4A9AA

Structure of rbg1 in complex with tma46 dfrp domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
368
structure length
356
Chain Sequence
b'STTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRRELLTSGAGIGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIIDGGRGKQVIAVARTCNLLFIILDVNKPLHHKQIIEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEASSRRYMPAIYVLNKIDSLSIEELELLYRIPNAVPISSGQDWNLDELLQVMWDRLNLVRIYTKPKGQIPDFTDPVVLRSDRCSVKDFCNQIHKSLVDDFRNALVYGSSVKHQPQYVGLSHILEDEDVVTILKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME-INTERACTING GTPASE 1
publication title Rbg1-Tma46 Dimer Structure Reveals New Functional Domains and Their Role in Polysome Recruitment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 116
structure length 356
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF02824 TGS TGS domain
A PF16897 MMR_HSR1_Xtn C-terminal region of MMR_HSR1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a9aA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a9aA02
4QJ5A 2OE2A 4Q1CA 2X8AA 2YVUA 3GD7A 5KUTA 1UBGA 2LCFA 1E2JA 3QXSA 3NTUA 3DOFA 4GBMA 3W3ZB 1KK0A 3AMZA 3I92A 5CK5A 4Q1DA 1R5OA 1NMZA 4W5JA 1VCOA 5FBRB 3SJAA 5IHPA 3NDBB 1AYFA 1SULA 1R8QA 2C9YA 1DE0A 2WV9A 5DN6D 3GLIB 3ASYA 1FO4A 5H8YE 4M1YA 4FMDB 3BB4A 4LJ9A 1FXAA 4G5GA 1GRRA 2R6CA 2ZJYA 1BS1A 2FFBA 2FPLA 2ZSBA 3DHWC 2DB3A 3R9XA 2BC9A 1E2GA 1G9XA 2UZIR 2AFIE 3DKVA 4PHFA 4LOAA 1X3SA 5KTYA 4HRSA 1VDVA 1NN1A 4G5RA 4HUQA 1XMSA 5FOVA 4JL6A 2J9RA 3C16C 3K70C 4A8JB 3Q8XB 5KNCA 4RD2A 3AVTA 2V54A 1CP2A 4NKRA 3AEBB 4RFVA 4KCGA 5GJCA 3U61B 2HDNB 4YMUA 3B7GA 4YTNB 4MUAA 3EPJA 3SN6A 3AVXA 3WRXC 1P60A 4XVQA 2EWWA 1OFUX 2BJVA 1IOZA 1TQDA 5B58C 1FW6A 1MKYA 3LBNA 3NC0C 1F5NA 4PC3A 1XB2A 5FTKA 4IEIA 4NZYA 2BDTA 4AWXA 4ZCMA 1WB9A 4LBYA 5J4HA 2IBMA 2BIFA 2WSSD 1IBRA 2HLDA 4BRWA 2JLZA 3ND8A 4A9AA 4TMKA 1G3MA 1JQJC 1TEVA 4RD0A 4TYQA 2BS2B 2WU5B 1XDBA 5DNYB 3ETRA 5F98A 3W6OA 2WWGA 3GMTA 1CU1A 2GEUA 1IY0A 2QG6A 3ZDQA 4YSZB 1E94E 2CL7X 3AN1A 1A82A 3NEJA 5DI3A 4R2IA 5KSPA 3NBZC 3SR0A 3RABA 3B60A 2WIBA 1PV4A 2A7QA 2H92A 1IM2A 3DZDA 3TK1A 2CJOA 1G7TA 1LB1B 1VDZA 2XSZD 4LPSA 1SHZA 1NG1A 4KXFB 1RVDA 1W4RA 1P7CA 3N5CA 4JLMA 1QOGA 2W83A 3LFUA 4IEEA 2BMEA 2XXAA 1OSNA 4Q66C 1QRAA 4WW0A 1KO1A 2NOAA 2WWXA 1J8MF 4LYAA 2EFCB 2B6HA 3TSOA 5AUPB 1FUUA 1E0SA 1NJFA 1OFIA 2QSYA 1KKMA 4D0NA 4E5UA 2B76B 1LW7A 2Q0HA 4P6VF 2GCNA 2TMKA 3QKSB 3AEDB 1CTQA 4L9SA 5C3JB 4TT3A 1FZQA 1YQTA 1Q1QA 2ZE8A 3LA6A 5E3HA 4HROA 1Z06A 3O8RA 3TQCA 1FMJA 2JX5A 2R6AA 1UKVY 2ZANA 4HLQB 4TLDA 1A5TA 3KQNA 5H92C 3THWB 3L8ZA 1EWQA 3UMFA 2G1KA 3R7WB 4MKHA 4Q4AA 1NRJB 2HT1A 2PEZA 3FFAA 3W3AA 3UATA 4TL9A 3BFVA 3QSYA 4KODA 1G16A 2VTKA 2GAOA 2R8RA 4XSHA 2IWRA 4M8NE 5HZKA 2E3TA 1G41A 4HZUB 3UKDA 3WYFA 5K8UA 1I4LD 1JR3E 1LV7A 1VG8A 4L15A 3ICQB 1NN0A 2BCJQ 4FMCB 1Z2CA 2FEMA 1AQUA 3B78A 4CEHB 3KDSE 4WZBE 5CJPA 3RPFC 1RE0A 1CKEA 4I1SA 2IYTA 4Q5IA 4CVNA 1QHGA 1HE1C 2ORIA 2P67A 5SZIA 5LD2B 2WTUA 1G7RA 3QQ5A 5AJXA 3I62A 2QP4A 4D0LB 4UNQA 2JASA 2DR3A 4F4JA 3QBVA 1Z83A 2XJ9A 2WBLC 2OO7A 4QOSA 3RRMA 1XTQA 2VP4A 5EZ6B 3TJZA 2MMCA 5CIWA 3EA5A 4C0QC 5HPYB 1VCMA 4JBWA 4DLZA 4US9A 5GVSA 3AKEA 4M1MA 4C0AC 3UMRA 2J46A 1Q21A 3LLUA 4KSBA 1FQKA 4X8LA 4JWSC 4F7WA 3EPHA 2KAJA 2BM1A 3K8YA 2Q6TA 4Z8YA 2NPFA 2M56B 2V7QD 4GDFA 1G6HA 4B76A 5EXTA 4CEJA 2F43A 3NKVA 5IF9A 3RS3A 3BH7A 3LY5A 3GPLA 1M34E 2QAGA 4BFWA 4DT1B 3BB1A 2ZRAA 2ZJAA 3AGPA 1YR6A 2DPXA 3U3KA 3U7GA 2EU8A 1EG7A 2EFDB 3SDZA 1F2TA 4ZHOA 5KYKA 5JI3E 2G88A 4OQXA 1YZGA 5FPSA 1BMFD 2KBFA 2QA5A 1OIWA 4Q00A 4TMTA 1T3LA 4Y0AA 4GOXA 4GMXA 3HYTA 2KMMA 4BGDA 5G5GA 2CEAA 1MRSA 1TU3A 4LHXA 1E2NA 4C0SA 1JR6A 2KBEA 1YU9A 4Q4HB 2OSBA 1QF6A 1KI6B 4GFDA 3TVDA 1OXVA 5JS7A 1P62B 1N6PA 1GNQA 3R9IA 1FP6A 4MGYR 1SF0A 3P4SB 2H5EA 4ON9A 4ZDJA 2WWIA 2GBLC 2VP9A 3TE6A 1LFDB 3TKLA 2OT3B 4XD7A 2C04A 5DSZA 1M7HA 1Q22A 4URVR 1KI9A 4KLNA 1N6HA 3K0EA 2AWOA 3T61A 3PO0A 3AP1A 2OBMA 4WA7A 4Q9HA 3QY0A 1CJTC 1XJCA 1G8GA 2X77A 2YINC 4JWUC 1CIPA 4G5SA 3I8SA 4ZV4A 3CLVA 3ADBA 1NP6A 1BIFA 3R20A 2NO7A 3UXMA 2OCPA 1L0VB 2B8TA 1K5DA 3CF2A 1GITA 3AM9A 2WJGA 3M6AA 1SGWA 2Y8EA 3QUSA 4A2QA 3IHWA 2QP9X 4P32A 3Q7QA 3MMPA 4NYJQ 3X1DA 3SE0A 3CONA 4LHZA 3B1YA 4D4KA 1P9WA 3A1SA 3H84A 3QE0A 1ONBA 1CR2A 2A30A 4LUCA 3WP1B 3A6PC 4ASUD 3VTKA 4IFEA 5CYPA 2W6JD 3Q85A 2YKGA 4FCVA 2AKAB 1T3QA 4LYHA 1S1CA 1JJVA 2OCAA 5FL7A 2HF9A 2QQ0A 3PXGA 3MWYW 3W6NA 1KHTA 4DHEA 5A0FA 1J7CA 5JWOA 2PEYA 2W0MA 1ROEA 4JLPA 5CK4A 3WNCA 4IRUB 2CJWA 1DARA 3I73A 4PC2A 1E9CA 5TB5A 3SQWA 2VP6A 4I1OA 4ZDIA 3D31A 4HLCA 3HU2A 5DYIA 3CM0A 5H1YA 5JZVA 4MA4A 2GXAA 4QXAA 4GOJA 1DAMA 2LEKA 2IF2A 2RGAA 3DO6A 2QUZA 3I32A 4PQFA 1ZC3A 3GEEA 1CLUA 2QU8A 4DVGA 3HU1A 4YONB 3GFTA 2ZI5A 5FUYA 3ZVLA 2NMVA 1EXMA 1PJRA 1L4UA 1H8HD 2MJEA 3DZ8A 1FP7A 3P4XA 2BV3A 4L9WA 4LPKA 1E2EA 5J4LA 1XXHA 1VCIA 4HYYA 4JKIA 2FV8A 1XD2B 1P2VA 3IKJA 3TNFA 5TMPA 1G291 1KK1A 3LX8A 3OEHA 1TF2A 1F2UA 4R98A 4D82A 3EZ2A 4KX6B 2XOKA 3VNUA 2WS3B 2A5JA 1N63A 5AJYA 2C95A 3EA0A 5KPDA 2FGKA 4B44A 3TUZC 3DMDA 3FVQA 3N70A 4A8JC 3TR0A 4HB3A 3I4LA 1DTSA 2MJ3A 3L0IB 3VKWA 