3WIMA

Gabarap-lir peptide complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GABARAP-LIR peptide complex
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Gamma-aminobutyric acid receptor-associated protein
total genus 34
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wimA00
1E7UA 4KIKA 4HPLB 4EFOA 2C7NB 2MBHA 1IP9A 5CX3A 4MJSA 4GOCA 5JH5C 3W1SC 2Z59B 3X23A 2KFKA 3VUYA 2MRPA 3JSVB 2BWES 2J0MA 3N3KB 4W9JA 2DAJA 4G0NB 2MBBB 1EO6A 3KYDD 2ZZPB 3GZNI 2M4NA 2K8CA 1V49A 1UELA 2K1FA 1WXAA 2M8SA 2ZJDA 4HCPB 2L0FA 2EKEC 3LDZE 2PE6B 3M3JA 2O2VB 2Y5BB 2LWPA 4K81A 4IC7B 2KK8A 4DHJB 2REXA 2BWFA 1I42A 3A9JA 2HD5B 4MGKE 2KLCA 4NPNA 5G2NA 4I6NB 4K1RB 2Z0EB 4BVUC 3VUXA 2NBVB 4B6WA 4ZRIA 2G4DB 3N30A 4HXDA 2LRUA 4KDIC 2D2QA 1WZ0A 2KLGA 3ZKJC 1Q5WB 1LFDA 2D11A 2BYVE 2JRIB 2XK5B 2KTFA 2Z0DB 2I1KA 3A1QA 4W9HA 2V4LA 3QX1A 2KDFB 4WWOA 3VXWA 2NS5A 1WGGA 4AUQC 1XD3B 4MM3A 4OVUA 4AJYB 4M0WB 1E90A 2LXCA 2FCQA 3QIJA 3ZDTA 2KC2A 3R66C 4BBNC 2R2OA 2UYZB 2J0JA 2JF5A 2RPQA 5HKHA 3A4SC 3RUIB 3AU4A 3TBLD 1V86A 5CHWA 4IWQA 2V3SA 1GC6A 3L0WB 4FLHA 3UINB 4NAWB 2KMAA 3H6NA 2N9XA 2BYEA 2D07B 4LJOB 4ANVA 1D3ZA 2FAZA 1NBFC 3D32A 2W9NA 3PLVA 1K8RB 2C7HA 3PRPB 4NQKE 3TL5A 3ZTCA 3GOEA 4BBNF 4II3B 3EC8A 3VVWB 1VD2A 2N1WA 4EEWA 1V81A 2YVCA 4W9GA 4MSQB 3DVNU 2KTRB 1SGHA 1EUVB 3QWZB 5KHOA 3CMMB 2KO3A 3BINA 2JPHA 3L13A 3PT2B 4W9EA 3PZDA 1WR6E 4HDQA 3APCA 5DCNA 2G3QB 1Q1OA 2AWTA 2GBMA 2WX0A 3A9JB 4MH0E 4KV2A 1G6JA 2MBQA 2KQSA 5D7GA 1VCBA 1WE7A 2M1MA 2LD9A 5IAAC 4FBJB 3NZSA 1LXDA 4OVVA 2KZRA 2M0XA 2KC1A 1BT0A 3K9PB 4W9IA 2ASQA 4CYEA 4WQOB 3DBRI 4GSWA 3A1QB 2MP2A 2N9EB 3PRMB 4FN2A 4LDTD 2FIDA 2L05A 4MJSB 2RGFA 2K39A 3VDZA 1WE6A 4EZJA 2J0KA 3QHTA 4WJPA 3R3MA 3QQ8B 4IWOA 2LVQA 3AXCA 4PYUA 5DPTA 4A3PA 1EF5A 5JHBA 4RM9A 1YIWA 2D3GA 2KOXA 2L76A 4XC2A 3SD5A 4AJWA 4MDKE 4EZKA 2N7DA 2C9WB 2EMSA 2IO2B 2KJ6A 4JGHB 2CHZA 4B95A 3Q3JA 3UQBA 2B3AA 2QHOA 2AL6A 3V61A 4W9DA 3A4RA 2R2QA 5IA7A 5JHAA 3APFA 4E71A 4HDOA 4W9FA 4HLEA 5FR6A 3Q3FA 2WWZA 4K7UA 3HM3A 4II2B 3UGBB 4LJPB 5G55A 2LGYA 2KQ7A 3ZUNA 3SHQA 3VUWA 1E8WA 3EFUA 1WI0A 2L0TA 4KVGB 1WXMA 2MX2A 3PGEA 2K8BA 5KHQA 4PS7A 3H1UA 3RT3B 1I35A 3QARA 3IVFA 4EKUA 4GMVA 1TGZB 1GC7A 2HE7A 2LGXA 2V1YA 3KYCD 1YD8U 1TBEA 1FXTB 3WALA 3EHVA 4NJ6A 3V6CB 2WDTB 2CU1A 4GDLA 1Q0WB 3HHMA 2KHWB 5LXHA 3AI5A 3L10B 1OGWA 3A9KB 2MSED 2BF8B 2IO0B 2N7EA 1WM2A 4FHKA 3RULA 1ZGUB 3ZRFA 4FULA 2YLMA 2DAFA 2KX3A 2AL3A 2ZNVC 4M8NA 3KUCB 3M63B 1V9JA 4HK2A 1P9DU 3I3TB 3H7PA 3OJ4B 4JQWC 1H8CA 3W1YA 1IPGA 2GMIC 2NBWB 3DDCB 5C1ZA 1LQBA 1R4NI 4JL9A 1UBQA 1YQBA 2ZVNA 3ONSA 4W9KA 4ASWC 4LCDE 2JT4B 2NCNA 2DZMA 3TMPB 4IWPA 3B0AA 2BYFA 2JZZA 2A5UA 2UWQA 2ZVOA 3ZIMA 1R4MI 2EMTA 2KDIA 2G4SA 1SIFA 1L7YA 4NAWA 4W9CA 3PHWB 1WX7A 4ZYNA 2KDEB 4ICVA 4WJQA 3VFKA 3IHPC 2AYOB 4I6LB 5JZEB 1WGDA 4IM3A 2K6QA 2IY0B 5TR5A 2FNJB 2BKRB 2PE9A 2DZIA 2ZCBA 3QAQA 2OOBB 1WJUA 3A9KA 2WYQA 5DPWA 1TZ1A 2C60A 3DBHI 2WX1A 3WA0A 4FJYA 1Z5SB 5AZFA 1WGRA 1QZEA 4EZLA 3U7DA 1RRBA 2JY6A 1KJTA 2M17A 1V2YA 2FCNA 1OTRB 2IZVB 3NZUA 5AEKB 2BGFA 2KJRA 1V5OA 4ANXA 2IO1B 3ZNGC 2O6VA 3SU8X 3HM6X 3U30A 3H9DA 4AP4C 1UH6A 3K9OB 1X1MA 2K8HA 2RR9A 3ENEA 4BKSA 1E8XA 3PRZA 5E6PA 3T8MA 3ZRCA 1NI2A 4E3CA 5CHVC 1XT9B 1WJ4A 2XEWA 3CF6E 1V6EA 3JVZX 1WJNA 2MP2B 1SE9A 2C5LC 2MBEA 3NS8A 1UD7A 1E8YA 1XQQA 4NQLB 3VH3B 1WF9A 3VTUA 2LGDA 3DVGY 3TCAA 1P0RA 4NNJB 3RCZA 1JRUA 3IFWB 4NJ7A 3PSEB 4IM2A 5AZHA 3U8ZA 2KKCA 4BFRA 3TIXA 2LVOA 3UF8A 3ZTDA 2JUOA 5D94A 1GG3A 1OEYJ 3QK0A 3ZLZA 4DHZB 3PVLA 4GU2A 4WWNA 3DCGA 1WH3A 4G3XB 2K25A 2DYBA 1WM3A 1AARA 1P98A 1WIAA 2DYOA 4GDLB 2GBRA 4W9LA 1J0GA 2JRHA 2JWZA 4ANUA 3PPAA 4IUMB 3ZO5B 4DDID 3H7SA 3DVNV 3HK0A 3CSTA 3PS6A 1UGMA 1J8CA 4WAAA 2DHZA 3BY4B 3PV1A 1GNUA 2ZEQA 3A33B 4MEMA 1C3TA 3OAWA 1ISNA 3CSFA 1KOTA 1EF1A 3V62A 1OEYA 1S1QB 2GBNA 2IY1B 1F9JA 3AULA 5CTRC 5D2MB 3NHEB 3EECA 3RZWC 2NR2A 2A4ZA 4JLCA 4A20A 4CHKA 4DDGD 3RD2A 3OLMD 2L00B 2GBKA 1RFAA 2LVPA 4G50A 4KDLB 4GB9A 2FIFA 4B9KA 4DHJD 1GJZA 3N32A 4IW0A 3WANA 5J18A 2NVUI 4DXAB 4K7SA 3LJ3A 3RZFA 4N9F4 1E7VA 3ZNID 3ZNHB 5DPSA 2GOWA 1CMXB 1WX9A 2JXXA 3KVFB 2BPSA 4IG7B 4MSMB 4G11A 1E8ZA 4A3OA 1WR1A 2AEHA 1ZKHA 1T0YA 3VHTC 4KSKC 4HPMB 1WJ6A 2ZPNA 2MCNB 1L2NA 2LRWA 2DX5B 2KD0A 4AOFA 3R7RA 2FCSA 1MG8A 2OJRA 4ANWA 1OQYA 2KWUB 4MGYE 1YX5B 2LZ6A 2DENB 1WXSA 4M8MA 2O2VA 2L3ZA 2HJ8A 4URKA 3NOBA 1WZ3A 2O6VB 2MW5A 3HIZA 2ZPYA 4RM8A 2MBOA 1P3QU 1WYWB 4F1SA 4BOSC 5LXIB 3KUZA 3ML8A 1NDDA 3ZDMC 4BKGA 2KVRA 3ZW3A 4MGZE 2MQJA 2DYMA 1PQSA 3AU5A 4KIKB 3KUDB 4BOZB 3VAWA 4HWIB 2MLBA 1WXVA 2L8JA 3OJ3A 3ALBA 2CKHB 1WGHA 5BO4B 4FHJA 3P2BA 5CHFA 4HCNB 1Y8RC 4J6IA 2IYDB 5L83A 3PLUA 1E5WA 4PS3A 3S2AA 4GIVA 4DK5A 2BKFA 1RAXA 4TQ0A 2KTRA 2L7RA 2KFJA 3RYTA 2JZ3B 1WRDB 1YJ1A 2ZNVB 3DBLI 4YL8A 4ZRKA 3T9LA 2JVCA 4WJNA 4TKNA 3L17A 4WJOA 4DWFA 3PHXB 1KLVA 2KN5A 1S3SG 3UIOB 1WGYA 2LASA 1Z2MA 1U4AA 3O65B 1WFYA 2GBJA 3APDA 3B08A 1H4RA 1TTNA 2IBIB 2CS4A 3WIMA 4KSLC 4MELA 4ZDVA 1P1AA 5E6NA 5J17A 2KFKB 2NPTA 3UIPB 3IG3A 4XX5A 2CHWA 4FJZA 4P7IA 4HVBA 4GN1A 4K7WA 3KW5B 1IYFA 2LI5A 3C0RB 3ML9A 2VRRB 3QA8A 2IO3B 3UQAA 1WY8A 3L54A 2NBUA 1WMHB 3MTNB 1C1YB 2KX0A 1UZXB 2LJ5A 4JIOU 4KZ0A 4FADA 3QC8B 4IM0A 1YX6B 4TQ1A 3DOWA 2LUEA 3JYUA 3ZNZB 1V5TA 3L08A 5AZGA 2DZJA 2PJHA 1ZW7A 3R7QA 3TJPA 4ZRJA 2DZKA 2FUHB 2RD0A 3VQIA 2FCMA 4F7ZA 2PPHA 1GUAB 1V80A 2RSUA 3QCAA 4GDKB 2C7MB 4GGQA 4CO7A 4XZ4A 3ZVVA 5J2RA 3IBEA 1HE8A 3V6EB 4X57B 4WWPA 3V60A 4TUUA 4EUTA 3B1LX 4GXBA 4PYZA 1UBIA 4TV3A 2KNBA 1M94A 2MA9B 3WAPA 1A5RA 2N9PC 3DVGX 4BKTA 5D6JB 4LDTB 4E74A 3DPDA 3JW0X 5E6OA 2CR5A 1LM8B 4PS8A 4AWJA 4FA6A 2KANA 3X0WA 1WMHA 5EDSA 3WAMA 3L16A 3SDLC 5DPRA 4EOYA 2HTHA 1KM7A 2N1VA 3DBSA 4I6PA 2K6DB 4NY0A 4RMAA 4GDKA 3M62B 3PTFC 2D10A 2I1JA 3PREA 4ICUA 2KWCA 2NPTB 3MJWA 2KJHB 1RLFA 3NY5A 2J7QB 5L95C 5LLIA 2MWSB 4KZCA 2KDBA 2LXAA 2G45B 4DHZE 3WAOA 2KMCA 3JSVA 3M95A 3QJZA 3DQVA 1WX8A 4DBGA 2ZCCA 3ECIA 2XBBC 2PEAA 3VH4B 1J19A 2N4FA 5C23A 4F8CB 2O6VD 2XK5A 3W1SA 5GMVA 3KH0A 3VTWA 4HJKA 2CHXA 4FJVB 2KXJA 3MHSD 4BKSD 3H7PB 4MGIE 3VTVA 2KWVB
chains in the Genus database with same CATH superfamily
