2IY0B

Senp1 (mutant) sumo1 rangap
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
IKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase activator
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
publication title Sumo Protease Senp1 Induces Isomerization of the Scissile Peptide Bond.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2iy0B00
2N1WA 3A4RA 3B0AA 2KOXA 3AULA 2MWSB 4HPLB 3A1QA 3D32A 1ZGUB 4XZ4A 3DVGY 4IWQA 2HTHA 5D6JB 3UF8A 3WANA 4HLEA 5E6PA 2FIFA 4A3OA 4WJPA 2IYDB 2LGDA 2XBBC 4E74A 3RULA 5TR5A 2PEAA 5G55A 4X57B 3VH4B 2QHOA 3H6NA 1C3TA 2DHZA 3ZTDA 4BOZB 1V49A 3VH3B 2MBHA 4CYEA 2NR2A 4HWIB 3AU4A 2J0KA 5BO4B 2CHXA 3AU5A 2NPTA 1JRUA 3M3JA 3B08A 4BKTA 2KDIA 4OVVA 4W9KA 1QZEA 4AJWA 3CSTA 3QAQA 3U30A 4DHJD 5HKHA 3H1UA 4GDKA 1E8ZA 2O6VB 4GOCA 1YJ1A 5KHQA 3IFWB 3T8MA 2V4LA 2J7QB 4WJOA 4IG7B 1TBEA 4FBJB 5CHVC 5G2NA 1U4AA 1VD2A 1V81A 2AL6A 2Z59B 3NHEB 4ZRKA 2NBUA 4NQKE 1E8XA 2DZMA 4TQ1A 2M1MA 1GG3A 4W9JA 1WR1A 3N32A 4KZ0A 2MCNB 3H7PB 3WAOA 5D2MB 1WX7A 1P0RA 2FUHB 2L3ZA 4J6IA 3SDLC 3DCGA 2Z0DB 2BF8B 2L76A 3W1SA 3SD5A 3SHQA 4URKA 2KKCA 2K6DB 4HVBA 4GB9A 4DWFA 2WYQA 3TCAA 2KFKB 1ZKHA 2OOBB 2L0FA 3PHWB 3ZTCA 1WJUA 2ZZPB 2AWTA 4II3B 2LJ5A 4KVGB 4BKSD 2IO3B 4HJKA 2KX3A 1V5OA 4WJNA 5J17A 1LXDA 4ICVA 4NY0A 3U8ZA 2FAZA 1H8CA 4FLHA 3L13A 3JW0X 3JVZX 2G4SA 3PZDA 3HM3A 2BKFA 2C60A 5DPTA 4BBNF 3WIMA 3M95A 1WGHA 3PS6A 3VXWA 4NJ7A 2K1FA 4JLCA 3OLMD 2KQ7A 2IO2B 2MW5A 3DDCB 3WAMA 2ZNVC 1P9DU 3ZW3A 5L83A 3DOWA 3TMPB 2J0MA 4BBNC 4WJQA 1UGMA 3HM6X 3PLUA 2JY6A 1SGHA 3WA0A 1KLVA 2RR9A 2FCNA 4E71A 3CMMB 2L7RA 3LJ3A 3V61A 3S2AA 2AL3A 2LRWA 2KDEB 1ISNA 2M17A 3UQAA 5J2RA 2G45B 1J0GA 4XX5A 2JPHA 2GBJA 3H9DA 2JZ3B 3R66C 2A4ZA 1WJ4A 1EF1A 4AUQC 3I3TB 2PE9A 4W9LA 5DPSA 2J0JA 3QK0A 4MDKE 4M8NA 3ZNID 4I6NB 4PS3A 3VTVA 3PT2B 3DVGX 1UZXB 2CS4A 2Y5BB 4NAWA 2N7EA 1R4NI 2MP2A 4KDIC 2CHWA 4ANUA 4WWPA 1V86A 3QWZB 2K39A 4BKSA 2DYBA 3APCA 3RZWC 2FCQA 3OJ4B 2B3AA 4G0NB 4HCNB 1V6EA 2DZIA 3ZDTA 1WI0A 2G4DB 5AZGA 1XD3B 2AYOB 4DXAB 1D3ZA 4W9HA 4ANXA 1WJNA 1X1MA 1P98A 3R3MA 2MA9B 1G6JA 2BPSA 5IAAC 1WXAA 2DAJA 4IUMB 4MELA 1UBIA 2N7DA 3HHMA 4MGIE 1YX5B 2JZZA 1XT9B 2JXXA 4JIOU 4W9DA 4B6WA 1LFDA 3TJPA 5JZEB 4ANVA 3PV1A 1RLFA 2KC2A 2D10A 3O65B 4BKGA 2WWZA 1NDDA 2IO1B 2RD0A 4IM2A 2O2VA 2JVCA 4DK5A 4CO7A 3A9KB 3V6EB 1WE6A 1CMXB 1UELA 4FJZA 3KH0A 4LJPB 3NOBA 4EEWA 2KZRA 3IG3A 2W9NA 3DQVA 4AJYB 2ZJDA 3AXCA 4DHZE 2N9PC 4II2B 5AZFA 2C5LC 3JSVB 3VUYA 3EFUA 3KYCD 5KHOA 2K6QA 2C7NB 2VRRB 2KDBA 1J8CA 2YVCA 1AARA 3MTNB 1OGWA 1C1YB 3M63B 3APDA 3OJ3A 4KIKA 4MJSB 2K8HA 3ENEA 4YL8A 2ZVOA 1UBQA 4K81A 2BKRB 2KC1A 5CX3A 1VCBA 3ZNHB 3VDZA 4NPNA 3DBHI 2FNJB 3JYUA 2XK5A 3QA8A 2WX0A 4XC2A 1P3QU 2KXJA 3KW5B 3A9JA 3HK0A 2DYOA 1OEYA 4JGHB 1UH6A 2YLMA 2PJHA 3DBLI 4IM3A 3TBLD 4AWJA 3VFKA 4EFOA 2JT4B 1OTRB 4K1RB 3ZLZA 3DVNU 4DHZB 2LWPA 4HDQA 2I1KA 1WJ6A 2LRUA 3PPAA 2K8BA 3X23A 3NY5A 2LGYA 3VTUA 3RD2A 2BYFA 4TUUA 2ZPNA 2IO0B 1YQBA 2CKHB 3N3KB 4I6LB 3VHTC 3IHPC 3A1QB 3Q3FA 2HJ8A 1WGRA 4TV3A 4EKUA 3RCZA 1XQQA 4K7WA 5LXIB 4JQWC 4ZDVA 2DZKA 2WX1A 3CF6E 1R4MI 3M62B 1PQSA 4EUTA 4DDGD 1WMHA 3QQ8B 2KJ6A 2C7HA 3ZUNA 4ANWA 2NPTB 2N1VA 4RM8A 4MH0E 1IP9A 4GGQA 5AEKB 4PYZA 2DENB 2NBWB 2O6VD 4ZRJA 2MQJA 2PE6B 2ZEQA 2KMAA 3EC8A 4G3XB 4LDTB 2JWZA 2NVUI 4K7SA 3ZRCA 4MM3A 3ZRFA 5D7GA 3V6CB 1Z2MA 2LI5A 4W9GA 2ZPYA 2NCNA 5DCNA 4PS7A 1OQYA 1WZ3A 2NS5A 1S1QB 3VVWB 2GBRA 4AP4C 3KUDB 4GDLA 4A20A 4GMVA 3QCAA 3AI5A 4AOFA 2IY0B 3L0WB 3ONSA 2ZNVB 1GNUA 3R7QA 1EUVB 3QHTA 3W1SC 4F7ZA 4MGYE 2KLCA 2LVOA 3VUWA 5D94A 5DPRA 3IVFA 1E5WA 1WX9A 3PGEA 4HDOA 3TIXA 3ZIMA 1SIFA 3TL5A 4BFRA 4IW0A 2MLBA 2CR5A 3N30A 2KWVB 4FJYA 1GJZA 4EZLA 2KLGA 2L00B 4E3CA 3ZDMC 2N9XA 1WFYA 4NJ6A 4BOSC 2D07B 2L0TA 1E90A 4MSQB 2UYZB 1J19A 3A9KA 2KN5A 3DBRI 2LXCA 4M8MA 1V2YA 1Q1OA 3CSFA 1WXMA 5FR6A 2R2QA 4ZYNA 5JHAA 2KTRB 3EECA 5J18A 3LDZE 3ZVVA 2LVPA 1UD7A 1WIAA 4W9CA 3RZFA 1WGGA 4ICUA 3UQBA 2FCSA 4LDTD 2C9WB 1Z5SB 2M4NA 3ECIA 2GMIC 2PPHA 3WALA 3DBSA 2O6VA 1V80A 1Q5WB 1WGDA 4ZRIA 3K9OB 3RYTA 2LGXA 4GXBA 3ALBA 2LD9A 4N9F4 4F1SA 4FA6A 4GN1A 4MGZE 3QJZA 2RGFA 2HD5B 4IM0A 5AZHA 1HE8A 2R2OA 2JRIB 2KVRA 4B95A 2KHWB 2K8CA 5CHWA 3MHSD 2I1JA 4DBGA 4NNJB 1H4RA 1BT0A 1WX8A 5LLIA 3KUCB 4BVUC 2KJRA 4FULA 1E8YA 5IA7A 3L10B 3ML9A 3PREA 4K7UA 3VQIA 2L8JA 3H7PA 4MEMA 1WE7A 4FHJA 2DZJA 1Q0WB 4PYUA 3SU8X 2MRPA 2V1YA 2BWES 2DYMA 3OAWA 1SE9A 4DDID 1FXTB 2GOWA 3ZKJC 4GU2A 3B1LX 4KDLB 3PVLA 4ASWC 3L08A 3V60A 2KFKA 3KYDD 1TTNA 4NAWB 3RUIB 2MP2B 2ZCCA 3GOEA 1L7YA 2LZ6A 3UINB 1YX6B 3L16A 2EKEC 1E7UA 1LQBA 3QX1A 3V62A 1MG8A 5E6NA 5L95C 3W1YA 4FHKA 4G50A 3U7DA 3Q3JA 3DPDA 1V9JA 4RMAA 2CHZA 2HE7A 4CHKA 4EOYA 2KANA 2MBBB 4WQOB 2ZVNA 2N4FA 2D11A 3KUZA 1V5TA 1WR6E 2KDFB 3L17A 3UGBB 4P7IA 2JRHA 3BY4B 1WM3A 2M8SA 3RT3B 1GC6A 2O2VB 3A33B 3UIPB 2GBKA 4WWOA 2JUOA 3ZO5B 4MSMB 3L54A 2LUEA 2LXAA 2DX5B 4MGKE 3VAWA 1WH3A 3PHXB 4OVUA 2KJHB 5CHFA 3T9LA 1IYFA 1NI2A 2KMCA 2LVQA 2XEWA 3UIOB 1WM2A 2KFJA 4W9FA 2MSED 4FJVB 2BYVE 4M0WB 3C0RB 1GUAB 4IC7B 3VTWA 1E7VA 4KIKB 4GDKB 2L05A 2MBOA 2XK5B 3QC8B 3X0WA 4B9KA 4EZKA 1WZ0A 2Z0EB 2DAFA 3A9JB 1ZW7A 3R7RA 4I6PA 1NBFC 4KSKC 4GIVA 2UWQA 4NQLB 2JF5A 3BINA 3NZUA 2KTRA 4JL9A 5C23A 2IBIB 1RAXA 3PRZA 1YD8U 3QARA 4HK2A 1RFAA 2ZCBA 4LCDE 3ZNGC 3PTFC 1T0YA 4WWNA 2D3GA 1WRDB 2KD0A 5E6OA 2REXA 3P2BA 5JH5C 2KK8A 5LXHA 2GBMA 1WY8A 5EDSA 3QIJA 2EMTA 1RRBA 2KTFA 3ML8A 1KJTA 2GBNA 1I42A 2EMSA 2IZVB 2KWCA 5C1ZA 2FIDA 1WXVA 3KVFB 2WDTB 2FCMA 2KWUB 1WMHB 4RM9A 5JHBA 2AEHA 2KNBA 1Y8RC 2N9EB 3NZSA 1S3SG 4IWPA 4WAAA 4EZJA 1K8RB 3JSVA 1TGZB 1LM8B 4F8CB 1EO6A 1YIWA 5CTRC 2MBQA 4PS8A 3VUXA 3PRMB 2ASQA 1IPGA 4A3PA 1A5RA 4KV2A 3IBEA 1KOTA 4FN2A 4MJSA 2CU1A 2RSUA 2NBVB 5GMVA 3WAPA 4DHJB 2BYEA 1WF9A 3HIZA 3K9PB 4HPMB 3EHVA 1E8WA 1WGYA 1KM7A 2KX0A 2C7MB 4HXDA 2BGFA 2KO3A 2V3SA 4GDLB 1WXSA 2MBEA 3PLVA 4FADA 2LASA 3PRPB 4LJOB 5DPWA 4GSWA 1GC7A 1OEYJ 2K25A 2M0XA 3DVNV 3PSEB 1M94A 4IWOA 1P1AA 3GZNI 1TZ1A 2G3QB 1L2NA 4W9IA 4TQ0A 3A4SC 2KQSA 1WYWB 3H7SA 1F9JA 4W9EA 1I35A 2BWFA 4TKNA 2RPQA 2IY1B 4KSLC 2MX2A 4G11A 3ZNZB 1EF5A 4HCPB 3MJWA 3APFA 2D2QA 4KZCA 3NS8A 2OJRA 2A5UA
chains in the Genus database with same CATH superfamily
