1D6EC

Crystal structure of hla-dr4 complex with peptidomimetic and seb
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
225
Chain Sequence
b'SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 62
structure length 225
sequence length 236
ec nomenclature
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d6eC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d6eC02
1YN4A 1LT4D 1XTCD 1EU3A 1DYQA 3BVZA 3W2DA 1I4QA 1L0YB 1RDPD 5I4DA 1G8ZD 2QEJC 4DXGA 1KLUD 2RDHA 1M4VA 4ZYSA 1I4HA 1STEA 1JQYD 1GOZA 1LT3D 1BCPB 4DXFA 1HA5A 1V1PB 5FKAC 1B1ZA 1JCKB 1HTLD 1I4RA 1I4PA 1JWSD 1SE3A 1EWCA 1SJHD 1CT1D 1LT5D 4K6LA 1YN5A 2NTTA 1EEFD 1TY0A 1TY2A 4RCOA 1MD2D 1ET9A 3EFXD 3BYTB 1LTTD 1KLGD 1PTOH 2IJ0A 2XNAC 3R2TA 2AQ2B 2WV6D 2TSSA 3SEBA 4RHSA 1UNSA 1D5MC 1SE4A 3BYYB 1YN3A 1BCPF 5D3IB 1HXYD 1LTSD 1TS3A 4TSSA 4RH6A 1V1OA 1LTGD 1D5XC 2CHBD 3BVMA 3V05A 1B44D 1PZJD 2AQ3B 1LO5D 1BCPD 1TS5A 1AW7A 1SEBD 2R61A 2SEBD 1PRTF 4C56C 5FK9C 4L63B 1ENFA 1T5XD 2NTSA 4OHJA 3EA6A 2Z8LA 1HQRD 1DJRD 3DWQA 2O2LD 1FNWA 4RGMA 5ELFA 4BWGB 1PRTD 1PRTB 1BCPC 1I4GA 1RCVD 4UDUC 1S5CD 4RGNA 4L6TB 2QILA 4RHRA 4Z9CB 1CQVA 1TS4A 5ELBA 1SJED 5ELEA 1D5ZC 2G9HD 5ELCA 1RF2D 2XN9C 2XRSD 3MC0B 1L0XB 1EU4A 1EEID 1BXTA 1ESFA 1PTOB 3R2IA 1FNVA 1F77A 4RGTA 1LTBD 3DWAA 2J4XA 3BZDB 1V1PA 1LT6D 3BVGA 5D3DA 1SBBB 1EFID 3GP7A 4RGOS 1FGBD 3CHBD 1D6EC 1S5ED 1S5BD 1JR0D 3DWPA 3TSSA 1JWUD 1LTRD 3OWEB 2ICIA 2XRQD 1FD7D 1SE2A 5TSSA 1CK1A 1PYWD 3O13A 1PTOF 3R8BA 4NZLB 2AQ1B 2IPKD 3MFGA 3URYA 1AN8A 1LTID 1PRTC 1FNUA 2RDGA 1PTOD 1CHQD 1JWMD 1S5FD 1SXTA 1TS2A 3KLSX 5ELDA 4O1NA 1ET6A 1LTAD 1CHPD 1KTKA 1RD9D 1S5DD 1I4XA 1UUPA 1LLRD 1XXGA 1QILA 1PZID 4RFBA 1PZKD 1PTOC
chains in the Genus database with same CATH superfamily
3SE0A 4Q5VA 2BWFA 5IGCA 4CDFC 1YD8U 3NQIA 5E1FA 5M3FB 4XGAB 3NPPA 2LD9A 2L83A 3CSTA 2A6EC 3T1HQ 3APCA 4DR6Q 5IGFA 2JA7H 4DNRB 2B2WC 1IKMA 1N9WA 2WU5B 1HR0W 2JY6A 4IPHA 2YVCA 1SF0A 1XLNA 1GPXA 4X64L 3CKIB 4MM3B 2N4FA 3P42A 2EYJA 3CCLA 4QUFA 1X3FA 3QWZB 4EFOA 2HDLA 2Z4HA 3RZDH 3L16A 4B3TL 1VQNA 1QQRA 2VQEL 4JI6Q 4KHPL 2Q2IA 1F2RC 2KD0A 1B8AA 2NBUA 1YJWA 2UYZB 2Z0EB 2LXAA 1K8AC 3H1UA 3PLUA 4RM8A 3AU4A 3MJ5A 1J0GA 3V60A 2K5HA 3B1LX 3J80i 2KTRB 4JI3L 2AUKA 2E2HB 4XQNA 2K3UA 2WAQG 1UNSA 4S3SA 1VQ4A 1QOAA 1K53A 3IBEA 4KDLB 4K5VA 2CQAA 1YN3A 3AMZA 1BCPF 4K3CA 1O7IA 1QNUA 3ZNZB 1GUTA 3IAS1 1BMLC 3ZVVA 3O65B 2QGQA 2A19A 3GTQB 3C19A 4ZHPA 5C4XB 4HMJA 1UGJA 2N88A 3NVVA 2B63G 5C5MA 4BBNF 1WFYA 1VF5C 2D0PA 3H91A 5CMDA 3I55A 3PO2H 5IGBA 1E5WA 2J0MA 3IKJA 1K51A 2Z0DB 3VTWA 1YIJA 5ELFA 1FNWA 4DV0Q 5C44B 4XWTA 4W9GA 1NCVA 3L2PA 4MDKE 1RCVD 1Y1VG 4B3RQ 4XX5A 2K75A 3UDGA 5H92C 5HI1A 2LXKA 4RHRA 1C77A 2DNCA 2A73B 2OTLA 2N7EA 2ZPYA 3NUHB 1J7AA 4IFDJ 3Q8DA 3M4PA 2N0SB 1LTLA 3NBIA 3A5UA 5FLXL 3H15A 2XN9C 1K8RB 2M17A 3Q8AA 2DNEA 2RF4A 4K7WA 2LMCA 4JI1L 2F0JA 2R92H 1TIFA 3TEWA 1ESFA 1IP9A 1VQMA 4WURA 1IPGA 2LEKA 2V0GA 3CP0A 1K0RA 3TEZA 5C0XG 4RGTA 5M3FH 3PV0A 5C4XG 5JPMC 2BH2A 1QOHA 1LT6D 3AULA 2K7VA 1P8LA 3MFYA 1PH7A 1EZ8A 2CWAA 4HJ9A 1PHJA 3ZJVA 2K5VA 1LTRD 5C44G 4WWMA 2ZW1A 2RHQB 2KQ7A 4B08A 1DOLA 1I94L 2I1JA 3IL8A 3O13A 1FYCA 3I72A 2D11A 1XCQL 2V3SA 4OX9Q 2Q2HA 2IPKD 1H4RA 4AIMA 3J7A5 2KJXA 1K0SA 2KNBA 3AE1B 2EY1A 1CI3M 5GMVA 1NSNS 1SMYC 2NZHA 2I07B 1CHPD 2Y0SB 1H9SA 1HA6A 3EGRA 2EJFC 1WFQA 4IDIA 2M2LA 2E2HH 1EF5A 2K1FA 4OL7A 2EJGC 1DCZA 4AP4C 4WAFA 4FBJB 2UXDL 3E0JA 1YJJA 1STBA 4YHHL 2FBWB 4LWCA 2MPMA 5D94A 2CJOA 2WXHA 1TZOA 1E1OA 2DY8A 2EXZA 5AFWA 3GTQH 3J80L 1ZKOA 1L0YB 3NUCA 4C3JB 5EDSA 1RDPD 5C4XH 1WRIA 5HHDG 4PYUA 2L05A 5ELOA 2IGGA 4U68A 1DZ1A 1G8ZD 2A6HC 2CKHB 1YNXA 2KK8A 3AXCA 3H94A 3UDIA 3H3VH 1B9NA 1E9MA 4PS3A 4YXDB 1EWHA 1Y14B 3ONSA 3PSEB 2PCFB 5M9OA 1B1ZA 1JCKB 4ZHOA 4A55A 1I4RA 2JP1A 3FAHA 4ZKCB 2Y0SG 2K25A 1LT5D 1OEYJ 1J7BA 4R4IA 1JJ2A 4HPMB 2X6GA 2BPSA 2A8VA 2LWPA 2WXJA 4H7BA 1KH0A 1WXQA 4LF5L 2B2UC 1KLVA 1IBMQ 1YMHE 3VYTA 2WACA 4N59A 1UZXB 1WTPA 4IC7B 5CHVC 3MEFA 1YI2A 3QG1A 2UXBQ 3FEWX 2FIFA 4HWIB 2OCEA 5JOBA 4A3IG 1Q86C 5T8IA 4C3JG 1WGKA 1MJDA 2R3ZA 3K7AB 4FULA 3RLOA 3VQIA 3NBHA 4I6LB 5E6NA 2KVRA 1O7LA 2X69A 2RA4A 2CH4W 5AJ3Q 2KQ3A 1VDZA 2NTSA 5D14A 4O42A 2PNRC 3EQLC 4IUNA 2B2UA 4HCPB 3KJOA 4NJ7A 4C3IB 2KOXA 3KUPA 2E76C 3ZRCA 3MC8A 3K9OB 4HCEA 2WB1E 1S5CD 3T13A 1P7FA 4KV2A 1EY0A 3OSOA 3VYUA 1PH5A 1TWGB 1Q1OA 1BBXC 1YOVB 4WWOA 3AE5B 2LVQA 4GDLA 3PHXB 1SFOB 3AFPA 1EYCA 2WXQA 2HDMA 3T3OA 1WM3A 2EKEC 2BYVE 4P1CC 2A68D 2XWJB 3SK6A 4JI0L 4FHJA 5C3JB 2D10A 1EQVA 2JA5G 3MTSA 3PF5A 1VQIA 2RPVA 4ZRJA 3K9PB 3EECA 4K81A 1HZ6A 4XQJA 4WWNA 4J6HA 1AEXA 2C5LC 2F0NA 1JE4A 2KC2A 4C3JH 1HNXQ 2QW7A 3JVZX 4XXEA 1SBBB 4X3TA 1JT8A 1OO9B 5AZFA 1G91A 1GUOA 1TWAB 1JR0D 1VQAA 1KRHA 2M19A 4C3IG 4DV3Q 4FXCA 1XF5L 2LHEA 1EL0A 1FXAA 3HOVG 1SYBA 3OIPA 3S15B 4A75A 1FJGQ 4DHJD 2MQHA 3TP5A 2W54A 4FJYA 4WJPA 4CKEA 2IX3A 2O5JC 3K5OA 4LCDE 2WWZA 2ALYB 3GOEA 2K6DB 4XDDA 5JZEB 1T9HA 4KKTA 2H88B 4YT0B 2XVSA 2UUBQ 2I5LX 4DV7Q 1RD9D 2BKRB 1XNRL 1ROEA 1SROA 4ASWC 3GQBA 3OLMD 4LFBQ 2KQ4X 2M9VA 4P1BC 1L1OC 2EOTA 