1OFFA

2fe-2s ferredoxin from synechocystis sp. pcc 6803
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
publication title The Active Conformation of Glutamate Synthase and its Binding to Ferredoxin
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1offA00
3HVZA 1WWTA 2DBYA 3AEDB 3P4SB 5H92C 2WU5B 5AUKA 2BS2B 4YSZB 3AE3B 1NENB 1NVID 4WWMA 1GPXA 1ZP0B 3L4PA 2H88B 2PVOD 3AE1B 3AE7B 3AEEB 1V97A 1TKGA 1IUEA 2H89B 2B76B 2W3SA 2DWQA 1QOFA 3W5UB 1L5PA 3NVYA 2LEKA 3DWGC 5EE9A 1QOAA 2W54A 1OFFA 4N58A 2MJDA 2BT6A 1PFDA 3LB8C 4JWSC 3NS1A 1XLNA 3AEGB 2N0SB 3B9JA 1FMAD 2K9XA 2WLBA 1I7HA 1EWYC 4A9AA 2WS3B 1KRHA 1JROA 3W9CB 4YT0B 2JQRB 1ROEA 1TKYA 5EE1A 2MJ3A 2KMMA 4YSYB 4KX6B 1GAQB 1ZOYB 2HTME 3AE9B 4C7ZA 4YSXB 1YJIA 2MH7A 1JW9D 1N5WA 3AE4B 3SFDB 1T3QA 1UWMA 3P4PB 5EE3A 2MJEA 1AYFA 1XO3A 2FBWB 1FIQA 1YQ4B 5GXGB 3AEAB 2W3RA 3NVWA 1KF6B 4ZHPA 1E9MA 3P1MA 2W55A 2QJLA 4US9A 3ZYYX 3NRZA 1NEKB 4ZHOA 1RWSA 1NYRA 4P6VF 1V8CA 2BS4B 4N6EB 1JRPA 2QIEB 1E10A 1PDXA 1WXQA 4US8A 1TJEA 2WDVB 3B2GA 1L6VA 1CJEA 2KAJA 1DOIA 1TKEA 2BS3B 1E7PB 3AN1A 1YJJA 1ZUD2 2WQYB 1JWAD 3P4RB 1VJKA 3AE6B 3SR6A 3AE8B 2L52A 1N60A 1JWBD 1QT9A 3AEFB 5G5GA 3HRDD 1QOGA 1JQ4A 1J7BA 1E6EB 3ETRA 2CJOA 4YTPB 1FFVA 1QLBB 1SF0A 2AX5A 4N59A 5C3JB 2E3TA 2PKOA 1XLQA 3FAHA 1DGJA 4IDIA 1WRIA 1PUTA 3CIRB 4YTMB 1DOYA 3NVZA 1OQQA 1R7SA 1FXIA 2EKIA 1N5XA 2M19A 3WCQA 2PIAA 3EUB2 1FFUA 3VR8B 3B2FA 1E0ZA 1FM0D 1FXAA 1NI3A 2CJNA 1SIJA 1A70A 2WU2B 1QOBA 3FC4A 4YXDB 1RM6C 1N61A 2Y5CA 1VDVA 2PVGC 3AH7A 4HRSA 2Q5WD 1N62A 1NYQA 5C2TB 1FO4A 3AM9A 3RPFC 1XLOA 1WYGA 1OQRA 2K22A 3VR9B 1KFYB 2M56B 3AEBB 1VLBA 4C80A 1RFKA 3CWIA 3W5VB 1RYJA 4JWUC 3VRBB 1F0ZA 1QF6A 1TYGB 3AV8A 4WQMA 1JALA 4HROA 4USAA 3BIID 4ZOHC 1CZPA 2JX5A 1DOXA 4LTUA 1J7CA 3HUIA 3NVVA 1L0VB 3AE5B 4JX1C 5AUIA 2K5PA 5H8YE 2WDRB 2ACZB 2WDQB 4YTNB 3P4QB 3VRAB 3DWMA 4C7YA 3AB5A 1AWDA 1L6UA 3ABVB 3AMZA 1B9RA 1N63A 3LXFA 1J7AA 2OHFA 3P63A 5G5HA 1SB3C 3AE2B 3SFEB 5MPOA 1YQ3B 4FXCA 4ITKA 2L83A 1FRRA 1FRDA 2G1EA 1XLPA 2CU3A 3KWLA 1WGKA 2WP9B 3PO0A 3AECB 1ZXIA 5EE0A
chains in the Genus database with same CATH superfamily
3ECIA 1D3ZA 2GBKA 3WIMA 2K8BA 4RNAA 3C19A 3IBEA 1IBXB 4FLHA 3L16A 2JRHA 4MEMA 1TKGA 1AN8A 2H89B 3PHWB 3ENEA 1L5PA 1V6EA 3S2AA 2FNJB 2CHXA 2WXKA 2NBWB 2BTEA 2C5LC 3SDLC 1GC6A 1YX6B 4W9IA 1HZ6A 2V0GA 3W1SC 2WWZA 1UWMA 4JLCA 1MFWA 2NVUI 1FCLA 2LGXA 3BK1A 3CF6E 4MM3B 2WYQA 2N1WA 4P6VF 2JT4B 2LMCA 3B2GA 2LVOA 3NZSA 1K52A 2BBCA 3SD5A 2WXGA 2I1KA 2KVRA 2G4DB 1E5WA 4KIKA 3N1YC 5C3JB 3FAHA 5EDSA 4M8MA 2KDMA 5GMVA 2N9PC 1Y8RC 4YXDB 1V1OA 3ZJTA 3PZ8A 1TT5B 5E6OA 2LVQA 1C3TA 2MCNB 4C80A 2KZRA 3N3KB 2GLSA 3I9V1 1BT0A 3KYCD 2D11A 2JYEA 4F8CB 1SE2A 1GJZA 1TZOA 5H8YE 3VRAB 1E0ZA 3DQVA 1I4PA 4DHZE 3W2DA 1XQQA 2BB5A 1E7VA 3KVFB 4KZCA 3EA6A 2ONQA 3ZRCA 1XT9B 2KKCA 4GSWA 2KWCA 4PK1A 3DBRI 3ZXRA 4GDKA 4B95A 1V86A 2KFJA 1Z5SB 2MEKA 2WXOA 2JYTA 3VAWA 2LZ6A 2BB6A 2DWQA 3KQ4A 4A3OA 2AQ2B 5EE9A 3O65B 3RNCC 3ZNGC 2BKFA 2BF8B 4MGIE 3VXWA 3PVLA 3NZ3A 4RGOS 1OEYJ 1GAQB 4BBNF 4DHZB 3AU5A 4TMAB 1XO3A 2KWDA 3EC8A 4URKA 2KO3A 3AU4A 1KF6B 1HA5A 1ZGUB 4IM0A 3QARA 1WX8A 1RWSA 3U4EG 2N7DA 4BKTA 1TJEA 1TKEA 2D3BA 3AEFB 1C78A 2L52A 1JWBD 1JQ4A 1PQSA 4NZLB 4GB9A 1XLQA 2KVZA 3R7QA 3BYTB 3V05A 4UDUC 2V9HA 3IAS1 2ZJDA 2KN5A 2Y5CA 4WWOA 1SEBD 2PVGC 4FJZA 4HRSA 5BMGA 5HKHA 1ENFA 1XLOA 1WYGA 1SE3A 4G0NB 2PPHA 2ZPNA 3W5VB 2EKEC 1F0ZA 2QMTA 1YX5B 2LGYA 3L08A 1JALA 1J7CA 4FA6A 3MC0B 3K9OB 1TY0A 3MJWA 1MHHE 3P63A 3M62B 1YQ3B 4GIVA 2PJHA 3R3MA 4LNKA 3HVZA 1L0XB 1YMHE 1NDDA 2ASQA 3M95A 1FXTB 5BO4B 3M63B 2B76B 2KDFB 1YIWA 3KLSX 5LLIA 4XZ4A 2KNBA 3DWGC 1K51A 2JXTA 2DHZA 4TUUA 4JWSC 1GUAB 4RM8A 2IO0B 1EWYC 1FCCC 2XEWA 4HWIB 1VZ6A 1YJIA 1WF9A 3ONSA 4MDKE 2X38A 4XDCA 2BGFA 1MI0A 1TGZB 2JZZA 4MGYE 2FCSA 1RLFA 2N1VA 4WAAA 1M4VA 3ML9A 4RMAA 5CHWA 4GOCA 2LVPA 4MACA 3A9JB 1LQBA 2KOXA 1SIFA 2KLCA 3BVGA 2CKHB 1ISNA 2G9HD 2K0PA 2KQ4X 1MHXA 1R7SA 2YVCA 2NTSA 4ARIA 1WI0A 2WXJA 3WAPA 4BVUC 1P98A 1LM8B 1C4PA 2SEBD 2KC1A 4RCOA 1KTKA 1HE8A 1MG4A 1I4RA 4WQMA 4LJOB 3RMKC 3KUCB 3RNAC 1LFDA 1CZPA 2LHEA 4LTUA 1T0RC 1LXDA 2M0AA 3A9KA 4HXDA 3LDZE 4C7YA 2L0FA 3VTUA 1N63A 3DOWA 1H4RA 5BYQA 5EE0A 1ACCA 1WWTA 5KHQA 4ANVA 5H92C 2GOWA 3Q69A 2D3CA 2O2VB 2FCQA 1K8RB 4MJSA 5IN7A 1QOFA 2LEKA 4WJOA 2V3SA 1GG3A 1RAXA 2WX0A 3PS6A 4DDID 1VD2A 2XN9C 1NI2A 4YT0B 4GU2A 4GDLB 2L8JA 5D7GA 5EE1A 3TEXA 3AE9B 3DBHB 1BUIC 2QHOA 3A1QA 1IYFA 1JMLA 3KW5B 1AYFA 3KYDD 3OAWA 2J53A 5DPRA 2MLBA 1BMLC 2RSUA 4DQOC 3CSFA 1YJJA 1JWAD 4KV2A 1QT9A 1FNWA 2VZKD 4YL8A 3QCAA 2PKOA 1YOVB 3Q2AC 3OLMD 3GB1A 2DX5B 2PIAA 2N7JA 1KLUD 2MBQA 3B2FA 1NI3A 5BYSA 3UF8A 4DXFA 1P3QU 5TSSA 4KVGB 2JZPA 1V49A 4XE0A 3AEBB 2AWTA 1PGBA 3BY4B 4XGAB 1YD8U 3IVFA 2IPKD 4F7ZA 3ZTCA 3P42A 4HROA 1T0QC 2K8HA 2LRWA 4ZOHC 1B1ZA 3AE5B 2J7QB 1QZEA 3QWZB 2DAJA 3P4QB 2IY0B 2KX0A 1IBXA 1SJED 4KDIC 2L83A 2WXIA 1MVKA 2KWVB 3KWLA 2WP9B 2Y5BB 3TCAA 3V6EB 3ZQ4A 5D2MB 3Q6BA 2BS2B 2RR9A 1OTRB 3L4PA 2RD0A 4IWOA 4GMVA 2B3AA 2GRIA 4HDOA 1WGDA 4M02A 4HCPB 1WZ0A 1R4MB 1VRAB 4S0RA 2ZVNA 4MM3A 4M8NA 2LFIA 4OVVA 1KRHA 1T6BX 4TV3A 3Q8AA 1ET9A 4YSYB 4KSLC 4KX6B 1ZOYB 1WM3A 3HM3A 2KTRA 4WJNA 2J0MA 3RULA 2QEJC 2C7NB 3C8YA 3PV1A 1EUVB 2FCMA 2KAJA 5AZFA 5CX3A 5G5GA 3UINB 3IFWB 3RNBC 2INDC 1IGCA 3WANA 4K7UA 2EKIA 4HK2A 2BPSA 2CJNA 3RNGC 5FR6A 2M17A 3FC4A 1D6EC 3J9CA 3NUHB 4L1BA 2M56B 1VLBA 3ZUNA 1I4GA 1R4NB 1YN5A 4GLSC 5L83A 3OWEB 3KWVA 3HUIA 4AP4C 1CK1A 3W1YA 2WDRB 2K25A 4HPMB 3CMMB 3PTFC 3TEZA 3L54A 3LXFA 5BMIA 1SB3C 3QJZA 4EZJA 1A5RA 2AL3A 2CU3A 3TUOA 1ZXIA 