1D6EC

Crystal structure of hla-dr4 complex with peptidomimetic and seb
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
total genus 62
structure length 225
sequence length 236
ec nomenclature
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d6eC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d6eC02
1STEA 3BVZA 2AQ3B 2TSSA 1S5ED 3EA6A 2XRSD 1LTBD 1LT3D 1FD7D 1PTOD 1LT6D 1LTRD 1LTSD 1LLRD 1PZID 3BVGA 1PRTB 2IJ0A 1D6EC 1B1ZA 1SXTA 2NTTA 3EFXD 1ET6A 4K6LA 3CHBD 4RGNA 1PRTC 3OWEB 1EU4A 1QILA 1S5BD 1EFID 1HA5A 1LTAD 2AQ1B 1PZKD 1V1OA 5D3DA 1JR0D 1TS4A 2XN9C 1HXYD 1I4RA 1XXGA 5ELDA 1MD2D 1L0YB 1S5DD 4C56C 3BYTB 2AQ2B 3MFGA 1PYWD 1PTOB 1ENFA 1LT4D 1UUPA 4TSSA 4RFBA 5ELCA 4RH6A 1AW7A 4O1NA 1JCKB 1RCVD 1D5MC 1YN5A 3W2DA 1D5XC 1PZJD 1LT5D 1L0XB 1CHQD 5ELFA 1JQYD 3DWPA 4UDUC 1CK1A 3DWQA 1HTLD 3R2IA 1BXTA 1BCPF 1LTGD 3BYYB 5FKAC 1RDPD 1FNWA 1PRTD 4RHSA 4RGMA 4RHRA 1SJED 1PTOH 1I4QA 1EWCA 1DYQA 2SEBD 2CHBD 1T5XD 1B44D 1ET9A 4Z9CB 1PRTF 1I4PA 1CHPD 2XRQD 4L6TB 2Z8LA 1CQVA 1I4HA 1SJHD 4RCOA 1FNVA 1M4VA 4DXGA 1UNSA 2IPKD 1GOZA 1AN8A 2QEJC 4ZYSA 1S5CD 1RD9D 1SBBB 3SEBA 1SE4A 1SEBD 1I4GA 2WV6D 2XNAC 1FNUA 3URYA 1DJRD 1ESFA 1D5ZC 2G9HD 1V1PB 1SE2A 1BCPC 1EEID 1FGBD 2NTSA 1EU3A 1XTCD 1RF2D 1TY0A 1JWUD 1PTOC 3KLSX 1TS5A 1HQRD 1LTID 4NZLB 5ELEA 4RGTA 3R2TA 3MC0B 1CT1D 1LO5D 2RDHA 2O2LD 3DWAA 1KLGD 1YN4A 5ELBA 1BCPD 1JWSD 1YN3A 3GP7A 3R8BA 3V05A 5I4DA 3BZDB 1I4XA 1PTOF 1JWMD 4RGOS 3TSSA 2R61A 5TSSA 4DXFA 3O13A 1TY2A 2J4XA 1TS3A 3BVMA 1LTTD 1SE3A 1KTKA 2QILA 1TS2A 1G8ZD 4L63B 1KLUD 1S5FD 5FK9C 1F77A 4BWGB 1V1PA 4OHJA 2RDGA 2ICIA 5D3IB 1EEFD 1BCPB
chains in the Genus database with same CATH superfamily
4JG2A 3CPWA 5BYRA 4BFRA 3VR6A 3EECA 4PYZA 2I38A 2R6GA 5M5WH 2D0PA 1V49A 2WDVB 2YEPB 1J8CA 2QKIC 2L3ZA 3IFTA 2LMCA 4R4CA 1STBA 4LTUA 4KN7C 2JXXA 5IODA 4KY7A 1HZBA 1I50H 3AFQA 1SYEA 4RKBA 3ALBA 4F8CB 4MDKE 4XZ4A 4A3IB 4FA6A 4ASWC 4DGZA 4ZRIA 2BOSA 2NVTB 3G71A 4DF7A 4CDDC 2BWFA 2YV5A 3EBEA 1LYLA 4JPSA 2UUBQ 4JBMA 3U4EG 2CQOA 1YX5B 1EQRA 2O2VB 2E76C 3S16H 1CTMA 3EC8A 1J0GA 5KHQA 4YWMA 4HJ5A 3HG9A 1YQ4B 2LUEA 2XN9C 4C2MB 1XXGA 2EYOA 5JJIA 4A3OA 2A6EC 2WKCA 3RN9C 3ZTCA 3TQYA 2DZKA 2KXJA 3UINB 1EYGA 1I94L 3JYUA 4A3BB 5KNBA 3RNAC 2PW5A 4A3MG 1FJGL 1Q5WB 3EIVA 4MTNA 5ELCA 1E8YA 3KF8A 4E3CA 1LGRA 1KFYB 1GAQB 1X9NA 4JBJA 4W9IA 3PO3H 2GOWA 4PQXA 1L7YA 4WJQA 1KLVA 3JAME 1OQQA 1CKNB 4HPLB 1LTGD 3X3NA 2Z0EB 2WXHA 5BN4A 2O6VD 3AEFB 2N1WA 1B7YB 1LM0A 2EIFA 3H7PB 4OZAA 1D4BA 2C5LC 2OQKA 4C7YA 1C3TA 2F0QA 3KWVA 3N1ZC 1X1MA 5K36G 2FAZA 4GSWA 2FCQA 1KRHA 2VB2X 1MJCA 4CKCA 2JRIB 3A9JA 3I3TB 4REZA 1MSHA 1QKZA 2BH2A 2GI9A 1V6EA 5C4XB 3IT6B 3SGIA 5C0XI 3QARA 4KZ0A 4OVVA 3AB9A 3CD6A 5IGBA 3HZXA 2EDGA 3NHEB 2QEJC 4ZYSA 4DHJB 4NKLA 1CQFA 4DKAC 2UXBQ 3AN1A 2KC2A 4KGTA 1YNJC 2WV6D 1V2YA 4ULLA 2D3AA 1SMXA 1V9PA 1ACCA 2DNCA 1VF7A 3M7NA 2EKEC 5H8YE 5GAEC 2J0MA 3QOLA 4DR5Q 3KK7A 2NTSA 4GN4B 3VR3A 4DR2L 2UUAL 3P4SB 5BYQA 1SNOA 3AMUA 1Y8OB 4HIOA 3ER0A 1LTID 1JT8A 2VQFQ 2JZZA 3KW5B 4IC7B 4XDDA 3APDA 4NJ6A 4DUZL 2WB1B 1A2UA 1T9HA 3HOWH 4GDKA 2A74C 4MACA 4MTKA 5L37A 3BZDB 3G6JB 5CORA 5IO9A 4RGOS 4MHEA 1H9KA 1RLFA 2BKFA 2CKHB 2JZ3B 2PQAA 1VQFA 2NZHA 1II3A 1NNXA 1CSQA 3I5JC 1SE3A 1HFGA 5G3LF 3HOVB 2MJ3A 3DBRB 3QIJA 4N59A 2BTEA 1AZQA 2K25A 5J3BA 5CV5A 1QOFA 1B3AA 4DNIA 2IY0B 3HUIA 2DBYA 4YCVA 2W3RA 2LRUA 2ICIA 3NTIA 2V9HA 3TP8A 1X56A 1FFUA 4HCPB 3H6NA 4HCSA 1EQTA 4DV0Q 2AL6A 4HJGE 3EQLC 4A3JB 1VQ8A 2VL6A 2J7ZA 2R92G 3VR8B 2KBNA 4JI0L 2X8XX 1XJVA 1E7UA 2E5LL 3BINA 2PO4A 1F52A 4KKTA 4X62Q 3W5VB 3CKIB 3RNEC 4DV4Q 3E3XA 4NPSA 5JEAJ 5CV7A 4GOPA 1FL0A 1B1ZA 3T1HQ 2N9LA 3ETRA 1YNJD 2NTTA 2RSUA 1XPRA 5IKCM 1JRUA 2PE9A 3PF5A 4DK3C 3Q8CA 5FR6A 2WXOA 4A8XC 2KLGA 4KN4C 3G6EA 3NOBA 5DPRA 3BZKA 1C4AA 4LF9Q 1EZ8A 2ZXRA 1SYGA 4FYDA 4ZKCB 1SYDA 2CW0C 1EF1A 4XT3B 2E2HB 1Q10A 4XQJA 1PYWD 4GLAC 1YJ1A 2NWGA 2KVZA 1IPGA 1UUPA 4HJKA 3J81i 3KF6A 3GTPH 3H09A 1N36L 1MBYA 1FRRA 1GPXA 4BAXA 4YTMB 4XQNA 1RCVD 2JE6I 2I5LX 3VR2A 4A3EH 3PRZA 4NDXA 5H92C 3FAHA 1TWFH 1TU2B 3PUZA 1H9SB 3C8YA 3NZ3A 3NWSA 1HTLD 4MJSB 5JEAG 2CVRA 2MP1A 3TS0A 4U68A 3E9HA 4L8JA 4A3IG 4RHRA 3I2ZA 4N58A 4IUVA 1EWIA 1EWCA 1Q1EA 2HCCA 5C0XH 1Z5SB 5IY0A 3KLSA 4CHKA 4HKQA 4KJOA 1TYGB 2GVBA 1HR0Q 1ZPSA 1NEKB 1SMYC 2FBWB 4HJ8A 5CC4A 1CHPD 3DBRI 3FKIG 4IPGA 5JAVA 4A9AA 4GKKQ 5AUKA 3J81L 1ZXTA 1VMPA 1M4VA 1E0BA 3SXHA 2UUCL 1I42A 4LWCA 4DXGA 2M56B 1WGRA 1VQNA 4PMBA 2HUGA 4C4VA 4HIMA 1VQ4A 4ITKA 1F2YA 4G7HC 3RZWC 2L83A 1C4QA 3T13A 1L6VA 2XNAC 5EAYA 2XSCA 3BDLA 2NZ1D 1WYWB 3URYA 2VY3A 1B8AA 1AP0A 4M8NA 2G9HD 2E75C 1C8CA 1C1YB 4LF5L 1OEYJ 1BCPC 3NE5B 1WSPA 5EQ0A 3DBHI 3CF5A 3W1SC 1PLFA 2WAQG 1Y1WH 2ZPYA 5BYSA 5M9OA 3PS6A 3ECIA 4O42A 4ZCKA 2A73B 5BN5A 2D5DA 1EO6A 4CBVA 2K6QA 4LK0M 2EYLA 3MXGA 3RR5A 1IUEA 2KMMA 4HR7B 4DHZE 2PKOA 4P73A 2KACA 4LF8L 2GBRA 3V05A 3IVFA 2ZPNA 3FPPA 2UU7A 3KDFB 2OEOA 5CGKA 1GUAB 1FPYA 3VH3B 5LXIB 4C00A 4K5VA 2K03A 2JP1A 3HOZB 1G91A 3I4NG 3N52A 2YVCA 2K52A 4R8IA 2WXJA 5JVG3 1KL9A 4A3IH 1E3PA 4DHJD 4KHVA 