1D6EC

Crystal structure of hla-dr4 complex with peptidomimetic and seb
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
total genus 62
structure length 225
sequence length 236
ec nomenclature
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d6eC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d6eC02
1JCKB 1XTCD 3BVZA 1I4PA 1FNWA 1EFID 1SXTA 1XXGA 3KLSX 4DXGA 1D5XC 1HA5A 1TS5A 1I4HA 5TSSA 1S5FD 1PRTD 1PRTF 1PZKD 1SJED 1LT3D 1M4VA 1PZID 1D6EC 1I4RA 3DWPA 4O1NA 1EWCA 1BCPD 4L6TB 4K6LA 1BCPF 1ET9A 1UUPA 1HXYD 1CK1A 3CHBD 2TSSA 1LTBD 1AW7A 4L63B 1KLUD 1ET6A 1PTOB 1TS2A 2Z8LA 1MD2D 1RF2D 3MFGA 4RGNA 1T5XD 1LTGD 1QILA 2XN9C 4RGMA 1UNSA 1EEID 2IPKD 1RD9D 3MC0B 2J4XA 1SEBD 2WV6D 3URYA 1L0XB 4Z9CB 4TSSA 1LT4D 2NTSA 3BZDB 1HTLD 3EFXD 5ELEA 4RHRA 1JR0D 1YN5A 1JWUD 2R61A 1FNVA 1EU3A 3SEBA 1PTOC 3BVMA 1I4XA 1RDPD 5D3IB 3V05A 5D3DA 1LTID 1G8ZD 1PTOF 2QEJC 4OHJA 5ELDA 1PTOD 4RFBA 1I4QA 1KTKA 1DYQA 1EU4A 1CT1D 1SBBB 2AQ1B 1FGBD 1V1OA 2XRQD 1SE2A 3R2IA 3R8BA 4BWGB 3OWEB 1CHQD 1SJHD 3R2TA 1V1PB 3BYYB 1RCVD 1FD7D 2IJ0A 1AN8A 1TY0A 1ENFA 1KLGD 1SE4A 1LTRD 1JWMD 1LTSD 5ELCA 1V1PA 5I4DA 3DWQA 1I4GA 4C56C 1L0YB 1CQVA 2RDGA 3EA6A 1YN4A 5ELBA 1SE3A 1STEA 5FK9C 1EEFD 3W2DA 4DXFA 1PTOH 4UDUC 3DWAA 1YN3A 1JQYD 2SEBD 1B1ZA 1DJRD 1PRTC 3BVGA 1LTTD 1S5CD 1CHPD 1FNUA 4RH6A 3O13A 2XRSD 2XNAC 1BCPC 1HQRD 3BYTB 4ZYSA 2CHBD 2O2LD 4RGTA 1D5MC 1JWSD 1F77A 2AQ2B 3GP7A 1LTAD 1D5ZC 3TSSA 1BXTA 2AQ3B 1B44D 1PRTB 1TY2A 5FKAC 4RCOA 1LO5D 1LLRD 1GOZA 1ESFA 1S5ED 2NTTA 4RGOS 1S5BD 4NZLB 1BCPB 1S5DD 4RHSA 1LT6D 1LT5D 2RDHA 1PZJD 5ELFA 2G9HD 1PYWD 1TS3A 1TS4A 2QILA 2ICIA
chains in the Genus database with same CATH superfamily
1RL2A 1JCKB 3WCQA 4QB4A 5C3EG 3CF6E 2BVCA 1JB7A 1I4PA 3JAMi 3K5LA 1Y1WG 1P3QU 3KUZA 5LXHA 2WAQB 1QOFA 5M3FG 4OONA 1NUCA 2LASA 1K3BC 1TZ1A 2D0PA 2MA9B 2YEPB 1KNEA 2PI2E 1UEBA 2CW0D 2AEHA 2BB6A 1I4RA 2RDFA 4MJSA 3ZGZA 1SAPA 5IP9H 2WXQA 2BS4B 2VH1A 3KF6B 3VUWA 1TT5B 3SFEB 3U50C 3S14H 2DJFC 1CZGA 4DUYQ 1Q5WB 3K6OA 4NMZA 3N32A 4W9DA 2E75C 2F0PA 5E6PA 4P1CC 2LXKA 1R7SA 1VS0A 1GVPA 1JOKA 1BBXC 3MFYA 4NW2A 3Q3OC 1Q46A 3PRPB 3VYRA 4PS8A 2AMCB 4R1JA 1T5XD 2IO2B 1A2UA 4RGMA 1PH7A 4P71A 2X38A 4LJZC 1CZWA 4WJWA 2J7QB 3D6CA 2LMCB 3H0GG 1VJKA 3AE4B 1KLVA 1K83H 4OO1G 1PDXA 4K7WA 2WXMA 2NR2A 1YIWA 1B9MA 1TWGB 3SDZA 3FKYA 3PTFC 4J6IA 2KVMA 1PFSA 3W3AA 1SIFA 4WJ3M 2NVQB 4FHJA 2KQ4X 4B6WA 3Q69A 1XO3A 2UUAQ 3HOWB 5C3XA 3QJYA 3DHHC 1EU3A 3E6ZX 1PTOC 5CMDA 2VXWA 4CYEA 1SFOB 5IGGA 2EYMA 2NVXB 3ZJUA 4A4IA 4P73A 1LTID 4QUCA 3SK5A 3G4SA 2KD0A 1XTDA 1IBKQ 1I4QA 3HKZG 1CT1D 2TMPA 3W1GA 4ALPA 2LFNA 2J42A 4JPSA 2F0NA 3AE6B 3GE3C 3A1QA 1ZGUB 5JHBA 2IX3A 1TY0A 3IAM1 4DV4Q 4RCNA 1O7ZA 2B3GA 3I72A 2D2QA 1TWGH 2ZJRA 5HKHA 4HKQA 1C48A 3OW2A 3VHTC 1GC6A 1WGKA 4HN7A 4W9JA 3TZUA 1XLPA 3KLSA 3CC4A 1X3PA 3ECIA 1CQVA 1BQQT 2RDGA 1V5TA 2WXOA 5ELBA 1BUVT 1SE3A 2K04A 1FRDA 1S40A 1K73C 1RAXA 1EEFD 4O42A 2KK8A 3MC8A 4UP9A 3T51B 5KRUA 4GLXA 2L3ZA 1GJXA 4U673 1JQYD 4FLHA 2SEBD 4RKLA 3I4NB 1KH0A 4A3EG 1DD2A 4ZRKA 2KQ7A 5AUKA 1DONA 2B8FA 3U4ZA 1Y1WH 4ZYSA 1A3UA 2O2LD 2Z59B 1Q8KA 3ND9A 3M63B 4YY3L 4JBKA 5M5WH 3AV8A 4REZA 1RJTA 1CI3M 1K51A 3OMCA 1WD1A 5I2YA 2YTVA 2ZVNA 3OAWA 1P16A 1LLRD 2N78A 2FCMA 4PK1A 3T3OA 2KACA 2XGTA 5CV7A 2OOBB 3MP9A 4FADA 2FMMA 3EROA 2RDHA 2MEKA 2HDMA 3VVWB 1IZ6A 1TS3A 4HJ5A 4HJ9A 3U58A 3AE8B 3HOUG 3APFA 1TKGA 4WJNA 1NI3A 2WKDA 1E9MA 1FPYA 3KUPA 2B76B 4JI7Q 1D4BA 2QEXA 1XXGA 4B9WA 1K8RB 3S1QB 5C44H 1Y8RC 2LUEA 1PZKD 3PO3G 2INPE 3GV6A 1WWTA 5LL6S 1XCTL 1HE8A 3C19A 4US8A 1YIJA 3NTHA 4DV0L 3GTLH 3OW7A 4C1NI 2BYTA 2BE5D 1MKHA 1WXSA 2EY2A 3RZDH 4L23A 3NY5A 3TN2A 1WTRA 4LNIA 1BT0A 4JOIA 2OF1A 1RWSA 3TREA 4EX5A 1HQMC 4R3DA 2KO3A 2WXPA 1RODA 2GVBA 2N8NA 4C3IH 4YCUA 2KC1A 1TWCB 2OEOA 2CU3A 4E71A 4IWPA 4IUQA 1E1OA 3TIXA 3FKIG 3VQIA 2LRWA 3AMZA 1JRPA 4LMQD 4A55A 1IBXA 3K58A 3PT2B 2WV6D 1N63A 3ND8A 4GDLA 4XXEA 4F8CB 3E9IA 1RFKA 3ONSA 1A15A 3BZDB 1DOIA 1PHJA 1VRAB 4EFOA 3EQLC 2KWDA 3RMHA 3G6EA 1MGSA 2MQHA 4JI3L 3RZFA 2RHQB 3LJ3A 3Q8CA 3BY4B 3J7YW 4RMFA 1WX9A 2PZUA 1MPEA 1PH8A 2NPTB 3K8AA 3RLOA 3IFTA 4IW0A 2K75A 4DV1L 4M8AA 2MJDA 1PV4A 2JZ3B 3A9KB 3HP3A 2JA7G 1GG3A 1E2WA 4KKTA 1S1QB 1LXDA 2AQ1B 4LF8Q 2R7ZH 1FGBD 4IWOA 4YWKA 4JI3Q 3P4PB 1Y1VH 3R2IA 1TWHH 2Q5WD 2N49A 4KDIC 5C4HA 3AB5A 4ICVA 3BS1A 3DHGC 4DXAB 2L11A 2JXXA 1WFYA 2MH7A 4RA8A 1KLGD 4WFN3 3OPOA 1YNJD 4W9GA 4HEA1 3ZJVA 4KKJA 1WYGA 3ML9A 2E76C 4P2CB 3HIZA 1K0RA 3M4OB 4AYBB 4TV3A 3CRKC 2PW9A 3ZW3A 4LF8L 5E1FA 1P1AA 4P7IA 3J81c 2K50A 3I4NH 4PQXA 3KLWA 5IODA 4DR3L 2QSDA 5FR3A 1LV9A 4K14A 3U9SA 3HOUH 3DWAA 3ZXVA 2HDLA 4ZUIA 3I8ZA 3D4RA 5E6OA 3DEPA 3CRLC 4PMWA 3HOZG 1EUJA 1J19A 4BBNC 1S5CD 3I2ZA 4JI1Q 2BT6A 4KY5A 3QWZB 2WAQG 4HIDA 4PYUA 3NS8A 1MSGA 3NOBA 1OXUA 3VH3B 5COYA 1BVSA 4FF1A 1FRRA 1YHBA 2AQ2B 1FMAD 3Q2AC 5CX3A 4ZDVA 3T1HL 2M4NA 5C44B 2WU2B 3S1QH 4Y7NH 1AZQA 5GQOA 5A35A 3HZXA 1HZAA 1KIXA 1EY4A 1GUOA 1K0SA 1PRTB 2B2YC 3KJPA 4OO1I 2RGFA 3I91A 3RULA 3A74A 3F2CA 1EQQA 3G6JB 2K22A 2PQAB 3D32A 4DR1Q 4RHSA 