1C9FA

Nmr structure of the cad domain of caspase-activated dnase
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
87
structure length
87
Chain Sequence
MCAVLRQPKCVKLRALHSACKFGVAARSCQELLRKGCVRFQLPMPGSRLCLYEDGTEVTDDCFPGLPNDAELLLLTAGETWHGYVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CASPASE-ACTIVATED DNASE
publication title Structure of the CAD domain of caspase-activated DNase and interaction with the CAD domain of its inhibitor.
pubmed doi rcsb
source organism Mus musculus
total genus 10
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c9fA00
5HHDG 1K50A 1UWXA 2ZW0A 2ONQA 4OZCA 5BMIA 1MHXA 1P7EA 1F2RC 1HZ5A 2ON8A 2LHEA 1XF5L 4HJGE 1MVKA 1ZXHA 2EELA 5BMGA 2LHDA 2PW9A 1Q10A 1P7FA 1FCLA 1IBXA 3FILB 2RMMA 1HEZE 2I38A 5HG2A 1IGDA 2N7JA 4IOIE 2NMQA 4KGSA 1KH0A 1XCQL 2JXTA 1IGCA 1EM7A 2J53A 2N9KA 3V3XA 1QKZA 4KGRA 3UI3A 2IGGA 1PGBA 4KGTA 2K0PA 1K51A 1XCTL 2KQ4X 2QSDA 1K52A 2JSVX 1PGXA 1MHHE 2KACA 1MPEA 2LGIA 4HKZE 1YMHE 1MI0A 3GB1A 5HFYA 2N9LA 2QMTA 2LUMA 4D2KA 1GB4A 5BMHA 1IBXB 1PGAA 2I2YA 4GLSC 1FCCC 2J52A 3MP9A 4OZAA 1C9FA 1GB1A 2OEDA 2GB1A 2KDMA 2JWUA 4OZBA 1HZ6A 2IGDA 2PTLA 2JU6X 1YNTE 1D4BA 2KWDA 4IKGA 5HI1A 2IGHA 2GI9A 5JXVA 4MACA 2KN4A 2PLPA 1F2RI 1FD6A 2JZPA 2RPVA 2ZW1A 3FILA 1JMLA 1K53A 4WH4A
chains in the Genus database with same CATH superfamily
5HHDG 1WE6A 2WXFA 4PT5A 2JPHA 3AE1B 4CHKA 1A5RA 2IO3B 1H8CA 2LRWA 3W1SC 4LDTB 4F7ZA 4RGMA 2KVZA 1JQ4A 1TIFA 3W9CB 5H92C 4JLCA 3NVWA 1E8YA 3WALA 1Q10A 1QILA 3A4SC 3Q8BA 3MFGA 4G11A 3TSSA 5CHVC 1EF1A 4NQKE 3NG0A 2JXTA 1Q1OA 4HKQA 4PS7A 2KX0A 3PHXB 2K0PA 1K51A 1MHHE 4PYZA 2R61A 3H7PA 3GB1A 1WFYA 1ZUD2 3Q8CA 4C00A 1RWSA 1GPXA 4HPPA 2ZNVC 2L32A 3PZ8A 4WIPA 5E6OA 2AX5A 2LGXA 1DGJA 3KVFB 1JWBD 3VUXA 3EFUA 3VHTC 2VZKD 1C9FA 2NCNA 2JYTA 1WXMA 4GDLB 2JWUA 3BVZA 4HVBA 1ET6A 1PYWD 4DWFA 5IP4D 1ZDVA 1GC7A 4MELA 2BQQA 3PGEA 1FO4A 3DHIC 3U8ZA 3H6NA 3RZWC 4NJ6A 3ZDTA 3AE4B 2LD9A 4KX6B 4I6PA 1L7YA 2MH7A 4ZRJA 1L4ZB 4WWNA 2REXA 3B1LX 1SE4A 2BT6A 3PRMB 1F0ZA 3ZLZA 5CX3A 1YIWA 1KJTA 2KX3A 1N5XA 4RCOA 3GS2A 1E7UA 2LRUA 1YN5A 2D5GA 2KO3A 4OVVA 1VLBA 1V5OA 3QCAA 5EE0A 2EELA 1G6JA 4OVUA 1EUVB 3I5JC 2WU5B 2YEPF 1L2NA 2KWVB 2BB5A 4OW0A 3VFKA 1N63A 4MSQB 3ZXVA 4XC2A 2K6DB 2KD0A 2WXKA 2J53A 4GB9A 3ZUNA 1TS2A 3UI3A 2Y3AA 1L6UA 3ML9A 1I4HA 3I3TB 4NZLB 1C4AA 1ENFA 3VRAB 2WDRB 1DOXA 2QMTA 2D3CA 3IVFA 2Z0DB 2J0MA 2K22A 1Q5WB 3PLVA 3RYTA 4KV2A 4GLSC 1FM0D 4PYUA 2SAKA 3MHZA 3PVLA 2PEAA 4DHJD 4HDOA 2AEHA 4W9CA 2BS2B 2Y5BB 1J7BA 3BIID 3QARA 2JX5A 2KC2A 1STEA 1F2RI 2KMMA 1WZ3A 2WXRA 4M00A 2LVPA 2A5UA 4JPSA 3IAS1 5L83A 5AZHA 4GU2A 2RPQA 3I9V1 3W5VB 5LXIB 3NZ3A 3U52E 2JF5A 4DBGA 3VH4B 1FRDA 2ZNVB 4K3BA 2V4IB 1R7SA 4MJSB 2LMCA 3RN9C 5KHOA 2WXNA 4P16A 1IGDA 1QOFA 1VCBA 2LASA 2UYZB 4BFRA 1V9JA 1T5XD 4N58A 2IY0B 3DBLI 4A6QA 2WYQA 4GDLA 2GOWA 2KMAA 4E71A 3V62A 2C7NB 2J4XA 1FFVA 2DYBA 3VR8B 4EEWA 1K52A 2LXAA 3ZRFA 1RFAA 4KIKA 4O1NA 2LFIA 2K8HA 2ACZB 5HFYA 1WI0A 2N9LA 3OG5A 3MJ5A 1YN3A 3HM3A 1PUTA 1IBXB 3MJWA 4AP4C 3BYTB 4LTUA 2IO1B 3ZGZA 4OZAA 2KVRA 1WH3A 2LI5A 3M95A 1E0ZA 2KDMA 2D2QA 2D11A 1XXGA 2K5PA 4TKNA 1HZ6A 4K7WA 5LLIA 2HTHA 3QWZB 2CU3A 1V2YA 1UD7A 4W9IA 2N9EB 1N60A 1WIAA 3AU4A 4MH0E 4MGIE 1GOZA 2BGFA 2MA9B 4FHKA 1C76A 2V3NA 4AQ7A 1V6EA 2JZZA 3QA8A 2NVUI 3QHTA 4EOYA 2TSSA 2K39A 1T0SC 5J17A 4OZCA 1P7EA 1DOIA 2BBCA 4L1BA 1WYGA 2IZVB 3OWEB 3ZNGC 2LHEA 2CR5A 1JROA 1UF0A 2K6QA 3IG3A 3L10B 2BF8B 1IUEA 1QOBA 1AWDA 1ZE3D 4L23A 3BK2A 1F9JA 2RDBC 5HG2A 2O6VA 4TUUA 3W1SA 3VDZA 1KH0A 3AB5A 1IYFA 1SF0A 3D32A 2M1MA 1D5ZC 2D3AA 1V97A 3B08A 2GBKA 3K9PB 1TS4A 1V86A 4JWSC 1WRDB 1UWMA 2OOBB 1EWCA 2G4SA 2KTRA 2LGIA 3N20C 3V60A 1YX5B 4A8XC 2MBQA 3B0AA 4ZRPA 4D2KA 2WS3B 2LGDA 5BMHA 4WWPA 4LNFA 2K25A 2RGFA 4URKA 1ISNA 3A1QB 2IGDA 1YNTE 3PO0A 4RGOS 1WJ4A 1V1PB 4TQ0A 1TKEA 4S0RA 3DHGC 4BKSD 4XDCA 1HQRD 1WWTA 3APDA 3T3NA 2LJIA 2RD0A 2L0FA 2JUOA 1KLUD 3BVGA 4ANUA 4C7YA 1RFKA 1TKGA 1ACCA 2V4LA 4WH4A 1DYQA 1E10A 3CMMB 2X8XX 3GE3C 4EFOA 1YOVB 1UWXA 2ZW0A 2MW5A 3KUCB 4IC7B 2OJWA 1C77A 3L17A 3R2IA 1LFDA 3QIJA 2ON8A 3NY5A 1WJ6A 3IT4B 1E6EB 4DQOC 2HD5B 3VQIA 1XQQA 1OTRB 4C4VB 4N59A 2BTEA 1OFFA 2KFKB 1IBXA 2LUEA 2RMMA 3BWUD 1JWSD 1D6EC 4YSZB 2W54A 3P4RB 3A4RA 3WIMA 2QJLA 2DLBA 2FCSA 2L1AA 3N9YC 3M63B 2K3UA 3V3XA 4MSMB 2NBWB 2V3PA 4KGTA 1VDVA 1FFUA 1ZP0B 3RFZB 2IBIB 2INCC 4ZYSA 4YXDB 1YMHE 1WYWB 3VTVA 1MI0A 4US8A 1YJIA 1N6ZA 4BAXA 2WXJA 3AEGB 1RLFA 2DHZA 4R3DA 3KH0A 1CQVA 4KDLB 2FUG1 4PS3A 2BVCA 3GZNI 3MP9A 1I4XA 3PZ7A 3B2FA 1DOYA 3R3MA 5CTRC 1LQBA 3Q8FA 4H2AA 4KKJA 2JU6X 5DPWA 1I35A 2N1VA 1TKYA 5EE3A 5JXVA 2IYDB 2W82A 4HXDA 2C5LC 1KTKA 1GNUA 1WXAA 1BXTA 3AE8B 2AQ3B 4M01A 4DHZE 1A70A 1KLVA 1MFWA 3WA0A 4C56C 2BWFA 3EHVA 4J3OD 3GE8C 3NZUA 4IM0A 3ZNHB 4B0MA 1WR1A 2G1EA 4FJYA 1SGHA 3AM9A 3ENEA 1V49A 5BO4B 3KWLA 3Q14C 4NAMA 3TEXA 3N32A 1L0VB 3RPFC 2KQSA 2N7EA 4WAFA 4EE2A 3QJZA 2DYOA 1QZEA 1FNUA 2A4ZA 1CJEA 1ZPSA 4RGNA 5I4DA 3JSVB 4AOFA 2N4FA 1TYGB 1WGHA 3DBLB 4FLHA 4GSWA 1QKZA 2PVGC 3RNCC 1PGBA 3A1QA 4FADA 2QSDA 2KACA 1V1PA 3VUYA 2KN5A 2L83A 2DBYA 2LUMA 3ZIMA 4C80A 3ZJUA 3P4PB 4EUTA 1L5PA 3QX1A 3V6EB 1JCKB 1J8CA 2D10A 3RNBC 1WGDA 3U2SC 3RNAC 2OEDA 2GB1A 3DBSA 4P1CC 3ONSA 4YTPB 2PTLA 3AEAB 4WURA 3W2DA 3HK0A 1CZPA 