3W1BA 1TTNA 4MSMB 4B6WA 2DNFA 2F0DA 3NY5A 4LNOA 3QK0A 2GVBA 1VQCA 3JAMc 4NAWB 2J7QB 1B3AA 1TKEA 4RAUC 3ERSX 3B08A 3RMHA 3I72A 3CD6A 3AM9A 1TY0A 1HTOA 2IDYA 4O1NA 2RR9A 1NR2A 1EOTA 3SR1A 4JI3L 3ULPA 5J2RA 2CFMA 5JXVA 5KIXA 4J6HA 1WTQA 3PO2B 2B2WC 2JX5A 4DBGA 3RFZB 4ZDVA 1KXLA 3P4SB 1TR5A 2WB1B 4G57A 5C3EB 2KXJA 1WJ6A 1Q3LA 3F2DA 1L6VA 4LF8L 1VLBA 4DAYB 2WYQA 2WKDA 4C3IB 4JX1C 1G51A 5G5HA 4ANXA 1WD0A 1U4AA 3MFYA 1O7LA 1O7YA 1BBWA 1Q86C 4B3RL 2L00B 3Q24A 3N1ZC 4LUVA 3NHHA 4ZUIA 1U0LA 2MHVA 4CJ2C 4W9JA 4IZ8A 3CCEA 2IZVB 1WTHA 2KFKA 2KC1A 4QIWE 1JJ2A 4TV3A 4R4OA 1G6PA 3VA7A 4R3DA 4UP7A 5C0XG 2R61A 2N55A 4A3LH 1IBLQ 2OHFA 4NW2A 2V3NA 2Z4IA 4R9WA 1PH1A 1STBA 3LX0A 1XLQA 4XDCA 4Z9CB 1NUCA 1C3TA 1TS5A 4GU2A 5LMNQ 3G6JB 2UUBQ 5M3FB 3KLSX 1SROA 2NVXH 4QQBX 2I1JA 3H7PA 4CDEC 5M3MH 3KQ4A 4NAMA 1TWGB 1VQEA 1V1QA 2AQ2B 3VYTA 3NTHA 1HZ5A 4BWGB 4DGZA 1UE5A 3MJWA 4FJZA 4ZHPA 4YSXB 4LLGM 3H94A 3ZW3A 1VQ4A 2F0QA 2KWVB 3BYYB 2YLMA 3DHQA 4A3JH 1Y14B 4RGMA 3UDIA 3KYDD 4K1RB 1BXTA 1OGWA 1PRTB 5FO9B 2E5LL 2ID0A 2GVAA 2WIIB 4M0WA 1N36L 4DR6L 4ZRKA 2K1BA 4H02A 1SFOH 4IPHA 3M4OH 4YIJA 1KD1C 3PO3H 1WGKA 4LF4L 2C60A 4UDUC 2KEDA 2EMTA 1LYLA 1WZ3A 3S1MB 3BZKA 1H4RA 3ENEA 3J80c 1WR6E 3QQ8B 2GI9A 2WKCA 3PREA 5CV6A 1FNVA 4RH6A 1HE8A 1V81A 2CHWA 2B2YA 1K3RA 3QJYA 2R6GA 4YCVA 1FEHA 3IAM1 2JA9A 3U4ZA 4ALPA 3FDTA 4WJWA 4DAVA 1YHQA 4L1BA 1HNXL 1MHHE 2OEDA 2CW0D 2JF5A 2F0SA 3J7YW 1HEZE 4IWOA 4MHEA 4GLAC 4FLHA 1SYFA 1TS2A 4NXNL 1EY6A 3STBC 2KMMA 3E9IA 3HKZG 1DYQA 1EWIA 3HOYH 3Q6BA 4KGTA 1PH2A 3P42A 1STNA 1H95A 3FKIH 2HJ1A 4DK0A 1PFDA 2NZHA 3NEMA 3C2PA 1WI0A 4JI8L 3L08A 1SB3C 3QARA 3IXSA 1FRDA 2XSCA 2L76A 4DV5L 4RCNA 5E6JA 4HCNB 4A75A 4HPPA 2NVYH 4LF6L 4RM9A 4LJZC 1IGCA 1RKNA 5GQOA 1FCCC 5H8YE 4DNIA 2XN9C 4A3DB 1A70A 1E8YA 1SBBB 4KZ0A 4X65Q 1VQAA 1KL9A 4B9WA 3AU4A 1UE6A 2HTHA 1S5BD 1YNJC 2HCIA 2R7DA 4JI7L 3K59A 4DV7Q 2F03A 2KVZA 1VQFA 2K5PA 3CPFA 1V1PB 4X64Q 2KAJA 1TJEA 5BMGA 2DNEA 4ODGA 1L1OA 2KNBA 2HHHL 5LL6S 1Z2MA 2Y5CA 3AEFB 3R7QA 2RSOA 3JVZX 3T8MA 3Q6SA 4ZAIA 3NQTA 5FK9C 5I2YA 1S5DD 1XMOL 3FPPA 1XMQL 3RZOH 3U58A 3S2HB 2L1AA 3UINB 2N7DA 1IYFA 2NBUA 3PVLA 5AZFA 3WOEA 3RD2A 5AJ3L 1S1QB 2F0NA 1CMXB 1FXIA 3A1QB 4GGQA 5JAVA 4IPDA 1E1TA 4RKLA 1UE7A 3J7AV 4II3B 4RMAA 4OO1I 1Q90A 2V1YA 1S72A 3HS0C 1BCPC 2P5ZX 3TQYA 3T1YQ 1F9SA 3IL8A 1PH5A 1PMRA 2WV6D 3EBEA 1V86A 1XTCD 2PQEA 3VTWA 1QWYA 4JGHB 1MG4A 3VR8B 3MHBA 1HZCA 4FJYA 2KHSA 4LF9L 1NVID 2BF8B 4ANUA 5EE1A 2WXGA 2RHSB 2MP2A 5D65A 2IY0B 4BY1G 1WM3A 4FN2A 1Y1VG 2QEXA 1BMLC 3MHSD 4A3FB 4KJNA 2EVBA 2NR2A 2MH7A 3R66C 2ZZPB 4ICVA 4DR4Q 1NJIC 2NBVB 2UXBL 2J0TD 1LFDA 2B2VA 1ZP0B 1NI3A 1YNNC 2I46A 2E2IB 4XC2A 4C80A 2LVPA 1RTNA 2LWPA 3RMKC 3ND8A 1UGJA 3ZDTA 1QVCA 3T1HL 2A73B 4JI4Q 3AEAB 2CKZB 3QWNA 4HJKA 3KDFB 1QOHA 5C44B 3S1NH 1S3OA 3I7FA 2G9HD 1GKHA 2EELA 1MI2A 2N9EB 3DEPA 2D10A 1KRHA 4A3BG 1PQSA 3KJOA 3X3MA 2L05A 2IWHA 2NTSA 2M2LA 1PA6A 1P0RA 1IYUA 1QF6A 3F8TA 4FP5D 3A9KA 4RKBA 1RCVD 3QOJA 4TRDA 3P20A 5AZGA 2PE6B 2WXPA 1PYWD 4HPLB 5EQ0A 5LXIB 1EL0A 4QL5A 5KHQA 5EBCA 3SK6A 3B6YA 1VQ7A 3ZJTA 2JE6I 1ZYRD 1JOQA 3AXCA 3H15A 2BS2B 2JA6G 1FYCA 1FIQA 4WJQA 3ZUNA 2LXCA 1R9TH 2KEEA 4TKOB 3CCSA 3NK9A 2V3PA 4URKA 1M90C 5JEAJ 1XEEA 4GZYC 1B9RA 3UE1A 1WX9A 4JK1C 1YHAA 1YJJA 1HTQA 2OJWA 1NCVA 1RJTA 4IUVA 3GZNB 2KTRB 4DQOC 4KV6A 1C78A 1O80A 2LUEA 3HZXA 4L8JA 4BKGA 1SN8A 3UDXA 4L2YA 2Z4HA 1E24A 3CU7A 1WF9A 2CCZA 2IY1B 