1FRRA

Crystal structure of [2fe-2s] ferredoxin i from equisetum arvense at 1.8 angstroms resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
AYKTVLKTPSGEFTLDVPEGTTILDAAEEAGYDLPFSCRAGACSSCLGKVVSGSVDESEGSFLDDGQMEEGFVLTCIAIPESDLVIETHKEEELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer(iron-sulfur protein)
molecule keywords FERREDOXIN I
publication title Structure of [2Fe-2S] ferredoxin I from Equisetum arvense at 1.8 A resolution.
pubmed doi rcsb
source organism Equisetum arvense
total genus 20
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1frrA00
1IUEA 3HVZA 3VR8B 4P6VF 1FFVA 3VR9B 4FXCA 2W3SA 1L6VA 2WQYB 5C3JB 2WDRB 1PDXA 1KRHA 3P1MA 3AV8A 3LB8C 2W54A 5G5HA 1JW9D 2PVGC 3SFDB 3W5UB 1QLBB 2MJEA 1V8CA 1N60A 1PFDA 1YJIA 4JWUC 1E7PB 1QT9A 1RM6C 4HRSA 4ZOHC 3RPFC 1AYFA 1WGKA 2H89B 3AN1A 1JALA 1N62A 1SB3C 2BS3B 4YTNB 3VRAB 2M19A 2WP9B 4KX6B 2K5PA 2M56B 1FRDA 1DOIA 1ZUD2 3AE2B 1KFYB 3NS1A 1WXQA 4IDIA 5H92C 3FC4A 4LTUA 1DOYA 5G5GA 4C7ZA 2K22A 1FMAD 1VLBA 1JWAD 2JQRB 3L4PA 3B9JA 2PVOD 2L52A 2QJLA 3AH7A 5AUIA 1VDVA 3ZYYX 1NEKB 1DGJA 1TKGA 1E6EB 3DWMA 1YJJA 1YQ4B 1N5WA 1SF0A 2MJDA 1JRPA 1N63A 3AEDB 4N6EB 4N58A 1R7SA 2BT6A 1FO4A 1N5XA 3AMZA 1FFUA 1A70A 2CU3A 1WWTA 2WDQB 3AB5A 2JX5A 3AECB 3HRDD 4A9AA 1E0ZA 1QOBA 3AE6B 2G1EA 1CZPA 2CJOA 2PIAA 1AWDA 3PO0A 1QOFA 1XLPA 1ROEA 1T3QA 3DWGC 1SIJA 1PUTA 3AE7B 3AEGB 1ZXIA 3P4PB 1B9RA 2LEKA 3AE5B 2FBWB 1GAQB 2B76B 5EE9A 3AEAB 1J7CA 1FIQA 1E10A 1FXAA 3LXFA 3B2GA 2Q5WD 1OFFA 2H88B 2WU5B 4YT0B 3SR6A 3AM9A 2CJNA 2KMMA 5C2TB 3NRZA 2KAJA 3VRBB 3KWLA 5MPOA 1ZOYB 2MJ3A 1JQ4A 1XLQA 3B2FA 2AX5A 1JWBD 1XO3A 3FAHA 1QOAA 1ZP0B 1F0ZA 3EUB2 3SFEB 3P4QB 1TYGB 4ZHOA 3ABVB 2N0SB 2DBYA 1OQRA 2E3TA 2Y5CA 2WDVB 3NVZA 4YTPB 5EE0A 1XLNA 4ITKA 1WRIA 2BS4B 2EKIA 1I7HA 3W9CB 2PKOA 5EE3A 5AUKA 2W55A 4JWSC 2WS3B 1NVID 1KF6B 1OQQA 1V97A 2QIEB 2DWQA 4YSZB 3AEBB 1NI3A 3AEEB 4JX1C 1N61A 3AE4B 1TKEA 2L83A 2W3RA 1UWMA 1QOGA 2MH7A 2OHFA 2ACZB 4YSYB 3BIID 4WWMA 3W5VB 2WU2B 1YQ3B 3AE1B 5H8YE 4YTMB 1TJEA 1L6UA 1L0VB 1L5PA 3NVYA 1RYJA 1TKYA 3P4SB 5EE1A 1DOXA 3AE8B 3ETRA 3HUIA 4N59A 4YSXB 4US8A 1CJEA 1J7AA 1FXIA 1JROA 2HTME 3WCQA 1FM0D 3CIRB 3P4RB 4US9A 3CWIA 1RWSA 5GXGB 4USAA 3P63A 1QF6A 1GPXA 1RFKA 1EWYC 4HROA 4C80A 4YXDB 1NYRA 1FRRA 1XLOA 2BS2B 1NENB 3AE3B 4ZHPA 1J7BA 2WLBA 1VJKA 3AE9B 3NVVA 3NVWA 4C7YA 1WYGA 2K9XA 1E9MA 1NYQA 3AEFB 4WQMA
chains in the Genus database with same CATH superfamily
4KSLC 4MH8A 1HA5A 2LRWA 3RNCC 1EWCA 1WMHB 1STEA 2L7RA 2MA9B 4WJOA 4ANVA 3RPFC 1NDDA 3BVGA 5E6OA 4W9CA 5I4DA 2KMCA 3L54A 4GSWA 3NS1A 4XDCA 2DNFA 1FD6A 3ZYYX 4BVUC 4XC2A 1AN8A 1V81A 2JXTA 2IO1B 1CZPA 4JGHB 4XYCA 4EOYA 1ROEA 1T3QA 2FIFA 5J17A 3RUIB 1GAQB 3B2GA 4R3DA 3QHTA 3LYYA 3VTUA 4C4VA 2NMQA 3Q3FA 2IZVB 3R7QA 1VZ8A 3B2FA 3H7PB 2X38A 4BKTA 5BYRA 2KACA 1Q0WB 1CMXB 1HTOA 5BMHA 5IOIA 1E8WA 2DWQA 2EELA 4NJ6A 4EZKA 4PT5A 1KJTA 3W5VB 4DBGA 4BOZB 1Y8RC 3WALA 1IGCA 1L6UA 5CTRC 3A4RA 2WXNA 4N59A 2HTME 1K53A 2XN9C 4A3PA 1TBEA 3P63A 5BO4B 3D32A 2BVCA 4RM8A 2JF5A 3KW5B 3TL5A 2AQ3B 2WXOA 1FCCC 2FCMA 2FCQA 4LCDE 4WQMA 1IUEA 3TEZA 1PYWD 1V1PB 2QMTA 1C79A 5IO9A 2L0TA 3TUOA 2NPTB 2LI5A 5IP4D 1PFDA 1UGMA 2ZJDA 4HEA1 1AYFA 1WGKA 1MVKA 2BS3B 2PEAA 1DYQA 3QWZB 5E6JA 3ECIA 4HXDA 2JQRB 2K1FA 2PVOD 3TSSA 1IGDA 1I4GA 2D3AA 1YJJA 2N7JA 2BF8B 3PRMB 4NJ7A 1R4MB 1PGAA 3PT2B 3AE6B 4E71A 1GJZA 2CJOA 4RFBA 4XWTA 4LDTD 1XLPA 4RGTA 1AW7A 1SJED 2K8BA 2FBWB 2BQQA 1N6ZA 1U4AA 3N1YC 2YEPB 4FBJB 1X1MA 2DLBA 2NCNA 3SU8X 4GDKB 1IBXB 2INNE 4GN1A 2ZPNA 3N1ZC 3W1SA 3T9LA 2DBYA 3VTVA 3Q8EA 1NVID 1LXDA 4AJWA 2KOXA 2SAKA 3FKYA 4ASWC 3ZNHB 2IY0B 3WAOA 2D5GA 1UWMA 3ZNID 4ANUA 2J0JA 3KLSX 2KFKA 4HCNB 1TZOA 3NHEB 3AE8B 2HJ1A 2M8SA 4I6NB 1Z5SB 4IOIE 4EZLA 1L7YA 2UU7A 3AE3B 1HQRD 2MWSB 2NTTA 2ON8A 1V1OA 4TQ0A 4B0EA 1I4QA 3HM3A 4K7SA 3DBHI 2IDYA 2K8CA 4MT5A 3VRAB 2AYOB 3UIOB 2I1JA 4B6WA 5AUIA 1C77A 1I4HA 3QX1A 5HHDG 2ZPYA 4N58A 2BT6A 1TY0A 2JX5A 2L32A 3QJZA 3SHQA 1E8XA 3H6NA 2K39A 3ZTDA 3KWVA 1XF5L 1D5MC 4EEWA 3A1QB 3ZXVA 2LJIA 1WGGA 5C23A 1P3QU 3KWLA 1SIFA 2L00B 3NZ3A 2MBEA 4MGIE 1D6EC 1ZP0B 4BKSD 3DPDA 3H8HA 5LXHA 2FCNA 3NVZA 4OZAA 4II2B 2KC1A 2C60A 3N9YC 2CKHB 3RNEC 2D07B 4II3B 2BGFA 1NI3A 2QEJC 3AEEB 3JW0X 3I3TB 3TBLD 2ACZB 3APCA 3NOBA 1CQVA 4B0MA 4BAXA 1L0VB 5EE1A 4US8A 3E9SA 2ZNVB 2QILA 1RWSA 1YN4A 1RFKA 2BKRB 2IBIB 1PQSA 4UDUC 1SE4A 2BW2A 4GOCA 3VTWA 4KIKA 1SSNA 3PRPB 4KZCA 4MDKE 2ZCBA 2M1MA 1NYQA 4RH6A 1OQYA 3DHIC 4K81A 1SE3A 2NS5A 2MJEA 1RM6C 3UIPB 4ZRPA 1SB3C 2BWES 1F77A 1D3ZA 3ZDMC 4BZAA 1Q10A 4HWIB 4YWGG 3ALBA 4RCOA 4MSMB 1P1AA 2ZNVC 4ZRKA 2KWVB 2N1WA 3GB1A 4KGSA 1DGJA 4E74A 1JRPA 5JZEB 3W1YA 1E7UA 3AECB 3C19A 1V86A 3PS6A 2VRRB 1QQRA 2BYEA 3PO0A 1ZXHA 4CQNA 1Y56A 3NZSA 2RDGA 4G11A 2MBOA 4P16A 5JXVA 4LNOA 3IFWB 4IUMB 4RF1A 2VH2A 1YMHE 1ESFA 1VCBA 2H88B 2XK5B 4ICVA 3UQAA 2KDMA 3OG5A 2JUOA 1E8ZA 3X0WA 2BBCA 1OQRA 3V62A 4K7WA 1V97A 2QIEB 2WXRA 3MJWA 3BIID 2LMCA 3OAWA 1L5PA 2WXLA 1TKYA 2GBRA 4EZJA 5HG2A 1FM0D 3GZNI 1SEBD 1V5OA 2GRIA 1WM3A 2XNAC 1WM2A 2X8XX 3DBLI 3NVWA 4HDQA 4CHKA 1XT9B 1WJ6A 4GMVA 4BKGA 4W9GA 1MG4A 3DHHC 2EMSA 3ZLZA 3AV8A 4W9IA 1JW9D 1P7EA 2L3ZA 2JYEA 2K6DB 1JWUD 1QT9A 4RGMA 2KYWA 1KFYB 1TTNA 2OJWA 2QDFA 4XWWA 1KOTA 3EECA 2UWQA 1ZDXA 3B9JA 5J18A 2LJ5A 1WX9A 2A4ZA 2D3GA 1I4RA 3A9KA 3AEDB 4PYUA 3BYYB 3TEYA 2RPVA 2V4IB 2LFIA 3RNFC 2KX0A 2CS4A 2KN4A 2N9KA 2V3PA 4LK0M 4B9KA 4KDIC 1SIJA 4A20A 4RF0A 1YQBA 2EMTA 2L05A 1L4DB 3VQIA 1JWMD 2RSUA 1G6JA 2LXCA 3DBRB 1M4VA 1ZPSA 1SJHD 2VZKD 3BVZA 3PTFC 3DVNU 1VRAB 1XLQA 1K51A 4KV2A 1C4CA 2MBBB 3P4QB 2KZRA 1UH6A 4LDTB 