2IY1B 2KOXA 1LGRA 3AMZA 1TS5A 3AE3B 5AEKB 4C4VA 3ZTDA 1XD3B 2KFKA 1TT5B 3OJ4B 4DXGA 3WAOA 3NS8A 1I42A 4K7SA 4ZDVA 3Q8EA 3N1XC 1TZ1A 5C1ZA 2NS5A 2AQ2B 3S2AA 4KIKB 2LVOA 3PHWB 1WM3A 4WJOA 3GP7A 4LNOA 4GDKB 4MM3A 2BKRB 5T8IA 3BK1A 4N6EB 4YSYB 4TMAB 2ZZPB 4WJQA 5D3DA 2N7JA 1YX6B 2VRRB 3NVZA 3TCAA 2HJ1A 3RCZA 3MC8A 4JIOU 1EM7A 1TY0A 1I4PA 2KTFA 1SJHD 2MBBB 1J7CA 2DENB 2WXOA 4REZA 3C19A 5J2RA 2KQ4X 1FXIA 3UGBB 1J0GA 3PT2B 4FJVB 5D7GA 1WMHB 4RM8A 1CK1A 2J7QB 4W9LA 2MEKA 4ARIA 2QDFA 1KLGD 4ZOHC 1UUPA 2WXPA 2WDVB 4WWOA 4DXAB 2QEJC 1SXTA 2LGSA 2EKEC 1NI3A 4BBNF 1YJJA 3BY4B 3P42A 1EU3A 1WM2A 2Z0EB 4P6VF 3AH7A 3KWVA 2KDEB 2KLCA 1JRUA 2AL6A 2O6VB 3SFEB 2RPVA 2BKFA 2LJ5A 4GMVA 5E6PA 2YVCA 2RSUA 3JSVA 4IWPA 4ASWC 3NHEB 4HRSA 3SHQA 2ZEQA 4QAYA 3RNEC 4A3OA 2KTRB 4HDQA 1T3QA 2NBVB 1N62A 2WGSA 2DZMA 4DXFA 2FCNA 5JHAA 1L6VA 2LGYA 3MC0B 4LDTD 5JH5C 3EGRA 5G2NA 3PSEB 1D5XC 1I7HA 4MT5A 3VH3B 4K1RB 3ML8A 1NYQA 4XWTA 3C0RB 3UF8A 2CKHB 4HPMB 2NMQA 2AL3A 4ANWA 4IW0A 3AECB 3DDCB 3B2GA 4BKGA 1I4RA 2GBJA 2KC1A 4KZ0A 3TEWA 4GXBA 1J7AA 3RNFC 4IWOA 4W9DA 5AUKA 3TIXA 1KM7A 5IKCM 1QF6A 5D2MB 1ROEA 4AJWA 3GOEA 2M0XA 4G3XB 3AULA 5AZFA 4K81A 3GZNB 2D3GA 3DVNV 2DZIA 2J42A 5BYSA 1FMAD 1WRIA 4DDGD 5IAAC 1ZDXA 1TY2A 1NDDA 2MBOA 4GDKA 1UNSA 3DWMA 4MGYE 2KN4A 1H4RA 1FD6A 4YTNB 4A9AA 2G45B 4W9GA 1IP9A 3JYUA 1WX7A 2HDEA 2JRIB 1K50A 2PIAA 4JGHB 3H9DA 3DHHC 1BT0A 2INPE 3A9KB 4P1BC 2DYMA 5BMIA 4E3CA 5AUIA 4YWGG 3QQ8B 3KUDB 4IM2A 3HVZA 2IO2B 3Q6BA 3DBHI 4AJYB 1BUIC 2KNBA 1NYRA 1TGZB 1MVKA 4LJPB 3WAMA 5G5GA 1AW7A 4ICUA 1NVID 1WMHA 2GBRA 2WXLA 3EFCA 4II3B 2C60A 3FILB 2MP2B 3R8BA 2K9XA 3PLUA 4HROA 4IG7B 1R4NI 3P4SB 2M0AA 1JWUD 2W9NA 4BOZB 5EE1A 5D94A 2WU2B 3HIZA 3NVYA 1PFDA 3SU8X 1VR9A 2N0SB 3U4EG 3CF6E 1E5WA 1WX9A 2L3ZA 2W55A 2MSED 3UIOB 4F1SA 1PGAA 1L4DB 2BYFA 3ZKJC 1EU4A 3N1YC 3I57A 4W9KA 1XLQA 1S3SG 1RM6C 4WJPA 5DPTA 3TEYA 4XWWA 2L76A 2O6VD 4KZCA 4YTMB 3UQBA 4CO7A 1OQYA 2KLGA 1VZ6A 3P63A 3VRBB 4A20A 3ZW3A 3Q3NC 2ICIA 2GI9A 1VZ8A 4NQLB 2MRPA 3RNGC 1WGGA 3AEEB 1SJED 3IBEA 2D07B 2KK8A 1T6BX 3ZVVA 1E8XA 2PJHA 4N9F4 3PPAA 2M17A 4NAWB 4I6NB 2JZ3B 1XO3A 2GRIA 4MGKE 1T0RC 1I4GA 3X0WA 1FXAA 3ZJVA 3LB8C 4B95A 1D5MC 3TL5A 4LCDE 1HTOA 2ASQA 2G9HD 1XEEA 3Q8AA 4NJCA 5FK9C 1NI2A 1WXSA 1F77A 4HJGE 2LZ6A 1SB3C 2BPSA 3VTUA 3DCGA 2M19A 2LWPA 2NTSA 5IO9A 4ITKA 1T0QC 2Y5CA 1WJNA 3L08A 4WWMA 4Q2JA 2EMSA 2K1FA 2W3RA 1GG3A 2B3AA 4II2B 4W9EA 4M8MA 3ZNID 4TQ1A 2MJ3A 3W5UB 5J18A 4W9HA 4RFBA 4L2YA 1YN4A 2VH1A 4W9FA 2Z59B 2J0KA 4KGRA 1WJUA 3SEBA 2CHXA 2CU1A 5C23A 1U4AA 5BYQA 2BW2A 2N9XA 5DPRA 4FULA 2MJEA 1WGYA 3AV8A 5L95C 1MPEA 4HKZE 1MJDA 4DK5A 4E74A 3V6CB 2WWZA 4EZKA 3KW5B 1GB4A 2BS3B 2Z8LA 1FPYA 3ZYYX 5AZGA 1E8WA 3A9KA 3L54A 2JQRB 4LLGM 3U30A 3AE9B 4J6IA 3TUOA 1E7VA 1JWAD 1VJKA 3L13A 1P9DU 4MM3B 3BZDB 3VAWA 3JVZX 3O65B 2NTTA 1C79A 3EA6A 4MACA 2NBUA 2DZKA 3T8MA 2D3BA 4S17A 2FNJB 3T3OA 1ZGUB 2JZPA 2ZW1A 2UWQA 3FILA 2MP2A 4LJOB 5C2TB 3N3KB 2V3SA 1JRPA 1QOGA 4JWUC 5DCNA 2XK5B 1MHXA 3PTFC 2E6XA 5DPSA 3J9CA 1M94A 2WXQA 4RF0A 2R2QA 1TJEA 2O2VB 3RMKC 2KQ7A 4XDDA 3P2BA 2RR9A 1AARA 3SFDB 2BB6A 1LXDA 1L0YB 4IOIE 1UBQA 3R7QA 3SD5A 3NOBA 4LNNA 2WP9B 1IGCA 4ICVA 2ZVOA 4XGAB 4XE0A 1OEYA 2KXJA 3NS1A 2Y5PA 4ANXA 3WANA 1SIJA 3RULA 1PDXA 3URYA 2EKIA 3AI5A 2JSVX 1YQ4B 4FXCA 1RYJA 4G0NB 4M0WB 4DDID 3DVGX 3ALBA 4B6WA 1RAXA 4KDIC 1VRAB 4IDIA 5JHBA 1FNVA 4ZHOA 2SEBD 1P3QU 3MHSD 2DNFA 2KAJA 2FUHB 4DHJB 4JL9A 4NAWA 4KVGB 1P98A 1HTQA 4OZBA 1WXVA 2AWTA 2ZCBA 3HHMA 2M56B 1JALA 2KYWA 4ZRIA 4BKTA 5CHWA 5HI1A 3Q69A 3TMPB 2FIFA 3O13A 3KUZA 2KJRA 3P1MA 3FAHA 2PLPA 2WX1A 1Y8RC 4FJZA 2PE6B 1XLPA 1C3TA 4NNJB 1E8ZA 5FR6A 1JMLA 1MG8A 4RM9A 4LK0M 4TV3A 4IUMB 1YQ3B 1LM8B 3IFWB 2L05A 3QAQA 1N61A 1WY8A 1ZW7A 3U7DA 1MG4A 3W1YA 1OQRA 3WAPA 4X57B 4EZJA 3LYYA 4NJ7A 3M3JA 2JYEA 3DBHB 2X38A 4WAAA 5FR3A 4KKIA 1GUAB 1E90A 2C7MB 1FXTB 2LHDA 2FCQA 1NEKB 3V05A 1ESFA 1WE7A 1WR6E 3Q3FA 4HK2A 1R4NB 3OJ3A 2MQJA 3I63C 1TS3A 2WNMA 1Z2MA 1WZ0A 4PS8A 1VZ7A 2IGGA 3DPDA 1UGMA 3PS6A 2KJHB 3APCA 2C7HA 1PGXA 3RUIB 3HRDD 1C4PA 3U7ZA 3KYCD 4NY0A 2MWSB 4XYCA 3NJTA 2RDGA 2WDQB 3N30A 2FBWB 2CHWA 3A9JA 1K8RB 4WQOB 5CHFA 2WHIA 5GXGB 1WF9A 2J52A 1M4VA 3LXFA 4HEA1 1R4MI 3FKYA 1GB1A 2L0TA 2XK5A 5MPOA 4M8NA 2BYTA 4XZ4A 1D4BA 2JVCA 1UELA 3AU5A 2B76B 3DBRB 2L8JA 1UH6A 2Q5WD 2O2VA 1WGRA 1GJZA 3H8HA 3R2TA 1AN8A 1PQSA 2OHFA 3M62B 4GGQA 3ABVB 1HE8A 3AEBB 4LNIA 1TBEA 2DWQA 1FIQA 5HKHA 2QHOA 1SBBB 2ONQA 4LNKA 2LVQA 1F1HA 3DOWA 1IPGA 5FKAC 3PZDA 2WXMA 1YJ1A 5IOIA 4M0WA 4W9JA 1UBIA 1C1YB 4YSXB 2FAZA 2GBNA 5BYRA 5IA7A 4M02A 1QLBB 2L00B 2N7DA 2PW9A 3BINA 1P7FA 3H7SA 2UU7A 4BVUC 3TEZA 4K7UA 1WGKA 2XEWA 1S1QB 1EO6A 1AYFA 3L0WB 2LEKA 1V8CA 3ZTCA 3IT6B 4BZAA 2XN9C 2KT7A 2WDTB 2KDFB 3UINB 2ZPNA 2L7RA 1V5TA 2MHJA 1WSPA 2K8BA 1WXQA 4KSLC 2KDBA 2KWCA 4B0EA 1FCCC 4KSKC 4P7IA 4IWQA 5GMVA 1OGWA 3FC4A 3E56A 2DAFA 2NPTB 3AEFB 3ZQ4A 5KHQA 2ZPYA 1ET9A 1EF5A 1HXYD 2JWZA 4G50A 3KYDD 4GOCA 5C3JB 3R66C 4RF1A 3RZFA 2KANA 2KZRA 4ZHPA 1Q0WB 3AEDB 3VXWA 3NRZA 2HJ8A 3AE7B 4JX1C 1E7PB 4EZLA 5D6JB 4BBNC 1HZ5A 3ZO5B 1KRHA 4OVZA 4OHJA 2I1KA 4HCPB 2RDHA 4ZRQA 1C4CA 4MH8A 1T0YA 4DHZB 1B9RA 1UZXB 2WXGA 1HA5A 4I6LB 1Z5SB 1LO5D 1V80A 3EUB2 3OLMD 1FCLA 2WXIA 3VR9B 2PKOA 2JXXA 2AYOB 3AXCA 4A90A 