2JK8A 3CP0A 1B2TA 3CHBD 4HMJA 1RD9D 1V49A 4IWQA 1XT9B 1LO5D 5I2XA 4A3OA 1YJIA 2BYVE 3NZSA 3UI3A 1LTGD 2ASQA 1DD2A 2A8VA 2B3AA 1ASZA 4E3CA 4R8NA 3GDEA 3NHEB 2HD5B 1HFNA 3CSFA 5J18A 2YEPF 2N9XA 2CW0C 2N9KA 2BA1A 4CBVA 2NB0A 3UIOB 1IHZA 1SJHD 1VCIA 1DJRD 4F8MA 3I4MB 1WH3A 5LNK1 1WFQA 3HOUB 4A3EH 3ERQA 1ZXHA 4D2KA 5JHBA 1P1AA 1ZUD2 4N8X1 2V4DA 1OEYA 3G4SA 4CYEA 3RULA 1B53A 2HIVA 1JOKA 2WX1A 2M00A 3EN2A 5CORA 3K9OB 1JQ4A 2WGSA 1GAQB 1SGHA 1KC8C 1HHVA 5D14A 2LMCA 5AZHA 2JXXA 2PE9A 4JBWA 5ELCA 3OAWA 1LUZA 1HCZA 3IAYA 4XT1B 4EGVA 4IC7B 2QSDA 3V3XA 3ZNHB 4YTMB 1KNAA 3DWGC 4EOYA 3QHTA 1PRTC 4BY7H 1TWFH 2A19A 2JA7G 1LABA 1E10A 3VYUA 3TMEA 2CHBD 1WWTA 1EOVA 5BN4A 1M1KC 3PIO3 4HWIB 3S1RB 5EKKA 1C4PA 4OVVA 2MW5A 3NVYA 1I94Q 4FBJB 4A3MG 1L0XB 5IIFA 3N3KB 1YNXA 3OJ3A 5C1ZA 2C9WB 5FLMG 1MG8A 3S24A 2D11A 1QNUA 3WA0A 1ZE3D 2LVOA 4GOPB 1EO6A 2D07B 3PLVA 3HG9A 1PHJA 4KKUA 3DXJC 2G5DA 2UUAQ 1L4ZB 4IO9A 2A6HD 2Y0SE 2Z8LA 3C1EA 3GTMB 2JYEA 4LK0M 3OMGA 5BMHA 2L11A 1IBXA 4WH4A 3FAHA 3C3LA 2HCCA 1Q5WB 2Q5WD 3APCA 4K3BA 3X3NA 1PH6A 1CA6A 1XNRQ 1DOLA 3SFEB 5DPSA 4DUZQ 4HPMB 1FPYA 4B0EA 4OELB 1N34L 4K7WA 1FJGQ 3TZUA 1KAWA 1EM7A 3MC0B 4R4CA 2F0FA 5I9OA 1X54A 4IFDH 1YQBA 4X6AH 2Z59B 4FXCA 2MQJA 2Q8RE 2L9HA 2J53A 1AP0A 5G2NA 4IPGA 4DPGA 5IT9L 1WXVA 2I0QA 5GADC 1WXMA 4XYQA 4RNAA 3AE2B 5FO7B 3KWVA 3RUIB 1CKNA 1PGAA 2G3QB 4XYCA 3DCGA 3A9JB 4WRDA 1BOSA 1EYGA 3H0GH 4RWSC 4DR2L 2HDEA 4MGYE 4A90A 2R93B 2DBYA 3GTOH 4CDFC 1BNZA 1LTBD 1RDPD 1KFYB 3AE3B 2HD3A 3B0AA 3PLUA 3P63A 3DHIC 3E3XA 5CV9A 4DR3Q 2MFIA 1W6JA 3EHVA 2KQSA 3U8ZA 4X62L 3P4QB 1SR3A 2JA5G 4HSVA 1AARA 5A2QL 1TGZB 2YU9H 2NZOA 2LHDA 2BVCA 2BH2A 2RPVA 1C0AA 2W3SA 1S5CD 5H92C 4RA8A 5JPMC 2IJ0A 1QZEA 3S2DB 4HEDA 4K5VA 4P6VF 3VUXA 4HSPA 3KVFB 2JYOA 1Q8KA 1B70B 4HN7A 2JP1A 3MTSA 1K8RB 3D6WA 4I6LB 4P1BC 4W9IA 3I70A 1CI3M 2MP1A 5FLXc 4C1NI 2JA8B 2WDQB 1T9HA 1BCPF 4AS1A 4P16A 3Q14C 5M5YB 5IP9H 3GTKB 3T3OA 2PVGC 4A3IH 3VR2A 1E90A 1IGDA 2C9OA 1KLVA 1A5RA 2BWES 1ZEQX 1IL8A 4DUYL 4WWMA 4ICUA 4I65A 2DWQA 5DPTA 2PMZE 3KUDB 5DNFA 5HI1A 3I8ZA 2ZCBA 2A69D 1WMHA 4IUQA 1GG3A 4R8IA 4U68A 3S14B 5CV7A 3JAMi 3VYSA 1JWSD 1R4MB 3U4EG 1HNZL 2UWQA 3TP8A 2WQYB 2HIXA 2B2WA 2OCEA 2PNRC 3GTGH 1OQRA 3TBLD 3CCLA 1Q12A 3PV0A 4YWMA 4C3HB 1LTTD 3RNGC 2H4OA 3AEGB 4KY6A 1WTPA 3V6CB 4CKEA 3FVQA 1F9RA 4LJPB 4GNXB 2L8JA 3MXGA 4IOCA 2VUMB 2BT6A 5BN5A 3TBIB 5C4XB 5C4JB 4OZAA 2Z9HA 2FUHB 3RNEC 1JWUD 3HFZB 4HRSA 2LXJA 4A3LG 1N6ZA 4A55A 4EVOA 5C0XJ 4F88A 2LJ5A 4JCVE 4ME5A 1S4ZA 3VR6A 3PS6A 1X3GA 2ZT9C 1YBYA 3S17H 4MM3A 4BY1H 2CWPA 2JU6X 1IL2A 4F87A 1F9JA 4KKJA 4HJ5A 2FUG1 1WI5A 1UEAB 2BH8A 2BB5A 3OWFA 1D4BA 1ML0D 2I38A 3FHWA 5IGDA 1GUWA 1MIUA 3AEDB 2PQAA 3CC2A 3PT2B 1KM7A 5M3MG 4XT3B 1IBKL 1D7QA 1Y56A 3E9HA 1M8AA 1JC7A 3WOFA 1PH8A 2FE8A 2IW3A 3GB1A 4EUTA 4LFBL 3TEHB 1JWBD 1FFVA 4LK1C 3JW0X 1V8QA 1PTOB 1EY8A 2R2QA 1VQNA 3SK5A 1RAXA 3CF5A 3R3MA 1YQ3B 1WGYA 5IGEA 1A15A 4HIMA 2K33A 1TWCB 3Q8DA 4A3JG 2KN5A 3UF8A 1S40A 2JZPA 4YWGG 1E7ZA 4A3BH 2UXCL 2LGYA 4MH8A 2GMIC 2K8BA 2YVCA 3NE5B 4F7XA 2EKIA 2PJHA 3PO3G 1WXSA 1XJVA 4N8FA 1Z47A 1VQMA 4JYAL 4C56C 5T1GA 2CU3A 1MHXA 2WAQG 2L3ZA 3DOWA 3LYYA 3PIPA 3GTJH 1JALA 2WXLA 3ZTCA 4LF5L 2LASA 1OO9B 4IALA 4FYDA 1PXUA 1ZW7A 3QCAA 2NUCA 4H13C 1H9RA 1YI2A 4LNFA 1CQFA 3S2AA 4DXGA 3L0WB 1TWHH 5LMUL 1CQVA 1QT9A 2XBBC 4RGTA 3HOXB 1IUEA 4DR7Q 1JCKB 3UQBA 3HOYG 4NB3A 3M4YA 3FKIG 4PYZA 3F2UA 4UP9A 3J80i 