3WIMA

Gabarap-lir peptide complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid receptor-associated protein
publication title GABARAP-LIR peptide complex
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 34
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wimA00
3UQAA 3APFA 2N7EA 2L76A 2WX0A 1HE8A 2LGDA 2KK8A 4GIVA 4IC7B 4AP4C 4GXBA 3APCA 3BY4B 2IO0B 3DCGA 1Q1OA 2JWZA 3HM6X 4HDOA 2J0KA 3A1QB 3R7QA 1Q0WB 3OJ4B 2BPSA 2KNBA 3S2AA 2KLGA 3V61A 3KVFB 2B3AA 2KFKA 2L8JA 3KYCD 4JQWC 3ZIMA 2IY1B 4DHJB 2KN5A 2HTHA 3M3JA 4ANWA 4BFRA 4KZ0A 4ICUA 1OEYA 3RYTA 1V5TA 4BKGA 4ANUA 1UH6A 1U4AA 3GZNI 1GC7A 2D11A 4NJ7A 2JZ3B 4K7WA 4KSKC 2LZ6A 4EKUA 1WM3A 2DAFA 5AZHA 4IWQA 2MX2A 1ZGUB 1LXDA 2D3GA 4IM2A 4PS7A 2L0FA 2OJRA 2IY0B 3PSEB 2KLCA 4LJOB 2MBOA 2KJHB 2K1FA 4II3B 2LRWA 1SE9A 2EMTA 1M94A 3HIZA 1Y8RC 5C1ZA 2KDEB 3C0RB 2K8HA 4ZRKA 3ML9A 4URKA 1OQYA 2QHOA 4W9EA 2IO2B 2JPHA 5E6OA 3OJ3A 1TBEA 2KFKB 3UIOB 3JVZX 2O6VD 4W9FA 3K9PB 1KLVA 2NR2A 2JVCA 5DCNA 4A3PA 3RZWC 2YLMA 4IWOA 1WFYA 2G4SA 3JYUA 3ZRCA 3NZUA 2DZJA 2O2VA 1GNUA 2Z0EB 5BO4B 4W9JA 2ZZPB 5CX3A 4M8MA 1IPGA 2FUHB 2BWES 2KWVB 3DVNU 2XEWA 4E74A 2ZCCA 3IBEA 2AEHA 3B1LX 1UELA 1NBFC 2DYBA 2IO1B 2KC2A 4M0WB 3ZNZB 3IFWB 4K7UA 1A5RA 1WXAA 3X0WA 3WALA 4G11A 1ZW7A 4GGQA 4B95A 4M8NA 2JRIB 4DHZE 3O65B 2Z59B 4ANXA 4WJPA 3PHWB 5JH5C 5JHAA 4I6NB 3UGBB 4B9KA 2RGFA 4FLHA 4W9GA 3ONSA 2GBJA 3RZFA 4IM3A 4EEWA 4YL8A 4FHKA 3RT3B 4K1RB 1WH3A 4WWPA 2DYMA 3RULA 1EUVB 1YQBA 2D2QA 2HD5B 1T0YA 3GOEA 4N9F4 1NI2A 2DX5B 3RCZA 1OGWA 3DQVA 3OAWA 2KFJA 2N1VA 3TJPA 3B08A 4G50A 2OOBB 4AUQC 2BF8B 2O6VA 4ANVA 2KKCA 4NJ6A 5IAAC 3VUYA 2Z0DB 1UZXB 3TL5A 4EZKA 2DZMA 4I6PA 4IW0A 4K7SA 2NCNA 2LWPA 3L10B 1WYWB 3HHMA 3NHEB 4CO7A 2GBMA 2YVCA 2DENB 2D10A 1WGDA 4ZRIA 2C5LC 2CS4A 4BBNC 5EDSA 4CHKA 1I42A 4BBNF 3A1QA 1L2NA 2KX3A 3ZVVA 1E90A 4W9DA 4PYZA 3KUCB 4DDID 2BGFA 4XC2A 3L54A 5CHVC 2GBNA 2MP2B 2FCNA 5D6JB 5TR5A 3ZDMC 4NQKE 1UBIA 3QCAA 1WY8A 3TIXA 2MLBA 2G3QB 4IG7B 2M0XA 3ZKJC 1P3QU 1LM8B 5J2RA 2PJHA 5AEKB 1E8XA 2O6VB 3AI5A 4IUMB 2KANA 3A9KA 2EKEC 3QC8B 2M8SA 3UF8A 2C7HA 2ZPYA 1OEYJ 3MJWA 5JZEB 2LXAA 3L0WB 3WA0A 4DBGA 2DZKA 2KDIA 3PV1A 5DPTA 5AZGA 3VTWA 1SIFA 2AYOB 3DDCB 4E71A 2KJ6A 1WE7A 3L17A 3PS6A 2IYDB 4NQLB 1JRUA 2K25A 1X1MA 1XQQA 4OVUA 2KHWB 3HM3A 1UGMA 4HJKA 3EFUA 2JUOA 4CYEA 2ASQA 2RSUA 3VH4B 2CHWA 4HWIB 4MJSA 4FA6A 2C7MB 3N32A 3A33B 4I6LB 2HJ8A 2KJRA 3H7PA 1IYFA 4HPMB 4W9IA 3JW0X 3Q3JA 4MEMA 2EMSA 2GMIC 2BYVE 2R2QA 2REXA 3H9DA 1WZ3A 3EHVA 4GB9A 4PS8A 4BOZB 3A9KB 3NZSA 1P98A 3PPAA 3N30A 1WM2A 1C1YB 3V60A 2KMCA 3U30A 2AWTA 2GBKA 2L3ZA 1GUAB 1V49A 4ICVA 4JGHB 4EUTA 1EO6A 4HLEA 2WWZA 1WX7A 1SGHA 2JY6A 2KWCA 3APDA 3P2BA 3DPDA 3QHTA 4GSWA 4WJOA 4BKSD 4DWFA 2KDFB 3ALBA 2MSED 2L7RA 2DHZA 4GDKB 1E7VA 5LXHA 2MWSB 1I35A 1RAXA 1V80A 2ZNVC 3ECIA 3PVLA 4A20A 4WJQA 4MJSB 3JSVA 3AU4A 3UINB 3K9OB 3TMPB 3N3KB 2C7NB 1TTNA 3H7PB 1Q5WB 1EF5A 1P1AA 4EZJA 3EC8A 3QARA 3I3TB 3Q3FA 4E3CA 1WMHA 3VTUA 1F9JA 2LASA 2NBVB 3KYDD 2FCQA 5G2NA 1J19A 2C60A 2UYZB 5CTRC 3VFKA 4GU2A 2BWFA 3L13A 4GDLA 3ZNID 4MGYE 1TGZB 4HXDA 4W9CA 2CHZA 1J0GA 4FADA 4B6WA 2V3SA 2KXJA 2LGXA 5DPRA 5HKHA 5IA7A 3DBLI 4IM0A 4NPNA 2XBBC 4KDIC 1E7UA 2MP2A 1WXSA 2LD9A 2WX1A 4BVUC 4KIKA 1WRDB 4DDGD 3DVGY 2MW5A 5J18A 1WX8A 1V2YA 5CHFA 3PTFC 2V1YA 1WXMA 3JSVB 1V5OA 2ZPNA 3D32A 3DVGX 1WF9A 3H6NA 3KUDB 3MHSD 3R3MA 3R7RA 2RR9A 2MCNB 3VUWA 2N7DA 4RMAA 2KO3A 3L08A 5LXIB 1LFDA 2DZIA 3ML8A 1R4MI 2HE7A 2L0TA 2PE6B 3BINA 3SHQA 2J0MA 4XX5A 4MSQB 1E8ZA 1AARA 3CMMB 2MQJA 5GMVA 3A4SC 3PRMB 1WMHB 4BKTA 3UQBA 3ZTCA 4MELA 4HK2A 4MDKE 2J0JA 3PLVA 3QAQA 1KOTA 1WE6A 3ZLZA 4TQ0A 2IZVB 3QQ8B 2LUEA 4KV2A 3H7SA 1E8WA 2GOWA 4GN1A 4NNJB 4A3OA 5C23A 2RD0A 2PEAA 3PHXB 3OLMD 1WGRA 1PQSA 2G4DB 3NOBA 2KTRA 5KHOA 4F7ZA 2LVPA 4KIKB 1J8CA 3LDZE 5J17A 5AZFA 4AJYB 2KMAA 2N9EB 1VCBA 3LJ3A 1CMXB 3WAMA 2K8BA 3X23A 2C9WB 2NBWB 1OTRB 4GDLB 4RM8A 3SD5A 1GJZA 3QJZA 3T8MA 3A4RA 4K81A 2BYFA 2LXCA 1WR1A 2JT4B 3PLUA 1WJNA 4EOYA 2CHXA 4EFOA 1MG8A 2L00B 2KTFA 3M63B 3ZW3A 1E8YA 2KD0A 3V6EB 4WWNA 3KUZA 5FR6A 2AL6A 2AL3A 3PT2B 3VHTC 3ZO5B 4X57B 2K39A 2XK5B 3PGEA 4IWPA 3VTVA 4HPLB 2NPTA 2LGYA 2V4LA 3MTNB 3NY5A 4GDKA 2FNJB 2KTRB 5DPSA 3ZRFA 2BYEA 4JLCA 2BKRB 3A9JA 2ZCBA 4ZRJA 2UWQA 2K8CA 4KZCA 1C3TA 2M17A 1YIWA 4WWOA 1IP9A 1YD8U 3DBHI 4GMVA 3ZUNA 4ASWC 2G45B 1YX6B 2A4ZA 1TZ1A 3ENEA 5L95C 2VRRB 2N4FA 1Z2MA 3IVFA 1UBQA 1YJ1A 4FHJA 2KC1A 4FJVB 2ZJDA 5D94A 5KHQA 2N1WA 3H1UA 3V6CB 4RM9A 2ZNVB 3KW5B 4MGIE 1L7YA 3TCAA 1NDDA 4G3XB 4WQOB 4LCDE 4LJPB 4ZYNA 4HVBA 3U8ZA 2NPTB 5D2MB 5E6PA 4FJZA 2KVRA 2MBBB 3AU5A 4II2B 4NY0A 4ZDVA 2I1KA 4MGZE 5CHWA 2ZVOA 1V6EA 3A9JB 3VXWA 2KQSA 3W1SC 2KZRA 4JL9A 2Y5BB 1FXTB 4TUUA 3IHPC 5L83A 3RD2A 3ZNGC 1WXVA 2A5UA 3ZNHB 1WIAA 2KQ7A 3HK0A 2WYQA 2JRHA 4BKSA 5D7GA 4DXAB 2BKFA 3DBSA 4MSMB 2R2OA 2NBUA 1E5WA 2CKHB 2FCMA 3SDLC 3PRZA 2CU1A 5JHBA 2RPQA 2FAZA 3WANA 3VUXA 1R4NI 4GOCA 1WX9A 2NS5A 2JZZA 3M95A 4W9KA 1WGHA 3U7DA 2CR5A 3PREA 3UIPB 2LRUA 3V62A 2KX0A 2NVUI 3PZDA 1WJUA 2KDBA 4MGKE 2I1JA 1P0RA 3DVNV 3SU8X 4OVVA 2K6QA 2N9PC 2WDTB 1WJ6A 4PYUA 4AOFA 3NS8A 2N9XA 4MM3A 1S3SG 4DHJD 2FCSA 2MBQA 1K8RB 1GC6A 4HCPB 3W1YA 1P9DU 2LJ5A 4W9HA 1BT0A 2W9NA 2PE9A 4FN2A 4LDTB 3R66C 2LVQA 2KWUB 3B0AA 4TV3A 3VH3B 4AWJA 4DK5A 4WJNA 1Z5SB 5DPWA 2FIFA 2MBHA 1EF1A 1YX5B 2K6DB 3VDZA 2J7QB 3QWZB 4JIOU 3ZTDA 1WGGA 2MA9B 4NAWA 1GG3A 2M1MA 1QZEA 3CF6E 3EECA 2XK5A 3QIJA 4TQ1A 4F8CB 1V9JA 2O2VB 3VQIA 3WIMA 3AXCA 1XT9B 4KVGB 4FBJB 4G0NB 3T9LA 2DAJA 1WR6E 3CSTA 3WAOA 3PRPB 1G6JA 3VVWB 4P7IA 1V81A 1WI0A 1VD2A 1WZ0A 4PS3A 3QA8A 2DYOA 1WJ4A 1H4RA 4WAAA 3DOWA 4BOSC 2ZEQA 4MH0E 3CSFA 4HCNB 1S1QB 3WAPA 4XZ4A 4TKNA 3DBRI 2D07B 1WGYA 4FULA 4EZLA 1D3ZA 1RFAA 4FJYA 2LVOA 1H8CA 2ZVNA 3VAWA 4KSLC 3AULA 3IG3A 3M62B 5LLIA 2IO3B 4HDQA 1KM7A 1ZKHA 4W9LA 4KDLB 5E6NA 2LI5A 3QK0A 3W1SA 2L05A 1UD7A 3ZDTA 4AJWA 1LQBA 1ISNA 2JF5A 4J6IA 4NAWB 1KJTA 1RRBA 3KH0A 2GBRA 1RLFA 3L16A 2JXXA 1XD3B 1V86A 3RUIB 3QX1A 2MRPA 2M4NA 2PPHA 2FIDA 2KOXA 4LDTD 4DHZB 4F1SA 2IBIB 5G55A 3TBLD 2MBEA
chains in the Genus database with same CATH superfamily