3NEMA 3SXHA 3H6NA 2JPHA 2KVRA 3UIOB 3GOEA 5IP9G 4A93G 1R9TB 3L08A 1CKMA 3W5VB 4MSQB 3TEXA 4A8XC 4B9KA 2XWJB 2KKCA 1W2BA 2CHWA 3H7SA 2D62A 2BWFA 1OXSC 4PV1C 4MGKE 4DV2Q 4ARIA 1VQ9A 1HA5A 4DV5Q 1SLJA 2V4IB 2PNRC 1GUTA 2V3PA 4FJZA 4W9KA 2CWPA 2KCCA 2A4ZA 4A9AA 1WR6E 2KMMA 3CMEA 2Y5PA 5JJKA 4AJWA 1L1OB 2QDBA 1NYQA 1K53A 4H44C 3RNGC 2PW5A 3D0FA 1TJEA 2B29A 2I5HA 5T1IA 2D2CC 4DV2L 2K3UA 2YTXA 1ZXTA 2F0TA 4IPDA 1E0BA 3TEHB 4DV5L 3S2HB 2BKRB 2KN5A 2Z8LA 2R92G 3J80c 2DZJA 1LYLA 3DBRB 3PO0A 3DM3A 3BIID 2OCEA 1W6KA 2NB0A 2R7FA 3FKIB 3QOJA 2WX0A 4CJ1B 1E8ZA 4HAEA 3ZXRA 2CU1A 1KD1C 1M90C 3ZNHB 2V3NA 1H4RA 3ZNGC 5GXGB 2BQQA 3KBGA 4FF4A 3C0RB 1NNXA 3OYYA 3ZJYC 5FLXL 1PH9A 4MH0E 3A8IE 4OL7A 5J1ZA 2KHWB 2ZTDA 5GMVA 4EGVA 3H0GH 3T13A 5JH5C 1EFWA 1Q81C 3X23A 5IGEA 2NN6G 5IYCG 1FXAA 5KHQA 1MFWA 5ELDA 2Y0SE 3I9V1 5GROA 3MTSA 5BMHA 3Q8DA 3AE1B 3A55A 1FYCA 3I63C 2L7RA 4MNOA 1HCZA 4Y52H 1V1PB 3AU4A 5IKCM 1H95A 2LRUA 3F2DA 4RF0A 2NVQH 3ZNID 1E3PA 1KRHA 3BDLA 4H0LC 3P4QB 3WA0A 1SYDA 2PW7A 3CCLA 2NVYB 2Z6KC 3AU7A 4LW1A 4QJFA 1TGZB 1N33Q 2AX5A 3ZVVA 3UDGA 5KHOA 3FEWX 3EBEA 4A75A 4DHZB 3B08A 1DXMA 3CCSA 4X62Q 2IO0B 4A3MG 2L9HA 3NK9A 1XNQL 1CM9A 5DPTA 4YWGG 4B08A 1WM3A 1YN3A 4DV3L 2A5UA 4B0EA 4U68A 1M8AA 2W3RA 2X8XX 2EYPA 4L5TA 2WYQA 3H91A 1LTTD 2CW0C 1B4OA 4OGQC 1C8CA 5DPWA 3HOYB 5HGQA 1BCPC 2N9PC 3BYTB 5C3WA 4WRDA 4GOCA 4S17A 1YEZA 2ACZB 4XC2A 2QF7A 3TRZA 4MM3B 4XYOA 1R4NI 3ZUNA 5I6YA 1PGBA 3A8KE 4PS3A 4WH4A 3GP7A 1XNRQ 4LF9Q 4JI2L 1V6EA 4I6NB 4JI5L 1TBEA 1V9PA 4GDLB 1X3GA 3L3OC 1MVKA 1ZPSA 2N9XA 2A6HC 4K0KL 2I1JA 1XD3B 2GLSA 2RSUA 3S2DH 2YV5A 4NZLB 4BA2I 2N9EB 3STBD 2BA0A 3QOLA 4GU2A 2FFKB 3A5UA 2A69D 4X64Q 1ZYRD 3IVFA 3V6CB 5BN5A 4M0WA 4RNAA 1FVIA 4JI2Q 4ZK9B 1NENB 2UXBQ 4JI5Q 5E7NA 1G2TA 5CTRC 2R7ZG 2RKSA 1B2TA 3I56A 2LKVA 1I4HA 2Y0SB 4AH6A 2KAJA 4IO9A 2MNAA 5C0XJ 1LT3D 4GS3A 2KCTA 1WM2A 3AULA 1TZOA 3E9SA 4W9FA 2EXZA 4DBGA 2D3BA 5EDSA 1WF9A 2K1FA 2LGXA 1QE6A 4QAYA 2NPTA 1CK1A 2IX0A 3JAML 1HR0W 4C3HB 3SVMA 1KLUD 4LF4Q 2C7NB 3HGBA 1Y8PB 1KDAA 2A68D 3BZCA 4C3JB 2K4KA 1VQNA 2C7HA 2FINB 3HOVB 1GNUA 1Q3LA 1B9RA 3WOEA 1UNSA 1EEID 4GN4B 1HTOA 2Q8TA 5KYLA 5IIFA 1SEBD 2L32A 4YWMA 3GTLB 4KHPL 3GTOB 3Q3NC 1PH4A 4LDTB 4ANXA 2KOLA 3AM9A 1JJGA 4GZYC 4GN1A 4DHZE 2DUDA 1VCIA 1T0YA 1N6ZA 2HJ8A 1VQJA 3GTQH 1MHHE 2JA8H 4JBWA 1JR0D 3E9HA 3RNUA 1VQ4A 2L00B 3NUHB 1IL2A 4ZRQA 4A3MB 4DHJD 4LF5Q 4DPGA 2IYDB 3HS0C 2KDEB 4IPCA 5FO9B 1N8RC 4XX5A 3NZ3A 1J6QA 1STAA 4KTAA 3V05A 3CCRA 1C0AA 1WXQA 2D11A 1OQYA 4XDXA 2JYEA 3BINA 4WURA 5CHWA 2DGYA 5M3FB 5M5XH 3KOJA 1NDDA 2YYZA 2ZT9C 3OWEB 2KQSA 5G3LF 2D3AA 1VZ6A 2I1KA 3ETRA 1RCVD 1JMLA 4LF5L 3HKZE 2JSOA 2O2VB 4FHKA 2MBEA 1TWFB 4LLGM 3SK8A 2LWPA 2ZTEA 1XPRA 4ZRJA 2GBJA 4QQBX 2KCMA 1XQQA 5T1GA 2D10A 1WMHA 2FE8A 2M56B 3GTPH 5L83A 1YI2A 2KN4A 5AJ3L 2F52A 1O80A 1JW9D 1AE3A 2N1VA 4L5SA 2VNUD 4IPHA 2MHJA 2E2DC 4B95A 2JEAI 1QKZA 4UDUC 4AP4C 3PO2H 5J39A 4J8QA 3CCMA 3ZTCA 4IM3A 1RTNA 3HFZB 2K5HA 5LMUQ 1F52A 4JYAL 2QCPX 3S16B 4GGQA 2MSED 1HQRD 1Z6HA 4MZ9A 2PLPA 5G5HA 4KLKA 2VZKB 3NTKA 3K0YA 3UI2A 5KGUA 5AJ3Q 1R4QB 1PGAA 3I57A 3PCOB 3TP5A 2I5MX 1VQIA 1D5ZC 2IW3A 2KBNA 2R92B 1BXTA 3J80E 3PO2G 3KVFB 3S15H 2M0XA 1UE6A 2Y5CA 2AWTA 2WIIB 4FP5D 3UE0A 1UD7A 2FUHB 1UBQA 2MJ8A 1Y1VG 1I42A 1RYJA 4XGAB 1EZ6A 5M5YH 1WMHB 4KD3A 2NBVB 3I7FA 3I73A 1FR3A 1PYWD 3R93A 2J52A 4HK2A 2KJXA 4IUNA 2NVXH 2DAFA 3DM1A 2HQLA 1Q1OA 5ELNA 1L5PA 4HIMA 3W1SA 2VQEQ 1SDFA 4AIMA 4G7ZC 4G0NB 3TEYA 1X3FA 2V4DA 3M4YA 4NKLA 5DPRA 1NI2A 3VUXA 3HOWH 1F9QA 3KLSX 3H7PB 1UEAB 2BH8A 1IKMA 4NQLB 5L95C 4PZ7A 1JROA 1YJIA 1EY8A 4DGZA 1C78A 4KV2A 3OIQA 4BKSA 1J5EQ 2UXDQ 2FAZA 1HZ9A 1WZ3A 4EQPA 2Y5BB 5JJLA 4DR5Q 1BCPF 2REXA 2QCZA 1ET9A 4HCNB 1VMPA 5KNDA 3NELA 3CHBD 2HE7A 4GDKB 5JPMC 4OX9Q 3A4RA 2DYBA 5IWAQ 3VR5A 2UXCQ 5BO4B 3A9KA 2BA1A 2PEAA 2EKIA 4YSZB 1MD2D 1RF2D 3J81j 1B9NA 1J5EL 3CPWA 3TCAA 1IW7C 3KYHC 3SR1A 1GUAB 3CPFA 1YNJC 1QNKA 3BU2A 5BR8Q 1NE3A 2E3TA 3Q8EA 3TP7A 1IBMQ 3KLRA 4JIOU 3K7AB 3NP8A 4BBSG 2G9DA 3PQIA 1YQBA 5IWAL 4YTNB 4HVBA 3VYUA 4JV5L 1PXUA 1J8IA 1VZ8A 2KFKA 4NDXA 4C2MH 2DY7A 3UQBA 1WVLA 1YVCA 5CHVC 3W9CB 2UUCQ 4DV6L 1AP0A 2ZVOA 4G57A 5BR8L 1VCBA 5ISRA 4DDID 3N3KB 4J15A 2IDYA 1Y56A 1LFDA 3PHXB 1VQFA 4TQUS 2K05A 2V1CC 2DZMA 4WORA 2JYTA 4IOIE 2XRQD 4OWXB 5K36G 4PS7A 2L76A 4OVUA 1HFGA 4H02A 2NN6H 4CDEC 5G5GA 1E0ZA 5C23A 4F7XA 5KYIA 1AN8A 1VQDA 1EIFA 3PV0A 2NVTH 3P1HA 4KJOA 2E2JH 3A7LA 2L0FA 3KDFA 2LGSA 4DV7L 1FJGQ 2KDIA 1UE1A 1WJJA 3ZTDA 2LSSA 4UP7A 4JI8L 4D2KA 4EOYA 4GIVA 3OTOL 3F1ZA 2ASQA 4KI0A 1EZ8A 4HSVA 2MO0A 4OIKA 4DAMA 1GUGA 2PCFB 5CV6A 1YITA 1QZEA 3AECB 4EQ5A 1L6UA 3DCGA 1P8LA 3HOZB 4CBVA 4IOCA 2X6LA 4ULLA 5CHFA 3NBHA 2KNBA 4HIKA 1T0QC 2NVUI 5AZHA 4RGTA 3OTOQ 5BYRA 2NZ1D 3RZWC 3VR2A 4ZHOA 1A6XA 1QVFA 2WDVB 1Q82C 2FCQA 3C1FA 2NCNA 1ROEA 4ANVA 3Q8AA 1YNXA 3GTMB 3PS6A 1NR4A 1O7LA 1E1TA 2QMTA 5IGCA 1YX5B 2A69C 4DR6Q 5KIXA 4K1RB 2XWBB 4IUTA 4KMUC 4DUYL 4LF6Q 2K8BA 1PZJD 3W1BA 1I3QB 1C4PA 2M17A 2EZVA 3SR6A 4QIWB 2F0JA 2HJ1A 4GDKA 4Q0FA 5I4DA 5I9OA 2F0EA 2K14A 