3RZWC

Crystal structure of the monobody ysmb-9 bound to human sumo1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Teaching an old scaffold new tricks: monobodies constructed using alternative surfaces of the FN3 scaffold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Monobody ySMB-9
total genus 20
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rzwC00
1IPGA 2KMCA 5C1ZA 3QQ8B 4P7IA 3M63B 3QA8A 3A1QA 4ZYNA 5AEKB 2KX0A 1V5OA 1OQYA 1WR1A 3M62B 2JUOA 4DHZE 5CHWA 1RFAA 5IAAC 4HDQA 4K81A 1XQQA 4WAAA 2KKCA 5LXIB 4JQWC 2KWVB 3W1YA 2DZMA 3ENEA 3APFA 3IHPC 5E6PA 2C60A 4MSQB 1GC7A 3EC8A 4ZRIA 2Y5BB 4TUUA 2V4LA 2Z59B 2LGXA 1NBFC 2PJHA 2FIFA 3O65B 4JL9A 4KZ0A 4K7SA 3VUWA 3ML9A 4IC7B 3ZDMC 3IVFA 3NZUA 3QJZA 1S3SG 1YIWA 2YVCA 1R4NI 3HIZA 3MTNB 3S2AA 4MDKE 3ZIMA 1WZ3A 2LUEA 4AOFA 3UGBB 4NAWB 3V61A 3ZNID 3DPDA 1GUAB 2OOBB 2J0JA 4W9JA 4F7ZA 1V5TA 4KV2A 2J7QB 1WM3A 4KVGB 3QC8B 5E6OA 3V6CB 3DVGY 2N4FA 2NPTA 4MELA 4PYUA 5D94A 4BBNC 4E74A 2PE6B 3RD2A 3PRMB 1UGMA 4IW0A 2CS4A 2KTRB 3EHVA 4HJKA 4GDLA 4XX5A 3ZUNA 2MQJA 3DCGA 3SDLC 4EKUA 2IY0B 2K25A 2N1WA 4I6LB 3DQVA 2JWZA 4W9KA 5G2NA 2DX5B 3RCZA 1WY8A 3AI5A 4MJSB 3A9KB 1C1YB 2L00B 2BWES 4BKSD 2EMSA 2BGFA 2KHWB 2PEAA 4FHJA 5G55A 1GJZA 2PPHA 3Q3JA 2LGDA 2ZEQA 4IWQA 3T9LA 2RD0A 3CF6E 1UELA 2DYOA 1A5RA 5D2MB 2M8SA 4WQOB 1BT0A 4FHKA 4DK5A 3RZWC 4WJOA 2KZRA 2WX1A 2A4ZA 3ZTDA 1WXAA 5GMVA 1V9JA 4WJQA 3QIJA 3QHTA 1WGGA 3WAPA 3L10B 3UQAA 4HCNB 4OVUA 3WAOA 5BO4B 2JRHA 4BKGA 2LZ6A 4HPMB 1E8XA 2LRUA 2HD5B 2KLCA 3VDZA 2K8CA 2EKEC 2D3GA 4MJSA 3WA0A 2L7RA 2MBBB 4DHJD 3APCA 3ONSA 1WMHA 3W1SA 3L13A 4GXBA 2BF8B 4HVBA 2V1YA 1E90A 4IM0A 4GDKA 2WWZA 4RM9A 1UBIA 3HHMA 2CHXA 1SE9A 3T8MA 4ANWA 3JVZX 2KC1A 2KFJA 3TIXA 4GSWA 4GU2A 1LFDA 2FAZA 4ZRKA 3W1SC 5JZEB 3M3JA 4J6IA 2C7NB 2NS5A 1EF1A 2L0TA 2N9EB 4NJ7A 3MJWA 5AZGA 1D3ZA 3BINA 1Z2MA 4PS3A 3VTUA 3WANA 3KH0A 1VD2A 1LXDA 2O2VA 1LM8B 1KOTA 2LRWA 2M4NA 5LXHA 2ASQA 1OGWA 1WX7A 4KIKA 2MX2A 2GMIC 4W9FA 4GDKB 1WJNA 4KIKB 3SU8X 1ISNA 1E8ZA 1CMXB 2ZJDA 4HLEA 1SIFA 4BKSA 2LXAA 1FXTB 2DYBA 2L76A 1WJ6A 2LJ5A 2MP2B 5CHVC 1WM2A 4FJZA 3L0WB 2GBRA 2KQSA 2NBUA 2GOWA 3M95A 4NQKE 3RYTA 2IO1B 3ZO5B 3A1QB 2XK5A 3ALBA 3N3KB 3KYDD 5D6JB 4AJWA 2O6VB 2K6DB 1WGDA 2WX0A 3CMMB 3PRPB 3PZDA 3TL5A 2BKFA 2VRRB 4ICVA 4DDID 4EEWA 4B9KA 3UQBA 4XC2A 3MHSD 1I42A 2L0FA 3L16A 4WJPA 5JHBA 4AWJA 4IWPA 1AARA 5L83A 1P0RA 3TBLD 2JRIB 2L3ZA 2KJHB 3APDA 3C0RB 2KLGA 2NBWB 1V80A 5HKHA 4PS7A 4A20A 4IM2A 4NY0A 4AJYB 2KTFA 5JH5C 4ANUA 2LVPA 3DDCB 3NS8A 1WJ4A 2K8HA 2KTRA 3L08A 1NI2A 2NVUI 2HE7A 4DHZB 4MM3A 2JZ3B 2CHZA 3B1LX 2IBIB 2DHZA 2AWTA 2KWCA 4B95A 4DXAB 2RPQA 2FIDA 2KC2A 3H1UA 3NHEB 3R66C 4AP4C 2I1JA 2KFKB 3D32A 2GBJA 1TGZB 3DBLI 3HK0A 4HK2A 3DVGX 3NY5A 1WIAA 2ZPYA 3AU4A 3PREA 4JLCA 2O6VA 3Q3FA 4E3CA 3A33B 2QHOA 1E7VA 2KOXA 3PRZA 4ANXA 4I6PA 5AZHA 3UIOB 2MBEA 1V2YA 2JF5A 3P2BA 2MCNB 2KFKA 2MLBA 1UH6A 2ZNVC 4TQ0A 1WZ0A 4EZLA 2R2QA 2LGYA 4LJOB 2DAJA 3VFKA 4EZJA 2RR9A 3ZW3A 2G3QB 2FCNA 3PHWB 3SHQA 1IYFA 1WGHA 5IA7A 5KHQA 2V3SA 1WI0A 1KJTA 1RAXA 2IZVB 3PTFC 2N7DA 4GDLB 4NQLB 4M0WB 3DBSA 3K9PB 1WE7A 3KUZA 2LVOA 4WJNA 1T0YA 2MA9B 3HM6X 2BPSA 3UIPB 4ASWC 1Z5SB 4DDGD 4TQ1A 2KK8A 1E7UA 2MBHA 4M8NA 1WJUA 3RZFA 2MWSB 4GOCA 2BYEA 4K1RB 4W9GA 1MG8A 2KNBA 2ZCBA 1WGRA 4RMAA 3WIMA 4EFOA 2KVRA 2G45B 1YX5B 2KQ7A 3IBEA 1WE6A 4KSKC 1P3QU 4MGIE 3N32A 5LLIA 1X1MA 1J8CA 1OEYJ 4G11A 2JXXA 1KM7A 1WMHB 4ZDVA 3H9DA 2G4DB 4LDTD 2KJRA 4G50A 1R4MI 4EZKA 2BWFA 3RULA 2REXA 5JHAA 2K8BA 3R7QA 3KYCD 3LDZE 2MSED 5L95C 3KW5B 1IP9A 2DZKA 2JT4B 3L17A 3ZLZA 1XT9B 2ZVOA 1TZ1A 5KHOA 2GBKA 2MRPA 1RRBA 4GIVA 3TJPA 2KN5A 2KMAA 4F1SA 3PV1A 2ZZPB 2J0KA 2GBNA 4K7WA 2LI5A 2KO3A 4GMVA 4MGKE 2DZIA 2Z0DB 3NOBA 4MSMB 2D2QA 3WALA 3X0WA 5E6NA 4FJYA 1TTNA 2C5LC 2D10A 2XBBC 4EOYA 2AL3A 1UBQA 2MBOA 1EO6A 1LQBA 1HE8A 1ZGUB 4MEMA 3AULA 1V81A 2NCNA 2RGFA 5DPTA 3ZTCA 5EDSA 2MW5A 1L7YA 2MBQA 2PE9A 5J17A 1H8CA 1J19A 2D11A 1UZXB 5DCNA 3ZKJC 4F8CB 5C23A 1WX8A 4A3PA 4ZRJA 4YL8A 3ZRFA 2KDIA 4W9EA 1EF5A 2N9XA 3H6NA 4B6WA 4FADA 3UF8A 5DPSA 4NNJB 5DPRA 3PGEA 3N30A 2FNJB 3VH3B 4BFRA 1L2NA 1YD8U 1P98A 3QAQA 3TCAA 3VHTC 4BBNF 4FN2A 4KSLC 2FCQA 4MGZE 2GBMA 2DENB 1E8YA 3H7PA 3PSEB 4BOSC 2JZZA 2KANA 2KXJA 1Q0WB 4LDTB 1KLVA 3CSTA 3U8ZA 2JY6A 2LD9A 1XD3B 2CKHB 1WXVA 2CR5A 4HPLB 1G6JA 1K8RB 1E5WA 3EECA 2A5UA 3A9KA 2AEHA 3VH4B 4WWPA 3WAMA 3QARA 3JSVA 2IO0B 3OJ3A 1WR6E 3KUCB 1VCBA 3B0AA 1YX6B 2AYOB 1JRUA 1Y8RC 2BYVE 1V49A 2J0MA 3VAWA 3PT2B 2ZPNA 2CU1A 1EUVB 2HTHA 2D07B 1J0GA 1S1QB 1RLFA 1GG3A 2FCMA 4RM8A 3R7RA 4E71A 3IFWB 3EFUA 4K7UA 1V6EA 1F9JA 2K1FA 2LASA 3DVNV 4AUQC 4CYEA 4FJVB 3GZNI 4II3B 2N9PC 5J18A 3JYUA 3K9OB 2MP2A 4FULA 4ICUA 3RUIB 2KDEB 4WWNA 3UINB 3OLMD 3R3MA 5CHFA 5FR6A 2XEWA 1H4RA 4II2B 3PLUA 4HXDA 4W9HA 4W9LA 4N9F4 3ZNZB 2L05A 2N1VA 1V86A 4IWOA 4CO7A 3PLVA 2ZNVB 4JIOU 2O6VD 1OTRB 3TMPB 1QZEA 4CHKA 3BY4B 2B3AA 2C9WB 2KX3A 3LJ3A 2FCSA 2O2VB 2UWQA 3GOEA 4A3OA 5TR5A 4G0NB 3JSVB 4BVUC 5D7GA 4W9IA 4EUTA 2RSUA 1SGHA 3A9JB 1C3TA 3HM3A 3AU5A 4NAWA 2I1KA 2C7HA 3V6EB 2DAFA 2KDBA 3SD5A 1GNUA 3VUYA 2BYFA 2BKRB 3KUDB 1WXMA 1YQBA 1WFYA 4PYZA 3QCAA 3X23A 4FBJB 3H7SA 2XK5B 3NZSA 1WH3A 3ZVVA 4NPNA 2KWUB 3V62A 1M94A 2N7EA 3QWZB 3ZDTA 2C7MB 5J2RA 2LVQA 3QX1A 3ZRCA 1PQSA 3B08A 1GC6A 3ML8A 3PVLA 4KDIC 3U30A 2KDFB 1WGYA 1I35A 4BOZB 4DHJB 5CX3A 4KDLB 5CTRC 1WXSA 2HJ8A 1WRDB 2JVCA 2KJ6A 2M0XA 2YLMA 2FUHB 2R2OA 2OJRA 4MGYE 2EMTA 3DBHI 3OJ4B 5AZFA 3U7DA 3VTVA 1WX9A 1P9DU 2ZVNA 5DPWA 3RT3B 3DOWA 2IY1B 2KD0A 3PPAA 2K39A 4JGHB 4IUMB 3AXCA 2DZJA 2L8JA 3OAWA 1ZKHA 4WWOA 2M17A 3A4SC 4LCDE 2CHWA 2IO2B 3H7PB 3JW0X 3KVFB 2WDTB 2WYQA 1ZW7A 2IO3B 2AL6A 3VXWA 4KZCA 2M1MA 4TV3A 4URKA 4M8MA 4GB9A 3I3TB 3A4RA 4OVVA 4HWIB 3A9JA 2NPTB 2JPHA 2ZCCA 4PS8A 1E8WA 1Q5WB 4I6NB 4BKTA 4FA6A 2K6QA 1WYWB 4TKNA 3V60A 4FLHA 4DBGA 4G3XB 3VUXA 4HCPB 1OEYA 4IG7B 3DBRI 4LJPB 2IYDB 4IM3A 2DYMA 1UD7A 3IG3A 3PS6A 3VVWB 3VTWA 4DWFA 1NDDA 3VQIA 1YJ1A 3DVNU 4GN1A 4GGQA 1U4AA 1P1AA 3QK0A 4MH0E 3ZNGC 2UYZB 2G4SA 3ECIA 3PHXB 2LWPA 4ANVA 4X57B 4HDOA 2NR2A 2Z0EB 1TBEA 4W9DA 3CSFA 3ZNHB 1Q1OA 2LXCA 4NJ6A 3L54A 4W9CA 2W9NA 4XZ4A 1WF9A 2NBVB
chains in the Genus database with same CATH superfamily