4GLSC 4IKGA 2JZ3B 2KO3A 4YSZB 4W9HA 2V1YA 1MPEA 4A55A 5DCNA 1ZE3D 4W9KA 4G50A 1UF0A 4JIOU 1YN3A 3APFA 2I2YA 3HUIA 1JROA 4N9F4 3WCQA 3DQVA 2C9WB 2GBJA 2KTRA 3L0WB 1F1HA 2V4LA 4DHJD 2GBMA 1IYFA 2O2VB 3S2AA 2ZW0A 2BB6A 2LGIA 3GE3C 1ZDVA 5T8IA 2WDTB 4NPNA 4DK5A 2DHZA 1KRHA 4MM3B 3C0RB 2W54A 2PVGC 3W5UB 1YJ1A 4K7UA 2DZMA 4NZLB 2G3QB 2I1KA 2IJ0A 4P1CC 2ZVNA 2PE9A 4L23A 4WAAA 2KWDA 3ZW3A 4ZRIA 1QILA 4PYZA 1I4PA 5BMGA 3PLUA 2NR2A 1WI0A 2MJDA 1N63A 2AQ1B 1I4XA 2G1EA 3BWUD 3AXCA 4DQOC 2V0GA 3AE7B 3ZJVA 4TKNA 4S0RA 3RMKC 1OTRB 2IO3B 1J7CA 3LXFA 1VZ6A 1D5XC 3AU5A 3NG0A 1RAXA 5D7GA 3EUB2 3IHPC 4WJQA 3TCAA 4KGRA 3DHGC 1XLNA 2AL6A 3WAPA 1XCQL 2OEDA 2KXJA 4RNAA 2W55A 1P7FA 3H7SA 1WJUA 3ML8A 3N32A 1C9FA 3N30A 4EFOA 1XXGA 1BUIC 1V9JA 1WXVA 2L83A 4ICUA 2C5LC 4QAYA 1VD2A 1YQ3B 2GLSA 2GBNA 2L0FA 2MHJA 3R7RA 1KLVA 4I6PA 5DPSA 1EU3A 2L8JA 2MQJA 3A33B 4KKJA 1FRRA 4WJNA 3RI7C 1FPYA 1P9DU 3R8BA 1E9MA 2LHDA 3H1UA 5G2NA 2WQYB 2G4DB 4EE2A 2BYFA 2K3UA 2WXPA 2O6VA 2J0KA 4JWUC 4LJPB 3KYCD 1E7PB 2PLPA 2CHWA 4MACA 3K9OB 4HPMB 3ZXRA 4ANWA 3A9JA 2ONQA 5D3IB 4D2KA 3UGBB 2LD9A 1FMAD 3ML9A 3L4PA 1NEKB 1YQ4B 2WXIA 3ZNGC 1UBIA 2J42A 4OVVA 1LQBA 2M4NA 1E0ZA 4GDLB 3B0AA 2L1AA 2K8HA 1PUTA 1ZXIA 3RCZA 4YL8A 3PHXB 3QAQA 2PPHA 3NRZA 4W9DA 1WMHA 3VRBB 2JYTA 1JWBD 3NUHB 3KYDD 1ZKHA 2PKOA 4JE3B 5EE3A 4WIPA 3LJ3A 3EFCA 1OQQA 2DYOA 1J8CA 2KC2A 3WA0A 4W9LA 3M95A 2JWUA 1N61A 3TEXA 2N7DA 1Q1OA 4LJOB 1QOGA 4YSYB 3BVMA 1KTKA 2Y3AA 2WU2B 2V3NA 4FJYA 1IP9A 2LGDA 4FULA 1WH3A 3DCGA 3N20C 1TGZB 1EF5A 5D94A 4OVZA 4REZA 2LVPA 4HROA 3ZUNA 2NVUI 4OVUA 2Z0EB 4EUTA 1J7BA 2WLBA 3SDLC 1WGRA 3QA8A 4YTNB 1GC6A 2C7NB 3H7PA 2LUMA 4HJGE 5FR6A 2M0AA 3P1MA 2LVQA 3JVZX 2FUHB 3BYTB 3ZQ4A 4HRSA 4AUQC 3Q3NC 4B95A 2MW5A 1FRDA 1ZUD2 4GB9A 2R2OA 4A6QA 4IDIA 3DBLB 1L2NA 2FAZA 2LZ6A 3OJ3A 1I42A 3E56A 2L52A 1VDVA 2E6XA 4EKUA 4TMAB 3RYTA 1YX6B 2JWZA 1VZ7A 5TR5A 4G0NB 3I63C 4CYEA 2KLCA 4K3CA 1WX7A 1F2RC 1I35A 3PGEA 2KVZA 1WR1A 4AOFA 3U2SC 1B9RA 1MJDA 4J6IA 2IYDB 4ZRQA 2MP2B 1FNWA 1V1PA 1WXMA 3HHMA 3RN9C 1SE2A 2RDHA 2NPTA 1WF9A 2HTHA 2D2QA 5JH5C 2D10A 1P98A 4A90A 4FHKA 5FR3A 3KUCB 3FILB 1TS3A 3PZ8A 1WXAA 2JVCA 2BKFA 2E3TA 4MJSB 2M0XA 1I7HA 4DXGA 2HE7A 2WS3B 1P0RA 1L0YB 2YEPF 2VZKB 4ARCA 4M01A 1S3SG 2QHOA 1GOZA 1WX8A 1TT5B 1WJ4A 3OWEB 4YSXB 3JYUA 4HVBA 2VH1A 4H2AA 2LGSA 3CSFA 4M00A 1JWSD 3ZDTA 3VR9B 4GDKA 1IBXA 4FXCA 5D3DA 1D4BA 2AEHA 3I57A 1HZ5A 5G5HA 1QLBB 2XBBC 2KX3A 2IGGA 2OOBB 3M63B 1SXTA 2M19A 4LNIA 2KNBA 3VUWA 4NAWB 2KDIA 2KANA 5E6NA 5H92C 4DHJB 1V80A 3U30A 4LLGM 1TS2A 2Z59B 2QJLA 5E6PA 3IXSA 3L17A 2G9HD 1MHHE 1N5XA 3TJPA 3Q6BA 4NNJB 2DZJA 4W9EA 2KQ4X 2Z8LA 3AE5B 3MTNB 1T0YA 1VR9A 2XEWA 3PZ7A 2WU5B 1OEYA 1T5XD 1D5ZC 4ZDVA 1JQ4A 4J3OD 2Y5PA 2FNJB 4KDLB 2WWZA 4DDID 1T6BX 2LXAA 2GBKA 2JRIB 2WDVB 4M8MA 2LGXA 1WFYA 2BS4B 4AP4C 4JQWC 2KFJA 2B3AA 2LHEA 2BWFA 4BOSC 3V6CB 5DPWA 5J2RA 3IG3A 2WXHA 4M0WB 4TQ1A 2NBWB 4F8CB 4DHZB 2IGDA 1CJEA 1FXIA 2J53A 3P4RB 1QF6A 5CHFA 3A1QA 3V3XA 1XLOA 3RNBC 3NJTA 2WXFA 3N1XC 4ZHPA 2UYZB 1VJKA 2J52A 1YOVB 1T0QC 3CSTA 4GXBA 2A5UA 3JSVB 2N4FA 3GOEA 5C3JB 1FCLA 3LB8C 3DOWA 3Q8BA 1IPGA 2JZZA 4WURA 1LFDA 4ZYNA 1CK1A 1WGDA 3VUYA 1YNTE 2K5PA 3DVGY 1DOIA 1ENFA 3H9DA 3HK0A 3URYA 2QCZA 3RNGC 3WIMA 4NJCA 2KWCA 4ANXA 2CU3A 1WWTA 2KK8A 1QOBA 1FNVA 1UWXA 2KKCA 4HKQA 2PIAA 3I9V1 2KMAA 2J4XA 2MCNB 1SGHA 5DPTA 1FXAA 2DZKA 1OFFA 2YLMA 3BK2A 4BBNC 1ZOYB 2MJ3A 1T0RC 2AX5A 2JXXA 4URKA 3AI5A 1F0ZA 4PK1A 1TYGB 2N0SB 2CHZA 5EE0A 2Y5CA 3RNAC 2KDBA 2WXKA 4AQ7A 2PJHA 5LLIA 2DYMA 1HZ6A 4LNNA 3AEBB 1XQQA 3QC8B 3IBEA 5G55A 2FUG1 3ZRCA 4WAFA 2MLBA 4MELA 3RT3B 4TV3A 4G3XB 1E90A 4M8NA 1RYJA 1DOXA 1JCKB 4C56C 3CWIA 4JPSA 3LDZE 4C80A 2INCC 2XK5A 3L13A 2KVRA 4F7ZA 3AEFB 4NQKE 3EHVA 4MGKE 2W82A 4KKIA 2WDRB 2AL3A 4P7IA 4C4VB 4DDGD 5CX3A 2JZPA 2G4SA 4ZOHC 1L4ZB 1WE7A 1N62A 4KX6B 2WP9B 1V49A 2KN5A 3Q69A 4FJZA 1DOYA 2KWUB 1WZ3A 3UI3A 1J19A 3AH7A 2N9LA 4RGOS 3L10B 4M02A 2LVOA 1FFUA 1EF1A 2WDQB 2NTSA 3U4EG 2I38A 3AB5A 3HRDD 2GB1A 3ZIMA 3MHZA 4OW0A 4JLCA 1AWDA 1WZ0A 2EKEC 2N9PC 1TS4A 3AEAB 5HI1A 1RFAA 2Q5WD 2CJNA 1KH0A 1V6EA 5MPOA 3UQBA 3I5JC 1R4NI 3DBHB 3P2BA 3O13A 2WNMA 2R61A 3KQ4A 3MFGA 4L2YA 3TMPB 3HM6X 1UELA 3W2DA 2DAJA 2WGSA 3CF6E 2W3RA 4I6LB 5H8YE 4IWPA 1M94A 4AJYB 2CR5A 2BB5A 1TY2A 1EWYC 4RMAA 3APDA 1NENB 5AEKB 2KQ7A 4KGTA 1GNUA 1WYGA 1QZEA 3C8YA 3HVZA 3VR8B 5AZFA 2DYBA 4HDOA 2G45B 2N9XA 3M62B 3HIZA 3RZWC 2INDC 4TUUA 5JHAA 3BINA 1JALA 1BXTA 3X23A 1NI2A 1C3TA 1BT0A 4ACFA 4HK2A 1E8YA 2M56B 3QIJA 3PRZA 3RFZB 4MSQB 5IN7A 3V05A 3ENEA 3R2TA 1E6EB 4ARIA 1SF0A 1R7SA 1KLGD 3AMZA 4FLHA 2MSED 4KZ0A 5FK9C 3DDCB 4A9AA 2KT7A 1HXYD 1HE8A 4HKZE 4HJKA 3L08A 2KFKB 4XGAB 2KDFB 1QOFA 1EU4A 5HKHA 3DWGC 2NBUA 1MHXA 3P4PB 2O2VA 2GMIC 2K25A 4GGQA 3PSEB 2M17A 1E10A 2KJHB 1LGRA 5IKCM 3PHWB 3AM9A 4DWFA 3U7DA 3W1SC 4MM3A 2DZIA 5CHVC 5FKAC 5LNK1 1XEEA 2HJ8A 2L76A 1E7VA 2FE8A 3N3KB 3IAM1 3SFEB 5LXIB 3ABVB 1XD3B 3K9PB 3R3MA 3VH4B 4AWJA 1B1ZA 2BPSA 3VHTC 3PVLA 3TEWA 4Q2JA 2MH7A 2C7HA 2KTFA 4IC7B 1HTQA 2KHWB 2N7EA 3VVWB 3ETRA 2OJRA 1TZ1A 1C76A 1GPXA 3KH0A 3QCAA 1WGHA 4A8XC 1K50A 1NYRA 4FN2A 1ET9A 3MJ5A 4IW0A 3DBRI 2K9XA 3TIXA 1FFVA 1WXSA 2AWTA 2WX1A 2PTLA 3DBSA 4FADA 3SFDB 3U7ZA 1V2YA 1KM7A 3NY5A 1HEZE 1UD7A 2IO0B 2QSDA 3AN1A 4GU2A 1UBQA 3AE2B 4XX5A 3FC4A 1PGBA 2ZW1A 4C7ZA 1JWAD 2JPHA 1TKGA 1KLUD 3MHSD 1YD8U 4BKSA 2KD0A 5L83A 1RRBA 5D2MB 3R2IA 3GZNB 2O6VD 4WWNA 4PS7A 4OHJA 2KDEB 2J7QB 4FA6A 3U52E 4XE0A 2LUEA 2B76B 4XZ4A 1WRDB 3L16A 2ZZPB 4KIKB 3Q8CA 3IT6B 3VH3B 3OJ4B 1S1QB 4S17A 3SEBA 3Q14C 1ZGUB 2MBHA 4ZHOA 1WRIA 2EKIA 2ICIA 3WANA 1J0GA 5AUKA 4WWPA 