1N5XA 1V1PB 1VZ6A 3AEEB 3N1YC 4RCOA 2MWSB 3DVGY 4IWQA 5E6PA 4A3OA 3KLSX 2PEAA 5G55A 3OWEB 3N1XC 2DHZA 1C3TA 4BOZB 3FAHA 2D3BA 4HWIB 3AU4A 2J0KA 1FNUA 2KDIA 4OVVA 1QZEA 2N9KA 3CSTA 4DHJD 5HKHA 1VLBA 5KHQA 3IFWB 4FBJB 3Q8BA 1VD2A 2V4IB 3U52E 3NHEB 4ZRKA 2NBUA 4NQKE 2QJLA 1WR1A 1AN8A 2DBYA 2INDC 2L3ZA 2OJWA 4A90A 3EA6A 4HVBA 4DWFA 2YEPF 3U7ZA 2IO3B 2KX3A 2JX5A 4YT0B 1TKGA 1LXDA 4ICVA 1H8CA 3C19A 3ZGZA 4DQOC 1JALA 3JW0X 2G4SA 5BMGA 3HM3A 5DPTA 1SF0A 5TSSA 3WIMA 1WGHA 4LLGM 2MW5A 4K3CA 1AW7A 3ZW3A 1P9DU 1KF6B 1ZP0B 1DYQA 4WJQA 3AE9B 3PLUA 2JY6A 1SGHA 1KLVA 2FCNA 1FCCC 3V61A 3Q8CA 3MC0B 5T8IA 2GBJA 4HKQA 2INNE 1QOAA 1WJ4A 4AUQC 3I3TB 1SIJA 2PE9A 4W9LA 4KGRA 3NVVA 2DLBA 4M8NA 3ZNID 1TS5A 1UZXB 1F1HA 2CS4A 4KDIC 4ANUA 1XLNA 3QWZB 1YOVB 1ZDXA 4IKGA 4DXAB 4W9HA 1JWAD 2KMMA 4YSXB 3IAS1 1N62A 1LFDA 1C4PA 2WU5B 2WWZA 2I2YA 1FXIA 5BYSA 3Q14C 3A9KB 4LJPB 3NOBA 3IG3A 2W9NA 3P4PB 1VRAB 2N9PC 3JSVB 1PUTA 2C7NB 1J8CA 3DBRB 3PZ8A 1R4NB 1OGWA 1C1YB 4KIKA 2DWQA 1VR9A 1VCBA 1ZOYB 3VDZA 2H88B 2FNJB 3JYUA 2XK5A 4XC2A 3A9JA 2DYOA 1Q10A 1UH6A 4JGHB 3SFEB 3TBLD 4AWJA 3AE8B 4EFOA 4L23A 1L0YB 1WJ6A 2K8BA 3X23A 2LGYA 2V3PA 2BYFA 3IHPC 2HJ8A 4TV3A 4EKUA 5LXIB 4JQWC 4ZDVA 3CF6E 4C7ZA 3M62B 1RYJA 2I38A 3L4PA 4N58A 2WQYB 1MJDA 1NEKB 4PK1A 1WWTA 3ZUNA 4HPPA 2NPTB 3TEWA 4S0RA 2WDQB 2PIAA 3EC8A 3FILB 2K22A 4G3XB 2NVUI 4MM3A 5D7GA 1QF6A 3VVWB 3T3NA 1JQ4A 3CWIA 3W1SC 1EUVB 1F2RC 4MGYE 3VUWA 1JCKB 3ZIMA 2KYWA 4LNFA 1GJZA 4EZLA 2KLGA 3PO0A 2J53A 1WFYA 4LNIA 2D07B 3B9JA 2KN5A 2FE8A 5JHAA 3ZJTA 3RNAC 1ZDVA 2L52A 4W9CA 3RZFA 3BK2A 2M4NA 2RDHA 1K52A 3R2IA 1WGDA 1Q5WB 2LGXA 4N59A 1FNWA 5LNK1 1ACCA 5AZHA 1HE8A 2KHWB 3DHHC 4NNJB 4ZOHC 1BT0A 2W3RA 1WX8A 1LGRA 3KUCB 5IA7A 3ML9A 4K7UA 3BYYB 3SU8X 1KLUD 2MRPA 2V1YA 2DYMA 2OEDA 1SE9A 1UNSA 3AV8A 3ZKJC 3IT4B 4GU2A 2NTSA 2QIEB 3HVZA 1YQ4B 3B1LX 5IKCM 3W2DA 4TMAB 2MJ3A 3PVLA 4ASWC 2D5GA 4P1CC 3V05A 2ZCCA 3UINB 1YX6B 2BVCA 1LQBA 2SAKA 3W1YA 4FHKA 3DPDA 4RMAA 2HE7A 2WXMA 4WQOB 1E6EB 2L1AA 2D11A 3RI7C 2KDFB 2M8SA 3RT3B 2GBKA 2JUOA 2GLSA 2LXAA 4MGKE 2KJHB 2XEWA 2KVZA 3C0RB 1D5XC 2L05A 1EU4A 1I4HA 1F0ZA 4TSSA 5HI1A 4NQLB 2JF5A 4JL9A 2KACA 1F77A 2ZW0A 4LCDE 5E6OA 5AUIA 2REXA 3HUIA 1Y56A 3WCQA 1YNTE 4HRSA 3ML8A 4JWUC 2GBNA 2EMSA 1K50A 2IZVB 5C1ZA 1FD6A 3AB5A 2WDTB 2KWUB 1WMHB 2NTTA 5JHBA 1Y8RC 3NZSA 1S3SG 1TS3A 4F8CB 5EE3A 5D3IB 4PS8A 3TEYA 1IPGA 2CU1A 1KTKA 2RSUA 1L0XB 1WGYA 3BVMA 5BMIA 1WXSA 2MBEA 2WXHA 5DPWA 4LJOB 3DVNV 2M0XA 3GZNI 1TZ1A 2G3QB 2IGDA 2GB1A 2WLBA 1I35A 4W9EA 2RPQA 2IY1B 2QDFA 3KWLA 3MJWA 4KZCA 3VR8B 3EGRA 4RGMA 3B0AA 3AULA 4K3BA 1OQQA 3A1QA 2HTHA 1JW9D 2FIFA 4WJPA 2LGDA 5TR5A 3VH4B 2QHOA 3H6NA 3ZTDA 2NR2A 3AU5A 2JQRB 3B08A 4BKTA 3TEXA 1SB3C 2JZPA 3H1UA 2O6VB 2IPKD 1DOXA 3T8MA 4NJCA 4IG7B 1U4AA 1I4PA 1V81A 2Z59B 2WXFA 1E8XA 3ABVB 4W9JA 1UWMA 2MCNB 1WYGA 5D2MB 1I4XA 2CU3A 3DCGA 1EWCA 2Z0DB 3W1SA 2BT6A 2WXLA 1QLBB 4URKA 2K6DB 1YQ3B 5I4DA 3TCAA 1ZKHA 2OOBB 3NVZA 2ZZPB 2LJ5A 4BKSD 4HJKA 1N61A 2FAZA 3BIID 4FLHA 3GS2A 4XWWA 1FXAA 2BKFA 2C60A 2K3UA 4GLSC 3OLMD 2KQ7A 2IO2B 3DDCB 3WAMA 4M01A 1GB4A 1VDVA 5L83A 5GXGB 1FFVA 4XDDA 1MFWA 2J0MA 1L0VB 2PKOA 3FKYA 2MJEA 3CMMB 4A6QA 2JXTA 2LRWA 1ISNA 1ZXIA 5J2RA 1XF5L 2VH1A 1ZE3D 4RGNA 2JPHA 3H9DA 3R66C 1WRIA 5DPSA 2J0JA 3DVGX 4Q2JA 4NAWA 2CHWA 5IO9A 1V86A 3APCA 2PTLA 3RZWC 2FCQA 4G0NB 1V6EA 2DZIA 1WI0A 1GOZA 4ANXA 1X1MA 2MA9B 4JWSC 2BPSA 1B1ZA 2N7DA 3HHMA 2QMTA 3PZ7A 4MGIE 1YX5B 3KQ4A 2JZZA 5JZEB 3PV1A 1RLFA 2D10A 3O65B 2WDVB 4KGTA 4WQMA 1SEBD 2IO1B 4IM2A 2RD0A 2O2VA 1WE6A 1CMXB 4FJZA 1ROEA 1XLPA 4EEWA 2KZRA 1EU3A 1FFUA 3SFDB 2ZJDA 3AXCA 4DHZE 5AZFA 4WIPA 1FO4A 4OZBA 1BMLC 3DHIC 2YVCA 1AARA 2BB6A 2ZVOA 4K81A 1UBQA 2KC1A 3ZNHB 3DBHI 2E6XA 2WX0A 1P3QU 2KXJA 3KW5B 3HK0A 1OEYA 2PJHA 3DBLI 3DHGC 2JT4B 1OTRB 4K1RB 3ZLZA 3Q69A 4DHZB 4NZLB 2I1KA 4B0MA 5EE9A 3NUHB 4LNOA 3VTUA 3RD2A 2IDYA 2J52A 3ZJUA 4C4VA 4TUUA 4M02A 4I6LB 1UWXA 3OG5A 1WGRA 1FMAD 3CIRB 1BXTA 1XQQA 2WX1A 1YJIA 2KJ6A 2PVGC 2N1VA 4RM8A 2LJIA 4GGQA 4PYZA 4EE2A 2MQJA 3AMZA 2KMAA 2JWZA 2QSDA 2LI5A 1DOIA 2NCNA 1WZ3A 1TS2A 1QOGA 3QCAA 3AI5A 2IY0B 3L0WB 4NAMA 2ZNVB 4F7ZA 3QHTA 2KLCA 2KAJA 5D94A 4ZRQA 3BK1A 1SIFA 4IW0A 1AWDA 2CR5A 2ACZB 3ZJVA 2M19A 2L00B 3O13A 4NJ6A 1OQRA 1J19A 3A9KA 2HJ1A 1V2YA 4ZYNA 3EECA 5D3DA 3RNBC 1WIAA 4REZA 4YSZB 1AYFA 2JYEA 1Z5SB 2J4XA 3WALA 4ZRIA 4UDUC 3RYTA 3ALBA 3KWVA 4MGZE 2HD5B 5CHWA 2AQ1B 3H7PA 3E9SA 4FHJA 1Q0WB 3RFZB 3OAWA 2W55A 4DDID 3P1MA 2WXIA 1TIFA 4P16A 2K9XA 2VZKB 4RGOS 2KFKA 3KYDD 3RUIB 3W5VB 2LZ6A 2CJNA 1C76A 1E7UA 3QX1A 5E6JA 1MG8A 5E6NA 3P4RB 2WXPA 4CHKA 3VR9B 2LEKA 5HHDG 1JWUD 2JRHA 3N20C 2N0SB 4ARCA 2BB5A 4WWOA 1F2RI 2L32A 3ZO5B 4MSMB 4RH6A 3RNCC 2LUEA 5H92C 2DX5B 3PHXB 3T9LA 1NI2A 2MSED 3NZ3A 4FJVB 4M0WB 1GUAB 2ON8A 2VZKD 4KIKB 3VTWA 4GDKB 4C00A 1NENB 2XK5B 3QC8B 2IGHA 1JRPA 2DAFA 3A9JB 1ZW7A 4A8XC 4XGAB 1FM0D 1D4BA 1QQRA 2IBIB 1RAXA 5FK9C 2UU7A 3PRZA 1T0YA 1WRDB 2KD0A 2WXQA 3P2BA 3MFGA 1QOFA 3BYTB 2EMTA 3U2SC 1SE4A 1V8CA 1SJED 1WXVA 3KVFB 4KX6B 2FCMA 2W82A 2MHJA 2AEHA 3EUB2 2N9EB 2L83A 1EO6A 1YIWA 2ASQA 3NVWA 4KV2A 1JWMD 4MJSA 2NBVB 2X8XX 4MM3B 2BYEA 1WF9A 4HPMB 3HIZA 1T0RC 4LNKA 1I4RA 1E8WA 2KX0A 1KM7A 2GI9A 2C7MB 4HXDA 2M56B 1TJEA 4GSWA 3PSEB 3U4EG 1P1AA 3LB8C 3AEDB 1J7CA 3A4SC 2BTEA 2KQSA 1CQVA 3HRDD 1F9JA 4BAXA 2BWFA 4G11A 3ZNZB 1B9RA 1C78A 2OJRA 2A5UA 2X38A 2KOXA 2LMCA 1GB1A 3D32A 3UF8A 1CJEA 2XN9C 2ZW1A 3AE3B 4YWGG 3RULA 4A9AA 1V49A 4CYEA 2CHXA 4W9KA 2KT7A 4AJWA 1K53A 3QAQA 1LO5D 3U30A 1FIQA 4GOCA 1YJ1A 1E7PB 1V97A 4RNAA 2V4LA 2J7QB 1FCLA 1TBEA 1F52A 5CHVC 1HZ6A 4RF1A 1IGCA 3VRBB 1GG3A 4KZ0A 1UGJA 1WX7A 1P0RA 2FUHB 4J6IA 1C4AA 4C7YA 3SHQA 3R8BA 1STEA 2L0FA 3PHWB 4S17A 4XWTA 1N6ZA 4II3B 4KVGB 2G9HD 4ZHOA 2WGSA 3ZQ4A 1DOYA 3DBHB 3L13A 1MI0A 4BBNF 1XXGA 2GRIA 3VXWA 3GE3C 1L4ZB 3GP7A 4JLCA 3AE4B 4ZHPA 1SE2A 2ZNVC 3TMPB 2KN4A 4BBNC 1UGMA 2MH7A 1T0QC 3WA0A 2RR9A 2G1EA 4E71A 2AQ2B 3LJ3A 3S2AA 1N63A 2HTME 5IOIA 2M17A 3UQAA 1WXQA 1FRDA 2JZ3B 1QOBA 2WXGA 1SBBB 1C4CA 2BS4B 4I6NB 4WH4A 3PT2B 2EKIA 2Q5WD 2N7EA 1R4NI 2MP2A 4YTNB 4WWPA 2K39A 4BKSA 2DYBA 2WXKA 4WAFA 3ZDTA 2VH2A 1XD3B 2AYOB 2XNAC 1P98A 3R3MA 1G6JA 5IAAC 4C56C 2DAJA 4IUMB 1M4VA 1XT9B 2JXXA 4JIOU 3TJPA 1ET9A 4ANVA 2KC2A 1L4DB 1E9MA 1NDDA 2N9LA 2JVCA 4CO7A 1KH0A 3V6EB 1UELA 1C79A 5FR3A 4WWMA 3DQVA 4AJYB 4PT5A 4II2B 2BS2B 2C5LC 3VUYA 1C9FA 3KYCD 2K6QA 2KDBA 3MTNB 3APDA 2K8HA 5CX3A 3QA8A 1YN3A 2PLPA 5JXVA 4RFBA 2YLMA 2WDRB 4IM3A 3VFKA 1ZUD2 5C2TB 3DVNU 3LYYA 1NYQA 2LWPA 3H8HA 2LRUA 1IBXA 2V0GA 4XE0A 2ONQA 2INPE 3N3KB 3A1QB 2QC8A 1QILA 2D3AA 4K7WA 2DZKA 1R4MI 1UF0A 4EUTA 4DDGD 3QQ8B 2C7HA 4ANWA 1OFFA 2HDEA 5AEKB 2WP9B 1HA5A 1I4QA 2O6VD 2WXOA 4ZRJA 2ZEQA 1NVID 4LDTB 4DXGA 4M00A 3ZRCA 1SE3A 1I7HA 1Z2MA 4W9GA 2ZPYA 1OQYA 2NS5A 1S1QB 3RNEC 4GDLA 1I4GA 4GMVA 4AOFA 3ONSA 3NVYA 1GNUA 1JWSD 1C77A 2LVOA 3AM9A 1KLGD 3IVFA 3MC8A 4MT5A 1WX9A 3TIXA 2E3TA 4BFRA 3VRAB 2MLBA 3BZDB 2KWVB 4FJYA 4E3CA 1V1PA 3ZDMC 4ACFA 2IJ0A 1E90A 3AE2B 4HROA 2J42A 2UYZB 4M8MA 2LXCA 3CSFA 1WXMA 4US9A 5FR6A 5IP4D 2KTRB 5J18A 3LDZE 2LVPA 1UD7A 1E10A 3UQBA 1WGGA 3IXSA 4IOIE 2FCSA 4LDTD 4YSYB 2C9WB 4MACA 1KFYB 2GMIC 3HVDA 1YJJA 3K9OB 4GXBA 2W54A 2LD9A 4LK0M 3AN1A 4GN1A 3AECB 4AS1A 4IM0A 1R7SA 4B95A 3UI3A 3MHSD 2I1JA 2SEBD 4DBGA 3AE5B 4BVUC 2KJRA 3J9CA 1E8YA 3IAM1 3L10B 3PREA 4FULA 3VQIA 1WE7A 3Q3MC 4PYUA 1ESFA 5BMHA 2GOWA 3IT6B 5MPOA 1JMLA 4KDLB 3MJ5A 4L1BA 3V60A 2LGIA 5EE0A 1TTNA 2BBCA 4NAWB 1GAQB 1TS4A 2Y3AA 3AEBB 3Q6BA 4G50A 3Q3JA 1V9JA 1VZ7A 2CHZA 1XCQL 1JWBD 3N9YC 4EOYA 1E0ZA 2QCZA 2KANA 2MBBB 2N4FA 5FKAC 3L17A 1YMHE 3NS1A 4P7IA 3BY4B 3W9CB 1NI3A 1ZPSA 4KKIA 1GC6A 2O2VB 3A33B 5HG2A 3VAWA 4OVUA 1IYFA 4AQ7A 3MP9A 3UIOB 1WM2A 2H89B 2KFJA 4W9FA 4N6EB 5BYRA 2BYVE 4A55A 2AQ3B 2MBOA 4B9KA 4EZKA 1WZ0A 2WU2B 2Z0EB 4KKJA 1NBFC 4GIVA 2UWQA 2WHIA 3BINA 4BZAA 3QARA 1RFAA 3FC4A 3ZNGC 3PTFC 1YN4A 2PVOD 3Q2AC 4C4VB 5JH5C 1WY8A 1L5PA 1UUPA 1RRBA 3MC9A 1DGJA 4IDIA 1I42A 2KWCA 2FIDA 2RPVA 4RM9A 2KNBA 4EZJA 3JSVA 1TGZB 1LM8B 2V3NA 5CTRC 3VUXA 4A3PA 3IBEA 5GMVA 3WAPA 3B2GA 1FNVA 2BW2A 4YTPB 2BGFA 2KO3A 3PLVA 2LASA 1FPYA 