4XE0A 4KIKA 4IOIE 4EFOA 1IP9A 4MJSA 4GOCA 3ZGZA 3VUYA 2BWES 2J0MA 2DAJA 1EO6A 2M4NA 3EUB2 1V49A 3T3OA 1UELA 1FFVA 3J9CA 3LDZE 2O2VB 2KK8A 1V1PB 1ET6A 2BWFA 3A9JA 4MGKE 4NPNA 4I6NB 4K1RB 4BVUC 3VUXA 2G4DB 1DOYA 1T6BX 1WZ0A 2D11A 2BYVE 3A1QA 2V3NA 2W55A 1MG4A 4HEA1 4WWOA 4OVUA 4AJYB 1I4XA 1E90A 4HPPA 3PO0A 4C7ZA 2OHFA 3RUIB 3TBLD 3AU4A 2RDHA 1WRIA 4NAWB 2N9XA 2BYEA 2D07B 1NBFC 3D32A 4B0MA 3GZNB 4NQKE 1KTKA 1YNTE 3Q14C 4KX6B 3SR6A 1TS3A 2K0PA 2KMMA 4MSQB 4L23A 1EUVB 2JU6X 5KHOA 1C77A 3CMMB 3PT2B 4HDQA 5DCNA 1AYFA 2GBMA 2WX0A 4MH0E 5D7GA 4OVVA 1LXDA 2M0XA 3K9PB 2D3CA 2N9EB 1K53A 4LDTD 1DYQA 3MC9A 5LNK1 2J0KA 3QHTA 1E7PB 3QQ8B 2LVQA 3SD5A 4AJWA 2N7DA 2IO2B 2EMSA 4ITKA 3DHIC 4B95A 1WSPA 2QHOA 2AL6A 1SXTA 5IA7A 3Q3FA 2EKIA 1MJDA 4II2B 5G55A 3LYYA 2WXIA 1E8WA 4KVGB 3PGEA 4PS7A 3QARA 4UDUC 1QF6A 4P1CC 1SJHD 2GRIA 3I63C 2WXGA 4GDLA 2KHWB 3Q3OC 2MSED 2N7EA 1WM2A 1PGAA 1TS5A 1T0QC 2ZNVC 3M63B 4YTNB 4HK2A 1P9DU 1NEKB 2INPE 4MT5A 1H8CA 2NBWB 1R4NI 2L1AA 3P4SB 4W9KA 1UBQA 1YQBA 4ASWC 4P6VF 1YMHE 4KGTA 3TMPB 3AE3B 2KDIA 1L7YA 1WX7A 2M19A 2KDEB 2QIEB 3VFKA 3IHPC 1WGDA 4IM3A 2K6QA 3W2DA 2BKRB 1D4BA 4QAYA 2DZIA 2OOBB 1WJUA 4H2AA 1TZ1A 4JE3B 2WX1A 2BQQA 3WA0A 5AZFA 1IUEA 1WGRA 1C4PA 1FRDA 3V05A 2M17A 1V2YA 1V5OA 2O6VA 3SU8X 3H9DA 2RMMA 2ZW1A 2K8HA 4RF0A 1YN4A 3SFDB 5E6PA 1WGKA 2QDFA 1XT9B 1WJ4A 1V6EA 1FXAA 2C5LC 2MBEA 1XCQL 4NQLB 1E8YA 3VH3B 1HZ5A 5D3DA 2LGDA 3TCAA 1P0RA 4NNJB 1M4VA 3IFWB 3RCZA 4IM2A 4C4VB 2D3AA 4BFRA 2PKOA 2LVOA 1OEYJ 1XLQA 1BXTA 4LK0M 1T5XD 2HJ1A 3DCGA 4NZLB 2KQ4X 1D5XC 1ET9A 1ZE3D 4W9LA 4ANUA 3Q69A 3ZO5B 3H7SA 3DVNV 3CIRB 4WURA 2MHJA 3BY4B 3PV1A 1GNUA 3Q8AA 2QC8A 2PIAA 2ICIA 3RZWC 2NR2A 2L00B 2WNMA 2KAJA 4G50A 3RNBC 4B9KA 4IW0A 3WANA 1AN8A 4OHJA 1E7VA 2GOWA 4IG7B 2BPSA 4YWGG 4G11A 2QEJC 3RPFC 1L4ZB 3VHTC 1ZKHA 1F0ZA 2KWDA 4KSKC 1WJ6A 1L2NA 3NZ3A 4MH8A 2LRWA 3ZXVA 1FRRA 2KD0A 1VZ6A 3WCQA 1GPXA 5G5GA 1VJKA 4MGYE 2OEDA 2WXQA 1KF6B 4TSSA 4ARCA 4RM8A 2H89B 4F1SA 4BOSC 1NDDA 2HTME 4BKGA 2OJWA 2DYMA 3AU5A 4KIKB 3KUDB 1EU3A 4BOZB 3VRBB 4HWIB 1WXVA 2CKHB 1WGHA 5BO4B 3BVZA 3W5UB 4HROA 5CHFA 4A55A 3S2AA 4GIVA 3DHHC 4YT0B 2RDBC 1TIFA 4ZRKA 3L17A 1XLNA 2MH7A 2LASA 1HTOA 1Z2MA 4IDIA 3VRAB 5IO9A 2LEKA 1FXIA 1V8CA 2CS4A 3U7ZA 2JYTA 2NPTA 4HJGE 3UIPB 4RCOA 4XX5A 2CHWA 4P7IA 1C79A 2KVZA 4ZRPA 1R4NB 2VRRB 3QA8A 1YQ3B 2NBUA 3MTNB 4JIOU 3QC8B 4IM0A 3JYUA 3L08A 5BMIA 2PJHA 4ZRJA 2LUMA 4GGQA 4CO7A 4RH6A 1HE8A 1VRAB 5EE1A 1GB1A 2X38A 3B1LX 4PYZA 3DWMA 1M94A 2MA9B 3FC4A 3U4EG 1OFFA 5D6JB 4E74A 1TKGA 4HKZE 1UWMA 4PS8A 2WGSA 2BVCA 1WMHA 2WXFA 3AEEB 1TJEA 2IPKD 3PTFC 1HA5A 5BYRA 3L4PA 3NY5A 1RWSA 3N1YC 1WWTA 4LNNA 5BYSA 3RNGC 3UI3A 2LXAA 3GS2A 2KMCA 4K3CA 4RFBA 1WX8A 1IBXB 1J19A 3U52E 4LNOA 1JWBD 3KH0A 2WXPA 3MC8A 3MHSD 3DBLB 3VTVA 1E7UA 2MBHA 4P1BC 5JH5C 2Z59B 3X23A 3RMKC 2MRPA 3JSVB 4US8A 2RDGA 4W9JA 4G0NB 3KYDD 2ZZPB 1QOFA 1KFYB 2K8CA 1WXAA 2DBYA 1NENB 2ZJDA 4R3DA 2L0FA 2PE6B 4DHJB 4K81A 4IC7B 4M00A 3MC0B 5G2NA 1VLBA 4ZRIA 2KLGA 2JRIB 1JCKB 5AUIA 5JXVA 4XYCA 2KDFB 1WGGA 4AUQC 1ZUD2 1MFWA 4MM3A 3T3NA 4LLGM 3AEGB 3HVZA 2KC2A 2UYZB 1C76A 2JF5A 1AW7A 2BS3B 2JWUA 2RPQA 3A4SC 3NJTA 5CHWA 5HI1A 1GC6A 4FLHA 3UINB 4S0RA 4LJOB 2W9NA 3P63A 3PRPB 3NRZA 2INCC 3FILA 3GOEA 3EC8A 1VD2A 1V81A 4W9GA 1FNUA 2DNFA 3RI7C 2KTRB 2PW9A 3TSSA 3P42A 3QWZB 3BINA 1L6VA 5GXGB 2G3QB 2BYTA 2AWTA 4A90A 2KZRA 2KC1A 4W9IA 3DBRI 2L05A 2Q5WD 2RGFA 2K39A 2W3SA 3VDZA 4EZJA 3BK1A 2MEKA 3R3MA 2PTLA 1EF5A 2K9XA 2L76A 2C9WB 1RYJA 3UQBA 5EE9A 4OZCA 3V61A 4XDDA 1HTQA 2R2QA 1C9FA 4E71A 4HLEA 5FR6A 1L0XB 1EWCA 4LJPB 1J7BA 2LGYA 1EWYC 3VUWA 3Q3NC 1PFDA 5FK9C 2L0TA 1QILA 3SFEB 2K8BA 4C00A 3H1UA 1TZOA 1I35A 1SIJA 2HE7A 2LGXA 4XWTA 2WDRB 1YD8U 4NJ6A 3V6CB 4JX1C 1P7EA 5LXHA 3AI5A 3ZRFA 1UF0A 2KT7A 2KX3A 3BYYB 1WYGA 3KUCB 1V9JA 3I3TB 1FFUA 3W1YA 2H88B 1LQBA 2BS2B 2WP9B 2ZVNA 1UGJA 3E9SA 4IWPA 3ETRA 2JZZA 4HRSA 2A5UA 3RNEC 2EMTA 4W9CA 3PHWB 4DQOC 1MHXA 4WQMA 2X8XX 1YOVB 1RM6C 5DPWA 2C60A 1JWMD 1Z5SB 1QZEA 1UWXA 1KJTA 2FCNA 2IZVB 1KRHA 3NZUA 5AEKB 2BGFA 2KJRA 5EE3A 1DGJA 1HZ6A 4XGAB 1NI2A 2NTTA 3BZDB 5CHVC 3CF6E 1GB4A 1WJNA 1SE9A 3NS8A 1UD7A 1XQQA 4US9A 2JYEA 4A9AA 4A6QA 1JRUA 5AZHA 2VZKD 1SJED 3ZTDA 1STEA 3QK0A 4DHZB 3ZJUA 1SF0A 2GB1A 4GU2A 1NYRA 3VR8B 2D3BA 1WH3A 2DYBA 1WIAA 1YQ4B 2GBRA 1J0GA 4IUMB 1N5WA 2N7JA 4Q2JA 1ACCA 3PS6A 1UGMA 1J8CA 2UU7A 2ZEQA 1ZP0B 1FPYA 3OAWA 2ON8A 1L0YB 1OEYA 4LTUA 1S1QB 4ARIA 3AULA 2BBCA 3EECA 3AEDB 2A4ZA 4DDGD 3RD2A 2FE8A 2WDVB 2FIFA 3N32A 3AM9A 2NVUI 3AN1A 4K7SA 4N9F4 3ZNID 5DPSA 2FUG1 1CMXB 1WX9A 3NUHB 4MSMB 2LFIA 4A3OA 2Y5CA 1WR1A 1TKEA 1CK1A 2ZPNA 3I9V1 3FKYA 2YEPF 2DX5B 4AOFA 5I4DA 2AQ3B 2YEPB 3R7RA 1E10A 1OQYA 2D5GA 3ZQ4A 4M8MA 3R2IA 3O13A 3NOBA 2ZPYA 3E56A 3IT4B 3NG0A 3KUZA 3ML8A 2XNAC 3ZDMC 3AE2B 1FNWA 2MQJA 2JQRB 2L8JA 2WXJA 1CQVA 3EA6A 1Y8RC 2IGHA 1ROEA 1V1OA 4TQ0A 2L7RA 1OQQA 3RYTA 3T9LA 1WRDB 4YL8A 4WJOA 4DWFA 1VZ8A 3PHXB 3RFZB 3O65B 1WFYA 3N1XC 4ZRQA 4EE2A 1TTNA 4KSLC 4MELA 1HQRD 3IG3A 4WIPA 1MVKA 4GN1A 5H8YE 3KW5B 3ML9A 2IO3B 1B9RA 1WMHB 2KX0A 2LJ5A 1YX6B 4TQ1A 3DOWA 1R7SA 2EELA 2NTSA 1UNSA 2WHIA 2J4XA 2FUHB 3IXSA 2CJOA 2PPHA 3NVWA 3QCAA 4X57B 3SEBA 2QJLA 4EUTA 4TV3A 4YTPB 2KNBA 3WAPA 3DVGX 4BKTA 5E6OA 3KLSX 1ZDXA 3X0WA 5EDSA 2BT6A 3L16A 3N20C 2HTHA 4EOYA 3TEXA 3DBSA 2K6DB 4GDKA 1NYQA 3M62B 1MPEA 4KGSA 2I1JA 2G9HD 4ICUA 2ACZB 3W9CB 2BB5A 2ONQA 1XLOA 4DHZE 4MACA 2ZCCA 2XBBC 4KKJA 2N4FA 2CU3A 2LHEA 2KDMA 1V97A 5BMHA 5HG2A 3P1MA 4HJKA 1TS4A 4FJVB 4MM3B 4ZYSA 3AE5B 3RNCC 3URYA 3W1SC 3NVVA 1Q10A 1BMLC 3FAHA 4HCPB 1E0ZA 2EKEC 2LWPA 1TS2A 3TUOA 2Z0EB 2NBVB 4B6WA 4LNIA 3N30A 3HRDD 1LFDA 1F52A 1IGCA 4OZAA 2V4LA 3VXWA 2NS5A 1NVID 1XD3B 3BIID 2QILA 2LXCA 1J7CA 3ZDTA 2R2OA 5HKHA 1GAQB 3GE8C 1V86A 1ESFA 3L0WB 2KMAA 4USAA 1D6EC 3PLVA 2C7HA 3ZTCA 3TL5A 3BYTB 4II3B 4EEWA 1QT9A 4OZBA 1E6EB 2HDEA 2PLPA 2JPHA 3L13A 4AS1A 3ZYYX 3PZDA 3AEBB 1XXGA 3APCA 1Q1OA 3A9JB 5MPOA 1FM0D 2WXHA 2KQSA 1VCBA 2LD9A 5IAAC 4FBJB 1BT0A 3I5JC 1MI0A 2V3PA 4WQOB 4JPSA 1SE3A 3A1QB 4GSWA 3W5VB 1ZOYB 4O1NA 4WJPA 4IWOA 4PYUA 4RM9A 4PK1A 1ENFA 3AE9B 4MDKE 4EZKA 2CHZA 3Q3JA 2B3AA 3TEZA 3APFA 2IGGA 1JW9D 4HDOA 4W9FA 2WWZA 2V9HA 3HM3A 2VH2A 2KQ7A 3ZUNA 3SHQA 1XO3A 3EFUA 1WXMA 5KHQA 3RT3B 3IVFA 1TGZB 1GC7A 2V1YA 3KYCD 1TBEA 3WALA 3EHVA 1I7HA 2AQ1B 2WU2B 3AEAB 4CQNA 1Q0WB 3HHMA 3DBHB 4KGRA 1OGWA 4JWUC 2BF8B 2GLSA 4FHKA 4FULA 2AL3A 1FMAD 2BS4B 4JQWC 1IPGA 3TEWA 3DDCB 1JRPA 3NS1A 4JL9A 1FNVA 1L4DB 4C4VA 3KWLA 4A8XC 3LXFA 2ZVOA 2I2YA 5TSSA 2ZW0A 1R4MI 1SIFA 4ZYNA 4ICVA 4WJQA 2AYOB 5JZEB 2IY0B 5TR5A 2FNJB 5IKCM 1KH0A 3QAQA 5EE0A 3A9KA 2WYQA 3BVGA 2VZKB 4DXGA 4EZLA 1RRBA 2JY6A 1V1PA 3CWIA 3PZ8A 4YSZB 3HM6X 3U30A 3ZXRA 4AP4C 1UH6A 3K9OB 3ENEA 1E8XA 3PRZA 2MP2B 1N6ZA 4RGMA 1PGBA 5HFYA 3VTUA 3DVGY 3AEFB 1L5PA 1FCLA 1JWAD 1L0VB 3UF8A 2N9LA 2JUOA 2E3TA 3ZLZA 3PVLA 1CJEA 4WWNA 4G3XB 1WM3A 4YSXB 1VR9A 1AARA 1T0RC 2DYOA 1JWUD 1ZPSA 3IAM1 1K51A 2JRHA 2JWZA 4ZOHC 3PPAA 4DDID 3OG5A 3CSTA 3RN9C 4S17A 4WAAA 2B76B 2DHZA 4MEMA 3CSFA 1EF1A 3V62A 1OQRA 4JWSC 3AE6B 1N60A 2IY1B 5CTRC 4A20A 4HKQA 2GBKA 1RFAA 3LB8C 2DLBA 4DHJD 2NMQA 3ABVB 1K52A 3Q2AC 5J18A 4DXAB 3LJ3A 1CZPA 3Q3MC 3ZNHB 4REZA 4IKGA 5IP4D 3KVFB 2SEBD 5FKAC 3KQ4A 3DHGC 1T0YA 2WU5B 2QSDA 2K5PA 4HPMB 2MCNB 3AE8B 4RGOS 3AB5A 1MG8A 2WQYB 3MFGA 1WXSA 2JXTA 2HJ8A 1SSNA 1WZ3A 1PYWD 3HIZA 1P3QU 3B2GA 2PMVA 1A70A 2KVRA 3ZW3A 4MGZE 1PGXA 1PQSA 4KKIA 1TT5B 4PT5A 2MLBA 2VH1A 1SE2A 2IDYA 3ALBA 4M0WA 3P2BA 4HCNB 2WLBA 1E5WA 1JROA 1RAXA 3Q8EA 2KTRA 5H92C 4N58A 2JZ3B 2WS3B 1YJ1A 3DBLI 3Q8FA 5FR3A 4WJNA 1Y56A 3N1ZC 1PUTA 1SBBB 1XEEA 4OVZA 3AMZA 1WGYA 1BUIC 1TYGB 3B08A 4LNKA 1H4RA 1ZXIA 4ZDVA 1EU4A 1P1AA 2V4IB 5E6NA 3Q8CA 2E6XA 5E6JA 1IYFA 1XCTL 1KLUD 1UZXB 4FADA 2JX5A 4ZHOA 2LUEA 3AH7A 1V5TA 1L6UA 3BVMA 2DZJA 2W82A 1ZW7A 3TJPA 3VQIA 1VDVA 4F7ZA 2LHDA 1GUAB 1V80A 1QOBA 2RSUA 2C7MB 5J2RA 3ZVVA 3V6EB 3V60A 1D5MC 1YJIA 2QCZA 1ZXHA 3OWEB 3NVYA 1A5RA 1I4GA 3DPDA 4BAXA 1SB3C 2Z8LA 3IT6B 3SDLC 4I6PA 1YN3A 2N1VA 1VZ7A 4N59A 2LGSA 2D10A 1F77A 3PREA 1LGRA 2WXMA 2NPTB 2J7QB 5L95C 5LLIA 1I4HA 2G45B 4RNAA 3GB1A 3WAOA 5D3IB 3GE3C 3JSVA 1TY2A 3DQVA 4DBGA 1F2RI 1FO4A 2M0AA 1I4PA 