1ENFA

Crystal structure of staphylococcal enterotoxin h determined to 1.69 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
212
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN H
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 71
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2000-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1enfA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1enfA02
1YN5A 4UDUC 3MFGA 1CQVA 1V1OA 5ELCA 4Z9CB 2WV6D 1KLGD 2QILA 2XRQD 1SJHD 1LT5D 1TS5A 3BVMA 1D5ZC 1PZKD 3DWPA 3W2DA 2R61A 1GOZA 1TY2A 4RH6A 1LTSD 1S5FD 1QILA 2RDHA 3OWEB 1PZID 1FNWA 1SJED 1RCVD 5D3DA 1EEFD 1LO5D 1F77A 1TS4A 5D3IB 1LTRD 4L63B 1I4HA 1JR0D 1CT1D 4RHSA 4RCOA 3URYA 1D5MC 5ELDA 1S5CD 3KLSX 1LT4D 2AQ1B 1TS3A 1DYQA 1EWCA 1ENFA 1HQRD 5FKAC 4RGOS 1T5XD 1PTOH 3BZDB 1PTOD 3EA6A 4L6TB 3EFXD 1AN8A 1ET9A 1D6EC 1LTBD 1I4XA 1LTAD 1S5ED 2SEBD 1ESFA 1SBBB 1UUPA 1V1PB 1SEBD 1PTOB 1LTTD 1LLRD 4C56C 1FGBD 3CHBD 1PRTD 1I4PA 4O1NA 1EU3A 1I4QA 1KLUD 2XN9C 1D5XC 1TY0A 3O13A 4DXFA 1TS2A 2G9HD 4RFBA 5FK9C 1LTGD 4RGNA 2J4XA 1SE2A 1EU4A 2XNAC 1BCPD 4RGMA 1PRTB 1HTLD 1KTKA 1S5DD 5ELFA 3DWQA 1XXGA 4RHRA 1B44D 1FD7D 2TSSA 5TSSA 1LT6D 2IPKD 2CHBD 2Z8LA 1ET6A 1MD2D 1JWUD 1SXTA 1YN3A 1STEA 1I4RA 1CK1A 2ICIA 1PZJD 3V05A 1BCPB 2AQ3B 1AW7A 1CHQD 3MC0B 2IJ0A 1RF2D 3BYTB 1RDPD 4ZYSA 1M4VA 1SE3A 1PRTF 1EEID 1HXYD 1UNSA 4OHJA 3BYYB 1PTOC 1L0XB 2QEJC 3DWAA 1L0YB 3SEBA 1YN4A 1G8ZD 4BWGB 1V1PA 2AQ2B 5I4DA 5ELEA 1BXTA 1LTID 2NTSA 2RDGA 4TSSA 4DXGA 1BCPF 1JWSD 1PTOF 3R8BA 5ELBA 1HA5A 1CHPD 1FNVA 1LT3D 4NZLB 1FNUA 1B1ZA 2O2LD 1I4GA 3GP7A 1PRTC 2XRSD 4RGTA 1SE4A 1XTCD 4K6LA 1JQYD 1PYWD 1S5BD 3TSSA 1DJRD 1EFID 3BVZA 2NTTA 3BVGA 1JCKB 1JWMD 3R2IA 1BCPC 1RD9D 3R2TA
chains in the Genus database with same CATH superfamily
5D65A 2D3AA 4NW2A 4WORA 5C4HA 3QARA 2I2YA 2GMIC 2QDFA 5IP9H 1FIQA 3D4WA 5H1SE 4KZCA 5IA7A 5ELCA 1OEYA 2D3BA 2KN5A 3PZDA 4A75A 4JI8Q 2YV5A 3IKJA 1PZKD 2F4VQ 2LWPA 4JI2L 3HOUB 1NR4A 4PZ6A 1HNZQ 1Z2MA 1ZKHA 1B3AA 5KRUA 1RCVD 1B3QA 1IL8A 4ZAIA 3OYYA 4HSVA 2VH2A 1N36L 2KACA 3ZNGC 3TRZA 1A63A 2JJQA 3ZW3A 5EE9A 1V86A 3U4ZA 4K7UA 3NE5B 4A3GB 2NVUI 3AEFB 1WMHB 3RLOA 4GN3B 4N59A 5E6PA 2C7NB 4G3XB 4DNIA 3LB8C 5FKAC 1JOOA 2BW2A 3BZDB 1HNXQ 1PTOD 5CX3A 3C1EA 2GRIA 3W1SC 1N5WA 4XC2A 2ES2A 1KOTA 3A8JE 3WOFA 3RR5A 3JSVA 5EE3A 2N88A 2AUJD 3VR2A 2AUKA 4OX9Q 3J80i 3M4QA 1N63A 1AZQA 1VQJA 4L5RC 4J1MA 1PTOB 2CH4A 3CPWA 1VQHA 1PYBA 5LHY1 5M3MG 1C4CA 1V2YA 4A3GG 2ACZB 2IY1B 5M5XB 2ZVNA 4LJOB 4DR1Q 3K5OA 2X38A 1TY0A 3KOJA 2MO0A 4UP8A 5AJ3L 1CM9A 2ZJPA 3K7AH 2Q8IB 1QG7A 1B8AA 2YYZA 3H15A 4KY7A 2GBJA 2LGSA 3DVGX 3OLMD 1EYCA 2R3ZA 4JOIC 5IGDA 1K73C 2NN6H 3BINA 1NEKB 3SU8X 4HXDA 4GN4B 4PK1A 1H9SA 3V2TA 3DCGA 2RHQB 1DD2A 3OIQA 4JI1L 1NTGA 1SE9A 1PQSA 1A0IA 2A69C 2LVOA 3OJ4B 1XNRQ 2BGFA 4FA6A 3CWIA 4JIOU 4RF0A 1IBKQ 2YTXA 1I4RA 4PMCA 4KDIC 1JOQA 1II3A 4RA8A 1Y8OB 3NZ3A 3CMMB 3APFA 1GM5A 4HCPB 4E3CA 1UNSA 2QEJC 4WQOB 2H4OA 1HR0W 1P1AA 3CF5A 3U52E 3SEBA 2KX3A 5I6YA 4JI2Q 2BS2B 4IFDH 5LXIB 4GDKA 1YZ6A 5M3FH 3GTKH 2B76B 2KC2A 1K28A 1YHAA 1HH2P 1KL9A 1YQBA 4R4QA 2V1YA 2KOLA 3J7YW 4W9JA 1N36Q 1B1ZA 4FVMA 1YITA 2DJGC 1X9NA 3L16A 3A7LA 1YI2A 4N58A 4CDDC 1OQYA 1FMAD 4J8QA 2F0FA 2SAKA 3T3OA 1YIJA 3W5VB 1ENCA 4DR3L 3T1HQ 1WGGA 4BFRA 1B2TA 3Q3FA 3M63B 3ZYYX 1WRIA 3UI2A 2K0PA 2W9NA 3BWUD 3U7ZA 4B0MA 1D2BA 2C7MB 3WAOA 2R7ZG 5ISRA 4GLVB 1EY9A 1YJ9A 1L4ZB 1WX7A 4NJ7A 2CVRA 4JI4L 1ZEQX 5FJ8G 4EE2A 3HEJA 4MM3A 5KHQA 1EIHA 3AN1A 4L5SA 4DAYA 1BBWA 4Z9CB 3M4OB 3L0WB 2WU2B 4EVOA 3AEGB 3A7AB 3PGZA 3TREA 4O42A 4DAPA 3HP3A 1F2MA 2BKFA 4MIUA 3RPFC 1B9RA 4ACFA 4LFCL 1GD7A 1IBXA 3NBIA 5J1ZA 1W3SA 3EHVA 4A3CG 3HRDD 2JXMB 3QB3A 5T8IA 2VB3X 3R7RA 2A69D 5AJ3Q 4TRDA 3HOYG 3I2ZA 4RHSA 3SK8A 3CPFA 2KHWB 1U4MA 2PE6B 3PLVA 2LFIA 4BBRG 1GUOA 3N1YC 1WD1A 3KJOA 4JI1Q 4USAA 2KDBA 2WXQA 1V6EA 1WJNA 4P6VF 1JROA 3A33B 1JALA 2ZPNA 3I9V1 3K5LA 4A76A 3PGEA 3QK0A 3AQQA 5FR3A 4DV0L 1RKNA 1HA6A 2MJ3A 4A3MB 2K75A 4JX1C 2PYKA 2LGXA 5G55A 4BVUC 1EYDA 1WGKA 4C3IG 1DOMA 3TP8A 2WXGA 2B8GA 4A3BH 4H13C 1I6VC 2VUMH 4MGKE 3O65B 5IY0A 3GTMH 4I65A 2JA7G 1IP9A 4IJLA 1EU3A 5IOCA 2WXJA 4LDTD 1LUZA 4RFBA 4TMAB 1HJPA 1F9PA 1A70A 1NDDA 1BVSA 4JPSA 4CKCA 1NUCA 3TIXA 3DM1A 3MTNB 1WXVA 1EQQA 4BY7H 2VQEL 1YQ4B 2JWZA 4GOCA 3ZVVA 1A2TA 4LDTB 2O6VA 3A1QA 2KAJA 4QQBX 2DZIA 2MQJA 3AB9A 5G3LD 1SXTA 1IHZA 2X8XX 1TWHH 1PZJD 2Y3AA 2HHHL 1TWAB 1QE6A 1WM3A 4NKLA 4XTCS 4CJ2C 2MP2A 4JI4Q 1UEAB 1P3QU 3NVVA 2JA8H 2LY7A 3W1BA 2A5UA 1SNQA 5BYSA 3LXFA 1E1TA 2PZTA 1FRRA 2ATWA 1FFVA 4A3KB 2KO3A 2QMTA 4NQLB 2EIFA 1C79A 4TSSA 1ROEA 1IGCA 3NHEB 4DXGA 3Q3MC 3BU2A 4KLKA 4LFCQ 3JC66 3GTPH 3Q0AA 1EWHA 4HDQA 3JAML 2JXXA 4IUNA 1EL0A 2AHOB 4RGTA 1TU2B 5G3LF 2FHTA 2KBNA 2WIIB 2JA6B 3T4AC 1SNCA 2F0JA 2ALYB 1AARA 3T8MA 4C3HB 1A8VA 1X56A 4A3KG 2GOWA 1VQ8A 2KUMA 2WYQA 1LV9A 3HIZA 4BY1G 1HTQA 2IGDA 4WJOA 4DV0Q 4HJAA 2PVOD 4FJYA 2IO0B 1TWCB 2V9HA 3FRPB 3NZSA 2LZ6A 4M8MA 4IUVA 2WV6D 1KLGD 1R4PB 1VQOA 4US8A 3BIID 1D5ZC 2XBBC 1V5TA 2KZRA 1MBYA 5EE1A 3PIP3 3S14B 