3WIMA

Gabarap-lir peptide complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Gamma-aminobutyric acid receptor-associated protein
publication title GABARAP-LIR peptide complex
rcsb
source organism Homo sapiens
total genus 34
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wimA00
3L08A 1SE9A 2I1JA 2FCQA 1I42A 2CU1A 2DZMA 3PT2B 4PS8A 3WAOA 3Q3FA 4WJNA 2WDTB 3PREA 2YVCA 3VTUA 1Q5WB 2LVQA 3HK0A 4EFOA 1U4AA 3PHXB 5JH5C 4FHKA 2EKEC 2L7RA 4A20A 1OTRB 2K8CA 3JW0X 1KM7A 3B1LX 4F8CB 1QZEA 3A4RA 4NAWA 2FIDA 1TBEA 4W9FA 3GZNI 1WJNA 4BOSC 5CHFA 2MQJA 3DVGX 4IWOA 4KIKA 4YL8A 3JVZX 4GIVA 2MCNB 3V6EB 4ZDVA 2C7NB 2MP2A 2G3QB 2MSED 2AL6A 2BPSA 3LDZE 2BYVE 4ANXA 3ZNID 4DHZE 2ZZPB 4GB9A 4WJPA 1ISNA 2JY6A 2L0FA 4HK2A 3ZLZA 4AOFA 5JHAA 3NS8A 1WM2A 1J0GA 3KH0A 4PYZA 3WAMA 2M4NA 4GGQA 3CSFA 3AI5A 4EOYA 1V49A 3ALBA 3IBEA 2IO2B 2KJ6A 3M62B 2O2VB 2NCNA 4FJZA 4ICVA 5JHBA 3MJWA 2BYEA 2MWSB 4MELA 1KJTA 4FULA 4KSKC 2KKCA 5DCNA 4BKSA 3C0RB 3AU4A 3OJ4B 3A9JB 2K6DB 2D07B 3BY4B 1LM8B 4PS7A 1UBIA 2KHWB 3W1SC 2IY0B 3QX1A 2Z0EB 2PPHA 4BKGA 4HJKA 2G45B 4FN2A 3VXWA 1LQBA 2KDFB 3EC8A 3VTVA 2IO0B 5AZHA 1A5RA 5LLIA 1WJUA 2HTHA 3WANA 1YX5B 1L2NA 4GMVA 2G4SA 1X1MA 2RR9A 4GDKB 4JGHB 3RZWC 3W1YA 4EZJA 1GJZA 1V5OA 4ANUA 1PQSA 2RSUA 2CHZA 4IC7B 3ZIMA 1VD2A 3RCZA 2VRRB 3AU5A 2KK8A 2D3GA 2MBOA 3KUDB 1TGZB 3L17A 1C1YB 1P9DU 2NBUA 3IG3A 3RZFA 1G6JA 1E7UA 1ZGUB 1SIFA 2M17A 2M0XA 4NPNA 4ANWA 4MJSA 1TTNA 1Z5SB 2REXA 3DPDA 4IUMB 4TQ0A 2BGFA 3APFA 4MSQB 2GOWA 5J18A 3ECIA 2AEHA 2G4DB 3IFWB 1WXAA 3I3TB 3VUYA 1P98A 5LXHA 3PSEB 1GUAB 3DOWA 3UIPB 2ZCBA 1OQYA 4II3B 1OEYJ 2IO1B 4GXBA 2RGFA 2LGYA 1WXSA 2PJHA 2XK5B 4BBNF 4W9HA 1FXTB 4E74A 4EEWA 4E3CA 2WYQA 4KV2A 1WH3A 3ZO5B 3SD5A 2KMAA 2WX1A 3QQ8B 1WIAA 2KOXA 3AXCA 3B08A 4KDIC 4IM0A 5AZFA 1WX7A 3L0WB 1WM3A 3SHQA 2O6VA 3A4SC 3PS6A 2KDIA 3WAPA 3PVLA 4ZRKA 2LJ5A 5EDSA 1XD3B 2JUOA 3O65B 4HVBA 3EHVA 1UGMA 3DQVA 2JXXA 4BKTA 4HCNB 1WRDB 1WX9A 3U30A 1UBQA 4W9LA 2MBEA 3ML9A 3R7RA 1YIWA 4DHZB 3S2AA 3VAWA 2MLBA 2KWUB 2K8BA 1LFDA 1WFYA 2DAFA 2LI5A 4MGKE 3V6CB 2ZVNA 3ZNHB 2AL3A 4URKA 3ENEA 3EFUA 3U7DA 2V4LA 3TL5A 4G11A 4P7IA 1EF1A 2LVPA 3N30A 3H7PB 5FR6A 4K7SA 5J2RA 1EF5A 2KQSA 1V5TA 1GC7A 4BKSD 4ICUA 4K7WA 3R3MA 1JRUA 2ZNVB 2MX2A 3QA8A 5C1ZA 2BKRB 2J0KA 2JPHA 4BOZB 3V60A 1GNUA 2D10A 2KFJA 3ML8A 1GC6A 3VTWA 4A3OA 2K25A 5AZGA 1WJ6A 2D11A 3VH3B 5AEKB 1IP9A 3OLMD 3H9DA 1IPGA 3W1SA 1RRBA 3QAQA 3VH4B 2B3AA 1WZ3A 4GDLA 3CMMB 5E6PA 3R7QA 1I35A 2DZJA 4MDKE 4IWPA 2KDEB 5LXIB 2KQ7A 4CHKA 3DBRI 2C5LC 4I6LB 4EKUA 2CHXA 2JVCA 2NBVB 2LVOA 2EMTA 1WMHB 2LRUA 4HDOA 4FBJB 1WF9A 1Z2MA 1ZW7A 2AYOB 4KSLC 4GN1A 3TCAA 3P2BA 4JQWC 2N1WA 3L54A 3T9LA 2I1KA 3JSVB 4MEMA 3EECA 3H7SA 2KD0A 2O2VA 4X57B 3QIJA 4JL9A 1WGHA 4GSWA 4AP4C 2L05A 2MA9B 2FCMA 2IBIB 2KLGA 3ONSA 1WGGA 3PZDA 4MGIE 4WJOA 1J8CA 4DHJD 2DZIA 3HIZA 4LDTD 4PS3A 1E8YA 2BWES 2O6VD 2M1MA 4KZCA 4NY0A 3TMPB 3VQIA 4GU2A 4RM9A 1R4NI 2MRPA 4LCDE 2L3ZA 4OVUA 4W9IA 1T0YA 3KVFB 5J17A 2BKFA 2GBKA 3NZSA 3IVFA 4I6NB 1E8ZA 4M0WB 3TJPA 3QHTA 4IW0A 1Q1OA 1ZKHA 1YQBA 2GBNA 3M95A 2W9NA 2J0JA 1S3SG 1V81A 2FIFA 2C9WB 5CHWA 4GDKA 3MTNB 4FA6A 4GOCA 1S1QB 1E5WA 1H8CA 1V6EA 4FHJA 2ZEQA 3HHMA 1NBFC 4CO7A 3A9KA 4ZYNA 2KANA 2HJ8A 5HKHA 2KTRB 1NI2A 5D7GA 3NZUA 3HM3A 2LXAA 4HWIB 2JF5A 1RLFA 1E8WA 3ZNGC 3QK0A 4XC2A 4PYUA 4BFRA 2ZVOA 4DDID 2KWVB 2R2OA 1E90A 5D6JB 4DK5A 5L83A 2IY1B 4ASWC 1XT9B 2IO3B 5JZEB 3K9OB 2KNBA 4MGYE 4FJYA 3ZRCA 1EUVB 5BO4B 2JZZA 4LJOB 5E6OA 4MM3A 3H1UA 2XK5A 4M8NA 4W9DA 1WY8A 3PTFC 3NHEB 1WGDA 3KUCB 2UYZB 2DYBA 3VVWB 2JRIB 1WXVA 2M8SA 3NOBA 1XQQA 2J7QB 2KFKB 4HLEA 3AULA 1YX6B 2CS4A 1WYWB 2LRWA 2ZPYA 2RD0A 4NQLB 3UQAA 3SDLC 1WZ0A 4LDTB 3ZRFA 4NNJB 1UD7A 2CHWA 2DYOA 3RT3B 2LZ6A 2ZPNA 1WX8A 2LXCA 3QJZA 4LJPB 2GBMA 2N9XA 3VHTC 2JZ3B 2NS5A 2Z0DB 4E71A 4DXAB 5L95C 4IM2A 2CR5A 4XX5A 2PE9A 3APCA 1UH6A 1WGRA 2BYFA 2R2QA 3QARA 3KYDD 4OVVA 2KN5A 1SGHA 2KC2A 3H7PA 2KZRA 3ZVVA 4DDGD 2J0MA 1L7YA 3KYCD 4A3PA 2DZKA 3L16A 2RPQA 4G3XB 5E6NA 4MGZE 1IYFA 2NPTA 1D3ZA 2IYDB 3A1QB 4TUUA 2L8JA 2DYMA 1UELA 3UIOB 3UINB 2KWCA 4WQOB 5G55A 4ZRIA 1E7VA 2QHOA 4AJWA 2MBQA 4HPLB 4J6IA 2NVUI 4AWJA 2UWQA 1C3TA 4IM3A 3DBSA 4CYEA 3JYUA 4K81A 2WWZA 5IA7A 5DPRA 2ZCCA 4FADA 2KX0A 4NJ6A 2V3SA 3V61A 3RD2A 3ZUNA 2N4FA 2GBJA 1LXDA 1OEYA 4JLCA 3WA0A 1GG3A 4II2B 5D94A 2KXJA 1P1AA 2HE7A 2L00B 2L76A 4MH0E 4NAWB 2PEAA 3QCAA 2MW5A 3ZKJC 4FJVB 3CF6E 3ZTDA 4W9GA 4KIKB 4HPMB 4GDLB 3PLUA 4TV3A 4WWOA 1WGYA 1V9JA 2MP2B 1WMHA 4G0NB 2JRHA 2ZNVC 2XEWA 2GMIC 4HXDA 3VDZA 4B95A 1RFAA 1H4RA 2K8HA 2FAZA 2FUHB 3VUXA 2PE6B 2LWPA 3DCGA 3PHWB 5DPTA 5G2NA 1M94A 1YD8U 4DBGA 3JSVA 2CKHB 1VCBA 2Z59B 3UF8A 3A9JA 2DX5B 2LD9A 2V1YA 3APDA 5CX3A 2BWFA 4K7UA 3QWZB 1TZ1A 3DDCB 5D2MB 2AWTA 2N7DA 3QC8B 3X23A 4HDQA 2C7HA 3M63B 3B0AA 4NQKE 3RYTA 4F7ZA 3ZW3A 4W9CA 3RULA 1V80A 1Q0WB 2C60A 4W9KA 4WWNA 4ZRJA 4B9KA 1V86A 2L0TA 3N32A 4RMAA 3M3JA 4W9EA 4NJ7A 2LASA 1EO6A 3DVNV 2KDBA 4EZKA 2IZVB 1CMXB 1V2YA 2NR2A 4M8MA 1UZXB 2FNJB 2N9EB 4I6PA 3SU8X 2D2QA 2EMSA 4K1RB 3ZDTA 3ZDMC 2OOBB 3L13A 4IWQA 2KTRA 2DHZA 2GBRA 3MHSD 3RUIB 3OJ3A 1WR6E 2KO3A 4AUQC 4BBNC 2N1VA 2DENB 3L10B 4TKNA 2JT4B 4EZLA 3A9KB 4MJSB 4WJQA 3Q3JA 4XZ4A 3UQBA 1BT0A 3KW5B 2A4ZA 3BINA 2LGDA 2Y5BB 2KJRA 3H6NA 2NBWB 1WE7A 4HCPB 5GMVA 3DBHI 3LJ3A 1WR1A 2LGXA 3TBLD 3ZNZB 3K9PB 3X0WA 3PRPB 4MSMB 3VUWA 2XBBC 4WAAA 4IG7B 5TR5A 2K39A 2KX3A 5DPSA 2LUEA 3VFKA 4BVUC 2DAJA 1MG8A 2YLMA 1AARA 2KLCA 4DHJB 2FCNA 1J19A 2KFKA 3PGEA 3WIMA 2O6VB 1P0RA 4KZ0A 5KHOA 4AJYB 2KTFA 2WX0A 4DWFA 3DVGY 1NDDA 4JIOU 3DVNU 5C23A 2BF8B 3V62A 1HE8A 2HD5B 3WALA 3PPAA 3NY5A 3PRZA 3D32A 2KMCA 3TIXA 2MBHA 3PRMB 3PLVA 5DPWA 4N9F4 1E8XA 1KOTA 1P3QU 1YJ1A 2A5UA 5KHQA 3PV1A 3KUZA 2KVRA 3OAWA 3A33B 2ASQA 1R4MI 5CHVC 4FLHA 3N3KB 1WE6A 1WXMA 1Y8RC 2MBBB 1WJ4A 1F9JA 2C7MB 2ZJDA 4KDLB 2N7EA 4B6WA 2KJHB 2N9PC 3CSTA 4W9JA 3GOEA 2OJRA 2K6QA 3A1QA 3HM6X 4TQ1A 5IAAC 3T8MA 2K1FA 1KLVA 2JWZA 4WWPA 4F1SA 3DBLI 2KC1A 4RM8A 4G50A 4KVGB 3UGBB 1RAXA 3U8ZA 2NPTB 1OGWA 1K8RB 5CTRC 4ANVA 3IHPC 2FCSA 3R66C 4EUTA 1WI0A 3ZTCA
chains in the Genus database with same CATH superfamily
