4M8NA

Crystal structure of plexinc1/rap1b complex
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
593
structure length
574
Chain Sequence
KQMSKKMNDQLELMESNIRRDIRQGFVDLQTEKSDLIVGAIPFLDYKHFASRIFFPEAGTLTAVMIREQTTVDEKCLAFAELIRDKQFLSCFVHALEEQKNFSIKDKCTVASLLTLALHGDLLYLTEIMEDLLQSLMDQSSNANPKLLLRRTESIVEKLLTNWMSICLYGFLRESVGQPLFLLVSALTQQISKGPVDSVTEKALYTLSEDWLLCQAQDFEPLKLKVVFAVGEEISESLEVIALTCDTIQQVKEKILQTFQRKFGFRYTQQIRDIEIEYEKEGKFVMLQEVDDTSEIRGHVTMLNTLKHYQVGDGACIKVITPKIHAPLKTQNSVKDDKNFSIKYFHLVDPPEKKALKIKEMYLIKLLSTKVAVHSFVENLFKSIWGLPNNKAPLAVKYFFDFLDEQAERKKITDPDVLHIWKTNSLPLRFWVNILKNPDFVFSDMEKSPHLDGCLSVIAQAFMDSFSLTDTHLDKHSPTNKLLYGKDIPQYKQEVKSYYKLVKDQTSISSQELKTFLQEESKKHQNEFNESAALRELYKYMQRYFTEIFQKLEQTDAPSNLKENMHRVKELFDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PlexinC1 Intracellular Region
publication title Structural basis for activation and non-canonical catalysis of the Rap GTPase activating protein domain of plexin.
pubmed doi rcsb
source organism Danio rerio
total genus 175
structure length 574
sequence length 593
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08337 Plexin_cytopl Plexin cytoplasmic RasGAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.506.10 Mainly Alpha Orthogonal Bundle GTPase Activation - p120GAP; domain 1 GTPase Activation - p120gap; domain 1 4m8nA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4m8nA02
2C7HA 3QC8B 2KMCA 2FIFA 2KFKA 2PE6B 2M0XA 3PHXB 4K81A 3UIOB 2MBBB 4B9KA 2FCNA 1XD3B 2PJHA 3AU4A 5D94A 1I42A 3DOWA 2LJ5A 4BOZB 1E7VA 1NF1A 2GOWA 3RYTA 1UZXB 2RGFA 3GZNI 2CU1A 1LXDA 1WM3A 4URKA 3R7QA 3QK0A 4F7ZA 1C1YB 4MEMA 3TBLD 1WXMA 2CS4A 3R66C 5EDSA 4OVUA 4EZLA 1WX7A 2KX0A 1J8CA 3H7PA 4G50A 4FBJB 2K8HA 2W9NA 2L3ZA 1EUVB 1WE7A 3RUIB 4KIKB 3GOEA 2CR5A 1C3TA 4ICVA 4GDLB 1WR1A 3V60A 2WWZA 1OTRB 2BKRB 3ZIMA 2ASQA 2IO1B 5CX3A 3JW0X 2KJRA 5AEKB 4W9LA 2KQSA 1IP9A 3HK0A 4W9JA 5KHQA 1ZKHA 3OLMD 2R2QA 2DAJA 5IAAC 2KO3A 4JIOU 1WY8A 1WGDA 1R4MI 3DVNV 5G55A 3W1SC 3M95A 2RR9A 1GG3A 4HCNB 3ZNID 2BKFA 3D32A 3DQVA 4XX5A 3QCAA 4PYUA 4BKSA 4EZKA 2O2VB 3KUDB 3VTUA 1OQYA 4HWIB 4NAWA 2K1FA 4K7WA 4DK5A 1VD2A 2G4DB 2HD5B 2WYQA 1J19A 2GBJA 3DBLI 3ZRCA 3I3TB 1FXTB 3DBRI 2R2OA 3LDZE 1WX9A 1CMXB 4LCDE 4W9GA 1L7YA 3KW5B 5LLIA 2KDIA 2GBNA 5C23A 4B6WA 4TUUA 3DDCB 2L7RA 2MCNB 4EOYA 1M94A 1NDDA 5JHBA 2D2QA 2N4FA 4WJQA 1OGWA 1WXSA 3IHPC 4NQKE 4XC2A 1SIFA 3WAMA 2L8JA 1RFAA 4GMVA 4HCPB 5IA7A 3APFA 3ZDTA 1XQQA 5J2RA 2IBIB 3U8ZA 3PVLA 3T8MA 3A4RA 4KV2A 3A1QB 3A9JB 1WRDB 3L10B 1A5RA 1AARA 4WQOB 4BVUC 3MTNB 2V4LA 5CHWA 3N3KB 2DHZA 3VTVA 4PS7A 1GUAB 2UWQA 2Y5BB 3JSVA 2I1KA 2KWVB 2AEHA 2JWZA 5L95C 1OEYJ 4AJYB 2KJHB 4ANVA 2L00B 2M1MA 2N9EB 3TJPA 2MW5A 4MDKE 2C5LC 1UBIA 1E8XA 2LXAA 3RCZA 2OOBB 3KH0A 2CHWA 5DCNA 3ECIA 3JYUA 5CHVC 4W9DA 1GNUA 4LDTD 3A33B 1WMHA 2MRPA 5E6OA 5J17A 3KYDD 4PYZA 2KX3A 4AP4C 1LFDA 2MQJA 4I6LB 3U7DA 2MA9B 4GN1A 4BKTA 5JZEB 3DCGA 4GDKA 2KTRB 3L08A 4BBNC 1WXAA 3LJ3A 2D3GA 3M3JA 2Z59B 4FN2A 2DZJA 4MSQB 1GJZA 1OEYA 4IM0A 2JZ3B 2LUEA 3RZWC 4YL8A 2DYBA 2BWES 2MSED 1ISNA 2BGFA 4ANUA 2N7DA 2NBUA 4MGKE 4HVBA 4HXDA 1P9DU 3PRPB 2XK5B 2L0FA 3TIXA 3UINB 3AU5A 3HM6X 2G4SA 2GMIC 2KC1A 2V3SA 4DDGD 3M62B 2CHZA 4FADA 1V5TA 2ZZPB 3PTFC 4II2B 3M63B 4M8MA 2IO2B 1V81A 1T0YA 1V5OA 2ZCCA 1TZ1A 1U4AA 1WR6E 2J0KA 2FAZA 1YD8U 1V2YA 3B08A 3VVWB 4MH0E 2ZJDA 4KIKA 3BXJA 2K25A 2MP2B 2LD9A 4IWPA 1IYFA 4IWOA 4GDLA 1S1QB 3KUCB 4IC7B 4K7SA 4F1SA 4GIVA 4NPNA 4W9CA 2LVOA 4JLCA 3PRZA 3TCAA 4LDTB 4ZRJA 2NPTB 4ZYNA 4A3PA 3ZNZB 2EMSA 3QJZA 2ZPYA 4GXBA 4DHJD 1WQ1G 3IVFA 2NBWB 4GOCA 2ZPNA 2JVCA 2N1WA 1WJUA 2M8SA 1UGMA 3DVGX 3RT3B 4J6IA 3N32A 1G6JA 2K39A 3DPDA 1Y8RC 3KUZA 3KVFB 4IG7B 3OAWA 4FJYA 4BBNF 3SU8X 3P2BA 3ENEA 2LXCA 2I1JA 2KLCA 2M17A 4I6PA 3WALA 2LRUA 2KKCA 1BT0A 3PSEB 3FAYA 1E7UA 2LRWA 2KANA 2LGYA 1P3QU 2BWFA 3PGEA 2LVPA 3VDZA 3QHTA 2B3AA 4CYEA 3NHEB 2XEWA 2DENB 1RLFA 4DXAB 2RPQA 3H1UA 3V62A 4HDQA 2KZRA 4EZJA 3NZSA 1XT9B 4GGQA 3A1QA 3HM3A 2REXA 3A9JA 3VQIA 4HJKA 2G3QB 5LXHA 4P7IA 4BKGA 2D10A 3OJ4B 4PS8A 3K9PB 3K9OB 4RM8A 4AUQC 3DBHI 2N7EA 3SD5A 3ML9A 1EO6A 3VXWA 4DHJB 1WXVA 1WGYA 2D07B 2KK8A 2NS5A 2AL6A 3PLVA 3VFKA 4GU2A 2JPHA 5DPWA 1NBFC 3X23A 3RULA 3HIZA 2L05A 4IW0A 3CMMB 3PPAA 2AWTA 4II3B 1F9JA 4NJ6A 5BO4B 2KLGA 2MBOA 4BFRA 4WJPA 2IYDB 2JRHA 3ML8A 4IM3A 3AXCA 4PS3A 5L83A 3A9KB 2MLBA 3EHVA 5JH5C 4G0NB 2L76A 4MGIE 2Z0EB 4W9KA 4WJNA 3QX1A 3IG3A 1K8RB 4NNJB 4X57B 2KTRA 1H8CA 1I35A 1TTNA 3APDA 4AWJA 2O6VD 2N9PC 4WAAA 4B95A 2K6DB 4XZ4A 1WJNA 2GBMA 2EMTA 3PS6A 3B1LX 1YX6B 5DPRA 3DVNU 3ZRFA 2KVRA 2KN5A 2FCMA 3EECA 3V6CB 2C9WB 2KWUB 2XK5A 5CTRC 2MWSB 3NY5A 2ZNVB 3ALBA 2N1VA 2BYEA 1ZW7A 2BYVE 3JVZX 2XBBC 4I6NB 4KZ0A 2HTHA 1E8YA 3PREA 3VAWA 2C60A 4EFOA 1JRUA 1V86A 4DDID 2ZVNA 1UBQA 3ONSA 2FNJB 1YJ1A 2KQ7A 2MP2A 4M8NA 1L2NA 1WGRA 1V9JA 5AZHA 4FJZA 3WAPA 3IFWB 2VRRB 4G3XB 4AJWA 4KVGB 1E5WA 2WDTB 2A4ZA 2PE9A 2J7QB 4MM3A 2BF8B 1VCBA 2JF5A 3RD2A 3Q3JA 3UQAA 4A3OA 2NPTA 2WX0A 2V1YA 2ZCBA 5G2NA 2NVUI 2KDBA 4BOSC 2G45B 1E8WA 4WJOA 2RD0A 2LI5A 4NY0A 3WANA 4MJSB 2A5UA 2K6QA 3AULA 3WIMA 2IY0B 3ZW3A 3UIPB 1KOTA 4DHZE 3TL5A 1Q1OA 1WI0A 2O6VB 3VUWA 2K8BA 4LJPB 4W9EA 2NCNA 3ZNHB 3SDLC 4LJOB 1V49A 3R3MA 4IM2A 1WGHA 1TBEA 4W9IA 5GMVA 3RZFA 3H7SA 2LVQA 4KDLB 3CSFA 2M4NA 4MSMB 3H9DA 4NJ7A 4TKNA 2J0JA 1SE9A 2KD0A 2J0MA 2WX1A 4GSWA 5J18A 2NR2A 3C0RB 3ZNGC 4K7UA 2KNBA 4ASWC 2C7NB 3Q3FA 1IPGA 1KLVA 4GDKB 4W9HA 3V6EB 3EFUA 2GBKA 3B0AA 3QWZB 3VHTC 2BPSA 2O2VA 2UYZB 3VH4B 1KM7A 2KWCA 1WIAA 5DPSA 5TR5A 1EF5A 4IUMB 2MBHA 1WFYA 4F8CB 4AOFA 1RAXA 4A20A 4N9F4 4G11A 2KC2A 3L13A 4K1RB 3BINA 1WZ3A 1D3ZA 3VUYA 3L17A 1WM2A 2CHXA 4TQ0A 4WWPA 2N9XA 1UH6A 1WH3A 5DPTA 3QQ8B 3R7RA 1WX8A 1WZ0A 4E3CA 1Z5SB 4TV3A 4FHKA 2KMAA 4KDIC 2KFKB 4KZCA 2JZZA 4BKSD 4CO7A 2KDFB 2NBVB 1Q5WB 5D7GA 1KJTA 2IO0B 1E90A 2RSUA 3L0WB 2GBRA 3QARA 3ZLZA 3VH3B 4DHZB 3PT2B 4ANWA 2HJ8A 2PPHA 3MHSD 4MGYE 3A9KA 2JXXA 2IZVB 1MG8A 3UF8A 3H7PB 1RRBA 4M0WB 1HE8A 4FULA 3VTWA 4ZRKA 1EF1A 3UQBA 2YVCA 1QZEA 2DZIA 1S3SG 1P0RA 2DZMA 2IO3B 1GC7A 2LASA 2FCQA 2FCSA 2LGXA 3HHMA 3L54A 3NOBA 3NS8A 4E71A 3NZUA 4GB9A 1ZGUB 1WGGA 3EC8A 4EEWA 4RMAA 5JHAA 4DWFA 4HLEA 1Z2MA 1LM8B 2MBEA 2ZVOA 1WE6A 3U30A 5E6NA 2CKHB 3H6NA 3QIJA 5D2MB 2KDEB 3O65B 4HDOA 3S2AA 1PQSA 1YX5B 4RM9A 2LGDA 1V80A 1WF9A 4ICUA 3X0WA 4NAWB 5E6PA 5FR6A 2AYOB 4MGZE 1H4RA 1X1MA 2FUHB 2HE7A 4E74A 1NI2A 3N30A 4FLHA 2FIDA 1UD7A 1P98A 2JT4B 4WWOA 3WA0A 3PHWB 3ZKJC 2ZEQA 1TGZB 3KYCD 2JY6A 2K8CA 2LWPA 1LQBA 4MELA 3PZDA 4ZRIA 3ZUNA 4MJSA 1R4NI 1P1AA 1UELA 1YQBA 4JL9A 5AZFA 4CHKA 2DZKA 5C1ZA 3WAOA 3QA8A 3W1YA 3CF6E 4ZDVA 2KHWB 2KJ6A 2O6VA 4HPLB 2KOXA 2DAFA 4FJVB 1SGHA 2DYMA 3TMPB 2AL3A 1V6EA 3PLUA 5KHOA 4ANXA 2YLMA 2OJRA 2PEAA 4JGHB 1WJ6A 4JQWC 4DBGA 1E8ZA 3CSTA 5CHFA 3A4SC 1Q0WB 3SHQA 3ZTDA 4W9FA 3UGBB 1YIWA 2KTFA 2MX2A 3V61A 3ZVVA 3AI5A 2BYFA 2JRIB 2QHOA 3APCA 3VUXA 5LXIB 2DX5B 3JSVB 4OVVA 1WJ4A 4NQLB 3ZO5B 2C7MB 2DYOA 2LZ6A 4KSKC 4HPMB 4WWNA 5AZGA 2MBQA 2EKEC 2Z0DB 5D6JB 3W1SA 2JUOA 3PV1A 4KSLC 4HK2A 4TQ1A 2ZNVC 2IY1B 2KXJA 4IWQA 4FA6A 3T9LA 3BY4B 3DVGY 3ZTCA 4EKUA 4EUTA 2D11A 3L16A 3ZDMC 3QAQA 3MJWA 1J0GA 3DBSA 1WERA 1WMHB 5HKHA 1WYWB 3OJ3A 3IBEA 3PRMB 4FHJA 1GC6A 2KFJA 2L0TA
chains in the Genus database with same CATH superfamily