4RKBA 3A8JE 4B3ML 3K57A 4LUOA 4DXGA 3CC2A 4X65Q 2O6VD 1QUQA 1GUSA 5H1SE 2OQKA 2R92H 2C9WB 1WFQA 2KJRA 2WXJA 2QDLA 3DBHB 3NJTA 1M4VA 3K81C 3ZDTA 1K52A 2KZRA 3AEFB 3RN5A 1JE5A 3CCEA 1MIUA 2F0HA 4TUUA 3AEBB 2W9NA 2KDMA 3H7PA 3ML8A 4A3BG 4FJVB 4FXCA 1IGCA 4WWMA 3H3VC 2GI9A 3DQVA 4I7AA 2OHFA 4F7ZA 2CJNA 4X3TA 3PO2B 1ET6A 4V0BA 2KWCA 1GKHA 1IBKL 2LGDA 3A1QB 2LGYA 4MELA 4A3FH 3Q3FA 2GN5A 2ZEQA 2I46A 2IPKD 2BKFA 1L2FA 1HNWL 3S17H 2L12A 3NHHA 2MPMA 1E7VA 3OHXC 2VS1A 2LVOA 1WTXA 3IAS1 3S1NB 2KTFA 1P7EA 1CKOA 5D2MB 3KBXA 1ACCA 2ZCCA 4RHRA 3PIPA 5LMNQ 4DR2L 1YN5A 1ZKHA 2K25A 3Q3MC 4CGYB 4W9HA 1JOQA 2DJGC 3MWYW 4Q2JA 5TR5A 4P75A 1J0GA 3QHTA 3DBSA 2F0KA 3B1LX 2HHHL 1F9SA 1NY4A 1O7IA 1IYJB 2UUAL 2DY8A 4F87A 1W3SA 4MH8A 1QOGA 2QKIC 2K0PA 1X1MA 5HHDG 1IYFA 2LMCA 3KK7A 4C7YA 3HVZA 2IWHA 2I0QA 4CKEA 5C5LA 5GADC 2H5XA 5E4WC 3RZOH 2KX3A 2EY6A 4KV6A 3P2BA 2A6HD 2FUG1 2D5GA 1YNND 4XTCS 3DBRI 4MJSB 5HG2A 1GJZA 3Q14C 2EMSA 1H9KA 5GAGC 5M3MB 4KDLB 1TQOA 4A93H 1V49A 2ZJPA 5BYQA 2EY1A 3KF6A 5EJWA 1JORA 3QQ8B 1L0YB 3OLMD 4P1BC 4IN3A 1VQPA 3P7JA 5FLXE 1U4RA 1VQ7A 4BY1H 5FK9C 2AUJD 2GVAA 1HZBA 2F0SA 2Z4IA 1N5WA 1I94Q 1YMHE 1JT8A 3PUWA 1VQLA 2FCNA 3OMGA 5LL6X 3GZNB 4TKNA 2MO1A 4NB3A 4IFDJ 1V2YA 5EGTA 3W1YA 1S72A 1NBFC 2JJQA 2K32A 5C6AA 1V5OA 1TIID 2F0DA 2IY0B 1D5MC 2VY3A 2E2JB 4A90A 1TKEA 2MBOA 3I3CA 1JOOA 1VQHA 4IOAA 1RHPA 2RCNA 5CBAE 4DV0Q 3KYDD 2RBMA 4R4TA 1VQMA 3GV3A 1HRJA 1ASZA 2W82A 4BBRH 3TP6A 4K3BA 2K7VA 1Y69U 5KNBA 3JAMc 1WTPA 1JALA 1WTOA 2FXQA 3E56A 3NWSA 2L8JA 1XEEA 3H8HA 4JQWC 3H3VH 2L1AA 3RR5A 3WAOA 4GLSC 3UQAA 3CU7A 3J9CA 1KXLA 2R93B 3BVZA 3IXSA 1MSHA 3H6MA 3IBEA 1S4ZA 5I2XA 1PDQA 3KF8A 4IFDI 1WXAA 3ZQ4A 2K52A 4KHZA 2B63H 4PNYA 3Q0AA 2K6DB 1PRTF 1SJED 2WU5B 5D7GA 3TUOA 4B3SL 4B9XA 1PZID 3J81E 3DWPA 3CCQA 4HJ7A 4A76A 2D9UA 1QB5D 3IHPC 5LXIB 3PGEA 2IBIB 2LUMA 2UWQA 3CP0A 1Z9FA 3DOWA 2F0UA 2PMZE 1PGXA 2ZJQA 2CS4A 3D8GA 3NUCA 1FCLA 2G4SA 3CCJA 1NBWA 1STGA 1PVOA 1OXTA 3PIO3 2QIEB 1EM7A 3UDFA 1LTGD 3MHSD 2ATWA 1SF0A 4ILWA 3NVWA 3R3MA 2MCNB 4L5RC 2EKEC 2WP9B 4WQOB 1VQGA 5IO9A 3PLUA 4DHJB 4EUTA 4DR4Q 1WR1A 2C35B 2NVYH 3TBIB 3FVQA 1SE8A 3ZYYX 3IL8A 1DOMA 3DVNV 1TXYA 2CQOA 4PZ8A 2JA5H 2XK5A 3A4SC 4KHVA 1MG8A 2WB1G 4WJOA 4C3IG 1TKYA 3BG3A 2AL6A 4C80A 1N36Q 5AFWA 4A3CH 2D07B 4IFDH 1XCQL 2V9HA 1KRSA 4BXXG 2RCFA 2WB1E 3W1SC 2QC8A 4A3GB 1E6EB 2JXTA 1UELA 1Z2MA 4M02A 4MGYE 3KW5B 4A3OA 5M5YB 2G1EA 3EHVA 1SNQA 4KJNA 1Y8OB 3C3LA 4YXDB 1V1OA 1N34L 3AU5A 3QG1A 4BWGB 2Z1CA 4C3HG 3X0WA 2IO3B 1SJHD 3IG3A 5JHAA 4JI1L 3AI5A 2HD3A 2M1MA 3MVVA 3HUIA 4MT5A 3OG5A 2F0OA 2OJRA 5JOBA 4XQNA 5ELCA 1IUEA 3AQQA 3U4VA 2HCIA 5IYDG 3ERQA 4HKZE 4Q5VA 4ID6A 4IUPA 2KLCA 2H4OA 2K5WA 1BOSA 3LDZE 4FBJB 2ZXOA 4HJ8A 3S2HH 4XDDA 1QVCA 1SMYC 4BY1B 1WJUA 3P4SB 4KZCA 3ULPA 4RF1A 5HI1A 1VQEA 1D8LA 2XRSD 4TQ0A 2ID0A 2KOXA 3H1UA 4DWFA 1PFMA 1MHWC 1STBA 1ZEQX 1HR0Q 1HTQA 1SRUA 1CJEA 2B2UC 2EMTA 1OTRB 2J53A 2N1WA 1F2ZA 1F77A 1GPXA 1EY7A 1KRTA 3N1ZC 1YQ3B 1KOTA 2EJGC 2CKHB 3FILB 2AQ3B 2MP2B 5H8YE 4AWJA 1B44D 2EVBA 3ULJA 3Q23A 2NUCA 1B50A 2B39A 4KKIA 2F0WA 2Z4HA 2KC2A 3DDCB 1VQCA 1BCPB 1L1OA 5M3FH 5JEAG 2G9HD 4ASWC 4A3LH 4HCPB 1SB3C 5J18A 4DR1L 2MBQA 1TS4A 2FJ2A 2FHTA 3M85A 2K6AA 1EQRA 3A56A 1E10A 4KVGB 3CMAA 5FO7B 3C8YA 2D5DA 3QB3A 1OFFA 3NQTA 1BDOA 1QOBA 3GTQB 1TYGB 2L1BA 1PRTD 4WWNA 3VUYA 1V1QA 4KGRA 4CDCC 1G6ZA 5IOIA 1EF1A 3I70A 4FNFA 4K6LA 2F3IA 4L6TB 1QUQB 4JI6L 4GXBA 3TDQA 4ARCA 4YY3Q 4M8NA 5FOBB 4OZBA 4BY7B 4LUZA 4USAA 3VR4A 4BVUC 4NJ6A 3I55A 4BZAA 4HLEA 1PYSB 1RIPA 1ZKOA 3L17A 4RGNA 4C3HH 2UUBL 4HXDA 5IT9c 2WGSA 1Y14B 1A3TA 2KWUB 3GTPB 3U2SC 4JI6Q 2CCZA 2N7EA 1A3VA 4LJOB 2BDOA 1RD9D 3OSOA 3P1MA 3VR6A 5C3EH 1WIAA 1U9RA 1TR5A 1Q0WB 5C0XH 2GBKA 3KWLA 1HTLD 2KX0A 1V9JA 5E6NA 3J80i 4JI7L 4A20A 1K3RA 1N33L 1CMXB 3WIMA 2WDTB 2CHZA 2KXJA 2OJWA 3SE0A 2QGQA 2O5JC 4G11A 1FNVA 4K5XA 5JEAH 2LGIA 4YWLA 4WWOA 4X62L 5G55A 5J22A 2M9VA 3AE2B 3QIAA 3C46A 3DLLA 5FJ8G 1XNQQ 1KAAA 4UP8A 3G71A 1R4NB 4EZKA 2W54A 4R9WA 5ELOA 4DV3Q 4GLVB 4DAYB 3AE3B 2V3SA 4OW0A 2G3QB 1QJOA 4BAXA 4ACFA 3QX1A 2N88A 2KHIA 1NAPA 3ULLA 1X65A 4L2YA 1HNZL 4A3BB 3B2FA 4A6QA 4A3KH 3GTMH 1HPCA 1PYBA 2IJ0A 2E2IH 3K80C 1RFAA 2L4NA 2PYKA 1OGWA 5EE0A 3IT6B 3U7DA 2JA9A 1LTSD 5IYCH 4BOZB 2VW9A 4LK0M 2PVGC 2ENBA 4KN7C 1GD7A 1IBLL 5DNFA 3HOYH 1A2TA 3T1YL 1EY9A 4GKJQ 1VF5C 4NXNL 5IYBH 2K5VA 4J3OD 1A62A 2L05A 3EC8A 2EYJA 5FLMH 4HROA 1U4PA 4M0WB 3U52E 1IL8A 2WWZA 1PTOH 4BKSD 4A3JB 3PMFA 1N62A 4KD4A 2NWGA 4MTNA 2L52A 5LHY1 2NN6I 1HZ6A 3AE9B 4IWQA 4LNKA 4LAAA 2UXBL 4ME3A 4LNQA 1U0LA 1NYRA 1Y8NB 2GOWA 4OELB 4DAYA 3NENA 4GKJL 4AJYB 4A3IG 3ITPA 1WD0A 2WINB 1QQRA 3ZO5B 3ZRFA 2VZKD 2N0SB 3CW2C 1M1KC 1FIQA 4FF2A 1GUWA 2GRIA 5FKAC 2OTLA 1LGRA 4LF9L 2JK8A 2NTTA 3GQBA 3IRBA 2WDRB 3QWNA 4HTHA 3EGRA 1SNOA 3A54A 2H88B 3QAQA 5BMGA 3U9OA 1ILPA 4XYCA 1HUMA 3TEWA 2ZM6Q 4CDDC 3QK0A 4JX1C 1GB4A 2ICIA 4GOPA 4KIKB 2JA5G 4DR3Q 1GUNA 1FNWA 5JVG3 2KA7A 2XIWA 1C9OA 1XJVA 2JWUA 2K5QA 1ZUD2 3J7ZC 1NSNS 2GBRA 3K7AH 3I3TB 4POFA 1BCPD 2FCSA 3DPDA 1K28A 2JY6A 