3RZWC

Crystal structure of the monobody ysmb-9 bound to human sumo1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Teaching an old scaffold new tricks: monobodies constructed using alternative surfaces of the FN3 scaffold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Monobody ySMB-9
total genus 20
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rzwC00
2KO3A 1TZ1A 3WAOA 4KV2A 2HE7A 3K9OB 3H9DA 3M63B 3N32A 3APCA 4HPLB 4NNJB 1QZEA 2GMIC 5J18A 1WXMA 3M95A 4MH0E 3H1UA 4B6WA 4BKSD 5DPSA 2UWQA 5IA7A 2RR9A 2BWES 3JYUA 2KK8A 4W9LA 3SU8X 2D2QA 2LGDA 2BKRB 4KDLB 3OLMD 2MBOA 1E90A 1WJ6A 2CR5A 4EZKA 2NBUA 2MBEA 2NVUI 2FUHB 3ML8A 3ZTDA 4A20A 3X23A 3EECA 2VRRB 2KN5A 2GBNA 2IO2B 3O65B 1M94A 2KD0A 2LUEA 2LVOA 3NS8A 3PREA 4XZ4A 4DBGA 1SE9A 4NQLB 1EUVB 5IAAC 4TUUA 2XBBC 2KC1A 4HCPB 4ZRKA 2ZVNA 1GC7A 1GNUA 1E8XA 2ZPNA 3NY5A 2BKFA 1V86A 4OVUA 5DPWA 2D07B 3QARA 1KLVA 3UINB 2BYFA 4W9DA 2AL3A 2RGFA 2FAZA 1YIWA 3L08A 1WM2A 1P9DU 5L83A 2DAFA 2NR2A 4DDID 4RM9A 3A9KB 4ICVA 5E6PA 2WX0A 4WWNA 5GMVA 2KANA 2KJHB 3SHQA 2PE9A 3B1LX 4AJWA 1P3QU 1J0GA 2XK5A 2C7NB 3KUCB 4M8MA 1E7VA 1WGGA 1LFDA 3OJ3A 1WY8A 3IBEA 2HTHA 3ALBA 4DHZE 1KOTA 3L13A 2JRHA 2CHXA 2KDBA 4K7UA 3SDLC 3T9LA 2DENB 1IYFA 2KFKB 2G4DB 3A9KA 2CKHB 4ZDVA 2ZCBA 1RRBA 2KDIA 3UQBA 4MDKE 1YD8U 5L95C 3KW5B 3AU4A 2OOBB 1OTRB 2NCNA 1I42A 1L2NA 4X57B 3BY4B 4HXDA 2GOWA 2L7RA 1PQSA 3ZRFA 3RCZA 2REXA 3RUIB 2J0KA 2IO3B 2D3GA 5G2NA 4GDKB 3H7SA 3ZIMA 2LJ5A 2KDEB 1S1QB 4K81A 3TL5A 2KHWB 1WZ0A 2KWVB 2L0TA 2MCNB 2WWZA 4KSKC 4BKTA 3AULA 5G55A 2N7EA 2AL6A 2N4FA 4G0NB 2D10A 2N9PC 2O6VA 4IW0A 3HK0A 4F1SA 3IHPC 1A5RA 4P7IA 4MJSA 3W1SA 4FLHA 1L7YA 1OQYA 2ZNVC 1C1YB 3ONSA 2MX2A 3V62A 5KHQA 2KX3A 1CMXB 4II2B 4W9FA 2JVCA 2IO0B 4PS8A 2N1VA 3QA8A 4XX5A 2C7MB 3SD5A 2JXXA 4OVVA 3S2AA 1LM8B 4NY0A 5LXHA 2KQSA 1J19A 2LVQA 3JSVA 4LDTD 2KNBA 1V2YA 2DX5B 2I1KA 3KYCD 4I6NB 3VHTC 4KDIC 4I6LB 1WE6A 4K7SA 1KJTA 2DZMA 1LXDA 4W9CA 1Z5SB 1EF5A 2N1WA 2K1FA 3DBSA 4NQKE 1WXVA 5JZEB 3M3JA 4TQ1A 4EZJA 1XT9B 4JQWC 5AZGA 3ZNID 3PTFC 3VUYA 1ZW7A 3QCAA 3B0AA 2PJHA 4HPMB 1P98A 3WA0A 1WMHB 3L54A 4JIOU 4IWQA 3VDZA 2I1JA 1WJNA 2BYVE 3NZSA 3MJWA 4FA6A 1E8ZA 2O2VA 4G11A 4KIKA 2LZ6A 4GDKA 4GU2A 2LGYA 4MEMA 3PZDA 1YQBA 3L10B 4KVGB 4B9KA 3R66C 4GOCA 3ZO5B 3GZNI 3UIOB 1F9JA 3OJ4B 3DBLI 4W9EA 3ML9A 2J0MA 1Q5WB 1R4NI 3CSFA 4WJPA 4ANUA 3W1YA 1UBQA 4HWIB 4AOFA 3TIXA 3MHSD 3H6NA 4FJVB 1WM3A 4AUQC 3Q3JA 2K8CA 2BF8B 3GOEA 4AP4C 1KM7A 3W1SC 2EMTA 1C3TA 4ANVA 4M8NA 4EFOA 3APFA 4IG7B 2KDFB 3ECIA 3L17A 2JY6A 3U7DA 1YX5B 2DAJA 3ZTCA 2C9WB 4LCDE 3R7RA 4URKA 3UQAA 4W9HA 4NAWA 3V6EB 4BBNC 3A9JA 4EZLA 3ENEA 1NI2A 4BFRA 2V4LA 3JVZX 2KOXA 1T0YA 3LDZE 4MGYE 3VUWA 3QX1A 2PEAA 5D7GA 2CHZA 2FIDA 1UGMA 3CSTA 3A4RA 1UELA 3TBLD 2DYMA 3D32A 1TGZB 3UIPB 1S3SG 2Z0EB 2C7HA 3UGBB 5BO4B 1XD3B 2K6QA 2FCNA 2JUOA 2KTRA 2RD0A 4WJNA 3C0RB 4HCNB 5DPTA 5LLIA 4ASWC 1SGHA 2J7QB 4HK2A 2ZCCA 3PT2B 1X1MA 3TMPB 2MBQA 1NBFC 4MGIE 4CHKA 3TCAA 2V1YA 5E6NA 2M8SA 4BKGA 4TV3A 3V6CB 5FR6A 4ANXA 5AZHA 3DBHI 4TKNA 2AYOB 1WIAA 4CYEA 1UD7A 3QHTA 4PS7A 3A9JB 1V80A 3VAWA 2M17A 3U8ZA 3ZNGC 3QWZB 4FHKA 2L8JA 3EHVA 1V6EA 2IZVB 2KX0A 3T8MA 3DCGA 4MGZE 2JF5A 1WZ3A 1J8CA 4W9KA 2MQJA 2M0XA 2MSED 2WYQA 3RZWC 2D11A 3HIZA 2JZZA 2IYDB 4HLEA 2NPTB 3AU5A 2KFJA 4BOZB 2KJRA 2L3ZA 2UYZB 3V61A 1RAXA 5J17A 5D6JB 4JGHB 4GB9A 2KWCA 4I6PA 2L76A 4FN2A 4XC2A 1WH3A 4ZYNA 2FCSA 3BINA 1U4AA 3H7PB 4JL9A 2NBWB 4DHJD 2KXJA 2A5UA 2L00B 2GBJA 2ZEQA 2O2VB 4KIKB 1JRUA 3QQ8B 1GUAB 1IPGA 3VTVA 2R2QA 3CF6E 2MRPA 4MSMB 2ZJDA 3TJPA 4FULA 3WAPA 3ZUNA 1LQBA 3WALA 1AARA 1V49A 5CTRC 1WGHA 3H7PA 4IM0A 3L0WB 4ZRIA 3ZNZB 3HM3A 1WJ4A 3ZW3A 2KLCA 4BKSA 4DK5A 2JWZA 4AWJA 1OEYJ 2KJ6A 3N3KB 2K8HA 2ZPYA 4A3OA 2DZJA 2LGXA 5EDSA 2FIFA 3IG3A 4E3CA 1WGDA 2NBVB 4BOSC 4MM3A 3VTUA 1I35A 3PRZA 1V9JA 2JPHA 2ASQA 3VUXA 2YVCA 4IM3A 2B3AA 2WX1A 4J6IA 4KSLC 1YJ1A 2JZ3B 1UBIA 1P0RA 2QHOA 1RFAA 4EUTA 1IP9A 1V5OA 3PV1A 3WANA 1EF1A 4KZCA 4DDGD 4IUMB 1GC6A 4DXAB 4EKUA 4IC7B 3A1QB 4F8CB 4BVUC 1HE8A 4HDOA 4WWPA 3VQIA 2LVPA 3QAQA 4WWOA 3ZDTA 2R2OA 3RULA 3K9PB 2O6VB 4W9IA 2NS5A 2MP2A 2CS4A 3ZVVA 1P1AA 1G6JA 2JT4B 2KWUB 4AJYB 4MSQB 3PVLA 3PLUA 2DZKA 3PS6A 2Y5BB 3A4SC 5JHAA 1E8YA 3ZRCA 4LDTB 4E74A 3PLVA 1MG8A 2GBMA 2KTRB 4PYZA 2ZNVB 5E6OA 2FCMA 3PSEB 3VH4B 4HVBA 1NDDA 1V5TA 2MBBB 2WDTB 3DOWA 1YX6B 2DHZA 2JRIB 4KZ0A 3RYTA 5HKHA 3DVNV 1Q1OA 2N9EB 3NOBA 2KKCA 3A33B 2IY0B 1E7UA 3APDA 1V81A 3HM6X 5D2MB 3R7QA 4NAWB 2L05A 2N9XA 3OAWA 3B08A 3KYDD 1WJUA 2DYBA 1WX7A 2G3QB 3I3TB 2HD5B 4M0WB 5C1ZA 5LXIB 1E5WA 1FXTB 3L16A 4FJYA 3VFKA 4DHJB 4CO7A 3LJ3A 2CU1A 2MLBA 2G45B 4PYUA 2Z0DB 4LJPB 2NPTA 2LASA 2RPQA 3VH3B 4NJ6A 3AI5A 4GSWA 3WIMA 1K8RB 1WR6E 3R3MA 5KHOA 1SIFA 3N30A 2V3SA 4WQOB 3DBRI 3QJZA 4GN1A 1WXAA 2FNJB 3MTNB 5TR5A 4PS3A 2A4ZA 2O6VD 1H8CA 5AEKB 4G50A 4K7WA 2ZVOA 3ZLZA 2XEWA 2MW5A 3QIJA 3ZNHB 2K8BA 1EO6A 2YLMA 4NPNA 2M4NA 1OGWA 2IY1B 4FBJB 2GBRA 3PPAA 3DVGY 3X0WA 3EFUA 2MA9B 4IWPA 1OEYA 1WXSA 2BWFA 3KH0A 3WAMA 4TQ0A 1WRDB 4GGQA 4DHZB 5D94A 3KUZA 3KUDB 2LRWA 4BBNF 1UZXB 4ANWA 4DWFA 1RLFA 4EOYA 2K39A 4IWOA 4YL8A 3KVFB 2MP2B 2PE6B 2BYEA 4HJKA 4LJOB 1TTNA 2LI5A 2DYOA 4IM2A 1WR1A 2W9NA 1H4RA 2PPHA 1GG3A 5DPRA 3JSVB 3A1QA 3P2BA 1ZGUB 3RT3B 3U30A 1WI0A 3IFWB 2LRUA 5JH5C 1WGRA 3ZKJC 4GIVA 3V60A 2J0JA 2GBKA 2DZIA 5CHFA 4B95A 1TBEA 4II3B 5CX3A 5DCNA 4E71A 1WX9A 3NHEB 2KZRA 1ISNA 2BPSA 4GDLB 3DDCB 5J2RA 3IVFA 3ZDMC 4MJSB 4F7ZA 1BT0A 2IBIB 5CHVC 2IO1B 1R4MI 1WGYA 1XQQA 1Y8RC 2LXAA 2Z59B 4ZRJA 4WAAA 3PGEA 2KQ7A 1UH6A 4K1RB 2M1MA 3RZFA 1WFYA 2FCQA 2KTFA 4ICUA 4MELA 2EKEC 4RMAA 3DVNU 2LD9A 1WE7A 2ZZPB 3PHXB 4NJ7A 1GJZA 3RD2A 2LWPA 2HJ8A 4W9JA 2BGFA 3QC8B 3AXCA 2N7DA 3VXWA 3VTWA 5AZFA 2KVRA 4WJOA 1D3ZA 1WMHA 2EMSA 2RSUA 4WJQA 3UF8A 3Q3FA 3CMMB 4FHJA 1WYWB 4W9GA 1E8WA 1WF9A 2K25A 4FADA 4A3PA 3M62B 2KC2A 3PRMB 2MWSB 4GMVA 2KMCA 1Q0WB 3PHWB 5JHBA 2C60A 1ZKHA 3EC8A 5CHWA 1VCBA 2C5LC 2K6DB 2KFKA 4G3XB 4GDLA 1Z2MA 2AWTA 4EEWA 4FJZA 3NZUA 1WX8A 5C23A 2KMAA 4RM8A 4GXBA 3HHMA 2OJRA 3VVWB 2CHWA 3DQVA 4MGKE 4HDQA 2XK5B 2AEHA 2MBHA 1VD2A 2LXCA 3PRPB 2L0FA 3QK0A 2G4SA 2KLGA 3DVGX 3JW0X 4N9F4 4JLCA 3DPDA
chains in the Genus database with same CATH superfamily