4A55A 4GIVA 2IO0B 5HI1A 2JWZA 1K51A 2J0KA 2WU5B 1Q0WB 2BPSA 4GLSC 2KNBA 2KLGA 2B3AA 3ZIMA 3AH7A 2HTHA 3M3JA 3AV8A 4KZ0A 1NEKB 1JQ4A 1UH6A 4NJ7A 4P1CC 2LZ6A 4KGRA 3ABVB 1EWYC 4IWQA 1ZGUB 5I4DA 5C1ZA 1PYWD 4C4VA 2QHOA 1TS3A 1JWAD 1OQRA 1BXTA 1N62A 2IO2B 5E6OA 2LHDA 3K9PB 1KLVA 5DCNA 4A3PA 2N0SB 4USAA 3Q3MC 1WFYA 1HZ5A 5BYSA 2KWVB 4KGSA 2ZCCA 3IBEA 1HEZE 2RMMA 3ZNZB 1HTOA 1T6BX 1D5XC 3WALA 4GGQA 2JRIB 2Z59B 4ANXA 2BS4B 4WJPA 5JHAA 1RM6C 3ONSA 4M00A 2GBJA 4EEWA 1XO3A 2VH2A 1B9RA 5FK9C 3DHHC 2BT6A 2WDRB 4C80A 2OOBB 4ANVA 4NJ6A 5IAAC 2WDVB 1ROEA 1WXQA 3L10B 1E9MA 2DENB 1I4HA 3BVGA 4CHKA 1YOVB 2KX3A 1UF0A 2MP2B 4C00A 3Q3NC 5TR5A 4NQKE 3QCAA 3TIXA 1SJHD 4S17A 2G3QB 2MJEA 1LM8B 3AI5A 1HXYD 4OW0A 2ON8A 2C7HA 5JZEB 3WA0A 2BBCA 2DZKA 2KDIA 3PV1A 5DPTA 3DDCB 4E71A 3N1XC 1WE7A 1JWBD 1TS5A 1X1MA 2CJOA 1WSPA 2CU3A 2ASQA 4HWIB 2KVZA 2C7MB 4I6LB 3H7PA 4HPMB 3B9JA 2AQ1B 3JW0X 2R2QA 2PVGC 1WZ3A 4PS8A 3A9KB 3NZSA 1P98A 2RDBC 2AWTA 4TSSA 1NYRA 1V49A 1E0ZA 5IOIA 1MPEA 4HLEA 3J9CA 4C7ZA 3APDA 3P2BA 2XN9C 2KDFB 2MSED 4GDKB 1JWMD 1YQ4B 5TSSA 3PVLA 4A20A 4HKZE 4MJSB 3JSVA 2JYEA 3CWIA 3TMPB 3N3KB 1V8CA 2C7NB 3MJ5A 1TTNA 3DWMA 3H8HA 1FRDA 1ET9A 3BYTB 3EC8A 3QARA 2BS2B 2NBVB 2UU7A 2UYZB 3VFKA 4GU2A 3RN9C 3Q6BA 4MGYE 2CHZA 4FADA 2M56B 2LGXA 3DBLI 1FRRA 4BVUC 4KIKA 2WXQA 5H8YE 5J18A 4GDLA 1WXMA 3KUDB 2ZPNA 3D32A 3DVGX 3H6NA 1J0GA 2MEKA 2RR9A 3SFEB 1DOYA 1R4MI 4K3CA 5BMIA 2J0MA 4XX5A 5GMVA 3A4SC 1WMHB 1T0QC 4HK2A 4MELA 3QAQA 1KOTA 1GOZA 4TQ0A 4KV2A 2GOWA 5C23A 2PEAA 3OLMD 1WGRA 2KTRA 5KHOA 4F7ZA 3LDZE 1C79A 3AE2B 5AZFA 5FR3A 2KMAA 3P4RB 1VCBA 4ZHOA 1CMXB 4RM8A 3VR9B 3HVZA 1GJZA 4N59A 1C4AA 3A4RA 4H2AA 2BTEA 2BYFA 4MT5A 4RGNA 2JT4B 3V05A 2CHXA 1MG8A 2QCZA 1RYJA 3V3XA 2L00B 4B0MA 1UGJA 3R2TA 4A8XC 1GB4A 2BVCA 3ZO5B 2WXNA 4JX1C 1KRHA 1SXTA 1D3ZA 3ETRA 2K8CA 4KZCA 2M17A 4WWOA 2WDQB 3DBHI 3ZUNA 4ASWC 2A4ZA 2I2YA 1TZ1A 3ENEA 5L95C 2VZKD 1YJ1A 4FHJA 2ZJDA 3H1UA 2ZNVB 4MGIE 4WIPA 1VRAB 2X38A 3TCAA 3TEXA 1HTQA 4JWUC 1PUTA 2PIAA 3RNFC 3U8ZA 5D2MB 3NVYA 4FJZA 2KVRA 4ZDVA 2I1KA 4OZAA 4MGZE 5D3IB 2ZVOA 3A9JB 1L0XB 4TUUA 1WXVA 3HK0A 2JRHA 2HTME 3Q8AA 2NBUA 1E5WA 3SDLC 3WCQA 3NUHB 1L4DB 4ZOHC 3VUXA 1KH0A 3DBLB 2NS5A 2JZZA 2KYWA 4W9KA 3UIPB 1EWCA 1P0RA 2ACZB 4OVZA 4AOFA 4XWTA 1R4MB 1TS4A 3AE4B 2G9HD 4DHJD 1K8RB 3W1YA 1ZE3D 3U7ZA 2PE9A 2LHEA 5DPWA 1GPXA 2MBHA 1HZ6A 1FXIA 4JIOU 1QOFA 2ONQA 1FFUA 1QZEA 3CF6E 2XK5A 3KWVA 5JXVA 1CJEA 4OHJA 3PRPB 4BZAA 2QSDA 1UUPA 1VD2A 2AQ2B 1N5XA 2DYOA 1WJ4A 1H4RA 3DOWA 4C7YA 1XCQL 2ZEQA 3AEFB 4MH0E 2OHFA 3CSFA 1S1QB 3NJTA 4FULA 2D3CA 4FJYA 1H8CA 2ZVNA 2IO3B 4W9LA 3ZDTA 2NTSA 2L05A 4ARIA 1LQBA 1ISNA 3URYA 4NAWB 1KJTA 1TIFA 2YEPF 4KX6B 2JXXA 1WYGA 1V86A 4M02A 3O13A 2M4NA 2JZPA 1Y56A 1WWTA 3Q8CA 4JPSA 3N9YC 2MBEA 3IAS1 3APFA 2N7EA 2L76A 3R2IA 2LGDA 2L32A 4IC7B 3RNCC 4GXBA 3APCA 3HM6X 2EKIA 1F2RC 4XGAB 2K3UA 1SIJA 3V61A 3KVFB 3KYCD 2IY1B 1OEYA 2OEDA 3Q2AC 3GZNI 1GC7A 2D11A 2JZ3B 4KSKC 1I4RA 1VZ6A 3ZYYX 2DAFA 2MX2A 2BB5A 4RH6A 1JROA 1LXDA 4HPPA 4PS7A 4A9AA 2L0FA 2IY0B 2QJLA 3PSEB 4LJOB 2MBOA 2K1FA 1M94A 1FNWA 1OQYA 2WXFA 4W9EA 2JPHA 2BB6A 2KFKB 2O6VD 1L0VB 4W9FA 2NR2A 1F52A 3RZWC 2YLMA 2PW9A 3JYUA 3NZUA 2O2VA 1GNUA 5BO4B 1VZ8A 3I5JC 4M8MA 1IPGA 5T8IA 2BWES 4E74A 2XEWA 3GB1A 3AN1A 1XLQA 2BW2A 1SSNA 1UELA 2DYBA 2IO1B 4M0WB 1QOAA 1N6ZA 3IFWB 4K7UA 4DHZE 4MACA 1C4CA 3IT4B 1PFDA 2LFIA 1KLUD 2QEJC 1IUEA 3RZFA 4YL8A 3UI3A 3BZDB 4K1RB 1FPYA 5GXGB 3KQ4A 2DYMA 1EUVB 2D2QA 3RCZA 2O6VA 3VUYA 3FAHA 1RWSA 3RMKC 2NCNA 1FM0D 1WYWB 2GBMA 2LMCA 4ZRIA 1A70A 4BBNF 1ZXIA 4W9DA 4XC2A 2GBNA 1IGDA 5D6JB 3W9CB 2WXGA 1WY8A 4P6VF 3BYYB 4IG7B 2M0XA 1P3QU 4OZBA 3P4SB 1N5WA 4IUMB 2KANA 3AE5B 1IBXB 4XWWA 2M8SA 4PK1A 2ZPYA 1OEYJ 3MJWA 2LXAA 3L0WB 5AZGA 3AEBB 2K25A 4OVUA 4RF1A 3I63C 3VH4B 5BMHA 2M0AA 1VR9A 4NZLB 1IYFA 4RFBA 3Q3JA 4MEMA 2EMSA 1E6EB 2REXA 4BOZB 3SR6A 1TYGB 4LNKA 1TKGA 4ICVA 4JGHB 1ACCA 1WX7A 2KWCA 2JY6A 4BKSD 3DPDA 3AEEB 4US8A 4DQOC 2L7RA 2K9XA 1I35A 3ECIA 4WJQA 2N9KA 4YTMB 5BYQA 3K9OB 3I57A 4EZJA 2IGDA 4ZHPA 3I3TB 3Q3FA 3TUOA 1F9JA 3KYDD 2QMTA 4LK0M 2K0PA 4HXDA 1P7EA 3Q8FA 1KF6B 2JX5A 2KXJA 5IA7A 5DPRA 5HKHA 1ZP0B 2XBBC 3NG0A 4NAMA 4WH4A 1WXSA 2LD9A 2SEBD 1WRDB 4DDGD 2DWQA 1KTKA 2V1YA 3QIJA 3VHTC 4BKSA 4YXDB 2MCNB 1LFDA 2TSSA 2HE7A 2L0TA 2PE6B 1E8ZA 2NMQA 4BKTA 3UQBA 3AEDB 3ZTCA 4MDKE 2J0JA 1HA5A 3ZLZA 3QQ8B 2LUEA 5EE3A 2YEPB 3H7SA 1FIQA 4NNJB 4A3OA 2MH7A 1PQSA 4HKQA 3NOBA 1J8CA 1I4GA 4AJYB 2N9EB 3QJZA 3T8MA 3TEYA 1SE3A 2LXCA 3PO0A 1K52A 3PLUA 3SFDB 3M63B 1GB1A 3V6EB 4WWNA 5FR6A 2AL6A 3PT2B 5HHDG 1TKEA 2G1EA 4X57B 2XK5B 3VTVA 2V4LA 3MTNB 1AYFA 4WQMA 2ZCBA 1J7CA 2LUMA 1C3TA 1YIWA 4GMVA 4AS1A 2W55A 2J53A 1UWXA 4FJVB 3R8BA 3IAM1 4MH8A 1C78A 1L7YA 1QOGA 2GRIA 5IN7A 4G3XB 4L1BA 4LCDE 3MHZA 1KFYB 4ZYNA 4HVBA 1C4PA 3BIID 2NPTB 5E6PA 4II2B 2WXHA 1CQVA 2KQSA 2KZRA 2H88B 5FKAC 2GI9A 1XEEA 3IHPC 3RD2A 2A5UA 5D7GA 4DXAB 4LNIA 3PRZA 2RPQA 2FAZA 3FILB 4WAFA 1L0YB 1WX9A 1DOIA 4HJGE 2CR5A 3V62A 2NVUI 3PZDA 4RGMA 2I1JA 3B2FA 3SU8X 1WJ6A 1YN5A 4LNOA 1S3SG 2M19A 1YN4A 2JQRB 2N9LA 1GC6A 4HCPB 4IKGA 1Q10A 1YMHE 1PGBA 2INPE 3VH3B 2KWUB 3B0AA 4DK5A 1JWUD 1Z5SB 4YSZB 5LNK1 2FIFA 3VDZA 1D5MC 3QWZB 4AQ7A 3ZJUA 2O2VB 3VQIA 4EE2A 3TSSA 4A6QA 2QILA 1FFVA 4RNAA 1G6JA 2BS3B 3VVWB 2LGIA 4P7IA 1V81A 4PS3A 4MM3B 4DXFA 3QA8A 4WAAA 4BOSC 4J3OD 4XZ4A 4TKNA 3DBRI 2D07B 1RFAA 5C3JB 5BYRA 3EGRA 3IG3A 4L23A 2WS3B 1JALA 4EKUA 2WXJA 3QK0A 1UD7A 1JMLA 2JF5A 4J6IA 2J42A 1RRBA 3L16A 3BK2A 1XD3B 2SAKA 3CIRB 3GE3C 2WP9B 2KOXA 2MJ3A 2IBIB 1HE8A 2KK8A 1PGAA 3DCGA 2L1AA 1Q1OA 4XYCA 3Q14C 3R7QA 2FE8A 2JSVX 3S2AA 2BQQA 4JQWC 2L8JA 1SJED 1BMLC 1B1ZA 4BFRA 2PLPA 4ICUA 5HG2A 1R7SA 4BKGA 4ANUA 1U4AA 1QLBB 2E6XA 4K7WA 2PVOD 4YSYB 5AZHA 3Q8BA 2LRWA 2EMTA 2OJWA 2KDEB 3C0RB 2K8HA 4ZRKA 3ML9A 2INNE 2LEKA 3OJ3A 1TBEA 3JVZX 4IOIE 4IWOA 2IGHA 2G4SA 1IGCA 2Z0EB 3ZGZA 3E9SA 2ZZPB 5CX3A 4NJCA 2FUHB 3DVNU 3B1LX 2KC2A 2V4IB 1A5RA 3X0WA 4G11A 4N6EB 3RNAC 3O65B 4P16A 1D4BA 5JH5C 4I6NB 1TT5B 4C4VB 2RGFA 5EE1A 4W9GA 4B0EA 4IM3A 2MJDA 3RT3B 4RCOA 5C2TB 3RULA 1YQBA 3GOEA 3MP9A 4N9F4 1T0YA 2DX5B 3DQVA 3OAWA 2W54A 2KFJA 5G5GA 3B08A 3NVWA 1N60A 2Z0DB 5EE0A 4EZKA 4IW0A 4RF0A 3NHEB 4RGOS 1JWSD 4L2YA 1WGDA 2CS4A 4BBNC 5EDSA 1I42A 3A1QA 1N61A 3ZVVA 1E90A 4PYZA 2WXKA 1V97A 3L54A 2FCNA 1I4PA 3ZDMC 1FNVA 1UBIA 3BWUD 2MLBA 4KGTA 3ZKJC 2PJHA 5AEKB 1XF5L 1E8XA 1SE4A 1I4QA 4K3BA 4YTNB 3A9KA 1TY0A 3DBHB 3QC8B 4XDDA 4DBGA 1F0ZA 1VZ7A 1SIFA 2AYOB 2KJ6A 3PS6A 1JRUA 3W2DA 4HJKA 1UGMA 3EFUA 1CK1A 2JUOA 4MJSA 1T3QA 3A33B 2IPKD 1D5ZC 2HJ8A 4W9IA 1QF6A 2BYVE 3H9DA 3EHVA 1ZOYB 3PPAA 3C19A 1WM2A 1C1YB 3V60A 3U30A 2GBKA 2L3ZA 3OG5A 2Q5WD 3AEGB 1DOXA 2W82A 4EUTA 1JCKB 4PT5A 1SGHA 4LLGM 3BVMA 4DWFA 3ALBA 5LXHA 3ZJTA 1RAXA 1V80A 2ZNVC 3NRZA 2QDFA 3HRDD 2KAJA 2V9HA 3H7PB 4E3CA 1WMHA 2LASA 5G2NA 2FCQA 2KACA 1J19A 2K5PA 1I7HA 1T0SC 4W9CA 4ZRQA 3RNEC 4B6WA 2ZW1A 4LTUA 1ZXHA 4NPNA 4KDIC 1TKYA 1E7UA 1PGXA 2WX1A 3DVGY 1WX8A 5CHFA 3PTFC 3JSVB 1V5OA 4LNNA 2HDEA 2N7DA 3MC8A 4LNFA 2DNFA 3NS1A 4RMAA 3RNGC 2DZIA 5LXIB 3ML8A 2FUG1 4IDIA 1TJEA 3SHQA 2MQJA 1E10A 3PRMB 1FD6A 3PLVA 1WE6A 3T3OA 2VH1A 5D3DA 4R3DA 5HFYA 3AE6B 1ET6A 4ITKA 1E8WA 1AW7A 3FKYA 4GN1A 1L6UA 1FNUA 3E56A 4KKIA 5BMGA 4P1BC 4KIKB 1NENB 1FEHA 3LJ3A 3WAMA 3X23A 3AMZA 2C9WB 2NBWB 1OTRB 4GDLB 2INDC 4XE0A 1WR1A 1WJNA 3L4PA 2KN4A 1E8YA 1FO4A 4WWMA 3ZRFA 3NY5A 2KTRB 5DPSA 2BYEA 4JLCA 1ZDXA 3A9JA 3GZNB 4ZRJA 3IT6B 1STEA 2WXPA 2UWQA 2D5GA 1FCLA 1IP9A 1YD8U 2G45B 2N4FA 3IVFA 2KC1A 2N7JA 5D94A 5KHQA 3V6CB 2J52A 2WQYB 4RM9A 3KW5B 3MC0B 2Y5CA 2JXTA 1NYQA 4WQOB 1XLPA 4LJPB 3LB8C 3U4EG 1V1PA 2Z8LA 3Q8EA 3AU5A 4NY0A 5CHWA 3VXWA 3W1SC 1QOBA 4JL9A 2Y5BB 1FXTB 3ZNGC 3ZNHB 1WIAA 2KQ7A 2B76B 2WYQA 2RPVA 2BKFA 3DBSA 1VDVA 2R2OA 3EUB2 4MSMB 1PDXA 2CKHB 2FCMA 1FXAA 4YSXB 2CU1A 5JHBA 3WANA 3BK1A 1R4NI 3DHIC 4GOCA 3U7DA 2LRUA 2PMVA 2KX0A 3Q69A 1WJUA 1XLNA 3DVNV 1YNTE 2WXRA 4OVVA 3NVZA 2K6QA 3AE8B 2N9PC 4PYUA 1K50A 1L6VA 3P4PB 3NS8A 1CZPA 2H89B 2FCSA 2MBQA 3I9V1 3TEZA 1P9DU 2LJ5A 4W9HA 3PZ8A 4FN2A 4ZRPA 2W3SA 2V3NA 1ENFA 1TZOA 3KLSX 1YX5B 2K6DB 2HJ1A 3ZTDA 2VZKB 1WGGA 2MA9B 4NAWA 3GE8C 3EECA 1TY2A 2IGGA 2M1MA 4TQ1A 4F8CB 1V9JA 