4A9AA

Structure of rbg1 in complex with tma46 dfrp domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
368
structure length
356
Chain Sequence
STTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRRELLTSGAGIGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIIDGGRGKQVIAVARTCNLLFIILDVNKPLHHKQIIEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEASSRRYMPAIYVLNKIDSLSIEELELLYRIPNAVPISSGQDWNLDELLQVMWDRLNLVRIYTKPKGQIPDFTDPVVLRSDRCSVKDFCNQIHKSLVDDFRNALVYGSSVKHQPQYVGLSHILEDEDVVTILKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME-INTERACTING GTPASE 1
publication title Rbg1-Tma46 Dimer Structure Reveals New Functional Domains and Their Role in Polysome Recruitment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 116
structure length 356
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF02824 TGS TGS domain
A PF16897 MMR_HSR1_Xtn C-terminal region of MMR_HSR1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a9aA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a9aA02
1OFFA 2X8AA 4DLWA 1TTTA 4Z51A 1H8ED 2P6UA 3KXIA 3BB4A 4FIDA 4QL3A 3I5XA 2P6RA 2VPPA 4GBMA 2PT5A 3B1XA 4OQLA 4O0MA 1E2PA 2WSSD 2W83A 3LDAA 3UANA 5FTLA 4LRWA 2QPOA 3DZDA 4B71A 1Q22A 2J5XA 3HPRA 5HCNA 3RRZA 1S4QA 2QROA 1G5PA 2QTFA 3EW9A 4RCZA 2WIBA 4TYPA 3AM1A 4LWZA 1DBSA 1E6CA 4LJAA 1UKYA 2OHFA 4P4UA 3E5HA 1TMKA 5DYIA 2PT7A 1CTQA 4F4IA 3C4JA 2G88A 2B92A 1P7CA 5GJVC 4X8MA 1XFAA 4ESVA 3AGPA 4Q4AB 4B76A 3TKLA 1LF5A 1E3MA 4NCHA 2ZRKA 1VIAA 2RB4A 2B7BA 1CIPA 1GOTA 1F48A 2A2ZA 2W2VA 3K0AB 3LD9A 4B6EA 5FOWA 1G7TA 2YOFA 4N3NA 1Z0KA 1E0JA 1NJGA 3VRAB 4MUAA 2NO6A 3FYHA 3SDZA 3KKPA 3AGQA 3IEUA 5GVRA 3WNCA 1BYIA 1OLOA 2QT0A 3U7FB 3AE8B 2GETA 2BEJA 3FB4A 4EPVA 2MH7A 1KO4A 1IOZA 1RVDA 3R7WA 2ZI9A 1VKJA 3E1SA 4A15A 1JALA 1S0UA 4V02A 2FSIA 1ELOA 1II8A 2YWHA 3U3MA 2FWRA 1DE0A 2XJ9A 5EP4A 4LBYA 4C0BA 2REBA 4C9BA 2X2EA 1JQLB 4KX6B 4R7ZA 5H1YA 5EJEA 1GRNA 4PO8A 5AWFC 2KBEA 1SVKA 2OCBA 4IDHA 3QQ5A 2HJGA 4XD7A 3AVVA 5FPYA 5AJWA 4PC7A 3SNHA 3IO5A 3CPEA 3KUDA 1Z6GA 2AKAB 3KJEA 1WP9A 2PZFA 4GP6A 5L3SB 2VP9A 4NYIQ 2N1BA 3IKJA 3EG5A 4YDHB 2D06A 3DPUA 5AUQA 3S1AA 2OEPA 4IOJA 2J41A 4FMCB 2V1UA 3BBPA 3LQRA 2J59A 2QRNA 3CRRA 1MO5A 2ZYWX 3DOFA 4URUR 3ABVB 1AQUA 4Q02A 3LO5A 2E87A 1EFCA 1SZPA 5TV2A 1WWTA 2PZEA 4GL2A 1XXHE 2BCGY 3MWYW 1T91A 2B8TA 4F38A 2C2HA 1SVOA 1KI7A 3I61A 2FZ4A 4Z1MA 1KO1A 2WVJA 1J7AA 4F93B 4LTUA 2ZRHA 3NDPA 4NU0A 4Q18A 4Q9LA 3WNDA 5HKKA 5CB8A 2HYDA 3DM9B 3RVBA 2QIEB 1JQ4A 3W6PA 2BMEA 4PXAA 1WYGA 1OXXK 2JAQA 1P2SA 1D2MA 3AEBB 1CBUA 5C1BA 1UAAA 3T1TA 2BIFA 2WPDA 4L9SA 4Q4JA 3FWYA 2RKOA 1Q1ZA 4DZZA 4QHTA 1DADA 1Z29A 2UZ3A 4D80A 5DN6D 3AM9A 3B85A 3AE3B 2ZI6A 3QF4B 4TL6A 4O2RA 2GJ8A 1UEIA 3RSLA 4LBVA 3MWLA 521PA 1IAQA 2K5UA 5ANRB 5DIFA 1OHHA 1U8ZA 1YKSA 4PX9A 2AFHE 2G77B 3B8HA 3VR9B 2AKYA 1M6NA 2IF2A 3B1YA 1NBMD 3EXAA 1N3BA 3RRYA 4UNRA 1OH5A 4G5QA 5G5GA 4MKFA 1J7BA 2WIAA 1G4UR 1PUTA 3IDQA 1G4AE 1DARA 1QOAA 2QP3A 3CZPA 3SC3A 4FXPA 1V97A 2KBFA 4TSFD 3C8UA 5BQ5A 2F3TA 5FTKA 2KE5A 4DIDA 2PKOA 1CR2A 2BHRA 2R2AA 4QBHA 5JS8A 1G3RA 1MV5A 4YT0B 1G3IA 2GZHA 3UG6A 4KODA 1DGJA 3B9JA 4JBYA 2XX3A 3I4LA 1OH6A 3B82A 1FMLA 4O3MA 1JB1A 4W5WA 1BOFA 2VA8A 5HR5A 1MR3F 3AUYA 1N6RA 4P4SB 3TLXA 3WHKA 3GLHB 1Q1BA 4M9XA 3KTAA 2IUSA 3SE0A 4EDHA 4TLBA 2C77A 3X1XA 4UKDA 1NI3A 5JMTA 4DB2A 5KDLA 1Y3AA 4OHXA 4LV8B 2KB0A 2XOKA 3SJAA 1NBME 1QG4A 1H65A 2HXYA 4E03A 3ZGXA 4CDGA 3EIEA 4O2LA 3T5DA 3BOSA 3A1VA 4KVAA 2OAQ1 2Z4RA 3KB1A 4X8LA 5HCIA 3ZZUA 4G1UC 1Y63A 3OEEA 1P62B 4LC1A 5CDFE 3TVTA 3NRZA 5F2EA 3FOZA 4LHVA 2FN4A 3NXSA 2XZPA 4HAZA 4AKEA 3WHLA 1RRGA 2D74A 4LHZA 4YLGA 121PA 3L43A 1FIQA 1G3UA 1E94E 1GTVA 1ZUNB 2R9VA 4JLVA 5CLLA 1UBEA 2WJJA 1E2MA 1N6NA 2B7CA 1TAGA 3M6AA 4YMTA 1E0ZA 1TQ4A 1N60A 1OIWA 3K09A 4C0KA 3FHOA 2RGEA 1NMYA 5L3SA 5C4MA 3CB4A 1C4OA 4C2UA 4US1R 4D4KA 1E1RD 1W4RA 1ZNWA 3B5JA 3NEJA 1QHGA 3X1ZA 1GZSA 4W5JA 4NCNA 4P32A 5LPNA 3GEIA 2OFOA 4DDUA 4JWUC 4BFUA 3FDIA 4GP7A 4QXAA 1FNNA 5AK0A 1B23P 5JSZB 3GD7A 2GXUA 3BORA 4PPQA 4AKIA 4JLOA 5EP1A 5KPJA 2FF7A 4I99A 1E10A 3VR3A 3TR0A 3DWGC 1XCPA 3IPXA 2JLWA 4NHOA 2AWNA 1VYUA 4BFXA 4OI1A 2JATA 5CJ2A 4I4LA 3W6OA 2JJ1D 5JLJA 4TTQA 1XLOA 4QHSA 2NMVA 4ZDJA 4A2PA 2VP2A 1GRQA 1DVRA 3A1UA 1RE0A 3RRNA 2XXAA 1S9DA 2CNWA 4NCJA 4PZYA 1VYTA 2CHQA 3LBNA 2ECKA 4YONB 1NNEA 1YZGA 2O0KA 2I3BA 2ZRDA 3QF4A 2EFHB 1GM5A 1OJLA 2JGNA 2SHKA 2ZAOA 3K70C 1T8TA 3LXFA 3AECB 2AFIE 1N5IA 5E95A 3B9PA 4IOKA 3EZ2A 4TLDA 2OILA 4LPKA 1NSFA 5EE1A 1G8HA 1ZXIA 2OESA 1AS0A 3VFDA 4Z1MD 4PC3A 4PO1A 4PZLA 4LJYA 3GFTA 3NHAA 1R5OA 2QM7A 4RD2A 1JI0A 3AE2B 1VCNA 1GNPA 3L0OA 4UNNA 3CO5A 4F4JA 2CK3A 2AX5A 4IW3B 1HTWA 2NGRA 2WPDD 4OHVA 2PMKA 4E09A 3OAAA 1XEFA 4Z8YA 4FXCA 1IONA 1KTVA 5LB4A 1I4LD 3I8SA 5JEDA 2ZM5A 2JJ2A 4OKSA 2C78A 5FTMA 3QOFA 1XF9A 1ZCAA 3PXGA 4EPWA 1OKKA 2WBLC 3VR6A 3PEVA 1CRQA 1CLUA 1H8HA 5TB5A 2WDRB 3IBYA 3O8BA 3WCQA 2D7DA 1GITA 4C7ZA 1JWBD 4LYFA 4P4SA 4UXIA 2PJZA 3FPAA 3GLHA 3LW8A 4QGGA 2GXAA 3AB5A 4HAUA 1M1YE 3MJHA 1XLPA 4WOPA 1W0JD 1N62A 1PFDA 2R6FA 4JMPA 3I72A 3IEVA 1QOFA 1Z0JA 2W6ID 1RRFA 5AJZA 2WTUA 4TYWA 1G8GA 4A8JC 