3WIMA

Gabarap-lir peptide complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
b'MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid receptor-associated protein
publication title GABARAP-LIR peptide complex
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 34
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wimA00
3PSEB 2B3AA 3RYTA 3DBLI 5CHVC 1V86A 4GDLA 2KFJA 2KX3A 4RMAA 3L54A 4EZKA 2M0XA 4MJSB 1G6JA 4FJZA 2BYVE 3PV1A 2LI5A 1GG3A 2PEAA 4HDOA 5L95C 2AEHA 4EKUA 2FUHB 1NBFC 1P0RA 1R4MI 3VDZA 2D10A 4DK5A 1E90A 3ZRFA 2CU1A 3KYDD 4FHJA 2KTFA 2G4SA 3L0WB 4MH0E 3UQAA 2FCNA 3GOEA 5C1ZA 3VUXA 1NDDA 4WJPA 2JT4B 3QX1A 2YLMA 3WANA 2JF5A 1KLVA 1VD2A 2KFKB 1WXAA 4KIKB 4K7WA 2KOXA 3CMMB 3DBSA 4FLHA 3PRPB 3VAWA 1WGGA 3NZSA 2KLCA 3VVWB 1V81A 2L0FA 3R66C 4JIOU 1KJTA 2MRPA 4ANVA 5IA7A 2GBNA 3MJWA 1RLFA 1RRBA 2C60A 2IO3B 4GGQA 4J6IA 1IYFA 2AL3A 1CMXB 4MSMB 1P98A 3ZTDA 2LVOA 5D6JB 3R7RA 4DXAB 1I35A 3TIXA 3V6EB 3VFKA 3DVNU 4GDKB 1SE9A 4FULA 3V6CB 4XC2A 4ZYNA 1E8XA 1WGRA 3H1UA 2LVPA 1OEYJ 3CF6E 5TR5A 3RZWC 2KZRA 3KYCD 1RAXA 2G3QB 2KHWB 4AWJA 4I6PA 1WJ6A 3KH0A 2FNJB 3N30A 4W9HA 3VTWA 4CHKA 3P2BA 2KVRA 2MP2B 3DVGX 2D3GA 4GU2A 3RCZA 3HHMA 4TKNA 2KMAA 2G4DB 2KWCA 4BBNF 5CHFA 1XD3B 1V5OA 3D32A 5JZEB 1H4RA 3A9KB 2MWSB 3AU5A 1WJ4A 1WZ3A 4II3B 2WX1A 3H7PA 2ZNVC 2DZKA 2KDBA 2NPTB 1EO6A 5EDSA 2ZCCA 1EF1A 3H7SA 3X23A 2KDEB 1WR6E 1H8CA 4HWIB 1WXMA 4ICVA 1QZEA 2KWVB 4FJVB 5JH5C 2W9NA 3MTNB 5AZGA 2FCMA 3DBHI 4NJ6A 2LASA 3VTVA 4DBGA 1TGZB 2M1MA 4GB9A 4KSLC 1L7YA 4HCNB 3U7DA 2CR5A 4ZRIA 4W9DA 4URKA 4A20A 4W9CA 2AWTA 4W9IA 4KV2A 1KOTA 3WALA 2FIFA 5E6OA 3VHTC 4HLEA 2D2QA 5HKHA 2K8CA 2HE7A 3U8ZA 2OOBB 3A33B 3QJZA 1WGYA 2MBEA 4HK2A 4LDTB 4DHZB 2G45B 5G2NA 1FXTB 2KC2A 2KJ6A 3X0WA 1WY8A 3WA0A 2N9XA 4GDLB 4WQOB 3T8MA 1S1QB 2CHWA 2J7QB 4PS3A 4ZRJA 5BO4B 2JXXA 4LCDE 4E74A 5DPSA 4JL9A 2LXAA 3LDZE 4MM3A 3V60A 1WE6A 1E7VA 3ML8A 3WAMA 2N9EB 4EZLA 3VTUA 1WGDA 1SGHA 4KDLB 1UZXB 2VRRB 2ZVNA 2AYOB 1WMHA 2KJRA 2GBMA 3K9PB 2CHZA 2DENB 3UIOB 5DPWA 1MG8A 4NQKE 3QCAA 4W9GA 3AU4A 2MBQA 3SDLC 1Z5SB 4GMVA 3DDCB 2XK5A 2LUEA 3KW5B 2LGXA 2Z0DB 3S2AA 2IBIB 1M94A 3QAQA 4NJ7A 3APFA 3EECA 5J18A 3UF8A 1EF5A 3DBRI 3ZRCA 2N4FA 4AP4C 2N7DA 2C7MB 2ZCBA 1OEYA 2AL6A 2KXJA 2DYMA 3L08A 3LJ3A 3NY5A 3CSTA 4LDTD 5CX3A 4BOZB 1SIFA 4F8CB 3PZDA 3OJ4B 4ANWA 3IBEA 1WI0A 3HIZA 3ML9A 3OAWA 2NVUI 3WIMA 1XQQA 2Y5BB 4W9JA 1WFYA 5D7GA 4TV3A 3ZDTA 3I3TB 4ASWC 4MELA 2I1JA 2ZZPB 2BWES 4K7SA 2JUOA 2DX5B 3M62B 3DCGA 5IAAC 2O2VA 5G55A 3RULA 3ZNZB 4EZJA 2DYBA 2KNBA 4IUMB 5D94A 2MLBA 4DHJB 3SU8X 3TMPB 3DVNV 4HCPB 3UGBB 3ZO5B 4G50A 2NBWB 1LXDA 2J0MA 4NY0A 4WWPA 2HJ8A 4WJOA 3ZIMA 2NR2A 5KHOA 3H6NA 2O6VA 1WJUA 2ZEQA 3O65B 4WJQA 3ZTCA 4E3CA 1YX6B 4RM8A 3A4RA 4JGHB 1WX8A 3HM6X 3N32A 3H7PB 3B1LX 2KWUB 2N9PC 2ASQA 2XBBC 4AUQC 2XEWA 3R3MA 2ZNVB 1P1AA 4W9EA 1WX9A 1C1YB 2K1FA 3L10B 3L17A 3EC8A 2M17A 3IHPC 2M8SA 3VUWA 2HTHA 2CHXA 2LXCA 3GZNI 3KUDB 4MGIE 5AZFA 3ZNID 4KZ0A 4KIKA 3Q3JA 3JSVA 3ZNGC 4XX5A 1ISNA 2FCQA 4IWOA 2YVCA 3MHSD 4TQ0A 3NZUA 2PPHA 3Q3FA 2KJHB 1XT9B 1JRUA 2LRWA 2UYZB 3ZDMC 3BY4B 3SHQA 3RZFA 4BKSA 2BPSA 4F7ZA 1P3QU 1X1MA 1OQYA 3BINA 3L13A 4G3XB 2J0JA 3QHTA 3A9JA 4HPMB 4DHJD 5JHBA 2UWQA 4DHZE 3A1QA 3EHVA 2EMTA 1WIAA 1V6EA 4FA6A 1WRDB 2LVQA 4FN2A 3ZKJC 2C9WB 2JWZA 5DPRA 4F1SA 2FIDA 2JPHA 1GNUA 2MBOA 2MQJA 4IC7B 2KTRA 1YQBA 5L83A 4IWQA 2PJHA 3IG3A 4MGYE 4B6WA 4IW0A 4NAWB 4PS7A 4KZCA 2MCNB 3TJPA 3QK0A 5E6NA 4K81A 5J17A 2NCNA 2ZPNA 3PREA 2C5LC 1WE7A 2LWPA 2N1VA 3PT2B 4MEMA 1TTNA 4FBJB 2LZ6A 1ZW7A 2HD5B 2WWZA 3EFUA 2NBVB 2IO0B 4IM0A 1A5RA 3OJ3A 2BWFA 3A4SC 2D07B 2LRUA 3ENEA 4JLCA 4FADA 2MA9B 2IY0B 1V49A 2I1KA 1P9DU 4ZDVA 1KM7A 1WMHB 4GOCA 3KUCB 4G11A 1UELA 5CHWA 4RM9A 3APCA 3QA8A 4OVUA 2WDTB 1E5WA 3QWZB 5KHQA 2R2QA 4EOYA 3CSFA 4CYEA 3A9KA 1GC7A 4HJKA 2N1WA 1V2YA 2RSUA 2KDFB 4B9KA 2RD0A 4WAAA 4FHKA 2KDIA 3SD5A 1ZGUB 2CKHB 1HE8A 2KMCA 2L00B 3TBLD 4BFRA 1J8CA 2JVCA 1GUAB 1UD7A 4GXBA 2KKCA 2A5UA 4AJYB 3W1SC 3T9LA 2GBRA 2JRHA 4W9FA 1UGMA 1WYWB 2M4NA 2BYFA 3PLUA 4OVVA 2LGDA 3NS8A 3PGEA 3W1SA 4IM2A 2KO3A 2R2OA 3IFWB 1WF9A 3PPAA 1LQBA 1Q0WB 4M8NA 2MW5A 4NQLB 1LM8B 2MX2A 4ZRKA 2QHOA 1WM3A 3VUYA 2RPQA 1WXSA 5LLIA 4X57B 4YL8A 2O2VB 2V1YA 4ANXA 2BF8B 5DPTA 4MGZE 2V3SA 4IG7B 3N3KB 4W9KA 2JZZA 2MSED 2A4ZA 4A3PA 4KVGB 3ZNHB 4TQ1A 4GSWA 1YX5B 1GJZA 1RFAA 4JQWC 2OJRA 3RT3B 1NI2A 1LFDA 1IPGA 1U4AA 2O6VB 4M0WB 2CS4A 2IZVB 2L3ZA 3VXWA 3PLVA 3NHEB 3UINB 2FCSA 2JY6A 3H9DA 1WXVA 3OLMD 2DYOA 4EUTA 2K39A 2ZJDA 2DAJA 2ZPYA 3V61A 2EMSA 3DVGY 2KD0A 1WM2A 3ZVVA 3R7QA 1OGWA 4WWNA 3PHWB 1E8YA 3ZW3A 4WJNA 2NBUA 1WGHA 3V62A 4B95A 2Z0EB 5D2MB 2GMIC 4BBNC 4PYZA 1R4NI 2K25A 3QIJA 3UIPB 4KSKC 2BKFA 4ANUA 3JSVB 2GBJA 4MSQB 4MJSA 2ZVOA 3B08A 2Z59B 4CO7A 1Q1OA 4IWPA 4DWFA 2L05A 1V5TA 4II2B 5AZHA 4A3OA 5LXHA 2IYDB 2RR9A 1GC6A 4XZ4A 3PRMB 5GMVA 2KANA 3A9JB 1UBIA 5JHAA 4G0NB 2IY1B 3VH4B 3A1QB 2KN5A 2LJ5A 3ZUNA 3L16A 4BVUC 1E7UA 4BOSC 2LGYA 1T0YA 2O6VD 5LXIB 2REXA 2KTRB 2KFKA 3HK0A 4GN1A 2JRIB 3PRZA 3RD2A 2K8HA 3U30A 4I6LB 4MDKE 3PVLA 2BKRB 3ZLZA 2C7HA 3DOWA 1K8RB 1WJNA 3QQ8B 4EFOA 2KQ7A 3JYUA 3TL5A 2C7NB 2KQSA 3C0RB 3B0AA 2FAZA 2KK8A 3JW0X 1F9JA 2D11A 2L0TA 4GIVA 4ICUA 3M3JA 2DAFA 4GDKA 4I6NB 3QC8B 4HPLB 1WR1A 2MBHA 1WZ0A 3KUZA 3PS6A 1WH3A 4BKGA 4DDID 4EEWA 2V4LA 3M63B 4LJOB 2DZMA 3QARA 2NS5A 1TZ1A 3ALBA 1OTRB 3M95A 1AARA 3ONSA 2DZJA 1IP9A 2KX0A 1TBEA 1BT0A 4BKSD 2RGFA 2J0KA 2IO1B 3HM3A 5J2RA 4DDGD 4M8MA 2K6QA 1YJ1A 1Q5WB 4K7UA 3DQVA 3APDA 1J19A 2L8JA 3IVFA 2MP2A 2PE6B 1YIWA 3PTFC 4NNJB 2BGFA 1UBQA 3PHXB 5AEKB 5FR6A 2L76A 1J0GA 2DZIA 4K1RB 3KVFB 1S3SG 4KDIC 1D3ZA 2K6DB 4HDQA 5CTRC 1C3TA 1YD8U 2WX0A 4PYUA 1E8ZA 1I42A 4NPNA 1VCBA 4E71A 1L2NA 2KC1A 3TCAA 2XK5B 4WWOA 1WX7A 4W9LA 3ECIA 2KLGA 4AOFA 2NPTA 4PS8A 4FJYA 4IM3A 2DHZA 3RUIB 3JVZX 3AXCA 4N9F4 2EKEC 3WAPA 1Y8RC 2BYEA 2JZ3B 2N7EA 5DCNA 3WAOA 2WYQA 3DPDA 4AJWA 4LJPB 2GOWA 1E8WA 3NOBA 2MBBB 4TUUA 3UQBA 1PQSA 1Z2MA 3AI5A 1V9JA 1EUVB 3AULA 4NAWA 2LD9A 1ZKHA 1V80A 4BKTA 4HXDA 4HVBA 3W1YA 3VQIA 2GBKA 2K8BA 5C23A 1UH6A 2IO2B 4P7IA 2PE9A 3VH3B 3K9OB 2L7RA 5E6PA 4MGKE
chains in the Genus database with same CATH superfamily