2JEBI 4IUMB 1FEHA 4FA6A 1G51A 5C4ZA 2KUMA 4DK1A 3TS2A 3FKIH 2R2OA 1AW7A 1YHAA 2INNE 4IQZA 4L63B 1WCMB 2DWQA 4K7SA 5C3JB 2MFIA 1TS2A 2KFKB 3NVVA 2B2WC 3MFGA 4BS9A 2K39A 4X66Q 3ERSX 1K8MA 4FO2A 4A3DH 2JA7H 1SSNA 3UGBB 2QA4A 1Z47A 4X3SA 3MC9A 3M3YH 2Z0EB 4DNRB 4JI0L 3B2GA 1PA6A 3NVYA 3PZDA 3L0OA 1E8XA 1PH3A 1ILQA 4G7HC 2IY1B 4CKBA 2DN8A 1YOVB 2BBCA 5AUIA 4BBSB 4X66L 4FJYA 4A3IH 2FIFA 1L2NA 3HOVG 4BFRA 3C2PA 3OJ3A 5IT9E 4P16A 1ENCA 4FF3A 3M4QA 5EE3A 3CIRB 3DBHI 4BKTA 2MX2A 4WAAA 2G4DB 3V96A 3WAPA 1X55A 3PRZA 3U7ZA 1YJJA 1U5KA 4RMAA 4YIJA 5DCNA 5CV5A 2AHOB 3FPUB 4LUVA 1O78A 1D3ZA 4HWIB 1B3AA 1CHQD 3PGZA 4OVZA 3S15B 1AFPA 5GAHC 1II3A 2K5PA 3DVNU 4GNXA 2PMZB 2B63G 1S3SG 3Q3JA 4DNIA 2K5NA 4JBJA 4JLCA 2WXLA 1CKNB 2RA4A 1ISNA 2MJEA 3M3YB 2MWSB 1I4GA 4A3KG 2RSNA 1EL0A 3RYTA 5EE9A 4KY7A 3E0JA 2FBWB 3MXNB 2KLGA 2O6VA 3QA8A 2BYVE 2RPQA 1TVXA 1FM0D 3H94A 2IL8A 3HOUB 1WCMH 4AUQC 4K2KA 4HEDA 3F2BA 2F4VL 4JWSC 1MJEA 5D94A 3WWVA 1UH6A 1YNTE 1GHJA 2LVPA 1QOHA 4RH6A 2VQFL 4GLAC 2AWOA 2VUMH 4IDIA 1XLNA 2A6ED 2M00A 4YT0B 3T16A 3V2TA 2BPSA 2N55A 3T3NA 4G4KA 1PH6A 1K50A 1C4CA 1GXDC 2F4VQ 3VH4B 3AYHB 5HY6A 1ZOYB 1TWHB 4E3CA 1MI0A 1UE5A 3CC7A 4RGOS 2NS5A 1L0WA 3IT4B 1X3EA 1S5DD 2KMCA 4BBNF 1LT5D 4XT1B 3LB8C 1VD2A 1XX8A 2JP1A 4I7ZC 2K01A 2CKZB 3N1YC 4FYDA 2F3VA 1YJWA 2EJMA 2J0TD 2LZ6A 2WXRA 3STBC 5IAAC 4MTKA 2RSOA 1WGYA 1TS5A 3RNBC 1SYFA 1WGRA 4XWTA 2N9KA 3QO2A 3EN2A 2I2YA 1QNUA 3L9AX 4JBMA 4LDTD 3SHQA 3NPPA 5J17A 1DGJA 3M95A 3FC4A 3PPAA 1L4DB 1MJDA 4H7BA 2A73B 1E90A 2BDNA 4N9PA 1V97A 4O2DA 1TKWB 2TSSA 4EEWA 1XNRL 2K6QA 3S24A 1J7AA 5KEEA 1PH2A 1EQTA 3QIJA 4C3JH 3HKZB 1WSPA 4ICUA 1WRIA 5D6JB 2X6GA 3T53B 1E22A 2KEDA 3VR9B 1HZCA 5IOCA 3H9DA 2UXCL 1K8AC 3RNFC 3SD5A 2A68C 2DZKA 1WXVA 2RMMA 1BO0A 5JPNC 1UGMA 1WJNA 1SNMA 1XMOQ 1N32Q 2WQYB 4J6HA 1W6JA 1CA6A 1AEXA 1HNXL 3VA7A 3GE8C 3PLVA 4W9EA 1ESRA 1QT9A 1C3TA 1JICA 4C00A 2K9XA 3SEBA 3J81L 2JRIB 1T9HA 1RRBA 2DZIA 3W5UB 2VL6A 2J0KA 2VH2A 4LNOA 4K8JA 4IZ8A 1AWDA 1UAPA 4CDFC 3D4WA 2A74C 2JRHA 4DV6Q 3J7A5 2EQSA 3HK0A 2DYOA 4RFBA 4C3JG 2LHDA 1DYQA 2JQRB 2EYLA 5IA7A 2PQEA 5CR3A 1AE2A 3S2DB 3E5SA 1HNXQ 4JI4Q 3PRMB 3SK6A 3AFPA 1A70A 3UIPB 5FO8B 1STHA 1FD7D 3ZJTA 4P72A 1GO3E 4DF7A 5M5WB 1T3QA 1LTRD 2F0MA 3A33B 3L4PA 4LFAQ 3NHEB 4WQMA 4EQOA 2VUMB 2IHEA 3AE7B 2C5LC 3TMEA 2OXPA 3FMCA 4N58A 2MJ3A 2M8SA 4ZKBB 4TMAB 1YN4A 4B3RL 1XLOA 2YU9H 1TWCH 1ZDXA 2HIXA 1CUKA 2XSCA 3TL5A 1NTGA 2F1MA 1DJRD 1PRTC 2NYZD 4ME5A 3HOXH 1GM5A 5J3BA 3I4MB 2ZNVC 3RZDB 1FNUA 1JB3A 2Z0DB 2OTJA 5H92C 4WJ4A 1I6VC 2VRRB 1JC7A 3PZ7A 1GHKA 2BW2A 4GSWA 1ASYA 1EOVA 1EO6A 2EY5A 3L7ZC 2J0MA 1I50H 1QF6A 4PG3A 1B70B 2MW5A 1D1KA 3DHIC 2LY7A 2KENA 3BDOA 2VUMG 4J1MA 1P0RA 2WXHA 1A8VA 1RLFA 5BN4A 1LT6D 1CTMA 1JJCB 4DA2A 5ELFA 1BF4A 2ES2A 3M7NA 4DR6L 3APCA 2IZVB 5L37A 2UU9L 4LF6L 3B9JA 4ZRIA 3X3MA 3TZDA 2B2TC 3X3NA 4BBRG 1XTCD 1HTPA 1ENAA 3E3XA 2IX1A 2BGFA 5GAEC 3FRPB 1SXTA 4A3IB 1PH1A 4NJCA 3VTVA 2NBWB 4BBSH 1HNWQ 1YX6B 4OEMB 1S5FD 2N9LA 3CMMB 1SYEA 3EUB2 5C2TB 4NAWA 4JWUC 3OIPA 4BXXH 4GKKL 1IYUA 4HJKA 4FDBA 1HZ5A 1RKNA 3RLNA 4CJ0B 4A3JG 2DNEA 1G91A 1UUPA 5LMNL 4DR2Q 2JA7B 1HXYD 1IGDA 4UAIA 3I90A 2LD9A 4YSXB 4NAWB 4HR7B 3RNCC 3R3OA 1WTVA 5AEKB 2KWVB 5JZEB 4BKGA 1ICWA 1WTQA 2PQAA 3PSIA 1C4AA 1Q90A 1WCMG 3RI7C 5K5PA 1T0SC 3S14B 3AXCA 3R66C 3CD6A 1OXVA 1C77A 2EYFA 2GA4B 4IJHA 1N61A 4TSSA 2UU7A 4FN2A 1IW7D 1KM7A 1ZXHA 1LT4D 4LCDE 2CFMA 1XMQQ 3ABVB 1YJ1A 1QOAA 1CQFA 1WJ4A 3RNEC 4AOFA 2IT1A 4EVOA 2ON8A 1V8QA 4N8FA 2VB2X 1JWUD 1F2MA 2R6GA 4RWSC 2BYEA 1WI5A 1ZDVA 3NZSA 1MG4A 3PUYA 3EFUA 5AZGA 2PO4A 3K0XA 1R9TH 4DR5L 2OQ0A 2QEJC 5E3FA 3R7QA 3NBHB 1SFOH 1J7CA 4R8IA 4E6IA 3L10B 1VQ6A 2MGSA 3R8BA 1EYDA 3NE5B 5IGFA 1U4LA 2LXCA 3L0WB 2WXKA 3NG0A 1E5WA 4CO7A 1XYIA 1SE4A 1YZ6A 3DWGC 3JVZX 4LNFA 3D4DA 1K83B 2V4LA 3V60A 5EAYA 4ITKA 5JVH3 1IBML 1CSPA 3I4LA 4MN3A 2BB5A 3NWTA 4OXPA 4II3B 4A3DB 3AEAB 2B2WA 3N20C 3N30A 3F2UA 3DXJC 1GAQB 1EUVB 1EY6A 4DXFA 3NSWA 3K5NA 4A3JH 2YEPF 1EOTA 1VQBA 5F2DA 5CBEE 2N7DA 3ZKJC 1B1ZA 1WTHA 2L83A 2ICEC 1H9SB 2YU9B 3DHQA 4EKUA 3BVGA 2A6EC 1X6OA 4WAFA 1EYAA 1ZW7A 2XNAC 1EYGA 1FGUA 3M4OH 2DNCA 1WY8A 2HIVA 2F03A 4NQKE 4IC7B 4UY8C 2B2YA 4L1BA 4QIWE 1YJ9A 1N5XA 4LFCQ 3PV1A 3BK2A 4A3KB 4JVZA 3C1EA 5IGBA 3EECA 3FDTA 1IPGA 4QY7A 1L0VB 1ZE3D 5C4XG 1YNNC 1K8GA 4R8NA 1Y1VB 4KGTA 2XBBC 3VA5A 2YTYA 4QMGA 2HTME 3RT3B 2AUKA 4K2LA 3LYYA 4DV7Q 4E74A 3CSTA 1LTLA 3M4PA 3JSVA 3KH0A 5LMNW 2ALYB 4JI8Q 4LFCL 2HTHA 5IYBG 3G48A 1HEZE 3PUZA 3T8MA 2JSVX 4JGHB 3MZ5A 5D65A 1E7UA 1X32A 5E4XA 4AYBG 3UF8A 2F4IA 4CKCA 3JSVB 3GTJH 1Q1EA 2WNMA 1MHXA 3JW0X 1OEYA 4I6LB 1J9OA 2A8VA 2MUYA 4XQQA 2LJIA 2ZPNA 4KKUA 4B3SQ 3VDZA 3A7AB 2K5DA 4XYQA 4AYBE 2ZW0A 4MGIE 4LWCA 4DU9A 1DOKA 2PPBC 1WX8A 2BS2B 4C4VA 2CJOA 3J7AV 1ZP0B 4RM8A 3PO3B 3B0AA 1J7BA 1VZ7A 2SOBA 1PTOB 1OO9B 3V6EB 1JWBD 4NY0A 5FJ8H 4BY7H 4R4IA 5EKKA 1WYWB 1ICFB 5IP7H 5E6JA 2BYFA 4KSLC 2J4XA 3J81i 4KK7A 1OXXK 4GN5A 5JXVA 3PVLA 4S3SA 4Z9CB 4DKAC 1A0IA 1OQRA 3RLFA 3DUZA 2D3GA 2DENB 3QCAA 3V62A 4B0MA 1F2RI 3S1MB 4C7ZA 