1D6EC

Crystal structure of hla-dr4 complex with peptidomimetic and seb
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 62
structure length 225
sequence length 236
ec nomenclature
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d6eC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d6eC02
3KLSX 1SEBD 1EEFD 1SE2A 1EEID 3O13A 1HA5A 3EA6A 1I4XA 1CHQD 1D6EC 1SXTA 1TS2A 1L0YB 4RGNA 1LT4D 2O2LD 1SE3A 1XTCD 4TSSA 1BCPC 1KLUD 3R2TA 2XN9C 1TS5A 1LTID 1AW7A 4C56C 1JCKB 1HXYD 1D5MC 4UDUC 2R61A 1JR0D 3DWQA 5FKAC 1RD9D 5I4DA 1S5FD 1D5XC 3BVZA 3MFGA 1UNSA 3BZDB 1KTKA 1FNVA 2RDGA 5ELDA 3BVMA 3R2IA 3TSSA 3GP7A 1SJHD 4L6TB 1PRTC 1D5ZC 1EFID 2QILA 5FK9C 1RCVD 1I4RA 1SJED 1LTTD 1YN5A 1F77A 1BCPF 1BCPB 3EFXD 1T5XD 1JWMD 1I4HA 1LT5D 1MD2D 1TY0A 3MC0B 4L63B 1S5DD 1EU3A 1PTOC 4RCOA 1I4PA 1PZKD 2XRQD 1FNUA 2XNAC 1TY2A 1ET9A 3DWAA 4DXGA 2SEBD 2CHBD 2IPKD 1I4GA 1LT6D 1PRTF 4RH6A 1PRTD 1PRTB 1S5CD 1GOZA 3SEBA 1L0XB 2WV6D 2J4XA 1UUPA 5ELCA 4BWGB 1PYWD 1I4QA 1B1ZA 1CHPD 1CT1D 1V1PA 1PZID 1ET6A 1FD7D 2AQ3B 2AQ2B 3URYA 1PTOF 1DYQA 4ZYSA 1BCPD 1PTOD 1LTGD 3V05A 1PTOB 1LT3D 1RF2D 5ELEA 2AQ1B 3CHBD 5D3DA 3BVGA 3W2DA 1YN3A 1DJRD 1M4VA 3BYTB 1CK1A 1STEA 1BXTA 1JQYD 1FGBD 2NTSA 1S5ED 1B44D 1FNWA 3DWPA 1TS4A 4RHSA 1KLGD 3BYYB 1EWCA 2IJ0A 4RGMA 1V1PB 1G8ZD 1HQRD 1S5BD 1SBBB 3R8BA 1HTLD 1LLRD 4O1NA 1TS3A 4RGTA 5ELBA 4DXFA 1RDPD 4RFBA 1ENFA 2QEJC 4NZLB 2TSSA 5TSSA 1AN8A 3OWEB 2XRSD 4OHJA 1ESFA 1V1OA 1JWSD 2ICIA 1XXGA 1YN4A 2RDHA 1LTRD 2G9HD 1LTBD 5D3IB 1PTOH 1QILA 1EU4A 4RGOS 5ELFA 2NTTA 4Z9CB 1SE4A 4RHRA 4K6LA 2Z8LA 1LTSD 1LO5D 1LTAD 1JWUD 1PZJD 1CQVA
chains in the Genus database with same CATH superfamily
3M4PA 2HDEA 1G291 3IL8A 2AEHA 3OG5A 2OQKA 1WCMG 5IYBG 4DV3Q 2QGQA 1WX7A 4WQMA 4IW0A 3MEHA 2AKWB 4C80A 1WI5A 1D4BA 3AULA 1WD0A 1WH3A 1ZXTA 2DGYA 3SE0A 4A3CG 4DNIA 3NS1A 1YJ1A 2C5LC 3R2TA 4K2LA 3I2ZA 2C60A 2XVSA 2LGXA 3TBIB 3ITPA 1T0YA 3SVMA 2OT2A 3HFZB 2ENBA 5KGUA 4KN7C 1EO6A 4AQ7A 2PPHA 3K5OA 4M02A 1NTGA 1QT9A 4N8FA 3DWQA 2A6HC 1RD9D 5I2YA 5JXVA 3B9JA 3IHPC 3A55A 3P4RB 4OELB 2DYMA 3LJ3A 3NK9A 1ZW7A 3QAQA 3KH0A 4A3MG 2UXDL 4C7ZA 4P73A 1SB3C 4DV5L 4DA2A 1PRTC 3NBHB 3K58A 1D5ZC 4LF8L 2BA1A 5DNFA 2AYOB 5CV5A 3WAOA 1WMHB 1IYUA 2QILA 2RCFA 3TP7A 5FK9C 1XTDA 4A3FH 2CW0D 2WS3B 1K8GA 2VUMG 2NZHA 2ZTEA 4XDXA 4EX5A 4MEMA 3J80E 2A6EC 4KY7A 1BBWA 4EQPA 4A3JG 1EF1A 2KJHB 2N9KA 2EKEC 2M56B 2PIAA 5T8IA 2I5LX 1RLFA 1WMHA 1F52A 3SDLC 3DBRI 3ECIA 4CKCA 3PO3G 2KMMA 2EPBA 4GGQA 1H8CA 2E76C 2N9EB 5JHAA 2RR9A 5C6AA 4WH4A 1H9SA 3U2SC 1FCCC 1SN8A 1PRTF 2XSCA 3ND9A 4RH6A 2XTIA 2JEBI 3AU5A 3HM6X 2WINB 2DYBA 2K75A 3K5NA 4A3KG 4F87A 1A8VA 1F9SA 2E2JB 1L0XB 2KOLA 3DBHI 1K83H 2UWQA 1K28A 1PYWD 4UP7A 3F2DA 3A54A 1QVFA 1MG8A 2WXJA 2AWTA 1PZID 3V2TA 3VDYA 1XMOQ 2DY7A 1XLQA 4HJKA 1N32Q 1PTOD 2WDQB 4DU9A 3STBD 1X9NA 2FNJB 2QSDA 1N5WA 1ZXHA 4EZLA 1ML0D 3F2UA 4NNJB 4ZHPA 4DR3L 1QOGA 1FD6A 1HFGA 4X64L 2N49A 2Z4HA 1PH7A 2IX1A 4LUVA 1HH2P 1QNKA 4HJGE 1TS4A 3TS2A 2UU7A 2HTHA 3P75A 4NP5A 2V4IB 1DGJA 1E8XA 2FUG1 5JPNC 1VQOA 4BBSH 1CSPA 2ON8A 2YEPF 4A3IH 5EAYA 2JQRB 2F0MA 2WB1E 3RFZB 2LRWA 4MGKE 3CC4A 2LVPA 3HOXG 4RCNA 3AE6B 1XPUA 2TSSA 1V80A 1WJ4A 4LK0M 4BBRG 1KHIA 5IE8A 4L5TA 1GXDC 4JC0A 3RULA 1II3A 1GD7A 3OIPA 4JGHB 1NBFC 5FLMG 2R7DA 5C4XG 3W9CB 4DR1L 3NZ3A 3UI3A 1XXGA 1MBYA 4IUMB 4U673 4KHPQ 2Z6BA 1TGZB 3VFKA 5D3IB 1IP9A 3RNBC 4JE3B 2ZXRA 1CA6A 1QVGA 3AB9A 2HD5B 4OVUA 1LTAD 4CO7A 2I38A 2Q2TA 2WB1B 1I94L 2C9WB 4GLAC 3RZDB 3NTHA 4AWJA 3KBGA 4HXDA 3H0GB 1DXMA 4PS3A 3SK6A 3QJYA 1EWIA 2D5DA 3EA6A 2VZAA 1I4XA 4XYOA 4XDDA 5DAUA 3RMHA 1KLVA 1XCTL 1J5EQ 4RGNA 3NG0A 3O65B 1X3EA 5IA7A 5EPLA 1YBYA 2UXCQ 3W1YA 5EQ0A 3VR8B 2ES2A 2FHTA 2LMCA 3K81C 3H9DA 4C2MH 1V2YA 1HJPA 1ZDVA 1ILQA 2EELA 3TEHB 4JI5L 2B29A 2L32A 1E7UA 4UP9A 4BA1I 3OIQA 1L0VB 3T1HQ 2N1WA 4KGRA 2INDC 1A0IA 1HNZL 1PGXA 4JI3L 1GB4A 1XNQQ 2NBVB 5EE9A 5BR8Q 1B3QA 1E1OA 1AZQA 3EHVA 1W6KA 1Z9FA 4OGQC 5BN4A 4JQWC 4HCEA 4DQOC 1EY8A 4YL8A 2NVTH 4OEMB 1Y1WG 1YHQA 3S9WA 1VS0A 1JWMD 5H1SE 3P1HA 4RCOA 2RF4A 3Q8DA 3A74A 2K33A 4YTPB 4XC2A 3LDZE 1ET9A 5HFYA 3W5OA 1K51A 4MJSA 3A8IE 4MM3B 4KV6A 2DYOA 2IX0A 2KHWB 1ASYA 3Q3FA 4JYAL 3CMMB 4B0MA 2MO0A 1LUZA 3F1ZA 1TXYA 5C3EB 3P63A 1J8CA 2AMCB 1AYFA 1DOMA 4MM3A 3VUXA 1B7YB 3TEWA 4DAPA 1P1AA 3D0FA 4LJOB 3Q8CA 2E75C 1VDVA 2ACZB 4UAIA 1FIQA 2BS2B 1V9PA 3MTNB 4AJYB 3C2PA 2KKCA 3IT4B 2C7MB 1NYRA 2G5DA 4G11A 2F3IA 5C44G 4LF5L 2L83A 2LI5A 3CCSA 2KZRA 1WM2A 4DR4Q 1WGKA 3PZ7A 4OX9Q 4DR5L 1VF7A 3MFYA 2JK8A 5HURA 3PCOB 1OQQA 1WTXA 4QMGA 4FJVB 4X6AH 5M3FG 1UEAB 4RHSA 2B63B 1HTOA 1MJCA 1HQMC 1VMCA 4X62Q 1TTNA 4II3B 2BA0A 4O1NA 1IUEA 1TS3A 2VZKB 2HDLA 3BDLA 4TMAB 1UD7A 4IOAA 1JALA 2CW0C 3GV3A 2EJGC 2JZ3B 3TN2A 4EOYA 4DR2Q 1C9OA 4JV5Q 1YIJA 1M90C 2E2JH 1V49A 1V43A 4GN4B 4WJ4A 4KV2A 3ABVB 5LLIA 3JAME 3G4SA 4NXMQ 2Y0SB 4IKGA 4YSZB 3UQAA 4PZ7A 4FXGC 4JBJA 2RDHA 1LTRD 1IL2A 2NVXB 4TVAB 4QUFA 3VYSA 4RGOS 2MH7A 3I3TB 4LNFA 5E6JA 2V3PA 5K36G 2MEKA 4JCVE 5IP4D 1E2WA 5CR3A 3NY5A 1JWUD 3BS1A 2Q8TA 3NE5B 1FXAA 3NQTA 