2ZNVC 3T9LA 4MH0E 1GC7A 2WU5B 3QX1A 4OVUA 1ZP0B 3MC8A 3TJPA 5E6JA 1WR1A 3AE7B 3GOEA 4LK0M 1PYWD 1FPYA 1QQRA 3W5UB 5I4DA 2NPTB 5AEKB 2BYTA 2O6VD 1E7UA 4DDGD 3AEGB 1UD7A 3B9JA 1FMAD 4C4VB 4P1CC 2WXFA 3MTNB 3IT4B 1SGHA 1UELA 2ICIA 3RUIB 1TKYA 2XK5B 1P0RA 4GXBA 2L1AA 3BINA 3B08A 4LNOA 2N9KA 4TQ0A 2LWPA 1YQ4B 3VVWB 1CMXB 5IP4D 3PRMB 1NEKB 2V4IB 2Z0DB 1V8CA 4N6EB 3PRZA 1SBBB 1WXQA 2WDVB 3UIPB 2FIDA 2WQYB 2JF5A 3HRDD 1J7BA 4D2KA 4E74A 1E6EB 2KJ6A 2CJOA 3U52E 1FFVA 2KFKB 1F9JA 1TS2A 2M0XA 2AL6A 2MWSB 5T8IA 3WAOA 1OQQA 3DDCB 1FXIA 1N5XA 1T0SC 2MP2B 3U7ZA 3ZXVA 4LLGM 1FM0D 3NHEB 1HZ5A 1SIJA 4NJCA 3VUXA 1UZXB 2C60A 3H7PB 1D5XC 4PS8A 3Q8CA 2FAZA 2G3QB 4BKSA 4IWQA 1KOTA 2KTRB 3ZGZA 2CR5A 2LXCA 4KKJA 4K7WA 2CHWA 3GZNI 2YEPB 1ZE3D 1WGHA 4YTNB 2IJ0A 2BYEA 3AB5A 4BOSC 1V9JA 3ABVB 5G5HA 2OHFA 5G55A 3AULA 3MFGA 4FXCA 4DHJD 3ZDMC 3NZUA 1FRRA 5IKCM 1WE7A 3I5JC 4H2AA 2DBYA 3AEDB 2WXQA 1P7FA 2H88B 4L2YA 1WXMA 2AEHA 4ZRJA 3ZTDA 2RDBC 2KLGA 1F52A 3PRPB 2RDGA 4M00A 3M3JA 2N0SB 3D32A 3ZNID 4RGMA 2J0KA 4W9LA 3DBRB 4C7ZA 3QK0A 3A9JA 3RZWC 1J19A 4HJGE 2EELA 4EOYA 1WX9A 2KQSA 2HJ1A 2QJLA 4M0WB 2N9LA 4ZHOA 3V6CB 2M8SA 1JRPA 2NBVB 1CJEA 5DPWA 4W9KA 2GBRA 4N9F4 2PE9A 1AARA 2GBNA 2D3AA 1WE6A 4N59A 4NJ7A 1WRIA 1WGGA 1I35A 3RT3B 1FXAA 2YEPF 1SE4A 3MJ5A 2OOBB 1VDVA 3LYYA 4KGRA 4DXAB 3NOBA 4IUMB 2K6DB 3URYA 2WXPA 1C1YB 1YN4A 5C23A 2PEAA 2CHZA 4EUTA 2UWQA 4NPNA 4IKGA 1KM7A 3VQIA 2O2VA 4JL9A 4FN2A 1AWDA 1LGRA 3ML8A 3AMZA 1YN3A 3SFEB 3MHZA 1UBIA 3JVZX 2GB1A 3N1ZC 3UGBB 3HVDA 1L7YA 1Q1OA 3MP9A 3BK2A 2NBUA 4A90A 2IZVB 2V3NA 3JSVB 4BAXA 1IUEA 5KHOA 4GDLA 1LO5D 1TZ1A 4AS1A 3RNEC 1SXTA 2VZKB 4ZYNA 4FJYA 3DVGX 3MC9A 4NY0A 4ZDVA 3BYYB 4FHKA 2LGDA 3Q8EA 4REZA 3ALBA 4XWTA 3UQBA 3A33B 5EE3A 2W9NA 4BOZB 1EU3A 1WGYA 2GI9A 3P1MA 1S1QB 2LRUA 3K9PB 3V3XA 2HE7A 4C56C 4PT5A 2ZVOA 3DBLI 3NY5A 2A5UA 4OZAA 1EU4A 3FILB 1L6VA 2MW5A 2A4ZA 2GBMA 2WNMA 4JIOU 1WH3A 3Q8BA 2DYMA 4IDIA 4YTMB 1TTNA 2M19A 4FADA 1XEEA 2J42A 2UU7A 5D94A 5JHBA 4HDQA 2REXA 4A20A 1WFYA 3AH7A 4NQKE 4CYEA 5IA7A 4RGTA 4E71A 1N6ZA 4YWGG 1KLGD 4EEWA 4PS7A 4JE3B 4RF0A 5TR5A 1F2RC 4LCDE 2QDFA 2DLBA 5AUIA 1WXAA 1HTOA 3NG0A 3PPAA 3BZDB 2WGSA 3OJ4B 2N4FA 2PTLA 1V2YA 3N9YC 4AOFA 2EMSA 1EF5A 1RFAA 1XLPA 2G1EA 3PO0A 1NBFC 2D5GA 2WHIA 1L4ZB 4ZRKA 1TS3A 4KGTA 3LJ3A 1HQRD 1Q0WB 1UBQA 1V97A 4NAMA 1MG8A 2Y3AA 2PLPA 3N1XC 3JYUA 2JUOA 3T8MA 2MRPA 4GGQA 2XNAC 3L13A 1C76A 3NS8A 3V60A 3T3NA 2KC2A 2JQRB 3ZLZA 3VTVA 3AE4B 2QC8A 2TSSA 2V1YA 2INCC 3VDZA 2WXHA 4IG7B 2W3RA 3GP7A 1Z2MA 5E6PA 1H8CA 4AJYB 1I4XA 4ZRPA 2QIEB 2MBHA 3Q3FA 2BS3B 1E7PB 2ZW1A 1VJKA 3BVZA 2IGGA 1N60A 1QOGA 3ETRA 4I6PA 1QLBB 2JSVX 2GBJA 3NVZA 3JW0X 3EUB2 1FFUA 4RGNA 4K3CA 1WGRA 3N20C 5C2TB 2Q5WD 3Q3NC 2PW9A 4S17A 3H1UA 1KFYB 5BMHA 2BWES 4PYUA 3I57A 2CS4A 4TSSA 4HCNB 4P16A 1QF6A 5D3DA 3PLVA 1ESFA 4DWFA 2O6VB 3A4SC 3NVVA 2XBBC 1XCTL 3ZVVA 1EWCA 1ZXHA 5HG2A 2Z59B 2K3UA 1V5TA 2INPE 2NPTA 3HM6X 1E90A 5AUKA 1UGJA 5HHDG 4WWMA 2LJ5A 4C4VA 3AE1B 1BXTA 3L17A 5DPTA 2XK5A 2VRRB 1DYQA 4HPLB 2KQ7A 2JY6A 2X8XX 4CO7A 2G45B 3GE3C 1V1PB 5D3IB 1WJ6A 4WJPA 2K9XA 2L0TA 3ZNZB 3ZNHB 1L2NA 3RFZB 4OVZA 1P9DU 1ROEA 2MQJA 2BW2A 1M94A 3TEWA 4YSXB 2E6XA 1T3QA 4RFBA 3P4PB 1OEYA 4KSKC 4Q2JA 4ARCA 1S3SG 2AQ3B 2KFKA 1WJUA 2N7EA 3I3TB 2L32A 4IOIE 4US9A 1F2RI 2KT7A 1NYRA 2MP2A 3SR6A 3AE6B 2V3PA 1WRDB 4C00A 3H7PA 4HLEA 1WJ4A 1WR6E 1JWUD 4G11A 1DGJA 2BYVE 1DOYA 3E56A 5LNK1 4DHJB 2QCZA 1YJ1A 3WCQA 2J4XA 2D2QA 3UQAA 4HEA1 4L23A 1GOZA 3EGRA 3R2TA 2BKRB 2I1JA 2KXJA 2GMIC 4HKQA 4HPPA 5DPSA 1FD6A 4DBGA 2DZKA 2K22A 2RMMA 4II3B 1XXGA 1RFKA 3VRBB 1V5OA 4X57B 5DCNA 1TYGB 3AV8A 4R3DA 4A55A 4A6QA 1VZ7A 4G3XB 2KDIA 1HTQA 3Q14C 4W9HA 3DWMA 4MGKE 2JWUA 3DBSA 1B9RA 2WXMA 1QKZA 4KKIA 4LDTD 4ITKA 1SE9A 3I63C 1WGKA 3P4SB 2J52A 4MT5A 3ZW3A 3AE3B 2DZMA 3ZJUA 4HJKA 4W9DA 5CHFA 2HD5B 1C9FA 2N9EB 3O13A 4CQNA 4EKUA 3DHIC 4J6IA 4E3CA 1XLNA 2WLBA 4M0WA 4OW0A 5CTRC 1SJHD 2AYOB 4LNIA 3W9CB 1R4NI 3AXCA 2KMMA 4RH6A 1Y56A 4FULA 1N5WA 4EE2A 4NAWB 4AJWA 2FBWB 3DCGA 2JU6X 3NVWA 2HJ8A 2MBEA 3PT2B 1TBEA 4US8A 3B0AA 5LXIB 2BQQA 4BKGA 2DENB 4ASWC 5FR3A 2LD9A 3VUYA 2HDEA 3EFUA 1SF0A 2IY1B 3CIRB 3VR8B 1WJNA 3V61A 4JPSA 2ZPYA 1D5ZC 1C79A 3EECA 5LXHA 3AM9A 1FNVA 2D10A 1T5XD 1WMHB 1YNTE 5AZHA 2KYWA 2IGHA 2KN4A 3PZ7A 2RGFA 2MSED 4ICVA 4ANUA 3Q3OC 4TQ1A 3VH3B 1EF1A 2ACZB 3JSVA 4PYZA 4W9GA 3W1SA 4B6WA 4RM9A 3ZIMA 2L76A 2K1FA 4XDDA 1GB1A 3PREA 1CQVA 4TKNA 2JVCA 1ZDXA 4ANWA 4DXGA 4IC7B 2KACA 1EM7A 3Q3JA 3VTWA 3GZNB 4ZRQA 4B0EA 2W3SA 1E8WA 2C7MB 4J3OD 3N30A 1PFDA 3NS1A 1UH6A 3AI5A 3QAQA 1Q5WB 4FBJB 4A9AA 2WXLA 3FILA 2MX2A 5J17A 5G2NA 3SU8X 2MH7A 2G4SA 1SSNA 3T3OA 4ZYSA 2ZCBA 4K3BA 1HEZE 1TY2A 1FEHA 1C4AA 4XWWA 1WYWB 3R7RA 3VH4B 1VZ8A 1E10A 1JWSD 4IM3A 1FNUA 2KDBA 2WXRA 4HVBA 1VR9A 3PSEB 3IAM1 2EMTA 2BVCA 3VHTC 3EHVA 4W9EA 2C9WB 3L0WB 4B9KA 2IYDB 2M1MA 1QOBA 1RM6C 1K50A 2L00B 1N62A 3CSTA 2C7HA 3X23A 3NJTA 4LNFA 2PMVA 1RYJA 1F1HA 3TSSA 4JQWC 5JHAA 3BIID 4KGSA 2IGDA 2ZNVB 3U2SC 5HI1A 1L0VB 4JX1C 2L3ZA 2K5PA 2LJIA 1J0GA 2LUEA 4MSMB 2UYZB 2Z8LA 4WWNA 3ZJVA 1ZDVA 4WWPA 4XX5A 1IP9A 3AECB 1C4CA 3ZDTA 1AW7A 1GPXA 1TIFA 4WIPA 3UIOB 2INNE 2OJWA 1OGWA 1E8YA 1ET6A 2KANA 3RZFA 4N58A 2BT6A 1PGXA 2LHDA 3H6NA 4K81A 1MJDA 3X0WA 2FCNA 1XCQL 2KJHB 2MJ3A 4A3PA 2R61A 4ICUA 4RF1A 5E6NA 2KTFA 3SFDB 4PS3A 3WA0A 2KDEB 1PGAA 2I2YA 3R66C 3AEAB 5JZEB 2FE8A 1MPEA 1E9MA 5IO9A 3NRZA 2KK8A 4W9JA 3DPDA 1PDXA 3QIJA 2BYFA 3AE8B 2JXXA 2KJRA 2QILA 2V4LA 5HFYA 4HKZE 3ZO5B 4O1NA 2WXNA 3TEYA 4F1SA 3QA8A 1X1MA 2W82A 2O6VA 2WU2B 1WZ3A 3FKYA 3IHPC 3DBLB 3RPFC 