1OFFA

2fe-2s ferredoxin from synechocystis sp. pcc 6803
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN I
publication title The Active Conformation of Glutamate Synthase and its Binding to Ferredoxin
pubmed doi rcsb
source organism Synechocystis sp.
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1offA00
1J7BA 4YT0B 2CU3A 3P4SB 4LTUA 2DWQA 2KMMA 2Q5WD 1RYJA 2CJOA 4N58A 2L52A 1JWBD 4A9AA 1SF0A 1UWMA 3LB8C 3RPFC 2WS3B 1JROA 1SB3C 4WWMA 1FFUA 1XLOA 5GXGB 1SIJA 3W5UB 1V97A 3HRDD 1NYQA 2BS2B 4JX1C 1AYFA 2L83A 3AH7A 2WU5B 2M19A 2PKOA 1JRPA 1YJIA 3AEBB 4JWUC 1F0ZA 1N5XA 2QIEB 3P1MA 1WYGA 1PUTA 3AE3B 1JQ4A 2WP9B 1DGJA 3AE6B 3AEEB 4US8A 5EE0A 3VR9B 2W55A 3NVVA 5C3JB 4USAA 2BT6A 3AV8A 4WQMA 4YTNB 1FM0D 1JWAD 5C2TB 2LEKA 1E0ZA 2WDQB 2W3SA 3AB5A 5EE3A 4C7ZA 1VLBA 1VJKA 1WWTA 3AE5B 1J7CA 1E7PB 1OQQA 1KFYB 1ZXIA 4P6VF 4YSYB 5AUIA 5MPOA 2M56B 2B76B 1JW9D 1DOYA 2JX5A 1NVID 2BS4B 2PVGC 1XLPA 3W5VB 4N6EB 2MJEA 5EE1A 3VR8B 3AM9A 1OQRA 2OHFA 1XLQA 1TKYA 2CJNA 1DOIA 4YTMB 1XO3A 3NS1A 4KX6B 1QOBA 4C7YA 2QJLA 2FBWB 3SFEB 4N59A 1OFFA 1RFKA 1T3QA 1ZOYB 2KAJA 2W54A 2WDRB 3HUIA 1YJJA 3PO0A 2WQYB 1L6UA 3AEGB 1VDVA 1A70A 3VRBB 1V8CA 5G5GA 1AWDA 3ETRA 3P4RB 2PVOD 2EKIA 3AEAB 3FC4A 3EUB2 2MJ3A 1R7SA 1N5WA 3B9JA 4HRSA 1DOXA 2WDVB 2K22A 5H8YE 3ZYYX 1PDXA 2WU2B 3AE4B 3P63A 1QT9A 1CJEA 3ABVB 2HTME 1GPXA 1RWSA 1XLNA 1KF6B 2G1EA 1QOFA 4ITKA 1TJEA 1CZPA 5AUKA 2H88B 3FAHA 1FO4A 3P4QB 1N63A 3VRAB 2BS3B 4YXDB 3NVZA 1TYGB 4HROA 1EWYC 3P4PB 4US9A 3SFDB 3AEDB 1FXIA 1B9RA 1N62A 2E3TA 3W9CB 2Y5CA 3NRZA 2JQRB 1E9MA 3DWGC 3CIRB 1FFVA 3AE7B 4YSZB 3B2GA 1QF6A 1WXQA 1JALA 1GAQB 2WLBA 1ROEA 1FXAA 1L5PA 1N60A 1WGKA 2N0SB 3AE2B 3AECB 4JWSC 3WCQA 4YSXB 4ZHOA 3L4PA 4C80A 4IDIA 1E10A 3SR6A 3B2FA 2H89B 2MJDA 3NVYA 3DWMA 3KWLA 1TKEA 3AEFB 2K5PA 3AE1B 1ZP0B 3AMZA 3AE9B 1IUEA 2W3RA 3CWIA 3NVWA 1KRHA 1YQ4B 4ZHPA 1YQ3B 1J7AA 1N61A 1NI3A 1WRIA 3AE8B 2DBYA 1ZUD2 5H92C 1E6EB 1FRRA 2PIAA 2AX5A 1QOGA 1FIQA 1NYRA 2K9XA 1RM6C 1PFDA 3LXFA 1NENB 1FMAD 1NEKB 2ACZB 4FXCA 4YTPB 1QLBB 3BIID 5EE9A 5G5HA 1L0VB 2MH7A 1QOAA 1TKGA 1I7HA 3AN1A 3HVZA 1FRDA 4ZOHC 1L6VA
chains in the Genus database with same CATH superfamily
4LJPB 2CU3A 3ZRCA 3DBLI 2Y3AA 2CHWA 2INDC 3V3XA 4GXBA 4JX1C 3DBHI 4AOFA 4UDUC 4BKSD 4DHZB 1R4MI 3VR9B 1V81A 3JVZX 4YTNB 4HLEA 2LEKA 1E90A 2ONQA 1FNUA 4MELA 1GOZA 3L54A 1MG8A 2E6XA 4KGTA 2J7QB 2JPHA 3V62A 4A8XC 1Y8RC 2ZNVC 1T0YA 4HPPA 4KX6B 3EHVA 4MJSA 2FBWB 4OZCA 4F7ZA 1SE9A 5LNK1 2BW2A 3PO0A 1JWMD 1WRDB 4EEWA 2KKCA 5FR6A 3U30A 2KLGA 3L0WB 3ZJTA 5IP4D 3NZ3A 4HK2A 1IBXB 5AZHA 4MDKE 5H8YE 4NJCA 2G1EA 3U52E 2INCC 1D3ZA 3A9KA 3FAHA 1N63A 2GRIA 3A9KB 1TYGB 3BVGA 4M0WA 2RDHA 1R4NB 2D07B 3AI5A 3RNBC 4RGMA 1WXVA 1ISNA 2PEAA 4GLSC 3KVFB 4EZJA 4C80A 2I2YA 5KHQA 2JY6A 2JZPA 3ZXRA 2AYOB 3Q69A 3JSVB 1OEYJ 2KWCA 3LJ3A 3AE9B 2BYTA 1G6JA 3RD2A 2EMTA 1WR6E 1QILA 2ZPYA 5J2RA 5G5HA 4WJNA 1L0VB 1YN4A 2J53A 3ML9A 1KLGD 2HJ1A 4GN1A 2KANA 3V6EB 1WZ3A 4DHJD 3C19A 2L52A 5LXHA 1VCBA 3A4RA 2JZZA 4NAWB 2N9LA 2NBUA 3AXCA 2M8SA 1GNUA 3TIXA 3WAPA 1T5XD 5E6PA 2IDYA 1JQ4A 3AEEB 3KH0A 1T6BX 2FCNA 3WIMA 3Q3NC 3EFCA 4TSSA 3V61A 1WWTA 2IO1B 1A5RA 1WJ4A 1YOVB 2DYMA 1ZXIA 2L1AA 4HEA1 4J3OD 2GB1A 4IWOA 1AW7A 1J19A 4MGKE 4E71A 1C4AA 1PGAA 4HDQA 1TTNA 1BUIC 4BKTA 3Q8EA 4LK0M 3DPDA 2GOWA 2JRIB 1WH3A 4ZYSA 3NUHB 2V3NA 1RAXA 3TMPB 3CSTA 4P16A 1WIAA 3UI3A 2PVOD 3KW5B 4W9FA 3QC8B 4W9KA 4BOZB 1P9DU 1JWUD 3T3OA 1C76A 2D10A 2WX0A 5FKAC 3T3NA 2L7RA 2JSVX 4A90A 1HQRD 4GMVA 2CR5A 3TEZA 1TGZB 1FD6A 2K25A 3CIRB 5C23A 3FKYA 1EF5A 1EU4A 3ZUNA 1JALA 2BTEA 2L0TA 4JWSC 1ZKHA 5CTRC 2LJ5A 1OQYA 2MBEA 3IG3A 3AEFB 1BT0A 3ZO5B 2CKHB 5JHBA 1E7VA 3CWIA 3NVWA 1YQ4B 1KJTA 3LXFA 1FMAD 4WJQA 4ANVA 3PS6A 1KLUD 1PQSA 1ESFA 1FRDA 2KO3A 3LB8C 1F2RC 1SJHD 3DBLB 1P98A 1YN5A 1EM7A 1K52A 1I4PA 3QARA 1ET9A 2JT4B 5GXGB 2LXCA 3I3TB 2PKOA 3Q6BA 1V49A 1E8XA 3A33B 5D3DA 1SGHA 3BZDB 4AJYB 1BXTA 1R4MB 3AE6B 1JWAD 2M17A 3U8ZA 2JUOA 4P1BC 4EFOA 3ZTDA 3QWZB 3AE5B 1KOTA 4JLCA 2MLBA 3KQ4A 4NPNA 3ZGZA 3KUZA 4ANXA 1GC7A 2MJEA 1SSNA 3SD5A 3MP9A 4F1SA 2CJNA 2KDMA 1C9FA 3CMMB 2M0AA 3HIZA 2MQJA 2BWFA 2L05A 1K50A 2EKIA 3APDA 2DX5B 3W2DA 4XC2A 1UBIA 2IBIB 3ZYYX 4HXDA 3AE4B 2LMCA 1XLNA 2BBCA 4L23A 4WAFA 3RCZA 1GC6A 4K81A 1SBBB 2V3PA 3JW0X 1L2NA 1WXSA 5L95C 1HTQA 3ZRFA 3V05A 4MM3B 3ZNID 3CSFA 4IUMB 4Q2JA 2DLBA 1ROEA 4IC7B 3KYCD 4W9EA 1FXTB 2MX2A 1WGDA 1HE8A 3VXWA 1MI0A 2KD0A 2EMSA 4HWIB 3DVGY 4OVUA 2DBYA 3N9YC 1SE3A 4C4VA 2QDFA 2V9HA 2KFJA 2O6VB 2PTLA 4LNIA 1WZ0A 3IT6B 2KVZA 4IW0A 3NG0A 4K1RB 4HVBA 1MVKA 2LASA 5JZEB 4MSQB 1JROA 4NQKE 1FFUA 1SIJA 2BWES 2ZNVB 5AZFA 4CO7A 1F0ZA 3AEBB 4W9HA 2BKRB 2MHJA 2KACA 2N1VA 4GDLA 4BBNF 1OQQA 3RYTA 4IM3A 4S0RA 4BBNC 3WAMA 4A20A 2ZCCA 4NQLB 5IOIA 3LDZE 1A70A 1C3TA 3Q8CA 1VR9A 4XDDA 2KWDA 1WGGA 2EELA 1C79A 2N9XA 3GE8C 3RN9C 4BKGA 2PW9A 2ZEQA 2PE6B 2EKEC 3ZQ4A 5E6JA 3DVNV 1EO6A 4HJGE 1FNWA 1FXIA 2KWUB 1I4XA 4MGYE 2UWQA 2JWZA 4YSZB 1GAQB 2N7JA 1L5PA 5JH5C 1Z2MA 1K8RB 1STEA 3PRPB 1QKZA 2G4DB 3QJZA 4KDLB 4P7IA 4A55A 2INNE 1WYWB 4GDKA 2GBMA 2AX5A 3EA6A 4AQ7A 2MBBB 4YTPB 3L10B 2O2VB 3ENEA 3HVZA 3GE3C 2JXTA 4PS3A 2BYFA 1WGRA 5BYRA 3CF6E 2KOXA 2K8BA 2WXHA 1YJIA 3P1MA 1ZDVA 2WX1A 2PE9A 2WP9B 3W1SC 3NZUA 2W82A 4USAA 2XN9C 5BMGA 4IM0A 2W3SA 4JQWC 3ZDTA 2REXA 5DPRA 3IFWB 3RNCC 3QIJA 1I4GA 4PYZA 5J17A 3HM3A 1BMLC 3VR8B 1V80A 1EF1A 2OHFA 2GBRA 2ZCBA 1RFKA 2KAJA 2WDRB 1YJJA 1YX6B 2Z0EB 4DXAB 3VRBB 1MG4A 4DHJB 1N5WA 1DOXA 2L32A 5J18A 3O65B 4PT5A 1RWSA 2PLPA 4L1BA 3VRAB 2BS3B 3Q3MC 1VZ8A 3W9CB 2FCSA 1V86A 3HHMA 2M0XA 2N4FA 