1B9RA 2FCQA 2CU1A 2J42A 3PT2B 3WAOA 3W5VB 1QQRA 2WDTB 3PREA 2YVCA 4EFOA 5L95C 4FHKA 2L7RA 5EE0A 3AEAB 1V97A 2K9XA 2JYEA 4NAWA 3C19A 1N5XA 3GZNI 3Q69A 1OFFA 4BOSC 3DVGX 2MCNB 2KACA 1D6EC 5MPOA 3ZNID 2MH7A 5FK9C 4DHZE 2ZZPB 3MC0B 5JHAA 2D3CA 3TEZA 4GGQA 4ZOHC 1EU3A 3AI5A 1NYRA 2KJ6A 5HHDG 5JHBA 3MJWA 2BYEA 4KSKC 4BKSA 3AU4A 3BVGA 2IY0B 1XXGA 1AWDA 2Z0EB 1VRAB 2HTME 3VTVA 2IO0B 5AZHA 1ZXIA 2HTHA 1FXAA 2Z8LA 2RR9A 3RZWC 1V5OA 4ANUA 4XDDA 2CHZA 2WHIA 2VRRB 4OVZA 1VJKA 2INDC 2D3GA 3KUDB 3RNEC 3BVMA 4OW0A 4CQNA 2N9LA 2BBCA 4NPNA 1TTNA 2RDBC 4AS1A 1K53A 1ET9A 1A70A 3IFWB 3AE7B 4YXDB 3I3TB 5LXHA 2Y5PA 3DOWA 3UIPB 2ZCBA 5FKAC 2IO1B 1WXSA 2XK5B 2WYQA 1WH3A 1KFYB 2WX1A 3QQ8B 2KOXA 3TEXA 1WX7A 3L0WB 2O6VA 2KDIA 3PVLA 4ZRKA 1JWUD 2KDMA 4HVBA 3EHVA 3DQVA 1WRDB 1PYWD 2MBEA 1F77A 1YIWA 1FCCC 3S2AA 1F2RI 1FNWA 3P1MA 1FD6A 2K8BA 1YJJA 3W5UB 4MGKE 1WFYA 2LI5A 3V6CB 2ZVNA 3ZNHB 3V3XA 3EFUA 4G11A 2DLBA 2D5GA 2K0PA 3H7PB 3Q2AC 2BVCA 2KQSA 2XN9C 1HTOA 3GE8C 1V5TA 3R3MA 3GS2A 3MFGA 1UNSA 2MX2A 5C1ZA 2LGIA 2LGSA 4BOZB 2JPHA 3V60A 3ZJUA 3N9YC 2G1EA 1YMHE 3BK1A 3OLMD 3H9DA 4NJCA 5H8YE 1WZ3A 4GDLA 2KYWA 4C00A 1KLGD 2I2YA 3SR6A 3AMZA 4IWPA 5LXIB 2LFIA 4I6LB 1E6EB 1I7HA 1WF9A 4KSLC 3B9JA 2QEJC 1QT9A 4JQWC 2OHFA 1EM7A 4MEMA 3MC8A 4X57B 4A9AA 2L05A 2MA9B 2FCMA 3PZDA 3Q8AA 2TSSA 2M1MA 4KZCA 2ONQA 3AEDB 2JXTA 4LCDE 2L3ZA 3EGRA 1TS5A 3I63C 4C56C 4I6NB 4M0WB 1EWCA 3TJPA 3QHTA 1ZKHA 2VZKD 2W9NA 5CHWA 4GDKA 3AH7A 1ZDVA 1E5WA 1H8CA 1R7SA 5D7GA 3NZUA 3HM3A 1E8WA 4BFRA 3QK0A 1D5MC 4XC2A 4DDID 4A8XC 3AB5A 4DK5A 2WXRA 4FXCA 4ASWC 1XT9B 2IO3B 4MGYE 4FJYA 4ARIA 1EUVB 3HUIA 1YOVB 1HQRD 2BB6A 3NHEB 2M8SA 1QOAA 3NOBA 2CU3A 3Q3OC 1WYWB 1ACCA 2RD0A 3UQAA 5IKCM 1NEKB 3ZRFA 2SEBD 2GBMA 2NS5A 2Z0DB 3R2TA 1SSNA 3QARA 1YN3A 2MJ3A 2FBWB 1SGHA 2KZRA 3KLSX 5BYQA 2QILA 1C76A 3KYCD 1SF0A 2IYDB 3OWEB 2L8JA 3C8YA 3UINB 5G55A 4HPLB 2NVUI 4AWJA 2UU7A 4P1CC 4J3OD 1I4GA 1C77A 4L2YA 1RYJA 2AQ1B 5DPRA 4NJ6A 2N4FA 3IAS1 3H8HA 1GG3A 1DYQA 4YWGG 2PEAA 3KQ4A 4FJVB 4W9GA 4GDLB 1XLNA 1PGXA 3EUB2 3NS1A 2INPE 2XEWA 4B95A 2LWPA 3DCGA 5G2NA 1YD8U 2CKHB 4KGRA 3N1ZC 3A9JA 1N62A 2PVOD 3APDA 5CX3A 2BWFA 4S17A 4RH6A 5EE1A 4L1BA 2PVGC 1AN8A 1T0SC 2BS4B 2AWTA 3QC8B 3M63B 3B0AA 3RULA 1V80A 5BMHA 3AE6B 2L0TA 3N32A 4RMAA 3M3JA 3FAHA 3DVNV 2DNFA 2BQQA 1V2YA 3MP9A 3SU8X 3ZDTA 2EMSA 3ZDMC 2MJEA 4IWQA 2DHZA 1WR6E 4R3DA 4LNIA 4BBNC 2N1VA 4TKNA 2JT4B 3UQBA 4WJQA 4XZ4A 2IGHA 1BT0A 2WXKA 3BINA 2JQRB 4P1BC 3Q8BA 1YN5A 5GMVA 3J9CA 3DBHI 1F2RC 3TBLD 3ZNZB 3LXFA 3PRPB 4HROA 2D3AA 2XBBC 4WAAA 2W82A 4IG7B 5TR5A 2IGDA 4AQ7A 1AARA 2FCNA 3PGEA 1FXIA 1P0RA 4JE3B 2KTFA 1NDDA 2BF8B 1FFUA 1V1PB 1DOIA 1KF6B 1KOTA 1FIQA 1YJ1A 3KUZA 3A33B 1MHXA 4FLHA 1R4NB 1WE6A 5G5GA 1F9JA 1FNVA 3A1QA 4N6EB 1I4QA 4DQOC 3DBLI 1D4BA 4KVGB 1RAXA 1OGWA 2W55A 1WI0A 1STEA 1SE9A 2L83A 2INNE 1I42A 3Q3FA 1Q5WB 2LVQA 4A20A 1OTRB 1I4HA 2K8CA 1RFKA 3P4QB 4KIKA 5CHFA 4YL8A 4JWSC 1I4PA 2BPSA 3LDZE 2V3PA 1L6UA 2BYVE 4XYCA 1UUPA 2WNMA 3NS8A 2QDFA 4RGOS 3E9SA 4EOYA 1K51A 1UGJA 2IO2B 3M62B 2O2VB 1PFDA 4RF1A 1DGJA 2MWSB 1GB1A 3B2FA 1WWTA 5DCNA 3A9JB 2WDRB 1FO4A 2K6DB 3BY4B 3AE4B 2QCZA 2PPHA 4BKGA 2G45B 3VXWA 2R61A 3EC8A 2NTTA 1QKZA 2N0SB 2YEPF 1QOBA 2G4SA 1X1MA 3W1YA 4M02A 3N1XC 3Q6BA 1L6VA 1BMLC 2KK8A 2MBOA 3L17A 2NBUA 3IG3A 4RGTA 2M17A 1AYFA 1ZXHA 4MJSA 1FFVA 1Z5SB 3DPDA 2AEHA 1YN4A 1YJIA 1WXAA 3O13A 4P6VF 4TMAB 4EEWA 2PTLA 4A55A 2ZW0A 4KV2A 3ZO5B 4KKIA 1WIAA 4LNKA 1ROEA 4D2KA 5AZFA 4IM0A 3SHQA 1V8CA 2KMMA 5HI1A 1ESFA 3WAPA 1HA5A 1XD3B 3O65B 4K3BA 2JXXA 1BUIC 1E9MA 1WX9A 4HCNB 1L0YB 1OQRA 1LFDA 3BZDB 2AL3A 2J52A 3U7DA 3TL5A 4P7IA 1EF1A 2LVPA 3N30A 4WAFA 4YTMB 1EF5A 1JRUA 2ZNVB 3RNAC 3P4RB 1GNUA 2D10A 2KFJA 3ML8A 3VTWA 4A3OA 5BMIA 1WJ6A 2D11A 4HEA1 2NTSA 1SJED 2EKIA 3QAQA 1KTKA 1F52A 3LYYA 3R7QA 2DZJA 3P4SB 2KDEB 1NI3A 2KQ7A 4CHKA 3DBRI 2C5LC 2CHXA 1L5PA 2EMTA 1TS3A 1WMHB 2LRUA 4FBJB 1Z2MA 2AYOB 3NUHB 2WQYB 3BYYB 1CZPA 2FE8A 3RNCC 3P2BA 1GB4A 5IP4D 2LHDA 3JSVB 4RGNA 2OEDA 3H7SA 2VH1A 1DOXA 4AP4C 1L0XB 2KLGA 4WJOA 4MGIE 2DZIA 4LDTD 3TMPB 1CQVA 2KN4A 1PGAA 4W9IA 4B0MA 2BYTA 1T0YA 3KVFB 3Q3MC 2BKFA 2GBKA 3NZSA 1R4MB 4IW0A 1SE2A 4WURA 2W3RA 2GBNA 2J0JA 1V81A 2OJWA 2X38A 4GOCA 3ZXVA 2WXOA 2WLBA 1DOYA 2WDVB 1J7CA 4CO7A 3A9KA 4YSXB 2KANA 2HJ8A 2KTRB 4GLSC 2LXAA 2JF5A 3ZNGC 4PYUA 2KWVB 2R2OA 4N58A 5D6JB 5L83A 2IY1B 1SB3C 3K9OB 3ZRCA 4LNFA 5BO4B 1WYGA 5E6OA 3H1UA 1HTQA 3NVYA 4M8NA 4W9DA 1WY8A 1JW9D 3GZNB 1WGDA 2DYBA 2JRIB 1WXQA 1XQQA 2AQ3B 2J7QB 2KFKB 1YX6B 3DBRB 1QF6A 4YSZB 1MG4A 3U7ZA 1UD7A 1B1ZA 2ZPNA 2WXFA 3FKYA 4LJPB 3LB8C 4DXAB 2CR5A 2PE9A 1UH6A 3N20C 1JRPA 4YTPB 2CJNA 2J0MA 1L7YA 4A3PA 3IT6B 3ZYYX 2RPQA 4G3XB 1IYFA 2NPTA 1WSPA 2DYMA 3UIOB 2ON8A 3GP7A 1SXTA 4AJWA 4HJGE 1C3TA 3AE1B 1L0VB 2WXJA 5IN7A 4K81A 2WWZA 1I4RA 2KX0A 3AE2B 3MC9A 2V3SA 1XLOA 4Q2JA 2WGSA 1LXDA 1OEYA 4A6QA 1P1AA 2L00B 4NAWB 1PGBA 3ZTDA 1T0QC 4TV3A 1WGYA 4G0NB 2JRHA 2ZNVC 3AE3B 2GMIC 3VDZA 4DXGA 2PE6B 3TUOA 3VR9B 4H2AA 4HKQA 1VCBA 5EE9A 2LD9A 2V1YA 4K7UA 3QWZB 1TZ1A 3X23A 4HDQA 2C7HA 4F7ZA 4W9CA 1Q0WB 4ZRJA 3I5JC 1V86A 3IXSA 4NJ7A 2LASA 1EO6A 3RNFC 2I38A 2NR2A 3BVZA 1JQ4A 4M00A 4K1RB 1N60A 2OOBB 1YQ3B 2GBRA 3MHSD 3OJ3A 2BTEA 4XDCA 4AUQC 4C4VA 3W2DA 1TYGB 2DENB 3L10B 1OQQA 3A9KB 3Q3JA 3H6NA 1NENB 2LGDA 2MEKA 5T8IA 1WR1A 2LGXA 1IUEA 3X0WA 2BB5A 4MH8A 1UF0A 1C9FA 1NYQA 1FRDA 2DAJA 1MG8A 2YLMA 5AUIA 1J19A 2LUMA 2O6VB 2B76B 4KZ0A 2LHEA 4DWFA 3DVGY 4XE0A 2KT7A 1SBBB 2HD5B 1WRIA 3PPAA 2MHJA 4LNNA 4C7ZA 2RMMA 2MBHA 2SAKA 3T3OA 1TKEA 1E8XA 4N9F4 3RNBC 4LK0M 4ZHOA 4ITKA 2ASQA 2H89B 1Y8RC 4P16A 4L23A 4KDLB 5IAAC 1KLVA 4KKJA 2KC1A 4REZA 1JALA 1FPYA 1F0ZA 3U8ZA 2NPTB 4ZYSA 1D5XC 2M0AA 4PS8A 4JPSA 3VTUA 1KM7A 1QZEA 5JXVA 2LEKA 4W9FA 1WJNA 2MQJA 4IWOA 4GIVA 3V6EB 4ZDVA 2C7NB 2MP2A 2IPKD 5GXGB 3ZLZA 4GB9A 4WJPA 2JY6A 4HK2A 4YTNB 4HRSA 4AOFA 1SE4A 3TEYA 3NZ3A 3ZJTA 2D3BA 1J0GA 3KH0A 2M4NA 2K22A 3CSFA 3ALBA 3IBEA 4FJZA 4ICVA 3P42A 4MELA 3PO0A 5E6JA 3C0RB 2PLPA 3CIRB 4XWTA 1BXTA 2D07B 1LM8B 1UBIA 1N61A 4FN2A 1FMAD 2KDFB 1QLBB 2QJLA 4YSYB 1VZ8A 1A5RA 1D5ZC 5LLIA 1WJUA 1YX5B 3Q8CA 3V05A 2ZW1A 4EZJA 4GDKB 4JGHB 1GJZA 4USAA 1PQSA 1TT5B 1LO5D 3SFEB 1TGZB 3EFCA 2W3SA 3RZFA 1Y56A 1HXYD 4TQ0A 2WXGA 2BGFA 2KQ4X 3APFA 4MSQB 4NZLB 4RNAA 3VUYA 1P98A 1GUAB 4B0EA 1F1HA 4II3B 1MJDA 1MI0A 1OEYJ 4C7YA 2LGYA 4BBNF 4NAMA 1FXTB 3MJ5A 4XWWA 2RPVA 3B08A 1J7BA 1WM3A 3PS6A 2LJ5A 2JUOA 2E6XA 4IOIE 4W9LA 2ICIA 3ML9A 3R7RA 4DHZB 3FILA 3VAWA 3Q8FA 2MLBA 4MACA 4URKA 1XCTL 3ENEA 2V4LA 5FR6A 1E7PB 4K7SA 5J2RA 1GC7A 4BKSD 3FC4A 4ICUA 3AEFB 3DWGC 1IBXA 3RN9C 2BKRB 5LNK1 5IO9A 3DHHC 3PZ8A 1V1OA 5AEKB 2WXIA 1IPGA 3W1SA 1RRBA 4ACFA 3VH4B 1EWYC 3VRBB 2WXQA 5FR3A 2GB1A 1C79A 3R2IA 4MDKE 3DBHB 2Q5WD 5EE3A 1FM0D 4EKUA 1JWSD 1ZW7A 5C3JB 4GN1A 3TCAA 2N1WA 3L54A 3T9LA 3UI3A 3EECA 2KD0A 3QIJA 1WGHA 4GSWA 1WGGA 3KWVA 2V3NA 4PS3A 2BWES 4JWUC 4N59A 2O6VD 2QSDA 4GU2A 1ZUD2 4RM9A 1C4PA 4OVUA 5J17A 2L52A 2H88B 1E8ZA 1YQ4B 1T5XD 1Q1OA 1S3SG 5BMGA 1P7FA 3AE8B 3MTNB 4FA6A 3DHGC 4JX1C 2G9HD 2ZEQA 3DBLB 3NVVA 1XEEA 1NBFC 1P7EA 4ZYNA 5HKHA 1NI2A 2PIAA 4KGSA 1RLFA 2ZVOA 1EU4A 5BYSA 4K3CA 5JZEB 2XK5A 3U2SC 3VVWB 2W54A 2CS4A 2LRWA 2ZPYA 4NQLB 1WZ0A 4NNJB 2CHWA 3RT3B 2LZ6A 1WX8A 3P63A 3BK2A 1JMLA 1L4ZB 3Q14C 3VHTC 2WXPA 4E71A 4IM2A 1Q10A 3FILB 3KYDD 2WU5B 2KC2A 3H7PA 4OZCA 4DDGD 3RMKC 3L16A 5E6NA 3AM9A 3A1QB 2KWCA 4ZRIA 1GAQB 1E7VA 2Y3AA 4J6IA 4EE2A 5BYRA 4IM3A 1IBXB 2KVZA 2J4XA 3V61A 3RD2A 3ZUNA 3Q3NC 4JLCA 3WA0A 3AE5B 4HPPA 4II2B 2L1AA 2HE7A 2L76A 5AUKA 1QOGA 2MW5A 4KIKB 4HPMB 1I4XA 3RPFC 4WWOA 2V4IB 2WXHA 2K8HA 2FUHB 3AEGB 4ZRPA 2JSVX 3PHWB 3W9CB 1FNUA 3UF8A 2IDYA 2J53A 3AECB 3BWUD 4RF0A 1JWMD 2ACZB 3DDCB 3SEBA 5D2MB 3U52E 3URYA 4NQKE 4M0WA 4W9KA 2C60A 3AEBB 4B9KA 3NJTA 2WU2B 1T6BX 2WDQB 2HJ1A 2QC8A 2IZVB 1RM6C 1UZXB 4I6PA 1IGCA 2QMTA 4KX6B 2KWDA 2PKOA 3RFZB 4EZLA 4MJSB 5H92C 2Y5BB 2KJRA 2NBWB 2N9KA 1GPXA 1WE7A 3K9PB 2K39A 2M19A 2JU6X 2LUEA 4DHJB 5KHOA 2WX0A 3DVNU 1XLPA 1RWSA 5C23A 1HE8A 3WALA 1KRHA 2EELA 3PRZA 3D32A 2KMCA 3PLVA 5DPWA 2JYTA 1P3QU 2A5UA 5KHQA 4WH4A 2KVRA 4OZAA 2GLSA 5CHVC 1WXMA 2MBBB 2ZJDA 2N7EA 4LTUA 4B6WA 3IAM1 4W9JA 3HM6X 3T8MA 3IT4B 