3RN5A 3I4NB 4IUTA 2AYOB 3SHLA 1PUTA 1E7PB 1YIWA 4GOCA 3RZFA 4ZUIA 2BDOA 2SNMA 3K7AH 1HFNA 4OONA 1HE8A 4HKZE 4IUVA 2JEBI 2LXJA 5IOIA 4PV1C 1I50B 1CTMA 1J19A 3T1HL 2LMCB 2Z9HA 5C0XI 4DR6L 5F2DA 4DR7Q 3AEFB 3Q8CA 1YJ9A 3J7ZC 1I4HA 2CHZA 2NBVB 3H9DA 4TV3A 2WXLA 1FCLA 4C3IH 1L1OA 2LJIA 3CRLC 3H3VI 4NDXA 1V8QA 5JEAH 1NI3A 2WXMA 1EWCA 1TWGH 4JI6L 4WWPA 4HR7B 1F9PA 5LLIA 1JB3A 2KDMA 1XX8A 5ELNA 2F0LA 2FIDA 1SFOH 1MPEA 3SU8X 3EFXD 3NXWA 3GO5A 1JRPA 4EOYA 1QT9A 2L7RA 2V9HA 2OEOA 4K14A 4DR1Q 2PO4A 1SE4A 1QJOA 2CHXA 3T16A 1ICFB 4DV4Q 2I0QA 4WJ4A 2C7MB 4E71A 1SIJA 3MA2B 4XC2A 4QAYA 1WTRA 4DUZQ 1H9SB 1WCMG 4KSLC 1TWAH 3NOBA 2E74C 1IW7D 2C35B 4A3MB 5I6WA 1N62A 4PS7A 3MHSD 2KCNA 3B08A 2QDFA 3ER0A 3W1SC 3S15H 3IFTA 1FVIA 1A63A 3QK0A 3KF6A 5GAHC 1IGDA 2R7ZH 4NXNQ 2A74C 5JJKA 4MTNA 3MHBA 3ZW3A 1EY6A 4FXDA 2KCTA 4B3RL 1XD3B 3K81C 2C9WB 4O0AA 1SSOA 3BDOA 4YWKA 1LACA 3QB3A 3VYSA 3I70A 2K6QA 3P4QB 1NE3A 3DHGC 2G9HD 1HZCA 2N78A 4LNOA 1HQMC 5IYBG 3FP9A 2IX1A 4W9LA 1HJPA 1KNAA 1L0XB 2XWBB 2RKSA 5EPJA 1B50A 1P7EA 2JWZA 3W1SA 3RNCC 1X3EA 3LDZE 3I4NH 3V62A 4IW0A 1E8ZA 1DD2A 1S1QB 1G51A 1IYVA 3WOEA 2IBIB 3I8ZA 1JQ4A 4BKGA 2J4XA 1K9MC 1I50H 3DLLA 1AP0A 3HOUG 2DZMA 1DM0B 3DQVA 3P63A 1N36Q 4G7ZC 1V5TA 1NY4A 4LJOB 5CORA 4WH4A 1K3BC 3BY4B 2BH8A 1O7ZA 2KDBA 3X23A 4OX9L 1YJNA 1CKOA 1RIPA 3NBHB 3DBRB 3BINA 3EN2A 3BDCA 1SGHA 4MH0E 3TREA 1A3UA 4P71A 3K5NA 1S5FD 2N9KA 4CKBA 1JRUA 4L5TA 4EGVA 4C00A 2VB2X 2FINB 2E75C 4P73A 3BS1A 4US8A 2IO0B 3EBEA 3LWEA 2QDLA 1SDFA 4P72A 2O5IC 3AH7A 3AE6B 3UE0A 1A0IA 2LI5A 2LKVA 3SD5A 3QOJA 3DBLI 3JAMc 1WY8A 2KACA 4GDLB 1GO3E 3W2DA 1U4LA 1D1KA 3I4MH 1YBYA 3GTLB 4BXXG 1UWXA 4KV6A 4A3MH 2JZZA 5BMIA 1WYGA 1N60A 2DENB 1F2MA 2D3AA 2L76A 1S3SG 2KX0A 3HOZG 1H95A 3IT4B 1WGHA 4PZ7A 4RNAA 2BE5D 2NPTA 2K03A 1TKYA 1VR9A 2KWCA 2BCOA 4NQLB 4FVMA 2HT1A 3I2ZA 1V97A 1L2NA 2Q8IB 5C4JB 3I63C 3HG9A 3U4ZA 2RCNA 1TY2A 5I9PA 2KFJA 3TMPB 4QMGA 2MBBB 3HOXG 2EZVA 2Q2UA 2LGSA 1IBML 1YX6B 1PDXA 4MZ9A 1XWEA 5C6AA 1A15A 2UXBL 1C4PA 5G5HA 2K22A 4MH8A 1HXYD 1LTSD 4FF2A 2BB6A 4TSSA 4JQWC 4JWSC 1SR3A 4JWUC 2D62A 2GRIA 4A3OA 4WAAA 3QIAA 4B3SQ 5FR6A 2CHBD 4GNXC 4CKCA 3ZTDA 1X3QA 4HXDA 5BN3A 1ASYA 1TZ1A 2DZKA 5AJ3L 4L1BA 3Q69A 3D32A 4MGIE 2JQOA 3J81E 2JXXA 4LTUA 2JRIB 5I2XA 1P98A 3VUWA 2VH1A 4MN3A 4ALPA 1Q0WB 3L4PA 3ZRFA 4HLEA 1CSQA 4X65Q 4A3KB 3BU2A 2KN5A 2MRPA 2JXMB 1PGAA 3H09A 2ACZB 1KHIA 3Q24A 4KD3A 3KLSA 1T3QA 1HCZA 1F2RI 2B8GA 4GNXA 1KQSA 1PH3A 1V81A 5CBAE 3PMFA 1V80A 2GA4B 2PMZE 1C4CA 3PRMB 3NTHA 2N1WA 2VNUD 2YEPF 1K83B 5LXHA 3PUXA 1AWDA 5MPOA 1L1OB 3VRAB 1W2BA 1U0LA 3JAMi 3KLWA 3T53B 3TUOA 1FNVA 4OWXB 1MVKA 2JPHA 4GIVA 1V6EA 3SDZA 5BMGA 4X57B 4LFAQ 3GTLH 1S3OA 3CAMA 2JU6X 2PZTA 2IYDB 2I2YA 2IO1B 2PQAA 2ZTCA 2ZXPA 4F1SA 1PFSA 1GHKA 4DV3L 2ZJPA 1IW7C 1JICA 3L08A 1O7YA 1STGA 3H0GB 4IOCA 1FJGL 5CV4A 3C46A 1RWSA 3VTVA 1HTPA 4YWGG 4IM2A 3K5LA 1PFMA 5TR5A 4NQKE 2NVUI 4YTPB 1XNQQ 4PMWA 2L3ZA 4DXAB 1PH1A 5FO9B 5C4JH 2ZT9C 2PE6B 2QKIC 1MHHE 3V96A 5M3MB 1WJUA 5IP7H 4JI2L 1XPRA 3KF6B 4DV7L 2WIIB 2L15A 4JV5Q 2GOWA 3IT6B 4M0WA 2A6ED 5EBCA 3QJYA 1QZEA 4LFBL 3M95A 1QZGA 1EIGA 3TEXA 1PTOC 3ZTCA 1ENCA 4BY7G 1KFYB 4OZAA 4RF1A 2L0CA 4MHEA 4TVAB 1JWBD 2BS3B 3UI3A 3WAPA 5KHQA 1FMAD 1DYQA 3BVZA 3CC4A 3A74A 3AECB 2C7HA 1IXRA 1ZOYB 4DR7L 4L23A 1UD7A 2KHWB 4K8JA 1T6BX 4LUZA 5IA7A 2QSDA 4A3KH 1D2BA 2BOSA 2F0FA 3S14B 2H5XA 4W9EA 2EYMA 1XMOL 3Q8BA 4DV1Q 1NBFC 4K6LA 3G71A 3E6ZX 4F8CB 1WI5A 2PIAA 1VQ9A 3PGEA 1K83H 1ET9A 1QKZA 5IYDG 1R4NB 1WRDB 2KAJA 4ZUJA 3R7QA 2XNAC 4FLHA 2ICEC 3SEBA 4DR1L 1BKBA 1D5MC 2FCNA 3N32A 3DBHB 3QJZA 1VZ7A 2W55A 5FOBB 4HSVA 4DV4L 4P2CB 3D4RA 4ULLA 4IPGA 1VS0A 3S16B 1E8WA 1YHAA 4IG7B 1AYFA 3J9CA 1Y56A 4C3HB 4X66Q 4DUZL 3ZYYX 4OO1H 1HR0Q 1ZDXA 3JAML 2WB1B 1TS5A 1EYAA 4H13C 3PIO3 2D9UA 5IP9H 1ZXHA 3CWIA 4W9DA 4L63B 1VLBA 1B70B 4JBWA 1RJTA 5KNDA 3H0GH 1PFBA 5D7GA 4JBJA 3RUIB 3S2HB 1SYCA 4NXNL 4GLXA 4WIPA 2KEDA 4YWMA 1OQQA 1VQDA 3N1YC 4P75A 1MJEA 1NEKB 2F0QA 4LNFA 4S0RA 3VUYA 4KVGB 2N55A 4FHKA 5M3MH 4C4VA 5NUCA 3U4VA 1S4ZA 1CFMA 2PPHA 3VR9B 1A8VA 1UE7A 3RNBC 2EQSA 4YTMB 4XWWA 3NHHA 4FA6A 5IYDH 1OQRA 2WXNA 4ZCKA 3SFDB 4RWSC 4K2LA 4LF8L 3Q8FA 5E3FA 4C1NI 4C3HG 3NVYA 4MGKE 1TT2A 2WB1G 3QWNA 2N9PC 3ML9A 4JI7Q 2BS2B 5COYA 4BBSG 2D3GA 2KUMA 2OJRA 4QY7A 3RNUA 4JX1C 5H8YE 1E3PA 1EFID 2K52A 2KENA 4KI0A 4KJNA 5I6YA 4AH6A 1ACCA 3DWPA 1N36L 1P1AA 4MACA 4QIWE 4P16A 1G6JA 1HPCA 5K5PA 3HOWB 4DAPA 1YNTE 4DUYQ 4KZCA 2HUGA 3R8BA 4OZBA 3U52E 3UIPB 3CD6A 3AE8B 1BDOA 4DHJB 4CBVA 2VUMB 3NWTA 1QWYA 2F0DA 3S14H 5CR3A 2VZKB 4XYQA 2M4NA 4TKNA 1EO6A 1YNND 3N52A 4IN3A 1WMHA 1UWVA 1C79A 3NP8A 3V61A 1G291 3DM1A 3VYRA 3RMKC 3WA0A 4M02A 2Z4IA 2KCCA 1FL0A 1BVSA 1PZID 4BBRB 2JA7G 1V2YA 5EE1A 2AX5A 2NZOA 3S16H 4GNXB 5IT9c 4J3OD 2ZVNA 2REXA 1LFDA 2PW7A 2NS5A 4IURA 4F8MA 2QEXA 4GN5A 3B0AA 4OIJA 3Q6BA 3E9HA 2F0MA 3AMUA 1QB5D 1D7QA 2NN6G 2WS3B 2EIFA 3Q8EA 2MUYA 5BN4A 3S2HH 3HKZE 3LB8C 5IKCM 1GOZA 1LT3D 2MW5A 2V1CC 1G2TA 2ASQA 3C1EA 1I6VC 1HTLD 3GTMB 5C2TB 2PQAB 3PUZA 4HROA 1U9RA 2RHSB 5C0XJ 4M01A 