1D6EC

Crystal structure of hla-dr4 complex with peptidomimetic and seb
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 62
structure length 225
sequence length 236
ec nomenclature
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d6eC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d6eC02
1LO5D 1LTTD 1F77A 1CT1D 3BVGA 1XXGA 1ESFA 1TS4A 1G8ZD 1LT5D 1PRTC 2QILA 4BWGB 1L0YB 2IPKD 3R2IA 1PRTB 2Z8LA 2XRQD 1YN5A 1TS2A 1B44D 1PRTF 3EFXD 3BYYB 1RD9D 3W2DA 1LTAD 1EU4A 1AW7A 5ELEA 2AQ1B 3BYTB 1SE4A 1ET6A 1FD7D 1SXTA 5ELBA 1TY2A 1V1PA 4K6LA 1T5XD 1LTBD 1PZID 1BCPB 4RGMA 1PRTD 1CQVA 1BCPF 1PTOH 4TSSA 4L63B 3TSSA 1PZKD 4L6TB 5D3DA 1D5ZC 1EWCA 3CHBD 4O1NA 2O2LD 5ELFA 3URYA 3GP7A 1JCKB 1V1OA 3BVZA 1LLRD 2RDGA 4RGOS 5I4DA 4RGNA 2AQ2B 1LTID 2QEJC 2XN9C 2ICIA 1BCPD 1HA5A 1D6EC 1DYQA 2R61A 4RCOA 4OHJA 1YN3A 2WV6D 5TSSA 1EEFD 1HQRD 1LT6D 1ENFA 4RGTA 1FGBD 3R8BA 1JR0D 1SBBB 1LTGD 4DXGA 1PZJD 1D5XC 1JWUD 1BCPC 1JQYD 1AN8A 3EA6A 1I4XA 1SJED 1TS5A 2J4XA 1V1PB 2XNAC 1UNSA 1BXTA 3O13A 4NZLB 1EFID 4C56C 1EU3A 5FKAC 1LT3D 1FNVA 1S5CD 5ELCA 1STEA 3DWAA 3DWPA 1FNWA 1KLGD 1PTOB 1I4PA 1CHQD 1UUPA 1QILA 1PTOF 1S5BD 1FNUA 1LTRD 4ZYSA 4RHSA 1SE3A 3MFGA 2RDHA 1I4QA 4UDUC 1MD2D 1EEID 1D5MC 3V05A 1ET9A 3SEBA 1LTSD 1L0XB 1PTOD 1RCVD 3R2TA 1DJRD 1KLUD 1CHPD 3OWEB 1YN4A 1HXYD 1LT4D 3KLSX 3MC0B 3BZDB 1TS3A 2SEBD 1M4VA 2XRSD 2NTTA 1PTOC 1RF2D 1JWMD 5ELDA 4RHRA 1HTLD 1S5ED 1I4GA 2NTSA 1JWSD 1KTKA 5FK9C 1GOZA 1TY0A 4DXFA 2CHBD 2AQ3B 4RFBA 1RDPD 1SE2A 1CK1A 2IJ0A 1S5FD 2TSSA 1XTCD 1SEBD 1B1ZA 1I4RA 1SJHD 1S5DD 3DWQA 2G9HD 4Z9CB 4RH6A 5D3IB 1PYWD 1I4HA 3BVMA
chains in the Genus database with same CATH superfamily
3UDXA 4JI4L 2IY0B 3G7LA 2RDFA 5E1FA 4F7ZA 1NR4A 4FBJB 1FRRA 3LWEA 4K2KA 2M0XA 3O65B 3PREA 3PIO3 3RFZB 2EQSA 1VQBA 4N9F4 3B2FA 2BTEA 4LUOA 4BBRB 3I56A 2D0OA 4FJZA 4A9AA 3VUXA 2Q8TA 4QUFA 3VHTC 1KDAA 2KN4A 4D2KA 1D4BA 2Q5WD 2F0VA 3P7JA 2D3GA 2RSNA 5DM73 4II3B 2HDEA 2C7MB 2Y0SG 2A6EC 1HR0L 1RODA 4OX9L 2CR5A 1PFDA 1SYDA 1GHKA 1D8LA 5M5WH 1VZ6A 1VQPA 2LGYA 1OXUA 3AQQA 1WGYA 2M4NA 2C9WB 4REZA 4NAMA 2JZPA 3GTMH 2JYEA 2JEAI 3ZO5B 3CCSA 4L6TB 2L0FA 1IYFA 1R4PB 1N33L 1QE6A 1EWCA 5C4XG 2JQOA 2AL6A 4P73A 1YJIA 1RHPA 2C7NB 4ANVA 2O2LD 5BYSA 2HCIA 1XMQQ 2KWCA 2DN8A 1V1OA 5NUCA 4YHHL 5FJ8H 1IBLL 3TEWA 3G6EA 1QB5D 3NTIA 2I1KA 1YN3A 2VUMB 1VJKA 4JBJA 3WDNA 5T1IA 1VQOA 3GZNB 2EY5A 3P4QB 4JI8Q 3CW2C 3R8BA 2DHZA 5D94A 1RYJA 2BQQA 1VDVA 1JB3A 4JG2A 3CMEA 3OIPA 2O4XA 1E7PB 1JQYD 3CCJA 1TZOA 2PLPA 4FF4A 3NVYA 1OXTA 2XNAC 2HHHL 3MC8A 4DNIA 2VY3A 4DU9A 4DV6Q 4OGQC 1H4RA 4Q5VA 2A19A 2OQ0A 1YJ1A 5FLMG 1KIXA 3OWFA 4AH6A 2GN5A 1MSGA 3DWPA 1GC6A 3RNGC 2QDFA 2E74C 4JOIA 5JPMC 3JAMi 3Q14C 1CHQD 4DR2L 3S15H 3K7UC 1KNAA 4LWCA 4XXEA 1CSQA 2K5WA 5IYBH 1YX6B 1XNQL 2K9XA 3AE2B 1VCBA 1Q46A 3BZKA 3RZOB 1C3TA 1WJ6A 3LYYA 2YU9H 4CKEA 3TZDA 5J17A 1QZGA 1TWCH 4CJ0B 2BH2A 5DAUA 1XMOL 3A1QB 2IHEA 1VD2A 4WJQA 1HHVA 1A3VA 1PTOD 1WTQA 4MM3B 3MHBA 3OLMD 1TT5B 5LXHA 2D9UA 4XQJA 3W3AA 2PMZE 1K73C 2KTRA 4XC2A 5FO8B 5HURA 2RDBC 2V1YA 4NB3A 4W9KA 3VR9B 1TYGB 1WE7A 1RF2D 5EDSA 2AWOA 4GGQA 5FO9B 1EF1A 4FP5D 3VR3A 4X62Q 1JORA 2LASA 4WQOB 1UELA 2JA8H 4I6LB 4MSQB 2HJ8A 2H4OA 4N9PA 4KKSA 5FK9C 1P0RA 2B2VC 4ZUIA 2FCNA 4DXFA 2LXCA 4IO9A 3HUIA 3MHSD 3MEFA 2EE1A 3AFQA 4HCNB 4FHJA 2AWNA 3RR5A 3HKZE 4MHEA 5FO7B 3VTUA 5G55A 3MVVA 2HD5B 1G2TA 2EY2A 4HXDA 1CKMA 2CH4W 2BOSA 3OYYA 3HOYG 1IW7C 4MTNA 3L54A 3ENEA 4KGSA 2WB1B 1CT1D 5HHDG 3PUVA 3FKIH 4GNXA 1PH7A 3M4OB 1E1OA 4X3KA 2K6DB 5KIXA 4A3PA 3A9KA 4YIJA 3G71A 2R7ZB 1MSHA 5BR8Q 4G57A 3PT2B 3PCOB 2AKWB 2NCNA 1XO3A 4EQOA 2SAKA 4X64L 4WAAA 4YSYB 4GOPB 1BDOA 1PFSA 1JJCB 5IWAQ 1JOKA 4KHVA 4C2MB 3HVZA 1Q90A 5ELBA 1ET6A 3MXPA 3NWTA 3CC2A 5M5YH 1E0ZA 2NPTA 2F0LA 4BKTA 2BW2A 2ZTEA 2ZCCA 3K7AB 5C3WA 2WXJA 1B7YB 3UE0A 1G51A 1CQFA 3BWUD 3RZWC 1VQNA 4BY7B 4L5SA 1L1OC 3E3XA 3QR8A 4LNNA 4JL9A 1DM0B 5EQ0A 2RR9A 4DV5Q 2Z6KA 5JEAH 1XPOA 2E5LL 2INPE 4K1RB 1Z6HA 4RGNA 4GLSC 3HKZG 2REXA 1D6EC 4R9WA 1XNRL 1LYLA 4XT1B 1I6HB 2DNFA 3C1EA 2N7DA 3HOUG 2EY6A 1V80A 2D5DA 3ND8A 2IX1A 3ZJVA 3JC66 2IGHA 2I38A 4JIOU 4BXXG 1L7YA 2F4VQ 2B76B 3WOFA 3DXJC 4BKGA 1ZUD2 4ZRQA 1V1PB 3CCQA 1LXDA 1B9MA 4NZLB 3MXGA 1MHWC 4BBNF 1E2VA 5DLQE 4QIWB 2VQEQ 2JF5A 4J1MA 1UWVA 3DWAA 3KBGA 4AWJA 1GB4A 3PHXB 3F2CA 5C4XH 1OO9B 3DWMA 3TDQA 4GDLB 2EKEC 4AQYQ 1CM9A 3QO2A 2GBJA 3U30A 4MGZE 5COYA 2A4ZA 2PNRC 1RAXA 1LTRD 5IGDA 2N78A 4FULA 4YTMB 2GBNA 3HOVH 3A8IE 1T3QA 1TIID 1CZPA 2R93G 1FXIA 1PYBA 2ICEC 3K5MA 2CW0C 3N6RA 1I94Q 2DJGC 1M8AA 4IFDG 3A5UA 4ICVA 3T1HQ 3LDZE 2ZTDA 1QZHA 2PW7A 3OW2A 3GTGB 1R7SA 4ZOHC 2UUBL 2XWBB 1I5FA 3LX0A 2B63G 5C4ZA 3QK0A 4ILWA 4RHRA 4C3IB 2FXQA 1HZCA 1S5ED 2L55A 1QOBA 2NBVB 3AV8A 4KZCA 5CORA 3UF8A 3AE8B 2BB5A 4ZUJA 3U50C 4MT5A 1E0BA 2Y3AA 1JICA 2O6VB 1I3QH 2F4IA 4DV3L 4FF3A 2KOXA 3JVZX 3DBRI 4A3IG 3DVNU 3NZSA 4YT0B 3DEPA 3TCAA 4WJOA 2N9EB 3H09A 5G5HA 4OZAA 1EWYC 5E6PA 1M94A 2CJOA 4GLAC 4KJOA 5KHOA 2DJFC 2E8GA 3UI2A 4JI2L 1PV4A 3GTOH 1BBWA 3NHEB 3ULLA 5FLXc 1DCZA 1VQFA 4OIKA 1PRTC 