1D6EC

Crystal structure of hla-dr4 complex with peptidomimetic and seb
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide inhibitor
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 225
sequence length 236
ec nomenclature
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d6eC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d6eC02
1PTOH 1JCKB 1JWSD 1PTOB 1JWUD 3OWEB 1FD7D 1RDPD 1LTGD 1YN4A 1B44D 2XRSD 5TSSA 1I4XA 1I4PA 4Z9CB 2IJ0A 4RFBA 1D5MC 1TY2A 1ET9A 4OHJA 1D5ZC 1LT6D 1XXGA 3CHBD 2AQ2B 1TS5A 1PTOF 3R2TA 1CHQD 1FGBD 1SE2A 1S5DD 4RGNA 4UDUC 3R2IA 3BYTB 1PRTC 1BCPF 1LTSD 1PZKD 1ESFA 1YN5A 1S5CD 1KLGD 1S5BD 1CK1A 1LT5D 1LT3D 1PTOD 1PTOC 1JWMD 1LO5D 1PZID 1UNSA 3EFXD 2SEBD 1BCPD 1M4VA 2R61A 5D3IB 3R8BA 3TSSA 1D5XC 1D6EC 1RCVD 2AQ1B 1BCPB 1CQVA 2NTTA 1CHPD 1CT1D 1UUPA 3GP7A 1L0XB 1LTBD 2QEJC 3DWQA 2WV6D 1SXTA 1V1PB 3KLSX 5ELEA 3DWAA 4O1NA 3BVMA 1SBBB 1V1PA 1LTID 1EU3A 2RDHA 1EFID 1KTKA 1I4HA 1SEBD 1TS2A 3BVZA 5FK9C 1S5FD 1GOZA 3EA6A 2IPKD 1PZJD 1LTTD 2NTSA 1STEA 4DXFA 1BCPC 1T5XD 1FNUA 4BWGB 2RDGA 2QILA 1HQRD 1PYWD 1KLUD 2G9HD 3MFGA 1MD2D 4L63B 1G8ZD 1EU4A 1I4QA 1AN8A 1XTCD 1FNVA 4ZYSA 1I4GA 2CHBD 1EEID 1LLRD 2O2LD 1BXTA 1SJED 3O13A 4RHRA 2TSSA 4RGOS 3BVGA 4RGMA 1SE3A 1LTAD 1RF2D 4RGTA 3SEBA 3V05A 5ELDA 2XN9C 4K6LA 4L6TB 1EWCA 1TY0A 1PRTF 5ELBA 4RHSA 2Z8LA 1I4RA 1TS3A 1AW7A 3BYYB 3DWPA 3BZDB 1DJRD 3MC0B 5I4DA 1RD9D 1DYQA 4RCOA 1HA5A 1QILA 1HXYD 5ELCA 4NZLB 1L0YB 1PRTD 2AQ3B 5FKAC 1EEFD 4DXGA 3W2DA 1FNWA 1JR0D 1S5ED 4C56C 1YN3A 5D3DA 1PRTB 1JQYD 4TSSA 1SE4A 2ICIA 1ENFA 1LT4D 2J4XA 2XNAC 3URYA 1LTRD 1TS4A 2XRQD 1F77A 1ET6A 1HTLD 1V1OA 4RH6A 5ELFA 1SJHD 1B1ZA
chains in the Genus database with same CATH superfamily
3AB5A 2JZZA 4WJNA 3RUZA 1FD6A 5IYBG 4X65L 1PUTA 2JA6B 4XWTA 1IBXB 1HTPA 1KDAA 4DR6Q 4JPBW 1IKLA 2O6VD 5IAAC 4RM8A 3CCMA 2VH1A 3CKIB 2C7HA 4QIWB 3S2HH 3U7DA 2M0XA 4K6DA 3STBC 3M95A 1SAPA 3I63C 3AN1A 1STNA 3TIXA 3RULA 1K0RA 1HEZE 4BKGA 1U4PA 1QG7A 1TGZB 3OLMD 1YN5A 1VQBA 3T51B 2D3CA 1WR1A 1H9MA 2IY1B 1J8IA 5IT9L 2K5WA 3UI3A 2WXIA 2D9UA 4ANUA 2LS01 3D6WA 3IL8A 1XYIA 5KHOA 3HOWB 2R61A 4FF2A 2LWPA 4P72A 1JRUA 5EKKA 5ELNA 2V1YA 2CHXA 4C3HG 1WGKA 2RR9A 4OWTB 1GD7A 5IYCG 3K57A 4KHPL 2YLMA 5EE0A 3RMKC 2IY5B 1FXIA 2IBIB 1T9HA 3H0GB 2KENA 1OXUA 3DWQA 3DEPA 1TWAH 3HKZG 5DEHA 3U9OA 1PH9A 2ES2A 1LYLA 2CFMA 1GPXA 1EY7A 1J8CA 2EOTA 2GBRA 2KWUB 1KL9A 3I4NB 3IT6B 2MQJA 3LYYA 1BDOA 3TP7A 3D4DA 5CBEE 2KCCA 4P16A 4Q2JA 4HPMB 4BKTA 2L3ZA 2N9LA 2L52A 3A8KE 4CHKA 5C0XI 1OTRB 1QOFA 3PV1A 3GTGH 3KF6A 2B2TC 4K81A 4JI6L 4K5XA 4RM9A 2BS2B 4DV3Q 4A3GB 3MVVA 5LMNL 2OEDA 4LNOA 1IBKL 4YWLA 1RFKA 1WYGA 2FIDA 1MIUA 2KJXA 2UUAL 5FJ8G 1VQDA 2YU9B 3M3YH 3H7SA 5HHDG 3HZXA 2DAFA 1CMXB 2VZAA 3VR2A 1C4PA 1XT9B 3D3RA 3BS1A 2EYFA 1H95A 1EZ6A 1PMRA 2MLBA 3IXSA 2R93H 3Q8AA 4P1BC 4F8CB 5HURA 5GROA 3N3KB 5D6JB 4AQYQ 1C1YB 1NAPA 3PLUA 5CC4A 2WNMA 4RWSC 2DJGC 2GLSA 3VTVA 4BBRH 1SNMA 2YTYA 2LEKA 5BMGA 3FPPA 3NVYA 3CD6A 2BYTA 1FGUA 2E2HB 1PFSA 3DDCB 4GB9A 2PQEA 5AUKA 1SIJA 5COYA 5A2QL 1N63A 4FADA 3K5NA 1TY0A 1ZUD2 1V43A 4CQNA 1C4AA 5HY6A 1GNUA 1WIAA 3FKIG 4H0LC 2CJOA 2B2VC 3RNBC 4HCEA 5C3EH 1FPYA 1YIWA 4TQ1A 2EVBA 1SLJA 3K7AB 2LXCA 1ZEQX 5EE9A 4A9AA 4EEWA 5C44H 3HOWG 2BW2A 2WXHA 5LMUL 3AEEB 1TJEA 4BBSG 2CHWA 2J7QB 2W3RA 2KWVB 1I42A 3OW7A 2F0JA 5HGTA 1E8ZA 2KLGA 3S1QB 4DNTB 4FJZA 3TEHB 3F2BA 3Q8DA 1MVKA 4GN3B 1HHVA 1JMCA 3I4LA 1SNDA 2AWNA 2RA4A 4KLKA 1D8LA 3QIJA 4PT5A 2K50A 3CP0A 4B3SQ 3IT4B 2JA8G 3S2DH 2PPBC 1MKHA 2N9EB 4RKBA 2SAKA 4F1SA 3VTWA 4LF8Q 3KW5B 4A93B 3CCRA 2ZVOA 3A7AB 4OWWB 1WJUA 1TY2A 1KH0A 3S24A 3PZ8A 4WWMA 2C5LC 4OIJA 3QK0A 2VZKB 2WXPA 4MJSA 2BF8B 1FCCC 4C3JG 3R93A 1R7SA 3N1XC 1NNXA 4FXKC 5IE8A 4KHZA 1SNCA 3EFUA 1D2BA 4G7ZC 1TWHH 4HKQA 1QVGA 1YNND 2LGDA 4XQNA 4JI0L 3EGRA 2LMCB 2INNE 2B63B 2ZJRA 4RMAA 1VCIA 1VQ6A 1QF6A 2I5MX 4CKBA 3SDLC 4B3ML 1EY5A 4FHKA 4GDLA 4KIKB 2FJ2A 4CDDC 1SIFA 1WMHA 3DXJC 4ME5A 1NI3A 1Y69U 1WTOA 3L3OC 3DUZA 3FEWX 2VZKD 4BBNF 4DU9A 5M5YH 1L7YA 1JT8A 2AWOA 1V1PB 1FJGQ 3M62B 3DWAA 1A62A 3A5ZB 1EWIA 1JE4A 2M00A 1FXAA 3RD2A 2ID0A 1LTID 3PIP3 1EU3A 1CJEA 2JZPA 3S17B 1NENB 3VRAB 5KHQA 1RM6C 2ZNVB 2RSNA 5M5XH 1J0GA 4CJ0B 1SE8A 5C0XJ 2E2DC 2PI2E 4C4VB 2VUMG 1OXTA 1QKZA 2PZTA 3NTKA 2IX0A 4IOIE 2K33A 1DCZA 3RLFA 2HQLA 5IP9H 3LXFA 4A3JH 4DR4L 2HD5B 4TRDA 3JAMc 3NUCA 2PJHA 1HCZA 5MPOA 4BS9A 1J7CA 2WKDA 4DKAC 4LJZC 4MH8A 4ZLTF 4O0AA 5EDSA 1X3GA 4A93G 2KT7A 1WJ4A 2IO1B 2Y0SB 1F2MA 1X54A 1XLOA 2F1MA 2H88B 3CCSA 5JPNC 3MC8A 1NDDA 4DHJB 3R3OA 5GAGC 3CAMA 1VQPA 2B8GA 3OMGA 3ZYYX 3PHXB 2MUYA 1J9OA 1TVXA 1LTAD 1KAWA 2MP2B 1G6JA 1IP9A 3JW0X 3J81j 4DV7Q 4L8JA 4BBNC 4A90A 5AZFA 5EGTA 2KLCA 3MEFA 2A1AA 4YT0B 1FVIA 1CI3M 1Q8KA 2CHZA 3DWMA 1IZ6A 1OXSC 3RLNA 2R92G 1YVCA 3MFYA 1PVOA 1ACCA 3W1SC 3ML8A 3C2PA 2VQEQ 4R4OA 3OYYA 1L0VB 1QILA 4KDIC 1MI2A 1OTCA 3RNGC 2WXOA 3CRLC 1NE3A 1VCBA 3AECB 1EEFD 3V96A 3I90A 2JA9A 4JI8Q 2JEAI 1FNWA 1P16A 1OEYJ 1UWMA 1S5ED 4CDEC 2MX2A 1JMLA 2I5LX 3DWGC 3R3MA 3W5VB 2F3VA 1HNXL 3HOVH 5EBCA 2A6HD 1I6HB 