3L2OB 4PQFA 4G3XA 2QU8A 1X1SA 4TTRA 4TT3D 5D3QA 4EJSB 4QG7A 3HUIA 2YWGA 1R2QA 3UMFA 4TYNA 2FFHA 1OXUA 1EX6A 1KJYA 1SULA 4UQOA 5E7JA 4GMXA 5SZHB 5FL7D 3BGWA 1SVIA 3I32A 1P9WA 3OEHA 4UXHA 1TF7A 1GAQB 1DOAA 2ZUDA 5DISB 1P61B 2REOA 1K5GA 1KK2A 1XD8A 2BMFA 1AJEA 2G1JA 3A8TA 1N6OA 5BWMA 5DHFA 2BJWA 5FBLB 2HJVA 1IY2A 1R0XA 3MWJA 4IOMA 3UXMA 1E99A 3Q3JB 4Y0AA 4DLXA 1QT9A 4RD4A 2HUPA 3DVLA 3SQWA 3TSOA 5JJKA 4A4DA 4ITRC 1UEJA 1JXMA 2EFGA 1PJRA 2J7PA 3GJ5A 4NYJR 4DIEA 2IF0A 4B47A 3DKPA 4ERNA 2P6NA 3ZS9A 1UPTA 1D9XA 4A9AA 1OFHA 4MKHA 4BWYA 5FBWB 4WXRA 2CHVA 4ZHOA 1F6BA 2BEKA 2ZEJA 3AVQA 3SFEB 3AP1A 4N0EA 4TTPA 2IK8A 4AYTA 5TMPA 1XTRA 1I4TD 1CJKC 4IEEA 1E2JA 1NVXQ 1XXHB 1MRSA 5F98A 5DNYB 3MLEA 4HB4A 1UBFA 2IWHA 1W0KA 3N70A 3EC2A 1PVOA 1U98A 2F9LA 4Q21A 3NBFA 4BQSA 1Z0FA 1WRIA 3B7GA 2XEXA 2HT6A 1ODFA 2C03A 2ZS8A 4NCKA 5GADl 1FO4A 1QG2A 4NMMA 4Q48A 1P3JA 2JDID 2I4IA 3CF6R 4P33A 3FE2A 2A5FA 3U44B 1E2EA 1IY1A 5FBQB 5TVKA 2OM2A 2PX0A 2AD1A 1FMAD 3AN1A 1ZC4A 2XSZD 3HR7A 4K46A 2ZSAA 1IHUA 2PEYA 3PUVA 2PVGC 2Q6TA 4IJMA 5FOXA 1NL3A 2YV5A 2J0UB 4D0LB 2R6GA 1N6PA 1Z47A 1TU3A 4XTCS 1UBGA 4DJTA 2ODWA 1NENB 1R0YA 1M7GA 1W2HA 2ZU0C 5EE0A 3UG7A 1CJUC 4IVRA 4EIWA 5J40A 2KSQA 2GZAA 3OIWA 3PV0A 2Q0HA 3AP3A 3HP1A 4RZ3A 2CNWD 2OBMA 2ZRFA 5G53C 1LS6A 2WWXA 1QVAA 2HCBA 1GSIA 3CWQA 2CCGA 2QAGB 3VR2A 1PDXA 3QKRA 3AVWA 3NTUA 2QAJA 1AS3A 3AKCA 4EFNA 4YXWD 3ZD6A 1DG3A 1ONBA 4AKGA 2CXXA 1P6XA 5LD2C 1KK3A 1N5JA 2QPAA 4B73A 1YZUA 5GVSA 1RYHA 3AE9B 1JR3E 2ANCA 2ZYTX 2QQEA 5L8VA 4KBGA 1FQKA 4P0TA 3RS4A 3OIYA 4HB0A 1W4CA 4ZV4A 3KXKA 4FW9A 5L3VA 4FI3C 4URZR 3VKHA 3D31A 1ZW6A 1D6JA 1LV7A 4TZ6A 4B2PA 1ZU4A 2IA5A 2JA1A 1OB2A 1IN7A 4ZCMA 3U4QA 2DB3A 1OXVA 3K1JA 2X77A 4JSYA 3I5YA 1W2GA 2YOHA 2WU2B 3GLGE 5GXGB 3BC1A 5J4YA 3QXJA 2V6JA 5CK4A 2PX3A 4LHXA 4XJXA 3ZQJA 1XEWY 4MITA 1AN0A 3THWB 2CL0X 1IQPA 5L3RA 1OKKD 5EUMA 3CX7A 3NVWA 1KI8A 1XMSA 4OJQA 4YXDB 1P2VA 2FZLA 2H57A 2WSSA 4MYHA 621PA 3PUXA 4C0LA 3QY0A 1XJCA 1NF3A 2DFKB 4PSKA 3FMFA 4JBWA 2J7KA 5KDDA 1TUIA 4NZYA 1T0HB 1SXJC 4IVPA 2ATVA 1FTNA 1ZJ6A 4Q7MB 3JZMA 2HEIA 1DEKA 4IKEA 1NN5A 1CR4A 2ZRCA 5CM8B 1G3MA 1O3YA 2ZIAA 1UF9A 2ZYVX 2A9KA 3TRFA 4I81A 4LHYA 4MKGA 3FAHA 2BOVA 2QI9C 2VSXA 2OO7A 2VBCA 1DAMA 2WMNB 5EXPA 4AI6A 4F7WA 5A0FA 2AWOA 4KO8A 3ADDA 1KJWA 4URXR 2QQ0A 5CK5A 3NHBA 2IYTA 1W48A 4JVSB 2G9NA 1NY5A 1M7HA 1DO2A 1QHHA 1XXHA 4QJ5A 3CBQA 2WU5B 4U5XA 1G6HA 3W8RA 1TQDA 1ZNXA 3P1JA 3CZQA 4ZKEA 2Q5WD 2CJOA 1A7JA 2QBYA 2PMDA 5LDDC 1QHYA 2J0QA 1CU1A 3EIQA 5JS7A 2CLCX 3OHMA 3MJRA 1VDVA 1QHSA 4QGAA 2OXCA 1R5BA 5HZHA 4LYAA 1KKLA 2ZSFA 3RANA 5K8TA 4WW0A 1XMJA 3A58B 1IN5A 1T4GA 3Q5EA 4ILEA 3CM0A 2JCSA 2VYFA 3QKTA 4G0NA 2IYRA 2OT3B 1GAJA 1NRJB 2EWVA 5EUQB 1QZXA 3I3SR 3MWKA 3U5ZB 2ZJZA 5BXQC 1GILA 2L83A 3THYA 3W5VB 3V00A 1MO4A 1XNJA 5EE9A 2NO7A 3SHFA 2G6BA 4U02A 1JQJC 5KU1A 1TU4A 3DMNA 2PJRA 2PCLA 1FOEB 1K5DA 3JZAA 4DC9A 4URWR 4ZKDA 3AP2A 4HSEA 1L6UA 1J7CA 2IYVA 3TH5A 3TMKA 1X86B 2RMKA 3LXXA 3TR5A 4WAUA 2P2LA 4ITKA 1WA5A 3GJXC 3ZH9B 3G82C 1F0ZA 5L3QB 3TAHA 5BN5A 4QNRA 4PTLA 3B13B 3GJ6A 4G5OA 3VR8B 3QUSA 2Q21A 2Q3HA 3AF3A 4GMDA 2WICA 3W3ZB 1DAHA 2BV3A 4NE2A 5FPHA 2ERXA 3CRW1 1OE0A 5C2JB 4BLSA 3LRPA 4I1OA 1E2DA 4WZ6A 1XO3A 4CZ2A 5JZVA 2NIPA 2FE4A 1RKBA 2BS2B 2J87A 3NH6A 5DN6A 4CF7A 2C99A 2O8DA 1KAGA 3I92A 4KSCA 3MGCA 1A5TA 2F1IA 2YZ2A 3T15A 3TUZC 1LVGA 4DWJA 2JQRB 2ZSEA 2WLBA 2QEQA 4PHFA 3A6PC 2YVUA 1E4YA 2QP4A 3ZLJA 1J8MF 1E9AA 3F8TA 1OXTA 4LUCA 2WAYA 4TQUS 1DOYA 1NBMA 1G291 1TF5A 2WWFA 3MUFA 3AKDA 4Q03A 4TN1A 3ND9A 5JHGB 3AVOA 3CWIA 1HQCA 3B1VA 3O47A 4LYJA 1WBDA 1KZGB 4PHHA 1SGWA 1WB9A 2YWEA 3H0KA 1ZD8A 3DO6A 4QC2A 3IPYA 1OH8A 2LCFA 1KDTA 5G3ZA 4TSFA 5CDFA 4M1MA 1E9BA 3HU1A 2ZVPX 3SHWA 1Z0DA 3LLUA 4WIAA 1N63A 1XEWX 5AUKA 3LQQA 2XZLA 2IL1A 3CKLA 3BFKA 2VQSA 4IVQA 4M0LA 3PUWA 2IS6A 1ZNZA 2CE7A 1ZAKA 3B2GA 2VHCA 3FKSA 3CH5A 1MO3A 2NPIA 1XTQA 4Q9JA 4BUJA 1OSNA 4HUQB 4PC6A 1E96A 4JSTA 4AG5A 3RDPA 1ZIOA 4IDNA 5FFMA 3CNNA 5KUTA 5DI3B 1BKDR 1F2TA 1UM8A 3FMOB 3IQXA 4MRVA 4Q9HA 3RS3A 1OIVA 1RFKA 3AE4B 1VCIA 4A0FA 3BERA 4YDSA 3LX5A 2BS4B 1E2HA 4UJ3A 1S3SA 1RC8A 1HE8B 3BH7A 2JX5A 3HR8A 2I1QA 1R7SA 2MSEB 4DEYA 4JVLA 4Q66C 2ZJOA 3QBVA 3QPVA 5BYKA 2QGNA 4KFUA 2OXRA 3L82B 1Q1QA 2JLQA 3EA0A 3NBZC 1NKTA 2P67A 421PA 2TMKA 1WXQA 1VLBA 3KXLA 4HATA 3SI7A 3TQCA 3T34A 1JPJA 5AJXA 4Q1AA 2WWWA 1ZM3A 4MGIR 2BWJA 1E2LA 2OLKA 2V55B 3LAWA 5B30A 1N5LA 3JVUA 3K0FB 1BS1A 1KMHB 1E7PB 4LJ7A 1Z22A 4USAA 2FH5B 1XP8A 5FUVA 2CU3A 5GJBA 1EG7A 1IXRC 1PUIA 4BFYA 2CL6X 4TLCA 3SS8A 1E1RA 4ARZB 2VSOA 821PA 3ZIAA 5HZKA 1HV8A 4YSXB 2VRWA 3C7KA 3UWOA 5JHHB 4A6PA 4MA4A 3QKSA 3CF0A 1JECA 4NONA 1Q20A 3VTKA 1FFUA 6Q21A 3ETLA 1DG1G 1U99A 2GEDA 1CKEA 1E9RA 1FQJA 2WKRA 1W4AA 4MKIA 3A4LA 1OXSC 1S9HA 4JLDA 5L3QA 4PANA 4LJ5A 1VHLA 1HUQA 2F43A 4JJZA 3KWLA 2WWYA 4DCUA 3GLIE 2VP0A 5EXXA 5FPTA 4BFSA 1DPFA 1R7RA 3W90A 1C1YA 1TKEA 2JJ1A 4XH9B 5DI9A 2K5PA 3QNUA 3ZDQA 4CEJB 1P72A 1ROEA 4CGZA 1RJ9B 3TSZA 4N6EB 8OHMA 2OZEA 4R2IA 2HYIC 1LNZA 2BMJA 4V0NA 1BH2A 1QRAA 1P2TA 2IYYA 5BN4A 4AYXA 1EFTA 1Z28A 1QDEA 2IXEA 2ODEA 3AEDB 2VHTA 1G41A 3R20A 4FMBB 3GLGB 