4A9AA

Structure of rbg1 in complex with tma46 dfrp domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
368
structure length
356
Chain Sequence
STTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRRELLTSGAGIGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIIDGGRGKQVIAVARTCNLLFIILDVNKPLHHKQIIEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEASSRRYMPAIYVLNKIDSLSIEELELLYRIPNAVPISSGQDWNLDELLQVMWDRLNLVRIYTKPKGQIPDFTDPVVLRSDRCSVKDFCNQIHKSLVDDFRNALVYGSSVKHQPQYVGLSHILEDEDVVTILKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME-INTERACTING GTPASE 1
publication title Rbg1-Tma46 Dimer Structure Reveals New Functional Domains and Their Role in Polysome Recruitment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 116
structure length 356
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF02824 TGS TGS domain
A PF16897 MMR_HSR1_Xtn C-terminal region of MMR_HSR1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a9aA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a9aA02
2GTPA 1XPRA 4V0NA 3U3OA 4CYMA 3ZLJA 4C7OA 4OHWA 5FL7D 2WIAA 3D8BA 4NH0A 3TUIC 1MH1A 1G5PA 1R6BX 2ZSBA 4PSAA 3TGPA 4PHTA 4Q66C 1HT2E 3X1ZA 3EASA 2FGJA 1ZOYB 1FPMA 3C4JA 3SZRA 2QMEA 1VYTA 3QJYA 4EUNA 4AKIA 3B2FA 4LHYA 3KQUA 1W2HA 5D3MA 4F4JA 2QAJA 4BRUA 5A5GA 2QBYA 3SI7A 1E2HA 4PTLA 1AWDA 1XFAA 2FGKA 1TUEA 3I73A 4AIIA 1X6VA 1PLKA 2IYLD 1GOTA 4C30A 3UMFA 3AVUA 3M0EA 5GJWC 1DVRA 2IUSA 4YTNB 2QQ0A 1WBDA 3TVDA 4LJ9A 1V5WA 1U9IC 1IM2A 2GA8A 2J0UA 2WKPA 2QM7A 1OT3A 2FA9A 1OH6A 3SQXA 1SVMA 4GBMA 4LJYA 4WXRA 1E0AA 1W2GA 3KXLA 2JIZD 4LJ7A 2E3TA 1EFRA 1SKYE 4M1SA 4QKQA 3T12A 5C3JB 3AV0B 4KHZA 5DGXA 1E96A 3TVTA 2A30A 2O8CB 1COWA 1ZC3A 2OCAA 4RVCA 1UDWA 5CLLA 2GZHA 3LX5A 5J4YA 2ZREA 1J70A 2FNAA 2FWRA 1SHZA 2GCOB 3L8YA 3KUCA 4KVAA 2FOLA 3B60A 3VQTA 4IHQA 2CVHA 3FDIA 2Z83A 1GAJA 2HEIA 1RE0A 4B3XA 1D9XA 4JBXA 2ZRCA 3PCRB 4NCHA 4C2TA 2OCPA 2CLSA 3L4PA 2O0HA 3LH5A 1SVIA 1Z0JA 4Q19A 4NCJA 1W4BA 4P6VF 1HA3A 3JZMA 3EIEA 2EKIA 2FFQA 2NO6A 4OQXA 3ZQJA 3NC1C 2QPAA 2ZVPX 1J90A 3TJZA 1W4AA 3Q7PA 1XLPA 4TMWA 5FFMA 2BDTA 4JLOA 3LWNA 2ZRLA 1XMSA 3ETLA 1GM5A 3AP2A 5H70A 5JWHA 2BCGY 4HUQA 2PMKA 3QF4B 3MWYW 4FN5A 2OHFA 3RPFC 2PBRA 1YRBA 3GLIB 1CF4A 2V4ZA 2FSFA 5FUWA 4P4SA 1EX7A 3HDTA 3BE4A 4OK6A 5EP1A 1IQPA 3TIFA 1MABB 2CNWA 1E79A 2PX0A 4YSYB 1S4QA 3SFVA 1KK2A 1G41A 2CDNA 3FTQA 3HR8A 4WWMA 3HU2A 4GT1A 4YMUA 4YXWD 1VPLA 1ZCBA 2XZLA 3SEAA 3NVWA 5AK0A 4YXDB 1E94E 3AEBB 3B78A 4HUTA 4PPNA 3AE5B 3MJHA 3P32A 4L16A 2Q3HA 4C0BA 4BZPA 1DBSA 1OXTA 1SGWA 1IXRC 2PVOD 2MSEB 5EUMA 4DVGA 3E5HA 1JW9D 4US0R 1G5RA 2E1RA 1PLJA 3UATA 5BW8A 5JCPA 2XOKA 3A1SA 3CX6A 3EIQA 4BASA 3VRBB 5GJBA 3IPXA 1GL9B 4I1VA 5KNDA 4GDFA 4B3DA 1AGRA 3TUZC 2KB0A 4LC0A 3X1YA 4ZOHC 3D3QA 1TQDA 1N6LA 1N6KA 1JAIA 3I1FA 2WM9B 4FIDA 5L3SA 2MMCA 1OXVA 3HYTA 1OXSC 3B1YA 3LDAA 3PUXA 4RKFA 4LDJA 5CJPA 4JMPA 4B3GA 2GNOA 1KSHA 1ZUNB 3OHMA 4L9SA 1HY3A 4B2IA 1OH8A 1GKIA 1MO6A 1T0HB 3BB3A 1UADA 1Z28A 2OG2A 3GJ7A 4RFVA 1GRNA 2WJJA 2VBCA 2ZYVX 4TLEA 5G3YA 5F3WB 1A2KC 3NHAA 4M1MA 4Z54A 5L3QA 4ESVA 2O8BB 4M9QA 3RS5A 4LWZA 3FOZA 1KYIA 4TL9A 2IYWA 1VJKA 2XXAA 4DEXA 3QKRA 1JRPA 2DR3A 3FMIA 1CLUA 1X3SA 2P0EA 2YINC 2VO1A 4BZXA 2ZSDA 2WWYA 1DGJA 2XTZA 3C14C 2ZVQX 4CVNA 1M6NA 4A9AA 2Y5CA 1FO4A 1QDEA 5EJEA 3WP0A 2ODWA 2L0XA 5EZ5A 4QFMA 1H8HD 2CJOA 1OFTA 4EPVA 4Q01A 1S1CA 3PG5A 2GESA 1FFVA 1FXIA 1SKQA 2AFIE 2IF0A 3KXIA 4RD2A 3TAHA 2W3RA 1NP6A 2X1VA 3QE0A 1EWQA 2PT5A 4Q00A 1E4VA 3PVSA 1X86B 4M22A 4JWSC 4K46A 3EIHA 5FI1B 4TTQA 5CM8B 3EZ9A 1JJ7A 2YNMA 1XXHA 4HLDA 1E2DA 5TXGA 4ACAA 4P3YA 4A8JA 1E2QA 1S0UA 3SBDA 1TEXA 4XTCS 1GDDA 1NG1A 1KRHA 1HQCA 2GAAA 5CDFA 4B6FA 3LD9A 1G17A 2O8DA 3ICEA 4TLCA 4LYJA 4HZUB 3T1TA 1G8HA 1NBMD 2GEDA 2IYVA 3KKPA 3UWKA 3OEHA 1IN7A 4X8OA 5FBQB 1Z6AA 4JVNA 1MO3A 1N6PA 4AI6A 4Z51A 1N5WA 1NY5A 1VG1A 5IHPA 2VEDA 4EPRA 2UKDA 2D2EA 4ZKEA 1G8GA 1LB1B 3KFXA 4IOLA 4Q02A 2IUUA 3CRMA 5KDOA 5EQTA 4MITA 1BH2A 3RS7A 2VP9A 3TSOA 1U98A 3BXZA 1N5KA 2BBSA 1ZAKA 1T5IA 2KI5A 1XD8A 1WQ1R 2RHMA 3LVQE 3V4FA 4D6PA 2DWQA 4D4KA 3CLVA 4Q4HA 5G40A 4QJ3A 2VTKA 1OHHD 4QNMA 4O3MA 3ADDA 2WP9B 2NZJA 1JAHA 1MT0A 2IYUA 5SZHB 3TUJC 2VA8A 1SZPA 5JI2E 4U02A 2F43A 1XF9A 5E7IA 3GJ0A 4BFTA 2ZI3A 5L3RA 3ZJYA 3B9JA 1XTJA 1TKGA 1RFLA 2GJ9A 2ZTSA 2PLFA 3LW7A 4HAZA 3DM9B 1E0SA 5EE9A 1XMJA 4Q4JB 4Q1EA 5JJLA 5CIQA 3T06B 2NG1A 4N58A 3TLXA 1UKZA 3WCQA 3K0FA 4DDUA 1XLNA 4Q4AB 1OE0A 5EP3A 1N62A 1GTVA 1YKSA 3EWSA 1W48A 3RYTC 3AKCA 5FOUA 2GRJA 1W44A 1ODFA 2G0NA 3MMPA 1N60A 4OQMA 2CL7X 3IHWA 3VKGA 4ZDWA 4IDOA 2WU2B 1KNQA 1OKKD 4CEJB 4UXHA 1TX4B 1N3BA 4C7ZA 2WDVB 3EA0A 3T61A 4HSEA 4JVSB 5BXQC 1M8PA 1NVUQ 1NEKB 2HCBA 1K6MA 2QENA 4N59A 2VP6A 3AH7A 4Z1MD 1VCMA 4A1FA 1KMQA 4JX1C 1FNNA 1G6OA 2VH5R 5J4LA 2ZR7A 1E3MA 2NO0A 1FL9A 2GBLC 4LV5B 2EFEB 5LDDC 1YZKA 4C80A 2J46A 4FCWA 1YZNA 4DCNA 3OEEA 2ZJ5A 3B85A 3ZVMA 3A58B 1CJKC 2QP9X 3X1XA 1XXHE 5ANRB 4GZMA 3ICQB 4FCTA 2C9OA 1YE8A 2GKSA 3ASZA 3UMSA 3FHTA 1GRQA 3KQLA 2HYIC 5CDFE 2YHSA 1Z6XA 1ZU4A 1HT1E 3GLHB 3LX8A 4B35A 3S1AB 2FG5A 1B9RA 1YZLA 2RGBA 3RHFA 3VR3A 1LY1A 1JWAD 4MYTA 1N5JA 1OPXA 