1ENFA

Crystal structure of staphylococcal enterotoxin h determined to 1.69 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
212
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ENTEROTOXIN H
publication title The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 71
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2000-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1enfA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1enfA02
1LTID 2R61A 1BXTA 1LT6D 1L0XB 3KLSX 2IPKD 3BZDB 4RFBA 4TSSA 4ZYSA 3DWPA 1PRTC 1YN3A 1AN8A 4BWGB 2RDHA 1LTTD 1KTKA 1LT3D 1LLRD 2TSSA 1SXTA 1TY0A 4RHSA 5D3DA 1DYQA 4UDUC 2Z8LA 1LO5D 4L63B 1RD9D 4DXGA 1PZJD 2CHBD 1UUPA 1JCKB 1I4XA 1PZKD 3R2IA 3EFXD 1L0YB 1JWUD 3V05A 2NTTA 1LT4D 1ET9A 1LTSD 1M4VA 2RDGA 2J4XA 4K6LA 1PTOF 1EU3A 2AQ2B 1MD2D 3BVZA 1CK1A 1RF2D 1BCPC 3URYA 1EU4A 4RGNA 1TS2A 1F77A 1TS5A 2QILA 4RCOA 1D5XC 1BCPB 2XN9C 1LT5D 1D5MC 3MFGA 1BCPD 1LTRD 1QILA 1PRTB 1I4HA 1S5DD 1D5ZC 1V1PB 1CHQD 1I4QA 5FKAC 3R8BA 1PRTD 1SE2A 2XRSD 3BYYB 1XXGA 4RGTA 3BVGA 4O1NA 1SE3A 1YN4A 1CHPD 2ICIA 3OWEB 1D6EC 1LTBD 5TSSA 1V1PA 1TS4A 1EEID 1I4PA 1S5CD 3EA6A 1FNWA 2NTSA 1ENFA 1FD7D 1PTOC 1SE4A 1S5ED 3SEBA 5ELDA 1LTGD 1PTOB 1SJED 1S5FD 1TY2A 1YN5A 1PTOD 1JQYD 1I4RA 1STEA 1ESFA 2XNAC 3O13A 4NZLB 4L6TB 1JWSD 1LTAD 5ELBA 5ELEA 1HTLD 5FK9C 1SBBB 3DWAA 4RH6A 1AW7A 1SJHD 1UNSA 2XRQD 2G9HD 4RGOS 1EFID 5I4DA 1SEBD 3R2TA 1PRTF 2SEBD 3BYTB 3W2DA 1FGBD 1JR0D 2QEJC 4RGMA 5D3IB 1B1ZA 3TSSA 1HA5A 1HXYD 1EWCA 1KLGD 2AQ3B 1CQVA 1JWMD 1CT1D 1XTCD 2WV6D 5ELCA 1S5BD 4OHJA 1DJRD 3CHBD 2IJ0A 1T5XD 4C56C 3BVMA 1RCVD 4RHRA 1HQRD 3GP7A 1B44D 3MC0B 2AQ1B 1PZID 1KLUD 1PYWD 1RDPD 1BCPF 1I4GA 1PTOH 1V1OA 3DWQA 4Z9CB 1ET6A 5ELFA 4DXFA 2O2LD 1FNUA 1GOZA 1G8ZD 1EEFD 1FNVA 1TS3A
chains in the Genus database with same CATH superfamily
1J7BA 1X65A 3NZUA 2N8NA 1GHKA 1I6VC 2F1MA 1IKMA 4L5TA 2KMCA 2ZPNA 1O7YA 3QIAA 2L55A 3DHIC 4IFDH 1XNQQ 2Y0SB 1XPRA 1FFVA 1XLNA 3OWFA 2YU9B 1HFNA 2AL3A 1GVPA 3K58A 1DYQA 3I4MG 2F52A 4HROA 3W1SA 4WAFA 3DBSA 1RTNA 3MXGA 4L5SA 3HOVH 2ZCBA 5FJ8H 1Q81C 5ELNA 1AZPA 1NI3A 2CHXA 1AFPA 3LWEA 3JAML 5KEEA 3S1NH 3HM3A 3S9WA 3KVFB 3NELA 1KNAA 1SYFA 2N49A 4GGQA 3K5LA 2EYJA 4CBVA 5E6OA 1MD2D 3NRZA 4LF4Q 4KY6A 4KMUC 2M17A 3URYA 3ZNHB 1SIJA 2KO3A 5EAYA 4BY7G 2NBVB 3KBGA 4PYZA 3SK6A 3R3MA 1Z5SB 1XPOA 4AOFA 4FBJB 2WXLA 4K5WA 1KD1C 2NBFA 1KQSA 2E2JB 4CQNA 4J8QA 1H9SB 1Y8NB 3A55A 1V8QA 3FPUB 5IGCA 1OQYA 4BAXA 3W9CB 1ZYRD 4K81A 2JT4B 1OXSC 2MJ8A 1JJCB 1MG4A 2WXRA 2B39A 2UUCL 4NDXA 1UELA 4HEDA 2V4LA 5IOIA 1WGKA 5G3LF 1E2VA 2EY2A 3V2TA 4A3EB 3NWSA 2KQ4X 4DUYL 3PUYA 1KM7A 5M5YH 1EEID 2JE6I 1R9TB 3H09A 3W5UB 4F1SA 3M4OB 3P4SB 1E24A 3HOWB 2FIDA 4CKBA 5JVH3 1DONA 1WYGA 4LF9L 2A6HD 4KHPL 2K14A 3I90A 3VDYA 4OXPA 4DR4L 3JVZX 4GIVA 3I55A 4I7AA 3ZUNA 4DHJD 2AWNA 3Q8CA 2Q2UA 1EZ8A 4LF8Q 3ALBA 3WA0A 1TZ1A 1Y14B 3CCJA 2ZTDA 3CCEA 5M5WB 1MKHA 4GOCA 1KDAA 3Q8BA 2XNAC 3O13A 4PT5A 3NBIA 4W9KA 4IFDJ 3RZDB 4ALPA 2IY5B 5EE1A 5JXVA 3ZJYC 2JA7G 3B0AA 4DK0A 1QVFA 3E9HA 1TIFA 1QOHA 2L83A 1WRDB 2HIVA 1WGGA 4XTCS 2VUMG 1K9MC 3P4RB 3N9YC 1N36Q 4JI5L 1EY8A 2KDBA 2BA1A 1QVCA 2ZNVB 4LUOA 2AQ3B 4WRDA 4K7WA 3S15B 1Q8KA 1HUMA 3DQVA 5DEHA 3G6EA 1C4CA 2ZJPA 1VQFA 1GC7A 5HI1A 2E8GA 4IPHA 3F2CA 4XYQA 2A1AA 1XPUA 2KANA 5BYRA 4WJ3M 1SMYD 2FXQA 1IBKQ 4DR1L 3CD6A 4KHVA 4W9DA 3RNEC 2AQ1B 2UU7A 2BCOA 4DAYB 1L7YA 1A5RA 1I4GA 4G0NB 4ZRJA 4C3IB 2Q8TA 2UXDQ 1VQNA 5C4XG 2BWES 2WDVB 3AE6B 2FCQA 4IWQA 3IFWB 2R61A 2FIFA 1BXTA 4CJ0B 2VW9A 4G7OC 4XE0A 2IPKD 3BZDB 5BN4A 4B3MQ 1SE9A 1U4MA 4EFOA 1D1IA 2VQEQ 4IUMB 4N9PA 1KL9A 3DHGC 5AUKA 1YHBA 3AMZA 2L9HA 4XQJA 4WJWA 3CKIB 4RNAA 3PS6A 1J7AA 1MHXA 1I3QH 3L13A 1C48A 1HZAA 2Z1CA 1I5FA 4DV3Q 1H9RA 1PV4A 2KTRB 3TL5A 3RNCC 2MJ3A 3E6ZX 2K8CA 3OMCA 3CC2A 3X3NA 2KN4A 3ZRFA 4MGYE 3PSIA 4RG1A 5E6JA 3HG9A 2R92B 1ET9A 1V80A 2FCSA 3A74A 3NPPA 2HD3A 3SK8A 3E5SA 5A35A 4QCLA 2FFKB 2AQ2B 1K53A 3UQBA 3AU4A 1SRUA 4IURA 4IQZA 4JPSA 1IYFA 1ML0D 2CQAA 3U30A 3FEWX 1J8CA 1YIJA 4ZAIA 1K8RB 3PO2B 2JA6H 2KHWB 3I7FA 4C3HB 2EYFA 4FXKC 3AE1B 4MJSB 3AB5A 5C44B 3R8BA 1UE7A 1XXGA 3SE0A 1WTHA 3SVMA 2PMZE 3M9BA 3NUCA 1Q1OA 1SSNA 4OELB 1RODA 2B8FA 5KRUA 4A3DH 1CHPD 1FPYA 2DYMA 4EGVA 2OQ0A 2I46A 1HTPA 2WX1A 4TQ0A 5BMHA 1N62A 4WH4A 4FN2A 3PV0A 3K59A 4DR3L 3RMKC 3VTWA 1TS4A 1F9QA 2YYZA 4DU9A 2AMCB 3DEOA 1K3BC 4GLSC 1L1OC 1QT9A 1F2MA 1B70B 2NTSA 4A3CH 3HVDA 4ITKA 3TCAA 3VUWA 2FUG1 4ZUJA 2OEOA 3W1BA 2PKOA 2H88B 3CCRA 2PJHA 2MQHA 2Z0EB 3BINA 1E5WA 1EY9A 3NTIA 4DR5Q 1N8RC 4DR6L 3IHPC 4LDTB 2DUDA 3E9IA 1PTOD 1XF5L 2WXMA 3S17B 3U4EG 2JY6A 1CZWA 1D3ZA 2L0FA 3LB8C 3R7RA 4TKOB 3VTUA 5D14A 1AE3A 1SAPA 4JBWA 2IT1A 5E4XA 3WANA 2BWFA 2WKDA 1SBBB 2PMZB 4JI8Q 1OQRA 3APDA 4GN3B 1OO9B 2RD0A 3ZNZB 2C5CA 2KCNA 3IBEA 2DNEA 3PGZA 1PRTF 1ZXTA 1HPCA 3S24A 4TUUA 1HZ9A 3U52E 1OXUA 1K8MA 3GTJB 3ZTDA 2ICEC 1IL2A 3T1HL 5M3MG 3U2SC 1CQVA 2CU1A 4AP4C 2DJFC 4AS1A 4AWJA 1J5EQ 1Q90A 5E7NA 4RF0A 1F2LA 5DPRA 3PIO3 1SB3C 2F03A 2IJ0A 2DYBA 2B2YC 2ZTEA 4C56C 2RA4A 1VQMA 1HNZQ 1VR9A 4NJCA 4PS7A 1C3TA 