5KHOA 3V60A 1E5WA 4DXFA 1C4PA 4JL9A 4MGYE 4JX1C 3UF8A 4IM3A 2JU6X 3B1LX 2D3BA 4GDLA 3AE1B 3PREA 4YTMB 3U8ZA 1TJEA 3P4SB 2REXA 1GUAB 5AZHA 4US9A 3ZKJC 2RR9A 3Q3MC 2BS2B 4PS3A 2MEKA 4O1NA 2J0MA 2PW9A 4RGNA 3AE9B 3NVVA 5CHWA 3VDZA 2DX5B 4C7YA 2AQ2B 2MX2A 5JHBA 4LNFA 4P6VF 3ZGZA 1PDXA 2IY1B 2C7MB 2LWPA 4X57B 1F52A 2INPE 1QKZA 3PPAA 3BK1A 4GIVA 3RZFA 2JRHA 2LASA 3NS8A 1YIWA 3DVNV 2K22A 3IAS1 3SD5A 1UUPA 3M3JA 5IAAC 1A70A 2GOWA 5BYSA 3EC8A 3QQ8B 4ZRJA 3Q2AC 1JMLA 1JRUA 3AEGB 4DHZE 1RLFA 2LEKA 3DVGX 1UNSA 2SEBD 1FIQA 2ASQA 2Z0DB 1OEYJ 3MC8A 2WX0A 3KUDB 4KVGB 2KAJA 2K6QA 1EUVB 4HPLB 4OZBA 4WQOB 1SE9A 5HFYA 3B08A 3PV1A 1WSPA 4NY0A 4YTPB 5KHQA 3V61A 1V5TA 3O65B 2BYTA 2DENB 2MRPA 1BMLC 4JWSC 1MI0A 1KF6B 4E3CA 1TIFA 1AARA 1TKEA 3BY4B 3EGRA 1R4NB 1FNUA 1H4RA 2HDEA 4K1RB 3A9KB 3ZJTA 4IWOA 1L0XB 3T3NA 2WXJA 1FEHA 3Q8FA 3RULA 3MC0B 1SBBB 3T3OA 3V6EB 2MP2A 1GB1A 5IA7A 1C78A 1Z2MA 4WWOA 3KVFB 1T0SC 2FCSA 3OLMD 1WY8A 3MP9A 3VXWA 3MC9A 2GI9A 2ZVOA 1F9JA 5DPRA 1L6VA 3FILA 3KUZA 3EA6A 3P42A 1WR6E 4MJSA 1R4MI 1N60A 1V8CA 2JY6A 4L1BA 4IWQA 3Q8AA 3EFUA 4ZYSA 2RMMA 1LO5D 1LM8B 2KJ6A 3ONSA 2BYVE 4NAMA 4WJPA 3VAWA 2WXMA 1WXQA 1OGWA 1TS5A 5G5GA 3GS2A 3GP7A 3ZO5B 4W9JA 2HD5B 1N5WA 4RM9A 3RD2A 1FO4A 3AU4A 5GMVA 5L95C 4OZCA 4K3BA 3Q3JA 2ZEQA 2R2QA 2WHIA 2LGYA 2NBVB 5D6JB 2IGHA 2KTRB 2RD0A 5EE9A 4XDDA 3NZUA 1F2RI 5BMIA 2RPQA 3QARA 2KMMA 5C2TB 5C1ZA 3J9CA 1XO3A 3IT4B 2QC8A 2WXGA 4NAWA 2JT4B 3ZRFA 4AS1A 1UGJA 3ZJUA 2LRUA 1A5RA 1K52A 4KSKC 5EDSA 1WE6A 1Q5WB 4MEMA 5AZGA 4FJVB 4DXAB 2OHFA 2V9HA 3Q3OC 3A4SC 1YN5A 2PMVA 4WWMA 2ZCCA 3NVYA 3CMMB 1UZXB 4F1SA 4P1BC 2WYQA 2TSSA 5GXGB 2MBQA 1ZW7A 3PZDA 1MFWA 4C00A 1K8RB 1XCTL 2D3CA 1MG8A 3VUXA 3BZDB 1EO6A 2W3SA 4IM2A 3IVFA 3HVDA 4W9FA 4PS8A 1WYWB 2RGFA 1YJIA 1C4AA 4HLEA 2H89B 4LNKA 3T8MA 4MH0E 1NBFC 1WGYA 2Y5BB 4LTUA 2KLGA 2IO2B 2K0PA 1VLBA 1ET6A 4M0WA 2PE6B 3DWMA 2RDBC 4HCPB 4N6EB 2CU1A 3AULA 4WH4A 3GE8C 2YVCA 1C1YB 3VFKA 5TSSA 4BBNF 1EM7A 2BTEA 1GB4A 1FXTB 1YX5B 4TSSA 4HPPA 1ISNA 4YT0B 3JSVA 3SR6A 3ZTCA 2V3SA 2N1VA 2D11A 3FAHA 1QOAA 2KJRA 3ZNZB 3PLVA 4ITKA 2O6VB 4MGZE 3W9CB 2IPKD 1H8CA 2N9EB 3A9JB 3AE4B 2JSVX 2W9NA 2WXQA 1GC7A 5BYQA 2FIDA 1WIAA 1GG3A 3UINB 4IM0A 1J7AA 3QK0A 2KQSA 3CIRB 2CHXA 1WJNA 4USAA 3ZVVA 4BFRA 4CO7A 4NQLB 4YXDB 4A3OA 1ACCA 1PGXA 3R66C 2DAFA 4IG7B 4FHJA 3WAMA
chains in the Genus database with same CATH topology
3VR9B 1FFVA 4MH8A 1HA5A 1IBXA 4FXCA 5D3DA 1D4BA 1EWCA 3I57A 2PTLA 1HZ5A 3AV8A 1STEA 1JW9D 5G5HA 1P7EA 3SFDB 1QLBB 3U7ZA 2JYEA 2IGGA 1HEZE 1JWUD 1QT9A 4RGMA 3RPFC 2QSDA 3BVGA 3AN1A 1SXTA 2M19A 5I4DA 4NAWB 3AE2B 1KFYB 3NS1A 4XDCA 5H92C 3FC4A 1PGBA 4XWWA 2ZW1A 4C7ZA 4LLGM 1JWAD 1ZDXA 3ZYYX 3B9JA 1TS2A 1FD6A 2QJLA 1TKGA 3IXSA 1I4RA 1KLUD 3AEDB 3BYYB 1AN8A 2RPVA 2G9HD 1MHHE 1N5XA 2V4IB 2LFIA 3TEYA 2JXTA 2KN4A 2N9KA 1CZPA 3R2IA 2V3PA 4OHJA 4LK0M 1ROEA 1T3QA 1SIJA 3U52E 4XE0A 4RF0A 2KQ4X 2Z8LA 3AE5B 1L4DB 1GAQB 2B76B 3VQIA 1VR9A 1JWMD 3PZ7A 3B2GA 4R3DA 2WU5B 3LYYA 1M4VA 1ZPSA 1SJHD 2VZKD 3BVZA 2NMQA 1T5XD 1VRAB 3Q8CA 1D5ZC 3IT6B 1VZ8A 4J3OD 1JQ4A 1XLQA 2Y5PA 3B2FA 1K51A 3SEBA 2X38A 5BYRA 1C4CA 2KACA 3P4QB 4ZHOA 1T6BX 2WDVB 1WRIA 2BS4B 2EKIA 2ICIA 5BMHA 4GLSC 5AUKA 4IKGA 2DWQA 2LHEA 4YSZB 2EELA 4DXFA 1C4PA 1MPEA 4JX1C 4PT5A 4A55A 2WXHA 2JU6X 1ZE3D 4TQ1A 3W5VB 3AE1B 4YTMB 1IGCA 1TJEA 1L6UA 1YN3A 3P4SB 2I2YA 2WXNA 3HUIA 2IGDA 4N59A 1CJEA 2J53A 2HTME 1FXIA 1JROA 1K53A 3WCQA 3P4RB 2XN9C 4US9A 1QF6A 3P63A 3V3XA 1XLOA 2AQ3B 2BS2B 2WXOA 2MEKA 2WXFA 4O1NA 1FCCC 4ZHPA 2PW9A 4RGNA 1VJKA 3AE9B 2J52A 3NVVA 4C7YA 2AQ2B 2ZW0A 2BB6A 2LGIA 4WQMA 1IUEA 4P6VF 3TEZA 3ZGZA 1ZDVA 5T8IA 1PYWD 1V1PB 2QMTA 5C3JB 1C79A 1FCLA 1PDXA 3TUOA 1KRHA 4MM3B 3LB8C 2W54A 2PVGC 3W5UB 2INPE 3Q8BA 1PFDA 4HEA1 4NZLB 1QKZA 1AYFA 1WGKA 3BK1A 1MVKA 4WURA 2BS3B 2IJ0A 1CK1A 1DYQA 1YNTE 2K5PA 4L23A 2KWDA 1DOIA 1ENFA 3URYA 5E6JA 2K22A 1QILA 2JQRB 1I4PA 2PVOD 3IAS1 5BMGA 3TSSA 1IGDA 1I4GA 4NJCA 1UUPA 1YJJA 2N7JA 2MJDA 1N63A 1A70A 2CU3A 1WWTA 2AQ1B 5BYSA 1QOBA 1PGAA 1FNVA 1I4XA 3AE6B 1UWXA 2G1EA 2CJOA 3BWUD 4HKQA 4RFBA 2PIAA 4DQOC 4XWTA 1XLPA 4RGTA 1AW7A 1JMLA 2V0GA 3AE7B 1SJED 3AEGB 3I9V1 2J4XA 2LEKA 3ZJVA 2FBWB 1UNSA 2SEBD 1J7CA 2YEPB 1FIQA 1FXAA 3LXFA 1VZ6A 1OFFA 3BK2A 1D5XC 2DLBA 2KAJA 1ZOYB 2MJ3A 5D7GA 2AX5A 4GDKB 1IBXB 4OZBA 2INNE 1F0ZA 3EUB2 3W1SA 5HFYA 1TYGB 2N0SB 2DBYA 4KGRA 2Y5CA 1WSPA 5EE0A 4YTPB 1XLNA 2BYTA 1XCQL 2OEDA 3Q8EA 2WXKA 4RNAA 1BMLC 2W55A 4JWSC 4AQ7A 1P7FA 2DYMA 1MI0A 1HZ6A 1KF6B 1NVID 2SAKA 3AEBB 1C9FA 1XXGA 1BUIC 2FUG1 1TKEA 2L83A 4WAFA 2D5GA 1UWMA 3EGRA 3KLSX 1FNUA 1YQ3B 2HDEA 1RYJA 1TZOA 1DOXA 3AE8B 3ZJTA 1L0XB 3T3NA 1JCKB 2WXJA 1FEHA 3Q8FA 4C56C 3CWIA 4IOIE 4JPSA 3MC0B 1SBBB 3T3OA 1EU3A 1GB1A 4KKJA 4C80A 1C78A 1FRRA 3AE3B 1HQRD 3MP9A 3AEFB 3R8BA 1E9MA 2NTTA 2ON8A 2LHDA 2W82A 2GI9A 1V1OA 4TQ0A 4KKIA 1L6VA 2WQYB 3FILA 4B0EA 2WDRB 4EE2A 1I4QA 2K3UA 3EA6A 3P42A 2WXPA 2JZPA 1V8CA 2IDYA 1N60A 4JWUC 4L1BA 1E7PB 2PLPA 3Q8AA 4ZOHC 1L4ZB 1N62A 4ZYSA 2RMMA 4MT5A 4MACA 1LO5D 3VRAB 4KX6B 2WP9B 4NAMA 2ONQA 2WXMA 5D3IB 1WXQA 4D2KA 3Q69A 1TS5A 1DOYA 5G5GA 3GS2A 3GP7A 1FMAD 5AUIA 1C77A 1I4HA 3L4PA 3UI3A 3AH7A 2N9LA 1NEKB 4RGOS 5HHDG 1YQ4B 1N5WA 4N58A 1FO4A 2BT6A 1TY0A 2WXIA 1FFUA 2J42A 2WDQB 3U4EG 2NTSA 2I38A 2JX5A 3AB5A 2GB1A 3HRDD 4OZCA 2L32A 3MHZA 1E0ZA 4GDLB 4OW0A 1AWDA 2L1AA 3KWVA 1XF5L 1D5MC 1PUTA 1ZXIA 2IGHA 1TS4A 5EE9A 3AEAB 4XDDA 1F2RI 5HI1A 5BMIA 2Q5WD 2CJNA 2LJIA 2KMMA 5C2TB 1KH0A 3NRZA 3J9CA 3VRBB 3KWLA 5MPOA 2JYTA 3NZ3A 1JWBD 1XO3A 3NUHB 3IT4B 1D6EC 1ZP0B 3H8HA 3O13A 2WNMA 3NVZA 4OZAA 2R61A 3KQ4A 2WXGA 3MFGA 2PKOA 4JE3B 