1ENFA

Crystal structure of staphylococcal enterotoxin h determined to 1.69 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
212
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords ENTEROTOXIN H
total genus 71
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2000-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1enfA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1enfA02
1CHPD 1I4QA 1V1PB 2O2LD 2AQ2B 1SXTA 3BVGA 4RFBA 1EU3A 2SEBD 1F77A 1I4RA 1PYWD 2NTTA 1TS4A 1PRTD 1EU4A 1SE4A 1TY2A 2WV6D 1S5DD 1YN3A 3MFGA 1JR0D 1D5ZC 1QILA 1RD9D 1AW7A 4RHRA 4C56C 1S5ED 1EFID 1BXTA 2R61A 4RGMA 4OHJA 3DWQA 1PRTF 1SBBB 1DYQA 1ENFA 3BVMA 2Z8LA 1PTOB 1SE2A 1LTGD 4UDUC 1I4XA 1SEBD 3BVZA 1STEA 1KLUD 5D3DA 3DWPA 5ELFA 5TSSA 1CHQD 1CT1D 1PZKD 2QEJC 1LTAD 3EFXD 4DXFA 1KTKA 4BWGB 3URYA 1JQYD 1S5BD 5D3IB 1S5CD 1PTOF 1ET9A 2AQ1B 4RH6A 1BCPF 2RDGA 4NZLB 1V1PA 3O13A 2CHBD 1LTID 1DJRD 1XXGA 1KLGD 1SJED 1BCPD 1SJHD 3R8BA 1S5FD 1D6EC 1LTBD 1JWMD 1B1ZA 1CK1A 1TS2A 2TSSA 3CHBD 4Z9CB 1PZJD 1YN4A 1PZID 3SEBA 3BYYB 1UNSA 1HQRD 2IJ0A 4L63B 1BCPB 1M4VA 3OWEB 1GOZA 4RGOS 1SE3A 5ELCA 1FGBD 1LO5D 1G8ZD 2ICIA 5FK9C 1LT5D 1XTCD 1HA5A 4K6LA 1LLRD 1PTOH 5ELDA 4RHSA 3GP7A 1AN8A 1PTOD 1YN5A 1EEFD 1B44D 1JWSD 1RF2D 1LT6D 1PRTC 1V1OA 1LTSD 3R2TA 3TSSA 1L0YB 2NTSA 1ET6A 1LTRD 1JCKB 4TSSA 4RCOA 1LT3D 1L0XB 1HXYD 1I4HA 3DWAA 1FNVA 2XN9C 1EWCA 2J4XA 3BZDB 1D5XC 4RGNA 5ELEA 1UUPA 2IPKD 5FKAC 2XNAC 5ELBA 3EA6A 1LTTD 2G9HD 3W2DA 1PTOC 1MD2D 4DXGA 1I4PA 1T5XD 4RGTA 1PRTB 1FNWA 2QILA 2RDHA 3KLSX 3V05A 3R2IA 1I4GA 1BCPC 1RCVD 1D5MC 1JWUD 1ESFA 1HTLD 1RDPD 2XRQD 2XRSD 1EEID 4ZYSA 1FD7D 1CQVA 1TS3A 1FNUA 4O1NA 1LT4D 5I4DA 1TS5A 3BYTB 4L6TB 2AQ3B 3MC0B 1TY0A
chains in the Genus database with same CATH superfamily
3CCRA 2O2LD 2VXWA 3BVGA 4X3KA 2F0TA 3U58A 1FPYA 3UI3A 1Q1OA 4NJCA 5CV9A 2B2YA 2EMTA 2PJHA 2WP9B 2W3SA 3V2TA 2IO3B 2B8GA 1WD1A 1TY2A 2X69A 1V81A 1G51A 1IPGA 3CMMB 3A55A 1KDAA 3HZXA 4B3RQ 4IWQA 1ONLA 3BDCA 3HOZG 1PQSA 2LGDA 4YWMA 4EKUA 1DOXA 1NI2A 2R61A 2D62A 2D10A 2B2TA 1V9JA 4A3IH 5C44H 1SMYC 1Q5WB 1SE2A 2KN5A 4LF8Q 1HNZL 3HOUG 2AL3A 2DYMA 3L54A 1GUGA 3VR6A 1KD1C 1SYFA 2A19A 4LMQD 1J8IA 4DDID 4LUZA 3UDFA 4JW0A 5T1GA 4ZLTF 2E2HH 3H3VH 1VQOA 2ZW1A 2WAQE 4LJZC 1Y8RC 2ONQA 4BOSC 5IP4D 2NVQH 4C4VB 3KOJA 4XT1B 4A3FB 1YJJA 4YL8A 2A6ED 2L12A 4EGVA 4EVOA 5CORA 4JBKA 3GTMB 1X1MA 5HG2A 2B39A 1Q8KA 4HAEA 1D3ZA 2WHIA 2HJ8A 4PZ7A 2UUCQ 3T4AC 2KJHB 1NMFA 5C4ZA 2V4LA 3EUB2 5H92C 3W1GA 5DCNA 1K9MC 1SRUA 3E9HA 1LGRA 2IDYA 4AJYB 4A3DG 5IIFA 5GAEC 3DUZA 1ASYA 1P1AA 3G6JB 3DHHC 3PGZA 2E3TA 4MM3B 2O6VD 2BVCA 2Z4HA 2GLSA 2D5DA 3JC66 3KF8B 3OIPA 2K5QA 1JRUA 3ZNID 2DZKA 4HSPA 5EAYA 4XXEA 4LJOB 4IW0A 2K5DA 2IYDB 1AZPA 3CRKC 2Q2TA 4KHPQ 4A3DB 1Y8PB 2OHFA 3ML9A 3CMEA 4ZHOA 2MCNB 4DHJD 1EWYC 3GP7A 1RYJA 3EVQA 5AFWA 3RZFA 5CHVC 1YN5A 4FJZA 2B29A 3R2TA 4YHHL 1LTSD 3ERSX 2Q2UA 4OX9L 3GTGH 4A3BB 2V3PA 3ZJYC 4L1BA 3V3XA 2BWES 2B2UC 1T0YA 5IGDA 2OTJA 1R4QB 2L1BA 3R3OA 2K9XA 2LRUA 1QOHA 2C60A 1GD7A 1A2TA 2IPKD 4QIWE 3UGBB 5EE3A 4LK1C 1DGSA 4CDEC 1WXSA 3MP9A 2EYHA 5IYBG 5C0XG 3K5MA 2PPBC 1GO3E 1C48A 5HGTA 3N52A 4UHVA 3VYTA 1EYCA 1FNWA 5HFYA 1I7HA 1EZ6A 3PVLA 1OTRB 4RAUC 2YYZA 3PCOB 4H44C 4DV4L 1BCPC 4G0NB 1NVID 1VS0A 4B3SL 3DVGY 4C3HB 1Q90A 4ZYSA 4FA6A 1FEHA 1P0RA 1L1OA 2X6GA 4L6TB 2NVYH 2MQHA 1B8AA 4X66L 1B2TA 3VA7A 4O0AA 3A5UA 3VH3B 2N7DA 1XPUA 3Q2AC 4XQJA 2OF1A 2NVXB 2PIAA 3DVGX 2WXOA 1BBUA 1WXVA 2QEXA 3BG3A 4IZ8A 3GS2A 4R4TA 4H7BA 2YVCA 3MXNB 3GTQB 3GTPH 1JMLA 3KW5B 1PH5A 3PUWA 4F8MA 3SDLC 1NDDA 4P72A 1OQYA 3Q8BA 1AH9A 4LF9Q 2QA4A 4C56C 2K75A 5IE8A 1BXTA 5AZGA 1DCZA 3AE5B 1UBIA 2PO4A 3LWUA 1B9RA 1V86A 4GNXB 2F0UA 4KLKA 1NEKB 3ETRA 2VUMB 4KDLB 3GZNB 3KH0A 4WJ3M 2N9XA 2MGSA 3CMAA 3PZ8A 1A2UA 3KYCD 4W9CA 2IX3A 1M1KC 2JA7H 5BYQA 2LKVA 2RDFA 3N1ZC 1DXMA 2OWOA 2CJOA 5I9PA 2WXPA 1YHBA 3I7FA 3PIOA 4BWGB 2NBFA 1PH8A 3IG3A 1WSPA 3OMGA 2F3WA 3QWNA 4G57A 1E2WA 2RHSB 5DAUA 5LMNL 2WLBA 2M2LA 4IOAA 1PH9A 4NAWB 2EE1A 2LXKA 2Q2IA 2F0OA 3QO2A 4BY1H 5I9OA 1S3OA 4NZLB 3C8YA 3W1SA 3O13A 3X23A 4BBNF 1IL2A 5IKCM 4CYEA 4GKJQ 4APVA 1YHAA 1YIJA 1AP0A 3STBD 3U30A 1ICFB 4RMAA 1SJED 1BCPD 1KNEA 1P9DU 3TRZA 1D6EC 2CW0D 1LTBD 4BZAA 5AUKA 1GUOA 3E3XA 1PZJD 4DKAC 1PZID 1J19A 5JVH3 2BOSA 4A3GG 1YD8U 1JB3A 4DR4Q 1C7YA 3RZDH 2PEAA 4QCLA 2Z6BA 4HTHA 4DV3Q 3GE3C 1TTNA 2V3NA 3Q69A 4B9KA 1WCMG 1BUVT 4A3PA 5BMHA 4ICVA 4KSKC 1Z7TA 2E8GA 4A3OA 3RMKC 4TUUA 3E6ZX 4N9TA 1DONA 2DNFA 4C4VA 4FADA 1IGDA 1PHJA 1YOVB 2WXKA 4A3IB 1WJ4A 4OZAA 2WFWA 4GGQA 1QE6A 3NQTA 1T0SC 1VRAB 1T5EA 1XWEA 2RCFA 2DAFA 3QHTA 1ET6A 4WAFA 2L3ZA 3ZLZA 4A3KB 4W9EA 2A5UA 3DPDA 3CRLC 2WIIB 4KN7C 4DV2L 2KENA 1HZCA 1HR0L 4NAWA 1HE8A 1GJZA 1N5WA 2UUBQ 1VDZA 5JJLA 4FLHA 2XNAC 1CZPA 3W3AA 1E8ZA 3HOYG 1L0VB 1ZP0B 3W2DA 2KD0A 2DNCA 4DXGA 5M5XH 1NBFC 2A5HA 1I4PA 3NTIA 4PS7A 1SYEA 4K8JA 5TR5A 4X65L 3RNCC 1I4GA 1Q8IA 2TMPA 1ESFA 1Y1WB 3X0WA 3U4VA 2M0AA 2PQAB 3T9LA 3MC9A 3H3VI 1WRIA 3NHEB 4MEMA 2F0HA 4K6DA 2EYLA 5DPRA 2DLBA 3O65B 3E9IA 1NNXA 2QJLA 3L16A 1YVCA 4B3TL 