2PEAA 2G1EA 2QMTA 4F8CB 4ZHPA 3W1SA 2CHXA 2KXJA 4BKSD 3H7PB 4MGIE 2K3UA 4HPLB 2C7NB 2N9KA 5CX3A 2LGIA 4L2YA 2KFKA 1I4RA 2J53A 3N3KB 2PVGC 2MBBB 3GZNI 2SAKA 2K1FA 2M8SA 2XN9C 1HEZE 3M3JA 4RF1A 2R61A 2AQ2B 2CJNA 2Y5BB 4DXFA 2REXA 1I42A 2HD5B 2KLCA 4C80A 2W54A 1B1ZA 4KDIC 4HXDA 2LRUA 1SE4A 2D2QA 3ZKJC 1Q5WB 4W9HA 3RULA 2XK5B 2KTFA 2Z0DB 2I1KA 3QX1A 4L1BA 4M0WB 2V0GA 5C3JB 1SEBD 1P7FA 3QIJA 2FCQA 3R66C 4BBNC 2J0JA 1RFKA 1DOIA 2LMCA 2V3SA 4IWQA 3H6NA 3EFCA 3R8BA 4ANVA 1KLGD 1D3ZA 2FAZA 1K8RB 1XF5L 4YXDB 3C8YA 2MJEA 1TY0A 3GP7A 4BBNF 1GOZA 3VVWB 2N1WA 4C7YA 3MJ5A 2YVCA 3DVNU 3AE7B 1SGHA 1YJJA 3AECB 2KO3A 1QLBB 1IGDA 2JZPA 1J7AA 4W9EA 5T8IA 1FEHA 1WR6E 4C56C 4KV2A 1G6JA 2MBQA 1QOGA 2Y3AA 1WE7A 2BB6A 2M1MA 5BYQA 3NZSA 2ASQA 4CYEA 3IAS1 5C2TB 2MP2A 3PRMB 3TEYA 2PVOD 4FN2A 2FIDA 4MJSB 3AE1B 2L52A 1WE6A 5DPTA 3AXCA 4A3PA 5JHBA 1K50A 1YIWA 2D3GA 2KOXA 4XC2A 5HHDG 4ACFA 2KJ6A 4JGHB 1N63A 4W9DA 3A4RA 5JHAA 1TKYA 4K7UA 1FCCC 3FILB 2MJDA 4M02A 3UGBB 3EGRA 3R2TA 3U2SC 2BTEA 1WI0A 2MX2A 1QKZA 4XWWA 1PDXA 4EKUA 4GMVA 3C19A 3P4RB 3B2FA 3AV8A 1FXTB 2WDTB 2CU1A 2AX5A 4J3OD 3L10B 4YSYB 1C78A 3A9KB 2IO0B 1QQRA 4OW0A 1ZGUB 2YLMA 2DAFA 4B0EA 1QOAA 4M8NA 2M56B 2L32A 1F2RC 2J42A 3H7PA 3OJ4B 3Q6BA 2GMIC 5C1ZA 3ZJVA 5AUKA 1JALA 3ONSA 4LCDE 1MHHE 1IBXA 2W3RA 2JT4B 2L83A 2DZMA 2NCNA 3B0AA 2BYFA 2UWQA 3P4PB 3ZIMA 3MHZA 1JQ4A 2G4SA 4NAWA 1N61A 1FD6A 4I6LB 1E9MA 1HXYD 2PE9A 2ZCBA 2KN4A 3PZ7A 2N0SB 2IGDA 3DBHI 4WWMA 4FJYA 4NAMA 3U7DA 3VR9B 1OTRB 3BK2A 2KACA 4ANXA 2IO1B 3ZNGC 1X1MA 2RR9A 2INDC 4BKSA 3T8MA 3ZRCA 4E3CA 2XEWA 3JVZX 4RGTA 1JMLA 1WF9A 2RPVA 1WXQA 4NJ7A 3PSEB 3RNFC 2INNE 3U8ZA 2KKCA 2I38A 3TIXA 1ZDVA 5D94A 1GG3A 4WAFA 1N62A 2K25A 1P98A 3B9JA 4GDLB 3AE4B 2KYWA 3RNAC 3HK0A 1I4QA 4N6EB 3A33B 1LO5D 1C3TA 1ISNA 1AWDA 3P4QB 1KOTA 4WH4A 2GBNA 1EM7A 1F9JA 5D2MB 3MP9A 3NHEB 5G5HA 4JLCA 4CHKA 1NI3A 3OLMD 2LVPA 4KDLB 4GB9A 1GJZA 2IJ0A 4RGNA 4GLSC 2WXLA 3RZFA 3NVZA 2JXXA 1E8ZA 2K22A 3HVDA 1T0SC 2AEHA 2BW2A 5IOIA 4XDCA 4P16A 2DWQA 1C4CA 2WXNA 2FCSA 3Q8BA 2OJRA 4ANWA 2KWUB 1YX5B 2LZ6A 2LJIA 2DENB 2O2VA 2L3ZA 4URKA 2O6VB 2MW5A 2WXKA 2MBOA 4TMAB 1WYWB 1C4AA 5BMGA 5LXIB 4YTMB 2WXRA 3N9YC 3VAWA 3OJ3A 1N5XA 4FHJA 4J6IA 2IYDB 5L83A 4D2KA 3PLUA 4PS3A 2TSSA 2FBWB 4DK5A 2BKFA 1DOXA 2KFJA 2ZNVB 2JVCA 4TKNA 2Y5PA 1D5ZC 3V3XA 1KLVA 2KN5A 1S3SG 3UIOB 1U4AA 2GBJA 3APDA 1T3QA 2IBIB 3WIMA 5J17A 2KFKB 4FJZA 3DWGC 4HVBA 4K7WA 2LI5A 3C0RB 3UQAA 1WY8A 2MJ3A 3L54A 1C1YB 4KZ0A 4K3BA 1YN5A 3ZNZB 3DBRB 4M01A 5AZGA 3R7QA 2DZKA 2RD0A 2FCMA 4GDKB 4XZ4A 3IBEA 1FIQA 4WWPA 3KWVA 1R4MB 4TUUA 4GXBA 1UBIA 2N9PC 1JWSD 4LDTB 3JW0X 2CR5A 1LM8B 4AWJA 3H8HA 4FA6A 3ZJTA 2JSVX 2WXOA 2KANA 2WDQB 3WAMA 5DPRA 3I57A 1KM7A 4NY0A 4RMAA 3BWUD 4BZAA 4LNFA 1UUPA 3HUIA 2KWCA 4NJCA 3MJWA 2KJHB 1RLFA 1F1HA 2MWSB 4KZCA 2KDBA 5IN7A 4AQ7A 2J52A 3M95A 3QJZA 1XLPA 3ECIA 4FXCA 3VH4B 5C23A 2O6VD 2XK5A 5GMVA 3VTWA 2GI9A 2KWVB
chains in the Genus database with same CATH topology
1E7UA 4KIKA 4HPLB 4EFOA 2C7NB 2MBHA 1IP9A 5CX3A 4MJSA 4GOCA 5JH5C 3W1SC 2Z59B 3X23A 2KFKA 3VUYA 2MRPA 3JSVB 2BWES 2J0MA 3N3KB 4W9JA 2DAJA 4G0NB 2MBBB 1EO6A 3KYDD 2ZZPB 3GZNI 2M4NA 2K8CA 1V49A 1UELA 2K1FA 1WXAA 2M8SA 2ZJDA 4HCPB 2L0FA 2EKEC 3LDZE 2PE6B 3M3JA 2O2VB 2Y5BB 2LWPA 4K81A 4IC7B 2KK8A 4DHJB 2REXA 2BWFA 1I42A 3A9JA 2HD5B 4MGKE 2KLCA 4NPNA 5G2NA 4I6NB 4K1RB 2Z0EB 4BVUC 3VUXA 2NBVB 4B6WA 4ZRIA 2G4DB 3N30A 4HXDA 2LRUA 4KDIC 2D2QA 1WZ0A 2KLGA 3ZKJC 1Q5WB 1LFDA 2D11A 2BYVE 2JRIB 2XK5B 2KTFA 2Z0DB 2I1KA 3A1QA 4W9HA 2V4LA 3QX1A 2KDFB 4WWOA 3VXWA 2NS5A 1WGGA 4AUQC 1XD3B 4MM3A 4OVUA 4AJYB 4M0WB 1E90A 2LXCA 2FCQA 3QIJA 3ZDTA 2KC2A 3R66C 4BBNC 2R2OA 2UYZB 2J0JA 2JF5A 2RPQA 5HKHA 3A4SC 3RUIB 3AU4A 3TBLD 1V86A 5CHWA 4IWQA 2V3SA 1GC6A 3L0WB 4FLHA 3UINB 4NAWB 2KMAA 3H6NA 2N9XA 2BYEA 2D07B 4LJOB 4ANVA 1D3ZA 2FAZA 1NBFC 3D32A 2W9NA 3PLVA 1K8RB 2C7HA 3PRPB 4NQKE 3TL5A 3ZTCA 3GOEA 4BBNF 4II3B 3EC8A 3VVWB 1VD2A 2N1WA 4EEWA 1V81A 2YVCA 4W9GA 4MSQB 3DVNU 2KTRB 1SGHA 1EUVB 3QWZB 5KHOA 3CMMB 2KO3A 3BINA 2JPHA 3L13A 3PT2B 4W9EA 3PZDA 1WR6E 4HDQA 3APCA 5DCNA 2G3QB 1Q1OA 2AWTA 2GBMA 2WX0A 3A9JB 4MH0E 4KV2A 1G6JA 2MBQA 2KQSA 5D7GA 1VCBA 1WE7A 2M1MA 2LD9A 5IAAC 4FBJB 3NZSA 1LXDA 4OVVA 2KZRA 2M0XA 2KC1A 1BT0A 3K9PB 4W9IA 2ASQA 4CYEA 4WQOB 3DBRI 4GSWA 3A1QB 2MP2A 2N9EB 3PRMB 4FN2A 4LDTD 2FIDA 2L05A 4MJSB 2RGFA 2K39A 3VDZA 1WE6A 4EZJA 2J0KA 3QHTA 4WJPA 3R3MA 3QQ8B 4IWOA 2LVQA 3AXCA 4PYUA 5DPTA 4A3PA 1EF5A 5JHBA 4RM9A 1YIWA 2D3GA 2KOXA 2L76A 4XC2A 3SD5A 4AJWA 4MDKE 4EZKA 2N7DA 2C9WB 2EMSA 2IO2B 2KJ6A 4JGHB 2CHZA 4B95A 3Q3JA 3UQBA 2B3AA 2QHOA 2AL6A 3V61A 4W9DA 3A4RA 2R2QA 5IA7A 5JHAA 3APFA 4E71A 4HDOA 4W9FA 4HLEA 5FR6A 3Q3FA 2WWZA 4K7UA 3HM3A 4II2B 3UGBB 4LJPB 5G55A 2LGYA 2KQ7A 3ZUNA 3SHQA 3VUWA 1E8WA 3EFUA 1WI0A 2L0TA 4KVGB 1WXMA 2MX2A 3PGEA 2K8BA 5KHQA 4PS7A 3H1UA 3RT3B 1I35A 3QARA 3IVFA 4EKUA 4GMVA 1TGZB 1GC7A 2HE7A 2LGXA 2V1YA 3KYCD 1YD8U 1TBEA 1FXTB 3WALA 3EHVA 4NJ6A 3V6CB 2WDTB 2CU1A 4GDLA 1Q0WB 3HHMA 2KHWB 5LXHA 3AI5A 3L10B 1OGWA 3A9KB 2MSED 2BF8B 2IO0B 2N7EA 1WM2A 4FHKA 3RULA 1ZGUB 3ZRFA 4FULA 2YLMA 2DAFA 2KX3A 2AL3A 2ZNVC 4M8NA 3KUCB 3M63B 1V9JA 4HK2A 1P9DU 3I3TB 3H7PA 3OJ4B 4JQWC 1H8CA 3W1YA 1IPGA 2GMIC 2NBWB 3DDCB 5C1ZA 1LQBA 1R4NI 4JL9A 1UBQA 1YQBA 2ZVNA 3ONSA 4W9KA 4ASWC 4LCDE 2JT4B 2NCNA 2DZMA 3TMPB 4IWPA 3B0AA 2BYFA 2JZZA 2A5UA 2UWQA 2ZVOA 3ZIMA 1R4MI 2EMTA 2KDIA 2G4SA 1SIFA 1L7YA 4NAWA 4W9CA 3PHWB 1WX7A 4ZYNA 2KDEB 4ICVA 4WJQA 3VFKA 3IHPC 2AYOB 4I6LB 5JZEB 1WGDA 4IM3A 2K6QA 2IY0B 5TR5A 2FNJB 2BKRB 2PE9A 2DZIA 2ZCBA 3QAQA 2OOBB 1WJUA 3A9KA 2WYQA 5DPWA 1TZ1A 2C60A 3DBHI 2WX1A 3WA0A 4FJYA 1Z5SB 5AZFA 1WGRA 1QZEA 4EZLA 3U7DA 1RRBA 2JY6A 1KJTA 2M17A 1V2YA 2FCNA 1OTRB 2IZVB 3NZUA 5AEKB 2BGFA 2KJRA 1V5OA 4ANXA 2IO1B 3ZNGC 2O6VA 3SU8X 3HM6X 3U30A 3H9DA 4AP4C 1UH6A 3K9OB 1X1MA 2K8HA 2RR9A 3ENEA 4BKSA 1E8XA 3PRZA 5E6PA 3T8MA 3ZRCA 1NI2A 4E3CA 5CHVC 1XT9B 1WJ4A 2XEWA 3CF6E 1V6EA 3JVZX 1WJNA 2MP2B 1SE9A 2C5LC 2MBEA 3NS8A 1UD7A 1E8YA 1XQQA 4NQLB 3VH3B 1WF9A 3VTUA 2LGDA 3DVGY 3TCAA 1P0RA 4NNJB 3RCZA 1JRUA 3IFWB 4NJ7A 3PSEB 4IM2A 5AZHA 3U8ZA 2KKCA 4BFRA 3TIXA 2LVOA 3UF8A 3ZTDA 2JUOA 5D94A 1GG3A 1OEYJ 3QK0A 3ZLZA 4DHZB 3PVLA 4GU2A 4WWNA 3DCGA 1WH3A 4G3XB 2K25A 2DYBA 1WM3A 1AARA 1P98A 1WIAA 2DYOA 4GDLB 2GBRA 4W9LA 1J0GA 2JRHA 2JWZA 4ANUA 3PPAA 4IUMB 3ZO5B 4DDID 3H7SA 3DVNV 3HK0A 3CSTA 3PS6A 1UGMA 1J8CA 4WAAA 2DHZA 3BY4B 3PV1A 1GNUA 2ZEQA 3A33B 4MEMA 1C3TA 3OAWA 1ISNA 3CSFA 1KOTA 1EF1A 3V62A 1OEYA 1S1QB 2GBNA 2IY1B 1F9JA 3AULA 5CTRC 5D2MB 3NHEB 3EECA 3RZWC 2NR2A 2A4ZA 4JLCA 4A20A 4CHKA 4DDGD 3RD2A 3OLMD 2L00B 2GBKA 1RFAA 2LVPA 4G50A 4KDLB 4GB9A 2FIFA 4B9KA 4DHJD 1GJZA 3N32A 4IW0A 3WANA 5J18A 2NVUI 4DXAB 4K7SA 3LJ3A 3RZFA 4N9F4 1E7VA 3ZNID 3ZNHB 5DPSA 2GOWA 1CMXB 1WX9A 2JXXA 3KVFB 2BPSA 4IG7B 4MSMB 4G11A 1E8ZA 4A3OA 1WR1A 2AEHA 1ZKHA 1T0YA 3VHTC 4KSKC 4HPMB 1WJ6A 2ZPNA 2MCNB 1L2NA 2LRWA 2DX5B 2KD0A 4AOFA 3R7RA 2FCSA 1MG8A 2OJRA 4ANWA 1OQYA 2KWUB 4MGYE 1YX5B 2LZ6A 2DENB 1WXSA 4M8MA 2O2VA 2L3ZA 2HJ8A 4URKA 3NOBA 1WZ3A 2O6VB 2MW5A 3HIZA 2ZPYA 4RM8A 2MBOA 1P3QU 1WYWB 4F1SA 4BOSC 5LXIB 3KUZA 3ML8A 1NDDA 3ZDMC 