5EE3A 4L2YA 4WIPA 4AS1A 1UGJA 3ZJUA 3N9YC 1OQQA 3W2DA 2DYOA 1K52A 2QEJC 1NI3A 3AEEB 2JWUA 1N61A 3TEXA 2W3RA 1QOGA 2OHFA 2ACZB 4YSYB 3BVMA 1YN5A 2PMVA 4WWMA 1KTKA 2Y3AA 2WU2B 5H8YE 1CQVA 4B0MA 2V3NA 1L0VB 3NVYA 5EE1A 4US8A 2BB5A 3E9SA 2QILA 2TSSA 1RWSA 1TY2A 5GXGB 1YN4A 1RFKA 1EWYC 4OVZA 4REZA 4HROA 1NENB 4KGTA 4UDUC 1J7BA 1SE4A 2BW2A 2WLBA 1SSNA 1XCTL 1WYGA 4YTNB 1NYQA 3C8YA 3HVZA 4RH6A 3VR8B 3BZDB 2W3SA 2LUMA 3HVDA 4HJGE 2M0AA 3P1MA 1SE3A 2MJEA 1YJIA 1C4AA 3BYTB 3ZQ4A 1RM6C 4HRSA 2H89B 4ZRPA 1JALA 1BXTA 1SB3C 1F77A 2M56B 1FRDA 1ZUD2 4A6QA 4IDIA 1Q10A 4LTUA 4YWGG 3RFZB 2K0PA 4RCOA 1VLBA 1ET6A 3V05A 3E56A 2L52A 4M0WA 1VDVA 2E6XA 3GB1A 4KGSA 1DGJA 3R2TA 4TMAB 1E6EB 1VZ7A 3DWMA 4ARIA 1SF0A 1JRPA 4N6EB 1R7SA 1KLGD 3AMZA 4WH4A 3AECB 5FK9C 4A9AA 1F2RC 1HXYD 4HKZE 1QQRA 3PO0A 1QOFA 1EU4A 1ZXHA 4CQNA 3U2SC 3DWGC 1Y56A 5TSSA 2RDGA 1MHXA 3P4PB 1B9RA 1EM7A 2BTEA 1GB4A 4P16A 4ZRQA 5JXVA 1FNWA 4TSSA 4RF1A 1E10A 1V1PA 1YMHE 1ESFA 2H88B 4YT0B 3SR6A 3AM9A 1SE2A 2RDHA 2KDMA 5FKAC 5LNK1 4A90A 1XEEA 3FAHA 5FR3A 1QOAA 2BBCA 3FILB 1TS3A 3PZ8A 2FE8A 3IAM1 3SFEB 3ABVB 1OQRA 2E3TA 4ITKA 1I7HA 3W9CB 4DXGA 2IPKD 2WS3B 1B1ZA 1V97A 2QIEB 2WXRA 3TEWA 4Q2JA 3AE4B 2JSVX 1L0YB 2WXQA 2YEPF 2VZKB 2MH7A 4ARCA 3BIID 2LMCA 5BYQA 1GOZA 1L5PA 2WXLA 1TKYA 3ETRA 3OWEB 4YSXB 1J7AA 5HG2A 1C76A 1FM0D 3CIRB 1SEBD 4USAA 1GPXA 2GRIA 4A8XC 4YXDB 1K50A 1NYRA 2XNAC 1ET9A 4H2AA 1ACCA 3MJ5A 1PGXA 3NVWA 2K9XA 1JWSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IUE A;  3HVZ A;  3VR8 B;  4P6V F;  1FFV A;  3VR9 B;  4FXC A;  2W3S A;  1L6V A;  2WQY B;  5C3J B;  2WDR B;  1PDX A;  1KRH A;  3P1M A;  3AV8 A;  3LB8 C;  2W54 A;  5G5H A;  1JW9 D;  2PVG C;  3SFD B;  3W5U B;  1QLB B;  2MJE A;  1V8C A;  1N60 A;  1PFD A;  1YJI A;  4JWU C;  1E7P B;  1QT9 A;  1RM6 C;  4HRS A;  4ZOH C;  3RPF C;  1AYF A;  1WGK A;  2H89 B;  3AN1 A;  1JAL A;  1N62 A;  1SB3 C;  2BS3 B;  4YTN B;  3VRA B;  2M19 A;  2WP9 B;  4KX6 B;  2K5P A;  2M56 B;  1FRD A;  1DOI A;  1ZUD 2;  3AE2 B;  1KFY B;  3NS1 A;  1WXQ A;  4IDI A;  5H92 C;  3FC4 A;  4LTU A;  1DOY A;  5G5G A;  4C7Z A;  2K22 A;  1FMA D;  1VLB A;  1JWA D;  2JQR B;  3L4P A;  3B9J A;  2PVO D;  2L52 A;  2QJL A;  3AH7 A;  5AUI A;  1VDV A;  3ZYY X;  1NEK B;  1DGJ A;  1TKG A;  1E6E B;  3DWM A;  1YJJ A;  1YQ4 B;  1N5W A;  1SF0 A;  2MJD A;  1JRP A;  1N63 A;  3AED B;  4N6E B;  4N58 A;  1R7S A;  2BT6 A;  1FO4 A;  1N5X A;  3AMZ A;  1FFU A;  1A70 A;  2CU3 A;  1WWT A;  2WDQ B;  3AB5 A;  2JX5 A;  3AEC B;  3HRD D;  4A9A A;  1E0Z A;  1QOB A;  3AE6 B;  2G1E A;  1CZP A;  2CJO A;  2PIA A;  1AWD A;  3PO0 A;  1QOF A;  1XLP A;  1ROE A;  1T3Q A;  3DWG C;  1SIJ A;  1PUT A;  3AE7 B;  3AEG B;  1ZXI A;  3P4P B;  1B9R A;  2LEK A;  3AE5 B;  2FBW B;  1GAQ B;  2B76 B;  5EE9 A;  3AEA B;  1J7C A;  1FIQ A;  1E10 A;  1FXA A;  3LXF A;  3B2G A;  2Q5W D;  1OFF A;  2H88 B;  2WU5 B;  4YT0 B;  3SR6 A;  3AM9 A;  2CJN A;  2KMM A;  5C2T B;  3NRZ A;  2KAJ A;  3VRB B;  3KWL A;  5MPO A;  1ZOY B;  2MJ3 A;  1JQ4 A;  1XLQ A;  3B2F A;  2AX5 A;  1JWB D;  1XO3 A;  3FAH A;  1QOA A;  1ZP0 B;  1F0Z A;  3EUB 2;  3SFE B;  3P4Q B;  1TYG B;  4ZHO A;  3ABV B;  2N0S B;  2DBY A;  1OQR A;  2E3T A;  2Y5C A;  2WDV B;  3NVZ A;  4YTP B;  5EE0 A;  1XLN A;  4ITK A;  1WRI A;  2BS4 B;  2EKI A;  1I7H A;  3W9C B;  2PKO A;  5EE3 A;  5AUK A;  2W55 A;  4JWS C;  2WS3 B;  1NVI D;  1KF6 B;  1OQQ A;  1V97 A;  2QIE B;  2DWQ A;  4YSZ B;  3AEB B;  1NI3 A;  3AEE B;  4JX1 C;  1N61 A;  3AE4 B;  1TKE A;  2L83 A;  2W3R A;  1UWM A;  1QOG A;  2MH7 A;  2OHF A;  2ACZ B;  4YSY B;  3BII D;  4WWM A;  3W5V B;  2WU2 B;  1YQ3 B;  3AE1 B;  5H8Y E;  4YTM B;  1TJE A;  1L6U A;  1L0V B;  1L5P A;  3NVY A;  1RYJ A;  1TKY A;  3P4S B;  5EE1 A;  1DOX A;  3AE8 B;  3ETR A;  3HUI A;  4N59 A;  4YSX B;  4US8 A;  1CJE A;  1J7A A;  1FXI A;  1JRO A;  2HTM E;  3WCQ A;  1FM0 D;  3CIR B;  3P4R B;  4US9 A;  3CWI A;  1RWS A;  5GXG B;  4USA A;  3P63 A;  1QF6 A;  1GPX A;  1RFK A;  1EWY C;  4HRO A;  4C80 A;  4YXD B;  1NYR A;  1FRR A;  1XLO A;  2BS2 B;  1NEN B;  3AE3 B;  4ZHP A;  1J7B A;  2WLB A;  1VJK A;  3AE9 B;  3NVV A;  3NVW A;  4C7Y A;  1WYG A;  2K9X A;  1E9M A;  1NYQ A;  3AEF B;  4WQM A; 
#chains in the Genus database with same CATH topology
 4KSL C;  4MH8 A;  1HA5 A;  2LRW A;  3RNC C;  1EWC A;  1WMH B;  1STE A;  2L7R A;  2MA9 B;  4WJO A;  4ANV A;  3RPF C;  1NDD A;  3BVG A;  5E6O A;  4W9C A;  5I4D A;  2KMC A;  3L54 A;  4GSW A;  3NS1 A;  4XDC A;  2DNF A;  1FD6 A;  3ZYY X;  4BVU C;  4XC2 A;  1AN8 A;  1V81 A;  2JXT A;  2IO1 B;  1CZP A;  4JGH B;  4XYC A;  4EOY A;  1ROE A;  1T3Q A;  2FIF A;  5J17 A;  3RUI B;  1GAQ B;  3B2G A;  4R3D A;  3QHT A;  3LYY A;  3VTU A;  4C4V A;  2NMQ A;  3Q3F A;  2IZV B;  3R7Q A;  1VZ8 A;  3B2F A;  3H7P B;  2X38 A;  4BKT A;  5BYR A;  2KAC A;  1Q0W B;  1CMX B;  1HTO A;  5BMH A;  5IOI A;  1E8W A;  2DWQ A;  2EEL A;  4NJ6 A;  4EZK A;  4PT5 A;  1KJT A;  3W5V B;  4DBG A;  4BOZ B;  1Y8R C;  3WAL A;  1IGC A;  1L6U A;  5CTR C;  3A4R A;  2WXN A;  4N59 A;  2HTM E;  1K53 A;  2XN9 C;  4A3P A;  1TBE A;  3P63 A;  5BO4 B;  3D32 A;  2BVC A;  4RM8 A;  2JF5 A;  3KW5 B;  3TL5 A;  2AQ3 B;  2WXO A;  1FCC C;  2FCM A;  2FCQ A;  4LCD E;  4WQM A;  1IUE A;  3TEZ A;  1PYW D;  1V1P B;  2QMT A;  1C79 A;  5IO9 A;  2L0T A;  3TUO A;  2NPT B;  2LI5 A;  5IP4 D;  1PFD A;  1UGM A;  2ZJD A;  4HEA 1;  1AYF A;  1WGK A;  1MVK A;  2BS3 B;  2PEA A;  1DYQ A;  3QWZ B;  5E6J A;  3ECI A;  4HXD A;  2JQR B;  2K1F A;  2PVO D;  3TSS A;  1IGD A;  1I4G A;  2D3A A;  1YJJ A;  2N7J A;  2BF8 B;  3PRM B;  