1Q82C 2B3GA 2R7ZG 1SROA 1KFYB 2DZJA 1LFDA 3RN2A 2B8GA 1LUZA 1V1QA 1FCLA 2F0PA 1PTOH 3ZYYX 2I38A 2ALYB 4A3MB 3HOUG 1XNRL 2HDMA 1FNVA 1TS3A 1YNJD 1Y1VG 1BQQT 1LT6D 3FRPB 3FVQA 3T4AC 4N8FA 3SK4A 1EIYB 3Q8FA 2KECA 1IXRA 2B29A 3CCQA 2VL6A 3M3YH 1R4QB 1TT5B 1YN3A 3CF6E 3ML9A 4FJVB 4KZCA 4NQKE 1T9HA 1KTKA 1HE8A 1SIFA 4HIOA 2RQXA 3AXCA 3QWNA 1PH4A 1SNCA 2BA0A 2QA4A 1K8GA 4LNKA 3UIOB 3VUYA 2Z6KA 4UDUC 1NR4A 2OCEA 4C2MH 2DYOA 4L63B 1EF5A 1FL0A 4IUPA 2LXAA 4ZRIA 1TU2B 2HCIA 2UUBL 2E2HB 2J7QB 3PF5A 4LNIA 1CJEA 4FJZA 2DLBA 3ML8A 3EFXD 1IBMQ 5BN3A 2QSDA 2NTTA 4MH0E 1LT4D 5C0XH 3G71A 2WDQB 4II2B 5AZGA 5CBEE 4Y7NB 5DPSA 2QKIC 1CK1A 5FOBB 1BCPC 2ZXOA 4ZRZA 1RFAA 5I2XA 4JYAQ 4ARIA 2N55A 2QDFA 5M3FG 5IIFA 1C4QA 4GZYC 2JN4A 1R4NI 1SYCA 2PO4A 1ZXIA 1D5ZC 3D0FA 3A56A 3J7YW 3TRZA 3APFA 2IBIB 2G3QB 3OTOL 3BYYB 1HA6A 3AV8A 3VFKA 1T0QC 4YY3Q 4AJYB 2E2IH 4WIPA 5AJ3Q 2F0VA 1P8LA 1MPEA 1VZ7A 2YVCA 1XMOQ 1K83H 4KLKA 1UGJA 4OONA 1MJCA 2VB2X 4W9EA 4BY7H 4C4VB 1B4OA 3WWVA 2NPTB 4TKNA 4JPBW 4L1BA 2VNUD 1HTOA 2PEAA 1QF6A 3KDFA 1LTGD 1MIUA 2E2DC 1P16A 4BBRG 1E10A 3PZ8A 2PPHA 3CC7A 4J3OD 3GTMB 1D4BA 4A3KG 3MP9A 2D5GA 2W54A 1Y69U 3RZFA 4HMJA 2KTFA 2V3SA 3Q69A 1TKEA 1NBWA 3OJ3A 5FO7B 5T8IA 4E74A 3N6RA 4BFRA 3IXSA 3SD5A 1UE5A 1Z47A 1WGRA 1HTLD 2JA6B 3DBHI 2O6VB 4G50A 4KGRA 2BBCA 4NNJB 2F3VA 1EY4A 5G5GA 1K28A 4BBSB 3R2TA 1GUAB 1VDVA 2HJ8A 5E3FA 1DD2A 2O5JC 2KJHB 3H6NA 4JLCA 4OL7A 3OLMD 4X66Q 4KKUA 5GAEC 1JOKA 1HA5A 2KA7A 4NMZA 4K7UA 3AMUA 5C0XJ 1N9WA 2E6XA 4X3SA 2IO0B 2V4DA 2ZZPB 1XTDA 1RFKA 1CT1D 2KKCA 3C1FA 2GB1A 3RUZA 2LRUA 3AI5A 3R3OA 1TR5A 3NBHB 1HFGA 3X3MA 1STHA 4DAVA 1EYCA 5EKIA 3I4NG 1E7VA 2LWPA 3RN5A 1TWAB 2JA7H 1KHIA 4S17A 4CJ1B 1N34L 3S1MB 3J81c 3WOEA 1NYRA 1TGZB 4RF1A 3WAOA 5ELFA 2VS1A 2VUMH 4WQMA 1UWXA 1I50B 1PH2A 3NZSA 3GTLH 4L2YA 1QJOA 5FLXE 1ASZA 3A4RA 3TMPB 4XX5A 1NY4A 1NNXA 2PZUA 1JJ2A 1T3QA 4X62Q 2PIAA 5IO9A 3M85A 2DENB 2K4KA 4FDBA 4HCPB 3I70A 1WTOA 2MBHA 2R93B 3RCZA 2WAQE 1K0SA 1Q1EA 1WE7A 4LF5L 1J8IA 4KVGB 1VQDA 3Q22A 1R4PB 1XMQQ 1WXMA 1L4DB 1BBWA 1PZKD 2K9XA 3DBHB 4MH8A 4NJ6A 4M0WA 3V6EB 3JAMc 5LMNL 2V1YA 3BZCA 4ZKBB 3PO3B 1K8OA 3VR5A 2VZKB 5C4XH 5CV5A 4B3RL 3L08A 2O4XA 4MM3A 3FKIB 2AL6A 4GN5A 4YTNB 3MC9A 2JA9A 2HIXA 1V2YA 1XX8A 1N32Q 3QOJA 1VQGA 1B2TA 4IDIA 1UBIA 1PH8A 2MJDA 5E4WC 5D6JB 5HG2A 2YTYA 2FCNA 1TWHB 2O2VA 1AH9A 1STYA 3KLSA 3FILA 4W9FA 4LMQD 3S14H 1J6QA 1F2YA 3L9AX 3M3YB 3L16A 1SE2A 3U8ZA 1E0ZA 5CV6A 2WAQB 3RLNA 1STGA 1FEHA 1TBEA 2D3BA 2K6QA 2CU3A 2KWCA 1A70A 3Q3MC 4B95A 4GN1A 2KD0A 4EEWA 3GTKB 4P72A 1YHAA 2KOLA 3VYTA 1ZGUB 2XWBB 4NJ7A 5HKHA 3A1QA 4QGUA 1SYGA 2SOBA 1M1KC 1JB3A 1GKHA 5D94A 2RVLA 5CV9A 1G6PA 3KUDB 1STAA 3HFZB 1P1AA 1UEAB 5ELDA 2FMCA 3J80L 1PQSA 1U4AA 3ZJTA 1VQHA 3E0EA 3ER0A 3WCQA 1VJKA 4OO1G 3RNAC 2YTVA 1YN5A 4F88A 3MEHA 1UWVA 4GDKA 2B2VC 1STEA 2LUEA 3RYTA 1ZPSA 1Q1BA 4PZ7A 2XSCA 2Q8IB 1RIPA 5KGUA 2MRPA 4NZLB 2KFKB 5HHDG 1WJUA 4X57B 1GUNA 4K7SA 5L95C 1LM8B 4MZ9A 1YMHE 1VF7A 4GKJQ 4A3IG 3EIVA 1XLOA 5EBCA 1UGMA 1VMCA 3T13A 1E2ZA 2OTJA 1H9JA 4ZQ3A 4B0EA 2KC2A 3TMEA 2V3PA 4HK2A 1A15A 4DV7Q 2NUCA 4M0WB 4P73A 4DR2Q 3N52A 3MC8A 3T9LA 2F0IA 2L15A 4I65A 4MSQB 1EL0A 5LXHA 1YQ3B 2NR2A 1IL8A 3DWGC 3VQIA 2WV6D 2J0MA 4H02A 2A69C 5L37A 2ENBA 1YQ4B 4HPLB 3P4QB 1HTQA 1CZPA 2N9KA 2EKEC 1GUSA 5MPOA 3VR2A 3F1ZA 1JB7A 3HP3A 2UU9L 2AX5A 2KAJA 2NBUA 2WXJA 1K3RA 5KHOA 2A74C 3AEFB 4YXDB 3NVWA 3L7ZC 1RDPD 1YHQA 1KLVA 2JZ3B 2O2VB 3FILB 1O80A 3OSOA 2F0LA 2LVPA 2MQJA 1IBXA 4JI2L 1LTID 2KQ7A 5C3WA 3HM6X 2PNHA 4HIKA 5H8YE 5FR3A 2WXNA 3HRZC 2QF7A 3X23A 3U4ZA 1AN8A 4DDID 4LWCA 3R66C 1PDQA 3ITPA 3A1QB 1WZ0A 1L2FA 4FULA 3LWUA 3MXUA 3QR8A 4YCVA 1BUVT 2X6GA 2CJNA 5JAVA 2BE5D 2UXCQ 3EBEA 1H9KA 1CSPA 2WXIA 2R7ZH 3PRMB 4IUNA 4PMWA 3TJPA 5JOBA 3A9JA 3EVQA 3GB1A 1NMGA 3GTOH 1Q5WB 1QQRA 3HOUH 3ECIA 3A0JA 2J42A 1VQJA 4NW2A 3PREA 3GTGH 3B6YA 5C3EG 3HIZA 4TV3A 1RRBA 3S1RH 1VQOA 5IP4D 1Y1VH 4EQOA 1E0BA 2JWZA 2NMQA 1TXYA 3KK7A 1STBA 2KCMA 1JWAD 2LVQA 4K3BA 2K01A 1Y1WB 2DNFA 3AE4B 1LT5D 2EXZA 1V81A 3OPOA 5CX3A 2BH8A 4DBGA 3UINB 2QDBA 4JOIA 1SYEA 5C3XA 3TS0A 1UH6A 3VDZA 4JI6Q 4JG2A 2D3CA 4OZCA 4GU2A 1T0RC 1PHJA 5IAAC 4HN7A 1OTRB 2JEAI 1KDBA 2F0JA 2ACZB 2GLSA 3N1YC 1TT2A 5T1GA 5IGFA 4JI7Q 4JWSC 3IFTA 4F8MA 4KDIC 1CM9A 1PH6A 4USAA 2NCNA 2F0UA 5IT9E 2BB6A 3Q8DA 2PQAA 3CC4A 3T1YL 4DV6Q 4K0KQ 2C7MB 3HVZA 2JA5G 3NS8A 2K5NA 1SE4A 2D2CC 5JPMC 5M3FH 1U4RA 4L5QA 3UDGA 1OTCA 2C7HA 3HZXA 3UIPB 5FLMH 1YX5B 3TEZA 1FD6A 2TMPA 1PYSB 4B9WA 1IBXB 2ZM6L 3J81j 1B50A 1NCVA 1W3SA 1WTRA 2MGSA 3TEXA 3TEHB 1WCMB 2SNMA 4ZLTF 2A8VA 1ESFA 4ZCKA 1JRUA 1YD8U 1PH3A 1IGDA 5JEAG 4YSYB 2R2OA 2PI2E 5LHY1 2N1WA 3CSTA 3IAYA 1C9OA 3H7SA 3PZDA 1AW7A 2ZTCA 2KC1A 5BYSA 1HNXQ 1KRSA 1A8VA 2VXWA 2JRHA 1EOVA 4PMCA 3M4QA 4LF8L 2IO1B 2M56B 3TP6A 2N9XA 1ZE3D 3S2AA 4AYBG 3F2BA 4RM9A 5IN7A 1RKNA 3OHXC 4HCSA 2GBJA 2HD5B 2EMTA 3IRBA 4BBRH 3ETRA 4BKSA 2KWDA 4A3KH 4A6QA 1UF0A 1B7YB 3MA2B 2QEXA 1ASYA 3JSVA 2FINB 1DJRD 2ZJRA 3CRLC 1N36L 5JZEB 3A9KA 5I6YA 4HAEA 3Q8EA 2RSUA 3P2BA 1TWGB 1E8ZA 4RHRA 2IGGA 2SNSA 3S2DB 3STBD 