3RZWC

Crystal structure of the monobody ysmb-9 bound to human sumo1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
b'EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monobody ySMB-9
publication title Teaching an old scaffold new tricks: monobodies constructed using alternative surfaces of the FN3 scaffold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rzwC00
3EECA 3TJPA 2CHZA 2N4FA 2Z0DB 2KD0A 3UQBA 2L05A 2G45B 4FN2A 4GDKB 2CR5A 4GOCA 4M8NA 4W9IA 2XBBC 2IO1B 2LZ6A 2GOWA 3PRMB 4MGYE 1FXTB 4NNJB 2JVCA 3BINA 2KC2A 2KWCA 2ZZPB 4WJNA 5EDSA 4G50A 4I6PA 4EZJA 4GGQA 4NY0A 4DHJB 2JUOA 3DBSA 4GN1A 1TZ1A 4OVUA 5E6NA 2ZEQA 4PYUA 2LRUA 1EO6A 4WWPA 4DDGD 3VUWA 4ZRJA 4ICVA 2PE9A 3U7DA 4FHKA 2K8HA 2KLGA 4NAWA 2D2QA 3M62B 4F1SA 3VUXA 2NS5A 1S1QB 5D7GA 1Q0WB 3L10B 3R66C 2KJ6A 1WM2A 4B9KA 2N1VA 2V1YA 4M0WB 3PT2B 4LJOB 1WX9A 4HXDA 3HIZA 4GDKA 2CU1A 1T0YA 4B6WA 3UQAA 1WXMA 2K8CA 3CSFA 4PS7A 5L95C 2KMCA 1WX8A 2ZJDA 1XD3B 1RAXA 4ASWC 5D2MB 2I1JA 1YX6B 2C7HA 4FBJB 2LD9A 4IM2A 5AEKB 3PVLA 1KM7A 2K6QA 1K8RB 4IM0A 5CTRC 4TQ0A 2FCQA 2K39A 1YX5B 1E8ZA 4KDIC 4IG7B 2BPSA 4OVVA 1OGWA 2GBRA 3N3KB 2FUHB 1Q5WB 4IUMB 4F8CB 3GZNI 4X57B 4K81A 2MP2A 1E7VA 2L3ZA 2R2QA 3PHXB 2XK5B 4FULA 1P0RA 2QHOA 4W9FA 2W9NA 3TIXA 1VCBA 2REXA 5JHAA 1S3SG 1CMXB 3PTFC 2LVQA 4HPLB 1YD8U 2KHWB 2NVUI 5E6PA 3RT3B 2WWZA 2KJHB 2L76A 3B08A 4KZCA 2PE6B 2RSUA 1SIFA 3IBEA 3VHTC 3ALBA 3KUDB 3VTUA 3VDZA 4BKGA 2LXCA 2LGYA 3IVFA 1WGYA 4FHJA 4MJSB 5CHFA 2AYOB 3IFWB 4MGKE 4DHZB 2AWTA 1H8CA 1SGHA 5L83A 2N9EB 4EEWA 4WWOA 1MG8A 3L16A 5D94A 4HVBA 2IZVB 2D11A 2HE7A 3B1LX 3DVNV 1OTRB 1YQBA 1WYWB 2XK5A 2UWQA 3JW0X 3L54A 3MHSD 4KVGB 3HK0A 3ZTCA 1WR1A 4MDKE 2CS4A 2KVRA 2JF5A 2LGXA 3EFUA 2KQSA 4ZRKA 3QA8A 2NBVB 3DVGX 2FCNA 4W9HA 2RR9A 3TL5A 1OEYJ 1WE7A 2K6DB 3V60A 3ZRCA 3JYUA 3NS8A 4ANXA 3PLVA 1GUAB 3T8MA 1H4RA 2MBQA 2JRHA 2DX5B 4K1RB 3ZVVA 2NR2A 4MJSA 1UD7A 1G6JA 1YJ1A 1HE8A 4W9KA 5C23A 3UF8A 1UELA 3DOWA 3ZW3A 3RZFA 1IPGA 3RCZA 4JGHB 2C5LC 2IO0B 1WF9A 2J7QB 2KOXA 2OOBB 2A4ZA 2N9PC 1V80A 2M4NA 4EOYA 3X0WA 2D3GA 2DYOA 3Q3JA 1WXAA 3WAMA 5G2NA 2KFJA 2MA9B 2KTRB 3PV1A 4GMVA 3I3TB 1NI2A 3ZNZB 3ZO5B 4EZLA 2O2VB 3PHWB 4EKUA 5DCNA 3CSTA 4IW0A 1ZW7A 1P3QU 3HM6X 2M1MA 1SE9A 4JL9A 3DCGA 2I1KA 1UBIA 2KWVB 5C1ZA 3ML8A 2LVOA 1E5WA 3APFA 2FIFA 2LXAA 4DXAB 4MGZE 4G0NB 1WJNA 5LXIB 3V6CB 2BKFA 1WM3A 3DDCB 2XEWA 4NJ6A 2FCMA 3VH4B 2JY6A 2ZCCA 1WFYA 2GBNA 2IY1B 2KJRA 1WJ4A 2BKRB 3VH3B 3OJ3A 2IO3B 3Q3FA 3UIOB 1RLFA 2C7MB 2KTRA 3AXCA 4B95A 3VFKA 1LFDA 2O2VA 4BOZB 2J0JA 2O6VD 4HDQA 5TR5A 2D07B 4II2B 4WWNA 2LJ5A 1WGGA 3VQIA 4MEMA 3ZLZA 4HJKA 1E8YA 4IM3A 2ZVOA 2YLMA 2HJ8A 1E90A 4GXBA 4GDLB 3RYTA 3NOBA 4W9JA 2L0FA 1J8CA 3L08A 2OJRA 3ML9A 3DBHI 5GMVA 1WZ0A 1WX7A 2RGFA 2L00B 2MBHA 1ZGUB 1E8XA 1P9DU 5HKHA 1XT9B 3HM3A 4ZRIA 2VRRB 1PQSA 1GJZA 3OLMD 3PREA 4DHZE 1EF5A 5JZEB 2KXJA 3LJ3A 2KK8A 4GIVA 5AZFA 2EMSA 3KW5B 2L0TA 3CF6E 4LCDE 4NJ7A 3ZRFA 4A20A 2IYDB 3A4SC 3U8ZA 4DDID 4M8MA 2EMTA 1Q1OA 3UIPB 4HWIB 2J0KA 4DBGA 4PS3A 2BWES 2IO2B 2NBUA 4NQKE 1BT0A 1WXSA 2M0XA 4GDLA 2C60A 2LI5A 4MH0E 4EUTA 3N30A 3A33B 4EFOA 5IA7A 3NHEB 1NDDA 4YL8A 3ZDMC 5DPWA 3M63B 5G55A 3A1QB 3AI5A 3A9JB 3QAQA 3VTVA 2K8BA 1UZXB 2N1WA 3P2BA 5E6OA 1F9JA 2NCNA 2C9WB 4CO7A 3ZNGC 4CHKA 1V5TA 4HCNB 1EUVB 3L0WB 4II3B 3WANA 4FJZA 4W9CA 1UGMA 4GB9A 1OQYA 4BFRA 1X1MA 4ICUA 2RPQA 2GBJA 1WR6E 1WY8A 2BGFA 4BKSD 2HTHA 3EHVA 1TGZB 4ANUA 3H9DA 1WE6A 3WALA 4BOSC 2G4DB 4A3OA 2BWFA 4HCPB 1E7UA 2HD5B 3RZWC 4I6LB 3QCAA 1WGHA 1WXVA 3A1QA 3QK0A 1WJUA 2GBKA 5KHOA 1XQQA 2O6VB 3M3JA 3IHPC 3R3MA 3QC8B 4RM9A 5IAAC 3LDZE 4G11A 3APCA 1LQBA 3PSEB 2N9XA 2MWSB 2LASA 1WH3A 2JZ3B 4JQWC 4N9F4 2IY0B 3W1YA 4LDTD 2MCNB 4FJVB 1KJTA 5J18A 2EKEC 2R2OA 2DZMA 3VUYA 5AZHA 1V6EA 2MW5A 3DVNU 2C7NB 1WMHB 3BY4B 4W9LA 1KLVA 4BKTA 5CHWA 2G3QB 3ENEA 3QX1A 3H7SA 3V62A 2LRWA 4HPMB 3QHTA 5DPRA 3WAOA 2O6VA 4K7UA 1Y8RC 2KX3A 1M94A 4P7IA 4DWFA 4E74A 1YIWA 3D32A 3H1UA 4KSLC 3ZTDA 4FADA 3NZSA 4ZDVA 3SDLC 3PRPB 2DZKA 3H6NA 5JH5C 4KZ0A 4AOFA 2BF8B 2RD0A 1UBQA 2JT4B 2WDTB 3ZUNA 3ZDTA 2PEAA 3KH0A 3ZNID 3TMPB 4TQ1A 3TBLD 2WYQA 2MRPA 4AJWA 1ISNA 1VD2A 4IC7B 4MM3A 1WMHA 4LJPB 1U4AA 3KYCD 4K7SA 4MSQB 2LVPA 3MJWA 4FJYA 3NY5A 5BO4B 2FAZA 4AP4C 4DK5A 1R4MI 2V3SA 4F7ZA 3DPDA 1GC6A 2JZZA 4W9GA 2ZNVB 5J2RA 3PZDA 2ZVNA 3GOEA 3UINB 2KX0A 3SHQA 2DAJA 4AJYB 2NBWB 2ZNVC 3VXWA 1A5RA 4G3XB 4WQOB 2KO3A 2KNBA 1WIAA 5CX3A 4I6NB 3R7QA 3UGBB 3RUIB 2B3AA 2KDBA 2K1FA 3A4RA 1C1YB 2PJHA 3A9KB 3DQVA 4FLHA 2FIDA 3PGEA 4KDLB 3WIMA 4PS8A 3JSVB 2Z0EB 2G4SA 4WJQA 1RFAA 2GMIC 3R7RA 2KQ7A 3ZKJC 1C3TA 2MP2B 3QQ8B 1Z5SB 2KTFA 1Z2MA 1D3ZA 3APDA 3RULA 1TBEA 5D6JB 4BKSA 2ZCBA 4JLCA 4LDTB 2KN5A 2KMAA 2FCSA 2ASQA 2KC1A 2CHXA 2MX2A 3X23A 2AEHA 1V86A 2BYEA 1TTNA 2DHZA 3PLUA 4PYZA 4WJPA 4NQLB 3W1SC 5LLIA 3O65B 4BVUC 2NPTB 1JRUA 4AWJA 3JVZX 2MQJA 4BBNF 4RMAA 3A9KA 4HDOA 3TCAA 4ANVA 1R4NI 3KYDD 2KDIA 4K7WA 3JSVA 3MTNB 2J0MA 1IP9A 2WX1A 4URKA 1V81A 1ZKHA 2L7RA 2LUEA 2LWPA 1GC7A 3DVGY 3V6EB 2KDEB 1EF1A 1E8WA 2MSED 3AU5A 4ZYNA 4BBNC 5DPTA 3H7PB 4KIKB 3KUZA 3K9OB 3PPAA 3U30A 2BYVE 1GNUA 2N7EA 1I42A 3PS6A 2YVCA 3SD5A 2IBIB 3W1SA 1V9JA 2M17A 2UYZB 3B0AA 3DBLI 4GSWA 1WGDA 4MGIE 2MBBB 2JPHA 3C0RB 2MBOA 3EC8A 1P1AA 2NPTA 2DZJA 2K25A 2KFKB 3A9JA 4DHJD 4W9EA 4J6IA 3VAWA 3ECIA 3OAWA 5JHBA 2KWUB 3L17A 2MLBA 4WJOA 2KLCA 3SU8X 2Z59B 4NPNA 4W9DA 1AARA 1I35A 4MSMB 1WRDB 5DPSA 4WAAA 1OEYA 3PRZA 2N7DA 4MELA 2JXXA 4JIOU 2A5UA 2JRIB 3WA0A 3CMMB 3QWZB 1UH6A 4HLEA 2KZRA 4IWPA 3V61A 4XZ4A 4A3PA 3H7PA 4KIKA 4EZKA 2FNJB 3QARA 2JWZA 2L8JA 3WAPA 1KOTA 4FA6A 3KVFB 3VTWA 2V4LA 2BYFA 3L13A 4E3CA 4CYEA 4RM8A 2AL3A 5LXHA 2CKHB 3VVWB 5KHQA 1LXDA 3ZIMA 2AL6A 1GG3A 4KV2A 2KFKA 3IG3A 2PPHA 4GU2A 2DENB 2KDFB 5J17A 2DAFA 3KUCB 4XX5A 1L2NA 2LGDA 4KSKC 2ZPYA 3ONSA 1L7YA 3N32A 4IWQA 2DZIA 4AUQC 1NBFC 3AULA 1QZEA 4TUUA 3T9LA 4TKNA 3RD2A 2MBEA 2DYMA 2M8SA 1IYFA 2KANA 2KKCA 3M95A 5CHVC 2WX0A 1P98A 1WJ6A 2ZPNA 3OJ4B 1WI0A 3QJZA 1LM8B 3HHMA 3K9PB 3S2AA 3NZUA 1J0GA 4ANWA 2D10A 2CHWA 4TV3A 3ZNHB 1V2YA 2Y5BB 1WGRA 4IWOA 4E71A 4HK2A 2GBMA 1RRBA 3AU4A 1V5OA 3DBRI 5FR6A 4NAWB 1V49A 4XC2A 1WZ3A 2DYBA 3QIJA 1J19A 5AZGA
chains in the Genus database with same CATH superfamily