4WWPA 4F1SA 4RM8A 3N1YC 1VLBA 1CK1A 5CTRC 3R66C 2FCSA 4EUTA 3ZTCA 1ENFA 3E56A 3L08A 2IGGA 4DXFA 2I1JA 2DZMA 4WJNA 3HK0A 5JH5C 1U4AA 2K3UA 3PHXB 2EKEC 1SE3A 3JW0X 1JWBD 3B1LX 4F8CB 3A4RA 2FIDA 1TBEA 3ETRA 2Y5CA 3JVZX 1HEZE 1C4AA 4UDUC 2G3QB 2MSED 2E3TA 2AL6A 1M4VA 3NRZA 3SFDB 2GI9A 4ANXA 3PZ7A 2KAJA 1ISNA 2L0FA 1WM2A 4PYZA 3WAMA 1V49A 3DWMA 1QOFA 2NCNA 5IOIA 3I9V1 1KJTA 1E10A 4FULA 3DHIC 2KKCA 3BYTB 3OJ4B 4S0RA 4PS7A 3NVZA 2KHWB 3W1SC 3QX1A 3VR8B 2DBYA 4HJKA 1XF5L 1LQBA 4XGAB 3R8BA 3WANA 1L2NA 4GMVA 4IKGA 2RSUA 4IC7B 3ZIMA 1VD2A 3RCZA 2DWQA 1HZ6A 3AU5A 3ZGZA 1J7AA 1C1YB 1P9DU 1G6JA 1E7UA 1ZGUB 1SIFA 4ANWA 2M0XA 4IUMB 2REXA 1TJEA 2GOWA 1TS2A 5J18A 3ECIA 2G4DB 1UWXA 3PSEB 1OQYA 3AE9B 4GXBA 2RGFA 3RI7C 2PJHA 4E74A 1JROA 1SEBD 4W9HA 4E3CA 3SD5A 1QILA 2WXLA 5G5HA 2KMAA 4KDIC 3KWLA 3AXCA 4PT5A 3A4SC 1T0RC 4LNOA 5EDSA 1UGMA 4BKTA 1V1PA 3U30A 1UBQA 4HKZE 3P4PB 2KWUB 4RCOA 2LJIA 2DAFA 5HFYA 2QIEB 3T3NA 1CJEA 1VZ6A 4YT0B 4US8A 2PW9A 3ZXRA 1VZ7A 4K7WA 3QA8A 3RNGC 2J0KA 1GC6A 2K25A 4ARCA 5AZGA 3VH3B 1IP9A 2IJ0A 2V0GA 1LGRA 2YEPB 1C4CA 2B3AA 3CMMB 5E6PA 1I35A 2AX5A 2JVCA 2NBVB 2LVOA 4HDOA 1TKYA 2I1KA 1XLQA 5TSSA 2O2VA 4JL9A 4US9A 2IBIB 3MHZA 3ONSA 1J8CA 4DHJD 3HIZA 1E8YA 3EA6A 4NY0A 3VQIA 2WS3B 1R4NI 1YNTE 2MRPA 3Q8EA 3IVFA 1ZOYB 1SJHD 1YQBA 3M95A 3TEWA 2XNAC 2FIFA 2C9WB 2LMCA 1S1QB 1UWMA 1V6EA 4FHJA 2BS2B 3HHMA 3AEEB 2INCC 3ZQ4A 3AN1A 4HWIB 1FRRA 2M56B 4O1NA 4C4VB 1MFWA 1ZDXA 2WP9B 1E90A 1KLUD 2KNBA 1ET6A 1K50A 2JZZA 4LJOB 4MM3A 5I4DA 3PTFC 4WWMA 2BS3B 2K5PA 1K52A 3NG0A 4TSSA 3KUCB 2UYZB 1WXVA 1SIJA 4HLEA 3AULA 3BIID 4BAXA 3SDLC 4M01A 4LDTB 1TIFA 2DYOA 1TY2A 2LXCA 3QJZA 5D3IB 2WXMA 2N9XA 2JZ3B 2N7JA 4XX5A 4ZRQA 1JWAD 1MVKA 3APCA 1WGRA 2BYFA 2R2QA 4OVVA 2KN5A 1TS4A 3ZVVA 1PUTA 3I57A 2DZKA 4MGZE 1D3ZA 4TUUA 1UELA 4WQOB 4RGMA 4QAYA 2QHOA 4RFBA 2MBQA 1HZ5A 2UWQA 1JCKB 1MHHE 1E0ZA 2VH2A 2WXNA 4C80A 3ZJVA 2MJDA 1TY0A 3DBSA 4CYEA 3JYUA 4LLGM 5IA7A 2ZCCA 4IDIA 2V9HA 4FADA 3TSSA 1TZOA 2GBJA 1VR9A 5D94A 2BW2A 2KXJA 4MH0E 3QCAA 3ZKJC 3CF6E 1ZE3D 3PLUA 1V9JA 2MP2B 1WMHA 2FUG1 3U4EG 4HXDA 1RFAA 1H4RA 2FAZA 3VUXA 3OG5A 5DPTA 1M94A 4DBGA 3JSVA 3GE3C 2Z59B 3VRAB 3CWIA 2DX5B 1AW7A 3ABVB 2N7DA 2L32A 3RYTA 2JX5A 3ZW3A 4OHJA 4MT5A 4WWNA 1TKGA 2JWUA 1N63A 4WIPA 4W9EA 2KDBA 2NMQA 4EZKA 3HVZA 1CMXB 4M8MA 2RDHA 2FNJB 1XO3A 2N9EB 2D2QA 3L13A 2GRIA 2KTRA 3WCQA 3RUIB 2KO3A 4PK1A 1L4DB 3HRDD 5D3DA 3KW5B 2A4ZA 2X8XX 1C78A 1KH0A 1T3QA 4HCPB 3LJ3A 4OZBA 3GB1A 4MSMB 3VUWA 1ZPSA 2KX3A 5DPSA 1ZP0B 3VFKA 4BVUC 4MM3B 2KLCA 2KFKA 3WIMA 4BZAA 1FCLA 4AJYB 4KGTA 2HDEA 4JIOU 4ZHPA 2CJOA 4WQMA 3V62A 2JZPA 1GOZA 3NY5A 3TIXA 3PRMB 5C2TB 1WGKA 2VZKB 3PV1A 3NVWA 1FEHA 5HG2A 3OAWA 3AV8A 1R4MI 3B2GA 4A90A 3N3KB 2RDGA 1WJ4A 2C7MB 1XCQL 1VDVA 3L4PA 2KJHB 2N9PC 3CSTA 3GOEA 2OJRA 2K6QA 4TQ1A 2AQ2B 1N5WA 1PDXA 2K1FA 2JWZA 4G50A 3UGBB 1MPEA 1IGDA 1N6ZA 1K8RB 3HVDA 2BT6A 3IHPC 4ANVA 2PMVA 1NVID
chains in the Genus database with same CATH topology
3L08A 1SE9A 2I1JA 2FCQA 1I42A 2CU1A 2DZMA 3PT2B 4PS8A 3WAOA 3Q3FA 4WJNA 2WDTB 3PREA 2YVCA 3VTUA 1Q5WB 2LVQA 3HK0A 4EFOA 1U4AA 3PHXB 5JH5C 4FHKA 2EKEC 2L7RA 4A20A 1OTRB 2K8CA 3JW0X 1KM7A 3B1LX 4F8CB 1QZEA 3A4RA 4NAWA 2FIDA 1TBEA 4W9FA 3GZNI 1WJNA 4BOSC 5CHFA 2MQJA 3DVGX 4IWOA 4KIKA 4YL8A 3JVZX 4GIVA 2MCNB 3V6EB 4ZDVA 2C7NB 2MP2A 2G3QB 2MSED 2AL6A 2BPSA 3LDZE 2BYVE 4ANXA 3ZNID 4DHZE 2ZZPB 4GB9A 4WJPA 1ISNA 2JY6A 2L0FA 4HK2A 3ZLZA 4AOFA 5JHAA 3NS8A 1WM2A 1J0GA 3KH0A 4PYZA 3WAMA 2M4NA 4GGQA 3CSFA 3AI5A 4EOYA 1V49A 3ALBA 3IBEA 2IO2B 2KJ6A 3M62B 2O2VB 2NCNA 4FJZA 4ICVA 5JHBA 3MJWA 2BYEA 2MWSB 4MELA 1KJTA 4FULA 4KSKC 2KKCA 5DCNA 4BKSA 3C0RB 3AU4A 3OJ4B 3A9JB 2K6DB 2D07B 3BY4B 1LM8B 4PS7A 1UBIA 2KHWB 3W1SC 2IY0B 3QX1A 2Z0EB 2PPHA 4BKGA 4HJKA 2G45B 4FN2A 3VXWA 1LQBA 2KDFB 3EC8A 3VTVA 2IO0B 5AZHA 1A5RA 5LLIA 1WJUA 2HTHA 3WANA 1YX5B 1L2NA 4GMVA 2G4SA 1X1MA 2RR9A 4GDKB 4JGHB 3RZWC 3W1YA 4EZJA 1GJZA 1V5OA 4ANUA 1PQSA 2RSUA 2CHZA 4IC7B 3ZIMA 1VD2A 3RCZA 2VRRB 3AU5A 2KK8A 2D3GA 2MBOA 3KUDB 1TGZB 3L17A 1C1YB 1P9DU 2NBUA 3IG3A 3RZFA 1G6JA 1E7UA 1ZGUB 1SIFA 2M17A 2M0XA 4NPNA 4ANWA 4MJSA 1TTNA 1Z5SB 2REXA 3DPDA 4IUMB 4TQ0A 2BGFA 3APFA 4MSQB 2GOWA 5J18A 3ECIA 2AEHA 2G4DB 3IFWB 1WXAA 3I3TB 3VUYA 1P98A 5LXHA 3PSEB 1GUAB 3DOWA 3UIPB 2ZCBA 1OQYA 4II3B 1OEYJ 2IO1B 4GXBA 2RGFA 2LGYA 1WXSA 2PJHA 2XK5B 4BBNF 4W9HA 1FXTB 4E74A 4EEWA 4E3CA 2WYQA 4KV2A 1WH3A 3ZO5B 3SD5A 2KMAA 2WX1A 3QQ8B 1WIAA 2KOXA 3AXCA 3B08A 4KDIC 4IM0A 5AZFA 1WX7A 3L0WB 1WM3A 3SHQA 2O6VA 3A4SC 3PS6A 2KDIA 3WAPA 3PVLA 4ZRKA 2LJ5A 5EDSA 1XD3B 2JUOA 3O65B 4HVBA 3EHVA 1UGMA 3DQVA 2JXXA 4BKTA 4HCNB 1WRDB 1WX9A 3U30A 1UBQA 4W9LA 2MBEA 3ML9A 3R7RA 1YIWA 4DHZB 3S2AA 3VAWA 2MLBA 2KWUB 2K8BA 1LFDA 1WFYA 2DAFA 2LI5A 4MGKE 3V6CB 2ZVNA 3ZNHB 2AL3A 4URKA 3ENEA 3EFUA 3U7DA 2V4LA 3TL5A 4G11A 4P7IA 1EF1A 2LVPA 3N30A 3H7PB 5FR6A 4K7SA 5J2RA 1EF5A 2KQSA 1V5TA 1GC7A 4BKSD 4ICUA 4K7WA 3R3MA 1JRUA 2ZNVB 2MX2A 3QA8A 5C1ZA 2BKRB 2J0KA 2JPHA 4BOZB 3V60A 1GNUA 2D10A 2KFJA 3ML8A 1GC6A 3VTWA 4A3OA 2K25A 5AZGA 1WJ6A 2D11A 3VH3B 5AEKB 1IP9A 3OLMD 3H9DA 1IPGA 3W1SA 1RRBA 3QAQA 3VH4B 2B3AA 1WZ3A 4GDLA 3CMMB 5E6PA 3R7QA 1I35A 2DZJA 4MDKE 4IWPA 2KDEB 5LXIB 2KQ7A 4CHKA 3DBRI 2C5LC 4I6LB 4EKUA 2CHXA 2JVCA 2NBVB 2LVOA 2EMTA 1WMHB 2LRUA 4HDOA 4FBJB 1WF9A 1Z2MA 1ZW7A 2AYOB 4KSLC 4GN1A 3TCAA 3P2BA 4JQWC 2N1WA 3L54A 3T9LA 2I1KA 3JSVB 4MEMA 3EECA 3H7SA 2KD0A 2O2VA 4X57B 3QIJA 4JL9A 1WGHA 4GSWA 4AP4C 2L05A 2MA9B 2FCMA 2IBIB 2KLGA 3ONSA 1WGGA 3PZDA 4MGIE 4WJOA 1J8CA 4DHJD 2DZIA 3HIZA 4LDTD 4PS3A 1E8YA 2BWES 2O6VD 2M1MA 4KZCA 4NY0A 3TMPB 3VQIA 4GU2A 4RM9A 1R4NI 2MRPA 4LCDE 2L3ZA 4OVUA 4W9IA 1T0YA 3KVFB 5J17A 2BKFA 2GBKA 3NZSA 3IVFA 4I6NB 1E8ZA 4M0WB 3TJPA 3QHTA 4IW0A 1Q1OA 1ZKHA 1YQBA 2GBNA 3M95A 2W9NA 2J0JA 1S3SG 1V81A 2FIFA 2C9WB 5CHWA 4GDKA 3MTNB 4FA6A 4GOCA 1S1QB 1E5WA 1H8CA 1V6EA 4FHJA 2ZEQA 3HHMA 1NBFC 4CO7A 3A9KA 4ZYNA 2KANA 2HJ8A 5HKHA 2KTRB 1NI2A 5D7GA 3NZUA 3HM3A 2LXAA 4HWIB 2JF5A 1RLFA 1E8WA 3ZNGC 3QK0A 4XC2A 4PYUA 4BFRA 2ZVOA 4DDID 2KWVB 2R2OA 1E90A 5D6JB 4DK5A 5L83A 2IY1B 4ASWC 1XT9B 2IO3B 5JZEB 3K9OB 2KNBA 4MGYE 4FJYA 3ZRCA 1EUVB 5BO4B 2JZZA 4LJOB 5E6OA 4MM3A 3H1UA 2XK5A 4M8NA 4W9DA 1WY8A 3PTFC 3NHEB 1WGDA 3KUCB 2UYZB 2DYBA 3VVWB 2JRIB 1WXVA 2M8SA 3NOBA 1XQQA 2J7QB 2KFKB 4HLEA 3AULA 1YX6B 2CS4A 1WYWB 2LRWA 2ZPYA 2RD0A 4NQLB 3UQAA 3SDLC 1WZ0A 4LDTB 3ZRFA 4NNJB 1UD7A 2CHWA 2DYOA 3RT3B 2LZ6A 2ZPNA 1WX8A 2LXCA 3QJZA 4LJPB 2GBMA 2N9XA 3VHTC 2JZ3B 2NS5A 2Z0DB 4E71A 4DXAB 5L95C 4IM2A 2CR5A 4XX5A 2PE9A 3APCA 1UH6A 1WGRA 2BYFA 2R2QA 3QARA 3KYDD 4OVVA 2KN5A 1SGHA 2KC2A 3H7PA 2KZRA 3ZVVA 4DDGD 2J0MA 1L7YA 3KYCD 4A3PA 2DZKA 3L16A 2RPQA 4G3XB 5E6NA 4MGZE 1IYFA 2NPTA 1D3ZA 2IYDB 3A1QB 4TUUA 2L8JA 2DYMA 1UELA 3UIOB 3UINB 2KWCA 4WQOB 5G55A 4ZRIA 1E7VA 2QHOA 4AJWA 2MBQA 4HPLB 4J6IA 2NVUI 4AWJA 2UWQA 1C3TA 4IM3A 3DBSA 4CYEA 3JYUA 4K81A 2WWZA 5IA7A 5DPRA 2ZCCA 4FADA 2KX0A 4NJ6A 2V3SA 3V61A 3RD2A 3ZUNA 2N4FA 2GBJA 1LXDA 1OEYA 4JLCA 3WA0A 1GG3A 4II2B 5D94A 2KXJA 1P1AA 2HE7A 2L00B 2L76A 4MH0E 4NAWB 2PEAA 3QCAA 2MW5A 3ZKJC 4FJVB 3CF6E 3ZTDA 4W9GA 4KIKB 4HPMB 4GDLB 3PLUA 4TV3A 4WWOA 1WGYA 