3VTUA 4AUQC 3MJWA 2WXLA 3ZIMA 3PV1A 3AE2B 4YSXB 1PGBA 4MH0E 4M02A 4LNFA 3NOBA 2IY1B 2DYOA 3PZ8A 2KQ4X 2WNMA 4IKGA 2BYVE 3TEWA 4BAXA 3UQBA 1TS5A 1NEKB 2ACZB 3OG5A 1ENFA 2X8XX 3KWVA 2MP2A 4KV2A 1P7EA 4YT0B 2KDIA 2BQQA 4XE0A 3RPFC 2K6QA 3QCAA 4RMAA 1V1PA 4LDTD 3HRDD 2BS2B 1V1PB 1LM8B 2J4XA 2MRPA 3KUDB 1HA5A 4HCNB 2XNAC 3H1UA 4B0EA 3NY5A 2KMAA 3VUWA 3PZDA 4KIKB 1T0QC 4L2YA 2A5UA 2LUMA 2CS4A 1OQRA 2DZJA 5DPSA 3A1QB 3AU4A 2ON8A 1IP9A 2JF5A 4JE3B 3J9CA 3SHQA 1OTRB 1PGXA 4IDIA 3OLMD 4FBJB 1QQRA 3I63C 2C60A 4BFRA 2V1YA 3B9JA 4II3B 2HTHA 3Q8FA 5I4DA 4XDCA 2I1JA 2AWTA 4NNJB 2YEPB 1P7FA 3P4PB 1TY0A 1UELA 4KGRA 4KSLC 2KK8A 4RM8A 3N1YC 3VUXA 4DWFA 1U4AA 4KKJA 1TS4A 4ACFA 1UBQA 4AJWA 4HDOA 2Z8LA 1IBXA 5T8IA 4M00A 1FNVA 2K1FA 4BVUC 2KQSA 2NS5A 1WI0A 4W9DA 5G55A 4B0MA 4DHZE 1TZOA 4MH8A 2MBOA 3AE1B 1C78A 2OJWA 5LLIA 4HKZE 2D2QA 5H92C 4XZ4A 3E56A 4NZLB 3UINB 4DDGD 4B6WA 1TZ1A 3X23A 2IO3B 4LTUA 1B1ZA 2C7MB 3JSVA 1QZEA 4GGQA 1MFWA 4A9AA 1K53A 4NAMA 3W5UB 3RNAC 4K7SA 5BO4B 4P1CC 1YNTE 4DXGA 2WXMA 1MHXA 2D11A 5C2TB 5BYQA 4TQ0A 5DPWA 3A9JB 2RMMA 2D5GA 1KFYB 1S3SG 3U7DA 2PMVA 4NAWA 4OZBA 4IM2A 1NVID 2KNBA 2BPSA 2LI5A 1KLVA 3PZ7A 1TKYA 4OZAA 4ICUA 2QMTA 2G4SA 2SAKA 3AULA 2MBQA 2WXIA 1Z5SB 3FC4A 3N32A 3KLSX 1KF6B 1CZPA 1DYQA 3V60A 4US9A 1I35A 1E5WA 3UQAA 2ZPNA 4TQ1A 2KX3A 3QHTA 5IN7A 1FFVA 1I4RA 3BVZA 2RPQA 4ZYNA 1FXAA 2RGFA 3SU8X 1X1MA 2H89B 4PS7A 2IGDA 2QEJC 3FILB 3C0RB 1YQ3B 3R8BA 1LQBA 3PPAA 4RGTA 2NCNA 3PRMB 3MC9A 2KFKB 1EUVB 1RM6C 5EE9A 2IPKD 3VFKA 1E8ZA 2LFIA 2MSED 5GMVA 2GBKA 4GOCA 1RRBA 3ZTCA 4RF0A 4MGIE 1P1AA 1WJ6A 1NYQA 4KKIA 2M19A 2IYDB 3NJTA 4RGOS 3TEYA 2K6DB 1I4HA 3AV8A 4HCPB 3AB5A 3U4EG 3M63B 4KZCA 3GP7A 2L00B 1NDDA 2R2QA 3TCAA 1UF0A 1XLQA 1XO3A 3NS1A 4C7YA 1TS3A 2J0KA 2DENB 1MPEA 1T3QA 2LZ6A 1FPYA 3UIPB 2C7HA 3Q2AC 3L08A 2MJ3A 1ZGUB 1Q1OA 3N3KB 4HRSA 1QT9A 3H7PB 2RPVA 3PHWB 3OAWA 1V6EA 5C1ZA 4IWQA 2WXJA 3UIOB 3Q3JA 5IKCM 1XD3B 1GUAB 1E9MA 2ICIA 2RD0A 3KUCB 3K9OB 1KTKA 3SR6A 2DHZA 3VVWB 3I57A 3BK1A 2JWUA 1VRAB 4ZHPA 3DQVA 4ASWC 4MM3A 1FIQA 1NYRA 1NENB 3QA8A 2KJRA 4EE2A 3PRZA 2MH7A 1QOAA 2MWSB 2KC2A 1I7HA 2N7DA 3TJPA 2L0FA 1L6VA 2FCMA 2Q5WD 3WAOA 1F2RI 2L8JA 1XLOA 2LRUA 4K7UA 1WY8A 1V97A 5HI1A 4K7WA 4NY0A 3WALA 2K39A 4JGHB 1SE2A 3DVGX 1L0XB 2O6VA 5IAAC 1JWSD 4MEMA 2AQ3B 5EE3A 2LWPA 1KM7A 1WE6A 2QHOA 1DOYA 2LHDA 3IXSA 4G11A 3ONSA 2KTFA 2QSDA 2FCQA 4K3BA 1NI2A 2ZW0A 5BMIA 1XCTL 2Y5BB 2ZVNA 5AEKB 3BY4B 4YL8A 4QAYA 4LLGM 2RSUA 1L4DB 3TEXA 3PTFC 5EDSA 1CJEA 2HTME 2AQ2B 1QOFA 4LDTB 1WXMA 5HKHA 3T8MA 1V5TA 3OJ3A 2MEKA 4DXFA 4YXDB 4HROA 2DYBA 4ZRJA 1XCQL 2WXPA 2FIFA 2FNJB 1L4ZB 3R7QA 5D2MB 4MGZE 1WM3A 2AL3A 4FHJA 1LGRA 1SEBD 2BB6A 2BF8B 3IT4B 3NVYA 5D3IB 1FCLA 3DWMA 1CK1A 2KTRB 5D6JB 3MHZA 3DOWA 2XK5B 4BKSA 1JRUA 4IG7B 2Z59B 5KHOA 2D3CA 2DNFA 2RDBC 1TKGA 3AN1A 2BKFA 3DHGC 1E7PB 1J7BA 2HJ8A 2DWQA 2DAJA 3HK0A 1GB4A 5TSSA 2NVUI 5FR3A 4G0NB 3SEBA 4J6IA 3MHSD 3VH3B 1SE4A 4DDID 1N5XA 3RUIB 3N20C 1D4BA 2O2VA 4IOIE 4US8A 1YMHE 1UUPA 2WDQB 2GMIC 3VAWA 1C77A 2KJ6A 2KMCA 1JW9D 1J0GA 4WQOB 4GIVA 4LCDE 1VD2A 2M4NA 1V1OA 3AM9A 3BK2A 1D6EC 2N7EA 2V0GA 3B0AA 5E6OA 3MJ5A 4H2AA 5TR5A 3AEGB 1H4RA 1V8CA 4ZRQA 2NPTB 3H6NA 4IWPA 3N1ZC 1TS2A 2JYTA 2K22A 3P63A 2WU2B 4RM9A 4FULA 4XX5A 2KN5A 4YWGG 4WWNA 5AUKA 4KDIC 4FADA 3M95A 2V4LA 1EWYC 1HZ6A 3AEDB 3ZXVA 2GI9A 3ZNZB 3DWGC 4G50A 1C1YB 4XGAB 4EUTA 3EECA 1WMHB 5IO9A 2LUEA 3R2IA 3K9PB 2NMQA 2FUHB 3B2FA 3RNGC 3Q3FA 1TKEA 4B95A 2IGGA 1GG3A 1N61A 1WRIA 4X57B 4ARIA 1ZE3D 3P2BA 2L76A 2LGXA 4M8NA 5IA7A 2C7NB 3PLUA 3MC8A 2JZ3B 4FJVB 4A3OA 1UD7A 3H8HA 1SB3C 4TV3A 1JRPA 2IY0B 3ECIA 1WYGA 1RFAA 3IHPC 3N30A 3AE3B 4I6NB 1XF5L 3ALBA 4WQMA 3ML8A 1E0ZA 5D7GA 1YQBA 3PGEA 3VQIA 4CHKA 4TUUA 2ZW1A 3UF8A 2M56B 2B76B 2LRWA 3B1LX 2G9HD 2BS4B 1JMLA 3L16A 4N6EB 3GOEA 1Y56A 4EZKA 1DOIA 3ZLZA 4N9F4 1T0RC 2BVCA 1F1HA 2NTTA 1S1QB 1P3QU 1OFFA 4YTMB 2WQYB 1VDVA 3ETRA 2R2OA 2SEBD 2WDVB 2GBJA 3PVLA 4KIKA 1TBEA 3ZW3A 3ZDMC 4K3CA 3APFA 1TJEA 1FO4A 3A1QA 3NVZA 1VZ6A 2A4ZA 5G2NA 3Q3OC 1XT9B 1TT5B 2JQRB 1P0RA 4WJPA 4E74A 1N6ZA 3GZNB 3AECB 2N0SB 4ZHOA 1YIWA 1M4VA 4WJOA 3DBSA 2K5PA 4WWPA 5CHWA 3NHEB 2W3RA 4ZDVA 2KXJA 1E6EB 1L0YB 2LVQA 1AN8A 3PT2B 4R3DA 2K9XA 4PK1A 3IBEA 2HD5B 5CHFA 1QLBB 2WDTB 4KVGB 2OOBB 4ICVA 2ZVOA 4E3CA 2LGSA 1D5XC 3IVFA 2KMMA 2D3GA 1C4CA 2VZKD 1Q0WB 3A4SC 3DBRI 2RDGA 3MFGA 2IO2B 2WS3B 2JRHA 1GJZA 3IAS1 2N9EB 1ZW7A 3L17A 4W9CA 4AS1A 3Q8BA 4CYEA 2AL6A 4MJSB 2IZVB 1DGJA 5JXVA 5EE0A 2L3ZA 3N1XC 5C3JB 1SIFA 2NBVB 3NZSA 4G3XB 4YSYB 4FLHA 5JHAA 4JPSA 2CHZA 2PVGC 3W5VB 2ZZPB 1YD8U 1WM2A 1UGJA 4M0WB 3NS8A 1L7YA 3SFEB 2Y5PA 1ZOYB 5HHDG 1WF9A 4NJ7A 2G45B 1XXGA 4W9IA 2JU6X 1R7SA 3A9JA 3RNFC 3RZFA 1RLFA 4HJKA 4S17A 2H88B 3PHXB 1E8YA 3M3JA 4JL9A 3E9SA 5FK9C 3MC0B 3QX1A 4W9LA 2KX0A 2OJRA 2WLBA 2UU7A 2KLCA 3C8YA 4PYUA 1N60A 2JYEA 4I6LB 4MACA 4PS8A 2QCZA 2K8CA 1WFYA 3R2TA 2IJ0A 3AU5A 2J0JA 3GS2A 2J42A 2MCNB 3P4SB 5BMHA 1FEHA 1KH0A 4HPLB 3RI7C 3R66C 4O1NA 1JWBD 2I1KA 3FILA 2K8HA 3VTWA 1WXAA 2NBWB 3PLVA 3AH7A 2KFKA 1MJDA 3W1SA 1YN3A 2W9NA 4OVZA 2BB5A 4KZ0A 1NBFC 2BT6A 3MTNB 3ZNHB 4BZAA 3VTVA 4C7ZA 1WJUA 4GB9A 3EGRA 2WYQA 2I38A 3R3MA 1ET6A 2JX5A 1V2YA 3RNEC 3DVNU 2BGFA 2WXQA 4EKUA 1LO5D 3HUIA 2FIDA 5G5GA 1AWDA 1WX8A 3P4RB 3AEAB 2N1WA 3VDZA 2WXGA 3RZWC 2FUG1 1GPXA 2JVCA 2XEWA 2GBNA 1XEEA 3SFDB 3QQ8B 1FCCC 1V9JA 3RFZB 1B9RA 2V3SA 2KDBA 4RF1A 2G3QB 4A3PA 3B2GA 2PPHA 1QF6A 1WE7A 2K0PA 1WR1A 1EU3A 3U2SC 2GLSA 2KWVB 3RULA 1E10A 3H7PA 4AP4C 2FAZA 1ZP0B 4ZRKA 3ZKJC 2WGSA 2C5LC 1Q5WB 3DBHB 1K51A 1J7AA 1WX9A 1UNSA 1PFDA 4JIOU 2NTSA 