1ET9A 2PE6B 2K3UA 2FCNA 2PJHA 1VZ8A 2D5GA 3RYTA 1UZXB 4KGRA 3R7QA 3HUIA 3Q8BA 1C1YB 2E3TA 3R66C 2LHEA 4EZLA 4G50A 1IGCA 1ZP0B 1AW7A 3RPFC 4YXDB 2WWZA 3Q6BA 3PZ7A 5CX3A 4W9LA 2KQSA 5E6JA 2DAJA 2KO3A 3DVNV 2RR9A 1GG3A 1TKEA 3QCAA 3Q2AC 4DK5A 4CQNA 1GPXA 1VD2A 2G4DB 2HD5B 4KGSA 1J19A 2YEPB 3ZRCA 4LCDE 5LLIA 2KDIA 4RGNA 2BYTA 1OQRA 2D2QA 4WJQA 1OGWA 4NQKE 2L8JA 1I4HA 1EU3A 3BYYB 2SEBD 3NVZA 3ZDTA 2IBIB 3A4RA 1ESFA 4KV2A 1FNWA 1HTOA 1WRDB 1ZDVA 4LNKA 5HI1A 2DBYA 4BVUC 2V4LA 4KKJA 1GUAB 1XCQL 1T0QC 2UWQA 3MC0B 3JSVA 2I1KA 3TEYA 2JWZA 1HZ6A 2C5LC 1UNSA 3RCZA 2OOBB 3KH0A 2CHWA 5DCNA 3ECIA 1AWDA 3JYUA 4W9DA 2MRPA 5E6OA 3CIRB 4AP4C 3IT6B 2RDBC 2HTME 4BKTA 2MA9B 4GN1A 1ZUD2 2Z59B 2BTEA 4IM0A 2JZ3B 2LUEA 5MPOA 1ISNA 2BGFA 4HXDA 1P9DU 2AQ1B 2G4SA 2KC1A 2V3PA 2M19A 1V5TA 4M8MA 3AEAB 1T0YA 1TJEA 3ZJUA 1QKZA 2HDEA 3L4PA 1C79A 2ZJDA 4KIKA 2J4XA 4MH0E 5G5GA 3BXJA 2K25A 2MP2B 2LD9A 2IJ0A 4IWOA 2G1EA 3RNAC 2BQQA 4IC7B 4K7SA 1F2RI 2LVOA 4JLCA 3PRZA 4LDTB 4ZRJA 1ZPSA 4A3PA 1A70A 2EMSA 4GXBA 1WQ1G 3IVFA 3I57A 2G9HD 3V3XA 4NAMA 4OZCA 2SAKA 1UGMA 4J6IA 2QCZA 3MC8A 3NVVA 4FJYA 3ENEA 2M17A 4JPSA 4L23A 3PSEB 3PGEA 2LVPA 3VDZA 4RGTA 2W55A 3MHZA 3ZXVA 3NG0A 2VH1A 1RLFA 4RFBA 3V62A 4HDQA 2KZRA 2WXQA 4EZJA 2N0SB 3A9JA 1SIJA 2PIAA 4LLGM 1C4CA 1QOGA 5LXHA 4BKGA 4RM8A 3DBHI 4IKGA 3ML9A 1TKGA 1EO6A 3VXWA 2CU3A 3TSSA 1WXVA 2KK8A 4AQ7A 3RN9C 3VFKA 1CZPA 1XLPA 2M0AA 5DPWA 4A9AA 2L05A 4DXFA 3CMMB 2AWTA 4II3B 2W3RA 4IM3A 4PS3A 2MLBA 3EHVA 5JH5C 1E7PB 1YN4A 2WU5B 1H8CA 1JW9D 2O6VD 2N9PC 2K6DB 2EMTA 1N61A 3B1LX 5DPRA 1N63A 2QIEB 2C9WB 2KWUB 3Q69A 2J42A 3VRAB 2N1VA 2BYEA 1R4MB 3PREA 1E8YA 5TSSA 1JRUA 1V86A 3ZYYX 2KQ7A 1YJ1A 2DNFA 2PMVA 3NVWA 3LB8C 1SBBB 4FJZA 3WAPA 1EWCA 3IFWB 4XYCA 2A4ZA 1QF6A 3ZGZA 2JF5A 3DBRB 4A3OA 2NPTA 2WX0A 2V1YA 2ZCBA 2KDBA 2RD0A 2LI5A 2K6QA 3AULA 2V4IB 1KOTA 1FRRA 1Q1OA 2Q5WD 1KLUD 2K8BA 4W9EA 2NCNA 1V1OA 1M4VA 2JYTA 1WGHA 5GMVA 2LVQA 2M4NA 3H9DA 4NJ7A 3SFEB 2RDGA 3BK2A 2YEPF 1NVID 2KNBA 4ASWC 2C7NB 5H8YE 4XWWA 1KLVA 1C9FA 2QMTA 2UYZB 2KWCA 1QOFA 1EF5A 3NVYA 4OZAA 2MBHA 1WFYA 2WLBA 4F8CB 4N9F4 4A8XC 2I38A 3P1MA 2BBCA 3L17A 2CHXA 1UH6A 1WH3A 3QQ8B 1WZ0A 2UU7A 1Z5SB 5IKCM 1KH0A 4KDIC 2WQYB 1XLNA 2MJEA 2RSUA 4C4VB 1SJHD 2CJNA 4A6QA 3VH3B 3TEXA 2BB5A 2HJ8A 1HEZE 2PPHA 3UF8A 3H7PB 1HE8A 4ZRKA 1EF1A 4EE2A 2DZIA 2FCQA 2FCSA 3L54A 3HHMA 3NOBA 4E71A 3NZUA 2MHJA 1ZGUB 4RMAA 4DWFA 2JYEA 2WU2B 2VZKD 4AS1A 3H6NA 3QIJA 4A90A 5D2MB 1VRAB 2KDEB 4HDOA 2KWDA 3B2FA 1V80A 1NEKB 1WF9A 3X0WA 5E6PA 1OQQA 3Q8FA 2AYOB 2WXPA 1H4RA 2WXFA 5H92C 1FIQA 1P98A 2JT4B 4WWOA 2ZEQA 2L83A 3BVZA 2BW2A 4MELA 4ZRIA 5HFYA 3TEWA 1P1AA 1ZE3D 3W5UB 4WAFA 5C1ZA 1PGBA 4TMAB 3QA8A 1FNVA 3W1YA 3CF6E 4ZDVA 4HPLB 2KOXA 2DAFA 5G5HA 5KHOA 2INPE 2YLMA 1E8ZA 1LO5D 4USAA 1Q0WB 4LNOA 4W9FA 3UGBB 3P63A 3APCA 2QHOA 5LXIB 1UF0A 2D3CA 1L4ZB 1KLGD 2C7MB 4YSYB 4KSKC 1RFKA 4WWNA 1JWUD 5AZGA 2EKEC 2JSVX 4YSZB 2WDQB 2KXJA 3AE9B 3DVGY 1J0GA 1WERA 5HKHA 2MEKA 1XLOA 2KVZA 3QC8B 1XO3A 2FIFA 3E9SA 1I42A 2IDYA 1E7VA 1NF1A 2RGFA 3GZNI 1WM3A 2QDFA 1TS3A 1WRIA 3AE4B 5EDSA 4DQOC 2KX0A 4MACA 1JWBD 4DXGA 3U52E 4M0WA 1MHXA 1VZ6A 1EUVB 1WE7A 4WIPA 1FO4A 4GLSC 2AX5A 4GDLB 3FKYA 3ZIMA 1EU4A 2KJRA 3EGRA 1ZKHA 1T0SC 2KYWA 4RNAA 5IAAC 1WGDA 4FXCA 3W1SC 4HCNB 2BKFA 4PYUA 2XNAC 4BKSA 4EZKA 4NAWA 2K1FA 5BYQA 4KX6B 3DBLI 3BVGA 1FXTB 3LDZE 1L0XB 1WX9A 1E0ZA 1TS5A 2ONQA 3KW5B 3U7ZA 3NUHB 4B6WA 4C7YA 1M94A 5JHBA 1P7FA 4XC2A 1SIFA 1PUTA 3W5VB 5HHDG 3PZ8A 1QQRA 5IA7A 5AUKA 3PVLA 4ZRQA 3N3KB 3VTVA 5D3IB 1DGJA 2AEHA 1OEYJ 4AJYB 2KJHB 1GB1A 3TJPA 3N1YC 3N1ZC 2K9XA 4MH8A 2LXAA 3AEDB 5CHVC 4LDTD 3A33B 1WMHA 3OWEB 3KYDD 4HJGE 1K53A 1XF5L 2K0PA 4P16A 5JZEB 2KTRB 2PTLA 1WXAA 3LJ3A 2D3GA 3M3JA 1E6EB 4MSQB 4US9A 3RZWC 1TIFA 4RF1A 4ANUA 2NBUA 4MGKE 3WCQA 2L0FA 3TIXA 2GMIC 2ON8A 4XDDA 1JMLA 2LJIA 3B9JA 3U2SC 2IGGA 4L2YA 3P4PB 1TZ1A 2J0KA 2FAZA 1IYFA 1I4QA 1D6EC 4NPNA 1B9RA 3AE6B 4ZYNA 4TSSA 2ZPYA 2IPKD 1TT5B 2NBWB 4GOCA 2ZPNA 2JVCA 1WJUA 3N32A 1G6JA 3DPDA 3AEBB 3KUZA 4IG7B 1D5XC 1XCTL 2N9LA 3ZJTA 4IOIE 1L4DB 1JWSD 1GOZA 4PK1A 1FCLA 2V3NA 2LRUA 3FAYA 2LRWA 1VR9A 2KANA 2LGYA 2BWFA 2RPVA 1D4BA 3HVDA 3I63C 3NHEB 2DENB 4DXAB 1J7AA 4GGQA 3VQIA 3A1QA 3HM3A 2REXA 4M02A 4HJKA 1DOYA 2ZW0A 1T3QA 4ARIA 1YJJA 5EE3A 3DHGC 2NS5A 2AL6A 2WDRB 2MH7A 2KDMA 3X23A 1IBXA 3HIZA 3CWIA 5BO4B 2KLGA 3NZ3A 2LMCA 1FFUA 2IYDB 3E56A 3KWVA 1TYGB 3A9KB 4HKZE 2WXLA 2L76A 2RMMA 3IAM1 4MGIE 4W9KA 3IG3A 1K8RB 4NNJB 1I35A 3RNBC 3APDA 3Q8EA 1WJNA 2GBMA 3PS6A 3DVNU 3AE1B 2HJ1A 1WXQA 2H89B 2XK5A 2MWSB 3ALBA 1ZW7A 2BYVE 1FFVA 2WXNA 2ZVNA 4O1NA 1UBQA 2FNJB 2TSSA 4M8NA 1FRDA 1L2NA 1V1PA 1V9JA 2AQ3B 3AV8A 5AZHA 3AEGB 2PE9A 4MM3A 2BF8B 1VCBA 3RD2A 4REZA 2G45B 1L0VB 1E8WA 1I4XA 3WANA 4MJSB 2A5UA 3ZW3A 4NJCA 3UIPB 4DHZE 3FILA 3ZNHB 1IGDA 3SDLC 4LJOB 5IOIA 1V49A 3ZQ4A 3C19A 4J3OD 2KQ4X 3CSFA 4MSMB 1SJED 1SE9A 2KD0A 2J0MA 4GSWA 4ZHOA 5FK9C 3ZNGC 3FC4A 2WP9B 3GP7A 1IPGA 1PGAA 5AUIA 3B0AA 1PDXA 3LXFA 1Y56A 2O2VA 1KM7A 2H88B 5TR5A 4HROA 1BMLC 1EWYC 2DWQA 4G11A 3BINA 1WZ3A 3VUYA 1CJEA 3C8YA 2WXIA 1WX8A 4TV3A 2KMAA 4KZCA 3R8BA 3NJTA 1I4GA 4HEA1 5D7GA 1JWMD 3L0WB 1QOBA 5EE0A 2GBRA 3ZLZA 4DHZB 1PYWD 1F77A 2OEDA 2KAJA 1UGJA 3VTWA 1L6VA 2YVCA 1ZXHA 2IO3B 1C76A 1JCKB 2L1AA 2QC8A 1SB3C 3EC8A 2X38A 2Z8LA 3P4RB 3IT4B 2INDC 5E6NA 2N7JA 1DOIA 3O65B 3S2AA 1DYQA 4RM9A 4MGZE 2FUHB 4E74A 1HQRD 1NI2A 2FIDA 1UD7A 1K51A 3ZKJC 1TGZB 3KYCD 1C78A 2JY6A 2LWPA 3PZDA 3I9V1 3Q8AA 2RDHA 3WAOA 3O13A 2KHWB 2O6VA 1WYGA 4FJVB 1IBXB 1B1ZA 1SEBD 5CHFA 2EKIA 3A4SC 3SHQA 3RNGC 1JALA 3ZTDA 3ZVVA 2MX2A 3V61A 3AI5A 2JRIB 3JSVB 3DBHB 1QILA 4NQLB 5FKAC 5D6JB 2JUOA 4HK2A 3GS2A 3AMZA 3T9LA 4EUTA 3QAQA 3DBSA 1STEA 3PRMB 1K50A 1NENB 2KFJA 4NZLB 2L0TA 3VRBB 2KMCA 2KFKA 3PHXB 4B9KA 3UIOB 1YQ4B 1XD3B 3DWMA 5D94A 3DOWA 2LJ5A 4BOZB 2GOWA 1J7CA 1V8CA 1LXDA 4URKA 2K5PA 3QK0A 4F7ZA 2CS4A 1MFWA 2NMQA 3ETRA 1J8CA 2INNE 4FBJB 4QAYA 3ZJVA 4BZAA 4K3CA 2K8HA 2W9NA 3TEZA 2L3ZA 2PW9A 1FXIA 2D3AA 3FILB 4KIKB 1C4AA 3GOEA 2CR5A 3EA6A 3V60A 1MPEA 1OTRB 2ASQA 2IO1B 4HPPA 3RMKC 1IP9A 3SR6A 5KHQA 3OLMD 2R2QA 1E9MA 3R2IA 4JIOU 5G55A 3M95A 1BXTA 1I7HA 2LFIA 2O2VB 3KUDB 3U4EG 4K7WA 2WDVB 1SE2A 2WYQA 2V0GA 2GBJA 3PO0A 1CMXB 1L7YA 5T8IA 4RGOS 1ZDXA 4TUUA 3DDCB 2L7RA 4EOYA 1NDDA 1WXSA 1RFAA 2Y5PA 3OG5A 5J2RA 4KKIA 3U8ZA 3A9JB 3L10B 1A5RA 1AARA 4XWTA 4WQOB 1YN3A 3MTNB 2W3SA 4ZHPA 1DOXA 2DHZA 3H8HA 1AYFA 2Y5CA 4LNNA 5L95C 1N5XA 4N6EB 2N9EB 2MW5A 4MDKE 3P42A 1UBIA 1E8XA 2JWUA 3GE3C 2GLSA 3V05A 1TKYA 1UWMA 1LFDA 2MQJA 4I6LB 3U7DA 3L08A 2OHFA 4BBNC 1CK1A 4FN2A 2DZJA 1GJZA 1RWSA 2N7DA 1I4RA 4HVBA 3PRPB 4S0RA 3AU5A 3HM6X 2J52A 4DDGD 2V3SA 2CHZA 1NI3A 1V81A 2BS3B 1V5OA 2WXKA 1YD8U 1V2YA 3B08A 4IWPA 3HRDD 4F1SA 4GIVA 4YTNB 4W9CA 2L32A 2NPTB 2N9KA 5EE1A 4ARCA 1XXGA 3ZNZB 3QJZA 1UUPA 1J7BA 4ZRPA 2M8SA 3DVGX 3RT3B 1FNUA 2K39A 2FE8A 1Y8RC 3MP9A 3OAWA 2K22A 4BBNF 3SU8X 3P2BA 1VZ7A 2LXCA 4I6PA 3WALA 2KKCA 3DHIC 1P3QU 1L0YB 2JU6X 4HRSA 3T3NA 3Q8CA 1XEEA 3H1UA 3NZSA 1XT9B 1BUIC 3KQ4A 2G3QB 3BZDB 3OJ4B 4PS8A 5GXGB 2N7EA 3SD5A 1F52A 4DHJB 4N58A 3AE8B 3PLVA 4GU2A 2JPHA 1NBFC 3RULA 1F9JA 3GZNB 2MBOA 3RNEC 4WJPA 4RH6A 5L83A 4G0NB 4OW0A 1MG4A 1PGXA 1TTNA 3B2GA 2NTSA 2LUMA 4WAAA 4XZ4A 4M01A 3ZRFA 2KVRA 2KN5A 2FCMA 3V6CB 3NY5A 2GB1A 2XBBC 3JVZX 2KMMA 3BWUD 2C60A 4EFOA 4DDID 4WWMA 3ONSA 2MP2A 4OZBA 1N60A 