4AQ7A 1C9FA 4KKUA 4LK0M 4MTKA 4MIUA 2LUMA 3W1SA 3CU7A 4HMJA 1E2ZA 4PS7A 5E4XA 4XDCA 1PRTF 3KF6A 4Y7NH 5T8IA 1F2MA 1YHBA 5JXVA 1H8CA 1T9HA 3KUZA 2R92H 2K6AA 2EYMA 2K05A 1EU4A 4W9CA 3BYTB 1FD7D 4IQZA 5L83A 1RFKA 2M0AA 2XK5A 1XLQA 3RNAC 1IL2A 2F0PA 5G3LD 5KEEA 1BCPB 4AYBB 4IUUA 2L5TA 3H3VI 5HKHA 3LB8C 3I90A 1M1KC 1YD8U 3M85A 2ZVNA 2PZWA 4R4IA 3BS1A 3C46A 5ELFA 2M17A 3I5JC 3HOYH 4HPMB 4JI7Q 3ALBA 2A1AA 2DX5B 2SOBA 3K0YA 3U4VA 4IWQA 4MSMB 4TQ1A 3QWZB 3T8MA 4DV2Q 1EQRA 2BB6A 5LL6S 3L08A 1P98A 2W55A 2QDLA 4I7AA 2JA6B 1R4MI 2FCQA 2KCTA 2C9OA 5M3MB 4DF7A 4JYAL 4L2YA 2D3CA 4A90A 3UIPB 1SJED 2VUMG 2NS5A 1V81A 3DWGC 2J4XA 4KY5A 1F2RI 2CS4A 2J0TD 2WXOA 3IHPC 3M63B 4EKUA 3J7AV 3OHXC 1KL9A 3B1LX 3A56A 1FNVA 4DK0A 1FXTB 4GMVA 4NAWA 3RNBC 2RCNA 2PNHA 4TKOB 4A3MH 1BNZA 5KNDA 1G6PA 1SMYC 1ROEA 2K0PA 4RM9A 2MP2A 5CV9A 1CMXB 4GLXA 3CSTA 4C3JH 2BYEA 1XLOA 4MJSA 2MWSB 4YCUA 5I6YA 1IYUA 2WP8J 3RPFC 2WDVB 2BS3B 5IGBA 1WTXA 4KSKC 4X65L 3TEZA 3OTOQ 4JI0Q 1O7ZA 4H13C 3Q2AC 3ZLZA 2B8FA 4GKKQ 1D5MC 2KCCA 1SAPA 3ERQA 2KTFA 1HQMC 1VQAA 2MPMA 1WZ3A 3Q3JA 4NQLB 4XYCA 4BOZB 2DYOA 1DJRD 5K36H 3ULPA 4BXXH 2L4NA 2WU5B 4A4IA 1XMQL 4B3TQ 1HZ5A 3L0OA 4K7UA 1N9WA 2K5PA 5AZGA 4OW0A 3S14B 4IUMB 1ZPSA 5LMNW 4DHJB 4GN4B 1BBXC 2OWOA 5C44H 1KTKA 1WGHA 4M00A 2KLGA 2RBMA 3PUZA 3KFUA 4GN1A 5E6OA 4U68A 1CZGA 5IKCM 3BK2A 1WWTA 5EJWA 2QMTA 4DPGA 1WJNA 2NVTB 1A3TA 2XWJB 2KQ7A 2WXPA 4FXCA 3AB5A 1SJHD 1WX9A 4TV3A 4GN3B 4LFCQ 4TKNA 2LJIA 1HCZA 2R93H 1ASYA 4DV6L 4CYEA 1O80A 2R2QA 2ZPYA 4H2AA 4CO7A 4FO2A 4IFDH 3NG0A 3KF8B 3OSOA 2ZJPA 2NBWB 3EFCA 3NZUA 3ABVB 1TS4A 3CCRA 3NTHA 1WX7A 5C0XI 3ZJTA 4IUQA 4JW0A 3E0EA 1PVOA 2Z8LA 1UBQA 4ZRPA 4MACA 1EOVA 1B44D 3L16A 3CCMA 1JRUA 4DKAC 3SK8A 1C4QA 1SYGA 2K7VA 2WB1G 2B3GA 2LFIA 4E74A 1C4AA 2XGTA 3GE8C 2HDLA 4EOYA 1TWHB 3H91A 2LY7A 3IL8A 3TN2A 3RZFA 4A93G 3RUIB 2NB0A 1NI3A 2NVQB 3I4MB 1HTOA 1IGDA 5IT9c 4JVZA 1QQRA 3PLVA 4PYZA 4R8IA 4LFBQ 5C3EB 2E2DC 5D3DA 3RN9C 3TEYA 3SD5A 2KJRA 2IBIB 3PZDA 2O6VD 4DV1Q 1QJOA 4RAUC 3HP3A 5J39A 1UZXB 2LGIA 1Q3LA 1YNXA 4JV5L 4RGOS 1IXRA 4DV7Q 2D5GA 5FOBB 4BBSG 2N4FA 3ERSX 3H94A 4EZKA 4DR5Q 1AARA 2B2TA 4BY7G 1IBXB 2INNE 3TRZA 1PLFA 3GD7A 2IO0B 3RNCC 1SBBB 1G91A 1S3SG 3ZRCA 5J2RA 1X55A 1K0RA 2NVUI 1GHJA 4J3OD 1WH3A 4XX5A 2WFWA 3HIZA 4F87A 2KA7A 3O13A 4DUYQ 1GUTA 1EOTA 3NE5B 1VQ9A 2O2VB 2GVBA 3A0JA 2MQHA 3CQZB 5C4JB 2PMVA 3MP9A 2KYWA 2CQOA 4ZRZA 5ELCA 5BR8L 5D14A 2J0KA 3NUCA 4A76A 1FIQA 1FNWA 1HR0W 3ER0A 1I4PA 2L8JA 3S2HH 3IBEA 5IWAL 2JN4A 5C0XG 2MEKA 1C8CA 2J53A 1JC7A 2N9LA 2PI2E 2FCMA 2UUAQ 4E6IA 1A62A 2V1CC 2BA1A 4DNTB 3GTKB 2QW7A 1WJUA 2WXIA 4C7ZA 5HGTA 5BYRA 1Q0WB 3VFKA 1STAA 3SEBA 1JWAD 1LTSD 2Q2UA 3KJPA 3NENA 2JXMB 3GTPH 2MUYA 4HCSA 1OEYJ 3NQIA 3QOJA 2ZZPB 3OG5A 1SNPA 2KVMA 3U52E 4DV5L 2QDBA 3VR6A 5AFWA 1OTCA 1RLFA 1X3GA 2WP9B 4DAPA 1JB7A 4OWXB 3PQIA 5G3LF 1Q86C 3KLRA 5LMUQ 2BT6A 1F2YA 5ISRA 4DGZA 1HUNA 2CHZA 3S1QB 2JXTA 3GS2A 4GU2A 1LM0A 3WIMA 4WJWA 1GOZA 2O5IC 1HNXQ 2C5CA 2DBYA 5M5XB 4KDLB 4C80A 4B3SQ 2D07B 3PUYA 3VDZA 2E2IH 2ZJRA 1L5PA 2L00B 1WYWB 1XTCD 1DOLA 1Z2MA 2FCSA 2R7DA 3DWQA 4Z9CB 1A6XA 2FIDA 2G1EA 2EKIA 2EYOA 1U4PA 4XDDA 2N55A 2J52A 2R3ZA 4NKLA 5J22A 2VQEL 1VQKA 1LO5D 1N62A 3T3OA 2NZHA 4HMIA 1F77A 4P71A 2N7JA 1G8ZD 2ON8A 1EY9A 2H5XA 4NJ7A 1WFQA 4AQYL 4KDIC 3H3VH 3RULA 3L13A 1H9SA 3VR4A 5HGQA 3M95A 3U4ZA 3I2ZA 4EQ5A 3FPPA 3CRLC 3D4DA 3Q8EA 1I50B 4WJPA 4ANWA 3U4EG 1XPUA 1U4LA 3DHQA 1AW7A 1I94L 3QCAA 2X6GA 2DZKA 4DBGA 2LXJA 4M8NA 1B8AA 1D1IA 2HTME 1D7QA 2KFKA 3I9V1 1IBKQ 4DDID 3T1HL 2YV5A 2H89B 4OIJA 4MH8A 1VQJA 3D3RA 4IPHA 3CF6E 3ZW3A 3EROA 3H7PB 1UEAB 3E9HA 4TSSA 4CKBA 4P74A 1UWMA 5AUKA 2J42A 2LGXA 3M4PA 5CV4A 4NY0A 3PO2H 2PQAB 2EYFA 2LVOA 3J7YW 1FMAD 3IAM1 4M8AA 4AYBG 2VQFL 4AOFA 1X9NA 1U9RA 3EBEA 1WJ4A 1IYJB 1K83B 1EEFD 1N34Q 1B2TA 2V4LA 1Y14B 4ULLA 1GNUA 1N61A 1PUTA 2V3SA 4KSLC 2LEKA 2RKSA 1SMXA 3I70A 1V49A 2ZXRA 3QIAA 3UDGA 2KO3A 2LRWA 1H9JA 1P1AA 2BE5C 1OQQA 3QOLA 2MBHA 1QOFA 4A93H 1F2ZA 2D3AA 4A3JG 3U7ZA 4A3KH 2MFIA 3QARA 2KZRA 5G5GA 4UP9A 2EELA 2JA6G 4DK3C 4XYQA 1TBEA 2KWUB 3FILA 3C1FA 4QF4A 4HPPA 5M3MG 3S2AA 1V6EA 2FUHB 1ENCA 2GOWA 4QGUA 2UU7A 1XCTL 1PTOB 2PJHA 4H0LC 2PO4A 2BF8B 2KQ3A 2GRIA 2A69C 1IKMA 1S40A 4BBSH 1XD3B 5D7GA 1TKWB 3TEXA 2CVRA 4I7ZC 3AU7A 3NPPA 4KGRA 1BUVT 1PH3A 5KNCA 2EYPA 5EBDA 5ELOA 4NJCA 3J80L 4BKSA 1PXUA 4K8JA 1SE9A 3HEJA 1L1OA 5C2TB 1UE5A 1CKNA 5JVH3 2VH1A 1ICWA 2B2UC 3KLSX 2UYZB 4JI7L 2FE8A 3BZDB 1TS3A 2WXFA 3H0GB 3G48A 1EWHA 3Q23A 2NTTA 5M3FB 3P2BA 2CWAA 2BWFA 4DR3Q 3HOXB 1E8WA 4CHKA 2IYDB 1WXSA 3BZCA 4IM3A 4B6WA 3AECB 5GAGC 4GIVA 4WORA 2DLBA 4O2DA 4YTNB 1BBUA 2PTLA 3KOJA 1GD7A 3RMKC 5C0XH 1KDBA 1S5FD 2K5VA 2AHOB 5HY6A 2MP1A 1XT9B 3MWYW 2IGDA 4FHKA 3M3YB 2KWVB 5GXGB 1O7IA 2RSOA 3PO3H 2PKOA 4J6HA 4LJPB 1Q1BA 5FR3A 1PYWD 4A3OA 3W5OA 3UDFA 1QF6A 1NBFC 2KC2A 2I5HA 3CAMA 4YCVA 4NXMQ 4NNJB 1PA6A 3IT4B 1XXGA 5IO9A 4P72A 2QILA 4R3DA 1C76A 3DMUA 1QVFA 2KTRB 4WAFA 3ZDMC 3R2IA 3AE5B 2GLSA 2F1MA 5LHY1 5EPKA 4NXNQ 4K8IA 3UIOB 1HNWQ 4JI0L 1DOXA 4PYUA 1ISNA 