3WAOA 1TZ1A 4JWUC 3K9OB 4YTNB 3APCA 4HPLB 2GB1A 2WU5B 5J18A 1D5XC 3JYUA 2KK8A 3GS2A 2D2QA 3SU8X 2MBOA 1E90A 4YSXB 1I4GA 3NG0A 2L52A 3NVZA 2V0GA 3EECA 2KN5A 1R4MB 2GBNA 4P6VF 1SE9A 4TSSA 3RN9C 5IAAC 1GNUA 3NY5A 2BYTA 1YQ4B 1V86A 4HROA 4OVUA 2D07B 2NTTA 2NR2A 4ICVA 5E6PA 2WX0A 3BK1A 2L1AA 2PE9A 1PFDA 1TY2A 3I63C 1J0GA 1P3QU 2K0PA 3V3XA 2XK5A 1F77A 4M0WA 4WH4A 1K50A 2CHXA 2KDBA 4XYCA 2X8XX 4WAFA 1IYFA 3Q3OC 2AQ1B 2LEKA 4ZDVA 2PVGC 2ZCBA 3AE4B 3UQBA 2SAKA 3N20C 1YD8U 2L32A 5L95C 3AU4A 2BVCA 1L2NA 5IKCM 4X57B 3BY4B 1VJKA 1JROA 2GOWA 2D3GA 2UU7A 5G2NA 2IPKD 4GDKB 3H7SA 3ZIMA 2YEPB 4K81A 4NZLB 2PKOA 1Q10A 2R61A 2MCNB 2L0TA 2WWZA 4KSKC 1PGBA 2N9PC 1TY0A 2Y5CA 3IHPC 3RPFC 4P7IA 2M19A 1FFUA 2VZKB 3AM9A 2N7JA 4IKGA 1SJED 2JVCA 1D5ZC 1ROEA 4PS8A 2C7MB 2PTLA 4OVVA 5LXHA 2LVQA 3JSVA 1J7CA 4LDTD 2MH7A 2DX5B 1J7BA 3W2DA 4KDIC 1YQ3B 5IN7A 1LXDA 1EF5A 1IGCA 3U2SC 4KX6B 1XT9B 4JQWC 1C78A 5AZGA 3ZNID 3PTFC 1ZW7A 3QCAA 4HPMB 3WA0A 3L54A 4JIOU 2QEJC 2I1JA 1HEZE 2BYVE 2WQYB 2O2VA 4GDKA 4XWWA 1SIJA 4MEMA 3PZDA 4US8A 3UIOB 5G5GA 4WJPA 1FNUA 2WXKA 3W1YA 1T3QA 3P42A 3P63A 1UWXA 1FXAA 1KM7A 2QJLA 2L83A 4ANVA 2IDYA 3L17A 1YX5B 2DAJA 2C9WB 4LCDE 3UQAA 4NAWA 1NI2A 1KTKA 2V4LA 2WXOA 3VR8B 2FUG1 2Z8LA 2D5GA 1OQRA 2WXLA 1UELA 3A4RA 1YMHE 2G9HD 1FNVA 3UIPB 1S3SG 1XD3B 4MT5A 4ASWC 1SB3C 5EE9A 1A70A 3TMPB 2MBQA 1JMLA 4HKQA 3TCAA 5E6NA 3P4SB 3V6CB 4ANXA 5AZHA 3DBHI 4TKNA 2FE8A 3AE5B 2K5PA 5E6JA 1UD7A 4PS7A 1C4CA 4WQMA 4K3CA 2KX0A 3T8MA 1DOYA 4MGZE 2MQJA 2WYQA 3HIZA 2JZZA 2NPTB 5BMIA 4BOZB 3LB8C 1ET9A 2W3RA 2LFIA 5D6JB 3ZXRA 4JGHB 2KWCA 3DWMA 2FCSA 1U4AA 2A5UA 2ZEQA 2O2VB 1QQRA 2R2QA 3CF6E 2MRPA 3WAPA 2CU3A 1N62A 1WGHA 3TUOA 3HM3A 4S0RA 3T3NA 3Q14C 3N3KB 2K8HA 1SBBB 1YJIA 1LO5D 3IG3A 1WGDA 2MJ3A 3VTUA 1V9JA 1TJEA 2DBYA 3VUXA 2YVCA 4IM3A 3BYYB 1UBIA 2QHOA 1RFAA 3DHIC 3PV1A 3WANA 1I4XA 4EKUA 3AE7B 4NAMA 1HE8A 3GE8C 2LVPA 4WWMA 2I38A 3K9PB 2IGHA 2NS5A 2MP2A 3ZVVA 4M01A 4AJYB 2KWUB 1HTQA 4ACFA 3ZRCA 1P7FA 3EFCA 3Q3NC 2W54A 1RFKA 2N9EB 1HXYD 1WWTA 1XLNA 3A33B 4XGAB 5D2MB 2N9XA 4AS1A 2WXIA 1L6UA 1WX7A 2PVOD 4M0WB 2HD5B 1F1HA 3L16A 4DHJB 3VFKA 1IGDA 2MLBA 2G45B 4PYUA 2KYWA 3MC8A 4YTMB 4KKJA 3ZJTA 3AI5A 4GSWA 1K8RB 5KHOA 3N30A 2BW2A 2V3SA 3DBRB 3QJZA 5TR5A 2A4ZA 4G50A 3BVGA 3ZLZA 2MW5A 3FILA 2YLMA 2M4NA 1OGWA 2GBRA 3W5VB 2MA9B 4LNIA 3MC9A 3KH0A 2BB5A 1FNWA 2WHIA 5EE0A 1UGJA 1WRDB 2I2YA 1DOXA 4GGQA 4DHZB 4RCOA 3KUDB 2VZKD 2FBWB 1ESFA 3AEGB 1T6BX 1VZ7A 3AEEB 4IM2A 1C4AA 2V3PA 3JSVB 4AQ7A 5JH5C 2J0JA 2GBKA 2DZIA 4B95A 3PO0A 1PUTA 2W55A 1JWMD 2IGGA 3DHHC 2BPSA 3DDCB 3ZDMC 3ZQ4A 1SE4A 4F7ZA 4P1CC 2IO1B 1R4MI 4XDDA 1YNTE 4N59A 1UH6A 4LNFA 3PHXB 2LWPA 2RDBC 2HJ8A 2EMSA 3Q8CA 4W9GA 2KQ4X 2K25A 3AE6B 1PGAA 3NUHB 3PHWB 5JHBA 3UI3A 3NVWA 1ZKHA 3R2IA 1VCBA 1SSNA 1WGKA 4RM8A 4YXDB 4MGKE 4HDQA 2XK5B 2L0FA 1QT9A 1WSPA 2AQ2B 2KO3A 2RPVA 3H9DA 3M63B 3GB1A 3N32A 3T3OA 2GMIC 1GPXA 3I57A 3M95A 4MH0E 4B6WA 4JPSA 1JWAD 3OLMD 2Q5WD 4EZKA 1DOIA 2NBUA 5BMHA 2MBEA 4A20A 3X23A 2VRRB 5HHDG 2BBCA 4A6QA 2KD0A 2LVOA 4DBGA 1EM7A 1OQQA 4NQLB 1EUVB 1R7SA 1XLOA 2KC1A 4ZRKA 1L0XB 1E8XA 4FXCA 1WRIA 3QARA 1KLVA 3UINB 1FPYA 2BYFA 5HG2A 2DAFA 1V8CA 4RM9A 4YSZB 4WWNA 2KANA 2KJHB 1VZ6A 3DBHB 4AJWA 4M8MA 1E7VA 1TT5B 3OJ3A 3Q8FA 2HTHA 4DHZE 1QOFA 3AH7A 3L13A 2JRHA 1LGRA 3SDLC 1D4BA 1TKEA 4ITKA 1XLQA 1JCKB 2NCNA 2LHEA 2HDEA 3FKYA 4DXGA 4C7YA 1DYQA 5AUKA 1T0RC 1UNSA 3TL5A 1HTOA 2BS4B 5G55A 1STEA 2D10A 2O6VA 4IW0A 3B2GA 4MJSA 5KHQA 1CMXB 1E7PB 4II2B 3RMKC 2N1VA 2KQSA 1J19A 1V2YA 2I1KA 1IBXA 3VHTC 4C4VB 3WCQA 1WE6A 4W9CA 1JWSD 3MFGA 1WXVA 2QDFA 5JZEB 3M3JA 4TQ1A 2QMTA 2WDRB 3B0AA 3BVZA 3FC4A 2PJHA 1P98A 1E0ZA 3VDZA 4USAA 3NZSA 3MJWA 4FA6A 4G11A 4KIKA 1N5WA 4B9KA 2DLBA 3R66C 5D3IB 2WXNA 4L2YA 1R4NI 3TEYA 2JX5A 4AOFA 3N9YC 4FJVB 2BF8B 3MP9A 1ENFA 1VRAB 1C3TA 4EFOA 2KDFB 3ECIA 1EWYC 4EZLA 3V6EB 2KN4A 3ZJUA 1T0YA 4MGYE 3QX1A 2OJWA 2PEAA 5FKAC 2HTME 1NI3A 2DYMA 1RM6C 3D32A 2JYEA 5BO4B 2K6QA 2JUOA 2RD0A 2WNMA 2WU2B 3C0RB 1TS5A 2GRIA 2LJIA 1NBFC 4MGIE 2PLPA 2V1YA 2M8SA 5FR6A 1WIAA 1L6VA 1HA5A 3VAWA 3QWZB 4ZYSA 1AWDA 3TEXA 1VDVA 1JQ4A 3DCGA 1PYWD 2JF5A 4W9KA 2M0XA 3IT4B 1D5MC 4MM3B 2KFJA 1ZOYB 1M4VA 3V61A 2LUMA 4GB9A 4FN2A 4XC2A 4B0EA 3BINA 1TS3A 3H7PB 3AE8B 4DHJD 2KXJA 1JRUA 1GUAB 1IPGA 1NENB 1I4RA 4JX1C 1P7EA 2MHJA 2ZJDA 3TJPA 4BAXA 4FULA 5EE1A 1LQBA 1AARA 5CTRC 4IM0A 4RFBA 3ZW3A 4DK5A 3NS1A 2JWZA 4AWJA 2KJ6A 2ZPYA 1PGXA 2LGXA 2FIFA 1I35A 2JPHA 3C19A 2WX1A 2JZPA 2JZ3B 1P0RA 2E3TA 2XN9C 1IP9A 1V5OA 1FM0D 1EF1A 2MJEA 4A55A 4KZCA 1GC6A 4DXAB 3A1QB 4F8CB 4BVUC 3Q69A 4WWPA 4WWOA 1KFYB 1SJHD 4W9IA 2WXFA 1P1AA 4MSQB 4EE2A 3PVLA 1VLBA 1IUEA 2Y5BB 3A4SC 2KVZA 3LXFA 2KTRB 1BXTA 5E6OA 2WXMA 5LNK1 4HVBA 3ZJVA 2MBBB 3DOWA 2OEDA 2DHZA 2JRIB 5HKHA 3DVNV 1Q1OA 2D3AA 2KKCA 5FK9C 1E7UA 4LNOA 3R7QA 3OAWA 3AV8A 1JWBD 3I3TB 1FXTB 4CO7A 2CU1A 2RPQA 3WIMA 2AQ3B 3DBRI 4GN1A 4IDIA 3MTNB 2N9LA 4PS3A 4KGRA 2VH1A 5AEKB 4MH8A 2ZVOA 1I4PA 2WXHA 2XEWA 3QIJA 2K8BA 1FD6A 2M56B 2ZW1A 2IY1B 4FBJB 2GI9A 3PPAA 1CZPA 1OEYA 3EA6A 1YOVB 1WXSA 2Y3AA 4JWSC 1ZDVA 3WAMA 2PIAA 2BTEA 5D94A 3KUZA 2LRWA 2N9KA 4YWGG 4ANWA 4M02A 1MG4A 2K39A 4IWOA 4YL8A 3KVFB 2PE6B 2D3BA 1EWCA 1C79A 4LNKA 3RNBC 1TTNA 2DYOA 1H4RA 2BS2B 5DPRA 3A1QA 3U30A 5BYQA 1WGRA 3AEFB 3ZKJC 4GIVA 3V60A 2RMMA 1TBEA 5CX3A 4ZHPA 3SFEB 4ARIA 1WX9A 2HJ1A 4GDLB 2ICIA 3AECB 3IVFA 2QC8A 1N60A 2INPE 2IBIB 5CHVC 1Y8RC 1WGYA 4J3OD 2KQ7A 3ZYYX 2M1MA 4P16A 1WFYA 2EKEC 3DVNU 2LD9A 4ZHOA 1WE7A 1GJZA 1F0ZA 3AXCA 1ZXHA 3VTWA 3VXWA 2KVRA 4WJOA 4OZAA 3UF8A 3Q3FA 1ZUD2 1GAQB 2KAJA 1Y56A 4A3PA 3M62B 3OWEB 3PRMB 3TSSA 4HKZE 3EC8A 2KFKA 4G3XB 2AWTA 3NZUA 1KF6B 2Y5PA 3O13A 3HHMA 3DQVA 3GZNB 2MBHA 3B9JA 1VD2A 3RNFC 3JW0X 4N9F4 3DPDA 2W3SA 4A8XC 1K52A 4KV2A 5BYRA 3EGRA 3AB5A 1WXQA 1FEHA 1WXMA 4BKSD 5DPSA 3R8BA 2BWES 2LGDA 4RF1A 2X38A 1GB1A 3H8HA 5BMGA 3HRDD 3ZTDA 2FUHB 3O65B 1M94A 3PREA 3NS8A 2LUEA 4XZ4A 1WYGA 1XCQL 2V4IB 4M00A 4TUUA 3ZGZA 4HCPB 2JQRB 1ZE3D 5BYSA 2AL3A 1E10A 1P9DU 5L83A 4DDID 3V05A 3N1XC 1D6EC 5GMVA 3W5UB 3SHQA 3B1LX 2C7NB 4WIPA 3P1MA 4YSYB 1LFDA 4H2AA 1FMAD 1KOTA 3ALBA 1C4PA 5HFYA 4O1NA 4K7UA 2DENB 1BUIC 2G4DB 3A9KA 2CKHB 1SF0A 1I42A 4A9AA 1PQSA 4Q2JA 2J0KA 1MJDA 2INDC 2W82A 2LJ5A 1S1QB 2K3UA 3MHZA 4RNAA 4CQNA 2IGDA 3IAS1 1L0YB 2KHWB 4ZRPA 1EU3A 1NEKB 2AL6A 5IO9A 4G0NB 3P4QB 4PT5A 4FLHA 1L7YA 2ZNVC 3ONSA 3V62A 2WXJA 1MFWA 1XF5L 2IO0B 4XX5A 3SD5A 4HJGE 3S2AA 1LM8B 3ABVB 3KYCD 1V97A 1RYJA 3NVYA 1Z5SB 4NJCA 2N1WA 2V9HA 3DBSA 4NQKE 4EZJA 3SR6A 1YN3A 1WMHB 4IWQA 1WJNA 1PDXA 1N5XA 2LZ6A 2LGYA 3I5JC 4UDUC 4GOCA 3ZO5B 1C9FA 3GZNI 5I4DA 1F9JA 1QOAA 1JWUD 3DBLI 3OJ4B 3ML9A 4W9EA 2J0MA 1Q5WB 3TIXA 3H6NA 1N63A 3AMZA 1C76A 3N1YC 3GOEA 3W1SC 4JE3B 4M8NA 2NTSA 4IG7B 1QILA 1YN4A 1AYFA 1KRHA 1F52A 3I9V1 3A9JA 3JVZX 2KOXA 3E9SA 3BVMA 3VUWA 1TIFA 1JALA 5D7GA 2CHZA 2FIDA 1FFVA 4GLSC 3HUIA 1TGZB 2Z0EB 2BS3B 2C7HA 2KTRA 4HCNB 1K53A 1SGHA 2JXTA 2D3CA 2KDMA 2J7QB 3PT2B 1X1MA 5GXGB 4HRSA 1QKZA 3RI7C 2AYOB 3A9JB 3ZNGC 4FHKA 4LK0M 2L8JA 2IZVB 1E6EB 5H8YE 3RZWC 1T0SC 4HLEA 3AU5A 1ZDXA 2KJRA 1QOGA 5J17A 1RAXA 4XDCA 4I6PA 4QAYA 4WURA 4ZYNA 3U52E 2GBJA 3QQ8B 2B76B 3ZUNA 3WALA 2YEPF 3R2TA 1V1PB 2KLCA 2QIEB 3RNCC 1OEYJ 2QILA 1K51A 4A3OA 3P4PB 1ZPSA 4E3CA 2NBVB 4BOSC 3PRZA 1T5XD 1SXTA 1FIQA 4J6IA 4KSLC 1YJ1A 3IXSA 3HVDA 4DDGD 1SEBD 4HDOA 3VQIA 4L1BA 2DNFA 2H89B 3ZDTA 3RULA 4C80A 3AE2B 2CS4A 1G6JA 1SE3A 3OG5A 3PLUA 1V1PA 3PS6A 1C77A 5JHAA 1CJEA 4LDTB 4E74A 3PLVA 2GBMA 2ZNVB 2FCMA 3DWGC 3VH4B 1NDDA 1V5TA 2WDTB 1YX6B 2JYTA 4KZ0A 1F2RC 4C7ZA 2WXGA 2IY0B 5IOIA 3HM6X 3Q2AC 3KYDD 3KWLA 2G3QB 5LXIB 5C1ZA 2M0AA 1E5WA 4FJYA 1J8CA 1GB4A 3LJ3A 2Z0DB 1UWMA 4LJPB 2LASA 4NJ6A 1R4NB 1WXAA 3U4EG 2O6VD 3IT6B 1T0QC 2LMCA 1HQRD 1BMLC 3ZNHB 2WXPA 3BZDB 2BT6A 3X0WA 4IWPA 2VH2A 4HPPA 2KT7A 3DHGC 5C3JB 4MACA 1N61A 1TS2A 4TQ0A 4C00A 4BBNF 1UZXB 4DWFA 1RLFA 2MP2B 2BYEA 4LJOB 2LI5A 2W9NA 1CK1A 3VRAB 1ZGUB 3C8YA 3RT3B 3SEBA 2LRUA 3VRBB 4IOIE 5CHFA 5C2TB 2KZRA 1UF0A 1BT0A 1EU4A 1L4DB 4WAAA 3PGEA 4K1RB 1AN8A 1ZXIA 2PMVA 4R3DA 4NJ7A 2BQQA 3FAHA 3HVZA 3QC8B 2N7DA 5AZFA 1D3ZA 1WMHA 3AEDB 4WJQA 