3RZWC

Crystal structure of the monobody ysmb-9 bound to human sumo1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Monobody ySMB-9
publication title Teaching an old scaffold new tricks: monobodies constructed using alternative surfaces of the FN3 scaffold.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rzwC00
1RAXA 4NNJB 4W9EA 3WAMA 4MDKE 2M17A 3CSTA 2KD0A 4DK5A 4M8MA 2GBJA 4HXDA 2KX0A 3IVFA 1UBIA 3PT2B 2PPHA 2LD9A 2DZIA 2GBKA 2MBBB 4IM3A 3K9PB 5DPSA 1ZKHA 2CHXA 2WWZA 4EUTA 1V5TA 4DXAB 5D7GA 1GNUA 4FLHA 4GMVA 3UF8A 4FJYA 4MGIE 2JUOA 3PHXB 4HWIB 4IM2A 4TUUA 2LJ5A 3W1SC 3OLMD 3ZKJC 3TL5A 2KFJA 4RM9A 2N9PC 2ZVOA 3P2BA 3T9LA 3DBLI 4A20A 1KM7A 2RSUA 2I1JA 1RRBA 2D07B 2JPHA 2Z0DB 1E8WA 2C9WB 3RULA 1XT9B 2MP2A 1F9JA 2L7RA 1E8XA 2BF8B 1LXDA 3VH3B 4MH0E 2C5LC 3M3JA 3B0AA 1UELA 2C7NB 1YQBA 3WALA 3W1SA 2O6VB 5AZHA 4FA6A 2KDFB 2AL6A 2KC1A 3PZDA 4NJ7A 3HM6X 1YX6B 2J0MA 2KKCA 2KQ7A 3PRZA 1V9JA 3EC8A 2R2OA 1WZ0A 3AULA 1XQQA 3SD5A 3K9OB 4IM0A 3R7RA 4BVUC 1E8ZA 3S2AA 4DWFA 1V2YA 3AU5A 1WE6A 2KTRB 3C0RB 3N3KB 3PHWB 1J19A 2MX2A 3VQIA 4DHJB 4HDOA 2KMCA 3LJ3A 4LJOB 1HE8A 1NI2A 3RT3B 4AOFA 1KLVA 3NHEB 3TJPA 3SDLC 3M95A 4NAWA 2D3GA 5LLIA 2L76A 1OEYJ 2IZVB 1IPGA 1LQBA 2IO0B 2LUEA 2MBOA 3VAWA 1ZW7A 3ZW3A 4RMAA 2V1YA 1V5OA 2L0FA 3NZUA 4W9FA 1R4NI 2NBUA 4KZCA 4W9LA 2QHOA 1EF5A 4GXBA 4GGQA 1X1MA 2A4ZA 2JZZA 1WX7A 1RFAA 4LJPB 3PSEB 1S3SG 2V3SA 3LDZE 3DDCB 2CU1A 2GBNA 2LGYA 3Q3FA 2D10A 1KOTA 3L16A 3I3TB 3RZWC 4FADA 2O2VA 5L95C 2N1WA 3ZLZA 1GC7A 2BPSA 4AP4C 4IC7B 4ANUA 1WXMA 1WXSA 3VTWA 1WX8A 4ZYNA 1WX9A 3KUZA 2JVCA 3QAQA 3ZTDA 3ECIA 2DX5B 2KWVB 5JHAA 2KDIA 3VUXA 4IWPA 1P3QU 1Q1OA 3MJWA 3WANA 1WJ4A 4FULA 5CTRC 3VTVA 5BO4B 4MGZE 3WAOA 1SE9A 2K6DB 1RLFA 4WJQA 3ZNGC 1CMXB 5KHQA 4HJKA 2IO1B 3VFKA 3UIPB 2KTRA 4WQOB 2CHZA 4KZ0A 3SHQA 1GUAB 4ZRJA 5G2NA 4NQKE 2MP2B 1I35A 3W1YA 2UYZB 3X0WA 2KTFA 5DPWA 3KVFB 3U30A 1WGRA 4EZLA 3PRPB 2FAZA 2PE6B 2XK5B 1P0RA 2C60A 2LRUA 2K8BA 3QCAA 1GJZA 2KXJA 3GOEA 2FCSA 2BGFA 5J2RA 3VUWA 1WI0A 2IBIB 2G4SA 2M0XA 1Y8RC 2KO3A 3IBEA 4JQWC 3ZRFA 2W9NA 2JT4B 2ZEQA 3A9KA 2KMAA 3WA0A 4EZKA 1UGMA 4GB9A 1WGDA 3PTFC 1WR6E 3ZO5B 2JWZA 1ISNA 4HDQA 4HPMB 3UGBB 3VXWA 2LVOA 3QARA 4B95A 3VH4B 4CHKA 4GDLB 1K8RB 2L05A 3KH0A 2M4NA 4RM8A 3IFWB 4WWPA 3V6CB 2I1KA 2D2QA 4ICUA 2Z0EB 2EKEC 4KVGB 1OTRB 3ZNZB 4YL8A 4ASWC 3IHPC 3M63B 3H7SA 4NAWB 4AJWA 2KDBA 1WM3A 3U7DA 3ML9A 1TBEA 2MLBA 4ZRKA 1TGZB 2BYFA 4N9F4 2GBRA 2JRHA 2OOBB 2ZZPB 3DVGX 4WWNA 2Z59B 3HIZA 1WXVA 3NS8A 4KV2A 1IP9A 3ZDMC 1UH6A 2MWSB 4II2B 3R66C 3ZTCA 3R7QA 3CSFA 3NY5A 2BKRB 2LWPA 2BYEA 4GIVA 3WAPA 2K1FA 4JGHB 1V6EA 5DPTA 4JIOU 3JVZX 2LVPA 5C23A 2N9XA 1WMHA 2KFKB 2XBBC 2O2VB 3H7PB 4G50A 4ANVA 4W9DA 1J8CA 4NJ6A 5JHBA 1WM2A 2WX1A 4TQ0A 2REXA 4EOYA 1LM8B 3PLVA 4M0WB 3A9JA 1TTNA 1U4AA 1UD7A 4FJZA 2FUHB 2HD5B 2KJHB 2XK5A 2DZKA 2ASQA 2K6QA 2MSED 2VRRB 3OJ3A 2GBMA 3DBHI 3QHTA 4II3B 5IAAC 1WR1A 2FCNA 2KK8A 4BBNC 2LVQA 3QJZA 4URKA 2LZ6A 5E6OA 3UQAA 1WYWB 2CHWA 5E6PA 1S1QB 3AU4A 1GG3A 1EUVB 2KJ6A 4K7SA 3RUIB 2UWQA 2NBVB 2ZPYA 3V6EB 4GDLA 1H8CA 5TR5A 4WJPA 3PRMB 2RPQA 5KHOA 3PREA 2L0TA 4K81A 2BYVE 1V81A 2MW5A 1WY8A 2MBQA 1WJ6A 3SU8X 4HPLB 1EO6A 2MRPA 2R2QA 4P7IA 4DBGA 4KIKB 4EKUA 4F7ZA 1ZGUB 5LXHA 4KDLB 4EEWA 1XD3B 2J0KA 2N7EA 3VUYA 2DAJA 1AARA 4KDIC 1C3TA 1WRDB 3QIJA 2WX0A 1C1YB 3DBSA 3RCZA 4MSMB 1SGHA 1E7VA 1VD2A 5E6NA 3U8ZA 4PYUA 3A9KB 1QZEA 2GMIC 3QK0A 4EFOA 3APFA 3CMMB 4JL9A 4KSLC 4FJVB 5IA7A 2AL3A 2RR9A 2ZNVB 4WJOA 2KFKA 3H6NA 3H7PA 2BWFA 3HM3A 1YJ1A 3VVWB 5D94A 2KQSA 4ZRIA 5JH5C 1SIFA 4W9CA 4BOZB 3JYUA 4F1SA 4BKTA 4MM3A 3ML8A 5JZEB 2MBHA 1UZXB 2Y5BB 4CO7A 4W9GA 3JW0X 2LGDA 3MTNB 4LCDE 2LI5A 2LRWA 1P1AA 3DPDA 1G6JA 4MGKE 3OJ4B 2FNJB 3PGEA 1WMHB 2KZRA 3TBLD 1P98A 1Z2MA 1V86A 4E71A 4CYEA 2DYMA 5LXIB 3O65B 2DYBA 5AEKB 1L2NA 2KOXA 3A9JB 3APDA 3PPAA 3V60A 2KLGA 4KIKA 3APCA 2O6VD 2OJRA 4ANXA 2AWTA 1WJNA 4DDGD 2ZVNA 2CS4A 2M8SA 1H4RA 2WYQA 4IWQA 1WGGA 2JZ3B 2D11A 4BKSD 4E74A 4KSKC 1V49A 3PVLA 4MEMA 3L17A 4MJSB 2EMSA 4BKGA 3QC8B 1OQYA 2IY1B 3HK0A 5D2MB 4BOSC 2M1MA 2KDEB 1V80A 2YLMA 3DCGA 4ANWA 2KWCA 2PJHA 2KLCA 3AXCA 3IG3A 4PS8A 3B08A 2IY0B 3ZUNA 4F8CB 1E8YA 1Z5SB 4I6NB 1E5WA 4M8NA 4TQ1A 2HJ8A 3EHVA 3VHTC 1E90A 3DVGY 2DZMA 2NVUI 2IO2B 3MHSD 2V4LA 4G11A 3L10B 4PS7A 3OAWA 2DYOA 2MBEA 4GU2A 4HLEA 1EF1A 3L0WB 3L13A 2MCNB 2PE9A 3A4RA 2C7HA 5EDSA 3ZNID 4WAAA 5DPRA 1WZ3A 2RD0A 3DVNV 3NZSA 4PYZA 5AZFA 2NPTB 4G0NB 4AWJA 1Q5WB 3CF6E 3EECA 3HHMA 2NS5A 4LDTD 3A4SC 2NCNA 4GSWA 3BY4B 5GMVA 3QA8A 2JXXA 2G3QB 3JSVB 4FHKA 2JY6A 1PQSA 2IO3B 3DOWA 3QWZB 1P9DU 3V61A 1J0GA 2ZPNA 1WE7A 4TV3A 4GDKB 5CHVC 3UINB 3ZNHB 2FIDA 4K7WA 3KUDB 3ZRCA 1D3ZA 4MJSA 2BWES 4X57B 4FBJB 1WGHA 3KUCB 1M94A 2ZJDA 3UQBA 2K8HA 3QX1A 2KWUB 3D32A 4HCNB 1OGWA 3H1UA 2HTHA 4DHZB 4MSQB 5CX3A 4I6LB 1OEYA 4FHJA 4ZDVA 4JLCA 4NQLB 2KANA 1YX5B 2JF5A 4I6PA 5CHFA 1WH3A 2LXAA 3QQ8B 2L3ZA 4J6IA 4B6WA 1WJUA 2JRIB 2HE7A 2KJRA 1A5RA 2IYDB 4WJNA 1I42A 4IUMB 2L8JA 3DQVA 3V62A 1T0YA 3A1QA 2FCMA 3KYDD 3TIXA 2A5UA 2EMTA 2LXCA 1WIAA 3PS6A 4DDID 2ZCCA 2N1VA 2NR2A 1LFDA 3PV1A 3NOBA 4MGYE 4A3PA 2AYOB 1NDDA 2WDTB 3PLUA 2J0JA 1L7YA 2NPTA 4XC2A 1MG8A 2XEWA 4BFRA 3KYCD 3L08A 2FIFA 4PS3A 4GOCA 2B3AA 2AEHA 4DHZE 1WXAA 2G45B 3R3MA 4AUQC 1VCBA 3M62B 2RGFA 1GC6A 3RYTA 3ZVVA 3JSVA 4K1RB 1BT0A 2KNBA 1YD8U 4BBNF 1Q0WB 4GDKA 2LASA 2DENB 3RD2A 3RZFA 1FXTB 5J18A 2KVRA 2GOWA 2KC2A 3ENEA 3TMPB 3A33B 4B9KA 4E3CA 5DCNA 5D6JB 4XX5A 2J7QB 3VDZA 3T8MA 4W9JA 3ZDTA 3AI5A 3DVNU 1JRUA 1WF9A 4A3OA 2K25A 3ONSA 4GN1A 4LDTB 2MA9B 4HK2A 2KHWB 2ZNVC 1TZ1A 2O6VA 2N9EB 4FN2A 1UBQA 1IYFA 2CR5A 4ICVA 4IW0A 4NY0A 4AJYB 4IWOA 3ZIMA 5FR6A 3N32A 4BKSA 5G55A 5HKHA 4HVBA 2L00B 5C1ZA 3VTUA 2NBWB 4TKNA 3Q3JA 1YIWA 2CKHB 2KN5A 4G3XB 3TCAA 1KJTA 3EFUA 2ZCBA 2DAFA 2N4FA 2K39A 2N7DA 3H9DA 3UIOB 3GZNI 4DHJD 2K8CA 5J17A 1R4MI 4W9IA 2MQJA 3WIMA 4NPNA 5CHWA 2YVCA 2FCQA 3N30A 2G4DB 2DHZA 4EZJA 4WWOA 4K7UA 1NBFC 2BKFA 4W9HA 1WFYA 2C7MB 4MELA 3KW5B 5L83A 4W9KA 2LGXA 3X23A 4IG7B 3B1LX 3L54A 3DBRI 4XZ4A 1WGYA 3A1QB 5AZGA 1E7UA 2DZJA 2KX3A 2PEAA 3ALBA 4OVUA 4OVVA 4HCPB 3BINA
chains in the Genus database with same CATH superfamily