2I38A 3DVNU 4K3CA 1CMXB 3QK0A 1YD8U 4A55A 2KKCA 2XNAC 2CHZA 2N9KA 3T9LA 1I4QA 4EKUA 1B1ZA 2INNE 2BYEA 4ZRKA 5EE9A 3ECIA 4GN1A 4BOSC 1QT9A 4ANVA 1GAQB 2DAJA 3CSTA 1TZOA 4C7ZA 5D3IB 2IO0B 3PRZA 5LNK1 2EMTA 2L52A 2DX5B 2INDC 2MX2A 3UIPB 2JY6A 1P1AA 3AN1A 4NPNA 2H88B 4A3PA 1SE9A 3ZDMC 2C9WB 2PPHA 4GIVA 1KFYB 2DZJA 2VH2A 3DQVA 3VUWA 1FNWA 3LJ3A 1SE2A 3ZRCA 2IJ0A 3UQAA 1P0RA 2IDYA 2N1WA 3ZNZB 2KMCA 2QILA 4MDKE 1NBFC 3ZXRA 2QC8A 2GBMA 2KJ6A 5H8YE 3QC8B 4WJNA 4USAA 5E6NA 1QQRA 2NR2A 3NVVA 3Q2AC 4TSSA 3HM6X 2FIDA 2K8CA 3BVMA 1E9MA 1KOTA 1QOAA 3KLSX 1F2RC 1JWMD 3DBRI 2MBHA 4RMAA 4MGZE 3CSFA 3AE2B 4RNAA 3ETRA 1KF6B 1YQBA 3B9JA 1ZXHA 5TSSA 3NUHB 2WLBA 5BMGA 2BWES 3A33B 4FA6A 4ACFA 1WX8A 2PE9A 3EECA 4HJKA 1HEZE 5G5HA 2XBBC 1VD2A 2MCNB 4KGSA 3RT3B 3PV1A 4US9A 2YEPB 4ARCA 3NZSA 4WQMA 2G3QB 1OQQA 3C8YA 3P4QB 2KFJA 2ZVNA 3RI7C 1XT9B 2V1YA 1J19A 1GC6A 1XCTL 2NPTA 3X23A 4BKSA 1SIFA 2BS4B 3Q3OC 2GLSA 5EDSA 3IHPC 1ZKHA 3L16A 4HPLB 3WCQA 2PMVA 4YL8A 1F52A 2R2OA 3H1UA 4HCNB 4AS1A 4HWIB 2BYVE 2IPKD 4MJSA 4AWJA 3R7RA 3EC8A 4RH6A 1TTNA 3CWIA 1XLOA 4FBJB 2MBEA 1EWYC 1R4MB 2HTME 3LDZE 3TJPA 2KDIA 4UDUC 5E6JA 3CIRB 2GMIC 2KHWB 3RD2A 4CYEA 4IKGA 1ZXIA 4AUQC 1OEYJ 2IGHA 2H89B 2OJRA 2WQYB 2VZKB 3H7PB 2WXHA 1XLNA 2AQ1B 2WX0A 1FEHA 3APFA 4JE3B 3AE6B 4HLEA 2ZJDA 3AE5B 2MJDA 1K53A 4XX5A 1NENB 4CQNA 1V81A 2FCMA 3OAWA 3KQ4A 3VTWA 3TBLD 4RGTA 3E9SA 2W3SA 4ZYNA 3DVGY 3MTNB 1FRRA 1XF5L 4FN2A 4FHJA 3A9JB 2PVOD 3JW0X 3Q3JA 4F8CB 2QCZA 3HVDA 2M8SA 5TR5A 5IN7A 2LXCA 4PK1A 5JZEB 2V9HA 3MC9A 2YLMA 1XCQL 1BMLC 2I1JA 3ZJTA 1ZOYB 2QIEB 3VVWB 3DWGC 2ZCCA 1L0XB 2CJNA 1JW9D 1RRBA 3N1ZC 2KWUB 1UGJA 1D3ZA 1V1OA 3SDLC 3K9OB 2MLBA 4IM3A 1SE3A 2I2YA 3PREA 2E3TA 1Y56A 2J0JA 2JT4B 3Q3MC 4YT0B 3V61A 2HE7A 3IXSA 1SEBD 3L4PA 2FE8A 4JQWC 1X1MA 3IAM1 5G55A 2G4DB 2KWDA 3PRPB 2N9PC 2V0GA 2CS4A 2JRHA 2CJOA 1SSNA 1C78A 3BYYB 3HUIA 2M4NA 4B9KA 3SR6A 1N5WA 5LXHA 4MEMA
chains in the Genus database with same CATH topology
5HHDG 1DYQA 2DWQA 1E10A 1K50A 1FIQA 2PIAA 2WXFA 1UWXA 4PT5A 2INPE 2ZW0A 2DYMA 3AE1B 1SBBB 2ONQA 5BMIA 1C77A 4WH4A 5AUIA 3R2IA 4YWGG 2ON8A 3HVZA 5FKAC 2WXMA 1BUIC 4M0WA 4RGMA 1NYRA 3IT4B 1MVKA 1JQ4A 1E6EB 5G5GA 1AW7A 3W9CB 4DQOC 4YSXB 5BYRA 5H92C 3NVWA 1NVID 3VQIA 1QLBB 2PW9A 1Q10A 4N59A 2WXLA 2BTEA 1P7FA 1OFFA 1QILA 3Q8BA 1IBXA 3FILB 2RMMA 3BWUD 2K9XA 3MFGA 3R8BA 3TEZA 4HROA 1JWSD 1D6EC 3TSSA 4YSZB 1WGKA 2W54A 3P4RB 3P4SB 2M0AA 2QJLA 2DLBA 2JXTA 1JWUD 2L1AA 3N9YC 4HKQA 1AYFA 5EE1A 2K3UA 2WU2B 3V3XA 2LEKA 1V8CA 3NVYA 3IT6B 1PFDA 2V3PA 4KGTA 2K0PA 1K51A 1VR9A 2XN9C 1VDVA 2N0SB 1MHHE 1FFUA 1ZP0B 3RFZB 3U4EG 4ZYSA 4YXDB 1YMHE 1MI0A 2R61A 3GB1A 4US8A 1ZUD2 1YJIA 2W55A 3Q8CA 2WXJA 3AEGB 1RWSA 1GPXA 1WSPA 2L32A 3PZ8A 1PGAA 4R3DA 4WIPA 1L4DB 2AX5A 1DGJA 1JWBD 1CQVA 1EU4A 1WXQA 3I57A 4B0EA 2FUG1 1XLQA 2VZKD 1FCCC 3MP9A 1I4XA 1RM6C 1C9FA 2JYTA 3PZ7A 3B2FA 1DOYA 3TEYA 3Q8FA 4XWWA 4H2AA 4GDLB 2JWUA 4YTMB 4KKJA 3FC4A 3E56A 2JU6X 3BVZA 1VZ6A 3P63A 1ET6A 3AEFB 1PYWD 3VRBB 3ZQ4A 1ZDVA 1TKYA 1ET9A 2ICIA 5EE3A 2GI9A 5JXVA 1HXYD 1VZ8A 1FO4A 2W82A 5C3JB 3AEEB 1SJED 1KTKA 3AE4B 4KX6B 1BXTA 4RF1A 3AE8B 2AQ3B 1T6BX 2MH7A 4ZHPA 1L4ZB 1A70A 4C56C 1SE4A 2BT6A 1F0ZA 4NAWB 4J3OD 1XO3A 2GRIA 1I4GA 1N5XA 3AEDB 4RCOA 1FXAA 4B0MA 2G1EA 3ZJVA 3GS2A 3LB8C 3NRZA 3AM9A 3AE7B 1YN5A 1D5MC 1E7PB 2D5GA 3KWLA 4JX1C 1HZ5A 4NAMA 1KRHA 2G9HD 4OVZA 1XEEA 3Q8AA 1VLBA 3TEXA 4NJCA 5FK9C 4OHJA 5EE0A 1F77A 4HJGE 2RDHA 4ZRQA 1L0VB 3RPFC 1SB3C 1C4CA 4MH8A 2EELA 1B9RA 2M19A 2WXGA 1HA5A 2NTSA 4WAFA 4ITKA 1LO5D 2WU5B 2Y5CA 2YEPF 3EUB2 4EE2A 2DYOA 1FCLA 1FNUA 4WWMA 2BB5A 2WXIA 4Q2JA 1CJEA 2PKOA 1ZPSA 2W3RA 4RGNA 3VR9B 5I4DA 4A90A 2I38A 4TQ1A 2MJ3A 4OW0A 3W5UB 4A55A 4RFBA 4L2YA 1N63A 1TYGB 1YN4A 2XNAC 2WXKA 2J53A 1TS2A 2N9KA 1QKZA 4KGRA 3SEBA 1I4QA 2PVGC 2Y3AA 5BYQA 1PGBA 3UI3A 1B1ZA 2BW2A 2INNE 1L6UA 5EE9A 2QSDA 2MJEA 1QT9A 1I4HA 3AV8A 2KACA 1V1PA 4NZLB 1C4AA 1GAQB 1MPEA 1ENFA 4HKZE 3VRAB 2L83A 2WDRB 1DOXA 1TZOA 2DBYA 4C7ZA 2QMTA 5D3IB 2LUMA 5LNK1 4C80A 1GB4A 3ZJUA 3P4PB 2BS3B 1L5PA 2Z8LA 2L52A 3AN1A 2K22A 1JCKB 4GLSC 2H88B 1FM0D 2SAKA 3MHZA 3ZYYX 1KFYB 3U2SC 2OEDA 2GB1A 2JQRB 4LLGM 1FNWA 1SE2A 3AE9B 4YTPB 3TUOA 2PTLA 1JWAD 2IJ0A 1VJKA 3AEAB 4WURA 3W2DA 4MM3B 2IDYA 3BZDB 2BS2B 1CZPA 1J7BA 3BIID 2JX5A 2QILA 2NTTA 1C79A 3EA6A 4MACA 3AMZA 5H8YE 1STEA 1TS5A 1F2RI 3T3OA 2KMMA 3AE3B 2JZPA 2WXRA 2ZW1A 4DXGA 3FILA 4USAA 4JPSA 3IAS1 5C2TB 1QQRA 3NVVA 4TSSA 3I9V1 1JRPA 1QOGA 3Q8EA 4JWUC 3W5VB 3BVMA 1E9MA 3NZ3A 3U52E 1MHXA 1QOAA 3KLSX 1F2RC 2E6XA 1JWMD 2AQ2B 3J9CA 2WXQA 3GP7A 1FRDA 3AE2B 4RF0A 4RNAA 3ETRA 2V4IB 1KF6B 1R7SA 1TJEA 4GDKB 3B9JA 1ZXHA 5TSSA 3NUHB 5T8IA 2WLBA 5BMGA 3BK1A 4XDDA 2LMCA 4N6EB 4YSYB 3SFDB 2BB6A 4TMAB 1HEZE 2WXNA 5G5HA 4P16A 5D3DA 1L0YB 1IGDA 2N7JA 4IOIE 3NVZA 4KGSA 1QOFA 4US9A 2WP9B 1IGCA 1T5XD 2YEPB 4N58A 4ARCA 1EM7A 4A6QA 4XE0A 4WQMA 3NS1A 2Y5PA 1TY0A 1OQQA 1I4PA 2J4XA 3C8YA 1SJHD 3P4QB 1J7CA 1SIJA 2WXOA 4REZA 1FFVA 3VR8B 1PDXA 1XCTL 3URYA 2EKIA 2KQ4X 1K52A 2BS4B 1FXIA 2JSVX 1YQ4B 4FXCA 1RYJA 4O1NA 3WCQA 1VRAB 2PMVA 2LFIA 2ACZB 5D7GA 2N9LA 5HFYA 1CK1A 4IDIA 3MJ5A 1YN3A 1FNVA 4ZHOA 2SEBD 2MEKA 4AS1A 4ARIA 1PUTA 1IBXB 2IPKD 1KLGD 3BYTB 4ZOHC 4RH6A 4LTUA 3CWIA 1UUPA 1XLOA 2KAJA 3ZGZA 4OZAA 1EWYC 