1FRRA

Crystal structure of [2fe-2s] ferredoxin i from equisetum arvense at 1.8 angstroms resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
AYKTVLKTPSGEFTLDVPEGTTILDAAEEAGYDLPFSCRAGACSSCLGKVVSGSVDESEGSFLDDGQMEEGFVLTCIAIPESDLVIETHKEEELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
publication title Structure of [2Fe-2S] ferredoxin I from Equisetum arvense at 1.8 A resolution.
pubmed doi rcsb
source organism Equisetum arvense
molecule tags Electron transfer(iron-sulfur protein)
total genus 20
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1frrA00
1ZOYB 1XLPA 1QOAA 1L5PA 2BT6A 2KMMA 1NVID 3AEEB 4YSZB 3AB5A 1FM0D 2BS2B 2WU5B 3HVZA 1FRRA 2EKIA 4HROA 1JRPA 4YSYB 4ZHPA 3HRDD 3P4QB 4HRSA 4ITKA 1N60A 1XLQA 3CWIA 4YTNB 1FXIA 1TKGA 1E0ZA 3KWLA 3P1MA 4N59A 3ETRA 2MH7A 1SB3C 4P6VF 1YJIA 1NYQA 2WQYB 4YTPB 3P4SB 3SFDB 1FXAA 1A70A 5C3JB 3B9JA 3L4PA 2PKOA 1YQ4B 4KX6B 3SFEB 3CIRB 3ZYYX 1GAQB 2H88B 4US9A 5AUKA 4USAA 2WP9B 1ZP0B 3PO0A 3AE8B 1YQ3B 3AE4B 2DBYA 3AE1B 2K9XA 3AEFB 2L83A 3NVWA 1E9MA 3W5UB 2AX5A 4JWSC 1OFFA 1RM6C 3NVYA 3AE3B 1TKEA 2W3SA 2Y5CA 2B76B 1JALA 1V8CA 1VLBA 1PUTA 3NRZA 1J7BA 2PIAA 2L52A 1TJEA 1OQQA 1XLNA 2WLBA 2OHFA 4LTUA 2DWQA 1SIJA 1XO3A 1E10A 3AE2B 3FAHA 1JWBD 1F0ZA 3NVVA 2WDQB 1B9RA 1NENB 4ZOHC 2E3TA 1TKYA 2QIEB 3P4PB 1N63A 3NVZA 1L0VB 3AECB 5EE1A 4ZHOA 3AE7B 1QOGA 2FBWB 4YTMB 2ACZB 1DOYA 4C7ZA 1FFVA 1ZUD2 1RWSA 1CJEA 1R7SA 1RYJA 2QJLA 3FC4A 1L6VA 4IDIA 2H89B 4WQMA 5AUIA 5G5GA 5C2TB 3P4RB 4C7YA 1XLOA 3AEBB 5GXGB 1J7AA 1FIQA 1WXQA 2WU2B 5H92C 1VJKA 1JWAD 2JQRB 2M56B 1AWDA 1KFYB 1PDXA 1QT9A 3VR8B 3AEAB 2BS4B 1VDVA 1WYGA 2CU3A 2WS3B 2CJOA 3AE5B 1GPXA 1ZXIA 1N5WA 1N62A 2LEKA 4C80A 1WRIA 1OQRA 2WDVB 3DWGC 1QOBA 1JW9D 3ABVB 3LB8C 3AE9B 3AV8A 1I7HA 3AM9A 4WWMA 1V97A 3W5VB 4US8A 2MJDA 2W55A 1IUEA 2Q5WD 3VR9B 3WCQA 4YSXB 1FFUA 1WWTA 1NI3A 3AN1A 2G1EA 3AEDB 3AMZA 3P63A 4FXCA 4JX1C 3W9CB 1RFKA 4A9AA 1WGKA 1E7PB 1KRHA 3AEGB 1TYGB 1ROEA 2MJEA 1L6UA 3HUIA 2W54A 1JROA 5H8YE 3BIID 2K22A 1UWMA 5EE9A 2M19A 1DOIA 1EWYC 1N5XA 1KF6B 1DGJA 4JWUC 3B2FA 5G5HA 2HTME 1DOXA 1FO4A 2K5PA 1AYFA 2JX5A 3VRAB 1J7CA 1T3QA 5MPOA 1NEKB 2W3RA 3LXFA 1FRDA 1N61A 2MJ3A 2N0SB 3B2GA 2PVOD 2BS3B 3EUB2 3NS1A 5EE0A 3RPFC 1QF6A 1JQ4A 5EE3A 1PFDA 1SF0A 2PVGC 4N58A 2CJNA 3SR6A 3AH7A 4YXDB 1CZPA 1QLBB 1FMAD 2KAJA 1QOFA 3VRBB 1YJJA 3AE6B 4N6EB 1E6EB 4YT0B 1NYRA 3DWMA 2WDRB
chains in the Genus database with same CATH superfamily
3Q14C 3M95A 3W2DA 3DBLB 1SJHD 4R3DA 4HROA 1V6EA 1SBBB 4S0RA 1E0ZA 3MC9A 2MWSB 1P98A 3O65B 2KN5A 2I2YA 2L76A 4LNOA 5AUKA 2N9EB 2KVZA 2WP9B 3Q8FA 3AE4B 2BPSA 3ZNGC 4W9IA 3RNAC 1XCTL 1OFFA 2DYMA 5DPWA 3FKYA 1TS3A 4JE3B 3KLSX 4URKA 4GN1A 5IAAC 4PS7A 1XLNA 3VTWA 3ENEA 1ZDXA 1F0ZA 1C4CA 2LXCA 2E3TA 1RRBA 2VH2A 4WWPA 1DOYA 1RWSA 1JCKB 5D3IB 3R3MA 5AUIA 1UELA 1YOVB 2L1AA 4ZHOA 4G3XB 1C4PA 1JWAD 4FA6A 1QT9A 3VR8B 1GC6A 4LNKA 2KFKB 1MVKA 5L95C 1J8CA 2ZPNA 5T8IA 2KXJA 2DX5B 4W9JA 1VRAB 3H9DA 2G1EA 3JSVA 1P0RA 2LMCA 4A9AA 3H8HA 2KQSA 4IUMB 3V3XA 2AQ2B 4IM3A 4I6PA 4A8XC 2N7EA 2DENB 5G5HA 4AQ7A 1DOXA 1VZ8A 2FCSA 4IM2A 2L32A 2DZIA 4IW0A 1K8RB 2M1MA 5EE0A 1I4GA 1GG3A 3O13A 1WXVA 3SR6A 4MT5A 2BYTA 2WX0A 4PYZA 2JPHA 2AQ3B 2KD0A 1QOAA 2BS2B 4ZHPA 3HRDD 3U7ZA 2YEPB 3GE3C 1XLQA 2ZJDA 1C3TA 2ONQA 4DWFA 4ANUA 4X57B 2BKFA 3ZTDA 2JYEA 2KX3A 2JXXA 2LI5A 1XF5L 2KYWA 1YNTE 3A4RA 1V5TA 1YN3A 2C7HA 2KDFB 3TEZA 4DDGD 1E9MA 3U7DA 2D07B 4XC2A 2HTHA 1V8CA 3EFCA 2KC1A 1PUTA 3DBSA 1J7BA 2ASQA 2LUMA 2IDYA 1OQQA 3MHZA 1JMLA 2OHFA 1EF1A 2DWQA 3PRPB 4BOSC 3HVDA 1CMXB 4IC7B 4XWWA 2JRHA 3V60A 2J52A 3T3OA 3AU5A 5GMVA 2QILA 4C4VB 2ACZB 2K6DB 1R7SA 2I38A 5G5GA 4DXGA 2NBVB 2IY0B 4M01A 3U52E 1AWDA 3RNEC 1WJNA 2R2QA 1UUPA 2LWPA 2V9HA 2KNBA 3I57A 1SIFA 3GZNI 1JWUD 4XWTA 2L8JA 2FE8A 3AE5B 4DK5A 1GPXA 1ZXIA 2D5GA 3NZSA 2MJDA 2Q5WD 4YSXB 1ZPSA 1WJ6A 3AEDB 4JX1C 3GOEA 4M00A 1T5XD 2WX1A 2KVRA 4HXDA 4KGRA 4KSLC 2K5PA 3TEWA 1E90A 1L7YA 2EMTA 3MC8A 2MHJA 2N0SB 2PVOD 1QF6A 3EFUA 1A5RA 4W9LA 4AWJA 5E6PA 2LGDA 1FMAD 1L4ZB 1VR9A 3Q3FA 2K25A 2PEAA 4OZAA 3OAWA 1L2NA 3DHGC 2AQ1B 1WGDA 2Y5BB 2BVCA 4ASWC 2BT6A 2K1FA 2DAFA 1B1ZA 3GP7A 4WWOA 1SB3C 4MEMA 2B3AA 4GXBA 4W9EA 2PKOA 4GMVA 1EM7A 1WSPA 4US9A 3IAM1 1ZP0B 2MBOA 3NY5A 2FCMA 3DHHC 4OVVA 3Q8CA 1TY2A 2O2VB 2Y5CA 3I5JC 4WQOB 3Q69A 2PIAA 1QKZA 4WJPA 5FR6A 2GBRA 4FN2A 3M62B 2KLGA 3T9LA 1GOZA 1AARA 2K8CA 5TSSA 2WU2B 3VUXA 3KUCB 3K9OB 4WAFA 1YX5B 2KX0A 5CHFA 2CU3A 2WS3B 2CJOA 3QHTA 3ZQ4A 3TSSA 4FLHA 1WGGA 3HM3A 4C80A 1HZ5A 1OQRA 2ZVNA 4BAXA 2PJHA 5JXVA 3TUOA 1S1QB 3QC8B 3WCQA 1FFUA 1RFKA 1K51A 3J9CA 2XN9C 4XYCA 1ZGUB 2G45B 2LJIA 1UWMA 3RCZA 1WX8A 2K3UA 3JSVB 1EUVB 1SJED 2LASA 1JWMD 5MPOA 3BVZA 3NS1A 1JQ4A 4HK2A 1YMHE 2Z0DB 4YXDB 3PLVA 4PYUA 4OW0A 3VRBB 3APDA 2L0TA 4G0NB 2J53A 4MSMB 2IYDB 4A3PA 2MBEA 2EMSA 1TIFA 2NBUA 2LHDA 1FXTB 4W9FA 5BYSA 3L08A 1A70A 1UGJA 3P42A 3EGRA 3NHEB 3C19A 2LZ6A 3QARA 1BUIC 1LQBA 4NJ6A 2AL6A 3AE1B 3U2SC 1HTQA 2IPKD 4JLCA 3AE3B 5G55A 1D6EC 1F52A 4MDKE 4K7WA 2LFIA 2WLBA 2N9LA 3EA6A 4JQWC 2WXKA 2DLBA 1QQRA 1ZUD2 3D32A 4WQMA 3FC4A 3BK2A 1SE9A 2KDMA 3UGBB 4LNFA 3C0RB 4OZBA 1XQQA 3ONSA 2A5UA 3X0WA 2MBHA 2L05A 3L54A 1JWSD 2MW5A 3VR9B 4WWNA 3ZUNA 1D5XC 5I4DA 4FHJA 5DPRA 3MFGA 5AZHA 5E6JA 3A9JB 1V86A 1L6UA 1C9FA 1DOIA 4M0WB 1DGJA 2KZRA 3Q3JA 1DYQA 4XDDA 1FO4A 3ZDTA 2KC2A 3URYA 4ZRJA 2OJRA 3LXFA 3DCGA 1WX7A 1GJZA 1WY8A 1N61A 2MJ3A 1YN5A 4N9F4 4XE0A 2FCQA 3DBHI 1WXAA 3R7QA 1E7VA 4WURA 3E56A 5FK9C 2KAJA 4I6NB 3H1UA 1K52A 2ZZPB 3R66C 4HLEA 1OEYJ 3DQVA 2IGHA 2Y5PA 1FRRA 1CK1A 3WIMA 3P4QB 3WANA 4A6QA 4BKGA 2N9KA 4N59A 4P1CC 3V6CB 