3ZRCA 3SGIA 3P4SB 2WKCA 2KCTA 3S1MH 1I6HB 3AI5A 4C3HG 3AE2B 5C4JB 4DUZL 1SNOA 1STAA 2K50A 2REXA 1PH2A 3UIPB 2C5CA 2PKOA 4ZUJA 5ELDA 2D5DA 4DN4M 1JRPA 3K0XA 4EQNA 2VQEQ 5G5GA 1EWCA 2EZVA 1LACA 1WY8A 4IM3A 5FOBB 2MWSB 3HKZG 4XWTA 3CCQA 1NYQA 3M62B 2B2TC 1I4XA 2HHHQ 1UGMA 1BDOA 2O4XA 5M3MH 3VUWA 1SBBB 1UUPA 1KH0A 5LMUL 3M95A 2BPSA 4JBWA 2Z0SA 1EYGA 2NS5A 4L1BA 3KUPA 1IBLL 3QAQA 2F0VA 2N8NA 1S3OA 4DNRB 5TR5A 3TEWA 4G57A 1SB3C 1KNEA 5FLXE 4DR2L 1V49A 2LXKA 1D8LA 3RYTA 5KHOA 4XDDA 2R6GA 2DBYA 2O2VA 1TBEA 3K5NA 2Z0EB 3AECB 4LJZC 3UINB 1OXSC 1JJ2A 1VQ4A 4M8NA 3EJIA 1S1QB 3EC8A 5HG2A 3L2PA 3PZ8A 4WJWA 2INCC 3NSWA 2JZ3B 3MTSA 1WTRA 4KZ0A 2TSSA 1CZGA 2RA4A 1PVOA 4X3UA 1ISNA 3CRLC 3TBLD 1VQBA 3AXCA 3QG1A 1B4OA 3IFTA 2UXBL 1CHQD 3VR6A 3Q8FA 2IJ0A 3M3YB 1LTLA 5AUIA 2FINB 1JJCB 2DZKA 3M7GA 1PH3A 1EEID 2KWUB 1HXYD 1QOHA 4AQYL 1K53A 1TXYA 4DHZB 4KV6A 1ZKOA 3SK4A 3FPPA 1WTOA 4LF8L 4MJSA 3K8AA 4QMGA 2YU9B 3PO3B 2KMAA 3AEBB 1V97A 2PMVA 4DV7L 2L11A 3KDFA 3WAMA 1SLJA 1YEZA 3NS8A 3F2DA 5BR8L 2KANA 2VL6A 4DUZQ 3PS6A 1NR2A 2ZW1A 1MJEA 2R92B 3UQBA 4NAWB 1ICWA 2HT1A 1PH6A 3G48A 1N33Q 4HROA 2INNE 1PRTC 2RD0A 2AWTA 2EYMA 1TTNA 1EYAA 4CHKA 1X55A 2JPHA 1Q8IA 3MAQA 1VQPA 2R7ZH 2PO4A 1R4NI 1WSPA 4RMAA 1K3BC 3L3OC 2NVYH 1JCKB 2V1CC 3J7ZC 2FUG1 4EQPA 4JLCA 1EIGA 4QGUA 2CKZB 3PO3G 5JPMC 2E2JB 1UBQA 5BMGA 4P72A 3UDFA 1SYEA 5JVH3 2N7JA 1J7BA 3ULLA 3TL5A 4XT1B 4EFOA 4NJ6A 1JE4A 3KLWA 4MELA 2ZNVC 4W9HA 1D1IA 2R92G 4BKSA 4BKGA 5LMUQ 4FJVB 1WXSA 2QILA 3FKIB 3SE0A 2WB1B 4G4KA 4YTNB 3T1YL 1IBLQ 4TKNA 3F8TA 4A3CH 1FPYA 3A9KB 3JW0X 4ZYNA 1GUGA 3HOYH 4Y52H 4S17A 2RR9A 3PV0A 2FMMA 2HTHA 4DDGD 3OWEB 1O7LA 1BNZA 1EEFD 1F77A 4KKJA 3PUXA 4BBRH 4MDKE 2NN6I 4OGQC 3NRZA 4W9IA 2K25A 3Q23A 2D10A 4P75A 4RMFA 1A5RA 1BQQT 4DV6L 5E3FA 1XLNA 3N32A 2WAQE 1VS0A 4RM8A 4YTMB 2F0NA 1HQRD 2DENB 2G4SA 3FKIG 4PZ8A 1TIID 1F2ZA 3EFXD 4C3IH 1J19A 2V4IB 2AEHA 3MC8A 1LXDA 4G50A 2K6DB 2MBQA 3IHPC 1F0ZA 5KGUA 2DZMA 4A3IG 1WH3A 2ZVOA 3M4PA 3BZCA 3CSTA 3WOEA 1N34L 2O5IC 3GTOH 1LM8B 1MVKA 2WWZA 2JWUA 1Z7TA 2N0SB 2DAJA 4LF8Q 3DUZA 1R4NB 3P7JA 4IFDI 4LNQA 4KHPL 1PRTD 3D3RA 1NJIC 3FILA 4BOSC 2MFIA 1V81A 1OTCA 4C80A 2EE1A 1O7IA 2MBOA 1KHIA 5BR8Q 3B0AA 1NBWA 2K05A 1PUTA 3HK0A 4BKTA 1IYJB 3PPAA 1EU4A 1KIXA 2MJDA 5IE8A 4EEWA 1PRTB 3R3OA 1KTKA 2M19A 5GROA 4B9WA 4A20A 1I50B 1LM0A 1ASZA 2PQAA 5L83A 1LT6D 1ZOYB 2PNHA 1E8YA 1SF0A 2I38A 2KK8A 3Q22A 2D62A 3AULA 4KVGB 2BOSA 3K7AB 2C35B 4KD3A 3NUCA 4ZK9B 3PHWB 4GS3A 1Q7YC 2OJRA 1PRTF 1KJTA 4LJPB 2ZNVB 1HTOA 2P5ZX 4KHVA 2F1MA 1JRUA 2L8JA 3T1YQ 3CIRB 3UE1A 1YN4A 3PO0A 1U4RA 3DEOA 2IX3A 4P1CC 3I8ZA 1P9DU 2F4IA 3GS2A 3PSIA 2B2VA 2J0JA 2ID0A 1LT3D 3PMFA 4DAVA 1FNUA 4KTAA 1JT8A 2JUOA 4KJNA 5C4ZA 4DV6Q 4PNYA 3T51B 5M3FB 3GTKB 1QUQB 2AYOB 1N60A 5IT9L 2WFWA 1WVLA 4WIPA 3VR9B 3UDXA 2IYDB 1DOIA 2KOXA 3E6ZX 3EFUA 2GVAA 2RKSA 1WGYA 1ACCA 2BB5A 1SMYC 4JI5L 3IBEA 3A4RA 1XXGA 2EYFA 1ZGUB 3SDLC 4LNNA 1YNJC 5IWAL 1YIWA 4DV1L 2E74C 1GB4A 5GQOA 1V9PA 3EQLC 1SJHD 4JG2A 2K1BA 1FYCA 3KBXA 4DR4L 2NBFA 1NBFC 4KHPQ 3HM6X 3VH3B 1IXRA 4HJ7A 2FCNA 3E0EA 1H9KA 1S5FD 4K2LA 5DPWA 1F1HA 3RNFC 1SN8A 5JH5C 4KY5A 3FHWA 2V3NA 1N32L 4N8FA 4TQ0A 1OEYJ 2L4NA 1D5MC 2BH2A 3FMCA 5C1ZA 1PFMA 2CCZA 5HY6A 5JZEB 4DGZA 3TQYA 2JP1A 4W9KA 2HIXA 2K5VA 4F8CB 3X0WA 2NBVB 5FO8B 2XSCA 2N55A 1HFGA 1N6ZA 1AN8A 1XPRA 1MFWA 1VDVA 3ZJVA 1KRHA 5FLXc 2NCNA 1PH1A 2GBRA 3V6EB 1M1KC 5H8YE 4GXBA 2KVRA 3ZTCA 2LMCB 3PIO3 1ENAA 5M5WB 5E4WC 4C4VB 2EYJA 2N9LA 2NZOA 3M9BA 1VQ6A 3NZUA 4HJ5A 4C00A 1LTTD 2MEKA 3BK1A 3DMUA 3QQ8B 4IQZA 2SOBA 3I91A 4X66L 2MSED 1LQBA 2KDFB 1C48A 4YSZB 4H7BA 3ZLZA 1A3UA 1DGSA 4R4TA 4YCUA 5M9OA 1R9TH 4HIKA 1FJGL 4A3BB 2D0OA 4MH0E 4HEA1 2KQ7A 4JBJA 2VUMB 2Y5CA 3ML9A 3KUZA 3IFDA 1SMYD 1F9QA 4K1RB 4A55A 1IYUA 4NMZA 2ZJQA 1L5PA 1VLBA 2JA9A 1YNJD 1SROA 4IN3A 5ELFA 5GAEC 2YEPB 1J0GA 1QVCA 4YY3L 5A2QE 1I35A 3UDIA 1VMPA 3K58A 5CR3A 1B9MA 1FD7D 2ASQA 2KXJA 1EY0A 2WXMA 3QCAA 2QDLA 2IX0A 2JN4A 4CHTB 5CV8A 1STEA 1S3SG 3NVZA 4GDLB 2EY6A 4AJWA 3MC0B 4JI8L 1AW7A 4JI5Q 2RMMA 4FXKC 1K9MC 1WI0A 1KXLA 3RNCC 5IWAQ 2K1FA 4IFDJ 4DV1Q 3HOXB 2N9XA 3M4YA 4GN5A 4A3BG 2YEPF 1YNTE 1K0SA 1Q1EA 2N9EB 4DHJD 1L0XB 1EY4A 2OQ0A 1O80A 3DHQA 5IYCH 2Q2UA 3CSFA 4HPPA 1L0YB 4OL7A 1A3TA 1TWHB 3T13A 3Q14C 1JWAD 5ELEA 1PGBA 2NTSA 5IYBH 4LNFA 4YWLA 1F2YA 1FXIA 1NI3A 2IO1B 1JE5A 1L1OA 1JWSD 2DUDA 1KABA 4PMBA 3J80E 2JA8B 1IKMA 4XDCA 1STBA 3NEMA 1N32Q 3I73A 2DZJA 2R2QA 3EUB2 4DHJB 1C9FA 4BY7G 3I5JC 4IALA 3NPPA 4LFAL 3EFCA 1A15A 2L15A 3I90A 1JQYD 3Q24A 1VQCA 1CZPA 1ZPSA 3ER0A 3NWSA 3TSSA 1R7SA 2M4NA 5CGKA 3IVFA 3P4PB 4F7ZA 5AZFA 4YWKA 3GTPB 1R4MI 2GBNA 1EIFA 1WYDA 3DVNV 3H7PA 4HJ9A 5AFWA 2WDVB 1Y8PB 2OEOA 1WTQA 4P1BC 1EY7A 3F2UA 2M8SA 4R9WA 2KEEA 3Q6BA 4KV2A 3S1RH 3ONSA 3ZNID 4KIKA 3R2TA 2DAFA 3GO5A 1IGDA 4CKBA 4CO7A 1U5KA 4MTKA 2K5WA 3GB1A 2WLBA 3RNGC 3WWVA 4M0WA 1I5FA 4X3KA 4YIJA 1N62A 4QAYA 3QIAA 3KF8A 1K8MA 3ZJYC 3WAPA 2F0IA 3H3VH 5BN3A 4X66Q 2V3PA 1DOKA 2WXHA 2QDBA 2LUEA 3H0GH 1HZAA 2K8BA 2X69A 2ZCBA 2CR5A 4OVVA 3NBHB 3M7NA 1CKMA 4ID6A 1EOTA 1SSNA 