4C7OA 3FMFA 4KFTA 3GLFE 4KFSA 3WNBA 2ZRFA 1I2MA 1XNJA 2VF8A 1D2MA 3AEEB 1E9SA 3AVQA 2IF0A 5F2EA 2QSZA 4LYJA 4NHOA 4XTRA 1E4YA 3CX6A 4DLYA 3I8XA 3HUIA 4DCVA 1N5KA 3NDPA 3MAAC 3OFNA 3EC2A 1N0UA 5CJ2A 2WIAA 1E9AA 3U7FB 4QNMA 5G3YA 3HPRA 3W90A 1TMKA 1E0AA 3AKDA 4AC9A 3GLHA 4OHXA 3NS1A 3RRZA 1LNZA 4FXCA 1V97A 2Z5FA 3TW4A 5L3VA 2FPMA 2WJJA 2IYSA 4MKIA 4MDEA 1HT2E 4DSOA 2CK3A 4IXMA 3L8YA 4JMPA 4RCYA 3BD9A 4XSGA 2GZHA 4FMBB 1WRIA 2ODBA 2QNRA 2CXXA 2ZE6A 1Z6GA 5K8TA 1OFFA 2JLWA 3B2GA 3RLFA 3QKRB 3VR5A 3HP1A 2DWOA 3KZ1E 2MJDA 3NVVA 3NH9A 4B48A 2A78A 1FX0A 4CW7A 1AZTA 2OFWA 5IK2A 1UBFA 1YHNA 5E7IA 1KO4A 1N0VC 2WWWA 4N58A 3C8UA 3LW8A 4A82A 5FBLB 4LK2A 4L5BA 3SC3A 4W5HA 3REFA 4BZPA 1D8TA 4W9MC 1ESNA 5JEEA 1DPFA 2F7SA 3A1TA 4PAQA 4V0ME 4LV8B 1QHSA 3KKMA 4EFMA 5LDDC 3ICEA 1MABB 4QJ3A 2R9VA 2YOHA 4TQAA 1UEJA 2AFHE 1XRJA 2YNMA 4UNPA 5CYOA 3IILA 1R0YA 2FFHA 2O52A 3PVSA 3OIUA 5G5HA 1W5TA 3L43A 2ZVPX 3N2EA 1CJMA 5HCIA 1XWIA 3B13B 3JZAA 1W0KA 5KSZA 2BT6A 4PHTA 3W5VB 4HB4A 2NO9A 2X2EA 5FPYA 4AYTA 3NEYA 1KJWA 4AKHA 2PBRA 1JEDA 3KL4A 3KJGA 3LBHA 2V9PA 1OYYA 3GLGA 1RPZA 4EPXA 1NN3A 3L82B 2HT6A 2FH5B 1ZIPA 1DAEA 5E7JA 3B9PA 521PA 2ZRMA 4KO8A 4M9SA 3TH5A 4C3ZA 1E2PA 2OCBA 4EKDA 1WYGA 4NU0A 5LD2C 1N0WA 4HAXA 4M21A 3SYNA 1BH2A 1E9FA 1JR3D 2P6UA 4QBGB 2AK2A 2VSXA 4R7ZA 2V3CC 4WIAA 1NN5A 2IUSA 3P63A 1XPOA 2X19A 1GZSA 4LBWA 4WXPA 2CNWA 1NIPA 4NCNA 5HTKA 4EUNA 1EESA 1U8YA 2IXEA 2JJ1D 4QM6A 2GILA 1G8HA 4PAMA 2Q9AA 4EQ6A 4US1R 1Z63A 4HDQB 3A4LA 1E2FA 1QHHB 1E2IA 1OXSC 1PUTA 1JBKA 2BVNA 1ESMA 1NBME 3RYTC 4KYIB 3WP0A 2BKEA 2XTZA 3BH0A 3AV8A 5BYJA 4CDGA 2PT7A 2EFGA 3JVUA 4LJ8A 2CDNA 1SXJA 2QENA 5FI0B 4I1VA 4PHHA 1LY1A 4OI2A 2OBLA 3FB4A 4QM7A 2GCOB 1N3BA 4MGZR 4O2RA 4AKIA 3KUDA 4LZZA 3QPUA 3AE3B 2QTFA 3CZQA 4PAOA 2O8FB 1CRPA 2NG1A 2IYWA 1SKYB 221PA 3AVPA 1Z08A 1OXTA 3TQFA 1QVAA 4OK6A 3AEZA 2BS4B 4TMVA 4DJTA 2N1BA 3VX4A 4EFLA 1Z28A 2FN4A 1WWTA 4A0HA 3W8RA 2J7KA 3CRVA 3M1IA 5HCNA 2J7PD 4OHVA 1W36C 1MRNA 4ZI2A 3OE7D 1WDTA 3GCGA 4MKFA 1G5TA 1KDTA 3FHCB 3T1VA 4ARZB 4KV9A 1LS1A 3U3MA 2ZAOA 1VPLA 1X1RA 2O8CA 2R6FA 5CDFA 5HKKA 4XWAA 1RM6C 4A6PA 3CNOA 1G7CA 5EE3A 1DO2A 1N5XA 2CVHA 5GXGB 4OQMA 1HEIA 4MGIR 2OFOA 1UWMA 4E07A 4D4LA 3T5DA 3TBKA 1U9IA 3FTQA 5AUNB 3ZLJA 1AWDA 3RAPR 1HQYE 2ZJ2A 4LX0A 2BOVA 1GG2A 2PJZA 5AK0A 3SJZA 1Z2AA 1Z0DA 5AJZA 2RGXA 2WAYA 4M4SA 2P5TB 2QRZA 1L6VA 1E9MA 4PHGA 4PPQA 3EZ9A 4AYWA 2C96A 2X2FA 2O8DB 2GK7A 1RJ9B 3ECCA 4IDPA 4Q7KA 2PZEA 5TARA 1VJKA 4TWZA 4ABYA 4Q4JB 3DM9B 3H4MA 3L2OB 4UQOA 1XLQA 5FOXA 4BFZA 2K5UA 3KJHA 1QG4A 4GSYA 3QEOA 3A37A 5DN6A 2WDVB 4DKXA 2ZSAA 4M9XA 3D7MA 4NCHA 3F3YA 1XP8A 3K0FA 4Q02A 4M0LA 4UXIA 1VYVA 3H1TA 2VLIA 4MUBA 1QHIA 2ZEJA 4A2PA 1N5JA 2DFKB 1YZKA 2Q5WD 1UKZA 4Q19A 2BEJA 3RDPA 2K9XA 2GWHA 4I4LA 5DHAA 3HWSA 2VH5R 1IN6A 2FNAA 1AQYA 2CE7A 2CL0X 3UG6A 5JJLA 3F0TA 3FMPB 2WMOB 4JL5A 3VQTA 4EPRA 2OUKA 2CLCX 3VR8B 2W00A 2GTPA 5L3RA 5JLJA 1JROA 1S4QA 4EAQA 4O0MA 3LAWA 1YRBA 4WWMA 3U4QB 4PFSA 2FEOA 5EXSA 3P1JA 3AF1A 2FF7A 3MD0A 5L3QA 1FQJA 2ORVA 2XNDD 4LHYA 3QF4A 1PDXA 3AB3A 2G83A 4LTUA 3FHTA 1TL7C 3PQCA 1T0JB 3QKTA 1RFLA 1D6JA 1X8LA 2OBNA 4EPYA 3THXA 1SHKA 4HUQB 1QDEA 4A36A 2A5DA 3A1UA 4V0KA 4XJXA 4C0HA 3AKYA 2IYVA 3ABVB 1TU4A 1T0HB 2REBA 4BE7B 3J81k 2RGCA 1ZP6A 1OB2A 2IK8A 4BEJA 1JPNA 3V00A 1P4SA 5SZHB 2EFHB 4M1SA 1E2KA 4XH9B 3HPQA 5H70A 2BMFA 3Q3JB 3MFYA 3PEYA 3ZYYX 4YMWA 4B2IA 1DEKA 1TF7A 2PH1A 4B6EA 3C41J 1QOBA 4GI7A 2GJSA 3O8DA 5C46F 4TTRA 2XSZA 2JLXA 1DBSA 3CIRB 4Q1BA 4V0LA 1G3RA 3GJ6A 2KWIA 1GPXA 1QG2A 2GEDA 3S1AA 3TAUA 5KDDA 4U7DA 3PR1A 3IPXA 3SJBA 1H65A 2BHRA 2C03A 3IHLA 3H86A 2GJAA 3DL0A 1YJJA 3Q9LA 4XOIA 1RC8A 1U0LA 2JLSA 5FL3A 4RD6A 1FRRA 1R0XA 3Q7PA 3IPYA 5K8LA 5P21A 6Q21A 3CKLA 4GT1A 3I5XA 2HV8A 4S35A 5DI3B 1QHXA 2JLRA 2ZJ5A 1KSHA 2FG5A 2ONKA 3QBTA 1AS3A 5M04A 3RNLA 1KK3A 3MLEA 3BK7A 2N0SB 2EFEB 4LJ7A 1OKKD 2FU5C 1FNMA 4IKEA 3A4NA 3NXSA 1Z6TA 4M1WA 2C99A 1E2DA 2IYZA 1JNYA 2JDID 3PG5A 1EGAA 3OAAD 2FSGA 5FR1A 2ZRCA 2FJUA 2Z4SA 4A1FA 1GFIA 2QAJA 2O8BA 2PIAA 1J7KA 2OZEA 2Z43A 3AP2A 1WQ1R 2G1EA 2AN9A 3VR4A 3BC1A 2ZYVX 2IUTA 3E5HA 4E09A 1S3SA 4JLKA 1JW9D 3U6BA 3K70D 1CEEA 5JCPA 4M22A 1YE8A 1D2NA 2AWNA 4HAUA 5ELXA 4O2LA 4Q4AB 1RKBA 1TPZA 1XEWY 2IYXA 3B6EA 5CLLA 1RIFA 5JJIA 3WCQA 2Q9BA 4DSTA 4ESVA 1XO3A 1CBUA 2QE7D 4RKFA 2NQ2C 3MSXA 1TQ4A 1QT9A 1AZSC 1GKIA 3U3OA 4C2UA 3P4PB 2HEIA 1RYFA 2WSMA 1A1VA 2Q3MA 1Q1BA 4FXPA 3TVTA 2QY9A 2LKDA 2RGNC 1CR1A 4A15A 3TMKA 1TQ6A 4WVFA 1DOIA 3CWIA 4BFUA 1Q3TA 2WJVA 2ZVQX 2CL6X 4AI6A 4ZCIA 3FMOB 4ZOHC 2FSHA 1XPRA 4V03A 3KWLA 3FC4A 1T9HA 2JJ8A 4D81A 2PLFA 4DEYA 1U90A 3QEJA 5LB4A 4L4UA 1KMHA 2VEDA 4DIEA 2AX5A 2BBSA 2WOJA 2QMUA 1BMFA 1G18A 3O8BA 4KSCA 1EWRA 1SB3C 2IYUA 4PANA 1QF9A 2WDQB 1XMIA 1BKDR 2HJGA 1NVWQ 2Z4RA 3LD9A 2R6DA 4DUGD 1W44A 4CEJB 2XZOA 3NRZA 1HH4A 2REXB 1DG3A 4IDNA 2VHJA 1AKEA 2QAGB 2WPDD 2WU2B 3GJXC 4M9QA 2ASEA 2VPPA 1NNEA 4JKYA 2Z6VA 3T1TA 1NBMD 1ZM3A 1F2TB 2O8EA 3W5UB 3DPUA 2M19A 5JRJA 1W49A 5JSZA 1RYJA 3AKCA 2V55B 5D3MB 3TRFA 1Z6YA 2AXNA 4IVPA 3VAAA 3TSWA 2BCGY 3IIJA 5SZKB 1KY3A 1UDWA 2IEZA 3THYA 2DBYA 1N6OA 3P27A 3NBYC 5UKDA 4JT4A 