4A9AA

Structure of rbg1 in complex with tma46 dfrp domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
368
structure length
356
Chain Sequence
STTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRRELLTSGAGIGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIIDGGRGKQVIAVARTCNLLFIILDVNKPLHHKQIIEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEASSRRYMPAIYVLNKIDSLSIEELELLYRIPNAVPISSGQDWNLDELLQVMWDRLNLVRIYTKPKGQIPDFTDPVVLRSDRCSVKDFCNQIHKSLVDDFRNALVYGSSVKHQPQYVGLSHILEDEDVVTILKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords RIBOSOME-INTERACTING GTPASE 1
publication title Rbg1-Tma46 Dimer Structure Reveals New Functional Domains and Their Role in Polysome Recruitment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 116
structure length 356
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF02824 TGS TGS domain
A PF16897 MMR_HSR1_Xtn C-terminal region of MMR_HSR1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a9aA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a9aA02
4BFTA 4DSNA 4V02A 1X86B 3UG7A 2C8VA 5C46F 4HAYA 4RZ3A 3M0EA 2Z4SA 2OZEA 1ETUA 2O0KA 3A1WA 3AF3A 3WBJA 4BLSA 1DAGA 1KI4A 4W9MC 4AIIA 3KX2A 1IN8A 2Z43A 2BBWA 3BFVA 3K70C 1XF9A 2HF9A 1U9IA 3B13B 4M8NE 2JASA 2WWWA 1NN0A 5DE3A 4AD8A 1GRQA 2BBTA 2WIAA 3OE7D 4CDGA 4KLZA 1GUAA 1G21E 1YQ3B 1P73A 4US8A 2P6UA 3LQQA 3LXRA 5G41A 2H18A 2XTNA 3MSXA 1U0LA 2OBNA 2ZEJA 4OJKA 2ZQ5A 3X1ZA 4A92A 1NNEA 3GP8A 3AB3A 2ZJOA 5L3SB 2G9NA 3AEFB 2OHFA 1U2RA 3D8BA 1FRDA 1R8QA 1XJ0A 1TADA 4RZ2A 1KI1A 4Q4JB 3B9PA 5DNYB 4NDZA 4NU0A 4NYIQ 2VSOA 1N5KA 1NLYA 4UNPA 3OF5A 3CLVA 2EYQA 5BYKA 3FTQA 3EZ6A 3QSYA 5DO9A 3WXMA 2J9RA 4JKIA 1FIQA 3PUWA 2FMXA 4MITA 4PC6A 1OB5A 4HZIA 2IEYA 2RKOA 3AVTA 4E09A 1KK3A 1OHHA 2ZROA 1ZP0B 4LHZA 4HAXA 3RS7A 4OQFA 4OKSA 3TKLA 5JMTA 4LCBA 3QY0A 5UKDA 4LJ6A 2A5GA 3QKRA 1TAGA 2E87A 4ZKDA 1IN4A 2ORWA 5FTJA 1VCMA 2CMKA 4EPVA 3A1TA 3REFA 2IS6A 1G3QA 3PQCA 2HJVA 2O8FB 2L52A 3CF0A 3M1IA 3VR5A 1E2GA 3E2IA 2CU3A 2YYZA 3AP1A 1GKYA 5DHAA 5J40A 1I2DA 3QG1A 2QPOA 2DFTA 3UWKA 2FV8A 4B3CA 2QTVB 4GPTA 1JRPA 3QQ5A 2ZYUX 4ASUA 2GJKA 3IO5A 1CZPA 3W3ZB 1HUQA 3GJ3A 3LAWA 4JVNA 1Q57A 4N58A 2AXNA 2BM1A 2JAQA 1ZNZA 2CK3A 3LRPA 3IDQA 5FUYA 4N0EA 1PVOA 1FTSA 1MRNA 2QP4A 3MWYW 4LJ9A 4TMVA 2GJAA 4HZUA 5LD2B 3AM1A 4Z51A 1QVRA 1E94E 3U7EB 1E98A 3CONA 1XTJA 3U3OA 3QPVA 2W83A 3I72A 3F5FA 1B0UA 4HDOB 2ODEA 4CEHA 1SXJA 3I8SA 3UK6A 1EESA 5L3QB 1XTIA 1FFHA 1TQDA 2YKGA 3VRAB 1CR1A 1UBCA 2C77A 2W54A 1IOZA 1L6UA 4GL2A 5DYIA 5KO2A 1BYIA 1YU9A 4AG6A 1RRPA 4YXDB 2PVGC 3SHWA 4C2UA 1ZXIA 4UNSA 3U6KA 5JRZA 3AE9B 2F1HA 4L15A 4D0LB 4TLDA 1VCNA 3K09C 4DUGD 2PCJA 1IBRA 5KTYA 3GLHE 1MO5A 4DIEA 2Q6TA 1KI8A 4MKIA 1NVUQ 3C5HA 3UPUA 3H86A 2GCOB 3P27A 3W5VB 2CJWB 1E9CA 3W34A 1YZKA 3QI2A 1DO0A 1N6LA 4QHTA 1TKGA 1R5NA 2FSFA 3CNLA 5EXTA 5B57C 5FL7D 3X1DA 1NI3A 3ND8A 1BYUA 4NE2A 4LC0A 3LXXA 4YXWA 1UAAA 1ZRHA 4U02A 2WICA 4M9ZA 5JWHA 3VAAA 1V8CA 2NQ2C 1TKYA 2NZ8A 3AEZA 3GQBA 4HB4A 3ZZTA 2FDCA 1TNDA 4LBYA 3BOSA 3SYKA 2DWPA 1E9MA 1Z63A 1ZIPA 2QE7A 1SULA 3VR2A 1GWNA 5E7MA 4A2PA 1SF0A 2MSCB 2WJHA 3VQTA 2XB2A 4MDFA 3PITA 1YVDA 2ZIAA 1ONBA 5ELXA 1LY1A 5JFGA 4AKGA 1J8YF 4F7WA 4YQFA 2UZIR 2CEAA 1A70A 4BWYA 4RCYA 4EPXA 1NENB 1S9HA 4IFEA 1EWRA 3R8FA 4B74A 2WSSD 1DELA 3AVOA 5BW8A 3CX6A 5A5GA 3CB4A 2RGAA 2QMUA 2EFDB 3IQXA 1W49A 2A5JA 2WOJA 3WNBA 4MYHA 1YZTA 1UPTA 3SEAA 2XXAB 5H92C 3NBXX 5DGXA 4Q4LA 4N59A 3ZIAD 1E2MA 1RFLA 1XPOA 3EIQA 1NF3A 4OHXA 4C0KA 4FINA 2ZPTX 1NG1A 5FUXA 3SJCA 5HKKA 2XZOA 3I32A 2ZRHA 2AWNA 2AWOA 4MRRA 3A1SA 4CEJA 1H8ED 4ZV4A 2WKRA 1F3OA 4FMCF 1IUEA 1T5LA 4M22A 4WZBE 4B3DA 4GDFA 2BEKA 4DLSA 3KKNA 4AKIA 1QOGA 3EZFA 2GJSA 2W6JD 4D0NA 1X8KA 1VIAA 1COWA 1YZUA 4B3BA 5JCPA 4DJTA 2V1UA 2ZRDA 3BD9A 3C16C 2ZVQX 4DEYA 1OH6A 1DADA 2HLDA 4WZ6A 1GNQA 1HYQA 3CR8A 5H70A 2GTPA 2W2VA 3AVUA 3H2YA 1GVNB 3SQXA 3QKTA 1KY2A 4R98A 4URYR 2K22A 5J4KA 1G7RA 1JXMA 2IBMA 4LY6A 3UMRA 1G7TA 3GLGE 4B35A 3MD0A 4LZZA 2N0SB 1JW9D 1QG4A 4DT1A 1S3SA 4QGHA 4JJKA 2RGDA 3BH0A 1VG1A 2NGRA 4IOKA 4E5UA 2E3TA 3CPEA 4X8LA 4IVPA 2GXSA 3WY9A 3OEHD 4A6XA 1P60A 5HE8A 2WP9B 4YMUA 2EWVA 1W48A 4B44A 5EJEA 4WWMA 3RANA 2JLRA 1AJEA 1QBKC 4NH0A 1RVDA 2RB4A 3AE4B 4HAVA 3IKJA 3LQRA 1NN5A 1AIPA 4LV5B 1OKKD 4RD3A 1E9AA 3MAAC 1SKYE 3F0TA 1QRAA 4TLCA 1OFTA 5J47A 1X3SA 4EQ6B 5KSZA 2ZREA 1ZM9A 3TSOA 1Z07A 2FN4A 2AD5A 2QAGA 1S1CA 2QT1A 4MDEA 5FR1A 1TUIA 2YWGA 3ZQ6A 3KQUA 4Q03A 1A2BA 3RNLA 2WAXA 5L8VA 4EPRA 1LVGA 2QNRA 5TB5A 1EFTA 4G5RA 3SU8A 2FSHA 2BCGY 4B6EA 1E9DA 2GXAA 3I5YA 1TF7A 2RGEA 2XB4A 1Y3AA 4MGYR 2OO7A 5G53C 2ZYTX 1W0JA 2G1EA 1KDTA 3I3SR 4WBSA 3WHKA 4XWOA 2ORVA 1P4SA 4LWZA 1W4RA 4YTPB 5JHHB 2N46A 1XXHA 1CULC 3LLMA 1CF4A 2R6DA 3ASYA 2R6CA 4I1OA 2JLSA 2H7VA 4P4SB 3KL4A 2WPDA 1TQ2A 1S0UA 1Z29A 1WBBA 3PUZA 2CHGA 3FFBA 5EP1A 1ZU5A 5E95A 1D5CA 1HV8A 4L5BA 2IHYA 2KB0A 1DS6A 3OE7A 3NVVA 1T3QA 1GIAA 4M9QA 1EFRA 3RHFA 5FOVA 4F4JA 4QJ3A 1NSTA 3U7GA 2VHUA 4FCTA 4TT3D 4FWIB 5CIWA 5AK0A 3CX8A 4FCWA 3CR7A 2PH1A 2RGNA 1KSFX 3G82C 4HUQA 4R7ZA 1JECA 2IYQA 4PHGA 2J0VA 4PC7A 1N5XA 1AA9A 1MH1A 3MUFA 3P4SB 1QHGA 4JZKA 