2PKOA 1G4UR 2UVQA 1NMXA 4E03A 2B21A 3QKSB 3M1IA 4EJSB 3ONWA 4JLVA 1JR3A 3A1UA 1ZUD2 1KO8A 2B7BA 2GK7A 3NKVA 3TSZA 4D0LB 1T3LA 2QN6A 5CYOA 4ASUA 1M1YE 5JHGB 5CYPA 1NF3A 3B2GA 2GCOA 2AWNA 4TMKA 3UWOA 2LEKA 1Y3AA 2BMDA 5AUQA 1E2JA 4IKEA 1S2MA 3NC0C 1RWSA 1E9FA 4MYUA 3MLEA 4OJQA 4BEJA 3UKDA 5BWMA 5DNYB 4PX9A 2ECKA 5DIFA 4KITB 1KMHB 2ASEA 4Q5IA 1G8FA 1KY3A 2R44A 3AEZA 3C5HA 3NIBA 3OAAA 3KKOA 3T5GA 1F6BA 4FCVA 3SYLA 2YWGA 1N6RA 5K8UA 1YZUA 1NENB 4FWTA 2DYKA 2DBYA 2CJNA 1S9DA 4G3XA 3NWJA 4US9A 3U7FB 3QF4A 1E9MA 1IN5A 4OI1A 4Q1DA 4DUGD 3GLIA 3AVPA 4DCUA 3EW9A 2WSMA 5DE3A 1NJFA 4LYFA 2ORWA 2CJWB 1VYUA 2HT6A 4NU0A 4Q1AA 1NVXQ 4RFSB 4TYWA 1MABA 2WJVA 2OCYC 3KB2A 1J2JA 3U7HB 4BFVA 5TDHA 3EARA 3FHCB 2WTUA 3IEVA 4M1KA 4GI7A 2Q3MA 2O8EB 1A2BA 3AV8A 5FTNA 4LC1A 1ZUHA 1P9RA 3KKMA 2W0MA 1U0HC 4RD0A 3W5JA 1N6NA 4GMDA 5G3ZA 1TF2A 3SU8A 621PA 1DPFA 5AUKA 2QAGC 3B1ZA 2EWWA 2GXAA 3ABVB 1AYFA 4OYHA 4OI0A 3AF4A 1ZD1A 5JJIA 1AZTA 2OBNA 1MV5A 4DHEA 1GRRA 4A0FA 1NJGA 5C2TB 1IHUA 5H8YE 1C4OA 2WWGA 1VKJA 2QRZA 2FZ4A 4B71A 4E5UA 1KJWA 3NBFA 1T9HA 1VIAA 1MO4A 1FX0A 2ZRFA 3ZS8A 4DLUA 3KXKA 1CJTC 3AVWA 4CEHB 1PLLA 4Q47A 3BAFA 4RCYA 3OIWA 2JJ1D 3QBVA 1KZGB 1OYWA 2WPDD 3UXMA 4Z8XA 3CIRB 1JR3E 2ZE6A 1KK0A 1ZD8A 3OF5A 1XP8A 1CZPA 1ZNXA 2PZEA 2FX3A 1G1MA 3GFTA 1CR1A 2XSZD 4CT5A 1VHTA 2O8BA 4A2QA 5UKDA 3JVVA 5JMTA 2PJRA 2ZIAA 3Q7QA 1UJ2A 3SNHA 1KO4A 4HB3A 1JPNA 4IXMA 2FV8A 1RZ3A 1VIYA 3MG9A 1MRNA 1N63A 1RRFA 2E87A 3KJGA 1Z83A 4M8NE 4KFSA 1A4RA 5BYJA 4IDPA 1VG9B 4LJAA 3I32A 1UBGA 3A8TA 1BIFA 2BT6A 5L8VA 1G5TA 3PEYA 1CJEA 1UDXA 1JROA 2P5SA 4JVMA 3B1XA 2ZRMA 1U8AA 3U4QA 4YMSA 1V43A 3RLFA 3EZ6A 3GLIE 1RM6C 1LF5A 2REBA 4JLNA 2ZRIA 5B30A 3P4XA 2ZI6A 4M1WA 3UIEA 2XJ9A 3AKEA 3ZH9B 1N6HA 5EE5B 4RD1A 3U5ZB 4F7WA 3AF0A 4BLOA 3QOFA 3PENA 4NBSA 1G9XA 3L0SA 2QU8A 1NY6A 3O8BA 2J0QA 2NTYC 2IS4A 4TMTA 5IDVA 1N0VC 4GSYA 3TR5A 4HZUA 1FW6A 2XITA 2OILA 1GNQA 3NVAA 4S2EA 2VF8A 2JDIA 1XU4A 3WP1B 1ROEA 1G7TA 2IXGA 4X8MA 1U94A 4NHOA 1IN8A 4A0GA 2GVDC 4PQRA 5E3HA 4JLKA 2GCNA 1VLBA 1T5LA 2ZUBA 4BZQA 3A4LA 4LX0A 3WHKA 1VTKA 3UK6A 1FTNA 1DAFA 1KO7A 2FF7A 4I1SA 1VECA 2OFXA 4I4LA 2I1QA 2W6IA 2IC5A 1XTQA 3LY5A 5LPNA 2K5UA 2GBLA 2JX5A 2A7QA 4K8OA 2NO1A 3CF6R 3X2SA 4OK3A 1L7VC 3T1VA 4D82A 4JIMA 2XNSA 4AC9A 3GEHA 1E0ZA 1LS1A 3KTAB 3PITA 1FNMA 4KX6B 5FOVA 4XVQA 4AG6A 3MSXA 2X8AA 4EIWA 3TRFA 2GJ8A 4B3CA 4Q4JA 4W9MC 3QG1A 3SJZA 1DAIA 2Q9CA 1QF9A 3B8HA 3KFVA 4V03A 4AYXA 1A1VA 5H92C 4DRZA 1W4RA 1CR0A 1T6NA 4B47A 4B2LA 3B5JA 4FINA 2ERYA 1RRCA 2QI9C 2C9CA 3U3JA 4NONA 3DEFA 4MKIA 4YMVA 5JEEA 1IJEA 5DI9A 1Z0DA 3MWJA 2JLZA 4QHTA 5LD2C 3EA5A 1F48A 4CEJA 5HKKA 1BMFA 2P2LA 1I2MA 3BB1A 4FD2A 3AVTA 3LLMA 4TQAA 4PO9A 3K70D 1RFKA 1QHXA 1ANKA 1GG2A 1XMIA 3Q72A 3OE7A 4BPBA 2WQYB 4UNNA 5E95A 4TQUS 3WYGA 4R98A 4NYIR 3AE6B 1WP9A 4AKHA 5G5HA 4QM7A 1R5BA 2H89B 2FZLA 5AJZA 5FBLB 2AD5A 2B6HA 4BLTA 2R9VA 3P4YA 4Q48A 1K8RA 1TF7A 1A7JA 3C15C 3K8YA 4TWZA 2JATA 1KTVA 3GJ6A 1CIPA 5CB6A 4M9XA 821PA 1ZP0B 3EC2A 3SOPA 1NKTA 1RIFA 2C96A 4OQLA 4KV9A 2MJEA 2EVWX 3GLHA 5AUOB 1S8FA 3S1AA 5KUTA 2A5YB 3EXAA 4MGZR 1Z0IA 3EZFA 4M1TA 2OO7A 2GF9A 1XRJA 3K9GA 1T3SA 1X1SA 2C2HA 3QKSA 2F9LA 4BLPA 4EJSA 3VHXA 4DB4A 3EZ2A 4LJ4A 1E9AA 1QHGA 4PC2A 3LBHA 2AFHE 4DZZA 1PUIA 4Q7KA 5EP2A 3C5CA 4IDIA 2CLCX 3QENA 4MGYR 4MRSA 2J0VA 4NYJR 4OHZA 3NVYA 4Q9JA 2YOGA 1P2VA 1P62B 4QM6A 4WA7A 1AKEA 4DC9A 3PJRA 3TBKA 1KMHA 1XBTA 1E1RD 3WBJA 3KUDA 2BMFA 3CH5A 2W6JD 1OB5A 2FEOA 3M4YA 4DXAA 3UPUA 2O8FB 2YWEA 4OK5A 2WKRA 1DOAA 2Z4RA 5JS8A 4DIDA 5HE9A 3AB5A 1TEVA 3RRZA 1G3QA 4TLAA 1JQJC 5KU1A 3LXFA 4MGKR 1UM8A 1WF3A 4RZXA 2ORIA 3GJ5A 5CJ2A 2J1LA 3I4LA 2CJWA 1KFYB 1JI0A 3IO5A 1E2GA 4RFSA 3WMGA 5B57C 4A36A 4HLQB 3HU1A 1G21E 2ZJZA 1L6UA 2VP5A 1MR3F 2FPLA 3CWZA 1TNDA 2ZM5A 1W47A 1NSTA 2Q9BA 3RS4A 4TYYA 3FMFA 5K8LA 1P2TA 4NCKA 3CH4B 2G9NA 5B64A 4FI3C 3SYKA 3FC4A 3U3MA 4E07A 3AM9A 4HB2A 3ZDQA 3O47A 1KDTA 3IPYA 5CIWA 1FFHA 2H18A 2QRNA 3D7MA 3DO6A 1CU1A 5DLQC 1FIQA 4EFNA 1M7GA 2I3BA 1Z0AA 2D62A 4NKRA 3V9PA 1YHNA 4GOXA 3OESA 4ZDIA 5GADl 1KI4A 2G3YA 2RB4A 1DOYA 1GAQB 2V55B 2ZJ2A 4ZDJA 1E99A 3GLHE 3LVRE 4UJ3A 1YQTA 4YMTA 3FMPB 1KOFA 1TKEA 3TQCA 1R8SA 2FFAA 2QMHA 3CO5A 5J40A 4CEHA 4NL4H 4MYHA 5FOTA 1OH5A 2QA5A 1GSIA 4PC1A 1NN1A 1ZMXA 5FL7A 4YQFA 1PDXA 5JBQA 5MPOA 1AKYA 5EZ6B 5JRZA 3AKYA 1AN0A 4HROA 2DB3A 1XLQA 3ADKA 5EXSA 1OFIA 4OKSA 1W4CA 3KL4A 1ESMA 4POAA 3TKLA 1E1QD 2YOFA 1QG2A 3R20A 1II0A 4KLZA 1KNXA 2JJ8A 3TNFA 2G88A 4R71A 2N46A 3W8RA 2L52A 1UFQA 2P6NA 1DAGA 2LKCA 3CZQA 1H65A 2QSZA 4QJ4A 2PVGC 1KI7A 4LPSA 1Z5ZA 4HB0A 4W7SA 5HTKA 4XIGS 2RAPA 2W2VA 3GMTA 2QG6A 4CF7A 3HPQA 1LNZA 3WRYC 1JNYA 1OJLA 2AKAB 2QIEB 2C9YA 3I3SR 4ESHA 5J47A 4JS0A 1Z8FA 1ZM4A 2IS6A 3B9QA 2R6FA 2CL6X 2JIZA 3LV8A 1G3MA 1N5LA 1UKVY 3WNBA 4NE2A 4B48A 1NN3A 1J7AA 1N0UA 5HCIA 5GXGB 1ESNA 1KY2A 1S3SA 4IDQA 4EFMA 3ZVLA 1FXAA 1KKLA 1OYYA 1AS2A 1FMLA 2FU5C 2DWPA 5TB5A 3CR7A 3NTUA 1XEWX 1YR8A 3AMZA 4JSYA 4L8GA 3GEEA 1Q44A 4Q1BA 4EPWA 2PMDA 5HZKA 3ZS9A 4DIEA 1QLBB 1TKYA 2W83A 1WCV1 4OHXA 5EE0A 2CL0X 3HU3A 3ZVRA 5KNBA 1WRBA 1GILA 2JLQA 4C0JA 2CHQA 3HWSA 3WMEA 3AN1A 1Q1QA 