1D6EC

Crystal structure of hla-dr4 complex with peptidomimetic and seb
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
total genus 62
structure length 225
sequence length 236
ec nomenclature
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d6eC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d6eC02
4BWGB 1GOZA 1CK1A 1D5ZC 5FKAC 3DWQA 4NZLB 2R61A 2G9HD 1CHPD 1EFID 1EU4A 2O2LD 2XRSD 1PTOH 2TSSA 4L63B 1B44D 3BVMA 1TS5A 3V05A 2QILA 4RHRA 1AN8A 1YN3A 1HQRD 1TY2A 2ICIA 4C56C 1TS4A 3BZDB 4L6TB 2SEBD 1PRTF 1ET9A 1LTGD 1SXTA 1YN4A 1BCPF 1SJED 1XXGA 5TSSA 1CT1D 1G8ZD 3MC0B 5ELEA 1PRTC 1PZJD 1JWSD 1I4HA 1JR0D 1LTTD 1TS3A 1BCPD 1SJHD 4RFBA 1S5BD 2NTSA 1FNVA 1EWCA 5D3IB 2Z8LA 1LTID 4K6LA 1CQVA 1ET6A 1SE3A 1LLRD 4DXGA 1LTAD 1EEFD 3DWAA 2IJ0A 3R2TA 1YN5A 4TSSA 1S5FD 3KLSX 3GP7A 2IPKD 1JWUD 1LTRD 1PTOF 1PRTD 1PZID 1I4XA 3O13A 1STEA 1LTBD 1I4GA 1SE2A 4RGOS 1BCPC 1XTCD 1LTSD 4RH6A 3MFGA 1PTOD 2XN9C 1EEID 1LT5D 1ESFA 1QILA 1V1OA 3SEBA 1RDPD 3TSSA 2AQ1B 1V1PA 1EU3A 1BXTA 4RHSA 1UUPA 1RD9D 2NTTA 1DJRD 3EFXD 4RCOA 3W2DA 1TS2A 1DYQA 1I4QA 1PTOC 4RGNA 2XNAC 2WV6D 3BYTB 2RDHA 1D6EC 1V1PB 4O1NA 3CHBD 3R2IA 2RDGA 1JCKB 5D3DA 1I4RA 5ELFA 1M4VA 1HTLD 1PYWD 1SEBD 2XRQD 1PTOB 1RCVD 1F77A 1FNUA 3BVGA 1UNSA 1JQYD 5ELDA 1T5XD 3EA6A 5ELBA 1LT3D 1HA5A 3BVZA 3URYA 1L0XB 4DXFA 1LT6D 1MD2D 3BYYB 1I4PA 4RGTA 1S5CD 1KLUD 1S5ED 3DWPA 1S5DD 1KTKA 2QEJC 2AQ3B 1L0YB 1FGBD 1PRTB 1LT4D 4OHJA 1PZKD 5I4DA 1SBBB 1HXYD 1CHQD 1LO5D 1FD7D 1BCPB 1SE4A 1ENFA 1D5MC 4RGMA 1B1ZA 5ELCA 3R8BA 2J4XA 3OWEB 4ZYSA 4Z9CB 1FNWA 1RF2D 1KLGD 1TY0A 4UDUC 1D5XC 1AW7A 1JWMD 2AQ2B 5FK9C 2CHBD
chains in the Genus database with same CATH superfamily
3QJZA 2KZRA 5HKHA 3APFA 3C2PA 4IWOA 1DOLA 5BR8Q 5IGGA 1Q8IA 2G9HD 4X3TA 4OO1H 1EY8A 2K05A 3SHLA 5A2QL 4IFDI 1M8AA 3APDA 4DNTB 5JJKA 4R8NA 1VQBA 1OXXK 3FHWA 3JAME 4PZ8A 3G6EA 2B2VA 2KWVB 5M5XH 5JXVA 1CKNB 1TS4A 4HDOA 4K0KL 1EIGA 1TU2B 3CCLA 1NMFA 1TR5A 3GDEA 2R92B 1L0VB 4X57B 1UF0A 3C19A 3PV0A 1DONA 1P1AA 5ELEA 4K81A 2D2CC 3PZ7A 4CYEA 1GUNA 3GTPB 3W1SC 1HCZA 2JA6G 5M5YH 3HOYG 1YQ3B 1KD1C 2C5LC 4HXDA 4YCWA 2JWZA 4YWKA 2WKDA 4JBJA 4DV1Q 2QKIC 5M3MH 4GOCA 4HWIB 1A3VA 1VQHA 4BKTA 1SE3A 4MH8A 1BOSA 1OQRA 3M3YH 1F52A 1R7SA 2B63B 2WXNA 1BQQT 3NZ3A 4TVAB 3Q22A 2HHHL 2KXJA 3T1YQ 4GKJL 4US9A 1LTRD 1BBXC 4YWGG 3VVWB 5CYUA 2WS3B 2ZCBA 2ZJRA 3ERQA 1C8CA 4AH6A 2WXQA 4OVZA 2GA4B 3IRBA 1WXAA 2KWDA 1R4MI 3P20A 3J81i 3N1ZC 5BO4B 4NXMQ 2G4SA 2LHEA 5DEHA 4A3FB 2N49A 1TWAB 1UBIA 5C4XH 3ZTCA 1V6EA 2K9XA 2ZW1A 2WYQA 2WB1B 4A3BH 1Q90A 3EFXD 1O7LA 4A3JB 1Y1WG 4LUOA 4NXNL 3H8HA 3HRZC 3ZNZB 2K01A 3PIP3 4DQOC 4LFBQ 4TV3A 2E74C 1F9QA 1V5TA 5L83A 3J7AV 3NVYA 4L5SA 4B3MQ 2OF1A 3ZYYX 5IGBA 1YHAA 5M3FH 3D4RA 1PH9A 1IBKQ 1L1OC 2KC1A 2LJ5A 3K5LA 4HJAA 2MSED 1ZKHA 4BY7G 3N1YC 1KM7A 3SFDB 4FXGC 1VQLA 1RJTA 1NDDA 1P9DU 2FUG1 3NWSA 4ZCKA 1SNDA 4P6VF 3VRAB 3FKIG 4USAA 2O5JC 2PIAA 1Q81C 3MJ5A 3S15H 4DR2L 1QB5D 4PZ6A 1QZGA 1PA6A 1Y1WH 3BYYB 2RHQB 4F7XA 2LGSA 4YWLA 3VR5A 4FVMA 3QX1A 2N55A 2F0EA 3H1UA 1PXUA 4IUTA 3S2HB 1N8RC 2FHTA 2EMTA 3DWGC 3NBIA 4HCSA 1YIJA 4MGYE 2IYDB 1IYUA 4XDXA 3PMFA 5G3LD 3B6YA 4E3CA 3PO2G 4WAAA 1F2MA 4RMAA 4BKSD 5BMHA 4G7OC 1B1ZA 1QLBB 5D2MB 4J8QA 2IX1A 5DPSA 1GHJA 4ZYSA 4AYBB 4PZ7A 1GB4A 3S2DB 2VB2X 1X6OA 1K0SA 3EIVA 1AW7A 1SIJA 1NYQA 4DR3Q 1T0RC 5C0XH 1MG4A 1K8OA 2K5HA 2VZAA 1V9JA 4KV2A 4JI3L 3GTKH 3OG5A 4NZLB 2BYFA 2N1VA 1JROA 1X3FA 3I8ZA 1OFFA 2I1JA 3ZXVA 3TEWA 3V05A 3L7ZC 2L05A 4XYQA 4KZCA 3FPUB 3M4OH 2A74C 2KANA 4XQQA 4W9HA 4HJ5A 4LW1A 1TWFH 4A3KB 1WCMG 1MHHE 4ZRKA 3STBD 4NPSA 3VDYA 1IL2A 1B70B 2KWCA 4FULA 1P3QU 1YN4A 3MHBA 2YYZA 1D8LA 1KL9A 1IYVA 2WACA 5EE1A 1HA6A 2NPTB 1KNAA 4K8JA 4DU9A 3P4PB 2MO0A 1I94Q 2VRRB 3EQLC 1QOBA 4BOZB 4JI0Q 1SJHD 5HGQA 1WJ6A 3NZSA 3TS2A 3PT2B 1HUMA 1XPUA 1D2BA 2Z8LA 1PFDA 1ET6A 3RMKC 1WD0A 4CHKA 3TMPB 3ER0A 4LCDE 2F0KA 2J52A 3QC8B 3WAPA 1EY4A 1TWGH 2IJ0A 1PH4A 1K50A 4M0WB 4WQOB 3LJ3A 3SHQA 3UQBA 3QA8A 3L0WB 2Z59B 2KQ7A 1LFDA 4O2DA 4C3IB 1QNUA 3TEYA 2YTXA 3H9DA 2UXDL 4YXDB 5J22A 4ZYNA 2E75C 1HZ9A 3LWUA 3PRMB 3NTIA 3NBHA 4FXDA 2FMCA 2Q8TA 3AEFB 3J81c 2UUBL 4IALA 1EL0A 3BDOA 1XJVA 4I7AA 3TP8A 2L83A 2PE9A 3ZRFA 2L1BA 2GVAA 2BQQA 1LACA 3BIID 2MHVA 2BTEA 1J9OA 4NMZA 2RGFA 3CP0A 2WKCA 5BN3A 4C00A 2DBYA 2M8SA 4A3MG 1RRBA 3VH4B 1L0WA 2YTYA 1AE3A 1EZ6A 4GKJQ 5IGCA 1JRUA 4KSLC 1ISNA 1YZ6A 1HQMC 3ENEA 4IKGA 3QWZB 3RLFA 2A68D 4UAIA 2LGXA 4EZJA 4K3BA 4HKZE 5ELFA 3RCZA 1FR3A 4XIGS 2IY0B 1RCVD 3GTQH 3J7ZC 3V3XA 2JYTA 2CR5A 4U673 1E90A 1Y8RC 3NVWA 3KUZA 1LT3D 4GDKB 5LLIA 5KHQA 3H09A 1Q12A 1CA5A 2QCZA 2L5TA 3AE8B 5KNCA 2JE6I 3RULA 2L12A 2IT1A 2RCNA 4GOPB 1S5DD 1G6ZA 1N61A 5D6JB 5LXHA 1STHA 1SMYC 5BR8L 4L8JA 2F03A 4GN5A 1LGRA 4LK1C 3DEOA 1KXLA 4DAPA 2M4NA 3H6NA 3DM1A 3EN2A 4W9FA 1BCPB 1KC8C 2F0QA 4JBMA 2JUOA 3DBHB 2EJMA 2HTME 2EXDA 2ZXOA 1OQQA 4GLVB 1S40A 3GTMH 1H4RA 2K5WA 2KQ4X 2KTRA 4HROA 2R3ZA 1TY0A 4X65L 2J7QB 1YD8U 4L2YA 1UE6A 2EY1A 2QGQA 4DV0L 3IKJA 2L32A 3GV6A 1N36L 2BS4B 1FPYA 4P72A 2Z0DB 4CDDC 3KDFB 3J80i 3H0GB 