4G7HC 2H1EA 3UIPB 1EEFD 5CBEE 3GDEA 4BKSA 3QB3A 4ALPA 5G5GA 4Y7NH 2FIDA 4DV4Q 2O2LD 2AWOA 1O7LA 3HKZG 3ZIMA 5IAAC 2HUGA 4G57A 3STBC 1N36Q 2HJ8A 2K4KA 2JZPA 1N34Q 1ICWA 2PQEA 4LAAA 3SXHA 2DLBA 2XEWA 3PGEA 4KGSA 3R66C 1HXYD 5GQOA 3UI2A 2DAFA 2DZIA 2W55A 2VB3X 3HKZE 4FYDA 1CTMA 4V190 1MVKA 1PFDA 3BY4B 4C3HB 2NYZD 1U4MA 2R93H 4OL7A 4KDIC 2MWSB 3VUWA 2R7FA 1Y1VH 1FNVA 1LABA 2EY5A 3GQBA 4C3IB 3KF8A 5BYRA 1Q3LA 2N78A 5IGCA 2ZNVC 2QF7A 5A35A 2J0MA 4A76A 1SSNA 1LTTD 4DV6L 4JI2L 5IWAL 2L05A 4EZKA 3SU8X 4YSYB 1BCPB 1STBA 2O5IC 2ZJDA 1IXRA 5LMNQ 4A3GH 1OGWA 1IBLL 3NQIA 1CKOA 3H0GH 3CCLA 4FHJA 1SLJA 1ZE3D 1WXMA 4W9CA 1TWGB 3KLSA 1KFYB 3MWYW 4KZ0A 3S1NB 5FOBB 3QIAA 1WTWA 4WURA 5DPSA 3R93A 2OOBB 3KYCD 1A3UA 2PQAA 1WTVA 4RNAA 4MTNA 1SNDA 1E0BA 1X3GA 3CP0A 3VYUA 3CF6E 5ELCA 3ZUNA 3TP5A 1VCIA 4B3TL 1I4QA 1B1ZA 1KIXA 4KKUA 1MG4A 4DHJB 4AQYL 3URYA 4K0KL 3PLUA 1I5FA 1TKEA 3DBLB 2F0IA 4NKLA 3T1YQ 1FGUA 2HQEA 4ZQ3A 1WYWB 1SYCA 3HOVH 1VRAB 3AI5A 2FCSA 3KYHC 2AL6A 4HJ8A 4K3CA 2KENA 4HPPA 2CQAA 2WP9B 4PS8A 2QA4A 3J9CA 1K50A 1FNWA 4MHEA 4OONA 4BY7H 3H1UA 3QJZA 4IG7B 3LYYA 2SNSA 4LUOA 1TT5B 2UUBQ 2FCMA 3HOWG 3T53B 3P42A 4ZRPA 4CJ0B 1RL2A 3SK5A 4LF7Q 4POFA 3U9OA 2O5JC 1JT8A 1AE2A 3VYTA 4NXNL 2EDGA 4HEDA 1FEHA 2B2UC 2VB2X 1S1QB 4KKSA 5C3EH 3W1BA 4DV2L 4PYZA 2E3TA 4QIWE 3IAS1 2NN6G 2K5PA 4GOPC 3X3MA 1K73C 2QEXA 1PFNA 1JWSD 5JOBA 5JEAH 5FLXc 2KTRB 3I91A 4RA8A 4LJPB 2HT1A 1BF4A 1ENCA 3P2BA 3ZRFA 5DPRA 1EOVA 3PSEB 3WANA 2NBWB 3FHWA 3NTIA 1B4OA 3N1YC 4CKEA 2PE6B 4M0WB 4BZAA 3GTMH 4X66Q 1MHWC 2K0PA 4R4CA 1X3QA 5CBAE 1DM0B 1VMPA 3D31A 2B63H 2LHDA 1NCVA 2F0DA 1XLPA 2KFJA 3D6WA 1SE3A 4R4IA 1VQ6A 1XD3B 2I5HA 4LFBQ 2RD0A 3M62B 2FJ2A 2QDFA 3VA7A 1UEBA 2B76B 1SYDA 2K04A 1PFSA 5IP7H 4ZDVA 3TMEA 3ICEA 4ZYNA 4RMAA 2IGHA 1SNCA 1VQHA 3PO2B 1F2RC 1T3QA 1V8CA 2R3ZA 4NB3A 3BZDB 3GP7A 2M0AA 3PQIA 1KDAA 2NVXH 3S1MB 3AEDB 3FILA 1J7CA 1I6HB 1OXXK 2L1BA 2V1CC 1LQBA 4LDTD 2N7DA 4CJ1B 4ILWA 4C4VB 3KUPA 5T1GA 3U4VA 4HJ7A 3F2BA 2PZWA 1EWHA 4JPSA 4LW1A 2KD0A 1IKLA 3KF6B 2K5NA 1TY0A 2D3AA 2ZW0A 3IFWB 4ACFA 4C00A 1IL8A 5ELOA 5EJWA 3J81L 2EIFA 4WJWA 3MTSA 1ISNA 4W9DA 2NVYH 3CXCA 4R8NA 4AIMA 3I57A 4OVVA 1X55A 2KOXA 5CV6A 2C7NB 1SR3A 4DR6Q 1I50B 2QC8A 3JYUA 2O6VB 2Y5BB 5HGQA 3HOYB 4O42A 1TKYA 3X23A 1FFUA 1VQIA 5ISRA 4BY1G 4FHKA 3CPWA 1LV9A 3UGBB 2QCZA 2OQ0A 3SR6A 2IBIB 4C3HH 2K3UA 1A5RA 1N33L 1JOOA 4V0BA 1S4ZA 3I55A 2L15A 3AQQA 4CDFC 2GBMA 4EQ5A 1OXVA 3SFEB 2B2WA 3C1FA 4C3IH 2IW3A 5C2TB 1LT3D 1X32A 4C1NK 4JI1Q 3OHXC 3I8ZA 1UWXA 5A2QE 4AYBG 1KD1C 1HZCA 3QWZB 1STEA 5IODA 3DEOA 3BK2A 3AEGB 4PS7A 4IWPA 2MFIA 1S5ED 1L1OC 2K03A 3K7AH 3WOEA 3I4MB 3C1EA 1E8ZA 2WLBA 5M3MG 1D2BA 3IXSA 3HOUB 3L10B 4E3CA 3Q3JA 1S5BD 3S1NH 3RNEC 4OWTB 4LCDE 2VZKD 4DXAB 3EUB2 3E0EA 4S3SA 2K8CA 5CV7A 1Y69U 4LF9L 3OSOA 4ME5A 2J0JA 3FKYA 1BVSA 3K0YA 1IBMQ 1UGMA 2KX0A 3PMFA 4QGUA 4DV0Q 2HIVA 3LWEA 2LKVA 1O7ZA 4F1SA 2K1BA 1PDQA 2BBCA 3MHZA 1JB3A 3KDFA 1VR9A 3HM3A 4HR7B 1Q10A 5JJLA 5BN5A 3AH7A 2YTYA 1G6JA 3GTPH 1ZGUB 1D1KA 1Q12A 3TREA 3AE4B 4JWSC 4A3DH 3QOLA 4J6HA 3MC8A 1EWYC 4GLSC 2MBEA 4X3UA 1CUKA 5J2RA 2FAZA 5GADC 2JP1A 1QUQB 3PRPB 3D4WA 2AHOB 3HS0C 3VR6A 2N88A 1E2VA 4M8MA 3VR3A 4IM0A 4A3FG 4B9KA 2D5GA 1AW7A 4EUTA 4DV7Q 4YHHL 1RTNA 4WWPA 3GV6A 1LACA 3GTJB 2G4DB 3NSWA 5IP9H 1JOKA 1R4MI 3RPFC 4JI4L 5KYLA 2JA7G 3S24A 1Q8IA 4A93B 4FULA 1MIUA 1HZ5A 1WZ3A 3ZVVA 5JH5C 4I65A 4HMIA 4LFAL 3S2HB 1JOQA 3Q2AC 3ML9A 1YHAA 3RUIB 1Y8NB 1EY4A 5FJ8H 1AFPA 4IOCA 3DBHB 2BB5A 2L9HA 3DVNU 3L16A 1R7SA 4LF4Q 2F4VL 4TUUA 4B3MQ 2JX5A 2EYHA 2FMCA 4OO1H 3BDOA 3KFUA 1STGA 3KLRA 4GN3B 4IPHA 1WTOA 4R4QA 4GDLA 1Q82C 3L08A 1GUNA 1YNJD 5J3BA 3DWMA 2KDIA 3K80C 3KUDB 4XDCA 1KNEA 1A3VA 4DF7A 3FP9A 3C0RB 2CHBD 4ANUA 2MQHA 4IQZA 3J81i 2OTLA 1NI3A 1K8MA 1Q1BA 2DUDA 3DVGX 4MT5A 1GOZA 2L4NA 1VZ7A 2G45B 1A2TA 1PH4A 1XLOA 2KO3A 4OO1I 3V60A 2K5VA 4DPGA 2K8HA 4DHJD 2FFKB 4EQOA 4FF1A 1UE5A 1L7YA 2AQ2B 3A56A 5AJ3L 3S1MH 1IBKQ 4A3IG 3BK1A 4K6DA 1I6HH 3TS0A 4GKKL 2E2HB 5FO9B 2NN6I 3NWSA 1P7FA 2JEAI 3NTKA 3P20A 3Q23A 1E2ZA 3PUVA 2BF8B 1XT9B 4GDKA 3IRBA 2RA4A 4I7AA 3PSIA 5JEAJ 2WQYB 4NQLB 1H9KA 3ULJA 4TKNA 1ROEA 4RKLA 1YJ9A 2BYEA 1G8ZD 2K6DB 2BYTA 3HGBA 2R92B 1JRPA 5KHOA 1I50H 1VQBA 2H88B 3H7PB 4YTNB 4LFCQ 1KDCA 3HOYH 3HEJA 3UIOB 4DV1Q 1ENFA 1EY6A 2LXKA 3I4NG 1JB7A 1YITA 4G7OC 1PDXA 1AN8A 3SK4A 2B2UA 1NY4A 1XNRQ 2WX1A 3ZXRA 1DD2A 3KW5B 3EGRA 3H7PA 4B6WA 4IO9A 4GOPA 4US8A 4ZUIA 1E22A 4H0LC 2AL3A 2KXJA 4RWSC 4LK1C 2ASQA 3B6YA 4HMJA 4JI8Q 2HCIA 4K1RB 1YJIA 3N52A 2BH2A 1YNTE 3DWGC 4G0NB 1QOHA 2D0OA 4XGAB 2CKZB 3L4PA 1KDBA 5DEHA 1E90A 2J7QB 3W5UB 5IKCM 2UUCL 3RLFA 2DY8A 4P74A 1UWVA 4NPNA 2K6AA 2JPHA 2N9XA 3AFPA 1EYGA 3I4MH 3O13A 3RLOA 1PA6A 4C3JB 1SFOH 4BXXH 1L6UA 1TZOA 3ZNHB 3T3OA 3HOUH 1OQRA 3B08A 4HJAA 2WAQB 1BR9A 4XWTA 2CHXA 2ZVOA 4ARCA 3ZNGC 3DVGY 3ND8A 3N30A 1HA6A 4B9XA 2F0KA 1D5MC 3Q6BA 3PREA 5AZFA 2B2VC 2R61A 2IY5B 2KJRA 2BPSA 3ERQA 5EE0A 4ANXA 3M9BA 2DBYA 2HIXA 3GOEA 4A3PA 1OFFA 2W54A 4US9A 4CKBA 4YY3L 3TL5A 3L17A 5E6NA 4O0AA 4P2CB 4BS9A 3CCMA 