3IGFA 2CU3A 2CCKA 3PFIA 2ACZB 5CLQA 1TQ2A 3VHLB 1G8YA 1K5GA 2R2AA 1CR4A 4EPYA 3B9PA 4ABYA 3J81k 5DN6D 1ZNWA 2DFNA 4XVRA 2R6GA 3DPUA 3AP3A 3W6NA 3B82A 1KSGA 4N6EB 2GJSA 4ZIRB 3K0CC 3K9NA 4PC3A 3U6BA 5GVRA 1G7CA 2X19A 2J0SA 1JEEA 1QG4A 4A15A 4KCGA 3MGCA 4GL2A 1G16A 1OIWA 4FXCA 2FMXA 1KSJA 2IWHA 1E9DA 2VHTA 3VRAB 2R6AA 4IVPA 2R6DA 2RHDA 3OIVA 2W00A 2NO7A 4TZ0A 2O0JA 1Z6YA 1FX0B 1M7HA 1XX6A 4PAOA 4YXWA 2ZJAA 1TL7C 3KTAA 5FPYA 4YTMB 1NMZA 2CBZA 5CITA 5B58C 4R2IA 4Q03A 1EFCA 1FQKA 1NN5A 4RKEA 5AJXA 4Q9LA 1LVGA 2ZETA 1BS1A 1LFDB 2J5XA 4B32A 4QXAA 2OFOA 2X2EA 2BBOA 1JJVA 4P4TA 1OLOA 2KSQA 1OW3B 3GLFB 4MRVA 2P65A 2FBWB 5A4JA 221PA 2YVUA 2ANCA 3PIRA 2IYXA 3SFDB 2G77B 4LRWA 3SN6A 4DSUA 1FUUA 3AVQA 1X8KA 1W0JD 2ZRNA 4QGAA 4B3FX 3PEWA 2V7QD 3CB4A 1E6CA 1CJVC 5EXTA 3QSYA 2ZSAA 2ONJA 1DAEA 2X77A 3THWB 3P1MA 1DAMA 2J59A 5FPKA 1R7SA 3AP1A 4G1UC 1H8ED 2VHCA 4W5WA 1BOFA 3AE8B 2ZRAA 3N70A 4KBFA 3AE4B 4DDTA 3QQ5A 4RSGA 3U4QB 4M0LA 3VAAA 1KI9A 4I99A 3WMFA 2JGNA 2PCLA 1SXJC 3K0EA 4ZCIA 1KIMA 5JWOA 3P4RB 5DI3B 3BH6A 3LQRA 4RZ2A 2JJ2D 5EUQB 4KAXA 5BN3A 1Q0UA 2IWRA 3AEAB 3DL0A 4NYIQ 1YR7A 1R0ZA 2QEQA 1FMJA 3HUIA 2JASA 2J7KA 5HPYB 3L82B 1W0KD 4QG7A 2UZIR 3KZ1E 1NLFA 4G5RA 5FBRB 2ATXA 3BRWD 1WGKA 4YTPB 2ZITA 1CS4C 1FRDA 1G4AE 1H8HA 1RJ9A 2V9PA 4QC2A 5JRJA 1IY0A 1G291 1R5OA 3BH0A 1QHHB 2WVJA 3OZXA 5LB4A 2HF8A 2A5JA 2NO9A 4AD8A 1ZM3A 2VYFA 2JLXA 2ZR0A 1OSNA 3BORA 3L8ZA 2C98A 2KE5A 3GEIA 1DG3A 1OIXA 4LHXA 1DEKA 1IN4A 2Y8EA 1S3GA 2ZSFA 4KFUA 1E98A 1W5SA 3SE0A 1FP6A 3NDPA 3Q5EA 3DDCA 1QRAA 5C4GB 2WOOA 5TMPA 2N42A 3VNUA 4KVGA 1VHLA 2O8FA 3QVUA 2IEZA 1Z6GA 4OI4A 5KNCA 4NYJQ 3QPUA 1NBMA 1FP7A 4GNKA 1E2PA 3BC1A 2CXXA 2IXFA 1G19A 4A6PA 3AE2B 1ZXIA 1R5NA 3EPHA 2VIIA 1QHYA 3VTKA 3GCGA 4TLDA 3W3ZB 4YC7A 2JLYA 1LV7A 1U9IA 2YZ2A 4S35A 3R9IA 5IK2D 4LUCA 2H7VA 2DPXA 4H9GA 1Z63A 2M56B 1MO5A 4AG5A 1KZ7B 3ASYA 3G5UA 2ODEA 4A0RA 4C9BA 2ZR9A 2NPFA 2VSXA 4N3NA 3DWMA 2ZRPA 3KQNA 2JA1A 2ZYTX 1OHHA 3OFND 1D8TA 3MWKA 2NZ8A 5FUXA 3RDPA 2Q0HA 2O0KA 3VR9B 1XDBA 2ZAOA 3GFPA 3REGA 5JZVA 1CTQA 4EDHA 1J99A 1NKSA 3PEUA 2AX4A 2F1HA 3AEGB 4TT3D 3SS8A 1WWTA 2C8VA 3HYRA 1Q1ZA 5J4VA 3U6KA 2QSYA 1RKBA 3L0IB 5KHOC 3U3RA 3Q85A 4Q7LA 4QNRA 2J7PA 5JLJA 4BFXA 4TMXA 2IHBA 4DJTA 1JB1A 4HAWA 4LBYA 4LJ6A 3EAQA 4OBEA 2JCSA 1XJQA 2PZGA 4JVLA 5KO2A 4RJLA 1XO3A 3Q8XB 1OKKA 3T35A 2ZJBA 5KTYA 5BQ5A 3DHWC 1YJJA 1WA5A 2ZRDA 1GNRA 3SDZA 3K70B 3AM1A 3L2OB 2BCJQ 1I4LD 2BEKA 4USAA 2GXUA 1HTWA 2VL7A 3R8FA 4Z1MA 1DO2A 1WMSA 1L4YA 2QMUA 1E6EB 3PV0A 1CJUC 2KBEA 1XCGB 2Q6TA 3BS4A 4NP6A 4PPFA 2CK3D 2QPTA 3E1SA 1R8QA 2CEAA 2QE7D 2YJTD 4UNPA 1Y63A 3BGWA 1FTSA 1NYRA 2WJYA 3A37A 3SC3A 1Z0KA 1E2IA 5K8IA 3QVVA 1EG7A 4BLSA 1TQ4A 4K81B 2RGCA 2FE4A 4L15A 3WY9A 1L0VB 2QAGB 4PANA 3BOSA 4PQFA 1W36D 5DYGA 5KDDA 3K0CA 3QY0A 1Z3IX 4E22A 4XSGA 1OFUX 4GZLA 3BERA 1IXZA 4HAVA 3WBKA 1NBME 2Z4SA 2ZSEA 3CONA 4JL6A 1E2KA 5KDLA 4D4JA 4MQBA 1P6XA 4TLBA 3RWOA 1XWIA 1N25A 4P32A 1Q3HA 3Q3JB 1W49A 3RABA 4PQYA 3R7WB 4B34A 3GJ8A 3CIOA 4EQ6B 1E9EA 1CP2A 2ZE7A 2BHRA 3UG6A 4F4CA 4M2LA 4IXNA 4WOPA 4HDQB 4GOKA 1OFFA 3SBEA 3K70C 4G0NA 3WRXC 3U61B 2QTVB 3SYNA 1FZQA 5AR1A 3TMKA 1U0JA 2GXQA 4TL7A 4XTRA 4RZ3A 2BS3B 3ND8A 2H92A 2IYRA 3PR1A 4Q21A 2VLIA 2C77A 1N5XA 4GP7A 3NH9A 1RW4A 3PO0A 3TR0A 1AZSC 3QPWA 4GFDA 6Q21A 1SXJD 4B2PA 2DFKB 4QGHA 1SVWA 2WHXA 1P73A 1NRJB 4EAQA 2YWFA 1FRRA 4QGFA 1BYIA 4ZIRA 2GWHA 4DUGA 3QEJA 3KWLA 1ONBA 4HAYA 1IY1A 5F9FA 4HLCA 1FFUA 3FHOA 3SR0A 1Q1EA 4DSOA 1ZIOA 1AK2A 1AQUA 4C0QC 4L9WA 3W5VB 1J7KA 2BVNA 4C0KA 1W7AA 4D2IA 3CRRA 2ZQ5A 2GJKA 2XEXA 1XJ0A 2XTMA 2IF2A 2W58A 3AUYA 3A6PC 1Z29A 2GZDA 2VRWA 4XD7D 2JLVA 1NN0A 4UJ5A 5BYKA 4ZHOA 1MRSA 2G1EA 4KI0A 4Q18A 3IHLA 2HCJB 2XGJA 2JLRA 3TE6A 2ZS9A 2QGZA 1QHNA 3BFXA 2HV8A 4RCZA 3TW4A 5KOYA 5F98A 2BM0A 5DH9A 1UPTA 5IF9A 1ZM9A 2BV3A 1QVAA 2Q5WD 2D7CA 2GAOA 4WVFA 3GLFA 4DLRA 4U7DA 4EFLA 1F0ZA 1E2MA 1CBUA 1B23P 1FMAD 4LTUA 2XTNA 3WNCA 3VNVA 2BKUA 4OI2A 5FI0B 4D80A 1XEXB 4BFZA 4DWJA 4PFSA 4KYUA 2BKEA 1M74A 1F2TA 2WICA 4DDWA 2BS4B 4M53A 2CVFA 2G1JA 2JJ1A 4LV6A 4URYR 3R8CA 5FR2A 4DB2A 2WPDA 3THWA 4EKDA 4PSKA 2F6RA 3IQXA 1XPUA 3NRZA 3VX4A 4O25A 4U00A 1Q3TA 1KI2A 2QTFA 2ZS8A 4X8HA 4V0MA 2ZYUX 1AGPA 2XNDD 3DKVA 1AJEA 1KF6B 1DO0A 2IXEA 2K22A 2XSZA 3CRW1 4DCTA 1P2UA 2NOAA 2F55A 1T3HA 3QXSA 1NIJA 2E9SA 1W1WA 3BB4A 4JJKA 2UZ3A 4OL0A 2G83A 2H57A 4M4SA 5DI3A 4AWXA 3U60B 3NXSA 3L0OA 1ZM7A 1SB3C 3P4SB 3SJAA 2IYSA 2PT7A 1R0WA 2QT0A 1D9ZA 2C03A 2ZANA 4FXPA 4JYCA 5C1BA 3KJHA 4ZPXA 4HAUA 3A1WA 1NIPA 2WOJA 4YSXB 2WWFA 3P4QB 2CE7A 2ZU0C 3RS3A 2YYZA 4LBWA 2A5FA 1E0KA 3B1WA 3FE2A 4L5BA 3VX3A 3MWLA 1GWNA 3WYFA 4FMCF 1GKYA 1DAKA 1QHHA 3T1QA 3TSWA 2QP3A 2W2XA 3W9YA 1UWMA 3IUYA 4IW3B 4TN1A 2IBMA 3LNCA 3IIMA 4D0NA 1BO6A 1N61A 5LD2B 2ERXA 3E70C 4CT4B 2WU5B 3VKHA 5FUVA 2OAQ1 4DLXA 3PXGA 3CX8A 5KSOA 1P5ZB 2RGGA 4N1AA 2VQSA 1UF9A 4TL8A 3AB3A 2WKQA 2MJDA 2ZI5A 4JL8A 4BUJA 5JSZB 4UNQA 3A36A 1Q21A 4FMDF 3IO3A 5FPSA 3DZ8A 5CK4A 4MYCA 1CJMA 3T15A 4TSFD 2ZJ8A 2EYQA 4XOIA 4URVR 1WRIA 2BMEA 1OH7A 4LYHA 2HUPA 5J4KA 2QT1A 2R65A 4IFBA 1IUEA 2EW1A 3NEJA 3NBXX 4PR0A 3BIFA 1M7BA 3GLFE 1L6VA 1XMVA 