4A9AA

Structure of rbg1 in complex with tma46 dfrp domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
368
structure length
356
Chain Sequence
STTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRRELLTSGAGIGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIIDGGRGKQVIAVARTCNLLFIILDVNKPLHHKQIIEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEASSRRYMPAIYVLNKIDSLSIEELELLYRIPNAVPISSGQDWNLDELLQVMWDRLNLVRIYTKPKGQIPDFTDPVVLRSDRCSVKDFCNQIHKSLVDDFRNALVYGSSVKHQPQYVGLSHILEDEDVVTILKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rbg1-Tma46 Dimer Structure Reveals New Functional Domains and Their Role in Polysome Recruitment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords RIBOSOME-INTERACTING GTPASE 1
total genus 116
structure length 356
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF02824 TGS TGS domain
A PF16897 MMR_HSR1_Xtn C-terminal region of MMR_HSR1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a9aA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a9aA02
5HR5A 4Q4AA 2CXXA 2CL0X 2YWGA 4KVGA 4EDHA 5BN5A 1Z5ZA 4JLBA 5B64A 3EWAA 1U9IC 1W48A 3Q8XB 4AYTA 3AE7B 1DG1G 1KI8A 3UPUA 3IIKA 4MKHA 2C04A 3IBGA 1L2TA 3OEHA 2ACZB 3PV0A 1NI3A 4KU4A 3TUZC 2PMDA 4LJ7A 4RFVA 4V0KA 4HZIA 3K0CC 2QGNA 2QENA 3QE0A 3I5YA 4PHFA 1B9RA 5AJZA 3GQBA 2ZYWX 4JYBA 1WXQA 4NONA 1EK0A 5G41A 3AE1B 5HCIA 3AF3A 3U3KA 1G7CA 4CEHA 2O8EB 1EFTA 2WJHA 2X2FA 1MOZA 2XJ4A 4BLOA 4B76A 1KOFA 1T6NA 3DWGC 5DHAA 5HKKA 2Z0MA 4PPFA 1I4TD 1Q12A 4CEJB 3PIRA 3ZZUA 3BGWA 4I1VA 1P5ZB 3EA0A 3TVDA 4ILEA 1S1CA 2ZRIA 4XVUA 5DNYB 1WRIA 3WRYC 1W4AA 3Q9LA 3BIID 4YMWA 2FSFA 3SFDB 2GXSA 2AR7A 3QKRB 4PC6A 4C7ZA 1GP2A 4DSUA 2PVOD 1US8A 2QT1A 4EFLA 1ZOYB 3SQWA 4KITB 1NLFA 2BHRA 1KDOA 1J90A 4QHSA 3Q5EA 4HATA 2GXQA 3GJ3A 2BBWA 2HYIC 1Z0IA 3KJGA 4BLPA 2G0TA 2WAXA 1E9AA 1CIPA 4ZDJA 2QSZA 3LBIA 5C4MA 3HPQA 5JECA 5EJEA 4Q1AA 2X1VA 3RDPA 1R0ZA 2AD1A 2V7QD 5UKDA 4HAVA 3FHOA 1PJRA 3GLHB 4M1OA 3SBEA 1QF9A 3K9NA 4R71A 2GJKA 5A0FA 3AKDA 1LY1A 1XTSA 2P67A 2WQYB 4NDZA 2HXYA 3PUWA 3DPUA 3EZ6A 2RGGA 3QF4A 3C14C 3U4QA 1ELOA 1AN0A 1W0KD 3ZS8A 4RFSB 1WE2A 3AEDB 1FM0D 3MMPA 2JIZA 4TMVA 521PA 4JKIA 3WNBA 3NDBB 2YKGA 4YTPB 3ASYA 1KZ7B 1TAGA 3WYFA 4JLKA 2GJ9A 1EX7A 2NO7A 1SHKA 1WBDA 3QXXA 3NIBA 1RFKA 5G5GA 1SXJD 4KVAA 2WOOA 1G18A 3LVQE 621PA 2Y5CA 3OEED 5F3WB 1DAHA 4PO8A 3NVZA 2QEQA 1OIVA 2QTVB 1DOAA 5BYKA 1W4BA 2CCKA 4BLRA 5JBQA 5E4FA 1Q1QA 3W5JA 1IY1A 1YVDA 3GJ7A 4RZXA 4QFMA 1UKZA 1YZGA 1UBGA 3UG7A 2QY9A 5LD2C 2EFGA 4QJ3A 3SHWA 4RZ2A 4LY6A 1UM8A 3NVWA 2BKEA 1E99A 2J41A 2EW1A 2JCSA 4FMCF 4JWSC 1JJ7A 4OQXA 2HYDA 4AK9A 5JCZA 5P21A 5AJVB 2L0XA 4B3DA 1R0YA 5JSZB 5CM8B 3ZZTA 3W90A 1SKQA 2FE4A 2JLVA 4OK6A 4L4UA 2D06A 3AQ4A 1FP7A 3LD9A 4RJLA 1KZGB 2JDIA 4C0AC 3R9XA 4Q19A 1HH4A 3B7GA 4F4JA 2HEIA 2MH7A 2RGDA 3U6KA 4B3GA 1FRDA 3FMOB 1W44A 2JGNA 4D0GA 3MUFA 4ZV4A 1MV5A 4LWZA 4URUR 1J70A 2H92A 1CJUC 5GVRA 1V97A 2IYUA 1MR3F 4CW7A 1KF6B 4KFTA 2I1QA 1HA3A 1KTVA 1OXTA 4QJ5A 1M7HA 4NYIR 3IIJA 4LV8B 1AK2A 4ZO4A 4HAYA 4QNMA 1P75A 1YR6A 3RLFA 2XB2A 1NSTA 1G20E 2DY1A 4RKEA 2ZJAA 1P60A 3OIUA 3CLVA 3RS5A 4LYAA 1IXZA 2LWIA 4RZ3A 5EE1A 3AM1A 4JS0A 2XOKA 3NXSA 3BFVA 3U3JA 1US8B 3GLFB 1UDWA 5JHGB 5FOTA 2W00A 3WMEA 1G7TA 3CX7A 1B23P 3P4QB 1JR3D 3NC0C 4WOPA 4UXJA 4OI2A 2A9KA 1YZNA 2ZYUX 4X8LA 3QY0A 3NDPA 2X8AA 5CB8A 2ZRAA 3I5XA 5L3QA 5JI3E 1KI2A 2IHYA 4Y0VA 3TNFA 5FTMA 3FFBA 3UK6A 4X8MA 4CDGA 3ND9A 1ZXIA 3T35A 2IS6A 4ZHPA 3DHWC 5BXQC 4CEHB 2GBLC 5AR1A 2CMKA 2MJ3A 4NP6A 2BEKA 4ZCLA 2G1EA 3D3QA 3B9QA 5E7IA 4QBGB 3ICEA 1T4GA 3FMIA 1FNMA 1GKUB 4Q7KA 2JATA 1Z63A 3LXXA 5CDFE 1NVID 5FOXA 2VP9A 1KDTA 5DIFA 3TK1A 2GK6A 4HDOB 4B3CA 2IXEA 5IK2A 4YMUA 3TQCA 1U0LA 3DDCA 1L5PA 4Q9LA 1X3SA 4ZIRA 1EWRA 2GZHA 2WPDA 3QSYA 5CDFA 1JQLB 1V5WA 3AECB 3GFPA 3PCRB 1G5RA 4BUJA 1M6NA 1T9HA 4C0KA 3B1XA 3EG5A 4EPWA 3AVYA 1SKYB 4O3MA 1LW7A 5BW8A 2B7BA 2ONKA 2P5SA 3CWQA 3QUSA 5FTNA 1VG8A 3U3RA 1ZBDA 4PQRA 1R8QA 3K70C 2QA5A 1EFUA 1FX0A 3BB4A 4KJZA 4BRUA 3VRBB 3FTQA 2FEMA 4G01B 1XBTA 4MRSA 5GJWC 4TLEA 5F2EA 4CZ2A 5AJWA 1ANKA 3AKYA 4C9BA 2DWQA 2CNWA 2O0HA 2IYYA 4UNNA 1ZNWA 3AF1A 3L8ZA 2AX5A 1G4AE 2FZ4A 1QF6A 2FMXA 2Q9CA 1QHHA 3HRDD 4NCHA 5FBRB 3SOPA 4Q03A 4RFSA 2XNDA 4Y0AA 4DIDA 3QXJA 5B30A 1OLOA 2YNMA 2PIAA 2KB0A 1ZNZA 1KO7A 5CJPA 4TYYA 4LV5B 2ZUCA 4BLSA 3P32A 4JBYA 4V03A 4N59A 1IJEA 1CRPA 2B8WA 4LSGA 3GP8A 3SFVA 2O8EA 4Q1BA 3KFXA 4GP7A 3AE8B 4OJKA 4W9MC 3ADCA 3PUXA 1CJEA 3I1FA 4IOJA 4EPVA 4FWTA 2O8FA 2VP6A 4U5XA 1E2KA 4PC1A 1XXHB 4BFZA 2OO7A 2QTHA 4TT3D 1VECA 1F2TA 2ZETA 4MKFA 3QF4B 5KHOC 2ODEA 2GF0A 2JIZD 5AUPB 1XRJA 1AS3A 2BVNA 5EE0A 2HUPA 2GXUA 3B60A 2ZI4A 3K9LA 4HUQA 4Q9JA 3KJIA 2IF0A 1BS1A 1LV7A 3O8BA 5KTYA 1RJ9B 2ANBA 3U44B 2O8DB 2VHCA 3THXA 4J0QA 3TW4A 3EPKA 5H8YE 2IXFA 3OF5A 4I81A 1G8PA 4USAA 1SVMA 3GFTA 2XITA 2REXB 1N60A 1XMIA 1XPRA 2PMKA 4BWYA 2GBLA 3CX8A 4P32A 5CLQA 3LDAA 4XVRA 1SF0A 1GFIA 3THWB 3VAAA 4HAWA 3KXKA 4GZLA 1BYIA 1FMAD 4HLUA 3PJRA 5KNCA 1IUEA 3CRW1 4X8HA 4D4LA 1VLBA 2UZ3A 4G5RA 1XPOA 4RSGA 4BFTA 1TF7A 1E2HA 2WJJA 4FXPA 1Z29A 2ODWA 1N2CE 3U7FB 2ZRHA 3THYA 3WNDA 1YRAA 