3T56B 1TIID 4BVUC 5M5YB 1EFID 1N61A 4TQUS 4GU2A 3IBEA 1YJWA 2ZEQA 2JA5B 1QJOA 3BG3A 2IY0B 2IHEA 3G48A 3H7SA 2J0TD 3PS6A 4HRSA 4NAWB 1F77A 3U8ZA 4HCPB 1C4CA 2B2TC 3ZQ4A 3CRKC 1EM7A 1C77A 3DVNV 4ZKBB 2ZJPA 1BUVT 2WDTB 1CKNA 5J1ZA 4L63B 2K1FA 2CH4W 4NAWA 3ZRCA 1GPXA 2E5LL 2EY2A 4WWNA 1GHJA 4HEA1 4IC7B 3HIZA 3VDZA 1VDZA 1GHKA 1ZPSA 1WE7A 1EIHA 2L7RA 4K5WA 2E6XA 2O6VD 2IPKD 4RF0A 2WU5B 4OVZA 1P0RA 4K7UA 1QB5D 2F03A 4YXDB 4B3SL 2X69A 4KKTA 1E6EB 2Y5CA 4MH8A 4JW0A 5LMUQ 3GTJH 5IN7A 3NZUA 4DHZB 4L8JA 3MJWA 1KNAA 3UINB 3L7ZC 1Y56A 3QCAA 4A93H 2IGDA 2WXRA 2F0WA 1WVLA 5JJKA 3FDTA 2AQ3B 4MDKE 3S2HH 4XQQA 2KBNA 1NAPA 2BH8A 1WCMB 4A3LH 1QWYA 1D3ZA 1RF2D 4KN4C 1HNWL 1WM3A 3M4QA 3CHBD 3R3MA 1H9SB 1DJRD 1ZYRC 4G7ZC 5IOCA 2UXBQ 4F88A 2A5HA 1F2LA 1UH6A 4HVBA 2CS4A 1VLBA 4KIKB 1WR1A 3PPAA 2D3CA 5C3WA 2LEKA 1EZ6A 2RHQB 5IGFA 2BQQA 4NW2A 3ZNID 3VUYA 3C19A 3ENEA 1LTLA 2F52A 1BOSA 5IYDH 4Q5VA 2BOSA 4KIKA 5KYIA 5G55A 4A3MB 1YX6B 4TKOB 4DXFA 1RDPD 2SDFA 3OYYA 2QHOA 2F0EA 1R9TB 2Z0SA 3HKSA 3Q3OC 4CJ2C 5TSSA 4ZLTF 3WAMA 3A7AB 1MKHA 3ZDMC 5I6WA 1RM6C 1V5OA 1J6QA 1GC7A 2I1KA 1BBXC 3Q3NC 1V1OA 2KC2A 2F0UA 1F0ZA 3K59A 4K5XA 2VUMB 2LUMA 2NWGA 4UHVA 1CI3M 2L55A 1N5XA 3DPDA 3EFUA 1NMFA 3NELA 3PF4A 1V5TA 4CDCC 1F2MA 3LGJA 2V3NA 3OWFA 2RQXA 5C4JH 1SMYD 1RFAA 4FN2A 2E2HH 3FKIG 3PO3B 1TYGB 1VJKA 3GTLB 2KUMA 3HK0A 3AEFB 1EYCA 4BKGA 2K9XA 4YCUA 5C4ZA 3J7YW 5IT9E 4HK2A 2IZVB 1I42A 1BUIC 3M3YH 2R93G 5AZHA 4WWMA 2DNEA 4WFN3 3IT6B 1Y1VG 1K8AC 4DR4L 5G3LD 1T0RC 2PNRC 3CSTA 1P7EA 2KDBA 4HIMA 3PZDA 1QVCA 2R92H 4TSSA 1B9RA 1T0SC 2FINB 2PTLA 3LB8C 3TMPB 3J80L 2C7HA 1B9NA 4A3EH 4IZ8A 4ZRKA 1S40A 1V6EA 2NVQB 5FKAC 4A3GG 3GTQB 1WRIA 1U4RA 2Z6KC 5FO7B 5J39A 4WORA 1YOVB 3R2IA 4IFDG 2KVRA 3K9PB 4L2YA 2FXQA 1HNXQ 4QAYA 1GB1A 2KVMA 2GBJA 3MXNA 2YYZA 2MJDA 2OJRA 1NBWA 2CR5A 3PRMB 1WRDB 4JV5L 4MGYE 3ZJTA 1WJ6A 1RCVD 5EKLA 1TKWB 1Y8PB 3PIOA 2LMCB 1F9PA 2RKSA 3VTUA 1CZWA 3EECA 2UU9L 2BYVE 2ID0A 2MP1A 4RM8A 1A63A 3ZJVA 3LWUA 4YWMA 1S5DD 4I6LB 2NBUA 5C0XI 1BDOA 3RUZA 4BBRB 2WYQA 5KEEA 1WF9A 1RKNA 4HDOA 2SEBD 4WQOB 1J9OA 2F0NA 5C4XB 1P16A 3HOVG 4KSLC 4JI0L 1XPOA 1DOXA 2XIWA 5JZEB 2BT6A 1NYQA 3S14H 3DUZA 1TU2B 4ZAIA 1NDDA 3NJTA 1UUPA 4EGVA 4DV4L 2UXDQ 1N60A 2ZPNA 2ASBA 2ZW1A 1KH0A 3I73A 4KJNA 4CBVA 4DV5Q 1N36L 4BY7G 1XO3A 1ZOYB 2JA8B 3RZOH 1K8OA 1OEYA 2V9HA 4ZRIA 5M5YH 2LSSA 1SNQA 4MJSB 2JA5H 4GKJQ 4H7BA 2QCPX 1HPCA 5FO8B 4JI6Q 3APFA 1QOFA 3QQ8B 5C3EG 2Z59B 2NTSA 4ZKCB 4H02A 1STYA 3QR8A 3TZUA 5BMHA 3ZGZA 3K57A 5JEAG 4DUYL 3ML8A 3EQLC 3L2PA 3CCVA 3DEPA 1GUWA 2LVQA 5CV8A 2YLMA 4J15A 4GOCA 1HQRD 1KRTA 4HN7A 1AE3A 1YD8U 5LMNL 1KL9A 3QG1A 3TCAA 4F7ZA 5AFWA 1QLBB 4EZJA 3P7JA 3TDQA 2LXJA 2QEJC 4DN4M 1FRRA 2IT1A 3E9HA 3OOCA 1IYVA 5KIXA 3JVZX 1C7YA 1TKGA 3VR5A 1QF6A 3P4QB 5IYCG 2VXWA 3P4SB 1Y1WB 1EQRA 4HTHA 2Z0EB 4P6VF 5IIFA 2CU1A 3AB5A 3EBEA 5EBCA 4M8NA 1WCMH 5IYBH 2OWOA 4GN1A 3G7LA 1Z6HA 3ONAB 4DR3Q 1FPYA 1SE4A 4WJPA 2HJ1A 4K6LA 4P75A 2F3WA 5JJIA 1LTSD 1LO5D 4OWWB 4PT5A 2FE8A 3J81c 1XMQL 2BS4B 3NEMA 2CJOA 2EYOA 4LNQA 3CKIB 3IFTA 4IUVA 4JOIC 2Q2HA 2Y0SG 4PK1A 1HR0W 1CHQD 1JWBD 2INPE 1D6EC 4XTCS 1JQ4A 4GLXA 2X6LA 1V9JA 1XTCD 2KCNA 3NVZA 1KLUD 1VQAA 1L2FA 1EQQA 1OXSC 1PHJA 4A3MH 3Q8EA 1R9TH 1JMLA 3PUXA 1T6BX 1GUTA 3N6RA 5C44B 1SRUA 2CH4A 1JR0D 2I46A 4DR1Q 1Q1OA 2IO0B 2RMMA 3DHHC 2OTJA 3W1GA 2VUMH 3J80i 3FRPB 4LF7L 2K50A 4FJYA 2IHFA 2EVBA 2N4FA 1S3SG 1SJHD 2V4DA 3BZCA 4L6TB 5E4WC 3HOZB 1FR3A 4IURA 2OCEA 3AE1B 5M3FB 1HZ9A 2M9VA 4IUTA 3M4OB 1ZDXA 4X65L 1WYGA 3PO3H 3DCGA 1I94Q 2XK5A 3DOWA 2VQEL 3OJ4B 4KDLB 2V4LA 1JE4A 1K9MC 1T5XD 1UE6A 1F1HA 1YMHE 1IKMA 2G3QB 4NJ6A 1DOKA 2N0SB 2M19A 3QIJA 1PTOC 1JW9D 2XGTA 1Y14B 3KK7A 2LHEA 2ZCCA 3KJOA 3Q0AA 5D2MB 1B9MA 2L76A 2AUKA 2R2QA 4KKIA 3KF8B 2VNUD 3DQVA 4CYEA 2D9UA 4BKTA 2INNE 4KJOA 1QZEA 4CDDC 5LXHA 1CKMA 3AE3B 4LNKA 1PRTB 4JI5Q 4Y52H 2NZOA 2KQ4X 2EY6A 2I5MX 2MUYA 4GN5A 4A8XC 5C1ZA 1JORA 1WGRA 2NVQH 4BWGB 5M5WB 1YI2A 2KWUB 5J18A 4LFBL 2MBQA 4R1JA 1V1PA 3C46A 4JI3Q 3Q22A 1PTOF 4DUZQ 4GIVA 1CZGA 4XE0A 2QMTA 3RZDH 2WXHA 3PVLA 3BVGA 1Q5WB 1YN3A 1TWFB 2PPBC 3A1QA 4KSKC 4KVGB 3WCQA 5L95C 2X6GA 2PQAB 3HKZB 4KTAA 2ZPYA 2LUEA 3EFCA 1WFQA 3CW2C 3JAML 1P98A 3OW7A 3AEEB 2TMPA 1B3AA 3FPPA 2D2CC 3TJPA 3FEWX 5ELNA 4N8X1 4BBRH 2YU9B 3LX0A 1XLNA 4LF6L 2M0XA 4K7SA 2YEPB 5FLMH 4JYAQ 2UYZB 2Q8IB 3GO5A 1TWHB 5G3LF 5AUKA 5IGGA 4NZLB 1VD2A 2ZJQA 2W9NA 1VQMA 1OTRB 3PHXB 3L0OA 4A3DG 2WACA 2KK8A 2KC1A 2L0FA 4DR6L 1O7YA 3PLVA 2WDRB 1WFYA 5CMDA 2ICIA 4I6PA 2HCCA 1LGRA 3FPUB 1BNZA 2JA8H 2G9HD 4ODGA 5KRUA 2ZM6L 1UWMA 4QCLA 1E7ZA 3GTKB 4DR5Q 3H3VI 3N3KB 1R4MB 2Y3AA 1E10A 1YNXA 2HTME 1H4RA 3KVFB 3L3OC 2K8BA 2MNAA 1PH8A 3S1RB 4JX1C 3I90A 3TEXA 3ZTCA 1HZAA 3OTOL 1EEID 1MPEA 4LNOA 4A3BG 3DLLA 2EXZA 5NUCA 2JE6I 1TS2A 1L0YB 4WIPA 1LT4D 3PV0A 5FJ8G 2RHSB 1CZPA 2E2IB 1SE8A 3DHIC 1KAAA 4C56C 3RNCC 4HWIB 4GNXC 1ZKOA 4K8JA 1STNA 1WGDA 2IDYA 3NHHA 5I9PA 2J53A 2MBHA 3VQIA 1EY7A 4WRDA 4GSWA 2LFIA 2KMAA 3BVMA 3K0XA 3U58A 1DOIA 2RGFA 1RYJA 1OXUA 2WWZA 2GA4B 4HCNB 2Z6KA 2WDVB 3ZW3A 