4KIKB 3QHTA 2KD0A 3H9DA 3N32A 2JRIB 4NQLB 3V62A 2L7RA 2LGSA 1JRUA 1U4AA 3EFCA 4K1RB 5J18A 2RDHA 2J0JA 2IDYA 4P1BC 2I38A 2LI5A 3DVNV 2NTTA 1QILA 2MHJA 4XYCA 4EFOA 3L10B 3RNFC 2OEDA 4YSZB 1V1PA 3QC8B 3U7DA 1J8CA 4XC2A 4NJ6A 2DYOA 4CHKA 1P1AA 3IXSA 2W54A 2Y5PA 4A8XC 4GDKB 2MA9B 3ZRFA 3Q3MC 2WS3B 1UWXA 4AQ7A 4II2B 1JW9D 4I6NB 2MJEA 3TL5A 2IBIB 1FIQA 3HHMA 1IPGA 3APFA 4ZHPA 2CU1A 1XD3B 3ZYYX 2L05A 2K8CA 3A4RA 3KUZA 3AN1A 5FKAC 4WQOB 1ZUD2 1ZW7A 4OZBA 3C0RB 4YTPB 2DAFA 2E3TA 4LDTB 3PZDA 2M4NA 3TBLD 1KJTA 2FUHB 2D3GA 2KMAA 3RN9C 1E8XA 1N61A 2JZ3B 1KLVA 1OQRA 2IO2B 3IG3A 1Q10A 4WJQA 2Z0EB 2LXAA 3R8BA 1I42A 1OQYA 1WXSA 5L95C 2MBBB 2JX5A 4OZCA 4QAYA 3PLUA 1RRBA 2IO3B 2WDQB 3DVNU 2DNFA 3BVMA 5MPOA 1F77A 2ON8A 3U30A 5CHVC 3APCA 1E8ZA 2AQ1B 2JWZA 2SAKA 3HK0A 3PGEA 1UUPA 1HXYD 4FJVB 2NMQA 2RPVA 2YLMA 3DBHI 3RI7C 1KH0A 4IW0A 2D07B 3RYTA 1ZPSA 2DZIA 4JGHB 2NCNA 4NAWA 5D6JB 2BWFA 1OFFA 4MGZE 4OHJA 2NR2A 4IM2A 3SEBA 5FK9C 2KWUB 2ZEQA 4AUQC 4GN1A 4BKSD 3DHGC 4WURA 2HTME 4NNJB 4W9FA 1WM2A 1JCKB 1C77A 1WIAA 4P7IA 2IO1B 1UF0A 2W55A 1XF5L 1ZKHA 2DYBA 3KUDB 4KDLB 1STEA 1DOIA 1WY8A 1YQBA 4M01A 1P7EA 2VH2A 1WMHA 2AX5A 1V81A 1PUTA 4W9CA 4B0MA 5AZGA 1A70A 3PHXB 5BYRA 1UNSA 1NYQA 5IOIA 4EZKA 1IGDA 2FUG1 4JWUC 4WH4A 1JWMD 5J2RA 2DZJA 4WAFA 1DOXA 5JH5C 1VCBA 1L0YB 2LUMA 1I4HA 1T0YA 2KHWB 2NS5A 3SHQA 1L6UA 1D4BA 1J7AA 3ZKJC 1R4MI 1UGMA 2OJRA 3RCZA 4K7SA 2LGIA 3H8HA 4BBNC 2R2OA 1NENB 1NVID 3A9KB 3B1LX 2PVOD 5C1ZA 3AEEB 3OG5A 3Q8FA 1EO6A 3TMPB 4G50A 4DK5A 3H7SA 3NVYA 2FIFA 3OJ3A 1QOAA 2MJDA 4KZ0A 3LB8C 3UI3A 2K39A 2WX1A 3GS2A 3U8ZA 2HTHA 3BWUD 1D5MC 1I7HA 1TS5A 4MJSB 3RD2A 1JROA 3VFKA 3IT6B 4AWJA 3DHHC 1G6JA 4ACFA 2R2QA 3WAMA 4BFRA 1I4QA 1WSPA 5GXGB 4LNNA 2LASA 2ZZPB 2VH1A 2WDTB 3KH0A 2BS4B 3APDA 3DVGY 5JXVA 3WALA 3A1QB 3P4RB 3P2BA 4ZRIA 4MH8A 2ZCCA 3GE8C 4LJPB 2K6QA 3MHSD 1GB4A 4FHJA 4BZAA 1K53A 1L4DB 4MELA 2RPQA 2QSDA 3E9SA 1WXVA 3QQ8B 1FO4A 2MBOA 1WX7A 3VR9B 3HIZA 3CWIA 2KMCA 4IWPA 3TIXA 2KX3A 4USAA 2ZW0A 2N9XA 3VUWA 1V80A 5IAAC 1GNUA 2PE6B 4MSQB 3AE2B 2JPHA 4EZLA 1FRDA 4I6LB 1TS4A 3R2IA 4ANXA
chains in the Genus database with same CATH topology
1C4CA 2D5GA 3ZQ4A 1AW7A 1L4ZB 2BS2B 1TS3A 1GPXA 4KGTA 4RNAA 3L4PA 1HQRD 4WIPA 1IBXB 1V97A 4NAMA 2INNE 1TKGA 2Y3AA 1AN8A 2GRIA 2PLPA 2H89B 1ET6A 1L5PA 4N58A 1VRAB 2BT6A 1PGXA 2WXKA 2XNAC 2LHDA 1C76A 2BTEA 2LFIA 3T3NA 1HZ6A 2V0GA 1KRHA 1XCQL 2JQRB 1T6BX 2MJ3A 1ET9A 2R61A 3Q8AA 4KX6B 1ZOYB 4YSYB 3AE4B 4RF1A 3SFDB 1UWMA 2TSSA 1FCLA 1PGAA 2I2YA 3BK1A 4MM3B 2WXHA 3AEAB 2W3RA 2FE8A 1MPEA 2QEJC 1E9MA 3GP7A 3NRZA 4P6VF 1I4XA 4ZRPA 3C8YA 2QIEB 1PDXA 2LMCA 3B2GA 2KAJA 2BS3B 1E7PB 1K52A 2ZW1A 1VJKA 2BBCA 3BVZA 2IGGA 3AE8B 1N60A 2WXGA 5G5GA 1QOGA 3ETRA 1QLBB 2QILA 5HFYA 5C3JB 1IGCA 2JSVX 4HKZE 3FAHA 4O1NA 2WXNA 3NVZA 3TEYA 2EKIA 3EUB2 1FFUA 2KDMA 4RGNA 2CJNA 2W82A 2WU2B 3FC4A 4YXDB 1D6EC 5C2TB 2Q5WD 1V1OA 3ZJTA 2PW9A 3J9CA 3RPFC 3PZ8A 3NUHB 4L1BA 1KFYB 2M56B 5BMHA 1VLBA 4C80A 3I57A 4TSSA 4P16A 1QF6A 1I4GA 3I9V1 5D3DA 1ESFA 1YN5A 2JYEA 4GLSC 2RDHA 3OWEB 2IDYA 1SE2A 3KWVA 1TZOA 3HUIA 3NVVA 5H8YE 1XCTL 1CK1A 2WDRB 1EWCA 2I38A 3VRAB 1ZXHA 3TEZA 2NTTA 1E0ZA 1QILA 3LXFA 5BMIA 1SB3C 1I4PA 3W2DA 5HG2A 2BB5A 2K3UA 3EA6A 2CU3A 2INPE 3TUOA 2ONQA 1ZXIA 2OEDA 4YSZB 2WU5B 5AUKA 1UGJA 1V1PA 4WWMA 5HHDG 1ZP0B 3AE1B 5E6JA 2MEKA 3AE7B 4LK0M 2DYOA 1BXTA 2WXOA 2JYTA 1PYWD 3KQ4A 2BB6A 2DWQA 1QQRA 3W5UB 1DYQA 2AQ2B 3IXSA 5EE9A 5I4DA 2W54A 2Y5PA 2BYTA 1V1PB 4A8XC 3AEGB 4GDKB 5D3IB 3B9JA 1FMAD 2K9XA 2WXFA 2WS3B 3NZ3A 3RFZB 1UWXA 3IT4B 2ICIA 4OVZA 1ROEA 4AQ7A 1TKYA 4RGOS 2BW2A 1GAQB 2L1AA 4YSXB 3TEWA 1JW9D 2E6XA 1T3QA 2N9KA 4RFBA 4TQ0A 3P4PB 2MJEA 4TMAB 1XO3A 2KWDA 1FIQA 1YQ4B 4Q2JA 4ARCA 2AQ3B 1KF6B 1HA5A 4ZHPA 2L32A 4IOIE 4US9A 1F2RI 1NEKB 3ZYYX 1RWSA 1NYRA 2V4IB 3U4EG 1V8CA 4N6EB 1SBBB 1WXQA 1TJEA 2WDVB 3AN1A 1TKEA 5FKAC 1ZUD2 2WQYB 3SR6A 3AE6B 3AEFB 1C78A 2L52A 1JWBD 1JQ4A 2V3PA 3HRDD 4OZBA 1J7BA 4D2KA 4NZLB 1E6EB 2CJOA 4YTPB 3U52E 1FFVA 2E3TA 1TS2A 1JWUD 1XLQA 1DGJA 5T8IA 1DOYA 3E56A 5LNK1 1OQQA 1FXIA 3BYTB 1N5XA 3WCQA 2J4XA 3U7ZA 4HEA1 4L23A 4LLGM 3V05A 1FM0D 4UDUC 1HZ5A 1SIJA 4NJCA 1GOZA 3EGRA 3R2TA 3IAS1 1N61A 2Y5CA 1SEBD 2PVGC 4HRSA 5BMGA 4HKQA 1FD6A 1ENFA 1D5XC 1XLOA 1WYGA 1OQRA 2K22A 2RMMA 3Q8CA 1SE3A 1Q10A 1XXGA 1RFKA 3W5VB 3VRBB 1F0ZA 3R8BA 3ZGZA 2QMTA 1TYGB 3AV8A 1JALA 4R3DA 4A55A 4A6QA 4KKJA 1VZ7A 2JX5A 4OZCA 1J7CA 2YEPB 3MC0B 1ZE3D 2WDQB 4YTNB 2IJ0A 3DWMA 2JWUA 1TY0A 3AB5A 3ABVB 1B9RA 1MHHE 2WXMA 2OHFA 1QKZA 3BVMA 3P63A 5G5HA 4KKIA 1F77A 2ON8A 5MPOA 1YQ3B 3MFGA 4FXCA 4ITKA 1FRRA 2AQ1B 2SAKA 1UUPA 1WGKA 1HXYD 3HVZA 4H2AA 1L0XB 1YMHE 2DBYA 3AEDB 2J52A 2WXQA 3P4SB 4MT5A 3AE3B 2NMQA 2RPVA 1P7FA 1KH0A 2H88B 4L2YA 3ZJUA 1C9FA 1ZPSA 2B76B 3KLSX 3O13A 3DWGC 4CQNA 1K51A 2JXTA 2RDGA 1OFFA 4OHJA 4JWSC 1XLNA 2N0SB 2WLBA 4M0WA 4OW0A 5FK9C 3SEBA 1EWYC 1FCCC 1SJHD 4RGMA 3W9CB 4WURA 2KMMA 4RH6A 2HTME 4C7ZA 1Y56A 1VZ6A 1YJIA 1N5WA 4EE2A 1JCKB 4NAWB 1C77A 4HJGE 2EELA 2FBWB 2X38A 4XDCA 1MI0A 2JU6X 3NVWA 2W55A 2QJLA 2N9LA 4ZHOA 1XF5L 1JRPA 1STEA 1M4VA 4US8A 1CJEA 1DOIA 4MACA 5FR3A 3BVGA 1P7EA 2HDEA 2AX5A 1SF0A 4N59A 2G9HD 2K0PA 1WRIA 1PUTA 2KQ4X 3CIRB 1MHXA 1R7SA 4B0MA 3VR8B 1FXAA 2NTSA 2YEPF 1A70A 1SE4A 3MJ5A 4JPSA 4ARIA 1D5ZC 1C79A 2WXJA 1UNSA 1VDVA 3LYYA 4KGRA 5BYRA 1NYQA 3AM9A 1FNVA 3URYA 1T5XD 1C4PA 1YNTE 2WXPA 2SEBD 1YN4A 1IGDA 2FUG1 2IGHA 2KN4A 3PZ7A 4RCOA 1KTKA 4JWUC 1I4RA 4WQMA 4TQ1A 4WH4A 1JWMD 4WAFA 4IKGA 1DOXA 1CZPA 2LHEA 4LTUA 1L0YB 2LUMA 1I4HA 2M0AA 2ACZB 3VQIA 4C7YA 1AWDA 1L6UA 3AMZA 1YN3A 1N63A 3SFEB 