1C9FA

Nmr structure of the cad domain of caspase-activated dnase
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
87
structure length
87
Chain Sequence
b'MCAVLRQPKCVKLRALHSACKFGVAARSCQELLRKGCVRFQLPMPGSRLCLYEDGTEVTDDCFPGLPNDAELLLLTAGETWHGYVSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-ACTIVATED DNASE
publication title Structure of the CAD domain of caspase-activated DNase and interaction with the CAD domain of its inhibitor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 10
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c9fA00
1MHXA 1YMHE 2ZW1A 1XF5L 4IKGA 4KGRA 2JSVX 2LGIA 4HJGE 4OZCA 1K50A 2EELA 1HZ5A 1HEZE 2I38A 5JXVA 1HZ6A 2N9KA 1MVKA 1XCTL 2QMTA 2JWUA 2J53A 2KACA 1PGXA 1P7FA 2LHEA 5HHDG 2GI9A 5BMIA 1FCLA 2IGDA 1JMLA 2RPVA 2IGHA 2KWDA 4OZBA 1MI0A 1YNTE 1XCQL 5BMHA 2KN4A 3MP9A 1F2RC 2KQ4X 2LUMA 2ON8A 1P7EA 2GB1A 1IBXA 1C9FA 2KDMA 1PGBA 1K51A 2QSDA 3FILB 1MPEA 3GB1A 3V3XA 2ONQA 1K52A 4IOIE 1IGDA 1F2RI 2LHDA 5HI1A 1QKZA 2PLPA 1MHHE 1IGCA 2J52A 1K53A 3UI3A 1GB1A 2JU6X 2IGGA 2N7JA 2OEDA 2JZPA 2N9LA 2RMMA 1GB4A 4D2KA 3FILA 1FCCC 2JXTA 4GLSC 4HKZE 5HG2A 1Q10A 4KGTA 5BMGA 2NMQA 1D4BA 2I2YA 4WH4A 4KGSA 1KH0A 4MACA 1FD6A 1EM7A 2K0PA 1UWXA 2PTLA 1ZXHA 1IBXB 5HFYA 2PW9A 4OZAA 2ZW0A 1PGAA
chains in the Genus database with same CATH superfamily
1SE2A 2KT7A 1UBIA 2C5LC 3TEYA 1C79A 2PJHA 1K8RB 3EA6A 2ZW1A 1TT5B 4IKGA 2O6VA 3PRZA 3IT6B 2NTTA 4FJZA 3A4RA 2Y5PA 3JSVB 4JE3B 2W54A 4W9HA 4HDOA 4GOCA 1FMAD 4IWPA 4KSLC 4WQMA 1WX8A 3PT2B 2JWUA 1XO3A 4WWMA 3DOWA 1SB3C 3WAMA 2GI9A 5BMIA 2FNJB 4M0WB 3AEGB 3ZIMA 3ZJUA 1VZ8A 1LFDA 3TMPB 3ZKJC 4MGZE 1WJUA 1GOZA 2UU7A 1YX5B 4XWTA 4DK5A 3Q3FA 4RGTA 2LXCA 3U7DA 1KLVA 2W3SA 4URKA 4MJSA 4ANXA 2Z0EB 1LM8B 1GC6A 4US8A 3NVYA 4IM3A 3QCAA 2B76B 3W1SC 1DGJA 2C7MB 2J52A 4B0EA 3P2BA 3PZ8A 5C23A 3T9LA 2M56B 4L1BA 5T8IA 1WGGA 2JYEA 4WWNA 2KJRA 2LGXA 4HKZE 4NAMA 3S2AA 3B9JA 1D4BA 2I2YA 3EHVA 4KGSA 2D2QA 5CHFA 2PTLA 2ZNVB 2I1JA 3UIPB 1EF5A 2YEPF 2D11A 4HRSA 4G0NB 5IOIA 1JWSD 3E56A 2SEBD 1EF1A 1EWCA 4LJOB 2WQYB 2KXJA 3UQAA 5DCNA 5LXIB 2L8JA 5FK9C 2DNFA 2NBUA 4KV2A 1NENB 1T3QA 4YTNB 2Q5WD 4HCPB 1AARA 5JH5C 1TZOA 2QMTA 5BYRA 2ZCBA 1CMXB 2DZKA 3ZO5B 4LTUA 5FR3A 2CHWA 4G50A 4ZRIA 2MCNB 4NJ6A 3PHWB 2LZ6A 3KUCB 4OZBA 2LI5A 4M8NA 3VDZA 2OJWA 4P6VF 3TCAA 1E0ZA 2LUMA 1JQ4A 4EE2A 4XDDA 2LUEA 2YEPB 3ABVB 2KMCA 4LNOA 2GB1A 1IBXA 3VXWA 2KDMA 1D5MC 3AU5A 1PGBA 3BK2A 4HVBA 2CU3A 2M8SA 2DAJA 2MA9B 1DOYA 3ZNZB 2NR2A 2D10A 1TKGA 3W5UB 4LCDE 4C7YA 1E5WA 3VVWB 4PYUA 2L0FA 3A4SC 3CIRB 2KN5A 2WXHA 4GGQA 3PHXB 3DBHB 3CMMB 3MFGA 2PVOD 3N3KB 5C3JB 3EECA 4IDIA 2KFJA 3ALBA 4FJVB 2FIDA 3DHIC 3L16A 4W9DA 1QT9A 1KH0A 5I4DA 1V9JA 3NJTA 2BWES 5HFYA 3HVDA 1RFAA 1WGKA 3NOBA 3UIOB 2EMTA 3M63B 4MGIE 3ZYYX 1WGYA 1S1QB 2BKRB 4AOFA 3SDLC 3ZTCA 2BKFA 3AI5A 3QWZB 1EWYC 3IT4B 3T8MA 3VFKA 4ICUA 4LJPB 2L83A 1C78A 2ZEQA 3AE3B 3ZXRA 2PE9A 3I57A 2J53A 5EE1A 4JIOU 1P7FA 1WMHA 4C7ZA 1I4PA 1FCLA 2O6VD 1WGDA 1H8CA 3T3NA 2BYTA 3ZRCA 1NYQA 1YJIA 5DPWA 4MH8A 3M3JA 4FN2A 2KO3A 4TUUA 3GE8C 3PZ7A 2YLMA 2DYOA 1NBFC 2KD0A 2HJ1A 3VR9B 1VR9A 3AB5A 3W2DA 2MEKA 2NBVB 3VH4B 3DDCB 3IXSA 1WGRA 4DHZE 4G3XB 1YN4A 2KDBA 3PGEA 4Q2JA 3U30A 4KZCA 1WXMA 3RN9C 1WI0A 4RH6A 2QHOA 1UWMA 2XBBC 4QAYA 4HDQA 2V4IB 2KTFA 2CHZA 3AE5B 4GDKB 1ZOYB 4WIPA 4D2KA 4M01A 1N5XA 4XC2A 4II2B 4GMVA 4NNJB 5JHAA 2N9PC 2BYVE 3DBSA 1D6EC 2ZZPB 2R61A 1E7PB 2VZKD 1UBQA 4XWWA 4ZHPA 2ZW0A 2EMSA 3URYA 4EZJA 2JWZA 3FC4A 5IN7A 1TY2A 3BYYB 2EELA 4HROA 3I5JC 1OFFA 3BYTB 4BKGA 3P4RB 3BY4B 3AULA 3C8YA 2L7RA 4W9GA 2DAFA 4JPSA 3SHQA 3NZSA 1JWBD 4IUMB 1E90A 4YWGG 4KKJA 1L0XB 2LVPA 3ZVVA 3N32A 2GRIA 4W9KA 3H9DA 1IP9A 2N4FA 2WXKA 4OVVA 1BXTA 4MEMA 1T5XD 1RYJA 4AWJA 3AEAB 4A6QA 3WIMA 2AQ1B 4A3PA 1YJJA 3AEEB 2HE7A 3B0AA 2BT6A 3NUHB 3NZ3A 1JALA 3EFCA 2O2VA 3HK0A 2MP2A 3Q69A 3GE3C 5IO9A 3UI3A 3OJ4B 2FAZA 3RNGC 3I9V1 1GUAB 1HA5A 1WYGA 4HEA1 2BQQA 1DYQA 2MWSB 1SE4A 2G3QB 2Y5CA 3VH3B 4KSKC 1E8XA 1SF0A 4P7IA 4GLSC 2Z59B 2X8XX 2G45B 1KM7A 1WFYA 4FULA 1SXTA 3B08A 3QHTA 2J0MA 3SD5A 3SFDB 4MJSB 2LRWA 4MH0E 2HD5B 4GDLB 4WAAA 1GG3A 4MDKE 4ZOHC 3R7RA 2BB5A 4GSWA 3KUDB 3RNCC 1E7VA 2V9HA 2N7EA 2Y5BB 2VZKB 4K7WA 2GBKA 3AE1B 3NY5A 2M4NA 1JWUD 1I4XA 4F8CB 3BVZA 3OJ3A 3RCZA 4MSQB 1V5TA 2IO2B 3A9JA 5E6OA 2W3RA 3NRZA 1Q1OA 2HJ8A 1E8WA 2UYZB 2MLBA 3QK0A 2JPHA 2NTSA 3R66C 1XLQA 1IUEA 4PK1A 1CJEA 4OHJA 3ML9A 2FUHB 3L4PA 4NAWA 3Q8AA 2J42A 2BF8B 3E9SA 3MC9A 1TS4A 3BINA 2LGSA 2K8CA 4J3OD 4RF1A 4DHJD 3TBLD 2PE6B 2WWZA 1RFKA 3DBRI 2JU6X 1HTQA 4WQOB 4IG7B 2IGGA 3A33B 2JZPA 4G11A 3MC8A 2K1FA 3Q3OC 4ARIA 1RM6C 4RM8A 2JXTA 1AYFA 1TY0A 3OG5A 1FNUA 3AM9A 1Y56A 1IPGA 2KWUB 2LJ5A 4USAA 2SAKA 1V1PB 3WAPA 3U4EG 3PLVA 2VRRB 1IBXB 2FBWB 5D6JB 4HXDA 2WDTB 4TV3A 2IPKD 4W9CA 4JLCA 2KMMA 5FR6A 4HKQA 4HJKA 4KGRA 4AUQC 2JXXA 3ZNGC 2WGSA 2R2QA 4YSZB 3ETRA 1R4MI 1PUTA 1HEZE 2QILA 3AEFB 3I63C 2C7NB 4A8XC 1FXIA 2MBQA 2V3PA 3L13A 2KACA 4WJOA 2KANA 4AP4C 3NVVA 1WM2A 2RGFA 4N59A 4EEWA 3BIID 4BBNC 1FO4A 2BS2B 3D32A 2LASA 4RF0A 2LRUA 4PS3A 1V49A 3RD2A 1WRDB 2NVUI 2DLBA 2WXQA 4N6EB 4F7ZA 1P3QU 1IYFA 4ICVA 1WRIA 2MJEA 5AUKA 1A5RA 1KFYB 3TIXA 5H92C 3KYDD 2WXIA 3OWEB 3FILA 2MW5A 2N1VA 1SE9A 1T0RC 4E71A 1WMHB 4K7SA 3U52E 3ZUNA 2BBCA 1T0QC 