3N5CA 1OF1A 5IRCD 5FL3A 4D26A 1UBEA 2C5LA 2GHIA 4QOSA 4RD6A 4UXIA 3CPEA 2VP2A 2G1KA 3PUZA 2WWXA 2WZQA 1GKUB 2ZEJA 1XCPA 1JPJA 3Q9LA 4DBLC 1R10A 1YZTA 4LJ8A 1ZNZA 5LBIA 4URWR 1UEIA 4W5HA 1HYQA 3NS1A 1JR6A 2FH5B 4V02A 1NLYA 1E32A 3OIYA 2CE2X 4DSTA 3ZIAD 2F1RA 1T4GA 2D2FA 3U44B 1T8TA 2CHGA 2WSSD 4V0ME 1QZXA 3QXJA 1KI1A 1E10A 5KYKA 2B7CA 4ITRC 5FPTA 3TH5A 2WWWA 2A3RA 1XTSA 1G18A 4Q1FA 2LKDA 3QI2A 4MRRA 5TVKA 4ZDKA 3NG1A 4JLDA 1GUAA 2PCJA 1IJFA 1RRPA 1YRAA 5B2ZA 4C0SA 2OXCA 5A0FA 4G5GA 3GLGA 2EQBA 4A6XA 4NCIA 3RRYA 1YQ4B 2REXB 4NZYA 2L83A 3FKSD 3CPHA 2YC4C 2Q9AA 4WW0A 3VR5A 1E2NA 1EFHA 1N6OA 3H1TA 2AWOA 1NVWQ 3VFDA 1XLOA 5C46F 3ZD6A 2HT1A 3W5IA 3WHLA 1N6IA 4CW7A 2QTHA 1G6HA 2RH5A 1S1MA 1SULA 1ZJ6A 1RJ9B 3EC1A 4Q4LA 4WBSA 2HLDD 2OLJA 2QJLA 3AQ4A 4B73A 4CEIB 2RCNA 2Q21A 3CX7A 4LI0A 2KMMA 1DARA 3RWMB 1TAGA 4DLTA 2ZYWX 4OHVA 3C41J 3SJBA 4BWYA 1KAOA 4HATA 2MMGA 1XCMA 3EWAA 2QAGA 3MAAC 5M04A 1N5IA 3F3YA 1GFIA 4M9SA 2NMVA 2VP0A 2AL7A 4ZCMA 4BGDA 2P6RA 3BFKA 2GK6A 3VU9B 2OXRA 4LBZA 1QOFA 1F5NA 5SZIA 1RRGA 4LOAA 3LB8C 3PEVA 1PUTA 2R6CA 2R8RA 3R7WA 4EQ6A 2PL3A 3FFBA 3GJ4A 5J4HA 4D4LA 1JEDA 2AHOA 3QUSA 2JLSA 1N2CE 4XWOA 1T91A 4QBHA 4D81A 1KDPA 1NLZA 3IKJA 1RC8A 1D5CA 5J5CA 1A5TA 1U2RA 5FBWB 3CF2A 2AXPA 1XD2B 3LQQA 4QRHA 4D25A 3L43A 2BIFA 3LLUA 3AVXA 2VPPA 4MKHA 2QNRA 4G5SA 1E1RA 2WMOB 2W6JA 4TTRA 4GP6A 4IDNA 2CLDX 4Q7JB 2IHYA 2XJ4A 4M1YA 2NPIA 5EXXA 1AS3A 5CK5A 3THOA 2BM1A 4DCSA 3R9WA 4TZ6A 1XNJA 2H16A 3W5UB 4MH0R 1O3YA 1HE8B 3CPJB 2V54A 3EUB2 5AJVB 4A8JC 5AWFC 1P75A 3A1TA 1P72A 5FPHA 3AKDA 1KJZA 1T8UA 3BWDD 4JJZA 3SHWA 1F3OA 3KKNA 1TU3A 1XEFA 3O8CA 3QXXA 3PQCA 2EFCB 4ILEA 1DE0A 2GEUA 4B75A 1EGAA 1P7CA 4LV8B 3G82C 1R2QA 3BD9A 2C04A 3GJXC 1GP2A 3AE9B 5FOSA 4I1UA 4MDFA 1NL3A 3VMFA 4HDOB 1ZW6A 3W34A 1T0JB 3LW8A 4JLPA 4JZKA 1EESA 5AUPB 4DSNA 1J7CA 1ZYUA 3BBPA 4PZYA 1EFRD 4CZ2A 2IYYA 5DSZA 4NYMR 4URZR 4ARZB 3FVQA 3K53A 1R4AA 4F93B 2OFWA 1COWD 1Z47A 2B8TA 1Q22A 2N1BA 2P5TB 4Q7MB 1WB9A 3HRDD 3W9CB 1Z2CA 4JYBA 2VP4A 1XEXA 4FMCB 4JLMA 1EXMA 1VG0B 1IOZA 3CNOA 3GD7A 3LBIA 3QKTA 1Q20A 2C99A 3IQWA 3RC8A 1KK1A 1LS6A 2PEZA 1JWBD 4URUR 2AN9A 1P4SA 3KKQA 1L5PA 2PIAA 1YZGA 4ZO4A 3ECCA 4R9UC 5SZJA 1E9CA 2Q3FA 2C95A 3ZYYX 4MUAA 3K9HA 3VR8B 1EFTA 1VDVA 1E1QA 1KDRA 5BN4A 2B92A 4FMDB 1K5DA 1Q1BA 4NDZA 1TADA 2FSHA 2TMKA 4WZAE 1E0JA 2BS2B 5C4MA 3EZ7A 4IVRA 1E7PB 1TF5A 3AUXA 4J0QA 4IOKA 1NVID 5EXPA 5JFGA 3QXHA 2ZS7A 3FKQA 3THXA 1LTQA 2SHKA 1YR9A 3ZYCA 1W36B 1CXZA 2CNWD 1E79D 3DVLA 3FPAA 3FYHA 2ZRGA 4LK2A 3ZVNA 2IEYA 4XVUA 2IL1A 2J41A 4PHGA 8OHMA 1P60A 2KWIA 4M1OA 1UAAA 4JLAA 1ZP6A 2AR7A 3IEUA 1SF0A 4V0KA 2ZUCA 1IN6A 3IIKA 5E7JA 2ZJOA 4C7YA 3THYB 4IOJA 4CIDA 1Z08A 2CHVA 2D4HA 5HE8A 1XPOA 1J7BA 4KXFB 4PZLA 1R0YA 3K0AB 2QORA 3MRSA 3CR8A 3CBQA 4AKEA 4JBYA 1ZM2A 4C2UA 2XOKD 2P67A 1SVLA 2GCPA 1Z07A 3TW8B 1DS6A 1LW7A 4H1VA 3LFUA 5JSZA 4B44A 1CRQA 1NSFA 4JT4A 4P0TA 1U90A 1HQYE 3AVOA 4ZKDA 1W46A 4OQFA 1E2FA 3QIAA 2OV2A 1D2EA 2W55A 2F9MA 1DELA 1UBCA 2IYQA 2JAQA 2W2TA 4XJXA 4US2R 1SXJB 5DN6A 1OQQA 5FOWA 3EPJA 2ZE5A 4AKGA 4QBGB 1E69A 1F60A 2PX3A 4V0LA 4A92A 3AEFB 1WYGA 2V1XA 2LCFA 3JZAA 3LO5A 4H1UA 3SFEB 4UNRA 3FGNA 5HZHA 1W36C 1Z6TA 5G5GA 1PVOA 1VDZA 3CUEF 4XWKA 2JLUA 2PEYA 3EPKA 1DADA 1E2EA 3QF7A 3CKLA 3QG5A 2ZPTX 3AEEB 5G41A 2HTME 1SQ5A 1JALA 4Q1CA 4B74A 2AK3A 3QEOA 5KSZA 3CNLA 1B0UA 1Z06A 2D74A 3TK1A 3H86A 3KJEA 1I4DD 2J45A 4WZBE 1IONA 2YKGA 2EYUA 3U44A 3X1DA 1EK0A 1F2TB 4KLNA 2B76B 3I8SA 4DCVA 3ZQ6A 4HRSA 3NEYA 2H1LA 5IT5A 1S9HA 2OLKA 1LF0A 4F4IA 2DWOA 1KGDA 1KAGA 2BBWA 5TY0A 1SVSA 2Z43A 3ADCA 3I8XA 5FTKA 3T34A 5EP4A 1XEWY 4YLGA 5F2EA 2XZOA 4QJ5A 2Z6VA 2N0SB 2W3SA 2A5DA 1TJEA 4DEYA 1W0JA 2DCUA 2V7QA 4CDGA 3F0TA 2HDNB 4CGZA 1ZNYA 2ZE8A 4O2RA 2JEOA 3P1JA 1V8CA 1H8EA 1NVVR 1XZQA 3K09C 4YONB 3FMOB 3B7GA 4CEIA 2H5EA 1ZIPA 3OEHD 4LCBA 2VHJA 2MSCB 1KKMA 1VCIA 1CULC 2V1UA 2ODNA 3RS2A 5EE3A 2JJ2A 2RGDA 2Z0MA 2FSIA 1XJCA 4LHZA 4KYIB 2OE2A 2V6JA 4KFTA 4IRUB 3ZZ0A 2BMJA 2F3TA 3DM5A 1JQLB 5JEDA 3ZD7A 1D2NA 2ZI7A 3EG5A 4KODA 2F1JA 4ZI2A 1AS0A 3C7KA 3CM0A 4HLUC 4ZHPA 1W0KA 3VU9A 4RZUA 3TQFA 5L3VA 4LGMA 1QT9A 5FH9A 2W0SA 5E4FA 4IJMA 2GZAA 4IVQA 4Y0VA 4BECA 4JL5A 1Z2AA 3JVUA 3SJCA 1UEJA 4NCNA 5DHFA 3FB4A 2CCJA 3RANA 2RKOA 5FUYA 2D7DA 4WIAA 1IY2A 1JQ4A 2GILA 2GF0A 1XB2A 1YQ3B 1WXQA 3V00A 4C3ZA 3CWIA 2HJVA 2IYTA 1KO1A 1NI3A 3ZZTA 1GL7A 2BJVA 1XD2A 1WE2A 5GJVC 4M21A 4HEJA 1I2DA 2ZRBA 4O2LA 1P2SA 4P4UA 2ZI4A 1IXSB 4WZ6A 1VMAA 4OJKA 4X8LA 2XB2A 4P33A 3LAWA 3FWYA 2WAXA 1M2OB 5SZKB 1TUIA 2LWIA 3NVVA 4YT0B 2QY9A 4PAQA 2ZU6A 2WJGA 2J3EA 2VHQA 2DHRA 2WBLC 2NGRA 4HB4A 2FPMA 2ZRHA 1VYVA 1II8B 3W8NA 4D0GA 1KI6B 4TMZA 1ETUA 4GMXA 3BIID 1UKYA 5IK2A 421PA 5CB8A 2J7PD 1D2MA 1M34E 2V8OA 3NDBB 2JQRB 4MRPA 1NMYA 1QHSA 2VSOA 3DMNA 3QPVA 1ZBDA 3OEED 5E7MA 2ANBA 3HJNA 2AKYA 2GVZC 1G20E 1OB2A 2OCBA 3LA6A 5C18A 2F1IA 1W5TA 5F9HA 3OFNA 2RGNC 3FFAA 4JKIA 4LJ5A 2BWJA 4NTZA 3GLGB 3K0SA 3I62A 1QHIA 2WWIA 1XTRA 4MKGA 4HZIA 4GOJA 4ACBA 3ADBA 2RMKA 4JBWA 4IOMA 5JECA 4N0EA 1TTTA 1KSFX 2XX3A 4KSBA 5K8TA 5JS7A 3UMRA 4TT3A 3D31A 2GEVA 4W5JA 4XWAA 5H8WA 2KAJA 2CCGA 4LPKA 4ARZA 