2C5CA 3I9V1 1SAPA 4QF4A 2P5ZX 4QL5A 2HQLA 4QIWB 3VHTC 3HOWB 1PH6A 1SYFA 3RN2A 1IBML 1YQ3B 1I4HA 3NPPA 2R2OA 4USAA 4XWWA 2JU6X 2OJWA 1N63A 2KCCA 3V6CB 4HDQA 1TWCB 3PZ8A 1L4DB 4DXGA 3FILB 2EYPA 1G51A 1NI2A 1ZEQX 1SIJA 2KLGA 2LASA 3NVVA 4W9LA 4IUNA 1J7AA 3NVWA 3BZKA 1I6VC 1EZ8A 1S5CD 4W9KA 2H89B 1NE3A 3U52E 3K6OA 4B0EA 1Q46A 1J8IA 3VRBB 1C4QA 5C44H 2PI2E 2ZTDA 3SEBA 2HD3A 3VA5A 4HIOA 2JUOA 3PIP3 1CHPD 1EF5A 4JBKA 4HJ9A 1E8YA 3TZDA 1MSHA 1IHZA 1FD7D 4AH6A 2PNHA 2K05A 2R6GA 4AUQC 1LTGD 2KEDA 3HOZH 5GAGC 2KDEB 5M3FH 4AP4C 4HPMB 4JI2Q 2RDBC 3HOYG 3QWNA 3BYTB 1CK1A 3AEVA 4X3SA 4XYCA 5T1IA 4FADA 1F2ZA 3S15B 4U68A 1IBLQ 3VVWB 4ABNA 1T0QC 3ETRA 1B44D 5JJZA 1FJGL 2D62A 2GBKA 1GNUA 2FIFA 3U7DA 1NNXA 4FA6A 3G6JB 1KABA 2K52A 1IW7D 4LF4L 3A33B 1V97A 2KMCA 3KWVA 3EVQA 3VH3B 3AE5B 2QDBA 3JAMi 1UELA 2K6QA 4ME3A 4HKQA 3ZYYX 1CJEA 3ZTDA 2M00A 2DJFC 1QKZA 2IO3B 1VCBA 4B3TQ 2JVCA 2LGYA 4RM9A 2GOWA 5M5WH 5K36H 5C23A 4YCVA 4WAFA 2JN4A 4K0KQ 5CORA 1ZKHA 5IY0A 4BXXG 4W9FA 1GJZA 1HUMA 1UE1A 4XT3B 1LTBD 2M4NA 1E24A 1JICA 2NBFA 3HG9A 2L8JA 1KC8C 1TWFH 2WXIA 3GS2A 3PT2B 4TV3A 2K28A 2GMIC 4AYBE 1H9MA 2MP2A 4YWGG 2O2VB 1TWGH 4HSVA 4W9JA 3S2AA 2Z1CA 2JT4B 4S17A 3GTOB 2KWDA 2A69D 2BB6A 2H5XA 4DK5A 1TJEA 1VQPA 2JXMB 1VQJA 3MAQA 4BY1B 2MA9B 2O2VA 1SXTA 1Q0WB 4JOIA 2R7ZG 2WKDA 5C5MA 3PF5A 3CRLC 4NXNQ 2BYFA 2GBRA 3NWTA 3RT3B 4IPDA 4RAUC 3WAPA 1IZ6A 3KDFB 2OF1A 4DV2Q 1NSNS 2HE7A 1WYDA 2F0QA 2WHIA 4G3XB 5HHDG 4DR7L 1MHXA 1CSQA 1B2TA 4ICVA 2K39A 5KNCA 2UUAL 2RDFA 4J1MA 2I07B 4DNRB 4BKSD 3TSSA 4LTUA 2RPVA 3GTKH 3N9YC 3D3RA 5M3MB 2WNMA 1GVPA 4B3RL 3NRZA 1EOTA 2BDNA 2Z9HA 4NPSA 1H95A 2SOBA 3K7UC 4K14A 4OXPA 2EYLA 1HTPA 2HHHQ 4JI7Q 3S1RH 3T13A 3VTVA 2CKHB 2WXFA 1V8QA 4IJHA 2JXTA 3L54A 3ZJUA 1IBXA 1F9RA 1UE7A 3Q24A 2WXKA 2QDLA 2EXDA 3L0WB 4HIKA 5EE1A 1SYBA 2ZTCA 3CC7A 2DENB 1RIPA 4FLHA 2E2IH 2XWJB 1KJTA 2DZJA 5FLXE 2ZXPA 3CU7A 1PRTD 1WXVA 2FBWB 1PH1A 4PZ8A 2YTXA 2ZNVB 2MHJA 5IGEA 3R7QA 2WXLA 3SR1A 1TZ1A 5C3XA 5LHY1 1BO0A 4TQ0A 1HZ6A 2JQOA 1S72A 1YJJA 1DGSA 2F0VA 5E6PA 3A0JA 1BCPD 3U9SA 2EMSA 4GDLB 5IYDG 2DWQA 4KK7A 3AEBB 1G2SA 4XIGS 1STHA 2EY1A 3M4YA 3PUZA 3W2DA 5HGTA 1T5EA 2REXA 3L13A 1Z47A 3LNNA 1EY5A 2PMZE 5BYQA 1PH3A 2N55A 2PW7A 1OEYJ 1FGBD 3HOWH 3PHWB 4FF3A 1K0RA 1RTOA 2RBMA 4MH0E 2WFWA 2Q2UA 2W82A 3GTGB 4KHZA 3S17B 3M85A 1K3RA 5BMGA 3D32A 4ZHOA 4DV3L 2NN6H 2L5TA 3BDCA 3J80c 2VW9A 2KHIA 1FM0D 3CCQA 1HTLD 2JA7B 4NAMA 1GKHA 4MNOA 5CC4A 3PO2H 1VQ8A 3N32A 1X3FA 3PV1A 2F0OA 2GN5A 1MGSA 5F2DA 1A6XA 2QJLA 3V6EB 4K3BA 4BBSG 4ID6A 1UBIA 1MFWA 1WR6E 2L0TA 4GDKB 4UP8A 1FYCA 5L83A 2CU3A 3ULPA 3KUCB 5J22A 1YN4A 2ONQA 1WTHA 1K83B 2C9OA 1GG3A 1T9HA 2R92G 2JA6B 3OMGA 1WXAA 1HR0Q 3AV8A 2N9LA 3ONSA 1Q8KA 2PEAA 1A70A 3PIO3 1PZJD 4H13C 1PXUA 4A3EG 4B9WA 3S15H 3JSVA 1ICFB 4JPBW 1VQNA 1WX8A 4R4OA 3AMUA 4C1NI 4E71A 2LWPA 4GOPB 2I0QA 5C4HA 2J42A 3QOJA 2Y5PA 3APDA 1Q1EA 3DHGC 3Q14C 4D2KA 2C35B 2XN9C 5BYSA 2SNMA 4IUPA 4J6IA 4EEWA 2LFNA 4LF9Q 4A3IB 1RJTA 4YTMB 4GNXA 3NVYA 4BAXA 2XWBB 2GBNA 1D5XC 2F4IA 3MC9A 1SDFA 2RDGA 5ELDA 3MP9A 5BO4B 1E7PB 2G9DA 3ZDTA 1B8AA 1DOYA 1XMOL 1WE6A 2DNFA 1TT2A 4MGZE 2DNCA 1N32L 3A4RA 1NMGA 1SJED 2B39A 2K14A 4CHTB 2WU2B 2RSNA 1FRDA 2IO1B 4GLVB 1WI0A 1WJUA 1G6ZA 1Q86C 4FP5D 3F8TA 4MGIE 5E4XA 1NVID 4A3OA 3MC0B 1R4NB 4MIUA 3GTOH 3B1LX 2VRRB 1EU3A 1XJVA 1QQRA 5COYA 4DKAC 3I4NB 4BY1H 5DPTA 3SFDB 1W6JA 3A4SC 3DWAA 3D4DA 1JC7A 1Z5SB 4ZRZA 4YHHQ 1AH9A 1LT6D 1VZ6A 2V3SA 1SE9A 2OXPA 3IVFA 2L12A 1TWAB 2G1EA 3CAMA 4DK6C 1CM9A 4P71A 4IWOA 1DOLA 2Q8RE 2ZJRA 4JI4Q 3A9JA 5M5XB 1B70B 3N1ZC 2J0KA 4J8QA 3I63C 1CKNB 4LFAQ 3TUOA 1PFBA 3SHQA 2A69C 3E3XA 2VQFQ 2GRIA 4GZYC 3K8AA 4YT0B 1DYQA 3VXWA 4KMUC 4OWXB 1D1IA 1EIFA 5IGBA 1NENB 3JW0X 3NZSA 1ASZA 2LGDA 4LNIA 4YWLA 4KHPL 3J7ZC 2F4VQ 5M3MH 4DAVA 2KACA 1MJEA 1L5PA 3TEZA 1EUVB 4EFOA 1JQYD 3BIID 2PYKA 5L37A 2DN8A 4Q2JA 3RZFA 1HNXL 2B8GA 4URKA 1ONLA 4DAMA 5IGDA 1ENAA 4L5SA 1GUGA 2NVTB 1JJGA 1YQ4B 3BYYB 1QOAA 2IYDB 1QE6A 3WWVA 4CGYB 1QCBD 4DDID 4KY5A 4W9HA 3TP8A 2L52A 1J5EL 1I35A 4YCWA 2UXCL 1XPRA 4TQ1A 1YJNA 2ZZPB 4ULLA 3G71A 3R7RA 3V62A 1WX9A 3OWEB 5CGKA 1WY8A 4ZOHC 2KNBA 1AWDA 3W1SC 3CCEA 5AJ3Q 1K52A 2FUHB 2G4SA 2K01A 4M01A 3SHLA 5C3JB 3T1HL 4KX6B 4M8AA 4FXKC 4GKKQ 1L1OB 1SYGA 2PZTA 4DK0A 1WSPA 1EU4A 3NHEB 2BS3B 2Q2IA 1XNQL 5BR8L 2EZVA 1NJIC 3NS8A 2IL8A 1L1OA 3MHBA 2M8SA 4REZA 5H92C 5EDSA 4FF4A 3CQZB 2PVOD 1YZ6A 4A6QA 1SNMA 3GTGH 2K5DA 3S17H 4GKJL 2BWES 3NBHA 4UPAA 4JI6L 2A74C 3VAWA 4FNFA 3NENA 2JA7H 1BCPC 2A19A 4MSQB 3DBSA 1WTPA 3A5UA 1NUCA 1LTID 1GUSA 2KYWA 1JCKB 2L00B 1L6VA 4FJZA 4A3JB 1U4AA 3T3NA 3VH4B 4AS1A 2X38A 1Z2MA 2RSOA 5LL6X 2PW9A 1YNJC 4LJZC 4HROA 2K5QA 3CPFA 1WJNA 1SIFA 2KHJA 3S16B 3U4EG 1VQ4A 3CMEA 3RNFC 2K32A 3AU7A 2MBBB 3M63B 1X65A 2JA6H 3OAWA 3QHTA 4JBWA 2WX0A 2UUCQ 3JAMc 1BCPF 3DM1A 3I72A 3NBIA 4A3KB 2ZVNA 4OX9L 3ALBA 4DGZA 4DAYB 4QUCA 4BBNC 1MD2D 1DONA 4C7YA 4E6IA 1F2YA 5CTRC 2PE9A 1LM8B 1I4PA 2MRPA 2CJNA 2XRQD 2MX2A 3VR4A 1TY2A 4DAYA 3KQ4A 2K5HA 1F9JA 3V3XA 2KQ3A 2WB1G 3X3NA 4X62L 3DHQA 3Q69A 3RNUA 