1FNWA 2FCNA 4DHJB 4AJWA 4LDTD 1ZXHA 3PLUA 2BS4B 1SIFA 1WZ3A 2KFKA 3H7PA 1UD7A 3DPDA 4JWUC 5DPTA 2XK5B 2KTRA 1MG8A 5D2MB 2NPTA 5J18A 4E74A 2WNMA 2L52A 4A20A 1WR6E 2BVCA 2IBIB 1ZDVA 2EKIA 2ZCCA 3PTFC 4M8MA 1G6JA 1SIJA 2GBJA 2E6XA 3IAM1 2W55A 4S0RA 3O13A 1WSPA 3KYCD 3H1UA 2ZJDA 1FEHA 2LGDA 1AWDA 1BUIC 1MFWA 3QC8B 2A4ZA 3TJPA 2WDVB 3AE2B 4II3B 2IJ0A 3IAS1 1WJNA 5IA7A 3M62B 3Q3NC 3AXCA 2XNAC 2GLSA 2WXMA 4YXDB 2RD0A 4K1RB 2KKCA 1C9FA 1YQ4B 1ZUD2 3P4SB 3N9YC 4MGKE 1K51A 3NZUA 3N20C 3GB1A 1U4AA 1NYRA 1XLPA 4IOIE 1VRAB 2KC1A 4S17A 2LFIA 2GBMA 3UF8A 1RLFA 1I4GA 4PT5A 1QOGA 2MBOA 4GIVA 5AUIA 2RMMA 3I3TB 4FADA 1VDVA 2KHWB 2MRPA 2WP9B 1FCCC 1YN5A 4FHJA 1XQQA 3UQBA 2AQ2B 2FCQA 3BZDB 3ZLZA 1PYWD 2DYMA 3NS1A 3L0WB 3R8BA 2C9WB 1F1HA 4ZRJA 4ANVA 3GOEA 3R7QA 2JZZA 4W9IA 1JCKB 3V6EB 4RFBA 3VRAB 2INCC 3SFEB 1YMHE 4RGMA 4KDLB 2JSVX 4PS8A 3LYYA 3RYTA 4RGOS 1C3TA 2MP2B 4B9KA 4LDTB 5JXVA 1L7YA 2REXA 3EFUA 1Q0WB 4GU2A 1MVKA 3QA8A 4RMAA 3MJ5A 1N5WA 4BKSA 3L10B 5BYSA 5HHDG 3LXFA 3KUZA 1UUPA 4JX1C 1C4CA 1BT0A 3DCGA 2L0TA 3VHTC 3O65B 3JSVA 1WF9A 3P63A 2WU5B 2WX1A 3MP9A 1WYWB 2PVGC 2D3CA 4C4VB 3W1YA 2QSDA 1PDXA 3K9OB 2R2OA 2KWVB 3DWMA 3RUIB 3ML8A 3WAOA 4M0WA 3M95A 2M17A 4KIKA 3RNFC 2PLPA 1IGCA 2GBNA 4US9A 1YOVB 4HCNB 5D3DA 3AH7A 3IVFA 1ENFA 3RMKC 4M00A 3APFA 3VRBB 5LXHA 2AX5A 3ZNID 3A9JB 2NCNA 2KJ6A 4K81A 1CQVA 1OGWA 2RDBC 5AZHA 2KYWA 3BWUD 3X23A 1J7CA 2G4SA 3N1ZC 1V2YA 3A9KB 4IWOA 4IM2A 1WE7A 1C4PA 2PW9A 3BK1A 3VUWA 2KVRA 3UGBB 4MM3B 2PEAA 1XF5L 2L32A 1ZGUB 3PZDA 4BFRA 4C80A 2M0XA 4A90A 1K50A 4WJNA 4DDID 4TKNA 1L6UA 3RNAC 2KLGA 3Q3JA 5LNK1 3DBHI 2DBYA 2AL6A 1ESFA 1Z5SB 4WWOA 3W9CB 1E6EB 2KVZA 1F0ZA 1QILA 3VQIA 2INNE 2K3UA 3GZNI 4TSSA 4LK0M 1H4RA 2C7HA 2IGDA 2RPQA 5G2NA 2AL3A 2AWTA 2JX5A 3PVLA 1V8CA 4TQ0A 3RT3B 2HDEA 3U7ZA 2WX0A 2PKOA 4BBNF 2KLCA 1VCBA 2WDQB 1R4NI 2DZMA 2KNBA 3W5VB 4UDUC 2V4LA 2KC2A 3A1QB 3V60A 2KJHB 2ZPNA 5G5GA 1E9MA 1T0SC 3H7SA 2LHDA 2NBWB 2WXOA 1VD2A 2L00B 3LDZE 1I4QA 4K3CA 2OJRA 3ENEA 2IDYA 5J17A 2N7JA 3QARA 1L0VB 4I6LB 3AE7B 2KAJA 2TSSA 3QQ8B 4MT5A 4OW0A 1J7AA 3NG0A 4B95A 1JWMD 1N6ZA 3QIJA 1FXTB 2I1KA 2QC8A 5D94A 2O6VB 2FCSA 3EC8A 4RGNA 3MJWA 4KKIA 3JW0X 1QOFA 4ZHOA 1YN3A 1T6BX 1UNSA 3AE6B 1TJEA 2K9XA 5EDSA 1PGAA 3DBRB 5H8YE 4AQ7A 1OQRA 2K6QA 3HM6X 1LQBA 4PS7A 1VZ7A 2LXAA 1L0YB 3AE4B 1FXAA 1WR1A 4OZCA 1ACCA 2VH2A 1YQBA 1KRHA 4JGHB 2L05A 4YTMB 3T3OA 1HZ6A 4N58A 2N9KA 2V0GA 2DENB 1N60A 1JROA 2J7QB 1ZKHA 2FE8A 1ZP0B 5G5HA 2ACZB 5EE0A 3AEBB 3TEWA 4LNKA 1WXAA 3IG3A 3DBLB 1N63A 2NS5A 5HKHA 1V97A 2KWDA 5BYQA 1S3SG 1TZ1A 4OVUA 3L17A 2DYBA 3NS8A 2V1YA 3GS2A 2KFKB 1R4MB 2BYFA 2KWCA 3H7PB 5E6PA 2MJDA 4ZRPA 1VZ6A 3VUXA 2NPTB 1RRBA 2MBHA 2LVOA 3Q2AC 2KOXA 5L95C 2M0AA 3ZTDA 4GXBA 2J0JA 3V61A 2FUG1 3NHEB 4EOYA 1F2RI 1WM3A 2IY1B 4B6WA 1AW7A 2W9NA 4LNIA 4WAFA 3Q14C 2VH1A 4W9LA 4LNFA 4A55A 1LGRA 1GAQB 3RPFC 2KDFB 1NI3A 2JQRB 1D5ZC 2JY6A 1KOTA 5HG2A 2WU2B 4I6NB 1EM7A 1UWXA 2RR9A 1J0GA 1WXVA 4GDKA 3ZDTA 2MBEA 4C00A 1M94A 4FA6A 2RDGA 2LGIA 2FIFA 3VUYA 4AJYB 2M19A 4ZYSA 4X57B 3VAWA 5DPRA 2KZRA 3HRDD 2CHXA 3RULA 1EO6A 4BOSC 4L23A 4RM9A 1YJ1A 1Z2MA 1HQRD 3RZWC 2LHEA 1QOBA 2H88B 2INDC 3P4PB 5BMHA 3H6NA 4NJCA 1F2RC 2ON8A 3RZFA 2K8BA 2Z8LA 1ET6A 1SE3A 1RWSA 3AU4A 1WWTA 3VTUA 3PV1A 2AYOB 2ONQA 4FJYA 1TTNA 1E7UA 1IGDA 1M4VA 5BO4B 1EUVB 5D3IB 3TEZA 2JYTA 1X1MA 2LMCA 4L2YA 1SGHA 1ZE3D 2K39A 2M1MA 3P42A 1QLBB 3WANA 4AS1A 2Y3AA 3APDA 1XT9B 2NMQA 2KQSA 1JW9D 4YSXB 4MACA 1FD6A 2K0PA 4HPMB 3C0RB 1FNVA 5IKCM 4FHKA 3AV8A 4NY0A 3KWLA 3HHMA 4OZAA 5E6JA 1GNUA 1JWAD 2IO1B 5CX3A 3R2IA 4I6PA 1QZEA 4EZLA 2J4XA 1Y8RC 1FRRA 3HUIA 4HWIB 4KIKB 4GN1A 5CTRC 3ZJTA 4NQLB 5C2TB 1LO5D 2JRIB 1P0RA 3V62A 5FKAC 1B9RA 2PMVA 2BB6A 4FBJB 1WGHA 3C19A 4C56C 4GDLA 3WCQA 1JMLA 4XX5A 1UGJA 4HPPA 5GXGB 3W1SA 2MBBB 2LEKA 2MSED 3DWGC 3HM3A 1I7HA 3R3MA 2XN9C 2WLBA 3PSEB 4A3OA 1WY8A 1SBBB 2G1EA 2BW2A 3APCA 3KQ4A 3EGRA 4WJQA 4K7UA 1ZPSA 3TUOA 2DZJA 1LXDA 3BVGA 3MTNB 2BGFA 3EUB2 1DOXA 2OEDA 2J0KA 1KF6B 2OOBB 1WH3A 1N61A 2JT4B 1F52A 4DDGD 1L5PA 2IO0B 1KJTA 5CHVC 3PPAA 4ASWC 1Q10A 4W9JA 2BYEA 1TS3A 4WJPA 3VTVA 2GOWA 3V05A 4DXAB 4CO7A 1V86A 3DHGC 2JVCA 1R7SA 2V3NA 5C1ZA 1CZPA 1L4ZB 5E6NA 4KX6B 2WXJA 3N30A 3PRMB 1OQYA 1XLNA 4ZRQA 5AZGA 1J8CA 2C60A 3N1YC 1A70A 1V1PA 3SEBA 1XXGA 1C76A 2I38A 2LD9A 1GPXA 3B2FA 1HTOA 5D7GA 2N1WA 2KDEB 3ECIA 3R2TA 3U8ZA 3HIZA 1KTKA 2PPHA 2V3SA 4B0MA 4J6IA 4YSYB 4YL8A 1ROEA 2MX2A 4ZYNA 2BPSA 3JYUA 2HTHA 3QAQA 2O2VB 1QOAA 2WDRB 3RNEC 1FM0D 4P1CC 3RNBC 3CWIA 3OLMD 4LLGM 3UINB 1OTRB 2K6DB 2QDFA 3FKYA 3MHSD 2LWPA 4XYCA 4K3BA 2QCZA 2K22A 4XDCA 1K52A 2KQ7A 3GZNB 1C77A 5HI1A 2HTME 5LLIA 2BTEA 3IFWB 3TEXA 1GB1A 3N1XC 1ET9A 1GC7A 1SJHD 1GB4A 2MH7A 2G4DB 2WXLA 4BKTA 2L1AA 2LVQA 3IBEA 1R4NB 2JZ3B 1DOIA 2Z0DB 3AEDB 1STEA 4IWQA 5IP4D 2MQJA 3QX1A 4XZ4A 3KVFB 1ZDXA 4XGAB 3RFZB 2XEWA 3B1LX 1P9DU 1V1OA 1WE6A 2D3AA 2PIAA 4BOZB 2CKHB 1MHXA 1HXYD 2INPE 3LJ3A 3NVWA 4REZA 3IHPC 2D5GA 2W82A 3ZW3A 1TKYA 1L4DB 2N0SB 4EKUA 4HJGE 2CR5A 1N62A 4HPLB 4JQWC 4YT0B 4JWSC 2L76A 4EFOA 1I4RA 3TL5A 4ZDVA 4XE0A 3DVGY 3WA0A 4ARCA 3VR8B 4NAWB 1FRDA 4A9AA 2XK5A 1AN8A 3CSTA 4DWFA 1PGXA 2IZVB 3ZNHB 1J7BA 4R3DA 4RCOA 1ZW7A 4PYZA 2WHIA 1UH6A 1VLBA 2OHFA 2RPVA 2MHJA 1HE8A 1JRUA 3WALA 3MC0B 4BZAA 2DZIA 