1ROEA 2BW2A 4WH4A 1ZP0B 4DK5A 2LMCA 1V1PA 1UBIA 4US8A 2DZIA 2MBBB 2YEPB 5DPSA 2CHXA 4NZLB 5D7GA 4FLHA 3ZQ4A 4MGIE 1L0VB 2JUOA 1MI0A 3DWMA 4K3BA 3OLMD 1T6BX 1I4QA 2KFJA 3NZ3A 3T9LA 3IAM1 4A20A 5D3IB 2QC8A 2RSUA 2I1JA 1RRBA 1LO5D 4KX6B 1EM7A 2C9WB 1XT9B 2L7RA 3VH3B 1E8XA 2BF8B 3ZXVA 3FILB 4AQ7A 3NG0A 2C7NB 3WALA 4XDDA 5EE1A 4FA6A 1YX6B 2M19A 4C4VB 1E0ZA 4BVUC 1E8ZA 1V2YA 4A6QA 4DHJB 1HE8A 1NI2A 3AEAB 5LLIA 1SB3C 2IZVB 5BYRA 1FNUA 4RMAA 4P1BC 4ACFA 4W9FA 2NBUA 4KZCA 2AQ1B 1EF5A 2WU2B 2WQYB 1NYQA 1WX7A 3O13A 1KOTA 2GBNA 1I7HA 1P7FA 4FADA 4AP4C 4XYCA 4IC7B 4ANUA 5I4DA 3VTWA 1VRAB 1XF5L 2JVCA 2BYTA 3ECIA 1C78A 3HUIA 1Q1OA 1ESFA 1UGJA 3WANA 3AEGB 1J7BA 1N62A 3NRZA 2TSSA 3WAOA 1E9MA 1JWUD 4S17A 3UIPB 1N6ZA 1GUAB 4ZRJA 5G2NA 2MP2B 1JALA 1I35A 2UYZB 4MT5A 1XO3A 3U30A 2C60A 3QCAA 2BGFA 3VUWA 4YXDB 3Q3OC 2JT4B 2FE8A 3PTFC 4IDIA 2JWZA 1ISNA 4HDQA 3VH4B 1K8RB 2L05A 3MFGA 2K5PA 2D2QA 3H7SA 2DLBA 2D5GA 1FFUA 2KDBA 3KQ4A 2KAJA 2OOBB 3NVWA 1B9RA 4KV2A 1IP9A 4PT5A 2MWSB 3ZTCA 1V6EA 1WMHA 2XBBC 4S0RA 2W3SA 2WX1A 4WAFA 2REXA 1F2RC 4EOYA 3PLVA 3A9JA 1TTNA 4MM3B 2INDC 2XK5A 1FM0D 2VRRB 2K6QA 2MSED 3OJ3A 2RDGA 1I4XA 2CHWA 3ZJUA 4N58A 4OW0A 2NBVB 1H8CA 1FPYA 2RPQA 4K81A 1V81A 2J53A 2W54A 4DBGA 4F7ZA 4EEWA 2DAJA 3QIJA 1C1YB 1SE4A 1QZEA 1L6UA 3APFA 1I4PA 1XLOA 4C56C 2ZNVB 2IDYA 1SF0A 2M0AA 3H6NA 3H7PA 5D94A 2NMQA 3DBLB 2XNAC 2H89B 3TEZA 5JZEB 2MBHA 4JX1C 4ZRQA 2LGDA 3MTNB 3DPDA 2KZRA 4XWWA 1Z2MA 2DYMA 5LXIB 1L2NA 2KOXA 5C3JB 4KIKA 3BK2A 2OJRA 2JYTA 2ZVNA 2CS4A 4ZOHC 3LB8C 1WGGA 4A55A 4MJSB 1WXQA 3QC8B 5D2MB 2KT7A 4BOSC 1V80A 1R4NB 4ANWA 2PJHA 2KLCA 3AXCA 3IG3A 1IBXA 4L23A 1E8YA 4M8NA 3ZYYX 3Q14C 4YTPB 2HJ8A 3EHVA 2SEBD 3P4PB 3DVGY 3GB1A 1VZ8A 2DZMA 2NVUI 3MHSD 1KFYB 3AEBB 1CJEA 2DYOA 4GU2A 2QCZA 1E6EB 3J9CA 1P7EA 1E10A 4KGRA 3A4RA 2PTLA 3ZNID 4WAAA 2L52A 4PYZA 3NZSA 5AZFA 4G0NB 3EUB2 2FBWB 3Q8CA 4GSWA 4KGTA 2G3QB 3JSVB 3DOWA 2VH1A 2ZW0A 3GP7A 4FBJB 2WXPA 3Q69A 1SE3A 1RWSA 2K8HA 2WXFA 1OGWA 3H1UA 4DHZB 4HROA 4MSQB 1OEYA 4JLCA 2WDVB 4XGAB 3QQ8B 1GAQB 2KJRA 3BIID 4IUMB 2L8JA 3DQVA 1T0YA 4A9AA 1M4VA 2FCMA 3KYDD 2EMTA 4DDID 2M56B 2INNE 2N1VA 5G5HA 4MGYE 1NDDA 1J7AA 1JWAD 2J0JA 1L7YA 1UWMA 2GI9A 1WXAA 4AUQC 3R3MA 1JWMD 1QKZA 3ZVVA 1BT0A 2KNBA 3B9JA 4BBNF 2DENB 1ZUD2 3ENEA 2J7QB 3P1MA 1XCTL 1V1PB 3DVNU 4A3OA 1ENFA 4JE3B 5IN7A 1J7CA 1TZ1A 3GS2A 2LUMA 4ICVA 3ZIMA 5FR6A 3ZJVA 3FAHA 2NBWB 1YIWA 2KN5A 1KJTA 4A8XC 2N4FA 2K8CA 1R4MI 3WIMA 2IPKD 3OWEB 3N30A 4DXGA 4EZJA 2I2YA 4H2AA 1NEKB 1SJED 2QDFA 1WFYA 2C7MB 5L83A 1ZE3D 1L5PA 5AZGA 1E7UA 2QEJC 4C00A 1SE2A 3R2IA 3BWUD 2OEDA 3AV8A 1RAXA 4W9EA 2M17A 4M8MA 3MP9A 2PPHA 3PT2B 2LD9A 1N60A 3EGRA 3K9PB 3P42A 1V5TA 1FIQA 1GNUA 4ARIA 4GMVA 4FJYA 2QILA 3NVVA 2JWUA 2LJ5A 3P4SB 2WGSA 3P2BA 1K53A 4XWTA 1TT5B 1C9FA 3RULA 2WDQB 2C5LC 3B0AA 1YQBA 2O6VB 2AL6A 1BMLC 2KKCA 3PRZA 1D4BA 3EC8A 3AULA 1XQQA 3K9OB 4IM0A 3R7RA 4DWFA 1HTQA 3N3KB 4HDOA 2KMCA 3LJ3A 3KWVA 1KLVA 4AOFA 3I57A 2QJLA 3Q8AA 3TJPA 1OEYJ 2LUEA 3AH7A 4KGSA 3RPFC 2WXNA 2CJOA 2E3TA 4GGQA 1X1MA 3PSEB 2ZW1A 3ZGZA 4N6EB 3Q3FA 1TS3A 2O2VA 5L95C 3ZLZA 2JYEA 2RDBC 2D3CA 1SBBB 3QAQA 1FNWA 2KWVB 3FC4A 3VUXA 4IWPA 1P3QU 2HTME 3AE7B 1WJ4A 5CTRC 3Q8BA 4EE2A 4HJKA 2QMTA 2PMVA 2KTRA 1YN5A 3SHQA 1L6VA 3NS1A 2J4XA 1C76A 1VZ6A 5DPWA 2KTFA 1NYRA 4EZLA 1T5XD 5AUKA 2PE6B 2XK5B 2K8BA 3GOEA 5J2RA 1I4HA 2KO3A 3ZRFA 1OQRA 3P4QB 3WA0A 1UGMA 1WGDA 3PZ7A 3UGBB 4HPMB 2LVOA 3QARA 4CHKA 5HI1A 3AE6B 4US9A 3NUHB 2EKEC 4YL8A 2V3NA 3IHPC 3M63B 1YN4A 3EFCA 4NAWB 4AJWA 1KLUD 1WM3A 3U7DA 2MLBA 1AYFA 2V3PA 1D5MC 2GBRA 2Z59B 1FFVA 3GE8C 3HIZA 3NS8A 3ZDMC 4FXCA 1UH6A 1ZXIA 1JRPA 2WS3B 2LWPA 4HRSA 3JVZX 2LVPA 3H7PB 4OZCA 2L83A 4OZBA 4W9DA 5JHBA 3VRAB 1XLPA 1EWYC 4NJCA 1U4AA 1UD7A 1FO4A 2PLPA 2HD5B 3GZNB 3DBHI 1WSPA 5BMIA 4WURA 3Q3NC 4BBNC 2LVQA 3QJZA 4URKA 1VJKA 1WYWB 1S1QB 1EUVB 3W5VB 2ZPYA 3V6EB 4GDLA 3B2GA 3PRMB 3DBRB 3PREA 1ZOYB 1CZPA 4L2YA 1ZDXA 3SU8X 1WJ6A 3HVDA 4EKUA 2MRPA 2R2QA 5LXHA 4KIKB 2WXHA 2N7EA 1T0SC 3DBSA 3RCZA 1HXYD 5BYSA 1SGHA 1E7VA 1YOVB 4L1BA 1DGJA 4PYUA 4WWMA 3A9KB 1HEZE 3ZJTA 2WXRA 4R3DA 4KSLC 2X8XX 1IBXB 3HM3A 4RNAA 1EU4A 2KQSA 1SIFA 4ARCA 4M0WA 4B0EA 4DXFA 4F1SA 2YEPF 1NI3A 1CK1A 4W9GA 1FD6A 2LI5A 1SJHD 1P1AA 1G6JA 4YTNB 1OQQA 4KKJA 1V86A 4E71A 3RFZB 5AEKB 2DYBA 3APDA 1QQRA 3N1YC 4ANXA 2AWTA 3RNCC 5MPOA 1H4RA 2BS4B 4LNNA 2D11A 1HZ6A 5EE3A 1HTOA 4BKGA 1EWCA 1ZDVA 1BXTA 4IOIE 4MH8A 2YLMA 2RDHA 3DCGA 2KWCA 1QF6A 3RNGC 4PS8A 4M01A 1FNVA 1F1HA 3TUOA 4ZHOA 4XE0A 3OAWA 1WGKA 2MBEA 3W9CB 2MCNB 2PE9A 5HFYA 2VZKD 1JCKB 1Q5WB 3EECA 2EKIA 1FXIA 3A4SC 2NCNA 3BY4B 3PO0A 5TSSA 5EE9A 4FHKA 2JU6X 2JY6A 2IO3B 1P9DU 3V61A 1J0GA 2ZPNA 1WE7A 4GLSC 4RGTA 3ZRCA 1D3ZA 1E7PB 2R61A 1K51A 4X57B 3QX1A 3D32A 4YSZB 4I6LB 4FHJA 4NQLB 5CHFA 2JF5A 2JRIB 2HE7A 5FKAC 1A5RA 4B0MA 1Y56A 1XEEA 4C7ZA 1I42A 4OVZA 3V62A 2L1AA 1FEHA 2AQ3B 2A5UA 2JZPA 1WIAA 3VR8B 1L4DB 1LFDA 4A3PA 4REZA 1KTKA 4XC2A 1TYGB 2NPTA 4BFRA 1TKGA 3L08A 1QOAA 2FIFA 4GOCA 4BZAA 3BVZA 1VCBA 2RGFA 3AEFB 3RNEC 4K1RB 5IOIA 1Q0WB 1SIJA 1UWXA 5J18A 2KACA 3AE8B 2BB5A 1MJDA 2VZKB 4XX5A 3VDZA 3ZDTA 3TEXA 1I4RA 4HPPA 4J3OD 1B1ZA 2VH2A 2DNFA 2Y5CA 2K9XA 1YN3A 4FN2A 1WYGA 3U2SC 4BKSA 2L00B 4YTMB 3AE4B 3OG5A 3AE5B 3Q3JA 4G3XB 3EFUA 1L0YB 2DAFA 3SEBA 3WCQA 2LJIA 5E6JA 2DHZA 1VR9A 2KDMA 1NBFC 3T3NA 1MG4A 1V8CA 2JXTA 3X23A 3L54A 3A1QB 2KX3A 1QILA 4OVVA 4LNOA 4MDKE 2ICIA 2GBJA 4HXDA 1PGXA 2KX0A 3IVFA 3HVZA 1L4ZB 4IM3A 1TY0A 4DXAB 3Q6BA 2IGHA 1T3QA 4RF0A 2BS3B 4JPSA 4HWIB 4N59A 3W1SC 3E56A 1PFDA 1UUPA 2N9PC 2ZVOA 3DBLI 2WXGA 1N5XA 1KM7A 2D07B 2JPHA 4QAYA 3AB5A 2MP2A 2Y5PA 2KC1A 3PZDA 2J0MA 2KQ7A 2HJ1A 4LTUA 1JQ4A 1FCLA 2R2OA 1WZ0A 1HZ5A 1UF0A 1C77A 2KTRB 3C0RB 3PHWB 3CIRB 3VQIA 4LJOB 3RT3B 1GB1A 3NHEB 1ET9A 3SDLC 2L76A 1LQBA 2IO0B 3ZW3A 2INCC 1V5OA 1QT9A 2OHFA 1L0XB 1R4NI 4W9LA 2QHOA 1C79A 5IP4D 3BVMA 4RH6A 2BQQA 2JZZA 1S3SG 2V3SA 3DDCB 2D10A 3H8HA 4USAA 3I3TB 3RZWC 2INPE 2BPSA 1WXMA 1WX9A 3ZTDA 2DX5B 2KDIA 3AEDB 3MJWA 5BMHA 1ET6A 5BO4B 2G9HD 3MHZA 1YQ4B 1JROA 4JWSC 1TIFA 2CHZA 1F77A 4NQKE 3Q2AC 1D6EC 3KVFB 3I5JC 3DHGC 1WGRA 4JWUC 3PRPB 1P0RA 1YMHE 2LRUA 1GJZA 4C7YA 3RNAC 5G5GA 1WI0A 2MJDA 2G4SA 2M0XA 1KF6B 3IBEA 4JQWC 4HJGE 1FRDA 1DOIA 2ZEQA 2KMAA 4GB9A 3ZO5B 1ZPSA 4P1CC 4B95A 4GDLB 3T3OA 4RM8A 3KH0A 2KQ4X 2M4NA 3IFWB 3V6CB 2I1KA 4ICUA 2Z0EB 3ZNZB 2IGDA 4LNFA 1TBEA 4ZRKA 2BYFA 1TS2A 2ZZPB 1F0ZA 4WWNA 3I63C 2AQ2B 2L32A 3R66C 3IT4B 3NY5A 3AMZA 4GIVA 3WAPA 3N9YC 4MACA 2K1FA 5C23A 1J8CA 4ANVA 2D3BA 4TQ0A 4LNKA 3FKYA 4M0WB 2LHEA 1Q10A 2MJEA 3AEEB 2DZKA 1IGCA 3R2TA 3QHTA 2GBMA 4II3B 1SSNA 5IAAC 2EELA 2KK8A 2N9KA 5E6OA 3AU4A 1GG3A 2KJ6A 4K7SA 2UWQA 5TR5A 4Q2JA 2L0TA 2ONQA 1TS5A 2MW5A 2MBQA 1EO6A 3TEYA 1ZGUB 2KN4A 2BT6A 4KDLB 2J0KA 3L4PA 3MJ5A 3VUYA 1AARA 3SFEB 3N1XC 4MSMB 3AE2B 1TKYA 2NTSA 1QLBB 2I38A 4EFOA 3CMMB 4M00A 1JWBD 4FJVB 5IA7A 2AL3A 2LEKA 2RR9A 2KFKA 2BWFA 4DQOC 5JH5C 3AM9A 1JWSD 4P16A 4W9CA 3JYUA 1DOYA 3I9V1 1FRRA 3ML8A 4CQNA 3LXFA 3LYYA 2Y5BB 1PGBA 4LCDE 5GXGB 2LRWA 2B76B 3ETRA 3IT6B 4MGKE 3OJ4B 5BYQA 2FNJB 3PGEA 1K52A 1WMHB 3RI7C 1P98A 2CU3A 4TSSA 4CYEA 4M02A 3A9JB 4RGOS 3PPAA 2KLGA 5C2TB 3CWIA 1WJNA 2WYQA 3V05A 3B2FA 2JZ3B 4BKSD 4E74A 4WIPA 4KSKC 1V49A 2EMSA 1Z5SB 3KLSX 2KYWA 4TQ1A 4IKGA 3MC8A 3BVGA 1T0RC 3DHIC 1VZ7A 1A70A 3L10B 3ZXRA 3C19A 2MHJA 2PIAA 4HLEA 1EF1A 4LNIA 1XXGA 2C7HA 1WZ3A 2RD0A 3DVNV 5BMGA 2NPTB 3CF6E 5FR3A 4LK0M 3HHMA 4LDTD 1PYWD 2JXXA 3QWZB 2UU7A 1YJIA 3KUDB 2BWES 1MPEA 2MH7A 1WGHA 1M94A 2AX5A 2KWUB 4HCNB 2HTHA 3W5UB 3MC0B 3DWGC 3NVZA 4I6PA 1WH3A 1GPXA 2LXAA 2L3ZA 4J6IA 1WJUA 4WJNA 1GOZA 1LGRA 1CQVA 4ITKA 4AS1A 3TIXA 3PS6A 2X38A 1FXAA 2ZCCA 2NR2A 1RM6C 3NOBA 2WXOA 1GB4A 3KYCD 2BTEA 4DHZE 2G45B 1GC6A 1UNSA 4YSYB 3RNFC 3AECB 4GDKA 3RD2A 2G1EA 3R8BA 2KVRA 2KC2A 1OFFA 3TMPB 2JQRB 3A33B 4B9KA 4E3CA 5D6JB 5H8YE 2V4IB 3T8MA 3RNBC 1JRUA 1WF9A 3P63A 2GLSA 4RGNA 3ONSA 4HEA1 1KRHA 4LDTB 2MA9B 4P6VF 3DHHC 2OJWA 2O6VA 4IW0A 4NY0A 4IWOA 5G55A 5HKHA 4HVBA 2ACZB 2CKHB 4O1NA 2ZCBA 2N7DA 3H9DA 3GZNI 3BYTB 5J17A 4W9IA 4NPNA 1MHXA 3TSSA 1MFWA 4K7UA 4W9KA 3DBRI 1YQ3B 2RMMA 1WGYA 3EA6A 2PEAA 2DZJA 3ALBA 4HCPB 1XCQL 3BINA 