3CMMB 4FHJA 1WYWB 3AEBB 2J4XA 3RFZB 2LHDA 2KC2A 4GMVA 5CHWA 3NZ3A 3U7ZA 4GDLA 1Z2MA 5AUIA 1KH0A 4C4VA 5HI1A 3TEZA 2CHWA 1KLGD 1CQVA 3QK0A 2G4SA 2KLGA 3DVGX 4C56C 4JLCA 1RWSA 2HE7A 4OZCA 4NNJB 1QZEA 2GLSA 3RNAC 1XO3A 3H1UA 4DXFA 2UWQA 5IA7A 1QLBB 2RR9A 4W9LA 2BKRB 4KDLB 2SEBD 3BWUD 1YJJA 1WJ6A 2CR5A 2ONQA 3J9CA 2NVUI 3ML8A 4RF0A 1MI0A 1SE2A 1JW9D 1XLPA 2IO2B 2LGIA 2EELA 2XBBC 2ZVNA 2WDQB 1GC7A 2ZPNA 2BKFA 2WP9B 5DPWA 1TYGB 4W9DA 2RGFA 2FAZA 4KGSA 3VR9B 1YIWA 3L08A 1WM2A 1VR9A 3A9KB 2KWDA 2XNAC 3AE3B 1UUPA 3KUCB 1WGGA 3EUB2 2J52A 1WY8A 2JU6X 3IBEA 4BZAA 2RDHA 3T9LA 2KFKB 3MC0B 1RRBA 2KDIA 2OHFA 4MDKE 3KW5B 2OOBB 1OTRB 4HXDA 1NVID 2L7RA 3ZRFA 3RCZA 1L4ZB 2REXA 3RUIB 2IO3B 3SFDB 2KDEB 2H88B 1WZ0A 2KWVB 1TS4A 4RGOS 4BKTA 3AULA 2N7EA 2N4FA 3HK0A 4F1SA 1A5RA 3W1SA 1OQYA 1C1YB 2MX2A 4OVZA 3PZ7A 5T8IA 1B9RA 2KX3A 3QA8A 2CJNA 2JXXA 3P4RB 1VZ8A 4NY0A 2KNBA 4I6NB 1F2RI 4I6LB 1ACCA 3IAM1 4K7SA 1KJTA 2DZMA 2JSVX 2K1FA 2K9XA 1MPEA 4YT0B 3VUYA 4A90A 2IJ0A 1E8ZA 1MVKA 4GU2A 2G1EA 1YQBA 3L10B 4KVGB 3FILB 3Q6BA 1N6ZA 1J7AA 3CSFA 4ANUA 1FRRA 2KACA 1UBQA 4HWIB 1FCCC 2V3NA 3MHSD 2PW9A 4AUQC 1WM3A 3Q3JA 2K8CA 4AP4C 2EMTA 3APFA 1QF6A 1HZ5A 1DGJA 2JY6A 2LGSA 5EE3A 3U7DA 3ZTCA 3R7RA 4URKA 1YN5A 4W9HA 5MPOA 4BBNC 3ENEA 1MHXA 4LNNA 4BFRA 3LDZE 1FRDA 1UGMA 3CSTA 1V1OA 3TEWA 4OHJA 3TBLD 4US9A 3BIID 3UGBB 2FCNA 4WJNA 5DPTA 5LLIA 5TSSA 3LYYA 5JXVA 4HK2A 3KLSX 2ZCCA 4CHKA 3CWIA 4BKGA 4KKIA 4TV3A 1ET6A 3AN1A 4CYEA 3QHTA 1V80A 1GOZA 2M17A 3U8ZA 3NJTA 3EHVA 1V6EA 1I4QA 3KQ4A 3BYTB 4L23A 1WZ3A 2WGSA 3CIRB 2MSED 3NVVA 2D11A 3KWVA 2IYDB 2J53A 3AE1B 2QSDA 2L3ZA 2UYZB 4OW0A 4LLGM 2L76A 2WXQA 1WH3A 4JL9A 2NBWB 2L00B 4KIKB 3NRZA 3VTVA 4MSMB 2INCC 3E56A 3GE3C 1V49A 3H7PA 4ZRIA 3L0WB 3ZNZB 1WJ4A 3BK2A 4BKSA 1QOBA 2NMQA 4REZA 3DBLB 4DQOC 2QCZA 1OFFA 2DZJA 5EDSA 1ZP0B 4MM3A 3AE9B 4OZBA 2E6XA 2ASQA 2ZW0A 4S17A 2B3AA 4ZRQA 1NYRA 4EUTA 4RGMA 2RDGA 4IUMB 1TKYA 4IC7B 2KMMA 5IP4D 3MJ5A 3QAQA 1XXGA 2R2OA 2O6VB 4RH6A 2JT4B 2EKIA 2WDVB 2DZKA 1E8YA 1MG8A 4PYZA 2INNE 3PSEB 1FCLA 1XCTL 3RYTA 1I7HA 2CJOA 1L0VB 3GP7A 3NOBA 4HEA1 2MEKA 3APDA 1V81A 4NAWB 2L05A 3B08A 1WJUA 2DYBA 2MJDA 1FO4A 3RNGC 3ZXVA 1HZ6A 2NPTA 3VH3B 2DWQA 3R3MA 1WR6E 1SIFA 3URYA 4WQOB 1AW7A 2FNJB 1H8CA 2J42A 1FXIA 4K7WA 2AX5A 1XEEA 1EO6A 3ETRA 4NPNA 3DVGY 3EFUA 2TSSA 4XE0A 1NYQA 2N0SB 1I4HA 2JWUA 3W9CB 2BWFA 4N6EB 2WS3B 1KLUD 4TMAB 2K22A 2ON8A 5FR3A 3Q3MC 4EOYA 4HJKA 4LTUA 3L4PA 1L5PA 3RNEC 1WR1A 3Q8AA 2PPHA 1GG3A 3P2BA 1TKGA 1WI0A 3IFWB 4XWTA 1JRPA 4PK1A 4II3B 3N1ZC 5DCNA 3AEAB 4E71A 3NHEB 4B0MA 1ISNA 5J2RA 4D2KA 2WXRA 4ZOHC 4MJSB 1XQQA 2LXAA 2Z59B 5H92C 4ZRJA 2ACZB 1E9MA 3RZFA 4MELA 2FCQA 2KTFA 3PZ8A 4ICUA 4RMAA 2ZZPB 5D3DA 3RD2A 4P1BC 2BB6A 4W9JA 2BGFA 4RGNA 2RSUA 1E8WA 1WF9A 4FADA 1MHHE 4RGTA 3Q8EA 4YTPB 4N58A 2MWSB 2KMCA 1Q0WB 2C60A 2WLBA 2C5LC 2K6DB 4EEWA 4FJZA 4K3BA 4KGTA 3B2FA 1WX8A 5C23A 2KMAA 5G5HA 4GXBA 1B1ZA 2OJRA 3VVWB 1IBXB 2AEHA 3Q8BA 3PRPB 2LXCA 4ARCA 4W9FA 1TZOA
chains in the Genus database with same CATH topology
2KO3A 1TZ1A 3WAOA 4KV2A 2HE7A 3K9OB 3H9DA 3M63B 3N32A 3APCA 4HPLB 4NNJB 1QZEA 2GMIC 5J18A 1WXMA 3M95A 4MH0E 3H1UA 4B6WA 4BKSD 5DPSA 2UWQA 5IA7A 2RR9A 2BWES 3JYUA 2KK8A 4W9LA 3SU8X 2D2QA 2LGDA 2BKRB 4KDLB 3OLMD 2MBOA 1E90A 1WJ6A 2CR5A 4EZKA 2NBUA 2MBEA 2NVUI 2FUHB 3ML8A 3ZTDA 4A20A 3X23A 3EECA 2VRRB 2KN5A 2GBNA 2IO2B 3O65B 1M94A 2KD0A 2LUEA 2LVOA 3NS8A 3PREA 4XZ4A 4DBGA 1SE9A 4NQLB 1EUVB 5IAAC 4TUUA 2XBBC 2KC1A 4HCPB 4ZRKA 2ZVNA 1GC7A 1GNUA 1E8XA 2ZPNA 3NY5A 2BKFA 1V86A 4OVUA 5DPWA 2D07B 3QARA 1KLVA 3UINB 2BYFA 4W9DA 2AL3A 2RGFA 2FAZA 1YIWA 3L08A 1WM2A 1P9DU 5L83A 2DAFA 2NR2A 4DDID 4RM9A 3A9KB 4ICVA 5E6PA 2WX0A 4WWNA 5GMVA 2KANA 2KJHB 3SHQA 2PE9A 3B1LX 4AJWA 1P3QU 1J0GA 2XK5A 2C7NB 3KUCB 4M8MA 1E7VA 1WGGA 1LFDA 3OJ3A 1WY8A 3IBEA 2HTHA 3ALBA 4DHZE 1KOTA 3L13A 2JRHA 2CHXA 2KDBA 4K7UA 3SDLC 3T9LA 2DENB 1IYFA 2KFKB 2G4DB 3A9KA 2CKHB 4ZDVA 2ZCBA 1RRBA 2KDIA 3UQBA 4MDKE 1YD8U 5L95C 3KW5B 3AU4A 2OOBB 1OTRB 2NCNA 1I42A 1L2NA 4X57B 3BY4B 4HXDA 2GOWA 2L7RA 1PQSA 3ZRFA 3RCZA 2REXA 3RUIB 2J0KA 2IO3B 2D3GA 5G2NA 4GDKB 3H7SA 3ZIMA 2LJ5A 2KDEB 1S1QB 4K81A 3TL5A 2KHWB 1WZ0A 2KWVB 2L0TA 2MCNB 2WWZA 4KSKC 4BKTA 3AULA 5G55A 2N7EA 2AL6A 2N4FA 4G0NB 2D10A 2N9PC 2O6VA 4IW0A 3HK0A 4F1SA 3IHPC 1A5RA 4P7IA 4MJSA 3W1SA 4FLHA 1L7YA 1OQYA 2ZNVC 1C1YB 3ONSA 2MX2A 3V62A 5KHQA 2KX3A 1CMXB 4II2B 4W9FA 2JVCA 2IO0B 4PS8A 2N1VA 3QA8A 4XX5A 2C7MB 3SD5A 2JXXA 4OVVA 3S2AA 1LM8B 4NY0A 5LXHA 2KQSA 1J19A 2LVQA 3JSVA 4LDTD 2KNBA 1V2YA 2DX5B 2I1KA 3KYCD 4I6NB 3VHTC 4KDIC 4I6LB 1WE6A 4K7SA 1KJTA 2DZMA 1LXDA 4W9CA 1Z5SB 1EF5A 2N1WA 2K1FA 3DBSA 4NQKE 1WXVA 5JZEB 3M3JA 4TQ1A 4EZJA 1XT9B 4JQWC 5AZGA 3ZNID 3PTFC 3VUYA 1ZW7A 3QCAA 3B0AA 2PJHA 4HPMB 1P98A 3WA0A 1WMHB 3L54A 4JIOU 4IWQA 3VDZA 2I1JA 1WJNA 2BYVE 3NZSA 3MJWA 4FA6A 1E8ZA 2O2VA 4G11A 4KIKA 2LZ6A 4GDKA 4GU2A 2LGYA 4MEMA 3PZDA 1YQBA 3L10B 4KVGB 4B9KA 3R66C 4GOCA 3ZO5B 3GZNI 3UIOB 1F9JA 3OJ4B 3DBLI 4W9EA 3ML9A 2J0MA 1Q5WB 1R4NI 3CSFA 4WJPA 4ANUA 3W1YA 1UBQA 4HWIB 4AOFA 3TIXA 3MHSD 3H6NA 4FJVB 1WM3A 4AUQC 3Q3JA 2K8CA 2BF8B 3GOEA 4AP4C 1KM7A 3W1SC 2EMTA 1C3TA 4ANVA 4M8NA 4EFOA 3APFA 4IG7B 2KDFB 3ECIA 3L17A 2JY6A 3U7DA 1YX5B 2DAJA 3ZTCA 2C9WB 4LCDE 3R7RA 4URKA 3UQAA 4W9HA 4NAWA 3V6EB 4BBNC 3A9JA 4EZLA 3ENEA 1NI2A 4BFRA 2V4LA 3JVZX 2KOXA 1T0YA 3LDZE 4MGYE 3VUWA 3QX1A 2PEAA 5D7GA 2CHZA 2FIDA 1UGMA 3CSTA 3A4RA 1UELA 3TBLD 2DYMA 3D32A 1TGZB 3UIPB 1S3SG 2Z0EB 2C7HA 3UGBB 5BO4B 1XD3B 2K6QA 2FCNA 2JUOA 2KTRA 2RD0A 4WJNA 3C0RB 4HCNB 5DPTA 5LLIA 4ASWC 1SGHA 2J7QB 4HK2A 2ZCCA 3PT2B 1X1MA 3TMPB 2MBQA 1NBFC 4MGIE 4CHKA 3TCAA 2V1YA 5E6NA 2M8SA 4BKGA 4TV3A 3V6CB 5FR6A 4ANXA 5AZHA 3DBHI 4TKNA 2AYOB 1WIAA 4CYEA 1UD7A 3QHTA 4PS7A 3A9JB 1V80A 3VAWA 2M17A 3U8ZA 3ZNGC 3QWZB 4FHKA 2L8JA 3EHVA 1V6EA 2IZVB 2KX0A 3T8MA 3DCGA 4MGZE 2JF5A 1WZ3A 1J8CA 4W9KA 2MQJA 2M0XA 2MSED 2WYQA 3RZWC 2D11A 3HIZA 2JZZA 2IYDB 4HLEA 2NPTB 3AU5A 2KFJA 4BOZB 2KJRA 2L3ZA 2UYZB 3V61A 1RAXA 5J17A 5D6JB 4JGHB 4GB9A 2KWCA 4I6PA 2L76A 4FN2A 4XC2A 1WH3A 4ZYNA 2FCSA 3BINA 1U4AA 3H7PB 4JL9A 2NBWB 4DHJD 2KXJA 2A5UA 2L00B 2GBJA 2ZEQA 2O2VB 4KIKB 1JRUA 3QQ8B 1GUAB 1IPGA 3VTVA 2R2QA 3CF6E 2MRPA 4MSMB 2ZJDA 3TJPA 4FULA 3WAPA 3ZUNA 1LQBA 3WALA 1AARA 1V49A 5CTRC 1WGHA 3H7PA 4IM0A 3L0WB 4ZRIA 3ZNZB 3HM3A 1WJ4A 3ZW3A 2KLCA 4BKSA 4DK5A 2JWZA 4AWJA 1OEYJ 2KJ6A 3N3KB 2K8HA 2ZPYA 4A3OA 2DZJA 2LGXA 5EDSA 2FIFA 3IG3A 4E3CA 1WGDA 2NBVB 4BOSC 4MM3A 3VTUA 1I35A 3PRZA 1V9JA 2JPHA 2ASQA 3VUXA 2YVCA 4IM3A 2B3AA 2WX1A 4J6IA 4KSLC 1YJ1A 2JZ3B 1UBIA 1P0RA 2QHOA 1RFAA 4EUTA 1IP9A 1V5OA 3PV1A 3WANA 1EF1A 4KZCA 4DDGD 4IUMB 1GC6A 4DXAB 4EKUA 4IC7B 3A1QB 4F8CB 4BVUC 1HE8A 4HDOA 4WWPA 3VQIA 2LVPA 3QAQA 4WWOA 3ZDTA 2R2OA 3RULA 3K9PB 2O6VB 4W9IA 2NS5A 2MP2A 2CS4A 3ZVVA 1P1AA 1G6JA 2JT4B 2KWUB 4AJYB 4MSQB 3PVLA 3PLUA 2DZKA 3PS6A 2Y5BB 3A4SC 5JHAA 1E8YA 3ZRCA 4LDTB 4E74A 3PLVA 1MG8A 2GBMA 2KTRB 4PYZA 2ZNVB 5E6OA 2FCMA 3PSEB 3VH4B 4HVBA 1NDDA 1V5TA 2MBBB 2WDTB 3DOWA 1YX6B 2DHZA 2JRIB 4KZ0A 3RYTA 5HKHA 3DVNV 1Q1OA 2N9EB 3NOBA 2KKCA 3A33B 2IY0B 1E7UA 3APDA 1V81A 3HM6X 5D2MB 3R7QA 4NAWB 2L05A 2N9XA 3OAWA 3B08A 3KYDD 