3SGIA 3QR8A 4R4OA 3HRDD 1ZXIA 3KUCB 3AE5B 5ELEA 4A3BH 3T56B 1MI2A 4ZYNA 3BWUD 3PF5A 1KL9A 2W55A 3Q6BA 4JCVE 3BZKA 1WGGA 5AZFA 2V1YA 3V61A 3BVMA 3U4EG 4G3XB 1PQSA 1YHQA 3M3JA 2SNSA 2B2VA 4BOSC 2Q8IB 3SHLA 5EKIA 4QCLA 1UE7A 4IKGA 4HJGE 1QG7A 2Q2TA 3DEOA 3U8ZA 4S0RA 3Q6SA 2ZXRA 2Z6KA 3BYYB 3JYUA 3T9LA 3K9PB 4UPAA 1N34Q 1XT9B 2AKWB 2KJHB 3S1NH 3ENEA 1EIGA 4M00A 5HURA 5FLMG 3GTKH 3RMKC 2O6VB 1JWMD 1EY0A 1YD8U 3L13A 1AYFA 3MA2B 1Y1WB 5C3EB 3DWQA 1NEKB 3QJZA 1PFDA 1XF5L 2HUGA 3CAMA 3KYCD 4ZOHC 3W5OA 4K7UA 4ZRPA 3Q22A 2BS3B 3W2DA 2N4FA 1LACA 3P63A 4HDQA 2FNJB 3D3RA 5EBDA 4W9LA 1NJIC 1EWHA 3OOCA 2HHHQ 3AN1A 1JMCA 1WZ0A 1IHZA 4DQOC 3VDYA 3HEJA 5IP4D 3I4OA 4W9CA 2VZAA 1QZHA 1V80A 3G7LA 2JN4A 4DV4L 1WXMA 2CQAA 2FIDA 4JL9A 3N9YC 3D6WA 4GN3B 4ABNA 2Z6BA 3DMUA 2EXDA 3PZ8A 4YTMB 3TSSA 5EE1A 4HCEA 5CV4A 2IGGA 5C1ZA 3HOWG 1KDBA 4KKSA 2CVRA 2B8GA 5EPKA 4OO1H 2AWNA 1BBWA 2D3CA 4MACA 4NP5A 3V3XA 1S5BD 3MEHA 4KZ0A 2EE1A 5DLQE 1Q7YC 1XWEA 3NRZA 2ZJDA 3WDNA 2KMAA 4KGSA 4FXGC 4HMJA 3IKJA 4A3GH 1I3QH 3P75A 2BWES 1HHVA 4KY6A 2XVSA 1JRUA 1VDZA 4ZCKA 3GDEA 4TQ1A 5T8IA 1HUNA 3L2PA 1EFID 1YQ4B 2H89B 5IYDH 2KCNA 2LFIA 1D5XC 1V43A 5TSSA 2G45B 4IG7B 1SMYD 2EOTA 5G2NA 1OTCA 4G7OC 1PFBA 2G5DA 4DK5A 1L6VA 1VLBA 1D6EC 1X3QA 2O2VA 4US9A 2BF8B 1AARA 2DBYA 4RAUC 2M0AA 3BJUA 2RDBC 1S3OA 2SNMA 1JQ4A 4P74A 1VQAA 2HD5B 1UWVA 5EPJA 3PIOA 1XPOA 3VYTA 4CHTB 3VXWA 1DZ1A 2WACA 3WALA 1IKLA 3CQZH 3M62B 3HG9A 1I6HH 3GTGB 4L5QA 2BCOA 2YVCA 2QJLA 1VF7A 4OWTB 1UWXA 1Q1BA 3PIP3 2LJ5A 4ANUA 2AL3A 2UUBQ 4QUFA 4IPGA 1HNZQ 1C1YB 2Q2HA 2CR5A 2SAKA 2WXIA 1G2SA 4L8JA 3N1XC 3A5ZB 4I6PA 2PZTA 5DM73 4BY7G 4NPNA 1H9MA 2WHIA 2OEDA 4DAPA 3IAYA 1QWYA 1E7PB 1MJCA 4C1NK 3CCVA 4HPMB 2B2VC 1BNZA 3KUDB 4HCSA 4JE3B 5C4JB 3A9JA 1ONLA 3FPPA 5D3IB 1PTOF 4OHJA 3N52A 4M1UB 3PUVA 5C4JH 1EU4A 4N9F4 4EZJA 1SBBB 1L1OC 2PIAA 2L0TA 1YBYA 4BBRB 1SE2A 3S1RH 4II2B 1F2YA 2K8CA 1EYCA 1R4MB 3AH7A 1B53A 3IFDA 3KDFB 5DPSA 4K0KQ 3L16A 1PFNA 3F8TA 4F8MA 1PH5A 1V81A 1V8CA 4X57B 1ENFA 4AS1A 2WKCA 4W9IA 2F0GA 2E8GA 1DOXA 3CCUA 5HGTA 1X9NA 1WJ6A 3TBLD 4X64L 1SN8A 4YTPB 4C56C 4HRSA 3RUIB 3EJIA 5DEHA 4DAVA 1DGSA 1E7ZA 1KNAA 2IHFA 4DK0A 4DV1Q 3GTGH 5NUCA 3SFDB 1F0ZA 4EE2A 2F0FA 1N36L 4URKA 3VFKA 4DUZQ 2ZM6L 1X56A 3A9JB 4MM3A 2NMQA 2EJFC 4IJLA 3VTWA 2Q2IA 2M19A 3T1HQ 2NZHA 2FMCA 1D2BA 4K6DA 3HM3A 3PHWB 2JA6H 1H9SA 2IY5B 1Q10A 2KJ6A 3GB1A 2V0GA 2QDFA 3KFUA 1LTAD 2E2IB 3UE1A 2B63B 4XDCA 1SNDA 4PZ6A 4LF4L 1SSOA 1E2VA 4OWWB 2LXJA 1TY2A 4DUZL 2R93G 5JAVA 2LVQA 1LO5D 3H3VI 3TP8A 1GOZA 2CWAA 2K33A 2L15A 3O65B 3VRBB 1WOCA 3AFQA 4ZUJA 1YJNA 1CZPA 1F2RC 3MXGA 1LQBA 3OWFA 1P98A 1WE7A 3KWVA 1TWAH 4IUVA 2ZNVB 3WAMA 3P20A 1VQKA 4PYZA 4XQJA 2M2LA 5C44G 2OT2A 1VQOA 2D0OA 2QILA 2R61A 3WANA 2C9OA 2PI2A 3DVGY 1F2LA 2GB1A 5I6WA 2PKOA 1SYGA 1IP9A 2E6XA 1FFVA 2KDBA 4DK6C 1CKNA 3RCZA 5BYSA 5MPOA 1JJ2A 3PF4A 2K03A 4MIUA 3H15A 1BBUA 4XT3B 1H9RA 1RTOA 1KDCA 2DX5B 4A3FG 5EPLA 1D1IA 4ZAIA 4HSPA 2HDEA 4NNJB 4EZLA 4EQNA 1SYCA 3S17B 3NZUA 1HR0L 4XZ4A 5CV9A 3KJOA 1UBIA 3VYSA 1QCBD 2F0LA 2WFWA 3LWUA 4RM9A 4LF7Q 3FHWA 2INDC 1LTBD 4HJAA 1HH2P 4YCVA 1NR2A 2IO1B 2ZZPB 4DDGD 3DVGX 5JEAJ 1H9JA 3FP9A 2A19A 2ZXPA 4LFBQ 1XLQA 3K5MA 4A93B 2BTEA 4ZLTF 3URYA 3B6YA 4H2AA 4IM0A 1T6BX 5FR6A 4LF7L 4IM2A 5M9OA 2PE9A 3P4RB 4JI0Q 4NAMA 3AEGB 1HJPA 2INCC 3TQYA 1KABA 3EFXD 2Y3AA 3SDLC 2E2HH 3ZDMC 3MXNA 4IURA 3NBIA 3RZOB 3Q8BA 3M9BA 5HFYA 3EIVA 1KF6B 1I4XA 4LFBL 3HRZC 5LMUL 1QVGA 2OWOA 2HT1A 2JVCA 3NS1A 2I5LX 3AMUA 2GMIC 1V86A 1A63A 3NVZA 5IY0A 3U30A 1DCZA 3MTNB 1QLBB 1C7YA 5C0XG 4N9TA 4LTUA 4GNXB 4UHVA 2B3AA 4F88A 1WGHA 1I35A 4A3MH 3HOXG 3HKSA 4TKOB 1GB1A 4IALA 3Q24A 4KN4C 4JPBW 5CV8A 3MHZA 2C60A 3S1MH 2LEKA 1OQQA 2RPVA 3I5JC 3UDXA 3JC66 1WTWA 3SK4A 2JA6B 1CA5A 3GTOH 2N3SA 1NCVA 2WLBA 1KHIA 1SE9A 2ONQA 2JZPA 2PPHA 4NPSA 2JF5A 3RN9C 1T5EA 3N6RA 1ZYRC 2MLBA 3K9OB 1K9MC 3VTUA 1JE4A 4FXKC 4YHHQ 3CKIB 2JZZA 3ZRCA 3P42A 1EIHA 1XPUA 4R4QA 2JWZA 1B3QA 1Z7TA 2UXDL 4K5VA 3RD2A 4A3PA 1G6JA 3TS0A 3CWIA 3GO5A 1CFMA 2WX1A 4YHHL 1JWSD 2JYOA 2L55A 3GTJB 3LXFA 2NVTB 2C5CA 2L5TA 1Q86C 4A3LG 5IP7G 1X54A 3S9WA 4RCOA 1BR9A 4C4VB 1ESFA 1DOYA 4A3EH 3AEDB 4NXML 2JT4B 1NMGA 2R3ZA 2KFJA 1WI0A 1VDVA 2R2QA 1IBLQ 2DNFA 3T1YQ 1U4AA 2X69A 1LUZA 4NXNQ 2RR9A 4OVVA 4TRDA 3WOFA 1F1HA 2HQEA 4K81A 4APVA 3K5OA 2F3WA 1I7HA 1C4QA 1KFYB 4K3CA 2RQXA 3RPFC 2W3SA 4N59A 5JJIA 1U4MA 3ZNZB 4NXMQ 1E24A 1F9PA 2JA5B 5CGKA 5I9PA 2UUCL 2KTRA 4O1NA 1EWCA 5FLXc 3CXCA 3DBLB 3KF8B 4IUUA 4A3CG 1FD6A 4GNXC 2Q8RE 2NZOA 2SDFA 3AEVA 2K8HA 1BMLC 1MBYA 3HOZH 3M7GA 3K7UC 5K36H 2EPBA 5C4XB 2LS01 4LK1C 4AQYQ 2AYOB 1KC8C 2LHEA 1FFUA 2EYOA 2XK5B 3RD4A 5KNCA 1DM0B 2RD0A 5C4XH 4F1SA 1QILA 2XN9C 2L0CA 5CYUA 3MC0B 1E2ZA 1F9JA 3CSFA 1OEYJ 3PSEB 3K59A 3HVDA 4M01A 4NJ7A 1PLFA 1L0XB 3T4AC 1WH3A 1PMRA 2J7ZA 4DFAA 3TMPB 3VRAB 4AQYL 4N8X1 2KQ3A 1M94A 3J80L 2KYWA 3RNAC 3ZIMA 2F0VA 1TT2A 3A0JA 3LGJA 4QL5A 5DM63 3IFWB 1IBXB 3OJ4B 4K5WA 1WYDA 2KHSA 1XMOL 1N32L 3UDIA 4JK1C 3S1RB 2R93H 4A3DG 4MGZE 4B3RQ 1JWAD 1UZXB 3RFZB 5BN3A 2K1BA 4MHEA 1EIYB 