1V9JA 2MP2B 1WMHA 4G0NB 2JRHA 2ZNVC 2XEWA 2GMIC 4HXDA 3VDZA 4B95A 1RFAA 1H4RA 2K8HA 2FAZA 2FUHB 3VUXA 2PE6B 2LWPA 3DCGA 3PHWB 5DPTA 5G2NA 1M94A 1YD8U 4DBGA 3JSVA 2CKHB 1VCBA 2Z59B 3UF8A 3A9JA 2DX5B 2LD9A 2V1YA 3APDA 5CX3A 2BWFA 4K7UA 3QWZB 1TZ1A 3DDCB 5D2MB 2AWTA 2N7DA 3QC8B 3X23A 4HDQA 2C7HA 3M63B 3B0AA 4NQKE 3RYTA 4F7ZA 3ZW3A 4W9CA 3RULA 1V80A 1Q0WB 2C60A 4W9KA 4WWNA 4ZRJA 4B9KA 1V86A 2L0TA 3N32A 4RMAA 3M3JA 4W9EA 4NJ7A 2LASA 1EO6A 3DVNV 2KDBA 4EZKA 2IZVB 1CMXB 1V2YA 2NR2A 4M8MA 1UZXB 2FNJB 2N9EB 4I6PA 3SU8X 2D2QA 2EMSA 4K1RB 3ZDTA 3ZDMC 2OOBB 3L13A 4IWQA 2KTRA 2DHZA 2GBRA 3MHSD 3RUIB 3OJ3A 1WR6E 2KO3A 4AUQC 4BBNC 2N1VA 2DENB 3L10B 4TKNA 2JT4B 4EZLA 3A9KB 4MJSB 4WJQA 3Q3JA 4XZ4A 3UQBA 1BT0A 3KW5B 2A4ZA 3BINA 2LGDA 2Y5BB 2KJRA 3H6NA 2NBWB 1WE7A 4HCPB 5GMVA 3DBHI 3LJ3A 1WR1A 2LGXA 3TBLD 3ZNZB 3K9PB 3X0WA 3PRPB 4MSMB 3VUWA 2XBBC 4WAAA 4IG7B 5TR5A 2K39A 2KX3A 5DPSA 2LUEA 3VFKA 4BVUC 2DAJA 1MG8A 2YLMA 1AARA 2KLCA 4DHJB 2FCNA 1J19A 2KFKA 3PGEA 3WIMA 2O6VB 1P0RA 4KZ0A 5KHOA 4AJYB 2KTFA 2WX0A 4DWFA 3DVGY 1NDDA 4JIOU 3DVNU 5C23A 2BF8B 3V62A 1HE8A 2HD5B 3WALA 3PPAA 3NY5A 3PRZA 3D32A 2KMCA 3TIXA 2MBHA 3PRMB 3PLVA 5DPWA 4N9F4 1E8XA 1KOTA 1P3QU 1YJ1A 2A5UA 5KHQA 3PV1A 3KUZA 2KVRA 3OAWA 3A33B 2ASQA 1R4MI 5CHVC 4FLHA 3N3KB 1WE6A 1WXMA 1Y8RC 2MBBB 1WJ4A 1F9JA 2C7MB 2ZJDA 4KDLB 2N7EA 4B6WA 2KJHB 2N9PC 3CSTA 4W9JA 3GOEA 2OJRA 2K6QA 3A1QA 3HM6X 4TQ1A 5IAAC 3T8MA 2K1FA 1KLVA 2JWZA 4WWPA 4F1SA 3DBLI 2KC1A 4RM8A 4G50A 4KVGB 3UGBB 1RAXA 3U8ZA 2NPTB 1OGWA 1K8RB 5CTRC 4ANVA 3IHPC 2FCSA 3R66C 4EUTA 1WI0A 3ZTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L08 A;  1SE9 A;  2I1J A;  2FCQ A;  1I42 A;  2CU1 A;  2DZM A;  3PT2 B;  4PS8 A;  3WAO A;  3Q3F A;  4WJN A;  2WDT B;  3PRE A;  2YVC A;  3VTU A;  1Q5W B;  2LVQ A;  3HK0 A;  4EFO A;  1U4A A;  3PHX B;  5JH5 C;  4FHK A;  2EKE C;  2L7R A;  4A20 A;  1OTR B;  2K8C A;  3JW0 X;  1KM7 A;  3B1L X;  4F8C B;  1QZE A;  3A4R A;  4NAW A;  2FID A;  1TBE A;  4W9F A;  3GZN I;  1WJN A;  4BOS C;  5CHF A;  2MQJ A;  3DVG X;  4IWO A;  4KIK A;  4YL8 A;  3JVZ X;  4GIV A;  2MCN B;  3V6E B;  4ZDV A;  2C7N B;  2MP2 A;  2G3Q B;  2MSE D;  2AL6 A;  2BPS A;  3LDZ E;  2BYV E;  4ANX A;  3ZNI D;  4DHZ E;  2ZZP B;  4GB9 A;  4WJP A;  1ISN A;  2JY6 A;  2L0F A;  4HK2 A;  3ZLZ A;  4AOF A;  5JHA A;  3NS8 A;  1WM2 A;  1J0G A;  3KH0 A;  4PYZ A;  3WAM A;  2M4N A;  4GGQ A;  3CSF A;  3AI5 A;  4EOY A;  1V49 A;  3ALB A;  3IBE A;  2IO2 B;  2KJ6 A;  3M62 B;  2O2V B;  2NCN A;  4FJZ A;  4ICV A;  5JHB A;  3MJW A;  2BYE A;  2MWS B;  4MEL A;  1KJT A;  4FUL A;  4KSK C;  2KKC A;  5DCN A;  4BKS A;  3C0R B;  3AU4 A;  3OJ4 B;  3A9J B;  2K6D B;  2D07 B;  3BY4 B;  1LM8 B;  4PS7 A;  1UBI A;  2KHW B;  3W1S C;  2IY0 B;  3QX1 A;  2Z0E B;  2PPH A;  4BKG A;  4HJK A;  2G45 B;  4FN2 A;  3VXW A;  1LQB A;  2KDF B;  3EC8 A;  3VTV A;  2IO0 B;  5AZH A;  1A5R A;  5LLI A;  1WJU A;  2HTH A;  3WAN A;  1YX5 B;  1L2N A;  4GMV A;  2G4S A;  1X1M A;  2RR9 A;  4GDK B;  4JGH B;  3RZW C;  3W1Y A;  4EZJ A;  1GJZ A;  1V5O A;  4ANU A;  1PQS A;  2RSU A;  2CHZ A;  4IC7 B;  3ZIM A;  1VD2 A;  3RCZ A;  2VRR B;  3AU5 A;  2KK8 A;  2D3G A;  2MBO A;  3KUD B;  1TGZ B;  3L17 A;  1C1Y B;  1P9D U;  2NBU A;  3IG3 A;  3RZF A;  1G6J A;  1E7U A;  1ZGU B;  1SIF A;  2M17 A;  2M0X A;  4NPN A;  4ANW A;  4MJS A;  1TTN A;  1Z5S B;  2REX A;  3DPD A;  4IUM B;  4TQ0 A;  2BGF A;  3APF A;  4MSQ B;  2GOW A;  5J18 A;  3ECI A;  2AEH A;  2G4D B;  3IFW B;  1WXA A;  3I3T B;  3VUY A;  1P98 A;  5LXH A;  3PSE B;  1GUA B;  3DOW A;  3UIP B;  2ZCB A;  1OQY A;  4II3 B;  1OEY J;  2IO1 B;  4GXB A;  2RGF A;  2LGY A;  1WXS A;  2PJH A;  2XK5 B;  4BBN F;  4W9H A;  1FXT B;  4E74 A;  4EEW A;  4E3C A;  2WYQ A;  4KV2 A;  1WH3 A;  3ZO5 B;  3SD5 A;  2KMA A;  2WX1 A;  3QQ8 B;  1WIA A;  2KOX A;  3AXC A;  3B08 A;  4KDI C;  4IM0 A;  5AZF A;  1WX7 A;  3L0W B;  1WM3 A;  3SHQ A;  2O6V A;  3A4S C;  3PS6 A;  2KDI A;  3WAP A;  3PVL A;  4ZRK A;  2LJ5 A;  5EDS A;  1XD3 B;  2JUO A;  3O65 B;  4HVB A;  3EHV A;  1UGM A;  3DQV A;  2JXX A;  4BKT A;  4HCN B;  1WRD B;  1WX9 A;  3U30 A;  1UBQ A;  4W9L A;  2MBE A;  3ML9 A;  3R7R A;  1YIW A;  4DHZ B;  3S2A A;  3VAW A;  2MLB A;  2KWU B;  2K8B A;  1LFD A;  1WFY A;  2DAF A;  2LI5 A;  4MGK E;  3V6C B;  2ZVN A;  3ZNH B;  2AL3 A;  4URK A;  3ENE A;  3EFU A;  3U7D A;  2V4L A;  3TL5 A;  4G11 A;  4P7I A;  1EF1 A;  2LVP A;  3N30 A;  3H7P B;  5FR6 A;  4K7S A;  5J2R A;  1EF5 A;  2KQS A;  1V5T A;  1GC7 A;  4BKS D;  4ICU A;  4K7W A;  3R3M A;  1JRU A;  2ZNV B;  2MX2 A;  3QA8 A;  5C1Z A;  2BKR B;  2J0K A;  2JPH A;  4BOZ B;  3V60 A;  1GNU A;  2D10 A;  2KFJ A;  3ML8 A;  1GC6 A;  3VTW A;  4A3O A;  2K25 A;  5AZG A;  1WJ6 A;  2D11 A;  3VH3 B;  5AEK B;  1IP9 A;  3OLM D;  3H9D A;  1IPG A;  3W1S A;  1RRB A;  3QAQ A;  3VH4 B;  2B3A A;  1WZ3 A;  4GDL A;  3CMM B;  5E6P A;  3R7Q A;  1I35 A;  2DZJ A;  4MDK E;  4IWP A;  2KDE B;  5LXI B;  2KQ7 A;  4CHK A;  3DBR I;  2C5L C;  4I6L B;  4EKU A;  2CHX A;  2JVC A;  2NBV B;  2LVO A;  2EMT A;  1WMH B;  2LRU A;  4HDO A;  4FBJ B;  1WF9 A;  1Z2M A;  1ZW7 A;  2AYO B;  4KSL C;  4GN1 A;  3TCA A;  3P2B A;  4JQW C;  2N1W A;  3L54 A;  3T9L A;  2I1K A;  3JSV B;  4MEM A;  3EEC A;  3H7S A;  2KD0 A;  2O2V A;  4X57 B;  3QIJ A;  4JL9 A;  1WGH A;  4GSW A;  4AP4 C;  2L05 A;  2MA9 B;  2FCM A;  2IBI B;  2KLG A;  3ONS A;  1WGG A;  3PZD A;  4MGI E;  4WJO A;  1J8C A;  4DHJ D;  2DZI A;  3HIZ A;  4LDT D;  4PS3 A;  1E8Y A;  2BWE S;  2O6V D;  2M1M A;  4KZC A;  4NY0 A;  3TMP B;  3VQI A;  4GU2 A;  4RM9 A;  1R4N I;  2MRP A;  4LCD E;  2L3Z A;  4OVU A;  4W9I A;  1T0Y A;  3KVF B;  5J17 A;  2BKF A;  2GBK A;  3NZS A;  3IVF A;  4I6N B;  1E8Z A;  4M0W B;  3TJP A;  3QHT A;  4IW0 A;  1Q1O A;  1ZKH A;  1YQB A;  2GBN A;  3M95 A;  2W9N A;  2J0J A;  1S3S G;  1V81 A;  2FIF A;  2C9W B;  5CHW A;  4GDK A;  3MTN B;  4FA6 A;  4GOC A;  1S1Q B;  1E5W A;  1H8C A;  1V6E A;  4FHJ A;  2ZEQ A;  3HHM A;  1NBF C;  4CO7 A;  3A9K A;  4ZYN A;  2KAN A;  2HJ8 A;  5HKH A;  2KTR B;  1NI2 A;  5D7G A;  3NZU A;  3HM3 A;  2LXA A;  4HWI B;  2JF5 A;  1RLF A;  1E8W A;  3ZNG C;  3QK0 A;  4XC2 A;  4PYU A;  4BFR A;  2ZVO A;  4DDI D;  2KWV B;  2R2O A;  1E90 A;  5D6J B;  4DK5 A;  5L83 A;  2IY1 B;  4ASW C;  1XT9 B;  2IO3 B;  5JZE B;  3K9O B;  2KNB A;  4MGY E;  4FJY A;  3ZRC A;  1EUV B;  5BO4 B;  2JZZ A;  4LJO B;  5E6O A;  4MM3 A;  3H1U A;  2XK5 A;  4M8N A;  4W9D A;  1WY8 A;  3PTF C;  3NHE B;  1WGD A;  3KUC B;  2UYZ B;  2DYB A;  3VVW B;  2JRI B;  1WXV A;  2M8S A;  3NOB A;  1XQQ A;  2J7Q B;  2KFK B;  4HLE A;  3AUL A;  1YX6 B;  2CS4 A;  1WYW B;  2LRW A;  2ZPY A;  2RD0 A;  4NQL B;  3UQA A;  3SDL C;  1WZ0 A;  4LDT B;  3ZRF A;  4NNJ B;  1UD7 A;  2CHW A;  2DYO A;  3RT3 B;  2LZ6 A;  2ZPN A;  1WX8 A;  2LXC A;  3QJZ A;  4LJP B;  2GBM A;  2N9X A;  3VHT C;  2JZ3 B;  2NS5 A;  2Z0D B;  4E71 A;  4DXA B;  5L95 C;  4IM2 A;  2CR5 A;  4XX5 A;  2PE9 A;  3APC A;  1UH6 A;  1WGR A;  2BYF A;  2R2Q A;  3QAR A;  3KYD D;  4OVV A;  2KN5 A;  1SGH A;  2KC2 A;  3H7P A;  2KZR A;  3ZVV A;  4DDG D;  2J0M A;  1L7Y A;  3KYC D;  4A3P