2B63G 2CH4W 1HR0Q 2R7DA 5T1IA 1XCTL 1BMLC 2HDLA 4P74A 3H3VI 2FHTA 2H4OA 1TTNA 3Q8AA 2L12A 1FNUA 4ILWA 5C4HA 4LTUA 4ABNA 3UI3A 5J18A 1GB1A 1P7FA 1C1YB 1FMAD 3I2ZA 4RFBA 1IBKL 5H1SE 1PFMA 3HOYG 4GKKL 2AUKA 2N9EB 1JRPA 1LTTD 3LDZE 4MELA 1JE4A 2KHJA 2PQAB 1E3PA 5CV8A 2UXDL 1CKNB 5GAHC 5JJKA 2M2LA 2WB1G 3RNGC 4YCWA 5C5MA 4DUZL 3T8MA 4DV0Q 3H3VC 4ZHOA 1IYUA 4BA1I 2QGQA 3EC8A 2CHBD 4HR7B 4UAIA 1AZQA 4B3ML 3I4NH 1PA6A 3QHTA 2C60A 3RFZB 2JP1A 5C4ZA 1WR1A 1YI2A 1L6VA 4HMIA 3NQIA 2M19A 4GNXA 1EU3A 4RAUC 1VS0A 1QVGA 2F0HA 1RF2D 4G11A 4ZRPA 1EU4A 4DV3L 4A76A 3I4OA 2M8SA 1P9DU 2NVXB 3NEMA 1D5XC 2JA8H 3EFUA 4WJQA 1IZ6A 3DXJC 1DGJA 3HRDD 1D5MC 1F9RA 2Z4HA 3PIOA 3MFGA 5DM73 1HUNA 2N9PC 1V1PB 3KF8A 2KZRA 2QMTA 4LDTD 3G7LA 5KNBA 3UGBB 4TRDA 4A3FG 1U5KA 3AEVA 5COYA 1EY0A 4UPAA 4A93G 2BS2B 2PMVA 4JI0L 1S72A 4NQLB 4US8A 3PLUA 4EQNA 2PW7A 3GTPH 3ZDTA 2NVUI 2B2TA 1J9OA 1P3QU 3JSVB 1JMLA 3A9KB 4A3GB 3VR6A 5E6PA 2LEKA 1V9JA 3NG0A 5LLIA 1S5CD 4OWTB 5IE8A 1ZOYB 1FNWA 1E8WA 3DPDA 3HK0A 3QX1A 1OXVA 5LXIB 3LNNA 2GVBA 2LD9A 3C3LA 1E1OA 4HKZE 2WP9B 5HURA 1WI0A 4U68A 4FYDA 2LGSA 3GTGB 4LFBQ 4DV4Q 1C4PA 2WXPA 3I3TB 1FM0D 1JQ4A 4CDEC 3HOXB 4S3SA 1JQYD 1I4RA 2KCTA 2MHJA 4W9LA 3UE1A 4RWSC 2G1EA 2Y3AA 4P16A 2R6GA 2KX0A 3W1SC 5AEKB 5IGBA 1VQ7A 3A54A 4DR5L 4EZJA 2EE1A 3T51B 1MSGA 3H94A 2PZTA 5I4DA 1FXAA 1N60A 3BYTB 3UQAA 2K3UA 2ZNVC 5JJZA 4XWTA 5BMGA 5K36G 4PG3A 3CMMB 3QO2A 5HGQA 4DR7Q 1EOTA 1LACA 4N9F4 3BIID 2F0WA 5GROA 3ERQA 4JI8L 4FNFA 1QZEA 3A4SC 4LF7L 4WWPA 4GNXB 4KJOA 4OO1H 2ZVOA 4XDDA 3NSWA 3M7NA 4NKLA 5IP9G 2MA9B 5IA7A 1KRHA 3RULA 1T5XD 5CORA 4J6IA 2CW0C 1RCVD 1RYJA 1UE1A 1FJGQ 3RI7C 4BZAA 2Z4IA 4A3IH 5IYBG 2DY7A 3L0OA 2WXFA 3HEJA 3JYUA 4IJHA 4W9GA 1V1OA 1Q46A 3KF8B 2GN5A 5ISRA 4MSMB 5CBAE 1JE5A 1G8ZD 4L5RC 2M1MA 1WH3A 1L0XB 1VQAA 2PTLA 3D3RA 4EQPA 1PRTC 3WAMA 5M5XB 1PGBA 4C80A 3ZJVA 1TZOA 1ICFB 2V4IB 2QCPX 4P75A 3H0GB 5G5HA 2B76B 1AP0A 1HNWQ 1BUIC 2MJEA 3BY4B 2DNCA 4OZAA 1MHWC 2BOSA 1C8CA 2LVOA 3HKZE 1U0LA 3D6WA 1F2RI 1IGCA 2QHOA 4ZKCB 4IFDI 2F3WA 1CMXB 5LMUQ 1Y56A 4K6LA 2K22A 1JMCA 1JW9D 2BPSA 4X65L 5CHVC 4C3JG 3EROA 5FO8B 4A3JG 4DAPA 3S2HH 1IBML 1VQ5A 2D3AA 4N6EB 1A63A 3NXWA 4IZ8A 1A2TA 2GI9A 2KWVB 1F2RC 4DV5Q 1BCPD 3ICEA 4XGAB 1PRTB 4R4CA 4MACA 2JK8A 1SNDA 1T0SC 2W82A 4GB9A 4CHTB 4RGTA 4JYAL 4BY1G 4IUUA 2LXCA 2WX0A 3UI2A 3E0JA 3HKZB 3Q0AA 1LTLA 1FXTB 2EDGA 2ICIA 4C7ZA 1VQKA 1JC7A 1EIGA 5C3EH 4Q2JA 1FXIA 3NE5B 2F4VL 3KQ4A 4OX9Q 1EQRA 2JRIB 2OF1A 1S3SG 2F0EA 4O42A 2NVYH 3J80c 1ZP0B 3HOZB 5AJ3L 3KOJA 1NVID 3TBIB 4FHJA 4KJNA 4IWOA 1XMOL 3DLLA 3VTVA 2L05A 5D65A 3J81i 2JA8B 1SMXA 4NXML 4IKGA 3ZW3A 2K8BA 4K14A 2I5MX 1OXXK 5DPTA 2K75A 5DLQE 5FK9C 4KGSA 4POFA 1YNTE 4YTMB 1SJHD 3APCA 3DM1A 5IOCA 4ANVA 1EFID 1MI0A 4IOCA 1P0RA 2BYEA 4ANUA 3HOVB 2HDEA 2PLPA 3K57A 3RZWC 2WGSA 2JA5H 2NN6G 3N30A 2JSVX 4HJ5A 2BT6A 3U50C 2LXKA 4CJ2C 2RMMA 3PMFA 2IW3A 3DBLI 4HJGE 5TR5A 1H8CA 1X3FA 3S1NB 3H8HA 3CPWA 4HWIB 1DOKA 2KENA 3K5OA 3RN9C 4G7ZC 1W2BA 3S1QH 2IX3A 1YIWA 3JAMi 4GXBA 4OHJA 5EJWA 3ZO5B 1E7PB 2B2WA 2A68D 1ONLA 4X66L 2KQ3A 4FF4A 2QIEB 5JEAH 1IKLA 1MBYA 3LX0A 2N3SA 1KLUD 2WU2B 4HCNB 2WDRB 4OWXB 1YBYA 5C6AA 5NUCA 2EPBA 2JF5A 2JXXA 1C0AA 3KUPA 1VQ9A 1KJTA 2MHVA 1EO6A 4E6IA 2D11A 2D0OA 2RDGA 3HGBA 1MHHE 5JJLA 1TWCH 4YCUA 1PH5A 2K39A 2CH4A 1ZYRC 2F0OA 2RCFA 1KF6B 2X69A 3A5UA 4QY7A 3CRKC 2BYVE 4LLGM 3D4RA 1LLRD 2O5IC 3G48A 3LJ3A 2BS3B 4N59A 4TQUS 4TVAB 5IWAQ 4DUYQ 1YJWA 4X6AH 5M5YB 1OFFA 2PE9A 2V3NA 4C00A 1S40A 2EQSA 1VD2A 2BKRB 3FC4A 2D62A 2ZPYA 3GD7A 4KSKC 4LF9Q 4KHPQ 2D07B 1NR2A 1YNXA 4QL5A 2B63H 1PVOA 2ZW1A 1VQIA 4IPCA 4GOPA 4X62L 3FDTA 2A6HC 1LTSD 4X64L 1QLBB 4WWNA 2Y0SG 1E7ZA 3EFCA 2C35B 3MXNA 4X3UA 1SR3A 3DBLB 3WAPA 4A20A 4S0RA 1XMQL 2MW5A 3FHWA 2VQFQ 1WSPA 4IOIE 1SYBA 3HOYH 2A6ED 2PZWA 2ONQA 4ZHPA 1E2WA 4R3DA 2A73B 5IKCM 2HE7A 3PTFC 1WX8A 2MBQA 4A55A 1TJEA 3EN2A 4XT1B 3K7AH 2PW5A 4R4IA 1D2BA 4LCDE 2JYTA 1N32L 4ZRKA 4KX6B 2INNE 3UDIA 3KW5B 1U4PA 3BDCA 4Y52H 4B3SQ 2G4DB 3ZQ4A 4CGYB 3SXHA 3T53B 5JH5C 4E3CA 1A62A 1LTBD 4JWUC 4JE3B 4JV5L 1MSHA 1SF0A 3AEEB 4WWOA 5JEAJ 1X1MA 2K5HA 3TREA 1RLFA 3X0WA 2LJIA 1JWBD 2AWOA 4QMGA 4R8IA 4DHJB 3K9PB 3QK0A 2UYZB 4A3PA 3V96A 4JC0A 3TIXA 4DAMA 5KYLA 4OWWB 3F2DA 3I4MH 4A3EG 2Z59B 3AU5A 4A3FH 3K0XA 1NJIC 1X6OA 4JK1C 4NAWA 1L0VB 1BBUA 4R4TA 3I3CA 4A93H 2Z6KC 1LTAD 4M1UB 3HOWG 5ELEA 3RUIB 3C8YA 3ZNID 4KI0A 1VQPA 2MBBB 3M3JA 1O7LA 1UNSA 1N61A 2G9HD 3AULA 3Q6BA 4P1BC 2AUJD 1PUTA 1XD3B 1I3QB 2PVOD 2MCNB 1SEBD 3Q3JA 2JQRB 2X8XX 3DWMA 4HCEA 3OG5A 1GB4A 5D3IB 4QQBX 1KABA 2LY7A 5IODA 2DAJA 4APVA 4XT3B 1HXYD 3CWIA 1EWCA 4GOPB 2A19A 5EQ0A 2F0QA 1FVIA 4GKJL 2GBMA 5J39A 1PYBA 1Q3LA 1OEYJ 1PLFA 1WTPA 3AE7B 3B2GA 4YTPB 1SNPA 3VRBB 4R8NA 3TS2A 1EF1A 2KDEB 2NZOA 3KYHC 1KRTA 2KACA 5EDSA 4IPDA 3MC0B 2EYLA 3ND8A 3SDZA 1XT9B 3AE5B 2LASA 2WQYB 1O7IA 5CC4A 3ZXRA 4K2LA 1I94Q 3GOEA 1WE6A 2JXMB 2K5VA 3L3OC 1WX7A 4KIKA 4KHZA 1OEYA 4IW0A 1Q12A 2J0KA 5K36H 1ESRA 3ERSX 2MO0A 4OVZA 3U7DA 4FXGC 2WP8J 2NB0A 2HTHA 1CUKA 4A3DB 1EWHA 4YSXB 2LRWA 1ISNA 2TSSA 4BKTA 5IP9H 4DR3Q 