1ENFA

Crystal structure of staphylococcal enterotoxin h determined to 1.69 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
212
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords ENTEROTOXIN H
total genus 71
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2000-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1enfA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1enfA02
1RCVD 1XTCD 1EU3A 1SE2A 1LTGD 3EFXD 2WV6D 1PTOD 1JWSD 1FGBD 5D3DA 4DXGA 1KTKA 1LT5D 5FK9C 1LT3D 1V1PA 2XN9C 2XNAC 1D5ZC 1DYQA 1HTLD 1SE4A 1SXTA 1XXGA 2SEBD 1EFID 4RHRA 1FNUA 3W2DA 1HXYD 1PRTB 1ET9A 1QILA 2XRSD 4RCOA 5ELEA 1EEFD 3BVGA 3O13A 1STEA 2J4XA 2RDHA 1BCPF 1ET6A 1RF2D 1BCPD 1SEBD 3EA6A 1I4XA 5FKAC 4L6TB 1I4QA 1LT4D 3GP7A 1PTOB 1CK1A 1L0YB 1D5MC 1PRTC 2TSSA 1SE3A 3DWAA 1TS5A 2ICIA 5TSSA 2RDGA 3URYA 1CQVA 1TS4A 1CHPD 3R2IA 1FNVA 2QILA 1FD7D 3SEBA 1LT6D 4RFBA 1LTSD 1EEID 1B44D 4TSSA 3BYTB 1B1ZA 1FNWA 2QEJC 4Z9CB 4RHSA 1BXTA 1LTID 1M4VA 1JWUD 4RGTA 1JR0D 3DWQA 3BZDB 5D3IB 1I4GA 3V05A 3BVMA 1KLUD 1EU4A 1YN3A 1PRTD 1S5FD 4O1NA 1HQRD 1S5DD 4RGOS 1PTOH 1UNSA 1JCKB 4L63B 1D5XC 1BCPC 1I4RA 1TY2A 1AW7A 2G9HD 4DXFA 1LO5D 2XRQD 1EWCA 1S5ED 1SJHD 1DJRD 1LTRD 2NTSA 1PTOC 3CHBD 1PZKD 3BYYB 2IPKD 1TY0A 4UDUC 3R8BA 1TS2A 4RGMA 4ZYSA 1F77A 2Z8LA 1V1OA 1PTOF 1LLRD 3OWEB 1YN5A 5ELBA 4NZLB 5I4DA 1G8ZD 1PZID 1L0XB 4OHJA 1PYWD 1T5XD 5ELDA 1YN4A 1CT1D 3TSSA 1BCPB 4C56C 2NTTA 1LTTD 2AQ3B 3BVZA 1S5CD 1SBBB 1V1PB 1PRTF 1ENFA 1JQYD 1SJED 1S5BD 4RGNA 1I4PA 1UUPA 2IJ0A 2AQ1B 1MD2D 4RH6A 1ESFA 1I4HA 1LTAD 3DWPA 5ELFA 1RDPD 1GOZA 1AN8A 5ELCA 2AQ2B 2R61A 3MC0B 4BWGB 3MFGA 1JWMD 1KLGD 1PZJD 3R2TA 1RD9D 4K6LA 1TS3A 1D6EC 2O2LD 1HA5A 1CHQD 3KLSX 2CHBD 1LTBD
chains in the Genus database with same CATH superfamily
3N1ZC 1RCVD 2YYZA 1HH2P 1XNQQ 4CQNA 2KCMA 2QF7A 2WDTB 1XWEA 4FLHA 1H9SA 1PH8A 2FJ2A 3I70A 5CHVC 1L2FA 1QE6A 2DJFC 2VS1A 3IFTA 5IIFA 4G0NB 3ZKJC 1XYIA 2JA5H 2ZNVC 1H8CA 2PVOD 2LXKA 4N8FA 3J80L 4QCLA 2R93G 1X56A 3RNCC 4BKTA 3ZJUA 3K6OA 1KRTA 2H4OA 1YHBA 3TQYA 1IBKQ 4A3GB 2BS4B 1HHVA 2M56B 1SLJA 3DHQA 5DPWA 1GO3E 1TWCB 3NBHB 3SGIA 2WXOA 4AP4C 1Q46A 1E6EB 2C5CA 5J22A 3K7UC 1M1KC 3PZ8A 4NXMQ 1K0SA 1X3PA 2KD0A 3RULA 2PIAA 3CF6E 3PZDA 5I6YA 3D4DA 5IYCG 2KMAA 2ZZPB 1AEXA 1PA6A 3QR8A 4EX5A 5DPSA 1KM7A 2WINB 1L4ZB 1B53A 1FCCC 2K1FA 5M3FB 1XNRQ 2LUMA 3NS8A 4IUQA 3H3VI 3ICEA 2FAZA 4APVA 3PF5A 4W9FA 4ACFA 3JC66 2MUYA 3A55A 3HOVH 4JIOU 1E24A 1VDVA 1PH5A 1X55A 2EVBA 3D6WA 1B44D 3IRBA 4KTAA 3GV6A 4KJOA 3VR6A 3S14H 3MJWA 5FR3A 3CKIB 1J8CA 1WTQA 1F2ZA 3CWIA 4HSVA 4YHHQ 4EGVA 4LK0M 3NZSA 1VQLA 4TV3A 3RLNA 3I9V1 5LMUL 2DAJA 5H92C 2GVBA 2HTHA 2ZTCA 1HA5A 1I4GA 3RZDB 2MCNB 2FUHB 4HCEA 2PPHA 2PW7A 5IA7A 4QL5A 3H3VH 4GN5A 4JBJA 4RG1A 3Q8BA 2K5NA 1YNJD 3W5OA 3AEGB 2IGDA 1II3A 1PYSB 1Q86C 3BZCA 5M3FH 2B2UA 5M3FG 4YY3L 3DHGC 3E9SA 1K3BC 3T8MA 3TN2A 2K22A 3KLRA 2OT2A 2QIEB 4JBKA 4AYBE 1I6HH 3CRKC 1K3RA 5IYCH 2BDOA 3V6CB 4WJ4A 2F4IA 2UXBL 4MH0E 3IAYA 4EQNA 1SDFA 2Z8LA 2OEOA 2OOBB 2N7DA 2K50A 3Q3OC 2PEAA 4GSWA 1C48A 2N8NA 3BY4B 1J0GA 5D65A 4FF1A 2KWDA 1HPCA 1HEZE 4K2LA 1HUMA 1EO6A 1O7LA 1STHA 4K6DA 2WGSA 3DBRI 5JEAG 2C9OA 3PREA 2EOTA 4GLVB 4ZKCB 1TIID 2ZW0A 4A3JG 3HEJA 2KDEB 3HOYH 2LMCA 3AE5B 2ASBA 3VTVA 2Y0SG 1LTTD 3NTHA 1NDDA 2EY6A 3MA2B 3AULA 1MIUA 3Q6SA 3VYTA 1QWYA 1UUPA 1SGHA 2IO0B 1F2YA 3V2TA 1GC6A 2F0MA 1EY4A 5ELCA 1TBEA 2BKFA 3IT6B 4HAEA 1H9KA 4CDFC 1WTWA 1QUQA 2EQSA 1KD1C 4H0LC 3A9KB 1ONLA 2HIXA 4L5TA 1TJEA 1N61A 2MJEA 3KUZA 1K28A 3L2PA 3DDCB 3AMUA 4X57B 4RWSC 5D3DA 5IGDA 1XMOL 3GTMH 4DV1Q 4ITKA 2WP8J 2QKIC 2XN9C 1A8VA 1IW7C 1SB3C 4IOAA 2F0IA 1UE7A 2KTRB 3VR5A 4FXDA 1JJ2A 1N60A 2WWZA 1Q1EA 2J4XA 4BY7B 2RDHA 1RF2D 2RHQB 2F0QA 1BCPD 3CCVA 4N59A 1EQRA 5FKAC 4ZQ3A 1MJEA 2O6VD 4AJYB 5M5XH 3PO3G 1C9FA 2F52A 5I6WA 2EYLA 2LRWA 1PH1A 1F2RC 1ILPA 4KHVA 4A3FB 3RNUA 2E75C 4I6LB 3DWAA 2BW2A 1MI2A 3CXCA 1IBXB 2KC1A 3RNEC 2IW3A 2RHSB 3WCQA 2JXMB 2L05A 2EE1A 4KKTA 2Z59B 1V81A 2DY8A 3MAQA 2I5HA 4DR3L 1IBKL 4JI4Q 4HK2A 4ZRPA 3U30A 2PE9A 2LUEA 3RFZB 3RZOH 1I42A 4QB4A 2R7FA 2EMSA 5ISRA 4DR3Q 4JI4L 1QF6A 2QEJC 2RMMA 4A3KG 1AWDA 3ZNZB 2ZJPA 1M4VA 3IL8A 1VQ5A 5M5WH 3DWQA 1EF5A 4C2MH 3BINA 2N0SB 2OJWA 4FJZA 2L00B 3ZNHB 2MHVA 2FIDA 1E1TA 3E9HA 1OEYJ 3ZGZA 4EQ5A 4RGOS 2F0JA 1UNSA 2GLSA 1A6XA 2QMTA 4R1JA 3AE3B 3VUXA 2QGQA 2F0FA 2AL3A 5IGGA 1SNOA 1GJXA 1AE3A 4LF8L 1ZEQX 3N3KB 3BU2A 1PZKD 2PW9A 3HRZC 5FR6A 2AMCB 3I4OA 1ICFB 4IM2A 4PYUA 2D2CC 4A3IG 3STBD 4POFA 4K0KL 4B3SL 3KW5B 2C9WB 1VQ9A 2WP9B 4HCSA 1R4PB 1YD8U 1ZKOA 1V9JA 2OXPA 2MBEA 5C4ZA 3CW2C 3J81j 4PS3A 2JP1A 1I3QB 1A0IA 4F8CB 3MXNB 3CQZH 4AOFA 3ZJTA 1KRSA 4W9HA 4A93G 3IHPC 1WD1A 3BVZA 4AIMA 3QWZB 3NWSA 1SBBB 4F7ZA 4DU9A 2DNFA 2WU5B 2BVCA 2EXZA 4GDLB 1WE6A 1CI3M 4KD4A 1MD2D 4A3IH 1IGCA 1CSPA 1E7ZA 2IWHA 1HNZL 4GIVA 2WXQA 4GN1A 2FBWB 3DBHI 4GMVA 5IO9A 3U7ZA 3OW7A 3UDXA 3H15A 3GTGH 5CMDA 2UUCL 2AX5A 4G11A 5IWAL 1R7SA 2A73B 2L0FA 2BE5D 1NVID 4DDGD 2Y5PA 3MEFA 3KJPA 2UUBL 3TEYA 4JK1C 3SK8A 5IOIA 4PZ7A 1D8LA 2Q2UA 2K01A 2KJXA 3RZFA 1UWVA 1LTGD 