3ZVRA 1LVGA 4AK9A 1GL9B 2CHGA 3AE2B 4NYIQ 2UKDA 3BXZA 1Q1EA 4Q9KA 1LS6A 3CR7A 2J87A 2D74A 2QZ4A 3KJIA 2CVFA 4P4TA 4MDFA 2RB4A 1G3IA 5JI2E 1GKYA 2CJNA 4YDSA 2IC5A 3X1ZA 2J3EA 4Q48A 5FTLA 1XZQA 1G8FA 1F48A 2H7VA 2P65A 3K0CC 2QPAA 4B3DA 4HAWA 1G17A 5KDOA 1N5WA 4B3GA 5L3SA 1R7SA 1JALA 1AGRA 2ZE7A 2XAUA 3BRWD 2YC2C 2FZ4A 4YMTA 5CM9C 1DOAA 4L16A 1E9RA 1E1RA 3CR8A 4A0GA 1KMQA 1R5BA 2ZYWX 4GL2A 2J0UB 1E2LA 4ASUA 1P72A 1S2MA 3GLIA 2W6JA 3SNHA 3W5JA 3ZVMA 1ZU4A 4CIDA 4PO1A 2WKRA 1II8A 3B1ZA 3C5HA 4FD2A 3ADCA 2ZROA 3VR2A 2PCJA 3LB8C 4NCIA 4D26A 3T1OA 1OHHD 2RHMA 5AUKA 5F9HA 3B1VA 4DC9A 5JEDA 1KJYA 1K6MA 3LWNA 4C0JA 3K9HA 4Z51A 2JCSA 2ZSFA 2QQEA 2CHQA 2WJYA 3WBKA 3AUXA 5CB8A 1GUAA 2V6IA 2XTNA 3AE5B 4URYR 1VHTA 3LXXA 5JWRA 3BJIC 3NH6A 1CJKC 4KFRA 4C0KA 2WZQA 1A7JA 1XJQA 1ZUD2 1VKJA 4LHVA 2RGEA 2W55A 4LJYA 1WGKA 1KIMA 4NDZA 3SBDA 1H8HA 3K0AA 4TN1A 3ZJYA 4LBZA 2CLDX 4B3CA 4NBSA 4GZMA 1YZNA 4AIIA 4MH0R 4AKEA 1E98A 1CRQA 1EFCA 1ZNWA 3LXFA 1Z47A 4RVCA 4CZ2A 3ZIAA 2A5GA 2CCKA 4DLUA 1XU4A 1GSIA 3ADDA 2QROA 2I4IA 2OAP1 3FWYA 5LPNA 1N25A 4MRSA 1MO5A 1IUEA 4A0FA 4GOKA 1WA5A 4RZ3A 3DEFA 2AXPA 5A5GA 4LJ6A 3RWOA 2ZJ8A 4PQRA 3WHKA 3BIID 3U44A 4QBHA 3VKGA 4C0BA 4KAXA 5FR2A 1FFVA 4XWOA 2PT5A 4EDHA 5BN3A 1XXHB 4PTLA 1RZ3A 1YZLA 2GJKA 1BOFA 2LWIA 1W36B 1GNPA 1F2UB 2ZJBA 1KKLA 2ZR0A 1VECA 2MSDB 1JWAD 3SHFA 4G01B 1Y3AA 1N6RA 4C7ZA 1KDPA 1IN8A 4A0RA 1E1QD 4MYUA 1R6BX 1L5PA 4XWKA 4N6EB 1NJGA 3IIMA 3GEHA 1X1SA 4Q01A 2NGRA 2VP5A 3R8FA 2CLSA 4QHSA 5A4JA 2EKIA 2IHBA 1YZQA 2PZFA 3QXJA 1COWA 1YKSA 3REGA 1SIJA 2XITA 4TLAA 4POAA 4LI0A 4TL7A 5EQTA 1OQRA 1T6NA 5EZ5A 4BZQA 3P4YA 4RZXA 2D2FA 4BLSA 1VHLA 3GLHB 4US8A 1HTWA 1GL6A 2CU3A 2CBZA 4MRVA 3RRYA 4LJAA 3ZYCA 1L8QA 3L4PA 4UKDA 5BN4A 3C7KA 1DAKA 1ZW6A 5FI1B 4AD8A 2AL7A 3R8CA 4HLUA 4YXWD 4M2LA 3ND9A 2HCBA 2H1LA 1E6EB 4CYMA 4IDQA 1RRFA 4TT3D 1Z5ZA 1NI3A 4X8OA 2IS4A 1S8FA 3NWJA 4DDUA 1S3GA 1E2MA 1XCPA 1FX0B 2ZAMA 1AA9A 4IVQA 4QL3A 1S0UA 1Q0UA 3BERA 3LRPA 4EJSA 4PXAA 4N1AA 4ZPXA 3CWZA 1OYWA 1L2TA 5CB6A 2ATVA 3NVYA 1S1MA 3PCRB 3AF4A 1ZP0B 2F55A 2K22A 1ZAKA 1CJEA 1G8PA 4NYJR 4DLVA 1R2QA 1Z6AA 4BRUA 2G9NA 2XJ4A 3VRBB 1E0ZA 1TF5A 1GIAA 2DFLA 3CRRA 4GZLA 4DDVA 1XPUA 4DB4A 1GRQA 1XEWX 3DWMA 2ODWA 3W34A 3C5CA 4D80A 3BBPA 1I4TD 2WP9B 5J47A 1JR3A 3T35A 4XVRA 2KSQA 3WYGA 3A1VA 3AVWA 1GRNA 2PX0A 2R65A 4WBSA 4ILEA 3B82A 1J7BA 1YR9A 5KHOC 2JJ1A 2W2VA 4IJMA 4KYUA 4BFSA 4GP7A 5HR5A 1ZCAA 2JIZD 3T06B 3GLGB 1KI1A 5BXQC 4Q7MB 5JECA 3O47A 4JVNA 2G77B 1O3YA 2GDJA 2G0TA 1RW4A 2WJIA 3LO5A 4OQLA 4URWR 5EP3A 1OQQA 3PEWA 3ZVNA 1ETUA 3V9PA 5FH9A 1DS6A 1XTSA 2D7DA 1J2JA 1H8ED 3EIQA 421PA 5AUQA 3BWDD 2RKOA 4Q03A 1Q57A 3EG5A 4IOKA 1TJEA 3RHFA 2EYQA 2Z0MA 3ZD6A 5EE9A 1ZM2A 2HXSA 2O0KA 1TTTA 1FMLA 1TKYA 1AJEA 4FMDF 3FPAA 4BLTA 4Q9IA 1Q3HA 2QMEA 3VU9A 1E6CA 3AE4B 1JJ7A 4EQ6B 4Q21A 4XVUA 3ETLA 3PUZA 4HZIA 4HB2A 3KQHA 3EPLA 2XZLA 3CRQA 4BFTA 3FMIA 1GKUB 1P5ZB 3B5JA 3CX8A 2GRJA 4CT5A 3IQXA 4KFUA 2GJ8A 2GZAA 1UM8A 4UNRA 2YV5A 2W6IA 4N59A 1Z3IX 1DO0A 5HE8A 2QAGC 4F93B 1IJFA 2J7PA 1L4YA 1FUKA 1SXJB 1XEFA 2J45A 3LVQE 1DAIA 3ZQ6A 2VSOA 3OE7A 1D2EA 2H57A 4Q1FA 1FM0D 2QMHA 3LH5A 3QI2A 3TR5A 1T5LA 3WMFA 3SQXA 2ORWA 1FXIA 1KYIA 2Z83A 2P6RA 1E32A 2V4ZA 4K46A 2OCYC 5H8WA 1JQ4A 4I1UA 1R10A 3KFXA 4QFMA 1G1MA 1PFDA 4XD7D 3EW9A 5GJVC 3PJRA 2YYZA 1Q44A 2VF7A 4JBXA 2QMOA 1GL7A 1N2CE 2C5LA 2J0SA 3OHMA 4B75A 5FUWA 1G5PA 2VQSA 4QGHA 1T8TA 3LDAA 5JCZA 4Q4LA 2FFQA 2JLVA 3KTAA 4M53A 5FBVB 1TUEA 3K09A 4ZIRB 4KBGA 2QM7A 4GNKA 2EYUA 3RS5A 1UBCA 2F3RA 4A6XA 4ACAA 4A92A 3VR1A 2VRWA 1CJVC 4DWJA 1FFUA 1J99A 2O0HA 2OEPA 2AX4A 3THOA 1VMAA 2W2TA 1T3SA 4B71A 5J4VA 1N6KA 4HDOB 4JLBA 4JLNA 3U3RA 2IYQA 2RGDA 2VP0A 3CF6R 1W4CA 1NMYA 2ZI7A 2FMXA 4OI0A 3A58B 1FNNA 3BIFA 3BFXA 4JYBA 3W5IA 1N60A 1AKYA 1NYQA 2IWHA 1II9A 1YQ3B 3B2EA 4U00A 5DYGA 1XJ0A 2E87A 2JAQA 4RZUA 2DWPA 3RRNA 4AKGA 1XD2A 2YOGA 1SKYE 1YR8A 3UPUA 3BGWA 2D2EA 4DDTA 2NO0A 2B8WA 2JLUA 1JECA 1UKYA 3MGCA 2EQBA 2VSFA 1ZM7A 1ZM4A 2F1HA 4DB2A 1XEXA 3GJ7A 1YJ5A 4DCUA 4FIDA 5DO9A 1CF4A 2GESA 2OILA 2W2XA 5EXPA 1HY3A 4LYFA 1QZXA 4Q7JB 4A4DA 4HAVA 1D9ZA 1EX6A 2FX3A 2P5SA 4D25A 3V4RA 2IHYA 2PL3A 2JJ2A 3VX3A 4YTPB 2OLJA 2J0QA 2DFTA 3QXHA 2ZI4A 1FL9A 2QRNA 3K0FB 1KSFX 3KKOA 4FMCF 1Z22A 3PIRA 4PPFA 2B92A 3U2QA 2XNDA 3HR7A 2VBCA 1XLPA 1NVVQ 1T91A 2YC4C 4LHWA 1W36D 4IDOA 3UK6A 4TYPA 1YR7A 4DLWA 2C9OA 3X1YA 1XZPA 2XB4A 2W3RA 2FBWB 3QVUA 3TLXA 1ZM9A 3SFVA 5B57C 1E69A 5BWMA 3MCAA 3P26A 1W4AA 3GJ8A 4FWIB 4OQFA 3IGFA 4XTCS 1NLZA 2IYYA 3MJRA 3IEUA 3TSZA 4ZDWA 2HYIC 3EZFA 4D4MA 2N42A 4F38A 1KK2A 1S96A 3FKSD 4I81A 1T8UA 2KB0A 3QKRA 4TYNA 3LV8A 5L3QB 1U0JA 4Q1AA 2HCJB 1KO5A 4HSEA 1E79D 1M7GA 5EE0A 4R2HA 4WQMA 3T5GA 2B7BA 1P73A 1ZVQA 3RSOA 4BFVA 3GLFA 621PA 3VRAB 3JVVA 1DAHA 2GAAA 3LX5A 5BW8A 3T15A 1D5CA 5C1BA 2QPTA 3THXB 4PSKA 4IDIA 4Q9LA 4OJQA 2JGNA 3AF2A 4CF7A 2GEVA 1ZUHA 5SZJA 2ZUDA 5DE3A 2RGGA 1Z0AA 5JMTA 4MYCA 5GJBA 1NF3A 5JWHA 2AK3A 1W0JD 1WRBA 2NPIA 5KNDA 4BUJA 3VKHA 4C4PA 1QHYA 2EW1A 3I61A 2GHIA 1I2DA 3AEGB 3WMEA 3PUYA 5JJKA 4B34A 4TYYA 2P2LA 2WWFA 1N5IA 4TLCA 1L7VC 3EWSA 4M1KA 5IK2D 5IRCD 1KTVA 3VR6A 