5FK9C 5IWAL 1K9MC 1I5FA 4DU9A 1VQOA 1W6KA 4ZRQA 4U673 5IOCA 2R93H 1GHJA 4GMVA 3NBHA 3NY5A 1F9PA 4MT5A 1EY5A 2WP9B 2EYPA 4DV3L 5C1ZA 1Q82C 2TSSA 3C46A 2MBBB 2Y0SG 2WAQB 1SGHA 3VRBB 5D65A 1YJWA 5D6JB 3S2AA 3IXSA 3CAMA 4IUUA 3BS1A 3T56B 3KUZA 4N9F4 1XNQL 1J19A 4P16A 1WD1A 2O6VB 1G291 1BQQT 3P4RB 2NYZD 3EFXD 2I0QA 2L05A 2LASA 3PLUA 2I5MX 1IKMA 4W9CA 1SIFA 2SOBA 4WRDA 1S3SG 4WURA 3SR1A 3CCVA 5KNDA 3KLWA 2K39A 3AE9B 1YITA 3ERSX 3CCMA 2N9KA 4YWGG 3AFPA 2L9HA 3I4LA 4DV3Q 3L54A 1JR0D 3IRBA 2CHWA 4YCUA 3VDZA 1EY7A 2NZOA 1JWAD 3OG5A 1HXYD 3E0JA 1VS0A 3RNBC 3BYTB 2XWJB 2EY2A 2K8HA 3M85A 2L4NA 3KUCB 4XC2A 5AFWA 3AH7A 1XCQL 4ID6A 4UP8A 3R7RA 2F0TA 2LS01 3FPUB 3KBGA 4HPMB 1LT5D 1XPUA 3Q22A 1UH6A 4A3EG 2ZNVB 2KHSA 4LNNA 1JB7A 5KEEA 1YD8U 4PZ8A 3STBD 5EE0A 3TCAA 1L1OA 1FNWA 1XYIA 2PCFB 2LGXA 4K7WA 1F1HA 4B9WA 5AZFA 5J18A 3H0GG 2Z59B 4JI4Q 1YJIA 3PVLA 1WF9A 2IBIB 3D31A 2K5QA 2Y0SE 3E56A 3N1YC 2FNJB 4KSLC 5GADC 5JJKA 2LJIA 4JCVE 3MWYW 1ZXIA 4ZRJA 4LDTD 1LV9A 1MG8A 2PJHA 2IL8A 2IDYA 2JU6X 3NUHB 4MNOA 4RCOA 1GHKA 3CCUA 5IYDH 3ZJVA 4XT1B 3PCOB 4LF4L 2HD5B 3NSWA 2M1MA 3VA7A 5IYBG 1FFVA 3N20C 4IFDG 1NY4A 4Q0FA 3BWUD 3MP9A 2UUCQ 3G4SA 4LFAL 4HRSA 1SEBD 1F9JA 1EOVA 2KHWB 2SDFA 4JI4L 1QWYA 3Q24A 4XIGS 4RG1A 1CKOA 4IALA 1HNXL 2L7RA 2JA7G 2JYEA 3HHMA 3VXWA 3AEBB 3ZGZA 1PV4A 2IY1B 2MRPA 1WYGA 1KF6B 2EMSA 2FXQA 2L52A 3CPFA 3EN2A 4LMQD 1N32L 2WLBA 1F2RC 1ZYRD 1O7YA 1E7ZA 1BOSA 4HMIA 2HE7A 3GP7A 4B3TL 2HTHA 5GROA 5I4DA 1UELA 3OAWA 3NVYA 1YIJA 1XLNA 1LTTD 4LNKA 2GBJA 1ZYRC 2IO3B 1IXRA 1IBKQ 2J42A 1Y1WB 1V1PA 2UXBL 3K7AH 3S1RH 3ZYYX 2KTRA 5JPNC 5DPWA 3H1UA 3GTGH 5G3LD 2MA9B 4C2MH 2E2DC 4DR2Q 4WJWA 4JI7Q 2OQ0A 4US8A 3I4MB 4FDBA 5D14A 4XQQA 1FXIA 1WWTA 3V2TA 2K04A 1LLRD 3NJTA 2Q5WD 1V8QA 3PIP3 1ZDVA 1XMQL 3BK2A 1FR3A 2K1BA 4C3JB 4G50A 2YYZA 3W1BA 2O5JC 2WXKA 2XIWA 4AH6A 2UU9Q 2MW5A 5LMNL 2LHDA 1LTAD 3TMPB 4ZDVA 1YJNA 1V1OA 3ZUNA 1U4PA 3QOJA 4DV0L 1XO3A 4JK1C 2CH4W 4YXDB 3ML8A 3QCAA 1C78A 4PMWA 1T3QA 2ZTDA 1S5DD 2B63B 2Q2IA 5DPTA 3GD7A 3DCGA 4A55A 4TKOB 5C6AA 3LJ3A 2VZKD 3NZSA 2XTIA 3SK5A 3SD5A 2R7ZH 2L0FA 3DBSA 1HNZQ 3TREA 2JJQA 2G4SA 1VQBA 5LHY1 1L4DB 1UE5A 2B2TC 3ZRFA 2D10A 1NE3A 1JQYD 4ANUA 1AZPA 4A3LH 5EPKA 1C4PA 2JA8G 1W6JA 4LF6L 4ILWA 2XVSA 1WYDA 3VYUA 5FOBB 1FXAA 4JQWC 3KYHC 2K5NA 2Z6BA 1QCBD 4RGMA 2KKCA 2CFMA 3TP6A 4BBSH 5KNCA 3FKYA 2W55A 2BPSA 3PPAA 1DYQA 2MP2A 5I9OA 1EL0A 1H9JA 4K8IA 3HOXG 1PRTF 1KRTA 4ABNA 4KY5A 4ZQ3A 2OTJA 3H3VI 2BS4B 3H91A 1CZWA 1SJHD 3IHPC 4S3SA 4QIWB 3RUZA 3M7GA 1A70A 4KHPL 2GBKA 2B2WA 1J8IA 1NBWA 4M1UB 1QZGA 5AJ3L 4JVZA 3KJOA 5I2YA 2EOTA 1WGYA 2W54A 2XK5B 3WAOA 1VZ6A 2I46A 2WS3B 2Y5PA 5C4HA 2VNUD 4LNQA 1F9RA 2RCNA 1KAWA 2E6XA 4WIPA 1DOKA 2KCTA 2ZXPA 2D07B 2CR5A 3K0XA 2Z0DB 4FJYA 4GLSC 3GV6A 3CQZH 1QUQB 4DFAA 4HMJA 2KN4A 1IBXB 4GN1A 3I70A 4OZCA 5LNK1 1X3EA 3C1FA 2L55A 1ENAA 1N8RC 4PS3A 5EDSA 3S9WA 1WXMA 2F0JA 1EY6A 4GGQA 1WJUA 1C9FA 4OL7A 4A6QA 1I6HH 4DBGA 5IP7G 4DR6Q 5E6NA 1WTVA 2QC8A 4KGRA 1HZ5A 1PFMA 4GOPB 2UXCQ 3IAM1 2WGSA 4M0WA 2ATWA 3H7SA 1CSPA 4LF9L 5IP9G 4B3ML 1JMLA 1SRUA 3S1QB 1OTCA 3K7UC 4IFDI 1CZPA 3N3KB 2Z1CA 2CCZA 1B53A 4JOIA 2LRWA 1BUIC 4EEWA 1V97A 3CCJA 2LJ5A 3HKZG 1UWVA 1O7LA 4DV7Q 2BDOA 4LDTB 1NYQA 3H6MA 1SSNA 4LNIA 3RUIB 3MTNB 1AWDA 2IHEA 2PEAA 1L2NA 3TEHB 2FCMA 2J0TD 3Q0AA 4OWTB 2AWOA 5IGFA 2R7ZG 2HIVA 4N6EB 4FXDA 2MQHA 4NP5A 4O0AA 4C3IB 4PG3A 3CC2A 1VQ5A 2DNFA 2QDFA 3PGEA 1WTHA 1E22A 5BR8Q 3L2PA 4X65L 2K4KA 3TEYA 2X6GA 4II2B 3L0OA 4NJ7A 3IFDA 3AU7A 2K5PA 2MBEA 2QCZA 3S1RB 2B2WC 2EYFA 5NUCA 5GXGB 1HA5A 3MA2B 4W9HA 4IWPA 1SMYD 2AQ1B 1AH9A 2KK8A 2WXNA 1G2SA 2H1EA 4DDID 2DYOA 4HN7A 1Q81C 1NSNS 4OIKA 3AE5B 1N6ZA 2KVRA 1WD0A 3SVMA 3T1YQ 2KEDA 3CU7A 2PVOD 4MM3A 2A6HC 3ONSA 4JI3L 2G3QB 3WANA 3UF8A 1JCKB 2KD0A 1PYBA 3W2DA 3RD4A 1EUJA 2VQEQ 3S14B 3DBHB 1PZJD 1L0XB 1X6OA 4LFBQ 4GLXA 3WCQA 4DWFA 3FDTA 1HFNA 4N8FA 2HHHQ 1TXYA 3HKSA 3A9KB 4ZOHC 2Z6KA 3TEXA 3A8IE 3PV0A 3OOCA 2K50A 4FP5D 3S1MH 2PW9A 1K8GA 1U4LA 4BY1G 2DJGC 3ULPA 5E6OA 2N9EB 3Q6SA 2DY8A 4TQUS 5EE3A 4IPHA 1T5XD 2BYEA 3M4PA 1PGXA 3BDOA 3TZUA 1I4PA 3RNFC 3ZJTA 4KIKA 4AYBB 4EQPA 5J1ZA 4A93G 1WRDB 4P74A 3ZJYC 3KYCD 1D1KA 1ROEA 4DV5Q 2NR2A 4QQBX 2DLBA 2ON8A 1WX7A 2VXWA 2FHTA 1QOHA 3RMHA 1WR6E 1QJOA 2M9VA 1Q90A 3NWTA 3OHXC 1IYJB 4W9DA 4HVBA 1XX8A 2BT6A 3B9JA 5LXHA 3I55A 1SNMA 2BVCA 3QR8A 3ULLA 1GC6A 2NMQA 4BZAA 2KN5A 1EYAA 4BXXG 3HK0A 4EFOA 3C3LA 4K5WA 2FMMA 3NS1A 3H7PA 3QB3A 5M5XB 1FGBD 1STGA 2G5DA 3BU2A 3ICEA 5C5LA 1PTOC 1UD7A 2LFIA 3KUDB 1HQRD 3WOEA 4WAAA 3W1GA 4I65A 2CW0D 2RHSB 5C4ZA 2WKDA 2KMAA 3K7AB 4YY3Q 2R93B 5IAAC 1HZCA 4AJWA 3R3OA 3GQBA 5E4WC 4KD3A 2FIFA 1KQSA 3L7ZC 3NVVA 1NYRA 3R8BA 4MGZE 3KUPA 5HHDG 1T0RC 1GJXA 3J7YW 4DV7L 1GB4A 3MEHA 3I4MH 3K80C 1TS3A 3A5ZB 2EE1A 3CC7A 4HK2A 2VZAA 4W9LA 2M0AA 3U9SA 5DM63 1EYCA 2E2JB 1NCVA 3CQZB 1WIAA 3I63C 2Q8RE 1BBWA 4KD4A 4DQOC 2OTLA 1SF0A 3KVFB 2HTME 3X0WA 4ZHOA 3P7JA 1EEFD 1ESRA 2Z8LA 1CA6A 2ASBA 4NNJB 3OTOQ 3RN2A 1JC7A 1I6HB 3BVZA 2KDMA 2L8JA 5CMDA 3RNUA 1VRAB 1WR1A 3GV3A 1T6BX 3F8TA 4R4IA 2C60A 