4DV0L 1HR0W 2KWUB 3KWLA 4JI3Q 1HTPA 4EE2A 4BA2I 1E8ZA 2HJ8A 1K0RA 4FO2A 4LF7L 3C0RB 3U7ZA 5EPJA 2MJEA 2BE5D 5JJKA 3VUYA 4WJNA 1I7HA 1ENFA 2KWCA 4DV4Q 1UZXB 3E5SA 4KVGB 4NJ6A 1Y8NB 2GLSA 4YSYB 1HQRD 3A7LA 3P4RB 1PZID 3ZRCA 2ON8A 3RLNA 5HHDG 2HDMA 4LF8Q 3AQQA 4DNTB 1WCMH 3G7LA 1RYJA 3EJIA 3TMPB 5I9PA 4GOPC 2I1KA 3LXFA 3PO0A 4B3RQ 1PRTF 2ENBA 3W5OA 1F2RI 2XK5B 3EGRA 3DVNU 1YNTE 1QZGA 5CTRC 4PS7A 4Y7NB 4HCPB 2H1EA 4ZYNA 5EGTA 3TEWA 4HKQA 1VQBA 5CV8A 4W9KA 2KA7A 3HRZC 4PS8A 2WB1E 2LGDA 4GXBA 4FF2A 4HVBA 1SF0A 1JJGA 4IUNA 2FCSA 3N52A 3MP9A 3PV1A 1X1MA 3Q8BA 4JLCA 1YHBA 1WTRA 2C5CA 3OYYA 5AUKA 2QILA 2K03A 3NZ3A 4ID6A 3J7ZC 3CW2C 4FNFA 1FXTB 1MJDA 4OVUA 4EZLA 2KMAA 2FBWB 1WJUA 1QUQA 5LL6X 1MD2D 4YTNB 2IGGA 1X56A 4TUUA 2WDVB 2BKRB 4US9A 2VB3X 4C2MB 1TQOA 4A3MH 1L5PA 3EECA 4WIPA 3D4WA 1DOKA 1X3PA 2KC2A 3AMZA 4KHVA 3PPAA 3D31A 3DBHI 3JSVB 2N88A 2VZKB 4MTKA 1R4NI 4YT0B 5I4DA 1N36Q 4DR6Q 4YWKA 3K7AB 1GUNA 2XRSD 3EFUA 1FNUA 4HMIA 1SJED 5J1ZA 4N6EB 2H88B 3M3JA 3ZIMA 5IYBH 3NVVA 3VA5A 2FCNA 2LZ6A 1UWMA 2PZTA 3KF6B 4W9CA 2N1WA 1EFID 3MXPA 3DM3A 3ALBA 4C1NK 4XE0A 4ZRQA 1GB1A 1AN8A 1TT2A 1BBXC 3S16B 3M3YB 2DYMA 3IRBA 5IOCA 2QC8A 3IG3A 1I6HH 1V97A 1HNXQ 4RGNA 3DPDA 2FXQA 3STBD 1B3QA 5K5PA 2J52A 3ER0A 2XRQD 1E0ZA 3AFQA 1C7YA 4NXNQ 2B63H 4ACFA 3ETRA 1EQRA 1H9MA 1H9SB 1A3UA 3E0JA 2L52A 1KRTA 3TEZA 2F4VQ 1HA6A 4JI8Q 2RF4A 2ACZB 4IM2A 5BO4B 2AUJD 2WINB 3FMCA 3HKZB 4FXKC 2M4NA 1HNWL 4G11A 4AQYQ 4K7SA 4LF6Q 2GBJA 4NP5A 2B29A 3E0EA 2NVQH 3T9LA 4YTPB 1LTSD 1YNJD 2KQ3A 4OX9L 4I6PA 3F1ZA 1SIJA 1VJKA 1N5WA 4JI2L 2Q8TA 2WHIA 1NNXA 4KD4A 2VS1A 2G45B 2J0MA 1LXDA 5E6NA 4X66Q 2KJ6A 2R2OA 4P1CC 2PPBC 1WE7A 1STHA 1A8VA 1PFMA 3I73A 2EZVA 1HZ9A 3FILB 3U9OA 3CQZB 1KH0A 4NAWA 3WAPA 4C7YA 2LEKA 4GNXC 4W9EA 3HHMA 1N8RC 4QB4A 2BCOA 1M4VA 3SK8A 3PIP3 1YOVB 2EOTA 5JVH3 4DR5L 1XMQQ 3DDCB 2QCPX 4J8QA 1V80A 1YITA 2DLBA 4TQUS 5LLIA 2B8FA 3W1YA 5EKIA 5M5WH 3IT4B 2QHOA 5JOBA 4K0KL 3JAME 1IPGA 2CJNA 1BCPD 2WS3B 4NZLB 2I2YA 1UD7A 4JL9A 4XQJA 4XWWA 3SVMA 1QZHA 4A3EG 4IM3A 2D5DA 1UEBA 2TMPA 1VQHA 3EA6A 3W5VB 1B9MA 4GDLB 3RZDB 3J81L 2QDBA 3VR9B 2OF1A 4LF9Q 2WXRA 3P1MA 4H2AA 3DM1A 1JT8A 2BE5C 4WAFA 2FFKB 1T0SC 1GB4A 4BBSH 2NVUI 3HOZH 2N0SB 2EQSA 5NUCA 1DOMA 4E74A 4AJYB 1NE3A 4A3KH 4HIDA 3IFDA 5CHWA 1FGUA 2EY6A 2IGDA 1YNND 3Q8CA 3VRAB 1QG7A 1Y1VB 4HTHA 1TT5B 1N33L 3K5OA 2F3VA 4MELA 2KHJA 4QJFA 1T0YA 2N7EA 4BY7G 1AH9A 1WYWB 2K04A 2PPHA 3T1HQ 2KVRA 2PKOA 2Z0DB 2C35B 4ANWA 2Q2IA 1WTWA 1SYDA 5KNCA 3KF8A 3LB8C 3L13A 3U2SC 4IURA 2NBWB 4IUMB 4UHVA 1VDZA 4CGYB 1IBML 1U5KA 4K6DA 5D2MB 1I4PA 2KVMA 2Y3AA 2ZPYA 2QDLA 4A3GB 5G55A 3K57A 1SNDA 1U4RA 1J7AA 3L2PA 4IM0A 3Q0AA 4AYBG 1DOIA 1QOAA 4US8A 3DBHB 1LT5D 1YD8U 2RQXA 1JQYD 4B9XA 4ZRIA 2DAFA 1ICWA 3DBLB 2A1AA 1V2YA 3ML9A 1KHIA 4CDCC 3APDA 2K22A 1D5XC 3Q8EA 2DZIA 3EFXD 1ILQA 1TXYA 4WFN3 4IFDG 4MGIE 2K5HA 1STGA 5CV4A 4GDKA 1T0RC 2EXZA 2CVRA 3AE9B 1UWXA 2JA6B 2FMCA 1X65A 1BUVT 3PUXA 4B3SL 2I07B 4AOFA 5E3FA 1VQ6A 2VL6A 2INCC 2M56B 3PUZA 4L5QA 1I4RA 4ZK9B 3H0GG 1HZBA 1AE2A 1UAPA 2V1CC 2R7ZH 3MJ5A 2J0KA 4Y52H 2NVTB 1QILA 4B3MQ 4HCSA 4GSWA 3KBXA 2F0IA 4GLXA 3J80E 2IX1A 3PGZA 5T1IA 1EU3A 5CMDA 1J5EL 2UU7A 2VXWA 3DEOA 1L0WA 1V1PA 3A4SC 1JE5A 4GKJQ 3CRKC 2KFKB 3M62B 3K81C 3Q8AA 1MGSA 1RIPA 4EQOA 3GO5A 1C4CA 4RF0A 1YJWA 4YHHL 4JI5Q 3UQAA 3W2DA 4GKKL 2K9XA 3OG5A 3WAMA 2DZMA 1J6QA 4KTAA 4ZRZA 5K36H 4P74A 4YSZB 1VQIA 4M8NA 1HTLD 