1J7AA 1D4BA 3MHZA 3W1SA 2GB1A 3HVDA 4XDDA 2LGIA 1GB1A 1CQVA 3H8HA 3MP9A 5BYQA 5EE0A 1ACCA 1WWTA 1ZDXA 3BK2A 5H92C 3Q69A 4A90A 1NENB 1NVID 4DXGA 2V3NA 2KACA 1EM7A 2PVOD 3AEEB 3Q8FA 4ZRQA 4B0EA 1IUEA 1LO5D 2W3SA 1QOFA 4AS1A 3NVYA 2LEKA 1SXTA 4J3OD 2VZKB 1QOAA 2MJDA 1PFDA 3LB8C 3NS1A 3UI3A 3GS2A 3BWUD 1D5MC 2XN9C 1I7HA 4A9AA 1TS5A 3BYYB 1JROA 3Q8EA 4REZA 4YT0B 5D7GA 4GDLB 4XWTA 3IT6B 2WXLA 3FILA 5EE1A 3TEXA 3AE9B 1BUIC 2MH7A 1SSNA 1JMLA 3T3OA 5EE3A 1AYFA 1I4QA 1EU3A 4ZYSA 1WSPA 5GXGB 2GI9A 1HEZE 1TY2A 1FEHA 2J53A 1C4AA 3P1MA 4XWWA 3V3XA 4C56C 4PT5A 2BS4B 1VZ8A 1E10A 1BMLC 4OZAA 1JWSD 1EU4A 3FILB 4DQOC 1L6VA 5JXVA 1FNUA 1YJJA 2WXRA 1JWAD 2WNMA 3P4RB 1QT9A 1VR9A 1FNWA 3IAM1 2VZKD 3Q8BA 2DYMA 4MH8A 2PKOA 4IDIA 4YTMB 3GB1A 2M19A 1XEEA 2PIAA 1GB4A 2J42A 2N7JA 1KLUD 3B2FA 1NI3A 5BYSA 4DXFA 1QOBA 1RM6C 1K50A 5TSSA 1K53A 1L4DB 3AH7A 2QSDA 1N62A 3E9SA 1FO4A 2JZPA 3VR9B 4XE0A 3AEBB 3CWIA 4RGTA 2PMVA 1PGBA 1RYJA 4YWGG 1KLGD 3TSSA 2IPKD 3P42A 4HROA 4JE3B 4RF0A 4USAA 3BIID 2ZW0A 4ZOHC 4KGSA 2IGDA 1F2RC 3U2SC 5HI1A 1B1ZA 2DLBA 1L0VB 3AE5B 4JX1C 5AUIA 2K5PA 3BZDB 3P4QB 2LJIA 1IBXA 1SJED 2PTLA 3AE2B 3N9YC 2L83A 2WXIA 1MVKA 1FRDA 2Z8LA 2G1EA 1XLPA 3ZJVA 1TS4A 3KWLA 1ZDVA 3PO0A 2WP9B 3R2IA 3AECB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HVZ A;  1WWT A;  2DBY A;  3AED B;  3P4S B;  5H92 C;  2WU5 B;  5AUK A;  2BS2 B;  4YSZ B;  3AE3 B;  1NEN B;  1NVI D;  4WWM A;  1GPX A;  1ZP0 B;  3L4P A;  2H88 B;  2PVO D;  3AE1 B;  3AE7 B;  3AEE B;  1V97 A;  1TKG A;  1IUE A;  2H89 B;  2B76 B;  2W3S A;  2DWQ A;  1QOF A;  3W5U B;  1L5P A;  3NVY A;  2LEK A;  3DWG C;  5EE9 A;  1QOA A;  2W54 A;  1OFF A;  4N58 A;  2MJD A;  2BT6 A;  1PFD A;  3LB8 C;  4JWS C;  3NS1 A;  1XLN A;  3AEG B;  2N0S B;  3B9J A;  1FMA D;  2K9X A;  2WLB A;  1I7H A;  1EWY C;  4A9A A;  2WS3 B;  1KRH A;  1JRO A;  3W9C B;  4YT0 B;  2JQR B;  1ROE A;  1TKY A;  5EE1 A;  2MJ3 A;  2KMM A;  4YSY B;  4KX6 B;  1GAQ B;  1ZOY B;  2HTM E;  3AE9 B;  4C7Z A;  4YSX B;  1YJI A;  2MH7 A;  1JW9 D;  1N5W A;  3AE4 B;  3SFD B;  1T3Q A;  1UWM A;  3P4P B;  5EE3 A;  2MJE A;  1AYF A;  1XO3 A;  2FBW B;  1FIQ A;  1YQ4 B;  5GXG B;  3AEA B;  2W3R A;  3NVW A;  1KF6 B;  4ZHP A;  1E9M A;  3P1M A;  2W55 A;  2QJL A;  4US9 A;  3ZYY X;  3NRZ A;  1NEK B;  4ZHO A;  1RWS A;  1NYR A;  4P6V F;  1V8C A;  2BS4 B;  4N6E B;  1JRP A;  2QIE B;  1E10 A;  1PDX A;  1WXQ A;  4US8 A;  1TJE A;  2WDV B;  3B2G A;  1L6V A;  1CJE A;  2KAJ A;  1DOI A;  1TKE A;  2BS3 B;  1E7P B;  3AN1 A;  1YJJ A;  1ZUD 2;  2WQY B;  1JWA D;  3P4R B;  1VJK A;  3AE6 B;  3SR6 A;  3AE8 B;  2L52 A;  1N60 A;  1JWB D;  1QT9 A;  3AEF B;  5G5G A;  3HRD D;  1QOG A;  1JQ4 A;  1J7B A;  1E6E B;  3ETR A;  2CJO A;  4YTP B;  1FFV A;  1QLB B;  1SF0 A;  2AX5 A;  4N59 A;  5C3J B;  2E3T A;  2PKO A;  1XLQ A;  3FAH A;  1DGJ A;  4IDI A;  1WRI A;  1PUT A;  3CIR B;  4YTM B;  1DOY A;  3NVZ A;  1OQQ A;  1R7S A;  1FXI A;  2EKI A;  1N5X A;  2M19 A;  3WCQ A;  2PIA A;  3EUB 2;  1FFU A;  3VR8 B;  3B2F A;  1E0Z A;  1FM0 D;  1FXA A;  1NI3 A;  2CJN A;  1SIJ A;  1A70 A;  2WU2 B;  1QOB A;  3FC4 A;  4YXD B;  1RM6 C;  1N61 A;  2Y5C A;  1VDV A;  2PVG C;  3AH7 A;  4HRS A;  2Q5W D;  1N62 A;  1NYQ A;  5C2T B;  1FO4 A;  3AM9 A;  3RPF C;  1XLO A;  1WYG A;  1OQR A;  2K22 A;  3VR9 B;  1KFY B;  2M56 B;  3AEB B;  1VLB A;  4C80 A;  1RFK A;  3CWI A;  3W5V B;  1RYJ A;  4JWU C;  3VRB B;  1F0Z A;  1QF6 A;  1TYG B;  3AV8 A;  4WQM A;  1JAL A;  4HRO A;  4USA A;  3BII D;  4ZOH C;  1CZP A;  2JX5 A;  1DOX A;  4LTU A;  1J7C A;  3HUI A;  3NVV A;  1L0V B;  3AE5 B;  4JX1 C;  5AUI A;  2K5P A;  5H8Y E;  2WDR B;  2ACZ B;  2WDQ B;  4YTN B;  3P4Q B;  3VRA B;  3DWM A;  4C7Y A;  3AB5 A;  1AWD A;  1L6U A;  3ABV B;  3AMZ A;  1B9R A;  1N63 A;  3LXF A;  1J7A A;  2OHF A;  3P63 A;  5G5H A;  1SB3 C;  3AE2 B;  3SFE B;  5MPO A;  1YQ3 B;  4FXC A;  4ITK A;  2L83 A;  1FRR A;  1FRD A;  2G1E A;  1XLP A;  2CU3 A;  3KWL A;  1WGK A;  2WP9 B;  3PO0 A;  3AEC B;  1ZXI A;  5EE0 A; 
#chains in the Genus database with same CATH topology
 3ECI A;  1D3Z A;  2GBK A;  3WIM A;  2K8B A;  4RNA A;  3C19 A;  3IBE A;  1IBX B;  4FLH A;  3L16 A;  2JRH A;  4MEM A;  1TKG A;  1AN8 A;  2H89 B;  3PHW B;  3ENE A;  1L5P A;  1V6E A;  3S2A A;  2FNJ B;  2CHX A;  2WXK A;  2NBW B;  2BTE A;  2C5L C;  3SDL C;  1GC6 A;  1YX6 B;  4W9I A;  1HZ6 A;  2V0G A;  3W1S C;  2WWZ A;  1UWM A;  4JLC A;  1MFW A;  2NVU I;  1FCL A;  2LGX A;  3BK1 A;  3CF6 E;  4MM3 B;  2WYQ A;  2N1W A;  4P6V F;  2JT4 B;  2LMC A;  3B2G A;  2LVO A;  3NZS A;  1K52 A;  2BBC A;  3SD5 A;  2WXG A;  2I1K A;  2KVR A;  2G4D B;  1E5W A;  4KIK A;  3N1Y C;  5C3J B;  3FAH A;  5EDS A;  4M8M A;  2KDM A;  5GMV A;  2N9P C;  1Y8R C;  4YXD B;  1V1O A;  3ZJT A;  3PZ8 A;  1TT5 B;  5E6O A;  2LVQ A;  1C3T A;  2MCN B;  4C80 A;  2KZR A;  3N3K B;  2GLS A;  3I9V 1;  1BT0 A;  3KYC D;  2D11 A;  2JYE A;  4F8C B;  1SE2 A;  1GJZ A;  1TZO A;  5H8Y E;  3VRA B;  1E0Z A;  3DQV A;  1I4P A;  4DHZ E;  3W2D A;  1XQQ A;  2BB5 A;  1E7V A;  3KVF B;  4KZC A;  3EA6 A;  2ONQ A;  3ZRC A;  1XT9 B;  2KKC A;  4GSW A;  2KWC A;  4PK1 A;  3DBR I;  3ZXR A;  4GDK A;  4B95 A;  1V86 A;  2KFJ A;  1Z5S B;  2MEK A;  2WXO A;  2JYT A;  3VAW A;  2LZ6 A;  2BB6 A;  2DWQ A;  3KQ4 A;  4A3O A;  2AQ2 B;  5EE9 A;  3O65 B;  3RNC C;  3ZNG C;  2BKF A;  2BF8 B;  4MGI E;  3VXW A;  3PVL A;  3NZ3 A;  4RGO S;  1OEY J;  1GAQ B;  4BBN F;  4DHZ B;  3AU5 A;  4TMA B;  1XO3 A;  2KWD A;  3EC8 A;  4URK A;  2KO3 A;  3AU4 A;  1KF6 B;  1HA5 A;  1ZGU B;  4IM0 A;  