1NVID 4KVGB 4G0NB 4RGTA 2DAJA 1T0RC 1WR6E 2R61A 3CSTA 3WAOA 1WZ0A 3VRAB 2JWUA 1WGYA 4EZLA 2QC8A 3ZXRA 3AULA 3M62B 1YN3A 2JYTA 5LLIA 4HDQA 3W1SA 1ZKHA 3DHGC 1I4XA 2L52A 5E6NA 4AJWA 4CQNA 3KH0A 2BYTA 2GBRA 1RLFA 1JW9D 3RUIB 2MRPA 2PPHA 4DHZB 4LDTD 4F1SA 4HRSA 3OWEB 1F2RI 5G55A 1SEBD 3TBLD 1XCTL 3UQAA 2WX0A 4AP4C 1OQQA 3BY4B 1MHHE 3P1MA 4HDOA 2DBYA 3A1QB 5IO9A 1MG4A 2WXIA 3OJ4B 2L83A 2Y3AA 2KFKA 4DHJB 2KN5A 4ANWA 3LXFA 1ZUD2 3RYTA 1V5TA 1QILA 4JWSC 2LJIA 1WM3A 2EELA 2AQ3B 4M0WA 4IM2A 2D3GA 3RI7C 2OJRA 2WHIA 2KLCA 3U52E 4II3B 2KJHB 1SE9A 4FXCA 3HIZA 1Y8RC 2GB1A 2LGSA 1P7FA 4URKA 1YJJA 4OZCA 1R4NB 2K22A 3MFGA 3UIOB 5IKCM 2JVCA 5IP4D 3TEWA 3ZRCA 2DZJA 1HQRD 1ZDVA 4W9JA 1L5PA 3Q3OC 2AEHA 4HROA 1NBFC 3DWGC 1WXAA 2WXLA 1ZW7A 4B95A 4M8NA 1SF0A 3PHWB 1ZPSA 3UGBB 4B9KA 1UNSA 2JU6X 4FLHA 2KQ4X 1SBBB 4FHKA 1VLBA 4TMAB 1WH3A 4WWPA 3N1YC 2HD5B 3EFCA 3AM9A 1NI2A 1OGWA 1C77A 1L4ZB 2N1VA 3TJPA 4AUQC 4G50A 2BF8B 5G5HA 5MPOA 4WURA 2KKCA 1WRIA 1UWMA 2X8XX 1UZXB 3TL5A 1C9FA 1IBXA 1FCCC 1OFFA 2DZMA 4I6PA 4K7SA 4REZA 2LWPA 2RDGA 3HHMA 4CO7A 2YVCA 2D10A 2C5LC 1KLGD 1L2NA 4DDID 3KUCB 1MFWA 2BGFA 2W3RA 5CHVC 2QIEB 1DGJA 2WNMA 3VRBB 1J7AA 1F1HA 3KWLA 5J2RA 2O6VB 2AX5A 2EKEC 2V0GA 3UF8A 3AE9B 3VTWA 3L17A 2IYDB 4NQLB 3GP7A 1XQQA 2KHWB 3HM3A 4CYEA 2RSUA 1C76A 2CHWA 2J4XA 4FA6A 3N32A 2KDMA 4DXGA 3AE3B 2KJRA 2KMMA 4GB9A 2GMIC 3NVVA 2ICIA 3N30A 1FMAD 2KMCA 1GUAB 1DYQA 1EO6A 2WWZA 3QHTA 4GSWA 4WJOA 4HEA1 1E7PB 2DHZA 1E7VA 2MWSB 1MI0A 3W5UB 3AU4A 3UINB 2D3BA 4ACFA 3FC4A 1Q5WB 1EF5A 4JE3B 1EU3A 1P1AA 1TS2A 1M4VA 2CJNA 1SE2A 3VTUA 2WXOA 3ZJVA 2C60A 1MVKA 5CTRC 2BWFA 1BUIC 3L13A 2PTLA 3ZNID 1TGZB 1YQ3B 2V3SA 4IM0A 1V1PB 2MP2A 4A90A 2MW5A 2WU2B 1V2YA 3MHSD 1WF9A 3R3MA 3VUWA 3R7RA 1QT9A 2KO3A 3L08A 2Y5PA 4BAXA 3BINA 4MSQB 1AARA 3CMMB 2I38A 4C56C 1D6EC 3DBRB 2IZVB 3AEAB 2E3TA 2RD0A 3PHXB 2G4DB 2GLSA 3AB5A 2LVPA 5E6JA 5J17A 4YTPB 2K8BA 3SD5A 4K81A 1V1OA 2RDHA 4EOYA 4EFOA 2V3PA 2KTFA 3N20C 3ZW3A 2KD0A 3KUZA 1WGKA 4S0RA 2AL3A 2IDYA 2K39A 3PGEA 4IWPA 4HPLB 2NPTA 2LGYA 1NI3A 4GDKA 2FNJB 2BKRB 4ZYSA 3HVDA 3VR8B 1YX6B 1JRPA 2VRRB 1Z2MA 1LGRA 1UBQA 2D3AA 2N1WA 3FILA 3N1ZC 3T3NA 5AUIA 1EM7A 1NDDA 2MHJA 3ZQ4A 3LYYA 3NZ3A 2MBBB 3RFZB 3AE7B 1V6EA 2WLBA 4O1NA 2ZW0A 2KT7A 4YT0B 3PZ7A 5L83A 1VJKA 3HUIA 3GS2A 2NTTA 2IJ0A 1XLOA 3P4QB 1ESFA 3M95A 2WGSA 1WGHA 3AECB 3PREA 2KDBA 4MGKE 1LO5D 1K53A 1MHXA 3AE1B 4N58A 1AWDA 2WDTB 2KWDA 1RFKA 2N9XA 2XNAC 4MM3A 1QKZA 4ARCA 4QAYA 1BT0A 2W9NA 2INCC 1GAQB 4LDTB 3R66C 2LVQA 4AWJA 4TV3A 4WJNA 3C8YA 1EF1A 3RNBC 2J7QB 1T5XD 4D2KA 1J7BA 1GG3A 4XDCA 3BVZA 1N63A 4US9A 3EA6A 3WIMA 1MJDA 3AXCA 3RPFC 1XT9B 4FBJB 3T9LA 1EU4A 4UDUC 1XXGA 1WI0A 2DLBA 3ZXVA 2PKOA 3MC9A 5AUKA 4HCNB 5H92C 3WAPA 3P63A 1YJIA 2LVOA 3B2GA 4Q2JA 3VAWA 4KSLC 1KM7A 4KDLB 2LI5A 3SEBA 1AN8A 1SB3C 2WXMA 1QQRA 3U2SC 2FBWB 3QX1A 4KKJA 3IXSA 3W5VB 4M01A 2FIDA 5EE9A 4YWGG 3P42A 1F77A
chains in the Genus database with same CATH topology
3UQAA 3APFA 2N7EA 2L76A 2WX0A 1HE8A 2LGDA 2KK8A 4GIVA 4IC7B 4AP4C 4GXBA 3APCA 3BY4B 2IO0B 3DCGA 1Q1OA 2JWZA 3HM6X 4HDOA 2J0KA 3A1QB 3R7QA 1Q0WB 3OJ4B 2BPSA 2KNBA 3S2AA 2KLGA 3V61A 3KVFB 2B3AA 2KFKA 2L8JA 3KYCD 4JQWC 3ZIMA 2IY1B 4DHJB 2KN5A 2HTHA 3M3JA 4ANWA 4BFRA 4KZ0A 4ICUA 1OEYA 3RYTA 1V5TA 4BKGA 4ANUA 1UH6A 1U4AA 3GZNI 1GC7A 2D11A 4NJ7A 2JZ3B 4K7WA 4KSKC 2LZ6A 4EKUA 1WM3A 2DAFA 5AZHA 4IWQA 2MX2A 1ZGUB 1LXDA 2D3GA 4IM2A 4PS7A 2L0FA 2OJRA 2IY0B 3PSEB 2KLCA 4LJOB 2MBOA 2KJHB 2K1FA 4II3B 2LRWA 1SE9A 2EMTA 1M94A 3HIZA 1Y8RC 5C1ZA 2KDEB 3C0RB 2K8HA 4ZRKA 3ML9A 4URKA 1OQYA 2QHOA 4W9EA 2IO2B 2JPHA 5E6OA 3OJ3A 1TBEA 2KFKB 3UIOB 3JVZX 2O6VD 4W9FA 3K9PB 1KLVA 2NR2A 2JVCA 5DCNA 4A3PA 3RZWC 2YLMA 4IWOA 1WFYA 2G4SA 3JYUA 3ZRCA 3NZUA 2DZJA 2O2VA 1GNUA 2Z0EB 5BO4B 4W9JA 2ZZPB 5CX3A 4M8MA 1IPGA 2FUHB 2BWES 2KWVB 3DVNU 2XEWA 4E74A 2ZCCA 3IBEA 2AEHA 3B1LX 1UELA 1NBFC 2DYBA 2IO1B 2KC2A 4M0WB 3ZNZB 3IFWB 4K7UA 1A5RA 1WXAA 3X0WA 3WALA 4G11A 1ZW7A 4GGQA 4B95A 4M8NA 2JRIB 4DHZE 3O65B 2Z59B 4ANXA 4WJPA 3PHWB 5JH5C 5JHAA 4I6NB 3UGBB 4B9KA 2RGFA 4FLHA 4W9GA 3ONSA 2GBJA 3RZFA 4IM3A 4EEWA 4YL8A 4FHKA 3RT3B 4K1RB 1WH3A 4WWPA 2DYMA 3RULA 1EUVB 1YQBA 2D2QA 2HD5B 1T0YA 3GOEA 4N9F4 1NI2A 2DX5B 3RCZA 1OGWA 3DQVA 3OAWA 2KFJA 2N1VA 3TJPA 3B08A 4G50A 2OOBB 4AUQC 2BF8B 2O6VA 4ANVA 2KKCA 4NJ6A 5IAAC 3VUYA 2Z0DB 1UZXB 3TL5A 4EZKA 2DZMA 4I6PA 4IW0A 4K7SA 2NCNA 2LWPA 3L10B 1WYWB 3HHMA 3NHEB 4CO7A 2GBMA 2YVCA 2DENB 2D10A 1WGDA 4ZRIA 2C5LC 2CS4A 4BBNC 5EDSA 4CHKA 1I42A 4BBNF 3A1QA 1L2NA 2KX3A 3ZVVA 1E90A 4W9DA 4PYZA 3KUCB 4DDID 2BGFA 4XC2A 3L54A 5CHVC 2GBNA 2MP2B 2FCNA 5D6JB 5TR5A 3ZDMC 4NQKE 1UBIA 3QCAA 1WY8A 3TIXA 2MLBA 2G3QB 4IG7B 2M0XA 3ZKJC 1P3QU 1LM8B 5J2RA 2PJHA 5AEKB 1E8XA 2O6VB 3AI5A 4IUMB 2KANA 3A9KA 2EKEC 3QC8B 2M8SA 3UF8A 2C7HA 2ZPYA 1OEYJ 3MJWA 5JZEB 2LXAA 3L0WB 3WA0A 4DBGA 2DZKA 2KDIA 3PV1A 5DPTA 5AZGA 3VTWA 1SIFA 2AYOB 3DDCB 4E71A 2KJ6A 1WE7A 3L17A 3PS6A 2IYDB 4NQLB 1JRUA 2K25A 1X1MA 1XQQA 4OVUA 2KHWB 3HM3A 1UGMA 4HJKA 3EFUA 2JUOA 4CYEA 2ASQA 2RSUA 3VH4B 2CHWA 4HWIB 4MJSA 4FA6A 2C7MB 3N32A 3A33B 4I6LB 2HJ8A 2KJRA 3H7PA 1IYFA 4HPMB 4W9IA 3JW0X 3Q3JA 4MEMA 2EMSA 2GMIC 2BYVE 2R2QA 2REXA 3H9DA 1WZ3A 3EHVA 4GB9A 4PS8A 4BOZB 3A9KB 3NZSA 1P98A 3PPAA 3N30A 1WM2A 1C1YB 3V60A 2KMCA 3U30A 2AWTA 2GBKA 2L3ZA 1GUAB 1V49A 4ICVA 4JGHB 4EUTA 1EO6A 4HLEA 2WWZA 1WX7A 1SGHA 2JY6A 2KWCA 3APDA 3P2BA 3DPDA 3QHTA 4GSWA 4WJOA 4BKSD 4DWFA 2KDFB 3ALBA 2MSED 2L7RA 2DHZA 4GDKB 1E7VA 5LXHA 2MWSB 1I35A 1RAXA 1V80A 2ZNVC 3ECIA 3PVLA 4A20A 4WJQA 4MJSB 3JSVA 3AU4A 3UINB 3K9OB 3TMPB 3N3KB 2C7NB 1TTNA 3H7PB 1Q5WB 1EF5A 1P1AA 4EZJA 3EC8A 3QARA 3I3TB 3Q3FA 4E3CA 1WMHA 3VTUA 1F9JA 2LASA 2NBVB 3KYDD 2FCQA 5G2NA 1J19A 2C60A 2UYZB 5CTRC 3VFKA 4GU2A 2BWFA 3L13A 4GDLA 3ZNID 4MGYE 1TGZB 4HXDA 4W9CA 2CHZA 1J0GA 4FADA 4B6WA 2V3SA 2KXJA 2LGXA 5DPRA 5HKHA 5IA7A 3DBLI 4IM0A 4NPNA 2XBBC 4KDIC 1E7UA 2MP2A 1WXSA 2LD9A 2WX1A 4BVUC 4KIKA 1WRDB 4DDGD 3DVGY 2MW5A 5J18A 1WX8A 1V2YA 5CHFA 3PTFC 2V1YA 1WXMA 3JSVB 1V5OA 2ZPNA 3D32A 3DVGX 1WF9A 3H6NA 3KUDB 3MHSD 3R3MA 3R7RA 2RR9A 2MCNB 3VUWA 2N7DA 4RMAA 2KO3A 3L08A 5LXIB 1LFDA 2DZIA 3ML8A 1R4MI 2HE7A 2L0TA 2PE6B 3BINA 3SHQA 2J0MA 4XX5A 4MSQB 1E8ZA 1AARA 3CMMB 2MQJA 5GMVA 3A4SC 3PRMB 1WMHB 4BKTA 3UQBA 3ZTCA 4MELA 4HK2A 4MDKE 2J0JA 3PLVA 3QAQA 1KOTA 1WE6A 3ZLZA 4TQ0A 2IZVB 3QQ8B 2LUEA 4KV2A 3H7SA 1E8WA 2GOWA 4GN1A 4NNJB 4A3OA 5C23A 2RD0A 2PEAA 3PHXB 3OLMD 1WGRA 1PQSA 2G4DB 3NOBA 2KTRA 5KHOA 4F7ZA 2LVPA 4KIKB 1J8CA 3LDZE 5J17A 5AZFA 4AJYB 2KMAA 2N9EB 1VCBA 3LJ3A 1CMXB 3WAMA 2K8BA 3X23A 2C9WB 2NBWB 1OTRB 4GDLB 4RM8A 3SD5A 1GJZA 3QJZA 3T8MA 3A4RA 4K81A 2BYFA 2LXCA 1WR1A 2JT4B 3PLUA 1WJNA 4EOYA 2CHXA 4EFOA 1MG8A 2L00B 2KTFA 3M63B 3ZW3A 1E8YA 2KD0A 3V6EB 4WWNA 3KUZA 5FR6A 2AL6A 2AL3A 3PT2B 3VHTC 3ZO5B 4X57B 2K39A 2XK5B 3PGEA 4IWPA 3VTVA 4HPLB 2NPTA 2LGYA 2V4LA 3MTNB 3NY5A 4GDKA 2FNJB 2KTRB 5DPSA 3ZRFA 2BYEA 4JLCA 2BKRB 3A9JA 2ZCBA 4ZRJA 2UWQA 2K8CA 4KZCA 1C3TA 2M17A 1YIWA 4WWOA 1IP9A 1YD8U 3DBHI 4GMVA 3ZUNA 4ASWC 2G45B 1YX6B 2A4ZA 1TZ1A 3ENEA 5L95C 2VRRB 2N4FA 1Z2MA 3IVFA 1UBQA 1YJ1A 4FHJA 2KC1A 4FJVB 2ZJDA 5D94A 5KHQA 2N1WA 