3A1QA 4HLEA 1WTXA 3EIVA 3BS1A 2G4SA 5CC4A 3DHHC 3NOBA 1UWVA 2ZXOA 3TCAA 5KRUA 4DDID 4KSKC 4YY3L 4NQKE 4KIKB 3BDLA 2KZRA 4FF3A 1SLJA 4C3JH 1FR3A 1BT0A 4DDGD 4JI0Q 4GB9A 3SHQA 3W5UB 3Q3MC 5IP9G 2QA4A 4A3IG 4MSQB 2OOBB 2LXAA 2NTTA 3VHTC 1PRTD 3C46A 2JUOA 4RCOA 2ZM6L 5E6PA 1KF6B 2CKHB 2FCQA 4RMFA 2RBMA 1IZ6A 2AYOB 5IN7A 4JI1L 3H3VC 3NVWA 3J7A5 2F52A 2KQ4X 4M0WB 4HCEA 1VMCA 2EYHA 4BA1I 3GTPH 2KN4A 4TKNA 4A93H 2K5WA 3VYRA 3IBEA 1HR0Q 1ET6A 1DCZA 1STYA 4L63B 4XZ4A 1I4QA 3GTLB 2VZAA 1N9WA 5A35A 2ASBA 4G4KA 3I57A 2DUDA 5C3JB 1K83B 3KDFA 4YCUA 2K8HA 4KGSA 4C00A 3I9V1 4WJOA 3BYTB 4IUTA 1E7VA 3AEEB 1K0SA 4IW0A 2EYOA 5IT9c 3B2GA 1EIHA 4BBNF 1FMAD 5CBAE 2ZTEA 2F1MA 4MTNA 1RM6C 2ZVNA 3T4AC 4IWPA 2BTEA 3SFDB 1S5ED 1JB7A 4JBMA 5FKAC 1PZKD 2KD0A 2KX0A 4QCLA 1ICFB 4PK1A 1Q1BA 4FJVB 1IXRA 1UH6A 3A8IE 4WJPA 5BN3A 1D2BA 1I6VC 4GN1A 4NQLB 3UI2A 5CHVC 5TSSA 1W2BA 1NMGA 3ZNZB 3NWTA 1I50B 1CT1D 2B2TC 4I7AA 3L54A 3DBRI 1JMLA 4FXDA 4W9FA 1EWHA 2WACA 4DR2Q 4N59A 3PUVA 3ULLA 5HURA 2MUYA 2Q2HA 2F0EA 4RGOS 1SE9A 1L1OB 1CFMA 3FPUB 3NBHA 4DV1L 4BXXH 4JI6L 1RWSA 2KTFA 3VQIA 4K2LA 2D2QA 2J42A 1YEZA 4PMBA 3KW5B 3V05A 1C77A 5DCNA 5KNBA 2MQHA 4MJSB 2C7MB 4DF7A 4P72A 1PDXA 5BR8Q 2Q8IB 2CR5A 4RM8A 3HEJA 1HUMA 2IHFA 4WURA 1MVKA 2Z1CA 4W9LA 3S15H 4PNYA 4ZRPA 1QOFA 1SYCA 1QOGA 2VRRB 2FIDA 1I3QH 1MJEA 3IFTA 2PZWA 3PSIA 1BDOA 2LGXA 2MO0A 3OTOQ 3GTQH 1YX5B 3K5MA 1K28A 4HIKA 1IBLL 2K01A 1YQ4B 2LUMA 2C5LC 3CF6E 5IP7H 3CCUA 3W1SC 1Y1WH 1QVGA 4DFAA 5KHOA 5LMNL 5HY6A 4DV3Q 3H8HA 1T3QA 1WXAA 4BZAA 1E5WA 3TZDA 1Q10A 2EJGC 5EPLA 3IFWB 5BYSA 1QCBD 4DUYQ 1ISNA 3VAWA 3VTUA 1P98A 4ILWA 2L32A 5J3BA 3BU2A 2L7RA 4LNNA 3UDFA 4YXDB 5DEHA 1TWAH 5FR6A 1WCMG 4POGA 2LVQA 4ZRJA 2V4IB 3WAOA 3KUCB 3B2FA 1BO0A 1CSQA 1V1OA 4J15A 3DLLA 1WIAA 3H6NA 1VDVA 1FXAA 3M63B 2HT1A 1WVLA 3H7SA 3A8JE 1C4AA 2WDTB 3R2IA 1PFNA 1CA5A 4F8CB 2QCZA 2PLPA 4DK1A 2OWOA 1WE6A 4H7BA 1EIFA 2R3ZA 4GOPA 2CH4A 4M1UB 1WY8A 2MWSB 2B2UC 4WQOB 1Q8IA 1E0BA 1CZGA 1L0YB 3BVGA 2E2JH 4B3TQ 2L0TA 3HIZA 3N1XC 1LT3D 1K8GA 2G1EA 2UYZB 2EPBA 2K3UA 3ZNGC 4G7ZC 1Q0WB 1E7PB 3K5NA 3AE7B 5GROA 1CZWA 1PZJD 1DONA 5JJZA 2NVXB 2XTIA 1DM0B 2KCCA 4BBRH 5CR3A 2QDFA 5M3MB 4MIUA 4AH6A 1O78A 2MX2A 1VCBA 2V9HA 1SNCA 1TS3A 2IBIB 4DK3C 3ZYYX 2PI2E 4QY7A 4QGUA 4EKUA 3K5LA 1K3BC 3FEWX 4XDDA 4OIKA 2GRIA 1V5TA 4DV7L 3Q2AC 3RN9C 3HOVH 2A5UA 4A3JB 1NTGA 1VQGA 1WTVA 4LAAA 4DV2L 1XPOA 3I4NH 4A76A 1SNPA 5IYBG 2UUCL 4JYAQ 4L5TA 2AHOB 2L15A 3AE6B 5FR3A 1RRBA 1SFOB 1QNKA 3M4OB 2INNE 3PO3B 5F2DA 3IHPC 3TJPA 1DGSA 4LF5Q 2AWOA 1T5XD 1Y8PB 1FFUA 3RLOA 2WAQB 4LNIA 4KHPL 1F77A 1OQYA 3RD4A 3MWYW 2JT4B 1K53A 2N7JA 3OW7A 3KH0A 2B63G 1JRUA 3T1YL 2E74C 2A4ZA 5JHAA 1XPUA 3QX1A 4S0RA 2O5IC 4MGKE 4DV0Q 5BYQA 1MPEA 3SD5A 2R92H 3ZXVA 1SNQA 3MXNB 3AEVA 1VMPA 3HOYB 2REXA 5JZEB 3FKIB 4XIGS 5IWAL 2AUKA 1XLOA 3SU8X 4WORA 4DU9A 3L9AX 1NAPA 4FHKA 4II2B 3M4PA 2NVYB 3X0WA 3AYHB 3JC66 4BAXA 1ROEA 3VDZA 4ME3A 2A68C 2BDNA 4HXDA 2EY2A 4ZYSA 1M94A 1D8LA 1NR4A 2NBFA 2PYKA 4OL7A 2IY5B 5C44G 2DNCA 2RDBC 2K14A 4JOIC 4OXPA 4QUCA 2O2VA 4KV2A 1PH9A 4LDTB 3RNFC 3Q3JA 5C6AA 2RDHA 1UE1A 3MA2B 2RKSA 2NYZD 3Q23A 4K81A 1YJ1A 1HH2P 1EF1A 2KQ7A 2HUGA 2I5LX 1PGBA 2LFIA 3HVZA 2L1BA 2ES2A 2NMQA 3H9DA 3NS1A 5M5XH 3RZOB 3CCJA 5FLXE 2DX5B 4GNXA 2OXPA 4DV6L 2NPTA 4L5SA 1JOOA 3W1GA 3C1FA 4X3KA 4A3CG 1IP9A 3M9BA 2B3GA 2D0OA 3AFPA 3KLSA 3AMUA 4K2KA 5C3WA 4WWPA 4DHZB 2PI2A 5JPNC 4LFCQ 3P4PB 4K7UA 