4NJ7 A;  1R4M B;  1PGA A;  3PT2 B;  3AE6 B;  4E71 A;  1GJZ A;  2CJO A;  4RFB A;  4XWT A;  4LDT D;  1XLP A;  4RGT A;  1AW7 A;  1SJE D;  2K8B A;  2FBW B;  2BQQ A;  1N6Z A;  1U4A A;  3N1Y C;  2YEP B;  4FBJ B;  1X1M A;  2DLB A;  2NCN A;  3SU8 X;  4GDK B;  1IBX B;  2INN E;  4GN1 A;  2ZPN A;  3N1Z C;  3W1S A;  3T9L A;  2DBY A;  3VTV A;  3Q8E A;  1NVI D;  1LXD A;  4AJW A;  2KOX A;  2SAK A;  3FKY A;  4ASW C;  3ZNH B;  2IY0 B;  3WAO A;  2D5G A;  1UWM A;  3ZNI D;  4ANU A;  2J0J A;  3KLS X;  2KFK A;  4HCN B;  1TZO A;  3NHE B;  3AE8 B;  2HJ1 A;  2M8S A;  4I6N B;  1Z5S B;  4IOI E;  4EZL A;  1L7Y A;  2UU7 A;  3AE3 B;  1HQR D;  2MWS B;  2NTT A;  2ON8 A;  1V1O A;  4TQ0 A;  4B0E A;  1I4Q A;  3HM3 A;  4K7S A;  3DBH I;  2IDY A;  2K8C A;  4MT5 A;  3VRA B;  2AYO B;  3UIO B;  2I1J A;  4B6W A;  5AUI A;  1C77 A;  1I4H A;  3QX1 A;  5HHD G;  2ZPY A;  4N58 A;  2BT6 A;  1TY0 A;  2JX5 A;  2L32 A;  3QJZ A;  3SHQ A;  1E8X A;  3H6N A;  2K39 A;  3ZTD A;  3KWV A;  1XF5 L;  1D5M C;  4EEW A;  3A1Q B;  3ZXV A;  2LJI A;  1WGG A;  5C23 A;  1P3Q U;  3KWL A;  1SIF A;  2L00 B;  3NZ3 A;  2MBE A;  4MGI E;  1D6E C;  1ZP0 B;  4BKS D;  3DPD A;  3H8H A;  5LXH A;  2FCN A;  3NVZ A;  4OZA A;  4II2 B;  2KC1 A;  2C60 A;  3N9Y C;  2CKH B;  3RNE C;  2D07 B;  4II3 B;  2BGF A;  1NI3 A;  2QEJ C;  3AEE B;  3JW0 X;  3I3T B;  3TBL D;  2ACZ B;  3APC A;  3NOB A;  1CQV A;  4B0M A;  4BAX A;  1L0V B;  5EE1 A;  4US8 A;  3E9S A;  2ZNV B;  2QIL A;  1RWS A;  1YN4 A;  1RFK A;  2BKR B;  2IBI B;  1PQS A;  4UDU C;  1SE4 A;  2BW2 A;  4GOC A;  3VTW A;  4KIK A;  1SSN A;  3PRP B;  4KZC A;  4MDK E;  2ZCB A;  2M1M A;  1NYQ A;  4RH6 A;  1OQY A;  3DHI C;  4K81 A;  1SE3 A;  2NS5 A;  2MJE A;  1RM6 C;  3UIP B;  4ZRP A;  1SB3 C;  2BWE S;  1F77 A;  1D3Z A;  3ZDM C;  4BZA A;  1Q10 A;  4HWI B;  4YWG G;  3ALB A;  4RCO A;  4MSM B;  1P1A A;  2ZNV C;  4ZRK A;  2KWV B;  2N1W A;  3GB1 A;  4KGS A;  1DGJ A;  4E74 A;  1JRP A;  5JZE B;  3W1Y A;  1E7U A;  3AEC B;  3C19 A;  1V86 A;  3PS6 A;  2VRR B;  1QQR A;  2BYE A;  3PO0 A;  1ZXH A;  4CQN A;  1Y56 A;  3NZS A;  2RDG A;  4G11 A;  2MBO A;  4P16 A;  5JXV A;  4LNO A;  3IFW B;  4IUM B;  4RF1 A;  2VH2 A;  1YMH E;  1ESF A;  1VCB A;  2H88 B;  2XK5 B;  4ICV A;  3UQA A;  2KDM A;  3OG5 A;  2JUO A;  1E8Z A;  3X0W A;  2BBC A;  1OQR A;  3V62 A;  4K7W A;  1V97 A;  2QIE B;  2WXR A;  3MJW A;  3BII D;  2LMC A;  3OAW A;  1L5P A;  2WXL A;  1TKY A;  2GBR A;  4EZJ A;  5HG2 A;  1FM0 D;  3GZN I;  1SEB D;  1V5O A;  2GRI A;  1WM3 A;  2XNA C;  1WM2 A;  2X8X X;  3DBL I;  3NVW A;  4HDQ A;  4CHK A;  1XT9 B;  1WJ6 A;  4GMV A;  4BKG A;  4W9G A;  1MG4 A;  3DHH C;  2EMS A;  3ZLZ A;  3AV8 A;  4W9I A;  1JW9 D;  1P7E A;  2L3Z A;  2JYE A;  2K6D B;  1JWU D;  1QT9 A;  4RGM A;  2KYW A;  1KFY B;  1TTN A;  2OJW A;  2QDF A;  4XWW A;  1KOT A;  3EEC A;  2UWQ A;  1ZDX A;  3B9J A;  5J18 A;  2LJ5 A;  1WX9 A;  2A4Z A;  2D3G A;  1I4R A;  3A9K A;  3AED B;  4PYU A;  3BYY B;  3TEY A;  2RPV A;  2V4I B;  2LFI A;  3RNF C;  2KX0 A;  2CS4 A;  2KN4 A;  2N9K A;  2V3P A;  4LK0 M;  4B9K A;  4KDI C;  1SIJ A;  4A20 A;  4RF0 A;  1YQB A;  2EMT A;  2L05 A;  1L4D B;  3VQI A;  1JWM D;  2RSU A;  1G6J A;  2LXC A;  3DBR B;  1M4V A;  1ZPS A;  1SJH D;  2VZK D;  3BVZ A;  3PTF C;  3DVN U;  1VRA B;  1XLQ A;  1K51 A;  4KV2 A;  1C4C A;  2MBB B;  3P4Q B;  2KZR A;  1UH6 A;  4LDT B;  4GLS C;  4IKG A;  2JZ3 B;  2KO3 A;  4YSZ B;  4W9H A;  2V1Y A;  1MPE A;  4A55 A;  5DCN A;  1ZE3 D;  4W9K A;  4G50 A;  1UF0 A;  4JIO U;  1YN3 A;  3APF A;  2I2Y A;  3HUI A;  1JRO A;  4N9F 4;  3WCQ A;  3DQV A;  2C9W B;  2GBJ A;  2KTR A;  3L0W B;  1F1H A;  2V4L A;  4DHJ D;  2GBM A;  1IYF A;  2O2V B;  3S2A A;  2ZW0 A;  2BB6 A;  2LGI A;  3GE3 C;  1ZDV A;  5T8I A;  2WDT B;  4NPN A;  4DK5 A;  2DHZ A;  1KRH A;  4MM3 B;  3C0R B;  2W54 A;  2PVG C;  3W5U B;  1YJ1 A;  4K7U A;  2DZM A;  4NZL B;  2G3Q B;  2I1K A;  2IJ0 A;  4P1C C;  2ZVN A;  2PE9 A;  4L23 A;  4WAA A;  2KWD A;  3ZW3 A;  4ZRI A;  1QIL A;  4PYZ A;  1I4P A;  5BMG A;  3PLU A;  2NR2 A;  1WI0 A;  2MJD A;  1N63 A;  2AQ1 B;  1I4X A;  2G1E A;  3BWU D;  3AXC A;  4DQO C;  2V0G A;  3AE7 B;  3ZJV A;  4TKN A;  4S0R A;  3RMK C;  1OTR B;  2IO3 B;  1J7C A;  3LXF A;  1VZ6 A;  1D5X C;  3AU5 A;  3NG0 A;  1RAX A;  5D7G A;  3EUB 2;  3IHP C;  4WJQ A;  3TCA A;  4KGR A;  3DHG C;  1XLN A;  2AL6 A;  3WAP A;  1XCQ L;  2OED A;  2KXJ A;  4RNA A;  2W55 A;  1P7F A;  3H7S A;  1WJU A;  3ML8 A;  3N32 A;  1C9F A;  3N30 A;  4EFO A;  1XXG A;  1BUI C;  1V9J A;  1WXV A;  2L83 A;  4ICU A;  2C5L C;  4QAY A;  1VD2 A;  1YQ3 B;  2GLS A;  2GBN A;  2L0F A;  2MHJ A;  3R7R A;  1KLV A;  4I6P A;  5DPS A;  1EU3 A;  2L8J A;  2MQJ A;  3A33 B;  4KKJ A;  1FRR A;  4WJN A;  3RI7 C;  1FPY A;  1P9D U;  3R8B A;  1E9M A;  2LHD A;  3H1U A;  5G2N A;  2WQY B;  2G4D B;  4EE2 A;  2BYF A;  2K3U A;  2WXP A;  2O6V A;  2J0K A;  4JWU C;  4LJP B;  3KYC D;  1E7P B;  2PLP A;  2CHW A;  4MAC A;  3K9O B;  4HPM B;  3ZXR A;  4ANW A;  3A9J A;  2ONQ A;  5D3I B;  4D2K A;  3UGB B;  2LD9 A;  1FMA D;  3ML9 A;  3L4P A;  1NEK B;  1YQ4 B;  2WXI A;  3ZNG C;  1UBI A;  2J42 A;  4OVV A;  1LQB A;  2M4N A;  1E0Z A;  4GDL B;  3B0A A;  2L1A A;  2K8H A;  1PUT A;  1ZXI A;  3RCZ A;  4YL8 A;  3PHX B;  3QAQ A;  2PPH A;  3NRZ A;  4W9D A;  1WMH A;  3VRB B;  2JYT A;  1JWB D;  3NUH B;  3KYD D;  1ZKH A;  2PKO A;  4JE3 B;  5EE3 A;  4WIP A;  3LJ3 A;  3EFC A;  1OQQ A;  2DYO A;  1J8C A;  2KC2 A;  3WA0 A;  4W9L A;  3M95 A;  2JWU A;  1N61 A;  3TEX A;  2N7D A;  1Q1O A;  4LJO B;  1QOG A;  4YSY B;  3BVM A;  1KTK A;  2Y3A A;  2WU2 B;  2V3N