2LGIA 2YLMA 2XBBC 1D5MC 3VUYA 4N58A 3DBRB 4MSMB 4FJYA 2LJIA 4WWMA 3RT3B 3JYUA 4BOSC 3X0WA 4W9GA 1I42A 1WX7A 2UYZB 2WWZA 2KQ7A 2KJHB 4DK5A 2X38A 2VH2A 2VRRB 2AEHA 1I4QA 3ZJUA 3QK0A 1FM0D 3TL5A 1HXYD 1J7CA 4P6VF 3DHHC 1WGYA 1XLPA 2QC8A 5CX3A 1AARA 2QJLA 2W54A 4EOYA 1L6UA 3DHIC 2DZIA 4A6QA 1ZPSA 3EUB2 2YEPF 4XYCA 1PDXA 2ASQA 3BINA 1IGCA 4RNAA 1SJED 3L13A 1IYFA 1YX5B 1LFDA 5HG2A 4M01A 4FJZA 3Q8AA 3UGBB 5BYSA 2IGHA 4REZA 3NRZA 2WXOA 4C4VB 3Q14C 2DZKA 3AE7B 4OHJA 2JXXA 2D3AA 1UGMA 1D5ZC 4OW0A 4EZLA 2CU1A 2WXKA 2MJDA 3H7SA 1IUEA 3QAQA 3BWUD 1TY2A 2HE7A 1ZUD2 1E8WA 3I9V1 2PIAA 3BIID 1F9JA 2AQ1B 4AWJA 4II2B 2C9WB 3BYYB 1IGDA 2KT7A 2LXAA 4LNOA 4LNKA 4ZOHC 3GZNI 4DQOC 4GDLB 4WURA 2CJOA 3ZNGC 3WA0A 1OEYA 2WXFA 2KTRA 5D94A 1SF0A 4W9JA 4ANWA 3P42A 2M1MA 2XK5A 1VZ7A 2WU5B 2TSSA 1HTOA 2KN4A 3KYDD 3URYA 5E6NA 1HEZE 2W55A 3NVVA 2N9PC 2Z0DB 3ZVVA 2J52A 1VJKA 1E7UA 2RR9A 1MHHE 5MPOA 3TSSA 5AUIA 4HKQA 2PJHA 1PYWD 4FA6A 1ACCA 1H8CA 1WSPA 5EE1A 2KZRA 2LVPA 4DBGA 4RFBA 1WGHA 3W1YA 2K3UA 1LXDA 3PREA 2B3AA 3M62B 3EFUA 4ANUA 2KDFB 5AZGA 1J8CA 2VZKB 4GU2A 1M94A 4C56C 4ITKA 1UH6A 2BYEA 5CHVC 4TKNA 4ARCA 2D3BA 2MA9B 3O13A 1V5OA 3TBLD 1R4NI 2Y5CA 4GDKB 1WJNA 4F8CB 2HDEA 1IPGA 2NPTA 1UZXB 3V6CB 2IO0B 1Q10A 4KGSA 1WGKA 3WCQA 4B9KA 1GB1A 3L4PA 2KDEB 4FN2A 4M8MA 3AMZA 2FE8A 1KRHA 5DPTA 3WANA 1CMXB 1FRRA 2N9KA 1QOGA 2QILA 4CQNA 2WHIA 1WMHA 2OEDA 2KYWA 2YVCA 3EC8A 3H9DA 2KC1A 3DCGA 1SXTA 1RYJA 4RGNA 3APCA 1UWMA 1EWCA 2R61A 3HM6X 4URKA 1AYFA 2L83A 4ZRPA 4JWUC 4OVVA 2QIEB 3IAM1 1XQQA 1PUTA 1TIFA 4KSKC 2KVRA 2NR2A 2WXNA 2LD9A 2WXRA 3D32A 1VLBA 2LGYA 4XWTA 3SDLC 4LNNA 2MW5A 3B08A 3R7RA 1YJ1A 4RH6A 3HVDA 4WAAA 3OWEB 1QOBA 5L83A 4HPMB 1F52A 4N59A 3DDCB 3LYYA 1ZXHA 3VH4B 3I5JC 4MT5A 4RCOA 4ZRIA 2CHXA 2INPE 2O6VD 2DZMA 2DAFA 3PSEB 4FHKA 2MBHA 4TMAB 4WH4A 3S2AA 3T9LA 3ABVB 1ZDXA 3RMKC 3P4QB 3TUOA 4I6PA 5LXIB 3GB1A 4D2KA 1N62A 2E3TA 4WIPA 2V4IB 1WXQA 2J0MA 2MP2B 4WWOA 3U7ZA 1F77A 4XWWA 4GSWA 5HFYA 1JCKB 3VHTC 3KWLA 4LJOB 1T0SC 2KHWB 4NJ6A 3ZJVA 1OGWA 1NI3A 1UWXA 3AE8B 1CQVA 2VH1A 3BVMA 2LHEA 5DCNA 4FXCA 3OJ4B 4C00A 2LGDA 1HZ5A 3BYTB 2ZJDA 1C4PA 2LVOA
chains in the Genus database with same CATH topology
2CU3A 3P4SB 5BMHA 1FEHA 2JXTA 2Q5WD 1F2RI 1KH0A 4O1NA 1JWBD 2Y3AA 3FILA 5BYRA 1XLOA 1V97A 5HI1A 3V3XA 4JX1C 3AH7A 2WXHA 1YJIA 3P1MA 1ZDVA 4UDUC 1SE2A 3W1SA 1YN3A 2WP9B 1L0XB 4OVZA 2W82A 3VR9B 2BB5A 4USAA 2BT6A 2XN9C 4YTNB 5BMGA 2LEKA 1JWSD 2AQ3B 2W3SA 5EE3A 4C7ZA 2ONQA 1FNUA 3EGRA 1GOZA 1I4GA 2E6XA 2I38A 1DOYA 1ET6A 2JX5A 2LHDA 3IXSA 4KGTA 1BMLC 3VR8B 2QSDA 4A8XC 2OHFA 4KX6B 2WXQA 2ZW0A 5BMIA 2FBWB 1LO5D 4OZCA 1RFKA 5LNK1 2KAJA 1XCTL 2BW2A 2WDRB 3HUIA 3PO0A 1YJJA 1JWMD 3VRBB 5G5GA 1AWDA 3P4RB 3AEAB 3ZJTA 1IBXB 3NZ3A 4LLGM 1N5WA 2WXGA 2L32A 5H8YE 1DOXA 1L4DB 3TEXA 2FUG1 4NJCA 1CJEA 2HTME 4PT5A 1GPXA 1RWSA 2AQ2B 2G1EA 3U52E 1QOFA 2PLPA 3FAHA 1N63A 2GRIA 4L1BA 2MEKA 2BS3B 3VRAB 4DXFA 4YXDB 1TYGB 3BVGA 4HROA 1XEEA 3SFDB 4M0WA 1FCCC 2RDHA 3RFZB 1B9RA 1VZ8A 1XCQL 3W9CB 2WXPA 4RF1A 1L4ZB 3B2GA 4RGMA 1QF6A 2WXLA 4GLSC 2K0PA 1EU3A 3AE2B 3U2SC 4YSXB 1PGBA 4C80A 2I2YA 1E10A 2JZPA 1SEBD 2BB6A 3IT4B 3NVYA 3Q69A 5D3IB 1FCLA 3DWMA 1CK1A 1ZP0B 3AE9B 2BYTA 2DYOA 3PZ8A 1K51A 2KQ4X 2WNMA 3MHZA 4IKGA 3TEWA 1J7AA 1UNSA 1TS5A 1QILA 1PFDA 1NEKB 2ACZB 1ENFA 5G5HA 3KWVA 1L0VB 1YN4A 2NTSA 2J53A 2LGIA 1TKGA 1KLGD 3AN1A 1P7EA 1E7PB 1D5MC 1J7BA 4YT0B 2DWQA 4N58A 2L52A 1GB4A 5TSSA 4XE0A 2LJIA 3RPFC 4NAWB 4WWMA 5FR3A 2N9LA 3SEBA 1V1PA 3HRDD 2BS2B 1V1PB 1SE4A 1N5XA 1T5XD 2J4XA 1D4BA 2IDYA 1JQ4A 2X38A 4IOIE 4US8A 3AEEB 1I4QA 1T6BX 3ZJUA 1HA5A 1YMHE 2XNAC 1FM0D 4TSSA 1UUPA 2WDQB 1HXYD 4B0EA 1WWTA 2DYMA 1J7CA 1ZXIA 2L1AA 1C77A 4HEA1 4J3OD 4P6VF 2GB1A 1JW9D 1AW7A 1C4AA 1PGAA 4L2YA 1XLPA 2LUMA 1BUIC 3Q8EA 4LK0M 1V1OA 3AM9A 1OQRA 3BK2A 1D6EC 2V0GA 2ON8A 4JE3B 3J9CA 2QJLA 3MJ5A 4H2AA 4ZYSA 2W54A 3NUHB 1PGXA 2V3NA 4IDIA 1L6UA 3AEGB 1V8CA 4P16A 3UI3A 4ZRQA 1QQRA 4A6QA 1ZPSA 2PVOD 3EUB2 2YEPF 3B9JA 1TS2A 2JYTA 2K22A 1PDXA 2WU2B 1JWUD 3P63A 3T3OA 1C76A 3Q8FA 5I4DA 1IGCA 4XDCA 4RNAA 4YWGG 1SJED 5FKAC 5AUKA 3T3NA 2JSVX 2YEPB 5HG2A 1P7FA 4A90A 1HQRD 1EWYC 3P4PB 3Q8AA 1HZ6A 1TY0A 3AEDB 5BYSA 4KGRA 2GI9A 2IGHA 4REZA 3NRZA 2WXOA 3TEZA 1FD6A 3DWGC 3CIRB 4KKJA 1TS4A 3AE7B 4OHJA 1EU4A 3R2IA 1JALA 2Z8LA 1IBXA 5T8IA 1FNVA 2BTEA 4JWSC 1D5ZC 4B0MA 2NMQA 4OW0A 2WXKA 3B2FA 1TZOA 2MJDA 4MH8A 1TKEA 3AEFB 3AE1B 1IUEA 2IGGA 1C78A 3CWIA 3NVWA 3BWUD 1TY2A 1YQ4B 1N61A 4HKZE 1WRIA 1ZUD2 5H92C 3E56A 4NZLB 3I9V1 2PIAA 4ARIA 1ZE3D 3LXFA 1FMAD 3BIID 2AQ1B 1KLUD 3BYYB 1ESFA 1IGDA 1FRDA 4DQOC 4ZOHC 3LB8C 1F2RC 1SJHD 4GDLB 4LTUA 1B1ZA 4WURA 1YN5A 2CJOA 2WXFA 4A9AA 1EM7A 1K53A 1K52A 1I4PA 1SF0A 3H8HA 4NAMA 1SB3C 1ET9A 3P42A 5GXGB 3W5UB 1VZ7A 2WU5B 2TSSA 2PKOA 1JRPA 1YNTE 1WYGA 2KN4A 3URYA 5D3DA 3AE3B 4DXGA 3BZDB 1BXTA 2WXMA 3AE6B 1HEZE 1XF5L 2W55A 1MHXA 3NVVA 4WQMA 5C2TB 1JWAD 1E0ZA 5BYQA 4TQ0A 5D7GA 2J52A 3VQIA 1VJKA 3AE5B 2ZW1A 1MHHE 2RMMA 2D5GA 3KQ4A 5MPOA 3TSSA 1KFYB 5AUIA 4HKQA 2M56B 2B76B 2PMVA 4OZBA 3ZGZA 1PYWD 2G9HD 1NVID 2BS4B 1ACCA 1JMLA 4N6EB 2MJEA 1WSPA 3PZ7A 5EE1A 1SSNA 1Y56A 3MP9A 1TKYA 2CJNA 2KDMA 2QMTA 1DOIA 4OZAA 4RFBA 1C9FA 2NTTA 2SAKA 1OFFA 4YTMB 2K3UA 2WQYB 2M0AA 1VDVA 2WXIA 3ETRA 1K50A 3FC4A 2EKIA 3W2DA 2SEBD 2WDVB 3ZYYX 2VZKB 3AE4B 3KLSX 4C56C 2LMCA 1XLNA 1KF6B 2BBCA 4L23A 4ITKA 4WAFA 1TJEA 1CZPA 1FO4A 1DYQA 1SBBB 2V3PA 4ARCA 3NVZA 1VZ6A 4US9A 3O13A 3V05A 4MM3B 4TQ1A 2Y5CA 4GDKB 4Q2JA 2JQRB 2HDEA 1FFVA 1I4RA 1Q10A 2DLBA 4KGSA 3BVZA 1ROEA 1FXAA 3AECB 1WGKA 2N0SB 3WCQA 1GB1A 4ZHOA 3L4PA 1M4VA 