1U9RA 3MXNB 2D3BA 1RHPA 4NMZA 1PQSA 3I4OA 2LY7A 3H0GG 1GAQB 4Y7NB 3RZWC 3K5LA 5C0XH 3PUYA 4HIDA 3LXFA 4JL9A 4XX5A 3FVQA 2F0FA 3FKIB 2J4XA 3M7NA 3KOJA 4YY3Q 3S1QB 4DR2L 2GVAA 1HZBA 4LUZA 4BBNF 3JC66 1FL0A 5KNBA 2GB1A 2EJMA 3J7AV 3NUCA 1ET6A 4NXML 1FFVA 1C4AA 2CHWA 1GM5A 2W3RA 3Q3MC 5HY6A 3D8GA 2R93B 2LRUA 1U0LA 1Y1VB 4I6NB 1S3OA 2RSUA 1QG7A 3HOXB 2RVLA 4PQXA 4C3JH 1MHHE 1O80A 5CX3A 1SGHA 3CIRB 1KOTA 2JSOA 2VS1A 2LD9A 2KTFA 2E5LQ 5AEKB 1H9RA 1V81A 3APCA 2RPQA 1KLGD 2I1JA 1N6ZA 3I4NH 3OPOA 3OMCA 2IJ0A 2JA8G 3M7GA 3EN2A 3WDNA 1C8CA 4A3GB 1WGYA 2KFKB 4N9F4 4G4KA 1Q7YC 4R3DA 4B3SQ 4KD3A 2IWHA 3QK0A 5ELBA 1KRHA 1EY0A 2EYFA 4N6EB 1X6OA 1TWAH 4EVOA 1N34L 4LF8Q 1DZ1A 5IT9L 3W5VB 3NXWA 2KFKA 5M5XH 2LXAA 1VQKA 1EIGA 4OHJA 1R4NI 3GE3C 4IDIA 4A20A 5CHVC 3MZ5A 1UGJA 1XEEA 4YIJA 4FBJB 4PMCA 1C78A 2ZT9C 3RLNA 1HNWQ 2KN5A 2PJHA 3TQYA 2EMTA 1F2RI 1J0GA 1JMCA 1QILA 5ELFA 3MEFA 1K3BC 4L5QA 2PW5A 5CV4A 5TR5A 1VQLA 3KLSX 2Z4IA 4O2DA 3ZJYC 2ATWA 1TR5A 4DUZL 3HOVB 3QARA 2MHVA 4GB9A 4LDTB 4DK1A 4IM3A 1TIFA 4F7XA 4IUUA 2BKRB 4PG3A 4A90A 1WGHA 2MGSA 1PVOA 1MJDA 1UF0A 4DDGD 1D8LA 1R4QB 3J7A5 3EC8A 2WXQA 3H8HA 4CQNA 2MO1A 1KXLA 3U4ZA 3UE0A 4BY7B 1TS5A 3HP3A 3MXPA 2B63G 5EBDA 4A55A 2D2QA 3CC2A 5JVH3 2BW2A 2AWNA 5I6YA 3EIVA 1PH2A 3UDIA 3WALA 2NPTB 4BFRA 1L2NA 2CFMA 1UNSA 4X64Q 2N7JA 3DM3A 5FR3A 5MPOA 3E6ZX 5IP7G 1WIAA 3RD2A 4A3CH 4MSMB 3KBXA 4IUQA 2KQSA 2B2WC 2NPTA 1ESRA 1FXTB 3E0JA 3T1YL 5E7NA 4FXCA 1GUAB 1E9MA 4P1BC 5JAVA 2DX5B 4P16A 1RFKA 3HRZC 2J7ZA 5DCNA 1SROA 2MBOA 3E9IA 3CQZH 3UDGA 1YNND 4W9EA 2LS01 2Y0SE 3RN5A 1XF5L 3BWUD 4IALA 5JPMC 2KVZA 3GTMB 1IPGA 1P9DU 4X57B 3PUWA 1X56A 3HOZG 2NZ1D 2KN4A 3IG3A 1HEZE 3CF5A 3VR9B 1I4GA 3H6MA 2UUBL 3AU4A 4OW0A 3ZNZB 2B2VA 3A5ZB 5LXIB 2PZUA 4WJNA 2OEDA 3AE8B 2XK5B 5CHFA 4BOZB 4A3JH 4HCSA 3E56A 1PUTA 2N3SA 3PO0A 1K53A 5C5LA 1EL0A 2PCFB 1VZ8A 1WD1A 4YWKA 4JLCA 3IFDA 3VTWA 4XQNA 2E2DC 2JYOA 4APVA 3GTLH 3S16H 3T9LA 5JHBA 3UQBA 4KGTA 4N58A 2DHZA 4ARIA 3H94A 5ELEA 2PLPA 2BKFA 4OIKA 2B2TA 4IPCA 4C3HG 1VQ9A 3P1MA 2OEOA 2KWCA 1DCZA 3TEYA 2UU9Q 3WOFA 1Y8RC 2N9PC 5HKHA 1GUOA 4A3KH 1FCLA 2JA9A 4K5VA 4C3IG 2AUJD 3RCZA 1HTQA 1C1YB 3DWPA 1YHBA 2D07B 3OW2A 2A1AA 4X66L 4HPLB 1SMYC 2MLBA 1EWCA 2KECA 1V1PB 1PLFA 2B2YC 2WP8J 4JI0Q 3UDXA 3U30A 1RRBA 3Q6SA 2J52A 2NVYB 1SYEA 3GTQH 4R4TA 4RFBA 5I2XA 1HNZQ 3A1QB 2LXCA 3FAHA 4EKUA 4K8IA 2CHZA 4ASWC 1WJJA 1AZPA 3FKIH 3S1QH 3PGZA 3ZXVA 2CWAA 1D7QA 2JRHA 2F0HA 4RG1A 2PKOA 3KUZA 3M95A 3P4PB 3W1SA 2NB0A 3I4LA 2IGGA 2YTVA 5IO9A 4F8MA 1J19A 1IGDA 1OQYA 2E8GA 3TIXA 5J17A 3HZXA 3HOXH 1ESFA 3MA2B 2FCNA 2IX3A 4X3TA 1ILPA 2F3VA 1JWAD 4L1BA 1WTQA 2INCC 4Q0FA 4DUYQ 2D3GA 2ALYB 4OIJA 1KM7A 3HHMA 2VH1A 3AECB 3NOBA 2KAJA 1U4LA 5C4XH 4OZBA 3RYTA 4XZ4A 3CCRA 3H3VH 1PGBA 2LJ5A 4B08A 3AE7B 3N1XC 1Q81C 1C4PA 1I3QB 5EKKA 1JROA 1TQOA 1KQSA 1C0AA 3K7AB 4FDBA 1F9QA 2Z0DB 3A8KE 3MXGA 5I9OA 3L9AX 1BBUA 4IFDH 4WJOA 2BVCA 4QB4A 2KLCA 4UDUC 2M1MA 4LF5Q 4LNNA 1B53A 2WXGA 2QIEB 4MELA 5EKIA 2D11A 4WAAA 1S5FD 3BVZA 1CA5A 3GB1A 1M1KC 2EE1A 1ACCA 3GZNB 3D6CA 2JXXA 4IWQA 1E3PA 1A2UA 5CHWA 1YQBA 2N7EA 1X54A 4MTKA 3ULLA 4KLKA 1LXDA 3WA0A 1K0SA 4H44C 4WJ3M 5BN3A 5IP9G 1W3SA 2CWPA 2PVGC 4IFDI 1XMQQ 4EE2A 4JI1L 5C0XJ 1YVCA 4K2KA 2KCTA 3J7AF 2YVCA 4LLGM 1IYJB 1M8AA 1STAA 5DPWA 2JZZA 2GVBA 1EYDA 3GTPB 2NUCA 2DZKA 2WGSA 4ZK9B 2IY1B 4RF1A 4ANWA 2BTEA 1PMRA 2K5WA 4A3DB 1E5WA 1N9WA 4KZCA 1X3PA 2K22A 4FVMA 1VQ5A 1C79A 1RWSA 2L11A 2O4XA 2RCNA 3TRZA 4OO1G 4LMQD 3E9SA 3C8YA 1Y1WH 1Z7TA 2GLSA 2JF5A 1C9FA 3MJ5A 2CQOA 2YV5A 2Q5WD 3H09A 5E6OA 2MCNB 1JJCB 1CT1D 4JK1C 5H8YE 3IKJA 5CYUA 2SAKA 3J81E 1HFNA 2X8XX 2D10A 1EUJA 3GE8C 5BMIA 2NR2A 4X65Q 4M1UB 4M00A 4DV0L 2VQEQ 1FXIA 1WXSA 1RAXA 2L0CA 4KD4A 4A3BB 3PO2G 1MI0A 1UBQA 2BWFA 2WXMA 4G50A 5AZGA 1XCQL 4TRDA 4KHVA 2PMVA 3SGIA 2LVOA 2F0GA 1WZ0A 2LJIA 2K25A 4HKZE 4ANVA 1TBEA 1NEKB 2KTRA 1NR4A 2NS5A 4ITKA 4GXBA 3Q8BA 3HUIA 4X3KA 3DDCB 4WWOA 2KQ7A 3T51B 2XBBC 4MZ9A 4ZUJA 2BGFA 3AYHB 4XQJA 2KCMA 3GD7A 3H6NA 1LLRD 3N20C 5IYCH 4RGTA 5GAHC 4GS3A 2HHHL 4JI7L 3I70A 4M0WA 1VQCA 2QW7A 3MXUA 5JVG3 4DV7L 1G6PA 1KF6B 2N8NA 2XRSD 4KY6A 2WXPA 5GXGB 3KLWA 4R8IA 4LWCA 2F1MA 3E5SA 2MJ8A 4DV6Q 3M4OH 5IWAQ 1YNNC 2B3GA 1C48A 5DM63 4POGA 2MSED 3UDFA 3Q8FA 3NUHB 4JWUC 1P3QU 3KYDD 3CCUA 4RMFA 4Z9CB 1R4PB 1SMXA 2A68D 2M17A 3RNGC 2D0PA 1G2TA 3TP6A 5CV9A 1WTRA 5DM73 1SE2A 1YIWA 4B3ML 3AM9A 3KWLA 3SDZA 1HA5A 4DK3C 4IJLA 4L23A 1XX8A 4LF6Q 5AUIA 2KA7A 3OLMD 2PI2A 2JWUA 4KI0A 1G91A 3QX1A 2N1VA 3K9OB 3A9KB 4C4VA 4WJQA 4OZCA 4PMWA 3I5JC 3MVVA 3SD5A 1V1QA 4AQYQ 3I4MG 4I7ZC 3HOUG 3KF6A 2MP2B 2EJFC 3VR2A 5I4DA 3A9KA 3V61A 2KWVB 4IOIE 1KRSA 3MFGA 2BE5D 1HCZA 2ZM6Q 4N9PA 1VF5C 4QJFA 1NR2A 2EYMA 4PZ6A 5D65A 1P8LA 1BKBA 4P72A 4FO2A 2O6VA 2JY6A 2LGIA 1QOBA 3NP8A 1IBKL 2NCNA 1ZUD2 3IAM1 1JE5A 2F0JA 1SNPA 2FMMA 3RD4A 4HLEA 1LFDA 3EFXD 2JYTA 1LT5D 5E3FA 3OTOQ 4FF2A 2YU9H 2JWZA 1N8RC 5EPKA 1O7IA 1HR0L 3S2DB 1WWTA 1PZKD 1TWHH 3R3OA 4PMBA 1FNUA 1L0WA 3ZLZA 1I3QH 2XNAC 1BMLC 4DWFA 2BCOA 4B95A 5IOIA 1IYFA 3BINA 2ZXOA 1SFOB 