1KY3A 1FP6A 3L2OB 4TMTA 3CWZA 1G1MA 2NO9A 4OK6A 4M53A 1M7HA 4A82A 1UJ2A 1L6VA 4CT4B 1KSJA 2D3WA 1EFUA 3BB3A 1E2JA 5MPOA 5DH9A 1IY1A 2GNOA 2GXQA 3NWJA 3KQLA 1E79A 2WMOB 3P20A 3SBEA 5DN6D 1XO3A 2XTMA 4QBGB 2ZI6A 2Q21A 5L3SA 1YKSA 2QG6A 3AE6B 2QP3A 2YC4C 2W3RA 1A5TA 1W7AA 4ZCIA 3TJZA 5C18A 2QU8A 1JNYA 4YDHB 1IJFA 1ZUNB 4NYMQ 4LHYA 2XX3A 3NHAA 2PMDA 3P1MA 2FPMA 2FBWB 2CLDX 2QI9C 3QEJA 3AE3B 2IS2A 5AUPB 2C98A 1IHUA 2V1XA 3NXSA 2HV8A 2CCGA 4ZI2A 5J5CA 4DIDA 1HQYE 4D4JA 1G3RA 5EE5B 4UXIA 3E5HA 5J4YA 1TU4A 2HXYA 2VPPA 4ESVA 3VKWA 4JWSC 3L0SA 5IDVA 1DBSA 1RYHA 1KI9A 1JAIA 3LDAA 1OQRA 1YR7A 4RKEA 3QKRB 4URWR 4B33A 2B76B 4Q1AA 3AECB 4DCUA 3C5CA 3FPAA 4GMDA 4MUAA 3AE8B 3U5ZB 4B76A 1D2EA 4TQAA 1T0HB 4DSTA 4BGDA 1CRPA 1OXTA 4BECA 2ZI5A 1U9IC 4KX6B 3W6PA 3WYFA 4N0DA 4KCGA 4UJ5A 2KWIA 4TYPA 2IYSA 4G5QA 3TVDA 1RPZA 3QE0A 2O8FA 2DPXA 1ZVQA 3OESA 1LF0A 3TSZA 2QRNA 2XOKA 1SIJA 3Q5DA 5FH9A 2LCFA 1XD8A 3PV0A 2GEUA 4JJZA 3ND9A 1US8B 1LTQA 3VKGA 4A4DA 4Q01A 4A8JB 1G291 4JVLA 4OJQA 3U3RA 2BS3B 2PKOA 3EZ2A 1QOAA 3DOEA 1AWDA 1EWYC 4OHZA 2QM8A 1CJUC 4IOJA 1J99A 3AGPA 3TQFA 1KJYA 5JWOA 2ZANA 1N2CE 2SHKA 2QBYB 4WW0A 1VG9B 4YDSA 4BEBA 3AMZA 1VYVA 3H84A 3T35A 1V5WA 2MSDB 3L0IB 1BO6A 1UKYA 2ZE7A 3LX8A 4IXMA 4Q4HA 3VR6A 1NMZA 4ASUD 4CEHB 2B8WA 3CRVA 2OG2A 1NBME 2RGCA 3JZMA 5E7IA 4DLUA 1NJGA 2GZDA 4DUGA 1U90A 4Q7JB 5JBQA 2VYFA 2BVNA 5L3QA 4FXPA 1N63A 1SKQA 2NPFA 2ZSEA 3FDIA 4PXAA 1Z0JA 4EPTA 4UNRA 1JROA 2BS4B 1JR6A 3C4JA 4OK5A 3OEED 3B1VA 1XBTA 1P2SA 1ZD8A 3W5IA 5FL7A 5BN4A 3CRQA 4ZPXA 2DBYA 3QKSB 1K8RA 3NVAA 1Z6GA 1AKYA 4XTCS 3B78A 1DOAA 3QXHA 3OAAD 4RVCA 4XOIA 4EDHA 4NYJR 3PUYA 2BS2B 3Q72A 4US1R 4HB3A 1S96A 3B1XA 1OH7A 2I3BA 1XP8A 2J0UB 2JJ8A 2PLRA 4G5OA 3TR0A 3EIEA 2GCOA 4FIDA 5TDHA 2F1IA 1SVWA 4V0OA 2ZITA 2CJWA 3Q8XB 4RD1A 3GD7A 1LFDB 2YNMA 1ODFA 4BFSA 1WF3A 2HCJB 2QQ0A 1E9EA 2WSSA 1TEXA 4RY2A 5KNBA 1GP2A 1TF5A 1YR8A 2GAAA 2C9OA 3K0AA 3CWIA 4M1SA 4EFMA 4N6EB 1AQYA 1W36B 1OPXA 2BCJQ 3KDSE 4PFSA 1IXRC 2M19A 2WKQA 4P3YA 5AUQA 4IEEA 3ZIAA 2JQRB 2X1VA 3NBYC 1TF2A 3G5UA 3FKQA 2X19A 3W6OA 3T12A 3G0HA 4YSZB 1HY3A 2EFGA 4PTLA 1OF1A 1R0WA 4GMXA 3RSOA 4JLNA 1H8EA 1OXVA 2JJ2D 3U7HB 2IHBA 1G6HA 2FSIA 4B6FA 1CIPA 1CU1A 3GEHA 2V6JA 2YWEA 2QE7D 1I7HA 1W4AA 4TL6A 5G5GA 1E2KA 1G18A 2OFOA 5EE9A 2OCBA 2WJJA 5G3YA 1XTKA 3LVRE 4MYCA 2A5DA 5GVRA 1W36D 2XXAA 2W6JA 2ORIA 2ZRAA 3EA0A 5FI0B 4CEJB 1U94A 1T0JB 4BLRA 5BN5A 3CPHA 3QVUA 3JVUA 4US9A 4IDIA 1RFKA 1Q12A 4RFSA 4AYXA 3TGPA 2HTME 5JJKA 2JIZA 1V97A 3QOFA 4URZR 5FBVB 4F91B 1QZXA 1RE0A 2NTYC 4P6VF 4R2HA 1JXOA 3BWDD 1DO2A 2O5VA 4L9SA 4JS0A 3TW8B 2AKAB 2OXRA 1FOEB 3FVQA 3KFXA 4OBEA 2ZS9A 4B2IA 1E9SA 3QENA 4WQMA 2C03A 5G5HA 3OIUA 4A2QA 4O0MA 1OXXK 3FHCB 3DKVA 1SHZA 1DE0A 2QAJA 4Q1BA 2JGNA 4BFVA 4FWTA 1TQ4A 1G7CA 4KBGA 4F92B 1F60A 1ZUHA 1OJLA 4EJSB 1IN7A 2FE4A 1KYIA 1UM8A 2BC9A 1R6BX 3OEHA 4ZDJA 2W55A 3H4MA 2QTFA 2L0XA 1ZM3A 1FZQA 1LW7A 1AZTA 2R8RA 4DDWA 1DAEA 4DT1B 5JEEA 5A4JA 2JEOA 3E1SA 4WAUA 5TY0A 1COWD 2PZEA 3OZXA 3ZVMA 1M1YE 4LSGA 1E4YA 2A30A 1E3MA 2CE2X 1OFIA 4IW3B 2ZRJA 1OSNA 4NZYA 1XTQA 4USAA 4NMMA 2HLDD 1OKKA 1ZP6A 1JWAD 3FMIA 3NEJA 4PPFA 1VTKA 4B73A 3K0CA 1XPRA 2O52A 1SHKA 3AV8A 1J70A 3ONWA 4PR0A 5C1BA 2VEDA 2QEQA 4Q18A 1E0ZA 2FWRA 3C41J 4IFBA 3T1QA 3K9NA 2WHXA 2A2ZA 1NJFA 4Q1CA 4URUR 4TYYA 3QPWA 1NSFA 3ZS8A 5FTLA 5K8IA 5KYKA 1U0HC 1UBGA 4QBFA 1JQJC 5HZHA 2QN6A 2GZHA 2J59A 1TU3A 3NC0C 3ZJYA 2DWQA 1GITA 3FMPB 1JPJA 2ZSAA 4LRWA 1Z0IA 3ZVRA 2OEPA 4QBHA 4C4PA 2ZJYA 4EQ6A 3GJ0A 2JJ1D 1M7GA 4NP6A 1NKSA 2ZRKA 4A0HA 5FPYA 4HYYA 1MRSA 2H57A 2M56B 3DEFA 3T34A 3NHBA 2G3YA 4D82A 4JBXA 3SFDB 2C9CA 2B7BA 1NMXA 2PX3A 3AVQA 4Q19A 1W4CA 4D4MA 1R4AA 3LH5A 1W46A 1PUIA 2IYUA 2PCLA 5C4MA 2ANCA 5D3MB 1AGPA 1XXHB 2XJ9A 4ON9A 3O8RA 2FPKA 5AUIA 1Q1QA 4Z8XA 1B9RA 3LD9A 2ZRFA 4A0RA 4TT3A 5CM8B 3BE4A 1MT0A 1L4YA 1OFHA 2UVQA 4ZO4A 3V00A 4JIMA 1YR9A 3ZZ0A 1E2FA 3EPHA 2YOGA 4P4SA 2ODWA 3GLHA 2GJ8A 4LJAA 1KO7A 2RHMA 5AJWA 4TMWA 5SZJA 2AFIE 1TTTA 2G1KA 3QBVA 1G8YA 4M21A 4ERNA 1QHIA 3NBZC 4DVGA 3DMDA 3Q85A 1RC8A 5AR1A 3B9JA 1WB9A 1CLUA 4BQSA 1T9HA 4PANA 3W5UB 4QGFA 5K8LA 4F38A 2WPDD 3QIAA 2O8CB 4Q9KA 1Z3IX 1Z08A 2GHIA 3RWMB 4HLCA 5DN6A 4URXR 2QAGC 4KVGA 1WBDA 3EUB2 5K8UA 2QA5A 1FTNA 5TV2A 1OW3B 4XWKA 3WCQA 2GBLA 3RLFA 1EFRD 2AHOA 1R5BA 2ZI4A 3TW4A 2LEKA 3NDBB 3TMKA 2H92A 2WVJA 2IWHA 4LBWA 4HSEA 1II9A 1U0JA 2GEVA 3GMTA 4B43A 5EE1A 4F93B 4G3XA 4NPHA 5FTMA 1VPLA 2QGNA 4OQMA 3T06B 3X1YA 3BK7A 3DKPA 3SFEB 1HQCA 4JT4A 4DZZA 2P5TB 1OIWA 1FMLA 4HI0E 1FFVA 2XEXA 5LB2A 1UF9A 1KI6A 3EZ7A 2RHDA 4BEJA 3RAPR 3VHLB 3TQCA 4DHEA 3W5JA 4P4UA 3THYB 2L83A 2QJLA 5KPJA 2ONKA 1E79D 2WDQB 1E2IA 3QXSA 3GJXC 1OH5A 4O25A 4IDOA 2JDID 4TSFD 4EUNA 1G64A 4LC1A 4NTZA 4U5XA 1N5JA 4KV9A 4B48A 5CJ2A 4G5GA 1MO3A 2V8OA 1IM2A 2Q0HA 2NZJA 3GLFE 4DBLC 3WNCA 1G17A 3TNFA 5JCZA 3VNVA 2PT5A 3ZLJA 5TARA 1I4DD 1W5SA 3AEAB 3W90A 3BJIC 4E03A 2CLSA 2WU5B 3U3MA 3AP2A 5JS8A 4JLPA 4B3GA 2IK8A 4Y0VA 4C3ZA 5AUOB 3SNHA 1PV4A 1YE8A 3PFIA 3I5XA 3AVVA 3VX3A 3ZGXA 1N6RA 5AJZA 4WZAE 4BE7B 1UKZA 4CEIB 5CYPA 4B47A 1US8A 3CIRB 4DEXA 4A8JA 1QG2A 2KE5A 2BWJA 2FGKA 3NVWA 1RJ9B 