2H89B 2IGDA 2QEJC 2K5PA 1MI0A 3AMZA 2FE8A 3FILB 2W3RA 1KRHA 1YQ3B 3R8BA 2DBYA 4RGTA 3N9YC 1E6EB 1FRRA 1L0YB 1SE3A 2N9KA 1AN8A 1QOGA 4R3DA 2QILA 2K9XA 1RM6C 4CQNA 5EE9A 1QLBB 2IPKD 2OEDA 2LFIA 2PTLA 3IT6B 1D5XC 2KMMA 1SXTA 1RYJA 1C4CA 4RGNA 2VZKD 2RDGA 3MFGA 1MVKA 1UWMA 2WS3B 1JROA 1EWCA 1FFUA 2R61A 4RF0A 1SIJA 1NYQA 4KKIA 1AYFA 2L83A 3IAS1 4ZRPA 2M19A 1F0ZA 4JWUC 3AEBB 4AS1A 3Q8BA 2QIEB 3IAM1 1PUTA 4RGOS 1DGJA 3TEYA 5JXVA 5EE0A 1I4HA 5C3JB 2KACA 3AV8A 2WXNA 3AB5A 2WXRA 1VLBA 4XWTA 3U4EG 3GP7A 1OQQA 4YSYB 4JPSA 2PVGC 4RH6A 3W5VB 3HVDA 1XLQA 1XO3A 3NS1A 3OWEB 1QOBA 4C7YA 1UGJA 1TS3A 3SFEB 4N59A 2Y5PA 1MPEA 1T3QA 1ZOYB 3LYYA 1ZXHA 1A70A 5HHDG 4MT5A 4RCOA 3Q8CA 1VR9A 4XDDA 2INPE 1XXGA 2KWDA 2EELA 2JU6X 1C79A 2MJ3A 1R7SA 4HRSA 4TMAB 4WH4A 2PW9A 1QT9A 3ABVB 1ZDXA 2RPVA 3ZQ4A 5E6JA 2H88B 3P4QB 4HJGE 3TUOA 2WXJA 1FNWA 1FXIA 3GB1A 4D2KA 1N62A 2E3TA 4WIPA 2V4IB 3E9SA 1I4XA 1E9MA 5FK9C 3MC0B 4YSZB 1WXQA 1GAQB 2N7JA 2WLBA 3U7ZA 1F77A 3C8YA 4XWWA 1L5PA 1N60A 2JYEA 4MACA 2ICIA 1STEA 1QKZA 3SR6A 1KTKA 5HFYA 1JCKB 3KWLA 3I57A 3BK1A 2JWUA 2INNE 4A55A 3ZJVA 1VRAB 4ZHPA 1NI3A 1UWXA 3AE8B 1CQVA 3BVMA 2LHEA 3EA6A 2AX5A 1FIQA 1NYRA 4FXCA 4AQ7A 1NENB 3R2TA 2IJ0A 4YTPB 4EE2A 1HZ5A 2MH7A 1QOAA 3GS2A 2J42A 1I7HA 3BYTB 3HVZA 1C4PA 1L6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7B A;  4YT0 B;  2CU3 A;  3P4S B;  4LTU A;  2DWQ A;  2KMM A;  2Q5W D;  1RYJ A;  2CJO A;  4N58 A;  2L52 A;  1JWB D;  4A9A A;  1SF0 A;  1UWM A;  3LB8 C;  3RPF C;  2WS3 B;  1JRO A;  1SB3 C;  4WWM A;  1FFU A;  1XLO A;  5GXG B;  1SIJ A;  3W5U B;  1V97 A;  3HRD D;  1NYQ A;  2BS2 B;  4JX1 C;  1AYF A;  2L83 A;  3AH7 A;  2WU5 B;  2M19 A;  2PKO A;  1JRP A;  1YJI A;  3AEB B;  4JWU C;  1F0Z A;  1N5X A;  2QIE B;  3P1M A;  1WYG A;  1PUT A;  3AE3 B;  1JQ4 A;  2WP9 B;  1DGJ A;  3AE6 B;  3AEE B;  4US8 A;  5EE0 A;  3VR9 B;  2W55 A;  3NVV A;  5C3J B;  4USA A;  2BT6 A;  3AV8 A;  4WQM A;  4YTN B;  1FM0 D;  1JWA D;  5C2T B;  2LEK A;  1E0Z A;  2WDQ B;  2W3S A;  3AB5 A;  5EE3 A;  4C7Z A;  1VLB A;  1VJK A;  1WWT A;  3AE5 B;  1J7C A;  1E7P B;  1OQQ A;  1KFY B;  1ZXI A;  4P6V F;  4YSY B;  5AUI A;  5MPO A;  2M56 B;  2B76 B;  1JW9 D;  1DOY A;  2JX5 A;  1NVI D;  2BS4 B;  2PVG C;  1XLP A;  3W5V B;  4N6E B;  2MJE A;  5EE1 A;  3VR8 B;  3AM9 A;  1OQR A;  2OHF A;  1XLQ A;  1TKY A;  2CJN A;  1DOI A;  4YTM B;  1XO3 A;  3NS1 A;  4KX6 B;  1QOB A;  4C7Y A;  2QJL A;  2FBW B;  3SFE B;  4N59 A;  1OFF A;  1RFK A;  1T3Q A;  1ZOY B;  2KAJ A;  2W54 A;  2WDR B;  3HUI A;  1YJJ A;  3PO0 A;  2WQY B;  1L6U A;  3AEG B;  1VDV A;  1A70 A;  3VRB B;  1V8C A;  5G5G A;  1AWD A;  3ETR A;  3P4R B;  2PVO D;  2EKI A;  3AEA B;  3FC4 A;  3EUB 2;  2MJ3 A;  1R7S A;  1N5W A;  3B9J A;  4HRS A;  1DOX A;  2WDV B;  2K22 A;  5H8Y E;  3ZYY X;  1PDX A;  2WU2 B;  3AE4 B;  3P63 A;  1QT9 A;  1CJE A;  3ABV B;  2HTM E;  1GPX A;  1RWS A;  1XLN A;  1KF6 B;  2G1E A;  1QOF A;  4ITK A;  1TJE A;  1CZP A;  5AUK A;  2H88 B;  3FAH A;  1FO4 A;  3P4Q B;  1N63 A;  3VRA B;  2BS3 B;  4YXD B;  3NVZ A;  1TYG B;  4HRO A;  1EWY C;  3P4P B;  4US9 A;  3SFD B;  3AED B;  1FXI A;  1B9R A;  1N62 A;  2E3T A;  3W9C B;  2Y5C A;  3NRZ A;  2JQR B;  1E9M A;  3DWG C;  3CIR B;  1FFV A;  3AE7 B;  4YSZ B;  3B2G A;  1QF6 A;  1WXQ A;  1JAL A;  1GAQ B;  2WLB A;  1ROE A;  1FXA A;  1L5P A;  1N60 A;  1WGK A;  2N0S B;  3AE2 B;  3AEC B;  4JWS C;  3WCQ A;  4YSX B;  4ZHO A;  3L4P A;  4C80 A;  4IDI A;  1E10 A;  3SR6 A;  3B2F A;  2H89 B;  2MJD A;  3NVY A;  3DWM A;  3KWL A;  1TKE A;  3AEF B;  2K5P A;  3AE1 B;  1ZP0 B;  3AMZ A;  3AE9 B;  1IUE A;  2W3R A;  3CWI A;  3NVW A;  1KRH A;  1YQ4 B;  4ZHP A;  1YQ3 B;  1J7A A;  1N61 A;  1NI3 A;  1WRI A;  3AE8 B;  2DBY A;  1ZUD 2;  5H92 C;  1E6E B;  1FRR A;  2PIA A;  2AX5 A;  1QOG A;  1FIQ A;  1NYR A;  2K9X A;  1RM6 C;  1PFD A;  3LXF A;  1NEN B;  1FMA D;  1NEK B;  2ACZ B;  4FXC A;  4YTP B;  1QLB B;  3BII D;  5EE9 A;  5G5H A;  1L0V B;  2MH7 A;  1QOA A;  1TKG A;  1I7H A;  3AN1 A;  3HVZ A;  1FRD A;  4ZOH C;  1L6V A; 
#chains in the Genus database with same CATH topology
 4LJP B;  2CU3 A;  3ZRC A;  3DBL I;  2Y3A A;  2CHW A;  2IND C;  3V3X A;  4GXB A;  4JX1 C;  3DBH I;  4AOF A;  4UDU C;  4BKS D;  4DHZ B;  1R4M I;  3VR9 B;  1V81 A;  3JVZ X;  4YTN B;  4HLE A;  2LEK A;  1E90 A;  2ONQ A;  1FNU A;  4MEL A;  1GOZ A;  3L54 A;  1MG8 A;  2E6X A;  4KGT A;  2J7Q B;  2JPH A;  3V62 A;  4A8X C;  1Y8R C;  2ZNV C;  1T0Y A;  4HPP A;  4KX6 B;  3EHV A;  4MJS A;  2FBW B;  4OZC A;  4F7Z A;  1SE9 A;  5LNK 1;  2BW2 A;  3PO0 A;  1JWM D;  1WRD B;  4EEW A;  2KKC A;  5FR6 A;  3U30 A;  2KLG A;  3L0W B;  3ZJT A;  5IP4 D;  3NZ3 A;  4HK2 A;  1IBX B;  5AZH A;  4MDK E;  5H8Y E;  4NJC A;  2G1E A;  3U52 E;  2INC C;  1D3Z A;  3A9K A;  3FAH A;  1N63 A;  2GRI A;  3A9K B;  1TYG B;  3BVG A;  4M0W A;  2RDH A;  1R4N B;  2D07 B;  3AI5 A;  3RNB C;  4RGM A;  1WXV A;  1ISN A;  2PEA A;  4GLS C;  3KVF B;  4EZJ A;  4C80 A;  2I2Y A;  5KHQ A;  2JY6 A;  2JZP A;  3ZXR A;  2AYO B;  3Q69 A;  3JSV B;  1OEY J;  2KWC A;  3LJ3 A;  3AE9 B;  2BYT A;  1G6J A;  3RD2 A;  2EMT A;  1WR6 E;  1QIL A;  2ZPY A;  5J2R A;  5G5H A;  4WJN A;  1L0V B;  1YN4 A;  2J53 A;  3ML9 A;  1KLG D;  2HJ1 A;  4GN1 A;  2KAN A;  3V6E B;  1WZ3 A;  4DHJ D;  3C19 A;  2L52 A;  5LXH A;  1VCB A;  3A4R A;  2JZZ A;  4NAW B;  2N9L A;  2NBU A;  3AXC A;  2M8S A;  1GNU A;  3TIX A;  3WAP A;  1T5X D;  5E6P A;  2IDY A;  1JQ4 A;  3AEE B;  3KH0 A;  1T6B X;  2FCN A;  3WIM A;  3Q3N C;  3EFC A;  4TSS A;  3V61 A;  1WWT A;  2IO1 B;  1A5R