4G0NA 1JEEA 1OKKA 3CH5A 2HXYA 1XLOA 3FKQA 1E9EA 3S1AB 3QG1A 1UJ2A 2IT1A 1VTKA 2JDIA 4B43A 2ECKA 2N46A 3MUFA 4TMZA 2AD5A 2VL7A 2FA9A 1IXRC 2C8VA 4PC1A 4PPGA 1A2KC 3G82C 4GP6A 2H18A 4YT0B 4OYHA 1HURA 4PZZA 1W2HA 3RC8A 2NZ8A 1JRPA 4HAYA 3C15C 4CEIA 2P3SA 2ZRPA 5JS8A 4DLSA 2ZETA 1KSGA 1EFRD 1G6OA 4V0MA 1E2QA 4PZYA 5DLQC 3SHWA 3TUIC 4D0GA 2NO1A 3WMGA 3U5ZB 3PUVA 3U60B 2ZRIA 4ZKEA 1DADA 1UDXA 1MOZA 5CM8B 2GK6A 2PVGC 2OFXA 3MG9A 1W47A 1DOYA 3E1SA 4LGMA 3VNVA 4QNRA 4QKQA 3EZ7A 3UWKA 2ODNA 3TGPA 1W1WA 1OW3B 3KUCA 1EK0A 4USAA 2O8BB 5BYKA 1VIYA 8OHMA 3I72A 4MYHA 2PVOD 3H0KA 1OFHA 1W48A 3CIOA 2V1UA 2E1RA 1A70A 4C7YA 3BE4A 2A5FA 2O5VA 2IUUA 3CNLA 5EUMA 1M74A 3OIVA 5C4MA 4KHZA 1N62A 1Z8FA 4J0QA 2ERYA 4ZI3A 1OF1A 4DDWA 3NG1A 1DGJA 3RS4A 5FOUA 1M8PA 4IW3B 4QRHA 4BLOA 3SBEA 2ZTSA 4DIDA 5B30A 2VP2A 2O8FA 3A8TA 4X8MA 4QJ4A 4MGKR 4WZ6A 2IS6A 1Z0JA 2WSSA 5C4GB 3LQRA 1B23P 1EFTA 4TZ6A 3LW7A 3OEED 2YWGA 3HU3A 4FCTA 5KO2A 4WOPA 5AJWA 4Z1MD 1E9DA 1G64A 2VHCA 3ADKA 1ZD9A 4RD4A 4DUGA 4Z54A 1CXZA 1IQPA 2FPKA 1SXJD 3K0SA 2ZPTX 1Z6XA 3L0PA 1ZUIA 4JIMA 5AUIA 5FPKA 1LTQA 5F9FA 2REOA 1IHUA 1P75A 2V8OA 1NBMA 3QIAA 1KMHB 1OLOA 1NG9A 1KZ7B 1VYUA 4B73A 2ZJZA 4DSNA 1P2TA 3GJ0A 4IFBA 1RFKA 4C80A 1Z0IA 1TADA 3VR3A 1T4GA 1B9RA 3SFDB 4Q47A 3PEUA 4JLDA 4M1TA 4ERNA 1XLNA 1SXJC 4KI0A 1HQCA 2IL1A 1BYIA 2UVQA 2H89B 1US8A 1E99A 1J70A 2B21A 2NZJA 3EAQA 4BZXA 3GJ3A 5KSYA 4BFYA 5LB2A 1C9KA 1W4BA 3B8HA 4FINA 1VG9B 2F3TA 2ZITA 2OXRA 2IYRA 4DLRA 2O8EB 1OJLA 1KFYB 1CJUC 2ZU0C 3QKUA 1WMSA 1J7AA 3OIYA 4ZHPA 4TYWA 4W5WA 1FIQA 2WHXA 2XXAB 1KO8A 2O8DA 1M6NA 1RJ9A 4H1UA 3B9JA 2R2AA 3THYB 4URZR 4Q4JA 3U3JA 5D3QA 2XB2A 3SEAA 2WKQA 2H16A 5G53C 2V6JA 4R71A 2XTMA 2QTHA 3FAHA 2JEOA 5J5CA 1AS0A 2ZRKA 4OBEA 2R44A 3W9YA 2CHVA 1SVKA 1R8SA 2MMGA 3A1WA 3OESA 1OHHA 1ZYUA 1SVMA 4YTMB 3WYAA 2ZRDA 1KI8A 3IEVA 1S9HA 4W7SA 4DLXA 4F92B 3KKNA 2NTYC 5KSOA 5L3SB 2X1VA 4JLOA 2AR7A 2IXFA 2OLKA 4V02A 1U9IC 4KVAA 2G3YA 1M7BA 5B2ZA 2D3WA 1AS2A 2ODEA 4N3NA 3CNNA 3IBGA 4F4CA 1GNRA 3P20A 1UPTA 2IS2A 1II8B 3U4QA 3U7EB 3QOFA 5TVKA 1WBBA 2ZREA 5TV2A 4NL4H 2OM2A 1GP2A 2V7QA 3FGNA 5FPTA 4N0EA 2EVWX 1P6XA 2W58A 1EFUA 1NKSA 2QN6A 4LC0A 2E9SA 1MO4A 4RY2A 2VA8A 3MWKA 3RS2A 3EASA 1IY2A 1NVXQ 1QHNA 1W2GA 5FPHA 1EX7A 4EFNA 3KQUA 3PUXA 2OXCA 2QT0A 5C2JB 4TSFD 2IS1A 2R6GA 5AR1A 3RWMB 3GFPA 1IN7A 1FTSA 2F9MA 2GNOA 2DCUA 5K8IA 1E9BA 2GBLA 4QHTA 1P9NA 1UAAA 3WHLA 2GVZC 4AY2A 3NHAA 1SZPA 1UEIA 4HDCA 4MRPA 3B9QA 3IQWA 1IXSB 1OT3A 3K0AB 1P2SA 4B35A 2QTVB 4TMWA 3AE6B 2F43B 1WBDA 2I1QA 4M1OA 2AD1A 4RKEA 1XTKA 2QT1A 1QVRA 2QIEB 2IW3A 4G5OA 2SHKA 3BORA 4ITRC 4N0DA 4OI4A 2J59A 4DLTA 3QPVA 3NHBA 5FTNA 4E22A 4NCJA 2QGZA 1OH8A 4LC1A 4LV6A 4YXDB 4HB0A 4JLVA 1G19A 5FTMA 3DM5A 3UG7A 3U7HB 4C30A 1GVNB 1E1QA 3U44B 2D62A 3ZS9A 2Q9CA 1V43A 1UKEA 2ZS7A 3TW8B 1PUIA 4B32A 2YJTD 1SQ5A 2RHDA 1ZC4A 2QBYA 3AB5A 1NMXA 2IYLD 2WAXA 4OHWA 4P4SA 4B3XA 3AVYA 3D3QA 5FOSA 1BYUA 3ONWA 4JS0A 3T12A 4KVGA 4IOMA 4LBVA 4RFSA 4IOJA 1V8CA 5LBIA 2KJQA 5EUQB 3IBYA 3VMFA 2W0SA 3PFIA 1UFQA 1ZIOA 4K8OA 1EFHA 3PEVA 1P3JA 1GOTA 1KOFA 2ZS8A 5TXGA 4C2TA 1U98A 3F5FA 3HVZA 3P32A 1E0JA 1OV4A 2FOLA 1TX4B 2BBTA 3E70C 1TUIA 2AKYA 5EP4A 4ITKA 4FW9A 3AF0A 4YXWA 4B3BA 1DVRA 4KJZA 3OF5A 4DEXA 1OFTA 3DOEA 4NYIR 4MRRA 1X8KA 1AGPA 1IN4A 1E2HA 2RAPA 2ZI6A 2L52A 1C4OA 1E4VA 2ZJOA 2L0XA 3FYHA 2D7CA 2J1LA 5BQ5A 1VLBA 1OH6A 1W5SA 3MWLA 3EARA 4X8HA 1A4RA 4DCSA 3QG5A 3NVZA 1D9XA 2GVDC 1DOXA 1F3OA 1ZD8A 2QGNA 1KDRA 1KF6B 1TAGA 1SVLA 5IDVA 1I4DD 1U94A 3HR8A 2GKSA 3WY9A 4V0OA 5GVRA 5DI9A 3PITA 4B3FX 3D6TB 1NSTA 5FFMA 4LCBA 1XXHE 2H8KA 1ELOA 1FMAD 4L8GA 3DWGC 1IJEA 1DAGA 3KX2A 4WXRA 1F60A 1JXOA 4A8JA 1Y63A 1WE2A 5E4FA 1N6IA 1ZUNB 3P4RB 1WP9A 4EPVA 1J90A 2HUPA 3AEFB 2K5PA 3KXIA 2HJVA 3NIBA 2GETA 4EJSB 1PLLA 3B1WA 1HV8A 2CJWB 3LLMA 4TTPA 3K53A 2MH7A 2Q3FA 2ZRJA 5FBWB 2QP3A 5HE9A 1FTNA 1MV5A 1SVIA 1XCGB 2H17A 1KSJA 3CPJB 1N6NA 2JIZA 2ERXA 3IIKA 5F3WB 1SVSA 1OXUA 3WXMA 4PPNA 1JB1A 1IXZA 3ZH9B 2FGJA 1SVOA 2GF0A 3SI7A 4NONA 4Q7LA 2IEYA 1H8EA 3B85A 3GLHE 3U6KA 3HJNA 3KB1A 3MRSA 1NSFA 4YDHB 5C18A 3LBIA 4IDHA 4BLPA 3KXLA 4US2R 5FBQB 4JJKA 1CZPA 4OHYA 1X8JA 1V5WA 3I5YA 1MH1A 2HLDD 3CBQA 1JPJA 5D3MA 2WICA 1O87A 2F1IA 4C7OB 3SOPA 1GM5A 3RC3A 1X6VA 1HE8B 4NE2A 3VR9B 2FSFA 1KZGB 2FFAA 3GJ4A 3QKSA 1XD8A 1GAJA 1G3UA 1IAQA 2A2ZA 1QOFA 1U81A 1UADA 3D8BA 4Q18A 2JA1A 1ZD1A 3THWA 3K1JA 1IONA 4DCNA 2Q21A 4AG5A 2W54A 3VHXA 3CRW1 2ZXUA 3R7WA 1NLFA 1QBKC 2DFNA 4YLGA 4IOLA 4D2IA 3VU9B 4ZDKA 1XCMA 2ONJA 3Q72A 1DELA 3ZZTA 4BWYA 4ESHA 4P4UA 5DISB 3ZD7A 3AE7B 2O0JA 4AG6A 2XZPA 4HZUA 4S2EA 3FOZA 4OK5A 3RS7A 3GQBA 2J0UA 4LWZA 4CEHA 2ANBA 2GZDA 4IHQA 1M1YE 3CWQA 3WNDA 2ZSEA 1KI7A 5G40A 1GAQB 3PV0A 1YRAA 4QBIA 3QENA 2QPOA 2BBWA 3IDQA 4H9GA 2KI5A 3PUWA 1DG1G 3SZRA 5CLQA 1JXMA 3IO5A 4JJZA 3GLGE 4CGZA 1YZTA 5FUVA 4PO9A 4PC7A 3BAFA 1SKQA 3WRYC 3EZ6A 1Q1ZA 2D06A 3KFVA 3QXCA 121PA 4EPWA 4RSGA 3PENA 4FN5A 3AM1A 1ZOYB 1WF3A 1XMVA 3UANA 1G3QA 1AIPA 1E1RD 1PLJA 1WXQA 4LDJA 2DYKA 2GXSA 2ACZB 3BS4A 4JT2A 4PSAA 2ZM5A 4G1UC 1ZNYA 2DY1A 4Z8XA 1OIXA 1NLYA 3VHLB 1JI0A 5GADl 1ANKA 3KTAB 4QGFA 1ZMXA 2GA8A 4RD3A 