4DV1Q 4HJ9A 2YTXA 2B63H 2VZKB 2HIXA 1W3SA 4ZYNA 5J39A 4DR1Q 3PV1A 4EE2A 5IGDA 1JJCB 2WHIA 4L2YA 1ZGUB 3VQIA 3S1QH 2INCC 1E8ZA 2NVYH 2UXDQ 2F0MA 3S15B 4RGNA 4K6LA 2EELA 5IN7A 3LB8C 4RM8A 4G57A 1PVOA 5DPSA 3R3MA 3A1QA 2HJ8A 2L32A 1KNAA 1PH6A 5LL6X 4QUCA 2HDMA 5J22A 1G6JA 2WAQE 4A3LG 1ICFB 4ZRZA 2MJDA 4KKIA 1EIGA 3MHSD 1L0YB 5EKLA 4C56C 1KH0A 2DAFA 5C44H 3I4NB 4BBSB 3T4AC 3MZ5A 1Y8RC 2CU3A 5AZHA 2JYOA 1YNXA 1R9TH 4ME3A 2WFWA 5A35A 4JI7L 5HKHA 1A0IA 4MZ9A 1N33L 2BDNA 1VQMA 2NPTA 3DDCB 3EFUA 1GD7A 1UAPA 1STYA 3PT2B 1MKHA 2GBNA 1X54A 1JE5A 1STHA 4TV3A 3JC66 1IBML 3J7AV 4I6NB 3CCEA 4C3IG 1WTQA 1GC7A 4MSMB 1EY0A 5KYIA 4JI5Q 2LXAA 3EFCA 4PT5A 3ZQ4A 4Z9CB 4EZJA 4RCNA 1K3BC 2E2IB 1JW9D 4X57B 2C5CA 1QZHA 4JI2L 3UQAA 2N7EA 5C3XA 5CBEE 3Q3MC 4DAVA 2F3IA 2OCEA 2PI2E 5C2TB 4GKJL 3S1NH 4DV5L 1I4GA 2EQSA 1HNZL 4A3BG 2JY6A 2UWQA 2F1MA 1WZ0A 3CWIA 2NB0A 1DJRD 4K0KL 2KANA 4XYCA 3LWUA 2H89B 3CXCA 1J7BA 2JWUA 1IKLA 4DAMA 2PNRC 4P7IA 4H2AA 3JSVB 4E74A 1H95A 1TWCB 1PQSA 1G6ZA 2C9WB 1XLPA 2N4FA 2IGGA 3RLFA 1YQBA 4DV1L 1F9QA 4DK5A 4IURA 3M95A 5IYDG 4DV6Q 3B6YA 4A3KG 1QVFA 2HHHL 5ELBA 3QC8B 1BCPD 2E74C 3DQVA 4GXBA 1FEHA 1I4XA 2BYVE 1YNNC 3MHBA 5TSSA 4EGVA 4C4VB 1P7EA 2K5HA 2YTYA 3IKJA 4JI8Q 2NVQH 1IGCA 3ZXRA 3P63A 1SYBA 5M5XH 2EXZA 1TIFA 2BWES 3GS2A 4TQ0A 2L00B 1MJEA 3IFWB 2O2VA 1WOCA 3M4OB 1KDAA 4C3JH 2JSVX 2WXGA 2V4DA 4HTHA 4EX5A 1ASYA 2WXQA 3T9LA 4W9EA 2I1JA 1IZ6A 2LGIA 2L76A 1CZGA 3L0WB 1TWAB 3NQTA 1ZW7A 2RMMA 4UP7A 2XRSD 1DONA 4MELA 1TKYA 1KXLA 3DM1A 3L10B 3ZLZA 3KF8B 1LTSD 4IUQA 4YHHL 1TR5A 3TEWA 4AQ7A 4A3BH 2IJ0A 2KHJA 2MJ8A 2C7NB 2VUMB 4DNTB 1T0QC 4DR7L 2LVPA 3LDZE 3QK0A 4K7UA 4WFN3 3J7ZC 3JAML 1XNRL 3CW2C 5CHVC 1OXXK 5CX3A 1TS4A 3TDQA 1KABA 1BO0A 4XTCS 5CV6A 3UDFA 5KIXA 3CF6E 2MSED 1FRDA 4TKNA 5FLMH 1Y1VG 3TS2A 4BKTA 4A3CG 3S1MB 4RAUC 3MFGA 2F52A 2RSOA 2K32A 5KRUA 1G2TA 3H94A 1EF5A 4KLKA 1SSOA 2IHFA 2JQOA 2NVYB 1FYCA 2ZTCA 4W9FA 2JA5H 3V61A 4P75A 1AW7A 4GNXA 3AEAB 3TMEA 5C4XH 2CKZB 4USAA 2F0WA 2D9UA 4XX5A 2N9PC 2R3ZA 3FMCA 5EKIA 2JA6G 3PF4A 1MJDA 4QUFA 5CHFA 1CK1A 3P75A 2OF1A 4IOAA 4XYOA 4IPCA 1S40A 5GMVA 3HP3A 2VQEL 2PIAA 2WYQA 1A2TA 4L5SA 4KHZA 3AE7B 3VH4B 4Q2JA 4BBSG 4YTPB 1U4AA 2RDFA 2ZM6Q 4KX6B 2MBQA 1IW7D 2N8NA 4DR3Q 2C9OA 2AYOB 1V43A 2AHOB 4GDLB 1CQVA 1HTOA 4GS3A 1WY8A 4B3MQ 4CGYB 4F1SA 1K8RB 5AUIA 1UNSA 2D2CC 2PQAB 1S5CD 2Y3AA 1RD9D 1QNUA 2NBVB 1IW7C 1X3QA 1SYCA 4APVA 4K7SA 5KYLA 3GTQB 4LUVA 4IUMB 1D5ZC 1E5WA 1Y8PB 4X62L 5LMNW 3HOVH 4PK1A 3IBEA 1VZ8A 3H9DA 1LFDA 1EU3A 1MIUA 4H7BA 3BIID 1UZXB 2KX0A 2DYBA 4LFBL 3EROA 1R4MB 4WWNA 3KJPA 1HR0W 2JF5A 1JE4A 2JUOA 1TTNA 1LQBA 1Z6HA 2O2LD 1KM7A 5IE8A 1BBXC 4JX1C 3BY4B 1ZP0B 1R4QB 5HGTA 4FVMA 4UHVA 3AEEB 4LJZC 4CHTB 3VFKA 4MGKE 4IJHA 1JWMD 3A4RA 3TZDA 3O13A 2FIDA 3VAWA 3VYTA 2RCFA 3BVMA 4JYAL 2OJWA 3ZTDA 3ZIMA 3M4YA 4C3IH 5COYA 1QOGA 3PIO3 1TS2A 4DAYB 1TVXA 2B2VA 2F0GA 3PO0A 3K5OA 3RZDB 4FN2A 1F77A 5JEAH 2CHZA 5D3IB 3NTHA 2A6HD 3CCQA 2MEKA 2R2OA 4LNFA 1MPEA 1RTOA 2GN5A 2KQ3A 3WDNA 2VB3X 2WXLA 2JSOA 5BR8L 4CJ1B 3PSEB 1BF4A 4G7OC 1XPOA 5FO8B 2K8CA 1CM9A 1ONLA 3AULA 4FLHA 4ARIA 4RF1A 3S2DH 2BCOA 2PW7A 5C4JB 2KDBA 3Q3NC 1Z7TA 2B2YA 2NVQB 2V4LA 2PQEA 4B3SQ 5C44B 4NAWA 5G2NA 1XMQQ 5C44G 4CDCC 1RRBA 3X3MA 3H0GB 1HZ6A 4LF5Q 3BJUA 4N8X1 4XWTA 3M4OH 2KWCA 1V81A 1EQQA 2N1VA 4X66Q 1WFYA 3AE3B 4IN3A 1KD1C 3Q3JA 1C0AA 2K5VA 1B9RA 2A69C 5D3DA 1H8CA 2CH4A 3DM3A 4HPPA 1SE8A 2HCIA 1QOAA 2W82A 3NRZA 1RM6C 4FBJB 2ZTEA 1DGJA 2KDEB 3UE0A 4DN4M 1KHIA 3MHZA 3ZKJC 1CKMA 2R92H 2UU9L 2AWNA 2ZCBA 1F2LA 4KI0A 1EZ6A 1IGDA 1PGAA 5I2XA 2L0TA 1V9JA 3UDXA 1Q8KA 2L15A 3QIAA 5H1SE 1TGZB 2FMCA 2K6AA 4GZYC 2X6LA 1VQAA 3UE1A 1DOLA 2KHIA 3T53B 2RKSA 2JEBI 4NXML 1FJGQ 4DR7Q 3DVGY 3NG0A 3VTWA 1HJPA 1I94Q 2AUKA 4LW1A 4YHHQ 4A3FH 3AV8A 3B2FA 1T0YA 4HLEA 4WWPA 4MGYE 4DHZB 2KCCA 1TWCH 1Q3LA 4OO1G 5M3FG 2A5UA 1R4NI 4IOCA 1VR9A 3ZVVA 1E24A 4L1BA 2JQRB 2ONQA 1UGJA 4W9GA 5M3MH 3EGRA 2K5WA 3PRPB 2PTLA 2KFKA 3VR5A 5HY6A 1C7YA 2LVQA 2MBHA 3NZUA 4K81A 4MGIE 3SFDB 2F0DA 1D3ZA 2JX5A 1TQOA 4C3JG 1Q0WB 5JHBA 4X66L 1BVSA 4K3BA 2MHVA 4K3CA 1R4NB 3HOZH 1E0ZA 1PA6A 1BDOA 5G5GA 1WX8A 3UQBA 4JPBW 3J9CA 3T1HL 3QA8A 3PO2H 2E2JH 1E10A 3N30A 4OO1I 1VQGA 4FJVB 4L5TA 3I56A 4AJYB 4WQOB 4WAFA 2AUJD 2RDHA 1KLGD 4BBRH 2MO1A 3J80L 1D1IA 1SYFA 4WWOA 4A4IA 1UEBA 5HI1A 4ANVA 4WJ4A 1RAXA 1P3QU 1NVID 3GTQH 3D3RA 1E7VA 2J4XA 1YMHE 2V0GA 4M00A 3GZNB 2F0VA 4DR1L 1NENB 4NW2A 4WORA 1TKWB 4K0KQ 2CWPA 4Y7NB 3K59A 1PFDA 4KV2A 2N49A 1G8ZD 2LZ6A 1QB5D 4EQNA 3A1QB 1BR9A 3MJWA 4WWMA 3SHLA 4OHJA 4F7ZA 4EVOA 4G3XB 3SFEB 1K51A 2Q2HA 4KK7A 1M1KC 4TMAB 3DHHC 5EJWA 3NELA 4PMCA 2L0CA 3HOUG 1K52A 4FADA 1IYFA 2KJ6A 5ISRA 2EY5A 4JI1Q 2KT7A 5FO9B 2AEHA 2Z0SA 3B08A 2L12A 4QL5A 1VQ6A 1YOVB 2G1EA 4B9XA 1CMXB 3T1YL 2WNMA 3P4PB 4KVGB 2NPTB 4R4TA 5ELNA 4GNXC 3OIPA 1OFFA 3L13A 1NTGA 3QHTA 1E6EB 1ET6A 2D5GA 3CCSA 1JOKA 3OW2A 1EU4A 2V4IB 2MQJA 1P98A 4KKUA 4TVAB 3LNNA 3C0RB 5E4XA 4HROA 1PZKD 1B9MA 1VQIA 2SNMA 1IL2A 4UPAA 4GIVA 4X65Q 3LX0A 4XDCA 4POGA 4J3OD 2GA4B 2H88B 2WXIA 1NI2A 