1X1MA 4AYBB 2WXNA 1PYBA 1WXQA 1L4ZB 2WKCA 4LFCL 3HRDD 2OHFA 4DV1L 2WV6D 1PV4A 1SNOA 3CSFA 4QY7A 2MJ3A 1VQDA 1XNRL 1JJ2A 2LGSA 4N59A 4NJCA 1IBXB 4QQBX 4K81A 1BQQT 2KDFB 3Q8AA 4ZRQA 2B8FA 3B2FA 1MI2A 1J7BA 3B0AA 1PTOB 3H91A 1WOCA 4JI8L 1M4VA 4JVZA 1VQGA 4A93G 2R7ZB 3TBLD 2KHSA 1B50A 2A6HD 1HE8A 2MQJA 3RMKC 2JSVX 2KJ6A 4NJ7A 2GI9A 4L5RC 1VQ7A 4A3LG 2EOTA 4MN3A 1JRUA 5A2QL 2ZCBA 4H2AA 4E74A 3GZNI 4J3OD 1Q90A 3I3CA 1W2BA 4F8CB 1QNUA 2F0SA 1AARA 2MJEA 2WXOA 3ZO5B 1SBBB 5DLQE 4P7IA 2VY3A 2BDOA 3FMCA 1HHVA 4ICUA 4AOFA 1XYIA 2QKIC 2B2YA 1GJXA 4EQNA 4W9IA 2A6ED 3K5MA 3DBLI 5EPJA 1EYAA 1FVIA 3AXCA 1ZYRD 4CHKA 2HDMA 4RKBA 2K7VA 1K8RB 1SF0A 4A9AA 3DBRB 2F0PA 4IN3A 2A5UA 1QUQA 5GROA 2CCZA 2L1AA 1C3TA 3IAYA 1N62A 4XYQA 2W3SA 4IM2A 1OO9B 4K7WA 2L3ZA 1EY9A 4NY0A 4A3FB 1WGGA 3QA8A 4IFDJ 3CD6A 4A3BH 4RHRA 3HVDA 3A7LA 2Z8LA 1HRJA 2F0TA 3OJ3A 1CQVA 2VQFL 3ERSX 1TWCH 4R9WA 1QZGA 1SEBD 1FJGQ 2A4ZA 5HG2A 3RNAC 5LNK1 2V0GA 4II2B 5LL6S 5D7GA 2DAJA 1RODA 3J81j 3QO2A 2FCQA 1FO4A 1M94A 4GMVA 3RI7C 2WIIB 1YEZA 2LZ6A 5D94A 1EQVA 2EQSA 3U50C 2JA6G 1YX5B 2JYEA 1N33Q 4IPGA 4JIOU 5GMVA 2PMZB 3PRZA 4A4IA 3F2CA 3AN1A 4KKJA 2I2YA 2A73B 2JJQA 2B3AA 2KANA 1UAPA 4DHZE 4BOSC 3JSVB 3PTFC 1A15A 1IGCA 2H4OA 5LMUL 1HUNA 3T16A 1KTKA 4W9GA 3AE2B 5D6JB 1CQFA 4N9TA 1ZXIA 4UY8C 3H3VC 2AX5A 1V86A 5HI1A 2VL6A 3T8MA 1ZP0B 1XWEA 5KHQA 4NQKE 2KJXA 5KNDA 2JRIB 3AFQA 5FLXL 3KJPA 3UF8A 5FR6A 4YSXB 2VH2A 1O78A 1I4RA 1YN5A 1MSGA 3C3LA 4NDXA 5D14A 3I56A 5C0XG 2UXBL 1E7VA 5C4JB 3EJIA 4GNXB 2MW5A 2KEEA 2KT7A 3SK8A 4MACA 5EGTA 1I7HA 5GAEC 1KAWA 4PV1C 4BBSB 5G5HA 3M3YB 3HVZA 5IT9c 4XT1B 3AEAB 1OXTA 3RR5A 4ZRJA 3EROA 4JG2A 1BT0A 4AJWA 1E0ZA 5LMNW 3CCJA 3DXJC 4DR7Q 4C3JG 5E1FA 2A68C 4P1CC 5G2NA 3VYRA 5K5PA 4HSPA 2ICEC 3BJUA 2UUAQ 2WAQG 1OTCA 1PH9A 1IW7C 4OZAA 1H9JA 3M3JA 3W3AA 3B2GA 4A3EB 1EQTA 4HAEA 2KDMA 2PO4A 1VQEA 4ZYSA 1UZXB 2DZMA 3V05A 3T4AC 3ZKJC 2WAQE 2DJGC 2M2LA 3PIPA 4B3RQ 2MPMA 2EKIA 2AQ1B 5EE3A 5D3DA 4DFAA 3BU2A 3X0WA 1AEXA 4PNYA 1AP0A 4JBMA 1BXTA 3CWIA 4PYUA 3VRAB 1XQQA 4XXEA 3DMUA 3H15A 3U7ZA 3A9JB 1E8WA 1GO3E 1C76A 3AE9B 3S2DH 2V1YA 3QC8B 2JA5G 1TVXA 2BE5C 3I7FA 3R8BA 4RGMA 3CMAA 1EIYB 3RN9C 1E1TA 3G6EA 2CVRA 3UE1A 3AMZA 4S0RA 1GC6A 3V96A 1FMAD 4C2MB 4CDEC 4HJ5A 1PH5A 1A62A 2NMQA 4DBGA 1CFMA 1LM0A 1U4PA 1VQFA 3A8JE 3WIMA 1PGAA 4ZCKA 2EYJA 1A3TA 3ER0A 2A8VA 3MHSD 1QZHA 1U5KA 3FC4A 3S14B 2KX3A 1SSOA 1PYSB 2E74C 3D4RA 1PTOH 1CMXB 2NVUI 4BA2I 1Y8OB 2NTTA 4A75A 4DNTB 2IO2B 1LYLA 1EFWA 5M9OA 4FXDA 3RZOB 2F0LA 2R7ZH 1PFMA
chains in the Genus database with same CATH topology
2HDEA 1G291 3IL8A 4WQMA 3MEHA 4C80A 1D4BA 1WD0A 1ZXTA 3SE0A 3NS1A 3R2TA 4K2LA 2XVSA 3TBIB 3ITPA 3SVMA 2OT2A 5KGUA 2ENBA 4KN7C 4AQ7A 3K5OA 1QT9A 3DWQA 2A6HC 1RD9D 5I2YA 5JXVA 3B9JA 3P4RB 3A55A 2DYMA 3NK9A 4C7ZA 1SB3C 4DA2A 1PRTC 3K58A 1D5ZC 2BA1A 5DNFA 5CV5A 1IYUA 2QILA 3TP7A 5FK9C 2CW0D 2WS3B 4XDXA 3J80E 2A6EC 4KY7A 2PIAA 4EQPA 2N9KA 2M56B 5T8IA 4CKCA 2KMMA 2EPBA 2E76C 5C6AA 4WH4A 1H9SA 3U2SC 1FCCC 2XSCA 1PRTF 3ND9A 4RH6A 2JEBI 2WINB 3K5NA 4F87A 1F9SA 2E2JB 1L0XB 2KOLA 1PYWD 3A54A 2WXJA 1PZID 3V2TA 1XLQA 2DY7A 1PTOD 2WDQB 4DU9A 2QSDA 1N5WA 1ZXHA 1ML0D 3F2UA 4ZHPA 1QOGA 1FD6A 1HFGA 2Z4HA 2IX1A 1QNKA 4HJGE 1TS4A 3P75A 4NP5A 2V4IB 1DGJA 2FUG1 5JPNC 2ON8A 2YEPF 2JQRB 2F0MA 3RFZB 4RCNA 3AE6B 2TSSA 4LK0M 1GXDC 1II3A 3OIPA 3W9CB 3NZ3A 3UI3A 1XXGA 1MBYA 4U673 5D3IB 4JE3B 2ZXRA 1CA6A 3AB9A 1LTAD 2I38A 2WB1B 3RZDB 3NTHA 3KBGA 3H0GB 1DXMA 3SK6A 3QJYA 2D5DA 3EA6A 4XYOA 1I4XA 4XDDA 5DAUA 3RMHA 1XCTL 4RGNA 5EPLA 5EQ0A 3VR8B 2FHTA 2LMCA 1ZDVA 1ILQA 2EELA 2L32A 4BA1I 3OIQA 1L0VB 4KGRA 1PGXA 1GB4A 5EE9A 1AZQA 1W6KA 5BN4A 4OGQC 4HCEA 4DQOC 1EY8A 3S9WA 1JWMD 3P1HA 4RCOA 2K33A 4YTPB 1ET9A 5HFYA 1K51A 3A8IE 4MM3B 4KV6A 2DYOA 2IX0A 4B0MA 5C3EB 3P63A 1AYFA 1DOMA 3TEWA 4DAPA 3Q8CA 2E75C 1VDVA 2ACZB 4UAIA 1FIQA 2BS2B 3C2PA 3IT4B 1NYRA 2L83A 1WGKA 3PZ7A 1VF7A 3MFYA 5HURA 1OQQA 1WTXA 4QMGA 1UEAB 4RHSA 2B63B 1HQMC 1VMCA 2BA0A 4O1NA 1IUEA 1TS3A 2VZKB 2HDLA 3BDLA 4TMAB 1JALA 2CW0C 3GV3A 2EJGC 3TN2A 1V43A 3ABVB 3JAME 4YSZB 4IKGA 2Y0SB 4FXGC 2RDHA 1LTRD 2NVXB 4QUFA 3VYSA 4RGOS 2MH7A 5E6JA 2V3PA 5K36G 2MEKA 1E2WA 5CR3A 1JWUD 3BS1A 2Q8TA 3NE5B 1FXAA 3NQTA 4G7HC 2H1EA 1EEFD 5CBEE 3QB3A 5G5GA 2O2LD 2AWOA 1O7LA 2HUGA 4G57A 2JZPA 4KGSA 1ICWA 2PQEA 4LAAA 3SXHA 2DLBA 1HXYD 2W55A 3UI2A 2VB3X 4FYDA 1CTMA 4V190 1MVKA 1PFDA 4C3HB 2NYZD 1U4MA 4OL7A 1FNVA 1LABA 2EY5A 3GQBA 4C3IB 3KF8A 5BYRA 1Q3LA 5IGCA 2QF7A 5A35A 1SSNA 1LTTD 4YSYB 1BCPB 1STBA 2O5IC 3NQIA 1ZE3D 1TWGB 3KLSA 1KFYB 3MWYW 3S1NB 5FOBB 3QIAA 1WTWA 4WURA 3R93A 1A3UA 1WTVA 4RNAA 1SNDA 1E0BA 3VYUA 5ELCA 3TP5A 1VCIA 1I4QA 1B1ZA 4KKUA 3URYA 1TKEA 2F0IA 4NKLA 2HQEA 4ZQ3A 1SYCA 1VRAB 2CQAA 2WP9B 3J9CA 1K50A 1FNWA 4MHEA 3LYYA 2SNSA 3P42A 4ZRPA 3T53B 4CJ0B 3SK5A 2O5JC 3U9OA 3VYTA 2EDGA 4HEDA 1FEHA 2B2UC 2VB2X 4KKSA 2E3TA 3IAS1 2NN6G 2K5PA 3X3MA 1PFNA 1JWSD 5JOBA 5JEAH 3I91A 4RA8A 1BF4A 1ENCA 3NTIA 1B4OA 4CKEA 2K0PA 1X3QA 5CBAE 1DM0B 1VMPA 3D31A 2LHDA 1NCVA 2F0DA 1XLPA 3D6WA 1SE3A 2FJ2A 