A;  2DZK A;  3L16 A;  2RPQ A;  4G3X B;  5E6N A;  4MGZ E;  1IYF A;  2NPT A;  1D3Z A;  2IYD B;  3A1Q B;  4TUU A;  2L8J A;  2DYM A;  1UEL A;  3UIO B;  3UIN B;  2KWC A;  4WQO B;  5G55 A;  4ZRI A;  1E7V A;  2QHO A;  4AJW A;  2MBQ A;  4HPL B;  4J6I A;  2NVU I;  4AWJ A;  2UWQ A;  1C3T A;  4IM3 A;  3DBS A;  4CYE A;  3JYU A;  4K81 A;  2WWZ A;  5IA7 A;  5DPR A;  2ZCC A;  4FAD A;  2KX0 A;  4NJ6 A;  2V3S A;  3V61 A;  3RD2 A;  3ZUN A;  2N4F A;  2GBJ A;  1LXD A;  1OEY A;  4JLC A;  3WA0 A;  1GG3 A;  4II2 B;  5D94 A;  2KXJ A;  1P1A A;  2HE7 A;  2L00 B;  2L76 A;  4MH0 E;  4NAW B;  2PEA A;  3QCA A;  2MW5 A;  3ZKJ C;  4FJV B;  3CF6 E;  3ZTD A;  4W9G A;  4KIK B;  4HPM B;  4GDL B;  3PLU A;  4TV3 A;  4WWO A;  1WGY A;  1V9J A;  2MP2 B;  1WMH A;  4G0N B;  2JRH A;  2ZNV C;  2XEW A;  2GMI C;  4HXD A;  3VDZ A;  4B95 A;  1RFA A;  1H4R A;  2K8H A;  2FAZ A;  2FUH B;  3VUX A;  2PE6 B;  2LWP A;  3DCG A;  3PHW B;  5DPT A;  5G2N A;  1M94 A;  1YD8 U;  4DBG A;  3JSV A;  2CKH B;  1VCB A;  2Z59 B;  3UF8 A;  3A9J A;  2DX5 B;  2LD9 A;  2V1Y A;  3APD A;  5CX3 A;  2BWF A;  4K7U A;  3QWZ B;  1TZ1 A;  3DDC B;  5D2M B;  2AWT A;  2N7D A;  3QC8 B;  3X23 A;  4HDQ A;  2C7H A;  3M63 B;  3B0A A;  4NQK E;  3RYT A;  4F7Z A;  3ZW3 A;  4W9C A;  3RUL A;  1V80 A;  1Q0W B;  2C60 A;  4W9K A;  4WWN A;  4ZRJ A;  4B9K A;  1V86 A;  2L0T A;  3N32 A;  4RMA A;  3M3J A;  4W9E A;  4NJ7 A;  2LAS A;  1EO6 A;  3DVN V;  2KDB A;  4EZK A;  2IZV B;  1CMX B;  1V2Y A;  2NR2 A;  4M8M A;  1UZX B;  2FNJ B;  2N9E B;  4I6P A;  3SU8 X;  2D2Q A;  2EMS A;  4K1R B;  3ZDT A;  3ZDM C;  2OOB B;  3L13 A;  4IWQ A;  2KTR A;  2DHZ A;  2GBR A;  3MHS D;  3RUI B;  3OJ3 A;  1WR6 E;  2KO3 A;  4AUQ C;  4BBN C;  2N1V A;  2DEN B;  3L10 B;  4TKN A;  2JT4 B;  4EZL A;  3A9K B;  4MJS B;  4WJQ A;  3Q3J A;  4XZ4 A;  3UQB A;  1BT0 A;  3KW5 B;  2A4Z A;  3BIN A;  2LGD A;  2Y5B B;  2KJR A;  3H6N A;  2NBW B;  1WE7 A;  4HCP B;  5GMV A;  3DBH I;  3LJ3 A;  1WR1 A;  2LGX A;  3TBL D;  3ZNZ B;  3K9P B;  3X0W A;  3PRP B;  4MSM B;  3VUW A;  2XBB C;  4WAA A;  4IG7 B;  5TR5 A;  2K39 A;  2KX3 A;  5DPS A;  2LUE A;  3VFK A;  4BVU C;  2DAJ A;  1MG8 A;  2YLM A;  1AAR A;  2KLC A;  4DHJ B;  2FCN A;  1J19 A;  2KFK A;  3PGE A;  3WIM A;  2O6V B;  1P0R A;  4KZ0 A;  5KHO A;  4AJY B;  2KTF A;  2WX0 A;  4DWF A;  3DVG Y;  1NDD A;  4JIO U;  3DVN U;  5C23 A;  2BF8 B;  3V62 A;  1HE8 A;  2HD5 B;  3WAL A;  3PPA A;  3NY5 A;  3PRZ A;  3D32 A;  2KMC A;  3TIX A;  2MBH A;  3PRM B;  3PLV A;  5DPW A;  4N9F 4;  1E8X A;  1KOT A;  1P3Q U;  1YJ1 A;  2A5U A;  5KHQ A;  3PV1 A;  3KUZ A;  2KVR A;  3OAW A;  3A33 B;  2ASQ A;  1R4M I;  5CHV C;  4FLH A;  3N3K B;  1WE6 A;  1WXM A;  1Y8R C;  2MBB B;  1WJ4 A;  1F9J A;  2C7M B;  2ZJD A;  4KDL B;  2N7E A;  4B6W A;  2KJH B;  2N9P C;  3CST A;  4W9J A;  3GOE A;  2OJR A;  2K6Q A;  3A1Q A;  3HM6 X;  4TQ1 A;  5IAA C;  3T8M A;  2K1F A;  1KLV A;  2JWZ A;  4WWP A;  4F1S A;  3DBL I;  2KC1 A;  4RM8 A;  4G50 A;  4KVG B;  3UGB B;  1RAX A;  3U8Z A;  2NPT B;  1OGW A;  1K8R B;  5CTR C;  4ANV A;  3IHP C;  2FCS A;  3R66 C;  4EUT A;  1WI0 A;  3ZTC A; 
#chains in the Genus database with same CATH topology
 1B9R A;  2FCQ A;  2CU1 A;  2J42 A;  3PT2 B;  3WAO A;  3W5V B;  1QQR A;  2WDT B;  3PRE A;  2YVC A;  4EFO A;  5L95 C;  4FHK A;  2L7R A;  5EE0 A;  3AEA B;  1V97 A;  2K9X A;  2JYE A;  4NAW A;  3C19 A;  1N5X A;  3GZN I;  3Q69 A;  1OFF A;  4BOS C;  3DVG X;  2MCN B;  2KAC A;  1D6E C;  5MPO A;  3ZNI D;  2MH7 A;  5FK9 C;  4DHZ E;  2ZZP B;  3MC0 B;  5JHA A;  2D3C A;  3TEZ A;  4GGQ A;  4ZOH C;  1EU3 A;  3AI5 A;  1NYR A;  2KJ6 A;  5HHD G;  5JHB A;  3MJW A;  2BYE A;  4KSK C;  4BKS A;  3AU4 A;  3BVG A;  2IY0 B;  1XXG A;  1AWD A;  2Z0E B;  1VRA B;  2HTM E;  3VTV A;  2IO0 B;  5AZH A;  1ZXI A;  2HTH A;  1FXA A;  2Z8L A;  2RR9 A;  3RZW C;  1V5O A;  4ANU A;  4XDD A;  2CHZ A;  2WHI A;  2VRR B;  4OVZ A;  1VJK A;  2IND C;  2D3G A;  3KUD B;  3RNE C;  3BVM A;  4OW0 A;  4CQN A;  2N9L A;  2BBC A;  4NPN A;  1TTN A;  2RDB C;  4AS1 A;  1K53 A;  1ET9 A;  1A70 A;  3IFW B;  3AE7 B;  4YXD B;  3I3T B;  5LXH A;  2Y5P A;  3DOW A;  3UIP B;  2ZCB A;  5FKA C;  2IO1 B;  1WXS A;  2XK5 B;  2WYQ A;  1WH3 A;  1KFY B;  2WX1 A;  3QQ8 B;  2KOX A;  3TEX A;  1WX7 A;  3L0W B;  2O6V A;  2KDI A;  3PVL A;  4ZRK A;  1JWU D;  2KDM A;  4HVB A;  3EHV A;  3DQV A;  1WRD B;  1PYW D;  2MBE A;  1F77 A;  1YIW A;  1FCC C;  3S2A A;  1F2R I;  1FNW A;  3P1M A;  1FD6 A;  2K8B A;  1YJJ A;  3W5U B;  4MGK E;  1WFY A;  2LI5 A;  3V6C B;  2ZVN A;  3ZNH B;  3V3X A;  3EFU A;  4G11 A;  2DLB A;  2D5G A;  2K0P A;  3H7P B;  3Q2A C;  2BVC A;  2KQS A;  2XN9 C;  1HTO A;  3GE8 C;  1V5T A;  3R3M A;  3GS2 A;  3MFG A;  1UNS A;  2MX2 A;  5C1Z A;  2LGI A;  2LGS A;  4BOZ B;  2JPH A;  3V60 A;  3ZJU A;  3N9Y C;  2G1E A;  1YMH E;  3BK1 A;  3OLM D;  3H9D A;  4NJC A;  5H8Y E;  1WZ3 A;  4GDL A;  2KYW A;  4C00 A;  1KLG D;  2I2Y A;  3SR6 A;  3AMZ A;  4IWP A;  5LXI B;  2LFI A;  4I6L B;  1E6E B;  1I7H A;  1WF9 A;  4KSL C;  3B9J A;  2QEJ C;  1QT9 A;  4JQW C;  2OHF A;  1EM7 A;  4MEM A;  3MC8 A;  4X57 B;  4A9A A;  2L05 A;  2MA9 B;  2FCM A;  3PZD A;  3Q8A A;  2TSS A;  2M1M A;  4KZC A;  2ONQ A;  3AED B;  2JXT A;  4LCD E;  2L3Z A;  3EGR A;  1TS5 A;  3I63 C;  4C56 C;  4I6N B;  4M0W B;  1EWC A;  3TJP A;  3QHT A;  1ZKH A;  2VZK D;  2W9N A;  5CHW A;  4GDK A;  3AH7 A;  1ZDV A;  1E5W A;  1H8C A;  1R7S A;  5D7G A;  3NZU A;  3HM3 A;  1E8W A;  4BFR A;  3QK0 A;  1D5M C;  4XC2 A;  4DDI D;  4A8X C;  3AB5 A;  4DK5 A;  2WXR A;  4FXC A;  4ASW C;  1XT9 B;  2IO3 B;  4MGY E;  4FJY A;  4ARI A;  1EUV B;  3HUI A;  1YOV B;  1HQR D;  2BB6 A;  3NHE B;  2M8S A;  1QOA A;  3NOB A;  2CU3 A;  3Q3O C;  1WYW B;  1ACC A;  2RD0 A;  3UQA A;  5IKC M;  1NEK B;  3ZRF A;  2SEB D;  2GBM A;  2NS5 A;  2Z0D B;  3R2T A;  1SSN A;  3QAR A;  1YN3 A;  2MJ3 A;  2FBW B;  1SGH A;  2KZR A;  3KLS X;  5BYQ A;  2QIL A;  1C76 A;  3KYC D;  1SF0 A;  2IYD B;  3OWE B;  2L8J A;  3C8Y A;  3UIN B;  5G55 A;  4HPL B;  2NVU I;  4AWJ A;  2UU7 A;  4P1C C;  4J3O D;  1I4G A;  1C77 A;  4L2Y A;  1RYJ A;  2AQ1 B;  5DPR A;  4NJ6 A;  2N4F A;  3IAS 1;  3H8H A;  1GG3 A;  1DYQ A;  4YWG G;  2PEA A;  3KQ4 A;  4FJV B;  4W9G A;  4GDL B;  1XLN A;  1PGX A;  3EUB 2;  3NS1 A;  2INP E;  2XEW A;  4B95 A;  2LWP A;  3DCG A;  5G2N A;  1YD8 U;  2CKH B;  4KGR A;  3N1Z C;  3A9J A;  1N62 A;  2PVO D;  3APD A;  5CX3 A;  2BWF A;  4S17 A;  4RH6 A;  5EE1 A;  4L1B A;  2PVG C;  1AN8 A;  1T0S C;  2BS4 B;  2AWT A;  3QC8 B;  3M63 B;  3B0A A;  3RUL A;  1V80 A;  5BMH A;  3AE6 B;  2L0T A;  3N32 A;  4RMA A;  3M3J A;  3FAH A;  3DVN V;  2DNF A;  2BQQ A;  1V2Y A;  3MP9 A;  3SU8 X;  3ZDT A;  2EMS A;  3ZDM C;  2MJE A;  4IWQ A;  2DHZ A;  1WR6 E;  4R3D A;  4LNI A;  4BBN C;  2N1V A;  4TKN A;  2JT4 B;  3UQB A;  4WJQ A;  4XZ4 A;  2IGH A;  1BT0 A;  2WXK A;  3BIN A;  2JQR B;  4P1B C;  3Q8B A;  1YN5 A;  5GMV A;  3J9C A;  3DBH I;  1F2R C;  3TBL D;  3ZNZ B;  3LXF A;  3PRP B;  4HRO A;  2D3A A;  2XBB C;  4WAA A;  2W82 A;  4IG7 B;  5TR5 A;  2IGD A;  4AQ7 A;  1AAR A;  2FCN A;  3PGE A;  1FXI A;  1P0R A;  4JE3 