1C4PA 1QLBB 4GDLA 4B0EA 4RMAA 3L54A 2QSDA 1K52A 1G6JA 1ROEA 2BYVE 3PV1A 4WH4A 4FXCA 2WGSA 5L95C 3VDZA 1JWSD 1E90A 3ZRFA 3KYDD 1QOGA 2KTFA 2G4SA 2ACZB 2KN4A 3VR8B 3VUXA 1NDDA 2BB6A 4WJPA 3TUOA 2JF5A 4KIKB 3Q8BA 1VZ8A 3AMZA 2J4XA 3BVGA 3NZSA 1NENB 2MJDA 4JIOU 4J6IA 2BS4B 1IYFA 2W3SA 1XCQL 5D6JB 1R4NB 2NTSA 2G1EA 1SE9A 1K50A 4IKGA 4P6VF 4K3CA 3BVMA 2RDHA 1OEYJ 1ZDXA 3CF6E 5TR5A 3AEBB 3RZWC 1EU3A 3PZ7A 1V1PB 1ZXIA 1AN8A 2FNJB 3VTWA 4CHKA 3T3NA 2LMCA 3GS2A 4N58A 2WXHA 1OQRA 3AEFB 2KMAA 2G4DB 3D32A 2MWSB 1MI0A 3H7PA 2ZNVC 4XWWA 1GB1A 2KDEB 2I38A 1KFYB 3AV8A 1SSNA 2KWVB 5JH5C 2JX5A 2ZW0A 2W9NA 1VZ6A 5AZGA 2WU5B 2RDBC 1T0QC 1TGZB 1CZPA 2W3RA 2CR5A 4URKA 4W9IA 4C00A 2M0AA 2WXRA 2CJOA 2FIFA 3VHTC 2D2QA 4LLGM 1WGYA 3P1MA 3X0WA 2N9XA 4GDLB 2LHEA 5MPOA 1QQRA 1TKEA 1EWCA 3LDZE 4UDUC 2N9EB 2VRRB 3K9PB 4P1CC 1FXAA 1L0YB 1EM7A 3DHHC 1I4RA 2MJEA 4W9GA 1MG4A 1XO3A 3P4SB 4OZBA 3I57A 4P16A 5J18A 3EECA 3UF8A 3DBRI 4AP4C 1PYWD 2HJ1A 3NRZA 1I4QA 4F8CB 3PZDA 3WIMA 1XQQA 4MELA 2ZZPB 2BWES 3M62B 2IJ0A 2KNBA 5D94A 3BZDB 1WXQA 3H8HA 3DVNV 3UGBB 4G50A 1V97A 2J0MA 4LNKA 2O6VA 1WJUA 4WJQA 1HTQA 3ZTCA 1UUPA 3N32A 3H7PB 1DGJA 2KWUB 3B1LX 4BAXA 1F2RI 1WX9A 1C1YB 1HA5A 4C7ZA 2HTHA 3GZNI 1QILA 1FNUA 1ISNA 1DYQA 1XT9B 1E6EB 3ZDMC 1BXTA 4BKSA 3BY4B 1X1MA 2EKIA 4L1BA 4G3XB 3IXSA 2KYWA 3A1QA 3EHVA 4AQ7A 1I7HA 1WRDB 2D3BA 5DPRA 1GNUA 2MBOA 2MQJA 4IC7B 2KTRA 2W54A 5BYRA 1JROA 5E6NA 4K81A 3AE7B 1WE7A 1STEA 4MEMA 2LZ6A 3BIID 3ABVB 1N63A 3OJ3A 3A4SC 3ENEA 2IY0B 1QOFA 1L0XB 3KUCB 1E0ZA 1TS2A 1HZ5A 2J52A 3QWZB 5KHQA 3CSFA 4CYEA 4HJKA 1JRPA 2JYTA 4TSSA 5EE9A 4FHKA 3Q8AA 1HE8A 2KMCA 1WYGA 2JVCA 1GUAB 1UD7A 2KKCA 4AJYB 3T9LA 1QOAA 2LGDA 3DHIC 3W1SA 4IM2A 3Q69A 2JXTA 4M8NA 2MW5A 4NQLB 1LM8B 1PGBA 4ZRKA 1WM3A 1MHXA 2FBWB 4X57B 3R2TA 2BF8B 4MGZE 4IG7B 2A4ZA 1JCKB 2WXPA 1D4BA 4XDDA 1CJEA 1NI2A 1LFDA 1SE2A 1U4AA 2O6VB 4DQOC 4A8XC 5TSSA 4YSYB 2EMSA 3LYYA 2KT7A 1DOYA 2KD0A 1E8YA 3ZW3A 2BBCA 2NBUA 1WGKA 4XWTA 3VRBB 2IGDA 3PZ8A 4MSQB 4MJSA 2SEBD 4IWPA 5LXHA 5AZHA 1VRAB 4S0RA 4MH8A 2RR9A 3PRMB 2VH2A 3CIRB 1UBIA 5JHAA 2N9LA 2IY1B 3A1QB 1L4ZB 4USAA 2QDFA 3L16A 4BOSC 2LFIA 2KTRB 2JWUA 2IDYA 3RD2A 2V0GA 3ZXRA 2R61A 1TS5A 2Y5PA 1N61A 1K8RB 3QQ8B 2KQ7A 3JYUA 5E6JA 3C0RB 4ZRPA 3JW0X 2L0TA 5BMHA 4GDKA 1WR1A 3PS6A 4LJOB 2DZJA 1VZ7A 2RGFA 2J0KA 2K6QA 1TKGA 3TSSA 2L8JA 1FD6A 3IVFA 3PTFC 2VH1A 1YIWA 1UBQA 3PHXB 5AEKB 1FXIA 5FR6A 2L76A 2VZKD 1J0GA 2DZIA 3FILA 1S3SG 4HDQA 1C3TA 1YD8U 1YN5A 3Q8FA 3TCAA 2J53A 3SFEB 2KLGA 2NPTA 4IM3A 4MT5A 1EWYC 3JVZX 1ESFA 4KX6B 2GOWA 2L1AA 3Q2AC 1TY2A 5C2TB 3AI5A 1Z2MA 3AULA 4NAWA 2E6XA 1AW7A 2QC8A 4LTUA 3MHZA 1YN4A 2GLSA 3DWMA 2K3UA 5C23A 3W5VB 3BYTB 4RGTA 4P7IA 2PE9A 3VH3B 4Q2JA 4RCOA 4MGKE 3PSEB 3RYTA 3DBLI 1V86A 1PGAA 2KFJA 4MJSB 2WDQB 3J9CA 1GG3A 1VJKA 2PMVA 4AS1A 4EKUA 3AE1B 4WQMA 4DK5A 2D10A 2CU1A 1IGCA 4FHJA 4XYCA 3I5JC 4A90A 2KWDA 2WXFA 3GOEA 3QX1A 2YLMA 3WANA 1WXAA 3GB1A 3PRPB 3VAWA 1WGGA 2KLCA 3VVWB 1V81A 2BS2B 3R66C 1KJTA 5IA7A 3MJWA 1RLFA 4GGQA 2C60A 5H8YE 2QIEB 1P98A 1IGDA 1QT9A 3V6EB 1I35A 4M01A 4GDKB 4FULA 5AUKA 2V3NA 4XC2A 2JQRB 3LB8C 1F1HA 1FEHA 1SB3C 3RN9C 1RAXA 2G3QB 4AWJA 1WJ6A 3KH0A 3B2FA 4HKZE 3DVGX 1E9MA 4GU2A 3FILB 4BBNF 1MHHE 1V5OA 1T5XD 3A9KB 1VR9A 1WJ4A 2Z8LA 2NPTB 5EDSA 2ZCCA 3H7SA 1XXGA 2WNMA 3V3XA 1H8CA 4HWIB 1WXMA 4FJVB 2EELA 3MTNB 2TSSA 2XNAC 3VTVA 4IDIA 1C9FA 1F2RC 4W9DA 4A20A 1KOTA 3WALA 5E6OA 5HKHA 2WXKA 4LNIA 4KGTA 1NYRA 3U8ZA 3FKYA 1TIFA 2INDC 1SJHD 2G45B 5G2NA 1FXTB 4ZYSA 2KJ6A 1WY8A 4PK1A 3WA0A 2CHWA 4ZRJA 5BO4B 2INCC 1SF0A 1HZ6A 3Q14C 4LCDE 2UU7A 4MM3A 4EZLA 4KDLB 1SGHA 3ZXVA 2L32A 3AE3B 1MG8A 5DPWA 3QCAA 3IAS1 5C3JB 4GMVA 4KGRA 1D6EC 2LGXA 2Z0DB 3S2AA 1M94A 3ZRCA 4ZOHC 2BTEA 2ZCBA 3NVYA 1OEYA 2AL6A 2KXJA 2DYMA 4LDTD 4WURA 1SIFA 1WI0A 3HIZA 3U52E 3OAWA 2NVUI 2Y5BB 3ZDTA 1MPEA 4K7SA 2JUOA 2DX5B 2RMMA 1JW9D 4IUMB 4DHJB 1FCLA 4DXGA 1ENFA 4HCPB 2NBWB 4IOIE 3ZIMA 4WJOA 2NR2A 3H6NA 4M0WA 4GLSC 1I4XA 1FRDA 4LK0M 4RM8A 1C78A 3N1XC 2XBBC 4M02A 2XEWA 1MVKA 3L17A 4RGOS 2LXCA 1RM6C 3KUDB 4KZ0A 3Q3JA 2IPKD 3ZNGC 2FCQA 4IWOA 2YVCA 3MHSD 4TQ0A 2D3AA 1JRUA 3SEBA 1P3QU 5JHBA 2UWQA 3VRAB 4FA6A 2JWZA 4F1SA 5L83A 4IWQA 2PJHA 4MGYE 3L4PA 4PS7A 4KZCA 3RNCC 2C5LC 2WDVB 5EE0A 3PT2B 3NJTA 3BVZA 4MM3B 1ZW7A 2PVGC 2WWZA 4IM0A 1A5RA 3FAHA 4J3OD 1V49A 5IOIA 4ZDVA 4B0MA 5CHWA 4RM9A 2WDRB 2W82A 1YNTE 4DXFA 1V2YA 4WAAA 2WXIA 1PUTA 3SD5A 2KACA 2L00B 1J8CA 3SR6A 2A5UA 3W1SC 2JRHA 1N62A 2BYFA 5D3IB 3KLSX 2N9KA 4RF1A 2KO3A 1WF9A 3PPAA 1LQBA 1Q0WB 3AH7A 4C56C 5IN7A 3MJ5A 1I4PA 4ANXA 1YJIA 5DPTA 2V3SA 2PIAA 1B1ZA 3N3KB 2MH7A 2MSED 3ZNHB 2OJRA 1IPGA 4M0WB 4LNNA 3RNGC 4ARIA 2JY6A 3OLMD 3DBRB 2K39A 3ZVVA 3R7QA 1KH0A 1UGJA 3CWIA 3V62A 2YEPB 2WXJA 2Z0EB 4BBNC 4PYZA 2K25A 1P7EA 5I4DA 2GBJA 2CJNA 1Q1OA 2DLBA 2L05A 4DWFA 1V5TA 4A3OA 2Y5CA 3RPFC 1TYGB 5GMVA 3FC4A 1SBBB 3BWUD 4JPSA 3E56A 3ZUNA 4BVUC 4N59A 1T0YA 5LXIB 2JRIB 3C8YA 4I6LB 4MDKE 4US9A 3PVLA 2BKRB 1WJNA 3TL5A 2C7NB 4TMAB 2FAZA 1F9JA 3GZNB 2D11A 4ICUA 3M3JA 2QILA 1VLBA 3NZ3A 4DDID 2DZMA 3QARA 1TZ1A 1J7CA 3W2DA 2INNE 2KX0A 1BT0A 2WXLA 2IO1B 1Q5WB 3TEWA 3DQVA 2MP2A 2YEPF 1PDXA 1ZPSA 1BUIC 3UI3A 1D5ZC 1D3ZA 4RNAA 2K6DB 1HEZE 1P7FA 2WX0A 4PYUA 2ZW1A 1I42A 1VCBA 2L52A 4E71A 4ZHOA 2KC1A 1L2NA 1WX7A 4W9LA 3R8BA 4FJYA 3RUIB 3MC0B 3WAOA 5DCNA 4AJWA 2WYQA 4S17A 1TJEA 3NUHB 1E8WA 3NOBA 4TUUA 1PQSA 1V9JA 1EUVB 1V80A 4HXDA 2N7JA 1UH6A 5BMGA 1FO4A 2K22A 2B3AA 2K5PA 1XLNA 2MHJA 4EZKA 4FJZA 1VDVA 2K9XA 4XGAB 2B76B 2LI5A 2PEAA 4JWUC 2BT6A 3AEDB 3EUB2 2FUHB 1ZUD2 4OW0A 1P0RA 1DOIA 3DHGC 1ET9A 2FCNA 4NJCA 5C1ZA 1J7AA 1YOVB 1VD2A 4K7WA 4FLHA 2L0FA 1GB4A 2MRPA 4US8A 4ANVA 1GAQB 2WLBA 3TEZA 1RRBA 3IT6B 2AL3A 4MSMB 3ZTDA 2LVOA 3Q3OC 4DXAB 2KQ4X 3DVNU 3V6CB 3AE9B 4ZYNA 1WGRA 3H1UA 2LVPA 2BS3B 4QAYA 4M00A 2KZRA 1ZE3D 3KYCD 2V4IB 1MJDA 1K51A 3N30A 3P2BA 2KVRA 2MP2B 2D3GA 2V9HA 1FIQA 1FPYA 2RPVA 3HHMA 1JWMD 1WSPA 4OZCA 4R3DA 1H4RA 1C76A 3U4EG 1WZ3A 2WX1A 2DZKA 2KDBA 1EF1A 3X23A 2CU3A 1QZEA 1ZDVA 2FCMA 4NJ6A 2LASA 4DBGA 2M1MA 3C19A 1L7YA 4HCNB 4ZRIA 4KV2A 1FNWA 2L83A 2SAKA 4HLEA 2K8CA 2HE7A 1C4CA 3R2IA 5HHDG 2OOBB 3A33B 3QJZA 4KKJA 4HK2A 2KC2A 3MFGA 1WWTA 4WQOB 3T8MA 1S1QB 4PS3A 1RYJA 3HUIA 3OWEB 3VR9B 4JL9A 5LNK1 3V60A 4RGMA 3BYYB 2QCZA 3PO0A 1WGDA 2AYOB 1WMHA 2GBMA 2CHZA 2DENB 3W9CB 3AU4A 2MBQA 1FRRA 3DDCB 2XK5A 2LUEA 2IBIB 3QAQA 3APFA 1YMHE 3IT4B 3RI7C 3MC9A 2C7MB 3NY5A 3DBLB 4NAMA 4ANWA 3IBEA 4RH6A 3AE2B 1HTOA 4A55A 1RFKA 3I9V1 2PTLA 5IAAC 3DCGA 2O2VA 5G55A 3RULA 4EZJA 3SU8X 5T8IA 2M19A 4WAFA 4L23A 4NY0A 4WWPA 2HJ8A 3O65B 3A4RA 5HI1A 4JGHB 1WX8A 2N9PC 2ASQA 4YTPB 3AE8B 3R3MA 1P1AA 2M17A 2M8SA 3ZNID 2D5GA 3NS1A 4MGIE 1DOXA 4KIKA 3JSVA 4XX5A 4ITKA 2PPHA 3RZFA 2BPSA 1OQYA 3L13A 4HPMB 3QHTA 2LEKA 3A9JA 2K0PA 3EGRA 4REZA 4DHZE 2EMTA 1WIAA 3ZKJC 2FE8A 2FIDA 1AYFA 2JPHA 3RNEC 2WP9B 1B9RA 1JMLA 5G5GA 4B6WA 4IW0A 4NAWB 3TJPA 2MCNB 3QK0A 2BYTA 5J17A 3PREA 1TTNA 4HKQA 4YTMB 4FBJB 3EFUA 2NBVB 2IO0B 2BWFA 4JLCA 2D07B 2MA9B 1KM7A 1WMHB 1FM0D 4GOCA 4G11A 4XE0A 5FR3A 1SXTA 2IGGA 2R2QA 3NVWA 3Q8CA 2AX5A 2KDFB 4B9KA 2KDIA 4N6EB 2WXQA 3TBLD 1RWSA 3AE4B 4BFRA 2KVZA 4W9FA 1WYWB 1TS4A 3PLUA 4OVVA 4A6QA 3T3OA 2RDGA 3IFWB 3AE5B 2QHOA 3VUYA 2RPQA 4JE3B 3BK2A 2O2VB 2V1YA 1KLUD 4O1NA 3N20C 2JZZA 4KVGB 4TQ1A 2WS3B 4JQWC 3RT3B 1V8CA 2IZVB 2L3ZA 3VXWA 3PLVA 3NHEB 2FCSA 3H9DA 3NVVA 2IGHA 4EUTA 5JXVA 2ZJDA 2DAJA 3V61A 2DBYA 3AEEB 1JALA 1WM2A 2LGSA 4YXDB 4WJNA 2HTME 5D2MB 2GMIC 1R4NI 3UIPB 3AM9A 1XLQA 1TZOA 4ANUA 3JSVB 1XLOA 4CO7A 4II2B 1FFVA 2IYDB 4XZ4A 1GC6A 4L2YA 4LNFA 3NG0A 2KANA 3A9JB 3VH4B 3AE6B 2H88B 1T3QA 2VZKB 1YN3A 2LGYA 2O6VD 2DWQA 2REXA 3HK0A 2KFKA 4HEA1 2JSVX 4CQNA 2K8HA 3N1YC 1YJJA 3ZLZA 2C7HA 5BYSA 3DOWA 1R7SA 2KQSA 1WRIA 4GIVA 2DAFA 2WXNA 2PLPA 2MBHA 3KUZA 4BKGA 1WH3A 4D2KA 2V4LA 5FK9C 3M63B 1C77A 1AARA 1LGRA 1XEEA 4BKSD 4DDGD 4M8MA 3NVZA 1L6VA 1YJ1A 4ZRQA 1J19A 4OZAA 3B9JA 2BQQA 2JZPA 2X38A 1PFDA 3KQ4A 4K1RB 2INPE 2PVOD 3HVDA 3KVFB 4WWMA 4MACA 1E10A 5CTRC 4YTNB 1FCCC 3AEGB 1E8ZA 4BZAA 1D5MC 1UWMA 2BB5A 3W5UB 3V05A 4C7YA 1K53A 3BK1A 4N9F4 2EKEC 1Y8RC 2BYEA 3DPDA 1HXYD 2MBBB 3UQBA 1SIJA 3ZJUA 1ZKHA 