2KMCA 5C1ZA 4XE0A 4P7IA 2V3PA 3A1QA 5AEKB 1V5OA 1OQYA 4DHZE 4JWUC 3I63C 3NJTA 2KKCA 5LXIB 2KWVB 2DZMA 3ENEA 2DNFA 3Q6BA 2C60A 1GC7A 3EC8A 1VZ6A 1XCQL 4ZRIA 3O65B 3ML9A 2KMMA 3NZUA 2PIAA 3QJZA 3RNGC 1S3SG 1L0XB 2MH7A 3MTNB 3S2AA 3ZIMA 1L4DB 4AOFA 3UGBB 4NAWB 3V61A 1QILA 4KKJA 1GUAB 4W9JA 2PVOD 2J7QB 3AE8B 3B2FA 3QC8B 5E6OA 4MELA 4E74A 2KTRB 3EHVA 4HJKA 3DCGA 2GB1A 3SR6A 2K25A 2JWZA 4YT0B 4N58A 3Q14C 3AE7B 4AQ7A 1ZDXA 2JWUA 2L00B 2M0AA 1GJZA 3Q3JA 2LGDA 1L4ZB 3CF6E 3SFEB 1UELA 2JX5A 2TSSA 4DK5A 1N5WA 3RZWC 2A4ZA 1WXAA 1V9JA 4WJQA 3AEEB 4HCNB 4BKGA 4HPMB 2K8CA 2EKEC 2D3GA 4MJSA 2L7RA 2YEPF 1C9FA 3W1SA 4HVBA 4GDKA 2WWZA 3HVDA 4ANWA 1PDXA 2KFJA 3FAHA 4GU2A 2FAZA 4ZRKA 2LGSA 3M3JA 4J6IA 3EA6A 2QEJC 1ZXHA 2NS5A 2WXKA 2ICIA 4NJ7A 1C77A 1IBXA 2WDQB 1F77A 3P42A 3R2TA 1LM8B 1JWMD 4YTNB 1FRRA 1OGWA 1WX7A 4HKZE 3VR9B 4W9FA 3AE4B 4KIKB 1VZ7A 2WQYB 5IKCM 1XCTL 4BKSA 2L76A 1FM0D 2GBRA 2W54A 4RGMA 4NJCA 3N3KB 5FK9C 5D6JB 2IDYA 2O6VB 2VRRB 4EEWA 3MHSD 4OHJA 2L0FA 3L16A 5JHBA 4AWJA 4IWPA 4N6EB 5L83A 3TBLD 2L3ZA 5BMGA 2Z8LA 5HKHA 4NY0A 4BAXA 1P7FA 5JH5C 3DDCB 4ZRQA 2BS3B 1K52A 4EE2A 1HEZE 3B9JA 2AWTA 2KWCA 4PT5A 4DXAB 1EWCA 2RPQA 1GB4A 2IPKD 3NHEB 3R66C 1L0YB 1TJEA 3NVVA 4HK2A 2BT6A 3DVGX 1FFUA 3MFGA 3Q3FA 2BVCA 2QHOA 1HTQA 1V2YA 2JF5A 5IN7A 2KFKA 2ZNVC 1MHXA 1WZ0A 3P4SB 4OVZA 2FCNA 1I4GA 3SHQA 1IYFA 5KHQA 1KJTA 1RAXA 3NG0A 1SXTA 2N7DA 3EFCA 1JRPA 3KUZA 1FPYA 2RDHA 4WJNA 2LVOA 2BQQA 1XLQA 2KK8A 1E7UA 3RZFA 1WJUA 2BYEA 4W9GA 2PTLA 4P16A 4JWSC 2K5PA 3BWUD 1WE6A 4KSKC 1P3QU 3BK1A 3N32A 4G11A 1KM7A 2G4DB 4LDTD 3AEAB 1R4MI 2WNMA 4EZKA 1TY0A 3DHIC 2LFIA 1L6VA 1IP9A 1V1OA 1XT9B 1TZ1A 5KHOA 2MRPA 2KN5A 2GBNA 2QIEB 2DZIA 5EE9A 4DXFA 4ZOHC 4FJYA 5JXVA 2XBBC 1V81A 1R4MB 1V97A 2QCZA 5BMIA 5J17A 3AEDB 3BIID 3RNFC 2INPE 4A3PA 1AWDA 3ZRFA 2KDIA 1EF5A 2N9XA 3H6NA 4FADA 2WXIA 4NNJB 2WP9B 3VH3B 1P98A 3HUIA 4OZCA 1TIFA 2Q5WD 2DENB 3C19A 3PSEB 2JZZA 3CSTA 3U8ZA 1XD3B 2CKHB 1QQRA 4ARCA 3QARA 2Y5PA 2BS4B 1VCBA 1ACCA 1FCLA 4YSZB 2AYOB 3VRAB 1FNVA 2WHIA 2D07B 2IJ0A 1KRHA 1RLFA 1RYJA 1R7SA 1XLPA 1F9JA 2K1FA 4AUQC 4II3B 5J18A 2MP2A 2KDEB 4WWNA 3R3MA 4II2B 1H4RA 1SIJA 5FKAC 2L05A 4JIOU 1OTRB 4CHKA 1QZEA 3BY4B 2BTEA 2B3AA 2C9WB 3LJ3A 1YQ3B 3TUOA 4W9IA 3W9CB 1K50A 3HM3A 2I1KA 4JE3B 2QC8A 3BK2A 1AN8A 2DAFA 3VUYA 2ACZB 1WXMA 2AX5A 4O1NA 1F2RC 2KWUB 3V62A 1M94A 2N7EA 2LVQA 1PQSA 4KDIC 1RM6C 2FUG1 4BOZB 5CX3A 2EKIA 2JVCA 2YLMA 2JXTA 2FUHB 2WDRB 2J52A 2OJRA 3VTVA 3RT3B 1LO5D 3DBRB 2L8JA 1ZKHA 4WWOA 2KAJA 3NVWA 1NI3A 2WYQA 1C76A 1E9MA 2AL6A 3T3NA 2AQ2B 4KZCA 3BYTB 3VRBB 3MC9A 3I3TB 1V8CA 4HWIB 2MJDA 1E8WA 3R2IA 4XDCA 3P4RB 4FA6A 4H2AA 1E0ZA 1KH0A 4TKNA 4FLHA 1OEYA 3DBRI 1WRIA 1N60A 1QLBB 2IYDB 2RDGA 3IG3A 2D5GA 4DWFA 4YTMB 1NDDA 1YJ1A 1XF5L 1U4AA 1WSPA 2QJLA 3P4PB 2G4SA 4HDOA 1FXAA 3NRZA 3CSFA 1WGKA 1Q1OA 2LXCA 2W9NA 1WF9A 1IPGA 2VH2A 4L1BA 1C79A 4ZYNA 3C8YA 1WR1A 3M62B 2V0GA 5CHWA 1PGBA 2VZKB 4LNNA 3WCQA 1ET6A 2YEPB 4MACA 2L32A 3APFA 3RNEC 1SF0A 5AUIA 1F1HA 2V4LA 2Z59B 1NBFC 4KKIA 4RF1A 4KZ0A 4IC7B 2JZPA 3IVFA 5BYRA 1UGJA 1WZ3A 2LUEA 3ZNID 1XEEA 1SJHD 3V6CB 3DVGY 1STEA 2PE6B 1UGMA 2CS4A 3ZUNA 2X8XX 3SDLC 2K22A 4EKUA 2IY0B 2N1WA 2K9XA 5G2NA 1UWXA 2DX5B 5HG2A 3RCZA 3AI5A 4MJSB 4DXGA 4RH6A 3A9KB 1C1YB 1YQ4B 3RNAC 2BWES 2EMSA 4RCOA 2KHWB 2PEAA 4HEA1 3T9LA 1VJKA 2M8SA 2NTTA 3T3OA 4WJOA 2KZRA 2WX1A 2WGSA 3QHTA 4C56C 3UQAA 3NS1A 2LZ6A 2LRUA 2M56B 2KLCA 4AS1A 3APCA 4GXBA 2V1YA 2BS2B 1UBIA 1HZ5A 1YN5A 4GSWA 3Q8CA 4IKGA 5D3DA 4TMAB 3V05A 1EF1A 1SSNA 2L0TA 3MJWA 4PS3A 1DYQA 2LRWA 4KIKA 3MHZA 1ISNA 1E8ZA 4HLEA 2J53A 2LXAA 1WJ6A 1TS5A 2LJ5A 1TS3A 5CHVC 1WM2A 4FJZA 3DHGC 3L0WB 3M95A 2IO1B 3A1QB 1QOAA 1NVID 1WGDA 3TL5A 4DDID 1TT5B 3UQBA 1YJJA 4WJPA 1AYFA 2JRIB 1YN3A 3C0RB 2WXPA 4PS7A 1SE2A 2NMQA 1C4AA 2KTFA 1QOFA 4C7YA 4ANUA 2LVPA 3NS8A 1JALA 2WXMA 1FD6A 4P6VF 3L08A 1NI2A 2HE7A 2CHZA 3N1YC 3B1LX 3ZJTA 2PVGC 4B95A 4AP4C 3D32A 2GBJA 2WXJA 3UI3A 3ZQ4A 3NVZA 2Y3AA 2K0PA 1WIAA 1YMHE 2ZPYA 3AU4A 3MC0B 3PREA 2O6VA 1L6UA 2KOXA 3PRZA 4I6PA 5AZHA 3UIOB 2MBEA 1QOGA 2MLBA 1LGRA 4EZLA 2R2QA 2RR9A 1V1PB 2CU3A 1WGHA 1R4NB 3LYYA 2IZVB 2JYEA 4GDLB 4NQLB 3N20C 1TY2A 2MA9B 3UIPB 4ASWC 1I4RA 2MBHA 3I5JC 4MH8A 5GXGB 4GLSC 1WGRA 4RMAA 4EFOA 2KVRA 1T0SC 2QDFA 5LLIA 1QF6A 2ON8A 1J8CA 4IOIE 3I9V1 4ZDVA 3H9DA 1KLGD 2KJRA 2REXA 4OZAA 1E7PB 3KYCD 2DZKA 2ZVOA 1Q10A 3BZDB 3KWLA 2D3AA 1RRBA 3TJPA 2INCC 4F1SA 2J0KA 4K7WA 5EE3A 4MSMB 2D2QA 2C5LC 1SE4A 2BBCA 1LQBA 1XLNA 4C4VB 4MEMA 3AULA 1GPXA 2NCNA 1L7YA 1J19A 4F8CB 5C23A 2LEKA 4UDUC 3ZXVA 1WX8A 4ZRJA 2DLBA 4W9EA 2B76B 1T3QA 3UF8A 5G5GA 2MEKA 3N30A 4BFRA 3TSSA 1YD8U 3Q2AC 3QAQA 3TCAA 4BBNF 2IGGA 4FN2A 1GB1A 3H7PA 2KANA 2LD9A 2XN9C 3AM9A 1G6JA 1FNWA 3GB1A 3EECA 2AEHA 1YNTE 4WWPA 2ZW0A 3WAMA 1ZUD2 4P1BC 4HRSA 3Q3MC 2J0MA 1CQVA 3VAWA 2HTHA 1F52A 1J0GA 3PZ8A 1FMAD 4RF0A 3R7RA 4REZA 1PGXA 1TKYA 4E71A 1K51A 1V6EA 4CYEA 4FJVB 3JYUA 2GRIA 3W2DA 1PUTA 3OLMD 5FR6A 2KWDA 3PLUA 3AE5B 3AE6B 1BXTA 4IWOA 1OFFA 3W5VB 4CO7A 2WXRA 2O6VD 2KX3A 3RPFC 2O2VB 4A3OA 5TR5A 4G0NB 2WS3B 5D7GA 4EUTA 2RSUA 4C00A 1SGHA 1SB3C 1D4BA 3AU5A 4M01A 3ZYYX 1WWTA 3MJ5A 4YSYB 2GLSA 2WXHA 2BYFA 2WXQA 4PYZA 4IDIA 3NZ3A 4NPNA 3ZDTA 1M4VA 5E6JA 2GI9A 2KDFB 1WXSA 1C78A 3N9YC 2M0XA 2R2OA 2JYTA 3GE3C 4ZRPA 1ZOYB 4MGYE 3OJ4B 3U7DA 1JWAD 1D6EC 3DOWA 2L83A 2IY1B 1YOVB 2K39A 4IUMB 2DZJA 1UF0A 3ZJVA 2BB5A 2M17A 3TEWA 4LCDE 2CHWA 3JW0X 3KVFB 5T8IA 2IO3B 1HQRD 2E6XA 1QOBA 4US8A 1TKGA 3VXWA 2M1MA 4M8MA 4KGRA 4XWWA 4OVVA 2NPTB 2CJOA 2K6QA 1KF6B 3E56A 4HCPB 3Q8AA 4IG7B 5BYQA 4WH4A 1UD7A 3PS6A 3VQIA 3DVNU 2Y5CA 3URYA 1P1AA 3RFZB 4MH0E 1EWYC 3N1ZC 3SEBA 3ECIA 3PHXB 2LWPA 4ANVA 4CQNA 2Z0EB 2LUMA 2I2YA 3ZNHB 1KTKA 3L54A 1KLVA 1J7AA 1J7CA 3J9CA 1E6EB 4YSXB 2LJIA 3QQ8B 3QA8A 2BW2A 5LNK1 5IAAC 4HDQA 1MI0A 2IGHA 4WAAA 4ZHOA 3W1YA 1MHHE 5E6PA 4MSQB 4TUUA 5C3JB 1TKEA 2R61A 3ZDMC 4WQMA 1XLOA 2N9LA 1YIWA 2V3NA 3AE3B 3OG5A 4OW0A 3DPDA 2OOBB 2J0JA 4KV2A 2OJWA 4KVGB 4RFBA 2N4FA 2NPTA 4PYUA 1GOZA 1IGDA 4BBNC 3RD2A 3PRMB 2VH1A 2MQJA 4I6LB 4YTPB 2WXOA 2V9HA 1YJIA 2KN4A 2EELA 4BKSD 5I4DA 5G55A 2ZEQA 4IWQA 4HKQA 2RD0A 1UNSA 2HTME 1A5RA 4WQOB 1EU4A 5GMVA 3L10B 3PO0A 5BO4B 2WLBA 3AN1A 3Q3OC 1JCKB 2RMMA 2HD5B 3VDZA 1ESFA 4DHJD 2E3TA 1KFYB 1WMHA 3KLSX 3L13A 3AH7A 3CIRB 4IM0A 5IP4D 2UU7A 4RM9A 3HHMA 2DWQA 1SE9A 3ZJUA 4RNAA 2KC1A 3TIXA 5JZEB 2C7NB 5IOIA 2N9EB 5AZGA 4US9A 3BINA 1Z2MA 2G9HD 3KH0A 1VD2A 2HDEA 2O2VA 3DBHB 4BZAA 4WAFA 3EUB2 5LXHA 3IT6B 2MX2A 1MVKA 2QMTA 4GDKB 3Q69A 3SU8X 3RN9C 1P7EA 1CMXB 3AECB 1SIFA 4WURA 3N1XC 4S17A 2NBUA 4NQKE 3PZ7A 3BVMA 2XK5A 1NENB 2K6DB 5TSSA 1NYRA 3PRPB 2BKFA 4PK1A 1I7HA 4B9KA 1I42A 3EGRA 1AARA 1P0RA 2KJHB 2KLGA 3P1MA 1MPEA 2INNE 4AJYB 1JWSD 1WJ4A 2K8HA 2KQ4X 2KTRA 3DWGC 4MM3A 3B2GA 2JZ3B 2IBIB 4NAMA 2FIDA 3TEXA 2LGIA 1NYQA 3H1UA 3RNCC 3AEGB 4KGTA 3DBLI 3HK0A 4HROA 3NY5A 1CZPA 5HI1A 4JLCA 2RDBC 4XGAB 4E3CA 1E7VA 4ANXA 1HXYD 5EE0A 3NVYA 3P2BA 2MCNB 1DGJA 2LGYA 3W5UB 2DAJA 3VFKA 1N62A 3PHWB 1SE3A 2V3SA 3FILB 3MP9A 2AQ1B 1WE7A 4MT5A 4LTUA 2H88B 3DBLB 1T0YA 1J7BA 1XO3A 1IGCA 4DDGD 2MWSB 4Q2JA 4GOCA 4K1RB 4XYCA 2ZCBA 1YX5B 2KQ7A 3IBEA 3OWEB 4MGIE 4WIPA 1OEYJ 1OQQA 3DWMA 4NZLB 4G50A 1PGAA 3RULA 2QILA 3Q8EA 1I4XA 3LDZE 5L95C 3KW5B 4GIVA 2KMAA 2WXGA 4USAA 3U52E 2LI5A 2OHFA 4MGKE 3Q8FA 1CK1A 3NOBA 5BMHA 1N5XA 2D10A 2MBOA 1T5XD 1TS4A 3ZTCA 5DPTA 4ZYSA 4MM3B 2MBQA 1H8CA 2MHJA 2M19A 5EE1A 5HFYA 4B0MA 1B1ZA 3RMKC 4LNKA 4ACFA 5DPSA 3MC8A 2SEBD 2XNAC 1ROEA 1L2NA 3NUHB 3VHTC 4KSLC 4MGZE 3CWIA 2PMVA 3ETRA 2KXJA 3FKYA 3GZNB 2VZKD 1KLUD 2JY6A 1WXVA 2CR5A 1K8RB 3GE8C 1MJDA 2A5UA 3A9KA 3JSVA 2IO0B 4A8XC 1ZXIA 1QKZA 3OJ3A 3R8BA 5FR3A 1JW9D 1DOIA 2HJ1A 1JRUA 1Y56A 1Y8RC 2BYVE 3PT2B 2ZPNA 2CU1A 1EUVB 2W3SA 2G1EA 1GG3A 1T0RC 1K53A 1SBBB 3EFUA 4K7UA 2RPVA 2LASA 3GZNI 1TS2A 2N9PC 4FULA 3UINB 2KYWA 1ZDVA 5CHFA 3U7ZA 4HXDA 4N9F4 1V86A 4ITKA 3U4EG 3TMPB 1VZ8A 2W3RA 2FCSA 4BVUC 3GOEA 3A9JB 1C3TA 4NAWA 2FBWB 1DOXA 4RGTA 2MJ3A 1JMLA 5D3IB 2KDBA 4L2YA 4FBJB 1WFYA 3QCAA 2N9KA 3H7SA 2JU6X 3ZVVA 1FCCC 2C7MB 5J2RA 3QX1A 3ZRCA 3U30A 1HTOA 4DHJB 4KDLB 2HJ8A 4K3BA 1YN4A 5AZFA 