1SE3A 4G3XB 1ACCA 1E5WA 3BIID 2J7QB 1OFFA 3DBLB 4JWUC 3Q3JA 3UQAA 3UI3A 2D3BA 4BOSC 2NVUI 4WJOA 5C2TB 4P1CC 3WIMA 2WXGA 1JROA 1WI0A 3VUWA 4LJPB 4IM2A 1HXYD 1TBEA 1ZXIA 4W9IA 3RZFA 2FBWB 4IDIA 2J0JA 2WX1A 4LNIA 2NR2A 2LGSA 3AE7B 4W9HA 1R4NB 3EFUA 3VHTC 1KTKA 2BPSA 4K3BA 5DPSA 3Q3OC 4A20A 4K1RB 4C7ZA 5DPTA 4E3CA 3R7RA 2JZZA 3P4QB 2NBVB 1KJTA 2WHIA 2IO0B 2LHDA 3LYYA 3QARA 2WXHA 3PT2B 4ANWA 2IZVB 1MG8A 3KLSX 4M0WB 1VLBA 1GAQB 1QZEA 1S3SG 1P0RA 2DZMA 1GC7A 2LASA 1NYQA 4GB9A 1JQ4A 1N5WA 3P4SB 1Z2MA 2JQRB 5IN7A 2ZVOA 2CKHB 4WQMA 4YSXB 1MVKA 3AEFB 1PQSA 4ICUA 4NAWB 5FR6A 3I5JC 1X1MA 2HE7A 3N30A 3AE5B 4WURA 1VJKA 3PHWB 1AN8A 5C3JB 3ZUNA 1UELA 4JL9A 4CHKA 3GE8C 2KJ6A 3MC9A 1SGHA 1HA5A 2AL3A 4RCOA 1V6EA 1SSNA 1YOVB 2OJRA 4JGHB 4JQWC 4DBGA 5JXVA 2JXTA 3VR9B 2KTFA 1TY0A 4OVVA 2PVGC 3ZO5B 1R7SA 3Q3MC 2DYOA 4HPMB 3W1SA 2MBQA 2QJLA 4M00A 4KSLC 4TQ1A 1MJDA 3BY4B 4JE3B 3AN1A 1SXTA 3ZTCA 2D11A 3L16A 4ZOHC 3ZDMC 4EKUA 2ICIA 1WMHB 1QOAA 4FHJA 1GC6A 2C7HA 1XLQA 4K81A 2M0XA 1GB4A 2MBBB 1I4PA 3N9YC 1PFDA 3AU4A 3AE3B 4C4VA 1YJIA 2CU1A 4RGMA 4YTPB 1T5XD 3AECB 2WXJA 4MEMA 3TBLD 1WXMA 4OVUA 1WX7A 3H7PA 2INCC 1T0RC 3RNFC 2V9HA 3RUIB 1C3TA 4ICVA 1N62A 1WR1A 3TUOA 3MJ5A 2BKRB 3JW0X 5AEKB 1HTQA 2W82A 3HK0A 1YN5A 4JX1C 4W9JA 4WH4A 1WY8A 1R4MI 1TY2A 1WGKA 3ZNID 3D32A 3DQVA 4XX5A 4MT5A 2CJOA 3VTUA 1OQYA 4HWIB 2GI9A 1JWAD 4US8A 1ENFA 4YT0B 2I2YA 3I3TB 3DBRI 2R2OA 1QLBB 4W9GA 3RI7C 2GBNA 1MI0A 5C23A 2MCNB 2N4FA 3IHPC 3WAMA 4GMVA 4HCPB 3APFA 1XQQA 5BYRA 3KWLA 3T8MA 3Q3NC 3A1QB 2VH2A 5CHWA 1FD6A 4HKQA 4PS7A 2Y5BB 2KWVB 4ANVA 2L00B 2M1MA 4JWSC 2KT7A 3Q14C 1V97A 5D3DA 1WWTA 1YNTE 1GNUA 3DWGC 1KFYB 5J17A 4PYZA 2WS3B 1WSPA 2KX3A 4XGAB 4OVZA 3DCGA 4GDKA 1OEYA 4LK0M 4YL8A 2DYBA 2BWES 1FCCC 1QT9A 2MSED 2LGIA 2L52A 2B76B 3EUB2 2XK5B 3UINB 4YTMB 5IP4D 4FADA 3M62B 2ZZPB 3PTFC 4II2B 3M63B 1TZOA 2IO2B 2ZCCA 4P1BC 1U4AA 1WR6E 2BS4B 3VVWB 2QEJC 3SFDB 1MHHE 4GDLA 1S1QB 3KUCB 2BS2B 1V1PB 3BK1A 1YMHE 4MM3B 3TCAA 2FUG1 2BT6A 2WGSA 5IO9A 4DHJD 2WXOA 1KRHA 1D5MC 5BMHA 2N1WA 3IAS1 1YQ3B 1VDVA 4Q2JA 3KVFB 4P6VF 1RYJA 4KGTA 1FPYA 2I1JA 2KLCA 3VR8B 1K52A 4C00A 2DLBA 1BT0A 2MJ3A 1E7UA 1P7EA 3HVZA 4RF0A 3QHTA 2QILA 2B3AA 4CYEA 2XEWA 2PLPA 2RPQA 1EM7A 3GB1A 4UDUC 4P7IA 2D10A 2M56B 4AUQC 2J53A 3K9PB 3K9OB 3ZXRA 4PT5A 1WGYA 2D07B 5I4DA 2XN9C 2R61A 4IW0A 1NYRA 3PPAA 4NJ6A 2E6XA 2JX5A 4BFRA 2JRHA 3ML8A 2WXRA 3AXCA 2NTTA 2Z0EB 4WJNA 3QX1A 3NS1A 3N1XC 4X57B 2KTRA 4AWJA 1ZOYB 4B95A 1F2RC 1YX6B 4H2AA 2OJWA 3IXSA 3EECA 4BAXA 5CTRC 2ZNVB 1ROEA 2BVCA 4I6NB 4KZ0A 1C4PA 2HTHA 3VAWA 5HG2A 4C80A 4L1BA 1SF0A 1WGRA 1FM0D 2VRRB 1UWXA 4AJWA 4KVGB 2WDTB 4YWGG 3EFCA 3AB5A 4XDCA 3T3OA 2ZW1A 5G2NA 3J9CA 1N6ZA 4NY0A 2IY0B 1JRPA 1TS2A 3TL5A 4D2KA 2MJDA 2IGHA 2O6VB 4R3DA 3AE2B 1FEHA 1FXAA 1L5PA 3R3MA 1LGRA 2LEKA 3AEEB 3H7SA 4KDLB 3W2DA 4TKNA 2QSDA 1CQVA 5J18A 3C0RB 4K7UA 5BYSA 2AQ2B 3NRZA 3Q3FA 2IGDA 4GDKB 3V6EB 2GBKA 3QWZB 2BB6A 1F0ZA 3VH4B 1WIAA 2W54A 4IUMB 4B0EA 3N20C 4AOFA 1RAXA 1ET6A 4S17A 2KC2A 3L13A 1D3ZA 2KN4A 1WM2A 4TQ0A 5LNK1 4WWPA 2N9XA 5EE9A 1TS4A 4FHKA 2EELA 3DHHC 4OHJA 3R2TA 2KFKB 4BKSD 4CO7A 2KDFB 1Q5WB 1E90A 4LTUA 1F1HA 3SEBA 4N59A 3MHSD 4MGYE 3A9KA 2JXXA 1RRBA 5FR3A 4FULA 3UQBA 1FMAD 4ZYSA 2LGXA 3ABVB 2JZPA 2PVOD 3NS8A 1HZ5A 2WXMA 1KF6B 4B0MA 1WGGA 4EEWA 4A55A 5JHAA 4HLEA 1Q10A 1LM8B 2MBEA 1WE6A 3U30A 3AM9A 1YX5B 2WNMA 2LGDA 2GRIA 4FLHA 2PKOA 3WA0A 3MFGA 1RM6C 1D5ZC 2K8CA 4LNFA 1IUEA 1LQBA 3RNCC 2ACZB 4MJSA 1R4NI 2X8XX 1T6BX 1YQBA 5AZFA 2DZKA 5BMGA 2DYMA 3TMPB 1E10A 3FAHA 3PLUA 2KACA 4XE0A 4ANXA 3W9CB 2PEAA 1WJ6A 3BYTB 3CSTA 4ACFA 1SE4A 1YIWA 2BYFA 3VUXA 3AH7A 2VZKB 2DX5B 1WJ4A 3URYA 2LZ6A 2Z0DB 1C77A 3PV1A 4C56C 2ZNVC 2IY1B 2Y3AA 4IWQA 4FA6A 5BMIA 1L6UA 3MJWA 3RFZB 1WYWB 3OJ3A 3IBEA 4ITKA 3BVMA
chains in the Genus database with same CATH topology
2C7HA 3QC8B 2KMCA 2FIFA 2KFKA 2PE6B 2M0XA 3PHXB 4K81A 3UIOB 2MBBB 4B9KA 2FCNA 1XD3B 2PJHA 3AU4A 5D94A 1I42A 3DOWA 2LJ5A 4BOZB 1E7VA 1NF1A 2GOWA 3RYTA 1UZXB 2RGFA 3GZNI 2CU1A 1LXDA 1WM3A 4URKA 3R7QA 3QK0A 4F7ZA 1C1YB 4MEMA 3TBLD 1WXMA 2CS4A 3R66C 5EDSA 4OVUA 4EZLA 1WX7A 2KX0A 1J8CA 3H7PA 4G50A 4FBJB 2K8HA 2W9NA 2L3ZA 1EUVB 1WE7A 3RUIB 4KIKB 3GOEA 2CR5A 1C3TA 4ICVA 4GDLB 1WR1A 3V60A 2WWZA 1OTRB 2BKRB 3ZIMA 2ASQA 2IO1B 5CX3A 3JW0X 2KJRA 5AEKB 4W9LA 2KQSA 1IP9A 3HK0A 4W9JA 5KHQA 1ZKHA 3OLMD 2R2QA 2DAJA 5IAAC 2KO3A 4JIOU 1WY8A 1WGDA 1R4MI 3DVNV 5G55A 3W1SC 3M95A 2RR9A 1GG3A 4HCNB 3ZNID 2BKFA 3D32A 3DQVA 4XX5A 3QCAA 4PYUA 4BKSA 4EZKA 2O2VB 3KUDB 3VTUA 1OQYA 4HWIB 4NAWA 2K1FA 4K7WA 4DK5A 1VD2A 2G4DB 2HD5B 2WYQA 1J19A 2GBJA 3DBLI 3ZRCA 3I3TB 1FXTB 3DBRI 2R2OA 3LDZE 1WX9A 1CMXB 4LCDE 4W9GA 1L7YA 3KW5B 5LLIA 2KDIA 2GBNA 5C23A 4B6WA 4TUUA 3DDCB 2L7RA 2MCNB 4EOYA 1M94A 1NDDA 5JHBA 2D2QA 2N4FA 4WJQA 1OGWA 1WXSA 3IHPC 4NQKE 4XC2A 1SIFA 3WAMA 2L8JA 1RFAA 4GMVA 4HCPB 5IA7A 3APFA 3ZDTA 1XQQA 5J2RA 2IBIB 3U8ZA 3PVLA 3T8MA 3A4RA 4KV2A 3A1QB 3A9JB 1WRDB 3L10B 1A5RA 1AARA 4WQOB 4BVUC 3MTNB 2V4LA 5CHWA 3N3KB 2DHZA 3VTVA 4PS7A 1GUAB 2UWQA 2Y5BB 3JSVA 2I1KA 2KWVB 2AEHA 2JWZA 5L95C 1OEYJ 4AJYB 2KJHB 4ANVA 2L00B 2M1MA 2N9EB 3TJPA 2MW5A 4MDKE 2C5LC 1UBIA 1E8XA 2LXAA 3RCZA 2OOBB 3KH0A 2CHWA 5DCNA 3ECIA 3JYUA 5CHVC 4W9DA 1GNUA 4LDTD 3A33B 1WMHA 2MRPA 5E6OA 5J17A 3KYDD 4PYZA 2KX3A 4AP4C 1LFDA 2MQJA 4I6LB 3U7DA 2MA9B 4GN1A 4BKTA 5JZEB 3DCGA 4GDKA 2KTRB 3L08A 4BBNC 1WXAA 3LJ3A 2D3GA 3M3JA 2Z59B 4FN2A 2DZJA 4MSQB 1GJZA 1OEYA 4IM0A 2JZ3B 2LUEA 3RZWC 4YL8A 2DYBA 2BWES 2MSED 1ISNA 2BGFA 4ANUA 2N7DA 2NBUA 4MGKE 4HVBA 4HXDA 1P9DU 3PRPB 2XK5B 2L0FA 3TIXA 3UINB 3AU5A 3HM6X 2G4SA 2GMIC 2KC1A 2V3SA 4DDGD 3M62B 2CHZA 4FADA 1V5TA 2ZZPB 3PTFC 4II2B 3M63B 4M8MA 2IO2B 1V81A 1T0YA 1V5OA 2ZCCA 1TZ1A 1U4AA 1WR6E 2J0KA 2FAZA 1YD8U 1V2YA 3B08A 3VVWB 4MH0E 2ZJDA 4KIKA 3BXJA 2K25A 2MP2B 2LD9A 4IWPA 1IYFA 4IWOA 4GDLA 1S1QB 3KUCB 4IC7B 4K7SA 4F1SA 4GIVA 4NPNA 4W9CA 2LVOA 4JLCA 3PRZA 3TCAA 4LDTB 4ZRJA 2NPTB 4ZYNA 4A3PA 3ZNZB 2EMSA 3QJZA 2ZPYA 4GXBA 4DHJD 1WQ1G 3IVFA 2NBWB 4GOCA 2ZPNA 2JVCA 2N1WA 1WJUA 2M8SA 1UGMA 3DVGX 3RT3B 4J6IA 3N32A 1G6JA 2K39A 3DPDA 1Y8RC 3KUZA 3KVFB 4IG7B 3OAWA 4FJYA 4BBNF 3SU8X 3P2BA 3ENEA 2LXCA 2I1JA 2KLCA 2M17A 4I6PA 3WALA 2LRUA 2KKCA 1BT0A 3PSEB 3FAYA 1E7UA 2LRWA 2KANA 2LGYA 1P3QU 2BWFA 3PGEA 2LVPA 3VDZA 3QHTA 2B3AA 4CYEA 3NHEB 2XEWA 2DENB 1RLFA 4DXAB 2RPQA 3H1UA 3V62A 4HDQA 2KZRA 4EZJA 3NZSA 1XT9B 4GGQA 3A1QA 3HM3A 2REXA 3A9JA 3VQIA 4HJKA 2G3QB 5LXHA 4P7IA 4BKGA 2D10A 3OJ4B 4PS8A 3K9PB 3K9OB 4RM8A 4AUQC 3DBHI 2N7EA 3SD5A 3ML9A 1EO6A 3VXWA 4DHJB 1WXVA 1WGYA 2D07B 2KK8A 2NS5A 2AL6A 3PLVA 3VFKA 4GU2A 2JPHA 5DPWA 1NBFC 3X23A 3RULA 3HIZA 2L05A 4IW0A 3CMMB 3PPAA 2AWTA 4II3B 1F9JA 4NJ6A 5BO4B 2KLGA 2MBOA 4BFRA 4WJPA 2IYDB 2JRHA 3ML8A 4IM3A 3AXCA 4PS3A 5L83A 3A9KB 2MLBA 3EHVA 5JH5C 4G0NB 2L76A 4MGIE 2Z0EB 4W9KA 4WJNA 3QX1A 3IG3A 1K8RB 4NNJB 4X57B 2KTRA 1H8CA 1I35A 1TTNA 3APDA 4AWJA 2O6VD 2N9PC 4WAAA 4B95A 2K6DB 4XZ4A 1WJNA 2GBMA 2EMTA 3PS6A 3B1LX 1YX6B 5DPRA 3DVNU 3ZRFA 2KVRA 2KN5A 2FCMA 3EECA 3V6CB 2C9WB 2KWUB 2XK5A 5CTRC 2MWSB 3NY5A 2ZNVB 3ALBA 2N1VA 2BYEA 1ZW7A 2BYVE 3JVZX 2XBBC 4I6NB 4KZ0A 2HTHA 1E8YA 3PREA 3VAWA 2C60A 4EFOA 1JRUA 1V86A 4DDID 2ZVNA 1UBQA 3ONSA 2FNJB 1YJ1A 2KQ7A 2MP2A 4M8NA 1L2NA 1WGRA 1V9JA 5AZHA 4FJZA 3WAPA 3IFWB 2VRRB 4G3XB 4AJWA 4KVGB 1E5WA 2WDTB 2A4ZA 