1KOTA

Solution structure of human gaba receptor associated protein gabarap
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GABARAP
publication title Solution structure of human GABA(A) receptor-associated protein GABARAP: implications for biolgoical funcrion and its regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1kotA00
3WIMA 2KX3A 4GOCA 4GMVA 4M8NA 3PVLA 3GOEA 4F7ZA 5AEKB 2KDBA 3T8MA 2K39A 3V61A 2LI5A 2NBUA 1LM8B 4GDKB 5GMVA 3Q3FA 1GG3A 1WFYA 5BO4B 4XC2A 3KVFB 2Z59B 2NR2A 1PQSA 2BWFA 4PS8A 1UBIA 1LFDA 1RRBA 4LDTD 2MBBB 2KMCA 2ZCCA 1WZ3A 5D7GA 1WMHB 2N7EA 2VRRB 2ZEQA 1ISNA 4AWJA 4K7SA 4ZRKA 2NS5A 3OJ3A 2W9NA 4PS3A 3RYTA 5IAAC 2L8JA 4G3XB 1OEYJ 1CMXB 2IO1B 3UGBB 3P2BA 2V3SA 2HJ8A 1WGHA 1WXSA 1Z2MA 1P0RA 3ML9A 4ZYNA 2KJHB 4I6LB 1WJ4A 1WX8A 2LZ6A 2KOXA 4W9HA 5C1ZA 2MW5A 1WM2A 5D94A 2NPTA 2LRUA 4RMAA 2KFJA 2DYMA 4FA6A 2ZVOA 3C0RB 4NPNA 4NNJB 4W9CA 3X0WA 1WGGA 2JT4B 3ZKJC 3VTWA 3KUDB 1UBQA 2MCNB 4JQWC 4URKA 3L0WB 2CR5A 4BKSD 2CU1A 2OJRA 3KYDD 5LLIA 3CMMB 3LDZE 4GN1A 3HM3A 2J0KA 4BOSC 5D6JB 1UH6A 3H1UA 1WX7A 2FCNA 3JYUA 2D07B 3EFUA 2EMTA 2ZVNA 1G6JA 1YX5B 2N9EB 3PRPB 1Y8RC 2KLGA 3ENEA 2DZIA 2K6QA 4ANVA 1E5WA 2J7QB 1V5OA 4FJYA 4OVVA 3W1SC 3UQBA 2JRIB 1X1MA 3N3KB 4W9FA 4ASWC 3B1LX 1WE6A 2AYOB 3ONSA 4WWOA 1C3TA 3QK0A 3RD2A 4HXDA 1I42A 3OJ4B 2DAFA 3ZW3A 5AZHA 1P98A 4BBNF 4MELA 2C7NB 1FXTB 2BPSA 2V1YA 2NPTB 2FIDA 2K1FA 2KTFA 1WGRA 3L17A 2KVRA 2GBRA 5E6PA 2MSED 2BKFA 3EECA 2KKCA 2AL6A 3DBRI 4HDOA 4IWPA 4OVUA 4A3OA 1U4AA 2FUHB 3R66C 1WI0A 2JZ3B 2N1WA 1WGYA 2LVPA 2JXXA 2O2VA 2BGFA 2GBKA 4JGHB 2QHOA 3L54A 3VUXA 2NBVB 2R2OA 1E7UA 2BYVE 1WIAA 2MBQA 4TQ0A 5J18A 4KZ0A 4DDGD 1Q1OA 2IY0B 2LXCA 3QWZB 1TGZB 4MJSB 2K6DB 2L3ZA 4LDTB 3OLMD 4X57B 5DPTA 3ZVVA 1UD7A 5D2MB 3VTVA 4YL8A 4IC7B 4KSKC 4B6WA 3ZNZB 4GSWA 1OGWA 2JWZA 4IG7B 3IVFA 3DBLI 3JW0X 4II3B 2LGYA 4KVGB 4W9JA 2K8CA 2CS4A 3EC8A 2YLMA 3V60A 3JVZX 4FHJA 2L0TA 3DCGA 4AP4C 5L83A 1RLFA 3PV1A 2A4ZA 3DVGX 4KIKB 2KWUB 2JUOA 3A9JA 2Z0EB 1KOTA 2KJRA 1J0GA 4M8MA 2AEHA 4P7IA 3VUYA 4E71A 2M17A 2KX0A 2CKHB 3IBEA 1K8RB 3QARA 1V2YA 3PT2B 3CSTA 2JPHA 3V6CB 2LD9A 3ML8A 4JL9A 1GJZA 1A5RA 2PJHA 4WJNA 2LGDA 2I1JA 3PZDA 3M63B 4G11A 4DHJB 2LXAA 2KO3A 2LUEA 1EO6A 4KZCA 3UINB 2Z0DB 1WJUA 2ZPNA 4K7UA 5J2RA 2MP2A 4GIVA 3VTUA 2L0FA 3AULA 4NAWB 1WJ6A 2KFKA 1AARA 5FR6A 3UIOB 5EDSA 2RSUA 2WX1A 3B08A 3RULA 2KTRA 2LWPA 5KHQA 2KC2A 3A9JB 2KXJA 4MGYE 1ZKHA 1VD2A 4DXAB 1EF5A 3PS6A 1WRDB 4KSLC 3WAMA 4EEWA 3APFA 4PYZA 3A9KA 3KW5B 2M0XA 2RR9A 3TCAA 4FBJB 1XQQA 3ZNID 1KM7A 1WM3A 1TZ1A 3JSVB 3QHTA 2XBBC 2KDFB 2IYDB 4IWOA 3R7QA 1TTNA 4FJVB 4WAAA 3NS8A 2FCQA 1SE9A 4N9F4 3V6EB 2YVCA 2K8BA 3QA8A 3APCA 3EHVA 2LRWA 3DQVA 1KLVA 2L7RA 4G0NB 3TBLD 4EOYA 1YD8U 5CHWA 2KDIA 2MP2B 2C60A 2GBNA 3L13A 2C5LC 4W9IA 2R2QA 2G4DB 3VH4B 4DWFA 4K1RB 4RM9A 4BBNC 3ZRCA 4IW0A 1WYWB 5G55A 3IHPC 2NVUI 2KTRB 3T9LA 3Q3JA 3QJZA 4MH0E 1GNUA 4HPMB 2JRHA 4HJKA 4ZDVA 2MX2A 1E7VA 4DHJD 2D3GA 2RD0A 1V9JA 1Q0WB 3VUWA 3WA0A 1MG8A 2KC1A 1WXVA 2EKEC 4DHZB 5JZEB 4IM3A 3H7SA 2IO3B 4WWNA 4LCDE 2G4SA 2PE9A 3DOWA 1P9DU 4II2B 4LJPB 3VHTC 4XX5A 1V6EA 1E90A 1E8YA 2KD0A 3AU5A 3SD5A 2DAJA 2KDEB 2WX0A 4TQ1A 1VCBA 5CHFA 5J17A 3HIZA 4NQLB 2ZNVB 1IYFA 2JF5A 1V49A 1QZEA 3HK0A 4LJOB 3ZUNA 2ZCBA 4MM3A 3TJPA 4JLCA 2JVCA 4HK2A 1E8XA 5KHOA 5L95C 2Y5BB 4HCPB 4A20A 4BOZB 3D32A 3VFKA 2L05A 4MDKE 3TIXA 3M3JA 2MBOA 3OAWA 3ZLZA 4MGZE 3SU8X 1LQBA 2NBWB 1V86A 2CHZA 1RFAA 3L16A 3W1SA 3LJ3A 4DDID 4W9LA 3PRZA 1R4MI 2ZPYA 2DZJA 1J19A 2AL3A 5DCNA 2HTHA 3NY5A 1BT0A 2WWZA 1WY8A 3B0AA 4IWQA 4ANUA 2BYEA 2O6VA 1YIWA 2BKRB 3QCAA 3U8ZA 4BVUC 5DPWA 2KN5A 4BFRA 3UQAA 4AOFA 3HHMA 5CTRC 2DENB 3PLUA 3SHQA 3DVNV 1WJNA 4WJOA 3QIJA 1TBEA 1V5TA 3APDA 1P1AA 1Z5SB 4F1SA 3IG3A 2FNJB 2LASA 3UF8A 2FAZA 1HE8A 4BKSA 2CHWA 3O65B 4RM8A 5DPSA 1D3ZA 3V62A 3CSFA 3VDZA 3H7PA 1P3QU 3RCZA 2ZZPB 4KDIC 1NDDA 2M8SA 2KLCA 5IA7A 2O2VB 2DYOA 3DVGY 3H6NA 3VQIA 1SIFA 4KDLB 4EFOA 2GBJA 4M0WB 1WXAA 4G50A 3DBSA 2B3AA 2REXA 5E6NA 1XT9B 5G2NA 2FCSA 2C7MB 4WQOB 4KV2A 1IPGA 2BYFA 4B95A 2CHXA 2JY6A 3KH0A 3N30A 3PTFC 1WE7A 2KWCA 3ALBA 3ECIA 4MEMA 5DPRA 1L7YA 1Q5WB 3MJWA 4W9KA 3L08A 4FLHA 3AI5A 3NHEB 1KJTA 1OEYA 3R3MA 3UIPB 2A5UA 1WMHA 4JIOU 4EZKA 1EF1A 1F9JA 3PPAA 1YJ1A 2BWES 4WJPA 2WYQA 3M62B 2KQ7A 3WAOA 1GC7A 4PS7A 2IBIB 2UWQA 4ANXA 4AJWA 2RPQA 3A4SC 2ZJDA 3W1YA 3PRMB 4BKTA 