1VCIA 4K5WA 2L76A 5AUKA 2PTLA 3CF5A 3ZDTA 2CH4A 3U4EG 3D6WA 1YX6B 2OCEA 1HR0L 1CZWA 2CU3A 4H0LC 3AEEB 5CV6A 4HPLB 2DJFC 3T1YL 1A62A 4RG1A 1XNQL 1WZ0A 2JYEA 2F0VA 5E4XA 1WYDA 1N62A 3A1QA 3RD2A 1A70A 1XWEA 4QAYA 2F1MA 2X69A 4IQZA 2XK5B 1T6BX 3U7ZA 1X55A 1TS3A 2WXHA 3SFEB 3SVMA 2BT6A 2KACA 3ONSA 4E71A 2H4OA 2KOLA 4DV5Q 1WCMB 4BXXH 2B2VC 5JJIA 1TTNA 1J5EQ 1I6HH 1NI3A 2DUDA 1IBXA 1LTAD 1EEFD 2CKZB 3CC7A 2E8GA 2VW9A 1STBA 3Q2AC 2LY7A 1BF4A 3JC66 1JE4A 4JI6L 2R7ZG 2HDEA 4B0EA 3NSWA 1NEKB 1U4MA 3PUWA 3X3NA 4WJWA 1JB3A 2WXJA 1LTSD 1U5KA 3D6CA 4GDLB 2OHFA 4W9LA 2K14A 4FF2A 1AWDA 5CV5A 2GOWA 3K0XA 5DNFA 2DX5B 1CI3M 2UUCQ 4A3GG 3AE4B 3HHMA 3MJWA 5EKIA 2AQ1B 1B8AA 4HEDA 3KYCD 4DR2Q 4PV1C 3VR9B 3T16A 3NE5B 1C77A 3WA0A 3N20C 2NTTA 4C3IG 2EXZA 4RCOA 1PYBA 1Y14B 3VR4A 2PQAB 1PGBA 1UGMA 2K6QA 3H7PB 2MP2A 4G7ZC 4IUMB 5HG2A 4W9KA 1NCVA 1D6EC 1I50H 3HGBA 3AEGB 3EBEA 4A75A 1E8YA 3FILA 1I42A 2JU6X 1SDFA 2DN8A 3HEJA 1XLQA 2LGDA 3T8MA 1ICFB 3ONAB 3R66C 2J0JA 1VQ7A 3RFZB 2LXAA 2E5LL 5DPWA 1FNUA 1ROEA 2MQHA 1BUIC 3Q8CA 1TIID 4PT5A 4WWNA 3ZQ4A 2BOSA 2AYOB 1A63A 1A8VA 4DXFA 2W82A 3QG1A 5HI1A 2INNE 4XXEA 5M9OA 1WZ3A 2ACZB 3T13A 4DF7A 2JA6B 5FO9B 5AJ3Q 4DV1L 2MBQA 4R4OA 3JYUA 3GTPH 1GO3E 3T4AC 3QHTA 5FO7B 4A3JG 1WOCA 2A19A 3HOUG 2EKEC 2VH2A 2WX0A 2MUYA 2KJXA 1KDAA 3PVLA 4MJSB 5M3MB 2HHHQ 2LFIA 3N9YC 3G48A 5KNDA 5G2NA 3GE8C 4TUUA 3HOZG 1QOHA 1JORA 4DR7Q 2KX0A 2R2OA 2KVRA 1KLGD 3I3CA 4ANXA 4BY1H 2RQXA 2CHBD 1BT0A 2RDFA 3T3OA 3ZGZA 3L3OC 3OTOQ 2QC8A 2IHFA 1V2YA 3DWQA 5IY0A 1XMQL 1BBWA 3I2ZA 2FMMA 4LF7L 4HMJA 1SYEA 1B44D 4KGRA 4KIKB 1FRRA 2F0JA 1WTVA 1WM2A 3E56A 1HTPA 2MX2A 4N6EB 1EF5A 1YJ9A 3GTOH 2B39A 2CVRA 3PO2H 3C1EA 3QIJA 4UY8C 4QJFA 1BCPF 2EY5A 5TSSA 2NVXH 4FF3A 3IFWB 4WURA 3V61A 1DM0B 5G5HA 2JA8H 1I4HA 2K32A 2VB3X 4XTCS 2UXCQ 5F2DA 2JEBI 3MXNA 4KMUC 2Q5WD 2WXPA 1SE8A 3AEDB 3B1LX 3TP5A 2FUHB 4CDEC 2A8VA 3CKIB 1WVLA 3WAOA 1L1OA 4IUQA 4OONA 3GTJH 3UINB 1TBEA 3DVGY 2N78A 2L4NA 3FPPA 1JOKA 3S15B 4GN3B 2LVPA 3TIXA 1YNND 1XNQQ 3LB8C 4HVBA 4OO1G 1HNZL 1PRTD 3KW5B 1K9MC 1SMXA 5ISRA 4P7IA 1I4GA 4K3CA 4BBRH 2LS01 4CDFC 3CCVA 4GNXA 2B2WA 2WGSA 4WQMA 3G7LA 3PUVA 4MSMB 4K14A 1VQNA 3K59A 3M4PA 4XQJA 4G50A 4CQNA 3ZDMC 2NCNA 2BH2A 3KWVA 2C7NB 1EU3A 2DGYA 1EQRA 2J0TD 3T1HQ 3U9OA 1GAQB 3K57A 2WDTB 1U9RA 1Y8OB 2MQJA 2JA7H 4B3RL 2KX3A 4MN3A 1ASYA 4ZKBB 1Y56A 1PTOC 4IC7B 1WTPA 2Z4HA 3ZNGC 1BDOA 4C3JG 3TEXA 4P74A 4S3SA 3W9CB 3BU2A 3GTKB 2RDGA 3VTWA 1SFOH 4ZRQA 1SIFA 3ZTDA 1HTLD 4RAUC 1D7QA 3U30A 3NQTA 1GUSA 3PSIA 1UWVA 2M1MA 4LF6Q 3RNBC 4LF4Q 2QMTA 3HZXA 3CQZB 3KK7A 4V190 1WGRA 3TQYA 2F0TA 4O0AA 3URYA 4IFDJ 1WGKA 1WTRA 1XNRL 3UDGA 1QT9A 2HIXA 4H13C 2IW3A 1AE2A 3VUYA 5HFYA 2XTIA 4X3SA 2QA4A 3EC8A 4J3OD 4KHZA 4LDTD 3VR8B 2PVOD 3U8ZA 3TBIB 1HR0W 5LNK1 1GD7A 5J39A 1SNPA 2AUKA 4DAVA 4KKUA 2CW0C 4B3SL 4DHJB 4LNFA 2VUMG 1NTGA 2K5VA 1LO5D 1K8RB 2OQKA 4A3BB 1K73C 1HFNA 3AE7B 4I6LB 4NAWB 3DXJC 5C44G 1TWGB 4WORA 4ZKCB 4XDCA 1EWYC 4DDID 1IHZA 2K52A 1WYWB 2REXA 4BA1I 1GKHA 1WX9A 4BFRA 2A69C 4JCVE 1D5ZC 5J1ZA 3ULJA 3RUIB 3H6MA 2NWGA 4QL5A 4R9WA 2C7HA 3I9V1 3MHSD 3LX0A 3HOWB 4TKOB 3I5JC 2RVLA 3L13A 2PVGC 3C46A 1AN8A 5BYQA 3DHIC 3STBC 1VQGA 4KK7A 2M0XA 4K8IA 3A8JE 2BWFA 3BY4B 2ZJPA 1UEBA 3F2BA 2DZIA 1ZW7A 4N9F4 4JW0A 3R7RA 2DWQA 1PDXA 3AE3B 1F2LA 2MP1A 3UQAA 1ZXHA 2B2UC 1K52A 1WRDB 3NENA 3OTOL 4HCPB 3BDCA 1WMHA 1VZ8A 1CKNA 2L00B 4K5VA 4A20A 1S5BD 1TKYA 2UUCL 2GMIC 4HSPA 3OIPA 1H9KA 3UDFA 4CDCC 2K3UA 3TMEA 3ZJUA 4ITKA 3U9SA 3DHHC 4KHPQ 2DLBA 3SR1A 4NP5A 3PF4A 1F2YA 1NVID 2N1WA 1JWUD 3BK1A 5L95C 4RA8A 2IO3B 2PEAA 2O2VA 2ZW0A 2PYKA 1WTOA 3S1NH 2MO1A 2PJHA 2XVSA 4RGOS 3ZKJC 1JWAD 3NPPA 5JOBA 3OLMD 1VQAA 2GBRA 1X56A 5J2RA 4DGZA 4G57A 1YJWA 3QOJA 3AFQA 3MC8A 2AWOA 4B08A 2IO2B 1X9NA 3B08A 5CTRC 3PO3H 4HR7B 4ANUA 3M4OB 1FXTB 2J53A 2BYTA 1C76A 2OOBB 4A3KH 2LXKA 2RD0A 1WH3A 1UUPA 2WXRA 1CKOA 2BKFA 1B9MA 4LDTB 3V96A 2RF4A 5CMDA 1TS2A 1YITA 5MPOA 4K7UA 3GTMB 3N6RA 1CMXB 4IPGA 1WGHA 3ZO5B 5IA7A 2HQLA 1I4QA 2M17A 2RDBC 1WXMA 4JI2L 3ABVB 1ZP0B 4LF9Q 2EOTA 4H44C 1NBFC 2D5GA 3AV8A 3A7AB 3JVZX 1IYJB 3G6JB 3I7FA 4CHTB 3IAM1 1Q10A 5JPMC 1KHIA 3MXGA 2RPQA 4DK0A 4DUZQ 4C3HH 3W1SA 4BVUC 2B8FA 2HDLA 1EUJA 1W6JA 1X3PA 5T1GA 5I9PA 3J7YW 4A3EG 4HMIA 3VR2A 4J6HA 4FHJA 2DNFA 2MBHA 5IIFA 3BVZA 4OZBA 2E2IH 4EZLA 1S1QB 3TZDA 4WJOA 5EPJA 3I56A 1IBLQ 2DZJA 3NS1A 2MFIA 2F0NA 5AJ3L 3V60A 4OELB 1TT5B 4ANVA 3MFYA 3KLWA 3FC4A 2L52A 3NXWA 4GGQA 2QDBA 2EPBA 1H95A 5I4DA 4AJWA 2F0MA 3BJUA 4MTNA 3OIQA 4B3ML 4JGHB 2XIWA 4EGVA 4ID6A 4YCUA 5IYBH 1E2VA 2FIDA 1II3A 4POGA 1VQDA 1KDCA 2XWBB 2L3ZA 3KF6A 2P5ZX 2B63H 1MJDA 3DHGC 4G7HC 2K50A 3TP6A 1L2FA 2BCOA 2BVCA 2FNJB 4PYUA 3GOEA 1S3OA 3NELA 4C3HG 4OVVA 3HKZB 4WJPA 3MZ5A 1SF0A 3NZUA 5EDSA 3S17H 4LF5Q 2VUMB 4X3KA 1XO3A 1J6QA 2A1AA 1OXTA 1JC7A 2VY3A 3EVQA 4HIOA 2NVTH 1XQQA 4FJZA 4JWSC 4OW0A 3DMUA 3X23A 3EFCA 4DR6Q 2B8GA 2LVOA 3WAMA 1STAA 4A3FH 2JRHA 5C4XB 1X65A 5L37A 2KVZA 4K7SA 2UU9Q 1TWCB 4KJOA 2CHXA 1VQIA 4A3JH 2MBBB 4MHEA 1MKHA 4KDLB 1EY6A 1K0RA 1CT1D 2KEDA 5A2QE 3ZNHB 