3CD6A 2KFJA 2XK5A 3MHZA 5ELNA 1STHA 1NCVA 2ASBA 4WWPA 3URYA 4GSWA 4IOAA 3DHHC 1XNRL 1D4BA 5EPJA 1CFMA 1X3EA 4J15A 1VF7A 4L5TA 1XMQL 1K8AC 2BWES 1K52A 4YY3Q 1F52A 2E3TA 5FLMH 2VY3A 3S1MB 2GI9A 4HJKA 2OCEA 1YMHE 2MX2A 1WJ6A 2KLCA 4XZ4A 3EA6A 1N9WA 5I6WA 3GZNI 1E22A 4A3IH 3UE0A 2J0KA 3W1YA 2LD9A 1Z47A 1AWDA 4IPHA 1TWGH 2PNRC 4ZRZA 5IYDH 5LNK1 1TWFH 2B2UC 1FVIA 1S5ED 3HHMA 3LJ3A 4A3DH 3P4QB 1V1PB 2BA0A 3GTGH 4K8IA 3RZOH 4YSYB 2FIDA 1WXAA 4FHKA 1C4PA 1LLRD 2FCMA 1R4MB 2F0PA 3SHLA 1XQQA 3HUIA 1VQEA 2CFMA 4P74A 5AUKA 4DV2L 1QWYA 3OTOL 3KF6B 5M3MB 3L0OA 3EN2A 1T6BX 2WXIA 4A3FG 3DLLA 2ZJDA 2JYTA 2VZAA 1NSNS 3CC7A 5G2NA 1NMFA 3EBEA 3T1HL 1Q10A 2A68C 2OXPA 3E9IA 4IURA 1HZ5A 1CKNB 4LFAQ 3STBC 1Y56A 2D5GA 2FCQA 4RNAA 2HUGA 1BO0A 1BF4A 1BMLC 3IAS1 4R4OA 5EBDA 3SK6A 2Q5WD 4KX6B 1VMCA 4E71A 1Q12A 2EXDA 4OO1H 3I70A 2Q8RE 5E6NA 3U2SC 2F52A 3TZUA 1UGJA 4EX5A 1STGA 2N1WA 2ZT9C 1JORA 2JQOA 3NTHA 3BYTB 4MGYE 1J7AA 3HG9A 3K81C 2JT4B 1RDPD 2PMZB 4LNIA 2K32A 3VRAB 4DK6C 5CV6A 2WQYB 2R7FA 2IY0B 5IP4D 3NTIA 4II3B 4BA2I 2BS4B 2BDOA 2JSVX 2DYMA 3BY4B 3MC9A 1UEBA 4IUQA 3GZNB 3N30A 3DOWA 2K04A 5I9PA 1YHBA 2Z1CA 5CC4A 1BR9A 3NENA 1PH4A 4MT5A 3GQBA 1PTOF 4AYBG 5IGGA 2Z59B 2LXCA 2WX1A 5AZGA 4N8X1 1C7YA 4OVUA 3GP7A 2Z6KA 4AIMA 2PPHA 5EAYA 1Y14B 1PYWD 3DHGC 1GHJA 1WCMG 1XMQQ 3SHQA 2MA9B 2DGYA 1L0VB 2PEAA 2H88B 4G7OC 2IW3A 1EUVB 3KYDD 2K5DA 4P73A 1Y1VG 1GUAB 2K8HA 2KN4A 2LGDA 5IAAC 2C5LC 4DR5L 2HD3A 2NZHA 4KI0A 4LFBL 2LGIA 1EFWA 3VTVA 4A8XC 2WXFA 1O78A 2KWVB 2KHIA 3CC2A 2MRPA 2IGHA 3AMZA 3P42A 2R7ZB 4DFAA 4CJ1B 1VRAB 2NVYB 3OAWA 3MXGA 4A4IA 4I6NB 4K7WA 4KY6A 1FCCC 2A68D 5J17A 1WJ4A 3U9SA 2INPE 3STBD 2KVZA 1WYGA 3PUYA 1YX5B 3WANA 4DV2Q 3OTOQ 2DLBA 2LUMA 4KGSA 1BUVT 1WE7A 3MXNB 2MHVA 4JYAQ 5C4XG 1E7PB 1XLPA 3IAYA 3APDA 3ML8A 4GGQA 4GLSC 3A4SC 4L63B 3TN2A 3U9OA 1VQKA 1MHXA 4RCOA 2MJEA 3GV6A 1AH9A 4YSXB 2F3WA 5IGEA 2B2YA 4LF9L 3P1MA 3K0YA 3HOYB 5E6JA 1CZWA 2MUYA 1LYLA 2W54A 3S2AA 5CBEE 4RGOS 2QF7A 2JYOA 5C3EG 1T5XD 4KJOA 2B29A 3TP7A 1RAXA 3D6CA 1HZ6A 2K7VA 4XQNA 1C0AA 4BBRB 2LVPA 5CHWA 2F0KA 2XWJB 1VQ7A 2EY1A 2Y0SB 3KK7A 1OXTA 1ILQA 4JW0A 1CMXB 1YNNC 4NXNL 2KMCA 3A54A 2N3SA 5KNCA 2A1AA 2NBWB 2BKRB 3AEAB 3SD5A 3HS0C 4EZLA 3OWFA 3BS1A 1SIJA 3AE1B 1FM0D 2IO2B 4C3IB 3AE4B 3CHBD 3KYHC 5LLIA 2JRIB 3GDEA 4ZRJA 1GB1A 2WNMA 2ZZPB 2GVBA 3LDZE 1TS2A 4K5XA 4OWXB 5K36H 3TEYA 2K5PA 1LTGD 2LMCA 2CS4A 2JA7B 3GTOB 2KJHB 2NVQH 2Y0SG 2ZCCA 4HIDA 2GBKA 3B2GA 3X3MA 3FAHA 4XGAB 2DJFC 1KRTA 1E5WA 1WFQA 2AMCB 4OWTB 1KD1C 3I4MH 3V60A 2I07B 2EDGA 3L08A 4N9TA 3QJYA 5GAGC 1ZYRC 3F2CA 1NAPA 4PS3A 4OELB 3T56B 4CJ0B 3U4VA 2MNAA 1G51A 1ZDXA 2WXOA 1WFYA 2NWGA 1TJEA 4DR5Q 4LFBQ 3PO2G 1BUIC 2JYEA 3H7SA 3V6CB 1PDQA 3KQ4A 1E10A 1Y8NB 3J80c 4WURA 2MP1A 1E8WA 2KFKB 1W6KA 4GLAC 1P16A 4KK7A 3S15B 4L5QA 4FXDA 2HDLA 1Y8RC 2WS3B 3W1GA 3LWUA 4DK5A 3UF8A 4BS9A 4BA1I 2E2IB 2LASA 3C8YA 1L2NA 2B2WC 1OQRA 1SFOH 1LTID 1IUEA 3N20C 1V8CA 4IDIA 3CP0A 4L8JA 2Z4IA 2B63G 2MQHA 1QT9A 4QUCA 1CHPD 1WTXA 5IO9A 2AWOA 2Q2IA 1DOLA 3GE8C 4ZHPA 1XCTL 4S0RA 2GBMA 2F0MA 1TKGA 2QEXA 2A8VA 1VZ6A 2GB1A 3A0JA 4JGHB 1K83H 1S5BD 4LF9Q 2BDNA 3AEVA 1WJUA 1YNND 3KLSA 4M1UB 3Q8EA 4AJYB 3T53B 4DHZE 3B6YA 4ALPA 3ICEA 1UWXA 1HEZE 1DZ1A 3CCLA 2JA5H 4LF6L 1ZXTA 3ALBA 1H9RA 1RD9D 3MEHA 3NWTA 2EYLA 1CQVA 1WZ3A 4NXNQ 2YTVA 3HRZC 2D07B 3WDNA 4BY1B 2BS3B 4K2KA 2K3UA 1WGDA 3R3MA 4II2B 2ENBA 1AP0A 2LI5A 1FL0A 2J0TD 2F0EA 1X6OA 4MACA 1RFAA 1IW7C 1MI2A 4P2CB 5LL6S 4WJPA 1W6JA 1TKEA 2JY6A 3TEXA 1UELA 2PLPA 2B3AA 1ZYRD 4HCNB 5JXVA 4IW0A 1J9OA 5HI1A 2LFNA 3RN2A 1NE3A 3E9SA 2UU9L 1JR0D 2XVSA 1CT1D 1E1OA 1XO3A 5C5MA 5BYQA 3VTUA 1G2TA 3SVMA 1S5CD 1LT4D 4W9DA 3AE3B 4CDFC 2H89B 1C1YB 2BF8B 2WXKA 5EDSA 2HJ1A 4GOPA 3OMCA 2WB1E 5AEKB 1RHPA 3T16A 2NPTA 2ICEC 2V0GA 1U4AA 1LFDA 2MPMA 3LX0A 2CWAA 1RIPA 3PF4A 4HJGE 2HCIA 3I72A 3S1QH 4ZHOA 1PFNA 3EIVA 4DK0A 4O0AA 3B08A 1ZXIA 3S1NH 3P75A 2I1KA 2M17A 3HKZB 2E5LL 3A5ZB 3NVWA 2M1MA 3L17A 3VTWA 1VZ8A 2OEDA 4C3JG 3GTJH 2UXDL 3ZRFA 1P8LA 1G6ZA 1GJXA 2FNJB 4A3FH 1GKHA 3ZDTA 1KLUD 1N33L 5C0XG 3RN9C 5DAUA 3QOLA 3NQTA 3VA5A 2XNAC 3AM9A 5DEHA 1MJCA 2E8GA 2EELA 4H44C 4K5WA 4V0BA 1XEEA 4EKUA 3H3VC 2EJMA 4FNFA 3U8ZA 1C78A 5CMDA 4Q5VA 5EGTA 1CA6A 1PGAA 3U50C 4GKKL 4P16A 2CJNA 4EQOA 2CHBD 3DDCB 4HIOA 3I3CA 1R9TB 1WMHA 1WJJA 1YN3A 2KEDA 2K14A 2ZTDA 3PCOB 4LF6Q 1RL2A 1SIFA 2DNFA 1TIFA 1UE1A 1IW7D 2PJHA 4WJQA 3S2DH 5JAVA 3A9JB 1WR1A 3BYYB 3RNAC 2DX5B 4BZAA 2J7QB 2HQEA 1PDXA 3H3VI 4TV3A 1NYRA 3V3XA 2N4FA 3RZDH 1G91A 3VHTC 4CQNA 2KJXA 2RDGA 1S4ZA 1BKBA 3N9YC 2LRWA 4KGRA 4OVZA 5ELBA 1HA5A 1R4QB 2PW5A 1WCMH 4FP5D 2K28A 3ZTDA 2UU9Q 4R8NA 5C3JB 4Q0FA 2XRSD 5K5PA 3TDQA 1EY5A 4DKAC 1XTCD 3J81L 1PHJA 1NNXA 3S16H 1Y1VH 3EGRA 2JEBI 1MKHA 3MHBA 3H8HA 4LK0M 2IDYA 1MIUA 4I7ZC 5A35A 4B3ML 1C76A 3HVDA 2CQAA 2HIVA 2LXJA 4FF4A 4K81A 4WJ3M 4QIWB 4WAAA 1Q81C 4DUYL 1YOVB 2JXTA 1XX8A 4IWOA 3I7FA 1GVPA 1YVCA 2KMMA 3D6WA 3DBSA 4C1NK 2DHZA 2F0DA 3I4NH 2FUHB 2C9OA 3VDZA 3X23A 4B0EA 4CGYB 2E5LQ 2LEKA 3UI3A 4AOFA 2WKDA 2F3IA 5IYCG 4F8MA 4AUQC 3MEFA 4PMWA 1XF5L 