1GUOA 1MFWA 3GTLH 1LT4D 2J7QB 2KWVB 5IP4D 3VYRA 2D3CA 4FXKC 3A54A 4X3SA 3Q69A 3D6CA 2LEKA 3E5SA 1MHHE 4TQ1A 1FCCC 1YN5A 2KOXA 3Q14C 1EIHA 1MI0A 2J0JA 3AEGB 3EHVA 2PPHA 3I57A 1K73C 4CYEA 2VS1A 3PSIA 3APCA 4HWIB 5FKAC 3S1NB 1PDXA 4CKBA 5J2RA 1PRTD 3ZXVA 1Y8NB 4K2KA 5FO7B 3AXCA 1XT9B 1I6VC 1X32A 1GB1A 3DUZA 1SJED 2NN6I 2GLSA 1I4QA 2BE5C 4DUYL 3G7LA 2AWTA 1JJGA 3H8HA 1SROA 1RTNA 3U7ZA 3A55A 5C3WA 1PH2A 5C3JB 1B44D 1A62A 1YNND 3V6EB 2R92B 1RODA 1PH3A 3KFUA 2QMTA 2B2YC 3TN2A 2WX0A 3HVZA 4IWOA 3I91A 1LTLA 1V5TA 2JK8A 2WDTB 1FNVA 1EWHA 3CSTA 2RR9A 2ZW0A 1XTDA 3GTKH 3ULJA 1GOZA 2CQAA 2NN6H 4QF4A 1WGKA 1H9SA 3PO2G 3MVVA 4B9KA 4BS9A 2X38A 1WJJA 3JW0X 2B2VC 1MHWC 2H4OA 1WTWA 1HR0L 2AKWB 2DGYA 1E7PB 2KWUB 3TIXA 1XWEA 1TY0A 2F0HA 1TS5A 4OVZA 3KBXA 2AL3A 5IYCG 3R2TA 2LHEA 1STNA 1K50A 4C80A 3S24A 1YN4A 2LMCB 1IYUA 4Q5VA 2LKVA 3H3VC 2DZJA 3GTGB 1UBIA 2BS2B 1GG3A 3CCRA 2PZWA 1CI3M 2LGDA 4HCNB 4JV5L 4KSKC 4KJNA 2EY1A 1PTOF 2XBBC 1Y69U 2GB1A 3GB1A 5DCNA 3Q8EA 3S2DB 4HDQA 3AQQA 1TY2A 5C4JH 1QVGA 3PQIA 2RDBC 1YEZA 5D7GA 1BNZA 3TEZA 1Y14B 3ERQA 1N36Q 2JZPA 4DPGA 2JT4B 3PO2B 4G11A 5JH5C 4O2DA 3KQ4A 2IZVB 2KNBA 2KMCA 4US9A 3F2UA 3HOUH 4AQYL 5HURA 1BCPB 1WJ6A 3GE3C 4J8QA 4BBRB 1OGWA 2KQSA 2IYDB 2L1AA 2ZJQA 1RFAA 2MGSA 1EYDA 4NY0A 2F4VQ 1C9OA 1YZ6A 1VQKA 4A93H 1CJEA 3K8AA 1N34L 3I7FA 4P71A 3TRZA 2BB6A 1VD2A 1LTBD 1EY9A 1LT6D 1VDZA 1TWHB 1XMOQ 4LF6Q 3CCLA 3NS8A 2NVXB 3FEWX 1X3GA 2JA5B 3MXPA 2Z6KC 3RMKC 5EPLA 3HOYG 1V86A 1Q8IA 3S2HB 1E9MA 1IBLQ 2HQEA 4ICUA 3M3JA 4QB4A 1PH4A 3VR4A 2EJGC 2MPMA 1JWBD 2BGFA 3E6ZX 2EZVA 1I3QB 4X3TA 2LFNA 4LF7L 3A9JB 1GUNA 1K8OA 4BKSA 1JOOA 4A3FB 5DLQE 4BOSC 2FINB 2I1KA 3LXFA 4GDLA 4TSSA 5K5PA 3T3OA 3MC9A 2IO0B 3TP7A 1VF5C 1D5MC 4RWSC 3RZOB 3Q2AC 1D5XC 4KHPQ 1N5XA 2XK5A 1SAPA 1NR2A 1F2ZA 2EJFC 3E0EA 3B2GA 2JA5G 2BS3B 1F0ZA 3FVQA 4ZKBB 2EYHA 2BYTA 2K22A 2HDEA 2BW2A 1RWSA 3MC8A 2I2YA 3CP0A 4K8JA 2FFKB 1N33Q 3P2BA 4DV2L 4HDOA 3DVNU 1SR3A 2PMVA 2A8VA 4KDLB 1IBMQ 5CTRC 3DVGX 5JPMC 1EIFA 4A3JG 4JE3B 4JOIC 1F2RI 3MFYA 1YNTE 1J7AA 1J5EQ 2QJLA 2KECA 4GDKB 5D2MB 4F87A 2MH7A 1WE7A 3F1ZA 5JOBA 2ALYB 4CJ2C 2F3VA 4JI5L 3T51B 1XQQA 4OZBA 3DWGC 1C79A 1C48A 2AMCB 3R93A 4FXGC 1KDBA 1JRPA 2FJ2A 4DAYA 1NI3A 4JIOU 1L1OB 1L2FA 1I7HA 1BUVT 1WXVA 2BQQA 2KQ4X 4LJPB 4E71A 3OIQA 2MCNB 1Q46A 4Y7NH 1L4ZB 2Q8TA 2K14A 1N9WA 1RF2D 3RZDH 4I7AA 4ZK9B 1B3QA 2RF4A 5ELEA 1B2TA 4NZLB 2P5ZX 2WXPA 5EE1A 3A7LA 3X23A 1L6UA 2MFIA 2E5LQ 2B2UC 3PLVA 1FGUA 2NUCA 1X65A 4FULA 4YL8A 4YSXB 4BBRG 4DR5L 1DD2A 1WJNA 3PREA 1GO3E 1KRSA 1HNXQ 2K1FA 2K7VA 1EUVB 1OTRB 3Q8DA 4R3DA 3SK4A 3V6CB 1WXQA 3AB5A 1OQYA 5C5MA 5BMIA 4OIJA 3U52E 1XMOL 2NVUI 4R4QA 5HGQA 3AMZA 4IG7B 3D8GA 2HJ1A 1KAAA 4ALPA 3K5NA 2B8FA 4A75A 5GAGC 1KTKA 2MUYA 3HOVG 1G6PA 1D2BA 4AYBE 3OLMD 3QQ8B 3VRAB 3GE8C 4D2KA 3HS0C 3UI2A 2V1YA 2RGFA 2LSSA 4FF3A 2RQXA 4H13C 3J81j 1PH8A 2DUDA 2ZCCA 1V5OA 5JJZA 4B3RL 2IGHA 3HKZB 5M5YB 2BYFA 2A4ZA 3R7QA 4N9PA 4G4KA 4ZLTF 4HKZE 4EUTA 5M3FB 4ACFA 3QJYA 1GUGA 1S5ED 4MM3B 1AFPA 3DOWA 1LM8B 3J81c 1HPCA 1TT5B 2JRHA 2DX5B 3BVGA 3L9AX 4XXEA 4X64L 1PRTB 3TJPA 1ZEQX 4YIJA 1MHXA 4NAMA 5FR3A 4KKSA 3ZJUA 3RLOA 3U2SC 3VTUA 3W5OA 4MJSA 2ZEQA 3S14H 1S5BD 1D7QA 2FUHB 1UE6A 2RA4A 5FLXL 3CRLC 3QX1A 2JA8H 1QZEA 3HOYH 2D62A 4YT0B 3QAQA 5M5WB 3ONAB 3RN5A 1VQ7A 2A5HA 4ANWA 3NHHA 1WX9A 2IX0A 2F3WA 5FJ8G 3A33B 4MEMA 1FMAD 3I72A 4X6AH 1PTOB 5I6YA 1GJZA 1TWHH 3RT3B 1O80A 1SFOH 1WMHA 4J6HA 3OJ3A 1A3UA 1PXUA 1V80A 2JEAI 2E3TA 1VQHA 2K01A 1SE9A 3R66C 5KGUA 2WXMA 3GOEA 1YJ9A 1PFNA 2KEEA 2KFKB 5ELFA 3PUYA 1BMLC 2FCSA 1X55A 1UGMA 4EKUA 2UUAQ 3R2IA 5M3MB 1VLBA 2WXFA 3FC4A 2KUMA 3BYYB 3HKZE 1D8LA 5IWAQ 4RHSA 4W9JA 3MTSA 1DXMA 1U4RA 2YEPF 2KDIA 2HQLA 2XWBB 2V3PA 3GZNI 4DUYQ 1QQRA 2B2UA 3IL8A 3VHTC 1HZ9A 4K5XA 2KJXA 3WAPA 3U7DA 2HD3A 3U9OA 4L5RC 1OEYA 3RZOH 2XRQD 2OOBB 1ZE3D 5LL6S 1N5WA 4L6TB 2OEDA 4LNOA 1O78A 2LWPA 1MI2A 4S17A 4GNXB 3KDFA 1VDVA 3Q3OC 2ZM6L 2IPKD 1M8AA 5DEHA 2K3UA 1B50A 4C1NK 2F0UA 4XYQA 2F03A 3ND9A 2YU9H 3DHGC 3NVWA 3I8ZA 1KJTA 3GTJH 5EBDA 2R7DA 1FO4A 4B3SL 3SR6A 4ODGA 4LF8Q 1NR4A 2QGQA 4K14A 4X3KA 2IT1A 4EQOA 4LJOB 1Y1VH 4NQKE 3WA0A 1HRJA 1A5RA 1WFQA 1O7ZA 1U9RA 2MHJA 4CQNA 4DR4Q 3PZ8A 4P2CB 1RYJA 1LXDA 1HHVA 2A68D 4A3DB 3CMEA 1JQ4A 1SNDA 1YN3A 4RA8A 4A93B 3PHXB 2WDQB 1K0SA 2Q2TA 2O6VA 4I6PA 4B95A 3CSFA 3IT4B 5JHAA 5C3EG 2BF8B 4AWJA 1M94A 5C0XG 2EY6A 2ENBA 1ZOYB 2GRIA 2B76B 5DAUA 2B3AA 4ICVA 3A56A 4JI1L 3S15H 1HZAA 4MN3A 5EE9A 3SK8A 2VRRB 3K6OA 3E9IA 4F7XA 3K81C 2K0PA 1QUQA 2VW9A 3AE4B 3NVZA 3SDLC 1IBXA 2LXCA 1Y1WG 3PO3G 4IDIA 1A8VA 2MX2A 2M17A 3DBLI 2D0OA 1AE3A 3FKIH 1L0WA 2ZJRA 4A3MH 3ZNHB 2W9NA 1J7CA 1GKHA 1JJ2A 4KY6A 3I4NH 2Q8IB 3GTLB 4KKJA 5IT9E 3T8MA 1O7IA 3ITPA 3T3NA 4FNFA 3J80c 4JWSC 4R9WA 3HRZC 2PVGC 1N63A 2WU2B 1PH7A 1GUWA 3IG3A 4JI6Q 2BA1A 3Q23A 3CMMB 5T1IA 1UE1A 1Z2MA 1OXTA 5CHWA 3JAMi 3VDYA 2WU5B 3ABVB 3V3XA 5DM73 3OJ4B 4QY7A 4KV6A 4OWXB 5ELDA 3NK9A 1I4RA 3QO2A 1K28A 5EBCA 2JA7B 3B0AA 5K36H 1TBEA 2AQ2B 4JWUC 4BY1H 2QSDA 3HIZA 1E2ZA 3EJIA 4JL9A 1ZXHA 3C19A 1U5KA 1PUTA 