3H1UA 3V6CB 4RM9A 2ZNVB 3KW5B 4MGIE 1L7YA 3TCAA 1NDDA 4G3XB 4WQOB 4LCDE 4LJPB 4ZYNA 4HVBA 3U8ZA 2NPTB 5D2MB 5E6PA 4FJZA 2KVRA 2MBBB 3AU5A 4II2B 4NY0A 4ZDVA 2I1KA 4MGZE 5CHWA 2ZVOA 1V6EA 3A9JB 3VXWA 2KQSA 3W1SC 2KZRA 4JL9A 2Y5BB 1FXTB 4TUUA 3IHPC 5L83A 3RD2A 3ZNGC 1WXVA 2A5UA 3ZNHB 1WIAA 2KQ7A 3HK0A 2WYQA 2JRHA 4BKSA 5D7GA 4DXAB 2BKFA 3DBSA 4MSMB 2R2OA 2NBUA 1E5WA 2CKHB 2FCMA 3SDLC 3PRZA 2CU1A 5JHBA 2RPQA 2FAZA 3WANA 3VUXA 1R4NI 4GOCA 1WX9A 2NS5A 2JZZA 3M95A 4W9KA 1WGHA 3U7DA 2CR5A 3PREA 3UIPB 2LRUA 3V62A 2KX0A 2NVUI 3PZDA 1WJUA 2KDBA 4MGKE 2I1JA 1P0RA 3DVNV 3SU8X 4OVVA 2K6QA 2N9PC 2WDTB 1WJ6A 4PYUA 4AOFA 3NS8A 2N9XA 4MM3A 1S3SG 4DHJD 2FCSA 2MBQA 1K8RB 1GC6A 4HCPB 3W1YA 1P9DU 2LJ5A 4W9HA 1BT0A 2W9NA 2PE9A 4FN2A 4LDTB 3R66C 2LVQA 2KWUB 3B0AA 4TV3A 3VH3B 4AWJA 4DK5A 4WJNA 1Z5SB 5DPWA 2FIFA 2MBHA 1EF1A 1YX5B 2K6DB 3VDZA 2J7QB 3QWZB 4JIOU 3ZTDA 1WGGA 2MA9B 4NAWA 1GG3A 2M1MA 1QZEA 3CF6E 3EECA 2XK5A 3QIJA 4TQ1A 4F8CB 1V9JA 2O2VB 3VQIA 3WIMA 3AXCA 1XT9B 4KVGB 4FBJB 4G0NB 3T9LA 2DAJA 1WR6E 3CSTA 3WAOA 3PRPB 1G6JA 3VVWB 4P7IA 1V81A 1WI0A 1VD2A 1WZ0A 4PS3A 3QA8A 2DYOA 1WJ4A 1H4RA 4WAAA 3DOWA 4BOSC 2ZEQA 4MH0E 3CSFA 4HCNB 1S1QB 3WAPA 4XZ4A 4TKNA 3DBRI 2D07B 1WGYA 4FULA 4EZLA 1D3ZA 1RFAA 4FJYA 2LVOA 1H8CA 2ZVNA 3VAWA 4KSLC 3AULA 3IG3A 3M62B 5LLIA 2IO3B 4HDQA 1KM7A 1ZKHA 4W9LA 4KDLB 5E6NA 2LI5A 3QK0A 3W1SA 2L05A 1UD7A 3ZDTA 4AJWA 1LQBA 1ISNA 2JF5A 4J6IA 4NAWB 1KJTA 1RRBA 3KH0A 2GBRA 1RLFA 3L16A 2JXXA 1XD3B 1V86A 3RUIB 3QX1A 2MRPA 2M4NA 2PPHA 2FIDA 2KOXA 4LDTD 4DHZB 4F1SA 2IBIB 5G55A 3TBLD 2MBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQA A;  3APF A;  2N7E A;  2L76 A;  2WX0 A;  1HE8 A;  2LGD A;  2KK8 A;  4GIV A;  4IC7 B;  4AP4 C;  4GXB A;  3APC A;  3BY4 B;  2IO0 B;  3DCG A;  1Q1O A;  2JWZ A;  3HM6 X;  4HDO A;  2J0K A;  3A1Q B;  3R7Q A;  1Q0W B;  3OJ4 B;  2BPS A;  2KNB A;  3S2A A;  2KLG A;  3V61 A;  3KVF B;  2B3A A;  2KFK A;  2L8J A;  3KYC D;  4JQW C;  3ZIM A;  2IY1 B;  4DHJ B;  2KN5 A;  2HTH A;  3M3J A;  4ANW A;  4BFR A;  4KZ0 A;  4ICU A;  1OEY A;  3RYT A;  1V5T A;  4BKG A;  4ANU A;  1UH6 A;  1U4A A;  3GZN I;  1GC7 A;  2D11 A;  4NJ7 A;  2JZ3 B;  4K7W A;  4KSK C;  2LZ6 A;  4EKU A;  1WM3 A;  2DAF A;  5AZH A;  4IWQ A;  2MX2 A;  1ZGU B;  1LXD A;  2D3G A;  4IM2 A;  4PS7 A;  2L0F A;  2OJR A;  2IY0 B;  3PSE B;  2KLC A;  4LJO B;  2MBO A;  2KJH B;  2K1F A;  4II3 B;  2LRW A;  1SE9 A;  2EMT A;  1M94 A;  3HIZ A;  1Y8R C;  5C1Z A;  2KDE B;  3C0R B;  2K8H A;  4ZRK A;  3ML9 A;  4URK A;  1OQY A;  2QHO A;  4W9E A;  2IO2 B;  2JPH A;  5E6O A;  3OJ3 A;  1TBE A;  2KFK B;  3UIO B;  3JVZ X;  2O6V D;  4W9F A;  3K9P B;  1KLV A;  2NR2 A;  2JVC A;  5DCN A;  4A3P A;  3RZW C;  2YLM A;  4IWO A;  1WFY A;  2G4S A;  3JYU A;  3ZRC A;  3NZU A;  2DZJ A;  2O2V A;  1GNU A;  2Z0E B;  5BO4 B;  4W9J A;  2ZZP B;  5CX3 A;  4M8M A;  1IPG A;  2FUH B;  2BWE S;  2KWV B;  3DVN U;  2XEW A;  4E74 A;  2ZCC A;  3IBE A;  2AEH A;  3B1L X;  1UEL A;  1NBF C;  2DYB A;  2IO1 B;  2KC2 A;  4M0W B;  3ZNZ B;  3IFW B;  4K7U A;  1A5R A;  1WXA A;  3X0W A;  3WAL A;  4G11 A;  1ZW7 A;  4GGQ A;  4B95 A;  4M8N A;  2JRI B;  4DHZ E;  3O65 B;  2Z59 B;  4ANX A;  4WJP A;  3PHW B;  5JH5 C;  5JHA A;  4I6N B;  3UGB B;  4B9K A;  2RGF A;  4FLH A;  4W9G A;  3ONS A;  2GBJ A;  3RZF A;  4IM3 A;  4EEW A;  4YL8 A;  4FHK A;  3RT3 B;  4K1R B;  1WH3 A;  4WWP A;  2DYM A;  3RUL A;  1EUV B;  1YQB A;  2D2Q A;  2HD5 B;  1T0Y A;  3GOE A;  4N9F 4;  1NI2 A;  2DX5 B;  3RCZ A;  1OGW A;  3DQV A;  3OAW A;  2KFJ A;  2N1V A;  3TJP A;  3B08 A;  4G50 A;  2OOB B;  4AUQ C;  2BF8 B;  2O6V A;  4ANV A;  2KKC A;  4NJ6 A;  5IAA C;  3VUY A;  2Z0D B;  1UZX B;  3TL5 A;  4EZK A;  2DZM A;  4I6P A;  4IW0 A;  4K7S A;  2NCN A;  2LWP A;  3L10 B;  1WYW B;  3HHM A;  3NHE B;  4CO7 A;  2GBM A;  2YVC A;  2DEN B;  2D10 A;  1WGD A;  4ZRI A;  2C5L C;  2CS4 A;  4BBN C;  5EDS A;  4CHK A;  1I42 A;  4BBN F;  3A1Q A;  1L2N A;  2KX3 A;  3ZVV A;  1E90 A;  4W9D A;  4PYZ A;  3KUC B;  4DDI D;  2BGF A;  4XC2 A;  3L54 A;  5CHV C;  2GBN A;  2MP2 B;  2FCN A;  5D6J B;  5TR5 A;  3ZDM C;  4NQK E;  1UBI A;  3QCA A;  1WY8 A;  3TIX A;  2MLB A;  2G3Q B;  4IG7 B;  2M0X A;  3ZKJ C;  1P3Q U;  1LM8 B;  5J2R A;  2PJH A;  5AEK B;  1E8X A;  2O6V B;  3AI5 A;  4IUM B;  2KAN A;  3A9K A;  2EKE C;  3QC8 B;  2M8S A;  3UF8 A;  2C7H A;  2ZPY A;  1OEY J;  3MJW A;  5JZE B;  2LXA A;  3L0W B;  3WA0 A;  4DBG A;  2DZK A;  2KDI A;  3PV1 A;  5DPT A;  5AZG A;  3VTW A;  1SIF A;  2AYO B;  3DDC B;  4E71 A;  2KJ6 A;  1WE7 A;  3L17 A;  3PS6 A;  2IYD B;  4NQL B;  1JRU A;  2K25 A;  1X1M A;  1XQQ A;  4OVU A;  2KHW B;  3HM3 A;  1UGM A;  4HJK A;  3EFU A;  2JUO A;  4CYE A;  2ASQ A;  2RSU A;  3VH4 B;  2CHW A;  4HWI B;  4MJS A;  4FA6 A;  2C7M B;  3N32 A;  3A33 B;  4I6L B;  2HJ8 A;  2KJR A;  3H7P A;  1IYF A;  4HPM B;  4W9I A;  3JW0 X;  3Q3J A;  4MEM A;  2EMS A;  2GMI C;  2BYV E;  2R2Q A;  2REX A;  3H9D A;  1WZ3 A;  3EHV A;  4GB9 A;  4PS8 A;  4BOZ B;  3A9K B;  3NZS A;  1P98 A;  3PPA A;  3N30 A;  1WM2 A;  1C1Y B;  3V60 A;  2KMC A;  3U30 A;  2AWT A;  2GBK A;  2L3Z A;  1GUA B;  1V49 A;  4ICV A;  4JGH B;  4EUT A;  1EO6 A;  4HLE A;  2WWZ A;  1WX7 A;  1SGH A;  2JY6 A;  2KWC A;  3APD A;  3P2B A;  3DPD A;  3QHT A;  4GSW A;  4WJO A;  4BKS D;  4DWF A;  2KDF B;  3ALB A;  2MSE D;  2L7R A;  2DHZ A;  4GDK B;  1E7V A;  5LXH A;  2MWS B;  1I35 A;  1RAX A;  1V80 A;  2ZNV C;  3ECI A;  3PVL A;  4A20 A;  4WJQ A;  4MJS B;  3JSV A;  3AU4 A;  3UIN B;  3K9O B;  3TMP B;  3N3K B;  2C7N B;  1TTN A;  3H7P B;  1Q5W B;  1EF5 A;  1P1A A;  4EZJ A;  3EC8 A;  3QAR A;  3I3T B;  3Q3F A;  4E3C A;  1WMH A;  3VTU A;  1F9J A;  2LAS A;  2NBV B;  3KYD D;  2FCQ A;  5G2N A;  1J19 A;  2C60 A;  2UYZ B;  5CTR C;  3VFK A;  4GU2 A;  2BWF A;  3L13 A;  4GDL A;  3ZNI D;  4MGY E;  1TGZ B;  4HXD A;  4W9C A;  2CHZ A;  1J0G A;  4FAD A;  4B6W A;  2V3S A;  2KXJ A;  2LGX A;  5DPR A;  5HKH A;  5IA7 A;  3DBL I;  4IM0 A;  4NPN A;  2XBB C;  4KDI C;  1E7U A;  2MP2 A;  1WXS A;  2LD9 A;  2WX1 A;  4BVU C;  4KIK A;  1WRD B;  4DDG D;  3DVG Y;  2MW5 A;  5J18 A;  1WX8 A;  1V2Y A;  5CHF A;  3PTF C;  2V1Y A;  1WXM A;  3JSV B;  1V5O A;  2ZPN A;  3D32 A;  3DVG X;  1WF9 A;  3H6N A;  3KUD B;  3MHS D;  3R3M A;  3R7R A;  2RR9 A;  2MCN B;  3VUW A;  2N7D A;  4RMA A;  2KO3 A;  3L08 A;  5LXI B;  1LFD A;  2DZI A;  3ML8 A;  1R4M I;  2HE7 A;  2L0T A;  2PE6 B;  3BIN A;  3SHQ A;  2J0M A;  4XX5 A;  4MSQ B;  1E8Z A;  1AAR A;  3CMM B;  2MQJ A;  5GMV A;  3A4S C;  3PRM B;  1WMH B;  4BKT A;  3UQB A;  3ZTC A;  4MEL A;  4HK2 A;  4MDK E;  2J0J A;  3PLV A;  3QAQ A;  1KOT A;  1WE6 A;  3ZLZ A;  4TQ0 A;  2IZV B;  3QQ8 B;  2LUE A;  4KV2 A;  3H7S A;  1E8W A;  2GOW A;  4GN1 A;  4NNJ B;  4A3O A;  5C23 A;  2RD0 A;  2PEA A;  3PHX B;  3OLM D;  1WGR A;  1PQS A;  2G4D B;  3NOB A;  2KTR A;  5KHO A;  4F7Z A;  2LVP A;  4KIK B;  1J8C A;  3LDZ E;  5J17 A;  5AZF A;  4AJY B;  2KMA A;  2N9E B;  1VCB A;  3LJ3 A;  1CMX B;  3WAM A;  2K8B A;  3X23 A;  2C9W B;  2NBW B;  1OTR B;  4GDL B;  4RM8 A;  3SD5 A;  1GJZ A;  3QJZ A;  3T8M A;  3A4R A;  4K81 A;  2BYF A;  2LXC