1PUJA 4DC9A 121PA 1QHNA 4ZOHC 4DUGA 1IN6A 1QOFA 1D8TA 1N5KA 2GZAA 5CK4A 4XSGA 1M8PA 2ORVA 4DZZA 1ZD8A 3DM9B 2B6HA 3RYTC 4OK3A 2HXSA 3RVBA 1KK1A 4BFVA 4MKGA 1MH1A 4PZZA 3LRPA 1YJIA 1L8QA 1R0XA 5FUYA 2Q6TA 2WWXA 4TTPA 2JJ1A 5HKKD 2QI9C 4IDPA 1CZPA 1BOFA 2FEOA 4IFBA 2FV8A 3R9IA 5AUIA 1NVVR 2H88B 2J0UA 3PUVA 4A0HA 1XP8A 5EZ5A 5H8WA 1EESA 5AJXA 2ZQ5A 5DI9A 5G53C 2L83A 2VPPA 2H89B 2W54A 1CJMA 3WRXC 4CRWB 4N1AA 4ZDIA 5C1BA 3VR3A 1W36D 2FX3A 3RRYA 2EVWX 4MGKR 2BKUA 4DCUA 2BT6A 1FMJA 2KSQA 3M6AA 4MQBA 3MAAC 4P3YA 3GLGE 4KCGA 3FAHA 5A5GA 2YINC 3RS3A 3ADKA 4IVQA 4XWKA 2XZOA 4BFYA 4TZ6A 1FZQA 3X1XA 2F6RA 2O8CB 3IEUA 1EWYC 1U81A 2UZIR 3WP1B 4JBWA 1T8TA 1R4AA 2QORA 3GLFA 3CONA 1QVAA 3RRMA 1N6LA 2O0KA 3P1JA 2XB4A 4M1MA 3GEEA 2QUZA 4DT1A 1QOGA 1CJTC 1KO8A 5ELXA 1J2JA 4TYPA 4O25A 4YXWD 4U00A 1OFTA 3DZ8A 4AURA 4TLDA 2WMNB 1G4UR 3BK7A 3C41J 3TLXA 1CJKC 1COWD 3QPUA 4DLRA 3QBVA 4E09A 1H65A 1R5OA 5FUWA 1BH2A 1VYTA 2Z6VA 4PPGA 1QVRA 2MMCA 4DWJA 2QQEA 1RRCA 1PV4A 3I73A 4BGDA 3D7MA 2CU3A 2IUSA 3N2IA 1PUIA 2EFDB 4S2EA 2C78A 3MWJA 3VKWA 2NPIA 1OQRA 1HT2E 4OKSA 1E3MA 5JJKA 3ZVMA 3EZFA 5L3SB 1NG1A 2IHBA 3PUZA 4LDJA 2HF9A 3QKTA 1OXXK 2PLFA 4LV6A 2VA8A 1TQ6A 4PPNA 3NRZA 4RD3A 4D0NA 1GIAA 3BC1A 2CLSA 1Z2CA 3UANA 4HDCA 3A4NA 3K0EA 3UWOA 1Q22A 2FWRA 3I4LA 1R8SA 1LTQA 3DL0A 2J0QA 1IN7A 1UF9A 3KZ1E 2X77A 2B76B 4G5SA 3WNCA 2QE7D 2QSYA 1OIXA 2RHMA 2OM2A 4P31A 1OH8A 1X6VA 1B0UA 2QAGC 3CF2A 2A2ZA 1AKEA 2IYXA 2FH5B 2NMVA 6Q21A 1H8ED 3BH6A 1KY3A 1AYFA 4W5JA 4BZXA 1MRSA 2FA9A 4Q1FA 3SJZA 5CJ2A 3CZPA 3SR6A 4JVMA 2C5LA 2A5GA 2RGNC 3K0AA 2VEDA 2J0SA 4IHQA 1MABB 1TQ2A 5J4LA 2C9OA 4B3XA 2ANCA 2RGXA 2ZSBA 1XXHA 1NG9A 1E2NA 1F3OA 3AF2A 2YWEA 1ZW6A 5L8VA 3LX8A 5LD2B 3W6NA 4DLYA 4BEBA 4JWUC 1G3RA 3AVUA 1E9SA 4D4JA 4R9UC 2Q3HA 1IXSB 4ACBA 3W5VB 2W6ID 4X8OA 1IBRA 2C95A 2Q3MA 5G3YA 3RS4A 1JJVA 3W34A 4C80A 3RC3A 4BQSA 2IYLD 2F7SA 1TF5A 2FNAA 3QPWA 4JJZA 1C9KA 1RRGA 1GSIA 2CK3A 2QM8A 1JEDA 3BH0A 4H1UA 3DZDA 3PUYA 4PO1A 4V02A 2IWRA 2IS1A 4PC2A 4IW3B 1RPZA 4MDEA 2XJ9A 5CIWA 1N6RA 1GILA 3BD9A 3BXZA 3KTAB 3NTUA 4PHHA 4A36A 3MGCA 4L5BA 1F2TB 1Z6GA 2A5FA 4P4SB 4KXFB 4TSFD 1Z08A 4I1UA 4KLZA 3DOFA 2XGJA 1C1YA 3LW8A 4B6EA 1UKEA 4IOLA 4JLVA 1VCIA 4C0JA 1OFHA 2IUUA 3N5CA 2G9NA 1E0ZA 2J59A 3LFUA 2FU5C 2GNOA 4MGYR 4OBEA 5FI0B 1FUUA 1JR3E 5TDHA 3P4YA 3GJ4A 3HYTA 4WZBE 2GA8A 1KI6A 1XEFA 3ZVNA 5EQTA 2IA5A 2QGZA 1N6HA 2OV2A 2KJQA 2W2VA 4EQ6B 2F1HA 2W6IA 5BN4A 1XCMA 1WMSA 2B8TA 1E69A 1ZM3A 4UJ3A 3AM9A 3SZRA 1UADA 1Y63A 2XZLA 2JJ8A 2ZRDA 1XZPA 3LY5A 2C9YA 2GESA 1Q1EA 1HE1C 4ACAA 3DVLA 1OB5A 4UJ5A 4NTZA 2BBSA 3H0KA 3TBKA 2ZRFA 3SHFA 3H1TA 1W2GA 4JL8A 3C5CA 2J0UB 1YZKA 1N63A 1GITA 4PZLA 2BEJA 2C96A 3HP1A 3U44A 1NVUQ 2R6FA 1DARA 3X1ZA 1T3QA 2JLZA 1A1VA 2ZI5A 2OHFA 4FIDA 5EP4A 3H84A 5H1YA 4LUCA 1YR7A 4HRSA 2QRNA 2ZANA 3B2FA 1X8KA 1F5NA 4GFDA 1Z8FA 1P9NA 4IJMA 4A2WA 5MPOA 2J5XA 3GJ6A 4Q7LA 5FI1B 2QTFA 4FMCB 5FFMA 1XJCA 5D3QA 1J8YF 4US0R 2ZRNA 3THYB 1TQ4A 1GTVA 1I2MA 2PZGA 2W0MA 4QBFA 4MRPA 2QP3A 4AI6A 3BAFA 4KSCA 2IYQA 2WSSA 2FBWB 2J7PA 3FVQA 1KDRA 2I4IA 1G19A 5TXGA 1TTTA 5FOSA 5G40A 3TE6A 1W36C 4QJ4A 2R6AA 4TN1A 1N5LA 1NY6A 4TYWA 3VR2A 1KAGA 3PVSA 4BZPA 3W9YA 2ZR7A 2NOAA 4JZKA 2BMEA 3PEUA 1JAIA 3WMGA 3A58B 1AIPA 2IBMA 1RW4A 2NO0A 1N62A 2AKYA 3K0AB 1COWA 2C8VA 4B48A 4G0NA 1EFHA 3P4RB 5GXGB 4ZKEA 1GNQA 2AFIE 2OT3B 3OFNA 5LB2A 4XTCS 2O8FB 1WGKA 1E98A 1JPNA 3B1VA 1NIJA 3K0FB 5H70A 1VYUA 2BIFA 4MITA 2H16A 2ZI9A 1Z0FA 3ABVB 1NLYA 1SZPA 1VIAA 1VG0B 1QG2A 2WAYA 2BMFA 3CKLA 1A5TA 5DGXA 4N0EA 2RGBA 5DI3B 4IVRA 2VLIA 2IEZA 4LGMA 4OQMA 3GLHE 2HLDA 4NPHA 4QGFA 1NVXQ 5KSZA 2VQSA 3A37A 3L2OB 2SHKA 4IXMA 2P2LA 4B3FX 3NC1C 2QL6A 2RCNA 4KFUA 3UMSA 4DRZA 1OH7A 2QBYB 2R2AA 2YVUA 1II0A 2XTMA 3CH5A 1YZLA 4KFSA 4WXPA 4A6XA 3P4PB 3RWOA 1CU1A 4QBIA 4EUNA 2KBFA 5SZHB 4DB2A 1JR6A 4DLXA 1XTJA 4S35A 1TUIA 3FGNA 4KFRA 3REFA 3AVPA 3VR9B 1Z2AA 2Q9BA 3C8UA 3IHWA 3IQWA 2HV8A 3IQXA 4LYFA 2MSDB 5F98A 3SYKA 5JFGA 3PENA 3EX7C 3B1ZA 5SZKB 3P26A 4XD7D 3J81k 4JX1C 4JT2A 3SFEB 4Z8YA 5EXSA 1E2EA 2ASEA 4DT1B 1RE0A 1K8RA 1UBCA 2K9XA 3AEFB 4YSYB 1NN1A 4EQ6A 2CJOA 3CF0A 4IDIA 4LX0A 3AE6B 5AUQA 2R44A 3CWZA 4M9SA 2QRZA 2NO1A 1YR9A 1QBKC 4BFUA 3HR8A 3TUJC 2C77A 3D8BA 3B1YA 5JJLA 1FTSA 1UKYA 4LBVA 4Q1DA 3UIEA 1KI4A 2PX3A 2IW3A 1KJZA 3LQRA 4K8OA 4NMMA 4OHWA 1FO4A 1AM4D 1S3SA 1SKYE 2H18A 5FR2A 3SJAA 1JALA 1G6OA 3L0IB 1E4VA 2FDCA 4A8JC 2N0SB 2RGAA 1VPLA 3SJBA 3L0SA 1IONA 1W0KA 1ZUIA 5KOYA 3TR5A 4YSZB 3OE7A 5FOUA 4NHOA 1TX4B 4QHYA 3LV8A 4ZDKA 3SJCA 2AX4A 1XNJA 3UXMA 4LHXA 3ZDQA 1RYHA 3ONWA 4MGIR 4AKEA 4URXR 1AGPA 5FH9A 1T5LA 1XMVA 1M1YE 4JVSB 1XZQA 2WKPA 1NRJB 1E2IA 5FBLB 1JI0A 2AN9A 2VF7A 4OK5A 2GAAA 1X1SA 1CBUA 1FPMA 1DELA 1XTRA 2DPXA 1TYGB 3OE7D 2WHXA 1E7PB 3RANA 2QQ0A 3R9WA 4NE2A 2HJVA 5J40A 1KNXA 1ZM7A 1JXMA 1ZC4A 1NVWQ 4GRAA 2VSXA 4OI4A 1X86B 1Z07A 2QNRA 1D2NA 1VDVA 3LB8C 4H9GA 2OG2A 3LNCA 3LVRE 3MJRA 4P4SA 1XLQA 1HE8B 1U98A 4K81B 4QC2A 1XLPA 3U7GA 1WB9A 3P27A 1NN3A 4Q01A 2KWIA 2WOJA 1TEXA 4QGAA 2CK3D 2F9MA 3P63A 3TR0A 3M4YA 2NQ2C 4KLNA 4B2LA 5LDDC 4EJSB 4IXNA 2F55A 1SXJA 2W83A 4DEYA 3T61A 5J4KA 2NTYC 5H68A 