3KLWA 4DR1Q 4BA2I 1U4MA 1LTLA 2JA7B 3I4NB 1QZEA 4US8A 4K6LA 3S17H 2LJ5A 2N7EA 1EQQA 5E7NA 1PZID 1JROA 3AE3B 4CDFC 2R6GA 4UAIA 2A74C 3VRBB 4URKA 1B9RA 1BCPF 4B3TL 1E90A 3S1NH 2LHDA 4ZHOA 3DBHI 3BJUA 2AL3A 4LLGM 5H1SE 4BY1B 4WWPA 4C3HH 3I4MG 3J81j 3P4SB 1PH4A 1JW9D 2V4DA 1EM7A 2F0SA 4GNXB 4R1JA 5C3EG 2QC8A 3OOCA 2JY6A 1WJJA 3GTJB 3W9CB 3K9OB 1JJGA 1V43A 3MXNA 1TWAH 4LFCL 1C4PA 2RSUA 1VF7A 2K04A 1TR5A 1FYCA 4HKQA 1VZ7A 2YTXA 3HOWH 2NVXB 2QHOA 3AE6B 2N88A 4HIKA 3PUWA 1NNXA 1ZW7A 2NPTB 2K75A 1WTRA 2K52A 2MHJA 3HM6X 1JE5A 1MJCA 3ZUNA 1MKHA 4RM8A 1VR9A 1KAAA 2F0QA 5IYDG 1HZ9A 4UP8A 4X3UA 4KHPQ 4KVGB 1OXVA 1CA6A 2E2JH 4GZYC 4WWOA 1J0GA 3SDZA 1HZAA 3U9OA 1R4QB 4DUZQ 3ZYYX 4JBMA 4LDTD 3F1ZA 1QOHA 3X3NA 4A3DG 4RHSA 5I9PA 1SE3A 1SLJA 3CRKC 3JAMc 5E6JA 1Y8NB 5LXIB 1EEID 4LF6Q 3TP6A 2LRUA 1FFVA 1YJWA 2O5JC 2DNEA 4LFBL 1Q8KA 1TWGH 2L3ZA 3K5LA 1Y8OB 4P7IA 3J80i 4DV1L 3W5UB 3S1RH 4S17A 3A55A 3WCQA 4A3JH 3I91A 2XVSA 2SEBD 1VQDA 4A3GG 1U0LA 1Q82C 4IKGA 2QF7A 4EE2A 3M3JA 1G6JA 2KQSA 3ONAB 2Q8RE 4DR5L 4EVOA 4DWFA 3EQLC 1XX8A 4S3SA 1DOKA 1H9MA 4H7BA 2V3PA 4XYOA 2AQ3B 2INCC 1BO0A 4HLEA 4F8CB 5CGKA 4L5QA 1R9TH 4H02A 1CSPA 1GO3E 1I4RA 1WZ0A 1WGGA 4HEA1 2KK8A 1U5KA 1KH0A 1TKYA 2KOLA 2E76C 2N0SB 1HTQA 2Z6BA 4DNRB 3K5NA 4I6NB 2RPQA 1QG7A 2N3SA 3M4YA 1F9RA 1ESFA 2WX0A 3MJWA 3IAYA 3S1MB 4OWTB 2EJMA 1L0YB 3A5ZB 2HIVA 4N6EB 3P1HA 1F9PA 1W2BA 2JA9A 2JSOA 3HFZB 2UUAL 2DYMA 2KVZA 1FCCC 2L32A 1J6QA 1ZXTA 1CA5A 1NUCA 3GTLH 3M4QA 4CBVA 1EQTA 4ITKA 3KLSA 5ELEA 1SIFA 1E3PA 2JPHA 3V6EB 2K1BA 2Z1CA 1A15A 1T5EA 2DZJA 4P1CC 3RLNA 3ULJA 4RGMA 4OO1G 3VXWA 2CU3A 4HJ7A 2ZNVB 3ZXVA 3SHQA 1CQVA 1YNJC 2IT1A 3NELA 1N63A 1PGAA 3AEGB 2LVPA 4NPNA 4FXDA 1FD6A 5LMUL 1XCQL 3RYTA 3URYA 4JX1C 4KY7A 5T1GA 2KCMA 3MJ5A 4DAYA 2DAJA 1TIFA 1I35A 1STGA 1HNXL 1OQRA 3R7QA 3GB1A 1DYQA 1K52A 4B3SL 2RPVA 1LT6D 1ENFA 4KKTA 4RGTA 1IUEA 2KDBA 2NWGA 4IFDI 4F88A 3KF6B 2D11A 3T53B 3LJ3A 3KUPA 4G7OC 2L7RA 5ELNA 1KFYB 2MHVA 1Y1VG 3CIRB 2UXDQ 3ZNID 2N49A 2ZT9C 4ZAIA 2XK5B 3J9CA 5H8YE 4E3CA 2EZVA 4DR7Q 4NQKE 4LCDE 1RFAA 2KEDA 2JZ3B 5HI1A 3TL5A 1LT3D 2KJXA 1SFOH 2I2YA 1MJEA 3TREA 4M01A 1UAPA 3CXCA 2HQEA 4U673 5IGGA 1FRDA 1YIWA 3VUWA 3HM3A 1FEHA 2YTYA 4IJHA 1L6UA 1XLNA 2DY7A 2MBQA 5FLXE 2F0JA 3CD6A 3HVDA 3Q0AA 4ZYSA 4V190 1J7BA 1GUGA 1IHZA 2CQAA 1IBKL 4GXBA 3DLLA 1CUKA 5EKLA 3K81C 4UDUC 4LFAQ 4YWMA 1PH2A 3S2DH 1TGZB 2CU1A 2L76A 3I55A 2LD9A 3SFEB 1C78A 1Y1WB 1SYFA 3VYTA 1EIGA 3SVMA 3F2DA 3CCEA 4B9WA 4EGVA 1AE2A 1RCVD 2GA4B 4BBNC 1EZ8A 3DQVA 3ONSA 3NS8A 3QWNA 4ZHPA 3EC8A 1V8QA 4DR4Q 4TMAB 1QNUA 3OWEB 1PHJA 1NTGA 1LT4D 4DHZB 4P6VF 3EUB2 2NBFA 1NMGA 4NW2A 1NEKB 1PFMA 3DHGC 1E6EB 1K53A 1IKLA 1ZOYB 1ILPA 1FVIA 4USAA 2F0UA 4C00A 1EY8A 1HJPA 2NTSA 4NAWB 2KNBA 2YEPB 1WMHA 5EE0A 5BN5A 2QKIC 3T13A 4IUPA 4A3FB 2MQJA 2AUKA 4CKCA 2MP2B 4OZCA 1YQBA 4MJSB 1I6VC 1DD2A 1W3SA 3Q8DA 2MBOA 3A9JA 2CKZB 3HOXG 2WKCA 2ZXOA 3APDA 1GC7A 3PRPB 4S0RA 4K6DA 4A3DH 4ACFA 1S5DD 2DNCA 4JI1Q 4M0WA 1BR9A 3V96A 3FHWA 5IGCA 1I4HA 2KX0A 2QSDA 1S4ZA 4FDBA 2UUCQ 5E3FA 1AEXA 2PW9A 4JWSC 5JEAJ 3Q3MC 3P75A 4V0BA 2K6QA 2YVCA 1LT5D 2V0GA 4BWGB 5C6AA 2MLBA 2JA5B 2VNUD 5FR6A 1RWSA 4N9TA 4LF5L 1STNA 4A3GH 2OHFA 5FLMH 3VH3B 1X3PA 1WM3A 3KBXA 3CCLA 4BZAA 3AEDB 4G7HC 3GO5A 1UEBA 1HEZE 5K5PA 5CV6A 1YQ4B 3KJOA 1J19A 2E75C 1EZ6A 3HZXA 3HGBA 2EXZA 1WCMB 3KDFA 4A3BG 1N60A 4MM3A 1UGMA 3U7DA 2IDYA 3RZDH 3GZNI 3NTKA 5KYIA 1HA6A 2EPBA 3NSWA 4HCEA 5C5MA 1SNMA 5IYCG 1LM8B 3AULA 4PS3A 4B0MA 3HOZB 3ZKJC 1QKZA 1FXAA 1SIJA 2MW5A 4WH4A 4JBKA 2ENBA 1TU2B 3I4NG 2JSVX 5JZEB 4A3EG 5EBCA 4L5TA 3CPWA 1XQQA 4GS3A 2NVYH 2MBEA 5DPRA 2LZ6A 2WWZA 1Z47A 2QEXA 4NJ6A 3AYHB 2XN9C 1RIPA 4KY6A 1KM7A 2E2HH 4AUQC 1MI2A 2QGQA 1EFWA 3DBSA 3SFDB 2VZAA 3VH4B 4YY3Q 3FMCA 4P1BC 2QA4A 1KNEA 3K5OA 2LMCA 1JR0D 2OCEA 3Q8FA 4HN7A 3MC9A 4BBRG 3PRMB 3KYHC 1C9OA 3EA6A 3S16H 4DAVA 1GUNA 1S3OA 1VS0A 2EYJA 4MEMA 2OEOA 1JMCA 1PDXA 5C1ZA 1BXTA 3OJ3A 4LF7Q 1F52A 4HSVA 3NJTA 5M5WB 4IALA 2YYZA 1BQQT 5IY0A 2KENA 1UD7A 4B3RQ 5CYUA 3IXSA 3GTMB 4HDQA 2DUDA 3PSEB 2UWQA 4NXNL 4MZ9A 1HNWL 1SGHA 1PTOF 4OZBA 4DR1L 2BVCA 3PRZA 1EYDA 5DPTA 1E8YA 1WYDA 4DFAA 3TS0A 3R66C 5AZFA 1CTMA 2FJ2A 2A68D 4L5RC 3GOEA 3Q3FA 3E9IA 1KF6B 3GTQH 2BDOA 1Q8IA 4K3CA 3VR8B 2WAQB 3CMMB 4ZDVA 3PIPA 1B70B 1QT9A 5EE9A 4XZ4A 2DENB 1K3RA 4LW1A 4UPAA 2EMTA 4BOSC 2Y5BB 2PYKA 3ZXRA 4B0EA 1HXYD 1ENAA 1Y1VH 2BDNA 3BU2A 3ZNHB 4C7YA 3B0AA 1TWFH 1M4VA 1QUQA 2AYOB 1GB1A 5IT9E 3JYUA 2L12A 1QWYA 2PIAA 3CCUA 4JI3Q 3U8ZA 4JOIC 5IP9G 1DOYA 3ZJUA 2P5ZX 4FLHA 4B3MQ 4W9LA 3EHVA 1QVGA 2EDGA 4X66Q 1QCBD 3C3LA 4RKLA 2ATWA 1AZPA 2EXDA 1SSOA 3QG1A 3S15B 4OEMB 1N5XA 4HVBA 5J18A 1T6BX 3HOUH 2ACZB 3K58A 3JSVB 3RLOA 3PZ8A 2PW5A 2WB1E 3TS2A 4OVZA 1L6VA 2FHTA 1VQHA 2R7FA 3KK7A 4ME5A 4B9XA 1VQEA 2YU9B 4PQXA 1TJEA 1TWCB 3TP7A 1WXQA 4P75A 4YCWA 1XLPA 1RL2A 4KTAA 1X3FA 4KHPL 2N8NA 5CV7A 4I6PA 4N58A 3ICEA 3Q3OC 2WLBA 1ZYRD 1J5EQ 3QC8B 5D6JB 2KHSA 5C23A 2LXKA 2VZKD 4JI8L 1LABA 1HH2P 4LF6L 2ZVOA 2JYTA 4OXPA 4LMQD 2JA8B 1K0SA 1SYEA 4HJAA 1NSNS 2HT1A 1EUJA 4G4KA 1CJEA 2JWZA 3ZDTA 4L8JA 4CQNA 5I2YA 2B2UA 2OTJA 1B3QA 5J3BA 2WXGA 1NE3A 1GUOA 1Q12A 1WFYA 1GG3A 3L10B 2BA0A 3X3MA 2G4SA 3C19A 1LLRD 2RDGA 5I4DA 2EJFC 1VF5C 1MG8A 1G6ZA 2A6HC 1JWBD 4OVUA 3SDLC 1XWEA 2ASBA 3SHLA 1E7VA 1VQ7A 2WV6D 2B63H 4KGTA 1K28A 2B3AA 3FKIB 2F0DA 2RQXA 2PI2A 2KN5A 1FR3A 3N30A 1H9SB 5IGFA 3ZNGC 1D5XC 2VB2X 1MIUA 2BCOA 4TRDA 3AE7B 3DBLB 4LJZC 4ZRIA 3NOBA 4A3BH 2KHWB 1PDQA 1AN8A 1RTNA 2R7ZG 1LQBA 4ZLTF 3PVLA 1GUSA 2IHFA 3L2PA 3PF5A 4A3IH 4QIWE 3NUHB 5IN7A 5IYCH 4NMZA 2KFKB 3TBIB 1UNSA 4Y52H 3AM9A 4HK2A 1P3QU 1STHA 1EFID 1ZXIA 4ODGA 5FKAC 2MSED 2B8GA 5M5YB 1E2WA 4HTHA 1EIHA 2DAFA 1VZ8A 2KWDA 2MNAA 4QUCA 3J81E 4X62L 1ZP0B 3ECIA 2ZW0A 5LLIA 4A3EH 2Z6KC 5JAVA 1UUPA 3J81L 3STBD 3VAWA 2VL6A 1X1MA 2ZJDA 1EYGA 3NVVA 3ND9A 3SE0A 3ZQ4A 2Z59B 1MHHE 1PH8A 5JOBA 1YI2A 1ET9A 3G4SA 3Q69A 3QAQA 1YNND 3CWIA 4BBRH 2EJGC 5EAYA 2MJEA 1L4ZB 1V9PA 4IZ8A 2HHHQ 3IG3A 2N9KA 3ETRA 3I4OA 2Y0SB 3K6OA 4XQNA 2DZIA 3VR2A 1Y1WG 3FILB 3OJ4B 2FIFA 1I4GA 4KMUC 4YXDB 5JVG3 4JC0A 4UY8C 4DR2Q 2B29A 2ZCBA 3IVFA 2AUJD 5C4XB 4HJ9A 5IOCA 2ZW1A 1EUVB 3UE1A 3B2GA 1UE6A 3VQIA 1N5WA 1X56A 2UXDL 4K14A 1HPCA 4LAAA 3APCA 2CJNA 3H6NA 5D3IB 4DR7L 4A6QA 3NS1A 1TTNA 3HOVB 4O42A 1P9DU 3RCZA 2FMMA 5BO4B 1WI5A 2PE6B 3K80C 4ZKCB 1H95A 2VUMH 1FPYA 4Q2JA 1EWIA 3RI7C 5CV8A 2TMPA 4IUTA 4R4OA 1L1OB 3R3OA 3I4LA 4MN3A 2I0QA 1WTWA 3K59A 2PPBC 1WGRA 4JPSA 4YL8A 1VMPA 2RCFA 1LGRA 2G4DB 4LNQA 2L0TA 4M02A 1PMRA 4HCPB 1LV9A 3WAPA 5GMVA 3V3XA 2EVBA 3VTWA 5IP9H 4JI5Q 4LFAL 4LNOA 1XTDA 3S9WA 4AYBE 3OMCA 2IY5B 2G9DA 2JA5G 2D2CC 4WJ3M 1JJ2A 1EIYB 2F4VL 4C3IG 2UXCQ 4PMWA 1LTBD 3Q22A 4FJYA 4HR7B 4DR4L 2Y5CA 5D2MB 1I3QB 2KX3A 1F9QA 3Q8BA 4XGAB 3H6MA 2AMCB 1UBIA 3E56A 4TQUS 3D31A 1WCMG 2F03A 3N1XC 5KNBA 4DK1A 4DK6C 3I63C 3KVFB 1R4NI 4HWIB 2F3VA 2JX5A 3SK6A 3N32A 3HOZG 3RZOH 3C2PA 1Q81C 1BF4A 4B95A 2A6ED 3GTOB 4Q0FA 4GOPC 2I07B 5TSSA 4OELB 2A73B 4PZ8A 1FGBD 5M9OA 1IPGA 2ZXPA 3SR6A 1E7ZA 1WGKA 2KCNA 5L37A 2F0TA 3CF5A 1YMHE 1IGCA 2M00A 4ZCKA 2UUCL 3KF8A 3NBIA 4Y7NB 2W54A 2BH8A 2KMCA 3FVQA 1GM5A 1EL0A 1Y56A 5CHVC 2R92B 4HJ8A 1TS5A 3I7FA 3GV3A 4P16A 2OT2A 4LDTB 1MBYA 4TVAB 2N9XA 4I65A 1FGUA 3RNEC 1S5CD 3GV6A 4EX5A 1C77A 3A8KE 3EJIA 1UGJA 1SRUA 2HQLA 2E5LQ 2B2VA 3I72A 1T0QC 3KUCB 3VYUA 3AU5A 1FNUA 2MBBB 3HOYB 1EYAA 1RKNA 2GVAA 4X3TA 4HIMA 4WJNA 1I4QA 1QLBB 3UDIA 1VQ8A 1V5TA 3D8GA 2WU2B 4TUUA 3MXNB 1X65A 3M4OH 2AEHA 2L1BA 2LGSA 4GOCA 4CDCC 2R7ZH 2HTHA 1YN4A 1WI0A 2PZUA 3MC0B 1ICFB 1WTVA 2PPHA 1CZWA 1A3UA 2L11A 2J7ZA 2XRSD 4A3CG 3SXHA 1HTPA 2PMZB 2WAQG 3AFPA 4C2MH 4DV4Q 3CSFA 2M56B 2IO1B 3HK0A 2NMQA 2F0WA 4YY3L 3P63A 5MPOA 4FF2A 1GUWA 2JXXA 2YEPF 2OOBB 4DA2A 5LL6X 3K7AH 3OMGA 4A3MB 1VQMA 1MGSA 2MX2A 4K0KQ 3J7A5 1L0VB 4DV0Q 1F2LA 4C3JB 2KKCA 1SEBD 2KECA 1PYSB 4BY7H 2BPSA 1WY8A 2HUGA 1K3BC 3MA2B 2WINB 1X6OA 3NWSA 2I5MX 3HKZB 5JJZA 4LF7L 3Q24A 2KT7A 2FINB 3P42A 3OPOA 1G2SA 1Z5SB 5DM63 1WTPA 4F1SA 3L3OC 3SU8X 3TMPB 4B3RL 2IGGA 5HFYA 4KJNA 1U4AA 4CJ1B 3WAMA 4FN2A 3DPDA 3EGRA 3T1YQ 5F2DA 1I6HH 2SDFA 2DWQA 4GDKA 4EZLA 4M1UB 3PMFA 4NDXA 4DV2L 4PMCA 3HRDD 2N9PC 1TS2A 2MJ8A 1E9MA 1DOIA 2WACA 5JJLA 1LTAD 3RN2A 2K8CA 4DV3Q 5C5LA 5C44B 2KJHB 1IW7D 4N59A 4JI6Q 2DZMA 5A2QE 1W6JA 1KC8C 4OONA 1D2BA 1E8ZA 3FEWX 1Y8RC 3N1ZC 4IPGA 5CTRC 1TZ1A 5LNK1 4PV1C 2IO3B 4HKZE 4KD4A 3T16A 3SGIA 5DPWA 2NBUA 5KYLA 1A0IA 1D5ZC 3JAME 2VXWA 2GI9A 5E6NA 1HNZQ 3L0WB 2WXRA 4JI2Q 4JI3L 3MAQA 1UE7A 2NZOA 4IG7B 2YLMA 2R93B 2Q2IA 4IPCA 4YTPB 3WALA 1II3A 4B3ML 2FUG1 3K9PB 2JP1A 2AQ2B 2OJRA 2MGSA 5C3JB 3P1MA 1UF0A 1H9KA 1CFMA 3OTOL 2OF1A 3K8AA 3VA5A 3D0FA 2G3QB 4GKKL 4LF9Q 3GTGH 1BCPC 4CDEC 2K14A 3H9DA 3VDYA 3EECA 3LXFA 3NVWA 4BKSD 1VRAB 2CKHB 1FCLA 1YZ6A 4XWTA 1WD1A 4GKJQ 4C3IH 2K5DA 3D6CA 5JJIA 1JALA 2KFJA 4E71A 2I1JA 4DAMA 1P16A 4HDOA 2XIWA 4IJLA 5A35A 1EF5A 1QVCA 3PV1A 4ICUA 4A20A 4MGIE 1EO6A 4RNAA 3L7ZC 1PH6A 4WJ4A 1VMCA 4JGHB 4KX6B 2HCCA 2WDQB 1EY7A 4BS9A 4LNFA 4WURA 3UGBB 3LWUA 1AH9A 3NEMA 2KDMA 1AFPA 2V9HA 5CBEE 1YBYA 2CHXA 2XEWA 4RCNA 4DAYB 3A9KB 3EVQA 3M9BA 2E3TA 2NN6G 2WXQA 3H7PA 4ME3A 4G7ZC 1V9JA 1NMFA 2WX1A 1E1TA 5JPNC 4KN7C 3ZJYC 4UHVA 1RJTA 1SSNA 3DVGX 2DGYA 2GBMA 4B08A 2FAZA 1KABA 5JEAG 4J6IA 1WX8A 3GE3C 3H15A 2WNMA 4FJVB 1HE8A 4F8MA 3NZ3A 4P2CB 2L83A 2D10A 3J80c 3H7SA 1WVLA 3JW0X 3L17A 4EZJA 2CW0D 2WKDA 1TY0A 2F0NA 1YITA 2CHBD 3FAHA 4C4VA 2X38A 4OO1I 4RFBA 4ARIA 1WXAA 3TBLD 5CV5A 4AP4C 3D6WA 4NP5A 2KC1A 3S2HB 4X65Q 1C0AA 3AEEB 1CI3M 3ZVVA 4QY7A 1WOCA 1EY4A 2QIEB 3AN1A 3BVMA 3QB3A 2XBBC 3LNNA 4HIOA 2Z0DB 1D3ZA 1LTTD 2VH2A 1VQ4A 1N6ZA 4QB4A 2WXLA 1B4OA 3DM1A 3L9AX 4DV7L 2L05A 4KIKA 3GTPB 3GDEA 1O78A 2JA6H 2FBWB 2IPKD 3A4RA 4A3CH 2F3IA 5M3MH 3HOVG 4LUVA 5CBAE 4DK5A 3AMUA 3DBRB 4H44C 3VRAB 3H1UA 1XYIA 1A5RA 1A2UA 1RD9D 1QNKA 1WMHB 2D2QA 4NPSA 1TY2A 1ILQA 4R4TA 1TKGA 2JEBI 3NBHA 1PRTD 2H1EA 4DUYL 3IFTA 3A9JB 4WIPA 3E5SA 1VQ5A 2E2IB 3AEAB 2IX0A 4FYDA 3PIOA 4M0WB 5GROA 2KLCA 3U2SC 2NR2A 4G50A 3MHZA 5CHWA 3LGJA 3I73A 2QJLA 1LACA 2Z4HA 4HJKA 1P7FA 1HZBA 4IOIE 2CHWA 1FJGQ 5G2NA 4TQ0A 2QEJC 4HPLB 1HA5A 4RCOA 2JE6I 