1WJUA 2DYBA 1WX7A 2G3QB 3I3TB 2HD5B 4M0WB 5C1ZA 5LXIB 1E5WA 1FXTB 3L16A 4FJYA 3VFKA 4DHJB 4CO7A 3LJ3A 2CU1A 2MLBA 2G45B 4PYUA 2Z0DB 4LJPB 2NPTA 2LASA 2RPQA 3VH3B 4NJ6A 3AI5A 4GSWA 3WIMA 1K8RB 1WR6E 3R3MA 5KHOA 1SIFA 3N30A 2V3SA 4WQOB 3DBRI 3QJZA 4GN1A 1WXAA 2FNJB 3MTNB 5TR5A 4PS3A 2A4ZA 2O6VD 1H8CA 5AEKB 4G50A 4K7WA 2ZVOA 3ZLZA 2XEWA 2MW5A 3QIJA 3ZNHB 2K8BA 1EO6A 2YLMA 4NPNA 2M4NA 1OGWA 2IY1B 4FBJB 2GBRA 3PPAA 3DVGY 3X0WA 3EFUA 2MA9B 4IWPA 1OEYA 1WXSA 2BWFA 3KH0A 3WAMA 4TQ0A 1WRDB 4GGQA 4DHZB 5D94A 3KUZA 3KUDB 2LRWA 4BBNF 1UZXB 4ANWA 4DWFA 1RLFA 4EOYA 2K39A 4IWOA 4YL8A 3KVFB 2MP2B 2PE6B 2BYEA 4HJKA 4LJOB 1TTNA 2LI5A 2DYOA 4IM2A 1WR1A 2W9NA 1H4RA 2PPHA 1GG3A 5DPRA 3JSVB 3A1QA 3P2BA 1ZGUB 3RT3B 3U30A 1WI0A 3IFWB 2LRUA 5JH5C 1WGRA 3ZKJC 4GIVA 3V60A 2J0JA 2GBKA 2DZIA 5CHFA 4B95A 1TBEA 4II3B 5CX3A 5DCNA 4E71A 1WX9A 3NHEB 2KZRA 1ISNA 2BPSA 4GDLB 3DDCB 5J2RA 3IVFA 3ZDMC 4MJSB 4F7ZA 1BT0A 2IBIB 5CHVC 2IO1B 1R4MI 1WGYA 1XQQA 1Y8RC 2LXAA 2Z59B 4ZRJA 4WAAA 3PGEA 2KQ7A 1UH6A 4K1RB 2M1MA 3RZFA 1WFYA 2FCQA 2KTFA 4ICUA 4MELA 2EKEC 4RMAA 3DVNU 2LD9A 1WE7A 2ZZPB 3PHXB 4NJ7A 1GJZA 3RD2A 2LWPA 2HJ8A 4W9JA 2BGFA 3QC8B 3AXCA 2N7DA 3VXWA 3VTWA 5AZFA 2KVRA 4WJOA 1D3ZA 1WMHA 2EMSA 2RSUA 4WJQA 3UF8A 3Q3FA 3CMMB 4FHJA 1WYWB 4W9GA 1E8WA 1WF9A 2K25A 4FADA 4A3PA 3M62B 2KC2A 3PRMB 2MWSB 4GMVA 2KMCA 1Q0WB 3PHWB 5JHBA 2C60A 1ZKHA 3EC8A 5CHWA 1VCBA 2C5LC 2K6DB 2KFKA 4G3XB 4GDLA 1Z2MA 2AWTA 4EEWA 4FJZA 3NZUA 1WX8A 5C23A 2KMAA 4RM8A 4GXBA 3HHMA 2OJRA 3VVWB 2CHWA 3DQVA 4MGKE 4HDQA 2XK5B 2AEHA 2MBHA 1VD2A 2LXCA 3PRPB 2L0FA 3QK0A 2G4SA 2KLGA 3DVGX 3JW0X 4N9F4 4JLCA 3DPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KO3 A;  1TZ1 A;  3WAO A;  4KV2 A;  2HE7 A;  3K9O B;  3H9D A;  3M63 B;  3N32 A;  3APC A;  4HPL B;  4NNJ B;  1QZE A;  2GMI C;  5J18 A;  1WXM A;  3M95 A;  4MH0 E;  3H1U A;  4B6W A;  4BKS D;  5DPS A;  2UWQ A;  5IA7 A;  2RR9 A;  2BWE S;  3JYU A;  2KK8 A;  4W9L A;  3SU8 X;  2D2Q A;  2LGD A;  2BKR B;  4KDL B;  3OLM D;  2MBO A;  1E90 A;  1WJ6 A;  2CR5 A;  4EZK A;  2NBU A;  2MBE A;  2NVU I;  2FUH B;  3ML8 A;  3ZTD A;  4A20 A;  3X23 A;  3EEC A;  2VRR B;  2KN5 A;  2GBN A;  2IO2 B;  3O65 B;  1M94 A;  2KD0 A;  2LUE A;  2LVO A;  3NS8 A;  3PRE A;  4XZ4 A;  4DBG A;  1SE9 A;  4NQL B;  1EUV B;  5IAA C;  4TUU A;  2XBB C;  2KC1 A;  4HCP B;  4ZRK A;  2ZVN A;  1GC7 A;  1GNU A;  1E8X A;  2ZPN A;  3NY5 A;  2BKF A;  1V86 A;  4OVU A;  5DPW A;  2D07 B;  3QAR A;  1KLV A;  3UIN B;  2BYF A;  4W9D A;  2AL3 A;  2RGF A;  2FAZ A;  1YIW A;  3L08 A;  1WM2 A;  1P9D U;  5L83 A;  2DAF A;  2NR2 A;  4DDI D;  4RM9 A;  3A9K B;  4ICV A;  5E6P A;  2WX0 A;  4WWN A;  5GMV A;  2KAN A;  2KJH B;  3SHQ A;  2PE9 A;  3B1L X;  4AJW A;  1P3Q U;  1J0G A;  2XK5 A;  2C7N B;  3KUC B;  4M8M A;  1E7V A;  1WGG A;  1LFD A;  3OJ3 A;  1WY8 A;  3IBE A;  2HTH A;  3ALB A;  4DHZ E;  1KOT A;  3L13 A;  2JRH A;  2CHX A;  2KDB A;  4K7U A;  3SDL C;  3T9L A;  2DEN B;  1IYF A;  2KFK B;  2G4D B;  3A9K A;  2CKH B;  4ZDV A;  2ZCB A;  1RRB A;  2KDI A;  3UQB A;  4MDK E;  1YD8 U;  5L95 C;  3KW5 B;  3AU4 A;  2OOB B;  1OTR B;  2NCN A;  1I42 A;  1L2N A;  4X57 B;  3BY4 B;  4HXD A;  2GOW A;  2L7R A;  1PQS A;  3ZRF A;  3RCZ A;  2REX A;  3RUI B;  2J0K A;  2IO3 B;  2D3G A;  5G2N A;  4GDK B;  3H7S A;  3ZIM A;  2LJ5 A;  2KDE B;  1S1Q B;  4K81 A;  3TL5 A;  2KHW B;  1WZ0 A;  2KWV B;  2L0T A;  2MCN B;  2WWZ A;  4KSK C;  4BKT A;  3AUL A;  5G55 A;  2N7E A;  2AL6 A;  2N4F A;  4G0N B;  2D10 A;  2N9P C;  2O6V A;  4IW0 A;  3HK0 A;  4F1S A;  3IHP C;  1A5R A;  4P7I A;  4MJS A;  3W1S A;  4FLH A;  1L7Y A;  1OQY A;  2ZNV C;  1C1Y B;  3ONS A;  2MX2 A;  3V62 A;  5KHQ A;  2KX3 A;  1CMX B;  4II2 B;  4W9F A;  2JVC A;  2IO0 B;  4PS8 A;  2N1V A;  3QA8 A;  4XX5 A;  2C7M B;  3SD5 A;  2JXX A;  4OVV A;  3S2A A;  1LM8 B;  4NY0 A;  5LXH A;  2KQS A;  1J19 A;  2LVQ A;  3JSV A;  4LDT D;  2KNB A;  1V2Y A;  2DX5 B;  2I1K A;  3KYC D;  4I6N B;  3VHT C;  4KDI C;  4I6L B;  1WE6 A;  4K7S A;  1KJT A;  2DZM A;  1LXD A;  4W9C A;  1Z5S B;  1EF5 A;  2N1W A;  2K1F A;  3DBS A;  4NQK E;  1WXV A;  5JZE B;  3M3J A;  4TQ1 A;  4EZJ A;  1XT9 B;  4JQW C;  5AZG A;  3ZNI D;  3PTF C;  3VUY A;  1ZW7 A;  3QCA A;  3B0A A;  2PJH A;  4HPM B;  1P98 A;  3WA0 A;  1WMH B;  3L54 A;  4JIO U;  4IWQ A;  3VDZ A;  2I1J A;  1WJN A;  2BYV E;  3NZS A;  3MJW A;  4FA6 A;  1E8Z A;  2O2V A;  4G11 A;  4KIK A;  2LZ6 A;  4GDK A;  4GU2 A;  2LGY A;  4MEM A;  3PZD A;  1YQB A;  3L10 B;  4KVG B;  4B9K A;  3R66 C;  4GOC A;  3ZO5 B;  3GZN I;  3UIO B;  1F9J A;  3OJ4 B;  3DBL I;  4W9E A;  3ML9 A;  2J0M A;  1Q5W B;  1R4N I;  3CSF A;  4WJP A;  4ANU A;  3W1Y A;  1UBQ A;  4HWI B;  4AOF A;  3TIX A;  3MHS D;  3H6N A;  4FJV B;  1WM3 A;  4AUQ C;  3Q3J A;  2K8C A;  2BF8 B;  3GOE A;  4AP4 C;  1KM7 A;  3W1S C;  2EMT A;  1C3T A;  4ANV A;  4M8N A;  4EFO A;  3APF A;  4IG7 B;  2KDF B;  3ECI A;  3L17 A;  2JY6 A;  3U7D A;  1YX5 B;  2DAJ A;  3ZTC A;  2C9W B;  4LCD E;  3R7R A;  4URK A;  3UQA A;  4W9H A;  4NAW A;  3V6E B;  4BBN C;  3A9J A;  4EZL A;  3ENE A;  1NI2 A;  4BFR A;  2V4L A;  3JVZ X;  2KOX A;  1T0Y A;  3LDZ E;  4MGY E;  3VUW A;  3QX1 A;  2PEA A;  5D7G A;  2CHZ A;  2FID A;  1UGM A;  3CST A;  3A4R A;  1UEL A;  3TBL D;  2DYM A;  3D32 A;  1TGZ B;  3UIP B;  1S3S G;  2Z0E B;  2C7H A;  3UGB B;  5BO4 B;  1XD3 B;  2K6Q A;  2FCN A;  2JUO A;  2KTR A;  2RD0 A;  4WJN A;  3C0R B;  4HCN B;  5DPT A;  5LLI A;  4ASW C;  1SGH A;  2J7Q B;  4HK2 A;  2ZCC A;  3PT2 B;  1X1M A;  3TMP B;  2MBQ A;  1NBF C;  4MGI E;  4CHK A;  3TCA A;  2V1Y A;  5E6N A;  2M8S A;  4BKG A;  4TV3 A;  3V6C B;  5FR6 A;  4ANX A;  5AZH A;  3DBH I;  4TKN A;  2AYO B;  1WIA A;  4CYE A;  1UD7 A;  3QHT A;  4PS7 A;  3A9J B;  1V80 A;  3VAW A;  2M17 A;  3U8Z A;  3ZNG C;  3QWZ B;  4FHK A;  2L8J A;  3EHV A;  1V6E A;  2IZV B;  2KX0 A;  3T8M A;  3DCG A;  4MGZ E;  2JF5 A;  1WZ3 A;  1J8C A;  4W9K A;  2MQJ A;  2M0X A;  2MSE D;  2WYQ A;  3RZW C;  2D11 A;  3HIZ A;  2JZZ A;  2IYD B;  4HLE A;  2NPT B;  3AU5 A;  2KFJ A;  4BOZ B;  2KJR A;  2L3Z A;  2UYZ B;  3V61 A;  1RAX A;  5J17 A;  5D6J B;  4JGH B;  4GB9 A;  2KWC A;  4I6P A;  2L76 A;  4FN2 A;  4XC2 A;  1WH3 A;  4ZYN A;  2FCS A;  3BIN A;  1U4A A;  3H7P B;  4JL9 A;  2NBW B;  4DHJ D;  2KXJ A;  2A5U A;  2L00 B;  2GBJ A;  2ZEQ A;  2O2V B;  4KIK B;  1JRU A;  3QQ8 B;  1GUA B;  1IPG A;  3VTV A;  2R2Q A;  3CF6 E;  2MRP A;  4MSM B;  2ZJD A;  3TJP A;  4FUL A;  3WAP A;  3ZUN A;  1LQB A;  3WAL A;  1AAR A;  1V49 A;  5CTR C;  1WGH A;  3H7P A;  4IM0 A;  3L0W B;  4ZRI A;  3ZNZ B;  3HM3 A;  1WJ4 A;  3ZW3 A;  2KLC A;  4BKS A;  4DK5 A;  2JWZ A;  4AWJ A;  1OEY J;  2KJ6 A;  3N3K B;  2K8H A;  2ZPY A;  4A3O A;  2DZJ A;  2LGX A;  5EDS A;  2FIF A;  3IG3 A;  4E3C A;  1WGD A;  2NBV B;  4BOS C;  4MM3 A;  3VTU A;  1I35 A;  3PRZ A;  1V9J A;  2JPH A;  2ASQ A;  3VUX A;  2YVC A;  4IM3 A;  2B3A A;  2WX1 A;  4J6I A;  4KSL C;  1YJ1 A;  2JZ3 B;  1UBI A;  1P0R A;  2QHO A;  1RFA A;  4EUT A;  1IP9 A;  1V5O A;  3PV1 A;  3WAN A;  1EF1 A;  4KZC A;  4DDG D;  4IUM B;  1GC6 A;  4DXA B;  4EKU A;  4IC7 B;  3A1Q B;  4F8C B;  4BVU C;  