3SS8A 2YYZA 4G3XA 4CEJA 4B32A 2NPFA 1Z6AA 1XWIA 1OT3A 1II8B 4DSTA 2W3SA 5H92C 1LF5A 4HLCA 3K70B 2IS4A 2ZJZA 2C9CA 1UEIA 3AEEB 4NBSA 5CLLA 3LAWA 4O0MA 2CL7X 2DFKB 3X1YA 2FF7A 4LHVA 2H1LA 3EW9A 3QQ5A 1W2HA 2ZJBA 5CYOA 4WVFA 3SYLA 5BWMA 1XEXA 3D31A 1WRBA 1E0AA 2BM0A 1D6JA 3W5IA 3FMFA 1HYQA 3CNNA 4RVCA 2W2XA 3MSXA 2WWIA 4GBMA 2KI5A 3IPXA 3NBFA 1NIPA 1T5IA 1YZUA 4AG5A 3CM0A 2P6UA 4AIIA 5JRZA 2G3YA 2VP4A 1E32A 4TMWA 4A0GA 2HT6A 1R0WA 3KQNA 2J3EA 1K5DA 3THOA 5K8IA 2GDJA 4HAXA 2CCJA 4OQLA 3SR0A 4KV9A 4ZCIA 2CLCX 2BCJQ 1QHSA 1E0SA 5C46F 2ZEJA 3UMFA 2QAJA 4R2IA 4M0LA 1BYUA 3RHFA 1Z0DA 2Q9AA 4B44A 4D4MA 3FC4A 2REBA 3ZH9B 4D6PA 1P2VA 3KXLA 4MDFA 3B8HA 3EC2A 4BRWA 2EQBA 5AUOB 4Q21A 4CT5A 4DLVA 1XU4A 1UBEA 2ZYTX 3AF4A 3TSOA 4PTLA 2QT0A 3KKPA 5JEDA 3QJYA 4TYNA 4BZQA 5FL3A 1Q0UA 1X8LA 3BORA 2C98A 1OF1A 1SGWA 3NEJA 4NKRA 4BFWA 3KQHA 2PVGC 1IY0A 1ZP6A 3HYRA 3V00A 3C16C 3EWSA 2P6NA 2UVQA 4E5UA 1W0JD 1AA9A 3CZQA 4Z54A 3MCAA 1IN5A 1BKDR 1MT0A 2CJNA 3FDIA 3K70D 4HB2A 1QOBA 1F48A 4E22A 2ECKA 3CF6R 2N1BA 1VHTA 4BE7B 5C3JB 2TMKA 2JQRB 1L6UA 4ZI2A 2D3WA 4QL3A 3VR4A 1EFCA 1OSNA 3CRVA 4URWR 3JZAA 1GVNB 2GCOB 4NCKA 4A92A 5DN6D 4DSOA 3IGFA 2ONJA 3T5GA 5FL7D 1OXUA 3I62A 3B1WA 1OFIA 3E5HA 3OIYA 3TVTA 4B74A 5KYKA 4QGHA 1D2EA 4TQUS 4Z8XA 4M53A 3BH7A 3PITA 5GADl 2G1JA 3P4XA 1T3HA 2Y8EA 4PAMA 4DCSA 4ZKDA 1JWBD 5HTKA 3WCQA 4JJKA 3KQLA 3FKSA 4I4LA 1S4QA 1A7JA 3ZS9A 4TYQA 3CB4A 4M1KA 4C0SA 4YT0B 1IHUA 3SFZA 1UWMA 3AH7A 4GMXA 3EPLA 1ZYUA 3U61B 4NYMQ 1SIJA 2W6JA 3KQUA 3OIVA 4D0LB 1GAJA 1ZINA 3VNUA 1N5WA 3TUIC 1Q57A 2CVHA 1FFUA 1DS6A 3AEZA 3HDTA 1DAMA 3KX2A 1GKYA 5DSZA 1K6MA 1SB3C 4MYCA 5B2ZA 4K46A 3GLFE 3NHAA 1TNDA 2ZE8A 2M19A 3K09C 5C18A 4PZYA 5TARA 2WWFA 1KI7A 2E9SA 4A2PA 2EWVA 4A8JB 1OXSC 1OIWA 5BN3A 2O5VA 1XD8A 2CVFA 2AD5A 1JAHA 1TU4A 3AE3B 2J45A 1KNQA 2VBCA 1KJWA 1RIFA 3NBZC 2OCAA 2Q0HA 4LI0A 4Q4AB 3R8CA 3B2EA 4L15A 3CW2A 4W7SA 5FOVA 1IOZA 4WQMA 3L4PA 1E0KA 1VCMA 1OKKA 4O2RA 1G7SA 4G1UC 4Q7JB 1FIQA 2QPAA 1N61A 1CR4A 1S8FA 3W3AA 2HT1A 3Q85A 1QRAA 4W5WA 3QI2A 3EPJA 2A5YB 3DO6A 5KNDA 1KMQA 5D3MB 2A7QA 5F9FA 1N5IA 1WP9A 2JLUA 2IL1A 3ZZ0A 4DDVA 5FTKA 3HU2A 5K8TA 4EPYA 4HUQB 3Q3JB 1HQYE 2W0SA 3KUDA 1RFLA 2I1VB 4UNQA 2D2FA 4FI3C 1D2MA 1P61B 3CR8A 4YC7A 3QKUA 2ZJOA 1P6XA 1ZUNB 4LRWA 3R7WA 4LJYA 1T0HB 1FRRA 1VMAA 2FPLA 1J7BA 1XFAA 4B73A 4M1YA 1Q3HA 1T8UA 3B82A 2R6CA 2FGKA 2ZUDA 4GOKA 2QBYA 5TY0A 1XX6A 5G3ZA 3L0PA 4P4UA 2JAQA 3U3MA 3UG6A 3AE2B 2QJLA 3CRMA 2WTUA 3T1TA 1QHGA 1XDBA 5LPNA 3LLUA 3JVUA 2MSCB 4OL0A 2CNWD 2H8KA 2JJ2D 2PBRA 3WP0A 4DXAA 4HROA 3EARA 5EE3A 2WMOB 1CP2A 3THXB 1H8EA 1HEIA 1W47A 1OW3B 4PSKA 4DCTA 3IO5A 3NBXX 4BECA 1DGJA 4XOIA 2VHUA 2OAP1 4ZPXA 2DYKA 5KPJA 4D26A 1SHZA 4BASA 4HLQB 4LPSA 2XTZA 2QMHA 3VKHA 1P2SA 3RSLA 1P4SA 2GRJA 3QVUA 4CVNA 3AVXA 1II8A 3AUXA 1LNZA 1QHXA 2I3BA 2X19A 2P65A 2IWHA 2LEKA 3WBKA 3A4MA 1CTQA 1EFRD 1QZXA 4M9XA 2F43B 3T15A 1F2UB 1HY3A 2P3SA 3BOSA 5KSOA 4RCZA 4IDHA 2DWPA 2VTKA 4N58A 1NKTA 4KI0A 1DAIA 3NG1A 2OBNA 4RCYA 1XB2A 2YWHA 4Z1MA 2QP9X 3K09A 3RS0A 1D9ZA 4MRVA 1HV8A 1WCV1 1CKEA 2EKIA 4HAUA 3SE0A 2QU8A 3AVTA 3AEGB 4MRNA 3KB2A 3K53A 2WJVA 2BV3A 1MO3A 1OE0A 3F3YA 2D4HA 4A2QA 3U2QA 4C4PA 2OZEA 4YSXB 1E2PA 5DLQC 1X8JA 2JLYA 5DO9A 2H7VA 4RD6A 1O87A 2GXAA 5KSPA 2IT1A 5GVSA 4WW0A 4ARZA 4RZUA 2WS3B 3SI7A 1H8HD 4WBSA 4LJ4A 2WWWA 4C2TA 4Q9HA 4OHXA 1ZCBA 2ATVA 2D62A 3KQKA 1T3SA 2AWOA 4OI0A 2HDNB 1E2FA 2ZRCA 3IUYA 3WXMA 3I61A 1DPFA 4URYR 4A82A 3OESA 3TKLA 5DYGA 4IVPA 3GLIE 1JECA 1DAFA 3A1WA 3KL4A 1CR2A 2ZSFA 3FWYA 2MSEB 4M1WA 1E1RD 1S2MA 1EX6A 2DFTA 1WBBA 1RVDA 4FINA 4WAUA 1II9A 2ORWA 2OXRA 3DWMA 2EWWA 3ETRA 1N6NA 1Y3AA 2YJTD 4P4TA 721PA 2ZIAA 3QKRA 4PO9A 3TMKA 4QM6A 4C7YA 3HWSA 1KYIA 1JR3A 4MUBA 3ETLA 1U0HC 4PHGA 1W7AA 2BWJA 2FOLA 5DH9A 3V4FA 2GCOA 4ITKA 3NBYC 1DOIA 1DVRA 4XTRA 1L4YA 5CYPA 4JLOA 4F38A 3AP3A 5IDVA 1YZTA 3PG5A 4GNKA 4IEEA 4NYJR 1V8CA 3DM5A 2JX5A 2JASA 2IUTA 1CR0A 4DHEA 1ZCAA 1FMLA 4POAA 4AYWA 3HVZA 1ZU5A 3TQFA 1JROA 1AS0A 1KI6B 2RAPA 1BMFD 4IFEA 3TAUA 1TEVA 4B6FA 2AXNA 2CDNA 5GJBA 3OAAA 1AWDA 1IN4A 2VSFA 2BJVA 1KI3A 2J0VA 2OAQ1 2PZEA 3SC3A 3B6EA 3BE4A 2GCPA 3CNOA 2H5EA 5BYJA 2QMUA 1A4RA 5KDOA 2D2EA 2F43A 2QM7A 2OBLA 1R5NA 3QPVA 1GNPA 1NP6A 2CHGA 1U8YA 2ZI6A 5JEEA 2VH5R 4PSVA 1BIFA 3F5FA 4IDOA 4Q4JB 2PT7A 4AKIA 2HCJB 1N25A 3K9HA 5DISB 2NZJA 1M34E 1L4UA 4L16A 2KE5A 3BIFA 2KBEA 3N2EA 4US8A 1JQ4A 1A2KC 3TRFA 4JLNA 2CL6X 1JEEA 2G1KA 4BLTA 4O2LA 3GLGA 1T0JB 1KK2A 1A2BA 1P3JA 4DLUA 3AV8A 3A1UA 3QXHA 1KK0A 1QG4A 1FXAA 1W36B 3TSWA 1RC8A 1NN5A 5CK5A 1VKJA 5FBQB 5FPSA 1ZU4A 5FUXA 4A6PA 3G0HA 1BMFA 1ZC3A 3C5HA 3ZQJA 2F3RA 2XNDD 2DCUA 2AFHE 2FFQA 4ERNA 1MO4A 1XD2A 4UXIA 1E6EB 4WIAA 4DKXA 1OFUX 2OXCA 2V54A 1FFVA 1FP6A 1VIYA 1U8ZA 3SNHA 2ZRLA 4DCNA 2A78A 1S9HA 4M2LA 1QDEA 4M21A 4DJTA 1CJVC 1NLZA 2J7PD 2AWNA 1ODFA 2AKAB 4NYJQ 2R8RA 4EFNA 5FPHA 3V4RA 1F0ZA 2DFLA 1MRNA 2CLDX 1GNRA 2DHRA 3GMTA 3MWLA 2GVDC 4I1OA 2XEXA 4TLCA 1OQQA 3IILA 5IF9A 1CXZA 4HLUC 5M04A 4KODA 3AEBB 1GM5A 4TLAA 1FW6A 2OFOA 1N3BA 2GEVA 3QF7A 2WWGA 4A9AA 4PFSA 1XJ0A 4ZHOA 4MYHA 4KYIB 3O8CA 1ZIPA 1IN8A 2ZI3A 2V4ZA 4N0DA 1KSFX 