4YTPB 1NBFC 2QCZA 4ANXA 3L13A 3GS2A 1ZDVA 4BBNC 3IFWB 4KZ0A 2MBBB 3DPDA 4XDCA 2DHZA 3JYUA 1KLUD 1B9RA 3L16A 2M8SA 3PGEA 4JL9A 2QIEB 3UIPB 1QOGA 5LXHA 4GOCA 3PSEB 2EKEC 1L6VA 2KK8A 3NJTA 1KLVA 1XCQL 3AEBB 2PLPA 1PDXA 1E8ZA 2JZPA 1SE2A 5BMHA 4M8MA 1J0GA 2IGDA 2LXAA 2QC8A 3ABVB 1JW9D 3ALBA 4IWPA 4US8A 4NQKE 3R2IA 2QHOA 3PLUA 2C7MB 4WJOA 1WWTA 4XGAB 1ROEA 4BZAA 1TS2A 3NZ3A 1ZXHA 4ARIA 1N5XA 4E74A 3A1QB 3N1XC 1AYFA 3RYTA 2Z59B 3QJZA 5DPSA 3RPFC 3T8MA 4KDIC 1WE6A 4N58A 2GBJA 4CYEA 5J17A 3WAOA 2PPHA 4AUQC 4B6WA 1FEHA 1E5WA 1V1PA 4YSYB 4WJNA 2N9XA 4HRSA 4PS8A 4W9GA 2BQQA 2UYZB 1FXIA 3P1MA 3LJ3A 4FBJB 1YQ3B 2WYQA 5TR5A 3NVWA 1H8CA 2XNAC 1WJ4A 3E9SA 4MSQB 3GZNB 3N32A 1E10A 1EU3A 1HZ6A 2NCNA 2RGFA 3NVZA 1L0VB 3H7PB 2J0MA 2YLMA 4B95A 2WXHA 3VUYA 1E8XA 3UQAA 4MM3A 4EFOA 2I1JA 2K0PA 1GB1A 2BS4B 4RGMA 2WXLA 2K6QA 2KHWB 1F77A 4II2B 5C23A 3ZXRA 1UBIA 3IVFA 1UGMA 2NS5A 2YVCA 3Q6BA 3TIXA 2YEPF 2W54A 3A33B 1TTNA 2NPTA 2K22A 3EECA 2CHZA 4LNIA 1GB4A 4RF1A 4EOYA 5IO9A 2KANA 4NZLB 2G4SA 1FRDA 5J18A 2D3GA 4KIKB 2ZCBA 3ML9A 2JVCA 4EKUA 2BBCA 4NPNA 1WE7A 2EELA 4K3CA 2SAKA 2KDIA 1F2RI 2KOXA 3BWUD 2C7NB 2FAZA 2M0XA 3BINA 3I63C 3U30A 3APFA 2Y3AA 1XLPA 3L17A 2AEHA 2LRUA 2C9WB 1C4AA 1TS5A 3RMKC 2A4ZA 1FNVA 2W82A 3QQ8B 2I1KA 1TKGA 3ZNZB 2LHEA 1FXAA 2GI9A 4KX6B 1N6ZA 1YIWA 5D6JB 3ZVVA 2CHWA 3IT4B 3TEXA 2DBYA 4EZLA 2W3SA 2FUG1 2IO1B 1VLBA 3NRZA 3UIOB 2KN4A 2KWUB 1TS4A 3FAHA 1OQYA 1IPGA 1WR6E 1D4BA 5EDSA 1KM7A 1TKYA 1N63A 2KWDA 3AECB 2LGXA 4HJGE 1IP9A 5H92C 2LGIA 1WRDB 4RGTA 5FKAC 3UF8A 5D94A 4O1NA 2LEKA 4L23A 4PK1A 2KO3A 4JGHB 2IBIB 4K1RB 2PMVA 4L1BA 1YX6B 2NR2A 4D2KA 1WGYA 2K8BA 1TYGB 2D3AA 2MEKA 5E6OA 4JWUC 3UI3A 3S2AA 2PW9A 1F2RC 2RDHA 4WH4A 3APCA 2BYEA 2JWUA 3PREA 1ACCA 1E7UA 2RPQA 2JSVX 1HE8A 1XXGA 1PFDA 2BB5A 3L0WB 2INDC 1YJ1A 3VH3B 2M0AA 3AH7A 5HKHA 3L10B 4RM8A 3NOBA 3KVFB 4YT0B 3DWMA 3DBLI 1L5PA 3K9PB 4YL8A 2NVUI 3TL5A 1FNUA 1WMHB 1N60A 2RD0A 2GOWA 2LVOA 1L0XB 4IWOA 4S17A 2KKCA 3I9V1 3SFDB 1I4HA 1WF9A 1YQ4B 1FCCC 1V1PB 3ZYYX 3ZW3A 3WALA 3PO0A 3AE8B 1YD8U 4LLGM 3HIZA 1MG8A 1NDDA 4H2AA 3BVMA 3DOWA 2NTSA 3JVZX 4LTUA 1XO3A 3AE2B 1WZ3A 3NS8A 1BT0A 2FCNA 2MSED 3TEYA 3ZJTA 4C56C 3PZ8A 3TCAA 2WNMA 4LDTD 2MRPA 2JQRB 2JXTA 1KLGD 1QILA 3DBRI 1QOBA 4RF0A 3AV8A 1L4DB 3ZNID 1V97A 1GNUA 3RT3B 1LFDA 4BVUC 3DBHB 1Y56A 3SEBA 1U4AA 3GB1A 1XT9B 3R7RA 4HDOA 3CMMB 2HTME 3KYDD 4KSKC 1SGHA 3ZGZA 1ESFA 3QIJA 4KGSA 2W3RA 3HM6X 4W9DA 3PVLA 2NPTB 1RLFA 4MELA 1C79A 3B2GA 1WZ0A 4GU2A 2N1VA 4Q2JA 1IBXA 1WH3A 1HQRD 3QWZB 1XEEA 4KVGB 2HJ8A 3QK0A 4MGIE 2IY1B 1Q1OA 2DZKA 5DCNA 1TT5B 4EUTA 1UH6A 4ZRKA 4P7IA 3AB5A 3RN9C 1ISNA 4FADA 2LVQA 3KWLA 2PTLA 4TUUA 4ANVA 1WGHA 1PYWD 2J42A 2ZEQA 1R4NI 4HCPB 1V80A 4BFRA 2M4NA 4HCNB 4USAA 3RNGC 2K9XA 3WAPA 3W5UB 2X8XX 2KT7A 2WXFA 4LJPB 2Z0EB 3ZRCA 2JF5A 5CHWA 4HKZE 1UWXA 2KJ6A 2ZCCA 3RI7C 5EE1A 2FBWB 4W9KA 3PV1A 2ZPYA 5GXGB 1VJKA 1VDVA 1WYGA 3VHTC 4OZCA 1D3ZA 1MJDA 1N62A 4TQ0A 2L7RA 2RMMA 3CSTA 2MX2A 3W5VB 2V3PA 3TJPA 2V4LA 3OLMD 2KWVB 3ZLZA 2V0GA 2MJEA 4MH0E 1JROA 4NAMA 2BYFA 5IP4D 3VUWA 1ZW7A 2BB6A 4I6LB 3R8BA 2NTTA 2BKRB 1E8WA 4IM0A 1HTOA 1QOFA 5BMIA 1D5MC 4W9CA 2RDBC 2L0FA 5G2NA 3HVZA 5JHAA 4TV3A 3Q3MC 2KWCA 2C60A 2OOBB 3LYYA 2M17A 5BO4B 1ET6A 3KWVA 1YJIA 3P4SB 5C3JB 2KFJA 1HXYD 2KFKA 2AYOB 4ACFA 1Q5WB 2H88B 4NQLB 3DVGX 3IAS1 3BZDB 2R2OA 2L00B 2L3ZA 4NAWA 1KTKA 4F8CB 4GB9A 1L0YB 4IKGA 4P16A 1F9JA 1UNSA 3P4PB 2MA9B 1WM2A 1FFVA 4F1SA 1RYJA 4KKJA 2KACA 1P3QU 3CF6E 3V61A 4KV2A 4NNJB 4MJSA 4RNAA 2R61A 3IBEA 4ZYSA 3DWGC 1MPEA 2V3NA 3LB8C 5BYRA 2MP2A 4PS3A 5L83A 3ECIA 2ZW1A 1V2YA 2BW2A 4HJKA 3KYCD 5H8YE 1ZKHA 4A90A 1SSNA 1EWYC 4TMAB 2MBQA 4PT5A 2VZKD 2PE9A 4A55A 3DVNV 2KTFA 3ZTCA 4ANWA 4DXFA 3N30A 2LJ5A 1GUAB 1QLBB 3U4EG 2QSDA 2WXRA 3AE6B 5LNK1 2IGGA 1LM8B 2MCNB 1NI2A 5AZFA 2N1WA 4HKQA 1VZ6A 1R4MI 5LLIA 1GC7A 1V49A 1ZOYB 3BYTB 5D7GA 1IBXB 3OWEB 1NVID 3AEEB 1FM0D 3UQBA 3HK0A 3U8ZA 1I4XA 2Z8LA 2J4XA 4P1BC 3L4PA 3MJ5A 3RNFC 3RFZB 4NJCA 1GAQB 4MACA 2NBWB 3Q8BA 1WFYA 2HE7A 3NVYA 3DDCB 1BMLC 2WGSA 3M63B 4FJZA 3P2BA 4MGYE 4OHJA 2GLSA 3NVVA 4JIOU 4LDTB 4AJWA 2LRWA 3JW0X 4GSWA 1YQBA 3RNCC 3V6EB 1FPYA 2GMIC 2LVPA 3A4SC 1T0SC 1EF5A 1Z5SB 1T0RC 1EU4A 3R2TA 4ICVA 4RCOA 1WRIA 3IT6B 3Q3OC 4WWMA 4KKIA 3ZKJC 3TBLD 3AMZA 2KQ4X 2KMAA 2OJWA 1KRHA 2BWFA 4K7UA 1SE3A 4EZJA 1WI0A 3N9YC 1KF6B 2HDEA 2BWES 4KZCA 3VRAB 1T3QA 1QZEA 1I4RA 4J3OD 4EZKA 2V4IB 2IO3B 2O2VA 3CSFA 3W1YA 3MHSD 1ET9A 5AEKB 4WAAA 3VTVA 5KHOA 4AP4C 3AULA 3ZO5B 2WDRB 3HHMA 4K3BA 4LCDE 2LGYA 4ITKA 4L2YA 4IWQA 4BKSD 3W1SA 2ZNVC 2GRIA 1H4RA 2WQYB 2GBKA 4GDKA 2DYOA 3MC0B 2G4DB 1F1HA 5DPTA 4TKNA 2INNE 3WAMA 4JWSC 3GE8C 3NZUA 1TKEA 1LXDA 2JU6X 1FD6A 1C77A 1VCBA 2L52A 1VZ7A 2HD5B 5CX3A 3DBRB 4YWGG 1T0YA 3PS6A 1KJTA 2G3QB 2ICIA 1I4QA 4NAWB 4ICUA 2FNJB 2H89B 3P4RB 2KQ7A 1WX9A 1FIQA 2D2QA 2V1YA 2SEBD 1V81A 1P7FA 4KGTA 2QDFA 1VD2A 4LJOB 2VRRB 4HPMB 3AE9B 4II3B 2HJ1A 4EE2A 1BXTA 1JRUA 2N9PC 2W55A 4A3OA 3AN1A 3BY4B 2FIDA 4K81A 2K8HA 4MJSB 2KDBA 2NMQA 1PGAA 3ZIMA 3OG5A 3MP9A 4M02A 2MP2B 4G11A 1WM3A 1V1OA 4IOIE 4BBNF 1ZE3D 2BGFA 2XK5A 1T6BX 2J0KA 1WGRA 3B1LX 3FILA 4BKSA 4MGKE 4NY0A 1SF0A 2OEDA 1R4NB 3Q2AC 3Q8AA 3SD5A 3VDZA 2DAJA 2JZ3B 3KH0A 3H7SA 4HVBA 5BYQA 2LGSA 2IO0B 1E6EB 4B0MA 1T0QC 2LD9A 4GDLA 5CHVC 3PZDA 5AZGA 4OVUA 3NG0A 2WXOA 2O6VD 3ETRA 2N7DA 2KJRA 1CQVA 1NYQA 1SE4A 2D10A 4FHKA 1XD3B 3B9JA 4BKTA 1UD7A 1KH0A 1P7EA 2AX5A 1RM6C 1Z2MA 1Q0WB 3B08A 4ZRIA 2INCC 3PZ7A 2CHXA 1TJEA 3PHWB 1LO5D 2DZMA 3A9JA 1EWCA 1JWBD 2J7QB 2WDQB 3ZNHB 4M0WA 3SDLC 4LNNA 3PTFC 3AE7B 2KMCA 2BF8B 4RH6A 1PGBA 5JH5C 2W9NA 3BK1A 3VTUA 3TMPB 1WXQA 