2FUG1 3W1YA 1N5WA 2GBKA 1FNVA 3ZYYX 4EE2A 1GPXA 1XCTL 1ACCA 4YSXB 3K9OB 3OG5A 5E6PA 1J7BA 3N1ZC 1UWXA 5CHVC 2KX3A 2M0XA 2QMTA 4HDOA 2AEHA 4NZLB 1I4GA 1NBFC 2PW9A 2WXMA 1R4MI 4WIPA 3L0WB 2MEKA 4MH0E 3UQAA 2AQ3B 3DWGC 2JT4B 1KLVA 2KFKB 2KOXA 2HDEA 3CMMB 3DBSA 4K3BA 3AN1A 4OVZA 1R4MB 1F0ZA 2GBNA 1F77A 2AQ2B 4XDCA 2IO3B 3E9SA 1CMXB 3R7RA 3TIXA 2OEDA 1QOBA 3VFKA 1T0SC 4ZHPA 2XN9C 2GB1A 1IBXA 1JWBD 1N5XA 1E8XA 1M4VA 2GRIA 4H2AA 3P4QB 2KHWB 2V3PA 1TKYA 4RFBA 4I6PA 2BW2A 4W9HA 3HRDD 3U2SC 3RCZA 4TKNA 2J42A 2KWCA 5CHFA 1XD3B 5JZEB 3TEYA 3AU5A 4II3B 5BYQA 1EO6A 3RMKC 5FKAC 2WU2B 1WR6E 1L5PA 1SE3A 4ICVA 2ICIA 3DBHI 5BMIA 3N9YC 3RNBC 4GB9A 4KSLC 3U7DA 2MJ3A 2AWTA 4W9CA 1Y56A 1IUEA 1AWDA 4C80A 1QF6A 2MBEA 3DBHB 3EFCA 4LDTB 4DHZB 4A9AA 1GOZA 1N6ZA 2J7QB 4C4VA 2NMQA 2Q5WD 1T0RC 2JXXA 2OJWA 4YSZB 4E74A 2H89B 5DPSA 1SEBD 2LXAA 3P4PB 1WE6A 1E7VA 3ML8A 1Q10A 3WAMA 3VTUA 2X8XX 1T6BX 1UZXB 2ZVNA 5EE1A 1F52A 2KJRA 3UIOB 3P63A 4NQKE 3SDLC 1Z5SB 3ZGZA 3KW5B 4NJ7A 2ONQA 3Q6BA 1EF5A 2LGIA 2N4FA 2KMMA 2N7DA 5CX3A 1FFUA 3L08A 3LJ3A 3CSTA 4HPPA 4BOZB 3OJ4B 4PT5A 3ML9A 1IBXB 4YT0B 3AECB 4W9JA 2NTTA 1WFYA 5D7GA 4TV3A 3I3TB 4ASWC 2I1JA 3Q3MC 2WQYB 1NVID 3ZNZB 2DYBA 1CK1A 2MLBA 5EE3A 3TMPB 3ZO5B 1LXDA 5KHOA 3AEAB 2ZEQA 4E3CA 1YX6B 2AQ1B 1OFFA 3HM6X 4AUQC 1HQRD 2ZNVB 1FMAD 4W9EA 2K1FA 3L10B 2Y3AA 3EC8A 3MP9A 2KDMA 3IHPC 3VUWA 3P42A 2CHXA 5AZFA 3KWLA 3NZUA 4HJGE 1ET6A 3Q3FA 2KJHB 1NEKB 2UYZB 2LRWA 3SHQA 4F7ZA 3BINA 2PKOA 4HROA 2J0JA 4DHJD 3GE8C 1L6UA 5IP4D 1V6EA 2LVQA 4FN2A 3AB5A 2C9WB 4LNOA 2E3TA 2W55A 1YQBA 3IG3A 5IO9A 1XF5L 1N60A 4C4VB 2NCNA 2ZPNA 3HVZA 2KAJA 2LWPA 2N1VA 3O13A 3GP7A 2HD5B 1YQ3B 2LRUA 4FADA 2I1KA 5HFYA 1P9DU 3ZQ4A 1UELA 3APCA 3QA8A 3RNAC 4OVUA 2WDTB 1E5WA 4EOYA 3A9KA 1GC7A 2N1WA 2JU6X 2RSUA 2BVCA 2RD0A 2D3CA 1TY0A 5H92C 3LXFA 1ZGUB 2CKHB 2WHIA 2JYEA 4GXBA 2GBRA 1UGMA 2M4NA 3TEXA 3NS8A 3PGEA 3Q8EA 2OHFA 1JWAD 1KRHA 2LHDA 2R2OA 1EU4A 1D5XC 5G5HA 2MX2A 1WXSA 5LLIA 2LUMA 4YL8A 2WXGA 3RNFC 4W9KA 2LJIA 3EA6A 4A3PA 4GSWA 1YX5B 4P1BC 1KLGD 1GJZA 1RFAA 4YWGG 2CS4A 3KWVA 3UINB 4ACFA 1WXVA 2DYOA 1E7PB 2ZPYA 1C4AA 3DVGY 4HRSA 1OGWA 1KF6B 4WWNA 3PHWB 3ZJTA 1WGHA 5IKCM 4B95A 1JQ4A 3QIJA 1L0VB 3RFZB 4KSKC 2BKFA 4RF0A 2ZVOA 3B08A 4ARCA 2Z59B 3Q3NC 1YQ4B 3SFDB 1UF0A 1UNSA 4KKIA 2WXOA 2DNFA 4G0NB 1SJED 2KN5A 2LJ5A 1E7UA 3GE3C 4GN1A 3PRZA 2QEJC 2QJLA 1PGXA 2ON8A 3U30A 3ZJVA 4EFOA 3MC8A 2GI9A 1TS3A 3B0AA 2KK8A 3P4RB 4I6NB 3QC8B 4HPLB 1WZ0A 3ETRA 4EEWA 3B2GA 2G9HD 2NS5A 3ALBA 1JWUD 1OTRB 3M95A 3ONSA 1IP9A 4OHJA 1TBEA 1QKZA 4JX1C 1V1PA 3HM3A 2N0SB 5J2RA 1I4HA 1LO5D 4K7UA 3APDA 1CQVA 1V1OA 2PE6B 4NNJB 2BGFA 1NI3A 1C79A 1A70A 4KDIC 3U7ZA 1KTKA 1BMLC 4NPNA 3IAM1 2XK5B 4WWOA 3ECIA 4AOFA 1TT5B 4KGSA 4PS8A 2DHZA 4JWSC 5GXGB 3AXCA 3WAPA 2JZ3B 2N7EA 1ZOYB 1ZP0B 4LJPB 2M56B 5HG2A 3URYA 2LD9A 4RGNA 1OQQA 1L4DB 2I2YA 4BKTA 1NYQA 1SE4A 4HVBA 3WCQA 1ZXHA 3VQIA 2K8BA 5AUIA 2IO2B 3I63C 5D3DA 2L7RA 1MFWA 1XLPA
chains in the Genus database with same CATH topology
3PSEB 2B3AA 3RYTA 3DBLI 5CHVC 1V86A 4GDLA 2KFJA 2KX3A 4RMAA 3L54A 4EZKA 2M0XA 4MJSB 1G6JA 4FJZA 2BYVE 3PV1A 2LI5A 1GG3A 2PEAA 4HDOA 5L95C 2AEHA 4EKUA 2FUHB 1NBFC 1P0RA 1R4MI 3VDZA 2D10A 4DK5A 1E90A 3ZRFA 2CU1A 3KYDD 4FHJA 2KTFA 2G4SA 3L0WB 4MH0E 3UQAA 2FCNA 3GOEA 5C1ZA 3VUXA 1NDDA 4WJPA 2JT4B 3QX1A 2YLMA 3WANA 2JF5A 1KLVA 1VD2A 2KFKB 1WXAA 4KIKB 4K7WA 2KOXA 3CMMB 3DBSA 4FLHA 3PRPB 3VAWA 1WGGA 3NZSA 2KLCA 3VVWB 1V81A 2L0FA 3R66C 4JIOU 1KJTA 2MRPA 4ANVA 5IA7A 2GBNA 3MJWA 1RLFA 1RRBA 2C60A 2IO3B 4GGQA 4J6IA 1IYFA 2AL3A 1CMXB 4MSMB 1P98A 3ZTDA 2LVOA 5D6JB 3R7RA 4DXAB 1I35A 3TIXA 3V6EB 3VFKA 3DVNU 4GDKB 1SE9A 4FULA 3V6CB 4XC2A 4ZYNA 1E8XA 1WGRA 3H1UA 2LVPA 1OEYJ 3CF6E 5TR5A 3RZWC 2KZRA 3KYCD 1RAXA 2G3QB 2KHWB 4AWJA 4I6PA 1WJ6A 3KH0A 2FNJB 3N30A 4W9HA 3VTWA 4CHKA 3P2BA 2KVRA 2MP2B 3DVGX 2D3GA 4GU2A 3RCZA 3HHMA 4TKNA 2KMAA 2G4DB 2KWCA 4BBNF 5CHFA 1XD3B 1V5OA 3D32A 5JZEB 1H4RA 3A9KB 2MWSB 3AU5A 1WJ4A 1WZ3A 4II3B 2WX1A 3H7PA 2ZNVC 2DZKA 2KDBA 2NPTB 1EO6A 5EDSA 2ZCCA 1EF1A 3H7SA 3X23A 2KDEB 1WR6E 1H8CA 4HWIB 1WXMA 4ICVA 1QZEA 2KWVB 4FJVB 5JH5C 2W9NA 3MTNB 5AZGA 2FCMA 3DBHI 4NJ6A 2LASA 3VTVA 4DBGA 1TGZB 2M1MA 4GB9A 4KSLC 1L7YA 4HCNB 3U7DA 2CR5A 4ZRIA 4W9DA 4URKA 4A20A 4W9CA 2AWTA 4W9IA 4KV2A 1KOTA 3WALA 2FIFA 5E6OA 3VHTC 4HLEA 2D2QA 5HKHA 2K8CA 2HE7A 3U8ZA 2OOBB 3A33B 3QJZA 1WGYA 2MBEA 4HK2A 4LDTB 4DHZB 2G45B 5G2NA 1FXTB 2KC2A 2KJ6A 3X0WA 1WY8A 3WA0A 2N9XA 4GDLB 4WQOB 3T8MA 1S1QB 2CHWA 2J7QB 4PS3A 4ZRJA 5BO4B 2JXXA 4LCDE 4E74A 5DPSA 4JL9A 2LXAA 3LDZE 4MM3A 3V60A 1WE6A 1E7VA 3ML8A 3WAMA 2N9EB 4EZLA 3VTUA 1WGDA 1SGHA 4KDLB 1UZXB 2VRRB 2ZVNA 2AYOB 1WMHA 2KJRA 2GBMA 3K9PB 2CHZA 2DENB 3UIOB 5DPWA 1MG8A 4NQKE 3QCAA 4W9GA 3AU4A 2MBQA 3SDLC 1Z5SB 4GMVA 3DDCB 2XK5A 2LUEA 3KW5B 2LGXA 2Z0DB 3S2AA 2IBIB 1M94A 3QAQA 4NJ7A 3APFA 3EECA 5J18A 3UF8A 1EF5A 3DBRI 3ZRCA 2N4FA 4AP4C 2N7DA 2C7MB 2ZCBA 1OEYA 2AL6A 2KXJA 2DYMA 3L08A 3LJ3A 3NY5A 3CSTA 4LDTD 5CX3A 4BOZB 1SIFA 4F8CB 3PZDA 3OJ4B 4ANWA 3IBEA 1WI0A 3HIZA 3ML9A 3OAWA 2NVUI 3WIMA 1XQQA 2Y5BB 4W9JA 1WFYA 5D7GA 4TV3A 3ZDTA 3I3TB 4ASWC 4MELA 2I1JA 2ZZPB 2BWES 4K7SA 2JUOA 2DX5B 3M62B 3DCGA 5IAAC 2O2VA 5G55A 3RULA 3ZNZB 4EZJA 2DYBA 2KNBA 4IUMB 5D94A 2MLBA 4DHJB 3SU8X 3TMPB 3DVNV 4HCPB 3UGBB 3ZO5B 4G50A 2NBWB 1LXDA 2J0MA 4NY0A 4WWPA 2HJ8A 4WJOA 3ZIMA 2NR2A 5KHOA 3H6NA 2O6VA 1WJUA 2ZEQA 3O65B 4WJQA 3ZTCA 4E3CA 1YX6B 4RM8A 3A4RA 4JGHB 1WX8A 3HM6X 3N32A 3H7PB 3B1LX 2KWUB 2N9PC 2ASQA 2XBBC 4AUQC 2XEWA 3R3MA 2ZNVB 1P1AA 4W9EA 1WX9A 1C1YB 2K1FA 3L10B 3L17A 3EC8A 2M17A 3IHPC 2M8SA 3VUWA 2HTHA 2CHXA 2LXCA 3GZNI 3KUDB 4MGIE 5AZFA 3ZNID 4KZ0A 4KIKA 3Q3JA 3JSVA 3ZNGC 4XX5A 1ISNA 2FCQA 4IWOA 2YVCA 3MHSD 4TQ0A 3NZUA 2PPHA 3Q3FA 2KJHB 1XT9B 1JRUA 2LRWA 2UYZB 3ZDMC 3BY4B 3SHQA 3RZFA 4BKSA 2BPSA 4F7ZA 1P3QU 1X1MA 1OQYA 3BINA 3L13A 4G3XB 2J0JA 3QHTA 3A9JA 4HPMB 4DHJD 5JHBA 2UWQA 4DHZE 3A1QA 3EHVA 2EMTA 1WIAA 1V6EA 4FA6A 1WRDB 2LVQA 4FN2A 3ZKJC 2C9WB 2JWZA 5DPRA 4F1SA 2FIDA 2JPHA 1GNUA 2MBOA 2MQJA 4IC7B 2KTRA 1YQBA 5L83A 4IWQA 2PJHA 3IG3A 4MGYE 4B6WA 4IW0A 4NAWB 4PS7A 4KZCA 2MCNB 3TJPA 3QK0A 5E6NA 4K81A 5J17A 2NCNA 2ZPNA 3PREA 2C5LC 1WE7A 2LWPA 2N1VA 3PT2B 4MEMA 1TTNA 4FBJB 2LZ6A 1ZW7A 2HD5B 2WWZA 3EFUA 2NBVB 2IO0B 4IM0A 1A5RA 3OJ3A 2BWFA 3A4SC 2D07B 2LRUA 3ENEA 4JLCA 4FADA 2MA9B 2IY0B 1V49A 2I1KA 1P9DU 4ZDVA 1KM7A 1WMHB 4GOCA 3KUCB 4G11A 1UELA 5CHWA 4RM9A 3APCA 3QA8A 4OVUA 2WDTB 1E5WA 3QWZB 5KHQA 2R2QA 4EOYA 3CSFA 4CYEA 3A9KA 1GC7A 4HJKA 2N1WA 1V2YA 2RSUA 2KDFB 4B9KA 2RD0A 4WAAA 4FHKA 2KDIA 3SD5A 1ZGUB 2CKHB 1HE8A 2KMCA 2L00B 3TBLD 4BFRA 1J8CA 2JVCA 1GUAB 1UD7A 4GXBA 2KKCA 2A5UA 4AJYB 3W1SC 3T9LA 2GBRA 2JRHA 4W9FA 1UGMA 1WYWB 2M4NA 2BYFA 3PLUA 4OVVA 2LGDA 3NS8A 3PGEA 3W1SA 4IM2A 2KO3A 2R2OA 3IFWB 1WF9A 3PPAA 1LQBA 1Q0WB 4M8NA 2MW5A 4NQLB 1LM8B 2MX2A 4ZRKA 2QHOA 1WM3A 3VUYA 2RPQA 1WXSA 5LLIA 4X57B 4YL8A 2O2VB 2V1YA 4ANXA 2BF8B 5DPTA 4MGZE 2V3SA 4IG7B 3N3KB 4W9KA 2JZZA 2MSED 2A4ZA 4A3PA 4KVGB 3ZNHB 4TQ1A 4GSWA 1YX5B 1GJZA 1RFAA 4JQWC 2OJRA 3RT3B 1NI2A 1LFDA 1IPGA 1U4AA 2O6VB 4M0WB 2CS4A 2IZVB 2L3ZA 3VXWA 3PLVA 3NHEB 3UINB 2FCSA 2JY6A 3H9DA 1WXVA 