3EECA 4RF1A 2J53A 2YEPB 2L05A 4FN2A 4H2AA 1F2RI 2IO1B 1FXTB 2KC2A 1VRAB 3MC9A 4NY0A 4DHJB 4GN1A 2LFIA 5E6NA 2ZEQA 2LRUA 1EO6A 1TY2A 1XCQL 4WWPA 4A9AA 4DDGD 2PE9A 4FHKA 1FM0D 2K8HA 4NAWA 1TS2A 3M62B 4F1SA 2M19A 2NS5A 5D7GA 2V3NA 1XF5L 1Q0WB 2WHIA 3L10B 3P42A 1WM2A 2N1VA 2V1YA 4LJOB 1WX9A 2OJWA 1T0YA 4B6WA 3CSFA 1F0ZA 4PS7A 2ZJDA 1C4AA 1J7AA 1XD3B 4ASWC 2Y5CA 1K52A 2I1JA 1WXQA 4FBJB 2LD9A 5AEKB 1HA5A 1KM7A 1JCKB 4TQ0A 2K39A 1OQQA 1JQ4A 1C4CA 4F8CB 3GZNI 4X57B 4N58A 4K81A 2OEDA 2R2QA 4FULA 2ACZB 1JW9D 5EE0A 1TJEA 1VCBA 3N1ZC 3PTFC 2LVQA 1YD8U 2KHWB 2NVUI 5E6PA 2WWZA 2L76A 2RSUA 3VTUA 3MHZA 2LHEA 1YN5A 3URYA 2LUMA 3IVFA 4FHJA 2BB5A 4MJSB 3IFWB 4DHZB 4A55A 4WWMA 1T0RC 3B1LX 4Q2JA 3ZJUA 1WYWB 1FRRA 3ZTCA 4MDKE 2JF5A 3IT6B 2RR9A 1OEYJ 1R7SA 2K6DB 4YTPB 1ET6A 3JYUA 5IN7A 3NS8A 1H4RA 3ZVVA 1SJED 1L5PA 2WNMA 4YSXB 4YXDB 1WWTA 1ESFA 1EM7A 3MC8A 2N9PC 1V80A 3AEGB 1ENFA 1JWAD 3X0WA 1TS4A 1YNTE 2MA9B 4GMVA 1FMAD 1CQVA 3NS1A 4IW0A 3MJ5A 1F52A 1IBXA 4O1NA 3APFA 3R2IA 4S17A 4G0NB 2XEWA 2FCMA 2ZCCA 1WFYA 5IP4D 2Z8LA 1PGAA 3GE8C 2W54A 4QAYA 2KTRA 1C78A 1QOGA 2O6VD 5TR5A 2D07B 1FCLA 3VQIA 2W55A 1YJJA 1SEBD 4IM3A 2YLMA 1R4NB 1HZ6A 4GDLB 1VJKA 1J8CA 5GMVA 1HEZE 1ZGUB 1E8XA 5HKHA 1XT9B 2QC8A 5IKCM 1GJZA 3OLMD 4K3CA 4DHZE 1EF5A 5JZEB 1FNVA 5AZFA 4LCDE 3CF6E 4NJ7A 2IYDB 3U8ZA 1TKGA 1ZXHA 3BK1A 2BWES 4NQKE 1BT0A 5FKAC 2M0XA 2LI5A 4MH0E 1ACCA 4A90A 1K50A 4YL8A 3ZDMC 5G55A 3A1QB 2K8BA 2N1WA 1UNSA 2NCNA 4CO7A 1SJHD 1E6EB 1I7HA 4HCNB 1UGMA 2IGHA 4BFRA 2GBJA 2NTSA 1BXTA 2BGFA 4BKSD 4ANUA 3WALA 4A3OA 1PGBA 2LEKA 1RFKA 3RZWC 3WCQA 3QCAA 5KHOA 3Q8CA 2AQ1B 2O6VB 4C80A 3M3JA 3B2GA 3RI7C 3R3MA 3LDZE 1N61A 1L0XB 2MWSB 2BTEA 5JXVA 1WH3A 1N5WA 2XNAC 3E9SA 3I63C 4LDTD 4FJVB 1FO4A 3VUYA 1V6EA 3DVNU 4YTNB 2K0PA 3BY4B 4W9LA 2VH1A 3ENEA 3QX1A 3RN9C 3H7SA 3V62A 5DPRA 2R61A 3LB8C 4K7UA 1Y8RC 1M94A 4P7IA 4DWFA 4E74A 3AEFB 1F2RC 2YEPF 3MFGA 4FADA 2LMCA 3EUB2 3PRPB 4KZ0A 1MFWA 4IDIA 2BW2A 2JT4B 2L32A 4FXCA 3ZUNA 3NVWA 3TMPB 2WYQA 1ISNA 1PFDA 3HVZA 1MHXA 1GAQB 1SE3A 1HQRD 3MJWA 1MHHE 4USAA 1MPEA 2V3SA 3EFCA 1GC6A 1VZ6A 2JZZA 2ZNVB 1FPYA 3AV8A 3PZDA 1L0VB 3GOEA 2WXMA 3UINB 5C2TB 2RDGA 2KVZA 1JWUD 4I6NB 5IO9A 4HEA1 2PJHA 1SBBB 3JSVB 1C4PA 1N6ZA 4L23A 1TS5A 2E3TA 3R8BA 2INPE 1C3TA 3QQ8B 1Z2MA 1D3ZA 2MJDA 2LJIA 2IDYA 4LDTB 1TIFA 2ASQA 2LGIA 2DHZA 4CQNA 2MHJA 4C00A 1D5ZC 3JVZX 4BBNF 4HDOA 3TCAA 2GI9A 4ANVA 1R4NI 2WX1A 4URKA 5HFYA 1I4RA 2KDEB 2H88B 1ET9A 3AE4B 3AU5A 4ZYNA 1FXAA 4KIKB 3KUZA 3U30A 1I42A 4HROA 3SD5A 2IBIB 4GSWA 1WGDA 1ZDVA 4LNOA 3TEXA 2JPHA 3C0RB 2N7JA 1YOVB 2CJOA 1AN8A 2KWUB 2MLBA 3SU8X 2Z59B 4NPNA 3I9V1 2DNFA 1WRDB 3BZDB 5DPSA 1MJDA 3U7ZA 2JWUA 3TEZA 2JRIB 3I5JC 3CMMB 3DWGC 3QWZB 4IWPA 3SFDB 3V61A 4XZ4A 4A3PA 5BMHA 3H7PA 3AB5A 2L8JA 3FC4A 2BYFA 2MJ3A 5KHQA 1LXDA 1JWBD 2KFKA 3PZ8A 2PPHA 2KDFB 1FFUA 1D5MC 4IWQA 2DZIA 4REZA 1QZEA 2FUG1 4TUUA 2MBEA 2KKCA 5CHVC 2ZPNA 3V05A 1KLUD 2CHWA 4IWOA 1V5OA 5H8YE 4NAWB 1WGKA 2WXFA 1V49A 2BBCA 1WZ3A 4YSZB 2JYEA 1JWSD 5G5GA 3TJPA 3BWUD 2CHZA 1EWYC 2WU5B 1PYWD 4M8NA 2GOWA 4MGYE 2JVCA 3BINA 2KWCA 4I6PA 4EZJA 2JUOA 1TZ1A 1YJIA 4OVUA 4RH6A 1SSNA 2K9XA 4HJGE 4ZRJA 4XGAB 4LNNA 2KLGA 4BZAA 3IT4B 3VUXA 1I4HA 3R66C 4M0WB 3PT2B 5EE9A 3HIZA 2CU1A 2QIEB 3UQAA 5L95C 2WXPA 2N0SB 1CJEA 1YQ4B 2C7HA 4RFBA 2K6QA 1K8RB 2KQ4X 1YX5B 2JYTA 3ZJTA 1D4BA 3N3KB 4P1BC 2QSDA 4KGSA 3VRBB 2RPVA 2WXRA 1FNUA 4LNIA 3AH7A 4B0EA 4KZCA 3IBEA 4RGNA 3ALBA 3VDZA 2Y5PA 1WGYA 4MGKE 2N9EB 5HI1A 4WWOA 3L16A 5D94A 4HVBA 1I4PA 2XK5A 3JW0X 2UWQA 4IKGA 1Y56A 2CS4A 4B0MA 3Q8AA 2HTME 2LGXA 3R2TA 2KQSA 3DVGX 1D5XC 2FCNA 1YQ3B 3ZRCA 3BK2A 1NENB 1XLPA 3P1MA 1V1OA 1V8CA 1GUAB 2PMVA 4K1RB 1IBXB 3BIID 1HE8A 4W9KA 5C23A 4WURA 1UELA 2G1EA 1IPGA 3RCZA 4JGHB 2IO0B 3V3XA 2KOXA 1GB4A 1QT9A 2JSVX 2D3GA 2DYOA 3Q3JA 1WXAA 1VLBA 2KFJA 3ZNZB 2KTRB 1I4XA 2ON8A 4OVZA 1NI2A 4EKUA 2SEBD 2M1MA 1FCCC 4JL9A 2KWVB 5C1ZA 1ZE3D 2I38A 1SE4A 2LVOA 1FEHA 4P6VF 1F1HA 4DXAB 1WJNA 5LXIB 3VH4B 2BKFA 1WM3A 3J9CA 2KJRA 3Q6BA 3MP9A 1TYGB 2BKRB 4RCOA 5D3IB 2IO3B 4OHJA 4DXGA 3AXCA 3VFKA 2JU6X 2O2VA 4BOZB 2L83A 1GB1A 2LGSA 2LJ5A 2G9HD 4LTUA 4WH4A 3P63A 1GPXA 1YN4A 4EE2A 3L08A 1E7PB 2BS3B 3AMZA 2JX5A 1WX7A 2RGFA 2MBHA 1FD6A 1ROEA 1VZ8A 2KXJA 3DHHC 3LJ3A 5HG2A 4GIVA 2L0TA 4A20A 2GB1A 3ZRFA 3Q3NC 2D3AA 3BYYB 2EMTA 2C60A 3AE8B 3N30A 4M0WA 3A33B 1NDDA 2WDVB 3RPFC 1QOAA 4ZRPA 3P4PB 3L0WB 4W9CA 4N6EB 2WLBA 2WQYB 4ICUA 1IGCA 2RPQA 1UUPA 1WR6E 5BYSA 3H9DA 1WE6A 3AN1A 4BOSC 2NMQA 3DHIC 1E10A 2G4DB 2BWFA 1I4QA 3Q8EA 2WDRB 4AS1A 3QK0A 2WXGA 2EKIA 2QCZA 4G11A 5FK9C 2LASA 4LLGM 3ZQ4A 3VR8B 4NJCA 2D3CA 3AE1B 1DOIA 2GRIA 1QOFA 2EKEC 3N1YC 5AZHA 2V0GA 2C7NB 3AE3B 2G3QB 4OZAA 4TSSA 2KX3A 3FILB 1TS3A 1YIWA 1C9FA 1PGXA 4ZDVA 4OZCA 3SDLC 2DZKA 3H6NA 1UF0A 2K22A 2BF8B 2KAJA 4HPPA 2PEAA 2E6XA 4M02A 1VD2A 4M01A 4LJPB 3VRAB 3DHGC 5LNK1 4FJYA 4AP4C 4R3DA 4F7ZA 2MEKA 4HKZE 3DPDA 4J3OD 3TSSA 2ZVNA 4AQ7A 3RNGC 3SHQA 4DQOC 1A5RA 2ZNVC 1EU4A 4WQOB 3SFEB 2KO3A 1WIAA 5CX3A 3UGBB 2FBWB 2B3AA 1IGDA 4XWTA 1JRPA 2GMIC 2ICIA 2V3PA 2IGGA 3Q3MC 3ZKJC 2MP2B 1Z5SB 1TBEA 5D6JB 3OG5A 2KN5A 2FCSA 2CHXA 2AEHA 3P4QB 2MH7A 4NQLB 5LLIA 4BVUC 4AWJA 4RMAA 3A9KA 3KLSX 3KYDD 3Q8FA 1C77A 2J0MA 1IP9A 1ZKHA 2L7RA 1GC7A 3V6EB 1EF1A 1E8WA 1OQRA 2MSED 5DPTA 3H7PB 2BYVE 1GNUA 2N7EA 3W1SA 1TKYA 2M17A 2UYZB 3B0AA 2MBOA 3EC8A 3AEBB 2K25A 2KFKB 3VAWA 3ECIA 1JROA 5JHBA 1L6UA 2KLCA 1QOBA 2WXIA 1AYFA 1XLNA 1DGJA 1DOXA 3DWMA 4MELA 2JXXA 3BYTB 1L0YB 2A5UA 3KQ4A 3AE5B 2KZRA 1T5XD 1SF0A 3NUHB 3P4RB 3HVDA 4E3CA 1K51A 1UGJA 2AL3A 3IAM1 2AQ2B 5LXHA 5EE1A 3VVWB 1ZP0B 1P7FA 4XX5A 1L2NA 4KSKC 2ZPYA 3ONSA 1L7YA 3N32A 3AULA 4UDUC 1R4MB 3T9LA 4ITKA 2BQQA 2M8SA 1IUEA 2KANA 3M95A 3AECB 1NVID 3DBHB 2HDEA 3HHMA 3S2AA 1TKEA 4N59A 2D10A 4ANWA 3ZNHB 4TV3A 2Y5BB 1WGRA 4E71A 4HK2A 1MVKA 5FR6A 3FILA 3SEBA 4XC2A 2DYBA 4LK0M 3QIJA 2LWPA 4GLSC 5AZGA 4RNAA 2KD0A 3RNEC 3UQBA 2G45B 1M4VA 2Q5WD 5MPOA 4W9IA 2LZ6A 1STEA 4NNJB 2BT6A 2ZZPB 4G50A 1AWDA 3DBSA 4P16A 1L4ZB 5FR3A 3VUWA 4HKQA 3CWIA 2D2QA 2PIAA 1XLQA 2BVCA 2KJ6A 3ETRA 4HXDA 4GDKA 1VR9A 4YTMB 2KMCA 4ZOHC 3VR9B 4IM2A 3PVLA 4IM0A 3DBLB 2FCQA 1N5XA 1E8ZA 3ZYYX 1OGWA 4IUMB 1Q5WB 5E6JA 2MP2A 2L3ZA 3PHXB 2AX5A 2XK5B 2PKOA 1S3SG 2KJHB 3RNFC 2TSSA 2PE6B 1SIFA 1QF6A 3KUDB 1BMLC 1T0QC 4BKGA 2WDQB 2LXCA 2OHFA 5CHFA 2AYOB 2BS4B 1XXGA 3H8HA 2D11A 2KWDA 3DVNV 2WXJA 1HTQA 2D5GA 2X8XX 3L54A 4KVGB 3HK0A 2KMMA 2KVRA 1V1PB 4ZRKA 3QA8A 2NBVB 3TL5A 2RMMA 4YT0B 2WS3B 3T8MA 2MBQA 2JRHA 2CJNA 1DYQA 1ZPSA 1UD7A 1G6JA 3W5VB 3DOWA 3ZW3A 3RZFA 4IOIE 2C5LC 2J7QB 2OOBB 4LNKA 2M4NA 4EOYA 3FKYA 1AW7A 4RGOS 3AEEB 2WXQA 3I3TB 3N20C 2O2VB 4XDCA 2W82A 3PHWB 5DCNA 3CSTA 1P3QU 3HM6X 2QDFA 1K53A 2RDHA 3ML8A 4A6QA 3Q69A 2HJ1A 4MGZE 3V6CB 1NYQA 3DDCB 2M0AA 4XYCA 3U2SC 2IY1B 1WJ4A 2V9HA 3VH3B 1JALA 3Q3FA 3UIOB 1RLFA 4B95A 1OFFA 1XCTL 4II2B 4WWNA 4MEMA 1E8YA 4C56C 2ZVOA 2HJ8A 1E90A 4KKIA 3RYTA 4PK1A 4WAFA 2L0FA 3I57A 2OJRA 3DBHI 1WZ0A 4ZHOA 4JX1C 1P9DU 3HM3A 4ZRIA 1PQSA 1FRDA 2IGDA 2WXLA 3PREA 2KK8A 2PTLA 3AEAB 3E56A 3KW5B 5IOIA 3A4SC 1Q1OA 3UIPB 3ZJVA 2J0KA 2IO2B 3EA6A 2VZKD 4EFOA 2MJEA 5DPWA 2Y3AA 3AI5A 3A9JB 3AM9A 5E6OA 2C9WB 4A8XC 3RMKC 1V5TA 1EUVB 4II3B 3WANA 3GE3C 4FJZA 4GB9A 1X1MA 1WY8A 3PO0A 4JWUC 2WXKA 2HTHA 3EHVA 3GS2A 2KDMA 2HD5B 1SXTA 2N9KA 1WGHA 1WXVA 3U4EG 3QC8B 3N1XC 4RM9A 3T3OA 3PSEB 2WXOA 2N9XA 4ZYSA 3Q3OC 2KACA 2JXTA 2JZ3B 4ZRQA 2RDBC 4N9F4 3DBRB 3W1YA 1MG4A 2MCNB 1KJTA 5J18A 1WRIA 2L1AA 2QJLA 1V1PA 2LRWA 4HPMB 3QHTA 3WAOA 2GLSA 3D32A 3H1UA 3NZSA 1TZOA 1LGRA 2VZKB 1FNWA 1QKZA 3OWEB 3ZDTA 1N63A 2UU7A 3HRDD 3B9JA 2MRPA 4AJWA 4MM3A 1RWSA 1WMHA 3PZ7A 1U4AA 3KYCD 4K7SA 5BO4B 4DK5A 2QILA 3MC0B 4W9GA 5J2RA 1L6VA 1T0SC 4MACA 4M00A 4AJYB 3VXWA 4G3XB 4JPSA 2KDBA 2K1FA 1C1YB 3A9KB 1D6EC 4FLHA 2FIDA 3PGEA 4KDLB 3WIMA 2Z0EB 2G4SA 4WJQA 1HZ5A 1RM6C 1F77A 3R7RA 5G5HA 2KQ7A 2KTFA 3APDA 3RULA 5D3DA 3KWLA 1NEKB 2ZCBA 2J52A 3Q2AC 4NZLB 2MX2A 1TTNA 3PLUA 4PYZA 4WJPA 3O65B 2NTTA 1TT5B 2JQRB 3RNCC 2KDIA 4K7WA 1ZUD2 1I4GA 4L2YA 1T3QA 3Q8BA 4ARCA 2QMTA 1E9MA 2XN9C 5BMIA 4KGRA 4US9A 3C8YA 2YVCA 1V9JA 2PLPA 2WGSA 2MBBB 