3NENA 2A69D 2BBCA 3D6WA 1WVLA 4P1BC 4YCWA 4JBKA 2O4XA 3O65B 4XDXA 1L5PA 1TWGB 4RH6A 2KFJA 2QCPX 4FJZA 4W9KA 4L5QA 4H44C 1DOMA 1NMGA 4DK1A 4IUNA 2E2IH 1H4RA 5IYBH 3GDEA 4KGSA 1OO9B 3DWPA 1TT2A 3APFA 1KIXA 1FIQA 4MH0E 4L23A 3D0FA 5CV8A 3GTKB 1NMFA 3BZCA 1RDPD 1BBUA 2WB1E 1X3PA 2PYKA 4K6DA 2E2HH 2VH1A 3RI7C 4IW0A 5LLIA 2A19A 1PTOH 2AX5A 3FILA 1E1OA 3JSVA 1PGBA 1SFOB 4OELB 3PGZA 1XNQQ 2DAJA 3JVZX 3KYDD 3N9YC 4FXCA 1L0VB 3U8ZA 3AE2B 4QCLA 4NXMQ 3TL5A 5IA7A 1VQEA 1N62A 2IW3A 4A3EB 2MLBA 3AE1B 1WM3A 2B3GA 3NUCA 4K2LA 4IKGA 1TWFB 4QGUA 3DPDA 2OHFA 1XNRQ 2ASQA 2I5HA 5L83A 3E9SA 2ZW1A 1WCMB 2PPBC 3GTOH 3S17H 3BG3A 2IO1B 1AN8A 2F0SA 3KWLA 5G55A 3RCZA 1SE4A 3CC4A 3DMUA 3W9CB 3L08A 1XCTL 3ND8A 2V3SA 4IZ8A 3VTVA 4B0EA 1MSGA 2WINB 3A9KA 3I3CA 2K9XA 2A1AA 3M3YH 4N9TA 1ISNA 2XEWA 3I4OA 4BOZB 3FP9A 1HNWL 2N78A 2N7JA 2KTRB 1HH2P 2B29A 1K53A 2G4DB 2KDFB 1VMCA 1J6QA 3HOUB 4A3KB 4E6IA 5M3MG 5LMUL 1SNCA 4DV6L 5M5YH 4WJPA 1JOQA 2F0EA 2K5DA 4NQLB 2RVLA 5M3FH 1W2BA 1TWAH 2EXDA 2C7HA 1NUCA 3AEVA 3K9PB 3GTMH 4ZRPA 1A63A 1GUTA 1ZKOA 4AQYQ 4JI8L 2F0FA 4CDEC 3PTFC 3ZO5B 3F2DA 4ME5A 1IHZA 4EZLA 1H9RA 2QILA 1HEZE 4B0MA 2NVXH 2VUMH 5IP7H 1PHJA 1WTOA 4ZAIA 5LMNQ 3D4WA 5FLXE 3WIMA 1V1QA 3VYSA 2G45B 1YHQA 3DLLA 1V8CA 5AZGA 1GVPA 1STEA 2JA8B 1E2VA 5AEKB 3KOJA 4I6LB 4IUTA 1CA5A 4OWWB 4QMGA 1I3QH 4A76A 2CJOA 2QA4A 4IM0A 4PV1C 3L17A 5I6WA 4PS7A 1N61A 1LTRD 4XE0A 1IP9A 3I4MG 4RMAA 1D6EC 3I90A 3OYYA 2ES2A 3AM9A 3RULA 3ZNID 3OTOL 4DDGD 4B3TQ 4QJFA 3L4PA 4J15A 3OWEB 3J80i 1R4MI 1QILA 3NQIA 2C35B 1WH3A 2NBWB 4BKGA 4A3GH 1TIID 3RYTA 1WE6A 3A74A 5JZEB 3PUWA 2UUBL 2RPQA 1Y56A 4IPDA 1WZ3A 2YLMA 1FXTB 5G5HA 3PIPA 2JA9A 1HCZA 1MD2D 1QG7A 3JAMc 4B3RQ 4K1RB 3W3AA 4CKEA 1K0RA 3M62B 1ENFA 4BXXH 2W3SA 4EOYA 2Y5BB 2DWQA 4XGAB 2C7MB 2CHXA 4BY7H 1P0RA 4I7ZC 3P20A 3J7A5 2UXCL 4FF4A 5CV4A 2RBMA 4AUQC 3PIOA 4HJAA 4GOPC 1P1AA 4LK1C 2JA6B 1BXTA 4X64Q 4OW0A 2DJFC 4OGQC 2N88A 1STAA 5JJLA 2QHOA 3AE6B 1DOXA 2KJRA 1JMCA 1TKEA 4DNRB 1PH1A 4BA2I 3GTJB 3A4SC 1EIYB 4C1NI 2N9XA 4CDFC 5T8IA 1EQVA 1TWGH 4UP9A 1QT9A 4JI0Q 4B6WA 5HFYA 2RPVA 1YBYA 1DGSA 3ZNGC 4TUUA 4WJ3M 3UIPB 1KOTA 4II3B 1YHAA 3HRDD 2L11A 1AE2A 2B39A 5LMUQ 4A3DH 1A15A 2LGSA 4RNAA 1EOTA 3SEBA 1WI5A 4HSPA 1YIWA 2NBFA 3C2PA 3PZDA 1L1OC 1FD6A 3OWFA 1RL2A 2VUMG 1ESFA 5GAHC 4DV4L 5IP9H 4DR6L 2F0OA 1S3OA 2K75A 3STBC 4J1MA 1JALA 2A6ED 3K5LA 3WAMA 4AP4C 3KLSX 3A8JE 4IFDJ 1HA6A 2LXJA 2M4NA 1HQMC 3I9V1 2KJHB 4R8NA 2OXPA 1CT1D 4NB3A 4LFCL 4M01A 1AYFA 1F2MA 5EGTA 3N6RA 4JI3Q 3VVWB 5E1FA 4ARCA 1EY8A 3U50C 3A7AB 1Q1BA 4ZHPA 1XLOA 4DXFA 4OX9Q 2M8SA 4DAPA 3UGBB 3W1YA 2F4IA 3SDZA 3M3YB 3KLRA 2DNEA 3H0GH 2WP8J 2E8GA 1XD3B 3P42A 3WOFA 1KLUD 4YSZB 4HJ7A 5EKKA 4IM3A 1CFMA 2RDGA 2D11A 4IM2A 1WI0A 2WX1A 1HTPA 2NN6G 3Q8BA 4DR4L 5I9PA 4RM9A 2AQ3B 3G48A 4NXNL 5C0XJ 3HOYB 1N60A 3NPPA 3WALA 2KLCA 3A5UA 1VQPA 2JA7H 1UF0A 3GO5A 2CS4A 4IOIE 5IGGA 1EWYC 5MPOA 2BA0A 1GUSA 3MEFA 5IGCA 3AYHB 2KX3A 3L16A 3CMAA 3OPOA 2DZMA 4WQMA 1SXTA 5E3FA 4ZUJA 2HT1A 1HNWQ 3P4QB 3MXNB 4QAYA 4OVUA 2Q2UA 2Y0SB 1WGHA 3DVNV 3NXWA 1PFBA 4AIMA 1TKGA 3DHQA 4BBNF 4V190 3P1MA 2DENB 4UAIA 3V96A 4BKSD 4GLVB 2F4VL 4C3HB 4NXNQ 2V3NA 1QF6A 3HOXH 3RLNA 2K28A 3PHWB 4DR3L 1OQRA 5D94A 1WTPA 3PRMB 1HUMA 5CYUA 1ILQA 4BY7G 1ZUD2 4Y52H 1I50B 4LUOA 1S4ZA 5E7NA 1DZ1A 1IBKL 2PI2A 1PFSA 5A2QE 3H15A 3HGBA 1UEAB 1PH5A 4RFBA 1UWMA 4G0NB 4EQ5A 4O1NA 4C3HG 3F2BA 5BMHA 1A3TA 2H5XA 2ZT9C 5C4XG 4JC0A 1AARA 1FCLA 4DA2A 2KTFA 2WXRA 3UDGA 1ENCA 4LLGM 2ZVNA 4ZUIA 3MAQA 1MVKA 4AOFA 2YU9B 2A68C 2BH8A 1VQDA 2K33A 3OMCA 2ID0A 2KWDA 1UBQA 4A3CH 4A20A 2WACA 2R7ZB 5TR5A 4GB9A 2SEBD 4RMFA 2R2QA 2Z4HA 4BY7B 1WRIA 1ET9A 1RIPA 1Y1VB 1T0SC 4MSQB 3OW7A 3RNGC 3RD2A 3RZFA 3V62A 1SDFA 3J80E 4P6VF 5IT9c 1PDQA 2ICEC 1UWXA 3HVDA 5E6PA 4BA1I 1E8XA 4P72A 1CKNA 1FNUA 4EZKA 4PYUA 4LUZA 2LI5A 1AEXA 3EUB2 3IAYA 3N32A 2JXMB 2LY7A 3P1HA 1XTCD 1BT0A 3K0YA 4P1CC 3K9OB 2IY5B 2MP2B 3Q3FA 2B2TA 2JVCA 2R7FA 5ELOA 2KCMA 3ENEA 5HG2A 2LUMA 2CU1A 3HFZB 1WTXA 2QW7A 1U0LA 2UYZB 1P16A 1JWSD 3M4QA 4G7ZC 2MWSB 1X3FA 2YTVA 1E90A 3HEJA 2UXDL 3TSSA 3FKIB 2R61A 4M8MA 4A3MB 2EPBA 2REXA 1OXUA 5GQOA 2HDLA 4IJLA 2KVMA 2F0IA 1ML0D 4KTAA 3RFZB 4S0RA 3FRPB 1E2WA 1VQJA 4PZ7A 3AI5A 1E8WA 1WJ4A 3L3OC 1WCMG 4BBNC 2KAJA 3OMGA 3TUOA 1CUKA 2LXKA 1P8LA 1RFKA 3ML9A 4AYBG 5E6JA 2ACZB 2MO0A 2IX1A 3WWVA 2IO2B 4JGHB 3NTKA 5IT9L 4X3UA 4OO1H 2CJNA 1VCBA 3DBLB 4PS8A 1C77A 1FD7D 1PTOD 2VQFL 4BY1B 4FHJA 1PZID 3Q8AA 2J52A 3ZDMC 4JLCA 4A3FG 4FF1A 2INPE 1XF5L 4A90A 5FJ8H 3KH0A 4M0WB 1ICWA 1K83B 4IFDH 1LUZA 3CHBD 4HSVA 2F0KA 1PRTC 1A3VA 5CBAE 5AJ3Q 2K8BA 1JORA 2KQ7A 2PLPA 3DEPA 1T5EA 1A6XA 3W1SA 1I35A 4DUZQ 2V1CC 3K58A 4IWQA 3LGJA 4YY3L 5CV9A 1KDCA 2BE5D 3IAS1 4OEMB 1FM0D 5L95C 2EVBA 2PNHA 2JA6H 4GN3B 3U30A 1B70B 2NS5A 4CO7A 2Z4IA 3FILB 1RJTA 1HTQA 4H0LC 5FLXc 3H3VH 3UDIA 4M02A 3RNCC 1SB3C 1JROA 5J17A 2D3GA 4OX9L 2ZXOA 3ZRCA 2IWHA 3VUYA 4HIDA 1M90C 2WWZA 4JBWA 4KMUC 1GM5A 5IIFA 2B63G 2N3SA 3BK1A 3BDCA 1DCZA 2EMTA 2L5TA 2NVTH 4IO9A 2M0XA 2I07B 5FLMG 1QVCA 1C4CA 4OONA 1Z47A 3W5UB 