1OEYJ 1GPXA 4IWOA 1L2NA 3AE1B 4W9IA 4KSLC 1EWYC 4P6VF 1RWSA 2D2QA 1J7BA 2N1WA 3A4RA 4HPLB 1ZGUB 4XZ4A 5D6JB 3WANA 4HLEA 3DWGC 2IYDB 1CZPA 2XBBC 4E74A 4X57B 3RN9C 3VH3B 2MBHA 4O1NA 4B0EA 5IN7A 5BO4B 2NPTA 1JRUA 3M3JA 3W5UB 4M0WA 3TUOA 4GDKA 1E8ZA 2BYTA 3FILA 4WJOA 1TZOA 3GZNB 5G2NA 2AL6A 1PDXA 1K51A 2BQQA 4P1BC 2DZMA 4TQ1A 2M1MA 2ICIA 3N32A 3H7PB 3WAOA 3SDLC 2BF8B 1ET6A 2L76A 3SD5A 2RDGA 1MG4A 1XEEA 2KKCA 4WURA 4GB9A 3DWMA 3I5JC 2JWUA 2WYQA 2KFKB 2BS3B 2KWDA 3ZTCA 1WJUA 2AWTA 2JU6X 5H8YE 3RPFC 2DNFA 1T5XD 1V5OA 3URYA 4WJNA 3RMKC 5J17A 2LHEA 4NY0A 3U8ZA 3ZXRA 1HEZE 3I63C 3JVZX 3PZDA 3B2FA 3M95A 2FBWB 3PS6A 4NJ7A 2K1FA 5EE1A 5G5HA 4OZAA 3DOWA 1RM6C 4J3OD 3HM6X 2K0PA 1ZXHA 1KRHA 2FUG1 4DXFA 2L7RA 2AL3A 2KDEB 2K5PA 4OW0A 5G5GA 2G45B 3R2TA 1J0GA 4XX5A 1SXTA 3RNFC 2MEKA 2A4ZA 1EF1A 3C8YA 1R4MB 3QK0A 4MDKE 4PS3A 3VTVA 3P4QB 4OHJA 2Y5BB 4D2KA 1SJHD 5BYQA 5AUKA 3OJ4B 2Z8LA 2B3AA 4HCNB 1PGAA 2G4DB 2WS3B 5AZGA 3AH7A 4XYCA 2LUMA 1D3ZA 1WJNA 1WXAA 4MELA 4RF0A 1UBIA 1XLOA 1PYWD 4B6WA 4W9DA 1T0SC 4BKGA 2INCC 1TY0A 4DK5A 4XDCA 1HTOA 4YXDB 3KH0A 2LHDA 2JSVX 1ENFA 3EFUA 3BVGA 5KHOA 2VRRB 4YL8A 4MJSB 3M63B 3OJ3A 3BVZA 3ENEA 2PW9A 2BKRB 1FEHA 1XCTL 2WXNA 3P63A 4NPNA 1EM7A 3AEGB 3ETRA 3P4SB 3EFCA 2OHFA 4LNNA 1TKEA 3ZYYX 3AEAB 4HDQA 2CJOA 4L2YA 3RNGC 1L6VA 3PPAA 2QEJC 3NY5A 1BUIC 2ZPNA 2IO0B 3I57A 4R3DA 1HTQA 1YQBA 2D3CA 1N60A 2CKHB 3VHTC 4KGSA 1V1OA 3Q3FA 2TSSA 3Q8FA 3RCZA 4US8A 1J7AA 1WGKA 2RMMA 1PQSA 1HZ5A 1WMHA 4JX1C 1IP9A 1T3QA 4MH0E 2DENB 1WSPA 3Q8EA 2NBWB 2EELA 2PE6B 1MHHE 3DBLB 4K7SA 3V3XA 2YEPB 3ZRFA 3V6CB 5DCNA 4PS7A 2GBRA 4AP4C 2MJDA 3KUDB 4A20A 2N7JA 3R7QA 4OVZA 1HQRD 5DPRA 4JE3B 1D5MC 1XO3A 1E5WA 3PGEA 3NRZA 4HDOA 3TL5A 3N30A 1P7EA 1TT5B 1HXYD 2N9XA 4BOSC 1CK1A 2L0TA 1IGDA 4MSQB 1RFKA 2KDMA 3DBRI 1Q1OA 1YN5A 2R2QA 4HKZE 3ZVVA 1NYRA 4LTUA 1TKYA 4ICUA 2LFIA 4YTMB 2WXJA 3ECIA 2PPHA 3NJTA 3DBSA 2O6VA 3Q3NC 1V80A 1FRRA 4ZYSA 2R61A 2RDBC 4N9F4 4C80A 4F1SA 4FA6A 3GB1A 3QJZA 2RGFA 1A70A 2R2OA 2JRIB 2KVRA 2K8CA 1H4RA 5LLIA 4ITKA 2L8JA 4MEMA 2DZJA 4CQNA 2BWES 3T3OA 1VZ8A 1FXTB 1MPEA 1IUEA 2V9HA 3N1ZC 1TY2A 4FXCA 1MVKA 2KQ4X 3L08A 3SR6A 2MP2B 3GOEA 1L7YA 5HFYA 3BWUD 1XLQA 3Q8AA 3L16A 2EKEC 1N5WA 3TSSA 3V62A 5L95C 2PMVA 3U7DA 2Y5PA 3MHZA 2ZVNA 3KUZA 1V5TA 1WR6E 3P42A 3LXFA 3UGBB 2LGSA 2QILA 1WM3A 3UIPB 1TYGB 3L54A 1WH3A 5CHFA 4ARIA 2KMCA 2LVQA 1D5ZC 1PGXA 4IC7B 3TEZA 1E7VA 1PFDA 2Y5CA 3AEFB 3X0WA 4HEA1 3R7RA 4I6PA 3AE6B 3NG0A 1MHXA 4RGTA 3GE8C 4KSKC 4JPSA 1QT9A 3NZUA 2KTRA 5C23A 1P7FA 4HJGE 2JYTA 2W3SA 3Q3OC 1YD8U 4HK2A 2ZCBA 1L6UA 2IGGA 4WWNA 2D3GA 1IBXB 1D6EC 1VJKA 2KK8A 2M0AA 5LXHA 2GBMA 2NMQA 5EDSA 3QIJA 1T6BX 1PGBA 4MH8A 2KTFA 1KJTA 2B76B 3AE7B 4OZCA 4IWPA 4WAAA 1K8RB 3SEBA 4USAA 2WXRA 2MBQA 4QAYA 3PRMB 2AX5A 1A5RA 1KOTA 4FN2A 3ZXVA 1JROA 4DHJB 2WNMA 3K9PB 3I9V1 3EHVA 1SSNA 1QKZA 4FADA 2V3SA 4GDLB 3PRPB 3E56A 1GC7A 2K25A 1M94A 5C3JB 4TQ0A 4ZRPA 1WYWB 3H7SA 4TKNA 2MX2A 1EF5A 4HCPB 3APFA 4H2AA 3NS8A
chains in the Genus database with same CATH topology
2N1WA 3A4RA 3B0AA 2KOXA 3AULA 2MWSB 4HPLB 3A1QA 3D32A 1ZGUB 4XZ4A 3DVGY 4IWQA 2HTHA 5D6JB 3UF8A 3WANA 4HLEA 5E6PA 2FIFA 4A3OA 4WJPA 2IYDB 2LGDA 2XBBC 4E74A 3RULA 5TR5A 2PEAA 5G55A 4X57B 3VH4B 2QHOA 3H6NA 1C3TA 2DHZA 3ZTDA 4BOZB 1V49A 3VH3B 2MBHA 4CYEA 2NR2A 4HWIB 3AU4A 2J0KA 5BO4B 2CHXA 3AU5A 2NPTA 1JRUA 3M3JA 3B08A 4BKTA 2KDIA 4OVVA 4W9KA 1QZEA 4AJWA 3CSTA 3QAQA 3U30A 4DHJD 5HKHA 3H1UA 4GDKA 1E8ZA 2O6VB 4GOCA 1YJ1A 5KHQA 3IFWB 3T8MA 2V4LA 2J7QB 4WJOA 4IG7B 1TBEA 4FBJB 5CHVC 5G2NA 1U4AA 1VD2A 1V81A 2AL6A 2Z59B 3NHEB 4ZRKA 2NBUA 4NQKE 1E8XA 2DZMA 4TQ1A 2M1MA 1GG3A 4W9JA 1WR1A 3N32A 4KZ0A 2MCNB 3H7PB 3WAOA 5D2MB 1WX7A 1P0RA 2FUHB 2L3ZA 4J6IA 3SDLC 3DCGA 2Z0DB 2BF8B 2L76A 3W1SA 3SD5A 3SHQA 4URKA 2KKCA 2K6DB 4HVBA 4GB9A 4DWFA 2WYQA 3TCAA 2KFKB 1ZKHA 2OOBB 2L0FA 3PHWB 3ZTCA 1WJUA 2ZZPB 2AWTA 4II3B 2LJ5A 4KVGB 4BKSD 2IO3B 4HJKA 2KX3A 1V5OA 4WJNA 5J17A 1LXDA 4ICVA 4NY0A 3U8ZA 2FAZA 1H8CA 4FLHA 3L13A 3JW0X 3JVZX 2G4SA 3PZDA 3HM3A 2BKFA 2C60A 5DPTA 4BBNF 3WIMA 3M95A 1WGHA 3PS6A 3VXWA 4NJ7A 2K1FA 4JLCA 3OLMD 2KQ7A 2IO2B 2MW5A 3DDCB 3WAMA 2ZNVC 1P9DU 3ZW3A 5L83A 3DOWA 3TMPB 2J0MA 4BBNC 4WJQA 1UGMA 3HM6X 3PLUA 2JY6A 1SGHA 3WA0A 1KLVA 2RR9A 2FCNA 4E71A 3CMMB 2L7RA 3LJ3A 3V61A 3S2AA 2AL3A 2LRWA 2KDEB 1ISNA 2M17A 3UQAA 5J2RA 2G45B 1J0GA 4XX5A 2JPHA 2GBJA 3H9DA 2JZ3B 3R66C 2A4ZA 1WJ4A 1EF1A 4AUQC 3I3TB 2PE9A 4W9LA 5DPSA 2J0JA 3QK0A 4MDKE 4M8NA 3ZNID 4I6NB 4PS3A 3VTVA 3PT2B 3DVGX 1UZXB 2CS4A 2Y5BB 4NAWA 2N7EA 1R4NI 2MP2A 4KDIC 2CHWA 4ANUA 4WWPA 1V86A 3QWZB 2K39A 4BKSA 2DYBA 3APCA 3RZWC 2FCQA 3OJ4B 2B3AA 4G0NB 4HCNB 1V6EA 2DZIA 3ZDTA 1WI0A 2G4DB 5AZGA 1XD3B 2AYOB 4DXAB 1D3ZA 4W9HA 4ANXA 1WJNA 1X1MA 1P98A 3R3MA 2MA9B 1G6JA 2BPSA 5IAAC 1WXAA 2DAJA 4IUMB 4MELA 1UBIA 2N7DA 3HHMA 4MGIE 1YX5B 2JZZA 1XT9B 2JXXA 4JIOU 4W9DA 4B6WA 1LFDA 3TJPA 5JZEB 4ANVA 3PV1A 1RLFA 2KC2A 2D10A 3O65B 4BKGA 2WWZA 1NDDA 2IO1B 2RD0A 4IM2A 2O2VA 2JVCA 4DK5A 4CO7A 3A9KB 3V6EB 1WE6A 1CMXB 1UELA 4FJZA 3KH0A 4LJPB 3NOBA 4EEWA 2KZRA 3IG3A 2W9NA 3DQVA 4AJYB 2ZJDA 3AXCA 4DHZE 2N9PC 4II2B 5AZFA 2C5LC 3JSVB 3VUYA 3EFUA 3KYCD 5KHOA 2K6QA 2C7NB 2VRRB 2KDBA 1J8CA 2YVCA 1AARA 3MTNB 1OGWA 1C1YB 3M63B 3APDA 3OJ3A 4KIKA 4MJSB 2K8HA 3ENEA 4YL8A 2ZVOA 1UBQA 4K81A 2BKRB 2KC1A 5CX3A 1VCBA 3ZNHB 3VDZA 4NPNA 3DBHI 2FNJB 3JYUA 2XK5A 3QA8A 2WX0A 4XC2A 1P3QU 2KXJA 3KW5B 3A9JA 3HK0A 2DYOA 1OEYA 4JGHB 1UH6A 2YLMA 2PJHA 3DBLI 4IM3A 3TBLD 4AWJA 3VFKA 4EFOA 2JT4B 1OTRB 4K1RB 3ZLZA 3DVNU 4DHZB 2LWPA 4HDQA 2I1KA 1WJ6A 2LRUA 3PPAA 2K8BA 3X23A 3NY5A 2LGYA 3VTUA 3RD2A 2BYFA 4TUUA 2ZPNA 2IO0B 1YQBA 2CKHB 3N3KB 4I6LB 3VHTC 3IHPC 3A1QB 3Q3FA 2HJ8A 1WGRA 4TV3A 4EKUA 3RCZA 1XQQA 4K7WA 5LXIB 4JQWC 4ZDVA 2DZKA 2WX1A 3CF6E 1R4MI 3M62B 1PQSA 4EUTA 4DDGD 1WMHA 3QQ8B 2KJ6A 2C7HA 3ZUNA 4ANWA 2NPTB 2N1VA 4RM8A 4MH0E 1IP9A 4GGQA 5AEKB 4PYZA 2DENB 2NBWB 2O6VD 4ZRJA 2MQJA 2PE6B 2ZEQA 2KMAA 3EC8A 4G3XB 4LDTB 2JWZA 2NVUI 4K7SA 3ZRCA 4MM3A 3ZRFA 5D7GA 3V6CB 1Z2MA 2LI5A 4W9GA 2ZPYA 2NCNA 5DCNA 4PS7A 1OQYA 1WZ3A 2NS5A 1S1QB 3VVWB 2GBRA 4AP4C 3KUDB 4GDLA 4A20A 4GMVA 3QCAA 3AI5A 4AOFA 2IY0B 3L0WB 3ONSA 2ZNVB 1GNUA 3R7QA 1EUVB 3QHTA 3W1SC 4F7ZA 4MGYE 2KLCA 2LVOA 3VUWA 5D94A 5DPRA 3IVFA 1E5WA 1WX9A 3PGEA 4HDOA 3TIXA 3ZIMA 1SIFA 3TL5A 4BFRA 4IW0A 2MLBA 2CR5A 3N30A 2KWVB 4FJYA 1GJZA 4EZLA 2KLGA 2L00B 4E3CA 3ZDMC 2N9XA 1WFYA 4NJ6A 4BOSC 2D07B 2L0TA 1E90A 4MSQB 2UYZB 1J19A 3A9KA 2KN5A 3DBRI 2LXCA 4M8MA 1V2YA 1Q1OA 3CSFA 1WXMA 5FR6A 2R2QA 4ZYNA 5JHAA 2KTRB 3EECA 5J18A 3LDZE 3ZVVA 2LVPA 1UD7A 1WIAA 4W9CA 3RZFA 1WGGA 4ICUA 3UQBA 2FCSA 4LDTD 2C9WB 1Z5SB 2M4NA 3ECIA 2GMIC 2PPHA 3WALA 3DBSA 2O6VA 1V80A 1Q5WB 1WGDA 4ZRIA 3K9OB 3RYTA 2LGXA 4GXBA 3ALBA 2LD9A 4N9F4 4F1SA 4FA6A 4GN1A 4MGZE 3QJZA 2RGFA 2HD5B 4IM0A 5AZHA 1HE8A 2R2OA 2JRIB 2KVRA 4B95A 2KHWB 2K8CA 5CHWA 3MHSD 2I1JA 4DBGA 4NNJB 1H4RA 1BT0A 1WX8A 5LLIA 3KUCB 4BVUC 2KJRA 4FULA 1E8YA 5IA7A 3L10B 3ML9A 3PREA 4K7UA 3VQIA 2L8JA 3H7PA 4MEMA 1WE7A 4FHJA 2DZJA 1Q0WB 4PYUA 3SU8X 2MRPA 2V1YA 2BWES 2DYMA 3OAWA 1SE9A 4DDID 1FXTB 2GOWA 3ZKJC 4GU2A 3B1LX 4KDLB 3PVLA 4ASWC 3L08A 3V60A 2KFKA 3KYDD 1TTNA 4NAWB 