3D4WA 5JJLA 2Z1CA 2NTTA 5DEHA 4B9WA 1ASZA 1Y8OB 4L5SA 2TMPA 3H8HA 3BZKA 3V2TA 3QARA 3RNAC 4BBRG 4DV5Q 2LGIA 2OQ0A 3J7AV 2A4ZA 2ZZPB 1W6JA 1HZBA 3ULLA 2YTYA 3APFA 3KYCD 2AQ2B 2KHJA 5C5LA 1E6EB 1PFNA 3HIZA 1J8CA 1H9KA 1K3RA 4DK0A 1B53A 3DMUA 4L5QA 2B2VC 4LW1A 2HJ8A 3PO2G 2N1VA 4OWTB 2DNFA 3X0WA 3SR6A 3PIP3 2FE8A 4B3SL 2XEWA 4NAWB 4IJHA 4P6VF 1IYJB 1GKHA 1JJCB 4M0WB 1B3QA 2SOBA 4EQNA 3F1ZA 1RTNA 1QZHA 3HOWH 1TBEA 1WJ6A 3PPAA 3QR8A 1ENFA 1T5XD 4OHJA 5C3EB 3DVGX 1T0YA 1SMXA 3J81j 4W9FA 3NE5B 5J17A 1KXLA 2NN6H 2F03A 2VUMH 1UH6A 4ZRQA 3N1XC 5HFYA 2C7NB 2SAKA 2R92G 2M1MA 3U2SC 4BKTA 3K5MA 2Z6BA 2KWVB 4D2KA 1KAWA 4BFRA 2F0EA 2QILA 2B2WA 3PV1A 2HQEA 1SE8A 5ELBA 5M3FG 2GMIC 5ELEA 4REZA 3FILA 3VAWA 4EZLA 3BJUA 4WJOA 2INNE 1GJXA 1BXTA 3W1YA 1PTOB 2EYPA 4BBRH 1E7ZA 2L1BA 3ML8A 1R4MB 3NK9A 3KK7A 3GE3C 5C1ZA 1F9QA 1J6QA 3GV6A 1Q7YC 2VQFQ 4LFAL 4HCSA 3EC8A 5D6JB 2PTLA 4BAXA 1QOGA 1N32Q 1UBIA 4IUMB 1FGBD 5CV9A 4A4IA 5H1SE 2CWPA 3TSSA 1W3SA 1DOMA 2ICIA 3NEMA 3SVMA 3R66C 1XYIA 4HPPA 2HQLA 4DR4L 2GBMA 4EZJA 4XZ4A 4KKUA 4DK3C 2B39A 4CJ0B 1HZAA 1X54A 2F0OA 3MWYW 1AN8A 5DLQE 3URYA 1CA6A 4EQOA 1XNQL 4A93B 2DHZA 2D3CA 1ISNA 3NRZA 4A9AA 4X3UA 4A3LH 1XT9B 1Q12A 1F2YA 1KC8C 2JEAI 4JV5L 3FPUB 4POGA 2KHIA 1WJNA 1SN8A 1DOXA 2KDEB 3A4SC 2PKOA 2AWTA 4LF9Q 1WX8A 1Z5SB 3J7AF 5EQ0A 2J53A 1N61A 2K28A 3L10B 3A8IE 4AOFA 4C4VB 2RR9A 1F52A 4GXBA 2G1EA 2L8JA 4CDCC 5CV5A 2XSCA 3FKIB 1FD6A 4GKJQ 4DXGA 1KLUD 1VCBA 4KDIC 2ZJDA 4M8AA 5C3EH 3AQQA 1VQBA 4WJ3M 5C23A 1SNCA 3PGZA 1LXDA 4EZKA 1I3QH 2B2YC 4DN4M 1SE9A 2JSVX 2QDBA 1WYDA 1HNZQ 4P74A 3A9KA 4CJ2C 1I4PA 4CGYB 5T1IA 1JWSD 2PI2A 2R6GA 4EX5A 3I4OA 1F2ZA 3BZCA 2BVCA 4G0NB 4QB4A 4LF7Q 4G7HC 1DXMA 3K57A 1TGZB 4ZKBB 3L13A 3GB1A 2WYQA 1YNNC 5IYCH 3BYTB 5KNBA 1LTTD 1PTOH 2TSSA 2BB5A 1Q8IA 3OWFA 3STBD 1E1TA 2YV5A 3L3OC 1WTWA 2B2YA 1VQ8A 3RLNA 2GB1A 1BUIC 1P9DU 5EE0A 3DEOA 2XTIA 3FKIG 2I5MX 3K58A 1OGWA 1WMHB 3BVMA 2M0XA 4JPSA 1NMFA 4X66L 4BY1B 3KBXA 1FEHA 1HR0L 2MNAA 1LO5D 2ID0A 4PZ6A 2F0TA 2G3QB 3FVQA 5IT9L 1IBLQ 1TU2B 3G6JB 3DEPA 3NTIA 3VH3B 2KJHB 1NYQA 2M8SA 4JL9A 3RCZA 5HY6A 2JA9A 2MCNB 4OIKA 3KUZA 1WIAA 1RFAA 4K3BA 3WCQA 4R4OA 3KQ4A 2JE6I 1SRUA 1BCPC 3KUCB 4A93H 2NN6I 2QIEB 5G3LD 3DHHC 5DPRA 2I1KA 2M0AA 1VRAB 2X38A 2VB3X 5AUIA 3VR8B 3L9AX 1II3A 1J8IA 2A5UA 3GS2A 2XRSD 4BBNC 4K5XA 2GBJA 3D0FA 4CHKA 2WP8J 1EUJA 4W9JA 4PYZA 3KOJA 5JJIA 5HKHA 4HJ8A 1YNJD 3D3RA 2MFIA 2G4SA 3ETRA 2F4IA 3CRKC 3ZQ4A 4NPSA 2VXWA 3CF5A 4JLCA 1RYJA 2MO0A 3CCUA 4PZ8A 3J7YW 5IAAC 2F0PA 2IX0A 4DPGA 1WTHA 4HJ5A 1MG8A 3FKIH 3P75A 2MBOA 3QIJA 3D8GA 4II3B 3BIID 2O6VD 3OWEB 4DV2Q 2XRQD 1U5KA 2WGSA 3ULJA 5J22A 1AARA 3Q3FA 4N8X1 4B9KA 1HUNA 4ZYNA 3I91A 2KWUB 3RYTA 5A2QE 3K0YA 1CHQD 1HNWQ 1XMQQ 3DHQA 3I4LA 2WX1A 4LDTB 5FO7B 3UDFA 3WAOA 4CYEA 4C7ZA 1TS2A 1GD7A 4DR2Q 1S5DD 3F2UA 3Q22A 3V6CB 1YVCA 1ZDVA 3I3CA 2KZRA 1E8YA 2CU3A 3FMCA 5CX3A 1L7YA 3PRZA 2LFIA 1RODA 2R2OA 5L37A 4H0LC 4A3CH 4BY1H 3TP7A 3FILB 5KIXA 3CQZB 2UUCQ 4ZOHC 4ZLTF 2NYZD 2WDVB 2PNHA 3DVNV 1C9OA 1TIID 4KN7C 5JEAG 4A3DB 2R7ZB 1JORA 2LJ5A 4JE3B 4L8JA 4UY8C 2J52A 4NKLA 2VZKD 1HTQA 2K04A 2HIVA 1SNDA 1JMLA 1TTNA 4IFDH 2OJWA 2MJ3A 1DOKA 4BZAA 1HA5A 3JYUA 5HGTA 4PS8A 2N49A 4KHZA 2A5HA 1Q82C 4GGQA 3RN9C 1TWCB 2OOBB 4GN1A 2EE1A 3NENA 4ZAIA 2KECA 1SJHD 5LMNW 3TBLD 3PF4A 2CH4A 2V4DA 3F2DA 4JBKA 1XEEA 2MQJA 4RCOA 4DV5L 3RD4A 1QOBA 4LUVA 3OTOQ 2C9OA 3E0EA 4ARIA 3FDTA 1XQQA 4F7XA 3BWUD 1E0ZA 4DA2A 2E2IB 5LHY1 3HM6X 3TEHB 2E8GA 3OJ3A 4M8NA 1KM7A 2FJ2A 1ZKHA 3NS8A 3WAMA 1R4MI 4PT5A 3NVZA 2BA1A 3I90A 3BG3A 5IODA 4A3DG 2R7ZG 3N1ZC 3M63B 2BA0A 4UPAA 3HFZB 4IO9A 2R61A 2EY2A 1PLFA 2F4VQ 4NW2A 2DJGC 4WJWA 1L6VA 1A3VA 2KJRA 1YEZA 4GB9A 3U50C 5EKLA 1U4MA 2K39A 3RZWC 4BWGB 3QC8B 1R9TB 1UE5A 4A3BB 4KSKC 4J15A 1PA6A 2UU9Q 4UDUC 4FNFA 4ANWA 4HK2A 2BW2A 3I4NG 4AYBE 3VDZA 2BTEA 4JIOU 4TUUA 1ILQA 4ANVA 1GUWA 1D5ZC 4K6DA 1RF2D 1IBXA 2RDBC 2AKWB 4RKLA 1MHXA 1UAPA 3CC2A 1K8GA 3A9KB 3ITPA 3NZUA 5IGGA 1MGSA 3F2CA 4OWWB 3I4MB 1F77A 3STBC 2IHFA 1WX9A 2HCIA 2ZXRA 3DWAA 2HD5B 2W3RA 1PH2A 3M4QA 1Z7TA 4JI8Q 1P16A 2ZCBA 3CQZH 2VQFL 1CZGA 2JK8A 2YLMA 4DV0L 2GBNA 4A3DH 3BK1A 5KRUA 2KXJA 1KD1C 3VR5A 5BR8Q 4CHTB 4A3BG 3VA5A 1ZXIA 1EOVA 4DDID 2WDQB 3M7GA 2INPE 4TKOB 2AL6A 1OXVA 4R4CA 1WXAA 2N9EB 2CS4A 3L54A 4R4QA 3AYHB 1TWCH 1C76A 1HFGA 4DK1A 2KOLA 3DBSA 3MHZA 2WAQE 1PTOD 1TWHB 5IWAQ 1MG4A 4AQ7A 4A3JB 2DYOA 4OVZA 3ZJUA 3KLSX 3HRDD 3Q3JA 1EUVB 3N3KB 2M00A 1E90A 4KX6B 4L2YA 3DPDA 3I4MG 4G3XB 4Y7NB 5KNCA 2G5DA 1VQPA 2E2IH 4A3MG 4RFBA 2LASA 3M3JA 2KO3A 4FJVB 1YN4A 2E3TA 1IGCA 1YNJC 4HIKA 4YWLA 2RVLA 3HKZB 2EYHA 3QQ8B 2ONQA 3A1QA 4G4KA 1V9PA 1X32A 3VFKA 1JOOA 4HAEA 1H9JA 3FPPA 3W3AA 3T51B 2IGDA 2Q5WD 3KVFB 2L1AA 1EZ6A 1WXVA 3GZNB 5I9OA 2K8HA 2VS1A 5DAUA 2NBWB 2G4DB 4PK1A 4HEA1 5C3XA 4YIJA 1R9TH 2BYEA 4A3BH 3W9CB 1BCPB 5J39A 1Y8NB 5LL6S 2OWOA 3N30A 3MXUA 4ILWA 1HNZL 2V3PA 4B95A 3U7DA 2KDFB 5KHOA 4XE0A 2HTME 3AE9B 1N33Q 2DWQA 3KF8B 4OXPA 4X62Q 3PT2B 3UGBB 5CV8A 3GTOB 4LF7L 3NTKA 5A35A 3D6CA 1IL2A 5C4HA 5LNK1 3R2TA 2IJ0A 3PQIA 4BS9A 4CJ1B 