B;  2KTF A;  1NDD A;  2BF8 B;  1FFU A;  1V1P B;  1DOI A;  1KF6 B;  1KOT A;  1FIQ A;  1YJ1 A;  3KUZ A;  3A33 B;  1MHX A;  4FLH A;  1R4N B;  1WE6 A;  5G5G A;  1F9J A;  1FNV A;  3A1Q A;  4N6E B;  1I4Q A;  4DQO C;  3DBL I;  1D4B A;  4KVG B;  1RAX A;  1OGW A;  2W55 A;  1WI0 A;  1STE A;  1SE9 A;  2L83 A;  2INN E;  1I42 A;  3Q3F A;  1Q5W B;  2LVQ A;  4A20 A;  1OTR B;  1I4H A;  2K8C A;  1RFK A;  3P4Q B;  4KIK A;  5CHF A;  4YL8 A;  4JWS C;  1I4P A;  2BPS A;  3LDZ E;  2V3P A;  1L6U A;  2BYV E;  4XYC A;  1UUP A;  2WNM A;  3NS8 A;  2QDF A;  4RGO S;  3E9S A;  4EOY A;  1K51 A;  1UGJ A;  2IO2 B;  3M62 B;  2O2V B;  1PFD A;  4RF1 A;  1DGJ A;  2MWS B;  1GB1 A;  3B2F A;  1WWT A;  5DCN A;  3A9J B;  2WDR B;  1FO4 A;  2K6D B;  3BY4 B;  3AE4 B;  2QCZ A;  2PPH A;  4BKG A;  2G45 B;  3VXW A;  2R61 A;  3EC8 A;  2NTT A;  1QKZ A;  2N0S B;  2YEP F;  1QOB A;  2G4S A;  1X1M A;  3W1Y A;  4M02 A;  3N1X C;  3Q6B A;  1L6V A;  1BML C;  2KK8 A;  2MBO A;  3L17 A;  2NBU A;  3IG3 A;  4RGT A;  2M17 A;  1AYF A;  1ZXH A;  4MJS A;  1FFV A;  1Z5S B;  3DPD A;  2AEH A;  1YN4 A;  1YJI A;  1WXA A;  3O13 A;  4P6V F;  4TMA B;  4EEW A;  2PTL A;  4A55 A;  2ZW0 A;  4KV2 A;  3ZO5 B;  4KKI A;  1WIA A;  4LNK A;  1ROE A;  4D2K A;  5AZF A;  4IM0 A;  3SHQ A;  1V8C A;  2KMM A;  5HI1 A;  1ESF A;  3WAP A;  1HA5 A;  1XD3 B;  3O65 B;  4K3B A;  2JXX A;  1BUI C;  1E9M A;  1WX9 A;  4HCN B;  1L0Y B;  1OQR A;  1LFD A;  3BZD B;  2AL3 A;  2J52 A;  3U7D A;  3TL5 A;  4P7I A;  1EF1 A;  2LVP A;  3N30 A;  4WAF A;  4YTM B;  1EF5 A;  1JRU A;  2ZNV B;  3RNA C;  3P4R B;  1GNU A;  2D10 A;  2KFJ A;  3ML8 A;  3VTW A;  4A3O A;  5BMI A;  1WJ6 A;  2D11 A;  4HEA 1;  2NTS A;  1SJE D;  2EKI A;  3QAQ A;  1KTK A;  1F52 A;  3LYY A;  3R7Q A;  2DZJ A;  3P4S B;  2KDE B;  1NI3 A;  2KQ7 A;  4CHK A;  3DBR I;  2C5L C;  2CHX A;  1L5P A;  2EMT A;  1TS3 A;  1WMH B;  2LRU A;  4FBJ B;  1Z2M A;  2AYO B;  3NUH B;  2WQY B;  3BYY B;  1CZP A;  2FE8 A;  3RNC C;  3P2B A;  1GB4 A;  5IP4 D;  2LHD A;  3JSV B;  4RGN A;  2OED A;  3H7S A;  2VH1 A;  1DOX A;  4AP4 C;  1L0X B;  2KLG A;  4WJO A;  4MGI E;  2DZI A;  4LDT D;  3TMP B;  1CQV A;  2KN4 A;  1PGA A;  4W9I A;  4B0M A;  2BYT A;  1T0Y A;  3KVF B;  3Q3M C;  2BKF A;  2GBK A;  3NZS A;  1R4M B;  4IW0 A;  1SE2 A;  4WUR A;  2W3R A;  2GBN A;  2J0J A;  1V81 A;  2OJW A;  2X38 A;  4GOC A;  3ZXV A;  2WXO A;  2WLB A;  1DOY A;  2WDV B;  1J7C A;  4CO7 A;  3A9K A;  4YSX B;  2KAN A;  2HJ8 A;  2KTR B;  4GLS C;  2LXA A;  2JF5 A;  3ZNG C;  4PYU A;  2KWV B;  2R2O A;  4N58 A;  5D6J B;  5L83 A;  2IY1 B;  1SB3 C;  3K9O B;  3ZRC A;  4LNF A;  5BO4 B;  1WYG A;  5E6O A;  3H1U A;  1HTQ A;  3NVY A;  4M8N A;  4W9D A;  1WY8 A;  1JW9 D;  3GZN B;  1WGD A;  2DYB A;  2JRI B;  1WXQ A;  1XQQ A;  2AQ3 B;  2J7Q B;  2KFK B;  1YX6 B;  3DBR B;  1QF6 A;  4YSZ B;  1MG4 A;  3U7Z A;  1UD7 A;  1B1Z A;  2ZPN A;  2WXF A;  3FKY A;  4LJP B;  3LB8 C;  4DXA B;  2CR5 A;  2PE9 A;  1UH6 A;  3N20 C;  1JRP A;  4YTP B;  2CJN A;  2J0M A;  1L7Y A;  4A3P A;  3IT6 B;  3ZYY X;  2RPQ A;  4G3X B;  1IYF A;  2NPT A;  1WSP A;  2DYM A;  3UIO B;  2ON8 A;  3GP7 A;  1SXT A;  4AJW A;  4HJG E;  1C3T A;  3AE1 B;  1L0V B;  2WXJ A;  5IN7 A;  4K81 A;  2WWZ A;  1I4R A;  2KX0 A;  3AE2 B;  3MC9 A;  2V3S A;  1XLO A;  4Q2J A;  2WGS A;  1LXD A;  1OEY A;  4A6Q A;  1P1A A;  2L00 B;  4NAW B;  1PGB A;  3ZTD A;  1T0Q C;  4TV3 A;  1WGY A;  4G0N B;  2JRH A;  2ZNV C;  3AE3 B;  2GMI C;  3VDZ A;  4DXG A;  2PE6 B;  3TUO A;  3VR9 B;  4H2A A;  4HKQ A;  1VCB A;  5EE9 A;  2LD9 A;  2V1Y A;  4K7U A;  3QWZ B;  1TZ1 A;  3X23 A;  4HDQ A;  2C7H A;  4F7Z A;  4W9C A;  1Q0W B;  4ZRJ A;  3I5J C;  1V86 A;  3IXS A;  4NJ7 A;  2LAS A;  1EO6 A;  3RNF C;  2I38 A;  2NR2 A;  3BVZ A;  1JQ4 A;  4M00 A;  4K1R B;  1N60 A;  2OOB B;  1YQ3 B;  2GBR A;  3MHS D;  3OJ3 A;  2BTE A;  4XDC A;  4AUQ C;  4C4V A;  3W2D A;  1TYG B;  2DEN B;  3L10 B;  1OQQ A;  3A9K B;  3Q3J A;  3H6N A;  1NEN B;  2LGD A;  2MEK A;  5T8I A;  1WR1 A;  2LGX A;  1IUE A;  3X0W A;  2BB5 A;  4MH8 A;  1UF0 A;  1C9F A;  1NYQ A;  1FRD A;  2DAJ A;  1MG8 A;  2YLM A;  5AUI A;  1J19 A;  2LUM A;  2O6V B;  2B76 B;  4KZ0 A;  2LHE A;  4DWF A;  3DVG Y;  4XE0 A;  2KT7 A;  1SBB B;  2HD5 B;  1WRI A;  3PPA A;  2MHJ A;  4LNN A;  4C7Z A;  2RMM A;  2MBH A;  2SAK A;  3T3O A;  1TKE A;  1E8X A;  4N9F 4;  3RNB C;  4LK0 M;  4ZHO A;  4ITK A;  2ASQ A;  2H89 B;  1Y8R C;  4P16 A;  4L23 A;  4KDL B;  5IAA C;  1KLV A;  4KKJ A;  2KC1 A;  4REZ A;  1JAL A;  1FPY A;  1F0Z A;  3U8Z A;  2NPT B;  4ZYS A;  1D5X C;  2M0A A;  4PS8 A;  4JPS A;  3VTU A;  1KM7 A;  1QZE A;  5JXV A;  2LEK A;  4W9F A;  1WJN A;  2MQJ A;  4IWO A;  4GIV A;  3V6E B;  4ZDV A;  2C7N B;  2MP2 A;  2IPK D;  5GXG B;  3ZLZ A;  4GB9 A;  4WJP A;  2JY6 A;  4HK2 A;  4YTN B;  4HRS A;  4AOF A;  1SE4 A;  3TEY A;  3NZ3 A;  3ZJT A;  2D3B A;  1J0G A;  3KH0 A;  2M4N A;  2K22 A;  3CSF A;  3ALB A;  3IBE A;  4FJZ A;  4ICV A;  3P42 A;  4MEL A;  3PO0 A;  5E6J A;  3C0R B;  2PLP A;  3CIR B;  4XWT A;  1BXT A;  2D07 B;  1LM8 B;  1UBI A;  1N61 A;  4FN2 A;  1FMA D;  2KDF B;  1QLB B;  2QJL A;  4YSY B;  1VZ8 A;  1A5R A;  1D5Z C;  5LLI A;  1WJU A;  1YX5 B;  3Q8C A;  3V05 A;  2ZW1 A;  4EZJ A;  4GDK B;  4JGH B;  1GJZ A;  4USA A;  1PQS A;  1TT5 B;  1LO5 D;  3SFE B;  1TGZ B;  3EFC A;  2W3S A;  3RZF A;  1Y56 A;  1HXY D;  4TQ0 A;  2WXG A;  2BGF A;  2KQ4 X;  3APF A;  4MSQ B;  4NZL B;  4RNA A;  3VUY A;  1P98 A;  1GUA B;  4B0E A;  1F1H A;  4II3 B;  1MJD A;  1MI0 A;  1OEY J;  4C7Y A;  2LGY A;  4BBN F;  4NAM A;  1FXT B;  3MJ5 A;  4XWW A;  2RPV A;  3B08 A;  1J7B A;  1WM3 A;  3PS6 A;  2LJ5 A;  2JUO A;  2E6X A;  4IOI E;  4W9L A;  2ICI A;  3ML9 A;  3R7R A;  4DHZ B;  3FIL A;  3VAW A;  3Q8F A;  2MLB A;  4MAC A;  4URK A;  1XCT L;  3ENE A;  2V4L A;  5FR6 A;  1E7P B;  4K7S A;  5J2R A;  1GC7 A;  4BKS D;  3FC4 A;  4ICU A;  3AEF B;  3DWG C;  1IBX A;  3RN9 C;  2BKR B;  5LNK 1;  5IO9 A;  3DHH C;  3PZ8 A;  1V1O A;  5AEK B;  2WXI A;  1IPG A;  3W1S A;  1RRB A;  4ACF A;  3VH4 B;  1EWY C;  3VRB B;  2WXQ A;  5FR3 A;  2GB1 A;  1C79 A;  3R2I A;  4MDK E;  3DBH B;  2Q5W D;  5EE3 A;  1FM0 D;  4EKU A;  1JWS D;  1ZW7 A;  5C3J B;  4GN1 A;  3TCA A;  2N1W A;  3L54 A;  3T9L A;  3UI3 A;  3EEC A;  2KD0 A;  3QIJ A;  1WGH A;  4GSW A;  1WGG A;  3KWV A;  2V3N A;  4PS3 A;  2BWE S;  4JWU C;  4N59 A;  2O6V D;  2QSD A;  4GU2 A;  1ZUD 2;  4RM9 A;  1C4P A;  4OVU A;  5J17 A;  2L52 A;  2H88 B;  1E8Z A;  1YQ4 B;  1T5X D;  1Q1O A;  1S3S G;  5BMG A;  1P7F A;  3AE8 B;  3MTN B;  4FA6 A;  3DHG C;  4JX1 C;  2G9H D;  2ZEQ A;  3DBL B;  3NVV A;  1XEE A;  1NBF C;  1P7E A;  4ZYN A;  5HKH A;  1NI2 A;  2PIA A;  4KGS A;  1RLF A;  2ZVO A;  1EU4 A;  5BYS A;  4K3C A;  5JZE B;  2XK5 A;  3U2S C;  3VVW B;  2W54 A;  2CS4 A;  2LRW A;  2ZPY A;  4NQL B;  1WZ0 A;  4NNJ B;  2CHW A;  3RT3 B;  2LZ6 A;  1WX8 A;  3P63 A;  3BK2 A;  1JML A;  1L4Z B;  3Q14 C;  3VHT C;  2WXP A;  4E71 A;  4IM2 A;  1Q10 A;  3FIL B;  3KYD D;  2WU5 B;  2KC2 A;  3H7P A;  4OZC A;  4DDG D;  3RMK C;  3L16 A;  5E6N A;  3AM9 A;  3A1Q B;  2KWC A;  4ZRI A;  1GAQ B;  1E7V A;  2Y3A A;  4J6I