3FHWA 3HM3A 3S16B 1FVIA 4C3HH 5T1GA 1P7FA 2PMZB 1WCMH 3GTOB 3S17B 5BN3A 1GNUA 1S72A 3M9BA 2KCNA 3VR9B 1DM0B 2BB5A 2QF7A 5BMGA 4WH4A 1NAPA 2JN4A 3GTPB 1NBFC 1OXSC 3VA5A 2D2QA 2CHBD 1S1QB 3QWNA 2ZZPB 1WMHB 3NP8A 2GBMA 3KF6B 3PO3B 1IBLL 1H9MA 1PYSB 4A3KH 1PH9A 2INDC 5DNFA 4C7ZA 4IUPA 2FE8A 1EFWA 4OXPA 2WB1G 5IYCH 4GKJQ 2DHZA 2J0KA 4R4OA 2IX3A 2NCNA 4YTNB 1DOYA 1SN8A 2SNSA 3J81E 1OXVA 1SBBB 2KZRA 2RHQB 3GTMB 2GMIC 1R7SA 1V1PB 2JWZA 3Q8FA 4F88A 4FHKA 1VJKA 2MJEA 2DYMA 3V60A 2L1BA 3PUVA 1EEID 3TBIB 1N34Q 1KNEA 3DXJC 5C3EH 4CJ0B 1HUNA 2VH2A 3DWMA 4JV5Q 2EJMA 2RSNA 1EY4A 2ZJDA 1ZKHA 1YHBA 3SHQA 1U4MA 2QIEB 3M63B 1WM2A 2Y5CA 1LO5D 1K8MA 3SE0A 3VUXA 4KIKB 5KHOA 4LCDE 1E1TA 2M2LA 2ZVOA 3I73A 1Q86C 3RPFC 4YSYB 3PZ7A 3T16A 4NPNA 3K5MA 1P9DU 1TZ1A 1SIJA 2KC1A 1IYVA 3D4RA 3TBLD 3AEDB 4DK0A 2LD9A 3MJ5A 4L63B 2N7DA 2LGYA 1IL8A 3SK6A 3PUXA 4R1JA 3PMFA 4WJNA 2DY7A 1F9SA 2FCNA 1N32Q 3Q6BA 3S2HH 4A3GB 4POFA 2BKRB 4WJOA 3U58A 2R93G 4RF0A 2B8GA 4UY8C 2MBOA 3HOXB 2D3BA 4ANXA 3CRKC 3EA6A 1ILPA 2X69A 3HM6X 1LT3D 3NEMA 4JI6L 1B9NA 4FF2A 2EYJA 2ZNVC 3DHIC 5EPJA 1VQ9A 1XEEA 2DN8A 5A2QL 2M00A 1ASZA 1QLBB 3B1LX 4J6IA 2M19A 1GXDC 4A3PA 1VQLA 3D4DA 3SU8X 4LFAQ 4QIWE 2KOLA 2Z9HA 2LVOA 4MH8A 1NDDA 3VUWA 2CWAA 1K3RA 1EFID 1Q7YC 4A3GG 5F2DA 4A3JH 2INNE 5CR3A 1Q1OA 1QNKA 3AU4A 3NBHB 1QE6A 2PMZE 2SAKA 2KENA 1B4OA 1SNPA 3OSOA 2PZTA 1J5EL 4JI2Q 2WIIB 4H02A 2OWOA 2J53A 3AECB 5IOIA 4DK6C 1G51A 4YWLA 4JW0A 2JXTA 1UE7A 1EM7A 2MNAA 1R4PB 2WDRB 4HEDA 4AS1A 3NBIA 1JB3A 2G9DA 3A8KE 4RKLA 4JYAQ 2OJRA 3N1XC 4B08A 1NJIC 3A0JA 3TP5A 1SNQA 2N0SB 4HAEA 1CHQD 1C76A 3LWEA 4KZCA 4NJCA 4HIKA 2F0PA 2PE6B 4UDUC 2QDLA 3EVQA 3DWQA 4URKA 1VCIA 1Z9FA 1BCPF 3QJZA 1YX6B 4PNYA 1ZDXA 1BKBA 1KC8C 2QEXA 1JICA 3UI3A 3AE8B 1WGGA 4DV2Q 1MG4A 4HCEA 2JYTA 2EKIA 2IGDA 1WGDA 1J9OA 3U4ZA 1R9TB 5C23A 3C1EA 3K57A 4PZ6A 3U4VA 2PZUA 1WXSA 4GKKL 3ZDTA 3J7AF 2N55A 2K05A 1I4HA 1MGSA 2QDBA 4LF7Q 1WXAA 1DOIA 1K8AC 4LFCQ 1QOBA 4MIUA 4YWKA 1TZOA 2O5IC 3ZW3A 3HOWB 2K6DB 5IGEA 4FO2A 1Q12A 4M8AA 3UIOB 1RHPA 2KYWA 2JPHA 3HOZG 4NMZA 1SE2A 3AU5A 2GVAA 5JXVA 2DZIA 4LAAA 4GU2A 4KDIC 2FUG1 1TJEA 2NBUA 1HE8A 1VZ7A 2WQYB 1JWUD 5JVH3 4RGTA 4HEA1 4V0BA 1PMRA 2KA7A 3MC0B 3HOWG 3DWAA 1RKNA 3F2CA 4LF4Q 3QWZB 2RD0A 4HXDA 2F0NA 3QG1A 4NAWB 1SLJA 3ZNZB 1YJJA 2OT2A 2TMPA 2XGTA 1YVCA 4F8MA 3MXNA 1LACA 3CIRB 1YI2A 4DXAB 1VQCA 3LYYA 5C3EB 1XLQA 3DEOA 1S5FD 2EYMA 1K83H 3MXUA 4BWGB 5BO4B 1LABA 4IQZA 1YQ3B 4ZRKA 2KO3A 2F0LA 4TRDA 2ZJPA 4XWWA 1WTRA 3D32A 4GOCA 4BVUC 4A3DG 4GN5A
chains in the Genus database with same CATH topology
5BYRA 3VR6A 2I38A 2R6GA 2YEPB 2WDVB 2QKIC 3IFTA 2LMCA 1STBA 4LTUA 4KN7C 5IODA 4KY7A 1SYEA 4RKBA 4A3IB 4DGZA 2BOSA 2NVTB 4DF7A 4JPSA 3U4EG 2E76C 1CTMA 1YQ4B 3HG9A 2XN9C 4C2MB 1XXGA 2EYOA 2A6EC 2WKCA 4A3BB 5KNBA 2PW5A 5ELCA 3KF8A 1KFYB 1GAQB 4PQXA 3JAME 1OQQA 1LTGD 3X3NA 2WXHA 5BN4A 3AEFB 4OZAA 1D4BA 4C7YA 2F0QA 3KWVA 5K36G 1KRHA 2VB2X 4CKCA 4REZA 1MSHA 1QKZA 2GI9A 5C4XB 3IT6B 5C0XI 3AB9A 5IGBA 3HZXA 2EDGA 2QEJC 4ZYSA 4NKLA 1CQFA 3AN1A 4KGTA 1YNJC 2WV6D 4ULLA 1ACCA 2DNCA 1VF7A 3M7NA 5H8YE 3QOLA 3KK7A 2NTSA 3P4SB 3VR3A 5BYQA 1SNOA 3AMUA 1Y8OB 1LTID 4XDDA 2WB1B 1A2UA 2A74C 4MACA 3BZDB 3G6JB 5CORA 4RGOS 4MHEA 1H9KA 1II3A 1SE3A 1HFGA 5G3LF 3HOVB 2MJ3A 4N59A 2BTEA 4HKQA 1AZQA 5CV5A 1QOFA 1B3AA 3HUIA 2DBYA 2W3RA 2ICIA 3NTIA 3TP8A 1FFUA 4HCSA 1EQTA 4HJGE 3EQLC 4A3JB 2J7ZA 3VR8B 2PO4A 4KKTA 3W5VB 3CKIB 5JEAJ 5CV7A 1B1ZA 2N9LA 3ETRA 1YNJD 2NTTA 3Q8CA 2WXOA 4A8XC 4KN4C 1C4AA 1EZ8A 2ZXRA 1SYGA 4FYDA 4ZKCB 1SYDA 2CW0C 4XT3B 2E2HB 1Q10A 4XQJA 1PYWD 2NWGA 1UUPA 3H09A 1MBYA 1FRRA 1GPXA 4YTMB 4XQNA 1RCVD 2JE6I 3VR2A 5H92C 4NDXA 3FAHA 1TU2B 3PUZA 1H9SB 3C8YA 3NZ3A 3NWSA 1HTLD 5JEAG 2CVRA 2MP1A 4U68A 4L8JA 4RHRA 4N58A 4IUVA 1EWCA 1Q1EA 2HCCA 5C0XH 3KLSA 4KJOA 1TYGB 1ZPSA 1NEKB 1SMYC 2FBWB 5CC4A 1CHPD 5JAVA 4A9AA 5AUKA 3J81L 1ZXTA 1VMPA 1M4VA 1E0BA 3SXHA 4DXGA 2M56B 4PMBA 2HUGA 4ITKA 1F2YA 4G7HC 2L83A 1C4QA 3T13A 1L6VA 2XNAC 2XSCA 3BDLA 2NZ1D 3URYA 1AP0A 2G9HD 2E75C 1C8CA 1BCPC 3NE5B 1WSPA 5EQ0A 1PLFA 5BYSA 5M9OA 4O42A 4LK0M 2A73B 5BN5A 2D5DA 4CBVA 2EYLA 3MXGA 1IUEA 2KMMA 4HR7B 2PKOA 2KACA 3V05A 3FPPA 2OEOA 5CGKA 4K5VA 2K03A 2JP1A 3HOZB 1G91A 3N52A 4R8IA 2WXJA 5JVG3 4KHVA 5FK9C 4DU9A 1W6KA 4ZRQA 4U673 5IOCA 1GHJA 4MT5A 3NBHA 1F9PA 1EY5A 2WP9B 2EYPA 2TSSA 3C46A 2WAQB 3VRBB 5D65A 3IXSA 4IUUA 3BS1A 3T56B 4P16A 1WD1A 1G291 1BQQT 3P4RB 2NYZD 3EFXD 1IKMA 2SOBA 4WRDA 4WURA 3SR1A 5KNDA 3AE9B 2N9KA 4YWGG 2L9HA 3I4LA 1JR0D 1EY7A 1JWAD 1HXYD 3E0JA 3BYTB 2XWJB 2EY2A 3M85A 2L4NA 5AFWA 3AH7A 1XCQL 4ID6A 2F0TA 2LS01 3FPUB 3KBGA 1LT5D 3Q22A 2KHSA 5KEEA 5EE0A 1FNWA 1XYIA 2PCFB 4B9WA 1YJIA 3D31A 2K5QA 3E56A 2LJIA 3MWYW 1ZXIA 1LV9A 2IL8A 2IDYA 2JU6X 3NUHB 4RCOA 1GHKA 3ZJVA 4XT1B 3NSWA 3VA7A 1FFVA 4IFDG 4Q0FA 3BWUD 3MP9A 4HRSA 1SEBD 2SDFA 1QWYA 3Q24A 4XIGS 4IALA 2JYEA 3AEBB 3ZGZA 1WYGA 1KF6B 2L52A 4LMQD 2WLBA 1F2RC 1ZYRD 1O7YA 1BOSA 4HMIA 3GP7A 5I4DA 3NVYA 1XLNA 1LTTD 1ZYRC 2J42A 1Y1WB 1V1PA 3ZYYX 5JPNC 5G3LD 2E2DC 4WJWA 4US8A 