4G50A 1WYWB 3RUIB 4REZA 1N5WA 3RULA 4NJ7A 1IGDA 4F7ZA 4YTMB 4B9KA 3BVGA 1I7HA 5IKCM 2VZKB 1E8YA 2N7JA 2C5LC 2KTRA 4WIPA 2RR9A 3QA8A 1UZXB 3AEGB 3AU4A 5LXIB 3DVNU 3IG3A 3BYYB 2CKHB 3B2FA 5D2MB 1TZ1A 2CU1A 3VAWA 1AN8A 1S3SG 1TGZB 3N1ZC 1J7CA 1NEKB 2JY6A 2O6VA 4DHJD 2BS3B 1G6JA 3ML8A 4MM3B 2PVGC 3Q3NC 2AL3A 5E6NA 1CZPA 1Y8RC 4GIVA 4AOFA 5HG2A 4CQNA 2DZJA 1FCLA 4RGOS 1SEBD 1EO6A 3CWIA 4P6VF 4M8NA 2WDTB 2KLCA 3SFEB 2D3CA 2WXNA 3VXWA 2REXA 3RZFA 1UF0A 3AEFB 2JWZA 4ZDVA 1WIAA 2IJ0A 2BYVE 3LDZE 4GDKB 2B76B 2VH1A 4FJVB 4MGZE 3DHIC 2WXGA 3A9KA 4KDLB 2TSSA 3PPAA 3A1QA 2WXPA 3C8YA 1C78A 1CJEA 2QJLA 5C2TB 3AXCA 2WXMA 3M3JA 1XLOA 2GB1A 1KFYB 1TY0A 1UBQA 1MFWA 4AJYB 4TSSA 2XEWA 4DHZB 2WDVB 3AM9A 4FJYA 4HWIB 4E71A 3AI5A 2RDGA 1X1MA 4J6IA 1NI3A 3RD2A 3KW5B 1C1YB 3W9CB 2BTEA 1OEYA 2XBBC 1WGKA 4RM9A 3HUIA 3BIID 1R4MB 2KJHB 3X23A 5J2RA 5IN7A 2D11A 4TQ1A 1I42A 1P9DU 2QMTA 4GGQA 4E3CA 3KQ4A 5D3DA 1PGXA 3UINB 3EC8A 3OJ4B 2X38A 4ZRQA 5KHQA 2XK5B 1FNWA 4EEWA 4LK0M 3N20C 4CHKA 3VQIA 3FILB 4AS1A 1NYRA 4DDID 2ZNVB 5JHBA 3ZJUA 3H7PA 1MHXA 1PQSA 1JRPA 4CO7A 2JUOA 2V3SA 2DYBA 2GBMA 4DBGA 2KDEB 3VH4B 2CR5A 3T3NA 4GDLB 2JT4B 4B0EA 3QCAA 3RNBC 3H6NA 3PT2B 2PE6B 4XX5A 1STEA 2L83A 3VVWB 3PRZA 1WXMA 3QX1A 4A20A 4DQOC 1I35A 3MTNB 3IXSA 1YN4A 5C1ZA 2LUEA 2RPVA 4QAYA 1NENB 4ZOHC 4HPLB 5HI1A 4RMAA 4C7ZA 3N1YC 2N4FA 1ENFA 4KIKA 4C7YA 4HPPA 3KUZA 4C00A 1OGWA 1M4VA 3AEAB 3KUDB 2AWTA 1MI0A 1WR1A 5BMGA 4DXAB 5JZEB 2MLBA 1IUEA 3P63A 1M94A 1SXTA 5HHDG 1E7PB 2QEJC 4UDUC 1WJUA 4ZRPA 4OVZA 3V05A 2K39A 2KTRB 2WHIA 3I3TB 3Q8EA 1MG4A 3V62A 5FR3A 4BOZB 2INPE 1K50A 2GBNA 2CJNA 4FULA 4WJQA 2WXJA 3ZDMC 1Q10A 1IYFA 3ZXVA 2O6VB 4N6EB 2ZW0A 2KMMA 3B0AA 3PHXB 3QAQA 4RGNA 4YSZB 2RSUA 2WU5B 2EKIA 1AW7A 3OJ3A 2J0JA 4IG7B 4YTNB 2MH7A 2IO2B 4HEA1 2UWQA 3CIRB 2WXIA 3ZRFA 2JZZA 3MJWA 3N3KB 1K53A 3SU8X 2IZVB 1TZOA 1MHHE 3RZWC 3PRMB 4RFBA 1HA5A 1HEZE 3VFKA 1JALA 1RFAA 2MQJA 4C4VA 2JRIB 1SIJA 1TBEA 4HDQA 5IOIA 3DVGY 1WXSA 2E6XA 4ARCA 3ZJVA 2WXQA 4IDIA 2DNFA 3A9KB 1J7AA 2M56B 3SHQA 2CS4A 4K7SA 1KOTA 4GLSC 3IHPC 1P1AA 1I4PA 3W1SC 5IA7A 1V9JA 3NUHB 4DHZE 2WWZA 4FXCA 4MH8A 1D5ZC 1WMHA 4DHJB 5EE9A 2M19A 2G9HD 1IGCA 2ZVOA 2JX5A 4JPSA 1C76A 1LGRA 2D3BA 5CTRC 2FUHB 1OTRB 3EUB2 1RAXA 5EE3A 4ZYNA 2JYTA 2FIFA 1J19A 4XZ4A 3EHVA 1YJJA 1V5OA 5HFYA 2ON8A 3WA0A 4W9HA 2UU7A
chains in the Genus database with same CATH topology
2IGHA 3W2DA 3AB5A 2Y5PA 1FRRA 1SJHD 4R3DA 4HROA 1CK1A 3P4QB 1SBBB 4A6QA 2WXOA 1E0ZA 2N9KA 3KWLA 4N59A 2PTLA 3ETRA 1CQVA 1PYWD 2J42A 1NYQA 1SE4A 4YTPB 3B9JA 2I2YA 5AUKA 4USAA 2WP9B 3Q8FA 3AE4B 1KH0A 1P7EA 3GS2A 2K9XA 3W5UB 1XCTL 2AX5A 1OFFA 1RM6C 1ZDVA 2DYMA 2WXFA 1TS3A 4JE3B 3KLSX 3PZ7A 1TJEA 1LO5D 1XLNA 1EWCA 1ZDXA 4XDCA 1JWBD 1F0ZA 1KLUD 4HKZE 1C4CA 2WDQB 1UWXA 1B9RA 4M0WA 2E3TA 2QIEB 5EE1A 3AE7B 1QOGA 2FBWB 1DOYA 4RH6A 1RWSA 1JCKB 1PGBA 5D3IB 1L6VA 5AUIA 3BK1A 2L1AA 4ZHOA 1XCQL 3AEBB 2PLPA 5GXGB 1WXQA 1VJKA 1C4PA 1JWAD 1PDXA 1QT9A 3VR8B 4REZA 1VDVA 1WYGA 1MVKA 4OZCA 2JZPA 1SE2A 5BMHA 5T8IA 1N5WA 1N62A 2IGDA 4TQ0A 1IGDA 2RMMA 4YTMB 3ABVB 1JW9D 3BVGA 3W5VB 1I7HA 2V3PA 4US8A 3R2IA 2VZKB 1VRAB 1WWTA 2G1EA 2N7JA 2LMCA 4WIPA 4A9AA 3AEGB 1ROEA 2MJEA 2V0GA 1TS2A 3H8HA 3NZ3A 1ZXHA 1JROA 3V3XA 2AQ2B 4ARIA 3BYYB 4A8XC 1N5XA 4NAMA 3B2FA 5G5HA 4AQ7A 1DOXA 2BB6A 1AN8A 1VZ8A 1AYFA 1J7CA 2L32A 1NEKB 3RPFC 2BS3B 5EE0A 1I4GA 4MM3B 3O13A 2PVGC 3R8BA 2NTTA 4N58A 3SR6A 1CZPA 4MT5A 2BYTA 1QOFA 5BMIA 5HG2A 1D5MC 4CQNA 1FCLA 2AQ3B 4RGOS 1SEBD 1FEHA 1QOAA 2BS2B 3HVZA 1V1PA 4YSYB 4ZHPA 3HRDD 3U7ZA 4HRSA 3LYYA 2YEPB 1XLQA 3CWIA 1ET6A 1FXIA 2ONQA 3P1MA 4P6VF 3KWVA 1YJIA 3P4SB 2JYEA 5C3JB 1HXYD 3SFEB 1XF5L 2WXNA 1YNTE 2H88B 1YQ3B 3TEZA 1YN3A 3AEFB 3IAS1 3NVWA 1E9MA 2IJ0A 4GDKB 3BZDB 2B76B 1V8CA 2XNAC 3E9SA 1PUTA 1J7BA 2LUMA 2IDYA 1OQQA 3MHZA 1JMLA 2OHFA 2DWQA 1E10A 1KTKA 1EU3A 3HVDA 1L0YB 2WXGA 4IKGA 1HZ6A 4P16A 1UNSA 4XWWA 3P4PB 3NVZA 1L0VB 2J52A 2TSSA 3T3OA 2QILA 2ACZB 2WXPA 3C8YA 1FFVA 2WXHA 1C78A 1CJEA 1R7SA 1RYJA 2I38A 2QJLA 5C2TB 5G5GA 4KKJA 4DXGA 2WXMA 1XLOA 2GB1A 2KACA 3U52E 1AWDA 1KFYB 1TY0A 2K0PA 1GB1A 2BS4B 1UUPA 4RGMA 4XWTA 2WXLA 3I57A 1JWUD 2FE8A 3AE5B 1GPXA 1ZXIA 4RNAA 2D5GA 2R61A 4TSSA 1F77A 4ZYSA 2WDVB 3DWGC 1MPEA 2V3NA 3LB8C 5BYRA 3AM9A 2MJDA 2Q5WD 4YSXB 2RDGA 1NI3A 1ZPSA 3AEDB 4JX1C 3W9CB 2ZW1A 2BTEA 1WGKA 1T5XD 2BW2A 3HUIA 2YEPF 2W54A 5H8YE 3BIID 2K22A 4A90A 1SSNA 1EWYC 4TMAB 1GB4A 4KGRA 4PT5A 2VZKD 4A55A 4TQ1A 4RF1A 2K5PA 3TEWA 4NZLB 2QMTA 1FRDA 3KQ4A 5D3DA 1PGXA 2N0SB 2PVOD 1QF6A 4DXFA 2BBCA 2EELA 2SAKA 2X38A 4ZRQA 1F2RI 1QLBB 3U4EG 1FNWA 1FMAD 4LK0M 1L4ZB 2QSDA 2WXRA 3BWUD 1VR9A 3AE6B 5LNK1 3VQIA 2IGGA 4OZAA 3FILB 4AS1A 1NYRA 2AQ1B 4HKQA 1VZ6A 2Y3AA 3ZJUA 1ZOYB 1XLPA 3BYTB 5D7GA 1IBXB 2BT6A 3OWEB 1NVID 1MHXA 3AEEB 1C4AA 1FM0D 1TS5A 1JRPA 1FNVA 2W82A 1TKGA 1B1ZA 3GP7A 1SB3C 2LHEA 1I4XA 2Z8LA 2J4XA 3T3NA 4GDLB 1FXAA 4B0EA 3L4PA 2GI9A 2PKOA 3MJ5A 4KX6B 1EM7A 4NJCA 3RFZB 1GAQB 1WSPA 4US9A 4MACA 3IAM1 1ZP0B 3IT4B 3TEXA 3Q8BA 2DBYA 1STEA 2L83A 3Q8CA 3NVYA 1TY2A 2W3SA 2FUG1 2Y5CA 4DQOC 1BMLC 3Q69A 1VLBA 3NRZA 2PIAA 1QKZA 3IXSA 2KN4A 1YN4A 1TS4A 3FAHA 4OHJA 2RPVA 3NVVA 1D4BA 1NENB 4ZOHC 1TKYA 1N63A 1GOZA 5HI1A 2KWDA 3AECB 4C7ZA 5TSSA 1ENFA 4C7YA 4HJGE 2WU2B 5H92C 1EU4A 2LGIA 1M4VA 3AEAB 3R2TA 4RGTA 5FKAC 4WAFA 2CU3A 2WS3B 2CJOA 4O1NA 3ZQ4A 3TSSA 4RCOA 2LEKA 4C80A 1MI0A 1WRIA 1HZ5A 4L23A 1OQRA 3IT6B 5BMGA 5JXVA 4WWMA 3TUOA 4KKIA 2PMVA 3WCQA 1IUEA 4L1BA 1FFUA 3P63A 3AMZA 4D2KA 1RFKA 2KQ4X 1SXTA 5HHDG 1E7PB 1KRHA 1K51A 1TYGB 3J9CA 2XN9C 2QEJC 2MEKA 1SE3A 4UDUC 2LJIA 1UWMA 4ZRPA 3N9YC 1KF6B 2HDEA 4OVZA 