3KK7A 3IFTA 1N60A 3UGBB 2OCEA 4ICVA 2L9HA 4UY8C 4WWPA 1B1ZA 2Q2HA 5J1ZA 4DV1Q 1CKOA 4HJ7A 1ZYRD 3PUYA 4WAAA 1PTOB 4YTMB 1STGA 2EPBA 2KAJA 2NS5A 2PW7A 4G0NB 1Q5WB 3DHQA 3F2UA 2BA0A 2MRPA 4LJPB 3WANA 4MH0E 2CKZB 3HVZA 5IOCA 1W3SA 1ET9A 2VS1A 4OWXB 1BBXC 2ASBA 4BY7G 3H94A 1LT6D 2YTXA 1XXGA 4KMUC 3C46A 1WYWB 2NVUI 3AE6B 4KKIA 1QUQA 4A8XC 1WH3A 2NZ1D 2Z0SA 4ZUJA 4A3LH 4X66L 2NBWB 4JV5L 2KCNA 3VH4B 3GTMH 1BMLC 2ZPYA 4AP4C 4B0MA 4IW0A 3VR6A 4OX9Q 2Y0SG 1O7IA 2EYJA 1N34L 1YHAA 1Z9FA 3HP3A 4H02A 2ZJDA 3E6ZX 1EF1A 1PTOD 4KGSA 2DN8A 1WD1A 3BK2A 2L12A 5IY0A 1N5XA 4A6QA 5H1SE 4XQJA 4HPPA 4FO2A 4MM3B 3A54A 5DAUA 5G3LD 1UGJA 3DMUA 4HTHA 3TSSA 3R66C 4MTNA 3U9SA 2WGSA 3SFEB 2J42A 2KFJA 1XNQL 4E6IA 2HQEA 2GB1A 2DY7A 2KYWA 4PYZA 4QQBX 3PQIA 1Q1BA 2NB0A 2VY3A 3U50C 1K73C 3CU7A 2EZVA 1P8LA 1SBBB 1JORA 2G4DB 1U4RA 1E7PB 4YSXB 4IDIA 2RDHA 3AE4B 4WIPA 3O65B 4XYCA 1SYEA 3DHHC 1KTKA 4XC2A 1SEBD 2PW5A 2C35B 4M1UB 4NXNQ 1TZOA 2JZ3B 1FL0A 2NVTH 2GOWA 1G2TA 3J7AF 2E5LQ 2UUCQ 4JI1Q 2M2LA 1VDVA 3KH0A 5KYIA 5CTRC 3TN2A 2WXFA 3W3AA 2KDEB 1EL0A 2JRIB 4X62Q 3P4SB 3TZDA 1CTMA 1G8ZD 3VFKA 1XTCD 5CV7A 4JBMA 2JF5A 1U9RA 2E2JH 1HZCA 5AEKB 1X65A 3ZJYC 1EEID 2IDYA 3U8ZA 2R7DA 4K0KQ 2M4NA 3M4OB 1ZE3D 2K6QA 2EIFA 2TSSA 4YCUA 3PO2B 1E5WA 1MI0A 1KFYB 4KX6B 3HKZE 3VR9B 1Z5SB 1A3UA 5D14A 3ZTCA 1R4MB 3ETRA 3ZVVA 4IJLA 3SEBA 1V8CA 2DZKA 5IP4D 1Q0WB 1LFDA 2AWTA 4FLHA 2F0UA 4IUUA 4JYAL 4MNOA 3AEAB 4KV2A 4E3CA 3BDLA 3J81E 1IL2A 1TXYA 2V0GA 1G2SA 1AW7A 4CJ2C 1HA6A 2YEPB 4OVZA 3RN5A 2KCTA 3QHTA 1X56A 3MHZA 2IW3A 1K8MA 2BE5D 2NBFA 3NY5A 1O7YA 2K8CA 3EQLC 3H1UA 4PK1A 4C2MH 3R7QA 2PIAA 1IHZA 2IWHA 4S17A 2LZ6A 3ULPA 4MACA 1Y1VG 1XPRA 4GSWA 4P6VF 2WDTB 2G1EA 1BQQT 4F87A 1CSPA 2IO2B 1YJNA 4US9A 4NKLA 5CV4A 5EPLA 1H9SB 2A73B 2WFWA 2F0MA 2LHEA 2EDGA 2WDVB 4RH6A 2D62A 4JLCA 3ZRFA 1WCMG 1SR3A 2W9NA 4HDOA 1HR0Q 1XMQL 2I2YA 1EQRA 4LF7L 3N52A 3AE8B 3T1YL 2BQQA 3T9LA 3FMCA 4PZ6A 2MJDA 1HTOA 4OELB 5EPJA 4RFBA 1KAAA 2DY8A 1K8OA 2N9PC 2KUMA 5T1GA 1L4DB 4N58A 1TS5A 3MC9A 3H3VI 4PYUA 4C7YA 4HWIB 3A55A 2KTRA 2WB1G 1GJZA 4HJAA 3BYTB 1LTSD 1Y8RC 5FOBB 1XO3A 5IYBH 3ONSA 2NN6I 5GADC 2AEHA 1VDZA 4PMBA 2W55A 2N4FA 2K39A 1O78A 3ABVB 1KLGD 3V6CB 3NXWA 3PRMB 4KGRA 3EECA 5A35A 2N7JA 4OEMB 2KXJA 5J39A 2MO1A 3V2TA 3CPWA 5CV6A 1PH8A 1E0BA 4LNQA 3PO2G 2L0TA 3Q14C 1ICFB 4ASWC 1BCPD 4PZ8A 3LX0A 1YJ1A 2A4ZA 1X55A 4A3BB 2LUMA 2V3PA 2OF1A 4CGYB 1TKYA 1R4QB 3G7LA 2NVXB 5C6AA 2F0TA 4GMVA 4K7WA 2JA7G 2A68D 2ACZB 1ZXTA 3GTQB 2Q8IB 4UP8A 4WJOA 4GNXB 1KDCA 1Y8NB 1SXTA 1PH1A 2K1FA 2KX3A 3EN2A 2EJGC 3A0JA 3L2PA 3GV6A 3BY4B 3UI2A 4KZCA 1DOLA 1WJJA 2ICEC 1JJ2A 2KVZA 3PT2B 3NTHA 3A1QB 1B3QA 4MTKA 4NY0A 2KO3A 4B9XA 3RZFA 3C0RB 3UINB 4AYBG 2HD3A 2MO0A 4C3HH 4KDLB 2PEAA 4H13C 4KN7C 3EA6A 1IW7D 1F2LA 1YIJA 4WWOA 2KC2A 3S9WA 4KKSA 3GO5A 2B39A 4K2LA 4DAVA 2F0DA 5KGUA 4DNRB 2KEDA 5BMHA 2WQYB 4ULLA 4FJYA 4R4CA 4DV2Q 2KN5A 3M4YA 4X65Q 4TQUS 4KN4C 2F0NA 3K7UC 4ZAIA 4JWUC 1YNJC 1XD3B 2K6DB 3Q8BA 2TMPA 4FF4A 1F1HA 5JZEB 3MEHA 1ZOYB 1H9JA 5IP7G 3T1HL 2BT6A 4OZBA 3VRBB 5FJ8H 1L2FA 1SE3A 4DV0L 3NZUA 1K3RA 4OW0A 4J15A 4TMAB 2LKVA 3MHBA 1K51A 2LRWA 2BDNA 4EOYA 3GTKH 5IOIA 2PZUA 5C0XG 1ZW7A 1VQ9A 2KDMA 5C4ZA 1SNPA 3ZNHB 2EY2A 3A74A 5M3FB 3VYTA 4JCVE 2Y5CA 4RCOA 3QA8A 2D3AA 4FN2A 4CYEA 1B4OA 3ULJA 2L8JA 1EUJA 2J0KA 2JA5G 2K05A 3KYDD 1TYGB 3TMEA 3L0OA 4FVMA 1JR0D 3CCVA 1C78A 3BZCA 5E4XA 2FIFA 1WSPA 3FKIH 2NMQA 2SOBA 1SFOB 3KF8B 1LT4D 5AZGA 1TKGA 3C3LA 1WFQA 4LUVA 3SR6A 4JI3L 1K3BC 1GKHA 4I6NB 5IT9c 3HOWH 2RDFA 4XZ4A 1PFDA 4A76A 2JT4B 4GOPB 4YWMA 4BBSH 1Q8IA 4ZRJA 1WJNA 3ZXVA 4IZ8A 3DEOA 4H2AA 1ROEA 3H0GH 2UU9L 3HOYB 4JW0A 1SF0A 1IBXA 3CHBD 4DUYQ 3RFZB 1WXMA 2F0PA 2PPHA 4E74A 2RHQB 3RNFC 5DPTA 1ASZA 4XYQA 2KHJA 2JA8H 1MHXA 2JYOA 1E22A 4GOCA 1I6HH 1YZ6A 1S5CD 2KQSA 1GVPA 2VL6A 2XBBC 3TUOA 1VF5C 2ZCBA 4LFCL 4A3GH 4GLXA 4LNIA 5GAHC 3VYUA 3GOEA 1Q1EA 1KC8C 2D2CC 4TQ0A 2SEBD 5JJKA 2EMSA 3M3JA 3WAMA 1I35A 1M4VA 2MBEA 1S1QB 2N1VA 5GAEC 1MG4A 4ZRPA 4C3JH 3NP8A 1D5XC 5BN5A 1GHJA 2O2VA 3PIO3 2FUG1 1CT1D 3GP7A 4A4IA 4LF6Q 1GUGA 3QWNA 1F9QA 2PNHA 5M9OA 1ILPA 1Y14B 4F8MA 4NJ6A 1AE3A 2GI9A 2N7DA 4ZCKA 3GV3A 2JYTA 3RI7C 2V3SA 4B9WA 3MJWA 5C23A 3U4ZA 4DV4L 3TS0A 3SR1A 4DBGA 3RNUA 1I4HA 2B2YC 2B2WA 3BVZA 2WU5B 1VS0A 3AEGB 2ZTCA 1NR2A 1QOBA 3I73A 5I2YA 1F9SA 1PZJD 3QARA 1KABA 4G3XB 1V49A 3P4PB 2CU1A 3U4EG 1XF5L 3PTFC 1QVFA 1E0ZA 2JEBI 1FNUA 3MTNB 1MPEA 3V3XA 3MFGA 1E8WA 3U58A 4FDBA 4QUCA 5FLMG 3BDOA 4BY1B 1F9PA 3TQYA 2VUMH 3HM3A 1YNXA 2QCPX 4X64L 2KFKB 4C3IG 4M02A 3CXCA 1XNRQ 3ZNZB 4F7ZA 4XDXA 3Q22A 3ZUNA 3A9KA 5JJLA 2KKCA 3DVGX 2WIIB 1W6KA 4PQXA 2UWQA 1QB5D 4IC7B 5IO9A 1L1OB 1UE7A 1DD2A 4DR3Q 2L00B 4A93H 3VXWA 1L6UA 4RG1A 4HEDA 4WRDA 2WX0A 1YJIA 1I50B 2XVSA 3APFA 1TIID 1FCLA 2L05A 2KHWB 4XGAB 1OXVA 2IHEA 1MG8A 1U5KA 4N8FA 3V60A 1H9RA 1HXYD 1SROA 1WX9A 2KNBA 2RCFA 2AQ3B 1JE5A 4K3CA 1WGDA 3X3MA 4MGYE 1KOTA 3L08A 2X38A 4KV6A 4C56C 5JVG3 1PRTB 4BA2I 4IFDJ 4RKLA 1WX8A 1A8VA 2G5DA 1HZ6A 2CU3A 1Q90A 2R92H 2GBJA 3VVWB 2RBMA 2OHFA 2F0KA 4JI5Q 1SJHD 1KRSA 