2GCOB 2GAOA 2XGJA 3SR0A 5FPSA 1G6OA 1X8KA 1J8YF 2WOJA 2R6CA 4PAOA 1TEVA 4JZKA 2O0HA 3SYLA 2IEZA 2O8FB 4V0MA 2Z5FA 4O25A 4Z8XA 1G1MA 2J3EA 1E2GA 5JWOA 2QY9A 4LV6A 5CM9C 4JWSC 1ZD1A 5HPYB 2VF7A 5EZ6B 1YJ5A 3LY5A 4Z54A 1XBTA 5JI2E 1ZMXA 4HDOB 4HAXA 1W36C 5LBIA 2ZRBA 2H88B 4AG6A 5KDOA 1ESNA 2QGZA 3TE6A 4C0HA 1GWNA 4I1UA 2F3RA 2G1EA 1G64A 3FVQA 1UKEA 4C80A 4D26A 2IXFA 3QG5A 1KMQA 4PPGA 4KFTA 2R6AA 3TBKA 2W58A 3B6EA 2VLIA 4BGDA 3GLFE 4OYHA 1W1WA 1W0JA 1G5RA 2QNRA 5DI3A 3AV8A 2KJQA 5KTYA 3ZD7A 3W8NA 2W6IA 4DT1B 5JEEA 3H2YA 1XD2B 3ICQB 1JROA 1ANKA 2K22A 4TT3A 3I1FA 4FD2A 4FMCF 2E3TA 2WKPA 5EXSA 3NDBB 2WAXA 3CF2A 3KJGA 2WJIA 2ZJ2A 1W4BA 1JEDA 1KOFA 4OI0A 1I2MA 1L2TA 3DDCA 3KJIA 1YZKA 5FL7A 1DAEA 1GUAA 4BRWA 1T5IA 1XU4A 3FKSD 5CYOA 4Q4AA 1NEKB 4FWIB 1JW9D 3WNBA 3SJCA 1XJQA 2FPKA 3BAFA 3ZZTA 1G8FA 5E7IA 1ZNYA 2CVFA 3K0AA 3KUCA 1XTSA 5KHOC 1NVVR 1GG2A 2BKUA 3CPJB 3KKOA 4U7DA 2NO1A 3V4FA 1W49A 4HAYA 3KKNA 2UZIR 4MRSA 3K0FA 2VSFA 1KMHA 2LWIA 5FI0B 3IIJA 1AYFA 2BT6A 1KI4A 2BCJQ 3B1ZA 3CPHA 4C0QC 4BFTA 1WCV1 4JT2A 3M0EA 3OFND 3AF1A 2ZANA 3N2IA 4YMVA 4ASUA 3WYGA 3EX7C 5FOUA 1UKZA 4WQMA 1J7KA 2PVOD 2DCUA 2FSGA 2YNMA 1FZQA 1GL9B 1II0A 3IO3A 3AF2A 1JXOA 1LF0A 2RGDA 2H8KA 3HYTA 4GOKA 2VF8A 1I7HA 5DLQC 1A1VA 2R65A 1KO8A 1XZQA 4RY2A 1MKYA 2A5DA 4YSYB 2RGAA 5DSZA 4GFDA 5G40A 3ZVMA 1JR3A 3IIKA 2WDQB 3BFVA 5EP3A 1R5NA 1YHNA 2H92A 3P4RB 2JDIA 1S8FA 3ZIAD 3F5FA 1WDTA 2DY1A 4EKDA 3P27A 2FGKA 4B43A 4TMXA 2XSZA 4QBIA 4CYMA 2QRZA 4WA7A 4IFBA 4UNQA 3GLGA 2GCOA 3QI2A 4L8GA 1OQRA 1E1QA 1NSTA 4IXMA 5H70A 1JPNA 3WYAA 4B3BA 1N6KA 1TQ2A 2OAP1 1IN8A 3LXRA 3LX8A 3ZZ0A 3P4SB 3QPWA 1A2KC 4TYQA 2O8FA 2ZUCA 3A4MA 3QKUA 3LFUA 2X1VA 3U6BA 1GPXA 2JIZD 3PR1A 1GKUB 4B44A 4D25A 3CW2A 2QG6A 2ONKA 4TMZA 4Q4HB 2A5GA 1YE8A 1FP6A 4B34A 1KI6B 2EU8A 2CVHA 3QXCA 4YXWA 4R2HA 2QMHA 1U9IC 1F3OA 1LW7A 2J9RA 4JT4A 1R6BX 3ETRA 1ZM9A 2WZQA 2WWIA 3K0EA 3PITA 2R8RA 3DWMA 3C5CA 1ZUD2 3K0SA 1KDRA 2Q9CA 4QBFA 4RSGA 5J5CA 5F3WB 2UKDA 2W54A 4OHWA 2JLZA 2VHUA 1NJFA 4C0SA 1G7RA 2MJ3A 1P5ZB 2YC4C 4HLUC 4TMKA 4ZO4A 4BEBA 2FPLA 3TGPA 1KFYB 4DT1A 2BC9A 4HZUB 1N61A 2JLUA 1XD2A 3HDTA 3BIFA 5TARA 2WJVA 2LEKA 3ZS8A 1EFRA 1YR6A 2BBOA 1OYWA 4ZCLA 4DLUA 2OLJA 3QPUA 4IEIA 2Z4SA 3REGA 4OBEA 2FV8A 2D2EA 1KHTA 1TKYA 2M19A 2ERYA 3RC3A 4N58A 1MRNA 3EZ7A 3RYTC 1L5PA 1DELA 3C41J 3U7GA 3EWAA 2QUZA 2KAJA 3K8YA 3NC0C 2FSHA 1KI9A 3EUB2 3UMRA 1M34E 2WWGA 4C4PA 3ZJYA 4ZDIA 1U0LA 4CW7A 3SBEA 3UWKA 4R98A 3SJZA 1NIPA 3TK1A 2KWIA 2DBYA 4BLRA 4HDCA 1A2BA 1Z83A 2GHIA 2RGNA 4V0LA 4ZOHC 4J0QA 5TDHA 4BFWA 3BRWD 3SQXA 3TJZA 3W9CB 1S1CA 2IYQA 3NBYC 4ZI2A 1RW4A 2GVDC 5KSYA 1M8PA 3GJ3A 1B0UA 4JLNA 1EWQA 1U0HC 2CE2X 2GTPA 2BJVA 4KV9A 4ACAA 1OB5A 4C7OB 3RS5A 5IRCD 4EPYA 4KYIB 5DH9A 3LLMA 2NPFA 2HCJB 2PBRA 4BZXA 1NVWQ 3O8CA 1Q3HA 4EPRA 3OE7D 2IC5A 5DYGA 1KF6B 2EVWX 3ZQ6A 3Q7PA 3AV0B 1NN3A 1OF1A 2W55A 1XPRA 4MYCA 1GNQA 4GNKA 3GLIB 1MABB 3VX3A 1JNYA 1RIFA 2IS2A 1P9RA 4LY6A 4DCTA 5H92C 2QORA 2R44A 1N5WA 2ZE8A 2CJNA 4FCWA 5BYJA 2GRJA 4QNMA 2ZE6A 2F1HA 1M7BA 3QENA 5KNBA 1NVUQ 3CRVA 4CT4B 2VH5R 3IGFA 4URYR 1U90A 4ASUD 5GJWC 1MT0A 4D4MA 2EKIA 5JSZA 1J90A 1LS1A 4G5RA 4GT1A 3QSYA 4M1OA 3KQNA 2A30A 3BIID 2VHQA 1YQTA 2OBNA 1Z2AA 4MDFA 1RZ3A 1RFLA 4XVQA 1L4YA 4DB4A 4EPTA 2WOOA 4DDVA 1KO5A 2JEOA 3HWSA 2C9CA 2O0JA 2PLRA 3GJ7A 1JR3D 4B48A 1CJVC 4OQMA 4QJ3A 2NZJA 3L0SA 1E98A 2DWOA 3TVDA 2QMUA 1KI2A 4TMVA 4M1WA 1VG9B 2XNSA 4B35A 2BBSA 2DFLA 5IK2D 2FMXA 2ZR7A 1LTQA 1OFUX 1N2CE 2GF0A 1VDZA 4ACBA 2ZU6A 3T1OA 4HROA 4ZIRB 5EE3A 2PL3A 4RD6A 4BZPA 2ZR9A 3IILA 4JVNA 2RHDA 1E1QD 4PQRA 1VMAA 5EZ5A 1DAGA 2BDTA 4B75A 4P3YA 4A0HA 4YMUA 1SKYE 4YMSA 3L4PA 1N6HA 1Z06A 3DOEA 3Q72A 1OQQA 3QIAA 4WZAE 5CJPA 3QXXA 1SXJE 2GESA 3GLFB 3DZ8A 4JBXA 1YZQA 4NYMR 2FX3A 1E79D 3LB8C 5FPKA 3KQUA 4AIIA 1XEXB 2AD5A 4LPSA 1WBBA 1R0WA 1HT2E 1G17A 4M2LA 1PV4A 2ZUBA 1XLNA 3NVZA 4R9UC 2CJWB 3L0PA 1G3QA 2ZXUA 1NYQA 3G0HA 2IWRA 1GL6A 4BRUA 2VL7A 2WM9B 2HXSA 4LI0A 4JS0A 2OFWA 1F60A 1X6VA 1Z0AA 3V4RA 3PIRA 2H7VA 1U0JA 4EQ6B 2IEYA 1PLJA 3WBJA 1E9CA 2ZSBA 4WZBE 4KHZA 4B3FX 3X1WA 2WDVB 2JLSA 5D3MB 4RKEA 4LHWA 4PPNA 2AXPA 1KSJA 4OL0A 1EFRD 1YU9A 5AJYA 4EJSA 2F55A 2CHGA 1KJZA 2NO9A 3UATA 2B21A 1L8QA 4L9WA 3E70C 4NYJQ 1GIAA 4KLZA 5A4JA 5FI1B 4CEIB 3QXHA 3ZVLA 4RZUA 4C7OA 1FXAA 1C9KA 2C95A 4EUNA 1GKIA 5ELXA 2GBLA 2GNOA 3TQFA 4US2R 1U8YA 2W0MA 3A37A 3TNFA 3PJRA 1G5TA 3K70B 4HYYA 1R8SA 3P63A 2GVZC 2WHXA 3H84A 1GKYA 2IYLD 1UDWA 3HU3A 4B3GA 2GWHA 2AL7A 4X8HA 2RHMA 4OK3A 221PA 4LBZA 3WMFA 1COWA 3GLIA 2QSZA 2GDJA 1JR6A 1VG1A 1AZSC 4JYCA 1XMIA 1W7AA 1CP2A 4M1TA 2A5YB 3U3KA 3R8CA 4YQFA 4JLKA 1W5SA 3KZ1E 4I1VA 1WQ1R 2FNAA 4MRNA 1FXIA 1TUEA 4OK6A 5KSOA 1Z6AA 3WBKA 1G21E 2FG5A 1W46A 2I1VB 1FUUA 1NY6A 3BH6A 3K9GA 3E2IA 2V6IA 3MG9A 1XLQA 2O8BB 3QJYA 4Q7JB 3PO0A 4KAXA 4BEJA 5B58C 5C18A 2QSYA 1CF4A 5DE3A 2W0SA 3W3AA 2CBZA 2PIAA 4XVRA 3O8RA 3AMZA 4Q1FA 2V9PA 2GJAA 2XNDD 2YYZA 3AH8A 4AKHA 3ASYA 2BVNA 1T9HA 1DTSA 2V54A 5K8LA 1UWMA 1Z2CA 1HH4A 3D8BA 4FN5A 1DAIA 1VECA 2BKEA 1W47A 3K09C 4DHEA 1J70A 5H68A 2PCJA 3KQHA 3C14C 1ZM7A 2YC2C 2MSDB 3B60A 3IUYA 4A8JB 1EWYC 3U44A 3K9LA 1EK0A 