4XWTA 1WX9A 1P9DU 2ZVNA 3AEBB 2KT7A 4JGHB 2L1AA 5H8YE 3OAWA 1SJED 4YXDB 2BYTA 3H7PB 2IO2B 2WDTB 2FE8A 1FXIA 4TV3A 3KWVA 4GB9A 3A4RA 2CJNA 3A9JA 1V1PA 2WDVB 2JPHA 4PS8A 1NEKB 2DBYA 4WWMA 4DBGA 4G3XB 4LNIA 1FFVA 4IM3A 2DYMA 1FEHA 3VVWB 2KVZA 5G5HA 3QK0A 3ZNGC 1CJEA 4HPPA 2KACA 4K3CA 4W9CA 4XZ4A 2NBVB 2PW9A 3M63B 2KX0A 2JUOA 2JSVX 1B9RA 1RFAA 3BVGA 4K81A 1XQQA 4JQWC 1MG4A 3IHPC 3RI7C 2Y5BB 2WXLA 2LGXA 1C4CA 2PJHA 2FIFA 3VUWA 4JL9A 4K7SA 1WXQA 1MFWA 2YVCA 1R4NI 3HIZA 4MDKE 1I4PA 4F7ZA 1V5TA 2L52A 3AEFB 1WM3A 5BYSA 2LHEA 5D94A 4IW0A 2V4IB 4XX5A 4GDLA 3ZXRA 4JX1C 1BMLC 3DQVA 4W9KA 1WY8A 2X38A 4J3OD 2BGFA 4FHJA 2PPHA 1IUEA 2DYOA 5D2MB 1BT0A 4FHKA 3GS2A 3ZTDA 3IAS1 3QIJA 1JROA 1WGGA 3WAPA 3P4QB 4C7ZA 4OVUA 3WAOA 2JRHA 3GP7A 1E8XA 1ET9A 3WA0A 2MBBB 1EM7A 3ONSA 2BF8B 1FNUA 4N59A 2OEDA 1E90A 4A90A 2KDMA 5C2TB 3V3XA 2CHXA 3T8MA 1JWBD 3JVZX 3W1SC 1LFDA 1FIQA 4TSSA 1UUPA 4LLGM 1D3ZA 3VTUA 3WANA 2N0SB 1RFKA 1LXDA 1KOTA 4RGOS 2ZW1A 2M4NA 1RWSA 2ASQA 2GMIC 1WJNA 4D2KA 1T0QC 2ZJDA 2LHDA 1FXTB 2DYBA 3H8HA 2MP2B 2KQSA 2GOWA 2D3CA 3RYTA 3ZO5B 3AE1B 3ALBA 3KYDD 1L0VB 4AJWA 2WX0A 3CMMB 3PZDA 2PKOA 4ICVA 4A9AA 3IAM1 4HJGE 4XC2A 3HVZA 1N61A 1SEBD 3KQ4A 3APDA 2NBWB 5IO9A 1EU3A 1V80A 4A20A 2WXFA 4IM2A 2INDC 2NVUI 4DHZB 4ZHPA 4LNFA 2DHZA 3U2SC 4C4VA 2KC2A 4A6QA 2W82A 5H92C 3AE2B 3AE9B 2I1JA 2KFKB 1TGZB 3BYYB 2SAKA 3AV8A 3A33B 1UH6A 4TQ0A 1E10A 4LJOB 4EZJA 1ZP0B 3ZW3A 2G3QB 2JQRB 5IA7A 1WI0A 3PTFC 4M0WB 3DBSA 3K9PB 2ONQA 1JWUD 5MPOA 3HM6X 2BPSA 3AB5A 4JPSA 1Z5SB 4TQ1A 4M8NA 1XXGA 3VR8B 4M02A 1MG8A 2KNBA 4C80A 3WIMA 2G45B 1X1MA 1T6BX 2JXXA 1WMHB 4B0EA 2BWFA 3ABVB 5JHAA 2NTSA 2K8BA 2I38A 3R7QA 2MSED 2JT4B 3L17A 3ZLZA 2GBKA 2WXNA 3PV1A 2ZZPB 4FXCA 3Q3NC 4GMVA 2KO3A 4M00A 1I4QA 2Z0DB 1VR9A 2MJEA 4QAYA 3WALA 3X0WA 5E6NA 4ARIA 1TTNA 3BVZA 4EOYA 1D5ZC 3DHHC 2AL3A 1UBQA 1EO6A 1HE8A 1ZGUB 2RGFA 5EDSA 2MW5A 2PE9A 3E9SA 2D11A 4XDDA 1UZXB 5DCNA 3FILA 1VLBA 3ZKJC 4KX6B 2AQ3B 1WYGA 4YL8A 1HA5A 2J4XA 4OZBA 4B6WA 3Q8BA 1BUIC 4RGNA 5DPRA 3PGEA 2FNJB 1C4PA 2BB6A 3TEZA 2FCQA 1ENFA 2GBMA 1E8YA 4BOSC 1Q0WB 4LDTB 1ZPSA 4HPLB 3O13A 2K3UA 1L5PA 1E5WA 1GAQB 3HRDD 3VH4B 3LB8C 3L4PA 1F2RI 3ZGZA 1WR6E 3KUCB 3B0AA 4S0RA 1FRDA 1YX6B 1V49A 2W55A 1S1QB 1PYWD 4RM8A 2FCMA 3IFWB 4A55A 3DVNV 4YWGG 3LXFA 2IGDA 3K9OB 5HHDG 4ICUA 3RUIB 2QSDA 2XEWA 4W9LA 4W9HA 3ZNZB 2N1VA 3PLVA 2ZNVB 4KGSA 2UWQA 3P63A 3JSVB 1TYGB 1IBXB 4L23A 1QT9A 3AMZA 3I57A 1DOYA 5AUKA 2C7HA 2D3BA 1PFDA 3SD5A 3V6EB 1GNUA 1F0ZA 4R3DA 2BKRB 3KUDB 1YQBA 3X23A 4M0WA 2XK5B 3NZSA 1WH3A 1VDVA 1N6ZA 3QWZB 1UWMA 3B08A 1GC6A 3ML8A 3PVLA 1WGYA 1I35A 4DQOC 5CTRC 1WRDB 2KJ6A 1VRAB 2EMTA 3DBHI 2LMCA 1D5MC 5DPWA 4P1CC 2KD0A 3PPAA 1N63A 1D5XC 3AXCA 3A4SC 1OQRA 1ZW7A 3IXSA 4URKA 1AW7A 1HZ6A 2ZCCA 4LK0M 2WU2B 1A70A 1Q5WB 4I6NB 4BKTA 3IT4B 1WYWB 3FC4A 4LNOA 3V60A 3RNBC 3VUXA 2N7JA 4LJPB 3TEYA 3VTWA 3SFDB 1TZOA 4GN1A 4GGQA 1I4HA 2J42A 2PLPA 1ZE3D 1FO4A 2WU5B 2UYZB 4X57B 2NR2A 1TBEA 4W9DA 1JQ4A 4NJ6A 2H89B
chains in the Genus database with same CATH topology
1IPGA 2KMCA 5C1ZA 3QQ8B 4P7IA 3M63B 3QA8A 3A1QA 4ZYNA 5AEKB 2KX0A 1V5OA 1OQYA 1WR1A 3M62B 2JUOA 4DHZE 5CHWA 1RFAA 5IAAC 4HDQA 4K81A 1XQQA 4WAAA 2KKCA 5LXIB 4JQWC 2KWVB 3W1YA 2DZMA 3ENEA 3APFA 3IHPC 5E6PA 2C60A 4MSQB 1GC7A 3EC8A 4ZRIA 2Y5BB 4TUUA 2V4LA 2Z59B 2LGXA 1NBFC 2PJHA 2FIFA 3O65B 4JL9A 4KZ0A 4K7SA 3VUWA 3ML9A 4IC7B 3ZDMC 3IVFA 3NZUA 3QJZA 1S3SG 1YIWA 2YVCA 1R4NI 3HIZA 3MTNB 3S2AA 4MDKE 3ZIMA 1WZ3A 2LUEA 4AOFA 3UGBB 4NAWB 3V61A 3ZNID 3DPDA 1GUAB 2OOBB 2J0JA 4W9JA 4F7ZA 1V5TA 4KV2A 2J7QB 1WM3A 4KVGB 3QC8B 5E6OA 3V6CB 3DVGY 2N4FA 2NPTA 4MELA 4PYUA 5D94A 4BBNC 4E74A 2PE6B 3RD2A 3PRMB 1UGMA 4IW0A 2CS4A 2KTRB 3EHVA 4HJKA 4GDLA 4XX5A 3ZUNA 2MQJA 3DCGA 3SDLC 4EKUA 2IY0B 2K25A 2N1WA 4I6LB 3DQVA 2JWZA 4W9KA 5G2NA 2DX5B 3RCZA 1WY8A 3AI5A 4MJSB 3A9KB 1C1YB 2L00B 2BWES 4BKSD 2EMSA 2BGFA 2KHWB 2PEAA 4FHJA 5G55A 1GJZA 2PPHA 3Q3JA 2LGDA 2ZEQA 4IWQA 3T9LA 2RD0A 3CF6E 1UELA 2DYOA 1A5RA 5D2MB 2M8SA 4WQOB 1BT0A 4FHKA 4DK5A 3RZWC 4WJOA 2KZRA 2WX1A 2A4ZA 3ZTDA 1WXAA 5GMVA 1V9JA 4WJQA 3QIJA 3QHTA 1WGGA 3WAPA 3L10B 3UQAA 4HCNB 4OVUA 3WAOA 5BO4B 2JRHA 4BKGA 2LZ6A 4HPMB 1E8XA 2LRUA 2HD5B 2KLCA 3VDZA 2K8CA 2EKEC 2D3GA 4MJSA 3WA0A 2L7RA 2MBBB 4DHJD 3APCA 3ONSA 1WMHA 3W1SA 3L13A 4GXBA 2BF8B 4HVBA 2V1YA 1E90A 4IM0A 4GDKA 2WWZA 4RM9A 1UBIA 3HHMA 2CHXA 1SE9A 3T8MA 4ANWA 3JVZX 2KC1A 2KFJA 3TIXA 4GSWA 4GU2A 1LFDA 2FAZA 4ZRKA 3W1SC 5JZEB 3M3JA 4J6IA 2C7NB 2NS5A 1EF1A 2L0TA 2N9EB 4NJ7A 3MJWA 5AZGA 1D3ZA 3BINA 1Z2MA 4PS3A 3VTUA 3WANA 3KH0A 1VD2A 1LXDA 2O2VA 1LM8B 1KOTA 2LRWA 2M4NA 5LXHA 2ASQA 1OGWA 1WX7A 4KIKA 2MX2A 2GMIC 4W9FA 4GDKB 1WJNA 4KIKB 3SU8X 1ISNA 1E8ZA 1CMXB 2ZJDA 4HLEA 1SIFA 4BKSA 2LXAA 1FXTB 2DYBA 2L76A 1WJ6A 2LJ5A 2MP2B 5CHVC 1WM2A 4FJZA 3L0WB 2GBRA 2KQSA 2NBUA 2GOWA 3M95A 4NQKE 3RYTA 2IO1B 3ZO5B 3A1QB 2XK5A 3ALBA 3N3KB 3KYDD 5D6JB 4AJWA 2O6VB 2K6DB 1WGDA 2WX0A 3CMMB 3PRPB 3PZDA 3TL5A 2BKFA 2VRRB 4ICVA 4DDID 4EEWA 4B9KA 3UQBA 4XC2A 3MHSD 1I42A 2L0FA 3L16A 4WJPA 5JHBA 4AWJA 4IWPA 1AARA 5L83A 1P0RA 3TBLD 2JRIB 2L3ZA 2KJHB 3APDA 3C0RB 2KLGA 2NBWB 1V80A 5HKHA 4PS7A 4A20A 4IM2A 4NY0A 4AJYB 2KTFA 5JH5C 4ANUA 2LVPA 3DDCB 3NS8A 1WJ4A 2K8HA 2KTRA 3L08A 1NI2A 2NVUI 2HE7A 4DHZB 4MM3A 2JZ3B 2CHZA 3B1LX 2IBIB 2DHZA 2AWTA 2KWCA 4B95A 4DXAB 2RPQA 2FIDA 2KC2A 3H1UA 3NHEB 3R66C 4AP4C 2I1JA 2KFKB 3D32A 2GBJA 1TGZB 3DBLI 3HK0A 4HK2A 3DVGX 3NY5A 1WIAA 2ZPYA 3AU4A 3PREA 4JLCA 2O6VA 3Q3FA 4E3CA 3A33B 2QHOA 1E7VA 2KOXA 3PRZA 4ANXA 4I6PA 5AZHA 3UIOB 2MBEA 1V2YA 2JF5A 3P2BA 2MCNB 2KFKA 2MLBA 1UH6A 2ZNVC 4TQ0A 1WZ0A 4EZLA 2R2QA 2LGYA 4LJOB 2DAJA 3VFKA 4EZJA 2RR9A 3ZW3A 2G3QB 2FCNA 3PHWB 3SHQA 1IYFA 1WGHA 5IA7A 5KHQA 2V3SA 1WI0A 1KJTA 1RAXA 2IZVB 3PTFC 2N7DA 4GDLB 4NQLB 4M0WB 3DBSA 3K9PB 1WE7A 3KUZA 2LVOA 4WJNA 1T0YA 2MA9B 3HM6X 2BPSA 3UIPB 4ASWC 1Z5SB 4DDGD 4TQ1A 2KK8A 1E7UA 2MBHA 4M8NA 1WJUA 3RZFA 2MWSB 4GOCA 2BYEA 4K1RB 4W9GA 1MG8A 2KNBA 2ZCBA 1WGRA 4RMAA 3WIMA 4EFOA 2KVRA 2G45B 1YX5B 2KQ7A 3IBEA 1WE6A 4KSKC 1P3QU 4MGIE 3N32A 5LLIA 1X1MA 1J8CA 1OEYJ 4G11A 2JXXA 1KM7A 1WMHB 4ZDVA 3H9DA 2G4DB 4LDTD 2KJRA 4G50A 1R4MI 4EZKA 2BWFA 3RULA 2REXA 5JHAA 2K8BA 3R7QA 3KYCD 3LDZE 2MSED 5L95C 3KW5B 1IP9A 2DZKA 2JT4B 3L17A 3ZLZA 1XT9B 2ZVOA 1TZ1A 5KHOA 2GBKA 2MRPA 1RRBA 4GIVA 3TJPA 2KN5A 2KMAA 4F1SA 3PV1A 2ZZPB 2J0KA 2GBNA 4K7WA 2LI5A 2KO3A 4GMVA 4MGKE 2DZIA 2Z0DB 3NOBA 4MSMB 2D2QA 3WALA 3X0WA 5E6NA 4FJYA 1TTNA 2C5LC 2D10A 2XBBC 4EOYA 2AL3A 1UBQA 2MBOA 1EO6A 1LQBA 1HE8A 1ZGUB 4MEMA 3AULA 1V81A 2NCNA 2RGFA 5DPTA 3ZTCA 5EDSA 2MW5A 1L7YA 2MBQA 2PE9A 5J17A 1H8CA 1J19A 2D11A 1UZXB 5DCNA 3ZKJC 4F8CB 5C23A 1WX8A 4A3PA 4ZRJA 4YL8A 3ZRFA 2KDIA 4W9EA 1EF5A 2N9XA 3H6NA 4B6WA 4FADA 3UF8A 5DPSA 4NNJB 5DPRA 3PGEA 3N30A 2FNJB 3VH3B 4BFRA 1L2NA 1YD8U 1P98A 3QAQA 3TCAA 3VHTC 4BBNF 4FN2A 4KSLC 2FCQA 4MGZE 2GBMA 2DENB 1E8YA 3H7PA 3PSEB 4BOSC 2JZZA 2KANA 2KXJA 1Q0WB 4LDTB 1KLVA 3CSTA 3U8ZA 2JY6A 2LD9A 1XD3B 2CKHB 1WXVA 2CR5A 4HPLB 1G6JA 1K8RB 1E5WA 3EECA 2A5UA 3A9KA 2AEHA 3VH4B 4WWPA 3WAMA 3QARA 3JSVA 2IO0B 3OJ3A 1WR6E 3KUCB 1VCBA 3B0AA 1YX6B 2AYOB 1JRUA 1Y8RC 2BYVE 1V49A 2J0MA 3VAWA 3PT2B 2ZPNA 2CU1A 