2VUMH 1ZDXA 2KCCA 2AQ2B 2C9OA 4L5QA 3N6RA 2Y3AA 1YIWA 2N9KA 1U9RA 2MP1A 2KTRB 3QQ8B 2WDQB 3NWTA 4HIDA 1X65A 4LDTD 2FE8A 1D5ZC 3J81j 2KMCA 1TWFB 4YWGG 2B3GA 4EEWA 3L08A 1X3QA 2KBNA 1DGJA 1WXQA 4OHJA 2LJ5A 3CCMA 2V9HA 2OCEA 2ZPNA 1DYQA 4QAYA 2LXJA 4ZCKA 4UP8A 4HPPA 1CUKA 3MVVA 4AYBG 4K8IA 1WTRA 1WTVA 5IYDG 3H3VC 3H0GH 5D3DA 1HTOA 5ELFA 2LRWA 2P5ZX 3OTOL 3NZUA 4XT3B 4II3B 5KNBA 3EFXD 3Q3NC 5EPKA 3Q23A 1S5BD 5FO9B 3VAWA 2JEAI 1PMRA 2DWQA 2GBRA 4B95A 1OXSC 1VQ7A 2I1KA 3GTJB 1XLQA 4RH6A 3AV8A 1Z6HA 2K5WA 4EE2A 4BBRH 3ULLA 2D5GA 2F4VQ 1TIID 2RF4A 4FP5D 1K0SA 3P7JA 5M3MH 3ZUNA 1HTPA 4YWLA 3OWFA 2ZNVC 4KKTA 4DK6C 4JI8L 2WXFA 3B2GA 2RGFA 5DPTA 1TS2A 3S1MH 4KKJA 3H6MA 3KUPA 3M3YH 1KL9A 2JA9A 4NB3A 3J80L 5K36G 4OXPA 3PIPA 3SR6A 4LDTB 3L10B 1KH0A 1TKYA 4HEA1 1FGBD 4KY7A 1VCBA 1LTLA 2F0FA 2ZCCA 3I5JC 4HVBA 4LF8L 3Q8FA 2CU3A 2VB2X 5ELDA 3KJOA 5C1ZA 3KF8A 1RFAA 4DR6L 5NUCA 4GKJL 3FHWA 2O2VB 1JW9D 1SIJA 3CF6E 1PTOD 4IN3A 2KCNA 4HSVA 2F4VL 1WMHB 3CSTA 3WIMA 3GD7A 4WJQA 1WX7A 2LGIA 2JE6I 3M85A 4I6NB 2E2IH 2FMCA 4DU9A 2KNBA 2FINB 1SFOB 3MAQA 4CKBA 3TS2A 4IFDH 1W3SA 1GC7A 1LT3D 2HT1A 1L0XB 2D11A 3DEOA 1TBEA 2E2JB 1UZXB 4KVGB 4IWOA 4U68A 4MSQB 4RGNA 4OWXB 2N9LA 3E0EA 4X3TA 5GADC 4OVVA 4ILWA 3BZCA 4DN4M 4IALA 3PREA 2HIVA 2IZVB 4HDOA 1FRDA 4A6QA 3F8TA 4DR7L 3TIXA 3APDA 1EOVA 1T0QC 2ZM6Q 4A93H 4G50A 5BR8L 1PH2A 1WGHA 3JVZX 4IFDI 4B3RL 2JYEA 4ZAIA 4A3LH 4OX9Q 1D5MC 4BBNC 3CD6A 1RDPD 2JA8G 5M3MB 1EEID 1PFNA 2MO1A 3MTSA 5AJ3Q 3K80C 4KHVA 1FM0D 1EY4A 1O78A 3FILB 3KK7A 2ZJQA 3HOWH 4UPAA 2JPHA 2NVXH 4RNAA 1CZGA 2UXBQ 1BF4A 3VYSA 3H1UA 3B1LX 5LHY1 1GB1A 1MJEA 2JF5A 3RNFC 3EGRA 2B2YC 5FLMG 1JORA 1E90A 3KWVA 4KK7A 2M56B 4KKIA 2NZ1D 5J3BA 5J2RA 4O42A 3DMUA 1SNOA 3AEAB 3ZVVA 2NB0A 1AYFA 4GDLB 1JR0D 4CJ2C 1L4ZB 1S5ED 4HJ5A 2K8HA 1SMXA 3AH7A 1WJNA 1TYGB 2MJEA 3Q3FA 1PRTF 4ZKBB 3LGJA 3BVMA 4XE0A 2G45B 1E2ZA 2DENB 4C3HG 1R4PB 1K8GA 1KRSA 2EVBA 1EQRA 2J0JA 4B3MQ 3N32A 3T1YQ 3QK0A 4HMIA 2QDBA 3PO3B 1MVKA 3QOLA 3GE8C 3VUXA 4GSWA 2QW7A 4IUUA 3ZTCA 3GTKH 1EUJA 1Y8OB 5K36H 1HZ9A 4J8QA 3ZNHB 1O7ZA 3K5OA 1L2NA 1Z5SB 3A9JA 1W6JA 2NN6H 2NR2A 1ET9A 3UDXA 2WNMA 3TJPA 3KUCB 3GZNI 1F1HA 5FLXL 3I4MG 1C4PA 2GVAA 1ZUD2 1VLBA 4CDCC 4L23A 4ALPA 1X55A 1J0GA 2NN6G 5FJ8G 1IBKL 3NQIA 4O2DA 1DJRD 3HOYH 2JRHA 4NY0A 4HCPB 2K33A 3ND9A 1I6HB 2WXNA 2AWNA 3V6CB 4A8XC 2EJGC 3AEVA 1KXLA 5BMGA 1P8LA 4NKLA 2NN6I 3S15H 3MEHA 1BCPB 1CKNB 4ZRZA 2YTXA 3OWEB 4H2AA 4K81A 4XWWA 1K8OA 3STBC 1NENB 1KIXA 2MW5A 1VMPA 3VDYA 2WXGA 1TR5A 1I5FA 5HGQA 4Y7NB 3S2DB 1WM2A 4QUCA 1HNXQ 2CHZA 4DK1A 1PTOH 2J0TD 2DUDA 5EPJA 3M3YB 3QAQA 3EBEA 4BBSG 2E5LL 5C0XJ 4FHJA 4IG7B 3LB8C 4WQMA 3LWEA 1YMHE 3A1QB 3CSFA 4HJAA 3M3JA 3ZJTA 4M02A 2VZKD 4YCUA 1AE2A 2DN8A 2N3SA 4TSSA 4EQOA 1MFWA 1C76A 1E7UA 5E6PA 4KGRA 1HXYD 3AEBB 4K14A 4A3GH 5LMNQ 2XK5A 3VXWA 5ELEA 3NZSA 1I94L 3PLVA 1Q82C 3U52E 3PPAA 1H9SB 3A7LA 4TQUS 3D31A 3MFYA 1RODA 3TEHB 3UE1A 2Z1CA 1EIYB 3B08A 2CQOA 2A68D 4HCSA 4DGZA 1R7SA 2RPQA 2EJFC 2KEDA 4IM3A 1G6PA 2L15A 4EX5A 4A93G 4OL7A 3I4NH 4W9FA 1ZEQX 4KJOA 4KV6A 1TWGH 4DR3Q 1J7AA 2M19A 2QMTA 3ITPA 2KTRA 4JGHB 1L1OC 2R2QA 2JA7G 2E2JH 4IWPA 4R8IA 2I5LX 3NVVA 4GNXC 4JBWA 4X64Q 1IHZA 2LUEA 2BQQA 3NPPA 3PMFA 4IFDG 1FXIA 1SFOH 2QHOA 2W9NA 1F77A 1PYWD 3E5SA 3JAME 4JI2L 3WDNA 3EJIA 1CTMA 1E0BA 3M7GA 2WXQA 4JBMA 1U4MA 1PFBA 3A8JE 1YN3A 4X66Q 1QZHA 4BY7H 3AU7A 4A3CG 3VUWA 1D1IA 3EIVA 3HKZG 4MHEA 5CHWA 4DV4Q 2AUKA 1PTOB 1RIPA 5C4XG 1S72A 1NUCA 3T51B 2LFNA 3ZRFA 2CS4A 3NOBA 5E4WC 1ZKHA 2YLMA 3P4QB 3RNAC 4EZJA 4AWJA 4AIMA 3A1QA 3RNUA 1SNCA 3IBEA 2HQLA 1J9OA 2L83A 2F0WA 5C2TB 1YITA 1TQOA 3HOXG 4IPGA 5G5HA 1WGDA 1GPXA 1LV9A 1HA6A 3NBHA 4XGAB 4A9AA 1UE7A 3GTJH 2L8JA 1FFUA 4N6EB 3J80E 1V1PA 4LFBQ 1R4NI 2F52A 4PK1A 1Q12A 5DLQE 1N6ZA 2A6HD 3G48A 3I4MB 2BYFA 3ECIA 3ZTDA 3M4QA 2PMZB 1BVSA 3OHXC 1EQQA 1WH3A 4S17A 1UH6A 3P42A 5JJIA 2ZZPB 4NPNA 4W9LA 2LJIA 2M9VA 2WB1E 1GUAB 4JG2A 2LI5A 4II2B 4JI4Q 1AE3A 3DEPA 5J39A 1VQEA 1QKZA 3HGBA 3NUHB 5FR6A 3TEXA 4QGUA 4JBJA 3CC7A 3GOEA 2N78A 4K5VA 3PUZA 5D94A 2KA7A 3VR4A 1L2FA 2ICIA 2KFKB 3KFUA 3N1XC 2BS2B 2NWGA 1PFDA 4ANXA 1CM9A 1G291 5GQOA 1MGSA 4WH4A 1GXDC 4KSLC 4TRDA 1PH1A 2B2TC 2G4DB 4ZUIA 2D07B 4TMAB 4RCOA 4NXML 4C1NK 2K0PA 5MPOA 5IAAC 3G7LA 4YY3L 5FLMH 4J1MA 1E5WA 3VRBB 3PUXA 5IY0A 1DOYA 2QDFA 2QCPX 2BS4B 1VQDA 4GU2A 2WS3B 3IT4B 2NBWB 3DXJC 3KLSA 1EO6A 4WWNA 1FGUA 4IPHA 1Q7YC 1WZ0A 4IM2A 1XYIA 2F0EA 1MD2D 3APFA 3H09A 1D7QA 1C8CA 1Y56A 4ME5A 5C0XI 2JA5H 3ZW3A 2QILA 2VZAA 1K73C 2LS01 3U50C 3VQIA 2UXCL 4H0LC 4A3MG 1EWIA 2KK8A 5E1FA 4OIJA 4IDIA 2K1BA 2WAQB 4POGA 2AQ3B 1ENCA 2W54A 3I4OA 4JK1C 3NXWA 4DV5L 4XYOA 4TKOB 2EYJA 3I91A 3L2PA 5M5YB 3S1MB 2PNHA 1EU3A 2PZUA 2IGGA 5KHOA 3IKJA 2SOBA 1JE5A 1FL0A 3K81C 5CTRC 2UYZB 3VTVA 3VH4B 4HJ8A 1TS4A 1EQTA 4MT5A 2QDLA 2KYWA 4DA2A 3AEDB 5CV4A 2E76C 1IBML 1I6VC 4DNIA 3OJ4B 4HCNB 1IP9A 1JJ2A 3NG0A 1WXMA 4PV1C 4NP5A 1WF9A 2NVTB 3DWQA 5BN5A 1X3GA 1H95A 5KYIA 1V8QA 1WCMH 2KVRA 2N7EA 2NBUA 2AL6A 2KQ3A 4AJWA 1HTQA 1I4XA 1CA5A 1V1QA 1SYDA 3AECB 1QCBD 1H4RA 2WXRA 