3HM6X 1LM0A 2OJRA 3WALA 3ZGZA 1VQEA 1IPGA 1J7BA 2JP1A 4IOAA 1OGWA 3FAHA 2LGSA 2XRSD 5IN7A 4OIKA 3AEFB 4A3DB 1FRDA 4XXEA 3L16A 3Q24A 3DCGA 5AJ3Q 1I3QB 1D5ZC 3OMCA 3QB3A 3GTJB 2KZRA 2AQ2B 1WGHA 2LHDA 1PFNA 2O6VB 4A3OA 1AE2A 5M3MB 2M9VA 1CA6A 1TWCB 3BU2A 1GUWA 1UF0A 2ZJQA 3C1EA 4JBWA 2ENBA 2PW9A 3H91A 1NSNS 2XIWA 4ANWA 1FO4A 1EYCA 1PDQA 1XPUA 3S1MB 1YX6B 2E74C 1LT5D 3VR5A 2SDFA 3AE7B 4BY7H 4IG7B 2ZW0A 1VMCA 4DR5Q 4JG2A 4DR1L 1R4MI 2LMCA 3VH3B 3ZJTA 1EWHA 4LF4Q 3ERQA 1MJEA 4P71A 4JWSC 4MDKE 2I1JA 3DM3A 4NW2A 5IIFA 1Q3LA 4R8IA 3L0WB 3E9IA 4HK2A 5F2DA 5ISRA 1C9FA 4KIKA 1N5WA 3OJ3A 2WV6D 1K8AC 3FILB 1GB4A 2NVYB 3TREA 3RZDB 3KLSX 2K1BA 3T13A 2CR5A 1EIGA 3BVMA 2KN4A 3AE3B 4RAUC 1V1PA 1XLPA 3HOZB 2MHJA 2QSDA 3RN9C 5IGGA 1C4QA 4HMIA 2V4LA 1FYCA 3MWYW 3CCLA 2EXDA 3PO3G 1YI2A 3HS0C 3OIPA 1U4MA 4PV1C 1GG3A 3P20A 2CKHB 2F0HA 3EIVA 1IYJB 4DGZA 1IXRA 1LTTD 4DR7Q 2WAQG 2ASQA 2N49A 3A4RA 3GTPB 2EMTA 2YVCA 5DLQE 1N33Q 3FPUB 1BBWA 3EFCA 4UHVA 1LXDA 4A3FB 4LCDE 4XDDA 2WLBA 3E9SA 3N30A 4A3DG 2PE6B 4O42A 5DM63 4GGQA 1T0SC 1XLNA 2B2WC 3CSFA 1Y1WB 4M0WA 3J9CA 3JSVB 3MJ5A 4R4IA 1E8XA 1QJOA 1R9TB 4PZ7A 4USAA 4JI4Q 5M3MG 5C4HA 1PV4A 4KI0A 1XMOL 4TUUA 1E9MA 4K3BA 5CORA 4LDTB 3HOXG 1B9MA 3IAM1 2MP2A 2EYPA 1S3SG 1C48A 1JJCB 1RJTA 4AYBE 2C5CA 4POGA 3H3VC 1P3QU 1XQQA 2MBHA 3HVDA 2PCFB 3NBHB 3P1HA 4MEMA 2KQ7A 3K81C 4IPDA 1VQFA 1GM5A 4FXDA 1SMYC 2B8FA 4OXPA 3L4PA 5G55A 3GE8C 2JA6G 1W2BA 1WTXA 1K52A 1DGSA 3N1YC 2UXBQ 2L11A 2WACA 2JY6A 5C4XB 4LLGM 3W1SA 1STHA 4LFAL 2GN5A 5BR8L 3I91A 3APCA 4GDKA 4G7OC 1EFWA 3HKSA 2MWSB 4LDTD 5EAYA 1TT2A 3QWZB 3HOZG 1UH6A 1Y1VH 4OL7A 1HR0W 1GUSA 2QKIC 1VQ7A 4HSPA 4KJOA 4DF7A 1WD0A 4YY3L 3HOUB 2MSED 2C7NB 2IGHA 2KOLA 2DGYA 1I7HA 2IGDA 2Q5WD 3A33B 1V1QA 3VA7A 4WQOB 4BZAA 1HE8A 1WCMH 1W6JA 2KJHB 4CBVA 3A56A 5EPKA 5IWAQ 2D11A 2WXLA 3I57A 2BKFA 2OOBB 2V4DA 3KUPA 1YNTE 3H0GG 4Y7NB 2NVQB 3QCAA 1K8GA 1VQKA 1Q12A 1YNNC 2J7ZA 4M8MA 4DDID 3MTSA 2KMCA 4IWPA 4YSZB 1R4PB 2ZEQA 2JVCA 3I4NG 4EE2A 2FINB 2DHZA 1C4CA 5AUIA 3NELA 4WFN3 3OG5A 4AJYB 2WS3B 2EYMA 3A9JB 2R7ZB 2AQ1B 3CW2C 1J5EL 1VQNA 2PVGC 3DVNV 1XEEA 4MM3A 2NBUA 5E6PA 4A3GG 1QNUA 4ZUIA 3RMHA 2GBMA 1KRHA 3S16B 3HRDD 1RHPA 3SHLA 3PO2H 4IKGA 5D94A 4C1NK 1UE6A 3PRPB 4POFA 4MGZE 2K4KA 3S1RH 4A55A 3TP8A 2LGXA 2NN6G 1TWGB 2BVCA 1UZXB 1QWYA 4LNNA 3RZWC 2N3SA 1K83B 1UWXA 3I3TB 2BKRB 2JA7H 4EUTA 2JQOA 4GKKQ 1YHBA 3CMEA 1ISNA 1IYUA 4JI7L 3W9CB 4CHTB 4IUVA 2H89B 3CPFA 1ZGUB 3ICEA 4R1JA 4NPNA 2PO4A 1VZ8A 1VF7A 3Q69A 5IGEA 2UXCL 1WOCA 4W9DA 1E2ZA 1Z47A 4DR2Q 4B3RL 1FEHA 1IBMQ 1EUVB 5CHWA 3W1YA 3CQZB 1RRBA 3KUCB 3Q3FA 4ZQ3A 2BTEA 3S15H 3WOFA 3O13A 2ZNVC 2W82A 3WCQA 4RGOS 4LF5Q 2R2QA 3BVGA 2KMMA 3DVGY 3C1FA 1NI2A 3PSEB 4RGTA 1BBUA 1JALA 2ZXRA 3VHTC 2XN9C 4DUZQ 2FCMA 3Q3MC 2IYDB 3MZ5A 4JIOU 1I4RA 4BXXG 4NXML 2OEOA 3DWPA 3WA0A 2K9XA 1HNZL 1N36L 3J7AV 1WM3A 5EE1A 2UUBQ 2LXAA 4ZYNA 3K9OB 5IP7H 1PGXA 4R4TA 2B29A 1HNWL 1L0YB 2R7ZG 4M8NA 1BKBA 1STYA 4YCWA 4X3KA 4JI2L 2E76C 5C0XH 3EJIA 3NQIA 4OGQC 5L95C 5IT9E 3K5LA 2A6HC 1EIFA 2KBNA 1YJJA 1JB7A 4U68A 5JXVA 1VD2A 3PZDA 1H9SA 3VQIA 3Q8FA 1ZYRC 2F0IA 2HHHL 2JA5H 3GTLH 1HZBA 2PVOD 3SXHA 4ZRZA 2UXDQ 4OO1I 3Q3OC 1LTGD 4B3TQ 3ENEA 1I4PA 4Z9CB 4B6WA 2X69A 2B63G 1CKNB 3NEMA 3F1ZA 4EGVA 4HJKA 4W9LA 1XTDA 2KHSA 4KD4A 1X1MA 1SE2A 3RR5A 5BMIA 3S2HB 1SB3C 1STBA 4HLEA 4QL5A 1F9JA 4Q0FA 1F52A 2DWQA 2YTVA 3KF6B 4HIDA 2ON8A 1HRJA 4EFOA 4DR6L 4QB4A 3TL5A 5J22A 3AI5A 1S5BD 4PNYA 1GXDC 3I56A 1E8YA 1QOAA 4JX1C 2K8HA 4H44C 1PTOC 1MFWA 5K5PA 1UNSA 2VW9A 1T5EA 3KDFB 4P73A 2K75A 3TDQA 2E8GA 2BS3B 2JRHA 3AXCA 2QF7A 1KIXA 3RLOA 5DM73 3DHGC 3N32A 3AU5A 3KLRA 1AZQA 5C3WA 4A3CG 1XJVA 3QJZA 3SFDB 3SE0A 1WVLA 2LRUA 4IUNA 3P7JA 5JH5C 2DZMA 4KK7A 2VRRB 1TWAB 5IA7A 2ONQA 5CMDA 1CFMA 2IX1A 1EOVA 3H6MA 4ANVA 1WE6A 4WH4A 5I6WA 5LXIB 4JOIA 1L4ZB 5I9PA 2H4OA 5A2QE 3T3OA 4H7BA 4DK6C 1PH5A 4K14A 2I5HA 4HCPB 1ENCA 3Q2AC 2WDRB 3AMZA 4NAWA 4J6IA 3CCUA 3NPPA 1NR4A 2QMTA 5EJWA 4Q5VA 3TEXA 2CQAA 1YX5B 2LD9A 4YTPB 1TWFH 4EX5A 1V81A 5LHY1 4JVZA 3K80C 3LWUA 4JI3Q 1Q7YC 2F4VQ 4CJ1B 1L0WA 2YEPF 2EQSA 5DPWA 2HUGA 2NZHA 3AU4A 1FNVA 3E9HA 4L5TA 4YIJA 2R93B 1GC6A 4DV3L 3NSWA 3TRZA 1SFOH 1OEYA 3GZNB 3KWLA 2O2LD 2M17A 1SJED 3BDCA 4BBRB 4RGMA 3OIQA 3K5MA 3OOCA 2F0FA 2E2IH 1RLFA 2WDQB 3V05A 4I65A 2M56B 3Q6SA 1GHKA 4HJ9A 4RHSA 5IKCM 1SYFA 4BVUC 5FLMH 3N20C 3TZUA 4YCVA 3V61A 2BE5C 4C3IH 4II2B 5I6YA 4MSQB 2LVPA 1WFYA 2H1EA 2WHIA 1HA5A 4MJSB 1VMPA 3R7RA 1IBLQ 4NDXA 4N59A 4CDCC 1V5OA 2PLPA 5C44B 4IOCA 5ELCA 3SK4A 1A0IA 1N32Q 3PMFA 3P1MA 1WTQA 3ZQ4A 2WYQA 5D3DA 1JQYD 2L5TA 4HCNB 4MSMB 2ICIA 1SMXA 4HDQA 3AU7A 3LGJA 4N9PA 2IT1A 2DJFC 3ZO5B 2ZM6L 2EYHA 5ELFA 2A6ED 3NHEB 2HCIA 1QOGA 2C7MB 3H9DA 2C9WB 1YITA 4P7IA 1WTWA 1SGHA 1TIFA 2XGTA 3S2DB 1A6XA 1B53A 4RCNA 1B44D 1EY0A 1LV9A 4XTCS 5M5WH 1YJWA 4L5RC 4FF3A 2L32A 2N88A 4GOPA 1E90A 1D5MC 2ZVNA 4EZLA 1C7YA 5EKLA 4K5VA 5E6NA 4C00A 4WURA 4DV6Q 4AIMA 1DONA 2BPSA 3PO0A 1OO9B 4B3SL 4PS3A 2DX5B 1QOHA 4TV3A 4LF8L 2QW7A 4LF9Q 4K2KA 1D1KA 2MA9B 4D2KA 5NUCA 2M19A 3FHWA 3VDYA 1AZPA 