2PE9A 2J7QB 4MM3A 2BF8B 1VCBA 2JF5A 3RD2A 3Q3JA 3UQAA 4A3OA 2NPTA 2WX0A 2V1YA 2ZCBA 5G2NA 2NVUI 2KDBA 4BOSC 2G45B 1E8WA 4WJOA 2RD0A 2LI5A 4NY0A 3WANA 4MJSB 2A5UA 2K6QA 3AULA 3WIMA 2IY0B 3ZW3A 3UIPB 1KOTA 4DHZE 3TL5A 1Q1OA 1WI0A 2O6VB 3VUWA 2K8BA 4LJPB 4W9EA 2NCNA 3ZNHB 3SDLC 4LJOB 1V49A 3R3MA 4IM2A 1WGHA 1TBEA 4W9IA 5GMVA 3RZFA 3H7SA 2LVQA 4KDLB 3CSFA 2M4NA 4MSMB 3H9DA 4NJ7A 4TKNA 2J0JA 1SE9A 2KD0A 2J0MA 2WX1A 4GSWA 5J18A 2NR2A 3C0RB 3ZNGC 4K7UA 2KNBA 4ASWC 2C7NB 3Q3FA 1IPGA 1KLVA 4GDKB 4W9HA 3V6EB 3EFUA 2GBKA 3B0AA 3QWZB 3VHTC 2BPSA 2O2VA 2UYZB 3VH4B 1KM7A 2KWCA 1WIAA 5DPSA 5TR5A 1EF5A 4IUMB 2MBHA 1WFYA 4F8CB 4AOFA 1RAXA 4A20A 4N9F4 4G11A 2KC2A 3L13A 4K1RB 3BINA 1WZ3A 1D3ZA 3VUYA 3L17A 1WM2A 2CHXA 4TQ0A 4WWPA 2N9XA 1UH6A 1WH3A 5DPTA 3QQ8B 3R7RA 1WX8A 1WZ0A 4E3CA 1Z5SB 4TV3A 4FHKA 2KMAA 4KDIC 2KFKB 4KZCA 2JZZA 4BKSD 4CO7A 2KDFB 2NBVB 1Q5WB 5D7GA 1KJTA 2IO0B 1E90A 2RSUA 3L0WB 2GBRA 3QARA 3ZLZA 3VH3B 4DHZB 3PT2B 4ANWA 2HJ8A 2PPHA 3MHSD 4MGYE 3A9KA 2JXXA 2IZVB 1MG8A 3UF8A 3H7PB 1RRBA 4M0WB 1HE8A 4FULA 3VTWA 4ZRKA 1EF1A 3UQBA 2YVCA 1QZEA 2DZIA 1S3SG 1P0RA 2DZMA 2IO3B 1GC7A 2LASA 2FCQA 2FCSA 2LGXA 3HHMA 3L54A 3NOBA 3NS8A 4E71A 3NZUA 4GB9A 1ZGUB 1WGGA 3EC8A 4EEWA 4RMAA 5JHAA 4DWFA 4HLEA 1Z2MA 1LM8B 2MBEA 2ZVOA 1WE6A 3U30A 5E6NA 2CKHB 3H6NA 3QIJA 5D2MB 2KDEB 3O65B 4HDOA 3S2AA 1PQSA 1YX5B 4RM9A 2LGDA 1V80A 1WF9A 4ICUA 3X0WA 4NAWB 5E6PA 5FR6A 2AYOB 4MGZE 1H4RA 1X1MA 2FUHB 2HE7A 4E74A 1NI2A 3N30A 4FLHA 2FIDA 1UD7A 1P98A 2JT4B 4WWOA 3WA0A 3PHWB 3ZKJC 2ZEQA 1TGZB 3KYCD 2JY6A 2K8CA 2LWPA 1LQBA 4MELA 3PZDA 4ZRIA 3ZUNA 4MJSA 1R4NI 1P1AA 1UELA 1YQBA 4JL9A 5AZFA 4CHKA 2DZKA 5C1ZA 3WAOA 3QA8A 3W1YA 3CF6E 4ZDVA 2KHWB 2KJ6A 2O6VA 4HPLB 2KOXA 2DAFA 4FJVB 1SGHA 2DYMA 3TMPB 2AL3A 1V6EA 3PLUA 5KHOA 4ANXA 2YLMA 2OJRA 2PEAA 4JGHB 1WJ6A 4JQWC 4DBGA 1E8ZA 3CSTA 5CHFA 3A4SC 1Q0WB 3SHQA 3ZTDA 4W9FA 3UGBB 1YIWA 2KTFA 2MX2A 3V61A 3ZVVA 3AI5A 2BYFA 2JRIB 2QHOA 3APCA 3VUXA 5LXIB 2DX5B 3JSVB 4OVVA 1WJ4A 4NQLB 3ZO5B 2C7MB 2DYOA 2LZ6A 4KSKC 4HPMB 4WWNA 5AZGA 2MBQA 2EKEC 2Z0DB 5D6JB 3W1SA 2JUOA 3PV1A 4KSLC 4HK2A 4TQ1A 2ZNVC 2IY1B 2KXJA 4IWQA 4FA6A 3T9LA 3BY4B 3DVGY 3ZTCA 4EKUA 4EUTA 2D11A 3L16A 3ZDMC 3QAQA 3MJWA 1J0GA 3DBSA 1WERA 1WMHB 5HKHA 1WYWB 3OJ3A 3IBEA 3PRMB 4FHJA 1GC6A 2KFJA 2L0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C7H A;  3QC8 B;  2KMC A;  2FIF A;  2KFK A;  2PE6 B;  2M0X A;  3PHX B;  4K81 A;  3UIO B;  2MBB B;  4B9K A;  2FCN A;  1XD3 B;  2PJH A;  3AU4 A;  5D94 A;  1I42 A;  3DOW A;  2LJ5 A;  4BOZ B;  1E7V A;  1NF1 A;  2GOW A;  3RYT A;  1UZX B;  2RGF A;  3GZN I;  2CU1 A;  1LXD A;  1WM3 A;  4URK A;  3R7Q A;  3QK0 A;  4F7Z A;  1C1Y B;  4MEM A;  3TBL D;  1WXM A;  2CS4 A;  3R66 C;  5EDS A;  4OVU A;  4EZL A;  1WX7 A;  2KX0 A;  1J8C A;  3H7P A;  4G50 A;  4FBJ B;  2K8H A;  2W9N A;  2L3Z A;  1EUV B;  1WE7 A;  3RUI B;  4KIK B;  3GOE A;  2CR5 A;  1C3T A;  4ICV A;  4GDL B;  1WR1 A;  3V60 A;  2WWZ A;  1OTR B;  2BKR B;  3ZIM A;  2ASQ A;  2IO1 B;  5CX3 A;  3JW0 X;  2KJR A;  5AEK B;  4W9L A;  2KQS A;  1IP9 A;  3HK0 A;  4W9J A;  5KHQ A;  1ZKH A;  3OLM D;  2R2Q A;  2DAJ A;  5IAA C;  2KO3 A;  4JIO U;  1WY8 A;  1WGD A;  1R4M I;  3DVN V;  5G55 A;  3W1S C;  3M95 A;  2RR9 A;  1GG3 A;  4HCN B;  3ZNI D;  2BKF A;  3D32 A;  3DQV A;  4XX5 A;  3QCA A;  4PYU A;  4BKS A;  4EZK A;  2O2V B;  3KUD B;  3VTU A;  1OQY A;  4HWI B;  4NAW A;  2K1F A;  4K7W A;  4DK5 A;  1VD2 A;  2G4D B;  2HD5 B;  2WYQ A;  1J19 A;  2GBJ A;  3DBL I;  3ZRC A;  3I3T B;  1FXT B;  3DBR I;  2R2O A;  3LDZ E;  1WX9 A;  1CMX B;  4LCD E;  4W9G A;  1L7Y A;  3KW5 B;  5LLI A;  2KDI A;  2GBN A;  5C23 A;  4B6W A;  4TUU A;  3DDC B;  2L7R A;  2MCN B;  4EOY A;  1M94 A;  1NDD A;  5JHB A;  2D2Q A;  2N4F A;  4WJQ A;  1OGW A;  1WXS A;  3IHP C;  4NQK E;  4XC2 A;  1SIF A;  3WAM A;  2L8J A;  1RFA A;  4GMV A;  4HCP B;  5IA7 A;  3APF A;  3ZDT A;  1XQQ A;  5J2R A;  2IBI B;  3U8Z A;  3PVL A;  3T8M A;  3A4R A;  4KV2 A;  3A1Q B;  3A9J B;  1WRD B;  3L10 B;  1A5R A;  1AAR A;  4WQO B;  4BVU C;  3MTN B;  2V4L A;  5CHW A;  3N3K B;  2DHZ A;  3VTV A;  4PS7 A;  1GUA B;  2UWQ A;  2Y5B B;  3JSV A;  2I1K A;  2KWV B;  2AEH A;  2JWZ A;  5L95 C;  1OEY J;  4AJY B;  2KJH B;  4ANV A;  2L00 B;  2M1M A;  2N9E B;  3TJP A;  2MW5 A;  4MDK E;  2C5L C;  1UBI A;  1E8X A;  2LXA A;  3RCZ A;  2OOB B;  3KH0 A;  2CHW A;  5DCN A;  3ECI A;  3JYU A;  5CHV C;  4W9D A;  1GNU A;  4LDT D;  3A33 B;  1WMH A;  2MRP A;  5E6O A;  5J17 A;  3KYD D;  4PYZ A;  2KX3 A;  4AP4 C;  1LFD A;  2MQJ A;  4I6L B;  3U7D A;  2MA9 B;  4GN1 A;  4BKT A;  5JZE B;  3DCG A;  4GDK A;  2KTR B;  3L08 A;  4BBN C;  1WXA A;  3LJ3 A;  2D3G A;  3M3J A;  2Z59 B;  4FN2 A;  2DZJ A;  4MSQ B;  1GJZ A;  1OEY A;  4IM0 A;  2JZ3 B;  2LUE A;  3RZW C;  4YL8 A;  2DYB A;  2BWE S;  2MSE D;  1ISN A;  2BGF A;  4ANU A;  2N7D A;  2NBU A;  4MGK E;  4HVB A;  4HXD A;  1P9D U;  3PRP B;  2XK5 B;  2L0F A;  3TIX A;  3UIN B;  3AU5 A;  3HM6 X;  2G4S A;  2GMI C;  2KC1 A;  2V3S A;  4DDG D;  3M62 B;  2CHZ A;  4FAD A;  1V5T A;  2ZZP B;  3PTF C;  4II2 B;  3M63 B;  4M8M A;  2IO2 B;  1V81 A;  1T0Y A;  1V5O A;  2ZCC A;  1TZ1 A;  1U4A A;  1WR6 E;  2J0K A;  2FAZ A;  1YD8 U;  1V2Y A;  3B08 A;  3VVW B;  4MH0 E;  2ZJD A;  4KIK A;  3BXJ A;  2K25 A;  2MP2 B;  2LD9 A;  4IWP A;  1IYF A;  4IWO A;  4GDL A;  1S1Q B;  3KUC B;  4IC7 B;  4K7S A;  4F1S A;  4GIV A;  4NPN A;  4W9C A;  2LVO A;  4JLC A;  3PRZ A;  3TCA A;  4LDT B;  4ZRJ A;  2NPT B;  4ZYN A;  4A3P A;  3ZNZ B;  2EMS A;  3QJZ A;  2ZPY A;  4GXB A;  4DHJ D;  1WQ1 G;  3IVF A;  2NBW B;  4GOC A;  2ZPN A;  2JVC A;  2N1W A;  1WJU A;  2M8S A;  1UGM A;  3DVG X;  3RT3 B;  4J6I A;  3N32 A;  1G6J A;  2K39 A;  3DPD A;  1Y8R C;  3KUZ A;  3KVF B;  4IG7 B;  3OAW A;  4FJY A;  4BBN F;  3SU8 X;  3P2B A;  3ENE A;  2LXC A;  2I1J A;  2KLC A;  2M17 A;  4I6P A;  3WAL A;  2LRU A;  2KKC A;  1BT0 A;  3PSE B;  3FAY A;  1E7U A;  2LRW A;  2KAN A;  2LGY A;  1P3Q U;  2BWF A;  3PGE A;  2LVP A;  3VDZ A;  3QHT A;  2B3A A;  4CYE A;  3NHE B;  2XEW A;  2DEN B;  1RLF A;  4DXA B;  2RPQ A;  3H1U A;  3V62 A;  4HDQ A;  2KZR A;  4EZJ A;  3NZS A;  1XT9 B;  4GGQ A;  3A1Q A;  3HM3 A;  2REX A;  3A9J A;  3VQI A;  4HJK A;  2G3Q B;  5LXH A;  4P7I A;  4BKG A;  2D10 A;  3OJ4 B;  4PS8 A;  3K9P B;  3K9O B;  4RM8 A;  4AUQ C;  3DBH I;  2N7E A;  3SD5 A;  3ML9 A;  1EO6 A;  3VXW A;  4DHJ B;  1WXV A;  1WGY A;  2D07 B;  2KK8 A;  2NS5 A;  2AL6 A;  3PLV A;  3VFK A;  4GU2 A;  2JPH A;  5DPW A;  1NBF C;  3X23 A;  3RUL A;  3HIZ A;  2L05 A;  4IW0 A;  3CMM B;  3PPA A;  2AWT A;  4II3 B;  1F9J A;  4NJ6 A;  5BO4 B;  2KLG A;  2MBO A;  4BFR A;  4WJP A;  2IYD B;  2JRH A;  3ML8 A;  4IM3 A;  3AXC A;  4PS3 A;  5L83 A;  3A9K B;  2MLB A;  3EHV A;  5JH5 C;  4G0N B;  2L76 A;  4MGI E;  2Z0E B;  4W9K A;  4WJN A;  3QX1 A;  3IG3 A;  1K8R B;  4NNJ B;  4X57 B;  2KTR A;  1H8C A;  1I35 A;  1TTN A;  3APD A;  4AWJ A;  2O6V D;  2N9P C;  4WAA A;  4B95 A;  2K6D B;  4XZ4 A;  1WJN A;  2GBM A;  2EMT A;  3PS6 A;  3B1L X;  1YX6 B;  5DPR A;  3DVN U;  3ZRF A;  2KVR A;  2KN5 A;  2FCM A;  3EEC A;  3V6C B;  2C9W B;  2KWU B;  2XK5 A;  5CTR C;  2MWS B;  3NY5 A;  2ZNV B;  3ALB A;  2N1V A;  2BYE A;  1ZW7 A;  2BYV E;  3JVZ X;  2XBB C;  4I6N B;  4KZ0 A;  2HTH A;  1E8Y A;  3PRE A;  3VAW