1FCCC 4NNJB 3WAMA 3CSTA 2KD0A 4KKIA 2GBKA 3C8YA 1ZKHA 2WWZA 4EUTA 2J52A 3UF8A 3PHXB 4IM2A 4TUUA 3ZKJC 3TL5A 4RM9A 4ZRPA 1VLBA 1PGAA 2Z0DB 2WNMA 1WWTA 1E8WA 2WLBA 5FK9C 3UI3A 1F9JA 1LXDA 2WXLA 2MJ3A 4MH0E 3M3JA 1UELA 5EE0A 1AN8A 3W1SA 5AZHA 2KDFB 1QOGA 4NJ7A 3HM6X 1RYJA 3VR9B 1V1OA 1V9JA 4RGMA 3SD5A 2NTTA 3S2AA 3AU5A 1WE6A 1J19A 2MX2A 3SFDB 1R7SA 3M95A 4NAWA 2D3GA 2N7JA 2WXKA 1IPGA 2WHIA 1MHHE 2MBOA 3VAWA 1ZW7A 2V1YA 5IKCM 1QOFA 2L0FA 3NZUA 4TMAB 4GXBA 3AN1A 2A4ZA 3HRDD 1RFAA 4LJPB 2N9LA 4YWGG 3LDZE 2CU1A 2LGYA 3RN9C 3L16A 2N1WA 1GC7A 1WXSA 1WX8A 4ZYNA 3FILA 3KUZA 1IGDA 5JHAA 3P4RB 1TY2A 4C4VA 1F52A 4FULA 3VTVA 4MGZE 1SE9A 2K6DB 1RLFA 4WJQA 3ZNGC 1CMXB 5KHQA 5LNK1 4D2KA 2IO1B 3VFKA 4RFBA 4WQOB 4ZHPA 4KZ0A 3IXSA 3W1YA 3X0WA 2FAZA 3VRBB 1TJEA 2KXJA 2DWQA 2FCSA 1V97A 3AE1B 2IBIB 1Y8RC 2BB6A 2W9NA 3A9KA 4EZKA 1QOBA 1WR6E 2D3AA 4LLGM 3VXWA 1IUEA 1KH0A 3N1ZC 2XN9C 4WWPA 3W2DA 3BZDB 1YNTE 1OTRB 4KVGB 4ASWC 1FMAD 1TZOA 3U52E 4C80A 3Q8FA 3ML9A 2KVZA 2HDEA 1TGZB 4N9F4 2JRHA 3ABVB 3DVGX 2Y3AA 1WXVA 3BYYB 4II2B 1PUTA 3R7QA 3CSFA 2BKRB 2BYEA 1VDVA 4JGHB 5T8IA 5DPTA 4JIOU 2N9XA 2KFKB 2O2VB 4G50A 4NJ6A 1WM2A 1JW9D 4RF1A 3AE3B 1LM8B 4FJZA 4YT0B 2FUHB 2KJHB 2BVCA 2ASQA 3NVYA 1R4MB 5IO9A 2SAKA 2W82A 1N61A 1WR1A 2FCNA 4RCOA 2LZ6A 3UQAA 1N63A 2WXJA 5E6PA 3RUIB 1C4CA 4WJPA 2BS2B 5KHOA 1C4AA 2BYVE 1STEA 2PW9A 1TS4A 3U7ZA 1WY8A 3URYA 3E9SA 4HPLB 4P7IA 1MVKA 1XD3B 1C3TA 4KDIC 1PDXA 1WRDB 2WX0A 1VD2A 5E6NA 3U8ZA 2V0GA 2GMIC 3QK0A 2K22A 5D3DA 2IJ0A 4JL9A 1AWDA 4WJOA 1YJ1A 3VVWB 1WRIA 2PVOD 5HHDG 4OZAA 4ZRIA 4K3CA 2Z8LA 4BOZB 2H88B 3BK1A 4BKTA 4MM3A 1UZXB 4CO7A 3JW0X 2WP9B 2WXQA 3NJTA 4WQMA 4PK1A 3TBLD 3Q8EA 3O65B 3V60A 3APCA 2O6VD 4DDGD 1EU3A 2M8SA 4IWQA 1RFKA 3GE3C 2W3RA 2QIEB 1AW7A 3PVLA 4MEMA 2Q5WD 3L17A 4BAXA 1OQYA 2IY1B 1YJJA 2WXIA 4A90A 2JSVX 3HK0A 2M1MA 2KMMA 2PKOA 2GB1A 2KDEB 2LHDA 3KWLA 3B08A 2IY0B 2K3UA 3ZUNA 4F8CB 4I6NB 4YSXB 1E5WA 2PVGC 4ZYSA 2QSDA 3VHTC 1E90A 2BBCA 2IO2B 2WDRB 2V4LA 4G11A 4PS7A 1JMLA 4NAMA 3L0WB 3L13A 1HA5A 2RPVA 1HQRD 5EDSA 5DPRA 4AWJA 1XLQA 2NS5A 5JXVA 1ACCA 3QA8A 2FUG1 5GMVA 1PQSA 5HG2A 3RMKC 5CHVC 4TV3A 1SEBD 4GDKB 3UINB 3ZNHB 2FIDA 4K7WA 1NVID 2LGIA 1C4PA 4MJSA 3KUCB 1KLGD 2V9HA 2ZJDA 3UQBA 2E6XA 5CX3A 4ZDVA 2KANA 1YX5B 2WU5B 1TKEA 2K0PA 4B6WA 2IYDB 3A1QA 2J42A 3Q3MC 2JX5A 2LXCA 3PV1A 2CJNA 2AYOB 3AE9B 2WDTB 1SXTA 3PLUA 2LGSA 1MG8A 2XEWA 3U4EG 4PS3A 1T0QC 2B3AA 2AEHA 3M62B 2LFIA 1XLNA 3RYTA 1F2RI 3IAS1 3JSVA 1D5XC 4XDCA 1BUIC 1YD8U 4HKZE 4UDUC 3RZFA 2LASA 1FXTB 2N0SB 2GOWA 1DYQA 4OHJA 5DCNA 3DBHB 4W9JA 1NENB 3AI5A 3TEWA 2K25A 4GN1A 5AUIA 2GRIA 4HK2A 2KHWB 2ZNVC 2MEKA 2KWDA 2W55A 2N9EB 1UBQA 1IYFA 1DOXA 2CR5A 3N20C 4AJYB 3N32A 5C1ZA 3VTUA 4TKNA 3TCAA 2IGGA 1ZXHA 2K39A 2WXMA 3UIOB 3PZ8A 4DHJD 2MQJA 5CHWA 2ON8A 2FCQA 2YVCA 1D5ZC 2G4DB 1N5WA 1K50A 4WWOA 2BKFA 4W9HA 3SR6A 3V3XA 1I4GA 2DBYA 3KW5B 4MELA 2LGXA 5H92C 4IG7B 3B1LX 4XZ4A 3MC9A 4HKQA 4OVUA
chains in the Genus database with same CATH topology
1RAXA 4NNJB 4W9EA 3WAMA 4MDKE 2M17A 3CSTA 2KD0A 4DK5A 4M8MA 2GBJA 4HXDA 2KX0A 3IVFA 1UBIA 3PT2B 2PPHA 2LD9A 2DZIA 2GBKA 2MBBB 4IM3A 3K9PB 5DPSA 1ZKHA 2CHXA 2WWZA 4EUTA 1V5TA 4DXAB 5D7GA 1GNUA 4FLHA 4GMVA 3UF8A 4FJYA 4MGIE 2JUOA 3PHXB 4HWIB 4IM2A 4TUUA 2LJ5A 3W1SC 3OLMD 3ZKJC 3TL5A 2KFJA 4RM9A 2N9PC 2ZVOA 3P2BA 3T9LA 3DBLI 4A20A 1KM7A 2RSUA 2I1JA 1RRBA 2D07B 2JPHA 2Z0DB 1E8WA 2C9WB 3RULA 1XT9B 2MP2A 1F9JA 2L7RA 1E8XA 2BF8B 1LXDA 3VH3B 4MH0E 2C5LC 3M3JA 3B0AA 1UELA 2C7NB 1YQBA 3WALA 3W1SA 2O6VB 5AZHA 4FA6A 2KDFB 2AL6A 2KC1A 3PZDA 4NJ7A 3HM6X 1YX6B 2J0MA 2KKCA 2KQ7A 3PRZA 1V9JA 3EC8A 2R2OA 1WZ0A 3AULA 1XQQA 3SD5A 3K9OB 4IM0A 3R7RA 4BVUC 1E8ZA 3S2AA 4DWFA 1V2YA 3AU5A 1WE6A 2KTRB 3C0RB 3N3KB 3PHWB 1J19A 2MX2A 3VQIA 4DHJB 4HDOA 2KMCA 3LJ3A 4LJOB 1HE8A 1NI2A 3RT3B 4AOFA 1KLVA 3NHEB 3TJPA 3SDLC 3M95A 4NAWA 2D3GA 5LLIA 2L76A 1OEYJ 2IZVB 1IPGA 1LQBA 2IO0B 2LUEA 2MBOA 3VAWA 1ZW7A 3ZW3A 4RMAA 2V1YA 1V5OA 2L0FA 3NZUA 4W9FA 1R4NI 2NBUA 4KZCA 4W9LA 2QHOA 1EF5A 4GXBA 4GGQA 1X1MA 2A4ZA 2JZZA 1WX7A 1RFAA 4LJPB 3PSEB 1S3SG 2V3SA 3LDZE 3DDCB 2CU1A 2GBNA 2LGYA 3Q3FA 2D10A 1KOTA 3L16A 3I3TB 3RZWC 4FADA 2O2VA 5L95C 2N1WA 3ZLZA 1GC7A 2BPSA 4AP4C 4IC7B 4ANUA 1WXMA 1WXSA 3VTWA 1WX8A 4ZYNA 1WX9A 3KUZA 2JVCA 3QAQA 3ZTDA 3ECIA 2DX5B 2KWVB 5JHAA 2KDIA 3VUXA 4IWPA 1P3QU 1Q1OA 3MJWA 3WANA 1WJ4A 4FULA 5CTRC 3VTVA 5BO4B 4MGZE 3WAOA 1SE9A 2K6DB 1RLFA 4WJQA 3ZNGC 1CMXB 5KHQA 4HJKA 2IO1B 3VFKA 3UIPB 2KTRA 4WQOB 2CHZA 4KZ0A 3SHQA 1GUAB 4ZRJA 5G2NA 4NQKE 2MP2B 1I35A 3W1YA 2UYZB 3X0WA 2KTFA 5DPWA 3KVFB 3U30A 1WGRA 4EZLA 3PRPB 2FAZA 2PE6B 2XK5B 1P0RA 2C60A 2LRUA 2K8BA 3QCAA 1GJZA 2KXJA 3GOEA 2FCSA 2BGFA 5J2RA 3VUWA 1WI0A 2IBIB 2G4SA 2M0XA 1Y8RC 2KO3A 3IBEA 4JQWC 3ZRFA 2W9NA 2JT4B 2ZEQA 3A9KA 2KMAA 3WA0A 4EZKA 1UGMA 4GB9A 1WGDA 3PTFC 1WR6E 3ZO5B 2JWZA 1ISNA 4HDQA 4HPMB 3UGBB 3VXWA 2LVOA 3QARA 4B95A 3VH4B 4CHKA 4GDLB 1K8RB 2L05A 3KH0A 2M4NA 4RM8A 3IFWB 4WWPA 3V6CB 2I1KA 2D2QA 4ICUA 2Z0EB 2EKEC 4KVGB 1OTRB 3ZNZB 4YL8A 4ASWC 3IHPC 3M63B 3H7SA 4NAWB 4AJWA 2KDBA 1WM3A 3U7DA 3ML9A 1TBEA 2MLBA 4ZRKA 1TGZB 2BYFA 4N9F4 2GBRA 2JRHA 2OOBB 2ZZPB 3DVGX 4WWNA 2Z59B 3HIZA 1WXVA 3NS8A 4KV2A 1IP9A 3ZDMC 1UH6A 2MWSB 4II2B 3R66C 3ZTCA 3R7QA 3CSFA 3NY5A 2BKRB 2LWPA 2BYEA 4GIVA 3WAPA 2K1FA 4JGHB 1V6EA 5DPTA 4JIOU 3JVZX 2LVPA 5C23A 2N9XA 1WMHA 2KFKB 2XBBC 2O2VB 3H7PB 4G50A 4ANVA 4W9DA 1J8CA 4NJ6A 5JHBA 1WM2A 2WX1A 4TQ0A 2REXA 4EOYA 1LM8B 3PLVA 4M0WB 3A9JA 1TTNA 1U4AA 1UD7A 4FJZA 2FUHB 2HD5B 2KJHB 2XK5A 2DZKA 2ASQA 2K6QA 2MSED 2VRRB 3OJ3A 2GBMA 3DBHI 3QHTA 4II3B 5IAAC 1WR1A 2FCNA 2KK8A 4BBNC 2LVQA 3QJZA 4URKA 2LZ6A 5E6OA 3UQAA 1WYWB 2CHWA 5E6PA 1S1QB 3AU4A 1GG3A 1EUVB 2KJ6A 4K7SA 3RUIB 2UWQA 2NBVB 2ZPYA 3V6EB 4GDLA 1H8CA 5TR5A 4WJPA 3PRMB 2RPQA 5KHOA 3PREA 2L0TA 4K81A 2BYVE 1V81A 2MW5A 1WY8A 2MBQA 1WJ6A 3SU8X 4HPLB 1EO6A 2MRPA 2R2QA 4P7IA 4DBGA 4KIKB 4EKUA 4F7ZA 1ZGUB 5LXHA 4KDLB 4EEWA 1XD3B 2J0KA 2N7EA 3VUYA 2DAJA 1AARA 4KDIC 1C3TA 1WRDB 3QIJA 2WX0A 1C1YB 3DBSA 3RCZA 4MSMB 1SGHA 1E7VA 1VD2A 5E6NA 3U8ZA 4PYUA 3A9KB 1QZEA 2GMIC 3QK0A 4EFOA 3APFA 3CMMB 4JL9A 4KSLC 4FJVB 5IA7A 2AL3A 2RR9A 2ZNVB 4WJOA 2KFKA 3H6NA 3H7PA 2BWFA 3HM3A 1YJ1A 3VVWB 5D94A 2KQSA 4ZRIA 5JH5C 1SIFA 4W9CA 4BOZB 3JYUA 4F1SA 4BKTA 4MM3A 3ML8A 5JZEB 2MBHA 1UZXB 2Y5BB 4CO7A 4W9GA 3JW0X 2LGDA 3MTNB 4LCDE 2LI5A 2LRWA 1P1AA 3DPDA 1G6JA 4MGKE 3OJ4B 2FNJB 3PGEA 1WMHB 2KZRA 3TBLD 1P98A 1Z2MA 1V86A 4E71A 4CYEA 2DYMA 5LXIB 3O65B 2DYBA 5AEKB 1L2NA 2KOXA 3A9JB 3APDA 3PPAA 3V60A 2KLGA 4KIKA 3APCA 2O6VD 2OJRA 4ANXA 2AWTA 1WJNA 4DDGD 2ZVNA 2CS4A 2M8SA 1H4RA 2WYQA 4IWQA 1WGGA 2JZ3B 2D11A 4BKSD 4E74A 4KSKC 1V49A 3PVLA 4MEMA 3L17A 4MJSB 2EMSA 4BKGA 3QC8B 1OQYA 2IY1B 3HK0A 5D2MB 4BOSC 2M1MA 2KDEB 1V80A 2YLMA 3DCGA 4ANWA 2KWCA 2PJHA 2KLCA 3AXCA 3IG3A 4PS8A 3B08A 2IY0B 3ZUNA 4F8CB 1E8YA 1Z5SB 4I6NB 1E5WA 4M8NA 4TQ1A 2HJ8A 3EHVA 3VHTC 1E90A 3DVGY 2DZMA 2NVUI 2IO2B 3MHSD 2V4LA 4G11A 3L10B 4PS7A 3OAWA 2DYOA 2MBEA 4GU2A 4HLEA 1EF1A 3L0WB 3L13A 2MCNB 2PE9A 3A4RA 2C7HA 5EDSA 3ZNID 4WAAA 5DPRA 1WZ3A 2RD0A 3DVNV 3NZSA 4PYZA 5AZFA 2NPTB 4G0NB 4AWJA 1Q5WB 3CF6E 3EECA 3HHMA 2NS5A 4LDTD 