3NZ3A 2NPTA 2DZJA 3A9JA 3AE9B 4W9EA 3OAWA 3AEDB 5C3JB 1E0ZA 1C76A 3HUIA 4W9DA 1AARA 4MSMB 3PRZA 3WA0A 2PW9A 5I4DA 4EZKA 3GP7A 2JWZA 3WAPA 1KOTA 2IJ0A 4RGTA 4FA6A 3KVFB 3VTWA 2V4LA 3L13A 4RM8A 1CK1A 2L52A 1B9RA 1GG3A 3IXSA 1ZXIA 2CU3A 2DENB 1KH0A 2LGDA 4OZBA 2KYWA 2INNE 3ZXVA 4TKNA 4JE3B 1VZ7A 2DYMA 1IYFA 4HRSA 1P98A 1WJ6A 3ZXRA 1WI0A 1LM8B 1KFYB 3K9PB 4C4VA 1RRBA 3AU4A 3NJTA 3DBRI 4XE0A 2BS2B 1FIQA 2N4FA 2BB6A 2Z0DB 4GDKB 2CR5A 4GOCA 2XBBC 3PRMB 2DBYA 3KWVA 4RF0A 4WJNA 5EDSA 4GGQA 1WYGA 4D2KA 3O13A 4JWSC 4PYUA 4ACFA 4XWWA 4ICVA 2INCC 3U7DA 5AUIA 1S1QB 1QLBB 1KRHA 1VDVA 4B9KA 2FE8A 5TSSA 1WXMA 2K8CA 1WX8A 2J42A 4MH8A 1J7CA 1RAXA 2DLBA 5D2MB 1YX6B 3W9CB 5CTRC 3FAHA 4NAMA 3NVZA 4KDIC 4IG7B 2BPSA 4OVVA 2GBRA 2FUHB 1KTKA 1E7VA 2N9LA 1P0RA 2QHOA 4W9FA 2W9NA 3TIXA 2REXA 5JHAA 1CMXB 4HPLB 5H92C 3RT3B 3RNAC 1BUIC 3B08A 2LHDA 3VHTC 5GXGB 2LGYA 1JMLA 1H8CA 2AWTA 1SGHA 4L1BA 5L83A 4EEWA 1MG8A 2WU2B 2D3BA 2QEJC 2IZVB 2HE7A 2KT7A 1OTRB 1EWCA 3L4PA 3IAS1 1YQBA 3MHSD 1XLOA 3ZGZA 5EE3A 1WR1A 5BYQA 3C19A 3EFUA 1CZPA 4W9HA 3V60A 1WE7A 2ONQA 4ANXA 3PLVA 1KLGD 3EGRA 2DX5B 2NR2A 4MJSA 1YJ1A 3UF8A 1N62A 5BYRA 1WF9A 4YWGG 2A4ZA 4KGTA 4KX6B 3WAMA 5G2NA 3ZO5B 3PV1A 4EZLA 4US8A 2W3SA 3NVYA 1UWXA 1ZW7A 1SE9A 3DCGA 2I1KA 1UBIA 1DOYA 1E5WA 2FIFA 4WIPA 2LXAA 1HTOA 3LYYA 2ZW0A 4NJ6A 2JY6A 2GBNA 5T8IA 4PT5A 3OJ3A 1PDXA 2C7MB 4OW0A 1LFDA 3AE2B 2J0JA 4HDQA 1WGGA 3ZLZA 4HJKA 1HXYD 3RFZB 4GXBA 3B2FA 3CIRB 3NOBA 4W9JA 1XEEA 3ML9A 2W3RA 1SIJA 2L00B 1P7EA 2VRRB 3U52E 3LXFA 3AE7B 2EMSA 3NG0A 2KN4A 1B1ZA 1NYRA 4DDID 4M8MA 4HWIB 3T3NA 4DBGA 4PS3A 2NBUA 1WXSA 4GDLA 1QQRA 1WSPA 4EUTA 5IA7A 3NHEB 3M63B 3SR6A 3W5UB 3QAQA 3VTVA 1UZXB 3P2BA 1F9JA 3ZNGC 2SAKA 4CHKA 1T6BX 5BMGA 1OQYA 3RNBC 4LNFA 4WQMA 1TGZB 1ZOYB 3Q14C 1FXIA 4HCPB 1E7UA 4I6LB 3A1QA 2I2YA 1WJUA 2GBKA 1XQQA 1YMHE 3IHPC 5IAAC 2ZW1A 4XDDA 3APCA 1LQBA 1EU3A 3BVMA 4JQWC 2IY0B 2R2OA 2DZMA 2MW5A 4MM3B 1UWMA 1WMHB 1TY0A 1KLVA 4BKTA 5CHWA 1RYJA 2O6VA 4KSLC 1SE2A 3ZTDA 1A70A 3TEWA 1MI0A 5AUKA 4ZHPA 4C7ZA 5JH5C 1NI3A 4AOFA 2RD0A 1UBQA 2WDTB 2IPKD 2K5PA 3KH0A 3ZNID 1V97A 4TQ1A 3TBLD 3P4SB 4IC7B 1JWMD 4MSQB 3UI3A 2LVPA 1YN3A 3NY5A 2FAZA 1QILA 1C79A 1R4MI 1XO3A 2KX0A 2DAJA 2NBWB 1L4DB 2X38A 2KNBA 3R7QA 3GZNB 3RUIB 2WP9B 4TMAB 4MT5A 3A4RA 3DQVA 2H89B 4PS8A 1RFAA 4DXFA 3TUOA 1PUTA 2BYTA 1GOZA 2EELA 4BKSA 4JLCA 2KMAA 2KC1A 3TEYA 3X23A 1V86A 2BYEA 4S0RA 3W1SC 2NPTB 1JRUA 2MQJA 3W2DA 5HHDG 2DWQA 3NRZA 3JSVA 3MTNB 2INDC 1V81A 3AE6B 2LUEA 3DVGY 4K3BA 4BBNC 4RGMA 3K9OB 3PPAA 3PS6A 1J7BA 3DBLI 4MGIE 1P1AA 3GB1A 3ABVB 3BVZA 2PVGC 3NVVA 4DHJD 4J6IA 1LO5D 3L17A 4WJOA 1I35A 2JZPA 4WAAA 2V4IB 1OEYA 2N7DA 1N60A 4JIOU 4ARIA 2WXNA 1UH6A 4HLEA 3BVGA 4KIKA 2FNJB 3QARA 1KF6B 4YSYB 4KKJA 1FFVA 4CYEA 2CKHB 3ZIMA 4C4VB 2AL6A 4KV2A 4P1CC 3IG3A 4GU2A 2AQ3B 5J17A 2DAFA 3KUCB 1Q10A 1ZDXA 2VH2A 1SB3C 4AUQC 1NBFC 4C7YA 2M56B 3RD2A 2J4XA 2WXHA 2B76B 2WX0A 3N9YC 3OJ4B 3QJZA 2PVOD 3NZUA 1J0GA 1V2YA 2K3UA 2GBMA 4BAXA 1J19A
chains in the Genus database with same CATH topology
3EECA 3TJPA 2CHZA 2N4FA 2Z0DB 2KD0A 3UQBA 2L05A 2G45B 4FN2A 4GDKB 2CR5A 4GOCA 4M8NA 4W9IA 2XBBC 2IO1B 2LZ6A 2GOWA 3PRMB 4MGYE 1FXTB 4NNJB 2JVCA 3BINA 2KC2A 2KWCA 2ZZPB 4WJNA 5EDSA 4G50A 4I6PA 4EZJA 4GGQA 4NY0A 4DHJB 2JUOA 3DBSA 4GN1A 1TZ1A 4OVUA 5E6NA 2ZEQA 4PYUA 2LRUA 1EO6A 4WWPA 4DDGD 3VUWA 4ZRJA 4ICVA 2PE9A 3U7DA 4FHKA 2K8HA 2KLGA 4NAWA 2D2QA 3M62B 4F1SA 3VUXA 2NS5A 1S1QB 5D7GA 1Q0WB 3L10B 3R66C 2KJ6A 1WM2A 4B9KA 2N1VA 2V1YA 4M0WB 3PT2B 4LJOB 1WX9A 4HXDA 3HIZA 4GDKA 2CU1A 1T0YA 4B6WA 3UQAA 1WXMA 2K8CA 3CSFA 4PS7A 5L95C 2KMCA 1WX8A 2ZJDA 1XD3B 1RAXA 4ASWC 5D2MB 2I1JA 1YX6B 2C7HA 4FBJB 2LD9A 4IM2A 5AEKB 3PVLA 1KM7A 2K6QA 1K8RB 4IM0A 5CTRC 4TQ0A 2FCQA 2K39A 1YX5B 1E8ZA 4KDIC 4IG7B 2BPSA 4OVVA 1OGWA 2GBRA 3N3KB 2FUHB 1Q5WB 4IUMB 4F8CB 3GZNI 4X57B 4K81A 2MP2A 1E7VA 2L3ZA 2R2QA 3PHXB 2XK5B 4FULA 1P0RA 2QHOA 4W9FA 2W9NA 3TIXA 1VCBA 2REXA 5JHAA 1S3SG 1CMXB 3PTFC 2LVQA 4HPLB 1YD8U 2KHWB 2NVUI 5E6PA 3RT3B 2WWZA 2KJHB 2L76A 3B08A 4KZCA 2PE6B 2RSUA 1SIFA 3IBEA 3VHTC 3ALBA 3KUDB 3VTUA 3VDZA 4BKGA 2LXCA 2LGYA 3IVFA 1WGYA 4FHJA 4MJSB 5CHFA 2AYOB 3IFWB 4MGKE 4DHZB 2AWTA 1H8CA 1SGHA 5L83A 2N9EB 4EEWA 4WWOA 1MG8A 3L16A 5D94A 4HVBA 2IZVB 2D11A 2HE7A 3B1LX 3DVNV 1OTRB 1YQBA 1WYWB 2XK5A 2UWQA 3JW0X 3L54A 3MHSD 4KVGB 3HK0A 3ZTCA 1WR1A 4MDKE 2CS4A 2KVRA 2JF5A 2LGXA 3EFUA 2KQSA 4ZRKA 3QA8A 2NBVB 3DVGX 2FCNA 4W9HA 2RR9A 3TL5A 1OEYJ 1WE7A 2K6DB 3V60A 3ZRCA 3JYUA 3NS8A 4ANXA 3PLVA 1GUAB 3T8MA 1H4RA 2MBQA 2JRHA 2DX5B 4K1RB 3ZVVA 2NR2A 4MJSA 1UD7A 1G6JA 1YJ1A 1HE8A 4W9KA 5C23A 3UF8A 1UELA 3DOWA 3ZW3A 3RZFA 1IPGA 3RCZA 4JGHB 2C5LC 2IO0B 1WF9A 2J7QB 2KOXA 2OOBB 2A4ZA 2N9PC 1V80A 2M4NA 4EOYA 3X0WA 2D3GA 2DYOA 3Q3JA 1WXAA 3WAMA 5G2NA 2KFJA 2MA9B 2KTRB 3PV1A 4GMVA 3I3TB 1NI2A 3ZNZB 3ZO5B 4EZLA 2O2VB 3PHWB 4EKUA 5DCNA 3CSTA 4IW0A 1ZW7A 1P3QU 3HM6X 2M1MA 1SE9A 4JL9A 3DCGA 2I1KA 1UBIA 2KWVB 5C1ZA 3ML8A 2LVOA 1E5WA 3APFA 2FIFA 2LXAA 4DXAB 4MGZE 4G0NB 1WJNA 5LXIB 3V6CB 2BKFA 1WM3A 3DDCB 2XEWA 4NJ6A 2FCMA 3VH4B 2JY6A 2ZCCA 1WFYA 2GBNA 2IY1B 2KJRA 1WJ4A 2BKRB 3VH3B 3OJ3A 2IO3B 3Q3FA 3UIOB 1RLFA 2C7MB 2KTRA 3AXCA 4B95A 3VFKA 1LFDA 2O2VA 4BOZB 2J0JA 2O6VD 4HDQA 5TR5A 2D07B 4II2B 4WWNA 2LJ5A 1WGGA 3VQIA 4MEMA 3ZLZA 4HJKA 1E8YA 4IM3A 2ZVOA 2YLMA 2HJ8A 1E90A 4GXBA 4GDLB 3RYTA 3NOBA 4W9JA 2L0FA 1J8CA 3L08A 2OJRA 3ML9A 3DBHI 5GMVA 1WZ0A 1WX7A 2RGFA 2L00B 2MBHA 1ZGUB 1E8XA 1P9DU 5HKHA 1XT9B 3HM3A 4ZRIA 2VRRB 1PQSA 1GJZA 3OLMD 3PREA 4DHZE 1EF5A 5JZEB 2KXJA 3LJ3A 2KK8A 4GIVA 5AZFA 2EMSA 3KW5B 2L0TA 3CF6E 4LCDE 4NJ7A 3ZRFA 4A20A 2IYDB 3A4SC 3U8ZA 4DDID 4M8MA 2EMTA 1Q1OA 3UIPB 4HWIB 2J0KA 4DBGA 4PS3A 2BWES 2IO2B 2NBUA 4NQKE 1BT0A 1WXSA 2M0XA 4GDLA 2C60A 2LI5A 4MH0E 4EUTA 3N30A 3A33B 4EFOA 5IA7A 3NHEB 1NDDA 4YL8A 3ZDMC 5DPWA 3M63B 5G55A 3A1QB 3AI5A 3A9JB 3QAQA 3VTVA 2K8BA 1UZXB 2N1WA 3P2BA 5E6OA 1F9JA 2NCNA 2C9WB 4CO7A 3ZNGC 4CHKA 1V5TA 4HCNB 1EUVB 3L0WB 4II3B 3WANA 4FJZA 4W9CA 1UGMA 4GB9A 1OQYA 4BFRA 1X1MA 4ICUA 2RPQA 2GBJA 1WR6E 1WY8A 2BGFA 4BKSD 2HTHA 3EHVA 1TGZB 4ANUA 3H9DA 1WE6A 3WALA 4BOSC 2G4DB 4A3OA 2BWFA 4HCPB 1E7UA 2HD5B 3RZWC 4I6LB 3QCAA 1WGHA 1WXVA 3A1QA 3QK0A 1WJUA 2GBKA 5KHOA 1XQQA 2O6VB 3M3JA 3IHPC 3R3MA 3QC8B 4RM9A 5IAAC 3LDZE 4G11A 3APCA 1LQBA 3PSEB 2N9XA 2MWSB 2LASA 1WH3A 2JZ3B 4JQWC 4N9F4 2IY0B 3W1YA 4LDTD 2MCNB 4FJVB 1KJTA 5J18A 2EKEC 2R2OA 2DZMA 3VUYA 5AZHA 1V6EA 2MW5A 3DVNU 2C7NB 1WMHB 3BY4B 4W9LA 1KLVA 4BKTA 5CHWA 2G3QB 3ENEA 3QX1A 3H7SA 3V62A 2LRWA 4HPMB 3QHTA 5DPRA 3WAOA 2O6VA 4K7UA 1Y8RC 2KX3A 1M94A 4P7IA 4DWFA 4E74A 1YIWA 3D32A 3H1UA 4KSLC 3ZTDA 4FADA 3NZSA 4ZDVA 3SDLC 3PRPB 2DZKA 3H6NA 5JH5C 4KZ0A 4AOFA 2BF8B 2RD0A 1UBQA 2JT4B 2WDTB 3ZUNA 3ZDTA 2PEAA 3KH0A 3ZNID 3TMPB 4TQ1A 3TBLD 2WYQA 2MRPA 4AJWA 1ISNA 1VD2A 4IC7B 4MM3A 1WMHA 4LJPB 1U4AA 3KYCD 4K7SA 4MSQB 2LVPA 3MJWA 4FJYA 3NY5A 5BO4B 2FAZA 4AP4C 4DK5A 1R4MI 2V3SA 4F7ZA 3DPDA 1GC6A 2JZZA 4W9GA 2ZNVB 5J2RA 3PZDA 2ZVNA 3GOEA 3UINB 2KX0A 3SHQA 2DAJA 4AJYB 2NBWB 2ZNVC 3VXWA 1A5RA 4G3XB 4WQOB 2KO3A 2KNBA 1WIAA 5CX3A 4I6NB 3R7QA 3UGBB 3RUIB 2B3AA 2KDBA 2K1FA 3A4RA 1C1YB 2PJHA 3A9KB 3DQVA 4FLHA 2FIDA 