A;  1WR1 A;  2JT4 B;  3PLU A;  1WJN A;  4EOY A;  2CHX A;  4EFO A;  1MG8 A;  2L00 B;  2KTF A;  3M63 B;  3ZW3 A;  1E8Y A;  2KD0 A;  3V6E B;  4WWN A;  3KUZ A;  5FR6 A;  2AL6 A;  2AL3 A;  3PT2 B;  3VHT C;  3ZO5 B;  4X57 B;  2K39 A;  2XK5 B;  3PGE A;  4IWP A;  3VTV A;  4HPL B;  2NPT A;  2LGY A;  2V4L A;  3MTN B;  3NY5 A;  4GDK A;  2FNJ B;  2KTR B;  5DPS A;  3ZRF A;  2BYE A;  4JLC A;  2BKR B;  3A9J A;  2ZCB A;  4ZRJ A;  2UWQ A;  2K8C A;  4KZC A;  1C3T A;  2M17 A;  1YIW A;  4WWO A;  1IP9 A;  1YD8 U;  3DBH I;  4GMV A;  3ZUN A;  4ASW C;  2G45 B;  1YX6 B;  2A4Z A;  1TZ1 A;  3ENE A;  5L95 C;  2VRR B;  2N4F A;  1Z2M A;  3IVF A;  1UBQ A;  1YJ1 A;  4FHJ A;  2KC1 A;  4FJV B;  2ZJD A;  5D94 A;  5KHQ A;  2N1W A;  3H1U A;  3V6C B;  4RM9 A;  2ZNV B;  3KW5 B;  4MGI E;  1L7Y A;  3TCA A;  1NDD A;  4G3X B;  4WQO B;  4LCD E;  4LJP B;  4ZYN A;  4HVB A;  3U8Z A;  2NPT B;  5D2M B;  5E6P A;  4FJZ A;  2KVR A;  2MBB B;  3AU5 A;  4II2 B;  4NY0 A;  4ZDV A;  2I1K A;  4MGZ E;  5CHW A;  2ZVO A;  1V6E A;  3A9J B;  3VXW A;  2KQS A;  3W1S C;  2KZR A;  4JL9 A;  2Y5B B;  1FXT B;  4TUU A;  3IHP C;  5L83 A;  3RD2 A;  3ZNG C;  1WXV A;  2A5U A;  3ZNH B;  1WIA A;  2KQ7 A;  3HK0 A;  2WYQ A;  2JRH A;  4BKS A;  5D7G A;  4DXA B;  2BKF A;  3DBS A;  4MSM B;  2R2O A;  2NBU A;  1E5W A;  2CKH B;  2FCM A;  3SDL C;  3PRZ A;  2CU1 A;  5JHB A;  2RPQ A;  2FAZ A;  3WAN A;  3VUX A;  1R4N I;  4GOC A;  1WX9 A;  2NS5 A;  2JZZ A;  3M95 A;  4W9K A;  1WGH A;  3U7D A;  2CR5 A;  3PRE A;  3UIP B;  2LRU A;  3V62 A;  2KX0 A;  2NVU I;  3PZD A;  1WJU A;  2KDB A;  4MGK E;  2I1J A;  1P0R A;  3DVN V;  3SU8 X;  4OVV A;  2K6Q A;  2N9P C;  2WDT B;  1WJ6 A;  4PYU A;  4AOF A;  3NS8 A;  2N9X A;  4MM3 A;  1S3S G;  4DHJ D;  2FCS A;  2MBQ A;  1K8R B;  1GC6 A;  4HCP B;  3W1Y A;  1P9D U;  2LJ5 A;  4W9H A;  1BT0 A;  2W9N A;  2PE9 A;  4FN2 A;  4LDT B;  3R66 C;  2LVQ A;  2KWU B;  3B0A A;  4TV3 A;  3VH3 B;  4AWJ A;  4DK5 A;  4WJN A;  1Z5S B;  5DPW A;  2FIF A;  2MBH A;  1EF1 A;  1YX5 B;  2K6D B;  3VDZ A;  2J7Q B;  3QWZ B;  4JIO U;  3ZTD A;  1WGG A;  2MA9 B;  4NAW A;  1GG3 A;  2M1M A;  1QZE A;  3CF6 E;  3EEC A;  2XK5 A;  3QIJ A;  4TQ1 A;  4F8C B;  1V9J A;  2O2V B;  3VQI A;  3WIM A;  3AXC A;  1XT9 B;  4KVG B;  4FBJ B;  4G0N B;  3T9L A;  2DAJ A;  1WR6 E;  3CST A;  3WAO A;  3PRP B;  1G6J A;  3VVW B;  4P7I A;  1V81 A;  1WI0 A;  1VD2 A;  1WZ0 A;  4PS3 A;  3QA8 A;  2DYO A;  1WJ4 A;  1H4R A;  4WAA A;  3DOW A;  4BOS C;  2ZEQ A;  4MH0 E;  3CSF A;  4HCN B;  1S1Q B;  3WAP A;  4XZ4 A;  4TKN A;  3DBR I;  2D07 B;  1WGY A;  4FUL A;  4EZL A;  1D3Z A;  1RFA A;  4FJY A;  2LVO A;  1H8C A;  2ZVN A;  3VAW A;  4KSL C;  3AUL A;  3IG3 A;  3M62 B;  5LLI A;  2IO3 B;  4HDQ A;  1KM7 A;  1ZKH A;  4W9L A;  4KDL B;  5E6N A;  2LI5 A;  3QK0 A;  3W1S A;  2L05 A;  1UD7 A;  3ZDT A;  4AJW A;  1LQB A;  1ISN A;  2JF5 A;  4J6I A;  4NAW B;  1KJT A;  1RRB A;  3KH0 A;  2GBR A;  1RLF A;  3L16 A;  2JXX A;  1XD3 B;  1V86 A;  3RUI B;  3QX1 A;  2MRP A;  2M4N A;  2PPH A;  2FID A;  2KOX A;  4LDT D;  4DHZ B;  4F1S A;  2IBI B;  5G55 A;  3TBL D;  2MBE A; 
#chains in the Genus database with same CATH topology
 4A55 A;  4GIV A;  2IO0 B;  5HI1 A;  2JWZ A;  1K51 A;  2J0K A;  2WU5 B;  1Q0W B;  2BPS A;  4GLS C;  2KNB A;  2KLG A;  2B3A A;  3ZIM A;  3AH7 A;  2HTH A;  3M3J A;  3AV8 A;  4KZ0 A;  1NEK B;  1JQ4 A;  1UH6 A;  4NJ7 A;  4P1C C;  2LZ6 A;  4KGR A;  3ABV B;  1EWY C;  4IWQ A;  1ZGU B;  5I4D A;  5C1Z A;  1PYW D;  4C4V A;  2QHO A;  1TS3 A;  1JWA D;  1OQR A;  1BXT A;  1N62 A;  2IO2 B;  5E6O A;  2LHD A;  3K9P B;  1KLV A;  5DCN A;  4A3P A;  2N0S B;  4USA A;  3Q3M C;  1WFY A;  1HZ5 A;  5BYS A;  2KWV B;  4KGS A;  2ZCC A;  3IBE A;  1HEZ E;  2RMM A;  3ZNZ B;  1HTO A;  1T6B X;  1D5X C;  3WAL A;  4GGQ A;  2JRI B;  2Z59 B;  4ANX A;  2BS4 B;  4WJP A;  5JHA A;  1RM6 C;  3ONS A;  4M00 A;  2GBJ A;  4EEW A;  1XO3 A;  2VH2 A;  1B9R A;  5FK9 C;  3DHH C;  2BT6 A;  2WDR B;  4C80 A;  2OOB B;  4ANV A;  4NJ6 A;  5IAA C;  2WDV B;  1ROE A;  1WXQ A;  3L10 B;  1E9M A;  2DEN B;  1I4H A;  3BVG A;  4CHK A;  1YOV B;  2KX3 A;  1UF0 A;  2MP2 B;  4C00 A;  3Q3N C;  5TR5 A;  4NQK E;  3QCA A;  3TIX A;  1SJH D;  4S17 A;  2G3Q B;  2MJE A;  1LM8 B;  3AI5 A;  1HXY D;  4OW0 A;  2ON8 A;  2C7H A;  5JZE B;  3WA0 A;  2BBC A;  2DZK A;  2KDI A;  3PV1 A;  5DPT A;  3DDC B;  4E71 A;  3N1X C;  1WE7 A;  1JWB D;  1TS5 A;  1X1M A;  2CJO A;  1WSP A;  2CU3 A;  2ASQ A;  4HWI B;  2KVZ A;  2C7M B;  4I6L B;  3H7P A;  4HPM B;  3B9J A;  2AQ1 B;  3JW0 X;  2R2Q A;  2PVG C;  1WZ3 A;  4PS8 A;  3A9K B;  3NZS A;  1P98 A;  2RDB C;  2AWT A;  4TSS A;  1NYR A;  1V49 A;  1E0Z A;  5IOI A;  1MPE A;  4HLE A;  3J9C A;  4C7Z A;  3APD A;  3P2B A;  2XN9 C;  2KDF B;  2MSE D;  4GDK B;  1JWM D;  1YQ4 B;  5TSS A;  3PVL A;  4A20 A;  4HKZ E;  4MJS B;  3JSV A;  2JYE A;  3CWI A;  3TMP B;  3N3K B;  1V8C A;  2C7N B;  3MJ5 A;  1TTN A;  3DWM A;  3H8H A;  1FRD A;  1ET9 A;  3BYT B;  3EC8 A;  3QAR A;  2BS2 B;  2NBV B;  2UU7 A;  2UYZ B;  3VFK A;  4GU2 A;  3RN9 C;  3Q6B A;  4MGY E;  2CHZ A;  4FAD A;  2M56 B;  2LGX A;  3DBL I;  1FRR A;  4BVU C;  4KIK A;  2WXQ A;  5H8Y E;  5J18 A;  4GDL A;  1WXM A;  3KUD B;  2ZPN A;  3D32 A;  3DVG X;  3H6N A;  1J0G A;  2MEK A;  2RR9 A;  3SFE B;  1DOY A;  1R4M I;  4K3C A;  5BMI A;  2J0M A;  4XX5 A;  5GMV A;  3A4S C;  1WMH B;  1T0Q C;  4HK2 A;  4MEL A;  3QAQ A;  1KOT A;  1GOZ A;  4TQ0 A;  4KV2 A;  2GOW A;  5C23 A;  2PEA A;  3OLM D;  1WGR A;  2KTR A;  5KHO A;  4F7Z A;  3LDZ E;  1C79 A;  3AE2 B;  5AZF A;  5FR3 A;  2KMA A;  3P4R B;  1VCB A;  4ZHO A;  1CMX B;  4RM8 A;  3VR9 B;  3HVZ A;  1GJZ A;  4N59 A;  1C4A A;  3A4R A;  4H2A A;  2BTE A;  2BYF A;  4MT5 A;  4RGN A;  2JT4 B;  3V05 A;  2CHX A;  1MG8 A;  2QCZ A;  1RYJ A;  3V3X A;  2L00 B;  4B0M A;  1UGJ A;  3R2T A;  4A8X C;  1GB4 A;  2BVC A;  3ZO5 B;  2WXN A;  4JX1 C;  1KRH A;  1SXT A;  1D3Z A;  3ETR A;  2K8C A;  4KZC A;  2M17 A;  4WWO A;  2WDQ B;  3DBH I;  3ZUN A;  4ASW C;  2A4Z A;  2I2Y A;  1TZ1 A;  3ENE A;  5L95 C;  2VZK D;  1YJ1 A;  4FHJ A;  2ZJD A;  3H1U A;  2ZNV B;  4MGI E;  4WIP A;  1VRA B;  2X38 A;  3TCA A;  3TEX A;  1HTQ A;  4JWU C;  1PUT A;  2PIA A;  3RNF C;  3U8Z A;  5D2M B;  3NVY A;  4FJZ A;  2KVR A;  4ZDV A;  2I1K A;  4OZA A;  4MGZ E;  5D3I B;  2ZVO A;  3A9J B;  1L0X B;  4TUU A;  1WXV A;  3HK0 A;  2JRH A;  2HTM E;  3Q8A A;  2NBU A;  1E5W A;  3SDL C;  3WCQ A;  3NUH B;  1L4D B;  4ZOH C;  3VUX A;  1KH0 A;  3DBL B;  2NS5 A;  2JZZ A;  2KYW A;  4W9K A;  3UIP B;  1EWC A;  1P0R A;  2ACZ B;  4OVZ A;  4AOF A;  4XWT A;  1R4M B;  1TS4 A;  3AE4 B;  2G9H D;  4DHJ D;  1K8R B;  3W1Y A;  1ZE3 D;  3U7Z A;  2PE9 A;  2LHE A;  5DPW A;  1GPX A;  2MBH A;  1HZ6 A;  1FXI A;  4JIO U;  1QOF A;  2ONQ A;  1FFU A;  1QZE A;  3CF6 E;  2XK5 A;  3KWV A;  5JXV A;  1CJE A;  4OHJ A;  3PRP B;  4BZA A;  2QSD A;  1UUP A;  1VD2 A;  2AQ2 B;  1N5X A;  2DYO A;  1WJ4 A;  1H4R A;  3DOW A;  4C7Y A;  1XCQ L;  2ZEQ A;  3AEF B;  4MH0 E;  2OHF A;  3CSF A;  1S1Q B;  3NJT A;  4FUL A;  2D3C A;  4FJY A;  1H8C A;  2ZVN A;  2IO3 B;  4W9L A;  3ZDT A;  2NTS A;  