3A4SC 2NCNA 4GSWA 3BY4B 5GMVA 3QA8A 2JXXA 2G3QB 3JSVB 4FHKA 2JY6A 1PQSA 2IO3B 3DOWA 3QWZB 1P9DU 3V61A 1J0GA 2ZPNA 1WE7A 4TV3A 4GDKB 5CHVC 3UINB 3ZNHB 2FIDA 4K7WA 3KUDB 3ZRCA 1D3ZA 4MJSA 2BWES 4X57B 4FBJB 1WGHA 3KUCB 1M94A 2ZJDA 3UQBA 2K8HA 3QX1A 2KWUB 3D32A 4HCNB 1OGWA 3H1UA 2HTHA 4DHZB 4MSQB 5CX3A 4I6LB 1OEYA 4FHJA 4ZDVA 4JLCA 4NQLB 2KANA 1YX5B 2JF5A 4I6PA 5CHFA 1WH3A 2LXAA 3QQ8B 2L3ZA 4J6IA 4B6WA 1WJUA 2JRIB 2HE7A 2KJRA 1A5RA 2IYDB 4WJNA 1I42A 4IUMB 2L8JA 3DQVA 3V62A 1T0YA 3A1QA 2FCMA 3KYDD 3TIXA 2A5UA 2EMTA 2LXCA 1WIAA 3PS6A 4DDID 2ZCCA 2N1VA 2NR2A 1LFDA 3PV1A 3NOBA 4MGYE 4A3PA 2AYOB 1NDDA 2WDTB 3PLUA 2J0JA 1L7YA 2NPTA 4XC2A 1MG8A 2XEWA 4BFRA 3KYCD 3L08A 2FIFA 4PS3A 4GOCA 2B3AA 2AEHA 4DHZE 1WXAA 2G45B 3R3MA 4AUQC 1VCBA 3M62B 2RGFA 1GC6A 3RYTA 3ZVVA 3JSVA 4K1RB 1BT0A 2KNBA 1YD8U 4BBNF 1Q0WB 4GDKA 2LASA 2DENB 3RD2A 3RZFA 1FXTB 5J18A 2KVRA 2GOWA 2KC2A 3ENEA 3TMPB 3A33B 4B9KA 4E3CA 5DCNA 5D6JB 4XX5A 2J7QB 3VDZA 3T8MA 4W9JA 3ZDTA 3AI5A 3DVNU 1JRUA 1WF9A 4A3OA 2K25A 3ONSA 4GN1A 4LDTB 2MA9B 4HK2A 2KHWB 2ZNVC 1TZ1A 2O6VA 2N9EB 4FN2A 1UBQA 1IYFA 2CR5A 4ICVA 4IW0A 4NY0A 4AJYB 4IWOA 3ZIMA 5FR6A 3N32A 4BKSA 5G55A 5HKHA 4HVBA 2L00B 5C1ZA 3VTUA 2NBWB 4TKNA 3Q3JA 1YIWA 2CKHB 2KN5A 4G3XB 3TCAA 1KJTA 3EFUA 2ZCBA 2DAFA 2N4FA 2K39A 2N7DA 3H9DA 3UIOB 3GZNI 4DHJD 2K8CA 5J17A 1R4MI 4W9IA 2MQJA 3WIMA 4NPNA 5CHWA 2YVCA 2FCQA 3N30A 2G4DB 2DHZA 4EZJA 4WWOA 4K7UA 1NBFC 2BKFA 4W9HA 1WFYA 2C7MB 4MELA 3KW5B 5L83A 4W9KA 2LGXA 3X23A 4IG7B 3B1LX 3L54A 3DBRI 4XZ4A 1WGYA 3A1QB 5AZGA 1E7UA 2DZJA 2KX3A 2PEAA 3ALBA 4OVUA 4OVVA 4HCPB 3BINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RAX A;  4NNJ B;  4W9E A;  3WAM A;  4MDK E;  2M17 A;  3CST A;  2KD0 A;  4DK5 A;  4M8M A;  2GBJ A;  4HXD A;  2KX0 A;  3IVF A;  1UBI A;  3PT2 B;  2PPH A;  2LD9 A;  2DZI A;  2GBK A;  2MBB B;  4IM3 A;  3K9P B;  5DPS A;  1ZKH A;  2CHX A;  2WWZ A;  4EUT A;  1V5T A;  4DXA B;  5D7G A;  1GNU A;  4FLH A;  4GMV A;  3UF8 A;  4FJY A;  4MGI E;  2JUO A;  3PHX B;  4HWI B;  4IM2 A;  4TUU A;  2LJ5 A;  3W1S C;  3OLM D;  3ZKJ C;  3TL5 A;  2KFJ A;  4RM9 A;  2N9P C;  2ZVO A;  3P2B A;  3T9L A;  3DBL I;  4A20 A;  1KM7 A;  2RSU A;  2I1J A;  1RRB A;  2D07 B;  2JPH A;  2Z0D B;  1E8W A;  2C9W B;  3RUL A;  1XT9 B;  2MP2 A;  1F9J A;  2L7R A;  1E8X A;  2BF8 B;  1LXD A;  3VH3 B;  4MH0 E;  2C5L C;  3M3J A;  3B0A A;  1UEL A;  2C7N B;  1YQB A;  3WAL A;  3W1S A;  2O6V B;  5AZH A;  4FA6 A;  2KDF B;  2AL6 A;  2KC1 A;  3PZD A;  4NJ7 A;  3HM6 X;  1YX6 B;  2J0M A;  2KKC A;  2KQ7 A;  3PRZ A;  1V9J A;  3EC8 A;  2R2O A;  1WZ0 A;  3AUL A;  1XQQ A;  3SD5 A;  3K9O B;  4IM0 A;  3R7R A;  4BVU C;  1E8Z A;  3S2A A;  4DWF A;  1V2Y A;  3AU5 A;  1WE6 A;  2KTR B;  3C0R B;  3N3K B;  3PHW B;  1J19 A;  2MX2 A;  3VQI A;  4DHJ B;  4HDO A;  2KMC A;  3LJ3 A;  4LJO B;  1HE8 A;  1NI2 A;  3RT3 B;  4AOF A;  1KLV A;  3NHE B;  3TJP A;  3SDL C;  3M95 A;  4NAW A;  2D3G A;  5LLI A;  2L76 A;  1OEY J;  2IZV B;  1IPG A;  1LQB A;  2IO0 B;  2LUE A;  2MBO A;  3VAW A;  1ZW7 A;  3ZW3 A;  4RMA A;  2V1Y A;  1V5O A;  2L0F A;  3NZU A;  4W9F A;  1R4N I;  2NBU A;  4KZC A;  4W9L A;  2QHO A;  1EF5 A;  4GXB A;  4GGQ A;  1X1M A;  2A4Z A;  2JZZ A;  1WX7 A;  1RFA A;  4LJP B;  3PSE B;  1S3S G;  2V3S A;  3LDZ E;  3DDC B;  2CU1 A;  2GBN A;  2LGY A;  3Q3F A;  2D10 A;  1KOT A;  3L16 A;  3I3T B;  3RZW C;  4FAD A;  2O2V A;  5L95 C;  2N1W A;  3ZLZ A;  1GC7 A;  2BPS A;  4AP4 C;  4IC7 B;  4ANU A;  1WXM A;  1WXS A;  3VTW A;  1WX8 A;  4ZYN A;  1WX9 A;  3KUZ A;  2JVC A;  3QAQ A;  3ZTD A;  3ECI A;  2DX5 B;  2KWV B;  5JHA A;  2KDI A;  3VUX A;  4IWP A;  1P3Q U;  1Q1O A;  3MJW A;  3WAN A;  1WJ4 A;  4FUL A;  5CTR C;  3VTV A;  5BO4 B;  4MGZ E;  3WAO A;  1SE9 A;  2K6D B;  1RLF A;  4WJQ A;  3ZNG C;  1CMX B;  5KHQ A;  4HJK A;  2IO1 B;  3VFK A;  3UIP B;  2KTR A;  4WQO B;  2CHZ A;  4KZ0 A;  3SHQ A;  1GUA B;  4ZRJ A;  5G2N A;  4NQK E;  2MP2 B;  1I35 A;  3W1Y A;  2UYZ B;  3X0W A;  2KTF A;  5DPW A;  3KVF B;  3U30 A;  1WGR A;  4EZL A;  3PRP B;  2FAZ A;  2PE6 B;  2XK5 B;  1P0R A;  2C60 A;  2LRU A;  2K8B A;  3QCA A;  1GJZ A;  2KXJ A;  3GOE A;  2FCS A;  2BGF A;  5J2R A;  3VUW A;  1WI0 A;  2IBI B;  2G4S A;  2M0X A;  1Y8R C;  2KO3 A;  3IBE A;  4JQW C;  3ZRF A;  2W9N A;  2JT4 B;  2ZEQ A;  3A9K A;  2KMA A;  3WA0 A;  4EZK A;  1UGM A;  4GB9 A;  1WGD A;  3PTF C;  1WR6 E;  3ZO5 B;  2JWZ A;  1ISN A;  4HDQ A;  4HPM B;  3UGB B;  3VXW A;  2LVO A;  3QAR A;  4B95 A;  3VH4 B;  4CHK A;  4GDL B;  1K8R B;  2L05 A;  3KH0 A;  2M4N A;  4RM8 A;  3IFW B;  4WWP A;  3V6C B;  2I1K A;  2D2Q A;  4ICU A;  2Z0E B;  2EKE C;  4KVG B;  1OTR B;  3ZNZ B;  4YL8 A;  4ASW C;  3IHP C;  3M63 B;  3H7S A;  4NAW B;  4AJW A;  2KDB A;  1WM3 A;  3U7D A;  3ML9 A;  1TBE A;  2MLB A;  4ZRK A;  1TGZ B;  2BYF A;  4N9F 4;  2GBR A;  2JRH A;  2OOB B;  2ZZP B;  3DVG X;  4WWN A;  2Z59 B;  3HIZ A;  1WXV A;  3NS8 A;  4KV2 A;  1IP9 A;  3ZDM C;  1UH6 A;  2MWS B;  4II2 B;  3R66 C;  3ZTC A;  3R7Q A;  3CSF A;  3NY5 A;  2BKR B;  2LWP A;  2BYE A;  4GIV A;  3WAP A;  2K1F A;  4JGH B;  1V6E A;  5DPT A;  4JIO U;  3JVZ X;  2LVP A;  5C23 A;  2N9X A;  1WMH A;  2KFK B;  2XBB C;  2O2V B;  3H7P B;  4G50 A;  4ANV A;  4W9D A;  1J8C A;  4NJ6 A;  5JHB A;  1WM2 A;  2WX1 A;  4TQ0 A;  2REX A;  4EOY A;  1LM8 B;  3PLV A;  4M0W B;  3A9J A;  1TTN A;  1U4A A;  1UD7 A;  4FJZ A;  2FUH B;  2HD5 B;  2KJH B;  2XK5 A;  2DZK A;  2ASQ A;  2K6Q A;  2MSE D;  2VRR B;  3OJ3 A;  2GBM A;  3DBH I;  3QHT A;  4II3 B;  5IAA C;  1WR1 A;  2FCN A;  2KK8 A;  4BBN C;  2LVQ A;  3QJZ A;  4URK A;  2LZ6 A;  5E6O A;  3UQA A;  1WYW B;  2CHW A;  5E6P A;  1S1Q B;  3AU4 A;  1GG3 A;  1EUV B;  2KJ6 A;  4K7S A;  3RUI B;  2UWQ A;  2NBV B;  2ZPY A;  3V6E B;  4GDL A;  1H8C A;  5TR5 A;  4WJP A;  3PRM B;  2RPQ A;  5KHO A;  3PRE A;  2L0T A;  4K81 A;  2BYV E;  1V81 A;  2MW5 A;  1WY8 A;  2MBQ A;  1WJ6 A;  3SU8 X;  4HPL B;  1EO6 A;  2MRP A;  2R2Q A;  4P7I A;  4DBG A;  4KIK B;  4EKU A;  4F7Z A;  1ZGU B;  5LXH A;  4KDL B;  4EEW A;  1XD3 B;  2J0K A;  2N7E A;  3VUY A;  2DAJ A;  1AAR A;  4KDI C;  1C3T A;  1WRD B;  3QIJ A;  2WX0 A;  1C1Y B;  3DBS A;  3RCZ A;  4MSM B;  1SGH A;  1E7V A;  1VD2 A;  5E6N A;  3U8Z A;  4PYU A;  3A9K B;  1QZE A;  2GMI C;  3QK0 A;  4EFO A;  3APF A;  3CMM B;  4JL9 A;  4KSL C;  4FJV B;  5IA7 A;  2AL3 A;  2RR9 A;  2ZNV B;  4WJO A;  2KFK A;  3H6N A;  3H7P A;  2BWF A;  3HM3 A;  1YJ1 A;  3VVW B;  5D94 A;  2KQS A;  4ZRI A;  5JH5 C;  1SIF A;  4W9C A;  4BOZ B;  3JYU A;  4F1S A;  4BKT A;  4MM3 A;  3ML8 A;  5JZE B;  2MBH A;  1UZX B;  2Y5B B;  4CO7 A;  4W9G A;  3JW0 X;  2LGD A;  3MTN B;  4LCD E;  2LI5 A;  2LRW A;  1P1A A;  3DPD A;  1G6J A;  4MGK E;  3OJ4 B;  2FNJ B;  3PGE A;  1WMH B;  2KZR A;  3TBL D;  1P98 A;  1Z2M A;  1V86 A;  4E71 A;  4CYE A;  2DYM A;  5LXI B;  3O65 B;  2DYB A;  5AEK B;  1L2N A;  2KOX A;  3A9J B;  3APD A;  3PPA A;  3V60 A;  2KLG A;  4KIK A;  3APC A;  2O6V D;  2OJR A;  4ANX A;  2AWT A;  1WJN A;  4DDG D;  2ZVN A;  2CS4 A;  2M8S A;  1H4R A;  2WYQ A;  4IWQ A;  1WGG A;  2JZ3 B;  2D11 A;  4BKS D;  4E74 A;  4KSK C;  1V49 A;  3PVL A;  