4JWUC 3V05A 2K3UA 3UI3A 2PW9A 1F2RC 2RDHA 4WH4A 1SJED 3VRAB 3Q8EA 1T3QA 1JWMD 5MPOA 2JWUA 1ACCA 1I4RA 4J3OD 3BVZA 5FR3A 3NS1A 1JQ4A 2JSVX 2INPE 2V4IB 1K50A 1XXGA 1PFDA 1YMHE 2BB5A 2CJNA 1ET9A 2WXJA 2M0AA 3AH7A 4YXDB 1Q10A 4OW0A 3VRBB 4N6EB 2J53A 4YT0B 3DWMA 2ZW0A 2WDRB 1L5PA 2KMMA 4RGNA 4YSZB 2WU5B 2EKIA 1AW7A 1FNUA 4ITKA 1N60A 2LHDA 4L2YA 4YTNB 3W1SA 1L0XB 2MH7A 5BYSA 3I9V1 2GRIA 2WQYB 3SFDB 1A70A 1UGJA 1I4HA 3EGRA 3P42A 4HEA1 1YQ4B 2DYOA 1FCCC 3CIRB 1V1PB 3MC0B 3ZYYX 2WXIA 3PO0A 3AE8B 2INNE 1BUIC 1K53A 1TZOA 3AE1B 3U2SC 2IPKD 4LLGM 1MHHE 4JWSC 4RFBA 1HA5A 1HEZE 3AE3B 1TKEA 1JALA 1D6EC 4H2AA 2LFIA 2JU6X 1FD6A 1C77A 2L52A 2WLBA 2N9LA 3BVMA 2NTSA 4LTUA 1SIJA 1XO3A 3EA6A 3AE2B 1VZ7A 2WXKA 2E6XA 4YWGG 4ARCA 3ZJVA 3TEYA 3ZJTA 2WXQA 2DLBA 2ICIA 1I4QA 1QQRA 1ZUD2 4NAWB 4C56C 4WQMA 4IDIA 3FC4A 2H89B 3BK2A 3PZ8A 3P4RB 2WNMA 2KDMA 1FIQA 1J7AA 2M56B 2JQRB 4OZBA 2SEBD 1P7FA 2JXTA 1KLGD 4KGTA 4GLSC 1QILA 1JWSD 1I4PA 1QOBA 4RF0A 3AE9B 1L4DB 3AV8A 4EE2A 1V97A 1BXTA 2W55A 3VR9B 1D5XC 3NUHB 3AN1A 4FXCA 4MH8A 5I4DA 1D5ZC 3MFGA 5E6JA 2NMQA 1PGAA 1L6UA 1Y56A 1C9FA 3SEBA 3GB1A 3MP9A 5EE9A 2M19A 1DOIA 2G9HD 1DGJA 1IGCA 1V1OA 2HTME 1DYQA 4XDDA 4IOIE 1FO4A 1ZE3D 3ZGZA 1ESFA 2JX5A 4JPSA 3URYA 1C76A 1T6BX 4KGSA 2W3RA 3LXFA 1N61A 2MJ3A 1YN5A 1C79A 3B2GA 3FILA 3EUB2 4XE0A 5EE3A 2JYTA 1SF0A 2OEDA 4Q2JA 3Q8AA 1IBXA 1HQRD 4WURA 3E56A 5FK9C 2KAJA 5BYQA 1YJJA 1XEEA 5HFYA 2ON8A 1K52A 1E6EB 4B0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOY B;  1XLP A;  1QOA A;  1L5P A;  2BT6 A;  2KMM A;  1NVI D;  3AEE B;  4YSZ B;  3AB5 A;  1FM0 D;  2BS2 B;  2WU5 B;  3HVZ A;  1FRR A;  2EKI A;  4HRO A;  1JRP A;  4YSY B;  4ZHP A;  3HRD D;  3P4Q B;  4HRS A;  4ITK A;  1N60 A;  1XLQ A;  3CWI A;  4YTN B;  1FXI A;  1TKG A;  1E0Z A;  3KWL A;  3P1M A;  4N59 A;  3ETR A;  2MH7 A;  1SB3 C;  4P6V F;  1YJI A;  1NYQ A;  2WQY B;  4YTP B;  3P4S B;  3SFD B;  1FXA A;  1A70 A;  5C3J B;  3B9J A;  3L4P A;  2PKO A;  1YQ4 B;  4KX6 B;  3SFE B;  3CIR B;  3ZYY X;  1GAQ B;  2H88 B;  4US9 A;  5AUK A;  4USA A;  2WP9 B;  1ZP0 B;  3PO0 A;  3AE8 B;  1YQ3 B;  3AE4 B;  2DBY A;  3AE1 B;  2K9X A;  3AEF B;  2L83 A;  3NVW A;  1E9M A;  3W5U B;  2AX5 A;  4JWS C;  1OFF A;  1RM6 C;  3NVY A;  3AE3 B;  1TKE A;  2W3S A;  2Y5C A;  2B76 B;  1JAL A;  1V8C A;  1VLB A;  1PUT A;  3NRZ A;  1J7B A;  2PIA A;  2L52 A;  1TJE A;  1OQQ A;  1XLN A;  2WLB A;  2OHF A;  4LTU A;  2DWQ A;  1SIJ A;  1XO3 A;  1E10 A;  3AE2 B;  3FAH A;  1JWB D;  1F0Z A;  3NVV A;  2WDQ B;  1B9R A;  1NEN B;  4ZOH C;  2E3T A;  1TKY A;  2QIE B;  3P4P B;  1N63 A;  3NVZ A;  1L0V B;  3AEC B;  5EE1 A;  4ZHO A;  3AE7 B;  1QOG A;  2FBW B;  4YTM B;  2ACZ B;  1DOY A;  4C7Z A;  1FFV A;  1ZUD 2;  1RWS A;  1CJE A;  1R7S A;  1RYJ A;  2QJL A;  3FC4 A;  1L6V A;  4IDI A;  2H89 B;  4WQM A;  5AUI A;  5G5G A;  5C2T B;  3P4R B;  4C7Y A;  1XLO A;  3AEB B;  5GXG B;  1J7A A;  1FIQ A;  1WXQ A;  2WU2 B;  5H92 C;  1VJK A;  1JWA D;  2JQR B;  2M56 B;  1AWD A;  1KFY B;  1PDX A;  1QT9 A;  3VR8 B;  3AEA B;  2BS4 B;  1VDV A;  1WYG A;  2CU3 A;  2WS3 B;  2CJO A;  3AE5 B;  1GPX A;  1ZXI A;  1N5W A;  1N62 A;  2LEK A;  4C80 A;  1WRI A;  1OQR A;  2WDV B;  3DWG C;  1QOB A;  1JW9 D;  3ABV B;  3LB8 C;  3AE9 B;  3AV8 A;  1I7H A;  3AM9 A;  4WWM A;  1V97 A;  3W5V B;  4US8 A;  2MJD A;  2W55 A;  1IUE A;  2Q5W D;  3VR9 B;  3WCQ A;  4YSX B;  1FFU A;  1WWT A;  1NI3 A;  3AN1 A;  2G1E A;  3AED B;  3AMZ A;  3P63 A;  4FXC A;  4JX1 C;  3W9C B;  1RFK A;  4A9A A;  1WGK A;  1E7P B;  1KRH A;  3AEG B;  1TYG B;  1ROE A;  2MJE A;  1L6U A;  3HUI A;  2W54 A;  1JRO A;  5H8Y E;  3BII D;  2K22 A;  1UWM A;  5EE9 A;  2M19 A;  1DOI A;  1EWY C;  1N5X A;  1KF6 B;  1DGJ A;  4JWU C;  3B2F A;  5G5H A;  2HTM E;  1DOX A;  1FO4 A;  2K5P A;  1AYF A;  2JX5 A;  3VRA B;  1J7C A;  1T3Q A;  5MPO A;  1NEK B;  2W3R A;  3LXF A;  1FRD A;  1N61 A;  2MJ3 A;  2N0S B;  3B2G A;  2PVO D;  2BS3 B;  3EUB 2;  3NS1 A;  5EE0 A;  3RPF C;  1QF6 A;  1JQ4 A;  5EE3 A;  1PFD A;  1SF0 A;  2PVG C;  4N58 A;  2CJN A;  3SR6 A;  3AH7 A;  4YXD B;  1CZP A;  1QLB B;  1FMA D;  2KAJ A;  1QOF A;  3VRB B;  1YJJ A;  3AE6 B;  4N6E B;  1E6E B;  4YT0 B;  1NYR A;  3DWM A;  2WDR B; 
#chains in the Genus database with same CATH topology
 3Q14 C;  3M95 A;  3W2D A;  3DBL B;  1SJH D;  4R3D A;  4HRO A;  1V6E A;  1SBB B;  4S0R A;  1E0Z A;  3MC9 A;  2MWS B;  1P98 A;  3O65 B;  2KN5 A;  2I2Y A;  2L76 A;  4LNO A;  5AUK A;  2N9E B;  2KVZ A;  2WP9 B;  3Q8F A;  3AE4 B;  2BPS A;  3ZNG C;  4W9I A;  3RNA C;  1XCT L;  1OFF A;  2DYM A;  5DPW A;  3FKY A;  1TS3 A;  4JE3 B;  3KLS X;  4URK A;  4GN1 A;  5IAA C;  4PS7 A;  1XLN A;  3VTW A;  3ENE A;  1ZDX A;  1F0Z A;  1C4C A;  2LXC A;  2E3T A;  1RRB A;  2VH2 A;  4WWP A;  1DOY A;  1RWS A;  1JCK B;  5D3I B;  3R3M A;  5AUI A;  1UEL A;  1YOV B;  2L1A A;  4ZHO A;  4G3X B;  1C4P A;  1JWA D;  4FA6 A;  1QT9 A;  3VR8 B;  1GC6 A;  4LNK A;  2KFK B;  1MVK A;  5L95 C;  1J8C A;  2ZPN A;  5T8I A;  2KXJ A;  2DX5 B;  4W9J A;  1VRA B;  3H9D A;  2G1E A;  3JSV A;  1P0R A;  2LMC A;  4A9A A;  3H8H A;  2KQS A;  4IUM B;  3V3X A;  2AQ2 B;  4IM3 A;  4I6P A;  4A8X C;  2N7E A;  2DEN B;  5G5H A;  4AQ7 A;  1DOX A;  1VZ8 A;  2FCS A;  4IM2 A;  2L32 A;  2DZI A;  4IW0 A;  1K8R B;  2M1M A;  5EE0 A;  1I4G A;  1GG3 A;  3O13 A;  1WXV A;  3SR6 A;  4MT5 A;  2BYT A;  2WX0 A;  4PYZ A;  2JPH A;  2AQ3 B;  2KD0 A;  1QOA A;  2BS2 B;  4ZHP A;  3HRD D;  3U7Z A;  2YEP B;  3GE3 C;  1XLQ A;  2ZJD A;  1C3T A;  2ONQ A;  4DWF A;  4ANU A;  4X57 B;  2BKF A;  3ZTD A;  2JYE A;  2KX3 A;  2JXX A;  2LI5 