3PGEA 4KDLB 3WIMA 4PS8A 3JSVB 2Z0EB 2G4SA 4WJQA 1RFAA 2GMIC 3R7RA 2KQ7A 3ZKJC 1C3TA 2MP2B 3QQ8B 1Z5SB 2KTFA 1Z2MA 1D3ZA 3APDA 3RULA 1TBEA 5D6JB 4BKSA 2ZCBA 4JLCA 4LDTB 2KN5A 2KMAA 2FCSA 2ASQA 2KC1A 2CHXA 2MX2A 3X23A 2AEHA 1V86A 2BYEA 1TTNA 2DHZA 3PLUA 4PYZA 4WJPA 4NQLB 3W1SC 5LLIA 3O65B 4BVUC 2NPTB 1JRUA 4AWJA 3JVZX 2MQJA 4BBNF 4RMAA 3A9KA 4HDOA 3TCAA 4ANVA 1R4NI 3KYDD 2KDIA 4K7WA 3JSVA 3MTNB 2J0MA 1IP9A 2WX1A 4URKA 1V81A 1ZKHA 2L7RA 2LUEA 2LWPA 1GC7A 3DVGY 3V6EB 2KDEB 1EF1A 1E8WA 2MSED 3AU5A 4ZYNA 4BBNC 5DPTA 3H7PB 4KIKB 3KUZA 3K9OB 3PPAA 3U30A 2BYVE 1GNUA 2N7EA 1I42A 3PS6A 2YVCA 3SD5A 2IBIB 3W1SA 1V9JA 2M17A 2UYZB 3B0AA 3DBLI 4GSWA 1WGDA 4MGIE 2MBBB 2JPHA 3C0RB 2MBOA 3EC8A 1P1AA 2NPTA 2DZJA 2K25A 2KFKB 3A9JA 4DHJD 4W9EA 4J6IA 3VAWA 3ECIA 3OAWA 5JHBA 2KWUB 3L17A 2MLBA 4WJOA 2KLCA 3SU8X 2Z59B 4NPNA 4W9DA 1AARA 1I35A 4MSMB 1WRDB 5DPSA 4WAAA 1OEYA 3PRZA 2N7DA 4MELA 2JXXA 4JIOU 2A5UA 2JRIB 3WA0A 3CMMB 3QWZB 1UH6A 4HLEA 2KZRA 4IWPA 3V61A 4XZ4A 4A3PA 3H7PA 4KIKA 4EZKA 2FNJB 3QARA 2JWZA 2L8JA 3WAPA 1KOTA 4FA6A 3KVFB 3VTWA 2V4LA 2BYFA 3L13A 4E3CA 4CYEA 4RM8A 2AL3A 5LXHA 2CKHB 3VVWB 5KHQA 1LXDA 3ZIMA 2AL6A 1GG3A 4KV2A 2KFKA 3IG3A 2PPHA 4GU2A 2DENB 2KDFB 5J17A 2DAFA 3KUCB 4XX5A 1L2NA 2LGDA 4KSKC 2ZPYA 3ONSA 1L7YA 3N32A 4IWQA 2DZIA 4AUQC 1NBFC 3AULA 1QZEA 4TUUA 3T9LA 4TKNA 3RD2A 2MBEA 2DYMA 2M8SA 1IYFA 2KANA 2KKCA 3M95A 5CHVC 2WX0A 1P98A 1WJ6A 2ZPNA 3OJ4B 1WI0A 3QJZA 1LM8B 3HHMA 3K9PB 3S2AA 3NZUA 1J0GA 4ANWA 2D10A 2CHWA 4TV3A 3ZNHB 1V2YA 2Y5BB 1WGRA 4IWOA 4E71A 4HK2A 2GBMA 1RRBA 3AU4A 1V5OA 3DBRI 5FR6A 4NAWB 1V49A 4XC2A 1WZ3A 2DYBA 3QIJA 1J19A 5AZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEC A;  3TJP A;  2CHZ A;  2N4F A;  2Z0D B;  2KD0 A;  3UQB A;  2L05 A;  2G45 B;  4FN2 A;  4GDK B;  2CR5 A;  4GOC A;  4M8N A;  4W9I A;  2XBB C;  2IO1 B;  2LZ6 A;  2GOW A;  3PRM B;  4MGY E;  1FXT B;  4NNJ B;  2JVC A;  3BIN A;  2KC2 A;  2KWC A;  2ZZP B;  4WJN A;  5EDS A;  4G50 A;  4I6P A;  4EZJ A;  4GGQ A;  4NY0 A;  4DHJ B;  2JUO A;  3DBS A;  4GN1 A;  1TZ1 A;  4OVU A;  5E6N A;  2ZEQ A;  4PYU A;  2LRU A;  1EO6 A;  4WWP A;  4DDG D;  3VUW A;  4ZRJ A;  4ICV A;  2PE9 A;  3U7D A;  4FHK A;  2K8H A;  2KLG A;  4NAW A;  2D2Q A;  3M62 B;  4F1S A;  3VUX A;  2NS5 A;  1S1Q B;  5D7G A;  1Q0W B;  3L10 B;  3R66 C;  2KJ6 A;  1WM2 A;  4B9K A;  2N1V A;  2V1Y A;  4M0W B;  3PT2 B;  4LJO B;  1WX9 A;  4HXD A;  3HIZ A;  4GDK A;  2CU1 A;  1T0Y A;  4B6W A;  3UQA A;  1WXM A;  2K8C A;  3CSF A;  4PS7 A;  5L95 C;  2KMC A;  1WX8 A;  2ZJD A;  1XD3 B;  1RAX A;  4ASW C;  5D2M B;  2I1J A;  1YX6 B;  2C7H A;  4FBJ B;  2LD9 A;  4IM2 A;  5AEK B;  3PVL A;  1KM7 A;  2K6Q A;  1K8R B;  4IM0 A;  5CTR C;  4TQ0 A;  2FCQ A;  2K39 A;  1YX5 B;  1E8Z A;  4KDI C;  4IG7 B;  2BPS A;  4OVV A;  1OGW A;  2GBR A;  3N3K B;  2FUH B;  1Q5W B;  4IUM B;  4F8C B;  3GZN I;  4X57 B;  4K81 A;  2MP2 A;  1E7V A;  2L3Z A;  2R2Q A;  3PHX B;  2XK5 B;  4FUL A;  1P0R A;  2QHO A;  4W9F A;  2W9N A;  3TIX A;  1VCB A;  2REX A;  5JHA A;  1S3S G;  1CMX B;  3PTF C;  2LVQ A;  4HPL B;  1YD8 U;  2KHW B;  2NVU I;  5E6P A;  3RT3 B;  2WWZ A;  2KJH B;  2L76 A;  3B08 A;  4KZC A;  2PE6 B;  2RSU A;  1SIF A;  3IBE A;  3VHT C;  3ALB A;  3KUD B;  3VTU A;  3VDZ A;  4BKG A;  2LXC A;  2LGY A;  3IVF A;  1WGY A;  4FHJ A;  4MJS B;  5CHF A;  2AYO B;  3IFW B;  4MGK E;  4DHZ B;  2AWT A;  1H8C A;  1SGH A;  5L83 A;  2N9E B;  4EEW A;  4WWO A;  1MG8 A;  3L16 A;  5D94 A;  4HVB A;  2IZV B;  2D11 A;  2HE7 A;  3B1L X;  3DVN V;  1OTR B;  1YQB A;  1WYW B;  2XK5 A;  2UWQ A;  3JW0 X;  3L54 A;  3MHS D;  4KVG B;  3HK0 A;  3ZTC A;  1WR1 A;  4MDK E;  2CS4 A;  2KVR A;  2JF5 A;  2LGX A;  3EFU A;  2KQS A;  4ZRK A;  3QA8 A;  2NBV B;  3DVG X;  2FCN A;  4W9H A;  2RR9 A;  3TL5 A;  1OEY J;  1WE7 A;  2K6D B;  3V60 A;  3ZRC A;  3JYU A;  3NS8 A;  4ANX A;  3PLV A;  1GUA B;  3T8M A;  1H4R A;  2MBQ A;  2JRH A;  2DX5 B;  4K1R B;  3ZVV A;  2NR2 A;  4MJS A;  1UD7 A;  1G6J A;  1YJ1 A;  1HE8 A;  4W9K A;  5C23 A;  3UF8 A;  1UEL A;  3DOW A;  3ZW3 A;  3RZF A;  1IPG A;  3RCZ A;  4JGH B;  2C5L C;  2IO0 B;  1WF9 A;  2J7Q B;  2KOX A;  2OOB B;  2A4Z A;  2N9P C;  1V80 A;  2M4N A;  4EOY A;  3X0W A;  2D3G A;  2DYO A;  3Q3J A;  1WXA A;  3WAM A;  5G2N A;  2KFJ A;  2MA9 B;  2KTR B;  3PV1 A;  4GMV A;  3I3T B;  1NI2 A;  3ZNZ B;  3ZO5 B;  4EZL A;  2O2V B;  3PHW B;  4EKU A;  5DCN A;  3CST A;  4IW0 A;  1ZW7 A;  1P3Q U;  3HM6 X;  2M1M A;  1SE9 A;  4JL9 A;  3DCG A;  2I1K A;  1UBI A;  2KWV B;  5C1Z A;  3ML8 A;  2LVO A;  1E5W A;  3APF A;  2FIF A;  2LXA A;  4DXA B;  4MGZ E;  4G0N B;  1WJN A;  5LXI B;  3V6C B;  2BKF A;  1WM3 A;  3DDC B;  2XEW A;  4NJ6 A;  2FCM A;  3VH4 B;  2JY6 A;  2ZCC A;  1WFY A;  2GBN A;  2IY1 B;  2KJR A;  1WJ4 A;  2BKR B;  3VH3 B;  3OJ3 A;  2IO3 B;  3Q3F A;  3UIO B;  1RLF A;  2C7M B;  2KTR A;  3AXC A;  4B95 A;  3VFK A;  1LFD A;  2O2V A;  4BOZ B;  2J0J A;  2O6V D;  4HDQ A;  5TR5 A;  2D07 B;  4II2 B;  4WWN A;  2LJ5 A;  1WGG A;  3VQI A;  4MEM A;  3ZLZ A;  4HJK A;  1E8Y A;  4IM3 A;  2ZVO A;  2YLM A;  2HJ8 A;  1E90 A;  4GXB A;  4GDL B;  3RYT A;  3NOB A;  4W9J A;  2L0F A;  1J8C A;  3L08 A;  2OJR A;  3ML9 A;  3DBH I;  5GMV A;  1WZ0 A;  1WX7 A;  2RGF A;  2L00 B;  2MBH A;  1ZGU B;  1E8X A;  1P9D U;  5HKH A;  1XT9 B;  3HM3 A;  4ZRI A;  2VRR B;  1PQS A;  1GJZ A;  3OLM D;  3PRE A;  4DHZ E;  1EF5 A;  5JZE B;  2KXJ A;  3LJ3 A;  2KK8 A;  4GIV A;  5AZF A;  2EMS A;  3KW5 B;  2L0T A;  3CF6 E;  4LCD E;  4NJ7 A;  3ZRF A;  4A20 A;  2IYD B;  3A4S C;  3U8Z A;  4DDI D;  4M8M A;  2EMT A;  1Q1O A;  3UIP B;  4HWI B;  2J0K A;  4DBG A;  4PS3 A;  2BWE S;  2IO2 B;  2NBU A;  4NQK E;  1BT0 A;  1WXS A;  2M0X A;  4GDL A;  2C60 A;  2LI5 A;  4MH0 E;  4EUT A;  3N30 A;  3A33 B;  4EFO A;  5IA7 A;  3NHE B;  1NDD A;  4YL8 A;  3ZDM C;  5DPW A;  3M63 B;  5G55 A;  3A1Q B;  3AI5 A;  3A9J B;  3QAQ A;  3VTV A;  2K8B A;  1UZX B;  2N1W A;  3P2B A;  5E6O A;  1F9J A;  2NCN A;  2C9W B;  4CO7 A;  3ZNG C;  4CHK A;  1V5T A;  4HCN B;  1EUV B;  3L0W B;  4II3 B;  3WAN A;  4FJZ A;  4W9C A;  1UGM A;  4GB9 A;  1OQY A;  4BFR A;  1X1M A;  4ICU A;  2RPQ A;  2GBJ A;  1WR6 E;  1WY8 A;  2BGF A;  4BKS D;  2HTH A;  3EHV A;  1TGZ B;  4ANU A;  3H9D A;  1WE6 A;  3WAL A;  4BOS C;  2G4D B;  4A3O A;  2BWF A;  4HCP B;  1E7U A;  2HD5 B;  3RZW C;  4I6L B;  3QCA A;  1WGH A;  1WXV A;  3A1Q A;  3QK0 A;  1WJU A;  2GBK A;  5KHO A;  1XQQ A;  2O6V B;  3M3J A;  3IHP C;  3R3M A;  3QC8 B;  4RM9 A;  5IAA C;  3LDZ E;  4G11 A;  3APC A;  1LQB A;  3PSE B;  2N9X A;  2MWS B;  2LAS A;  1WH3 A;  2JZ3 B;  4JQW C;  4N9F 4;  2IY0 B;  3W1Y A;  4LDT D;  2MCN B;  4FJV B;  1KJT A;  5J18 A;  2EKE C;  2R2O A;  2DZM A;  3VUY A;  5AZH A;  1V6E A;  2MW5 A;  3DVN U;  2C7N B;  1WMH B;  3BY4 B;  4W9L A;  1KLV A;  4BKT A;  5CHW A;  2G3Q B;  3ENE A;  3QX1 A;  3H7S A;  3V62 A;  2LRW A;  4HPM B;  3QHT A;  5DPR A;  3WAO A;  2O6V A;  4K7U A;  1Y8R C;  2KX3 A;  1M94 A;  4P7I A;  4DWF A;  4E74 A;  1YIW A;  3D32 A;  3H1U A;  4KSL C;  3ZTD A;  4FAD A;  3NZS A;  4ZDV A;  3SDL C;  3PRP B;  2DZK A;  3H6N A;  5JH5 C;  4KZ0 A;  4AOF A;  2BF8 B;  