1EUVB 2HTHA 2D07B 1J0GA 1S1QB 1RLFA 1GG3A 2FCMA 4RM8A 3R7RA 4E71A 3IFWB 3EFUA 4K7UA 1V6EA 1F9JA 2K1FA 2LASA 3DVNV 4AUQC 4CYEA 4FJVB 3GZNI 4II3B 2N9PC 5J18A 3JYUA 3K9OB 2MP2A 4FULA 4ICUA 3RUIB 2KDEB 4WWNA 3UINB 3OLMD 3R3MA 5CHFA 5FR6A 2XEWA 1H4RA 4II2B 3PLUA 4HXDA 4W9HA 4W9LA 4N9F4 3ZNZB 2L05A 2N1VA 1V86A 4IWOA 4CO7A 3PLVA 2ZNVB 4JIOU 2O6VD 1OTRB 3TMPB 1QZEA 4CHKA 3BY4B 2B3AA 2C9WB 2KX3A 3LJ3A 2FCSA 2O2VB 2UWQA 3GOEA 4A3OA 5TR5A 4G0NB 3JSVB 4BVUC 5D7GA 4W9IA 4EUTA 2RSUA 1SGHA 3A9JB 1C3TA 3HM3A 3AU5A 4NAWA 2I1KA 2C7HA 3V6EB 2DAFA 2KDBA 3SD5A 1GNUA 3VUYA 2BYFA 2BKRB 3KUDB 1WXMA 1YQBA 1WFYA 4PYZA 3QCAA 3X23A 4FBJB 3H7SA 2XK5B 3NZSA 1WH3A 3ZVVA 4NPNA 2KWUB 3V62A 1M94A 2N7EA 3QWZB 3ZDTA 2C7MB 5J2RA 2LVQA 3QX1A 3ZRCA 1PQSA 3B08A 1GC6A 3ML8A 3PVLA 4KDIC 3U30A 2KDFB 1WGYA 1I35A 4BOZB 4DHJB 5CX3A 4KDLB 5CTRC 1WXSA 2HJ8A 1WRDB 2JVCA 2KJ6A 2M0XA 2YLMA 2FUHB 2R2OA 2OJRA 4MGYE 2EMTA 3DBHI 3OJ4B 5AZFA 3U7DA 3VTVA 1WX9A 1P9DU 2ZVNA 5DPWA 3RT3B 3DOWA 2IY1B 2KD0A 3PPAA 2K39A 4JGHB 4IUMB 3AXCA 2DZJA 2L8JA 3OAWA 1ZKHA 4WWOA 2M17A 3A4SC 4LCDE 2CHWA 2IO2B 3H7PB 3JW0X 3KVFB 2WDTB 2WYQA 1ZW7A 2IO3B 2AL6A 3VXWA 4KZCA 2M1MA 4TV3A 4URKA 4M8MA 4GB9A 3I3TB 3A4RA 4OVVA 4HWIB 3A9JA 2NPTB 2JPHA 2ZCCA 4PS8A 1E8WA 1Q5WB 4I6NB 4BKTA 4FA6A 2K6QA 1WYWB 4TKNA 3V60A 4FLHA 4DBGA 4G3XB 3VUXA 4HCPB 1OEYA 4IG7B 3DBRI 4LJPB 2IYDB 4IM3A 2DYMA 1UD7A 3IG3A 3PS6A 3VVWB 3VTWA 4DWFA 1NDDA 3VQIA 1YJ1A 3DVNU 4GN1A 4GGQA 1U4AA 1P1AA 3QK0A 4MH0E 3ZNGC 2UYZB 2G4SA 3ECIA 3PHXB 2LWPA 4ANVA 4X57B 4HDOA 2NR2A 2Z0EB 1TBEA 4W9DA 3CSFA 3ZNHB 1Q1OA 2LXCA 4NJ6A 3L54A 4W9CA 2W9NA 4XZ4A 1WF9A 2NBVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IPG A;  2KMC A;  5C1Z A;  3QQ8 B;  4P7I A;  3M63 B;  3QA8 A;  3A1Q A;  4ZYN A;  5AEK B;  2KX0 A;  1V5O A;  1OQY A;  1WR1 A;  3M62 B;  2JUO A;  4DHZ E;  5CHW A;  1RFA A;  5IAA C;  4HDQ A;  4K81 A;  1XQQ A;  4WAA A;  2KKC A;  5LXI B;  4JQW C;  2KWV B;  3W1Y A;  2DZM A;  3ENE A;  3APF A;  3IHP C;  5E6P A;  2C60 A;  4MSQ B;  1GC7 A;  3EC8 A;  4ZRI A;  2Y5B B;  4TUU A;  2V4L A;  2Z59 B;  2LGX A;  1NBF C;  2PJH A;  2FIF A;  3O65 B;  4JL9 A;  4KZ0 A;  4K7S A;  3VUW A;  3ML9 A;  4IC7 B;  3ZDM C;  3IVF A;  3NZU A;  3QJZ A;  1S3S G;  1YIW A;  2YVC A;  1R4N I;  3HIZ A;  3MTN B;  3S2A A;  4MDK E;  3ZIM A;  1WZ3 A;  2LUE A;  4AOF A;  3UGB B;  4NAW B;  3V61 A;  3ZNI D;  3DPD A;  1GUA B;  2OOB B;  2J0J A;  4W9J A;  4F7Z A;  1V5T A;  4KV2 A;  2J7Q B;  1WM3 A;  4KVG B;  3QC8 B;  5E6O A;  3V6C B;  3DVG Y;  2N4F A;  2NPT A;  4MEL A;  4PYU A;  5D94 A;  4BBN C;  4E74 A;  2PE6 B;  3RD2 A;  3PRM B;  1UGM A;  4IW0 A;  2CS4 A;  2KTR B;  3EHV A;  4HJK A;  4GDL A;  4XX5 A;  3ZUN A;  2MQJ A;  3DCG A;  3SDL C;  4EKU A;  2IY0 B;  2K25 A;  2N1W A;  4I6L B;  3DQV A;  2JWZ A;  4W9K A;  5G2N A;  2DX5 B;  3RCZ A;  1WY8 A;  3AI5 A;  4MJS B;  3A9K B;  1C1Y B;  2L00 B;  2BWE S;  4BKS D;  2EMS A;  2BGF A;  2KHW B;  2PEA A;  4FHJ A;  5G55 A;  1GJZ A;  2PPH A;  3Q3J A;  2LGD A;  2ZEQ A;  4IWQ A;  3T9L A;  2RD0 A;  3CF6 E;  1UEL A;  2DYO A;  1A5R A;  5D2M B;  2M8S A;  4WQO B;  1BT0 A;  4FHK A;  4DK5 A;  3RZW C;  4WJO A;  2KZR A;  2WX1 A;  2A4Z A;  3ZTD A;  1WXA A;  5GMV A;  1V9J A;  4WJQ A;  3QIJ A;  3QHT A;  1WGG A;  3WAP A;  3L10 B;  3UQA A;  4HCN B;  4OVU A;  3WAO A;  5BO4 B;  2JRH A;  4BKG A;  2LZ6 A;  4HPM B;  1E8X A;  2LRU A;  2HD5 B;  2KLC A;  3VDZ A;  2K8C A;  2EKE C;  2D3G A;  4MJS A;  3WA0 A;  2L7R A;  2MBB B;  4DHJ D;  3APC A;  3ONS A;  1WMH A;  3W1S A;  3L13 A;  4GXB A;  2BF8 B;  4HVB A;  2V1Y A;  1E90 A;  4IM0 A;  4GDK A;  2WWZ A;  4RM9 A;  1UBI A;  3HHM A;  2CHX A;  1SE9 A;  3T8M A;  4ANW A;  3JVZ X;  2KC1 A;  2KFJ A;  3TIX A;  4GSW A;  4GU2 A;  1LFD A;  2FAZ A;  4ZRK A;  3W1S C;  5JZE B;  3M3J A;  4J6I A;  2C7N B;  2NS5 A;  1EF1 A;  2L0T A;  2N9E B;  4NJ7 A;  3MJW A;  5AZG A;  1D3Z A;  3BIN A;  1Z2M A;  4PS3 A;  3VTU A;  3WAN A;  3KH0 A;  1VD2 A;  1LXD A;  2O2V A;  1LM8 B;  1KOT A;  2LRW A;  2M4N A;  5LXH A;  2ASQ A;  1OGW A;  1WX7 A;  4KIK A;  2MX2 A;  2GMI C;  4W9F A;  4GDK B;  1WJN A;  4KIK B;  3SU8 X;  1ISN A;  1E8Z A;  1CMX B;  2ZJD A;  4HLE A;  1SIF A;  4BKS A;  2LXA A;  1FXT B;  2DYB A;  2L76 A;  1WJ6 A;  2LJ5 A;  2MP2 B;  5CHV C;  1WM2 A;  4FJZ A;  3L0W B;  2GBR A;  2KQS A;  2NBU A;  2GOW A;  3M95 A;  4NQK E;  3RYT A;  2IO1 B;  3ZO5 B;  3A1Q B;  2XK5 A;  3ALB A;  3N3K B;  3KYD D;  5D6J B;  4AJW A;  2O6V B;  2K6D B;  1WGD A;  2WX0 A;  3CMM B;  3PRP B;  3PZD A;  3TL5 A;  2BKF A;  2VRR B;  4ICV A;  4DDI D;  4EEW A;  4B9K A;  3UQB A;  4XC2 A;  3MHS D;  1I42 A;  2L0F A;  3L16 A;  4WJP A;  5JHB A;  4AWJ A;  4IWP A;  1AAR A;  5L83 A;  1P0R A;  3TBL D;  2JRI B;  2L3Z A;  2KJH B;  3APD A;  3C0R B;  2KLG A;  2NBW B;  1V80 A;  5HKH A;  4PS7 A;  4A20 A;  4IM2 A;  4NY0 A;  4AJY B;  2KTF A;  5JH5 C;  4ANU A;  2LVP A;  3DDC B;  3NS8 A;  1WJ4 A;  2K8H A;  2KTR A;  3L08 A;  1NI2 A;  2NVU I;  2HE7 A;  4DHZ B;  4MM3 A;  2JZ3 B;  2CHZ A;  3B1L X;  2IBI B;  2DHZ A;  2AWT A;  2KWC A;  4B95 A;  4DXA B;  2RPQ A;  2FID A;  2KC2 A;  3H1U A;  3NHE B;  3R66 C;  4AP4 C;  2I1J A;  2KFK B;  3D32 A;  2GBJ A;  1TGZ B;  3DBL I;  3HK0 A;  4HK2 A;  3DVG X;  3NY5 A;  1WIA A;  2ZPY A;  3AU4 A;  3PRE A;  4JLC A;  2O6V A;  3Q3F A;  4E3C A;  3A33 B;  2QHO A;  1E7V A;  2KOX A;  3PRZ A;  4ANX A;  4I6P A;  5AZH A;  3UIO B;  2MBE A;  1V2Y A;  2JF5 A;  3P2B A;  2MCN B;  2KFK A;  2MLB A;  1UH6 A;  2ZNV C;  4TQ0 A;  1WZ0 A;  4EZL A;  2R2Q A;  2LGY A;  4LJO B;  2DAJ A;  3VFK A;  4EZJ A;  2RR9 A;  3ZW3 A;  2G3Q B;  2FCN A;  3PHW B;  3SHQ A;  1IYF A;  1WGH A;  5IA7 A;  5KHQ A;  2V3S A;  1WI0 A;  1KJT A;  1RAX A;  2IZV B;  3PTF C;  2N7D A;  4GDL B;  4NQL B;  4M0W B;  3DBS A;  3K9P B;  1WE7 A;  3KUZ A;  2LVO A;  4WJN A;  1T0Y A;  2MA9 B;  3HM6 X;  2BPS A;  3UIP B;  4ASW C;  1Z5S B;  4DDG D;  4TQ1 A;  2KK8 A;  1E7U A;  2MBH A;  4M8N A;  1WJU A;  3RZF A;  2MWS B;  4GOC A;  2BYE A;  4K1R B;  4W9G A;  1MG8 A;  2KNB A;  2ZCB A;  1WGR A;  4RMA A;  3WIM A;  4EFO A;  2KVR A;  2G45 B;  1YX5 B;  2KQ7 A;  3IBE A;  1WE6 A;  4KSK C;  1P3Q U;  4MGI E;  3N32 A;  5LLI A;  1X1M A;  1J8C A;  1OEY J;  4G11 A;  2JXX A;  1KM7 A;  1WMH B;  4ZDV A;  3H9D A;  2G4D B;  4LDT D;  2KJR A;  4G50 A;  1R4M I;  4EZK A;  2BWF A;  3RUL A;  2REX A;  5JHA A;  2K8B A;  3R7Q A;  3KYC D;  3LDZ E;  2MSE D;  5L95 C;  3KW5 B;  1IP9 A;  2DZK A;  2JT4 B;  3L17 A;  3ZLZ A;  1XT9 B;  2ZVO A;  1TZ1 A;  5KHO A;  2GBK A;  2MRP A;  1RRB A;  4GIV A;  3TJP A;  2KN5 A;  2KMA A;  4F1S A;  3PV1 A;  2ZZP B;  2J0K A;  2GBN A;  4K7W A;  2LI5 A;  2KO3 A;  4GMV A;  4MGK E;  2DZI A;  2Z0D B;  3NOB A;  4MSM B;  2D2Q A;  3WAL A;  3X0W A;  5E6N A;  4FJY A;  1TTN A;  2C5L C;  2D10 A;  2XBB C;  4EOY A;  2AL3 A;  1UBQ A;  2MBO A;  1EO6 A;  1LQB A;  1HE8 A;  1ZGU B;  4MEM A;  3AUL A;  1V81 A;  2NCN A;  2RGF A;  5DPT A;  3ZTC A;  5EDS A;  2MW5 A;  1L7Y A;  2MBQ A;  2PE9 A;  5J17 A;  1H8C A;  1J19 A;  2D11 A;  1UZX B;  5DCN A;  3ZKJ C;  4F8C B;  5C23 A;  1WX8 A;  4A3P A;  4ZRJ A;  4YL8 A;  3ZRF A;  2KDI A;  4W9E A;  