3RUIB 2MP2B 2ZCCA 3GOEA 1L7YA 2LZ6A 3UINB 1YX6B 3L16A 2EKEC 1E7UA 1LQBA 3QX1A 3V62A 1MG8A 5E6NA 5L95C 3W1YA 4FHKA 4G50A 3U7DA 3Q3JA 3DPDA 1V9JA 4RMAA 2CHZA 2HE7A 4CHKA 4EOYA 2KANA 2MBBB 4WQOB 2ZVNA 2N4FA 2D11A 3KUZA 1V5TA 1WR6E 2KDFB 3L17A 3UGBB 4P7IA 2JRHA 3BY4B 1WM3A 2M8SA 3RT3B 1GC6A 2O2VB 3A33B 3UIPB 2GBKA 4WWOA 2JUOA 3ZO5B 4MSMB 3L54A 2LUEA 2LXAA 2DX5B 4MGKE 3VAWA 1WH3A 3PHXB 4OVUA 2KJHB 5CHFA 3T9LA 1IYFA 1NI2A 2KMCA 2LVQA 2XEWA 3UIOB 1WM2A 2KFJA 4W9FA 2MSED 4FJVB 2BYVE 4M0WB 3C0RB 1GUAB 4IC7B 3VTWA 1E7VA 4KIKB 4GDKB 2L05A 2MBOA 2XK5B 3QC8B 3X0WA 4B9KA 4EZKA 1WZ0A 2Z0EB 2DAFA 3A9JB 1ZW7A 3R7RA 4I6PA 1NBFC 4KSKC 4GIVA 2UWQA 4NQLB 2JF5A 3BINA 3NZUA 2KTRA 4JL9A 5C23A 2IBIB 1RAXA 3PRZA 1YD8U 3QARA 4HK2A 1RFAA 2ZCBA 4LCDE 3ZNGC 3PTFC 1T0YA 4WWNA 2D3GA 1WRDB 2KD0A 5E6OA 2REXA 3P2BA 5JH5C 2KK8A 5LXHA 2GBMA 1WY8A 5EDSA 3QIJA 2EMTA 1RRBA 2KTFA 3ML8A 1KJTA 2GBNA 1I42A 2EMSA 2IZVB 2KWCA 5C1ZA 2FIDA 1WXVA 3KVFB 2WDTB 2FCMA 2KWUB 1WMHB 4RM9A 5JHBA 2AEHA 2KNBA 1Y8RC 2N9EB 3NZSA 1S3SG 4IWPA 4WAAA 4EZJA 1K8RB 3JSVA 1TGZB 1LM8B 4F8CB 1EO6A 1YIWA 5CTRC 2MBQA 4PS8A 3VUXA 3PRMB 2ASQA 1IPGA 4A3PA 1A5RA 4KV2A 3IBEA 1KOTA 4FN2A 4MJSA 2CU1A 2RSUA 2NBVB 5GMVA 3WAPA 4DHJB 2BYEA 1WF9A 3HIZA 3K9PB 4HPMB 3EHVA 1E8WA 1WGYA 1KM7A 2KX0A 2C7MB 4HXDA 2BGFA 2KO3A 2V3SA 4GDLB 1WXSA 2MBEA 3PLVA 4FADA 2LASA 3PRPB 4LJOB 5DPWA 4GSWA 1GC7A 1OEYJ 2K25A 2M0XA 3DVNV 3PSEB 1M94A 4IWOA 1P1AA 3GZNI 1TZ1A 2G3QB 1L2NA 4W9IA 4TQ0A 3A4SC 2KQSA 1WYWB 3H7SA 1F9JA 4W9EA 1I35A 2BWFA 4TKNA 2RPQA 2IY1B 4KSLC 2MX2A 4G11A 3ZNZB 1EF5A 4HCPB 3MJWA 3APFA 2D2QA 4KZCA 3NS8A 2OJRA 2A5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1W A;  3A4R A;  3B0A A;  2KOX A;  3AUL A;  2MWS B;  4HPL B;  3A1Q A;  3D32 A;  1ZGU B;  4XZ4 A;  3DVG Y;  4IWQ A;  2HTH A;  5D6J B;  3UF8 A;  3WAN A;  4HLE A;  5E6P A;  2FIF A;  4A3O A;  4WJP A;  2IYD B;  2LGD A;  2XBB C;  4E74 A;  3RUL A;  5TR5 A;  2PEA A;  5G55 A;  4X57 B;  3VH4 B;  2QHO A;  3H6N A;  1C3T A;  2DHZ A;  3ZTD A;  4BOZ B;  1V49 A;  3VH3 B;  2MBH A;  4CYE A;  2NR2 A;  4HWI B;  3AU4 A;  2J0K A;  5BO4 B;  2CHX A;  3AU5 A;  2NPT A;  1JRU A;  3M3J A;  3B08 A;  4BKT A;  2KDI A;  4OVV A;  4W9K A;  1QZE A;  4AJW A;  3CST A;  3QAQ A;  3U30 A;  4DHJ D;  5HKH A;  3H1U A;  4GDK A;  1E8Z A;  2O6V B;  4GOC A;  1YJ1 A;  5KHQ A;  3IFW B;  3T8M A;  2V4L A;  2J7Q B;  4WJO A;  4IG7 B;  1TBE A;  4FBJ B;  5CHV C;  5G2N A;  1U4A A;  1VD2 A;  1V81 A;  2AL6 A;  2Z59 B;  3NHE B;  4ZRK A;  2NBU A;  4NQK E;  1E8X A;  2DZM A;  4TQ1 A;  2M1M A;  1GG3 A;  4W9J A;  1WR1 A;  3N32 A;  4KZ0 A;  2MCN B;  3H7P B;  3WAO A;  5D2M B;  1WX7 A;  1P0R A;  2FUH B;  2L3Z A;  4J6I A;  3SDL C;  3DCG A;  2Z0D B;  2BF8 B;  2L76 A;  3W1S A;  3SD5 A;  3SHQ A;  4URK A;  2KKC A;  2K6D B;  4HVB A;  4GB9 A;  4DWF A;  2WYQ A;  3TCA A;  2KFK B;  1ZKH A;  2OOB B;  2L0F A;  3PHW B;  3ZTC A;  1WJU A;  2ZZP B;  2AWT A;  4II3 B;  2LJ5 A;  4KVG B;  4BKS D;  2IO3 B;  4HJK A;  2KX3 A;  1V5O A;  4WJN A;  5J17 A;  1LXD A;  4ICV A;  4NY0 A;  3U8Z A;  2FAZ A;  1H8C A;  4FLH A;  3L13 A;  3JW0 X;  3JVZ X;  2G4S A;  3PZD A;  3HM3 A;  2BKF A;  2C60 A;  5DPT A;  4BBN F;  3WIM A;  3M95 A;  1WGH A;  3PS6 A;  3VXW A;  4NJ7 A;  2K1F A;  4JLC A;  3OLM D;  2KQ7 A;  2IO2 B;  2MW5 A;  3DDC B;  3WAM A;  2ZNV C;  1P9D U;  3ZW3 A;  5L83 A;  3DOW A;  3TMP B;  2J0M A;  4BBN C;  4WJQ A;  1UGM A;  3HM6 X;  3PLU A;  2JY6 A;  1SGH A;  3WA0 A;  1KLV A;  2RR9 A;  2FCN A;  4E71 A;  3CMM B;  2L7R A;  3LJ3 A;  3V61 A;  3S2A A;  2AL3 A;  2LRW A;  2KDE B;  1ISN A;  2M17 A;  3UQA A;  5J2R A;  2G45 B;  1J0G A;  4XX5 A;  2JPH A;  2GBJ A;  3H9D A;  2JZ3 B;  3R66 C;  2A4Z A;  1WJ4 A;  1EF1 A;  4AUQ C;  3I3T B;  2PE9 A;  4W9L A;  5DPS A;  2J0J A;  3QK0 A;  4MDK E;  4M8N A;  3ZNI D;  4I6N B;  4PS3 A;  3VTV A;  3PT2 B;  3DVG X;  1UZX B;  2CS4 A;  2Y5B B;  4NAW A;  2N7E A;  1R4N I;  2MP2 A;  4KDI C;  2CHW A;  4ANU A;  4WWP A;  1V86 A;  3QWZ B;  2K39 A;  4BKS A;  2DYB A;  3APC A;  3RZW C;  2FCQ A;  3OJ4 B;  2B3A A;  4G0N B;  4HCN B;  1V6E A;  2DZI A;  3ZDT A;  1WI0 A;  2G4D B;  5AZG A;  1XD3 B;  2AYO B;  4DXA B;  1D3Z A;  4W9H A;  4ANX A;  1WJN A;  1X1M A;  1P98 A;  3R3M A;  2MA9 B;  1G6J A;  2BPS A;  5IAA C;  1WXA A;  2DAJ A;  4IUM B;  4MEL A;  1UBI A;  2N7D A;  3HHM A;  4MGI E;  1YX5 B;  2JZZ A;  1XT9 B;  2JXX A;  4JIO U;  4W9D A;  4B6W A;  1LFD A;  3TJP A;  5JZE B;  4ANV A;  3PV1 A;  1RLF A;  2KC2 A;  2D10 A;  3O65 B;  4BKG A;  2WWZ A;  1NDD A;  2IO1 B;  2RD0 A;  4IM2 A;  2O2V A;  2JVC A;  4DK5 A;  4CO7 A;  3A9K B;  3V6E B;  1WE6 A;  1CMX B;  1UEL A;  4FJZ A;  3KH0 A;  4LJP B;  3NOB A;  4EEW A;  2KZR A;  3IG3 A;  2W9N A;  3DQV A;  4AJY B;  2ZJD A;  3AXC A;  4DHZ E;  2N9P C;  4II2 B;  5AZF A;  2C5L C;  3JSV B;  3VUY A;  3EFU A;  3KYC D;  5KHO A;  2K6Q A;  2C7N B;  2VRR B;  2KDB A;  1J8C A;  2YVC A;  1AAR A;  3MTN B;  1OGW A;  1C1Y B;  3M63 B;  3APD A;  3OJ3 A;  4KIK A;  4MJS B;  2K8H A;  3ENE A;  4YL8 A;  2ZVO A;  1UBQ A;  4K81 A;  2BKR B;  2KC1 A;  5CX3 A;  1VCB A;  3ZNH B;  3VDZ A;  4NPN A;  3DBH I;  2FNJ B;  3JYU A;  2XK5 A;  3QA8 A;  2WX0 A;  4XC2 A;  1P3Q U;  2KXJ A;  3KW5 B;  3A9J A;  3HK0 A;  2DYO A;  1OEY A;  4JGH B;  1UH6 A;  2YLM A;  2PJH A;  3DBL I;  4IM3 A;  3TBL D;  4AWJ A;  3VFK A;  4EFO A;  2JT4 B;  1OTR B;  4K1R B;  3ZLZ A;  3DVN U;  4DHZ B;  2LWP A;  4HDQ A;  2I1K A;  1WJ6 A;  2LRU A;  3PPA A;  2K8B A;  3X23 A;  3NY5 A;  2LGY A;  3VTU A;  3RD2 A;  2BYF A;  4TUU A;  2ZPN A;  2IO0 B;  1YQB A;  2CKH B;  3N3K B;  4I6L B;  3VHT C;  3IHP C;  3A1Q B;  3Q3F A;  2HJ8 A;  1WGR A;  4TV3 A;  4EKU A;  3RCZ A;  1XQQ A;  4K7W A;  5LXI B;  4JQW C;  4ZDV A;  2DZK A;  2WX1 A;  3CF6 E;  1R4M I;  3M62 B;  1PQS A;  4EUT A;  4DDG D;  1WMH A;  3QQ8 B;  2KJ6 A;  2C7H A;  3ZUN A;  4ANW A;  2NPT B;  2N1V A;  4RM8 A;  4MH0 E;  1IP9 A;  4GGQ A;  5AEK B;  4PYZ A;  2DEN B;  2NBW B;  2O6V D;  4ZRJ A;  2MQJ A;  2PE6 B;  2ZEQ A;  2KMA A;  3EC8 A;  4G3X B;  4LDT B;  2JWZ A;  2NVU I;  4K7S A;  3ZRC A;  4MM3 A;  3ZRF A;  5D7G A;  3V6C B;  1Z2M A;  2LI5 A;  4W9G A;  2ZPY A;  2NCN A;  5DCN A;  4PS7 A;  1OQY A;  1WZ3 A;  2NS5 A;  1S1Q B;  3VVW B;  2GBR A;  4AP4 C;  3KUD B;  4GDL A;  4A20 A;  4GMV A;  3QCA A;  3AI5 A;  4AOF A;  2IY0 B;  3L0W B;  3ONS A;  2ZNV B;  1GNU A;  3R7Q A;  1EUV B;  3QHT A;  3W1S C;  4F7Z A;  4MGY E;  2KLC A;  2LVO A;  3VUW A;  5D94 A;  5DPR A;  3IVF A;  1E5W A;  1WX9 A;  3PGE A;  4HDO A;  3TIX A;  3ZIM A;  1SIF A;  3TL5 A;  4BFR A;  4IW0 A;  2MLB A;  2CR5 A;  3N30 A;  2KWV B;  4FJY A;  1GJZ A;  4EZL A;  2KLG A;  2L00 B;  4E3C A;  3ZDM C;  2N9X A;  1WFY A;  4NJ6 A;  4BOS C;  2D07 B;  2L0T A;  1E90 A;  4MSQ B;  2UYZ B;  1J19 A;  3A9K A;  2KN5 A;  3DBR I;  2LXC A;  4M8M A;  1V2Y A;  1Q1O A;  3CSF A;  1WXM A;  5FR6 A;  2R2Q A;  4ZYN A;  5JHA A;  2KTR B;  3EEC A;  5J18 A;  3LDZ E;  3ZVV A;  2LVP A;  1UD7 A;  1WIA A;  4W9C A;  3RZF A;  1WGG A;  4ICU A;  3UQB A;  2FCS A;  4LDT D;  2C9W B;  1Z5S B;  2M4N A;  3ECI A;  2GMI C;  2PPH A;  3WAL A;  3DBS A;  2O6V A;  1V80 A;  1Q5W