1HE8 A;  4HDO A;  4WWP A;  3VQI A;  2LVP A;  3QAQ A;  4WWO A;  3ZDT A;  2R2O A;  3RUL A;  3K9P B;  2O6V B;  4W9I A;  2NS5 A;  2MP2 A;  2CS4 A;  3ZVV A;  1P1A A;  1G6J A;  2JT4 B;  2KWU B;  4AJY B;  4MSQ B;  3PVL A;  3PLU A;  2DZK A;  3PS6 A;  2Y5B B;  3A4S C;  5JHA A;  1E8Y A;  3ZRC A;  4LDT B;  4E74 A;  3PLV A;  1MG8 A;  2GBM A;  2KTR B;  4PYZ A;  2ZNV B;  5E6O A;  2FCM A;  3PSE B;  3VH4 B;  4HVB A;  1NDD A;  1V5T A;  2MBB B;  2WDT B;  3DOW A;  1YX6 B;  2DHZ A;  2JRI B;  4KZ0 A;  3RYT A;  5HKH A;  3DVN V;  1Q1O A;  2N9E B;  3NOB A;  2KKC A;  3A33 B;  2IY0 B;  1E7U A;  3APD A;  1V81 A;  3HM6 X;  5D2M B;  3R7Q A;  4NAW B;  2L05 A;  2N9X A;  3OAW A;  3B08 A;  3KYD D;  1WJU A;  2DYB A;  1WX7 A;  2G3Q B;  3I3T B;  2HD5 B;  4M0W B;  5C1Z A;  5LXI B;  1E5W A;  1FXT B;  3L16 A;  4FJY A;  3VFK A;  4DHJ B;  4CO7 A;  3LJ3 A;  2CU1 A;  2MLB A;  2G45 B;  4PYU A;  2Z0D B;  4LJP B;  2NPT A;  2LAS A;  2RPQ A;  3VH3 B;  4NJ6 A;  3AI5 A;  4GSW A;  3WIM A;  1K8R B;  1WR6 E;  3R3M A;  5KHO A;  1SIF A;  3N30 A;  2V3S A;  4WQO B;  3DBR I;  3QJZ A;  4GN1 A;  1WXA A;  2FNJ B;  3MTN B;  5TR5 A;  4PS3 A;  2A4Z A;  2O6V D;  1H8C A;  5AEK B;  4G50 A;  4K7W A;  2ZVO A;  3ZLZ A;  2XEW A;  2MW5 A;  3QIJ A;  3ZNH B;  2K8B A;  1EO6 A;  2YLM A;  4NPN A;  2M4N A;  1OGW A;  2IY1 B;  4FBJ B;  2GBR A;  3PPA A;  3DVG Y;  3X0W A;  3EFU A;  2MA9 B;  4IWP A;  1OEY A;  1WXS A;  2BWF A;  3KH0 A;  3WAM A;  4TQ0 A;  1WRD B;  4GGQ A;  4DHZ B;  5D94 A;  3KUZ A;  3KUD B;  2LRW A;  4BBN F;  1UZX B;  4ANW A;  4DWF A;  1RLF A;  4EOY A;  2K39 A;  4IWO A;  4YL8 A;  3KVF B;  2MP2 B;  2PE6 B;  2BYE A;  4HJK A;  4LJO B;  1TTN A;  2LI5 A;  2DYO A;  4IM2 A;  1WR1 A;  2W9N A;  1H4R A;  2PPH A;  1GG3 A;  5DPR A;  3JSV B;  3A1Q A;  3P2B A;  1ZGU B;  3RT3 B;  3U30 A;  1WI0 A;  3IFW B;  2LRU A;  5JH5 C;  1WGR A;  3ZKJ C;  4GIV A;  3V60 A;  2J0J A;  2GBK A;  2DZI A;  5CHF A;  4B95 A;  1TBE A;  4II3 B;  5CX3 A;  5DCN A;  4E71 A;  1WX9 A;  3NHE B;  2KZR A;  1ISN A;  2BPS A;  4GDL B;  3DDC B;  5J2R A;  3IVF A;  3ZDM C;  4MJS B;  4F7Z A;  1BT0 A;  2IBI B;  5CHV C;  2IO1 B;  1R4M I;  1WGY A;  1XQQ A;  1Y8R C;  2LXA A;  2Z59 B;  4ZRJ A;  4WAA A;  3PGE A;  2KQ7 A;  1UH6 A;  4K1R B;  2M1M A;  3RZF A;  1WFY A;  2FCQ A;  2KTF A;  4ICU A;  4MEL A;  2EKE C;  4RMA A;  3DVN U;  2LD9 A;  1WE7 A;  2ZZP B;  3PHX B;  4NJ7 A;  1GJZ A;  3RD2 A;  2LWP A;  2HJ8 A;  4W9J A;  2BGF A;  3QC8 B;  3AXC A;  2N7D A;  3VXW A;  3VTW A;  5AZF A;  2KVR A;  4WJO A;  1D3Z A;  1WMH A;  2EMS A;  2RSU A;  4WJQ A;  3UF8 A;  3Q3F A;  3CMM B;  4FHJ A;  1WYW B;  4W9G A;  1E8W A;  1WF9 A;  2K25 A;  4FAD A;  4A3P A;  3M62 B;  2KC2 A;  3PRM B;  2MWS B;  4GMV A;  2KMC A;  1Q0W B;  3PHW B;  5JHB A;  2C60 A;  1ZKH A;  3EC8 A;  5CHW A;  1VCB A;  2C5L C;  2K6D B;  2KFK A;  4G3X B;  4GDL A;  1Z2M A;  2AWT A;  4EEW A;  4FJZ A;  3NZU A;  1WX8 A;  5C23 A;  2KMA A;  4RM8 A;  4GXB A;  3HHM A;  2OJR A;  3VVW B;  2CHW A;  3DQV A;  4MGK E;  4HDQ A;  2XK5 B;  2AEH A;  2MBH A;  1VD2 A;  2LXC A;  3PRP B;  2L0F A;  3QK0 A;  2G4S A;  2KLG A;  3DVG X;  3JW0 X;  4N9F 4;  4JLC A;  3DPD A; 
#chains in the Genus database with same CATH topology
 3WAO A;  1TZ1 A;  4JWU C;  3K9O B;  4YTN B;  3APC A;  4HPL B;  2GB1 A;  2WU5 B;  5J18 A;  1D5X C;  3JYU A;  2KK8 A;  3GS2 A;  2D2Q A;  3SU8 X;  2MBO A;  1E90 A;  4YSX B;  1I4G A;  3NG0 A;  2L52 A;  3NVZ A;  2V0G A;  3EEC A;  2KN5 A;  1R4M B;  2GBN A;  4P6V F;  1SE9 A;  4TSS A;  3RN9 C;  5IAA C;  1GNU A;  3NY5 A;  2BYT A;  1YQ4 B;  1V86 A;  4HRO A;  4OVU A;  2D07 B;  2NTT A;  2NR2 A;  4ICV A;  5E6P A;  2WX0 A;  3BK1 A;  2L1A A;  2PE9 A;  1PFD A;  1TY2 A;  3I63 C;  1J0G A;  1P3Q U;  2K0P A;  3V3X A;  2XK5 A;  1F77 A;  4M0W A;  4WH4 A;  1K50 A;  2CHX A;  2KDB A;  4XYC A;  2X8X X;  4WAF A;  1IYF A;  3Q3O C;  2AQ1 B;  2LEK A;  4ZDV A;  2PVG C;  2ZCB A;  3AE4 B;  3UQB A;  2SAK A;  3N20 C;  1YD8 U;  2L32 A;  5L95 C;  3AU4 A;  2BVC A;  1L2N A;  5IKC M;  4X57 B;  3BY4 B;  1VJK A;  1JRO A;  2GOW A;  2D3G A;  2UU7 A;  5G2N A;  2IPK D;  4GDK B;  3H7S A;  3ZIM A;  2YEP B;  4K81 A;  4NZL B;  2PKO A;  1Q10 A;  2R61 A;  2MCN B;  2L0T A;  2WWZ A;  4KSK C;  1PGB A;  2N9P C;  1TY0 A;  2Y5C A;  3IHP C;  3RPF C;  4P7I A;  2M19 A;  1FFU A;  2VZK B;  3AM9 A;  2N7J A;  4IKG A;  1SJE D;  2JVC A;  1D5Z C;  1ROE A;  4PS8 A;  2C7M B;  2PTL A;  4OVV A;  5LXH A;  2LVQ A;  3JSV A;  1J7C A;  4LDT D;  2MH7 A;  2DX5 B;  1J7B A;  3W2D A;  4KDI C;  1YQ3 B;  5IN7 A;  1LXD A;  1EF5 A;  1IGC A;  3U2S C;  4KX6 B;  1XT9 B;  4JQW C;  1C78 A;  5AZG A;  3ZNI D;  3PTF C;  1ZW7 A;  3QCA A;  4HPM B;  3WA0 A;  3L54 A;  4JIO U;  2QEJ C;  2I1J A;  1HEZ E;  2BYV E;  2WQY B;  2O2V A;  4GDK A;  4XWW A;  1SIJ A;  4MEM A;  3PZD A;  4US8 A;  3UIO B;  5G5G A;  4WJP A;  1FNU A;  2WXK A;  3W1Y A;  1T3Q A;  3P42 A;  3P63 A;  1UWX A;  1FXA A;  1KM7 A;  2QJL A;  2L83 A;  4ANV A;  2IDY A;  3L17 A;  1YX5 B;  2DAJ A;  2C9W B;  4LCD E;  3UQA A;  4NAW A;  1NI2 A;  1KTK A;  2V4L A;  2WXO A;  3VR8 B;  2FUG 1;  2Z8L A;  2D5G A;  1OQR A;  2WXL A;  1UEL A;  3A4R A;  1YMH E;  2G9H D;  1FNV A;  3UIP B;  1S3S G;  1XD3 B;  4MT5 A;  4ASW C;  1SB3 C;  5EE9 A;  1A70 A;  3TMP B;  2MBQ A;  1JML A;  4HKQ A;  3TCA A;  5E6N A;  3P4S B;  3V6C B;  4ANX A;  5AZH A;  3DBH I;  4TKN A;  2FE8 A;  3AE5 B;  2K5P A;  5E6J A;  1UD7 A;  4PS7 A;  1C4C A;  4WQM A;  4K3C A;  2KX0 A;  3T8M A;  1DOY A;  4MGZ E;  2MQJ A;  2WYQ A;  3HIZ A;  2JZZ A;  2NPT B;  5BMI A;  4BOZ B;  3LB8 C;  1ET9 A;  2W3R A;  2LFI A;  5D6J B;  3ZXR A;  4JGH B;  2KWC A;  3DWM A;  2FCS A;  1U4A A;  2A5U A;  2ZEQ A;  2O2V B;  1QQR A;  2R2Q A;  3CF6 E;  2MRP A;  3WAP A;  2CU3 A;  1N62 A;  1WGH A;  3TUO A;  3HM3 A;  4S0R A;  3T3N A;  3Q14 C;  3N3K B;  2K8H A;  1SBB B;  1YJI A;  1LO5 D;  3IG3 A;  1WGD A;  2MJ3 A;  3VTU A;  1V9J A;  1TJE A;  2DBY A;  3VUX A;  2YVC A;  4IM3 A;  3BYY B;  1UBI A;  2QHO A;  1RFA A;  3DHI C;  3PV1 A;  3WAN A;  1I4X A;  4EKU A;  3AE7 B;  4NAM A;  1HE8 A;  3GE8 C;  2LVP A;  4WWM A;  2I38 A;  3K9P B;  2IGH A;  2NS5 A;  2MP2 A;  3ZVV A;  4M01 A;  4AJY B;  2KWU B;  1HTQ A;  4ACF A;  3ZRC A;  1P7F A;  3EFC A;  3Q3N C;  2W54 A;  1RFK A;  2N9E B;  1HXY D;  1WWT A;  1XLN A;  3A33 B;  4XGA B;  5D2M B;  2N9X A;  4AS1 A;  2WXI A;  1L6U A;  1WX7 A;  2PVO D;  4M0W B;  2HD5 B;  1F1H A;  3L16 A;  4DHJ B;  3VFK A;  1IGD A;  2MLB A;  2G45 B;  4PYU A;  2KYW A;  3MC8 A;  4YTM B;  4KKJ A;  3ZJT A;  3AI5 A;  4GSW A;  1K8R B;  5KHO A;  3N30 A;  2BW2 A;  2V3S A;  3DBR B;  3QJZ A;  5TR5 A;  2A4Z A;  4G50 A;  3BVG A;  3ZLZ A;  2MW5 A;  3FIL A;  2YLM A;  2M4N A;  1OGW A;  2GBR A;  3W5V B;  2MA9 B;  4LNI A;  3MC9 A;  3KH0 A;  2BB5 A;  1FNW A;  2WHI A;  5EE0 A;  1UGJ A;  1WRD B;  2I2Y A;  1DOX A;  4GGQ A;  4DHZ B;  4RCO A;  3KUD B;  2VZK D;  2FBW B;  1ESF A;  3AEG B;  1T6B X;  1VZ7 A;  3AEE B;  4IM2 A;  1C4A A;  2V3P A;  3JSV B;  4AQ7 A;  5JH5 C;  2J0J A;  2GBK A;  2DZI A;  4B95 A;  3PO0 A;  1PUT A;  2W55 A;  1JWM D;  2IGG A;  3DHH C;  2BPS A;  3DDC B;  3ZDM C;  3ZQ4 A;  1SE4 A;  