2HTME 2WXPA 1E0ZA 2KDMA 4OZBA 1XXGA 2K5PA 2WDVB 2QEJC 1SXTA 1HZ6A 4UDUC 5E6JA 3CIRB 2M56B 2CU3A 1JALA 1NI3A 1YJJA 4IKGA 1ZXIA 5HI1A 3P42A 2IGHA 3Q69A 3O13A 1EU3A 2H89B 4P6VF 3AH7A 2WQYB 2VZKB 3KWVA 2WXHA 3P1MA 1XLNA 1N60A 3FAHA 2AQ1B 2PLPA 1FEHA 3SFEB 2RPVA 4JE3B 1XLPA 3AE6B 3AE5B 2MJDA 1JMLA 1K53A 1GOZA 1C76A 2V3NA 4AQ7A 4LK0M 1NENB 4CQNA 1YQ3B 2TSSA 4HRSA 1N61A 4OZCA 1P7EA 3KQ4A 1DOIA 2BBCA 4L1BA 1T3QA 1OQRA 1WYGA 1N62A 4RGTA 3LYYA 3OWEB 2LHEA 3E9SA 2W3SA 4DXFA 2JYEA 1FRRA 1XF5L 2X38A 5FR3A 4KKIA 1L6VA 1JROA 3MC0B 2PVOD 3EGRA 2LHDA 1IUEA 1D5XC 1I7HA 1QOBA 4MT5A 1NEKB 1AWDA 3HVDA 1ZE3D 1ESFA 3V05A 1NYQA 4L23A 3BK2A 4XWTA 5HG2A 2NMQA 3W1SA 1TS3A 2WNMA 3AECB 1KH0A 3B2GA 1I4RA 1XCQL 3AB5A 1BMLC 1SF0A 3TEWA 3ZJTA 1VZ7A 1D5ZC 1ZOYB 2IGGA 2QIEB 1V97A 1J7AA 3DWGC 1TS4A 1L0XB 1PGXA 2CJNA 5AUKA 1JW9D 3HRDD 4JWSC 1UWMA 1EWCA 1C4PA 1UGJA 3U7ZA 2LGIA 1V1OA 1QF6A 4A8XC 4ZRPA 4D2KA 2WS3B 2RDGA 2WDQB 1ROEA 5BMHA 2FBWB 1SE3A 2I2YA 5GXGB 2J52A 2E3TA 1M4VA 3LXFA 4HEA1 1Y56A 4YT0B 2J42A 3IXSA 5BYSA 1GB1A 1SEBD 1FMAD 3L4PA 1WRIA 2FE8A 5MPOA 2IGDA 3IAM1 2BYTA 1YNTE 1ZDXA 1D4BA 1TY2A 3PO0A 4RGOS 2KWDA 2B76B 1V1PB 4TQ0A 1TKEA 2V0GA 2Q5WD 4XDCA 1HQRD 1UNSA 1WWTA 3DWMA 3T3NA 2LJIA 2KN4A 3H8HA 3R2TA 1AN8A 2CJOA 1KLUD 2OHFA 3BVGA 4YTNB 1FD6A 1SSNA 1C78A 3BYYB 3HUIA 4A9AA 3ABVB 3SR6A 1RFKA 4C7YA 3AEBB 1TKGA 1ACCA 1N5WA 2HDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HHD G;  1K50 A;  1UWX A;  2ZW0 A;  2ONQ A;  4OZC A;  5BMI A;  1MHX A;  1P7E A;  1F2R C;  1HZ5 A;  2ON8 A;  2LHE A;  1XF5 L;  4HJG E;  1MVK A;  1ZXH A;  2EEL A;  5BMG A;  2LHD A;  2PW9 A;  1Q10 A;  1P7F A;  1FCL A;  1IBX A;  3FIL B;  2RMM A;  1HEZ E;  2I38 A;  5HG2 A;  1IGD A;  2N7J A;  4IOI E;  2NMQ A;  4KGS A;  1KH0 A;  1XCQ L;  2JXT A;  1IGC A;  1EM7 A;  2J53 A;  2N9K A;  3V3X A;  1QKZ A;  4KGR A;  3UI3 A;  2IGG A;  1PGB A;  4KGT A;  2K0P A;  1K51 A;  1XCT L;  2KQ4 X;  2QSD A;  1K52 A;  2JSV X;  1PGX A;  1MHH E;  2KAC A;  1MPE A;  2LGI A;  4HKZ E;  1YMH E;  1MI0 A;  3GB1 A;  5HFY A;  2N9L A;  2QMT A;  2LUM A;  4D2K A;  1GB4 A;  5BMH A;  1IBX B;  1PGA A;  2I2Y A;  4GLS C;  1FCC C;  2J52 A;  3MP9 A;  4OZA A;  1C9F A;  1GB1 A;  2OED A;  2GB1 A;  2KDM A;  2JWU A;  4OZB A;  1HZ6 A;  2IGD A;  2PTL A;  2JU6 X;  1YNT E;  1D4B A;  2KWD A;  4IKG A;  5HI1 A;  2IGH A;  2GI9 A;  5JXV A;  4MAC A;  2KN4 A;  2PLP A;  1F2R I;  1FD6 A;  2JZP A;  2RPV A;  2ZW1 A;  3FIL A;  1JML A;  1K53 A;  4WH4 A; 
#chains in the Genus database with same CATH topology
 5HHD G;  1WE6 A;  2WXF A;  4PT5 A;  2JPH A;  3AE1 B;  4CHK A;  1A5R A;  2IO3 B;  1H8C A;  2LRW A;  3W1S C;  4LDT B;  4F7Z A;  4RGM A;  2KVZ A;  1JQ4 A;  1TIF A;  3W9C B;  5H92 C;  4JLC A;  3NVW A;  1E8Y A;  3WAL A;  1Q10 A;  1QIL A;  3A4S C;  3Q8B A;  3MFG A;  4G11 A;  3TSS A;  5CHV C;  1EF1 A;  4NQK E;  3NG0 A;  2JXT A;  1Q1O A;  4HKQ A;  4PS7 A;  2KX0 A;  3PHX B;  2K0P A;  1K51 A;  1MHH E;  4PYZ A;  2R61 A;  3H7P A;  3GB1 A;  1WFY A;  1ZUD 2;  3Q8C A;  4C00 A;  1RWS A;  1GPX A;  4HPP A;  2ZNV C;  2L32 A;  3PZ8 A;  4WIP A;  5E6O A;  2AX5 A;  2LGX A;  1DGJ A;  3KVF B;  1JWB D;  3VUX A;  3EFU A;  3VHT C;  2VZK D;  1C9F A;  2NCN A;  2JYT A;  1WXM A;  4GDL B;  2JWU A;  3BVZ A;  4HVB A;  1ET6 A;  1PYW D;  4DWF A;  5IP4 D;  1ZDV A;  1GC7 A;  4MEL A;  2BQQ A;  3PGE A;  1FO4 A;  3DHI C;  3U8Z A;  3H6N A;  3RZW C;  4NJ6 A;  3ZDT A;  3AE4 B;  2LD9 A;  4KX6 B;  4I6P A;  1L7Y A;  2MH7 A;  4ZRJ A;  1L4Z B;  4WWN A;  2REX A;  3B1L X;  1SE4 A;  2BT6 A;  3PRM B;  1F0Z A;  3ZLZ A;  5CX3 A;  1YIW A;  1KJT A;  2KX3 A;  1N5X A;  4RCO A;  3GS2 A;  1E7U A;  2LRU A;  1YN5 A;  2D5G A;  2KO3 A;  4OVV A;  1VLB A;  1V5O A;  3QCA A;  5EE0 A;  2EEL A;  1G6J A;  4OVU A;  1EUV B;  3I5J C;  2WU5 B;  2YEP F;  1L2N A;  2KWV B;  2BB5 A;  4OW0 A;  3VFK A;  1N63 A;  4MSQ B;  3ZXV A;  4XC2 A;  2K6D B;  2KD0 A;  2WXK A;  2J53 A;  4GB9 A;  3ZUN A;  1TS2 A;  3UI3 A;  2Y3A A;  1L6U A;  3ML9 A;  1I4H A;  3I3T B;  4NZL B;  1C4A A;  1ENF A;  3VRA B;  2WDR B;  1DOX A;  2QMT A;  2D3C A;  3IVF A;  2Z0D B;  2J0M A;  2K22 A;  1Q5W B;  3PLV A;  3RYT A;  4KV2 A;  4GLS C;  1FM0 D;  4PYU A;  2SAK A;  3MHZ A;  3PVL A;  2PEA A;  4DHJ D;  4HDO A;  2AEH A;  4W9C A;  2BS2 B;  2Y5B B;  1J7B A;  3BII D;  3QAR A;  2JX5 A;  2KC2 A;  1STE A;  1F2R I;  2KMM A;  1WZ3 A;  2WXR A;  4M00 A;  2LVP A;  2A5U A;  4JPS A;  3IAS 1;  5L83 A;  5AZH A;  4GU2 A;  2RPQ A;  3I9V 1;  3W5V B;  5LXI B;  3NZ3 A;  3U52 E;  2JF5 A;  4DBG A;  3VH4 B;  1FRD A;  2ZNV B;  4K3B A;  2V4I B;  1R7S A;  4MJS B;  2LMC A;  3RN9 C;  5KHO A;  2WXN A;  4P16 A;  1IGD A;  1QOF A;  1VCB A;  2LAS A;  2UYZ B;  4BFR A;  1V9J A;  1T5X D;  4N58 A;  2IY0 B;  3DBL I;  4A6Q A;  2WYQ A;  4GDL A;  2GOW A;  2KMA A;  4E71 A;  3V62 A;  2C7N B;  2J4X A;  1FFV A;  2DYB A;  3VR8 B;  4EEW A;  1K52 A;  2LXA A;  3ZRF A;  1RFA A;  4KIK A;  4O1N A;  2LFI A;  2K8H A;  2ACZ B;  5HFY A;  1WI0 A;  2N9L A;  3OG5 A;  3MJ5 A;  1YN3 A;  3HM3 A;  1PUT A;  1IBX B;  3MJW A;  4AP4 C;  3BYT B;  4LTU A;  2IO1 B;  3ZGZ A;  4OZA A;  2KVR A;  1WH3 A;  2LI5 A;  3M95 A;  1E0Z A;  2KDM A;  2D2Q A;  2D11 A;  1XXG A;  2K5P A;  4TKN A;  1HZ6 A;  4K7W A;  5LLI A;  2HTH