2QENA 3AE5B 3TE6A 4RD0A 3WRXC 2JLXA 4G01B 1PLLA 2ATVA 2OV2A 4QXAA 2QBYA 4Q4HB 2G0TA 2XOKD 3OEEA 1F2TB 1HT2E 4E22A 1Z6YA 1NVID 1PLKA 4PSAA 4QOSA 3QXXA 2XJ4A 1GILA 4V0ME 3QXCA 4HEJA 1G5RA 3CNNA 2J45A 3BORA 3OAAA 4XWAA 4NCIA 4BRUA 5IHPA 5KSOA 2WV9A 2A9KA 3PENA 4X8HA 2WMNB 2HYIC 2GDJA 3AVPA 4JLBA 1BMFA 2RAPA 3GFPA 2AD1A 1ZC4A 3A4LA 5E3HA 1BOFA 3ECCA 1RW4A 2DWOA 1ELOA 3HDTA 2YZ2A 1J7KA 3OFND 5LDDC 3AVWA 4HROA 3QKSA 2F3TA 4TLEA 3T1OA 3TR5A 3U7FB 2WWYA 1KF6B 3PEUA 5FL3A 4F4IA 4OI0A 2ANBA 4G0NA 1XB2A 3T61A 2J0UA 3R20A 1YZQA 1SB3C 3DVLA 4MGIR 4RSGA 4PPQA 1OV4A 5FFMA 4TTPA 3O8CA 2HEIA 4W5JA 3K0AB 1CKEA 2ODBA 2JJ2A 4MRPA 3CIOA 3J81k 3HPRA 5E7JA 4A36A 3L82B 3K1JA 2WOOA 4OHYA 4C80A 1EK0A 1Q0UA 4BFYA 2GAOA 1GG2A 2REXB 1W47A 2XAUA 2IXGA 3RYTC 3DO6A 4B34A 4OK3A 4KFSA 2WDVB 1OXUA 2RH5A 4HAWA 1IXZA 2DHRA 2C95A 3I1FA 2KBEA 1PJRA 4US2R 3KFVA 1XJCA 4NHOA 5HE9A 4M1MA 3VX4A 2GF0A 1YZNA 3GJ6A 5EP3A 3P4PB 4CW7A 1XMSA 3QF4A 5KU1A 1A1VA 4AKHA 3AKDA 3O47A 1D6JA 2B7CA 1G4AE 1T8UA 5L3VA 2OM2A 4TMZA 3RS4A 1WRIA 2IYLD 4RFSB 3DDCA 1UFQA 1EFHA 2Q9CA 1Q1BA 2PBRA 1KMQA 4TQ9A 2JLUA 4TTRA 4KI0A 1FMJA 2FX3A 3NVZA 1NLFA 1VDVA 4JBWA 1GZSA 1XD2B 1S3GA 1NY6A 3LBHA 2VP4A 3EW9A 1WXQA 1NIJA 4NYIR 3CZQA 3NVYA 1ZAKA 3LBIA 1I2MA 1GRNA 3SI7A 4MKFA 3RRYA 1EFCA 2YWFA 5EE0A 2WM9B 3B6EA 1D8TA 4EFLA 2ZUCA 2MH7A 1UADA 2JIZD 1VHTA 1CTQA 1G4UR 4M1TA 1GDDA 4EJSA 4RD4A 1KAOA 3FAHA 3OIWA 2OAQ1 1FUKA 2QSZA 3OIYA 3B82A 1N3BA 4BFWA 2H1LA 4OHWA 1ZC3A 1XLOA 1Q1ZA 1GKUB 1YJ5A 4NBSA 2BMEA 3FOZA 4PSVA 2P0EA 1X1RA 2PEZA 5LBIA 4GP6A 2O0JA 5CK5A 3EASA 5AWFC 4IOLA 4MYTA 4ZHPA 4OI1A 1NVXQ 3BERA 2KSQA 1G20E 1DAIA 4QM7A 3D31A 1ZUD2 721PA 1XEWX 2EQBA 1E4VA 2VF7A 1SVLA 3AGQA 1Y63A 3Q9LA 4QJ4A 3CPJB 1GPXA 3W8NA 3WP0A 1DAHA 2JJ1A 2RCNA 4ARZB 1TMKA 3CRMA 2CDNA 3AF0A 1OH8A 1IY0A 4QJ5A 2RMKA 1AK2A 4LV8B 5AJXA 3RS2A 3K9HA 4IRUB 4TWZA 4AY2A 2PX0A 4DDTA 4NONA 4JSTA 2DR3A 2CCKA 5B58C 2LKCA 3NH6A 3QXJA 1A7JA 5SZHB 3AEEB 5EQTA 2MJ3A 1KHTA 4Q1FA 3CO5A 4XVRA 2J3EA 4BLPA 2ZE6A 2ZU0C 4Q4AB 1VYTA 3SE0A 5M04A 4NL4H 1C9KA 2IYVA 5FR2A 3SR6A 1FO4A 2QRZA 3EARA 4WVFA 5G3ZA 4KAXA 1Q21A 1KSGA 2H88B 2KI5A 1EXMA 3DHWC 1SXJE 3P4QB 3MMPA 1EGAA 1KKLA 2V7QA 3MJRA 4OQNA 3BGWA 1XCPA 4M9SA 5JSZA 1OQQA 1IONA 4XSHA 4A2WA 5SZKB 1X1SA 4GBMA 2KAJA 2NG1A 1E1RD 4ZDKA 5JS7A 2X2EA 1A82A 1XJQA 4I4LA 4IVQA 4BASA 3P1JA 5D3MA 4POAA 5FTNA 3SHFA 5B64A 4DB4A 2EFEB 2FOLA 3LLUA 2H17A 3GLHB 3K0CC 3NIBA 3AUYA 1KO4A 2V9PA 3WP1B 4DLYA 1NRJB 1EX6A 1Z28A 4UJ3A 5KHOC 3EPKA 4IHQA 4H9GA 2GA8A 1IY2A 5DI3B 5C3JB 1CEEA 4HLUC 4RZUA 1QT9A 4JT2A 2AR7A 3ZZUA 4LPSA 2CJOA 1XMJA 1T8TA 2VH5R 4IDNA 3ZYYX 2RGGA 3KUCA 1J2JA 4BLOA 2QROA 1G16A 1GRRA 2Q3MA 1LB1B 1LS1A 4TN1A 1DARA 5CYOA 5EXXA 2O8CA 4IDPA 5AJVB 3ADBA 3K0SA 1FFUA 5CITA 5CIQA 4QHYA 3RS3A 3AM9A 2EW1A 3W6NA 4GOKA 2WWHA 4DSOA 1LF5A 4TLBA 3SJZA 3LO5A 2BM0A 1G7SA 3EC1A 2WIBA 3TLXA 2BMFA 1CJMA 2VP9A 2ZETA 5D3QA 4A0FA 4O3MA 1PUTA 1IXSB 4AKEA 2VBCA 1XLPA 2ZRIA 3WBKA 1L0VB 4FMCB 3TAUA 5BWMA 2JDIA 4FD2A 1HEIA 3AQ4A 2CNWA 4PSKA 4TSFA 4EAQA 1JEEA 4TMXA 3R9XA 5DYGA 4NCNA 3THXB 4LYHA 4M9XA 4Q66C 3TUIC 1KI6B 4EFNA 2AK2A 1AS0A 4QRHA 3P32A 3PUVA 1GNPA 1IJEA 1DAKA 3NC1C 4M1OA 1J7AA 1VCIA 1XRJA 3CNOA 4JYCA 1CR4A 5KDLA 2YVUA 3HJNA 4I1SA 1XPUA 3THYA 3KJEA 3W9CB 3UANA 2WWXA 4K46A 5C4GB 5IF9A 4LJ8A 3PG5A 5H1YA 2DYKA 4TZ0A 2ZRMA 1DAMA 3AN1A 2QIEB 3NRZA 2V55B 3A1VA 1DOYA 1KZGB 4O2LA 3TAHA 3T5GA 3L8YA 1QHSA 1VDZA 3TBKA 1FUUA 4B3FX 3BS4A 4TYNA 1OT3A 3KKOA 1JR3E 1N5LA 3M4YA 5EXSA 4GRAA 2BMJA 4XIGS 3WMFA 2G88A 4Y0AA 3K53A 4KU4A 3WMGA 4Q02A 2MJDA 2R62A 1QDEA 1SGWA 3QG5A 3X1WA 4LDJA 1FRRA 2JLWA 3VU9B 1I4LD 2CHVA 2Q3FA 2OLKA 1E0JA 1N0VC 3FHOA 2REOA 2ZS8A 3GLGB 3EXAA 4LUCA 4M2LA 2ZR0A 3SQWA 2P6RA 2G6BA 1YRBA 5EP4A 1KFYB 1N62A 5AUNB 3UIEA 2VRWA 5CDFA 2WTUA 3PXGA 3O8BA 4CEIA 3SDZA 1KO1A 1Q44A 4PO9A 1Z06A 1E0KA 2D2FA 2BT6A 1W2GA 3W9YA 3GFTA 1RJ9A 1DAFA 4YTNB 2ZAOA 4OI4A 2Q5WD 3EG5A 1AGRA 3K09A 4Q1DA 5FPHA 4BFXA 4URVR 5KDOA 3GLIE 1TKEA 1M7BA 1OYWA 4F4CA 3N5CA 2IUUA 1F2TA 3D7MA 2YINC 3OFNA 4MYUA 1LNZA 3B1YA 4CT5A 4AG5A 1II8B 3RWOA 4PAQA 3B1WA 5JI2E 1SKYB 1FX0A 3IILA 3TSWA 1P2UA 4ZHOA 1XCMA 4WOPA 5FI1B 2J46A 3EWAA 6Q21A 4M1WA 3A1UA 3Q7PA 5CM9C 1R5OA 1XLQA 4ACAA 2BBOA 2G83A 1KMHB 1BIFA 2XZPA 4DLXA 2QY9A 1G19A 1XNJA 4JKYA 1DPFA 3SN6A 1F48A 2IA5A 1ZCAA 2ZRLA 4UXHA 4C2TA 1NVVQ 3HVZA 4ZOHC 4TL9A 4FCVA 4P4TA 1W4BA 5BN3A 1T3SA 1CR0A 2ZI3A 2GVZC 1D2MA 1VCOA 4X8MA 1P3JA 2HDNB 4RCZA 1H8HA 1TQ6A 4KHZA 1BMFD 1VMAA 2CLCX 4AWXA 3EPLA 2PVOD 4I1VA 4PHTA 5FBRB 1P9NA 1WE2A 2D4HA 2ECKA 3FWYA 3IPYA 4GP7A 4GI7A 2A7QA 3RC8A 4HRSA 1M2OB 4CYMA 4MGZR 4MRVA 4RKFA 5JHGB 4GNKA 2ATXA 2HUPA 221PA 4ACBA 5KSYA 3AVYA 4C7OA 1Q20A 4C7YA 1SVMA 3L8ZA 2OBLA 3AKEA 4MQBA 4YMVA 4B75A 1UDWA 3KUDA 1TYGB 3EPJA 1E2PA 4A9AA 3P63A 1SXJC 2XNSA 3RSLA 2HCBA 2RGXA 2MMGA 1ESNA 1WMSA 2VL7A 3AKCA 2HF8A 3CWQA 3A6PC 1NL3A 1IAQA 2VIIA 3B85A 5J4HA 5F3WB 2FU5C 3A4MA 4ITRC 3QF4B 4PZLA 4U00A 3BH7A 1MO6A 2VHCA 4KYIB 2PJZA 5HPYB 3D3QA 1J7CA 3AE2B 3KTAB 3B5JA 2DFNA 4IKEA 2DCUA 3F8TA 3NTUA 4HB2A 5IK2D 4DB2A 3WRYC 3FB4A 1X8JA 3FKSD 1XEXB 3KWLA 3JZAA 1XTRA 4DDVA 3BFKA 2PIAA 