4DSUA 1JAHA 4JL8A 3P1MA 1W7AA 3UMSA 2VO1A 1IN5A 2VIIA 1U99A 3EIEA 1RWSA 1Q12A 4DT1A 3SFZA 1VG1A 2OAQ1 1KNXA 2YWHA 4YMVA 4ZKDA 4YSYB 3HDTA 2HF8A 3QPWA 3HRDD 1NYRA 1Z07A 2VHTA 1XBTA 3DKPA 3NVAA 2V1XA 4OK3A 5DGXA 4EPTA 1OE0A 1G4AE 2JATA 2Y5CA 2ZS9A 3HYRA 1SXJE 3Q5DA 4URUR 4GMDA 5BN5A 3AVVA 2ZQ5A 1OH7A 3AGQA 3L0OA 4C0LA 1F0ZA 5KPJA 1KI2A 2JQRB 1KDOA 4BEBA 2PZGA 1KI4A 4KITB 4Q4HA 3LXRA 1KI6A 1JWBD 3AV0B 1U8ZA 2PLRA 3ZIAD 3AE8B 1U2RA 4FCWA 3KQKA 4D6PA 4ZO4A 1MO6A 3UWOA 3K9NA 1OXXK 2CCGA 2F1RA 2VHUA 3OZXA 1XEXB 4HAZA 5AJVB 1YZUA 2WOOA 2UZ3A 1KRHA 2G1JA 3CPHA 4LJ5A 5E7MA 1E3MA 3EC1A 5FOWA 4QC2A 3TAHA 1TYGB 2GXQA 4UNNA 5G3ZA 1JAIA 3AECB 3KKPA 1TKEA 3GJ5A 5ANRB 1YVDA 4Q9JA 2ZI9A 3FKSA 4OJKA 3DMNA 3QJYA 5CDFE 2JLYA 2F6RA 4GRAA 2WLBA 4OKSA 2QJLA 1E79A 2BMDA 4GPTA 5E95A 2ZR7A 4NYMQ 3C14C 4QG7A 1M2OB 2RGBA 5JBQA 1WCV1 3CRMA 4MITA 3W6PA 2ZUCA 5L8VA 1PVOA 3QXXA 2FE4A 1G8YA 3WBJA 4XIGS 4H1VA 1GWNA 1RRPA 4HEJA 2P6NA 4O25A 3CW2A 2OG2A 4LSGA 1F6BA 4YQFA 1W0JA 1UBEA 1Z29A 1Z0KA 4PQYA 4YSXB 4PX9A 1XTRA 2BM0A 2QEQA 4QHYA 1Q20A 4HUTA 1G21E 1COWD 3CUEF 1NL3A 4LY6A 3X1WA 5KNBA 1OH5A 1CS4C 1R0WA 4TZ0A 1I7HA 1GILA 4NH0A 2WWHA 1CULC 2GF9A 4OHZA 3QNUA 3BFKA 4E03A 2J5XA 4O3MA 1AM4D 3GLFB 4NYMR 3BH6A 4JSYA 5J4KA 4AURA 4HLDA 2O8CB 1R7RA 5J40A 1P61B 2A5YB 1KJZA 5KDLA 3DDCA 3ZGXA 1XMJA 3CB4A 1NENB 2OV2A 2OHFA 2RCNA 4YC7A 1ZRHA 3NBFA 3IO3A 4DXAA 1R4AA 2ZIAA 1IY1A 4TMXA 3EXAA 4TTQA 3FHOA 5AUOB 4TL6A 3K9LA 5IT5A 4MQBA 2ZSDA 4UXJA 1R0ZA 3LVRE 4NP6A 3NC1C 1NIJA 1PUJA 3QF7A 5FL7D 3RSLA 4B2LA 4BECA 1EFRA 1C1YA 1PZNA 4IXNA 5KOYA 1JQLB 3TIFA 3IUYA 4R9UC 4KU4A 1S9DA 1ZINA 1ZNZA 2CE2X 3GEIA 4DZZA 1XTJA 2WWYA 1RYHA 5JHGB 1FPMA 1VYTA 4TLEA 2PMKA 3AH7A 3E2IA 1YJIA 2BWJA 1VCNA 4B74A 1MO3A 4NCKA 4HLUC 1K8RA 1T3HA 3MWJA 3CX7A 2EWVA 2MSCB 3BB3A 1NEKB 2Q3HA 3H2YA 3SJCA 1G4UR 1E0KA 4OL0A 2WMNB 2G6BA 2PX3A 4EIWA 1DAFA 1RRGA 3AQ4A 5EP1A 1P9RA 2NO6A 4CEIB 3K70B 3KKQA 2WJHA 4RD1A 4EJSC 2QL6A 3GFOA 1OIVA 2IA5A 1ZCBA 1G20E 2B7CA 2CCJA 5TY0A 4NPHA 2PMDA 2DWQA 1MT0A 4HI0E 1B0UA 2ZRLA 1AK2A 3OEHD 1ZJ6A 4U02A 1U8AA 4YMSA 3CF0A 1MR3F 2XOKD 5DHFA 3R9WA 3OIWA 3SFEB 3FE2A 2C9CA 4PC6A 1VG0B 2F1JA 3CH4B 2DHRA 4MRNA 3NBXX 4P0TA 4G5QA 3SS8A 2MSEB 3OEEA 1A2BA 4Y0VA 4Z1MA 3LQQA 2IX3A 2L83A 2ZYUX 1P2UA 1K5GA 1XTIA 1GDDA 3QF4B 5MPOA 1NVUQ 1NVVR 3OFND 4TQ9A 1KI3A 2WDRB 4G3XA 3FDIA 4I99A 4TLBA 3SR6A 1HT1E 3LNCA 4JLJA 2P0EA 3AP3A 5EE1A 3AVOA 3CO5A 3EIHA 3I3SR 1KY2A 3W9CB 4B33A 4BPBA 5EE5B 5JHHB 4BLQA 1XX6A 2C78A 2ZR9A 2FDCA 1FFHA 5C2TB 2ATXA 2PKOA 2CK3D 3DVLA 5FUXA 4D4JA 1TQ2A 1ZBDA 1MABA 4US0R 4DCTA 1EWYC 2W6ID 4HATA 4RJLA 3AH8A 4UJ3A 4QGAA 3ZZ0A 1XF9A 2ANCA 2G0NA 4M9ZA 1FOEB 2D4HA 821PA 4JSTA 2GCPA 1FRDA 5H68A 3X1XA 4NMMA 4AYXA 1QOAA 4PZLA 3KJEA 4ZIRA 1N61A 4IVRA 1U0HC 3W8NA 4RCZA 4JLAA 4JBYA 3O8CA 3G5UA 1N5LA 4FI3C 4BQSA 1YQ4B 2BBOA 2ZRBA 3MJHA 3BOSA 5GJWC 2F9LA 4B2PA 3F8TA 2AHOA 5CIQA 4F4IA 2WVJA 1KAGA 4LJ4A 3OAAA 3NVWA 3P4QB 3L0SA 5FTJA 3AE9B 2QI9C 3KQLA 2FWRA 4NTZA 3RANA 2ZYTX 4F91B 5J4YA 1NY6A 3JZMA 4TQUS 4B6FA 4B47A 2ZE5A 1US8B 2RGNA 2XGJA 4U5XA 1NVID 2W3SA 3QVVA 3V4FA 2LKCA 2ZRGA 4A2WA 3AEAB 1E7PB 1W0KD 2HYDA 2QORA 5FOTA 4DBLC 1T5IA 2ZI3A 4QBFA 4MKGA 3T1QA 3ZQJA 3VFDA 2BS3B 4BASA 4C9BA 2QE7A 4JVSB 4LRWA 4QGGA 5EP2A 2XNSA 5KU1A 4JX1C 3RVBA 1Z0FA 4ZCLA 5JRZA 2I1VB 2HTME 1N6LA 1QHHA 4KLZA 4FWTA 3K09C 2C77A 1XFAA 3RS0A 3X2SA 3N2IA 1RRCA 1ZNXA 4PR0A 1J8YF 1X86B 1NY5A 2WQYB 721PA 3M0EA 1CR0A 2RH5A 3ZZUA 1LF5A 1W46A 4PSVA 2J0VA 2CNWD 2PCLA 1OB5A 4JVMA 2BEKA 2GCOA 4DRZA 2NIPA 3A36A 5HZHA 2XX3A 2R62A 3AF3A 1TNDA 3AUYA 3I1FA 4TSFA 4PO8A 5B64A 3B1XA 3KXKA 4II7A 4WZAE 2CMKA 1E96A 4P33A 1OPXA 4P3YA 4UJ5A 2YWFA 2ZRHA 2JJ2D 1HYQA 5AWFC 5EJEA 1R5NA 3FFBA 2YZ2A 2VYFA 4Q1EA 1KAOA 4CRWB 2OESA 3M4YA 3G0HA 2FZLA 2J41A 4LV5B 2JLQA 2ZUBA 5G41A 2WPDA 3EX7C 4JZKA 5TDHA 2A9KA 1KNQA 4KBFA 1ODFA 4K81B 1ZU5A 1E10A 1UF9A 3SU8A 4ARZA 3GP8A 4UNSA 2XEXA 1GTVA 5DIFA 3EUB2 1KO7A 1SVWA 1II0A 3B2FA 2KE5A 3K0CA 2I3BA 2WKPA 3A4MA 2IXGA 2ZRNA 1QLBB 1KGDA 3ZS8A 1G7SA 2A3RA 4RZ2A 2C98A 4URXR 4JYCA 3CZPA 4P31A 3SYKA 2BJWA 2C2HA 1XD9A 1TEXA 3UIEA 4JVLA 1ZXIA 1HA3A 2RMKA 4ACBA 2PJRA 3AVUA 3Q5EA 4V0NA 3CPEA 2WM9B 4UXHA 3GLIE 4TL8A 4BFXA 4OI1A 4CT4B 1TKGA 1PLKA 3KB2A 5DH9A 4BLRA 5EXXA 1L6UA 5HKKD 3EPKA 5JSZB 2ZU6A 3EWAA 3AE1B 2YWEA 3TUJC 2BMJA 3ASZA 2BKUA 3C4JA 2GXUA 3T34A 4MYTA 2VHQA 3SYLA 1VIAA 2YHSA 1LF0A 2QBYB 1CR4A 1G5RA 4P4SB 1HUQA 2QM8A 1NKTA 1AN0A 2H88B 2YOFA 4RFSB 5JFGA 3K9GA 4WAUA 1BO6A 2FSIA 2GJ9A 4OQNA 5CITA
chains in the Genus database with same CATH superfamily