1QLBB 1XRJA 3VHXA 1RRCA 3WRXC 2R6DA 1G8YA 4FMDB 4OK5A 3OIVA 3GEHA 4B3XA 3ADBA 2IYWA 4D81A 2J0UA 5FUWA 3QF7A 3RS7A 1GL7A 4Q7KA 2YHSA 1EFHA 3MD0A 1DS6A 3TAUA 1N0VC 1L4UA 1KZ7B 4RZXA 4ZDKA 2NTYC 2ZI5A 1TNDA 2FFQA 3TUJC 5CIWA 3WY9A 4DCVA 3U7HB 3GFPA 5EQTA 1SHZA 4PFSA 3GP8A 2P3SA 1KI1A 1XEXA 4TYYA 1Q0UA 4F92B 2AK2A 2GJ9A 2QAGA 2QT1A 3EAQA 4JIMA 3T35A 3UIEA 2GILA 4QGHA 4XWAA 4E07A 2X19A 1XD9A 3EA5A 3W5IA 1FMJA 1OW3B 2OCPA 5KNCA 1E9SA 2O8CB 4QHYA 3THOA 2CJWA 1KSHA 4RFSB 1FPMA 5E4FA 1AGRA 1S3GA 1II8B 2HF9A 3QE0A 4RZ2A 3NS1A 5B64A 3IHWA 2H1LA 4CVNA 5J4KA 1Z3IX 3PEUA 1EESA 5DO9A 2ZRMA 1CJTC 2H16A 4EQ6A 5B57C 4V03A 1K8RA 2CDNA 1XTJA 1IJFA 2FJUA 2G83A 1X8JA 2IXGA 4DCNA 4TZ0A 3U6KA 2QL6A 4QBGB 4M9ZA 4NTZA 1T3LA 4QGFA 5IF9A 2OBLA 1BYUA 5FBRB 2ONJA 5KOYA 3H1TA 1KKMA 4NP6A 2OCAA 3THWA 5AUIA 3RRMA 5P21A 5IT5A 1T0JB 4GI7A 1EGAA 3C16C 4WVFA 3S1AB 2B76B 1DO0A 3FTQA 5FOVA 3THXB 5KYKA 1A4RA 3LBIA 4YSZB 4B32A 5DHAA 2C96A 3DHWC 4EAQA 5JJIA 1R8QA 5FL3A 4IDQA 5C2TB 4IDPA 3C5HA 1E32A 2O52A 3NKVA 3AE6B 1ZINA 2ZRGA 2W2TA 4CIDA 2WS3B 3EIHA 3EASA 4RJLA 3D3QA 2IX3A 4XTRA 4NYIR 1SHKA 2CLDX 5AR1A 3ZVNA 1F2UB 1Z6XA 4KCGA 2QE7D 1JJVA 1YZLA 1NMZA 4ON9A 4Q9KA 4H1VA 1GRRA 1V8CA 4D4LA 1WGKA 1VHTA 4ZPXA 2GJKA 1R10A 2ANBA 4XWOA 5AUOB 3CIOA 4NKRA 4DLYA 2VEDA 3IHLA 1U94A 2ZR0A 1E2KA 2DFNA 2F1JA 3MSXA 4Q4JB 2O8BA 1UADA 2OFXA 3T5GA 1AS2A 1ZYUA 1BMFD 4LDJA 2QZ4A 4NDZA 1QBKC 2P65A 3ASZA 1WMSA 1QHXA 1XTIA 3LV8A 4N0DA 3KL4A 4DBLC 2IS4A 5LD2B 1O87A 1FFVA 5FR2A 4MGKR 1OFIA 3A1SA 1NG1A 1J2JA 3VAAA 2H5EA 1COWD 3PENA 4Q1EA 1QOBA 4JLPA 3OFNA 4G01B 2WJYA 1CS4C 3QXSA 3K9NA 4HB2A 4LZZA 4XSGA 3AEGB 2DWQA 3R8FA 1U8AA 3VR4A 4QKQA 3QG1A 4C0AC 2IUTA 2ZRIA 3H86A 5CYPA 2IYUA 2FFAA 4DDTA 1CXZA 1TADA 4BZQA 3I62A 2WWHA 4A8JA 4Y0VA 1IXSB 2J45A 2R62A 2DPXA 3SFZA 4PO9A 4BLTA 4DDWA 2E9SA 2F7SA 1XMVA 1A82A 3A1TA 3VRBB 3LVRE 1T6NA 2FPMA 3SR6A 2FFBA 2VHJA 2IHYA 2A7QA 3C15C 3I8XA 1E0KA 4GPTA 4H9GA 4OQFA 4AWXA 1UJ2A 4HAWA 5KSPA 1XDBA 3NC1C 1P73A 4DVGA 1TKGA 1HYQA 1TJEA 1JAHA 1SKYB 1I4DD 5G3YA 4BLQA 5M04A 2JASA 3BWDD 1Q57A 5MPOA 2DFTA 1D9ZA 3LW7A 1SXJB 1ZM4A 4JKIA 4K8OA 3KTAB 1IY0A 2CEAA 1VYVA 2D62A 3EPKA 4HRSA 2ZREA 3SFDB 3Q7QA 3NIBA 1AIPA 1YQ4B 3AEFB 2NG1A 2UVQA 2V4ZA 4W5HA 1ETUA 2CCKA 4E5UA 2ZI4A 2P5TB 4JKYA 3AF0A 5KNDA 2RCNA 1KK0A 3B78A 5LB2A 3Q9LA 2O8CA 3TW8B 4RFSA 4S35A 5K8IA 3EWSA 3AH7A 4M22A 2JIZA 3ND8A 4POAA 4DEXA 4IHQA 1XWIA 2REXB 4MRRA 3CONA 4JLAA 4IDOA 4C30A 3FGNA 3SU8A 4YTMB 4QM6A 3T12A 2J1LA 2ZI3A 4IFEA 1EWRA 2O8EB 4GRAA 4NCIA 3P32A 5DGXA 4B33A 1P2UA 3H4MA 2ORIA 1E9EA 4A0GA 4NL4H 3U2QA 1L6VA 4OJKA 4TL8A 4BFZA 1NKSA 2WKQA 5KO2A 3Q8XB 3IQWA 3IBGA 3NVVA 2HDNB 3EPHA 4QOSA 1TYGB 2DYKA 2QP9X 2ZJAA 1Q12A 3MFYA 5KPDA 4PZZA 2ZRLA 3THXA 1NIJA 4PQYA 5EE5B 1NP6A 4BPBA 4DKXA 1HEIA 1M2OB 1EX7A 2BM1A 5SZIA 1AM4D 1RPZA 4TWZA 1ZCBA 5HE9A 3R9XA 3AVXA 3V9PA 4JLBA 1IN4A 2OCYC 2EFCB 3SZRA 1F2UA 3CNLA 2ZROA 4OHYA 1CEEA 3MRSA 1X1RA 2ODNA 1NLFA 4EJSC 1CULC 1E0SA 3RS0A 3K9HA 4NH0A 2XJ4A 3AB3A 1W44A 2GF9A 2HLDD 2ZJ8A 2WSMA 4HUQA 2IYZA 3AQ4A 4OI2A 4K81B 3CX6A 2H18A 4ABYA 2XXAB 3SYNA 2ZQ5A 3VQTA 2WMOB 1G19A 4MYTA 4V0OA 5KSZA 2FBWB 3K70D 2GBLC 5F9FA 4W7SA 4LX0A 4XIGS 3L8YA 5SZKB 3PCRB 1E0AA 4DUGD 5J47A 1YJJA 5JCPA 2GXSA 2ZI7A 3KKQA 3LH5A 4TLEA 2W00A 1KNQA 1PUJA 2NZ8A 2LKCA 4DXAA 2FSFA 3X2SA 2C04A 1AA9A 3DKVA 2RGCA 2GK7A 1TQ6A 3KDSE 3PFIA 1AK2A 1IN6A 3KQLA 1US8B 4A36A 3OE7A 5AUNB 4KITB 1KYIA 4D4JA 1N5KA 4LJ6A 4MH0R 4RFVA 2Y8EA 4M8NE 1GFIA 2NOAA 5FUXA 1FL9A 2XITA 3VNUA 1XPOA 4HLDA 1SIJA 4LJ9A 4M9QA 2GCPA 2BBTA 4HDQB 1DAFA 3F0TA 3NWJA 4YTPB 3DMDA 3RLFA 4KFSA 5AJVB 4US8A 3J81k 1HT1E 4M9SA 3K0CA 1L0VB 4BECA 4ARZA 1FX0B 1G9XA 3KJHA 5BN3A 2Z83A 3W6NA 2G1KA 3AUXA 3RWOA 3HYRA 1KO7A 1SXJA 1II9A 4KI0A 3NBXX 3EC1A 2ZE7A 3AVTA 4A1FA 4LYHA 4WBSA 2HF8A 3U3OA 2K9XA 3PEYA 5CIQA 4DLRA 1XX6A 5JWRA 1ZD9A 1D8TA 3G5UA 1AGPA 2ASEA 3DM5A 2ZS9A 4HB3A 4TL9A 4MGYR 1KI3A 3MCAA 1FW6A 2V7QA 4CEJA 4ZDWA 2C9OA 2ZRNA 1RJ9A 1ZOYB 1ZRHA 2ZJYA 2L52A 4KFRA 5G41A 1AKYA 1UDXA 2FU5C 1VCMA 4II7A 4GZLA 1T3QA 2PH1A 3CIRB 1HQYE 1JBKA 1KY2A 2A78A 1FNMA 1VG8A 2V1XA 5IK2A 3SYKA 4A2WA 4BLOA 3AVYA 3CRQA 2O8EA 4M53A 2RGXA 1E4VA 1UBCA 1AWDA 3DEFA 2B8WA 2N0SB 2G0NA 4KVGA 4RD1A 2CCJA 3P4PB 5FOSA 2Q3MA 3LBHA 3CH4B 1GVNB 1X8LA 1Z5ZA 3RAPR 2VP6A 4WXPA 5UKDA 2QAGC 3KFVA 4E22A 4GSYA 1FFHA 1QVRA 3GQBA 1S96A 2CMKA 3ICEA 3BS4A 3B9QA 1QF9A 2GAAA 1E79A 2QENA 1U81A 4US9A 2ZITA 3WXMA 4KJZA 2H17A 2OE2A 4OQNA 4D0GA 1ZUHA 2IYSA 4XWKA 3R9IA 3BD9A 4XD7D 1FTSA 1QHIA 3EARA 3KKMA 4D6PA 4B3DA 3UK6A 1KAOA 2IW3A 2ZE5A 4JLJA 3NVYA 4WWMA 1LFDB 1IJEA 1OYYA 1GP2A 3SN6A 3UMSA 3QVUA 2EQBA 2ZJ5A 1D2EA 1YRAA 3N2EA 5EXTA 2QM8A 1WE2A 1ZP6A 4GDFA 1IUEA 4G5GA 1IXZA 2OG2A 3QVVA 3U3JA 2ZJBA 4Q1BA 3WYFA 4L15A 2W3SA 4MQBA 2D3WA 3AE7B 2N46A 2W2XA 4I1SA 4YMWA 2DR3A 4JX1C 1OFTA 2DHRA 1YR8A 2Z0MA 2V3CC 4N1AA 1T5LA 3L0IB 4ZCIA 1SVSA 4CEHB 1NVVQ 1VPLA 2Q3FA 3D6TB 3T1VA 1G7CA 2BM0A 5H8WA 4Q5IA 1WRBA 2HTME 2HV8A 4M1KA 5FTNA 3OF5A 4C2TA 2YJTD 3PUZA 1CR1A 1Z07A 3ZVRA 5HKKD 3CNOA 3PUYA 4DLZA 2QA5A 3LA6A 2WJGA 3U3RA 2ZRJA 4BFVA 5JI3E 1US8A 1E69A 3TUIC 4DSNA 4HLQB 4EFLA 