1TWHB 4IUQA 1A15A 2Z6KA 2RGFA 3N1ZC 1DOIA 4QCLA 3OJ4B 1HUNA 4QIWE 3WWVA 1BUVT 1J19A 1LTLA 3K0XA 3B9JA 3NVZA 3IRBA 3P2BA 3DM1A 4W9IA 1JRPA 2KANA 4F7XA 4YHHQ 2GA4B 2JWZA 4XT1B 4AH6A 1F2YA 4J8QA 1BCPB 3P63A 4IPHA 1NBFC 5LNK1 3NWSA 1CHPD 1H9KA 1I94Q 2QEJC 3S14B 2IO0B 2L4NA 2N8NA 1G6PA 4ICUA 3B1LX 2EE1A 5M5YB 1C8CA 3CRKC 3KLWA 4ZKCB 2ATWA 1U4LA 3ULLA 2CH4W 4IQZA 2EKIA 5GQOA 1WXQA 4II3B 4U673 5M5XB 1S72A 4R8NA 5CYUA 4X3TA 4DAYB 1FJGL 1WZ0A 3KLSA 1TR5A 1T0YA 4DXFA 2QGQA 3MXNA 2FAZA 3NRZA 4OZCA 4ZOHC 1T5XD 1DXMA 2B2YA 4A3JB 4BWGB 2QEXA 3EHVA 3NE5B 2NYZD 1PYWD 4GNXC 1WF9A 3I5JC 2L0CA 1KRTA 2VQFQ 4JOIC 3VUYA 3WIMA 4HIKA 2K03A 3PO3H 2DNEA 1I4QA 1B9NA 3J80L 4GKJQ 1N62A 3Q8CA 3T4AC 4X6AH 2CHBD 2HCCA 2WU2B 3AEDB 4NNJB 1D3ZA 1HZ9A 2WX1A 2Z4HA 2FFKB 2Q2UA 4LFBQ 2OQ0A 3S1NH 2KFKA 3M9BA 4EQPA 5AFWA 1VRAB 4HVBA 3AULA 3NZ3A 1OQRA 1JJGA 2KX0A 3NENA 2HTHA 2N9XA 2MEKA 2N7EA 2GBNA 3EC8A 4A3DH 1F0ZA 2Z59B 2D0OA 2ZT9C 2QC8A 1L1OA 5CV9A 3UDGA 1QUQB 3Q6BA 2Z9HA 2REXA 1RWSA 3NHHA 3TBLD 1X3PA 3M4QA 2VNUD 5M3MH 4HN7A 3KUZA 4A3EB 4DV7L 1TWCH 2DYMA 5FKAC 1JC7A 2Q2TA 2C60A 3TEWA 3HOXH 3H09A 1Q10A 1NMFA 3AE1B 3I9V1 4L2YA 4OZAA 3S1MH 2KVMA 1C77A 3PZ7A 4B95A 2CCZA 2D10A 1ICWA 4AS1A 2G4SA 2MJEA 4WQMA 3HOVB 1E1TA 4J3OD 2VQEL 1F77A 1V1OA 2AL3A 2UYZB 4DAMA 5LL6S 1VQ8A 1K8RB 1TU2B 1UD7A 4WJQA 2JA6H 1GUOA 3JYUA 1JCKB 3E0EA 1M1KC 4LNFA 3V6EB 5FLXL 4JI8L 1EQQA 4KVGB 4A3KB 1CQFA 4YWKA 3PUWA 4IN3A 2IZVB 3QQ8B 3IAS1 3TBIB 3MP9A 2D3BA 1RAXA 3U52E 2EYLA 3TEZA 1PH2A 3LDZE 1HFNA 1SRUA 3R2TA 4A3BG 1PH6A 4DV1L 3HOZH 1A70A 3B2FA 1PZKD 4LAAA 4KHVA 2O6VA 5J18A 1UELA 4IFDI 4KHPQ 4RNAA 2FHTA 1E2WA 1VR9A 2K01A 4GOPC 2DLBA 4XE0A 3E0JA 2AKWB 3AE9B 1CSQA 2JYEA 5BN4A 2GRIA 4KGTA 2LGIA 2MH7A 3R8BA 3PF5A 3OSOA 3PHWB 3K6OA 1CZWA 4A3FH 2OJWA 4YL8A 1WRIA 1CKMA 2KD0A 2OTJA 1LM8B 4OX9L 2H5XA 3PUVA 3Q3JA 4HJGE 3U30A 4HAEA 1L0XB 4NJ7A 1N9WA 4FJVB 4JI6Q 4BA1I 2BBCA 4IM2A 1YNJD 5LMNQ 2M1MA 4MN3A 1IBKQ 3UDXA 4ARIA 1Z7TA 2Z6KC 2VXWA 3I4NH 1RFAA 5BYQA 1IYFA 3FILA 1RTOA 2UUAQ 5IGCA 1ZDVA 1NCVA 2FXQA 1EFID 1TTNA 2FUHB 2KWDA 2EELA 1WE7A 1V9JA 2K5QA 3ITPA 1G51A 1MHHE 3PUXA 2D5DA 2A74C 5KYLA 4EQOA 1V9PA 4EVOA 3DBRB 2NTSA 3AM9A 1STEA 4HEA1 1WX7A 3H3VH 2YU9H 4GXBA 1P1AA 4M00A 2E3TA 2SNMA 1JOKA 3I4MB 1Q81C 4IJHA 4A3IB 2J53A 2NN6H 1GO3E 4A3KG 1EYDA 1IKMA 4L63B 4GN5A 4IPCA 1T0RC 3PLVA 4ODGA 3RYTA 3J7ZC 5M3FG 2GMIC 2KDBA 2CS4A 2E5LL 2UUCL 3NS8A 4JI1L 4KTAA 2E2HH 3K9PB 1FFVA 5JEAJ 4LNKA 2BOSA 3VR3A 2KVRA 4MGKE 3JSVA 1RF2D 2A5HA 5LMUQ 2Y5PA 4BFRA 3D6CA 4NJCA 4X62L 3RUIB 3A7LA 3OTOL 3UIOB 1PRTF 1JB3A 5JOBA 5JVH3 4N9F4 4N9TA 2B2UC 3RT3B 2KDIA 1IUEA 3M7NA 2Y0SE 3MC0B 4K0KL 3TEYA 4XYOA 2DYBA 3K7AH 3QG1A 1GAQB 4C2MB 2DZJA 2CH4A 2EJFC 3NBHA 1PH4A 4HXDA 5DCNA 2WWZA 2N78A 4HROA 4DXGA 5C4JB 4QY7A 2MHVA 3S1QH 2PE9A 4Y7NH 1V97A 2G45B 4BXXH 5ELOA 3HOYG 4ALPA 2W3SA 1VLBA 4FHJA 1BUIC 1B70B 3P4RB 4AJWA 3VYRA 3C8YA 4NB3A 1E3PA 5D65A 1HTLD 1L1OC 5L37A 4DAPA 2CW0D 3HGBA 3NTIA 4JPSA 2INDC 5H8YE 2F0QA 1E1OA 3M7GA 1JWUD 1IGDA 2R7ZH 1FD7D 1KHIA 1YN4A 3AFQA 2A19A 1I4XA 3SVMA 1WRDB 2RMMA 2BCOA 4JI0Q 2N1WA 1EY4A 3RZOB 4FA6A 3NK9A 1S5DD 2XSCA 1HR0L 1J7AA 2WXNA 1EY8A 3K0YA 1PRTC 1HZ5A 4A3IG 4B3MQ 1K9MC 3AQQA 1RL2A 2NPTB 1AP0A 3GZNI 2F0OA 4GN1A 1K50A 4S0RA 2K28A 1C0AA 1MHWC 2ZTEA 4QAYA 5JHAA 2B63H 4B3RQ 2X8XX 2P5ZX 1E2VA 4NAMA 5E6OA 3W1BA 3ZDMC 1UEBA 1S4ZA 3ALBA 1QQRA 5T8IA 4FXGC 3CMAA 1P7EA 2INPE 1EIYB 1EQVA 5G5HA 3DBHB 4OO1G 4IM0A 1ZXIA 4IUPA 3TJPA 4R3DA 3C19A 3A9JA 3KOJA 4JGHB 2JX5A 4IFDH 2FE8A 5IODA 5L83A 4AQ7A 1HTQA 5K36G 2W54A 3G4SA 1HNZQ 2IO3B 1N36Q 2KK8A 4UPAA 3E5SA 2EJMA 4DR4Q 3AMUA 3S17H 4PG3A 4HRSA 4WJ4A 3N6RA 1PA6A 3GB1A 3AE2B 4LK0M 2Q2IA 2F03A 4BY1G 2MW5A 4GLAC 3K5OA 3PSIA 1K0SA 4C3HB 2PNRC 1GOZA 4A3CH 3MXUA 2EY1A 3I4OA 1VQIA 3HUIA 2DNFA 1V5TA 2HJ1A 4ZK9B 3P4QB 1E24A 3D4WA 5IGFA 3HKZB 2L1BA 1HH2P 3KYCD 1DOYA 2LVQA 2WP8J 5JJZA 4EZKA 1HQRD 2G9DA 1MJDA 1DGJA 3W5UB 1VQ4A 4ZRQA 3KUDB 1E10A 1FRRA 2NZOA 2JE6I 3PVLA 2DENB 2MP1A 4WJPA 4DHZE 1Q46A 1QNKA 1D1IA 4NMZA 4MELA 5FO8B 4MIUA 3UE1A 1A3VA 3CCJA 3QO2A 3EROA 3PGZA 1P0RA 2WB1E 2INCC 3ML9A 4K6LA 1V2YA 4DV2L 4ZHOA 4L6TB 1R4NB 4G50A 2Z8LA 3GTKB 1WGRA 4GLVB 2XK5B 1EYGA 5T1IA 1S3OA 1KNEA 1PYBA 1EQTA 3QC8B 1PXUA 4C4VA 3ERSX 2A69D 1HNXQ 1SE9A 2PTLA 3T53B 3ZJVA 3JAMi 4DK3C 1KQSA 1XCTL 4PMCA 2K04A 5FO9B 4HIMA 4I7ZC 1K53A 4FNFA 4EZJA 4A3PA 4I6PA 2KACA 2K5NA 2KJRA 3ND9A 1NTGA 2K25A 1SYCA 3E56A 3Q3NC 3J80i 1XX8A 1ZDXA 4BKSD 3FKIB 3E3XA 1LTRD 1TKWB 2O4XA 2XRQD 1SNQA 1A2UA 3ZJUA 1PTOH 1EYAA 1FXTB 2O2VB 3FC4A 4CO7A 5J17A 3IVFA 1XPOA 2C9OA 4X66Q 4JV5Q 1UAPA 4YSYB 2K14A 4BBSB 1QVCA 3EUB2 4NQKE 4K8IA 1N34Q 4OHJA 1JICA 2WXGA 5BYSA 2QDFA 2IHFA 1CKNA 2ZW1A 4LTUA 3MAQA 2K5PA 3STBD 2AUJD 4FXCA 2XWJB 2J0TD 3U4VA 2M8SA 3QIAA 1ENAA 1DZ1A 3HIZA 2JA8B 1SDFA 4ID6A 5LL6X 3BG3A 1WXSA 4WWNA 4IALA 4NP5A 3K58A 1VQJA 1S40A 2Q8TA 3I8ZA 2R6GA 4DUYL 1XNQQ 1M8AA 1WI5A 1WGYA 3PIPA 1LQBA 3JC66 4XDCA 2QIEB 3A5UA 2BDOA 5D3IB 1E7UA 3A8IE 4IWOA 2KMAA 1D6EC 3KDFA 3ECIA 3X3NA 3SK8A 4C3JB 2Z1CA 3EVQA 4K5WA 1C79A 