3I4MB 5D14A 4XQQA 1FXIA 1WWTA 3V2TA 2K04A 1LLRD 2Q5WD 1V8QA 3PIP3 1ZDVA 3BK2A 1FR3A 2K1BA 4C3JB 2YYZA 2O5JC 2WXKA 2XIWA 2LHDA 1LTAD 1V1OA 1U4PA 3QOJA 1XO3A 4JK1C 4YXDB 1C78A 4PMWA 1T3QA 1S5DD 2B63B 3GD7A 4A55A 4TKOB 5C6AA 2VZKD 3SK5A 5LHY1 1L4DB 2B2TC 1JQYD 1AZPA 5EPKA 1C4PA 1W6JA 4ILWA 2XVSA 5FOBB 3VYUA 1FXAA 1QCBD 4RGMA 3TP6A 5KNCA 2W55A 1DYQA 5I9OA 1EL0A 1H9JA 4K8IA 1PRTF 4ABNA 4KY5A 4ZQ3A 2BS4B 3H91A 1CZWA 1SJHD 4S3SA 4QIWB 3RUZA 3M7GA 1A70A 2B2WA 1J8IA 4M1UB 5I2YA 2EOTA 2W54A 1VZ6A 2I46A 2WS3B 2Y5PA 5C4HA 2VNUD 1F9RA 2E6XA 4WIPA 1DOKA 2ZXPA 4GLSC 3GV6A 2KN4A 4DFAA 4HMJA 1IBXB 3I70A 4OZCA 5LNK1 3C1FA 2L55A 1ENAA 3S9WA 2F0JA 1EY6A 1C9FA 4OL7A 4A6QA 1WTVA 4KGRA 1HZ5A 1PFMA 3IAM1 4M0WA 1JMLA 3S1QB 4IFDI 1CZPA 2Z1CA 1B53A 1BUIC 1V97A 1O7LA 2BDOA 1NYQA 3H6MA 1SSNA 1AWDA 2J0TD 3Q0AA 2AWOA 5IGFA 4N6EB 4FXDA 4NP5A 4C3IB 3TEYA 2X6GA 3IFDA 3AU7A 2K5PA 3S1RB 2B2WC 2EYFA 5NUCA 5GXGB 1HA5A 3MA2B 1SMYD 2AQ1B 2WXNA 1G2SA 2H1EA 2DYOA 4HN7A 1NSNS 4OIKA 3AE5B 1WD0A 3SVMA 2KEDA 3CU7A 2PVOD 2A6HC 1JCKB 3W2DA 3RD4A 3S14B 1PZJD 1L0XB 3WCQA 3FDTA 1HFNA 4ZOHC 3TEXA 3A8IE 3PV0A 3OOCA 4FP5D 2PW9A 1U4LA 3Q6SA 2DY8A 4TQUS 5EE3A 1T5XD 1PGXA 3BDOA 3TZUA 1I4PA 3ZJTA 4AYBB 4EQPA 5J1ZA 1D1KA 1ROEA 2DLBA 2ON8A 2VXWA 2FHTA 1QOHA 3RMHA 1QJOA 2M9VA 1Q90A 3NWTA 3OHXC 1XX8A 2BT6A 3B9JA 1SNMA 2NMQA 1EYAA 3C3LA 4K5WA 2FMMA 3NS1A 3QB3A 5M5XB 1FGBD 1STGA 5C5LA 1PTOC 2LFIA 1HQRD 3WOEA 4I65A 2CW0D 5C4ZA 2WKDA 3K7AB 2R93B 3R3OA 3GQBA 5E4WC 4KD3A 3NVVA 3L7ZC 1NYRA 3R8BA 3KUPA 5HHDG 1GJXA 3J7YW 1GB4A 3MEHA 1TS3A 2EE1A 2M0AA 3U9SA 5DM63 1EYCA 2E2JB 1NCVA 3CQZB 2Q8RE 4KD4A 4DQOC 1SF0A 2HTME 4ZHOA 3P7JA 1EEFD 1ESRA 2Z8LA 1CA6A 2KDMA 1JC7A 1I6HB 3BVZA 5CMDA 1VRAB 3GV3A 1T6BX 2VZKB 5J39A 4EE2A 5IGDA 4L2YA 3VQIA 2F0MA 3S15B 4RGNA 4K6LA 2EELA 3LB8C 4G57A 2L32A 1KNAA 5LL6X 4QUCA 2HDMA 5J22A 4ZRZA 2MJDA 4KKIA 1EIGA 1L0YB 5EKLA 4C56C 1KH0A 3I4NB 4BBSB 3T4AC 3MZ5A 2CU3A 2JYOA 5A35A 2BDNA 1UAPA 1STYA 1STHA 3J7AV 4C3IG 1WTQA 1EY0A 5KYIA 4PT5A 3ZQ4A 4Z9CB 4RCNA 2E2IB 1JW9D 2C5CA 5C3XA 5CBEE 4DAVA 5C2TB 1I4GA 3CWIA 2F1MA 2NB0A 1DJRD 3LWUA 2H89B 1J7BA 2JWUA 1IKLA 2PNRC 4H2AA 1TWCB 1G6ZA 1XLPA 2IGGA 3RLFA 1F9QA 4IURA 5ELBA 1BCPD 2E74C 1FEHA 1I4XA 1YNNC 3MHBA 5TSSA 4EGVA 1P7EA 3IKJA 1IGCA 3P63A 1SYBA 2EXZA 3GS2A 4TQ0A 2WXGA 3M4OB 1KDAA 2JSVX 2V4DA 4HTHA 2WXQA 2LGIA 1CZGA 1TWAB 3NQTA 2RMMA 2XRSD 1DONA 1TKYA 3DM1A 1LTSD 4IUQA 1TR5A 3TEWA 4AQ7A 2IJ0A 2MJ8A 2VUMB 4DNTB 4WFN3 3JAML 1OXXK 1TS4A 3TDQA 1KABA 5KIXA 1BO0A 4XTCS 5CV6A 1FRDA 3S1MB 4RAUC 3MFGA 2RSOA 2K32A 5KRUA 1G2TA 3H94A 1SSOA 2NVYB 1FYCA 1AW7A 3AEAB 3TMEA 4USAA 2F0WA 2D9UA 2R3ZA 3FMCA 5EKIA 4QUFA 1CK1A 3P75A 2OF1A 4XYOA 3HP3A 2PIAA 1A2TA 4KHZA 3AE7B 4Q2JA 4YTPB 2RDFA 4KX6B 1IW7D 2C9OA 1V43A 4GDLB 1CQVA 4CGYB 5AUIA 1UNSA 2D2CC 1S5CD 2Y3AA 1RD9D 1QNUA 1IW7C 1X3QA 1SYCA 5KYLA 3GTQB 1D5ZC 1Y8PB 1VZ8A 1EU3A 3BIID 4H7BA 3EROA 1JE4A 1Z6HA 2O2LD 4JX1C 1BBXC 1ZP0B 1R4QB 5HGTA 4FVMA 3AEEB 4LJZC 4CHTB 1JWMD 3TZDA 3O13A 3VYTA 3BVMA 3M4YA 5COYA 1QOGA 3PIO3 1TS2A 1TVXA 2B2VA 2F0GA 3PO0A 3K5OA 3RZDB 1F77A 5JEAH 5D3IB 3NTHA 2A6HD 2MEKA 1MPEA 1RTOA 3WDNA 2KQ3A 2VB3X 2WXLA 2JSOA 4CJ1B 1BF4A 4G7OC 5FO8B 1CM9A 1ONLA 4ARIA 4RF1A 2BCOA 2PW7A 5C4JB 1Z7TA 2B2YA 2NVQB 2PQEA 5C44B 3X3MA 3H0GB 1HZ6A 4XWTA 3AE3B 4IN3A 1B9RA 2A69C 5D3DA 2HCIA 1QOAA 2W82A 3NRZA 1RM6C 1DGJA 4DN4M 3MHZA 2AWNA 1F2LA 4KI0A 1EZ6A 1IGDA 1PGAA 5I2XA 3QIAA 2FMCA 2K6AA 4GZYC 2X6LA 1DOLA 3T53B 2RKSA 2JEBI 2AUKA 3AV8A 3B2FA 2KCCA 1Q3LA 4OO1G 1VR9A 4L1BA 2JQRB 2ONQA 1UGJA 3EGRA 2K5WA 2PTLA 3VR5A 3SFDB 2F0DA 2JX5A 1TQOA 4C3JG 2MHVA 1E0ZA 5G5GA 1BDOA 3J9CA 1E10A 4OO1I 4WAFA 2AUJD 2RDHA 1KLGD 3J80L 1D1IA 1SYFA 5HI1A 1NVID 3D3RA 1YMHE 2J4XA 2V0GA 2F0VA 1NENB 4NW2A 4WORA 1TKWB 1PFDA 4Y7NB 3K59A 1G8ZD 1QB5D 4EQNA 1BR9A 4WWMA 3SHLA 4OHJA 4EVOA 3SFEB 1K51A 4KK7A 4TMAB 5EJWA 4PMCA 2L0CA 1K52A 5ISRA 2EY5A 5FO9B 2L12A 2G1EA 4B9XA 2WNMA 3P4PB 3OIPA 1OFFA 1E6EB 1ET6A 2D5GA 1JOKA 1EU4A 2V4IB 4KKUA 3LNNA 5E4XA 4HROA 1PZKD 1B9MA 2SNMA 3LX0A 4XDCA 4J3OD 2GA4B 2H88B 2WXIA 1GUOA 1LT4D 3VYRA 4FXKC 3A54A 4X3SA 3Q69A 3D6CA 2LEKA 3E5SA 1MHHE 4TQ1A 1FCCC 1YN5A 1EIHA 1MI0A 3AEGB 3I57A 5FKAC 3S1NB 1PDXA 4CKBA 1PRTD 1Y8NB 4K2KA 5FO7B 1I6VC 1X32A 1GB1A 3DUZA 1SJED 2NN6I 1I4QA 2BE5C 3G7LA 3H8HA 1RTNA 3U7ZA 3A55A 5C3WA 5C3JB 1B44D 1YNND 2R92B 1RODA 2QMTA 2B2YC 3TN2A 3HVZA 3I91A 1FNVA 1EWHA 2ZW0A 1GOZA 2CQAA 2NN6H 4QF4A 1WGKA 1H9SA 3MVVA 4BS9A 2X38A 2B2VC 2H4OA 1WTWA 1E7PB 1XWEA 1TY0A 2F0HA 1TS5A 4OVZA 3KBXA 3R2TA 2LHEA 1STNA 1K50A 4C80A 1YN4A 2LMCB 1IYUA 4Q5VA 2LKVA 3H3VC 3GTGB 2BS2B 2PZWA 1CI3M 4KJNA 2EY1A 1PTOF 1Y69U 2GB1A 3GB1A 3Q8EA 3S2DB 1TY2A 5D7GA 1BNZA 3TEZA 3ERQA 2JZPA 3PO2B 3KQ4A 4US9A 3F2UA 5HURA 1BCPB 4J8QA 4BBRB 2L1AA 2MGSA 1EYDA 1CJEA 2BB6A 1LTBD 1EY9A 1LT6D 1VDZA 1TWHB 2NVXB 3FEWX 2JA5B 3MXPA 5EPLA 1Q8IA 3S2HB 1E9MA 2HQEA 4QB4A 3VR4A 2EJGC 2MPMA 1JWBD 3E6ZX 2EZVA 1I3QB 4X3TA 2LFNA 1GUNA 1K8OA 1JOOA 4A3FB 2FINB 3LXFA 4TSSA 5K5PA 3T3OA 3TP7A 1VF5C 1D5MC 4RWSC 3RZOB 1D5XC 1N5XA 1SAPA 