4ME5A 2OJWA 1B4OA 2GBKA 2KLCA 3WALA 2IO1B 3U52E 2DY8A 2PMZB 4JI3Q 4IN3A 1WXSA 3Q8EA 1S3SG 5KHOA 1U4RA 1UE7A 2N3SA 5IP9H 1FXIA 3C0RB 2WXOA 3EROA 4EOYA 2I5LX 2YEPB 2VQFQ 1SB3C 4ZHOA 4OGQC 3DQVA 3F1ZA 3IXSA 2NMQA 1H9MA 2C9OA 1XYIA 2A6HC 4QUFA 2JA8G 3HOVH 3ML8A 4FXCA 4HTHA 3R7QA 4M1UB 3I4NH 2WXFA 2WAQE 1IP9A 3K7UC 1K83B 2NZOA 2V4DA 5KGUA 2C9WB 3NS8A 5GROA 1PH1A 4YSXB 5COYA 2NN6G 3WDNA 1C48A 2F0DA 3L9AX 1KRSA 4PNYA 5JHBA 3T3NA 2MHJA 1JT8A 1LT5D 5IYDH 1DZ1A 3OWFA 4GS3A 1P0RA 2IGDA 2IZVB 3KUDB 2OT2A 4KIKA 2EYJA 3P4SB 5M5XB 1VQFA 3Q8DA 3RLOA 3FDTA 1L7YA 2WWZA 2A6ED 3HKZE 1XD3B 4KD4A 3CPFA 1YBYA 1HTOA 3S2DH 1WR1A 4TQ0A 3J81L 1RIPA 3NTHA 2NYZD 2L8JA 1FJGQ 5C44H 2CWPA 3M3JA 4RGNA 2KDBA 3JSVA 4YTPB 1KLVA 2MW5A 2VXWA 4JI1L 2C60A 2OEDA 5C3JB 4M00A 4B3SQ 3H3VI 1IKLA 1YOVB 2UXDQ 1PYWD 4XC2A 1Z2MA 3NRZA 3PHXB 2R93G 4FNFA 4ZRZA 1IGCA 5ELDA 3ZUNA 1KF6B 2DZMA 2X8XX 3SK4A 1LT6D 3HVDA 3I3TB 3ULLA 4GNXC 1SNMA 4DBGA 5JEAG 1UZXB 4BBSG 3RPFC 1UGJA 1VQCA 1GHKA 2PW9A 5C0XI 3RYTA 4MSQB 4K6DA 3I4MG 2SNMA 2D3GA 3PLUA 4M01A 4JI2Q 3CU7A 1CHQD 2E6XA 2MEKA 2N0SB 4DR5Q 5E3FA 3Q3NC 1P98A 4X62L 1Y69U 3B2GA 1E8ZA 2YU9H 4FA6A 4JBWA 4DV3L 2UXBQ 2V3NA 4I7ZC 4UP8A 4KKIA 4N58A 3BWUD 2HCCA 4LFCL 4DDGD 3DUZA 5GQOA 1SNQA 4ALPA 1E0ZA 3K5OA 1D5XC 3IT6B 1VQKA 1A15A 3CCQA 1YJNA 1WYGA 1LM8B 2B2YA 4C3IH 2EKIA 2WB1E 1D1KA 2BYEA 3L0OA 4CKCA 3RN5A 1WFYA 3KLRA 4CJ2C 2PW5A 5IGEA 2TSSA 3NOBA 3EHVA 3KYDD 4DKAC 3RUZA 3WOEA 5G3LF 5C2TB 1YN3A 2K6AA 3A8IE 2KUMA 1B2TA 2N9XA 4A3DG 4L6TB 4RNAA 1EIFA 1ET9A 2FFKB 2QDLA 3NQIA 3UDXA 4UPAA 2X38A 3MXPA 2K8BA 1IBKL 3A9KA 1E2WA 1FVIA 1TWHH 4OO1I 2INPE 5AZFA 1BCPD 4HIMA 1TKGA 3VR6A 1HNWQ 2BH8A 2R92G 4LF6L 4BXXG 1WX8A 4X64Q 1EYGA 2WXMA 2HJ8A 3AEBB 1YHBA 1GJZA 1LLRD 3X3MA 1RODA 2VZKB 1FO4A 1RFAA 3HS0C 3RZFA 4DR6L 3GZNB 2IPKD 4BY1B 3RN9C 4C7ZA 3TN2A 4WAFA 4EQOA 5DM73 1KNEA 1TQOA 1RKNA 1PUTA 1WTWA 2DYOA 1SE2A 2JN4A 3UE0A 4B9XA 4L23A 3NEMA 3DHQA 4IFDG 2KDMA 3HM6X 2Y5CA 3KBGA 2B2TC 2SAKA 4RWSC 4A3OA 2UUAL 1RYJA 1P16A 1RL2A 3AU7A 3QIAA 3UI3A 1BXTA 2NVUI 3CSTA 4RHSA 4P1BC 4S0RA 3PO2B 4IWQA 2KHIA 1QVCA 3Q6SA 2BF8B 4A3FG 3VTVA 3NP8A 2K8CA 4JI5Q 1LQBA 4BKGA 2JA8B 3HOXH 2WV6D 4LF9L 1VQ9A 3SK6A 2RMMA 2K04A 2LRWA 3QQ8B 4OZAA 2K7VA 4DV7Q 2D3CA 1JCKB 4REZA 2BBCA 4GLAC 4C3JB 1YNJD 2MP2B 2CS4A 2XRQD 2F52A 2F3IA 4ILWA 5KYIA 2Y0SG 4OXPA 3NUCA 2DAJA 2KMMA 4W9JA 1CFMA 2KTFA 1MD2D 1PH7A 1NMGA 4IZ8A 4DNIA 2KHWB 5D7GA 2NVYB 4WJ4A 1VQEA 2MH7A 4LF5L 2BE5D 1KH0A 3I4NG 3TEHB 4C80A 1FGBD 3M9BA 4KN4C 2EELA 4IOIE 1GC7A 2CH4W 1KRTA 1WWTA 1XMOQ 1YX5B 3K5MA 4WWMA 3SK5A 4CKEA 1U0LA 2KHSA 1W2BA 5D94A 4KJNA 3R8BA 1I6HB 2JA7B 1MHWC 3ND8A 1WI0A 4MM3A 2PZWA 3R3OA 1QKZA 1O7IA 4DV0Q 4L5RC 2KDEB 4PS8A 1EF1A 1ZXTA 5BMIA 1E3PA 3BZKA 4ICUA 4XDDA 1FFVA 3I73A 2OEOA 1PFNA 1Q5WB 1QZEA 4ARIA 2KCMA 4FXKC 1AARA 2KKCA 1JQ4A 3E9IA 4EX5A 1WRIA 4JQWC 1Z7TA 3H3VC 2QF7A 3PUXA 2K75A 2WP8J 4LUVA 4RHRA 5JVG3 2VQEQ 2ZJDA 2YV5A 2L1AA 2WXKA 4C56C 3JW0X 4DK5A 3J81j 2EZVA 2JVCA 3AECB 2SEBD 2CFMA 4WWOA 1SXTA 3W5VB 1J0GA 3ZIMA 1TGZB 2PE6B 1A2TA 2EYLA 5FOBB 4YHHL 1VD2A 4A3GH 3P4QB 2BB6A 3PIO3 3OJ4B 3V6EB 1RM6C 1I50B 2A6HD 1WGGA 2DJGC 3ZVVA 2WU5B 2EJFC 1I3QB 1WGDA 1XMQQ 4A3KG 4IM2A 4C3HB 3A1QB 2JZZA 3R2TA 4TQUS 3ALBA 1EIYB 4ICVA 3K0YA 2Y5PA 3Q24A 2F0OA 1S5FD 2JYOA 3VTUA 5BN4A 2G45B 2EY2A 3MWYW 1PTOF 4XYOA 2E2IB 2QHOA 3HFZB 2J0KA 4PYZA 5C6AA 3KYHC 4C1NI 1K28A 5J18A 1FM0D 2PPBC 5C4ZA 4A6QA 3NUHB 4DV4L 2JA6H 4ACFA 3AULA 2NBVB 3H0GH 3TRZA 2AKWB 2M00A 3HOVG 1XT9B 1PLFA 2KENA 1VDVA 2NZ1D 4B9WA 4NJ6A 2Y0SE 2I2YA 1QE6A 1RDPD 1MPEA 4DR1L 1Y8PB 4XWWA 2BW2A 2A4ZA 4XWTA 3GS2A 4A3BG 5IOCA 1S72A 1IZ6A 1Q7YC 3AN1A 4NNJB 2ZEQA 1N9WA 2KTRB 1DOIA 2D10A 4W9IA 1ZDXA 3S9WA 4RF0A 4AQ7A 3IAYA 3CC4A 3Q0AA 4A3MH 5GMVA 1N36Q 3I4MB 4L5QA 4DAYB 4TMAB 3MVVA 5AZGA 2WXGA 1WTHA 1D3ZA 2ES2A 1Q8KA 2B2YC 2MJ3A 3MEHA 4HPPA 4R4CA 2MA9B 4UHVA 3RZOH 5JHAA 3AMUA 2KFJA 2RSOA 3RLNA 4HJ9A 2XEWA 4Y7NH 4L5TA 1UD7A 5IT9c 1E7PB 4TKNA 1WE7A 2BKRB 4HLEA 4KLKA 4EE2A 1ACCA 4LNKA 3RN2A 2HD3A 2Z6BA 3MTSA 2ZTCA 4QUCA 1CTMA 2LMCB 1Q86C 2F0IA 3TS0A 3OSOA 3VUWA 1GPXA 4NXNQ 4JPBW 2WHIA 2B29A 1HZBA 1JRPA 4YWMA 2ZT9C 2LUEA 1C7YA 1PZKD 5I6WA 1UWMA 4AJYB 3W3AA 3CXCA 3B9JA 4YSYB 4MEMA 5EBCA 2HD5B 1PVOA 1PV4A 2WB1G 1D5MC 5C23A 4BKSA 1UWXA 4KY5A 3HOUB 2J4XA 4LFCQ 3DVNV 4DHZB 3IBEA 3P7JA 1RF2D 4MZ9A 2ICEC 1SROA 3A54A 3K80C 4GB9A 3I4NB 1N5XA 2LXJA 4KDIC 2ZVOA 1K83H 1RTOA 1XNRQ 2I1KA 1HZAA 2UXCL 1DOMA 2BB5A 2FAZA 1ZXIA 1DOXA 3TJPA 3CMMB 1VZ7A 2VL6A 2KC2A 1EQTA 1Q1OA 4WIPA 1G51A 1VQMA 4F1SA 1X3QA 4CBVA 2KT7A 4RKBA 2PNRC 4OWWB 2KYWA 4IUNA 2KWUB 2CWAA 2Z1CA 3SGIA 4LMQD 4GZYC 1CUKA 4LNOA 4ME3A 1F9JA 1H9RA 4ASWC 1Z6HA 1E9MA 4IPHA 1BUVT 1WY8A 3OJ3A 1LTGD 4ZK9B 3TCAA 3ML9A 2HDMA 2LMCA 1G8ZD 1A0IA 2Z4IA 3HOYB 1AH9A 2KJHB 3QAQA 4ZAIA 4C2MH 2RSUA 5EPKA 1O80A 2L7RA 4DR3L 4W9DA 5CV7A 2JQRB 4A3CG 4QCLA 1ZEQX 1GM5A 5IYBG 1OGWA 1WGYA 4KY6A 5D3IB 2G3QB 3KUPA 4HJKA 1QZHA 2R2QA 4GNXB 2NVQH 4F88A 3AFPA 1JALA 4LJZC 1UBQA 2RR9A 4R4IA 4DPGA 3CQZH 4QY7A 3GP7A 5DAUA 3U4ZA 1B7YB 3W1YA 