3VA7A 2B76B 1SYDA 2K04A 3TMEA 2IGHA 1SNCA 3PO2B 1F2RC 1T3QA 1V8CA 2R3ZA 3BZDB 3GP7A 2M0AA 3FILA 1KDAA 3S1MB 3AEDB 1J7CA 1I6HB 1OXXK 2L1BA 4CJ1B 4ILWA 3KUPA 5T1GA 2PZWA 1EWHA 4JPSA 1IKLA 1TY0A 2ZW0A 1IL8A 5EJWA 3J81L 4WJWA 3MTSA 4R8NA 3I57A 5CV6A 1I50B 3HOYB 4O42A 1TKYA 1FFUA 5ISRA 1LV9A 3SR6A 2K3UA 1JOOA 4V0BA 1S4ZA 3SFEB 1OXVA 2B2WA 3C1FA 2IW3A 5C2TB 1LT3D 1X32A 4C1NK 3OHXC 3I8ZA 1UWXA 5A2QE 1STEA 5IODA 3DEOA 3BK2A 3AEGB 1S5ED 2K03A 3WOEA 3I4MB 3C1EA 2WLBA 1D2BA 3IXSA 3HOUB 1S5BD 2VZKD 3EUB2 4S3SA 5CV7A 1Y69U 3OSOA 4ME5A 3K0YA 3PMFA 3LWEA 2LKVA 1O7ZA 2K1BA 1PDQA 2BBCA 3MHZA 1JB3A 1VR9A 4HR7B 1Q10A 5BN5A 3AH7A 1D1KA 1Q12A 3AE4B 4JWSC 3QOLA 4J6HA 4GLSC 1EWYC 4X3UA 2JP1A 3D4WA 3HS0C 3VR6A 2N88A 1E2VA 3VR3A 2D5GA 1AW7A 1RTNA 3GV6A 1LACA 3GTJB 3NSWA 3RPFC 1JOKA 5KYLA 1Q8IA 4A93B 1HZ5A 4I65A 4HMIA 3S2HB 1JOQA 1Y8NB 1EY4A 1AFPA 2BB5A 2L9HA 1R7SA 2JX5A 2EYHA 2FMCA 4OO1H 3BDOA 1STGA 3KLRA 1WTOA 1GUNA 1YNJD 3DWMA 4XDCA 1KNEA 1A3VA 4DF7A 2CHBD 4IQZA 1NI3A 1K8MA 1Q1BA 4MT5A 1GOZA 2L4NA 1VZ7A 1A2TA 1XLOA 4OO1I 2FFKB 4EQOA 4FF1A 2AQ2B 3A56A 3BK1A 4K6DA 2E2HB 5FO9B 2NN6I 3NWSA 1P7FA 2JEAI 3NTKA 3P20A 3Q23A 1E2ZA 3PUVA 2RA4A 5JEAJ 2WQYB 1H9KA 1ROEA 4RKLA 1G8ZD 2BYTA 3HGBA 2R92B 1JRPA 2H88B 4YTNB 1KDCA 3HEJA 1ENFA 1EY6A 1PDXA 4G7OC 1AN8A 3SK4A 2B2UA 1DD2A 3EGRA 4US8A 4ZUIA 4H0LC 4RWSC 4LK1C 4HMJA 2HCIA 1YJIA 3N52A 1YNTE 3DWGC 1QOHA 3L4PA 1KDBA 5DEHA 3W5UB 3RLFA 2DY8A 2K6AA 1L6UA 3O13A 1TZOA 4C3JB 3T3OA 1OQRA 2WAQB 1BR9A 4XWTA 4ARCA 3ND8A 1HA6A 4B9XA 2F0KA 1D5MC 2B2VC 2R61A 3ERQA 5EE0A 2DBYA 1OFFA 2W54A 4US9A 4CKBA 4P2CB 4BS9A 3T56B 1TIID 5M5YB 1EFID 1N61A 4TQUS 2JA5B 1QJOA 3BG3A 4NAWB 2J0TD 4HRSA 1F77A 3ZQ4A 1C4CA 2B2TC 3CRKC 1EM7A 1C77A 4ZKBB 1BUVT 5J1ZA 4L63B 1GPXA 2EY2A 1GHJA 4HEA1 1VDZA 1GHKA 1ZPSA 1EIHA 4K5WA 2E6XA 2IPKD 4RF0A 2WU5B 4OVZA 1QB5D 2F03A 4YXDB 2X69A 4KKTA 1E6EB 2Y5CA 4MH8A 4L8JA 1KNAA 3L7ZC 1Y56A 2IGDA 2WXRA 2F0WA 1WVLA 3FDTA 2AQ3B 4XQQA 1NAPA 1WCMB 1QWYA 1RF2D 4KN4C 3CHBD 1H9SB 1DJRD 1ZYRC 4G7ZC 5IOCA 4F88A 2A5HA 1F2LA 1VLBA 5C3WA 2LEKA 1EZ6A 5IGFA 4NW2A 1BOSA 4Q5VA 2BOSA 5KYIA 4A3MB 4TKOB 4DXFA 1RDPD 2SDFA 2F0EA 1R9TB 4CJ2C 5TSSA 4ZLTF 3A7AB 5I6WA 1RM6C 1BBXC 1V1OA 2F0UA 1F0ZA 3K59A 4K5XA 2VUMB 2LUMA 2NWGA 1CI3M 2L55A 1N5XA 2V3NA 1F2MA 3OWFA 2RQXA 1SMYD 3PO3B 1TYGB 1VJKA 3GTLB 2KUMA 3AEFB 1EYCA 2K9XA 5C4ZA 3J7YW 5IT9E 1BUIC 4WWMA 2DNEA 4WFN3 3IT6B 5G3LD 2PNRC 1P7EA 4TSSA 1B9RA 3LB8C 2FINB 2PTLA 3J80L 1B9NA 4IZ8A 2NVQB 5FKAC 3GTQB 1WRIA 1U4RA 5J39A 5FO7B 4WORA 3R2IA 4IFDG 4L2YA 1GB1A 2KVMA 3MXNA 2YYZA 2MJDA 3ZJTA 1RCVD 5EKLA 1TKWB 1Y8PB 2LMCB 1F9PA 2RKSA 1CZWA 2ID0A 2MP1A 3ZJVA 3LWUA 1S5DD 5C0XI 1BDOA 3RUZA 4BBRB 5KEEA 1RKNA 2SEBD 1J9OA 2F0NA 5C4XB 1DOXA 2XIWA 2BT6A 1NYQA 3DUZA 1TU2B 4ZAIA 1UUPA 4EGVA 1N60A 2ZW1A 1KH0A 3I73A 4KJNA 4CBVA 1XO3A 1ZOYB 2JA8B 1K8OA 1SNQA 4H7BA 2QCPX 1HPCA 5FO8B 1QOFA 2NTSA 4ZKCB 1STYA 3TZUA 5BMHA 3ZGZA 3K57A 5JEAG 3EQLC 1GUWA 3DEPA 5CV8A 1HQRD 4HN7A 3QG1A 5AFWA 1QLBB 3P7JA 3TDQA 4DN4M 2QEJC 1FRRA 2IT1A 3OOCA 1IYVA 5KIXA 1TKGA 3VR5A 1QF6A 3P4QB 2VXWA 3P4SB 1Y1WB 4HTHA 4P6VF 5IIFA 3AB5A 5EBCA 3G7LA 1Z6HA 3ONAB 1SE4A 4K6LA 2F3WA 1LTSD 1LO5D 4PT5A 2FE8A 2BS4B 2CJOA 2EYOA 3CKIB 3IFTA 4IUVA 1CHQD 1JWBD 2INPE 1D6EC 4XTCS 1JQ4A 2X6LA 1XTCD 2KCNA 3NVZA 1KLUD 1OXSC 3Q8EA 1JMLA 3PUXA 1T6BX 1GUTA 3N6RA 5C44B 2I46A 2RMMA 1JR0D 5EE3A 3FRPB 2EVBA 1SJHD 2V4DA 4L6TB 5E4WC 3HOZB 1FR3A 4IURA 3AE1B 5M3FB 2M9VA 4IUTA 3M4OB 1ZDXA 1WYGA 1JE4A 1T5XD 1YMHE 1IKMA 1DOKA 2N0SB 2M19A 1PTOC 1JW9D 3KK7A 2LHEA 3Q0AA 1B9MA 2AUKA 4KKIA 2VNUD 2D9UA 2INNE 4KJOA 3AE3B 1PRTB 2KQ4X 2EY6A 4A8XC 2MUYA 1JORA 4BWGB 5M5WB 1V1PA 3C46A 3Q22A 1PTOF 1CZGA 4XE0A 2QMTA 2WXHA 3BVGA 1YN3A 1TWFB 2PPBC 3WCQA 2X6GA 3HKZB 4KTAA 3JAML 3OW7A 3AEEB 2TMPA 1B3AA 3FPPA 2D2CC 3FEWX 2YU9B 3LX0A 1XLNA 2YEPB 2Q8IB 3GO5A 1TWHB 5G3LF 5AUKA 5IGGA 4NZLB 2WACA 1O7YA 2WDRB 5CMDA 2ICIA 2HCCA 3FPUB 1BNZA 1UWMA 2G9HD 4ODGA 5KRUA 4QCLA 3GTKB 2Y3AA 1E10A 2HTME 3L3OC 4JX1C 3S1RB 3I90A 3TEXA 1EEID 1MPEA 2EXZA 5NUCA 2JE6I 1TS2A 1L0YB 4WIPA 1LT4D 3PV0A 1CZPA 2E2IB 1KAAA 4C56C 1ZKOA 4K8JA 1STNA 2IDYA 3NHHA 5I9PA 2J53A 3VQIA 1EY7A 4WRDA 2LFIA 3BVMA 1DOIA 1RYJA 1OXUA 2GA4B 2WDVB 2C5CA 3I9V1 1SAPA 4QF4A 4QIWB 3HOWB 1SYFA 1YQ3B 1I4HA 3NPPA 4XWWA 4USAA 2JU6X 1N63A 2KCCA 1TWCB 3PZ8A 1L4DB 4DXGA 3FILB 2EYPA 1SIJA 1ZEQX 3NVVA 4IUNA 1J7AA 3NVWA 1I6VC 1EZ8A 1S5CD 3U52E 2H89B 4B0EA 3K6OA 1J8IA 3VRBB 1C4QA 3SEBA 3VA5A 3PIP3 1CHPD 3TZDA 1MSHA 1IHZA 1FD7D 2K05A 2R6GA 1LTGD 2KEDA 3QWNA 3BYTB 1CK1A 4X3SA 5T1IA 1F2ZA 3S15B 4U68A 4ABNA 3ETRA 1B44D 5JJZA 2D62A 3G6JB 1KABA 1IW7D 1V97A 3KWVA 3EVQA 3AE5B 2QDBA 4HKQA 3ZYYX 1CJEA 2M00A 1QKZA 5K36H 4WAFA 5CORA 1HUMA 4XT3B 1LTBD 1JICA 2NBFA 3HG9A 2WXIA 3GS2A 2K28A 1H9MA 4YWGG 4HSVA 2Z1CA 3GTOB 2KWDA 2A69D 2BB6A 1TJEA 2JXMB 3MAQA 4BY1B 1SXTA 2WKDA 5C5MA 3CRLC 3NWTA 4RAUC 2OF1A 1NSNS 2F0QA 5HHDG 1MHXA 1B2TA 5KNCA 2RDFA 4J1MA 2I07B 4DNRB 3TSSA 4LTUA 2RPVA 3N9YC 3D3RA 5M3MB 2WNMA 3NRZA 1EOTA 2BDNA 2SOBA 4K14A 2EYLA 1HTPA 3T13A 