3OLMD 2DYOA 4EUTA 2K39A 2ZJDA 2DAJA 2ZPYA 3V61A 2EMSA 3DVGY 2KD0A 1WM2A 3ZVVA 3R7QA 1OGWA 4WWNA 3PHWB 1E8YA 3ZW3A 4WJNA 2NBUA 1WGHA 3V62A 4B95A 2Z0EB 5D2MB 2GMIC 4BBNC 4PYZA 1R4NI 2K25A 3QIJA 3UIPB 4KSKC 2BKFA 4ANUA 3JSVB 2GBJA 4MSQB 4MJSA 2ZVOA 3B08A 2Z59B 4CO7A 1Q1OA 4IWPA 4DWFA 2L05A 1V5TA 4II2B 5AZHA 4A3OA 5LXHA 2IYDB 2RR9A 1GC6A 4XZ4A 3PRMB 5GMVA 2KANA 3A9JB 1UBIA 5JHAA 4G0NB 2IY1B 3VH4B 3A1QB 2KN5A 2LJ5A 3ZUNA 3L16A 4BVUC 1E7UA 4BOSC 2LGYA 1T0YA 2O6VD 5LXIB 2REXA 2KTRB 2KFKA 3HK0A 4GN1A 2JRIB 3PRZA 3RD2A 2K8HA 3U30A 4I6LB 4MDKE 3PVLA 2BKRB 3ZLZA 2C7HA 3DOWA 1K8RB 1WJNA 3QQ8B 4EFOA 2KQ7A 3JYUA 3TL5A 2C7NB 2KQSA 3C0RB 3B0AA 2FAZA 2KK8A 3JW0X 1F9JA 2D11A 2L0TA 4GIVA 4ICUA 3M3JA 2DAFA 4GDKA 4I6NB 3QC8B 4HPLB 1WR1A 2MBHA 1WZ0A 3KUZA 3PS6A 1WH3A 4BKGA 4DDID 4EEWA 2V4LA 3M63B 4LJOB 2DZMA 3QARA 2NS5A 1TZ1A 3ALBA 1OTRB 3M95A 1AARA 3ONSA 2DZJA 1IP9A 2KX0A 1TBEA 1BT0A 4BKSD 2RGFA 2J0KA 2IO1B 3HM3A 5J2RA 4DDGD 4M8MA 2K6QA 1YJ1A 1Q5WB 4K7UA 3DQVA 3APDA 1J19A 2L8JA 3IVFA 2MP2A 2PE6B 1YIWA 3PTFC 4NNJB 2BGFA 1UBQA 3PHXB 5AEKB 5FR6A 2L76A 1J0GA 2DZIA 4K1RB 3KVFB 1S3SG 4KDIC 1D3ZA 2K6DB 4HDQA 5CTRC 1C3TA 1YD8U 2WX0A 4PYUA 1E8ZA 1I42A 4NPNA 1VCBA 4E71A 1L2NA 2KC1A 3TCAA 2XK5B 4WWOA 1WX7A 4W9LA 3ECIA 2KLGA 4AOFA 2NPTA 4PS8A 4FJYA 4IM3A 2DHZA 3RUIB 3JVZX 3AXCA 4N9F4 2EKEC 3WAPA 1Y8RC 2BYEA 2JZ3B 2N7EA 5DCNA 3WAOA 2WYQA 3DPDA 4AJWA 4LJPB 2GOWA 1E8WA 3NOBA 2MBBB 4TUUA 3UQBA 1PQSA 1Z2MA 3AI5A 1V9JA 1EUVB 3AULA 4NAWA 2LD9A 1ZKHA 1V80A 4BKTA 4HXDA 4HVBA 3W1YA 3VQIA 2GBKA 2K8BA 5C23A 1UH6A 2IO2B 4P7IA 2PE9A 3VH3B 3K9OB 2L7RA 5E6PA 4MGKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSE B;  2B3A A;  3RYT A;  3DBL I;  5CHV C;  1V86 A;  4GDL A;  2KFJ A;  2KX3 A;  4RMA A;  3L54 A;  4EZK A;  2M0X A;  4MJS B;  1G6J A;  4FJZ A;  2BYV E;  3PV1 A;  2LI5 A;  1GG3 A;  2PEA A;  4HDO A;  5L95 C;  2AEH A;  4EKU A;  2FUH B;  1NBF C;  1P0R A;  1R4M I;  3VDZ A;  2D10 A;  4DK5 A;  1E90 A;  3ZRF A;  2CU1 A;  3KYD D;  4FHJ A;  2KTF A;  2G4S A;  3L0W B;  4MH0 E;  3UQA A;  2FCN A;  3GOE A;  5C1Z A;  3VUX A;  1NDD A;  4WJP A;  2JT4 B;  3QX1 A;  2YLM A;  3WAN A;  2JF5 A;  1KLV A;  1VD2 A;  2KFK B;  1WXA A;  4KIK B;  4K7W A;  2KOX A;  3CMM B;  3DBS A;  4FLH A;  3PRP B;  3VAW A;  1WGG A;  3NZS A;  2KLC A;  3VVW B;  1V81 A;  2L0F A;  3R66 C;  4JIO U;  1KJT A;  2MRP A;  4ANV A;  5IA7 A;  2GBN A;  3MJW A;  1RLF A;  1RRB A;  2C60 A;  2IO3 B;  4GGQ A;  4J6I A;  1IYF A;  2AL3 A;  1CMX B;  4MSM B;  1P98 A;  3ZTD A;  2LVO A;  5D6J B;  3R7R A;  4DXA B;  1I35 A;  3TIX A;  3V6E B;  3VFK A;  3DVN U;  4GDK B;  1SE9 A;  4FUL A;  3V6C B;  4XC2 A;  4ZYN A;  1E8X A;  1WGR A;  3H1U A;  2LVP A;  1OEY J;  3CF6 E;  5TR5 A;  3RZW C;  2KZR A;  3KYC D;  1RAX A;  2G3Q B;  2KHW B;  4AWJ A;  4I6P A;  1WJ6 A;  3KH0 A;  2FNJ B;  3N30 A;  4W9H A;  3VTW A;  4CHK A;  3P2B A;  2KVR A;  2MP2 B;  3DVG X;  2D3G A;  4GU2 A;  3RCZ A;  3HHM A;  4TKN A;  2KMA A;  2G4D B;  2KWC A;  4BBN F;  5CHF A;  1XD3 B;  1V5O A;  3D32 A;  5JZE B;  1H4R A;  3A9K B;  2MWS B;  3AU5 A;  1WJ4 A;  1WZ3 A;  4II3 B;  2WX1 A;  3H7P A;  2ZNV C;  2DZK A;  2KDB A;  2NPT B;  1EO6 A;  5EDS A;  2ZCC A;  1EF1 A;  3H7S A;  3X23 A;  2KDE B;  1WR6 E;  1H8C A;  4HWI B;  1WXM A;  4ICV A;  1QZE A;  2KWV B;  4FJV B;  5JH5 C;  2W9N A;  3MTN B;  5AZG A;  2FCM A;  3DBH I;  4NJ6 A;  2LAS A;  3VTV A;  4DBG A;  1TGZ B;  2M1M A;  4GB9 A;  4KSL C;  1L7Y A;  4HCN B;  3U7D A;  2CR5 A;  4ZRI A;  4W9D A;  4URK A;  4A20 A;  4W9C A;  2AWT A;  4W9I A;  4KV2 A;  1KOT A;  3WAL A;  2FIF A;  5E6O A;  3VHT C;  4HLE A;  2D2Q A;  5HKH A;  2K8C A;  2HE7 A;  3U8Z A;  2OOB B;  3A33 B;  3QJZ A;  1WGY A;  2MBE A;  4HK2 A;  4LDT B;  4DHZ B;  2G45 B;  5G2N A;  1FXT B;  2KC2 A;  2KJ6 A;  3X0W A;  1WY8 A;  3WA0 A;  2N9X A;  4GDL B;  4WQO B;  3T8M A;  1S1Q B;  2CHW A;  2J7Q B;  4PS3 A;  4ZRJ A;  5BO4 B;  2JXX A;  4LCD E;  4E74 A;  5DPS A;  4JL9 A;  2LXA A;  3LDZ E;  4MM3 A;  3V60 A;  1WE6 A;  1E7V A;  3ML8 A;  3WAM A;  2N9E B;  4EZL A;  3VTU A;  1WGD A;  1SGH A;  4KDL B;  1UZX B;  2VRR B;  2ZVN A;  2AYO B;  1WMH A;  2KJR A;  2GBM A;  3K9P B;  2CHZ A;  2DEN B;  3UIO B;  5DPW A;  1MG8 A;  4NQK E;  3QCA A;  4W9G A;  3AU4 A;  2MBQ A;  3SDL C;  1Z5S B;  4GMV A;  3DDC B;  2XK5 A;  2LUE A;  3KW5 B;  2LGX A;  2Z0D B;  3S2A A;  2IBI B;  1M94 A;  3QAQ A;  4NJ7 A;  3APF A;  3EEC A;  5J18 A;  3UF8 A;  1EF5 A;  3DBR I;  3ZRC A;  2N4F A;  4AP4 C;  2N7D A;  2C7M B;  2ZCB A;  1OEY A;  2AL6 A;  2KXJ A;  2DYM A;  3L08 A;  3LJ3 A;  3NY5 A;  3CST A;  4LDT D;  5CX3 A;  4BOZ B;  1SIF A;  4F8C B;  3PZD A;  3OJ4 B;  4ANW A;  3IBE A;  1WI0 A;  3HIZ A;  3ML9 A;  3OAW A;  2NVU I;  3WIM A;  1XQQ A;  2Y5B B;  4W9J A;  1WFY A;  5D7G A;  4TV3 A;  3ZDT A;  3I3T B;  4ASW C;  4MEL A;  2I1J A;  2ZZP B;  2BWE S;  4K7S A;  2JUO A;  2DX5 B;  3M62 B;  3DCG A;  5IAA C;  2O2V A;  5G55 A;  3RUL A;  3ZNZ B;  4EZJ A;  2DYB A;  2KNB A;  4IUM B;  5D94 A;  2MLB A;  4DHJ B;  3SU8 X;  3TMP B;  3DVN V;  4HCP B;  3UGB B;  3ZO5 B;  4G50 A;  2NBW B;  1LXD A;  2J0M A;  4NY0 A;  4WWP A;  2HJ8 A;  4WJO A;  3ZIM A;  2NR2 A;  5KHO A;  3H6N A;  2O6V A;  1WJU A;  2ZEQ A;  3O65 B;  4WJQ A;  3ZTC A;  4E3C A;  1YX6 B;  4RM8 A;  3A4R A;  4JGH B;  1WX8 A;  3HM6 X;  3N32 A;  3H7P B;  3B1L X;  2KWU B;  2N9P C;  2ASQ A;  2XBB C;  4AUQ C;  2XEW A;  3R3M A;  2ZNV B;  1P1A A;  4W9E A;  1WX9 A;  1C1Y B;  2K1F A;  3L10 B;  3L17 A;  3EC8 A;  2M17 A;  3IHP C;  2M8S A;  3VUW A;  2HTH A;  2CHX A;  2LXC A;  3GZN I;  3KUD B;  4MGI E;  5AZF A;  3ZNI D;  4KZ0 A;  4KIK A;  3Q3J A;  3JSV A;  3ZNG C;  4XX5 A;  1ISN A;  2FCQ A;  4IWO A;  2YVC A;  3MHS D;  4TQ0 A;  3NZU A;  2PPH A;  3Q3F A;  2KJH B;  1XT9 B;  1JRU A;  2LRW A;  2UYZ B;  3ZDM C;  3BY4 B;  3SHQ A;  3RZF A;  4BKS A;  2BPS A;  4F7Z A;  1P3Q U;  1X1M A;  1OQY A;  3BIN A;  3L13 A;  4G3X B;  2J0J A;  3QHT A;  3A9J A;  4HPM B;  4DHJ D;  5JHB A;  2UWQ A;  4DHZ E;  3A1Q A;  3EHV A;  2EMT A;  1WIA A;  1V6E A;  4FA6 A;  1WRD B;  2LVQ A;  4FN2 A;  3ZKJ C;  2C9W B;  2JWZ A;  5DPR A;  4F1S A;  2FID A;  2JPH A;  1GNU A;  2MBO A;  2MQJ A;  4IC7 B;  2KTR A;  1YQB A;  5L83 A;  4IWQ A;  2PJH A;  3IG3 A;  4MGY E;  4B6W A;  4IW0 A;  4NAW B;  4PS7 A;  4KZC A;  2MCN B;  3TJP A;  3QK0 A;  5E6N A;  4K81 A;  5J17 A;  2NCN A;  2ZPN A;  3PRE A;  2C5L C;  1WE7 A;  2LWP A;  2N1V A;  3PT2 B;  4MEM A;  1TTN A;  4FBJ B;  2LZ6 A;  1ZW7 A;  2HD5 B;  2WWZ A;  3EFU A;  2NBV B;  2IO0 B;  4IM0 A;  1A5R A;  3OJ3 A;  2BWF A;  3A4S C;  2D07 B;  2LRU A;  3ENE A;  4JLC A;  4FAD A;  2MA9 B;  2IY0 B;  1V49 A;  2I1K A;  1P9D U;  4ZDV A;  1KM7 A;  1WMH B;  4GOC A;  3KUC B;  4G11 A;  1UEL A;  5CHW A;  4RM9 A;  3APC A;  3QA8 A;  4OVU A;  2WDT B;  1E5W A;  3QWZ B;  5KHQ A;  2R2Q A;  4EOY A;  3CSF A;  4CYE A;  3A9K A;  1GC7 A;  4HJK A;  2N1W A;  1V2Y A;  2RSU A;  2KDF B;  4B9K A;  2RD0 A;  4WAA A;  4FHK A;  2KDI A;  3SD5 A;  1ZGU B;  2CKH B;  1HE8 A;  2KMC A;  2L00 B;  3TBL D;  4BFR A;  1J8C A;  2JVC A;  1GUA B;  1UD7 A;  4GXB A;  2KKC A;  2A5U A;  4AJY B;  3W1S C;  3T9L A;  