2Z4HA 3W2DA 5C4XH 2A74C 2ZTCA 5FO7B 2UXDQ 1NENB 2D11A 3C19A 3IAM1 5IYBG 2MO1A 3S1RB 2HCCA 3JAMi 2G1EA 4MEMA 1EQVA 5CHFA 4HR7B 3PV1A 5GAHC 1FEHA 3HVZA 4JQWC 3U30A 1LO5D 2XIWA 1A6XA 2J52A 1I4HA 5JOBA 4HAEA 1SNPA 3HM3A 5C3EH 1XNQL 2N9KA 1DCZA 2UUCL 5LL6X 1ML0D 3DWMA 4K7SA 1FR3A 4E6IA 3M3JA 1RJTA 3QOJA 4OO1I 1VQ9A 2QJLA 2MCNB 2CHZA 4GKKQ 4WRDA 4QUFA 2KTRB 3VYRA 2RSUA 1S72A 1WRDB 3AFPA 3MVVA 3S2HB 4FF1A 2EVBA 1JMCA 4JCVE 2SEBD 5JHAA 3W3AA 3W1SA 3MJ5A 1GC7A 3HZXA 1K8RB 1KF6B 1RFKA 1FFUA 1V9JA 4LWCA 2I5MX 4A3IB 1H9MA 1T3QA 1TWGB 4WWNA 5M5YH 1TWFB 1I4QA 3H0GG 4HCSA 1K50A 4LAAA 4ANVA 2L9HA 2PZUA 4A3DB 2BYFA 5FK9C 2M0XA 3K80C 5MPOA 2KTFA 3VA7A 4PS7A 4RGNA 5IGBA 3GV3A 2NR2A 3GTGB 2F0GA 3RZOB 2B39A 1QZEA 2JQRB 1YJ1A 3PUWA 2JK8A 1PH8A 3HOVG 4DBGA 4DQOC 2MBBB 3SXHA 1ZP0B 1MG8A 2BWFA 5FLMG 4DK3C 1IYVA 1N8RC 1A3VA 2AWNA 4B3MQ 2MJ8A 5TSSA 3PO2H 1JC7A 4JOIA 2ZXPA 2BYEA 2Z8LA 2M56B 1BT0A 5J22A 1JMLA 3RN5A 5H92C 4DUYQ 1MPEA 4ANWA 5IYDG 2BE5C 2A4ZA 1VQGA 2YLMA 2BT6A 4A3DG 2WDRB 1PGXA 3ULJA 1NVID 2LVQA 4TVAB 4JWUC 1UE6A 5CV4A 2RCFA 4EOYA 3DWAA 5DM73 1N5XA 5BMHA 5HGTA 3ECIA 1F2RC 2E6XA 4H02A 2B63H 2Z9HA 1LABA 5JJZA 3CCSA 1KAWA 3KLRA 4WWMA 4KGTA 1MGSA 5EPLA 1ILPA 1L7YA 4ZDVA 4GMVA 4FF2A 1GUWA 3JVZX 3VR4A 1UH6A 3AMUA 4JI0L 1SDFA 3VXWA 3NQIA 1BOSA 1XNQQ 3GTLH 2JU6X 4AH6A 2UUCQ 3B9JA 2AX5A 2ON8A 2WXRA 1Z9FA 3J81i 4OO1G 2LJ5A 2G4DB 4LF5L 2BH8A 3BDCA 3J7AV 2FFKB 2WDQB 3JSVB 1F2RI 5AZHA 2YVCA 2WACA 3W5OA 1KDBA 2VW9A 1VJKA 4RG1A 2XTIA 4X57B 4OEMB 1YD8U 3N6RA 1WTWA 3AU7A 3BDLA 2E2DC 3VYTA 2IT1A 3RUZA 1VQ5A 5EJWA 5IOIA 2UXCL 2RQXA 4FHJA 5BMIA 1OXXK 2K9XA 3CC4A 1LT5D 3RMHA 2RGFA 5C3WA 1SNDA 4X64L 3I4OA 4FLHA 1DOYA 2NZ1D 3WIMA 3KW5B 1QILA 4RKLA 4LTUA 2KQ3A 2A5HA 1UE7A 3A8IE 1X3QA 1H9SB 2EY2A 2QSDA 4FN2A 2LSSA 1LTRD 2JSOA 4MHEA 4IKGA 4KSKC 4MH8A 3U7DA 1E8XA 2BE5D 4DR6L 2V3SA 2L0FA 5EKLA 1FXTB 1ZE3D 3UQAA 4GKJL 4NDXA 1P7FA 1G291 1F9RA 3MA2B 1BBXC 1YJNA 1QNKA 4XDXA 4GZYC 4ZRPA 4IM0A 4L6TB 4XWWA 3AU4A 4OW0A 3HGBA 3KH0A 4YT0B 4LW1A 4P71A 3WCQA 5C23A 1LTAD 1CUKA 2M9VA 3MWYW 4C3JH 2HJ8A 3L7ZC 1MHWC 4KD4A 4Y7NH 1X3GA 3BG3A 2K8CA 3K59A 4IJHA 2VNUD 4GDKB 1G6JA 2AL6A 1DXMA 3NXWA 5C0XH 2LXAA 2L0CA 1RLFA 4N9PA 4ZKCB 1B50A 1I4PA 3ZGZA 1E8ZA 2MBHA 1SYCA 3O13A 1GNUA 4DXFA 2Q2HA 4WWOA 1UBIA 4PYZA 1JOKA 4URKA 3SK5A 3E56A 4TQUS 2J4XA 2N9PC 1AEXA 4JI0Q 4AS1A 1BBUA 3DHIC 1C4QA 2KT7A 3GE3C 3T3NA 4KDLB 1U9RA 1Y69U 3H9DA 2EYHA 4LF5Q 2K4KA 4G0NB 1SSOA 3HOZG 4MM3B 4A3JH 3OIPA 4DAYB 2AQ3B 1AE2A 1WGRA 2KNBA 1HNWL 4BAXA 4EGVA 3I4MB 1K8GA 1E2VA 1VQIA 4HIMA 4A3LH 2I1JA 3VUXA 4RKBA 2EMTA 1YJWA 2EQSA 4OHJA 1ZUD2 2B3GA 2UXCQ 2C9WB 1DOXA 5L95C 4NY0A 1IBXB 4Q2JA 4DR7L 3AB5A 4GB9A 4X62L 2CU1A 1S40A 4X64Q 2NBUA 2B8FA 2AQ2B 2INDC 3KWLA 1JB7A 2LRUA 1H9JA 3GTMB 5K36G 2K33A 3DBHI 3R8BA 2G9DA 1X32A 5DPRA 1M90C 5A2QL 3A9JA 2WP8J 4NQKE 5E7NA 1I3QH 2N7EA 4UPAA 1SE4A 4DR6Q 2LGYA 4F88A 3I4MG 1B9NA 3MXUA 2PTLA 1SFOB 1WX8A 4GKJQ 4BY7B 1FD6A 2N1VA 1HZBA 3R2IA 4X6AH 1OGWA 3AE7B 4FADA 3QX1A 4KKIA 3ZO5B 1UAPA 4J6HA 1XJVA 1HQMC 2WAQG 2BYVE 4P7IA 3ZJTA 2WDTB 3TJPA 1E3PA 1UF0A 4LCDE 2Z0DB 3D4RA 1K83B 4IUMB 4HVBA 1CSQA 2L83A 2BA1A 1VR9A 4FULA 1T5EA 2RDBC 2PIAA 1TS5A 2OWOA 2O6VD 3J80L 2OOBB 2CU3A 2JA5B 3VR8B 1KM7A 2JEAI 2IHEA 3A8KE 1TKYA 3LGJA 2RPQA 2UYZB 3TMPB 2IY5B 3NP8A 1FRDA 4XQQA 5HGQA 5E4XA 5JEAH 4GNXC 5JJLA 1N61A 2KQSA 1XMOL 5F2DA 3ZXVA 1PLFA 2O6VB 3A1QB 5E1FA 1SMXA 3FP9A 3KLSX 4A3OA 1WOCA 3PLUA 3PREA 1RTNA 2I5HA 3DVGY 5D94A 4NAWA 2FIFA 4R8IA 1STNA 1D1KA 1WTVA 4KSLC 3QWNA 1EQTA 2EOTA 1TT2A 2MP2B 2PW7A 4BBSH 3K57A 2X6LA 3DBHB 2JA5G 2LHDA 1UE5A 5DCNA 2RDFA 4IOIE 1HNWQ 2LS01 3ERQA 5IP7G 3J7AF 4ILWA 3H91A 3MP9A 2F0QA 1MI0A 4RF1A 4A9AA 2YU9H 5IKCM 4JE3B 2L55A 2GLSA 2B2TA 1WWTA 1K51A 1FGBD 3CRKC 4DR7Q 2R93G 3RLFA 4JVZA 4X62Q 2KDIA 4B9XA 1H95A 3D31A 5NUCA 3S1QB 3I4LA 1GUSA 2MGSA 3HOVH 2Y5PA 3S1NB 3TCAA 1WYWB 2I46A 2D0PA 3EROA 1WXMA 4IUTA 3CU7A 3GTJB 2KC1A 1C77A 1J8IA 1B53A 1EWIA 4A3FB 1HUNA 2ONQA 4HMIA 3QO2A 4K14A 2E2JH 2PI2E 1AFPA 4KKTA 4XIGS 1EWYC 1L6UA 1P98A 2IPKD 4UP7A 4POFA 1CSPA 4C1NI 2C60A 3ENEA 4D2KA 4MGZE 3GTQH 1TQOA 2VS1A 4YCVA 3S9WA 1KQSA 2FBWB 3SFEB 1Y1WH 2RCNA 3EVQA 2D3GA 3K7UC 2DYBA 3AE9B 2I0QA 1FXAA 3NUHB 3TBIB 3CCRA 1CTMA 3P63A 2N7DA 1J7CA 2L05A 2R2OA 3FC4A 3N3KB 3KFUA 4F7XA 1T9HA 4ARIA 4JYAL 4BOZB 1MHHE 2YTYA 1IL2A 5I4DA 5LMNL 1QVGA 1E2WA 4EZJA 3A9KA 4DXAB 3S2DB 2MH7A 3I63C 4GNXB 3D0FA 2KWDA 2O2LD 1XMOQ 2RBMA 1HTPA 4A93H 3UDGA 4AYBB 1RODA 3K9PB 3RZDB 4C2MH 2OT2A 4QJFA 4OXPA 3I3TB 2HTME 5CV9A 4HEDA 5EE0A 5I9OA 2VZKD 4BBNC 4ULLA 4DAMA 3VDYA 4NPSA 1JWMD 3HKSA 1WIAA 1VQDA 2RSNA 2A73B 4NXML 1WCMB 3EECA 1HZCA 3C46A 4LLGM 5COYA 3ZUNA 2GN5A 3S16B 3OW2A 3D32A 1Y1VB 4DK1A 3NK9A 3RD2A 2VZKB 2J7ZA 4ZUIA 4CBVA 1EIYB 3HOUG 3MJWA 4NPNA 4GU2A 5I2XA 1SNMA 3VFKA 4EUTA 2O2VB 1Q8KA 4W9GA 4RH6A 3QWZB 1LTSD 3J9CA 1JICA 3HOWH 3I4NB 2X6GA 2EJGC 2IWHA 5D3DA 4X65L 5D3IB 3OMGA 1KLVA 4FYDA 4R1JA 1I50H 1CJEA 2KCNA 1OXUA 5C4XB 2IBIB 3AH7A 4QB4A 3KJPA 4HSPA 5GMVA 1JQ4A 3PSEB 2DYOA 5IT9c 3FVQA 2XGTA 1YJIA 2W55A 2QIEB 4M02A 4WQMA 4OONA 3KYCD 1QUQA 1D6EC 3NG0A 1XD3B 5HFYA 5C3EB 2L7RA 3I4NG 1QQRA 4KKSA 4MJSB 4K6DA 5JPNC 3L13A 1SEBD 1RRBA 3CF6E 1KNAA 3KDFB 3WALA 2ZM6L 3S17H 2QA4A 4CDCC 3KUCB 3R7QA 1OQQA 2EMSA 1XPOA 2TMPA 3H09A 2J42A 2BQQA 5LMNQ 1PH5A 1P0RA 4C7YA 4B95A 4APVA 4ZKBB 3N1XC 2K6QA 2ZXOA 1WZ0A 2Z6BA 4BKSD 5D2MB 4YWGG 4RGMA 4IPCA 1A62A 2PZWA 4HMJA 1S5DD 2A6HC 3DWQA 3HKZE 3HOZH 1V43A 5M5YB 1O7ZA 1GUTA 1MJDA 3P2BA 2W3SA 1NY4A 1ZXHA 3C0RB 2E2HH 1GO3E 2K5QA 1YBYA 3OOCA 2CH4W 2H5XA 2ICIA 1CK1A 1V8QA 2K52A 5L37A 3I56A 3C2PA 4NXMQ 4FO2A 1WI5A 1M94A 1WE6A 4ICUA 4HKQA 2KCMA 1SR3A 2W82A 2D3CA 4UAIA 1F2LA 1PFSA 1W2BA 3N1ZC 4REZA 3QR8A 1E7VA 2VXWA 1V80A 5J18A 5C2TB 3PO2B 1XPUA 1EOVA 4BBNF 1WD0A 3NVYA 1KFYB 3T9LA 4C4VA 2B2VC 3DBRI 1BXTA 4IPDA 4B3TL 3H6MA 2V4DA 4IG7B 5I2YA 5BYRA 1PXUA 4X65Q 3G71A 1FNVA 2VB2X 2FE8A 2E76C 1GJZA 4L23A 1C3TA 4HDOA 3TP6A 2EXZA 3BDOA 2B63B 2OJWA 5J2RA 3FPUB 4CDEC 1FGUA 2A6EC 1QNUA 2O5JC 3BVZA 2E75C 4A3PA 2EPBA 4TQ1A 2OF1A 5M5WH 1MSHA 2F0HA 2RVLA 3E9HA 2Y5BB 3AEEB 1YN5A 2BBCA 4B9KA 3GTLB 4J6IA 1MSGA 2CW0C 1TT5B 3PTFC 1V1OA 4GDLA 3FILB 5C0XI 1Z6HA 2KENA 3GD7A 3OPOA 4ZCKA 1QOAA 1O7YA 1XWEA 2I5LX 2ZM6Q 3BVMA 3FDTA 4B3RL 4XT3B 2ZJRA 1GOZA 3AE8B 5DNFA 4K0KL 2KQ4X 2A6HD 4YHHL 3IT4B 2LHEA 5LXHA 3QC8B 2WX0A 3BJUA 4QL5A 1SJED 4QIWE 5C44H 2NUCA 2DWQA 1PYSB 4IWQA 2PQAB 2NVTH 3QHTA 1GUNA 1WF9A 3OW7A 1WTPA 3OJ3A 3NY5A 1DYQA 4PT5A 3ND8A 1DONA 3DBRB 1XT9B 3QIJA 5CHVC 2RHSB 1IBML 1WM2A 3PIOA 4A3MG 4CYEA 1X65A 5IP7H 3E0JA 4RAUC 4N6EB 4M01A 4WJ4A 3HOXH 2ZXRA 2F0OA 2PCFB 2KDMA 4YCWA 3Q3JA 4DR3Q 4A3EH 1OXVA 3CCVA 3D8GA 1KC8C 1FCLA 2R93H 1T0YA 2KCCA 1OO9B 2L52A 5JJKA 1UD7A 2VH1A 3VVWB 1H4RA 4MN3A 5DLQE 3A74A 1UWMA 3I57A 5CBAE 2IO3B 1SGHA 2V4LA 2A6ED 2AKWB 3TEHB 4B3TQ 1XCQL 1SRUA 4C3JB 1QOGA 3DM3A 3CCMA 2CJOA 4Y7NB 2KJRA 5HKHA 3A55A 3ERSX 2OHFA 3KBGA 2H1EA 4ME3A 4NB3A 1MG4A 3MZ5A 3NBHA 3CXCA 3AU5A 1HTLD 4WAFA 1UWVA 3AYHB 3JAME 3ZJUA 5GADC 3PRMB 2CW0D 4RHRA 2C7HA 4HPLB 3L54A 4MGIE 3B2FA 1E7UA 5CYUA 4J3OD 1JWUD 2HE7A 4UHVA 4PV1C 4U673 3VYUA 4GIVA 2L32A 1HHVA 2ZEQA 1TZ1A 3CQZH 1YJJA 2KDEB 3B1LX 3RZWC 2K03A 4UP9A 4K3CA 1A2UA 1QF6A 1VDZA 1AYFA 3V62A 1YX6B 2WXLA 4QF4A 1PV4A 1VQNA 2EJFC 1L1OC 4ZLTF 4JL9A 3G6EA 2F0UA 3LNNA 2NVXH 3PQIA 4B3RQ 4F1SA 1V1PA 4FDBA 4A3JB 1TZOA 5D6JB 4YXDB 4K0KQ 1F9JA 4YHHQ 2JVCA 1VF5C 1L6VA 4LUVA 2JA6G 1NMGA 4LUOA 1KRSA 2KWCA 1RTOA 3DXJC 3TZDA 3DQVA 4NZLB 2FMCA 3TMEA 4ZRIA 4TUUA 1HR0L 1L4DB 3KF6A 2G45B 3H6NA 1QOFA 1UZXB 3VUYA 3KVFB 4YTPB 1EFID 1IYFA 3BVGA 1IBMQ 1CKNA 2KHJA 3MXPA 1J5EL 4ANXA 3BZKA 4GNXA 4B08A 4A3JG 3PF5A 5FLXL 2G3QB 4MTNA 4AP4C 1IZ6A 2KJ6A 1I3QB 2KX0A 3HOUH 1SYDA 4UDUC 3MFGA 3PVLA 4A3LG 3NELA 4OZBA 3OG5A 3RULA 1HUMA 4ASWC 3H94A 3OSOA 1E9MA 1VD2A 1IPGA 4JWSC 4HKZE 3DWPA 1ASYA 4A3GH 2R61A 4R4CA 1TY2A 2MHJA 1ICFB 1EZ8A 3GOEA 2CHXA 1EZ6A 2KA7A 2RDHA 3X3NA 1QKZA 3APCA 4DWFA 5EQ0A 1GAQB 4KN4C 1FNWA 2KECA 4BXXG 2MBEA 2JZZA 4HPMB 5DPSA 1TS4A 3E3XA 4DV4L 4X3TA 1J8CA 4RWSC 2PE9A 4IM2A 1EO6A 4V190 2JX5A 3Q8CA 5KYLA 3DEPA 4NNJB 4XYOA 4NJCA 4DA2A 2FJ2A 3TEZA 1QZGA 5D14A 1Z5SB 2M2LA 1PTOH 1Q90A 1RYJA 3NTKA 4UY8C 5M5XH 3RZFA 2LJIA 1EQRA 4EZKA 5C0XJ 1RWSA 3LWEA 4JI3L 4JK1C 2KHSA 1GPXA 1U4PA 3J81E 1X1MA 3DPDA 2WXPA 1I94L 4H0LC 3AE5B 1KAAA 2B2UA 2MW5A 3Q2AC 3E5SA 4BBSB 1L1OB 2JF5A 4HK2A 3VH4B 3SR1A 1L2FA 5BN4A 5HHDG 1E6EB 1P7EA 3U58A 1E0BA 3KWVA 2LKVA 5JEAG 3SFDB 3UIOB 3V61A 2DNEA 4DNTB 4ARCA 3RUIB 3H0GB 3RD4A 5JVG3 1I7HA 1HR0Q 3W5UB 2J53A 3MXNA 2KVMA 5CORA 3H7PB 3DVNU 4G7HC 4JBKA 1PH7A 2UUAL 5JJIA 1CKOA 3TP5A 2BB6A 4I6LB 2CWPA 3ULPA 3HOVB 4KIKB 1YQ3B 2Q2TA 1J5EQ 4BBSG 2WGSA 1ET6A 1EM7A 4TKOB 4R4IA 3K9OB 1H8CA 4DV5L 1ONLA 2XWBB 3V05A 4G11A 2HDEA 2G5DA 4DF7A 3D4DA 3Q8AA 1WR6E 4JI6L 4M0WB 4RCNA 3TUOA 5FJ8H 2N78A 4EQ5A 4JV5L 1JW9D 4L2YA 3KF8B 5T1GA 1E2ZA 1D7QA 4MNOA 4OIJA 2PVGC 3W9CB 3P4RB 3QJZA 3GTQB 2BTEA 4G7ZC 4N9F4 5KNDA 1Y1WB 2PI2A 2XK5B 2SNMA 4KMUC 1YNXA 2Z6KC 4PYUA 2DY7A 4KN7C 3I55A 4ODGA 3VRBB 1EY6A 2L12A 1VQLA 5KIXA 2WHIA 4U68A 4DV4Q 3RMKC 4PZ7A 4OZAA 4DR2Q 2OQKA 3IXSA 3SR6A 4IO9A 1WXQA 2EKEC 1HE8A 1E7ZA 4XX5A 5GXGB 2K01A 4US9A 2J0MA 3BK2A 4S3SA 1AE3A 2PPBC 4FBJB 5IN7A 4HJ8A 3N52A 1Q82C 3H1UA 4LUZA 3M4OH 1VCIA 3P1HA 3S24A 4JI7L 1PFDA 4IC7B 4ICVA 3RFZB 3VQIA 3ITPA 3CCJA 1Y1WG 2XEWA 5ELOA 4A93B 4JI3Q 4IOCA 2WB1G 5EPKA 4C2MB 3Q69A 2UUBL 2D2QA 3ND9A 2K22A 4LK1C 4KKUA 1KDCA 1XYIA 4MSMB 1IKLA 1I94Q 2BCOA 3PZ7A 2XRQD 3F1ZA 2UXBQ 2OTLA 4I6PA 5JEAJ 3PUVA 4ME5A 2FCSA 5IP9G 4ZRKA 2RF4A 2KFKA 2K5NA 1FO4A 2JA7H 2IL8A 4AQYQ 1HFNA 5EKIA 1PZID 1SAPA 2B2YC 3VR5A 1WTHA 4LF4L 4FF3A 3CMAA 4DV7Q 5C5LA 4XQJA 4A93G 4MSQB 4A3MH 4LMQD 2L0TA 1HPCA 3CMEA 2KD0A 4DDID 4O2DA 2A19A 3IRBA 1PMRA 2UUAQ 3PT2B 3HOWB 4JPBW 1QB5D 4OIKA 1VZ7A 1ZW7A 4ITKA 3ZNZB 1LGRA 1DM0B 4PQXA 2KKCA 4WJNA 1KDAA 4M00A 2EYPA 5CV5A 1Q1OA 1V1QA 3L10B 4DV5Q 1LTBD 1E0ZA 4LF7L 2DNCA 1QOBA 3ZDMC 2F3VA 3S15H 1VQFA 4JI6Q 1QJOA 1GHKA 5IGCA 3F2BA 3G7LA 4IZ8A 1ZDVA 3VR3A 3FKYA 4JV5Q 3KUDB 1EF5A 4IPGA 2E2IH 1WX9A 3M85A 4PS8A 3ZXRA 1E90A 1HCZA 4NP5A 2QC8A 3R66C 4C56C 3JAMc 4W9CA 2BYTA 