3VTUA 2KXJA 3MXPA 2RKSA 5DM63 2ZJRA 2EDGA 4XTCS 4A76A 4JWUC 1C4AA 3S1QH 3WAOA 4KY5A 2K01A 4M8AA 5EKLA 1QQRA 1CT1D 2D0PA 4GLAC 3RZOB 1QT9A 2WYQA 1S4ZA 3GTKB 2Q8TA 3C0RB 3SHLA 4XC2A 3M4PA 4A3EH 2LWPA 1UE6A 1BUIC 3HFZB 4MNOA 3NZ3A 1S5CD 5CBEE 1X3FA 4ARCA 2BYVE 4MZ9A 2JSOA 2UXDQ 4I65A 5I2XA 2K6QA 5DNFA 3CC2A 4XX5A 1RTNA 3D0FA 2OJRA 4DK5A 2EJMA 2Z6KC 3H15A 1G91A 2D2CC 1C78A 1L7YA 1CKNA 2V1CC 3MXGA 1STHA 3K0XA 4XYQA 1YJIA 1E1TA 3A9JB 2DX5B 4IQZA 1H9JA 3K9OB 3M7NA 1TWAH 5DPWA 3ULPA 4C1NI 4BBSB 1WTXA 1F2YA 1MSGA 1Y8NB 1XO3A 4L63B 4LK0M 4YT0B 2IJ0A 4EZLA 1C3TA 2I07B 1TZOA 4R4IA 1UELA 3RT3B 2DZIA 3NTHA 2NCNA 1XD3B 1N63A 3SK6A 1V6EA 4ODGA 1J8CA 4QJFA 4K6LA 2UUAL 2KC2A 1BT0A 3DLLA 1K8RB 1FFVA 1WGRA 4FULA 3VFKA 3NBHB 1F2ZA 2AKWB 2HCIA 1NYRA 2WDVB 1VQGA 4ITKA 2AYOB 1IYJB 1A63A 1MKHA 3C46A 1WYWB 2LMCA 3A8IE 3FILA 4Q5VA 3FAHA 1KLVA 4YWKA 2J4XA 3BZDB 2KDMA 1WE7A 1WFYA 2XVSA 5C44B 5JZEB 1T6BX 3DHGC 3C19A 3KDFA 2DY8A 2OT2A 3VYUA 1LM0A 1IW7D 2KEEA 4CJ1B 5IGGA 2H89B 3HRZC 2UU7A 3HHMA 3L4PA 2KANA 3HVZA 2PI2E 4C3IH 4JOIC 2ZT9C 2L4NA 4YCWA 5CV6A 1VQLA 2N1VA 5G2NA 1X54A 4HN7A 4RA8A 1TVXA 3TREA 3WOEA 3ZYYX 5M5WB 1E7VA 3Q8CA 3ZO5B 2KDFB 2YEPB 1TY0A 3NRZA 3G71A 2M00A 1PV4A 3UQAA 4R4QA 3D32A 2KMMA 2WINB 1BDOA 4WQOB 2L05A 4EZKA 4KGTA 1NTGA 4LTUA 3HUIA 4HJGE 4LF6Q 5EPLA 3OSOA 4DR1Q 2D3BA 1BOSA 1MIUA 1PRTD 2K28A 5EQ0A 3A5ZB 2M0XA 1WTPA 2WU5B 3M4OH 4PNYA 4C3IG 4KV2A 1GM5A 3K7UC 2V3SA 3P4RB 2R93H 4DR3L 5BR8Q 4J15A 4P75A 1TKEA 3P20A 3ZXVA 3ZQ4A 2GBNA 5H1SE 3U9OA 3Q8EA 4HJ7A 1GJXA 3DBLB 3K5NA 1NSNS 2Z8LA 1PFMA 3HS0C 4WWMA 2Y5CA 3BVZA 2L0CA 3HKZB 3BK2A 3PIP3 3N9YC 1N61A 4OVUA 4DUZQ 4GLXA 1BNZA 1WMHA 3NJTA 1XJVA 4LF6L 3ZKJC 4NNJB 5FO7B 1E8YA 2MX2A 3PO0A 2BDOA 4P74A 5F2DA 5IOCA 5M5YH 3H0GB 4JI0Q 2IL8A 3I8ZA 4QMGA 5EGTA 2XGTA 4HIMA 2MQJA 1XNRL 2BF8B 2C9WB 5E6OA 1WJUA 4R8NA 3L0WB 4OWTB 2E5LQ 1EUVB 4EFOA 2L0TA 3EFCA 1HCZA 1E2VA 5IA7A 5C4JB 3GTQH 1TWFH 2L5TA 2LHEA 5IOIA 1V49A 3AU5A 3ZJVA 3ONSA 1HFGA 2JUOA 2JA5B 1K51A 1YN4A 2KCTA 5C0XH 1WY8A 4Q0FA 2KQSA 1HJPA 1Q1EA 3U7ZA 2KZRA 2MUYA 1SF0A 4RGOS 2QGQA 4DR5Q 4DAYB 3A4SC 1SAPA 4FXGC 3OIQA 3J81E 1R9TH 2N7JA 4GOPA 2BKFA 4JX1C 3B0AA 3A56A 1VF7A 2EKEC 2JY6A 2MP2A 3RN9C 3X3NA 3VRAB 2INPE 1HZAA 1R9TB 1N32Q 2RHQB 3CCEA 1AN8A 2I46A 2KVMA 1EEFD 1JWSD 2RCNA 1Z2MA 2V4IB 3QARA 2A74C 5EBCA 2KWVB 4HK2A 3IFTA 3S17B 5JJZA 2N9EB 4P2CB 3K58A 2B3AA 2JN4A 2RQXA 1SE9A 3P1MA 1EF1A 3RPFC 4WJOA 1Q3LA 2F0SA 2WX1A 1F9JA 4BOZB 5ELOA 3K6OA 2VQEL 3L3OC 1EWCA 2ACZB 1FO4A 1JQ4A 4OO1H 3W1YA 2FHTA 1VDVA 1EY5A 3CCJA 4FVMA 1YQ3B 1U5KA 2KQ4X 4G3XB 1PTOC 3RLNA 4LLGM 4LNFA 2KDBA 1GG3A 3LJ3A 4YTNB 4ZUJA 2X6LA 1B7YB 2BKRB 4RF0A 2ID0A 2ZXPA 1SR3A 2A68C 2GBKA 4R3DA 1SROA 5KGUA 2JYOA 3GTLB 2AUJD 1MG8A 2QSDA 4JQWC 2ZXOA 2KX0A 1N34Q 2J42A 3PS6A 2L9HA 4JV5Q 4OO1I 5JPNC 1G2TA 1T3QA 4ZQ3A 1BMLC 3IHPC 4LNNA 4TV3A 5EKKA 4URKA 4XDCA 1N5XA 3P4PB 2UXDL 3OLMD 2IY0B 3EC8A 1K8AC 3M95A 1IYVA 4DR2Q 5LL6S 4R4CA 1CZWA 4B3ML 1HH2P 4DAPA 5D7GA 2SEBD 3PV0A 2R2OA 1V9PA 2B63B 2NTTA 2E2DC 3Q22A 3D4WA 5IO9A 1J6QA 3OMCA 1VQMA 5IYDH 2JZ3B 1IBKQ 3QWZB 1WJJA 3A7AB 3MFGA 4RHRA 2JZZA 4CKCA 4A3BG 4G7OC 2BDNA 1WYDA 2PNRC 1M8AA 1STNA 4PZ6A 3ABVB 4LFBL 4HKQA 5DEHA 2KVZA 2D2QA 1TT2A 4IUNA 4A90A 4KZCA 4C7YA 1IKMA 4MH0E 1JOQA 2HTME 2Q8RE 5LXIB 1LTGD 1K52A 4BKGA 4HLEA 1FCCC 2UU9Q 4C3JG 5FLXc 4JYAL 1AFPA 2EY1A 5M5WH 3MZ5A 1W6KA 3VDZA 3J7ZC 1PLFA 1QB5D 5L37A 4MM3A 2W3RA 2F0IA 2FCQA 4JI8Q 1PXUA 1CKOA 2B2VC 2EYOA 4ULLA 2VUMG 3HOYB 1DZ1A 1OGWA 3NENA 2Y5BB 2GA4B 3VA5A 3VR2A 1RLFA 1Q10A 2G3QB 2XIWA 3AQQA 3PUYA 3HOVG 1FIQA 4HMJA 4BFRA 4F87A 5BO4B 1WGGA 3DVNU 1BCPF 3Q3MC 2OQ0A 2CH4W 5AZHA 1NI3A 3AE9B 1XMOQ 1XXGA 1P16A 1JRPA 4A3BH 2IO1B 2ALYB 1CI3M 3SD5A 2JU6X 2R92G 1P7EA 3OTOQ 1X3EA 2KUMA 1A3TA 1UAPA 3UE0A 2PW9A 2DHZA 4UP9A 2VNUD 3FDTA 4GOCA 1H9KA 3RCZA 3TUOA 1M4VA 2HE7A 2BE5D 4NW2A 2LVQA 1YZ6A 3Q8AA 2YU9H 3IFWB 1WCMB 2MHJA 4BBRB 1FMAD 4PYUA 2CVRA 3HOUH 1LT5D 4K3BA 1LLRD 3L13A 4MGYE 3L9AX 4A3GB 4USAA 1WTHA 3SK5A 2HDEA 1JC7A 3NVWA 4REZA 2KOLA 5G5GA 3MA2B 1HNXL 1IYFA 1PRTC 2MBHA 1L0YB 2NTSA 4HXDA 4KKUA 2QKIC 2JYTA 4MDKE 1PGAA 2E75C 2KWDA 1LUZA 1RWSA 4EQNA 3V6EB 4B3TQ 1D5XC 1STYA 2Z59B 3EECA 2INNE 3LDZE 2K52A 4FBJB 1FR3A 2B2WA 3NTKA 2MBQA 4W9KA 4QQBX 1YJNA 4JI4L 4ZRIA 1X3PA 1RAXA 4YHHQ 2DGYA 2C7HA 1OEYA 4HDQA 2RVLA 2F3IA 4RGTA 5C3EB 4MGZE 3MC8A 3HOXB 1MHHE 1QOGA 1HQMC 3BDOA 3FEWX 3KLWA 2Q8IB 4BY7G 4ZRQA 5FR3A 2XRQD 4HRSA 1FJGQ 2NZOA 1FD7D 5KRUA 2RPVA 4FN2A 2IX0A 2LY7A 2PZWA 4YIJA 1VQ5A 2WXJA 3KVFB 4ARIA 4FXCA 1Y1VB 5C3EG 1D1KA 2LXAA 5GXGB 5DM73 2K5VA 3HKZE 1SSNA 1V1PB 1WIAA 1Y1VH 3SGIA 4KHZA 3SK8A 3HM3A 4XDXA 2HHHQ 2K3UA 3R66C 4P16A 4NQKE 2LEKA 3FC4A 3TN2A 3H9DA 3PT2B 2WV6D 5C4XB 2ZNVB 4P1CC 2CW0C 2IO2B 2HQEA 1RD9D 2SNSA 1QILA 5C3EH 4DV6Q 1GUNA 1XT9B 4Q2JA 4RGMA 3H6NA 2O5JC 3PRZA 5J22A 3TZUA 4N8X1 1I42A 3W5OA 1I50B 5IWAL 1UEAB 5J1ZA 1PUTA 1TZ1A 2VW9A 3HEJA 5IYCH 2Y5PA 4KD3A 3NVZA 4M01A 2ENBA 4NDXA 4CDDC 4FF3A 1WX9A 1QWYA 1TXYA 2MA9B 4QIWB 1QNKA 2CCZA 1STEA 1WE6A 4P71A 1V97A 5TSSA 4WIPA 1PZKD 1EIGA 2Z0EB 