3Q8FA 1YJNA 3DBSA 1W6KA 4KD3A 5D94A 1IW7C 2EMSA 3HK0A 4IOAA 1L0VB 4BBSG 1YN3A 3HOZG 3PUWA 3L16A 2E2HH 2EY1A 4JWUC 1PH7A 4HJ8A 1H9KA 1ENAA 1SE3A 4QMGA 4A3KG 2F3IA 1GM5A 1X6OA 3HUIA 4DAMA 1ACCA 2QEJC 3N6RA 3VR5A 1EWYC 3E6ZX 4UAIA 2KDFB 1PUTA 2XEWA 1TZ1A 4NY0A 1E1OA 1OFFA 4N58A 3QC8B 3CSTA 3VFKA 4QAYA 1D1IA 1K50A 2PW7A 3K7UC 4A6QA 3S1QH 1UGMA 4LDTD 1DZ1A 1LTID 1GUSA 3PZ7A 3HOWH 2IO2B 1DOXA 1K52A 1VQPA 2ZPNA 5LMNW 1JORA 1II3A 3NVZA 2JEBI 3TP7A 2KENA 2IPKD 3TP6A 1OTRB 4LUZA 1YMHE 2EJFC 2EJMA 3S1NB 1A3VA 1GJZA 1TBEA 5GAGC 4IFDI 2RSUA 3HKSA 4DHJB 4HIOA 2F4IA 3OIQA 2QW7A 3K8AA 1N32Q 1UBQA 4IN3A 2AMCB 4MEMA 4JPSA 5TR5A 1R4QB 4NKLA 1MBYA 3PO2H 2F3WA 2K6QA 4LMQD 3SEBA 4KGRA 4KLKA 2AQ1B 4P2CB 3L4PA 5I6YA 5C3XA 4P75A 2WXFA 1ZOYB 2X8XX 1JWMD 1PYBA 4TQ0A 4DHZE 2SEBD 5C3EH 2SNSA 4IFDJ 2KLCA 2ONQA 4A9AA 1HNWQ 2VH2A 3N20C 4C4VB 4HK2A 3MAQA 2UXDL 2IYDB 1R9TB 4HDOA 4DK6C 4C3IH 4ZHOA 3OIPA 1K73C 1HQMC 2DENB 1VF7A 4OX9Q 3DWPA 3PF5A 4M8MA 1E9MA 1UNSA 2F0OA 2GB1A 4A8XC 4B9KA 3ULJA 4JI2Q 2D0PA 4IPCA 3SXHA 3ZVVA 4NJCA 3BG3A 3BZDB 3QO2A 2R7ZG 3BIID 3J7AF 3PRZA 2KMCA 4LW1A
chains in the Genus database with same CATH topology
5E4XA 1STEA 2LFNA 2WU5B 4REZA 2EE1A 3DWAA 4K5WA 4KN7C 2DYOA 4FVMA 2KCNA 3HRDD 5AUIA 2L0CA 1FO4A 2OT2A 1JB3A 1J8IA 1P7EA 5KGUA 1ZDVA 5K36G 5EE9A 1EY4A 1EIGA 1XWEA 1XX8A 1JICA 2WXHA 2F0HA 2NWGA 2NN6H 4A3EB 4OGQC 1PTOD 4C3JG 3AECB 2EYLA 3NUHB 3RPFC 2EY5A 4RF1A 1OXTA 1KDAA 3HVDA 5EE3A 3WCQA 3I90A 3T13A 1B9NA 1MI0A 1X32A 4ZOHC 5ELFA 5KYIA 3ONAB 3IAS1 2XIWA 2N9LA 2F0MA 2WP8J 1WRIA 2INPE 2X6LA 1U4MA 1T5EA 1TWFB 4BY7B 1ZDXA 1G2SA 1XCQL 1EQTA 3AE1B 3P1HA 3MXUA 2BBCA 3A55A 1CZPA 1HZ6A 3URYA 1KTKA 1TIID 2L83A 4KK7A 4IDIA 1EY7A 2AQ3B 1C9FA 4AYBB 3AB5A 2JQRB 2LJIA 3SHLA 2M19A 4RHRA 3P75A 3CRLC 1ZPSA 3E9SA 3TN2A 1H9SA 3KLRA 2WXNA 2F0TA 4MT5A 4EQNA 1D6EC 1HPCA 4DXFA 2F0PA 4NDXA 1LTRD 4DNRB 3IT6B 1Y69U 4TQ1A 4M8AA 2DY7A 4U673 2BA0A 2FMMA 1A3TA 4S3SA 3H0GB 1GHJA 5D7GA 4CKCA 4HEA1 3GTOB 2B2TA 1FCLA 1EWCA 1NENB 3FILA 4G7OC 1STAA 1C79A 1TYGB 2YU9B 3ITPA 1U4PA 1GXDC 3O13A 3VR3A 5COYA 2W82A 5J39A 1C76A 1KAAA 2IT1A 5HG2A 5CV5A 5J22A 3A7AB 4ULLA 2BW2A 2MJDA 5BMIA 2K32A 3NUCA 1EY9A 3OWEB 4V0BA 5HFYA 3NBIA 5ELBA 1IYVA 2RSNA 3V96A 1ONLA 2VZKD 1AW7A 3QB3A 3DWQA 3TP5A 2F0KA 1FD7D 2RDFA 1SYGA 3W1SA 3D4DA 2PCFB 4A3IB 3NQIA 1C4QA 3PZ8A 3NSWA 4DAYA 2DN8A 2X6GA 4K5XA 2O5JC 1GJXA 1ZXTA 3SR6A 1HRJA 5EPKA 1U4LA 1ET9A 2MEKA 1EYDA 3H09A 1HUNA 2EDGA 3T51B 3GTGB 1EZ8A 5DM63 1SEBD 2SDFA 1K8MA 1OXVA 2JEAI 4PMWA 2KDMA 1CTMA 2BOSA 1F0ZA 3NXWA 4MN3A 2WU2B 4CJ1B 4O42A 2BDOA 3ABVB 5C5LA 3QOLA 1NSNS 1WYGA 1CM9A 1PTOC 1BF4A 1QB5D 4AQ7A 3MEHA 1GHKA 3S17B 3R8BA 4BY1B 2QIEB 1SYBA 3EQLC 3K0YA 3L7ZC 2B2UA 1G6ZA 4DN4M 5KEEA 2PW5A 2E76C 2KOLA 3V2TA 4KX6B 1T6BX 1GUTA 4GLSC 1FRRA 1SSNA 3OHXC 3ZQ4A 5IGBA 1G8ZD 2HQEA 4EQPA 4A3BB 1DGJA 1N61A 1QLBB 1VF5C 2FJ2A 4H0LC 3IKJA 3NTKA 1JE4A 2ZXRA 1CJEA 4PT5A 2H89B 2WXKA 1E2WA 2MJ3A 3GTJB 5G3LD 1XO3A 2K5QA 1RODA 1F2ZA 4OO1H 1TWHB 3FRPB 1GUGA 3Q69A 2TSSA 3BWUD 1U9RA 2RDGA 1Z6HA 1WXQA 4CQNA 1CHPD 2KUMA 5C5MA 2WXOA 5BYRA 4N9PA 3AE8B 1YN5A 1SE4A 3SDZA 1LT4D 3M85A 5CBEE 2E75C 5ISRA 1OXSC 1N5XA 1TZOA 2DY8A 5D3IB 1OXUA 4KI0A 1AZQA 1VZ6A 2ICEC 1JWAD 1PFBA 1WCMB 3HP3A 3KUPA 2F0UA 3TEXA 1XYIA 4V190 2ICIA 2WXJA 3U9SA 4TMAB 1A2UA 4FF1A 4HROA 3I91A 1LTAD 3GD7A 5M9OA 2FINB 4KJOA 1TKGA 2K5DA 3OOCA 5JEAH 3LWUA 2O2LD 2V0GA 3ZJVA 1VR9A 1F9PA 