2RD0 A;  1UBQ A;  2JT4 B;  2WDT B;  3ZUN A;  3ZDT A;  2PEA A;  3KH0 A;  3ZNI D;  3TMP B;  4TQ1 A;  3TBL D;  2WYQ A;  2MRP A;  4AJW A;  1ISN A;  1VD2 A;  4IC7 B;  4MM3 A;  1WMH A;  4LJP B;  1U4A A;  3KYC D;  4K7S A;  4MSQ B;  2LVP A;  3MJW A;  4FJY A;  3NY5 A;  5BO4 B;  2FAZ A;  4AP4 C;  4DK5 A;  1R4M I;  2V3S A;  4F7Z A;  3DPD A;  1GC6 A;  2JZZ A;  4W9G A;  2ZNV B;  5J2R A;  3PZD A;  2ZVN A;  3GOE A;  3UIN B;  2KX0 A;  3SHQ A;  2DAJ A;  4AJY B;  2NBW B;  2ZNV C;  3VXW A;  1A5R A;  4G3X B;  4WQO B;  2KO3 A;  2KNB A;  1WIA A;  5CX3 A;  4I6N B;  3R7Q A;  3UGB B;  3RUI B;  2B3A A;  2KDB A;  2K1F A;  3A4R A;  1C1Y B;  2PJH A;  3A9K B;  3DQV A;  4FLH A;  2FID A;  3PGE A;  4KDL B;  3WIM A;  4PS8 A;  3JSV B;  2Z0E B;  2G4S A;  4WJQ A;  1RFA A;  2GMI C;  3R7R A;  2KQ7 A;  3ZKJ C;  1C3T A;  2MP2 B;  3QQ8 B;  1Z5S B;  2KTF A;  1Z2M A;  1D3Z A;  3APD A;  3RUL A;  1TBE A;  5D6J B;  4BKS A;  2ZCB A;  4JLC A;  4LDT B;  2KN5 A;  2KMA A;  2FCS A;  2ASQ A;  2KC1 A;  2CHX A;  2MX2 A;  3X23 A;  2AEH A;  1V86 A;  2BYE A;  1TTN A;  2DHZ A;  3PLU A;  4PYZ A;  4WJP A;  4NQL B;  3W1S C;  5LLI A;  3O65 B;  4BVU C;  2NPT B;  1JRU A;  4AWJ A;  3JVZ X;  2MQJ A;  4BBN F;  4RMA A;  3A9K A;  4HDO A;  3TCA A;  4ANV A;  1R4N I;  3KYD D;  2KDI A;  4K7W A;  3JSV A;  3MTN B;  2J0M A;  1IP9 A;  2WX1 A;  4URK A;  1V81 A;  1ZKH A;  2L7R A;  2LUE A;  2LWP A;  1GC7 A;  3DVG Y;  3V6E B;  2KDE B;  1EF1 A;  1E8W A;  2MSE D;  3AU5 A;  4ZYN A;  4BBN C;  5DPT A;  3H7P B;  4KIK B;  3KUZ A;  3K9O B;  3PPA A;  3U30 A;  2BYV E;  1GNU A;  2N7E A;  1I42 A;  3PS6 A;  2YVC A;  3SD5 A;  2IBI B;  3W1S A;  1V9J A;  2M17 A;  2UYZ B;  3B0A A;  3DBL I;  4GSW A;  1WGD A;  4MGI E;  2MBB B;  2JPH A;  3C0R B;  2MBO A;  3EC8 A;  1P1A A;  2NPT A;  2DZJ A;  2K25 A;  2KFK B;  3A9J A;  4DHJ D;  4W9E A;  4J6I A;  3VAW A;  3ECI A;  3OAW A;  5JHB A;  2KWU B;  3L17 A;  2MLB A;  4WJO A;  2KLC A;  3SU8 X;  2Z59 B;  4NPN A;  4W9D A;  1AAR A;  1I35 A;  4MSM B;  1WRD B;  5DPS A;  4WAA A;  1OEY A;  3PRZ A;  2N7D A;  4MEL A;  2JXX A;  4JIO U;  2A5U A;  2JRI B;  3WA0 A;  3CMM B;  3QWZ B;  1UH6 A;  4HLE A;  2KZR A;  4IWP A;  3V61 A;  4XZ4 A;  4A3P A;  3H7P A;  4KIK A;  4EZK A;  2FNJ B;  3QAR A;  2JWZ A;  2L8J A;  3WAP A;  1KOT A;  4FA6 A;  3KVF B;  3VTW A;  2V4L A;  2BYF A;  3L13 A;  4E3C A;  4CYE A;  4RM8 A;  2AL3 A;  5LXH A;  2CKH B;  3VVW B;  5KHQ A;  1LXD A;  3ZIM A;  2AL6 A;  1GG3 A;  4KV2 A;  2KFK A;  3IG3 A;  2PPH A;  4GU2 A;  2DEN B;  2KDF B;  5J17 A;  2DAF A;  3KUC B;  4XX5 A;  1L2N A;  2LGD A;  4KSK C;  2ZPY A;  3ONS A;  1L7Y A;  3N32 A;  4IWQ A;  2DZI A;  4AUQ C;  1NBF C;  3AUL A;  1QZE A;  4TUU A;  3T9L A;  4TKN A;  3RD2 A;  2MBE A;  2DYM A;  2M8S A;  1IYF A;  2KAN A;  2KKC A;  3M95 A;  5CHV C;  2WX0 A;  1P98 A;  1WJ6 A;  2ZPN A;  3OJ4 B;  1WI0 A;  3QJZ A;  1LM8 B;  3HHM A;  3K9P B;  3S2A A;  3NZU A;  1J0G A;  4ANW A;  2D10 A;  2CHW A;  4TV3 A;  3ZNH B;  1V2Y A;  2Y5B B;  1WGR A;  4IWO A;  4E71 A;  4HK2 A;  2GBM A;  1RRB A;  3AU4 A;  1V5O A;  3DBR I;  5FR6 A;  4NAW B;  1V49 A;  4XC2 A;  1WZ3 A;  2DYB A;  3QIJ A;  1J19 A;  5AZG A; 
#chains in the Genus database with same CATH topology
 3EEC A;  4RF1 A;  2J53 A;  2YEP B;  2L05 A;  4FN2 A;  4H2A A;  1F2R I;  2IO1 B;  1FXT B;  2KC2 A;  1VRA B;  3MC9 A;  4NY0 A;  4DHJ B;  4GN1 A;  2LFI A;  5E6N A;  2ZEQ A;  2LRU A;  1EO6 A;  1TY2 A;  1XCQ L;  4WWP A;  4A9A A;  4DDG D;  2PE9 A;  4FHK A;  1FM0 D;  2K8H A;  4NAW A;  1TS2 A;  3M62 B;  4F1S A;  2M19 A;  2NS5 A;  5D7G A;  2V3N A;  1XF5 L;  1Q0W B;  2WHI A;  3L10 B;  3P42 A;  1WM2 A;  2N1V A;  2V1Y A;  4LJO B;  1WX9 A;  2OJW A;  1T0Y A;  4B6W A;  3CSF A;  1F0Z A;  4PS7 A;  2ZJD A;  1C4A A;  1J7A A;  1XD3 B;  4ASW C;  2Y5C A;  1K52 A;  2I1J A;  1WXQ A;  4FBJ B;  2LD9 A;  5AEK B;  1HA5 A;  1KM7 A;  1JCK B;  4TQ0 A;  2K39 A;  1OQQ A;  1JQ4 A;  1C4C A;  4F8C B;  3GZN I;  4X57 B;  4N58 A;  4K81 A;  2OED A;  2R2Q A;  4FUL A;  2ACZ B;  1JW9 D;  5EE0 A;  1TJE A;  1VCB A;  3N1Z C;  3PTF C;  2LVQ A;  1YD8 U;  2KHW B;  2NVU I;  5E6P A;  2WWZ A;  2L76 A;  2RSU A;  3VTU A;  3MHZ A;  2LHE A;  1YN5 A;  3URY A;  2LUM A;  3IVF A;  4FHJ A;  2BB5 A;  4MJS B;  3IFW B;  4DHZ B;  4A55 A;  4WWM A;  1T0R C;  3B1L X;  4Q2J A;  3ZJU A;  1WYW B;  1FRR A;  3ZTC A;  4MDK E;  2JF5 A;  3IT6 B;  2RR9 A;  1OEY J;  1R7S A;  2K6D B;  4YTP B;  1ET6 A;  3JYU A;  5IN7 A;  3NS8 A;  1H4R A;  3ZVV A;  1SJE D;  1L5P A;  2WNM A;  4YSX B;  4YXD B;  1WWT A;  1ESF A;  1EM7 A;  3MC8 A;  2N9P C;  1V80 A;  3AEG B;  1ENF A;  1JWA D;  3X0W A;  1TS4 A;  1YNT E;  2MA9 B;  4GMV A;  1FMA D;  1CQV A;  3NS1 A;  4IW0 A;  3MJ5 A;  1F52 A;  1IBX A;  4O1N A;  3APF A;  3R2I A;  4S17 A;  4G0N B;  2XEW A;  2FCM A;  2ZCC A;  1WFY A;  5IP4 D;  2Z8L A;  1PGA A;  3GE8 C;  2W54 A;  4QAY A;  2KTR A;  1C78 A;  1QOG A;  2O6V D;  5TR5 A;  2D07 B;  1FCL A;  3VQI A;  2W55 A;  1YJJ A;  1SEB D;  4IM3 A;  2YLM A;  1R4N B;  1HZ6 A;  4GDL B;  1VJK A;  1J8C A;  5GMV A;  1HEZ E;  1ZGU B;  1E8X A;  5HKH A;  1XT9 B;  2QC8 A;  5IKC M;  1GJZ A;  3OLM D;  4K3C A;  4DHZ E;  1EF5 A;  5JZE B;  1FNV A;  5AZF A;  4LCD E;  3CF6 E;  4NJ7 A;  2IYD B;  3U8Z A;  1TKG A;  1ZXH A;  3BK1 A;  2BWE S;  4NQK E;  1BT0 A;  5FKA C;  2M0X A;  2LI5 A;  4MH0 E;  1ACC A;  4A90 A;  1K50 A;  4YL8 A;  3ZDM C;  5G55 A;  3A1Q B;  2K8B A;  2N1W A;  1UNS A;  2NCN A;  4CO7 A;  1SJH D;  1E6E B;  1I7H A;  4HCN B;  1UGM A;  2IGH A;  4BFR A;  2GBJ A;  2NTS A;  1BXT A;  2BGF A;  4BKS D;  4ANU A;  3WAL A;  4A3O A;  1PGB A;  2LEK A;  1RFK A;  3RZW C;  3WCQ A;  3QCA A;  5KHO A;  3Q8C A;  2AQ1 B;  2O6V B;  4C80 A;  3M3J A;  3B2G A;  3RI7 C;  3R3M A;  3LDZ E;  1N61 A;  1L0X B;  2MWS B;  2BTE A;  5JXV A;  1WH3 A;  1N5W A;  2XNA C;  3E9S A;  3I63 C;  4LDT D;  4FJV B;  1FO4 A;  3VUY A;  1V6E A;  3DVN U;  4YTN B;  2K0P A;  3BY4 B;  4W9L A;  2VH1 A;  3ENE A;  3QX1 A;  3RN9 C;  3H7S A;  3V62 A;  5DPR A;  2R61 A;  3LB8 C;  4K7U A;  1Y8R C;  1M94 A;  4P7I A;  4DWF A;  4E74 A;  3AEF B;  1F2R C;  2YEP F;  3MFG A;  4FAD A;  2LMC A;  3EUB 2;  3PRP B;  4KZ0 A;  1MFW A;  4IDI A;  2BW2 A;  2JT4 B;  2L32 A;  4FXC A;  3ZUN A;  3NVW A;  3TMP B;  2WYQ A;  1ISN A;  1PFD A;  3HVZ A;  1MHX A;  1GAQ B;  1SE3 A;  1HQR D;  3MJW A;  1MHH E;  4USA A;  1MPE A;  2V3S A;  3EFC A;  1GC6 A;  1VZ6 A;  2JZZ A;  2ZNV B;  1FPY A;  3AV8 A;  3PZD A;  1L0V B;  3GOE A;  2WXM A;  3UIN B;  5C2T B;  2RDG A;  2KVZ A;  1JWU D;  4I6N B;  5IO9 A;  4HEA 1;  2PJH A;  1SBB B;  3JSV B;  1C4P A;  1N6Z A;  4L23 A;  1TS5 A;  2E3T A;  3R8B A;  2INP E;  1C3T A;  3QQ8 B;  1Z2M A;  1D3Z A;  2MJD A;  2LJI A;  2IDY A;  4LDT B;  1TIF A;  2ASQ A;  2LGI A;  2DHZ A;  4CQN A;  2MHJ A;  4C00 A;  1D5Z C;  3JVZ X;  4BBN F;  4HDO A;  3TCA A;  2GI9 A;  4ANV A;  1R4N I;  2WX1 A;  4URK A;  5HFY A;  1I4R A;  2KDE B;  2H88 B;  1ET9 A;  3AE4 B;  3AU5 A;  4ZYN A;  1FXA A;  4KIK B;  3KUZ A;  3U30 A;  1I42 A;  4HRO A;  3SD5 A;  2IBI B;  4GSW A;  1WGD A;  1ZDV A;  4LNO A;  3TEX A;  2JPH A;  3C0R B;  2N7J A;  1YOV B;  2CJO A;  1AN8 A;  2KWU B;  