4MEM A;  3L17 A;  4MJS B;  2EMS A;  4BKG A;  3QC8 B;  1OQY A;  2IY1 B;  3HK0 A;  5D2M B;  4BOS C;  2M1M A;  2KDE B;  1V80 A;  2YLM A;  3DCG A;  4ANW A;  2KWC A;  2PJH A;  2KLC A;  3AXC A;  3IG3 A;  4PS8 A;  3B08 A;  2IY0 B;  3ZUN A;  4F8C B;  1E8Y A;  1Z5S B;  4I6N B;  1E5W A;  4M8N A;  4TQ1 A;  2HJ8 A;  3EHV A;  3VHT C;  1E90 A;  3DVG Y;  2DZM A;  2NVU I;  2IO2 B;  3MHS D;  2V4L A;  4G11 A;  3L10 B;  4PS7 A;  3OAW A;  2DYO A;  2MBE A;  4GU2 A;  4HLE A;  1EF1 A;  3L0W B;  3L13 A;  2MCN B;  2PE9 A;  3A4R A;  2C7H A;  5EDS A;  3ZNI D;  4WAA A;  5DPR A;  1WZ3 A;  2RD0 A;  3DVN V;  3NZS A;  4PYZ A;  5AZF A;  2NPT B;  4G0N B;  4AWJ A;  1Q5W B;  3CF6 E;  3EEC A;  3HHM A;  2NS5 A;  4LDT D;  3A4S C;  2NCN A;  4GSW A;  3BY4 B;  5GMV A;  3QA8 A;  2JXX A;  2G3Q B;  3JSV B;  4FHK A;  2JY6 A;  1PQS A;  2IO3 B;  3DOW A;  3QWZ B;  1P9D U;  3V61 A;  1J0G A;  2ZPN A;  1WE7 A;  4TV3 A;  4GDK B;  5CHV C;  3UIN B;  3ZNH B;  2FID A;  4K7W A;  3KUD B;  3ZRC A;  1D3Z A;  4MJS A;  2BWE S;  4X57 B;  4FBJ B;  1WGH A;  3KUC B;  1M94 A;  2ZJD A;  3UQB A;  2K8H A;  3QX1 A;  2KWU B;  3D32 A;  4HCN B;  1OGW A;  3H1U A;  2HTH A;  4DHZ B;  4MSQ B;  5CX3 A;  4I6L B;  1OEY A;  4FHJ A;  4ZDV A;  4JLC A;  4NQL B;  2KAN A;  1YX5 B;  2JF5 A;  4I6P A;  5CHF A;  1WH3 A;  2LXA A;  3QQ8 B;  2L3Z A;  4J6I A;  4B6W A;  1WJU A;  2JRI B;  2HE7 A;  2KJR A;  1A5R A;  2IYD B;  4WJN A;  1I42 A;  4IUM B;  2L8J A;  3DQV A;  3V62 A;  1T0Y A;  3A1Q A;  2FCM A;  3KYD D;  3TIX A;  2A5U A;  2EMT A;  2LXC A;  1WIA A;  3PS6 A;  4DDI D;  2ZCC A;  2N1V A;  2NR2 A;  1LFD A;  3PV1 A;  3NOB A;  4MGY E;  4A3P A;  2AYO B;  1NDD A;  2WDT B;  3PLU A;  2J0J A;  1L7Y A;  2NPT A;  4XC2 A;  1MG8 A;  2XEW A;  4BFR A;  3KYC D;  3L08 A;  2FIF A;  4PS3 A;  4GOC A;  2B3A A;  2AEH A;  4DHZ E;  1WXA A;  2G45 B;  3R3M A;  4AUQ C;  1VCB A;  3M62 B;  2RGF A;  1GC6 A;  3RYT A;  3ZVV A;  3JSV A;  4K1R B;  1BT0 A;  2KNB A;  1YD8 U;  4BBN F;  1Q0W B;  4GDK A;  2LAS A;  2DEN B;  3RD2 A;  3RZF A;  1FXT B;  5J18 A;  2KVR A;  2GOW A;  2KC2 A;  3ENE A;  3TMP B;  3A33 B;  4B9K A;  4E3C A;  5DCN A;  5D6J B;  4XX5 A;  2J7Q B;  3VDZ A;  3T8M A;  4W9J A;  3ZDT A;  3AI5 A;  3DVN U;  1JRU A;  1WF9 A;  4A3O A;  2K25 A;  3ONS A;  4GN1 A;  4LDT B;  2MA9 B;  4HK2 A;  2KHW B;  2ZNV C;  1TZ1 A;  2O6V A;  2N9E B;  4FN2 A;  1UBQ A;  1IYF A;  2CR5 A;  4ICV A;  4IW0 A;  4NY0 A;  4AJY B;  4IWO A;  3ZIM A;  5FR6 A;  3N32 A;  4BKS A;  5G55 A;  5HKH A;  4HVB A;  2L00 B;  5C1Z A;  3VTU A;  2NBW B;  4TKN A;  3Q3J A;  1YIW A;  2CKH B;  2KN5 A;  4G3X B;  3TCA A;  1KJT A;  3EFU A;  2ZCB A;  2DAF A;  2N4F A;  2K39 A;  2N7D A;  3H9D A;  3UIO B;  3GZN I;  4DHJ D;  2K8C A;  5J17 A;  1R4M I;  4W9I A;  2MQJ A;  3WIM A;  4NPN A;  5CHW A;  2YVC A;  2FCQ A;  3N30 A;  2G4D B;  2DHZ A;  4EZJ A;  4WWO A;  4K7U A;  1NBF C;  2BKF A;  4W9H A;  1WFY A;  2C7M B;  4MEL A;  3KW5 B;  5L83 A;  4W9K A;  2LGX A;  3X23 A;  4IG7 B;  3B1L X;  3L54 A;  3DBR I;  4XZ4 A;  1WGY A;  3A1Q B;  5AZG A;  1E7U A;  2DZJ A;  2KX3 A;  2PEA A;  3ALB A;  4OVU A;  4OVV A;  4HCP B;  3BIN A; 
#chains in the Genus database with same CATH topology
 1ROE A;  2BW2 A;  4WH4 A;  1ZP0 B;  4DK5 A;  2LMC A;  1V1P A;  1UBI A;  4US8 A;  2DZI A;  2MBB B;  2YEP B;  5DPS A;  2CHX A;  4NZL B;  5D7G A;  4FLH A;  3ZQ4 A;  4MGI E;  1L0V B;  2JUO A;  1MI0 A;  3DWM A;  4K3B A;  3OLM D;  1T6B X;  1I4Q A;  2KFJ A;  3NZ3 A;  3T9L A;  3IAM 1;  4A20 A;  5D3I B;  2QC8 A;  2RSU A;  2I1J A;  1RRB A;  1LO5 D;  4KX6 B;  1EM7 A;  2C9W B;  1XT9 B;  2L7R A;  3VH3 B;  1E8X A;  2BF8 B;  3ZXV A;  3FIL B;  4AQ7 A;  3NG0 A;  2C7N B;  3WAL A;  4XDD A;  5EE1 A;  4FA6 A;  1YX6 B;  2M19 A;  4C4V B;  1E0Z A;  4BVU C;  1E8Z A;  1V2Y A;  4A6Q A;  4DHJ B;  1HE8 A;  1NI2 A;  3AEA B;  5LLI A;  1SB3 C;  2IZV B;  5BYR A;  1FNU A;  4RMA A;  4P1B C;  4ACF A;  4W9F A;  2NBU A;  4KZC A;  2AQ1 B;  1EF5 A;  2WU2 B;  2WQY B;  1NYQ A;  1WX7 A;  3O13 A;  1KOT A;  2GBN A;  1I7H A;  1P7F A;  4FAD A;  4AP4 C;  4XYC A;  4IC7 B;  4ANU A;  5I4D A;  3VTW A;  1VRA B;  1XF5 L;  2JVC A;  2BYT A;  3ECI A;  1C78 A;  3HUI A;  1Q1O A;  1ESF A;  1UGJ A;  3WAN A;  3AEG B;  1J7B A;  1N62 A;  3NRZ A;  2TSS A;  3WAO A;  1E9M A;  1JWU D;  4S17 A;  3UIP B;  1N6Z A;  1GUA B;  4ZRJ A;  5G2N A;  2MP2 B;  1JAL A;  1I35 A;  2UYZ B;  4MT5 A;  1XO3 A;  3U30 A;  2C60 A;  3QCA A;  2BGF A;  3VUW A;  4YXD B;  3Q3O C;  2JT4 B;  2FE8 A;  3PTF C;  4IDI A;  2JWZ A;  1ISN A;  4HDQ A;  3VH4 B;  1K8R B;  2L05 A;  3MFG A;  2K5P A;  2D2Q A;  3H7S A;  2DLB A;  2D5G A;  1FFU A;  2KDB A;  3KQ4 A;  2KAJ A;  2OOB B;  3NVW A;  1B9R A;  4KV2 A;  1IP9 A;  4PT5 A;  2MWS B;  3ZTC A;  1V6E A;  1WMH A;  2XBB C;  4S0R A;  2W3S A;  2WX1 A;  4WAF A;  2REX A;  1F2R C;  4EOY A;  3PLV A;  3A9J A;  1TTN A;  4MM3 B;  2IND C;  2XK5 A;  1FM0 D;  2VRR B;  2K6Q A;  2MSE D;  3OJ3 A;  2RDG A;  1I4X A;  2CHW A;  3ZJU A;  4N58 A;  4OW0 A;  2NBV B;  1H8C A;  1FPY A;  2RPQ A;  4K81 A;  1V81 A;  2J53 A;  2W54 A;  4DBG A;  4F7Z A;  4EEW A;  2DAJ A;  3QIJ A;  1C1Y B;  1SE4 A;  1QZE A;  1L6U A;  3APF A;  1I4P A;  1XLO A;  4C56 C;  2ZNV B;  2IDY A;  1SF0 A;  2M0A A;  3H6N A;  3H7P A;  5D94 A;  2NMQ A;  3DBL B;  2XNA C;  2H89 B;  3TEZ A;  5JZE B;  2MBH A;  4JX1 C;  4ZRQ A;  2LGD A;  3MTN B;  3DPD A;  2KZR A;  4XWW A;  1Z2M A;  2DYM A;  5LXI B;  1L2N A;  2KOX A;  5C3J B;  4KIK A;  3BK2 A;  2OJR A;  2JYT A;  2ZVN A;  2CS4 A;  4ZOH C;  3LB8 C;  1WGG A;  4A55 A;  4MJS B;  1WXQ A;  3QC8 B;  5D2M B;  2KT7 A;  4BOS C;  1V80 A;  1R4N B;  4ANW A;  2PJH A;  2KLC A;  3AXC A;  3IG3 A;  1IBX A;  4L23 A;  1E8Y A;  4M8N A;  3ZYY X;  3Q14 C;  4YTP B;  2HJ8 A;  3EHV A;  2SEB D;  3P4P B;  3DVG Y;  3GB1 A;  1VZ8 A;  2DZM A;  2NVU I;  3MHS D;  1KFY B;  3AEB B;  1CJE A;  2DYO A;  4GU2 A;  2QCZ A;  1E6E B;  3J9C A;  1P7E A;  1E10 A;  4KGR A;  3A4R A;  2PTL A;  3ZNI D;  4WAA A;  2L52 A;  4PYZ A;  3NZS A;  5AZF A;  4G0N B;  3EUB 2;  2FBW B;  3Q8C A;  4GSW A;  4KGT A;  2G3Q B;  3JSV B;  3DOW A;  2VH1 A;  2ZW0 A;  3GP7 A;  4FBJ B;  2WXP A;  3Q69 A;  1SE3 A;  1RWS A;  2K8H A;  2WXF A;  1OGW A;  3H1U A;  4DHZ B;  4HRO A;  4MSQ B;  1OEY A;  4JLC A;  2WDV B;  4XGA B;  3QQ8 B;  1GAQ B;  2KJR A;  3BII D;  4IUM B;  2L8J A;  3DQV A;  1T0Y A;  4A9A A;  1M4V A;  2FCM A;  3KYD D;  2EMT A;  4DDI D;  2M56 B;  2INN E;  2N1V A;  5G5H A;  4MGY E;  1NDD A;  1J7A A;  1JWA D;  2J0J A;  1L7Y A;  1UWM A;  2GI9 A;  1WXA A;  4AUQ C;  3R3M A;  1JWM D;  1QKZ A;  3ZVV A;  1BT0 A;  2KNB A;  3B9J A;  4BBN F;  2DEN B;  1ZUD 2;  3ENE A;  2J7Q B;  3P1M A;  1XCT L;  1V1P B;  3DVN U;  4A3O A;  1ENF A;  4JE3 B;  5IN7 A;  1J7C A;  1TZ1 A;  3GS2 A;  2LUM A;  4ICV A;  3ZIM A;  5FR6 A;  3ZJV A;  3FAH A;  2NBW B;  1YIW A;  2KN5 A;  1KJT A;  4A8X C;  2N4F A;  2K8C A;  1R4M I;  3WIM A;  2IPK D;  3OWE B;  3N30 A;  4DXG A;  4EZJ A;  2I2Y A;  4H2A A;  1NEK B;  1SJE D;  2QDF A;  1WFY A;  2C7M B;  5L83 A;  1ZE3 D;  1L5P A;  5AZG A;  1E7U A;  2QEJ C;  4C00 A;  1SE2 A;  3R2I A;  3BWU D;  2OED A;  3AV8 A;  1RAX A;  