2L05 A;  4ARI A;  1LQB A;  1ISN A;  3URY A;  4NAW B;  1KJT A;  1TIF A;  2YEP F;  4KX6 B;  2JXX A;  1WYG A;  1V86 A;  4M02 A;  3O13 A;  2M4N A;  2JZP A;  1Y56 A;  1WWT A;  3Q8C A;  4JPS A;  3N9Y C;  2MBE A;  3IAS 1;  3APF A;  2N7E A;  2L76 A;  3R2I A;  2LGD A;  2L32 A;  4IC7 B;  3RNC C;  4GXB A;  3APC A;  3HM6 X;  2EKI A;  1F2R C;  4XGA B;  2K3U A;  1SIJ A;  3V61 A;  3KVF B;  3KYC D;  2IY1 B;  1OEY A;  2OED A;  3Q2A C;  3GZN I;  1GC7 A;  2D11 A;  2JZ3 B;  4KSK C;  1I4R A;  1VZ6 A;  3ZYY X;  2DAF A;  2MX2 A;  2BB5 A;  4RH6 A;  1JRO A;  1LXD A;  4HPP A;  4PS7 A;  4A9A A;  2L0F A;  2IY0 B;  2QJL A;  3PSE B;  4LJO B;  2MBO A;  2K1F A;  1M94 A;  1FNW A;  1OQY A;  2WXF A;  4W9E A;  2JPH A;  2BB6 A;  2KFK B;  2O6V D;  1L0V B;  4W9F A;  2NR2 A;  1F52 A;  3RZW C;  2YLM A;  2PW9 A;  3JYU A;  3NZU A;  2O2V A;  1GNU A;  5BO4 B;  1VZ8 A;  3I5J C;  4M8M A;  1IPG A;  5T8I A;  2BWE S;  4E74 A;  2XEW A;  3GB1 A;  3AN1 A;  1XLQ A;  2BW2 A;  1SSN A;  1UEL A;  2DYB A;  2IO1 B;  4M0W B;  1QOA A;  1N6Z A;  3IFW B;  4K7U A;  4DHZ E;  4MAC A;  1C4C A;  3IT4 B;  1PFD A;  2LFI A;  1KLU D;  2QEJ C;  1IUE A;  3RZF A;  4YL8 A;  3UI3 A;  3BZD B;  4K1R B;  1FPY A;  5GXG B;  3KQ4 A;  2DYM A;  1EUV B;  2D2Q A;  3RCZ A;  2O6V A;  3VUY A;  3FAH A;  1RWS A;  3RMK C;  2NCN A;  1FM0 D;  1WYW B;  2GBM A;  2LMC A;  4ZRI A;  1A70 A;  4BBN F;  1ZXI A;  4W9D A;  4XC2 A;  2GBN A;  1IGD A;  5D6J B;  3W9C B;  2WXG A;  1WY8 A;  4P6V F;  3BYY B;  4IG7 B;  2M0X A;  1P3Q U;  4OZB A;  3P4S B;  1N5W A;  4IUM B;  2KAN A;  3AE5 B;  1IBX B;  4XWW A;  2M8S A;  4PK1 A;  2ZPY A;  1OEY J;  3MJW A;  2LXA A;  3L0W B;  5AZG A;  3AEB B;  2K25 A;  4OVU A;  4RF1 A;  3I63 C;  3VH4 B;  5BMH A;  2M0A A;  1VR9 A;  4NZL B;  1IYF A;  4RFB A;  3Q3J A;  4MEM A;  2EMS A;  1E6E B;  2REX A;  4BOZ B;  3SR6 A;  1TYG B;  4LNK A;  1TKG A;  4ICV A;  4JGH B;  1ACC A;  1WX7 A;  2KWC A;  2JY6 A;  4BKS D;  3DPD A;  3AEE B;  4US8 A;  4DQO C;  2L7R A;  2K9X A;  1I35 A;  3ECI A;  4WJQ A;  2N9K A;  4YTM B;  5BYQ A;  3K9O B;  3I57 A;  4EZJ A;  2IGD A;  4ZHP A;  3I3T B;  3Q3F A;  3TUO A;  1F9J A;  3KYD D;  2QMT A;  4LK0 M;  2K0P A;  4HXD A;  1P7E A;  3Q8F A;  1KF6 B;  2JX5 A;  2KXJ A;  5IA7 A;  5DPR A;  5HKH A;  1ZP0 B;  2XBB C;  3NG0 A;  4NAM A;  4WH4 A;  1WXS A;  2LD9 A;  2SEB D;  1WRD B;  4DDG D;  2DWQ A;  1KTK A;  2V1Y A;  3QIJ A;  3VHT C;  4BKS A;  4YXD B;  2MCN B;  1LFD A;  2TSS A;  2HE7 A;  2L0T A;  2PE6 B;  1E8Z A;  2NMQ A;  4BKT A;  3UQB A;  3AED B;  3ZTC A;  4MDK E;  2J0J A;  1HA5 A;  3ZLZ A;  3QQ8 B;  2LUE A;  5EE3 A;  2YEP B;  3H7S A;  1FIQ A;  4NNJ B;  4A3O A;  2MH7 A;  1PQS A;  4HKQ A;  3NOB A;  1J8C A;  1I4G A;  4AJY B;  2N9E B;  3QJZ A;  3T8M A;  3TEY A;  1SE3 A;  2LXC A;  3PO0 A;  1K52 A;  3PLU A;  3SFD B;  3M63 B;  1GB1 A;  3V6E B;  4WWN A;  5FR6 A;  2AL6 A;  3PT2 B;  5HHD G;  1TKE A;  2G1E A;  4X57 B;  2XK5 B;  3VTV A;  2V4L A;  3MTN B;  1AYF A;  4WQM A;  2ZCB A;  1J7C A;  2LUM A;  1C3T A;  1YIW A;  4GMV A;  4AS1 A;  2W55 A;  2J53 A;  1UWX A;  4FJV B;  3R8B A;  3IAM 1;  4MH8 A;  1C78 A;  1L7Y A;  1QOG A;  2GRI A;  5IN7 A;  4G3X B;  4L1B A;  4LCD E;  3MHZ A;  1KFY B;  4ZYN A;  4HVB A;  1C4P A;  3BII D;  2NPT B;  5E6P A;  4II2 B;  2WXH A;  1CQV A;  2KQS A;  2KZR A;  2H88 B;  5FKA C;  2GI9 A;  1XEE A;  3IHP C;  3RD2 A;  2A5U A;  5D7G A;  4DXA B;  4LNI A;  3PRZ A;  2RPQ A;  2FAZ A;  3FIL B;  4WAF A;  1L0Y B;  1WX9 A;  1DOI A;  4HJG E;  2CR5 A;  3V62 A;  2NVU I;  3PZD A;  4RGM A;  2I1J A;  3B2F A;  3SU8 X;  1WJ6 A;  1YN5 A;  4LNO A;  1S3S G;  2M19 A;  1YN4 A;  2JQR B;  2N9L A;  1GC6 A;  4HCP B;  4IKG A;  1Q10 A;  1YMH E;  1PGB A;  2INP E;  3VH3 B;  2KWU B;  3B0A A;  4DK5 A;  1JWU D;  1Z5S B;  4YSZ B;  5LNK 1;  2FIF A;  3VDZ A;  1D5M C;  3QWZ B;  4AQ7 A;  3ZJU A;  2O2V B;  3VQI A;  4EE2 A;  3TSS A;  4A6Q A;  2QIL A;  1FFV A;  4RNA A;  1G6J A;  2BS3 B;  3VVW B;  2LGI A;  4P7I A;  1V81 A;  4PS3 A;  4MM3 B;  4DXF A;  3QA8 A;  4WAA A;  4BOS C;  4J3O D;  4XZ4 A;  4TKN A;  3DBR I;  2D07 B;  1RFA A;  5C3J B;  5BYR A;  3EGR A;  3IG3 A;  4L23 A;  2WS3 B;  1JAL A;  4EKU A;  2WXJ A;  3QK0 A;  1UD7 A;  1JML A;  2JF5 A;  4J6I A;  2J42 A;  1RRB A;  3L16 A;  3BK2 A;  1XD3 B;  2SAK A;  3CIR B;  3GE3 C;  2WP9 B;  2KOX A;  2MJ3 A;  2IBI B;  1HE8 A;  2KK8 A;  1PGA A;  3DCG A;  2L1A A;  1Q1O A;  4XYC A;  3Q14 C;  3R7Q A;  2FE8 A;  2JSV X;  3S2A A;  2BQQ A;  4JQW C;  2L8J A;  1SJE D;  1BML C;  1B1Z A;  4BFR A;  2PLP A;  4ICU A;  5HG2 A;  1R7S A;  4BKG A;  4ANU A;  1U4A A;  1QLB B;  2E6X A;  4K7W A;  2PVO D;  4YSY B;  5AZH A;  3Q8B A;  2LRW A;  2EMT A;  2OJW A;  2KDE B;  3C0R B;  2K8H A;  4ZRK A;  3ML9 A;  2INN E;  2LEK A;  3OJ3 A;  1TBE A;  3JVZ X;  4IOI E;  4IWO A;  2IGH A;  2G4S A;  1IGC A;  2Z0E B;  3ZGZ A;  3E9S A;  2ZZP B;  5CX3 A;  4NJC A;  2FUH B;  3DVN U;  3B1L X;  2KC2 A;  2V4I B;  1A5R A;  3X0W A;  4G11 A;  4N6E B;  3RNA C;  3O65 B;  4P16 A;  1D4B A;  5JH5 C;  4I6N B;  1TT5 B;  4C4V B;  2RGF A;  5EE1 A;  4W9G A;  4B0E A;  4IM3 A;  2MJD A;  3RT3 B;  4RCO A;  5C2T B;  3RUL A;  1YQB A;  3GOE A;  3MP9 A;  4N9F 4;  1T0Y A;  2DX5 B;  3DQV A;  3OAW A;  2W54 A;  2KFJ A;  5G5G A;  3B08 A;  3NVW A;  1N60 A;  2Z0D B;  5EE0 A;  4EZK A;  4IW0 A;  4RF0 A;  3NHE B;  4RGO S;  1JWS D;  4L2Y A;  1WGD A;  2CS4 A;  4BBN C;  5EDS A;  1I42 A;  3A1Q A;  1N61 A;  3ZVV A;  1E90 A;  4PYZ A;  2WXK A;  1V97 A;  3L54 A;  2FCN A;  1I4P A;  3ZDM C;  1FNV A;  1UBI A;  3BWU D;  2MLB A;  4KGT A;  3ZKJ C;  2PJH A;  5AEK B;  1XF5 L;  1E8X A;  1SE4 A;  1I4Q A;  4K3B A;  4YTN B;  3A9K A;  1TY0 A;  3DBH B;  3QC8 B;  4XDD A;  4DBG A;  1F0Z A;  1VZ7 A;  1SIF A;  2AYO B;  2KJ6 A;  3PS6 A;  1JRU A;  3W2D A;  4HJK A;  1UGM A;  3EFU A;  1CK1 A;  2JUO A;  4MJS A;  1T3Q A;  3A33 B;  2IPK D;  1D5Z C;  2HJ8 A;  4W9I A;  1QF6 A;  2BYV E;  3H9D A;  3EHV A;  1ZOY B;  3PPA A;  3C19 A;  1WM2 A;  1C1Y B;  3V60 A;  3U30 A;  2GBK A;  2L3Z A;  3OG5 A;  2Q5W D;  3AEG B;  1DOX A;  2W82 A;  4EUT A;  1JCK B;  4PT5 A;  1SGH A;  4LLG M;  3BVM A;  4DWF A;  3ALB A;  5LXH A;  3ZJT A;  1RAX A;  1V80 A;  2ZNV C;  3NRZ A;  2QDF A;  3HRD D;  2KAJ A;  2V9H A;  3H7P B;  4E3C A;  1WMH A;  2LAS A;  5G2N A;  2FCQ A;  2KAC A;  1J19 A;  2K5P A;  1I7H A;  1T0S C;  4W9C A;  4ZRQ A;  3RNE C;  4B6W A;  2ZW1 A;  4LTU A;  1ZXH A;  4NPN A;  4KDI C;  1TKY A;  1E7U A;  1PGX A;  2WX1 A;  3DVG Y;  1WX8 A;  5CHF A;  3PTF C;  3JSV B;  1V5O A;  4LNN A;  2HDE A;  2N7D A;  3MC8 A;  4LNF A;  2DNF A;  3NS1 A;  4RMA A;  3RNG C;  2DZI A;  5LXI B;  3ML8 A;  2FUG 1;  4IDI A;  1TJE A;  3SHQ A;  2MQJ A;  1E10 A;  3PRM B;  1FD6 A;  3PLV A;  1WE6 A;  3T3O A;  2VH1 A;  5D3D A;  4R3D A;  5HFY A;  3AE6 B;  1ET6 A;  4ITK A;  1E8W A;  1AW7 A;  3FKY A;  4GN1 A;  1L6U A;  1FNU A;  3E56 A;  4KKI A;  5BMG A;  4P1B C;  4KIK B;  1NEN B;  1FEH A;  3LJ3 A;  3WAM A;  3X23 A;  3AMZ A;  2C9W B;  2NBW B;  1OTR B;  4GDL B;  2IND C;  4XE0 A;  1WR1 A;  1WJN A;  3L4P A;  2KN4 A;  1E8Y A;  1FO4 A;  4WWM A;  3ZRF A;  3NY5 A;  2KTR B;  5DPS A;  2BYE A;  4JLC A;  