2MLB A;  3SU8 X;  2Z59 B;  4NPN A;  3I9V 1;  2DNF A;  1WRD B;  3BZD B;  5DPS A;  1MJD A;  3U7Z A;  2JWU A;  3TEZ A;  2JRI B;  3I5J C;  3CMM B;  3DWG C;  3QWZ B;  4IWP A;  3SFD B;  3V61 A;  4XZ4 A;  4A3P A;  5BMH A;  3H7P A;  3AB5 A;  2L8J A;  3FC4 A;  2BYF A;  2MJ3 A;  5KHQ A;  1LXD A;  1JWB D;  2KFK A;  3PZ8 A;  2PPH A;  2KDF B;  1FFU A;  1D5M C;  4IWQ A;  2DZI A;  4REZ A;  1QZE A;  2FUG 1;  4TUU A;  2MBE A;  2KKC A;  5CHV C;  2ZPN A;  3V05 A;  1KLU D;  2CHW A;  4IWO A;  1V5O A;  5H8Y E;  4NAW B;  1WGK A;  2WXF A;  1V49 A;  2BBC A;  1WZ3 A;  4YSZ B;  2JYE A;  1JWS D;  5G5G A;  3TJP A;  3BWU D;  2CHZ A;  1EWY C;  2WU5 B;  1PYW D;  4M8N A;  2GOW A;  4MGY E;  2JVC A;  3BIN A;  2KWC A;  4I6P A;  4EZJ A;  2JUO A;  1TZ1 A;  1YJI A;  4OVU A;  4RH6 A;  1SSN A;  2K9X A;  4HJG E;  4ZRJ A;  4XGA B;  4LNN A;  2KLG A;  4BZA A;  3IT4 B;  3VUX A;  1I4H A;  3R66 C;  4M0W B;  3PT2 B;  5EE9 A;  3HIZ A;  2CU1 A;  2QIE B;  3UQA A;  5L95 C;  2WXP A;  2N0S B;  1CJE A;  1YQ4 B;  2C7H A;  4RFB A;  2K6Q A;  1K8R B;  2KQ4 X;  1YX5 B;  2JYT A;  3ZJT A;  1D4B A;  3N3K B;  4P1B C;  2QSD A;  4KGS A;  3VRB B;  2RPV A;  2WXR A;  1FNU A;  4LNI A;  3AH7 A;  4B0E A;  4KZC A;  3IBE A;  4RGN A;  3ALB A;  3VDZ A;  2Y5P A;  1WGY A;  4MGK E;  2N9E B;  5HI1 A;  4WWO A;  3L16 A;  5D94 A;  4HVB A;  1I4P A;  2XK5 A;  3JW0 X;  2UWQ A;  4IKG A;  1Y56 A;  2CS4 A;  4B0M A;  3Q8A A;  2HTM E;  2LGX A;  3R2T A;  2KQS A;  3DVG X;  1D5X C;  2FCN A;  1YQ3 B;  3ZRC A;  3BK2 A;  1NEN B;  1XLP A;  3P1M A;  1V1O A;  1V8C A;  1GUA B;  2PMV A;  4K1R B;  1IBX B;  3BII D;  1HE8 A;  4W9K A;  5C23 A;  4WUR A;  1UEL A;  2G1E A;  1IPG A;  3RCZ A;  4JGH B;  2IO0 B;  3V3X A;  2KOX A;  1GB4 A;  1QT9 A;  2JSV X;  2D3G A;  2DYO A;  3Q3J A;  1WXA A;  1VLB A;  2KFJ A;  3ZNZ B;  2KTR B;  1I4X A;  2ON8 A;  4OVZ A;  1NI2 A;  4EKU A;  2SEB D;  2M1M A;  1FCC C;  4JL9 A;  2KWV B;  5C1Z A;  1ZE3 D;  2I38 A;  1SE4 A;  2LVO A;  1FEH A;  4P6V F;  1F1H A;  4DXA B;  1WJN A;  5LXI B;  3VH4 B;  2BKF A;  1WM3 A;  3J9C A;  2KJR A;  3Q6B A;  3MP9 A;  1TYG B;  2BKR B;  4RCO A;  5D3I B;  2IO3 B;  4OHJ A;  4DXG A;  3AXC A;  3VFK A;  2JU6 X;  2O2V A;  4BOZ B;  2L83 A;  1GB1 A;  2LGS A;  2LJ5 A;  2G9H D;  4LTU A;  4WH4 A;  3P63 A;  1GPX A;  1YN4 A;  4EE2 A;  3L08 A;  1E7P B;  2BS3 B;  3AMZ A;  2JX5 A;  1WX7 A;  2RGF A;  2MBH A;  1FD6 A;  1ROE A;  1VZ8 A;  2KXJ A;  3DHH C;  3LJ3 A;  5HG2 A;  4GIV A;  2L0T A;  4A20 A;  2GB1 A;  3ZRF A;  3Q3N C;  2D3A A;  3BYY B;  2EMT A;  2C60 A;  3AE8 B;  3N30 A;  4M0W A;  3A33 B;  1NDD A;  2WDV B;  3RPF C;  1QOA A;  4ZRP A;  3P4P B;  3L0W B;  4W9C A;  4N6E B;  2WLB A;  2WQY B;  4ICU A;  1IGC A;  2RPQ A;  1UUP A;  1WR6 E;  5BYS A;  3H9D A;  1WE6 A;  3AN1 A;  4BOS C;  2NMQ A;  3DHI C;  1E10 A;  2G4D B;  2BWF A;  1I4Q A;  3Q8E A;  2WDR B;  4AS1 A;  3QK0 A;  2WXG A;  2EKI A;  2QCZ A;  4G11 A;  5FK9 C;  2LAS A;  4LLG M;  3ZQ4 A;  3VR8 B;  4NJC A;  2D3C A;  3AE1 B;  1DOI A;  2GRI A;  1QOF A;  2EKE C;  3N1Y C;  5AZH A;  2V0G A;  2C7N B;  3AE3 B;  2G3Q B;  4OZA A;  4TSS A;  2KX3 A;  3FIL B;  1TS3 A;  1YIW A;  1C9F A;  1PGX A;  4ZDV A;  4OZC A;  3SDL C;  2DZK A;  3H6N A;  1UF0 A;  2K22 A;  2BF8 B;  2KAJ A;  4HPP A;  2PEA A;  2E6X A;  4M02 A;  1VD2 A;  4M01 A;  4LJP B;  3VRA B;  3DHG C;  5LNK 1;  4FJY A;  4AP4 C;  4R3D A;  4F7Z A;  2MEK A;  4HKZ E;  3DPD A;  4J3O D;  3TSS A;  2ZVN A;  4AQ7 A;  3RNG C;  3SHQ A;  4DQO C;  1A5R A;  2ZNV C;  1EU4 A;  4WQO B;  3SFE B;  2KO3 A;  1WIA A;  5CX3 A;  3UGB B;  2FBW B;  2B3A A;  1IGD A;  4XWT A;  1JRP A;  2GMI C;  2ICI A;  2V3P A;  2IGG A;  3Q3M C;  3ZKJ C;  2MP2 B;  1Z5S B;  1TBE A;  5D6J B;  3OG5 A;  2KN5 A;  2FCS A;  2CHX A;  2AEH A;  3P4Q B;  2MH7 A;  4NQL B;  5LLI A;  4BVU C;  4AWJ A;  4RMA A;  3A9K A;  3KLS X;  3KYD D;  3Q8F A;  1C77 A;  2J0M A;  1IP9 A;  1ZKH A;  2L7R A;  1GC7 A;  3V6E B;  1EF1 A;  1E8W A;  1OQR A;  2MSE D;  5DPT A;  3H7P B;  2BYV E;  1GNU A;  2N7E A;  3W1S A;  1TKY A;  2M17 A;  2UYZ B;  3B0A A;  2MBO A;  3EC8 A;  3AEB B;  2K25 A;  2KFK B;  3VAW A;  3ECI A;  1JRO A;  5JHB A;  1L6U A;  2KLC A;  1QOB A;  2WXI A;  1AYF A;  1XLN A;  1DGJ A;  1DOX A;  3DWM A;  4MEL A;  2JXX A;  3BYT B;  1L0Y B;  2A5U A;  3KQ4 A;  3AE5 B;  2KZR A;  1T5X D;  1SF0 A;  3NUH B;  3P4R B;  3HVD A;  4E3C A;  1K51 A;  1UGJ A;  2AL3 A;  3IAM 1;  2AQ2 B;  5LXH A;  5EE1 A;  3VVW B;  1ZP0 B;  1P7F A;  4XX5 A;  1L2N A;  4KSK C;  2ZPY A;  3ONS A;  1L7Y A;  3N32 A;  3AUL A;  4UDU C;  1R4M B;  3T9L A;  4ITK A;  2BQQ A;  2M8S A;  1IUE A;  2KAN A;  3M95 A;  3AEC B;  1NVI D;  3DBH B;  2HDE A;  3HHM A;  3S2A A;  1TKE A;  4N59 A;  2D10 A;  4ANW A;  3ZNH B;  4TV3 A;  2Y5B B;  1WGR A;  4E71 A;  4HK2 A;  1MVK A;  5FR6 A;  3FIL A;  3SEB A;  4XC2 A;  2DYB A;  4LK0 M;  3QIJ A;  2LWP A;  4GLS C;  5AZG A;  4RNA A;  2KD0 A;  3RNE C;  3UQB A;  2G45 B;  1M4V A;  2Q5W D;  5MPO A;  4W9I A;  2LZ6 A;  1STE A;  4NNJ B;  2BT6 A;  2ZZP B;  4G50 A;  1AWD A;  3DBS A;  4P16 A;  1L4Z B;  5FR3 A;  3VUW A;  4HKQ A;  3CWI A;  2D2Q A;  2PIA A;  1XLQ A;  2BVC A;  2KJ6 A;  3ETR A;  4HXD A;  4GDK A;  1VR9 A;  4YTM B;  2KMC A;  4ZOH C;  3VR9 B;  4IM2 A;  3PVL A;  4IM0 A;  3DBL B;  2FCQ A;  1N5X A;  1E8Z A;  3ZYY X;  1OGW A;  4IUM B;  1Q5W B;  5E6J A;  2MP2 A;  2L3Z A;  3PHX B;  2AX5 A;  2XK5 B;  2PKO A;  1S3S G;  2KJH B;  3RNF C;  2TSS A;  2PE6 B;  1SIF A;  1QF6 A;  3KUD B;  1BML C;  1T0Q C;  4BKG A;  2WDQ B;  2LXC A;  2OHF A;  5CHF A;  2AYO B;  2BS4 B;  1XXG A;  3H8H A;  2D11 A;  2KWD A;  3DVN V;  2WXJ A;  1HTQ A;  2D5G A;  2X8X X;  3L54 A;  4KVG B;  3HK0 A;  2KMM A;  2KVR A;  1V1P B;  4ZRK A;  3QA8 A;  2NBV B;  3TL5 A;  2RMM A;  4YT0 B;  2WS3 B;  3T8M A;  2MBQ A;  2JRH A;  2CJN A;  1DYQ A;  1ZPS A;  1UD7 A;  1G6J A;  3W5V B;  3DOW A;  3ZW3 A;  3RZF A;  4IOI E;  2C5L C;  2J7Q B;  2OOB B;  4LNK A;  2M4N A;  4EOY A;  3FKY A;  1AW7 A;  4RGO S;  3AEE B;  2WXQ A;  3I3T B;  3N20 C;  2O2V B;  4XDC A;  2W82 A;  3PHW B;  5DCN A;  3CST A;  1P3Q U;  3HM6 X;  2QDF A;  1K53 A;  2RDH A;  3ML8 A;  4A6Q A;  3Q69 A;  2HJ1 A;  4MGZ E;  3V6C B;  1NYQ A;  3DDC B;  2M0A A;  4XYC A;  3U2S C;  2IY1 B;  1WJ4 A;  2V9H A;  3VH3 B;  1JAL A;  3Q3F A;  3UIO B;  1RLF A;  4B95 A;  1OFF A;  1XCT L;  4II2 B;  4WWN A;  4MEM A;  1E8Y A;  4C56 C;  2ZVO A;  2HJ8 A;  1E90 A;  4KKI A;  3RYT A;  4PK1 A;  4WAF A;  2L0F A;  3I57 A;  2OJR A;  3DBH I;  1WZ0 A;  4ZHO A;  4JX1 C;  1P9D U;  3HM3 A;  4ZRI A;  1PQS A;  1FRD A;  2IGD A;  2WXL A;  3PRE A;  2KK8 A;  2PTL A;  3AEA B;  3E56 A;  3KW5 B;  5IOI A;  3A4S C;  1Q1O A;  3UIP B;  3ZJV A;  2J0K A;  2IO2 B;  3EA6 A;  2VZK D;  4EFO A;  2MJE A;  5DPW A;  2Y3A A;  3AI5 A;  3A9J B;  3AM9 A;  5E6O A;  2C9W B;  4A8X C;  3RMK C;  1V5T A;  1EUV B;  4II3 B;  3WAN A;  3GE3 C;  4FJZ A;  4GB9 A;  1X1M A;  1WY8 A;  3PO0 A;  4JWU C;  2WXK A;  2HTH A;  3EHV A;  3GS2 A;  2KDM A;  2HD5 B;  1SXT A;  2N9K A;  1WGH A;  1WXV A;  3U4E G;  3QC8 B;  3N1X C;  4RM9 A;  3T3O A;  3PSE B;  2WXO A;  2N9X A;  4ZYS A;  3Q3O C;  2KAC A;  2JXT A;  2JZ3 B;  4ZRQ A;  