1S3GA 4M8NE 4PAQA 1E9FA 1LFDB 1GAQB 2PEYA 1NKSA 1OYWA 3AV0B 3NEYA 4AC9A 1NJGA 5J4YA 1RZ3A 4WWMA 1D5CA 3AP2A 3C4JA 2QMEA 4PHTA 3QKSA 3D6TB 1EFRA 2M56B 2V55B 2NG1A 2Z4RA 3M0EA 2FPKA 4JKYA 4LJ5A 1PFDA 4R98A 2ORIA 5FR1A 2OCPA 4JIMA 5HCNA 1NBMD 4ESHA 4AD8A 2EFCB 3KFVA 2JLQA 4DB4A 4YXDB 1VJKA 1KMHA 3W5UB 3R20A 3NH9A 3RS2A 3B9JA 4NL4H 1DO2A 3DKPA 4Q18A 4DLZA 3T1QA 3OFND 1M2OB 2HJGA 1AJEA 4H1VA 3WYGA 1FFHA 2RMKA 1CR1A 2GZDA 2WM9B 2FN4A 1EG7A 3B13B 3OZXA 1FQJA 1NMXA 4NCNA 5K8LA 3U60B 1ONBA 1ESMA 3ZYCA 2F9LA 2XOKD 2PL3A 2H57A 3VFDA 3LO5A 5JHHB 5CITA 1RYFA 4B75A 5HE9A 3MD0A 2FFAA 1RWSA 1Z6XA 2YC2C 1PLLA 2GVZC 2OBMA 1OB2A 1PVOA 3E2IA 3W9CB 2O8DA 1UPTA 1M7GA 3W6PA 2C2HA 4B43A 2ZE6A 3K0FA 2JLWA 1AZSC 4FD2A 5DYIA 2FGJA 2XSZA 2ZAMA 2XXAA 5TMPA 4YDHB 1LVGA 4PANA 1G17A 3U6BA 3B9PA 1Q1ZA 1OH5A 1KFYB 4QG7A 3LW7A 1R2QA 4LCBA 1I4DD 3W3ZB 1XCPA 1TKGA 3EZ9A 3I92A 3U3OA 1N6PA 1G8HA 1Z0JA 4KO8A 3VMFA 2D74A 1JPJA 1ZNYA 2ZJ2A 4NCIA 2IYSA 4Q9IA 4XJXA 4FCWA 4L8GA 3AE4B 3SQXA 1JW9D 1RRFA 2F3TA 3AUYA 4ASUD 3I8SA 3RRNA 3VX3A 4C0QC 4IOKA 4IRUB 3EPHA 4AKGA 3QEJA 1G291 3BB1A 2FSHA 1EGAA 2OE2A 1S0UA 2BM1A 2J87A 4JLPA 4NU0A 3GLIA 3A1SA 1HURA 2REOA 2WICA 4F93B 1CF4A 1VTKA 3ZVLA 1LS1A 2B7CA 2WV9A 4C0HA 2K5PA 2ZJ5A 1MO6A 1PUTA 4URVR 1E9BA 5KNBA 1QT9A 3L43A 2ZS7A 1P7CA 1C4OA 2VP5A 3I8XA 2VF8A 3AVOA 3AGPA 5EXXA 4DLTA 2A5DA 1E4YA 4U02A 3BWDD 5F9HA 2XAUA 1F60A 4Z51A 3K0SA 2X2EA 1UDXA 4F7WA 2IYRA 4IKEA 1E2JA 4E03A 3C7KA 3T1VA 2EFHB 1ZNXA 2L52A 1GL9B 1U90A 1MKYA 1FUKA 4Q02A 1E9RA 1VG1A 3P4SB 3T5DA 1IM2A 4BFXA 2WU2B 3LH5A 1E9EA 1KI1A 2GILA 3UMRA 1LS6A 2BS3B 1DAEA 2EYQA 3AN1A 2IF2A 4Q1EA 2BDTA 1L6VA 3CX6A 3QKSB 1EXMA 4G5OA 3GLGB 2F1RA 3ZLJA 5EE5B 2IYVA 3CH4B 2Z5FA 3N70A 1DOYA 3LQQA 3ND8A 3CRRA 1EWQA 3KKOA 1OYYA 4KSBA 4D4KA 2AK3A 4TMXA 2V1XA 3SDZA 3KWLA 1IQPA 1Q20A 3WY9A 3U5ZB 2W3RA 1GPXA 4KBGA 5EP1A 4HYYA 5KUTA 4XWOA 4LJAA 1VYVA 2WIBA 4CEIB 4KX6B 4GP6A 1XEWX 2QP4A 4EFMA 3FOZA 1XEWY 1AS2A 3A1TA 3CPJB 1KI9A 3W8RA 4LHZA 4L9WA 1Q3TA 1U99A 2FJUA 4FCVA 3R8FA 2PT5A 3CR7A 3KXIA 2K5UA 2WIAA 3AB3A 4TQ9A 2ZUBA 2JLXA 2D7DA 1G3QA 4PC3A 3ZIAA 4GSYA 5LB4A 1NMZA 5TB5A 3NVVA 1Z0AA 2FFHA 1SXJE 1KO1A 2BMJA 4UXHA 4M4SA 5LBIA 3GJ8A 2WP9B 2Z43A 1U8AA 4XH9B 2QPTA 3A4LA 4F4CA 5KO2A 4FWIB 1DEKA 4GI7A 3O8DA 5ANRB 3WHLA 4LHWA 2BC9A 1KMHB 1WQ1R 2ZRPA 5TV2A 1AKYA 3IHLA 1U9IA 2GJAA 3I72A 4RD1A 4WZAE 5EUQB 4C30A 1Z6TA 2O8BA 4B34A 4EJSA 4JL5A 3GFOA 5E3HA 5IK2D 5BQ5A 1G3MA 3UWKA 1AQUA 2F1JA 3C15C 2RB4A 4GOJA 2C03A 3FYHA 3M1IA 2WJIA 2ZVQX 2HF8A 1N6KA 4XVQA 5C4GB 1Q21A 5DHFA 5FTJA 4P6VF 2QZ4A 1E9CA 3PQCA 3P1MA 2P6RA 1ETUA 2J46A 5J4VA 2QPOA 2ZITA 2W58A 3DMDA 3EIHA 4HB3A 3IO3A 4OQNA 221PA 4DVGA 3U4QB 3X1DA 4BLQA 1SXJB 5IRCD 1NN0A 4HI0E 3S1AB 1E9MA 2CCGA 4R7ZA 3OEHD 2ZS9A 4RD0A 4A4DA 4CGZA 4G5GA 3EC1A 3KJHA 1DG3A 3AKCA 3FB4A 1M74A 2LCFA 2JLSA 2ZJ8A 4MRRA 1Z06A 1KHTA 1KRHA 1TF2A 1ZUHA 4XWAA 2ODNA 3TSZA 1CEEA 1M7BA 2VSOA 2ZRJA 5E7MA 2HCBA 1YZQA 2ZR0A 4B3BA 1GZSA 1N0UA 2J7KA 4KHZA 5AUNB 2Q3FA 4V0LA 3B2GA 3W8NA 4CT4B 2LKCA 3VRAB 3EZ2A 3FFAA 2A3RA 1G16A 2ZROA 2V1UA 5FTLA 4Q9KA 3PR1A 4TMTA 1ZD9A 5EP3A 4RKFA 4RY2A 3T34A 3KKMA 2YC4C 1OFFA 1E79A 2AK2A 3H86A 1PZNA 1KAOA 1SVIA 1FL9A 2GJ8A 3QG1A 4JSYA 4R2HA 4GDFA 4D25A 5HZKA 1XD2B 2ZVPX 2GJSA 4F91B 2GCNA 3QENA 2JJ1D 1NENB 4FCTA 5JRJA 2BCGY 1FXIA 1XCGB 4LTUA 2IEYA 3ECCA 4NH0A 5FOWA 4YMVA 1E10A 4D81A 4PC7A 4LPKA 1JQJC 3SBDA 5EP2A 3WMFA 4C0LA 4PSAA 3ZJYA 3Q7PA 4TL7A 2IYTA 4NCJA 1NEKB 3GLIB 5JWRA 3MWYW 3L82B 4ASUA 4DDWA 3PEYA 3K0CA 3ADBA 3U7HB 1ZM9A 4HDQB 821PA 4V0NA 2KAJA 1N5XA 2UKDA 5SZIA 1FOEB 1E2GA 5CM9C 3VR8B 3AVQA 1ZVQA 1UKVY 1YU9A 2G6BA 2XXAB 4DIEA 1NBME 3RNLA 4L9SA 3ZD7A 2J1LA 421PA 2WDVB 2G0NA 2QAGA 4HUTA 5L3QB 2YOHA 1RM6C 1FX0B 3AKEA 4JMPA 2IC5A 5EXPA 1GRRA 5EUMA 4BFSA 3A36A 2V9PA 3KJEA 4UNRA 4TWZA 2CJWA 1VCOA 3BBPA 5GJVC 2RGNA 3L0OA 3QIAA 4YMSA 1KJYA 1HUQA 2XTNA 1FTNA 2CE7A 4KYUA 1IAQA 1WYGA 1G5TA 3KTAA 3LX5A 4TTRA 5JMTA 4EKDA 4F92B 1W1WA 4IDQA 5TVKA 1AQYA 4JLMA 4EIWA 1E6CA 5EXTA 1NJFA 1SULA 1W4RA 3AH8A 3NHBA 3NKVA 4GT1A 2WWYA 3Q7QA 3B5JA 1E9DA 4TMZA 4BPBA 3CWIA 2LKDA 1GWNA 4N3NA 4TT3A 3CPEA 2Z4SA 4GMDA 2O8BB 1Q1BA 4M1TA 4TZ0A 2N42A 1DE0A 1HTWA 1Z83A 2FFBA 2R62A 3FKSD 3WBJA 4DLWA 4FW9A 1DAGA 1U2RA 4ESVA 4A8JA 4UKDA 3VHLB 3B85A 2XSZD 1FNNA 4YMTA 3RS7A 4ZCMA 4JLAA 2KMMA 5AJYA 1OH6A 3MFYA 3VU9A 2PJRA 3T12A 2MJDA 3FE2A 3RPFC 1XD9A 4GPTA 1ROEA 1Z6YA 4TL6A 4M9ZA 4LC1A 3UKDA 1J7KA 2CEAA 3ZVRA 1N0WA 1E94E 1YKSA 2WPDD 2ZJYA 4ZI3A 2GTPA 1P9WA 2CBZA 3NS1A 4OQFA 1TU3A 1W49A 3HJNA 1VCNA 1KO5A 2ZRKA 2ZAOA 4CEIA 2ZRGA 4MYTA 4Q4LA 1GUAA 5JWHA 4LBWA 2PJZA 1TQDA 2ZS8A 1D9XA 1HQCA 3QVVA 2D7CA 3AE9B 4Q4JA 3VR6A 4C7OA 1NMYA 1TADA 3BS4A 3TJZA 1NBMA 1IXRC 3I32A 4YONB 1TPZA 1VDZA 1UEJA 4AYXA 2VHJA 2EYUA 4B2IA 3NVYA 3LLMA 1NL3A 5L3RA 1W5SA 4Q4HB 3AF0A 3H2YA 2XNSA 2AL7A 5FPKA 4PX9A 3BFKA 3GJ5A 4CIDA 4CYMA 1HT1E 4CF7A 3A1VA 1DO0A 3CBQA 4JSTA 4V0ME 4NYIQ 2DWOA 1W5TA 4QXAA 3RSOA 1XMSA 1TKYA 4OI1A 2JDID 3CO5A 3G5UA 2VP0A 1R7SA 2PZFA 3EIQA 5FUVA 2ZI7A 4DBLC 1YQTA 4BEJA 2B92A 5FPYA 1SQ5A 2G83A 1G9XA 2J9RA 2MJEA 3FKQA 4ZIRB 5JWOA 2VO1A 5DE3A 4QBHA 4DCVA 