A;  2C60 A;  4EFO A;  1JRU A;  1V86 A;  4DDI D;  2ZVN A;  1UBQ A;  3ONS A;  2FNJ B;  1YJ1 A;  2KQ7 A;  2MP2 A;  4M8N A;  1L2N A;  1WGR A;  1V9J A;  5AZH A;  4FJZ A;  3WAP A;  3IFW B;  2VRR B;  4G3X B;  4AJW A;  4KVG B;  1E5W A;  2WDT B;  2A4Z A;  2PE9 A;  2J7Q B;  4MM3 A;  2BF8 B;  1VCB A;  2JF5 A;  3RD2 A;  3Q3J A;  3UQA A;  4A3O A;  2NPT A;  2WX0 A;  2V1Y A;  2ZCB A;  5G2N A;  2NVU I;  2KDB A;  4BOS C;  2G45 B;  1E8W A;  4WJO A;  2RD0 A;  2LI5 A;  4NY0 A;  3WAN A;  4MJS B;  2A5U A;  2K6Q A;  3AUL A;  3WIM A;  2IY0 B;  3ZW3 A;  3UIP B;  1KOT A;  4DHZ E;  3TL5 A;  1Q1O A;  1WI0 A;  2O6V B;  3VUW A;  2K8B A;  4LJP B;  4W9E A;  2NCN A;  3ZNH B;  3SDL C;  4LJO B;  1V49 A;  3R3M A;  4IM2 A;  1WGH A;  1TBE A;  4W9I A;  5GMV A;  3RZF A;  3H7S A;  2LVQ A;  4KDL B;  3CSF A;  2M4N A;  4MSM B;  3H9D A;  4NJ7 A;  4TKN A;  2J0J A;  1SE9 A;  2KD0 A;  2J0M A;  2WX1 A;  4GSW A;  5J18 A;  2NR2 A;  3C0R B;  3ZNG C;  4K7U A;  2KNB A;  4ASW C;  2C7N B;  3Q3F A;  1IPG A;  1KLV A;  4GDK B;  4W9H A;  3V6E B;  3EFU A;  2GBK A;  3B0A A;  3QWZ B;  3VHT C;  2BPS A;  2O2V A;  2UYZ B;  3VH4 B;  1KM7 A;  2KWC A;  1WIA A;  5DPS A;  5TR5 A;  1EF5 A;  4IUM B;  2MBH A;  1WFY A;  4F8C B;  4AOF A;  1RAX A;  4A20 A;  4N9F 4;  4G11 A;  2KC2 A;  3L13 A;  4K1R B;  3BIN A;  1WZ3 A;  1D3Z A;  3VUY A;  3L17 A;  1WM2 A;  2CHX A;  4TQ0 A;  4WWP A;  2N9X A;  1UH6 A;  1WH3 A;  5DPT A;  3QQ8 B;  3R7R A;  1WX8 A;  1WZ0 A;  4E3C A;  1Z5S B;  4TV3 A;  4FHK A;  2KMA A;  4KDI C;  2KFK B;  4KZC A;  2JZZ A;  4BKS D;  4CO7 A;  2KDF B;  2NBV B;  1Q5W B;  5D7G A;  1KJT A;  2IO0 B;  1E90 A;  2RSU A;  3L0W B;  2GBR A;  3QAR A;  3ZLZ A;  3VH3 B;  4DHZ B;  3PT2 B;  4ANW A;  2HJ8 A;  2PPH A;  3MHS D;  4MGY E;  3A9K A;  2JXX A;  2IZV B;  1MG8 A;  3UF8 A;  3H7P B;  1RRB A;  4M0W B;  1HE8 A;  4FUL A;  3VTW A;  4ZRK A;  1EF1 A;  3UQB A;  2YVC A;  1QZE A;  2DZI A;  1S3S G;  1P0R A;  2DZM A;  2IO3 B;  1GC7 A;  2LAS A;  2FCQ A;  2FCS A;  2LGX A;  3HHM A;  3L54 A;  3NOB A;  3NS8 A;  4E71 A;  3NZU A;  4GB9 A;  1ZGU B;  1WGG A;  3EC8 A;  4EEW A;  4RMA A;  5JHA A;  4DWF A;  4HLE A;  1Z2M A;  1LM8 B;  2MBE A;  2ZVO A;  1WE6 A;  3U30 A;  5E6N A;  2CKH B;  3H6N A;  3QIJ A;  5D2M B;  2KDE B;  3O65 B;  4HDO A;  3S2A A;  1PQS A;  1YX5 B;  4RM9 A;  2LGD A;  1V80 A;  1WF9 A;  4ICU A;  3X0W A;  4NAW B;  5E6P A;  5FR6 A;  2AYO B;  4MGZ E;  1H4R A;  1X1M A;  2FUH B;  2HE7 A;  4E74 A;  1NI2 A;  3N30 A;  4FLH A;  2FID A;  1UD7 A;  1P98 A;  2JT4 B;  4WWO A;  3WA0 A;  3PHW B;  3ZKJ C;  2ZEQ A;  1TGZ B;  3KYC D;  2JY6 A;  2K8C A;  2LWP A;  1LQB A;  4MEL A;  3PZD A;  4ZRI A;  3ZUN A;  4MJS A;  1R4N I;  1P1A A;  1UEL A;  1YQB A;  4JL9 A;  5AZF A;  4CHK A;  2DZK A;  5C1Z A;  3WAO A;  3QA8 A;  3W1Y A;  3CF6 E;  4ZDV A;  2KHW B;  2KJ6 A;  2O6V A;  4HPL B;  2KOX A;  2DAF A;  4FJV B;  1SGH A;  2DYM A;  3TMP B;  2AL3 A;  1V6E A;  3PLU A;  5KHO A;  4ANX A;  2YLM A;  2OJR A;  2PEA A;  4JGH B;  1WJ6 A;  4JQW C;  4DBG A;  1E8Z A;  3CST A;  5CHF A;  3A4S C;  1Q0W B;  3SHQ A;  3ZTD A;  4W9F A;  3UGB B;  1YIW A;  2KTF A;  2MX2 A;  3V61 A;  3ZVV A;  3AI5 A;  2BYF A;  2JRI B;  2QHO A;  3APC A;  3VUX A;  5LXI B;  2DX5 B;  3JSV B;  4OVV A;  1WJ4 A;  4NQL B;  3ZO5 B;  2C7M B;  2DYO A;  2LZ6 A;  4KSK C;  4HPM B;  4WWN A;  5AZG A;  2MBQ A;  2EKE C;  2Z0D B;  5D6J B;  3W1S A;  2JUO A;  3PV1 A;  4KSL C;  4HK2 A;  4TQ1 A;  2ZNV C;  2IY1 B;  2KXJ A;  4IWQ A;  4FA6 A;  3T9L A;  3BY4 B;  3DVG Y;  3ZTC A;  4EKU A;  4EUT A;  2D11 A;  3L16 A;  3ZDM C;  3QAQ A;  3MJW A;  1J0G A;  3DBS A;  1WER A;  1WMH B;  5HKH A;  1WYW B;  3OJ3 A;  3IBE A;  3PRM B;  4FHJ A;  1GC6 A;  2KFJ A;  2L0T A; 
#chains in the Genus database with same CATH topology
 1ET9 A;  2PE6 B;  2K3U A;  2FCN A;  2PJH A;  1VZ8 A;  2D5G A;  3RYT A;  1UZX B;  4KGR A;  3R7Q A;  3HUI A;  3Q8B A;  1C1Y B;  2E3T A;  3R66 C;  2LHE A;  4EZL A;  4G50 A;  1IGC A;  1ZP0 B;  1AW7 A;  3RPF C;  4YXD B;  2WWZ A;  3Q6B A;  3PZ7 A;  5CX3 A;  4W9L A;  2KQS A;  5E6J A;  2DAJ A;  2KO3 A;  3DVN V;  2RR9 A;  1GG3 A;  1TKE A;  3QCA A;  3Q2A C;  4DK5 A;  4CQN A;  1GPX A;  1VD2 A;  2G4D B;  2HD5 B;  4KGS A;  1J19 A;  2YEP B;  3ZRC A;  4LCD E;  5LLI A;  2KDI A;  4RGN A;  2BYT A;  1OQR A;  2D2Q A;  4WJQ A;  1OGW A;  4NQK E;  2L8J A;  1I4H A;  1EU3 A;  3BYY B;  2SEB D;  3NVZ A;  3ZDT A;  2IBI B;  3A4R A;  1ESF A;  4KV2 A;  1FNW A;  1HTO A;  1WRD B;  1ZDV A;  4LNK A;  5HI1 A;  2DBY A;  4BVU C;  2V4L A;  4KKJ A;  1GUA B;  1XCQ L;  1T0Q C;  2UWQ A;  3MC0 B;  3JSV A;  2I1K A;  3TEY A;  2JWZ A;  1HZ6 A;  2C5L C;  1UNS A;  3RCZ A;  2OOB B;  3KH0 A;  2CHW A;  5DCN A;  3ECI A;  1AWD A;  3JYU A;  4W9D A;  2MRP A;  5E6O A;  3CIR B;  4AP4 C;  3IT6 B;  2RDB C;  2HTM E;  4BKT A;  2MA9 B;  4GN1 A;  1ZUD 2;  2Z59 B;  2BTE A;  4IM0 A;  2JZ3 B;  2LUE A;  5MPO A;  1ISN A;  2BGF A;  4HXD A;  1P9D U;  2AQ1 B;  2G4S A;  2KC1 A;  2V3P A;  2M19 A;  1V5T A;  4M8M A;  3AEA B;  1T0Y A;  1TJE A;  3ZJU A;  1QKZ A;  2HDE A;  3L4P A;  1C79 A;  2ZJD A;  4KIK A;  2J4X A;  4MH0 E;  5G5G A;  3BXJ A;  2K25 A;  2MP2 B;  2LD9 A;  2IJ0 A;  4IWO A;  2G1E A;  3RNA C;  2BQQ A;  4IC7 B;  4K7S A;  1F2R I;  2LVO A;  4JLC A;  3PRZ A;  4LDT B;  4ZRJ A;  1ZPS A;  4A3P A;  1A70 A;  2EMS A;  4GXB A;  1WQ1 G;  3IVF A;  3I57 A;  2G9H D;  3V3X A;  4NAM A;  4OZC A;  2SAK A;  1UGM A;  4J6I A;  2QCZ A;  3MC8 A;  3NVV A;  4FJY A;  3ENE A;  2M17 A;  4JPS A;  4L23 A;  3PSE B;  3PGE A;  2LVP A;  3VDZ A;  4RGT A;  2W55 A;  3MHZ A;  3ZXV A;  3NG0 A;  2VH1 A;  1RLF A;  4RFB A;  3V62 A;  4HDQ A;  2KZR A;  2WXQ A;  4EZJ A;  2N0S B;  3A9J A;  1SIJ A;  2PIA A;  4LLG M;  1C4C A;  1QOG A;  5LXH A;  4BKG A;  4RM8 A;  3DBH I;  4IKG A;  3ML9 A;  1TKG A;  1EO6 A;  3VXW A;  2CU3 A;  3TSS A;  1WXV A;  2KK8 A;  4AQ7 A;  3RN9 C;  3VFK A;  1CZP A;  1XLP A;  2M0A A;  5DPW A;  4A9A A;  2L05 A;  4DXF A;  3CMM B;  2AWT A;  4II3 B;  2W3R A;  4IM3 A;  4PS3 A;  2MLB A;  3EHV A;  5JH5 C;  1E7P B;  1YN4 A;  2WU5 B;  1H8C A;  1JW9 D;  2O6V D;  2N9P C;  2K6D B;  2EMT A;  1N61 A;  3B1L X;  5DPR A;  1N63 A;  2QIE B;  2C9W B;  2KWU B;  3Q69 A;  2J42 A;  3VRA B;  2N1V A;  2BYE A;  1R4M B;  3PRE A;  1E8Y A;  5TSS A;  1JRU A;  1V86 A;  3ZYY X;  2KQ7 A;  1YJ1 A;  2DNF A;  2PMV A;  3NVW A;  3LB8 C;  1SBB B;  4FJZ A;  3WAP A;  1EWC A;  3IFW B;  4XYC A;  2A4Z A;  1QF6 A;  3ZGZ A;  2JF5 A;  3DBR B;  4A3O A;  2NPT A;  2WX0 A;  2V1Y A;  2ZCB A;  2KDB A;  2RD0 A;  2LI5 A;  2K6Q A;  3AUL A;  2V4I B;  1KOT A;  1FRR A;  1Q1O A;  2Q5W D;  1KLU D;  2K8B A;  4W9E A;  2NCN A;  1V1O A;  1M4V A;  2JYT A;  1WGH A;  5GMV A;  2LVQ A;  2M4N A;  3H9D A;  4NJ7 A;  3SFE B;  2RDG A;  3BK2 A;  2YEP F;  1NVI D;  2KNB A;  4ASW C;  2C7N B;  5H8Y E;  4XWW A;  1KLV A;  1C9F A;  2QMT A;  2UYZ B;  2KWC A;  1QOF A;  1EF5 A;  3NVY A;  4OZA A;  2MBH A;  1WFY A;  2WLB A;  4F8C B;  4N9F 4;  4A8X C;  2I38 A;  3P1M A;  2BBC A;  3L17 A;  2CHX A;  1UH6 A;  1WH3 A;  3QQ8 B;  1WZ0 A;  2UU7 A;  1Z5S B;  5IKC M;  1KH0 A;  4KDI C;  2WQY B;  1XLN A;  2MJE A;  2RSU A;  4C4V B;  1SJH D;  2CJN A;  4A6Q A;  3VH3 B;  3TEX A;  2BB5 A;  2HJ8 A;  1HEZ E;  2PPH A;  3UF8 A;  3H7P B;  1HE8 A;  4ZRK A;  1EF1 A;  4EE2 A;  2DZI A;  2FCQ A;  2FCS