1T0YA 4HPLB 4HDQA 4EZJA 2PEAA 2HE7A 4W9EA 3NOBA 4E74A 1R4NI 2LVQA 3DBHI 4A3PA 2FCMA 4FN2A 1UZXB 2MBHA 3ZNGC 3PHWB 2MLBA 3QAQA 4WJQA 5HKHA 3PGEA 2GOWA 4AUQC 2FIFA 4MGKE 3AU4A 2ZNVC 2IY1B 2XK5A 2KHWB 2RGFA 3CF6E 2OOBB 4NJ7A 1WXMA 2N9XA 3TL5A 4GXBA 2DYBA 2KFKB 5CHVC 2KK8A 2KANA 2HD5B 3MTNB 4GDLA 2L00B 1GC6A 1RAXA 3QX1A 4W9DA 2K25A 3WAPA 4CYEA 4EZLA 2D2QA 2M4NA 3VXWA 5AZFA 4TUUA 1WH3A 3L10B 3QQ8B 3U30A 3NZUA 3A4RA 2IO2B 3A9KB 4ZRJA 4GU2A 1NBFC 2O6VD 3PLVA 4IM2A 3A33B 1WR1A 4DBGA 1ZGUB 2C7HA 1J8CA 1NI2A 3RZWC 2DZKA 5LXHA 2LVOA 3I3TB 4CO7A 2MWSB 2XK5B 3BY4B 3DPDA 2IO0B 1EUVB 5C23A 3ZDTA 4XZ4A 1JRUA 2PE6B 3PHXB 3VVWB 4GB9A 2G3QB 2NCNA 2DZMA 3QC8B 1S3SG 1E8ZA 4AJYB 4GDLB 3M95A 4ICUA 3BINA 4NQKE 4ANWA 1C1YB 4FADA 1M94A 1UGMA 2N7DA 3ZNHB 3MHSD 1WZ0A 4MJSA 2K8HA 3H9DA 4FHKA 4TKNA 2KNBA 2UYZB 5LXIB 3ZO5B 2N9PC 4HLEA 5AZGA 2BF8B 1ZW7A 3A1QA 1V81A 2D10A 3KUZA 4TV3A 3AXCA 3K9PB 3SDLC 3PSEB 1YQBA 3DDCB 2MBEA 4ZRIA 4F8CB 1I35A 2EMSA 4MSMB 2WDTB 2N4FA 3RUIB 1OTRB 4DHZE 3KYCD 2J0MA 4K7WA 4GGQA 4KIKA 2V4LA 4I6NB 4B9KA 3KUCB 3TMPB 3WANA 2IZVB 5CX3A 4MGIE 2DHZA 4W9GA 2I1KA 2M1MA 1GUAB 4MSQB 2KJ6A 4DK5A 3ZDMC 2XEWA 4IM0A 3ZTCA 4HWIB 4NJ6A 5JHBA 5TR5A 2GBMA 1YX6B 4ICVA 1WF9A 1XD3B 3VAWA 4FJZA 3R7RA 2MA9B 3X23A 1OQYA 1IP9A 2LGXA 1L2NA 3A1QB 2C9WB 1E8WA 4PYUA 3IFWB 3DVNU 2KMAA 3HM6X 3K9OB 4WWPA 5JH5C 2D11A 4NAWA 4GDKA 3WALA 4BKGA 2JZZA 4EUTA 2MRPA 1LXDA 2J0JA 2KQSA 3VH3B 4J6IA 4HCNB 3U7DA 1V80A 2KWVB 1WR6E 2O6VB 1H4RA 5JHAA 4FULA 3ZTDA 3GZNI 2MQJA 1UELA 3NZSA 2N1VA 4IUMB 3ZRFA 4E3CA 4HVBA 4NY0A 5E6OA 3PREA 4I6PA 2G45B 2AWTA 2LJ5A 2L76A 1WGDA 3ZIMA 3JSVA 1H8CA 4EKUA 3N32A 4CHKA 2KZRA 3RT3B 3H7PB 1WX9A 3S2AA 2DX5B 2PPHA 1SGHA 2GMIC 2ASQA 4K81A 1S1QB 3RZFA
chains in the Genus database with same CATH superfamily
3WIMA 2KX3A 5AEKB 2KDBA 3V61A 1LM8B 3Q3FA 1TT5B 1GG3A 1QKZA 2W3SA 5BO4B 4LNOA 1HA5A 1PQSA 2N9KA 1UBIA 2QCZA 2MBBB 2INCC 2ZCCA 1J7BA 1WMHB 4PS3A 4C56C 2L8JA 3UGBB 3ZYYX 1DGJA 2HJ8A 3ML9A 3VRAB 1FD6A 5T8IA 2IGHA 4W9HA 2NPTA 2PKOA 4FA6A 2ZVOA 1T0QC 4LNKA 4NNJB 3GZNB 3I57A 4MT5A 3VTWA 4JQWC 1Y56A 4XYCA 2CU1A 2OJRA 5LLIA 3LDZE 2CJOA 3AE5B 4GN1A 3HM3A 4BOSC 4N59A 2G1EA 5D6JB 1FPYA 1WX7A 1XLOA 3FILB 3EFUA 4OVVA 4FJYA 1AN8A 2D3AA 4L1BA 4WWOA 4D2KA 4BAXA 3QK0A 4HXDA 3ZW3A 4B0MA 2RDHA 4BBNF 3TEWA 4L23A 2KT7A 2K1FA 3P4SB 4IKGA 4HDOA 4A3OA 5IOIA 1U4AA 2QMTA 1WI0A 2JZ3B 1EU3A 1T6BX 2BGFA 4JGHB 1KLUD 3L54A 2NBVB 2BYVE 4M0WA 1NYQA 4DDGD 4S0RA 5D3IB 4FXCA 4IC7B 1VLBA 1OGWA 2N0SB 3IVFA 4KVGB 3NZ3A 1ZOYB 4FHJA 1ET6A 2L0TA 4AP4C 4KIKB 3A9JA 1C76A 3Q2AC 1K50A 1Q10A 2BTEA 1I4QA 3IBEA 2TSSA 3QARA 3PT2B 2LD9A 1N60A 2LXAA 1F0ZA 1UGJA 3IXSA 3DBRB 4NAWB 4OVZA 3BVZA 3ZXRA 5HG2A 2WX1A 5KHQA 1D5ZC 2LFIA 1VD2A 1EF5A 1WRDB 1FIQA 4ITKA 2MJEA 1N6ZA 3KW5B 2M0XA 1WM3A 3SFDB 4IWOA 2I2YA 4WAAA 3NS8A 1SE9A 3APCA 1KLVA 1UF0A 3TBLD 1SE2A 4DXGA 5BMGA 2MP2B 1FNVA 2C60A 1MFWA 3L13A 2C5LC 2G4DB 2HDEA 4BBNC 2NVUI 2KTRB 3Q3JA 1MI0A 3QJZA 4RGOS 2D3GA 2RD0A 1FNUA 1MG8A 4DHZB 4H2AA 3H7SA 2G4SA 4II2B 4LJPB 1MJDA 1NVID 1V6EA 1E90A 3AU5A 5BYRA 3SD5A 2WX0A 4TQ1A 3IAS1 1QZEA 4MM3A 1MHXA 2JVCA 3SFEB 4HCPB 4A20A 3D32A 2L05A 2MBOA 4MGZE 3SU8X 1GAQB 2OHFA 3CIRB 3PRZA 2GB1A 1R4MI 2AL3A 4O1NA 1XLNA 3W5VB 2WWZA 1J7CA 2O6VA 3U8ZA 4BVUC 5DPWA 2BW2A 2PVGC 3UQAA 1DOYA 1IBXA 3HHMA 5CTRC 2MJDA 1FFVA 4L2YA 4WJOA 1P1AA 3ABVB 5LNK1 3O65B 3V62A 3VDZA 1SJED 2EKIA 3RCZA 2ZZPB 4KDIC 1PGBA 4PT5A 2DYOA 3H6NA 4KDLB 1N63A 1RYJA 3RPFC 2RDBC 2JQRB 2WXRA 4HKZE 4HEA1 4KGTA 3MJ5A 5E6NA 3P63A 5G2NA 2FCSA 2C7MB 3AEDB 4YTMB 1VZ7A 3RMKC 1L7YA 1K53A 2RPVA 1AYFA 3AI5A 3R3MA 3Q8EA 3WCQA 1WMHA 3PPAA 2BWES 1FFUA 1ZUD2 2WYQA 4PS7A 4C4VA 2IBIB 4ANXA 2RPQA 3PRMB 2BT6A 4HDQA 2HE7A 1R4NI 2FCMA 3ZNGC 3PHWB 3QAQA 4WJQA 5HKHA 4AUQC 2FIFA 2IY1B 3FILA 2HD5B 3MTNB 2K25A 2M4NA 4RH6A 4TUUA 3A4RA 4YSXB 4GU2A 1FEHA 1C4AA 3BK1A 1J8CA 1NI2A 1E9MA 3C19A 2LVOA 5LXHA 2ONQA 2MWSB 2ACZB 3R2TA 2XK5B 1GPXA 3DHHC 5IP4D 4XZ4A 1JRUA 4GLSC 4KKIA 3VVWB 2N9LA 2G3QB 2NCNA 3QC8B 3Q8FA 1E7PB 4ICUA 2V9HA 1YMHE 3BINA 2YEPF 1C1YB 1UGMA 2N7DA 4ZHOA 2WXFA 2K8HA 3H9DA 2KNBA 3W5UB 5LXIB 2KQ4X 4XWWA 1RWSA 2H88B 2YEPB 2VZKD 3RUIB 2NTSA 2V3PA 2E3TA 1XLPA 4KIKA 2WS3B 3WANA 2IZVB 2WDRB 4MGIE 2M1MA 1GUAB 3FAHA 4YSYB 2LJIA 2PTLA 4WURA 2M19A 2AQ2B 1AW7A 4HWIB 5TR5A 3P4QB 2BS2B 1TKGA 3RNFC 3RNCC 1JWUD 1FCCC 3X23A 1OQYA 3A1QB 2C9WB 