3VUYA 2OXPA 1WTHA 3U9SA 1MVKA 4XQQA 4DDGD 4ABNA 2INDC 4LF4Q 1JMLA 1YJNA 2IX3A 1JWUD 2MH7A 2OTLA 2JQRB 4PT5A 5AEKB 4POFA 2KQ4X 3KDFB 2DYBA 2E6XA 5DNFA 3E9SA 4MDKE 1HFGA 3S14H 4CGYB 2VW9A 1BKBA 1HRJA 3N52A 4XTCS 2PZTA 1TKEA 2KANA 1XJVA 2EYLA 5BYQA 1S72A 1KRSA 2I5LX 2R92G 4RF0A 3QA8A 1N36Q 1J9OA 4K5WA 2NVTH 4JV5Q 3V6CB 4JI5L 4KV6A 3AEVA 1R4MB 2R2OA 3PO2B 1VQIA 4LTUA 5IP4D 3SR1A 1AZQA 4II2B 2UXCL 1VLBA 3APFA 2JT4B 4K2LA 2C60A 2LMCB 1GUAB 3BY4B 1L0XB 3PTFC 3ZTCA 1WGDA 3D32A 4RWSC 4CDDC 1ZE3D 4IOCA 3R7RA 1TT2A 3PS6A 2KHIA 4PZ6A 1SMYD 2UU9Q 3U58A 4YWKA 2LFNA 1QOAA 2D62A 1VQCA 2J0MA 4JBWA 4A93B 4W9EA 4DXAB 2JVCA 5C3XA 4A3KB 1OEYA 1TWHH 4QJFA 1MI0A 4XDXA 1P7EA 4XE0A 1IZ6A 1JWSD 1SDFA 1IBMQ 2ONQA 4G11A 2B2WC 4ZQ3A 2NVQH 1PGXA 1N32Q 3I4MH 3NK9A 1SB3C 1DONA 1G291 2VRRB 4KV2A 3ZTDA 5BMIA 4JK1C 1SE2A 1VCIA 2IJ0A 5C3EH 5FLXL 3W5VB 2KDIA 3DHIC 2LWPA 1JE4A 3K0XA 2PCFB 1B1ZA 2PQEA 1DOMA 2G9HD 2ALYB 2NN6H 4PG3A 4HJ5A 4WQMA 2MCNB 4EEWA 4AS1A 2VZKB 4ANUA 2WIIB 4CJ2C 4ID6A 4BBSB 4ZYNA 4A3MG 3S24A 5AJ3Q 3NRZA 4C3JG 3TP8A 1V97A 3C0RB 3F2BA 3DCGA 1O7LA 4IM0A 4N8FA 3AEFB 2RHQB 3PUXA 2BBCA 2XRQD 1QUQB 1YN5A 3AU4A 1N34L 5IYDH 3FDTA 1OQYA 4MGYE 3KQ4A 1ZGUB 5GAEC 1SN8A 1AE3A 3H0GG 4IWPA 3DVGY 3T4AC 5M3FG 2V3NA 3CMAA 4DR6Q 1K8MA 5K36G 3KWLA 2K5NA 3HKSA 4RF1A 4FADA 1SNOA 1KDCA 1T5XD 3CQZH 5C4JH 1NCVA 1OXSC 3Q6BA 2LXAA 2KD0A 1ML0D 3UQAA 4UP7A 2FNJB 3PGZA 4L63B 2A6HD 1K8RB 1PZKD 1AWDA 1WE6A 1PGBA 1NAPA 1A63A 4DV4L 4JLCA 1VQ6A 2B2YC 5C44G 3CHBD 3PO3B 2XTIA 4J15A 5AUIA 1KHIA 1OXXK 1JCKB 1Q1OA 3GTKH 2IY1B 3E6ZX 2QCZA 2CWPA 1OFFA 2NUCA 2A5UA 2F0EA 1X3QA 2M2LA 1A2TA 2X69A 2ZTCA 3TEHB 4IOAA 1BT0A 3A1QA 4K0KL 3RUZA 3X23A 1JT8A 4LJOB 4DV0L 1K8OA 3R93A 3AE1B 3F8TA 4XWWA 1PZJD 2A8VA 3PPAA 5CX3A 3VVWB 2KEEA 1WIAA 3BG3A 3WWVA 2MO0A 3HG9A 2UXBQ 3IAS1 2J7QB 4K3BA 2OEDA 1PFNA 4IUVA 1VQLA 1WYGA 3AB9A 2W3RA 4KI0A 3Q6SA 3T1YL 1GJZA 1SYBA 3PIP3 2KMAA 3CKIB 2F0MA 3S1QH 1EU3A 3PGEA 3S17B 2RMMA 1RM6C 4KLKA 2PVOD 3AEBB 5AZHA 4QQBX 2JA7G 1DZ1A 1STEA 1ZEQX 4LK1C 4DR3L 2YTVA 3PZ7A 5M5XH 4XIGS 2AWTA 2WDTB 2OQKA 4K81A 2BS2B 1NBWA 3S1NB 2GBKA 3W1BA 2RF4A 1NJIC 3BK1A 1STYA 2VQFQ 1T0YA 3TQYA 1WXVA 4IW0A 1ZXHA 2M9VA 3WA0A 1YHAA 4LF8Q 4C3HB 3ML8A 3VTVA 2Q2TA 4JI6L 1NVID 2H88B 2RDHA 2HIXA 2Z0SA 2LHEA 4BY1G 4JWUC 5KGUA 4YWGG 4K5VA 1X3EA 1EY5A 2K03A 1PQSA 4O0AA 3EN2A 3RNFC 5BMHA 1HNZL 4NXML 1TWAB 4FXKC 2ID0A 1BVSA 1KRHA 1KLVA 4OO1H 2EYHA 3A8JE 2ZM6Q 1I50H 1IL8A 3HOWB 1PTOC 3OW7A 3FRPB 2L52A 4GOPA 1HTLD 3QQ8B 3VYRA 1KD1C 1JRPA 5E4WC 5EGTA 1KXLA 2IO2B 4HROA 1RRBA 4X57B 2LS01 2WXHA 2JWUA 5KHQA 3CP0A 1I7HA 3W1YA 4BA1I 4LF9L 5BN4A 1RDPD 1UH6A 2E2JB 1B9NA 3N1YC 2G45B 1A8VA 3H8HA 4LNKA 2F0HA 1GVPA 3A74A 4GKJL 1N8RC 1AYFA 4RH6A 2D0PA 4XT3B 5LMNQ 5KRUA 3HS0C 2K01A 3P4RB 4PS8A 3VYSA 3T3NA 2JZZA 5BMGA 1KRTA 1NY4A 3K57A 3V60A 3N20C 1FO4A 1RTOA 3AH7A 4PK1A 1K83H 1X32A 1J7CA 3ZRFA 2CH4A 1TWGB 4FVMA 1D1KA 2IL8A 4J8QA 1F0ZA 1M90C 4W9GA 4W9HA 3S1RB 4KK7A 5IT9L 3PV0A 4A3JB 1T0RC 5IP7G 1SNDA 2PVGC 3A7LA 3M7GA 1V5OA 1SE4A 5IGEA 1YJJA 4KZ0A 1V1PA 2HD3A 1C1YB 2K22A 4PZ7A 3I3TB 3UQBA 1GKHA 4OWWB 3F2UA 1EYCA 1L2FA 3AMZA 4IN3A 4POGA 3UI3A 1PTOH 1R4NB 1HFNA 4MNOA 2KVRA 2LUEA 2WDRB 1MFWA 3AE9B 1R9TB 2D3BA 4R8NA 3SK5A 1K8AC 4MELA 2KBNA 4GDLA 4QMGA 4RKBA 2Q2HA 2JUOA 3ZIMA 4IURA 2JU6X 1I42A 1K9MC 3M62B 1ZKHA 4DUZL 3FP9A 4WFN3 1NYRA 2HE7A 3AI5A 2R61A 3A33B 4OHJA 1E8XA 2ZEQA 1C7YA 1HQRD 1EY6A 3TIXA 4A55A 1L0WA 1F9SA 2BGFA 4W9JA 4ARCA 4YSZB 2F0FA 1DGJA 2VS1A 1OTRB 1OGWA 3H0GH 1LFDA 3GTLB 5M3FH 3NQTA 2WGSA 1V1QA 2EOTA 3HOXH 3NY5A 2KAJA 3BIID 4EQNA 2K28A 1B3AA 4JI4Q 1C48A 3OAWA 1Y69U 3DDCB 1E10A 2A5HA 4APVA 1KOTA 4MH0E 1AP0A 1DGSA 1NR2A 2O6VA 4GNXC 1QILA 1S5BD 1FL0A 2W9NA 4K7WA 3M3YH 3V62A 2M19A 3BDCA 2BE5D 2SNMA 2WYQA 4WWMA 2Q8IB 4GSWA 1PH1A 2ES2A 4EQPA 3KUDB 1VQGA 4C1NI 3A4SC 4EFOA 2KUMA 3MFGA 2ZJQA 4IDIA 4L1BA 1STBA 1YHQA 3ZNZB 1ZKOA 1HR0Q 4OX9Q 4DHZE 1WR6E 2BKFA 1V8CA 2BYFA 3VR5A 3PO2G 3FC4A 3AXCA 3MEHA 1JOQA 2DY8A 2K8BA 5JHAA 1KLUD 3PHWB 1CHPD 4IM2A 4ALPA 4HIDA 1C79A 2RD0A 4W9DA 3OIQA 1FJGL 2A69D 4FF1A 4DN4M 2WQYB 1N33Q 1WF9A 1YJ9A 2K25A 1JWMD 1TXYA 2JA7H 3I4NH 3DOWA 1SF0A 3HHMA 3T56B 3AE4B 2FMCA 4YHHQ 1IBLQ 2K4KA 1SFOB 1A70A 4LF4L 1MHXA 4HAEA 4GB9A 4QAYA 1K50A 3WAOA 1CK1A 4JPBW 2WS3B 3KYCD 4A3KG 5JH5C 2L0CA 2OJWA 3V61A 3EIVA 2V4IB 3FKYA 4IFDJ 1F1HA 4BY1H 5I6WA 2CFMA 5HG2A 4KD3A 1E5WA 1UWXA 2BS4B 2K3UA 3B6YA 3D4WA 3S2DB 4OVVA 1J8IA 4A8XC 3HRZC 1PH5A 2LKVA 1WRDB 2C7HA 1LUZA 1Y8PB 4WRDA 3I3CA 1N36L 2AX5A 3GTJH 3ML9A 1F9JA 2RA4A 3PO0A 5IIFA 2WXKA 3NXWA 4LUZA 4A3LG 3A54A 2IZVB 2F52A 1FFUA 5EE1A 3BDOA 2NVXH 2Y5PA 1XF5L 2AQ1B 4YWLA 1SXTA 3D4RA 1L4DB 1XNQQ 1IP9A 3I8ZA 2MRPA 4DQOC 3WANA 5C4HA 4HEDA 1MG4A 5CHFA 3RMHA 2UU9L 3FPUB 1XMOQ 5I2XA 1U4RA 3T51B 4A3FG 1XPRA 2K33A 3DHHC 3KW5B 4A3DB 1Q7YC 2BYVE 2QCPX 2BYTA 1GPXA 1IBML 3KWVA 1GXDC 3TP5A 4HJGE 1N32L 1CKNB 4MGKE 1SYCA 2ICIA 1BCPD 1SNQA 2Z4IA 4M8MA 2KACA 4HRSA 3H3VC 5EPJA 3QJZA 1J7AA 4GDKB 4OL7A 3MFYA 3PO3G 1HZ6A 2KJ6A 3JSVA 5IP7H 3MTNB 4US9A 1YOVB 4ANXA 