3TL3A 3QUAA 3PNPA 3HO1A 2C7VA 4CLHA 1RRKA 2ADMA 5L4LA 3SJAA 4W5JA 3IUPA 3SEFA 4KDRA 2AT1A 3CE9A 4LJ9A 5ICSA 1OC4A 2IOFK 3R9XA 4NAHA 1WDKA 5DGHA 5KINB 1G8SA 3IELA 1CZOA 1YDGA 4MWSA 1OBVA 2H85A 2HF7A 1UXKA 3J7AC 3AVXA 2BJVA 1Z0SA 1DFHA 3I45A 4BRWA 4W8HA 2HD5B 3ZWAA 4TMKA 5TE9A 4NQRA 3X44A 5EPOA 1RNLA 2WWGA 3W1WA 4H15A 3ONSA 4A8XC 1PV4A 2H92A 3DZDA 2CJOA 1G7TA 1SUSA 5FNVB 1NG1A 1W4RA 1QE3A 1G9SA 4IEEA 3WL6A 5EZSA 2YVCA 5JYDA 4N5NA 2ZULA 1NX6A 4QTUB 4F3CA 1ABBA 4CR7A 1LW7A 5LJIA 2C3UA 5C3JB 2LGYA 1Q1QA 2ZE8A 3HEBA 2BHNA 4YRGA 3H17A 2MLBA 5LXHA 5I5EA 2E3TA 4HZUB 3WGVA 1M2NA 3A3NA 3UKDA 3D8NA 3FYDA 2ZQYA 1U2DC 3RPFC 5LXTF 5KWIA 4PF1A 4ZVLA 4CIWA 2C29D 1VBNA 2DR3A 2WBLC 1WZ3A 1K08A 5EHZA 5ENVA 4KUGA 2QD5A 1DKPA 1KWKA 2E82A 4F7WA 4BV2A 2KAJA 5G2NA 1FPQA 2A9RA 2M56B 3TF5A 2JXXA 3BH7A 3MYRA 4DQOC 4A27A 4CKEA 2WXLA 1NHGA 4Y2XA 5DNCA 5A1TA 4OQXA 3AFGA 2NV2B 3CHYA 1BMFD 3WDMA 5A7HA 1TM5E 5G5GA 1GGJA 3N5KA 3BWUD 5CAEA 3QFCA 4C0SA 1SFRA 3ZW9A 4JITA 4YRMA 2JFVA 2BUCA 3R9IA 1OAAA 2H5EA 1THZA 4FYWA 2W70A 3W2IA 2GBLC 4XD7A 2C04A 1VZ3A 3OAWA 3KAJA 4Q9HA 2VATA 1KRXA 3ZY3A 2NT4A 3TLZA 2PT9A 3A06A 3QA8A 3PXUA 3DR3A 3ZE7A 3H84A 3AI2A 4N5LA 5C8YA 3V2UA 2GCGA 4CM8B 3EZGA 3VR2D 4DHEA 5BOSA 4PBRA 1ROEA 4GBGA 1DARA 1EFDN 5A5FA 3F1KA 5H1YA 2GXAA 3DO6A 3HSYA 3GFTA 1FP7A 4L9WA 4PG8A 4KBYA 1I94B 1QYIA 5IARA 1G291 3OEHA 3MMXA 1USKA 4AQDA 1ZSNA 5KPDA 3TR0A 5I45A 2KQ4X 3PFFA 5CVTA 3S29A 7AT1A 3RNCC 3W0LB 5JSHA 4A3OA 5F2EA 2E18A 4BZWA 4G2TA 3CX6A 1SXPA 2DPHA 1OJ7A 3ZWVA 4KXQA 4WJQA 1TMKA 1ZN7A 2ZBRA 3T9FA 3KSMA 2P9TA 1R0LA 1FFAA 1OFFA 4B7CA 5I9BA 5BW4A 1CRLA 4YUWA 4W5HA 1VJDA 1JEQA 4Q3CA 3QEBZ 4TM7A 3CVXA 3UHPA 1RZUA 3DB2A 5LMNB 2AFHE 1UXOA 3PHCA 5ULLA 5CYOA 2C7RA 2DUMA 5IH7A 2PGJA 2IIVA 2VJMA 3MQ4A 4G1VA 4LKOA 5BSMA 4E2XA 4PHTA 3B2QA 5JQGF 5FPYA 1YJ1A 4P3NA 1D6EC 3AJDA 4O0LA 3TRDA 3T8MA 2FKNA 2XDQA 4M9SA 4C3ZA 2X6QA 1ZGBA 1W2WB 2O7NA 4WIAA 3N75A 3X23A 1XPOA 3KEFA 2RC6A 1P1AA 1U8YA 5E6UA 5EMNA 5I4KA 2DBVO 1AARA 4KLAA 4D5EA 3ZRCA 3ZU6A 3RU7A 3BZBA 2KC1A 4CCYB 4CDGA 1JBEA 1K6JA 4BQNA 4Y6PA 1DQZA 5FAKA 3H2BA 4IIJA 3FPKA 1XQ6A 3GBSA 1QVAA 4BIIA 3MWGA 5CEJA 2XYGA 1QQ7A 1KM7A 2WWRA 3ZC3A 3DVSX 3DE0X 2EKDA 2W98A 1Y4UA 3OA0A 1OXMA 4GC5A 4LDQA 1MB0A 5K0GA 3IL2A 4FHKA 3ZQ4A 5JZOA 4BX0A 4EUFA 4YRBA 5C23A 2VNAA 3FYUC 1O95C 3DYIA 1U0TA 5LXIB 4FHFA 2AZDA 1KOLA 4KIFA 1W8DA 3H75A 4UHFA 2G72A 1ZXXA 2K4MA 3EY9A 1KH1A 4UXIA 4LW8A 2Z0DB 2BSAA 4EF4A 3ITDA 3K9CA 2PS9A 4MS3A 5DHAA 1QQ5A 3OPQA 1OREA 5EOVA 2CNOA 1ZMRA 1A97A 1E7RA 4C20A 3T52A 1P45A 5A9RA 4MJLA 3MD0A 1E9VA 1FQJA 4KK3A 3QF4A 3F49S 3SNKA 2QTZA 4ENVA 1AOXA 3YASA 3BXHA 1U7OA 2D0OB 2IYVA 2ZJ7A 2IK8A 4BEJA 4PS0A 3VJMA 4Y2UA 3VPGA 3HPQA 3ZTDA 2YV3A 2H1WA 1CD5A 3PEYA 5DTRA 1Z5UA 1TF7A 1J2UA 1H1DA 1O94A 3IERA 4ZJPA 1XALA 4RA9B 2KLHA 3AU8A 1E62A 3CF4A 1PJAA 1TLFA 5ICEA 4WE3A 4WBNA 1AS3A 4NS1A 1XTZA 4H7JA 1NDDA 3QX1A 1FXSA 3RKUA 3S7ZA 4OQZA 1IIRA 5JH7B 3FCOA 2C2YA 1D5MC 1J7KA 1BXTA 2ONYA 3FCYA 4ZV9A 4YUAA 4AO8A 1JJAA 2MBQA 5FEMA 3JRNA 2VNIA 1C0KA 3NW9A 2I33A 2CHZA 3GLQA 1XT9B 3TINA 5B3AA 1DOIA 4KN9S 1R4ZA 2FSHA 3WJ1A 3FC4A 2IVFA 3LT2A 1W0CA 1GTMA 3WSWA 2C0CA 1XO1A 2RE8A 5FA5A 1U0NA 1I4OA 4CEJB 2W6QA 3D2BA 2WPDD 4UBJA 1ENFA 3QNMA 5E8JA 2LZ6A 1WGGA 1DKOA 1DKLA 2M19A 1WFYA 5JSZA 1U7ZA 3VSEA 1Z2MA 4YIHA 3IIJA 3AU5A 1ECCA 3D64A 3REOA 5D3IB 3HXQA 3UH0A 3WKDA 3ZVKA 4OMCA 1DBRA 5A3SA 5FTLA 1FRNA 3DVRX 3FPJA 5BRJA 4YMTA 2FZ4A 2CUNA 4NFHA 3CR8A 4A0GA 2ZYWX 5BORA 2W6JA 4QOJA 3N8DA 1V8PA 1JG3A 3OU2A 1D2HA 4MWGA 4WD3A 3G0GA 4PYZA 3AUXA 3EH1A 2PL1A 5JWRA 2IUYA 3NH6A 4KFRA 3Q6IA 3GFQA 1GPKA 1T9GS 3NQ41 2P9GA 3LXFA 2PYIA 1N6ZA 2XE8A 1ZGAA 2RKWA 5C7IO 3T7CA 4A0FA 3DEFA 3BDIA 3RWOA 2ZJ8A 4QBHA 5EHNA 2Q3JA 4NCXA 4WH0A 1QVVA 3IC5A 2IPLA 1JWAD 3RODA 2V9CA 1QTRA 1V9JA 2IO0B 1UANA 2PFGA 5E1OA 2XITA 3GRKA 1CFZA 1EQUA 4BLSA 3GT7A 4QJBA 1HTWA 1GL6A 3DNFA 5BN4A 3C7KA 1CDOA 2SEBD 4M2LA 2AN4A 1E6EB 1RRFA 4DQDA 5JAZA 4S0ZA 1A04A 3IX7A 1Q0UA 3BERA 3GJQA 3EG9B 5EFZA 1S1MA 1ZAKA 1RR6A 5BVHB 1JHOA 4JI6B 3EGRA 2R68A 2B35A 3IR5A 3AO0B 4LRXA 4PLFA 2Q1XA 4YP0A 3P9ZA 4NG5A 2LGJA 3KP1A 2J48A 1R27A 4R1NA 3HA2A 1BHO1 2GDJA 4OQLA 1RW4A 5KVSA 3MF4A 2X0KA 1Z82A 1YNTE 2IYNA 3RHFA 1YMUA 1D5XC 3BIWA 1AJEA 2J67A 1XV5A 4BFTA 1GKUB 3CX8A 2CNNA 2GF2A 4FA6A 2J7PA 1NQUA 5FWNA 4Q1FA 1D2EA 1VE3A 3WMFA 3NAGA 1CZUA 2BEUA 3WL7A 4M0MA 2PS1A 3T3MB 2VF7A 4KV7A 1H2YA 1AHHA 1I4HA 1VMEA 4IGIA 3TD2A 4BKTA 3K09A 4ZIRB 2EYUA 4FDVA 3TYXA 2PG3A 1FFUA 5ALIA 5KBYA 3U3RA 5LIPA 1DXOA 2HLNA 3AEKA 3AG6A 4E1AA 3OM0A 1MHHE 3QJ5A 4YMIA 3J80A 4DCUA 4FIDA 4EG7A 2W2XA 1BA3A 3EWNA 4LS3A 4BY9E 5E4YA 4KIWA 5AKJA 4DM4A 3NOXA 3F46A 1N2GA 2CW5A 1DDIA 3FG9A 1E69A 4ZCRA 2VDKB 2EHJA 4ZDWA 4XDYA 1VL5A 4I81A 3GFFA 4Q1AA 4R2HA 621PA 4P7BA 4M3NA 2QUJA 4RPHA 1O8CA 2C92A 2JGNA 5HQTA 2W6MA 1LBTA 2YMPA 5SZJA 1TZMA 5JWHA 3PRKE 3ZPXA 2QSUA 3TEYA 4YFVA 2N3ZA 4XWTA 4X71A 3FDZB 4DA6A 1XZFA 3DHYA 2QX7A 2JXTA 4K9DA 2JGDB 2O14A 4PC1A 1A2KC 1TUBB 1XNHA 4FJ0A 3NWPA 4OGFA 2DAPA 1FU4A 4CEIA 4UFOA 1O97D 4NMXB 3DBHI 2ZIUB 4P98A 2ZRIA 2JF0A 4MJ7A 2ZWOA 2AFHA 5CB4B 1DOYA 4QKQA 4LF8B 1I01A 2XR1A 3JQPA 1K4MA 1U2QA 1ZA1A 2F4VB 4DS3A 2KVRA 3CNLA 1GTZA 5COBA 2ZXFA 2LWPA 3E8XA 1WVIA 4A8HA 1U8UA 5JU6A 2ERYA 3KLSX 1L8XA 1GZ6A 5FOUA 4IG4A 2VP2A 3A8TA 2WYWA 3VR6H 1Z4MA 4JYMA 1XIVA 2FUEA 2HJWA 1YN4A 4D3SA 2HQRA 2W8ZA 1HE3A 4MCAA 4UDXX 1KMHB 3OKPA 4AKSA 1CUWA 3SFDB 1CK4A 3CLRD 2A3NA 4L73A 3TDNA 1JWSD 2H89B 1WU8A 5AI5A 2CFRA 2PSEA 2MP2B 2O8EB 4R84A 4ZRQA 2R6R1 2COUA 3A9UA 3OZFA 2WHXA 2AV6A 3ZW7A 1CCWA 5D3QA 3NJTA 2QOEA 2AC7A 3OQMA 5KSOA 3KKNA 1EUCA 2EBFX 4QQKA 4V02A 2VUHB 3DFUA 1QKKA 3WL8A 1WCIB 4J1TA 3KVRA 2NUTB 2WK1A 4DV2B 2VKTA 