1E8WA 3IFWB 3HM6X 2KMAA 4RFBA 4TMAB 4NAWA 2K3UA 4BKGA 2JZZA 4EUTA 2MRPA 2J0JA 4J6IA 3I9V1 3U7DA 1WR6E 4KKJA 3GZNI 5IKCM 3ZRFA 2RMMA 4NY0A 2QILA 2LJ5A 1STEA 1H8CA 3N32A 4CHKA 3RZFA 3Q69A 2K5PA 4GOCA 3AE6B 1K52A 1ACCA 1HZ6A 2LI5A 4GDKB 1J7AA 3URYA 3MHZA 4P1CC 1JQ4A 2NR2A 2JZPA 1PGAA 3BIID 2Y3AA 3NVWA 1RRBA 4LDTD 4C7YA 3BYTB 2LUMA 2BBCA 4ZRKA 3GB1A 4G3XB 1CMXB 2IPKD 2V3SA 4ZYNA 2KJHB 1WX8A 5BMIA 4A6QA 2MW5A 4HPPA 3RI7C 2UU7A 1PFDA 3HUIA 2DYMA 4N58A 2WXJA 1WGGA 5HHDG 3KUDB 4URKA 4BKSD 2WU2B 3KYDD 2PW9A 2LGSA 1V8CA 2WDVB 2J0KA 2JYEA 1F52A 1UH6A 2H89B 2FCNA 1QOFA 2D07B 2EMTA 1SB3C 4RF0A 3N1YC 2KLGA 1SSNA 3AE3B 1E5WA 2J7QB 5HFYA 1V5OA 3BZDB 2JRIB 4W9FA 4ASWC 1I4PA 4M02A 1R7SA 1P98A 1V1PA 2C7NB 1FXTB 1KFYB 4ARCA 2KTFA 3ZJUA 1WGRA 3PO0A 2V3NA 3LB8C 2AL6A 3DBRI 4IWPA 4OVUA 4RCOA 2FUHB 3R66C 1YN3A 3EUB2 2GBKA 1E7UA 2MBQA 1WIAA 4TQ0A 1LO5D 2K0PA 1DYQA 1Q1OA 2IY0B 2LXCA 1TGZB 4MJSB 3KQ4A 2L3ZA 3OLMD 4X57B 5D2MB 4YL8A 1F2RI 2KYWA 4KSKC 1HZ5A 2I38A 4II3B 2LGYA 4HRSA 4M01A 4XWTA 3FKYA 3L4PA 3TUOA 3AH7A 1BMLC 1JWAD 4E71A 3NS1A 2KX0A 1ROEA 3AB5A 1K8RB 1V2YA 3CSTA 3V6CB 3SEBA 2I1JA 3AE2B 3PZDA 4JPSA 4G11A 2WXNA 4DHJB 2KO3A 2LUEA 2OEDA 3J9CA 2L32A 1UWXA 2Z0DB 2ZPNA 4K7UA 2L0FA 4NAMA 2K22A 4YSZB 5FR6A 1ZPSA 2BYTA 2RSUA 3B08A 2LWPA 2KC2A 4KSLC 4QAYA 4EEWA 1XO3A 4C00A 2RR9A 5JXVA 2J53A 4K3CA 3ZNID 1TZ1A 1WWTA 2IYDB 4N9F4 2K8BA 2ICIA 2LRWA 1HQRD 2L7RA 4G0NB 5CHWA 1RFKA 2GBNA 2WXOA 5C3JB 4DWFA 3VH4B 4XDDA 4A55A 3T9LA 4MH0E 2E6XA 1GNUA 2WU5B 4HJKA 1E7VA 4DHJD 1UNSA 1WXVA 4IM3A 3NVZA 4WWNA 1SBBB 1ZDXA 1L4DB 1FM0D 1E8YA 2DAJA 1L6UA 4MACA 5CHFA 2QIEB 1QQRA 1IYFA 2ZNVB 3P4RB 2QDFA 3TJPA 4HK2A 5L95C 1ESFA 1I7HA 3TIXA 3NRZA 1F77A 1SJHD 4JE3B 3OG5A 4DDID 4HKQA 2BS3B 1QLBB 1FNWA 5DCNA 3NY5A 1BT0A 4LLGM 2GRIA 2MH7A 4IWQA 3FC4A 2KN5A 4BFRA 1YN4A 3SHQA 1MVKA 3QIJA 1V5TA 3AE8B 3APDA 1XCTL 4LTUA 3IG3A 1D5XC 4BKSA 1HE8A 1XLQA 3ZJVA 2MJ3A 2CHWA 3CSFA 1TZOA 4TSSA 1B9RA 1TS4A 3W2DA 2O2VB 3HRDD 1SIFA 3Q3OC 4G50A 2B3AA 2REXA 5AUIA 5TSSA 3AEAB 4WQOB 4KV2A 2JY6A 3PTFC 2KWCA 2V4IB 3NHEB 3IT6B 4OW0A 2JYTA 1DOIA 4WJPA 4NZLB 3TEYA 2UWQA 4AJWA 3GP7A 1T0YA 3RNEC 3NOBA 3RN9C 4KGRA 5EE9A 1UZXB 3U52E 3AE1B 2GOWA 3EA6A 3T3OA 2ZNVC 2KHWB 3KLSX 1GB1A 2OOBB 4NJ7A 2N9XA 3TSSA 2L00B 1RAXA 2RDGA 2D2QA 3VXWA 1GOZA 2JSVX 2V0GA 2IO2B 5G5GA 1JWMD 1NBFC 3PLVA 1WR1A 3R2IA 2C7HA 4RGNA 5C23A 3PHXB 3TEXA 1S3SG 4AJYB 2XNAC 4GDLB 4NQKE 1TS3A 4FADA 3V3XA 3ZNHB 2DBYA 3MHSD 4MJSA 4TKNA 3R8BA 3ZO5B 1ZW7A 2D10A 4HROA 4TV3A 1MHHE 3AXCA 1JW9D 2MBEA 4ZRIA 4F8CB 2EMSA 3HVZA 5H92C 4DHZE 2J0MA 3N1ZC 4GGQA 2W82A 2V4LA 1I4RA 4I6NB 4B9KA 2BS4B 4IM0A 3ZTCA 4NJ6A 1VDVA 2GBMA 3DWGC 4EE2A 3UI3A 4DQOC 2LGXA 3AV8A 5JH5C 3E9SA 3Q3NC 4WH4A 2KQSA 1RM6C 3KWVA 2IDYA 1FRDA 1V80A 1IGDA 3ZTDA 2N1VA 4HVBA 3U7ZA 5E6OA 3PREA 4I6PA 2G45B 2AWTA 4P16A 1WGDA 3ZIMA 4EKUA 2KZRA 3H7PB 1WX9A 3VR9B 3LYYA 1SGHA 1TKEA 3BK2A 3AM9A 2EELA 4M8NA 2LHEA 1L6VA 1T3QA 3GOEA 3T8MA 2K39A 1VRAB 5GMVA 2G9HD 1TIFA 1WFYA 3Q6BA 1YNTE 1FXAA 2BWFA 4PS8A 2VZKB 1LFDA 5D7GA 1WZ3A 2ZEQA 2VRRB 5H8YE 4AWJA 3RYTA 4USAA 2IO1B 3P2BA 1Z2MA 1QOBA 1WXSA 1P0RA 1UWMA 4I6LB 1WJ4A 2LZ6A 2KOXA 5C1ZA 3U4EG 4NPNA 2L52A 2X8XX 2JWUA 3X0WA 3ZKJC 1FO4A 2FUG1 3L0WB 4OZAA 3CMMB 2XN9C 4JWUC 2HJ1A 2QEJC 1JWBD 4OHJA 3JYUA 4ZYSA 3N9YC 4LNIA 1N62A 2ZVNA 1YX5B 4IDIA 3ENEA 4UDUC 3N3KB 1C3TA 3B1LX 1WE6A 2AYOB 3ONSA 3CWIA 1SE4A 3RD2A 2J4XA 1XF5L 2DAFA 3OJ4B 5AZHA 1NEKB 2BPSA 2V1YA 2NPTB 2KVRA 4OZBA 2VH1A 3MC9A 3AN1A 1KLGD 2JXXA 2O2VA 2QHOA 3N1XC 3VUXA 1GB4A 5J18A 2WXHA 4KZ0A 3BVGA 1SIJA 2K6DB 4LDTB 1KTKA 2KACA 1FCLA 5DPTA 3ZVVA 1UD7A 2SAKA 3GE3C 4BZAA 2JWZA 4IG7B 3JW0X 2CS4A 2K8CA 3EC8A 2YLMA 3V60A 3JVZX 2QC8A 1I4XA 1MG4A 1RLFA 2A4ZA 1L4ZB 2K9XA 2LMCA 4M8MA 2AEHA 4P7IA 3VUYA 4C80A 3B9JA 2CKHB 4XGAB 2JPHA 2J52A 3MP9A 1JWSD 2WXPA 1A5RA 1FRRA 1QOGA 1EO6A 1OQRA 4KZCA 3AECB 5J2RA 1QILA 2MP2A 4GIVA 3VTUA 3AULA 2CJNA 4RGMA 5EDSA 1JROA 1MPEA 4ZRPA 3AEGB 2KTRA 2AX5A 3A9JB 2KXJA 4MGYE 3V05A 1ZKHA 1R4MB 1CK1A 3APFA 2ZW0A 1C78A 4PYZA 1SEBD 1XQQA 3QHTA 1OFFA 3R7QA 2DLBA 4WAFA 1CJEA 3DBLB 3MFGA 3QA8A 3EHVA 4EOYA 1XEEA 1YD8U 5IN7A 1VJKA 4W9IA 2R2QA 3KWLA 4K1RB 4RM9A 3ZRCA 3IHPC 2N7JA 3AEBB 1WRIA 4HPMB 2JRHA 4ZDVA 2MX2A 3E56A 3AEEB 3P1MA 1Q0WB 3WA0A 2EKEC 1WSPA 3T3NA 2IO3B 2INDC 3DOWA 1P9DU 1TS5A 4XX5A 3AMZA 2W3RA 3OWEB 3TEZA 1D5MC 1ZXHA 3IAM1 