4C4VA 4XYOA 3PRZA 2D3CA 1V1PA 2KCTA 1AZPA 1EQQA 5G3LF 2BWES 3T51B 3N9YC 2MWSB 4R4TA 5KNDA 1MSHA 2I38A 2L52A 2PYKA 1PFSA 3J7YW 3L10B 4ZHPA 1O7IA 4FXKC 4GOPB 2L11A 4OVVA 4KY6A 4BBRB 2OF1A 1JOOA 2JEAI 1HNWQ 1QOAA 4GLSC 2D2QA 4QIWE 2BYTA 3HOXG 1IGDA 1YJ9A 5AZGA 3EVQA 2REXA 1G291 4RM8A 1SE3A 2QSDA 4DV1L 4BBSB 4F87A 1WE7A 2KECA 4OL7A 3HKZG 5D14A 4JI7L 5C3EB 4IFDH 4G57A 2QILA 4B3RQ 4OO1H 3S1RH 1YEZA 1YVCA 2YTXA 2E6XA 1Y1VB 3CCUA 1IBMQ 2DZIA 2N9LA 1YI2A 1LV9A 3A1QA 1A63A 3F2DA 2L32A 4CKBA 1V8CA 3M7GA 4GKKL 4M8NA 2CHXA 1L1OA 4J6HA 1V80A 4L5RC 4A3BH 1RIPA 3GTLH 1RTNA 1MJDA 4OEMB 1STAA 1MVKA 4IPGA 1VQCA 2N49A 2CQAA 2XBBC 2XEWA 4PZ6A 2OQ0A 3JAME 4ZRJA 3GZNB 5EE0A 2ZT9C 4A3LH 2I5LX 2EJFC 3A9JB 1YJNA 2HJ1A 2L83A 2KDFB 4EZJA 1SE9A 5MPOA 3I55A 1EZ6A 1XMOQ 2KK8A 1BR9A 2JA8B 4GZYC 5EKKA 3IFDA 3NOBA 4K3BA 3R66C 4ZRQA 4ZKBB 1CKNB 1T3QA 2L55A 1VQ7A 5LXIB 3F8TA 3MXPA 2BA1A 1EYGA 2FCQA 5JHBA 2D5GA 4HLEA 3OWEB 3ENEA 3KLSA 4N8X1 1UWXA 5EJWA 2BYVE 2Z0DB 1DD2A 5C0XI 3N32A 4XWWA 2DNCA 3NENA 2OWOA 3APDA 4A3DH 1STBA 2I07B 2KTFA 2UYZB 3IBEA 1T5XD 5EAYA 3LDZE 4CYEA 3A54A 4HR7B 1T0SC 2B39A 1KNAA 3FKIB 3M4PA 3K5MA 1YN4A 4H13C 3OAWA 1D1IA 1SMYC 3I73A 4C56C 3QOLA 2F03A 2CR5A 2UWQA 3IXSA 4HROA 1T5EA 4OWXB 3E0EA 1DOIA 4NDXA 4NMZA 3NQIA 5J18A 2L76A 4ZRKA 1PFMA 1SFOB 4HN7A 4B3SQ 2K04A 2PJHA 2KEEA 3HUIA 1BKBA 4ICVA 3DHHC 3V96A 2UUBQ 4IN3A 1Y1WH 4BWGB 3IKJA 4G7ZC 2AKWB 2ZCBA 3SU8X 2C7MB 2EXDA 4C3IH 2K39A 4NB3A 1D6EC 4I7AA 2A6HC 2N55A 4L63B 1CHQD 3HZXA 4LF4Q 2AWOA 1LQBA 4KIKA 3S2AA 1MI0A 2K7VA 3ZYYX 2QDLA 4GOCA 1CSQA 3EQLC 4ME5A 2NUCA 1QVFA 2LASA 2WXNA 2WNMA 4FADA 1I3QH 3R93A 2VZKD 1VQDA 1A3TA 4B9WA 4KDIC 4FHJA 4K7UA 1XXGA 3PVLA 4EOYA 4TQUS 4U68A 2F0HA 2E5LL 2JA6G 3QK0A 3R3OA 1PRTB 1Q1OA 2ASQA 4BKGA 4DHJB 1STNA 2LGXA 1QOHA 1KABA 3O13A 4HSPA 2A4ZA 3TCAA 4IQZA 4ASWC 3I7FA 1QZHA 4XDDA 2LJ5A 2JVCA 4BVUC 4OIJA 2ZNVB 1WOCA 1QB5D 3S1QB 1AYFA 5D2MB 2KFKA 1LT4D 3T9LA 1STYA 3J80c 3ETRA 2Z4HA 3ULLA 3I4NB 1K52A 3W1GA 2OHFA 4MGIE 4W9GA 3VRBB 4FBJB 3A56A 4LWCA 3J81i 5CHWA 1P9DU 1HNXL 4B3ML 2KCCA 1B9MA 1CM9A 2RDGA 4DR4L 1KDAA 1QT9A 3OW2A 4BY7G 4K5WA 4ZOHC 4DR4Q 1GHKA 2JWZA 2YTVA 4EZLA 1YZ6A 4DV6Q 2Y5CA 3N30A 1E10A 1J6QA 2J0TD 2XVSA 2A69C 4YTNB 3DM3A 2WFWA 1QQRA 1WR6E 3NK9A 2L7RA 4IC7B 4RF0A 2NWGA 3S9WA 3TEXA 4EVOA 3C19A 3PCOB 3U2SC 3PO2H 5EBDA 1KLUD 1OGWA 1ZDXA 2H89B 1E2VA 1OXXK 3AB9A 1YQ3B 3E6ZX 2UUAL 1NSNS 2WYQA 5IWAQ 4KMUC 1EUVB 2D3BA 1TKWB 4NPNA 2R92B 4I6NB 1NJIC 3H3VC 3GZNI 1C3TA 1FMAD 4DXFA 4HJ5A 1GNUA 1DJRD 5IGEA 4A3DB 1RFAA 1JW9D 5K36H 3RCZA 4IALA 5C44G 1WGKA 4DK1A 5JAVA 4N6EB 2M8SA 1YBYA 3NUCA 3I3CA 1EY5A 4JLCA 4B0EA 2M2LA 3KWVA 2L5TA 1X65A 2XWJB 1YJWA 3KUPA 4OO1G 3I5JC 4W9KA 3WAMA 1D2BA 3PF4A 5CORA 4MIUA 4A3MH 5IN7A 1C76A 2EPBA 3WOFA 1X3FA 4MDKE 1V5OA 1CKMA 1WTVA 4A75A 2Z6KC 3ZO5B 3KYHC 3P4QB 1BDOA 3I56A 2SAKA 4ARCA 3SR1A 1UBIA 3GTPB 2MO0A 1SAPA 4A3IB 2AQ3B 1JQ4A 4JYAL 3RLFA 4LUZA 2JYOA 2NPTA 4B3TL 3QJYA 2CQOA 4OIKA 2FNJB 4BA1I 5FO8B 2WAQG 2F1MA 3H0GB 4DFAA 4IUTA 1IUEA 5CTRC 1AN8A 4YCWA 3S17H 3H6NA 2RPVA 4M01A 1CZWA 1VQHA 2PQAB 4R9WA 1VJKA 4C3HH 1U9RA 3SVMA 2WIIB 1XCTL 2HD3A 4A93B 1ILQA 2GBKA 2N7JA 1EU3A 5JVG3 2CHWA 4IM3A 1ZW7A 4M02A 1N32L 3U52E 2K03A 4GOPA 1D7QA 4HIOA 4O2DA 1ISNA 4P1CC 2K52A 5JZEB 4K0KQ 4LNOA 4WJWA 5LMUQ 1W3SA 3W5VB 1L1OC 3CCLA 1G91A 1FXTB 3S24A 5D94A 3QOJA 4CBVA 4FA6A 5BYQA 4A3EH 3LGJA 4BBRH 1UBQA 3K8AA 1J8IA 3AEAB 2MJ8A 2KXJA 3U7DA 3S14B 4UPAA 5IT9c 1YNND 2B8FA 2LEKA 5C5LA 4A3FH 3H0GG 3U4EG 5G2NA 3B6YA 1EWHA 1PTOB 2PMZB 3Q8CA 1CK1A 4WFN3 4JVZA 2I1JA 2VRRB 3LX0A 4A3CG 1IL8A 3JAMc 5TSSA 2F0TA 2MLBA 4XQNA 2PMVA 3ABVB 1YQBA 2NBFA 4DV3Q 1FNVA 3KYCD 3W3AA 3V62A 1TIFA 2DYMA 1AZQA 4W9CA 5CC4A 1EEID 1WD0A 3I4MH 3TS0A 5CV7A 3H91A 2VB3X 4Z9CB 3ER0A 2K5DA 5NUCA 3RUZA 2KENA 4XXEA 1TWAB 1E22A 2M9VA 4MGYE 3TIXA 3ZDTA 1A15A 4DAYB 2IYDB 4RGTA 4XE0A 1NUCA 1F0ZA 2JA5G 4LTUA 4JI6Q 4W9DA 1L2NA 1FXIA 3NJTA 2NPTB 3AE8B 4KSKC 4DK6C 3T3OA 1OQRA 3S1NH 1PHJA 1FR3A 4O1NA 3D3RA 1V97A 2NCNA 1M90C 2PI2A 4KZCA 4H7BA 1TXYA 2HDLA 2NZHA 4XYCA 4P16A 3IFWB 3A33B 1MHWC 1EY6A 3J9CA 5L37A 1JROA 3D6CA 1CZGA 2INPE 3IVFA 3PUWA 1C77A 1PLFA 2FCSA 4J1MA 1PYBA 2FFKB 4DV4L 4C1NK 3HOYB 2KACA 2PTLA 4IKGA 3M4OB 3GQBA 4TKOB 5JOBA 4EQPA 2DYBA 1MG8A 4FVMA 4HVBA 2MNAA 2B2TA 4L1BA 3PRMB 1LLRD 2PMZE 3BZKA 1Y8NB 4IOCA 4DK3C 3DWGC 1B7YB 3MFYA 4OHJA 2K6AA 4BBSH 2KJ6A 3NZ3A 5BO4B 2JA7H 2R3ZA 2L9HA 3C1EA 4H44C 3WDNA 2CH4W 5LL6X 3QIJA 2W3SA 4IUVA 4IUNA 3GTQH 4A20A 4K5VA 3DQVA 5E6JA 4PYZA 4N9PA 3QG1A 5C4XH 2F4VQ 3M62B 2VQFL 4WJ3M 1S5CD 1PXUA 1LGRA 4HJ7A 4BOSC 1TZ1A 1UEAB 4W9JA 1BOSA 1PDQA 4K5XA 4OWTB 4X64L 1PV4A 3S17B 1I4HA 5ELFA 1WM2A 3Q8EA 5G55A 1S3OA 3TL5A 1KJTA 2L3ZA 1N36Q 1J7CA 2NMQA 4AQYQ 3N6RA 5CV5A 2A5HA 1NE3A 2IY0B 1QUQB 5FJ8G 4HJ8A 1TS3A 4DAVA 1JJGA 3EJIA 4JX1C 1XTCD 4S0RA 1SYCA 4ZCKA 2KLCA 4IO9A 3GTPH 4KLKA 2DHZA 1P1AA 4MJSB 1FGBD 1BNZA 3A4SC 2LGDA 1WXVA 3ZLZA 4LF5L 2RBMA 1DYQA 1B8AA 4LF7L 3KLWA 2JUOA 3KUDB 1FNUA 2JA6H 2M1MA 2Z6KA 2IGGA 1ESRA 2B63H 4XZ4A 2LY7A 2CH4A 1XD3B 3Q0AA 3MC8A 4U673 