A;  3L54 A;  3HHM A;  3NOB A;  4E71 A;  3NZU A;  2MHJ A;  1ZGU B;  4RMA A;  4DWF A;  2JYE A;  2WU2 B;  2VZK D;  4AS1 A;  3H6N A;  3QIJ A;  4A90 A;  5D2M B;  1VRA B;  2KDE B;  4HDO A;  2KWD A;  3B2F A;  1V80 A;  1NEK B;  1WF9 A;  3X0W A;  5E6P A;  1OQQ A;  3Q8F A;  2AYO B;  2WXP A;  1H4R A;  2WXF A;  5H92 C;  1FIQ A;  1P98 A;  2JT4 B;  4WWO A;  2ZEQ A;  2L83 A;  3BVZ A;  2BW2 A;  4MEL A;  4ZRI A;  5HFY A;  3TEW A;  1P1A A;  1ZE3 D;  3W5U B;  4WAF A;  5C1Z A;  1PGB A;  4TMA B;  3QA8 A;  1FNV A;  3W1Y A;  3CF6 E;  4ZDV A;  4HPL B;  2KOX A;  2DAF A;  5G5H A;  5KHO A;  2INP E;  2YLM A;  1E8Z A;  1LO5 D;  4USA A;  1Q0W B;  4LNO A;  4W9F A;  3UGB B;  3P63 A;  3APC A;  2QHO A;  5LXI B;  1UF0 A;  2D3C A;  1L4Z B;  1KLG D;  2C7M B;  4YSY B;  4KSK C;  1RFK A;  4WWN A;  1JWU D;  5AZG A;  2EKE C;  2JSV X;  4YSZ B;  2WDQ B;  2KXJ A;  3AE9 B;  3DVG Y;  1J0G A;  1WER A;  5HKH A;  2MEK A;  1XLO A;  2KVZ A;  3QC8 B;  1XO3 A;  2FIF A;  3E9S A;  1I42 A;  2IDY A;  1E7V A;  1NF1 A;  2RGF A;  3GZN I;  1WM3 A;  2QDF A;  1TS3 A;  1WRI A;  3AE4 B;  5EDS A;  4DQO C;  2KX0 A;  4MAC A;  1JWB D;  4DXG A;  3U52 E;  4M0W A;  1MHX A;  1VZ6 A;  1EUV B;  1WE7 A;  4WIP A;  1FO4 A;  4GLS C;  2AX5 A;  4GDL B;  3FKY A;  3ZIM A;  1EU4 A;  2KJR A;  3EGR A;  1ZKH A;  1T0S C;  2KYW A;  4RNA A;  5IAA C;  1WGD A;  4FXC A;  3W1S C;  4HCN B;  2BKF A;  4PYU A;  2XNA C;  4BKS A;  4EZK A;  4NAW A;  2K1F A;  5BYQ A;  4KX6 B;  3DBL I;  3BVG A;  1FXT B;  3LDZ E;  1L0X B;  1WX9 A;  1E0Z A;  1TS5 A;  2ONQ A;  3KW5 B;  3U7Z A;  3NUH B;  4B6W A;  4C7Y A;  1M94 A;  5JHB A;  1P7F A;  4XC2 A;  1SIF A;  1PUT A;  3W5V B;  5HHD G;  3PZ8 A;  1QQR A;  5IA7 A;  5AUK A;  3PVL A;  4ZRQ A;  3N3K B;  3VTV A;  5D3I B;  1DGJ A;  2AEH A;  1OEY J;  4AJY B;  2KJH B;  1GB1 A;  3TJP A;  3N1Y C;  3N1Z C;  2K9X A;  4MH8 A;  2LXA A;  3AED B;  5CHV C;  4LDT D;  3A33 B;  1WMH A;  3OWE B;  3KYD D;  4HJG E;  1K53 A;  1XF5 L;  2K0P A;  4P16 A;  5JZE B;  2KTR B;  2PTL A;  1WXA A;  3LJ3 A;  2D3G A;  3M3J A;  1E6E B;  4MSQ B;  4US9 A;  3RZW C;  1TIF A;  4RF1 A;  4ANU A;  2NBU A;  4MGK E;  3WCQ A;  2L0F A;  3TIX A;  2GMI C;  2ON8 A;  4XDD A;  1JML A;  2LJI A;  3B9J A;  3U2S C;  2IGG A;  4L2Y A;  3P4P B;  1TZ1 A;  2J0K A;  2FAZ A;  1IYF A;  1I4Q A;  1D6E C;  4NPN A;  1B9R A;  3AE6 B;  4ZYN A;  4TSS A;  2ZPY A;  2IPK D;  1TT5 B;  2NBW B;  4GOC A;  2ZPN A;  2JVC A;  1WJU A;  3N32 A;  1G6J A;  3DPD A;  3AEB B;  3KUZ A;  4IG7 B;  1D5X C;  1XCT L;  2N9L A;  3ZJT A;  4IOI E;  1L4D B;  1JWS D;  1GOZ A;  4PK1 A;  1FCL A;  2V3N A;  2LRU A;  3FAY A;  2LRW A;  1VR9 A;  2KAN A;  2LGY A;  2BWF A;  2RPV A;  1D4B A;  3HVD A;  3I63 C;  3NHE B;  2DEN B;  4DXA B;  1J7A A;  4GGQ A;  3VQI A;  3A1Q A;  3HM3 A;  2REX A;  4M02 A;  4HJK A;  1DOY A;  2ZW0 A;  1T3Q A;  4ARI A;  1YJJ A;  5EE3 A;  3DHG C;  2NS5 A;  2AL6 A;  2WDR B;  2MH7 A;  2KDM A;  3X23 A;  1IBX A;  3HIZ A;  3CWI A;  5BO4 B;  2KLG A;  3NZ3 A;  2LMC A;  1FFU A;  2IYD B;  3E56 A;  3KWV A;  1TYG B;  3A9K B;  4HKZ E;  2WXL A;  2L76 A;  2RMM A;  3IAM 1;  4MGI E;  4W9K A;  3IG3 A;  1K8R B;  4NNJ B;  1I35 A;  3RNB C;  3APD A;  3Q8E A;  1WJN A;  2GBM A;  3PS6 A;  3DVN U;  3AE1 B;  2HJ1 A;  1WXQ A;  2H89 B;  2XK5 A;  2MWS B;  3ALB A;  1ZW7 A;  2BYV E;  1FFV A;  2WXN A;  2ZVN A;  4O1N A;  1UBQ A;  2FNJ B;  2TSS A;  4M8N A;  1FRD A;  1L2N A;  1V1P A;  1V9J A;  2AQ3 B;  3AV8 A;  5AZH A;  3AEG B;  2PE9 A;  4MM3 A;  2BF8 B;  1VCB A;  3RD2 A;  4REZ A;  2G45 B;  1L0V B;  1E8W A;  1I4X A;  3WAN A;  4MJS B;  2A5U A;  3ZW3 A;  4NJC A;  3UIP B;  4DHZ E;  3FIL A;  3ZNH B;  1IGD A;  3SDL C;  4LJO B;  5IOI A;  1V49 A;  3ZQ4 A;  3C19 A;  4J3O D;  2KQ4 X;  3CSF A;  4MSM B;  1SJE D;  1SE9 A;  2KD0 A;  2J0M A;  4GSW A;  4ZHO A;  5FK9 C;  3ZNG C;  3FC4 A;  2WP9 B;  3GP7 A;  1IPG A;  1PGA A;  5AUI A;  3B0A A;  1PDX A;  3LXF A;  1Y56 A;  2O2V A;  1KM7 A;  2H88 B;  5TR5 A;  4HRO A;  1BML C;  1EWY C;  2DWQ A;  4G11 A;  3BIN A;  1WZ3 A;  3VUY A;  1CJE A;  3C8Y A;  2WXI A;  1WX8 A;  4TV3 A;  2KMA A;  4KZC A;  3R8B A;  3NJT A;  1I4G A;  4HEA 1;  5D7G A;  1JWM D;  3L0W B;  1QOB A;  5EE0 A;  2GBR A;  3ZLZ A;  4DHZ B;  1PYW D;  1F77 A;  2OED A;  2KAJ A;  1UGJ A;  3VTW A;  1L6V A;  2YVC A;  1ZXH A;  2IO3 B;  1C76 A;  1JCK B;  2L1A A;  2QC8 A;  1SB3 C;  3EC8 A;  2X38 A;  2Z8L A;  3P4R B;  3IT4 B;  2IND C;  5E6N A;  2N7J A;  1DOI A;  3O65 B;  3S2A A;  1DYQ A;  4RM9 A;  4MGZ E;  2FUH B;  4E74 A;  1HQR D;  1NI2 A;  2FID A;  1UD7 A;  1K51 A;  3ZKJ C;  1TGZ B;  3KYC D;  1C78 A;  2JY6 A;  2LWP A;  3PZD A;  3I9V 1;  3Q8A A;  2RDH A;  3WAO A;  3O13 A;  2KHW B;  2O6V A;  1WYG A;  4FJV B;  1IBX B;  1B1Z A;  1SEB D;  5CHF A;  2EKI A;  3A4S C;  3SHQ A;  3RNG C;  1JAL A;  3ZTD A;  3ZVV A;  2MX2 A;  3V61 A;  3AI5 A;  2JRI B;  3JSV B;  3DBH B;  1QIL A;  4NQL B;  5FKA C;  5D6J B;  2JUO A;  4HK2 A;  3GS2 A;  3AMZ A;  3T9L A;  4EUT A;  3QAQ A;  3DBS A;  1STE A;  3PRM B;  1K50 A;  1NEN B;  2KFJ A;  4NZL B;  2L0T A;  3VRB B;  2KMC A;  2KFK A;  3PHX B;  4B9K A;  3UIO B;  1YQ4 B;  1XD3 B;  3DWM A;  5D94 A;  3DOW A;  2LJ5 A;  4BOZ B;  2GOW A;  1J7C A;  1V8C A;  1LXD A;  4URK A;  2K5P A;  3QK0 A;  4F7Z A;  2CS4 A;  1MFW A;  2NMQ A;  3ETR A;  1J8C A;  2INN E;  4FBJ B;  4QAY A;  3ZJV A;  4BZA A;  4K3C A;  2K8H A;  2W9N A;  3TEZ A;  2L3Z A;  2PW9 A;  1FXI A;  2D3A A;  3FIL B;  4KIK B;  1C4A A;  3GOE A;  2CR5 A;  3EA6 A;  3V60 A;  1MPE A;  1OTR B;  2ASQ A;  2IO1 B;  4HPP A;  3RMK C;  1IP9 A;  3SR6 A;  5KHQ A;  3OLM D;  2R2Q A;  1E9M A;  3R2I A;  4JIO U;  5G55 A;  3M95 A;  1BXT A;  1I7H A;  2LFI A;  2O2V B;  3KUD B;  3U4E G;  4K7W A;  2WDV B;  1SE2 A;  2WYQ A;  2V0G A;  2GBJ A;  3PO0 A;  1CMX B;  1L7Y A;  5T8I A;  4RGO S;  1ZDX A;  4TUU A;  3DDC B;  2L7R A;  4EOY A;  1NDD A;  1WXS A;  1RFA A;  2Y5P A;  3OG5 A;  5J2R A;  4KKI A;  3U8Z A;  3A9J B;  3L10 B;  1A5R A;  1AAR A;  4XWT A;  4WQO B;  1YN3 A;  3MTN B;  2W3S A;  4ZHP A;  1DOX A;  2DHZ A;  3H8H A;  1AYF A;  2Y5C A;  4LNN A;  5L95 C;  1N5X A;  4N6E B;  2N9E B;  2MW5 A;  4MDK E;  3P42 A;  1UBI A;  1E8X A;  2JWU A;  3GE3 C;  2GLS A;  3V05 A;  1TKY A;  1UWM A;  1LFD A;  2MQJ A;  4I6L B;  3U7D A;  3L08 A;  2OHF A;  4BBN C;  1CK1 A;  4FN2 A;  2DZJ A;  1GJZ A;  1RWS A;  2N7D A;  1I4R A;  4HVB A;  3PRP B;  4S0R A;  3AU5 A;  3HM6 X;  2J52 A;  4DDG D;  2V3S A;  2CHZ A;  1NI3 A;  1V81 A;  2BS3 B;  1V5O A;  2WXK A;  1YD8 U;  1V2Y A;  3B08 A;  4IWP A;  3HRD D;  4F1S A;  4GIV A;  4YTN B;  4W9C A;  2L32 A;  2NPT B;  2N9K A;  5EE1 A;  4ARC A;  1XXG A;  3ZNZ B;  3QJZ A;  1UUP A;  1J7B A;  4ZRP A;  2M8S A;  3DVG X;  3RT3 B;  1FNU A;  2K39 A;  2FE8 A;  1Y8R C;  3MP9 A;  3OAW A;  2K22 A;  4BBN F;  3SU8 X;  3P2B A;  1VZ7 A;  2LXC A;  4I6P A;  3WAL A;  2KKC A;  3DHI C;  1P3Q U;  1L0Y B;  2JU6 X;  4HRS A;  3T3N A;  3Q8C A;  1XEE A;  3H1U A;  3NZS A;  1XT9 B;  1BUI C;  3KQ4 A;  2G3Q B;  3BZD B;  3OJ4 B;  4PS8 A;  5GXG B;  2N7E A;  3SD5 A;  1F52 A;  4DHJ B;  4N58 A;  3AE8 B;  3PLV A;  4GU2 A;  2JPH A;  1NBF C;  3RUL A;  1F9J A;  3GZN B;  2MBO A;  3RNE C;  4WJP A;  4RH6 A;  5L83 A;  4G0N B;  4OW0 A;  1MG4 A;  1PGX A;  1TTN A;  3B2G A;  2NTS A;  2LUM A;  4WAA A;  4XZ4 A;  4M01 A;  3ZRF A;  2KVR