5G5HA 2AXPA 1CRQA 1GKIA 1MO5A 1WF3A 1XTIA 2ERYA 2G77B 3JZMA 1J8MF 4FMDF 2WBLC 3HR7A 5CIQA 1E2MA 2PLRA 3GEHA 2OESA 5IHPA 3DEFA 4DLSA 3VKGA 1NSFA 3OAAD 4QKQA 2N46A 2OFWA 4LOAA 4PQYA 2QIEB 4JVLA 1KIMA 2R65A 3AB5A 1E1QA 1QHYA 1NF3A 2P0EA 4DDTA 4FMBB 1F2UA 1R6BX 2Z83A 1DAKA 4WZ6A 3BERA 3LWNA 2ZSDA 2YWFA 3OIWA 4OYHA 2WLBA 3A8TA 1I7HA 1TUEA 2WSMA 4LHYA 4TQAA 4TTQA 4WXRA 1GOTA 2ATXA 1ZIOA 4HZUB 4PPQA 3VX4A 4G5QA 3TIFA 1XLNA 1SVLA 4EPRA 2OLKA 1DTSA 1P62B 2OCBA 3W6OA 1QHHB 1TKEA 4KAXA 3VR5A 4C3ZA 3PEWA 4ARZB 4HLDA 2JJ2A 1G5PA 3O47A 4PR0A 2WJYA 1ZP0B 1G41A 2AHOA 2EU8A 2ZE7A 3BJIC 1NYQA 3K8YA 3CRQA 1WDTA 2ZTSA 4HB0A 3MJHA 5KU1A 4MKIA 4D82A 2GHIA 3I3SR 3S1AA 1XTKA 2ZU0C 3B78A 4LBZA 4TL8A 2OCYC 2OEPA 4N6EB 2PKOA 1JB1A 3T1OA 1DADA 2IK8A 3GJ0A 5KSYA 4QM7A 3PO0A 4OHZA 3DMNA 1ZM2A 2V7QA 8OHMA 3U7EB 5JLJA 1ZRHA 1UBFA 2WZQA 4YDSA 1TMKA 1KSGA 2WDRB 1XPUA 4JLDA 2WKQA 4UNSA 1PDXA 3V9PA 2ZRMA 5C2TB 2HTME 4LJ8A 1G64A 3IIMA 4JL6A 4QHTA 3BRWD 3MRSA 1DOXA 4IEIA 4PQFA 4YLGA 4LJ9A 5FBVB 5L3SA 1VG9B 2A5JA 3IPYA 3NH6A 4II7A 5KPDA 4LK2A 4TSFA 1RJ9A 2GF9A 1OV4A 3IKJA 1A82A 1Q44A 2RGCA 3LXRA 4B71A 1KSJA 2K22A 1XEXB 3QG5A 1R7RA 3CIOA 1KKMA 2VP2A 2W2TA 3K1JA 4B2PA 3EA5A 5J4HA 4IDNA 4XD7A 1XLOA 2VIIA 4HEJA 1E2QA 1R10A 3IEVA 3THWA 4M1SA 1N5JA 4IOMA 2PCLA 2RGEA 1T91A 1E1QD 2OSBA 4LBYA 4ITRC 1J99A 2PCJA 3RABA 3RRZA 2YHSA 1P9RA 4DSNA 3UATA 3EXAA 5AUKA 3AP1A 4EAQA 3OEEA 1UJ2A 3AGQA 4Q00A 4A15A 1UFQA 4V0MA 2FPMA 4ZDWA 2DB3A 1NVVQ 5GJCA 1NY5A 4P33A 5HE8A 5HZHA 2O8CA 3VQTA 1MABA 4JLJA 3QXSA 2NO9A 3Q5DA 2MMGA 1E2DA 2C99A 1FQKA 3JVVA 1ZAKA 1KGDA 5B58C 1LF0A 5AWFC 2Q21A 1DBSA 1TL7C 2VRWA 1SVWA 1YJ5A 3RWMB 4B35A 2QAGB 2HLDD 3HU1A 2ZRBA 1E96A 1XMJA 2BBTA 1GRQA 2DR3A 2RHDA 2QN6A 3SEAA 4AY2A 2O52A 4I1SA 2GEUA 4M9QA 2GAOA 1YR8A 1E79D 2QMOA 3KKQA 1ZM4A 2Q5WD 4W5HA 4A0FA 4EPTA 4MH0R 4GOXA 2WU5B 2OLJA 1SXJC 1A70A 2JEOA 2CE2X 3L8YA 3GPLA 4JYCA 3REGA 2YV5A 1YHNA 5C2JB 5DI3A 5JS8A 2VYFA 4US2R 3PFIA 3CIRB 5CB6A 2GK7A 5JI2E 2B21A 2CJWB 3FPAA 4URZR 5E7JA 3X1WA 5IT5A 2ZM5A 1RRPA 2NGRA 1W4CA 3EAQA 1GDDA 3ZGXA 2OUKA 1GL7A 2ZE5A 4HZUA 3SYNA 3QXCA 5B57C 4MUAA 4UNPA 4US9A 1U0JA 2NZ8A 3GCGA 2BOVA 3MG9A 3BFXA 3HU3A 3GLHA 2QE7A 1YE8A 2V6JA 2FSIA 1PLKA 2WSSD 2BMDA 2NO6A 4NYMR 4Q1CA 4C7OB 1W0JA 3LBHA 3KDSE 5E95A 5FPTA 5EE9A 3ZYYX 1ZJ6A 1JBKA 1XTQA 2ZSEA 1J7AA 2BS2B 3F0TA 1K5GA 4EPXA 4YXWA 3P20A 1ESNA 1P73A 2CHQA 3PEVA 2V8OA 4C0BA 2YOGA 1G7RA 4F4IA 1P2UA 5KDLA 4DDUA 2QROA 4ON9A 1U94A 4ABYA 4Z1MD 4KBFA 5K8UA 1G21E 3T06B 2PH1A 3LBNA 3TH5A 1XJQA 4AG6A 3KKNA 4C2UA 1G3IA 4TMKA 4LZZA 3ADDA 1H8HA 2FG5A 1YJJA 4HB4A 5EZ6B 1ZD1A 2FZLA 2E3TA 4Q47A 3QNUA 1T3LA 3CPHA 2H17A 4JBXA 2QG6A 3DKVA 2ZPTX 4QGGA 3F8TA 1O3YA 4US1R 4M22A 4RD2A 1I4LD 4DEXA 3OHMA 3AMZA 1G6HA 1X1RA 4OJQA 2WJGA 1JXOA 2ZREA 4FMDB 3R7WB 3AEAB 3WYAA 3ZIAD 4YQFA 4Q66C 3E1SA 1N6OA 3K9GA 1L7VC 3TW8B 5L3VA 1ZMXA 4EJSC 3NVAA 4FN5A 1Z3IX 4LC0A 3MLEA 1GL6A 2DFNA 1KY2A 3MWKA 2ZXUA 1R5BA 5KDDA 5AK0A 4NZYA 3QOFA 3AVVA 4RD4A 1S96A 4HSEA 1CLUA 2G88A 2ZYVX 5JJIA 1KO4A 3A6PC 1XO3A 3Q72A 1V43A 4MA4A 2EFEB 2PEZA 2R9VA 3O8RA 4Q5IA 1S9DA 1P2TA 2GETA 2NIPA 2PX0A 4LYJA 4MGZR 1TJEA 1SVSA 3ZD6A 1QHIA 2WDQB 2F1IA 2O0JA 1UAAA 5JS7A 2BBOA 1CULC 3EIEA 4Q7MB 4DUGD 1ZUD2 5HPYB 2P5TB 5FBWB 1N6IA 5D3MA 4E07A 1IJFA 1OXVA 1J7CA 2JA1A 4QRHA 1JRPA 3VTKA 2JLRA 2YZ2A 4AWXA 2ERXA 1P72A 3VU9B 4MYUA 1IY2A 4OHYA 2OILA 3RAPR 4B33A 3ICQB 3VNVA 2V6IA 3CUEF 4U7DA 1I2DA 1OKKD 1OHHD 2XX3A 1QOAA 2ZSAA 3EASA 3KB1A 3EUB2 2IYZA 1XXHE 1PLJA 1G3UA 1W46A 2R6DA 2VL7A 1JWAD 3E70C 3IBYA 3RC8A 3H4MA 5JZVA 2E87A 3VR1A 1YQ3B 1G1MA 2XZPA 4TL9A 4YTMB 3G82C 4I99A 1OHHA 4WA7A 1YQ4B 3VHXA 4QNRA 3DOEA 4QOSA 5JSZA 1WWTA 4D80A 1SVOA 2WWHA 4GL2A 1QLBB 1G8YA 3ZQ6A 3GD7A 1GRNA 1N0VC 5SZJA 1L0VB 3X2SA 1G8FA 1F6BA 3GJXC 3TGPA 1OPXA 1BO6A 2W55A 3BB3A 1XF9A 2WVJA 1KKLA 4Q4HA 2A30A 5A4JA 1KK3A 4A1FA 1NNEA 2ODBA 1RYJA 2GWHA 2YOFA 1E1RA 1RKBA 3NWJA 2RKOA 4TLBA 4OHVA 2ZU6A 4UQOA 4LYHA 2BJWA 1Z22A 3CNLA 1KSHA 3IDQA 2R6GA 3HPRA 4HAZA 4V0OA 2DBYA 3LA6A 3WHKA 2GEDA 3HUIA 4PXAA 4JVNA 2VHTA 3EZ7A 4A0RA 1OJLA 4D2IA 2IS2A 2RH5A 3LXFA 2WKRA 4LJ6A 5J5CA 1Z0KA 4XIGS 3GEIA 1E2LA 2W6JD 1LB1B 3KUCA 5DN6A 2GKSA 2FSGA 3AE5B 3FHCB 2V3CC 2BS4B 1AGRA 3ASZA 1Z28A 2OFXA 4PAOA 1VHLA 4P0TA 5FL7A 3SU8A 3TAHA 4AKHA 1KDPA 3QBTA 4JT4A 1CS4C 4B47A 3QEOA 5JCPA 2IYWA 2ZR9A 3FMPB 4XSHA 4FXCA 1S1MA 1WA5A 1E0JA 3SN6A 1AZTA 1NYRA 4GZMA 2VHQA 2CHVA 1JNYA 3FHTA 1GG2A 1YRBA 4YTNB 3AVWA 2IX3A 3PXGA 2E1RA 5J47A 1Z47A 1G8GA 2IXGA 1SVKA 4Q48A
chains in the Genus database with same CATH superfamily