1UKVY 2ZTSA 3IIJA 4LOAA 1JBKA 2H8KA 3QNUA 3H0KA 3Q5EA 3UXMA 4II7A 3FC4A 4ZCMA 2W2TA 3B9QA 4HLQB 1XD2A 2B8TA 3I8XA 4C0HA 5FOSA 3B2EA 4DSUA 2OCPA 1E32A 4HDQB 4NYMR 4O2RA 3MWKA 3CW2A 5HCIA 1TPZA 1DGJA 3I92A 3UWOA 2MSEB 1Z5ZA 2NO0A 3X2SA 4P32A 1E0AA 3RS5A 1C1YA 2PMKA 4PC1A 2IYZA 4JLVA 4AC9A 3K0FB 4CF7A 4B3XA 3DL0A 4CGZA 1XCGB 2PL3A 2EKIA 5BXQC 1W36C 1UKEA 2PJRA 2ZUBA 4C0QC 4K81B 1K5DA 3AB5A 4OI2A 3SOPA 1KO5A 2V4ZA 4Q00A 4MRSA 1U8AA 2Z5FA 4LJ4A 4MH0R 4W5HA 1B23P 1N6PA 3N2IA 4QNMA 4L4UA 1E7PB 2F3RA 4EKDA 1FXIA 1KJZA 3PEWA 3PVSA 2OFWA 3IHLA 3LA6A 4U7DA 3DWMA 1E99A 1II0A 2BJWA 2R2AA 3MG9A 4Q9IA 1PFDA 2GF9A 4LHVA 3DZDA 1KDPA 3BB1A 4DKXA 1KDOA 2OXCA 4DLWA 4JSYA 4D26A 3LNCA 2KJQA 1O3YA 4NCKA 2F1RA 4TYWA 1E96A 4KODA 3KKPA 5LB4A 2Z4RA 1P9RA 2G1JA 4KFTA 2E1RA 4ARZA 3REGA 2QORA 1Z2AA 3DWGC 3L4PA 4W7SA 5IRCD 2D06A 2IW3A 5JI3E 3PEVA 1HT1E 3IBYA 4HLDA 2O8DB 3BBPA 5EXPA 1KTVA 1L4UA 2VP0A 2Z83A 3Q7QA 621PA 4TL7A 1K5GA 1JWBD 1G8PA 1E1RA 1DG3A 3VR4A 3GLIB 2VLIA 4D4LA 1KRHA 2DB3A 2P5SA 4JVMA 2N1BA 3LVQE 3U60B 1Z8FA 3BC1A 4Q4AA 1XTSA 2F43A 2C9YA 1ZW6A 2FNAA 1QOFA 4OL0A 3MRSA 4IOMA 5JSZB 2I1QA 2F55A 2HYDA 2ZJ5A 1WWTA 1GM5A 4B32A 1JB1A 2AKYA 2OUKA 4W5WA 4S35A 3MCAA 1KJWA 5FBWB 3AP3A 3HUIA 4XSGA 3SBDA 4YSYB 1HA3A 4ZIRB 2X8AA 3K70B 2QGZA 2GKSA 1ZBDA 4P0TA 4PAOA 3ZYCA 4BLQA 2BOVA 2J1LA 2R9VA 3GPLA 1Z6AA 4KSBA 3AEBB 1TUEA 3UATA 3IIKA 2WWGA 1NBMD 3KJHA 1MKYA 1F5NA 3IUYA 1N6IA 4JLDA 2V7QD 2ZRCA 2NOAA 3HWSA 2DFLA 2EYUA 1IN6A 4A1FA 1L8QA 1XFAA 2QPAA 4H1VA 4M0LA 4HDCA 5JRJA 2BKEA 4C30A 3V4RA 5DI3A 4CRWB 1DVRA 1ESMA 1S4QA 3BFXA 1E6EB 3R7WB 3K70D 5LPNA 1K6MA 4ESHA 1D2NA 1G5TA 4Z8YA 5CB6A 1QF9A 2AN9A 3AE7B 2OCAA 2CL6X 4D81A 3EC2A 4ZCLA 1MR3F 1R2QA 4LJYA 5P21A 2ZM5A 2Z0MA 1R0XA 3DZ8A 3C7KA 3CZPA 2OILA 4DXAA 1YJJA 2DFKB 2W58A 3KKQA 4OQXA 2JLQA 1TX4B 4B2LA 5DIFA 2J5XA 4AI6A 3AEGB 4C9BA 1FP7A 1QVAA 1R0ZA 1GAJA 2ZE5A 3SYNA 5EUMA 4Q5IA 2BHRA 3AH7A 1CBUA 2PZFA 4DCNA 1P2TA 3NDPA 4KITB 3HP1A 4D80A 2W3SA 4NCHA 4G1UC 3KB1A 4MGKR 2CBZA 1QOBA 4Q9JA 4H1UA 1GKIA 2G77B 1U8ZA 3THXA 4DCTA 2OT3B 3VR9B 3I73A 4YTMB 2KMMA 1MO4A 3CKLA 3AEDB 1TL7C 2JCSA 2Y8EA 3BRWD 4V0LA 4YMSA 1E2DA 1HH4A 2J0SA 2CNWD 1KAGA 2O8EB 3UKDA 2E9SA 2GETA 4XH9B 1ZNXA 3ASZA 3GCGA 1AM4D 2RGNC 1D9ZA 1WGKA 3SZRA 2ZJ8A 4G5SA 1RM6C 2NO1A 1JQLB 3FE2A 3IO3A 1M6NA 3ZD7A 3LXFA 3SJBA 2QMOA 4IJMA 1J7BA 1XEWY 1ZMXA 1CXZA 2O8BB 2W00A 4JL5A 2WBLC 3EX7C 1KGDA 4V0KA 5FBLB 4RFVA 1F0ZA 4PQRA 4RD2A 3VTKA 5K8TA 1OE0A 4Z54A 3VU9A 3HR7A 4LPKA 2K5PA 2FFBA 3CX7A 1S1MA 2MMCA 3OHMA 1QHYA 4LJ5A 3GLGA 2IUTA 4GZMA 4ITKA 4TYQA 3A58B 3LW8A 1L2TA 4LI0A 1U81A 1AN0A 1N5IA 3WMEA 2ZE8A 4XD7D 3ZDQA 1Z47A 1SVKA 3FFAA 4LTUA 1CJVC 5EUQB 4XJXA 4KXFB 4EPWA 3GLFA 2A78A 1Z83A 3KJIA 2BDTA 2H16A 2D62A 3HPQA 1ANKA 4QNRA 2PLFA 3FMOB 3MLEA 1FX0B 4DDUA 2ODNA 1II8A 1Z0AA 5FOWA 2IYWA 5EZ5A 2WWFA 3WNDA 4BZPA 1KI7A 1JAHA 1WYGA 1FL9A 1Q22A 1T3HA 3TK1A 1ZM7A 2YHSA 2QUZA 4KFUA 3ZD6A 1F2UA 3NEYA 2WAYA 3BAFA 4UQOA 5E4FA 3GJ4A 1XZQA 521PA 1J90A 5CLLA 2Y5CA 1XU4A 4KVAA 4V0NA 4Z1MA 1KMHA 4IVRA 4CZ2A 1OXSC 4L9WA 1KOFA 1CS4C 3T1TA 4DCSA 4JLAA 1JI0A 2FZ4A 2YOHA 2ZR9A 3W3AA 2C5LA 3U4QB 2C04A 2A3RA 2OAP1 4E07A 3HU1A 3U2QA 1CP2A 1OFFA 3NH9A 1A2KC 5KDDA 1YQ4B 1Z0FA 4GOJA 4BZQA 1TEVA 1ZCBA 1ZD1A 1N6HA 2FF7A 3HU3A 1RRFA 5BYJA 2R44A 5CLQA 5HZKA 1YHNA 3T15A 4C7OB 3AUXA 4KO8A 4Q21A 4LV6A 4XVUA 3GFOA 2IWRA 3SR0A 4KBFA 2P67A 4FI3C 1H8HD 3ZH9B 5LD2C 2GCNA 2QTHA 2XZLA 2X2FA 4YLGA 1NIPA 2YOFA 4PHHA 1W5TA 5ANRB 3VKHA 3P4RB 5IK2A 4UKDA 3U44B 1IN5A 3A8TA 3QVVA 2QT0A 1MABB 4LHXA 3FKSA 4A6PA 5SZIA 3UG6A 1NLZA 1CJEA 2J7PD 2VHJA 2GVDC 5JZVA 2FEMA 4YONB 3S1AB 3BIID 4C7ZA 2BMDA 2W6ID 2GZAA 5FUWA 4DC9A 1ZNYA 5CK4A 3RRMA 2VP6A 1GFIA 2CCJA 2V54A 2ZJZA 3T1VA 2AK3A 4L8GA 3U61B 2XNDA 3KZ1E 5B2ZA 2QP9X 3KTAA 3LBNA 4GFDA 4CVNA 2XTZA 4WXRA 1VLBA 2FA9A 4WXPA 4YSXB 3CF2A 3CBQA 1W0KD 3CRW1 1XEXA 1YJIA 1E9FA 1G5PA 1ZUIA 2C96A 2ZUDA 2HT1A 3EA5A 3KXKA 4PO8A 1P5ZB 1S2MA 2WJIA 1XX6A 3QPUA 5GJWC 4Q7KA 3V4FA 5JWRA 1JPNA 2UKDA 3ADCA 1E1QA 3RABA 3NKVA 1GL6A 5JLJA 1SVIA 4QC2A 2ZXUA 1P9WA 4JVSB 1NMYA 5J4VA 1PUJA 1DOIA 2F9LA 2AX4A 2VP5A 3GJ8A 1UDXA 1CJTC 3CH4B 3HU2A 3L0OA 3U6BA 4A15A 5DSZA 1P75A 4M4SA 5DHFA 2BKUA 3ETLA 3KJGA 2QMEA 2IXEA 2EWWA 2I4IA 2OBMA 3LY5A 4Q7MB 1C4OA 3K0FA 3THWB 2IYYA 1O87A 4MA4A 5FOXA 4C0LA 2GWHA 3CUEF 1P72A 3KKMA 2ASEA 1KSHA 1KI2A 3GLFB 5AUKA 3K8YA 4IEIA 1NEKB 4C0BA 1VKJA 4UXJA 3RS0A 3R8CA 1WP9A 1AS3A 5FBQB 3W8RA 2R65A 1BH2A 2UZ3A 1JR3A 4AURA 2WZQA 2EFHB 3L0PA 4IDHA 3NS1A 1EX7A 1NYQA 1G3IA 4Q7LA 3A37A 2OE2A 2ZRNA 4I1UA 3ZVLA 1S8FA 2J7KA 1FNNA 1U98A 3I61A 3HYTA 4PHFA 1UEJA 1G3MA 1X6VA 2AL7A 2J0QA 2BJVA 1HURA 1GSIA 4EPYA 2GK7A 3K0EA 3MJHA 1GNRA 1ZYUA 2VO1A 3MFYA 5H8WA 4JBYA 4LBVA 4XVQA 4D2IA 3JVVA 4PQYA 5HR5A 4P33A 4PAMA 4I99A 4D25A 2O8DA 2HT6A 2QM7A 2QSYA 4C0SA 3GEIA 4QBIA 1N25A 5FPTA 3ADDA 3GLIA 4WIAA 2HXSA 1HE8B 2F43B 5KNDA 4BFZA 1RRCA 2GESA 2IUSA 2LKDA 2Q9AA 1ZM2A 2VSFA 1NBMA 3M6AA 1R0YA 5KPDA 3KQKA 1N60A 4S2EA 3SFVA 1VG0B 1KK2A 1GL9B 4TMKA 3UMFA 2P65A 1WRBA 3HRDD 3KQNA 1VIYA 1RWSA 4HATA 3RRZA 5FOUA 1PZNA 2FFQA 3SYLA 2IS1A 5JEDA 1XLNA 2K5UA 5DLQC 