2GBR A;  2JRH A;  4W9F A;  1UGM A;  1WYW B;  2M4N A;  2BYF A;  3PLU A;  4OVV A;  2LGD A;  3NS8 A;  3PGE A;  3W1S A;  4IM2 A;  2KO3 A;  2R2O A;  3IFW B;  1WF9 A;  3PPA A;  1LQB A;  1Q0W B;  4M8N A;  2MW5 A;  4NQL B;  1LM8 B;  2MX2 A;  4ZRK A;  2QHO A;  1WM3 A;  3VUY A;  2RPQ A;  1WXS A;  5LLI A;  4X57 B;  4YL8 A;  2O2V B;  2V1Y A;  4ANX A;  2BF8 B;  5DPT A;  4MGZ E;  2V3S A;  4IG7 B;  3N3K B;  4W9K A;  2JZZ A;  2MSE D;  2A4Z A;  4A3P A;  4KVG B;  3ZNH B;  4TQ1 A;  4GSW A;  1YX5 B;  1GJZ A;  1RFA A;  4JQW C;  2OJR A;  3RT3 B;  1NI2 A;  1LFD A;  1IPG A;  1U4A A;  2O6V B;  4M0W B;  2CS4 A;  2IZV B;  2L3Z A;  3VXW A;  3PLV A;  3NHE B;  3UIN B;  2FCS A;  2JY6 A;  3H9D A;  1WXV A;  3OLM D;  2DYO A;  4EUT A;  2K39 A;  2ZJD A;  2DAJ A;  2ZPY A;  3V61 A;  2EMS A;  3DVG Y;  2KD0 A;  1WM2 A;  3ZVV A;  3R7Q A;  1OGW A;  4WWN A;  3PHW B;  1E8Y A;  3ZW3 A;  4WJN A;  2NBU A;  1WGH A;  3V62 A;  4B95 A;  2Z0E B;  5D2M B;  2GMI C;  4BBN C;  4PYZ A;  1R4N I;  2K25 A;  3QIJ A;  3UIP B;  4KSK C;  2BKF A;  4ANU A;  3JSV B;  2GBJ A;  4MSQ B;  4MJS A;  2ZVO A;  3B08 A;  2Z59 B;  4CO7 A;  1Q1O A;  4IWP A;  4DWF A;  2L05 A;  1V5T A;  4II2 B;  5AZH A;  4A3O A;  5LXH A;  2IYD B;  2RR9 A;  1GC6 A;  4XZ4 A;  3PRM B;  5GMV A;  2KAN A;  3A9J B;  1UBI A;  5JHA A;  4G0N B;  2IY1 B;  3VH4 B;  3A1Q B;  2KN5 A;  2LJ5 A;  3ZUN A;  3L16 A;  4BVU C;  1E7U A;  4BOS C;  2LGY A;  1T0Y A;  2O6V D;  5LXI B;  2REX A;  2KTR B;  2KFK A;  3HK0 A;  4GN1 A;  2JRI B;  3PRZ A;  3RD2 A;  2K8H A;  3U30 A;  4I6L B;  4MDK E;  3PVL A;  2BKR B;  3ZLZ A;  2C7H A;  3DOW A;  1K8R B;  1WJN A;  3QQ8 B;  4EFO A;  2KQ7 A;  3JYU A;  3TL5 A;  2C7N B;  2KQS A;  3C0R B;  3B0A A;  2FAZ A;  2KK8 A;  3JW0 X;  1F9J A;  2D11 A;  2L0T A;  4GIV A;  4ICU A;  3M3J A;  2DAF A;  4GDK A;  4I6N B;  3QC8 B;  4HPL B;  1WR1 A;  2MBH A;  1WZ0 A;  3KUZ A;  3PS6 A;  1WH3 A;  4BKG A;  4DDI D;  4EEW A;  2V4L A;  3M63 B;  4LJO B;  2DZM A;  3QAR A;  2NS5 A;  1TZ1 A;  3ALB A;  1OTR B;  3M95 A;  1AAR A;  3ONS A;  2DZJ A;  1IP9 A;  2KX0 A;  1TBE A;  1BT0 A;  4BKS D;  2RGF A;  2J0K A;  2IO1 B;  3HM3 A;  5J2R A;  4DDG D;  4M8M A;  2K6Q A;  1YJ1 A;  1Q5W B;  4K7U A;  3DQV A;  3APD A;  1J19 A;  2L8J A;  3IVF A;  2MP2 A;  2PE6 B;  1YIW A;  3PTF C;  4NNJ B;  2BGF A;  1UBQ A;  3PHX B;  5AEK B;  5FR6 A;  2L76 A;  1J0G A;  2DZI A;  4K1R B;  3KVF B;  1S3S G;  4KDI C;  1D3Z A;  2K6D B;  4HDQ A;  5CTR C;  1C3T A;  1YD8 U;  2WX0 A;  4PYU A;  1E8Z A;  1I42 A;  4NPN A;  1VCB A;  4E71 A;  1L2N A;  2KC1 A;  3TCA A;  2XK5 B;  4WWO A;  1WX7 A;  4W9L A;  3ECI A;  2KLG A;  4AOF A;  2NPT A;  4PS8 A;  4FJY A;  4IM3 A;  2DHZ A;  3RUI B;  3JVZ X;  3AXC A;  4N9F 4;  2EKE C;  3WAP A;  1Y8R C;  2BYE A;  2JZ3 B;  2N7E A;  5DCN A;  3WAO A;  2WYQ A;  3DPD A;  4AJW A;  4LJP B;  2GOW A;  1E8W A;  3NOB A;  2MBB B;  4TUU A;  3UQB A;  1PQS A;  1Z2M A;  3AI5 A;  1V9J A;  1EUV B;  3AUL A;  4NAW A;  2LD9 A;  1ZKH A;  1V80 A;  4BKT A;  4HXD A;  4HVB A;  3W1Y A;  3VQI A;  2GBK A;  2K8B A;  5C23 A;  1UH6 A;  2IO2 B;  4P7I A;  2PE9 A;  3VH3 B;  3K9O B;  2L7R A;  5E6P A;  4MGK E; 
#chains in the Genus database with same CATH topology
 1C4P A;  1QLB B;  4GDL A;  4B0E A;  4RMA A;  3L54 A;  2QSD A;  1K52 A;  1G6J A;  1ROE A;  2BYV E;  3PV1 A;  4WH4 A;  4FXC A;  2WGS A;  5L95 C;  3VDZ A;  1JWS D;  1E90 A;  3ZRF A;  3KYD D;  1QOG A;  2KTF A;  2G4S A;  2ACZ B;  2KN4 A;  3VR8 B;  3VUX A;  1NDD A;  2BB6 A;  4WJP A;  3TUO A;  2JF5 A;  4KIK B;  3Q8B A;  1VZ8 A;  3AMZ A;  2J4X A;  3BVG A;  3NZS A;  1NEN B;  2MJD A;  4JIO U;  4J6I A;  2BS4 B;  1IYF A;  2W3S A;  1XCQ L;  5D6J B;  1R4N B;  2NTS A;  2G1E A;  1SE9 A;  1K50 A;  4IKG A;  4P6V F;  4K3C A;  3BVM A;  2RDH A;  1OEY J;  1ZDX A;  3CF6 E;  5TR5 A;  3AEB B;  3RZW C;  1EU3 A;  3PZ7 A;  1V1P B;  1ZXI A;  1AN8 A;  2FNJ B;  3VTW A;  4CHK A;  3T3N A;  2LMC A;  3GS2 A;  4N58 A;  2WXH A;  1OQR A;  3AEF B;  2KMA A;  2G4D B;  3D32 A;  2MWS B;  1MI0 A;  3H7P A;  2ZNV C;  4XWW A;  1GB1 A;  2KDE B;  2I38 A;  1KFY B;  3AV8 A;  1SSN A;  2KWV B;  5JH5 C;  2JX5 A;  2ZW0 A;  2W9N A;  1VZ6 A;  5AZG A;  2WU5 B;  2RDB C;  1T0Q C;  1TGZ B;  1CZP A;  2W3R A;  2CR5 A;  4URK A;  4W9I A;  4C00 A;  2M0A A;  2WXR A;  2CJO A;  2FIF A;  3VHT C;  2D2Q A;  4LLG M;  1WGY A;  3P1M A;  3X0W A;  2N9X A;  4GDL B;  2LHE A;  5MPO A;  1QQR A;  1TKE A;  1EWC A;  3LDZ E;  4UDU C;  2N9E B;  2VRR B;  3K9P B;  4P1C C;  1FXA A;  1L0Y B;  1EM7 A;  3DHH C;  1I4R A;  2MJE A;  4W9G A;  1MG4 A;  1XO3 A;  3P4S B;  4OZB A;  3I57 A;  4P16 A;  5J18 A;  3EEC A;  3UF8 A;  3DBR I;  4AP4 C;  1PYW D;  2HJ1 A;  3NRZ A;  1I4Q A;  4F8C B;  3PZD A;  3WIM A;  1XQQ A;  4MEL A;  2ZZP B;  2BWE S;  3M62 B;  2IJ0 A;  2KNB A;  5D94 A;  3BZD B;  1WXQ A;  3H8H A;  3DVN V;  3UGB B;  4G50 A;  1V97 A;  2J0M A;  4LNK A;  2O6V A;  1WJU A;  4WJQ A;  1HTQ A;  3ZTC A;  1UUP A;  3N32 A;  3H7P B;  1DGJ A;  2KWU B;  3B1L X;  4BAX A;  1F2R I;  1WX9 A;  1C1Y B;  1HA5 A;  4C7Z A;  2HTH A;  3GZN I;  1QIL A;  1FNU A;  1ISN A;  1DYQ A;  1XT9 B;  1E6E B;  3ZDM C;  1BXT A;  4BKS A;  3BY4 B;  1X1M A;  2EKI A;  4L1B A;  4G3X B;  3IXS A;  2KYW A;  3A1Q A;  3EHV A;  4AQ7 A;  1I7H A;  1WRD B;  2D3B A;  5DPR A;  1GNU A;  2MBO A;  2MQJ A;  4IC7 B;  2KTR A;  2W54 A;  5BYR A;  1JRO A;  5E6N A;  4K81 A;  3AE7 B;  1WE7 A;  1STE A;  4MEM A;  2LZ6 A;  3BII D;  3ABV B;  1N63 A;  3OJ3 A;  3A4S C;  3ENE A;  2IY0 B;  1QOF A;  1L0X B;  3KUC B;  1E0Z A;  1TS2 A;  1HZ5 A;  2J52 A;  3QWZ B;  5KHQ A;  3CSF A;  4CYE A;  4HJK A;  1JRP A;  2JYT A;  4TSS A;  5EE9 A;  4FHK A;  3Q8A A;  1HE8 A;  2KMC A;  1WYG A;  2JVC A;  1GUA B;  1UD7 A;  2KKC A;  4AJY B;  3T9L A;  1QOA A;  2LGD A;  3DHI C;  3W1S A;  4IM2 A;  3Q69 A;  2JXT A;  4M8N A;  2MW5 A;  4NQL B;  1LM8 B;  1PGB A;  4ZRK A;  1WM3 A;  1MHX A;  2FBW B;  4X57 B;  3R2T A;  2BF8 B;  4MGZ E;  4IG7 B;  2A4Z A;  1JCK B;  2WXP A;  1D4B A;  4XDD A;  1CJE A;  1NI2 A;  1LFD A;  1SE2 A;  1U4A A;  2O6V B;  4DQO C;  4A8X C;  5TSS A;  4YSY B;  2EMS A;  3LYY A;  2KT7 A;  1DOY A;  2KD0 A;  1E8Y A;  3ZW3 A;  2BBC A;  2NBU A;  1WGK A;  4XWT A;  3VRB B;  2IGD A;  3PZ8 A;  4MSQ B;  4MJS A;  2SEB D;  4IWP A;  5LXH A;  5AZH A;  1VRA B;  4S0R A;  4MH8 A;  2RR9 A;  3PRM B;  2VH2 A;  3CIR B;  1UBI A;  5JHA A;  2N9L A;  2IY1 B;  3A1Q B;  1L4Z B;  4USA A;  2QDF A;  3L16 A;  4BOS C;  2LFI A;  2KTR B;  2JWU A;  2IDY A;  3RD2 A;  2V0G A;  3ZXR A;  2R61 A;  1TS5 A;  2Y5P A;  1N61 A;  1K8R B;  3QQ8 B;  2KQ7 A;  3JYU A;  5E6J A;  3C0R B;  4ZRP A;  3JW0 X;  2L0T A;  5BMH A;  4GDK A;  1WR1 A;  3PS6 A;  4LJO B;  2DZJ A;  1VZ7 A;  2RGF A;  2J0K A;  2K6Q A;  1TKG A;  3TSS A;  2L8J A;  1FD6 A;  3IVF A;  3PTF C;  2VH1 A;  1YIW A;  1UBQ A;  3PHX B;  5AEK B;  1FXI A;  5FR6 A;  2L76 A;  2VZK D;  1J0G A;  2DZI A;  3FIL A;  1S3S G;  4HDQ A;  1C3T A;  1YD8 U;  1YN5 A;  3Q8F A;  3TCA A;  2J53 A;  3SFE B;  2KLG A;  2NPT A;  4IM3 A;  4MT5 A;  1EWY C;  3JVZ X;  1ESF A;  4KX6 B;  2GOW A;  2L1A A;  3Q2A C;  1TY2 A;  5C2T B;  3AI5 A;  1Z2M A;  3AUL A;  4NAW A;  2E6X