3ZQ4A 2QCPX 4HLEA 3CCUA 5T1IA 4ABNA 5KYIA 3HOWG 2R7DA 1E24A 3DWGC 1TVXA 2JE6I 5DM63 2HQLA 3J7A5 1NI2A 2UWQA 3PRZA 1SYGA 1T0QC 2OTJA 1K8OA 1SE2A 3S17B 5FR6A 1TWAH 5J39A 1I42A 1C8CA 1B7YB 1K3RA 3PUZA 2WINB 1HRJA 1B44D 2ZTEA 4DV3L 4WH4A 2WP9B 2VQFL 2HDMA 3SDZA 2NN6G 2F0TA 1MD2D 4JI7Q 3J81j 4KHZA 4A3KH 4HCEA 4K3BA 4RM9A 3TS0A 2RSOA 4BY1H 2HD5B 2GA4B 2SNSA 3HFZB 5IT9E 3R93A 2ZW0A 5LMNW 4ZYSA 2UU7A 2UUBQ 3HOZB 2IHFA 4IWPA 5KNBA 3QA8A 2E2HB 1JJGA 4R3DA 2RPVA 3C3LA 2JA6H 1B70B 1X54A 4BWGB 2N49A 1C9OA 2F0LA 1N34Q 2D9UA 3CW2C 1XLQA 3U4EG 4C3HH 4PG3A 3VAWA 2PW9A 4GN1A 4IUPA 4K5VA 4IFDG 4LF4Q 5IGFA 2B2WA 3G4SA 5M3FG 5C6AA 2CHWA 3WA0A 1I4GA 1HZ9A 1VQAA 2NMQA 4K6LA 4HTHA 1EY8A 1TWCH 2DY8A 2NVQB 1T0SC 1DJRD 3CAMA 3FEWX 2L00B 3MHSD 4NAMA 1OTRB 1K0RA 1Q46A 3C1FA 1PA6A 1GC6A 2QHOA 4OZCA 1GG3A 4M8AA 5BO4B 4W9LA 2KYWA 4DU9A 1BCPC 3S14H 2K5HA 2FAZA 4LF7Q 3K6OA 4QY7A 3ONAB 1I6HH 2L5TA 3PHXB 2SDFA 5E6OA 5C4JH 2IZVB 1SYBA 3RI7C 2VRRB 2FXQA 5C3XA 4FXCA 1TYGB 2CKHB 3Q3OC 4XXEA 2WAQB 1PFBA 3DBLI 4HWIB 3OHXC 5IODA 4GLXA 4AYBE 1CQFA 3AV8A 2NYZD 4BXXH 4OWWB 2M0AA 3L4PA 4A6QA 1EUJA 4HRSA 1J6QA 4W9FA 1F9SA 1Q0WB 1M8AA 3VYSA 4B3SL 2AL3A 2PMZE 5EBCA 3ETRA 4FXGC 4GOPC 5D7GA 4YL8A 4X3SA 2IGGA 2L76A 3CKIB 2AQ1B 1TS3A 3J81c 2KLGA 4JC0A 3CCEA 4CKEA 2MLBA 4DV3Q 1ENFA 4I7AA 2VQFQ 3RT3B 2M00A 3A5UA 3AE6B 3G6JB 3PIPA 5C44B 3LYYA 1G6PA 2EYOA 1PH9A 2L1AA 3AEDB 1C4AA 1JWBD 4XYCA 1ET9A 1WGHA 2QCZA 2NVTB 4QCLA 1Q86C 1ESFA 4ZQ3A 4JBMA 1ESRA 4ANUA 1SYFA 4FJZA 1Q1BA 4LNOA 1TGZB 1G2SA 5BN5A 4ZOHC 2F4VL 1CA5A 2L1BA 3TS2A 3RNBC 2JZPA 4O1NA 2VUMG 2PQEA 1VQMA 4A3EB 2XN9C 1D5XC 1HNZL 1U0LA 2G9HD 2NB0A 3P20A 4XYQA 5C44G 2R93B 1RM6C 5G5HA 4DR4Q 5CV7A 4YWMA 3RNUA 1SE8A 3A56A 3IG3A 1XLOA 3ZKJC 4A90A 3MFYA 2BVCA 3DBLB 4B6WA 1BCPD 4POGA 1OFFA 3M3YH 1QVFA 2F03A 1Q5WB 2WXNA 3PRPB 2IX1A 3ABVB 4HN7A 2JRHA 2F0SA 3JYUA 1HNXL 1TKWB 3RLNA 5HURA 3IT6B 4MZ9A 3HOXG 5JHBA 3PO3H 4K8JA 1BCPB 5DPTA 4DPGA 4A3EG 3ZNHB 2DN8A 1RF2D 2KTRA 3Q3NC 1STYA 1M4VA 3NHHA 1SE3A 2ZPYA 4OX9L 1V5OA 1JB3A 3ZIMA 5J3BA 2R92H 1Q3LA 1PTOC 5EKKA 1T0RC 2Q8TA 4AWJA 1VCBA 1X3PA 2JA8G 3NOBA 1G8ZD 3Q8DA 4DR1L 1AZPA 4IUUA 3NS1A 2K39A 2Y0SE 3CQZB 2D2CC 1EF1A 5CTRC 1BCPF 2QW7A 4B3SQ 2EKIA 3RNEC 4F87A 4WFN3 1D3ZA 4W9EA 3IL8A 1GXDC 2CQOA 1CI3M 2EY5A 1QZHA 4XE0A 4GOPB 1QCBD 2QGQA 2NVXB 2NPTB 4C7ZA 1DGJA 2QKIC 1L0WA 4AQ7A 1FJGQ 3V96A 5IIFA 1YHQA 3IFWB 3NJTA 2NTTA 4H2AA 4E74A 4ZRQA 3UGBB 2W3RA 3S2HH 1QLBB 3FKIH 3Q6SA 2F0WA 1XTDA 1X3FA 3RCZA 1TR5A 3Q8BA 1IBKL 2WU5B 3L9AX 1U4LA 2K6AA 5FO9B 5KEEA 3K5MA 4LNKA 3AFQA 2L3ZA
chains in the Genus database with same CATH topology
5D65A 4NW2A 4WORA 5C4HA 2I2YA 1FIQA 3D4WA 5ELCA 3IKJA 1PZKD 3HOUB 1NR4A 1B3AA 5KRUA 1RCVD 1IL8A 4ZAIA 4HSVA 2KACA 5EE9A 3NE5B 4A3GB 3AEFB 4N59A 3LB8C 5FKAC 1JOOA 2BW2A 3BZDB 1PTOD 3C1EA 2GRIA 1N5WA 3A8JE 3WOFA 5EE3A 2N88A 2AUJD 3VR2A 2AUKA 1N63A 1AZQA 4J1MA 1PTOB 2ACZB 5LHY1 1C4CA 4A55A 5M5XB 3K5OA 2X38A 1TY0A 1CM9A 2Q8IB 1QG7A 2YYZA 4KY7A 1EYCA 2R3ZA 5IGDA 2NN6H 1NEKB 1H9SA 3V2TA 1DD2A 3OIQA 2A69C 3CWIA 4RF0A 4PMCA 1I4RA 1JOQA 1II3A 4RA8A 1Y8OB 3NZ3A 1UNSA 2QEJC 2H4OA 3U52E 3SEBA 5I6YA 2BS2B 4IFDH 2B76B 2KOLA 3J7YW 1B1ZA 4FVMA 3A7LA 4N58A 1FMAD 4J8QA 2F0FA 2SAKA 3T3OA 3W5VB 1ENCA 1B2TA 3ZYYX 1WRIA 3UI2A 2K0PA 3BWUD 3U7ZA 4B0MA 1D2BA 5ISRA 1L4ZB 1EY9A 4EE2A 2CVRA 1ZEQX 3HEJA 1EIHA 3AN1A 4DAYA 4Z9CB 3M4OB 2WU2B 4EVOA 3AEGB 3A7AB 4O42A 4DAPA 3HP3A 1F2MA 4MIUA 3RPFC 1IBXA 3NBIA 5J1ZA 5T8IA 3HRDD 2JXMB 3QB3A 2VB3X 2A69D 4TRDA 4RHSA 3SK8A 1U4MA 2LFIA 1GUOA 1WD1A 4USAA 2WXQA 4P6VF 1JROA 1JALA 3I9V1 3K5LA 5FR3A 1RKNA 1HA6A 2MJ3A 4A3MB 4JX1C 2PYKA 1EYDA 1WGKA 4C3IG 1DOMA 3TP8A 2WXGA 2B8GA 4H13C 1I6VC 4I65A 1EU3A 5IOCA 2WXJA 4RFBA 4TMAB 1F9PA 1A70A 4JPSA 4CKCA 1NUCA 3DM1A 1YQ4B 1A2TA 2KAJA 3AB9A 5G3LD 1SXTA 1IHZA 1PZJD 2Y3AA 1TWAB 1QE6A 4NKLA 4XTCS 4CJ2C 1UEAB 3NVVA 2LY7A 1SNQA 5BYSA 3LXFA 2PZTA 1FRRA 1FFVA 4A3KB 2QMTA 1C79A 4TSSA 1ROEA 1IGCA 4DXGA 3Q0AA 1EWHA 3JAML 4IUNA 1EL0A 4RGTA 1TU2B 5G3LF 2FHTA 2WIIB 2JA6B 3T4AC 1SNCA 2F0JA 4C3HB 2KUMA 1LV9A 2IGDA 2PVOD 1TWCB 3FRPB 4IUVA 2WV6D 1KLGD 1R4PB 4US8A 3BIID 1D5ZC 5EE1A 1MBYA 3PIP3 3S14B 3P4SB 2WKCA 1I6HB 4C3HG 3AE2B 5C4JB 1SNOA 1STAA 2C5CA 2PKOA 4ZUJA 5ELDA 2D5DA 4DN4M 1JRPA 4EQNA 5G5GA 1EWCA 2EZVA 1LACA 5FOBB 1NYQA 2B2TC 1I4XA 1BDOA 2O4XA 1SBBB 1UUPA 1KH0A 4JBWA 4L1BA 3KUPA 2F0VA 4DNRB 3TEWA 4G57A 1SB3C 1KNEA 5FLXE 4XDDA 2R6GA 2DBYA 3K5NA 3AECB 4LJZC 1OXSC 5HG2A 3EJIA 3PZ8A 4WJWA 3NSWA 3MTSA 1WTRA 2TSSA 1CZGA 2RA4A 4X3UA 3CRLC 3QG1A 1B4OA 3IFTA 3Q8FA 1CHQD 3VR6A 2IJ0A 3M3YB 5AUIA 2FINB 3M7GA 1EEID 1HXYD 1QOHA 1K53A 4KV6A 1ZKOA 3SK4A 3FPPA 1WTOA 4QMGA 2YU9B 3PO3B 3AEBB 1V97A 2PMVA 2L11A 1NR2A 2ZW1A 2R92B 4NAWB 1ICWA 4HROA 2INNE 1PRTC 2EYMA 1EYAA 1Q8IA 3MAQA 2PO4A 1WSPA 3L3OC 1JCKB 2FUG1 4EQPA 1EIGA 5JPMC 2E2JB 5BMGA 1SYEA 5JVH3 2N7JA 1J7BA 4XT1B 1JE4A 1D1IA 2QILA 3FKIB 3SE0A 2WB1B 4G4KA 4YTNB 1GUGA 3PV0A 2FMMA 3OWEB 1O7LA 1BNZA 1EEFD 1F77A 4KKJA 3PUXA 2NN6I 4OGQC 3NRZA 3Q23A 1BQQT 5E3FA 1XLNA 4YTMB 2F0NA 1HQRD 1TIID 1F2ZA 