4BKGA 2KVRA 3ZW3A 4MGZE 2MQJA 2DYMA 1PQSA 3AU5A 4KIKB 3KUDB 4BOZB 3VAWA 4HWIB 2MLBA 1WXVA 2L8JA 3OJ3A 3ALBA 2CKHB 1WGHA 5BO4B 4FHJA 3P2BA 5CHFA 4HCNB 1Y8RC 4J6IA 2IYDB 5L83A 3PLUA 1E5WA 4PS3A 3S2AA 4GIVA 4DK5A 2BKFA 1RAXA 4TQ0A 2KTRA 2L7RA 2KFJA 3RYTA 2JZ3B 1WRDB 1YJ1A 2ZNVB 3DBLI 4YL8A 4ZRKA 3T9LA 2JVCA 4WJNA 4TKNA 3L17A 4WJOA 4DWFA 3PHXB 1KLVA 2KN5A 1S3SG 3UIOB 1WGYA 2LASA 1Z2MA 1U4AA 3O65B 1WFYA 2GBJA 3APDA 3B08A 1H4RA 1TTNA 2IBIB 2CS4A 3WIMA 4KSLC 4MELA 4ZDVA 1P1AA 5E6NA 5J17A 2KFKB 2NPTA 3UIPB 3IG3A 4XX5A 2CHWA 4FJZA 4P7IA 4HVBA 4GN1A 4K7WA 3KW5B 1IYFA 2LI5A 3C0RB 3ML9A 2VRRB 3QA8A 2IO3B 3UQAA 1WY8A 3L54A 2NBUA 1WMHB 3MTNB 1C1YB 2KX0A 1UZXB 2LJ5A 4JIOU 4KZ0A 4FADA 3QC8B 4IM0A 1YX6B 4TQ1A 3DOWA 2LUEA 3JYUA 3ZNZB 1V5TA 3L08A 5AZGA 2DZJA 2PJHA 1ZW7A 3R7QA 3TJPA 4ZRJA 2DZKA 2FUHB 2RD0A 3VQIA 2FCMA 4F7ZA 2PPHA 1GUAB 1V80A 2RSUA 3QCAA 4GDKB 2C7MB 4GGQA 4CO7A 4XZ4A 3ZVVA 5J2RA 3IBEA 1HE8A 3V6EB 4X57B 4WWPA 3V60A 4TUUA 4EUTA 3B1LX 4GXBA 4PYZA 1UBIA 4TV3A 2KNBA 1M94A 2MA9B 3WAPA 1A5RA 2N9PC 3DVGX 4BKTA 5D6JB 4LDTB 4E74A 3DPDA 3JW0X 5E6OA 2CR5A 1LM8B 4PS8A 4AWJA 4FA6A 2KANA 3X0WA 1WMHA 5EDSA 3WAMA 3L16A 3SDLC 5DPRA 4EOYA 2HTHA 1KM7A 2N1VA 3DBSA 4I6PA 2K6DB 4NY0A 4RMAA 4GDKA 3M62B 3PTFC 2D10A 2I1JA 3PREA 4ICUA 2KWCA 2NPTB 3MJWA 2KJHB 1RLFA 3NY5A 2J7QB 5L95C 5LLIA 2MWSB 4KZCA 2KDBA 2LXAA 2G45B 4DHZE 3WAOA 2KMCA 3JSVA 3M95A 3QJZA 3DQVA 1WX8A 4DBGA 2ZCCA 3ECIA 2XBBC 2PEAA 3VH4B 1J19A 2N4FA 5C23A 4F8CB 2O6VD 2XK5A 3W1SA 5GMVA 3KH0A 3VTWA 4HJKA 2CHXA 4FJVB 2KXJA 3MHSD 4BKSD 3H7PB 4MGIE 3VTVA 2KWVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7U A;  4KIK A;  4HPL B;  4EFO A;  2C7N B;  2MBH A;  1IP9 A;  5CX3 A;  4MJS A;  4GOC A;  5JH5 C;  3W1S C;  2Z59 B;  3X23 A;  2KFK A;  3VUY A;  2MRP A;  3JSV B;  2BWE S;  2J0M A;  3N3K B;  4W9J A;  2DAJ A;  4G0N B;  2MBB B;  1EO6 A;  3KYD D;  2ZZP B;  3GZN I;  2M4N A;  2K8C A;  1V49 A;  1UEL A;  2K1F A;  1WXA A;  2M8S A;  2ZJD A;  4HCP B;  2L0F A;  2EKE C;  3LDZ E;  2PE6 B;  3M3J A;  2O2V B;  2Y5B B;  2LWP A;  4K81 A;  4IC7 B;  2KK8 A;  4DHJ B;  2REX A;  2BWF A;  1I42 A;  3A9J A;  2HD5 B;  4MGK E;  2KLC A;  4NPN A;  5G2N A;  4I6N B;  4K1R B;  2Z0E B;  4BVU C;  3VUX A;  2NBV B;  4B6W A;  4ZRI A;  2G4D B;  3N30 A;  4HXD A;  2LRU A;  4KDI C;  2D2Q A;  1WZ0 A;  2KLG A;  3ZKJ C;  1Q5W B;  1LFD A;  2D11 A;  2BYV E;  2JRI B;  2XK5 B;  2KTF A;  2Z0D B;  2I1K A;  3A1Q A;  4W9H A;  2V4L A;  3QX1 A;  2KDF B;  4WWO A;  3VXW A;  2NS5 A;  1WGG A;  4AUQ C;  1XD3 B;  4MM3 A;  4OVU A;  4AJY B;  4M0W B;  1E90 A;  2LXC A;  2FCQ A;  3QIJ A;  3ZDT A;  2KC2 A;  3R66 C;  4BBN C;  2R2O A;  2UYZ B;  2J0J A;  2JF5 A;  2RPQ A;  5HKH A;  3A4S C;  3RUI B;  3AU4 A;  3TBL D;  1V86 A;  5CHW A;  4IWQ A;  2V3S A;  1GC6 A;  3L0W B;  4FLH A;  3UIN B;  4NAW B;  2KMA A;  3H6N A;  2N9X A;  2BYE A;  2D07 B;  4LJO B;  4ANV A;  1D3Z A;  2FAZ A;  1NBF C;  3D32 A;  2W9N A;  3PLV A;  1K8R B;  2C7H A;  3PRP B;  4NQK E;  3TL5 A;  3ZTC A;  3GOE A;  4BBN F;  4II3 B;  3EC8 A;  3VVW B;  1VD2 A;  2N1W A;  4EEW A;  1V81 A;  2YVC A;  4W9G A;  4MSQ B;  3DVN U;  2KTR B;  1SGH A;  1EUV B;  3QWZ B;  5KHO A;  3CMM B;  2KO3 A;  3BIN A;  2JPH A;  3L13 A;  3PT2 B;  4W9E A;  3PZD A;  1WR6 E;  4HDQ A;  3APC A;  5DCN A;  2G3Q B;  1Q1O A;  2AWT A;  2GBM A;  2WX0 A;  3A9J B;  4MH0 E;  4KV2 A;  1G6J A;  2MBQ A;  2KQS A;  5D7G A;  1VCB A;  1WE7 A;  2M1M A;  2LD9 A;  5IAA C;  4FBJ B;  3NZS A;  1LXD A;  4OVV A;  2KZR A;  2M0X A;  2KC1 A;  1BT0 A;  3K9P B;  4W9I A;  2ASQ A;  4CYE A;  4WQO B;  3DBR I;  4GSW A;  3A1Q B;  2MP2 A;  2N9E B;  3PRM B;  4FN2 A;  4LDT D;  2FID A;  2L05 A;  4MJS B;  2RGF A;  2K39 A;  3VDZ A;  1WE6 A;  4EZJ A;  2J0K A;  3QHT A;  4WJP A;  3R3M A;  3QQ8 B;  4IWO A;  2LVQ A;  3AXC A;  4PYU A;  5DPT A;  4A3P A;  1EF5 A;  5JHB A;  4RM9 A;  1YIW A;  2D3G A;  2KOX A;  2L76 A;  4XC2 A;  3SD5 A;  4AJW A;  4MDK E;  4EZK A;  2N7D A;  2C9W B;  2EMS A;  2IO2 B;  2KJ6 A;  4JGH B;  2CHZ A;  4B95 A;  3Q3J A;  3UQB A;  2B3A A;  2QHO A;  2AL6 A;  3V61 A;  4W9D A;  3A4R A;  2R2Q A;  5IA7 A;  5JHA A;  3APF A;  4E71 A;  4HDO A;  4W9F A;  4HLE A;  5FR6 A;  3Q3F A;  2WWZ A;  4K7U A;  3HM3 A;  4II2 B;  3UGB B;  4LJP B;  5G55 A;  2LGY A;  2KQ7 A;  3ZUN A;  3SHQ A;  3VUW A;  1E8W A;  3EFU A;  1WI0 A;  2L0T A;  4KVG B;  1WXM A;  2MX2 A;  3PGE A;  2K8B A;  5KHQ A;  4PS7 A;  3H1U A;  3RT3 B;  1I35 A;  3QAR A;  3IVF A;  4EKU A;  4GMV A;  1TGZ B;  1GC7 A;  2HE7 A;  2LGX A;  2V1Y A;  3KYC D;  1YD8 U;  1TBE A;  1FXT B;  3WAL A;  3EHV A;  4NJ6 A;  3V6C B;  2WDT B;  2CU1 A;  4GDL A;  1Q0W B;  3HHM A;  2KHW B;  5LXH A;  3AI5 A;  3L10 B;  1OGW A;  3A9K B;  2MSE D;  2BF8 B;  2IO0 B;  2N7E A;  1WM2 A;  4FHK A;  3RUL A;  1ZGU B;  3ZRF A;  4FUL A;  2YLM A;  2DAF A;  2KX3 A;  2AL3 A;  2ZNV C;  4M8N A;  3KUC B;  3M63 B;  1V9J A;  4HK2 A;  1P9D U;  3I3T B;  3H7P A;  3OJ4 B;  4JQW C;  1H8C A;  3W1Y A;  1IPG A;  2GMI C;  2NBW B;  3DDC B;  5C1Z A;  1LQB A;  1R4N I;  4JL9 A;  1UBQ A;  1YQB A;  2ZVN A;  3ONS A;  4W9K A;  4ASW C;  4LCD E;  2JT4 B;  2NCN A;  2DZM A;  3TMP B;  4IWP A;  3B0A A;  2BYF A;  2JZZ A;  2A5U A;  2UWQ A;  2ZVO A;  3ZIM A;  1R4M I;  2EMT A;  2KDI A;  2G4S A;  1SIF A;  1L7Y A;  4NAW A;  4W9C A;  3PHW B;  1WX7 A;  4ZYN A;  2KDE B;  4ICV A;  4WJQ A;  3VFK A;  3IHP C;  2AYO B;  4I6L B;  5JZE B;  1WGD A;  4IM3 A;  2K6Q A;  2IY0 B;  5TR5 A;  2FNJ B;  2BKR B;  2PE9 A;  2DZI A;  2ZCB A;  3QAQ A;  2OOB B;  1WJU A;  3A9K A;  2WYQ A;  5DPW A;  1TZ1 A;  2C60 A;  3DBH I;  2WX1 A;  3WA0 A;  4FJY A;  1Z5S B;  5AZF A;  1WGR A;  1QZE A;  4EZL A;  3U7D A;  1RRB A;  2JY6 A;  1KJT A;  2M17 A;  1V2Y A;  2FCN A;  1OTR B;  2IZV B;  3NZU A;  5AEK B;  2BGF A;  2KJR A;  1V5O A;  4ANX A;  2IO1 B;  3ZNG C;  2O6V A;  3SU8 X;  3HM6 X;  3U30 A;  3H9D A;  4AP4 C;  1UH6 A;  3K9O B;  1X1M A;  2K8H A;  2RR9 A;  3ENE A;  4BKS A;  1E8X A;  3PRZ A;  5E6P A;  3T8M A;  3ZRC A;  1NI2 A;  4E3C A;  5CHV C;  1XT9 B;  1WJ4 A;  2XEW A;  3CF6 E;  1V6E A;  3JVZ X;  1WJN A;  2MP2 B;  1SE9 A;  2C5L C;  2MBE A;  3NS8 A;  1UD7 A;  1E8Y A;  1XQQ A;  4NQL B;  3VH3 B;  1WF9 A;  3VTU A;  2LGD A;  3DVG Y;  3TCA A;  1P0R A;  4NNJ B;  3RCZ A;  1JRU A;  3IFW B;  4NJ7 A;  3PSE B;  4IM2 A;  5AZH A;  3U8Z A;  2KKC A;  4BFR A;  3TIX A;  2LVO A;  3UF8 A;  3ZTD A;  2JUO A;  5D94 A;  1GG3 A;  1OEY J;  3QK0 A;  3ZLZ A;  4DHZ B;  3PVL A;  4GU2 A;  4WWN A;  3DCG A;  1WH3 A;  4G3X B;  2K25 A;  2DYB A;  1WM3 A;  1AAR A;  1P98 A;  1WIA A;  2DYO A;  4GDL B;  2GBR A;  4W9L A;  1J0G A;  2JRH A;  2JWZ A;  4ANU A;  3PPA A;  4IUM B;  3ZO5 B;  4DDI D;  3H7S A;  3DVN V;  3HK0 A;  3CST A;  3PS6 A;  1UGM A;  1J8C A;  4WAA A;  2DHZ A;  3BY4 B;  3PV1 A;  1GNU A;  2ZEQ A;  3A33 B;  4MEM A;  1C3T A;  3OAW A;  1ISN A;  3CSF A;  1KOT A;  1EF1 A;  3V62 A;  1OEY A;  1S1Q B;  2GBN A;  2IY1 B;  1F9J A;  3AUL A;  5CTR C;  5D2M B;  3NHE B;  3EEC A;  3RZW C;  2NR2 A;  2A4Z A;  4JLC A;  4A20 A;  4CHK A;  4DDG D;  3RD2 A;  3OLM D;  2L00 B;  2GBK A;  1RFA A;  2LVP A;  4G50 A;  4KDL B;  4GB9 