3HM6X 3VAWA 2BE5C 5D3DA 4GB9A 1PTOD 3ICEA 5A2QE 1LABA 2BH2A 4LNNA 1SIJA 1FXTB 4A3EB 3NTIA 3I4NG 1SR3A 3H0GB 3MJWA 3QARA 2H1EA 1AZPA 4C2MB 4KHPQ 1D7QA 2I07B 1P7FA 4PMCA 3APDA 2CH4W 3ZLZA 4K8IA 2KVZA 3ALBA 4JI4L 3KQ4A 4V190 2GBMA 2Q2UA 1UWMA 1V1PA 3AEEB 5CC4A 2PJHA 2MRPA 2O4XA 3S16H 4OZCA 1VQ5A 4ANWA 2ZPYA 4LFAL 2EELA 3MXPA 1STEA 4R4CA 4B3MQ 1AH9A 1K8OA 1EQVA 2DLBA 4HDOA 3PREA 1I6HB 2R7DA 5IE8A 3CQZB 4ZQ3A 2WAQE 4X65L 4JYAQ 3J7AF 4JOIC 4GMVA 1L7YA 1A5RA 1Q8IA 4YSYB 1SROA 5G3LD 4WWPA 1E8YA 3O13A 4ZKCB 3H09A 5LLIA 1GC7A 2CHBD 4TVAB 4XE0A 5M3MH 4YL8A 4BA1I 4YCWA 1PUTA 5A2QL 1T0RC 2VB3X 3GTKB 1ML0D 1TU2B 1FXIA 4MSMB 4GKKQ 1BKBA 1QZGA 2QW7A 4HMIA 3EFCA 1P9DU 3Q8FA 4FULA 2RF4A 3I4MG 2MQJA 1H8CA 3FILA 2PE6B 2P5ZX 4HPLB 3MHBA 2E5LQ 1WE6A 5M5XB 5C5MA 1STNA 3FAHA 2ZCBA 1O7YA 4WJQA 2VQEL 5C0XI 2LXAA 3S2AA 4JC0A 4N6EB 4AQ7A 2WXNA 2F0IA 3MXUA 4G50A 2IGHA 1VQ8A 3CF5A 2E74C 1LM8B 4IFDG 2BOSA 2UU9Q 1L4ZB 3TJPA 1SMXA 2E2HB 3HOYG 1UGJA 4GOPC 4Y7NB 1Z5SB 1J8CA 2E5LL 2ASBA 1I50B 2WB1B 2F0QA 4HIOA 1WX7A 2KANA 2JA6G 5DAUA 2PMVA 4ZHPA 1SYBA 4I65A 2KDFB 2WP8J 2VQFQ 4HPPA 1I5FA 2WXFA 1B8AA 4PMBA 4XIGS 2WXGA 2CH4A 3NQIA 4A3FB 3I4MH 1WGDA 4DK3C 2UYZB 3HOXB 4O0AA 2N7JA 3HOVH 2MP2A 5J2RA 3TEZA 1SNPA 2QHOA 1STYA 5EQ0A 3BK1A 2JQOA 3BDCA 2MHVA 3R7RA 1B7YB 1G291 2DHZA 3ONAB 2RHSB 3RUZA 1SGHA 4DNTB 2A1AA 3DWMA 4DN4M 2PTLA 3GS2A 5IGDA 3NXWA 1LM0A 2JA8G 2C7MB 4JV5Q 2MBHA 2YLMA 3GZNI 2DYMA 4MEMA 5EBCA 1C9FA 3VR8B 1CSQA 2NTSA 2RVLA 4QF4A 1TWFH 1EWYC 2KT7A 4CJ2C 4X3UA 1HFNA 1N60A 4P6VF 4JG2A 2XEWA 4ODGA 2WS3B 1XMQL 1I94L 2DAJA 2Y0SG 3RN2A 2J0JA 2Z9HA 4JW0A 4OX9L 4OIJA 2R7ZB 1RDPD 3LNNA 4XWWA 1G8ZD 1TWAB 2JE6I 2KHJA 2PNHA 1EWIA 4CHKA 4QGUA 1KTKA 4B3TQ 3E0EA 3QC8B 3MEFA 2Z0SA 3VR3A 1EY5A 4WIPA 1IXRA 2KEEA 1BUIC 1FL0A 5EKLA 3R2TA 4WJPA 2ZW1A 3D31A 2JA8B 4KX6B 1C76A 1HA6A 2B2TA 5IN7A 4GOPB 4KIKA 2MBBB 1FJGL 2XTIA 2MP1A 3MAQA 4POGA 2O5IC 4DR7L 3L54A 2IGDA 2GBNA 4KSKC 5LNK1 2JUOA 1Q12A 2JXMB 4A3GG 3UI3A 1EF5A 4B3TL 5BMIA 2EYHA 4X3KA 4LJPB 3UINB 4M8MA 3DBLI 3EA6A 1R4PB 1N9WA 2NBFA 1KQSA 5D14A 1TIFA 4OZAA 2KECA 2EDGA 2WDQB 1FO4A 4RG1A 4C3IB 1TTNA 4FXDA 1NMFA 5CORA 1VR9A 3PO3H 3HHMA 4DR7Q 4FVMA 3LX0A 2B2UA 4BY1G 3SU8X 1CHPD 4ZRZA 1FCCC 3AB9A 1UF0A 2LI5A 2JX5A 3MJ5A 4PT5A 2CHXA 2PVOD 5M3MG 1G6PA 1E8WA 4X6AH 2JU6X 1KJTA 1SNCA 1DOLA 2EIFA 1KAWA 1IYVA 3PUXA 2ZTCA 1R4MI 2I38A 1WRDB 1S5ED 1F9RA 3GD7A 3LWEA 1NVID 5JJZA 3ER0A 2A5HA 3EVQA 3JAME 4CQNA 4MDKE 4DR4L 1C79A 2K28A 2KTRB 1VMCA 2HCCA 2PZWA 1RM6C 5IT9L 4H13C 2NBUA
chains in the Genus database with same CATH topology
1JCKB 3WCQA 4QB4A 1I4PA 3K5LA 2WAQB 1QOFA 1NUCA 2YEPB 1KNEA 2CW0D 2BB6A 1I4RA 2RDFA 3ZGZA 1SAPA 2WXQA 2BS4B 3SFEB 1CZGA 3K6OA 4NMZA 2E75C 2F0PA 1R7SA 1JOKA 1BBXC 3MFYA 4NW2A 3VYRA 1T5XD 1A2UA 4RGMA 2X38A 4LJZC 1CZWA 4WJWA 3AE4B 3D6CA 2LMCB 1VJKA 4OO1G 1PDXA 2WXMA 1B9MA 1TWGB 3SDZA 2KVMA 3W3AA 2NVQB 2KQ4X 3Q69A 1XO3A 3HOWB 5C3XA 3QJYA 1EU3A 3E6ZX 1PTOC 5CMDA 2VXWA 1SFOB 5IGGA 2EYMA 2NVXB 3ZJUA 1LTID 4QUCA 3SK5A 1I4QA 1CT1D 2TMPA 2J42A 2LFNA 4JPSA 2F0NA 3AE6B 2IX3A 1TY0A 3IAM1 4RCNA 1O7ZA 3I72A 4HKQA 1C48A 1WGKA 4HN7A 3TZUA 1XLPA 3KLSA 1X3PA 1CQVA 1BQQT 2RDGA 2WXOA 5ELBA 1BUVT 1SE3A 2K04A 1FRDA 1EEFD 4O42A 3T51B 5KRUA 1GJXA 4U673 1JQYD 2SEBD 4RKLA 3I4NB 1KH0A 1DD2A 5AUKA 1DONA 2B8FA 4ZYSA 1A3UA 2O2LD 3ND9A 3AV8A 4REZA 1RJTA 1CI3M 1K51A 3OMCA 1WD1A 5I2YA 1LLRD 3T3OA 2KACA 5CV7A 3MP9A 2FMMA 3EROA 2RDHA 2MEKA 2HDMA 1TS3A 3AE8B 1TKGA 1NI3A 2WKDA 1E9MA 3KUPA 2B76B 1D4BA 1XXGA 4B9WA 3S1QB 1PZKD 2INPE 3GV6A 1WWTA 5LL6S 1XCTL 4US8A 3NTHA 3OW7A 4C1NI 2BYTA 2BE5D 2EY2A 4L23A 3TN2A 1WTRA 2OF1A 1RWSA 1HQMC 4R3DA 2WXPA 1RODA 1TWCB 2OEOA 2CU3A 4IUQA 3VQIA 3AMZA 1JRPA 4LMQD 4A55A 1IBXA 3K58A 2WV6D 1N63A 3ND8A 4XXEA 1RFKA 1A15A 3BZDB 1DOIA 1VRAB 3EQLC 2KWDA 3RMHA 1MGSA 3Q8CA 3J7YW 2PZUA 1MPEA 3IFTA 4M8AA 2MJDA 3HP3A 1E2WA 4KKTA 2AQ1B 1FGBD 3P4PB 3R2IA 2Q5WD 5C4HA 3AB5A 3BS1A 2L11A 2MH7A 4RA8A 1KLGD 4WFN3 3OPOA 1YNJD 4HEA1 3ZJVA 4KKJA 1WYGA 2E76C 4P2CB 3M4OB 4AYBB 3CRKC 2PW9A 5E1FA 2QSDA 4PQXA 5IODA 5FR3A 1LV9A 4K14A 3U9SA 3DWAA 2HDLA 4ZUIA 3I8ZA 3D4RA 3DEPA 3CRLC 4PMWA 1S5CD 2BT6A 4KY5A 1MSGA 1OXUA 5COYA 4FF1A 1FRRA 1FMAD 2AQ2B 2WU2B 5C44B 1AZQA 5A35A 3HZXA 1EY4A 1GUOA 1PRTB 2B2YC 4OO1I 3I91A 3G6JB 2K22A 4RHSA 3SXHA 1R9TB 3W5VB 4A8XC 3TEXA 2XWJB 2D62A 1OXSC 4PV1C 4ARIA 1HA5A 2V4IB 2PNRC 1GUTA 2V3PA 2KCCA 4A9AA 2KMMA 2Y5PA 2QDBA 1NYQA 1K53A 4H44C 2PW5A 1TJEA 5T1IA 2D2CC 2K3UA 1ZXTA 2F0TA 1E0BA 3S2HB 2Z8LA 3PO0A 3BIID 1W6KA 2NB0A 3FKIB 3QOJA 4CJ1B 4HAEA 2V3NA 5GXGB 3KBGA 4FF4A 5FLXL 3A8IE 4OL7A 5J1ZA 4EGVA 3T13A 5IGEA 2NN6G 1FXAA 5ELDA 3I9V1 3MTSA 5BMHA 3AE1B 3A55A 1FYCA 1HCZA 1V1PB 4RF0A 1KRHA 3BDLA 4H0LC 3P4QB 1SYDA 2PW7A 2NVYB 3AU7A 2AX5A 3FEWX 1DXMA 2L9HA 3NK9A 1CM9A 4YWGG 4B08A 1YN3A 4B0EA 4U68A 1M8AA 2W3RA 2EYPA 3H91A 1LTTD 2CW0C 1B4OA 4OGQC 1C8CA 3HOYB 1BCPC 3BYTB 5C3WA 4WRDA 2ACZB 2QF7A 4MM3B 4XYOA 5I6YA 1PGBA 3A8KE 4WH4A 3GP7A 4GDLB 3L3OC 1MVKA 1ZPSA 2A6HC 4NZLB 4BA2I 2BA0A 3QOLA 2FFKB 2A69D 1ZYRD 