4W9E A;  2M17 A;  4M8M A;  3MP9 A;  2PPH A;  3PT2 B;  2LD9 A;  1N60 A;  3EGR A;  3K9P B;  3P42 A;  1V5T A;  1FIQ A;  1GNU A;  4ARI A;  4GMV A;  4FJY A;  2QIL A;  3NVV A;  2JWU A;  2LJ5 A;  3P4S B;  2WGS A;  3P2B A;  1K53 A;  4XWT A;  1TT5 B;  1C9F A;  3RUL A;  2WDQ B;  2C5L C;  3B0A A;  1YQB A;  2O6V B;  2AL6 A;  1BML C;  2KKC A;  3PRZ A;  1D4B A;  3EC8 A;  3AUL A;  1XQQ A;  3K9O B;  4IM0 A;  3R7R A;  4DWF A;  1HTQ A;  3N3K B;  4HDO A;  2KMC A;  3LJ3 A;  3KWV A;  1KLV A;  4AOF A;  3I57 A;  2QJL A;  3Q8A A;  3TJP A;  1OEY J;  2LUE A;  3AH7 A;  4KGS A;  3RPF C;  2WXN A;  2CJO A;  2E3T A;  4GGQ A;  1X1M A;  3PSE B;  2ZW1 A;  3ZGZ A;  4N6E B;  3Q3F A;  1TS3 A;  2O2V A;  5L95 C;  3ZLZ A;  2JYE A;  2RDB C;  2D3C A;  1SBB B;  3QAQ A;  1FNW A;  2KWV B;  3FC4 A;  3VUX A;  4IWP A;  1P3Q U;  2HTM E;  3AE7 B;  1WJ4 A;  5CTR C;  3Q8B A;  4EE2 A;  4HJK A;  2QMT A;  2PMV A;  2KTR A;  1YN5 A;  3SHQ A;  1L6V A;  3NS1 A;  2J4X A;  1C76 A;  1VZ6 A;  5DPW A;  2KTF A;  1NYR A;  4EZL A;  1T5X D;  5AUK A;  2PE6 B;  2XK5 B;  2K8B A;  3GOE A;  5J2R A;  1I4H A;  2KO3 A;  3ZRF A;  1OQR A;  3P4Q B;  3WA0 A;  1UGM A;  1WGD A;  3PZ7 A;  3UGB B;  4HPM B;  2LVO A;  3QAR A;  4CHK A;  5HI1 A;  3AE6 B;  4US9 A;  3NUH B;  2EKE C;  4YL8 A;  2V3N A;  3IHP C;  3M63 B;  1YN4 A;  3EFC A;  4NAW B;  4AJW A;  1KLU D;  1WM3 A;  3U7D A;  2MLB A;  1AYF A;  2V3P A;  1D5M C;  2GBR A;  2Z59 B;  1FFV A;  3GE8 C;  3HIZ A;  3NS8 A;  3ZDM C;  4FXC A;  1UH6 A;  1ZXI A;  1JRP A;  2WS3 B;  2LWP A;  4HRS A;  3JVZ X;  2LVP A;  3H7P B;  4OZC A;  2L83 A;  4OZB A;  4W9D A;  5JHB A;  3VRA B;  1XLP A;  1EWY C;  4NJC A;  1U4A A;  1UD7 A;  1FO4 A;  2PLP A;  2HD5 B;  3GZN B;  3DBH I;  1WSP A;  5BMI A;  4WUR A;  3Q3N C;  4BBN C;  2LVQ A;  3QJZ A;  4URK A;  1VJK A;  1WYW B;  1S1Q B;  1EUV B;  3W5V B;  2ZPY A;  3V6E B;  4GDL A;  3B2G A;  3PRM B;  3DBR B;  3PRE A;  1ZOY B;  1CZP A;  4L2Y A;  1ZDX A;  3SU8 X;  1WJ6 A;  3HVD A;  4EKU A;  2MRP A;  2R2Q A;  5LXH A;  4KIK B;  2WXH A;  2N7E A;  1T0S C;  3DBS A;  3RCZ A;  1HXY D;  5BYS A;  1SGH A;  1E7V A;  1YOV B;  4L1B A;  1DGJ A;  4PYU A;  4WWM A;  3A9K B;  1HEZ E;  3ZJT A;  2WXR A;  4R3D A;  4KSL C;  2X8X X;  1IBX B;  3HM3 A;  4RNA A;  1EU4 A;  2KQS A;  1SIF A;  4ARC A;  4M0W A;  4B0E A;  4DXF A;  4F1S A;  2YEP F;  1NI3 A;  1CK1 A;  4W9G A;  1FD6 A;  2LI5 A;  1SJH D;  1P1A A;  1G6J A;  4YTN B;  1OQQ A;  4KKJ A;  1V86 A;  4E71 A;  3RFZ B;  5AEK B;  2DYB A;  3APD A;  1QQR A;  3N1Y C;  4ANX A;  2AWT A;  3RNC C;  5MPO A;  1H4R A;  2BS4 B;  4LNN A;  2D11 A;  1HZ6 A;  5EE3 A;  1HTO A;  4BKG A;  1EWC A;  1ZDV A;  1BXT A;  4IOI E;  4MH8 A;  2YLM A;  2RDH A;  3DCG A;  2KWC A;  1QF6 A;  3RNG C;  4PS8 A;  4M01 A;  1FNV A;  1F1H A;  3TUO A;  4ZHO A;  4XE0 A;  3OAW A;  1WGK A;  2MBE A;  3W9C B;  2MCN B;  2PE9 A;  5HFY A;  2VZK D;  1JCK B;  1Q5W B;  3EEC A;  2EKI A;  1FXI A;  3A4S C;  2NCN A;  3BY4 B;  3PO0 A;  5TSS A;  5EE9 A;  4FHK A;  2JU6 X;  2JY6 A;  2IO3 B;  1P9D U;  3V61 A;  1J0G A;  2ZPN A;  1WE7 A;  4GLS C;  4RGT A;  3ZRC A;  1D3Z A;  1E7P B;  2R61 A;  1K51 A;  4X57 B;  3QX1 A;  3D32 A;  4YSZ B;  4I6L B;  4FHJ A;  4NQL B;  5CHF A;  2JF5 A;  2JRI B;  2HE7 A;  5FKA C;  1A5R A;  4B0M A;  1Y56 A;  1XEE A;  4C7Z A;  1I42 A;  4OVZ A;  3V62 A;  2L1A A;  1FEH A;  2AQ3 B;  2A5U A;  2JZP A;  1WIA A;  3VR8 B;  1L4D B;  1LFD A;  4A3P A;  4REZ A;  1KTK A;  4XC2 A;  1TYG B;  2NPT A;  4BFR A;  1TKG A;  3L08 A;  1QOA A;  2FIF A;  4GOC A;  4BZA A;  3BVZ A;  1VCB A;  2RGF A;  3AEF B;  3RNE C;  4K1R B;  5IOI A;  1Q0W B;  1SIJ A;  1UWX A;  5J18 A;  2KAC A;  3AE8 B;  2BB5 A;  1MJD A;  2VZK B;  4XX5 A;  3VDZ A;  3ZDT A;  3TEX A;  1I4R A;  4HPP A;  4J3O D;  1B1Z A;  2VH2 A;  2DNF A;  2Y5C A;  2K9X A;  1YN3 A;  4FN2 A;  1WYG A;  3U2S C;  4BKS A;  2L00 B;  4YTM B;  3AE4 B;  3OG5 A;  3AE5 B;  3Q3J A;  4G3X B;  3EFU A;  1L0Y B;  2DAF A;  3SEB A;  3WCQ A;  2LJI A;  5E6J A;  2DHZ A;  1VR9 A;  2KDM A;  1NBF C;  3T3N A;  1MG4 A;  1V8C A;  2JXT A;  3X23 A;  3L54 A;  3A1Q B;  2KX3 A;  1QIL A;  4OVV A;  4LNO A;  4MDK E;  2ICI A;  2GBJ A;  4HXD A;  1PGX A;  2KX0 A;  3IVF A;  3HVZ A;  1L4Z B;  4IM3 A;  1TY0 A;  4DXA B;  3Q6B A;  2IGH A;  1T3Q A;  4RF0 A;  2BS3 B;  4JPS A;  4HWI B;  4N59 A;  3W1S C;  3E56 A;  1PFD A;  1UUP A;  2N9P C;  2ZVO A;  3DBL I;  2WXG A;  1N5X A;  1KM7 A;  2D07 B;  2JPH A;  4QAY A;  3AB5 A;  2MP2 A;  2Y5P A;  2KC1 A;  3PZD A;  2J0M A;  2KQ7 A;  2HJ1 A;  4LTU A;  1JQ4 A;  1FCL A;  2R2O A;  1WZ0 A;  1HZ5 A;  1UF0 A;  1C77 A;  2KTR B;  3C0R B;  3PHW B;  3CIR B;  3VQI A;  4LJO B;  3RT3 B;  1GB1 A;  3NHE B;  1ET9 A;  3SDL C;  2L76 A;  1LQB A;  2IO0 B;  3ZW3 A;  2INC C;  1V5O A;  1QT9 A;  2OHF A;  1L0X B;  1R4N I;  4W9L A;  2QHO A;  1C79 A;  5IP4 D;  3BVM A;  4RH6 A;  2BQQ A;  2JZZ A;  1S3S G;  2V3S A;  3DDC B;  2D10 A;  3H8H A;  4USA A;  3I3T B;  3RZW C;  2INP E;  2BPS A;  1WXM A;  1WX9 A;  3ZTD A;  2DX5 B;  2KDI A;  3AED B;  3MJW A;  5BMH A;  1ET6 A;  5BO4 B;  2G9H D;  3MHZ A;  1YQ4 B;  1JRO A;  4JWS C;  1TIF A;  2CHZ A;  1F77 A;  4NQK E;  3Q2A C;  1D6E C;  3KVF B;  3I5J C;  3DHG C;  1WGR A;  4JWU C;  3PRP B;  1P0R A;  1YMH E;  2LRU A;  1GJZ A;  4C7Y A;  3RNA C;  5G5G A;  1WI0 A;  2MJD A;  2G4S A;  2M0X A;  1KF6 B;  3IBE A;  4JQW C;  4HJG E;  1FRD A;  1DOI A;  2ZEQ A;  2KMA A;  4GB9 A;  3ZO5 B;  1ZPS A;  4P1C C;  4B95 A;  4GDL B;  3T3O A;  4RM8 A;  3KH0 A;  2KQ4 X;  2M4N A;  3IFW B;  3V6C B;  2I1K A;  4ICU A;  2Z0E B;  3ZNZ B;  2IGD A;  4LNF A;  1TBE A;  4ZRK A;  2BYF A;  1TS2 A;  2ZZP B;  1F0Z A;  4WWN A;  3I63 C;  2AQ2 B;  2L32 A;  3R66 C;  3IT4 B;  3NY5 A;  3AMZ A;  4GIV A;  3WAP A;  3N9Y C;  4MAC A;  2K1F A;  5C23 A;  1J8C A;  4ANV A;  2D3B A;  4TQ0 A;  4LNK A;  3FKY A;  4M0W B;  2LHE A;  1Q10 A;  2MJE A;  3AEE B;  2DZK A;  1IGC A;  3R2T A;  3QHT A;  2GBM A;  4II3 B;  1SSN A;  5IAA C;  2EEL A;  2KK8 A;  2N9K A;  5E6O A;  3AU4 A;  1GG3 A;  2KJ6 A;  4K7S A;  2UWQ A;  5TR5 A;  4Q2J A;  2L0T A;  2ONQ A;  1TS5 A;  2MW5 A;  2MBQ A;  1EO6 A;  3TEY A;  1ZGU B;  2KN4 A;  2BT6 A;  4KDL B;  2J0K A;  3L4P A;  3MJ5 A;  3VUY A;  1AAR A;  3SFE B;  3N1X C;  4MSM B;  3AE2 B;  1TKY A;  2NTS A;  1QLB B;  2I38 A;  4EFO A;  3CMM B;  4M00 A;  1JWB D;  4FJV B;  5IA7 A;  2AL3 A;  2LEK A;  2RR9 A;  2KFK A;  2BWF A;  4DQO C;  5JH5 C;  3AM9 A;  1JWS D;  4P16 A;  4W9C A;  3JYU A;  1DOY A;  3I9V 1;  1FRR A;  3ML8 A;  4CQN A;  3LXF A;  3LYY A;  2Y5B B;  1PGB A;  4LCD E;  5GXG B;  2LRW A;  2B76 B;  3ETR A;  3IT6 B;  4MGK E;  3OJ4 B;  5BYQ A;  2FNJ B;  3PGE A;  1K52 A;  1WMH B;  3RI7 C;  1P98 A;  2CU3 A;  4TSS A;  4CYE A;  4M02 A;  3A9J B;  4RGO S;  3PPA A;  2KLG A;  5C2T B;  3CWI A;  1WJN A;  2WYQ A;  3V05 A;  3B2F A;  2JZ3 B;  4BKS D;  4E74 A;  4WIP A;  4KSK C;  1V49 A;  2EMS A;  1Z5S B;  3KLS X;  2KYW A;  4TQ1 A;  4IKG A;  3MC8 A;  3BVG A;  1T0R C;  3DHI C;  1VZ7 A;  1A70 A;  3L10 B;  3ZXR A;  3C19 A;  2MHJ A;  2PIA A;  4HLE A;  1EF1 A;  4LNI A;  1XXG A;  2C7H A;  1WZ3 A;  2RD0 A;  3DVN V;  5BMG A;  2NPT B;  3CF6 E;  5FR3 