5F9HA 3DOFA 1KK1A 3DMNA 4ZDIA 5H8YE 4ZIRA 1M34E 3GJ7A 4MUBA 3ZVNA 2ZVPX 1SVOA 2BIFA 3MWLA 2BBSA 4P31A 5GXGB 3EZ9A 4PZYA 1JJ7A 1T4GA 1E9BA 3TUJC 4I81A 3AV0B 4JLMA 4BLTA 4NYJQ 5G40A 3PUXA 2F1JA 4Q1EA 3ZS9A 4TZ6A 2B92A 3FGNA 3C15C 2ZRGA 4K8OA 3RDPA 5KUTA 2MJEA 2QQEA 4JL8A 2CVFA 3QBTA 1FNMA 2XSZA 1RRGA 3R7WA 2IXFA 4DLZA 1H65A 4AK9A 1ZOYB 1Z6XA 2BV3A 2PZGA 3O8DA 4OYHA 2W0SA 2XGJA 3IEUA 1E2QA 4LJ7A 1QHHA 1ZNWA 1Z22A 3VHXA 2JLYA 1N0UA 5JJLA 2R6GA 1XWIA 5FTKA 2FFHA 1V43A 1NY5A 1QHNA 2JA1A 3B7GA 1VYUA 1QLBB 1R10A 3IPXA 5F2EA 1FM0D 4BUJA 4C0AC 3TIFA 2VA8A 1SQ5A 1PDXA 1N0WA 2VHQA 1DOXA 1T6NA 5GVSA 4FW9A 421PA 2F6RA 1OB2A 5KSPA 1Q3TA 4CIDA 1E2EA 1VECA 1DEKA 4J0QA 1W1WA 1AYFA 2VSXA 3C14C 4LYJA 4KLNA 3RRNA 8OHMA 5FPKA 4M1KA 1R7RA 2ZRPA 1W2HA 2FEOA 4KSCA 3R9IA 1OIXA 1FMAD 3U3JA 1XMVA 4TL8A 3T5DA 2B6HA 5H68A 1JALA 3LFUA 1Z2CA 3KB2A 1FQJA 3KXIA 1RZ3A 4XTRA 3VR1A 2YC2C 2ZYWX 1YZGA 1QHXA 2ZYVX 2O8EA 1G3UA 3VR3A 2X77A 4QGGA 3LB8C 3QJYA 2BEJA 4DRZA 4ABYA 1NVWQ 1Z0DA 2WSMA 4KFRA 1RKBA 2NPIA 4Q4JA 3EWSA 2NIPA 2A5YB 4JLJA 2C2HA 2GBLC 2WJGA 3DPUA 4GT1A 4JLOA 4GSYA 4LK2A 4LBZA 2WU2B 2O0HA 2Q3HA 5JECA 5JJIA 2O8BA 1G8GA 2HJGA 4ZKEA 5IT5A 4XD7A 3V9PA 3IHWA 3SFZA 4RJLA 3EIHA 3P26A 1P6XA 1EG7A 4HAZA 3CRRA 2GJ9A 4GZLA 4B71A 1L7VC 1G41A 3N2EA 2A5FA 2OLJA 4TTQA 4M1YA 4MKGA 2H5EA 2YV5A 2F9MA 2P2LA 3WYGA 3BH6A 2P3SA 2Q9BA 1G8HA 4X8OA 3D6TB 3B60A 1NKTA 4LX0A 1CRQA 1Z6TA 2IYXA 5AJYA 3PIRA 5GJVC 2XITA 1N6OA 1OHHD 2CJNA 1A4RA 3AF4A 3TVTA 1TJEA 2ZSDA 1E2LA 4KYUA 2KBFA 1NYRA 1OYYA 3NBFA 3L43A 1Z0KA 4QG7A 3PR1A 3EAQA 3P4YA 2YWHA 1I4TD 5FUVA 3SC3A 2WS3B 3LWNA 2D7DA 2Z6VA 2K9XA 3HYRA 1XDBA 1CR2A 1HE1C 2GK6A 4QHSA 2PEYA 5CJPA 2ZAMA 4N1AA 1ZINA 3R9WA 1RYFA 5C2JB 1F2UB 1G8FA 1WQ1R 1KIMA 2IF0A 4HZUB 4WA7A 2FPLA 3KQHA 2G0NA 1UWMA 3AF1A 5A0FA 4GOXA 4R9UC 3AVXA 2J41A 1VJKA 1G9XA 4FMDF 1AS2A 4OQLA 4JX1C 4FMBB 1ZIOA 1G6OA 1SXJB 3P4XA 4FN5A 3MGCA 2IL1A 3UMSA 5BQ5A 1KNQA 3E70C 2OSBA 4QFMA 1YZLA 3U4QA 2CK3D 2JX5A 2ZI9A 4MKHA 1DG1G 3VNUA 2IC5A 3LW7A 2D2EA 2V3CC 2FH5B 4BZXA 2JLVA 3VR8B 4RZXA 4A8JC 4ZI3A 3ICQB 3NG1A 2J87A 1WDTA 4Z1MD 1P2VA 1UBEA 5GJCA 1XXHE 3ZQJA 2WLBA 2J7PA 4D4KA 2CHQA 4PPNA 3X1XA 1ZJ6A 4MRNA 4BRWA 2D7CA 1SXJD 5KNCA 1ZM4A 2FGJA 4TLAA 1NN1A 2W6IA 2DY1A 1XMIA 2WDRB 5DISB 1CJKC 3A4NA 1BS1A 4DCVA 2IYRA 2IT1A 4DLRA 1L5PA 1AQUA 1KO8A 2CL7X 2TMKA 2ZJAA 3MWJA 1OFUX 2VQSA 3QF7A 1WA5A 3SJAA 1KDRA 2ZR7A 3AE1B 2ACZB 1R7SA 1OLOA 2YJTD 4D0GA 3U44A 3IEVA 2WWIA 3IBGA 1MABA 1W0KA 1FW6A 2ZJ2A 1E0SA 5HCNA 3TUZC 1PLJA 2GEDA 4JYBA 2ONJA 3BXZA 3B1ZA 1N6KA 4PQFA 1GL7A 1IQPA 3S1AA 5GJBA 1SVSA 2PT7A 4JLKA 4Q47A 1HTWA 4Q9LA 5EZ6B 2LWIA 1MOZA 5C2TB 4BFUA 2ZU6A 3WYAA 3IGFA 4LGMA 3VMFA 4UNNA 4DLVA 2IX3A 1P7CA 2OESA 3DM9B 4LYFA 4NCJA 2NMVA 4QM6A 4YXWD 1F6BA 1E2NA 2IF2A 2VF8A 4OHVA 5HTKA 3AKYA 1Q1EA 1ROEA 3B2GA 2CE7A 4FXCA 1KZ7B 4PPGA 4YMWA 2XNDD 1XZPA 1W44A 3I4LA 2OFXA 1SZPA 3CM0A 1Q3HA 4RD6A 3K9LA 1RIFA 1KNXA 121PA 3IQWA 3VFDA 2NO7A 4QKQA 1GOTA 3HR8A 5TMPA 4LHWA 1KI3A 1AKEA 5B30A 2R6AA 3K9GA 1E1QD 1WCV1 4KJZA 1N5WA 3LX5A 5J4LA 4HB0A 2C78A 3THWA 1E9RA 2W0MA 4US0R 1NP6A 1NG9A 3A36A 2N42A 3ADKA 5L3RA 4A0GA 4V03A 3IIMA 1YQTA 1UEIA 5DI9A 4HUTA 1X8LA 3CH5A 3F3YA 3RVBA 4AYTA 1JQ4A 3FYHA 2WJYA 2ZI7A 4PX9A 1GTVA 2CXXA 4YMTA 2FG5A 2B21A 2FJUA 3BB4A 5HKKD 1KKMA 4BPBA 5F98A 4ILEA 2W2XA 1D9XA 2FSGA 2AX5A 2EFCB 4IDQA 3QKUA 4DWJA 1GAQB 4C0JA 4PC3A 3PJRA 1E6CA 2ZSFA 2GXUA 4NKRA 2ZRBA 2ERXA 1S9DA 3PCRB 2ZS7A 1ZU4A 2C99A 4JMPA 1AZSC 1N61A 3RPFC 3CF6R 4Q48A 1UBFA 2VP2A 3DM5A 3KXLA 1JR3D 2NO6A 5F9FA 5EP2A 5CDFE 2P6NA 2GRJA 1E69A 1U8YA 3TRFA 5TXGA 3SS8A 1R8SA 3U3KA 1FQKA 4PZZA 4R2IA 2FFAA 1E10A 2WJVA 3QUSA 4LYAA 3C8UA 4FMDB 3I62A 2GCPA 4AYWA 1T3LA 1MV5A 1VG8A 2JATA 3N70A 5FOTA 2D74A 2QMHA 4EJSC 4V0MA 2IEZA 3ETRA 1XD9A 3AH8A 3H1TA 4HLUA 4PC2A 4YC7A 4JL6A 1P61B 1JJVA 5GADl 3FMFA 4JWUC 3Q3JB 2IYTA 4UNQA 1BKDR 5KOYA 1JEDA 2QAGB 4B2PA 3FHTA 2VHTA 4HAUA 1FPMA 4ZDWA 2QZ4A 4QL3A 3QEOA 3RC3A 4N3NA 1J8MF 1U99A 5FPSA 4PO1A 5EE3A 1OIVA 3AF2A 1NVVR 3OIVA 2ZSBA 2H89B 2V6IA 5CB8A 1T91A 3WHLA 2CVHA 1P62B 1FXAA 1EWQA 2QPTA 3ABVB 1RYJA 1LV7A 3BIFA 2R6FA 2ZJBA 1N6NA 3ICEA 2WQYB 1VHLA 1LS6A 1KK0A 1ZD9A 2ERYA 1NN3A 1E2HA 3LV8A 2IS4A 1DTSA 3TH5A 2EVWX 2VTKA 2WKPA 3GJ5A 2F7SA 1M74A 821PA 4L16A 1M8PA 4Q9HA 4EIWA 3THOA 1QHHB 4IXNA 4YT0B 1QF6A 4DLTA 3PEYA 2GILA 2AFHE 2REBA 1T5IA 3PO0A 2OCYC 4TQUS 2AXPA 4D6PA 3GEEA 1YRAA 3B8HA 2QL6A 1W0JD 2RGBA 2EU8A 1XEFA 4R71A 4QGAA 2I1VB 2JLZA 2FZLA 1YR6A 3B2FA 3VRBB 2XSZD 2CL0X 5TVKA 4HUQB
chains in the Genus database with same CATH superfamily