A;  1WJ4 A;  1YOV B;  2DYM A;  1ZXI A;  2L1A A;  4HEA 1;  4J3O D;  2GB1 A;  4IWO A;  1AW7 A;  1J19 A;  4MGK E;  4E71 A;  1C4A A;  1PGA A;  4HDQ A;  1TTN A;  1BUI C;  4BKT A;  3Q8E A;  4LK0 M;  3DPD A;  2GOW A;  2JRI B;  1WH3 A;  4ZYS A;  3NUH B;  2V3N A;  1RAX A;  3TMP B;  3CST A;  4P16 A;  1WIA A;  3UI3 A;  2PVO D;  3KW5 B;  4W9F A;  3QC8 B;  4W9K A;  4BOZ B;  1P9D U;  1JWU D;  3T3O A;  1C76 A;  2D10 A;  2WX0 A;  5FKA C;  3T3N A;  2L7R A;  2JSV X;  4A90 A;  1HQR D;  4GMV A;  2CR5 A;  3TEZ A;  1TGZ B;  1FD6 A;  2K25 A;  3CIR B;  5C23 A;  3FKY A;  1EF5 A;  1EU4 A;  3ZUN A;  1JAL A;  2BTE A;  2L0T A;  4JWS C;  1ZKH A;  5CTR C;  2LJ5 A;  1OQY A;  2MBE A;  3IG3 A;  3AEF B;  1BT0 A;  3ZO5 B;  2CKH B;  5JHB A;  1E7V A;  3CWI A;  3NVW A;  1YQ4 B;  1KJT A;  3LXF A;  1FMA D;  4WJQ A;  4ANV A;  3PS6 A;  1KLU D;  1PQS A;  1ESF A;  1FRD A;  2KO3 A;  3LB8 C;  1F2R C;  1SJH D;  3DBL B;  1P98 A;  1YN5 A;  1EM7 A;  1K52 A;  1I4P A;  3QAR A;  1ET9 A;  2JT4 B;  5GXG B;  2LXC A;  3I3T B;  2PKO A;  3Q6B A;  1V49 A;  1E8X A;  3A33 B;  5D3D A;  1SGH A;  3BZD B;  4AJY B;  1BXT A;  1R4M B;  3AE6 B;  1JWA D;  2M17 A;  3U8Z A;  2JUO A;  4P1B C;  4EFO A;  3ZTD A;  3QWZ B;  3AE5 B;  1KOT A;  4JLC A;  2MLB A;  3KQ4 A;  4NPN A;  3ZGZ A;  3KUZ A;  4ANX A;  1GC7 A;  2MJE A;  1SSN A;  3SD5 A;  3MP9 A;  4F1S A;  2CJN A;  2KDM A;  1C9F A;  3CMM B;  2M0A A;  3HIZ A;  2MQJ A;  2BWF A;  2L05 A;  1K50 A;  2EKI A;  3APD A;  2DX5 B;  3W2D A;  4XC2 A;  1UBI A;  2IBI B;  3ZYY X;  4HXD A;  3AE4 B;  2LMC A;  1XLN A;  2BBC A;  4L23 A;  4WAF A;  3RCZ A;  1GC6 A;  4K81 A;  1SBB B;  2V3P A;  3JW0 X;  1L2N A;  1WXS A;  5L95 C;  1HTQ A;  3ZRF A;  3V05 A;  4MM3 B;  3ZNI D;  3CSF A;  4IUM B;  4Q2J A;  2DLB A;  1ROE A;  4IC7 B;  3KYC D;  4W9E A;  1FXT B;  2MX2 A;  1WGD A;  1HE8 A;  3VXW A;  1MI0 A;  2KD0 A;  2EMS A;  4HWI B;  3DVG Y;  4OVU A;  2DBY A;  3N9Y C;  1SE3 A;  4C4V A;  2QDF A;  2V9H A;  2KFJ A;  2O6V B;  2PTL A;  4LNI A;  1WZ0 A;  3IT6 B;  2KVZ A;  4IW0 A;  3NG0 A;  4K1R B;  4HVB A;  1MVK A;  2LAS A;  5JZE B;  4MSQ B;  1JRO A;  4NQK E;  1FFU A;  1SIJ A;  2BWE S;  2ZNV B;  5AZF A;  4CO7 A;  1F0Z A;  3AEB B;  4W9H A;  2BKR B;  2MHJ A;  2KAC A;  2N1V A;  4GDL A;  4BBN F;  1OQQ A;  3RYT A;  4IM3 A;  4S0R A;  4BBN C;  3WAM A;  4A20 A;  2ZCC A;  4NQL B;  5IOI A;  3LDZ E;  1A70 A;  1C3T A;  3Q8C A;  1VR9 A;  4XDD A;  2KWD A;  1WGG A;  2EEL A;  1C79 A;  2N9X A;  3GE8 C;  3RN9 C;  4BKG A;  2PW9 A;  2ZEQ A;  2PE6 B;  2EKE C;  3ZQ4 A;  5E6J A;  3DVN V;  1EO6 A;  4HJG E;  1FNW A;  1FXI A;  2KWU B;  1I4X A;  4MGY E;  2UWQ A;  2JWZ A;  4YSZ B;  1GAQ B;  2N7J A;  1L5P A;  5JH5 C;  1Z2M A;  1K8R B;  1STE A;  3PRP B;  1QKZ A;  2G4D B;  3QJZ A;  4KDL B;  4P7I A;  4A55 A;  2INN E;  1WYW B;  4GDK A;  2GBM A;  2AX5 A;  3EA6 A;  4AQ7 A;  2MBB B;  4YTP B;  3L10 B;  2O2V B;  3ENE A;  3HVZ A;  3GE3 C;  2JXT A;  4PS3 A;  2BYF A;  1WGR A;  5BYR A;  3CF6 E;  2KOX A;  2K8B A;  2WXH A;  1YJI A;  3P1M A;  1ZDV A;  2WX1 A;  2PE9 A;  2WP9 B;  3W1S C;  3NZU A;  2W82 A;  4USA A;  2XN9 C;  5BMG A;  4IM0 A;  2W3S A;  4JQW C;  3ZDT A;  2REX A;  5DPR A;  3IFW B;  3RNC C;  3QIJ A;  1I4G A;  4PYZ A;  5J17 A;  3HM3 A;  1BML C;  3VR8 B;  1V80 A;  1EF1 A;  2OHF A;  2GBR A;  2ZCB A;  1RFK A;  2KAJ A;  2WDR B;  1YJJ A;  1YX6 B;  2Z0E B;  4DXA B;  3VRB B;  1MG4 A;  4DHJ B;  1N5W A;  1DOX A;  2L32 A;  5J18 A;  3O65 B;  4PT5 A;  1RWS A;  2PLP A;  4L1B A;  3VRA B;  2BS3 B;  3Q3M C;  1VZ8 A;  3W9C B;  2FCS A;  1V86 A;  3HHM A;  2M0X A;  2N4F A;  3VTU A;  4AUQ C;  3MJW A;  2WXL A;  3ZIM A;  3PV1 A;  3AE2 B;  4YSX B;  1PGB A;  4MH0 E;  4M02 A;  4LNF A;  3NOB A;  2IY1 B;  2DYO A;  3PZ8 A;  2KQ4 X;  2WNM A;  4IKG A;  2BYV E;  3TEW A;  4BAX A;  3UQB A;  1TS5 A;  1NEK B;  2ACZ B;  3OG5 A;  1ENF A;  2X8X X;  3KWV A;  2MP2 A;  4KV2 A;  1P7E A;  4YT0 B;  2KDI A;  2BQQ A;  4XE0 A;  3RPF C;  2K6Q A;  3QCA A;  4RMA A;  1V1P A;  4LDT D;  3HRD D;  2BS2 B;  1V1P B;  1LM8 B;  2J4X A;  2MRP A;  3KUD B;  1HA5 A;  4HCN B;  2XNA C;  3H1U A;  4B0E A;  3NY5 A;  2KMA A;  3VUW A;  3PZD A;  4KIK B;  1T0Q C;  4L2Y A;  2A5U A;  2LUM A;  2CS4 A;  1OQR A;  2DZJ A;  5DPS A;  3A1Q B;  3AU4 A;  2ON8 A;  1IP9 A;  2JF5 A;  4JE3 B;  3J9C A;  3SHQ A;  1OTR B;  1PGX A;  4IDI A;  3OLM D;  4FBJ B;  1QQR A;  3I63 C;  2C60 A;  4BFR A;  2V1Y A;  3B9J A;  4II3 B;  2HTH A;  3Q8F A;  5I4D A;  4XDC A;  2I1J A;  2AWT A;  4NNJ B;  2YEP B;  1P7F A;  3P4P B;  1TY0 A;  1UEL A;  4KGR A;  4KSL C;  2KK8 A;  4RM8 A;  3N1Y C;  3VUX A;  4DWF A;  1U4A A;  4KKJ A;  1TS4 A;  4ACF A;  1UBQ A;  4AJW A;  4HDO A;  2Z8L A;  1IBX A;  5T8I A;  4M00 A;  1FNV A;  2K1F A;  4BVU C;  2KQS A;  2NS5 A;  1WI0 A;  4W9D A;  5G55 A;  4B0M A;  4DHZ E;  1TZO A;  4MH8 A;  2MBO A;  3AE1 B;  1C78 A;  2OJW A;  5LLI A;  4HKZ E;  2D2Q A;  5H92 C;  4XZ4 A;  3E56 A;  4NZL B;  3UIN B;  4DDG D;  4B6W A;  1TZ1 A;  3X23 A;  2IO3 B;  4LTU A;  1B1Z A;  2C7M B;  3JSV A;  1QZE A;  4GGQ A;  1MFW A;  4A9A A;  1K53 A;  4NAM A;  3W5U B;  3RNA C;  4K7S A;  5BO4 B;  4P1C C;  1YNT E;  4DXG A;  2WXM A;  1MHX A;  2D11 A;  5C2T B;  5BYQ A;  4TQ0 A;  5DPW A;  3A9J B;  2RMM A;  2D5G A;  1KFY B;  1S3S G;  3U7D A;  2PMV A;  4NAW A;  4OZB A;  4IM2 A;  1NVI D;  2KNB A;  2BPS A;  2LI5 A;  1KLV A;  3PZ7 A;  1TKY A;  4OZA A;  4ICU A;  2QMT A;  2G4S A;  2SAK A;  3AUL A;  2MBQ A;  2WXI A;  1Z5S B;  3FC4 A;  3N32 A;  3KLS X;  1KF6 B;  1CZP A;  1DYQ A;  3V60 A;  4US9 A;  1I35 A;  1E5W A;  3UQA A;  