3QAR A;  1WX8 A;  1RWS A;  3U4E G;  2N7D A;  4BKT A;  1TJE A;  1TKE A;  2D3B A;  3AEF B;  1C78 A;  2L52 A;  1JWB D;  1JQ4 A;  1PQS A;  4NZL B;  4GB9 A;  1XLQ A;  2KVZ A;  3R7Q A;  3BYT B;  3V05 A;  4UDU C;  2V9H A;  3IAS 1;  2ZJD A;  2KN5 A;  2Y5C A;  4WWO A;  1SEB D;  2PVG C;  4FJZ A;  4HRS A;  5BMG A;  5HKH A;  1ENF A;  1XLO A;  1WYG A;  1SE3 A;  4G0N B;  2PPH A;  2ZPN A;  3W5V B;  2EKE C;  1F0Z A;  2QMT A;  1YX5 B;  2LGY A;  3L08 A;  1JAL A;  1J7C A;  4FA6 A;  3MC0 B;  3K9O B;  1TY0 A;  3MJW A;  1MHH E;  3P63 A;  3M62 B;  1YQ3 B;  4GIV A;  2PJH A;  3R3M A;  4LNK A;  3HVZ A;  1L0X B;  1YMH E;  1NDD A;  2ASQ A;  3M95 A;  1FXT B;  5BO4 B;  3M63 B;  2B76 B;  2KDF B;  1YIW A;  3KLS X;  5LLI A;  4XZ4 A;  2KNB A;  3DWG C;  1K51 A;  2JXT A;  2DHZ A;  4TUU A;  4JWS C;  1GUA B;  4RM8 A;  2IO0 B;  1EWY C;  1FCC C;  2XEW A;  4HWI B;  1VZ6 A;  1YJI A;  1WF9 A;  3ONS A;  4MDK E;  2X38 A;  4XDC A;  2BGF A;  1MI0 A;  1TGZ B;  2JZZ A;  4MGY E;  2FCS A;  1RLF A;  2N1V A;  4WAA A;  1M4V A;  3ML9 A;  4RMA A;  5CHW A;  4GOC A;  2LVP A;  4MAC A;  3A9J B;  1LQB A;  2KOX A;  1SIF A;  2KLC A;  3BVG A;  2CKH B;  1ISN A;  2G9H D;  2K0P A;  2KQ4 X;  1MHX A;  1R7S A;  2YVC A;  2NTS A;  4ARI A;  1WI0 A;  2WXJ A;  3WAP A;  4BVU C;  1P98 A;  1LM8 B;  1C4P A;  2SEB D;  2KC1 A;  4RCO A;  1KTK A;  1HE8 A;  1MG4 A;  1I4R A;  4WQM A;  4LJO B;  3RMK C;  3KUC B;  3RNA C;  1LFD A;  1CZP A;  2LHE A;  4LTU A;  1T0R C;  1LXD A;  2M0A A;  3A9K A;  4HXD A;  3LDZ E;  4C7Y A;  2L0F A;  3VTU A;  1N63 A;  3DOW A;  1H4R A;  5BYQ A;  5EE0 A;  1ACC A;  1WWT A;  5KHQ A;  4ANV A;  5H92 C;  2GOW A;  3Q69 A;  2D3C A;  2O2V B;  2FCQ A;  1K8R B;  4MJS A;  5IN7 A;  1QOF A;  2LEK A;  4WJO A;  2V3S A;  1GG3 A;  1RAX A;  2WX0 A;  3PS6 A;  4DDI D;  1VD2 A;  2XN9 C;  1NI2 A;  4YT0 B;  4GU2 A;  4GDL B;  2L8J A;  5D7G A;  5EE1 A;  3TEX A;  3AE9 B;  3DBH B;  1BUI C;  2QHO A;  3A1Q A;  1IYF A;  1JML A;  3KW5 B;  1AYF A;  3KYD D;  3OAW A;  2J53 A;  5DPR A;  2MLB A;  1BML C;  2RSU A;  4DQO C;  3CSF A;  1YJJ A;  1JWA D;  4KV2 A;  1QT9 A;  1FNW A;  2VZK D;  4YL8 A;  3QCA A;  2PKO A;  1YOV B;  3Q2A C;  3OLM D;  3GB1 A;  2DX5 B;  2PIA A;  2N7J A;  1KLU D;  2MBQ A;  3B2F A;  1NI3 A;  5BYS A;  3UF8 A;  4DXF A;  1P3Q U;  5TSS A;  4KVG B;  2JZP A;  1V49 A;  4XE0 A;  3AEB B;  2AWT A;  1PGB A;  3BY4 B;  4XGA B;  1YD8 U;  3IVF A;  2IPK D;  4F7Z A;  3ZTC A;  3P42 A;  4HRO A;  1T0Q C;  2K8H A;  2LRW A;  4ZOH C;  1B1Z A;  3AE5 B;  2J7Q B;  1QZE A;  3QWZ B;  2DAJ A;  3P4Q B;  2IY0 B;  2KX0 A;  1IBX A;  1SJE D;  4KDI C;  2L83 A;  2WXI A;  1MVK A;  2KWV B;  3KWL A;  2WP9 B;  2Y5B B;  3TCA A;  3V6E B;  3ZQ4 A;  5D2M B;  3Q6B A;  2BS2 B;  2RR9 A;  1OTR B;  3L4P A;  2RD0 A;  4IWO A;  4GMV A;  2B3A A;  2GRI A;  4HDO A;  1WGD A;  4M02 A;  4HCP B;  1WZ0 A;  1R4M B;  1VRA B;  4S0R A;  2ZVN A;  4MM3 A;  4M8N A;  2LFI A;  4OVV A;  1KRH A;  1T6B X;  4TV3 A;  3Q8A A;  1ET9 A;  4YSY B;  4KSL C;  4KX6 B;  1ZOY B;  1WM3 A;  3HM3 A;  2KTR A;  4WJN A;  2J0M A;  3RUL A;  2QEJ C;  2C7N B;  3C8Y A;  3PV1 A;  1EUV B;  2FCM A;  2KAJ A;  5AZF A;  5CX3 A;  5G5G A;  3UIN B;  3IFW B;  3RNB C;  2IND C;  1IGC A;  3WAN A;  4K7U A;  2EKI A;  4HK2 A;  2BPS A;  2CJN A;  3RNG C;  5FR6 A;  2M17 A;  3FC4 A;  1D6E C;  3J9C A;  3NUH B;  4L1B A;  2M56 B;  1VLB A;  3ZUN A;  1I4G A;  1R4N B;  1YN5 A;  4GLS C;  5L83 A;  3OWE B;  3KWV A;  3HUI A;  4AP4 C;  1CK1 A;  3W1Y A;  2WDR B;  2K25 A;  4HPM B;  3CMM B;  3PTF C;  3TEZ A;  3L54 A;  3LXF A;  5BMI A;  1SB3 C;  3QJZ A;  4EZJ A;  1A5R A;  2AL3 A;  2CU3 A;  3TUO A;  1ZXI A;  2ZNV C;  3T9L A;  4MH0 E;  1GC7 A;  2WU5 B;  3QX1 A;  4OVU A;  1ZP0 B;  3MC8 A;  3TJP A;  5E6J A;  1WR1 A;  3AE7 B;  3GOE A;  4LK0 M;  1PYW D;  1FPY A;  1QQR A;  3W5U B;  5I4D A;  2NPT B;  5AEK B;  2BYT A;  2O6V D;  1E7U A;  4DDG D;  3AEG B;  1UD7 A;  3B9J A;  1FMA D;  4C4V B;  4P1C C;  2WXF A;  3MTN B;  3IT4 B;  1SGH A;  1UEL A;  2ICI A;  3RUI B;  1TKY A;  2XK5 B;  1P0R A;  4GXB A;  2L1A A;  3BIN A;  3B08 A;  4LNO A;  2N9K A;  4TQ0 A;  2LWP A;  1YQ4 B;  3VVW B;  1CMX B;  5IP4 D;  3PRM B;  1NEK B;  2V4I B;  2Z0D B;  1V8C A;  4N6E B;  3PRZ A;  1SBB B;  1WXQ A;  2WDV B;  3UIP B;  2FID A;  2WQY B;  2JF5 A;  3HRD D;  1J7B A;  4D2K A;  4E74 A;  1E6E B;  2KJ6 A;  2CJO A;  3U52 E;  1FFV A;  2KFK B;  1F9J A;  1TS2 A;  2M0X A;  2AL6 A;  2MWS B;  5T8I A;  3WAO A;  1OQQ A;  3DDC B;  1FXI A;  1N5X A;  1T0S C;  2MP2 B;  3U7Z A;  3ZXV A;  4LLG M;  1FM0 D;  3NHE B;  1HZ5 A;  1SIJ A;  4NJC A;  3VUX A;  1UZX B;  2C60 A;  3H7P B;  1D5X C;  4PS8 A;  3Q8C A;  2FAZ A;  2G3Q B;  4BKS A;  4IWQ A;  1KOT A;  2KTR B;  3ZGZ A;  2CR5 A;  2LXC A;  4KKJ A;  4K7W A;  2CHW A;  3GZN I;  2YEP B;  1ZE3 D;  1WGH A;  4YTN B;  2IJ0 A;  2BYE A;  3AB5 A;  4BOS C;  1V9J A;  3ABV B;  5G5H A;  2OHF A;  5G55 A;  3AUL A;  3MFG A;  4FXC A;  4DHJ D;  3ZDM C;  3NZU A;  1FRR A;  5IKC M;  1WE7 A;  3I5J C;  4H2A A;  2DBY A;  3AED B;  2WXQ A;  1P7F A;  2H88 B;  4L2Y A;  1WXM A;  2AEH A;  4ZRJ A;  3ZTD A;  2RDB C;  2KLG A;  1F52 A;  3PRP B;  2RDG A;  4M00 A;  3M3J A;  2N0S B;  3D32 A;  3ZNI D;  4RGM A;  2J0K A;  4W9L A;  3DBR B;  4C7Z A;  3QK0 A;  3A9J A;  3RZW C;  1J19 A;  4HJG E;  2EEL A;  4EOY A;  1WX9 A;  2KQS A;  2HJ1 A;  2QJL A;  4M0W B;  2N9L A;  4ZHO A;  3V6C B;  2M8S A;  1JRP A;  2NBV B;  1CJE A;  5DPW A;  4W9K A;  2GBR A;  4N9F 4;  2PE9 A;  1AAR A;  2GBN A;  2D3A A;  1WE6 A;  4N59 A;  4NJ7 A;  1WRI A;  1WGG A;  1I35 A;  3RT3 B;  