3UG7A 2Q8QA 1SKBA 4PX5A 3ANLA 1R8JA 1O9GA 4J1TC 4E0BA 1F7UA 1D0SA 4O4HA 1VHWA 5CX4A 1XDDA 2G9NA 3V3KA 1SCUB 3V4LA 1AUXA 2VSOA 4NYIQ 1NLYA 3CLVA 2GBMA 1FRZA 1Y9EA 3IAM1 3AEYA 4B46A 3PUWA 4PC6A 3UXYA 1ZP0B 2JRLA 4HP8A 3WLRA 5I7EA 2XY4A 1Y0BA 3HN2A 3R3UA 4E7OA 1FMFA 4NJCA 3DKKA 3MBIA 4ALIA 5GOTA 2NYAA 1U80A 3NBQA 3RNGC 5ESDA 3IO5A 1OV6A 4YXFA 1ZZEA 1HUQA 4JVNA 5BSKA 1AK1A 2AXNA 4UDNA 3ML1A 1QH8A 4JA2A 1Y5IA 4HZUA 3HMQA 1KZ6A 2BEWA 4S0XA 3U3OA 2VJYA 2FTKE 3F5FA 1ODIA 3TFOA 4ZI5A 1FFHA 2A1UB 3O6VA 2C77A 3A3KA 3A4VA 4GL2A 2C7HA 2ILTA 1JG1A 1K8RB 1ZXIA 4UNSA 1E5QA 4Z3OA 3UVEA 3K09C 5KTYA 1T2EA 3H86A 1DEXA 4MP8A 2FSFA 2XOXA 3KL2A 3LXXA 1U9YA 3PFKA 1NC3A 1OAAA 2ZBGA 4KTVE 2W6MA 1O8CA 4OBBA 2EBHX 3E2PA 2VRRB 1NAIA 1J8YF 2QUAA 2VSYA 4KW7A 2H51A 1T0YA 1DELA 2F4NA 4GW3A 3IQEA 4ZHSA 1P1AA 2A5JA 1XU7A 3OHSX 3RF6A 4ZAXA 1HDEA 3IVXA 2OLEA 4PLZA 2WKRA 4M22A 1NDUA 1QOGA 4F56A 2QILA 1FLVA 2IFTA 2NVOA 3BMQA 5JH7F 3UB2A 1X8KA 2KKCA 1COWA 1TZOA 1VGQA 1TVMA 3H75A 4JDPA 3ZK8A 5IJ0B 1LDMA 2H1SA 1WHSB 3ROPA 2GTPA 2W2VA 2NNWB 1V0JA 1XR3A 3ONNA 4X66B 2C92A 2YH2A 4RA9B 4X61A 2JI4A 4DM4A 3FSGD 1J2EA 4UD2A 5BO5A 4UEKA 3UT0A 3UHFA 1C4WA 2YVLA 1H3FA 1R0RE 2F3SA 3FVWA 1PYGA 3AE4B 5JMWA 1JRLA 3A6ZA 1CVRA 1GCGA 3VV2A 1SKYE 3Q3JA 3KEOA 1L1FA 5FQOA 1ZJYA 3DVSX 3TSOA 3DQVA 3I5AA 1TUIA 4PYIA 3EA6A 2AWTA 1CF2O 5HBGA 3R7RA 2VSQA 2QS9A 3D4PA 1CY1A 4KO3S 1H9BA 2JRIB 4M7WA 3KEGA 5LU9A 2R6CA 3QVKA 2JLSA 4RIGA 3PUZA 4ZA2A 3VKUA 1DXOA 2PGDA 3ZTTA 3VPBA 4LK3A 1E7UA 2KB0A 3WLNA 1K8ZB 4ZVTA 4M9QA 4G89A 4QJ3A 3OJCA 2J30A 3MHTA 1W8IA 3G82C 2KTRA 4LZOA 4AX4A 1NUAA 4F6LA 4MGIE 4CT4B 1JQ3A 2D3WA 3BB3A 3KQLA 4FTWA 4HWIB 3P20A 2ODPA 4EG5A 5DN6D 1T6YA 2ZI6A 2PGIA 4TLMB 4D42A 4Y2SA 3OZWA 4RC9A 2QN8A 2QI9C 1T0BA 3QEJA 2K2QB 1RLOA 2B1RA 4I5EA 2QG9A 3T95A 1OQRA 1YR7A 4CM9A 3ZH2A 3AECB 3FPAA 4GMDA 1IYFA 5U4XA 4G1CA 3DAPA 2YWDA 2FCAA 3B5IA 4I2NA 2J3MA 1UC5B 1US8B 1XZ8A 3E8SA 5AW5A 3CA8A 3DMPA 1CJUC 2X1HA 4E21A 1VG9B 3SOZA 1VYVA 1BO6A 4Q4HA 5AKKA 4DR2B 1Q2UA 1A9TA 4DLUA 5JSHA 4EQZA 2NM0A 3H65A 1KYTA 3JYOA 3FDIA 3KBOA 1TZCA 1ZD8A 2SICE 2RFLA 2WHIA 4ZPXA 3RC2A 1A77A 5T8IA 4N5LA 4XTCS 3B1XA 2ZSIA 3VZPA 3E84A 3BMCA 3L8FA 4D41A 4LEIA 1OAOA 4BX2A 4L6IA 3E27A 4ZYZA 4IWQA 4CE6A 1H1DA 5AM2A 3CJRA 4P3YA 5BNTA 5JFOA 3NBYC 3R5FA 4J43A 3FKQA 2X19A 4O1HA 1GZ4A 4C05A 4ALJA 1XFDA 3PSAA 4C04A 2GKGA 3KVNA 2O3SA 1ILWA 1QIFA 1U3UA 5EE9A 3LVRE 1SXHA 4CEJB 1QHFA 1EFAA 3OCWA 3D8HA 1Q12A 3T0IA 3TGPA 1QZXA 4F3KA 1RSZA 2AKAB 1TBEA 4OBEA 4B2IA 4TQ1A 5BR1A 3OIUA 4A2QA 3T9CA 2WSBA 5DGHA 1N6ZA 1IN7A 4IWYA 2G04A 2YZKA 2AFVA 4CUKA 1ENZA 2DG2A 3EZNA 2ONQA 4LSGA 3W9UA 2A30A 3WQHA 1QWSA 1E3DA 2VDLB 2HLDD 1AUVA 3HZRA 5JATA 3AKZA 2GRIA 5BP7A 2NSLA 3H05A 3DHVA 1ESFA 4RVNA 2KT7A 3M3JA 3AK4A 2NZXA 2A0KA 4RFBA 3ORFA 4Q05A 3N2LA 4DHWA 2Z6AA 2RK3A 2ZSAA 3ZVRA 4BB0A 4EQ6A 2Y1LA 2YY7A 3LWZA 1HMPA 1MAAA 4NQLB 3G0CA 1I3CA 3F90A 4RNCA 2FPKA 4Z8XA 3D8UA 5ENDA 5JD4A 4FFDA 3G8YA 5THXA 1E2FA 1KO7A 4H31A 2AFIE 2R8OA 2XBMA 4XARA 3RREA 4ERNA 1T9HA 5K8LA 2PPLA 2GN6A 5TVGA 5CEJA 2CXTA 3GN2A 3QP9A 3VPSA 4G5XA 3EUB2 1M0WA 1FTNA 5TV2A 2FWAA 1N5DA 2GCIA 4OCZA 1JIQA 1U2TA 2BKXA 3L7JA 1VR9A 4ENRA 4HSEA 4B43A 1JDPA 5AOAA 3MHSD 4LOLA 4O4IF 1TAQA 4WXEA 5ADVA 1E3WB 1J5PA 1WF9A 2LDBA 4GKKB 4QFCA 3JQDA 5B6PA 4JWTA 2G5CA 4LYEA 3UIOB 4B7ZA 4LC1A 4NG4A 4ZHQB 3EUWA 1NAHA 1SKUA 5KYXB 2Y0EA 3TNFA 1HL7A 3LSTA 2AS0A 5B2EA 2FMFA 2FUEA 1PV4A 1MD9A 1FMCA 4NV1A 3PHLA 1D7AA 4WZAE 5AT1A 1GZ7A 4P92A 3BE6A 3L01A 3PP8A 1GCOA 5CRIA 3RR2A 2BWES 1SOWA 1S8AA 2YRFA 3DXYA 4K3UA 2PH7A 4KP7A 2NP6A 3U7ZA 4EGFA 1VMEA 3PYLA 2ZP1A 1MW9X 2GD0A 4FN2A 1DT5A 1J7KA 3OFND 5LDDC 4QA9A 1WY8A 4X3CA 4DNXA 4F7DA 5BXYA 4KUHA 5AHWA 2ZWVA 2NUPA 4MELA 3BHIA 1F9JA 1LFDA 2F1KA 2XLCA 5BMVF 2HEGA 4A3OA 4B6WA 3TJPA 1DKRA 4RW0A 1X2BA 3KYCD 2ECPA 3EVNA 4K9PA 1HX7A 3QF4A 5E6SB 1D6JA 4QZVA 5MF6A 1QQ6A 2H85A 4MHOA 2O1XA 1TO6A 1ACLA 2Y1FA 3RVQA 1IY9A 5DT2A 5B7PA 1FMJA 1VDVA 1EFVB 2CDRA 1GZSA 3UV7A 2IBSA 4ZYLA 1C3OA 2OBBA 3CZQA 1I4WA 2J9FB 2I62A 1D8TA 2O6VA 2I2XB 5IKXA 5CA1B 1GDDA 3LP5A 1E1LA 4BFWA 1XLOA 5FWDA 4CMGA 5KINB 2P6OA 3TG8A 2OB2A 4P3PA 1EDOA 2KSQA 1XQQA 4EO7A 2ID4A 2PUBA 4B4KA 2EHDA 1A8HA 4N76A 4BGUA 4QEKA 4PO3X 3OZBA 4FT2A 3T3HA 2UWQA 2ISSD 2FP3A 4IRUB 1RWWA 4GC9A 2QC8A 1M72A 5B58C 3ENNA 1Y4ZA 3O26A 1TTPB 4RPKA 4I55F 1KSGA 4WVFA 2DKNA 1AN8A 2QJFA 4YBZA 4GKBA 5DHSA 2VQEB 5I9SA 3VR4D 2VAVA 3IYLW 1A82A 2XA9A 3K0CC 2JU6X 1ZSNA 3AG5A 1NRJB 5FNVB 4IHQA 4RPIA 6AT1A 4JT2A 4NK4A 4IDNA 3KUCA 1WXEA 2A0YA 4URFA 1O58A 2P62A 2FK8A 4QHYA 1YC5A 4GOKA 3EG9A 3LO5A 4O3MA 1PUTA 3QLVC 2ZSUA 1XLPA 2VZ9A 2VH1A 1MB9A 3L4KA 3ZGZA 3BD7A 5IXSA 1U4AA 4CR8A 4NCBA 2X0DA 1IJEA 2Z2IA 1WX7A 5KDLA 2COEA 4ZEWA 5DM60 3UOGA 4TPKA 3BQMB 1OU4A 3TLAA 1T0UA 4YAGA 4X00A 2VYNA 3UJ9A 3A1VA 2WWZA 3L8YA 2EKQA 4IRXA 4KWCA 3KKOA 4EG4A 3PLRA 2JH3A 1QIHA 1YL5A 4C4XA 5KKCA 1G9TA 4LRYA 5CVDA 4KZ0A 1M3SA 5NLLA 2XGOA 3EXAA 4JR0A 2X2OA 2FZEA 3M4NA 2ZIZA 2DKOA 3TQTA 1B43A 3JQCA 2QTZA 1AGRA 3HRHA 1OYWA 2O14A 4DBGA 2I6FA 3E03A 4MO2A 5L7TA 5AFSA 2F62A 1L4KA 3UCEA 3IKMB 2QTNA 1G19A 1VE7A 4C2TA 3FTDA 4UXHA 4G23A 3UJDA 3EGDB 2VAMA 3DBLA 1Y6FA 1H8HA 1V4VA 3N05A 2ACEA 2X76A 3PZDA 3AHFA 4RKFA 4TUYF 4UARA 1K6JA 5CJJA 1QE3A 1JYFA 2YFHA 3N3KB 3QJ5A 1M6VB 1WWKA 5L45A 4WY5A 2DLBA 4WACA 3GAAA 3IKLA 1MO6A 4O4IA 1J97A 5LLSA 1BEZA 1EUYA 4DC0A 1LRLA 3FB4A 3KWLA 1PL8A 3CE9A 1JBKA 4DMRA 2GHTA 1YQ9A 3T9DA 5JSKA 1E32A 1FCJA 2QVZX 3CUSA 1YZ3A 5BXQC 1UKEA 2NUAA 4BQNA 3ETNA 2OYSA 4LE1A 1JVNA 3S28A 4IV5A 3MG9A 2OXFA 3B3QA 4JSYA 5EFOA 4WLVA 4IC7B 2Z4RA 4RVDA 1LU9A 4MJLA 3GA7A 4D4GA 5FLXA 2WYQA 3UAWA 3KQVA 2C4VA 3GPBA 1P2GA 4IZHA 2F43A 1KU0A 4OXRA 2QL5A 