A;  2KN5 A;  2FCM A;  3V6C B;  3NY5 A;  2GB1 A;  2XBB C;  3JVZ X;  2KMM A;  3BWU D;  2C60 A;  4EFO A;  4DDI D;  4WWM A;  3ONS A;  2MP2 A;  4OZB A;  1N60 A;  1SE3 A;  4G3X B;  1ACC A;  1E5W A;  3BII D;  2J7Q B;  1OFF A;  3DBL B;  4JWU C;  3Q3J A;  3UQA A;  3UI3 A;  2D3B A;  4BOS C;  2NVU I;  4WJO A;  5C2T B;  4P1C C;  3WIM A;  2WXG A;  1JRO A;  1WI0 A;  3VUW A;  4LJP B;  4IM2 A;  1HXY D;  1TBE A;  1ZXI A;  4W9I A;  3RZF A;  2FBW B;  4IDI A;  2J0J A;  2WX1 A;  4LNI A;  2NR2 A;  2LGS A;  3AE7 B;  4W9H A;  1R4N B;  3EFU A;  3VHT C;  1KTK A;  2BPS A;  4K3B A;  5DPS A;  3Q3O C;  4A20 A;  4K1R B;  4C7Z A;  5DPT A;  4E3C A;  3R7R A;  2JZZ A;  3P4Q B;  2NBV B;  1KJT A;  2WHI A;  2IO0 B;  2LHD A;  3LYY A;  3QAR A;  2WXH A;  3PT2 B;  4ANW A;  2IZV B;  1MG8 A;  3KLS X;  4M0W B;  1VLB A;  1GAQ B;  1QZE A;  1S3S G;  1P0R A;  2DZM A;  1GC7 A;  2LAS A;  1NYQ A;  4GB9 A;  1JQ4 A;  1N5W A;  3P4S B;  1Z2M A;  2JQR B;  5IN7 A;  2ZVO A;  2CKH B;  4WQM A;  4YSX B;  1MVK A;  3AEF B;  1PQS A;  4ICU A;  4NAW B;  5FR6 A;  3I5J C;  1X1M A;  2HE7 A;  3N30 A;  3AE5 B;  4WUR A;  1VJK A;  3PHW B;  1AN8 A;  5C3J B;  3ZUN A;  1UEL A;  4JL9 A;  4CHK A;  3GE8 C;  2KJ6 A;  3MC9 A;  1SGH A;  1HA5 A;  2AL3 A;  4RCO A;  1V6E A;  1SSN A;  1YOV B;  2OJR A;  4JGH B;  4JQW C;  4DBG A;  5JXV A;  2JXT A;  3VR9 B;  2KTF A;  1TY0 A;  4OVV A;  2PVG C;  3ZO5 B;  1R7S A;  3Q3M C;  2DYO A;  4HPM B;  3W1S A;  2MBQ A;  2QJL A;  4M00 A;  4KSL C;  4TQ1 A;  1MJD A;  3BY4 B;  4JE3 B;  3AN1 A;  1SXT A;  3ZTC A;  2D11 A;  3L16 A;  4ZOH C;  3ZDM C;  4EKU A;  2ICI A;  1WMH B;  1QOA A;  4FHJ A;  1GC6 A;  2C7H A;  1XLQ A;  4K81 A;  2M0X A;  1GB4 A;  2MBB B;  1I4P A;  3N9Y C;  1PFD A;  3AU4 A;  3AE3 B;  4C4V A;  1YJI A;  2CU1 A;  4RGM A;  4YTP B;  1T5X D;  3AEC B;  2WXJ A;  4MEM A;  3TBL D;  1WXM A;  4OVU A;  1WX7 A;  3H7P A;  2INC C;  1T0R C;  3RNF C;  2V9H A;  3RUI B;  1C3T A;  4ICV A;  1N62 A;  1WR1 A;  3TUO A;  3MJ5 A;  2BKR B;  3JW0 X;  5AEK B;  1HTQ A;  2W82 A;  3HK0 A;  1YN5 A;  4JX1 C;  4W9J A;  4WH4 A;  1WY8 A;  1R4M I;  1TY2 A;  1WGK A;  3ZNI D;  3D32 A;  3DQV A;  4XX5 A;  4MT5 A;  2CJO A;  3VTU A;  1OQY A;  4HWI B;  2GI9 A;  1JWA D;  4US8 A;  1ENF A;  4YT0 B;  2I2Y A;  3I3T B;  3DBR I;  2R2O A;  1QLB B;  4W9G A;  3RI7 C;  2GBN A;  1MI0 A;  5C23 A;  2MCN B;  2N4F A;  3IHP C;  3WAM A;  4GMV A;  4HCP B;  3APF A;  1XQQ A;  5BYR A;  3KWL A;  3T8M A;  3Q3N C;  3A1Q B;  2VH2 A;  5CHW A;  1FD6 A;  4HKQ A;  4PS7 A;  2Y5B B;  2KWV B;  4ANV A;  2L00 B;  2M1M A;  4JWS C;  2KT7 A;  3Q14 C;  1V97 A;  5D3D A;  1WWT A;  1YNT E;  1GNU A;  3DWG C;  1KFY B;  5J17 A;  4PYZ A;  2WS3 B;  1WSP A;  2KX3 A;  4XGA B;  4OVZ A;  3DCG A;  4GDK A;  1OEY A;  4LK0 M;  4YL8 A;  2DYB A;  2BWE S;  1FCC C;  1QT9 A;  2MSE D;  2LGI A;  2L52 A;  2B76 B;  3EUB 2;  2XK5 B;  3UIN B;  4YTM B;  5IP4 D;  4FAD A;  3M62 B;  2ZZP B;  3PTF C;  4II2 B;  3M63 B;  1TZO A;  2IO2 B;  2ZCC A;  4P1B C;  1U4A A;  1WR6 E;  2BS4 B;  3VVW B;  2QEJ C;  3SFD B;  1MHH E;  4GDL A;  1S1Q B;  3KUC B;  2BS2 B;  1V1P B;  3BK1 A;  1YMH E;  4MM3 B;  3TCA A;  2FUG 1;  2BT6 A;  2WGS A;  5IO9 A;  4DHJ D;  2WXO A;  1KRH A;  1D5M C;  5BMH A;  2N1W A;  3IAS 1;  1YQ3 B;  1VDV A;  4Q2J A;  3KVF B;  4P6V F;  1RYJ A;  4KGT A;  1FPY A;  2I1J A;  2KLC A;  3VR8 B;  1K52 A;  4C00 A;  2DLB A;  1BT0 A;  2MJ3 A;  1E7U A;  1P7E A;  3HVZ A;  4RF0 A;  3QHT A;  2QIL A;  2B3A A;  4CYE A;  2XEW A;  2PLP A;  2RPQ A;  1EM7 A;  3GB1 A;  4UDU C;  4P7I A;  2D10 A;  2M56 B;  4AUQ C;  2J53 A;  3K9P B;  3K9O B;  3ZXR A;  4PT5 A;  1WGY A;  2D07 B;  5I4D A;  2XN9 C;  2R61 A;  4IW0 A;  1NYR A;  3PPA A;  4NJ6 A;  2E6X A;  2JX5 A;  4BFR A;  2JRH A;  3ML8 A;  2WXR A;  3AXC A;  2NTT A;  2Z0E B;  4WJN A;  3QX1 A;  3NS1 A;  3N1X C;  4X57 B;  2KTR A;  4AWJ A;  1ZOY B;  4B95 A;  1F2R C;  1YX6 B;  4H2A A;  2OJW A;  3IXS A;  3EEC A;  4BAX A;  5CTR C;  2ZNV B;  1ROE A;  2BVC A;  4I6N B;  4KZ0 A;  1C4P A;  2HTH A;  3VAW A;  5HG2 A;  4C80 A;  4L1B A;  1SF0 A;  1WGR A;  1FM0 D;  2VRR B;  1UWX A;  4AJW A;  4KVG B;  2WDT B;  4YWG G;  3EFC A;  3AB5 A;  4XDC A;  3T3O A;  2ZW1 A;  5G2N A;  3J9C A;  1N6Z A;  4NY0 A;  2IY0 B;  1JRP A;  1TS2 A;  3TL5 A;  4D2K A;  2MJD A;  2IGH A;  2O6V B;  4R3D A;  3AE2 B;  1FEH A;  1FXA A;  1L5P A;  3R3M A;  1LGR A;  2LEK A;  3AEE B;  3H7S A;  4KDL B;  3W2D A;  4TKN A;  2QSD A;  1CQV A;  5J18 A;  3C0R B;  4K7U A;  5BYS A;  2AQ2 B;  3NRZ A;  3Q3F A;  2IGD A;  4GDK B;  3V6E B;  2GBK A;  3QWZ B;  2BB6 A;  1F0Z A;  3VH4 B;  1WIA A;  2W54 A;  4IUM B;  4B0E A;  3N20 C;  4AOF A;  1RAX A;  1ET6 A;  4S17 A;  2KC2 A;  3L13 A;  1D3Z A;  2KN4 A;  1WM2 A;  4TQ0 A;  5LNK 1;  4WWP A;  2N9X A;  5EE9 A;  1TS4 A;  4FHK A;  2EEL A;  3DHH C;  4OHJ A;  3R2T A;  2KFK B;  4BKS D;  4CO7 A;  2KDF B;  1Q5W B;  1E90 A;  4LTU A;  1F1H A;  3SEB A;  4N59 A;  3MHS D;  4MGY E;  3A9K A;  2JXX A;  1RRB A;  5FR3 A;  4FUL A;  3UQB A;  1FMA D;  4ZYS A;  2LGX A;  3ABV B;  2JZP A;  2PVO D;  3NS8 A;  1HZ5 A;  2WXM A;  1KF6 B;  4B0M A;  1WGG A;  4EEW A;  4A55 A;  5JHA A;  4HLE A;  1Q10 A;  1LM8 B;  2MBE A;  1WE6 A;  3U30 A;  3AM9 A;  1YX5 B;  2WNM A;  2LGD A;  2GRI A;  4FLH A;  2PKO A;  3WA0 A;  3MFG A;  1RM6 C;  1D5Z C;  2K8C A;  4LNF A;  1IUE A;  1LQB A;  3RNC C;  2ACZ B;  4MJS A;  1R4N I;  2X8X X;  1T6B X;  1YQB A;  5AZF A;  2DZK A;  5BMG A;  2DYM A;  3TMP B;  1E10 A;  3FAH A;  3PLU A;  2KAC A;  4XE0 A;  4ANX A;  3W9C B;  2PEA A;  1WJ6 A;  3BYT B;  3CST A;  4ACF A;  1SE4 A;  1YIW A;  2BYF A;  3VUX A;  3AH7 A;  2VZK B;  2DX5 B;  1WJ4 A;  3URY A;  2LZ6 A;  2Z0D B;  1C77 A;  3PV1 A;  4C56 C;  2ZNV C;  2IY1 B;  2Y3A A;  4IWQ A;  4FA6 A;  5BMI A;  1L6U A;  3MJW A;  3RFZ B;  1WYW B;  3OJ3 A;  3IBE A;  4ITK A;  3BVM A; 
#chains in the Genus database with same CATH homology
 2C7H A;  3QC8 B;  2KMC A;  2FIF A;  2KFK A;  2PE6 B;  2M0X A;  3PHX B;  4K81 A;  3UIO B;  2MBB B;  4B9K A;  2FCN A;  1XD3 B;  2PJH A;  3AU4 A;  5D94 A;  1I42 A;  3DOW A;  2LJ5 A;  4BOZ B;  1E7V A;  1NF1 A;  2GOW A;  3RYT A;  1UZX B;  2RGF A;  3GZN I;  2CU1 A;  1LXD A;  1WM3 A;  4URK A;  3R7Q A;  3QK0 A;  4F7Z A;  1C1Y B;  4MEM A;  3TBL D;  1WXM A;  2CS4 A;  3R66 C;  5EDS A;  4OVU A;  4EZL A;  1WX7 A;  2KX0 A;  1J8C A;  3H7P A;  4G50 A;  4FBJ B;  2K8H A;  2W9N A;  2L3Z A;  1EUV B;  1WE7 A;  3RUI B;  4KIK B;  3GOE A;  2CR5 A;  1C3T A;  4ICV A;  4GDL B;  1WR1 A;  3V60 A;  2WWZ A;  1OTR B;  2BKR B;  3ZIM A;  2ASQ A;  2IO1 B;  5CX3 A;  3JW0 X;  2KJR A;  5AEK B;  4W9L A;  2KQS A;  1IP9 A;  3HK0 A;  4W9J A;  5KHQ A;  1ZKH A;  3OLM D;  2R2Q A;  2DAJ A;  5IAA C;  2KO3 A;  4JIO U;  1WY8 A;  1WGD A;  1R4M I;  3DVN V;  5G55 A;  3W1S C;  3M95 A;  2RR9 A;  1GG3 A;  4HCN B;  3ZNI D;  2BKF A;  3D32 A;  3DQV A;  4XX5 A;  3QCA A;  4PYU A;  4BKS A;  4EZK A;  2O2V B;  3KUD B;  3VTU A;  1OQY A;  4HWI B;  4NAW A;  2K1F A;  4K7W A;  4DK5 A;  1VD2 A;  2G4D B;  2HD5 B;  2WYQ A;  1J19 A;  2GBJ A;  3DBL I;  3ZRC A;  3I3T B;  1FXT B;  3DBR I;  2R2O A;  3LDZ E;  1WX9 A;  1CMX B;  4LCD E;  4W9G A;  1L7Y A;  3KW5 B;  5LLI A;  2KDI A;  2GBN A;  5C23 A;  4B6W A;  4TUU A;  3DDC B;  2L7R A;  2MCN B;  4EOY A;  1M94 A;  1NDD A;  5JHB A;  2D2Q A;  2N4F A;  4WJQ A;  1OGW A;  1WXS A;  3IHP C;  4NQK E;  4XC2 A;  1SIF A;  3WAM A;  2L8J A;  1RFA A;  4GMV A;  4HCP B;  5IA7 A;  3APF A;  3ZDT A;  1XQQ A;  5J2R A;  2IBI B;  3U8Z A;  3PVL A;  3T8M A;  3A4R A;  4KV2 A;  3A1Q B;  3A9J B;  1WRD B;  3L10 B;  1A5R A;  1AAR A;  4WQO B;  4BVU C;  3MTN B;  2V4L A;  5CHW A;  3N3K B;  2DHZ A;  3VTV A;  4PS7 A;  1GUA B;  2UWQ A;  2Y5B B;  3JSV A;  2I1K A;  2KWV B;  2AEH A;  2JWZ A;  5L95 C;  1OEY J;  4AJY B;  2KJH B;  4ANV A;  2L00 B;  2M1M A;  2N9E B;  3TJP A;  2MW5 A;  4MDK E;  2C5L C;  1UBI A;  1E8X A;  2LXA A;  3RCZ A;  2OOB B;  3KH0 A;  2CHW A;  5DCN A;  3ECI A;  3JYU A;  5CHV C;  4W9D A;  1GNU A;  4LDT D;  3A33 B;  1WMH A;  2MRP A;  5E6O A;  5J17 A;  3KYD D;  4PYZ A;  2KX3 A;  4AP4 C;  1LFD A;  2MQJ A;  4I6L B;  3U7D A;  2MA9 B;  4GN1 A;  4BKT A;  5JZE B;  3DCG A;  4GDK A;  2KTR B;  3L08 A;  4BBN C;  1WXA A;  3LJ3 A;  2D3G A;  3M3J A;  2Z59 B;  4FN2 A;  2DZJ A;  4MSQ B;  1GJZ A;  1OEY A;  4IM0 A;  2JZ3 B;  2LUE A;  3RZW C;  4YL8 A;  2DYB A;  2BWE S;  2MSE D;  1ISN A;  2BGF A;  4ANU A;  2N7D A;  2NBU A;  4MGK E;  4HVB A;  4HXD A;  1P9D U;  3PRP B;  2XK5 B;  2L0F A;  3TIX A;  3UIN B;  3AU5 A;  3HM6 X;  2G4S A;  2GMI C;  2KC1 A;  2V3S A;  4DDG D;  3M62 B;  2CHZ A;  4FAD A;  1V5T A;  2ZZP B;  3PTF C;  4II2 B;  3M63 B;  4M8M A;  2IO2 B;  1V81 A;  1T0Y A;  1V5O A;  2ZCC A;  1TZ1 A;  1U4A A;  1WR6 E;  2J0K A;  2FAZ A;  1YD8 U;  1V2Y A;  3B08 A;  3VVW B;  4MH0 E;  2ZJD A;  4KIK A;  3BXJ A;  2K25 A;  2MP2 B;  2LD9 A;  4IWP A;  1IYF A;  4IWO A;  4GDL A;  1S1Q B;  3KUC B;  4IC7 B;  4K7S A;  4F1S A;  4GIV A;  4NPN A;  4W9C A;  2LVO A;  4JLC A;  3PRZ A;  3TCA A;  4LDT B;  4ZRJ A;  2NPT B;  4ZYN A;  4A3P A;  3ZNZ B;  2EMS A;  3QJZ A;  2ZPY A;  4GXB A;  4DHJ D;  1WQ1 G;  3IVF A;  2NBW B;  4GOC A;  2ZPN A;  2JVC A;  2N1W A;  1WJU A;  2M8S A;  1UGM A;  3DVG X;  3RT3 B;  4J6I A;  3N32 A;  1G6J A;  2K39 A;  3DPD A;  1Y8R C;  3KUZ A;  3KVF B;  4IG7 B;  3OAW A;  4FJY A;  4BBN F;  3SU8 X;  3P2B A;  3ENE A;  2LXC A;  2I1J A;  2KLC A;  2M17 A;  4I6P A;  3WAL A;  2LRU A;  2KKC A;  1BT0 A;  3PSE B;  3FAY A;  1E7U A;  2LRW A;  2KAN A;  2LGY A;  1P3Q U;  2BWF A;  3PGE A;  2LVP A;  3VDZ A;  3QHT A;  2B3A A;  4CYE A;  3NHE B;  2XEW A;  2DEN B;  1RLF A;  4DXA B;  2RPQ A;  3H1U A;  3V62 A;  4HDQ A;  2KZR A;  4EZJ A;  3NZS A;  1XT9 B;  4GGQ A;  3A1Q A;  3HM3 A;  2REX A;  3A9J A;  3VQI A;  4HJK A;  2G3Q B;  5LXH A;  4P7I A;  4BKG A;  2D10 A;  3OJ4 B;  4PS8 A;  3K9P B;  3K9O B;  4RM8 A;  4AUQ C;  3DBH I;  2N7E A;  3SD5 A;  3ML9 A;  1EO6 A;  3VXW A;  4DHJ B;  1WXV A;  1WGY A;  2D07 B;  2KK8 A;  2NS5 A;  2AL6 A;  3PLV A;  3VFK A;  4GU2 A;  2JPH A;  5DPW A;  1NBF C;  3X23 A;  3RUL A;  3HIZ A;  2L05 A;  4IW0 A;  3CMM B;  3PPA A;  2AWT A;  4II3 B;  1F9J A;  4NJ6 A;  5BO4 B;  2KLG A;  2MBO A;  4BFR A;  4WJP A;  2IYD B;  2JRH A;  3ML8 A;  4IM3 A;  3AXC A;  4PS3 A;  5L83 A;  3A9K B;  2MLB A;  3EHV A;  5JH5 C;  4G0N B;  2L76 A;  4MGI E;  2Z0E B;  4W9K A;  4WJN A;  3QX1 A;  3IG3 A;  1K8R B;  4NNJ B;  4X57 B;  2KTR A;  1H8C A;  1I35 A;  1TTN A;  3APD A;  4AWJ A;  2O6V D;  2N9P C;  4WAA A;  4B95 A;  2K6D B;  4XZ4 A;  1WJN A;  2GBM A;  2EMT A;  3PS6 A;  3B1L X;  1YX6 B;  5DPR A;  3DVN U;  3ZRF A;  2KVR A;  2KN5 A;  2FCM A;  3EEC A;  3V6C B;  2C9W B;  2KWU B;  2XK5 A;  5CTR C;  2MWS B;  3NY5 A;  2ZNV B;  3ALB A;  2N1V A;  2BYE A;  1ZW7 A;  2BYV E;  3JVZ X;  2XBB C;  4I6N B;  4KZ0 A;  2HTH A;  1E8Y A;  3PRE A;  3VAW A;  2C60 A;  4EFO A;  1JRU A;  1V86 A;  4DDI D;  2ZVN A;  1UBQ A;  3ONS A;  2FNJ B;  1YJ1 A;  2KQ7 A;  2MP2 A;  4M8N A;  1L2N A;  1WGR A;  1V9J A;  5AZH A;  4FJZ A;  3WAP A;  3IFW B;  2VRR B;  4G3X B;  4AJW A;  4KVG B;  1E5W A;  2WDT B;  2A4Z A;  2PE9 A;  2J7Q B;  4MM3 A;  2BF8 B;  1VCB A;  2JF5 A;  3RD2 A;  3Q3J A;  3UQA A;  4A3O A;  2NPT A;  2WX0 A;  2V1Y A;  2ZCB A;  5G2N A;  2NVU I;  2KDB A;  4BOS C;  2G45 B;  1E8W A;  4WJO A;  2RD0 A;  2LI5 A;  4NY0 A;  3WAN A;  4MJS B;  2A5U A;  2K6Q A;  3AUL A;  3WIM A;  2IY0 B;  3ZW3 A;  3UIP B;  1KOT A;  4DHZ E;  3TL5 A;  1Q1O A;  1WI0 A;  2O6V B;  3VUW A;  2K8B A;  4LJP B;  4W9E A;  2NCN A;  3ZNH B;  3SDL C;  4LJO B;  1V49 A;  3R3M A;  4IM2 A;  1WGH A;  1TBE A;  4W9I A;  5GMV A;  3RZF A;  3H7S A;  2LVQ A;  4KDL B;  3CSF A;  2M4N A;  4MSM B;  3H9D A;  4NJ7 A;  4TKN A;  2J0J A;  1SE9 A;  2KD0 A;  2J0M A;  2WX1 A;  4GSW A;  5J18 A;  2NR2 A;  3C0R B;  3ZNG C;  4K7U A;  2KNB A;  4ASW C;  2C7N B;  3Q3F A;  1IPG A;  1KLV A;  4GDK B;  4W9H A;  3V6E B;  3EFU A;  2GBK A;  3B0A A;  3QWZ B;  3VHT C;  2BPS A;  2O2V A;  2UYZ B;  3VH4 B;  1KM7 A;  2KWC A;  1WIA A;  5DPS A;  5TR5 A;  1EF5 A;  4IUM B;  2MBH A;  1WFY A;  4F8C B;  4AOF A;  1RAX A;  4A20 A;  4N9F 4;  4G11 A;  2KC2 A;  3L13 A;  4K1R B;  3BIN A;  1WZ3 A;  1D3Z A;  3VUY A;  3L17 A;  1WM2 A;  2CHX A;  4TQ0 A;  4WWP A;  2N9X A;  1UH6 A;  1WH3 A;  5DPT A;  3QQ8 B;  3R7R A;  1WX8 A;  1WZ0 A;  4E3C A;  1Z5S B;  4TV3 A;  4FHK A;  2KMA A;  4KDI C;  2KFK B;  4KZC A;  2JZZ A;  4BKS D;  4CO7 A;  2KDF B;  2NBV B;  1Q5W B;  5D7G A;  1KJT A;  2IO0 B;  1E90 A;  2RSU A;  3L0W B;  2GBR A;  3QAR A;  3ZLZ A;  3VH3 B;  4DHZ B;  3PT2 B;  4ANW A;  2HJ8 A;  2PPH A;  3MHS D;  4MGY E;  3A9K A;  2JXX A;  2IZV B;  1MG8 A;  3UF8 A;  3H7P B;  1RRB A;  4M0W B;  1HE8 A;  4FUL A;  3VTW A;  4ZRK A;  1EF1 A;  3UQB A;  2YVC A;  1QZE A;  2DZI A;  1S3S G;  1P0R A;  2DZM A;  2IO3 B;  1GC7 A;  2LAS A;  2FCQ A;  2FCS A;  2LGX A;  3HHM A;  3L54 A;  3NOB A;  3NS8 A;  4E71 A;  3NZU A;  4GB9 A;  1ZGU B;  1WGG A;  3EC8 A;  4EEW A;  4RMA A;  5JHA A;  4DWF A;  4HLE A;  1Z2M A;  1LM8 B;  2MBE A;  2ZVO A;  1WE6 A;  3U30 A;  5E6N A;  2CKH B;  3H6N A;  3QIJ A;  5D2M B;  2KDE B;  3O65 B;  4HDO A;  3S2A A;  1PQS A;  1YX5 B;  4RM9 A;  2LGD A;  1V80 A;  1WF9 A;  4ICU A;  3X0W A;  4NAW B;  5E6P A;  5FR6 A;  2AYO B;  4MGZ E;  1H4R A;  1X1M A;  2FUH B;  2HE7 A;  4E74 A;  1NI2 A;  3N30 A;  4FLH A;  2FID A;  1UD7 A;  1P98 A;  2JT4 B;  4WWO A;  3WA0 A;  3PHW B;  3ZKJ C;  2ZEQ A;  1TGZ B;  3KYC D;  2JY6 A;  2K8C A;  2LWP A;  1LQB A;  4MEL A;  3PZD A;  4ZRI A;  3ZUN A;  4MJS A;  1R4N I;  1P1A A;  1UEL A;  1YQB A;  4JL9 A;  5AZF A;  4CHK A;  2DZK A;  5C1Z A;  3WAO A;  3QA8 A;  3W1Y A;  3CF6 E;  4ZDV A;  2KHW B;  2KJ6 A;  2O6V A;  4HPL B;  2KOX A;  2DAF A;  4FJV B;  1SGH A;  2DYM A;  3TMP B;  2AL3 A;  1V6E A;  3PLU A;  5KHO A;  4ANX A;  2YLM A;  2OJR A;  2PEA A;  4JGH B;  1WJ6 A;  4JQW C;  4DBG A;  1E8Z A;  3CST A;  5CHF A;  3A4S C;  1Q0W B;  3SHQ A;  3ZTD A;  4W9F A;  3UGB B;  1YIW A;  2KTF A;  2MX2 A;  3V61 A;  3ZVV A;  3AI5 A;  2BYF A;  2JRI B;  2QHO A;  3APC A;  3VUX A;  5LXI B;  2DX5 B;  3JSV B;  4OVV A;  1WJ4 A;  4NQL B;  3ZO5 B;  2C7M B;  2DYO A;  2LZ6 A;  4KSK C;  4HPM B;  4WWN A;  5AZG A;  2MBQ A;  2EKE C;  2Z0D B;  5D6J B;  3W1S A;  2JUO A;  3PV1 A;  4KSL C;  4HK2 A;  4TQ1 A;  2ZNV C;  2IY1 B;  2KXJ A;  4IWQ A;  4FA6 A;  3T9L A;  3BY4 B;  3DVG Y;  3ZTC A;  4EKU A;  4EUT A;  2D11 A;  3L16 A;  3ZDM C;  3QAQ A;  3MJW A;  1J0G A;  3DBS A;  1WER A;  1WMH B;  5HKH A;  1WYW B;  3OJ3 A;  3IBE A;  3PRM B;  4FHJ A;  1GC6 A;  2KFJ A;  2L0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...