4ANWA 5DPSA 2ZNVC 2G9HD 1WXQA 1P98A 2AEHA 1P7EA 4ZRKA 3JVZX 3DHHC 3V6CB 2DWQA 2WXFA 1D3ZA 4GB9A 4WURA 5EE3A 1MPEA 3Q6BA 1MJDA 3QJZA 3V3XA 5L83A 1GJZA 2ZPYA 3FAHA 3DVNU 1KLUD 1E8ZA 1EU4A 2BWFA 4KDIC 2RSUA 4OVZA 2D3GA 2B3AA 1C4AA 1V80A 1XEEA 3PO0A 2IO3B 4O1NA 2D3BA 4IM0A 2FCMA 1TKEA 2CJNA 4IC7B 3LB8C 1V5OA 4WWPA 3KWVA 1FFVA 4M02A 1XLOA 2QIEB 1F9JA 2K8HA 4TQ1A 1V6EA 3CF6E 2KX0A 1WX9A 2K25A 3HVZA 1SJED 2ZVOA 1E10A 3ONSA 2IY0B 1WZ0A 1L6VA 2K5PA 1QF6A 4CHKA 4DHZB 5G55A 1QQRA 1TIFA 3BVMA 1SSNA 3DVGX 5TSSA 4DXFA 1YD8U 2LJIA 2WXGA 3ZRFA 4KZ0A 2BS3B 2CJOA 1EU3A 2GMIC 2RDHA 1NEKB 3X0WA 1PQSA 1TYGB 2JUOA 3ZGZA 3Q3MC 4NJ7A 3ZQ4A 3P4QB 3VTWA 1WX7A 5MPOA 2IYDB 2IGHA 4DBGA 5EE9A 2KDIA 1MI0A 1UF0A 1YNTE 1WJ4A 5J2RA 2AQ3B 1Q5WB 3L08A 1F77A 1B1ZA 1OEYJ 2KQ4X 3Q8EA 3ZJVA 3SU8X 1WJ6A 1P1AA 1C1YB 2N7DA 1UGMA 4E3CA 1UELA 1NI2A 3FILB 3AMZA 3H8HA 3DVNV 4MELA 1XD3B 1D5XC 2UWQA 1L2NA 4H2AA 1QKZA 5AEKB 2WXNA 1YIWA 1TS5A 2H89B 3RI7C 1MHHE 2WYQA 2QJLA 2CU1A 2E3TA 4DXGA 1UZXB 4NPNA 5IAAC 4ITKA 4BVUC 1OQQA 4C4VA 1BMLC 1YQ3B 4F1SA 4BKSD 2MJ3A 1TS2A 4KVGB 2KTRB 2YVCA 4MGYE 3OAWA 2DX5B 4BAXA 2JRHA 3AECB 1WIAA 3SR6A 4NQKE 2QEJC 3KLSX 4KGTA 2KK8A 2X38A 3AN1A 4TMAB 3KW5B 2EKEC 3PRPB 2D07B 3ZDMC 1I35A 1FFUA 3CSFA 3Q8CA 4LNNA 1CK1A 3NVZA 3MHZA 3AE9B 2L3ZA 2DHZA 3A9KA 1RAXA 1HZ5A 4CQNA 1VJKA 1XCTL 2A5UA 2WXPA 2ZVNA 3PREA 4MM3A 4W9EA 2N9XA 5TR5A 1SEBD 1I4HA 4FXCA 3PS6A 5CHWA 4HLEA 5GMVA 3U2SC 4HK2A 4EZKA 1XCQL 3J9CA 2KN4A 1ISNA 1FIQA 4DQOC 1MG4A 1FPYA 4FLHA 1I42A 3KH0A 3P1MA 4P1BC 4MSMB 2WS3B 1WXSA 4N9F4 1KLGD 4NZLB 4YTPB 1V81A 2KMAA 3DQVA 1PFDA 2LGYA 4RNAA 4ANUA 3B2GA 2CS4A 5KHQA 1K53A 4IW0A 1T0YA 3AE8B 3Q8BA 2ASQA 3K9PB 1NDDA 5JZEB 3DBLI 2N9LA 2KX3A 1E8YA 2N9EB 1OEYA 3A1QA 3TSSA 1JRPA 1J19A 3GP7A 5AZFA 1TBEA 1NVID 1TGZB 2ICIA 5BMGA 4W9FA 1YX6B 3Q8FA 4WH4A 5JHBA 4P16A 2GBRA 4EUTA 4JL9A 2JF5A 3L54A 4CYEA 5KHOA 3ZXVA 4ACFA 1ZXIA 2WXRA
chains in the Genus database with same CATH topology
1CZPA 1SE2A 1L4ZB 4KX6B 3TEYA 1C79A 2WXJA 3EA6A 4MM3B 2ZW1A 1XF5L 4IKGA 2L32A 1XLNA 4ZRQA 3IT6B 2NTTA 4GDLB 4C80A 4A90A 1A70A 4ZOHC 2Y5PA 1K50A 1V1PA 3SEBA 1XXGA 2BB5A 1L6UA 1C76A 4JE3B 5LNK1 2I38A 2VZKB 2W54A 1GPXA 3AE1B 3B2FA 1JWUD 2DBYA 5D7GA 1FMAD 1ESFA 1I4XA 4WQMA 3BVZA 3W9CB 3R2TA 1E6EB 2JWUA 1F0ZA 1XO3A 1QILA 4WWMA 3VQIA 1KTKA 1SB3C 2INNE 2K3UA 2W3RA 4B0MA 4TSSA 3NRZA 2GI9A 4LK0M 5BMIA 2IGDA 4YSYB 1ROEA 2NTSA 3AEGB 1XLQA 1IUEA 2JX5A 3ZJUA 1V8CA 1CJEA 4TQ0A 1VZ8A 4OHJA 1QOAA 2WDRB 2HDEA 1FM0D 3U7ZA 3CWIA 1GOZA 2PKOA 4LLGM 4XWTA 3L4PA 3Q8AA 4RGTA 2WDQB 2W3SA 3W5VB 4UDUC 2J42A 2K22A 3E9SA 5G5GA 1TS4A 4XDCA 4US8A 1E9MA 1K52A 3NVYA 2LHDA 1C77A 5HI1A 4J3OD 2B76B 1DGJA 2WXOA 2HTME 4RF1A 2BTEA 2J52A 3TEXA 1I4QA 1RFKA 4B0EA 1GB1A 2JU6X 3PZ8A 2IDYA 2IGGA 2N7JA 1L0VB 1ET9A 2M56B 3AE7B 4L1BA 2JZPA 2KAJA 2TSSA 5T8IA 1SJHD 4MT5A 1GB4A 2JYEA 4OW0A 1J7AA 2MH7A 2WXLA 1JWMD 4ARIA 2L1AA 1DOIA 3AEDB 1RM6C 1STEA 4RGNA 2JXTA 4HKZE 4NAMA 4KKIA 1AYFA 1TY0A 3B9JA 1FNUA 3AM9A 1Y56A 1D4BA 2I2YA 1QOFA 4KGSA 4USAA 1ZDXA 1V1PB 2SAKA 3RFZB 1V1OA 2PTLA 3U4EG 2PIAA 4ZHOA 1YN3A 1T6BX 1UNSA 2YEPF 1IBXB 3AE6B 1TJEA 2FBWB 2K9XA 4HRSA 1PGAA 1MHXA 5H8YE 2IPKD 1JWSD 1HXYD 2INPE 3E56A 4AQ7A 1OQRA 2SEBD 2KMMA 3NVWA 4REZA 2D5GA 4HKQA 1EWCA 2W82A 1TKYA 1VZ7A 2WQYB 1L4DB 1L0YB 2N0SB 4KGRA 4HJGE 3AE4B 1N62A 1FXAA 4OZCA 5FK9C 1ACCA 4YT0B 1NENB 1T3QA 4JWSC 4YTNB 2Q5WD 4YSZB 3ETRA 1I4RA 1PUTA 1KRHA 1HEZE 4YTMB 3T3OA 1HZ6A 2QILA 2N9KA 4N58A 4XE0A 2V0GA 1N60A 1JROA 1TZOA 3AEFB 4ARCA 3VR8B 2QMTA 4NAWB 1FRDA 5BYRA 4A8XC 1FXIA 2FE8A 1ZP0B 5G5HA 2V3PA 4A9AA 2ACZB 4LTUA 1AN8A 3AEBB 5EE0A 3TEWA 2KACA 5FR3A 1PGXA 1J7BA 4R3DA 4RCOA 1N63A 1VLBA 2OHFA 2RPVA 4OZBA 1V97A 2KWDA 3NVVA 5BYQA 4P6VF 3MC0B 4N59A 1E0ZA 3BIID 2G9HD 2LUMA 1JQ4A 1FO4A 4EE2A 2BS2B 1WXQA 2YEPB 3ABVB 4XDDA 1P7EA 2GB1A 3GS2A 1IBXA 2KDMA 1D5MC 4RF0A 1PGBA 2MJDA 3BK2A 2CU3A 4ZRPA 1VZ6A 2DWQA 2WXFA 4WURA 2DLBA 2WXQA 5EE3A 1MPEA 4N6EB 2M0AA 3V3XA 2FUG1 3FAHA 1DOYA 1KLUD 1EU4A 1F2RI 1WRIA 2MJEA 1AW7A 4OVZA 1TKGA 1C4AA 1XEEA 4WAFA 5AUKA 3W5UB 4C7YA 3PO0A 4O1NA 1KFYB 4A55A 1TKEA 2CJNA 1GAQB 3CIRB 5H92C 2WXHA 3RPFC 2WXIA 3OWEB 3FILA 2PVOD 3LB8C 3MFGA 1NI3A 5C3JB 4IDIA 3U52E 3KWVA 1FFVA 2JQRB 2BBCA 1D5ZC 1FNWA 1XLOA 5HG2A 2QIEB 1QT9A 4TQ1A 2WU2B 1KH0A 1EM7A 1UWXA 5I4DA 1ZXHA 2BS4B 5HFYA 3HVDA 1WGKA 3HVZA 1SJED 4JWUC 1E10A 3ZYYX 1L6VA 2WNMA 2K5PA 2L52A 1QF6A 2RDGA 1QQRA 2LGIA 1ZDVA 3BVMA 1SSNA 2EKIA 5TSSA 2M19A 4ZYSA 1EWYC 3IT4B 1SIJA 4DXFA 2LJIA 2E6XA 2WXGA 3HRDD 3IAM1 4L23A 2L83A 1C78A 2W55A 2BS3B 3O13A 2CJOA 1EU3A 1WSPA 3AE3B 1HQRD 1NEKB 2RDHA 3I57A 5EE1A 2J53A 1FEHA 1AWDA 1BUIC 1TYGB 1P7FA 2LHEA 3ZGZA 4C7ZA 1QOBA 2WDVB 3AE2B 1I4PA 2H88B 1FCLA 2IJ0A 3ZQ4A 3P4QB 3IAS1 5MPOA 2IGHA 3T3NA 5EE9A 2BYTA 1MI0A 1YNTE 1NYQA 2AQ3B 1F77A 1YJIA 1B1ZA 2XNAC 3P4PB 5BMHA 4NJCA 2WXMA 4MH8A 1F2RC 2KQ4X 2ON8A 3Q8EA 3ZJVA 4YXDB 2Z8LA 1ET6A 3PZ7A 1C9FA 1YQ4B 2DYOA 1ZUD2 3P4SB 3N9YC 1SE3A 1K51A 1RWSA 3VR9B 1VR9A 3FILB 3AMZA 3H8HA 3AB5A 3W2DA 2MEKA 1WWTA 3GB1A 3IXSA 1D5XC 1NYRA 1XLPA 2ONQA 4IOIE 1VRAB 1IGDA 1M4VA 4H2AA 1QKZA 2WXNA 1TS5A 1YN4A 2H89B 5D3IB 2LFIA 1MHHE 3TEZA 4Q2JA 2QJLA 2E3TA 1I4GA 4PT5A 4RH6A 4DXGA 2JYTA 1UWMA 1QOGA 2V4IB 5AUIA 3AE5B 4ITKA 1OQQA 4GDKB 1ZOYB 