2HYDA 3OIFA 3QEMA 4W5WA 3MCAA 4YSYB 4WCFC 1V48A 1TUEA 1NBMD 4DTIA 4EGJA 5KWSA 5G0WA 2APJA 2XCRB 3O90A 2OJWA 1MC5A 4MUYA 4X71A 4BE9A 3EISA 4UAUA 4H7JA 3L84A 1FJHA 3RARA 3MBKA 2UVDA 5FWYB 2WU8A 4ANWA 2Y0DA 4RTOA 1RS0A 3A3NA 1KS2A 4KOEC 5K5EA 5K9ZA 4H7EA 5IAKA 1MO4A 5FK9C 1CRZA 5FCDA 5ICEA 1GOZA 3A9WA 4QGBA 1V86A 1D4OA 4PGMA 1U3FA 2NS5A 4HD8A 2O8BB 2AG1A 3T7TA 5FBLB 4UUMA 3HR7A 3S44A 1M1YB 3OHMA 2GN2A 3LW8A 4J4HA 2ZE8A 1YI8A 1F6DA 4GDKB 1ZN7A 1O1YA 1CJVC 2F3QA 2GPAA 3QKWA 4BNMA 3CEMA 1C80A 1C0PA 1R64A 1Q22A 4XE5A 1FL9A 2QUZA 2XMRA 2OYCA 1XZJA 2ZSJA 5T8KC 1J21A 3KM0A 3ITDA 2LZ6A 4B6QA 5MN4A 4FJYA 1CP2A 1OFFA 1RABA 2P41A 3ZWBA 3RFFA 1NOJA 4ZZ3A 3KK0A 3TYXA 1QH1A 4GOLD 3T15A 2HA4A 3AJAA 3SR0A 4D3ZA 2GCNA 1F2RC 4PHHA 4M8MA 5AM4A 1UH5A 3V9AA 3FKSA 2A58A 5LMNB 1TKRA 1UBHS 2FZWA 1ODJA 2FLVA 3ZKWB 1U0NA 1IULA 2KHZA 4GFDA 2XTZA 1T9CA 3CF2A 4BMSA 2FJPA 1G5PA 4PO8A 1YH3A 4ZK6A 1AHIA 4R9RA 2CFSA 2BKUA 4D9CA 3RE1A 4XVHA 5E9JA 2B3TA 5FOXA 2IKQA 3WHPA 3OOWA 2IHJA 5FLEX 2UZ3A 4B6SA 2XE4A 1XJWA 2EEZA 3FOBA 1VKHA 4PHFA 2CD9A 2A1IA 3KVOA 2BJVA 1HURA 3HYSA 5INTA 5AW7A 1NV8A 4GLBA 1TTQB 2P35A 5FHQA 3HXOA 1KR5A 5A9TA 4L4YA 1ZDXA 5AVWA 3L7DA 3IRVA 3DUFA 3GEIA 2N9UA 3QC8B 4QVIA 4BFZA 1AG9A 2DQKA 2Q9AA 1VKOA 2IIVA 3OZVA 2SKCA 2PNFA 1JMKC 1VG0B 4TMKA 1K27A 4HATA 2I6GA 4LCJA 5JEDA 2K5UA 5F9HA 2D11A 4CFZA 3GJ7A 2ZVPX 3WLAA 3AJDA 4QLOA 4TV8B 4TUYA 3TRJA 2VATA 4NYJQ 3EWNA 4D0SA 1THGA 1O9BA 3QBTA 2CHZA 2ZCUA 2TYSB 1ORDA 3O8DA 3SFTA 2OCLA 1OLUB 4DXAB 1N0UA 1XWIA 2MT9A 1CUVA 5F3RA 2QF7A 3DVRX 3RUCA 3AIOA 2C7MB 3HUTA 1GXSA 2H9AA 3TIFA 1SQ5A 1DOXA 5TS2A 3EMDA 1RBYA 3C98A 1AN9A 1T8PA 3C14C 2ZRPA 2PA0A 2FEOA 3R9IA 2I3AA 1QR6A 4LGVA 3M33A 4MDYA 3VZQA 4TL8A 5DWVA 2YC2C 4XM1A 1I5OA 3LX4A 2O8EA 2GAFA 4YYZA 5TMEA 3LB8C 4BU1A 5DBGA 2KK8A 2M1ZA 3FRJA 3AEQB 1CUCA 4RMNA 4JQSA 2GJ9A 3VTVA 2GOWA 5D3IB 1KTKA 3ZY4A 1CE8B 4BO2A 1G8HA 1CX9B 4HEA1 3UAGA 1OHHD 1CZHA 2OOKA 2BI8A 3JARA 5TPWA 2G4DB 1OYYA 2C58A 4DEVA 2JKZA 3R44A 2N1MA 2AT1A 1DKOA 4MS3B 5ETJA 2KWDA 5CNIA 3AZOA 1LNSA 2I2DA 4QXMA 2WFLA 3DC2A 4GOXA 1WDMA 2WJWA 1AS2A 1XZCA 2LWPA 3IAS6 1NU8A 1N1DA 2BFBA 2SKEA 3Q7IA 3UT5B 1WUYA 3W06A 3JRXA 2JIBA 3D5EA 4Z1MD 4QWMA 5F12A 2R68A 3N87A 1ZM4A 1SOAA 4N7MA 5KX5B 4WOKA 3PKJA 1RADA 4JUCA 3K2IA 1JLMA 4TN5A 3IEVA 2ZLBA 5K0TA 2YMMA 3E61A 4MW6A 3AJ8A 2G70A 5ALSA 4JYBA 1ZW1A 4JLKA 3VO1A 2D0IA 2LRUA 3W79A 2LIVA 4R83A 2C9BA 4GBJA 4BKSD 4DA0A 4DLVA 1VJ1A 2YQ5A 1P7CA 3DM9B 3W1SC 3SNKA 1G5HA 4BWVA 2GUWA 3V8MA 2XNDD 1IXYA 3I4LA 3CM0A 4HPXB 3K9LA 4NZ9A 1KNXA 4LHWA 5T6BA 3KE8A 4H17A 2XUFA 4V24A 2C1XA 1YQTA 1OXMA 1E8YA 1T1SA 4XR4A 3H87A 4I1PA 3FNHA 4DOMA 1JL3A 1AXRA 2ERXA 2ZS7A 4IH1A 1DKNA 2CMGA 4LYAA 2EKDA 2WU3A 3L8MA 2H7YA 2PNJA 3AH8A 3LOPA 4H7PA 3WLTA 1I3OA 2WF5A 4K6FA 3EB9A 3KEMA 1KAHA 5LCXA 3RC3A 1N2EA 3V62A 3KNZA 3KQYA 1IBSA 4E2XA 1ZQ9A 1N6NA 2L1AA 2H4FA 3H5IA 5CVTA 4AQ7A 1W94A 2VJMA 4W9LA 3PO0A 1ONNA 5J1SB 1YRAA 3EECA 3DT9A 3G2LA 3VRBB 4BFTA 2HWWA 4HAYA 3M0EA 4ENPA 3EUEA 4LZWA 1A9YA 4Y2VA 3F5MA 4XIJA 2NYRA 3B13B 3UC9A 2FWIA 2BKRB 4KLZA 3Q8EA 4DCCA 3K6RA 3NTQA 4MGZE 2LE0A 3C7DB 3AB3A 5L3SB 1U2RA 4UMVA 3R7NA 4IVNA 1R8QA 2J0JA 1K51A 3FGZA 3COZA 4ONEA 4ZZ1A 3RIGA 2HIGA 1SUDA 1KZ1A 4MITA 3W5HA 4RX1A 2OHJA 2CHEA 4AQDA 2A5GA 5I4CA 4XUEA 3JQ9C 5K09A 1DBWA 2CMKA 2B4TO 2L52A 1QYDA 4XX0B 4XWTA 4NJMB 4H77A 1WGGA 4EX6A 3DNPA 2VH2A 1D7OA 1J56A 3OM8A 1ZNZA 4OA8A 1V7QA 1D1QA 2C2KA 1WJ6A 1B0UA 3RSHA 2BPOA 4JJ8A 1Q7EA 4WLOA 5CNJA 3K5IA 3EDCA 4FBGA 5JRZA 1Z2EA 2Q6KA 3QU5A 3GX1A 3CRNA 5AK5A 4X57B 1E1KA 4UMDA 1QG0A 2BSQA 2DQ4A 3G0BA 4XYLA 3VKFA 1JI3A 2XLBA 2NVWA 1SULA 4A2PA 2MSCB 4CQLB 3GELA 2Y0CA 3O1JC 5CAEA 4RTMA 2DZIA 1U7ZA 1S9HA 5AW3A 3QOWA 4ILKA 4OM7A 3CX6A 5KNBD 2DMRA 2RGAA 4HGPA 4V0QA 4A10A 4I4TF 2XXAB 3B1LX 2ZPTX 1Y5LA 2C7PA 2B36A 3KT6A 4KN9S 3KKNA 3EZFA 5KTPA 1PQWA 4KYVA 1P18A 2VXOA 3HVRA 4OJTA 3FETA 3AOEC 5CLHA 1OH6A 2YZNA 3JQGB 3SQXA 5E1DA 1AKWA 1KY2A 2AVNA 4JBHA 1SMKA 2IBMA 5E9WA 2XNCA 3F4BA 2Y67A 1K7SN 4BVHA 1NPDA 3R3MA 2P8JA 1U2DC 3FPFA 1T15A 4LYYA 3SC2A 1I10A 5IAOA 1GTMA 3WFIA 3F0TA 4GRIA 3UPTA 4Y2JA 3PNKA 1ZN2A 3K72B 1WLSA 3V8PA 1PDWA 3PXAA 2B1IA 1DXHA 1NXXA 4R8VA 4KIUA 2DKFA 2J9ZB 3J9CA 2RGEA 3E7WA 3O2JA 1MLDA 1W0JA 1ZK4A 3WGGA 2ORVA 2Q0XA 5JHHB 2IODA 2PRSA 4Q3LA 4C29A 3HDVA 1Z29A 3HKEB 3F2IA 4PWYA 2XUZA 3O82A 2IHYA 3OOHA 3VZCA 4JP3A 3RHFA 1G2IA 2JK1A 1C4CA 1NSTA 4TT3D 3ND5A 4C6HA 1KSFX 2NTTA 3OOEA 4KVGB 4W5OA 1JWMD 1BCSA 3A9CA 2DZKA 4JX8A 3LPMA 4XCXA 5DH9A 3O4JA 5T3UA 4Y2PA 2BLLA 2XTMA 3FVTA 2IOFA 1VC2A 3E9RA 5KNDH 1TVEA 4FHFA 2FPMA 1XN1A 3NXSA 2EX0A 4DIKA 1ZIDA 3HG7A 4GE0A 5J5CA 1HQYE 4DIDA 3OUZA 4GWLA 3C6YA 3RVRA 3AFHA 1RBZA 1C3JA 1NBHA 3AW9A 4RAQA 4IGKA 4KPUA 4R69A 4FB5A 4G5QA 3KBBA 4N3GA 4JJZA 3TNDA 1LTQA 5DCYA 2I4MA 3NANA 4I3FA 4NNOA 4YDSA 3DVGY 4HPMB 5JBNA 4OUKX 4IXDA 4O0LA 3LX8A 5IO9A 1D4BA 1FFGA 1N63A 5DXJA 4RGTA 4PBRA 4NU8X 4IGEA 5D7BA 2Q99A 2CN1A 1GA1A 5K45A 3AZQA 4QUDA 3UGQA 3VYTB 3PQDA 3ADOA 3AUUA 2JIMA 1OR8A 1OH7A 4R1OA 2I3BA 3TR0A 2PIDA 1DEAA 3A4IA 3APFA 4V0OA 2ZITA 3WL8A 1GZ3A 2HBQA 2IJGX 2ETVA 1PX0A 3ODGA 2YR0A 4KMSA 2D2VA 1ZA2A 1FDVA 