4DXGA 3BINA 2W3SA 3DUZA 5EKIA 4W9FA 4A3GB 2LVQA 4ZK9B 2ZNVC 1W6KA 4K5XA 2JRHA 1I4XA 3DBHB 2M8SA 4G3XB 4GN5A 4YSXB 5AJ3L 3QHTA 2A68C 3RD4A 3TJPA 4AJYB 3J7AF 2NZ1D 3MZ5A 3RZDB 4C56C 2KDEB 3B08A 4JCVE 1YIJA 4IWOA 5JJKA 4RG1A 5L95C 1SNCA 2EY1A 2K5QA 2PE9A 1Q5WB 2IW3A 2EMSA 5H92C 1NENB 4ASWC 5IA7A 3DVNV 4RA8A 3W1SC 2LSSA 4KKJA 1TQOA 2NVYB 4AIMA 4DR6L 2WAQE 1Q10A 1F2RC 4X64Q 2MA9B 2X8XX 4JI1L 4KHZA 1MD2D 1EQVA 2E2HB 4C1NK 3WOEA 3J81c 4RMFA 3MTSA 2C5LC 3S1MH 2N1VA 5J1ZA 4HSPA 4GLVB 3T9LA 1H9RA 2HDMA 2X6LA 5EE3A 1TVXA 1L2NA 4X3SA 4C3HG 5DPSA 2WXMA 1JOOA 2GBRA 2RVLA 3J7ZC 3MXUA 3S16B 3TMEA 4A75A 2HJ1A 5ELDA 1NI2A 1WXMA 1E22A 2JK8A 1ZDVA 3NP8A 1X54A 4LNIA 3Q8AA 3J81i 3G6JB 3RN5A 3P20A 3V2TA 5IE8A 4KN4C 1UE1A 1ZYRC 1XNRQ 5CMDA 3HOWG 1SR3A 2MO1A 2UXBL 2TSSA 3BDLA 3ITPA 1B50A 2N1WA 3X0WA 3CPFA 5GAHC 3RD2A 1VDZA 5EKKA 4IPDA 1WR1A 2LGDA 4DHJD 1J8CA 2K1FA 5EPLA 1YQ3B 4EUTA 2Z9HA 3IT6B 2SNSA 3Q8CA 3GTQB 5FJ8G 1SROA 2F3WA 3BVGA 3N9YC 2K5HA 3IKJA 2MJ3A 2C35B 2M1MA 5JHBA 1EIFA 3VA7A 2EIFA 1NYQA 2CCZA 1P8LA 1GJXA 3RNUA 2LI5A 2L9HA 1IBXA 1PRTB 2KDFB 2JYOA 1NDDA 4IC7B 1Y1VB 1QOGA 4LF8L 3N3KB 2I46A 3EFXD 1TWFB 3BYYB 1MJDA 1EY0A 1K51A 4FXGC 1ESRA 3W2DA 2W82A 4G0NB 3B9JA 1WRIA 2VB3X 2MJDA 3PSIA 4PNYA 3R3MA 2B39A 4C4VB 1Z9FA 2O2VA 2K39A 2ZPNA 3DBLI 1ACCA 3CCVA 2ZM6L 3L4PA 3GQBA 2RHSB 3TSSA 1ONLA 4W9IA 3SK4A 1BOSA 4R4CA 1WM2A 4O1NA 4RMAA 2K8HA 3HOUB 5CC4A 1T0SC 3GP7A 1PFBA 1GAQB 2B2WA 3BVZA 3IFWB 2RGFA 2UUBQ 1O7YA 1V2YA 4BFRA 1LTID 5IYBG 2NN6I 4FNFA 1PH9A 1XEEA 1WD0A 4KIKB 4LF5Q 5IAAC 3IRBA 1C4CA 1Y1WH 2F0KA 4R4QA 4FA6A 2XSCA 5IODA 3PF4A 2F0OA 2F0GA 3UINB 4A3LH 1YNJD 1LTGD 2F0IA 5BN3A 5LMNL 3STBC 3EFUA 2FFKB 3Q3NC 4K7SA 3J80E 1E24A 2L15A 1KJTA 3TUOA 4AJWA 4BVUC 2NYZD 1ZDXA 3DM3A 2ASQA 2WHIA 4X6AH 1WSPA 2BKRB 2L1AA 5GADC 5A2QL 1BUIC 5IOIA 4ZRJA 3NBHB 1WTOA 2G5DA 1YNTE 3CC4A 3PLUA 1FM0D 5TR5A 1YNNC 2Z0EB 4A3FH 3W1GA 2WXNA 3JAML 2JA8G 3NVZA 4PMBA 4ZKBB 4F7XA 1KLGD 4N8X1 2PEAA 3TZUA 4CHTB 3QIJA 1DXMA 4X66L 4B9KA 3M7NA 1Q1EA 1Z7TA 4WWNA 2KMMA 4ZRKA 3IFDA 2GB1A 1KQSA 3P4PB 4IUNA 2J0JA 5I9OA 2B63B 3V05A 1IYVA 4JQWC 4KKIA 3QJYA 3C8YA 1K8GA 1YEZA 3R2TA 3RLFA 2JA5H 2Y0SE 2B2YA 2KHJA 3FKIG 1V86A 3CC7A 2BWES 2GMIC 4BAXA 3ZGZA 1YVCA 4A3BB 1YX5B 2K32A 3QX1A 3NHHA 5GQOA 1J5EL 4A3IB 5CR3A 4L23A 1HUMA 1WCMH 5DCNA 5D65A 1KAWA 3E0JA 3KYDD 1E7UA 2K50A 3A7AB 2KXJA 3DEOA 4JE3B 1MPEA 5C0XJ 1BMLC 3HOZH 4QL5A 1CKOA 2IWHA 4A3EB 1B53A 2B2TC 1S1QB 2JJQA 5DEHA 3KH0A 1ASZA 1JQ4A 4QCLA 2JRIB 3RT3B 4JYAQ 3I57A 1SE8A 2PQAA
chains in the Genus database with same CATH topology
3G7LA 2RDFA 5E1FA 1NR4A 1FRRA 3LWEA 4K2KA 3PIO3 3RFZB 3B2FA 2BTEA 4BBRB 4A9AA 2Q8TA 4QUFA 1KDAA 2KN4A 4D2KA 1D4BA 2Q5WD 2F0VA 3P7JA 2RSNA 5DM73 2HDEA 2A6EC 1RODA 1PFDA 1SYDA 1GHKA 1VZ6A 1OXUA 4REZA 4NAMA 2JZPA 2JYEA 2JEAI 4L6TB 1R4PB 1QE6A 1EWCA 1YJIA 1RHPA 2O2LD 5BYSA 2HCIA 3TEWA 2DN8A 1V1OA 5NUCA 1QB5D 3NTIA 1YN3A 2VUMB 1VJKA 3WDNA 5T1IA 2EY5A 3P4QB 3R8BA 1RYJA 1VDVA 1JB3A 3OIPA 2O4XA 1E7PB 1JQYD 1TZOA 2PLPA 4FF4A 3NVYA 1OXTA 2XNAC 4DU9A 4OGQC 4Q5VA 3OWFA 3DWPA 1MSGA 2E74C 5JPMC 1CHQD 1KNAA 4XXEA 2K5WA 2K9XA 3AE2B 3RZOB 3LYYA 4CKEA 3TZDA 4CJ0B 5DAUA 1HHVA 1A3VA 1PTOD 1WTQA 4MM3B 3MHBA 2D9UA 4XQJA 3W3AA 5FO8B 5HURA 3VR9B 1TYGB 1RF2D 2AWOA 5FO9B 4FP5D 3VR3A 1JORA 2H4OA 4N9PA 4KKSA 5FK9C 2B2VC 4ZUIA 4DXFA 3HUIA 2EE1A 2AWNA 4MHEA 5FO7B 3MVVA 1G2TA 2EY2A 2BOSA 1IW7C 4KGSA 2WB1B 1CT1D 5HHDG 3PUVA 3M4OB 4X3KA 5KIXA 4YIJA 2R7ZB 1MSHA 4G57A 1XO3A 4EQOA 2SAKA 4YSYB 1BDOA 1JOKA 4KHVA 4C2MB 3HVZA 1Q90A 5ELBA 1ET6A 3MXPA 3NWTA 1E0ZA 2F0LA 2BW2A 3K7AB 5C3WA 2WXJA 1CQFA 3BWUD 4BY7B 1DM0B 5EQ0A 5JEAH 2INPE 1Z6HA 4RGNA 4GLSC 1D6EC 4R9WA 4XT1B 1I6HB 3C1EA 2EY6A 2D5DA 3ND8A 2IX1A 3ZJVA 2IGHA 2I38A 2B76B 3WOFA 3DXJC 1ZUD2 4ZRQA 1V1PB 1B9MA 4NZLB 3MXGA 1E2VA 4QIWB 4J1MA 3DWAA 3KBGA 1GB4A 1OO9B 3DWMA 3TDQA 4GDLB 1CM9A 3QO2A 5COYA 2PNRC 1LTRD 5IGDA 4YTMB 3A8IE 1T3QA 1TIID 1CZPA 1FXIA 3K5MA 2ICEC 2CW0C 3N6RA 1M8AA 4IFDG 2PW7A 3GTGB 1R7SA 4ZOHC 2XWBB 3LX0A 5C4ZA 4ILWA 4RHRA 4C3IB 2L55A 1S5ED 1QOBA 3AV8A 5CORA 3AE8B 2BB5A 4ZUJA 4MT5A 1E0BA 2Y3AA 1JICA 4FF3A 2F4IA 4YT0B 3DEPA 3H09A 5G5HA 4OZAA 1EWYC 2CJOA 4KJOA 3UI2A 1DCZA 4OIKA 1PRTC 4AQ7A 1C9FA 4KKUA 4LK0M 3W1SA 4MIUA 2LUMA 3CU7A 4HMJA 1E2ZA 4XDCA 5E4XA 1PRTF 5T8IA 5JXVA 1F2MA 2K6AA 2EYMA 2K05A 1EU4A 3BYTB 1FD7D 4IQZA 1RFKA 2M0AA 1XLQA 2F0PA 5G3LD 5KEEA 1BCPB 4AYBB 4IUUA 2L5TA 3LB8C 3I90A 3M85A 2PZWA 3BS1A 3C46A 5ELFA 2SOBA 3K0YA 4TQ1A 2BB6A 5LL6S 2W55A 2JA6B 2C9OA 5M3MB 4DF7A 4L2YA 4A90A 1SJED 3DWGC 2J4XA 4KY5A 1F2RI 2J0TD 2WXOA 3J7AV 3OHXC 3A56A 1FNVA 4DK0A 4TKOB 1BNZA 5KNDA 1SMYC 1ROEA 2K0PA 5CV9A 1XLOA 5I6YA 1IYUA 2WP8J 3RPFC 2WDVB 2BS3B 5IGBA 1WTXA 3TEZA 1O7ZA 4H13C 2B8FA 1D5MC 2KCCA 1SAPA 3ERQA 1HQMC 2MPMA 2DYOA 1DJRD 5K36H 2L4NA 2WU5B 1HZ5A 2K5PA 4OW0A 3S14B 1ZPSA 1BBXC 1KTKA 2RBMA 3PUZA 4U68A 1CZGA 3BK2A 1WWTA 5EJWA 2QMTA 2NVTB 1A3TA 2XWJB 4FXCA 2WXPA 3AB5A 1SJHD 2LJIA 1HCZA 1O80A 4H2AA 4FO2A 4IFDH 3OSOA 3ABVB 1TS4A 3NTHA 5C0XI 3ZJTA 4IUQA 2Z8LA 4ZRPA 4MACA 