1FXA A;  2YEP F;  1SE4 A;  3MJ5 A;  2OOB B;  1VDV A;  3LYY A;  4KGR A;  4DXA B;  3NOB A;  4IUM B;  2K6D B;  3URY A;  2WXP A;  1C1Y B;  1YN4 A;  5C23 A;  2PEA A;  2CHZ A;  4EUT A;  2UWQ A;  4NPN A;  4IKG A;  1KM7 A;  3VQI A;  2O2V A;  4JL9 A;  4FN2 A;  1AWD A;  1LGR A;  3ML8 A;  3AMZ A;  1YN3 A;  3SFE B;  3MHZ A;  1UBI A;  3JVZ X;  2GB1 A;  3N1Z C;  3UGB B;  3HVD A;  1L7Y A;  1Q1O A;  3MP9 A;  3BK2 A;  2NBU A;  4A90 A;  2IZV B;  2V3N A;  3JSV B;  4BAX A;  1IUE A;  5KHO A;  4GDL A;  1LO5 D;  1TZ1 A;  4AS1 A;  3RNE C;  1SXT A;  2VZK B;  4ZYN A;  4FJY A;  3DVG X;  3MC9 A;  4NY0 A;  4ZDV A;  3BYY B;  4FHK A;  2LGD A;  3Q8E A;  4REZ A;  3ALB A;  4XWT A;  3UQB A;  3A33 B;  5EE3 A;  2W9N A;  4BOZ B;  1EU3 A;  1WGY A;  2GI9 A;  3P1M A;  1S1Q B;  2LRU A;  3K9P B;  3V3X A;  2HE7 A;  4C56 C;  4PT5 A;  2ZVO A;  3DBL I;  3NY5 A;  2A5U A;  4OZA A;  1EU4 A;  3FIL B;  1L6V A;  2MW5 A;  2A4Z A;  2GBM A;  2WNM A;  4JIO U;  1WH3 A;  3Q8B A;  2DYM A;  4IDI A;  4YTM B;  1TTN A;  2M19 A;  4FAD A;  1XEE A;  2J42 A;  2UU7 A;  5D94 A;  5JHB A;  4HDQ A;  2REX A;  4A20 A;  1WFY A;  3AH7 A;  4NQK E;  4CYE A;  5IA7 A;  4RGT A;  4E71 A;  1N6Z A;  4YWG G;  1KLG D;  4EEW A;  4PS7 A;  4JE3 B;  4RF0 A;  5TR5 A;  1F2R C;  4LCD E;  2QDF A;  2DLB A;  5AUI A;  1WXA A;  1HTO A;  3NG0 A;  3PPA A;  3BZD B;  2WGS A;  3OJ4 B;  2N4F A;  2PTL A;  1V2Y A;  3N9Y C;  4AOF A;  2EMS A;  1EF5 A;  1RFA A;  1XLP A;  2G1E A;  3PO0 A;  1NBF C;  2D5G A;  2WHI A;  1L4Z B;  4ZRK A;  1TS3 A;  4KGT A;  3LJ3 A;  1HQR D;  1Q0W B;  1UBQ A;  1V97 A;  4NAM A;  1MG8 A;  2Y3A A;  2PLP A;  3N1X C;  3JYU A;  2JUO A;  3T8M A;  2MRP A;  4GGQ A;  2XNA C;  3L13 A;  1C76 A;  3NS8 A;  3V60 A;  3T3N A;  2KC2 A;  2JQR B;  3ZLZ A;  3VTV A;  3AE4 B;  2QC8 A;  2TSS A;  2V1Y A;  2INC C;  3VDZ A;  2WXH A;  4IG7 B;  2W3R A;  3GP7 A;  1Z2M A;  5E6P A;  1H8C A;  4AJY B;  1I4X A;  4ZRP A;  2QIE B;  2MBH A;  3Q3F A;  2BS3 B;  1E7P B;  2ZW1 A;  1VJK A;  3BVZ A;  2IGG A;  1N60 A;  1QOG A;  3ETR A;  4I6P A;  1QLB B;  2JSV X;  2GBJ A;  3NVZ A;  3JW0 X;  3EUB 2;  1FFU A;  4RGN A;  4K3C A;  1WGR A;  3N20 C;  5C2T B;  2Q5W D;  3Q3N C;  2PW9 A;  4S17 A;  3H1U A;  1KFY B;  5BMH A;  2BWE S;  4PYU A;  3I57 A;  2CS4 A;  4TSS A;  4HCN B;  4P16 A;  1QF6 A;  5D3D A;  3PLV A;  1ESF A;  4DWF A;  2O6V B;  3A4S C;  3NVV A;  2XBB C;  1XCT L;  3ZVV A;  1EWC A;  1ZXH A;  5HG2 A;  2Z59 B;  2K3U A;  1V5T A;  2INP E;  2NPT A;  3HM6 X;  1E90 A;  5AUK A;  1UGJ A;  5HHD G;  4WWM A;  2LJ5 A;  4C4V A;  3AE1 B;  1BXT A;  3L17 A;  5DPT A;  2XK5 A;  2VRR B;  1DYQ A;  4HPL B;  2KQ7 A;  2JY6 A;  2X8X X;  4CO7 A;  2G45 B;  3GE3 C;  1V1P B;  5D3I B;  1WJ6 A;  4WJP A;  2K9X A;  2L0T A;  3ZNZ B;  3ZNH B;  1L2N A;  3RFZ B;  4OVZ A;  1P9D U;  1ROE A;  2MQJ A;  2BW2 A;  1M94 A;  3TEW A;  4YSX B;  2E6X A;  1T3Q A;  4RFB A;  3P4P B;  1OEY A;  4KSK C;  4Q2J A;  4ARC A;  1S3S G;  2AQ3 B;  2KFK A;  1WJU A;  2N7E A;  3I3T B;  2L32 A;  4IOI E;  4US9 A;  1F2R I;  2KT7 A;  1NYR A;  2MP2 A;  3SR6 A;  3AE6 B;  2V3P A;  1WRD B;  4C00 A;  3H7P A;  4HLE A;  1WJ4 A;  1WR6 E;  1JWU D;  4G11 A;  1DGJ A;  2BYV E;  1DOY A;  3E56 A;  5LNK 1;  4DHJ B;  2QCZ A;  1YJ1 A;  3WCQ A;  2J4X A;  2D2Q A;  3UQA A;  4HEA 1;  4L23 A;  1GOZ A;  3EGR A;  3R2T A;  2BKR B;  2I1J A;  2KXJ A;  2GMI C;  4HKQ A;  4HPP A;  5DPS A;  1FD6 A;  4DBG A;  2DZK A;  2K22 A;  2RMM A;  4II3 B;  1XXG A;  1RFK A;  3VRB B;  1V5O A;  4X57 B;  5DCN A;  1TYG B;  3AV8 A;  4R3D A;  4A55 A;  4A6Q A;  1VZ7 A;  4G3X B;  2KDI A;  1HTQ A;  3Q14 C;  4W9H A;  3DWM A;  4MGK E;  2JWU A;  3DBS A;  1B9R A;  2WXM A;  1QKZ A;  4KKI A;  4LDT D;  4ITK A;  1SE9 A;  3I63 C;  1WGK A;  3P4S B;  2J52 A;  4MT5 A;  3ZW3 A;  3AE3 B;  2DZM A;  3ZJU A;  4HJK A;  4W9D A;  5CHF A;  2HD5 B;  1C9F A;  2N9E B;  3O13 A;  4CQN A;  4EKU A;  3DHI C;  4J6I A;  4E3C A;  1XLN A;  2WLB A;  4M0W A;  4OW0 A;  5CTR C;  1SJH D;  2AYO B;  4LNI A;  3W9C B;  1R4N I;  3AXC A;  2KMM A;  4RH6 A;  1Y56 A;  4FUL A;  1N5W A;  4EE2 A;  4NAW B;  4AJW A;  2FBW B;  3DCG A;  2JU6 X;  3NVW A;  2HJ8 A;  2MBE A;  3PT2 B;  1TBE A;  4US8 A;  3B0A A;  5LXI B;  2BQQ A;  4BKG A;  2DEN B;  4ASW C;  5FR3 A;  2LD9 A;  3VUY A;  2HDE A;  3EFU A;  1SF0 A;  2IY1 B;  3CIR B;  3VR8 B;  1WJN A;  3V61 A;  4JPS A;  2ZPY A;  1D5Z C;  1C79 A;  3EEC A;  5LXH A;  3AM9 A;  1FNV A;  2D10 A;  1T5X D;  1WMH B;  1YNT E;  5AZH A;  2KYW A;  2IGH A;  2KN4 A;  3PZ7 A;  2RGF A;  2MSE D;  4ICV A;  4ANU A;  3Q3O C;  4TQ1 A;  3VH3 B;  1EF1 A;  2ACZ B;  3JSV A;  4PYZ A;  4W9G A;  3W1S A;  4B6W A;  4RM9 A;  3ZIM A;  2L76 A;  2K1F A;  4XDD A;  1GB1 A;  3PRE A;  1CQV A;  4TKN A;  2JVC A;  1ZDX A;  4ANW A;  4DXG A;  4IC7 B;  2KAC A;  1EM7 A;  3Q3J A;  3VTW A;  3GZN B;  4ZRQ A;  4B0E A;  2W3S A;  1E8W A;  2C7M B;  4J3O D;  3N30 A;  1PFD A;  3NS1 A;  1UH6 A;  3AI5 A;  3QAQ A;  1Q5W B;  4FBJ B;  4A9A A;  2WXL A;  3FIL A;  2MX2 A;  5J17 A;  5G2N A;  3SU8 X;  2MH7 A;  2G4S A;  1SSN A;  3T3O A;  4ZYS A;  2ZCB A;  4K3B A;  1HEZ E;  1TY2 A;  1FEH A;  1C4A A;  4XWW A;  1WYW B;  3R7R A;  3VH4 B;  1VZ8 A;  1E10 A;  1JWS D;  4IM3 A;  1FNU A;  2KDB A;  2WXR A;  4HVB A;  1VR9 A;  3PSE B;  3IAM 1;  2EMT A;  2BVC A;  3VHT C;  3EHV A;  4W9E A;  2C9W B;  3L0W B;  4B9K A;  2IYD B;  2M1M A;  1QOB A;  1RM6 C;  1K50 A;  2L00 B;  1N62 A;  3CST A;  2C7H A;  3X23 A;  3NJT A;  4LNF A;  2PMV A;  1RYJ A;  1F1H A;  3TSS A;  4JQW C;  5JHA A;  3BII D;  4KGS A;  2IGD A;  2ZNV B;  3U2S C;  5HI1 A;  