1G91A 3EQLC 2YEPF 3V60A 4C3IG 1P98A 2WU5B 4ULLA 4XIGS 3JW0X 3BK1A 4LK0M 1PZJD 1V9PA 5IGDA 1JT8A 1UUPA 4KN7C 1UBQA 2RPVA 5E1FA 1EY6A 3GQBA 4IM2A 1NYQA 5IYBH 3GV3A 2OTLA 4GMVA 4DR6Q 1XLPA 3KJOA 2RDFA 2J4XA 3OW2A 3HS0C 3RLFA 2UUAL 5FLXc 2ZJQA 4HXDA 4NAWB 4ZDVA 4ZUIA 1Z6HA 3L2PA 2HHHQ 4K1RB 1O78A 1F77A 5C4JH 4FLHA 4HJ9A 3QAQA 3V61A 3M63B 2MBEA 2B2UA 2Q2IA 4TQ1A 1YJJA 3I73A 1HHVA 5C0XI 2R92G 1QILA 4YIJA 2MEKA 1H9MA 5AZHA 2LGXA 4H0LC 2KQSA 3LXFA 1O7ZA 4DF7A 2ZJDA 3VR8B 3GV6A 1EFWA 2MX2A 1WD0A 1MJDA 2K5WA 2CWPA 3MEFA 3VYSA 1E8XA 3MHZA 4FXDA 1AE2A 1YNNC 2DZIA 4EUTA 3T1HQ 2N88A 4WQOB 3KDFB 2GBRA 2B3AA 3SR1A 2I1JA 4UP7A 3PCOB 4HPMB 1WJJA 3K0YA 2EJFC 1WGYA 3PO2G 3J81E 4C3HG 4MGIE 3TP7A 3NZ3A 5AFWA 4C3JH 3ZRCA 4I6LB 2KMMA 5C44G 4A3JH 1K8AC 5KNCA 3T3NA 4OGQC 2AYOB 2L5TA 4IFDG 2RCNA 3K80C 1RAXA 1S1QB 1PTOB 4N58A 1XEEA 2EOTA 2L0TA 1XNRQ 4KIKB 3QIJA 3VXWA 4B3TQ 2IY0B 3L10B 5J22A 4BY1H 1YNJC 3CQZH 1GUOA 1KIXA 3B2FA 3VHTC 4D2KA 2WB1B 4QUCA 4K6DA 3P75A 1SFOH 4PZ8A 3JAME 2INPE 2E76C 3NUHB 4DWFA 1C76A 4C2MB 4EE2A 3H1UA 5IY0A 4M02A 1N33Q 3KH0A 1ROEA 5DCNA 1VMPA 5G55A 1A3VA 2BYFA 1EY7A 3DVNV 1NEKB 2K5QA 3MTSA 3D4WA 3ENEA 3ONAB 4MHEA 3OW7A 2BGFA 2EY5A 1DCZA 1PMRA 1HNXL 4XC2A 2KWUB 1BO0A 3K81C 3K6OA 5G3LD 3HKSA 2J7ZA 1S5BD 4MTNA 1ZEQX 1N6ZA 4GSWA 2WS3B 2LFIA 1QOAA 3NVZA 3ZJUA 3RZOH 4LJOB 4LK1C 1PGXA 3GZNI 1TKGA 1EIHA 3C0RB 5BO4B 5DPWA 1R4MI 5IGGA 1YZ6A 4KD3A 3I4MB 5C2TB 3SDLC 4PS8A 3R7QA 1II3A 4WFN3 2XIWA 4JX1C 3PIP3 2NN6H 1ILPA 2E2IB 4R4QA 1IYJB 1DXMA 3BZKA 1HR0L 3NENA 1MI2A 3U7ZA 1K83B 1TY0A 3P1HA 5D3DA 4RKLA 5A2QL 1WY8A 3ZIMA 4MM3B 3AFQA 2D3GA 1TIID 2H89B 3QJYA 3MZ5A 4A3MG 1AEXA 1YEZA 4BY7B 1RD9D 5J1ZA 2KJRA 2N0SB 4LFAL 1R7SA 2KLGA 1QOGA 4IG7B 1F9JA 3BS1A 4BXXG 4UY8C 3KBXA 2KEDA 3AE2B 1W6JA 2HTME 1GD7A 3SU8X 1I6HH 4ZRQA 2J52A 3RLOA 1PTOF 2JZZA 2PNRC 4HJ8A 4DV0L 4YT0B 3PPAA 5G2NA 2NVTH 2K7VA 4ME5A 4Q5VA 5LMNW 2RGFA 2Z6BA 1GHJA 1TS5A 5L83A 2H1EA 1Z9FA 2G45B 2KK8A 2I07B 3PF4A 4CKEA 5M3MH 4LNQA 4KGTA 3MJ5A 3GE8C 1WZ3A 1QWYA 2MLBA 2WWZA 2CS4A 2DZMA 1B8AA 4GDLA 2EVBA 1I4QA 5CHWA 3RT3B 1PFNA 5I6WA 2EY1A 4OZBA 2A5UA 2K25A 4RMAA 3GZNB 1FO4A 3MFYA 3VH3B 3SGIA 3K5MA 1R4MB 1IBLQ 4KTAA 4L23A 3A8IE 1XNQL 1HJPA 1BVSA 2WIIB 3OWEB 1GG3A 1D6EC 2YU9H 5CMDA 2OWOA 4GDKB 4YHHQ 2KN5A 5BYQA 4HJKA 3ZLZA 2MPMA 1ENFA 2UWQA 4YL8A 3VR4A 4E71A 2JA7B 3I63C 3ZKJC 4ACFA 1XLQA 2LSSA 2C9WB 3AECB 1HEZE 3A5ZB 5J2RA 2PW9A 3U4VA 4JI1Q 2VUMB 1TVXA 1QE6A 1NBFC 1KH0A 4FP5D 2ZEQA 2K6AA 3N20C 3GTLB 4LF4L 4IOAA 4FF3A 1C79A 5D2MB 2Y5CA 3TP5A 3PUWA 4JVZA 4ARCA 1EZ6A 1L0WA 2JEBI 5IT9c 1CI3M 1IPGA 3GE3C 4LFBL 2W9NA 4G57A 1IW7C 4DV4L 3W3AA 2G5DA 4RGOS 1SNMA 1YX6B 4XZ4A 2NZHA 2F4IA 2KHIA 3TEYA 2E2JH 4LF5Q 1ICWA 4IM0A 2KVRA 1HZ6A 3MHSD 3CF5A 2IX0A 3PUVA 1G2SA 2D5DA 1X3PA 1F0ZA 2EJMA 2X6LA 2GBKA 2LI5A 4W9IA 2RHQB 3DOWA 5C4XB 2BS4B 2JPHA 3H91A 2JA6G 4ME3A 2OJRA 1A3UA 3N32A 4H2AA 1MJEA 1TKWB 4X3KA 3HUIA 4BBNF 4MIUA 4BBSG 1V5OA 1R9TH 3BVMA 4L8JA 1C9FA 3M4OH 4WAAA 4JOIC 2J0TD 2EYHA 3P7JA 3HOWH 3D32A 4M8NA 3JC66 2SDFA 4DK1A 2VB3X 2HQLA 4PS3A 3NJTA 2LGIA 1V43A 3S14B 2VH2A 4OIKA 1AYFA 1ZXHA 3Q3OC 4K8JA 2MP1A 2PCFB 1XJVA 1ZKOA 4A3CG 4TSSA 5M5WH 2LS01 2XVSA 3D31A 5BR8Q 2DWQA 2N4FA 1FJGL 3Q14C 1H95A 4PNYA 2DY8A 3RZDH 1GAQB 2WXOA 3A9JB 1WTWA 3T3OA 2MSED 5BMIA 2M0XA 1SXTA 3KYDD 1M90C 2MH7A 2BVCA 5AZFA 3M4PA 4DGZA 1E6EB 2QJLA 3GO5A 3ONSA 1Z7TA 3RD4A 1WTQA 3M4YA 1F52A 4EKUA 3S15H 3MJWA 4JCVE 3SFDB 3VH4B 1HNWL 4HTHA 2GVAA 4WJOA 1X3EA 2R93G 3M7GA 4BOZB 2PQEA 4H44C 4PMBA 3ZNGC 2UXBQ 4LFCQ 3FAHA 2QC8A 3NVVA 4P1CC 4LUZA 4XWWA 2RSOA 2NVQH 1DM0B 2IO3B 1WFYA 3PO3G 5LMUL 4LJPB 4C3IH 1B9MA 5CTRC 4HVBA 4CDDC 1J0GA 3J7AV 1WGDA 3FKIG 2XRSD 1A0IA 1VLBA 1NMFA 4O1NA 2GA4B 2L8JA 3W5OA 2VQEL 1WTXA 1YITA 3CCVA 4DV5L 1HZ5A 2K50A 5C5LA 2L76A 4W9JA 1RM6C 3DVGY 1H9SA 1WR6E 1BF4A 2EELA 5FLXL 5IP7G 4K5VA 3CCSA 2WAQG 1FR3A 4JQWC 1I6HB 2QDLA 2NYZD 1IUEA 3RR5A 3QOLA 2KNBA 2R92H 3AYHB 2CHZA 2NBWB 4OX9L 2KDFB 2CFMA 2FCMA 2LGDA 1VQCA 3UDXA 2KDIA 2EYOA 4JBKA 1A3TA 5CHFA 5M3MB 2R7FA 4BKGA 1S3OA 3RNFC 3TP8A 1BOSA 3DWAA 4RH6A 4G4KA 1HH2P 2ID0A 2DJGC 1KDCA 4ODGA 1IHZA 5JVG3 4ZK9B 2XWJB 4KD4A 1YJNA 3PO2H 1AWDA 4C3HH 4OW0A 2J53A 3FKYA 4KKTA 1JR0D 3IG3A 2FNJB 5C44H 3ZVVA 3AB9A 2R7ZB 4CO7A 3OOCA 1UEBA 2BE5C 4GNXC 1XO3A 3PV1A 3I4LA 1KLGD 2BW2A 2FAZA 3DUZA 3GTOB 4A8XC 3HOUB 4IALA 4NXNQ 1XTCD 2F0KA 2W3SA 3DCGA 3S1RB 2E5LQ 1Y1VB 2Q2TA 4GLAC 2KVZA 4R4OA 1M8AA 3VUXA 2NWGA 2JUOA 1NUCA 1SSOA 4AQYQ 4EVOA 1GJZA 2HQEA 4FF2A 2KMAA 1GUGA 3GS2A 1VQBA 1IP9A 4RMFA 5IGEA 5IYCG 1G2TA 3OYYA 1ENAA 4WJNA 1VDZA 2AWTA 1EYAA 2MBOA 1NAPA 3NWTA 1EEFD 3HHMA 2QW7A 2KX3A 4IN3A 4YWMA 3S17H 5EPJA 1D1KA 2B2TC 1BNZA 1HRJA 2W55A 4G3XB 1EYGA 1PH9A 2IDYA 2BH2A 4GLXA 4IUTA 4DAYA 3P20A 4CYEA 4JI3Q 2E3TA 2ZW0A 3SHQA 3T1YQ 2F0TA 4DXAB 3RNUA 4WJPA 2WXQA 1QZHA 3Q2AC 3NVYA 2L1BA 5M3FB 4A3LG 1JCKB 1JJGA 4RKBA 1FRRA 3UF8A 3GTJH 3NTHA 5K5PA 3V05A 2CVRA 1Q10A 2H5XA 1J5EL 2ZM6Q 5IWAL 1EWIA 2ZVNA 3BVZA 4RA8A 4DV1Q 4HLEA 4UHVA 3IT6B 4ANXA 2LHEA 3OIPA 2KHSA 2JYEA 2KTRA 3VR9B 1HNZL 2RKSA 4LAAA 