A;  4FJY A;  1IP9 A;  2LGD A;  4FUL A;  1WH3 A;  3DCG A;  3N20 C;  1TGZ B;  1EF5 A;  5D94 A;  4OVZ A;  4REZ A;  2LVP A;  4HRO A;  3ZUN A;  2NVU I;  4OVU A;  2Z0E B;  4EUT A;  1J7B A;  2WLB A;  3SDL C;  1WGR A;  3QA8 A;  4YTN B;  1GC6 A;  2C7N B;  3H7P A;  2LUM A;  4HJG E;  5FR6 A;  2M0A A;  3P1M A;  2LVQ A;  3JVZ X;  2FUH B;  3BYT B;  3ZQ4 A;  4HRS A;  4AUQ C;  3Q3N C;  4B95 A;  2MW5 A;  1FRD A;  1ZUD 2;  4GB9 A;  2R2O A;  4A6Q A;  4IDI A;  3DBL B;  1L2N A;  2FAZ A;  2LZ6 A;  3OJ3 A;  1I42 A;  3E56 A;  2L52 A;  1VDV A;  2E6X A;  4EKU A;  4TMA B;  3RYT A;  1YX6 B;  2JWZ A;  1VZ7 A;  5TR5 A;  4G0N B;  3I63 C;  4CYE A;  2KLC A;  4K3C A;  1WX7 A;  1F2R C;  1I35 A;  3PGE A;  2KVZ A;  1WR1 A;  4AOF A;  3U2S C;  1B9R A;  1MJD A;  4J6I A;  2IYD B;  4ZRQ A;  2MP2 B;  1FNW A;  1V1P A;  1WXM A;  3HHM A;  3RN9 C;  1SE2 A;  2RDH A;  2NPT A;  1WF9 A;  2HTH A;  2D2Q A;  5JH5 C;  2D10 A;  1P98 A;  4A90 A;  4FHK A;  5FR3 A;  3KUC B;  3FIL B;  1TS3 A;  3PZ8 A;  1WXA A;  2JVC A;  2BKF A;  2E3T A;  4MJS B;  2M0X A;  1I7H A;  4DXG A;  2HE7 A;  2WS3 B;  1P0R A;  1L0Y B;  2YEP F;  2VZK B;  4ARC A;  4M01 A;  1S3S G;  2QHO A;  1GOZ A;  1WX8 A;  1TT5 B;  1WJ4 A;  3OWE B;  4YSX B;  3JYU A;  4HVB A;  2VH1 A;  4H2A A;  2LGS A;  3CSF A;  4M00 A;  1JWS D;  3ZDT A;  3VR9 B;  4GDK A;  1IBX A;  4FXC A;  5D3D A;  1D4B A;  2AEH A;  3I57 A;  1HZ5 A;  5G5H A;  1QLB B;  2XBB C;  2KX3 A;  2IGG A;  2OOB B;  3M63 B;  1SXT A;  2M19 A;  4LNI A;  2KNB A;  3VUW A;  4NAW B;  2KDI A;  2KAN A;  5E6N A;  5H92 C;  4DHJ B;  1V80 A;  3U30 A;  4LLG M;  1TS2 A;  2Z59 B;  2QJL A;  5E6P A;  3IXS A;  3L17 A;  2G9H D;  1MHH E;  1N5X A;  3TJP A;  3Q6B A;  4NNJ B;  2DZJ A;  4W9E A;  2KQ4 X;  2Z8L A;  3AE5 B;  3MTN B;  1T0Y A;  1VR9 A;  2XEW A;  3PZ7 A;  2WU5 B;  1OEY A;  1T5X D;  1D5Z C;  4ZDV A;  1JQ4 A;  4J3O D;  2Y5P A;  2FNJ B;  4KDL B;  2WWZ A;  4DDI D;  1T6B X;  2LXA A;  2GBK A;  2JRI B;  2WDV B;  4M8M A;  2LGX A;  1WFY A;  2BS4 B;  4AP4 C;  4JQW C;  2KFJ A;  2B3A A;  2LHE A;  2BWF A;  4BOS C;  3V6C B;  5DPW A;  5J2R A;  3IG3 A;  2WXH A;  4M0W B;  4TQ1 A;  2NBW B;  4F8C B;  4DHZ B;  2IGD A;  1CJE A;  1FXI A;  2J53 A;  3P4R B;  1QF6 A;  5CHF A;  3A1Q A;  3V3X A;  1XLO A;  3RNB C;  3NJT A;  2WXF A;  3N1X C;  4ZHP A;  2UYZ B;  1VJK A;  2J52 A;  1YOV B;  1T0Q C;  3CST A;  4GXB A;  2A5U A;  3JSV B;  2N4F A;  3GOE A;  5C3J B;  1FCL A;  3LB8 C;  3DOW A;  3Q8B A;  1IPG A;  2JZZ A;  4WUR A;  1LFD A;  4ZYN A;  1CK1 A;  1WGD A;  3VUY A;  1YNT E;  2K5P A;  3DVG Y;  1DOI A;  1ENF A;  3H9D A;  3HK0 A;  3URY A;  2QCZ A;  3RNG C;  3WIM A;  4NJC A;  2KWC A;  4ANX A;  2CU3 A;  1WWT A;  2KK8 A;  1QOB A;  1FNV A;  1UWX A;  2KKC A;  4HKQ A;  2PIA A;  3I9V 1;  2KMA A;  2J4X A;  2MCN B;  1SGH A;  5DPT A;  1FXA A;  2DZK A;  1OFF A;  2YLM A;  3BK2 A;  4BBN C;  1ZOY B;  2MJ3 A;  1T0R C;  2AX5 A;  2JXX A;  4URK A;  3AI5 A;  1F0Z A;  4PK1 A;  1TYG B;  2N0S B;  2CHZ A;  5EE0 A;  2Y5C A;  3RNA C;  2KDB A;  2WXK A;  4AQ7 A;  2PJH A;  5LLI A;  2DYM A;  1HZ6 A;  4LNN A;  3AEB B;  1XQQ A;  3QC8 B;  3IBE A;  5G55 A;  2FUG 1;  3ZRC A;  4WAF A;  2MLB A;  4MEL A;  3RT3 B;  4TV3 A;  4G3X B;  1E90 A;  4M8N A;  1RYJ A;  1DOX A;  1JCK B;  4C56 C;  3CWI A;  4JPS A;  3LDZ E;  4C80 A;  2INC C;  2XK5 A;  3L13 A;  2KVR A;  4F7Z A;  3AEF B;  4NQK E;  3EHV A;  4MGK E;  2W82 A;  4KKI A;  2WDR B;  2AL3 A;  4P7I A;  4C4V B;  4DDG D;  5CX3 A;  2JZP A;  2G4S A;  4ZOH C;  1L4Z B;  1WE7 A;  1N62 A;  4KX6 B;  2WP9 B;  1V49 A;  2KN5 A;  3Q69 A;  4FJZ A;  1DOY A;  2KWU B;  1WZ3 A;  3UI3 A;  1J19 A;  3AH7 A;  2N9L A;  4RGO S;  3L10 B;  4M02 A;  2LVO A;  1FFU A;  1EF1 A;  2WDQ B;  2NTS A;  3U4E G;  2I38 A;  3AB5 A;  3HRD D;  2GB1 A;  3ZIM A;  3MHZ A;  4OW0 A;  4JLC A;  1AWD A;  1WZ0 A;  2EKE C;  2N9P C;  1TS4 A;  3AEA B;  5HI1 A;  1RFA A;  2Q5W D;  2CJN A;  1KH0 A;  1V6E A;  5MPO A;  3UQB A;  3I5J C;  1R4N I;  3DBH B;  3P2B A;  3O13 A;  2WNM A;  2R61 A;  3KQ4 A;  3MFG A;  4L2Y A;  3TMP B;  3HM6 X;  1UEL A;  3W2D A;  2DAJ A;  2WGS A;  3CF6 E;  2W3R A;  4I6L B;  5H8Y E;  4IWP A;  1M94 A;  4AJY B;  2CR5 A;  2BB5 A;  1TY2 A;  1EWY C;  4RMA A;  3APD A;  1NEN B;  5AEK B;  2KQ7 A;  4KGT A;  1GNU A;  1WYG A;  1QZE A;  3C8Y A;  3HVZ A;  3VR8 B;  5AZF A;  2DYB A;  4HDO A;  2G45 B;  2N9X A;  3M62 B;  3HIZ A;  3RZW C;  2IND C;  4TUU A;  5JHA A;  3BIN A;  1JAL A;  1BXT A;  3X23 A;  1NI2 A;  1C3T A;  1BT0 A;  4ACF A;  4HK2 A;  1E8Y A;  2M56 B;  3QIJ A;  3PRZ A;  3RFZ B;  4MSQ B;  5IN7 A;  3V05 A;  3ENE A;  3R2T A;  1E6E B;  4ARI A;  1SF0 A;  1R7S A;  1KLG D;  3AMZ A;  4FLH A;  2MSE D;  4KZ0 A;  5FK9 C;  3DDC B;  4A9A A;  2KT7 A;  1HXY D;  1HE8 A;  4HKZ E;  4HJK A;  3L08 A;  2KFK B;  4XGA B;  2KDF B;  1QOF A;  1EU4 A;  5HKH A;  3DWG C;  2NBU A;  1MHX A;  3P4P B;  2O2V A;  2GMI C;  2K25 A;  4GGQ A;  3PSE B;  2M17 A;  1E10 A;  2KJH B;  1LGR A;  5IKC M;  3PHW B;  3AM9 A;  4DWF A;  3U7D A;  3W1S C;  4MM3 A;  2DZI A;  5CHV C;  5FKA C;  5LNK 1;  1XEE A;  2HJ8 A;  2L76 A;  1E7V A;  2FE8 A;  3N3K B;  3IAM 1;  3SFE B;  5LXI B;  3ABV B;  1XD3 B;  3K9P B;  3R3M A;  3VH4 B;  4AWJ A;  1B1Z A;  2BPS A;  3VHT C;  3PVL A;  3TEW A;  4Q2J A;  2MH7 A;  2C7H A;  2KTF A;  4IC7 B;  1HTQ A;  2KHW B;  2N7E A;  3VVW B;  3ETR A;  2OJR A;  1TZ1 A;  1C76 A;  1GPX A;  3KH0 A;  3QCA A;  1WGH A;  4A8X C;  1K50 A;  1NYR A;  4FN2 A;  1ET9 A;  3MJ5 A;  4IW0 A;  3DBR I;  2K9X A;  3TIX A;  1FFV A;  1WXS A;  2AWT A;  2WX1 A;  2PTL A;  3DBS A;  4FAD A;  3SFD B;  3U7Z A;  1V2Y A;  1KM7 