2ZPN A;  4TQ1 A;  2KX3 A;  3QHT A;  5IN7 A;  1FFV A;  1I4R A;  3BVZ A;  2RPQ A;  4ZYN A;  1FXA A;  2RGF A;  3SU8 X;  1X1M A;  2H89 B;  4PS7 A;  2IGD A;  2QEJ C;  3FIL B;  3C0R B;  1YQ3 B;  3R8B A;  1LQB A;  3PPA A;  4RGT A;  2NCN A;  3PRM B;  3MC9 A;  2KFK B;  1EUV B;  1RM6 C;  5EE9 A;  2IPK D;  3VFK A;  1E8Z A;  2LFI A;  2MSE D;  5GMV A;  2GBK A;  4GOC A;  1RRB A;  3ZTC A;  4RF0 A;  4MGI E;  1P1A A;  1WJ6 A;  1NYQ A;  4KKI A;  2M19 A;  2IYD B;  3NJT A;  4RGO S;  3TEY A;  2K6D B;  1I4H A;  3AV8 A;  4HCP B;  3AB5 A;  3U4E G;  3M63 B;  4KZC A;  3GP7 A;  2L00 B;  1NDD A;  2R2Q A;  3TCA A;  1UF0 A;  1XLQ A;  1XO3 A;  3NS1 A;  4C7Y A;  1TS3 A;  2J0K A;  2DEN B;  1MPE A;  1T3Q A;  2LZ6 A;  1FPY A;  3UIP B;  2C7H A;  3Q2A C;  3L08 A;  2MJ3 A;  1ZGU B;  1Q1O A;  3N3K B;  4HRS A;  1QT9 A;  3H7P B;  2RPV A;  3PHW B;  3OAW A;  1V6E A;  5C1Z A;  4IWQ A;  2WXJ A;  3UIO B;  3Q3J A;  5IKC M;  1XD3 B;  1GUA B;  1E9M A;  2ICI A;  2RD0 A;  3KUC B;  3K9O B;  1KTK A;  3SR6 A;  2DHZ A;  3VVW B;  3I57 A;  3BK1 A;  2JWU A;  1VRA B;  4ZHP A;  3DQV A;  4ASW C;  4MM3 A;  1FIQ A;  1NYR A;  1NEN B;  3QA8 A;  2KJR A;  4EE2 A;  3PRZ A;  2MH7 A;  1QOA A;  2MWS B;  2KC2 A;  1I7H A;  2N7D A;  3TJP A;  2L0F A;  1L6V A;  2FCM A;  2Q5W D;  3WAO A;  1F2R I;  2L8J A;  1XLO A;  2LRU A;  4K7U A;  1WY8 A;  1V97 A;  5HI1 A;  4K7W A;  4NY0 A;  3WAL A;  2K39 A;  4JGH B;  1SE2 A;  3DVG X;  1L0X B;  2O6V A;  5IAA C;  1JWS D;  4MEM A;  2AQ3 B;  5EE3 A;  2LWP A;  1KM7 A;  1WE6 A;  2QHO A;  1DOY A;  2LHD A;  3IXS A;  4G11 A;  3ONS A;  2KTF A;  2QSD A;  2FCQ A;  4K3B A;  1NI2 A;  2ZW0 A;  5BMI A;  1XCT L;  2Y5B B;  2ZVN A;  5AEK B;  3BY4 B;  4YL8 A;  4QAY A;  4LLG M;  2RSU A;  1L4D B;  3TEX A;  3PTF C;  5EDS A;  1CJE A;  2HTM E;  2AQ2 B;  1QOF A;  4LDT B;  1WXM A;  5HKH A;  3T8M A;  1V5T A;  3OJ3 A;  2MEK A;  4DXF A;  4YXD B;  4HRO A;  2DYB A;  4ZRJ A;  1XCQ L;  2WXP A;  2FIF A;  2FNJ B;  1L4Z B;  3R7Q A;  5D2M B;  4MGZ E;  1WM3 A;  2AL3 A;  4FHJ A;  1LGR A;  1SEB D;  2BB6 A;  2BF8 B;  3IT4 B;  3NVY A;  5D3I B;  1FCL A;  3DWM A;  1CK1 A;  2KTR B;  5D6J B;  3MHZ A;  3DOW A;  2XK5 B;  4BKS A;  1JRU A;  4IG7 B;  2Z59 B;  5KHO A;  2D3C A;  2DNF A;  2RDB C;  1TKG A;  3AN1 A;  2BKF A;  3DHG C;  1E7P B;  1J7B A;  2HJ8 A;  2DWQ A;  2DAJ A;  3HK0 A;  1GB4 A;  5TSS A;  2NVU I;  5FR3 A;  4G0N B;  3SEB A;  4J6I A;  3MHS D;  3VH3 B;  1SE4 A;  4DDI D;  1N5X A;  3RUI B;  3N20 C;  1D4B A;  2O2V A;  4IOI E;  4US8 A;  1YMH E;  1UUP A;  2WDQ B;  2GMI C;  3VAW A;  1C77 A;  2KJ6 A;  2KMC A;  1JW9 D;  1J0G A;  4WQO B;  4GIV A;  4LCD E;  1VD2 A;  2M4N A;  1V1O A;  3AM9 A;  3BK2 A;  1D6E C;  2N7E A;  2V0G A;  3B0A A;  5E6O A;  3MJ5 A;  4H2A A;  5TR5 A;  3AEG B;  1H4R A;  1V8C A;  4ZRQ A;  2NPT B;  3H6N A;  4IWP A;  3N1Z C;  1TS2 A;  2JYT A;  2K22 A;  3P63 A;  2WU2 B;  4RM9 A;  4FUL A;  4XX5 A;  2KN5 A;  4YWG G;  4WWN A;  5AUK A;  4KDI C;  4FAD A;  3M95 A;  2V4L A;  1EWY C;  1HZ6 A;  3AED B;  3ZXV A;  2GI9 A;  3ZNZ B;  3DWG C;  4G50 A;  1C1Y B;  4XGA B;  4EUT A;  3EEC A;  1WMH B;  5IO9 A;  2LUE A;  3R2I A;  3K9P B;  2NMQ A;  2FUH B;  3B2F A;  3RNG C;  3Q3F A;  1TKE A;  4B95 A;  2IGG A;  1GG3 A;  1N61 A;  1WRI A;  4X57 B;  4ARI A;  1ZE3 D;  3P2B A;  2L76 A;  2LGX A;  4M8N A;  5IA7 A;  2C7N B;  3PLU A;  3MC8 A;  2JZ3 B;  4FJV B;  4A3O A;  1UD7 A;  3H8H A;  1SB3 C;  4TV3 A;  1JRP A;  2IY0 B;  3ECI A;  1WYG A;  1RFA A;  3IHP C;  3N30 A;  3AE3 B;  4I6N B;  1XF5 L;  3ALB A;  4WQM A;  3ML8 A;  1E0Z A;  5D7G A;  1YQB A;  3PGE A;  3VQI A;  4CHK A;  4TUU A;  2ZW1 A;  3UF8 A;  2M56 B;  2B76 B;  2LRW A;  3B1L X;  2G9H D;  2BS4 B;  1JML A;  3L16 A;  4N6E B;  3GOE A;  1Y56 A;  4EZK A;  1DOI A;  3ZLZ A;  4N9F 4;  1T0R C;  2BVC A;  1F1H A;  2NTT A;  1S1Q B;  1P3Q U;  1OFF A;  4YTM B;  2WQY B;  1VDV A;  3ETR A;  2R2O A;  2SEB D;  2WDV B;  2GBJ A;  3PVL A;  4KIK A;  1TBE A;  3ZW3 A;  3ZDM C;  4K3C A;  3APF A;  1TJE A;  1FO4 A;  3A1Q A;  3NVZ A;  1VZ6 A;  2A4Z A;  5G2N A;  3Q3O C;  1XT9 B;  1TT5 B;  2JQR B;  1P0R A;  4WJP A;  4E74 A;  1N6Z A;  3GZN B;  3AEC B;  2N0S B;  4ZHO A;  1YIW A;  1M4V A;  4WJO A;  3DBS A;  2K5P A;  4WWP A;  5CHW A;  3NHE B;  2W3R A;  4ZDV A;  2KXJ A;  1E6E B;  1L0Y B;  2LVQ A;  1AN8 A;  3PT2 B;  4R3D A;  2K9X A;  4PK1 A;  3IBE A;  2HD5 B;  5CHF A;  1QLB B;  2WDT B;  4KVG B;  2OOB B;  4ICV A;  2ZVO A;  4E3C A;  2LGS A;  1D5X C;  3IVF A;  2KMM A;  2D3G A;  1C4C A;  2VZK D;  1Q0W B;  3A4S C;  3DBR I;  2RDG A;  3MFG A;  2IO2 B;  2WS3 B;  2JRH A;  1GJZ A;  3IAS 1;  2N9E B;  1ZW7 A;  3L17 A;  4W9C A;  4AS1 A;  3Q8B A;  4CYE A;  2AL6 A;  4MJS B;  2IZV B;  1DGJ A;  5JXV A;  5EE0 A;  2L3Z A;  3N1X C;  5C3J B;  1SIF A;  2NBV B;  3NZS A;  4G3X B;  4YSY B;  4FLH A;  5JHA A;  4JPS A;  2CHZ A;  2PVG C;  3W5V B;  2ZZP B;  1YD8 U;  1WM2 A;  1UGJ A;  4M0W B;  3NS8 A;  1L7Y A;  3SFE B;  2Y5P A;  1ZOY B;  5HHD G;  1WF9 A;  4NJ7 A;  2G45 B;  1XXG A;  4W9I A;  2JU6 X;  1R7S A;  3A9J A;  3RNF C;  3RZF A;  1RLF A;  4HJK A;  4S17 A;  2H88 B;  3PHX B;  1E8Y A;  3M3J A;  4JL9 A;  3E9S A;  5FK9 C;  3MC0 B;  3QX1 A;  4W9L A;  2KX0 A;  2OJR A;  2WLB A;  2UU7 A;  2KLC A;  3C8Y A;  4PYU A;  1N60 A;  2JYE A;  4I6L B;  4MAC A;  4PS8 A;  2QCZ A;  2K8C A;  1WFY A;  3R2T A;  2IJ0 A;  3AU5 A;  2J0J A;  3GS2 A;  2J42 A;  2MCN B;  3P4S B;  5BMH A;  1FEH A;  1KH0 A;  4HPL B;  3RI7 C;  3R66 C;  4O1N A;  1JWB D;  2I1K A;  3FIL A;  2K8H A;  3VTW A;  1WXA A;  2NBW B;  3PLV A;  3AH7 A;  2KFK A;  1MJD