4WIPA 2RMMA 2LMCA 4L2YA 1BMLC 1YQ3B 4D2KA 1N5XA 2MJ3A 1TS2A 1ZE3D 1VDVA 3P42A 3AECB 1QLBB 2WP9B 3SR6A 1FCCC 1YN5A 2Y3AA 2QEJC 4AS1A 3KLSX 4KGTA 2NMQA 2X38A 1D6EC 2AQ2B 1JW9D 3BZDB 4YSXB 1PYWD 2DYMA 4MACA 2K0PA 3AN1A 3NS1A 4TMAB 2R61A 1FD6A 1E7PB 1FNVA 3R8BA 2VZKD 4XWWA 3AV8A 4ZHPA 1FFUA 3KWLA 4OZAA 2ZW0A 5E6JA 1JWAD 3R2IA 1JCKB 3Q8CA 4RFBA 3VRAB 1CK1A 3SFEB 1YMHE 3URYA 3NVZA 4RGMA 2J4XA 3AE9B 3FC4A 2JSVX 3MHZA 1FRRA 1TY2A 3BYYB 3HUIA 3LYYA 2EELA 4RGOS 4HROA 1OFFA 1HZ5A 3ZJTA 5JXVA 3BYTB 4CQNA 3P4RB 1VJKA 3C8YA 1MVKA 4JPSA 1XCTL 5C2TB 1LO5D 3MJ5A 1JWBD 1N5WA 5FKAC 2WXPA 1B9RA 4YWGG 2PMVA 4KKJA 2BB6A 5BYSA 5HHDG 1L0XB 3LXFA 1UUPA 4JX1C 1C4CA 2GRIA 4C56C 1SEBD 1I4HA 3WCQA 1JMLA 4FXCA 1UGJA 3U2SC 2WXKA 5GXGB 3W1SA 3P63A 1XCQL 1BXTA 3J9CA 2LEKA 2KN4A 3DWGC 2WU5B 1I7HA 3MP9A 1T5XD 1FIQA 4DQOC 1RYJA 3AEAB 3P1MA 2PVGC 4A6QA 2XN9C 2AQ1B 2WS3B 2WLBA 1YJJA 3AEEB 2QSDA 1PDXA 1KLGD 3DWMA 1SBBB 2BT6A 3NUHB 4NZLB 3NZ3A 4YTPB 2G1EA 1JALA 4M0WA 1PFDA 2BW2A 4RNAA 3KQ4A 2PLPA 3EGRA 3B2GA 3Q69A 1IGCA 1K53A 1ZPSA 3TUOA 3UI3A 3BVGA 4US9A 3AE8B 3I9V1 3EUB2 3Q8BA 3AH7A 5D3DA 1DOXA 2OEDA 1ENFA 1HA5A 1KF6B 2N9LA 1WYGA 4HEA1 3VRBB 1DYQA 1SE4A 2Y5CA 1N61A 2AX5A 3TSSA 1L5PA 1JRPA 3GP7A 1SF0A 1CQVA 4GLSC 3BWUD 1NVID 1Q10A 2ICIA 5BMGA 1TS3A 3Q8FA 4WH4A 1J7CA 4P16A 1SXTA 3V05A 1C4PA 2PW9A 1R7SA 2V3NA 1ZXIA 3SFDB 2WXRA 3BK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHX A;  1YMH E;  2ZW1 A;  1XF5 L;  4IKG A;  4KGR A;  2JSV X;  2LGI A;  4HJG E;  4OZC A;  1K50 A;  2EEL A;  1HZ5 A;  1HEZ E;  2I38 A;  5JXV A;  1HZ6 A;  2N9K A;  1MVK A;  1XCT L;  2QMT A;  2JWU A;  2J53 A;  2KAC A;  1PGX A;  1P7F A;  2LHE A;  5HHD G;  2GI9 A;  5BMI A;  1FCL A;  2IGD A;  1JML A;  2RPV A;  2IGH A;  2KWD A;  4OZB A;  1MI0 A;  1YNT E;  1XCQ L;  5BMH A;  2KN4 A;  3MP9 A;  1F2R C;  2KQ4 X;  2LUM A;  2ON8 A;  1P7E A;  2GB1 A;  1IBX A;  1C9F A;  2KDM A;  1PGB A;  1K51 A;  2QSD A;  3FIL B;  1MPE A;  3GB1 A;  3V3X A;  2ONQ A;  1K52 A;  4IOI E;  1IGD A;  1F2R I;  2LHD A;  5HI1 A;  1QKZ A;  2PLP A;  1MHH E;  1IGC A;  2J52 A;  1K53 A;  3UI3 A;  1GB1 A;  2JU6 X;  2IGG A;  2N7J A;  2OED A;  2JZP A;  2N9L A;  2RMM A;  1GB4 A;  4D2K A;  3FIL A;  1FCC C;  2JXT A;  4GLS C;  4HKZ E;  5HG2 A;  1Q10 A;  4KGT A;  5BMG A;  2NMQ A;  1D4B A;  2I2Y A;  4WH4 A;  4KGS A;  1KH0 A;  4MAC A;  1FD6 A;  1EM7 A;  2K0P A;  1UWX A;  2PTL A;  1ZXH A;  1IBX B;  5HFY A;  2PW9 A;  4OZA A;  2ZW0 A;  1PGA A; 
#chains in the Genus database with same CATH topology
 1SE2 A;  2KT7 A;  1UBI A;  2C5L C;  3TEY A;  1C79 A;  2PJH A;  1K8R B;  3EA6 A;  2ZW1 A;  1TT5 B;  4IKG A;  2O6V A;  3PRZ A;  3IT6 B;  2NTT A;  4FJZ A;  3A4R A;  2Y5P A;  3JSV B;  4JE3 B;  2W54 A;  4W9H A;  4HDO A;  4GOC A;  1FMA D;  4IWP A;  4KSL C;  4WQM A;  1WX8 A;  3PT2 B;  2JWU A;  1XO3 A;  4WWM A;  3DOW A;  1SB3 C;  3WAM A;  2GI9 A;  5BMI A;  2FNJ B;  4M0W B;  3AEG B;  3ZIM A;  3ZJU A;  1VZ8 A;  1LFD A;  3TMP B;  3ZKJ C;  4MGZ E;  1WJU A;  1GOZ A;  2UU7 A;  1YX5 B;  4XWT A;  4DK5 A;  3Q3F A;  4RGT A;  2LXC A;  3U7D A;  1KLV A;  2W3S A;  4URK A;  4MJS A;  4ANX A;  2Z0E B;  1LM8 B;  1GC6 A;  4US8 A;  3NVY A;  4IM3 A;  3QCA A;  2B76 B;  3W1S C;  1DGJ A;  2C7M B;  2J52 A;  4B0E A;  3P2B A;  3PZ8 A;  5C23 A;  3T9L A;  2M56 B;  4L1B A;  5T8I A;  1WGG A;  2JYE A;  4WWN A;  2KJR A;  2LGX A;  4HKZ E;  4NAM A;  3S2A A;  3B9J A;  1D4B A;  2I2Y A;  3EHV A;  4KGS A;  2D2Q A;  5CHF A;  2PTL A;  2ZNV B;  2I1J A;  3UIP B;  1EF5 A;  2YEP F;  2D11 A;  4HRS A;  4G0N B;  5IOI A;  1JWS D;  3E56 A;  2SEB D;  1EF1 A;  1EWC A;  4LJO B;  2WQY B;  2KXJ A;  3UQA A;  5DCN A;  5LXI B;  2L8J A;  5FK9 C;  2DNF A;  2NBU A;  4KV2 A;  1NEN B;  1T3Q A;  4YTN B;  2Q5W D;  4HCP B;  1AAR A;  5JH5 C;  1TZO A;  2QMT A;  5BYR A;  2ZCB A;  1CMX B;  2DZK A;  3ZO5 B;  4LTU A;  5FR3 A;  2CHW A;  4G50 A;  4ZRI A;  2MCN B;  4NJ6 A;  3PHW B;  2LZ6 A;  3KUC B;  4OZB A;  2LI5 A;  4M8N A;  3VDZ A;  2OJW A;  4P6V F;  3TCA A;  1E0Z A;  2LUM A;  1JQ4 A;  4EE2 A;  4XDD A;  2LUE A;  2YEP B;  3ABV B;  2KMC A;  4LNO A;  2GB1 A;  1IBX A;  3VXW A;  2KDM A;  1D5M C;  3AU5 A;  1PGB A;  3BK2 A;  4HVB A;  2CU3 A;  2M8S A;  2DAJ A;  2MA9 B;  1DOY A;  3ZNZ B;  2NR2 A;  2D10 A;  1TKG A;  3W5U B;  4LCD E;  4C7Y A;  1E5W A;  3VVW B;  4PYU A;  2L0F A;  3A4S C;  3CIR B;  2KN5 A;  2WXH A;  4GGQ A;  3PHX B;  3DBH B;  3CMM B;  3MFG A;  2PVO D;  3N3K B;  5C3J B;  3EEC A;  4IDI A;  2KFJ A;  3ALB A;  4FJV B;  2FID A;  3DHI C;  3L16 A;  4W9D A;  1QT9 A;  1KH0 A;  5I4D A;  1V9J A;  3NJT A;  2BWE S;  5HFY A;  3HVD A;  1RFA A;  1WGK A;  3NOB A;  3UIO B;  2EMT A;  3M63 B;  4MGI E;  3ZYY X;  1WGY A;  1S1Q B;  2BKR B;  4AOF A;  3SDL C;  3ZTC A;  2BKF A;  3AI5 A;  3QWZ B;  1EWY C;  3IT4 B;  3T8M A;  3VFK A;  4ICU A;  4LJP B;  2L83 A;  1C78 A;  2ZEQ A;  3AE3 B;  3ZXR A;  2PE9 A;  3I57 A;  2J53 A;  5EE1 A;  4JIO U;  1P7F A;  1WMH A;  4C7Z A;  1I4P A;  1FCL A;  2O6V D;  1WGD A;  1H8C A;  3T3N A;  2BYT A;  3ZRC A;  1NYQ A;  1YJI A;  5DPW A;  4MH8 A;  3M3J A;  4FN2 A;  2KO3 A;  4TUU A;  3GE8 C;  3PZ7 A;  2YLM A;  2DYO A;  1NBF C;  2KD0 A;  2HJ1 A;  3VR9 B;  1VR9 A;  3AB5 A;  3W2D A;  2MEK A;  2NBV B;  3VH4 B;  