A;  3NY5 A;  1HEZ E;  1UD7 A;  2IO0 B;  2QSD A;  3AN1 A;  4GU2 A;  1UBQ A;  3AE2 B;  4XX5 A;  3FC4 A;  1PGB A;  2ZW1 A;  4C7Z A;  1JWA D;  2JPH A;  1TKG A;  1KLU D;  3MHS D;  1YD8 U;  4BKS A;  2KD0 A;  5L83 A;  1RRB A;  5D2M B;  3R2I A;  3GZN B;  2O6V D;  4WWN A;  4PS7 A;  4OHJ A;  2KDE B;  2J7Q B;  4FA6 A;  3U52 E;  4XE0 A;  2LUE A;  2B76 B;  4XZ4 A;  1WRD B;  3L16 A;  2ZZP B;  4KIK B;  3Q8C A;  3IT6 B;  3VH3 B;  3OJ4 B;  1S1Q B;  4S17 A;  3SEB A;  3Q14 C;  1ZGU B;  2MBH A;  4ZHO A;  1WRI A;  2EKI A;  2ICI A;  3WAN A;  1J0G A;  5AUK A;  4WWP A;  5KHO A;  3V60 A;  1E5W A;  4DXF A;  1C4P A;  4JL9 A;  4MGY E;  4JX1 C;  3UF8 A;  4IM3 A;  2JU6 X;  3B1L X;  2D3B A;  4GDL A;  3AE1 B;  3PRE A;  4YTM B;  3U8Z A;  1TJE A;  3P4S B;  2REX A;  1GUA B;  5AZH A;  4US9 A;  3ZKJ C;  2RR9 A;  3Q3M C;  2BS2 B;  4PS3 A;  2MEK A;  4O1N A;  2J0M A;  2PW9 A;  4RGN A;  3AE9 B;  3NVV A;  5CHW A;  3VDZ A;  2DX5 B;  4C7Y A;  2AQ2 B;  2MX2 A;  5JHB A;  4LNF A;  4P6V F;  3ZGZ A;  1PDX A;  2IY1 B;  2C7M B;  2LWP A;  4X57 B;  1F52 A;  2INP E;  1QKZ A;  3PPA A;  3BK1 A;  4GIV A;  3RZF A;  2JRH A;  2LAS A;  3NS8 A;  1YIW A;  3DVN V;  2K22 A;  3IAS 1;  3SD5 A;  1UUP A;  3M3J A;  5IAA C;  1A70 A;  2GOW A;  5BYS A;  3EC8 A;  3QQ8 B;  4ZRJ A;  3Q2A C;  1JML A;  1JRU A;  3AEG B;  4DHZ E;  1RLF A;  2LEK A;  3DVG X;  1UNS A;  2SEB D;  1FIQ A;  2ASQ A;  2Z0D B;  1OEY J;  3MC8 A;  2WX0 A;  3KUD B;  4KVG B;  2KAJ A;  2K6Q A;  1EUV B;  4HPL B;  4OZB A;  4WQO B;  1SE9 A;  5HFY A;  3B08 A;  3PV1 A;  1WSP A;  4NY0 A;  4YTP B;  5KHQ A;  3V61 A;  1V5T A;  3O65 B;  2BYT A;  2DEN B;  2MRP A;  1BML C;  4JWS C;  1MI0 A;  1KF6 B;  4E3C A;  1TIF A;  1AAR A;  1TKE A;  3BY4 B;  3EGR A;  1R4N B;  1FNU A;  1H4R A;  2HDE A;  4K1R B;  3A9K B;  3ZJT A;  4IWO A;  1L0X B;  3T3N A;  2WXJ A;  1FEH A;  3Q8F A;  3RUL A;  3MC0 B;  1SBB B;  3T3O A;  3V6E B;  2MP2 A;  1GB1 A;  5IA7 A;  1C78 A;  1Z2M A;  4WWO A;  3KVF B;  1T0S C;  2FCS A;  3OLM D;  1WY8 A;  3MP9 A;  3VXW A;  3MC9 A;  2GI9 A;  2ZVO A;  1F9J A;  5DPR A;  1L6V A;  3FIL A;  3KUZ A;  3EA6 A;  3P42 A;  1WR6 E;  4MJS A;  1R4M I;  1N60 A;  1V8C A;  2JY6 A;  4L1B A;  4IWQ A;  3Q8A A;  3EFU A;  4ZYS A;  2RMM A;  1LO5 D;  1LM8 B;  2KJ6 A;  3ONS A;  2BYV E;  4NAM A;  4WJP A;  3VAW A;  2WXM A;  1WXQ A;  1OGW A;  1TS5 A;  5G5G A;  3GS2 A;  3GP7 A;  3ZO5 B;  4W9J A;  2HD5 B;  1N5W A;  4RM9 A;  3RD2 A;  1FO4 A;  3AU4 A;  5GMV A;  5L95 C;  4OZC A;  4K3B A;  3Q3J A;  2ZEQ A;  2R2Q A;  2WHI A;  2LGY A;  2NBV B;  5D6J B;  2IGH A;  2KTR B;  2RD0 A;  5EE9 A;  4XDD A;  3NZU A;  1F2R I;  5BMI A;  2RPQ A;  3QAR A;  2KMM A;  5C2T B;  5C1Z A;  3J9C A;  1XO3 A;  3IT4 B;  2QC8 A;  2WXG A;  4NAW A;  2JT4 B;  3ZRF A;  4AS1 A;  1UGJ A;  3ZJU A;  2LRU A;  1A5R A;  1K52 A;  4KSK C;  5EDS A;  1WE6 A;  1Q5W B;  4MEM A;  5AZG A;  4FJV B;  4DXA B;  2OHF A;  2V9H A;  3Q3O C;  3A4S C;  1YN5 A;  2PMV A;  4WWM A;  2ZCC A;  3NVY A;  3CMM B;  1UZX B;  4F1S A;  4P1B C;  2WYQ A;  2TSS A;  5GXG B;  2MBQ A;  1ZW7 A;  3PZD A;  1MFW A;  4C00 A;  1K8R B;  1XCT L;  2D3C A;  1MG8 A;  3VUX A;  3BZD B;  1EO6 A;  2W3S A;  4IM2 A;  3IVF A;  3HVD A;  4W9F A;  4PS8 A;  1WYW B;  2RGF A;  1YJI A;  1C4A A;  4HLE A;  2H89 B;  4LNK A;  3T8M A;  4MH0 E;  1NBF C;  1WGY A;  2Y5B B;  4LTU A;  2KLG A;  2IO2 B;  2K0P A;  1VLB A;  1ET6 A;  4M0W A;  2PE6 B;  3DWM A;  2RDB C;  4HCP B;  4N6E B;  2CU1 A;  3AUL A;  4WH4 A;  3GE8 C;  2YVC A;  1C1Y B;  3VFK A;  5TSS A;  4BBN F;  1EM7 A;  2BTE A;  1GB4 A;  1FXT B;  1YX5 B;  4TSS A;  4HPP A;  1ISN A;  4YT0 B;  3JSV A;  3SR6 A;  3ZTC A;  2V3S A;  2N1V A;  2D11 A;  3FAH A;  1QOA A;  2KJR A;  3ZNZ B;  3PLV A;  4ITK A;  2O6V B;  4MGZ E;  3W9C B;  2IPK D;  1H8C A;  2N9E B;  3A9J B;  3AE4 B;  2JSV X;  2W9N A;  2WXQ A;  1GC7 A;  5BYQ A;  2FID A;  1WIA A;  1GG3 A;  3UIN B;  4IM0 A;  1J7A A;  3QK0 A;  2KQS A;  3CIR B;  2CHX A;  1WJN A;  4USA A;  3ZVV A;  4BFR A;  4CO7 A;  4NQL B;  4YXD B;  4A3O A;  1ACC A;  1PGX A;  3R66 C;  2DAF A;  4IG7 B;  4FHJ A;  3WAM A; 
#chains in the Genus database with same CATH homology
 3VR9 B;  1FFV A;  4MH8 A;  1HA5 A;  1IBX A;  4FXC A;  5D3D A;  1D4B A;  1EWC A;  3I57 A;  2PTL A;  1HZ5 A;  3AV8 A;  1STE A;  1JW9 D;  5G5H A;  1P7E A;  3SFD B;  1QLB B;  3U7Z A;  2JYE A;  2IGG A;  1HEZ E;  1JWU D;  1QT9 A;  4RGM A;  3RPF C;  2QSD A;  3BVG A;  3AN1 A;  1SXT A;  2M19 A;  5I4D A;  4NAW B;  3AE2 B;  1KFY B;  3NS1 A;  4XDC A;  5H92 C;  3FC4 A;  1PGB A;  4XWW A;  2ZW1 A;  4C7Z A;  4LLG M;  1JWA D;  1ZDX A;  3ZYY X;  3B9J A;  1TS2 A;  1FD6 A;  2QJL A;  1TKG A;  3IXS A;  1I4R A;  1KLU D;  3AED B;  3BYY B;  1AN8 A;  2RPV A;  2G9H D;  1MHH E;  1N5X A;  2V4I B;  2LFI A;  3TEY A;  2JXT A;  2KN4 A;  2N9K A;  1CZP A;  3R2I A;  2V3P A;  4OHJ A;  4LK0 M;  1ROE A;  1T3Q A;  1SIJ A;  3U52 E;  4XE0 A;  4RF0 A;  2KQ4 X;  2Z8L A;  3AE5 B;  1L4D B;  1GAQ B;  2B76 B;  3VQI A;  1VR9 A;  1JWM D;  3PZ7 A;  3B2G A;  4R3D A;  2WU5 B;  3LYY A;  1M4V A;  1ZPS A;  1SJH D;  2VZK D;  3BVZ A;  2NMQ A;  1T5X D;  1VRA B;  3Q8C A;  1D5Z C;  3IT6 B;  1VZ8 A;  4J3O D;  1JQ4 A;  1XLQ A;  2Y5P A;  3B2F A;  1K51 A;  3SEB A;  2X38 A;  5BYR A;  1C4C A;  2KAC A;  3P4Q B;  4ZHO A;  1T6B X;  2WDV B;  1WRI A;  2BS4 B;  2EKI A;  2ICI A;  5BMH A;  4GLS C;  5AUK A;  4IKG A;  2DWQ A;  2LHE A;  4YSZ B;  2EEL A;  4DXF A;  1C4P A;  1MPE A;  4JX1 C;  4PT5 A;  4A55 A;  2WXH A;  2JU6 X;  1ZE3 D;  4TQ1 A;  3W5V B;  3AE1 B;  4YTM B;  1IGC A;  1TJE A;  1L6U A;  1YN3 A;  3P4S B;  2I2Y A;  2WXN