4P2CB 1UUPA 5C5MA 1ZXHA 2BYEA 2EKEC 2WXRA 4GZYC 3PPAA 1RTNA 3A9KB 1PGBA 1CUKA 4V0BA 2BYFA 4O1NA 5C1ZA 2BA1A 5E3FA 1TKEA 3AFPA 5I9OA 2F0WA 2Q8RE 4A3FG 4JL9A 1EO6A 4AOFA 1F2ZA 1GUNA 5FK9C 2I46A 4EQNA 2PQAB 1Y1WG 2HDMA 3QOLA 4RA8A 4LF6L 1V86A 1X32A 2IPKD 2MNAA 5BO4B 3TS2A 1PDXA 1LACA 1AWDA 2JXMB 4BOSC 5HG2A 2RSUA 5E6JA 2K5DA 3HEJA 1SMYD 2ZM6Q 2HDEA 1A5RA 2RDGA 3TP6A 2NUCA 4S3SA 4RF0A 3QOJA 4JYAQ 1MSHA 5FO7B 2MJ8A 4KJNA 4QMGA 4QF4A 1VQOA 2BH2A 4YTNB 4KSLC 2JQRB 1H8CA 2EXZA 1ASYA 3MXGA 2KEEA 3UQAA 3M4OH 1LLRD 2VUMB 4HMJA 2KHIA 2V9HA 5IGDA 1O80A 4ZHPA 3S2AA 4R4QA 4WORA 5FR6A 2HJ8A 1X3EA 5C4XG 4DN4M 1MJCA 3ZIMA 5KIXA 5CBAE 3BYYB 1DJRD 2MPMA 1XNRL 4HKZE 3GTOB 3NG0A 4FYDA 2BGFA 3UE0A 4A3MB 1PHJA 1YQ3B 3KBGA 2Y3AA 1J6QA 1XMQQ 4LF7Q 1X6OA 1DOXA 3T1YQ 1F2RI 3DHIC 4DR3L 3QAQA 2CQOA 3HOUG 5JPMC 4XT3B 4G7HC 3J7A5 2FNJB 5AZHA 4NPSA 4A75A 3H7PB 4TSSA 1WTHA 3I2ZA 1SE4A 1MBYA 4B9KA 3KBXA 3PS6A 2K22A 5JEAG 1TS4A 2R92B 3RNEC 2JN4A 3RPFC 1A63A 2GBKA 2AUKA 1YD8U 4W9HA 1RIPA 3CF6E 4DV5L 1SNOA 3VUWA 1HQMC 1RDPD 5GXGB 1WTRA 2Z6BA 3J81L 1NMGA 2G3QB 3S14H 1RKNA 3DBRI 3NWTA 2HIVA 2K52A 4W9FA 2K5VA 3CIRB 4XWWA 1PTOF 3AE5B 1FGBD 4JI5L 2J52A 1KM7A 2LJIA 1B9RA 4RGNA 3UDIA 3KVFB 2JUOA 2Y5BB 2R2OA 5CR3A 5G3LF 2MJ3A 3SDZA 3VYSA 2NR2A 1WZ3A 1N61A 4IPGA 3VDZA 3WAOA 4GLSC 2MQHA 2BS4B 1CK1A 5AJ3L 3CWIA 5D7GA 2KWCA 3DQVA 4B08A 1JWMD 5HKHA 4BY7B 2E75C 3D31A 2D3GA 4A3BH 3SD5A 1SN8A 3ZTDA 3NS1A 2LUEA 4PMWA 2NVXH 3ZW3A 4HPLB 4LUZA 3RNAC 2HTME 4UP9A 1WR6E 3GTQH 4KY5A 4M0WB 1P9DU 1CQVA 2YYZA 5D2MB 2NWGA 4LMQD 1AARA 1AYFA 2O5IC 2MGSA 1TT5B 4L23A 4OVVA 4LK1C 4DR5L 1VJKA 4A3MG 2KTFA 3ZNGC 3NVWA 3J80c 4US8A 4LF4L 3FVQA 1PYSB 3EBEA 4FP5D 2KQ3A 5E4WC 3MXPA 2V4IB 4LUOA 1XLQA 5LMNW 3H15A 3K59A 3DLLA 3W5OA 3FDTA 1II3A 1NJIC 4QJFA 1FIQA 1KF6B 3HHMA 2WXMA 4WAFA 1NYQA 2D0PA 4IFDG 3G48A 5JJIA 3DBLB 4K1RB 2N55A 1Z6HA 2RD0A 2D07B 2MBOA 4DAYA 5IYDG 3T1HQ 4HCSA 4NQLB 3UIPB 4G57A 4DV0Q 3JVZX 4A3EH 1OQQA 1AEXA 3F2CA 1M90C 4IUTA 1EZ8A 1MD2D 1YMHE 4DHJD 3B0AA 2K5HA 1AN8A 3A4SC 4GDKB 2PYKA 4W9GA 5E7NA 1WTVA 1V8QA 3B6YA 2RQXA 2JPHA 4DR7L 2JSVX 1P7FA 3NJTA 2L83A 1NY4A 4RHRA 3KWVA 2HDLA 4GNXA 2OTLA 3L54A 3OHXC 4C7ZA 3NQTA 1YBYA 1N33L 5KRUA 4HJ5A 1Y56A 2RPVA 1N8RC 2KC1A 2QA4A 1B7YB 1M94A 3A1QA 3TP5A 4BAXA 1SYBA 2EY5A 1NYRA 1EWCA 1MSGA 2F3WA 4A3KH 3RCZA 3WAPA 2KECA 3SGIA 4DK5A 1WTPA 3GTGB 2K6AA 3BZDB 1EM7A 1V6EA 2UU7A 2KQ4X 5FLXc 5M3FH 3H8HA 4M8AA 4P1CC 4ZKBB 1WM2A 2MCNB 1ILQA 1NBWA 2DUDA 1DYQA 1CZPA 4JI4L 2FCNA 4E71A 3M3YB 2WXQA 4W9EA 2FMCA 3SK5A 2N0SB 3L9AX 3DBHI 4AUQC 3KQ4A 3X23A 3L7ZC 4L5QA 4XQQA 1VZ7A 1PQSA 2YV5A 1L6VA 2FBWB 3T3NA 2JU6X 1UBQA 4DA2A 1JQ4A 1HFGA 4HSVA 1UGMA 2AYOB 1RODA 2UU9Q 3AV8A 1KDBA 1YHQA 2QDLA 1EOTA 1PLFA 5C3XA 3ZXRA 3KYHC 5LLIA 3OPOA 2A6EC 5I2XA 3RD4A 4DQOC 3QJYA 1F9RA 5IGBA 2BYVE 3OWEB 2UXBL 2AMCB 3SHQA 2ZXPA 4AQYL 1Y1VB 2WP9B 1SYDA 1HUMA 5EQ0A 2IGGA 1ESRA 3HOYH 3TCAA 2RHSB 1HZAA 2K3UA 4LFCQ 4URKA 5C3EB 1D4BA 5CV5A 2AHOB 1TZ1A 2WAQE 4MGIE 3UQBA 2EY6A 1JOOA 3LWEA 3NBIA 2JJQA 3ZRCA 1PFMA 1BCPF 5KNCA 3D8GA 1WCMB 3LJ3A 2K8BA 3U7ZA 3W1GA 3HG9A 1EY6A 2GVBA 1VQ5A 2LFIA 2N9KA 1G6ZA 3ER0A 2HT1A 1LT3D 1QLBB 4DHZB 2KCMA 3KF8A 5CHFA 5HFYA 4GDLB 3M4PA 1V80A 1WMHB 3N9YC 5IWAL 3I4MH 1D7QA 2QHOA 4A3IH 2ZPNA 3DVNU 2WB1B 1R4NI 3KFUA 1T0QC 4DV4Q 4OONA 2X6GA 1PFBA 2NTTA 2PMZE 3OTOQ 3M63B 1LTBD 1YJ9A 1VQLA 2PI2A 5G5GA 4G4KA 1FR3A 5TR5A 2CWAA 1G291 1KJTA 2I07B 3HFZB 1E7VA 1GJXA 3IHPC 3GD7A 1LGRA 1UE1A 4I7AA 4QUFA 1STAA 2RKSA 5KEEA 3S1RB 1X3QA 2JWUA 4OO1H 3D32A 4M01A 4ILWA 5HI1A 5KNBA 5J3BA 1TS2A 2R93G 1HJPA 2IX3A 3RN2A 2JXTA 2JA7B 3I3CA 1OFFA 4DDGD 4X64Q 3IFDA 4BBRG 4MT5A 4BOZB 5K36H 2FCQA 2OQKA 2KDFB 1EWYC 1BCPC 3BWUD 2L55A 3GDEA 2F4IA 2ZCCA 5JHBA 2ZJPA 2QILA 1L2NA 4REZA 4UAIA 2A68C 5C4JH 4Y52H 4ANXA 4BY1H 5DPRA 4AYBB 1AFPA 1VQGA 2LY7A 4GKKL 2FMMA 4V190 1B50A 3VR4A 2RDBC 3VTUA 2F3IA 3I70A 4JE3B 2F0LA 1BXTA 1EIHA 2AX5A 5C3EG 1QZGA 1CZGA 3WDNA 1IYVA 3S15B 2JK8A 3LNNA 3UDFA 4L5SA 4HJ8A 5E1FA 5C44G 2JSOA 3I7FA 2MBQA 4ITKA 5CV8A 3Q8EA 2V1CC 5ELDA 4X3SA 5CGKA 2L15A 2DBYA 4DR2L 1B2TA 1IBML 2HIXA 3PRZA 1TS3A 3MHSD 1IW7C 3T16A 3IBEA 2LXKA 1DOKA 4K8JA 5C5LA 3CMMB 3GE3C 1I50H 3AH7A 3JAML 4N8X1 3Q23A 4GU2A 4JQWC 2OXPA 2LVOA 2A8VA 3RZOH 1UE5A 4LF5L 2A5UA 3WOEA 1IL8A 1B3AA 4C80A 1VQHA 4DUZL 2WKCA 1Y8PB 2B2UA 4KD3A 3NZSA 4JC0A 4HIOA 3Q0AA 1BO0A 4TVAB 1YN3A 5BYRA 2HE7A 1GC7A 3BINA 3FKYA 1ENFA 2UUBL 2NBVB 3IG3A 3D0FA 4OVUA 3HK0A 2J0MA 1ET6A 4IURA 3F8TA 1SSNA 1VQCA 1UWVA 3L13A 4KKUA 1K28A 1FM0D 2AL6A 4EKUA 3VAWA 3ZDTA 1QCBD 2JA5B 4DK1A 3GTLB 1GUAB 1GUTA 2F0GA 5TSSA 4ME3A 1ZP0B 1XCQL 2IJ0A 1I3QH 3FP9A 3GTJH 1WJ6A 4MZ9A 4PS8A 2I0QA 1JROA 2D2QA 4KY6A 1FMAD 3TMPB 1CHQD 3NVVA 4C1NI 2BB6A 1B8AA 4DR1Q 1N6ZA 4UDUC 3R2IA 4KY7A 2DYOA 4IWQA 1ZPSA 4X57B 1X9NA 2LI5A 2UXDL 3PIOA 1P98A 5EBDA 1I6VC 4NAWB 4B3TL 1ESFA 4JK1C 1T6BX 1ONLA 3LB8C 2M0AA 5IYCH 4MHEA 3G6EA 2NPTA 4W9JA 1L5PA 2BB5A 1E7ZA 4FULA 4IO9A 2LSSA 3EFXD 1NVID 3KJPA 4L1BA 2CJNA 2K7VA 5G2NA 1RCVD 2OWOA 3MA2B 1QZEA 1KLVA 2RCNA 2WINB 3J81i 3D4RA 