1G6JA 1FCCC 4KKJA 3QJYA 4LJPB 2JP1A 5IP7H 5EE9A 2QJLA 4JI8Q 5FLXc 4YHHQ 1VF7A 4P2CB 3I63C 4A3LG 5BN5A 1V43A 3M85A 2HJ1A 2PZUA 2K1FA 1MIUA 4FJYA 2O2VB 5JZEB 1EWHA 4OZCA 3L17A 4JI0L 1TIFA 3D4DA 3AEVA 1G91A 2CCZA 3E9HA 4GDLA 4JE3B 2L55A 4DR7L 4LUZA 4IM0A 1TWCH 1RD9D 2AWTA 2YU9B 1DJRD 2LJIA 1EWIA 4A3CH 5JH5C 1KOTA 3CPWA 4KX6B 3I57A 3I70A 4X66Q 2D11A 2LFNA 1HZCA 1ILQA 4QMGA 5FLMG 5E6PA 2NUCA 2IY1B 3FKYA 2RDHA 2OTLA 3UDIA 4YTMB 1QOFA 5K36G 1U4LA 3L54A 3PCOB 5LMNQ 1IGDA 2W55A 5D3DA 1L4ZB 2MLBA 2VNUD 4NDXA 3IHPC 2FINB 4BY1G 1SEBD 5C0XG 1FIQA 4NPNA 4C4VB 2YTVA 4DK6C 2F0LA 4GIVA 4HRSA 1UNSA 2E2HB 2GI9A 3RI7C 2VZKD 1NNXA 3EA6A 5CV4A 5LL6X 2B3AA 2WP9B 1L0XB 4QQBX 4XE0A 4I6PA 2MJ8A 5IGDA 4RGTA 3UI2A 2EYMA 4HJ8A 1NJIC 2J42A 2K6DB 3WIMA 2KAJA 3AU4A 4IOCA 2V3PA 3P63A 2JZPA 4WJQA 2NN6I 1EFWA 4A90A 5IYDG 4H7BA 1L0YB 1A2UA 3BDLA 3VAWA 2E76C 2F3VA 4OHJA 4LNIA 4A3LH 2GN5A 4AOFA 2NN6H 3J7AF 2DYMA 5M3FG 1SE4A 4QIWE 2KN4A 3L08A 4M8NA 2V1CC 1ZYRD 2IY5B 3IVFA 5E7NA 2LVQA 3A74A 3OWEB 4YIJA 2FE8A 4IUVA 3M95A 3E9SA 2I0QA 3UGBB 3H0GG 5C44B 3RNEC 1JWMD 3ND9A 4U68A 5C3WA 1F9SA 1YI2A 4BY7H 3S1NB 4GSWA 4B0MA 3AE1B 1CK1A 3CCRA 4NXML 3KF8A 1SFOB 3NBHB 4AQYL 4WJ3M 2H88B 3QK0A 4UP7A 1EIHA 2FBWB 1C3TA 4NB3A 1X3EA 4MACA 3PO3B 3FAHA 3S1MB 1EY7A 4PG3A 5LHY1 1VQOA 4XYCA 2NBWB 1HQRD 4HAEA 3AXCA 3GO5A 3U50C 2N9EB 4N8X1 1WJNA 4B9KA 1H9SA 1CSPA 5IGFA 1ONLA 1KABA 5FR6A 1IBMQ 3PO3G 3FKIB 1SSOA 3U7DA 1VJKA 5E6NA 3JSVB 4IJHA 4XZ4A 1FNVA 5CORA 3VR3A 1EY5A 4A3DB 2ZM6Q 2AX5A 2Y5BB 4DV2L 1YJJA 2DNCA 3GTLB 1LABA 4NJ7A 4JBKA 1PGAA 1NE3A 2JF5A 4KGTA 3IFDA 3CCEA 3C8YA 2F4IA 2WU2B 1QQRA 2L11A 1RLFA 4TQ1A 3RZWC 5BYSA 1I4XA 3LWEA 4EZKA 1STEA 5GAEC 2KDIA 2KOXA 1XTCD 3PGZA 1SE9A 4R1JA 4IURA 2WAQB 2IO0B 1BO0A 3NTKA 1HPCA 3KLSA 1EEID 3U4VA 3K6OA 3WCQA 4F8CB 1F1HA 2X6GA 1J7AA 2EVBA 3LGJA 5T1IA 2VQFL 1SGHA 3A9JA 3VA7A 5D14A 3H3VH 4KI0A 2KK8A 1E5WA 3OOCA 3VYUA 2PPHA 5TR5A 2LD9A 4YY3Q 3JAMi 1QG7A 3DBRB 1O78A 4URKA 2HIVA 3P75A 2KMAA 1FRDA 3C1FA 2KFKB 4IDIA 5CR3A 2IWHA 1XX8A 4ULLA 1M4VA 3J80E 1JJGA 2N9PC 4IPCA 3I4LA 1SAPA 1U4PA 3GQBA 1HH2P 1PTOB 5IYCH 1JB7A 2LRUA 3BVGA 3TZUA 4DV5L 1ILPA 5ELBA 1HJPA 4E6IA 2UYZB 2HQEA 2VS1A 2PQEA 4JVZA 4C7YA 1I94L 4N9PA 1SYFA 4FF1A 3ZXRA 1JJCB 3QO2A 2LGIA 2H89B 4G11A 3Q69A 4MM3B 1OXSC 1WMHB 4JOIA 2V1YA 5FJ8G 2XSCA 3JAMc 5C3EB 4A3GB 1Y1VG 3MHZA 4WJNA 2O6VA 3Q14C 4ODGA 2V4LA 4BA2I 1FD7D 5LMUQ 1LM0A 3IG3A 2EE1A 1VQJA 3IAS1 4KHPL 1C4AA 4A3IG 2N7EA 3HKZG 1JW9D 3R93A 1RWSA 1ZUD2 4J6IA 1TKWB 1NI2A 3HKSA 1F9PA 2JEAI 5FK9C 4Y52H 4BBNC 4FP5D 4ZRJA 1UAPA 4IUPA 1SNCA 3ICEA 1VZ6A 3P1MA 4MTKA 2NR2A 5FKAC 2BYVE 3SR6A 3V6CB 5C3XA 4C3JH 3CWIA 3M4YA 1ZKOA 2O2LD 2MJEA 1VF5C 4DFAA 3PGEA 1HZ5A 1JICA 1Q46A 3TREA 1JOQA 4DR5L 2DENB 2VH1A 4W9GA 3H94A 3T53B 4A3IH 3SD5A 2WIIB 4F8MA 5C4HA 4YCVA 1VMPA 2BA0A 3MXUA 2RPVA 4ZOHC 3BG3A 3K8AA 1V9PA 2JXMB 5M5WB 3M62B 4L1BA 2JA5G 1SJED 1YNNC 3EGRA 3MC0B 1PRTC 4O42A 3TL5A 1PH5A 1PH3A 4IPDA 4QF4A 3CSFA 2ONQA 3VA5A 3DDCB 3A7LA 1W3SA 3MEFA 1KRHA 5DM63 4TRDA 1I7HA 3HVZA 3J80c 5EGTA 3TDQA 3DVGX 4PQXA 3OPOA 2E2DC 1E7ZA 1H8CA 4DK3C 4JL9A 4R4QA 4PS3A 2Y0SB 4KHVA 1C1YB 3UIOB 2PZTA 5C1ZA 3KLSX 2GVBA 4K5XA 1N33Q 3Q3JA 1IXRA 1VDZA 1N60A 1CZGA 4APVA 4JI6Q 4LTUA 3CCSA 4JI4L 4OX9L 2AL3A 1N34Q 1LTBD 2K1BA 4HJGE 4RH6A 3FEWX 1IBML 3S17B 2K5QA 1HEZE 1PTOD 4PMWA 2VUMH 2MBEA 2Z0EB 2F4VQ 2R7ZB 5IAAC 3VDZA 1G291 3G71A 4DAYA 1NENB 1Y1VB 4JYAQ 1ZPSA 4A8XC 3QARA 3TEZA 2MBOA 4M02A 3RNGC 1TZOA 2A5UA 2KJRA 1TKEA 4EFOA 2ZM6L 3NG0A 3OYYA 1V1PA 2R7FA 1HNWL 5GADC 4POFA 4XQNA 5H92C 4BOSC 1DGSA 4H02A 2C5CA 3B2FA 4DV2Q 3Q8AA 2I38A 2KCNA 4OEMB 4HDQA 4KY7A 1E2ZA 3KJOA 2RA4A 1H9JA 2ASQA 2FCSA 1PFSA 3GTGH 4X3UA 1XCTL 3RNAC 3H7SA 1NBWA 1QUQB 1OTCA 3BYTB 3DVNU 1EYAA 1CQFA 2EYOA 2O6VD 1SR3A 2ENBA 1DGJA 3ZNID 3GV3A 1PQSA 1XEEA 4KKSA 4GLSC 3F2UA 3E6ZX 3V62A 4YSZB 3I91A 5IP7G 2ZPYA 2O4XA 2F0WA 2C35B 4X64L 4A3EH 1R4NB 5IYCG 2HT1A 1ZOYB 5CHFA 1T5XD 4FBJB 2UUAQ 3HOZH 2KCCA 1HZ6A 4N9TA 4IO9A 5EQ0A 2QIEB 2INCC 3S16H 5C5LA 3J80L 2EYFA 3OHXC 2KD0A 4AQYQ 1S5ED 3DWPA 3PQIA 3AH7A 2D3BA 4RCNA 2AQ3B 5FLMH 2PI2E 2AL6A 3EFUA 1PMRA 1A3UA 2I5HA 4JK1C 1VCBA 2JPHA 5M5YB 3RZDH 2JA5B 1V97A 1G2TA 3EECA 4AS1A 1E10A 1B53A 2ZZPB 4B6WA 5J3BA 2NVQB 4PMCA 2N8NA 3WWVA 2F0UA 3KOJA 1HNXL 3PREA 4A3MB 1JMCA 3I4MH 3CRKC 2WXLA 4G4KA 3T1HL 4RM9A 5CV9A 4HJ7A 3SU8X 1D4BA 4BBSH 4HEA1 2QCPX 1YNTE 2AWNA 2GBJA 4EUTA 1EOVA 2MGSA 3J7A5 1J5EL 1J19A 3CD6A 2X6LA 1FEHA 4NW2A 1SYGA 2BE5C 4Y7NB 1TS5A 2F0PA 5EJWA 1CM9A 1YJIA 3O65B 4IG7B 5KEEA 4DUYQ 1S4ZA 4BS9A 4ZUJA 5A35A 5GXGB 5C4JB 2NS5A 1PH8A 4LF4L 2KBNA 4JG2A 1XTDA 2G9DA 3T56B 2XBBC 1YQ4B 3GZNI 3D0FA 2JT4B 4GXBA 1XXGA 4FF4A 2Y3AA 2LZ6A 3N52A 4JIOU 3W5UB 3HOXB 2KEEA 1N6ZA 2KDFB 4X6AH 2JY6A 2NTSA 1WSPA 4Q2JA 1EWCA 3S14H 5K5PA 1E8XA 2CHZA 1C4QA 2IHEA 4FHKA 1MBYA 3NK9A 1VS0A 3K7AB 4ANWA 2MRPA 4DXGA 4US8A 1WFQA 1WJJA 3CW2C 2CHWA 1MJCA 4LFAL 2N7JA 3FMCA 1VQ8A 1G6PA 5IOIA 3LDZE 2IL8A 2LASA 1QVFA 3NWTA 3DLLA 4DHJD 2GB1A 1ENCA 3A56A 3DM3A 4HCEA 2J7ZA 3CC2A 3K58A 3TUOA 2NVYH 2R7DA 