A;  3HUI A;  2IGD A;  4N59 A;  1CJE A;  2J53 A;  2HTM E;  1FXI A;  1JRO A;  1K53 A;  3WCQ A;  3P4R B;  2XN9 C;  4US9 A;  1QF6 A;  3P63 A;  3V3X A;  1XLO A;  2AQ3 B;  2BS2 B;  2WXO A;  2MEK A;  2WXF A;  4O1N A;  1FCC C;  4ZHP A;  2PW9 A;  4RGN A;  1VJK A;  3AE9 B;  2J52 A;  3NVV A;  4C7Y A;  2AQ2 B;  2ZW0 A;  2BB6 A;  2LGI A;  4WQM A;  1IUE A;  4P6V F;  3TEZ A;  3ZGZ A;  1ZDV A;  5T8I A;  1PYW D;  1V1P B;  2QMT A;  5C3J B;  1C79 A;  1FCL A;  1PDX A;  3TUO A;  1KRH A;  4MM3 B;  3LB8 C;  2W54 A;  2PVG C;  3W5U B;  2INP E;  3Q8B A;  1PFD A;  4HEA 1;  4NZL B;  1QKZ A;  1AYF A;  1WGK A;  3BK1 A;  1MVK A;  4WUR A;  2BS3 B;  2IJ0 A;  1CK1 A;  1DYQ A;  1YNT E;  2K5P A;  4L23 A;  2KWD A;  1DOI A;  1ENF A;  3URY A;  5E6J A;  2K22 A;  1QIL A;  2JQR B;  1I4P A;  2PVO D;  3IAS 1;  5BMG A;  3TSS A;  1IGD A;  1I4G A;  4NJC A;  1UUP A;  1YJJ A;  2N7J A;  2MJD A;  1N63 A;  1A70 A;  2CU3 A;  1WWT A;  2AQ1 B;  5BYS A;  1QOB A;  1PGA A;  1FNV A;  1I4X A;  3AE6 B;  1UWX A;  2G1E A;  2CJO A;  3BWU D;  4HKQ A;  4RFB A;  2PIA A;  4DQO C;  4XWT A;  1XLP A;  4RGT A;  1AW7 A;  1JML A;  2V0G A;  3AE7 B;  1SJE D;  3AEG B;  3I9V 1;  2J4X A;  2LEK A;  3ZJV A;  2FBW B;  1UNS A;  2SEB D;  1J7C A;  2YEP B;  1FIQ A;  1FXA A;  3LXF A;  1VZ6 A;  1OFF A;  3BK2 A;  1D5X C;  2DLB A;  2KAJ A;  1ZOY B;  2MJ3 A;  5D7G A;  2AX5 A;  4GDK B;  1IBX B;  4OZB A;  2INN E;  1F0Z A;  3EUB 2;  3W1S A;  5HFY A;  1TYG B;  2N0S B;  2DBY A;  4KGR A;  2Y5C A;  1WSP A;  5EE0 A;  4YTP B;  1XLN A;  2BYT A;  1XCQ L;  2OED A;  3Q8E A;  2WXK A;  4RNA A;  1BML C;  2W55 A;  4JWS C;  4AQ7 A;  1P7F A;  2DYM A;  1MI0 A;  1HZ6 A;  1KF6 B;  1NVI D;  2SAK A;  3AEB B;  1C9F A;  1XXG A;  1BUI C;  2FUG 1;  1TKE A;  2L83 A;  4WAF A;  2D5G A;  1UWM A;  3EGR A;  3KLS X;  1FNU A;  1YQ3 B;  2HDE A;  1RYJ A;  1TZO A;  1DOX A;  3AE8 B;  3ZJT A;  1L0X B;  3T3N A;  1JCK B;  2WXJ A;  1FEH A;  3Q8F A;  4C56 C;  3CWI A;  4IOI E;  4JPS A;  3MC0 B;  1SBB B;  3T3O A;  1EU3 A;  1GB1 A;  4KKJ A;  4C80 A;  1C78 A;  1FRR A;  3AE3 B;  1HQR D;  3MP9 A;  3AEF B;  3R8B A;  1E9M A;  2NTT A;  2ON8 A;  2LHD A;  2W82 A;  2GI9 A;  1V1O A;  4TQ0 A;  4KKI A;  1L6V A;  2WQY B;  3FIL A;  4B0E A;  2WDR B;  4EE2 A;  1I4Q A;  2K3U A;  3EA6 A;  3P42 A;  2WXP A;  2JZP A;  1V8C A;  2IDY A;  1N60 A;  4JWU C;  4L1B A;  1E7P B;  2PLP A;  3Q8A A;  4ZOH C;  1L4Z B;  1N62 A;  4ZYS A;  2RMM A;  4MT5 A;  4MAC A;  1LO5 D;  3VRA B;  4KX6 B;  2WP9 B;  4NAM A;  2ONQ A;  2WXM A;  5D3I B;  1WXQ A;  4D2K A;  3Q69 A;  1TS5 A;  1DOY A;  5G5G A;  3GS2 A;  3GP7 A;  1FMA D;  5AUI A;  1C77 A;  1I4H A;  3L4P A;  3UI3 A;  3AH7 A;  2N9L A;  1NEK B;  4RGO S;  5HHD G;  1YQ4 B;  1N5W A;  4N58 A;  1FO4 A;  2BT6 A;  1TY0 A;  2WXI A;  1FFU A;  2J42 A;  2WDQ B;  3U4E G;  2NTS A;  2I38 A;  2JX5 A;  3AB5 A;  2GB1 A;  3HRD D;  4OZC A;  2L32 A;  3MHZ A;  1E0Z A;  4GDL B;  4OW0 A;  1AWD A;  2L1A A;  3KWV A;  1XF5 L;  1D5M C;  1PUT A;  1ZXI A;  2IGH A;  1TS4 A;  5EE9 A;  3AEA B;  4XDD A;  1F2R I;  5HI1 A;  5BMI A;  2Q5W D;  2CJN A;  2LJI A;  2KMM A;  5C2T B;  1KH0 A;  3NRZ A;  3J9C A;  3VRB B;  3KWL A;  5MPO A;  2JYT A;  3NZ3 A;  1JWB D;  1XO3 A;  3NUH B;  3IT4 B;  1D6E C;  1ZP0 B;  3H8H A;  3O13 A;  2WNM A;  3NVZ A;  4OZA A;  2R61 A;  3KQ4 A;  2WXG A;  3MFG A;  2PKO A;  4JE3 B;  5EE3 A;  4L2Y A;  4WIP A;  4AS1 A;  1UGJ A;  3ZJU A;  3N9Y C;  1OQQ A;  3W2D A;  2DYO A;  1K52 A;  2QEJ C;  1NI3 A;  3AEE B;  2JWU A;  1N61 A;  3TEX A;  2W3R A;  1QOG A;  2OHF A;  2ACZ B;  4YSY B;  3BVM A;  1YN5 A;  2PMV A;  4WWM A;  1KTK A;  2Y3A A;  2WU2 B;  5H8Y E;  1CQV A;  4B0M A;  2V3N A;  1L0V B;  3NVY A;  5EE1 A;  4US8 A;  2BB5 A;  3E9S A;  2QIL A;  2TSS A;  1RWS A;  1TY2 A;  5GXG B;  1YN4 A;  1RFK A;  1EWY C;  4OVZ A;  4REZ A;  4HRO A;  1NEN B;  4KGT A;  4UDU C;  1J7B A;  1SE4 A;  2BW2 A;  2WLB A;  1SSN A;  1XCT L;  1WYG A;  4YTN B;  1NYQ A;  3C8Y A;  3HVZ A;  4RH6 A;  3VR8 B;  3BZD B;  2W3S A;  2LUM A;  3HVD A;  4HJG E;  2M0A A;  3P1M A;  1SE3 A;  2MJE A;  1YJI A;  1C4A A;  3BYT B;  3ZQ4 A;  1RM6 C;  4HRS A;  2H89 B;  4ZRP A;  1JAL A;  1BXT A;  1SB3 C;  1F77 A;  2M56 B;  1FRD A;  1ZUD 2;  4A6Q A;  4IDI A;  1Q10 A;  4LTU A;  4YWG G;  3RFZ B;  2K0P A;  4RCO A;  1VLB A;  1ET6 A;  3V05 A;  3E56 A;  2L52 A;  4M0W A;  1VDV A;  2E6X A;  3GB1 A;  4KGS A;  1DGJ A;  3R2T A;  4TMA B;  1E6E B;  1VZ7 A;  3DWM A;  4ARI A;  1SF0 A;  1JRP A;  4N6E B;  1R7S A;  1KLG D;  3AMZ A;  4WH4 A;  3AEC B;  5FK9 C;  4A9A A;  1F2R C;  1HXY D;  4HKZ E;  1QQR A;  3PO0 A;  1QOF A;  1EU4 A;  1ZXH A;  4CQN A;  3U2S C;  3DWG C;  1Y56 A;  5TSS A;  2RDG A;  1MHX A;  3P4P B;  1B9R A;  1EM7 A;  2BTE A;  1GB4 A;  4P16 A;  4ZRQ A;  5JXV A;  1FNW A;  4TSS A;  4RF1 A;  1E10 A;  1V1P A;  1YMH E;  1ESF A;  2H88 B;  4YT0 B;  3SR6 A;  3AM9 A;  1SE2 A;  2RDH A;  2KDM A;  5FKA C;  5LNK 1;  4A90 A;  1XEE A;  3FAH A;  5FR3 A;  1QOA A;  2BBC A;  3FIL B;  1TS3 A;  3PZ8 A;  2FE8 A;  3IAM 1;  3SFE B;  3ABV B;  1OQR A;  2E3T A;  4ITK A;  1I7H A;  3W9C B;  4DXG A;  2IPK D;  2WS3 B;  1B1Z A;  1V97 A;  2QIE B;  2WXR A;  3TEW A;  4Q2J A;  3AE4 B;  2JSV X;  1L0Y B;  2WXQ A;  2YEP F;  2VZK B;  2MH7 A;  4ARC A;  3BII D;  2LMC A;  5BYQ A;  1GOZ A;  1L5P A;  2WXL A;  1TKY A;  3ETR A;  3OWE B;  4YSX B;  1J7A A;  5HG2 A;  1C76 A;  1FM0 D;  3CIR B;  1SEB D;  4USA A;  1GPX A;  2GRI A;  4A8X C;  4YXD B;  1K50 A;  1NYR A;  2XNA C;  1ET9 A;  4H2A A;  1ACC A;  3MJ5 A;  1PGX A;  3NVW A;  2K9X A;  1JWS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...