2GCNA 2FDCA 1Z63A 3QEJA 4F4CA 5TY0A 5JBQA 2CL7X 5JWHA 1EFUA 3KX2A 4KU4A 4S2EA 3X1DA 4AYWA 3QKRB 1P4SA 1IBRA 3BFXA 3U60B 4AY2A 4JL6A 2QN6A 1WF3A 2L0XA 2WV9A 2FEMA 1KY3A 5IDVA 3NH9A 3AVUA 5JJLA 4Q1CA 1OHHD 2F1RA 2ZPTX 4F91B 3FMPB 1FX0A 1ZM2A 2BBWA 3VMFA 1J99A 2EWWA 1FRDA 2Q9BA 1DOIA 4LJ8A 4Q4LA 1S1MA 1YZTA 2GXQA 3RHFA 2XAUA 2VIIA 2PEZA 2XTMA 4OI4A 4B2LA 1W36B 2C5LA 4L5BA 1Q44A 5AUPB 3U4QB 3UKDA 2XNDA 4P6VF 3HPQA 4LGMA 3TIFA 2KMMA 3PEWA 3HJNA 1KDOA 3QEOA 4ESHA 721PA 1ZUIA 3B2FA 4XOIA 2OSBA 3M1IA 3SJBA 4DCSA 1DAKA 1XJ0A 1Q1EA 3BXZA 4TQAA 3PVSA 2QTHA 3WMEA 5JFGA 1Z8FA 4FCTA 4V0ME 2LKDA 3LNCA 2DWPA 2ZS7A 2ZRAA 3EPJA 3VNVA 2VTKA 1CJEA 1QOGA 1E9FA 3TSWA 1SXJD 4LOAA 4KXFB 4LBWA 3U7EB 5JRZA 1YR9A 3B1WA 2V8OA 4Q9IA 3ZYCA 2C98A 2FEOA 5FH9A 3CX8A 4C7YA 1DOXA 4KYUA 3AE1B 5H8YE 1FM0D 5E3HA 1ZVQA 2XOKD 4Q47A 2QMOA 3AE5B 3EZ9A 3VHLB 3EZFA 3W9YA 2P0EA 1TPZA 1A70A 2W3RA 1KRHA 1N6LA 2AN9A 4OQXA 3CR8A 5JRJA 1P60A 2V7QD 3ADKA 1G7SA 4X8OA 1GDDA 2RH5A 4OHZA 1RRPA 2B6HA 3IIMA 1G8PA 3A4NA 2CLSA 3BE4A 3MAAC 3O8DA 3OEED 4LC0A 4KSBA 5FUYA 4Q4HA 5HTKA 4A0RA 1ZIPA 2PZGA 2EYQA 3UPUA 1QHHB 2ZRPA 2ACZB 1KI6A 2GJSA 2VO1A 4Q00A 3B2EA 4A2QA 1OIXA 1UFQA 1NYRA 1PLLA 5JECA 2EFEB 2QBYB 1VG0B 4PHTA 1MOZA 1QF6A 1N0UA 1XZPA 2OUKA 3AVPA 2M56B 3GJ8A 2O5VA 4PPFA 3KB2A 2JLRA 3CR7A 3FFAA 3A1WA 2ZSDA 3NEYA 3FHTA 2QJLA 3T61A 2RGBA 3RS2A 3P20A 1ZP0B 4G5SA 2J46A 1JWAD 1W5TA 2GK6A 3BB1A 3R9WA 2MJDA 2GKSA 4HZUA 5FOTA 2P5SA 5TXGA 1HY3A 3TW4A 4D2IA 3RABA 3OESA 1E6EB 2IHBA 1NG9A 1E9MA 2E1RA 2Q9AA 4CEHA 1CR0A 1NVID 3THYB 2VP4A 3CWZA 3FHCB 4MUBA 4RD3A 1U2RA 2NO0A 4LJ4A 2JLVA 2JJ8A 2WQYB 2QMEA 3WP0A 2YWFA 4PHGA 2C8VA 4R71A 4BASA 1SKQA 3BH0A 3VKGA 2WP9B 1NN1A 1TX4B 4YC7A 3M4YA 4IRUB 2ZAMA 4UNSA 4DRZA 3Q85A 1P9NA 5EP2A 4C3ZA 3BB3A 2IS1A 2GA8A 3MMPA 1OT3A 3P4QB 3EZ6A 1I2DA 4QJ4A 4HEJA 1KIMA 4Q1DA 1R0ZA 3SOPA 5J4VA 3GMTA 5G5HA 2J0SA 2ZETA 1KGDA 4W9MC 4D0NA 2QE7A 5C3JB 2QPTA 4M1SA 1F5NA 3W5UB 3CUEF 2W6JA 3ECCA 4UJ5A 4AK9A 2FA9A 1XB2A 4TMTA 3T1QA 1K6MA 1R4AA 4RKFA 4EFMA 4BLPA 5C46F 2HT1A 4L16A 4CT5A 1SVWA 1TEXA 1BO6A 1QHNA 3VX4A 1CRPA 2ATXA 5JCZA 1BMFA 1NMXA 2EFDB 2O8DB 4Q7LA 3FC4A 2RAPA 4MYUA 2H89B 3VR1A 5C4GB 4C0JA 4QFMA 1JRPA 1IM2A 4L4UA 2CK3D 4ZI3A 3VU9B 1OPXA 2Z6VA 3WMGA 1YR7A 2N42A 2ZVQX 3OAAD 2EW1A 2Y5CA 1VIYA 1MABA 3W34A 2JJ2D 3GPLA 5SZJA 1V43A 4B3CA 1MO6A 2IYXA 1NLYA 1H8EA 4LV5B 1D2NA 4A6XA 5J4LA 4NPHA 1G20E 1HE1C 1RM6C 3FKQA 1N0WA 2ORWA 1FUKA 1L7VC 1H8HD 3W5JA 1YQ3B 5IHPA 1HA3A 2QTVB 5GJCA 1ZBDA 3K0CC 2GEVA 3QBTA 4PAMA 2FOLA 3AEAB 1N6IA 1TF2A 4PSAA 1ZC3A 2OV2A 2IUUA 2AX4A 2A5JA 4TLAA 4A82A 4BE7B 1E2IA 3CLVA 1EXMA 5HE8A 3GJ4A 1AQYA 1AZTA 1S2MA 4M4SA 4FWTA 3ADCA 1Z08A 3U61B 3GFOA 1E2NA 3AEZA 4KBFA 3OZXA 4PC2A 1N5XA 4RCYA 1XTKA 3FMIA 1VTKA 3RC8A 1SVLA 4XVUA 5E7MA 1OH7A 1BIFA 3K53A 4MGZR 3OEHD 2MSCB 2G3YA 3GCGA 2MJEA 4HUTA 1F2TB 4DLSA 4RD0A 2FGJA 3GEEA 3P4XA 4PSVA 2VP5A 2F9MA 1CZPA 3T06B 3RSOA 3LVQE 4NYMQ 2XB4A 1GNRA 2XTZA 4H1UA 3HRDD 4AD8A 2ORVA 3F3YA 4ZIRA 4LCBA 3SFVA 2GZDA 2A3RA 3BK7A 4M1YA 2AK3A 2Z43A 1NLZA 4PAQA 2PLFA 2J7PD 3OIUA 4JLMA 4M21A 2G0TA 4U00A 1VJKA 2C9YA 1UKVY 3D7MA 1LY1A 5FR1A 1MH1A 3DL0A 2XZOA 1AKEA 2BS3B 4IOLA 2YINC 4NBSA 3X1YA 4TQ9A 1G18A 3WRYC 4N59A 2MMGA 2XTNA 4UNPA 3FFBA 4IXNA 5CB6A 3GLFA 1P75A 3CRMA 3GLHE 4D82A 1SQ5A 1YZNA 4UXJA 1JJ7A 1G16A 1X3SA 2AR7A 1XCGB 5CITA 1RYFA 1D5CA 4B6FA 1Q21A 4JL8A 1KDPA 1PZNA 4HI0E 3A36A 1E9DA 4HZIA 4EPXA 4DSOA 2J0VA 3NVAA 2IT1A 2YKGA 4Q19A 3REFA 4A92A 2BMDA 1W0KD 5FTJA 2JLYA 2YOGA 1KSGA 2JLXA 1JAIA 2D2FA 5CLQA 3R7WB 2XB2A 3Q5DA 4FCVA 3AF4A 4AC9A 1XCMA 2KI5A 3HU2A 4IDIA 3QKSB 1KK1A 4YTNB 1Z6TA 4PR0A 4XSHA 2ODBA 2F6RA 3KQKA 3P26A 4LK2A 1OV4A 1XPUA 4QM7A 3BJIC 2ZTSA 3NG1A 4MDEA 2F43B 2AHOA 5D3MA 5B2ZA 1T8UA 2D4HA 1YVDA 2GEUA 4P4TA 1RWSA 2HLDA 2NQ2C 4JVMA 4JJKA 4KLNA 4TMWA 4DSTA 1ESMA 1Q3TA 2ZYUX 4CEIA 3VR5A 1FP7A 1LB1B 2X2FA 1CJMA 4FMDF 1N25A 2MMCA 1FRRA 3ONWA 4US0R 3RNLA 1PLKA 3L8ZA 1TL7C 3EPLA 1KSFX 2AXNA 5BW8A 2RGGA 3PQCA 1U9IA 1B9RA 3PG5A 4HAVA 3RPFC 1T3SA 4QRHA 4DUGA 4GZMA 3VU9A 4B2IA 4PC1A 4B74A 1SB3C 4HLCA 3VKWA 3GJ0A 3I73A 1YRBA 4TL7A 1E2FA 1Z6YA 3P1MA 4JL5A 2WJHA 4Q01A 3JVVA 3LWNA 4DLVA 1E2QA 2RGNC 2EYUA 2D7CA 4HLUA 2W6JD 4GOJA 4DSUA 4ZHPA 1SVMA 2IBMA 3N5CA 3P4YA 1M74A 4P31A 3AEEB 4V0KA 4FINA 1KNXA 5F9HA 5K8UA 4AURA 1JEEA 1SF0A 1HURA 1NN0A 4URVR 3AKEA 4DLTA 3WP1B 4CRWB 5A5GA 4GOXA 1W36D 4RVCA 1YJIA 1ZU5A 4LSGA 5FBVB 3ZYYX 1RYJA 3RWMB 3HVZA 1T3HA 1VCOA 4MRPA 5J4HA 3AKYA 4JYBA 3SBDA 3SEAA 3KFXA 1Z0IA 1V5WA
chains in the Genus database with same CATH superfamily