3ERQA 3I63C 4GDKA 3VHTC 1XX8A 1MHXA 3PSEB 3S2AA 1GUTA 2H1EA 1A15A 1VZ7A 1JQYD 4X64L 4ANVA 2I2YA 2JQRB 1PTOF 2BA1A 3SFDB 1UEBA 4GLVB 2B8FA 1SMYD 4DV7L 2LD9A 3GB1A 1V2YA 3PHXB 4IOIE 2BWFA 3HG9A 4AH6A 3I55A 4IKGA 2K22A 3AFQA 2R7ZG 4GXBA 3PLUA 2WAQG 2AEHA 1RL2A 3JAML 5IT9L 1WX8A 3U2SC 3K8AA 3GTGB 3I72A 4GZYC 2UWQA 5JEAG 3KWLA 2N8NA 3RZOH 4Y7NH 1JALA 3ND8A 3T13A 1ZXIA 3JSVA 4XZ4A 3HOVB 5ELCA 2FNJB 1TWHH 3ICEA 4GN3B 1YQ4B 1YX5B 1AWDA 2MLBA 2XEWA 4HPLB 4KN4C 2VL6A 2IO0B 2HDMA 3K7AB 4QB4A 4DV7Q 2EKIA 2FUG1 2N9PC 4XIGS 4PMBA 2X8XX 5C4HA 3OPOA 2N88A 1WGKA 3NY5A 4GB9A 2C35B 2KWUB 3S17H 1LT6D 2DJGC 3TS0A 3TMPB 4AUQC 2CWPA 3M4YA 2MFIA 4DV3L 3CXCA 4NXNQ 1ZXTA 2MHVA 1FVIA 1TIFA 2KHWB 2PQAA 4OO1G 2MBBB 3TCAA 1NR4A 5COYA 4YTPB 4V190 2IY5B 2MJ3A 5C4JH 1N36L 2PW5A 4PT5A 2GMIC 3AE8B 1F2RC 3A8KE 3EA6A 4NJ7A 1A3UA 1F2LA 4BXXG 3VUYA 4P73A 1ZYRC 5EKIA 4L5SA 3QJZA 2L55A 1D4BA 3U4EG 1SLJA 3QX1A 4MGKE 4CHTB 1J5EL 1NMGA 2NVQB 1EM7A 2HUGA 3AE1B 3CW2C 3S1RB 1SNQA 3L17A 1HZ6A 5LMUQ 2WGSA 4B0EA 3SK4A 1EYAA 5JEAJ 5ISRA 2WP8J 4CJ0B 1CKMA 1L5PA 2GOWA 1BQQT 5M3FB 2I38A 3LXFA 2E6XA 1K3BC 5E3FA 2ON8A 1IBXB 3SE0A 2BGFA 2LZ6A 1EIHA 4FJVB 3RZDB 4ME3A 4IM0A 2R93B 2G1EA 3HOZB 4FHKA 5IGBA 1LM8B 1MI2A 5C3JB 2BYTA 2L76A 2KECA 3NEMA 4CBVA 2E74C 3A9KB 4J3OD 5HKHA 3PF5A 4A3LG 3KQ4A 3J7AF 2IGHA 4B3SQ 3MEFA 1FYCA 5E6NA 3RD4A 1XPRA 4P7IA 3ZGZA 2PW7A 3QG1A 1KNAA 2OXPA 3TL5A 1I50H 4GN5A 4XWTA 4IUQA 3I3CA 4X65Q 2KJ6A 3AE4B 4C2MB 3BK1A 1J7BA 2Q2HA 2JXXA 2L32A 5JOBA 3PF4A 1Z9FA 1FXTB 2L0FA 4ZHPA 2D0OA 2DNEA 3LNNA 1WFQA 3SDZA 3L7ZC 2EMSA 2ZXRA 3QOJA 2K03A 1N34L 3BDLA 1OO9B 1QLBB 1SYGA 2N0SB 1BBWA 4JI6L 2R93G 2JA8B 2GN5A 3UF8A 1IKLA 2EXZA 1WD0A 3CCQA 3DBRB 1GHKA 4JIOU 5EE1A 2MP2B 2DZMA 2K5PA 1EY7A 1YNNC 2CHBD 2CFMA 1E7PB 2JX5A 3CCUA 4K7WA 1GVPA 1M94A 2KKCA 2O2VA 2BB6A 3I73A 3TEZA 1FCLA 3I56A 1STBA 3GQBA 4X3UA 2FAZA 3HP3A 3F2DA 2PVOD 1JE4A 5T1IA 2FBWB 2PYKA 4XQNA 5T8IA 3BYYB 3UQBA 5IP9H 4DV2Q 3DDCB 3CPWA 1A70A 1K0RA 2A73B 3HRDD 1KF6B 2FCSA 1CQFA 4B9XA 1SNMA 1K83H 3Q6BA 4DBGA 4F7XA 1TWCB 5FK9C 2V1YA 1DOKA 2AHOB 1U0LA 3FP9A 5LMUL 3I4NG 2V0GA 4BBRG 2W55A 3UDGA 3T1HL 2DYBA 5LLIA 4KTAA 2ES2A 3AMUA 5IGCA 1RF2D 4HEDA 1YI2A 2UUCL 4DR6Q 1NAPA 3KYHC 4DDGD 1UGMA 1VQPA 3K0YA 2YTYA 1S1QB 3ZDMC 3ZDTA 2WB1B 4UY8C 3S16H 1I4HA 3H94A 1KFYB 1U4AA 4JLCA 3D3RA 3AXCA 3HK0A 1MSHA 1OEYJ 1YQBA 3AM9A 5GMVA 1E8WA 2DAJA 2KLCA 1B3AA 4B6WA 4XQQA 2K4KA 3CP0A 1T9HA 1WWTA 3ONAB 1QZEA 4LNQA 2QF7A 4OEMB 1YNND 3BINA 2PCFB 3RLOA 3SVMA 3DWGC 4ZDVA 1KAAA 4GIVA 1VQ9A 2IGDA 1RCVD 4LUVA 1KDBA 3J81i 2VH1A 1HTLD 5D14A 3QIAA 4LFCL 1A6XA 1WXAA 3PO3H 1CQVA 2WQYB 3T3NA 1LT4D 4FXKC 3T1HQ 2EELA 2HD5B 2R7ZB 5KEEA 5CBAE 2J52A 3P4SB 4K7SA 2KAJA 4DAVA 1YEZA 2D3CA 4CO7A 4FO2A 1RHPA 2RMMA 1I4QA 3OAWA 3D6CA 2C7NB 1ZW7A 2AX5A 3P1HA 4LAAA 4J6IA 3QC8B 4CHKA 1Q1BA 1ZGUB 2A8VA 2XWBB 4JV5L 1UGJA 4TQ1A 4ZOHC 2J7ZA 1MBYA 1PYBA 3R3MA 1E10A 1QG7A 2FXQA 4MACA 3I4MH 1O7YA 4X57B 2ZPYA 1S3SG 1F2MA 3LYYA 4BKSD 5JXVA 4E3CA 1SBBB 5JHBA 1GB4A 1K3RA 2F0LA 1UWMA 1VQJA 3ZRCA 2K04A 2IBIB 3HOUB 1UBQA 1XCTL 4WFN3 4DR4L 1N9WA 3S16B 1QOAA 3VR5A 2F0VA 4ZKCB 5I2YA 1CMXB 1KLUD 3FKIH 2K6DB 5LNK1 4BAXA 3HOXH 5FLXE 3MXNA 2PVGC 2WX0A 1TKGA 5IT9E 3J7A5 4DXFA 3APCA 2B63H 2IHEA 1OXXK 4JE3B 3M62B 3CF5A 2B2VA 1CJEA 4DHZB 1VQKA 1VCIA 2IWHA 1GUSA 4DPGA 4GLSC 2Y0SB 2JXTA 3VR8B 2MRPA 1KAWA 3CQZH 1N32L 3WALA 4OZBA 3FMCA 1SNDA 1EQVA 2NUCA 2K14A 2K1FA 1H8CA 3GV3A 3P63A 1FXAA 1ZYRD 3DBHB 5GAHC 4MJSA 2MBEA 3A74A 3D6WA 4FNFA 4IUTA 1VQIA 5G3LD 4JWSC 3AEGB 1B1ZA 1IL8A 1E7ZA 1ILQA 3X3MA 2VQFL 1QOBA 4PZ8A 5HURA 4LNOA 2FCMA 1B53A 1MJCA 2BE5C 1P98A 3HM6X 2B76B 1WRDB 1PDXA 2LFIA 3CKIB 2NYZD 5JPMC 2KOXA 5EBDA 1FJGL 1XTCD 2LSSA 2JA8H 1SN8A 1RTOA 4DNTB 3PRPB 1VR9A 4J6HA 2IX1A 4KI0A 4LF5L 1F9SA 3TBIB 2JA5G 2QIEB 5BMIA 4LNKA 3NELA 4WAAA 2K05A 3QB3A 3DBLI 3JW0X 3I4NB 3HVDA 1V1OA 2OOBB 1ZPSA 2LVPA 4IUMB 4F1SA 4GMVA 1XTDA 1DOIA 1GKHA 3RN2A 1ASZA 4WWPA 2KTFA 3DM3A 1XQQA 4HIKA 2D9UA 1Z47A 3TP7A 4DR2L 2J53A 3AB5A 2XN9C 1N33L 5FKAC 1KM7A 2XSCA 3GTOB 2L7RA 2JA6G 2RSOA 4TQ0A 1QZGA 4M8MA 4N9F4 1ZDVA 4P6VF 4N9PA 3I4LA 3U4ZA 3KBGA 4WWOA 1SGHA 3UIOB 1PRTB 1PYSB 2Y0SE 3KLSX 1QVCA 4JI1Q 5C3XA 4JPSA 5JH5C 2Z6KA 2I0QA 3CPFA 1VZ8A 3R2IA 4ANUA 1GUWA 1JWUD 4L5RC 1IBXA 4A3CH 1GC6A 2XRSD 3RNGC 4RMFA 3I57A 1TS3A 4C80A 1E1OA 4IPDA 2KLGA 3BYTB 2NPTA 3TZDA 2F0KA 3CQZB 3PSIA 4GNXA 1H9RA 1XF5L 4LJPB 4RFBA 2PTLA 1YHQA 3SU8X 3RZWC 2GB1A 3RULA 4RM9A 2FCNA 1K50A 5IP7G 4IC7B 2F0GA 3DHQA 4BKSA 2LASA 4YTMB 1EU4A 3JYUA 3KF6A 1M90C 3ENEA 4LUOA 1KJTA 1P7FA 1XMOL 1FRRA 1JJCB 3TP8A 2L1AA 3KDFB 2XWJB 2BB5A 3E9SA 5C23A 2I5MX 4UAIA 3PIO3 3SHQA 4LFCQ 1K53A 2BCOA 3FVQA 4HR7B 3ZNZB 2VB3X 3ZXRA 1E24A 5BYRA 3SFEB 4A3MH 2CH4A 3NK9A 5IYBH 4UDUC 2L11A 3A9KA 3RR5A 2YTVA 4HROA 1X6OA 3MJ5A 2J0MA 3PZDA 5J17A 3DWPA 4A3EG 1SYCA 3LX0A 2JXMB 4HWIB 2A4ZA 2L00B 4UP7A 2DBYA 4LFAL 1QOFA 4LW1A 2QEJC 2NBVB 4AP4C 1KTKA 5CYUA 1JICA 2EPBA 3URYA 1VQNA 2UXBL 4IOCA 3AE6B 5AZFA 4QL5A 4ZK9B 1N8RC 2NPTB 3H8HA 1QUQA 4BY1B 4N8FA 4JOIA 3P75A 2CQAA 1IGCA 3AE3B 1UE1A 1TWHB 1J7CA 4HKZE 4ASWC 2V4DA 1HZ5A 1UWVA 2Z9HA 1TWGB 2AWOA 1JOOA 1B3QA 5ELNA 3RNEC 1F52A 3RUZA 3KF6B 1JMCA 2JA6H 2ASQA 4A3KH 1X9NA 2CJNA 4LNIA 4ID6A 1NY4A 4WRDA 1EY6A 2CKZB 1H9MA 4YY3Q 1VZ6A 2MO0A 1HQRD 3BZKA 3DBRI 1HNZQ 3A33B 3PGEA 1N36Q 4ABNA 3PO2G 2WXMA 2WACA 4W9DA 4ZRJA 2J7QB 1CFMA 4HJ9A 3MTNB 4JI7Q 5E7NA 5LL6X 1NBWA 2VRRB 4K3CA 1LYLA 1IXRA 2KN4A 1UE5A 4ACFA 3QJYA 1VJKA 3AEFB 3GTPB 1D2BA 2JP1A 1AEXA 4JI3L 1AARA 2CWAA 1IBLL 2AWTA 2KT7A 4W9HA 1ESRA 1I3QB 4LF7Q 3BS1A 4OWWB 3AFPA 5D65A 1HZBA 2EIFA 2DYOA 4KHPL 1JT8A 3BWUD 1E0ZA 4BA2I 3QCAA 1U4LA 3IVFA 5BYSA 3S2DH 4A4IA 3F2CA 3IT6B 1HNWL 3PO2H 4JC0A 4DR5L 2NVYB 2LGYA 5DPSA 4DV1L 5ELBA 1WZ3A 3BJUA 3CWIA 2EZVA 3PV1A 1ZKOA 5IT9c 4A3FG 4IJLA 2EQSA 1OQQA 4NQLB 3UINB 3W1BA 4S3SA 4L5TA 3PTFC 4BBSH 1SDFA 4FF4A 1GHJA 4AS1A 3V05A 1C9OA 3FKIB 5C4XH 2F0PA 2IW3A 3W1SC 3DM1A 3MJWA 2SNMA 1SE8A 2LGXA 4K2KA 3KUDB 1KOTA 5I4DA 2F0NA 3NS1A 1CSQA 3MC0B 3W9CB 3IXSA 5HHDG 3J81L 2N49A 4PG3A 2KJRA 2LGSA 3TMEA 1G2SA 1CHPD 1OXUA 4M00A 5CV8A 4GS3A 2JEBI 4OZCA 3FKIG 2F0MA 4NMZA 2JRIB 2O5IC 1WYGA 1OXTA 4YSZB 3B9JA 1B70B 2FFKB 2PLPA 3S1NB 1A62A 3T16A 1S40A 2LHDA 5IGEA 1YNJD 5KYLA 5FJ8H 3D4DA 1CA6A 3OJ3A 2N1WA 3BY4B 1A5RA 4G4KA 1AW7A 2CU1A 3ML8A 1EFID 2R6GA 4C2MH 2K50A 3OOCA 2NMQA 2QC8A 3DBSA 4N59A 2ZEQA 4U673 5A2QE 4K0KL 5JJKA 4JI0L 2FUHB 4B08A 2B2UA 1MJDA 1ENAA 5CC4A 2LVOA 1HRJA 1WM3A 3AU4A 5E6JA 1PH3A 4GKKL 3DCGA 2ZTEA 4LF4Q 2WDTB 4YXDB 2GRIA 1U4PA 3F2BA 2WXHA 1QNUA 2HHHL 3OW2A 4C3HH 4DV5Q 2IT1A 4GKKQ 5LXHA 1HHVA 3V60A 4EUTA 2WB1G 1HFNA 1QVFA 4BKTA 2F0DA 3WWVA 4A3KG 2B2WC 2REXA 1R4MB 3PO2B 3WAMA 1K28A 2NVTH 1OFFA 2XBBC 2C7MB 1B4OA 1O7LA 2RDGA 4NXNL 5G55A 3RUIB 4LWCA 3DOWA 5D2MB 5CMDA 2F3VA 3U7DA 2HTHA 1TU2B 5IN7A 2INCC 3RNBC 1ZE3D 1KLGD 1G6JA 1I35A 2ZW0A 3P2BA 1PFSA 1QF6A 2KMAA 1VQ8A 5GROA 1JWMD 1VD2A 2MSED 4Z9CB 3CHBD 4YSYB 3OYYA 5H8YE 2JA7B 1F9RA 1II3A 4CDFC 1EYGA 3S1QB 4MJSB 5K5PA 2R7DA 1L6VA 4WORA 2OJWA 3DBHI 1LO5D 5IYCG 1G8ZD 4DK3C 2M8SA 3AMZA 2EXDA 5I6YA 3N30A 1DM0B 3S2HH 5A2QL 1PVOA 2WKCA 1RKNA 4RF1A 1VQBA 4MTNA 4H02A 1UWXA 1QUQB 4RCNA 2E2IB 2F1MA 4CKEA 2OTLA 4WURA 3B6YA 1YX6B 1QVGA 5JHAA 3V61A 3K7AH 1EYDA 3NSWA 1L6UA 4EQPA 4DR1L 5IP9G 3A0JA 3DWAA 5IP7H 4S0RA 4DHZE 1XMQL 3AB9A 2K5NA 1FD6A 2R7ZH 5EE0A 3TEYA 4JI5Q 1A3VA 2JJQA 3J7AV 2M1MA 4RWSC 4G7ZC 2RR9A 2UU9L 1VQ4A 3JSVB 4DQOC 1T5XD 2RA4A 2JK8A 2KDEB 2H4OA 1WI5A 2RSUA 2KHSA 2OQKA 3IFDA 4OGQC 1X32A 3ULJA 4NPSA 1YBYA 4KJNA 2ZCBA 4GDLA 4E6IA 3V62A 4NJ6A 2ZTDA 4MN3A 1FNUA 3Q14C 4X3SA 2A1AA 1SYBA 3Q0AA 1UD7A 5CGKA 2JT4B 1C77A 3IAM1 4MTKA 5CR3A 4AQYQ 2MJ8A 1XMQQ 1PA6A 3ZNGC 3T3OA 3RYTA 3Q24A 2ZJDA 4BXXH 2IY1B 3K5LA 3EFUA 4C3JB 4MELA 3NWSA 2AMCB 3MHBA 1N60A 4KGSA 1VMCA 2WXIA 4WJPA 4DUYL 3K9PB 1TT5B 4CQNA 4GN4B 2JA6B 4WJWA 2EY6A 3HOWG 2GBJA 4NAMA 5IGFA 3AULA 3EHVA 2WKDA 1PH6A 3NBIA 2A6EC 4IJHA 1EFWA 1K83B 4PS8A 5M3FH 3IAS1 4RG1A 3NUCA 4WJ4A 2EY5A 1ENFA 1RM6C 1YJ1A 1NR2A 2H5XA 2PI2A 1ISNA 4I6LB 3S1RH 4FDBA 1WVLA 2VZKB 1RRBA 2I5HA 3J81c 4DF7A 1Q0WB 4M0WB 4MIUA 4X62Q 1F2RI 4H13C 3HKSA 3H7SA 3U8ZA 2CHWA 3RN5A 1ZXHA 2BT6A 3S24A 2W82A 4AQ7A 5JEAH 1NCVA 5FO8B 4KIKA 2Z4IA 2GVBA 5AJ3L 4DUZL 1F9PA 1W2BA 2KX3A 1P3QU 3NP8A 4IPCA 1YJ9A 4DAYA 4W9IA 5A35A 3RFZB 4JI7L 5IWAQ 4L8JA 2ZVNA 3TEWA 2OEDA 4DUYQ 3HOVH 2M4NA 2LMCB 4DV6L 2D3AA 2KCMA 2EYMA 2R3ZA 1KABA 1STGA 1B50A 1EY9A 1JJGA 1I3QH 3GV6A 2K7VA 1PH7A 1HUMA 1CK1A 2TSSA 5JVG3 4A3FH 4X6AH 2ZVOA 4YSXB 1TKWB 5M5XB 4B0MA 2MH7A 2G9DA 2DJFC 2HCCA 4C3JH 1HUNA 3M9BA 4TVAB 2VQEQ 1SE3A 4K7UA 1PGXA 2EY2A 4A3JH 1IYUA 4X62L 3AN1A 4BS9A 1NJIC 3J9CA 2LXCA 1U4RA 4AYBB 4DXAB 1WTQA 1MI0A 1O80A 4DWFA 3F1ZA 1BBXC 4PS3A 4US9A 4LCDE 1EWHA 2DY7A 4JI1L 5JAVA 4JI6Q 1UF0A 2K5HA 4JVZA 4BY1G 4OELB 1YNJC 3TSSA 3MHZA 3G4SA 4F8CB 1TGZB 4DAMA 1LTRD 2O6VB 4F88A 4PMWA 2F0JA 3KYDD 2MNAA 2JSVX 1PDQA 1YNXA 3BU2A 4MSMB 3DWMA 1JOKA 1FNVA 1Q46A 2YV5A 2RSNA 1HEZE 1LQBA 2VY3A 1ZOYB 2FIFA 2O4XA 4PMCA 1WGYA 2YU9B 2KFKA 4FF1A 4A55A 1L0WA 4ZYNA 4W9JA 2A6HC 1R4MI 1WR6E 1KC8C 1KRTA 4HIOA 4AQYL 3H0GG 4MGIE 4HPMB 2RDHA 3AE7B 3PO3G 3CAMA 2Q5WD 4A3EB 3E56A 4FJYA 3R7QA 1Y1WG 3WAPA 3EQLC 4IUVA 3S1NH 2QCZA 3Q3OC 2OEOA 1F9QA 4N58A 4OW0A 3AYHB 4QF4A 1BR9A 2VS1A 3CU7A 3AE2B 3S14H 4POFA 1V43A 1G6ZA 2PMVA 1PH4A 2RBMA 4RKLA 1HNWQ 1HR0Q 4DFAA 3ALBA 1R4NB 3T1YL 1SB3C 1EOTA 4JI5L 1HR0W 1JROA 1D8LA 1I4RA 2VH2A 4BA1I 5BN3A 3S9WA 1I6HH 2BH8A 4C3IB 2BS3B 2KWCA 1LABA 4GDKB 1C4QA 1IZ6A 1S5DD 3I9V1 2UXCQ 1XPOA 4TKNA 5M3MG 1GAQB 3I3TB 5AEKB 3ZJUA 4US8A 4M0WA 4CGYB 2JVCA 1YJWA 3PHWB 5D6JB 4K1RB 1JWBD 2Z0DB 2HJ1A 4XYCA 1EY8A 3FPUB 5CV7A 4I6PA 3OG5A 3N20C 1L4DB 1SEBD 1TJEA 4IO9A 2SAKA 1VQAA 4KMUC 5IODA 3H7PA 3VTWA 3C3LA 3W5UB 4A75A 2PQEA 2RDBC 1E22A 1E8XA 4L2YA 3KBXA 1K8MA 4JYAQ 4JL9A 3CC4A 3NE5B 1E3PA 5D3IB 2WDRB 1HPCA 2NVUI 5G3LF 4I7ZC 5C5LA 2AQ1B 1WJ6A 1MHWC 2KO3A 4K5WA 3CCSA 4AYBE 2FMMA 5C44G 2RD0A 5KHQA 1LTID 5KIXA 1NYQA 2ZJPA 2K32A 3DVNV 4KKSA 2XTIA 3Q6SA 2R7FA 2HD3A 2UUAQ 2A69C 3HOZH 3WCQA 1EZ8A 2UUBL 4DNRB 3DHIC 4E71A 4RKBA 1TWAB 1DD2A 4G7HC 2KACA 2WWZA 2K39A 1RJTA 