2VW9A 2KWDA 1TR5A 3TEYA 2O6VA 1KDAA 3X3MA 4ANXA 2HCCA 3MXNA 3S2AA 2JRHA 4KKJA 4YTNB 4B9XA 3PUYA 4R9WA 4A3GB 4IJLA 4DV6Q 5JJZA 4GDKB 3RMHA 2IGHA 1CQFA 2Y3AA 1EY9A 1SEBD 2LUEA 1EY8A 3QAQA 3UF8A 4PMCA 3ZNHB 2BBCA 4AUQC 4LFCQ 2ATWA 3H7PA 3QX1A 1YQ4B 2EPBA 2IWHA 4C7YA 1E2VA 1I4GA 3AB5A 4A76A 5CHWA 3Q3OC 5KYLA 4RGNA 3UDXA 1KJTA 4GN3B 1TWHH 3GD7A 1N34Q 4A3JH 2JYOA 1NBWA 2DX5B 2EKIA 4KHVA 2ENBA 4EUTA 2L4NA 3LNNA 3OMGA 4II2B 1XO3A 3PVLA 2ZVOA 2Q2TA 3ZDMC 1B2TA 4Y7NH 1OXSC 2RD0A 4M00A 1Z47A 4N58A 3FRPB 4ME5A 4KY7A 3TMEA 1CKNA 1LYLA 4RKBA 3JW0X 1D4BA 1X1MA 2OT2A 4DGZA 3M62B 5J18A 1NDDA 4JYAQ 2PW9A 1V1PA 1JOQA 2N9LA 3GTKB 1N8RC 1I42A 4G11A 3RNEC 1S5BD 2D5GA 2JXTA 1WGGA 1K28A 4ZDVA 4DV2L 1LUZA 3MAQA 2R93B 4IUPA 2ZCCA 1MIUA 1PYWD 3A7LA 4ZK9B 5IP7G 2UUAQ 3NZSA 1WTVA 2WFWA 3C2PA 3TDQA 2Q8RE 3GTGB 1IKLA 5EBDA 2ZM6Q 2KLGA 4GZYC 4ARCA 2LHDA 4GKKQ 1LTID 2EY5A 5CV6A 2JYEA 2RDGA 1HNWL 5C3WA 5EKIA 1XMQL 1QNKA 3GTOH 1B3AA 1BT0A 2B8FA 2PE9A 4A90A 4MIUA 5ELDA 3PZ8A 3OOCA 2JF5A 3E3XA 2RSNA 2JUOA 2WXPA 3H7SA 2VQEQ 2JQRB 1HNXL 3TRZA 2OQKA 4NPNA 3E56A 1ZEQX 1BR9A 3HVZA 5EAYA 4JI3Q 1CZWA 4A3GH 1FM0D 3AFQA 3AEBB 3QHTA 4WJQA 3IAM1 4A3KG 4WRDA 2UUCL 2GBRA 1IBXB 2YTVA 1WI0A 3I9V1 4A6QA 2ASBA 1ZUD2 5BYRA 2QEJC 5JVG3 2F0UA 1M4VA 4XT3B 5E4WC 3M3YB 1JJGA 5ISRA 2EMSA 2WQYB 3AB9A 4H2AA 5GXGB 4WQMA 3P4RB 1VQKA 1WR6E 1RTOA 4HJKA 4LDTD 5G5GA 1ZXTA 2LSSA 1K73C 2K9XA 1MI2A 2VL6A 4NAWA 4NXMQ 1KRSA 2UUBL 4YCUA 1OTRB 1SE3A 5DPSA 1STAA 4LNKA 1BOSA 1G6PA 2G45B 3SHQA 5FO8B 3J81c 3A33B 5EKKA 2KA7A 5FR3A 4NAMA 1X6OA 1KLGD 4OO1G 2LVOA 2WV6D 5D65A 4N9TA 1Y1WB 5KYIA 1YITA 5IP9G 1EF1A 4WJNA 3T3NA 4HKQA 3A4RA 2XGTA 3PHWB 5C4ZA 4WFN3 2RSUA 4DR5Q 3H0GG 2XK5A 1LTGD 2O4XA 1I35A 3F2BA 3GTKH 1R7SA 3PCOB 4V190 1UELA 3VTUA 4B0EA 1SYFA 4IWOA 4XIGS 4C56C 1D1IA 2F4VL 1GM5A 1JB7A 1YJIA 2R93H 3G48A 5J2RA 5M3MG 2K50A 3HP3A 2XIWA 2LGYA 3GTGH 2EMTA 2O2LD 3PUVA 3V3XA 1MKHA 1PRTD 2EYOA 2UU9L 3A1QB 1YJ1A 2KDIA 3PO0A 1L4DB 2JJQA 1A3TA 2L0TA 2K6AA 4F88A 1KF6B 2MEKA 2EY6A 1VJKA 2MHVA 3TS2A 4IOAA 1RFKA 2D0OA 4JC0A 1KIXA 2BWES 5LXIB 5IY0A 1FIQA 3MC0B 1HZ5A 2OHFA 2O2VA 2D2CC 4IUUA 5K36H 1FPYA 3HOYH 3MP9A 2WKDA 4UAIA 4FDBA 2YU9B 2KT7A 2A69D 3DHIC 2MP2B 1WGDA 3DM3A 5AEKB 1LTBD 3GV3A 4QL5A 1VQCA 4DKAC 1N6ZA 4MSQB 2Y5CA 4JI5Q 2HE7A 4JI8L 4KGTA 1O80A 1HRJA 3EJIA 2JN4A 4XT1B 1SB3C 3RPFC 3OIQA 4KIKA 1WXMA 4KGSA 5E4XA 4A3EB 4NB3A 1S5ED 4FJZA 1BQQT 5BR8L 4DNIA 1X3GA 4U673 3M3YH 2K4KA 4QJFA 3RLFA 2BQQA 2J42A 2O6VB 3MXNB 2WXFA 3DBRI 4DBGA 1CK1A 3GZNI 4EKUA 1A2UA 5BYQA 3CMEA 4NY0A 4LJZC 4AQYQ 2H89B 1B7YB 3GTPB 3OPOA 3J81i 1IBKQ 1C4AA 3I3TB 2D07B 2XBBC 4DFAA 2AUJD 1GUNA 2V3NA 3J80E 2F0IA 3K8AA 4OEMB 1TKWB 2EELA 5M5YB 2F0VA 1U4RA 1KRTA 2R7DA 4HTHA 4JI4Q 3HS0C 3H7PB 1SNQA 3S9WA 3S17B 1UUPA 1Y1WH 2JX5A 1E7UA 1OTCA 1SYEA 3P1HA 4HPLB 3ERSX 1PZKD 4YY3Q 3RULA 4KKSA 1QG7A 2JA8B 3P4SB 1NJIC 2IO3B 2DBYA 4YCVA 4LF5Q 4GOPC 2FCMA 3RZOB 5DCNA 2EDGA 1A62A 3CCMA 4QCLA 2A1AA 2DZJA 3MTNB 1WE7A 1VQOA 2B3AA 4R8NA 3T9LA 3SXHA 1ZP0B 3NS1A 1CKNB 4DAVA 2HTHA 2ZJQA 1XLQA 4EQ5A 2NUCA 3EHVA 1MJCA 1V1PB 5D2MB 4DHZE 1VMPA 4GOPA 3MZ5A 3K59A 1A5RA 4X62L 1GXDC 2LXCA 2F52A 3TQYA 3A54A 2KCMA 3MVVA 1STHA 2CR5A 4JW0A 4WQOB 3JSVA 3WALA 4EEWA 1MD2D 3ND9A 3SDLC 4OVUA 3K7UC 3CXCA 3PUWA 3DXJC 2JA8G 3L17A 3U58A 4LJPB 2YU9H 1GHJA 4UP7A 3T1YQ 3HOWG 4MJSA 2GVAA 3BYYB 2LUMA 4LLGM 4PG3A 5HURA 2KX3A 1VQ5A 4RH6A 1V1OA 3RD2A 1KABA 3PIOA 2VUMG 1V8CA 2K5PA 2HIXA 2PW5A 4DV6L 3SK8A 1PZJD 1Q8KA 4I65A 4A3EH 1X9NA 2HDEA 2JYTA 1BCPD 3A0JA 4BOSC 1FXIA 4AYBB 5BN5A 4H02A 4A3PA 3W5OA 3I56A 1SIFA 1X65A 1HQRD 2CQOA 2BGFA 1X3PA 2B2TC 4RGMA 3TN2A 4LF6Q 5M5WB 3GTPH 1X55A 1KAAA 3TZUA 1FRRA 1TVXA 4CDEC 3AV8A 4GLSC 3AN1A 2CFMA 4FP5D 4F87A 2INDC 4KGRA 1N34L 1WGRA 1CQVA 5M5YH 2I5HA 3TP6A 1VD2A 1C4QA 2W3SA 3DDCB 2KBNA 2PEAA 4W9IA 2X8XX 4TMAB 1WM2A 3S17H 4TQ1A 4N6EB 4R3DA 3AEVA 3J81L 4RM9A 1OFFA 1QVFA 2Z6KC 4JGHB 4J6IA 1C3TA 2N8NA 3PO3H 2QF7A 4V0BA 2JA8H 3U7ZA 2B2TA 5LMUQ 5GQOA 1LV9A 3ULPA 3RZOH 4BVUC 2WDTB 3VA7A 2F3IA 4OO1I 4JYAL 2INCC 2V4LA 2FHTA 2IW3A 3AE7B 1QOFA 3B2GA 4AYBG 2CCZA 1PGXA 4DQOC 4JCVE 3DVNU 3CHBD 2J0JA 4B0MA 1I3QB 2CW0C 4FADA 2KMMA 4UP8A 2WAQB 1E2ZA 3CW2C 4X65L 4L5RC 2EVBA 2WXOA 4MT5A 1BBUA 2B2VA 4DF7A 4A3LG 3BK2A 1SE2A 4DDGD 2RQXA 1OXUA 2AMCB 3ZO5B 2IT1A 2Z6KA 2L00B 2XK5B 2UUAL 1WSPA 3AI5A 1S40A 3DVGY 3FC4A 2FCQA 2ZM6L 4W9HA 3C3LA 1N5XA 4GKKL 1PRTC 2Z59B 4I6NB 2B63B 1TKEA 3RNGC 1JE5A 1NNXA 1V86A 3C8YA 4J8QA 2NCNA 2KEEA 3KWVA 4M8MA 3NG0A 4MTKA 4HJAA 1OQYA 3GTMH 3OW7A 1OEYA 3ZIMA 4HMIA 2UXCQ 1T0RC 1Y1VB 2QCPX 2JZ3B 3DWMA 5CHFA 4BKSD 4AS1A 5C3EG 1FCCC 2K05A 1VQJA 2MJDA 1LT4D 3X3NA 5IGEA 2A69C 3KUDB 5FLMH 3G4SA 4LMQD 3IFWB 2O2VB 5LL6X 4N9PA 1NUCA 1XPOA 2PZWA 3P7JA 2WP9B 1GVPA 1YX5B 4K0KQ 4XYOA 2IY0B 1JQYD 5M5WH 1WX7A 3M85A 2WXGA 1CKMA 5IYCG 2ZTEA 2JVCA 5IGDA 4NXML 1SSNA 5JPNC 2K33A 2KYWA 3AEGB 4KIKB 2DY7A 1MI0A 1GC7A 1WD0A 1R4NI 4J1MA 1GAQB 1RRBA 1ILPA 5T1GA 1YN5A 1WWTA 4DK6C 2IO2B 3HZXA 3KH0A 3VDYA 4MGYE 2IDYA 3TCAA 1VQLA 2F0WA 1RAXA 2MBHA 4IWPA 1TJEA 4ZRPA 2DAJA 