1EF5 A;  2N9X A;  3H6N A;  4B6W A;  4FAD A;  3UF8 A;  5DPS A;  4NNJ B;  5DPR A;  3PGE A;  3N30 A;  2FNJ B;  3VH3 B;  4BFR A;  1L2N A;  1YD8 U;  1P98 A;  3QAQ A;  3TCA A;  3VHT C;  4BBN F;  4FN2 A;  4KSL C;  2FCQ A;  4MGZ E;  2GBM A;  2DEN B;  1E8Y A;  3H7P A;  3PSE B;  4BOS C;  2JZZ A;  2KAN A;  2KXJ A;  1Q0W B;  4LDT B;  1KLV A;  3CST A;  3U8Z A;  2JY6 A;  2LD9 A;  1XD3 B;  2CKH B;  1WXV A;  2CR5 A;  4HPL B;  1G6J A;  1K8R B;  1E5W A;  3EEC A;  2A5U A;  3A9K A;  2AEH A;  3VH4 B;  4WWP A;  3WAM A;  3QAR A;  3JSV A;  2IO0 B;  3OJ3 A;  1WR6 E;  3KUC B;  1VCB A;  3B0A A;  1YX6 B;  2AYO B;  1JRU A;  1Y8R C;  2BYV E;  1V49 A;  2J0M A;  3VAW A;  3PT2 B;  2ZPN A;  2CU1 A;  1EUV B;  2HTH A;  2D07 B;  1J0G A;  1S1Q B;  1RLF A;  1GG3 A;  2FCM A;  4RM8 A;  3R7R A;  4E71 A;  3IFW B;  3EFU A;  4K7U A;  1V6E A;  1F9J A;  2K1F A;  2LAS A;  3DVN V;  4AUQ C;  4CYE A;  4FJV B;  3GZN I;  4II3 B;  2N9P C;  5J18 A;  3JYU A;  3K9O B;  2MP2 A;  4FUL A;  4ICU A;  3RUI B;  2KDE B;  4WWN A;  3UIN B;  3OLM D;  3R3M A;  5CHF A;  5FR6 A;  2XEW A;  1H4R A;  4II2 B;  3PLU A;  4HXD A;  4W9H A;  4W9L A;  4N9F 4;  3ZNZ B;  2L05 A;  2N1V A;  1V86 A;  4IWO A;  4CO7 A;  3PLV A;  2ZNV B;  4JIO U;  2O6V D;  1OTR B;  3TMP B;  1QZE A;  4CHK A;  3BY4 B;  2B3A A;  2C9W B;  2KX3 A;  3LJ3 A;  2FCS A;  2O2V B;  2UWQ A;  3GOE A;  4A3O A;  5TR5 A;  4G0N B;  3JSV B;  4BVU C;  5D7G A;  4W9I A;  4EUT A;  2RSU A;  1SGH A;  3A9J B;  1C3T A;  3HM3 A;  3AU5 A;  4NAW A;  2I1K A;  2C7H A;  3V6E B;  2DAF A;  2KDB A;  3SD5 A;  1GNU A;  3VUY A;  2BYF A;  2BKR B;  3KUD B;  1WXM A;  1YQB A;  1WFY A;  4PYZ A;  3QCA A;  3X23 A;  4FBJ B;  3H7S A;  2XK5 B;  3NZS A;  1WH3 A;  3ZVV A;  4NPN A;  2KWU B;  3V62 A;  1M94 A;  2N7E A;  3QWZ B;  3ZDT A;  2C7M B;  5J2R A;  2LVQ A;  3QX1 A;  3ZRC A;  1PQS A;  3B08 A;  1GC6 A;  3ML8 A;  3PVL A;  4KDI C;  3U30 A;  2KDF B;  1WGY A;  1I35 A;  4BOZ B;  4DHJ B;  5CX3 A;  4KDL B;  5CTR C;  1WXS A;  2HJ8 A;  1WRD B;  2JVC A;  2KJ6 A;  2M0X A;  2YLM A;  2FUH B;  2R2O A;  2OJR A;  4MGY E;  2EMT A;  3DBH I;  3OJ4 B;  5AZF A;  3U7D A;  3VTV A;  1WX9 A;  1P9D U;  2ZVN A;  5DPW A;  3RT3 B;  3DOW A;  2IY1 B;  2KD0 A;  3PPA A;  2K39 A;  4JGH B;  4IUM B;  3AXC A;  2DZJ A;  2L8J A;  3OAW A;  1ZKH A;  4WWO A;  2M17 A;  3A4S C;  4LCD E;  2CHW A;  2IO2 B;  3H7P B;  3JW0 X;  3KVF B;  2WDT B;  2WYQ A;  1ZW7 A;  2IO3 B;  2AL6 A;  3VXW A;  4KZC A;  2M1M A;  4TV3 A;  4URK A;  4M8M A;  4GB9 A;  3I3T B;  3A4R A;  4OVV A;  4HWI B;  3A9J A;  2NPT B;  2JPH A;  2ZCC A;  4PS8 A;  1E8W A;  1Q5W B;  4I6N B;  4BKT A;  4FA6 A;  2K6Q A;  1WYW B;  4TKN A;  3V60 A;  4FLH A;  4DBG A;  4G3X B;  3VUX A;  4HCP B;  1OEY A;  4IG7 B;  3DBR I;  4LJP B;  2IYD B;  4IM3 A;  2DYM A;  1UD7 A;  3IG3 A;  3PS6 A;  3VVW B;  3VTW A;  4DWF A;  1NDD A;  3VQI A;  1YJ1 A;  3DVN U;  4GN1 A;  4GGQ A;  1U4A A;  1P1A A;  3QK0 A;  4MH0 E;  3ZNG C;  2UYZ B;  2G4S A;  3ECI A;  3PHX B;  2LWP A;  4ANV A;  4X57 B;  4HDO A;  2NR2 A;  2Z0E B;  1TBE A;  4W9D A;  3CSF A;  3ZNH B;  1Q1O A;  2LXC A;  4NJ6 A;  3L54 A;  4W9C A;  2W9N A;  4XZ4 A;  1WF9 A;  2NBV B; 
#chains in the Genus database with same CATH topology
 2KMC A;  5C1Z A;  4XE0 A;  4P7I A;  2V3P A;  3A1Q A;  5AEK B;  1V5O A;  1OQY A;  4DHZ E;  4JWU C;  3I63 C;  3NJT A;  2KKC A;  5LXI B;  2KWV B;  2DZM A;  3ENE A;  2DNF A;  3Q6B A;  2C60 A;  1GC7 A;  3EC8 A;  1VZ6 A;  1XCQ L;  4ZRI A;  3O65 B;  3ML9 A;  2KMM A;  3NZU A;  2PIA A;  3QJZ A;  3RNG C;  1S3S G;  1L0X B;  2MH7 A;  3MTN B;  3S2A A;  3ZIM A;  1L4D B;  4AOF A;  3UGB B;  4NAW B;  3V61 A;  1QIL A;  4KKJ A;  1GUA B;  4W9J A;  2PVO D;  2J7Q B;  3AE8 B;  3B2F A;  3QC8 B;  5E6O A;  4MEL A;  4E74 A;  2KTR B;  3EHV A;  4HJK A;  3DCG A;  2GB1 A;  3SR6 A;  2K25 A;  2JWZ A;  4YT0 B;  4N58 A;  3Q14 C;  3AE7 B;  4AQ7 A;  1ZDX A;  2JWU A;  2L00 B;  2M0A A;  1GJZ A;  3Q3J A;  2LGD A;  1L4Z B;  3CF6 E;  3SFE B;  1UEL A;  2JX5 A;  2TSS A;  4DK5 A;  1N5W A;  3RZW C;  2A4Z A;  1WXA A;  1V9J A;  4WJQ A;  3AEE B;  4HCN B;  4BKG A;  4HPM B;  2K8C A;  2EKE C;  2D3G A;  4MJS A;  2L7R A;  2YEP F;  1C9F A;  3W1S A;  4HVB A;  4GDK A;  2WWZ A;  3HVD A;  4ANW A;  1PDX A;  2KFJ A;  3FAH A;  4GU2 A;  2FAZ A;  4ZRK A;  2LGS A;  3M3J A;  4J6I A;  3EA6 A;  2QEJ C;  1ZXH A;  2NS5 A;  2WXK A;  2ICI A;  4NJ7 A;  1C77 A;  1IBX A;  2WDQ B;  1F77 A;  3P42 A;  3R2T A;  1LM8 B;  1JWM D;  4YTN B;  1FRR A;  1OGW A;  1WX7 A;  4HKZ E;  3VR9 B;  4W9F A;  3AE4 B;  4KIK B;  1VZ7 A;  2WQY B;  5IKC M;  1XCT L;  4BKS A;  2L76 A;  1FM0 D;  2GBR A;  2W54 A;  4RGM A;  4NJC A;  3N3K B;  5FK9 C;  5D6J B;  2IDY A;  2O6V B;  2VRR B;  4EEW A;  3MHS D;  4OHJ A;  2L0F A;  3L16 A;  5JHB A;  4AWJ A;  4IWP A;  4N6E B;  5L83 A;  3TBL D;  2L3Z A;  5BMG A;  2Z8L A;  5HKH A;  4NY0 A;  4BAX A;  1P7F A;  5JH5 C;  3DDC B;  4ZRQ A;  2BS3 B;  1K52 A;  4EE2 A;  1HEZ E;  3B9J A;  2AWT A;  2KWC A;  4PT5 A;  4DXA B;  1EWC A;  2RPQ A;  1GB4 A;  2IPK D;  3NHE B;  3R66 C;  1L0Y B;  1TJE A;  3NVV A;  4HK2 A;  2BT6 A;  3DVG X;  1FFU A;  3MFG A;  3Q3F A;  2BVC A;  2QHO A;  1HTQ A;  1V2Y A;  2JF5 A;  5IN7 A;  2KFK A;  2ZNV C;  1MHX A;  1WZ0 A;  3P4S B;  4OVZ A;  2FCN A;  1I4G A;  3SHQ A;  1IYF A;  5KHQ A;  1KJT A;  1RAX A;  3NG0 A;  1SXT A;  2N7D A;  3EFC A;  1JRP A;  3KUZ A;  1FPY A;  2RDH A;  4WJN A;  2LVO A;  2BQQ A;  1XLQ A;  2KK8 A;  1E7U A;  3RZF A;  1WJU A;  2BYE A;  4W9G A;  2PTL A;  4P16 A;  4JWS C;  2K5P A;  3BWU D;  1WE6 A;  4KSK C;  1P3Q U;  3BK1 A;  3N32 A;  4G11 A;  1KM7 A;  2G4D B;  4LDT D;  3AEA B;  1R4M I;  2WNM A;  4EZK A;  1TY0 A;  3DHI C;  2LFI A;  1L6V A;  1IP9 A;  1V1O A;  1XT9 B;  1TZ1 A;  5KHO A;  2MRP A;  2KN5 A;  2GBN A;  2QIE B;  2DZI A;  5EE9 A;  4DXF A;  4ZOH C;  4FJY A;  5JXV A;  2XBB C;  1V81 A;  1R4M B;  1V97 A;  2QCZ A;  5BMI A;  5J17 A;  3AED B;  3BII D;  3RNF C;  2INP E;  4A3P A;  1AWD A;  3ZRF A;  2KDI A;  1EF5 A;  2N9X A;  3H6N A;  4FAD A;  2WXI A;  4NNJ B;  2WP9 B;  3VH3 B;  1P98 A;  3HUI A;  4OZC A;  1TIF A;  2Q5W D;  2DEN B;  3C19 A;  3PSE B;  2JZZ A;  3CST A;  3U8Z A;  1XD3 B;  2CKH B;  1QQR A;  4ARC A;  3QAR A;  2Y5P A;  2BS4 B;  1VCB A;  1ACC A;  1FCL A;  4YSZ B;  2AYO B;  3VRA B;  1FNV A;  2WHI A;  2D07 B;  2IJ0 A;  1KRH A;  1RLF A;  1RYJ A;  1R7S A;  1XLP A;  1F9J A;  2K1F A;  4AUQ C;  4II3 B;  5J18 A;  2MP2 A;  2KDE B;  4WWN A;  3R3M A;  4II2 B;  1H4R A;  1SIJ A;  5FKA C;  2L05 A;  4JIO U;  1OTR B;  4CHK A;  1QZE A;  3BY4 B;  2BTE A;  2B3A A;  2C9W B;  3LJ3 A;  1YQ3 B;  3TUO A;  4W9I A;  3W9C B;  1K50 A;  3HM3 A;  2I1K A;  4JE3 B;  2QC8 A;  3BK2 A;  1AN8 A;  2DAF A;  3VUY A;  2ACZ B;  1WXM A;  2AX5 A;  4O1N A;  1F2R C;  2KWU B;  3V62 A;  1M94 A;  2N7E A;  2LVQ A;  1PQS A;  4KDI C;  1RM6 C;  2FUG 1;  4BOZ B;  5CX3 A;  2EKI A;  2JVC A;  2YLM A;  2JXT A;  2FUH B;  2WDR B;  2J52 A;  2OJR A;  3VTV A;  3RT3 B;  1LO5 D;  3DBR B;  2L8J A;  1ZKH A;  4WWO A;  2KAJ A;  3NVW A;  1NI3 A;  2WYQ A;  1C76 A;  1E9M A;  2AL6 A;  3T3N A;  2AQ2 B;  4KZC A;  3BYT B;  3VRB B;  3MC9 A;  3I3T B;  1V8C A;  