A;  1AW7 A;  2QC8 A;  4LTU A;  3MHZ A;  1YN4 A;  2GLS A;  3DWM A;  2K3U A;  5C23 A;  3W5V B;  3BYT B;  4RGT A;  4P7I A;  2PE9 A;  3VH3 B;  4Q2J A;  4RCO A;  4MGK E;  3PSE B;  3RYT A;  3DBL I;  1V86 A;  1PGA A;  2KFJ A;  4MJS B;  2WDQ B;  3J9C A;  1GG3 A;  1VJK A;  2PMV A;  4AS1 A;  4EKU A;  3AE1 B;  4WQM A;  4DK5 A;  2D10 A;  2CU1 A;  1IGC A;  4FHJ A;  4XYC A;  3I5J C;  4A90 A;  2KWD A;  2WXF A;  3GOE A;  3QX1 A;  2YLM A;  3WAN A;  1WXA A;  3GB1 A;  3PRP B;  3VAW A;  1WGG A;  2KLC A;  3VVW B;  1V81 A;  2BS2 B;  3R66 C;  1KJT A;  5IA7 A;  3MJW A;  1RLF A;  4GGQ A;  2C60 A;  5H8Y E;  2QIE B;  1P98 A;  1IGD A;  1QT9 A;  3V6E B;  1I35 A;  4M01 A;  4GDK B;  4FUL A;  5AUK A;  2V3N A;  4XC2 A;  2JQR B;  3LB8 C;  1F1H A;  1FEH A;  1SB3 C;  3RN9 C;  1RAX A;  2G3Q B;  4AWJ A;  1WJ6 A;  3KH0 A;  3B2F A;  4HKZ E;  3DVG X;  1E9M A;  4GU2 A;  3FIL B;  4BBN F;  1MHH E;  1V5O A;  1T5X D;  3A9K B;  1VR9 A;  1WJ4 A;  2Z8L A;  2NPT B;  5EDS A;  2ZCC A;  3H7S A;  1XXG A;  2WNM A;  3V3X A;  1H8C A;  4HWI B;  1WXM A;  4FJV B;  2EEL A;  3MTN B;  2TSS A;  2XNA C;  3VTV A;  4IDI A;  1C9F A;  1F2R C;  4W9D A;  4A20 A;  1KOT A;  3WAL A;  5E6O A;  5HKH A;  2WXK A;  4LNI A;  4KGT A;  1NYR A;  3U8Z A;  3FKY A;  1TIF A;  2IND C;  1SJH D;  2G45 B;  5G2N A;  1FXT B;  4ZYS A;  2KJ6 A;  1WY8 A;  4PK1 A;  3WA0 A;  2CHW A;  4ZRJ A;  5BO4 B;  2INC C;  1SF0 A;  1HZ6 A;  3Q14 C;  4LCD E;  2UU7 A;  4MM3 A;  4EZL A;  4KDL B;  1SGH A;  3ZXV A;  2L32 A;  3AE3 B;  1MG8 A;  5DPW A;  3QCA A;  3IAS 1;  5C3J B;  4GMV A;  4KGR A;  1D6E C;  2LGX A;  2Z0D B;  3S2A A;  1M94 A;  3ZRC A;  4ZOH C;  2BTE A;  2ZCB A;  3NVY A;  1OEY A;  2AL6 A;  2KXJ A;  2DYM A;  4LDT D;  4WUR A;  1SIF A;  1WI0 A;  3HIZ A;  3U52 E;  3OAW A;  2NVU I;  2Y5B B;  3ZDT A;  1MPE A;  4K7S A;  2JUO A;  2DX5 B;  2RMM A;  1JW9 D;  4IUM B;  4DHJ B;  1FCL A;  4DXG A;  1ENF A;  4HCP B;  2NBW B;  4IOI E;  3ZIM A;  4WJO A;  2NR2 A;  3H6N A;  4M0W A;  4GLS C;  1I4X A;  1FRD A;  4LK0 M;  4RM8 A;  1C78 A;  3N1X C;  2XBB C;  4M02 A;  2XEW A;  1MVK A;  3L17 A;  4RGO S;  2LXC A;  1RM6 C;  3KUD B;  4KZ0 A;  3Q3J A;  2IPK D;  3ZNG C;  2FCQ A;  4IWO A;  2YVC A;  3MHS D;  4TQ0 A;  2D3A A;  1JRU A;  3SEB A;  1P3Q U;  5JHB A;  2UWQ A;  3VRA B;  4FA6 A;  2JWZ A;  4F1S A;  5L83 A;  4IWQ A;  2PJH A;  4MGY E;  3L4P A;  4PS7 A;  4KZC A;  3RNC C;  2C5L C;  2WDV B;  5EE0 A;  3PT2 B;  3NJT A;  3BVZ A;  4MM3 B;  1ZW7 A;  2PVG C;  2WWZ A;  4IM0 A;  1A5R A;  3FAH A;  4J3O D;  1V49 A;  5IOI A;  4ZDV A;  4B0M A;  5CHW A;  4RM9 A;  2WDR B;  2W82 A;  1YNT E;  4DXF A;  1V2Y A;  4WAA A;  2WXI A;  1PUT A;  3SD5 A;  2KAC A;  2L00 B;  1J8C A;  3SR6 A;  2A5U A;  3W1S C;  2JRH A;  1N62 A;  2BYF A;  5D3I B;  3KLS X;  2N9K A;  4RF1 A;  2KO3 A;  1WF9 A;  3PPA A;  1LQB A;  1Q0W B;  3AH7 A;  4C56 C;  5IN7 A;  3MJ5 A;  1I4P A;  4ANX A;  1YJI A;  5DPT A;  2V3S A;  2PIA A;  1B1Z A;  3N3K B;  2MH7 A;  2MSE D;  3ZNH B;  2OJR A;  1IPG A;  4M0W B;  4LNN A;  3RNG C;  4ARI A;  2JY6 A;  3OLM D;  3DBR B;  2K39 A;  3ZVV A;  3R7Q A;  1KH0 A;  1UGJ A;  3CWI A;  3V62 A;  2YEP B;  2WXJ A;  2Z0E B;  4BBN C;  4PYZ A;  2K25 A;  1P7E A;  5I4D A;  2GBJ A;  2CJN A;  1Q1O A;  2DLB A;  2L05 A;  4DWF A;  1V5T A;  4A3O A;  2Y5C A;  3RPF C;  1TYG B;  5GMV A;  3FC4 A;  1SBB B;  3BWU D;  4JPS A;  3E56 A;  3ZUN A;  4BVU C;  4N59 A;  1T0Y A;  5LXI B;  2JRI B;  3C8Y A;  4I6L B;  4MDK E;  4US9 A;  3PVL A;  2BKR B;  1WJN A;  3TL5 A;  2C7N B;  4TMA B;  2FAZ A;  1F9J A;  3GZN B;  2D11 A;  4ICU A;  3M3J A;  2QIL A;  1VLB A;  3NZ3 A;  4DDI D;  2DZM A;  3QAR A;  1TZ1 A;  1J7C A;  3W2D A;  2INN E;  2KX0 A;  1BT0 A;  2WXL A;  2IO1 B;  1Q5W B;  3TEW A;  3DQV A;  2MP2 A;  2YEP F;  1PDX A;  1ZPS A;  1BUI C;  3UI3 A;  1D5Z C;  1D3Z A;  4RNA A;  2K6D B;  1HEZ E;  1P7F A;  2WX0 A;  4PYU A;  2ZW1 A;  1I42 A;  1VCB A;  2L52 A;  4E71 A;  4ZHO A;  2KC1 A;  1L2N A;  1WX7 A;  4W9L A;  3R8B A;  4FJY A;  3RUI B;  3MC0 B;  3WAO A;  5DCN A;  4AJW A;  2WYQ A;  4S17 A;  1TJE A;  3NUH B;  1E8W A;  3NOB A;  4TUU A;  1PQS A;  1V9J A;  1EUV B;  1V80 A;  4HXD A;  2N7J A;  1UH6 A;  5BMG A;  1FO4 A;  2K22 A;  2B3A A;  2K5P A;  1XLN A;  2MHJ A;  4EZK A;  4FJZ A;  1VDV A;  2K9X A;  4XGA B;  2B76 B;  2LI5 A;  2PEA A;  4JWU C;  2BT6 A;  3AED B;  3EUB 2;  2FUH B;  1ZUD 2;  4OW0 A;  1P0R A;  1DOI A;  3DHG C;  1ET9 A;  2FCN A;  4NJC A;  5C1Z A;  1J7A A;  1YOV B;  1VD2 A;  4K7W A;  4FLH A;  2L0F A;  1GB4 A;  2MRP A;  4US8 A;  4ANV A;  1GAQ B;  2WLB A;  3TEZ A;  1RRB A;  3IT6 B;  2AL3 A;  4MSM B;  3ZTD A;  2LVO A;  3Q3O C;  4DXA B;  2KQ4 X;  3DVN U;  3V6C B;  3AE9 B;  4ZYN A;  1WGR A;  3H1U A;  2LVP A;  2BS3 B;  4QAY A;  4M00 A;  2KZR A;  1ZE3 D;  3KYC D;  2V4I B;  1MJD A;  1K51 A;  3N30 A;  3P2B A;  2KVR A;  2MP2 B;  2D3G A;  2V9H A;  1FIQ A;  1FPY A;  2RPV A;  3HHM A;  1JWM D;  1WSP A;  4OZC A;  4R3D A;  1H4R A;  1C76 A;  3U4E G;  1WZ3 A;  2WX1 A;  2DZK A;  2KDB A;  1EF1 A;  3X23 A;  2CU3 A;  1QZE A;  1ZDV A;  2FCM A;  4NJ6 A;  2LAS A;  4DBG A;  2M1M A;  3C19 A;  1L7Y A;  4HCN B;  4ZRI A;  4KV2 A;  1FNW A;  2L83 A;  2SAK A;  4HLE A;  2K8C A;  2HE7 A;  1C4C A;  3R2I A;  5HHD G;  2OOB B;  3A33 B;  3QJZ A;  4KKJ A;  4HK2 A;  2KC2 A;  3MFG A;  1WWT A;  4WQO B;  3T8M A;  1S1Q B;  4PS3 A;  1RYJ A;  3HUI A;  3OWE B;  3VR9 B;  4JL9 A;  5LNK 1;  3V60 A;  4RGM A;  3BYY B;  2QCZ A;  3PO0 A;  1WGD A;  2AYO B;  1WMH A;  2GBM A;  2CHZ A;  2DEN B;  3W9C B;  3AU4 A;  2MBQ A;  1FRR A;  3DDC B;  2XK5 A;  2LUE A;  2IBI B;  3QAQ A;  3APF A;  1YMH E;  3IT4 B;  3RI7 C;  3MC9 A;  2C7M B;  3NY5 A;  3DBL B;  4NAM A;  4ANW A;  3IBE A;  4RH6 A;  3AE2 B;  1HTO A;  4A55 A;  1RFK A;  3I9V 1;  2PTL A;  5IAA C;  3DCG A;  2O2V A;  5G55 A;  3RUL A;  4EZJ A;  3SU8 X;  5T8I A;  2M19 A;  4WAF A;  4L23 A;  4NY0 A;  4WWP A;  2HJ8 A;  3O65 B;  3A4R A;  5HI1 A;  4JGH B;  1WX8 A;  2N9P C;  2ASQ A;  4YTP B;  3AE8 B;  3R3M A;  1P1A A;  2M17 A;  2M8S A;  3ZNI D;  2D5G A;  3NS1 A;  4MGI E;  1DOX A;  4KIK A;  3JSV A;  4XX5 A;  4ITK A;  2PPH A;  3RZF A;  2BPS A;  1OQY A;  3L13 A;  4HPM B;  3QHT A;  2LEK A;  3A9J A;  2K0P A;  3EGR A;  4REZ A;  4DHZ E;  2EMT A;  1WIA A;  3ZKJ C;  2FE8 A;  2FID A;  1AYF A;  2JPH A;  3RNE C;  2WP9 B;  1B9R A;  1JML A;  5G5G A;  4B6W A;  4IW0 A;  4NAW B;  3TJP A;  2MCN B;  3QK0 A;  2BYT A;  5J17 A;  3PRE A;  1TTN A;  4HKQ A;  4YTM B;  4FBJ B;  3EFU A;  2NBV B;  2IO0 B;  2BWF A;  4JLC A;  2D07 B;  2MA9 B;  1KM7 A;  1WMH B;  1FM0 D;  4GOC A;  4G11 A;  4XE0 A;  5FR3 A;  1SXT A;  2IGG A;  2R2Q A;  3NVW A;  3Q8C A;  2AX5 A;  2KDF B;  4B9K A;  2KDI A;  4N6E B;  2WXQ A;  3TBL D;  1RWS A;  3AE4 B;  4BFR A;  2KVZ A;  4W9F A;  1WYW B;  1TS4 A;  3PLU A;  4OVV A;  4A6Q A;  3T3O A;  2RDG A;  3IFW B;  3AE5 B;  2QHO A;  3VUY A;  2RPQ A;  4JE3 B;  3BK2 A;  2O2V B;  2V1Y A;  1KLU D;  4O1N A;  3N20 C;  2JZZ A;  4KVG B;  4TQ1 A;  2WS3 B;  4JQW C;  3RT3 B;  1V8C A;  2IZV B;  2L3Z A;  3VXW A;  3PLV A;  3NHE B;  2FCS A;  3H9D A;  3NVV A;  2IGH A;  4EUT A;  5JXV A;  2ZJD A;  2DAJ A;  3V61 A;  2DBY