3AGQA 3EPLA 1JR3D 1AIPA 4RY2A 1CKEA 1DG1G 5EE1A 4ASUD 5D3QA 2OEPA 1YJIA 3AE1B 4FMBB 2HYDA 3PUWA 3X1WA 3CRQA 4HDCA 3VR4A 3A4MA 2OM2A 2M19A 2H17A 4EPXA 1CEEA 4ERNA 2WMNB 2WDRB 3AE3B 3CF0A 3W3AA 1G7SA 4NYMQ 1KO5A 2WWHA 4E09A 1FUKA 1R0XA 3VR2A 4II7A 121PA 3WNDA 3KQKA 1Q57A 3OAAD 3RC3A 1RYHA 2ONKA 4TL6A 3RS0A 3MUFA 3SQWA 5DYIA 3U7GA 1FM0D 4JT2A 4N0DA 4DLVA 2AXNA 2WAYA 2B8WA 4V0OA 1S96A 1V97A 2AK2A 4BRWA 2W54A 1DAHA 4TTPA 2O8CA 4LHWA 2CK3A 2RGAA 5HR5A 1UKEA 3HR7A 2QE7A 4B3BA 5FOXA 2QL6A 4NPHA 3I5YA 3EX7C 3NHBA 2D06A 3BJIC 1SKYB 3N2IA 4JLBA 2BBTA 4Y0AA 3H2YA 3GQBA 2V3CC 4B76A 2PZFA 5H1YA 1P61B 2I4IA 3L0PA 4AY2A 1PJRA 3IILA 2IX3A 3H0KA 1NYQA 1QOAA 4PO1A 2IS1A 1U99A 5JCZA 4IDHA 4F91B 3MCAA 1AA9A 3AVYA 3AF1A 1HH4A 3U3KA 4G5QA 3BH7A 2DFLA 3H4MA 2Z5FA 1GVNB 1PZNA 2FFHA 3CRVA 4M9ZA 3WXMA 1EWRA 1GNPA 4NMMA 4DT1B 4TYPA 5GJCA 2OBLA 3A4NA 3LBNA 1X8JA 3NVZA 4GRAA 4C0AC 5HCNA 3THYA 3R9XA 3IBGA 3CZPA 3DOEA 1PUJA 3KJIA 2MJ3A 3K0AA 4IEEA 1BKDR 3NH6A 3T5DA 4QBFA 2EFGA 2IYZA 4A2PA 1OXXK 2IUTA 1L2TA 2C78A 3W6PA 3C16C 5JI3E 1RPZA 1HV8A 2QGNA 5G53C 3I92A 2EFDB 1PFDA 4EJSC 3GPLA 1US8B 4WQMA 2D3WA 4BLQA 4KO8A 1U81A 4LY6A 1QOBA 5H68A 1G7RA 4U5XA 3A1VA 4XH9B 1EX6A 1F2UB 5FTJA 1RYJA 3KX2A 1ZD9A 521PA 4DKXA 4MDEA 4GPTA 1SXJA 4C7OB 2CMKA 4L4UA 1I4TD 3B1VA 3RRMA 4PO8A 5P21A 1G3UA 2YWHA 3U7EB 4D4MA 4ITKA 4O0MA 1OIVA 5D3MB 4AYWA 3HPRA 2A78A 1OQRA 3P26A 2F7SA 2QBYB 1HUQA 3NBZC 3W6OA 3K09A 4MGIR 4AURA 2KBFA 2BC9A 2YOHA 4BFSA 2ZRJA 3OIUA 3O8RA 2AD1A 4PXAA 4XD7A 1DOXA 4YDSA 1C1YA 3P63A 2GJAA 1DOIA 1U0LA 2I1VB 1G3IA 2BOVA 2J0UB 4BEBA 2VHUA 4ZV4A 1IBRA 1KI8A 4QHSA 721PA 2GETA 1E4YA 4KJZA 5FR1A 4B43A 3BFVA 4A0HA 4CRWB 4ZI3A 5C2JB 2ZJYA 2ZROA 3GFOA 2EFHB 2P3SA 2WJHA 3RRNA 3PUVA 3ZZUA 4HLUA 1QVRA 1JBKA 4PHHA 3DKPA 4YDHB 4A82A 3ETRA 2ODBA 1ZINA 3N2EA 4LYAA 1SIJA 3CNNA 5DO9A 1ZVQA 2DFTA 3U2QA 1ZCAA 1HURA 3I5XA 1TU4A 2DY1A 2ZAMA 2F3RA 4LSGA 2OZEA 2BJWA 3QXCA 4URXR 2A5GA 4MRNA 3VKWA 4QHYA 3THXB 4PPQA 4Q9IA 2J9RA 4JWUC 1A82A 1XTKA 1YR6A 2QM8A 2P6UA 2IT1A 4TMVA 1Q12A 2HJGA 3DOFA 2XNDA 2JDID 1NG9A 1GITA 3HP1A 1CRPA 5ELXA 1X8LA 3P20A 1N0WA 1E9SA 4JKYA 1OV4A 4HUQB 1KI3A 1I7HA 2IA5A 1OFHA 2OAP1 2YV5A 3F8TA 3RAPR 3M6AA 3H84A 2ATVA 4P4SB 4RD4A 2H88B 1NVVQ 4YMWA 1EFUA 1WDTA 1VCOA 2W6ID 3UG7A 1SXJE 1D6JA 4I1OA 2EU8A 1Z22A 4KBGA 3FAHA 3SR6A 2A2ZA 3WYAA 4G5OA 2WLBA 1JXMA 1QOGA 1SVKA 2O52A 3B6EA 4KFRA 4MKFA 2QROA 3AVVA 1E9RA 3O8DA 3REFA 2RGNA 4TQ9A 1A70A 4TYQA 4BFWA 2IK8A 3QKUA 1AM4D 1R7RA 3I61A 2QP4A 3DMDA 4R2HA 4QGGA 4JLJA 4DLZA 1YZQA 2O5VA 1TYGB 4KU4A 1UBFA 3GJ3A 4F38A 1HE1C 3I72A 1DTSA 3KQHA 4QBIA 2K5PA 5KSYA 3QBTA 1GZSA 2HF9A 4OQNA 4UQOA 3VR1A 4EPTA 2WS3B 4TSFA 4DLYA 1P9NA 3LXRA 4IEIA 2JLWA 2HXYA 4FWIB 1YJ5A 5CM9C 1BMFD 5HKKD 5L3SB 1SVOA 2H8KA 2QMOA 3W90A 4OHYA 3RVBA 2GXSA 4XSHA 5FBVB 4US1R 5TARA 1NNEA 3OE7D 4RD3A 1II8A 1ZRHA 4PC7A 1KI6A 1G64A 3T1OA 3GP8A 4US8A 2PLRA 1ZC4A 5BN5A 5JHHB 5FTLA 4UKDA 2A9KA 4UXJA 1JXOA 1P9WA 2GDJA 4BFUA 2IW3A 3C8UA 4Q9KA 4Q4AA 5JWRA 5L3QB 4F92B 3IIJA 4A2WA 2NQ2C 1E2LA 4PHFA 1J8MF 1EWYC 3AECB 1P3JA 2XB4A 4IFEA 4MA4A 3IDQA 1RVDA 2OSBA 2QPOA 2FN4A 4PPGA 3CWQA 4AYTA 5GVSA 2XXAB 3KB1A 3QKRB 1G8PA 3AH8A 4PSVA 4Z8YA 1L8QA 4PZZA 5AJWA 1KJYA 2BEJA 5KSPA 3LRPA 4DLSA 1QF6A 2NIPA 4HI0E 3ZIAA 3QNUA 5JJKA 5FTMA 5DHAA 3ZGXA 1Z0FA 2WSSA 1TQ6A 2OT3B 2RGXA 4BLRA 2WIBA 4YSZB 4Q9HA 2IS2A 1JECA 4B6EA 2FEMA 1WBBA 3AGPA 1O87A 3AF2A 4C0HA 2RGEA 3D6TB 3MJRA 2YC2C 4B33A 1XD9A 4C0LA 2KJQA 2REOA 3ND9A 1QBKC 2FDCA 4LBVA 3AEDB 3SFZA 3SHFA 3VR6A 1VCNA 4I81A 2VF7A 2AX5A 4R7ZA 4C4PA 2G6BA 1C9KA 1MOZA 4HYYA 1KHTA 5AUNB 4DDVA 1E9BA 2ORVA 4AK9A 4ZCLA 3FKSA 1RYFA 1XXHB 4TYNA 4HAXA 4A8JB 1G3RA 4WAUA 1U8YA 2PH1A 4PAMA 3G0HA 4FW9A 3MD0A 4P31A 1KDOA 1XTIA 1YU9A 1AQYA 3P27A 1J8YF 4LZZA 2O8DB 2FJUA 1FQJA 3UANA 2ZRKA 1GL6A 2QQEA 1U8ZA 4PC6A 2J87A 4KSCA 3P4PB 4JSTA 2MSDB 1VG8A 2HLDA 3RSOA 5KPJA 1X1RA 5DISB 1OXUA 2WJIA 3F5FA 1YVDA 1TPZA 3Q5DA 4QL3A 2FPKA 1GIAA 2ZUDA 3B2EA 3NBYC 1L4UA 3BK7A 3CW2A 1II9A 2FSGA 2ZI9A 1GPXA 2K9XA 3K9LA 4BE7B 3AF3A 2EWVA 3HVZA 1XZPA 1ZUIA 2VSFA 3PUYA 2XAUA 2QUZA 4G01B 2OBMA 2XZPA 1CR2A 2OUKA 4UNSA 5AJYA 3V4RA 5AUIA 4Q4HB 4MUBA 3RNLA 3TAUA 2X2FA 1KK3A 4DT1A 2PJZA 5LB2A 1ZU5A 1ELOA 2ZXUA 2WV9A 2F43B 2QZ4A 4DLWA 2OESA 3LXXA 3DWGC 4WXPA 4A4DA 3K1JA 2HXSA 1FOEB 2FFBA 5TV2A 2MH7A 2V6IA 1HEIA 4BQSA 1IAQA 4LHVA 2WDQB 1BYUA 1TMKA 3GLGE 4BFYA 3K0FB 1US8A 1MKYA 3RSLA 2R62A 5KPDA 2O8EA 3MFYA 3KDSE 3B13B 3IBYA 1PV4A 2G0TA 1T3QA 3DZDA 3E2IA 3AE7B 1F2UA 4ON9A 1SHKA
chains in the Genus database with same CATH superfamily