B;  1WGD A;  4ZRI A;  3K9O B;  3RYT A;  2LGX A;  4GXB A;  3ALB A;  2LD9 A;  4N9F 4;  4F1S A;  4FA6 A;  4GN1 A;  4MGZ E;  3QJZ A;  2RGF A;  2HD5 B;  4IM0 A;  5AZH A;  1HE8 A;  2R2O A;  2JRI B;  2KVR A;  4B95 A;  2KHW B;  2K8C A;  5CHW A;  3MHS D;  2I1J A;  4DBG A;  4NNJ B;  1H4R A;  1BT0 A;  1WX8 A;  5LLI A;  3KUC B;  4BVU C;  2KJR A;  4FUL A;  1E8Y A;  5IA7 A;  3L10 B;  3ML9 A;  3PRE A;  4K7U A;  3VQI A;  2L8J A;  3H7P A;  4MEM A;  1WE7 A;  4FHJ A;  2DZJ A;  1Q0W B;  4PYU A;  3SU8 X;  2MRP A;  2V1Y A;  2BWE S;  2DYM A;  3OAW A;  1SE9 A;  4DDI D;  1FXT B;  2GOW A;  3ZKJ C;  4GU2 A;  3B1L X;  4KDL B;  3PVL A;  4ASW C;  3L08 A;  3V60 A;  2KFK A;  3KYD D;  1TTN A;  4NAW B;  3RUI B;  2MP2 B;  2ZCC A;  3GOE A;  1L7Y A;  2LZ6 A;  3UIN B;  1YX6 B;  3L16 A;  2EKE C;  1E7U A;  1LQB A;  3QX1 A;  3V62 A;  1MG8 A;  5E6N A;  5L95 C;  3W1Y A;  4FHK A;  4G50 A;  3U7D A;  3Q3J A;  3DPD A;  1V9J A;  4RMA A;  2CHZ A;  2HE7 A;  4CHK A;  4EOY A;  2KAN A;  2MBB B;  4WQO B;  2ZVN A;  2N4F A;  2D11 A;  3KUZ A;  1V5T A;  1WR6 E;  2KDF B;  3L17 A;  3UGB B;  4P7I A;  2JRH A;  3BY4 B;  1WM3 A;  2M8S A;  3RT3 B;  1GC6 A;  2O2V B;  3A33 B;  3UIP B;  2GBK A;  4WWO A;  2JUO A;  3ZO5 B;  4MSM B;  3L54 A;  2LUE A;  2LXA A;  2DX5 B;  4MGK E;  3VAW A;  1WH3 A;  3PHX B;  4OVU A;  2KJH B;  5CHF A;  3T9L A;  1IYF A;  1NI2 A;  2KMC A;  2LVQ A;  2XEW A;  3UIO B;  1WM2 A;  2KFJ A;  4W9F A;  2MSE D;  4FJV B;  2BYV E;  4M0W B;  3C0R B;  1GUA B;  4IC7 B;  3VTW A;  1E7V A;  4KIK B;  4GDK B;  2L05 A;  2MBO A;  2XK5 B;  3QC8 B;  3X0W A;  4B9K A;  4EZK A;  1WZ0 A;  2Z0E B;  2DAF A;  3A9J B;  1ZW7 A;  3R7R A;  4I6P A;  1NBF C;  4KSK C;  4GIV A;  2UWQ A;  4NQL B;  2JF5 A;  3BIN A;  3NZU A;  2KTR A;  4JL9 A;  5C23 A;  2IBI B;  1RAX A;  3PRZ A;  1YD8 U;  3QAR A;  4HK2 A;  1RFA A;  2ZCB A;  4LCD E;  3ZNG C;  3PTF C;  1T0Y A;  4WWN A;  2D3G A;  1WRD B;  2KD0 A;  5E6O A;  2REX A;  3P2B A;  5JH5 C;  2KK8 A;  5LXH A;  2GBM A;  1WY8 A;  5EDS A;  3QIJ A;  2EMT A;  1RRB A;  2KTF A;  3ML8 A;  1KJT A;  2GBN A;  1I42 A;  2EMS A;  2IZV B;  2KWC A;  5C1Z A;  2FID A;  1WXV A;  3KVF B;  2WDT B;  2FCM A;  2KWU B;  1WMH B;  4RM9 A;  5JHB A;  2AEH A;  2KNB A;  1Y8R C;  2N9E B;  3NZS A;  1S3S G;  4IWP A;  4WAA A;  4EZJ A;  1K8R B;  3JSV A;  1TGZ B;  1LM8 B;  4F8C B;  1EO6 A;  1YIW A;  5CTR C;  2MBQ A;  4PS8 A;  3VUX A;  3PRM B;  2ASQ A;  1IPG A;  4A3P A;  1A5R A;  4KV2 A;  3IBE A;  1KOT A;  4FN2 A;  4MJS A;  2CU1 A;  2RSU A;  2NBV B;  5GMV A;  3WAP A;  4DHJ B;  2BYE A;  1WF9 A;  3HIZ A;  3K9P B;  4HPM B;  3EHV A;  1E8W A;  1WGY A;  1KM7 A;  2KX0 A;  2C7M B;  4HXD A;  2BGF A;  2KO3 A;  2V3S A;  4GDL B;  1WXS A;  2MBE A;  3PLV A;  4FAD A;  2LAS A;  3PRP B;  4LJO B;  5DPW A;  4GSW A;  1GC7 A;  1OEY J;  2K25 A;  2M0X A;  3DVN V;  3PSE B;  1M94 A;  4IWO A;  1P1A A;  3GZN I;  1TZ1 A;  2G3Q B;  1L2N A;  4W9I A;  4TQ0 A;  3A4S C;  2KQS A;  1WYW B;  3H7S A;  1F9J A;  4W9E A;  1I35 A;  2BWF A;  4TKN A;  2RPQ A;  2IY1 B;  4KSL C;  2MX2 A;  4G11 A;  3ZNZ B;  1EF5 A;  4HCP B;  3MJW A;  3APF A;  2D2Q A;  4KZC A;  3NS8 A;  2OJR A;  2A5U A; 
#chains in the Genus database with same CATH topology
 1N5X A;  1V1P B;  1VZ6 A;  3AEE B;  3N1Y C;  4RCO A;  2MWS B;  3DVG Y;  4IWQ A;  5E6P A;  4A3O A;  3KLS X;  2PEA A;  5G55 A;  3OWE B;  3N1X C;  2DHZ A;  1C3T A;  4BOZ B;  3FAH A;  2D3B A;  4HWI B;  3AU4 A;  2J0K A;  1FNU A;  2KDI A;  4OVV A;  1QZE A;  2N9K A;  3CST A;  4DHJ D;  5HKH A;  1VLB A;  5KHQ A;  3IFW B;  4FBJ B;  3Q8B A;  1VD2 A;  2V4I B;  3U52 E;  3NHE B;  4ZRK A;  2NBU A;  4NQK E;  2QJL A;  1WR1 A;  1AN8 A;  2DBY A;  2IND C;  2L3Z A;  2OJW A;  4A90 A;  3EA6 A;  4HVB A;  4DWF A;  2YEP F;  3U7Z A;  2IO3 B;  2KX3 A;  2JX5 A;  4YT0 B;  1TKG A;  1LXD A;  4ICV A;  1H8C A;  3C19 A;  3ZGZ A;  4DQO C;  1JAL A;  3JW0 X;  2G4S A;  5BMG A;  3HM3 A;  5DPT A;  1SF0 A;  5TSS A;  3WIM A;  1WGH A;  4LLG M;  2MW5 A;  4K3C A;  1AW7 A;  3ZW3 A;  1P9D U;  1KF6 B;  1ZP0 B;  1DYQ A;  4WJQ A;  3AE9 B;  3PLU A;  2JY6 A;  1SGH A;  1KLV A;  2FCN A;  1FCC C;  3V61 A;  3Q8C A;  3MC0 B;  5T8I A;  2GBJ A;  4HKQ A;  2INN E;  1QOA A;  1WJ4 A;  4AUQ C;  3I3T B;  1SIJ A;  2PE9 A;  4W9L A;  4KGR A;  3NVV A;  2DLB A;  4M8N A;  3ZNI D;  1TS5 A;  1UZX B;  1F1H A;  2CS4 A;  4KDI C;  4ANU A;  1XLN A;  3QWZ B;  1YOV B;  1ZDX A;  4IKG A;  4DXA B;  4W9H A;  1JWA D;  2KMM A;  4YSX B;  3IAS 1;  1N62 A;  1LFD A;  1C4P A;  2WU5 B;  2WWZ A;  2I2Y A;  1FXI A;  5BYS A;  3Q14 C;  3A9K B;  4LJP B;  3NOB A;  3IG3 A;  2W9N A;  3P4P B;  1VRA B;  2N9P C;  3JSV B;  1PUT A;  2C7N B;  1J8C A;  3DBR B;  3PZ8 A;  1R4N B;  1OGW A;  1C1Y B;  4KIK A;  2DWQ A;  1VR9 A;  1VCB A;  1ZOY B;  3VDZ A;  2H88 B;  2FNJ B;  3JYU A;  2XK5 A;  4XC2 A;  3A9J A;  2DYO A;  1Q10 A;  1UH6 A;  4JGH B;  3SFE B;  3TBL D;  4AWJ A;  3AE8 B;  4EFO A;  4L23 A;  1L0Y B;  1WJ6 A;  2K8B A;  3X23 A;  2LGY A;  2V3P A;  2BYF A;  3IHP C;  2HJ8 A;  4TV3 A;  4EKU A;  5LXI B;  4JQW C;  4ZDV A;  3CF6 E;  4C7Z A;  3M62 B;  1RYJ A;  2I38 A;  3L4P A;  4N58 A;  2WQY B;  1MJD A;  1NEK B;  4PK1 A;  1WWT A;  3ZUN A;  4HPP A;  2NPT B;  3TEW A;  4S0R A;  2WDQ B;  2PIA A;  3EC8 A;  3FIL B;  2K22 A;  4G3X B;  2NVU I;  4MM3 A;  5D7G A;  1QF6 A;  3VVW B;  3T3N A;  1JQ4 A;  3CWI A;  3W1S C;  1EUV B;  1F2R C;  4MGY E;  3VUW A;  1JCK B;  3ZIM A;  2KYW A;  4LNF A;  1GJZ A;  4EZL A;  2KLG A;  3PO0 A;  2J53 A;  1WFY A;  4LNI A;  2D07 B;  3B9J A;  2KN5 A;  2FE8 A;  5JHA A;  3ZJT A;  3RNA C;  1ZDV A;  2L52 A;  4W9C A;  3RZF A;  3BK2 A;  2M4N A;  2RDH A;  1K52 A;  3R2I A;  1WGD A;  1Q5W B;  2LGX A;  4N59 A;  1FNW A;  5LNK 1;  1ACC A;  5AZH A;  1HE8 A;  2KHW B;  3DHH C;  4NNJ B;  4ZOH C;  1BT0 A;  2W3R A;  1WX8 A;  1LGR A;  3KUC B;  5IA7 A;  3ML9 A;  4K7U A;  3BYY B;  3SU8 X;  1KLU D;  2MRP A;  2V1Y A;  2DYM A;  2OED A;  1SE9 A;  1UNS A;  3AV8 A;  3ZKJ C;  3IT4 B;  4GU2 A;  2NTS A;  2QIE B;  3HVZ A;  1YQ4 B;  3B1L X;  5IKC M;  3W2D A;  4TMA B;  2MJ3 A;  3PVL A;  4ASW C;  2D5G A;  4P1C C;  3V05 A;  2ZCC A;  3UIN B;  1YX6 B;  2BVC A;  1LQB A;  2SAK A;  3W1Y A;  4FHK A;  3DPD A;  4RMA A;  2HE7 A;  2WXM A;  4WQO B;  1E6E B;  2L1A A;  2D11 A;  3RI7 C;  2KDF B;  2M8S A;  3RT3 B;  2GBK A;  2JUO A;  2GLS A;  2LXA A;  4MGK E;  2KJH B;  2XEW A;  2KVZ A;  3C0R B;  1D5X C;  2L05 A;  1EU4 A;  1I4H A;  1F0Z A;  4TSS A;  5HI1 A;  4NQL B;  2JF5 A;  4JL9 A;  2KAC A;  1F77 A;  2ZW0 A;  4LCD E;  5E6O A;  5AUI A;  2REX A;  3HUI A;  1Y56 A;  3WCQ A;  1YNT E;  4HRS A;  3ML8 A;  4JWU C;  2GBN A;  2EMS A;  1K50 A;  2IZV B;  5C1Z A;  1FD6 A;  3AB5 A;  2WDT B;  2KWU B;  1WMH B;  2NTT A;  5JHB A;  1Y8R C;  3NZS A;  1S3S G;  1TS3 A;  4F8C B;  5EE3 A;  5D3I B;  4PS8 A;  3TEY A;  1IPG A;  2CU1 A;  1KTK A;  2RSU A;  1L0X B;  1WGY A;  3BVM A;  5BMI A;  1WXS A;  2MBE A;  2WXH A;  5DPW A;  4LJO B;  3DVN V;  2M0X A;  3GZN I;  1TZ1 A;  2G3Q B;  2IGD A;  2GB1 A;  2WLB A;  1I35 A;  4W9E A;  2RPQ A;  2IY1 B;  2QDF A;  3KWL A;  3MJW A;  4KZC A;  3VR8 B;  3EGR A;  4RGM A;  3B0A A;  3AUL A;  4K3B A;  1OQQ A;  3A1Q A;  2HTH A;  1JW9 D;  2FIF A;  4WJP A;  2LGD A;  5TR5 A;  3VH4 B;  2QHO A;  3H6N A;  3ZTD A;  2NR2 A;  3AU5 A;  2JQR B;  3B08 A;  4BKT A;  3TEX A;  1SB3 C;  2JZP A;  3H1U A;  2O6V B;  2IPK D;  1DOX A;  3T8M A;  4NJC A;  4IG7 B;  1U4A A;  1I4P A;  1V81 A;  2Z59 B;  2WXF A;  1E8X A;  3ABV B;  4W9J A;  1UWM A;  2MCN B;  1WYG A;  5D2M B;  1I4X A;  2CU3 A;  3DCG A;  1EWC A;  2Z0D B;  3W1S A;  2BT6 A;  2WXL A;  1QLB B;  4URK A;  2K6D B;  1YQ3 B;  5I4D A;  3TCA A;  1ZKH A;  2OOB B;  3NVZ A;  2ZZP B;  2LJ5 A;  4BKS D;  4HJK A;  1N61 A;  2FAZ A;  3BII D;  4FLH A;  3GS2 A;  4XWW A;  1FXA A;  2BKF A;  2C60 A;  2K3U A;  4GLS C;  3OLM D;  2KQ7 A;  2IO2 B;  3DDC B;  3WAM A;  4M01 A;  1GB4 A;  1VDV A;  5L83 A;  5GXG B;  1FFV A;  4XDD A;  1MFW A;  2J0M A;  1L0V B;  2PKO A;  3FKY A;  2MJE A;  3CMM B;  4A6Q A;  2JXT A;  2LRW A;  1ISN A;  1ZXI A;  5J2R A;  1XF5 L;  2VH1 A;  1ZE3 D;  4RGN A;  2JPH A;  3H9D A;  3R66 C;  1WRI A;  5DPS A;  2J0J A;  3DVG X;  4Q2J A;  4NAW A;  2CHW A;  5IO9 A;  1V86 A;  3APC A;  2PTL A;  3RZW C;  2FCQ A;  4G0N B;  1V6E A;  2DZI A;  1WI0 A;  1GOZ A;  4ANX A;  1X1M A;  2MA9 B;  4JWS C;  2BPS A;  1B1Z A;  2N7D A;  3HHM A;  2QMT A;  3PZ7 A;  4MGI E;  1YX5 B;  3KQ4 A;  2JZZ A;  5JZE B;  3PV1 A;  1RLF A;  2D10 A;  3O65 B;  2WDV B;  4KGT A;  4WQM A;  1SEB D;  2IO1 B;  4IM2 A;  2RD0 A;  2O2V A;  1WE6 A;  1CMX B;  4FJZ A;  1ROE A;  1XLP A;  4EEW A;  2KZR A;  1EU3 A;  1FFU A;  3SFD B;  2ZJD A;  3AXC A;  4DHZ E;  5AZF A;  4WIP A;  1FO4 A;  4OZB A;  1BML C;  3DHI C;  2YVC A;  1AAR A;  2BB6 A;  2ZVO A;  4K81 A;  1UBQ A;  2KC1 A;  3ZNH B;  3DBH I;  2E6X A;  2WX0 A;  1P3Q U;  2KXJ A;  3KW5 B;  3HK0 A;  1OEY A;  2PJH A;  3DBL I;  3DHG C;  2JT4 B;  1OTR B;  4K1R B;  3ZLZ A;  3Q69 A;  4DHZ B;  4NZL B;  2I1K A;  4B0M A;  5EE9 A;  3NUH B;  4LNO A;  3VTU A;  3RD2 A;  2IDY A;  2J52 A;  3ZJU A;  4C4V A;  4TUU A;  4M02 A;  4I6L B;  1UWX A;  3OG5 A;  1WGR A;  1FMA D;  3CIR B;  1BXT A;  1XQQ A;  2WX1 A;  1YJI A;  2KJ6 A;  2PVG C;  2N1V A;  4RM8 A;  2LJI A;  4GGQ A;  4PYZ A;  4EE2 A;  2MQJ A;  3AMZ A;  2KMA A;  2JWZ A;  2QSD A;  2LI5 A;  1DOI A;  2NCN A;  1WZ3 A;  1TS2 A;  1QOG A;  3QCA A;  3AI5 A;  2IY0 B;  3L0W B;  4NAM A;  2ZNV B;  4F7Z A;  3QHT A;  2KLC A;  2KAJ A;  5D94 A;  4ZRQ A;  3BK1 A;  1SIF A;  4IW0 A;  1AWD A;  2CR5 A;  2ACZ B;  3ZJV A;  2M19 A;  2L00 B;  3O13 A;  4NJ6 A;  1OQR A;  1J19 A;  3A9K A;  2HJ1 A;  1V2Y A;  4ZYN A;  3EEC A;  5D3D A;  3RNB C;  1WIA A;  4REZ A;  4YSZ B;  1AYF A;  2JYE A;  1Z5S B;  2J4X A;  3WAL A;  4ZRI A;  4UDU C;  3RYT A;  3ALB A;  3KWV A;  4MGZ E;  2HD5 B;  5CHW A;  2AQ1 B;  3H7P A;  3E9S A;  4FHJ A;  1Q0W B;  3RFZ B;  3OAW A;  2W55 A;  4DDI D;  3P1M A;  2WXI A;  1TIF A;  4P16 A;  2K9X A;  2VZK B;  4RGO S;  2KFK A;  3KYD D;  3RUI B;  3W5V B;  2LZ6 A;  2CJN A;  1C76 A;  1E7U A;  3QX1 A;  5E6J A;  1MG8 A;  5E6N A;  3P4R B;  2WXP A;  4CHK A;  3VR9 B;  2LEK A;  5HHD G;  1JWU D;  2JRH A;  3N20 C;  2N0S B;  4ARC A;  2BB5 A;  4WWO A;  1F2R I;  2L32 A;  3ZO5 B;  4MSM B;  4RH6 A;  3RNC C;  2LUE A;  5H92 C;  2DX5 B;  3PHX B;  3T9L A;  1NI2 A;  2MSE D;  3NZ3 A;  4FJV B;  4M0W B;  1GUA B;  2ON8 A;  2VZK D;  4KIK B;  3VTW A;  4GDK B;  4C00 A;  1NEN B;  2XK5 B;  3QC8 B;  2IGH A;  1JRP A;  2DAF A;  3A9J B;  1ZW7 A;  4A8X C;  4XGA B;  1FM0 D;  1D4B A;  1QQR A;  2IBI B;  1RAX A;  5FK9 C;  2UU7 A;  3PRZ A;  1T0Y A;  1WRD B;  2KD0 A;  2WXQ A;  3P2B A;  3MFG A;  1QOF A;  3BYT B;  2EMT A;  3U2S C;  1SE4 A;  1V8C A;  1SJE D;  1WXV A;  3KVF B;  4KX6 B;  2FCM A;  2W82 A;  2MHJ A;  2AEH A;  3EUB 2;  2N9E B;  2L83 A;  1EO6 A;  1YIW A;  2ASQ A;  3NVW A;  4KV2 A;  1JWM D;  4MJS A;  2NBV B;  2X8X X;  4MM3 B;  2BYE A;  1WF9 A;  4HPM B;  3HIZ A;  1T0R C;  4LNK A;  1I4R A;  1E8W A;  2KX0 A;  1KM7 A;  2GI9 A;  2C7M B;  4HXD A;  2M56 B;  1TJE A;  4GSW A;  3PSE B;  3U4E G;  1P1A A;  3LB8 C;  3AED B;  1J7C A;  3A4S C;  2BTE A;  2KQS A;  1CQV A;  3HRD D;  1F9J A;  4BAX A;  2BWF A;  4G11 A;  3ZNZ B;  1B9R A;  1C78 A;  2OJR A;  2A5U A;  2X38 A;  2KOX A;  2LMC A;  1GB1 A;  3D32 A;  3UF8 A;  1CJE A;  2XN9 C;  2ZW1 A;  3AE3 B;  4YWG G;  3RUL A;  4A9A A;  1V49 A;  4CYE A;  2CHX A;  4W9K A;  2KT7 A;  4AJW A;  1K53 A;  3QAQ A;  1LO5 D;  3U30 A;  1FIQ A;  4GOC A;  1YJ1 A;  1E7P B;  1V97 A;  4RNA A;  2V4L A;  2J7Q B;  1FCL A;  1TBE A;  1F52 A;  5CHV C;  1HZ6 A;  4RF1 A;  1IGC A;  3VRB B;  1GG3 A;  4KZ0 A;  1UGJ A;  1WX7 A;  1P0R A;  2FUH B;  4J6I A;  1C4A A;  4C7Y A;  3SHQ A;  3R8B A;  1STE A;  2L0F A;  3PHW B;  4S17 A;  4XWT A;  1N6Z A;  4II3 B;  4KVG B;  2G9H D;  4ZHO A;  2WGS A;  3ZQ4 A;  1DOY A;  3DBH B;  3L13 A;  1MI0 A;  4BBN F;  1XXG A;  2GRI A;  3VXW A;  3GE3 C;  1L4Z B;  3GP7 A;  4JLC A;  3AE4 B;  4ZHP A;  1SE2 A;  2ZNV C;  3TMP B;  2KN4 A;  4BBN C;  1UGM A;  2MH7 A;  1T0Q C;  3WA0 A;  2RR9 A;  2G1E A;  4E71 A;  2AQ2 B;  3LJ3 A;  3S2A A;  1N63 A;  2HTM E;  5IOI A;  2M17 A;  3UQA A;  1WXQ A;  1FRD A;  2JZ3 B;  1QOB A;  2WXG A;  1SBB B;  1C4C A;  2BS4 B;  4I6N B;  4WH4 A;  3PT2 B;  2EKI A;  2Q5W D;  2N7E A;  1R4N I;  2MP2 A;  4YTN B;  4WWP A;  2K39 A;  4BKS A;  2DYB A;  2WXK A;  4WAF A;  3ZDT A;  2VH2 A;  1XD3 B;  2AYO B;  2XNA C;  1P98 A;  3R3M A;  1G6J A;  5IAA C;  4C56 C;  2DAJ A;  4IUM B;  1M4V A;  1XT9 B;  2JXX A;  4JIO U;  3TJP A;  1ET9 A;  4ANV A;  2KC2 A;  1L4D B;  1E9M A;  1NDD A;  2N9L A;  2JVC A;  4CO7 A;  1KH0 A;  3V6E B;  1UEL A;  1C79 A;  5FR3 A;  4WWM A;  3DQV A;  4AJY B;  4PT5 A;  4II2 B;  2BS2 B;  2C5L C;  3VUY A;  1C9F A;  3KYC D;  2K6Q A;  2KDB A;  3MTN B;  3APD A;  2K8H A;  5CX3 A;  3QA8 A;  1YN3 A;  2PLP A;  5JXV A;  4RFB A;  2YLM A;  2WDR B;  4IM3 A;  3VFK A;  1ZUD 2;  5C2T B;  3DVN U;  3LYY A;  1NYQ A;  2LWP A;  3H8H A;  2LRU A;  1IBX A;  2V0G A;  4XE0 A;  2ONQ A;  2INP E;  3N3K B;  3A1Q B;  2QC8 A;  1QIL A;  2D3A A;  4K7W A;  2DZK A;  1R4M I;  1UF0 A;  4EUT A;  4DDG D;  3QQ8 B;  2C7H A;  4ANW A;  1OFF A;  2HDE A;  5AEK B;  2WP9 B;  1HA5 A;  1I4Q A;  2O6V D;  2WXO A;  4ZRJ A;  2ZEQ A;  1NVI D;  4LDT B;  4DXG A;  4M00 A;  3ZRC A;  1SE3 A;  1I7H A;  1Z2M A;  4W9G A;  2ZPY A;  1OQY A;  2NS5 A;  1S1Q B;  3RNE C;  4GDL A;  1I4G A;  4GMV A;  4AOF A;  3ONS A;  3NVY A;  1GNU A;  1JWS D;  1C77 A;  2LVO A;  3AM9 A;  1KLG D;  3IVF A;  3MC8 A;  4MT5 A;  1WX9 A;  3TIX A;  2E3T A;  4BFR A;  3VRA B;  2MLB A;  3BZD B;  2KWV B;  4FJY A;  4E3C A;  1V1P A;  3ZDM C;  4ACF A;  2IJ0 A;  1E90 A;  3AE2 B;  4HRO A;  2J42 A;  2UYZ B;  4M8M A;  2LXC A;  3CSF A;  1WXM A;  4US9 A;  5FR6 A;  5IP4 D;  2KTR B;  5J18 A;  3LDZ E;  2LVP A;  1UD7 A;  1E10 A;  3UQB A;  1WGG A;  3IXS A;  4IOI E;  2FCS A;  4LDT D;  4YSY B;  2C9W B;  4MAC A;  1KFY B;  2GMI C;  3HVD A;  1YJJ A;  3K9O B;  4GXB A;  2W54 A;  2LD9 A;  4LK0 M;  3AN1 A;  4GN1 A;  3AEC B;  4AS1 A;  4IM0 A;  1R7S A;  4B95 A;  3UI3 A;  3MHS D;  2I1J A;  2SEB D;  4DBG A;  3AE5 B;  4BVU C;  2KJR A;  3J9C A;  1E8Y A;  3IAM 1;  3L10 B;  3PRE A;  4FUL A;  3VQI A;  1WE7 A;  3Q3M C;  4PYU A;  1ESF A;  5BMH A;  2GOW A;  3IT6 B;  5MPO