1VQMA 3OW2A 2F0SA 2NVYH 1WY8A 3RZDH 1JWBD 5IP9G 4P75A 5ELEA 1DM0B 2Z4IA 4A3JG 1H4RA 5H92C 2LASA 3IFWB 4DWFA 1WXVA 4ZRIA 1OXXK 4GS3A 3QR8A 2KOXA 3RNCC 3GTMB 2F52A 2OT2A 2E6XA 4K7SA 2ZZPB 4GN4B 2DZIA 3NOBA 2VB2X 1TBEA 3AEVA 3H6NA 1E6EB 2LJ5A 2Z0DB 3GTPH 3U2SC 1LABA 1Q82C 1WXAA 2L1AA 3OWFA 3CCEA 3NUHB 1YOVB 3G6JB 1F2RC 1TWFB 2RVLA 2ZTDA 3P42A 2KA7A 3SU8X 1Y8OB 3DPDA 1XMOQ 4J6HA 1EU4A 4EQ5A 3BIID 1Y1WH 1I4GA 4WJWA 4WJ3M 1NUCA 1R9TH 3AB9A 4KKJA 3M85A 1ZKHA 4A3EG 4P74A 4LWCA 3SK6A 1G91A 2QCZA 3DOWA 3PF4A 2MFIA 2F4VL 1SYGA 2X6LA 2E2IB 2XEWA 4YWGG 2QDBA 5LXHA 3AYHB 4CKEA 2RF4A 5J2RA 3PREA 4BKSA 5BN3A 4YXDB 2B3GA 3UF8A 4LFAQ 2NVTB 3HOVG 1DOMA 5I4DA 5CX3A 1VQAA 5BR8Q 2QJLA 1RD9D 4C3IB 5HGQA 2XK5A 4KZ0A 3KJOA 1BNZA 4HR7B 3I55A 2XTIA 3B2GA 3T8MA 1CM9A 1U0LA 4JBKA 2PKOA 5C4XH 4NXNL 4ZRKA 3W2DA 2CVRA 3VA5A 1PGAA 2L7RA 2F0EA 1EF5A 3CCQA 2ZXOA 1C9OA 2RSOA 2E2JB 2BWES 4YY3Q 2J4XA 2WXKA 1YQ4B 2CWPA 4QGUA 2XNAC 3URYA 2WXJA 4KKTA 1IBLL 3B08A 3IKJA 4DNIA 2CW0C 5KNDA 3BK1A 4A3LG 2BH8A 1N32L 1JWSD 5CHVC 1TQOA 2GVAA 1JW9D 3HOUH 2K0PA 3DBLI 5M5WB 1T3QA 1WGGA 4W9KA 3VUXA 4ZDVA 4KSKC 2KTRB 3V62A 2I1KA 2B3AA 5JEAH 3L17A 4K7UA 3X0WA 1EY9A 2DNCA 2O5JC 1YEZA 3FRPB 2NVQH 4RMFA 1IGCA 1QT9A 2B76B 1GB1A 1BR9A 1J5EQ 5C3JB 4UP7A 1WWTA 2KJ6A 2V3NA 1QE6A 3MXNB 1SSOA 3JAME 2LGYA 1O7ZA 2J0JA 1BVSA 3CC7A 1LO5D 1PZID 3BJUA 4DV6L 3L10B 2LXJA 1PH7A 5JAVA 5DNFA 1BF4A 5GMVA 2F0VA 2IL8A 3PV0A 1O7LA 4LF9L 2PZWA 2BWFA 4FBJB 2B2TA 3AEBB 3F2DA 3J80E 3P75A 3ONAB 5FR3A 3S16H 4ARCA 1WYDA 2VB3X 4JI7Q 4R9WA 1X3FA 3DBSA 1VZ6A 4XX5A 3I4MG 2JXXA 4XIGS 2SNSA 3ND8A 1TWGH 4LJOB 4YHHL 1LUZA 4GIVA 1Z2MA 1A2TA 1K83H 4CDFC 2UXCQ 4ABNA 2IY0B 1S5FD 1I94L 4DFAA 4DK0A 3ZLZA 1FFUA 1MGSA 2XWBB 3GTOH 4JBJA 4J1MA 2VH2A 3BZKA 3HRZC 4CKCA 3PCOB 2PQAA 1Q86C 4A3MH 3CF5A 3APDA 4RF1A 2I38A 1PH3A 1KLUD 1BT0A 2G9HD 1AH9A 2PMVA 3CQZH 3PUZA 5C2TB 2R7FA 4IUMB 4DV5Q 1ML0D 1CA5A 4ZYSA 3PO3B 2B2VA 1ZKOA 4NXMQ 4G11A 4FF1A 1BOSA 2L76A 2L0FA 4B0EA 3OAWA 1C76A 3QX1A 1WI0A 1C3TA 2WAQB 4O2DA 5IYDH 1KD1C 4IM3A 3S1NB 1JWAD 3ZKJC 2FCSA 4ACFA 3A8JE 4PS7A 1KXLA 4TKOB 5FLXE 2VQFL 1HNWQ 5EKIA 1RYJA 5ELBA 2DAJA 4DPGA 1I5FA 1JOQA 4I6LB 4JI2Q 4AWJA 3ZNID 2ALYB 4GKJL 4TKNA 3T56B 2MBBB 2LFNA 2Z0EB 1XWEA 3PGEA 1YQBA 5DPSA 2A69C 4LFBL 3J81c 1Q1OA 1QZHA 3CC4A 4LW1A 3J7YW 4DXAB 3CC2A 3VR8B 2EYOA 4NZLB 1PRTD 2HHHQ 4F88A 2NCNA 1HPCA 2R3ZA 3GQBA 1OQYA 3I72A 4APVA 1UBIA 1NEKB 4W9CA 2RPQA 5EE3A 4X3UA 3HOXB 2PMZB 1KNAA 1A3TA 2K32A 4A20A 3IAYA 4N6EB 3CSTA 3H7PA 3G71A 3K8AA 1UEAB 2D5GA 1U4AA 3GS2A
chains in the Genus database with same CATH topology
3AB5A 3RUZA 1FD6A 1PUTA 2JA6B 4XWTA 1IBXB 1HTPA 1KDAA 1IKLA 3CKIB 4QIWB 4K6DA 1SAPA 3AN1A 1STNA 1HEZE 1U4PA 1QG7A 1YN5A 3T51B 1H9MA 1J8IA 5IT9L 2K5WA 3UI3A 2WXIA 2D9UA 2LS01 3D6WA 3IL8A 1XYIA 3HOWB 2R61A 4FF2A 5EKKA 4C3HG 1WGKA 3K57A 5EE0A 1FXIA 3H0GB 1OXUA 3DWQA 3DEPA 3U9OA 5DEHA 1GPXA 1EY7A 2EOTA 3I4NB 3IT6B 3LYYA 1BDOA 3TP7A 3D4DA 5CBEE 2KCCA 4P16A 4Q2JA 2N9LA 2L52A 3A8KE 5C0XI 1QOFA 2B2TC 4K5XA 2BS2B 4A3GB 3MVVA 2OEDA 1RFKA 1WYGA 2KJXA 2YU9B 5HHDG 3HZXA 3VR2A 1C4PA 3D3RA 3BS1A 2EYFA 1EZ6A 1PMRA 3IXSA 3Q8AA 5HURA 1NAPA 5CC4A 2WNMA 4RWSC 1SNMA 5BMGA 2LEKA 3FPPA 3NVYA 2BYTA 2E2HB 2PQEA 5AUKA 1SIJA 5COYA 5A2QL 1N63A 3K5NA 1TY0A 1ZUD2 1V43A 4CQNA 1C4AA 4H0LC 2CJOA 2B2VC 4HCEA 4TQ1A 2EVBA 3K7AB 5EE9A 1ZEQX 4A9AA 2BW2A 2WXHA 3AEEB 1TJEA 2W3RA 3OW7A 2F0JA 5HGTA 3S1QB 4DNTB 1MVKA 1HHVA 3I4LA 1SNDA 2AWNA 2RA4A 4PT5A 3IT4B 2PPBC 2SAKA 4RKBA 4A93B 3PZ8A 3A7AB 1TY2A 1KH0A 4WWMA 4OIJA 2VZKB 2WXPA 1FCCC 4C3JG 3R93A 1R7SA 4FXKC 4KHZA 1SNCA 1D2BA 4G7ZC 4HKQA 1YNND 4XQNA 3EGRA 2LMCB 2INNE 2B63B 1VCIA 1QF6A 4CKBA 1EY5A 2FJ2A 3DXJC 4ME5A 1NI3A 1Y69U 1WTOA 3L3OC 3DUZA 3FEWX 2VZKD 4DU9A 2AWOA 1V1PB 3DWAA 1JE4A 2M00A 1FXAA 2ID0A 1LTID 3PIP3 1EU3A 1CJEA 2JZPA 3S17B 1NENB 3VRAB 1RM6C 2RSNA 4CJ0B 5C0XJ 2E2DC 1OXTA 1QKZA 2PZTA 3NTKA 2IX0A 4IOIE 2K33A 1DCZA 3RLFA 3LXFA 4TRDA 5MPOA 3NUCA 1HCZA 4BS9A 1J7CA 2WKDA 4LJZC 4MH8A 4ZLTF 2Y0SB 1F2MA 1XLOA 2H88B 2F1MA 5JPNC 3R3OA 2B8GA 3OMGA 3ZYYX 2MUYA 1J9OA 1TVXA 1LTAD 4L8JA 4A90A 5EGTA 4YT0B 3DWMA 1CI3M 1OXSC 3MFYA 1ACCA 3C2PA 1L0VB 1QILA 1MI2A 2WXOA 3CRLC 3AECB 1EEFD 3V96A 3I90A 2JEAI 4DQOC 1FNWA 1UWMA 1S5ED 3DWGC 3W5VB 1JMLA 2F3VA 5EBCA 2A6HD 3KK7A 3IFTA 1N60A 2L9HA 1B1ZA 5J1ZA 1ZYRD 3PUYA 1PTOB 4YTMB 1STGA 2EPBA 2KAJA 2PW7A 3DHQA 3F2UA 2BA0A 3HVZA 5IOCA 1ET9A 1BBXC 3H94A 1LT6D 3C46A 1XXGA 4KMUC 3AE6B 4KKIA 4A8XC 2NZ1D 4ZUJA 2KCNA 1BMLC 4B0MA 3VR6A 2EYJA 3HP3A 3E6ZX 1PTOD 4KGSA 2DN8A 1WD1A 3BK2A 2L12A 1N5XA 4A6QA 4XQJA 4FO2A 4MM3B 3A54A 5DAUA 5G3LD 1UGJA 3DMUA 4HTHA 3TSSA 3U9SA 3SFEB 2J42A 4E6IA 2HQEA 2GB1A 2DY7A 1Q1BA 2NB0A 1JORA 3CU7A 2EZVA 1SBBB 1U4RA 1E7PB 4YSXB 4IDIA 2RDHA 3AE4B 4WIPA 1SYEA 1KTKA 1SEBD 2PW5A 4M1UB 1TZOA 1G2TA 3J7AF 2M2LA 1VDVA 5KYIA 3TN2A 2WXFA 3W3AA 1EL0A 3P4SB 3TZDA 1CTMA 1G8ZD 1XTCD 5CV7A 1U9RA 1EEID 2IDYA 3M4OB 1ZE3D 2TSSA 1MI0A 3PO2B 4KX6B 3VR9B 1KFYB 1A3UA 5D14A 3ETRA 3SEBA 1V8CA 2F0UA 4IUUA 3AEAB 2V0GA 3BDLA 3J81E 1G2SA 1AW7A 4CJ2C 