3DDC B;  3IXS A;  1WGR A;  4DHZ E;  4G3X B;  1YN4 A;  2KDB A;  3PGE A;  4Q2J A;  3U30 A;  4KZC A;  1WXM A;  3RN9 C;  1WI0 A;  4RH6 A;  2QHO A;  1UWM A;  2XBB C;  4QAY A;  4HDQ A;  2V4I B;  2KTF A;  2CHZ A;  3AE5 B;  4GDK B;  1ZOY B;  4WIP A;  4D2K A;  4M01 A;  1N5X A;  4XC2 A;  4II2 B;  4GMV A;  4NNJ B;  5JHA A;  2N9P C;  2BYV E;  3DBS A;  1D6E C;  2ZZP B;  2R61 A;  1E7P B;  2VZK D;  1UBQ A;  4XWW A;  4ZHP A;  2ZW0 A;  2EMS A;  3URY A;  4EZJ A;  2JWZ A;  3FC4 A;  5IN7 A;  1TY2 A;  3BYY B;  2EEL A;  4HRO A;  3I5J C;  1OFF A;  3BYT B;  4BKG A;  3P4R B;  3BY4 B;  3AUL A;  3C8Y A;  2L7R A;  4W9G A;  2DAF A;  4JPS A;  3SHQ A;  3NZS A;  1JWB D;  4IUM B;  1E90 A;  4YWG G;  4KKJ A;  1L0X B;  2LVP A;  3ZVV A;  3N32 A;  2GRI A;  4W9K A;  3H9D A;  1IP9 A;  2N4F A;  2WXK A;  4OVV A;  1BXT A;  4MEM A;  1T5X D;  1RYJ A;  4AWJ A;  3AEA B;  4A6Q A;  3WIM A;  2AQ1 B;  4A3P A;  1YJJ A;  3AEE B;  2HE7 A;  3B0A A;  2BT6 A;  3NUH B;  3NZ3 A;  1JAL A;  3EFC A;  2O2V A;  3HK0 A;  2MP2 A;  3Q69 A;  3GE3 C;  5IO9 A;  3UI3 A;  3OJ4 B;  2FAZ A;  3RNG C;  3I9V 1;  1GUA B;  1HA5 A;  1WYG A;  4HEA 1;  2BQQ A;  1DYQ A;  2MWS B;  1SE4 A;  2G3Q B;  2Y5C A;  3VH3 B;  4KSK C;  1E8X A;  1SF0 A;  4P7I A;  4GLS C;  2Z59 B;  2X8X X;  2G45 B;  1KM7 A;  1WFY A;  4FUL A;  1SXT A;  3B08 A;  3QHT A;  2J0M A;  3SD5 A;  3SFD B;  4MJS B;  2LRW A;  4MH0 E;  2HD5 B;  4GDL B;  4WAA A;  1GG3 A;  4MDK E;  4ZOH C;  3R7R A;  2BB5 A;  4GSW A;  3KUD B;  3RNC C;  1E7V A;  2V9H A;  2N7E A;  2Y5B B;  2VZK B;  4K7W A;  2GBK A;  3AE1 B;  3NY5 A;  2M4N A;  1JWU D;  1I4X A;  4F8C B;  3BVZ A;  3OJ3 A;  3RCZ A;  4MSQ B;  1V5T A;  2IO2 B;  3A9J A;  5E6O A;  2W3R A;  3NRZ A;  1Q1O A;  2HJ8 A;  1E8W A;  2UYZ B;  2MLB A;  3QK0 A;  2JPH A;  2NTS A;  3R66 C;  1XLQ A;  1IUE A;  4PK1 A;  1CJE A;  4OHJ A;  3ML9 A;  2FUH B;  3L4P A;  4NAW A;  3Q8A A;  2J42 A;  2BF8 B;  3E9S A;  3MC9 A;  1TS4 A;  3BIN A;  2LGS A;  2K8C A;  4J3O D;  4RF1 A;  4DHJ D;  3TBL D;  2PE6 B;  2WWZ A;  1RFK A;  3DBR I;  2JU6 X;  1HTQ A;  4WQO B;  4IG7 B;  2IGG A;  3A33 B;  2JZP A;  4G11 A;  3MC8 A;  2K1F A;  3Q3O C;  4ARI A;  1RM6 C;  4RM8 A;  2JXT A;  1AYF A;  1TY0 A;  3OG5 A;  1FNU A;  3AM9 A;  1Y56 A;  1IPG A;  2KWU B;  2LJ5 A;  4USA A;  2SAK A;  1V1P B;  3WAP A;  3U4E G;  3PLV A;  2VRR B;  1IBX B;  2FBW B;  5D6J B;  4HXD A;  2WDT B;  4TV3 A;  2IPK D;  4W9C A;  4JLC A;  2KMM A;  5FR6 A;  4HKQ A;  4HJK A;  4KGR A;  4AUQ C;  2JXX A;  3ZNG C;  2WGS A;  2R2Q A;  4YSZ B;  3ETR A;  1R4M I;  1PUT A;  1HEZ E;  2QIL A;  3AEF B;  3I63 C;  2C7N B;  4A8X C;  1FXI A;  2MBQ A;  2V3P A;  3L13 A;  2KAC A;  4WJO A;  2KAN A;  4AP4 C;  3NVV A;  1WM2 A;  2RGF A;  4N59 A;  4EEW A;  3BII D;  4BBN C;  1FO4 A;  2BS2 B;  3D32 A;  2LAS A;  4RF0 A;  2LRU A;  4PS3 A;  1V49 A;  3RD2 A;  1WRD B;  2NVU I;  2DLB A;  2WXQ A;  4N6E B;  4F7Z A;  1P3Q U;  1IYF A;  4ICV A;  1WRI A;  2MJE A;  5AUK A;  1A5R A;  1KFY B;  3TIX A;  5H92 C;  3KYD D;  2WXI A;  3OWE B;  3FIL A;  2MW5 A;  2N1V A;  1SE9 A;  1T0R C;  4E71 A;  1WMH B;  4K7S A;  3U52 E;  3ZUN A;  2BBC A;  1T0Q C;  1FNW A;  2FCN A;  4DHJ B;  4AJW A;  4LDT D;  1ZXH A;  3PLU A;  2BS4 B;  1SIF A;  1WZ3 A;  2KFK A;  3H7P A;  1UD7 A;  3DPD A;  4JWU C;  5DPT A;  2XK5 B;  2KTR A;  1MG8 A;  5D2M B;  2NPT A;  5J18 A;  4E74 A;  2WNM A;  2L52 A;  4A20 A;  1WR6 E;  2BVC A;  2IBI B;  1ZDV A;  2EKI A;  2ZCC A;  3PTF C;  4M8M A;  1G6J A;  1SIJ A;  2GBJ A;  2E6X A;  3IAM 1;  2W55 A;  4S0R A;  3O13 A;  1WSP A;  3KYC D;  3H1U A;  2ZJD A;  1FEH A;  2LGD A;  1AWD A;  1BUI C;  1MFW A;  3QC8 B;  2A4Z A;  3TJP A;  2WDV B;  3AE2 B;  4II3 B;  2IJ0 A;  3IAS 1;  1WJN A;  5IA7 A;  3M62 B;  3Q3N C;  3AXC A;  2XNA C;  2GLS A;  2WXM A;  4YXD B;  2RD0 A;  4K1R B;  2KKC A;  1C9F A;  1YQ4 B;  1ZUD 2;  3P4S B;  3N9Y C;  4MGK E;  1K51 A;  3NZU A;  3N20 C;  3GB1 A;  1U4A A;  1NYR A;  1XLP A;  4IOI E;  1VRA B;  2KC1 A;  4S17 A;  2LFI A;  2GBM A;  3UF8 A;  1RLF A;  1I4G A;  4PT5 A;  1QOG A;  2MBO A;  4GIV A;  5AUI A;  2RMM A;  3I3T B;  4FAD A;  1VDV A;  2KHW B;  2MRP A;  2WP9 B;  1FCC C;  1YN5 A;  4FHJ A;  1XQQ A;  3UQB A;  2AQ2 B;  2FCQ A;  3BZD B;  3ZLZ A;  1PYW D;  2DYM A;  3NS1 A;  3L0W B;  3R8B A;  2C9W B;  1F1H A;  4ZRJ A;  4ANV A;  3GOE A;  3R7Q A;  2JZZ A;  4W9I A;  1JCK B;  3V6E B;  4RFB A;  3VRA B;  2INC C;  3SFE B;  1YMH E;  4RGM A;  4KDL B;  2JSV X;  4PS8 A;  3LYY A;  3RYT A;  4RGO S;  1C3T A;  2MP2 B;  4B9K A;  4LDT B;  5JXV A;  1L7Y A;  2REX A;  3EFU A;  1Q0W B;  4GU2 A;  1MVK A;  3QA8 A;  4RMA A;  3MJ5 A;  1N5W A;  4BKS A;  3L10 B;  5BYS A;  5HHD G;  3LXF A;  3KUZ A;  1UUP A;  4JX1 C;  1C4C A;  1BT0 A;  3DCG A;  2L0T A;  3VHT C;  3O65 B;  3JSV A;  1WF9 A;  3P63 A;  2WU5 B;  2WX1 A;  3MP9 A;  1WYW B;  2PVG C;  2D3C A;  4C4V B;  3W1Y A;  2QSD A;  1PDX A;  3K9O B;  2R2O A;  2KWV B;  3DWM A;  3RUI B;  3ML8 A;  3WAO A;  4M0W A;  3M95 A;  2M17 A;  4KIK A;  3RNF C;  2PLP A;  1IGC A;  2GBN A;  4US9 A;  1YOV B;  4HCN B;  5D3D A;  3AH7 A;  3IVF A;  1ENF A;  3RMK C;  4M00 A;  3APF A;  3VRB B;  5LXH A;  2AX5 A;  3ZNI D;  3A9J B;  2NCN A;  2KJ6 A;  4K81 A;  1CQV A;  1OGW A;  2RDB C;  5AZH A;  2KYW A;  3BWU D;  3X23 