1NR2A 1F2ZA 2EJFC 3B2GA 1F0ZA 2BS3B 3FVQA 4ZKBB 2EYHA 2K22A 2HDEA 2BW2A 1RWSA 2I2YA 4K8JA 2FFKB 2PMVA 5JPMC 4JE3B 1F2RI 3MFYA 1YNTE 1J7AA 2QJLA 4GDKB 2KECA 4F87A 2MH7A 5JOBA 4CJ2C 2F3VA 3T51B 4OZBA 3DWGC 1C79A 1C48A 3R93A 4FXGC 1KDBA 1JRPA 2FJ2A 4DAYA 1NI3A 2KQ4X 1I7HA 1BUVT 3OIQA 1L4ZB 2Q8TA 1RF2D 4ZK9B 1B2TA 5ELEA 4NZLB 5EE1A 2WXPA 3A7LA 1L6UA 2B2UC 2NUCA 4YSXB 1DD2A 2BYTA 2K7VA 4R3DA 3SK4A 1WXQA 3AB5A 5C5MA 5BMIA 4OIJA 3U52E 3AMZA 3D8GA 1KAAA 3K5NA 2B8FA 1KTKA 2MUYA 3VRAB 4ARCA 1D2BA 4D2KA 3HS0C 3UI2A 4FF3A 2RQXA 4H13C 5JJZA 2IGHA 3HKZB 5M5YB 4N9PA 4G4KA 4ZLTF 4HKZE 5M3FB 3QJYA 1GUGA 1S5ED 4MM3B 1AFPA 1HPCA 3BVGA 3L9AX 4XXEA 1PRTB 1ZEQX 4YIJA 1MHXA 4NAMA 5FR3A 4KKSA 3ZJUA 3U2SC 1S5BD 2RA4A 5FLXL 3CRLC 2D62A 4YT0B 5M5WB 3ONAB 2A5HA 3NHHA 2IX0A 2F3WA 1FMAD 3I72A 1PTOB 5I6YA 1O80A 4J6HA 1A3UA 1PXUA 2JEAI 2E3TA 2K01A 5KGUA 2WXMA 1PFNA 2KEEA 5ELFA 3PUYA 1BMLC 3R2IA 5M3MB 1VLBA 2WXFA 3FC4A 2KUMA 3BYYB 4RHSA 3MTSA 1DXMA 1U4RA 2YEPF 2XWBB 2V3PA 1QQRA 2B2UA 3IL8A 4K5XA 2KJXA 3U9OA 2XRQD 1ZE3D 5LL6S 1N5WA 4L6TB 2OEDA 1O78A 1MI2A 1VDVA 2IPKD 1M8AA 5DEHA 2K3UA 1B50A 4C1NK 2F0UA 4XYQA 2F03A 3ND9A 3NVWA 3I8ZA 5EBDA 1FO4A 3SR6A 4ODGA 1NR4A 4K14A 4X3KA 2IT1A 4EQOA 1HRJA 1O7ZA 1U9RA 4CQNA 3PZ8A 4P2CB 1RYJA 1HHVA 2A68D 4A3DB 1JQ4A 1SNDA 1YN3A 4RA8A 4A93B 2WDQB 3IT4B 5C0XG 2EY6A 2ENBA 1ZOYB 2GRIA 2B76B 5DAUA 3A56A 4MN3A 5EE9A 3SK8A 3K6OA 4F7XA 2K0PA 1IBXA 3AE4B 3NVZA 4IDIA 1J7CA 4KY6A 2Q8IB 3GTLB 4KKJA 5IT9E 3ITPA 3T3NA 4FNFA 4JWSC 4R9WA 3HRZC 2PVGC 1N63A 2WU2B 1GUWA 2BA1A 3Q23A 5T1IA 1OXTA 3V3XA 2WU5B 3ABVB 5DM73 4KV6A 5ELDA 1I4RA 3NK9A 3QO2A 2JA7B 5EBCA 5K36H 2AQ2B 4JWUC 2QSDA 1E2ZA 3EJIA 1ZXHA 1PUTA 2A69D 2BBCA 3D6WA 1WVLA 2O4XA 4XDXA 1L5PA 1TWGB 4RH6A 2QCPX 4H44C 1DOMA 4DK1A 4IUNA 4KGSA 1OO9B 3DWPA 1TT2A 1FIQA 4L23A 5CV8A 3GTKB 1RDPD 1X3PA 2PYKA 4K6DA 2AX5A 1PTOH 3FILA 3N9YC 1PGBA 1SFOB 4FXCA 1L0VB 3AE2B 4QCLA 1N62A 2IW3A 4A3EB 3AE1B 3NUCA 4K2LA 4IKGA 1TWFB 2OHFA 3E9SA 2ZW1A 1WCMB 2PPBC 3BG3A 3KWLA 1AN8A 2F0SA 1SE4A 3DMUA 3W9CB 1XCTL 3ND8A 4IZ8A 4B0EA 1MSGA 2WINB 3I3CA 2K9XA 4N9TA 2N7JA 1K53A 1VMCA 3HOUB 4A3KB 4E6IA 1SNCA 1JOQA 2F0EA 2K5DA 2RVLA 1NUCA 4ZRPA 1GUTA 1ZKOA 2F0FA 4ME5A 1IHZA 1H9RA 2QILA 1HEZE 4B0MA 1WTOA 4ZAIA 3D4WA 5FLXE 3VYSA 1V8CA 1STEA 2JA8B 1E2VA 4IUTA 1CA5A 4QMGA 2CJOA 4PV1C 5I6WA 1N61A 1LTRD 4XE0A 1D6EC 3I90A 3AM9A 3L4PA 3OWEB 1QILA 3NQIA 1TIID 3PUWA 5G5HA 1Y56A 1HCZA 1MD2D 1QG7A 3W3AA 4CKEA 1ENFA 2W3SA 2DWQA 4I7ZC 3P20A 4FF4A 5CV4A 2RBMA 4LK1C 2JA6B 1BXTA 4OW0A 4OGQC 2N88A 1STAA 3AE6B 1DOXA 1TKEA 4DNRB 4BA2I 3GTJB 4C1NI 5T8IA 1EQVA 1QT9A 5HFYA 2RPVA 3HRDD 2L11A 2B39A 1A15A 4RNAA 1EOTA 3SEBA 4HSPA 2NBFA 3C2PA 1FD6A 3OWFA 1ESFA 2F0OA 4J1MA 1JALA 2A6ED 3K5LA 3KLSX 3A8JE 4IFDJ 1HA6A 1HQMC 3I9V1 4R8NA 2OXPA 1CT1D 1AYFA 1F2MA 5EGTA 3N6RA 5E1FA 1EY8A 3A7AB 1Q1BA 4ZHPA 1XLOA 4DXFA 4DAPA 2F4IA 3SDZA 3M3YB 3KLRA 2DNEA 2WP8J 3P42A 3WOFA 1KLUD 4YSZB 5EKKA 1CFMA 2RDGA 1HTPA 2NN6G 3Q8BA 5I9PA 2AQ3B 5C0XJ 3HOYB 1N60A 3NPPA 3GO5A 4IOIE 5IGGA 1EWYC 5MPOA 2BA0A 1GUSA 5IGCA 4WQMA 3OPOA 1SXTA 5E3FA 4ZUJA 3P4QB 2Y0SB 3NXWA 1PFBA 1TKGA 3DHQA 4V190 3P1MA 4UAIA 3V96A 4C3HB 2V3NA 1QF6A 2K28A 1OQRA 1WTPA 1HUMA 5CYUA 1ILQA 1ZUD2 1I50B 1S4ZA 1DZ1A 5A2QE 3HGBA 1UEAB 4RFBA 1UWMA 4O1NA 4C3HG 5BMHA 1A3TA 2ZT9C 1FCLA 4DA2A 2WXRA 1ENCA 4LLGM 4ZUIA 3MAQA 1MVKA 2YU9B 2A68C 2K33A 3OMCA 2KWDA 2WACA 2R7ZB 2SEBD 2Z4HA 4BY7B 1WRIA 1ET9A 1Y1VB 3OW7A 1SDFA 3J80E 4P6VF 1PDQA 2ICEC 1UWXA 3HVDA 4BA1I 1FNUA 3EUB2 1AEXA 3IAYA 2JXMB 2LY7A 3P1HA 1XTCD 3K0YA 2B2TA 5HG2A 2LUMA 1WTXA 1JWSD 4G7ZC 3HEJA 3TSSA 3FKIB 2R61A 4A3MB 2EPBA 1OXUA 2HDLA 2KVMA 2F0IA 1ML0D 4KTAA 3RFZB 3FRPB 1E2WA 3L3OC 2KAJA 3OMGA 3TUOA 1RFKA 5E6JA 2ACZB 2IX1A 3NTKA 5IT9L 4X3UA 4OO1H 2CJNA 1C77A 1FD7D 1PTOD 4BY1B 1PZID 3Q8AA 2J52A 4FF1A 2INPE 4A90A 1XF5L 1ICWA 1K83B 4IFDH 3CHBD 4HSVA 2F0KA 1PRTC 1A3VA 5CBAE 2PLPA 1JORA 3W1SA 3DEPA 1T5EA 1A6XA 3K58A 5CV9A 1KDCA 2BE5D 3IAS1 1FM0D 2EVBA 2Z4IA 3FILB 1RJTA 4H0LC 1SB3C 1JROA 2ZXOA 2IWHA 4JBWA 4KMUC 5IIFA 3BK1A 3BDCA 1DCZA 2L5TA 2I07B 1C4CA 1Z47A 3W5UB 3S16B 5T1GA 1P7FA 2PMZB 3GTOB 3S17B 5BN3A 2KCNA 3VR9B 1DM0B 2BB5A 2QF7A 5BMGA 4WH4A 1NAPA 3GTPB 1OXSC 3VA5A 2CHBD 3QWNA 3NP8A 3PO3B 1H9MA 5DNFA 4C7ZA 4IUPA 2FE8A 4YTNB 2IX3A 1DOYA 3J81E 2SNSA 1OXVA 1SBBB 3GTMB 1R7SA 1V1PB 3Q8FA 4F88A 1VJKA 2MJEA 2DYMA 2L1BA 3PUVA 1EEID 3TBIB 1KNEA 3DXJC 1HUNA 4CJ0B 3DWMA 2EJMA 2RSNA 1EY4A 1U4MA 2QIEB 2Y5CA 1LO5D 1K8MA 3SE0A 2M2LA 3I73A 3RPFC 4YSYB 3PZ7A 3T16A 3K5MA 1SIJA 1IYVA 3D4RA 3AEDB 4DK0A 3MJ5A 4L63B 1IL8A 3SK6A 3PUXA 3PMFA 2DY7A 1F9SA 4A3GB 4RF0A 2B8GA 3HOXB 3CRKC 3EA6A 1ILPA 2X69A 1LT3D 1B9NA 4FF2A 2EYJA 5EPJA 1XEEA 2DN8A 5A2QL 2M00A 1QLBB 2M19A 1GXDC 3D4DA 2KOLA 4MH8A 1EFID 5F2DA 2INNE 5CR3A 1QNKA 1QE6A 2SAKA 1B4OA 1SNPA 3OSOA 2PZTA 2J53A 2WIIB 3AECB 2JXTA 1EM7A 1R4PB 2WDRB 4HEDA 4AS1A 3NBIA 1JB3A 2G9DA 3A8KE 4RKLA 4B08A 3TP5A 1SNQA 2N0SB 4HAEA 1CHQD 1C76A 3LWEA 4NJCA 2F0PA 4UDUC 3EVQA 3DWQA 1VCIA 1BCPF 4PNYA 1ZDXA 1JICA 3UI3A 3AE8B 4HCEA 2JYTA