3ZHSA 1FYVA 1SPBS 2XUAA 3G0HA 3D0RA 1R0WA 2IZ6A 1NMEA 1OXVA 1S89A 3D4BA 4DJFC 5CEEA 2YDYA 3HDYA 1UQTA 2GBIA 1UOOA 4OATA 4OG2A 4FYYA 4IDIA 1RFKA 2KDBA 2JIZA 5FBVB 5K4AA 3NKFA 2R48A 3BWMA 2ZIXB 4XDZA 3HA5A 3QVGB 3N3BC 4FYWA 4R3NA 4A90A 2N3ZA 3HLTA 1EUCB 3DAHA 1F60A 1GA6A 3ESXA 4GUAA 4FFSA 2QTFA 3KJQA 1F2DA 3HB5X 5A4JA 5KYGA 1GZHB 2ZBFA 4NZYA 3A6KA 4QOIA 4GSWA 2AJTA 1JE1A 3EMBA 2JZ3B 3FYUA 4NOKA 1XPRA 4MPRA 2YXPX 2CVZA 4PR0A 3JQFA 3C3KA 5LXTB 2MYNA 2DE0X 2YMPA 4IPTA 4BQEA 1JPJA 4EP1A 4QBHA 1I30A 4GWKA 1P4JA 4YALA 1WOMA 4EG7A 2H08A 4AZ0A 4LMAA 1C8BA 3CT4A 4RMGA 2CNDA 1RWKA 2HQ1A 3ABIA 3DCJA 1AGPA 3RVOA 1SBIA 3RGGA 3ZZ0A 4EO9A 1NW8A 4BTVA 3EPHA 1GPMA 1JEYB 4TMWA 2IGGA 3TSCA 5K8VA 3SLGA 1GQYA 2I6SA 1ISMA 5AR1A 1FLDA 3EHEA 5HRUA 1JG4A 4WUVA 3OHPA 1GCIA 1DC7A 3ZUNA 4CTMA 2EL7A 4I4TA 3W1VA 3WDLA 3TW4A 2H92A 1C3TA 5KHLB 1V1RA 1TCAA 5JBIA 2QGNA 3RT7A 3T06B 4KL8S 2JBHA 2UUAB 1AGNA 3ZIDA 1M6HA 2IZZA 5EINA 1M0SA 4I08A 3S27A 1Z4LA 2H52A 3DDUA 2FN8A 2X13A 4CM4A 3Q6NA 2QL7A 2QXTA 5F76A 1G64A 2Z5LA 5IU6A 5AMXA 3SQLA 1W9MA 1DX4A 1S3SG 2XNHA 3PRKE 1YN3A 3SYTA 4Y9DA 2VYQA 5JS8A 4QAQA 3CUVA 5AUOB 4UBMA 1G8SA 1GNVA 3VX3A 1GUDA 5LKRA 2ZB7A 5AJZA 1TCVA 1ZPSA 2A84A 4IDCA 5HFJA 2ATVA 1YIWA 2IPMA 5BSUA 4N01A 5H9WA 4DMGA 5M5BA 3CNNA 4X8HA 3TBLD 2HYIC 3A4LA 4PTZA 1G98A 4RM8A 4ANUA 1MX9A 1I4RA 5IAAA 2WXLA 1XB2A 3C85A 3IHKA 3HACA 4PM4A 1H6BA 3KYCB 4R5MA 4DPLA 3CIOA 1RKQA 4A36A 2Q1XA 1TA4A 4RDXA 4U1RA 1RZVA 2Q2NA 4AG3A 4J0JA 3MCZA 3GWGA 5EWJA 1CG6A 2GZ1A 3ZWPA 3MGAA 2WJAA 1YULA 1JMVA 3PPVA 3WFJA 5L3VA 1ODSA 2OR3A 4IEFB 4LXTA 4WA8A 4R9SA 5I5EA 4RZQA 2G45B 4PLWA 1OQAA 3ZWOA 4H60A 1GEGA 1TT5B 1NY6A 4FHZA 3TDNA 4UTRA 2B1JA 5HIKA 4JJGA 3OIWA 1R6UA 4OHWA 1ZR4A 5DHTA 5BMGA 4HQRA 2M6RA 4GYJA 4Q3AA 4CG1A 5I9LA 3NM5A 3TFWA 4XXHA 4BFCA 2OEDA 4X62B 1B74A 2ETXA 2J6HA 3W8NA 1ZQ1A 2H63A 4L8YA 1MC1A 2CDNA 4QJ5A 2BEVB 9GPBA 3FPJA 3ON5A 3CH6A 1OJ7A 2LP4Y 3Q3EA 4ECAA 3NH6A 1A7JA 3C70A 3X2FA 1V8PA 4NL4H 1QS0A 1C9KA 1RVV1 1BHQ1 1EIWA 4DCOA 4GXRA 5LMCA 3AG6A 3ZOKA 4LRTB 3NGMA 1XJQA 4DW8A 1YD8U 1NONA 2HDHA 3H18A 5IFLA 1AMNA 1U3VA 5KYWA 3IQDB 1UZAA 4NULA 1QT9A 3G2MA 3JY6A 3T9AA 3JQAA 3VYUB 4OZAA 5G0VA 3D6JA 2Y4NA 1LS1A 4LS3A 2O8CA 3LOQA 5EKXA 3ADBA 2Y76A 5CITA 1Y8QB 4B7AA 2LASA 3AFMA 1JSXA 1RAIA 1SG6A 1IMJA 4HL6A 4TMXA 3WGIA 3CS3A 4KWEA 1AS0A 4KXYA 2XMSA 3UJ3X 3B6MA 3P2JA 1X1TA 2YVUA 3U37A 5KOJA 3OQOA 3M5PA 4TZ0A 2ZT5A 1DOYA 4B0OA 4UASA 2EJCA 3G2JA 3DF9A 4XPIA 2VJPA 4GRAA 4TTIA 1CT9A 5I9TA 4XZ3A 1KE2A 1NBEA 1W96A 1OEYA 1EFPA 3QG5A 1UBLS 2OLKA 4I4CA 4Y6PA 1BAPA 2ZR0A 2YTZA 5D1NA 4UAJA 4AB1A 5F2NA 1HYEA 1IZZA 3MJ4A 4BNYA 4IHKA 5DNVA 4HDMB 3W9YA 1UXJA 1OZHA 3IX7A 5BMIA 3KVFB 3OT1B 2BFFA 2YWRA 4J16A 4RTLA 1T8SA 1L5GB 1FX0A 2WLSA 2X2PA 1Y7LA 3HDQA 2F00A 3Q3MC 1W5FA 1DPFA 1EEHA 4FYJA 2W2KB 4DXHA 4ZOHC 4P4TA 4RM9A 1KR2A 4KHZA 1BMFD 2CLCX 2BTQA 2ECKA 4MRVA 1MF7A 4RCVA 3CEPB 2OBLA 4B75A 5KTRA 4MEBA 1EM8B 4QTXA 3AKCA 1HETA 1WEKA 4MYSA 5KTSA 4OMDA 5KJ1A 4ITRC 5CLFA 2EIHA 5A3SA 3R7QA 1DQSA 3GYBA 1X8JA 1WBJB 4GXNA 1A7AA 2H8KA 3H0KA 2PLWA 4KKXB 4XDCA 3NZ3A 3O93A 1D3ZA 4YI3A 4EOYA 5ALEA 3RN9C 3P2MA 1VZ3A 3DVAA 4AM8A 1Z5ZA 2QQGA 4CGZA 3H9BA 3MGBA 3OPXA 4UM9D 3DZJA 1EP2B 3TRIA 4BVUC 5JAOA 3DWMA 2MBBB 5E3JA 1VPVA 1XIVA 4NCKA 3DYVA 3KKPA 1YE3A 3MN1A 1JDBC 1V3VA 4Q3EA 1JWBD 1DG3A 2UZAA 5CT6A 4LXHA 1HSZA 1LLFA 2IDKA 3CE6A 4FX2A 4Q4AA 3L77A 3LKZA 4NAUA 5IDWA 2PR7A 4MB0A 3DL2A 4CMAA 3GNLA 4P0TA 2WD7B 4W8GA 3GPLA 4CG2A 5IS2A 5ENZA 3BMXA 4C4YA 3G5LA 2V0CA 2ZRCA 1KS9A 2V74B 1ISFA 5LPNA 1E18A 3F4LA 4TM8A 5JO9A 1DRKA 2J5XA 1QVAA 1CBUA 4D80A 4NQZA 1TMGE 3KB1A 2QL9A 2Y1XA 1R3DA 3FOEC 3PHCA 2D5IA 1IB0A 1R9GA 3AWIA 1L0XB 1SXGA 3QVMA 4YQZA 4XH9B 1T2FA 3SZRA 4XWWA 2IEGA 3LXFA 4OXNA 3U4IA 4EW6A 3JYPA 3IA2A 3MT0A 4NEHB 1SU8A 4HYTA 4C5AA 4ITKA 1FIUA 1STEA 2JFGA 2PO5A 2GD1O 2PRYA 4E31A 3WIVA 2R4TA 2BDTA 3GUUA 4U7PB 1Z68A 3FMOB 2BY4A 2EP8A 3TINA 2O2IA 3ESQA 4HDKB 1JH9A 1SK8A 2Y99A 5FT9A 4ZOLB 2AI1A 1RI2A 2WJ6A 1NMSA 3MA0A 1ZD4A 3NVDA 2NBWB 1N6HA 1NP3A 5HZKA 2OKCA 1UM9A 4JGHB 4Q21A 2V03A 2ZK7A 2O7RA 3MOGA 2QTHA 3PNLA 2ZT7A 4O2AB 1IWBB 3BXHA 4NDAA 3BIID 5KNCD 4C7ZA 4NNPA 1IGDA 1QV7A 4RENA 1OTXA 1GFIA 1HZZC 2AK3A 4L8GA 3TTVA 4KRGA 1B41A 1MPXA 5IA7A 3QPUA 1SBHA 3ADCA 4WHMA 2GX6A 3RABA 1GL6A 4MW9A 3NWEA 3PJEA 3DO5A 5J4VA 1PL6A 1CJTC 4HDQA 3L10B 3ZD8A 2WYHA 1X1MA 1P72A 2Q41A 1KSHA 1VKJA 4UXJA 4IUBS 2WZQA 9ABPA 5BVGA 1NQVA 2OE2A 5AZHA 2VN8A 4YCAA 2CT8A 1UEJA 4CQMD 4EM6A 3A1QB 3FAKA 2CB9A 4FDUA 1AB5A 1ZYUA 4YAEA 2PGAA 4LBVA 2AUTA 4YFYA 2EERA 3GNTA 2NN3C 1N25A 2I65A 3L4BC 5JRDS 1RRCA 1VE1A 3IESA 2AI3A 1K52A 1H2ZA 1TC1A 3GZJA 2P65A 2C61A 3BWUD 4C4VB 2FFQA 4KHPB 3D8TA 4RVHA 1BEUB 3MBOA 2XMPA 3EZ9A 4R8RA 1E9BA 3KT3A 2RH4A 2QIPA 2ZT6A 2JEZA 2PZGA 2W0SA 5IBQA 4LJ7A 4I4IA 1PSDA 2R6GA 1DHTA 4HY3A 4B09A 3ZGOA 4AZVA 3KSUA 2Y0PA 3I64A 3PDJA 2B4AA 2OQ2A 4DRXB 3TOCA 5H16A 4ENVA 1AA6A 4Q12A 1QO0D 4XTRA 1L7PA 4PCAA 1DJNA 1QHXA 1PRYA 2VTDA 3TEFA 3JASB 5KYNA 1KBZA 1L7MA 4GT1A 1YA6A 5JECA 2O0HA 5JJIA 2DHDA 5DK4A 5JNWA 2ASVA 3IHWA 4BMPB 4YJ2B 4BE4A 4CUJA 3DE1X 1N5MA 4DS3A 3JSVB 3Q15C 2FRDA 4EHBA 1TM4E