1ZDX A;  3A9J A;  3GZN B;  4ZRJ A;  3IT6 B;  1STE A;  2WXP A;  2UWQ A;  2D5G A;  1FCL A;  1IP9 A;  1YD8 U;  2G45 B;  2N4F A;  3IVF A;  2KC1 A;  2N7J A;  5D94 A;  5KHQ A;  3V6C B;  2J52 A;  2WQY B;  4RM9 A;  3KW5 B;  3MC0 B;  2Y5C A;  2JXT A;  1NYQ A;  4WQO B;  1XLP A;  4LJP B;  3LB8 C;  3U4E G;  1V1P A;  2Z8L A;  3Q8E A;  3AU5 A;  4NY0 A;  5CHW A;  3VXW A;  3W1S C;  1QOB A;  4JL9 A;  2Y5B B;  1FXT B;  3ZNG C;  3ZNH B;  1WIA A;  2KQ7 A;  2B76 B;  2WYQ A;  2RPV A;  2BKF A;  3DBS A;  1VDV A;  2R2O A;  3EUB 2;  4MSM B;  1PDX A;  2CKH B;  2FCM A;  1FXA A;  4YSX B;  2CU1 A;  5JHB A;  3WAN A;  3BK1 A;  1R4N I;  3DHI C;  4GOC A;  3U7D A;  2LRU A;  2PMV A;  2KX0 A;  3Q69 A;  1WJU A;  1XLN A;  3DVN V;  1YNT E;  2WXR A;  4OVV A;  3NVZ A;  2K6Q A;  3AE8 B;  2N9P C;  4PYU A;  1K50 A;  1L6V A;  3P4P B;  3NS8 A;  1CZP A;  2H89 B;  2FCS A;  2MBQ A;  3I9V 1;  3TEZ A;  1P9D U;  2LJ5 A;  4W9H A;  3PZ8 A;  4FN2 A;  4ZRP A;  2W3S A;  2V3N A;  1ENF A;  1TZO A;  3KLS X;  1YX5 B;  2K6D B;  2HJ1 A;  3ZTD A;  2VZK B;  1WGG A;  2MA9 B;  4NAW A;  3GE8 C;  3EEC A;  1TY2 A;  2IGG A;  2M1M A;  4TQ1 A;  4F8C B;  1V9J A;  1NVI D;  4KVG B;  4G0N B;  4RGT A;  2DAJ A;  1T0R C;  1WR6 E;  2R61 A;  3CST A;  3WAO A;  1WZ0 A;  3VRA B;  2JWU A;  1WGY A;  4EZL A;  2QC8 A;  3ZXR A;  3AUL A;  3M62 B;  1YN3 A;  2JYT A;  5LLI A;  4HDQ A;  3W1S A;  1ZKH A;  3DHG C;  1I4X A;  2L52 A;  5E6N A;  4AJW A;  4CQN A;  3KH0 A;  2BYT A;  2GBR A;  1RLF A;  1JW9 D;  3RUI B;  2MRP A;  2PPH A;  4DHZ B;  4LDT D;  4F1S A;  4HRS A;  3OWE B;  1F2R I;  5G55 A;  1SEB D;  3TBL D;  1XCT L;  3UQA A;  2WX0 A;  4AP4 C;  1OQQ A;  3BY4 B;  1MHH E;  3P1M A;  4HDO A;  2DBY A;  3A1Q B;  5IO9 A;  1MG4 A;  2WXI A;  3OJ4 B;  2L83 A;  2Y3A A;  2KFK A;  4DHJ B;  2KN5 A;  4ANW A;  3LXF A;  1ZUD 2;  3RYT A;  1V5T A;  1QIL A;  4JWS C;  2LJI A;  1WM3 A;  2EEL A;  2AQ3 B;  4M0W A;  4IM2 A;  2D3G A;  3RI7 C;  2OJR A;  2WHI A;  2KLC A;  3U52 E;  4II3 B;  2KJH B;  1SE9 A;  4FXC A;  3HIZ A;  1Y8R C;  2GB1 A;  2LGS A;  1P7F A;  4URK A;  1YJJ A;  4OZC A;  1R4N B;  2K22 A;  3MFG A;  3UIO B;  5IKC M;  2JVC A;  5IP4 D;  3TEW A;  3ZRC A;  2DZJ A;  1HQR D;  1ZDV A;  4W9J A;  1L5P A;  3Q3O C;  2AEH A;  4HRO A;  1NBF C;  3DWG C;  1WXA A;  2WXL A;  1ZW7 A;  4B95 A;  4M8N A;  1SF0 A;  3PHW B;  1ZPS A;  3UGB B;  4B9K A;  1UNS A;  2JU6 X;  4FLH A;  2KQ4 X;  1SBB B;  4FHK A;  1VLB A;  4TMA B;  1WH3 A;  4WWP A;  3N1Y C;  2HD5 B;  3EFC A;  3AM9 A;  1NI2 A;  1OGW A;  1C77 A;  1L4Z B;  2N1V A;  3TJP A;  4AUQ C;  4G50 A;  2BF8 B;  5G5H A;  5MPO A;  4WUR A;  2KKC A;  1WRI A;  1UWM A;  2X8X X;  1UZX B;  3TL5 A;  1C9F A;  1IBX A;  1FCC C;  1OFF A;  2DZM A;  4I6P A;  4K7S A;  4REZ A;  2LWP A;  2RDG A;  3HHM A;  4CO7 A;  2YVC A;  2D10 A;  2C5L C;  1KLG D;  1L2N A;  4DDI D;  3KUC B;  1MFW A;  2BGF A;  2W3R A;  5CHV C;  2QIE B;  1DGJ A;  2WNM A;  3VRB B;  1J7A A;  1F1H A;  3KWL A;  5J2R A;  2O6V B;  2AX5 A;  2EKE C;  2V0G A;  3UF8 A;  3AE9 B;  3VTW A;  3L17 A;  2IYD B;  4NQL B;  3GP7 A;  1XQQ A;  2KHW B;  3HM3 A;  4CYE A;  2RSU A;  1C76 A;  2CHW A;  2J4X A;  4FA6 A;  3N32 A;  2KDM A;  4DXG A;  3AE3 B;  2KJR A;  2KMM A;  4GB9 A;  2GMI C;  3NVV A;  2ICI A;  3N30 A;  1FMA D;  2KMC A;  1GUA B;  1DYQ A;  1EO6 A;  2WWZ A;  3QHT A;  4GSW A;  4WJO A;  4HEA 1;  1E7P B;  2DHZ A;  1E7V A;  2MWS B;  1MI0 A;  3W5U B;  3AU4 A;  3UIN B;  2D3B A;  4ACF A;  3FC4 A;  1Q5W B;  1EF5 A;  4JE3 B;  1EU3 A;  1P1A A;  1TS2 A;  1M4V A;  2CJN A;  1SE2 A;  3VTU A;  2WXO A;  3ZJV A;  2C60 A;  1MVK A;  5CTR C;  2BWF A;  1BUI C;  3L13 A;  2PTL A;  3ZNI D;  1TGZ B;  1YQ3 B;  2V3S A;  4IM0 A;  1V1P B;  2MP2 A;  4A90 A;  2MW5 A;  2WU2 B;  1V2Y A;  3MHS D;  1WF9 A;  3R3M A;  3VUW A;  3R7R A;  1QT9 A;  2KO3 A;  3L08 A;  2Y5P A;  4BAX A;  3BIN A;  4MSQ B;  1AAR A;  3CMM B;  2I38 A;  4C56 C;  1D6E C;  3DBR B;  2IZV B;  3AEA B;  2E3T A;  2RD0 A;  3PHX B;  2G4D B;  2GLS A;  3AB5 A;  2LVP A;  5E6J A;  5J17 A;  4YTP B;  2K8B A;  3SD5 A;  4K81 A;  1V1O A;  2RDH A;  4EOY A;  4EFO A;  2V3P A;  2KTF A;  3N20 C;  3ZW3 A;  2KD0 A;  3KUZ A;  1WGK A;  4S0R A;  2AL3 A;  2IDY A;  2K39 A;  3PGE A;  4IWP A;  4HPL B;  2NPT A;  2LGY A;  1NI3 A;  4GDK A;  2FNJ B;  2BKR B;  4ZYS A;  3HVD A;  3VR8 B;  1YX6 B;  1JRP A;  2VRR B;  1Z2M A;  1LGR A;  1UBQ A;  2D3A A;  2N1W A;  3FIL A;  3N1Z C;  3T3N A;  5AUI A;  1EM7 A;  1NDD A;  2MHJ A;  3ZQ4 A;  3LYY A;  3NZ3 A;  2MBB B;  3RFZ B;  3AE7 B;  1V6E A;  2WLB A;  4O1N A;  2ZW0 A;  2KT7 A;  4YT0 B;  3PZ7 A;  5L83 A;  1VJK A;  3HUI A;  3GS2 A;  2NTT A;  2IJ0 A;  1XLO A;  3P4Q B;  1ESF A;  3M95 A;  2WGS A;  1WGH A;  3AEC B;  3PRE A;  2KDB A;  4MGK E;  1LO5 D;  1K53 A;  1MHX A;  3AE1 B;  4N58 A;  1AWD A;  2WDT B;  2KWD A;  1RFK A;  2N9X A;  2XNA C;  4MM3 A;  1QKZ A;  4ARC A;  4QAY A;  1BT0 A;  2W9N A;  2INC C;  1GAQ B;  4LDT B;  3R66 C;  2LVQ A;  4AWJ A;  4TV3 A;  4WJN A;  3C8Y A;  1EF1 A;  3RNB C;  2J7Q B;  1T5X D;  4D2K A;  1J7B A;  1GG3 A;  4XDC A;  3BVZ A;  1N63 A;  4US9 A;  3EA6 A;  3WIM A;  1MJD A;  3AXC A;  3RPF C;  1XT9 B;  4FBJ B;  3T9L A;  1EU4 A;  4UDU C;  1XXG A;  1WI0 A;  2DLB A;  3ZXV A;  2PKO A;  3MC9 A;  5AUK A;  4HCN B;  5H92 C;  3WAP A;  3P63 A;  1YJI A;  2LVO A;  3B2G A;  4Q2J A;  3VAW A;  4KSL C;  1KM7 A;  4KDL B;  2LI5 A;  3SEB A;  1AN8 A;  1SB3 C;  2WXM A;  1QQR A;  3U2S C;  2FBW B;  3QX1 A;  4KKJ A;  3IXS A;  3W5V B;  4M01 A;  2FID A;  5EE9 A;  4YWG G;  3P42 A;  1F77 A; 
#chains in the Genus database with same CATH homology
 3UQA A;  3APF A;  2N7E A;  2L76 A;  2WX0 A;  1HE8 A;  2LGD A;  2KK8 A;  4GIV A;  4IC7 B;  4AP4 C;  4GXB A;  3APC A;  3BY4 B;  2IO0 B;  3DCG A;  1Q1O A;  2JWZ A;  3HM6 X;  4HDO A;  2J0K A;  3A1Q B;  3R7Q A;  1Q0W B;  3OJ4 B;  2BPS A;  2KNB A;  3S2A A;  2KLG A;  3V61 A;  3KVF B;  2B3A A;  2KFK A;  2L8J A;  3KYC D;  4JQW C;  3ZIM A;  2IY1 B;  4DHJ B;  2KN5 A;  2HTH A;  3M3J A;  4ANW A;  4BFR A;  4KZ0 A;  4ICU A;  1OEY A;  3RYT A;  1V5T A;  4BKG A;  4ANU A;  1UH6 A;  1U4A A;  3GZN I;  1GC7 A;  2D11 A;  4NJ7 A;  2JZ3 B;  4K7W A;  4KSK C;  2LZ6 A;  4EKU A;  1WM3 A;  2DAF A;  5AZH A;  4IWQ A;  2MX2 A;  1ZGU B;  1LXD A;  2D3G A;  4IM2 A;  4PS7 A;  2L0F A;  2OJR A;  2IY0 B;  3PSE B;  2KLC A;  4LJO B;  2MBO A;  2KJH B;  2K1F A;  4II3 B;  2LRW A;  1SE9 A;  2EMT A;  1M94 A;  3HIZ A;  1Y8R C;  5C1Z A;  2KDE B;  3C0R B;  2K8H A;  4ZRK A;  3ML9 A;  4URK A;  1OQY A;  2QHO A;  4W9E A;  2IO2 B;  2JPH A;  5E6O A;  3OJ3 A;  1TBE A;  2KFK B;  3UIO B;  3JVZ X;  2O6V D;  4W9F A;  3K9P B;  1KLV A;  2NR2 A;  2JVC A;  5DCN A;  4A3P A;  3RZW C;  2YLM A;  4IWO A;  1WFY A;  2G4S A;  3JYU A;  3ZRC A;  3NZU A;  2DZJ A;  2O2V A;  1GNU A;  2Z0E B;  5BO4 B;  4W9J A;  2ZZP B;  5CX3 A;  4M8M A;  1IPG A;  2FUH B;  2BWE S;  2KWV B;  3DVN U;  2XEW A;  4E74 A;  2ZCC A;  3IBE A;  2AEH A;  3B1L X;  1UEL A;  1NBF C;  2DYB A;  2IO1 B;  2KC2 A;  4M0W B;  3ZNZ B;  3IFW B;  4K7U A;  1A5R A;  1WXA A;  3X0W A;  3WAL A;  4G11 A;  1ZW7 A;  4GGQ A;  4B95 A;  4M8N A;  2JRI B;  4DHZ E;  3O65 