1EZ8A 3GTLB 3H8HA 4PT5A 2EYFA 1E3PA 2K75A 5CX3A 4DBGA 1SYFA 1XO3A 3T3NA 3VR3A 5JH5C 1SEBD 3ECIA 4ID6A 3T1HQ 4XT3B 3AE1B 2K1BA 1KC8C 1YQ4B 3SHLA 1X1MA 4MT5A 4XDCA 5M3MG 4AUQC 4IM0A 3P7JA 1H9RA 2ZVOA 4A4IA 2KANA 2K0PA 2RF4A 2SOBA 1SYGA 2KMCA 3W1SC 1WX9A 4RMFA 3RZDH 4XT1B 3GTJB 3FHWA 1E8WA 1SR3A 2FXQA 3RD4A 3SEBA 4WWOA 2KTRA 3TP6A 4DR2L 3C3LA 2WX0A 4RFBA 4JI6L 5LXHA 1MPEA 5EE9A 2HQEA 3BDCA 3FRPB 2K5VA 1QVGA 4KN7C 3I4NG 3IG3A 3CC7A 3UQBA 1IBLL 1KF6B 4ZAIA 2W54A 1FPYA 3AEDB 5KHOA 2KOXA 1XNRL 2B2UC 3H7PB 2A74C 1B3QA 3J7A5 3PUVA 4DNIA 1E0ZA 4ZUJA 4P71A 5DLQE 2J53A 1SNMA 4FF3A 1IHZA 3FPUB 4KGSA 3UDIA 4FNFA 4OX9Q 2IL8A 1WGRA 1PTOH 2KHWB 1BBUA 4MM3B 4EKUA 2B2YC 4DA2A 1DOLA 5J1ZA 3GTOH 5IKCM 2R7ZB 2Q8TA 3M7NA 3EC8A 3NEMA 2KUMA 2BQQA 3D4RA 3GE8C 3F1ZA 2JA7B 2MP2B 4PS8A 5IP7H 1EY8A 2IHEA 3S1RB 1JRUA 4MELA 1SYBA 4C3JH 3DWMA 4H2AA 2NN6H 4LF9Q 3RT3B 3PPAA 3P1HA 3KF6A 2FMMA 2CU3A 3TP8A 1JORA 1DZ1A 3CRLC 1PTOF 3FILB 4M00A 1WY8A 2AEHA 4UHVA 1HRJA 1S4ZA 2D10A 3APFA 3T13A 4IUMB 5LL6S 4ZRIA 4DGZA 2L0CA 4WWPA 4JWUC 1U4PA 2MPMA 1WRDB 1KIXA 2K6DB 1R4MB 3G6EA 2A5UA 1XX8A 4GKJL 2ZXOA 3KF8A 3B0AA 2ES2A 1WF9A 2QW7A 5C4XG 2W3RA 3CSTA 1WZ0A 2B3AA 1SIFA 2KHSA 4MTNA 4GKJQ 4NJCA 1V1PB 3T53B 3GTKH 4R4OA 4HPLB 2RCNA 2R6GA 1PFBA 3DVGY 4YCVA 5C3XA 1E7UA 3BK2A 2JA8H 3PO0A 1LTAD 4P72A 3ZRCA 3Q8AA 1ENAA 3D8GA 2AQ2B 5HGQA 2EZVA 3NBIA 4DKAC 3B1LX 1RD9D 1VQBA 4K6LA 3E0JA 4X3UA 2A69D 4HMIA 2G45B 3A74A 2CHBD 3TBIB 2WU2B 1WH3A 1JMCA 2B2TC 4QUFA 1HZ9A 2BTEA 4DWFA 3OLMD 1R4MI 5H8YE 1EL0A 3S2HB 2LJIA 2IY1B 2DYOA 5IGCA 3ZNID 4IPDA 1D5ZC 1HTLD 2JA9A 2N88A 2SEBD 5AFWA 1KDCA 3A5UA 1K8GA 2XRSD 3ZTDA 1ML0D 5TR5A 1GUGA 4PMCA 2UXCL 1EEFD 4DUZL 3M63B 1STEA 3M95A 1VF5C 2E74C 3DPDA 2I1KA 3D32A 1A62A 4L6TB 3N52A 4GLXA 2SDFA 5M5WB 3FP9A 3C2PA 2EMTA 1QJOA 2IX1A 2FCNA 2RPQA 4LCDE 3RNGC 4A3GH 2DBYA 3TEZA 2PQAA 4ULLA 3AB5A 3RMKC 3PZ7A 1P16A 1V43A 1Q3LA 3P4PB 3A0JA 4M8MA 4BOZB 4KI0A 2NVXH 2RDFA 4DV5L 2A68C 2JA8G 2ZXRA 1MJCA 2UU7A 5C5MA 2B8GA 2J0MA 3KH0A 5CBEE 1KDBA 1FFUA 1NEKB 2Z0EB 3A8KE 5KNBA 5M3MH 1MFWA 1FNWA 2Y3AA 2CS4A 2M4NA 2PZWA 3L9AX 3VR2A 2LVOA 3Q3FA 3T1HL 1F9JA 5AUKA 4YXDB 3VUWA 2CVRA 2EYJA 1DXMA 2FHTA 2C7HA 1CKNA 1VDZA 3SK5A 1WXSA 1QVCA 2VZAA 1L7YA 1WGGA 4TRDA 4FYDA 4FF2A 2N9XA 3CCEA 4CKEA 2O4XA 2X69A 1S5DD 1DGSA 4IDIA 5A2QL 1XPOA 4NXML 1ROEA 2CU1A 4GN4B 4K81A 5C3JB 2M00A 1BCPC 1MHXA 2J42A 4CO7A 4GNXA 1PH9A 3R3MA 2IO2B 3A9JA 3NUHB 4ZDVA 4XTCS 2PKOA 1S5ED 1EFWA 1XQQA 2N78A 3OIQA 4C3JG 2WKDA 3DVNV 1VD2A 1OXTA 4LDTB 5IP7G 1A2TA 1ICWA 2PZUA 2JYEA 3V6EB 3CCQA 3HKZB 3AQQA 1H9JA 1BUVT 2R2QA 2KNBA 4HKQA 3RNAC 4K7WA 4DK0A 2MBBB 3UIPB 2NVUI 2UXBQ 1HZAA 2JN4A 4DAYA 3QX1A 4N9TA 5J17A 4OX9L 1WCMG 2F0PA 1IZ6A 2BPSA 2NS5A 1GC7A 2A8VA 3MVVA 4AH6A 1N62A 2BB5A 3OMCA 2R92H 4JI8Q 5FLMG 2O6VB 4QAYA 1ZE3D 1FD6A 1TR5A 1VQOA 1RWSA 4CGYB 1SYDA 3M4YA 3DVGX 1P3QU 2F0NA 3TP5A 4BKSD 2EELA 5KYLA 1PMRA 4NNJB 4HKZE 2YLMA 1S5BD 4HIKA 4GN3B 4DAPA 1WXMA 4KV2A 2F3VA 4UP8A 3X0WA 3K59A 1UGMA 3EN2A 3MC0B 1WX7A 4MSQB 3UE0A 3FKIH 1WTHA 3TZUA 5AEKB 3K7AB 1MSGA 3TMEA 2RR9A 5BYSA 5EPLA 5IGFA 1C78A 1QOGA 4GDKA 4XC2A 3J80i 4LMQD 2HE7A 3SHQA 3UIOB 5HKHA 2H1EA 4CHTB 3CMAA 1IP9A 3HFZB 1VQFA 2DENB 3UF8A 1LABA 4DXGA 2WQYB 3VDZA 3EUB2 3BDOA 5FK9C 4C1NI 4MGKE 5BMIA 2HIVA 5DM73 4HIDA 1ZGUB 2B2WC 2WXGA 3RN9C 5E7NA 1YX5B 2RSUA 1GUSA 3P4SB 4G50A 1XCQL 2MX2A 5C4JB 2Z1CA 3W5UB 3U9OA 3A9KA 4IPCA 3ZW3A 2L12A 4B3RL 2KWCA 2QDBA 5FLXE 1SNQA 1K8MA 3DMUA 3VA5A 1XLPA 3ZTCA 3T56B 4C00A 4EEWA 1NBWA 3CCSA 5CHFA 3T1YQ 4K14A 3AM9A 1QZEA 4J15A 5IODA 3A4RA 4JW0A 2E2JH 3EHVA 1F52A 3HP3A 1KFYB 1ZKHA 1IXRA 1EYCA 1SSOA 4JV5L 2EY2A 2LVQA 3GE3C 1EYAA 1WZ3A 2AYOB 4W9LA 1C4QA 4PMBA 3QO2A 1LT6D 3KFUA 2A68D 1GVPA 2EKIA 1YOVB 2KQ4X 1T9HA 2MFIA 4LFBQ 1JALA 2JRHA 3A7LA 1ZDVA 3Q22A 4ZRZA 2ENBA 4US8A 1F9SA 4C2MB 4KSLC 1Q1BA 3PMFA 1Y69U 2G1EA 2KKCA 1KXLA 4GB9A 4LAAA 4JOIC 2JA6B 5D3IB 2NVXB 3D31A 2N9PC 2WXPA 3QC8B 1VZ8A 1SFOH 4YSZB 2AHOB 1WI0A 4HPPA 1KH0A 3EIVA 1PUTA 1WGYA 3HM6X 1C0AA 2KYWA 1IKLA 2YEPB 4UP9A 3H7SA 5DNFA 4JI0L 4PG3A 5CR3A 3WIMA 4G7HC 1J9OA 4A55A 1YX6B 4P73A 2G9HD 1G6PA 2LGYA 2LS01 4KGRA 1NNXA 4Q5VA 2VQEL 3DEPA 3J80E 1EIHA 4HJAA 2IX0A 1IYVA 2IPKD 1WTRA 2X6LA 2L4NA 2QCZA 3IAM1 1V6EA 4TQ0A 3P4RB 5AUIA 2QA4A 1IYJB 5FO9B 2WDRB 1X9NA 3SDZA 1XMQL 1OFFA 4OO1I 4DUZQ 3AFQA 4ZK9B 5EE3A 2ZM6L 2N1VA 4P75A 4L5QA 2JT4B 1YN5A 1GUWA 4A3OA 4NJ7A 4RNAA 4V0BA 4IWOA 5JJZA 3GTMB 4G7OC 1H4RA 2LXCA 2K4KA 1WTOA 1DOYA 2Y5BB 3DXJC 3TSSA 4DQOC 2K9XA 1BCPB 5GROA 2ZCCA 5EDSA 2R93B 4DV5Q 5ELOA 1VMCA 1W6JA 4JI3L 4A3GG 3E56A 1J5EQ 3RD2A 2KDBA 3P42A 1BBXC 4YCUA 3D4WA 1RAXA 2ZTEA 1SJED 5CV9A 4NXNQ 2PPBC 5C0XG 3A1QB 3MC9A 3A5ZB 3ZJVA 4JI1L 1HUNA 3X23A 2BE5C 4RM9A 3DWPA 2KQ7A 2DAFA 4TKNA 3VVWB 2WACA 3MEHA 2JEBI 2KFKB 3W1SA 1BUIC 1Q81C 4MSMB 5C1ZA 2RA4A 4NJ6A 1X54A 2Z4IA 1WTXA 1TWHB 4YSXB 5C44H 2GMIC 4JI2L 5K36G 2OJRA 3PUXA 3KQ4A 3ZDMC 1SE2A 2C35B 3QIAA 4WWNA 3EFXD 4NW2A 4C3IB 2JPHA 1IPGA 1KTKA 3GV3A 3HS0C 2JRIB 2V3SA 3TBLD 3DBLB 4RMAA 2WB1B 1VQJA 3A8IE 4POGA 3RZOB 1RLFA 2E8GA 2K8CA 