4HWI B;  2MJD A;  1E8W A;  3R2I A;  4XDC A;  3P4R B;  4FA6 A;  4H2A A;  1E0Z A;  1KH0 A;  4TKN A;  4FLH A;  1OEY A;  3DBR I;  1WRI A;  1N60 A;  1QLB B;  2IYD B;  2RDG A;  3IG3 A;  2D5G A;  4DWF A;  4YTM B;  1NDD A;  1YJ1 A;  1XF5 L;  1U4A A;  1WSP A;  2QJL A;  3P4P B;  2G4S A;  4HDO A;  1FXA A;  3NRZ A;  3CSF A;  1WGK A;  1Q1O A;  2LXC A;  2W9N A;  1WF9 A;  1IPG A;  2VH2 A;  4L1B A;  1C79 A;  4ZYN A;  3C8Y A;  1WR1 A;  3M62 B;  2V0G A;  5CHW A;  1PGB A;  2VZK B;  4LNN A;  3WCQ A;  1ET6 A;  2YEP B;  4MAC A;  2L32 A;  3APF A;  3RNE C;  1SF0 A;  5AUI A;  1F1H A;  2V4L A;  2Z59 B;  1NBF C;  4KKI A;  4RF1 A;  4KZ0 A;  4IC7 B;  2JZP A;  3IVF A;  5BYR A;  1UGJ A;  1WZ3 A;  2LUE A;  3ZNI D;  1XEE A;  1SJH D;  3V6C B;  3DVG Y;  1STE A;  2PE6 B;  1UGM A;  2CS4 A;  3ZUN A;  2X8X X;  3SDL C;  2K22 A;  4EKU A;  2IY0 B;  2N1W A;  2K9X A;  5G2N A;  1UWX A;  2DX5 B;  5HG2 A;  3RCZ A;  3AI5 A;  4MJS B;  4DXG A;  4RH6 A;  3A9K B;  1C1Y B;  1YQ4 B;  3RNA C;  2BWE S;  2EMS A;  4RCO A;  2KHW B;  2PEA A;  4HEA 1;  3T9L A;  1VJK A;  2M8S A;  2NTT A;  3T3O A;  4WJO A;  2KZR A;  2WX1 A;  2WGS A;  3QHT A;  4C56 C;  3UQA A;  3NS1 A;  2LZ6 A;  2LRU A;  2M56 B;  2KLC A;  4AS1 A;  3APC A;  4GXB A;  2V1Y A;  2BS2 B;  1UBI A;  1HZ5 A;  1YN5 A;  4GSW A;  3Q8C A;  4IKG A;  5D3D A;  4TMA B;  3V05 A;  1EF1 A;  1SSN A;  2L0T A;  3MJW A;  4PS3 A;  1DYQ A;  2LRW A;  4KIK A;  3MHZ A;  1ISN A;  1E8Z A;  4HLE A;  2J53 A;  2LXA A;  1WJ6 A;  1TS5 A;  2LJ5 A;  1TS3 A;  5CHV C;  1WM2 A;  4FJZ A;  3DHG C;  3L0W B;  3M95 A;  2IO1 B;  3A1Q B;  1QOA A;  1NVI D;  1WGD A;  3TL5 A;  4DDI D;  1TT5 B;  3UQB A;  1YJJ A;  4WJP A;  1AYF A;  2JRI B;  1YN3 A;  3C0R B;  2WXP A;  4PS7 A;  1SE2 A;  2NMQ A;  1C4A A;  2KTF A;  1QOF A;  4C7Y A;  4ANU A;  2LVP A;  3NS8 A;  1JAL A;  2WXM A;  1FD6 A;  4P6V F;  3L08 A;  1NI2 A;  2HE7 A;  2CHZ A;  3N1Y C;  3B1L X;  3ZJT A;  2PVG C;  4B95 A;  4AP4 C;  3D32 A;  2GBJ A;  2WXJ A;  3UI3 A;  3ZQ4 A;  3NVZ A;  2Y3A A;  2K0P A;  1WIA A;  1YMH E;  2ZPY A;  3AU4 A;  3MC0 B;  3PRE A;  2O6V A;  1L6U A;  2KOX A;  3PRZ A;  4I6P A;  5AZH A;  3UIO B;  2MBE A;  1QOG A;  2MLB A;  1LGR A;  4EZL A;  2R2Q A;  2RR9 A;  1V1P B;  2CU3 A;  1WGH A;  1R4N B;  3LYY A;  2IZV B;  2JYE A;  4GDL B;  4NQL B;  3N20 C;  1TY2 A;  2MA9 B;  3UIP B;  4ASW C;  1I4R A;  2MBH A;  3I5J C;  4MH8 A;  5GXG B;  4GLS C;  1WGR A;  4RMA A;  4EFO A;  2KVR A;  1T0S C;  2QDF A;  5LLI A;  1QF6 A;  2ON8 A;  1J8C A;  4IOI E;  3I9V 1;  4ZDV A;  3H9D A;  1KLG D;  2KJR A;  2REX A;  4OZA A;  1E7P B;  3KYC D;  2DZK A;  2ZVO A;  1Q10 A;  3BZD B;  3KWL A;  2D3A A;  1RRB A;  3TJP A;  2INC C;  4F1S A;  2J0K A;  4K7W A;  5EE3 A;  4MSM B;  2D2Q A;  2C5L C;  1SE4 A;  2BBC A;  1LQB A;  1XLN A;  4C4V B;  4MEM A;  3AUL A;  1GPX A;  2NCN A;  1L7Y A;  1J19 A;  4F8C B;  5C23 A;  2LEK A;  4UDU C;  3ZXV A;  1WX8 A;  4ZRJ A;  2DLB A;  4W9E A;  2B76 B;  1T3Q A;  3UF8 A;  5G5G A;  2MEK A;  3N30 A;  4BFR A;  3TSS A;  1YD8 U;  3Q2A C;  3QAQ A;  3TCA A;  4BBN F;  2IGG A;  4FN2 A;  1GB1 A;  3H7P A;  2KAN A;  2LD9 A;  2XN9 C;  3AM9 A;  1G6J A;  1FNW A;  3GB1 A;  3EEC A;  2AEH A;  1YNT E;  4WWP A;  2ZW0 A;  3WAM A;  1ZUD 2;  4P1B C;  4HRS A;  3Q3M C;  2J0M A;  1CQV A;  3VAW A;  2HTH A;  1F52 A;  1J0G A;  3PZ8 A;  1FMA D;  4RF0 A;  3R7R A;  4REZ A;  1PGX A;  1TKY A;  4E71 A;  1K51 A;  1V6E A;  4CYE A;  4FJV B;  3JYU A;  2GRI A;  3W2D A;  1PUT A;  3OLM D;  5FR6 A;  2KWD A;  3PLU A;  3AE5 B;  3AE6 B;  1BXT A;  4IWO A;  1OFF A;  3W5V B;  4CO7 A;  2WXR A;  2O6V D;  2KX3 A;  3RPF C;  2O2V B;  4A3O A;  5TR5 A;  4G0N B;  2WS3 B;  5D7G A;  4EUT A;  2RSU A;  4C00 A;  1SGH A;  1SB3 C;  1D4B A;  3AU5 A;  4M01 A;  3ZYY X;  1WWT A;  3MJ5 A;  4YSY B;  2GLS A;  2WXH A;  2BYF A;  2WXQ A;  4PYZ A;  4IDI A;  3NZ3 A;  4NPN A;  3ZDT A;  1M4V A;  5E6J A;  2GI9 A;  2KDF B;  1WXS A;  1C78 A;  3N9Y C;  2M0X A;  2R2O A;  2JYT A;  3GE3 C;  4ZRP A;  1ZOY B;  4MGY E;  3OJ4 B;  3U7D A;  1JWA D;  1D6E C;  3DOW A;  2L83 A;  2IY1 B;  1YOV B;  2K39 A;  4IUM B;  2DZJ A;  1UF0 A;  3ZJV A;  2BB5 A;  2M17 A;  3TEW A;  4LCD E;  2CHW A;  3JW0 X;  3KVF B;  5T8I A;  2IO3 B;  1HQR D;  2E6X A;  1QOB A;  4US8 A;  1TKG A;  3VXW A;  2M1M A;  4M8M A;  4KGR A;  4XWW A;  4OVV A;  2NPT B;  2CJO A;  2K6Q A;  1KF6 B;  3E56 A;  4HCP B;  3Q8A A;  4IG7 B;  5BYQ A;  4WH4 A;  1UD7 A;  3PS6 A;  3VQI A;  3DVN U;  2Y5C A;  3URY A;  1P1A A;  3RFZ B;  4MH0 E;  1EWY C;  3N1Z C;  3SEB A;  3ECI A;  3PHX B;  2LWP A;  4ANV A;  4CQN A;  2Z0E B;  2LUM A;  2I2Y A;  3ZNH B;  1KTK A;  3L54 A;  1KLV A;  1J7A A;  1J7C A;  3J9C A;  1E6E B;  4YSX B;  2LJI A;  3QQ8 B;  3QA8 A;  2BW2 A;  5LNK 1;  5IAA C;  4HDQ A;  1MI0 A;  2IGH A;  4WAA A;  4ZHO A;  3W1Y A;  1MHH E;  5E6P A;  4MSQ B;  4TUU A;  5C3J B;  1TKE A;  2R61 A;  3ZDM C;  4WQM A;  1XLO A;  2N9L A;  1YIW A;  2V3N A;  3AE3 B;  3OG5 A;  4OW0 A;  3DPD A;  2OOB B;  2J0J A;  4KV2 A;  2OJW A;  4KVG B;  4RFB A;  2N4F A;  2NPT A;  4PYU A;  1GOZ A;  1IGD A;  4BBN C;  3RD2 A;  3PRM B;  2VH1 A;  2MQJ A;  4I6L B;  4YTP B;  2WXO A;  2V9H A;  1YJI A;  2KN4 A;  2EEL A;  4BKS D;  5I4D A;  5G55 A;  2ZEQ A;  4IWQ A;  4HKQ A;  2RD0 A;  1UNS A;  2HTM E;  1A5R A;  4WQO B;  1EU4 A;  5GMV A;  3L10 B;  3PO0 A;  5BO4 B;  2WLB A;  3AN1 A;  3Q3O C;  1JCK B;  2RMM A;  2HD5 B;  3VDZ A;  1ESF A;  4DHJ D;  2E3T A;  1KFY B;  1WMH A;  3KLS X;  3L13 A;  3AH7 A;  3CIR B;  4IM0 A;  5IP4 D;  2UU7 A;  4RM9 A;  3HHM A;  2DWQ A;  1SE9 A;  3ZJU A;  4RNA A;  2KC1 A;  3TIX A;  5JZE B;  2C7N B;  5IOI A;  2N9E B;  5AZG A;  4US9 A;  3BIN A;  1Z2M A;  2G9H D;  3KH0 A;  1VD2 A;  2HDE A;  2O2V A;  3DBH B;  4BZA A;  4WAF A;  3EUB 2;  5LXH A;  3IT6 B;  2MX2 A;  1MVK A;  2QMT A;  4GDK B;  3Q69 A;  3SU8 X;  3RN9 C;  1P7E A;  1CMX B;  3AEC B;  1SIF A;  4WUR A;  3N1X C;  4S17 A;  2NBU A;  4NQK E;  3PZ7 A;  3BVM A;  2XK5 A;  1NEN B;  2K6D B;  5TSS A;  1NYR A;  3PRP B;  2BKF A;  4PK1 A;  1I7H A;  4B9K A;  1I42 A;  3EGR A;  1AAR A;  1P0R A;  2KJH B;  2KLG A;  3P1M A;  1MPE A;  2INN E;  4AJY B;  1JWS D;  1WJ4 A;  2K8H A;  2KQ4 X;  2KTR A;  3DWG C;  4MM3 A;  3B2G A;  2JZ3 B;  2IBI B;  4NAM A;  2FID A;  3TEX A;  2LGI A;  1NYQ A;  3H1U A;  3RNC C;  3AEG B;  4KGT A;  3DBL I;  3HK0 A;  4HRO A;  3NY5 A;  1CZP A;  5HI1 A;  4JLC A;  2RDB C;  4XGA B;  4E3C A;  1E7V A;  4ANX A;  1HXY D;  5EE0 A;  3NVY A;  3P2B A;  2MCN B;  1DGJ A;  2LGY A;  3W5U B;  2DAJ A;  3VFK A;  1N62 A;  3PHW B;  1SE3 A;  2V3S A;  3FIL B;  3MP9 A;  2AQ1 B;  1WE7 A;  4MT5 A;  4LTU A;  2H88 B;  3DBL B;  1T0Y A;  1J7B A;  1XO3 A;  1IGC A;  4DDG D;  2MWS B;  4Q2J A;  4GOC A;  4K1R B;  4XYC A;  2ZCB A;  1YX5 B;  2KQ7 A;  3IBE A;  3OWE B;  4MGI E;  4WIP A;  1OEY J;  1OQQ A;  3DWM A;  4NZL B;  4G50 A;  1PGA A;  3RUL A;  2QIL A;  3Q8E A;  1I4X A;  3LDZ E;  5L95 C;  3KW5 B;  4GIV A;  2KMA A;  2WXG A;  4USA A;  3U52 E;  2LI5 A;  2OHF A;  4MGK E;  3Q8F A;  1CK1 A;  3NOB A;  5BMH A;  1N5X A;  2D10 A;  2MBO A;  1T5X D;  1TS4 A;  3ZTC A;  5DPT A;  4ZYS A;  4MM3 B;  2MBQ A;  1H8C A;  2MHJ A;  2M19 