4A93B 3KUZA 1KHIA 1XNQL 3BIID 1GOZA 2INDC 1I94Q 3T56B 1Q81C 1Q86C 1T0RC 3F2UA 1VQCA 3AI5A 3QIJA 3C2PA 3WOFA 2KC1A 1STAA 2FIDA 3E0JA 1XEEA 2F4IA 4A3DH 4KIKB 3AEEB 5CX3A 4RHSA 2N4FA 5FOBB 3K57A 1C0AA 3N1YC 3KJPA 2M17A 3UDIA 2PMZE 2HDLA 3RI7C 3RD2A 1SSOA 2SDFA 3SR1A 1B44D 4KX6B 2Y0SG 4OONA 1C79A 3PZ7A 1XNRQ 4G11A 4OIKA 1BO0A 4C00A 4D2KA 1JCKB 3K59A 1SIFA 2Z0SA 1AZQA 1CSPA 4MH8A 4JI2Q 4FYDA 2ICEC 3W5VB 1VQHA 4PQXA 3MXUA 5CV5A 2WU2B 3ZIMA 1UUPA 2EYPA 4K2LA 1WTWA 2R92H 2K25A 3I2ZA 1LTTD 4DHJB 2G5DA 3D4RA 5L95C 4DV0L 2F03A 3FKYA 4M8NA 4FXDA 2K8CA 5M3FG 4V0BA 4B9WA 3U9SA 2ZTCA 3T53B 5GAGC 3Q8DA 3IAYA 4NXMQ 2IHFA 4A3IG 4JCVE 1ML0D 4R4OA 3JAMi 1PGBA 2A69D 4GN1A 4A20A 1VQFA 3ER0A 4QY7A 2ZM6L 1KRHA 2ATWA 2I1JA 3WA0A 5HI1A 1EIFA 2E2HB 5L83A 4O1NA 1IBMQ 3UI2A 4LF5Q 1V8CA 1LXDA 3N3KB 4LFAQ 3DQVA 4Y52H 2C5CA 4HJKA 4P1BC 1OXVA 2D3GA 2NZHA 4YCVA 3PRMB 2B63G 1N33Q 4C7ZA 3KLRA 1SXTA 3GDEA 3GTMH 4LF4L 4ICUA 1VQ6A 2EYFA 1L1OB 3CIRB 3D8GA 4HCEA 1Y69U 2PE6B 3GTLH 1SE4A 3SXHA 1ILPA 1C9FA 3A54A 4W9GA 3IRBA 1RFKA 2JWZA 3PUVA 2BA0A 2CR5A 3MHSD 2G4SA 4LF7L 4RM8A 3VVWB 1OQRA 1ACCA 3CCLA 3H7PB 2HIXA 2NS5A 2JWUA 3VR9B 3HOWB 3TP6A 1V5OA 2GBMA 1B9NA 1OTCA 3FRPB 1LACA 4M1UB 5BN4A 2JZPA 3TQYA 5C3WA 2KDIA 1IW7C 1C4CA 2KHJA 3J7YW 4OVZA 4KD4A 3EROA 1DOMA 1E9MA 1NE3A 3RLFA 4AOFA 1CHQD 4ZRPA 3V96A 3TP5A 2GI9A 2KHIA 1A8VA 1WTOA 3TBLD 1LTAD 1XLNA 2PE9A 1X56A 3TDQA 2KQ7A 4WJNA 2BTEA 3R7RA 1Y1VG 2MWSB 3Q3JA 4ZRKA 3H91A 3NHHA 2PPHA 1IUEA 2C5LC 2MEKA 2L52A 3C1FA 1IBLQ 4K5XA 1XCQL 4JI3Q 3B2FA 4BY7B 4A3MB 1KDCA 1MG4A 2PZTA 2KFJA 2MBOA 2XK5B 3J80c 1DOLA 1SJHD 3R8BA 3A4RA 1S5FD 2LUMA 4DV1Q 3WANA 5C5MA 4DV0Q 4KDIC 5I6WA 4I7AA 5EDSA 4DR7Q 5J18A 3SEBA 1UNSA 1H9SA 4E74A 3EN2A 4R1JA 3G6EA 3S2HB 3CCVA 1ICWA 1ROEA 5HY6A 2BPSA 2WXLA 4BVUC 4K0KQ 2CHXA 2N55A 5CHFA 1F0ZA 5E4XA 4FF2A 1V80A 3GO5A 3C1EA 1VF5C 1WOCA 2O6VA 1TWCH 1HA5A 2KJXA 4GOPC 1Y1WH 2X38A 2K6AA 1GNUA 1B9MA 2MPMA 2JQOA 1WI0A 4DK0A 1J5EQ 5EE9A 1BKBA 4ANWA 1WR1A 4EQ5A 2BBCA 2DZJA 2H88B 4XDDA 4F7ZA 1QJOA 1Y14B 1SNPA 2ASBA 1A0IA 3S15B 2MJDA 1EL0A 1E6EB 2FJ2A 4IUPA 3J80i 3NS8A 3I70A 3RMHA 3VYRA 2VQFQ 2EOTA 3M63B 3I90A 1JWAD 1XLOA 1EF5A 2BH2A 2PKOA 2BW2A 4QUFA 3QR8A 1XNQQ 1YNTE 3JAMc 1N62A 2CKHB 1EY0A 4GOPB 1MPEA 2R92B 4JPBW 1C1YB 2G9HD 2YEPF 2K8BA 4KZ0A 3S14B 1O7IA 3HIZA 4IURA 4IFDJ 3T8MA 3VR3A 5M9OA 3OW7A 3UIPB 3FPPA 4EOYA 4KY6A 3M4OB 5C6AA 2J0KA 3IL8A 1LFDA 1XLPA 4LF9L 3PQIA 4PYZA 3R93A 5KNDA 5AUIA 3L0OA 5KNCA 3NVYA 5EJWA 1TS5A 4R9WA 2F0QA 5LMNW 4A3JG 4A3JB 1KQSA 1JB7A 3MWYW 3GTOH 2BYEA 1V5TA 3QA8A
chains in the Genus database with same CATH topology
2O2LD 2VXWA 3BVGA 4X3KA 2F0TA 3UI3A 4NJCA 5CV9A 2B2YA 2WP9B 2W3SA 3V2TA 2B8GA 1WD1A 1TY2A 2X69A 3A55A 1KDAA 3HZXA 1ONLA 3BDCA 1DOXA 2R61A 2D62A 2B2TA 1SMYC 1SE2A 2DYMA 1GUGA 3VR6A 1SYFA 4LMQD 1J8IA 5T1GA 4ZLTF 2ZW1A 4LJZC 2ONQA 4XT1B 4A3FB 1YJJA 2A6ED 2L12A 4EGVA 4EVOA 5CORA 3GTMB 5HG2A 2B39A 4HAEA 3T4AC 5C4ZA 3EUB2 5H92C 2IDYA 5IIFA 3DUZA 3G6JB 2E3TA 4MM3B 2Z4HA 2D5DA 3OIPA 2K5QA 4HSPA 4XXEA 2K5DA 1AZPA 3CRKC 4A3DB 1Y8PB 2OHFA 4ZHOA 1EWYC 3GP7A 1RYJA 3EVQA 5AFWA 1YN5A 3R2TA 4A3BB 1LTSD 4L1BA 2V3PA 3V3XA 2B2UC 5IGDA 1R4QB 2L1BA 3R3OA 2K9XA 1QOHA 1A2TA 2IPKD 5EE3A 4LK1C 3MP9A 2EYHA 3K5MA 5C0XG 2PPBC 1C48A 5HGTA 3N52A 3VYTA 1EYCA 1FNWA 1I7HA 1EZ6A 4RAUC 2YYZA 4H44C 1BCPC 1NVID 4C3HB 1Q90A 4ZYSA 1FEHA 2X6GA 4L6TB 1B2TA 3VA7A 4XQJA 2OF1A 2NVXB 2PIAA 2WXOA 3BG3A 4IZ8A 3GS2A 4H7BA 3GTQB 1JMLA 3PUWA 4F8MA 3Q8BA 4C56C 1BXTA 1DCZA 3AE5B 2PO4A 3LWUA 1B9RA 2F0UA 1NEKB 3ETRA 2VUMB 2MGSA 3PZ8A 1A2UA 2IX3A 5BYQA 2LKVA 2RDFA 1DXMA 2CJOA 5I9PA 2WXPA 4BWGB 2NBFA 1WSPA 3OMGA 2F3WA 3QWNA 4G57A 1E2WA 5DAUA 2WLBA 2M2LA 4NAWB 2EE1A 4XDCA 3W1SA 2F0OA 3QO2A 4NZLB 5I9OA 3C8YA 3O13A 1AP0A 1SJED 1BCPD 1KNEA 1D6EC 2CW0D 1LTBD 5AUKA 1GUOA 1PZJD 1PZID 5JVH3 2BOSA 1JB3A 4QCLA 4HTHA 3Q69A 2V3NA 5BMHA 1BUVT 1Z7TA 3E6ZX 4N9TA 1DONA 1IGDA 2WXKA 4A3IB 4OZAA 1QE6A 3NQTA 1VRAB 1T5EA 1XWEA 1ET6A 4WAFA 4A3KB 3CRLC 2WIIB 4KN7C 1N5WA 1VDZA 2XNAC 1CZPA 3W3AA 1ZP0B 1L0VB 3W2DA 2DNCA 4DXGA 2A5HA 1I4PA 3NTIA 1SYEA 4K8JA 1I4GA 1Q8IA 2TMPA 1ESFA 1Y1WB 2M0AA 1WRIA 2F0HA 4K6DA 2EYLA 2DLBA 2QJLA 1ZDXA 2KCCA 2AQ2B 2C9OA 3N6RA 2Y3AA 2N9KA 1U9RA 2MP1A 2WDQB 3NWTA 2FE8A 1D5ZC 1TWFB 4YWGG 1X3QA 1DGJA 1WXQA 4OHJA 1DYQA 1WTRA 3MVVA 4K8IA 3H3VC 1WTVA 5D3DA 5ELFA 4XT3B 5KNBA 3EFXD 5EPKA 3Q23A 1S5BD 5FO9B 2JEAI 1PMRA 2DWQA 1OXSC 3GTJB 1XLQA 4RH6A 3AV8A 1Z6HA 2K5WA 4EE2A 2D5GA 1TIID 4FP5D 3P7JA 1HTPA 3OWFA 4KKTA 2WXFA 3B2GA 1TS2A 4KKJA 3H6MA 3KUPA 5K36G 3J80L 3SR6A 1KH0A 1TKYA 4HEA1 1FGBD 4KY7A 2F0FA 3Q8FA 2CU3A 2VB2X 5ELDA 3KF8A 5NUCA 1JW9D 1SIJA 1PTOD 4IN3A 2KCNA 4HSVA 3GD7A 2LGIA 2JE6I 3M85A 2FMCA 4DU9A 2FINB 1SFOB 3MAQA 4CKBA 4IFDH 1LT3D 1L0XB 3DEOA 2E2JB 4U68A 4RGNA 2N9LA 4X3TA 4ILWA 4DN4M 4IALA 4A6QA 1FRDA 4IFDI 2JYEA 4ZAIA 1D5MC 1RDPD 5M3MB 1EEID 1PFNA 3MTSA 4KHVA 1FM0D 1EY4A 1O78A 3FILB 3KK7A 4RNAA 1CZGA 1BF4A 3VYSA 5LHY1 1GB1A 3EGRA 2B2YC 1JORA 3KWVA 4KK7A 2M56B 4KKIA 2NZ1D 4O42A 3DMUA 1SNOA 3AEAB 2NB0A 1AYFA 4GDLB 1JR0D 