A;  3W1S A;  1YN3 A;  2W9N A;  4OVZ A;  2BB5 A;  4KZ0 A;  1NBF C;  2BT6 A;  3MTN B;  3ZNH B;  4BZA A;  3VTV A;  4C7Z A;  1WJU A;  4GB9 A;  3EGR A;  2WYQ A;  2I38 A;  3R3M A;  1ET6 A;  2JX5 A;  1V2Y A;  3RNE C;  3DVN U;  2BGF A;  2WXQ A;  4EKU A;  1LO5 D;  3HUI A;  2FID A;  5G5G A;  1AWD A;  1WX8 A;  3P4R B;  3AEA B;  2N1W A;  3VDZ A;  2WXG A;  3RZW C;  2FUG 1;  1GPX A;  2JVC A;  2XEW A;  2GBN A;  1XEE A;  3SFD B;  3QQ8 B;  1FCC C;  1V9J A;  3RFZ B;  1B9R A;  2V3S A;  2KDB A;  4RF1 A;  2G3Q B;  4A3P A;  3B2G A;  2PPH A;  1QF6 A;  1WE7 A;  2K0P A;  1WR1 A;  1EU3 A;  3U2S C;  2GLS A;  2KWV B;  3RUL A;  1E10 A;  3H7P A;  4AP4 C;  2FAZ A;  1ZP0 B;  4ZRK A;  3ZKJ C;  2WGS A;  2C5L C;  1Q5W B;  3DBH B;  1K51 A;  1J7A A;  1WX9 A;  1UNS A;  1PFD A;  4JIO U;  2NTS A;  2LGI A;  2YLM A;  2XBB C;  1D5M C;  3VUY A;  4N58 A;  3DBR B;  4MSM B;  4FJY A;  2LJI A;  4WWM A;  3RT3 B;  3JYU A;  4BOS C;  3X0W A;  4W9G A;  1I42 A;  1WX7 A;  2UYZ B;  2WWZ A;  2KQ7 A;  2KJH B;  4DK5 A;  2X38 A;  2VH2 A;  2VRR B;  2AEH A;  1I4Q A;  3ZJU A;  3QK0 A;  1FM0 D;  3TL5 A;  1HXY D;  1J7C A;  4P6V F;  3DHH C;  1WGY A;  1XLP A;  2QC8 A;  5CX3 A;  1AAR A;  2QJL A;  2W54 A;  4EOY A;  1L6U A;  3DHI C;  2DZI A;  4A6Q A;  1ZPS A;  3EUB 2;  2YEP F;  4XYC A;  1PDX A;  2ASQ A;  3BIN A;  1IGC A;  4RNA A;  1SJE D;  3L13 A;  1IYF A;  1YX5 B;  1LFD A;  5HG2 A;  4M01 A;  4FJZ A;  3Q8A A;  3UGB B;  5BYS A;  2IGH A;  4REZ A;  3NRZ A;  2WXO A;  4C4V B;  3Q14 C;  2DZK A;  3AE7 B;  4OHJ A;  2JXX A;  2D3A A;  1UGM A;  1D5Z C;  4OW0 A;  4EZL A;  2CU1 A;  2WXK A;  2MJD A;  3H7S A;  1IUE A;  3QAQ A;  3BWU D;  1TY2 A;  2HE7 A;  1ZUD 2;  1E8W A;  3I9V 1;  2PIA A;  3BII D;  1F9J A;  2AQ1 B;  4AWJ A;  4II2 B;  2C9W B;  3BYY B;  1IGD A;  2KT7 A;  2LXA A;  4LNO A;  4LNK A;  4ZOH C;  3GZN I;  4DQO C;  4GDL B;  4WUR A;  2CJO A;  3ZNG C;  3WA0 A;  1OEY A;  2WXF A;  2KTR A;  5D94 A;  1SF0 A;  4W9J A;  4ANW A;  3P42 A;  2M1M A;  2XK5 A;  1VZ7 A;  2WU5 B;  2TSS A;  1HTO A;  2KN4 A;  3KYD D;  3URY A;  5E6N A;  1HEZ E;  2W55 A;  3NVV A;  2N9P C;  2Z0D B;  3ZVV A;  2J52 A;  1VJK A;  1E7U A;  2RR9 A;  1MHH E;  5MPO A;  3TSS A;  5AUI A;  4HKQ A;  2PJH A;  1PYW D;  4FA6 A;  1ACC A;  1H8C A;  1WSP A;  5EE1 A;  2KZR A;  2LVP A;  4DBG A;  4RFB A;  1WGH A;  3W1Y A;  2K3U A;  1LXD A;  3PRE A;  2B3A A;  3M62 B;  3EFU A;  4ANU A;  2KDF B;  5AZG A;  1J8C A;  2VZK B;  4GU2 A;  1M94 A;  4C56 C;  4ITK A;  1UH6 A;  2BYE A;  5CHV C;  4TKN A;  4ARC A;  2D3B A;  2MA9 B;  3O13 A;  1V5O A;  3TBL D;  1R4N I;  2Y5C A;  4GDK B;  1WJN A;  4F8C B;  2HDE A;  1IPG A;  2NPT A;  1UZX B;  3V6C B;  2IO0 B;  1Q10 A;  4KGS A;  1WGK A;  3WCQ A;  4B9K A;  1GB1 A;  3L4P A;  2KDE B;  4FN2 A;  4M8M A;  3AMZ A;  2FE8 A;  1KRH A;  5DPT A;  3WAN A;  1CMX B;  1FRR A;  2N9K A;  1QOG A;  2QIL A;  4CQN A;  2WHI A;  1WMH A;  2OED A;  2KYW A;  2YVC A;  3EC8 A;  3H9D A;  2KC1 A;  3DCG A;  1SXT A;  1RYJ A;  4RGN A;  3APC A;  1UWM A;  1EWC A;  2R61 A;  3HM6 X;  4URK A;  1AYF A;  2L83 A;  4ZRP A;  4JWU C;  4OVV A;  2QIE B;  3IAM 1;  1XQQ A;  1PUT A;  1TIF A;  4KSK C;  2KVR A;  2NR2 A;  2WXN A;  2LD9 A;  2WXR A;  3D32 A;  1VLB A;  2LGY A;  4XWT A;  3SDL C;  4LNN A;  2MW5 A;  3B08 A;  3R7R A;  1YJ1 A;  4RH6 A;  3HVD A;  4WAA A;  3OWE B;  1QOB A;  5L83 A;  4HPM B;  1F52 A;  4N59 A;  3DDC B;  3LYY A;  1ZXH A;  3VH4 B;  3I5J C;  4MT5 A;  4RCO A;  4ZRI A;  2CHX A;  2INP E;  2O6V D;  2DZM A;  2DAF A;  3PSE B;  4FHK A;  2MBH A;  4TMA B;  4WH4 A;  3S2A A;  3T9L A;  3ABV B;  1ZDX A;  3RMK C;  3P4Q B;  3TUO A;  4I6P A;  5LXI B;  3GB1 A;  4D2K A;  1N62 A;  2E3T A;  4WIP A;  2V4I B;  1WXQ A;  2J0M A;  2MP2 B;  4WWO A;  3U7Z A;  1F77 A;  4XWW A;  4GSW A;  5HFY A;  1JCK B;  3VHT C;  3KWL A;  4LJO B;  1T0S C;  2KHW B;  4NJ6 A;  3ZJV A;  1OGW A;  1NI3 A;  1UWX A;  3AE8 B;  1CQV A;  2VH1 A;  3BVM A;  2LHE A;  5DCN A;  4FXC A;  3OJ4 B;  4C00 A;  2LGD A;  1HZ5 A;  3BYT B;  2ZJD A;  1C4P A;  2LVO A; 
#chains in the Genus database with same CATH homology
 2CU3 A;  3P4S B;  5BMH A;  1FEH A;  2JXT A;  2Q5W D;  1F2R I;  1KH0 A;  4O1N A;  1JWB D;  2Y3A A;  3FIL A;  5BYR A;  1XLO A;  1V97 A;  5HI1 A;  3V3X A;  4JX1 C;  3AH7 A;  2WXH A;  1YJI A;  3P1M A;  1ZDV A;  4UDU C;  1SE2 A;  3W1S A;  1YN3 A;  2WP9 B;  1L0X B;  4OVZ A;  2W82 A;  3VR9 B;  2BB5 A;  4USA A;  2BT6 A;  2XN9 C;  4YTN B;  5BMG A;  2LEK A;  1JWS D;  2AQ3 B;  2W3S A;  5EE3 A;  4C7Z A;  2ONQ A;  1FNU A;  3EGR A;  1GOZ A;  1I4G A;  2E6X A;  2I38 A;  1DOY A;  1ET6 A;  2JX5 A;  2LHD A;  3IXS A;  4KGT A;  1BML C;  3VR8 B;  2QSD A;  4A8X C;  2OHF A;  4KX6 B;  2WXQ A;  2ZW0 A;  5BMI A;  2FBW B;  1LO5 D;  4OZC A;  1RFK A;  5LNK 1;  2KAJ A;  1XCT L;  2BW2 A;  2WDR B;  3HUI A;  3PO0 A;  1YJJ A;  1JWM D;  3VRB B;  5G5G A;  1AWD A;  3P4R B;  3AEA B;  3ZJT A;  1IBX B;  3NZ3 A;  4LLG M;  1N5W A;  2WXG A;  2L32 A;  5H8Y E;  1DOX A;  1L4D B;  3TEX A;  2FUG 1;  4NJC A;  1CJE A;  2HTM E;  4PT5 A;  1GPX A;  1RWS A;  2AQ2 B;  2G1E A;  3U52 E;  1QOF A;  2PLP A;  3FAH A;  1N63 A;  2GRI A;  4L1B A;  2MEK A;  2BS3 B;  3VRA B;  4DXF A;  4YXD B;  1TYG B;  3BVG A;  4HRO A;  1XEE A;  3SFD B;  4M0W A;  1FCC C;  2RDH A;  3RFZ B;  1B9R A;  1VZ8 A;  1XCQ L;  3W9C B;  2WXP A;  4RF1 A;  1L4Z B;  3B2G A;  4RGM A;  1QF6 A;  2WXL A;  4GLS C;  2K0P A;  1EU3 A;  3AE2 B;  3U2S C;  4YSX B;  1PGB A;  4C80 A;  2I2Y A;  1E10 A;  2JZP A;  1SEB D;  2BB6 A;  3IT4 B;  3NVY A;  3Q69 A;  5D3I B;  1FCL A;  3DWM A;  1CK1 A;  