3RR5A 3IHPC 1H9RA 3DBHI 2ZEQA 3NQTA 4EVOA 3H6NA 3KDFA 3CF6E 1T0QC 1GUSA 3PIPA 1TS3A 1WR1A 2MO1A 4DR5L 4RCNA 2RBMA 2PVOD 3P2BA 3SFEB 3K6OA 4HIOA 1D5XC 5KEEA 2KQSA 3RT3B 1HHVA 1KOTA 1DOIA 2AQ3B 3CPFA 3ICEA 4A93G 2YEPB 5E6OA 4C2MB 1PMRA 2E2DC 3I73A 4CQNA 4RMFA 2Z8LA 3CMMB 3ZJTA 3KYHC 4DV1L 2R7FA 4KTAA 2HJ1A 5EE3A 2WXIA 4TQUS 1ZPSA 5CBEE 5LMNQ 3KWLA 1MHWC 4BOZB 4A20A 4L6TB 2B63H 2FMCA 2GLSA 1AH9A 2E5LQ 3A8KE 1IUEA 4Q2JA 4GSWA 4UP9A 1Q5WB 5EPLA 5I2YA 1HTOA 1EU4A 4ZRKA 1DOYA 1Y1VH 1Y8PB 5JEAJ 3FKYA 3W1BA 2F0HA 4FXGC 2KFKA 3L0OA 1J5EQ 4GOPB 1ZGUB 3A55A 3Q0AA 4YSXB 3A8JE 2NB0A 3CCVA 1L4ZB 1EY7A 1WJJA 3K0XA 2LS01 3BZDB 2K1BA 4JI5L 1Q81C 5DM73 1CA5A 3JSVB 2PMZB 2QJLA 3GP7A 4S17A 1U4PA 3HRZC 4I7ZC 1PV4A 1PVOA 4OW0A 3ZKJC 1JWUD 4MJSB 2K32A 5C0XH 4A3IB 1MSHA 3PSIA 4NZLB 2KMCA 2QMTA 4N9F4 4XDCA 4AQYL 1K8MA 4FN2A 2H4OA 3WOFA 1IBKL 1WZ3A 3MFGA 1WD1A 3PLVA 3B6YA 1MSGA 4QGUA 1AZQA 1FNUA 5C44H 1L2FA 3OW2A 4E3CA 3LX0A 3TJPA 2NMQA 1RKNA 1EIYB 2PJHA 4LNNA 4M1UB 4A3CG 3V6EB 4BY1G 3KJPA 4JI4L 4HN7A 2HHHQ 3U8ZA 4A3FB 1C48A 4FO2A 4JI7L 2C60A 1P0RA 2MJ8A 3KFUA 4YY3L 4GU2A 2BDNA 4MELA 1KDBA 1WOCA 3S24A 3KF8A 2N9XA 2WDRB 3TL5A 3SK4A 5J3BA 4IFDG 1EWYC 4PNYA 4DUYL 1GG3A 1ZW7A 3A7AB 3DBLB 2B76B 1VQEA 4XDXA 2DYBA 4C2MH 2OTJA 3S1RB 1ZE3D 3AE4B 1PH8A 2JA5B 3N20C 1STEA 2WXRA 2OEDA 3RUZA 5AZHA 2EYFA 4HDQA 2SNSA 1G2SA 2SDFA 4R8IA 5FKAC 1Q1EA 3SR1A 1N63A 3CCQA 1C0AA 1EIHA 4GDKA 1E2WA 1VDVA 2DLBA 1PYSB 2JSOA 1CUKA 2NWGA 2MP1A 4A3FG 2MJEA 3HOVB 1S72A 5BYSA 1BO0A 2FFKB 4LUOA 2L55A 4ZRZA 4DAYA 4HJGE 4Y52H 2M56B 1V5OA 3HUIA 1LM0A 1DGJA 1A70A 3ENEA 4DK5A 4YSYB 2WINB 3T1YL 3APDA 4HSPA 3CSFA 5IN7A 4ICVA 3C0RB 3LXFA 1JROA 1VQ6A 3HKSA 3UI2A 4G57A 2KANA 1F9SA 2F3WA 3V05A 1FO4A 4NP5A 1B44D 4X3KA 5IIFA 2MSED 4QQBX 3E5SA 2SEBD 1WVLA 1E22A 4P7IA 3I7FA 4A3IH 3CIRB 1YHQA 2RPQA 1JOKA 2DGYA 2K5QA 2NVQB 3OAWA 5G3LF 5CC4A 1FFVA 4IALA 1VQFA 3OYYA 2LY7A 4LF6L 3G7LA 3JC66 1UBQA 1PRTB 4IPCA 4HCNB 4GLVB 4KY5A 1BF4A 1R4QB 4BKSA 5EGTA 2P5ZX 2CKZB 2LFNA 1C1YB 1STNA 1PDQA 2PQEA 3C1FA 1SJED 3NELA 4KLKA 2KKCA 2LVPA 2MH7A 3ZNGC 3CMAA 4A3FH 4WORA 2B3GA 1SLJA 3DWGC 2MGSA 3TS0A 1I7HA 4IKGA 4HIDA 3AEAB 4K7UA 1VQGA 1PXUA 3GDEA 5LMUL 3HHMA 4JI2Q 4APVA 4DAMA 1D8LA 3NHEB 2EJMA 1M90C 1MBYA 1UWMA 1V9JA 5JHBA 3P4PB 3OJ4B 1F9RA 4I7AA 2E2JB 1K50A 2YTXA 3UE1A 1NI2A 4R1JA 3T4AC 4DR3Q 3S1RH 3KDFB 2FXQA 4PMBA 4QUCA 5CYUA 2JA5H 2NR2A 5IP4D 3IXSA 4DU9A 3ALBA 4HRSA 4B3MQ 3N6RA 1AE3A 2E6XA 1B9MA 1C8CA 4CO7A 4KJOA 3VXWA 5L83A 2X6LA 4IM0A 1DONA 1WCMB 2K5DA 2RCFA 2L12A 3PTFC 1I5FA 2JZPA 1I6HB 2V1YA 2K14A 3HOVH 1GB1A 1A2TA 1SXTA 5GAGC 2AWOA 4OVVA 2FMMA 4QIWB 4ZRIA 4EE2A 2Y5BB 1E7VA 1KTKA 5IE8A 1A6XA 1I4XA 1X56A 1XMOQ 5DNFA 2ES2A 1Q46A 2WLBA 3IFDA 2UXCL 1QILA 2L9HA 1SAPA 5CTRC 3R3MA 1JWAD 3G6EA 1N32L 2FNJB 1VCIA 1E24A 2JT4B 1XTCD 1CZPA 1GNUA 3VH4B 4ME3A 4Q0FA 2MX2A 2PMVA 4YSZB 1F0ZA 3VR3A 3D4DA 4DHZB 3U30A 2NVQH 4ZYSA 1TKGA 1QCBD 1FFUA 4K0KL 2KFKB 4RMAA 5BO4B 4AJYB 4R4TA 3GE8C 1SNMA 2OXPA 3HOUB 3PZ7A 3S2DB 2IZVB 4LF4Q 1WTXA 3AEEB 2RGFA 1CT1D 4KD4A 1AE2A 2J7QB 1EEFD 3JAME 1FGUA 1YHBA 4LF9L 1L5PA 4NNJB 3M4OB 3IAYA 4XYCA 1XPUA 3ZXRA 2NVYB 2WX0A 1IYUA 5D3IB 1U4AA 5EE9A 1O78A 1L0VB 3NSWA 4GKJL 1Z6HA 4H44C 2JWUA 3M9BA 5CV7A 3CCEA 4LK1C 1IHZA 3FHWA 3S1NB 4LK0M 2E2JH 2WNMA 1M1KC 3HM3A 4LF8Q 1UGMA 2WHIA 3VR2A 2JA6B 2ZNVC 3AEDB 2PVGC 1ZYRD 4MSMB 4K7SA 2HD3A 3F8TA 2YYZA 3MXGA 4E6IA 4A3JG 4IFDI 1C78A 3IG3A 3ZXVA 1TQOA 5M5XB 2MP2A 3VR6A 2UU7A 5DM63 5LMNL 1QVGA 1QVCA 2AWNA 1WCMH 2D5DA 1Z9FA 3M4YA 1PGBA 3EFCA 2DZIA 1HZ9A 1I6HH 2AHOB 3N9YC 2E5LL 2PZUA 1Y69U 3HKZG 2QHOA 1VQ7A 3A9JA 4NMZA 3OHXC 2GBKA 1KNEA 3HOZB 3PS6A 1WXSA 3S1QB 3R2IA 5GROA 3ZNID 2KVZA 1RLFA 4ICUA 2Q8TA 1J5EL 3R93A 2KMAA 3T56B 1EM7A 2ZPNA 4B6WA 1UE6A 1IBLL 3RI7C 1EY4A 1EQRA 2KVMA 4IOIE 2JA6G 3Q2AC 5IYBH 3HOXB 2IY5B 5D3DA 4DAYB 3IVFA 2K8BA 2WKCA 3QCAA 4US9A 3T8MA 4K8IA 4RGOS 3UQAA 2BS4B 1D6EC 5E7NA 2A68C 3AE2B 5E6PA 2NVTB 4W9CA 1W6KA 2CU1A 1CM9A 1RL2A 1EYDA 1PTOF 3EROA 4ITKA 3S1MB 4BA2I 3HOUH 4GLAC 1EY5A 1NYRA 2FUG1 3S2DH 5HGQA 5JAVA 4LNQA 1BNZA 1WE6A 3B2FA 4HDOA 2GN5A 5AZGA 3R7RA 1VQHA 4IM3A 3EIVA 1VZ6A 1NR2A 2D3BA 2N7JA 5G2NA 1C7YA 3KBGA 2LGDA 2F0KA 2B29A 4TRDA 4A3GG 3WIMA 1LTAD 2AL3A 4YCWA 3M4OH 2LZ6A 4NJ6A 4K5WA 1V49A 2HHHL 2NVYH 4RA8A 3KYDD 2BYTA 3ZDTA 4I6PA 4X3SA 5AUKA 5BMHA 2QA4A 1T5EA 3GTJB 1K52A 5DPWA 1EU3A 3S1NH 5A2QL 2Y0SE 1F9JA 2PLPA 1I4QA 3K80C 1P3QU 1ONLA 2JA6H 1WJ4A 1YZ6A 5I4DA 3Q3MC 4HJ7A 4USAA 3RNFC 3WANA 3HGBA 1OXTA 2RDHA 3VR4A 5M5XH 4KY6A 1J7CA 3ABVB 2RSOA 4X64Q 3QA8A 3L7ZC 4QF4A 2KN4A 1H9MA 1ML0D 5L95C 4DXFA 1EYGA 4BXXH 4FF3A 3NWSA 1JW9D 2V4IB 4C80A 4DR2L 1XLOA 2MBEA 4B3TQ 2BYFA 5IOCA 1QUQA 4KHPQ 1WZ0A 1B9RA 2BKFA 2MWSB 3QO2A 1TY0A 3HOYB 1K8OA 1T0SC 3VHTC 1R4PB 4XTCS 2PPBC 4JPBW 3HK0A 3HOZH 3KLRA 1WYWB 3VRBB 3S1QH 1E10A 3E9IA 2IY1B 1DGSA 1NMGA 3CPWA 1BBWA 2R93G 4JG2A 2KLCA 3ND8A 2D2QA 3VVWB 4JOIC 3HOXH 1NR4A 5E6JA 1XTDA 3AU5A 3ZGZA 3RN2A 2NVTH 1JC7A 1M94A 1EOTA 1IZ6A 1PQSA 2K0PA 2DN8A 1WTQA 1EQTA 3EA6A 4BY7B 2MA9B 3Q3NC 4GN4B 3CU7A 3S1MH 