4CJ2C 1L4ZB 1S5ED 3AH7A 1TYGB 2MJEA 1PRTF 4ZKBB 3BVMA 4XE0A 1E2ZA 4C3HG 1R4PB 2EVBA 4HMIA 2QDBA 3PO3B 1MVKA 3QOLA 4IUUA 1Y8OB 5K36H 4J8QA 1O7ZA 3K5OA 1W6JA 2NN6H 1ET9A 2WNMA 5FLXL 1C4PA 1ZUD2 1VLBA 4L23A 2NN6G 3NQIA 1DJRD 2K33A 3ND9A 1I6HB 2WXNA 2AWNA 4A8XC 2EJGC 5BMGA 4NKLA 2NN6I 3MEHA 1BCPB 4ZRZA 4H2AA 3OWEB 4XWWA 1K8OA 1NENB 1VMPA 2WXGA 1TR5A 4Y7NB 3S2DB 4QUCA 4DK1A 1PTOH 2J0TD 5EPJA 3M3YB 5C0XJ 3LB8C 4WQMA 3LWEA 1YMHE 3ZJTA 2VZKD 2DN8A 4EQOA 4TSSA 1C76A 4KGRA 1HXYD 3AEBB 4K14A 5ELEA 3U52E 1H9SB 3A7LA 4TQUS 3D31A 3MFYA 1RODA 2Z1CA 2A68D 4HCSA 4DGZA 1R7SA 2EJFC 2KEDA 4OL7A 1ZEQX 4KJOA 4KV6A 1J7AA 2M19A 2QMTA 3ITPA 4R8IA 3NVVA 4JBWA 1IHZA 3NPPA 3PMFA 4IFDG 1FXIA 1F77A 1PYWD 3E5SA 3JAME 3WDNA 3EJIA 1CTMA 1E0BA 3M7GA 2WXQA 1U4MA 1PFBA 3A8JE 1YN3A 3AU7A 1D1IA 4MHEA 2AUKA 1PTOB 1NUCA 3T51B 2LFNA 5E4WC 3P4QB 1SNCA 1J9OA 2L83A 2F0WA 5C2TB 1TQOA 5G5HA 1GPXA 1LV9A 1HA6A 3NBHA 4A9AA 1FFUA 4N6EB 3J80E 1V1PA 1Q12A 2A6HD 3I4MB 2PMZB 3OHXC 3P42A 2LJIA 2M9VA 3DEPA 5J39A 1QKZA 3HGBA 3NUHB 3TEXA 4K5VA 3PUZA 2KA7A 3VR4A 2ICIA 2BS2B 2NWGA 1PFDA 1CM9A 1G291 1MGSA 4WH4A 1GXDC 4TRDA 2B2TC 4ZUIA 4TMAB 4RCOA 4C1NK 2K0PA 5MPOA 3G7LA 4J1MA 3VRBB 3PUXA 1DOYA 2QCPX 2BS4B 2WS3B 3IT4B 3DXJC 3KLSA 1XYIA 2F0EA 1MD2D 3H09A 1C8CA 1Y56A 4ME5A 5C0XI 2QILA 2LS01 3VQIA 4H0LC 5E1FA 4OIJA 4IDIA 2K1BA 2WAQB 2AQ3B 1ENCA 2W54A 4JK1C 3NXWA 4XYOA 4TKOB 2EYJA 3I91A 5M5YB 3S1MB 2PZUA 1EU3A 2IGGA 3IKJA 2SOBA 1TS4A 1EQTA 4MT5A 4DA2A 3AEDB 5CV4A 2E76C 1I6VC 4PV1C 4NP5A 2NVTB 3DWQA 5BN5A 5KYIA 1V8QA 2KQ3A 1I4XA 1CA5A 1SYDA 3AECB 1QCBD 2WXRA 3MXPA 2RKSA 5DM63 4JWUC 2EDGA 4XTCS 1C4AA 4KY5A 2K01A 4M8AA 5EKLA 1QQRA 1CT1D 3RZOB 1QT9A 1S4ZA 3GTKB 2Q8TA 3SHLA 1BUIC 3NZ3A 1S5CD 5CBEE 4ARCA 2JSOA 4I65A 5I2XA 5DNFA 1RTNA 2EJMA 1G91A 2D2CC 1C78A 4XYQA 3MXGA 1STHA 1YJIA 4IQZA 1H9JA 3M7NA 4C1NI 4BBSB 1WTXA 1F2YA 1MSGA 1Y8NB 1XO3A 4L63B 4LK0M 4YT0B 2IJ0A 2I07B 1TZOA 3NTHA 1N63A 3SK6A 4ODGA 4K6LA 1FFVA 1F2ZA 2HCIA 1NYRA 2WDVB 4ITKA 3C46A 2LMCA 3A8IE 3FILA 4Q5VA 3FAHA 2J4XA 3BZDB 2KDMA 2XVSA 5C44B 1T6BX 3VYUA 2DY8A 2OT2A 1IW7D 2KEEA 4CJ1B 5IGGA 2H89B 3HRZC 3L4PA 3HVZA 2ZT9C 2L4NA 5CV6A 4RA8A 4HN7A 3Q8CA 1TVXA 3WOEA 3ZYYX 5M5WB 2YEPB 1TY0A 3NRZA 2M00A 2KMMA 2WINB 1BDOA 4KGTA 4LTUA 3HUIA 4HJGE 5EPLA 3OSOA 1BOSA 1PRTD 2K28A 5EQ0A 1WTPA 2WU5B 4PNYA 4C3IG 3P4RB 1TKEA 3P20A 3ZQ4A 3U9OA 3Q8EA 1GJXA 3K5NA 1NSNS 2Z8LA 1PFMA 3HS0C 4WWMA 2Y5CA 3BVZA 2L0CA 3HKZB 3BK2A 3PIP3 3N9YC 1N61A 1BNZA 5FO7B 3PO0A 2BDOA 5IOCA 5F2DA 3H0GB 2IL8A 3I8ZA 4QMGA 5EGTA 4R8NA 1HCZA 1E2VA 5C4JB 2L5TA 2LHEA 3ZJVA 1HFGA 2JA5B 1K51A 1YN4A 5C0XH 4Q0FA 3U7ZA 1Q1EA 2MUYA 1SF0A 4RGOS 1SAPA 4FXGC 3OIQA 3J81E 2N7JA 4JX1C 3A56A 1VF7A 3X3NA 3VRAB 2INPE 1R9TB 1AN8A 2I46A 2KVMA 1EEFD 1JWSD 2V4IB 2A74C 5EBCA 3IFTA 3S17B 5JJZA 4P2CB 3K58A 2RQXA 3RPFC 3P1MA 1Q3LA 2F0SA 3K6OA 2ACZB 3L3OC 1EWCA 1FO4A 1JQ4A 4OO1H 2FHTA 1VDVA 1EY5A 4FVMA 1YQ3B 2KQ4X 1PTOC 4LLGM 4YTNB 4ZUJA 2X6LA 4RF0A 2ID0A 2ZXPA 2A68C 4R3DA 5KGUA 2JYOA 3GTLB 2AUJD 2QSDA 2ZXOA 2J42A 2L9HA 4OO1I 1G2TA 5JPNC 1T3QA 4ZQ3A 1BMLC 5EKKA 1N5XA 3P4PB 1IYVA 5LL6S 1CZWA 4DAPA 5D7GA 2SEBD 3PV0A 2B63B 2NTTA 2E2DC 3Q22A 3D4WA 3OMCA 3A7AB 3MFGA 4RHRA 4CKCA 4G7OC 2BDNA 2PNRC 1M8AA 1STNA 3ABVB 4HKQA 5DEHA 1TT2A 4IUNA 4A90A 4C7YA 1IKMA 1JOQA 2HTME 2Q8RE 1LTGD 1K52A 1FCCC 4C3JG 1AFPA 2EY1A 3MZ5A 1W6KA 1PLFA 1QB5D 2W3RA 2F0IA 1PXUA 2B2VC 2EYOA 4ULLA 3HOYB 1DZ1A 2GA4B 3VA5A 3VR2A 1Q10A 2XIWA 3PUYA 1FIQA 4HMJA 4F87A 1BCPF 1NI3A 3AE9B 1XXGA 1JRPA 1CI3M 2JU6X 1P7EA 2KUMA 1A3TA 1UAPA 2PW9A 2VNUD 3FDTA 3TUOA 1H9KA 1M4VA 2BE5D 4NW2A 3Q8AA 1WCMB 4BBRB 1FMAD 2CVRA 1LT5D 1LLRD 4USAA 3L9AX 4A3GB 3SK5A 2HDEA 1JC7A 3NVWA 4REZA 2KOLA 5G5GA 3MA2B 1PRTC 1L0YB 2NTSA 4KKUA 2QKIC 2JYTA 1PGAA 2E75C 2KWDA 1RWSA 4EQNA 1D5XC 1STYA 2INNE 1FR3A 2B2WA 3NTKA 1X3PA 2RVLA 5C3EB 4RGTA 3HOXB 1MHHE 1QOGA 1HQMC 3BDOA 3FEWX 2Q8IB 5FR3A 4ZRQA 2XRQD 4HRSA 1FD7D 5KRUA 2RPVA 2IX0A 2LY7A 2PZWA 4YIJA 2WXJA 4ARIA 4FXCA 1Y1VB 1D1KA 5GXGB 5DM73 1SSNA 1V1PB 4KHZA 3SK8A 4XDXA 2K3UA 4P16A 2LEKA 3FC4A 3TN2A 2WV6D 5C4XB 2CW0C 2HQEA 1RD9D 2SNSA 1QILA 1GUNA 4Q2JA 4RGMA 2O5JC 5J22A 3TZUA 1I50B 1PUTA 1UEAB 5J1ZA 3HEJA 2Y5PA 4KD3A 3NVZA 2ENBA 4NDXA 4FF3A 1QWYA 4QIWB 1QNKA 1STEA 1V97A 5TSSA 4WIPA 1PZKD 1EIGA 3ERQA 1XX8A 1MHXA 1GUTA 2H1EA 1A15A 1VZ7A 1JQYD 2I2YA 2JQRB 1PTOF 2BA1A 3SFDB 2B8FA 1SMYD 3GB1A 4IOIE 3HG9A 4IKGA 2K22A 3JAML 3U2SC 5IT9L 3GTGB 3I72A 4GZYC 5JEAG 3KWLA 1JALA 3ND8A 3T13A 1ZXIA 3HOVB 5ELCA 1YQ4B 1AWDA 4KN4C 2HDMA 3K7AB 4QB4A 2EKIA 2FUG1 4XIGS 4PMBA 5C4HA 3OPOA 2N88A 1WGKA 1LT6D 3M4YA 1ZXTA 2MHVA 4OO1G 1NR4A 5COYA 4YTPB 4V190 2MJ3A 2PW5A 4PT5A 3AE8B 1F2RC 3A8KE 3EA6A 1A3UA 1F2LA 1ZYRC 5EKIA 2L55A 1D4BA 3U4EG 4CHTB 2NVQB 1EM7A 2HUGA 3AE1B 3S1RB 1SNQA 1HZ6A 4B0EA 3SK4A 1EYAA 5JEAJ 5ISRA 2WP8J 4CJ0B 1L5PA 1BQQT 5M3FB 2I38A 3LXFA 2E6XA 5E3FA 2ON8A 1IBXB 3SE0A 1EIHA 3RZDB 2R93B 2G1EA 3HOZB 5IGBA 5C3JB 1MI2A 2BYTA 2KECA 4CBVA 2E74C 4J3OD 3KQ4A 3J7AF 2IGHA 1FYCA 3RD4A 3ZGZA 2PW7A 3QG1A 1KNAA 2OXPA 4XWTA 4IUQA 3I3CA 3AE4B 