5A4FS 5HR5A 3DHEA 5JYDA 2VQDA 1MAUA 2Y3IA 3A4SC 1JGTA 2YV3A 2YWGA 4KVGA 4OV6B 1Z5ZA 4PTZA 5BN5A 2Z2KA 3CG4A 3Q8XB 3TW0A 4LK0M 1DG1G 3COYA 3JYQA 4B82A 3UPUA 4Z0TA 1CRLA 2DE0X 4MKHA 1E4OA 3IBGA 3R66C 3N6RA 2GDZA 3OEHA 1GN9A 1ISJA 3M1LA 3PV0A 4KU4A 3H2GA 3LDUA 1NVDA 1C0KA 3KVNA 3F8WA 4HXDA 1F0KA 2JBAB 2Q5JA 4IJQA 4PZEA 4RJ2A 5CA0A 4EL5A 2IYDB 4JNKA 1X77A 1LK7A 5HCIA 1BJRE 2C5BA 2Y77A 1I6MA 1H2HA 1OWPA 3AF3A 2COEA 4IIHA 5DBOA 3RRBA 3WZMA 4Y2RA 6REQB 3B3FA 2Q4RA 4YL8A 1M33A 1CD5A 2HLPA 5DHAA 3H6KA 1EJBA 4JUIA 3HRKA 3ENVA 2MEKA 3TOXA 5LOVF 3FDZB 2HW8A 2DCMA 3ZZUA 1NVEA 4I1VA 1JZTA 4QLAA 2D1YA 1M2KA 3TVDA 4NICA 4CM5A 5AM4A 1WRIA 4C21A 2KFKB 2Q1XA 3IR6A 4YCLA 5AVJA 4BDTA 2EMTA 2ATIA 4MV4A 3QKRB 3DKKA 3E56A 3GNQA 1V8ZA 4M7RA 1PRYA 3DYBA 5FNZA 4KH1A 5DKFA 5FYQA 5A05A 3NHMA 4CLDA 5CG2A 3QFSA 2PFKA 1ZOYB 3NDJA 1Q7GA 4HEQA 4MR8A 4KITB 2A1IA 4HKTA 2BHRA 1KDOA 4L6AA 5CDYA 4AECA 2ZZMA 3Q5EA 3U1BA 5K3CA 2GXQA 4TWJA 2PZBA 1J0BA 4N3BA 2BBWA 3FRIA 3KTFA 5FEMA 3KJGA 1HNXB 2OL4A 2AX3A 2HUNA 3PXBA 1SSNA 4WKGA 4Y6QA 3KJFA 4R1NA 1PEYA 4RIGA 4AJIA 3HPQA 1SD1A 2AJ8A 1UZAA 3OY7A 3ETDA 5AKEA 4M0UA 3B7WA 5JDCA 5DEIA 2NYRA 1ZJJA 1R0ZA 3RDPA 2AD1A 2V7QD 3VC7A 4HAVA 3UJ6A 4BMZA 4M1OA 4CQMD 3L8CA 4EBBA 1SUCA 4X91A 3VOBA 1TBEA 7REQA 2GJKA 2UXCB 2VWPA 4AWBA 3AKDA 3R0VA 2Q8QA 2RHCA 4M1EA 1G6KA 3FFXA 1XTSA 2ZTVA 3H8VA 2P67A 3EBOA 3VH3B 4C6HA 4IJVA 2YCBA 3ZWQA 1RAXA 3IUEA 3BHNA 3C14C 3UPDA 1IQUA 2G71A 4O0LA 5DBGA 3K9CA 1TQHA 3U4QA 2KD0A 1DKMA 1VSVA 3OFKA 1P0QA 4IHKA 5KYWA 3VDZA 2PRYA 4O29A 4TMVA 521PA 1HC7A 4NPCA 3WNBA 1MQ8B 2JFHA 3VR4H 2AMYA 3NTOA 4JLKA 1NDHA 1MPXA 4NNPA 1EX7A 3KTOA 3LBFA 3DUFB 1SHKA 3R4CA 4I0WB 3LA8A 3B9RA 1MQAA 4INOA 3Q8EA 3MTQA 4HHEA 1SXJD 1P1AA 2KTRB 5D7GA 3E9ZA 4JY7A 2Z2YA 3I9FA 2FY8A 3ZOZA 5L83A 4J6FA 3A33B 1UK8A 1CG6A 1VXOA 1XMPA 3FUTA 4WFIA 3ZZMA 1Y8CA 1S3IA 2B35A 4MWTA 3VNBA 4KX3A 4N48A 1VI6A 4O8CA 2H4ZA 4MR9A 3GLTA 2W2NA 4JL9A 3T1OA 2FTKE 2C4UA 4BJ3A 2O54A 3HJAA 4RJKA 3JD4A 4S24A 5BYAA 2FPUA 3L49A 3PGXA 3PVCA 5DP1A 2KX3A 1LX7A 1UM8A 4L8LA 1UZMA 1UBQA 4LY6A 2OQIA 3O90A 1TY0A 1E99A 1X3LA 2J41A 4H3KB 1U3FA 4JWSC 4JC8A 1T6BX 1CT9A 4OQXA 1XT6A 1IWBB 1MTZA 1JHAA 2BGMA 4F4UA 4B3DA 5JSZB 1TA4A 2RK6A 2V0NA 2X8BA 4ZGBA 5CM8B 3DB2A 3IL2A 1XO1A 2XXJA 1IOVA 4QVKA 4KPYA 4UM8B 1R0CA 2IP2A 3HLKA 3NUZA 4XLZA 5EMMA 5IDYA 4ZOBA 3SC6A 3QW2A 4CV1A 1UIRA 4H1HA 4WEOA 4KNYA 3AQ4A 1T9KA 3MT7A 3GAFA 1Q5PA 2DYOA 4PGAA 1M8GA 3HNRA 1HH4A 4X66B 3HI6A 1GSAA 4M0EA 3QEMB 5BNTA 3LCUA 3HJTA 3OFSA 2O1SA 2R96A 5EQFA 1KDVA 2GD0A 3RADC 1UJ5A 3ZXRA 1W44A 3DTVD 3HJRA 4D0GA 2JPDA 4L5AA 4PBTA 4BTVA 2H92A 4F97A 1MU0A 4WCFB 3ZI0A 3A6DA 3KR1A 4F86A 5ES4B 1H93A 4KFTA 4DHWA 1VPDA 1P98A 2B30A 4KQJA 4NBTA 2ZSUA 2O50A 5J2TA 2H4FA 1YR6A 4DL9A 2FSVC 2WC1A 1P60A 4G0VA 1XMXA 2CUZA 4CLRA 2DBZA 3LE8A 1BEEA 3RS5A 5H59A 3N74A 2XOKA 4GLSC 1D2GA 3F90A 4GE0A 4CMIB 2UYQA 4KIWA 2R7LA 4CV2A 1NUSA 4B3RB 1YTLA 1CY1A 1USVA 4MRAA 5IN7A 4B4DA 5T3YA 3I6BA 4HKZE 3CX7A 2W90A 3IDFA 2WAAA 4E5SA 1RDFA 5U4XA 2MSLA 1LA2A 3AUUA 3PGMA 3SKVA 3QY0A 3NDPA 4I1YA 3ZY6A 5IDXA 4CUJA 3BEDA 3IRVA 4UTXA 3HO8A 4TWBA 3UJBA 4Y0VA 3MEQA 5FTMA 3PSEB 1EIZA 1HDRA 4X8MA 2C4HA 4A20A 4QUJA 2PHZA 2CFRA 4MHOA 5HJ7A 1JHUA 3VPBA 2X5XA 3V7FA 3C5VA 5AR1A 4LFAB 4NP6A 2BEKA 2J8ZA 1C3XA 3QKIA 4M87A 3ICEA 1L5HB 1NBAA 3FMIA 1FS6A 2VP9A 1Y7LA 1F8YA 1PL6A 2XVZA 5E9AA 2FWJA 2IXTA 3R3VA 4M8IA 4YMUA 5JH7B 5ISMA 1U0LA 3ERCA 2FR0A 1QAMA 2J08A 2ZPAA 4A8PA 2GSWA 5FI3A 1IBLB 4BOYA 2GZHA 2WPDA 5K9ZA 1BDMA 2IDKA 1JIQA 4Q3AA 2HK7A 4BGEA 2H0RA 3HB0A 4NZMA 4RABA 1OZGA 1G5RA 4QICA 3MYYA 4H31A 5AHKA 2VJNA 4RA6A 1A88A 4UM9B 3F5QA 1OFUA 3JQ8B 4B3IA 1TLTA 1ZR2A 3M4XA 2P77A 2ONKA 3CWQA 5THKA 4QTXA 4FBGA 2VUUA 4XM2A 1T1JA 2E4XA 3U3RA 1BVUA 1X7WB 2LDBA 1WXVA 3LC2O 4GVXA 3DBOB 4LZPA 1ZBDA 2ZB2A 4HZGA 4FR2A 5DPRA 4KJZA 5F4ZA 3A11A 3VRBB 2PYIA 5C8ZA 4N0QA 1EDEA 2IYPA 5GWXA 3FJOA 1RWMA 5J2RA 2N1MA 4G01B 3FNQA 5JSQA 1CQIA 3IAFA 1G8KA 3ECAA 5GJWC 1SE9A 3OZDA 1ANKA 3NXKA 5KNCH 3KQQA 3IBTA 4OHBA 1MB2A 4ZAVA 5HOQA 2CNWA 3BDAA 3PYLA 1YDFA 2GM5A 3AF1A 5IBQA 5K0GA 4YXFA 4REZA 1X42A 1E6EA 1ZW7A 1YAHA 1BHQ1 2FZ4A 4JPSA 2IZ0A 2WJPA 3QU5A 5I9BA 2VAPA 1QHHA 3SOPA 3GD5A 4M01A 3D1VA 3TD9A 1NVTA 4KUHA 4UW9A 3DBLI 4OW0A 2ZUVA 4DIDA 1GVHA 3ANXA 1GTRA 4R3DA 1OLOA 4P92A 2R6R1 4GXQA 1JR2A 4RVSA 2AYYA 2NTVA 5CJPA 3FTFA 4R54A 1P3Y1 3IJ5A 4TYYA 4LV5B 2O3QA 5BNZA 4BLSA 4V2IA 3J80A 3PYXA 2OHGA 4B81A 3M5PA 5IJAA 2NW6A 4I3FA 3OCXA 2D13A 3G8CA 3PFWO 3WLFA 1PKXA 3BT7A 1QLHA 3EQ8A 3K8OE 5AZGA 3RTGA 4J03A 4BMDA 2VCYA 4IJUA 1X0XA 3LQ4A 4B31A 1JSRA 4N7BA 4PC1A 3TRKA 3M4ZA 4BFZA 2OO7A 5KEIA 3QYFA 3HXTA 2NVUI 1Z5OA 5KHOC 1ICIA 3IMCA 2YASA 2LUMA 3MTAA 2JIZD 1OC2A 4EW3A 2GASA 4ZI7B 5AUPB 4ZHQF 2XUQA 1TIFA 3HE3A 5HRCA 5EE0A 4AZTA 4FU0A 2XCLA 4LGVA 3B60A 1P17A 2GS9A 4FGSA 5DTJA 5EJ7A 2IF0A 5KTYA 2FWNA 2RB5A 1BWPA 3CNHA 2VHCA 4CU2A 3U44B 3RHSA 1AUPA 4KX5A 4KKXB 2LHEA 3DHIC 3TW4A 4I81A 1SQGA 3L3BA 3WIVA 1JPUA 1SVMA 3VPAA 2D1TA 2Z59B 1UC5B 1N60A 1XPRA 2OORA 5HSGA 4I6PA 2PD3A 3H0EA 1LKZA 3CX8A 4P32A 5LIPA 1AN9A 2GHTA 5J2TF 3T8YA 2VWQA 1EIWA 4HAWA 2FK8A 3TZQA 3KXKA 1Y5LA 5K7SA 3PJRA 1L5QA 2I6FA 3QWBA 1GPUA 4G5RA 5C7OO 2VDOB 4NZ9A 4EB3A 1E2HA 4Q4CA 2ODWA 3U7FB 1RPTA 1JT2A 1PWEA 1YRAA 3MRVA 1Z74A 121PA 2H0QA 1UK6A 3GUHA 4JUDX 3ZI7A 3IAEA 4ZT6A 1GTL1 1O95D 2I62A 4KUEA 4ZVQA 2BKRB 1OVMA 1DKRA 4UE2A 2Z9DA 2GWRA 3EVTA 4L1BA 1ZD8A 3OCYA 5E1MA 3DM9B 2ZIZA 4OK3A 2XDWA 1EYZA 3PHCA 3SIXA 2G4DB 1GDHA 5C5DA 3JQ7A 3N7UA 1Z88A 4MKGA 1MH1A 3K0BA 5KU7A 3ZW3A 2OP1A 2VPYA 5FUYA 2FG7C 3SSMA 2QUAA 2JJ1A 5HKKD 1HX7A 2H2IA 3G0GA 1M9NA 2QI9C 2ZLBA 4WL0A 1ZUNA 2C2GA 2FEOA 2Y92A 3DQZA 3MJVA 4H17A 5AXAA 4COKA 5B7GA 