4YL8A 1DJRD 2I38A 4ACFA 4XQQA 2F1MA 3P1MA 5JH5C 4JK1C 1ENAA 3TP8A 3A56A 3CCSA 4HIMA 4JBMA 2MHJA 5K36G 3HOYG 1CJEA 1PH9A 2R2QA 3OTOL 1RHPA 1LGRA 4DR4Q 4JOIA 4GS3A 3U4EG 5GAEC 2VRRB 4A8XC 1M8AA 5ELCA 2VZAA 2K8CA 1WGYA 1PH4A 1EFWA 1FXTB 3HVDA 3L0WB 1EEID 4JI1Q 4PQXA 3TIXA 1RM6C 1WF9A 1V1QA 1MFWA 2ZW0A 4KZ0A 1KDCA 2CW0D 4AWJA 2FUHB 1WTOA 3GTJH 4K2KA 3QOLA 4MM3A 3UINB 3DUZA 2K5NA 2WU2B 5FLXE 4KMUC 2Y5PA 2W82A 3TZDA 5DPTA 3BVGA 2LGXA 2KC1A 3KW5B 1GJZA 1H8CA 4RAUC 2BF8B 1LABA 2KHSA 3U9SA 4DR3L 4EQPA 1SYGA 1NENB 1YQBA 2J7ZA 2J0KA 4GMVA 1FD7D 1I94Q 4LAAA 1GUGA 1ZYRC 4IUQA 3WDNA 4B3ML 3AE3B 5GADC 2L0FA 3MEHA 2W9NA 2KTRA 4DWFA 3H3VC 3HEJA 2IHEA 1AFPA 4TQ0A 1Y1WG 2LRWA 4CDDC 4LNIA 2RDFA 3CCJA 4KKIA 2FCSA 3E9SA 5HG2A 3NJTA 1JMCA 3ZLZA 4ID6A 2MLBA 3I57A 1JWMD 3LGJA 1PFDA 2EXDA 4MGZE 5G55A 4NJCA 1EIFA 1ET6A 1TWFB 3ERQA 1LQBA 5JXVA 1V43A 1XXGA 4OELB 1QE6A 1F2LA 2UXDQ 1XJVA 4O1NA 2CHWA 4HVBA 2CVRA 3PREA 4YHHQ 2G9DA 3Q23A 4ANUA 2K01A 4FYDA 1CSPA 4UHVA 1Q10A 1XLPA 3I5JC 3NZ3A 3A9JB 2NVXB 4BA1I 4RG1A 4X6AH 2ZNVB 2VH2A 4W9KA 1HH2P 3U9OA 2QC8A 3OMCA 1E8XA 1HEZE 1UEAB 3Q14C 3PZDA 4BY7H 1AZPA 1L6UA 4K1RB 3MC9A 4ODGA 5IWAL 1F1HA 2UWQA 2LRUA 3D6WA 4BBSB 2CJNA 3OG5A 1NTGA 4LF4L 5CGKA 4MEMA 1YQ3B 3M7NA 5FLXc 2MBQA 3W5UB 3EVQA 2F0SA 2N7DA 5EPKA 1UF0A 3LYYA 3W1GA 1CMXB 5IT9E 3PO3B 1QLBB 1ESRA 4A3EG 2BE5C 2OF1A 4RHSA 5FJ8G 5JVH3 3UQBA 1Q90A 2L5TA 4O2DA 1WH3A 4MNOA 2FAZA 2J0TD 2NPTB 4RF0A 2GVBA 3SK5A 3ECIA 4ABNA 4URKA 1AW7A 4OZCA 2DAFA 1PRTF 5FK9C 1GUAB 1SYDA 2JA7B 4C1NK 4E74A 1STYA 1UE1A 1N33L 2ON8A 3NY5A 3DWQA 2EYLA 3EUB2 1OXXK 1GC6A 1EWIA 2C5CA 3W5VB 2F3VA 1NVID 1JALA 2GI9A 2PI2E 2DJFC 1EQQA 5J1ZA 3ZJYC 3RZDB 1Y8RC 3AM9A 3MJWA 3PO3G 3RFZB 1D3ZA 3SGIA 3EFUA 1SMYD 4Z9CB 4AJWA 2ZXOA 2NBFA 1E0BA 1TS4A 2VY3A 1Q3LA 1BUVT 1TWFH 3CCRA 3ONAB 3TBIB 2F0GA 4POFA 1HUMA 1ICWA 3B9JA 1TXYA 4HEDA 3PRPB 4JVZA 3MXPA 2RMMA 3NVWA 4FXKC 4KK7A 4IZ8A 3VUXA 3ZUNA 1C9FA 4JI0Q 1XCTL 1Z2MA 1L0WA 2H1EA 1G6ZA 3J80c 1QUQB 1B4OA 3IRBA 5FJ8H 3LJ3A 2NVXH 3LWUA 3R3OA 1N5WA 5JHAA 2A6HD 4FF1A 4IWQA 1KL9A 4LFCL 1QF6A 5IO9A 1TYGB 2DYMA 1UEBA 5KGUA 3Q6SA 2N3SA 1FRDA 2BT6A 3CC7A 5EJWA 4C3HH 3AU7A 5TSSA 3PO2B 1PH6A 2L52A 2PYKA 1TT5B 4G7OC 4F7ZA 2AQ1B 4ZQ3A 4BBSH 1LM8B 1PYBA 1IYFA 3WWVA 2AEHA 1IL8A 1GB4A 4IPDA 1Q1BA 2NZ1D 1SNOA 2IL8A 3BDLA 4OGQC 4DNTB 4KN4C 2ZTDA 1VF7A 2L32A 2K5WA 2I46A 2ZJRA 1NAPA 3H6MA 3UIOB 3DOWA 3P20A 2KJ6A 2L11A 1VZ8A 3DCGA 1SNPA 3D31A 4IQZA 1FR3A 4FF4A 1LLRD 2Z0SA 3A5ZB 4N8FA 2DUDA 5FLMG 1VMCA 1XNRQ 2R92B 2KTFA 2QCZA 2WXKA 1J9OA 4G50A
chains in the Genus database with same CATH topology
3SE0A 4Q5VA 5IGCA 3NQIA 5E1FA 5M3FB 3NPPA 2L83A 2A6EC 5IGFA 4DNRB 2B2WC 1IKMA 2WU5B 1SF0A 1XLNA 1GPXA 3CKIB 4MM3B 3P42A 2EYJA 4QUFA 2HDLA 2Z4HA 1QQRA 1F2RC 4H2AA 3MJ5A 2AUKA 2E2HB 4XQNA 2K3UA 1UNSA 4S3SA 1QOAA 1K53A 4K5VA 2CQAA 1YN3A 3AMZA 1BCPF 1QNUA 1GUTA 3IAS1 1BMLC 3GTQB 4ZHPA 5C4XB 4HMJA 1UGJA 2N88A 3NVVA 5C5MA 1VF5C 5CMDA 3H91A 5IGBA 3IKJA 1K51A 5ELFA 1FNWA 5C44B 4XWTA 1NCVA 1RCVD 5H92C 5HI1A 4RHRA 1C77A 2DNCA 2A73B 3NUHB 1J7AA 4IFDJ 2N0SB 3NBIA 5FLXL 3Q8AA 2XN9C 2DNEA 2LMCA 3TEWA 2F0JA 1ESFA 4WURA 2LEKA 2V0GA 3TEZA 5C0XG 4RGTA 3PV0A 5JPMC 1QOHA 1LT6D 2K7VA 3MFYA 1EZ8A 3ZJVA 1LTRD 4WWMA 2ZW1A 4B08A 1DOLA 3IL8A 3O13A 1FYCA 3I72A 1XCQL 2IPKD 2KJXA 3AE1B 2EY1A 1CI3M 1NSNS 1SMYC 2Y0SB 2I07B 1CHPD 1HA6A 1H9SA 4IDIA 3EGRA 2EJFC 2M2LA 4OL7A 2EJGC 1DCZA 4WAFA 3E0JA 1YJJA 1STBA 2FBWB 2MPMA 2CJOA 2WXHA 1TZOA 2DY8A 2EXZA 5AFWA 3J80L 1ZKOA 1L0YB 3NUCA 4C3JB 1RDPD 1WRIA 5HHDG 2IGGA 4U68A 1DZ1A 1G8ZD 2A6HC 3H94A 1E9MA 1B9NA 4YXDB 1EWHA 2PCFB 5M9OA 1B1ZA 1JCKB 4ZHOA 4A55A 1I4RA 2JP1A 3FAHA 4ZKCB 1LT5D 1J7BA 2X6GA 2WXJA 4H7BA 1KH0A 1WXQA 2B2UC 1YMHE 3VYTA 2WACA 4N59A 1WTPA 3QG1A 3FEWX 5T8IA 5JOBA 4C3JG 1WGKA 2R3ZA 3K7AB 3VQIA 3NBHA 1O7LA 2X69A 2RA4A 2KQ3A 1VDZA 2NTSA 5D14A 4O42A 2PNRC 3EQLC 4IUNA 2B2UA 4C3IB 3KUPA 2E76C 4HCEA 1S5CD 3T13A 1P7FA 1EY0A 3OSOA 3VYUA 1TWGB 1BBXC 3AE5B 1SFOB 1EYCA 2WXQA 2HDMA 3T3OA 5C3JB 2A68D 2XWJB 3SK6A 1EQVA 3MTSA 2RPVA 1HZ6A 4XQJA 4J6HA 1AEXA 2F0NA 1JE4A 4XXEA 1SBBB 4X3TA 1OO9B 1G91A 1GUOA 1TWAB 1JR0D 1KRHA 2M19A 4C3IG 4FXCA 1XF5L 2LHEA 1EL0A 1FXAA 1SYBA 3OIPA 3S15B 3TP5A 2W54A 4CKEA 2IX3A 2O5JC 3K5OA 4XDDA 4KKTA 4YT0B 2H88B 2XVSA 1RD9D 1ROEA 3GQBA 2KQ4X 2M9VA 2EOTA 3I4NB 4IUTA 3SHLA 1PUTA 1E7PB 4ZUIA 2BDOA 2SNMA 1HFNA 4HKZE 4IUVA 2JEBI 4PV1C 1I50B 1CTMA 2LMCB 5C0XI 5F2DA 3AEFB 3Q8CA 1I4HA 2WXLA 1FCLA 2LJIA 3CRLC 4NDXA 1V8QA 5JEAH 1NI3A 2WXMA 1EWCA 4HR7B 1F9PA 1JB3A 2KDMA 1XX8A 2F0LA 1MPEA 3EFXD 3NXWA 3GO5A 1JRPA 1QT9A 2OEOA 4K14A 2PO4A 1SE4A 1QJOA 3T16A 1SIJA 3MA2B 1WTRA 1H9SB 2E74C 1IW7D 4A3MB 5I6WA 1N62A 2KCNA 3IFTA 1IGDA 2A74C 3MHBA 1EY6A 4FXDA 1SSOA 3BDOA 1LACA 3QB3A 3VYSA 3I70A 3P4QB 2G9HD 1HQMC 2IX1A 1P7EA 1KNAA 1L0XB 2XWBB 2RKSA 5EPJA 1B50A 3W1SA 1DD2A 1IYVA 3WOEA 1JQ4A 3I8ZA 2J4XA 1AP0A 1DM0B 3P63A 4G7ZC 5CORA 4WH4A 1O7ZA 3BDCA 1A3UA 3K5NA 2N9KA 1S5FD 4CKBA 4EGVA 2VB2X 2FINB 2E75C 3BS1A 4US8A 3LWEA 1SDFA 2O5IC 3AH7A 3AE6B 2LKVA 3QOJA 2KACA 4GDLB 