5JPDA 2P6UA 5I45A 2JD0A 1FFCA 4QQFA 3OT1A 1EWCA 2QPOA 1STOA 4RGOS 4UCXA 3H8WA 3CQ9A 3UGTA 5HXAA 3E5HA 3J7AC 1ENFA 5LMUB 3C4JA 1UKCA 2EZTA 3LY8A 4Q4AB 4FDUA 5D00A 4FYXA 4BNHA 2R6R1 2P9GA 4Z2AA 3FYHA 4GLSC 2YVLA 3RIHA 1A04A 4DBZA 1AZWA 2BZ1A 1OA1A 4W7HA 4FYHA 2BW0A 5LXTF 4KDIC 3QWAA 2QM0A 1C4KA 3ROEA 5AWFC 3KPWA 3CZRA 3SNHA 3PDJA 3MERA 1EFPB 3EG5A 3FM9A 3GZ4A 4HJRA 4HCPB 3I1JA 1VPDA 3LQRA 3CRRA 2ZYWX 1BGWA 5IAAC 1JMYA 5HQ3B 3SBXA 2WAMA 4X60A 1G8AA 2H1IA 3G0OA 4PXYA 3IYLW 2RH8A 4S0ZA 2FY8A 1H2YA 5IM4A 4ETWA 1VLVA 5F73A 1BE0A 1L4MA 2QZ9A 3CZPA 4MJ3A 3WWPA 1V97A 1GTZA 3BE8A 4BJ1A 3UV7A 1RABA 1GQ2A 4Y0NA 5IC4A 2I6GA 5EQDA 3KZCA 4BBJA 3PK0A 3EIXA 3RPEA 4DB2A 1XRNA 2ZNVB 2DMRA 4G8BA 4BO2A 1E3JA 4MB2A 2P2SA 4IL5A 1N9GA 3A32A 4EF4A 2BFOA 2IGGA 4EI9A 3G2QA 2R9VA 1QF7A 3CVOA 1NNUA 1N6NA 2PGXA 1BEUB 1N60A 3K09A 4ZOLB 2AYXA 2XOEA 4IJ5A 1XRMA 4R8VA 4R3WA 3PXEA 4CMCA 2GLXA 4JK3A 4NCBA 3RYCA 1XCPA 1P3DA 4PG7A 3BIWA 4QHSA 3I6QA 4QQKA 1ND5A 2R96A 3K70C 2AFIE 1KORA 2JAHA 1BTOA 1AS0A 3AF6A 4JN6B 1NLUA 1R5OA 3ET5A 1GNPA 4UNNA 5JXHA 4PYZA 5JEDA 4EZJA 2ZM5A 2JCGA 4EPWA 4EB6A 2BYTA 1LSOA 3NIDB 3D43A 1WR6E 4DNFA 1GNUA 3FCEA 2N9XA 3WCQA 2PUTA 2JLCA 5LXHA 1SEPA 2WHEA 2QVXX 1JKIA 1Z0JA 2QDXA 1IPEA 3M5CA 4WNAA 1WHSB 3MCWA 3QU5A 4EJSB 2Z0EB 3L02A 3N1YC 4QG7A 3H0EA 3DTNA 4RGNA 3IVMA 3JQ8B 1PR1A 1LTHR 1UP6A 2BFEA 3P52A 3UF0A 1ZVVA 4B0OA 1TTNA 4TYMA 3D5QA 1P9DU 4ERNA 2P6NA 4MKHA 2AEEA 4MUIA 2VQDA 2IK8A 3EVAA 1CJKC 3OPYA 4W99A 4DRYA 2N9KA 3LRXA 1NBOA 1SBQA 2IPAB 1PVOA 1U98A 5L4NA 2IP4A 4L9AA 3CF6E 5CR9A 3IAS6 3BCSA 1RZUA 2HT6A 5KBYA 1J9GA 3IAUA 5FBQB 2AZXA 1ZMBA 2Z0DB 4LQCA 4PZAA 3ROKA 4M9RA 2GN4A 4O5AA 3RU7A 4DDMA 3A1FA 3PQ5A 2Q4DA 4YBRA 2V7WA 3KOMA 4GKKB 1YKGA 1WU8A 3PNVA 1TS4A 2E37A 4ANVA 4ANUA 3CR3C 2YYYA 2QPAA 1XRQA 3GFRA 3O2JA 4URZR 3KVFB 1ZU4A 4JQZA 1IK4A 3OPMA 5C1IA 5F5NA 1OXVA 4MIKA 4PFKA 3I5YA 4HQNA 3QXJA 4X92A 4Q39A 5CK4A 4CLRA 1SE3A 3B08A 1DFIA 3FPKA 4OJQA 1A27A 4KPGA 2ZUTA 1XJCA 3UA4A 2NTVA 3B0AA 2AXQA 4FC6A 3AOGA 3ONSA 2HEIA 3W7AA 3VO1A 4IKPA 3IEPA 1YE3A 4YCLA 4EBBA 2Q0QA 2PBZA 4Q93A 4PYMA 2IYTA 2H4FA 1OYOA 1YQXA 1KYTA 1DO2A 5AJHA 2WU5B 3ZJTA 3KPVA 2FWPA 4QGAA 5HZHA 1KKLA 5JAPA 3NGMA 4NE7A 4ZV9A 4WWHA 2ZJZA 1QFMA 4P2BA 3W5VB 1MO4A 1TFUA 3JZAA 4K1LA 4K6FA 2O7NA 1HQKA 3A0RB 4KPUB 5DN9A 1QIMA 5L3QB 3TAHA 1I1OA 3A2LA 4I8DA 3QUSA 1LPSA 2NZ2A 3C1UA 1IBSA 1ZD2P 3TJRA 4PIVA 2VAPA 1PWXA 5GMVA 1ADFA 5DN6A 3M49A 4M1EA 4YRFA 1VL0A 4QFBA 1Z37A 5EEHA 1ESEA 3LTEA 1DOYA 3GNSA 1T6XA 4YMIA 4DMLA 1OH8A 4D0SA 3DAOA 1VGQA 4TSFA 2R7AA 1XHFA 3HSYA 3CKMA 4RVFA 4D5EA 1ZNZA 1ZAKA 3EHEA 1XTQA 3CZMA 1DFGA 1E96A 3JZDA 1HRDA 3PNMA 1UM8A 1F2TA 1F6DA 3WGYA 4J16C 1ZSVA 3BH7A 4D6XA 4QLBA 4HKZE 2GZRA 4JVLA 3IUQA 3AHIA 4OXYA 1Q1QA 3T99A 1XZMA 2FSPA 3MWGA 3OX4A 4FT2A 5IAEA 1JPJA 1TTQB 1TM3E 2WWWA 1QYDA 4HG2A 2FRXA 3HFSA 2CU3A 3NU1A 3MGBA 4L9RA 2JHAA 4P4NA 1FFUA 4R9VA 2NZVG 3RFUA 3W8DA 3L8EA 3PPXA 2HMSA 3BGIA 1R7RA 1EA7A 4DLPA 3QUTA 1EFTA 4OQZA 3RYFA 1TGYA 2VHTA 3W1YA 2GCOB 5BR1A 4KV2A 4FULA 2I2DA 4ZRDA 5FPSA 2O8FB 2VWGA 1ODIA 3S1LA 5JSYA 2QNIA 4YJGA 4C0HA 1JQKA 3UNXA 3ROFA 2MR5A 3FVQA 1UKEA 1T2FA 3QG5A 4I3FA 3GFQA 1U0EA 1W0JA 4DGSA 3ET4A 2QZSA 5ELLA 5CT4A 3KJGA 2E4UA 4H1TA 5JAUA 4LJOB 3PD1A 1I01A 1XU4A 3FGOA 3WTBA 2QLBA 2J53A 3TM4A 4L5AA 5I7UA 1AG9A 5ILOA 4HQRA 1AV7A 2QD1A 2VSFA 1B0PA 2Y9PB 1YT5A 1U5CA 2ABWA 4Z49A 5JXJA 3M0EA 2ISCA 3AF1A 3X1JA 3PJGA 3RTAA 3HSKA 5KVSA 1II0A 3AF2A 1USKA 3VBEA 2VEOA 5SYAA 4LAFA 2G9ZA 4DUYB 2EBWA 4B83A 2C4VA 1PU2A 3UXHA 1DKPA 1Y4ZA 3A3PA 3EFOA 3QXGA 4YRBA 2A0UA 5D6OA 3F5QA 2UZAA 1Z2NX 4L57A 4CIVA 2WFLB 1FQOA 1JYSA 3VYUB 1ENPA 3ZZ0A 4FPXA 3SOZA 3O0DA 1GPXA 4FXOA 5F2OA 3GAFA 2QG6A 2OHOA 3D3EA 3HBMA 2PTHA 1RI1A 4ZAVA 4YXWA 4JOCA 3RBVA 4TUYA 1LX6A 1E5LA 1QFXA 3T7DA 1CUZA 5BV8A 2PLWA 4G0QA 3BIFA 2LEKA 3ZLUA 4IEIA 4LMAA 3RAFC 3JZFA 5BUCA 1I13A 5KYWB 3RC3A 3FUXA 2QUZA 1V8PA 5AM4A 3E9MA 3ZJYA 3RS9A 2G5GX 3GROA 4I4TA 3SJZA 4YJ3B 3SQXA 3UOWA 3GBSA 3VI3B 3OU2A 1RCFA 2GTPA 1QGYA 2V3SA 2QR5A 2EJCA 4AMUA 8ATCA 1D0VA 1MABB 3GNTA 3H6NA 4EGAA 1QIEA 3AB8A 5H92C 1DJPA 3SYRA 5BYJA 2GRJA 4Q12A 2O20A 1YC2A 1W8DA 1LS1A 4B87A 2DPMA 2A30A 1H22A 4NG5A 1NBAA 1RZ3A 3HI6A 3DC7A 4KGDA 2C9CA 1T0QC 4CKCA 1LH0A 2DAPA 2QMUA 4O2BF 4TXNA 4YLEA 4B35A 2A67A 3UI3A 4RMHA 2NYUA 2VJAA 3TNYA 1CB0A 1VMAA 4QD3A 3Q72A 2EZ8A 2OYRA 3QELA 4AIIA 2VBFA 4JC4A 3FPFA 3BJRA 3VU1A 4L1BA 3CE6A 1ZJWA 1G3QA 5IXJA 3S5JA 3ISTA 1M9NA 1X6VA 4JA2A 2MLBA 3JD4A 3KEGA 1U0JA 4H2DA 2XV1A 3ZWWA 2AJLI 1LQ2A 1EFRD 3A7EA 1W6UA 2HMUA 1R18A 2I76A 1C9KA 1W93A 4FN2A 3HCFA 1KEVA 2QXUA 4UE3S 3H84A 3RNAC 1AARA 5KAMA 5B2FA 4JLKA 1WLYA 4MW9A 2FG5A 1L4GA 1KIFA 3JWGA 5D84A 2GPYA 4C43A 1A72A 5C18A 4QJIA 2FW1A 4NFLA 3O8RA 1JHUA 4PYOA 3D6HA 2AVDA 3WIBA 1C9YA 5AXAA 1C9NA 2NTSA 3KR0A 3D8BA 3EECA 3HN2A 4DV7B 4HPMB 4D42A 3B60A 5A62A 3QFCA 3OM9A 3OT1B 4R9NA 3EBPA 1G8YA 3K8QA 3E61A 4RW0A 1U3UA 4QULA 1H4SA 3PQEA 3EW7A 1TAHA 3J81A 4IAOA 3W7BA 5MN5A 1ZGAA 3R44A 4OHMA 1MJ5A 2QT1A 3T35A 4RZSA 2X19A 2PE6B 3PWZA 5KNCA 5E4YA 3AZPA 2MR6A 3NS1A 4TQ0A 4FS3A 2YCBA 2H16A 3TQHA 3TS1A 3FOAA 3JQGA 2B1QA 5A9SA 4CFSA 2VPTA 4E0BA 1DEHA 1A8UA 1EVIA 3PXXA 3THSA 4E32A 3C5HA 1JCKB 4TV9B 2GAJA 3D3QA 2CSUA 3RNFC 1SHKA 2Z2YA 2FIDA 4IDDA 1R10A 1N2BA 4BVHA 1U28A 3I01A 1K8XB 2ECQA 4MGKR 2IDJA 4OO3A 5CA0F 2JVCA 3EXG1 4JLPA 4U9HS 3K9NA 2ZLBA 3M6XA 5BR7A 3GEGA 5CFNA 4G0OA 3DEHA 3T5BA 1AGXA 4B5KA 4F71A 1K6EA 3WK5A 2JB9A 1WSDA 4PLTA 3SQOA 2XGOA 2J9YB 5LUAA 3C15C 1P73A 1HYQA 4BP3A 2VHVA 5TT1A 3OJFA 4LDQA 1W1UA 4HRSA 1ETUA 3RBAA 4E5UA 3JAMA 4MW1A 2ZXFA 4D98A 1EX9A 5DNDA 3Q9LA 1Z33A 4L8LA 1BU8A 5AZGA 2OHVA 1N9GB 3PHHA 4OL9A 4J94A 3BTOA 1HFEL 1WCIB 5J2UA 