A;  4LK0 M;  3HHM A;  4LDT D;  1PYW D;  2JXX A;  3QWZ B;  2UU7 A;  1YJI A;  3KUD B;  2BWE S;  1MPE A;  2MH7 A;  1WGH A;  1M94 A;  2AX5 A;  2KWU B;  4HCN B;  2HTH A;  3W5U B;  3MC0 B;  3DWG C;  3NVZ A;  4I6P A;  1WH3 A;  1GPX A;  2LXA A;  2L3Z A;  4J6I A;  1WJU A;  4WJN A;  1GOZ A;  1LGR A;  1CQV A;  4ITK A;  4AS1 A;  3TIX A;  3PS6 A;  2X38 A;  1FXA A;  2ZCC A;  2NR2 A;  1RM6 C;  3NOB A;  2WXO A;  1GB4 A;  3KYC D;  2BTE A;  4DHZ E;  2G45 B;  1GC6 A;  1UNS A;  4YSY B;  3RNF C;  3AEC B;  4GDK A;  3RD2 A;  2G1E A;  3R8B A;  2KVR A;  2KC2 A;  1OFF A;  3TMP B;  2JQR B;  3A33 B;  4B9K A;  4E3C A;  5D6J B;  5H8Y E;  2V4I B;  3T8M A;  3RNB C;  1JRU A;  1WF9 A;  3P63 A;  2GLS A;  4RGN A;  3ONS A;  4HEA 1;  1KRH A;  4LDT B;  2MA9 B;  4P6V F;  3DHH C;  2OJW A;  2O6V A;  4IW0 A;  4NY0 A;  4IWO A;  5G55 A;  5HKH A;  4HVB A;  2ACZ B;  2CKH B;  4O1N A;  2ZCB A;  2N7D A;  3H9D A;  3GZN I;  3BYT B;  5J17 A;  4W9I A;  4NPN A;  1MHX A;  3TSS A;  1MFW A;  4K7U A;  4W9K A;  3DBR I;  1YQ3 B;  2RMM A;  1WGY A;  3EA6 A;  2PEA A;  2DZJ A;  3ALB A;  4HCP B;  1XCQ L;  3BIN A;  1FCC C;  4NNJ B;  3WAM A;  3CST A;  2KD0 A;  4KKI A;  2GBK A;  3C8Y A;  1ZKH A;  2WWZ A;  4EUT A;  2J52 A;  3UF8 A;  3PHX B;  4IM2 A;  4TUU A;  3ZKJ C;  3TL5 A;  4RM9 A;  4ZRP A;  1VLB A;  1PGA A;  2Z0D B;  2WNM A;  1WWT A;  1E8W A;  2WLB A;  5FK9 C;  3UI3 A;  1F9J A;  1LXD A;  2WXL A;  2MJ3 A;  4MH0 E;  3M3J A;  1UEL A;  5EE0 A;  1AN8 A;  3W1S A;  5AZH A;  2KDF B;  1QOG A;  4NJ7 A;  3HM6 X;  1RYJ A;  3VR9 B;  1V1O A;  1V9J A;  4RGM A;  3SD5 A;  2NTT A;  3S2A A;  3AU5 A;  1WE6 A;  1J19 A;  2MX2 A;  3SFD B;  1R7S A;  3M95 A;  4NAW A;  2D3G A;  2N7J A;  2WXK A;  1IPG A;  2WHI A;  1MHH E;  2MBO A;  3VAW A;  1ZW7 A;  2V1Y A;  5IKC M;  1QOF A;  2L0F A;  3NZU A;  4TMA B;  4GXB A;  3AN1 A;  2A4Z A;  3HRD D;  1RFA A;  4LJP B;  2N9L A;  4YWG G;  3LDZ E;  2CU1 A;  2LGY A;  3RN9 C;  3L16 A;  2N1W A;  1GC7 A;  1WXS A;  1WX8 A;  4ZYN A;  3FIL A;  3KUZ A;  1IGD A;  5JHA A;  3P4R B;  1TY2 A;  4C4V A;  1F52 A;  4FUL A;  3VTV A;  4MGZ E;  1SE9 A;  2K6D B;  1RLF A;  4WJQ A;  3ZNG C;  1CMX B;  5KHQ A;  5LNK 1;  4D2K A;  2IO1 B;  3VFK A;  4RFB A;  4WQO B;  4ZHP A;  4KZ0 A;  3IXS A;  3W1Y A;  3X0W A;  2FAZ A;  3VRB B;  1TJE A;  2KXJ A;  2DWQ A;  2FCS A;  1V97 A;  3AE1 B;  2IBI B;  1Y8R C;  2BB6 A;  2W9N A;  3A9K A;  4EZK A;  1QOB A;  1WR6 E;  2D3A A;  4LLG M;  3VXW A;  1IUE A;  1KH0 A;  3N1Z C;  2XN9 C;  4WWP A;  3W2D A;  3BZD B;  1YNT E;  1OTR B;  4KVG B;  4ASW C;  1FMA D;  1TZO A;  3U52 E;  4C80 A;  3Q8F A;  3ML9 A;  2KVZ A;  2HDE A;  1TGZ B;  4N9F 4;  2JRH A;  3ABV B;  3DVG X;  2Y3A A;  1WXV A;  3BYY B;  4II2 B;  1PUT A;  3R7Q A;  3CSF A;  2BKR B;  2BYE A;  1VDV A;  4JGH B;  5T8I A;  5DPT A;  4JIO U;  2N9X A;  2KFK B;  2O2V B;  4G50 A;  4NJ6 A;  1WM2 A;  1JW9 D;  4RF1 A;  3AE3 B;  1LM8 B;  4FJZ A;  4YT0 B;  2FUH B;  2KJH B;  2BVC A;  2ASQ A;  3NVY A;  1R4M B;  5IO9 A;  2SAK A;  2W82 A;  1N61 A;  1WR1 A;  2FCN A;  4RCO A;  2LZ6 A;  3UQA A;  1N63 A;  2WXJ A;  5E6P A;  3RUI B;  1C4C A;  4WJP A;  2BS2 B;  5KHO A;  1C4A A;  2BYV E;  1STE A;  2PW9 A;  1TS4 A;  3U7Z A;  1WY8 A;  3URY A;  3E9S A;  4HPL B;  4P7I A;  1MVK A;  1XD3 B;  1C3T A;  4KDI C;  1PDX A;  1WRD B;  2WX0 A;  1VD2 A;  5E6N A;  3U8Z A;  2V0G A;  2GMI C;  3QK0 A;  2K22 A;  5D3D A;  2IJ0 A;  4JL9 A;  1AWD A;  4WJO A;  1YJ1 A;  3VVW B;  1WRI A;  2PVO D;  5HHD G;  4OZA A;  4ZRI A;  4K3C A;  2Z8L A;  4BOZ B;  2H88 B;  3BK1 A;  4BKT A;  4MM3 A;  1UZX B;  4CO7 A;  3JW0 X;  2WP9 B;  2WXQ A;  3NJT A;  4WQM A;  4PK1 A;  3TBL D;  3Q8E A;  3O65 B;  3V60 A;  3APC A;  2O6V D;  4DDG D;  1EU3 A;  2M8S A;  4IWQ A;  1RFK A;  3GE3 C;  2W3R A;  2QIE B;  1AW7 A;  3PVL A;  4MEM A;  2Q5W D;  3L17 A;  4BAX A;  1OQY A;  2IY1 B;  1YJJ A;  2WXI A;  4A90 A;  2JSV X;  3HK0 A;  2M1M A;  2KMM A;  2PKO A;  2GB1 A;  2KDE B;  2LHD A;  3KWL A;  3B08 A;  2IY0 B;  2K3U A;  3ZUN A;  4F8C B;  4I6N B;  4YSX B;  1E5W A;  2PVG C;  4ZYS A;  2QSD A;  3VHT C;  1E90 A;  2BBC A;  2IO2 B;  2WDR B;  2V4L A;  4G11 A;  4PS7 A;  1JML A;  4NAM A;  3L0W B;  3L13 A;  1HA5 A;  2RPV A;  1HQR D;  5EDS A;  5DPR A;  4AWJ A;  1XLQ A;  2NS5 A;  5JXV A;  1ACC A;  3QA8 A;  2FUG 1;  5GMV A;  1PQS A;  5HG2 A;  3RMK C;  5CHV C;  4TV3 A;  1SEB D;  4GDK B;  3UIN B;  3ZNH B;  2FID A;  4K7W A;  1NVI D;  2LGI A;  1C4P A;  4MJS A;  3KUC B;  1KLG D;  2V9H A;  2ZJD A;  3UQB A;  2E6X A;  5CX3 A;  4ZDV A;  2KAN A;  1YX5 B;  2WU5 B;  1TKE A;  2K0P A;  4B6W A;  2IYD B;  3A1Q A;  2J42 A;  3Q3M C;  2JX5 A;  2LXC A;  3PV1 A;  2CJN A;  2AYO B;  3AE9 B;  2WDT B;  1SXT A;  3PLU A;  2LGS A;  1MG8 A;  2XEW A;  3U4E G;  4PS3 A;  1T0Q C;  2B3A A;  2AEH A;  3M62 B;  2LFI A;  1XLN A;  3RYT A;  1F2R I;  3IAS 1;  3JSV A;  1D5X C;  4XDC A;  1BUI C;  1YD8 U;  4HKZ E;  4UDU C;  3RZF A;  2LAS A;  1FXT B;  2N0S B;  2GOW A;  1DYQ A;  4OHJ A;  5DCN A;  3DBH B;  4W9J A;  1NEN B;  3AI5 A;  3TEW A;  2K25 A;  4GN1 A;  5AUI A;  2GRI A;  4HK2 A;  2KHW B;  2ZNV C;  2MEK A;  2KWD A;  2W55 A;  2N9E B;  1UBQ A;  1IYF A;  1DOX A;  2CR5 A;  3N20 C;  4AJY B;  3N32 A;  5C1Z A;  3VTU A;  4TKN A;  3TCA A;  2IGG A;  1ZXH A;  2K39 A;  2WXM A;  3UIO B;  3PZ8 A;  4DHJ D;  2MQJ A;  5CHW A;  2ON8 A;  2FCQ A;  2YVC A;  1D5Z C;  2G4D B;  1N5W A;  1K50 A;  4WWO A;  2BKF A;  4W9H A;  3SR6 A;  3V3X A;  1I4G A;  2DBY A;  3KW5 B;  4MEL A;  2LGX A;  5H92 C;  4IG7 B;  3B1L X;  4XZ4 A;  3MC9 A;  4HKQ A;  4OVU A; 
#chains in the Genus database with same CATH homology
 1RAX A;  4NNJ B;  4W9E A;  3WAM A;  4MDK E;  2M17 A;  3CST A;  2KD0 A;  4DK5 A;  4M8M A;  2GBJ A;  4HXD A;  2KX0 A;  3IVF A;  1UBI A;  3PT2 B;  2PPH A;  2LD9 A;  2DZI A;  2GBK A;  2MBB B;  4IM3 A;  3K9P B;  5DPS A;  1ZKH A;  2CHX A;  2WWZ A;  4EUT A;  1V5T A;  4DXA B;  5D7G A;  1GNU A;  4FLH A;  4GMV A;  3UF8 A;  4FJY A;  4MGI E;  2JUO A;  3PHX B;  4HWI B;  4IM2 A;  4TUU A;  2LJ5 A;  3W1S C;  3OLM D;  3ZKJ C;  3TL5 A;  2KFJ A;  4RM9 A;  2N9P C;  2ZVO A;  3P2B A;  3T9L A;  3DBL I;  4A20 A;  1KM7 A;  2RSU A;  2I1J A;  1RRB A;  2D07 B;  2JPH A;  2Z0D B;  1E8W A;  2C9W B;  3RUL A;  1XT9 B;  2MP2 A;  1F9J A;  2L7R A;  1E8X A;  2BF8 B;  1LXD A;  3VH3 B;  4MH0 E;  2C5L C;  3M3J A;  3B0A A;  1UEL A;  2C7N B;  1YQB A;  3WAL A;  3W1S A;  2O6V B;  5AZH A;  4FA6 A;  2KDF B;  2AL6 A;  2KC1 A;  3PZD A;  4NJ7 A;  3HM6 X;  1YX6 B;  2J0M A;  2KKC A;  2KQ7 A;  3PRZ A;  1V9J A;  3EC8 A;  2R2O A;  1WZ0 A;  3AUL A;  1XQQ A;  3SD5 A;  3K9O B;  4IM0 A;  3R7R A;  4BVU C;  1E8Z A;  3S2A A;  4DWF A;  1V2Y A;  3AU5 A;  1WE6 A;  2KTR B;  3C0R B;  3N3K B;  3PHW B;  1J19 A;  2MX2 A;  3VQI A;  4DHJ B;  4HDO A;  2KMC A;  3LJ3 A;  4LJO B;  1HE8 A;  1NI2 A;  3RT3 B;  4AOF A;  1KLV A;  3NHE B;  3TJP A;  3SDL C;  3M95 A;  4NAW A;  2D3G A;  5LLI A;  2L76 A;  1OEY J;  2IZV B;  1IPG A;  1LQB A;  2IO0 B;  2LUE A;  2MBO A;  3VAW A;  1ZW7 A;  3ZW3 A;  4RMA A;  2V1Y A;  1V5O A;  2L0F A;  3NZU A;  4W9F A;  1R4N I;  2NBU A;  4KZC A;  4W9L A;  2QHO A;  1EF5 A;  4GXB A;  4GGQ A;  