A;  1J7C A;  2G4S A;  3N1Z C;  1V2Y A;  3A9K B;  4IWO A;  4IM2 A;  1WE7 A;  1C4P A;  2PW9 A;  3BK1 A;  3VUW A;  2KVR A;  3UGB B;  4MM3 B;  2PEA A;  1XF5 L;  2L32 A;  1ZGU B;  3PZD A;  4BFR A;  4C80 A;  2M0X A;  4A90 A;  1K50 A;  4WJN A;  4DDI D;  4TKN A;  1L6U A;  3RNA C;  2KLG A;  3Q3J A;  5LNK 1;  3DBH I;  2DBY A;  2AL6 A;  1ESF A;  1Z5S B;  4WWO A;  3W9C B;  1E6E B;  2KVZ A;  1F0Z A;  1QIL A;  3VQI A;  2INN E;  2K3U A;  3GZN I;  4TSS A;  4LK0 M;  1H4R A;  2C7H A;  2IGD A;  2RPQ A;  5G2N A;  2AL3 A;  2AWT A;  2JX5 A;  3PVL A;  1V8C A;  4TQ0 A;  3RT3 B;  2HDE A;  3U7Z A;  2WX0 A;  2PKO A;  4BBN F;  2KLC A;  1VCB A;  2WDQ B;  1R4N I;  2DZM A;  2KNB A;  3W5V B;  4UDU C;  2V4L A;  2KC2 A;  3A1Q B;  3V60 A;  2KJH B;  2ZPN A;  5G5G A;  1E9M A;  1T0S C;  3H7S A;  2LHD A;  2NBW B;  2WXO A;  1VD2 A;  2L00 B;  3LDZ E;  1I4Q A;  4K3C A;  2OJR A;  3ENE A;  2IDY A;  5J17 A;  2N7J A;  3QAR A;  1L0V B;  4I6L B;  3AE7 B;  2KAJ A;  2TSS A;  3QQ8 B;  4MT5 A;  4OW0 A;  1J7A A;  3NG0 A;  4B95 A;  1JWM D;  1N6Z A;  3QIJ A;  1FXT B;  2I1K A;  2QC8 A;  5D94 A;  2O6V B;  2FCS A;  3EC8 A;  4RGN A;  3MJW A;  4KKI A;  3JW0 X;  1QOF A;  4ZHO A;  1YN3 A;  1T6B X;  1UNS A;  3AE6 B;  1TJE A;  2K9X A;  5EDS A;  1PGA A;  3DBR B;  5H8Y E;  4AQ7 A;  1OQR A;  2K6Q A;  3HM6 X;  1LQB A;  4PS7 A;  1VZ7 A;  2LXA A;  1L0Y B;  3AE4 B;  1FXA A;  1WR1 A;  4OZC A;  1ACC A;  2VH2 A;  1YQB A;  1KRH A;  4JGH B;  2L05 A;  4YTM B;  3T3O A;  1HZ6 A;  4N58 A;  2N9K A;  2V0G A;  2DEN B;  1N60 A;  1JRO A;  2J7Q B;  1ZKH A;  2FE8 A;  1ZP0 B;  5G5H A;  2ACZ B;  5EE0 A;  3AEB B;  3TEW A;  4LNK A;  1WXA A;  3IG3 A;  3DBL B;  1N63 A;  2NS5 A;  5HKH A;  1V97 A;  2KWD A;  5BYQ A;  1S3S G;  1TZ1 A;  4OVU A;  3L17 A;  2DYB A;  3NS8 A;  2V1Y A;  3GS2 A;  2KFK B;  1R4M B;  2BYF A;  2KWC A;  3H7P B;  5E6P A;  2MJD A;  4ZRP A;  1VZ6 A;  3VUX A;  2NPT B;  1RRB A;  2MBH A;  2LVO A;  3Q2A C;  2KOX A;  5L95 C;  2M0A A;  3ZTD A;  4GXB A;  2J0J A;  3V61 A;  2FUG 1;  3NHE B;  4EOY A;  1F2R I;  1WM3 A;  2IY1 B;  4B6W A;  1AW7 A;  2W9N A;  4LNI A;  4WAF A;  3Q14 C;  2VH1 A;  4W9L A;  4LNF A;  4A55 A;  1LGR A;  1GAQ B;  3RPF C;  2KDF B;  1NI3 A;  2JQR B;  1D5Z C;  2JY6 A;  1KOT A;  5HG2 A;  2WU2 B;  4I6N B;  1EM7 A;  1UWX A;  2RR9 A;  1J0G A;  1WXV A;  4GDK A;  3ZDT A;  2MBE A;  4C00 A;  1M94 A;  4FA6 A;  2RDG A;  2LGI A;  2FIF A;  3VUY A;  4AJY B;  2M19 A;  4ZYS A;  4X57 B;  3VAW A;  5DPR A;  2KZR A;  3HRD D;  2CHX A;  3RUL A;  1EO6 A;  4BOS C;  4L23 A;  4RM9 A;  1YJ1 A;  1Z2M A;  1HQR D;  3RZW C;  2LHE A;  1QOB A;  2H88 B;  2IND C;  3P4P B;  5BMH A;  3H6N A;  4NJC A;  1F2R C;  2ON8 A;  3RZF A;  2K8B A;  2Z8L A;  1ET6 A;  1SE3 A;  1RWS A;  3AU4 A;  1WWT A;  3VTU A;  3PV1 A;  2AYO B;  2ONQ A;  4FJY A;  1TTN A;  1E7U A;  1IGD A;  1M4V A;  5BO4 B;  1EUV B;  5D3I B;  3TEZ A;  2JYT A;  1X1M A;  2LMC A;  4L2Y A;  1SGH A;  1ZE3 D;  2K39 A;  2M1M A;  3P42 A;  1QLB B;  3WAN A;  4AS1 A;  2Y3A A;  3APD A;  1XT9 B;  2NMQ A;  2KQS A;  1JW9 D;  4YSX B;  4MAC A;  1FD6 A;  2K0P A;  4HPM B;  3C0R B;  1FNV A;  5IKC M;  4FHK A;  3AV8 A;  4NY0 A;  3KWL A;  3HHM A;  4OZA A;  5E6J A;  1GNU A;  1JWA D;  2IO1 B;  5CX3 A;  3R2I A;  4I6P A;  1QZE A;  4EZL A;  2J4X A;  1Y8R C;  1FRR A;  3HUI A;  4HWI B;  4KIK B;  4GN1 A;  5CTR C;  3ZJT A;  4NQL B;  5C2T B;  1LO5 D;  2JRI B;  1P0R A;  3V62 A;  5FKA C;  1B9R A;  2PMV A;  2BB6 A;  4FBJ B;  1WGH A;  3C19 A;  4C56 C;  4GDL A;  3WCQ A;  1JML A;  4XX5 A;  1UGJ A;  4HPP A;  5GXG B;  3W1S A;  2MBB B;  2LEK A;  2MSE D;  3DWG C;  3HM3 A;  1I7H A;  3R3M A;  2XN9 C;  2WLB A;  3PSE B;  4A3O A;  1WY8 A;  1SBB B;  2G1E A;  2BW2 A;  3APC A;  3KQ4 A;  3EGR A;  4WJQ A;  4K7U A;  1ZPS A;  3TUO A;  2DZJ A;  1LXD A;  3BVG A;  3MTN B;  2BGF A;  3EUB 2;  1DOX A;  2OED A;  2J0K A;  1KF6 B;  2OOB B;  1WH3 A;  1N61 A;  2JT4 B;  1F52 A;  4DDG D;  1L5P A;  2IO0 B;  1KJT A;  5CHV C;  3PPA A;  4ASW C;  1Q10 A;  4W9J A;  2BYE A;  1TS3 A;  4WJP A;  3VTV A;  2GOW A;  3V05 A;  4DXA B;  4CO7 A;  1V86 A;  3DHG C;  2JVC A;  1R7S A;  2V3N A;  5C1Z A;  1CZP A;  1L4Z B;  5E6N A;  4KX6 B;  2WXJ A;  3N30 A;  3PRM B;  1OQY A;  1XLN A;  4ZRQ A;  5AZG A;  1J8C A;  2C60 A;  3N1Y C;  1A70 A;  1V1P A;  3SEB A;  1XXG A;  1C76 A;  2I38 A;  2LD9 A;  1GPX A;  3B2F A;  1HTO A;  5D7G A;  2N1W A;  2KDE B;  3ECI A;  3R2T A;  3U8Z A;  3HIZ A;  1KTK A;  2PPH A;  2V3S A;  4B0M A;  4J6I A;  4YSY B;  4YL8 A;  1ROE A;  2MX2 A;  4ZYN A;  2BPS A;  3JYU A;  2HTH A;  3QAQ A;  2O2V B;  1QOA A;  2WDR B;  3RNE C;  1FM0 D;  4P1C C;  3RNB C;  3CWI A;  3OLM D;  4LLG M;  3UIN B;  1OTR B;  2K6D B;  2QDF A;  3FKY A;  3MHS D;  2LWP A;  4XYC A;  4K3B A;  2QCZ A;  2K22 A;  4XDC A;  1K52 A;  2KQ7 A;  3GZN B;  1C77 A;  5HI1 A;  2HTM E;  5LLI A;  2BTE A;  3IFW B;  3TEX A;  1GB1 A;  3N1X C;  1ET9 A;  1GC7 A;  1SJH D;  1GB4 A;  2MH7 A;  2G4D B;  2WXL A;  4BKT A;  2L1A A;  2LVQ A;  3IBE A;  1R4N B;  2JZ3 B;  1DOI A;  2Z0D B;  3AED B;  1STE A;  4IWQ A;  5IP4 D;  2MQJ A;  3QX1 A;  4XZ4 A;  3KVF B;  1ZDX A;  4XGA B;  3RFZ B;  2XEW A;  3B1L X;  1P9D U;  1V1O A;  1WE6 A;  2D3A A;  2PIA A;  4BOZ B;  2CKH B;  1MHX A;  1HXY D;  2INP