2R93H 1IKMA 1OXUA 2F3WA 4RCOA 5JJLA 4GDKB 3KDFA 5IYBH 3Q3NC 3CC2A 1S72A 4QJFA 2QHOA 1VQIA 1BCPF 5H1SE 3QAQA 4A3LG 2BOSA 4A3KB 1SRUA 2G9DA 3UI3A 1CA5A 2MO1A 1HZ5A 3STBC 1G6ZA 2WAQB 4UP7A 4KKJA 1KL9A 2LXAA 3NG0A 5IYDH 1JRPA 1R9TB 1F9QA 2Z6BA 1WXQA 3VH3B 3R2IA 4O42A 1ENCA 2AUKA 1NMGA 2ATWA 2B63B 1NR4A 4LFCL 3RYTA 2DWQA 3OSOA 2V1YA 4KDLB 2O6VA 1PGBA 4KKIA 5C2TB 4IG7B 1HNXQ 4B3MQ 3ZIMA 3BYTB 3NE5B 1Q5WB 3U50C 3AYHB 4DF7A 5JEAH 2Z0SA 4IWPA 2LZ6A 1RHPA 4OWWB 3GB1A 2C7NB 3ML9A 3Q14C 3I2ZA 1GUTA 2E2HH 2PW5A 2ZEQA 3BZDB 2RSOA 2MP2A 3KYDD 2KX0A 3OTOQ 3CU7A 2F0LA 1ASZA 4BY1B 3OG5A 1HA6A 1G2SA 4IJHA 1J7BA 1Q90A 5FOBB 3AU4A 3KUCB 2EDGA 5JPMC 2I46A 3PGEA 3JYUA 4R8IA 2IX3A 4XGAB 2VH1A 1G6JA 3H09A 2Y0SB 3FAHA 1Z5SB 5C0XJ 1PQSA 1WX8A 3K0XA 1XMQQ 4LFBL 1EWCA 2JWUA 1HZBA 1WR1A 3S16H 2PE6B 1PGXA 3HOZH 2O5JC 1TY0A 3R8BA 3HKSA 3LJ3A 1F9RA 4RGMA 3VYRA 5C0XH 2LXJA 3MTSA 1VQKA 3FVQA 4JI7Q 1TWFB 2N1WA 2D5DA 3T4AC 4US9A 4E3CA 4X65L 1ASYA 4DHZB 3H94A 4HMJA 2ZXPA 2VZKB 3PHXB 1A5RA 2NB0A 3VYUA 5C23A 4WH4A 3TEWA 1PYWD 3P1MA 4MZ9A 1GUOA 1EIFA 4Y7NB 5J39A 3NHHA 2INCC 2LSSA 1BF4A 1E8ZA 3V61A 2KDMA 5FLMH 1XNQL 3M4OH 4NPSA 5DCNA 3RNFC 4K3CA 2TMPA 1I6HB 2K5WA 4A93H 4NQKE 2KN5A 1WJJA 3QA8A 1NI3A 4A76A 2D07B 1N32Q 1OEYA 4OZCA 1N8RC 3APCA 4OVUA 1WRIA 2AQ1B 4DNRB 4JI2Q 4HCPB 1CKOA 3DHIC 4DR1L 3HOUH 4TUUA 4DR7Q 3L0WB 3U4VA 3SFEB 3HM3A 3BS1A 1DOKA 2E76C 4DAMA 4YSYB 3VA7A 4A3FG 4Y7NH 3NSWA 4L5SA 4W9EA 1I94L 2RGFA 4LK1C 2N7EA 4DR2Q 3Q6BA 4JYAQ 3NWTA 1J19A 3I3TB 1SNPA 1RYJA 2DX5B 2WV6D 1KRHA 1L5PA 1FIQA 2UU9Q 3LB8C 4IFDI 4MJSA 1LT3D 4KZ0A 3OHXC 2BA0A 1E9MA 2RKSA 3W2DA 4DR6L 4X66L 3VQIA 2WAQE 3G71A 1GUAB 3ZUNA 5ELEA 4M0WA 3J7ZC 3AE4B 2MEKA 1A3VA 4X62L 1DONA 1OQYA 1F9PA 2WXJA 4DV2L 5IAAC 1MG4A 1I4QA 5GADC 2B2VA 4ME3A 2BBCA 2KA7A 2CKHB 1SIJA 2HDMA 4MGZE 3KDFB 3PSIA 3G7LA 1BBWA 1L0YB 4DUYL 4DNTB 5DPTA 2LHDA 4WJPA 2ICIA 4X3KA 4DHJD 1BO0A 4HCNB 3DM1A 5GAGC 1KLVA 5LMNW 3L13A 1TYGB 1WXAA 3RZWC 1JB7A 3FPPA 4OONA 2KT7A 2E3TA 3HVZA 3PRPB 2MP1A 5BN4A 2D0PA 1EF1A 3Q3MC 5DM63 1LTSD 4LUVA 3PUZA 1LFDA 4FN2A 3A8JE 3NS1A 5IP9H 1B3AA 2LMCB 3K57A 1HNWL 4LNIA 1BQQT 1JOKA 1OXVA 2K8BA 3SDLC 4QMGA 2FUG1 3WA0A 3EFCA 3SK6A 2KMMA 3ZNGC 4B9XA 1EU4A 3PO3B 1S5FD 1K9MC 4I7ZC 1P98A 2RDBC 4IJLA 5AZFA 5IYDG 1C9OA 1Z2MA 3M3JA 2AUJD 4JWSC 1TY2A 3FKIG 1TWCH 1U4RA 3HIZA 2K5HA 3ITPA 2Q2IA 2K33A 1WM3A 3CPFA 5HY6A 3T1YL 1GG3A 2KVRA 4UDUC 2KO3A 1F2MA 1CZPA 1ZPSA 1B9RA 3ZRFA 1ZOYB 4MACA 1F77A 5E1FA 2AWNA 4BY1G 1WTPA 2E2IH 1KAWA 3M85A 3G6JB 2CWAA 2ZPNA 4GOPC 2UXCQ 2A6ED 1UF0A 1G8ZD 1S1QB 2K6QA 3N20C 4WAFA 1TWHH 1K8RB 4RKBA 2INDC 1KNEA 2KLGA 1CT1D 5LNK1 2WX1A 1IL2A 1YHAA 4M8AA 2IO1B 2CHZA 1JQYD 1OTCA 1VQEA 1K8OA 4PK1A 2R7ZG 2WDVB 4RGNA 4W9IA 2BYFA 4BY1H 1TKGA 1FCLA 2WLBA 5JJIA 4TQ1A 3JSVB 3DBRB 1PZJD 2K28A 4LJZC 4HJ9A 2WXHA 3VDYA 4GU2A 1EIGA 5GAHC 4ARIA 2IZVB 2Z9HA 4DR5Q 1VRAB 5JXVA 4A3MB 3M3YH 2KBNA 1JICA 1WYWB 4XX5A 2F0DA 2NVYH 2CW0C 4LF8Q 2GBRA 4MH8A 4CJ0B 3SFDB 4RCNA 1Z7TA 5LMNQ 2WS3B 4RHRA 4DPGA 3RMHA 1UZXB 2LHEA 1JC7A 3AH7A 3BVGA 2GI9A 2JXXA 4HXDA 5C6AA 1FXAA 2A6EC 1YIJA 4DHZE 2KFJA 1HTPA 3BJUA 3LWUA 3QB3A 2M19A 4C80A 2WXLA 2XWBB 5IY0A 3X3NA 2BS3B 2E2JB 1X32A 1O80A 3HVDA 4UAIA 3ERSX 4R3DA 4BFRA 4LFAQ 4F88A 3K9PB 3AEEB 4A3EB 5C3EH 4OZAA 1D5MC 1C4PA 2XK5B 3F2CA 3S1QH 4YWMA 2Q2TA 1D3ZA 4OELB 3NTIA 2N9KA 3KOJA 1E2ZA 2J7ZA 2JA5B 1R4NI 4OGQC 1TKEA 5M5YB 2AWTA 2F0EA 3URYA 2MJ3A 2RD0A 3JSVA 3EFUA 4TMAB 1YJ1A 3X3MA 4P6VF 1FD7D 2B2VC 2Q8IB 5C4JH 2ZJRA 2SNMA 3HOWH 1KOTA 4TSSA 4CKCA 2BDNA 1TQOA 3KF6B 5IOCA 1TZOA 4DV2Q 3K5NA 1WYDA 4RHSA 4A3CH 1F2LA 2KDIA 3TMPB 1TTNA 1AARA 3MXUA 4ALPA 4PZ8A 4F7XA 1PFDA 2F0SA 3W9CB 2HCCA 2JX5A 1HQMC 1SE8A 1OTRB 3HK0A 3C46A 1NBFC 1T0RC 1PRTD 2G5DA 2B63G 5C3WA 2L0TA 3K9OB 1Y1WB 4URKA 2LWPA 2EYOA 4YWKA 2GBNA 4NAWB 5CV8A 1D4BA 2KHJA 1RFKA 2D11A 2EY5A 3S2DH 2BCOA 3DVNU 1K53A 2UXDQ 5E6OA 1Y8RC 3R7RA 1NCVA 3BYYB 2BKRB 3CD6A 2CWPA 2YU9B 4MHEA 2E5LQ 3PIPA 4K8JA 2W82A 4DV6L 3T16A 2GRIA 3AEBB 5I9PA 4BA2I 3U8ZA 1Y8PB 2HUGA 3Q3JA 4X62Q 1A2UA 4HIMA 3HOUB 3CIRB 2WXRA 1YIWA 3HKZE 5ELBA 4WWMA 1CFMA 3RN5A 5AJ3Q 1P0RA 3J7AF 2QJLA 2DLBA 4WQMA 1X3GA 2VL6A 5AJ3L 3K7AH 5ELDA 3L7ZC 3I4LA 4A3JH 1HR0W 3SXHA 1WSPA 3UGBB 4YL8A 1NENB 4YT0B 1SSNA 1Q7YC 3S2DB 1UH6A 1UEBA 3ND8A 2G3QB 4LUOA 2V4DA 1WYGA 3NRZA 3DBHB 4IWQA 1GJZA 4DR5L 1LXDA 3L16A 1GB1A 2J0JA 5LHY1 4GGQA 4X64Q 5HURA 4LJOB 1NTGA 1NI2A 3ML8A 4A3BB 1NYQA 3R2TA 1Q12A 3CCJA 1P8LA 1TWFH 3Q24A 3I4MG 4IFDJ 2DNEA 1Z47A 4AWJA 1JOQA 3CCRA 3CC4A 2F0KA 3VYSA 2BWFA 2B76B 4K2KA 3P20A 3DOWA 4K1RB 4HTHA 3R7QA 1HR0Q 1H9SB 2XNAC 1SXTA 1QILA 4TVAB 4IURA 2LRUA 2KVZA 3LXFA 5COYA 3KJOA 1WGDA 3PS6A 1TWGH 1EIYB 2EJGC 1U0LA 3ZVVA 3AEVA 3NBHA 4R4QA 4WJNA 2VXWA 2IY5B 1WMHA 4JI0Q 1ZXHA 5J2RA 1TWAH 5I9OA 4YHHL 3GTJH 1X6OA 2NBUA 2JQOA 1PRTC 2OCEA 1DGJA 1V1QA 1VQ8A 3NVVA 3I4MB 3L3OC 5K5PA 1WVLA 4AQYL 2KJHB 4BS9A 3NVWA 3K5LA 2HDEA 2EJMA 3W1BA 1WCMH 4H02A 1GPXA 5JVH3 4KIKB 2Q8RE 2VH2A 3H9DA 2V0GA 4ZYNA 4BXXG 3KVFB 2FCMA 1RJTA 4C7YA 3CF5A 2I2YA 1Q0WB 3QJZA 1WIAA 3HOXB 3VR9B 4NXNL 