2RDB C;  4N9F 4;  3DBR B;  3W1Y A;  1MG4 A;  2MCN B;  1KJT A;  5J18 A;  1WRI A;  2L1A A;  2QJL A;  1V1P A;  2LRW A;  4HPM B;  3QHT A;  3WAO A;  2GLS A;  3D32 A;  3H1U A;  3NZS A;  1TZO A;  1LGR A;  2VZK B;  1FNW A;  1QKZ A;  3OWE B;  3ZDT A;  1N63 A;  2UU7 A;  3HRD D;  3B9J A;  2MRP A;  4AJW A;  4MM3 A;  1RWS A;  1WMH A;  3PZ7 A;  1U4A A;  3KYC D;  4K7S A;  5BO4 B;  4DK5 A;  2QIL A;  3MC0 B;  4W9G A;  5J2R A;  1L6V A;  1T0S C;  4MAC A;  4M00 A;  4AJY B;  3VXW A;  4G3X B;  4JPS A;  2KDB A;  2K1F A;  1C1Y B;  3A9K B;  1D6E C;  4FLH A;  2FID A;  3PGE A;  4KDL B;  3WIM A;  2Z0E B;  2G4S A;  4WJQ A;  1HZ5 A;  1RM6 C;  1F77 A;  3R7R A;  5G5H A;  2KQ7 A;  2KTF A;  3APD A;  3RUL A;  5D3D A;  3KWL A;  1NEK B;  2ZCB A;  2J52 A;  3Q2A C;  4NZL B;  2MX2 A;  1TTN A;  3PLU A;  4PYZ A;  4WJP A;  3O65 B;  2NTT A;  1TT5 B;  2JQR B;  3RNC C;  2KDI A;  4K7W A;  1ZUD 2;  1I4G A;  4L2Y A;  1T3Q A;  3Q8B A;  4ARC A;  2QMT A;  1E9M A;  2XN9 C;  5BMI A;  4KGR A;  4US9 A;  3C8Y A;  2YVC A;  1V9J A;  2PLP A;  2WGS A;  2MBB B;  3NZ3 A;  2NPT A;  2DZJ A;  3A9J A;  3AE9 B;  4W9E A;  3OAW A;  3AED B;  5C3J B;  1E0Z A;  1C76 A;  3HUI A;  4W9D A;  1AAR A;  4MSM B;  3PRZ A;  3WA0 A;  2PW9 A;  5I4D A;  4EZK A;  3GP7 A;  2JWZ A;  3WAP A;  1KOT A;  2IJ0 A;  4RGT A;  4FA6 A;  3KVF B;  3VTW A;  2V4L A;  3L13 A;  4RM8 A;  1CK1 A;  2L52 A;  1B9R A;  1GG3 A;  3IXS A;  1ZXI A;  2CU3 A;  2DEN B;  1KH0 A;  2LGD A;  4OZB A;  2KYW A;  2INN E;  3ZXV A;  4TKN A;  4JE3 B;  1VZ7 A;  2DYM A;  1IYF A;  4HRS A;  1P98 A;  1WJ6 A;  3ZXR A;  1WI0 A;  1LM8 B;  1KFY B;  3K9P B;  4C4V A;  1RRB A;  3AU4 A;  3NJT A;  3DBR I;  4XE0 A;  2BS2 B;  1FIQ A;  2N4F A;  2BB6 A;  2Z0D B;  4GDK B;  2CR5 A;  4GOC A;  2XBB C;  3PRM B;  2DBY A;  3KWV A;  4RF0 A;  4WJN A;  5EDS A;  4GGQ A;  1WYG A;  4D2K A;  3O13 A;  4JWS C;  4PYU A;  4ACF A;  4XWW A;  4ICV A;  2INC C;  3U7D A;  5AUI A;  1S1Q B;  1QLB B;  1KRH A;  1VDV A;  4B9K A;  2FE8 A;  5TSS A;  1WXM A;  2K8C A;  1WX8 A;  2J42 A;  4MH8 A;  1J7C A;  1RAX A;  2DLB A;  5D2M B;  1YX6 B;  3W9C B;  5CTR C;  3FAH A;  4NAM A;  3NVZ A;  4KDI C;  4IG7 B;  2BPS A;  4OVV A;  2GBR A;  2FUH B;  1KTK A;  1E7V A;  2N9L A;  1P0R A;  2QHO A;  4W9F A;  2W9N A;  3TIX A;  2REX A;  5JHA A;  1CMX B;  4HPL B;  5H92 C;  3RT3 B;  3RNA C;  1BUI C;  3B08 A;  2LHD A;  3VHT C;  5GXG B;  2LGY A;  1JML A;  1H8C A;  2AWT A;  1SGH A;  4L1B A;  5L83 A;  4EEW A;  1MG8 A;  2WU2 B;  2D3B A;  2QEJ C;  2IZV B;  2HE7 A;  2KT7 A;  1OTR B;  1EWC A;  3L4P A;  3IAS 1;  1YQB A;  3MHS D;  1XLO A;  3ZGZ A;  5EE3 A;  1WR1 A;  5BYQ A;  3C19 A;  3EFU A;  1CZP A;  4W9H A;  3V60 A;  1WE7 A;  2ONQ A;  4ANX A;  3PLV A;  1KLG D;  3EGR A;  2DX5 B;  2NR2 A;  4MJS A;  1YJ1 A;  3UF8 A;  1N62 A;  5BYR A;  1WF9 A;  4YWG G;  2A4Z A;  4KGT A;  4KX6 B;  3WAM A;  5G2N A;  3ZO5 B;  3PV1 A;  4EZL A;  4US8 A;  2W3S A;  3NVY A;  1UWX A;  1ZW7 A;  1SE9 A;  3DCG A;  2I1K A;  1UBI A;  1DOY A;  1E5W A;  2FIF A;  4WIP A;  2LXA A;  1HTO A;  3LYY A;  2ZW0 A;  4NJ6 A;  2JY6 A;  2GBN A;  5T8I A;  4PT5 A;  3OJ3 A;  1PDX A;  2C7M B;  4OW0 A;  1LFD A;  3AE2 B;  2J0J A;  4HDQ A;  1WGG A;  3ZLZ A;  4HJK A;  1HXY D;  3RFZ B;  4GXB A;  3B2F A;  3CIR B;  3NOB A;  4W9J A;  1XEE A;  3ML9 A;  2W3R A;  1SIJ A;  2L00 B;  1P7E A;  2VRR B;  3U52 E;  3LXF A;  3AE7 B;  2EMS A;  3NG0 A;  2KN4 A;  1B1Z A;  1NYR A;  4DDI D;  4M8M A;  4HWI B;  3T3N A;  4DBG A;  4PS3 A;  2NBU A;  1WXS A;  4GDL A;  1QQR A;  1WSP A;  4EUT A;  5IA7 A;  3NHE B;  3M63 B;  3SR6 A;  3W5U B;  3QAQ A;  3VTV A;  1UZX B;  3P2B A;  1F9J A;  3ZNG C;  2SAK A;  4CHK A;  1T6B X;  5BMG A;  1OQY A;  3RNB C;  4LNF A;  4WQM A;  1TGZ B;  1ZOY B;  3Q14 C;  1FXI A;  4HCP B;  1E7U A;  4I6L B;  3A1Q A;  2I2Y A;  1WJU A;  2GBK A;  1XQQ A;  1YMH E;  3IHP C;  5IAA C;  2ZW1 A;  4XDD A;  3APC A;  1LQB A;  1EU3 A;  3BVM A;  4JQW C;  2IY0 B;  2R2O A;  2DZM A;  2MW5 A;  4MM3 B;  1UWM A;  1WMH B;  1TY0 A;  1KLV A;  4BKT A;  5CHW A;  1RYJ A;  2O6V A;  4KSL C;  1SE2 A;  3ZTD A;  1A70 A;  3TEW A;  1MI0 A;  5AUK A;  4ZHP A;  4C7Z A;  5JH5 C;  1NI3 A;  4AOF A;  2RD0 A;  1UBQ A;  2WDT B;  2IPK D;  2K5P A;  3KH0 A;  3ZNI D;  1V97 A;  4TQ1 A;  3TBL D;  3P4S B;  4IC7 B;  1JWM D;  4MSQ B;  3UI3 A;  2LVP A;  1YN3 A;  3NY5 A;  2FAZ A;  1QIL A;  1C79 A;  1R4M I;  1XO3 A;  2KX0 A;  2DAJ A;  2NBW B;  1L4D B;  2X38 A;  2KNB A;  3R7Q A;  3GZN B;  3RUI B;  2WP9 B;  4TMA B;  4MT5 A;  3A4R A;  3DQV A;  2H89 B;  4PS8 A;  1RFA A;  4DXF A;  3TUO A;  1PUT A;  2BYT A;  1GOZ A;  2EEL A;  4BKS A;  4JLC A;  2KMA A;  2KC1 A;  3TEY A;  3X23 A;  1V86 A;  2BYE A;  4S0R A;  3W1S C;  2NPT B;  1JRU A;  2MQJ A;  3W2D A;  5HHD G;  2DWQ A;  3NRZ A;  3JSV A;  3MTN B;  2IND C;  1V81 A;  3AE6 B;  2LUE A;  3DVG Y;  4K3B A;  4BBN C;  4RGM A;  3K9O B;  3PPA A;  3PS6 A;  1J7B A;  3DBL I;  4MGI E;  1P1A A;  3GB1 A;  3ABV B;  3BVZ A;  2PVG C;  3NVV A;  4DHJ D;  4J6I A;  1LO5 D;  3L17 A;  4WJO A;  1I35 A;  2JZP A;  4WAA A;  2V4I B;  1OEY A;  2N7D A;  1N60 A;  4JIO U;  4ARI A;  2WXN A;  1UH6 A;  4HLE A;  3BVG A;  4KIK A;  2FNJ B;  3QAR A;  1KF6 B;  4YSY B;  4KKJ A;  1FFV A;  4CYE A;  2CKH B;  3ZIM A;  4C4V B;  2AL6 A;  4KV2 A;  4P1C C;  3IG3 A;  4GU2 A;  2AQ3 B;  5J17 A;  2DAF A;  3KUC B;  1Q10 A;  1ZDX A;  2VH2 A;  1SB3 C;  4AUQ C;  1NBF C;  4C7Y A;  2M56 B;  3RD2 A;  2J4X A;  2WXH A;  2B76 B;  2WX0 A;  3N9Y C;  3OJ4 B;  3QJZ A;  2PVO D;  3NZU A;  1J0G A;  1V2Y A;  2K3U A;  2GBM A;  4BAX A;  1J19 A; 
#chains in the Genus database with same CATH homology
 3EEC A;  3TJP A;  2CHZ A;  2N4F A;  2Z0D B;  2KD0 A;  3UQB A;  2L05 A;  2G45 B;  4FN2 A;  4GDK B;  2CR5 A;  4GOC A;  4M8N A;  4W9I A;  2XBB C;  2IO1 B;  2LZ6 A;  2GOW A;  3PRM B;  4MGY E;  1FXT B;  4NNJ B;  2JVC A;  3BIN A;  2KC2 A;  2KWC A;  2ZZP B;  4WJN A;  5EDS A;  4G50 A;  4I6P A;  4EZJ A;  4GGQ A;  4NY0 A;  4DHJ B;  2JUO A;  3DBS A;  4GN1 A;  1TZ1 A;  4OVU A;  5E6N A;  2ZEQ A;  4PYU A;  2LRU A;  1EO6 A;  4WWP A;  4DDG D;  3VUW A;  4ZRJ A;  4ICV A;  2PE9 A;  3U7D A;  4FHK A;  2K8H A;  2KLG A;  4NAW A;  2D2Q A;  3M62 B;  4F1S A;  3VUX A;  2NS5 A;  1S1Q B;  5D7G A;  1Q0W B;  3L10 B;  3R66 C;  2KJ6 A;  1WM2 A;  4B9K A;  2N1V A;  2V1Y A;  4M0W B;  3PT2 B;  4LJO B;  1WX9 A;  4HXD A;  3HIZ A;  4GDK A;  2CU1 A;  1T0Y A;  4B6W A;  3UQA A;  1WXM A;  2K8C A;  3CSF A;  4PS7 A;  5L95 C;  2KMC A;  1WX8 A;  2ZJD A;  1XD3 B;  1RAX A;  4ASW C;  5D2M B;  2I1J A;  1YX6 B;  2C7H A;  4FBJ B;  2LD9 A;  4IM2 A;  5AEK B;  3PVL A;  1KM7 A;  2K6Q A;  1K8R B;  4IM0 A;  5CTR C;  4TQ0 A;  2FCQ A;  2K39 A;  1YX5 B;  1E8Z A;  4KDI C;  4IG7 B;  2BPS A;  4OVV A;  1OGW A;  2GBR A;  3N3K B;  2FUH B;  1Q5W B;  4IUM B;  4F8C B;  3GZN I;  4X57 B;  4K81 A;  2MP2 A;  1E7V A;  2L3Z A;  2R2Q A;  3PHX B;  2XK5 B;  4FUL A;  1P0R A;  2QHO A;  4W9F A;  2W9N A;  3TIX A;  1VCB A;  2REX A;  5JHA A;  1S3S G;  1CMX B;  3PTF C;  2LVQ A;  4HPL B;  1YD8 U;  2KHW B;  2NVU I;  5E6P A;  3RT3 B;  2WWZ A;  2KJH B;  2L76 A;  3B08 A;  4KZC A;  2PE6 B;  2RSU A;  1SIF A;  3IBE A;  3VHT