A;  3QWZ B;  2CU3 A;  1V2Y A;  1UD7 A;  4W9I A;  2N9E B;  1N60 A;  1WIA A;  3AU4 A;  4MH0 E;  4MGI E;  1GOZ A;  2BGF A;  2MA9 B;  4FHK A;  1C76 A;  2V3N A;  4AQ7 A;  1V6E A;  2JZZ A;  3QA8 A;  2NVU I;  3QHT A;  4EOY A;  2TSS A;  2K39 A;  1T0S C;  5J17 A;  4OZC A;  1P7E A;  1DOI A;  2BBC A;  4L1B A;  1WYG A;  2IZV B;  3OWE B;  3ZNG C;  2LHE A;  2CR5 A;  1JRO A;  1UF0 A;  2K6Q A;  3IG3 A;  3L10 B;  2BF8 B;  1IUE A;  1QOB A;  1AWD A;  1ZE3 D;  4L23 A;  3BK2 A;  1F9J A;  2RDB C;  5HG2 A;  2O6V A;  4TUU A;  3W1S A;  3VDZ A;  1KH0 A;  3AB5 A;  1IYF A;  1SF0 A;  3D32 A;  2M1M A;  1D5Z C;  2D3A A;  1V97 A;  3B08 A;  2GBK A;  3K9P B;  1TS4 A;  1V86 A;  4JWS C;  1WRD B;  1UWM A;  2OOB B;  1EWC A;  2G4S A;  2KTR A;  2LGI A;  3N20 C;  3V60 A;  1YX5 B;  4A8X C;  2MBQ A;  3B0A A;  4ZRP A;  4D2K A;  2WS3 B;  2LGD A;  5BMH A;  4WWP A;  4LNF A;  2K25 A;  2RGF A;  4URK A;  1ISN A;  3A1Q B;  2IGD A;  1YNT E;  3PO0 A;  4RGO S;  1WJ4 A;  1V1P B;  4TQ0 A;  1TKE A;  4S0R A;  3DHG C;  4BKS D;  4XDC A;  1HQR D;  1WWT A;  3APD A;  3T3N A;  2LJI A;  2RD0 A;  2L0F A;  2JUO A;  1KLU D;  3BVG A;  4ANU A;  4C7Y A;  1RFK A;  1TKG A;  1ACC A;  2V4L A;  4WH4 A;  1DYQ A;  1E10 A;  3CMM B;  2X8X X;  3GE3 C;  4EFO A;  1YOV B;  1UWX A;  2ZW0 A;  2MW5 A;  3KUC B;  4IC7 B;  2OJW A;  1C77 A;  3L17 A;  3R2I A;  1LFD A;  3QIJ A;  2ON8 A;  3NY5 A;  1WJ6 A;  3IT4 B;  1E6E B;  4DQO C;  2HD5 B;  3VQI A;  1XQQ A;  1OTR B;  4C4V B;  4N59 A;  2BTE A;  1OFF A;  2KFK B;  1IBX A;  2LUE A;  2RMM A;  3BWU D;  1JWS D;  1D6E C;  4YSZ B;  2W54 A;  3P4R B;  3A4R A;  3WIM A;  2QJL A;  2DLB A;  2FCS A;  2L1A A;  3N9Y C;  3M63 B;  2K3U A;  3V3X A;  4MSM B;  2NBW B;  2V3P A;  4KGT A;  1VDV A;  1FFU A;  1ZP0 B;  3RFZ B;  2IBI B;  2INC C;  4ZYS A;  4YXD B;  1YMH E;  1WYW B;  3VTV A;  1MI0 A;  4US8 A;  1YJI A;  1N6Z A;  4BAX A;  2WXJ A;  3AEG B;  1RLF A;  2DHZ A;  4R3D A;  3KH0 A;  1CQV A;  4KDL B;  2FUG 1;  4PS3 A;  2BVC A;  3GZN I;  3MP9 A;  1I4X A;  3PZ7 A;  3B2F A;  1DOY A;  3R3M A;  5CTR C;  1LQB A;  3Q8F A;  4H2A A;  4KKJ A;  2JU6 X;  5DPW A;  1I35 A;  2N1V A;  1TKY A;  5EE3 A;  5JXV A;  2IYD B;  2W82 A;  4HXD A;  2C5L C;  1KTK A;  1GNU A;  1WXA A;  1BXT A;  3AE8 B;  2AQ3 B;  4M01 A;  4DHZ E;  1A70 A;  1KLV A;  1MFW A;  3WA0 A;  4C56 C;  2BWF A;  3EHV A;  4J3O D;  3GE8 C;  3NZU A;  4IM0 A;  3ZNH B;  4B0M A;  1WR1 A;  2G1E A;  4FJY A;  1SGH A;  3AM9 A;  3ENE A;  1V49 A;  5BO4 B;  3KWL A;  3Q14 C;  4NAM A;  3TEX A;  3N32 A;  1L0V B;  3RPF C;  2KQS A;  2N7E A;  4WAF A;  4EE2 A;  3QJZ A;  2DYO A;  1QZE A;  1FNU A;  2A4Z A;  1CJE A;  1ZPS A;  4RGN A;  5I4D A;  3JSV B;  4AOF A;  2N4F A;  1TYG B;  1WGH A;  3DBL B;  4FLH A;  4GSW A;  1QKZ A;  2PVG C;  3RNC C;  1PGB A;  3A1Q A;  4FAD A;  2QSD A;  2KAC A;  1V1P A;  3VUY A;  2KN5 A;  2L83 A;  2DBY A;  2LUM A;  3ZIM A;  4C80 A;  3ZJU A;  3P4P B;  4EUT A;  1L5P A;  3QX1 A;  3V6E B;  1JCK B;  1J8C A;  2D10 A;  3RNB C;  1WGD A;  3U2S C;  3RNA C;  2OED A;  2GB1 A;  3DBS A;  4P1C C;  3ONS A;  4YTP B;  2PTL A;  3AEA B;  4WUR A;  3W2D A;  3HK0 A;  1CZP A;  2IY1 B;  2KOX A;  1LGR A;  3AMZ A;  1TS5 A;  3AE3 B;  5AEK B;  4C4V A;  3ZTD A;  1XD3 B;  2KFK A;  1TT5 B;  3OJ4 B;  4DXG A;  3WAO A;  3NS8 A;  1I42 A;  4K7S A;  4ZDV A;  3Q8E A;  3N1X C;  1TZ1 A;  5C1Z A;  2NS5 A;  2AQ2 B;  3S2A A;  4KIK B;  2LVO A;  3PHW B;  1WM3 A;  4WJO A;  3GP7 A;  4LNO A;  4GDK B;  4MM3 A;  2BKR B;  5T8I A;  3BK1 A;  4N6E B;  4YSY B;  4TMA B;  2ZZP B;  4WJQ A;  5D3D A;  2N7J A;  1YX6 B;  2VRR B;  3NVZ A;  3TCA A;  2HJ1 A;  3RCZ A;  3MC8 A;  4JIO U;  1EM7 A;  1TY0 A;  1I4P A;  2KTF A;  1SJH D;  2MBB B;  1J7C A;  2DEN B;  2WXO A;  4REZ A;  3C19 A;  5J2R A;  2KQ4 X;  1FXI A;  3UGB B;  1J0G A;  3PT2 B;  4FJV B;  5D7G A;  1WMH B;  4RM8 A;  1CK1 A;  2J7Q B;  4W9L A;  2MEK A;  4ARI A;  2QDF A;  1KLG D;  4ZOH C;  1UUP A;  2WXP A;  2WDV B;  4WWO A;  4DXA B;  2QEJ C;  1SXT A;  2LGS A;  2EKE C;  1NI3 A;  4BBN F;  1YJJ A;  3BY4 B;  3P42 A;  1EU3 A;  1WM2 A;  2Z0E B;  4P6V F;  3AH7 A;  3KWV A;  2KDE B;  2KLC A;  1JRU A;  2AL6 A;  2O6V B;  3SFE B;  2RPV A;  2BKF A;  2LJ5 A;  4GMV A;  5E6P A;  2YVC A;  2RSU A;  3JSV A;  4IWP A;  4ASW C;  3NHE B;  4HRS A;  3SHQ A;  2ZEQ A;  4QAY A;  3RNE C;  4A3O A;  2KTR B;  4HDQ A;  1T3Q A;  2NBV B;  1N62 A;  2WGS A;  2DZM A;  4DXF A;  2FCN A;  5JHA A;  1L6V A;  2LGY A;  3MC0 B;  4LDT D;  5JH5 C;  3EGR A;  5G2N A;  3PSE B;  1D5X C;  1I7H A;  4MT5 A;  3VH3 B;  4K1R B;  3ML8 A;  1NYQ A;  4XWT A;  3C0R B;  3UF8 A;  2CKH B;  4HPM B;  2NMQ A;  2AL3 A;  4ANW A;  4IW0 A;  3AEC B;  3DDC B;  3B2G A;  4BKG A;  1I4R A;  2GBJ A;  2KC1 A;  4KZ0 A;  3TEW A;  4GXB A;  1J7A A;  3RNF C;  4IWO A;  4W9D A;  5AUK A;  3TIX A;  1KM7 A;  5IKC M;  1QF6 A;  5D2M B;  1ROE A;  4AJW A;  3GOE A;  2M0X A;  4G3X B;  3AUL A;  5AZF A;  4K81 A;  3GZN B;  2D3G A;  3DVN V;  2DZI A;  2J42 A;  5BYS A;  1FMA D;  1WRI A;  4DDG D;  5IAA C;  1ZDX A;  1TY2 A;  1NDD A;  2MBO A;  4GDK A;  1UNS A;  3DWM A;  4MGY E;  2KN4 A;  1H4R A;  1FD6 A;  4YTN B;  4A9A A;  2G45 B;  4W9G A;  1IP9 A;  3JYU A;  1WX7 A;  2HDE A;  2JRI B;  1K50 A;  2PIA A;  4JGH B;  3H9D A;  3DHH C;  1BT0 A;  