A;  1XF5 L;  2KYW A;  1YNT E;  3A4R A;  1V5T A;  1YN3 A;  2C7H A;  2KDF B;  3TEZ A;  4DDG D;  1E9M A;  3U7D A;  2D07 B;  4XC2 A;  2HTH A;  1V8C A;  3EFC A;  2KC1 A;  1PUT A;  3DBS A;  1J7B A;  2ASQ A;  2LUM A;  2IDY A;  1OQQ A;  3MHZ A;  1JML A;  2OHF A;  1EF1 A;  2DWQ A;  3PRP B;  4BOS C;  3HVD A;  1CMX B;  4IC7 B;  4XWW A;  2JRH A;  3V60 A;  2J52 A;  3T3O A;  3AU5 A;  5GMV A;  2QIL A;  4C4V B;  2ACZ B;  2K6D B;  1R7S A;  2I38 A;  5G5G A;  4DXG A;  2NBV B;  2IY0 B;  4M01 A;  3U52 E;  1AWD A;  3RNE C;  1WJN A;  2R2Q A;  1UUP A;  2LWP A;  2V9H A;  2KNB A;  3I57 A;  1SIF A;  3GZN I;  1JWU D;  4XWT A;  2L8J A;  2FE8 A;  3AE5 B;  4DK5 A;  1GPX A;  1ZXI A;  2D5G A;  3NZS A;  2MJD A;  2Q5W D;  4YSX B;  1ZPS A;  1WJ6 A;  3AED B;  4JX1 C;  3GOE A;  4M00 A;  1T5X D;  2WX1 A;  2KVR A;  4HXD A;  4KGR A;  4KSL C;  2K5P A;  3TEW A;  1E90 A;  1L7Y A;  2EMT A;  3MC8 A;  2MHJ A;  2N0S B;  2PVO D;  1QF6 A;  3EFU A;  1A5R A;  4W9L A;  4AWJ A;  5E6P A;  2LGD A;  1FMA D;  1L4Z B;  1VR9 A;  3Q3F A;  2K25 A;  2PEA A;  4OZA A;  3OAW A;  1L2N A;  3DHG C;  2AQ1 B;  1WGD A;  2Y5B B;  2BVC A;  4ASW C;  2BT6 A;  2K1F A;  2DAF A;  1B1Z A;  3GP7 A;  4WWO A;  1SB3 C;  4MEM A;  2B3A A;  4GXB A;  4W9E A;  2PKO A;  4GMV A;  1EM7 A;  1WSP A;  4US9 A;  3IAM 1;  1ZP0 B;  2MBO A;  3NY5 A;  2FCM A;  3DHH C;  4OVV A;  3Q8C A;  1TY2 A;  2O2V B;  2Y5C A;  3I5J C;  4WQO B;  3Q69 A;  2PIA A;  1QKZ A;  4WJP A;  5FR6 A;  2GBR A;  4FN2 A;  3M62 B;  2KLG A;  3T9L A;  1GOZ A;  1AAR A;  2K8C A;  5TSS A;  2WU2 B;  3VUX A;  3KUC B;  3K9O B;  4WAF A;  1YX5 B;  2KX0 A;  5CHF A;  2CU3 A;  2WS3 B;  2CJO A;  3QHT A;  3ZQ4 A;  3TSS A;  4FLH A;  1WGG A;  3HM3 A;  4C80 A;  1HZ5 A;  1OQR A;  2ZVN A;  4BAX A;  2PJH A;  5JXV A;  3TUO A;  1S1Q B;  3QC8 B;  3WCQ A;  1FFU A;  1RFK A;  1K51 A;  3J9C A;  2XN9 C;  4XYC A;  1ZGU B;  2G45 B;  2LJI A;  1UWM A;  3RCZ A;  1WX8 A;  2K3U A;  3JSV B;  1EUV B;  1SJE D;  2LAS A;  1JWM D;  5MPO A;  3BVZ A;  3NS1 A;  1JQ4 A;  4HK2 A;  1YMH E;  2Z0D B;  4YXD B;  3PLV A;  4PYU A;  4OW0 A;  3VRB B;  3APD A;  2L0T A;  4G0N B;  2J53 A;  4MSM B;  2IYD B;  4A3P A;  2MBE A;  2EMS A;  1TIF A;  2NBU A;  2LHD A;  1FXT B;  4W9F A;  5BYS A;  3L08 A;  1A70 A;  1UGJ A;  3P42 A;  3EGR A;  3NHE B;  3C19 A;  2LZ6 A;  3QAR A;  1BUI C;  1LQB A;  4NJ6 A;  2AL6 A;  3AE1 B;  3U2S C;  1HTQ A;  2IPK D;  4JLC A;  3AE3 B;  5G55 A;  1D6E C;  1F52 A;  4MDK E;  4K7W A;  2LFI A;  2WLB A;  2N9L A;  3EA6 A;  4JQW C;  2WXK A;  2DLB A;  1QQR A;  1ZUD 2;  3D32 A;  4WQM A;  3FC4 A;  3BK2 A;  1SE9 A;  2KDM A;  3UGB B;  4LNF A;  3C0R B;  4OZB A;  1XQQ A;  3ONS A;  2A5U A;  3X0W A;  2MBH A;  2L05 A;  3L54 A;  1JWS D;  2MW5 A;  3VR9 B;  4WWN A;  3ZUN A;  1D5X C;  5I4D A;  4FHJ A;  5DPR A;  3MFG A;  5AZH A;  5E6J A;  3A9J B;  1V86 A;  1L6U A;  1C9F A;  1DOI A;  4M0W B;  1DGJ A;  2KZR A;  3Q3J A;  1DYQ A;  4XDD A;  1FO4 A;  3ZDT A;  2KC2 A;  3URY A;  4ZRJ A;  2OJR A;  3LXF A;  3DCG A;  1WX7 A;  1GJZ A;  1WY8 A;  1N61 A;  2MJ3 A;  1YN5 A;  4N9F 4;  4XE0 A;  2FCQ A;  3DBH I;  1WXA A;  3R7Q A;  1E7V A;  4WUR A;  3E56 A;  5FK9 C;  2KAJ A;  4I6N B;  3H1U A;  1K52 A;  2ZZP B;  3R66 C;  4HLE A;  1OEY J;  3DQV A;  2IGH A;  2Y5P A;  1FRR A;  1CK1 A;  3WIM A;  3P4Q B;  3WAN A;  4A6Q A;  4BKG A;  2N9K A;  4N59 A;  4P1C C;  3V6C B;  4YTP B;  1NBF C;  2QCZ A;  4ANX A;  3L13 A;  3GS2 A;  1ZDV A;  4BBN C;  3IFW B;  4KZ0 A;  2MBB B;  3DPD A;  4XDC A;  2DHZ A;  3JYU A;  1KLU D;  1B9R A;  3L16 A;  2M8S A;  3PGE A;  4JL9 A;  2QIE B;  3UIP B;  1QOG A;  5LXH A;  4GOC A;  3PSE B;  2EKE C;  1L6V A;  2KK8 A;  3NJT A;  1KLV A;  1XCQ L;  3AEB B;  2PLP A;  1PDX A;  1E8Z A;  2JZP A;  1SE2 A;  5BMH A;  4M8M A;  1J0G A;  2IGD A;  2LXA A;  2QC8 A;  3ABV B;  1JW9 D;  3ALB A;  4IWP A;  4US8 A;  4NQK E;  3R2I A;  2QHO A;  3PLU A;  2C7M B;  4WJO A;  1WWT A;  4XGA B;  1ROE A;  4BZA A;  1TS2 A;  3NZ3 A;  1ZXH A;  4ARI A;  1N5X A;  4E74 A;  3A1Q B;  3N1X C;  1AYF A;  3RYT A;  2Z59 B;  3QJZ A;  5DPS A;  3RPF C;  3T8M A;  4KDI C;  1WE6 A;  4N58 A;  2GBJ A;  4CYE A;  5J17 A;  3WAO A;  2PPH A;  4AUQ C;  4B6W A;  1FEH A;  1E5W A;  1V1P A;  4YSY B;  4WJN A;  2N9X A;  4HRS A;  4PS8 A;  4W9G A;  2BQQ A;  2UYZ B;  1FXI A;  3P1M A;  3LJ3 A;  4FBJ B;  1YQ3 B;  2WYQ A;  5TR5 A;  3NVW A;  1H8C A;  2XNA C;  1WJ4 A;  3E9S A;  4MSQ B;  3GZN B;  3N32 A;  1E10 A;  1EU3 A;  1HZ6 A;  2NCN A;  2RGF A;  3NVZ A;  1L0V B;  3H7P B;  2J0M A;  2YLM A;  4B95 A;  2WXH A;  3VUY A;  1E8X A;  3UQA A;  4MM3 A;  4EFO A;  2I1J A;  2K0P A;  1GB1 A;  2BS4 B;  4RGM A;  2WXL A;  2K6Q A;  2KHW B;  1F77 A;  4II2 B;  5C23 A;  3ZXR A;  1UBI A;  3IVF A;  1UGM A;  2NS5 A;  2YVC A;  3Q6B A;  3TIX A;  2YEP F;  2W54 A;  3A33 B;  1TTN A;  2NPT A;  2K22 A;  3EEC A;  2CHZ A;  4LNI A;  1GB4 A;  4RF1 A;  4EOY A;  5IO9 A;  2KAN A;  4NZL B;  2G4S A;  1FRD A;  5J18 A;  2D3G A;  4KIK B;  2ZCB A;  3ML9 A;  2JVC A;  4EKU A;  2BBC A;  4NPN A;  1WE7 A;  2EEL A;  4K3C A;  2SAK A;  2KDI A;  1F2R I;  2KOX A;  3BWU D;  2C7N B;  2FAZ A;  2M0X A;  3BIN A;  3I63 C;  3U30 A;  3APF A;  2Y3A A;  1XLP A;  3L17 A;  2AEH A;  2LRU A;  2C9W B;  1C4A A;  1TS5 A;  3RMK C;  2A4Z A;  1FNV A;  2W82 A;  3QQ8 B;  2I1K A;  1TKG A;  3ZNZ B;  2LHE A;  1FXA A;  2GI9 A;  4KX6 B;  1N6Z A;  1YIW A;  5D6J B;  3ZVV A;  2CHW A;  3IT4 B;  3TEX A;  2DBY A;  4EZL A;  2W3S A;  2FUG 1;  2IO1 B;  1VLB A;  3NRZ A;  3UIO B;  2KN4 A;  2KWU B;  1TS4 A;  3FAH A;  1OQY A;  1IPG A;  1WR6 E;  1D4B A;  5EDS A;  1KM7 A;  1TKY A;  1N63 