E;  3LJ3 A;  3NVW A;  4REZ A;  3IHP C;  2D5G A;  2W82 A;  3ZW3 A;  1TKY A;  1L4D B;  2N0S B;  4EKU A;  4HJG E;  2CR5 A;  1N62 A;  4HPL B;  4JQW C;  4YT0 B;  4JWS C;  2L76 A;  4EFO A;  1I4R A;  3TL5 A;  4ZDV A;  4XE0 A;  3DVG Y;  3WA0 A;  4ARC A;  3VR8 B;  4NAW B;  1FRD A;  4A9A A;  2XK5 A;  1AN8 A;  3CST A;  4DWF A;  1PGX A;  2IZV B;  3ZNH B;  1J7B A;  4R3D A;  4RCO A;  1ZW7 A;  4PYZ A;  2WHI A;  1UH6 A;  1VLB A;  2OHF A;  2RPV A;  2MHJ A;  1HE8 A;  1JRU A;  3WAL A;  3MC0 B;  4BZA A;  2DZI A;  4ANW A;  5DPS A;  2ZNV C;  2G9H D;  1WXQ A;  1P98 A;  2AEH A;  1P7E A;  4ZRK A;  3JVZ X;  3DHH C;  3V6C B;  2DWQ A;  2WXF A;  1D3Z A;  4GB9 A;  4WUR A;  5EE3 A;  1MPE A;  3Q6B A;  1MJD A;  3QJZ A;  3V3X A;  5L83 A;  1GJZ A;  2ZPY A;  3FAH A;  3DVN U;  1KLU D;  1E8Z A;  1EU4 A;  2BWF A;  4KDI C;  2RSU A;  4OVZ A;  2D3G A;  2B3A A;  1C4A A;  1V80 A;  1XEE A;  3PO0 A;  2IO3 B;  4O1N A;  2D3B A;  4IM0 A;  2FCM A;  1TKE A;  2CJN A;  4IC7 B;  3LB8 C;  1V5O A;  4WWP A;  3KWV A;  1FFV A;  4M02 A;  1XLO A;  2QIE B;  1F9J A;  2K8H A;  4TQ1 A;  1V6E A;  3CF6 E;  2KX0 A;  1WX9 A;  2K25 A;  3HVZ A;  1SJE D;  2ZVO A;  1E10 A;  3ONS A;  2IY0 B;  1WZ0 A;  1L6V A;  2K5P A;  1QF6 A;  4CHK A;  4DHZ B;  5G55 A;  1QQR A;  1TIF A;  3BVM A;  1SSN A;  3DVG X;  5TSS A;  4DXF A;  1YD8 U;  2LJI A;  2WXG A;  3ZRF A;  4KZ0 A;  2BS3 B;  2CJO A;  1EU3 A;  2GMI C;  2RDH A;  1NEK B;  3X0W A;  1PQS A;  1TYG B;  2JUO A;  3ZGZ A;  3Q3M C;  4NJ7 A;  3ZQ4 A;  3P4Q B;  3VTW A;  1WX7 A;  5MPO A;  2IYD B;  2IGH A;  4DBG A;  5EE9 A;  2KDI A;  1MI0 A;  1UF0 A;  1YNT E;  1WJ4 A;  5J2R A;  2AQ3 B;  1Q5W B;  3L08 A;  1F77 A;  1B1Z A;  1OEY J;  2KQ4 X;  3Q8E A;  3ZJV A;  3SU8 X;  1WJ6 A;  1P1A A;  1C1Y B;  2N7D A;  1UGM A;  4E3C A;  1UEL A;  1NI2 A;  3FIL B;  3AMZ A;  3H8H A;  3DVN V;  4MEL A;  1XD3 B;  1D5X C;  2UWQ A;  1L2N A;  4H2A A;  1QKZ A;  5AEK B;  2WXN A;  1YIW A;  1TS5 A;  2H89 B;  3RI7 C;  1MHH E;  2WYQ A;  2QJL A;  2CU1 A;  2E3T A;  4DXG A;  1UZX B;  4NPN A;  5IAA C;  4ITK A;  4BVU C;  1OQQ A;  4C4V A;  1BML C;  1YQ3 B;  4F1S A;  4BKS D;  2MJ3 A;  1TS2 A;  4KVG B;  2KTR B;  2YVC A;  4MGY E;  3OAW A;  2DX5 B;  4BAX A;  2JRH A;  3AEC B;  1WIA A;  3SR6 A;  4NQK E;  2QEJ C;  3KLS X;  4KGT A;  2KK8 A;  2X38 A;  3AN1 A;  4TMA B;  3KW5 B;  2EKE C;  3PRP B;  2D07 B;  3ZDM C;  1I35 A;  1FFU A;  3CSF A;  3Q8C A;  4LNN A;  1CK1 A;  3NVZ A;  3MHZ A;  3AE9 B;  2L3Z A;  2DHZ A;  3A9K A;  1RAX A;  1HZ5 A;  4CQN A;  1VJK A;  1XCT L;  2A5U A;  2WXP A;  2ZVN A;  3PRE A;  4MM3 A;  4W9E A;  2N9X A;  5TR5 A;  1SEB D;  1I4H A;  4FXC A;  3PS6 A;  5CHW A;  4HLE A;  5GMV A;  3U2S C;  4HK2 A;  4EZK A;  1XCQ L;  3J9C A;  2KN4 A;  1ISN A;  1FIQ A;  4DQO C;  1MG4 A;  1FPY A;  4FLH A;  1I42 A;  3KH0 A;  3P1M A;  4P1B C;  4MSM B;  2WS3 B;  1WXS A;  4N9F 4;  1KLG D;  4NZL B;  4YTP B;  1V81 A;  2KMA A;  3DQV A;  1PFD A;  2LGY A;  4RNA A;  4ANU A;  3B2G A;  2CS4 A;  5KHQ A;  1K53 A;  4IW0 A;  1T0Y A;  3AE8 B;  3Q8B A;  2ASQ A;  3K9P B;  1NDD A;  5JZE B;  3DBL I;  2N9L A;  2KX3 A;  1E8Y A;  2N9E B;  1OEY A;  3A1Q A;  3TSS A;  1JRP A;  1J19 A;  3GP7 A;  5AZF A;  1TBE A;  1NVI D;  1TGZ B;  2ICI A;  5BMG A;  4W9F A;  1YX6 B;  3Q8F A;  4WH4 A;  5JHB A;  4P16 A;  2GBR A;  4EUT A;  4JL9 A;  2JF5 A;  3L54 A;  4CYE A;  5KHO A;  3ZXV A;  4ACF A;  1ZXI A;  2WXR A; 
#chains in the Genus database with same CATH homology
 1CZP A;  1SE2 A;  1L4Z B;  4KX6 B;  3TEY A;  1C79 A;  2WXJ A;  3EA6 A;  4MM3 B;  2ZW1 A;  1XF5 L;  4IKG A;  2L32 A;  1XLN A;  4ZRQ A;  3IT6 B;  2NTT A;  4GDL B;  4C80 A;  4A90 A;  1A70 A;  4ZOH C;  2Y5P A;  1K50 A;  1V1P A;  3SEB A;  1XXG A;  2BB5 A;  1L6U A;  1C76 A;  4JE3 B;  5LNK 1;  2I38 A;  2VZK B;  2W54 A;  1GPX A;  3AE1 B;  3B2F A;  1JWU D;  2DBY A;  5D7G A;  1FMA D;  1ESF A;  1I4X A;  4WQM A;  3BVZ A;  3W9C B;  3R2T A;  1E6E B;  2JWU A;  1F0Z A;  1XO3 A;  1QIL A;  4WWM A;  3VQI A;  1KTK A;  1SB3 C;  2INN E;  2K3U A;  2W3R A;  4B0M A;  4TSS A;  3NRZ A;  2GI9 A;  4LK0 M;  5BMI A;  2IGD A;  4YSY B;  1ROE A;  2NTS A;  3AEG B;  1XLQ A;  1IUE A;  2JX5 A;  3ZJU A;  1V8C A;  1CJE A;  4TQ0 A;  1VZ8 A;  4OHJ A;  1QOA A;  2WDR B;  2HDE A;  1FM0 D;  3U7Z A;  3CWI A;  1GOZ A;  2PKO A;  4LLG M;  4XWT A;  3L4P A;  3Q8A A;  4RGT A;  2WDQ B;  2W3S A;  3W5V B;  4UDU C;  2J42 A;  2K22 A;  3E9S A;  5G5G A;  1TS4 A;  4XDC A;  4US8 A;  1E9M A;  1K52 A;  3NVY A;  2LHD A;  1C77 A;  5HI1 A;  4J3O D;  2B76 B;  1DGJ A;  2WXO A;  2HTM E;  4RF1 A;  2BTE A;  2J52 A;  3TEX A;  1I4Q A;  1RFK A;  4B0E A;  1GB1 A;  2JU6 X;  3PZ8 A;  2IDY A;  2IGG A;  2N7J A;  1L0V B;  1ET9 A;  2M56 B;  3AE7 B;  4L1B A;  2JZP A;  2KAJ A;  2TSS A;  5T8I A;  1SJH D;  4MT5 A;  1GB4 A;  2JYE A;  4OW0 A;  1J7A A;  2MH7 A;  2WXL A;  1JWM D;  4ARI A;  2L1A A;  1DOI A;  3AED B;  1RM6 C;  1STE A;  4RGN A;  2JXT A;  4HKZ E;  4NAM A;  4KKI A;  1AYF A;  1TY0 A;  3B9J A;  1FNU A;  3AM9 A;  1Y56 A;  1D4B A;  2I2Y A;  1QOF A;  4KGS A;  4USA A;  1ZDX A;  1V1P B;  2SAK A;  3RFZ B;  1V1O A;  2PTL A;  3U4E G;  2PIA A;  4ZHO A;  1YN3 A;  1T6B X;  1UNS A;  2YEP F;  1IBX B;  3AE6 B;  1TJE A;  2FBW B;  2K9X A;  4HRS A;  1PGA A;  1MHX A;  