A;  2FIF A;  4B9K A;  4DHJ D;  1GJZ A;  3N32 A;  4IW0 A;  3WAN A;  5J18 A;  2NVU I;  4DXA B;  4K7S A;  3LJ3 A;  3RZF A;  4N9F 4;  1E7V A;  3ZNI D;  3ZNH B;  5DPS A;  2GOW A;  1CMX B;  1WX9 A;  2JXX A;  3KVF B;  2BPS A;  4IG7 B;  4MSM B;  4G11 A;  1E8Z A;  4A3O A;  1WR1 A;  2AEH A;  1ZKH A;  1T0Y A;  3VHT C;  4KSK C;  4HPM B;  1WJ6 A;  2ZPN A;  2MCN B;  1L2N A;  2LRW A;  2DX5 B;  2KD0 A;  4AOF A;  3R7R A;  2FCS A;  1MG8 A;  2OJR A;  4ANW A;  1OQY A;  2KWU B;  4MGY E;  1YX5 B;  2LZ6 A;  2DEN B;  1WXS A;  4M8M A;  2O2V A;  2L3Z A;  2HJ8 A;  4URK A;  3NOB A;  1WZ3 A;  2O6V B;  2MW5 A;  3HIZ A;  2ZPY A;  4RM8 A;  2MBO A;  1P3Q U;  1WYW B;  4F1S A;  4BOS C;  5LXI B;  3KUZ A;  3ML8 A;  1NDD A;  3ZDM C;  4BKG A;  2KVR A;  3ZW3 A;  4MGZ E;  2MQJ A;  2DYM A;  1PQS A;  3AU5 A;  4KIK B;  3KUD B;  4BOZ B;  3VAW A;  4HWI B;  2MLB A;  1WXV A;  2L8J A;  3OJ3 A;  3ALB A;  2CKH B;  1WGH A;  5BO4 B;  4FHJ A;  3P2B A;  5CHF A;  4HCN B;  1Y8R C;  4J6I A;  2IYD B;  5L83 A;  3PLU A;  1E5W A;  4PS3 A;  3S2A A;  4GIV A;  4DK5 A;  2BKF A;  1RAX A;  4TQ0 A;  2KTR A;  2L7R A;  2KFJ A;  3RYT A;  2JZ3 B;  1WRD B;  1YJ1 A;  2ZNV B;  3DBL I;  4YL8 A;  4ZRK A;  3T9L A;  2JVC A;  4WJN A;  4TKN A;  3L17 A;  4WJO A;  4DWF A;  3PHX B;  1KLV A;  2KN5 A;  1S3S G;  3UIO B;  1WGY A;  2LAS A;  1Z2M A;  1U4A A;  3O65 B;  1WFY A;  2GBJ A;  3APD A;  3B08 A;  1H4R A;  1TTN A;  2IBI B;  2CS4 A;  3WIM A;  4KSL C;  4MEL A;  4ZDV A;  1P1A A;  5E6N A;  5J17 A;  2KFK B;  2NPT A;  3UIP B;  3IG3 A;  4XX5 A;  2CHW A;  4FJZ A;  4P7I A;  4HVB A;  4GN1 A;  4K7W A;  3KW5 B;  1IYF A;  2LI5 A;  3C0R B;  3ML9 A;  2VRR B;  3QA8 A;  2IO3 B;  3UQA A;  1WY8 A;  3L54 A;  2NBU A;  1WMH B;  3MTN B;  1C1Y B;  2KX0 A;  1UZX B;  2LJ5 A;  4JIO U;  4KZ0 A;  4FAD A;  3QC8 B;  4IM0 A;  1YX6 B;  4TQ1 A;  3DOW A;  2LUE A;  3JYU A;  3ZNZ B;  1V5T A;  3L08 A;  5AZG A;  2DZJ A;  2PJH A;  1ZW7 A;  3R7Q A;  3TJP A;  4ZRJ A;  2DZK A;  2FUH B;  2RD0 A;  3VQI A;  2FCM A;  4F7Z A;  2PPH A;  1GUA B;  1V80 A;  2RSU A;  3QCA A;  4GDK B;  2C7M B;  4GGQ A;  4CO7 A;  4XZ4 A;  3ZVV A;  5J2R A;  3IBE A;  1HE8 A;  3V6E B;  4X57 B;  4WWP A;  3V60 A;  4TUU A;  4EUT A;  3B1L X;  4GXB A;  4PYZ A;  1UBI A;  4TV3 A;  2KNB A;  1M94 A;  2MA9 B;  3WAP A;  1A5R A;  2N9P C;  3DVG X;  4BKT A;  5D6J B;  4LDT B;  4E74 A;  3DPD A;  3JW0 X;  5E6O A;  2CR5 A;  1LM8 B;  4PS8 A;  4AWJ A;  4FA6 A;  2KAN A;  3X0W A;  1WMH A;  5EDS A;  3WAM A;  3L16 A;  3SDL C;  5DPR A;  4EOY A;  2HTH A;  1KM7 A;  2N1V A;  3DBS A;  4I6P A;  2K6D B;  4NY0 A;  4RMA A;  4GDK A;  3M62 B;  3PTF C;  2D10 A;  2I1J A;  3PRE A;  4ICU A;  2KWC A;  2NPT B;  3MJW A;  2KJH B;  1RLF A;  3NY5 A;  2J7Q B;  5L95 C;  5LLI A;  2MWS B;  4KZC A;  2KDB A;  2LXA A;  2G45 B;  4DHZ E;  3WAO A;  2KMC A;  3JSV A;  3M95 A;  3QJZ A;  3DQV A;  1WX8 A;  4DBG A;  2ZCC A;  3ECI A;  2XBB C;  2PEA A;  3VH4 B;  1J19 A;  2N4F A;  5C23 A;  4F8C B;  2O6V D;  2XK5 A;  3W1S A;  5GMV A;  3KH0 A;  3VTW A;  4HJK A;  2CHX A;  4FJV B;  2KXJ A;  3MHS D;  4BKS D;  3H7P B;  4MGI E;  3VTV A;  2KWV B; 
#chains in the Genus database with same CATH topology
 4XE0 A;  4KIK A;  4IOI E;  4EFO A;  1IP9 A;  4MJS A;  4GOC A;  3ZGZ A;  3VUY A;  2BWE S;  2J0M A;  2DAJ A;  1EO6 A;  2M4N A;  3EUB 2;  1V49 A;  3T3O A;  1UEL A;  1FFV A;  3J9C A;  3LDZ E;  2O2V B;  2KK8 A;  1V1P B;  1ET6 A;  2BWF A;  3A9J A;  4MGK E;  4NPN A;  4I6N B;  4K1R B;  4BVU C;  3VUX A;  2G4D B;  1DOY A;  1T6B X;  1WZ0 A;  2D11 A;  2BYV E;  3A1Q A;  2V3N A;  2W55 A;  1MG4 A;  4HEA 1;  4WWO A;  4OVU A;  4AJY B;  1I4X A;  1E90 A;  4HPP A;  3PO0 A;  4C7Z A;  2OHF A;  3RUI B;  3TBL D;  3AU4 A;  2RDH A;  1WRI A;  4NAW B;  2N9X A;  2BYE A;  2D07 B;  1NBF C;  3D32 A;  4B0M A;  3GZN B;  4NQK E;  1KTK A;  1YNT E;  3Q14 C;  4KX6 B;  3SR6 A;  1TS3 A;  2K0P A;  2KMM A;  4MSQ B;  4L23 A;  1EUV B;  2JU6 X;  5KHO A;  1C77 A;  3CMM B;  3PT2 B;  4HDQ A;  5DCN A;  1AYF A;  2GBM A;  2WX0 A;  4MH0 E;  5D7G A;  4OVV A;  1LXD A;  2M0X A;  3K9P B;  2D3C A;  2N9E B;  1K53 A;  4LDT D;  1DYQ A;  3MC9 A;  5LNK 1;  2J0K A;  3QHT A;  1E7P B;  3QQ8 B;  2LVQ A;  3SD5 A;  4AJW A;  2N7D A;  2IO2 B;  2EMS A;  4ITK A;  3DHI C;  4B95 A;  1WSP A;  2QHO A;  2AL6 A;  1SXT A;  5IA7 A;  3Q3F A;  2EKI A;  1MJD A;  4II2 B;  5G55 A;  3LYY A;  2WXI A;  1E8W A;  4KVG B;  3PGE A;  4PS7 A;  3QAR A;  4UDU C;  1QF6 A;  4P1C C;  1SJH D;  2GRI A;  3I63 C;  2WXG A;  4GDL A;  2KHW B;  3Q3O C;  2MSE D;  2N7E A;  1WM2 A;  1PGA A;  1TS5 A;  1T0Q C;  2ZNV C;  3M63 B;  4YTN B;  4HK2 A;  1P9D U;  1NEK B;  2INP E;  4MT5 A;  1H8C A;  2NBW B;  1R4N I;  2L1A A;  3P4S B;  4W9K A;  1UBQ A;  1YQB A;  4ASW C;  4P6V F;  1YMH E;  4KGT A;  3TMP B;  3AE3 B;  2KDI A;  1L7Y A;  1WX7 A;  2M19 A;  2KDE B;  2QIE B;  3VFK A;  3IHP C;  1WGD A;  4IM3 A;  2K6Q A;  3W2D A;  2BKR B;  1D4B A;  4QAY A;  2DZI A;  2OOB B;  1WJU A;  4H2A A;  1TZ1 A;  4JE3 B;  2WX1 A;  2BQQ A;  3WA0 A;  5AZF A;  1IUE A;  1WGR A;  1C4P A;  1FRD A;  3V05 A;  2M17 A;  1V2Y A;  1V5O A;  2O6V A;  3SU8 X;  3H9D A;  2RMM A;  2ZW1 A;  2K8H A;  4RF0 A;  1YN4 A;  3SFD B;  5E6P A;  1WGK A;  2QDF A;  1XT9 B;  1WJ4 A;  1V6E A;  1FXA A;  2C5L C;  2MBE A;  1XCQ L;  4NQL B;  1E8Y A;  3VH3 B;  1HZ5 A;  5D3D A;  2LGD A;  3TCA A;  1P0R A;  4NNJ B;  1M4V A;  3IFW B;  3RCZ A;  4IM2 A;  4C4V B;  2D3A A;  4BFR A;  2PKO A;  2LVO A;  1OEY J;  1XLQ A;  1BXT A;  4LK0 M;  1T5X D;  2HJ1 A;  3DCG A;  4NZL B;  2KQ4 X;  1D5X C;  1ET9 A;  1ZE3 D;  4W9L A;  4ANU A;  3Q69 A;  3ZO5 B;  3H7S A;  3DVN V;  3CIR B;  4WUR A;  2MHJ A;  3BY4 B;  3PV1 A;  1GNU A;  3Q8A A;  2QC8 A;  2PIA A;  2ICI A;  3RZW C;  2NR2 A;  2L00 B;  2WNM A;  2KAJ A;  4G50 A;  3RNB C;  4B9K A;  4IW0 A;  3WAN A;  1AN8 A;  4OHJ A;  1E7V A;  2GOW A;  4IG7 B;  2BPS A;  4YWG G;  4G11 A;  2QEJ C;  3RPF C;  1L4Z B;  3VHT C;  1ZKH A;  1F0Z A;  2KWD A;  4KSK C;  1WJ6 A;  1L2N A;  3NZ3 A;  4MH8 A;  2LRW A;  3ZXV A;  1FRR A;  2KD0 A;  1VZ6 A;  3WCQ A;  1GPX A;  5G5G A;  1VJK A;  4MGY E;  2OED A;  2WXQ A;  1KF6 B;  4TSS A;  4ARC A;  4RM8 A;  2H89 B;  4F1S A;  4BOS C;  1NDD A;  2HTM E;  4BKG A;  2OJW A;  2DYM A;  3AU5 A;  4KIK B;  3KUD B;  1EU3 A;  4BOZ B;  3VRB B;  4HWI B;  1WXV A;  2CKH B;  1WGH A;  5BO4 B;  3BVZ A;  3W5U B;  4HRO A;  5CHF A;  4A55 A;  3S2A A;  4GIV A;  3DHH C;  4YT0 B;  2RDB C;  1TIF A;  4ZRK A;  3L17 A;  1XLN A;  2MH7 A;  2LAS A;  1HTO A;  1Z2M A;  4IDI A;  3VRA B;  5IO9 A;  2LEK A;  1FXI A;  1V8C A;  2CS4 A;  3U7Z A;  2JYT A;  2NPT A;  4HJG E;  3UIP B;  4RCO A;  4XX5 A;  2CHW A;  4P7I A;  1C79 A;  2KVZ A;  4ZRP A;  1R4N B;  2VRR B;  3QA8 A;  1YQ3 B;  2NBU A;  3MTN B;  4JIO U;  3QC8 B;  4IM0 A;  3JYU A;  3L08 A;  5BMI A;  2PJH A;  4ZRJ A;  2LUM A;  4GGQ A;  4CO7 A;  4RH6 A;  1HE8 A;  1VRA B;  5EE1 A;  1GB1 A;  2X38 A;  3B1L X;  4PYZ A;  3DWM A;  1M94 A;  2MA9 B;  3FC4 A;  3U4E G;  1OFF A;  5D6J B;  4E74 A;  1TKG A;  4HKZ E;  1UWM A;  4PS8 A;  2WGS A;  2BVC A;  1WMH A;  2WXF A;  3AEE B;  1TJE A;  2IPK D;  3PTF C;  1HA5 A;  5BYR A;  3L4P