2EYPA 4JI4Q 5JHBA 4ICVA 5AUIA 3SK5A 2F0NA 5M9OA 2NS5A 4UP9A 4A3MH 2LKVA 3KF6A 5FKAC 3OIQA 1WJNA 4W9CA 1KAAA 3IL8A 2VQFL 4IUVA 1Q7YC 1TKYA 4ID6A 2IO2B 4BBRB 4BXXH 4IJLA 2IGDA 2GBNA 3BDLA 1Y1WG 4A3KB 3KFUA 5HY6A 5GAGC 2CCZA 2CJOA 2L32A 2PYKA 4A75A 4NP5A 1EUVB 1SNOA 3RMHA 2ASQA 1CZGA 4MJSA 2OOBB 2N9LA 2XEWA 2I2YA 3F8TA 3PLVA 3EA6A 3WDNA 3Q24A 4V190 4WURA 1FD7D 3SEBA 2E2HH 5LL6S 1C7YA 5EE3A 4B3SL 1BDOA 4LF6Q 4UP8A 1X55A 5EKKA 3KUCB 2K03A 3STBC 1S5FD 3AN1A 2F0GA 1GUTA 2K5PA 3NHEB 1OQQA 1VQ6A 5I9OA 1NI2A 4Y7NH 1LV9A 1UD7A 2WNMA 2F0DA 4OEMB 5CYUA 3TZDA 1L4ZB 3VAWA 4PV1C 4EZKA 3D8GA 4GKKQ 3TBLD 2HT1A 1E90A 1UWMA 1UAPA 1WOCA 1W6KA 2DZKA 1V49A 1GJXA 2CWAA 1GXDC 1K0RA 3J7A5 4DUZQ 4I7ZC 4DV2Q 1QNUA 1WYDA 1MG8A 2O6VD 4KZ0A 1X3QA 4BS9A 4H7BA 1OGWA 4NPSA 2AEHA 2CHWA 4C7YA 3I4NB 2FE8A 1B9NA 2C9OA 2OHFA 2OXPA 1WCMG 5EBDA 4YY3L 1WF9A 2Y5BB 4HJAA 4HKQA 4A3BG 2N7JA 1KOTA 2M0AA 4IM3A 3GDEA 5ELCA 2YTXA 2I5HA 3VYRA 2V1CC 2I0QA 2IX1A 3DMUA 3KWLA 3IAS1 2C5LC 2D10A 3U9SA 1K52A 3P63A 4QJFA 3D6CA 1C78A 2GMIC 2FMMA 3QARA 1RHPA 4DNRB 5IT9L 1L1OA 4GLVB 3DWQA 3DVGX 2R3ZA 5LL6X 3GTMH 3KF6B 4OO1I 4CDCC 2WXGA 4NPNA 1ZUD2 2RBMA 3IKJA 4ZYSA 3DWPA 1WXVA 4JI0Q 1UZXB 2NVQB 2VRRB 3AEGB 3H7PA 4P6VF 3J80E 3GTPB 4ICUA 1LT3D 3FMCA 1X54A 1EIFA 1VQ8A 2NZ1D 1I94L 4IC7B 1QKZA 4LNFA 3H15A 4NAMA 2Z8LA 4B0MA 1LO5D 4BBSH 1WM3A 1E7UA 3J7AF 1F9PA 2K0PA 3CMEA 4C1NK 4O2DA 2GRIA 2IHEA 4A9AA 1M4VA 3LYYA 4IUQA 1Z2MA 3ABVB 2I5LX 1F9SA 1Q8IA 3L4PA 3NQTA 1QOFA 3BU2A 2VZKD 1G6JA 4RGNA 2K5DA 2M00A 4P2CB 1TYGB 5ELOA 4OVVA 2XN9C 4AQ7A 1SGHA 2IL8A 3IFDA 2E75C 1TWAH 3A33B 2B2YA 3DM3A 1QOBA 2UUCQ 4P71A 5A2QE 3A7LA 3S1MH 1ZW7A 1S5DD 1C4AA 2KDMA 4FA6A 1I50H 5FO9B 1DGSA 1SN8A 3K7UC 2HHHL 3S16H 2ES2A 3QWZB 1SE3A 3GTQH 2PPBC 4XQNA 4DKAC 1YN4A 1ZDVA 3M95A 2B2WC 1GM5A 4LF7Q 3PT2B 2JXTA 2KJXA 4DR4Q 2QCZA 2AKWB 2F0FA 3PIPA 3I56A 3I5JC 4JIOU 1WMHA 2F0MA 2JU6X 1YNND 4KY7A 2K1FA 3K9OB 2R93H 1YQBA 4MEMA 1PXUA 2L7RA 4URKA 1VQLA 1CTMA 3J9CA 2KOXA 3AEBB 1GC6A 1ILQA 4A3IB 1L1OB 3KYCD 4HIDA 3WALA 3MXPA 3DHHC 4EX5A 4RM8A 2HCCA 1SJED 2HUGA 3CP0A 1WD1A 3PO3H 3NS1A 5H92C 1WJ4A 1QNKA 4DPGA 4PK1A 1TQOA 2WKCA 3FKIH 4JI5Q 1DZ1A 4A3GG 1JORA 4C4VA 3CPFA 5FR6A 2NPTA 3A8KE 3H7PB 2J0JA 1SNQA 2F0SA 1X32A 4QF4A 3ZXVA 3OAWA 3QJZA 1D7QA 2ATWA 1WXQA 1PH1A 2DN8A 2YEPB 2KUMA 1QCBD 4ASWC 2YV5A 3T16A 4B3TL 1TWHH 3C2PA 2BF8B 2SEBD 1VZ8A 3HOXG 4GOPC 2QEJC 4KK7A 5IP7H 1FGUA 4XYCA 4WWMA 4DR1Q 2K32A 1NDDA 3DVNU 4JL9A 1SMYC 2O6VA 1NENB 2N1VA 3GTKH 1V6EA 2WYQA 2XGTA 5I2YA 1N33L 1K51A 2KT7A 3P42A 1N5XA 2K1BA 1STNA 4X65Q 3UDFA 2IY1B 1JOOA 4LJZC 4X3TA 1L6UA 1E1TA 1V8CA 3ULPA 2WLBA 3S2HB 2D2QA 2ZXPA 2PE6B 3V62A 1U9RA 2OJWA 3AM9A 4JBJA 1E8YA 2IHFA 3T56B 1PYWD 1WX9A 1E9MA 2KVMA 1CFMA 4EZLA 1DOXA 1GOZA 3NBHA 1KNEA 2EMSA 3EUB2 1DOLA 4MTKA 3KLSX 4PQXA 2JX5A 4A4IA 3QC8B 4FXCA 2M4NA 1VZ6A 3R93A 1WGHA 2RF4A 2BTEA 4N9TA 5FLMG 3KUZA 3CAMA 2Z0DB 4MGZE 1JOQA 1RJTA 2Q2HA 5KHQA 5C3EB 4RHSA 1VRAB 1H4RA 5IYDG 1WMHB 3MXNB 3D4DA 2F4VQ 3CIRB 2K6DB 4MT5A 2JVCA 1BKBA 3E3XA 3I8ZA 4KV2A 1LM0A 4DXGA 2R2QA 1B3AA 1X3GA 2NVYB 3KLWA 2WXHA 3BWUD 4DV7L 3L0WB 2GOWA 1I4XA 4DR2L 4I6PA 1FIQA 2RHSB 4LUVA 5IYCH 5EE9A 1JWUD 2WINB 3TQYA 3ULJA 1G6ZA 2OT2A 2A69D 3SR6A 4K8IA 1EQQA 3PGEA 4JBMA 4XYOA 4Q0FA 3H0GG 1ZKHA 3G4SA 3IAM1 4FVMA 1B3QA 1J7CA 4NXMQ 1PDXA 5JJIA 3C1EA 2WFWA 1DOMA 3PUXA 1PGAA 1BCPB 1QG7A 2LFNA 1RTOA 3CU7A 1BBXC 2WHIA 4AYBE 1I7HA 3IVFA 4HSVA 1HCZA 3TN2A 3TUOA 1LTRD 1XQQA 2YLMA 2MO1A 5CV7A 4F7XA 5EPKA 2JA5B 2L1AA 2L4NA 3N1ZC 4XDXA 4A3LH 4RCNA 4DA2A 3CXCA 1A6XA 4QB4A 1EYDA 3C46A 2D9UA 3S1QB 1IYVA 2EXDA 1I35A 2JJQA 3B08A 1WRIA 2WDTB 3QB3A 4IO9A 3KJPA 3B9JA 1KAWA 4J6HA 4MNOA 1PH7A 1LXDA 4US9A 3VR3A 4HSPA 1C77A 4DK5A 2L52A 1PTOC 1NE3A 1Q0WB 4OIJA 2A68C 2F3IA 3Q23A 3CCLA 2UXCL 4HIMA 4V0BA 2Q8RE 1Q86C 1IBLL 2WACA 3HKZG 5F2DA 4EQ5A 3CCUA 3AU7A 4POGA 3VA7A 4AYBB 5HFYA 1JROA 2ZCCA 2EYMA 4LNOA 1L2NA 4YHHL 1TWCB 3NTKA 1WIAA 3MWYW 1GNUA 4M8AA 2K52A 2BQQA 2JYOA 1WJ6A 2A4ZA 1VF5C 2WB1E 1BT0A 3TEWA 3HOZG 1Y1WH 1AARA 3ZGZA 5C23A 3F2UA 4GS3A 4JI1L 2L3ZA 4B9XA 1MVKA 2MP2A 2K28A 2HJ1A 3S16B 3NK9A 4LW1A 3W2DA 2BB5A 2V0GA 1FGBD 4JI6L 1Y8PB 3AQQA 2ZXRA 4RGMA 2IWHA 1B1ZA 5CR3A 1QZGA 3GTQB 4FADA 1CA5A 2B63B 1IW7D 2JA8G 2KFKA 4MN3A 4X64Q 3PRPB 4JI7L 2RR9A 3PO0A 4FHKA 1QB5D 3V3XA 5EPLA 2B2UC 4DV6L 2JZPA 4K0KL 3HOVG 3HOYB 3E9SA 3PSEB 4HRSA 5FJ8G 1FYCA 2CKHB 4HPPA 1HQRD 3GP7A 2IYDB 4PYUA 4AJWA 2A6EC 3BG3A 1BCPF 2DAFA 1ET6A 3TZUA 3K7AB 5JPNC 1EM7A 1WXAA 1WXSA 2REXA 3AH7A 3KLRA 4FO2A 4XQQA 3NP8A 2UUBQ 1WCMH 2VY3A 4B6WA 2XK5A 3PRZA 1QUQA 2EIFA 1S4ZA 1VQ4A 4BWGB 1N63A 2B2VA 2RDHA 2EY6A 4A3BH 2LZ6A 4C1NI 2W3RA 1MFWA 1NTGA 4JV5Q 3LGJA 2N7DA 4I6NB 4MGKE 3H6MA 4CKCA 1WM2A 4WORA 2FBWB 4YWLA 3E56A 5KIXA 2MUYA 2LHDA 1Y8OB 5BR8L 4BBNC 3FPPA 3R2IA 3DBRI 1DOYA 1N5WA 1L0YB 1I42A 1EQVA 4DFAA 1WWTA 4IPGA 3KWVA 1HQMC 4N8X1 4QUFA 2BDNA 2L0CA 5KNDA 3NOBA 4AIMA 1BR9A 3PQIA 4A3FB 4YWGG 1TWFH 2CKZB 1CSQA 5C1ZA 3OTOQ 2JSOA 1TS2A 4A93B 1RWSA 2KFJA 2QILA 2K8HA 1TWGH 4DDGD 5CV4A 3S2DH 1E22A 3MVVA 2MP2B 1I4HA 1YJIA 1CHQD 