5TV2A 5DB4A 2WJWA 4YLEA 2W58A 1EFUA 4GOCA 2H6EA 2VA8A 3MWKA 1SIWA 3EGDA 5FPHA 4JFAA 5KJFA 1DWQA 2QT0A 3F2IA 3PHHA 2GNOA 1NBOA 2I66A 4TKZA 3IQWA 5CX3A 2WHRA 3ORYA 2BR4A 3H7AA 1A88A 4CMEC 1IZZA 5JC8A 4YP6A 4HB0A 5FTMA 4XGNA 4FEAA 4KQGA 2O3RA 4UOEA 4ZEWA 3AZQA 4B32A 4JB8A 4EJFA 2VC2B 3N59A 2FCNA 4P1ZA 2PUCA 2F3SA 4TYMA 5KC9A 3KWJA 3IQGX 1PWYE 4X7MA 5BYSA 5LUAA 4GXBA 4NESA 1ZKDA 2CF6A 2L0XA 1L9XA 5HGJA 4LYEA 3EARA 2JUOA 1GEEA 1D9XA 5K4AA 1F3OA 4X54A 5A4AA 1M2VA 2PNJA 2ZCUA 4Z2YA 2H8KA 1F60A 2Y71A 1N6IA 3GP5A 1CZLA 4ZAGA 4CKYA 3WBFA 4KYVA 3VTFA 3N7AA 5KAMA 3M9WA 2FSVC 3ABQB 1NUUA 3HN7A 3U81A 3VTAA 3SQDA 1MJNA 1KAEA 3OKAA 4G4IA 2GD6A 3SI7A 1H8EA 3SF8B 3B85A 3N39C 2I1WA 3KXLA 4EHAA 4US2R 3RSHA 3HVDA 1MH1A 3DZHA 4S1TA 3NIGB 1XN4A 2F1IA 4BO2A 3H9GA 2GD1O 1K3UB 3HV2A 3WGGA 3M4ZA 2Q21A 2R6HA 5M29A 4Y67A 1LSJA 1XCMA 2WDZA 1IN1A 3DTVB 1NRWA 2Q0QA 4CEHA 3U30A 4C1BA 4BNJA 1J5EB 4QBIA 2BBWA 5KYYB 2GN1A 5CLQA 1NYLA 3EZ6A 2J5KA 4EPWA 1WR8A 2Q6LA 1HTQA 1DBQA 2HKIA 5I9LA 2C83A 4G1UC 1E63A 4Z8XA 1Y9ZA 4L74A 4ZHQB 3SKXA 1SH7A 3KTAB 3UM9A 4DSUA 4Y6QA 3I05A 3UAWA 1OY1A 4BO8A 2NR2A 4CM4A 2WZBA 1A7AA 3HRDD 4EPTA 4YRDA 1F9AA 1OH7A 3DD5A 4WWNA 1M6WA 4GF5A 4Q82A 2JCYA 4BMDA 1UK8A 1GJRA 1KI6A 1JWBD 2FDRA 3DL4A 4ED9A 1UXJA 4OHJA 4ZCSA 5AJVB 4QDUA 5F35A 4HGQA 3GH3A 1U8EA 4QC2A 2PZJA 3WX0A 2WR8A 2IE0A 4Q9JA 1LLDA 4D3YA 2BMDA 4MGYE 2RHRA 1Q1NA 2ZR7A 1QFSA 4NYMQ 4P53A 3C14C 4JPSA 3CRMA 3M4XA 3X43A 2OG2A 1BE8A 1F6BA 4N18A 1W0JA 3BZUA 1QE0A 3WIDA 4YSXB 2BM0A 4HAIA 1BROA 1Q20A 5FWXA 4NOJA 2QLJA 4C6HA 3TZ6A 1WXMA 4NFYA 1WR6E 4CYEA 3P0RA 1ZRHA 4L4XA 3IO3A 5BN1A 2JI7A 3FHOA 3H5VA 1R4MI 2DFPA 3N2GB 1EFRA 4C01A 1GPJA 3P19A 1CF9A 4FFBA 1LDYA 3O2QB 4NCKA 3R77A 4KQIA 3DHGC 3Q7SA 3TQQA 5BSRA 2AEMA 3CUYA 3HDYA 1QE5A 5JFTA 3JQ8A 3NHRA 4NPHA 2WZCA 3B36A 4I6NB 3V42A 3WKEA 2O2CA 2MSEB 4J2HA 1FSFA 3I9OA 1R00A 1GDDA 5I7WA 3BD7A 1LZLA 1V11A 4RHUA 2JLCA 1RHKA 4JLJA 3AP3A 3H2KA 4B3SB 3ZWWA 3OBBA 2UU9B 2ZR9A 3Q3VA 2AL6A 4QVKA 2D4HA 3S3TA 3C74A 3NOVA 3KPUA 1BHQ1 1ORDA 4GQBA 2WXOA 4MMXB 1T0RC 3PGEA 4BQSA 2BBOA 2ZRBA 1XYVA 2OHOA 1ENPA 4ZTUB 1KYZA 1YN3A 2Y6UA 3PC2A 4N5MA 1BU5A 1Z7BA 4PPYA 5JS1A 2ZWVA 4P4LA 3SBOA 3ZCPA 3AEAB 2HYDA 3UXEA 3RTBA 2VNKA 3H9QA 1KKUA 4HDQA 1CIVA 2HHJA 3JV7A 4DDGD 4HNQA 3JWGA 1TK9A 1S3IA 3WZMA 1MJGM 3B5IA 2YV2A 3AONB 4PK1A 1XLTC 3I1FA 4JJGA 3R2TA 4II7A 3HMQA 3KZXA 2FG6C 1DAOA 5F12A 3PQ5A 4KPUB 2I9PA 2A9KA 4B6JA 1A5ZA 1J0EA 2XEXA 3I42A 3CYFA 1N1GA 2MYNA 1ODCA 3N9IA 7YASA 3A4MA 2ZRNA 4X20B 1KYYA 1V7ZA 3M5WA 5AKGA 5DNEA 1XD9A 3RZFA 4IWPA 3AETA 3N0XA 3WWYA 3GWZA 5K51A 2GXUA 4TTAA 1VIAA 4IG9A 2VDVE 4OSPA 4DR6B 5T5QA 3NETA 2OE2A 2E6XA 2X8AA 3O3MB 1JZTA 3S28A 1CHNA 4L72A 3PJFA 3LFHA 4IXDA 2Q0XA 5KTKA 3TJMA 1TMOA 1FXAA 3QFTA 3U7QB 2FPLA 2ZB2A 4PHFA 4MELA 1H2WA 4TS1A 3LDUA 4IAOA 2J9RA 3G5AA 2C84A 2CS4A 2V54A 5IVHA 1D6NA 2C07A 2HDNB 1JF8A 3H9BA 3HBJA 4PO3X 4KIUA 1YS7A 2Y93A 3LBNA 3VNBA 2G3QB 1HNWB 4ZCMA 1XSEA 2IBMA 2BGMA 1HG1A 3GB9A 2WU5B 2HBQA 2K8CA 4ZRDA 3W6OA 5ED0A 2I3GA 4L8WB 3RABA 1KYXA 3B60A 3KR0A 1MUUA 3FJOA 2DTXA 4KXFB 4ALKA 3UJ3X 1KO1A 3N6VA 3TSOA 1NJFA 2B76B 3U56A 3LQFA 3GCDA 4MHOA 5LOVA 4EATA 2IPMA 1MFZA 3SY8A 4GLBA 1WW2A 4GYWA 5K6AC 4KR6A 5KQPA 1Y6RA 1LQTA 1P6QA 3SSNA 3KAPA 3CS3A 2DUWA 4O4IF 2MHCA 2PSDA 1XTQA 4JUBA 1UIRA 4US9A 3WK9A 1L4MA 3PGA1 1Y1LA 2QIPA 3G2NA 4DXDA 2HM7A 2DHZA 4N3GA 3V6MA 1E5VA 1OA0A 2OOKA 4W7IA 1MG4A 1NBAA 1OIWA 1D4ZA 2PZBA 3TVDA 2OP0A 2KMLA 1BDBA 4R1QA 3K31A 4QVGA 3UWMA 1JE1A 4NZOA 4ZQIA 4ZV7A 3CLVA 4IIHA 1NP6A 3QUSA 3PDHA 5CR9A 2CFOA 1R9MA 3CLUD 5BPFA 1CR2A 2XMSA 1WMHA 2IPAB 2Y3AA 1DEAA 4M0CA 4RACA 3VC3A 3CLSD 3GOHA 3UMJA 1YFZA 1A1SA 3V60A 2PBLA 2R7LA 5DBFA 4I1OA 5ILGA 3I32A 5LJLA 3S0JA 1WMAA 1SUDA 3P4XA 1B8NA 2I7CA 3E15A 1VCIA 5HQ3B 4AY3A 3RUIB 3TNFA 2AJBA 3G7UA 5AJYA 4OHPA 4G0ZA 2POCA 3TW6A 5CX4A 2MJ3A 5HQJA 3FPCA 2D8MA 3WAKA 3WNBA 1R64A 1L1FA 3O93A 2ZYSA 3MAAC 2F8SA 3OQIB 3WAGA 3U4AA 1TMYA 1QLHA 4UUOA 1BQ3A 4RCYA 5AW2A 2JHPA 5JTUA 2GA9A 3KZ1E 3T3OA 3D0KA 4ADSG 2AMYA 5E7IA 3E4DA 3O7WA 3REFA 5ETJA 2H7YA 3ICEA 5I3ZA 4NABA 4AJ1A 3N87A 2PBFA 1TW3A 1YDHA 3MJDA 3C6QA 2AG8A 1Y8RC 1FYVA 4RX1A 4DG9A 4RMNA 3SM9A 4AYTA 1F1BA 2JBAB 1EJBA 2CXSA 4IKOA 1P9OA 1N2JA 4FEEA 5I4CA 1EVKA 5GONA 1WYGA 1EJ0A 4NAMA 3VA7A 1E9FA 3INNA 4FZJA 1UGJA 1M1NA 2QN7A 3KOZA 1P7EA 3UQYS 2CNWA 2LV8A 2WYUA 3O83A 4RF2A 4A73A 2D3GA 1E2IA 1PUTA 5BO4B 4ZQEA 2GUGA 4I1VA 2QD4A 4CLRA 4YFYA 3BMCB 3CEPB 1IU9A 4CETA 1Z08A 5LP6B 3Q2IA 4UFNA 4OLAA 4NBWA 4RSHA 2C8LA 4QU9A 4WK4B 2ZAOA 1JKMA 3DMTA 4IINA 3EDCA 4RHEA 1D1SA 5KB3A 1YL5A 3RAPR 6NULA 2JU6X 3M1LA 1OZFA 4KO4S 2NAPA 1GB4A 3SJZA 4PLZA 3HADA 5J1SB 2RGXA 3H9CA 2O8DB 3K15A 2OTCA 3KT6A 4UQOA 1XLQA 5E4JA 4M9XA 5I7OA 2X0JA 4ZO6A 4D4HA 1P98A 4I4LA 3LHSA 2FPPA 2O5EA 3BCSA 5LQKA 3RWBA 5ER9A 1RLJA 3R5SA 3V1KA 1BKSB 2PUHA 2WNSA 1MB3A 1PDXA 3RSSA 3GRCA 4FFPA 1THGA 4ZYTA 4V0KA 2WLSA 4PZEA 2REBA 1E7SA 4JU9A 4CJXA 1Z75A 4JT8A 4NAVA 2BMFA 3URKA 1Z5PA 3RFTA 3LTNC 3L6UA 2V5VA 2B1QA 1QIMA 3S1AA 1GPXA 4FU0A 3HY3A 5KNDD 1GTL1 1EVEA 5AM1A 1FRRA 4RJTA 4INAA 4GT1A 3ZBUA 1NVFA 3DHVA 2EFEB 2SCUA 1PR9A 2FU5C 