2INP E;  3A9K B;  4P1B C;  2DYM A;  5BMI A;  4E3C A;  5AUI A;  4YWG G;  3QQ8 B;  3KUD B;  4IM2 A;  3HVZ A;  2IO2 B;  3Q6B A;  3DBH I;  4AJY B;  1BUI C;  2KNB A;  1NYR A;  1TGZ B;  1MVK A;  4LJP B;  3WAM A;  5G5G A;  1AW7 A;  4ICU A;  1NVI D;  1WMH A;  2GBR A;  2WXL A;  3EFC A;  4II3 B;  2C60 A;  3FIL B;  2MP2 B;  3R8B A;  2K9X A;  3PLU A;  4HRO A;  4IG7 B;  1R4N I;  3P4S B;  2M0A A;  1JWU D;  2W9N A;  4BOZ B;  5EE1 A;  5D94 A;  2WU2 B;  3HIZ A;  3NVY A;  1PFD A;  3SU8 X;  1VR9 A;  2N0S B;  3U4E G;  3CF6 E;  1E5W A;  1WX9 A;  2L3Z A;  2W55 A;  2MSE D;  3UIO B;  4F1S A;  1PGA A;  1L4D B;  2BYF A;  3ZKJ C;  1EU4 A;  3N1Y C;  3I57 A;  4W9K A;  1XLQ A;  1S3S G;  1RM6 C;  4WJP A;  5DPT A;  3TEY A;  4XWW A;  2L76 A;  2O6V D;  4KZC A;  4YTM B;  3UQB A;  4CO7 A;  1OQY A;  2KLG A;  1VZ6 A;  3P63 A;  3VRB B;  4A20 A;  3ZW3 A;  3Q3N C;  2ICI A;  2GI9 A;  1VZ8 A;  4NQL B;  2MRP A;  3RNG C;  1WGG A;  3AEE B;  1SJE D;  3IBE A;  2D07 B;  2KK8 A;  1T6B X;  3ZVV A;  1E8X A;  2PJH A;  4N9F 4;  3PPA A;  2M17 A;  4NAW B;  4I6N B;  2JZ3 B;  1XO3 A;  2GRI A;  4MGK E;  1T0R C;  1I4G A;  3X0W A;  1FXA A;  3ZJV A;  3LB8 C;  4B95 A;  1D5M C;  3TL5 A;  4LCD E;  1HTO A;  2ASQ A;  2G9H D;  1XEE A;  3Q8A A;  4NJC A;  5FK9 C;  1NI2 A;  1WXS A;  1F77 A;  4HJG E;  2LZ6 A;  1SB3 C;  2BPS A;  3VTU A;  3DCG A;  2M19 A;  2LWP A;  2NTS A;  5IO9 A;  4ITK A;  1T0Q C;  2Y5C A;  1WJN A;  3L08 A;  4WWM A;  4Q2J A;  2EMS A;  2K1F A;  2W3R A;  1GG3 A;  2B3A A;  4II2 B;  4W9E A;  4M8M A;  3ZNI D;  4TQ1 A;  2MJ3 A;  3W5U B;  5J18 A;  4W9H A;  4RFB A;  4L2Y A;  1YN4 A;  2VH1 A;  4W9F A;  2Z59 B;  2J0K A;  4KGR A;  1WJU A;  3SEB A;  2CHX A;  2CU1 A;  5C23 A;  1U4A A;  5BYQ A;  2BW2 A;  2N9X A;  5DPR A;  4FUL A;  2MJE A;  1WGY A;  3AV8 A;  5L95 C;  1MPE A;  4HKZ E;  1MJD A;  4DK5 A;  4E74 A;  3V6C B;  2WWZ A;  4EZK A;  3KW5 B;  1GB4 A;  2BS3 B;  2Z8L A;  1FPY A;  3ZYY X;  5AZG A;  1E8W A;  3A9K A;  3L54 A;  2JQR B;  4LLG M;  3U30 A;  3AE9 B;  4J6I A;  3TUO A;  1E7V A;  1JWA D;  1VJK A;  3L13 A;  1P9D U;  4MM3 B;  3BZD B;  3VAW A;  3JVZ X;  3O65 B;  2NTT A;  1C79 A;  3EA6 A;  4MAC A;  2NBU A;  2DZK A;  3T8M A;  2D3B A;  4S17 A;  2FNJ B;  3T3O A;  1ZGU B;  2JZP A;  2ZW1 A;  2UWQ A;  3FIL A;  2MP2 A;  4LJO B;  5C2T B;  3N3K B;  2V3S A;  1JRP A;  1QOG A;  4JWU C;  5DCN A;  2XK5 B;  1MHX A;  3PTF C;  2E6X A;  5DPS A;  3J9C A;  1M94 A;  2WXQ A;  4RF0 A;  2R2Q A;  1TJE A;  2O2V B;  3RMK C;  2KQ7 A;  4XDD A;  3P2B A;  2RR9 A;  1AAR A;  3SFD B;  2BB6 A;  1LXD A;  1L0Y B;  4IOI E;  1UBQ A;  3R7Q A;  3SD5 A;  3NOB A;  4LNN A;  2WP9 B;  1IGC A;  4ICV A;  2ZVO A;  4XGA B;  4XE0 A;  1OEY A;  2KXJ A;  3NS1 A;  2Y5P A;  4ANX A;  3WAN A;  1SIJ A;  3RUL A;  1PDX A;  3URY A;  2EKI A;  3AI5 A;  2JSV X;  1YQ4 B;  4FXC A;  1RYJ A;  4G0N B;  4M0W B;  4DDI D;  3DVG X;  3ALB A;  4B6W A;  1RAX A;  4KDI C;  1VRA B;  4IDI A;  5JHB A;  1FNV A;  4ZHO A;  2SEB D;  1P3Q U;  3MHS D;  2DNF A;  2KAJ A;  2FUH B;  4DHJ B;  4JL9 A;  4NAW A;  4KVG B;  1P98 A;  1HTQ A;  4OZB A;  1WXV A;  2AWT A;  2ZCB A;  3HHM A;  2M56 B;  1JAL A;  2KYW A;  4ZRI A;  4BKT A;  5CHW A;  5HI1 A;  3Q69 A;  3TMP B;  2FIF A;  3O13 A;  3KUZ A;  2KJR A;  3P1M A;  3FAH A;  2PLP A;  2WX1 A;  1Y8R C;  4FJZ A;  2PE6 B;  1XLP A;  1C3T A;  4NNJ B;  1E8Z A;  5FR6 A;  1JML A;  1MG8 A;  4RM9 A;  4LK0 M;  4TV3 A;  4IUM B;  1YQ3 B;  1LM8 B;  3IFW B;  2L05 A;  3QAQ A;  1N61 A;  1WY8 A;  1ZW7 A;  3U7D A;  1MG4 A;  3W1Y A;  1OQR A;  3WAP A;  4X57 B;  4EZJ A;  3LYY A;  4NJ7 A;  3M3J A;  2JYE A;  3DBH B;  2X38 A;  4WAA A;  5FR3 A;  4KKI A;  1GUA B;  1E90 A;  2C7M B;  1FXT B;  2LHD A;  2FCQ A;  1NEK B;  3V05 A;  1ESF A;  1WE7 A;  1WR6 E;  3Q3F A;  4HK2 A;  1R4N B;  3OJ3 A;  2MQJ A;  3I63 C;  1TS3 A;  2WNM A;  1Z2M A;  1WZ0 A;  4PS8 A;  1VZ7 A;  2IGG A;  3DPD A;  1UGM A;  3PS6 A;  2KJH B;  3APC A;  2C7H A;  1PGX A;  3RUI B;  3HRD D;  1C4P A;  3U7Z A;  3KYC D;  4NY0 A;  2MWS B;  4XYC A;  3NJT A;  2RDG A;  2WDQ B;  3N30 A;  2FBW B;  2CHW A;  3A9J A;  1K8R B;  4WQO B;  5CHF A;  2WHI A;  5GXG B;  1WF9 A;  2J52 A;  1M4V A;  3LXF A;  4HEA 1;  1R4M I;  3FKY A;  1GB1 A;  2L0T A;  2XK5 A;  5MPO A;  4M8N A;  2BYT A;  4XZ4 A;  1D4B A;  2JVC A;  1UEL A;  3AU5 A;  2B76 B;  3DBR B;  2L8J A;  1UH6 A;  2Q5W D;  2O2V A;  1WGR A;  1GJZ A;  3H8H A;  3R2T A;  1AN8 A;  1PQS A;  2OHF A;  3M62 B;  4GGQ A;  3ABV B;  1HE8 A;  3AEB B;  4LNI A;  1TBE A;  2DWQ A;  1FIQ A;  5HKH A;  2QHO A;  1SBB B;  2ONQ A;  4LNK A;  2LVQ A;  1F1H A;  3DOW A;  1IPG A;  5FKA C;  3PZD A;  2WXM A;  1YJ1 A;  5IOI A;  4M0W A;  4W9J A;  1UBI A;  1C1Y B;  4YSX B;  2FAZ A;  2GBN A;  5BYR A;  5IA7 A;  4M02 A;  1QLB B;  2L00 B;  2N7D A;  2PW9 A;  3BIN A;  1P7F A;  3H7S A;  2UU7 A;  4BVU C;  3TEZ A;  4K7U A;  1WGK A;  2XEW A;  1S1Q B;  1EO6 A;  1AYF A;  3L0W B;  2LEK A;  1V8C A;  3ZTC A;  3IT6 B;  4BZA A;  2XN9 C;  2KT7 A;  2WDT B;  2KDF B;  3UIN B;  2ZPN A;  2L7R A;  1V5T A;  2MHJ A;  1WSP A;  2K8B A;  1WXQ A;  4KSL C;  2KDB A;  2KWC A;  4B0E A;  1FCC C;  4KSK C;  4P7I A;  4IWQ A;  5GMV A;  1OGW A;  3FC4 A;  3E56 A;  2DAF A;  2NPT B;  3AEF B;  3ZQ4 A;  5KHQ A;  2ZPY A;  1ET9 A;  1EF5 