2OQKA 4EOYA 1F1HA 3QG1A 4J1MA 4WJ4A 1FFUA 2L11A 3BVGA 2UXBL 2KJ6A 2RDBC 3SFEB 1J19A 1PFDA 1B9RA 2G9DA 4LFCL 3A8JE 5DM63 4KN4C 3QA8A 4W9HA 5DNFA 3CMAA 4BKSD 1V97A 2KBNA 2Z9HA 3L17A 5TSSA 4M00A 4HEA1 4XDCA 4DK3C 1LGRA 1I4PA 3U9OA 2LMCA 3RPFC 1MGSA 1EQTA 1M94A 4AUQC 4ZYNA 4YSZB 5EGTA 3O65B 4BOSC 2D0PA 1EUJA 4MDKE 1R4NB 2KCCA 1WFQA 1TY2A 2AHOB 3J7ZC 2MNAA 4NB3A 4XXEA 2INDC 4B08A 4REZA 4KKIA 2IZVB 3K8AA 3DBRB 3H9DA 1ACCA 5D7GA 2XK5B 1QUQB 4G7HC 4KV6A 1WI5A 3EJIA 2NVXH 1CKMA 3VYUA 2C7NB 2IGHA 1WVLA 3QQ8B 3EGRA 3C19A 3VA5A 2XRQD 4CHKA 5GADC 3Q6SA 1XCQL 3N3KB 2LGYA 2N7EA 2DGYA 1XYIA 2CQOA 1G51A 3AFPA 3TSSA 3OMGA 1Y8RC 2Y5PA 4FJYA 4B9KA 1T6BX 1XWEA 5GQOA 2X38A 1YJ1A 1JWMD 2LXJA 2KLCA 4DHZE 3H3VH 2ON8A 4A3OA 1N34Q 2UUAQ 2MWSB 1T5EA 4KY5A 3L54A 1SE8A 2Z0SA 4K2KA 1WYWB 4H13C 1V5TA 2KYWA 1VCIA 3CHBD 4A3GH 1LYLA 2PVGC 3P4PB 5C4JB 4KDLB 3I72A 1HZBA 5LNK1 4QAYA 4OVUA 4ANWA 2BKFA 4TMAB 4PZ6A 1EY5A 4DN4M 4ZOHC 3BDOA 4NXNL 1X56A 4O0AA 1WTVA 4CDFC 2JWUA 1PFSA 2E5LL 2O2LD 1P7EA 1YOVB 2XTIA 1CQFA 1SYDA 1VCBA 2FUHB 3PHXB 3QCAA 5I9PA 3HOXH 4M01A 2N78A 2Q5WD 1UE6A 4AQYL 3PHWB 2ZT9C 3BJUA 1GO3E 1VQEA 2XBBC 4F8CB 1ZDXA 2JQOA 3BK2A 3ZTCA 5LMNQ 3CSFA 1GPXA 4F87A 2G4SA 3U58A 3W1YA 4DHZB 2PI2A 4KKSA 2DBYA 4B3RQ 2VH1A 3N1XC 4JGHB 3VVWB 2LMCB 2A5HA 2EZVA 4C3JB 2L00B 4M8MA 4A3EH 2INCC 1JALA 4A3JB 1HR0W 1B53A 5BN5A 1FRDA 2NN6I 1YVCA 5EKLA 4II3B 1HZCA 4DR7L 2SAKA 3DDCB 5HGTA 1KXLA 3NY5A 4A3DG 1D8LA 4JI3L 3V6CB 1CKNA 4GDLB 3WOFA 4KKJA 5J17A 2CW0D 3MTNB 5EE0A 3W5VB 4BY1B 4K5XA 3CCMA 3M62B 4J15A 3PUZA 3CQZB 2RSNA 1F2ZA 4RCOA 1SDFA 2ASBA 2V9HA 1SFOB 3PVLA 3MHBA 1JICA 2OEDA 4HDOA 4GN4B 5IYDH 5C3JB 3I91A 4U673 4DV1L 4BVUC 3K5NA 4AH6A 1PRTD 1U4LA 1T0YA 3DHQA 2EKIA 5CGKA 2DX5B 1CKOA 4A3BB 3EHVA 3WIMA 1LABA 2FJ2A 2K33A 3A7AB 3FP9A 2MFIA 4DNIA 4JI4L 5M5XH 1FCCC 3RD2A 4QIWE 1L5PA 2K05A 3UE0A 3AE9B 3I57A 4DNTB 2BYTA 4IWPA 3H0GH 2KEEA 5J3BA 3J80i 4YWKA 1V1PA 2LUMA 3OJ4B 4HJ7A 4DK6C 3RZOB 1K50A 3AE3B 2WXKA 3VRAB 4LNNA 1G291 1S5ED 1KC8C 1ENCA 1EWYC 4P7IA 3DEPA 4HDQA 4FF1A 5GXGB 3SHLA 4NY0A 3B1LX 3G6JB 1DOIA 4F7ZA 1GUWA 1TWFB 1OXTA 1PFBA 2KXJA 2LJ5A 2K04A 3CW2C 5GMVA 4L6TB 1JWSD 2P5ZX 1K73C 5ELBA 4LF6L 3AE8B 5E6NA 5KYIA 3TDQA 1A2UA 3PZ7A 4QIWB 2EJGC 1YJ9A 3ZDMC 4K3CA 2I1KA 3RNBC 3ULLA 4LFAQ 2UU9Q 3I9V1 2Y0SE 2CR5A 3AEAB 1RL2A 3IT4B 3ND9A 3AEDB 4R1JA 4DQOC 4R9WA 3NHHA 3P1MA 4DV2L 2BDOA 4JW0A 4JI2Q 2NVTB 2RPQA 3W1GA 1LQBA 1NSNS 2VZAA 2E74C 5DAUA 1CA6A 4KSLC 1B44D 2DHZA 3HOZH 1PZID 3EECA 3Q3FA 5JHAA 1SLJA 1X9NA 4A90A 5C0XG 4BA2I 2M9VA 4Z9CB 4DXFA 3J81L 1V86A 3MAQA 3Q3NC
chains in the Genus database with same CATH topology
1J7BA 1GHKA 1I6VC 2F1MA 1IKMA 1O7YA 3QIAA 2L55A 4IFDH 2Y0SB 1FFVA 1XLNA 3OWFA 2YU9B 1HFNA 3K58A 1DYQA 4HROA 3W1SA 4WAFA 1RTNA 3MXGA 1AZPA 1NI3A 1AFPA 3LWEA 3JAML 5KEEA 3S9WA 1KNAA 1SYFA 3K5LA 2EYJA 4CBVA 1MD2D 3NRZA 4KY6A 4KMUC 3URYA 1SIJA 3KBGA 3SK6A 2WXLA 4K5WA 2NBFA 4CQNA 2E2JB 4J8QA 1H9SB 1Y8NB 3A55A 1V8QA 3FPUB 5IGCA 3W9CB 1ZYRD 1OXSC 2MJ8A 2WXRA 2B39A 4NDXA 4HEDA 1WGKA 5G3LF 1E2VA 2EY2A 3V2TA 4A3EB 3NWSA 2KQ4X 3PUYA 1EEID 2JE6I 1R9TB 3H09A 3W5UB 3M4OB 3P4SB 3HOWB 4CKBA 5JVH3 1DONA 1WYGA 2A6HD 3I90A 2AWNA 3Q8CA 1EZ8A 5M5WB 1KDAA 3Q8BA 2XNAC 3O13A 4PT5A 3NBIA 4IFDJ 3RZDB 5EE1A 5JXVA 4DK0A 2L83A 1QOHA 3P4RB 4XTCS 3N9YC 1EY8A 2BA1A 4WRDA 2AQ3B 3S15B 1HUMA 5DEHA 1C4CA 5HI1A 5BYRA 4XYQA 1SMYD 4KHVA 2AQ1B 2BCOA 1I4GA 4C3IB 2Q8TA 2WDVB 3AE6B 2R61A 1BXTA 4CJ0B 4G7OC 4XE0A 2IPKD 3BZDB 5BN4A 1U4MA 1D1IA 4N9PA 5AUKA 3AMZA 2L9HA 4XQJA 4WJWA 3CKIB 4RNAA 1J7AA 1MHXA 1C48A 2Z1CA 1H9RA 2MJ3A 3E6ZX 3OMCA 2KN4A 3X3NA 5E6JA 3HG9A 2R92B 1ET9A 3NPPA 3SK8A 3E5SA 5A35A 4QCLA 2FFKB 2AQ2B 1K53A 4IURA 4IQZA 4JPSA 1ML0D 2CQAA 3FEWX 4ZAIA 3PO2B 4C3HB 2EYFA 4FXKC 3AE1B 3AB5A 5C44B 3R8BA 1XXGA 3SE0A 3SVMA 3NUCA 1SSNA 1RODA 2B8FA 5KRUA 1CHPD 2DYMA 4EGVA 2I46A 1HTPA 4TQ0A 5BMHA 1N62A 4WH4A 3PV0A 3K59A 1TS4A 1F9QA 2YYZA 4DU9A 3DEOA 4GLSC 1QT9A 1F2MA 4ITKA 2NTSA 3HVDA 2FUG1 4ZUJA 2OEOA 2PKOA 2H88B 1EY9A 3NTIA 1PTOD 1XF5L 2WXMA 3S17B 3U4EG 1CZWA 3LB8C 4TKOB 5D14A 1SAPA 4JBWA 2IT1A 5E4XA 2WKDA 1SBBB 2PMZB 1OQRA 1OO9B 2C5CA 2KCNA 2DNEA 1PRTF 1ZXTA 1HPCA 3U52E 1OXUA 1K8MA 3GTJB 2ICEC 3U2SC 1CQVA 4AS1A 1Q90A 4RF0A 1F2LA 3PIO3 1SB3C 2F03A 2IJ0A 2B2YC 4C56C 2RA4A 1VR9A 4NJCA 1KFYB 2B8GA 1FCLA 2F0PA 1PTOH 3ZYYX 2I38A 4A3MB 2HDMA 1FNVA 1TS3A 1YNJD 3FRPB 1BQQT 1LT6D 3FVQA 3T4AC 2V4IB 3SK4A 3Q8FA 2KECA 1YN3A 1R4QB 1KTKA 2RQXA 3QWNA 1SNCA 2BA0A 4UDUC 2DYOA 1NR4A 4L63B 4IUPA 1TU2B 2HCIA 2E2HB 1CJEA 2DLBA 3EFXD 5BN3A 2QSDA 2NTTA 1LT4D 5C0XH 2WDQB 5CBEE 4Y7NB 2QKIC 1CK1A 5FOBB 1BCPC 2ZXOA 4ZRZA 5I2XA 4ARIA 2N55A 5IIFA 1C4QA 4GZYC 1SYCA 2PO4A 1ZXIA 1D5ZC 3A56A 3J7YW 3BYYB 1HA6A 3AV8A 4WIPA 2F0VA 1MPEA 1VZ7A 1UGJA 2VB2X 1B4OA 4L1BA 2VNUD 1QF6A 1LTGD 1E10A 2E2DC 3PZ8A 4J3OD 3GTMB 1D4BA 3MP9A 2D5GA 2W54A 1Y69U 4HMJA 3Q69A 1TKEA 5T8IA 5FO7B 3N6RA 3IXSA 1Z47A 1HTLD 2JA6B 4KGRA 2BBCA 2F3VA 1EY4A 5G5GA 4BBSB 3R2TA 1VDVA 5E3FA 1DD2A 2O5JC 4OL7A 4KKUA 1JOKA 1HA5A 2KA7A 4NMZA 3AMUA 5C0XJ 2E6XA 4X3SA 2V4DA 1RFKA 