A;  5EE1 A;  5HFY A;  4B0M A;  1B1Z A;  3RMK C;  4LNK A;  4ACF A;  5DPS A;  3MC8 A;  2SEB D;  2XNA C;  1ROE A;  1L2N A;  3NUH B;  3VHT C;  4KSL C;  4MGZ E;  3CWI A;  2PMV A;  3ETR A;  2KXJ A;  3FKY A;  3GZN B;  2VZK D;  1KLU D;  2JY6 A;  1WXV A;  2CR5 A;  1K8R B;  3GE8 C;  1MJD A;  2A5U A;  3A9K A;  3JSV A;  2IO0 B;  4A8X C;  1ZXI A;  1QKZ A;  3OJ3 A;  3R8B A;  5FR3 A;  1JW9 D;  1DOI A;  2HJ1 A;  1JRU A;  1Y56 A;  1Y8R C;  2BYV E;  3PT2 B;  2ZPN A;  2CU1 A;  1EUV B;  2W3S A;  2G1E A;  1GG3 A;  1T0R C;  1K53 A;  1SBB B;  3EFU A;  4K7U A;  2RPV A;  2LAS A;  3GZN I;  1TS2 A;  2N9P C;  4FUL A;  3UIN B;  2KYW A;  1ZDV A;  5CHF A;  3U7Z A;  4HXD A;  4N9F 4;  1V86 A;  4ITK A;  3U4E G;  3TMP B;  1VZ8 A;  2W3R A;  2FCS A;  4BVU C;  3GOE A;  3A9J B;  1C3T A;  4NAW A;  2FBW B;  1DOX A;  4RGT A;  2MJ3 A;  1JML A;  5D3I B;  2KDB A;  4L2Y A;  4FBJ B;  1WFY A;  3QCA A;  2N9K A;  3H7S A;  2JU6 X;  3ZVV A;  1FCC C;  2C7M B;  5J2R A;  3QX1 A;  3ZRC A;  3U30 A;  1HTO A;  4DHJ B;  4KDL B;  2HJ8 A;  4K3B A;  1YN4 A;  5AZF A;  4XWT A;  1WX9 A;  1P9D U;  2ZVN A;  3AEB B;  2KT7 A;  4JGH B;  2L1A A;  5H8Y E;  3OAW A;  1SJE D;  4YXD B;  2BYT A;  3H7P B;  2IO2 B;  2WDT B;  2FE8 A;  1FXI A;  4TV3 A;  3KWV A;  4GB9 A;  3A4R A;  2CJN A;  3A9J A;  1V1P A;  2WDV B;  2JPH A;  4PS8 A;  1NEK B;  2DBY A;  4WWM A;  4DBG A;  4G3X B;  4LNI A;  1FFV A;  4IM3 A;  2DYM A;  1FEH A;  3VVW B;  2KVZ A;  5G5H A;  3QK0 A;  3ZNG C;  1CJE A;  4HPP A;  2KAC A;  4K3C A;  4W9C A;  4XZ4 A;  2NBV B;  2PW9 A;  3M63 B;  2KX0 A;  2JUO A;  2JSV X;  1B9R A;  1RFA A;  3BVG A;  4K81 A;  1XQQ A;  4JQW C;  1MG4 A;  3IHP C;  3RI7 C;  2Y5B B;  2WXL A;  2LGX A;  1C4C A;  2PJH A;  2FIF A;  3VUW A;  4JL9 A;  4K7S A;  1WXQ A;  1MFW A;  2YVC A;  1R4N I;  3HIZ A;  4MDK E;  1I4P A;  4F7Z A;  1V5T A;  2L52 A;  3AEF B;  1WM3 A;  5BYS A;  2LHE A;  5D94 A;  4IW0 A;  2V4I B;  4XX5 A;  4GDL A;  3ZXR A;  4JX1 C;  1BML C;  3DQV A;  4W9K A;  1WY8 A;  2X38 A;  4J3O D;  2BGF A;  4FHJ A;  2PPH A;  1IUE A;  2DYO A;  5D2M B;  1BT0 A;  4FHK A;  3GS2 A;  3ZTD A;  3IAS 1;  3QIJ A;  1JRO A;  1WGG A;  3WAP A;  3P4Q B;  4C7Z A;  4OVU A;  3WAO A;  2JRH A;  3GP7 A;  1E8X A;  1ET9 A;  3WA0 A;  2MBB B;  1EM7 A;  3ONS A;  2BF8 B;  1FNU A;  4N59 A;  2OED A;  1E90 A;  4A90 A;  2KDM A;  5C2T B;  3V3X A;  2CHX A;  3T8M A;  1JWB D;  3JVZ X;  3W1S C;  1LFD A;  1FIQ A;  4TSS A;  1UUP A;  4LLG M;  1D3Z A;  3VTU A;  3WAN A;  2N0S B;  1RFK A;  1LXD A;  1KOT A;  4RGO S;  2ZW1 A;  2M4N A;  1RWS A;  2ASQ A;  2GMI C;  1WJN A;  4D2K A;  1T0Q C;  2ZJD A;  2LHD A;  1FXT B;  2DYB A;  3H8H A;  2MP2 B;  2KQS A;  2GOW A;  2D3C A;  3RYT A;  3ZO5 B;  3AE1 B;  3ALB A;  3KYD D;  1L0V B;  4AJW A;  2WX0 A;  3CMM B;  3PZD A;  2PKO A;  4ICV A;  4A9A A;  3IAM 1;  4HJG E;  4XC2 A;  3HVZ A;  1N61 A;  1SEB D;  3KQ4 A;  3APD A;  2NBW B;  5IO9 A;  1EU3 A;  1V80 A;  4A20 A;  2WXF A;  4IM2 A;  2IND C;  2NVU I;  4DHZ B;  4ZHP A;  4LNF A;  2DHZ A;  3U2S C;  4C4V A;  2KC2 A;  4A6Q A;  2W82 A;  5H92 C;  3AE2 B;  3AE9 B;  2I1J A;  2KFK B;  1TGZ B;  3BYY B;  2SAK A;  3AV8 A;  3A33 B;  1UH6 A;  4TQ0 A;  1E10 A;  4LJO B;  4EZJ A;  1ZP0 B;  3ZW3 A;  2G3Q B;  2JQR B;  5IA7 A;  1WI0 A;  3PTF C;  4M0W B;  3DBS A;  3K9P B;  2ONQ A;  1JWU D;  5MPO A;  3HM6 X;  2BPS A;  3AB5 A;  4JPS A;  1Z5S B;  4TQ1 A;  4M8N A;  1XXG A;  3VR8 B;  4M02 A;  1MG8 A;  2KNB A;  4C80 A;  3WIM A;  2G45 B;  1X1M A;  1T6B X;  2JXX A;  1WMH B;  4B0E A;  2BWF A;  3ABV B;  5JHA A;  2NTS A;  2K8B A;  2I38 A;  3R7Q A;  2MSE D;  2JT4 B;  3L17 A;  3ZLZ A;  2GBK A;  2WXN A;  3PV1 A;  2ZZP B;  4FXC A;  3Q3N C;  4GMV A;  2KO3 A;  4M00 A;  1I4Q A;  2Z0D B;  1VR9 A;  2MJE A;  4QAY A;  3WAL A;  3X0W A;  5E6N A;  4ARI A;  1TTN A;  3BVZ A;  4EOY A;  1D5Z C;  3DHH C;  2AL3 A;  1UBQ A;  1EO6 A;  1HE8 A;  1ZGU B;  2RGF A;  5EDS A;  2MW5 A;  2PE9 A;  3E9S A;  2D11 A;  4XDD A;  1UZX B;  5DCN A;  3FIL A;  1VLB A;  3ZKJ C;  4KX6 B;  2AQ3 B;  1WYG A;  4YL8 A;  1HA5 A;  2J4X A;  4OZB A;  4B6W A;  3Q8B A;  1BUI C;  4RGN A;  5DPR A;  3PGE A;  2FNJ B;  1C4P A;  2BB6 A;  3TEZ A;  2FCQ A;  1ENF A;  2GBM A;  1E8Y A;  4BOS C;  1Q0W B;  4LDT B;  1ZPS A;  4HPL B;  3O13 A;  2K3U A;  1L5P A;  1E5W A;  1GAQ B;  3HRD D;  3VH4 B;  3LB8 C;  3L4P A;  1F2R I;  3ZGZ A;  1WR6 E;  3KUC B;  3B0A A;  4S0R A;  1FRD A;  1YX6 B;  1V49 A;  2W55 A;  1S1Q B;  1PYW D;  4RM8 A;  2FCM A;  3IFW B;  4A55 A;  3DVN V;  4YWG G;  3LXF A;  2IGD A;  3K9O B;  5HHD G;  4ICU A;  3RUI B;  2QSD A;  2XEW A;  4W9L A;  4W9H A;  3ZNZ B;  2N1V A;  3PLV A;  2ZNV B;  4KGS A;  2UWQ A;  3P63 A;  3JSV B;  1TYG B;  1IBX B;  4L23 A;  1QT9 A;  3AMZ A;  3I57 A;  1DOY A;  5AUK A;  2C7H A;  2D3B A;  1PFD A;  3SD5 A;  3V6E B;  1GNU A;  1F0Z A;  4R3D A;  2BKR B;  3KUD B;  1YQB A;  3X23 A;  4M0W A;  2XK5 B;  3NZS A;  1WH3 A;  1VDV A;  1N6Z A;  3QWZ B;  1UWM A;  3B08 A;  1GC6 A;  3ML8 A;  3PVL A;  1WGY A;  1I35 A;  4DQO C;  5CTR C;  1WRD B;  2KJ6 A;  1VRA B;  2EMT A;  3DBH I;  2LMC A;  1D5M C;  5DPW A;  4P1C C;  2KD0 A;  3PPA A;  1N63 A;  1D5X C;  3AXC A;  3A4S C;  1OQR A;  1ZW7 A;  3IXS A;  4URK A;  1AW7 A;  1HZ6 A;  2ZCC A;  4LK0 M;  2WU2 B;  1A70 A;  1Q5W B;  4I6N B;  4BKT A;  3IT4 B;  1WYW B;  3FC4 A;  4LNO A;  3V60 A;  3RNB C;  3VUX A;  2N7J A;  4LJP B;  3TEY A;  3VTW A;  3SFD B;  1TZO A;  4GN1 A;  4GGQ A;  1I4H A;  2J42 A;  2PLP A;  1ZE3 D;  1FO4 A;  2WU5 B;  2UYZ B;  4X57 B;  2NR2 A;  1TBE A;  4W9D A;  1JQ4 A;  4NJ6 A;  2H89 B; 
#chains in the Genus database with same CATH homology
 1IPG A;  2KMC A;  5C1Z A;  3QQ8 B;  4P7I A;  3M63 B;  3QA8 A;  3A1Q A;  4ZYN A;  5AEK B;  2KX0 A;  1V5O A;  1OQY A;  1WR1 A;  3M62 B;  2JUO A;  4DHZ E;  5CHW A;  1RFA A;  5IAA C;  4HDQ A;  4K81 A;  1XQQ A;  4WAA A;  2KKC A;  5LXI B;  4JQW C;  2KWV B;  3W1Y A;  2DZM A;  3ENE A;  3APF A;  3IHP C;  5E6P A;  2C60 A;  4MSQ B;  1GC7 A;  3EC8 A;  4ZRI A;  2Y5B B;  4TUU A;  2V4L A;  2Z59 B;  2LGX A;  1NBF C;  2PJH A;  2FIF A;  3O65 B;  4JL9 A;  4KZ0 A;  4K7S A;  3VUW A;  3ML9 A;  4IC7 B;  3ZDM C;  3IVF A;  3NZU A;  3QJZ A;  1S3S G;  1YIW A;  2YVC A;  1R4N I;  3HIZ A;  3MTN B;  3S2A A;  4MDK E;  3ZIM A;  1WZ3 A;  2LUE A;  4AOF A;  3UGB B;  4NAW B;  3V61 A;  3ZNI D;  3DPD A;  1GUA B;  2OOB B;  2J0J A;  4W9J A;  4F7Z A;  1V5T A;  4KV2 A;  2J7Q B;  1WM3 A;  4KVG B;  3QC8 B;  5E6O A;  3V6C B;  3DVG Y;  2N4F A;  2NPT A;  4MEL A;  4PYU A;  5D94 A;  4BBN C;  4E74 A;  2PE6 B;  3RD2 A;  3PRM B;  1UGM A;  4IW0 A;  2CS4 A;  2KTR B;  3EHV A;  4HJK A;  4GDL A;  4XX5 A;  3ZUN A;  2MQJ A;  3DCG A;  3SDL C;  4EKU A;  2IY0 B;  2K25 A;  2N1W A;  4I6L B;  3DQV A;  2JWZ A;  4W9K A;  5G2N A;  2DX5 B;  3RCZ A;  1WY8 A;  3AI5 A;  4MJS B;  3A9K B;  1C1Y B;  2L00 B;  2BWE S;  4BKS D;  2EMS A;  2BGF A;  2KHW B;  2PEA A;  4FHJ A;  5G55 A;  1GJZ A;  2PPH A;  3Q3J A;  2LGD A;  2ZEQ A;  4IWQ A;  3T9L A;  2RD0 A;  3CF6 E;  1UEL A;  2DYO A;  1A5R A;  5D2M B;  2M8S A;  4WQO B;  1BT0 A;  4FHK A;  4DK5 A;  3RZW C;  4WJO A;  2KZR A;  2WX1 A;  2A4Z A;  3ZTD A;  1WXA A;  5GMV