3Q1KA 4EBBA 3HWRA 1N3IA 3GFRA 2QS9A 1XRPA 3ANSA 4W5OA 3BC1A 3F96A 4BNLA 2YN0A 1ID1A 1D2NA 1DIHA 1MT3A 2CU1A 4I7EA 1WXDA 3U3ZA 2QE7D 3GLSA 3MWDA 1ZHFA 3DUFB 1H1LA 1SU8A 1VL1A 2H4WA 2HEIA 3QGMA 4XCVA 3VHTC 4QFCA 3PNQA 2PEAA 1OGYA 1W75A 3AR3A 1IOVA 4K81A 1HYBA 1T9HA 3CIFA 5IVDA 2VEDA 1R9JA 3KVNA 3A9KB 4AL4A 5JASA 1RCTE 3PXXA 3VSBA 4OOFA 1RWBA 3AC0A 3UK1A 4LHEA 4IQ4A 4F5EA 1NQWA 4M87A 3WFJA 1TKRA 1Q1EA 1RAGA 2D74A 1FUYB 2HMSA 3W4IA 4JBLA 3GHYA 3VHXB 2IC5A 3RF7A 3I2JA 9ATCA 1EU3A 3GROA 1R7SA 2LXNA 1X3LA 1QNLA 1OI4A 5CM9C 1E2LA 3LHKA 1II8A 1BWQA 4DYDA 4HLEA 5JTTA 2RHMA 3DE2X 1NJ5A 3UF0A 4FFWA 4LF5B 2I6XA 1MC8A 5EJ4A 2BRUA 1QIHA 4ALLA 2V6IA 2Q5EA 2J0MA 4WINA 4JVOA 1A7JA 3TN7A 5A05A 2RGEA 1YK1A 3RYCA 3CFYA 5BVGA 4TN1A 1E3EA 3JD2A 1YZNA 1E98A 3IQDB 1K9VF 4CZ2A 1I9GA 4XM0A 2J07A 4LDRA 3I4FA 3HRIA 1COZA 4FMPA 4TTSA 4ZO9A 2Y0CA 5COAA 4YH1A 1APBA 4IHJF 1F0NA 4KMRA 1V5GA 5LQDA 3M82A 1KDPA 3K73O 3HFSA 4PTZA 1R6BX 1L5WA 3R8FA 4QHSA 2WVAA 5K3FA 4LZLA 3SYRA 3DAOA 5EQTA 1YF3A 2RD2A 4UKDA 3UWDA 4AD8A 3HCRA 4Q3KA 5BWOA 3OD5A 1AQ6A 3ZV6A 2ZIVB 3C45A 1S0UA 4OLJA 3HVKA 1A9SA 5TMBA 1JA0A 5D00A 4WNCA 2ATVA 1FVXA 2K22A 1G98A 1T1EA 4C4SA 3WZLA 3NI2A 4MPDA 3C6YA 3QBJA 2J0EA 1SO8A 2FB9A 3BBPA 4CLOA 1YCDA 4DHZB 2Y1XA 3A1VA 5TS3A 1GRNA 4QDTA 4ILEA 1EP9A 3IAS6 1D4FA 4IJMA 4Q9NA 3LMKA 1QRSA 4K0KB 2G0TA 2V6FA 3VSCA 4W6QA 1LJ8A 1Y34E 3AI7A 2Z0MA 3E03A 1O2DA 1LUAA 1LQ2A 4HZIA 2OPBA 3FMIA 3JQGB 3OE1A 3OZTA 4BB0A 1XZBA 5BNTA 3K96A 1OWOA 4QFMA 2N9XA 3CG4A 4WXMA 3O1JC 5A02A 2C5LA 5JOQA 2EZUA 1GFZA 2CLHB 2B82A 5JC1A 2HO5A 1GOZA 4M99A 3CCCA 1NMYA 2FZ5A 4TV8A 4YRCA 1NYQA 2TMGA 5IS2A 1E8YA 4YRQA 1O1YA 3WWZA 3UFXB 1BEZA 1MH9A 1XEXA 5DO9A 4G65A 3R7SA 4DG8A 1LTHR 2OB1A 3LP5A 2XWQA 5JAUA 2JJ2A 1M1XB 3P9CA 4UPEA 1U8TA 3QXHA 2XMZA 1U1EA 4FMCF 2XNDA 4ZU1X 3OJWA 4W1QA 1G55A 3EXHB 2HQ1A 1XZPA 3VV2A 4IJUA 2YFKA 2G5CA 3P26A 1BJRE 1B1AA 5C9ZA 4DIUA 4FJ1A 1K68A 2IYYA 3I6BA 2VK8A 3TD6A 4EGCB 1GA6A 4IM2A 5IAOA 1P73A 1N7GA 2I6TA 4OSEA 5A4DA 4EELA 1KQNA 4JODA 3TEFA 1SBNE 1T4MA 1MVKA 2KX0A 1EKXA 4KZ0A 4C4PA 1QHYA 4IJQA 3I61A 4MI3A 3PUYA 3EIXA 4HQNA 4TLCA 3LI2A 3NAQA 1E61A 2C3OA 1KTVA 1IATA 4UZFA 1QTIA 4EB6B 1VTKA 3HGQA 1CJSA 3MJEA 2FA9A 4CKXA 5AVOA 3G82C 2NAFA 5FI5A 1E7WA 2VOJA 3MLAA 4ZVUA 3H7SA 4EA9A 3DW3X 5L4NA 1E2QA 3PTFC 1V2HE 2K2QB 3A32A 4DR2B 2PGLA 4QNRA 3TLKA 4YALA 5A2QA 3DDHA 2D8AA 2O8BB 1WDLA 4RYLA 2C4HA 2Z95A 1WP4A 3IAM6 5EUMA 3P9IA 4WUVA 3PIDA 4IW3B 3SBEA 1B3RA 3CXRA 1PYOA 2L2QA 1QIFA 5KO2A 4WOPA 1AXRA 1UUFA 3DVGX 2FPKA 1SXJD 3CXUA 4JIMA 5IAAA 1IHUA 3DCYA 3QP9A 2CXNA 1QFZA 3N3AC 5DWVA 5HI1A 2RHOA 5BNIA 3F9CA 3VVBA 2NZJA 4BFYA 1IM5A 1C9KA 3JW8A 3S27A 1GV0A 2IYRA 3MTJA 5K05A 4ZHPA 4Q3LA 2I2YA 3SC4A 4Q4JA 4RPCA 4R71A 2QTHA 3IAHA 4Y1GA 5LQJA 1LQUA 2EJTA 3E84A 3Q3EA 3GQVA 4DMCA 4CKBB 2HZBA 2I7XA 5ALGA 1Q7TA 4DLXA 1A71A 3SQMA 1OA1A 3A10A 1GGEA 2VT6A 3CNNA 3KZVA 3G0CA 1R0CA 3RT7A 2ZT7A 3M89A 3SDLC 3C3DA 4IWXA 1VIVA 1Y6JA 3JQFA 3RS2A 5CBPA 1YZVA 2C00A 5CFNA 1C3EA 3RREA 5K8IA 1L4DB 3AL3A 4GKAA 3OC6A 1UEIA 1P2SA 2QEJC 3LRXA 2SHKA 4RJJA 2VZ9A 4DC0A 1WSAA 2GK3A 4C30A 5IVIA 4NOLA 1KVRA 1OLUA 4MZDA 2VEOA 2CHXA 1NMXA 4C22A 1DU4A 3LZCA 4P4SA 5GZ3A 2E2WA 1NQOA 3F3KA 4ARCA 4N41A 2DZDA 3BK2A 2BBTA 1UJMA 3R7AA 1E2HA 4MRPA 2XKBA 1C4OA 1KJIA 4EEZA 1KDRA 1U94A 1HZ5A 2AI1A 1QGUA 2XGGA 5ARDA 3MVEA 2PO7A 2PU7A 2PUWA 3ENZA 4HUJA 1AKRA 4A8JA 1WE2A 3U4HA 4N0PA 1UAGA 2QUKA 4JJ6A 4MINA 3DOHA 1KJQA 2XCRB 3K53A 1P7PA 2Q3FA 2WFZA 4QDXA 3OLXA 1GFWA 1N6NA 5HKLA 1L5HA 2YUIA 4IYRA 4G0OA 4H0FA 5KNCD 5EERA 3UO8B 4D8XA 1S8AA 2Z56A 1NSFA 4WWPA 1B26A 4O4JA 2XQGA 2FR8A 1NPYA 4DNPA 4EKUA 2LGSA 3PQ2A 3JALA 3QLVA 4BGIA 2A2ZA 2H4YA 3NTVA 4JUCA 2BI8A 3HHPA 3CT4A 4QRDA 4GDLB 3GQBA 2ANBA 3WNDA 4F2GA 2ORED 5G40A 1YRAA 1H4TA 1ZNQO 5FORA 2HRCA 3TNDA 1SOUA 3GLGE 4CGZA 4Y18A 5DW3A 3O91A 1HNNA 3PENA 1QDLB 1EP2B 1QGYA 4L6CA 1WSBA 2NV0A 1NLYA 2VHVA 2BKXA 4G67A 2PRIA 3Q8LA 5TQVA 1VG1A 2OAQ1 4YSYB 2KQSA 3RSFA 2VZEA 1I4GA 5BN5A 2OSVA 1F0ZA 2LRWA 4FFVA 1Z6QA 2OGTA 1JSRA 1CF2O 5FX2A 4W5RA 3OZDA 1WLYA 4U39A 3ENEA 2UZ3A 1C3VA 3GHHA 2WLTA 1D6SA 2RAVA 4Y2TA 5LWHA 1TYGB 2GXQA 1I4RA 5ANRB 1ZVMA 4M83A 2WTAA 1N9KA 2X2PA 4OKSA 3LF1A 1GADO 4QG7A 4BLWA 3W6PA 4KG7A 1USGA 3WDLA 1O9HA 1Z29A 2Z9BA 4I9UA 5A5VA 3NZEA 3HVHA 1R0WA 4DJ5X 3ISTA 4O3MA 1AM4D 3GLFB 2PQMA 2J9FB 4AURA 4HLDA 1P61B 4Z2AA 2OV2A 4M0FA 3RVOA 1IY1A 2I5PO 1V16A 3ER6A 1KOTA 3NC1C 1PZNA 1KZ4A 3EGIA 4KU4A 1HEUA 3GS2A 4N6OA 1JHQA 1VYTA 5DW0A 3O74A 3CX7A 4OB7A 1UMKA 2P69A 4P22A 1LEHA 2NO6A 4TSKA 2WJHA 1F8GA 2O57A 1TS2A 3RC9A 3VPAA 2PMDA 1USVA 4ISBA 4FHZA 3K8ZA 4L4YA 5LMUB 3OIWA 3FE2A 1YN5A 2F1JA 3PFCA 5DP2A 5J23A 2OD9A 1A2BA 4UU7A 4RENA 4C29A 3TNLA 3Q3GE 5DEOA 3QQPA 1XX6A 2CK3D 1XRNA 4X0EA 2J53A 1NBWB 3NZUA 1NONA 3LVBA 3H4VA 4JSTA 4AYXA 1KJ9A 4U9UA 3AJEA 2AMJA 4JC8A 3BOSA 4B2PA 1Q7BA 2LRHA 2QXYA 3HY6A 2AVNA 1X1CA 2QI9C 1YZ3A 2KDBA 4Z7NB 3WIEA 3JZMA 2GBNA 4E3WA 1SG0A 1HEZE 2RGNA 1Q7EA 4A7PA 1S4MA 3ELYA 1U9JA 1YRYE 3QWFA 5ITSA 2D07B 2I1VB 1N6LA 1QHHA 3GE8C 1U1GA 3C8DA 1YNOA 2P4SA 3L79A 2YW2A 1REQB 4CUZA 2UZ4A 3W6ZA 3SU8X 1K89A 2BEKA 2NLOA 2BGTA 3FW1A