A;  4EE2 A;  5BYR A;  4IM3 A;  1IBX B;  2KVZ A;  2J4X A;  3V61 A;  3RD2 A;  3ZUN A;  3Q3N C;  4JLC A;  3WA0 A;  3AE5 B;  4HPP A;  4II2 B;  2L1A A;  2HE7 A;  2L76 A;  5AUK A;  1QOG A;  2MW5 A;  4KIK B;  4HPM B;  1I4X A;  3RPF C;  4WWO A;  2V4I B;  2WXH A;  2K8H A;  2FUH B;  3AEG B;  4ZRP A;  2JSV X;  3PHW B;  3W9C B;  1FNU A;  3UF8 A;  2IDY A;  2J53 A;  3AEC B;  3BWU D;  4RF0 A;  1JWM D;  2ACZ B;  3DDC B;  3SEB A;  5D2M B;  3U52 E;  3URY A;  4NQK E;  4M0W A;  4W9K A;  2C60 A;  3AEB B;  4B9K A;  3NJT A;  2WU2 B;  1T6B X;  2WDQ B;  2HJ1 A;  2QC8 A;  2IZV B;  1RM6 C;  1UZX B;  4I6P A;  1IGC A;  2QMT A;  4KX6 B;  2KWD A;  2PKO A;  3RFZ B;  4EZL A;  4MJS B;  5H92 C;  2Y5B B;  2KJR A;  2NBW B;  2N9K A;  1GPX A;  1WE7 A;  3K9P B;  2K39 A;  2M19 A;  2JU6 X;  2LUE A;  4DHJ B;  5KHO A;  2WX0 A;  3DVN U;  1XLP A;  1RWS A;  5C23 A;  1HE8 A;  3WAL A;  1KRH A;  2EEL A;  3PRZ A;  3D32 A;  2KMC A;  3PLV A;  5DPW A;  2JYT A;  1P3Q U;  2A5U A;  5KHQ A;  4WH4 A;  2KVR A;  4OZA A;  2GLS A;  5CHV C;  1WXM A;  2MBB B;  2ZJD A;  2N7E A;  4LTU A;  4B6W A;  3IAM 1;  4W9J A;  3HM6 X;  3T8M A;  3IT4 B;  4WWP A;  4F1S A;  4RM8 A;  3N1Y C;  1VLB A;  1CK1 A;  5CTR C;  3R66 C;  2FCS A;  4EUT A;  3ZTC A;  1ENF A;  3E56 A;  3L08 A;  2IGG A;  4DXF A;  2I1J A;  2DZM A;  4WJN A;  3HK0 A;  5JH5 C;  1U4A A;  2K3U A;  3PHX B;  2EKE C;  1SE3 A;  3JW0 X;  1JWB D;  3B1L X;  4F8C B;  3A4R A;  2FID A;  1TBE A;  3ETR A;  2Y5C A;  3JVZ X;  1HEZ E;  1C4A A;  4UDU C;  2G3Q B;  2MSE D;  2E3T A;  2AL6 A;  1M4V A;  3NRZ A;  3SFD B;  2GI9 A;  4ANX A;  3PZ7 A;  2KAJ A;  1ISN A;  2L0F A;  1WM2 A;  4PYZ A;  3WAM A;  1V49 A;  3DWM A;  1QOF A;  2NCN A;  5IOI A;  3I9V 1;  1KJT A;  1E10 A;  4FUL A;  3DHI C;  2KKC A;  3BYT B;  3OJ4 B;  4S0R A;  4PS7 A;  3NVZ A;  2KHW B;  3W1S C;  3QX1 A;  3VR8 B;  2DBY A;  4HJK A;  1XF5 L;  1LQB A;  4XGA B;  3R8B A;  3WAN A;  1L2N A;  4GMV A;  4IKG A;  2RSU A;  4IC7 B;  3ZIM A;  1VD2 A;  3RCZ A;  2DWQ A;  1HZ6 A;  3AU5 A;  3ZGZ A;  1J7A A;  1C1Y B;  1P9D U;  1G6J A;  1E7U A;  1ZGU B;  1SIF A;  4ANW A;  2M0X A;  4IUM B;  2REX A;  1TJE A;  2GOW A;  1TS2 A;  5J18 A;  3ECI A;  2G4D B;  1UWX A;  3PSE B;  1OQY A;  3AE9 B;  4GXB A;  2RGF A;  3RI7 C;  2PJH A;  4E74 A;  1JRO A;  1SEB D;  4W9H A;  4E3C A;  3SD5 A;  1QIL A;  2WXL A;  5G5H A;  2KMA A;  4KDI C;  3KWL A;  3AXC A;  4PT5 A;  3A4S C;  1T0R C;  4LNO A;  5EDS A;  1UGM A;  4BKT A;  1V1P A;  3U30 A;  1UBQ A;  4HKZ E;  3P4P B;  2KWU B;  4RCO A;  2LJI A;  2DAF A;  5HFY A;  2QIE B;  3T3N A;  1CJE A;  1VZ6 A;  4YT0 B;  4US8 A;  2PW9 A;  3ZXR A;  1VZ7 A;  4K7W A;  3QA8 A;  3RNG C;  2J0K A;  1GC6 A;  2K25 A;  4ARC A;  5AZG A;  3VH3 B;  1IP9 A;  2IJ0 A;  2V0G A;  1LGR A;  2YEP B;  1C4C A;  2B3A A;  3CMM B;  5E6P A;  1I35 A;  2AX5 A;  2JVC A;  2NBV B;  2LVO A;  4HDO A;  1TKY A;  2I1K A;  1XLQ A;  5TSS A;  2O2V A;  4JL9 A;  4US9 A;  2IBI B;  3MHZ A;  3ONS A;  1J8C A;  4DHJ D;  3HIZ A;  1E8Y A;  3EA6 A;  4NY0 A;  3VQI A;  2WS3 B;  1R4N I;  1YNT E;  2MRP A;  3Q8E A;  3IVF A;  1ZOY B;  1SJH D;  1YQB A;  3M95 A;  3TEW A;  2XNA C;  2FIF A;  2C9W B;  2LMC A;  1S1Q B;  1UWM A;  1V6E A;  4FHJ A;  2BS2 B;  3HHM A;  3AEE B;  2INC C;  3ZQ4 A;  3AN1 A;  4HWI B;  1FRR A;  2M56 B;  4O1N A;  4C4V B;  1MFW A;  1ZDX A;  2WP9 B;  1E90 A;  1KLU D;  2KNB A;  1ET6 A;  1K50 A;  2JZZ A;  4LJO B;  4MM3 A;  5I4D A;  3PTF C;  4WWM A;  2BS3 B;  2K5P A;  1K52 A;  3NG0 A;  4TSS A;  3KUC B;  2UYZ B;  1WXV A;  1SIJ A;  4HLE A;  3AUL A;  3BII D;  4BAX A;  3SDL C;  4M01 A;  4LDT B;  1TIF A;  2DYO A;  1TY2 A;  2LXC A;  3QJZ A;  5D3I B;  2WXM A;  2N9X A;  2JZ3 B;  2N7J A;  4XX5 A;  4ZRQ A;  1JWA D;  1MVK A;  3APC A;  1WGR A;  2BYF A;  2R2Q A;  4OVV A;  2KN5 A;  1TS4 A;  3ZVV A;  1PUT A;  3I57 A;  2DZK A;  4MGZ E;  1D3Z A;  4TUU A;  1UEL A;  4WQO B;  4RGM A;  4QAY A;  2QHO A;  4RFB A;  2MBQ A;  1HZ5 A;  2UWQ A;  1JCK B;  1MHH E;  1E0Z A;  2VH2 A;  2WXN A;  4C80 A;  3ZJV A;  2MJD A;  1TY0 A;  3DBS A;  4CYE A;  3JYU A;  4LLG M;  5IA7 A;  2ZCC A;  4IDI A;  2V9H A;  4FAD A;  3TSS A;  1TZO A;  2GBJ A;  1VR9 A;  5D94 A;  2BW2 A;  2KXJ A;  4MH0 E;  3QCA A;  3ZKJ C;  3CF6 E;  1ZE3 D;  3PLU A;  1V9J A;  2MP2 B;  1WMH A;  2FUG 1;  3U4E G;  4HXD A;  1RFA A;  1H4R A;  2FAZ A;  3VUX A;  3OG5 A;  5DPT A;  1M94 A;  4DBG A;  3JSV A;  3GE3 C;  2Z59 B;  3VRA B;  3CWI A;  2DX5 B;  1AW7 A;  3ABV B;  2N7D A;  2L32 A;  3RYT A;  2JX5 A;  3ZW3 A;  4OHJ A;  4MT5 A;  4WWN A;  1TKG A;  2JWU A;  1N63 A;  4WIP A;  4W9E A;  2KDB A;  2NMQ A;  4EZK A;  3HVZ A;  1CMX B;  4M8M A;  2RDH A;  2FNJ B;  1XO3 A;  2N9E B;  2D2Q A;  3L13 A;  2GRI A;  2KTR A;  3WCQ A;  3RUI B;  2KO3 A;  4PK1 A;  1L4D B;  3HRD D;  5D3D A;  3KW5 B;  2A4Z A;  2X8X X;  1C78 A;  1KH0 A;  1T3Q A;  4HCP B;  3LJ3 A;  4OZB A;  3GB1 A;  4MSM B;  3VUW A;  1ZPS A;  2KX3 A;  5DPS A;  1ZP0 B;  3VFK A;  4BVU C;  4MM3 B;  2KLC A;  2KFK A;  3WIM A;  4BZA A;  1FCL A;  4AJY B;  4KGT A;  2HDE A;  4JIO U;  4ZHP A;  2CJO A;  4WQM A;  3V62 A;  2JZP A;  1GOZ A;  3NY5 A;  3TIX A;  3PRM B;  5C2T B;  1WGK A;  2VZK B;  3PV1 A;  3NVW A;  1FEH A;  5HG2 A;  3OAW A;  3AV8 A;  1R4M I;  3B2G A;  4A90 A;  3N3K B;  2RDG A;  1WJ4 A;  2C7M B;  1XCQ L;  1VDV A;  3L4P A;  2KJH B;  2N9P C;  3CST A;  3GOE A;  2OJR A;  2K6Q A;  4TQ1 A;  2AQ2 B;  1N5W A;  1PDX A;  2K1F A;  2JWZ A;  4G50 A;  3UGB B;  1MPE A;  1IGD A;  1N6Z A;  1K8R B;  3HVD A;  2BT6 A;  3IHP C;  4ANV A;  2PMV A;  1NVI D; 
#chains in the Genus database with same CATH homology
 3L08 A;  1SE9 A;  2I1J A;  2FCQ A;  1I42 A;  2CU1 A;  2DZM A;  3PT2 B;  4PS8 A;  3WAO A;  3Q3F A;  4WJN A;  2WDT B;  3PRE A;  2YVC A;  3VTU A;  1Q5W B;  2LVQ A;  3HK0 A;  4EFO A;  1U4A A;  3PHX B;  5JH5 C;  4FHK A;  2EKE C;  2L7R A;  4A20 A;  1OTR B;  2K8C A;  3JW0 X;  1KM7 A;  3B1L X;  4F8C B;  1QZE A;  3A4R A;  4NAW A;  2FID A;  1TBE A;  4W9F A;  3GZN I;  1WJN A;  4BOS C;  5CHF A;  2MQJ A;  3DVG X;  4IWO A;  4KIK A;  4YL8 A;  3JVZ X;  4GIV A;  2MCN B;  3V6E B;  4ZDV A;  2C7N B;  2MP2 A;  2G3Q B;  2MSE D;  2AL6 A;  2BPS A;  3LDZ E;  2BYV E;  4ANX A;  3ZNI D;  4DHZ E;  2ZZP B;  4GB9 A;  4WJP A;  1ISN A;  2JY6 A;  2L0F A;  4HK2 A;  3ZLZ A;  4AOF A;  5JHA A;  3NS8 A;  1WM2 A;  1J0G A;  3KH0 A;  4PYZ A;  3WAM A;  2M4N A;  4GGQ A;  3CSF A;  3AI5 A;  4EOY A;  1V49 A;  3ALB A;  3IBE A;  2IO2 B;  2KJ6 A;  3M62 B;  2O2V B;  2NCN A;  4FJZ A;  4ICV A;  5JHB A;  3MJW A;  2BYE A;  2MWS B;  4MEL A;  1KJT A;  4FUL A;  4KSK C;  2KKC A;  5DCN A;  4BKS A;  3C0R B;  3AU4 A;  3OJ4 B;  3A9J B;  2K6D B;  2D07 B;  3BY4 B;  1LM8 B;  4PS7 A;  1UBI A;  2KHW B;  3W1S C;  2IY0 B;  3QX1 A;  2Z0E B;  2PPH A;  4BKG A;  4HJK A;  2G45 B;  4FN2 A;  3VXW A;  1LQB A;  2KDF B;  3EC8 A;  3VTV A;  2IO0 B;  5AZH A;  1A5R A;  5LLI A;  1WJU A;  2HTH A;  3WAN A;  1YX5 B;  1L2N A;  4GMV A;  2G4S A;  1X1M A;  2RR9 A;  4GDK B;  4JGH B;  3RZW C;  3W1Y A;  4EZJ A;  1GJZ A;  1V5O A;  4ANU A;  1PQS A;  2RSU A;  2CHZ A;  4IC7 B;  3ZIM A;  1VD2 A;  3RCZ A;  2VRR B;  3AU5 A;  2KK8 A;  2D3G