5H8Y E;  2IPK D;  1JWS D;  1HXY D;  2INP E;  3E56 A;  4AQ7 A;  1OQR A;  2SEB D;  2KMM A;  3NVW A;  4REZ A;  2D5G A;  4HKQ A;  1EWC A;  2W82 A;  1TKY A;  1VZ7 A;  2WQY B;  1L4D B;  1L0Y B;  2N0S B;  4KGR A;  4HJG E;  3AE4 B;  1N62 A;  1FXA A;  4OZC A;  5FK9 C;  1ACC A;  4YT0 B;  1NEN B;  1T3Q A;  4JWS C;  4YTN B;  2Q5W D;  4YSZ B;  3ETR A;  1I4R A;  1PUT A;  1KRH A;  1HEZ E;  4YTM B;  3T3O A;  1HZ6 A;  2QIL A;  2N9K A;  4N58 A;  4XE0 A;  2V0G A;  1N60 A;  1JRO A;  1TZO A;  3AEF B;  4ARC A;  3VR8 B;  2QMT A;  4NAW B;  1FRD A;  5BYR A;  4A8X C;  1FXI A;  2FE8 A;  1ZP0 B;  5G5H A;  2V3P A;  4A9A A;  2ACZ B;  4LTU A;  1AN8 A;  3AEB B;  5EE0 A;  3TEW A;  2KAC A;  5FR3 A;  1PGX A;  1J7B A;  4R3D A;  4RCO A;  1N63 A;  1VLB A;  2OHF A;  2RPV A;  4OZB A;  1V97 A;  2KWD A;  3NVV A;  5BYQ A;  4P6V F;  3MC0 B;  4N59 A;  1E0Z A;  3BII D;  2G9H D;  2LUM A;  1JQ4 A;  1FO4 A;  4EE2 A;  2BS2 B;  1WXQ A;  2YEP B;  3ABV B;  4XDD A;  1P7E A;  2GB1 A;  3GS2 A;  1IBX A;  2KDM A;  1D5M C;  4RF0 A;  1PGB A;  2MJD A;  3BK2 A;  2CU3 A;  4ZRP A;  1VZ6 A;  2DWQ A;  2WXF A;  4WUR A;  2DLB A;  2WXQ A;  5EE3 A;  1MPE A;  4N6E B;  2M0A A;  3V3X A;  2FUG 1;  3FAH A;  1DOY A;  1KLU D;  1EU4 A;  1F2R I;  1WRI A;  2MJE A;  1AW7 A;  4OVZ A;  1TKG A;  1C4A A;  1XEE A;  4WAF A;  5AUK A;  3W5U B;  4C7Y A;  3PO0 A;  4O1N A;  1KFY B;  4A55 A;  1TKE A;  2CJN A;  1GAQ B;  3CIR B;  5H92 C;  2WXH A;  3RPF C;  2WXI A;  3OWE B;  3FIL A;  2PVO D;  3LB8 C;  3MFG A;  1NI3 A;  5C3J B;  4IDI A;  3U52 E;  3KWV A;  1FFV A;  2JQR B;  2BBC A;  1D5Z C;  1FNW A;  1XLO A;  5HG2 A;  2QIE B;  1QT9 A;  4TQ1 A;  2WU2 B;  1KH0 A;  1EM7 A;  1UWX A;  5I4D A;  1ZXH A;  2BS4 B;  5HFY A;  3HVD A;  1WGK A;  3HVZ A;  1SJE D;  4JWU C;  1E10 A;  3ZYY X;  1L6V A;  2WNM A;  2K5P A;  2L52 A;  1QF6 A;  2RDG A;  1QQR A;  2LGI A;  1ZDV A;  3BVM A;  1SSN A;  2EKI A;  5TSS A;  2M19 A;  4ZYS A;  1EWY C;  3IT4 B;  1SIJ A;  4DXF A;  2LJI A;  2E6X A;  2WXG A;  3HRD D;  3IAM 1;  4L23 A;  2L83 A;  1C78 A;  2W55 A;  2BS3 B;  3O13 A;  2CJO A;  1EU3 A;  1WSP A;  3AE3 B;  1HQR D;  1NEK B;  2RDH A;  3I57 A;  5EE1 A;  2J53 A;  1FEH A;  1AWD A;  1BUI C;  1TYG B;  1P7F A;  2LHE A;  3ZGZ A;  4C7Z A;  1QOB A;  2WDV B;  3AE2 B;  1I4P A;  2H88 B;  1FCL A;  2IJ0 A;  3ZQ4 A;  3P4Q B;  3IAS 1;  5MPO A;  2IGH A;  3T3N A;  5EE9 A;  2BYT A;  1MI0 A;  1YNT E;  1NYQ A;  2AQ3 B;  1F77 A;  1YJI A;  1B1Z A;  2XNA C;  3P4P B;  5BMH A;  4NJC A;  2WXM A;  4MH8 A;  1F2R C;  2KQ4 X;  2ON8 A;  3Q8E A;  3ZJV A;  4YXD B;  2Z8L A;  1ET6 A;  3PZ7 A;  1C9F A;  1YQ4 B;  2DYO A;  1ZUD 2;  3P4S B;  3N9Y C;  1SE3 A;  1K51 A;  1RWS A;  3VR9 B;  1VR9 A;  3FIL B;  3AMZ A;  3H8H A;  3AB5 A;  3W2D A;  2MEK A;  1WWT A;  3GB1 A;  3IXS A;  1D5X C;  1NYR A;  1XLP A;  2ONQ A;  4IOI E;  1VRA B;  1IGD A;  1M4V A;  4H2A A;  1QKZ A;  2WXN A;  1TS5 A;  1YN4 A;  2H89 B;  5D3I B;  2LFI A;  1MHH E;  3TEZ A;  4Q2J A;  2QJL A;  2E3T A;  1I4G A;  4PT5 A;  4RH6 A;  4DXG A;  2JYT A;  1UWM A;  1QOG A;  2V4I B;  5AUI A;  3AE5 B;  4ITK A;  1OQQ A;  4GDK B;  1ZOY B;  4WIP A;  2RMM A;  2LMC A;  4L2Y A;  1BML C;  1YQ3 B;  4D2K A;  1N5X A;  2MJ3 A;  1TS2 A;  1ZE3 D;  1VDV A;  3P42 A;  3AEC B;  1QLB B;  2WP9 B;  3SR6 A;  1FCC C;  1YN5 A;  2Y3A A;  2QEJ C;  4AS1 A;  3KLS X;  4KGT A;  2NMQ A;  2X38 A;  1D6E C;  2AQ2 B;  1JW9 D;  3BZD B;  4YSX B;  1PYW D;  2DYM A;  4MAC A;  2K0P A;  3AN1 A;  3NS1 A;  4TMA B;  2R61 A;  1FD6 A;  1E7P B;  1FNV A;  3R8B A;  2VZK D;  4XWW A;  3AV8 A;  4ZHP A;  1FFU A;  3KWL A;  4OZA A;  2ZW0 A;  5E6J A;  1JWA D;  3R2I A;  1JCK B;  3Q8C A;  4RFB A;  3VRA B;  1CK1 A;  3SFE B;  1YMH E;  3URY A;  3NVZ A;  4RGM A;  2J4X A;  3AE9 B;  3FC4 A;  2JSV X;  3MHZ A;  1FRR A;  1TY2 A;  3BYY B;  3HUI A;  3LYY A;  2EEL A;  4RGO S;  4HRO A;  1OFF A;  1HZ5 A;  3ZJT A;  5JXV A;  3BYT B;  4CQN A;  3P4R B;  1VJK A;  3C8Y A;  1MVK A;  4JPS A;  1XCT L;  5C2T B;  1LO5 D;  3MJ5 A;  1JWB D;  1N5W A;  5FKA C;  2WXP A;  1B9R A;  4YWG G;  2PMV A;  4KKJ A;  2BB6 A;  5BYS A;  5HHD G;  1L0X B;  3LXF A;  1UUP A;  4JX1 C;  1C4C A;  2GRI A;  4C56 C;  1SEB D;  1I4H A;  3WCQ A;  1JML A;  4FXC A;  1UGJ A;  3U2S C;  2WXK A;  5GXG B;  3W1S A;  3P63 A;  1XCQ L;  1BXT A;  3J9C A;  2LEK A;  2KN4 A;  3DWG C;  2WU5 B;  1I7H A;  3MP9 A;  1T5X D;  1FIQ A;  4DQO C;  1RYJ A;  3AEA B;  3P1M A;  2PVG C;  4A6Q A;  2XN9 C;  2AQ1 B;  2WS3 B;  2WLB A;  1YJJ A;  3AEE B;  2QSD A;  1PDX A;  1KLG D;  3DWM A;  1SBB B;  2BT6 A;  3NUH B;  4NZL B;  3NZ3 A;  4YTP B;  2G1E A;  1JAL A;  4M0W A;  1PFD A;  2BW2 A;  4RNA A;  3KQ4 A;  2PLP A;  3EGR A;  3B2G A;  3Q69 A;  1IGC A;  1K53 A;  1ZPS A;  3TUO A;  3UI3 A;  3BVG A;  4US9 A;  3AE8 B;  3I9V 1;  3EUB 2;  3Q8B A;  3AH7 A;  5D3D A;  1DOX A;  2OED A;  1ENF A;  1HA5 A;  1KF6 B;  2N9L A;  1WYG A;  4HEA 1;  3VRB B;  1DYQ A;  1SE4 A;  2Y5C A;  1N61 A;  2AX5 A;  3TSS A;  1L5P A;  1JRP A;  3GP7 A;  1SF0 A;  1CQV A;  4GLS C;  3BWU D;  1NVI D;  1Q10 A;  2ICI A;  5BMG A;  1TS3 A;  3Q8F A;  4WH4 A;  1J7C A;  4P16 A;  1SXT A;  3V05 A;  1C4P A;  2PW9 A;  1R7S A;  2V3N A;  1ZXI A;  3SFD B;  2WXR A;  3BK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...