3W2DA 1U4LA 1D1KA 1UWXA 3GTLB 4KV6A 5BMIA 1WYGA 1N60A 1F2MA 3IT4B 4RNAA 2BE5D 2K03A 1TKYA 1VR9A 2BCOA 4FVMA 1V97A 2Q8IB 5C4JB 3HG9A 5I9PA 1TY2A 4QMGA 2EZVA 1PDXA 1XWEA 5C6AA 1A15A 1C4PA 5G5HA 2K22A 4MH8A 1HXYD 1LTSD 4FF2A 2BB6A 4TSSA 4JWSC 4JWUC 2D62A 2GRIA 3QIAA 2CHBD 4CKCA 1X3QA 5BN3A 4L1BA 3Q69A 3J81E 4LTUA 5I2XA 4MN3A 3L4PA 4A3KB 2JXMB 1PGAA 3H09A 2ACZB 3Q24A 4KD3A 3KLSA 1T3QA 1HCZA 1F2RI 2B8GA 5CBAE 3PMFA 2GA4B 1C4CA 3NTHA 2VNUD 2YEPF 1K83B 5MPOA 3PUXA 1AWDA 3VRAB 3T53B 3TUOA 1FNVA 1MVKA 3SDZA 5BMGA 2JU6X 2PZTA 2I2YA 2ZXPA 1GHKA 1IW7C 1JICA 1C9FA 1O7YA 1STGA 3H0GB 5CV4A 3C46A 1RWSA 1HTPA 4YWGG 3K5LA 1PFMA 4YTPB 4PMWA 5FO9B 2ZT9C 2QKIC 1MHHE 3V96A 5M3MB 2WIIB 3IT6B 4M0WA 2A6ED 5EBCA 3QJYA 1EIGA 3TEXA 1PTOC 1ENCA 1KFYB 4OZAA 4RF1A 2L0CA 4MHEA 2BS3B 1JWBD 3UI3A 1FMAD 1DYQA 3BVZA 3AECB 1ZOYB 4L23A 4K8JA 1T6BX 2QSDA 1D2BA 2BOSA 2F0FA 3S14B 2EYMA 3Q8BA 4K6LA 3E6ZX 2PIAA 1ET9A 1QKZA 2KAJA 4ZUJA 2XNAC 2ICEC 3SEBA 1D5MC 1VZ7A 2W55A 5FOBB 4HSVA 4P2CB 3D4RA 4ULLA 3S16B 1AYFA 3J9CA 1Y56A 4C3HB 4OO1H 3ZYYX 1ZDXA 3JAML 2WB1B 1TS5A 1EYAA 4H13C 3PIO3 2D9UA 1ZXHA 3CWIA 4L63B 1VLBA 4JBWA 1RJTA 5KNDA 1PFBA 5D7GA 3S2HB 1SYCA 4WIPA 2KEDA 1OQQA 1NEKB 2F0QA 2N55A 5NUCA 1S4ZA 1CFMA 3VR9B 4YTMB 4XWWA 3NHHA 1OQRA 2WXNA 3SFDB 4RWSC 4K2LA 3Q8FA 5E3FA 4C1NI 4C3HG 3NVYA 1TT2A 3QWNA 2BS2B 5COYA 2KUMA 4JX1C 5H8YE 1EFID 4KI0A 1ACCA 4KJNA 5I6YA 3DWPA 4MACA 4P16A 1HPCA 5K5PA 3HOWB 4DAPA 1YNTE 2HUGA 3R8BA 4OZBA 3U52E 3AE8B 1BDOA 4CBVA 2VUMB 3NWTA 1QWYA 2F0DA 5CR3A 2VZKB 4XYQA 1YNND 3N52A 4IN3A 1C79A 3NP8A 1G291 3DM1A 3VYRA 2Z4IA 2KCCA 4BBRB 1PZID 5EE1A 2AX5A 4J3OD 2PW7A 4IURA 4F8MA 4OIJA 2F0MA 3AMUA 1QB5D 2NN6G 2WS3B 3Q8EA 2MUYA 5BN4A 3LB8C 1GOZA 1LT3D 1G2TA 3C1EA 1I6VC 1HTLD 3GTMB 5C2TB 3PUZA 4HROA 1U9RA 5C0XJ 3D4WA 2Z1CA 2NTTA 5DEHA 4B9WA 1Y8OB 2TMPA 3H8HA 3V2TA 3J7AV 1W6JA 2AQ2B 5C5LA 1E6EB 1PFNA 1H9KA 4DK0A 1B53A 3DMUA 2B2VC 3SR6A 3PIP3 2FE8A 4NAWB 4P6VF 2SOBA 4EQNA 1RTNA 1ENFA 1T5XD 4OHJA 5C3EB 3NE5B 2NN6H 2F03A 4ZRQA 5HFYA 2SAKA 3U2SC 3K5MA 4D2KA 2F0EA 2QILA 2B2WA 2HQEA 5ELBA 5ELEA 4REZA 3FILA 2INNE 1GJXA 1BXTA 1PTOB 2EYPA 2L1BA 3NK9A 3KK7A 1F9QA 3GV6A 4HCSA 2PTLA 1QOGA 1FGBD 5CV9A 3TSSA 1DOMA 2ICIA 3SVMA 1XYIA 4KKUA 2B39A 4CJ0B 1CA6A 3MWYW 2F0OA 3URYA 1AN8A 3NRZA 4EQOA 4A93B 4A9AA 4X3UA 1Q12A 1F2YA 2JEAI 3FPUB 1DOXA 2PKOA 3J7AF 5EQ0A 2J53A 1N61A 2K28A 3A8IE 2G1EA 5CV5A 2XSCA 3FKIB 1FD6A 4DXGA 1KLUD 4M8AA 1SNCA 4DN4M 2B2YC 2JSVX 2QDBA 4CJ2C 1I4PA 4CGYB 5T1IA 1JWSD 2R6GA 1F2ZA 4QB4A 4G7HC 1DXMA 3K57A 4ZKBB 3GB1A 1YNNC 3BYTB 5KNBA 1LTTD 1PTOH 2TSSA 2BB5A 1Q8IA 3OWFA 3L3OC 1WTWA 2B2YA 2GB1A 1BUIC 5EE0A 3DEOA 3K58A 4JPSA 3BVMA 4BY1B 1FEHA 3KBXA 1LO5D 2ID0A 2F0TA 3FVQA 5IT9L 1TU2B 3G6JB 3DEPA 3NTIA 1NYQA 4OIKA 3WCQA 3KQ4A 2JE6I 1BCPC 2NN6I 2QIEB 5G3LD 2M0AA 1VRAB 2X38A 2VB3X 5AUIA 3VR8B 3L9AX 1II3A 1J8IA 3GS2A 2XRSD 4K5XA 2WP8J 1YNJD 3D3RA 3ETRA 2F4IA 3CRKC 3ZQ4A 2VXWA 1RYJA 3J7YW 2F0PA 2IX0A 3P75A 3D8GA 3BIID 3OWEB 2XRQD 5J22A 1HUNA 3I91A 5A2QE 3K0YA 1CHQD 3DHQA 3I4LA 5FO7B 4C7ZA 1TS2A 1S5DD 3F2UA 3Q22A 1ZDVA 3I3CA 2CU3A 3FMCA 2LFIA 1RODA 4H0LC 3TP7A 3FILB 5KIXA 3CQZB 4ZOHC 4ZLTF 2NYZD 2WDVB 1TIID 4KN7C 5JEAG 4A3DB 2R7ZB 1JORA 4JE3B 4L8JA 2J52A 4NKLA 2VZKD 2K04A 1SNDA 1JMLA 4IFDH 2MJ3A 1DOKA 1HA5A 5HGTA 4KHZA 2A5HA 1TWCB 2EE1A 4ZAIA 2KECA 1SJHD 2V4DA 1XEEA 4RCOA 3RD4A 1QOBA 2C9OA 4ARIA 3FDTA 4F7XA 3BWUD 1E0ZA 4DA2A 2E2IB 5LHY1 2FJ2A 4PT5A 3NVZA 2BA1A 3I90A 3BG3A 5IODA 2BA0A 2R61A 2EY2A 1PLFA 4NW2A 4WJWA 1L6VA 1A3VA 5EKLA 1U4MA 4BWGB 1R9TB 4A3BB 4UDUC 4FNFA 2BW2A 2BTEA 1ILQA 1GUWA 1D5ZC 4K6DA 1RF2D 1IBXA 4RKLA 1MHXA 1UAPA 3ITPA 5IGGA 1MGSA 3I4MB 1F77A 2HCIA 2ZXRA 3DWAA 2W3RA 1Z7TA 1CZGA 3BK1A 5KRUA 3VR5A 4CHTB 3VA5A 1ZXIA 2WDQB 3M7GA 2INPE 4TKOB 1OXVA 1C76A 1HFGA 4DK1A 2KOLA 3MHZA 1PTOD 1TWHB 4AQ7A 4A3JB 2DYOA 4OVZA 3ZJUA 3KLSX 3HRDD 2M00A 4KX6B 4L2YA 4Y7NB 5KNCA 4RFBA 1YN4A 2E3TA 1IGCA 1YNJC 2RVLA 3HKZB 2EYHA 2ONQA 4G4KA 1X32A 1JOOA 4HAEA 1H9JA 3FPPA 3W3AA 3T51B 2IGDA 2Q5WD 2L1AA 1EZ6A 5I9OA 5DAUA 4HEA1 5C3XA 4YIJA 3W9CB 1BCPB 5J39A 1Y8NB 5LL6S 3MXUA 4ILWA 2V3PA 4XE0A 2HTME 3AE9B 2DWQA 5CV8A 3GTOB 3NTKA 5A35A 3D6CA 5C4HA 5LNK1 3R2TA 2IJ0A 4BS9A 4CJ1B 2KWDA 1TR5A 3TEYA 1KDAA 3X3MA 2HCCA 3MXNA 4KKJA 4YTNB 4B9XA 3PUYA 4R9WA 4A3GB 4GDKB 5JJZA 3RMHA 2IGHA 1CQFA 2Y3AA 1EY9A 1SEBD 1EY8A 4PMCA 2BBCA 1YQ4B 2EPBA 2IWHA 4C7YA 1E2VA 1I4GA 3AB5A 5KYLA 4RGNA 3GD7A 2JYOA 2EKIA 4KHVA 2ENBA 2L4NA 3LNNA 3OMGA 1XO3A 1B2TA 1OXSC 1Z47A 4N58A 3FRPB 4ME5A 4KY7A 3TMEA 4RKBA 1D4BA 2OT2A 4DGZA 2PW9A 1V1PA 1JOQA 2N9LA 3GTKB 1S5BD 2D5GA 2JXTA 3MAQA 2R93B 4IUPA 1PYWD 3A7LA 4ZK9B 1WTVA 3C2PA 3GTGB 3TDQA 2Q8RE 1IKLA 5EBDA 4GZYC 4ARCA 2LHDA 1LTID 2EY5A 5CV6A 2JYEA 2RDGA 5C3WA 5EKIA 1QNKA 1B3AA 4A90A 2B8FA 4MIUA 5ELDA 3PZ8A 3OOCA 2RSNA 2WXPA 2JQRB 3E56A 1ZEQX 1BR9A 3HVZA 3AEBB 1CZWA 1FM0D 3IAM1 4WRDA 1IBXB 3I9V1 4A6QA 1ZUD2 5BYRA 2QEJC 5JVG3 2F0UA 1M4VA 4XT3B 5E4WC 3M3YB 2WQYB 5ISRA 5GXGB 3AB9A 4WQMA 3P4RB 1RTOA 5G5GA 1ZXTA 2K9XA 1MI2A 1SE3A 1STAA 1BOSA 5FO8B 5EKKA 2KA7A 