A;  2MBO A;  3KUD B;  1TGZ B;  3L17 A;  1C1Y B;  1P9D U;  2NBU A;  3IG3 A;  3RZF A;  1G6J A;  1E7U A;  1ZGU B;  1SIF A;  2M17 A;  2M0X A;  4NPN A;  4ANW A;  4MJS A;  1TTN A;  1Z5S B;  2REX A;  3DPD A;  4IUM B;  4TQ0 A;  2BGF A;  3APF A;  4MSQ B;  2GOW A;  5J18 A;  3ECI A;  2AEH A;  2G4D B;  3IFW B;  1WXA A;  3I3T B;  3VUY A;  1P98 A;  5LXH A;  3PSE B;  1GUA B;  3DOW A;  3UIP B;  2ZCB A;  1OQY A;  4II3 B;  1OEY J;  2IO1 B;  4GXB A;  2RGF A;  2LGY A;  1WXS A;  2PJH A;  2XK5 B;  4BBN F;  4W9H A;  1FXT B;  4E74 A;  4EEW A;  4E3C A;  2WYQ A;  4KV2 A;  1WH3 A;  3ZO5 B;  3SD5 A;  2KMA A;  2WX1 A;  3QQ8 B;  1WIA A;  2KOX A;  3AXC A;  3B08 A;  4KDI C;  4IM0 A;  5AZF A;  1WX7 A;  3L0W B;  1WM3 A;  3SHQ A;  2O6V A;  3A4S C;  3PS6 A;  2KDI A;  3WAP A;  3PVL A;  4ZRK A;  2LJ5 A;  5EDS A;  1XD3 B;  2JUO A;  3O65 B;  4HVB A;  3EHV A;  1UGM A;  3DQV A;  2JXX A;  4BKT A;  4HCN B;  1WRD B;  1WX9 A;  3U30 A;  1UBQ A;  4W9L A;  2MBE A;  3ML9 A;  3R7R A;  1YIW A;  4DHZ B;  3S2A A;  3VAW A;  2MLB A;  2KWU B;  2K8B A;  1LFD A;  1WFY A;  2DAF A;  2LI5 A;  4MGK E;  3V6C B;  2ZVN A;  3ZNH B;  2AL3 A;  4URK A;  3ENE A;  3EFU A;  3U7D A;  2V4L A;  3TL5 A;  4G11 A;  4P7I A;  1EF1 A;  2LVP A;  3N30 A;  3H7P B;  5FR6 A;  4K7S A;  5J2R A;  1EF5 A;  2KQS A;  1V5T A;  1GC7 A;  4BKS D;  4ICU A;  4K7W A;  3R3M A;  1JRU A;  2ZNV B;  2MX2 A;  3QA8 A;  5C1Z A;  2BKR B;  2J0K A;  2JPH A;  4BOZ B;  3V60 A;  1GNU A;  2D10 A;  2KFJ A;  3ML8 A;  1GC6 A;  3VTW A;  4A3O A;  2K25 A;  5AZG A;  1WJ6 A;  2D11 A;  3VH3 B;  5AEK B;  1IP9 A;  3OLM D;  3H9D A;  1IPG A;  3W1S A;  1RRB A;  3QAQ A;  3VH4 B;  2B3A A;  1WZ3 A;  4GDL A;  3CMM B;  5E6P A;  3R7Q A;  1I35 A;  2DZJ A;  4MDK E;  4IWP A;  2KDE B;  5LXI B;  2KQ7 A;  4CHK A;  3DBR I;  2C5L C;  4I6L B;  4EKU A;  2CHX A;  2JVC A;  2NBV B;  2LVO A;  2EMT A;  1WMH B;  2LRU A;  4HDO A;  4FBJ B;  1WF9 A;  1Z2M A;  1ZW7 A;  2AYO B;  4KSL C;  4GN1 A;  3TCA A;  3P2B A;  4JQW C;  2N1W A;  3L54 A;  3T9L A;  2I1K A;  3JSV B;  4MEM A;  3EEC A;  3H7S A;  2KD0 A;  2O2V A;  4X57 B;  3QIJ A;  4JL9 A;  1WGH A;  4GSW A;  4AP4 C;  2L05 A;  2MA9 B;  2FCM A;  2IBI B;  2KLG A;  3ONS A;  1WGG A;  3PZD A;  4MGI E;  4WJO A;  1J8C A;  4DHJ D;  2DZI A;  3HIZ A;  4LDT D;  4PS3 A;  1E8Y A;  2BWE S;  2O6V D;  2M1M A;  4KZC A;  4NY0 A;  3TMP B;  3VQI A;  4GU2 A;  4RM9 A;  1R4N I;  2MRP A;  4LCD E;  2L3Z A;  4OVU A;  4W9I A;  1T0Y A;  3KVF B;  5J17 A;  2BKF A;  2GBK A;  3NZS A;  3IVF A;  4I6N B;  1E8Z A;  4M0W B;  3TJP A;  3QHT A;  4IW0 A;  1Q1O A;  1ZKH A;  1YQB A;  2GBN A;  3M95 A;  2W9N A;  2J0J A;  1S3S G;  1V81 A;  2FIF A;  2C9W B;  5CHW A;  4GDK A;  3MTN B;  4FA6 A;  4GOC A;  1S1Q B;  1E5W A;  1H8C A;  1V6E A;  4FHJ A;  2ZEQ A;  3HHM A;  1NBF C;  4CO7 A;  3A9K A;  4ZYN A;  2KAN A;  2HJ8 A;  5HKH A;  2KTR B;  1NI2 A;  5D7G A;  3NZU A;  3HM3 A;  2LXA A;  4HWI B;  2JF5 A;  1RLF A;  1E8W A;  3ZNG C;  3QK0 A;  4XC2 A;  4PYU A;  4BFR A;  2ZVO A;  4DDI D;  2KWV B;  2R2O A;  1E90 A;  5D6J B;  4DK5 A;  5L83 A;  2IY1 B;  4ASW C;  1XT9 B;  2IO3 B;  5JZE B;  3K9O B;  2KNB A;  4MGY E;  4FJY A;  3ZRC A;  1EUV B;  5BO4 B;  2JZZ A;  4LJO B;  5E6O A;  4MM3 A;  3H1U A;  2XK5 A;  4M8N A;  4W9D A;  1WY8 A;  3PTF C;  3NHE B;  1WGD A;  3KUC B;  2UYZ B;  2DYB A;  3VVW B;  2JRI B;  1WXV A;  2M8S A;  3NOB A;  1XQQ A;  2J7Q B;  2KFK B;  4HLE A;  3AUL A;  1YX6 B;  2CS4 A;  1WYW B;  2LRW A;  2ZPY A;  2RD0 A;  4NQL B;  3UQA A;  3SDL C;  1WZ0 A;  4LDT B;  3ZRF A;  4NNJ B;  1UD7 A;  2CHW A;  2DYO A;  3RT3 B;  2LZ6 A;  2ZPN A;  1WX8 A;  2LXC A;  3QJZ A;  4LJP B;  2GBM A;  2N9X A;  3VHT C;  2JZ3 B;  2NS5 A;  2Z0D B;  4E71 A;  4DXA B;  5L95 C;  4IM2 A;  2CR5 A;  4XX5 A;  2PE9 A;  3APC A;  1UH6 A;  1WGR A;  2BYF A;  2R2Q A;  3QAR A;  3KYD D;  4OVV A;  2KN5 A;  1SGH A;  2KC2 A;  3H7P A;  2KZR A;  3ZVV A;  4DDG D;  2J0M A;  1L7Y A;  3KYC D;  4A3P A;  2DZK A;  3L16 A;  2RPQ A;  4G3X B;  5E6N A;  4MGZ E;  1IYF A;  2NPT A;  1D3Z A;  2IYD B;  3A1Q B;  4TUU A;  2L8J A;  2DYM A;  1UEL A;  3UIO B;  3UIN B;  2KWC A;  4WQO B;  5G55 A;  4ZRI A;  1E7V A;  2QHO A;  4AJW A;  2MBQ A;  4HPL B;  4J6I A;  2NVU I;  4AWJ A;  2UWQ A;  1C3T A;  4IM3 A;  3DBS A;  4CYE A;  3JYU A;  4K81 A;  2WWZ A;  5IA7 A;  5DPR A;  2ZCC A;  4FAD A;  2KX0 A;  4NJ6 A;  2V3S A;  3V61 A;  3RD2 A;  3ZUN A;  2N4F A;  2GBJ A;  1LXD A;  1OEY A;  4JLC A;  3WA0 A;  1GG3 A;  4II2 B;  5D94 A;  2KXJ A;  1P1A A;  2HE7 A;  2L00 B;  2L76 A;  4MH0 E;  4NAW B;  2PEA A;  3QCA A;  2MW5 A;  3ZKJ C;  4FJV B;  3CF6 E;  3ZTD A;  4W9G A;  4KIK B;  4HPM B;  4GDL B;  3PLU A;  4TV3 A;  4WWO A;  1WGY A;  1V9J A;  2MP2 B;  1WMH A;  4G0N B;  2JRH A;  2ZNV C;  2XEW A;  2GMI C;  4HXD A;  3VDZ A;  4B95 A;  1RFA A;  1H4R A;  2K8H A;  2FAZ A;  2FUH B;  3VUX A;  2PE6 B;  2LWP A;  3DCG A;  3PHW B;  5DPT A;  5G2N A;  1M94 A;  1YD8 U;  4DBG A;  3JSV A;  2CKH B;  1VCB A;  2Z59 B;  3UF8 A;  3A9J A;  2DX5 B;  2LD9 A;  2V1Y A;  3APD A;  5CX3 A;  2BWF A;  4K7U A;  3QWZ B;  1TZ1 A;  3DDC B;  5D2M B;  2AWT A;  2N7D A;  3QC8 B;  3X23 A;  4HDQ A;  2C7H A;  3M63 B;  3B0A A;  4NQK E;  3RYT A;  4F7Z A;  3ZW3 A;  4W9C A;  3RUL A;  1V80 A;  1Q0W B;  2C60 A;  4W9K A;  4WWN A;  4ZRJ A;  4B9K A;  1V86 A;  2L0T A;  3N32 A;  4RMA A;  3M3J A;  4W9E A;  4NJ7 A;  2LAS A;  1EO6 A;  3DVN V;  2KDB A;  4EZK A;  2IZV B;  1CMX B;  1V2Y A;  2NR2 A;  4M8M A;  1UZX B;  2FNJ B;  2N9E B;  4I6P A;  3SU8 X;  2D2Q A;  2EMS A;  4K1R B;  3ZDT A;  3ZDM C;  2OOB B;  3L13 A;  4IWQ A;  2KTR A;  2DHZ A;  2GBR A;  3MHS D;  3RUI B;  3OJ3 A;  1WR6 E;  2KO3 A;  4AUQ C;  4BBN C;  2N1V A;  2DEN B;  3L10 B;  4TKN A;  2JT4 B;  4EZL A;  3A9K B;  4MJS B;  4WJQ A;  3Q3J A;  4XZ4 A;  3UQB A;  1BT0 A;  3KW5 B;  2A4Z A;  3BIN A;  2LGD A;  2Y5B B;  2KJR A;  3H6N A;  2NBW B;  1WE7 A;  4HCP B;  5GMV A;  3DBH I;  3LJ3 A;  1WR1 A;  2LGX A;  3TBL D;  3ZNZ B;  3K9P B;  3X0W A;  3PRP B;  4MSM B;  3VUW A;  2XBB C;  4WAA A;  4IG7 B;  5TR5 A;  2K39 A;  2KX3 A;  5DPS A;  2LUE A;  3VFK A;  4BVU C;  2DAJ A;  1MG8 A;  2YLM A;  1AAR A;  2KLC A;  4DHJ B;  2FCN A;  1J19 A;  2KFK A;  3PGE A;  3WIM A;  2O6V B;  1P0R A;  4KZ0 A;  5KHO A;  4AJY B;  2KTF A;  2WX0 A;  4DWF A;  3DVG Y;  1NDD A;  4JIO U;  3DVN U;  5C23 A;  2BF8 B;  3V62 A;  1HE8 A;  2HD5 B;  3WAL A;  3PPA A;  3NY5 A;  3PRZ A;  3D32 A;  2KMC A;  3TIX A;  2MBH A;  3PRM B;  3PLV A;  5DPW A;  4N9F 4;  1E8X A;  1KOT A;  1P3Q U;  1YJ1 A;  2A5U A;  5KHQ A;  3PV1 A;  3KUZ A;  2KVR A;  3OAW A;  3A33 B;  2ASQ A;  1R4M I;  5CHV C;  4FLH A;  3N3K B;  1WE6 A;  1WXM A;  1Y8R C;  2MBB B;  1WJ4 A;  1F9J A;  2C7M B;  2ZJD A;  4KDL B;  2N7E A;  4B6W A;  2KJH B;  2N9P C;  3CST A;  4W9J A;  3GOE A;  2OJR A;  2K6Q A;  3A1Q A;  3HM6 X;  4TQ1 A;  5IAA C;  3T8M A;  2K1F A;  1KLV A;  2JWZ A;  4WWP A;  4F1S A;  3DBL I;  2KC1 A;  4RM8 A;  4G50 A;  4KVG B;  3UGB B;  1RAX A;  3U8Z A;  2NPT B;  1OGW A;  1K8R B;  5CTR C;  4ANV A;  3IHP C;  2FCS A;  3R66 C;  4EUT A;  1WI0 A;  3ZTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...