3HKBA 4NCIA 4F97A 5ITWA 5KQSA 4BFZA 4H59A 4A6QA 5BUSA 1KAQA 5KO2A 1L4NA 5JS1A 5DM0A 4QOSA 4BPBA 5TEWA 2A59A 2KDIA 1YOBA 2JPDA 2CWWA 4FBJB 1A9QA 3L9WA 4M8IA 3WLPA 5L53A 1Y9DA 1CEEA 3LHDA 3K9HA 3TD9A 2C7OA 4UU0A 4UQLA 2LIVA 4FFPA 4J7UA 5K0LA 4BZWA 3IS3A 1JIJA 4W9KA 1G19A 1MG8A 2GBLC 4WNIA 4D4GA 3RARA 3MW8A 3SF8A 4TLEA 4WK2B 1PUJA 3UGBB 3O1LA 2J6BA 1ECJA 1F8FA 1KOTA 1OGJA 2P1DA 4MH0R 4JCCA 5FWAA 2IE0A 1RFAA 3RAEC 3K0CA 3TTXA 4RFLA 3HYRA 1KO7A 3PUJA 3HIZA 1YIAA 3ETGA 1MZPA 1MC1A 4WNAB 4I4NA 3DWIA 3OZFA 3FF4A 3ZWDA 4CKBB 3DM5A 2WW8A 4TWRA 3DOOA 1P2FA 5DOZA 3W2IA 2ZRNA 1RJ9A 4GX1A 1Z4KA 1E1LA 2JBAA 1RP7A 4C78A 1HQYE 1S2NA 5JE8A 1FNMA 4WZBA 1AWDA 2G0NA 2Q1SA 1X8LA 3OZEA 2HXGA 3ENEA 4IHAA 2GAAA 3NJ8A 4UM9B 4HRYA 1YBHA 3OPYB 3I5MA 4F7ZA 1AT1A 1VQ1A 5A7HA 3WQHA 4UZSA 1G21A 2VC2B 3FYDA 4BVKA 5CA1F 4NPNA 3D6TB 3SSMA 2NVUA 2FEAA 2NUBA 4L4YA 3UTDA 3FZYA 4AO6A 1ZPDA 2V0NA 4X7RA 1H23A 1YRWA 3HUTA 2FG7C 4B2LA 4ZTUB 1U7DA 5JAZA 3PEWA 721PA 4CLRB 4XOIA 3M1IA 4EY3A 3UAXA 3UXEA 4WGFA 1MGOA 5JFGA 3PE4A 3SSNA 4N5DA 3Q8EA 5ERXA 2ZS7A 2AN1A 2JFUA 2OR3A 1T1SA 3OMLA 3R0ZA 4FSXA 4HNRA 1TIPA 2JEYA 4AS3A 3NZSA 2QMOA 3LJKA 5BMVB 4F6LA 1HT0A 2AN9A 1K8ZB 3CR8A 3F7TA 2W37A 4UOEA 4PGFA 2ACZB 3AJEA 1N3YA 2XUGA 5EJ4A 5JCJA 3K9BA 1DT5A 2NT4A 1B1ZA 2AL6A 3T61A 4CWAA 2CLEB 1E6UA 1IL0A 3LLSA 3HNOA 3LF1A 2GK6A 5KJ1A 2MJDA 5FOTA 2DWCA 3EGXA 2E4AA 4I9HA 2JJ8A 3VR3D 4Z0HO 2PSSA 2VTDA 3QAQA 3TDMA 2D3BA 2YDYA 3VTFA 1P7ZA 3DBRI 2ZVJA 4M1SA 4LKRA 5CT8A 2IEAA 4AK9A 3ID6C 2ZDHA 3GY0A 2TS1A 3TFQA 1TPYA 3VR1A 1BXZA 4OY3A 5MN4A 3PS9A 1YB2A 2PGJA 3GPLA 5HF8A 3TLBA 1D2NA 3WNZA 2QL5A 3KU1A 1FUKA 4UUMA 1KYVA 3Q12A 4LRUA 4O63O 2ON8A 1IWBB 2AX4A 3ZKJC 2VRBA 1E2IA 4RSRA 2PW9A 1Z08A 2X15A 1CUEA 2NZWA 1BN6A 1XTKA 4XUCA 1U2GA 2GM9A 1F2TB 2GK3A 3FW1A 4FMPA 4HTFA 5KC9A 3IUJA 2ZT6A 1UAYA 3V05A 1LY1A 4INZA 4NFHA 3WAKA 1ADYA 4EARA 3EH2A 2EFYA 2PM8A 1FS5A 3TFOA 2YRFA 1JJ7A 3L7JA 1V5FA 1N8KA 1Q21A 5EOVA 3P9SA 1T4DA 4ES6A 3ZC3A 4F3CA 3NVAA 2Z2XA 4UQPA 4UBIA 4W9NA 2JLXA 2PZMA 5C8YB 3JWJA 4M83A 1MJGM 1I6MA 4QM7A 2WUFA 3JQPA 4EGSA 4KLNA 4DSTA 1R1DA 4CEIA 1FNCA 3HB5X 4Y6LA 2BSQA 1FRRA 2JFVA 1N5RA 4XJTA 2NACA 2KXJA 4B74A 1SB3C 3GJ0A 3GT7A 2P41A 3I73A 1L7MA 1IUOA 4WOKA 3OZTA 4O1IA 1E2QA 4Q3LA 2P7HA 2W6JD 1XPUA 3UMJA 1M74A 3MNFA 1EIZA 1EQ2A 3RVJA 3IAEA 4DVJA 2C0CA 1Z0UA 3OD5A 3G8AA 5J3JA 3T4XA 1F8UA 2V97A 4QL3A 4EI2A 2UYYA 2IYDB 2PT5A 3IH5A 1GCIA 3MQ4A 2DZJA 4LJAA 5CLIA 1L5HA 1P4RA 3RI3A 1FIUA 1OGYA 1QFZA 4IIEA 5L9AA 2KD0A 2AF4C 5K3SA 2B7BA 5K3CA 3ZHBA 2INGX 3IEUA 4MJSA 3IAM6 3DVNV 2N7JA 2BHTA 1IOZA 3FTEA 4C6RA 2K39A 1RM0A 5C1OA 2W4IA 1GRNA 3F1LA 4PO8A 1D09A 1DBWA 3ORSA 3BY4B 4TXLA 4J76A 4O4IA 3CPEA 2MWMA 1ZJYA 5IMSA 4GPD1 3IQZA 4KLAA 4LCJA 1U7TA 3RF6A 3KYCD 3MTGA 1ISRA 4U0KA 2QRNA 3RKSA 4Q02A 4UTOA 1C1XB 4PYIA 4GL2A 4PR3A 2BCGY 3ZNQA 4YMHA 3JSVB 2HK6A 4EHFA 5HKKA 1RQXA 1VE6A 3FCUB 2JS7A 3ML8A 3IC5A 2WIFA 5TF4A 1DADA 1JHRA 4TUYB 4TPKA 1OHHA 2LXNA 1T5DX 2AKYA 3U4IA 5L51A 1L7RA 3RRYA 3SXUB 5DYWA 3H8HA 1VJRA 3C70A 2XI4A 4U1RA 2RBGA 1SQ6A 4JE3B 2FLVA 3RIEA 2EARA 2GZHA 2PXCA 2I1KA 3B9JA 2HFKA 2Q5OA 2YEPB 1C50A 1BOFA 2F4VB 5HR5A 4W8OA 2QX6A 4BQQA 1N6RA 4RVGA 3TLXA 1CJCA 3GLHB 4FONA 4M9XA 2JI6A 1P7VA 3KHUA 4R2XA 3X1XA 4LA4A 4DIMA 3P96A 4ZJUA 2KB0A 2VJDA 4R8RA 4OHPA 1EQUA 5AI6A 3N2ZB 2KDEB 3PLUA 3QWBA 5LZ5A 2I1LA 5FBZA 2AOUB 2B7CA 3WB0A 1B73A 2BKAA 1EFPA 4IBOA 3WLTA 1EWYA 3JVIA 2P11A 5HF9A 3QW2A 2YDXA 3O7WA 3GD7A 2AE1A 1TYDE 5HQ3A 1E10A 1I1HA 3BJZA 2OGUA 2AWNA 2R1TA 5DBFA 3AESA 1DVRA 4JJ6A 1P44A 3LBNA 4HEA1 5THXA 1QO0D 1DIAA 3OCVA 2X5NA 1RWMA 4C1NA 2ZKIA 3ZV5A 4PZLA 1M0EA 1Y42X 2X14A 1XLUA 4MMXB 2EHDA 3QELB 3RFVA 5LJIA 1IONA 1ZCAA 2WK1A 4LDPA 4NEGA 5TB5A 2WDRB 3WGGA 5D7BA 4BNMA 4UXIA 2X8BA 2PJZA 4IMRA 1KPIA 3TSWA 2GZ3A 2H1HA 2ZG6A 1B2LA 1FU7A 3Q15C 4MNTA 4YALA 4MHTA 3HUIA 3W79A 5GGXA 3PVZA 2Q1TA 5DHFA 5BVGA 1R0XA 2J9FA 4Y0AA 1JEYB 5AW4A 2PWZA 5NLLA 2YVKA 1JXMA 1M2JA 1P0PA 2H4JA 2J7PA 4UOZA 2IF0A 2HJWA 2CF5A 1H0SA 1NNLA 3W5BA 1X42A 1L5KA 1W76A 3T5TA 4N0EA 3AVQA 5CVCA 1E2JA 4QRDA 4H0FA 1UBQA 3B1LX 4O6VA 3TF5A 3A4IA 4QOIA 3GEDA 3P9CA 3JD3A 3H83A 2W48A 2PPVA 4K7WA 3FWZA 2FUEA 4K46A 3S8YA 4C2AA 4ER0A 3I6IA 3DAYA 1KIAA 1NP3A 3M89A 5BSTA 1BD3A 4U2FA 2VJCA 5G53C 2HCBA 2I4NA 3OQHA 1X80A 3AKCA 2XBLA 4KH0A 3VAZA 1Q0SA 3KOZA 2V7TA 3NZEA 1TIFA 3BGDA 3QEMB 4TLMB 1YUNA 1OB2A 1MFWA 3HRIA 5ALWA 2WU2B 3QX1A 5J4YA 5A9SB 2YXBA 2DAJA 4OB7A 5EMHA 1ZEMA 4IJQA 1N4AA 1HOXA 3O31A 3HY3A 4UBNA 3M9LA 1MTZA 1NN5A 2HO5A 5BMOA 1M1UA 3DCNA 3U31A 1J00A 3KHSA 1XCTL 2QQ0A 3KEMA 4TM8A 3HDYA 1CRLA 3PHLA 5DP1A 1ZNXA 3FBTA 3CZQA 2Q5WD 1T5TA 5B1HA 1B93A 4ZOEA 3ZHYA 3R7AA 4W5OA 4C22A 1I4XA 1JG4A 3RN9C 2YZNA 4M54A 2IYRA 3ZDEA 1QZXA 1LBQA 3ESQA 3I2IA 2Y1FA 1K5DA 4MMZB 3D7LA 3QX3A 4C01A 4C14A 2R25B 4ZKDA 3U7QA 1L6UA 1VR9A 2A58A 5K6RA 3IB3A 2IOHA 4M88A 3R5XA 2C3YA 4PTLA 1HTTA 3HE3A 1ZIDA 4Y6RA 4BEVA 2ZZMA 2FQYA 4BLSA 4I1OA 2X40A 2NIPA 2FE4A 2I6UA 2BS2B 1KAGA 3V3KA 3M83A 1XZDA 5J2UB 3HKBB 3A6PC 5CVTA 2F8SA 4RZHA 3IEKA 1ZO8A 3VJKA 4TQUS 5EHIA 5JHGB 2FWAA 4N76A 1IZ0A 4AP9A 1PF7E 3U0VA 3PL1A 2MBBB 2VQSA 3KCQA 