4GDKB 1KLUD 1G2TA 1RTOA 2F0VA 3N9YC 2JA7B 2PZUA 3OPOA 4JWSC 4BS9A 1GOZA 2A5HA 4A3MB 4IUUA 2JYTA 1KABA 4X3TA 3GV6A 4DA2A 2KACA 3BDCA 1SYEA 5IT9E 2D5GA 1SNMA 1XCTL 2D9UA 4OZCA 2G9DA 2XNAC 1TVXA 4OHJA 2JXTA 3GP7A 2RMMA 1I6HB 4OVZA 1L6UA 3OSOA 5A2QE 3D4RA 3K58A 4J1MA 2IX0A 2B63B 2F0WA 4QIWB 2JSOA 2E6XA 3T16A 3CKIB 1XLNA 4KN4C 1WD1A 1QQRA 4X3SA 1HFGA 4C3IG 4IUPA 3JAML 2CQAA 2A68D 4XTCS 2NVQB 2XWBB 1GUOA 2JA5B 3VR4A 3PUYA 1ENCA 1I4HA 2J4XA 5D3DA 1MSHA 4X3UA 1IKMA 2GA4B 1F2RC 4ZQ3A 5EE0A 3MZ5A 1PLFA 3BVMA 1HA5A 1B50A 1KDCA 1AZPA 5IODA 1KDBA 5M5WB 2SAKA 4IOIE 5EKLA 3T53B 3A54A 2OEOA 1IKLA 1IW7D 4TSSA 3VRBB 2NN6G 1PTOH 3D3RA 2QKIC 3AEBB 1PTOF 4CHTB 4G7HC 1J9OA 2A6ED 2D62A 1EEID 1N63A 4BBSB 1LACA 3HOZB 4HAEA 1D5MC 1NYRA 2X69A 1H9JA 4QUFA 4A3KB 1SXTA 1E2VA 3ZJUA 4JE3B 1S5FD 1A6XA 2VNUD 1G91A 4KKSA 2PTLA 1SNOA 1R7SA 2JSVX 1YN4A 2K0PA 3RUZA 2W54A 2F0JA 4HR7B 4ZKBB 2K7VA 5C2TB 3AU7A 1C8CA 3DWMA 5DM73 3ND9A 1EEFD 2WXQA 2J7ZA 4L6TB 1VRAB 3J80L 4ARIA 3KK7A 3W3AA 2W3RA 2RA4A 1AFPA 4USAA 1I4XA 4OIJA 5FO8B 4FXGC 1SSOA 2L55A 5IGGA 2F0LA 3LNNA 2E2DC 3MXNA 3LWEA 4K14A 1BUIC 4K6LA 1XLPA 2LGIA 1XF5L 2WLBA 3MHZA 4ITKA 2D2CC 2QMTA 3TEYA 4OZBA 4KY5A 4NMZA 2R7ZB 1QKZA 1JW9D 4KHZA 2E3TA 1NYQA 3PMFA 3OMCA 1SE2A 3T56B 5C0XH 1G291 5ELEA 1LLRD 2LY7A 1B44D 1CHQD 3P7JA 4MACA 1TS4A 2LMCB 3RLFA 2PW9A 1GB4A 3GS2A 2B76B 4KKTA 1DXMA 3AE4B 3CIRB 3TSSA 4C3JB 1JRPA 1RFKA 2EYMA 3AB9A 5E4WC 3D8GA 1WSPA 2F0GA 1SDFA 3AH7A 1EU4A 1LT6D 2B2YC 1K51A 2L5TA 4I7ZC 1IBXB 2LKVA 4HKZE 1RHPA 2RVLA 2ZXPA 4J3OD 2Y5PA 3MVVA 1JR0D 2SNMA 1N62A 5KYLA 3GTPB 1ZKOA 4A93B 3K6OA 1TY2A 2QJLA 2BS4B 4ZLTF 2VB2X 1ILPA 3M7GA 1KLGD 3KBGA 2PVOD 2B39A 4RFBA 4LTUA 1OQQA 2MPMA 4E6IA 1ZYRC 2L12A 2WP9B 5LHY1 3R3OA 5C4HA 2LS01 3CWIA 4ABNA 3H6MA 1X3QA 3EROA 2A6EC 1Z7TA 2EYPA 3EVQA 1BQQT 1SMYD 1ESFA 5EBDA 3S9WA 4H44C 5GXGB 2EYJA 1JROA 1EY0A 3EUB2 1VZ7A 2BS3B 1EQVA 1EZ6A 4N9TA 4ARCA 4K8IA 2WNMA 1OXXK 2HDLA 2WXIA 3I4LA 5E1FA 5IGFA 5C0XI 3C8YA 2IX3A 1CK1A 2K28A 1RF2D 2BYTA 3BK1A 2B8GA 4B0MA 3S15B 2YYZA 2AWNA 5G3LF 1I3QB 2B2VC 4L23A 4OO1G 3GTQB 2A74C 3SE0A 5HGTA 2BB6A 1HXYD 1QOBA 3U52E 4PQXA 2Y0SB 1Y1WB 4KY7A 1LV9A 4XWTA 1SAPA 3NTIA 2K05A 1AYFA 3SK4A 2LHEA 3GV3A 5IGCA 1FM0D 1D5ZC 2O4XA 1TKYA 4PV1C 1UUPA 3J81E 5ELDA 5MPOA 2KWDA 1V43A 2EYFA 3DUZA 1TWAB 5EJWA 1QE6A 2YEPB 3WDNA 4MM3B 2X38A 2A6HC 1EYCA 2AX5A 4XQNA 1ZXIA 4KKIA 5DAUA 5C4ZA 1F2YA 1Q1EA 3BVZA 2XWJB 1O7ZA 5JEAG 3AE5B 2WDRB 1EY5A 1Y8OB 5JVG3 2E2JB 3D6CA 4IQZA 1XXGA 3A56A 4Q0FA 3AN1A 2WXMA 2JWUA 3MFGA 1R4PB 1B1ZA 3GQBA 1NEKB 2K6AA 2CJOA 4BBRB 4OW0A 2HTME 2XVSA 1C48A 1AWDA 5CYUA 2ZW0A 4HJGE 2MJ8A 1N60A 2PMZB 3FC4A 3HOVB 4ZUJA 3I4NB 4PMCA 1E6EB 4XYOA 1D1KA 3BK2A 4IKGA 3NPPA 5FOBB 1QJOA 1A2TA 2SOBA 1PDQA 1F9QA 1KNEA 1WTOA 4KMUC 2W55A 3E56A 2FHTA 1V8CA 4XQQA 2M9VA 3Q22A 5G5GA 3NWSA 1SMYC 1BR9A 3HGBA 4CKBA 2IGHA 1F2MA 2R92B 2A69C 2PMVA 2NZ1D 5T8IA 4CJ0B 5FLXL 4C3HG 3J9CA 3NP8A 4DAPA 2MGSA 3DMUA 1GPXA 4FF4A 1TKWB 2ZW1A 1F2LA 1P7FA 4Q2JA 1J7CA 2PO4A 1J7BA 2PIAA 1PGXA 2KJXA 4B08A 1E2ZA 4ZKCB 1B4OA 3M7NA 3TUOA 1FD6A 2NN6I 1FNWA 5KNDA 2M0AA 4C7ZA 3A8KE 2L4NA 1BCPB 5I6WA 1L4DB 3AV8A 3T3NA 5M5XB 1MSGA 2QF7A 4WQMA 2IL8A 3W9CB 3BDOA 1EYAA 4Q5VA 1TU2B 1ESRA 3H91A 2JXMB 1AEXA 3TDQA 4K8JA 3QIAA 5CGKA 3QG1A 2E2HB 1FGBD 3R93A 3I3CA 3B9JA 3ZGZA 3L3OC 4RHSA 4XDXA 3NRZA 1K8OA 4QF4A 3S1QB 4XXEA 2KECA 3R2TA 1VZ8A 3HOWB 1DOYA 5AFWA 1I4GA 2F0DA 4NAWB 1B3AA 