5FR3A 4NAMA 1KLGD 4OO1G 2WV6D 5D65A 4N9TA 1Y1WB 5KYIA 3T3NA 4HKQA 5C4ZA 4WFN3 1LTGD 2O4XA 1R7SA 4V190 4B0EA 1SYFA 4XIGS 4C56C 1D1IA 1YJIA 3HP3A 2XIWA 3V3XA 2O2LD 3PUVA 1PRTD 2EYOA 3PO0A 1L4DB 1A3TA 2K6AA 4F88A 1KF6B 2MEKA 2EY6A 1VJKA 2MHVA 1RFKA 1FIQA 1HZ5A 3MC0B 2OHFA 2D2CC 4IUUA 5K36H 3MP9A 2WKDA 4UAIA 2YU9B 2A69D 1LTBD 3GV3A 2Y5CA 4KGTA 1O80A 1HRJA 3EJIA 4XT1B 1SB3C 3RPFC 3OIQA 4KGSA 5E4XA 4A3EB 1S5ED 1BQQT 4U673 3RLFA 2J42A 2WXFA 1CK1A 1A2UA 5BYQA 4LJZC 2H89B 3GTPB 3OPOA 1C4AA 4DFAA 2AUJD 1GUNA 2V3NA 3J80E 2F0IA 1TKWB 2EELA 5M5YB 2F0VA 1U4RA 4HTHA 3HS0C 1SNQA 3S9WA 3S17B 1UUPA 2JX5A 1SYEA 3P1HA 1PZKD 4KKSA 1QG7A 2JA8B 3P4SB 2DBYA 3RZOB 2EDGA 4QCLA 4R8NA 3SXHA 1ZP0B 3NS1A 4DAVA 1XLQA 2NUCA 1V1PB 1VMPA 3MZ5A 3K59A 1GXDC 3A54A 3MVVA 1STHA 1MD2D 3ND9A 3PUWA 3DXJC 1GHJA 2LUMA 3BYYB 4LLGM 5HURA 4RH6A 1V1OA 1KABA 1V8CA 2K5PA 2HDEA 2PW5A 3SK8A 1PZJD 4I65A 2JYTA 1BCPD 1FXIA 4AYBB 5BN5A 1HQRD 1X3PA 2B2TC 4RGMA 3TN2A 5M5WB 1KAAA 3TZUA 1FRRA 1TVXA 3AV8A 4GLSC 3AN1A 4KGRA 4FP5D 4F87A 1CQVA 3TP6A 1C4QA 2W3SA 4TMAB 4TQ1A 4N6EB 4R3DA 3J81L 1OFFA 2QF7A 4V0BA 3U7ZA 2B2TA 1LV9A 3VA7A 4OO1I 3AE7B 3B2GA 2FHTA 2IW3A 1QOFA 4DQOC 1PGXA 3CHBD 4B0MA 1I3QB 2CW0C 2KMMA 2WAQB 1E2ZA 2WXOA 4MT5A 2EVBA 2B2VA 4DF7A 3BK2A 1SE2A 2RQXA 1OXUA 2IT1A 3FC4A 1WSPA 3C3LA 1N5XA 1PRTC 2B63B 1TKEA 3C8YA 4J8QA 2KEEA 3KWVA 3OW7A 4HMIA 1Y1VB 2QCPX 3DWMA 4AS1A 1FCCC 2K05A 2MJDA 1LT4D 3X3NA 5IGEA 2A69C 4LMQD 5LL6X 4N9PA 1NUCA 2PZWA 3P7JA 2WP9B 4XYOA 1JQYD 3M85A 2WXGA 5IGDA 1SSNA 5JPNC 2K33A 3AEGB 2DY7A 1MI0A 1WD0A 4J1MA 1GAQB 1ILPA 5T1GA 1YN5A 1WWTA 3HZXA 2IDYA 2F0WA 1TJEA 4ZRPA 1H9RA 3NQTA 4EVOA 1GUSA 1TS3A 4RCNA 2RBMA 2PVOD 3SFEB 3K6OA 1D5XC 5KEEA 1HHVA 1DOIA 2AQ3B 2YEPB 4C2MB 1PMRA 2E2DC 3I73A 4CQNA 2Z8LA 3ZJTA 4KTAA 5EE3A 2WXIA 4TQUS 1ZPSA 5CBEE 3KWLA 4L6TB 2FMCA 3A8KE 1IUEA 4Q2JA 5EPLA 5I2YA 1DOYA 1EU4A 1Y8PB 5JEAJ 2F0HA 4FXGC 3A55A 3Q0AA 4YSXB 3A8JE 2NB0A 1L4ZB 1EY7A 1CA5A 2LS01 3BZDB 2K1BA 5DM73 2PMZB 2QJLA 3GP7A 1U4PA 3HRZC 4I7ZC 4OW0A 1JWUD 2K32A 5C0XH 4A3IB 1MSHA 4NZLB 2QMTA 4XDCA 1K8MA 2H4OA 3WOFA 3MFGA 1WD1A 1MSGA 1AZQA 1FNUA 3LX0A 2NMQA 1RKNA 4M1UB 4HN7A 4A3FB 1C48A 4FO2A 2MJ8A 2BDNA 1KDBA 3KF8A 2WDRB 3SK4A 1EWYC 4IFDG 4PNYA 3A7AB 2B76B 4XDXA 3S1RB 1ZE3D 3AE4B 2JA5B 1STEA 2WXRA 2OEDA 3RUZA 2EYFA 2SNSA 1G2SA 2SDFA 4R8IA 5FKAC 1Q1EA 3SR1A 1N63A 1EIHA 1E2WA 1VDVA 2DLBA 2JSOA 2NWGA 2MP1A 2MJEA 5BYSA 3HOVB 1BO0A 2FFKB 2L55A 4ZRZA 4DAYA 4HJGE 2M56B 3HUIA 1DGJA 1A70A 4YSYB 2WINB 4HSPA 3LXFA 1JROA 3UI2A 4G57A 1F9SA 2F3WA 3V05A 1FO4A 4NP5A 1B44D 4X3KA 5IIFA 3E5SA 2SEBD 1WVLA 3CIRB 1JOKA 2K5QA 2NVQB 5G3LF 5CC4A 1FFVA 4IALA 2LY7A 3G7LA 1PRTB 4KY5A 1BF4A 1R4QB 5EGTA 2LFNA 1STNA 1PDQA 2PQEA 3C1FA 1SJED 2MH7A 4WORA 3DWGC 2MGSA 1I7HA 4IKGA 3AEAB 1PXUA 2EJMA 1MBYA 1UWMA 3P4PB 1F9RA 2E2JB 1K50A 3T4AC 4PMBA 5CYUA 4QUCA 3IXSA 4DU9A 4HRSA 3N6RA 2E6XA 1B9MA 1C8CA 4KJOA 2X6LA 1DONA 1WCMB 2K5DA 2L12A 2JZPA 1I6HB 1GB1A 1A2TA 1SXTA 2AWOA 4EE2A 2FMMA 4QIWB 1KTKA 1A6XA 1I4XA 5DNFA 2WLBA 3IFDA 1QILA 2L9HA 1SAPA 1JWAD 1VCIA 1XTCD 1CZPA 4Q0FA 2PMVA 1F0ZA 4YSZB 3VR3A 3D4DA 4ZYSA 1TKGA 1QCBD 1FFUA 1SNMA 2OXPA 3HOUB 3PZ7A 3S2DB 1WTXA 3AEEB 1CT1D 4KD4A 1EEFD 3JAME 1L5PA 3M4OB 3IAYA 2NVYB 1IYUA 5D3IB 5EE9A 1O78A 1L0VB 3NSWA 1Z6HA 4H44C 2JWUA 5CV7A 4LK0M 4LK1C 1IHZA 3S1NB 2WNMA 3VR2A 2JA6B 3AEDB 2PVGC 1ZYRD 3MXGA 2YYZA 4E6IA 4IFDI 1C78A 1TQOA 5M5XB 3VR6A 5DM63 2AWNA 2D5DA 3M4YA 1PGBA 3N9YC 2PZUA 1Y69U 4NMZA 3OHXC 1KNEA 3HOZB 3S1QB 3R2IA 2Q8TA 3R93A 3T56B 1EM7A 1EY4A 2KVMA 4IOIE 3HOXB 5D3DA 2WKCA 4US9A 4K8IA 4RGOS 2BS4B 1D6EC 2A68C 3AE2B 2NVTB 1W6KA 1CM9A 1EYDA 1PTOF 3EROA 4ITKA 3S1MB 4BA2I 1EY5A 1NYRA 2FUG1 5JAVA 1BNZA 3B2FA 1VZ6A 1NR2A 2N7JA 3KBGA 2F0KA 4TRDA 1LTAD 4K5WA 4RA8A 2BYTA 4X3SA 5AUKA 5BMHA 1K52A 1T5EA 3GTJB 1EU3A 5A2QL 2PLPA 1I4QA 1ONLA 5I4DA 4USAA 3HGBA 1OXTA 2RDHA 3VR4A 3ABVB 4KY6A 1J7CA 2RSOA 3L7ZC 4QF4A 2KN4A 1H9MA 1ML0D 4DXFA 4FF3A 3NWSA 1JW9D 2V4IB 4C80A 1XLOA 5IOCA 1B9RA 3QO2A 1TY0A 3HOYB 1K8OA 1R4PB 4XTCS 2PPBC 3KLRA 3VRBB 1E10A 3ND8A 1NR4A 5E6JA 3ZGZA 1JC7A 1EOTA 2K0PA 2DN8A 1WTQA 1EQTA 3EA6A 4BY7B 3CU7A 1DJRD 2I38A 4XQQA 2F1MA 3P1MA 4JK1C 1ENAA 3TP8A 3A56A 5K36G 1CJEA 1RHPA 3U4EG 4A8XC 1M8AA 5ELCA 3HVDA 1EEID 4PQXA 1RM6C 2ZW0A 1KDCA 2CW0D 1WTOA 4K2KA 3QOLA 3DUZA 2WU2B 5FLXE 4KMUC 2Y5PA 2W82A 3TZDA 3BVGA 4RAUC 1LABA 2KHSA 3U9SA 4EQPA 1SYGA 1NENB 2J7ZA 1FD7D 4LAAA 1GUGA 1ZYRC 4IUQA 3WDNA 3AE3B 3MEHA 3H3VC 3HEJA 1AFPA 4TQ0A 2RDFA 4KKIA 3E9SA 5HG2A 4ID6A 3I57A 1JWMD 1PFDA 4NJCA 1ET6A 1TWFB 3ERQA 5JXVA 1V43A 1XXGA 1QE6A 1F2LA 4O1NA 2CVRA 3Q23A 2G9DA 2K01A 4FYDA 1Q10A 1XLPA 3NZ3A 2NVXB 4BA1I 3U9OA 3OMCA 1HEZE 1UEAB 1AZPA 1L6UA 4ODGA 3D6WA 4BBSB 2CJNA 5CGKA 1YQ3B 3M7NA 3W5UB 3EVQA 2F0SA 5EPKA 3LYYA 5IT9E 3PO3B 1QLBB 1ESRA 2BE5C 2OF1A 4RHSA 5JVH3 1Q90A 2L5TA 2J0TD 4RF0A 3SK5A 4ABNA 1AW7A 4OZCA 1PRTF 5FK9C 1SYDA 2JA7B 4C1NK 1STYA 2ON8A 3DWQA 2EYLA 3EUB2 1OXXK 2C5CA 3W5VB 2F3VA 1NVID 1JALA 2GI9A 5J1ZA 3RZDB 3AM9A 3RFZB 1SMYD 4Z9CB 2ZXOA 2NBFA 1E0BA 1TS4A 1Q3LA 1BUVT