2WXFA 1V8QA 2JXTA 3ZJUA 1IBXA 1F9RA 2WXKA 3Q24A 5EE1A 1SYBA 2XWJB 5FLXE 2ZXPA 3CU7A 1PRTD 2FBWB 5IGEA 2WXLA 3SR1A 5C3XA 5LHY1 1BO0A 1HZ6A 1YJJA 2F0VA 1BCPD 3U9SA 4GDLB 2DWQA 4KK7A 3AEBB 1G2SA 4XIGS 1STHA 2EY1A 3M4YA 3PUZA 3W2DA 5HGTA 1T5EA 4KX6B 1Z47A 3LNNA 1EY5A 5BYQA 2N55A 2PW7A 1FGBD 4FF3A 1RTOA 2RBMA 2W82A 3GTGB 4KHZA 3S17B 3M85A 5BMGA 4ZHOA 2NN6H 2L5TA 3BDCA 1FM0D 1HTLD 2JA7B 4NAMA 5CC4A 2F0OA 5F2DA 1MGSA 1A6XA 2QJLA 4ID6A 4GDKB 1FYCA 2CU3A 5J22A 1YN4A 2ONQA 2C9OA 1K83B 3AV8A 2JA6B 3OMGA 2N9LA 1A70A 3PIO3 1PZJD 4H13C 1PXUA 4B9WA 3AMUA 4C1NI 5C4HA 2J42A 3QOJA 2Y5PA 1Q1EA 4D2KA 2XN9C 5BYSA 2SNMA 4IUPA 2LFNA 4A3IB 1RJTA 4YTMB 3NVYA 2XWBB 1D5XC 2F4IA 1SDFA 2RDGA 5ELDA 3MP9A 1E7PB 2G9DA 1DOYA 1TT2A 2DNCA 1SJED 2B39A 4CHTB 2WU2B 2RSNA 1FRDA 1G6ZA 4FP5D 5E4XA 1NVID 3MC0B 4MIUA 1EU3A 1QQRA 5COYA 3I4NB 3SFDB 1W6JA 3DWAA 3D4DA 1JC7A 4ZRZA 1LT6D 1VZ6A 2OXPA 2L12A 1TWAB 2G1EA 1CM9A 1DOLA 2Q8RE 5M5XB 4J8QA 3TUOA 1PFBA 2A69C 2GRIA 4GZYC 4YT0B 1DYQA 4KMUC 1D1IA 5IGBA 1NENB 4DAVA 2KACA 1L5PA 3TEZA 1JQYD 3BIID 2PYKA 4Q2JA 2DN8A 2B8GA 1ONLA 5IGDA 1ENAA 1GUGA 2NVTB 1YQ4B 3BYYB 1QOAA 1QE6A 4CGYB 1QCBD 4KY5A 3TP8A 2L52A 4TQ1A 4ULLA 3OWEB 5CGKA 4ZOHC 1AWDA 1K52A 2K01A 3SHLA 5C3JB 4M8AA 4FXKC 1WSPA 1SYGA 2PZTA 4DK0A 1EU4A 2BS3B 2EZVA 2IL8A 3MHBA 4REZA 5H92C 4FF4A 3CQZB 2PVOD 4A6QA 1SNMA 2K5DA 3NBHA 2A74C 4FNFA 1BCPC 1WTPA 1NUCA 1LTID 1GUSA 1JCKB 1L6VA 4A3JB 3T3NA 4AS1A 2X38A 2RSOA 5LL6X 2PW9A 1YNJC 4LJZC 4HROA 2K5QA 3S16B 3U4EG 2K32A 3AU7A 4JBWA 1BCPF 3DM1A 3I72A 3NBIA 4A3KB 4DGZA 4QUCA 1MD2D 1DONA 4C7YA 4E6IA 1F2YA 1I4PA 2CJNA 2XRQD 3VR4A 1TY2A 4DAYA 3KQ4A 3V3XA 2KQ3A 3X3NA 3DHQA 3Q69A 1U9RA 1RHPA 4NMZA 2LY7A 1GAQB 4Y7NB 3K5LA 5C0XH 3PUYA 3LXFA 3FVQA 2F0FA 3FKIB 2J4XA 3M7NA 3S1QB 2OEDA 5KNBA 2GB1A 2EJMA 3J7AV 3NUCA 1ET6A 1FFVA 1C4AA 2W3RA 3D8GA 2R93B 1Y1VB 1QG7A 3HOXB 2RVLA 4PQXA 1MHHE 1O80A 3CIRB 2JSOA 1H9RA 1KLGD 3OPOA 3OMCA 2IJ0A 3M7GA 3WDNA 1C8CA 4A3GB 4G4KA 4R3DA 4KD3A 2IWHA 5ELBA 1KRHA 1EY0A 2EYFA 4N6EB 4EVOA 3W5VB 1DZ1A 5IT9L 3NXWA 4IDIA 1EIGA 4OHJA 3MZ5A 1UGJA 1XEEA 4YIJA 4PMCA 1C78A 2ZT9C 1F2RI 1QILA 5ELFA 2PW5A 5CV4A 3KLSX 2Z4IA 1TR5A 3HOVB 2MHVA 4DK1A 4F7XA 4IUUA 4A90A 2MGSA 1R4QB 2WXQA 3H8HA 4CQNA 4BY7B 1TS5A 3HP3A 3MXPA 5EBDA 4A55A 2BW2A 5JVH3 2AWNA 5I6YA 2N7JA 1UNSA 5FR3A 5MPOA 3E6ZX 3KBXA 4IUQA 2B2WC 1ESRA 3E0JA 4FXCA 1E9MA 5JAVA 4P16A 1RFKA 3HRZC 2J7ZA 1YNND 2LS01 3BWUD 1XF5L 4IALA 5JPMC 3GTMB 3PUWA 2KN4A 2NZ1D 1HEZE 3VR9B 1I4GA 3H6MA 4OW0A 2B2VA 2PZUA 3AE8B 4HCSA 3E56A 1PUTA 3PO0A 1K53A 5C5LA 1EL0A 2PCFB 1VZ8A 1WD1A 3IFDA 4XQNA 2E2DC 2JYOA 4KGTA 4N58A 4ARIA 3H94A 5ELEA 2PLPA 4OIKA 2B2TA 4C3HG 3P1MA 2OEOA 3TEYA 1DCZA 3WOFA 1GUOA 1FCLA 4K5VA 4C3IG 2AUJD 3DWPA 1SMYC 1EWCA 2KECA 1V1PB 1PLFA 2B2YC 2WP8J 3Q6SA 2J52A 2NVYB 1SYEA 4RFBA 5I2XA 3FAHA 4K8IA 1AZPA 2PKOA 2F0HA 3P4PB 3W1SA 2NB0A 3I4LA 2IGGA 4F8MA 1IGDA 3HZXA 1ESFA 3MA2B 4L1BA 2IX3A 4X3TA 1ILPA 2F3VA 1JWAD 1WTQA 4Q0FA 4OIJA 3AECB 2KAJA 1U4LA 4OZBA 1PGBA 3AE7B 4B08A 1C4PA 1I3QB 5EKKA 1JROA 1TQOA 3K7AB 1F9QA 3A8KE 3MXGA 5I9OA 3L9AX 4IFDH 4QB4A 4UDUC 1B53A 2WXGA 2QIEB 5EKIA 1S5FD 3BVZA 1CA5A 3GB1A 2EE1A 1ACCA 3D6CA 1A2UA 4H44C 5BN3A 2PVGC 4IFDI 4EE2A 5C0XJ 4K2KA 3J7AF 4LLGM 1M8AA 1STAA 1EYDA 3GTPB 2NUCA 4ZK9B 4RF1A 2BTEA 1PMRA 2K5WA 4A3DB 1X3PA 2K22A 4FVMA 1C79A 1RWSA 2L11A 2O4XA 4OO1G 4LMQD 3E9SA 3C8YA 1Z7TA 1C9FA 3MJ5A 2Q5WD 3H09A 1CT1D 4JK1C 5H8YE 3IKJA 5CYUA 2SAKA 3J81E 1HFNA 5BMIA 4M1UB 1FXIA 2L0CA 4KD4A 4A3BB 1MI0A 2WXMA 1XCQL 4TRDA 4KHVA 2PMVA 2F0GA 2LJIA 4HKZE 1NEKB 4ITKA 1NR4A 3Q8BA 3HUIA 4X3KA 3T51B 4ZUJA 4XQJA 3GD7A 1LLRD 4RGTA 3I70A 4M0WA 3MXUA 5JVG3 1KF6B 2XRSD 4KY6A 2WXPA 5GXGB 4R8IA 2F1MA 3E5SA 2MJ8A 1YNNC 5DM63 1C48A 3Q8FA 3NUHB 4JWUC 4Z9CB 1R4PB 2A68D 1G2TA 3TP6A 5CV9A 1WTRA 5DM73 1SE2A 3AM9A 3KWLA 3SDZA 1HA5A 4L23A 1XX8A 5AUIA 2KA7A 2JWUA 4KI0A 1G91A 4OZCA 4PMWA 3MVVA 4I7ZC 2EJFC 3VR2A 5I4DA 4IOIE 3MFGA 2BE5D 1HCZA 4N9PA 1VF5C 1NR2A 2EYMA 5D65A 4FO2A 2LGIA 1QOBA 3NP8A 1ZUD2 3IAM1 2F0JA 1SNPA 2FMMA 3RD4A 3EFXD 2JYTA 1LT5D 5E3FA 4FF2A 5EPKA 3S2DB 1WWTA 1PZKD 3R3OA 4PMBA 1FNUA 2XNAC 1BMLC 2BCOA 2ZXOA 1SFOB 2WXNA 4AYBB 1WXQA 1L4ZB 2WKCA 3HRDD 2OHFA 2WV6D 1SNOA 2MJ3A 4N59A 4NJCA 1IBXB 1BQQT 3Q8AA 4ZRQA 2B8FA 3B2FA 1MI2A 1J7BA 1PTOB 3H91A 1M4VA 2R7ZB 2KHSA 1B50A 2A6HD 2JSVX 2GI9A 2EOTA 4MN3A 5A2QL 4H2AA 4J3OD 1Q90A 3I3CA 1QNUA 2F0SA 2MJEA 2WXOA 1SBBB 2BDOA 3FMCA 1HHVA 1XYIA 2QKIC 2B2YA 1GJXA 4EQNA 2A6ED 3K5MA 5EPJA 1EYAA 1ZYRD 2HDMA 4RKBA 2K7VA 1SF0A 4A9AA 2F0PA 4IN3A 2L1AA 3IAYA 1N62A 4XYQA 2W3SA 1OO9B 1EY9A 4A3FB 4IFDJ 4RHRA 3HVDA 3A7LA 2Z8LA 1HRJA 2F0TA 1CQVA 4R9WA 1SEBD 5LNK1 5HG2A 2V0GA 5LL6S 5D7GA 1RODA 3QO2A 1FO4A 2WIIB 1EQVA 2JYEA 2PMZB 3AN1A 4KKJA 2I2YA 2A73B 1UAPA 1A15A 1IGCA 2H4OA 1HUNA 3T16A 1KTKA 3AE2B 1CQFA 4N9TA 1ZXIA 3H3VC 2AX5A 5HI1A 1ZP0B 1XWEA 2KJXA 5KNDA 5FLXL 4YSXB 1O78A 1I4RA 1YN5A 1MSGA 3C3LA 4NDXA 5D14A 5C0XG 5C4JB 3EJIA 2KEEA 4MACA 3SK8A 5EGTA 1I7HA 4PV1C 4BBSB 5G5HA 3M3YB 3HVZA 3AEAB 4XT1B 1OXTA 3EROA 1E0ZA 3DXJC 4C3JG