3KL2A 1UEXC 5BSEA 1RWQA 2AUNA 3EH1A 4B7XA 1VIVA 4JSTA 1FFXA 1DXQA 5KUTA 5DI3B 1RFKA 3IDFA 4YDSA 1EUVB 4PGMA 3AKZA 1I0ZA 1FRZA 3V2IA 4AX4A 2JX5A 3HA2A 5IBQA 3TRKA 2F17A 2TMKA 1O6CA 1IOLA 1WXQA 5CCDA 1YS7A 2NU7A 3TQCA 1ET9A 1ZOOA 1WM2A 3D0RA 4DJAA 2QY6A 5FUVA 1IUKA 2EMSA 4JA0A 4Q3BA 2D10A 5JHHB 4H18A 1KETA 2HBQA 4I08A 5L3QA 1NRXA 1PK9A 4PANA 3K4PA 4TKLA 1VHLA 3LQKA 2MIIA 5CB4A 1RJ9B 4M7WA 2CU1A 3N8HA 2IXEA 1SUSA 3ZE9A 2XGSA 4R1MA 3DE6X 3R20A 3ER6A 2WYUA 3CVXA 1ISHA 2G7ZA 3SSAA 1G6OA 2CFCA 3EIFA 2O0HA 3EDRA 3IB6A 2W2LD 1AQNA 5CM9C 2PKYX 4JWSC 3CT4A 2I80A 1YJ5A 1NBEA 2Q8PA 2VJBA 1XBTA 2JH8A 3EE6A 1CQPA 2ZRBA 4Z99A 3TE6A 2QLNA 3L8FA 5BOVA 2PRJA 3QOYA 4KFTA 4XDZA 1XVLA 4N0PA 3B38A 3ZD7A 3MTQA 5DBEX 2HK8A 3H2YA 2DNFA 5EKUA 3I1FA 3M6IA 3NDBB 3ZD9A 4HN9A 5BSGA 5H9VA 3KJIA 4L3WA 5DHPA 3IR5A 5DP2A 3APFA 3AC0A 4G56A 3OBBA 3SJCA 2DQZA 5E7IA 4UM7A 3T38A 3OE5A 5JPIA 1GG2A 2Y0PA 1A9OA 5LQAA 4L22A 1M0WA 4Y1FA 3ANYB 3OT4A 5CPBA 1KE2A 5SICE 1FMCA 1RDFA 4IWNA 4OVKA 2QIPA 1SQ0A 2DCUA 2HDHA 4CM9D 1I3OA 4D9GA 4JWKA 1SZDA 1MVOA 1MKYA 4QDXA 3IIKA 3WO1A 4N82A 1YJAA 3F5FA 3Q3OC 3WV5A 3ZBPA 1P0QA 1QIIA 1HXHA 1OZFA 5IZCA 2GCOA 1D6NA 3EHDA 3ZDBA 3ZQUA 4UTNA 2O8FA 4PU0A 4D25A 4ENPA 5JXVA 4YR7A 4DHJB 4YRTA 5HNKA 3E82A 3WSTA 3VV2A 1CCWA 4P1CC 1ZI6A 3ON5A 4BEBA 4YFVA 4N48A 3I0ZA 2BC9A 4Z4GA 3PHXB 2C4MA 3KLMX 4RYDA 5E6SA 3ZPXA 3QPUA 3REGA 4OBEA 4N58A 4KP7A 1QRTA 4CM6A 2DM6A 4JI2B 1I5OA 4QT0A 5I7RA 1RW4A 2GVDC 3WGQA 5CEJA 1KRXA 2CE2X 1ZCZA 1N2SA 1E3WB 4KMMA 2GZ2A 3OQVA 1K51A 4EHNA 3DV9A 4ZICA 4MYCA 2XGMA 1JNYA 3R4VA 2QORA 2IYEA 4ECEA 4DXFA 4UAGA 2BH2A 4ASUD 2Q0XA 4D4MA 2XMBA 1OVMA 2VSNA 4IS3A 5TX7A 2MT9A 2WFLA 3Q11A 2W42A 5HA5A 3V8NA 4DDVA 5A2GA 1QK3A 3CVJA 3L0SA 1ZVMA 4J3FA 3CU5A 1E1NA 4HTFB 3RTGA 3T1OA 4RD6A 3KWJA 2RHDA 4IYJA 4NABA 2FZEA 4FHEA 1LWOA 2QTNA 5CJPA 4LTNA 3FYSA 4OFZA 2FX3A 5K3EA 3Q8WA 1AB5A 3DVQX 2Z6UA 3PC3A 3U7DA 3WGTA 3FCYA 4GZ5A 2CXHA 1T4MA 5IDYA 4I19A 8MHTA 5EY5B 4AF7A 4WCDA 2VI5A 3OUZA 4HNTA 5KB3A 5H80A 2XE4A 1E9CA 4LSWA 4WZBE 1P18A 1QV7A 3OZSA 3GA5A 3L01A 4ZJYA 4C5AA 4NZOA 2CHGA 1QH8A 4NYJQ 4CEIB 2FJPA 1GAQA 4MWBA 3HMKA 1Z2EA 2D1FA 1Q14A 1HEYA 1QRUA 1GKYA 4GE3A 4QSMA 2OM6A 1USUA 3VAWA 2HA6A 2GHTA 2YZ7A 3WBKA 1G21E 3KJXA 2V6IA 1LQTA 2G67A 1SSNA 1QNLA 2X41A 2V9CA 2Q99A 3IP9A 2OB1A 3H1GA 3PD7A 5BSWA 1O95D 3HGMA 1VECA 1Z12A 1NW7A 2L05A 4NCAA 3QYPA 1LBTA 5JTTA 3QEKA 4A8JB 1L5HB 2FWMX 2VDPB 1TUBA 5TR9A 1F14A 1GL7A 3IA2A 2EBFX 3CCFA 1PBNA 2B82A 4DCVA 1ECPA 3OFKA 4LGVA 1MHPA 5CNKA 2OXEA 4OMUA 2YZMA 4Q1VA 1YMQA 4JZYA 4QHYA 4RFSB 2ZRMA 2ISSD 1XMPA 1JGTA 3Q8MA 4O4IB 1G60A 4ZQIA 5ALMA 4KG7A 2XCTB 3H1TA 3F9IA 1KJJA 4XE5A 1JG6A 1A69A 2JRIB 3DVGX 3LBIA 2HPAA 4EHIA 3ZE7A 1NMZA 1ZH2A 3N8DA 5E6NA 4ENSA 4O0LA 3UT6A 3MSXA 2OFXA 2QZ4A 1QBKC 1WMSA 1QHXA 1CQVA 1U3FA 1MQ9A 2X1MA 2RGWA 4Y2GA 1O6FA 1GUBA 4EVRA 4ND7A 4DG9A 3I6ZA 2BJHA 2W93A 3A1NA 1H0RA 3VR4A 3QG1A 2IUTA 3JR7A 3H5LA 2SICE 4MVCA 4HS4A 2WIDA 2F8TA 2QPLA 1U4AA 2FPMA 1SY7A 1K50A 4H9GA 4MSQB 4YV1A 2BT4A 4IV8A 3V6EB 2O7SA 2KMLA 4FN4A 1NR7A 2TSSA 1NZDA 2WDTB 1D6SA 3Q7QA 3NIBA 4FFLA 4GLFA 4DBGA 2NG1A 1K63A 3H2BA 4BHTA 1TTPB 1GOZA 1Q1OA 3QVWA 1WXDA 4NK5A 4ZU1X 5J43A 3M7IA 3CONA 2VYCA 2O9JA 2HF7A 3P32A 4JX8A 5DGXA 1BEZA 4DOMA 2QLJA 1NKSA 3WANA 1F6WA 4S3MA 1Q12A 4XWTA 2BB6A 4CE6A 1R8XA 4K05A 4CKWA 2YWCA 4TV9A 1M4VA 1F06A 4BMPB 2X8XX 4KUHA 4D56A 3FH0A 2EFCB 4ZAZA 1L5LA 3W5SA 4AICA 4AXBA 1UKBA 4D3XA 3FZEA 5KJ6A 2R1TB 1HC7A 4EATA 3DHHC 3AESB 2XUKA 4KWIA 1UXHA 1KY5A 4EMSA 2PE9A 1PYDA 4DUGD 3UC5A 4FOPA 1NE2A 3BMOA 1F17A 1OLXA 2R85A 1QCDA 1K5PA 1FX1A 4ALLA 3TG2A 2WQ7A 3L7NA 1QCYA 3TXAA 4JXKA 2I4TA 2NOAA 4M9QA 3OOWA 1NJSA 4J4TA 3UAGA 1LNSA 1JLRA 2AEMA 4ZAFA 2TMGA 2XADA 3EC1A 2NZUG 1ITZA 3LZDA 3OZDA 2IGBA 2HRCA 1RRKA 2V7QA 5TQ2A 1JDBB 2NM0A 3RUFA 5C31A 5BVGB 1E3SA 4OAPA 3DUFA 1VG8A 2J9FB 2I29A 1WCIA 5JO0A 2KLCA 3ITDA 1D1SA 3WL8A 3N28A 1QF9A 4IOIE 4U63A 1RYDA 1AKVA 3VDMA 4C07A 2Z08A 4XWKA 5TEVA 1EWKA 1WU7A 2J0MA 2XQIA 3TECE 1EINA 2Y1LA 4BKQA 3ES9A 1NXXA 1YRAA 2YFYA 3AT1A 2GGSA 3AZQA 4YMWA 4Y2RA 3U80A 3II6X 4INPA 4KGZA 1TB4A 1VPLA 3HFRA 1WRBA 4O4LF 1WSWA 3DZCA 2OENG 3QSGA 2DUJA 5JBQA 1X80B 3JRWA 3D2BA 1TYBE 3ROGA 5WRFA 1IIBA 3USCS 1Y98A 5DYYA 1J2EA 3QP9A 1K1EA 4OI4A 1CEQA 1HZJA 3TIFA 1H9AA 3WBBA 4CKBA 1HE4A 3HB7A 4TTAA 4MQ5A 4UTXA 3EXG2 4V0ME 1E6KA 2YY6A 1G4HA 3GCXA 5U1PA 2FEOA 2EP7A 1DOXA 2QMYA 3TNLA 2JYEA 1NVBA 3B5IA 1IGCA 2W3RA 4IS2A 3NDRA 5CHWA 3K4HA 1GDDA 2IOFK 3RTBA 1GPWB 2CXSA 4Q4HA 1ZIPA 3KYDD 2GJSA 5JECA 1PFYA 3LF2A 3H2JA 1QYIA 1E7QA 4OU5A 2MWSB 2YICA 4FUQA 1JWAD 3RABA 2NO0A 4FBMA 4S1NA 4PHGA 3ZGLA 2QM3A 4ZHQB 3IJEB 3U7QB 1O6BA 1Z13A 2V59A 3IUBA 2YWJA 1NQ5A 2EWMA 1V2GA 3SOPA 2YS7A 3VSBA 4HSGA 3ROPA 2BKXA 4C06A 1WZIA 2CEKA 1U7WA 3HUFA 4RKFA 1ORVA 4CT5A 2VTEA 2V7EA 1XQXA 3DHNA 4BO5A 4CG1A 5BV7A 1PG2A 2JJ2D 1SMKA 2TMYA 3RG2A 5BUZA 3H18A 1V49A 1P0IA 3OJ0A 2G70A 1P91A 1JFSA 4WLVA 1NTRA 1Y6RA 3UUEA 3HDQA 4MGZE 1RJEA 1E2NA 4RBNA 1N5XA 5BSVA 2FUKA 4K8RB 5BMVA 4MW7A 4CM1A 1FFXB 4LWOA 3EMVA 3GCGA 2I2WA 2FGJA 4RL4A 1ETHA 1YVRA 3W2HA 2WSBA 3FXAA 2IHJA 1NLZA 1VL2A 3OE4A 4UNPA 2XDAA