3NHEB 3QQ8B 5EPKA 4FJYA 4WAAA 5KHQA 1HQRD 1FFVA 1VQMA 2XIWA 5IT9L 5HGTA 1XPUA 3VHTC 5DEHA 4CJ2C 1K83H 2WXKA 4EZKA 1Y1VG 2JE6I 3GS2A 1LO5D 2XRQD 2F0OA 2LKVA 3LNNA 1C8CA 1E8YA 4DV3L 2BH8A 4HJGE 2NZOA 1EOTA 3K0YA 4ZYSA 1R9TH 3MP9A 4JL9A 4ANUA 3MXNA 1ACCA 1N33L 2DZMA 3VR4A 2VW9A 2N4FA 1A3UA 2N3SA 2ICEC 5M9OA 1YJJA 2M0XA 3SK4A 5AZHA 1D1KA 2BGFA 3J81c 1PH4A 1V49A 5KIXA 4XQJA 2RSNA 3AN1A 1YNXA 4K8IA 2OTJA 1EY7A 2CCZA 3S1MB 2KX3A 4I6PA 1HFNA 4DR6Q 1ZXTA 4WURA 1RRBA 2EY1A 2MQJA 4IW0A 5T1IA 3TDQA 4E6IA 2DZKA 4DV4Q 1RM6C 4WIPA 3C0RB 3IAS1 3PV0A 5EBCA 1FO4A 3VXWA 3MZ5A 1FYCA 1Y14B 4L23A 2V1CC 2PO4A 1FGUA 4JPSA 2F0UA 4JI8L 1K50A 4YTPB 1ESFA 4LFCQ 2VB2X 2GA4B 3HOUG 1N5WA 1RDPD 1GOZA 1E2WA 1YN3A 2GB1A 3AI5A 3S16B 1R4QB 5HFYA 3I8ZA 3PO3H 4DV0Q 2LFNA 3RLOA 3CP0A 3AE6B 4DV7Q 1PH2A 4R4IA 2A6HD 2DZJA 2BF8B 2XK5A 1OO9B 4HDOA 1LM0A 1N34Q 5KYIA 2FE8A 3DBSA 2NVTH 3PLVA 4EE2A 4NQLB 4FF4A 3HGBA 1S40A 2KQ3A 3OOCA 3GOEA 1HE8A 4FO2A 3Q2AC 5EE1A 4A8XC 5G5GA 4OVZA 2YVCA 4BBNC 4NY0A 1CJEA 1SE4A 1H95A 3SD5A 3B08A 2MBHA 5T8IA 1PGAA 3OTOL 1I6VC 1ET9A 4XYQA 2ZW1A 3JAMi 3RPFC 2ONQA 1B4OA 3S1MH 1Z9FA 4GDLA 3MHSD 3PO2B 4DDID 2HCIA 4B0MA 1I4XA 3FDTA 5LLIA 4KVGB 3VR8B 1AE2A 1UGJA 4LJPB 4OZBA 4G3XB 1VCBA 2HD5B 3ZXVA 2G4SA 1FM0D 1S3SG 1GKHA 1HFGA 2VUMB 3PLUA 4N9F4 2D62A 2HHHQ 1WGHA 2V3NA 1EWIA 5BR8L 3PIOA 1JMLA 3L54A 2ZPYA 2KJRA 1L0WA 4BY7H 1CHPD 2Q5WD 1IBML 3C8YA 4I65A 4WQOB 1IYFA 2HQLA 2V3PA 4WORA 1NY4A 3UE1A 5IP9G 3ND9A 3K58A 2YEPF 4BBRG 1LTID 2DJGC 4F8MA 3I4NH 2L15A 2WB1G 4KJNA 2CFMA 1WJNA 2LVPA 1I50B 1VMPA 1JR0D 2Y0SE 4CDDC 3TRZA 1PFNA 3ALBA 3AU5A 1NAPA 3ONSA 4GNXB 1TWGB 1HZCA 5C3EG 2ZJDA 5G3LD 3G48A 2YTYA 3H6MA 4NKLA 4JGHB 5L83A 3EROA 3VH4B 2VUMG 4JOIA 4RAUC 4XQQA 5EQ0A 3P2BA 1W2BA 2BB6A 1U4AA 2K5PA 1T0QC 2M17A 3HRDD 2MQHA 1J7AA 4DR1Q 2JU6X 1PTOC 1AFPA 1LM8B 5C4XB 2YV5A 1F2RI 1T0YA 4RA8A 1V9PA 4BAXA 1V2YA 2IGHA 4O0AA 4NAWA 3UINB 5CYUA 5KGUA 4CHKA 3HOWB 4B3TQ 2JF5A 4JI3Q 3PSEB 4KHZA 4OW0A 3I63C 1Y1WG 1YNTE 5E4XA 2WXMA 1EQVA 1L1OB 2NYZD 1SNCA 3OWFA 3F2BA 5IYBG 1WMHB 3GDEA 1PZID 4MNOA 2C5LC 4YIJA 2GBMA 1DM0B 3AE9B 5BMGA 1XT9B 1M94A 1ZUD2 3CMMB 2UUCQ 1DOXA 1TU2B 1C7YA 1VQ6A 1G51A 2A19A 2J52A 3W1YA 1VR9A 1UAPA 2MA9B 4HPMB 4FDBA 1EY9A 5C44B 4LNKA 1PRTF 2E2DC 3MXGA 3TS2A 2O2VA 1OXSC 4IUUA 1SMXA 3TUOA 4C4VB 3ULJA 1E90A 4YY3Q 2IT1A 2JK8A 4KN4C 1QCBD 1N9WA 4MM3A 1BVSA 1PH3A 2X8XX 5A2QE 4USAA 2QDFA 3JAML 1UE5A 3MFGA 5CV4A 3Q8FA 1WFYA 2LGIA 3HOWG 4FP5D 3LYYA 3S2HH 3M4QA 4KGTA 4ANVA 3HHMA 1DOMA 1K73C 2PLPA 3WWVA 3QWNA 2O2LD 3NXWA 3L08A 3KLSX 4ANXA 4FXGC 2I0QA 4QGUA 2N9EB 2E2HB 5IT9E 4JBMA 4BZAA 2DGYA 2WHIA 4IUPA 3ZXRA 3VAWA 4ANWA 1JWSD 2Q2HA 5CGKA 1FJGQ 2KZRA 3NP8A 1X3QA 4JG2A 2F0GA 2KHIA 2GVAA 3NQTA 3JW0X 3OIPA 3AFPA 1JWAD 1VZ7A 1B2TA 5E4WC 2MBOA 3MTNB 2ALYB 4II2B 3BG3A 4P7IA 4PMWA 1QNKA 4ZUIA 1FL0A 2P5ZX 3GTKB 1VZ6A 1QZGA 2LI5A 3L17A 4DV0L 1PH6A 4YWGG 2XSCA 4LF6Q 1F1HA 5BR8Q 3WOEA 1GAQB 4N58A 3KF8B 2WB1E 1UE1A 4Y52H 4QQBX 1VCIA 5EKIA 3HG9A 2BH2A 5IE8A 5IP4D 3PGZA 5F2DA 4A3KH 2JY6A 1TS5A 1C4AA 4KY5A 1JJCB 2L8JA 2F4VL 1CQVA 1YNNC 4IFDG 5ELNA 1R4NB 2KQSA 5BYRA 1FRRA 2WDQB 3EGRA 4AYBB 3EBEA 1CTMA 2MBQA 3NELA 4J8QA 4OXPA 4X3TA 3MJ5A 3N1XC 3VFKA 3HOXH 1B1ZA 2H5XA 1BXTA 4J6IA 3MHBA 1C1YB 2DUDA 3P75A 2LD9A 3UDGA 1LTLA 2B29A 1LUZA 3BVMA 2R7DA 1VQ4A 4MN3A 1O7ZA 3GTOB 2ACZB 2MJDA 3ZJYC 1TT2A 5E3FA 1I7HA 1FVIA 4XWTA 2JYTA 3LWEA 4GXBA 1ZYRD 1D5XC 1E5WA 1JT8A 3KBGA 1I4RA 2NVQB 4JCVE 2RVLA 5FO7B 1NMFA 3BIID 3V60A 2F0WA 4DK5A 2CJNA 3CHBD 5G5HA 2GBJA 2CW0D 1H9MA 4PS7A 1V5TA 4JV5Q 3NY5A 2C60A 2M0AA 5E6NA 5M5YH 2HJ8A 3OJ3A 4KHPQ 3WALA 4B95A 3BWUD 4KV6A 2KN4A 1SROA 3SE0A 3OMGA 1FEHA 4L2YA 2OEDA 2D0OA 5JJKA 4KHPL 5HG2A 4C7ZA 3TP7A 3Q8DA 1GM5A 3KBXA 1N36L 1NR2A 3HOVG 2ZM6Q 1E8XA 1QOFA 1L0XB 2W9NA 3L4PA 4FULA 2JSVX 5GMVA 5LMNL 4A3DG 2JZZA 4BKSA 4BXXH 2FMCA 1EOVA 2NZ1D 1HR0L 3RI7C 3RR5A 1U4MA 3QHTA 3TREA 1Q10A 3AV8A 3H7PA 1UD7A 1ZXIA 4MTKA 4LNNA 1X3EA 3QARA 2NTTA 3H0GH 1XF5L 4S17A 3SR6A 4C3HG 4D2KA 1I35A 1U4LA 5JHAA 4FHKA 4DXAB 3GD7A 5DPRA 3OYYA 4NP5A 4LF5Q 1SNDA 2QCPX 3PV1A 4BBNF 3U4ZA 1RODA 4P74A 3B2FA 1MBYA 1IW7D 5A35A 4A3EG 1O78A 2K14A 5JEAJ 2YU9H 3I91A 4LF4L 3M3YB 2BYEA 3O65B 4X66Q 2LGSA 1HTQA 1XLQA 3ZQ4A 3KWLA 1ZYRC 1SYEA 5C4HA 3D0FA 2ZJQA 3GTGB 1L4DB 1N5XA 1PH7A 1EY0A 3I57A 3DBLI 3HOVB 3RUIB 4EUTA 4KK7A 4JPBW 2RCFA 1RTOA 5I2YA 4E71A 3PT2B 1C4CA 4B6WA 1PTOD 3ULPA 2NR2A 4IPHA 2GN5A 5JPNC 1I94Q 1EUJA 1N33Q 4AS1A 2SNSA 1VQGA 4M0WB 4FJVB 1EFID 4DR7L 4G4KA 1HXYD 4EQOA 5BN3A 1P7FA 4IZ8A 2V4IB 4EFOA 3CQZB 1A70A 1TGZB 1V8QA 3QCAA 2A1AA 1YJIA 1EYDA 3C1FA 1XLNA 1ET6A 4B08A 4X6AH 3UQAA 5IGBA 3RNBC 1C79A 1J5EL 4PNYA 1Y1VH 1K83B 2HT1A 1Z6HA 2ZTDA 1JE4A 3KK7A 1IBLQ 3GP7A 3DEOA 3NVYA 3A7AB 4GS3A 4PV1C 4LNFA 2TSSA 4ABNA 3PHWB 1Q8KA 2E2IB 5E6PA 5L95C 1FJGL 3OPOA 4WJOA 2K25A 3IT4B 2K05A 4L8JA 1TS4A 1TT5B 3NTKA 4C3JB 2D9UA 2JQRB 4HRSA 2UUAQ 1HNZQ 3AE7B 4A90A 1B50A 4A3MG 2XTIA 1QG7A 3FEWX 3VRAB 1L0VB 1UE6A 1CUKA 1XTDA 1YHQA 2NVQH 2PI2E 4KX6B 1XPRA 1VF7A 2JXTA 1JE5A 5GXGB 1E0BA 1VQAA 3FMCA 3CSFA 