C;  3ALB A;  3KUD B;  3VTU A;  3VDZ A;  4BKG A;  2LXC A;  2LGY A;  3IVF A;  1WGY A;  4FHJ A;  4MJS B;  5CHF A;  2AYO B;  3IFW B;  4MGK E;  4DHZ B;  2AWT A;  1H8C A;  1SGH A;  5L83 A;  2N9E B;  4EEW A;  4WWO A;  1MG8 A;  3L16 A;  5D94 A;  4HVB A;  2IZV B;  2D11 A;  2HE7 A;  3B1L X;  3DVN V;  1OTR B;  1YQB A;  1WYW B;  2XK5 A;  2UWQ A;  3JW0 X;  3L54 A;  3MHS D;  4KVG B;  3HK0 A;  3ZTC A;  1WR1 A;  4MDK E;  2CS4 A;  2KVR A;  2JF5 A;  2LGX A;  3EFU A;  2KQS A;  4ZRK A;  3QA8 A;  2NBV B;  3DVG X;  2FCN A;  4W9H A;  2RR9 A;  3TL5 A;  1OEY J;  1WE7 A;  2K6D B;  3V60 A;  3ZRC A;  3JYU A;  3NS8 A;  4ANX A;  3PLV A;  1GUA B;  3T8M A;  1H4R A;  2MBQ A;  2JRH A;  2DX5 B;  4K1R B;  3ZVV A;  2NR2 A;  4MJS A;  1UD7 A;  1G6J A;  1YJ1 A;  1HE8 A;  4W9K A;  5C23 A;  3UF8 A;  1UEL A;  3DOW A;  3ZW3 A;  3RZF A;  1IPG A;  3RCZ A;  4JGH B;  2C5L C;  2IO0 B;  1WF9 A;  2J7Q B;  2KOX A;  2OOB B;  2A4Z A;  2N9P C;  1V80 A;  2M4N A;  4EOY A;  3X0W A;  2D3G A;  2DYO A;  3Q3J A;  1WXA A;  3WAM A;  5G2N A;  2KFJ A;  2MA9 B;  2KTR B;  3PV1 A;  4GMV A;  3I3T B;  1NI2 A;  3ZNZ B;  3ZO5 B;  4EZL A;  2O2V B;  3PHW B;  4EKU A;  5DCN A;  3CST A;  4IW0 A;  1ZW7 A;  1P3Q U;  3HM6 X;  2M1M A;  1SE9 A;  4JL9 A;  3DCG A;  2I1K A;  1UBI A;  2KWV B;  5C1Z A;  3ML8 A;  2LVO A;  1E5W A;  3APF A;  2FIF A;  2LXA A;  4DXA B;  4MGZ E;  4G0N B;  1WJN A;  5LXI B;  3V6C B;  2BKF A;  1WM3 A;  3DDC B;  2XEW A;  4NJ6 A;  2FCM A;  3VH4 B;  2JY6 A;  2ZCC A;  1WFY A;  2GBN A;  2IY1 B;  2KJR A;  1WJ4 A;  2BKR B;  3VH3 B;  3OJ3 A;  2IO3 B;  3Q3F A;  3UIO B;  1RLF A;  2C7M B;  2KTR A;  3AXC A;  4B95 A;  3VFK A;  1LFD A;  2O2V A;  4BOZ B;  2J0J A;  2O6V D;  4HDQ A;  5TR5 A;  2D07 B;  4II2 B;  4WWN A;  2LJ5 A;  1WGG A;  3VQI A;  4MEM A;  3ZLZ A;  4HJK A;  1E8Y A;  4IM3 A;  2ZVO A;  2YLM A;  2HJ8 A;  1E90 A;  4GXB A;  4GDL B;  3RYT A;  3NOB A;  4W9J A;  2L0F A;  1J8C A;  3L08 A;  2OJR A;  3ML9 A;  3DBH I;  5GMV A;  1WZ0 A;  1WX7 A;  2RGF A;  2L00 B;  2MBH A;  1ZGU B;  1E8X A;  1P9D U;  5HKH A;  1XT9 B;  3HM3 A;  4ZRI A;  2VRR B;  1PQS A;  1GJZ A;  3OLM D;  3PRE A;  4DHZ E;  1EF5 A;  5JZE B;  2KXJ A;  3LJ3 A;  2KK8 A;  4GIV A;  5AZF A;  2EMS A;  3KW5 B;  2L0T A;  3CF6 E;  4LCD E;  4NJ7 A;  3ZRF A;  4A20 A;  2IYD B;  3A4S C;  3U8Z A;  4DDI D;  4M8M A;  2EMT A;  1Q1O A;  3UIP B;  4HWI B;  2J0K A;  4DBG A;  4PS3 A;  2BWE S;  2IO2 B;  2NBU A;  4NQK E;  1BT0 A;  1WXS A;  2M0X A;  4GDL A;  2C60 A;  2LI5 A;  4MH0 E;  4EUT A;  3N30 A;  3A33 B;  4EFO A;  5IA7 A;  3NHE B;  1NDD A;  4YL8 A;  3ZDM C;  5DPW A;  3M63 B;  5G55 A;  3A1Q B;  3AI5 A;  3A9J B;  3QAQ A;  3VTV A;  2K8B A;  1UZX B;  2N1W A;  3P2B A;  5E6O A;  1F9J A;  2NCN A;  2C9W B;  4CO7 A;  3ZNG C;  4CHK A;  1V5T A;  4HCN B;  1EUV B;  3L0W B;  4II3 B;  3WAN A;  4FJZ A;  4W9C A;  1UGM A;  4GB9 A;  1OQY A;  4BFR A;  1X1M A;  4ICU A;  2RPQ A;  2GBJ A;  1WR6 E;  1WY8 A;  2BGF A;  4BKS D;  2HTH A;  3EHV A;  1TGZ B;  4ANU A;  3H9D A;  1WE6 A;  3WAL A;  4BOS C;  2G4D B;  4A3O A;  2BWF A;  4HCP B;  1E7U A;  2HD5 B;  3RZW C;  4I6L B;  3QCA A;  1WGH A;  1WXV A;  3A1Q A;  3QK0 A;  1WJU A;  2GBK A;  5KHO A;  1XQQ A;  2O6V B;  3M3J A;  3IHP C;  3R3M A;  3QC8 B;  4RM9 A;  5IAA C;  3LDZ E;  4G11 A;  3APC A;  1LQB A;  3PSE B;  2N9X A;  2MWS B;  2LAS A;  1WH3 A;  2JZ3 B;  4JQW C;  4N9F 4;  2IY0 B;  3W1Y A;  4LDT D;  2MCN B;  4FJV B;  1KJT A;  5J18 A;  2EKE C;  2R2O A;  2DZM A;  3VUY A;  5AZH A;  1V6E A;  2MW5 A;  3DVN U;  2C7N B;  1WMH B;  3BY4 B;  4W9L A;  1KLV A;  4BKT A;  5CHW A;  2G3Q B;  3ENE A;  3QX1 A;  3H7S A;  3V62 A;  2LRW A;  4HPM B;  3QHT A;  5DPR A;  3WAO A;  2O6V A;  4K7U A;  1Y8R C;  2KX3 A;  1M94 A;  4P7I A;  4DWF A;  4E74 A;  1YIW A;  3D32 A;  3H1U A;  4KSL C;  3ZTD A;  4FAD A;  3NZS A;  4ZDV A;  3SDL C;  3PRP B;  2DZK A;  3H6N A;  5JH5 C;  4KZ0 A;  4AOF A;  2BF8 B;  2RD0 A;  1UBQ A;  2JT4 B;  2WDT B;  3ZUN A;  3ZDT A;  2PEA A;  3KH0 A;  3ZNI D;  3TMP B;  4TQ1 A;  3TBL D;  2WYQ A;  2MRP A;  4AJW A;  1ISN A;  1VD2 A;  4IC7 B;  4MM3 A;  1WMH A;  4LJP B;  1U4A A;  3KYC D;  4K7S A;  4MSQ B;  2LVP A;  3MJW A;  4FJY A;  3NY5 A;  5BO4 B;  2FAZ A;  4AP4 C;  4DK5 A;  1R4M I;  2V3S A;  4F7Z A;  3DPD A;  1GC6 A;  2JZZ A;  4W9G A;  2ZNV B;  5J2R A;  3PZD A;  2ZVN A;  3GOE A;  3UIN B;  2KX0 A;  3SHQ A;  2DAJ A;  4AJY B;  2NBW B;  2ZNV C;  3VXW A;  1A5R A;  4G3X B;  4WQO B;  2KO3 A;  2KNB A;  1WIA A;  5CX3 A;  4I6N B;  3R7Q A;  3UGB B;  3RUI B;  2B3A A;  2KDB A;  2K1F A;  3A4R A;  1C1Y B;  2PJH A;  3A9K B;  3DQV A;  4FLH A;  2FID A;  3PGE A;  4KDL B;  3WIM A;  4PS8 A;  3JSV B;  2Z0E B;  2G4S A;  4WJQ A;  1RFA A;  2GMI C;  3R7R A;  2KQ7 A;  3ZKJ C;  1C3T A;  2MP2 B;  3QQ8 B;  1Z5S B;  2KTF A;  1Z2M A;  1D3Z A;  3APD A;  3RUL A;  1TBE A;  5D6J B;  4BKS A;  2ZCB A;  4JLC A;  4LDT B;  2KN5 A;  2KMA A;  2FCS A;  2ASQ A;  2KC1 A;  2CHX A;  2MX2 A;  3X23 A;  2AEH A;  1V86 A;  2BYE A;  1TTN A;  2DHZ A;  3PLU A;  4PYZ A;  4WJP A;  4NQL B;  3W1S C;  5LLI A;  3O65 B;  4BVU C;  2NPT B;  1JRU A;  4AWJ A;  3JVZ X;  2MQJ A;  4BBN F;  4RMA A;  3A9K A;  4HDO A;  3TCA A;  4ANV A;  1R4N I;  3KYD D;  2KDI A;  4K7W A;  3JSV A;  3MTN B;  2J0M A;  1IP9 A;  2WX1 A;  4URK A;  1V81 A;  1ZKH A;  2L7R A;  2LUE A;  2LWP A;  1GC7 A;  3DVG Y;  3V6E B;  2KDE B;  1EF1 A;  1E8W A;  2MSE D;  3AU5 A;  4ZYN A;  4BBN C;  5DPT A;  3H7P B;  4KIK B;  3KUZ A;  3K9O B;  3PPA A;  3U30 A;  2BYV E;  1GNU A;  2N7E A;  1I42 A;  3PS6 A;  2YVC A;  3SD5 A;  2IBI B;  3W1S A;  1V9J A;  2M17 A;  2UYZ B;  3B0A A;  3DBL I;  4GSW A;  1WGD A;  4MGI E;  2MBB B;  2JPH A;  3C0R B;  2MBO A;  3EC8 A;  1P1A A;  2NPT A;  2DZJ A;  2K25 A;  2KFK B;  3A9J A;  4DHJ D;  4W9E A;  4J6I A;  3VAW A;  3ECI A;  3OAW A;  5JHB A;  2KWU B;  3L17 A;  2MLB A;  4WJO A;  2KLC A;  3SU8 X;  2Z59 B;  4NPN A;  4W9D A;  1AAR A;  1I35 A;  4MSM B;  1WRD B;  5DPS A;  4WAA A;  1OEY A;  3PRZ A;  2N7D A;  4MEL A;  2JXX A;  4JIO U;  2A5U A;  2JRI B;  3WA0 A;  3CMM B;  3QWZ B;  1UH6 A;  4HLE A;  2KZR A;  4IWP A;  3V61 A;  4XZ4 A;  4A3P A;  3H7P A;  4KIK A;  4EZK A;  2FNJ B;  3QAR A;  2JWZ A;  2L8J A;  3WAP A;  1KOT A;  4FA6 A;  3KVF B;  3VTW A;  2V4L A;  2BYF A;  3L13 A;  4E3C A;  4CYE A;  4RM8 A;  2AL3 A;  5LXH A;  2CKH B;  3VVW B;  5KHQ A;  1LXD A;  3ZIM A;  2AL6 A;  1GG3 A;  4KV2 A;  2KFK A;  3IG3 A;  2PPH A;  4GU2 A;  2DEN B;  2KDF B;  5J17 A;  2DAF A;  3KUC B;  4XX5 A;  1L2N A;  2LGD A;  4KSK C;  2ZPY A;  3ONS A;  1L7Y A;  3N32 A;  4IWQ A;  2DZI A;  4AUQ C;  1NBF C;  3AUL A;  1QZE A;  4TUU A;  3T9L A;  4TKN A;  3RD2 A;  2MBE A;  2DYM A;  2M8S A;  1IYF A;  2KAN A;  2KKC A;  3M95 A;  5CHV C;  2WX0 A;  1P98 A;  1WJ6 A;  2ZPN A;  3OJ4 B;  1WI0 A;  3QJZ A;  1LM8 B;  3HHM A;  3K9P B;  3S2A A;  3NZU A;  1J0G A;  4ANW A;  2D10 A;  2CHW A;  4TV3 A;  3ZNH B;  1V2Y A;  2Y5B B;  1WGR A;  4IWO A;  4E71 A;  4HK2 A;  2GBM A;  1RRB A;  3AU4 A;  1V5O A;  3DBR I;  5FR6 A;  4NAW B;  1V49 A;  4XC2 A;  1WZ3 A;  2DYB A;  3QIJ A;  1J19 A;  5AZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...