1X1M A;  2A4Z A;  2JZZ A;  1WX7 A;  1RFA A;  4LJP B;  3PSE B;  1S3S G;  2V3S A;  3LDZ E;  3DDC B;  2CU1 A;  2GBN A;  2LGY A;  3Q3F A;  2D10 A;  1KOT A;  3L16 A;  3I3T B;  3RZW C;  4FAD A;  2O2V A;  5L95 C;  2N1W A;  3ZLZ A;  1GC7 A;  2BPS A;  4AP4 C;  4IC7 B;  4ANU A;  1WXM A;  1WXS A;  3VTW A;  1WX8 A;  4ZYN A;  1WX9 A;  3KUZ A;  2JVC A;  3QAQ A;  3ZTD A;  3ECI A;  2DX5 B;  2KWV B;  5JHA A;  2KDI A;  3VUX A;  4IWP A;  1P3Q U;  1Q1O A;  3MJW A;  3WAN A;  1WJ4 A;  4FUL A;  5CTR C;  3VTV A;  5BO4 B;  4MGZ E;  3WAO A;  1SE9 A;  2K6D B;  1RLF A;  4WJQ A;  3ZNG C;  1CMX B;  5KHQ A;  4HJK A;  2IO1 B;  3VFK A;  3UIP B;  2KTR A;  4WQO B;  2CHZ A;  4KZ0 A;  3SHQ A;  1GUA B;  4ZRJ A;  5G2N A;  4NQK E;  2MP2 B;  1I35 A;  3W1Y A;  2UYZ B;  3X0W A;  2KTF A;  5DPW A;  3KVF B;  3U30 A;  1WGR A;  4EZL A;  3PRP B;  2FAZ A;  2PE6 B;  2XK5 B;  1P0R A;  2C60 A;  2LRU A;  2K8B A;  3QCA A;  1GJZ A;  2KXJ A;  3GOE A;  2FCS A;  2BGF A;  5J2R A;  3VUW A;  1WI0 A;  2IBI B;  2G4S A;  2M0X A;  1Y8R C;  2KO3 A;  3IBE A;  4JQW C;  3ZRF A;  2W9N A;  2JT4 B;  2ZEQ A;  3A9K A;  2KMA A;  3WA0 A;  4EZK A;  1UGM A;  4GB9 A;  1WGD A;  3PTF C;  1WR6 E;  3ZO5 B;  2JWZ A;  1ISN A;  4HDQ A;  4HPM B;  3UGB B;  3VXW A;  2LVO A;  3QAR A;  4B95 A;  3VH4 B;  4CHK A;  4GDL B;  1K8R B;  2L05 A;  3KH0 A;  2M4N A;  4RM8 A;  3IFW B;  4WWP A;  3V6C B;  2I1K A;  2D2Q A;  4ICU A;  2Z0E B;  2EKE C;  4KVG B;  1OTR B;  3ZNZ B;  4YL8 A;  4ASW C;  3IHP C;  3M63 B;  3H7S A;  4NAW B;  4AJW A;  2KDB A;  1WM3 A;  3U7D A;  3ML9 A;  1TBE A;  2MLB A;  4ZRK A;  1TGZ B;  2BYF A;  4N9F 4;  2GBR A;  2JRH A;  2OOB B;  2ZZP B;  3DVG X;  4WWN A;  2Z59 B;  3HIZ A;  1WXV A;  3NS8 A;  4KV2 A;  1IP9 A;  3ZDM C;  1UH6 A;  2MWS B;  4II2 B;  3R66 C;  3ZTC A;  3R7Q A;  3CSF A;  3NY5 A;  2BKR B;  2LWP A;  2BYE A;  4GIV A;  3WAP A;  2K1F A;  4JGH B;  1V6E A;  5DPT A;  4JIO U;  3JVZ X;  2LVP A;  5C23 A;  2N9X A;  1WMH A;  2KFK B;  2XBB C;  2O2V B;  3H7P B;  4G50 A;  4ANV A;  4W9D A;  1J8C A;  4NJ6 A;  5JHB A;  1WM2 A;  2WX1 A;  4TQ0 A;  2REX A;  4EOY A;  1LM8 B;  3PLV A;  4M0W B;  3A9J A;  1TTN A;  1U4A A;  1UD7 A;  4FJZ A;  2FUH B;  2HD5 B;  2KJH B;  2XK5 A;  2DZK A;  2ASQ A;  2K6Q A;  2MSE D;  2VRR B;  3OJ3 A;  2GBM A;  3DBH I;  3QHT A;  4II3 B;  5IAA C;  1WR1 A;  2FCN A;  2KK8 A;  4BBN C;  2LVQ A;  3QJZ A;  4URK A;  2LZ6 A;  5E6O A;  3UQA A;  1WYW B;  2CHW A;  5E6P A;  1S1Q B;  3AU4 A;  1GG3 A;  1EUV B;  2KJ6 A;  4K7S A;  3RUI B;  2UWQ A;  2NBV B;  2ZPY A;  3V6E B;  4GDL A;  1H8C A;  5TR5 A;  4WJP A;  3PRM B;  2RPQ A;  5KHO A;  3PRE A;  2L0T A;  4K81 A;  2BYV E;  1V81 A;  2MW5 A;  1WY8 A;  2MBQ A;  1WJ6 A;  3SU8 X;  4HPL B;  1EO6 A;  2MRP A;  2R2Q A;  4P7I A;  4DBG A;  4KIK B;  4EKU A;  4F7Z A;  1ZGU B;  5LXH A;  4KDL B;  4EEW A;  1XD3 B;  2J0K A;  2N7E A;  3VUY A;  2DAJ A;  1AAR A;  4KDI C;  1C3T A;  1WRD B;  3QIJ A;  2WX0 A;  1C1Y B;  3DBS A;  3RCZ A;  4MSM B;  1SGH A;  1E7V A;  1VD2 A;  5E6N A;  3U8Z A;  4PYU A;  3A9K B;  1QZE A;  2GMI C;  3QK0 A;  4EFO A;  3APF A;  3CMM B;  4JL9 A;  4KSL C;  4FJV B;  5IA7 A;  2AL3 A;  2RR9 A;  2ZNV B;  4WJO A;  2KFK A;  3H6N A;  3H7P A;  2BWF A;  3HM3 A;  1YJ1 A;  3VVW B;  5D94 A;  2KQS A;  4ZRI A;  5JH5 C;  1SIF A;  4W9C A;  4BOZ B;  3JYU A;  4F1S A;  4BKT A;  4MM3 A;  3ML8 A;  5JZE B;  2MBH A;  1UZX B;  2Y5B B;  4CO7 A;  4W9G A;  3JW0 X;  2LGD A;  3MTN B;  4LCD E;  2LI5 A;  2LRW A;  1P1A A;  3DPD A;  1G6J A;  4MGK E;  3OJ4 B;  2FNJ B;  3PGE A;  1WMH B;  2KZR A;  3TBL D;  1P98 A;  1Z2M A;  1V86 A;  4E71 A;  4CYE A;  2DYM A;  5LXI B;  3O65 B;  2DYB A;  5AEK B;  1L2N A;  2KOX A;  3A9J B;  3APD A;  3PPA A;  3V60 A;  2KLG A;  4KIK A;  3APC A;  2O6V D;  2OJR A;  4ANX A;  2AWT A;  1WJN A;  4DDG D;  2ZVN A;  2CS4 A;  2M8S A;  1H4R A;  2WYQ A;  4IWQ A;  1WGG A;  2JZ3 B;  2D11 A;  4BKS D;  4E74 A;  4KSK C;  1V49 A;  3PVL A;  4MEM A;  3L17 A;  4MJS B;  2EMS A;  4BKG A;  3QC8 B;  1OQY A;  2IY1 B;  3HK0 A;  5D2M B;  4BOS C;  2M1M A;  2KDE B;  1V80 A;  2YLM A;  3DCG A;  4ANW A;  2KWC A;  2PJH A;  2KLC A;  3AXC A;  3IG3 A;  4PS8 A;  3B08 A;  2IY0 B;  3ZUN A;  4F8C B;  1E8Y A;  1Z5S B;  4I6N B;  1E5W A;  4M8N A;  4TQ1 A;  2HJ8 A;  3EHV A;  3VHT C;  1E90 A;  3DVG Y;  2DZM A;  2NVU I;  2IO2 B;  3MHS D;  2V4L A;  4G11 A;  3L10 B;  4PS7 A;  3OAW A;  2DYO A;  2MBE A;  4GU2 A;  4HLE A;  1EF1 A;  3L0W B;  3L13 A;  2MCN B;  2PE9 A;  3A4R A;  2C7H A;  5EDS A;  3ZNI D;  4WAA A;  5DPR A;  1WZ3 A;  2RD0 A;  3DVN V;  3NZS A;  4PYZ A;  5AZF A;  2NPT B;  4G0N B;  4AWJ A;  1Q5W B;  3CF6 E;  3EEC A;  3HHM A;  2NS5 A;  4LDT D;  3A4S C;  2NCN A;  4GSW A;  3BY4 B;  5GMV A;  3QA8 A;  2JXX A;  2G3Q B;  3JSV B;  4FHK A;  2JY6 A;  1PQS A;  2IO3 B;  3DOW A;  3QWZ B;  1P9D U;  3V61 A;  1J0G A;  2ZPN A;  1WE7 A;  4TV3 A;  4GDK B;  5CHV C;  3UIN B;  3ZNH B;  2FID A;  4K7W A;  3KUD B;  3ZRC A;  1D3Z A;  4MJS A;  2BWE S;  4X57 B;  4FBJ B;  1WGH A;  3KUC B;  1M94 A;  2ZJD A;  3UQB A;  2K8H A;  3QX1 A;  2KWU B;  3D32 A;  4HCN B;  1OGW A;  3H1U A;  2HTH A;  4DHZ B;  4MSQ B;  5CX3 A;  4I6L B;  1OEY A;  4FHJ A;  4ZDV A;  4JLC A;  4NQL B;  2KAN A;  1YX5 B;  2JF5 A;  4I6P A;  5CHF A;  1WH3 A;  2LXA A;  3QQ8 B;  2L3Z A;  4J6I A;  4B6W A;  1WJU A;  2JRI B;  2HE7 A;  2KJR A;  1A5R A;  2IYD B;  4WJN A;  1I42 A;  4IUM B;  2L8J A;  3DQV A;  3V62 A;  1T0Y A;  3A1Q A;  2FCM A;  3KYD D;  3TIX A;  2A5U A;  2EMT A;  2LXC A;  1WIA A;  3PS6 A;  4DDI D;  2ZCC A;  2N1V A;  2NR2 A;  1LFD A;  3PV1 A;  3NOB A;  4MGY E;  4A3P A;  2AYO B;  1NDD A;  2WDT B;  3PLU A;  2J0J A;  1L7Y A;  2NPT A;  4XC2 A;  1MG8 A;  2XEW A;  4BFR A;  3KYC D;  3L08 A;  2FIF A;  4PS3 A;  4GOC A;  2B3A A;  2AEH A;  4DHZ E;  1WXA A;  2G45 B;  3R3M A;  4AUQ C;  1VCB A;  3M62 B;  2RGF A;  1GC6 A;  3RYT A;  3ZVV A;  3JSV A;  4K1R B;  1BT0 A;  2KNB A;  1YD8 U;  4BBN F;  1Q0W B;  4GDK A;  2LAS A;  2DEN B;  3RD2 A;  3RZF A;  1FXT B;  5J18 A;  2KVR A;  2GOW A;  2KC2 A;  3ENE A;  3TMP B;  3A33 B;  4B9K A;  4E3C A;  5DCN A;  5D6J B;  4XX5 A;  2J7Q B;  3VDZ A;  3T8M A;  4W9J A;  3ZDT A;  3AI5 A;  3DVN U;  1JRU A;  1WF9 A;  4A3O A;  2K25 A;  3ONS A;  4GN1 A;  4LDT B;  2MA9 B;  4HK2 A;  2KHW B;  2ZNV C;  1TZ1 A;  2O6V A;  2N9E B;  4FN2 A;  1UBQ A;  1IYF A;  2CR5 A;  4ICV A;  4IW0 A;  4NY0 A;  4AJY B;  4IWO A;  3ZIM A;  5FR6 A;  3N32 A;  4BKS A;  5G55 A;  5HKH A;  4HVB A;  2L00 B;  5C1Z A;  3VTU A;  2NBW B;  4TKN A;  3Q3J A;  1YIW A;  2CKH B;  2KN5 A;  4G3X B;  3TCA A;  1KJT A;  3EFU A;  2ZCB A;  2DAF A;  2N4F A;  2K39 A;  2N7D A;  3H9D A;  3UIO B;  3GZN I;  4DHJ D;  2K8C A;  5J17 A;  1R4M I;  4W9I A;  2MQJ A;  3WIM A;  4NPN A;  5CHW A;  2YVC A;  2FCQ A;  3N30 A;  2G4D B;  2DHZ A;  4EZJ A;  4WWO A;  4K7U A;  1NBF C;  2BKF A;  4W9H A;  1WFY A;  2C7M B;  4MEL A;  3KW5 B;  5L83 A;  4W9K A;  2LGX A;  3X23 A;  4IG7 B;  3B1L X;  3L54 A;  3DBR I;  4XZ4 A;  1WGY A;  3A1Q B;  5AZG A;  1E7U A;  2DZJ A;  2KX3 A;  2PEA A;  3ALB A;  4OVU A;  4OVV A;  4HCP B;  3BIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...