1CT1D 3C1FA 2GB1A 3RUZA 3R3OA 1TR5A 1HFGA 3X3MA 1STHA 4DAVA 1EYCA 5EKIA 1TWAB 4CJ1B 3S1MB 3WOEA 1NYRA 4RF1A 5ELFA 4WQMA 1UWXA 1I50B 4L2YA 1QJOA 5FLXE 2PZUA 1T3QA 2PIAA 3M85A 3I70A 1WTOA 2R93B 1Q1EA 1J8IA 3Q22A 1R4PB 1L4DB 4MH8A 1PZKD 2K9XA 4M0WA 4ZKBB 3PO3B 1K8OA 3VR5A 2VZKB 5CV5A 2O4XA 3FKIB 4YTNB 1XX8A 3QOJA 1B2TA 4IDIA 2MJDA 5E4WC 5HG2A 1TWHB 1STYA 3KLSA 3FILA 4LMQD 3M3YB 1F2YA 3L9AX 1E0ZA 1SE2A 5CV6A 2WAQB 1STGA 1FEHA 2CU3A 1A70A 3GTKB 3VYTA 2KOLA 2XWBB 1SYGA 2SOBA 1JB3A 2RVLA 5CV9A 1STAA 1UEAB 5ELDA 2FMCA 3J80L 3ZJTA 3WCQA 1VJKA 4OO1G 1YN5A 4F88A 3MEHA 2B2VC 1STEA 1ZPSA 1Q1BA 5KGUA 2XSCA 2Q8IB 4NZLB 5HHDG 1GUNA 1YMHE 1VF7A 1XLOA 5EBCA 1VMCA 3T13A 1E2ZA 1H9JA 4ZQ3A 4B0EA 3TMEA 2V3PA 1A15A 2NUCA 3N52A 2F0IA 4I65A 1EL0A 1YQ3B 1IL8A 3DWGC 3VQIA 2WV6D 2A69C 2ENBA 1YQ4B 3P4QB 1CZPA 2N9KA 5MPOA 1GUSA 3VR2A 3HP3A 2AX5A 2KAJA 2WXJA 4YXDB 2A74C 3AEFB 3NVWA 3L7ZC 1RDPD 3FILB 1O80A 3OSOA 2F0LA 1IBXA 1LTID 5C3WA 5H8YE 5FR3A 2WXNA 3HRZC 2QF7A 1AN8A 1PDQA 3ITPA 3LWUA 3MXUA 1BUVT 2X6GA 2CJNA 5JAVA 2BE5D 1H9KA 2WXIA 4IUNA 4PMWA 5JOBA 3EVQA 3GB1A 1QQRA 2J42A 4NW2A 4EQOA 1E0BA 2NMQA 3KK7A 1STBA 1JWAD 2K01A 1Y1WB 3AE4B 1LT5D 2EXZA 3OPOA 2QDBA 5C3XA 1SYEA 4OZCA 4HN7A 2JEAI 1KDBA 2F0JA 2ACZB 1TT2A 5T1GA 5IGFA 4JWSC 3IFTA 4F8MA 4USAA 1CM9A 2F0UA 5IT9E 2BB6A 3HVZA 1SE4A 2D2CC 5JPMC 1U4RA 3HZXA 1FD6A 3TEZA 2TMPA 1IBXB 4B9WA 1B50A 1NCVA 1WTRA 2MGSA 3TEXA 1WCMB 2SNMA 4ZLTF 1ESFA 1IGDA 5JEAG 4YSYB 5LHY1 3IAYA 1AW7A 5BYSA 2VXWA 4PMCA 2M56B 3TP6A 1ZE3D 1RKNA 3OHXC 4HCSA 3ETRA 2KWDA 4A6QA 3MA2B 2FINB 1DJRD 3CRLC 5I6YA 4HAEA 3Q8EA 1TWGB 4RHRA 2IGGA 2SNSA 3S2DB 5T1IA 1XCTL 1BMLC 2HDLA 2FHTA 2H4OA 3Q8AA 2L12A 1FNUA 4ILWA 5C4HA 4LTUA 4ABNA 3UI3A 1GB1A 1P7FA 1FMAD 4RFBA 1PFMA 2AUKA 1JRPA 1LTTD 1JE4A 5CV8A 2M2LA 5C5MA 4ZHOA 3H3VC 1IYUA 4BA1I 2CHBD 4HR7B 4UAIA 1AZQA 3RFZB 2JP1A 5C4ZA 1L6VA 4HMIA 3NQIA 2M19A 1EU3A 4RAUC 2F0HA 1RF2D 4ZRPA 1EU4A 2NVXB 1D5XC 3DXJC 3HRDD 1D5MC 1F9RA 2Z4HA 3MFGA 5DM73 1HUNA 1V1PB 3KF8A 2QMTA 3G7LA 5KNBA 4TRDA 5COYA 1EY0A 2PMVA 4US8A 2BS2B 4EQNA 2PW7A 2B2TA 1J9OA 1JMLA 4A3GB 3VR6A 2LEKA 1S5CD 1ZOYB 1FNWA 1OXVA 3LNNA 3C3LA 4HKZE 2WP9B 5HURA 4U68A 4FYDA 3GTGB 1C4PA 2WXPA 1FM0D 1JQ4A 3HOXB 4S3SA 1JQYD 1I4RA 4RWSC 2G1EA 2Y3AA 4P16A 2R6GA 5IGBA 3A54A 2EE1A 3T51B 1MSGA 3H94A 2PZTA 5I4DA 1FXAA 1N60A 3BYTB 2K3UA 5JJZA 4XWTA 5BMGA 5K36G 3QO2A 1EOTA 1LACA 3BIID 2F0WA 3ERQA 4FNFA 4KJOA 4OO1H 4XDDA 3NSWA 3M7NA 4NKLA 1KRHA 1T5XD 5CORA 2CW0C 1RCVD 1RYJA 2Z4IA 2WXFA 2DY7A 3HEJA 1V1OA 5ISRA 5CBAE 1G8ZD 1L0XB 2PTLA 3D3RA 4EQPA 1PRTC 5M5XB 1PGBA 4C80A 3ZJVA 1TZOA 2QCPX 5G5HA 3H0GB 2B76B 1AP0A 1BUIC 2MJEA 2DNCA 4OZAA 2BOSA 1C8CA 3D6WA 1F2RI 1IGCA 4ZKCB 4IFDI 2F3WA 1Y56A 4K6LA 2K22A 1JW9D 4C3JG 3EROA 5FO8B 4DAPA 4N6EB 3NXWA 4IZ8A 1A2TA 2GI9A 1F2RC 1BCPD 1PRTB 4MACA 1SNDA 2W82A 4CHTB 4RGTA 4IUUA 3UI2A 3E0JA 3HKZB 3Q0AA 2EDGA 2ICIA 4C7ZA 1JC7A 1EIGA 4Q2JA 1FXIA 3NE5B 3KQ4A 2OF1A 1ZP0B 2F0EA 4O42A 3HOZB 1NVID 3TBIB 4KJNA 5D65A 2JA8B 4IKGA 4K14A 1OXXK 5FK9C 4KGSA 1YNTE 4YTMB 1SJHD 3DM1A 5IOCA 1EFID 1MI0A 3HOVB 2HDEA 2PLPA 3K57A 2NN6G 2JSVX 2BT6A 2RMMA 4CJ2C 3PMFA 2IW3A 4HJGE 3S1NB 3H8HA 1DOKA 3K5OA 4G7ZC 2IX3A 4OHJA 5EJWA 1E7PB 2B2WA 2A68D 1ONLA 4FF4A 2KQ3A 2QIEB 5JEAH 1IKLA 1MBYA 3LX0A 1KLUD 2WU2B 2WDRB 5C6AA 5NUCA 2EPBA 1GPXA 3KUPA 2MHVA 4E6IA 2RDGA 3HGBA 1MHHE 1ZYRC 2F0OA 1KF6B 4LLGM 2X69A 3CRKC 3D4RA 1LLRD 2O5IC 2BS3B 4N59A 4TQUS 1OFFA 5M5YB 2V3NA 3FC4A 2D62A 3GD7A 1NR2A 2ZW1A 1QLBB 3FDTA 2A6HC 1LTSD 3MXNA 4X3UA 1WSPA 4IOIE 1SYBA 2A6ED 2PZWA 2ONQA 4ZHPA 1E2WA 4R3DA 2A73B 4A55A 1TJEA 4XT1B 2PW5A 1D2BA 2JYTA 4KX6B 2INNE 1U4PA 3BDCA 3ZQ4A 4CGYB 3SXHA 3T53B 1LTBD 4JWUC 4JE3B 1MSHA 1SF0A 3AEEB 5JEAJ 2LJIA 1JWBD 2AWOA 4QMGA 4R8IA 3V96A 5KYLA 4JK1C 1L0VB 3I3CA 1LTAD 4M1UB 5ELEA 3C8YA 4KI0A 1O7LA 1UNSA 1N61A 2G9HD 2AUJD 1PUTA 1I3QB 2PVOD 1SEBD 2JQRB 3DWMA 4HCEA 1GB4A 5D3IB 1KABA 2LY7A 5IODA 4XT3B 1HXYD 3CWIA 1EWCA 5EQ0A 2F0QA 5J39A 1Q3LA 1PLFA 1WTPA 3AE7B 3B2GA 4YTPB 1SNPA 3VRBB 4R8NA 2KACA 3MC0B 2EYLA 3ND8A 3SDZA 3AE5B 2WQYB 5CC4A 4K2LA 2JXMB 3L3OC 4KHZA 1Q12A 5K36H 1ESRA 4OVZA 4FXGC 2WP8J 2NB0A 4A3DB 1EWHA 4YSXB 2TSSA 1G91A 3EQLC 2YEPF 4C3IG 2WU5B 4ULLA 4XIGS 3BK1A 4LK0M 1PZJD 5IGDA 2RPVA 1UUPA 4KN7C 5E1FA 1EY6A 3GQBA 1NYQA 3GV3A 1XLPA 2RDFA 2J4XA 3HS0C 3RLFA 4NAWB 4ZUIA 1Z6HA 1O78A 1F77A 2B2UA 4TQ1A 1YJJA 3I73A 1HHVA 5C0XI 1QILA 4YIJA 2MEKA 1H9MA 3LXFA 4H0LC 3VR8B 1O7ZA 4DF7A 3GV6A 1WD0A 2K5WA 3VYSA 3MHZA 4FXDA 1YNNC 2N88A 3SR1A 3K0YA 2EJFC 3J81E 4C3HG 3TP7A 3NZ3A 5AFWA 2KMMA 5KNCA 3T3NA 4OGQC 2L5TA 4IFDG 1PTOB 4N58A 1XEEA 2EOTA 5J22A 1YNJC 1GUOA 3B2FA 4D2KA 2WB1B 4QUCA 4K6DA 3P75A 2INPE 3JAME 3NUHB 2E76C 1C76A 4C2MB 4EE2A 1ROEA 1VMPA 1A3VA 1EY7A 1NEKB 2K5QA 3MTSA 3D4WA 3ONAB 4MHEA 3OW7A 2EY5A 1DCZA 1PMRA 1BO0A 3K6OA 5G3LD 2J7ZA 1S5BD 1ZEQX 2WS3B 2LFIA 1QOAA 3NVZA 3ZJUA 4LK1C 1PGXA 1TKGA 1EIHA 5IGGA 4KD3A 3I4MB 5C2TB 1II3A 4WFN3 2XIWA 4JX1C 3PIP3 2NN6H 1ILPA 2E2IB 1DXMA 1MI2A 3U7ZA 1K83B 1TY0A 3P1HA 5D3DA 4RKLA 5A2QL 4MM3B 2H89B 1TIID 3QJYA 3MZ5A 