A;  2KWD A;  3AEC B;  2LGX A;  4HJG E;  1IP9 A;  5H92 C;  2LGI A;  1WRD B;  4RGT A;  5FKA C;  3UF8 A;  5D94 A;  4O1N A;  2LEK A;  4L23 A;  4PK1 A;  2KO3 A;  4JGH B;  2IBI B;  4K1R B;  2PMV A;  4L1B A;  1YX6 B;  2NR2 A;  4D2K A;  1WGY A;  2K8B A;  1TYG B;  2D3A A;  2MEK A;  5E6O A;  4JWU C;  3UI3 A;  3S2A A;  2PW9 A;  1F2R C;  2RDH A;  4WH4 A;  3APC A;  2BYE A;  2JWU A;  3PRE A;  1ACC A;  1E7U A;  2RPQ A;  2JSV X;  1HE8 A;  1XXG A;  1PFD A;  2BB5 A;  3L0W B;  2IND C;  1YJ1 A;  3VH3 B;  2M0A A;  3AH7 A;  5HKH A;  3L10 B;  4RM8 A;  3NOB A;  3KVF B;  4YT0 B;  3DWM A;  3DBL I;  1L5P A;  3K9P B;  4YL8 A;  2NVU I;  3TL5 A;  1FNU A;  1WMH B;  1N60 A;  2RD0 A;  2GOW A;  2LVO A;  1L0X B;  4IWO A;  4S17 A;  2KKC A;  3I9V 1;  3SFD B;  1I4H A;  1WF9 A;  1YQ4 B;  1FCC C;  1V1P B;  3ZYY X;  3ZW3 A;  3WAL A;  3PO0 A;  3AE8 B;  1YD8 U;  4LLG M;  3HIZ A;  1MG8 A;  1NDD A;  4H2A A;  3BVM A;  3DOW A;  2NTS A;  3JVZ X;  4LTU A;  1XO3 A;  3AE2 B;  1WZ3 A;  3NS8 A;  1BT0 A;  2FCN A;  2MSE D;  3TEY A;  3ZJT A;  4C56 C;  3PZ8 A;  3TCA A;  2WNM A;  4LDT D;  2MRP A;  2JQR B;  2JXT A;  1KLG D;  1QIL A;  3DBR I;  1QOB A;  4RF0 A;  3AV8 A;  1L4D B;  3ZNI D;  1V97 A;  1GNU A;  3RT3 B;  1LFD A;  4BVU C;  3DBH B;  1Y56 A;  3SEB A;  1U4A A;  3GB1 A;  1XT9 B;  3R7R A;  4HDO A;  3CMM B;  2HTM E;  3KYD D;  4KSK C;  1SGH A;  3ZGZ A;  1ESF A;  3QIJ A;  4KGS A;  2W3R A;  3HM6 X;  4W9D A;  3PVL A;  2NPT B;  1RLF A;  4MEL A;  1C79 A;  3B2G A;  1WZ0 A;  4GU2 A;  2N1V A;  4Q2J A;  1IBX A;  1WH3 A;  1HQR D;  3QWZ B;  1XEE A;  4KVG B;  2HJ8 A;  3QK0 A;  4MGI E;  2IY1 B;  1Q1O A;  2DZK A;  5DCN A;  1TT5 B;  4EUT A;  1UH6 A;  4ZRK A;  4P7I A;  3AB5 A;  3RN9 C;  1ISN A;  4FAD A;  2LVQ A;  3KWL A;  2PTL A;  4TUU A;  4ANV A;  1WGH A;  1PYW D;  2J42 A;  2ZEQ A;  1R4N I;  4HCP B;  1V80 A;  4BFR A;  2M4N A;  4HCN B;  4USA A;  3RNG C;  2K9X A;  3WAP A;  3W5U B;  2X8X X;  2KT7 A;  2WXF A;  4LJP B;  2Z0E B;  3ZRC A;  2JF5 A;  5CHW A;  4HKZ E;  1UWX A;  2KJ6 A;  2ZCC A;  3RI7 C;  5EE1 A;  2FBW B;  4W9K A;  3PV1 A;  2ZPY A;  5GXG B;  1VJK A;  1VDV A;  1WYG A;  3VHT C;  4OZC A;  1D3Z A;  1MJD A;  1N62 A;  4TQ0 A;  2L7R A;  2RMM A;  3CST A;  2MX2 A;  3W5V B;  2V3P A;  3TJP A;  2V4L A;  3OLM D;  2KWV B;  3ZLZ A;  2V0G A;  2MJE A;  4MH0 E;  1JRO A;  4NAM A;  2BYF A;  5IP4 D;  3VUW A;  1ZW7 A;  2BB6 A;  4I6L B;  3R8B A;  2NTT A;  2BKR B;  1E8W A;  4IM0 A;  1HTO A;  1QOF A;  5BMI A;  1D5M C;  4W9C A;  2RDB C;  2L0F A;  5G2N A;  3HVZ A;  5JHA A;  4TV3 A;  3Q3M C;  2KWC A;  2C60 A;  2OOB B;  3LYY A;  2M17 A;  5BO4 B;  1ET6 A;  3KWV A;  1YJI A;  3P4S B;  5C3J B;  2KFJ A;  1HXY D;  2KFK A;  2AYO B;  4ACF A;  1Q5W B;  2H88 B;  4NQL B;  3DVG X;  3IAS 1;  3BZD B;  2R2O A;  2L00 B;  2L3Z A;  4NAW A;  1KTK A;  4F8C B;  4GB9 A;  1L0Y B;  4IKG A;  4P16 A;  1F9J A;  1UNS A;  3P4P B;  2MA9 B;  1WM2 A;  1FFV A;  4F1S A;  1RYJ A;  4KKJ A;  2KAC A;  1P3Q U;  3CF6 E;  3V61 A;  4KV2 A;  4NNJ B;  4MJS A;  4RNA A;  2R61 A;  3IBE A;  4ZYS A;  3DWG C;  1MPE A;  2V3N A;  3LB8 C;  5BYR A;  2MP2 A;  4PS3 A;  5L83 A;  3ECI A;  2ZW1 A;  1V2Y A;  2BW2 A;  4HJK A;  3KYC D;  5H8Y E;  1ZKH A;  4A90 A;  1SSN A;  1EWY C;  4TMA B;  2MBQ A;  4PT5 A;  2VZK D;  2PE9 A;  4A55 A;  3DVN V;  2KTF A;  3ZTC A;  4ANW A;  4DXF A;  3N30 A;  2LJ5 A;  1GUA B;  1QLB B;  3U4E G;  2QSD A;  2WXR A;  3AE6 B;  5LNK 1;  2IGG A;  1LM8 B;  2MCN B;  1NI2 A;  5AZF A;  2N1W A;  4HKQ A;  1VZ6 A;  1R4M I;  5LLI A;  1GC7 A;  1V49 A;  1ZOY B;  3BYT B;  5D7G A;  1IBX B;  3OWE B;  1NVI D;  3AEE B;  1FM0 D;  3UQB A;  3HK0 A;  3U8Z A;  1I4X A;  2Z8L A;  2J4X A;  4P1B C;  3L4P A;  3MJ5 A;  3RNF C;  3RFZ B;  4NJC A;  1GAQ B;  4MAC A;  2NBW B;  3Q8B A;  1WFY A;  2HE7 A;  3NVY A;  3DDC B;  1BML C;  2WGS A;  3M63 B;  4FJZ A;  3P2B A;  4MGY E;  4OHJ A;  2GLS A;  3NVV A;  4JIO U;  4LDT B;  4AJW A;  2LRW A;  3JW0 X;  4GSW A;  1YQB A;  3RNC C;  3V6E B;  1FPY A;  2GMI C;  2LVP A;  3A4S C;  1T0S C;  1EF5 A;  1Z5S B;  1T0R C;  1EU4 A;  3R2T A;  4ICV A;  4RCO A;  1WRI A;  3IT6 B;  3Q3O C;  4WWM A;  4KKI A;  3ZKJ C;  3TBL D;  3AMZ A;  2KQ4 X;  2KMA A;  2OJW A;  1KRH A;  2BWF A;  4K7U A;  1SE3 A;  4EZJ A;  1WI0 A;  3N9Y C;  1KF6 B;  2HDE A;  2BWE S;  4KZC A;  3VRA B;  1T3Q A;  1QZE A;  1I4R A;  4J3O D;  4EZK A;  2V4I B;  2IO3 B;  2O2V A;  3CSF A;  3W1Y A;  3MHS D;  1ET9 A;  5AEK B;  4WAA A;  3VTV A;  5KHO A;  4AP4 C;  3AUL A;  3ZO5 B;  2WDR B;  3HHM A;  4K3B A;  4LCD E;  2LGY A;  4ITK A;  4L2Y A;  4IWQ A;  4BKS D;  3W1S A;  2ZNV C;  2GRI A;  1H4R A;  2WQY B;  2GBK A;  4GDK A;  2DYO A;  3MC0 B;  2G4D B;  1F1H A;  5DPT A;  4TKN A;  2INN E;  3WAM A;  4JWS C;  3GE8 C;  3NZU A;  1TKE A;  1LXD A;  2JU6 X;  1FD6 A;  1C77 A;  1VCB A;  2L52 A;  1VZ7 A;  2HD5 B;  5CX3 A;  3DBR B;  4YWG G;  1T0Y A;  3PS6 A;  1KJT A;  2G3Q B;  2ICI A;  1I4Q A;  4NAW B;  4ICU A;  2FNJ B;  2H89 B;  3P4R B;  2KQ7 A;  1WX9 A;  1FIQ A;  2D2Q A;  2V1Y A;  2SEB D;  1V81 A;  1P7F A;  4KGT A;  2QDF A;  1VD2 A;  4LJO B;  2VRR B;  4HPM B;  3AE9 B;  4II3 B;  2HJ1 A;  4EE2 A;  1BXT A;  1JRU A;  2N9P C;  2W55 A;  4A3O A;  3AN1 A;  3BY4 B;  2FID A;  4K81 A;  2K8H A;  4MJS B;  2KDB A;  2NMQ A;  1PGA A;  3ZIM A;  3OG5 A;  3MP9 A;  4M02 A;  2MP2 B;  4G11 A;  1WM3 A;  1V1O A;  4IOI E;  4BBN F;  1ZE3 D;  2BGF A;  2XK5 A;  1T6B X;  2J0K A;  1WGR A;  3B1L X;  3FIL A;  4BKS A;  4MGK E;  4NY0 A;  1SF0 A;  2OED A;  1R4N B;  3Q2A C;  3Q8A A;  3SD5 A;  3VDZ A;  2DAJ A;  2JZ3 B;  3KH0 A;  3H7S A;  4HVB A;  5BYQ A;  2LGS