A;  3NY5 A;  1RWS A;  3N1Y C;  1WWT A;  4LNN A;  5BYS A;  3RNG C;  3UI3 A;  2LXA A;  3GS2 A;  2KMC A;  4K3C A;  4RFB A;  1WX8 A;  1IBX B;  1J19 A;  3U52 E;  4LNO A;  1JWB D;  3KH0 A;  2WXP A;  3MC8 A;  3MHS D;  3DBL B;  3VTV A;  1E7U A;  2MBH A;  4P1B C;  5JH5 C;  2Z59 B;  3X23 A;  3RMK C;  2MRP A;  3JSV B;  4US8 A;  2RDG A;  4W9J A;  4G0N B;  3KYD D;  2ZZP B;  1QOF A;  1KFY B;  2K8C A;  1WXA A;  2DBY A;  1NEN B;  2ZJD A;  4R3D A;  2L0F A;  2PE6 B;  4DHJ B;  4K81 A;  4IC7 B;  4M00 A;  3MC0 B;  5G2N A;  1VLB A;  4ZRI A;  2KLG A;  2JRI B;  1JCK B;  5AUI A;  5JXV A;  4XYC A;  2KDF B;  1WGG A;  4AUQ C;  1ZUD 2;  1MFW A;  4MM3 A;  3T3N A;  4LLG M;  3AEG B;  3HVZ A;  2KC2 A;  2UYZ B;  1C76 A;  2JF5 A;  1AW7 A;  2BS3 B;  2JWU A;  2RPQ A;  3A4S C;  3NJT A;  5CHW A;  5HI1 A;  1GC6 A;  4FLH A;  3UIN B;  4S0R A;  4LJO B;  2W9N A;  3P63 A;  3PRP B;  3NRZ A;  2INC C;  3FIL A;  3GOE A;  3EC8 A;  1VD2 A;  1V81 A;  4W9G A;  1FNU A;  2DNF A;  3RI7 C;  2KTR B;  2PW9 A;  3TSS A;  3P42 A;  3QWZ B;  3BIN A;  1L6V A;  5GXG B;  2G3Q B;  2BYT A;  2AWT A;  4A90 A;  2KZR A;  2KC1 A;  4W9I A;  3DBR I;  2L05 A;  2Q5W D;  2RGF A;  2K39 A;  2W3S A;  3VDZ A;  4EZJ A;  3BK1 A;  2MEK A;  3R3M A;  2PTL A;  1EF5 A;  2K9X A;  2L76 A;  2C9W B;  1RYJ A;  3UQB A;  5EE9 A;  4OZC A;  3V61 A;  4XDD A;  1HTQ A;  2R2Q A;  1C9F A;  4E71 A;  4HLE A;  5FR6 A;  1L0X B;  1EWC A;  4LJP B;  1J7B A;  2LGY A;  1EWY C;  3VUW A;  3Q3N C;  1PFD A;  5FK9 C;  2L0T A;  1QIL A;  3SFE B;  2K8B A;  4C00 A;  3H1U A;  1TZO A;  1I35 A;  1SIJ A;  2HE7 A;  2LGX A;  4XWT A;  2WDR B;  1YD8 U;  4NJ6 A;  3V6C B;  4JX1 C;  1P7E A;  5LXH A;  3AI5 A;  3ZRF A;  1UF0 A;  2KT7 A;  2KX3 A;  3BYY B;  1WYG A;  3KUC B;  1V9J A;  3I3T B;  1FFU A;  3W1Y A;  2H88 B;  1LQB A;  2BS2 B;  2WP9 B;  2ZVN A;  1UGJ A;  3E9S A;  4IWP A;  3ETR A;  2JZZ A;  4HRS A;  2A5U A;  3RNE C;  2EMT A;  4W9C A;  3PHW B;  4DQO C;  1MHX A;  4WQM A;  2X8X X;  1YOV B;  1RM6 C;  5DPW A;  2C60 A;  1JWM D;  1Z5S B;  1QZE A;  1UWX A;  1KJT A;  2FCN A;  2IZV B;  1KRH A;  3NZU A;  5AEK B;  2BGF A;  2KJR A;  5EE3 A;  1DGJ A;  1HZ6 A;  4XGA B;  1NI2 A;  2NTT A;  3BZD B;  5CHV C;  3CF6 E;  1GB4 A;  1WJN A;  1SE9 A;  3NS8 A;  1UD7 A;  1XQQ A;  4US9 A;  2JYE A;  4A9A A;  4A6Q A;  1JRU A;  5AZH A;  2VZK D;  1SJE D;  3ZTD A;  1STE A;  3QK0 A;  4DHZ B;  3ZJU A;  1SF0 A;  2GB1 A;  4GU2 A;  1NYR A;  3VR8 B;  2D3B A;  1WH3 A;  2DYB A;  1WIA A;  1YQ4 B;  2GBR A;  1J0G A;  4IUM B;  1N5W A;  2N7J A;  4Q2J A;  1ACC A;  3PS6 A;  1UGM A;  1J8C A;  2UU7 A;  2ZEQ A;  1ZP0 B;  1FPY A;  3OAW A;  2ON8 A;  1L0Y B;  1OEY A;  4LTU A;  1S1Q B;  4ARI A;  3AUL A;  2BBC A;  3EEC A;  3AED B;  2A4Z A;  4DDG D;  3RD2 A;  2FE8 A;  2WDV B;  2FIF A;  3N32 A;  3AM9 A;  2NVU I;  3AN1 A;  4K7S A;  4N9F 4;  3ZNI D;  5DPS A;  2FUG 1;  1CMX B;  1WX9 A;  3NUH B;  4MSM B;  2LFI A;  4A3O A;  2Y5C A;  1WR1 A;  1TKE A;  1CK1 A;  2ZPN A;  3I9V 1;  3FKY A;  2YEP F;  2DX5 B;  4AOF A;  5I4D A;  2AQ3 B;  2YEP B;  3R7R A;  1E10 A;  1OQY A;  2D5G A;  3ZQ4 A;  4M8M A;  3R2I A;  3O13 A;  3NOB A;  2ZPY A;  3E56 A;  3IT4 B;  3NG0 A;  3KUZ A;  3ML8 A;  2XNA C;  3ZDM C;  3AE2 B;  1FNW A;  2MQJ A;  2JQR B;  2L8J A;  2WXJ A;  1CQV A;  3EA6 A;  1Y8R C;  2IGH A;  1ROE A;  1V1O A;  4TQ0 A;  2L7R A;  1OQQ A;  3RYT A;  3T9L A;  1WRD B;  4YL8 A;  4WJO A;  4DWF A;  1VZ8 A;  3PHX B;  3RFZ B;  3O65 B;  1WFY A;  3N1X C;  4ZRQ A;  4EE2 A;  1TTN A;  4KSL C;  4MEL A;  1HQR D;  3IG3 A;  4WIP A;  1MVK A;  4GN1 A;  5H8Y E;  3KW5 B;  3ML9 A;  2IO3 B;  1B9R A;  1WMH B;  2KX0 A;  2LJ5 A;  1YX6 B;  4TQ1 A;  3DOW A;  1R7S A;  2EEL A;  2NTS A;  1UNS A;  2WHI A;  2J4X A;  2FUH B;  3IXS A;  2CJO A;  2PPH A;  3NVW A;  3QCA A;  4X57 B;  3SEB A;  2QJL A;  4EUT A;  4TV3 A;  4YTP B;  2KNB A;  3WAP A;  3DVG X;  4BKT A;  5E6O A;  3KLS X;  1ZDX A;  3X0W A;  5EDS A;  2BT6 A;  3L16 A;  3N20 C;  2HTH A;  4EOY A;  3TEX A;  3DBS A;  2K6D B;  4GDK A;  1NYQ A;  3M62 B;  1MPE A;  4KGS A;  2I1J A;  2G9H D;  4ICU A;  2ACZ B;  3W9C B;  2BB5 A;  2ONQ A;  1XLO A;  4DHZ E;  4MAC A;  2ZCC A;  2XBB C;  4KKJ A;  2N4F A;  2CU3 A;  2LHE A;  2KDM A;  1V97 A;  5BMH A;  5HG2 A;  3P1M A;  4HJK A;  1TS4 A;  4FJV B;  4MM3 B;  4ZYS A;  3AE5 B;  3RNC C;  3URY A;  3W1S C;  3NVV A;  1Q10 A;  1BML C;  3FAH A;  4HCP B;  1E0Z A;  2EKE C;  2LWP A;  1TS2 A;  3TUO A;  2Z0E B;  2NBV B;  4B6W A;  4LNI A;  3N30 A;  3HRD D;  1LFD A;  1F52 A;  1IGC A;  4OZA A;  2V4L A;  3VXW A;  2NS5 A;  1NVI D;  1XD3 B;  3BII D;  2QIL A;  2LXC A;  1J7C A;  3ZDT A;  2R2O A;  5HKH A;  1GAQ B;  3GE8 C;  1V86 A;  1ESF A;  3L0W B;  2KMA A;  4USA A;  1D6E C;  3PLV A;  2C7H A;  3ZTC A;  3TL5 A;  3BYT B;  4II3 B;  4EEW A;  1QT9 A;  4OZB A;  1E6E B;  2HDE A;  2PLP A;  2JPH A;  3L13 A;  4AS1 A;  3ZYY X;  3PZD A;  3AEB B;  1XXG A;  3APC A;  1Q1O A;  3A9J B;  5MPO A;  1FM0 D;  2WXH A;  2KQS A;  1VCB A;  2LD9 A;  5IAA C;  4FBJ B;  1BT0 A;  3I5J C;  1MI0 A;  2V3P A;  4WQO B;  4JPS A;  1SE3 A;  3A1Q B;  4GSW A;  3W5V B;  1ZOY B;  4O1N A;  4WJP A;  4IWO A;  4PYU A;  4RM9 A;  4PK1 A;  1ENF A;  3AE9 B;  4MDK E;  4EZK A;  2CHZ A;  3Q3J A;  2B3A A;  3TEZ A;  3APF A;  2IGG A;  1JW9 D;  4HDO A;  4W9F A;  2WWZ A;  2V9H A;  3HM3 A;  2VH2 A;  2KQ7 A;  3ZUN A;  3SHQ A;  1XO3 A;  3EFU A;  1WXM A;  5KHQ A;  3RT3 B;  3IVF A;  1TGZ B;  1GC7 A;  2V1Y A;  3KYC D;  1TBE A;  3WAL A;  3EHV A;  1I7H A;  2AQ1 B;  2WU2 B;  3AEA B;  4CQN A;  1Q0W B;  3HHM A;  3DBH B;  4KGR A;  1OGW A;  4JWU C;  2BF8 B;  2GLS A;  4FHK A;  4FUL A;  2AL3 A;  1FMA D;  2BS4 B;  4JQW C;  1IPG A;  3TEW A;  3DDC B;  1JRP A;  3NS1 A;  4JL9 A;  1FNV A;  1L4D B;  4C4V A;  3KWL A;  4A8X C;  3LXF A;  2ZVO A;  2I2Y A;  5TSS A;  2ZW0 A;  1R4M I;  1SIF A;  4ZYN A;  4ICV A;  4WJQ A;  2AYO B;  5JZE B;  2IY0 B;  5TR5 A;  2FNJ B;  5IKC M;  1KH0 A;  3QAQ A;  5EE0 A;  3A9K A;  2WYQ A;  3BVG A;  2VZK B;  4DXG A;  4EZL A;  1RRB A;  2JY6 A;  1V1P A;  3CWI A;  3PZ8 A;  4YSZ B;  3HM6 X;  3U30 A;  3ZXR A;  4AP4 C;  1UH6 A;  3K9O B;  3ENE A;  1E8X A;  3PRZ A;  2MP2 B;  1N6Z A;  4RGM A;  1PGB A;  5HFY A;  3VTU A;  3DVG Y;  3AEF B;  1L5P A;  1FCL A;  1JWA D;  1L0V B;  3UF8 A;  2N9L A;  2JUO A;  2E3T A;  3ZLZ A;  3PVL A;  1CJE A;  4WWN A;  4G3X B;  1WM3 A;  4YSX B;  1VR9 A;  1AAR A;  1T0R C;  2DYO A;  1JWU D;  1ZPS A;  3IAM 1;  1K51 A;  2JRH A;  2JWZ A;  4ZOH C;  3PPA A;  4DDI D;  3OG5 A;  3CST A;  3RN9 C;  4S17 A;  4WAA A;  2B76 B;  2DHZ A;  4MEM A;  3CSF A;  1EF1 A;  3V62 A;  1OQR A;  4JWS C;  3AE6 B;  1N60 A;  2IY1 B;  5CTR C;  4A20 A;  4HKQ A;  2GBK A;  1RFA A;  3LB8 C;  2DLB A;  4DHJ D;  2NMQ A;  3ABV B;  1K52 A;  3Q2A C;  5J18 A;  4DXA B;  3LJ3 A;  1CZP A;  3Q3M C;  3ZNH B;  4REZ A;  4IKG A;  5IP4 D;  3KVF B;  2SEB D;  5FKA C;  3KQ4 A;  3DHG C;  1T0Y A;  2WU5 B;  2QSD A;  2K5P A;  4HPM B;  2MCN B;  3AE8 B;  4RGO S;  3AB5 A;  1MG8 A;  2WQY B;  3MFG A;  1WXS A;  2JXT A;  2HJ8 A;  1SSN A;  1WZ3 A;  1PYW D;  3HIZ A;  1P3Q U;  3B2G A;  2PMV A;  1A70 A;  2KVR A;  3ZW3 A;  4MGZ E;  1PGX A;  1PQS