2WNMA 3GS2A 5J17A 3HIZA 2JF5A 3HK0A 3Q8CA 3ZUNA 4A8XC 2ZCBA 4JLCA 5KHOA 1M4VA 3Q14C 3MC0B 1P7FA 4BOZB 3NUHB 2NTTA 3AE9B 4MDKE 3ZLZA 3M3JA 2NBWB 4C7ZA 1R4NB 2CHZA 1RFAA 3L16A 3SR6A 5BMHA 3LJ3A 2PVOD 2W55A 4W9LA 1ET9A 2ZPYA 3NJTA 4ACFA 2FE8A 4YXDB 1WY8A 4ANUA 2BYEA 2WXLA 4HJGE 3EGRA 4N6EB 1I4GA 3QCAA 1PGXA 5MPOA 4S17A 3DVNV 3GE8C 1TBEA 2FNJB 2FAZA 5EE1A 3AE4B 2M0AA 3I63C 4RM8A 5DPSA 1NENB 3H7PA 1P3QU 3Q8AA 4M00A 1NDDA 2M8SA 3DVGY 3VQIA 4EFOA 3ZGZA 2WXMA 2INPE 2PMVA 1XT9B 1IPGA 2BYFA 2WLBA 1C4PA 3KH0A 2CHXA 3O13A 2PIAA 3ECIA 1CQVA 3ALBA 3VR8B 4JWSC 1L0VB 1IBXB 3MJWA 4W9KA 4CQNA 3L08A 3UIPB 4NJCA 2A5UA 4JIOU 1EF1A 4US8A 1YJ1A 2KQ7A 1GC7A 1ZXIA 2ZJDA 1N5WA 1SXTA 3W1YA 4BKTA 4OZCA 4HPLB 4W9EA 5GXGB 4E74A 4FN2A 2Y5PA 3PGEA 2DNFA 2JX5A 4MGKE 1N61A 1PDXA 2XK5A 3AU4A 2RGFA 4ZRQA 2W54A 3CF6E 3ZXVA 2BVCA 1WXMA 4GXBA 2AQ3B 2KFKB 5CHVC 2KANA 1LGRA 2BQQA 4CYEA 4C4VB 1JCKB 1WH3A 2WHIA 3L10B 4JX1C 1E10A 2KN4A 3NZUA 4LNFA 3A9KB 4ZRJA 2R61A 2O6VD 1HTQA 2ON8A 3A33B 1ZGUB 3RZWC 2DZKA 1SF0A 4CO7A 1T5XD 2KMMA 3BY4B 1TKYA 1PYWD 4GB9A 1WYGA 2DZMA 3M95A 2PLPA 4ANWA 1A70A 2L1AA 1WXQA 3DBHB 1HEZE 2UYZB 1HXYD 3ZJTA 5AZGA 3A1QA 3KUZA 1YQBA 3DDCB 2WGSA 3Q3MC 2WDTB 2N4FA 2IJ0A 4K7WA 3PZ7A 3KUCB 1VR9A 4AQ7A 4W9GA 2I1KA 3NVYA 3ZDMC 2XEWA 5JHBA 4ICVA 3ZQ4A 1WF9A 1VZ6A 2WP9B 3VAWA 2MA9B 4KX6B 4PYUA 2AQ1B 3DVNU 4WWPA 5FR3A 4A9AA 4GDKA 4P6VF 4LNNA 4DXFA 1LXDA 2KWDA 3VH3B 4YWGG 3C8YA 1H4RA 5JHAA 3Q8BA 3NZSA 4IUMB 3AE7B 2L76A 1BXTA 4WQMA 3RT3B 2BB6A 2DX5B 2PPHA 3IT4B 4R3DA 2GMIC 1SE3A 1S1QB 4GMVA 1FXIA 3PVLA 4F7ZA 5FKAC 2NBUA 4B0EA 1JRPA 2LEKA 1ZP0B 4XC2A 3KVFB 2Z59B 2HTME 1NI3A 3NG0A 2KMCA 2N7EA 1ISNA 1T0SC 2D3CA 4K7SA 2NS5A 3OJ3A 2W9NA 5IAAC 1OEYJ 2GI9A 1JMLA 1WGHA 1P7EA 2WQYB 1WM2A 1FMAD 1OQQA 5D94A 5BYQA 2LRUA 4RMAA 1WGKA 2KFJA 3C0RB 4W9CA 2JT4B 2MCNB 1UBQA 2CR5A 1T0RC 4K3BA 4IOIE 3H1UA 3RNBC 1G6JA 2N9EB 3PRPB 1Y8RC 2DZIA 2K6QA 4ANVA 2INNE 3W1SC 3UQBA 4J3OD 1X1MA 3DWMA 4RNAA 2OJWA 2LGIA 1I42A 3RNAC 4MELA 1L0XB 2FIDA 2L83A 3L17A 2GBRA 1AWDA 2SEBD 5E6PA 2MSED 2BKFA 3EECA 2KKCA 1B1ZA 3MC8A 2N1WA 4ZHPA 1WGYA 2LVPA 4KGSA 2J42A 2R2OA 4XE0A 3QWZB 4ARIA 3VTVA 4YTNB 4B6WA 3ZNZB 4RGTA 4GSWA 2Q5WD 1V1PB 3DBLI 4W9JA 2QSDA 1XXGA 3DCGA 5L83A 3PV1A 4YTPB 3DVGX 2KWUB 1C79A 1TYGB 2JUOA 1KOTA 2Z0EB 1L5PA 2KJRA 1J0GA 1F2RC 2M17A 5E6JA 1YJIA 3ML8A 4JL9A 1GJZA 2PJHA 4WJNA 2LGDA 3M63B 3UINB 1WJUA 1WJ6A 2KFKA 1AARA 3LXFA 3UIOB 1C77A 3RULA 4DXAB 3PS6A 3WAMA 2KDMA 1KRHA 2MEKA 2NMQA 3A9KA 4FBJB 3TCAA 1KM7A 3BYYB 1TY2A 3JSVB 4LK0M 2XBBC 2KDFB 1TTNA 4FJVB 1C9FA 2FCQA 3V6EB 2YVCA 3P4PB 3DQVA 5C2TB 1E6EB 3AEFB 1D4BA 2KDIA 4IW0A 1WYWB 5G55A 1EWCA 1V9JA 3VUWA 4A90A 2KC1A 3N20C 5JZEB 3VRBB 4P1BC 4LCDE 2PE9A 3VHTC 1F1HA 2KD0A 1DOXA 2KDEB 5EE3A 2KVZA 1VCBA 4NQLB 4WIPA 1V49A 4LJOB 1E8XA 2Y5BB 3VFKA 4XDCA 3OAWA 1YOVB 1LQBA 1V86A 1N5XA 5HI1A 3W1SA 2DWQA 2D3BA 2CU3A 2DZJA 2QJLA 5IO9A 1J19A 2HTHA 4REZA 5AUKA 3NVVA 2B76B 3B0AA 1YQ4B 1YIWA 2BKRB 4AOFA 1CZPA 2DENB 3PLUA 2BB5A 1WJNA 3P42A 1L0YB 1Z5SB 4F1SA 2LASA 3UF8A 1UUPA 1D3ZA 2WDQB 1TJEA 1E0ZA 2VH2A 2KLCA 5IA7A 3BWUD 2GBJA 4M0WB 1WXAA 3DBSA 3W9CB 5BYSA 1VZ8A 4B95A 2JU6X 3N30A 1D6EC 1WE7A 5DPRA 1TS2A 4MEMA 1Q5WB 4FLHA 1EM7A 4AS1A 1KJTA 1OEYA 4PK1A 4EZKA 1F9JA 2WXKA 1C4CA 3B2GA 3M62B 3WAOA 3H8HA 3A4SC 4EZJA 2PEAA 3PZ8A 4Q2JA 2LVQA 1NYRA 3DBHI 4A3PA 2MHJA 2MBHA 4ZOHC 2IGDA 2MLBA 2ZW1A 1V97A 1QT9A 3TL5A 2Y5CA 3B2FA 2DYBA 1K51A 5G5HA 2KK8A 3ETRA 4GDLA 3WAPA 1GC6A 3QX1A 4W9DA 4EZLA 5AZFA 3QQ8B 3U30A 2X38A 4IM2A 4DBGA 4US9A 1V1OA 3I3TB 3EFCA 1YQ3B 4MH8A 3DPDA 3U2SC 2IO0B 1EUVB 3ZDTA 1KH0A 1ZDVA 2PE6B 1E8ZA 5EE0A 1KF6B 1M94A 1WZ0A 1YN5A 4RF1A 4FHKA 1QOAA 1I4HA 2IGGA 1IUEA 2N9PC 4HLEA 2BF8B 1V81A 2D5GA 3K9PB 3SDLC 3PSEB 5I4DA 1I35A 4MSMB 3RNGC 4WWMA 1OTRB 1BUIC 3KYCD 2LHDA 1YJJA 3TMPB 5CX3A 2DHZA 4MSQB 2KJ6A 1ZE3D 2M56B 4MM3B 4DK5A 3BVMA 2GLSA 1PUTA 2WXQA 1YX6B 1XD3B 4FJZA 3R7RA 3DHGC 3I5JC 2FBWB 2WXIA 1IP9A 1L2NA 5D3DA 1TY0A 1QF6A 3K9OB 1HTOA 2D11A 4YT0B 1ENFA 3WALA 1JALA 1XCQL 2WXGA 3DHIC 4HCNB 1EWYC 5FK9C 2KWVB 2O6VB 4FULA 2Z8LA 2MQJA 1UELA 4E3CA 3RFZB 3HVDA 3JSVA 1EU4A 2KAJA 2JXTA 3S2AA 1IGCA 2ASQA 4K81A
chains in the Genus database with same CATH topology