1B44D 3SK8A 1C4QA 1SYGA 2K7VA 2LFIA 1C4AA 2HDLA 1TWHB 3H91A 2LY7A 3IL8A 3TN2A 2NB0A 1NI3A 2NVQB 3I4MB 1IGDA 1QQRA 4R8IA 5C3EB 2E2DC 5D3DA 3TEYA 1QJOA 4RAUC 3HP3A 5J39A 2LGIA 1Q3LA 4RGOS 2D5GA 5FOBB 3H94A 2B2TA 1IBXB 2INNE 1PLFA 3GD7A 1SBBB 1G91A 1GHJA 4J3OD 4F87A 2KA7A 3O13A 1GUTA 1EOTA 3NE5B 3CQZB 5C4JB 2PMVA 3MP9A 5ELCA 4ZRZA 5D14A 3NUCA 1FIQA 1FNWA 1I4PA 5C0XG 2MEKA 1C8CA 2J53A 1JC7A 2N9LA 4E6IA 2BA1A 4DNTB 3GTKB 2WXIA 4C7ZA 5HGTA 5BYRA 1STAA 3SEBA 1JWAD 1LTSD 2JXMB 2MUYA 4HCSA 3U52E 3NQIA 3QOJA 1SNPA 2KVMA 2QDBA 3VR6A 5AFWA 4DAPA 5G3LF 2BT6A 3KLRA 3GS2A 2JXTA 1F2YA 5ISRA 4DGZA 1HUNA 3S1QB 4WJWA 1GOZA 2O5IC 2C5CA 2DBYA 5M5XB 4C80A 3PUYA 1L5PA 1XTCD 1DOLA 3DWQA 1A6XA 4Z9CB 2G1EA 2EKIA 2EYOA 1U4PA 4XDDA 2N55A 2J52A 2R3ZA 4NKLA 5J22A 1LO5D 1N62A 3T3OA 4HMIA 1F77A 2N7JA 1G8ZD 2ON8A 1EY9A 1H9SA 3VR4A 3Q8EA 3FPPA 3CRLC 3D4DA 1I50B 3U4EG 1U4LA 3DHQA 1AW7A 2X6GA 2HTME 1D1IA 3I9V1 4MH8A 2H89B 4OIJA 3D3RA 3EROA 1UEAB 4TSSA 4CKBA 1UWMA 5AUKA 2J42A 5CV4A 2EYFA 3J7YW 1FMAD 3IAM1 4M8AA 1U9RA 1K83B 1EEFD 1B2TA 1PUTA 4ULLA 1N61A 2LEKA 2RKSA 3I70A 2ZXRA 3QIAA 1H9JA 2BE5C 1OQQA 3QOLA 1QOFA 1F2ZA 3U7ZA 5G5GA 2EELA 4XYQA 3FILA 3C1FA 4QF4A 1ENCA 1XCTL 1PTOB 4H0LC 2PO4A 2GRIA 2KQ3A 2A69C 1IKMA 5D7GA 1TKWB 3TEXA 2CVRA 4I7ZC 3AU7A 3NPPA 4KGRA 1BUVT 5KNCA 2EYPA 5EBDA 4NJCA 3J80L 1PXUA 4K8JA 5C2TB 3HEJA 5JVH3 1ICWA 2B2UC 3KLSX 2WXFA 2FE8A 3BZDB 1TS3A 3H0GB 3Q23A 1EWHA 2NTTA 5M3FB 3HOXB 3AECB 4WORA 2DLBA 4YTNB 2PTLA 5C0XH 1KDBA 1S5FD 2MP1A 2IGDA 3MWYW 3M3YB 5GXGB 2RSOA 5FR3A 2PKOA 4J6HA 1Q1BA 1PYWD 1QF6A 3IT4B 1XXGA 2QILA 4R3DA 1C76A 3DMUA 4WAFA 3R2IA 3AE5B 2F1MA 5LHY1 5EPKA 1DOXA 4K8IA 4BA2I 1U4MA 2JA7B 3I4NB 4US8A 4K6LA 1PZID 1JROA 3AE3B 2R6GA 4UAIA 2A74C 3VRBB 1B9RA 1BCPF 2LHDA 4ZHOA 4LLGM 4BY1B 3P4SB 1JW9D 2V4DA 1EM7A 2F0SA 3OOCA 3GTJB 3W9CB 1V43A 3MXNA 1C4PA 1VF7A 2K04A 1TR5A 1FYCA 4HKQA 1VZ7A 2NVXB 3AE6B 2N88A 3PUWA 1WTRA 1VR9A 1KAAA 2F0QA 4X3UA 1OXVA 1CA6A 4GZYC 3SDZA 3U9OA 1R4QB 3ZYYX 1QOHA 3X3NA 4RHSA 5I9PA 1SE3A 3CRKC 5E6JA 1Y8NB 1EEID 3TP6A 1FFVA 2O5JC 2DNEA 3K5LA 1Y8OB 3W5UB 3WCQA 3A55A 3I91A 2XVSA 2SEBD 4IKGA 2QF7A 4EE2A 3ONAB 2Q8RE 4EVOA 3EQLC 1XX8A 4S3SA 1DOKA 1H9MA 4H7BA 2V3PA 4XYOA 2AQ3B 1BO0A 5CGKA 1I4RA 4HEA1 1KH0A 1TKYA 2KOLA 2E76C 2N0SB 4DNRB 3K5NA 1QG7A 3M4YA 1F9RA 1ESFA 3IAYA 3S1MB 2EJMA 1L0YB 4N6EB 3P1HA 1F9PA 2JSOA 2DYMA 2L32A 1FCCC 1ZXTA 1CA5A 1NUCA 4CBVA 1EQTA 4ITKA 3KLSA 5ELEA 2K1BA 2Z1CA 1A15A 1T5EA 4RGMA 4OO1G 2CU3A 1CQVA 1YNJC 2IT1A 1N63A 1PGAA 3AEGB 4FXDA 1FD6A 1XCQL 3URYA 4JX1C 4KY7A 5T1GA 3MJ5A 4DAYA 1STGA 1OQRA 3GB1A 1DYQA 1K52A 2RPVA 1LT6D 1ENFA 4KKTA 4RGTA 1IUEA 2NWGA 4IFDI 4F88A 3T53B 3KUPA 4G7OC 1KFYB 2MHVA 3CIRB 4ZAIA 2ZT9C 3J9CA 5H8YE 2EZVA 5HI1A 2KEDA 1LT3D 2KJXA 2I2YA 1UAPA 2HQEA 4U673 5IGGA 1FRDA 1FEHA 1L6UA 1XLNA 2DY7A 5FLXE 2F0JA 3HVDA 3Q0AA 4ZYSA 4V190 1J7BA 1GUGA 1IHZA 2CQAA 5EKLA 4UDUC 3SFEB 1C78A 1Y1WB 1SYFA 3VYTA 1EIGA 3SVMA 2WP9B 4B9WA 4EGVA 1RCVD 2GA4B 4ZHPA 1EZ8A 3QWNA 1V8QA 4TMAB 1QNUA 3OWEB 1LT4D 4P6VF 3EUB2 2NBFA 4NW2A 1NEKB 1PFMA 1E6EB 1K53A 1IKLA 1ZOYB 1ILPA 4USAA 2F0UA 1EY8A 2NTSA 4NAWB 2YEPB 5EE0A 5BN5A 2QKIC 3T13A 4IUPA 4A3FB 2AUKA 4CKCA 4OZCA 1I6VC 1DD2A 2WKCA 2ZXOA 4K6DA 1S5DD 2DNCA 4M0WA 1BR9A 3V96A 5IGCA 1I4HA 2QSDA 1S4ZA 5E3FA 1AEXA 2PW9A 4JWSC 5JEAJ 3P75A 4V0BA 1LT5D 2V0GA 4BWGB 5C6AA 2JA5B 2VNUD 1RWSA 4N9TA 1STNA 2OHFA 1X3PA 3KBXA 3AEDB 4G7HC 3GO5A 1HEZE 1YQ4B 5K5PA 5CV6A 1N60A 2E75C 1EZ6A 2EXZA 3HGBA 3HZXA 1WCMB 2IDYA 3NTKA 5KYIA 1HA6A 2EPBA 3NSWA 4HCEA 5C5MA 1SNMA 4B0MA 3HOZB 1QKZA 1FXAA 1SIJA 4WH4A 2ENBA 1TU2B 2JSVX 5EBCA 1Z47A 2XN9C 4KY6A 1MI2A 3SFDB 3FMCA 1KNEA 3K5OA 2LMCA 1JR0D 3Q8FA 4HN7A 3EA6A 4DAVA 1GUNA 2EYJA 2OEOA 1PDXA 1BXTA 4HSVA 5M5WB 4IALA 2YYZA 1BQQT 3IXSA 5CYUA 3GTMB 1PTOF 4OZBA 1EYDA 4DFAA 1CTMA 2FJ2A 2A68D 1KF6B 2BDOA 1Q8IA 3VR8B 2WAQB 1QT9A 5EE9A 4B0EA 2PYKA 1HXYD 1ENAA 2BDNA 4C7YA 1M4VA 1GB1A 5IT9E 2L12A 1QWYA 2PIAA 1DOYA 3ZJUA 2EDGA 1QCBD 3C3LA 4RKLA 1AZPA 1SSOA 3QG1A 3S15B 1N5XA 1T6BX 3PZ8A 2ACZB 3K58A 2PW5A 4OVZA 1L6VA 2FHTA 3KK7A 4ME5A 2YU9B 4B9XA 1TJEA 1WXQA 4PQXA 1TWCB 3TP7A 1XLPA 4KTAA 4N58A 5CV7A 2WLBA 1ZYRD 2KHSA 2VZKD 1LABA 2JYTA 4LMQD 2JA8B 1SYEA 1NSNS 4G4KA 1CJEA 4L8JA 4CQNA 5I2YA 2B2UA 2WXGA 1GUOA 1Q12A 2BA0A 3X3MA 1LLRD 2RDGA 5I4DA 2EJFC 1VF5C 1G6ZA 2A6HC 1JWBD 1XWEA 3SHLA 2WV6D 4KGTA 3FKIB 2F0DA 2RQXA 1FR3A 1H9SB 5IGFA 1D5XC 2VB2X 2BCOA 4TRDA 3AE7B 4LJZC 1PDQA 1AN8A 1RTNA 4ZLTF 1GUSA 3NUHB 4NMZA 3TBIB 1UNSA 3AM9A 1STHA 1EFID 1ZXIA 4ODGA 5FKAC 2B8GA 5M5YB 1E2WA 4HTHA 1EIHA 1VZ8A 2KWDA 4QUCA 3J81E 1ZP0B 2ZW0A 3J81L 5JAVA 1UUPA 3NVVA 3ND9A 3SE0A 3ZQ4A 1MHHE 5JOBA 1ET9A 3Q69A 1YNND 3CWIA 2EJGC 2MJEA 1L4ZB 4IZ8A 2N9KA 3ETRA 2Y0SB 3K6OA 4XQNA 3VR2A 3FILB 1I4GA 4KMUC 4YXDB 5JVG3 2AUJD 5C4XB 5IOCA 2ZW1A 3B2GA 3VQIA 1N5WA 4K14A 1HPCA 4LAAA 2CJNA 5D3IB 4A6QA 3NS1A 3HOVB 4O42A 2FMMA 4ZKCB 4Q2JA 5CV8A 2TMPA 4IUTA 3R3OA 3I4LA 4MN3A 1WTWA 3K59A 2PPBC 4JPSA 1VMPA 1PMRA 1LV9A 3V3XA 2EVBA 3S9WA 3OMCA 2G9DA 2D2CC 4C3IG 4PMWA 1LTBD 3Q22A 