2WFWA 1R4NI 4MGZE 3CAMA 3LXFA 1YEZA 4A93B 1C79A 3FRPB 4GKKQ 3A9JB 1R9TH 1ML0D 4XT1B 1AYFA 2O6VB 3K9OB 3PRZA 3A4RA 1E7VA 5M3MG 1WXVA 5EE0A 1AZQA 5GAGC 1BNZA 2LXCA 3HOYH 3HIZA 4OIKA 5AEKB 3K81C 2ZTDA 1JOOA 2K22A 4DHZE 1TWHB 3OW2A 3Q8BA 2TMPA 5IN7A 4BY7B 3Q23A 1QJOA 1OXVA 2G5DA 3CMEA 1BVSA 1J7CA 4JYAL 2J0MA 2K8HA 4JV5L 1P8LA 5CBAE 5FR3A 3VYTA 3ZLZA 4J1MA 2ATWA 2FCNA 2HE7A 2INDC 2IX0A 4DR1Q 4A4IA 3CCMA 1MVKA 1A3TA 1RHPA 1M94A 3W1BA 3PIOA 2AHOB 4B3TQ 1S5CD 4ZUIA 1NSNS 3S1QH 3ULPA 2NBFA 1CZPA 5JPNC 1EUVB 2JSVX 2KJ6A 2KMCA 3A9KB 3HG9A 4PK1A 2Z6KC 2XGTA 3BZCA 2EJGC 2PLPA 1B9RA 1SYDA 2ID0A 2Z0SA 3PHWB 1ASZA 3ZRCA 2W3SA 5KYLA 2K28A 2JA7G 1TWAH 1U4AA 3U2SC 1JJ2A 4HIDA 2IGHA 2M56B 1ZYRC 4NKLA 3RNUA 1WIAA 1IW7D 1NR2A 5G55A 3VFKA 1GUWA 2JJQA 5DPTA 1ICWA 1NY4A 3ZW3A 4FN2A 2ZVNA 4JLCA 4UDUC 2PO4A 3KDFA 4DK1A 1WI5A 2YLMA 3KUCB 1L6UA 5IE8A 5E1FA 4KN7C 3L2PA 2B2TA 3JAML 4ZLTF 2KQSA 4G3XB 1V8QA 5M3FB 5LL6S 1EQVA 5D65A 3RT3B 1STYA 2R61A 4N8FA 4V0BA 2C7MB 2LGYA 1F0ZA 5IT9L 2K5NA 5EKLA 2VQEL 2M2LA 5JAVA 1HE8A 1K3BC 4DV6Q 4K2KA 5EAYA 3KF8B 1SNOA 1A6XA 2F4VL 4BZAA 2PCFB 1FYCA 1EZ8A 1JWSD 4M8AA 1LTTD 2ON8A 1YMHE 4I65A 4IJLA 4RFBA 3HM3A 4GOPC 3APCA 1ZGUB 4LJOB 4GLXA 4KD3A 3RNFC 4A76A 4R8IA 4JX1C 3PSEB 2EYHA 4F87A 2E2JH 3PZDA 1NUCA 5HURA 2CKHB 2GLSA 3RZOB 2LHDA 4R4TA 3BS1A 3DWAA 1H9SB 5JEAJ 1VQ5A 1V86A 2KLGA 3DPDA 1YN5A 3D32A 3N30A 1WJUA 3ECIA 5BMGA 2RCFA 1WE6A 2CJNA 3MP9A 1FGUA 4FLHA 4LFBL 2NBUA 4MGKE 1HFGA 3SDZA 3SK8A 2D0OA 1EY9A 1T0YA 4GU2A 3PF5A 1AEXA 3N3KB 3MFGA 4W9CA 4WFN3 2KHJA 3S1MH 2M0AA 2WX1A 3M7GA 3PRPB 1BMLC 1MFWA 2BS3B 1Q1BA 2JQOA 1TWFB 2D3AA 1RFKA 1A5RA 2DHZA 1E1TA 2G4DB 4RF1A 5EBDA 1PDQA 1UH6A 3FP9A 4XT3B 3W2DA 4IUUA 4PMBA 3HOUH 3Q3MC 1YHQA 3S2AA 1L2NA 5E6OA 1LTLA 2PMZE 2F3WA 1XPRA 1CJEA 1LXDA 4WRDA 4HPMB 3TBLD 3VYRA 2KNBA 2HUGA 3PTFC 3FKIH 3PPAA 1K8GA 1WF9A 4OWXB 1C4CA 2A5HA 3AEAB 5CHWA 1CKMA 1N32L 2Q2TA 2Q2HA 4FDBA 1ENAA 2WINB 3T51B 1I3QH 5EKKA 4DUZL 4Q0FA 3C3LA 1E0BA 3AE9B 3ZJTA 5HY6A 1C0AA 1GUGA 3GTLH 4GN4B 4S17A 3M63B 2DY7A 1JQYD 5DLQE 3AE5B 3DBHI 1F2RC 3NVVA 4NAMA 2FCMA 3WOFA 1PFMA 1QWYA 3SXHA 1KLUD 2FXQA 2R92H 1E1OA 3VQIA 2PI2A 4MJSA 2HTHA 4LF8Q 3N32A 3Q8FA 1E24A 2Q8IB 3E0EA 2PKOA 2ZNVC 3W1GA 4C2MB 2NPTA 3MA2B 5LMNL 1PHJA 2EY6A 1EYDA 1X3GA 2R6GA 1J8CA 1O7ZA 2IDYA 3MXNB 2CQOA 3MTNB 1ZE3D 2M19A 5ELCA 2K25A 1K53A 1FD6A 2JXXA 5CC4A 3EUB2 3TP7A 4DR4L 3M3YB 1HRJA 3PO0A 4GMVA 5C3EG 1EO6A 2EDGA 3NVZA 2JX5A 5IO9A 3ITPA 2OQ0A 5CV8A 3A55A 4IFDH 4JI7L 1LYLA 4BWGB 1Z9FA 5IP9G 5I2YA 2CW0D 3KJPA 2AMCB 1E7UA 2SOBA 2AEHA 1V1QA 1PH2A 4FO2A 3KWLA 3AI5A 1EU4A 2R7ZH 4A55A 4L63B 1PTOH 4P71A 4JI1Q 2H1EA 1GXDC 3I4OA 3SE0A 3DCGA 4LK0M 3N1XC 4CJ0B 3L4PA 3KFUA 2QILA 3LNNA 1SN8A 2WNMA 1T9HA 1KFYB 2ICIA 4HSVA 4IM3A 2W54A 3GD7A 1GUAB 3GE3C 4FJVB 4N59A 2L0FA 5C4XG 1C9FA 1AP0A 3IT4B 1Q3LA 1GNUA 1Z5SB 2A69D 5I2XA 4JI8L 2R93B 3E0JA 2ZNVB 4DXAB 3DEPA 2SNSA 1JR0D 5IT9E 2MCNB 3NHHA 1E8WA 4LAAA 4EVOA 5C0XJ 1VLBA 3CF6E 4NJCA 1AFPA 3RMHA 1C9OA 3MAQA 4HCNB 4XGAB 2BWES 2KFKA 2IX3A 3IFTA 3S1RH 3W5OA 4MH0E 3VRBB 1BR9A 5H1SE 4MNOA 1RAXA 2NB0A 3HOZB 2KECA 1OEYJ 1F2RI 4EQNA 2GRIA 4KZ0A 5AUIA 3RNCC 4X66L 1Y1WB 1OXUA 3O13A 3HRDD 3A33B 2EMSA 3KH0A 1HHVA 5CHVC 4MT5A 2BA1A 2XN9C 1SLJA 1KQSA 3S2HH 2DZKA 3VUXA 1QUQA 3J81E 2A73B 1V81A 2K5PA 3DBSA 3M4QA 2KVMA 3RZDB 2JA5H 1GG3A 1XLOA 2UU7A 2WDQB 1FCLA 1UE5A 4DNRB 3AB5A 4BBRG 2ZCCA 1FL0A 3AQQA 3AE6B 3SDLC 2JA9A 3OAWA 1IBLL 2B3GA 2D62A 1ZDVA 1JE5A 1WD1A 2ASBA 1LV9A 3Q3OC 2Z9HA 3ETRA 5I9OA 1OTRB 1IPGA 2I46A 5DPRA 2XNAC 2L0TA 4NY0A 3A5UA 4I6NB 4MGIE 2KA7A 4O1NA 1UELA 4MDKE 3L16A 1YQBA 1I4RA 5CGKA 4JV5Q 2ZTEA 4JWUC 2KO3A 3AYHB 3F2DA 3R3MA 1K51A 2EQSA 2JZ3B 4P16A 1UE1A 5IWAQ 3P4RB 1I4PA 2NZHA 3DWMA 3VH3B 5C5MA 3I55A 2LUMA 3BINA 2RSNA 3F2CA 1DOKA 4R3DA 1PH6A 1XLPA 4KSKC 4OVUA 2NVXB 3HOXG 2WDVB 3AB9A 2FCQA 2QEJC 2Z6KA 5FJ8H 1PRTB 1XLNA 2F0SA 1XF5L 1I35A 1GUOA 2ZJQA 1QOAA 3GB1A 4AYBE 1STGA 2MNAA 4AYBG 5FLXL 1HR0Q 4GOPA 3ZJVA 1EOTA 4LFAQ 4KTAA 4A3DH 2D0PA 2LKVA 4QB4A 1G2SA 1IL8A 3AU5A 5JJZA 1YIWA 1CSQA 2FJ2A 5G5GA 2EYPA 5IKCM 5GAHC 4DV6L 3H15A 2V3SA 4M8MA 3D4WA 3ZJYC 3NJTA 2K03A 4EKUA 1EY0A 1GVPA 4RGMA 2JK8A 3FVQA 2XWJB 3EJIA 3D31A 4JI5L 1VQ4A 4Q5VA 2PNHA 2N88A 4KKTA 4GKKL 2F0HA 4W9EA 3NY5A 1GJXA 1R4PB 4LF8L 2OXPA 1CHPD 2XRSD 2HCIA 4P75A 4LNQA 3K9PB 4A93H 4YT0B 4A3EB 3BVMA 3D3RA 4CKBA 2E2HH 2PMVA 5IODA 5JJLA 4AIMA 5KNBA 2BS2B 4BAXA 1R9TB 5EPLA 4EQPA 3PUZA 5LXIB 1PYSB 1IKMA 3S16B 1VR9A 1PRTF 1FJGL 2E3TA 3I90A 4ABNA 4UP9A 2PQAA 3BK2A 3KQ4A 5H8YE 3A5ZB 3WANA 4DAMA 1PZJD 2RKSA 5ELOA 5CX3A 4AP4C 2QW7A 5EE3A 1MSHA 1UEAB 1R4QB 3I72A 4C4VA 2E5LQ 3D8GA 1T0SC 4AWJA 2G1EA 1CQVA 2O5IC 2K39A 4K7WA 1SYBA 1EM7A 3PS6A 4ZQ3A 4ZRIA 3K5NA 3GTQB 1Q1EA 2JRIB 1FMAD 5DCNA 3M7NA 2L15A 4RMFA 4B3TL 2I5MX 4HN7A 1SSNA 2WQYB 3OMCA 3DBLI 1FXAA 4QGUA 1L6VA 1N32Q 3P2BA 4NQKE 4AUQC 1E22A 4YY3L 1VMCA 1K8MA 3F8TA 3Q3FA 3ERSX 1X32A 4JPSA 4WWPA 5K36H 1YNXA 1IUEA 1MI2A 1TXYA 2D9UA 4CO7A 1MSGA 1NR4A 3HOWG 1DOYA 4X62Q 3PIPA 1ESFA 1V1OA 3E5SA 3TSSA 3CRLC 5C4JH 2H5XA 