4F7Z A;  4P1C C;  2IO1 B;  1R4M I;  4XDD A;  1YNT E;  4N59 A;  1UH6 A;  4LNF A;  3PHX B;  2LWP A;  2RDB C;  2HJ8 A;  2EMS A;  3Q8C A;  4W9G A;  2KQ4 X;  2K25 A;  3AE6 B;  1PGA A;  3NUH B;  3PHW B;  5JHB A;  3UI3 A;  3NVW A;  1ZKH A;  3R2I A;  1VCB A;  1SSN A;  1WGK A;  4RM8 A;  4YXD B;  4MGK E;  4HDQ A;  2XK5 B;  2L0F A;  1QT9 A;  1WSP A;  2AQ2 B;  2KO3 A;  2RPV A;  3H9D A;  3M63 B;  3GB1 A;  3N32 A;  3T3O A;  2GMI C;  1GPX A;  3I57 A;  3M95 A;  4MH0 E;  4B6W A;  4JPS A;  1JWA D;  3OLM D;  2Q5W D;  4EZK A;  1DOI A;  2NBU A;  5BMH A;  2MBE A;  4A20 A;  3X23 A;  2VRR B;  5HHD G;  2BBC A;  4A6Q A;  2KD0 A;  2LVO A;  4DBG A;  1EM7 A;  1OQQ A;  4NQL B;  1EUV B;  1R7S A;  1XLO A;  2KC1 A;  4ZRK A;  1L0X B;  1E8X A;  4FXC A;  1WRI A;  3QAR A;  1KLV A;  3UIN B;  1FPY A;  2BYF A;  5HG2 A;  2DAF A;  1V8C A;  4RM9 A;  4YSZ B;  4WWN A;  2KAN A;  2KJH B;  1VZ6 A;  3DBH B;  4AJW A;  4M8M A;  1E7V A;  1TT5 B;  3OJ3 A;  3Q8F A;  2HTH A;  4DHZ E;  1QOF A;  3AH7 A;  3L13 A;  2JRH A;  1LGR A;  3SDL C;  1D4B A;  1TKE A;  4ITK A;  1XLQ A;  1JCK B;  2NCN A;  2LHE A;  2HDE A;  3FKY A;  4DXG A;  4C7Y A;  1DYQ A;  5AUK A;  1T0R C;  1UNS A;  3TL5 A;  1HTO A;  2BS4 B;  5G55 A;  1STE A;  2D10 A;  2O6V A;  4IW0 A;  3B2G A;  4MJS A;  5KHQ A;  1CMX B;  1E7P B;  4II2 B;  3RMK C;  2N1V A;  2KQS A;  1J19 A;  1V2Y A;  2I1K A;  1IBX A;  3VHT C;  4C4V B;  3WCQ A;  1WE6 A;  4W9C A;  1JWS D;  3MFG A;  1WXV A;  2QDF A;  5JZE B;  3M3J A;  4TQ1 A;  2QMT A;  2WDR B;  3B0A A;  3BVZ A;  3FC4 A;  2PJH A;  1P98 A;  1E0Z A;  3VDZ A;  4USA A;  3NZS A;  3MJW A;  4FA6 A;  4G11 A;  4KIK A;  1N5W A;  4B9K A;  2DLB A;  3R66 C;  5D3I B;  2WXN A;  4L2Y A;  1R4N I;  3TEY A;  2JX5 A;  4AOF A;  3N9Y C;  4FJV B;  2BF8 B;  3MP9 A;  1ENF A;  1VRA B;  1C3T A;  4EFO A;  2KDF B;  3ECI A;  1EWY C;  4EZL A;  3V6E B;  2KN4 A;  3ZJU A;  1T0Y A;  4MGY E;  3QX1 A;  2OJW A;  2PEA A;  5FKA C;  2HTM E;  1NI3 A;  2DYM A;  1RM6 C;  3D32 A;  2JYE A;  5BO4 B;  2K6Q A;  2JUO A;  2RD0 A;  2WNM A;  2WU2 B;  3C0R B;  1TS5 A;  2GRI A;  2LJI A;  1NBF C;  4MGI E;  2PLP A;  2V1Y A;  2M8S A;  5FR6 A;  1WIA A;  1L6V A;  1HA5 A;  3VAW A;  3QWZ B;  4ZYS A;  1AWD A;  3TEX A;  1VDV A;  1JQ4 A;  3DCG A;  1PYW D;  2JF5 A;  4W9K A;  2M0X A;  3IT4 B;  1D5M C;  4MM3 B;  2KFJ A;  1ZOY B;  1M4V A;  3V61 A;  2LUM A;  4GB9 A;  4FN2 A;  4XC2 A;  4B0E A;  3BIN A;  1TS3 A;  3H7P B;  3AE8 B;  4DHJ D;  2KXJ A;  1JRU A;  1GUA B;  1IPG A;  1NEN B;  1I4R A;  4JX1 C;  1P7E A;  2MHJ A;  2ZJD A;  3TJP A;  4BAX A;  4FUL A;  5EE1 A;  1LQB A;  1AAR A;  5CTR C;  4IM0 A;  4RFB A;  3ZW3 A;  4DK5 A;  3NS1 A;  2JWZ A;  4AWJ A;  2KJ6 A;  2ZPY A;  1PGX A;  2LGX A;  2FIF A;  1I35 A;  2JPH A;  3C19 A;  2WX1 A;  2JZP A;  2JZ3 B;  1P0R A;  2E3T A;  2XN9 C;  1IP9 A;  1V5O A;  1FM0 D;  1EF1 A;  2MJE A;  4A55 A;  4KZC A;  1GC6 A;  4DXA B;  3A1Q B;  4F8C B;  4BVU C;  3Q69 A;  4WWP A;  4WWO A;  1KFY B;  1SJH D;  4W9I A;  2WXF A;  1P1A A;  4MSQ B;  4EE2 A;  3PVL A;  1VLB A;  1IUE A;  2Y5B B;  3A4S C;  2KVZ A;  3LXF A;  2KTR B;  1BXT A;  5E6O A;  2WXM A;  5LNK 1;  4HVB A;  3ZJV A;  2MBB B;  3DOW A;  2OED A;  2DHZ A;  2JRI B;  5HKH A;  3DVN V;  1Q1O A;  2D3A A;  2KKC A;  5FK9 C;  1E7U A;  4LNO A;  3R7Q A;  3OAW A;  3AV8 A;  1JWB D;  3I3T B;  1FXT B;  4CO7 A;  2CU1 A;  2RPQ A;  3WIM A;  2AQ3 B;  3DBR I;  4GN1 A;  4IDI A;  3MTN B;  2N9L A;  4PS3 A;  4KGR A;  2VH1 A;  5AEK B;  4MH8 A;  2ZVO A;  1I4P A;  2WXH A;  2XEW A;  3QIJ A;  2K8B A;  1FD6 A;  2M56 B;  2ZW1 A;  2IY1 B;  4FBJ B;  2GI9 A;  3PPA A;  1CZP A;  1OEY A;  3EA6 A;  1YOV B;  1WXS A;  2Y3A A;  4JWS C;  1ZDV A;  3WAM A;  2PIA A;  2BTE A;  5D94 A;  3KUZ A;  2LRW A;  2N9K A;  4YWG G;  4ANW A;  4M02 A;  1MG4 A;  2K39 A;  4IWO A;  4YL8 A;  3KVF B;  2PE6 B;  2D3B A;  1EWC A;  1C79 A;  4LNK A;  3RNB C;  1TTN A;  2DYO A;  1H4R A;  2BS2 B;  5DPR A;  3A1Q A;  3U30 A;  5BYQ A;  1WGR A;  3AEF B;  3ZKJ C;  4GIV A;  3V60 A;  2RMM A;  1TBE A;  5CX3 A;  4ZHP A;  3SFE B;  4ARI A;  1WX9 A;  2HJ1 A;  4GDL B;  2ICI A;  3AEC B;  3IVF A;  2QC8 A;  1N60 A;  2INP E;  2IBI B;  5CHV C;  1Y8R C;  1WGY A;  4J3O D;  2KQ7 A;  3ZYY X;  2M1M A;  4P16 A;  1WFY A;  2EKE C;  3DVN U;  2LD9 A;  4ZHO A;  1WE7 A;  1GJZ A;  1F0Z A;  3AXC A;  1ZXH A;  3VTW A;  3VXW A;  2KVR A;  4WJO A;  4OZA A;  3UF8 A;  3Q3F A;  1ZUD 2;  1GAQ B;  2KAJ A;  1Y56 A;  4A3P A;  3M62 B;  3OWE B;  3PRM B;  3TSS A;  4HKZ E;  3EC8 A;  2KFK A;  4G3X B;  2AWT A;  3NZU A;  1KF6 B;  2Y5P A;  3O13 A;  3HHM A;  3DQV A;  3GZN B;  2MBH A;  3B9J A;  1VD2 A;  3RNF C;  3JW0 X;  4N9F 4;  3DPD A;  2W3S A;  4A8X C;  1K52 A;  4KV2 A;  5BYR A;  3EGR A;  3AB5 A;  1WXQ A;  1FEH A;  1WXM A;  4BKS D;  5DPS A;  3R8B A;  2BWE S;  2LGD A;  4RF1 A;  2X38 A;  1GB1 A;  3H8H A;  5BMG A;  3HRD D;  3ZTD A;  2FUH B;  3O65 B;  1M94 A;  3PRE A;  3NS8 A;  2LUE A;  4XZ4 A;  1WYG A;  1XCQ L;  2V4I B;  4M00 A;  4TUU A;  3ZGZ A;  4HCP B;  2JQR B;  1ZE3 D;  5BYS A;  2AL3 A;  1E10 A;  1P9D U;  5L83 A;  4DDI D;  3V05 A;  3N1X C;  1D6E C;  5GMV A;  3W5U B;  3SHQ A;  3B1L X;  2C7N B;  4WIP A;  3P1M A;  4YSY B;  1LFD A;  4H2A A;  1FMA D;  1KOT A;  3ALB A;  1C4P A;  5HFY A;  4O1N A;  4K7U A;  2DEN B;  1BUI C;  2G4D B;  3A9K A;  2CKH B;  1SF0 A;  1I42 A;  4A9A A;  1PQS A;  4Q2J A;  2J0K A;  1MJD A;  2IND C;  2W82 A;  2LJ5 A;  1S1Q B;  2K3U A;  3MHZ A;  4RNA A;  4CQN A;  2IGD A;  3IAS 1;  1L0Y B;  2KHW B;  4ZRP A;  1EU3 A;  1NEK B;  2AL6 A;  5IO9 A;  4G0N B;  3P4Q B;  4PT5 A;  4FLH A;  1L7Y A;  2ZNV C;  3ONS A;  3V62 A;  2WXJ A;  1MFW A;  1XF5 L;  2IO0 B;  4XX5 A;  3SD5 A;  4HJG E;  3S2A A;  1LM8 B;  3ABV B;  3KYC D;  1V97 A;  1RYJ A;  3NVY A;  1Z5S B;  4NJC A;  2N1W A;  2V9H A;  3DBS A;  4NQK E;  4EZJ A;  3SR6 A;  1YN3 A;  1WMH B;  4IWQ A;  1WJN A;  1PDX A;  1N5X A;  2LZ6 A;  2LGY A;  3I5J C;  4UDU C;  4GOC A;  3ZO5 B;  1C9F A;  3GZN I;  5I4D A;  1F9J A;  1QOA A;  1JWU D;  3DBL I;  3OJ4 B;  3ML9 A;  4W9E A;  2J0M A;  1Q5W B;  3TIX A;  3H6N A;  1N63 A;  3AMZ A;  1C76 A;  3N1Y C;  3GOE A;  3W1S C;  4JE3 B;  4M8N A;  2NTS A;  4IG7 B;  1QIL A;  1YN4 A;  1AYF A;  1KRH A;  1F52 A;  3I9V 1;  3A9J A;  3JVZ X;  2KOX A;  3E9S A;  3BVM A;  3VUW A;  1TIF A;  1JAL A;  5D7G A;  2CHZ A;  2FID A;  1FFV A;  4GLS C;  3HUI A;  1TGZ B;  2Z0E B;  2BS3 B;  2C7H A;  2KTR A;  4HCN B;  1K53 A;  1SGH A;  2JXT A;  2D3C A;  2KDM A;  2J7Q B;  3PT2 B;  1X1M A;  5GXG B;  4HRS A;  1QKZ A;  3RI7 C;  2AYO B;  3A9J B;  3ZNG C;  4FHK A;  4LK0 M;  2L8J A;  2IZV B;  1E6E B;  5H8Y E;  3RZW C;  1T0S C;  4HLE A;  3AU5 A;  1ZDX A;  2KJR A;  1QOG A;  5J17 A;  1RAX A;  4XDC A;  4I6P A;  4QAY A;  4WUR A;  4ZYN A;  3U52 E;  2GBJ A;  3QQ8 B;  2B76 B;  3ZUN A;  3WAL A;  2YEP F;  3R2T A;  1V1P B;  2KLC A;  2QIE B;  3RNC C;  1OEY J;  2QIL A;  1K51 A;  4A3O A;  3P4P B;  1ZPS A;  4E3C A;  2NBV B;  4BOS C;  3PRZ A;  1T5X D;  1SXT A;  1FIQ A;  4J6I A;  4KSL C;  1YJ1 A;  3IXS A;  3HVD A;  4DDG D;  1SEB D;  4HDO A;  3VQI A;  4L1B A;  2DNF A;  2H89 B;  3ZDT A;  3RUL A;  4C80 A;  3AE2 B;  2CS4 A;  1G6J