4ARSA 1D3AA 3G17A 4YP7A 3R9IA 1NVVR 2J0UA 1BA3A 3TXYA 3U39A 1CQPA 5B4TA 2HNBA 1QJCA 3ASVA 2DXIA 4J0HA 2ZB4A 5AJXA 1EESA 5G53C 4WLVA 4WWNA 2Q7OE 2L83A 2XF2A 1EFAA 1CUJA 4RKWA 1H5NA 5HKHA 2JIOA 1U3CA 3WRXC 4CM9D 4WAAA 2ONCA 2XMBA 1G2IA 1QSGA 2FX3A 2O4CA 2PUHA 1JLLB 3H83A 3LZ6A 3VH1A 2EVWX 1SOAA 4M9CA 4RHXA 1DBRA 1HDYA 2BKUA 2QV7A 4P1CC 2X3YA 3L0BA 5EEHA 5GV7A 4EKIA 5M29A 3QYPA 3MAAC 4MVWA 1EAMA 5B1EA 5A5GA 2YINC 1TD9A 2W48A 3E61A 3PKIA 4XWKA 1GR1A 2OP0A 2XZOA 2ZIFA 3FB1A 1ZX1A 4TRNA 5IM4A 3OLQA 5CPBA 3IEUA 1EWYC 3PPAA 2GK3A 3K92A 4CETA 1TUGA 4FFRA 5KTRA 4IDDA 1T8TA 3VPFA 4EUSA 1R4AA 2QORA 3FHJA 1QVAA 2ISSD 2JSVX 3OD1A 2MCNB 1VRCA 2XB4A 1BGXT 3IP8A 1KARA 1KO8A 2A58A 1M2JA 2O2DA 3C8HA 4LLGM 3LCMA 3RD5A 5BYRA 2PX6A 1OFTA 2ZR8A 3G8BA 4HMOA 3C8YA 4FOTA 4XGRA 1E3QA 2WMNB 3BK7A 3C41J 3QPUA 2QUKA 5FHQA 4DLRA 1ODJA 3VSDA 3QBVA 2BGGA 3HP4A 4E09A 1M5RA 3D1JA 1BW9B 5CD9A 1QVRA 2QQ5A 1N1MA 5C34B 3UCXA 4B8WA 3ZDBA 4C2AA 3HUEA 2CU3A 1OROA 5CX3A 2C8LA 1M94A 1VPTA 2EFDB 2IUSA 3N2IA 1VSUA 3E35A 5I7HA 3VKWA 5CLJA 2F9FA 1GLGA 2ZJFA 4MSQB 2OBFA 1WJ4A 4Z9FA 3IB3A 3HY4A 3ZVMA 1C14A 2BWFA 3K4HA 1NG1A 3N6VA 3PUZA 3UB2A 4C4OA 4N7MA 2I91A 2L7RA 1DQSA 3ICPA 4LV6A 1PDWA 3LTNC 4PPNA 1MVKA 1QOPB 2RBEA 3OOJA 2UYZB 1Y6QA 3BE8A 1HBJA 2CLSA 1Z2CA 3TTWA 3UWOA 1XLVA 1NNUA 3A4NA 4AMGA 2PS0A 5GTDA 3N0TA 4JQWC 4RPIA 4RQTA 1OJ7A 3A6GA 2H0AA 4ZJZA 3PXEA 3U52E 5DM60 4GM1A 1EXDA 2CFOA 2B76B 4PCAA 4UPEA 5J58A 3KLPX 1EUDA 1Q1NA 3R0IA 4B3TB 1OIXA 4GDLB 1YQWA 4P31A 1JU4A 4QO8A 2QAGC 2NU8A 1N9GA 2A2ZA 3O2JA 4L74A 2NMVA 1QKZA 2CB9A 1U9CA 3OM9A 5AVQA 3FTPA 3KETA 3BH6A 3P5SA 1MG0A 1MRSA 2FA9A 4Y1GA 1L5FA 2PPVA 3ZDRA 1BGVA 4JQCA 4HH3C 1KFCB 2C2KA 1KR5A 2A5GA 2YJZA 1AA6A 1L4GA 3E4CA 2WNMA 4ACFA 3C7AA 3EFOB 4CV3A 2ZPYA 2XR1A 4J76A 2C9OA 4MI6A 4EKEA 1E2NA 5GY7A 1UDRA 3AF2A 5JVDA 3EUFA 2BB5A 4FHKA 4B9KA 2IH2A 5M3BA 5J5AA 4IIJA 4DLYA 4FYPA 4JENA 3UAZA 2LCQA 3LKVA 4AN0A 4DJAA 4OQZA 3FCSB 4R9UC 1ZRSA 3SKYA 1IXSB 4ACBA 5K0EA 3K6SB 1XCQL 4YJ3F 5JMPA 4D4HA 1CUXA 2BF8B 5G3YA 3UH0A 1JJVA 3D6JA 1YR2A 2OHIA 3GLKA 4BQSA 4M7PA 3WZ2A 3O83A 3Q0TA 2OZKA 1C9KA 3ZU6A 2ENUA 1W96A 3F3SA 3M6WA 1RRGA 3N0RA 3RRJA 1GSIA 4JDUA 2QM8A 4BO5A 1WSWA 3PUYA 4JJAA 4KACA 4U4AA 3JRXA 3RF7A 1RPZA 3FWPA 4MDEA 5F77A 3TCAA 3EC8A 4RHCA 1U28C 3H5RA 4HNHA 1GILA 3KTAB 1TTPB 2ZXFA 3TKYA 4IUBS 4ZVVA 2P69A 1X7ZB 3GZJA 1F2TB 1Z6GA 4P4SB 5LQUA 4I1UA 4TM7A 3S81A 5ER6A 3WJ7A 3GT3A 3UMVA 3Q7SA 5G02A 4JLCA 3VZDA 4YAKA 1UKEA 1QNFA 1PWYE 4IOLA 4Z0PA 2JHCA 2PZ8A 3A31A 4C0JA 1M1NB 5IFLA 4ITVA 5IEJA 2DR0A 3C1OA 1E0ZA 3LFUA 4WBXC 1NFFA 4RACA 1FUUA 1JR3E 4LY3A 1KDYA 4BMVA 3ZVNA 3D64A 1KI6A 1XEFA 2B1QA 3ENQA 2I34A 3NAGA 1Q6YA 4YRPA 5AZHA 5BMIA 2IA5A 2QGZA 4E5NA 4EQ6B 5ADVA 3HB1A 4DHZE 2B8TA 4UJ3A 1O94D 1SVUA 1Y63A 1VOTA 1BMDA 2JJ8A 3S28A 1DX4A 1JG2A 2LW7A 1JE1A 1HE1C 4K9NA 5PGMA 3B2NA 3L77A 1NQWA 4ACAA 4WN9A 5A2GA 2XB9A 3H1UA 2HQ1A 1LGRA 3P2OA 3Q2KA 2C4WA 4KZCA 3TBKA 4B79A 4F4HA 3EISA 4G2TA 2ZRFA 4LWQA 1NHWA 1W2GA 2DM6A 5F4BA 3SQMA 5JXIA 1FFDA 1MDFA 3KT0A 3HP1A 1PQ4A 4A2CA 4HGRA 1E1DA 1NVUQ 1VMIA 1DARA 3P9SA 1PZEA 4LDNA 4Y0NA 1V7QA 3TIXB 3WXBA 5FOQA 3O8NA 5EMKA 3E9RA 2DETA 4TS9A 2MYUA 1KFJB 3IR5A 4GEGA 1IFXA 3RG8A 4BVKA 2DQYA 4EZEA 1VPWA 2YXNA 1O9GA 2E4AA 2HOQA 3ZGVA 3RK1A 3F7TA 1P9NA 3HCDA 4QU8A 4BE4A 1QCCA 4IJMA 4A2WA 2PZAA 2MP2A 3IUJA 1VGVA 3RSZA 3C6QA 1CQIB 2OPHA 1JKXA 5FI1B 1NBIA 2Y1XA 5CPFA 3SYTA 3UAWA 1SCQA 1M72A 3WOVA 2X0RA 2CT8A 1ES9A 4R6WA 1WFYA 3PPIA 4YGXB 2V03A 2X58A 5A04A 4HX2A 3DXXA 1I2AA 3F7NA 3OJCA 4MRPA 2I80A 1IHPA 4BOZB 4BNFA 2CNDA 3PNBA 1GAQA 2NPTA 4CIBA 4BX2A 3GZNI 2IH5A 2J7PA 3FVQA 1I6LA 4ZRNA 3DVQX 3F97A 5FOSA 4TSKA 4TV9A 4QPZA 3D3JA 4Y2PA 3LY8A 2SKEA 1E3JA 4ONEA 3SR3A 3VKUA 3W9YA 3MYRA 2ZR7A 2FLVA 2TRSB 4BVJA 1SJ9A 1VMDA 5DULA 3INGA 2BPOA 2P41A 4YWGG 2B4YA 3CLSC 4BN0A 1P4HA 2BMEA 3HA3A 4BBNF 1BX1A 3DOJA 3JQPA 2AZTA 1EK6A 2GN1A 2N9XA 3IAM1 3PGLA 4V3CA 4YRDA 1KQ3A 1LPNA 1R8JA 4B48A 1L7NA 1EFHA 4RZHA 3RW9A 3MWGA 1WHTA 2AFIE 1JG1A 2OT3B 2HJRA 4WJNA 5C1IA 2NBWB 2GM3A 3UHFA 6NULA 2HR1A 5F9MA 1NIJA 4UTPA 1A8IA 4FZ3A 1VSTA 2WTNA 3S2YA 4B5KA 3SY8A 3PKZA 4RH1A 1GA1A 4NQZA 4JGHB 1SZPA 3AXSA 1ZVMA 4ZAXA 3A7EA 1QG2A 3EF3A 2BFFB 4UCQA 2BB6A 2QLBA 1OXBB 1DMSA 2AZMA 3HVRA 4DR7B 4N0EA 4IVRA 3ECIA 1VBNA 2XYQA 4KYVA 4RJJA 5ECDA 1U0FA 1QDUA 3GLHE 4NPHA 2GCGA 2GZMA 1NU6A 1V8OA 4K7WA 1Z5WA 3CMMA 3EXG1 4GMFA 3A37A 3L2OB 1BCSA 2PVCA 4R1QA 5DLDA 5KSZA 4KFUA 4DRZA 3UMSA 4YP5A 5KVCA 1GB1A 4W1SA 1R6VA 4BZWA 4EYKA 3CH5A 5AHXA 1M73E 4QOEA 3P4PB 1DRWA 3L7BA 1CU1A 3EPRA 4UFNA 2X0DA 4JLSA 1OU4A 4WDRA 2NMQA 4X1OA 4LNUB 3LJKA 3U3ZA 1TUIA 3FGNA 4KFRA 1XQ6A 3QOXA 1JP7A 1M1YB 2YWRA 3VR9B 4PG5A 2Q9BA 5AFSA 2VRCA 3C6XA 5IZCC 1SD5A 3EX7C 3B1ZA 2CS4A 1IP9A 3E3OA 3P26A 4XD7D 5FKJA 4MGHA 5SZKB 4HBZA 4JX1C 5EXSA 3SFEB 1YCFA 3RARA 4L95C 1PQSA 2ASEA 3S6JA 1WW8A 3H2SA 3AEFB 1NBOA 1NN1A 5DRTA 4DPLA 2KDFB 1V8PA 4EQ6A 3FTDA 4F9GA 4IDIA 3E15A 3RU9A 3UHJA 3CWZA 3N8GA 1K86A 2QRZA 2I8LA 2WJZB 3TUJC 1QWOA 4DM7A 2W71A 3D8BA 4LNNA 1B7GO 1JSLA 2FPGB 2QTBA 3FAZA 4GKVA 5LBTA 4LZNA 3WGHA 5I4BA 1CJSA 1W1UA 3GGCA 3JVIA 4IFTA 4JJ4A 3UIEA 