4C2MB 3BK1A 1J7BA 2L32A 5JOBA 4ZHPA 2DNEA 3LNNA 3SDZA 3L7ZC 2ZXRA 3QOJA 2K03A 3BDLA 1OO9B 1QLBB 1SYGA 2N0SB 2JA8B 1IKLA 2EXZA 1WD0A 1GHKA 5EE1A 2K5PA 1EY7A 1YNNC 2CHBD 1E7PB 2JX5A 2BB6A 3I73A 3TEZA 1FCLA 1STBA 3GQBA 4X3UA 3HP3A 2PVOD 1JE4A 5T1IA 2FBWB 2PYKA 4XQNA 5T8IA 3BYYB 1A70A 2A73B 3HRDD 1KF6B 1CQFA 4B9XA 1SNMA 4F7XA 1TWCB 5FK9C 1DOKA 2V0GA 2W55A 4KTAA 3AMUA 5IGCA 1RF2D 4HEDA 1NAPA 3K0YA 2WB1B 1I4HA 3H94A 1KFYB 3D3RA 1MSHA 3AM9A 1B3AA 4XQQA 1WWTA 3ONAB 2QF7A 1YNND 2PCFB 3SVMA 3DWGC 1KAAA 2IGDA 1RCVD 1KDBA 1HTLD 5D14A 3QIAA 1A6XA 3T3NA 2WQYB 1CQVA 1LT4D 4FXKC 2EELA 1F0ZA 2R7ZB 5KEEA 5CBAE 2J52A 3P4SB 2KAJA 4DAVA 4FO2A 1RHPA 2RMMA 1I4QA 3D6CA 2AX5A 3P1HA 4LAAA 1Q1BA 2XWBB 1UGJA 4ZOHC 4TQ1A 2J7ZA 1MBYA 1E10A 1QG7A 4MACA 1O7YA 1F2MA 3LYYA 5JXVA 1GB4A 1SBBB 2F0LA 1UWMA 2K04A 3HOUB 1XCTL 4WFN3 3S16B 1QOAA 3VR5A 2F0VA 4ZKCB 5I2YA 1KLUD 5LNK1 5FLXE 3MXNA 2PVGC 1TKGA 5IT9E 4DXFA 1OXXK 4JE3B 2B2VA 1CJEA 1VCIA 2IWHA 1GUSA 4GLSC 2Y0SB 2JXTA 3VR8B 4OZBA 3FMCA 1SNDA 1EQVA 2NUCA 3GV3A 3P63A 1FXAA 1ZYRD 3D6WA 4FNFA 4IUTA 5G3LD 4JWSC 3AEGB 1B1ZA 1IL8A 3X3MA 1ILQA 1QOBA 5HURA 1B53A 2BE5C 2B76B 1PDXA 2LFIA 3CKIB 2NYZD 5JPMC 5EBDA 1XTCD 1RTOA 4DNTB 1VR9A 4J6HA 2IX1A 4KI0A 1F9SA 3TBIB 2QIEB 5BMIA 2K05A 3QB3A 3I4NB 3HVDA 1V1OA 1ZPSA 1DOIA 2D9UA 1Z47A 3TP7A 2J53A 3AB5A 2XN9C 5FKAC 2XSCA 3GTOB 2RSOA 4TQ0A 1ZDVA 4P6VF 4N9PA 3I4LA 3KBGA 1PRTB 4JPSA 3KLSX 5C3XA 1VZ8A 3R2IA 1GUWA 1JWUD 1IBXA 2XRSD 3I57A 1TS3A 4C80A 3BYTB 3TZDA 2F0KA 3CQZB 1H9RA 1XF5L 4RFBA 2PTLA 2GB1A 1K50A 2F0GA 3DHQA 4YTMB 1EU4A 1P7FA 1FRRA 3TP8A 2L1AA 2XWJB 2BB5A 3E9SA 4UAIA 3PIO3 1K53A 2BCOA 3FVQA 4HR7B 2VB3X 5BYRA 3SFEB 3NK9A 4UDUC 2L11A 4HROA 3MJ5A 3DWPA 1SYCA 3LX0A 2JXMB 2DBYA 1QOFA 2QEJC 1KTKA 5CYUA 1JICA 2EPBA 3URYA 3AE6B 4ZK9B 3H8HA 4BY1B 3P75A 2CQAA 1IGCA 3AE3B 1TWHB 1J7CA 4HKZE 2V4DA 1HZ5A 1TWGB 2AWOA 1JOOA 3RUZA 2CJNA 4ID6A 4WRDA 1EY6A 1VZ6A 1H9MA 1HQRD 4ABNA 2WXMA 2WACA 1CFMA 5LL6X 2KN4A 3QJYA 1VJKA 3AEFB 3GTPB 1D2BA 2JP1A 1AEXA 1ESRA 1I3QB 3BS1A 5D65A 2DYOA 3BWUD 1E0ZA 4BA2I 1U4LA 5BYSA 3IT6B 2NVYB 5ELBA 3CWIA 2EZVA 1ZKOA 1OQQA 4S3SA 1SDFA 4FF4A 1GHJA 4AS1A 3V05A 3FKIB 2F0PA 2IW3A 3DM1A 2SNMA 4K2KA 5I4DA 2F0NA 3NS1A 3MC0B 3W9CB 3IXSA 5HHDG 3J81L 3TMEA 1G2SA 1CHPD 1OXUA 5CV8A 2JEBI 4OZCA 2F0MA 4NMZA 4YSZB 2O5IC 1WYGA 1OXTA 3B9JA 2PLPA 2FFKB 3S1NB 3T16A 2LHDA 5IGEA 1YNJD 5KYLA 3D4DA 1CA6A 4G4KA 1AW7A 1EFID 2R6GA 3OOCA 2NMQA 4N59A 4U673 5A2QE 4B08A 2B2UA 1ENAA 5CC4A 1HRJA 5E6JA 4YXDB 2GRIA 1U4PA 2WXHA 1QNUA 2IT1A 1HHVA 1HFNA 2F0DA 2B2WC 3PO2B 1OFFA 1B4OA 1O7LA 2RDGA 5CMDA 2F3VA 1TU2B 1ZE3D 1KLGD 2ZW0A 1QF6A 1JWMD 4Z9CB 3CHBD 4YSYB 5H8YE 2JA7B 1F9RA 1II3A 3S1QB 5K5PA 1L6VA 4WORA 1LO5D 1G8ZD 3AMZA 5I6YA 1DM0B 5A2QL 2WKCA 1RKNA 4RF1A 1UWXA 4RCNA 2E2IB 2F1MA 4CKEA 4WURA 1EYDA 3NSWA 1L6UA 4EQPA 3DWAA 3AB9A 1FD6A 5EE0A 3TEYA 1A3VA 3J7AV 4RWSC 4G7ZC 4DQOC 1T5XD 2RA4A 2H4OA 2KHSA 3IFDA 4OGQC 1X32A 4KJNA 4E6IA 4MN3A 1FNUA 4X3SA 1SYBA 3Q0AA 5CGKA 1C77A 3IAM1 5CR3A 2MJ8A 3T3OA 3Q24A 3K5LA 4C3JB 3NWSA 3MHBA 1N60A 4KGSA 1VMCA 2WXIA 4CQNA 2JA6B 4WJWA 2EY6A 4NAMA 5IGFA 2WKDA 3NBIA 2A6EC 1K83B 3IAS1 3NUCA 2EY5A 1ENFA 1RM6C 1NR2A 1WVLA 2VZKB 4DF7A 4MIUA 1F2RI 4H13C 1ZXHA 2BT6A 2W82A 4AQ7A 5JEAH 1NCVA 5FO8B 2Z4IA 1F9PA 3NP8A 4DAYA 5A35A 3RFZB 4L8JA 3TEWA 2OEDA 2LMCB 2EYMA 2R3ZA 1KABA 1STGA 1B50A 1EY9A 3GV6A 2K7VA 1HUMA 1CK1A 5JVG3 2TSSA 4YSXB 1TKWB 5M5XB 4B0MA 2MH7A 2G9DA 2HCCA 1HUNA 1SE3A 1PGXA 2EY2A 1IYUA 3AN1A 4BS9A 3J9CA 1U4RA 4AYBB 1WTQA 1MI0A 1O80A 1BBXC 4US9A 1EWHA 2DY7A 5JAVA 1YNJC 3TSSA 3MHZA 1LTRD 4F88A 4PMWA 2F0JA 2JSVX 1PDQA 3DWMA 1JOKA 1FNVA 1HEZE 2RSNA 1ZOYB 2O4XA 4PMCA 2YU9B 4FF1A 4A55A 2A6HC 2RDHA 3AE7B 2Q5WD 4A3EB 3E56A 3EQLC 4IUVA 2OEOA 1F9QA 4N58A 4OW0A 4QF4A 1BR9A 3CU7A 3AE2B 1G6ZA 1V43A 2PMVA 2RBMA 4RKLA 4DFAA 1SB3C 1EOTA 1JROA 1I4RA 4BA1I 5BN3A 3S9WA 4C3IB 2BS3B 1LABA 4GDKB 1C4QA 1S5DD 3I9V1 1GAQB 3ZJUA 4US8A 4M0WA 4CGYB 1JWBD 1EY8A 3FPUB 5CV7A 1L4DB 1SEBD 1TJEA 2SAKA 4KMUC 5IODA 3C3LA 3W5UB 2PQEA 4L2YA 3KBXA 1K8MA 3NE5B 2WDRB 5D3IB 1HPCA 5G3LF 4I7ZC 5C5LA 2AQ1B 4K5WA 2FMMA 1LTID 5KIXA 1NYQA 2K32A 4KKSA 3Q6SA 2A69C 3WCQA 1EZ8A 4DNRB 4RKBA 1TWAB 1DD2A 4G7HC 2KACA 1RJTA 4A93B 3BIID 1GOZA 3T56B 3F2UA 3C2PA 3WOFA 1STAA 3E0JA 1XEEA 2F4IA 3AEEB 4RHSA 5FOBB 3K57A 2HDLA 1SSOA 3SR1A 2SDFA 1B44D 4KX6B 1C79A 3PZ7A 4OIKA 1BO0A 4D2KA 1JCKB 3K59A 1AZQA 4MH8A 4FYDA 2ICEC 3W5VB 4PQXA 3MXUA 5CV5A 2WU2B 5HFYA 1UUPA 2EYPA 4K2LA 1WTWA 1LTTD 3D4RA 2F03A 4FXDA 4V0BA 4B9WA 3U9SA 3T53B 3IAYA 1ML0D 1PGBA 2A69D 1KRHA 5HI1A 2E2HB 4O1NA 3UI2A 1V8CA 2C5CA 1OXVA 4C7ZA 3KLRA 1SXTA 2EYFA 3CIRB 3D8GA 4HCEA 1Y69U 1SE4A 3SXHA 1ILPA 1C9FA 3A54A 1RFKA 3PUVA 2BA0A 1OQRA 1ACCA 2JWUA 3VR9B 3HOWB 3TP6A 1B9NA 3FRPB 1LACA 4M1UB 5BN4A 2JZPA 5C3WA 1IW7C 1C4CA 3J7YW 4OVZA 4KD4A 3EROA 1DOMA 1E9MA 3RLFA 1CHQD 4ZRPA 3V96A 3TP5A 2GI9A 1WTOA 1LTAD 1XLNA 3TDQA 2BTEA 3H91A 3NHHA 1IUEA 2MEKA 2L52A 3C1FA 1XCQL 4K5XA 3B2FA 4BY7B 4A3MB 1KDCA 2PZTA 1DOLA 1SJHD 3R8BA 1S5FD 2LUMA 5C5MA 5I6WA 3SEBA 1UNSA 1H9SA 3S2HB