3H91A 3GTOB 1WR6E 1T0QC 4BBNF 1JWBD 1ESRA 1J7BA 1P7FA 4GN1A 4DWFA 5J17A 5KRUA 4A3PA 3DOWA 1W6KA 3CCJA 2Q2UA 4JC0A 4K2LA 3VHTC 4H2AA 2N7DA 1K3RA 4FYDA 2SDFA 1QOGA 1V8CA 3HUIA 3HK0A 1X54A 2LWPA 3A0JA 2PW7A 3QOLA 3S14B 1SYCA 2LSSA 3CHBD 3R2IA 1WM3A 3KVFB 4QIWB 3AM9A 2A68C 2MPMA 4HKQA 1L5PA 2IBIB 3K7AH 2QEXA 4DV3Q 1PFBA 2CQAA 2I07B 3GTJB 4DR4Q 2UXBL 2MWSB 2ZPNA 3J9CA 1F77A 3HOWH 2A6EC 3OMGA 2EIFA 4EEWA 2M9VA 1AZPA 2N4FA 4HIKA 4JI7Q 3PV1A 5JEAH 1D1IA 4B3RQ 1C78A 3V2TA 1T3QA 1WXQA 4BBRB 1YJ1A 1BBUA 4NAWA 3PZ8A 1MI0A 1PGXA 1TT2A 5M5WH 1WTQA 4J15A 1HUNA 4LF7Q 1VQ6A 2F0GA 4JI4Q 3A8KE 4OX9Q 3PLVA 1M1KC 4ZHPA 3OW7A 1LT4D 1SMYD 1CA6A 4MIUA 5LMUL 1HXYD 4GDKA 1MG8A 1QNKA 1HTQA 1SRUA 1IW7C 1RTNA 1KDBA 4KV6A 5FO8B 2D07B 2KN5A 2N9LA 2E2JB 3AE2B 2Q2IA 3E3XA 4Z9CB 3P42A 1FNWA 4K0KQ 2LEKA 3NHEB 2MJDA 1Q82C 2K33A 2YEPF 5HGTA 5FLXE 2AQ2B 1MHXA 2GBNA 4YL8A 3QR8A 2K4KA 3VYSA 5I6YA 2N9KA 4MELA 4CJ1B 1EQQA 2BPSA 3FILB 1GOZA 1B50A 3RD4A 1KAWA 4K1RB 4A9AA 1I6VC 1EFID 5AFWA 3QWNA 1GB1A 4A93G 2ALYB 1VRAB 4KVGB 1TVXA 3A4SC 4LLGM 4PS7A 2ZXRA 1HNZQ 3T9LA 1TY2A 1OQYA 1OEYA 2WDRB 4G0NB 1YVCA 3BZDB 2IGGA 5HHDG 2D5DA 1N33L 2K0PA 1DXMA 3S1QB 2QSDA 4II3B 2B76B 3DBLB 5NUCA 1WTXA 2L9HA 2CJOA 4OWTB 1TZ1A 4D2KA 1N34L 4E74A 4F7ZA 3S24A 1MGSA 4C1NK 1QVGA 5C3EH 3MC9A 4ZRPA 4DV7L 3KBXA 1BKBA 1Y8NB 4DN4M 2W9NA 2KQ3A 1P7EA 5E6JA 1R4MB 3RR5A 1F9RA 2DYBA 3UF8A 1XCQL 5T8IA 4IW0A 5E4WC 1E6EB 1LTID 4K6LA 2BDNA 2WLBA 1B9NA 3Q6BA 2V0GA 2JWUA 2ZXPA 1LUZA 3UIPB 4TSSA 1O7YA 1V80A 4JOIC 2RBMA 2AUJD 5CBEE 2GBMA 2UWQA 1PZID 4FADA 1L1OB 3L10B 1STNA 1BCPC 2DNEA 4DV4Q 4IOAA 4II2B 1T5EA 2OTJA 1TJEA 4M0WA 1IBXB 1WX7A 2YVCA 2Q8RE 3H7PA 3IL8A 1Z47A 4EQ5A 1XPOA 1Q0WB 1QILA 1N5WA 4DA2A 5IWAL 2D2QA 2DAFA 2UUBQ 4A3IB 2B2WC 2WXIA 4LNNA 1L4DB 4NQLB 4CGYB 4YTNB 1GC6A 1V49A 1C4PA 1NAPA 3CIRB 1IYFA 3CMAA 3P1HA 2L0CA 2OWOA 3AMZA 2JXTA 1DYQA 2BDOA 2UU9L 2W3RA 1WJ4A 2KCTA 2WAQG 2B63G 4WH4A 4ZDVA 4ARCA 1KAAA 1XMOL 1B3AA 1OO9B 1V1PB 4LWCA 1MJEA 4BBSB 1V5OA 1X1MA 2LI5A 4IWPA 4P1CC 1WCMH 2OJRA 1J8IA 2NVTB 2QDFA 1VQPA 2RHSB 5BYRA 1B3QA 5JVH3 1HA5A 1QCBD 2B2UA 4RKLA 1FFUA 2FIFA 3LYYA 4P73A 3PUYA 2V4IB 1NYRA 5LMNW 1F2ZA 4OIJA 1QF6A 3KF6B 1KTKA 2XK5A 1TYGB 1N63A 1DCZA 2R93H 1Y1VH 1K8AC 4XX5A 1DD2A 5ELNA 1YNJC 3QCAA 3VXWA 1SBBB 1I5FA 2F0FA 5KIXA 3B0AA 4B95A 1JMLA 3U58A 1EYCA 1KJTA 4KGSA 5IP4D 4DUYL 3DBRI 1ENFA 3CCUA 3G4SA 4RM8A 3X0WA 3UE1A 3HP3A 3S1RB 2K5DA 1M90C 1HNXQ 2CU1A 4OL7A 1KIXA 5AZHA 1GUTA 3GTGB 2V9HA 2JSOA 3HOVB 2BGFA 3QB3A 4HK2A 4X65Q 3SEBA
chains in the Genus database with same CATH topology
3C2PA 1DOLA 5IGGA 1Q8IA 2G9HD 4X3TA 4OO1H 1EY8A 2K05A 3SHLA 5A2QL 4IFDI 1M8AA 4DNTB 4R8NA 1OXXK 3JAME 2B2VA 5JXVA 1TS4A 1EIGA 1TU2B 1TR5A 2R92B 1L0VB 3PV0A 1DONA 5ELEA 2D2CC 3PZ7A 1GUNA 3GTPB 1HCZA 1YQ3B 2WKDA 2QKIC 1A3VA 1SE3A 4MH8A 1BOSA 1OQRA 1R7SA 2WXNA 2B63B 1BQQT 3NZ3A 3Q22A 4US9A 1LTRD 1BBXC 4YWGG 5CYUA 2WS3B 3ERQA 1C8CA 2WXQA 4OVZA 2GA4B 2KWDA 3P20A 2LHEA 5DEHA 4A3FB 1TWAB 2ZW1A 2K9XA 2WB1B 1Q90A 3EFXD 1O7LA 4A3JB 3H8HA 3HRZC 2K01A 3PIP3 4DQOC 2E74C 1F9QA 3J7AV 3NVYA 2OF1A 3ZYYX 5IGBA 3D4RA 3K5LA 3SFDB 4FXGC 1RJTA 2FUG1 3NWSA 4P6VF 1SNDA 3VRAB 4USAA 2O5JC 2PIAA 3MJ5A 1QB5D 3BYYB 4F7XA 3VR5A 4FVMA 2N55A 2F0EA 1PXUA 4IUTA 3S2HB 2FHTA 3DWGC 3NBIA 4HCSA 1IYUA 4XDXA 3PMFA 5G3LD 1F2MA 5BMHA 4G7OC 1B1ZA 1QLBB 4J8QA 2IX1A 1GHJA 4ZYSA 4AYBB 1GB4A 3S2DB 2VB2X 1AW7A 1SIJA 1NYQA 5C0XH 1K8OA 4NZLB 1JROA 3I8ZA 1OFFA 3TEWA 3V05A 3L7ZC 4XYQA 3FPUB 2A74C 4XQQA 4A3KB 1MHHE 1YN4A 3MHBA 2YYZA 1IYVA 5EE1A 2WACA 1HA6A 1KNAA 4K8JA 4DU9A 3P4PB 3EQLC 1QOBA 1SJHD 1HUMA 1D2BA 2Z8LA 1PFDA 1ET6A 1WD0A 2F0KA 2J52A 1EY4A 2IJ0A 1K50A 4C3IB 1QNUA 3TEYA 4YXDB 5J22A 2E75C 3LWUA 3NTIA 3NBHA 4FXDA 2FMCA 2Q8TA 3AEFB 4IALA 1EL0A 3BDOA 3TP8A 2L83A 2L1BA 1LACA 3BIID 2MHVA 2BTEA 1J9OA 4NMZA 2WKCA 5BN3A 2DBYA 1EZ6A 5IGCA 4IKGA 1HQMC 3RLFA 2A68D 4UAIA 4HKZE 5ELFA 1FR3A 4XIGS 1RCVD 3V3XA 2JYTA 4U673 3NVWA 1LT3D 4GDKB 3H09A 1Q12A 1CA5A 2L5TA 3AE8B 5KNCA 2JE6I 2L12A 2IT1A 1G6ZA 1S5DD 1N61A 1STHA 1SMYC 4L8JA 2F03A 4LK1C 3DEOA 4DAPA 3DM1A 1BCPB 2F0QA 2EJMA 2HTME 2ZXOA 1OQQA 4HROA 2KQ4X 2K5WA 2R3ZA 1TY0A 4L2YA 2EY1A 3IKJA 2L32A 3GV6A 2BS4B 3H0GB 1VCIA 4K5WA 5AUKA 2PTLA 3U4EG 3D6WA 3AEEB 1CZWA 2CU3A 4H0LC 5CV6A 2JYEA 2F0VA 5E4XA 1N62A 1A70A 1XWEA 2F1MA 2X69A 4IQZA 1T6BX 3U7ZA 1TS3A 2WXHA 3SFEB 3SVMA 2BT6A 2KACA 2H4OA 2KOLA 1WCMB 2B2VC 1NI3A 1IBXA 1LTAD 1EEFD 1STBA 2LY7A 1BF4A 1JE4A 2HDEA 4B0EA 3NSWA 1NEKB 1U4MA 3PUWA 3X3NA 4WJWA 1JB3A 2WXJA 1LTSD 3D6CA 4GDLB 2OHFA 1AWDA 4FF2A 5CV5A 5DNFA 1CI3M 3AE4B 5EKIA 2AQ1B 4HEDA 4PV1C 3VR9B 3T16A 3NE5B 1C77A 2NTTA 4C3IG 2EXZA 4RCOA 3VR4A 1PGBA 4G7ZC 5HG2A 1NCVA 1D6EC 3HGBA 3AEGB 3FILA 2JU6X 1SDFA 2DN8A 3HEJA 1XLQA 3ONAB 3RFZB 1FNUA 1ROEA 1BUIC 3Q8CA 1TIID 4PT5A 3ZQ4A 2BOSA 4DXFA 2W82A 3QG1A 5HI1A 2INNE 4XXEA 5M9OA 2ACZB 3T13A 4DF7A 2JA6B 5FO9B 3T4AC 5FO7B 2MUYA 2KJXA 1KDAA 5M3MB 2LFIA 3N9YC 5KNDA 1QOHA 1JORA 1KLGD 3I3CA 2RQXA 2CHBD 2RDFA 3T3OA 3ZGZA 3L3OC 3DWQA 2FMMA 4HMJA 1SYEA 1B44D 4KGRA 