2B2YA 3BK1A 3PUYA 4V190 1IYUA 5D7GA 4AJWA 3ONAB 1YNJC 5M3MB 2IBIB 1N6ZA 2I5MX 1MHHE 1LYLA 3JVZX 4ICUA 1LTBD 4R4CA 2QC8A 1TKYA 3RN2A 1HJPA 3S15H 1DCZA 1JCKB 1VS0A 3S1NB 1EQTA 3G4SA 2MGSA 2KC2A 4JI5Q 2PNHA 4WRDA 2FIFA 1AW7A 1UWMA 2KCNA 2CJOA 4JE3B 3Q23A 4M1UB 1LTRD 2NTSA 5FJ8H 1KQSA 1I50H 1I5FA 2IO3B 4BBSG 2J7QB 2K8HA 4KKSA 1VLBA 3PTFC 2IHFA 2B3GA 1JWBD 4A3BG 3PIP3 1TS2A 4A3JB 2NN6G 4ZHOA 4LW1A 3PQIA 1WJUA 4MEMA 1WWTA 2W55A 1HCZA 1V1OA 1GD7A 3WAOA 3DUZA 4A6QA 2EKEC 2R2OA 2XGTA 4HEDA 4LF6L 1QKZA 5M5XB 5I4DA 1N34L 1GUNA 1QLBB 4NZLB 5HHDG 5HI1A 5FLXL 1IBXA 4LF7Q 3CCMA 2KWUB 5BN5A 1K0RA 2VNUD 1VQPA 1B9NA 4X3SA 3Q69A 2MSED 2NVYB 2VQFQ 2FINB 1M8AA 5J3BA 1Y8OB 3HOYG 3BDLA 4NAMA 4JQWC 4C3IG 5I2XA 2D3AA 1RL2A 3UI2A 1K51A 1HZ6A 1ENFA 1JB3A 2KOLA 5CBAE 2INNE 4RH6A 3MWYW 4LNQA 2O5IC 1MKHA 2V9HA 5T1GA 4XDXA 1V86A 3NPPA 4RF1A 4KD3A 1BMLC 4PQXA 1QOBA 2K32A 1KLGD 1STGA 3L0OA 4QUCA 1CA6A 1EM7A 3WANA 1NYRA 3TJPA 1YMHE 2HHHL 3PIO3 4KKUA 4CDEC 1CMXB 2NN6I 3AU7A 4HWIB 4II3B 1WJ4A 2AL6A 4LLGM 4DN4M 2CKZB 4A3PA 3E9IA 1WCMB 1BT0A 4UY8C 1P7EA 4JBWA 4XIGS 3I72A 4C3HB 3M9BA 3TEHB 5GQOA 1LT5D 4ZLTF 1Q8IA 4YTMB 3FKYA 3I90A 2J0KA 2EYHA 2KVMA 2OQKA 2VQEQ 4ODGA 2ON8A 2RQXA 1E7PB 3N1YC 3MHZA 2DN8A 2JSOA 1G2TA 2WXIA 4A9AA 4AQ7A 4FXCA 3EA6A 1GB4A 2EYMA 4HDQA 3K81C 1O7YA 3ERQA 2B2WA 2ID0A 2R92G 1AH9A 2L1AA 2EIFA 3GO5A 1L6UA 1E1OA 4REZA 1LACA 2R7ZH 4LF9L 2MW5A 2KEDA 4GLAC 4LFAL 2KWVB 2IDYA 4QF4A 3P63A 3HOZB 5EPJA 2BT6A 3FC4A 5EGTA 1HTOA 3NVZA 4QIWB 2PZTA 1L6VA 1XJVA 5D6JB 2OTLA 4CJ1B 1RKNA 2O2VB 3V3XA 2UU9L 3VTWA 2PCFB 5FLXc 1JWUD 2PVGC 1B70B 4JI1Q 5DAUA 5CV6A 3V05A 3J81L 2UXDL 4GNXC 2MH7A 2WXFA 3AXCA 3FILA 3H1UA 3CAMA 2PQEA 5KRUA 2V4LA 3E3XA 2MHJA 5KEEA 3AECB 4AYBG 2VY3A 1MGSA 2X6GA 2NBWB 2NBVB 2K3UA 1CQFA 4YWLA 3CPWA 1AP0A 1EWYC 4Q2JA 4DUYQ 5EKLA 2MRPA 1SJHD 2EYPA 2HTME 3OJ4B 4WJQA 2KAJA 2F3IA 2NVTB 1VQNA 3HOZG 4S3SA 3AMZA 1WJ6A 2H88B 3U58A 5BMHA 2WKCA 1GXDC 4E74A 3E5SA 4DV7L 2L1BA 1YITA 2DY7A 4LDTD 2VUMH 1SN8A 2BS2B 4CDCC 3CMEA 3AE2B 1KAAA 3DLLA 4GKKQ 1K8AC 1UELA 4HEA1 3VUYA 3GTQB 1T6BX 2LFIA 1WFQA 2ZVNA 3AEFB 1TVXA 4QY7A 2JA7G 5GAEC 4JI5L 1ZP0B 2D3GA 3B9JA 5KNCA 4P1BC 2K5QA 1KHIA 1Y56A 2G4DB 2PNRC 2X38A 4JC0A 3TZDA 3S15B 3EECA 3PO2G 3K80C 3J81E 2JZPA 1GHJA 4K7SA 3DCGA 3U9SA 4Q0FA 1XEEA 2F0VA 3B2GA 1U5KA 4X65Q 1N63A 1I4PA 1W6KA 2IJ0A 3UDFA 1XLOA 4HJKA 4F1SA 4RKLA 1Q82C 1SMYD 2GOWA 4R8NA 2R61A 1PDXA 1JWMD 1E7VA 1WI5A 3NZUA 3K5OA 4ILWA 3F2UA 1OQQA 4IOIE 1FRDA 1QNUA 2QEXA 1PVOA 3VTUA 3WAPA 4J3OD 2JZ3B 4B9KA 1SF0A 2JJQA 4P2CB 3J7AV 4KY7A
chains in the Genus database with same CATH topology
1RCVD 2YYZA 4CQNA 2QF7A 1XWEA 1H9SA 2FJ2A 3I70A 1QE6A 3IFTA 5IIFA 1XYIA 2PVOD 3J80L 4QCLA 3ZJUA 3K6OA 2M56B 2H4OA 4A3GB 2BS4B 1HHVA 3DHQA 1TWCB 2WXOA 1E6EB 2C5CA 5J22A 3PZ8A 1X3PA 2PIAA 5I6YA 3D4DA 1AEXA 2WINB 1L4ZB 1B53A 1FCCC 2LUMA 5M3FB 4IUQA 2MUYA 3A55A 1VDVA 2EVBA 3D6WA 1B44D 4KTAA 3VR6A 3GV6A 4KJOA 5FR3A 3CKIB 1WTQA 1F2ZA 3CWIA 4HSVA 4LK0M 4EGVA 3I9V1 5H92C 1HA5A 1I4GA 3RZDB 4HCEA 2PW7A 3Q8BA 3AEGB 1YNJD 2IGDA 1II3A 2B2UA 3E9SA 3TN2A 2K22A 3KLRA 2OT2A 2QIEB 3CRKC 2BDOA 2F4IA 3IAYA 4EQNA 1SDFA 2Z8LA 2OEOA 1C48A 5D65A 4FF1A 2KWDA 1HPCA 1HEZE 4K2LA 1HUMA 1O7LA 1STHA 4K6DA 5JEAG 2C9OA 2EOTA 4ZKCB 2ZW0A 1TIID 4YSXB 3HEJA 2LMCA 3AE5B 1LTTD 3NTHA 2EY6A 3MA2B 3Q6SA 3VYTA 1QWYA 1UUPA 1F2YA 3V2TA 2F0MA 1EY4A 5ELCA 3IT6B 4HAEA 1H9KA 1WTWA 4H0LC 1ONLA 1TJEA 1N61A 2MJEA 3AMUA 4RWSC 5D3DA 5IGDA 4ITKA 2WP8J 2QKIC 2XN9C 1IW7C 1SB3C 2F0IA 3VR5A 4FXDA 1N60A 1Q1EA 2J4XA 4BY7B 2RDHA 1RF2D 2F0QA 1BCPD 4N59A 5FKAC 4ZQ3A 1C9FA 5I6WA 2EYLA 1F2RC 1ILPA 4KHVA 4A3FB 2E75C 3DWAA 2BW2A 1MI2A 1IBXB 2IW3A 3WCQA 2JXMB 2EE1A 4KKTA 2DY8A 3MAQA 4ZRPA 3RFZB 4QB4A 5ISRA 1QF6A 2QEJC 2RMMA 1AWDA 1M4VA 3IL8A 3DWQA 2N0SB 2MHVA 3ZGZA 4RGOS 2F0JA 1UNSA 1A6XA 2QMTA 3AE3B 2F0FA 5IGGA 1SNOA 1GJXA 1ZEQX 1PZKD 2PW9A 3HRZC 2D2CC 2WP9B 4HCSA 1R4PB 1ZKOA 2OXPA 5C4ZA 2JP1A 1I3QB 3ZJTA 1WD1A 3BVZA 3NWSA 1SBBB 4DU9A 2WU5B 4GDLB 2EXZA 1CI3M 4KD4A 1MD2D 1IGCA 2IWHA 2WXQA 2FBWB 3U7ZA 3OW7A 5CMDA 2AX5A 1R7SA 2A73B 2BE5D 1NVID 2Y5PA 3TEYA 4JK1C 3SK8A 2K01A 2KJXA 1LTGD 4XYOA 1V1PA 1AZPA 5G3LF 3T51B 3N9YC 5KNDA 1MSHA 2I38A 2L52A 2PYKA 3J7YW 4ZHPA 4FXKC 2L11A 4KY6A 2JEAI 2OF1A 1JOOA 4BBRB 4GLSC 1QOAA 2BYTA 1IGDA 3EVQA 1G291 1SE3A 2QSDA 4BBSB 4F87A 2KECA 4OL7A 5D14A 5C3EB 4IFDH 4G57A 2QILA 4OO1H 2E6XA 1Y1VB 2N9LA 1LV9A 2L32A 4CKBA 1V8CA 3M7GA 4J6HA 1RTNA 1MVKA 1STAA 2CQAA 3JAME 5EE0A 2ZT9C 2EJFC 2L83A 5MPOA 1EZ6A 1BR9A 2JA8B 4GZYC 5EKKA 3IFDA 4ZRQA 4ZKBB 1T3QA 2L55A 3MXPA 2BA1A 2D5GA 3OWEB 3KLSA 1UWXA 5EJWA 1DD2A 5C0XI 4XWWA 2DNCA 1STBA 2I07B 1T5XD 3A54A 4HR7B 2B39A 1KNAA 3FKIB 3K5MA 1YN4A 4H13C 1D1IA 2F03A 1SMYC 3I73A 3QOLA 4C56C 3IXSA 4HROA 1T5EA 1DOIA 4NDXA 4NMZA 3NQIA 1PFMA 1SFOB 4HN7A 2K04A 2KEEA 3HUIA 3V96A 4IN3A 4BWGB 3IKJA 4G7ZC 1D6EC 2A6HC 2N55A 4L63B 1CHQD 3HZXA 2AWOA 1MI0A 2K7VA 3ZYYX 3EQLC 4ME5A 2NUCA 2WXNA 2WNMA 3R93A 2VZKD 1A3TA 4B9WA 1XXGA 4TQUS 4U68A 2F0HA 3R3OA 1PRTB 1STNA 1QOHA 1KABA 3O13A 4HSPA 4IQZA 4XDDA 