A;  1HXY D;  2JWZ A;  4G50 A;  3KYD D;  4GOC A;  5C3J B;  3R66 C;  4RF1 A;  3RZF A;  2KAN A;  2KZR A;  4ZHP A;  1Q0W B;  3AED B;  3VXW A;  3NRZ A;  2HJ8 A;  3AE7 B;  4JX1 C;  1E7P B;  4EZL A;  5D6J B;  4BBN C;  1HZ5 A;  3ZO5 B;  1KRH A;  4OVZ A;  4OHJ A;  2I1K A;  4HCP B;  2RDH A;  4ZRQ A;  1C4C A;  4MH8 A;  1T0Y A;  4DHZ B;  1B9R A;  1UZX B;  2WXG A;  1HA5 A;  4I6L B;  1Z5S B;  1LO5 D;  1V80 A;  3EUB 2;  3OLM D;  1FCL A;  2WXI A;  3VR9 B;  2PKO A;  2JXX A;  2AYO B;  3AXC A;  4A90 A;  2I38 A;  3DVN U;  4K3C A;  1CMX B;  3QK0 A;  1YD8 U;  4A55 A;  2KKC A;  2XNA C;  2CHZ A;  2N9K A;  3T9L A;  1I4Q A;  4EKU A;  1B1Z A;  2INN E;  2BYE A;  4ZRK A;  5EE9 A;  3ECI A;  4GN1 A;  4BOS C;  1QT9 A;  4ANV A;  1GAQ B;  2DAJ A;  3CST A;  1TZO A;  4C7Z A;  5D3I B;  2IO0 B;  3PRZ A;  5LNK 1;  2EMT A;  2L52 A;  2DX5 B;  2IND C;  2MX2 A;  3UIP B;  2JY6 A;  1P1A A;  3AN1 A;  4NPN A;  2H88 B;  4A3P A;  1SE9 A;  3ZDM C;  2C9W B;  2PPH A;  4GIV A;  1KFY B;  2DZJ A;  2VH2 A;  3DQV A;  3VUW A;  1FNW A;  3LJ3 A;  1SE2 A;  3ZRC A;  2IJ0 A;  3UQA A;  1P0R A;  2IDY A;  2N1W A;  3ZNZ B;  2KMC A;  2QIL A;  4MDK E;  1NBF C;  3ZXR A;  2QC8 A;  2GBM A;  2KJ6 A;  5H8Y E;  3QC8 B;  4WJN A;  4USA A;  5E6N A;  1QQR A;  2NR2 A;  3NVV A;  3Q2A C;  4TSS A;  3HM6 X;  2FID A;  2K8C A;  3BVM A;  1E9M A;  1KOT A;  1QOA A;  3KLS X;  1F2R C;  1JWM D;  3DBR I;  2MBH A;  4RMA A;  4MGZ E;  3CSF A;  3AE2 B;  4RNA A;  3ETR A;  1KF6 B;  1YQB A;  3B9J A;  1ZXH A;  5TSS A;  3NUH B;  2WLB A;  5BMG A;  2BWE S;  3A33 B;  4FA6 A;  4ACF A;  1WX8 A;  2PE9 A;  3EEC A;  4HJK A;  1HEZ E;  5G5H A;  2XBB C;  1VD2 A;  2MCN B;  4KGS A;  3RT3 B;  3PV1 A;  4US9 A;  2YEP B;  4ARC A;  3NZS A;  4WQM A;  2G3Q B;  1OQQ A;  3C8Y A;  3P4Q B;  2KFJ A;  2ZVN A;  3RI7 C;  1XT9 B;  2V1Y A;  1J19 A;  1GC6 A;  1XCT L;  2NPT A;  3X23 A;  4BKS A;  1SIF A;  2BS4 B;  3Q3O C;  2GLS A;  5EDS A;  3IHP C;  1ZKH A;  3L16 A;  4HPL B;  3WCQ A;  2PMV A;  4YL8 A;  1F52 A;  2R2O A;  3H1U A;  4HCN B;  4AS1 A;  4HWI B;  2BYV E;  2IPK D;  4MJS A;  4AWJ A;  3R7R A;  3EC8 A;  4RH6 A;  1TTN A;  3CWI A;  1XLO A;  4FBJ B;  2MBE A;  1EWY C;  1R4M B;  2HTM E;  3LDZ E;  3TJP A;  2KDI A;  4UDU C;  5E6J A;  3CIR B;  2GMI C;  2KHW B;  3RD2 A;  4CYE A;  4IKG A;  1ZXI A;  4AUQ C;  1OEY J;  2IGH A;  2H89 B;  2OJR A;  2WQY B;  2VZK B;  3H7P B;  2WXH A;  1XLN A;  2AQ1 B;  2WX0 A;  1FEH A;  3APF A;  4JE3 B;  3AE6 B;  4HLE A;  2ZJD A;  3AE5 B;  2MJD A;  1K53 A;  4XX5 A;  1NEN B;  4CQN A;  1V81 A;  2FCM A;  3OAW A;  3KQ4 A;  3VTW A;  3TBL D;  4RGT A;  3E9S A;  2W3S A;  4ZYN A;  3DVG Y;  3MTN B;  1FRR A;  1XF5 L;  4FN2 A;  4FHJ A;  3A9J B;  2PVO D;  3JW0 X;  3Q3J A;  4F8C B;  2QCZ A;  3HVD A;  2M8S A;  5TR5 A;  5IN7 A;  2LXC A;  4PK1 A;  5JZE B;  2V9H A;  3MC9 A;  2YLM A;  1XCQ L;  1BML C;  2I1J A;  3ZJT A;  1ZOY B;  2QIE B;  3VVW B;  3DWG C;  2ZCC A;  1L0X B;  2CJN A;  1JW9 D;  1RRB A;  3N1Z C;  2KWU B;  1UGJ A;  1D3Z A;  1V1O A;  3SDL C;  3K9O B;  2MLB A;  4IM3 A;  1SE3 A;  2I2Y A;  3PRE A;  2E3T A;  1Y56 A;  2J0J A;  2JT4 B;  3Q3M C;  4YT0 B;  3V61 A;  2HE7 A;  3IXS A;  1SEB D;  3L4P A;  2FE8 A;  4JQW C;  1X1M A;  3IAM 1;  5G55 A;  2G4D B;  2KWD A;  3PRP B;  2N9P C;  2V0G A;  2CS4 A;  2JRH A;  2CJO A;  1SSN A;  1C78 A;  3BYY B;  3HUI A;  2M4N A;  4B9K A;  3SR6 A;  1N5W A;  5LXH A;  4MEM A; 
#chains in the Genus database with same CATH homology
 5HHD G;  1DYQ A;  2DWQ A;  1E10 A;  1K50 A;  1FIQ A;  2PIA A;  2WXF A;  1UWX A;  4PT5 A;  2INP E;  2ZW0 A;  2DYM A;  3AE1 B;  1SBB B;  2ONQ A;  5BMI A;  1C77 A;  4WH4 A;  5AUI A;  3R2I A;  4YWG G;  2ON8 A;  3HVZ A;  5FKA C;  2WXM A;  1BUI C;  4M0W A;  4RGM A;  1NYR A;  3IT4 B;  1MVK A;  1JQ4 A;  1E6E B;  5G5G A;  1AW7 A;  3W9C B;  4DQO C;  4YSX B;  5BYR A;  5H92 C;  3NVW A;  1NVI D;  3VQI A;  1QLB B;  2PW9 A;  1Q10 A;  4N59 A;  2WXL A;  2BTE A;  1P7F A;  1OFF A;  1QIL A;  3Q8B A;  1IBX A;  3FIL B;  2RMM A;  3BWU D;  2K9X A;  3MFG A;  3R8B A;  3TEZ A;  4HRO A;  1JWS D;  1D6E C;  3TSS A;  4YSZ B;  1WGK A;  2W54 A;  3P4R B;  3P4S B;  2M0A A;  2QJL A;  2DLB A;  2JXT A;  1JWU D;  2L1A A;  3N9Y C;  4HKQ A;  1AYF A;  5EE1 A;  2K3U A;  2WU2 B;  3V3X A;  2LEK A;  1V8C A;  3NVY A;  3IT6 B;  1PFD A;  2V3P A;  4KGT A;  2K0P A;  1K51 A;  1VR9 A;  2XN9 C;  1VDV A;  2N0S B;  1MHH E;  1FFU A;  1ZP0 B;  3RFZ B;  3U4E G;  4ZYS A;  4YXD B;  1YMH E;  1MI0 A;  2R61 A;  3GB1 A;  4US8 A;  1ZUD 2;  1YJI A;  2W55 A;  3Q8C A;  2WXJ A;  3AEG B;  1RWS A;  1GPX A;  1WSP A;  2L32 A;  3PZ8 A;  1PGA A;  4R3D A;  4WIP A;  1L4D B;  2AX5 A;  1DGJ A;  1JWB D;  1CQV A;  1EU4 A;  1WXQ A;  3I57 A;  4B0E A;  2FUG 1;  1XLQ A;  2VZK D;  1FCC C;  3MP9 A;  1I4X A;  1RM6 C;  1C9F A;  2JYT A;  3PZ7 A;  3B2F A;  1DOY A;  3TEY A;  3Q8F A;  4XWW A;  4H2A A;  4GDL B;  2JWU A;  4YTM B;  4KKJ A;  3FC4 A;  3E56 A;  2JU6 X;  3BVZ A;  1VZ6 A;  3P63 A;  1ET6 A;  3AEF B;  1PYW D;  3VRB B;  3ZQ4 A;  1ZDV A;  1TKY A;  1ET9 A;  2ICI A;  5EE3 A;  2GI9 A;  5JXV A;  1HXY D;  1VZ8 A;  1FO4 A;  2W82 A;  5C3J B;  3AEE B;  1SJE D;  1KTK A;  3AE4 B;  4KX6 B;  1BXT A;  4RF1 A;  3AE8 B;  2AQ3 B;  1T6B X;  2MH7 A;  4ZHP A;  1L4Z B;  1A70 A;  