A;  1SE3 A;  3OG5 A;  3PLU A;  1V1P A;  3PS6 A;  1C77 A;  5JHA A;  1CJE A;  4LDT B;  4E74 A;  3PLV A;  2GBM A;  2ZNV B;  2FCM A;  3DWG C;  3VH4 B;  1NDD A;  1V5T A;  2WDT B;  1YX6 B;  2JYT A;  4KZ0 A;  1F2R C;  4C7Z A;  2WXG A;  2IY0 B;  5IOI A;  3HM6 X;  3Q2A C;  3KYD D;  3KWL A;  2G3Q B;  5LXI B;  5C1Z A;  2M0A A;  1E5W A;  4FJY A;  1J8C A;  1GB4 A;  3LJ3 A;  2Z0D B;  1UWM A;  4LJP B;  2LAS A;  4NJ6 A;  1R4N B;  1WXA A;  3U4E G;  2O6V D;  3IT6 B;  1T0Q C;  2LMC A;  1HQR D;  1BML C;  3ZNH B;  2WXP A;  3BZD B;  2BT6 A;  3X0W A;  4IWP A;  2VH2 A;  4HPP A;  2KT7 A;  3DHG C;  5C3J B;  4MAC A;  1N61 A;  1TS2 A;  4TQ0 A;  4C00 A;  4BBN F;  1UZX B;  4DWF A;  1RLF A;  2MP2 B;  2BYE A;  4LJO B;  2LI5 A;  2W9N A;  1CK1 A;  3VRA B;  1ZGU B;  3C8Y A;  3RT3 B;  3SEB A;  2LRU A;  3VRB B;  4IOI E;  5CHF A;  5C2T B;  2KZR A;  1UF0 A;  1BT0 A;  1EU4 A;  1L4D B;  4WAA A;  3PGE A;  4K1R B;  1AN8 A;  1ZXI A;  2PMV A;  4R3D A;  4NJ7 A;  2BQQ A;  3FAH A;  3HVZ A;  3QC8 B;  2N7D A;  5AZF A;  1D3Z A;  1WMH A;  3AED B;  4WJQ A;  3CMM B;  4FHJ A;  1WYW B;  3AEB B;  2J4X A;  3RFZ B;  2LHD A;  2KC2 A;  4GMV A;  5CHW A;  3NZ3 A;  3U7Z A;  4GDL A;  1Z2M A;  5AUI A;  1KH0 A;  4C4V A;  5HI1 A;  3TEZ A;  2CHW A;  1KLG D;  1CQV A;  3QK0 A;  2G4S A;  2KLG A;  3DVG X;  4C56 C;  4JLC A;  1RWS A;  2HE7 A;  4OZC A;  4NNJ B;  1QZE A;  2GLS A;  3RNA C;  1XO3 A;  3H1U A;  4DXF A;  2UWQ A;  5IA7 A;  1QLB B;  2RR9 A;  4W9L A;  2BKR B;  4KDL B;  2SEB D;  3BWU D;  1YJJ A;  1WJ6 A;  2CR5 A;  2ONQ A;  3J9C A;  2NVU I;  3ML8 A;  4RF0 A;  1MI0 A;  1SE2 A;  1JW9 D;  1XLP A;  2IO2 B;  2LGI A;  2EEL A;  2XBB C;  2ZVN A;  2WDQ B;  1GC7 A;  2ZPN A;  2BKF A;  2WP9 B;  5DPW A;  1TYG B;  4W9D A;  2RGF A;  2FAZ A;  4KGS A;  3VR9 B;  1YIW A;  3L08 A;  1WM2 A;  1VR9 A;  3A9K B;  2KWD A;  2XNA C;  3AE3 B;  1UUP A;  3KUC B;  1WGG A;  3EUB 2;  2J52 A;  1WY8 A;  2JU6 X;  3IBE A;  4BZA A;  2RDH A;  3T9L A;  2KFK B;  3MC0 B;  1RRB A;  2KDI A;  2OHF A;  4MDK E;  3KW5 B;  2OOB B;  1OTR B;  4HXD A;  1NVI D;  2L7R A;  3ZRF A;  3RCZ A;  1L4Z B;  2REX A;  3RUI B;  2IO3 B;  3SFD B;  2KDE B;  2H88 B;  1WZ0 A;  2KWV B;  1TS4 A;  4RGO S;  4BKT A;  3AUL A;  2N7E A;  2N4F A;  3HK0 A;  4F1S A;  1A5R A;  3W1S A;  1OQY A;  1C1Y B;  2MX2 A;  4OVZ A;  3PZ7 A;  5T8I A;  1B9R A;  2KX3 A;  3QA8 A;  2CJN A;  2JXX A;  3P4R B;  1VZ8 A;  4NY0 A;  2KNB A;  4I6N B;  1F2R I;  4I6L B;  1ACC A;  3IAM 1;  4K7S A;  1KJT A;  2DZM A;  2JSV X;  2K1F A;  2K9X A;  1MPE A;  4YT0 B;  3VUY A;  4A90 A;  2IJ0 A;  1E8Z A;  1MVK A;  4GU2 A;  2G1E A;  1YQB A;  3L10 B;  4KVG B;  3FIL B;  3Q6B A;  1N6Z A;  1J7A A;  3CSF A;  4ANU A;  1FRR A;  2KAC A;  1UBQ A;  4HWI B;  1FCC C;  2V3N A;  3MHS D;  2PW9 A;  4AUQ C;  1WM3 A;  3Q3J A;  2K8C A;  4AP4 C;  2EMT A;  3APF A;  1QF6 A;  1HZ5 A;  1DGJ A;  2JY6 A;  2LGS A;  5EE3 A;  3U7D A;  3ZTC A;  3R7R A;  4URK A;  1YN5 A;  4W9H A;  5MPO A;  4BBN C;  3ENE A;  1MHX A;  4LNN A;  4BFR A;  3LDZ E;  1FRD A;  1UGM A;  3CST A;  1V1O A;  3TEW A;  4OHJ A;  3TBL D;  4US9 A;  3BII D;  3UGB B;  2FCN A;  4WJN A;  5DPT A;  5LLI A;  5TSS A;  3LYY A;  5JXV A;  4HK2 A;  3KLS X;  2ZCC A;  4CHK A;  3CWI A;  4BKG A;  4KKI A;  4TV3 A;  1ET6 A;  3AN1 A;  4CYE A;  3QHT A;  1V80 A;  1GOZ A;  2M17 A;  3U8Z A;  3NJT A;  3EHV A;  1V6E A;  1I4Q A;  3KQ4 A;  3BYT B;  4L23 A;  1WZ3 A;  2WGS A;  3CIR B;  2MSE D;  3NVV A;  2D11 A;  3KWV A;  2IYD B;  2J53 A;  3AE1 B;  2QSD A;  2L3Z A;  2UYZ B;  4OW0 A;  4LLG M;  2L76 A;  2WXQ A;  1WH3 A;  4JL9 A;  2NBW B;  2L00 B;  4KIK B;  3NRZ A;  3VTV A;  4MSM B;  2INC C;  3E56 A;  3GE3 C;  1V49 A;  3H7P A;  4ZRI A;  3L0W B;  3ZNZ B;  1WJ4 A;  3BK2 A;  4BKS A;  1QOB A;  2NMQ A;  4REZ A;  3DBL B;  4DQO C;  2QCZ A;  1OFF A;  2DZJ A;  5EDS A;  1ZP0 B;  4MM3 A;  3AE9 B;  4OZB A;  2E6X A;  2ASQ A;  2ZW0 A;  4S17 A;  2B3A A;  4ZRQ A;  1NYR A;  4EUT A;  4RGM A;  2RDG A;  4IUM B;  1TKY A;  4IC7 B;  2KMM A;  5IP4 D;  3MJ5 A;  3QAQ A;  1XXG A;  2R2O A;  2O6V B;  4RH6 A;  2JT4 B;  2EKI A;  2WDV B;  2DZK A;  1E8Y A;  1MG8 A;  4PYZ A;  2INN E;  3PSE B;  1FCL A;  1XCT L;  3RYT A;  1I7H A;  2CJO A;  1L0V B;  3GP7 A;  3NOB A;  4HEA 1;  2MEK A;  3APD A;  1V81 A;  4NAW B;  2L05 A;  3B08 A;  1WJU A;  2DYB A;  2MJD A;  1FO4 A;  3RNG C;  3ZXV A;  1HZ6 A;  2NPT A;  3VH3 B;  2DWQ A;  3R3M A;  1WR6 E;  1SIF A;  3URY A;  4WQO B;  1AW7 A;  2FNJ B;  1H8C A;  2J42 A;  1FXI A;  4K7W A;  2AX5 A;  1XEE A;  1EO6 A;  3ETR A;  4NPN A;  3DVG Y;  3EFU A;  2TSS A;  4XE0 A;  1NYQ A;  2N0S B;  1I4H A;  2JWU A;  3W9C B;  2BWF A;  4N6E B;  2WS3 B;  1KLU D;  4TMA B;  2K22 A;  2ON8 A;  5FR3 A;  3Q3M C;  4EOY A;  4HJK A;  4LTU A;  3L4P A;  1L5P A;  3RNE C;  1WR1 A;  3Q8A A;  2PPH A;  1GG3 A;  3P2B A;  1TKG A;  1WI0 A;  3IFW B;  4XWT A;  1JRP A;  4PK1 A;  4II3 B;  3N1Z C;  5DCN A;  3AEA B;  4E71 A;  3NHE B;  4B0M A;  1ISN A;  5J2R A;  4D2K A;  2WXR A;  4ZOH C;  4MJS B;  1XQQ A;  2LXA A;  2Z59 B;  5H92 C;  4ZRJ A;  2ACZ B;  1E9M A;  3RZF A;  4MEL A;  2FCQ A;  2KTF A;  3PZ8 A;  4ICU A;  4RMA A;  2ZZP B;  5D3D A;  3RD2 A;  4P1B C;  2BB6 A;  4W9J A;  2BGF A;  4RGN A;  2RSU A;  1E8W A;  1WF9 A;  4FAD A;  1MHH E;  4RGT A;  3Q8E A;  4YTP B;  4N58 A;  2MWS B;  2KMC A;  1Q0W B;  2C60 A;  2WLB A;  2C5L C;  2K6D B;  4EEW A;  4FJZ A;  4K3B A;  4KGT A;  3B2F A;  1WX8 A;  5C23 A;  2KMA A;  5G5H A;  4GXB A;  1B1Z A;  2OJR A;  3VVW B;  1IBX B;  2AEH A;  3Q8B A;  3PRP B;  2LXC A;  4ARC A;  4W9F A;  1TZO A; 
#chains in the Genus database with same CATH homology
 2KO3 A;  1TZ1 A;  3WAO A;  4KV2 A;  2HE7 A;  3K9O B;  3H9D A;  3M63 B;  3N32 A;  3APC A;  4HPL B;  4NNJ B;  1QZE A;  2GMI C;  5J18 A;  1WXM A;  3M95 A;  4MH0 E;  3H1U A;  4B6W A;  4BKS D;  5DPS A;  2UWQ A;  5IA7 A;  2RR9 A;  2BWE S;  3JYU A;  2KK8 A;  4W9L A;  3SU8 X;  2D2Q A;  2LGD A;  2BKR B;  4KDL B;  3OLM D;  2MBO A;  1E90 A;  1WJ6 A;  2CR5 A;  4EZK A;  2NBU A;  2MBE A;  2NVU I;  2FUH B;  3ML8 A;  3ZTD A;  4A20 A;  3X23 A;  3EEC A;  2VRR B;  2KN5 A;  2GBN A;  2IO2 B;  3O65 B;  1M94 A;  2KD0 A;  2LUE A;  2LVO A;  3NS8 A;  3PRE A;  4XZ4 A;  4DBG A;  1SE9 A;  4NQL B;  1EUV B;  5IAA C;  4TUU A;  2XBB C;  2KC1 A;  4HCP B;  4ZRK A;  2ZVN A;  1GC7 A;  1GNU A;  1E8X A;  2ZPN A;  3NY5 A;  2BKF A;  1V86 A;  4OVU A;  5DPW A;  2D07 B;  3QAR A;  1KLV A;  3UIN B;  2BYF A;  4W9D A;  2AL3 A;  2RGF A;  2FAZ A;  1YIW A;  3L08 A;  1WM2 A;  1P9D U;  5L83 A;  2DAF A;  2NR2 A;  4DDI D;  4RM9 A;  3A9K B;  4ICV A;  5E6P A;  2WX0 A;  4WWN A;  5GMV A;  2KAN A;  2KJH B;  3SHQ A;  2PE9 A;  3B1L X;  4AJW A;  1P3Q U;  1J0G A;  2XK5 A;  2C7N B;  3KUC B;  4M8M A;  1E7V A;  1WGG A;  1LFD A;  3OJ3 A;  1WY8 A;  3IBE A;  2HTH A;  3ALB A;  4DHZ E;  1KOT A;  3L13 A;  2JRH A;  2CHX A;  2KDB A;  4K7U A;  3SDL C;  3T9L A;  2DEN B;  1IYF A;  2KFK B;  2G4D B;  3A9K A;  2CKH B;  4ZDV A;  2ZCB A;  1RRB A;  2KDI A;  3UQB A;  4MDK E;  1YD8 U;  5L95 C;  3KW5 B;  3AU4 A;  2OOB B;  1OTR B;  2NCN A;  1I42 A;  1L2N A;  4X57 B;  3BY4 B;  4HXD A;  2GOW A;  2L7R A;  1PQS A;  3ZRF