1TKEA 4RAUC 3RMHA 3I72A 3AM9A 1TY0A 2IDYA 4O1NA 1NR2A 1EOTA 3SR1A 5JXVA 5KIXA 4J6HA 1WTQA 3PO2B 2B2WC 2JX5A 3RFZB 3P4SB 1TR5A 2WB1B 4G57A 5C3EB 1Q3LA 1L6VA 1VLBA 2WKDA 4C3IB 4JX1C 5G5HA 1WD0A 3MFYA 1O7LA 1O7YA 3Q24A 3NHHA 4ZUIA 2MHVA 4CJ2C 4IZ8A 4R3DA 3VA7A 5C0XG 2R61A 2N55A 2OHFA 4NW2A 2V3NA 2Z4IA 4R9WA 1STBA 3LX0A 1XLQA 4XDCA 4Z9CB 1NUCA 1TS5A 3G6JB 5M3FB 3KLSX 3KQ4A 4NAMA 1TWGB 2AQ2B 3VYTA 3NTHA 1HZ5A 4BWGB 4DGZA 4ZHPA 4YSXB 4LLGM 3H94A 2F0QA 3BYYB 3DHQA 4RGMA 1BXTA 1PRTB 5FO9B 2ID0A 4M0WA 2WIIB 2K1BA 4YIJA 1WGKA 4UDUC 2KEDA 3S1MB 2GI9A 2WKCA 5CV6A 1FNVA 4RH6A 2B2YA 1FEHA 3QJYA 2R6GA 3IAM1 3FDTA 4WJWA 4DAVA 4L1BA 1MHHE 2OEDA 2CW0D 2F0SA 3J7YW 1HEZE 4MHEA 1SYFA 1TS2A 1EY6A 2KMMA 1DYQA 4KGTA 3P42A 1STNA 4DK0A 1PFDA 3C2PA 1SB3C 3IXSA 1FRDA 2XSCA 4RCNA 5E6JA 4LJZC 1IGCA 1RKNA 1FCCC 5H8YE 2XN9C 4A3DB 1A70A 1SBBB 4B9WA 1S5BD 1YNJC 2HCIA 3K59A 2F03A 2K5PA 1V1PB 2KAJA 1TJEA 5BMGA 2DNEA 4ODGA 5LL6S 2Y5CA 3AEFB 2RSOA 3Q6SA 4ZAIA 3NQTA 5FK9C 5I2YA 1S5DD 3FPPA 3S2HB 2L1AA 3WOEA 2F0NA 1FXIA 5JAVA 4RKLA 3J7AV 4OO1I 1Q90A 3HS0C 1BCPC 1F9SA 3IL8A 1PMRA 2WV6D 1XTCD 2PQEA 1QWYA 3VR8B 3MHBA 2KHSA 1NVID 5EE1A 2WXGA 5D65A 1BMLC 4A3FB 4KJNA 2EVBA 2MH7A 2J0TD 2B2VA 1ZP0B 1NI3A 1YNNC 2I46A 2E2IB 4C80A 1RTNA 3ND8A 1UGJA 2A73B 3AEAB 3QWNA 1QOHA 5C44B 2EELA 2G9HD 1MI2A 3DEPA 1KRHA 3X3MA 2IWHA 2NTSA 2M2LA 1IYUA 1QF6A 4FP5D 4RKBA 1RCVD 3QOJA 4TRDA 3P20A 2WXPA 1PYWD 5EQ0A 1EL0A 5EBCA 3SK6A 3ZJTA 2JE6I 1ZYRD 1JOQA 2BS2B 1FYCA 1FIQA 2KEEA 4TKOB 3NK9A 2V3PA 5JEAJ 1XEEA 4GZYC 1B9RA 4JK1C 1YJJA 1NCVA 1RJTA 4IUVA 4DQOC 4KV6A 1C78A 1O80A 3HZXA 4L8JA 4L2YA 2Z4HA 3CU7A 1B2TA 3CHBD 4HMJA 1RD9D 1LO5D 5I2XA 1YJIA 3UI3A 1LTGD 1DD2A 4R8NA 1HFNA 2YEPF 2CW0C 2N9KA 2BA1A 4CBVA 2NB0A 1IHZA 1SJHD 1VCIA 1DJRD 4F8MA 3I4MB 5LNK1 3HOUB 3ERQA 1ZXHA 4D2KA 1ZUD2 2V4DA 1B53A 1JOKA 2M00A 5CORA 1JQ4A 1GAQB 1HHVA 5D14A 2LMCA 4JBWA 5ELCA 1HCZA 3IAYA 4XT1B 4EGVA 2QSDA 3V3XA 4YTMB 1KNAA 3DWGC 1PRTC 1LABA 1E10A 3VYUA 3TMEA 2CHBD 1WWTA 5BN4A 3PIO3 3S1RB 5EKKA 1C4PA 3NVYA 1L0XB 5IIFA 1QNUA 1ZE3D 3HG9A 4KKUA 3DXJC 1L4ZB 2A6HD 3GTMB 2Z8LA 3C1EA 2JYEA 4LK0M 5BMHA 3OMGA 1IBXA 2L11A 4WH4A 3FAHA 3C3LA 2HCCA 2Q5WD 3X3NA 1CA6A 1DOLA 3SFEB 4B0EA 3TZUA 1EM7A 3MC0B 2F0FA 5I9OA 4IFDH 4FXCA 2Q8RE 2L9HA 2J53A 1AP0A 5IT9L 4RNAA 4XYQA 3AE2B 5FO7B 3KWVA 1PGAA 4WRDA 1BOSA 4RWSC 2HDEA 4A90A 2R93B 2DBYA 1BNZA 1RDPD 1LTBD 1KFYB 3AE3B 3P63A 5CV9A 1W6JA 3P4QB 4HSVA 5A2QL 2LHDA 2RPVA 2W3SA 1S5CD 5H92C 4RA8A 5JPMC 2IJ0A 4P6VF 3S2DB 4HEDA 4K5VA 4HSPA 2JYOA 4HN7A 2JP1A 3MTSA 3D6WA 3I70A 1CI3M 2MP1A 4C1NI 2JA8B 2WDQB 1BCPF 4AS1A 4P16A 5M5YB 3GTKB 3T3OA 2PVGC 3VR2A 1IGDA 2C9OA 1ZEQX 1IL8A 4WWMA 5HI1A 4I65A 2DWQA 5DNFA 3I8ZA 2A69D 4IUQA 4R8IA 4U68A 3S14B 5CV7A 3VYSA 1JWSD 3U4EG 3TP8A 2WQYB 2B2WA 2PNRC 1OQRA 1Q12A 3PV0A 4C3HB 1LTTD 2H4OA 3AEGB 4KY6A 1WTPA 4CKEA 3FVQA 1F9RA 3MXGA 2BT6A 2VUMB 5BN5A 3TBIB 5C4XB 5C4JB 4OZAA 1JWUD 4HRSA 4A55A 4EVOA 5C0XJ 4F88A 4ME5A 1S4ZA 3VR6A 2ZT9C 2JU6X 4F87A 4KKJA 2FUG1 1UEAB 2BB5A 3OWFA 1D4BA 1ML0D 2I38A 5IGDA 1GUWA 3AEDB 4XT3B 1Y56A 3GB1A 3WOFA 1M8AA 1JC7A 2FE8A 2IW3A 1JWBD 1FFVA 4LK1C 1V8QA 1PTOB 1EY8A 3SK5A 1YQ3B 5IGEA 1A15A 2K33A 1TWCB 2JZPA 4YWGG 4MH8A 3NE5B 4F7XA 2EKIA 1Z47A 4C56C 5T1GA 2CU3A 1MHXA 3LYYA 1JALA 2WXLA 1OO9B 4IALA 4FYDA 1PXUA 2NUCA 4H13C 1H9RA 1CQFA 4DXGA 1QT9A 1CQVA 4RGTA 3HOXB 1IUEA 1JCKB 3M4YA 3F2UA 3KWLA 1HTPA 4EE2A 4BA2I 3U7ZA 4FO2A 