2K8BA 2BGGA 5JQGA 4PSAA 2JU6X 5FYDA 1GNUA 3O73A 3R3VA 1SXGA 3RJMA 3QJYA 2YQ5A 1EXNA 4MQLA 5CX1A 3TVDA 1XQ6A 1KA9H 4FSXA 1RHMA 1FDSA 3M49A 1SVMA 4WXRA 3EXEA 4QJBA 3DHIC 2FW1A 1WXSA 2CVHA 3SIWA 4GRIA 1SBIA 5KYGA 4WNAB 5FI5A 1GFWA 1GPMA 1U3FA 3BHNA 3ELUA 3VISA 3VYTB 3BULA 4J7CA 3DAYA 4D0SA 4EYOA 2PUBA 4OHBA 4EL5A 2I2DA 3VPSA 1R8YA 2D3BA 1JFFA 3WFJA 1H4TA 3E5HA 1JW9D 4YFVA 2I29A 3P97A 2IPMA 5EWJA 1AGRA 1ENZA 4OHJA 1FA9A 5EFZA 1ZL2A 1FNDA 2NADA 2X40A 3ZHBA 4EHIA 1VKHA 2B4RO 2BTQB 3IP6A 5T8IA 4RC9A 2ROQA 4O5OA 1GPBA 4OLJA 2LXNA 1M1NB 2H51A 3KSBC 1O7JA 2HZBA 3EC8A 2Y92A 1ZX1A 2SBTA 4K7JA 2VO1A 3JRXA 3KQ4A 4JP3A 2XQKA 2PL5A 3LP5A 3GJSA 3NX4A 4DRYA 2OTCA 3VGJA 4HDSB 3FDZB 3NU1A 2ZG6A 3VPGA 2ZJ6A 5FI1B 2BGWA 4TTQA 1NOKA 3S55A 4CF3A 4ACAA 5F7OA 3W0LB 1GDDA 2EP7A 1KTIA 2GAAA 3ICEA 1FFCA 2W2QA 4W9HA 1YS2X 4G4IA 3LX6A 4UU0A 2KPOA 2ZSIA 1NY5A 1G8GA 3FGZA 4Q02A 3RSSA 1UDAA 4X1YB 1KVQA 5E0OA 2C29D 4TKUB 2OB1A 1FLVA 2YX1A 1WCWA 2Q3JA 3T06B 1O6FA 4N58A 3P94A 2XCSB 3QVXA 1EK5A 4EABA 5HQ3B 4OQMA 5EWMB 1WX9A 4Y1FA 1OKKD 1M73E 4D96A 4C89A 1SAYA 2ZCVA 2NV6A 1KLGD 1TKCA 3H9UA 4I8IA 1OYOA 4RADA 3GYGA 4BV3A 3NAGA 1WVGA 4FCWA 1Y8QA 2RG7A 2C57A 4R0NA 2VN8A 1RJGA 4FCTA 5MF6A 1QSGA 3G2LA 2C7OA 2LJ5A 2B21A 4M0WA 3MJTA 3JQBC 5LFAA 4WBNB 1Y3AA 4EVIA 4PX9A 5C8ZA 2LUMA 3V2HA 1DC5A 3A7EA 4OI1A 1EXWA 2FP4B 3HGTA 4ZEWA 2WSMA 5G0SA 4C4YA 3IAXA 4EB6B 3TEZA 3U31A 3UBTA 4C78A 1BC5A 3FWHA 2MDTA 1QILA 1FTQA 2FCAA 4BV2A 4AJ4A 2PSSA 1N6NA 5G3ZA 5AUKA 1G8MA 2QN3A 1E6LA 3ABVB 4L8LA 2P3OA 3E1KA 3HJGA 1V86A 3K1YA 1LK5A 4GLLA 3ZS8A 1PJSA 3CSFA 1FYVA 3QE4A 1X0VA 3AETA 1DI0A 5EINA 1IBMB 1JMLA 4KBYA 4Z8XA 4YQYA 5DF1A 3QKIA 1S7GA 3ESDA 1NBFC 4XIFA 2JI8A 4Y2UA 3SNHA 2UVPB 3AM4A 3EEIA 4B85A 3DNMA 1VG9B 5L8VA 2XQGA 2IOQA 4JVMA 3T3GA 4YMSA 3ROPA 1NM5A 1O97C 4CL3A 2IITA 1FUIA 2H2AA 1ES9A 3QCAA 1R6DA 3GVCA 4BN4A 3ZW3A 5K2OA 3BIXA 1NY6A 4G4SO 4XM2A 4ZJYA 2D1RA 4KR6A 4AW9A 5LN1A 4S2EA 1G7TA 1V6SA 1ZOPA 5T64A 1W73A 4M8MA 3LVFO 2GEJA 1M4VA 3UK6A 2CHWA 2UYOA 4L07A 3RG2A 2Q5OA 3FPEA 3GCWA 2ZWOA 2WP0A 3SZLA 3PITA 3H05A 3PT9A 2BFBA 3QG1A 4E7PA 4RF3A 4RV4A 3AJEA 1RRCA 3IOBA 2WDTB 4QHTA 1L8AA 4NS4A 2X1LA 1N5MA 4ND5A 1A9XA 4MUFA 1SIUA 1C0EA 1X1AA 3LLVA 5BW5A 3I6ZA 2EJTA 3D7SA 1WP9A 3TM5A 1R5BA 2B6HA 2R9VA 3ZCTA 4FUQA 5CAEA 1GPUA 2YDXA 3EC2A 1D4BA 4DW8A 4JMLA 2I4MA 3GAAA 5A6SA 2GBJA 3VJRA 1MIOB 4D43A 1HDIA 1YE3A 3CMCO 3PD7A 1X1SA 3K92A 4E2ZA 3LFHA 4TWAA 4TM8A 2ZVDA 3DL2A 1RTTA 1TZJA 4U7PB 1FU4A 3QE2A 2GVNA 2JAPA 2PZJA 3HTXA 5LYJF 4ZTUB 3WGTA 2GFQA 3NXKA 3ZLTA 5I7AA 3TLCA 4DIDA 3IERA 2ERCA 1ETHA 1ZMRA 2YJ3A 2I1KA 1KFYB 1S1QB 1H9AA 3ZY6A 1ABFA 2XYGA 3U7JA 4R1TA 3AEUB 1VHJA 4HB2A 3CSUA 3HYCA 3DO6A 3CYFA 3PFBA 3GLVA 2VT3A 1JDNA 3DHYA 1GHTA 1C7JA 5MGBA 1FSPA 5F5LA 4LVUA 1L7DA 1HDEA 4Y2PA 4L0DA 2VZLA 2G88A 1CY1A 2UXCB 1UFQA 3HCCA 2XD4A 2HJ1A 1Z5ZA 3RKSA 1LNZA 3ZRCA 2RHGB 2R6FA 1N5LA 3AR9A 1N0UA 4P2BA 2IXDA 3OLWA 1I4RA 4YXFA 2HHAA 4G97A 1K4MA 1KR5A 2DY0A 4TV9A 5TJHA 4IJ5A 3ZVRA 1YS6A 3SBXA 1U4SA 5HS6A 3ZY3A 2C92A 3L84A 2QAIA 1JSCA 2V03A 3T52A 5LOVA 1XEEA 4U8HA 1N8KA 1AGXA 1T29A 2A88A 5HQJA 5JZOA 1NMSA 2UU9B 2XMPA 1M7HA 4NOJA 1NMZA 5ED4A 4Q03A 1TVKB 5DYNA 1LVGA 1OT5A 5EZYB 5ADWA 4K9QA 2HQSA 3I6IA 2RIRA 2KSQA 4HD8A 5BO4B 3QRWA 221PA 2W9XA 1H6DA 1GLNA 3SN6A 4K1XA 4AZSA 4QGAA 2A9PA 1CDDA 4KRGA 4DR5B 4ZOQI 2ZSAA 2EX0A 3JYOA 2RGYA 2VVTA 3HHPA 2ZRAA 4RSGA 1DFGA 4TWJA 1QC5A 5JQGF 3WMFA 4HFJA 1Q0UA 3PA6A 4DARA 1YR7A 5JD5A 4NPAA 5DNWA 1EA5A 2JHPA 3HA3A 1T3TA 2DTDA 4Y1EA 1GTRA 1CQXA 3H04A 5IP4D 2C5EA 1WWKA 1S3GA 4HXFB 4O5AA 3D64A 1GZ5A 1VHLA 4N0PA 2XQFA 3MT9A 4GNKA 2Y1WA 2COKA 3U1BA 4WY5A 1H4QA 3Q1KA 4DS3A 2NPFA 1RXYA 3DOJA 3L92A 4WX2B 1WG8A 3GFPA 4QAJA 3QHPA 4LXYA 3PEUA 2GK3A 3U56A 3AEGB 1K9VF 4OQDA 5J4VA 2XDWA 3BHJA 4Z3KA 1L7PA 3LOPA 2J7PA 3Q3CA 3EAQA 2DU8A 3SY8A 3WB0A 3DEZA 2RK3A 1OKKA 2ZJBA 3LPNA 3OIFA 2ZRDA 5CYFA 4MQ4A 1M33A 1L4YA 1U2TA 4BO9A 4PPFA 4UTRA 3H11B 2QPTA 4C4TA 1AH2A 1FTSA 3NTQA 2WJYA 3O1JC 1JS1X 1RAAA 4BLSA 2QTBA 3PSAA 2QVYX 4ZPJA 3RC7A 1VR9A 1H2BA 4M00A 4LKRA 1Q3HA 2HMAA 4QPCA 4CI0B 3HJTA 2R7AA 5JTTA 2D2VA 1NZDA 4G0NA 3APDA 1SNYA 2K25A 4X57B 4AJEA 1OWLA 1XE3A 4C56C 4EJ0A 2VDKB 1FW8A 4TRMA 3TCKA 1M2VB 3TR0A 2VHEA 3ANLA 2A59A 4MR9A 4B7XA 4ZIRA 2Z09A 4WWNA 3TW8A 3KT3A 4HDKB 1SQGA 4WCFA 9LDTA 4AZVA 2W6ZA 4NZLB 2O7RA 2HWXA 1KC3A 3DBLI 4OXRA 3TW0A 5DH9A 5IF9A 4WVFA 1B23P 4JLUA 5H4HA 5JASA 2CMHA 3OLVA 2W8BA 1XPUA 1S01A 2PA0A 2Q0XA 1B42A 2XNDD 2Z1DA 5AKZA 3HP4A 1Y7TA 2NOAA 3G9QA 3QA8A 2F55A 1BDHA 1TO2E 3KLMX 3ZDBA 2P0AA 2R84A 2ZT6A 4IY1A 3VH4A 3B1WA 3PTZA 4K9LA 5AVRA 2D5BA 3DMTA 3D1VA 1Q16A 3LC2O 5HHTA 3E2PA 3MT8A 5KSOA 3L8GA 4WOJA 2VUTA 4JJEA 4B6QA 3AW8A 5E2AA 1PEYA 3LGXA 2WINI 1E5LA 1MAWA 3AOEA 3ZLBA 2ZCBA 4BBJA 5A4DA 2L82A 2EW1A 3BE8A 1OF1A 2VDWA 3QC8B 2BONA 2ZZKA 4LJ8A 5D86A 3ZVVA 1QOZA 2LIPA 1WMDA 1P4HA 3TSYA 1XELA 3ZIAD 1FFBA 2F1RA 3C4QA 4AKSA 2RGUA 4NCXA 4M7PA 2V3VA 3U7QA 3UWPA 2ICIA 2X5XA 1G18A 3QI2A 4PS0A 1H6AA 4DJAA 4ZDKA 4DR2B 3JXEA 2EQBA 2C2BA 2YC4C 2ZAGA 3NONA 1QGUA 4S3MA 1XLOA 2PUWA 4TXJA 2KDMA 1TEZA 4ZN6A 3PS6A 1EWVA 1SULA 2IRWA 2HLDD 2WI8A 1P9LA 3FFWA 4QUGA 1G8JA 1PL6A 4LBZA 3FYUC 1RRGA 1JU3A 1B2LA 3Q3JA 4HRVA 5HK8A 3EK2A 4D4LA 1JEDA 1V7PC 4D8YA 1YIOA 1KLVA 3FN4A 1Y82A 3UW3A 1E3DA 4QRHA 2GBCA 4QDXA 5KSWB 4G0YA 3NHKA 1DO8A 3EGOA 2XTJA 2R6R1 3K5IA 4JP8A 2CUTA 2FWBA 3THOA 1PWHA 4MH0R 1IYZA 4L0QA 1SM4A 2V54A 4RH1A 3PCTA 1SCNE 5JHAA 2AG8A 1KJZA 3IBEA 4AL4A 3W5VA 4P7JA 2IOFK 3WKEA 3CE9A 1C9EA 1FNWA 5H3HA 3WANA 5IJ0A 5F21A 3G7UA 1Z5OA 2LW7A 2LV8A 3FOBA 2Z0EB 2XE6A 4PZYA 5BNIA 5C34B 3RZFA 3JVEA 3KQSA 2H52A 3BL8A 2Z1NA 4JYBA 4K3VA 4BB5A 4BNUA 1DWOA 3N0XA 2WYQA 3SK0A 4UTNA 