1ZP0 B;  3AE9 B;  2BYT A;  2DYO A;  3PZ8 A;  1K51 A;  2KQ4 X;  2WNM A;  3MHZ A;  4IKG A;  3TEW A;  1J7A A;  1UNS A;  1TS5 A;  1QIL A;  1PFD A;  1NEK B;  2ACZ B;  1ENF A;  5G5H A;  3KWV A;  1L0V B;  1YN4 A;  2NTS A;  2J53 A;  2LGI A;  1TKG A;  1KLG D;  3AN1 A;  1P7E A;  1E7P B;  1D5M C;  1J7B A;  4YT0 B;  2DWQ A;  4N58 A;  2L52 A;  1GB4 A;  5TSS A;  4XE0 A;  2LJI A;  3RPF C;  4NAW B;  4WWM A;  5FR3 A;  2N9L A;  3SEB A;  1V1P A;  3HRD D;  2BS2 B;  1V1P B;  1SE4 A;  1N5X A;  1T5X D;  2J4X A;  1D4B A;  2IDY A;  1JQ4 A;  2X38 A;  4IOI E;  4US8 A;  3AEE B;  1I4Q A;  1T6B X;  3ZJU A;  1HA5 A;  1YMH E;  2XNA C;  1FM0 D;  4TSS A;  1UUP A;  2WDQ B;  1HXY D;  4B0E A;  1WWT A;  2DYM A;  1J7C A;  1ZXI A;  2L1A A;  1C77 A;  4HEA 1;  4J3O D;  4P6V F;  2GB1 A;  1JW9 D;  1AW7 A;  1C4A A;  1PGA A;  4L2Y A;  1XLP A;  2LUM A;  1BUI C;  3Q8E A;  4LK0 M;  1V1O A;  3AM9 A;  1OQR A;  3BK2 A;  1D6E C;  2V0G A;  2ON8 A;  4JE3 B;  3J9C A;  2QJL A;  3MJ5 A;  4H2A A;  4ZYS A;  2W54 A;  3NUH B;  1PGX A;  2V3N A;  4IDI A;  1L6U A;  3AEG B;  1V8C A;  4P16 A;  3UI3 A;  4ZRQ A;  1QQR A;  4A6Q A;  1ZPS A;  2PVO D;  3EUB 2;  2YEP F;  3B9J A;  1TS2 A;  2JYT A;  2K22 A;  1PDX A;  2WU2 B;  1JWU D;  3P63 A;  3T3O A;  1C76 A;  3Q8F A;  5I4D A;  1IGC A;  4XDC A;  4RNA A;  4YWG G;  1SJE D;  5FKA C;  5AUK A;  3T3N A;  2JSV X;  2YEP B;  5HG2 A;  1P7F A;  4A90 A;  1HQR D;  1EWY C;  3P4P B;  3Q8A A;  1HZ6 A;  1TY0 A;  3AED B;  5BYS A;  4KGR A;  2GI9 A;  2IGH A;  4REZ A;  3NRZ A;  2WXO A;  3TEZ A;  1FD6 A;  3DWG C;  3CIR B;  4KKJ A;  1TS4 A;  3AE7 B;  4OHJ A;  1EU4 A;  3R2I A;  1JAL A;  2Z8L A;  1IBX A;  5T8I A;  1FNV A;  2BTE A;  4JWS C;  1D5Z C;  4B0M A;  2NMQ A;  4OW0 A;  2WXK A;  3B2F A;  1TZO A;  2MJD A;  4MH8 A;  1TKE A;  3AEF B;  3AE1 B;  1IUE A;  2IGG A;  1C78 A;  3CWI A;  3NVW A;  3BWU D;  1TY2 A;  1YQ4 B;  1N61 A;  4HKZ E;  1WRI A;  1ZUD 2;  5H92 C;  3E56 A;  4NZL B;  3I9V 1;  2PIA A;  4ARI A;  1ZE3 D;  3LXF A;  1FMA D;  3BII D;  2AQ1 B;  1KLU D;  3BYY B;  1ESF A;  1IGD A;  1FRD A;  4DQO C;  4ZOH C;  3LB8 C;  1F2R C;  1SJH D;  4GDL B;  4LTU A;  1B1Z A;  4WUR A;  1YN5 A;  2CJO A;  2WXF A;  4A9A A;  1EM7 A;  1K53 A;  1K52 A;  1I4P A;  1SF0 A;  3H8H A;  4NAM A;  1SB3 C;  1ET9 A;  3P42 A;  5GXG B;  3W5U B;  1VZ7 A;  2WU5 B;  2TSS A;  2PKO A;  1JRP A;  1YNT E;  1WYG A;  2KN4 A;  3URY A;  5D3D A;  3AE3 B;  4DXG A;  3BZD B;  1BXT A;  2WXM A;  3AE6 B;  1HEZ E;  1XF5 L;  2W55 A;  1MHX A;  3NVV A;  4WQM A;  5C2T B;  1JWA D;  1E0Z A;  5BYQ A;  4TQ0 A;  5D7G A;  2J52 A;  3VQI A;  1VJK A;  3AE5 B;  2ZW1 A;  1MHH E;  2RMM A;  2D5G A;  3KQ4 A;  5MPO A;  3TSS A;  1KFY B;  5AUI A;  4HKQ A;  2M56 B;  2B76 B;  2PMV A;  4OZB A;  3ZGZ A;  1PYW D;  2G9H D;  1NVI D;  2BS4 B;  1ACC A;  1JML A;  4N6E B;  2MJE A;  1WSP A;  3PZ7 A;  5EE1 A;  1SSN A;  1Y56 A;  3MP9 A;  1TKY A;  2CJN A;  2KDM A;  2QMT A;  1DOI A;  4OZA A;  4RFB A;  1C9F A;  2NTT A;  2SAK A;  1OFF A;  4YTM B;  2K3U A;  2WQY B;  2M0A A;  1VDV A;  2WXI A;  3ETR A;  1K50 A;  3FC4 A;  2EKI A;  3W2D A;  2SEB D;  2WDV B;  3ZYY X;  2VZK B;  3AE4 B;  3KLS X;  4C56 C;  2LMC A;  1XLN A;  1KF6 B;  2BBC A;  4L23 A;  4ITK A;  4WAF A;  1TJE A;  1CZP A;  1FO4 A;  1DYQ A;  1SBB B;  2V3P A;  4ARC A;  3NVZ A;  1VZ6 A;  4US9 A;  3O13 A;  3V05 A;  4MM3 B;  4TQ1 A;  2Y5C A;  4GDK B;  4Q2J A;  2JQR B;  2HDE A;  1FFV A;  1I4R A;  1Q10 A;  2DLB A;  4KGS A;  3BVZ A;  1ROE A;  1FXA A;  3AEC B;  1WGK A;  2N0S B;  3WCQ A;  1GB1 A;  4ZHO A;  3L4P A;  1M4V A;  2H89 B;  2IGD A;  2QEJ C;  2K5P A;  1MI0 A;  3AMZ A;  2FE8 A;  3FIL B;  2W3R A;  1KRH A;  1YQ3 B;  3R8B A;  2DBY A;  4RGT A;  3N9Y C;  1E6E B;  1FRR A;  1L0Y B;  1SE3 A;  2N9K A;  1AN8 A;  1QOG A;  4R3D A;  2QIL A;  2K9X A;  1RM6 C;  4CQN A;  5EE9 A;  1QLB B;  2IPK D;  2OED A;  2LFI A;  2PTL A;  3IT6 B;  1D5X C;  2KMM A;  1SXT A;  1RYJ A;  1C4C A;  4RGN A;  2VZK D;  2RDG A;  3MFG A;  1MVK A;  1UWM A;  2WS3 B;  1JRO A;  1EWC A;  1FFU A;  2R61 A;  4RF0 A;  1SIJ A;  1NYQ A;  4KKI A;  1AYF A;  2L83 A;  3IAS 1;  4ZRP A;  2M19 A;  1F0Z A;  4JWU C;  3AEB B;  4AS1 A;  3Q8B A;  2QIE B;  3IAM 1;  1PUT A;  4RGO S;  1DGJ A;  3TEY A;  5JXV A;  5EE0 A;  1I4H A;  5C3J B;  2KAC A;  3AV8 A;  2WXN A;  3AB5 A;  2WXR A;  1VLB A;  4XWT A;  3U4E G;  3GP7 A;  1OQQ A;  4YSY B;  4JPS A;  2PVG C;  4RH6 A;  3W5V B;  3HVD A;  1XLQ A;  1XO3 A;  3NS1 A;  3OWE B;  1QOB A;  4C7Y A;  1UGJ A;  1TS3 A;  3SFE B;  4N59 A;  2Y5P A;  1MPE A;  1T3Q A;  1ZOY B;  3LYY A;  1ZXH A;  1A70 A;  5HHD G;  4MT5 A;  4RCO A;  3Q8C A;  1VR9 A;  4XDD A;  2INP E;  1XXG A;  2KWD A;  2EEL A;  2JU6 X;  1C79 A;  2MJ3 A;  1R7S A;  4HRS A;  4TMA B;  4WH4 A;  2PW9 A;  1QT9 A;  3ABV B;  1ZDX A;  2RPV A;  3ZQ4 A;  5E6J A;  2H88 B;  3P4Q B;  4HJG E;  3TUO A;  2WXJ A;  1FNW A;  1FXI A;  3GB1 A;  4D2K A;  1N62 A;  2E3T A;  4WIP A;  2V4I B;  3E9S A;  1I4X A;  1E9M A;  5FK9 C;  3MC0 B;  4YSZ B;  1WXQ A;  1GAQ B;  2N7J A;  2WLB A;  3U7Z A;  1F77 A;  3C8Y A;  4XWW A;  1L5P A;  1N60 A;  2JYE A;  4MAC A;  2ICI A;  1STE A;  1QKZ A;  3SR6 A;  1KTK A;  5HFY A;  1JCK B;  3KWL A;  3I57 A;  3BK1 A;  2JWU A;  2INN E;  4A55 A;  3ZJV A;  1VRA B;  4ZHP A;  1NI3 A;  1UWX A;  3AE8 B;  1CQV A;  3BVM A;  2LHE A;  3EA6 A;  2AX5 A;  1FIQ A;  1NYR A;  4FXC A;  4AQ7 A;  1NEN B;  3R2T A;  2IJ0 A;  4YTP B;  4EE2 A;  1HZ5 A;  2MH7 A;  1QOA A;  3GS2 A;  2J42 A;  1I7H A;  3BYT B;  3HVZ A;  1C4P A;  1L6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...