4HR7B 2Y5CA 1I3QB 1F9QA 3Q8BA 3H6MA 3E56A 4TQUS 3D31A 2F03A 5KNBA 4DK1A 2F3VA 2JX5A 3SK6A 3C2PA 1BF4A 2A6ED 3GTOB 4Q0FA 2I07B 5TSSA 2A73B 1FGBD 5M9OA 2ZXPA 3SR6A 1WGKA 2KCNA 1YMHE 2F0TA 1IGCA 2M00A 3KF8A 3NBIA 4Y7NB 2W54A 3FVQA 1EL0A 1Y56A 2R92B 1TS5A 3GV3A 4P16A 2OT2A 1MBYA 4I65A 1S5CD 3GV6A 1C77A 3A8KE 3EJIA 1UGJA 2B2VA 3I72A 3VYUA 1FNUA 3HOYB 1EYAA 1RKNA 4X3TA 1I4QA 1QLBB 3D8GA 2WU2B 2L1BA 1YN4A 2PZUA 3MC0B 1WTVA 1CZWA 1A3UA 2L11A 2J7ZA 2XRSD 3SXHA 1HTPA 2PMZB 2M56B 3P63A 2NMQA 2F0WA 5MPOA 4FF2A 1GUWA 2YEPF 4DA2A 5LL6X 3OMGA 4A3MB 1MGSA 1L0VB 1F2LA 4C3JB 1SEBD 2KECA 2HUGA 3MA2B 2WINB 3NWSA 5JJZA 3HKZB 3P42A 3Q24A 2FINB 3OPOA 1G2SA 5DM63 1WTPA 3L3OC 2IGGA 5HFYA 4KJNA 4CJ1B 3EGRA 5F2DA 2SDFA 2DWQA 4M1UB 3PMFA 4NDXA 3HRDD 4PMCA 1TS2A 2MJ8A 1E9MA 1DOIA 2WACA 1LTAD 5C5LA 5C44B 1IW7D 4N59A 5A2QE 1W6JA 1D2BA 3FEWX 5LNK1 4PV1C 4HKZE 4KD4A 3T16A 5KYLA 1D5ZC 3JAME 2VXWA 2GI9A 2WXRA 3MAQA 2R93B 4YTPB 1II3A 2FUG1 2JP1A 2AQ2B 2MGSA 5C3JB 3P1MA 1H9KA 1CFMA 2OF1A 3VA5A 1BCPC 3NVWA 3LXFA 1FCLA 1VRAB 4XWTA 1WD1A 2K5DA 3D6CA 1JALA 2XIWA 5A35A 4RNAA 3L7ZC 1VMCA 4KX6B 2HCCA 2WDQB 1EY7A 4BS9A 4WURA 3LWUA 2KDMA 1AFPA 5CBEE 4RCNA 3EVQA 2NN6G 2WXQA 4G7ZC 5JPNC 4KN7C 1RJTA 1SSNA 4B08A 1KABA 5JEAG 2WNMA 4F8MA 3NZ3A 4P2CB 2L83A 1WVLA 2CW0D 2WKDA 1TY0A 2F0NA 3FAHA 2CHBD 2X38A 4OO1I 4RFBA 4ARIA 5CV5A 3D6WA 4NP5A 3S2HB 3AEEB 1CI3M 1EY4A 2QIEB 3AN1A 3BVMA 3QB3A 3LNNA 1LTTD 4QB4A 2WXLA 1B4OA 3DM1A 3L9AX 3GTPB 1O78A 2FBWB 2IPKD 5CBAE 3AMUA 4H44C 3VRAB 1XYIA 1A2UA 1RD9D 1QNKA 1TY2A 1ILQA 1TKGA 2JEBI 3NBHA 1PRTD 2H1EA 3IFTA 4WIPA 3E5SA 2E2IB 3AEAB 2IX0A 4FYDA 3U2SC 3MHZA 3I73A 2QJLA 1LACA 2Z4HA 1P7FA 4IOIE 4TQ0A 2QEJC 1HA5A 4RCOA 2JE6I 2OXPA 3U9SA 1MVKA 4XQQA 4ABNA 1JMLA 2IX3A 1JWUD 2MH7A 4PT5A 2JQRB 3E9SA 2KQ4X 2E6XA 5DNFA 1HFGA 4CGYB 1HRJA 3N52A 4XTCS 2PZTA 1TKEA 2EYLA 5BYQA 4RF0A 1J9OA 4K5WA 4KV6A 3PO2B 4LTUA 3SR1A 1AZQA 1VLBA 4K2LA 2LMCB 1L0XB 4RWSC 1ZE3D 1TT2A 1SMYD 2LFNA 1QOAA 2D62A 4JBWA 4A93B 5C3XA 4A3KB 1P7EA 1MI0A 4XDXA 4XE0A 2ONQA 1JWSD 1SDFA 2B2WC 4ZQ3A 1PGXA 3NK9A 1SB3C 1DONA 1G291 5BMIA 4JK1C 1SE2A 1VCIA 2IJ0A 5FLXL 3W5VB 1JE4A 2PCFB 1B1ZA 2PQEA 1DOMA 2G9HD 2NN6H 4WQMA 4AS1A 2VZKB 2WIIB 4CJ2C 4ID6A 4BBSB 3NRZA 4C3JG 3TP8A 1V97A 1O7LA 3AEFB 3PUXA 2BBCA 2XRQD 1YN5A 3FDTA 3KQ4A 3T4AC 2V3NA 1K8MA 5K36G 3KWLA 4RF1A 1SNOA 1KDCA 1T5XD 1NCVA 1OXSC 1ML0D 4L63B 2A6HD 1PZKD 1AWDA 1PGBA 1NAPA 2B2YC 3CHBD 3PO3B 5AUIA 1OXXK 1JCKB 3E6ZX 1OFFA 2NUCA 2F0EA 1X3QA 2M2LA 1A2TA 2X69A 3RUZA 1K8OA 3R93A 3AE1B 4XWWA 1PZJD 2KEEA 3BG3A 3HG9A 3IAS1 2OEDA 1PFNA 4IUVA 1WYGA 2W3RA 3AB9A 4KI0A 3Q6SA 1SYBA 3PIP3 3CKIB 2F0MA 1EU3A 3S17B 2RMMA 1RM6C 2PVOD 3AEBB 1DZ1A 1STEA 1ZEQX 4LK1C 3PZ7A 4XIGS 2BS2B 3S1NB 3BK1A 1STYA 1ZXHA 2M9VA 4C3HB 2H88B 1NVID 2RDHA 2LHEA 4JWUC 4YWGG 5KGUA 4K5VA 1EY5A 2K03A 5BMHA 1TWAB 4FXKC 2ID0A 1KRHA 4OO1H 2EYHA 3A8JE 1IL8A 3HOWB 1PTOC 3OW7A 3FRPB 2L52A 1HTLD 3VYRA 1JRPA 5E4WC 5EGTA 4HROA 2LS01 2WXHA 2JWUA 1I7HA 4BA1I 5BN4A 1RDPD 2E2JB 1B9NA 3H8HA 2F0HA 1AYFA 4RH6A 4XT3B 3P4RB 3T3NA 5KRUA 3HS0C 2K01A 3VYSA 5BMGA 3K57A 1FO4A 1RTOA 3AH7A 1X32A 1J7CA 1TWGB 4FVMA 1D1KA 2IL8A 4J8QA 1F0ZA 3S1RB 4KK7A 5IT9L 3PV0A 4A3JB 1SNDA 2PVGC 3A7LA 3M7GA 1SE4A 5IGEA 1YJJA 1V1PA 2K22A 3F2UA 1EYCA 3AMZA 4IN3A 3UI3A 1PTOH 1HFNA 2WDRB 3AE9B 1R9TB 4R8NA 3SK5A 4QMGA 4RKBA 4IURA 2JU6X 4WFN3 1NYRA 2R61A 4OHJA 1HQRD 1EY6A 4A55A 1F9SA 4ARCA 4YSZB 2F0FA 1DGJA 3GTLB 3NQTA 2EOTA 2KAJA 3BIID 4EQNA 2K28A 1B3AA 1C48A 1Y69U 1E10A 2A5HA 1AP0A 1NR2A 1QILA 1S5BD 2M19A 3BDCA 2BE5D 2SNMA 4WWMA 2Q8IB 4EQPA 4C1NI 2KUMA 3MFGA 4IDIA 4L1BA 1STBA 1ZKOA 1V8CA 3VR5A 3FC4A 3MEHA 1JOQA 2DY8A 1KLUD 1CHPD 1C79A 3OIQA 2A69D 4FF1A 4DN4M 2WQYB 1JWMD 1SF0A 3T56B 3AE4B 2FMCA 1SFOB 1A70A 1MHXA 4HAEA 1K50A 1CK1A 2WS3B 2L0CA 2V4IB 4IFDJ 5I6WA 5HG2A 4KD3A 1UWXA 2BS4B 2K3UA 3D4WA 3S2DB 4A8XC 1J8IA 3HRZC 2LKVA 2E3TA 1Y8PB 4WRDA 3I3CA 2AX5A 2RA4A 3PO0A 5IIFA 2WXKA 3NXWA 3A54A 1FFUA 5EE1A 3BDOA 2Y5PA 1XF5L 2AQ1B 1SXTA 3D4RA 1L4DB 3I8ZA 4DQOC 5C4HA 4HEDA 3RMHA 3FPUB 5I2XA 1U4RA 3T51B 2K33A 4A3DB 2QCPX 2BYTA 1GPXA 3KWVA 1GXDC 3TP5A 4HJGE 1SYCA 2ICIA 1BCPD 1SNQA 2Z4IA 2KACA 4HRSA 3H3VC 5EPJA 4GDKB 1J7AA 4OL7A 3MFYA 1HZ6A 4US9A 4DXGA 2W3SA 3DUZA 5EKIA 4A3GB 4ZK9B 1W6KA 4K5XA 1I4XA 4YSXB 2A68C 3RD4A 3J7AF 2NZ1D 3MZ5A 3RZDB 4C56C 1SNCA 2EY1A 2K5QA 2IW3A 5H92C 1NENB 4RA8A 4KKJA 1TQOA 2NVYB 1Q10A 1F2RC 4KHZA 1MD2D 1EQVA 2E2HB 4C1NK 3WOEA 3MTSA 5J1ZA 4HSPA 1H9RA 2HDMA 2X6LA 5EE3A 1TVXA 4X3SA 4C3HG 2WXMA 1JOOA 2RVLA 3MXUA 3S16B 3TMEA 5ELDA 1ZDVA 3NP8A 3Q8AA 3G6JB 3P20A 3V2TA 4KN4C 1ZYRC 5CMDA 2TSSA 3BDLA 3ITPA 1B50A 1VDZA 5EKKA 5EPLA 1YQ3B 3IT6B 2SNSA 3Q8CA 3GTQB 3BVGA 2F3WA 3N9YC 2MJ3A 3IKJA 3VA7A 1NYQA 1GJXA 2L9HA 1IBXA 1PRTB 2JYOA 1Y1VB 1QOGA 2I46A 3EFXD 1TWFB 3BYYB 1EY0A 1K51A 4FXGC 3W2DA 1ESRA 2W82A 3B9JA 1WRIA 2VB3X 2MJDA 4PNYA 2B39A 1ACCA 3L4PA 3GQBA 3TSSA 1ONLA 3SK4A 1BOSA 4O1NA 3HOUB 5CC4A 3GP7A 1PFBA 1GAQB 2B2WA 3BVZA 1O7YA 1LTID 2NN6I 4FNFA 1XEEA 1WD0A 1C4CA 2F0KA 2XSCA 5IODA 2F0OA 2F0GA 1YNJD