4W8HA 3PGKA 4WZBA 2YVKA 4MWTA 3LGAA 1IUNA 4ZMSA 3B3GA 5ITWA 1KDRA 3ANXA 2B92A 1S2LA 1Q50A 1CY8A 3AU8A 2A9FA 2IBIB 1U2DA 5D01A 2GO7A 2WKWA 1QYIA 4Q9DA 1N36B 3OM9A 3VTAA 4EGJA 4I6GA 1ODSA 3L6BA 2GH1A 4K6CA 4C7KA 3NZEA 1IN6A 3IHPC 5E1OA 1HFKA 2XOKD 3E9QA 2P67A 2NSLA 2GM3A 2A92A 2WWRA 4Y2HA 3WBBA 1UMKA 4XEHA 4XJXA 1RTKA 3Q8KA 1I6LA 3RNFC 3SFEB 3NALA 4BNGA 4P9NA 2PTHA 5CFNA 1SEVA 3VC7A 2O0MA 5KQGA 2P8JA 2NUPB 2I6FA 1EK0A 4FWBA 1ADBA 4TWBA 3WK5A 1WSBA 2GPSA 3TI7A 3DDZX 4WERA 2F9FA 2EJUA 3MTAA 3A32A 4FX5A 5BT8A 2H0QA 5A02A 3OVMA 2VH2A 2BTOA 5D87A 3DO8A 2AL3A 5KJFA 3RUCA 4X64B 3WGVA 4RXTA 4J0DA 2O3TA 2V6JA 3LM8A 2FSVA 2BMJA 4P2GA 3ZD7A 3EG5A 4X95A 3VTWA 1T24A 1T9DA 1XL0A 1AW7A 5DV9A 4G36A 3AU4A 3D8HA 1YQ3B 3G02A 3CWIA 1SG6A 2BJVA 3FMGA 2AMYA 2MINB 3DH0A 3LAWA 2KQUA 3OTWA 3HGQA 2NO5A 3ASUA 3HY6A 4O4IA 2BJHA 3OQPA 3DMNA 4OHKA 2WU3A 3D6MA 3KQQA 1NT2A 2H29A 5LOVF 1ORWA 3TRHA 1A9PA 1RMYA 5A5DA 1ESCA 1RWVA 4P7KA 1TOAA 1KYXA 4IUYA 5D3QA 1ZKMA 3X1WA 1YJCA 2RJ3A 1JHQA 1CEEA 4QFDA 3VUYA 3G5AA 2KTRA 4BXOA 2PKXA 2GRIA 1IBLB 1R0XA 2FN9A 3ZCSA 1LGRA 1O9HA 3Q9SA 2LHEA 1L4HA 2R86A 5B3JA 2G04A 3LPDA 1ET9A 3PVZA 2BBTA 2IEAA 4ZI7A 1QIKA 3L0PA 3I09A 3NBQA 3MWEB 4J8PA 3G6WA 4HR7A 4K1RB 4I5FA 2IUEA 3MCAA 4OW0A 1HH4A 3TB6A 4DHWA 2OBLA 3A4NA 5AI5A 1NULA 4PT5A 1PUJA 3KJIA 4LRUA 3WYEA 2I91A 4O4JF 3I34X 3SICE 3LCVB 4NOMA 1LBIA 3GCZA 1QOBA 2KDEB 4Y9SA 1KETA 2R751 2MHCA 4YP6A 1G3UA 2YWHA 3AFIA 3D4OA 1V1PA 1H23A 3V3TA 2RHBA 1W9MA 1DOIA 1G3IA 1QLJA 2BOVA 2ILTA 2NU8B 5FR1A 2EKPA 2BUAA 5KYWA 3DKPA 2GEFA 1ZINA 2IU0A 3LL4A 2B2CA 2B98A 4C6RA 4TVKA 3G8BA 3L79A 3C6ZA 4NOKA 2XNDA 2JSVX 1NR7A 3HXMA 2OAP1 3RAPR 3UB3A 4IV8A 3RVKA 3E7XA 2YH2A 3KWVA 1VPTA 3IBTA 4YMWA 4I1OA 3EVNA 1SVKA 5IKPA 2RGNA 1R7RA 4AZTA 3JAMA 5DWQA 3A9VA 3WIOA 4KU4A 3UQAA 3ZUPA 4A03A 2NVBA 3KZXA 2EJVA 4UQOA 4F4HA 1IOWA 1NI4B 4DLYA 1V5IA 3V48A 5A06A 4J91A 3X2FA 5IH7A 1NNEA 1IOLA 3H1GA 5FTLA 2GDJA 2QMZA 1WD5A 3GO4A 3ESYA 3RSFA 4PPGA 4KGXA 2XXAB 1IB6A 2C5AA 3AH8A 4PZZA 5AJWA 1EFDN 3ZIAA 3NY5A 1Q6ZA 3H8SA 4QREA 4BMZA 5IM5A 4FYYA 2YC2C 5HK9A 3OMWA 4FJ1A 5BOSA 4WXHA 4GIVA 3ZLZA 4AK9A 4ENWA 5FK9C 4GH5A 3WQBA 3ZEAA 4TYNA 3TOCA 2PH1A 4D8TA 2PS9A 3LRTA 3DMGA 3UANA 4LNOA 1E4EA 3T4XA 2HLDA 1XT6A 4XFDA 4IIUA 5HMMA 2CLIB 4LTNA 2FSGA 2ZI9A 2VJMB 8ABPA 1CR2A 4ANUA 2PRZA 5TQ0B 3S29A 3H9DA 2X2FA 2EZ8A 5LB2A 1WO8A 3RIXA 2F43B 4DLWA 3U1TA 1VMKA 3I4FA 3QYAA 2A1TS 2Z2IA 2UZ0A 1OBCA 3RVLA 3DTYA 3N6RA 2RARA 4W8GA 4RJIA 4C7OA 4WZZA 5A3VA 4YJ2B 3BKWA 3DGEC 1WEHA 1XCQL 1ZOYB 5FO0A 4RH0A 3RE1A 3E7WA 2QAJA 3SI7A 1ZDVA 3VAWA 3Q3FA 3DXZA 3BCRA 2P9BA 2ZBQA 2HJWA 1V1MB 1SKYE 5D6NA 3AV0B 5AOVA 3U81A 2M6LA 4RKWA 3IE2A 2GZHA 3TO5A 3VO2A 1H5UA 1VKZA 3LLSA 4HNSA 3LH5A 1C9DB 2NWQA 5ERXA 1WY7A 3IPRA 2YCBA 3LKZA 3HCFA 2OHFA 3DVSX 3V33A 4ZOLF 2G0AA 4I55A 4NEQA 1BCRB 1W35A 2JKVA 4BC0A 2CDNA 4TX1A 4MUKA 3AE5B 2WJWA 5JPDA 5FV7A 1PGNA 1RC1A 2XOKA 3NBMA 3TLYA 1WGYA 3GYBA 3TUZC 1HDXA 4DL9A 2KB0A 1JAIA 1QV7A 4FYWA 5CJPA 2GNOA 3V1UA 1L8LA 2I2CA 1KSHA 1HY3A 3RR2A 2BT4A 3V4SA 3OX1A 3I5JC 4MEBA 4KR0A 3DVNU 2AJTA 3FOZA 3H19A 4DXFA 2ZYDA 3NJRA 1JHUA 2ZCJA 2XTZA 3T1NA 1M6NA 4A9AA 2QLFA 5EJEA 1CEXA 3UJAA 4FZJA 1Z3CA 3ZWWA 1NUSA 3UMBA 1OZFA 2QZSA 4BQEA 3R74A 1JDVA 4HLDA 5TPWA 1JSZA 3DEAA 1UDBA 4WLUA 3LD9A 4G67A 4IZ6A 1MF7A 3HXKA 3ZD9A 2GGSA 3R5FA 4CMKA 2QRVA 3BSYA 2PU7A 2I1WA 2VEDA 2XXBA 4EPRA 3W7BA 4M8LA 3H1PA 5H83A 1K9SA 2XUFA 2D3TA 4H0CA 2BBSA 3BXGA 4DHZB 2GPAA 3ADDA 1OHHD 2WP9B 1UL1X 3DFFA 5FNVA 1GSOA 3Q0EA 3GJ0A 2ZI3A 2H9YA 4JOQA 2LBPA 5AOAA 1MQSA 5CBPB 3H2BA 1GGJA 1ZSNA 3FILA 1W48A 3KZCA 4D9CA 2WE7A 1NUQA 1TM3E 1G21B 1JVSA 2CL5A 2J67A 2H1CA 4HSEA 3DR3A 5GONA 1E2BA 2YJ6A 3KEMA 4MGYE 2G7MC 2PLWA 1H4VB 2EFEB 3QELB 1CUWA 1JXQA 5J58A 4Y1RB 1V81A 1B74A 4CGYA 2HYIC 1HDRA 1KHHA 1KIFA 2QLNA 3S1AB 2YW2A 3LP8A 1T5DX 3ZTWA 2YLMA 4ZQBA 2GHTA 4E03A 3HCPA 2FPGB 2AF4C 3ONWA 1KO8A 3TDMA 1KY4A 1O0SA 2XMBA 3V3KA 5JALA 1GAWA 2AWNA 1JLLA 1ZSVA 2G8NA 4MWOA 1OTYA 1C0PA 3NNSA 1RYYA 4FZRA 5ALIA 3ZW8A 3DD5A 1FS6A 3AEZA 3KKOA 2PUVA 4XGAB 1UFOA 4NZZA 4DUGD 5DE3A 5IYZA 4F7ZA 3KZMA 3TLGA 1MG8A 3AV8A 1TF2A 4Z0TA 4D9MA 4X85A 1AZTA 3RTBA 4G65A 2P2NA 3RYHB 1UANA 1A9YA 2BGIA 2BF8B 4NFSA 3JWPA 2JJ1D 4YNBA 4ZGBA 2PM8A 2D5AA 2PZEA 3E6AA 4JQWC 3GA7A 1V3VA 2FUEA 1WX7A 2D6FA 4DANA 1UDRA 1MRNA 2E87A 2WUFA 2Q5EA 3GH3A 3RU3A 3PA8A 3DFZA 2PVSA 3RLFA 1DIBA 3FPFA 1WPRA 1E59A 4LJKA 3CTMA 5EE5B 4F9EA 1PD1A 3IDAA 1Q0SA 4H35A 1P7ZA 4YRIA 1C3OA 5FWYA 1B3RA 4EG7A 2F48A 2GVDC 1DJQA 5ALRA 3MPOA 5CPBA 5M34A 2WIGA 2QG9A 4GVXA 4UZEA 3G1TA 3T3DA 2Q7XA 2EKZA 1OFUA 2KACA 5ICCA 5IJWA 4D82A 3KVRA 4E71A 2IPNA 4G4GA 3KLNA 3USES 3N2GB 2ZYGA 3TRFA 4B3CA 3BMQB 3WKDA 1CR0A 2G28A 2Z08A 2GD2A 1I9CA 4KLCA 4PYMA 3AVTA 1QCDA 4ZOCA 1GG2A 5EI5A 3ADPA 3Q72A 1CV2A 4ZVMA 4QM7A 5LQJA 1FRFS 2FZLA 4Q48A 4BNIA 2J5BA 2Q45A 1QYCA 1CZLA 2XRYA 3LVBA 1EUCB 3VBEA 3EVZA 1TKBA 4W9FA 2I7XA 3TVYA 4LJ4A 2ASQA 5EP2A 4NYJR 2J9YB 4MQ5A 1B16A 2I4RA 3H5IA 2Y0EA 4BZWA 1Y8AA 3LPLA 2D1QA 3T5AA 1QO9A 1Z4IA 1OB5A 1J49A 3ICOA 2O8FB 4E13A 2Q49A 4BKRA 1K53A 4IL5A 3LXFA 2K7ZA 2WSLA 4ZRNA 2ORIA 4KGDA 5G2NA 2C31A 