3WIMA 2KX3A 4GOCA 4GMVA 4M8NA 3PVLA 3GOEA 4F7ZA 5AEKB 2KDBA 3T8MA 2K39A 3V61A 2LI5A 2NBUA 1LM8B 4GDKB 5GMVA 3Q3FA 1GG3A 1WFYA 5BO4B 4XC2A 3KVFB 2Z59B 2NR2A 1PQSA 2BWFA 4PS8A 1UBIA 1LFDA 1RRBA 4LDTD 2MBBB 2KMCA 2ZCCA 1WZ3A 5D7GA 1WMHB 2N7EA 2VRRB 2ZEQA 1ISNA 4AWJA 4K7SA 4ZRKA 2NS5A 3OJ3A 2W9NA 4PS3A 3RYTA 5IAAC 2L8JA 4G3XB 1OEYJ 1CMXB 2IO1B 3UGBB 3P2BA 2V3SA 2HJ8A 1WGHA 1WXSA 1Z2MA 1P0RA 3ML9A 4ZYNA 2KJHB 4I6LB 1WJ4A 1WX8A 2LZ6A 2KOXA 4W9HA 5C1ZA 2MW5A 1WM2A 5D94A 2NPTA 2LRUA 4RMAA 2KFJA 2DYMA 4FA6A 2ZVOA 3C0RB 4NPNA 4NNJB 4W9CA 3X0WA 1WGGA 2JT4B 3ZKJC 3VTWA 3KUDB 1UBQA 2MCNB 4JQWC 4URKA 3L0WB 2CR5A 4BKSD 2CU1A 2OJRA 3KYDD 5LLIA 3CMMB 3LDZE 4GN1A 3HM3A 2J0KA 4BOSC 5D6JB 1UH6A 3H1UA 1WX7A 2FCNA 3JYUA 2D07B 3EFUA 2EMTA 2ZVNA 1G6JA 1YX5B 2N9EB 3PRPB 1Y8RC 2KLGA 3ENEA 2DZIA 2K6QA 4ANVA 1E5WA 2J7QB 1V5OA 4FJYA 4OVVA 3W1SC 3UQBA 2JRIB 1X1MA 3N3KB 4W9FA 4ASWC 3B1LX 1WE6A 2AYOB 3ONSA 4WWOA 1C3TA 3QK0A 3RD2A 4HXDA 1I42A 3OJ4B 2DAFA 3ZW3A 5AZHA 1P98A 4BBNF 4MELA 2C7NB 1FXTB 2BPSA 2V1YA 2NPTB 2FIDA 2K1FA 2KTFA 1WGRA 3L17A 2KVRA 2GBRA 5E6PA 2MSED 2BKFA 3EECA 2KKCA 2AL6A 3DBRI 4HDOA 4IWPA 4OVUA 4A3OA 1U4AA 2FUHB 3R66C 1WI0A 2JZ3B 2N1WA 1WGYA 2LVPA 2JXXA 2O2VA 2BGFA 2GBKA 4JGHB 2QHOA 3L54A 3VUXA 2NBVB 2R2OA 1E7UA 2BYVE 1WIAA 2MBQA 4TQ0A 5J18A 4KZ0A 4DDGD 1Q1OA 2IY0B 2LXCA 3QWZB 1TGZB 4MJSB 2K6DB 2L3ZA 4LDTB 3OLMD 4X57B 5DPTA 3ZVVA 1UD7A 5D2MB 3VTVA 4YL8A 4IC7B 4KSKC 4B6WA 3ZNZB 4GSWA 1OGWA 2JWZA 4IG7B 3IVFA 3DBLI 3JW0X 4II3B 2LGYA 4KVGB 4W9JA 2K8CA 2CS4A 3EC8A 2YLMA 3V60A 3JVZX 4FHJA 2L0TA 3DCGA 4AP4C 5L83A 1RLFA 3PV1A 2A4ZA 3DVGX 4KIKB 2KWUB 2JUOA 3A9JA 2Z0EB 1KOTA 2KJRA 1J0GA 4M8MA 2AEHA 4P7IA 3VUYA 4E71A 2M17A 2KX0A 2CKHB 3IBEA 1K8RB 3QARA 1V2YA 3PT2B 3CSTA 2JPHA 3V6CB 2LD9A 3ML8A 4JL9A 1GJZA 1A5RA 2PJHA 4WJNA 2LGDA 2I1JA 3PZDA 3M63B 4G11A 4DHJB 2LXAA 2KO3A 2LUEA 1EO6A 4KZCA 3UINB 2Z0DB 1WJUA 2ZPNA 4K7UA 5J2RA 2MP2A 4GIVA 3VTUA 2L0FA 3AULA 4NAWB 1WJ6A 2KFKA 1AARA 5FR6A 3UIOB 5EDSA 2RSUA 2WX1A 3B08A 3RULA 2KTRA 2LWPA 5KHQA 2KC2A 3A9JB 2KXJA 4MGYE 1ZKHA 1VD2A 4DXAB 1EF5A 3PS6A 1WRDB 4KSLC 3WAMA 4EEWA 3APFA 4PYZA 3A9KA 3KW5B 2M0XA 2RR9A 3TCAA 4FBJB 1XQQA 3ZNID 1KM7A 1WM3A 1TZ1A 3JSVB 3QHTA 2XBBC 2KDFB 2IYDB 4IWOA 3R7QA 1TTNA 4FJVB 4WAAA 3NS8A 2FCQA 1SE9A 4N9F4 3V6EB 2YVCA 2K8BA 3QA8A 3APCA 3EHVA 2LRWA 3DQVA 1KLVA 2L7RA 4G0NB 3TBLD 4EOYA 1YD8U 5CHWA 2KDIA 2MP2B 2C60A 2GBNA 3L13A 2C5LC 4W9IA 2R2QA 2G4DB 3VH4B 4DWFA 4K1RB 4RM9A 4BBNC 3ZRCA 4IW0A 1WYWB 5G55A 3IHPC 2NVUI 2KTRB 3T9LA 3Q3JA 3QJZA 4MH0E 1GNUA 4HPMB 2JRHA 4HJKA 4ZDVA 2MX2A 1E7VA 4DHJD 2D3GA 2RD0A 1V9JA 1Q0WB 3VUWA 3WA0A 1MG8A 2KC1A 1WXVA 2EKEC 4DHZB 5JZEB 4IM3A 3H7SA 2IO3B 4WWNA 4LCDE 2G4SA 2PE9A 3DOWA 1P9DU 4II2B 4LJPB 3VHTC 4XX5A 1V6EA 1E90A 1E8YA 2KD0A 3AU5A 3SD5A 2DAJA 2KDEB 2WX0A 4TQ1A 1VCBA 5CHFA 5J17A 3HIZA 4NQLB 2ZNVB 1IYFA 2JF5A 1V49A 1QZEA 3HK0A 4LJOB 3ZUNA 2ZCBA 4MM3A 3TJPA 4JLCA 2JVCA 4HK2A 1E8XA 5KHOA 5L95C 2Y5BB 4HCPB 4A20A 4BOZB 3D32A 3VFKA 2L05A 4MDKE 3TIXA 3M3JA 2MBOA 3OAWA 3ZLZA 4MGZE 3SU8X 1LQBA 2NBWB 1V86A 2CHZA 1RFAA 3L16A 3W1SA 3LJ3A 4DDID 4W9LA 3PRZA 1R4MI 2ZPYA 2DZJA 1J19A 2AL3A 5DCNA 2HTHA 3NY5A 1BT0A 2WWZA 1WY8A 3B0AA 4IWQA 4ANUA 2BYEA 2O6VA 1YIWA 2BKRB 3QCAA 3U8ZA 4BVUC 5DPWA 2KN5A 4BFRA 3UQAA 4AOFA 3HHMA 5CTRC 2DENB 3PLUA 3SHQA 3DVNV 1WJNA 4WJOA 3QIJA 1TBEA 1V5TA 3APDA 1P1AA 1Z5SB 4F1SA 3IG3A 2FNJB 2LASA 3UF8A 2FAZA 1HE8A 4BKSA 2CHWA 3O65B 4RM8A 5DPSA 1D3ZA 3V62A 3CSFA 3VDZA 3H7PA 1P3QU 3RCZA 2ZZPB 4KDIC 1NDDA 2M8SA 2KLCA 5IA7A 2O2VB 2DYOA 3DVGY 3H6NA 3VQIA 1SIFA 4KDLB 4EFOA 2GBJA 4M0WB 1WXAA 4G50A 3DBSA 2B3AA 2REXA 5E6NA 1XT9B 5G2NA 2FCSA 2C7MB 4WQOB 4KV2A 1IPGA 2BYFA 4B95A 2CHXA 2JY6A 3KH0A 3N30A 3PTFC 1WE7A 2KWCA 3ALBA 3ECIA 4MEMA 5DPRA 1L7YA 1Q5WB 3MJWA 4W9KA 3L08A 4FLHA 3AI5A 3NHEB 1KJTA 1OEYA 3R3MA 3UIPB 2A5UA 1WMHA 4JIOU 4EZKA 1EF1A 1F9JA 3PPAA 1YJ1A 2BWES 4WJPA 2WYQA 3M62B 2KQ7A 3WAOA 1GC7A 4PS7A 2IBIB 2UWQA 4ANXA 4AJWA 2RPQA 3A4SC 2ZJDA 3W1YA 3PRMB 4BKTA 1T0YA 4HPLB 4HDQA 4EZJA 2PEAA 2HE7A 4W9EA 3NOBA 4E74A 1R4NI 2LVQA 3DBHI 4A3PA 2FCMA 4FN2A 1UZXB 2MBHA 3ZNGC 3PHWB 2MLBA 3QAQA 4WJQA 5HKHA 3PGEA 2GOWA 4AUQC 2FIFA 4MGKE 3AU4A 2ZNVC 2IY1B 2XK5A 2KHWB 2RGFA 3CF6E 2OOBB 4NJ7A 1WXMA 2N9XA 3TL5A 4GXBA 2DYBA 2KFKB 5CHVC 2KK8A 2KANA 2HD5B 3MTNB 4GDLA 2L00B 1GC6A 1RAXA 3QX1A 4W9DA 2K25A 3WAPA 4CYEA 4EZLA 2D2QA 2M4NA 3VXWA 5AZFA 4TUUA 1WH3A 3L10B 3QQ8B 3U30A 3NZUA 3A4RA 2IO2B 3A9KB 4ZRJA 4GU2A 1NBFC 2O6VD 3PLVA 4IM2A 3A33B 1WR1A 4DBGA 1ZGUB 