3EFXD 2V4IB 1F0ZA 5KGUA 3WOEA 2O5IC 1MVKA 2JWUA 1Z7TA 2N0SB 3DUZA 3P7JA 4IFDI 1PRTD 3D3RA 3FILA 4C80A 2EE1A 2K05A 1PUTA 1EU4A 1PRTB 3R3OA 1KTKA 2M19A 4B9WA 1I50B 1LT6D 1ZOYB 1SF0A 2I38A 3Q22A 2D62A 2BOSA 3K7AB 4KD3A 3NUCA 4ZK9B 1PRTF 4KHVA 2F1MA 3CIRB 1YN4A 3PO0A 1U4RA 3DEOA 2IX3A 3I8ZA 2F4IA 3GS2A 2B2VA 2ID0A 1LT3D 3PMFA 4DAVA 1FNUA 4KTAA 4KJNA 5C4ZA 4PNYA 3T51B 5M3FB 3GTKB 1N60A 5IT9L 1WVLA 4WIPA 3VR9B 1DOIA 3E6ZX 2RKSA 1ACCA 2BB5A 1SMYC 2EYFA 1XXGA 1YNJC 2E74C 1GB4A 3EQLC 1SJHD 2K1BA 1FYCA 3KBXA 2NBFA 1H9KA 1S5FD 4K2LA 4KY5A 2V3NA 4TQ0A 2L4NA 1D5MC 3FMCA 1PFMA 4DGZA 2JP1A 5FO8B 2XSCA 2N55A 1HFGA 1AN8A 3ZJVA 1VDVA 1KRHA 5H8YE 2LMCB 3PIO3 1ENAA 5M5WB 5E4WC 2EYJA 2N9LA 1LTTD 2MEKA 3BK1A 3DMUA 4IQZA 2SOBA 3I91A 4YSZB 1C48A 4H7BA 1A3UA 5M9OA 4A3BB 4HEA1 2VUMB 2Y5CA 3IFDA 1SMYD 1F9QA 1IYUA 4NMZA 1VLBA 1L5PA 4IN3A 1YNJD 2YEPB 5ELFA 5A2QE 1VMPA 3K58A 5CR3A 1B9MA 1FD7D 2WXMA 1EY0A 2IX0A 4CHTB 5CV8A 1STEA 3NVZA 4GDLB 2EY6A 3MC0B 1AW7A 2RMMA 4FXKC 4IFDJ 3HOXB 3M4YA 2YEPF 1YNTE 1Q1EA 1L0XB 1EY4A 5HFYA 1O80A 3DHQA 1L0YB 4OL7A 1A3TA 1TWHB 3T13A 1JWAD 5ELEA 1PGBA 2NTSA 1F2YA 1FXIA 1NI3A 4PMBA 4XDCA 1JWSD 1KABA 2JA8B 3J80E 1IKMA 1STBA 1C9FA 3I73A 3EUB2 4IALA 3NPPA 1A15A 3I90A 1JQYD 3Q24A 1CZPA 1ZPSA 3NWSA 3TSSA 1R7SA 5CGKA 3P4PB 3GTPB 5AFWA 2WDVB 1Y8PB 2OEOA 1WTQA 1EY7A 3F2UA 4R9WA 2KEEA 3R2TA 3GO5A 1IGDA 4CKBA 2K5WA 3GB1A 2WLBA 4M0WA 4X3KA 4YIJA 1N62A 3QIAA 3KF8A 1K8MA 2F0IA 5BN3A 2V3PA 1DOKA 2WXHA 2QDBA 2X69A 3M7NA 4ID6A 1EOTA 1SSNA 3MHZA 1STHA 1NCVA 3URYA 1D4BA 5EPJA 1CFMA 1VF7A 4XWTA 1K52A 2E3TA 3S1MB 2GI9A 1YMHE 3EA6A 5I6WA 1Z47A 1AWDA 2PNRC 4ZRZA 5LNK1 2B2UC 1S5ED 3P4QB 1V1PB 2BA0A 4K8IA 4YSYB 1C4PA 1LLRD 2F0PA 3SHLA 3HUIA 5AUKA 1QWYA 5M3MB 1T6BX 2WXIA 2JYTA 1NSNS 1Q10A 2A68C 2OXPA 4IURA 1Y56A 1HZ5A 2D5GA 4RNAA 2HUGA 1BO0A 1BF4A 1BMLC 3IAS1 5EBDA 3SK6A 2Q5WD 4KX6B 1VMCA 1Q12A 4OO1H 3I70A 2Q8RE 3U2SC 3TZUA 1UGJA 1STGA 2ZT9C 1JORA 3NTHA 3BYTB 1J7AA 3HG9A 1RDPD 2PMZB 2K32A 3VRAB 5CV6A 2WQYB 3NTIA 4BA2I 2BS4B 2BDOA 2JSVX 2DYMA 4IUQA 2K04A 5I9PA 2Z1CA 5CC4A 1BR9A 4MT5A 3GQBA 1PTOF 5IGGA 3GP7A 1PYWD 1GHJA 1L0VB 2H88B 4G7OC 2IW3A 2K5DA 2KN4A 4KI0A 2LGIA 4A8XC 2WXFA 1O78A 3P42A 2IGHA 3AMZA 2R7ZB 4DFAA 4CJ1B 1VRAB 2NVYB 3MXGA 4KY6A 1FCCC 2A68D 3U9SA 2INPE 1WYGA 3PUYA 4KGSA 2DLBA 2LUMA 1BUVT 1XLPA 2MHVA 1E7PB 3IAYA 4GLSC 4L63B 3U9OA 3TN2A 1MHXA 2MJEA 4RCOA 3GV6A 4YSXB 2F3WA 5IGEA 2B2YA 3P1MA 3K0YA 3HOYB 5E6JA 1CZWA 2MUYA 2W54A 5CBEE 4RGOS 2QF7A 2JYOA 2K22A 1T5XD 4KJOA 2MJDA 3TP7A 3D6CA 1HZ6A 2K7VA 4XQNA 4BBRB 2F0KA 2XWJB 2EY1A 2Y0SB 3KK7A 1OXTA 1ILQA 1YNNC 3A54A 5KNCA 3AEAB 3HS0C 3OWFA 3BS1A 1SIJA 3AE1B 1FM0D 4C3IB 3AE4B 3CHBD 1GB1A 2WNMA 1TS2A 4K5XA 5K36H 3TEYA 2K5PA 1LTGD 2LMCA 2JA7B 3GTOB 3B2GA 3X3MA 3FAHA 2I07B 2EDGA 4N9TA 3QJYA 1ZYRC 1NAPA 4CJ0B 3T56B 1ZDXA 2WXOA 2NWGA 1TJEA 2JYEA 1BUIC 1PDQA 3KQ4A 1Y8NB 4WURA 2MP1A 1W6KA 4KK7A 3S15B 4FXDA 2HDLA 2WS3B 3LWUA 4BS9A 4BA1I 2E2IB 3C8YA 2B2WC 1OQRA 1LTID 1IUEA 4IDIA 1V8CA 4L8JA 2Z4IA 1QT9A 4QUCA 1CHPD 1WTXA 2AWOA 1DOLA 4ZHPA 1XCTL 2F0MA 1TKGA 1VZ6A 2GB1A 1S5BD 2BDNA 1YNND 3KLSA 4M1UB 3Q8EA 3T53B 1UWXA 1HEZE 1DZ1A 1ZXTA 1H9RA 1RD9D 3MEHA 3NWTA 2EYLA 1CQVA 3HRZC 3WDNA 4BY1B 2BS3B 4K2KA 2K3UA 2ENBA 1AP0A 2J0TD 2F0EA 4MACA 1IW7C 1MI2A 4P2CB 5LL6S 1W6JA 1TKEA 3TEXA 2PLPA 1ZYRD 5JXVA 1J9OA 5HI1A 2LFNA 3E9SA 1JR0D 2XVSA 1CT1D 1XO3A 5BYQA 5C5MA 1G2TA 3SVMA 1S5CD 1LT4D 3AE3B 2H89B 2WXKA 3OMCA 1RHPA 3T16A 2ICEC 2V0GA 2MPMA 3LX0A 4HJGE 2HCIA 3I72A 4ZHOA 1PFNA 4DK0A 1ZXIA 3P75A 3HKZB 3NVWA 1VZ8A 2OEDA 4C3JG 1G6ZA 1GJXA 1KLUD 5C0XG 5DAUA 3QOLA 3NQTA 3VA5A 2XNAC 3AM9A 5DEHA 2EELA 4H44C 4K5WA 4V0BA 1XEEA 3H3VC 2EJMA 4FNFA 1C78A 5CMDA 4Q5VA 5EGTA 1CA6A 1PGAA 4P16A 2CJNA 4EQOA 2CHBD 1R9TB 3I3CA 1YN3A 2KEDA 1IW7D 5JAVA 3BYYB 2HQEA 1PDXA 3V3XA 1NYRA 1G91A 4CQNA 2KJXA 2RDGA 1S4ZA 3N9YC 4OVZA 4KGRA 5ELBA 1HA5A 1R4QB 2PW5A 4FP5D 2K28A 4R8NA 5C3JB 4Q0FA 2XRSD 5K5PA 3TDQA 1EY5A 3EGRA 1XTCD 3J81L 2JEBI 3MHBA 3H8HA 4LK0M 2IDYA 1C76A 4I7ZC 5A35A 3HVDA 2CQAA 4FF4A 4QIWB 2JXTA 1XX8A 2KMMA 3D6WA 4C1NK 2F0DA 2C9OA 4B0EA 4CGYB 3UI3A 2LEKA 2WKDA 4F8MA 4PMWA 1XF5L 2Z4HA 3W2DA 1NENB 2A74C 5FO7B 3IAM1 3S1RB 2HCCA 2G1EA 1EQVA 4HR7B 1FEHA 3HVZA 1LO5D 2XIWA 1A6XA 2J52A 1I4HA 5JOBA 4HAEA 1SNPA 2N9KA 1DCZA 3DWMA 5LL6X 1ML0D 1FR3A 4E6IA 1RJTA 3QOJA 4OO1I 2QJLA 4WRDA 4QUFA 3VYRA 3MVVA 3S2HB 4FF1A 2EVBA 2SEBD 3W3AA 3W1SA 3MJ5A 3HZXA 1KF6B 1RFKA 1FFUA 4A3IB 1H9MA 1T3QA 1TWGB 1TWFB 1I4QA 4HCSA 1K50A 4LAAA 2L9HA 2PZUA 4A3DB 5FK9C 5MPOA 3VA7A 4RGNA 5IGBA 3GV3A 3GTGB 2F0GA 3RZOB 2B39A 2JQRB 3PUWA 4DQOC 3SXHA 1ZP0B 1IYVA 1A3VA 2AWNA 2MJ8A 5TSSA 1JC7A 2ZXPA 2Z8LA 2M56B 5J22A 1JMLA 5H92C 1MPEA 2BE5C 2BT6A 2WDRB 1PGXA 1NVID 4JWUC 5CV4A 5BMHA 3DWAA 5DM73 1N5XA 5HGTA 1F2RC 2E6XA 1LABA 5JJZA 4WWMA 3KLRA 4KGTA 1MGSA 5EPLA 1ILPA 4FF2A 1GUWA 3VR4A 3AMUA 1SDFA 3NQIA 1BOSA 2JU6X 3B9JA 2AX5A 2ON8A 2WXRA 4OO1G 3BDCA 2WDQB 3J7AV 2FFKB 1F2RI 2WACA 1KDBA 1VJKA 3N6RA 1WTWA 3AU7A 3BDLA 2E2DC 3VYTA 2IT1A 3RUZA 5EJWA 2RQXA 5BMIA 1OXXK 2K9XA 1LT5D 3RMHA 