1AEXA 4BY7B 1RD9D 5J1ZA 2N0SB 1R7SA 1QOGA 3BS1A 3KBXA 2KEDA 3AE2B 1W6JA 2HTME 4ZRQA 2J52A 1PTOF 2PNRC 4YT0B 2K7VA 4ME5A 4Q5VA 1GHJA 1TS5A 2H1EA 2I07B 4CKEA 4KGTA 3MJ5A 1QWYA 2EVBA 1I4QA 1PFNA 5I6WA 2EY1A 4OZBA 1FO4A 3MFYA 3K5MA 4KTAA 4L23A 3A8IE 3OWEB 2WIIB 1D6EC 5CMDA 4GDKB 5BYQA 2MPMA 1ENFA 3VR4A 2JA7B 1XLQA 3AECB 1HEZE 2PW9A 2VUMB 1TVXA 1QE6A 1KH0A 4FP5D 2K6AA 3GTLB 4FF3A 1C79A 2Y5CA 3TP5A 3PUWA 4ARCA 1EZ6A 2JEBI 1CI3M 4G57A 1IW7C 3W3AA 4RGOS 1SNMA 3TEYA 2F4IA 1ICWA 1HZ6A 2IX0A 3PUVA 1G2SA 2D5DA 1X3PA 1F0ZA 2EJMA 2X6LA 5C4XB 2BS4B 3H91A 1A3UA 4H2AA 1TKWB 4X3KA 3HUIA 4MIUA 3BVMA 4L8JA 1C9FA 2J0TD 2EYHA 3P7JA 2SDFA 4DK1A 2VB3X 2LGIA 1V43A 3S14B 4OIKA 1AYFA 1ZXHA 4K8JA 2MP1A 2PCFB 1ZKOA 4TSSA 2LS01 2XVSA 3D31A 2DWQA 3T3OA 4PNYA 2DY8A 1GAQB 2WXOA 1WTWA 5BMIA 1SXTA 2MH7A 4DGZA 1E6EB 2QJLA 3GO5A 1Z7TA 3RD4A 1WTQA 3M4YA 3SFDB 4HTHA 3M7GA 2PQEA 4H44C 4PMBA 3FAHA 3NVVA 4XWWA 2RSOA 1DM0B 1B9MA 3J7AV 2XRSD 1VLBA 4O1NA 2GA4B 1WTXA 1HZ5A 5C5LA 1RM6C 1H9SA 2EELA 1BF4A 5FLXL 4K5VA 1FR3A 1I6HB 2NYZD 1IUEA 3QOLA 2EYOA 1A3TA 5M3MB 3TP8A 1BOSA 3DWAA 4RH6A 4G4KA 2ID0A 5JVG3 4ODGA 1KDCA 1DGJA 1IHZA 4ZK9B 2XWJB 4KD4A 1AWDA 4OW0A 2J53A 4KKTA 1JR0D 3AB9A 2R7ZB 3OOCA 2BE5C 1XO3A 3I4LA 1KLGD 2BW2A 3DUZA 3GTOB 4A8XC 3HOUB 4IALA 1XTCD 2F0KA 2W3SA 3S1RB 1Y1VB 1M8AA 2NWGA 1NUCA 1SSOA 4EVOA 2HQEA 4FF2A 3GS2A 1GUGA 5IGEA 1G2TA 1ENAA 1VDZA 1EYAA 1NAPA 3NWTA 1EEFD 4IN3A 5EPJA 1D1KA 2B2TC 1BNZA 1HRJA 2W55A 2IDYA 4IUTA 4DAYA 3P20A 2ZW0A 2E3TA 2F0TA 2WXQA 3NVYA 2L1BA 5M3FB 1JCKB 4RKBA 1FRRA 3NTHA 5K5PA 3V05A 2CVRA 1Q10A 3BVZA 4RA8A 3IT6B 2LHEA 3OIPA 2KHSA 2JYEA 3VR9B 2RKSA 4LAAA 2EYPA 5AUIA 3SK5A 2F0NA 5M9OA 2LKVA 5FKAC 3OIQA 1KAAA 3IL8A 4IUVA 1TKYA 4ID6A 4BBRB 2IGDA 3BDLA 4A3KB 2CJOA 2L32A 2PYKA 4NP5A 1SNOA 3RMHA 1CZGA 2N9LA 2I2YA 3EA6A 3WDNA 3Q24A 4V190 4WURA 1FD7D 3SEBA 5LL6S 5EE3A 1BDOA 5EKKA 2K03A 1S5FD 3AN1A 2F0GA 1GUTA 2K5PA 1OQQA 5I9OA 1LV9A 2WNMA 2F0DA 5CYUA 3TZDA 1L4ZB 4PV1C 3D8GA 1UWMA 1UAPA 1W6KA 1GJXA 1GXDC 4I7ZC 1QNUA 1X3QA 4BS9A 4H7BA 4C7YA 3I4NB 2FE8A 1B9NA 2C9OA 2OHFA 2OXPA 5EBDA 4HKQA 2N7JA 2M0AA 5ELCA 3VYRA 2IX1A 3DMUA 3KWLA 3IAS1 3U9SA 1K52A 3P63A 3D6CA 1C78A 2FMMA 1RHPA 4DNRB 5IT9L 3DWQA 2R3ZA 5LL6X 4OO1I 2WXGA 1ZUD2 2RBMA 3IKJA 4ZYSA 3DWPA 2NVQB 3AEGB 4P6VF 3J80E 3GTPB 1LT3D 3FMCA 2NZ1D 1QKZA 4NAMA 2Z8LA 4B0MA 1LO5D 3J7AF 1F9PA 2K0PA 4C1NK 2GRIA 4A9AA 1M4VA 3LYYA 4IUQA 3ABVB 1F9SA 1Q8IA 3L4PA 3NQTA 1QOFA 2VZKD 4RGNA 2K5DA 2M00A 4P2CB 1TYGB 2XN9C 4AQ7A 2IL8A 3IFDA 2E75C 2B2YA 1QOBA 5A2QE 3A7LA 1S5DD 1C4AA 2KDMA 5FO9B 1SE3A 2PPBC 4XQNA 1YN4A 1ZDVA 2B2WC 2JXTA 2KJXA 2F0FA 2F0MA 2JU6X 1YNND 4KY7A 1PXUA 1CTMA 3J9CA 3AEBB 1ILQA 4A3IB 3MXPA 2HCCA 1SJED 2HUGA 1WD1A 3NS1A 5H92C 1QNKA 1TQOA 2WKCA 1DZ1A 1JORA 3A8KE 1SNQA 2F0SA 1X32A 4QF4A 1WXQA 2DN8A 2YEPB 2KUMA 1QCBD 3T16A 3C2PA 2SEBD 1VZ8A 2QEJC 4KK7A 4WWMA 2K32A 1SMYC 1NENB 5I2YA 1K51A 3P42A 1N5XA 2K1BA 1STNA 1JOOA 4LJZC 4X3TA 1L6UA 1V8CA 2WLBA 3S2HB 2ZXPA 1U9RA 3AM9A 3T56B 1PYWD 1E9MA 2KVMA 1CFMA 1DOXA 1GOZA 3NBHA 1KNEA 3EUB2 1DOLA 3KLSX 4PQXA 2JX5A 4FXCA 1VZ6A 3R93A 2BTEA 4N9TA 1JOQA 1RJTA 5C3EB 4RHSA 1VRAB 3D4DA 3CIRB 4MT5A 3I8ZA 4DXGA 1B3AA 2NVYB 3BWUD 2WXHA 1I4XA 1FIQA 5EE9A 1JWUD 2WINB 3SR6A 1G6ZA 2OT2A 2A69D 4K8IA 4XYOA 4Q0FA 3IAM1 4FVMA 1J7CA 1PDXA 3C1EA 1DOMA 3PUXA 1PGAA 1BCPB 1QG7A 2LFNA 1RTOA 3CU7A 1BBXC 1I7HA 4HSVA 1HCZA 3TN2A 3TUOA 1LTRD 5CV7A 4F7XA 5EPKA 2JA5B 2L1AA 2L4NA 4XDXA 4RCNA 4DA2A 1A6XA 4QB4A 1EYDA 3C46A 2D9UA 3S1QB 1IYVA 1WRIA 3QB3A 3B9JA 4US9A 4J6HA 3VR3A 4HSPA 1C77A 2L52A 1PTOC 4OIJA 2A68C 3Q23A 4V0BA 2Q8RE 2WACA 5F2DA 3AU7A 3VA7A 4AYBB 5HFYA 1JROA 2EYMA 1TWCB 3NTKA 3MWYW 4M8AA 2JYOA 1VF5C 3TEWA 3ZGZA 3F2UA 4B9XA 1MVKA 2K28A 3S16B 3NK9A 3W2DA 2BB5A 2V0GA 1FGBD 1Y8PB 4RGMA 2ZXRA 2IWHA 3GTQB 1B1ZA 5CR3A 1CA5A 2B63B 1IW7D 4MN3A 3PO0A 1QB5D 3V3XA 5EPLA 2B2UC 2JZPA 3E9SA 3HOYB 4HRSA 1FYCA 1HQRD 3GP7A 2A6EC 3BG3A 1BCPF 1ET6A 3TZUA 3K7AB 5JPNC 1EM7A 3AH7A 3KLRA 4FO2A 4XQQA 3NP8A 1S4ZA 4BWGB 1N63A 2B2VA 2RDHA 2EY6A 4C1NI 2W3RA 3H6MA 4CKCA 4WORA 2FBWB 3E56A 5KIXA 2MUYA 2LHDA 1Y8OB 3FPPA 3R2IA 1DOYA 1N5WA 1L0YB 1EQVA 4DFAA 1WWTA 3KWVA 1HQMC 4QUFA 2BDNA 2L0CA 5KNDA 1BR9A 4A3FB 4YWGG 2JSOA 1TS2A 4A93B 1RWSA 2QILA 5CV4A 3MVVA 1I4HA 1YJIA 1CHQD 3QG1A 4J1MA 1FFUA 3SFEB 2L11A 3BVGA 1B9RA 1PFDA 2G9DA 5DM63 3A8JE 4KN4C 5DNFA 1V97A 5TSSA 4HEA1 4XDCA 1I4PA 3U9OA 2LMCA 3RPFC 1MGSA 1EQTA 4YSZB 5EGTA 2KCCA 1TY2A 4XXEA 4B08A 4REZA 4KKIA 1ACCA 5D7GA 4G7HC 4KV6A 3EJIA 3VYUA 2IGHA 1WVLA 3EGRA 3VA5A 2XRQD 3Q6SA 1XCQL 1XYIA 3TSSA 2Y5PA 3OMGA 1T6BX 1XWEA 2X38A 1JWMD 2ON8A 1T5EA 4KY5A 4K2KA 4H13C 1VCIA 3CHBD 3P4PB 2PVGC 5C4JB 3I72A 5LNK1 4TMAB 1EY5A 4DN4M 4ZOHC 3BDOA 1WTVA 2JWUA 2O2LD 1P7EA 1CQFA 1SYDA 5I9PA 2Q5WD 2ZT9C 1ZDXA 3BK2A 4F87A 4KKSA 2DBYA 2LMCB 2A5HA 2EZVA 4C3JB 1JALA 4A3JB 1B53A 5BN5A 1FRDA 2NN6I 5EKLA 2SAKA 5HGTA 4GDLB 3WOFA 4KKJA 2CW0D 5EE0A 3W5VB 4BY1B 4K5XA 3PUZA 3CQZB 2RSNA 1F2ZA 4RCOA 1SDFA 1SFOB 3MHBA 1JICA 2OEDA 5C3JB 3I91A 4U673 3K5NA 1PRTD 1U4LA 2EKIA 3DHQA 5CGKA 4A3BB 1LABA