A;  1JML A;  4KDL B;  3MJ5 A;  4L1B A;  3V60 A;  2LGI A;  5EE0 A;  1TTN A;  2BBC A;  4NAW B;  1GAQ B;  1TS4 A;  2Y3A A;  3AEB B;  3Q6B A;  4G50 A;  3Q3J A;  1V9J A;  1VZ7 A;  2CHZ A;  1XCQ L;  1JWB D;  3N9Y C;  4EOY A;  1E0Z A;  2QCZ A;  2KAN A;  2MBB B;  2N4F A;  5FKA C;  3L17 A;  1YMH E;  3NS1 A;  4P7I A;  3BY4 B;  3W9C B;  1NI3 A;  1ZPS A;  4KKI A;  1GC6 A;  2O2V B;  3A33 B;  5HG2 A;  3VAW A;  4OVU A;  1IYF A;  4AQ7 A;  3MP9 A;  3UIO B;  1WM2 A;  2H89 B;  2KFJ A;  4W9F A;  4N6E B;  5BYR A;  2BYV E;  4A55 A;  2AQ3 B;  2MBO A;  4B9K A;  4EZK A;  1WZ0 A;  2WU2 B;  2Z0E B;  4KKJ A;  1NBF C;  4GIV A;  2UWQ A;  2WHI A;  3BIN A;  4BZA A;  3QAR A;  1RFA A;  3FC4 A;  3ZNG C;  3PTF C;  1YN4 A;  2PVO D;  3Q2A C;  4C4V B;  5JH5 C;  1WY8 A;  1L5P A;  1UUP A;  1RRB A;  3MC9 A;  1DGJ A;  4IDI A;  1I42 A;  2KWC A;  2FID A;  2RPV A;  4RM9 A;  2KNB A;  4EZJ A;  3JSV A;  1TGZ B;  1LM8 B;  2V3N A;  5CTR C;  3VUX A;  4A3P A;  3IBE A;  5GMV A;  3WAP A;  3B2G A;  1FNV A;  2BW2 A;  4YTP B;  2BGF A;  2KO3 A;  3PLV A;  2LAS A;  1FPY A;  1OEY J;  1GPX A;  4IWO A;  1L2N A;  3AE1 B;  4W9I A;  4KSL C;  1EWY C;  4P6V F;  1RWS A;  2D2Q A;  1J7B A;  2N1W A;  3A4R A;  4HPL B;  1ZGU B;  4XZ4 A;  5D6J B;  3WAN A;  4HLE A;  3DWG C;  2IYD B;  1CZP A;  2XBB C;  4E74 A;  4X57 B;  3RN9 C;  3VH3 B;  2MBH A;  4O1N A;  4B0E A;  5IN7 A;  5BO4 B;  2NPT A;  1JRU A;  3M3J A;  3W5U B;  4M0W A;  3TUO A;  4GDK A;  1E8Z A;  2BYT A;  3FIL A;  4WJO A;  1TZO A;  3GZN B;  5G2N A;  2AL6 A;  1PDX A;  1K51 A;  2BQQ A;  4P1B C;  2DZM A;  4TQ1 A;  2M1M A;  2ICI A;  3N32 A;  3H7P B;  3WAO A;  3SDL C;  2BF8 B;  1ET6 A;  2L76 A;  3SD5 A;  2RDG A;  1MG4 A;  1XEE A;  2KKC A;  4WUR A;  4GB9 A;  3DWM A;  3I5J C;  2JWU A;  2WYQ A;  2KFK B;  2BS3 B;  2KWD A;  3ZTC A;  1WJU A;  2AWT A;  2JU6 X;  5H8Y E;  3RPF C;  2DNF A;  1T5X D;  1V5O A;  3URY A;  4WJN A;  3RMK C;  5J17 A;  2LHE A;  4NY0 A;  3U8Z A;  3ZXR A;  1HEZ E;  3I63 C;  3JVZ X;  3PZD A;  3B2F A;  3M95 A;  2FBW B;  3PS6 A;  4NJ7 A;  2K1F A;  5EE1 A;  5G5H A;  4OZA A;  3DOW A;  1RM6 C;  4J3O D;  3HM6 X;  2K0P A;  1ZXH A;  1KRH A;  2FUG 1;  4DXF A;  2L7R A;  2AL3 A;  2KDE B;  2K5P A;  4OW0 A;  5G5G A;  2G45 B;  3R2T A;  1J0G A;  4XX5 A;  1SXT A;  3RNF C;  2MEK A;  2A4Z A;  1EF1 A;  3C8Y A;  1R4M B;  3QK0 A;  4MDK E;  4PS3 A;  3VTV A;  3P4Q B;  4OHJ A;  2Y5B B;  4D2K A;  1SJH D;  5BYQ A;  5AUK A;  3OJ4 B;  2Z8L A;  2B3A A;  4HCN B;  1PGA A;  2G4D B;  2WS3 B;  5AZG A;  3AH7 A;  4XYC A;  2LUM A;  1D3Z A;  1WJN A;  1WXA A;  4MEL A;  4RF0 A;  1UBI A;  1XLO A;  1PYW D;  4B6W A;  4W9D A;  1T0S C;  4BKG A;  2INC C;  1TY0 A;  4DK5 A;  4XDC A;  1HTO A;  4YXD B;  3KH0 A;  2LHD A;  2JSV X;  1ENF A;  3EFU A;  3BVG A;  5KHO A;  2VRR B;  4YL8 A;  4MJS B;  3M63 B;  3OJ3 A;  3BVZ A;  3ENE A;  2PW9 A;  2BKR B;  1FEH A;  1XCT L;  2WXN A;  3P63 A;  4NPN A;  1EM7 A;  3AEG B;  3ETR A;  3P4S B;  3EFC A;  2OHF A;  4LNN A;  1TKE A;  3ZYY X;  3AEA B;  4HDQ A;  2CJO A;  4L2Y A;  3RNG C;  1L6V A;  3PPA A;  2QEJ C;  3NY5 A;  1BUI C;  2ZPN A;  2IO0 B;  3I57 A;  4R3D A;  1HTQ A;  1YQB A;  2D3C A;  1N60 A;  2CKH B;  3VHT C;  4KGS A;  1V1O A;  3Q3F A;  2TSS A;  3Q8F A;  3RCZ A;  4US8 A;  1J7A A;  1WGK A;  2RMM A;  1PQS A;  1HZ5 A;  1WMH A;  4JX1 C;  1IP9 A;  1T3Q A;  4MH0 E;  2DEN B;  1WSP A;  3Q8E A;  2NBW B;  2EEL A;  2PE6 B;  1MHH E;  3DBL B;  4K7S A;  3V3X A;  2YEP B;  3ZRF A;  3V6C B;  5DCN A;  4PS7 A;  2GBR A;  4AP4 C;  2MJD A;  3KUD B;  4A20 A;  2N7J A;  3R7Q A;  4OVZ A;  1HQR D;  5DPR A;  4JE3 B;  1D5M C;  1XO3 A;  1E5W A;  3PGE A;  3NRZ A;  4HDO A;  3TL5 A;  3N30 A;  1P7E A;  1TT5 B;  1HXY D;  2N9X A;  4BOS C;  1CK1 A;  2L0T A;  1IGD A;  4MSQ B;  1RFK A;  2KDM A;  3DBR I;  1Q1O A;  1YN5 A;  2R2Q A;  4HKZ E;  3ZVV A;  1NYR A;  4LTU A;  1TKY A;  4ICU A;  2LFI A;  4YTM B;  2WXJ A;  3ECI A;  2PPH A;  3NJT A;  3DBS A;  2O6V A;  3Q3N C;  1V80 A;  1FRR A;  4ZYS A;  2R61 A;  2RDB C;  4N9F 4;  4C80 A;  4F1S A;  4FA6 A;  3GB1 A;  3QJZ A;  2RGF A;  1A70 A;  2R2O A;  2JRI B;  2KVR A;  2K8C A;  1H4R A;  5LLI A;  4ITK A;  2L8J A;  4MEM A;  2DZJ A;  4CQN A;  2BWE S;  3T3O A;  1VZ8 A;  1FXT B;  1MPE A;  1IUE A;  2V9H A;  3N1Z C;  1TY2 A;  4FXC A;  1MVK A;  2KQ4 X;  3L08 A;  3SR6 A;  2MP2 B;  3GOE A;  1L7Y A;  5HFY A;  3BWU D;  1XLQ A;  3Q8A A;  3L16 A;  2EKE C;  1N5W A;  3TSS A;  3V62 A;  5L95 C;  2PMV A;  3U7D A;  2Y5P A;  3MHZ A;  2ZVN A;  3KUZ A;  1V5T A;  1WR6 E;  3P42 A;  3LXF A;  3UGB B;  2LGS A;  2QIL A;  1WM3 A;  3UIP B;  1TYG B;  3L54 A;  1WH3 A;  5CHF A;  4ARI A;  2KMC A;  2LVQ A;  1D5Z C;  1PGX A;  4IC7 B;  3TEZ A;  1E7V A;  1PFD A;  2Y5C A;  3AEF B;  3X0W A;  4HEA 1;  3R7R A;  4I6P A;  3AE6 B;  3NG0 A;  1MHX A;  4RGT A;  3GE8 C;  4KSK C;  4JPS A;  1QT9 A;  3NZU A;  2KTR A;  5C23 A;  1P7F A;  4HJG E;  2JYT A;  2W3S A;  3Q3O C;  1YD8 U;  4HK2 A;  2ZCB A;  1L6U A;  2IGG A;  4WWN A;  2D3G A;  1IBX B;  1D6E C;  1VJK A;  2KK8 A;  2M0A A;  5LXH A;  2GBM A;  2NMQ A;  5EDS A;  3QIJ A;  1T6B X;  1PGB A;  4MH8 A;  2KTF A;  1KJT A;  2B76 B;  3AE7 B;  4OZC A;  4IWP A;  4WAA A;  1K8R B;  3SEB A;  4USA A;  2WXR A;  2MBQ A;  4QAY A;  3PRM B;  2AX5 A;  1A5R A;  1KOT A;  4FN2 A;  3ZXV A;  1JRO A;  4DHJ B;  2WNM A;  3K9P B;  3I9V 1;  3EHV A;  1SSN A;  1QKZ A;  4FAD A;  2V3S A;  4GDL B;  3PRP B;  3E56 A;  1GC7 A;  2K25 A;  1M94 A;  5C3J B;  4TQ0 A;  4ZRP A;  1WYW B;  3H7S A;  4TKN A;  2MX2 A;  1EF5 A;  4HCP B;  3APF A;  4H2A A;  3NS8 A; 
#chains in the Genus database with same CATH homology
 2N1W A;  3A4R A;  3B0A A;  2KOX A;  3AUL A;  2MWS B;  4HPL B;  3A1Q A;  3D32 A;  1ZGU B;  4XZ4 A;  3DVG Y;  4IWQ A;  2HTH A;  5D6J B;  3UF8 A;  3WAN A;  4HLE A;  5E6P A;  2FIF A;  4A3O A;  4WJP A;  2IYD B;  2LGD A;  2XBB C;  4E74 A;  3RUL A;  5TR5 A;  2PEA A;  5G55 A;  4X57 B;  3VH4 B;  2QHO A;  3H6N A;  1C3T A;  2DHZ A;  3ZTD A;  4BOZ B;  1V49 A;  3VH3 B;  2MBH A;  4CYE A;  2NR2 A;  4HWI B;  3AU4 A;  2J0K A;  5BO4 B;  2CHX A;  3AU5 A;  2NPT A;  1JRU A;  3M3J A;  3B08 A;  4BKT A;  2KDI A;  4OVV A;  4W9K A;  1QZE A;  4AJW A;  3CST A;  3QAQ A;  3U30 A;  4DHJ D;  5HKH A;  3H1U A;  4GDK A;  1E8Z A;  2O6V B;  4GOC A;  1YJ1 A;  5KHQ A;  3IFW B;  3T8M A;  2V4L A;  2J7Q B;  4WJO A;  4IG7 B;  1TBE A;  4FBJ B;  5CHV C;  5G2N A;  1U4A A;  1VD2 A;  1V81 A;  2AL6 A;  2Z59 B;  3NHE B;  4ZRK A;  2NBU A;  4NQK E;  1E8X A;  2DZM A;  4TQ1 A;  2M1M A;  1GG3 A;  4W9J A;  1WR1 A;  3N32 A;  4KZ0 A;  2MCN B;  3H7P B;  3WAO A;  5D2M B;  1WX7 A;  1P0R A;  2FUH B;  2L3Z A;  4J6I A;  3SDL C;  3DCG A;  2Z0D B;  2BF8 B;  2L76 A;  3W1S A;  3SD5 A;  3SHQ A;  4URK A;  2KKC A;  2K6D B;  4HVB A;  4GB9 A;  4DWF A;  2WYQ A;  3TCA A;  2KFK B;  1ZKH A;  2OOB B;  2L0F A;  3PHW B;  3ZTC A;  1WJU A;  2ZZP B;  2AWT A;  4II3 B;  2LJ5 A;  4KVG B;  4BKS D;  2IO3 B;  4HJK A;  2KX3 A;  1V5O A;  4WJN A;  5J17 A;  1LXD A;  4ICV A;  4NY0 A;  3U8Z A;  2FAZ A;  1H8C A;  4FLH A;  3L13 A;  3JW0 X;  3JVZ X;  2G4S A;  3PZD A;  3HM3 A;  2BKF A;  2C60 A;  5DPT A;  4BBN F;  3WIM A;  3M95 