1HA6A 2YEPB 4OVZA 3MHZA 2IW3A 1K8MA 2BE5D 2NBFA 1O7YA 3EQLC 2PIAA 1IHZA 2IWHA 4MACA 4P6VF 2G1EA 1BQQT 4F87A 4US9A 4NKLA 5CV4A 5EPLA 1H9SB 2A73B 2F0MA 2LHEA 2EDGA 2WDVB 4RH6A 2D62A 2I2YA 3N52A 3AE8B 3FMCA 2MJDA 5EPJA 4RFBA 1KAAA 2DY8A 1K8OA 2KUMA 5T1GA 1L4DB 4N58A 1TS5A 4C7YA 3A55A 3BYTB 1LTSD 5FOBB 1XO3A 2NN6I 2W55A 1VDZA 4PMBA 1O78A 3ABVB 1KLGD 3NXWA 4KGRA 5A35A 2N7JA 5J39A 3V2TA 5CV6A 1E0BA 1BCPD 3LX0A 2V3PA 4A3BB 2LUMA 2OF1A 4CGYB 1TKYA 1R4QB 3G7LA 2NVXB 5C6AA 2F0TA 2A68D 2ACZB 1ZXTA 3GTQB 2Q8IB 1KDCA 1Y8NB 1SXTA 2EJGC 3GV6A 3UI2A 1DOLA 2ICEC 3NTHA 4B9XA 4H13C 4KN7C 3EA6A 1IW7D 1F2LA 3S9WA 4KKSA 3GO5A 2B39A 4K2LA 4DAVA 2F0DA 5KGUA 4DNRB 2KEDA 5BMHA 2WQYB 4ULLA 3M4YA 4TQUS 4KN4C 2F0NA 4ZAIA 4JWUC 1YNJC 3Q8BA 2TMPA 4FF4A 3MEHA 1ZOYB 1H9JA 4OZBA 2BT6A 3VRBB 1SE3A 4OW0A 4TMAB 2LKVA 3MHBA 1K51A 2BDNA 2PZUA 5C0XG 2KDMA 5C4ZA 1SNPA 2EY2A 5M3FB 3VYTA 2Y5CA 4RCOA 1B4OA 2K05A 1TYGB 3TMEA 4FVMA 1JR0D 1C78A 5E4XA 1WSPA 2NMQA 2SOBA 1SFOB 1LT4D 3C3LA 3SR6A 2RDFA 1PFDA 1Q8IA 4IZ8A 3DEOA 4H2AA 1ROEA 3HOYB 1SF0A 1IBXA 3CHBD 3RFZB 2F0PA 4XYQA 1MHXA 2JYOA 1S5CD 3TUOA 1VF5C 3VYUA 1Q1EA 2D2CC 4TQ0A 2SEBD 1M4VA 4ZRPA 3NP8A 1D5XC 5BN5A 1GHJA 3PIO3 2FUG1 1CT1D 3GP7A 1GUGA 3QWNA 1F9QA 5M9OA 1ILPA 4F8MA 2GI9A 3GV3A 2JYTA 4B9WA 3SR1A 1I4HA 2B2YC 2B2WA 3BVZA 2WU5B 3AEGB 1NR2A 1QOBA 3I73A 5I2YA 1F9SA 1PZJD 1KABA 3P4PB 3U4EG 1XF5L 1E0ZA 2JEBI 1FNUA 1MPEA 3V3XA 3MFGA 4QUCA 3BDOA 4BY1B 1F9PA 2QCPX 4C3IG 4XDXA 3Q22A 2WIIB 1W6KA 4PQXA 1QB5D 1DD2A 1L6UA 4HEDA 4WRDA 1YJIA 1I50B 2XVSA 1TIID 1FCLA 1OXVA 1H9RA 1HXYD 2AQ3B 3X3MA 2X38A 4KV6A 4C56C 5JVG3 1PRTB 4BA2I 4IFDJ 4RKLA 2CU3A 1HZ6A 1Q90A 2RBMA 2OHFA 2F0KA 1SJHD 3ZGZA 1J7BA 2JP1A 3FAHA 2XRSD 4OIKA 3AEFB 4A3DB 1FRDA 4XXEA 3Q24A 1I3QB 1D5ZC 3OMCA 3QB3A 3GTJB 2AQ2B 2LHDA 1PFNA 5M3MB 2M9VA 1CA6A 1TWCB 1GUWA 3C1EA 4JBWA 2ENBA 2PW9A 3H91A 1NSNS 2XIWA 1FO4A 1EYCA 1PDQA 3S1MB 2E74C 1LT5D 3VR5A 2SDFA 3AE7B 2ZW0A 1VMCA 3ZJTA 2LMCA 1EWHA 3ERQA 4JWSC 4NW2A 5IIFA 1Q3LA 4R8IA 5F2DA 5ISRA 1C9FA 1N5WA 2WV6D 3FILB 1GB4A 2NVYB 3RZDB 3KLSX 2K1BA 3T13A 2KN4A 1EIGA 3BVMA 3AE3B 4RAUC 1V1PA 1XLPA 3HOZB 2QSDA 5IGGA 1C4QA 4HMIA 1FYCA 3MWYW 3HS0C 3OIPA 1U4MA 4PV1C 3P20A 2F0HA 4DGZA 1LTTD 3GTPB 3FPUB 4A3FB 4XDDA 2WLBA 3E9SA 4O42A 5DM63 1XLNA 2B2WC 4M0WA 1Y1WB 3J9CA 3MJ5A 1QJOA 1R9TB 4USAA 5C4HA 4KI0A 1E9MA 5CORA 1B9MA 3IAM1 2EYPA 1C48A 1RJTA 3HVDA 3H3VC 2C5CA 2PCFB 3P1HA 4FXDA 1SMYC 2B8FA 3L4PA 1WTXA 1K52A 3W1SA 2L11A 2WACA 5C4XB 4LLGM 1STHA 3I91A 4G7OC 1TT2A 4OL7A 1GUSA 2QKIC 4HSPA 4KJOA 4DF7A 1WD0A 3HOUB 2IGHA 2KOLA 1I7HA 2IGDA 2Q5WD 3VA7A 1W6JA 4CBVA 3A56A 5EPKA 2WXLA 3I57A 2V4DA 3KUPA 1YNTE 4Y7NB 2NVQB 1Q12A 1YNNC 2J7ZA 3MTSA 4YSZB 1R4PB 4EE2A 2FINB 1C4CA 5AUIA 4WFN3 2WS3B 2EYMA 2R7ZB 2AQ1B 2PVGC 1XEEA 1QNUA 4ZUIA 3RMHA 1KRHA 3S16B 3HRDD 1RHPA 3SHLA 4IKGA 4C1NK 4A55A 3TP8A 2NN6G 1TWGB 1QWYA 1K83B 1UWXA 1IYUA 3W9CB 4CHTB 4IUVA 2H89B 2PO4A 1VZ8A 1VF7A 3Q69A 5IGEA 1E2ZA 1Z47A 1FEHA 3CQZB 4ZQ3A 2BTEA 3WOFA 3O13A 2W82A 3WCQA 4RGOS 3BVGA 2KMMA 3C1FA 4RGTA 1JALA 2ZXRA 2XN9C 3MZ5A 1I4RA 2OEOA 3DWPA 2K9XA 3J7AV 5EE1A 1PGXA 1L0YB 1STYA 4X3KA 2E76C 5C0XH 3EJIA 3NQIA 4OGQC 5IT9E 3K5LA 2A6HC 1YJJA 4U68A 5JXVA 1H9SA 3VQIA 3Q8FA 1ZYRC 2F0IA 2PVOD 3SXHA 4ZRZA 4OO1I 1LTGD 1I4PA 4Z9CB 2X69A 4EGVA 2KHSA 4KD4A 1SE2A 5BMIA 3S2HB 1SB3C 1STBA 2DWQA 4Q0FA 2ON8A 1HRJA 4QB4A 5J22A 1S5BD 4PNYA 1GXDC 1QOAA 4JX1C 4H44C 1PTOC 5K5PA 1UNSA 1T5EA 3TDQA 2BS3B 2QF7A 5DM73 3KLRA 1AZQA 5C3WA 3SFDB 3SE0A 1WVLA 4IUNA 3P7JA 4KK7A 1TWAB 2ONQA 5CMDA 1CFMA 2IX1A 3H6MA 4WH4A 5I6WA 1L4ZB 5I9PA 2H4OA 5A2QE 3T3OA 4H7BA 4K14A 1ENCA 2WDRB 3AMZA 3NPPA 1NR4A 2QMTA 5EJWA 4Q5VA 3TEXA 2CQAA 4YTPB 5LHY1 3LWUA 4CJ1B 2YEPF 2HUGA 1FNVA 4YIJA 2R93B 3KWLA 3NSWA 2O2LD 1SJED 3BDCA 4BBRB 4RGMA 3OIQA 3K5MA 3OOCA 2F0FA 2WDQB 3V05A 4I65A 2M56B 3Q6SA 1GHKA 4RHSA 1SYFA 3TZUA 2BE5C 5I6YA 2H1EA 1HA5A 1VMPA 4NDXA 4N59A 2PLPA 5C44B 5ELCA 3SK4A 3PMFA 3P1MA 1WTQA 3ZQ4A 5D3DA 1JQYD 2L5TA 2ICIA 3AU7A 4N9PA 2IT1A 2EYHA 5ELFA 2A6ED 2HCIA 1QOGA 1WTWA 3S2DB 1A6XA 1TKGA 1B53A 4RCNA 1B44D 1EY0A 1LV9A 4XTCS 4FF3A 2L32A 2N88A 1D5MC 5EKLA 4K5VA 4WURA 1DONA 3PO0A 1OO9B 1QOHA 4K2KA 1D1KA 4D2KA 5NUCA 2M19A 1AZPA 1TWHB 4IUQA 1A15A 1DOIA 4QCLA 1HUNA 1BUVT 3B9JA 3NVZA 3DM1A 1JRPA 4F7XA 2GA4B 4XT1B 1F2YA 4J8QA 1BCPB 3P63A 5LNK1 3NWSA 1CHPD 1H9KA 2QEJC 3S14B 2L4NA 2EE1A 5M5YB 1C8CA 3CRKC 4ZKCB 1U4LA 4IQZA 2EKIA 1WXQA 4U673 5M5XB 4R8NA 5CYUA 4X3TA 3KLSA 1TR5A 4DXFA 3NRZA 3MXNA 4OZCA 4ZOHC 1T5XD 1DXMA 2B2YA 4A3JB 4BWGB 3NE5B 2NYZD 1PYWD 2L0CA 2K03A 2DNEA 1I4QA 1B9NA 3J80L 1N62A 3Q8CA 3T4AC 2CHBD 2HCCA 2WU2B 3AEDB 2Z4HA 2FFKB 4EQPA 5AFWA 1VRAB 3NZ3A 1OQRA 2MEKA 1F0ZA 2ZT9C 5CV9A 1RWSA 3NHHA 1X3PA 2VNUD 4HN7A 4A3EB 2DYMA 5FKAC 1JC7A 3TEWA 1Q10A 3H09A 3AE1B 3I9V1 4L2YA 4OZAA 2KVMA 1C77A 3PZ7A 1ICWA 4AS1A 2MJEA 4WQMA 3HOVB 4J3OD 1F77A 1V1OA 5LL6S 1TU2B 1GUOA 1JCKB 5FLXL 4A3KB 1CQFA 3PUWA 4IN3A 3IAS1 3TBIB 3MP9A 3TEZA 3U52E 2EYLA 1HFNA 3R2TA 1A70A 3B2FA 1PZKD 4LAAA 4KHVA 4IFDI 4RNAA 2FHTA 1E2WA 1VR9A 2K01A 