1L0V B;  4JX1 C;  2L3Z A;  2K5P A;  2LJI A;  1J0G A;  2LUE A;  4MSM B;  2UYZ B;  2Z8L A;  4WWN A;  3ZJV A;  1ZDV A;  4WWP A;  4XX5 A;  1IP9 A;  3AEC B;  1C4C A;  3ZDT A;  1AW7 A;  1GPX A;  1TIF A;  4WIP A;  3UIO B;  2INN E;  2OJW A;  1OGW A;  1E8Y A;  1ET6 A;  2KAN A;  3RZF A;  4N58 A;  2BT6 A;  1PGX A;  2LHD A;  3H6N A;  4K81 A;  1MJD A;  3X0W A;  2FCN A;  1XCQ L;  2KJH B;  2MJ3 A;  4A3P A;  2R61 A;  4ICU A;  4RF1 A;  5E6N A;  2KTF A;  3SFD B;  4PS3 A;  3WA0 A;  2KDE B;  1PGA A;  2I2Y A;  3R66 C;  3AEA B;  5JZE B;  2FE8 A;  1MPE A;  1E9M A;  5IO9 A;  3NRZ A;  2KK8 A;  4W9J A;  3DPD A;  1PDX A;  3QIJ A;  2BYF A;  3AE8 B;  2JXX A;  2KJR A;  2QIL A;  2V4L A;  5HFY A;  4HKZ E;  3ZO5 B;  4O1N A;  2WXN A;  3TEY A;  4F1S A;  3QA8 A;  1X1M A;  2W82 A;  2O6V A;  2WU2 B;  1WZ3 A;  3FKY A;  3IHP C;  3DBL B;  3RPF C;  4KIK B;  3QHT A;  2KD0 A;  3H9D A;  3N32 A;  2JRI B;  4NQL B;  3V62 A;  2L7R A;  2LGS A;  1JRU A;  1U4A A;  3EFC A;  4K1R B;  5J18 A;  2RDH A;  2J0J A;  2IDY A;  4P1B C;  2I38 A;  2LI5 A;  3DVN V;  2NTT A;  1QIL A;  2MHJ A;  4XYC A;  4EFO A;  3L10 B;  3RNF C;  2OED A;  4YSZ B;  1V1P A;  3QC8 B;  3U7D A;  1J8C A;  4XC2 A;  4NJ6 A;  2DYO A;  4CHK A;  1P1A A;  3IXS A;  2W54 A;  2Y5P A;  4A8X C;  4GDK B;  2MA9 B;  3ZRF A;  3Q3M C;  2WS3 B;  1UWX A;  4AQ7 A;  4II2 B;  1JW9 D;  4I6N B;  2MJE A;  3TL5 A;  2IBI B;  1FIQ A;  3HHM A;  1IPG A;  3APF A;  4ZHP A;  2CU1 A;  1XD3 B;  3ZYY X;  2L05 A;  2K8C A;  3A4R A;  3KUZ A;  3AN1 A;  5FKA C;  4WQO B;  1ZUD 2;  1ZW7 A;  4OZB A;  3C0R B;  4YTP B;  2DAF A;  2E3T A;  4LDT B;  3PZD A;  2M4N A;  3TBL D;  1KJT A;  2FUH B;  2D3G A;  2KMA A;  3RN9 C;  1E8X A;  1N61 A;  2JZ3 B;  1KLV A;  1OQR A;  2IO2 B;  3IG3 A;  1Q10 A;  4WJQ A;  2Z0E B;  2LXA A;  3R8B A;  1I42 A;  1OQY A;  1WXS A;  5L95 C;  2MBB B;  2JX5 A;  4OZC A;  4QAY A;  3PLU A;  1RRB A;  2IO3 B;  2WDQ B;  3DVN U;  2DNF A;  3BVM A;  5MPO A;  1F77 A;  2ON8 A;  3U30 A;  5CHV C;  3APC A;  1E8Z A;  2AQ1 B;  2JWZ A;  2SAK A;  3HK0 A;  3PGE A;  1UUP A;  1HXY D;  4FJV B;  2NMQ A;  2RPV A;  2YLM A;  3DBH I;  3RI7 C;  1KH0 A;  4IW0 A;  2D07 B;  3RYT A;  1ZPS A;  2DZI A;  4JGH B;  2NCN A;  4NAW A;  5D6J B;  2BWF A;  1OFF A;  4MGZ E;  4OHJ A;  2NR2 A;  4IM2 A;  3SEB A;  5FK9 C;  2KWU B;  2ZEQ A;  4AUQ C;  4GN1 A;  4BKS D;  3DHG C;  4WUR A;  2HTM E;  4NNJ B;  4W9F A;  1WM2 A;  1JCK B;  1C77 A;  1WIA A;  4P7I A;  2IO1 B;  1UF0 A;  2W55 A;  1XF5 L;  1ZKH A;  2DYB A;  3KUD B;  4KDL B;  1STE A;  1DOI A;  1WY8 A;  1YQB A;  4M01 A;  1P7E A;  2VH2 A;  1WMH A;  2AX5 A;  1V81 A;  1PUT A;  4W9C A;  4B0M A;  5AZG A;  1A70 A;  3PHX B;  5BYR A;  1UNS A;  1NYQ A;  5IOI A;  4EZK A;  1IGD A;  2FUG 1;  4JWU C;  4WH4 A;  1JWM D;  5J2R A;  2DZJ A;  4WAF A;  1DOX A;  5JH5 C;  1VCB A;  1L0Y B;  2LUM A;  1I4H A;  1T0Y A;  2KHW B;  2NS5 A;  3SHQ A;  1L6U A;  1D4B A;  1J7A A;  3ZKJ C;  1R4M I;  1UGM A;  2OJR A;  3RCZ A;  4K7S A;  2LGI A;  3H8H A;  4BBN C;  2R2O A;  1NEN B;  1NVI D;  3A9K B;  3B1L X;  2PVO D;  5C1Z A;  3AEE B;  3OG5 A;  3Q8F A;  1EO6 A;  3TMP B;  4G50 A;  4DK5 A;  3H7S A;  3NVY A;  2FIF A;  3OJ3 A;  1QOA A;  2MJD A;  4KZ0 A;  3LB8 C;  3UI3 A;  2K39 A;  2WX1 A;  3GS2 A;  3U8Z A;  2HTH A;  3BWU D;  1D5M C;  1I7H A;  1TS5 A;  4MJS B;  3RD2 A;  1JRO A;  3VFK A;  3IT6 B;  4AWJ A;  3DHH C;  1G6J A;  4ACF A;  2R2Q A;  3WAM A;  4BFR A;  1I4Q A;  1WSP A;  5GXG B;  4LNN A;  2LAS A;  2ZZP B;  2VH1 A;  2WDT B;  3KH0 A;  2BS4 B;  3APD A;  3DVG Y;  5JXV A;  3WAL A;  3A1Q B;  3P4R B;  3P2B A;  4ZRI A;  4MH8 A;  2ZCC A;  3GE8 C;  4LJP B;  2K6Q A;  3MHS D;  1GB4 A;  4FHJ A;  4BZA A;  1K53 A;  1L4D B;  4MEL A;  2RPQ A;  2QSD A;  3E9S A;  1WXV A;  3QQ8 B;  1FO4 A;  2MBO A;  1WX7 A;  3VR9 B;  3HIZ A;  3CWI A;  2KMC A;  4IWP A;  3TIX A;  2KX3 A;  4USA A;  2ZW0 A;  2N9X A;  3VUW A;  1V80 A;  5IAA C;  1GNU A;  2PE6 B;  4MSQ B;  3AE2 B;  2JPH A;  4EZL A;  1FRD A;  4I6L B;  1TS4 A;  3R2I A;  4ANX A; 
#chains in the Genus database with same CATH homology
 1C4C A;  2D5G A;  3ZQ4 A;  1AW7 A;  1L4Z B;  2BS2 B;  1TS3 A;  1GPX A;  4KGT A;  4RNA A;  3L4P A;  1HQR D;  4WIP A;  1IBX B;  1V97 A;  4NAM A;  2INN E;  1TKG A;  2Y3A A;  1AN8 A;  2GRI A;  2PLP A;  2H89 B;  1ET6 A;  1L5P A;  4N58 A;  1VRA B;  2BT6 A;  1PGX A;  2WXK A;  2XNA C;  2LHD A;  1C76 A;  2BTE A;  2LFI A;  3T3N A;  1HZ6 A;  2V0G A;  1KRH A;  1XCQ L;  2JQR B;  1T6B X;  2MJ3 A;  1ET9 A;  2R61 A;  3Q8A A;  4KX6 B;  1ZOY B;  4YSY B;  3AE4 B;  4RF1 A;  3SFD B;  1UWM A;  2TSS A;  1FCL A;  1PGA A;  2I2Y A;  3BK1 A;  4MM3 B;  2WXH A;  3AEA B;  2W3R A;  2FE8 A;  1MPE A;  2QEJ C;  1E9M A;  3GP7 A;  3NRZ A;  4P6V F;  1I4X A;  4ZRP A;  3C8Y A;  2QIE B;  1PDX A;  2LMC A;  3B2G A;  2KAJ A;  2BS3 B;  1E7P B;  1K52 A;  2ZW1 A;  1VJK A;  2BBC A;  3BVZ A;  2IGG A;  3AE8 B;  1N60 A;  2WXG A;  5G5G A;  1QOG A;  3ETR A;  1QLB B;  2QIL A;  5HFY A;  5C3J B;  1IGC A;  2JSV X;  4HKZ E;  3FAH A;  4O1N A;  2WXN A;  3NVZ A;  3TEY A;  2EKI A;  3EUB 2;  1FFU A;  2KDM A;  4RGN A;  2CJN A;  2W82 A;  2WU2 B;  3FC4 A;  4YXD B;  1D6E C;  5C2T B;  2Q5W D;  1V1O A;  3ZJT A;  2PW9 A;  3J9C A;  3RPF C;  3PZ8 A;  3NUH B;  4L1B A;  1KFY B;  2M56 B;  5BMH A;  1VLB A;  4C80 A;  3I57 A;  4TSS A;  4P16 A;  1QF6 A;  1I4G A;  3I9V 1;  5D3D A;  1ESF A;  1YN5 A;  2JYE A;  4GLS C;  2RDH A;  3OWE B;  2IDY A;  1SE2 A;  3KWV A;  1TZO A;  3HUI A;  3NVV A;  5H8Y E;  1XCT L;  1CK1 A;  2WDR B;  1EWC A;  2I38 A;  3VRA B;  1ZXH A;  3TEZ A;  2NTT A;  1E0Z A;  1QIL A;  3LXF A;  5BMI A;  1SB3 C;  1I4P A;  3W2D A;  5HG2 A;  2BB5 A;  2K3U A;  3EA6 A;  2CU3 A;  2INP E;  3TUO A;  2ONQ A;  1ZXI A;  2OED A;  4YSZ B;  2WU5 B;  5AUK A;  1UGJ A;  1V1P A;  4WWM A;  5HHD G;  1ZP0 B;  3AE1 B;  5E6J A;  2MEK A;  3AE7 B;  4LK0 M;  2DYO A;  1BXT A;  2WXO A;  2JYT A;  1PYW D;  3KQ4 A;  2BB6 A;  2DWQ A;  1QQR A;  3W5U B;  1DYQ A;  2AQ2 B;  3IXS A;  5EE9 A;  5I4D A;  2W54 A;  2Y5P A;  2BYT A;  1V1P B;  4A8X C;  3AEG B;  4GDK B;  5D3I B;  3B9J A;  1FMA D;  2K9X A;  2WXF A;  2WS3 B;  3NZ3 A;  3RFZ B;  1UWX A;  3IT4 B;  2ICI A;  4OVZ A;  1ROE A;  4AQ7 A;  1TKY A;  4RGO S;  2BW2 A;  1GAQ B;  2L1A A;  4YSX B;  3TEW A;  1JW9 D;  2E6X A;  1T3Q A;  2N9K A;  4RFB A;  4TQ0 A;  3P4P B;  2MJE A;  4TMA B;  1XO3 A;  2KWD A;  1FIQ A;  1YQ4 B;  4Q2J A;  4ARC A;  2AQ3 B;  1KF6 B;  1HA5 A;  4ZHP A;  2L32 A;  4IOI E;  4US9 A;  1F2R I;  1NEK B;  3ZYY X;  1RWS A;  1NYR A;  2V4I B;  3U4E G;  1V8C A;  4N6E B;  1SBB B;  1WXQ A;  1TJE A;  2WDV B;  3AN1 A;  1TKE A;  5FKA C;  1ZUD 2;  2WQY B;  3SR6 A;  3AE6 B;  3AEF B;  1C78 A;  2L52 A;  1JWB D;  1JQ4 A;  2V3P A;  3HRD D;  4OZB A;  1J7B A;  4D2K A;  4NZL B;  1E6E B;  2CJO A;  4YTP B;  3U52 E;  1FFV A;  2E3T A;  1TS2 A;  1JWU D;  1XLQ A;  1DGJ A;  5T8I A;  1DOY A;  3E56 A;  5LNK 1;  1OQQ A;  1FXI A;  3BYT B;  1N5X A;  3WCQ A;  2J4X A;  3U7Z A;  4HEA 1;  4L23 A;  4LLG M;  3V05 A;  1FM0 D;  4UDU C;  1HZ5 A;  1SIJ A;  4NJC A;  1GOZ A;  3EGR A;  3R2T A;  3IAS 1;  1N61 A;  2Y5C A;  1SEB D;  2PVG C;  4HRS A;  5BMG A;  4HKQ A;  1FD6 A;  1ENF A;  1D5X C;  1XLO A;  1WYG A;  1OQR A;  2K22 A;  2RMM A;  3Q8C A;  1SE3 A;  1Q10 A;  1XXG A;  1RFK A;  3W5V B;  3VRB B;  1F0Z A;  3R8B A;  3ZGZ A;  2QMT A;  1TYG B;  3AV8 A;  1JAL A;  4R3D A;  4A55 A;  4A6Q A;  4KKJ A;  1VZ7 A;  2JX5 A;  4OZC A;  1J7C A;  2YEP B;  3MC0 B;  1ZE3 D;  2WDQ B;  4YTN B;  2IJ0 A;  3DWM A;  2JWU A;  1TY0 A;  3AB5 A;  3ABV B;  1B9R A;  1MHH E;  2WXM A;  2OHF A;  1QKZ A;  3BVM A;  3P63 A;  5G5H A;  4KKI A;  1F77 A;  2ON8 A;  5MPO A;  1YQ3 B;  3MFG A;  4FXC A;  4ITK A;  1FRR A;  2AQ1 B;  2SAK A;  1UUP A;  1WGK A;  1HXY D;  3HVZ A;  4H2A A;  1L0X B;  1YMH E;  2DBY A;  3AED B;  2J52 A;  2WXQ A;  3P4S B;  4MT5 A;  3AE3 B;  2NMQ A;  2RPV A;  1P7F A;  1KH0 A;  2H88 B;  4L2Y A;  3ZJU A;  1C9F A;  1ZPS A;  2B76 B;  3KLS X;  3O13 A;  3DWG C;  4CQN A;  1K51 A;  2JXT A;  2RDG A;  1OFF A;  4OHJ A;  4JWS C;  1XLN A;  2N0S B;  2WLB A;  4M0W A;  4OW0 A;  5FK9 C;  3SEB A;  1EWY C;  1FCC C;  1SJH D;  4RGM A;  3W9C B;  4WUR A;  2KMM A;  4RH6 A;  2HTM E;  4C7Z A;  1Y56 A;  1VZ6 A;  1YJI A;  1N5W A;  4EE2 A;  1JCK B;  4NAW B;  1C77 A;  4HJG E;  2EEL A;  2FBW B;  2X38 A;  4XDC A;  1MI0 A;  2JU6 X;  3NVW A;  2W55 A;  2QJL A;  2N9L A;  4ZHO A;  1XF5 L;  1JRP A;  1STE A;  1M4V A;  4US8 A;  1CJE A;  1DOI A;  4MAC A;  5FR3 A;  3BVG A;  1P7E A;  2HDE A;  2AX5 A;  1SF0 A;  4N59 A;  2G9H D;  2K0P A;  1WRI A;  1PUT A;  2KQ4 X;  3CIR B;  1MHX A;  1R7S A;  4B0M A;  3VR8 B;  1FXA A;  2NTS A;  2YEP F;  1A70 A;  1SE4 A;  3MJ5 A;  4JPS A;  4ARI A;  1D5Z C;  1C79 A;  2WXJ A;  1UNS A;  1VDV A;  3LYY A;  4KGR A;  5BYR A;  1NYQ A;  3AM9 A;  1FNV A;  3URY A;  1T5X D;  1C4P A;  1YNT E;  2WXP A;  2SEB D;  1YN4 A;  1IGD A;  2FUG 1;  2IGH A;  2KN4 A;  3PZ7 A;  4RCO A;  1KTK A;  4JWU C;  1I4R A;  4WQM A;  4TQ1 A;  4WH4 A;  1JWM D;  4WAF A;  4IKG A;  1DOX A;  1CZP A;  2LHE A;  4LTU A;  1L0Y B;  2LUM A;  1I4H A;  2M0A A;  2ACZ B;  3VQI A;  4C7Y A;  1AWD A;  1L6U A;  3AMZ A;  1YN3 A;  1N63 A;  3SFE B;  1J7A A;  1D4B A;  3MHZ A;  3W1S A;  2GB1 A;  3HVD A;  4XDD A;  2LGI A;  1GB1 A;  1CQV A;  3H8H A;  3MP9 A;  5BYQ A;  5EE0 A;  1ACC A;  1WWT A;  1ZDX A;  3BK2 A;  5H92 C;  3Q69 A;  4A90 A;  1NEN B;  1NVI D;  4DXG A;  2V3N A;  2KAC A;  1EM7 A;  2PVO D;  3AEE B;  3Q8F A;  4ZRQ A;  4B0E A;  1IUE A;  1LO5 D;  2W3S A;  1QOF A;  4AS1 A;  3NVY A;  2LEK A;  1SXT A;  4J3O D;  2VZK B;  1QOA A;  2MJD A;  1PFD A;  3LB8 C;  3NS1 A;  3UI3 A;  3GS2 A;  3BWU D;  1D5M C;  2XN9 C;  1I7H A;  4A9A A;  1TS5 A;  3BYY B;  1JRO A;  3Q8E A;  4REZ A;  4YT0 B;  5D7G A;  4GDL B;  4XWT A;  3IT6 B;  2WXL A;  3FIL A;  5EE1 A;  3TEX A;  3AE9 B;  1BUI C;  2MH7 A;  1SSN A;  1JML A;  3T3O A;  5EE3 A;  1AYF A;  1I4Q A;  1EU3 A;  4ZYS A;  1WSP A;  5GXG B;  2GI9 A;  1HEZ E;  1TY2 A;  1FEH A;  2J53 A;  1C4A A;  3P1M A;  4XWW A;  3V3X A;  4C56 C;  4PT5 A;  2BS4 B;  1VZ8 A;  1E10 A;  1BML C;  4OZA A;  1JWS D;  1EU4 A;  3FIL B;  4DQO C;  1L6V A;  5JXV A;  1FNU A;  1YJJ A;  2WXR A;  1JWA D;  2WNM A;  3P4R B;  1QT9 A;  1VR9 A;  1FNW A;  3IAM 1;  2VZK D;  3Q8B A;  2DYM A;  4MH8 A;  2PKO A;  4IDI A;  4YTM B;  3GB1 A;  2M19 A;  1XEE A;  2PIA A;  1GB4 A;  2J42 A;  2N7J A;  1KLU D;  3B2F A;  1NI3 A;  5BYS A;  4DXF A;  1QOB A;  1RM6 C;  1K50 A;  5TSS A;  1K53 A;  1L4D B;  3AH7 A;  2QSD A;  1N62 A;  3E9S A;  1FO4 A;  2JZP A;  3VR9 B;  4XE0 A;  3AEB B;  3CWI A;  4RGT A;  2PMV A;  1PGB A;  1RYJ A;  4YWG G;  1KLG D;  3TSS A;  2IPK D;  3P42 A;  4HRO A;  4JE3 B;  4RF0 A;  4USA A;  3BII D;  2ZW0 A;  4ZOH C;  4KGS A;  2IGD A;  1F2R C;  3U2S C;  5HI1 A;  1B1Z A;  2DLB A;  1L0V B;  3AE5 B;  4JX1 C;  5AUI A;  2K5P A;  3BZD B;  3P4Q B;  2LJI A;  1IBX A;  1SJE D;  2PTL A;  3AE2 B;  3N9Y C;  2L83 A;  2WXI A;  1MVK A;  1FRD A;  2Z8L A;  2G1E A;  1XLP A;  3ZJV A;  1TS4 A;  3KWL A;  1ZDV A;  3PO0 A;  2WP9 B;  3R2I A;  3AEC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...