5C3WA 1SNDA 1DOYA 2NZ1D 1QILA 4RKLA 4LTUA 2KQ3A 2A5HA 3A8IE 1X3QA 1H9SB 2EY2A 2QSDA 1B9RA 4IKGA 1LTRD 2JSOA 4MHEA 4MH8A 2BE5D 5EKLA 1ZE3D 1P7FA 4NDXA 1G291 1F9RA 3MA2B 1BBXC 1QNKA 4XDXA 4GZYC 4ZRPA 4L6TB 4XWWA 4OW0A 3HGBA 4YT0B 3WCQA 1LTAD 3MWYW 2M9VA 3L7ZC 4KD4A 3BG3A 3K59A 2VNUD 4GDKB 1DXMA 3NXWA 5C0XH 2L0CA 4N9PA 4ZKCB 1B50A 1I4PA 3ZGZA 1SYCA 3O13A 4DXFA 1JOKA 3SK5A 3E56A 4TQUS 2J4XA 1AEXA 4AS1A 1C4QA 3T3NA 1U9RA 1Y69U 2EYHA 1SSOA 4MM3B 3OIPA 2AQ3B 4EGVA 3I4MB 1E2VA 4RKBA 4OHJA 1ZUD2 1DOXA 1IBXB 4Q2JA 3AB5A 2B8FA 2AQ2B 3KWLA 1H9JA 3GTMB 5K36G 2K33A 3R8BA 2G9DA 1X32A 5A2QL 2WP8J 1SE4A 4F88A 1B9NA 3MXUA 2PTLA 1SFOB 4BY7B 1FD6A 3R2IA 3AE7B 4KKIA 1UAPA 4J6HA 1HQMC 3ZJTA 3D4RA 1K83B 2L83A 2BA1A 1VR9A 1T5EA 2PIAA 1TS5A 3J80L 2CU3A 2JA5B 3VR8B 2JEAI 3A8KE 1TKYA 3NP8A 1FRDA 4XQQA 5E4XA 5JEAH 1N61A 5F2DA 1PLFA 5E1FA 3KLSX 1RTNA 4R8IA 1STNA 1D1KA 1WTVA 1EQTA 2EOTA 3QWNA 1TT2A 2PW7A 3K57A 2X6LA 2LHDA 2RDFA 4IOIE 2LS01 3ERQA 3J7AF 3MP9A 4ILWA 3H91A 4RF1A 2F0QA 1MI0A 4A9AA 4JE3B 2L55A 2B2TA 1WWTA 1K51A 1FGBD 3CRKC 3RLFA 4B9XA 3D31A 5NUCA 3S1QB 3I4LA 1GUSA 2MGSA 2Y5PA 3S1NB 2I46A 3EROA 4IUTA 3CU7A 3GTJB 1C77A 1J8IA 1B53A 4A3FB 1HUNA 2ONQA 4HMIA 3QO2A 4K14A 1AFPA 4KKTA 4XIGS 1EWYC 1L6UA 2IPKD 4C1NI 4D2KA 1TQOA 3S9WA 2FBWB 3SFEB 3AE9B 3EVQA 1FXAA 3NUHB 3TBIB 1CTMA 3P63A 1J7CA 3FC4A 4F7XA 4ARIA 1MHHE 5I4DA 1E2WA 3S2DB 2MH7A 2KWDA 2O2LD 2RBMA 1HTPA 4AYBB 1RODA 3RZDB 2OT2A 2HTME 5CV9A 4HEDA 5EE0A 5I9OA 2VZKD 4ULLA 1JWMD 2RSNA 2A73B 1WCMB 3C46A 4LLGM 5COYA 3S16B 1Y1VB 4DK1A 3NK9A 2VZKB 2J7ZA 4ZUIA 4CBVA 5I2XA 1SNMA 4RH6A 1LTSD 3J9CA 1JICA 3I4NB 2X6GA 2EJGC 2IWHA 5D3DA 5D3IB 3OMGA 4FYDA 1CJEA 2KCNA 1OXUA 5C4XB 3AH7A 4QB4A 4HSPA 1JQ4A 2DYOA 3FVQA 1YJIA 2W55A 2QIEB 4WQMA 1D6EC 5C3EB 1QQRA 4KKSA 4K6DA 5JPNC 1SEBD 1KNAA 1OQQA 2TMPA 3H09A 2J42A 4C7YA 4ZKBB 2ZXOA 4YWGG 4RGMA 2PZWA 4HMJA 1S5DD 2A6HC 3DWQA 5M5YB 1V43A 1O7ZA 1GUTA 2W3SA 1ZXHA 2K5QA 3OOCA 2ICIA 1CK1A 1V8QA 3C2PA 4FO2A 4HKQA 2W82A 4UAIA 1F2LA 4REZA 2VXWA 5C2TB 3PO2B 1WD0A 3NVYA 1KFYB 2B2VC 1BXTA 3H6MA 2V4DA 5I2YA 5BYRA 1PXUA 2FE8A 1FNVA 2VB2X 2E76C 4L23A 3TP6A 2EXZA 3BDOA 2B63B 3FPUB 2A6EC 1QNUA 2O5JC 3BVZA 2E75C 2EPBA 4TQ1A 2OF1A 1MSHA 2F0HA 2RVLA 3AEEB 1YN5A 2BBCA 3GTLB 1MSGA 2CW0C 1V1OA 3FILB 5C0XI 1Z6HA 3GD7A 3OPOA 1QOAA 1O7YA 1XWEA 3BVMA 3FDTA 4XT3B 1GOZA 3AE8B 5DNFA 2KQ4X 2A6HD 3IT4B 2LHEA 1SJED 2DWQA 2NUCA 1GUNA 3OW7A 1WTPA 1DYQA 4PT5A 3ND8A 1DONA 3E0JA 4RAUC 4N6EB 2ZXRA 2F0OA 2PCFB 2KDMA 1OXVA 1FCLA 3D8GA 2KCCA 1OO9B 2L52A 4MN3A 1UWMA 3I57A 5CBAE 2A6ED 1XCQL 1QOGA 4C3JB 2CJOA 4Y7NB 3A55A 2OHFA 3KBGA 2H1EA 3MZ5A 3NBHA 4WAFA 1HTLD 3ZJUA 3JAME 2CW0D 4RHRA 3B2FA 5CYUA 4J3OD 1JWUD 4PV1C 4U673 3VYUA 2L32A 1HHVA 1YJJA 2K03A 1A2UA 1QF6A 1VDZA 1AYFA 2WXLA 4QF4A 2EJFC 4ZLTF 2F0UA 3LNNA 1V1PA 4A3JB 1TZOA 4YXDB 1VF5C 1L6VA 1RTOA 3DXJC 3TZDA 4NZLB 2FMCA 3TMEA 1L4DB 1QOFA 4YTPB 1EFID 3BVGA 3MXPA 4B08A 5FLXL 1I3QB 1SYDA 4UDUC 3MFGA 4OZBA 1HUMA 3H94A 3OSOA 1E9MA 4JWSC 4HKZE 3DWPA 2R61A 1TY2A 1EZ8A 1EZ6A 2KA7A 2RDHA 3X3NA 1QKZA 5EQ0A 1GAQB 4KN4C 1FNWA 2KECA 1TS4A 4X3TA 4RWSC 4V190 2JX5A 3Q8CA 5KYLA 3DEPA 4XYOA 4NJCA 4DA2A 2FJ2A 3TEZA 5D14A 2M2LA 1PTOH 1Q90A 1RYJA 3NTKA 2LJIA 5C0XJ 1RWSA 3LWEA 4JK1C 2KHSA 1GPXA 1U4PA 3J81E 2WXPA 4H0LC 3AE5B 1KAAA 2B2UA 3E5SA 4BBSB 3SR1A 5BN4A 5HHDG 1E6EB 1P7EA 1E0BA 3KWVA 2LKVA 5JEAG 3SFDB 2DNEA 4DNTB 4ARCA 3H0GB 3RD4A 5JVG3 1I7HA 3W5UB 2J53A 3MXNA 2KVMA 5CORA 4G7HC 3TP5A 2BB6A 3HOVB 1YQ3B 1ET6A 1EM7A 4TKOB 1ONLA 2XWBB 3V05A 2HDEA 4DF7A 3D4DA 3Q8AA 4RCNA 3TUOA 1JW9D 4L2YA 5T1GA 1E2ZA 4OIJA 2PVGC 3W9CB 3P4RB 3GTQB 2BTEA 4G7ZC 5KNDA 1Y1WB 2SNMA 4KMUC 2DY7A 4KN7C 4ODGA 3VRBB 1EY6A 2L12A 5KIXA 4U68A 4OZAA 3IXSA 3SR6A 1WXQA 5GXGB 2K01A 4US9A 3BK2A 4S3SA 2PPBC 3N52A 1VCIA 3P1HA 1PFDA 3RFZB 3VQIA 3ITPA 4A93B 3Q69A 5EPKA 4C2MB 3ND9A 4LK1C 4KKUA 1KDCA 1XYIA 1IKLA 2BCOA 3PZ7A 2XRQD 5JEAJ 3PUVA 4ME5A 1FO4A 2IL8A 1HFNA 5EKIA 1PZID 1SAPA 2B2YC 3VR5A 4FF3A 5C5LA 4XQJA 4LMQD 1HPCA 1PMRA 4ITKA 3HOWB 1QB5D 4OIKA 1VZ7A 1DM0B 4PQXA 1KDAA 2EYPA 5CV5A 1LTBD 1E0ZA 1QOBA 2DNCA 2F3VA 1GHKA 1E10A 1QJOA 1ZDVA 5IGCA 3G7LA 4IZ8A 3VR3A 3M85A 1HCZA 4NP5A 4C56C 2BYTA 3ZQ4A 2QCPX 5T1IA 4ABNA 5KYIA 3DWGC 1TVXA 2JE6I 5DM63 1SYGA 1K8OA 1SE2A 3S17B 5J39A 1C8CA 3PUZA 1HRJA 2WINB 4WH4A 1B44D 2WP9B 3SDZA 2HDMA 2NN6G 2F0TA 1MD2D 4KHZA 4HCEA 2RSOA 2GA4B 2SNSA 5IT9E 3R93A 2ZW0A 4ZYSA 3HOZB 5KNBA 2E2HB 4R3DA 2RPVA 3C3LA 4BWGB 2F0LA 2D9UA 1XLQA 3U4EG 2PW9A 4IUPA 4K5VA 4IFDG 5IGFA 2B2WA 5C6AA 1I4GA 2NMQA 4K6LA 4HTHA 1EY8A 2DY8A 2NVQB 1DJRD 3FEWX 4NAMA 4OZCA 3C1FA 4M8AA 4DU9A 1BCPC 3K6OA 3ONAB 2L5TA 2SDFA 1SYBA 4FXCA 5C3XA 1TYGB 4XXEA 2WAQB 1PFBA 3OHXC 5IODA 1CQFA 3AV8A 2NYZD 2M0AA 3L4PA 4A6QA 4HRSA 1F9SA 1M8AA 3VYSA 5EBCA 3ETRA 4FXGC 5D7GA 4X3SA 2IGGA 3CKIB 2AQ1B 1TS3A 4CKEA 1ENFA 2M00A 3AE6B 3G6JB 3LYYA 5C44B 2EYOA 2L1AA 3AEDB 1C4AA 1JWBD 1ET9A 2NVTB 4QCLA 1ESFA 4ZQ3A 1ESRA 1SYFA 1Q1BA 1G2SA 5BN5A 4ZOHC 1CA5A 2L1BA 2JZPA 4O1NA 2PQEA 4A3EB 2XN9C 1D5XC 2G9HD 2NB0A 3P20A 4XYQA 2R93B 1RM6C 5G5HA 5CV7A