4XI9A 2IY0B 1A95A 2WA2A 5T6MA 2PX3A 2IW3A 2EDAA 3LQRA 4K8OA 2J7QB 1AM4D 5FR2A 3HTXA 3D5QA 1L5MA 4HP8A 2YVAA 1E4VA 4A8JC 3S8YA 1XQVA 1XTUA 1FBTA 1T2DA 1V41E 3GU3A 4JE3B 5TF0A 2J9FA 1IONA 1W0KA 2GD1O 4HWKA 3UYKA 5EJIA 2IYNA 1RLTA 3DFIA 4NQLB 1DC4A 4FQ7A 2DZIA 4NU6A 5CH5A 3JV7A 3ZXXA 2JUOA 2OCXA 4QARA 4QOGA 2VTVA 1F8UA 2YR0A 3DTTA 4H7DA 2PFGA 3SXUB 4JBNA 3UC9A 1SQ0A 3LLCA 5EIOA 1N4DA 2RJNA 3K6JA 4DC9A 1ZDVA 4DG8A 2AN9A 1EM8A 2ID8A 3LX6A 3M70A 3ZE0B 3WGUA 4JOCA 1JHMA 1TYGB 3K35A 1C3LA 2WHXA 3OE7D 3TJPA 2HRCA 1M5UA 2QQ0A 3R9WA 4NE2A 4RAQA 5J40A 3WWOA 1J07A 4GRAA 1KJ9A 1N1EA 1Z07A 2QNRA 1I4RA 1PFYA 4H9GA 4EWLA 2OBXA 3EQ9A 1QQ6A 4O1NA 1SIWA 2V65A 3II6X 1OBFO 4JQOA 4P4SA 5H80A 2Q27A 3QU4A 1V9LA 5K2MA 3U7GA 2C2ZA 3UT5A 4DLKA 1VYHA 4Y6LA 3BBLA 3G89A 2KWIA 5EWJB 5IWAB 1VRAB 3NV7A 4HVCA 3LO8A 1ZJ4A 4KMOA 4LC9A 2MSED 3KSBC 5A4IS 1JSXA 4L73A 1SA0A 4QGAA 1C30B 2F9MA 3P63A 3C1TA 3PD0A 4S1VA 4XJSA 3TR0A 3WL5A 3WWYA 5K6AA 3IAM6 2NQ2C 2UUAB 4B2LA 3FTEA 4EJSB 2XVAA 3G85A 3N75A 4R40A 4QUKA 3EBPA 1KEVA 3VPXA 1GPNA 4CTOA 3PICA 1T4CA 1X2BA 1RBMA 3PQ8A 4N3AA 4HEHA 4XX5A 3U4DA 3Q8MA 5J9FA 3LOQA 4U3JA 4B32A 3M3PA 1W34A 2P35A 3H4VA 1XWIA 1OT3A 2Q62A 3NZSA 1LF5A 1MHPA 1N8NA 2P4HX 3FUXA 4TSRA 5GONF 2WDTB 1DBWA 4D45A 4F85A 5KYWB 3K70B 1SCAA 2MA9B 1UEIA 1Y37A 3HHEA 2R61A 3OMXA 4EG8A 1Z2PX 1UBLS 3EUEA 2PKCA 2V5UA 4FYKA 1FXSA 3ICVA 2PSJA 3DUFA 4QU5A 4JC5A 4YAIA 1GUZA 4LHVA 2D2VA 3EW9A 6GPBA 2I71A 3QQ5A 2M17A 2ZJBA 2IIVA 3SYLA 3OQJA 4EX7A 4LQLA 4NZOA 2PL9A 1HNNA 1TJYA 3C3BA 3FMFA 1C7RA 4FGKA 1Q1OA 3CNNA 4HADA 5ICFA 2XNHA 2BLNA 4PV7A 1M54A 2KI5A 2XVMA 3T7TA 1TAQA 1YZUA 1Q0WB 2NPTB 1EWTA 3LT0A 1YI0A 4IH1A 1ZD2P 1KXZA 3IDZA 3NBUA 1RLFA 4EP1A 5IDQA 1Z62A 4PWYA 4G4SP 3O0TA 4XC2A 2M6RA 3IOCA 1BEZA 4IL5A 2AL3A 2H1IA 4ZAGA 3L7LA 2ZUTA 2AN5A 2ZDGA 3WL8A 1NWCA 4UZEA 3ZW8A 3ZXVA 2KTFA 2H7YA 2PVSA 4XCQA 4CKBA 2H4XA 1XWFA 5BVHA 2ZEJA 4UBNA 1LI5A 3UMFA 2IX9A 3RHFA 1L7AA 2Q9AA 4A3PA 1AGXA 2JGRA 2LIPA 2GD2A 3AY0A 3MS7A 3WRVA 3ZH9B 4L5JA 1JG4A 3HJFA 1P2VA 4W6QA 3RPEA 4MUGA 4C14A 4I7EA 3B8HA 2I9PA 4BLUA 3N2NA 3HS3A 4I2NA 4KRXA 3LZDA 2XLCA 3OICA 4QAQA 5AUOB 3LC0A 1F2VA 2JI4A 2XGGA 3UV6A 4CT5A 4E2ZA 1H3FA 2IBTA 2ZYTX 4GMVA 5AW4A 2QT0A 2V7GA 1DB3A 1CFJA 1E1YA 1K4KA 2Z04A 3VSAA 5JEDA 3TG8A 3NU1A 4FNGA 3T99A 4C00A 4HQNA 2DFVA 2R48A 4A1OA 1E3WB 2DSTA 4W9CA 5G0VA 4WLUA 3RI3A 2W6PA 3OUZA 1IY0A 1PYDA 5DLYA 1GV0A 1WVIA 3V00A 4JBIA 4ZD6A 1X14A 3EWSA 4DMMA 1B73A 1BXRB 5AKZA 1XQXA 4H7EA 4RIEA 3V2IA 1AA9A 3SMVA 3QLEA 4FFMA 4IILA 4Z54A 1O03A 3HL0A 3MCAA 1IN5A 1BKDR 1MT0A 5K8VA 1N8TA 1XCJA 5HBRA 2BYVE 3TPFA 1R3DA 1OGWA 3KYCD 1GKKA 5ENDA 3K70D 4DRXB 3CMMB 4CYEA 4JXJA 2VK2A 1Z4QA 2TMKA 3DOIA 2XEDA 2ALJA 2FJPA 3ELBA 1QONA 4YP9A 2FB9A 4MB2A 4TM8A 1FCJA 1QK4A 3SDSA 4PX3A 1WJGA 1K6JA 4A92A 4YBRA 4KDEA 3C3MA 2Y5BB 1AKWA 1HTBA 1TYCA 3HGTA 1I3OA 1O96A 4IUMB 3JSXA 3OOEA 4PTYA 5CNJA 1OXUA 3T5GA 2OCLA 3I62A 1OFIA 5KJCA 1CHNA 3KWVA 2JAPA 1YRQA 5AVRA 4TQUS 5IG2A 3W4KA 3BVGA 4M53A 2OB1A 2G1JA 4CNQA 1VKZA 3KYDD 1FMCA 4PAMA 3AI1A 4UHEA 3PX7A 3EB9A 1NHGA 2B1GA 3LPAA 4JJKA 3H1FA 3HEAA 4FJ1A 3LOPA 2YICA 5CIYA 2GI9A 1Z7YA 4M38A 4TYQA 4M6WB 2PWBA 4WURA 3LZCA 4H4DA 4TUUA 1UWMA 3AH7A 1QYCA 3GA7A 4U8GA 1T5TA 4NYMQ 3EH1A 3O3MB 2W6JA 1TS3A 4Z2AA 3OIVA 1GAJA 1UPFA 2FPGA 3T7JA 5CCEA 4W5OA 2IFTA 3TUIC 1LC3A 1UGJA 1GN8A 4M7OA 5AJTA 5CBPB 3OZEA 2KS6A 3CZ9A 3SEFA 4TVSA 5B7NA 1SB3C 4K46A 5AI4A 3GLFE 4OZAA 1UQRA 2P68A 1TNDA 2VRBA 3JWGA 2G72A 2FRDA 3M2TA 3NHAA 3U1TA 1RBYA 2M19A 1UQUA 4BHTA 3CLUC 1V9JA 3DBHI 1MO2A 1RMTA 5CYGA 1WB9A 4JLUA 1LDYA 3GBVA 1QH9A 4H60A 3F5SA 5IVPA 3AUJB 3DPSA 4A8JB 4E4YA 3DSRA 1OIWA 5C80A 1K66A 1XD8A 1SC9A 4IYJA 1YBVA 2AD5A 1JAHA 3B3JA 1MG5A 3S4YA 1TU4A 3AE3B 1T2AA 2J45A 2P7IA 1IBXA 1RIFA 2VNIA 3DDZX 3E48A 3NJ8A 5E0OA 1EJ2A 2J3LA 4Q4AB 2Y5PA 4GDKA 4OG2A 3B2EA 4L15A 1F1HA 4YLEA 1HTTA 3ZX5A 3CW2A 3Q6NA 3ZXIA 5FOVA 4C22A 1D4AA 4WQMA 5J3JA 2VI5A 3RIXA 3WX0A 1L0YB 4ZC1A 2PA0A 1KERA 1OKKA 4B3SB 1LSUA 1SKAA 3HVDA 2EIXA 2IOYA 1DKNA 4O4HA 4Q7JB 3PDHA 3WLNA 3L02A 5ARCA 4QASA 3W3AA 2VOJA 2QR2A 1QRAA 5FQNA 2QN2A 1E92A 3QI2A 5DGTA 4RSMA 2A5YB 3JQBC 5KNDA 3QVGB 2BP7A 5T41A 4CTJA 1KMQA 3RVLA 3ANMA 3WHIA 1UBNA 3TQQA 1N5IA 3K4PA 5L6LB 3ZZ0A 5CVTA 3ZBUA 1WB4A 4OSPA 3B20A 3A6JA 3TL2A 2WEKA 4U3JB 3Q3JB 4HF7A 1WUIS 3ACCA 3KUDA 3FZYA 1C1DB 4B3HA 4DYHA 1A69A 4FI3C 4OHOA 4GXRA 3FNIA 4YC7A 2XBUA 2P9JA 4HJXA 4P7BA 4BJ1A 1VMAA 3UA4A 4RGTA 1PR9A 1XFAA 2JZCA 3M4JA 1Q50A 4DG9A 1Q3HA 2FGKA 2HEGA 4JELA 1F0YA 4NBKA 1WSBA 3VHTC 3IT3A 4GQAA 2L18A 1XX6A 3L0PA 2I6TA 2WNIA 3S2EA 1PJCA 2D1FA 3U3MA 3Q2IA 4HUJA 2FMFA 2HRBA 1E3SA 3ZE7A 2CHXA 3NY5A 1QHGA 2HHCA 3T1TA 2FLKA 5HKAA 3FKYA 4X54A 4BRSA 5EEGA 2I7DA 2JJ2D 5KYYA 2QX7A 1PNOA 5K0FA 4MNTA 5FA5A 3RYCA 2YMLA 1Q7BA 1V2GA 4K0RA 1XYYA 4MA0A 1W47A 4D96A 3IP7A 1WXDA 1HXYD 3IEXA 4GH5A 1DGJA 4Q9DA 5E6UA 2Q0XA 4XOIA 3WQSB 2C7HA 3PREA 2OAP1 2VHUA 3LI2A 4ZPXA 2O0LA 3AOEA 1AZWA 4U6QA 2Q99A 2XTZA 1PFQA 2CKDA 3H42B 4IUCS 1P4SA 1I4OA 2MINB 3Q8FA 5HKOA 3CEHA 1NDDA 3V05A 4UCFA 5AXBA 1GSOA 3W9SA 2R8XA 1XWWA 2X19A 2IWHA 1CTQA 2AN1A 4M9XA 1YI1A 4F2HA 3TEZA 2O48X 1F