A;  3AEE B;  1JAL A;  1WM2 A;  2LGS A;  4YXD B;  4WJN A;  2HTM E;  5D2M B;  2GMI C;  1R4N I;  3UIP B;  3AM9 A;  1XLQ A;  1TZO A;  4ANU A;  3JSV B;  1XLO A;  4CO7 A;  4II2 B;  1FFV A;  2IYD B;  4XZ4 A;  1GC6 A;  4L2Y A;  4LNF A;  3NG0 A;  2KAN A;  3A9J B;  3VH4 B;  3AE6 B;  2H88 B;  1T3Q A;  2VZK B;  1YN3 A;  2LGY A;  2O6V D;  2DWQ A;  2REX A;  3HK0 A;  2KFK A;  4HEA 1;  2JSV X;  4CQN A;  2K8H A;  3N1Y C;  1YJJ A;  3ZLZ A;  2C7H A;  5BYS A;  3DOW A;  1R7S A;  2KQS A;  1WRI A;  4GIV A;  2DAF A;  2WXN A;  2PLP A;  2MBH A;  3KUZ A;  4BKG A;  1WH3 A;  4D2K A;  2V4L A;  5FK9 C;  3M63 B;  1C77 A;  1AAR A;  1LGR A;  1XEE A;  4BKS D;  4DDG D;  4M8M A;  3NVZ A;  1L6V A;  1YJ1 A;  4ZRQ A;  1J19 A;  4OZA A;  3B9J A;  2BQQ A;  2JZP A;  2X38 A;  1PFD A;  3KQ4 A;  4K1R B;  2INP E;  2PVO D;  3HVD A;  3KVF B;  4WWM A;  4MAC A;  1E10 A;  5CTR C;  4YTN B;  1FCC C;  3AEG B;  1E8Z A;  4BZA A;  1D5M C;  1UWM A;  2BB5 A;  3W5U B;  3V05 A;  4C7Y A;  1K53 A;  3BK1 A;  4N9F 4;  2EKE C;  1Y8R C;  2BYE A;  3DPD A;  1HXY D;  2MBB B;  3UQB A;  1SIJ A;  3ZJU A;  1ZKH A;  2FUG 1;  3W1Y A;  1N5W A;  2GBK A;  1FNV A;  3ZYY X;  4EE2 A;  1GPX A;  1XCT L;  1ACC A;  4YSX B;  3K9O B;  3OG5 A;  5E6P A;  1J7B A;  3N1Z C;  1UWX A;  5CHV C;  2KX3 A;  2M0X A;  2QMT A;  4HDO A;  2AEH A;  4NZL B;  1I4G A;  1NBF C;  2PW9 A;  2WXM A;  1R4M I;  4WIP A;  3L0W B;  2MEK A;  4MH0 E;  3UQA A;  2AQ3 B;  3DWG C;  2JT4 B;  1KLV A;  2KFK B;  2KOX A;  2HDE A;  3CMM B;  3DBS A;  4K3B A;  3AN1 A;  4OVZ A;  1R4M B;  1F0Z A;  2GBN A;  1F77 A;  2AQ2 B;  4XDC A;  2IO3 B;  3E9S A;  1CMX B;  3R7R A;  3TIX A;  2OED A;  1QOB A;  3VFK A;  1T0S C;  4ZHP A;  2XN9 C;  2GB1 A;  1IBX A;  1JWB D;  1N5X A;  1E8X A;  1M4V A;  2GRI A;  4H2A A;  3P4Q B;  2KHW B;  2V3P A;  1TKY A;  4RFB A;  4I6P A;  2BW2 A;  4W9H A;  3HRD D;  3U2S C;  3RCZ A;  4TKN A;  2J42 A;  2KWC A;  5CHF A;  1XD3 B;  5JZE B;  3TEY A;  3AU5 A;  4II3 B;  5BYQ A;  1EO6 A;  3RMK C;  5FKA C;  2WU2 B;  1WR6 E;  1L5P A;  1SE3 A;  4ICV A;  2ICI A;  3DBH I;  5BMI A;  3N9Y C;  3RNB C;  4GB9 A;  4KSL C;  3U7D A;  2MJ3 A;  2AWT A;  4W9C A;  1Y56 A;  1IUE A;  1AWD A;  4C80 A;  1QF6 A;  2MBE A;  3DBH B;  3EFC A;  4LDT B;  4DHZ B;  4A9A A;  1GOZ A;  1N6Z A;  2J7Q B;  4C4V A;  2NMQ A;  2Q5W D;  1T0R C;  2JXX A;  2OJW A;  4YSZ B;  4E74 A;  2H89 B;  5DPS A;  1SEB D;  2LXA A;  3P4P B;  1WE6 A;  1E7V A;  3ML8 A;  1Q10 A;  3WAM A;  3VTU A;  2X8X X;  1T6B X;  1UZX B;  2ZVN A;  5EE1 A;  1F52 A;  2KJR A;  3UIO B;  3P63 A;  4NQK E;  3SDL C;  1Z5S B;  3ZGZ A;  3KW5 B;  4NJ7 A;  2ONQ A;  3Q6B A;  1EF5 A;  2LGI A;  2N4F A;  2KMM A;  2N7D A;  5CX3 A;  1FFU A;  3L08 A;  3LJ3 A;  3CST A;  4HPP A;  4BOZ B;  3OJ4 B;  4PT5 A;  3ML9 A;  1IBX B;  4YT0 B;  3AEC B;  4W9J A;  2NTT A;  1WFY A;  5D7G A;  4TV3 A;  3I3T B;  4ASW C;  2I1J A;  3Q3M C;  2WQY B;  1NVI D;  3ZNZ B;  2DYB A;  1CK1 A;  2MLB A;  5EE3 A;  3TMP B;  3ZO5 B;  1LXD A;  5KHO A;  3AEA B;  2ZEQ A;  4E3C A;  1YX6 B;  2AQ1 B;  1OFF A;  3HM6 X;  4AUQ C;  1HQR D;  2ZNV B;  1FMA D;  4W9E A;  2K1F A;  3L10 B;  2Y3A A;  3EC8 A;  3MP9 A;  2KDM A;  3IHP C;  3VUW A;  3P42 A;  2CHX A;  5AZF A;  3KWL A;  3NZU A;  4HJG E;  1ET6 A;  3Q3F A;  2KJH B;  1NEK B;  2UYZ B;  2LRW A;  3SHQ A;  4F7Z A;  3BIN A;  2PKO A;  4HRO A;  2J0J A;  4DHJ D;  3GE8 C;  1L6U A;  5IP4 D;  1V6E A;  2LVQ A;  4FN2 A;  3AB5 A;  2C9W B;  4LNO A;  2E3T A;  2W55 A;  1YQB A;  3IG3 A;  5IO9 A;  1XF5 L;  1N60 A;  4C4V B;  2NCN A;  2ZPN A;  3HVZ A;  2KAJ A;  2LWP A;  2N1V A;  3O13 A;  3GP7 A;  2HD5 B;  1YQ3 B;  2LRU A;  4FAD A;  2I1K A;  5HFY A;  1P9D U;  3ZQ4 A;  1UEL A;  3APC A;  3QA8 A;  3RNA C;  4OVU A;  2WDT B;  1E5W A;  4EOY A;  3A9K A;  1GC7 A;  2N1W A;  2JU6 X;  2RSU A;  2BVC A;  2RD0 A;  2D3C A;  1TY0 A;  5H92 C;  3LXF A;  1ZGU B;  2CKH B;  2WHI A;  2JYE A;  4GXB A;  2GBR A;  1UGM A;  2M4N A;  3TEX A;  3NS8 A;  3PGE A;  3Q8E A;  2OHF A;  1JWA D;  1KRH A;  2LHD A;  2R2O A;  1EU4 A;  1D5X C;  5G5H A;  2MX2 A;  1WXS A;  5LLI A;  2LUM A;  4YL8 A;  2WXG A;  3RNF C;  4W9K A;  2LJI A;  3EA6 A;  4A3P A;  4GSW A;  1YX5 B;  4P1B C;  1KLG D;  1GJZ A;  1RFA A;  4YWG G;  2CS4 A;  3KWV A;  3UIN B;  4ACF A;  1WXV A;  2DYO A;  1E7P B;  2ZPY A;  1C4A A;  3DVG Y;  4HRS A;  1OGW A;  1KF6 B;  4WWN A;  3PHW B;  3ZJT A;  1WGH A;  5IKC M;  4B95 A;  1JQ4 A;  3QIJ A;  1L0V B;  3RFZ B;  4KSK C;  2BKF A;  4RF0 A;  2ZVO A;  3B08 A;  4ARC A;  2Z59 B;  3Q3N C;  1YQ4 B;  3SFD B;  1UF0 A;  1UNS A;  4KKI A;  2WXO A;  2DNF A;  4G0N B;  1SJE D;  2KN5 A;  2LJ5 A;  1E7U A;  3GE3 C;  4GN1 A;  3PRZ A;  2QEJ C;  2QJL A;  1PGX A;  2ON8 A;  3U30 A;  3ZJV A;  4EFO A;  3MC8 A;  2GI9 A;  1TS3 A;  3B0A A;  2KK8 A;  3P4R B;  4I6N B;  3QC8 B;  4HPL B;  1WZ0 A;  3ETR A;  4EEW A;  3B2G A;  2G9H D;  2NS5 A;  3ALB A;  1JWU D;  1OTR B;  3M95 A;  3ONS A;  1IP9 A;  4OHJ A;  1TBE A;  1QKZ A;  4JX1 C;  1V1P A;  3HM3 A;  2N0S B;  5J2R A;  1I4H A;  1LO5 D;  4K7U A;  3APD A;  1CQV A;  1V1O A;  2PE6 B;  4NNJ B;  2BGF A;  1NI3 A;  1C79 A;  1A70 A;  4KDI C;  3U7Z A;  1KTK A;  1BML C;  4NPN A;  3IAM 1;  2XK5 B;  4WWO A;  3ECI A;  4AOF A;  1TT5 B;  4KGS A;  4PS8 A;  2DHZ A;  4JWS C;  5GXG B;  3AXC A;  3WAP A;  2JZ3 B;  2N7E A;  1ZOY B;  1ZP0 B;  4LJP B;  2M56 B;  5HG2 A;  3URY A;  2LD9 A;  4RGN A;  1OQQ A;  1L4D B;  2I2Y A;  4BKT A;  1NYQ A;  1SE4 A;  4HVB A;  3WCQ A;  1ZXH A;  3VQI A;  2K8B A;  5AUI A;  2IO2 B;  3I63 C;  5D3D A;  2L7R A;  1MFW A;  1XLP A; 
#chains in the Genus database with same CATH homology
 3PSE B;  2B3A A;  3RYT A;  3DBL I;  5CHV C;  1V86 A;  4GDL A;  2KFJ A;  2KX3 A;  4RMA A;  3L54 A;  4EZK A;  2M0X A;  4MJS B;  1G6J A;  4FJZ A;  2BYV E;  3PV1 A;  2LI5 A;  1GG3 A;  2PEA A;  4HDO A;  5L95 C;  2AEH A;  4EKU A;  2FUH B;  1NBF C;  1P0R A;  1R4M I;  3VDZ A;  2D10 A;  4DK5 A;  1E90 A;  3ZRF A;  2CU1 A;  3KYD D;  4FHJ A;  2KTF A;  2G4S A;  3L0W B;  4MH0 E;  3UQA A;  2FCN A;  3GOE A;  5C1Z A;  3VUX A;  1NDD A;  4WJP A;  2JT4 B;  3QX1 A;  2YLM A;  3WAN A;  2JF5 A;  1KLV A;  1VD2 A;  2KFK B;  1WXA A;  4KIK B;  4K7W A;  2KOX A;  3CMM B;  3DBS A;  4FLH A;  3PRP B;  3VAW A;  1WGG A;  3NZS A;  2KLC A;  3VVW B;  1V81 A;  2L0F A;  3R66 C;  4JIO U;  1KJT A;  2MRP A;  4ANV A;  5IA7 A;  2GBN A;  3MJW A;  1RLF A;  1RRB A;  2C60 A;  2IO3 B;  4GGQ A;  4J6I A;  1IYF A;  2AL3 A;  1CMX B;  4MSM B;  1P98 A;  3ZTD A;  2LVO A;  5D6J B;  3R7R A;  4DXA B;  1I35 A;  3TIX A;  3V6E B;  3VFK A;  3DVN U;  4GDK B;  1SE9 A;  4FUL A;  3V6C B;  4XC2 A;  4ZYN A;  1E8X A;  1WGR A;  3H1U A;  2LVP A;  1OEY J;  3CF6 E;  5TR5 A;  3RZW C;  2KZR A;  3KYC D;  1RAX A;  2G3Q B;  2KHW B;  4AWJ A;  4I6P A;  1WJ6 A;  3KH0 A;  2FNJ B;  3N30 A;  4W9H A;  3VTW A;  4CHK A;  3P2B A;  2KVR A;  2MP2 B;  3DVG X;  2D3G A;  4GU2 A;  3RCZ A;  3HHM A;  4TKN A;  2KMA A;  2G4D B;  2KWC A;  4BBN F;  5CHF A;  1XD3 B;  1V5O A;  3D32 A;  5JZE B;  1H4R A;  3A9K B;  2MWS B;  3AU5 A;  1WJ4 A;  1WZ3 A;  4II3 B;  2WX1 A;  3H7P A;  2ZNV C;  2DZK A;  2KDB A;  2NPT B;  1EO6 A;  5EDS A;  2ZCC A;  