5BN5A 4M0WA 4RNAA 1NENB 4ZK9B 1G2TA 2RKSA 1B2TA 2LKVA 1I4HA 2Y0SB 2KAJA 5C0XJ 1LT3D 1TZOA 3E9SA 2EXZA 1QE6A 1CK1A 2IX0A 3JAML 4C3HB 3SVMA 1KLUD 1Y8PB 1KDAA 2A68D 3HGBA 4C3JB 2FINB 3HOVB 1Q3LA 1B9RA 3WOEA 1UNSA 1EEID 2Q8TA 5KYLA 5IIFA 1SEBD 2L32A 3GTLB 3GTOB 2KOLA 3AM9A 4GZYC 1VCIA 1MHHE 3NUHB 4JBWA 1JR0D 4ZRQA 4A3MB 3HS0C 5FO9B 3NZ3A 1STAA 2JYEA 4KTAA 3V05A 1WXQA 4XDXA 4WURA 5M3FB 2YYZA 2ZT9C 3OWEB 5G3LF 1VZ6A 3ETRA 1RCVD 1JMLA 2JSOA 1TWFB 4LLGM 3SK8A 5T1GA 2FE8A 2M56B 2KN4A 1O80A 1JW9D 2VNUD 2E2DC 2JEAI 1QKZA 4UDUC 5J39A 4J8QA 1RTNA 2QCPX 3S16B 1HQRD 1Z6HA 2PLPA 5G5HA 2VZKB 3NTKA 3K0YA 3UI2A 5KGUA 1R4QB 1PGAA 3I57A 3TP5A 1D5ZC 2IW3A 2R92B 1BXTA 3J80E 2Y5CA 2WIIB 4FP5D 2MJ8A 1RYJA 1EZ6A 4KD3A 3I73A 3R93A 1FR3A 1PYWD 2J52A 2KJXA 4IUNA 3DM1A 1L5PA 3W1SA 4G7ZC 1SDFA 3TEYA 2V4DA 3M4YA 4NKLA 1F9QA 3KLSX 1UEAB 1IKMA 1JROA 1YJIA 1EY8A 4DGZA 1C78A 3OIQA 4EQPA 1BCPF 1ET9A 1VMPA 5KNDA 3CHBD 4GDKB 5JPMC 3VR5A 2BA1A 2EKIA 4YSZB 1MD2D 1RF2D 1B9NA 1IW7C 3SR1A 1YNJC 1QNKA 2E3TA 3Q8EA 3TP7A 3KLRA 3K7AB 3NP8A 2G9DA 4YTNB 3VYUA 1J8IA 1PXUA 1VZ8A 4NDXA 2DY7A 1WVLA 3W9CB 1AP0A 4G57A 5ISRA 2IDYA 1Y56A 4TQUS 2K05A 4WORA 2JYTA 4IOIE 2XRQD 5K36G 1HFGA 2NN6H 5G5GA 1E0ZA 4F7XA 5KYIA 1AN8A 3PV0A 3P1HA 4KJOA 3A7LA 4D2KA 4KI0A 1EZ8A 4HSVA 3AECB 4OIKA 1GUGA 2PCFB 5CV6A 1L6UA 3HOZB 4CBVA 2X6LA 4ULLA 3NBHA 4RGTA 5BYRA 2NZ1D 4ZHOA 3VR2A 1A6XA 2WDVB 3C1FA 1ROEA 3Q8AA 3GTMB 1NR4A 1O7LA 2QMTA 5IGCA 2A69C 5KIXA 2XWBB 4IUTA 4KMUC 1PZJD 1I3QB 1C4PA 2EZVA 3SR6A 4QIWB 2F0JA 4Q0FA 5I9OA 5I4DA 2F0EA 4RKBA 3A8JE 3K57A 4DXGA 1GUSA 2WXJA 1M4VA 1K52A 3AEFB 2F0HA 3AEBB 2KDMA 4FXCA 1IGCA 4WWMA 3H3VC 2GI9A 2OHFA 2CJNA 4X3TA 3PO2B 1ET6A 4V0BA 2I46A 2IPKD 2L12A 3NHHA 2MPMA 3OHXC 1WTXA 3IAS1 3S1NB 1P7EA 3KBXA 1ACCA 4RHRA 1YN5A 4CGYB 1JOQA 3MWYW 4Q2JA 2F0KA 1F9SA 2DY8A 4F87A 4MH8A 1QOGA 2QKIC 2K0PA 5HHDG 2LMCA 3KK7A 4C7YA 3HVZA 2IWHA 4CKEA 5C5LA 5E4WC 2EY6A 4KV6A 2A6HD 2FUG1 2D5GA 1YNND 4XTCS 5HG2A 1H9KA 5M3MB 1TQOA 5BYQA 2EY1A 5EJWA 1JORA 1L0YB 4IN3A 3P7JA 5FLXE 1U4RA 5FK9C 2AUJD 2F0SA 2Z4IA 1N5WA 1YMHE 3PUWA 3OMGA 5LL6X 4IFDJ 5EGTA 2K32A 5C6AA 1TIID 2F0DA 1D5MC 2E2JB 4A90A 1TKEA 3I3CA 1JOOA 1RHPA 5CBAE 2RBMA 3GV3A 1HRJA 2W82A 3TP6A 2K7VA 1Y69U 5KNBA 1WTPA 1JALA 1WTOA 3E56A 3NWSA 1XEEA 3H8HA 2L1AA 4GLSC 3CU7A 3J9CA 2R93B 3BVZA 3IXSA 1MSHA 3H6MA 1S4ZA 5I2XA 1PDQA 3KF8A 4IFDI 3ZQ4A 4KHZA 4PNYA 3Q0AA 5D7GA 1PRTF 1SJED 2WU5B 3TUOA 4B9XA 1PZID 3J81E 3DWPA 2D9UA 1QB5D 2LUMA 2F0UA 1PGXA 1FCLA 3D8GA 3NUCA 1STGA 1OXTA 3PIO3 2QIEB 1EM7A 1LTGD 3NVWA 1SF0A 4ILWA 2WP9B 3TBIB 3FVQA 3ZYYX 3IL8A 1DOMA 4KHVA 4C3IG 1TKYA 3BG3A 4C80A 5AFWA 4IFDH 1XCQL 4A3GB 1E6EB 2JXTA 5M5YB 2G1EA 1SNQA 4KJNA 1Y8OB 3C3LA 4YXDB 1V1OA 4BWGB 3QG1A 2Z1CA 4C3HG 1SJHD 3MVVA 3HUIA 4MT5A 2F0OA 5JOBA 4XQNA 5ELCA 1IUEA 2HCIA 3ERQA 4HKZE 4Q5VA 4ID6A 4IUPA 2H4OA 2K5WA 1BOSA 2ZXOA 4XDDA 1SMYC 4BY1B 3P4SB 4RF1A 5HI1A 2XRSD 4TQ0A 2ID0A 1PFMA 1STBA 1ZEQX 1CJEA 2B2UC 2J53A 1F2ZA 1F77A 1GPXA 1EY7A 1YQ3B 2EJGC 3FILB 2AQ3B 5H8YE 1B44D 2EVBA 3Q23A 2NUCA 1B50A 2B39A 4KKIA 2F0WA 2Z4HA 1BCPB 5JEAG 2G9HD 1SB3C 1TS4A 2FJ2A 2FHTA 3M85A 2K6AA 3A56A 1E10A 5FO7B 3C8YA 2D5DA 3QB3A 1OFFA 3NQTA 1BDOA 1QOBA 3GTQB 1TYGB 2L1BA 1PRTD 4KGRA 1G6ZA 3I70A 4FNFA 4K6LA 4L6TB 3TDQA 4ARCA 5FOBB 4OZBA 4BY7B 4USAA 3VR4A 1ZKOA 4RGNA 1A3TA 3GTPB 3U2SC 1A3VA 2BDOA 1RD9D 3OSOA 3P1MA 3VR6A 1U9RA 1TR5A 5C0XH 3KWLA 1HTLD 3SE0A 2O5JC 1FNVA 4K5XA 5JEAH 2LGIA 5J22A 2M9VA 3AE2B 3QIAA 3C46A 1KAAA 2W54A 4R9WA 4OW0A 3AE3B 1QJOA 2N88A 1NAPA 4L2YA 4A3BB 3B2FA 4A6QA 1HPCA 2IJ0A 2L4NA 2PYKA 5EE0A 3IT6B 1LTSD 4LK0M 2PVGC 2ENBA 4KN7C 5DNFA 1A2TA 1EY9A 4J3OD 1VF5C 2EYJA 4HROA 1U4PA 3U52E 1IL8A 1PTOH 4A3JB 3PMFA 1N62A 4KD4A 2NWGA 2L52A 5LHY1 2NN6I 1HZ6A 3AE9B 4LAAA 1NYRA 1Y8NB 4DAYA 3ITPA 1WD0A 2WINB 1QQRA 2VZKD 2N0SB 1FIQA 4FF2A 1GUWA 2GRIA 5FKAC 2NTTA 2WDRB 3GQBA 3QWNA 4HTHA 3EGRA 1SNOA 3A54A 2H88B 5BMGA 3U9OA 1ILPA 1HUMA 3TEWA 4JX1C 1GB4A 2ICIA 1GUNA 1FNWA 5JVG3 2KA7A 2XIWA 2JWUA 2K5QA 1ZUD2 1NSNS 1BCPD 2JEBI 1FEHA 5C4ZA 2KUMA 4DK1A 1AW7A 2INNE 4IQZA 4L63B 1WCMB 2DWQA 5C3JB 1TS2A 3NVVA 2B2WC 3MFGA 4BS9A 1K8MA 4FO2A 1SSNA 1Z47A 4X3SA 4DNRB 3B2GA 3NVYA 1ILQA 4G7HC 4CKBA 2DN8A 2BBCA 5AUIA 4BBSB 3C2PA 5IT9E 4P16A 1ENCA 4FF3A 5EE3A 3CIRB 3V96A 3U7ZA 1YJJA 4YIJA 5CV5A 3FPUB 1O78A 1B3AA 1CHQD 4OVZA 3S15B 1AFPA 1II3A 2K5PA 2PMZB 2WXLA 2RA4A 2MJEA 3M3YB 1I4GA 2RSNA 1EL0A 5EE9A 4KY7A 3E0JA 2FBWB 1TVXA 1FM0D 3H94A 2IL8A 3HOUB 4K2KA 4HEDA 4JWSC 1YNTE 1GHJA 1QOHA 4RH6A 2AWOA 4IDIA 1XLNA 2A6ED 2M00A 4YT0B 3T16A 3V2TA 2N55A 3T3NA 4G4KA 1K50A 1C4CA 1GXDC 1ZOYB 1TWHB 1MI0A 3IT4B 4RGOS 1S5DD 1LT5D 4XT1B 3LB8C 1XX8A 2JP1A 4I7ZC 2K01A 4FYDA 2F3VA 2EJMA 2J0TD 2WXRA 2RSOA 1TS5A 1SYFA 4XWTA 2N9KA 3QO2A 2I2YA 1QNUA 3L9AX 3NPPA 1DGJA 3FC4A 1L4DB 4H7BA 2A73B 2BDNA 4N9PA 1V97A 1TKWB 2TSSA 1J7AA 5KEEA 1EQTA 3HKZB 1WSPA 1WRIA 2X6GA 3T53B 2KEDA 3VR9B 5IOCA 2A68C 2RMMA 1BO0A 5JPNC 1SNMA 2WQYB 4J6HA 1W6JA 1CA6A 1AEXA 3VA7A 1ESRA 1QT9A 1JICA 2K9XA 3SEBA 3J81L 3W5UB 4K8JA 4IZ8A 1AWDA 1UAPA 