A;  4KKI A;  1TT5 B;  4PT5 A;  2MLB A;  2VH1 A;  1SE2 A;  2IDY A;  3ALB A;  4M0W A;  3P2B A;  4HCN B;  2WLB A;  1E5W A;  1JRO A;  1RAX A;  3Q8E A;  2KTR A;  5H92 C;  4N58 A;  2JZ3 B;  2WS3 B;  1YJ1 A;  3DBL I;  3Q8F A;  5FR3 A;  4WJN A;  1Y56 A;  3N1Z C;  1PUT A;  1SBB B;  1XEE A;  4OVZ A;  3AMZ A;  1WGY A;  1BUI C;  1TYG B;  3B08 A;  4LNK A;  1H4R A;  1ZXI A;  4ZDV A;  1EU4 A;  1P1A A;  2V4I B;  5E6N A;  3Q8C A;  2E6X A;  5E6J A;  1IYF A;  1XCT L;  1KLU D;  1UZX B;  4FAD A;  2JX5 A;  4ZHO A;  2LUE A;  3AH7 A;  1V5T A;  1L6U A;  3BVM A;  2DZJ A;  2W82 A;  1ZW7 A;  3TJP A;  3VQI A;  1VDV A;  4F7Z A;  2LHD A;  1GUA B;  1V80 A;  1QOB A;  2RSU A;  2C7M B;  5J2R A;  3ZVV A;  3V6E B;  3V60 A;  1D5M C;  1YJI A;  2QCZ A;  1ZXH A;  3OWE B;  3NVY A;  1A5R A;  1I4G A;  3DPD A;  4BAX A;  1SB3 C;  2Z8L A;  3IT6 B;  3SDL C;  4I6P A;  1YN3 A;  2N1V A;  1VZ7 A;  4N59 A;  2LGS A;  2D10 A;  1F77 A;  3PRE A;  1LGR A;  2WXM A;  2NPT B;  2J7Q B;  5L95 C;  5LLI A;  1I4H A;  2G45 B;  4RNA A;  3GB1 A;  3WAO A;  5D3I B;  3GE3 C;  3JSV A;  1TY2 A;  3DQV A;  4DBG A;  1F2R I;  1FO4 A;  2M0A A;  1I4P A;  2PEA A;  2G1E A;  2QMT A;  4F8C B;  4ZHP A;  3W1S A;  2CHX A;  2KXJ A;  4BKS D;  3H7P B;  4MGI E;  2K3U A;  4HPL B;  2C7N B;  2N9K A;  5CX3 A;  2LGI A;  4L2Y A;  2KFK A;  1I4R A;  2J53 A;  3N3K B;  2PVG C;  2MBB B;  3GZN I;  2SAK A;  2K1F A;  2M8S A;  2XN9 C;  1HEZ E;  3M3J A;  4RF1 A;  2R61 A;  2AQ2 B;  2CJN A;  2Y5B B;  4DXF A;  2REX A;  1I42 A;  2HD5 B;  2KLC A;  4C80 A;  2W54 A;  1B1Z A;  4KDI C;  4HXD A;  2LRU A;  1SE4 A;  2D2Q A;  3ZKJ C;  1Q5W B;  4W9H A;  3RUL A;  2XK5 B;  2KTF A;  2Z0D B;  2I1K A;  3QX1 A;  4L1B A;  4M0W B;  2V0G A;  5C3J B;  1SEB D;  1P7F A;  3QIJ A;  2FCQ A;  3R66 C;  4BBN C;  2J0J A;  1RFK A;  1DOI A;  2LMC A;  2V3S A;  4IWQ A;  3H6N A;  3EFC A;  3R8B A;  4ANV A;  1KLG D;  1D3Z A;  2FAZ A;  1K8R B;  1XF5 L;  4YXD B;  3C8Y A;  2MJE A;  1TY0 A;  3GP7 A;  4BBN F;  1GOZ A;  3VVW B;  2N1W A;  4C7Y A;  3MJ5 A;  2YVC A;  3DVN U;  3AE7 B;  1SGH A;  1YJJ A;  3AEC B;  2KO3 A;  1QLB B;  1IGD A;  2JZP A;  1J7A A;  4W9E A;  5T8I A;  1FEH A;  1WR6 E;  4C56 C;  4KV2 A;  1G6J A;  2MBQ A;  1QOG A;  2Y3A A;  1WE7 A;  2BB6 A;  2M1M A;  5BYQ A;  3NZS A;  2ASQ A;  4CYE A;  3IAS 1;  5C2T B;  2MP2 A;  3PRM B;  3TEY A;  2PVO D;  4FN2 A;  2FID A;  4MJS B;  3AE1 B;  2L52 A;  1WE6 A;  5DPT A;  3AXC A;  4A3P A;  5JHB A;  1K50 A;  1YIW A;  2D3G A;  2KOX A;  4XC2 A;  5HHD G;  4ACF A;  2KJ6 A;  4JGH B;  1N63 A;  4W9D A;  3A4R A;  5JHA A;  1TKY A;  4K7U A;  1FCC C;  3FIL B;  2MJD A;  4M02 A;  3UGB B;  3EGR A;  3R2T A;  3U2S C;  2BTE A;  1WI0 A;  2MX2 A;  1QKZ A;  4XWW A;  1PDX A;  4EKU A;  4GMV A;  3C19 A;  3P4R B;  3B2F A;  3AV8 A;  1FXT B;  2WDT B;  2CU1 A;  2AX5 A;  4J3O D;  3L10 B;  4YSY B;  1C78 A;  3A9K B;  2IO0 B;  1QQR A;  4OW0 A;  1ZGU B;  2YLM A;  2DAF A;  4B0E A;  1QOA A;  4M8N A;  2M56 B;  2L32 A;  1F2R C;  2J42 A;  3H7P A;  3OJ4 B;  3Q6B A;  2GMI C;  5C1Z A;  3ZJV A;  5AUK A;  1JAL A;  3ONS A;  4LCD E;  1MHH E;  1IBX A;  2W3R A;  2JT4 B;  2L83 A;  2DZM A;  2NCN A;  3B0A A;  2BYF A;  2UWQ A;  3P4P B;  3ZIM A;  3MHZ A;  1JQ4 A;  2G4S A;  4NAW A;  1N61 A;  1FD6 A;  4I6L B;  1E9M A;  1HXY D;  2PE9 A;  2ZCB A;  2KN4 A;  3PZ7 A;  2N0S B;  2IGD A;  3DBH I;  4WWM A;  4FJY A;  4NAM A;  3U7D A;  3VR9 B;  1OTR B;  3BK2 A;  2KAC A;  4ANX A;  2IO1 B;  3ZNG C;  1X1M A;  2RR9 A;  2IND C;  4BKS A;  3T8M A;  3ZRC A;  4E3C A;  2XEW A;  3JVZ X;  4RGT A;  1JML A;  1WF9 A;  2RPV A;  1WXQ A;  4NJ7 A;  3PSE B;  3RNF C;  2INN E;  3U8Z A;  2KKC A;  2I38 A;  3TIX A;  1ZDV A;  5D94 A;  1GG3 A;  4WAF A;  1N62 A;  2K25 A;  1P98 A;  3B9J A;  4GDL B;  3AE4 B;  2KYW A;  3RNA C;  3HK0 A;  1I4Q A;  4N6E B;  3A33 B;  1LO5 D;  1C3T A;  1ISN A;  1AWD A;  3P4Q B;  1KOT A;  4WH4 A;  2GBN A;  1EM7 A;  1F9J A;  5D2M B;  3MP9 A;  3NHE B;  5G5H A;  4JLC A;  4CHK A;  1NI3 A;  3OLM D;  2LVP A;  4KDL B;  4GB9 A;  1GJZ A;  2IJ0 A;  4RGN A;  4GLS C;  2WXL A;  3RZF A;  3NVZ A;  2JXX A;  1E8Z A;  2K22 A;  3HVD A;  1T0S C;  2AEH A;  2BW2 A;  5IOI A;  4XDC A;  4P16 A;  2DWQ A;  1C4C A;  2WXN A;  2FCS A;  3Q8B A;  2OJR A;  4ANW A;  2KWU B;  1YX5 B;  2LZ6 A;  2LJI A;  2DEN B;  2O2V A;  2L3Z A;  4URK A;  2O6V B;  2MW5 A;  2WXK A;  2MBO A;  4TMA B;  1WYW B;  1C4A A;  5BMG A;  5LXI B;  4YTM B;  2WXR A;  3N9Y C;  3VAW A;  3OJ3 A;  1N5X A;  4FHJ A;  4J6I A;  2IYD B;  5L83 A;  4D2K A;  3PLU A;  4PS3 A;  2TSS A;  2FBW B;  4DK5 A;  2BKF A;  1DOX A;  2KFJ A;  2ZNV B;  2JVC A;  4TKN A;  2Y5P A;  1D5Z C;  3V3X A;  1KLV A;  2KN5 A;  1S3S G;  3UIO B;  1U4A A;  2GBJ A;  3APD A;  1T3Q A;  2IBI B;  3WIM A;  5J17 A;  2KFK B;  4FJZ A;  3DWG C;  4HVB A;  4K7W A;  2LI5 A;  3C0R B;  3UQA A;  1WY8 A;  2MJ3 A;  3L54 A;  1C1Y B;  4KZ0 A;  4K3B A;  1YN5 A;  3ZNZ B;  3DBR B;  4M01 A;  5AZG A;  3R7Q A;  2DZK A;  2RD0 A;  2FCM A;  4GDK B;  4XZ4 A;  3IBE A;  1FIQ A;  4WWP A;  3KWV A;  1R4M B;  4TUU A;  4GXB A;  1UBI A;  2N9P C;  1JWS D;  4LDT B;  3JW0 X;  2CR5 A;  1LM8 B;  4AWJ A;  3H8H A;  4FA6 A;  3ZJT A;  2JSV X;  2WXO A;  2KAN A;  2WDQ B;  3WAM A;  5DPR A;  3I57 A;  1KM7 A;  4NY0 A;  4RMA A;  3BWU D;  4BZA A;  4LNF A;  1UUP A;  3HUI A;  2KWC A;  4NJC A;  3MJW A;  2KJH B;  1RLF A;  1F1H A;  2MWS B;  4KZC A;  2KDB A;  5IN7 A;  4AQ7 A;  2J52 A;  3M95 A;  3QJZ A;  1XLP A;  3ECI A;  4FXC A;  3VH4 B;  5C23 A;  2O6V D;  2XK5 A;  5GMV A;  3VTW A;  2GI9 A;  2KWV B; 
#chains in the Genus database with same CATH homology
 1E7U A;  4KIK A;  4HPL B;  4EFO A;  2C7N B;  2MBH A;  1IP9 A;  5CX3 A;  4MJS A;  4GOC A;  5JH5 C;  3W1S C;  2Z59 B;  3X23 A;  2KFK A;  3VUY A;  2MRP A;  3JSV B;  2BWE S;  2J0M A;  3N3K B;  4W9J A;  2DAJ A;  4G0N B;  2MBB B;  1EO6 A;  3KYD D;  2ZZP B;  3GZN I;  2M4N A;  2K8C A;  1V49 A;  1UEL A;  2K1F A;  1WXA A;  2M8S A;  2ZJD A;  4HCP B;  2L0F A;  2EKE C;  3LDZ E;  2PE6 B;  3M3J A;  2O2V B;  2Y5B B;  2LWP A;  4K81 A;  4IC7 B;  2KK8 A;  4DHJ B;  2REX A;  2BWF A;  1I42 A;  3A9J A;  2HD5 B;  4MGK E;  2KLC A;  4NPN A;  5G2N A;  4I6N B;  4K1R B;  2Z0E B;  4BVU C;  3VUX A;  2NBV B;  4B6W A;  4ZRI A;  2G4D B;  3N30 A;  4HXD A;  2LRU A;  4KDI C;  2D2Q A;  1WZ0 A;  2KLG A;  3ZKJ C;  1Q5W B;  1LFD A;  2D11 A;  2BYV E;  2JRI B;  2XK5 B;  2KTF A;  2Z0D B;  2I1K A;  3A1Q A;  4W9H A;  2V4L A;  3QX1 A;  2KDF B;  4WWO A;  3VXW A;  2NS5 A;  1WGG A;  4AUQ C;  1XD3 B;  4MM3 A;  4OVU A;  4AJY B;  4M0W B;  1E90 A;  2LXC A;  2FCQ A;  3QIJ A;  3ZDT A;  2KC2 A;  3R66 C;  4BBN C;  2R2O A;  2UYZ B;  2J0J A;  2JF5 A;  2RPQ A;  5HKH A;  3A4S C;  3RUI B;  3AU4 A;  3TBL D;  1V86 A;  5CHW A;  4IWQ A;  2V3S A;  1GC6 A;  3L0W B;  4FLH A;  3UIN B;  4NAW B;  2KMA A;  3H6N A;  2N9X A;  2BYE A;  2D07 B;  4LJO B;  4ANV A;  1D3Z A;  2FAZ A;  1NBF C;  3D32 A;  2W9N A;  3PLV A;  1K8R B;  2C7H A;  3PRP B;  4NQK E;  3TL5 A;  3ZTC A;  3GOE A;  4BBN F;  4II3 B;  3EC8 A;  3VVW B;  1VD2 A;  2N1W A;  4EEW A;  1V81 A;  2YVC A;  4W9G A;  4MSQ B;  3DVN U;  2KTR B;  1SGH A;  1EUV B;  3QWZ B;  5KHO A;  3CMM B;  2KO3 A;  3BIN A;  2JPH A;  3L13 A;  3PT2 B;  4W9E A;  3PZD A;  1WR6 E;  4HDQ A;  3APC A;  5DCN A;  2G3Q B;  1Q1O A;  2AWT A;  2GBM A;  2WX0 A;  3A9J B;  4MH0 E;  4KV2 A;  1G6J A;  2MBQ A;  2KQS A;  5D7G A;  1VCB A;  1WE7 A;  2M1M A;  2LD9 A;  5IAA C;  4FBJ B;  3NZS A;  1LXD A;  4OVV A;  2KZR A;  2M0X A;  2KC1 A;  1BT0 A;  3K9P B;  4W9I A;  2ASQ A;  4CYE A;  4WQO B;  3DBR I;  4GSW A;  3A1Q B;  2MP2 A;  2N9E B;  3PRM B;  4FN2 A;  4LDT D;  2FID A;  2L05 A;  4MJS B;  2RGF A;  2K39 A;  3VDZ A;  1WE6 A;  4EZJ A;  2J0K A;  3QHT A;  4WJP A;  3R3M A;  3QQ8 B;  4IWO A;  2LVQ A;  3AXC A;  4PYU A;  5DPT A;  4A3P A;  1EF5 A;  5JHB A;  4RM9 A;  1YIW A;  2D3G A;  2KOX A;  2L76 A;  4XC2 A;  3SD5 A;  4AJW A;  4MDK E;  4EZK A;  2N7D A;  2C9W B;  2EMS A;  2IO2 B;  2KJ6 A;  4JGH B;  2CHZ A;  4B95 A;  3Q3J A;  3UQB A;  2B3A A;  2QHO A;  2AL6 A;  3V61 A;  4W9D A;  3A4R A;  2R2Q A;  5IA7 A;  5JHA A;  3APF A;  4E71 A;  4HDO A;  4W9F A;  4HLE A;  5FR6 A;  3Q3F A;  2WWZ A;  4K7U A;  3HM3 A;  4II2 B;  3UGB B;  4LJP B;  5G55 A;  2LGY A;  2KQ7 A;  3ZUN A;  3SHQ A;  3VUW A;  1E8W A;  3EFU A;  1WI0 A;  2L0T A;  4KVG B;  1WXM A;  2MX2 A;  3PGE A;  2K8B A;  5KHQ A;  4PS7 A;  3H1U A;  3RT3 B;  1I35 A;  3QAR A;  3IVF A;  4EKU A;  4GMV A;  1TGZ B;  1GC7 A;  2HE7 A;  2LGX A;  2V1Y A;  3KYC D;  1YD8 U;  1TBE A;  1FXT B;  3WAL A;  3EHV A;  4NJ6 A;  3V6C B;  2WDT B;  2CU1 A;  4GDL A;  1Q0W B;  3HHM A;  2KHW B;  5LXH A;  3AI5 A;  3L10 B;  1OGW A;  3A9K B;  2MSE D;  2BF8 B;  2IO0 B;  2N7E A;  1WM2 A;  4FHK A;  3RUL A;  1ZGU B;  3ZRF A;  4FUL A;  2YLM A;  2DAF A;  2KX3 A;  2AL3 A;  2ZNV C;  4M8N A;  3KUC B;  3M63 B;  1V9J A;  4HK2 A;  1P9D U;  3I3T B;  3H7P A;  3OJ4 B;  4JQW C;  1H8C A;  3W1Y A;  1IPG A;  2GMI C;  2NBW B;  3DDC B;  5C1Z A;  1LQB A;  1R4N I;  4JL9 A;  1UBQ A;  1YQB A;  2ZVN A;  3ONS A;  4W9K A;  4ASW C;  4LCD E;  2JT4 B;  2NCN A;  2DZM A;  3TMP B;  4IWP A;  3B0A A;  2BYF A;  2JZZ A;  2A5U A;  2UWQ A;  2ZVO A;  3ZIM A;  1R4M I;  2EMT A;  2KDI A;  2G4S A;  1SIF A;  1L7Y A;  4NAW A;  4W9C A;  3PHW B;  1WX7 A;  4ZYN A;  2KDE B;  4ICV A;  4WJQ A;  3VFK A;  3IHP C;  2AYO B;  4I6L B;  5JZE B;  1WGD A;  4IM3 A;  2K6Q A;  2IY0 B;  5TR5 A;  2FNJ B;  2BKR B;  2PE9 A;  2DZI A;  2ZCB A;  3QAQ A;  2OOB B;  1WJU A;  3A9K A;  2WYQ A;  5DPW A;  1TZ1 A;  2C60 A;  3DBH I;  2WX1 A;  3WA0 A;  4FJY A;  1Z5S B;  5AZF A;  1WGR A;  1QZE A;  4EZL A;  3U7D A;  1RRB A;  2JY6 A;  1KJT A;  2M17 A;  1V2Y A;  2FCN A;  1OTR B;  2IZV B;  3NZU A;  5AEK B;  2BGF A;  2KJR A;  1V5O A;  4ANX A;  2IO1 B;  3ZNG C;  2O6V A;  3SU8 X;  3HM6 X;  3U30 A;  3H9D A;  4AP4 C;  1UH6 A;  3K9O B;  1X1M A;  2K8H A;  2RR9 A;  3ENE A;  4BKS A;  1E8X A;  3PRZ A;  5E6P A;  3T8M A;  3ZRC A;  1NI2 A;  4E3C A;  5CHV C;  1XT9 B;  1WJ4 A;  2XEW A;  3CF6 E;  1V6E A;  3JVZ X;  1WJN A;  2MP2 B;  1SE9 A;  2C5L C;  2MBE A;  3NS8 A;  1UD7 A;  1E8Y A;  1XQQ A;  4NQL B;  3VH3 B;  1WF9 A;  3VTU A;  2LGD A;  3DVG Y;  3TCA A;  1P0R A;  4NNJ B;  3RCZ A;  1JRU A;  3IFW B;  4NJ7 A;  3PSE B;  4IM2 A;  5AZH A;  3U8Z A;  2KKC A;  4BFR A;  3TIX A;  2LVO A;  3UF8 A;  3ZTD A;  2JUO A;  5D94 A;  1GG3 A;  1OEY J;  3QK0 A;  3ZLZ A;  4DHZ B;  3PVL A;  4GU2 A;  4WWN A;  3DCG A;  1WH3 A;  4G3X B;  2K25 A;  2DYB A;  1WM3 A;  1AAR A;  1P98 A;  1WIA A;  2DYO A;  4GDL B;  2GBR A;  4W9L A;  1J0G A;  2JRH A;  2JWZ A;  4ANU A;  3PPA A;  4IUM B;  3ZO5 B;  4DDI D;  3H7S A;  3DVN V;  3HK0 A;  3CST A;  3PS6 A;  1UGM A;  1J8C A;  4WAA A;  2DHZ A;  3BY4 B;  3PV1 A;  1GNU A;  2ZEQ A;  3A33 B;  4MEM A;  1C3T A;  3OAW A;  1ISN A;  3CSF A;  1KOT A;  1EF1 A;  3V62 A;  1OEY A;  1S1Q B;  2GBN A;  2IY1 B;  1F9J A;  3AUL A;  5CTR C;  5D2M B;  3NHE B;  3EEC A;  3RZW C;  2NR2 A;  2A4Z A;  4JLC A;  4A20 A;  4CHK A;  4DDG D;  3RD2 A;  3OLM D;  2L00 B;  2GBK A;  1RFA A;  2LVP A;  4G50 A;  4KDL B;  4GB9 A;  2FIF A;  4B9K A;  4DHJ D;  1GJZ A;  3N32 A;  4IW0 A;  3WAN A;  5J18 A;  2NVU I;  4DXA B;  4K7S A;  3LJ3 A;  3RZF A;  4N9F 4;  1E7V A;  3ZNI D;  3ZNH B;  5DPS A;  2GOW A;  1CMX B;  1WX9 A;  2JXX A;  3KVF B;  2BPS A;  4IG7 B;  4MSM B;  4G11 A;  1E8Z A;  4A3O A;  1WR1 A;  2AEH A;  1ZKH A;  1T0Y A;  3VHT C;  4KSK C;  4HPM B;  1WJ6 A;  2ZPN A;  2MCN B;  1L2N A;  2LRW A;  2DX5 B;  2KD0 A;  4AOF A;  3R7R A;  2FCS A;  1MG8 A;  2OJR A;  4ANW A;  1OQY A;  2KWU B;  4MGY E;  1YX5 B;  2LZ6 A;  2DEN B;  1WXS A;  4M8M A;  2O2V A;  2L3Z A;  2HJ8 A;  4URK A;  3NOB A;  1WZ3 A;  2O6V B;  2MW5 A;  3HIZ A;  2ZPY A;  4RM8 A;  2MBO A;  1P3Q U;  1WYW B;  4F1S A;  4BOS C;  5LXI B;  3KUZ A;  3ML8 A;  1NDD A;  3ZDM C;  4BKG A;  2KVR A;  3ZW3 A;  4MGZ E;  2MQJ A;  2DYM A;  1PQS A;  3AU5 A;  4KIK B;  3KUD B;  4BOZ B;  3VAW A;  4HWI B;  2MLB A;  1WXV A;  2L8J A;  3OJ3 A;  3ALB A;  2CKH B;  1WGH A;  5BO4 B;  4FHJ A;  3P2B A;  5CHF A;  4HCN B;  1Y8R C;  4J6I A;  2IYD B;  5L83 A;  3PLU A;  1E5W A;  4PS3 A;  3S2A A;  4GIV A;  4DK5 A;  2BKF A;  1RAX A;  4TQ0 A;  2KTR A;  2L7R A;  2KFJ A;  3RYT A;  2JZ3 B;  1WRD B;  1YJ1 A;  2ZNV B;  3DBL I;  4YL8 A;  4ZRK A;  3T9L A;  2JVC A;  4WJN A;  4TKN A;  3L17 A;  4WJO A;  4DWF A;  3PHX B;  1KLV A;  2KN5 A;  1S3S G;  3UIO B;  1WGY A;  2LAS A;  1Z2M A;  1U4A A;  3O65 B;  1WFY A;  2GBJ A;  3APD A;  3B08 A;  1H4R A;  1TTN A;  2IBI B;  2CS4 A;  3WIM A;  4KSL C;  4MEL A;  4ZDV A;  1P1A A;  5E6N A;  5J17 A;  2KFK B;  2NPT A;  3UIP B;  3IG3 A;  4XX5 A;  2CHW A;  4FJZ A;  4P7I A;  4HVB A;  4GN1 A;  4K7W A;  3KW5 B;  1IYF A;  2LI5 A;  3C0R B;  3ML9 A;  2VRR B;  3QA8 A;  2IO3 B;  3UQA A;  1WY8 A;  3L54 A;  2NBU A;  1WMH B;  3MTN B;  1C1Y B;  2KX0 A;  1UZX B;  2LJ5 A;  4JIO U;  4KZ0 A;  4FAD A;  3QC8 B;  4IM0 A;  1YX6 B;  4TQ1 A;  3DOW A;  2LUE A;  3JYU A;  3ZNZ B;  1V5T A;  3L08 A;  5AZG A;  2DZJ A;  2PJH A;  1ZW7 A;  3R7Q A;  3TJP A;  4ZRJ A;  2DZK A;  2FUH B;  2RD0 A;  3VQI A;  2FCM A;  4F7Z A;  2PPH A;  1GUA B;  1V80 A;  2RSU A;  3QCA A;  4GDK B;  2C7M B;  4GGQ A;  4CO7 A;  4XZ4 A;  3ZVV A;  5J2R A;  3IBE A;  1HE8 A;  3V6E B;  4X57 B;  4WWP A;  3V60 A;  4TUU A;  4EUT A;  3B1L X;  4GXB A;  4PYZ A;  1UBI A;  4TV3 A;  2KNB A;  1M94 A;  2MA9 B;  3WAP A;  1A5R A;  2N9P C;  3DVG X;  4BKT A;  5D6J B;  4LDT B;  4E74 A;  3DPD A;  3JW0 X;  5E6O A;  2CR5 A;  1LM8 B;  4PS8 A;  4AWJ A;  4FA6 A;  2KAN A;  3X0W A;  1WMH A;  5EDS A;  3WAM A;  3L16 A;  3SDL C;  5DPR A;  4EOY A;  2HTH A;  1KM7 A;  2N1V A;  3DBS A;  4I6P A;  2K6D B;  4NY0 A;  4RMA A;  4GDK A;  3M62 B;  3PTF C;  2D10 A;  2I1J A;  3PRE A;  4ICU A;  2KWC A;  2NPT B;  3MJW A;  2KJH B;  1RLF A;  3NY5 A;  2J7Q B;  5L95 C;  5LLI A;  2MWS B;  4KZC A;  2KDB A;  2LXA A;  2G45 B;  4DHZ E;  3WAO A;  2KMC A;  3JSV A;  3M95 A;  3QJZ A;  3DQV A;  1WX8 A;  4DBG A;  2ZCC A;  3ECI A;  2XBB C;  2PEA A;  3VH4 B;  1J19 A;  2N4F A;  5C23 A;  4F8C B;  2O6V D;  2XK5 A;  3W1S A;  5GMV A;  3KH0 A;  3VTW A;  4HJK A;  2CHX A;  4FJV B;  2KXJ A;  3MHS D;  4BKS D;  3H7P B;  4MGI E;  3VTV A;  2KWV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...