A;  3RCZ A;  2REX A;  3RUI B;  2J0K A;  2IO3 B;  2D3G A;  5G2N A;  4GDK B;  3H7S A;  3ZIM A;  2LJ5 A;  2KDE B;  1S1Q B;  4K81 A;  3TL5 A;  2KHW B;  1WZ0 A;  2KWV B;  2L0T A;  2MCN B;  2WWZ A;  4KSK C;  4BKT A;  3AUL A;  5G55 A;  2N7E A;  2AL6 A;  2N4F A;  4G0N B;  2D10 A;  2N9P C;  2O6V A;  4IW0 A;  3HK0 A;  4F1S A;  3IHP C;  1A5R A;  4P7I A;  4MJS A;  3W1S A;  4FLH A;  1L7Y A;  1OQY A;  2ZNV C;  1C1Y B;  3ONS A;  2MX2 A;  3V62 A;  5KHQ A;  2KX3 A;  1CMX B;  4II2 B;  4W9F A;  2JVC A;  2IO0 B;  4PS8 A;  2N1V A;  3QA8 A;  4XX5 A;  2C7M B;  3SD5 A;  2JXX A;  4OVV A;  3S2A A;  1LM8 B;  4NY0 A;  5LXH A;  2KQS A;  1J19 A;  2LVQ A;  3JSV A;  4LDT D;  2KNB A;  1V2Y A;  2DX5 B;  2I1K A;  3KYC D;  4I6N B;  3VHT C;  4KDI C;  4I6L B;  1WE6 A;  4K7S A;  1KJT A;  2DZM A;  1LXD A;  4W9C A;  1Z5S B;  1EF5 A;  2N1W A;  2K1F A;  3DBS A;  4NQK E;  1WXV A;  5JZE B;  3M3J A;  4TQ1 A;  4EZJ A;  1XT9 B;  4JQW C;  5AZG A;  3ZNI D;  3PTF C;  3VUY A;  1ZW7 A;  3QCA A;  3B0A A;  2PJH A;  4HPM B;  1P98 A;  3WA0 A;  1WMH B;  3L54 A;  4JIO U;  4IWQ A;  3VDZ A;  2I1J A;  1WJN A;  2BYV E;  3NZS A;  3MJW A;  4FA6 A;  1E8Z A;  2O2V A;  4G11 A;  4KIK A;  2LZ6 A;  4GDK A;  4GU2 A;  2LGY A;  4MEM A;  3PZD A;  1YQB A;  3L10 B;  4KVG B;  4B9K A;  3R66 C;  4GOC A;  3ZO5 B;  3GZN I;  3UIO B;  1F9J A;  3OJ4 B;  3DBL I;  4W9E A;  3ML9 A;  2J0M A;  1Q5W B;  1R4N I;  3CSF A;  4WJP A;  4ANU A;  3W1Y A;  1UBQ A;  4HWI B;  4AOF A;  3TIX A;  3MHS D;  3H6N A;  4FJV B;  1WM3 A;  4AUQ C;  3Q3J A;  2K8C A;  2BF8 B;  3GOE A;  4AP4 C;  1KM7 A;  3W1S C;  2EMT A;  1C3T A;  4ANV A;  4M8N A;  4EFO A;  3APF A;  4IG7 B;  2KDF B;  3ECI A;  3L17 A;  2JY6 A;  3U7D A;  1YX5 B;  2DAJ A;  3ZTC A;  2C9W B;  4LCD E;  3R7R A;  4URK A;  3UQA A;  4W9H A;  4NAW A;  3V6E B;  4BBN C;  3A9J A;  4EZL A;  3ENE A;  1NI2 A;  4BFR A;  2V4L A;  3JVZ X;  2KOX A;  1T0Y A;  3LDZ E;  4MGY E;  3VUW A;  3QX1 A;  2PEA A;  5D7G A;  2CHZ A;  2FID A;  1UGM A;  3CST A;  3A4R A;  1UEL A;  3TBL D;  2DYM A;  3D32 A;  1TGZ B;  3UIP B;  1S3S G;  2Z0E B;  2C7H A;  3UGB B;  5BO4 B;  1XD3 B;  2K6Q A;  2FCN A;  2JUO A;  2KTR A;  2RD0 A;  4WJN A;  3C0R B;  4HCN B;  5DPT A;  5LLI A;  4ASW C;  1SGH A;  2J7Q B;  4HK2 A;  2ZCC A;  3PT2 B;  1X1M A;  3TMP B;  2MBQ A;  1NBF C;  4MGI E;  4CHK A;  3TCA A;  2V1Y A;  5E6N A;  2M8S A;  4BKG A;  4TV3 A;  3V6C B;  5FR6 A;  4ANX A;  5AZH A;  3DBH I;  4TKN A;  2AYO B;  1WIA A;  4CYE A;  1UD7 A;  3QHT A;  4PS7 A;  3A9J B;  1V80 A;  3VAW A;  2M17 A;  3U8Z A;  3ZNG C;  3QWZ B;  4FHK A;  2L8J A;  3EHV A;  1V6E A;  2IZV B;  2KX0 A;  3T8M A;  3DCG A;  4MGZ E;  2JF5 A;  1WZ3 A;  1J8C A;  4W9K A;  2MQJ A;  2M0X A;  2MSE D;  2WYQ A;  3RZW C;  2D11 A;  3HIZ A;  2JZZ A;  2IYD B;  4HLE A;  2NPT B;  3AU5 A;  2KFJ A;  4BOZ B;  2KJR A;  2L3Z A;  2UYZ B;  3V61 A;  1RAX A;  5J17 A;  5D6J B;  4JGH B;  4GB9 A;  2KWC A;  4I6P A;  2L76 A;  4FN2 A;  4XC2 A;  1WH3 A;  4ZYN A;  2FCS A;  3BIN A;  1U4A A;  3H7P B;  4JL9 A;  2NBW B;  4DHJ D;  2KXJ A;  2A5U A;  2L00 B;  2GBJ A;  2ZEQ A;  2O2V B;  4KIK B;  1JRU A;  3QQ8 B;  1GUA B;  1IPG A;  3VTV A;  2R2Q A;  3CF6 E;  2MRP A;  4MSM B;  2ZJD A;  3TJP A;  4FUL A;  3WAP A;  3ZUN A;  1LQB A;  3WAL A;  1AAR A;  1V49 A;  5CTR C;  1WGH A;  3H7P A;  4IM0 A;  3L0W B;  4ZRI A;  3ZNZ B;  3HM3 A;  1WJ4 A;  3ZW3 A;  2KLC A;  4BKS A;  4DK5 A;  2JWZ A;  4AWJ A;  1OEY J;  2KJ6 A;  3N3K B;  2K8H A;  2ZPY A;  4A3O A;  2DZJ A;  2LGX A;  5EDS A;  2FIF A;  3IG3 A;  4E3C A;  1WGD A;  2NBV B;  4BOS C;  4MM3 A;  3VTU A;  1I35 A;  3PRZ A;  1V9J A;  2JPH A;  2ASQ A;  3VUX A;  2YVC A;  4IM3 A;  2B3A A;  2WX1 A;  4J6I A;  4KSL C;  1YJ1 A;  2JZ3 B;  1UBI A;  1P0R A;  2QHO A;  1RFA A;  4EUT A;  1IP9 A;  1V5O A;  3PV1 A;  3WAN A;  1EF1 A;  4KZC A;  4DDG D;  4IUM B;  1GC6 A;  4DXA B;  4EKU A;  4IC7 B;  3A1Q B;  4F8C B;  4BVU C;  1HE8 A;  4HDO A;  4WWP A;  3VQI A;  2LVP A;  3QAQ A;  4WWO A;  3ZDT A;  2R2O A;  3RUL A;  3K9P B;  2O6V B;  4W9I A;  2NS5 A;  2MP2 A;  2CS4 A;  3ZVV A;  1P1A A;  1G6J A;  2JT4 B;  2KWU B;  4AJY B;  4MSQ B;  3PVL A;  3PLU A;  2DZK A;  3PS6 A;  2Y5B B;  3A4S C;  5JHA A;  1E8Y A;  3ZRC A;  4LDT B;  4E74 A;  3PLV A;  1MG8 A;  2GBM A;  2KTR B;  4PYZ A;  2ZNV B;  5E6O A;  2FCM A;  3PSE B;  3VH4 B;  4HVB A;  1NDD A;  1V5T A;  2MBB B;  2WDT B;  3DOW A;  1YX6 B;  2DHZ A;  2JRI B;  4KZ0 A;  3RYT A;  5HKH A;  3DVN V;  1Q1O A;  2N9E B;  3NOB A;  2KKC A;  3A33 B;  2IY0 B;  1E7U A;  3APD A;  1V81 A;  3HM6 X;  5D2M B;  3R7Q A;  4NAW B;  2L05 A;  2N9X A;  3OAW A;  3B08 A;  3KYD D;  1WJU A;  2DYB A;  1WX7 A;  2G3Q B;  3I3T B;  2HD5 B;  4M0W B;  5C1Z A;  5LXI B;  1E5W A;  1FXT B;  3L16 A;  4FJY A;  3VFK A;  4DHJ B;  4CO7 A;  3LJ3 A;  2CU1 A;  2MLB A;  2G45 B;  4PYU A;  2Z0D B;  4LJP B;  2NPT A;  2LAS A;  2RPQ A;  3VH3 B;  4NJ6 A;  3AI5 A;  4GSW A;  3WIM A;  1K8R B;  1WR6 E;  3R3M A;  5KHO A;  1SIF A;  3N30 A;  2V3S A;  4WQO B;  3DBR I;  3QJZ A;  4GN1 A;  1WXA A;  2FNJ B;  3MTN B;  5TR5 A;  4PS3 A;  2A4Z A;  2O6V D;  1H8C A;  5AEK B;  4G50 A;  4K7W A;  2ZVO A;  3ZLZ A;  2XEW A;  2MW5 A;  3QIJ A;  3ZNH B;  2K8B A;  1EO6 A;  2YLM A;  4NPN A;  2M4N A;  1OGW A;  2IY1 B;  4FBJ B;  2GBR A;  3PPA A;  3DVG Y;  3X0W A;  3EFU A;  2MA9 B;  4IWP A;  1OEY A;  1WXS A;  2BWF A;  3KH0 A;  3WAM A;  4TQ0 A;  1WRD B;  4GGQ A;  4DHZ B;  5D94 A;  3KUZ A;  3KUD B;  2LRW A;  4BBN F;  1UZX B;  4ANW A;  4DWF A;  1RLF A;  4EOY A;  2K39 A;  4IWO A;  4YL8 A;  3KVF B;  2MP2 B;  2PE6 B;  2BYE A;  4HJK A;  4LJO B;  1TTN A;  2LI5 A;  2DYO A;  4IM2 A;  1WR1 A;  2W9N A;  1H4R A;  2PPH A;  1GG3 A;  5DPR A;  3JSV B;  3A1Q A;  3P2B A;  1ZGU B;  3RT3 B;  3U30 A;  1WI0 A;  3IFW B;  2LRU A;  5JH5 C;  1WGR A;  3ZKJ C;  4GIV A;  3V60 A;  2J0J A;  2GBK A;  2DZI A;  5CHF A;  4B95 A;  1TBE A;  4II3 B;  5CX3 A;  5DCN A;  4E71 A;  1WX9 A;  3NHE B;  2KZR A;  1ISN A;  2BPS A;  4GDL B;  3DDC B;  5J2R A;  3IVF A;  3ZDM C;  4MJS B;  4F7Z A;  1BT0 A;  2IBI B;  5CHV C;  2IO1 B;  1R4M I;  1WGY A;  1XQQ A;  1Y8R C;  2LXA A;  2Z59 B;  4ZRJ A;  4WAA A;  3PGE A;  2KQ7 A;  1UH6 A;  4K1R B;  2M1M A;  3RZF A;  1WFY A;  2FCQ A;  2KTF A;  4ICU A;  4MEL A;  2EKE C;  4RMA A;  3DVN U;  2LD9 A;  1WE7 A;  2ZZP B;  3PHX B;  4NJ7 A;  1GJZ A;  3RD2 A;  2LWP A;  2HJ8 A;  4W9J A;  2BGF A;  3QC8 B;  3AXC A;  2N7D A;  3VXW A;  3VTW A;  5AZF A;  2KVR A;  4WJO A;  1D3Z A;  1WMH A;  2EMS A;  2RSU A;  4WJQ A;  3UF8 A;  3Q3F A;  3CMM B;  4FHJ A;  1WYW B;  4W9G A;  1E8W A;  1WF9 A;  2K25 A;  4FAD A;  4A3P A;  3M62 B;  2KC2 A;  3PRM B;  2MWS B;  4GMV A;  2KMC A;  1Q0W B;  3PHW B;  5JHB A;  2C60 A;  1ZKH A;  3EC8 A;  5CHW A;  1VCB A;  2C5L C;  2K6D B;  2KFK A;  4G3X B;  4GDL A;  1Z2M A;  2AWT A;  4EEW A;  4FJZ A;  3NZU A;  1WX8 A;  5C23 A;  2KMA A;  4RM8 A;  4GXB A;  3HHM A;  2OJR A;  3VVW B;  2CHW A;  3DQV A;  4MGK E;  4HDQ A;  2XK5 B;  2AEH A;  2MBH A;  1VD2 A;  2LXC A;  3PRP B;  2L0F A;  3QK0 A;  2G4S A;  2KLG A;  3DVG X;  3JW0 X;  4N9F 4;  4JLC A;  3DPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...