4OIJA 3S1QB 1QB5D 1AYFA 1LT4D 1STYA 3ETRA 2Z4HA 3I4NB 1K52A 2OHFA 3VRBB 3A56A 2KCCA 1B9MA 1CM9A 2RDGA 1KDAA 1QT9A 4ZOHC 4K5WA 1GHKA 2Y5CA 1E10A 2J0TD 2XVSA 2A69C 4YTNB 1QQRA 3NK9A 4RF0A 2NWGA 3S9WA 3TEXA 4EVOA 3U2SC 5EBDA 1KLUD 2H89B 1ZDXA 1E2VA 1OXXK 3AB9A 1YQ3B 3E6ZX 1NSNS 4KMUC 1TKWB 2R92B 3H3VC 1FMAD 4DXFA 1DJRD 5IGEA 4A3DB 1JW9D 5K36H 4IALA 1WGKA 4DK1A 5JAVA 4N6EB 3NUCA 3I3CA 1EY5A 4B0EA 2M2LA 3KWVA 2L5TA 2XWJB 3KUPA 4OO1G 1D2BA 5CORA 4MIUA 1C76A 2EPBA 3WOFA 1WTVA 3P4QB 1BDOA 4ARCA 2SAKA 3SR1A 3GTPB 1SAPA 4A3IB 2AQ3B 1JQ4A 3RLFA 2JYOA 3QJYA 4OIKA 4BA1I 5FO8B 2F1MA 3H0GB 4DFAA 4IUTA 1IUEA 1AN8A 2RPVA 1CZWA 4R9WA 1VJKA 1U9RA 3SVMA 2WIIB 1XCTL 4A93B 1ILQA 2N7JA 1EU3A 5JVG3 3U52E 2K03A 4WJWA 3W5VB 1G91A 3QOJA 4CBVA 5BYQA 1J8IA 3AEAB 2MJ8A 3S14B 1YNND 2B8FA 2LEKA 5C5LA 3U4EG 1EWHA 1PTOB 2PMZB 3Q8CA 1CK1A 4WFN3 3LX0A 1IL8A 5TSSA 2F0TA 4XQNA 2PMVA 3ABVB 2NBFA 1FNVA 3W3AA 2DYMA 1AZQA 5CC4A 1EEID 1WD0A 5CV7A 3H91A 2VB3X 4Z9CB 3RUZA 2K5DA 5NUCA 4XXEA 2DYOA 5C3JB 1TWAB 2M9VA 1A15A 4XE0A 4RGTA 1NUCA 1F0ZA 4LTUA 1FXIA 3AE8B 3T3OA 1OQRA 1FR3A 4O1NA 3D3RA 1V97A 4H7BA 2HDLA 4P16A 1EY6A 3J9CA 1JROA 3D6CA 1CZGA 2INPE 3PUWA 1C77A 1PLFA 4J1MA 2FFKB 2KACA 4C1NK 3HOYB 2PTLA 4IKGA 3M4OB 3GQBA 4TKOB 5JOBA 4EQPA 4FVMA 2B2TA 4L1BA 1LLRD 1Y8NB 3DWGC 3MFYA 4OHJA 2K6AA 3NZ3A 2R3ZA 2L9HA 3C1EA 4H44C 3WDNA 5LL6X 2W3SA 4IUVA 4IUNA 4K5VA 5E6JA 4N9PA 3QG1A 1S5CD 1PXUA 1UEAB 1BOSA 1PDQA 4K5XA 3S17B 3Q8EA 1I4HA 5ELFA 1J7CA 2NMQA 3N6RA 5CV5A 2A5HA 1TS3A 4DAVA 4JX1C 3EJIA 1XTCD 1SYCA 1FGBD 1BNZA 2RBMA 1DYQA 1FNUA 2IGGA 1ESRA 2LY7A 3Q0AA 4PT5A 4U673 1EZ8A 3GTLB 3H8HA 2EYFA 1SYFA 1XO3A 3T3NA 3VR3A 1SEBD 4ID6A 4XT3B 3AE1B 2K1BA 1YQ4B 3SHLA 4MT5A 4XDCA 3P7JA 1H9RA 2K0PA 2SOBA 1SYGA 3GTJB 4XT1B 3RD4A 3SEBA 3TP6A 3C3LA 4RFBA 1MPEA 5EE9A 2HQEA 3BDCA 3FRPB 4KN7C 1KF6B 4ZAIA 2W54A 3AEDB 2B2UC 2A74C 3PUVA 1E0ZA 4ZUJA 2J53A 1SNMA 4FF3A 1IHZA 3FPUB 4KGSA 4FNFA 2IL8A 4MM3B 1PTOH 2B2YC 4DA2A 1DOLA 5J1ZA 2R7ZB 2Q8TA 3M7NA 2KUMA 3D4RA 2JA7B 1EY8A 3S1RB 1SYBA 3DWMA 4H2AA 2NN6H 3P1HA 2FMMA 2CU3A 3TP8A 1JORA 1DZ1A 3CRLC 1PTOF 3FILB 1HRJA 1S4ZA 3T13A 5LL6S 4DGZA 2L0CA 4JWUC 1U4PA 2MPMA 1XX8A 2ZXOA 3KF8A 2W3RA 2KHSA 4NJCA 1V1PB 3T53B 2R6GA 1PFBA 5C3XA 3BK2A 3PO0A 1LTAD 3Q8AA 1ENAA 3D8GA 2AQ2B 2EZVA 3NBIA 1RD9D 4K6LA 3E0JA 4X3UA 2A69D 4HMIA 2CHBD 3TBIB 2WU2B 2B2TC 4QUFA 2BTEA 5H8YE 1EL0A 3S2HB 2LJIA 5IGCA 1D5ZC 1HTLD 2N88A 2SEBD 5AFWA 1KDCA 2XRSD 1ML0D 1GUGA 4PMCA 1EEFD 1STEA 1VF5C 2E74C 4L6TB 3N52A 3C2PA 2SDFA 5M5WB 1QJOA 2IX1A 2DBYA 3TEZA 3AB5A 4ULLA 3PZ7A 1V43A 1Q3LA 3P4PB 4KI0A 2RDFA 2A68C 2ZXRA 5C5MA 2B8GA 5CBEE 1KDBA 1FFUA 1NEKB 3A8KE 5KNBA 1FNWA 2Y3AA 2PZWA 3L9AX 3VR2A 5AUKA 4YXDB 2CVRA 2EYJA 1DXMA 2FHTA 1VDZA 3SK5A 4TRDA 4FYDA 4FF2A 4CKEA 2O4XA 2X69A 1S5DD 4IDIA 5A2QL 1ROEA 2M00A 1BCPC 1MHXA 2J42A 3NUHB 4XTCS 2PKOA 1S5ED 3OIQA 4C3JG 2WKDA 1OXTA 1A2TA 1ICWA 2PZUA 2JYEA 3HKZB 1H9JA 1BUVT 4HKQA 4DK0A 4DAYA 4N9TA 2F0PA 3MVVA 1N62A 2BB5A 3OMCA 1FD6A 1ZE3D 1TR5A 1RWSA 4CGYB 1SYDA 3M4YA 2F0NA 3TP5A 2EELA 5KYLA 1PMRA 4HKZE 1S5BD 4DAPA 2F3VA 3K59A 3MC0B 3TZUA 3K7AB 1MSGA 3TMEA 5BYSA 5EPLA 5IGFA 1C78A 1QOGA 4LMQD 2H1EA 4CHTB 1LABA 4DXGA 2WQYB 3EUB2 3BDOA 5FK9C 4C1NI 5BMIA 2WXGA 5DM73 2B2WC 1GUSA 3P4SB 1XCQL 5C4JB 2Z1CA 3W5UB 3U9OA 2L12A 2QDBA 5FLXE 1SNQA 1K8MA 3DMUA 3VA5A 1XLPA 3T56B 4K14A 3AM9A 5IODA 3HP3A 1KFYB 1EYCA 1SSOA 2EY2A 1EYAA 1C4QA 4PMBA 3QO2A 1LT6D 2A68D 2EKIA 2KQ4X 1JALA 3A7LA 1ZDVA 3Q22A 4ZRZA 2ENBA 4US8A 1F9SA 4C2MB 1Q1BA 3PMFA 1Y69U 2G1EA 4LAAA 2JA6B 5D3IB 2NVXB 3D31A 2WXPA 1VZ8A 4YSZB 1KH0A 1PUTA 1IKLA 2YEPB 5DNFA 5CR3A 4G7HC 1J9OA 4A55A 2G9HD 2LS01 4KGRA 4Q5VA 3DEPA 3J80E 1EIHA 2IX0A 1IYVA 2IPKD 1WTRA 2X6LA 2L4NA 3IAM1 4TQ0A 3P4RB 5AUIA 2WDRB 5FO9B 3SDZA 1OFFA 4OO1I 4ZK9B 5EE3A 1YN5A 1GUWA 4RNAA 4V0BA 5JJZA 3GTMB 4G7OC 1WTOA 1DOYA 3DXJC 3TSSA 4DQOC 2K9XA 1BCPB 2R93B 1VMCA 1W6JA 3E56A 3P42A 1BBXC 3D4WA 5CV9A 1SJED 3ZJVA 2PPBC 5C0XG 1HUNA 2BE5C 3DWPA 2WACA 3MEHA 2JEBI 3W1SA 1BUIC 2RA4A 2Z4IA 1WTXA 1TWHB 5K36G 3PUXA 3KQ4A 1SE2A 3QIAA 3EFXD 4NW2A 4C3IB 1KTKA 3GV3A 3HS0C 2WB1B 3RZOB 3A8IE 1IKMA 1OXUA 2F3WA 4RCOA 4GDKB 1BCPF 2BOSA 4A3KB 3UI3A 2G9DA 1CA5A 1HZ5A 1G6ZA 2WAQB 4KKJA 1JRPA 1R9TB 1F9QA 1WXQA 3R2IA 4O42A 1ENCA 2AUKA 2B63B 1NR4A 2DWQA 3OSOA 1PGBA 4KKIA 5C2TB 3BYTB 3NE5B 4DF7A 5JEAH 1RHPA 3GB1A 1GUTA 2PW5A 3BZDB 2RSOA 3CU7A 2F0LA 4BY1B 1HA6A 1G2SA 1J7BA 1Q90A 5FOBB 2EDGA 5JPMC 2I46A 4R8IA 2IX3A 3H09A 2Y0SB 3FAHA 5C0XJ 1EWCA 2JWUA 1PGXA 2O5JC 1TY0A 3R8BA 1F9RA 4RGMA 3VYRA 5C0XH 3MTSA 3FVQA 1TWFB 2D5DA 3T4AC 4US9A 3H94A 4HMJA 2ZXPA 2VZKB 2NB0A 3VYUA 4WH4A 3TEWA 1PYWD 3P1MA 1GUOA 4Y7NB 5J39A 3NHHA 1BF4A 2KDMA 2TMPA 1I6HB 2K5WA 1NI3A 4OZCA 1WRIA 2AQ1B 4DNRB 3SFEB 3BS1A 1DOKA 2E76C 4YSYB 3VA7A 3NSWA 4LK1C 3NWTA 1SNPA 1RYJA 2WV6D 1KRHA 1L5PA 1FIQA 3LB8C 4IFDI 1LT3D 3OHXC 2BA0A 1E9MA 2RKSA 3W2DA 3VQIA 5ELEA 4M0WA 3AE4B 2MEKA 1A3VA 1DONA 1F9PA 2WXJA 1I4QA 2B2VA 2BBCA 2KA7A 1SIJA 2HDMA 3G7LA 1L0YB 4DNTB 2LHDA 2ICIA 4X3KA 1BO0A 3DM1A 1TYGB 3FPPA 2E3TA 3HVZA 