A;  1WGH A;  3PS6 A;  3VXW A;  4NJ7 A;  2K1F A;  4JLC A;  3OLM D;  2KQ7 A;  2IO2 B;  2MW5 A;  3DDC B;  3WAM A;  2ZNV C;  1P9D U;  3ZW3 A;  5L83 A;  3DOW A;  3TMP B;  2J0M A;  4BBN C;  4WJQ A;  1UGM A;  3HM6 X;  3PLU A;  2JY6 A;  1SGH A;  3WA0 A;  1KLV A;  2RR9 A;  2FCN A;  4E71 A;  3CMM B;  2L7R A;  3LJ3 A;  3V61 A;  3S2A A;  2AL3 A;  2LRW A;  2KDE B;  1ISN A;  2M17 A;  3UQA A;  5J2R A;  2G45 B;  1J0G A;  4XX5 A;  2JPH A;  2GBJ A;  3H9D A;  2JZ3 B;  3R66 C;  2A4Z A;  1WJ4 A;  1EF1 A;  4AUQ C;  3I3T B;  2PE9 A;  4W9L A;  5DPS A;  2J0J A;  3QK0 A;  4MDK E;  4M8N A;  3ZNI D;  4I6N B;  4PS3 A;  3VTV A;  3PT2 B;  3DVG X;  1UZX B;  2CS4 A;  2Y5B B;  4NAW A;  2N7E A;  1R4N I;  2MP2 A;  4KDI C;  2CHW A;  4ANU A;  4WWP A;  1V86 A;  3QWZ B;  2K39 A;  4BKS A;  2DYB A;  3APC A;  3RZW C;  2FCQ A;  3OJ4 B;  2B3A A;  4G0N B;  4HCN B;  1V6E A;  2DZI A;  3ZDT A;  1WI0 A;  2G4D B;  5AZG A;  1XD3 B;  2AYO B;  4DXA B;  1D3Z A;  4W9H A;  4ANX A;  1WJN A;  1X1M A;  1P98 A;  3R3M A;  2MA9 B;  1G6J A;  2BPS A;  5IAA C;  1WXA A;  2DAJ A;  4IUM B;  4MEL A;  1UBI A;  2N7D A;  3HHM A;  4MGI E;  1YX5 B;  2JZZ A;  1XT9 B;  2JXX A;  4JIO U;  4W9D A;  4B6W A;  1LFD A;  3TJP A;  5JZE B;  4ANV A;  3PV1 A;  1RLF A;  2KC2 A;  2D10 A;  3O65 B;  4BKG A;  2WWZ A;  1NDD A;  2IO1 B;  2RD0 A;  4IM2 A;  2O2V A;  2JVC A;  4DK5 A;  4CO7 A;  3A9K B;  3V6E B;  1WE6 A;  1CMX B;  1UEL A;  4FJZ A;  3KH0 A;  4LJP B;  3NOB A;  4EEW A;  2KZR A;  3IG3 A;  2W9N A;  3DQV A;  4AJY B;  2ZJD A;  3AXC A;  4DHZ E;  2N9P C;  4II2 B;  5AZF A;  2C5L C;  3JSV B;  3VUY A;  3EFU A;  3KYC D;  5KHO A;  2K6Q A;  2C7N B;  2VRR B;  2KDB A;  1J8C A;  2YVC A;  1AAR A;  3MTN B;  1OGW A;  1C1Y B;  3M63 B;  3APD A;  3OJ3 A;  4KIK A;  4MJS B;  2K8H A;  3ENE A;  4YL8 A;  2ZVO A;  1UBQ A;  4K81 A;  2BKR B;  2KC1 A;  5CX3 A;  1VCB A;  3ZNH B;  3VDZ A;  4NPN A;  3DBH I;  2FNJ B;  3JYU A;  2XK5 A;  3QA8 A;  2WX0 A;  4XC2 A;  1P3Q U;  2KXJ A;  3KW5 B;  3A9J A;  3HK0 A;  2DYO A;  1OEY A;  4JGH B;  1UH6 A;  2YLM A;  2PJH A;  3DBL I;  4IM3 A;  3TBL D;  4AWJ A;  3VFK A;  4EFO A;  2JT4 B;  1OTR B;  4K1R B;  3ZLZ A;  3DVN U;  4DHZ B;  2LWP A;  4HDQ A;  2I1K A;  1WJ6 A;  2LRU A;  3PPA A;  2K8B A;  3X23 A;  3NY5 A;  2LGY A;  3VTU A;  3RD2 A;  2BYF A;  4TUU A;  2ZPN A;  2IO0 B;  1YQB A;  2CKH B;  3N3K B;  4I6L B;  3VHT C;  3IHP C;  3A1Q B;  3Q3F A;  2HJ8 A;  1WGR A;  4TV3 A;  4EKU A;  3RCZ A;  1XQQ A;  4K7W A;  5LXI B;  4JQW C;  4ZDV A;  2DZK A;  2WX1 A;  3CF6 E;  1R4M I;  3M62 B;  1PQS A;  4EUT A;  4DDG D;  1WMH A;  3QQ8 B;  2KJ6 A;  2C7H A;  3ZUN A;  4ANW A;  2NPT B;  2N1V A;  4RM8 A;  4MH0 E;  1IP9 A;  4GGQ A;  5AEK B;  4PYZ A;  2DEN B;  2NBW B;  2O6V D;  4ZRJ A;  2MQJ A;  2PE6 B;  2ZEQ A;  2KMA A;  3EC8 A;  4G3X B;  4LDT B;  2JWZ A;  2NVU I;  4K7S A;  3ZRC A;  4MM3 A;  3ZRF A;  5D7G A;  3V6C B;  1Z2M A;  2LI5 A;  4W9G A;  2ZPY A;  2NCN A;  5DCN A;  4PS7 A;  1OQY A;  1WZ3 A;  2NS5 A;  1S1Q B;  3VVW B;  2GBR A;  4AP4 C;  3KUD B;  4GDL A;  4A20 A;  4GMV A;  3QCA A;  3AI5 A;  4AOF A;  2IY0 B;  3L0W B;  3ONS A;  2ZNV B;  1GNU A;  3R7Q A;  1EUV B;  3QHT A;  3W1S C;  4F7Z A;  4MGY E;  2KLC A;  2LVO A;  3VUW A;  5D94 A;  5DPR A;  3IVF A;  1E5W A;  1WX9 A;  3PGE A;  4HDO A;  3TIX A;  3ZIM A;  1SIF A;  3TL5 A;  4BFR A;  4IW0 A;  2MLB A;  2CR5 A;  3N30 A;  2KWV B;  4FJY A;  1GJZ A;  4EZL A;  2KLG A;  2L00 B;  4E3C A;  3ZDM C;  2N9X A;  1WFY A;  4NJ6 A;  4BOS C;  2D07 B;  2L0T A;  1E90 A;  4MSQ B;  2UYZ B;  1J19 A;  3A9K A;  2KN5 A;  3DBR I;  2LXC A;  4M8M A;  1V2Y A;  1Q1O A;  3CSF A;  1WXM A;  5FR6 A;  2R2Q A;  4ZYN A;  5JHA A;  2KTR B;  3EEC A;  5J18 A;  3LDZ E;  3ZVV A;  2LVP A;  1UD7 A;  1WIA A;  4W9C A;  3RZF A;  1WGG A;  4ICU A;  3UQB A;  2FCS A;  4LDT D;  2C9W B;  1Z5S B;  2M4N A;  3ECI A;  2GMI C;  2PPH A;  3WAL A;  3DBS A;  2O6V A;  1V80 A;  1Q5W B;  1WGD A;  4ZRI A;  3K9O B;  3RYT A;  2LGX A;  4GXB A;  3ALB A;  2LD9 A;  4N9F 4;  4F1S A;  4FA6 A;  4GN1 A;  4MGZ E;  3QJZ A;  2RGF A;  2HD5 B;  4IM0 A;  5AZH A;  1HE8 A;  2R2O A;  2JRI B;  2KVR A;  4B95 A;  2KHW B;  2K8C A;  5CHW A;  3MHS D;  2I1J A;  4DBG A;  4NNJ B;  1H4R A;  1BT0 A;  1WX8 A;  5LLI A;  3KUC B;  4BVU C;  2KJR A;  4FUL A;  1E8Y A;  5IA7 A;  3L10 B;  3ML9 A;  3PRE A;  4K7U A;  3VQI A;  2L8J A;  3H7P A;  4MEM A;  1WE7 A;  4FHJ A;  2DZJ A;  1Q0W B;  4PYU A;  3SU8 X;  2MRP A;  2V1Y A;  2BWE S;  2DYM A;  3OAW A;  1SE9 A;  4DDI D;  1FXT B;  2GOW A;  3ZKJ C;  4GU2 A;  3B1L X;  4KDL B;  3PVL A;  4ASW C;  3L08 A;  3V60 A;  2KFK A;  3KYD D;  1TTN A;  4NAW B;  3RUI B;  2MP2 B;  2ZCC A;  3GOE A;  1L7Y A;  2LZ6 A;  3UIN B;  1YX6 B;  3L16 A;  2EKE C;  1E7U A;  1LQB A;  3QX1 A;  3V62 A;  1MG8 A;  5E6N A;  5L95 C;  3W1Y A;  4FHK A;  4G50 A;  3U7D A;  3Q3J A;  3DPD A;  1V9J A;  4RMA A;  2CHZ A;  2HE7 A;  4CHK A;  4EOY A;  2KAN A;  2MBB B;  4WQO B;  2ZVN A;  2N4F A;  2D11 A;  3KUZ A;  1V5T A;  1WR6 E;  2KDF B;  3L17 A;  3UGB B;  4P7I A;  2JRH A;  3BY4 B;  1WM3 A;  2M8S A;  3RT3 B;  1GC6 A;  2O2V B;  3A33 B;  3UIP B;  2GBK A;  4WWO A;  2JUO A;  3ZO5 B;  4MSM B;  3L54 A;  2LUE A;  2LXA A;  2DX5 B;  4MGK E;  3VAW A;  1WH3 A;  3PHX B;  4OVU A;  2KJH B;  5CHF A;  3T9L A;  1IYF A;  1NI2 A;  2KMC A;  2LVQ A;  2XEW A;  3UIO B;  1WM2 A;  2KFJ A;  4W9F A;  2MSE D;  4FJV B;  2BYV E;  4M0W B;  3C0R B;  1GUA B;  4IC7 B;  3VTW A;  1E7V A;  4KIK B;  4GDK B;  2L05 A;  2MBO A;  2XK5 B;  3QC8 B;  3X0W A;  4B9K A;  4EZK A;  1WZ0 A;  2Z0E B;  2DAF A;  3A9J B;  1ZW7 A;  3R7R A;  4I6P A;  1NBF C;  4KSK C;  4GIV A;  2UWQ A;  4NQL B;  2JF5 A;  3BIN A;  3NZU A;  2KTR A;  4JL9 A;  5C23 A;  2IBI B;  1RAX A;  3PRZ A;  1YD8 U;  3QAR A;  4HK2 A;  1RFA A;  2ZCB A;  4LCD E;  3ZNG C;  3PTF C;  1T0Y A;  4WWN A;  2D3G A;  1WRD B;  2KD0 A;  5E6O A;  2REX A;  3P2B A;  5JH5 C;  2KK8 A;  5LXH A;  2GBM A;  1WY8 A;  5EDS A;  3QIJ A;  2EMT A;  1RRB A;  2KTF A;  3ML8 A;  1KJT A;  2GBN A;  1I42 A;  2EMS A;  2IZV B;  2KWC A;  5C1Z A;  2FID A;  1WXV A;  3KVF B;  2WDT B;  2FCM A;  2KWU B;  1WMH B;  4RM9 A;  5JHB A;  2AEH A;  2KNB A;  1Y8R C;  2N9E B;  3NZS A;  1S3S G;  4IWP A;  4WAA A;  4EZJ A;  1K8R B;  3JSV A;  1TGZ B;  1LM8 B;  4F8C B;  1EO6 A;  1YIW A;  5CTR C;  2MBQ A;  4PS8 A;  3VUX A;  3PRM B;  2ASQ A;  1IPG A;  4A3P A;  1A5R A;  4KV2 A;  3IBE A;  1KOT A;  4FN2 A;  4MJS A;  2CU1 A;  2RSU A;  2NBV B;  5GMV A;  3WAP A;  4DHJ B;  2BYE A;  1WF9 A;  3HIZ A;  3K9P B;  4HPM B;  3EHV A;  1E8W A;  1WGY A;  1KM7 A;  2KX0 A;  2C7M B;  4HXD A;  2BGF A;  2KO3 A;  2V3S A;  4GDL B;  1WXS A;  2MBE A;  3PLV A;  4FAD A;  2LAS A;  3PRP B;  4LJO B;  5DPW A;  4GSW A;  1GC7 A;  1OEY J;  2K25 A;  2M0X A;  3DVN V;  3PSE B;  1M94 A;  4IWO A;  1P1A A;  3GZN I;  1TZ1 A;  2G3Q B;  1L2N A;  4W9I A;  4TQ0 A;  3A4S C;  2KQS A;  1WYW B;  3H7S A;  1F9J A;  4W9E A;  1I35 A;  2BWF A;  4TKN A;  2RPQ A;  2IY1 B;  4KSL C;  2MX2 A;  4G11 A;  3ZNZ B;  1EF5 A;  4HCP B;  3MJW A;  3APF A;  2D2Q A;  4KZC A;  3NS8 A;  2OJR A;  2A5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...