1FRRA 2F0JA 1WTVA 3E56A 1HTPA 4N6EB 2B39A 2CVRA 3C1EA 1BCPF 2EY5A 5TSSA 4FF3A 4WURA 1DM0B 5G5HA 1I4HA 2K32A 2VB3X 4XTCS 5F2DA 2JEBI 3MXNA 4KMUC 2Q5WD 2WXPA 3AEDB 3TP5A 3CKIB 1WVLA 4IUQA 2L4NA 3FPPA 1JOKA 3S15B 1YNND 3LB8C 4OO1G 1PRTD 5ISRA 1I4GA 2LS01 2B2WA 4WQMA 3G7LA 3PUVA 4K14A 3K59A 4XQJA 4CQNA 3KWVA 1EU3A 2J0TD 3U9OA 1GAQB 3K57A 1U9RA 1Y8OB 4MN3A 4ZKBB 1Y56A 1PTOC 1WTPA 2Z4HA 1BDOA 4C3JG 3TEXA 4S3SA 3W9CB 3GTKB 2RDGA 4ZRQA 1HTLD 4RAUC 3NQTA 1GUSA 2QMTA 3HZXA 3CQZB 3KK7A 4V190 2F0TA 3URYA 4IFDJ 1WGKA 1WTRA 1QT9A 5HFYA 4H13C 2IW3A 4X3SA 4J3OD 4KHZA 3VR8B 2PVOD 3TBIB 5LNK1 5J39A 1SNPA 2AUKA 4DAVA 4KKUA 2CW0C 1LO5D 1HFNA 4A3BB 3AE7B 4NAWB 3DXJC 1TWGB 4WORA 4ZKCB 4XDCA 1EWYC 1IHZA 4BA1I 2A69C 1D5ZC 5J1ZA 3H6MA 2NWGA 4R9WA 3I9V1 3LX0A 3HOWB 4TKOB 2RVLA 2PVGC 3C46A 1AN8A 5BYQA 4KK7A 4K8IA 3A8JE 2DWQA 1PDXA 3AE3B 1F2LA 2MP1A 1ZXHA 2B2UC 1K52A 3BDCA 1VZ8A 4K5VA 1S5BD 1TKYA 4HSPA 3OIPA 1H9KA 2K3UA 3TMEA 3ZJUA 4ITKA 3U9SA 2DLBA 3SR1A 4NP5A 1NVID 1F2YA 1JWUD 3BK1A 4RA8A 2ZW0A 2PYKA 1WTOA 2XVSA 4RGOS 1JWAD 3NPPA 5JOBA 4DGZA 4G57A 3QOJA 2AWOA 4B08A 4HR7B 3M4OB 2J53A 2BYTA 1C76A 2WXRA 1UUPA 1B9MA 3V96A 5CMDA 1TS2A 5MPOA 3GTMB 3N6RA 1I4QA 3ABVB 1ZP0B 2EOTA 4H44C 2D5GA 3AV8A 3A7AB 3G6JB 3IAM1 4CHTB 1Q10A 5JPMC 3MXGA 4DK0A 3W1SA 2B8FA 2HDLA 1W6JA 5T1GA 1X3PA 5I9PA 3J7YW 4HMIA 3VR2A 4J6HA 5IIFA 3BVZA 4OZBA 3TZDA 5EPJA 3NS1A 2F0NA 3MFYA 3FC4A 2L52A 3NXWA 2QDBA 2EPBA 5I4DA 2F0MA 3OIQA 2XIWA 4EGVA 4ID6A 1E2VA 1II3A 2XWBB 1KDCA 4G7HC 3TP6A 2BCOA 4C3HG 3HKZB 3MZ5A 1SF0A 2VUMB 4X3KA 1XO3A 1OXTA 1JC7A 3EVQA 4OW0A 4JWSC 3DMUA 2B8GA 1STAA 5C4XB 1TWCB 4KJOA 4MHEA 1EY6A 5A2QE 1CT1D 2KEDA 4ME5A 1B4OA 3U52E 2DY8A 2PMZB 4IN3A 3Q8EA 1U4RA 1FXIA 2WXOA 3EROA 2YEPB 1SB3C 4ZHOA 4OGQC 3IXSA 2NMQA 1H9MA 2C9OA 1XYIA 2A6HC 4QUFA 4FXCA 4HTHA 4M1UB 2WXFA 1K83B 2V4DA 5KGUA 4YSXB 5COYA 2NN6G 3WDNA 1C48A 2F0DA 3L9AX 4PNYA 3T3NA 1LT5D 1DZ1A 3OWFA 2IGDA 2OT2A 2EYJA 3P4SB 5M5XB 3FDTA 2A6ED 4KD4A 4TQ0A 3J81L 3NTHA 2NYZD 4RGNA 4YTPB 2VXWA 2OEDA 5C3JB 1IKLA 1PYWD 3NRZA 4FNFA 4ZRZA 1IGCA 5ELDA 1KF6B 3SK4A 1LT6D 3HVDA 1SNMA 5JEAG 3RPFC 1UGJA 1GHKA 2PW9A 5C0XI 4K6DA 2SNMA 3CU7A 1CHQD 2E6XA 2MEKA 2N0SB 5E3FA 3B2GA 1Y69U 4JBWA 2V3NA 4I7ZC 4KKIA 4N58A 3BWUD 2HCCA 3DUZA 1SNQA 1E0ZA 3K5OA 1D5XC 3IT6B 1A15A 1WYGA 2B2YA 2EKIA 1D1KA 4CKCA 3KLRA 4CJ2C 2PW5A 5IGEA 2TSSA 3RUZA 3WOEA 5G3LF 5C2TB 1YN3A 2K6AA 3A8IE 2KUMA 1B2TA 4L6TB 4RNAA 1ET9A 2FFKB 3NQIA 2X38A 3MXPA 1E2WA 4OO1I 2INPE 1BCPD 1TKGA 3VR6A 2WXMA 3AEBB 1LLRD 3X3MA 1RODA 2VZKB 1FO4A 3HS0C 2IPKD 4BY1B 4C7ZA 3TN2A 4WAFA 4EQOA 5DM73 1KNEA 1TQOA 1RKNA 1PUTA 1WTWA 2DYOA 1SE2A 4L23A 4B9XA 3DHQA 4IFDG 2KDMA 2Y5CA 3KBGA 2B2TC 2SAKA 4RWSC 1RYJA 3AU7A 3UI3A 3QIAA 1BXTA 4RHSA 3PO2B 3Q6SA 3NP8A 2JA8B 2WV6D 3SK6A 2RMMA 2K04A 4OZAA 2K7VA 4REZA 1JCKB 2BBCA 4C3JB 1YNJD 2XRQD 4ILWA 5KYIA 3NUCA 2KMMA 1CFMA 5D7GA 1MD2D 4IZ8A 2NVYB 2MH7A 2BE5D 1KH0A 4C80A 1FGBD 4KN4C 2EELA 4IOIE 1WWTA 3K5MA 4WWMA 3SK5A 4CKEA 2KHSA 4KJNA 3R8BA 1I6HB 2JA7B 3ND8A 2PZWA 3R3OA 1QKZA 1ZXTA 5BMIA 4XDDA 1FFVA 3I73A 2OEOA 1PFNA 4ARIA 4FXKC 1JQ4A 1WRIA 1Z7TA 3H3VC 2QF7A 3PUXA 2WP8J 4RHRA 5JVG3 2WXKA 2L1AA 4C56C 2EZVA 3AECB 2SEBD 1SXTA 3W5VB 1A2TA 2EYLA 5FOBB 3P4QB 2BB6A 3PIO3 1RM6C 1I50B 2A6HD 2WU5B 2EJFC 1I3QB 4C3HB 3R2TA 4TQUS 3K0YA 2Y5PA 3Q24A 2F0OA 1S5FD 2JYOA 5BN4A 2EY2A 3MWYW 1PTOF 4XYOA 2E2IB 5C6AA 4C1NI 1FM0D 2PPBC 5C4ZA 4A6QA 3NUHB 2M00A 1PLFA 1VDVA 2NZ1D 4B9WA 2I2YA 1QE6A 1RDPD 1MPEA 1Y8PB 4XWWA 2BW2A 4XWTA 3GS2A 5IOCA 3AN1A 1DOIA 4AQ7A 1ZDXA 3S9WA 4RF0A 3IAYA 3Q0AA 3I4MB 4TMAB 3MVVA 2WXGA 2B2YC 2MJ3A 3MEHA 3AMUA 2RSOA 1E7PB 4EE2A 1ACCA 3MTSA 4QUCA 1CTMA 2LMCB 2F0IA 3OSOA 1GPXA 1JRPA 2ZT9C 1UWMA 1PZKD 5I6WA 3W3AA 3B9JA 4YSYB 5EBCA 1D5MC 1UWXA 4KY5A 3HOUB 2J4XA 3P7JA 1RF2D 2ICEC 3A54A 3I4NB 1N5XA 1RTOA 1DOMA 2BB5A 1ZXIA 1DOXA 1VZ7A 1EQTA 4WIPA 1X3QA 4CBVA 4RKBA 2PNRC 4IUNA 2Z1CA 4LMQD 4GZYC 1H9RA 1Z6HA 1E9MA 1BUVT 1LTGD 4ZK9B 2HDMA 2LMCA 1G8ZD 2Z4IA 3HOYB 4ZAIA 5EPKA 1O80A 5CV7A 2JQRB 4QCLA 1ZEQX 4KY6A 5D3IB 3KUPA 4F88A 1JALA 4LJZC 3GP7A 5DAUA 1FCCC 4KKJA 3QJYA 5EE9A 2JP1A 2QJLA 1VF7A 4P2CB 5BN5A 1V43A 3M85A 2PZUA 1EWHA 4OZCA 3D4DA 1G91A 4JE3B 2L55A 1RD9D 2YU9B 1DJRD 2LJIA 4KX6B 3I57A 3I70A 2LFNA 4QMGA 1ILQA 2NUCA 2RDHA 4YTMB 1QOFA 5K36G 1U4LA 1IGDA 2W55A 5D3DA 1L4ZB 2VNUD 4NDXA 2FINB 1FIQA 1SEBD 5C0XG 2F0LA 4HRSA 1UNSA 2E2HB 2GI9A 2VZKD 3EA6A 5CV4A 5LL6X 2WP9B 1L0XB 4XE0A 5IGDA 2MJ8A 4RGTA 3UI2A 2EYMA 2J42A 2KAJA 2V3PA 3P63A 2JZPA 2NN6I 4A90A 4H7BA 1L0YB 1A2UA 3BDLA 2E76C 2F3VA 4OHJA 2NN6H 3J7AF 2DYMA 1SE4A 2KN4A 1ZYRD 3OWEB 4YIJA 2FE8A 4IUVA 3E9SA 5C44B 1JWMD 3ND9A 4U68A 5C3WA 1F9SA 4B0MA 3S1NB 3AE1B 1CK1A 3KF8A 1SFOB 2H88B 1EIHA 2FBWB 4MACA 3PO3B 3FAHA 3S1MB 1EY7A 5LHY1 1HQRD 4HAEA 3GO5A 1H9SA 5IGFA 1ONLA 1KABA 3FKIB 1SSOA 1VJKA 1FNVA 5CORA 3VR3A 1EY5A 4A3DB 2AX5A 1YJJA 2DNCA 3GTLB 1LABA 1PGAA 4KGTA 3IFDA 3C8YA 2F4IA 2WU2B 1QQRA 2L11A 5BYSA 4TQ1A 1I4XA 3LWEA 1STEA 1XTCD 4IURA 2WAQB 1BO0A 3NTKA 1HPCA 3KLSA 1EEID 3K6OA 3WCQA 2X6GA 1J7AA 2EVBA 5T1IA 3VA7A 5D14A 4KI0A 3OOCA 3VYUA 1QG7A 1O78A 3P75A 1FRDA 3C1FA 4IDIA 5CR3A 2IWHA 1XX8A 4ULLA 1M4VA 3J80E 3I4LA 1SAPA 1U4PA 3GQBA 1PTOB 3BVGA 3TZUA 1ILPA 5ELBA 4E6IA 2HQEA 2PQEA 4C7YA 4FF1A 4N9PA 1SYFA 3QO2A 2LGIA 2H89B 3Q69A 4MM3B 1OXSC 2XSCA 5C3EB 4A3GB 3MHZA 4ODGA 4BA2I 1FD7D 2EE1A 3IAS1 1C4AA 1JW9D 3R93A 1RWSA 1ZUD2 1TKWB 1F9PA 2JEAI 5FK9C 4FP5D 1UAPA 4IUPA 1SNCA 1VZ6A 3P1MA 3SR6A 5FKAC 5C3XA 3CWIA 3M4YA 1ZKOA 2O2LD 2MJEA 1VF5C 4DFAA 1HZ5A 1JICA 1JOQA 3H94A 3T53B 2WIIB 4F8MA 5C4HA 1VMPA 2BA0A 3MXUA 2RPVA 4ZOHC 3BG3A 4L1BA 2JXMB 5M5WB 1SJED 1YNNC 3EGRA 3MC0B 1PRTC 4O42A 4QF4A 2ONQA 3VA5A 3A7LA 1KRHA 5DM63 4TRDA 1I7HA 3HVZA 5EGTA 3TDQA 4PQXA 3OPOA 2E2DC 2Y0SB 4KHVA 2PZTA 3KLSX 4K5XA 1VDZA 1N60A 1CZGA 4LTUA 1LTBD 2K1BA 4HJGE 4RH6A 3FEWX 3S17B 1HEZE 2K5QA 1PTOD 4PMWA 2R7ZB 1G291 1ZPSA 4DAYA 1NENB 1Y1VB 4A8XC 3TEZA 1TZOA 1TKEA 1V1PA 4XQNA 5H92C 2C5CA 3B2FA 3Q8AA 2I38A 2KCNA 4KY7A 1E2ZA 2RA4A 1H9JA 1XCTL 4X3UA 3BYTB 1EYAA 1CQFA 2EYOA 2ENBA 1DGJA 3GV3A 1XEEA 4KKSA 4GLSC 3F2UA 3E6ZX 4YSZB 3I91A 2O4XA 2F0WA 1ZOYB 1T5XD 2KCCA 1HZ6A 4N9TA 5EQ0A 2QIEB 5C5LA 3J80L 2EYFA 3OHXC 1S5ED 3DWPA 3AH7A 4RCNA 2AQ3B 1PMRA 1A3UA 4JK1C 5M5YB 2JA5B 1V97A 1G2TA 4AS1A 1E10A 1B53A 2NVQB 4PMCA 2F0UA 4A3MB 2WXLA 3CRKC 4G4KA 5CV9A 1D4BA 4HEA1 2QCPX 1YNTE 2AWNA 2MGSA 2X6LA 1FEHA 4NW2A 1SYGA 2BE5C 4Y7NB 1TS5A 2F0PA 5EJWA 1CM9A 1YJIA 5KEEA 1S4ZA 4BS9A 4ZUJA 5A35A 5GXGB 5C4JB 2G9DA 3T56B 1YQ4B 1XXGA 4FF4A 2Y3AA 3N52A 3W5UB 3HOXB 2KEEA 2NTSA 1WSPA 4Q2JA 1EWCA 5K5PA 1C4QA 1MBYA 3NK9A 3K7AB 4DXGA 4US8A 2N7JA 3FMCA 2IL8A 3NWTA 2GB1A 1ENCA 3A56A 4HCEA 2J7ZA 3K58A 3TUOA 3LXFA 4A93B 1C79A 3FRPB 1ML0D 4XT1B 1AYFA 5EE0A 1AZQA 1BNZA 4OIKA 1JOOA 2K22A 1TWHB 3Q8BA 2TMPA 4BY7B 3Q23A 1QJOA 1OXVA 1J7CA 5CBAE 5FR3A 3VYTA 4J1MA 2IX0A 1MVKA 1A3TA 1RHPA 1S5CD 4ZUIA 1NSNS 1CZPA 2JSVX 2NBFA 5JPNC 3HG9A 2EJGC 2PLPA 1B9RA 1SYDA 2ID0A 2W3SA 5KYLA 2K28A 3U2SC 2IGHA 2M56B 1ZYRC 4NKLA 1IW7D 1NR2A 1GUWA 1ICWA 4UDUC 2PO4A 4DK1A 1L6UA 5E1FA 4KN7C 2B2TA 3JAML 4ZLTF 1V8QA 5M3FB 5LL6S 1EQVA 5D65A 1STYA 2R61A 4V0BA 1F0ZA 5IT9L 5EKLA 2M2LA 5JAVA 4K2KA 1SNOA 1A6XA 2PCFB 1FYCA 1EZ8A 1JWSD 4M8AA 1LTTD 2ON8A 1YMHE 4I65A 4RFBA 4KD3A 4R8IA 4JX1C 2EYHA 4F87A 1NUCA 5HURA 3RZOB 2LHDA 3BS1A 3DWAA 1H9SB 5JEAJ 1YN5A 5BMGA 2CJNA 3MP9A 1HFGA 3SDZA 3SK8A 1EY9A 1AEXA 3MFGA 4WFN3 2M0AA 3M7GA 1BMLC 2BS3B 1Q1BA 1TWFB 1RFKA 4RF1A 5EBDA 1PDQA 4XT3B 3W2DA 4IUUA 4PMBA 2F3WA 1CJEA 4WRDA 3VYRA 2HUGA 1C4CA 2A5HA 3AEAB 1ENAA 2WINB 3T51B 5EKKA 3C3LA 4Q0FA 3AE9B 1E0BA 3ZJTA 1GUGA 2DY7A 1JQYD 3AE5B 1F2RC 3NVVA 4NAMA 3WOFA 1PFMA 1QWYA 3SXHA 1KLUD 3VQIA 3Q8FA 2Q8IB 2PKOA 4C2MB 3MA2B 2EY6A 1EYDA 2R6GA 1O7ZA 2IDYA 1ZE3D 2M19A 5ELCA 1K53A 1FD6A 3EUB2 5CC4A 3TP7A 3M3YB 1HRJA 3PO0A 2EDGA 3NVZA 2JX5A 3ITPA 5CV8A 3A55A 4IFDH 4BWGB 5I2YA 2CW0D 2SOBA 4FO2A 3KWLA 1EU4A 4A55A 4L63B 1PTOH 2H1EA 1GXDC 3SE0A 4LK0M 4CJ0B 3L4PA 2QILA 3LNNA 2WNMA 1KFYB 2ICIA 4HSVA 2W54A 3GD7A 4N59A 1C9FA 1AP0A 3IT4B 1Q3LA 2A69D 5I2XA 2R93B 3E0JA 3DEPA 2SNSA 1JR0D 5IT9E 3NHHA 4LAAA 4EVOA 5C0XJ 1VLBA 4NJCA 1AFPA 3RMHA 3MAQA 2IX3A 3IFTA 3VRBB 1BR9A 2NB0A 3HOZB 2KECA 2GRIA 1F2RI 4EQNA 5AUIA 1Y1WB 1OXUA 3O13A 3HRDD 1HHVA 4MT5A 2BA1A 2XN9C 3J81E 2A73B 2K5PA 3RZDB 2KVMA 1XLOA 2WDQB 1FCLA 4DNRB 3AB5A 3AE6B 1ZDVA 2D62A 1WD1A 1LV9A 3ETRA 5I9OA 2I46A 2XNAC 2KA7A 4O1NA 1I4RA 5CGKA 4JWUC 1K51A 4P16A 3P4RB 1I4PA 3DWMA 5C5MA 2LUMA 2RSNA 1DOKA 4R3DA 1XLPA 2NVXB 2WDVB 3AB9A 2QEJC 1PRTB 1XLNA 2F0SA 1XF5L 1GUOA 1QOAA 3GB1A 1STGA 5FLXL 3ZJVA 1EOTA 4KTAA 2LKVA 4QB4A 1G2SA 1IL8A 5JJZA 5G5GA 2FJ2A 2EYPA 3D4WA 2K03A 1EY0A 4RGMA 3FVQA 2XWJB 3EJIA 3D31A 4Q5VA 2N88A 4KKTA 2F0HA 1GJXA 1R4PB 2OXPA 1CHPD 2XRSD 2HCIA 4YT0B 4A3EB 3BVMA 3D3RA 4CKBA 2PMVA 5IODA 5KNBA 2BS2B 1R9TB 5EPLA 4EQPA 3PUZA 1IKMA 3S16B 1VR9A 1PRTF 2E3TA 3I90A 4ABNA 3KQ4A 5H8YE 3BK2A 1PZJD 2RKSA 5EE3A 1MSHA 1UEAB 1R4QB 3I72A 3D8GA 2G1EA 1CQVA 2O5IC 1SYBA 1EM7A 4ZQ3A 3K5NA 3GTQB 1Q1EA 1FMAD 3M7NA 4HN7A 1SSNA 2WQYB 3OMCA 1FXAA 1L6VA 1VMCA 1K8MA 1X32A 4JPSA 5K36H 1IUEA 1MI2A 2D9UA 1MSGA 1NR4A 1DOYA 1ESFA 1V1OA 3E5SA 3TSSA 3CRLC 3H91A 3GTOB 1JWBD 1ESRA 1J7BA 1P7FA 5KRUA 1W6KA 4K2LA 4H2AA 4FYDA 2SDFA 1QOGA 1V8CA 3HUIA 2PW7A 3QOLA 3S14B 1SYCA 3CHBD 3R2IA 4QIWB 3AM9A 2A68C 2MPMA 4HKQA 1L5PA 1PFBA 2CQAA 2I07B 3GTJB 3J9CA 1F77A 2A6EC 3OMGA 2M9VA 1AZPA 5JEAH 1D1IA 1C78A 1T3QA 3V2TA 1WXQA 4BBRB 3PZ8A 1MI0A 1PGXA 1TT2A 1WTQA 1HUNA 2F0GA 3A8KE 4ZHPA 3OW7A 1LT4D 1SMYD 1CA6A 4MIUA 1HXYD 1QNKA 1IW7C 1RTNA 1KDBA 4KV6A 5FO8B 2N9LA 3AE2B 2E2JB 3P42A 4Z9CB 1FNWA 2LEKA 2MJDA 2K33A 2YEPF 5HGTA 5FLXE 2AQ2B 1MHXA 2N9KA 5I6YA 3VYSA 4CJ1B 3FILB 1GOZA 1B50A 3RD4A 4A9AA 1I6VC 1EFID 5AFWA 3QWNA 1GB1A 1VRAB 1TVXA 4LLGM 2ZXRA 1TY2A 2WDRB 3BZDB 2IGGA 5HHDG 2D5DA 2K0PA 1DXMA 3S1QB 2QSDA 2B76B 5NUCA 1WTXA 2L9HA 2CJOA 4D2KA 1MGSA 4C1NK 4ZRPA 3KBXA 1Y8NB 4DN4M 2KQ3A 1P7EA 5E6JA 1F9RA 1XCQL 5T8IA 5E4WC 1E6EB 1LTID 4K6LA 2BDNA 2WLBA 1B9NA 2V0GA 2JWUA 2ZXPA 4TSSA 1O7YA 2RBMA 2AUJD 5CBEE 1PZID 1STNA 1BCPC 2DNEA 4M0WA 1T5EA 1TJEA 1IBXB