A;  2IO0 B;  1E6E B;  4B0M A;  1T0Q C;  2LD9 A;  4GDL A;  5CHV C;  3PZD A;  5AZG A;  4OVU A;  3NG0 A;  2WXO A;  2O6V D;  3ETR A;  2N7D A;  2KJR A;  1CQV A;  1NYQ A;  1SE4 A;  2D10 A;  4FHK A;  1XD3 B;  3B9J A;  4BKT A;  1UD7 A;  1KH0 A;  1P7E A;  2AX5 A;  1RM6 C;  1Z2M A;  1Q0W B;  3B08 A;  4ZRI A;  2INC C;  3PZ7 A;  2CHX A;  1TJE A;  3PHW B;  1LO5 D;  2DZM A;  3A9J A;  1EWC A;  1JWB D;  2J7Q B;  2WDQ B;  3ZNH B;  4M0W A;  3SDL C;  4LNN A;  3PTF C;  3AE7 B;  2KMC A;  2BF8 B;  4RH6 A;  1PGB A;  5JH5 C;  2W9N A;  3BK1 A;  3VTU A;  3TMP B;  1WXQ A;  4G50 A;  1WYW B;  3RUI B;  4REZ A;  1N5W A;  3RUL A;  4NJ7 A;  1IGD A;  4F7Z A;  4YTM B;  4B9K A;  3BVG A;  1I7H A;  5IKC M;  2VZK B;  1E8Y A;  2N7J A;  2C5L C;  2KTR A;  4WIP A;  2RR9 A;  3QA8 A;  1UZX B;  3AEG B;  3AU4 A;  5LXI B;  3DVN U;  3IG3 A;  3BYY B;  2CKH B;  3B2F A;  5D2M B;  1TZ1 A;  2CU1 A;  3VAW A;  1AN8 A;  1S3S G;  1TGZ B;  3N1Z C;  1J7C A;  1NEK B;  2JY6 A;  2O6V A;  4DHJ D;  2BS3 B;  1G6J A;  3ML8 A;  4MM3 B;  2PVG C;  3Q3N C;  2AL3 A;  5E6N A;  1CZP A;  1Y8R C;  4GIV A;  4AOF A;  5HG2 A;  4CQN A;  2DZJ A;  1FCL A;  4RGO S;  1SEB D;  1EO6 A;  3CWI A;  4P6V F;  4M8N A;  2WDT B;  2KLC A;  3SFE B;  2D3C A;  2WXN A;  3VXW A;  2REX A;  3RZF A;  1UF0 A;  3AEF B;  2JWZ A;  4ZDV A;  1WIA A;  2IJ0 A;  2BYV E;  3LDZ E;  4GDK B;  2B76 B;  2VH1 A;  4FJV B;  4MGZ E;  3DHI C;  2WXG A;  3A9K A;  4KDL B;  2TSS A;  3PPA A;  3A1Q A;  2WXP A;  3C8Y A;  1C78 A;  1CJE A;  2QJL A;  5C2T B;  3AXC A;  2WXM A;  3M3J A;  1XLO A;  2GB1 A;  1KFY B;  1TY0 A;  1UBQ A;  1MFW A;  4AJY B;  4TSS A;  2XEW A;  4DHZ B;  2WDV B;  3AM9 A;  4FJY A;  4HWI B;  4E71 A;  3AI5 A;  2RDG A;  1X1M A;  4J6I A;  1NI3 A;  3RD2 A;  3KW5 B;  1C1Y B;  3W9C B;  2BTE A;  1OEY A;  2XBB C;  1WGK A;  4RM9 A;  3HUI A;  3BII D;  1R4M B;  2KJH B;  3X23 A;  5J2R A;  5IN7 A;  2D11 A;  4TQ1 A;  1I42 A;  1P9D U;  2QMT A;  4GGQ A;  4E3C A;  3KQ4 A;  5D3D A;  1PGX A;  3UIN B;  3EC8 A;  3OJ4 B;  2X38 A;  4ZRQ A;  5KHQ A;  2XK5 B;  1FNW A;  4EEW A;  4LK0 M;  3N20 C;  4CHK A;  3VQI A;  3FIL B;  4AS1 A;  1NYR A;  4DDI D;  2ZNV B;  5JHB A;  3ZJU A;  3H7P A;  1MHX A;  1PQS A;  1JRP A;  4CO7 A;  2JUO A;  2V3S A;  2DYB A;  2GBM A;  4DBG A;  2KDE B;  3VH4 B;  2CR5 A;  3T3N A;  4GDL B;  2JT4 B;  4B0E A;  3QCA A;  3RNB C;  3H6N A;  3PT2 B;  2PE6 B;  4XX5 A;  1STE A;  2L83 A;  3VVW B;  3PRZ A;  1WXM A;  3QX1 A;  4A20 A;  4DQO C;  1I35 A;  3MTN B;  3IXS A;  1YN4 A;  5C1Z A;  2LUE A;  2RPV A;  4QAY A;  1NEN B;  4ZOH C;  4HPL B;  5HI1 A;  4RMA A;  4C7Z A;  3N1Y C;  2N4F A;  1ENF A;  4KIK A;  4C7Y A;  4HPP A;  3KUZ A;  4C00 A;  1OGW A;  1M4V A;  3AEA B;  3KUD B;  2AWT A;  1MI0 A;  1WR1 A;  5BMG A;  4DXA B;  5JZE B;  2MLB A;  1IUE A;  3P63 A;  1M94 A;  1SXT A;  5HHD G;  1E7P B;  2QEJ C;  4UDU C;  1WJU A;  4ZRP A;  4OVZ A;  3V05 A;  2K39 A;  2KTR B;  2WHI A;  3I3T B;  3Q8E A;  1MG4 A;  3V62 A;  5FR3 A;  4BOZ B;  2INP E;  1K50 A;  2GBN A;  2CJN A;  4FUL A;  4WJQ A;  2WXJ A;  3ZDM C;  1Q10 A;  1IYF A;  3ZXV A;  2O6V B;  4N6E B;  2ZW0 A;  2KMM A;  3B0A A;  3PHX B;  3QAQ A;  4RGN A;  4YSZ B;  2RSU A;  2WU5 B;  2EKI A;  1AW7 A;  3OJ3 A;  2J0J A;  4IG7 B;  4YTN B;  2MH7 A;  2IO2 B;  4HEA 1;  2UWQ A;  3CIR B;  2WXI A;  3ZRF A;  2JZZ A;  3MJW A;  3N3K B;  1K53 A;  3SU8 X;  2IZV B;  1TZO A;  1MHH E;  3RZW C;  3PRM B;  4RFB A;  1HA5 A;  1HEZ E;  3VFK A;  1JAL A;  1RFA A;  2MQJ A;  4C4V A;  2JRI B;  1SIJ A;  1TBE A;  4HDQ A;  5IOI A;  3DVG Y;  1WXS A;  2E6X A;  4ARC A;  3ZJV A;  2WXQ A;  4IDI A;  2DNF A;  3A9K B;  1J7A A;  2M56 B;  3SHQ A;  2CS4 A;  4K7S A;  1KOT A;  4GLS C;  3IHP C;  1P1A A;  1I4P A;  3W1S C;  5IA7 A;  1V9J A;  3NUH B;  4DHZ E;  2WWZ A;  4FXC A;  4MH8 A;  1D5Z C;  1WMH A;  4DHJ B;  5EE9 A;  2M19 A;  2G9H D;  1IGC A;  2ZVO A;  2JX5 A;  4JPS A;  1C76 A;  1LGR A;  2D3B A;  5CTR C;  2FUH B;  1OTR B;  3EUB 2;  1RAX A;  5EE3 A;  4ZYN A;  2JYT A;  2FIF A;  1J19 A;  4XZ4 A;  3EHV A;  1YJJ A;  1V5O A;  5HFY A;  2ON8 A;  3WA0 A;  4W9H A;  2UU7 A; 
#chains in the Genus database with same CATH homology
 2IGH A;  3W2D A;  3AB5 A;  2Y5P A;  1FRR A;  1SJH D;  4R3D A;  4HRO A;  1CK1 A;  3P4Q B;  1SBB B;  4A6Q A;  2WXO A;  1E0Z A;  2N9K A;  3KWL A;  4N59 A;  2PTL A;  3ETR A;  1CQV A;  1PYW D;  2J42 A;  1NYQ A;  1SE4 A;  4YTP B;  3B9J A;  2I2Y A;  5AUK A;  4USA A;  2WP9 B;  3Q8F A;  3AE4 B;  1KH0 A;  1P7E A;  3GS2 A;  2K9X A;  3W5U B;  1XCT L;  2AX5 A;  1OFF A;  1RM6 C;  1ZDV A;  2DYM A;  2WXF A;  1TS3 A;  4JE3 B;  3KLS X;  3PZ7 A;  1TJE A;  1LO5 D;  1XLN A;  1EWC A;  1ZDX A;  4XDC A;  1JWB D;  1F0Z A;  1KLU D;  4HKZ E;  1C4C A;  2WDQ B;  1UWX A;  1B9R A;  4M0W A;  2E3T A;  2QIE B;  5EE1 A;  3AE7 B;  1QOG A;  2FBW B;  1DOY A;  4RH6 A;  1RWS A;  1JCK B;  1PGB A;  5D3I B;  1L6V A;  5AUI A;  3BK1 A;  2L1A A;  4ZHO A;  1XCQ L;  3AEB B;  2PLP A;  5GXG B;  1WXQ A;  1VJK A;  1C4P A;  1JWA D;  1PDX A;  1QT9 A;  3VR8 B;  4REZ A;  1VDV A;  1WYG A;  1MVK A;  4OZC A;  2JZP A;  1SE2 A;  5BMH A;  5T8I A;  1N5W A;  1N62 A;  2IGD A;  4TQ0 A;  1IGD A;  2RMM A;  4YTM B;  3ABV B;  1JW9 D;  3BVG A;  3W5V B;  1I7H A;  2V3P A;  4US8 A;  3R2I A;  2VZK B;  1VRA B;  1WWT A;  2G1E A;  2N7J A;  2LMC A;  4WIP A;  4A9A A;  3AEG B;  1ROE A;  2MJE A;  2V0G A;  1TS2 A;  3H8H A;  3NZ3 A;  1ZXH A;  1JRO A;  3V3X A;  2AQ2 B;  4ARI A;  3BYY B;  4A8X C;  1N5X A;  4NAM A;  3B2F A;  5G5H A;  4AQ7 A;  1DOX A;  2BB6 A;  1AN8 A;  1VZ8 A;  1AYF A;  1J7C A;  2L32 A;  1NEK B;  3RPF C;  2BS3 B;  5EE0 