1EF1 A;  3H7S A;  3X23 A;  2KDE B;  1WR6 E;  1H8C A;  4HWI B;  1WXM A;  4ICV A;  1QZE A;  2KWV B;  4FJV B;  5JH5 C;  2W9N A;  3MTN B;  5AZG A;  2FCM A;  3DBH I;  4NJ6 A;  2LAS A;  3VTV A;  4DBG A;  1TGZ B;  2M1M A;  4GB9 A;  4KSL C;  1L7Y A;  4HCN B;  3U7D A;  2CR5 A;  4ZRI A;  4W9D A;  4URK A;  4A20 A;  4W9C A;  2AWT A;  4W9I A;  4KV2 A;  1KOT A;  3WAL A;  2FIF A;  5E6O A;  3VHT C;  4HLE A;  2D2Q A;  5HKH A;  2K8C A;  2HE7 A;  3U8Z A;  2OOB B;  3A33 B;  3QJZ A;  1WGY A;  2MBE A;  4HK2 A;  4LDT B;  4DHZ B;  2G45 B;  5G2N A;  1FXT B;  2KC2 A;  2KJ6 A;  3X0W A;  1WY8 A;  3WA0 A;  2N9X A;  4GDL B;  4WQO B;  3T8M A;  1S1Q B;  2CHW A;  2J7Q B;  4PS3 A;  4ZRJ A;  5BO4 B;  2JXX A;  4LCD E;  4E74 A;  5DPS A;  4JL9 A;  2LXA A;  3LDZ E;  4MM3 A;  3V60 A;  1WE6 A;  1E7V A;  3ML8 A;  3WAM A;  2N9E B;  4EZL A;  3VTU A;  1WGD A;  1SGH A;  4KDL B;  1UZX B;  2VRR B;  2ZVN A;  2AYO B;  1WMH A;  2KJR A;  2GBM A;  3K9P B;  2CHZ A;  2DEN B;  3UIO B;  5DPW A;  1MG8 A;  4NQK E;  3QCA A;  4W9G A;  3AU4 A;  2MBQ A;  3SDL C;  1Z5S B;  4GMV A;  3DDC B;  2XK5 A;  2LUE A;  3KW5 B;  2LGX A;  2Z0D B;  3S2A A;  2IBI B;  1M94 A;  3QAQ A;  4NJ7 A;  3APF A;  3EEC A;  5J18 A;  3UF8 A;  1EF5 A;  3DBR I;  3ZRC A;  2N4F A;  4AP4 C;  2N7D A;  2C7M B;  2ZCB A;  1OEY A;  2AL6 A;  2KXJ A;  2DYM A;  3L08 A;  3LJ3 A;  3NY5 A;  3CST A;  4LDT D;  5CX3 A;  4BOZ B;  1SIF A;  4F8C B;  3PZD A;  3OJ4 B;  4ANW A;  3IBE A;  1WI0 A;  3HIZ A;  3ML9 A;  3OAW A;  2NVU I;  3WIM A;  1XQQ A;  2Y5B B;  4W9J A;  1WFY A;  5D7G A;  4TV3 A;  3ZDT A;  3I3T B;  4ASW C;  4MEL A;  2I1J A;  2ZZP B;  2BWE S;  4K7S A;  2JUO A;  2DX5 B;  3M62 B;  3DCG A;  5IAA C;  2O2V A;  5G55 A;  3RUL A;  3ZNZ B;  4EZJ A;  2DYB A;  2KNB A;  4IUM B;  5D94 A;  2MLB A;  4DHJ B;  3SU8 X;  3TMP B;  3DVN V;  4HCP B;  3UGB B;  3ZO5 B;  4G50 A;  2NBW B;  1LXD A;  2J0M A;  4NY0 A;  4WWP A;  2HJ8 A;  4WJO A;  3ZIM A;  2NR2 A;  5KHO A;  3H6N A;  2O6V A;  1WJU A;  2ZEQ A;  3O65 B;  4WJQ A;  3ZTC A;  4E3C A;  1YX6 B;  4RM8 A;  3A4R A;  4JGH B;  1WX8 A;  3HM6 X;  3N32 A;  3H7P B;  3B1L X;  2KWU B;  2N9P C;  2ASQ A;  2XBB C;  4AUQ C;  2XEW A;  3R3M A;  2ZNV B;  1P1A A;  4W9E A;  1WX9 A;  1C1Y B;  2K1F A;  3L10 B;  3L17 A;  3EC8 A;  2M17 A;  3IHP C;  2M8S A;  3VUW A;  2HTH A;  2CHX A;  2LXC A;  3GZN I;  3KUD B;  4MGI E;  5AZF A;  3ZNI D;  4KZ0 A;  4KIK A;  3Q3J A;  3JSV A;  3ZNG C;  4XX5 A;  1ISN A;  2FCQ A;  4IWO A;  2YVC A;  3MHS D;  4TQ0 A;  3NZU A;  2PPH A;  3Q3F A;  2KJH B;  1XT9 B;  1JRU A;  2LRW A;  2UYZ B;  3ZDM C;  3BY4 B;  3SHQ A;  3RZF A;  4BKS A;  2BPS A;  4F7Z A;  1P3Q U;  1X1M A;  1OQY A;  3BIN A;  3L13 A;  4G3X B;  2J0J A;  3QHT A;  3A9J A;  4HPM B;  4DHJ D;  5JHB A;  2UWQ A;  4DHZ E;  3A1Q A;  3EHV A;  2EMT A;  1WIA A;  1V6E A;  4FA6 A;  1WRD B;  2LVQ A;  4FN2 A;  3ZKJ C;  2C9W B;  2JWZ A;  5DPR A;  4F1S A;  2FID A;  2JPH A;  1GNU A;  2MBO A;  2MQJ A;  4IC7 B;  2KTR A;  1YQB A;  5L83 A;  4IWQ A;  2PJH A;  3IG3 A;  4MGY E;  4B6W A;  4IW0 A;  4NAW B;  4PS7 A;  4KZC A;  2MCN B;  3TJP A;  3QK0 A;  5E6N A;  4K81 A;  5J17 A;  2NCN A;  2ZPN A;  3PRE A;  2C5L C;  1WE7 A;  2LWP A;  2N1V A;  3PT2 B;  4MEM A;  1TTN A;  4FBJ B;  2LZ6 A;  1ZW7 A;  2HD5 B;  2WWZ A;  3EFU A;  2NBV B;  2IO0 B;  4IM0 A;  1A5R A;  3OJ3 A;  2BWF A;  3A4S C;  2D07 B;  2LRU A;  3ENE A;  4JLC A;  4FAD A;  2MA9 B;  2IY0 B;  1V49 A;  2I1K A;  1P9D U;  4ZDV A;  1KM7 A;  1WMH B;  4GOC A;  3KUC B;  4G11 A;  1UEL A;  5CHW A;  4RM9 A;  3APC A;  3QA8 A;  4OVU A;  2WDT B;  1E5W A;  3QWZ B;  5KHQ A;  2R2Q A;  4EOY A;  3CSF A;  4CYE A;  3A9K A;  1GC7 A;  4HJK A;  2N1W A;  1V2Y A;  2RSU A;  2KDF B;  4B9K A;  2RD0 A;  4WAA A;  4FHK A;  2KDI A;  3SD5 A;  1ZGU B;  2CKH B;  1HE8 A;  2KMC A;  2L00 B;  3TBL D;  4BFR A;  1J8C A;  2JVC A;  1GUA B;  1UD7 A;  4GXB A;  2KKC A;  2A5U A;  4AJY B;  3W1S C;  3T9L A;  2GBR A;  2JRH A;  4W9F A;  1UGM A;  1WYW B;  2M4N A;  2BYF A;  3PLU A;  4OVV A;  2LGD A;  3NS8 A;  3PGE A;  3W1S A;  4IM2 A;  2KO3 A;  2R2O A;  3IFW B;  1WF9 A;  3PPA A;  1LQB A;  1Q0W B;  4M8N A;  2MW5 A;  4NQL B;  1LM8 B;  2MX2 A;  4ZRK A;  2QHO A;  1WM3 A;  3VUY A;  2RPQ A;  1WXS A;  5LLI A;  4X57 B;  4YL8 A;  2O2V B;  2V1Y A;  4ANX A;  2BF8 B;  5DPT A;  4MGZ E;  2V3S A;  4IG7 B;  3N3K B;  4W9K A;  2JZZ A;  2MSE D;  2A4Z A;  4A3P A;  4KVG B;  3ZNH B;  4TQ1 A;  4GSW A;  1YX5 B;  1GJZ A;  1RFA A;  4JQW C;  2OJR A;  3RT3 B;  1NI2 A;  1LFD A;  1IPG A;  1U4A A;  2O6V B;  4M0W B;  2CS4 A;  2IZV B;  2L3Z A;  3VXW A;  3PLV A;  3NHE B;  3UIN B;  2FCS A;  2JY6 A;  3H9D A;  1WXV A;  3OLM D;  2DYO A;  4EUT A;  2K39 A;  2ZJD A;  2DAJ A;  2ZPY A;  3V61 A;  2EMS A;  3DVG Y;  2KD0 A;  1WM2 A;  3ZVV A;  3R7Q A;  1OGW A;  4WWN A;  3PHW B;  1E8Y A;  3ZW3 A;  4WJN A;  2NBU A;  1WGH A;  3V62 A;  4B95 A;  2Z0E B;  5D2M B;  2GMI C;  4BBN C;  4PYZ A;  1R4N I;  2K25 A;  3QIJ A;  3UIP B;  4KSK C;  2BKF A;  4ANU A;  3JSV B;  2GBJ A;  4MSQ B;  4MJS A;  2ZVO A;  3B08 A;  2Z59 B;  4CO7 A;  1Q1O A;  4IWP A;  4DWF A;  2L05 A;  1V5T A;  4II2 B;  5AZH A;  4A3O A;  5LXH A;  2IYD B;  2RR9 A;  1GC6 A;  4XZ4 A;  3PRM B;  5GMV A;  2KAN A;  3A9J B;  1UBI A;  5JHA A;  4G0N B;  2IY1 B;  3VH4 B;  3A1Q B;  2KN5 A;  2LJ5 A;  3ZUN A;  3L16 A;  4BVU C;  1E7U A;  4BOS C;  2LGY A;  1T0Y A;  2O6V D;  5LXI B;  2REX A;  2KTR B;  2KFK A;  3HK0 A;  4GN1 A;  2JRI B;  3PRZ A;  3RD2 A;  2K8H A;  3U30 A;  4I6L B;  4MDK E;  3PVL A;  2BKR B;  3ZLZ A;  2C7H A;  3DOW A;  1K8R B;  1WJN A;  3QQ8 B;  4EFO A;  2KQ7 A;  3JYU A;  3TL5 A;  2C7N B;  2KQS A;  3C0R B;  3B0A A;  2FAZ A;  2KK8 A;  3JW0 X;  1F9J A;  2D11 A;  2L0T A;  4GIV A;  4ICU A;  3M3J A;  2DAF A;  4GDK A;  4I6N B;  3QC8 B;  4HPL B;  1WR1 A;  2MBH A;  1WZ0 A;  3KUZ A;  3PS6 A;  1WH3 A;  4BKG A;  4DDI D;  4EEW A;  2V4L A;  3M63 B;  4LJO B;  2DZM A;  3QAR A;  2NS5 A;  1TZ1 A;  3ALB A;  1OTR B;  3M95 A;  1AAR A;  3ONS A;  2DZJ A;  1IP9 A;  2KX0 A;  1TBE A;  1BT0 A;  4BKS D;  2RGF A;  2J0K A;  2IO1 B;  3HM3 A;  5J2R A;  4DDG D;  4M8M A;  2K6Q A;  1YJ1 A;  1Q5W B;  4K7U A;  3DQV A;  3APD A;  1J19 A;  2L8J A;  3IVF A;  2MP2 A;  2PE6 B;  1YIW A;  3PTF C;  4NNJ B;  2BGF A;  1UBQ A;  3PHX B;  5AEK B;  5FR6 A;  2L76 A;  1J0G A;  2DZI A;  4K1R B;  3KVF B;  1S3S G;  4KDI C;  1D3Z A;  2K6D B;  4HDQ A;  5CTR C;  1C3T A;  1YD8 U;  2WX0 A;  4PYU A;  1E8Z A;  1I42 A;  4NPN A;  1VCB A;  4E71 A;  1L2N A;  2KC1 A;  3TCA A;  2XK5 B;  4WWO A;  1WX7 A;  4W9L A;  3ECI A;  2KLG A;  4AOF A;  2NPT A;  4PS8 A;  4FJY A;  4IM3 A;  2DHZ A;  3RUI B;  3JVZ X;  3AXC A;  4N9F 4;  2EKE C;  3WAP A;  1Y8R C;  2BYE A;  2JZ3 B;  2N7E A;  5DCN A;  3WAO A;  2WYQ A;  3DPD A;  4AJW A;  4LJP B;  2GOW A;  1E8W A;  3NOB A;  2MBB B;  4TUU A;  3UQB A;  1PQS A;  1Z2M A;  3AI5 A;  1V9J A;  1EUV B;  3AUL A;  4NAW A;  2LD9 A;  1ZKH A;  1V80 A;  4BKT A;  4HXD A;  4HVB A;  3W1Y A;  3VQI A;  2GBK A;  2K8B A;  5C23 A;  1UH6 A;  2IO2 B;  4P7I A;  2PE9 A;  3VH3 B;  3K9O B;  2L7R A;  5E6P A;  4MGK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...