2DLBA 3E0JA 3AE9B 2JYEA 5BN4A 2GRIA 4KGTA 2LGIA 2MH7A 3R8BA 3OSOA 3K6OA 1CZWA 1WRIA 4HJGE 3PUVA 4HAEA 1L0XB 4BA1I 2BBCA 1YNJD 4ARIA 4MN3A 1Z7TA 2VXWA 5BYQA 3FILA 1RTOA 5IGCA 1ZDVA 1NCVA 1EFID 2KWDA 2EELA 2K5QA 3ITPA 1MHHE 3PUXA 2D5DA 2A74C 5KYLA 4EQOA 4HEA1 4EVOA 3AM9A 2NTSA 1STEA 2E3TA 2SNMA 1JOKA 3I4MB 4A3IB 2J53A 2NN6H 1EYDA 1IKMA 4L63B 4ODGA 4KTAA 1FFVA 5JEAJ 2BOSA 3VR3A 1RF2D 2A5HA 2Y5PA 3D6CA 4NJCA 3A7LA 1PRTF 1JB3A 5JOBA 5JVH3 4N9TA 2B2UC 1IUEA 3M7NA 3TEYA 3MC0B 4XYOA 3QG1A 1GAQB 4C2MB 2EJFC 3NBHA 4HROA 4DXGA 5C4JB 2MHVA 1V97A 2W3SA 1VLBA 1BUIC 3P4RB 3VYRA 3C8YA 5D65A 1HTLD 4DAPA 2CW0D 3HGBA 3NTIA 4JPSA 5H8YE 2F0QA 3M7GA 1JWUD 1IGDA 1FD7D 1YN4A 1I4XA 3SVMA 2RMMA 2BCOA 1EY4A 3RZOB 3NK9A 1S5DD 2XSCA 1J7AA 2WXNA 1EY8A 3K0YA 1PRTC 1HZ5A 1AP0A 2F0OA 1K50A 2K28A 4NAMA 1E2VA 1S4ZA 1QQRA 5T8IA 4FXGC 1P7EA 2INPE 1EQVA 5G5HA 4OO1G 1ZXIA 4IUPA 4R3DA 4AQ7A 2JX5A 4IFDH 2FE8A 5IODA 5K36G 2W54A 3E5SA 2EJMA 3AMUA 4HRSA 3N6RA 3GB1A 3AE2B 4LK0M 2F03A 3K5OA 4C3HB 2PNRC 1GOZA 3MXUA 2EY1A 3HUIA 3P4QB 4ZK9B 3D4WA 5IGFA 3HKZB 2L1BA 1DOYA 2WP8J 5JJZA 1HQRD 2G9DA 3W5UB 1DGJA 4ZRQA 1E10A 1FRRA 2JE6I 2MP1A 1QNKA 4NMZA 1D1IA 5FO8B 4MIUA 1A3VA 3QO2A 3EROA 4K6LA 4ZHOA 4L6TB 2Z8LA 3GTKB 5T1IA 1KNEA 1EQTA 1PXUA 2A69D 2PTLA 3T53B 3ZJVA 1XCTL 4PMCA 2K04A 5FO9B 4I7ZC 1K53A 4FNFA 2KACA 3ND9A 1SYCA 3E56A 1XX8A 1ZDXA 3FKIB 1LTRD 1TKWB 2O4XA 2XRQD 1SNQA 1A2UA 3ZJUA 1PTOH 1EYAA 3FC4A 2C9OA 1UAPA 4YSYB 4BBSB 3EUB2 4K8IA 4OHJA 1JICA 2WXGA 5BYSA 2ZW1A 4LTUA 3MAQA 2K5PA 2AUJD 4FXCA 2XWJB 2J0TD 3QIAA 1ENAA 1DZ1A 2JA8B 1SDFA 4ID6A 5LL6X 3BG3A 4IALA 4NP5A 3K58A 1I6HB 2Q8TA 3I8ZA 2R6GA 1M8AA 4XDCA 2QIEB 2BDOA 5D3IB 3A8IE 1D6EC 3X3NA 3SK8A 4C3JB 2Z1CA 3EVQA 4K5WA 1C79A 4P2CB 1UUPA 5C5MA 1ZXHA 2WXRA 4GZYC 1RTNA 1PGBA 4V0BA 4O1NA 2BA1A 5E3FA 1TKEA 5I9OA 2F0WA 2Q8RE 1F2ZA 1GUNA 5FK9C 2I46A 4EQNA 2HDMA 3QOLA 4RA8A 1X32A 2IPKD 1PDXA 1LACA 1AWDA 2JXMB 5HG2A 5E6JA 2K5DA 3HEJA 1SMYD 2HDEA 2RDGA 3TP6A 2NUCA 4S3SA 4RF0A 3QOJA 1MSHA 5FO7B 2MJ8A 4KJNA 4QMGA 4QF4A 4YTNB 2JQRB 2EXZA 3MXGA 2KEEA 1LLRD 2VUMB 4HMJA 5IGDA 1O80A 4ZHPA 4WORA 4DN4M 5KIXA 5CBAE 3BYYB 1DJRD 2MPMA 4HKZE 3GTOB 4FYDA 4A3MB 1YQ3B 3KBGA 2Y3AA 1DOXA 1F2RI 5JPMC 4XT3B 4G7HC 4TSSA 1SE4A 1MBYA 3KBXA 2K22A 5JEAG 1TS4A 2R92B 3RPFC 2AUKA 1SNOA 1HQMC 1RDPD 5GXGB 1WTRA 3J81L 1RKNA 3NWTA 3CIRB 4XWWA 1PTOF 3AE5B 1FGBD 2J52A 1B9RA 2LJIA 4RGNA 5CR3A 5G3LF 2MJ3A 3SDZA 3VYSA 1N61A 4GLSC 2BS4B 1CK1A 3CWIA 5D7GA 4B08A 1JWMD 4BY7B 2E75C 3D31A 3NS1A 4PMWA 2HTME 4KY5A 1CQVA 2YYZA 2NWGA 4LMQD 1AYFA 2O5IC 2MGSA 4L23A 4LK1C 1VJKA 4US8A 3NVWA 3FVQA 2V4IB 4FP5D 2KQ3A 5E4WC 3MXPA 1XLQA 1FIQA 3K59A 1KF6B 3FDTA 1II3A 2WXMA 4WAFA 1NYQA 4IFDG 2N55A 1Z6HA 4DAYA 4HCSA 4G57A 1OQQA 1AEXA 4IUTA 1EZ8A 1MD2D 1YMHE 1AN8A 4GDKB 2PYKA 1WTVA 1V8QA 2RQXA 2JSVX 1P7FA 2L83A 4RHRA 3KWVA 2HDLA 3OHXC 4C7ZA 3NQTA 5KRUA 1Y56A 2RPVA 3TP5A 1SYBA 2EY5A 1NYRA 1EWCA 1MSGA 2F3WA 2KECA 1WTPA 3GTGB 2K6AA 3BZDB 1EM7A 2KQ4X 3H8HA 4M8AA 4ZKBB 1ILQA 1DYQA 1CZPA 3M3YB 2WXQA 2FMCA 3SK5A 2N0SB 3L9AX 3KQ4A 3L7ZC 4XQQA 1VZ7A 1L6VA 2FBWB 3T3NA 2JU6X 4DA2A 1JQ4A 1HFGA 4HSVA 1RODA 3AV8A 1KDBA 1EOTA 1PLFA 5C3XA 3OPOA 2A6EC 5I2XA 3RD4A 3QJYA 1F9RA 5IGBA 3OWEB 2ZXPA 1Y1VB 2WP9B 1SYDA 1HUMA 5EQ0A 2IGGA 1ESRA 2K3UA 5C3EB 1D4BA 5CV5A 2EY6A 1JOOA 3LWEA 3NBIA 1PFMA 1BCPF 5KNCA 3D8GA 1WCMB 3U7ZA 3HG9A 1EY6A 2LFIA 2N9KA 1G6ZA 1QLBB 1LT3D 3KF8A 5HFYA 4GDLB 3N9YC 2WB1B 2X6GA 1PFBA 2NTTA 1LTBD 5G5GA 4G4KA 1FR3A 1G291 2I07B 1GJXA 3GD7A 4QUFA 1STAA 2RKSA 5KEEA 3S1RB 1X3QA 2JWUA 4OO1H 5HI1A 4ILWA 5KNBA 1TS2A 2IX3A 2JXTA 2JA7B 3I3CA 1OFFA 4MT5A 3IFDA 5K36H 1EWYC 1BCPC 3BWUD 2L55A 2F4IA 2QILA 4REZA 4UAIA 2A68C 4AYBB 1AFPA 2LY7A 2FMMA 4V190 1B50A 3VR4A 3I70A 4JE3B 2F0LA 1BXTA 1EIHA 2AX5A 1CZGA 3WDNA 1IYVA 3S15B 3LNNA 5E1FA 2JSOA 4ITKA 5CV8A 3Q8EA 5ELDA 4X3SA 5CGKA 2DBYA 1B2TA 4XE0A 1TS3A 1IW7C 3T16A 4K8JA 1DOKA 5C5LA 3AH7A 3JAML 3Q23A 2OXPA 3WOEA 1IL8A 1B3AA 4C80A 2WKCA 1Y8PB 2B2UA 4KD3A 3Q0AA 1BO0A 1YN3A 5BYRA 1ENFA 1ET6A 4IURA 1SSNA 4KKUA 1FM0D 1QCBD 2JA5B 4DK1A 3GTLB 1GUTA 2F0GA 5TSSA 1ZP0B 1XCQL 2IJ0A 1JROA 4KY6A 1FMAD 1CHQD 3NVVA 4C1NI 2BB6A 4UDUC 3R2IA 4KY7A 2DYOA 1ZPSA 5EBDA 1I6VC 4NAWB 1ESFA 4JK1C 1T6BX 1ONLA 3LB8C 2M0AA 4MHEA 1L5PA 2BB5A 3EFXD 1NVID 4L1BA 2CJNA 2K7VA 1RCVD 3MA2B 2WINB 3D4RA 2F0SA 1JWBD 5ELEA 1DM0B 2Z4IA 5H92C 1OXXK 3GTMB 2E6XA 2OT2A 2VB2X 1E6EB 3U2SC 1LABA 2L1AA 3OWFA 3NUHB 3G6JB 1F2RC 1TWFB 2RVLA 3P42A 2KA7A 1Y8OB 4J6HA 1EU4A 3BIID 1I4GA 4WJWA 1NUCA 3AB9A 4KKJA 3M85A 1G91A 3SK6A 1SYGA 2X6LA 2E2IB 4YWGG 2QDBA 4CKEA 5BN3A 4YXDB 2NVTB 1DOMA 5I4DA 2QJLA 1RD9D 4C3IB 1BNZA 4HR7B 3B2GA 1CM9A 2PKOA 3W2DA 2CVRA 3VA5A 1PGAA 2F0EA 2ZXOA 2E2JB 2RSOA 2J4XA 2WXKA 1YQ4B 2XNAC 3URYA 4KKTA 3IKJA 2CW0C 5KNDA 3BK1A 1JWSD 1TQOA 1JW9D 2K0PA 5M5WB 1T3QA 5JEAH 1EY9A 2DNCA 2O5JC 1QT9A 3FRPB 2B76B 1IGCA 1GB1A 1BR9A 5C3JB 1WWTA 2V3NA 1QE6A 1SSOA 3JAME 1O7ZA 1LO5D 1PZID 5JAVA 5DNFA 1BF4A 2F0VA 2IL8A 3PV0A 1O7LA 2PZWA 2B2TA 3AEBB 3J80E 3P75A 3ONAB 5FR3A 4ARCA 2VB3X 4R9WA 1VZ6A 4XIGS