A;  1V9J A;  4WJQ A;  3QIJ A;  3QHT A;  1WGG A;  3WAP A;  3L10 B;  3UQA A;  4HCN B;  4OVU A;  3WAO A;  5BO4 B;  2JRH A;  4BKG A;  2LZ6 A;  4HPM B;  1E8X A;  2LRU A;  2HD5 B;  2KLC A;  3VDZ A;  2K8C A;  2EKE C;  2D3G A;  4MJS A;  3WA0 A;  2L7R A;  2MBB B;  4DHJ D;  3APC A;  3ONS A;  1WMH A;  3W1S A;  3L13 A;  4GXB A;  2BF8 B;  4HVB A;  2V1Y A;  1E90 A;  4IM0 A;  4GDK A;  2WWZ A;  4RM9 A;  1UBI A;  3HHM A;  2CHX A;  1SE9 A;  3T8M A;  4ANW A;  3JVZ X;  2KC1 A;  2KFJ A;  3TIX A;  4GSW A;  4GU2 A;  1LFD A;  2FAZ A;  4ZRK A;  3W1S C;  5JZE B;  3M3J A;  4J6I A;  2C7N B;  2NS5 A;  1EF1 A;  2L0T A;  2N9E B;  4NJ7 A;  3MJW A;  5AZG A;  1D3Z A;  3BIN A;  1Z2M A;  4PS3 A;  3VTU A;  3WAN A;  3KH0 A;  1VD2 A;  1LXD A;  2O2V A;  1LM8 B;  1KOT A;  2LRW A;  2M4N A;  5LXH A;  2ASQ A;  1OGW A;  1WX7 A;  4KIK A;  2MX2 A;  2GMI C;  4W9F A;  4GDK B;  1WJN A;  4KIK B;  3SU8 X;  1ISN A;  1E8Z A;  1CMX B;  2ZJD A;  4HLE A;  1SIF A;  4BKS A;  2LXA A;  1FXT B;  2DYB A;  2L76 A;  1WJ6 A;  2LJ5 A;  2MP2 B;  5CHV C;  1WM2 A;  4FJZ A;  3L0W B;  2GBR A;  2KQS A;  2NBU A;  2GOW A;  3M95 A;  4NQK E;  3RYT A;  2IO1 B;  3ZO5 B;  3A1Q B;  2XK5 A;  3ALB A;  3N3K B;  3KYD D;  5D6J B;  4AJW A;  2O6V B;  2K6D B;  1WGD A;  2WX0 A;  3CMM B;  3PRP B;  3PZD A;  3TL5 A;  2BKF A;  2VRR B;  4ICV A;  4DDI D;  4EEW A;  4B9K A;  3UQB A;  4XC2 A;  3MHS D;  1I42 A;  2L0F A;  3L16 A;  4WJP A;  5JHB A;  4AWJ A;  4IWP A;  1AAR A;  5L83 A;  1P0R A;  3TBL D;  2JRI B;  2L3Z A;  2KJH B;  3APD A;  3C0R B;  2KLG A;  2NBW B;  1V80 A;  5HKH A;  4PS7 A;  4A20 A;  4IM2 A;  4NY0 A;  4AJY B;  2KTF A;  5JH5 C;  4ANU A;  2LVP A;  3DDC B;  3NS8 A;  1WJ4 A;  2K8H A;  2KTR A;  3L08 A;  1NI2 A;  2NVU I;  2HE7 A;  4DHZ B;  4MM3 A;  2JZ3 B;  2CHZ A;  3B1L X;  2IBI B;  2DHZ A;  2AWT A;  2KWC A;  4B95 A;  4DXA B;  2RPQ A;  2FID A;  2KC2 A;  3H1U A;  3NHE B;  3R66 C;  4AP4 C;  2I1J A;  2KFK B;  3D32 A;  2GBJ A;  1TGZ B;  3DBL I;  3HK0 A;  4HK2 A;  3DVG X;  3NY5 A;  1WIA A;  2ZPY A;  3AU4 A;  3PRE A;  4JLC A;  2O6V A;  3Q3F A;  4E3C A;  3A33 B;  2QHO A;  1E7V A;  2KOX A;  3PRZ A;  4ANX A;  4I6P A;  5AZH A;  3UIO B;  2MBE A;  1V2Y A;  2JF5 A;  3P2B A;  2MCN B;  2KFK A;  2MLB A;  1UH6 A;  2ZNV C;  4TQ0 A;  1WZ0 A;  4EZL A;  2R2Q A;  2LGY A;  4LJO B;  2DAJ A;  3VFK A;  4EZJ A;  2RR9 A;  3ZW3 A;  2G3Q B;  2FCN A;  3PHW B;  3SHQ A;  1IYF A;  1WGH A;  5IA7 A;  5KHQ A;  2V3S A;  1WI0 A;  1KJT A;  1RAX A;  2IZV B;  3PTF C;  2N7D A;  4GDL B;  4NQL B;  4M0W B;  3DBS A;  3K9P B;  1WE7 A;  3KUZ A;  2LVO A;  4WJN A;  1T0Y A;  2MA9 B;  3HM6 X;  2BPS A;  3UIP B;  4ASW C;  1Z5S B;  4DDG D;  4TQ1 A;  2KK8 A;  1E7U A;  2MBH A;  4M8N A;  1WJU A;  3RZF A;  2MWS B;  4GOC A;  2BYE A;  4K1R B;  4W9G A;  1MG8 A;  2KNB A;  2ZCB A;  1WGR A;  4RMA A;  3WIM A;  4EFO A;  2KVR A;  2G45 B;  1YX5 B;  2KQ7 A;  3IBE A;  1WE6 A;  4KSK C;  1P3Q U;  4MGI E;  3N32 A;  5LLI A;  1X1M A;  1J8C A;  1OEY J;  4G11 A;  2JXX A;  1KM7 A;  1WMH B;  4ZDV A;  3H9D A;  2G4D B;  4LDT D;  2KJR A;  4G50 A;  1R4M I;  4EZK A;  2BWF A;  3RUL A;  2REX A;  5JHA A;  2K8B A;  3R7Q A;  3KYC D;  3LDZ E;  2MSE D;  5L95 C;  3KW5 B;  1IP9 A;  2DZK A;  2JT4 B;  3L17 A;  3ZLZ A;  1XT9 B;  2ZVO A;  1TZ1 A;  5KHO A;  2GBK A;  2MRP A;  1RRB A;  4GIV A;  3TJP A;  2KN5 A;  2KMA A;  4F1S A;  3PV1 A;  2ZZP B;  2J0K A;  2GBN A;  4K7W A;  2LI5 A;  2KO3 A;  4GMV A;  4MGK E;  2DZI A;  2Z0D B;  3NOB A;  4MSM B;  2D2Q A;  3WAL A;  3X0W A;  5E6N A;  4FJY A;  1TTN A;  2C5L C;  2D10 A;  2XBB C;  4EOY A;  2AL3 A;  1UBQ A;  2MBO A;  1EO6 A;  1LQB A;  1HE8 A;  1ZGU B;  4MEM A;  3AUL A;  1V81 A;  2NCN A;  2RGF A;  5DPT A;  3ZTC A;  5EDS A;  2MW5 A;  1L7Y A;  2MBQ A;  2PE9 A;  5J17 A;  1H8C A;  1J19 A;  2D11 A;  1UZX B;  5DCN A;  3ZKJ C;  4F8C B;  5C23 A;  1WX8 A;  4A3P A;  4ZRJ A;  4YL8 A;  3ZRF A;  2KDI A;  4W9E A;  1EF5 A;  2N9X A;  3H6N A;  4B6W A;  4FAD A;  3UF8 A;  5DPS A;  4NNJ B;  5DPR A;  3PGE A;  3N30 A;  2FNJ B;  3VH3 B;  4BFR A;  1L2N A;  1YD8 U;  1P98 A;  3QAQ A;  3TCA A;  3VHT C;  4BBN F;  4FN2 A;  4KSL C;  2FCQ A;  4MGZ E;  2GBM A;  2DEN B;  1E8Y A;  3H7P A;  3PSE B;  4BOS C;  2JZZ A;  2KAN A;  2KXJ A;  1Q0W B;  4LDT B;  1KLV A;  3CST A;  3U8Z A;  2JY6 A;  2LD9 A;  1XD3 B;  2CKH B;  1WXV A;  2CR5 A;  4HPL B;  1G6J A;  1K8R B;  1E5W A;  3EEC A;  2A5U A;  3A9K A;  2AEH A;  3VH4 B;  4WWP A;  3WAM A;  3QAR A;  3JSV A;  2IO0 B;  3OJ3 A;  1WR6 E;  3KUC B;  1VCB A;  3B0A A;  1YX6 B;  2AYO B;  1JRU A;  1Y8R C;  2BYV E;  1V49 A;  2J0M A;  3VAW A;  3PT2 B;  2ZPN A;  2CU1 A;  1EUV B;  2HTH A;  2D07 B;  1J0G A;  1S1Q B;  1RLF A;  1GG3 A;  2FCM A;  4RM8 A;  3R7R A;  4E71 A;  3IFW B;  3EFU A;  4K7U A;  1V6E A;  1F9J A;  2K1F A;  2LAS A;  3DVN V;  4AUQ C;  4CYE A;  4FJV B;  3GZN I;  4II3 B;  2N9P C;  5J18 A;  3JYU A;  3K9O B;  2MP2 A;  4FUL A;  4ICU A;  3RUI B;  2KDE B;  4WWN A;  3UIN B;  3OLM D;  3R3M A;  5CHF A;  5FR6 A;  2XEW A;  1H4R A;  4II2 B;  3PLU A;  4HXD A;  4W9H A;  4W9L A;  4N9F 4;  3ZNZ B;  2L05 A;  2N1V A;  1V86 A;  4IWO A;  4CO7 A;  3PLV A;  2ZNV B;  4JIO U;  2O6V D;  1OTR B;  3TMP B;  1QZE A;  4CHK A;  3BY4 B;  2B3A A;  2C9W B;  2KX3 A;  3LJ3 A;  2FCS A;  2O2V B;  2UWQ A;  3GOE A;  4A3O A;  5TR5 A;  4G0N B;  3JSV B;  4BVU C;  5D7G A;  4W9I A;  4EUT A;  2RSU A;  1SGH A;  3A9J B;  1C3T A;  3HM3 A;  3AU5 A;  4NAW A;  2I1K A;  2C7H A;  3V6E B;  2DAF A;  2KDB A;  3SD5 A;  1GNU A;  3VUY A;  2BYF A;  2BKR B;  3KUD B;  1WXM A;  1YQB A;  1WFY A;  4PYZ A;  3QCA A;  3X23 A;  4FBJ B;  3H7S A;  2XK5 B;  3NZS A;  1WH3 A;  3ZVV A;  4NPN A;  2KWU B;  3V62 A;  1M94 A;  2N7E A;  3QWZ B;  3ZDT A;  2C7M B;  5J2R A;  2LVQ A;  3QX1 A;  3ZRC A;  1PQS A;  3B08 A;  1GC6 A;  3ML8 A;  3PVL A;  4KDI C;  3U30 A;  2KDF B;  1WGY A;  1I35 A;  4BOZ B;  4DHJ B;  5CX3 A;  4KDL B;  5CTR C;  1WXS A;  2HJ8 A;  1WRD B;  2JVC A;  2KJ6 A;  2M0X A;  2YLM A;  2FUH B;  2R2O A;  2OJR A;  4MGY E;  2EMT A;  3DBH I;  3OJ4 B;  5AZF A;  3U7D A;  3VTV A;  1WX9 A;  1P9D U;  2ZVN A;  5DPW A;  3RT3 B;  3DOW A;  2IY1 B;  2KD0 A;  3PPA A;  2K39 A;  4JGH B;  4IUM B;  3AXC A;  2DZJ A;  2L8J A;  3OAW A;  1ZKH A;  4WWO A;  2M17 A;  3A4S C;  4LCD E;  2CHW A;  2IO2 B;  3H7P B;  3JW0 X;  3KVF B;  2WDT B;  2WYQ A;  1ZW7 A;  2IO3 B;  2AL6 A;  3VXW A;  4KZC A;  2M1M A;  4TV3 A;  4URK A;  4M8M A;  4GB9 A;  3I3T B;  3A4R A;  4OVV A;  4HWI B;  3A9J A;  2NPT B;  2JPH A;  2ZCC A;  4PS8 A;  1E8W A;  1Q5W B;  4I6N B;  4BKT A;  4FA6 A;  2K6Q A;  1WYW B;  4TKN A;  3V60 A;  4FLH A;  4DBG A;  4G3X B;  3VUX A;  4HCP B;  1OEY A;  4IG7 B;  3DBR I;  4LJP B;  2IYD B;  4IM3 A;  2DYM A;  1UD7 A;  3IG3 A;  3PS6 A;  3VVW B;  3VTW A;  4DWF A;  1NDD A;  3VQI A;  1YJ1 A;  3DVN U;  4GN1 A;  4GGQ A;  1U4A A;  1P1A A;  3QK0 A;  4MH0 E;  3ZNG C;  2UYZ B;  2G4S A;  3ECI A;  3PHX B;  2LWP A;  4ANV A;  4X57 B;  4HDO A;  2NR2 A;  2Z0E B;  1TBE A;  4W9D A;  3CSF A;  3ZNH B;  1Q1O A;  2LXC A;  4NJ6 A;  3L54 A;  4W9C A;  2W9N A;  4XZ4 A;  1WF9 A;  2NBV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...