B;  2Z59 B;  4ANX A;  4WJP A;  3PHW B;  5JH5 C;  5JHA A;  4I6N B;  3UGB B;  4B9K A;  2RGF A;  4FLH A;  4W9G A;  3ONS A;  2GBJ A;  3RZF A;  4IM3 A;  4EEW A;  4YL8 A;  4FHK A;  3RT3 B;  4K1R B;  1WH3 A;  4WWP A;  2DYM A;  3RUL A;  1EUV B;  1YQB A;  2D2Q A;  2HD5 B;  1T0Y A;  3GOE A;  4N9F 4;  1NI2 A;  2DX5 B;  3RCZ A;  1OGW A;  3DQV A;  3OAW A;  2KFJ A;  2N1V A;  3TJP A;  3B08 A;  4G50 A;  2OOB B;  4AUQ C;  2BF8 B;  2O6V A;  4ANV A;  2KKC A;  4NJ6 A;  5IAA C;  3VUY A;  2Z0D B;  1UZX B;  3TL5 A;  4EZK A;  2DZM A;  4I6P A;  4IW0 A;  4K7S A;  2NCN A;  2LWP A;  3L10 B;  1WYW B;  3HHM A;  3NHE B;  4CO7 A;  2GBM A;  2YVC A;  2DEN B;  2D10 A;  1WGD A;  4ZRI A;  2C5L C;  2CS4 A;  4BBN C;  5EDS A;  4CHK A;  1I42 A;  4BBN F;  3A1Q A;  1L2N A;  2KX3 A;  3ZVV A;  1E90 A;  4W9D A;  4PYZ A;  3KUC B;  4DDI D;  2BGF A;  4XC2 A;  3L54 A;  5CHV C;  2GBN A;  2MP2 B;  2FCN A;  5D6J B;  5TR5 A;  3ZDM C;  4NQK E;  1UBI A;  3QCA A;  1WY8 A;  3TIX A;  2MLB A;  2G3Q B;  4IG7 B;  2M0X A;  3ZKJ C;  1P3Q U;  1LM8 B;  5J2R A;  2PJH A;  5AEK B;  1E8X A;  2O6V B;  3AI5 A;  4IUM B;  2KAN A;  3A9K A;  2EKE C;  3QC8 B;  2M8S A;  3UF8 A;  2C7H A;  2ZPY A;  1OEY J;  3MJW A;  5JZE B;  2LXA A;  3L0W B;  3WA0 A;  4DBG A;  2DZK A;  2KDI A;  3PV1 A;  5DPT A;  5AZG A;  3VTW A;  1SIF A;  2AYO B;  3DDC B;  4E71 A;  2KJ6 A;  1WE7 A;  3L17 A;  3PS6 A;  2IYD B;  4NQL B;  1JRU A;  2K25 A;  1X1M A;  1XQQ A;  4OVU A;  2KHW B;  3HM3 A;  1UGM A;  4HJK A;  3EFU A;  2JUO A;  4CYE A;  2ASQ A;  2RSU A;  3VH4 B;  2CHW A;  4HWI B;  4MJS A;  4FA6 A;  2C7M B;  3N32 A;  3A33 B;  4I6L B;  2HJ8 A;  2KJR A;  3H7P A;  1IYF A;  4HPM B;  4W9I A;  3JW0 X;  3Q3J A;  4MEM A;  2EMS A;  2GMI C;  2BYV E;  2R2Q A;  2REX A;  3H9D A;  1WZ3 A;  3EHV A;  4GB9 A;  4PS8 A;  4BOZ B;  3A9K B;  3NZS A;  1P98 A;  3PPA A;  3N30 A;  1WM2 A;  1C1Y B;  3V60 A;  2KMC A;  3U30 A;  2AWT A;  2GBK A;  2L3Z A;  1GUA B;  1V49 A;  4ICV A;  4JGH B;  4EUT A;  1EO6 A;  4HLE A;  2WWZ A;  1WX7 A;  1SGH A;  2JY6 A;  2KWC A;  3APD A;  3P2B A;  3DPD A;  3QHT A;  4GSW A;  4WJO A;  4BKS D;  4DWF A;  2KDF B;  3ALB A;  2MSE D;  2L7R A;  2DHZ A;  4GDK B;  1E7V A;  5LXH A;  2MWS B;  1I35 A;  1RAX A;  1V80 A;  2ZNV C;  3ECI A;  3PVL A;  4A20 A;  4WJQ A;  4MJS B;  3JSV A;  3AU4 A;  3UIN B;  3K9O B;  3TMP B;  3N3K B;  2C7N B;  1TTN A;  3H7P B;  1Q5W B;  1EF5 A;  1P1A A;  4EZJ A;  3EC8 A;  3QAR A;  3I3T B;  3Q3F A;  4E3C A;  1WMH A;  3VTU A;  1F9J A;  2LAS A;  2NBV B;  3KYD D;  2FCQ A;  5G2N A;  1J19 A;  2C60 A;  2UYZ B;  5CTR C;  3VFK A;  4GU2 A;  2BWF A;  3L13 A;  4GDL A;  3ZNI D;  4MGY E;  1TGZ B;  4HXD A;  4W9C A;  2CHZ A;  1J0G A;  4FAD A;  4B6W A;  2V3S A;  2KXJ A;  2LGX A;  5DPR A;  5HKH A;  5IA7 A;  3DBL I;  4IM0 A;  4NPN A;  2XBB C;  4KDI C;  1E7U A;  2MP2 A;  1WXS A;  2LD9 A;  2WX1 A;  4BVU C;  4KIK A;  1WRD B;  4DDG D;  3DVG Y;  2MW5 A;  5J18 A;  1WX8 A;  1V2Y A;  5CHF A;  3PTF C;  2V1Y A;  1WXM A;  3JSV B;  1V5O A;  2ZPN A;  3D32 A;  3DVG X;  1WF9 A;  3H6N A;  3KUD B;  3MHS D;  3R3M A;  3R7R A;  2RR9 A;  2MCN B;  3VUW A;  2N7D A;  4RMA A;  2KO3 A;  3L08 A;  5LXI B;  1LFD A;  2DZI A;  3ML8 A;  1R4M I;  2HE7 A;  2L0T A;  2PE6 B;  3BIN A;  3SHQ A;  2J0M A;  4XX5 A;  4MSQ B;  1E8Z A;  1AAR A;  3CMM B;  2MQJ A;  5GMV A;  3A4S C;  3PRM B;  1WMH B;  4BKT A;  3UQB A;  3ZTC A;  4MEL A;  4HK2 A;  4MDK E;  2J0J A;  3PLV A;  3QAQ A;  1KOT A;  1WE6 A;  3ZLZ A;  4TQ0 A;  2IZV B;  3QQ8 B;  2LUE A;  4KV2 A;  3H7S A;  1E8W A;  2GOW A;  4GN1 A;  4NNJ B;  4A3O A;  5C23 A;  2RD0 A;  2PEA A;  3PHX B;  3OLM D;  1WGR A;  1PQS A;  2G4D B;  3NOB A;  2KTR A;  5KHO A;  4F7Z A;  2LVP A;  4KIK B;  1J8C A;  3LDZ E;  5J17 A;  5AZF A;  4AJY B;  2KMA A;  2N9E B;  1VCB A;  3LJ3 A;  1CMX B;  3WAM A;  2K8B A;  3X23 A;  2C9W B;  2NBW B;  1OTR B;  4GDL B;  4RM8 A;  3SD5 A;  1GJZ A;  3QJZ A;  3T8M A;  3A4R A;  4K81 A;  2BYF A;  2LXC A;  1WR1 A;  2JT4 B;  3PLU A;  1WJN A;  4EOY A;  2CHX A;  4EFO A;  1MG8 A;  2L00 B;  2KTF A;  3M63 B;  3ZW3 A;  1E8Y A;  2KD0 A;  3V6E B;  4WWN A;  3KUZ A;  5FR6 A;  2AL6 A;  2AL3 A;  3PT2 B;  3VHT C;  3ZO5 B;  4X57 B;  2K39 A;  2XK5 B;  3PGE A;  4IWP A;  3VTV A;  4HPL B;  2NPT A;  2LGY A;  2V4L A;  3MTN B;  3NY5 A;  4GDK A;  2FNJ B;  2KTR B;  5DPS A;  3ZRF A;  2BYE A;  4JLC A;  2BKR B;  3A9J A;  2ZCB A;  4ZRJ A;  2UWQ A;  2K8C A;  4KZC A;  1C3T A;  2M17 A;  1YIW A;  4WWO A;  1IP9 A;  1YD8 U;  3DBH I;  4GMV A;  3ZUN A;  4ASW C;  2G45 B;  1YX6 B;  2A4Z A;  1TZ1 A;  3ENE A;  5L95 C;  2VRR B;  2N4F A;  1Z2M A;  3IVF A;  1UBQ A;  1YJ1 A;  4FHJ A;  2KC1 A;  4FJV B;  2ZJD A;  5D94 A;  5KHQ A;  2N1W A;  3H1U A;  3V6C B;  4RM9 A;  2ZNV B;  3KW5 B;  4MGI E;  1L7Y A;  3TCA A;  1NDD A;  4G3X B;  4WQO B;  4LCD E;  4LJP B;  4ZYN A;  4HVB A;  3U8Z A;  2NPT B;  5D2M B;  5E6P A;  4FJZ A;  2KVR A;  2MBB B;  3AU5 A;  4II2 B;  4NY0 A;  4ZDV A;  2I1K A;  4MGZ E;  5CHW A;  2ZVO A;  1V6E A;  3A9J B;  3VXW A;  2KQS A;  3W1S C;  2KZR A;  4JL9 A;  2Y5B B;  1FXT B;  4TUU A;  3IHP C;  5L83 A;  3RD2 A;  3ZNG C;  1WXV A;  2A5U A;  3ZNH B;  1WIA A;  2KQ7 A;  3HK0 A;  2WYQ A;  2JRH A;  4BKS A;  5D7G A;  4DXA B;  2BKF A;  3DBS A;  4MSM B;  2R2O A;  2NBU A;  1E5W A;  2CKH B;  2FCM A;  3SDL C;  3PRZ A;  2CU1 A;  5JHB A;  2RPQ A;  2FAZ A;  3WAN A;  3VUX A;  1R4N I;  4GOC A;  1WX9 A;  2NS5 A;  2JZZ A;  3M95 A;  4W9K A;  1WGH A;  3U7D A;  2CR5 A;  3PRE A;  3UIP B;  2LRU A;  3V62 A;  2KX0 A;  2NVU I;  3PZD A;  1WJU A;  2KDB A;  4MGK E;  2I1J A;  1P0R A;  3DVN V;  3SU8 X;  4OVV A;  2K6Q A;  2N9P C;  2WDT B;  1WJ6 A;  4PYU A;  4AOF A;  3NS8 A;  2N9X A;  4MM3 A;  1S3S G;  4DHJ D;  2FCS A;  2MBQ A;  1K8R B;  1GC6 A;  4HCP B;  3W1Y A;  1P9D U;  2LJ5 A;  4W9H A;  1BT0 A;  2W9N A;  2PE9 A;  4FN2 A;  4LDT B;  3R66 C;  2LVQ A;  2KWU B;  3B0A A;  4TV3 A;  3VH3 B;  4AWJ A;  4DK5 A;  4WJN A;  1Z5S B;  5DPW A;  2FIF A;  2MBH A;  1EF1 A;  1YX5 B;  2K6D B;  3VDZ A;  2J7Q B;  3QWZ B;  4JIO U;  3ZTD A;  1WGG A;  2MA9 B;  4NAW A;  1GG3 A;  2M1M A;  1QZE A;  3CF6 E;  3EEC A;  2XK5 A;  3QIJ A;  4TQ1 A;  4F8C B;  1V9J A;  2O2V B;  3VQI A;  3WIM A;  3AXC A;  1XT9 B;  4KVG B;  4FBJ B;  4G0N B;  3T9L A;  2DAJ A;  1WR6 E;  3CST A;  3WAO A;  3PRP B;  1G6J A;  3VVW B;  4P7I A;  1V81 A;  1WI0 A;  1VD2 A;  1WZ0 A;  4PS3 A;  3QA8 A;  2DYO A;  1WJ4 A;  1H4R A;  4WAA A;  3DOW A;  4BOS C;  2ZEQ A;  4MH0 E;  3CSF A;  4HCN B;  1S1Q B;  3WAP A;  4XZ4 A;  4TKN A;  3DBR I;  2D07 B;  1WGY A;  4FUL A;  4EZL A;  1D3Z A;  1RFA A;  4FJY A;  2LVO A;  1H8C A;  2ZVN A;  3VAW A;  4KSL C;  3AUL A;  3IG3 A;  3M62 B;  5LLI A;  2IO3 B;  4HDQ A;  1KM7 A;  1ZKH A;  4W9L A;  4KDL B;  5E6N A;  2LI5 A;  3QK0 A;  3W1S A;  2L05 A;  1UD7 A;  3ZDT A;  4AJW A;  1LQB A;  1ISN A;  2JF5 A;  4J6I A;  4NAW B;  1KJT A;  1RRB A;  3KH0 A;  2GBR A;  1RLF A;  3L16 A;  2JXX A;  1XD3 B;  1V86 A;  3RUI B;  3QX1 A;  2MRP A;  2M4N A;  2PPH A;  2FID A;  2KOX A;  4LDT D;  4DHZ B;  4F1S A;  2IBI B;  5G55 A;  3TBL D;  2MBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...