2C7HA 1J8CA 1NI2A 3RZWC 2DZKA 5LXHA 2LVOA 3I3TB 4CO7A 2MWSB 2XK5B 3BY4B 3DPDA 2IO0B 1EUVB 5C23A 3ZDTA 4XZ4A 1JRUA 2PE6B 3PHXB 3VVWB 4GB9A 2G3QB 2NCNA 2DZMA 3QC8B 1S3SG 1E8ZA 4AJYB 4GDLB 3M95A 4ICUA 3BINA 4NQKE 4ANWA 1C1YB 4FADA 1M94A 1UGMA 2N7DA 3ZNHB 3MHSD 1WZ0A 4MJSA 2K8HA 3H9DA 4FHKA 4TKNA 2KNBA 2UYZB 5LXIB 3ZO5B 2N9PC 4HLEA 5AZGA 2BF8B 1ZW7A 3A1QA 1V81A 2D10A 3KUZA 4TV3A 3AXCA 3K9PB 3SDLC 3PSEB 1YQBA 3DDCB 2MBEA 4ZRIA 4F8CB 1I35A 2EMSA 4MSMB 2WDTB 2N4FA 3RUIB 1OTRB 4DHZE 3KYCD 2J0MA 4K7WA 4GGQA 4KIKA 2V4LA 4I6NB 4B9KA 3KUCB 3TMPB 3WANA 2IZVB 5CX3A 4MGIE 2DHZA 4W9GA 2I1KA 2M1MA 1GUAB 4MSQB 2KJ6A 4DK5A 3ZDMC 2XEWA 4IM0A 3ZTCA 4HWIB 4NJ6A 5JHBA 5TR5A 2GBMA 1YX6B 4ICVA 1WF9A 1XD3B 3VAWA 4FJZA 3R7RA 2MA9B 3X23A 1OQYA 1IP9A 2LGXA 1L2NA 3A1QB 2C9WB 1E8WA 4PYUA 3IFWB 3DVNU 2KMAA 3HM6X 3K9OB 4WWPA 5JH5C 2D11A 4NAWA 4GDKA 3WALA 4BKGA 2JZZA 4EUTA 2MRPA 1LXDA 2J0JA 2KQSA 3VH3B 4J6IA 4HCNB 3U7DA 1V80A 2KWVB 1WR6E 2O6VB 1H4RA 5JHAA 4FULA 3ZTDA 3GZNI 2MQJA 1UELA 3NZSA 2N1VA 4IUMB 3ZRFA 4E3CA 4HVBA 4NY0A 5E6OA 3PREA 4I6PA 2G45B 2AWTA 2LJ5A 2L76A 1WGDA 3ZIMA 3JSVA 1H8CA 4EKUA 3N32A 4CHKA 2KZRA 3RT3B 3H7PB 1WX9A 3S2AA 2DX5B 2PPHA 1SGHA 2GMIC 2ASQA 4K81A 1S1QB 3RZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WIM A;  2KX3 A;  4GOC A;  4GMV A;  4M8N A;  3PVL A;  3GOE A;  4F7Z A;  5AEK B;  2KDB A;  3T8M A;  2K39 A;  3V61 A;  2LI5 A;  2NBU A;  1LM8 B;  4GDK B;  5GMV A;  3Q3F A;  1GG3 A;  1WFY A;  5BO4 B;  4XC2 A;  3KVF B;  2Z59 B;  2NR2 A;  1PQS A;  2BWF A;  4PS8 A;  1UBI A;  1LFD A;  1RRB A;  4LDT D;  2MBB B;  2KMC A;  2ZCC A;  1WZ3 A;  5D7G A;  1WMH B;  2N7E A;  2VRR B;  2ZEQ A;  1ISN A;  4AWJ A;  4K7S A;  4ZRK A;  2NS5 A;  3OJ3 A;  2W9N A;  4PS3 A;  3RYT A;  5IAA C;  2L8J A;  4G3X B;  1OEY J;  1CMX B;  2IO1 B;  3UGB B;  3P2B A;  2V3S A;  2HJ8 A;  1WGH A;  1WXS A;  1Z2M A;  1P0R A;  3ML9 A;  4ZYN A;  2KJH B;  4I6L B;  1WJ4 A;  1WX8 A;  2LZ6 A;  2KOX A;  4W9H A;  5C1Z A;  2MW5 A;  1WM2 A;  5D94 A;  2NPT A;  2LRU A;  4RMA A;  2KFJ A;  2DYM A;  4FA6 A;  2ZVO A;  3C0R B;  4NPN A;  4NNJ B;  4W9C A;  3X0W A;  1WGG A;  2JT4 B;  3ZKJ C;  3VTW A;  3KUD B;  1UBQ A;  2MCN B;  4JQW C;  4URK A;  3L0W B;  2CR5 A;  4BKS D;  2CU1 A;  2OJR A;  3KYD D;  5LLI A;  3CMM B;  3LDZ E;  4GN1 A;  3HM3 A;  2J0K A;  4BOS C;  5D6J B;  1UH6 A;  3H1U A;  1WX7 A;  2FCN A;  3JYU A;  2D07 B;  3EFU A;  2EMT A;  2ZVN A;  1G6J A;  1YX5 B;  2N9E B;  3PRP B;  1Y8R C;  2KLG A;  3ENE A;  2DZI A;  2K6Q A;  4ANV A;  1E5W A;  2J7Q B;  1V5O A;  4FJY A;  4OVV A;  3W1S C;  3UQB A;  2JRI B;  1X1M A;  3N3K B;  4W9F A;  4ASW C;  3B1L X;  1WE6 A;  2AYO B;  3ONS A;  4WWO A;  1C3T A;  3QK0 A;  3RD2 A;  4HXD A;  1I42 A;  3OJ4 B;  2DAF A;  3ZW3 A;  5AZH A;  1P98 A;  4BBN F;  4MEL A;  2C7N B;  1FXT B;  2BPS A;  2V1Y A;  2NPT B;  2FID A;  2K1F A;  2KTF A;  1WGR A;  3L17 A;  2KVR A;  2GBR A;  5E6P A;  2MSE D;  2BKF A;  3EEC A;  2KKC A;  2AL6 A;  3DBR I;  4HDO A;  4IWP A;  4OVU A;  4A3O A;  1U4A A;  2FUH B;  3R66 C;  1WI0 A;  2JZ3 B;  2N1W A;  1WGY A;  2LVP A;  2JXX A;  2O2V A;  2BGF A;  2GBK A;  4JGH B;  2QHO A;  3L54 A;  3VUX A;  2NBV B;  2R2O A;  1E7U A;  2BYV E;  1WIA A;  2MBQ A;  4TQ0 A;  5J18 A;  4KZ0 A;  4DDG D;  1Q1O A;  2IY0 B;  2LXC A;  3QWZ B;  1TGZ B;  4MJS B;  2K6D B;  2L3Z A;  4LDT B;  3OLM D;  4X57 B;  5DPT A;  3ZVV A;  1UD7 A;  5D2M B;  3VTV A;  4YL8 A;  4IC7 B;  4KSK C;  4B6W A;  3ZNZ B;  4GSW A;  1OGW A;  2JWZ A;  4IG7 B;  3IVF A;  3DBL I;  3JW0 X;  4II3 B;  2LGY A;  4KVG B;  4W9J A;  2K8C A;  2CS4 A;  3EC8 A;  2YLM A;  3V60 A;  3JVZ X;  4FHJ A;  2L0T A;  3DCG A;  4AP4 C;  5L83 A;  1RLF A;  3PV1 A;  2A4Z A;  3DVG X;  4KIK B;  2KWU B;  2JUO A;  3A9J A;  2Z0E B;  1KOT A;  2KJR A;  1J0G A;  4M8M A;  2AEH A;  4P7I A;  3VUY A;  4E71 A;  2M17 A;  2KX0 A;  2CKH B;  3IBE A;  1K8R B;  3QAR A;  1V2Y A;  3PT2 B;  3CST A;  2JPH A;  3V6C B;  2LD9 A;  3ML8 A;  4JL9 A;  1GJZ A;  1A5R A;  2PJH A;  4WJN A;  2LGD A;  2I1J A;  3PZD A;  3M63 B;  4G11 A;  4DHJ B;  2LXA A;  2KO3 A;  2LUE A;  1EO6 A;  4KZC A;  3UIN B;  2Z0D B;  1WJU A;  2ZPN A;  4K7U A;  5J2R A;  2MP2 A;  4GIV A;  3VTU A;  2L0F A;  3AUL A;  4NAW B;  1WJ6 A;  2KFK A;  1AAR A;  5FR6 A;  3UIO B;  5EDS A;  2RSU A;  2WX1 A;  3B08 A;  3RUL A;  2KTR A;  2LWP A;  5KHQ A;  2KC2 