5EPJA 2MJEA 2BE5D 1I7HA 1ENFA 3E5SA 1Y8NB 4YSYB 1HQRD 3A7LA 3P4RB 1PZID 2ON8A 5HHDG 2HDMA 4DNTB 3G7LA 1RYJA 3EJIA 5I9PA 3PO0A 3LXFA 1PRTF 2ENBA 1F2RI 3EGRA 1YNTE 4Y7NB 2H1EA 5EGTA 3TEWA 4HKQA 5CV8A 2KA7A 3HRZC 4FF2A 1SF0A 4IUNA 3N52A 3MP9A 3Q8BA 1WTRA 2C5CA 5AUKA 2QILA 2K03A 3NZ3A 4ID6A 4FNFA 2FBWB 5LL6X 1MD2D 4YTNB 2IGGA 2WDVB 4US9A 2VB3X 4C2MB 1TQOA 1L5PA 4WIPA 3D4WA 1DOKA 1X3PA 3AMZA 4KHVA 3D31A 2N88A 2VZKB 4YT0B 5I4DA 3K7AB 1GUNA 2XRSD 1FNUA 4HMIA 1SJED 5J1ZA 4N6EB 2H88B 3NVVA 3VA5A 1UWMA 2PZTA 1EFID 3MXPA 4C1NK 4XE0A 4ZRQA 1GB1A 1AN8A 1TT2A 1BBXC 3S16B 3M3YB 2DYMA 5IOCA 1V97A 4RGNA 5K5PA 2J52A 2XRQD 1E0ZA 3ETRA 1H9MA 1H9SB 1A3UA 3E0JA 2L52A 3TEZA 1HA6A 2ACZB 2AUJD 2WINB 3FMCA 3HKZB 4FXKC 4NP5A 4YTPB 1LTSD 1YNJD 2KQ3A 1SIJA 1VJKA 1N5WA 2Q8TA 4KD4A 2PPBC 1STHA 1PFMA 3I73A 2EZVA 3FILB 4C7YA 3U9OA 3CQZB 1KH0A 2LEKA 4QB4A 2BCOA 1M4VA 3SK8A 3PIP3 2EOTA 5JVH3 2QCPX 4J8QA 2DLBA 4TQUS 2B8FA 5EKIA 3IT4B 5JOBA 3JAME 2WS3B 2CJNA 1BCPD 4NZLB 2I2YA 4XQJA 4XWWA 3SVMA 2D5DA 3EA6A 2TMPA 3W5VB 1B9MA 4GDLB 3RZDB 3J81L 2QDBA 3VR9B 2OF1A 2WXRA 4H2AA 3P1MA 3DM1A 2BE5C 4WAFA 2FFKB 2N0SB 5NUCA 1DOMA 3IFDA 2EY6A 2IGDA 1YNND 3Q8CA 3VRAB 1QG7A 1Y1VB 4HTHA 3K5OA 2F3VA 2K04A 2PKOA 1WTWA 1SYDA 5KNCA 3KF8A 3LB8C 3U2SC 4IURA 1VDZA 4CGYB 4K6DA 1I4PA 2KVMA 2Y3AA 4A3GB 3K57A 1SNDA 1U4RA 1J7AA 3Q0AA 1DOIA 1QOAA 4US8A 1LT5D 2RQXA 1JQYD 4B9XA 1ICWA 2K22A 1D5XC 3Q8EA 3EFXD 1ILQA 4WFN3 4IFDG 1STGA 5CV4A 2EXZA 2CVRA 3AE9B 1UWXA 2JA6B 2FMCA 1BUVT 3PUXA 2I07B 5E3FA 2M56B 3PUZA 1I4RA 4ZK9B 1UAPA 3MJ5A 2NVTB 1QILA 4HCSA 3KBXA 2F0IA 3J80E 2IX1A 5T1IA 1EU3A 5CMDA 2VXWA 3DEOA 1V1PA 3CRKC 3Q8AA 1MGSA 4EQOA 1C4CA 3GO5A 4RF0A 3W2DA 2K9XA 4KTAA 4ZRZA 5K36H 4YSZB 1HTLD 1WTXA 3BS1A 5CC4A 2ZXOA 5KRUA 3BDLA 4FF3A 1FR3A 3W5UB 2NTTA 1PRTD 3C46A 4RCOA 1KF6B 2RBMA 3H3VC 3NVWA 2KQ4X 4HCEA 1VMCA 2EYHA 4BA1I 2KN4A 2K5WA 3VYRA 1ET6A 1DCZA 1STYA 4L63B 1I4QA 3GTLB 5A35A 3I57A 4G4KA 5C3JB 1K83B 4KGSA 3I9V1 3BYTB 4IUTA 3AEEB 2EYOA 3B2GA 1EIHA 1FMAD 5CBAE 2F1MA 1RM6C 3T4AC 2BTEA 3SFDB 1S5ED 5FKAC 1PZKD 4QCLA 1Q1BA 3A8IE 5BN3A 1D2BA 1I6VC 3UI2A 5TSSA 3NWTA 1I50B 1CT1D 2B2TC 1JMLA 4FXDA 1EWHA 2WACA 4N59A 3PUVA 5HURA 2MUYA 2F0EA 4RGOS 1CFMA 3FPUB 3NBHA 1RWSA 3VQIA 4K2LA 2J42A 4PMBA 3V05A 1C77A 5KNBA 4DF7A 1PDXA 2Q8IB 3HEJA 1HUMA 4WURA 1MVKA 2Z1CA 4PNYA 4ZRPA 1QOFA 1SYCA 1QOGA 3IFTA 2PZWA 1BDOA 3K5MA 2K01A 1YQ4B 2LUMA 4DFAA 3H8HA 1T3QA 1Q10A 3TZDA 2EJGC 5EPLA 5BYSA 1QCBD 2L32A 4ILWA 4YXDB 5DEHA 2V4IB 3B2FA 1BO0A 1V1OA 1VDVA 1FXAA 1WVLA 3A8JE 1C4AA 3R2IA 1PFNA 1CA5A 2PLPA 4DK1A 4H7BA 2R3ZA 4M1UB 2B2UC 1Q8IA 1E0BA 1CZGA 1L0YB 3BVGA 1LT3D 2G1EA 2EPBA 2K3UA 4G7ZC 1E7PB 3K5NA 3AE7B 1CZWA 1PZJD 1DONA 5JJZA 2NVXB 1DM0B 2KCCA 5CR3A 5M3MB 4MIUA 1O78A 1SNCA 1TS3A 3ZYYX 3K5LA 4XDDA 3FEWX 4OIKA 2GRIA 4A3JB 1WTVA 4LAAA 1SNPA 3AE6B 5FR3A 1SFOB 1QNKA 3M4OB 2INNE 3PO3B 5F2DA 2AWOA 1T5XD 1Y8PB 1FFUA 2WAQB 1F77A 3RD4A 3MWYW 1K53A 2N7JA 3OW7A 2E74C 2O5IC 5BYQA 1MPEA 1SNQA 3HOYB 1VMPA 3FKIB 4XIGS 2AUKA 1XLOA 4WORA 4DU9A 3L9AX 1NAPA 2NVYB 1ROEA 2A68C 2BDNA 2EY2A 4ZYSA 1NR4A 2PYKA 2NBFA 4OL7A 2DNCA 4QUCA 5C6AA 2RDHA 3MA2B 2RKSA 2NYZD 3Q23A 2HUGA 3HVZA 1PGBA 2LFIA 2L1BA 2NMQA 3NS1A 3RZOB 5FLXE 2OXPA 1JOOA 3C1FA 4X3KA 3AMUA 3KLSA 4K2KA 5C3WA 5JPNC 3P4PB 3Q8FA 1W6KA 4KD3A 1IW7C 1L0VB 1YN3A 3PUWA 2EY1A 4JWUC 1H9KA 1ENAA 1SE3A 4QMGA 3HUIA 1ACCA 2QEJC 3N6RA 3VR5A 1EWYC 3E6ZX 4UAIA 1PUTA 1OFFA