4C56 C;  1SE4 A;  2BT6 A;  1F0Z A;  4NAW B;  4J3O D;  1XO3 A;  2GRI A;  1I4G A;  1N5X A;  3AED B;  4RCO A;  1FXA A;  4B0M A;  2G1E A;  3ZJV A;  3GS2 A;  3LB8 C;  3NRZ A;  3AM9 A;  3AE7 B;  1YN5 A;  1D5M C;  1E7P B;  2D5G A;  3KWL A;  4JX1 C;  1HZ5 A;  4NAM A;  1KRH A;  2G9H D;  4OVZ A;  1XEE A;  3Q8A A;  1VLB A;  3TEX A;  4NJC A;  5FK9 C;  4OHJ A;  5EE0 A;  1F77 A;  4HJG E;  2RDH A;  4ZRQ A;  1L0V B;  3RPF C;  1SB3 C;  1C4C A;  4MH8 A;  2EEL A;  1B9R A;  2M19 A;  2WXG A;  1HA5 A;  2NTS A;  4WAF A;  4ITK A;  1LO5 D;  2WU5 B;  2Y5C A;  2YEP F;  3EUB 2;  4EE2 A;  2DYO A;  1FCL A;  1FNU A;  4WWM A;  2BB5 A;  2WXI A;  4Q2J A;  1CJE A;  2PKO A;  1ZPS A;  2W3R A;  4RGN A;  3VR9 B;  5I4D A;  4A90 A;  2I38 A;  4TQ1 A;  2MJ3 A;  4OW0 A;  3W5U B;  4A55 A;  4RFB A;  4L2Y A;  1N63 A;  1TYG B;  1YN4 A;  2XNA C;  2WXK A;  2J53 A;  1TS2 A;  2N9K A;  1QKZ A;  4KGR A;  3SEB A;  1I4Q A;  2PVG C;  2Y3A A;  5BYQ A;  1PGB A;  3UI3 A;  1B1Z A;  2BW2 A;  2INN E;  1L6U A;  5EE9 A;  2QSD A;  2MJE A;  1QT9 A;  1I4H A;  3AV8 A;  2KAC A;  1V1P A;  4NZL B;  1C4A A;  1GAQ B;  1MPE A;  1ENF A;  4HKZ E;  3VRA B;  2L83 A;  2WDR B;  1DOX A;  1TZO A;  2DBY A;  4C7Z A;  2QMT A;  5D3I B;  2LUM A;  5LNK 1;  4C80 A;  1GB4 A;  3ZJU A;  3P4P B;  2BS3 B;  1L5P A;  2Z8L A;  2L52 A;  3AN1 A;  2K22 A;  1JCK B;  4GLS C;  2H88 B;  1FM0 D;  2SAK A;  3MHZ A;  3ZYY X;  1KFY B;  3U2S C;  2OED A;  2GB1 A;  2JQR B;  4LLG M;  1FNW A;  1SE2 A;  3AE9 B;  4YTP B;  3TUO A;  2PTL A;  1JWA D;  2IJ0 A;  1VJK A;  3AEA B;  4WUR A;  3W2D A;  4MM3 B;  2IDY A;  3BZD B;  2BS2 B;  1CZP A;  1J7B A;  3BII D;  2JX5 A;  2QIL A;  2NTT A;  1C79 A;  3EA6 A;  4MAC A;  3AMZ A;  5H8Y E;  1STE A;  1TS5 A;  1F2R I;  3T3O A;  2KMM A;  3AE3 B;  2JZP A;  2WXR A;  2ZW1 A;  4DXG A;  3FIL A;  4USA A;  4JPS A;  3IAS 1;  5C2T B;  1QQR A;  3NVV A;  4TSS A;  3I9V 1;  1JRP A;  1QOG A;  3Q8E A;  4JWU C;  3W5V B;  3BVM A;  1E9M A;  3NZ3 A;  3U52 E;  1MHX A;  1QOA A;  3KLS X;  1F2R C;  2E6X A;  1JWM D;  2AQ2 B;  3J9C A;  2WXQ A;  3GP7 A;  1FRD A;  3AE2 B;  4RF0 A;  4RNA A;  3ETR A;  2V4I B;  1KF6 B;  1R7S A;  1TJE A;  4GDK B;  3B9J A;  1ZXH A;  5TSS A;  3NUH B;  5T8I A;  2WLB A;  5BMG A;  3BK1 A;  4XDD A;  2LMC A;  4N6E B;  4YSY B;  3SFD B;  2BB6 A;  4TMA B;  1HEZ E;  2WXN A;  5G5H A;  4P16 A;  5D3D A;  1L0Y B;  1IGD A;  2N7J A;  4IOI E;  3NVZ A;  4KGS A;  1QOF A;  4US9 A;  2WP9 B;  1IGC A;  1T5X D;  2YEP B;  4N58 A;  4ARC A;  1EM7 A;  4A6Q A;  4XE0 A;  4WQM A;  3NS1 A;  2Y5P A;  1TY0 A;  1OQQ A;  1I4P A;  2J4X A;  3C8Y A;  1SJH D;  3P4Q B;  1J7C A;  1SIJ A;  2WXO A;  4REZ A;  1FFV A;  3VR8 B;  1PDX A;  1XCT L;  3URY A;  2EKI A;  2KQ4 X;  1K52 A;  2BS4 B;  1FXI A;  2JSV X;  1YQ4 B;  4FXC A;  1RYJ A;  4O1N A;  3WCQ A;  1VRA B;  2PMV A;  2LFI A;  2ACZ B;  5D7G A;  2N9L A;  5HFY A;  1CK1 A;  4IDI A;  3MJ5 A;  1YN3 A;  1FNV A;  4ZHO A;  2SEB D;  2MEK A;  4AS1 A;  4ARI A;  1PUT A;  1IBX B;  2IPK D;  1KLG D;  3BYT B;  4ZOH C;  4RH6 A;  4LTU A;  3CWI A;  1UUP A;  1XLO A;  2KAJ A;  3ZGZ A;  4OZA A;  1EWY C;  2HTM E;  2WXP A;  1E0Z A;  2KDM A;  4OZB A;  1XXG A;  2K5P A;  2WDV B;  2QEJ C;  1SXT A;  1HZ6 A;  4UDU C;  5E6J A;  3CIR B;  2M56 B;  2CU3 A;  1JAL A;  1NI3 A;  1YJJ A;  4IKG A;  1ZXI A;  5HI1 A;  3P42 A;  2IGH A;  3Q69 A;  3O13 A;  1EU3 A;  2H89 B;  4P6V F;  3AH7 A;  2WQY B;  2VZK B;  3KWV A;  2WXH A;  3P1M A;  1XLN A;  1N60 A;  3FAH A;  2AQ1 B;  2PLP A;  1FEH A;  3SFE B;  2RPV A;  4JE3 B;  1XLP A;  3AE6 B;  3AE5 B;  2MJD A;  1JML A;  1K53 A;  1GOZ A;  1C76 A;  2V3N A;  4AQ7 A;  4LK0 M;  1NEN B;  4CQN A;  1YQ3 B;  2TSS A;  4HRS A;  1N61 A;  4OZC A;  1P7E A;  3KQ4 A;  1DOI A;  2BBC A;  4L1B A;  1T3Q A;  1OQR A;  1WYG A;  1N62 A;  4RGT A;  3LYY A;  3OWE B;  2LHE A;  3E9S A;  2W3S A;  4DXF A;  2JYE A;  1FRR A;  1XF5 L;  2X38 A;  5FR3 A;  4KKI A;  1L6V A;  1JRO A;  3MC0 B;  2PVO D;  3EGR A;  2LHD A;  1IUE A;  1D5X C;  1I7H A;  1QOB A;  4MT5 A;  1NEK B;  1AWD A;  3HVD A;  1ZE3 D;  1ESF A;  3V05 A;  1NYQ A;  4L23 A;  3BK2 A;  4XWT A;  5HG2 A;  2NMQ A;  3W1S A;  1TS3 A;  2WNM A;  3AEC B;  1KH0 A;  3B2G A;  1I4R A;  1XCQ L;  3AB5 A;  1BML C;  1SF0 A;  3TEW A;  3ZJT A;  1VZ7 A;  1D5Z C;  1ZOY B;  2IGG A;  2QIE B;  1V97 A;  1J7A A;  3DWG C;  1TS4 A;  1L0X B;  1PGX A;  2CJN A;  5AUK A;  1JW9 D;  3HRD D;  4JWS C;  1UWM A;  1EWC A;  1C4P A;  1UGJ A;  3U7Z A;  2LGI A;  1V1O A;  1QF6 A;  4A8X C;  4ZRP A;  4D2K A;  2WS3 B;  2RDG A;  2WDQ B;  1ROE A;  5BMH A;  2FBW B;  1SE3 A;  2I2Y A;  5GXG B;  2J52 A;  2E3T A;  1M4V A;  3LXF A;  4HEA 1;  1Y56 A;  4YT0 B;  2J42 A;  3IXS A;  5BYS A;  1GB1 A;  1SEB D;  1FMA D;  3L4P A;  1WRI A;  2FE8 A;  5MPO A;  2IGD A;  3IAM 1;  2BYT A;  1YNT E;  1ZDX A;  1D4B A;  1TY2 A;  3PO0 A;  4RGO S;  2KWD A;  2B76 B;  1V1P B;  4TQ0 A;  1TKE A;  2V0G A;  2Q5W D;  4XDC A;  1HQR D;  1UNS A;  1WWT A;  3DWM A;  3T3N A;  2LJI A;  2KN4 A;  3H8H A;  3R2T A;  1AN8 A;  2CJO A;  1KLU D;  2OHF A;  3BVG A;  4YTN B;  1FD6 A;  1SSN A;  1C78 A;  3BYY B;  3HUI A;  4A9A A;  3ABV B;  3SR6 A;  1RFK A;  4C7Y A;  3AEB B;  1TKG A;  1ACC A;  1N5W A;  2HDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...