2MP1A 5BN4A 5DM63 1LTSD 3PUZA 3A8JE 3NS1A 1B3AA 2LMCB 3K57A 1BQQT 1JOKA 1OXVA 4QMGA 2FUG1 3SK6A 2KMMA 4B9XA 1EU4A 3PO3B 1S5FD 4I7ZC 2AUJD 4JWSC 1TY2A 1U4RA 3ITPA 2K33A 4UDUC 1F2MA 1CZPA 1ZPSA 1B9RA 1ZOYB 4MACA 1F77A 5E1FA 2AWNA 1WTPA 3M85A 3G6JB 2A6ED 1G8ZD 4WAFA 4RKBA 1KNEA 1CT1D 5LNK1 4M8AA 1JQYD 1K8OA 2WDVB 4RGNA 1TKGA 1FCLA 2WLBA 4TQ1A 1PZJD 2K28A 4LJZC 2WXHA 1EIGA 4ARIA 1VRAB 5JXVA 4A3MB 1JICA 2F0DA 2CW0C 4MH8A 4CJ0B 3SFDB 4RCNA 1Z7TA 2WS3B 4RHRA 3RMHA 2LHEA 1JC7A 3AH7A 3BVGA 2GI9A 5C6AA 1FXAA 2A6EC 1HTPA 3LWUA 3QB3A 2M19A 4C80A 2WXLA 2XWBB 2BS3B 3X3NA 2E2JB 1X32A 1O80A 3HVDA 4UAIA 4R3DA 4F88A 3AEEB 4A3EB 4OZAA 1D5MC 1C4PA 3NTIA 2N9KA 2JA5B 1E2ZA 2J7ZA 1TKEA 4OGQC 4TMAB 5M5YB 2F0EA 3URYA 2MJ3A 4P6VF 3X3MA 1FD7D 2B2VC 2Q8IB 2SNMA 4TSSA 4CKCA 2BDNA 1TQOA 1TZOA 5IOCA 3K5NA 4RHSA 1F2LA 3MXUA 1PFDA 4F7XA 2F0SA 3W9CB 2HCCA 2JX5A 1HQMC 3C46A 1PRTD 5C3WA 1Y1WB 2EYOA 4NAWB 5CV8A 1D4BA 1RFKA 2EY5A 2BCOA 1K53A 1NCVA 3BYYB 2YU9B 4MHEA 4K8JA 2W82A 3T16A 2GRIA 3AEBB 5I9PA 4BA2I 1Y8PB 2HUGA 1A2UA 3HOUB 3CIRB 2WXRA 5ELBA 4WWMA 1CFMA 2QJLA 3J7AF 2DLBA 4WQMA 5ELDA 3L7ZC 3I4LA 3SXHA 1WSPA 1NENB 4YT0B 1SSNA 3S2DB 3ND8A 2V4DA 1WYGA 3NRZA 1GB1A 5LHY1 5HURA 4A3BB 1NYQA 3R2TA 1Q12A 4IFDJ 3Q24A 2DNEA 1Z47A 1JOQA 2F0KA 3VYSA 2B76B 4K2KA 3P20A 4HTHA 1H9SB 2XNAC 1SXTA 1QILA 4IURA 3LXFA 5COYA 2EJGC 3NBHA 2VXWA 1ZXHA 5I9OA 1PRTC 1DGJA 3NVVA 3I4MB 3L3OC 5K5PA 1WVLA 4BS9A 3NVWA 3K5LA 2HDEA 2EJMA 1GPXA 5JVH3 2Q8RE 2V0GA 1RJTA 4C7YA 2I2YA 3HOXB 3VR9B 5EPKA 1HQRD 1FFVA 2XIWA 5IT9L 5HGTA 5DEHA 4CJ2C 2WXKA 2JE6I 3GS2A 1LO5D 2XRQD 2F0OA 2LKVA 3LNNA 1C8CA 4HJGE 1EOTA 3K0YA 4ZYSA 3MP9A 3MXNA 1ACCA 3VR4A 1A3UA 2ICEC 5M9OA 1YJJA 3SK4A 1D1KA 5KIXA 4XQJA 2RSNA 3AN1A 4K8IA 1EY7A 3S1MB 1HFNA 1ZXTA 4WURA 2EY1A 5T1IA 3TDQA 4E6IA 4WIPA 1RM6C 3IAS1 3PV0A 5EBCA 1FO4A 3MZ5A 1FYCA 4L23A 2PO4A 4JPSA 2F0UA 4YTPB 1K50A 1ESFA 2VB2X 2GA4B 1N5WA 1RDPD 1GOZA 1E2WA 1YN3A 2GB1A 3S16B 1R4QB 5HFYA 3I8ZA 2LFNA 3AE6B 2A6HD 1OO9B 5KYIA 2FE8A 4EE2A 4FF4A 3HGBA 2KQ3A 3OOCA 5EE1A 4FO2A 4A8XC 5G5GA 4OVZA 1CJEA 1SE4A 5T8IA 1PGAA 1I6VC 1ET9A 4XYQA 2ZW1A 3RPFC 2ONQA 1B4OA 3PO2B 2HCIA 4B0MA 1I4XA 3FDTA 3VR8B 1UGJA 4OZBA 1FM0D 1HFGA 2VUMB 2D62A 2V3NA 1JMLA 1CHPD 2Q5WD 3C8YA 4I65A 2V3PA 4WORA 2YEPF 3ND9A 3K58A 1LTID 4F8MA 4KJNA 1I50B 1VMPA 1JR0D 1PFNA 1NAPA 1TWGB 5G3LD 3H6MA 4NKLA 3EROA 4RAUC 4XQQA 5EQ0A 2BB6A 2K5PA 3HRDD 1J7AA 2JU6X 1PTOC 1AFPA 5C4XB 1F2RI 4RA8A 2IGHA 5CYUA 5KGUA 3HOWB 4OW0A 4KHZA 1YNTE 5E4XA 2WXMA 1EQVA 2NYZD 1SNCA 3OWFA 1PZID 4YIJA 1DM0B 3AE9B 5BMGA 1ZUD2 1DOXA 1TU2B 2J52A 1VR9A 1UAPA 1EY9A 5C44B 1PRTF 2E2DC 3MXGA 1OXSC 4IUUA 3TUOA 2IT1A 4KN4C 1QCBD 5A2QE 4USAA 3JAML 5CV4A 3MFGA 3Q8FA 2LGIA 3LYYA 4FP5D 4KGTA 1DOMA 2PLPA 3QWNA 2O2LD 3NXWA 3KLSX 4FXGC 2E2HB 5IT9E 4IUPA 1JWSD 5CGKA 3NP8A 1X3QA 2F0GA 3NQTA 3OIPA 1JWAD 1VZ7A 1B2TA 5E4WC 3BG3A 4PMWA 1QNKA 4ZUIA 1VZ6A 3GTKB 4YWGG 2XSCA 3WOEA 1GAQB 4N58A 1VCIA 5EKIA 3HG9A 5F2DA 1TS5A 1C4AA 4KY5A 1CQVA 1YNNC 4IFDG 5BYRA 1FRRA 2WDQB 3EGRA 4AYBB 1CTMA 4J8QA 4X3TA 3MJ5A 1B1ZA 1BXTA 3MHBA 3P75A 3BVMA 4MN3A 1O7ZA 3GTOB 2ACZB 2MJDA 1TT2A 5E3FA 1I7HA 4XWTA 2JYTA 3LWEA 1ZYRD 1D5XC 3KBGA 1I4RA 2NVQB 2RVLA 5FO7B 3BIID 2F0WA 2CJNA 3CHBD 5G5HA 2CW0D 1H9MA 2M0AA 3BWUD 4KV6A 2KN4A 3SE0A 4C7ZA 3OMGA 1FEHA 4L2YA 2OEDA 5HG2A 3TP7A 3KBXA 1NR2A 1QOFA 1L0XB 3L4PA 2JSVX 2FMCA 2NZ1D 1U4MA 1Q10A 3AV8A 1ZXIA 2NTTA 1XF5L 3SR6A 4C3HG 4D2KA 1U4LA 3GD7A 4NP5A 1SNDA 2QCPX 3B2FA 1RODA 1MBYA 1IW7D 5A35A 1O78A 5JEAJ 3I91A 3M3YB 1XLQA 3ZQ4A 3KWLA 1ZYRC 1SYEA 5C4HA 3GTGB 1N5XA 1L4DB 1EY0A 3I57A 3HOVB 4KK7A 5I2YA 1RTOA 1C4CA 1PTOD 5JPNC 4AS1A 2SNSA 1EFID 4G4KA 1HXYD 4EQOA 5BN3A 1P7FA 4IZ8A 2V4IB 3CQZB 1A70A 1V8QA 1YJIA 1EYDA 3C1FA 1XLNA 1ET6A 4B08A 5IGBA 1C79A 4PNYA 1K83B 1Z6HA 1JE4A 3KK7A 3GP7A 3DEOA 3NVYA 3A7AB 4PV1C 2TSSA 4ABNA 2E2IB 3OPOA 3IT4B 2K05A 4L8JA 1TS4A 3NTKA 4C3JB 2D9UA 2JQRB 4HRSA 4A90A 3AE7B 1B50A 1QG7A 3FEWX 3VRAB 1L0VB 4KX6B 1VF7A 2JXTA 5GXGB 1E0BA 3FMCA 2B2YA 3BK1A 3PUYA 4V190 1IYUA 5D7GA 3ONAB 1YNJC 5M3MB 1MHHE 1LTBD 1TKYA 1DCZA 1JCKB 3S1NB 1EQTA 2MGSA 4WRDA 1AW7A 1UWMA 2KCNA 2CJOA 4JE3B 3Q23A 4M1UB 1LTRD 2NTSA 4KKSA 1VLBA 1JWBD 3PIP3 1TS2A 4A3JB 2NN6G 4ZHOA 1WWTA 2W55A 1HCZA 1V1OA 3DUZA 4A6QA 4HEDA 1QKZA 4NZLB 5M5XB 5I4DA 1GUNA 1QLBB 5HHDG 5HI1A 5FLXL 1IBXA 5BN5A 2VNUD 1B9NA 4X3SA 3Q69A 2NVYB 2FINB 1M8AA 1Y8OB 3BDLA 4NAMA 4C3IG 5I2XA 1K51A 3UI2A 1HZ6A 1ENFA 1JB3A 2KOLA 5CBAE 2INNE 4RH6A 3MWYW 2O5IC 5T1GA 4XDXA 3NPPA 4RF1A 4KD3A 1BMLC 4PQXA 1QOBA 2K32A 1KLGD 1STGA 1CA6A 4QUCA 1EM7A 1NYRA 1YMHE 3PIO3 4KKUA 2NN6I 3AU7A 4LLGM 4DN4M 1WCMB 1P7EA 4JBWA 4XIGS 3I72A 4C3HB 1LT5D 4ZLTF 1Q8IA 4YTMB 3I90A 2EYHA 2KVMA 4ODGA 2ON8A 2RQXA 1E7PB 3MHZA 2DN8A 2JSOA 1G2TA 2WXIA 4A9AA 4AQ7A 4FXCA 3EA6A 1GB4A 2EYMA 1O7YA 3ERQA 2B2WA 2ID0A 2L1AA 3GO5A 1L6UA 4REZA 1LACA 2KEDA 2IDYA 4QF4A 3P63A 3HOZB 5EPJA 2BT6A 3FC4A 5EGTA 3NVZA 4QIWB 2PZTA 1L6VA 4CJ1B 1RKNA 3V3XA 2PCFB 1JWUD 2PVGC 3J81L 5DAUA 5CV6A 3V05A 3FILA 2MH7A 2WXFA 5KRUA 2PQEA 5KEEA 3AECB 1MGSA 2X6GA 2K3UA