A;  3A9J B;  2KXJ A;  4MGY E;  1ZKH A;  1VD2 A;  4DXA B;  1EF5 A;  3PS6 A;  1WRD B;  4KSL C;  3WAM A;  4EEW A;  3APF A;  4PYZ A;  3A9K A;  3KW5 B;  2M0X A;  2RR9 A;  3TCA A;  4FBJ B;  1XQQ A;  3ZNI D;  1KM7 A;  1WM3 A;  1TZ1 A;  3JSV B;  3QHT A;  2XBB C;  2KDF B;  2IYD B;  4IWO A;  3R7Q A;  1TTN A;  4FJV B;  4WAA A;  3NS8 A;  2FCQ A;  1SE9 A;  4N9F 4;  3V6E B;  2YVC A;  2K8B A;  3QA8 A;  3APC A;  3EHV A;  2LRW A;  3DQV A;  1KLV A;  2L7R A;  4G0N B;  3TBL D;  4EOY A;  1YD8 U;  5CHW A;  2KDI A;  2MP2 B;  2C60 A;  2GBN A;  3L13 A;  2C5L C;  4W9I A;  2R2Q A;  2G4D B;  3VH4 B;  4DWF A;  4K1R B;  4RM9 A;  4BBN C;  3ZRC A;  4IW0 A;  1WYW B;  5G55 A;  3IHP C;  2NVU I;  2KTR B;  3T9L A;  3Q3J A;  3QJZ A;  4MH0 E;  1GNU A;  4HPM B;  2JRH A;  4HJK A;  4ZDV A;  2MX2 A;  1E7V A;  4DHJ D;  2D3G A;  2RD0 A;  1V9J A;  1Q0W B;  3VUW A;  3WA0 A;  1MG8 A;  2KC1 A;  1WXV A;  2EKE C;  4DHZ B;  5JZE B;  4IM3 A;  3H7S A;  2IO3 B;  4WWN A;  4LCD E;  2G4S A;  2PE9 A;  3DOW A;  1P9D U;  4II2 B;  4LJP B;  3VHT C;  4XX5 A;  1V6E A;  1E90 A;  1E8Y A;  2KD0 A;  3AU5 A;  3SD5 A;  2DAJ A;  2KDE B;  2WX0 A;  4TQ1 A;  1VCB A;  5CHF A;  5J17 A;  3HIZ A;  4NQL B;  2ZNV B;  1IYF A;  2JF5 A;  1V49 A;  1QZE A;  3HK0 A;  4LJO B;  3ZUN A;  2ZCB A;  4MM3 A;  3TJP A;  4JLC A;  2JVC A;  4HK2 A;  1E8X A;  5KHO A;  5L95 C;  2Y5B B;  4HCP B;  4A20 A;  4BOZ B;  3D32 A;  3VFK A;  2L05 A;  4MDK E;  3TIX A;  3M3J A;  2MBO A;  3OAW A;  3ZLZ A;  4MGZ E;  3SU8 X;  1LQB A;  2NBW B;  1V86 A;  2CHZ A;  1RFA A;  3L16 A;  3W1S A;  3LJ3 A;  4DDI D;  4W9L A;  3PRZ A;  1R4M I;  2ZPY A;  2DZJ A;  1J19 A;  2AL3 A;  5DCN A;  2HTH A;  3NY5 A;  1BT0 A;  2WWZ A;  1WY8 A;  3B0A A;  4IWQ A;  4ANU A;  2BYE A;  2O6V A;  1YIW A;  2BKR B;  3QCA A;  3U8Z A;  4BVU C;  5DPW A;  2KN5 A;  4BFR A;  3UQA A;  4AOF A;  3HHM A;  5CTR C;  2DEN B;  3PLU A;  3SHQ A;  3DVN V;  1WJN A;  4WJO A;  3QIJ A;  1TBE A;  1V5T A;  3APD A;  1P1A A;  1Z5S B;  4F1S A;  3IG3 A;  2FNJ B;  2LAS A;  3UF8 A;  2FAZ A;  1HE8 A;  4BKS A;  2CHW A;  3O65 B;  4RM8 A;  5DPS A;  1D3Z A;  3V62 A;  3CSF A;  3VDZ A;  3H7P A;  1P3Q U;  3RCZ A;  2ZZP B;  4KDI C;  1NDD A;  2M8S A;  2KLC A;  5IA7 A;  2O2V B;  2DYO A;  3DVG Y;  3H6N A;  3VQI A;  1SIF A;  4KDL B;  4EFO A;  2GBJ A;  4M0W B;  1WXA A;  4G50 A;  3DBS A;  2B3A A;  2REX A;  5E6N A;  1XT9 B;  5G2N A;  2FCS A;  2C7M B;  4WQO B;  4KV2 A;  1IPG A;  2BYF A;  4B95 A;  2CHX A;  2JY6 A;  3KH0 A;  3N30 A;  3PTF C;  1WE7 A;  2KWC A;  3ALB A;  3ECI A;  4MEM A;  5DPR A;  1L7Y A;  1Q5W B;  3MJW A;  4W9K A;  3L08 A;  4FLH A;  3AI5 A;  3NHE B;  1KJT A;  1OEY A;  3R3M A;  3UIP B;  2A5U A;  1WMH A;  4JIO U;  4EZK A;  1EF1 A;  1F9J A;  3PPA A;  1YJ1 A;  2BWE S;  4WJP A;  2WYQ A;  3M62 B;  2KQ7 A;  3WAO A;  1GC7 A;  4PS7 A;  2IBI B;  2UWQ A;  4ANX A;  4AJW A;  2RPQ A;  3A4S C;  2ZJD A;  3W1Y A;  3PRM B;  4BKT A;  1T0Y A;  4HPL B;  4HDQ A;  4EZJ A;  2PEA A;  2HE7 A;  4W9E A;  3NOB A;  4E74 A;  1R4N I;  2LVQ A;  3DBH I;  4A3P A;  2FCM A;  4FN2 A;  1UZX B;  2MBH A;  3ZNG C;  3PHW B;  2MLB A;  3QAQ A;  4WJQ A;  5HKH A;  3PGE A;  2GOW A;  4AUQ C;  2FIF A;  4MGK E;  3AU4 A;  2ZNV C;  2IY1 B;  2XK5 A;  2KHW B;  2RGF A;  3CF6 E;  2OOB B;  4NJ7 A;  1WXM A;  2N9X A;  3TL5 A;  4GXB A;  2DYB A;  2KFK B;  5CHV C;  2KK8 A;  2KAN A;  2HD5 B;  3MTN B;  4GDL A;  2L00 B;  1GC6 A;  1RAX A;  3QX1 A;  4W9D A;  2K25 A;  3WAP A;  4CYE A;  4EZL A;  2D2Q A;  2M4N A;  3VXW A;  5AZF A;  4TUU A;  1WH3 A;  3L10 B;  3QQ8 B;  3U30 A;  3NZU A;  3A4R A;  2IO2 B;  3A9K B;  4ZRJ A;  4GU2 A;  1NBF C;  2O6V D;  3PLV A;  4IM2 A;  3A33 B;  1WR1 A;  4DBG A;  1ZGU B;  2C7H A;  1J8C A;  1NI2 A;  3RZW C;  2DZK A;  5LXH A;  2LVO A;  3I3T B;  4CO7 A;  2MWS B;  2XK5 B;  3BY4 B;  3DPD A;  2IO0 B;  1EUV B;  5C23 A;  3ZDT A;  4XZ4 A;  1JRU A;  2PE6 B;  3PHX B;  3VVW B;  4GB9 A;  2G3Q B;  2NCN A;  2DZM A;  3QC8 B;  1S3S G;  1E8Z A;  4AJY B;  4GDL B;  3M95 A;  4ICU A;  3BIN A;  4NQK E;  4ANW A;  1C1Y B;  4FAD A;  1M94 A;  1UGM A;  2N7D A;  3ZNH B;  3MHS D;  1WZ0 A;  4MJS A;  2K8H A;  3H9D A;  4FHK A;  4TKN A;  2KNB A;  2UYZ B;  5LXI B;  3ZO5 B;  2N9P C;  4HLE A;  5AZG A;  2BF8 B;  1ZW7 A;  3A1Q A;  1V81 A;  2D10 A;  3KUZ A;  4TV3 A;  3AXC A;  3K9P B;  3SDL C;  3PSE B;  1YQB A;  3DDC B;  2MBE A;  