1J1ZA 4A36A 1G42A 4FJVB 2RAVA 1WXMA 5DBEX 3PHGA 4AJWA 1EBUA 3L8DA 3JYHA 3KALA 3N53A 3AM9A 4LMPA 3PWTA 2P8SA 2X0JA 5DLQC 2D62A 3PQ7A 4XM1A 1RWNA 1TYBE 3IX7A 1UXOA 2HIGA 5ECWA 4KIWA 3PLVA 3S2AA 3W5DA 3VNRA 1TPYA 4HEQA 4QA9A 3HA5A 2KFJA 2VA9A 4PQEA 5JH7F 4XYEA 4J1QA 2KDFB 4A8TA 3W8RA 3CIFA 2O2VB 2P6NA 2M6RA 3CZQA 1AKVA 2IS6A 1E1KA 2J08A 4KIGA 4RVNA 2Q99A 5ECGC 1YB6A 2FU5C 3CR7A 3HSKA 3GEEA 3ZS9A 1XI2A 1WRBA 5IUNC 2JLQA 1F4VA 2N9LA 1W6RA 4I6LB 4L5AA 3V1KA 2NU6B 5CX3A 3URMA 3WL8A 4XVRA 1SC3A 2LZ6A 3A6KA 3OE1A 3W1YA 1QG4A 1YI1A 5C7LO 1Y1LA 2IODA 3A04A 2FPIA 3WAMA 4LOIA 2AG5A 4HYTA 2DENB 3WOVA 3KTAA 3MCUA 5AM1A 1QYRA 5K99A 2NVUB 4RKEA 5ILOA 1JFSA 2C59A 4OSPA 4BO8A 2ZETA 2J5XA 4L75A 1TGYA 5SY6A 4UBJA 2YFYA 1AB6A 3JQ8A 2PMCA 2G9VA 4DGQA 1FFWA 4CDRA 5L6MB 2BGKA 3RTCA 1DAEA 1T2NA 3THWB 3SNKA 5GTDA 1KF0A 4HMOA 1C1DA 5B7QA 5ILQA 3LQRA 2JJ2D 1NMQA 3DL0A 4CF6A 3CR3C 2ZBFA 2CXPA 3BMCA 4NYIQ 5C1PA 2DLDA 5K3CA 1OLUB 3TG2A 2J7KA 4QG7A 3FPGA 3KZ1E 1QANA 3BRWD 3OZXA 4BX8A 2NO9A 1XZAA 1AG9A 4MMYB 4IHJB 2C98A 1NYLA 2ZSFA 5L95C 4IQFA 1X70A 3K1TA 2JEYA 3PQFA 3VNUA 1I7LA 4PZCA 5CLGA 1SOMA 1AF4A 3QVUA 5AVXA 4BNNA 2C4TA 5LQCA 2K6DB 1R4MB 4BNDB 4LXXA 2VSXA 4MV0A 3ZPXA 2JFUA 1OHHA 1D6NA 3IB3A 4RFLA 2KWDA 2VC2B 3WL4A 2HIAA 1NKSA 2CBGA 4JDPA 4WN9B 4KO3S 2AE1A 3WWDA 2AOTB 4LRQA 2XI4A 2BHTA 3T9EA 4MHTA 4ZVPA 4DJTA 4B3HA 1JB1A 4EFDA 1JLKA 1FLNA 2AXQA 2PZGA 5ECDA 1NLMA 2X0NA 3IFSA 2JD0A 1UQTA 5GMVA 1H2WA 3U7IA 3CTPA 5THKA 5GV8A 2UXBB 3R8FA 1DO2A 1XCGB 1LPBB 4R51A 4B4OA 3QVVA 5E4TA 1DIGA 3TKYA 4L15A 1LSUA 3A05A 4RY0A 5J18A 3DOOA 1P0RA 1QXSA 1NBME 2C42A 3GNSA 1I2AA 4BFCA 4MZDA 3TNYA 1Y37A 4I4CA 4M2LA 2ZQYA 4AX4A 1LGYA 2C88A 5C51B 5TX7A 1WM3A 4EMBA 4BRSA 4R81A 2E4ZA 3JTEA 3F3KA 5HIAA 1SVWA 4QGFA 4L3OA 4DUGA 5SV2A 1NI2A 2XEXA 1JDTA 2X8WA 4UJ5A 3UQBA 5IAAA 1XROA 5KOYA 3AIIA 5CRIA 1F0ZA 4EKEA 1JHDA 5CTAA 1P2GA 4D80A 1EGMB 5KWVA 4KYTA 1Y6GA 1MH9A 4X9XA 1BDMA 4D3YA 2JJ1A 1I3LA 1P8AA 1B41A 1XYYA 1HZZC 4EKDA 3AM3A 4RKRA 4V0MA 3DKVA 3JSVB 2IXEA 5LYJA 3QXSA 2VPZA 3PQ6A 5DI3A 4R83A 5JVDB 4GMHA 4XVCA 3PE3A 3A1WA 4RF5A 3TSWA 1UWMA 1MX3A 5C1DA 2V4IB 4IFIA 2INGX 2VYCA 3H2ZA 4RJKA 4KMSA 1HTBA 1Q21A 1E5QA 2QUBA 5IF3A 4RLHA 4LYHA 1HLPA 4MEJA 1IUEA 1L6VA 2O5CA 3M83A 4RD6A 3L16A 1WF6A 3RU7A 4B2YA 3O4HA 4ALMA 3OKPA 2OVBA 1TTPB 4URWR 5JTUA 4UU7A 2FH5B 4DMKA 1P0CA 3RASA 1OXBB 3GGCA 1E7RA 4OKIA 1E8NA 2WWWA 1Y0BA 4R5MA 4Y2TA 4KXMA 1DQSA 4Q3KA 1C4WA 4KR3A 1TJ3A 1Z16A 2GPBA 5L9AA 4C0SA 4NZYA 3DE7X 1RI1A 4JITA 4JLSA 4RGQA 2I8LA 2IU6A 2GBNA 3DOUA 3SJBA 4BWYA 1LDYA 2QAGA 2BR5A 3MN1A 1L0XB 3IVMA 1S02A 3LY8A 3P42A 3DBHB 3PEVA 4BO0A 4QOHA 3NM4A 4HDQA 3DTVB 1M72A 3FOWA 4EMUA 4Y6RA 1XD2B 3C5EA 2YMMA 5JAZA 1VZ6A 1WIAA 2POQX 3N07A 1AS3A 1M8FA 1HEZE 1T1GA 5AJVB 1J9ZA 2XE8A 2FJPA 2IHJA 1PJ4A 1LQBA 4J0EA 1T8UA 3LL7A 4MSUA 1SEPA 2VQ6A 4LXIA 4AUKA 1E3WA 1F3OA 1DC8A 1PX0A 1YGYA 4BVAA 2DCMA 5IX8A 4LV8B 4YT5A 1GP2A 4U63A 1YS9A 5FOSA 5BORA 3FLEA 1YQ9A 2JIMA 2WHQA 3AWDA 4X97A 5AOCA 2I78A 4OQPA 3FVQA 2N1BA 1BE1A 4YAKA 4M1QA 1N2ZA 3CNOA 2IU4A 2XTAA 1HWYA 3L0ZA 2AN9A 4ZHSA 1MW9X 1E9CA 5DRTA 4ZYTA 2ZIGA 3NOQA 4NDZA 4XUDA 4BYGA 1E7PB 1MTOA 1USIA 2X8JA 2FYTA 3DAOA 3CZCA 4X3OA 3F7TA 4KJXA 3NHWA 1NBAA 4Y0NA 4PY2A 4G26A 4HGZA 1XXGA 3CCBA 4TKNA 4CCYA 3IT3A 2WRZA 4JC0A 4U2KA 3QFFA 1L4MA 4DMRA 1RQLA 4MUGA 2WUEA 5EJAA 3WLLA 3ESRA 4P0TA 4XYGA 4ZKDA 1W46A 4OQFA 4Z5XA 2ISCA 1P0PA 2W55A 1A9ZA 2F9MA 4O8CA 4YPVA 4YRAA 2GOYA 2C5FA 4EW3A 1ONOA 4GKKB 3AHJA 4A92A 4R8LA 4EW1A 1IQUA 3TSAA 2WD7A 5DEOA 1FEZA 4HWKA 3A11A 3K9OB 3PHWB 3V6MA 4MIKA 3NOBA 1BHQ1 5BR8B 1PV2A 4P3OA 3UGJA 1KAGA 5T8KC 4YDRA 1LDMA 4YAFA 1UXKA 2A5DA 4JELA 3KO8A 2FW7A 4CGZA 1RAFA 3EMVA 2FK8A 1K3UB 2JGKA 2WXGA 4Z4FA 3K09C 1RKVA 3Q10A 2ACEA 1VCIA 4YV1A 1CULC 1C1XB 5M7EA 2JJ2A 3IV7A 3N39C 2PUGA 2A14A 1QGAA 2ZI7A 3LUHA 1OWMA 3TMYA 1PQWA 4EA8A 3V4OA 3BRWA 1QT9A 4IVQA 4YBRA 4BECA 1ENOA 2VTBA 1C9YA 1FSSA 4NCNA 5IA7A 1VBFA 3K5PA 4UVEA 3VUWA 4OCZA 2Q4EA 5CDUA 4D9EA 4M88A 1E3LA 4DQUA 4YRMA 4BO2A 2PSEA 2P90A 1TUIA 3C8MA 3IRUA 5ALOA 3KOYA 3KS9A 2Z8LA 2FPMA 2ZRHA 1KI6B 1WMFA 2J7PD 4M7WA 4H2AA 4YFYA 1DXQA 1SCUB 3ICWA 2QZPA 3FFAA 1DKQA 3FNGA 3K1AA 4GOJA 3UMRA 2GEVA 3DFKA 5BMOA 3OEYA 4J07A 3SZGA 2C0CA 4P82A 5BUQA 3KNZA 1DG1G 2FOIA 1NUHA 4ASUD 4QO7A 2P69A 3S8MA 3W2FA 4ZQHA 4B81A 3MGKA 3HYSA 3CF0A 2KX3A 1QCZA 1VLZA 3L9WA 4II7A 3E9DA 2Q5JA 1GCOA 1XZ8A 4XA8A 1HE3A 1HE2A 3MLBA 1C0KA 3LWZA 3HL4A 5AXCA 1RBQA 2UYYA 1YS7A 3OF3A 3CRVA 4D4GA 4MEAA 1RBZA 4TYPA 3HDHA 4DDMA 4Z7JA 1UMDA 4Y2XA 3KE9A 1CY7A 4K2HA 4YJ3F 2IYOA 5FPPA 4LY6A 3DVGY 3OWHA 3FM9A 4BMYA 2O50A 3MSCA 1VLHA 3BWCA 5B6IA 3O84A 1QGYA 2X4IA 3V7YA 1VGQA 1JT2A 3E58A 4MAAA 4KTVE 3QAQA 1TTHA 2WZCA 2ZRJA 3LBAA 5DCNA 3P2YA 5B3KA 4CODB 2FX2A 5BQ3A 5IBCA 5C31A 1P2BA 3CUWA 5JY1A 5DO9A 1KWKA 3QXCA 3C45A 4KFCA 2GCEA 1U5BA 5I5EA 2J9RA 3C39A 2TMGA 3S68A 4S04A 4A16A 3GFQA 3DOFA 5J9FA 1P7PA 4BO7A 1TLFA 4GXNA 3Q8AA 3IVFA 2NUAA 1OV4A 4BAZA 3LHFA 3S7ZA 3PHCA 1WJGA 4H7FA 2ATVA 3FSJX 3K73O 4ZO7A 4D42A 1VXOA 3N2YA 1Z22A 5ALGA 3P9IA 2A4KA 1IN1A 5JATA 1B6SA 2QX4A 2HSZA 2VZKD 4L95C 4QXOA 1X80A 1QQTA 4BVBA 4D4IA