A;  1I4G A;  4MM3 B;  3O13 A;  2PVG C;  3R8B A;  2NTT A;  4N58 A;  3SR6 A;  1CZP A;  4MT5 A;  2BYT A;  1QOF A;  5BMI A;  5HG2 A;  1D5M C;  4CQN A;  1FCL A;  2AQ3 B;  4RGO S;  1SEB D;  1FEH A;  1QOA A;  2BS2 B;  3HVZ A;  1V1P A;  4YSY B;  4ZHP A;  3HRD D;  3U7Z A;  4HRS A;  3LYY A;  2YEP B;  1XLQ A;  3CWI A;  1ET6 A;  1FXI A;  2ONQ A;  3P1M A;  4P6V F;  3KWV A;  1YJI A;  3P4S B;  2JYE A;  5C3J B;  1HXY D;  3SFE B;  1XF5 L;  2WXN A;  1YNT E;  2H88 B;  1YQ3 B;  3TEZ A;  1YN3 A;  3AEF B;  3IAS 1;  3NVW A;  1E9M A;  2IJ0 A;  4GDK B;  3BZD B;  2B76 B;  1V8C A;  2XNA C;  3E9S A;  1PUT A;  1J7B A;  2LUM A;  2IDY A;  1OQQ A;  3MHZ A;  1JML A;  2OHF A;  2DWQ A;  1E10 A;  1KTK A;  1EU3 A;  3HVD A;  1L0Y B;  2WXG A;  4IKG A;  1HZ6 A;  4P16 A;  1UNS A;  4XWW A;  3P4P B;  3NVZ A;  1L0V B;  2J52 A;  2TSS A;  3T3O A;  2QIL A;  2ACZ B;  2WXP A;  3C8Y A;  1FFV A;  2WXH A;  1C78 A;  1CJE A;  1R7S A;  1RYJ A;  2I38 A;  2QJL A;  5C2T B;  5G5G A;  4KKJ A;  4DXG A;  2WXM A;  1XLO A;  2GB1 A;  2KAC A;  3U52 E;  1AWD A;  1KFY B;  1TY0 A;  2K0P A;  1GB1 A;  2BS4 B;  1UUP A;  4RGM A;  4XWT A;  2WXL A;  3I57 A;  1JWU D;  2FE8 A;  3AE5 B;  1GPX A;  1ZXI A;  4RNA A;  2D5G A;  2R61 A;  4TSS A;  1F77 A;  4ZYS A;  2WDV B;  3DWG C;  1MPE A;  2V3N A;  3LB8 C;  5BYR A;  3AM9 A;  2MJD A;  2Q5W D;  4YSX B;  2RDG A;  1NI3 A;  1ZPS A;  3AED B;  4JX1 C;  3W9C B;  2ZW1 A;  2BTE A;  1WGK A;  1T5X D;  2BW2 A;  3HUI A;  2YEP F;  2W54 A;  5H8Y E;  3BII D;  2K22 A;  4A90 A;  1SSN A;  1EWY C;  4TMA B;  1GB4 A;  4KGR A;  4PT5 A;  2VZK D;  4A55 A;  4TQ1 A;  4RF1 A;  2K5P A;  3TEW A;  4NZL B;  2QMT A;  1FRD A;  3KQ4 A;  5D3D A;  1PGX A;  2N0S B;  2PVO D;  1QF6 A;  4DXF A;  2BBC A;  2EEL A;  2SAK A;  2X38 A;  4ZRQ A;  1F2R I;  1QLB B;  3U4E G;  1FNW A;  1FMA D;  4LK0 M;  1L4Z B;  2QSD A;  2WXR A;  3BWU D;  1VR9 A;  3AE6 B;  5LNK 1;  3VQI A;  2IGG A;  4OZA A;  3FIL B;  4AS1 A;  1NYR A;  2AQ1 B;  4HKQ A;  1VZ6 A;  2Y3A A;  3ZJU A;  1ZOY B;  1XLP A;  3BYT B;  5D7G A;  1IBX B;  2BT6 A;  3OWE B;  1NVI D;  1MHX A;  3AEE B;  1C4A A;  1FM0 D;  1TS5 A;  1JRP A;  1FNV A;  2W82 A;  1TKG A;  1B1Z A;  3GP7 A;  1SB3 C;  2LHE A;  1I4X A;  2Z8L A;  2J4X A;  3T3N A;  4GDL B;  1FXA A;  4B0E A;  3L4P A;  2GI9 A;  2PKO A;  3MJ5 A;  4KX6 B;  1EM7 A;  4NJC A;  3RFZ B;  1GAQ B;  1WSP A;  4US9 A;  4MAC A;  3IAM 1;  1ZP0 B;  3IT4 B;  3TEX A;  3Q8B A;  2DBY A;  1STE A;  2L83 A;  3Q8C A;  3NVY A;  1TY2 A;  2W3S A;  2FUG 1;  2Y5C A;  4DQO C;  1BML C;  3Q69 A;  1VLB A;  3NRZ A;  2PIA A;  1QKZ A;  3IXS A;  2KN4 A;  1YN4 A;  1TS4 A;  3FAH A;  4OHJ A;  2RPV A;  3NVV A;  1D4B A;  1NEN B;  4ZOH C;  1TKY A;  1N63 A;  1GOZ A;  5HI1 A;  2KWD A;  3AEC B;  4C7Z A;  5TSS A;  1ENF A;  4C7Y A;  4HJG E;  2WU2 B;  5H92 C;  1EU4 A;  2LGI A;  1M4V A;  3AEA B;  3R2T A;  4RGT A;  5FKA C;  4WAF A;  2CU3 A;  2WS3 B;  2CJO A;  4O1N A;  3ZQ4 A;  3TSS A;  4RCO A;  2LEK A;  4C80 A;  1MI0 A;  1WRI A;  1HZ5 A;  4L23 A;  1OQR A;  3IT6 B;  5BMG A;  5JXV A;  4WWM A;  3TUO A;  4KKI A;  2PMV A;  3WCQ A;  1IUE A;  4L1B A;  1FFU A;  3P63 A;  3AMZ A;  4D2K A;  1RFK A;  2KQ4 X;  1SXT A;  5HHD G;  1E7P B;  1KRH A;  1K51 A;  1TYG B;  3J9C A;  2XN9 C;  2QEJ C;  2MEK A;  1SE3 A;  4UDU C;  2LJI A;  1UWM A;  4ZRP A;  3N9Y C;  1KF6 B;  2HDE A;  4OVZ A;  4JWU C;  3V05 A;  2K3U A;  3UI3 A;  2PW9 A;  1F2R C;  2RDH A;  4WH4 A;  1SJE D;  3VRA B;  3Q8E A;  1T3Q A;  1JWM D;  5MPO A;  2JWU A;  1ACC A;  1I4R A;  4J3O D;  3BVZ A;  5FR3 A;  3NS1 A;  1JQ4 A;  2JSV X;  2INP E;  2V4I B;  1K50 A;  1XXG A;  1PFD A;  1YMH E;  2BB5 A;  2CJN A;  1ET9 A;  2WXJ A;  2M0A A;  3AH7 A;  4YXD B;  1Q10 A;  4OW0 A;  3VRB B;  4N6E B;  2J53 A;  4YT0 B;  3DWM A;  2ZW0 A;  2WDR B;  1L5P A;  2KMM A;  4RGN A;  4YSZ B;  2WU5 B;  2EKI A;  1AW7 A;  1FNU A;  4ITK A;  1N60 A;  2LHD A;  4L2Y A;  4YTN B;  3W1S A;  1L0X B;  2MH7 A;  5BYS A;  3I9V 1;  2GRI A;  2WQY B;  3SFD B;  1A70 A;  1UGJ A;  1I4H A;  3EGR A;  3P42 A;  4HEA 1;  1YQ4 B;  2DYO A;  1FCC C;  3CIR B;  1V1P B;  3MC0 B;  3ZYY X;  2WXI A;  3PO0 A;  3AE8 B;  2INN E;  1BUI C;  1K53 A;  1TZO A;  3AE1 B;  3U2S C;  2IPK D;  4LLG M;  1MHH E;  4JWS C;  4RFB A;  1HA5 A;  1HEZ E;  3AE3 B;  1TKE A;  1JAL A;  1D6E C;  4H2A A;  2LFI A;  2JU6 X;  1FD6 A;  1C77 A;  2L52 A;  2WLB A;  2N9L A;  3BVM A;  2NTS A;  4LTU A;  1SIJ A;  1XO3 A;  3EA6 A;  3AE2 B;  1VZ7 A;  2WXK A;  2E6X A;  4YWG G;  4ARC A;  3ZJV A;  3TEY A;  3ZJT A;  2WXQ A;  2DLB A;  2ICI A;  1I4Q A;  1QQR A;  1ZUD 2;  4NAW B;  4C56 C;  4WQM A;  4IDI A;  3FC4 A;  2H89 B;  3BK2 A;  3PZ8 A;  3P4R B;  2WNM A;  2KDM A;  1FIQ A;  1J7A A;  2M56 B;  2JQR B;  4OZB A;  2SEB D;  1P7F A;  2JXT A;  1KLG D;  4KGT A;  4GLS C;  1QIL A;  1JWS D;  1I4P A;  1QOB A;  4RF0 A;  3AE9 B;  1L4D B;  3AV8 A;  4EE2 A;  1V97 A;  1BXT A;  2W55 A;  3VR9 B;  1D5X C;  3NUH B;  3AN1 A;  4FXC A;  4MH8 A;  5I4D A;  1D5Z C;  3MFG A;  5E6J A;  2NMQ A;  1PGA A;  1L6U A;  1Y56 A;  1C9F A;  3SEB A;  3GB1 A;  3MP9 A;  5EE9 A;  2M19 A;  1DOI A;  2G9H D;  1DGJ A;  1IGC A;  1V1O A;  2HTM E;  1DYQ A;  4XDD A;  4IOI E;  1FO4 A;  1ZE3 D;  3ZGZ A;  1ESF A;  2JX5 A;  4JPS A;  3URY A;  1C76 A;  1T6B X;  4KGS A;  2W3R A;  3LXF A;  1N61 A;  2MJ3 A;  1YN5 A;  1C79 A;  3B2G A;  3FIL A;  3EUB 2;  4XE0 A;  5EE3 A;  2JYT A;  1SF0 A;  2OED A;  4Q2J A;  3Q8A A;  1IBX A;  1HQR D;  4WUR A;  3E56 A;  5FK9 C;  2KAJ A;  5BYQ A;  1YJJ A;  1XEE A;  5HFY A;  2ON8 A;  1K52 A;  1E6E B;  4B0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...