3D4WA 2A74C 2DYOA 4RFBA 4C3JG 2LHDA 1DYQA 2JQRB 2EYLA 2PQEA 5CR3A 3S2DB 3E5SA 3SK6A 1A70A 5FO8B 1STHA 1FD7D 3ZJTA 4DF7A 5M5WB 1T3QA 4WQMA 1LTRD 2F0MA 3L4PA 4EQOA 2VUMB 3AE7B 3TMEA 2OXPA 3FMCA 4N58A 2MJ3A 4ZKBB 4TMAB 1YN4A 1XLOA 1ZDXA 2XSCA 2F1MA 1DJRD 1PRTC 2NYZD 4ME5A 3I4MB 3RZDB 1FNUA 1JB3A 5H92C 1I6VC 1JC7A 3PZ7A 1GHKA 2BW2A 2EY5A 3L7ZC 1QF6A 1D1KA 2LY7A 3BDOA 4J1MA 2WXHA 5BN4A 1LT6D 1CTMA 1BF4A 4DA2A 5ELFA 3M7NA 3B9JA 3X3MA 3TZDA 3X3NA 2B2TC 3VRAB 2IX1A 1XTCD 1HTPA 1ENAA 3FRPB 1SXTA 4A3IB 4NJCA 1S5FD 2N9LA 3EUB2 1SYEA 5C2TB 4JWUC 3OIPA 1IYUA 1HZ5A 1RKNA 4CJ0B 2DNEA 1G91A 1UUPA 2JA7B 1HXYD 1IGDA 4UAIA 3I90A 4YSXB 4NAWB 4HR7B 3R3OA 1WTVA 1ICWA 1WTQA 1C4AA 1Q90A 5K5PA 3S14B 1OXVA 1C77A 2EYFA 2GA4B 1N61A 4TSSA 1IW7D 1ZXHA 1LT4D 3ABVB 1QOAA 1CQFA 2IT1A 4EVOA 2ON8A 1V8QA 2VB2X 1JWUD 1F2MA 2R6GA 4RWSC 1ZDVA 3PUYA 2PO4A 2QEJC 5E3FA 1J7CA 4R8IA 4E6IA 2MGSA 3R8BA 1EYDA 3NE5B 5IGFA 1U4LA 2WXKA 1XYIA 1SE4A 3DWGC 3D4DA 1K83B 4ITKA 5JVH3 3I4LA 4MN3A 2BB5A 3NWTA 4A3DB 3AEAB 2B2WA 3F2UA 3DXJC 1GAQB 1EY6A 4DXFA 3NSWA 3K5NA 2YEPF 1EOTA 5CBEE 5F2DA 1B1ZA 2L83A 2YU9B 1H9SB 2ICEC 3DHQA 3BVGA 2A6EC 4WAFA 1EYAA 2XNAC 2DNCA 2F03A 2B2YA 4L1BA 1N5XA 3BK2A 4A3KB 3C1EA 5IGBA 3FDTA 1L0VB 1ZE3D 1YNNC 4R8NA 1Y1VB 4KGTA 3VA5A 4QMGA 2HTME 2AUKA 4K2LA 3LYYA 1HEZE 3PUZA 2JSVX 3MZ5A 5D65A 1X32A 5E4XA 2F4IA 4CKCA 1Q1EA 2WNMA 1MHXA 1J9OA 2MUYA 4XQQA 2LJIA 4KKUA 3A7AB 2K5DA 4XYQA 2ZW0A 4DU9A 2PPBC 1DOKA 2BS2B 2CJOA 3J7AV 1ZP0B 3PO3B 1J7BA 1VZ7A 2SOBA 1PTOB 1OO9B 1JWBD 5EKKA 5E6JA 2J4XA 4KK7A 1OXXK 5JXVA 4S3SA 4Z9CB 1OQRA 4B0MA 3RLFA 3DUZA 1F2RI 3S1MB 4C7ZA 3HRDD 1ZXIA 3AE5B 5ELEA 3T56B 1MI2A 3BWUD 2W55A 3BVMA 3U4EG 2SNSA 2B2VA 2Q8IB 3SHLA 5EKIA 4QCLA 4IKGA 4HJGE 1QG7A 3DEOA 3Q6SA 2ZXRA 3BYYB 1EIGA 5HURA 1JWMD 1EY0A 1AYFA 3MA2B 1Y1WB 5C3EB 3DWQA 1NEKB 1PFDA 1XF5L 2HUGA 4ZOHC 4ZRPA 3Q22A 2BS3B 3W2DA 1LACA 3P63A 3D3RA 5EBDA 1EWHA 3OOCA 3AN1A 1IHZA 4DQOC 3HEJA 3G7LA 2CQAA 3N9YC 3D6WA 4ABNA 3DMUA 3PZ8A 4YTMB 3TSSA 5EE1A 4HCEA 5CV4A 2IGGA 1KDBA 4KKSA 2CVRA 2B8GA 5EPKA 4OO1H 2AWNA 4MACA 3V3XA 4NP5A 1S5BD 3MEHA 2EE1A 3NRZA 1XWEA 3WDNA 4KGSA 4FXGC 4HMJA 3IKJA 3P75A 1HHVA 4KY6A 2XVSA 1VDZA 4TQ1A 5T8IA 1HUNA 1YQ4B 1EFID 2H89B 2KCNA 2LFIA 1D5XC 1V43A 5TSSA 1SMYD 2EOTA 4G7OC 1PFBA 1L6VA 1VLBA 1D6EC 1X3QA 4US9A 2DBYA 4RAUC 2M0AA 2SNMA 1JQ4A 5EPJA 3VYTA 4CHTB 1DZ1A 2WACA 1IKLA 3HG9A 3GTGB 2BCOA 2QJLA 1VF7A 1UWXA 1Q1BA 3PIP3 4QUFA 2SAKA 2WXIA 1G2SA 4L8JA 2PZTA 5DM73 1H9MA 2OEDA 4DAPA 3IAYA 1QWYA 1E7PB 4C1NK 2B2VC 1BNZA 4HCSA 4JE3B 5C4JB 1ONLA 3FPPA 5D3IB 1PTOF 4OHJA 3N52A 4M1UB 3PUVA 1EU4A 1SBBB 2PIAA 4BBRB 1SE2A 1F2YA 1EYCA 3AH7A 1B53A 3IFDA 1PFNA 4F8MA 4AS1A 1V8CA 1ENFA 2WKCA 2F0GA 1DOXA 5HGTA 4YTPB 4C56C 4HRSA 3EJIA 5DEHA 4DAVA 1KNAA 4DK0A 3SFDB 5NUCA 1F0ZA 4EE2A 2F0FA 2NMQA 2EJFC 2M19A 2FMCA 1D2BA 4K6DA 1H9SA 1Q10A 2V0GA 3GB1A 1LTAD 2E2IB 4XDCA 2B63B 1SNDA 1SSOA 1E2VA 1TY2A 5JAVA 1LO5D 3TP8A 1GOZA 2K33A 3VRBB 4ZUJA 1CZPA 1F2RC 3KWVA 3MXGA 3OWFA 4IUVA 3P20A 4XQJA 2M2LA 2OT2A 2QILA 2R61A 2C9OA 1F2LA 2GB1A 5I6WA 2PKOA 1SYGA 2E6XA 1FFVA 5BYSA 5MPOA 2K03A 4MIUA 4XT3B 1H9RA 1RTOA 1KDCA 2HDEA 5EPLA 1D1IA 4ZAIA 4HSPA 4EQNA 1SYCA 3S17B 5CV9A 3VYSA 1QCBD 2F0LA 3LWUA 1LTBD 1NR2A 5JEAJ 1H9JA 2ZXPA 1XLQA 3K5MA 4A93B 2BTEA 4ZLTF 3URYA 4H2AA 1T6BX 5M9OA 3P4RB 4NAMA 3AEGB 2Y3AA 1KABA 3EFXD 3MXNA 4IURA 3NBIA 3RZOB 3Q8BA 5HFYA 1KF6B 1I4XA 3HRZC 3NS1A 3AMUA 3NVZA 1DCZA 1QLBB 5C0XG 4N9TA 4LTUA 4F88A 4TKOB 1GB1A 4IALA 3Q24A 4KN4C 5CV8A 3MHZA 2LEKA 2RPVA 1OQQA 2JA6B 1WTWA 3SK4A 1CA5A 2WLBA 1NCVA 2ONQA 2JZPA 1T5EA 3N6RA 1ZYRC 1JE4A 4FXKC 3CKIB 3P42A 1EIHA 1Z7TA 4K5VA 3CWIA 3GO5A 1CFMA 1JWSD 2JYOA 2L55A 3GTJB 3LXFA 2NVTB 2C5CA 2L5TA 3S9WA 4RCOA 1BR9A 1ESFA 1DOYA 3AEDB 2R3ZA 1VDVA 2X69A 4TRDA 3WOFA 2HQEA 1I7HA 3K5OA 2F3WA 1C4QA 1KFYB 2RQXA 3RPFC 2W3SA 4N59A 1U4MA 1F9PA 2JA5B 5CGKA 5I9PA 4O1NA 1EWCA 4IUUA 1FD6A 2Q8RE 2SDFA 1BMLC 1MBYA 3M7GA 5K36H 2EPBA 5C4XB 2LS01 4LK1C 2LHEA 1FFUA 2EYOA 3RD4A 5KNCA 1DM0B 1QILA 2XN9C 2L0CA 5CYUA 3MC0B 1E2ZA 3K59A 3HVDA 1PLFA 1L0XB 3T4AC 1PMRA 2J7ZA 4DFAA 2KQ3A 3J80L 2F0VA 1TT2A 5DM63 1IBXB 4K5WA 2KHSA 3S1RB 4JK1C 1JWAD 3RFZB 5BN3A 2K1BA 4MHEA 2BE5C 5D3DA 1PTOD 5A2QE 1LABA 1SIJA 4A3EB 3NTIA 3H0GB 2H1EA 1AZPA 4C2MB 1P7FA 2I07B 4PMCA 4K8IA 3KQ4A 4V190 1UWMA 1V1PA 3AEEB 5CC4A 4OZCA 2O4XA 2EELA 3MXPA 1STEA 2DLBA 1K8OA 1EQVA 1I6HB 3CQZB 4ZQ3A 3J7AF 1Q8IA 4YSYB 5G3LD 3O13A 4ZKCB 3H09A 2CHBD 4XE0A 4BA1I 1PUTA 5A2QL 2VB3X 3GTKB 1ML0D 1TU2B 1FXIA 3Q8FA 4HMIA 3FILA 3MHBA 5M5XB 5C5MA 1STNA 3FAHA 1O7YA 5C0XI 4N6EB 4AQ7A 2WXNA 2F0IA 3MXUA 2IGHA 2E74C 4IFDG 2BOSA 1L4ZB 2E2HB 1UGJA 4Y7NB 1I50B 2WB1B 2F0QA 2PMVA 5DAUA 4ZHPA 1SYBA 4I65A 2WP8J 2WXFA 4PMBA 4XIGS 2WXGA 3NQIA 4A3FB 3HOXB 2N7JA 3TEZA 1SNPA 1STYA 5EQ0A 3BK1A 3BDCA 2MHVA 1G291 3ONAB 3RUZA 4DNTB 3DWMA 4DN4M 2PTLA 3GS2A 5IGDA 3NXWA 2DYMA 5EBCA 1C9FA 3VR8B 2NTSA 2RVLA 4QF4A 1EWYC 4CJ2C 4X3UA 1HFNA 1N60A 4P6VF 4ODGA 2WS3B 4OIJA 2R7ZB 1RDPD 3LNNA 4XWWA 1G8ZD 1TWAB 2JE6I 1KTKA 3VR3A 1EY5A 4WIPA 2KEEA 1BUIC