4ZRI A;  4F8C B;  1I35 A;  2EMS A;  4MSM B;  2WDT B;  2N4F A;  3RUI B;  1OTR B;  4DHZ E;  3KYC D;  2J0M A;  4K7W A;  4GGQ A;  4KIK A;  2V4L A;  4I6N B;  4B9K A;  3KUC B;  3TMP B;  3WAN A;  2IZV B;  5CX3 A;  4MGI E;  2DHZ A;  4W9G A;  2I1K A;  2M1M A;  1GUA B;  4MSQ B;  2KJ6 A;  4DK5 A;  3ZDM C;  2XEW A;  4IM0 A;  3ZTC A;  4HWI B;  4NJ6 A;  5JHB A;  5TR5 A;  2GBM A;  1YX6 B;  4ICV A;  1WF9 A;  1XD3 B;  3VAW A;  4FJZ A;  3R7R A;  2MA9 B;  3X23 A;  1OQY A;  1IP9 A;  2LGX A;  1L2N A;  3A1Q B;  2C9W B;  1E8W A;  4PYU A;  3IFW B;  3DVN U;  2KMA A;  3HM6 X;  3K9O B;  4WWP A;  5JH5 C;  2D11 A;  4NAW A;  4GDK A;  3WAL A;  4BKG A;  2JZZ A;  4EUT A;  2MRP A;  1LXD A;  2J0J A;  2KQS A;  3VH3 B;  4J6I A;  4HCN B;  3U7D A;  1V80 A;  2KWV B;  1WR6 E;  2O6V B;  1H4R A;  5JHA A;  4FUL A;  3ZTD A;  3GZN I;  2MQJ A;  1UEL A;  3NZS A;  2N1V A;  4IUM B;  3ZRF A;  4E3C A;  4HVB A;  4NY0 A;  5E6O A;  3PRE A;  4I6P A;  2G45 B;  2AWT A;  2LJ5 A;  2L76 A;  1WGD A;  3ZIM A;  3JSV A;  1H8C A;  4EKU A;  3N32 A;  4CHK A;  2KZR A;  3RT3 B;  3H7P B;  1WX9 A;  3S2A A;  2DX5 B;  2PPH A;  1SGH A;  2GMI C;  2ASQ A;  4K81 A;  1S1Q B;  3RZF A; 
#chains in the Genus database with same CATH topology
 3WIM A;  2KX3 A;  5AEK B;  2KDB A;  3V61 A;  1LM8 B;  3Q3F A;  1TT5 B;  1GG3 A;  1QKZ A;  2W3S A;  5BO4 B;  4LNO A;  1HA5 A;  1PQS A;  2N9K A;  1UBI A;  2QCZ A;  2MBB B;  2INC C;  2ZCC A;  1J7B A;  1WMH B;  4PS3 A;  4C56 C;  2L8J A;  3UGB B;  3ZYY X;  1DGJ A;  2HJ8 A;  3ML9 A;  3VRA B;  1FD6 A;  5T8I A;  2IGH A;  4W9H A;  2NPT A;  2PKO A;  4FA6 A;  2ZVO A;  1T0Q C;  4LNK A;  4NNJ B;  3GZN B;  3I57 A;  4MT5 A;  3VTW A;  4JQW C;  1Y56 A;  4XYC A;  2CU1 A;  2OJR A;  5LLI A;  3LDZ E;  2CJO A;  3AE5 B;  4GN1 A;  3HM3 A;  4BOS C;  4N59 A;  2G1E A;  5D6J B;  1FPY A;  1WX7 A;  1XLO A;  3FIL B;  3EFU A;  4OVV A;  4FJY A;  1AN8 A;  2D3A A;  4L1B A;  4WWO A;  4D2K A;  4BAX A;  3QK0 A;  4HXD A;  3ZW3 A;  4B0M A;  2RDH A;  4BBN F;  3TEW A;  4L23 A;  2KT7 A;  2K1F A;  3P4S B;  4IKG A;  4HDO A;  4A3O A;  5IOI A;  1U4A A;  2QMT A;  1WI0 A;  2JZ3 B;  1EU3 A;  1T6B X;  2BGF A;  4JGH B;  1KLU D;  3L54 A;  2NBV B;  2BYV E;  4M0W A;  1NYQ A;  4DDG D;  4S0R A;  5D3I B;  4FXC A;  4IC7 B;  1VLB A;  1OGW A;  2N0S B;  3IVF A;  4KVG B;  3NZ3 A;  1ZOY B;  4FHJ A;  1ET6 A;  2L0T A;  4AP4 C;  4KIK B;  3A9J A;  1C76 A;  3Q2A C;  1K50 A;  1Q10 A;  2BTE A;  1I4Q A;  3IBE A;  2TSS A;  3QAR A;  3PT2 B;  2LD9 A;  1N60 A;  2LXA A;  1F0Z A;  1UGJ A;  3IXS A;  3DBR B;  4NAW B;  4OVZ A;  3BVZ A;  3ZXR A;  5HG2 A;  2WX1 A;  5KHQ A;  1D5Z C;  2LFI A;  1VD2 A;  1EF5 A;  1WRD B;  1FIQ A;  4ITK A;  2MJE A;  1N6Z A;  3KW5 B;  2M0X A;  1WM3 A;  3SFD B;  4IWO A;  2I2Y A;  4WAA A;  3NS8 A;  1SE9 A;  3APC A;  1KLV A;  1UF0 A;  3TBL D;  1SE2 A;  4DXG A;  5BMG A;  2MP2 B;  1FNV A;  2C60 A;  1MFW A;  3L13 A;  2C5L C;  2G4D B;  2HDE A;  4BBN C;  2NVU I;  2KTR B;  3Q3J A;  1MI0 A;  3QJZ A;  4RGO S;  2D3G A;  2RD0 A;  1FNU A;  1MG8 A;  4DHZ B;  4H2A A;  3H7S A;  2G4S A;  4II2 B;  4LJP B;  1MJD A;  1NVI D;  1V6E A;  1E90 A;  3AU5 A;  5BYR A;  3SD5 A;  2WX0 A;  4TQ1 A;  3IAS 1;  1QZE A;  4MM3 A;  1MHX A;  2JVC A;  3SFE B;  4HCP B;  4A20 A;  3D32 A;  2L05 A;  2MBO A;  4MGZ E;  3SU8 X;  1GAQ B;  2OHF A;  3CIR B;  3PRZ A;  2GB1 A;  1R4M I;  2AL3 A;  4O1N A;  1XLN A;  3W5V B;  2WWZ A;  1J7C A;  2O6V A;  3U8Z A;  4BVU C;  5DPW A;  2BW2 A;  2PVG C;  3UQA A;  1DOY A;  1IBX A;  3HHM A;  5CTR C;  2MJD A;  1FFV A;  4L2Y A;  4WJO A;  1P1A A;  3ABV B;  5LNK 1;  3O65 B;  3V62 A;  3VDZ A;  1SJE D;  2EKI A;  3RCZ A;  2ZZP B;  4KDI C;  1PGB A;  4PT5 A;  2DYO A;  3H6N A;  4KDL B;  1N63 A;  1RYJ A;  3RPF C;  2RDB C;  2JQR B;  2WXR A;  4HKZ E;  4HEA 1;  4KGT A;  3MJ5 A;  5E6N A;  3P63 A;  5G2N A;  2FCS A;  2C7M B;  3AED B;  4YTM B;  1VZ7 A;  3RMK C;  1L7Y A;  1K53 A;  2RPV A;  1AYF A;  3AI5 A;  3R3M A;  3Q8E A;  3WCQ A;  1WMH A;  3PPA A;  2BWE S;  1FFU A;  1ZUD 2;  2WYQ A;  4PS7 A;  4C4V A;  2IBI B;  4ANX A;  2RPQ A;  3PRM B;  2BT6 A;  4HDQ A;  2HE7 A;  1R4N I;  2FCM A;  3ZNG C;  3PHW B;  3QAQ A;  4WJQ A;  5HKH A;  4AUQ C;  2FIF A;  2IY1 B;  3FIL A;  2HD5 B;  3MTN B;  2K25 A;  2M4N A;  4RH6 A;  4TUU A;  3A4R A;  4YSX B;  4GU2 A;  1FEH A;  1C4A A;  3BK1 A;  1J8C A;  1NI2 A;  1E9M A;  3C19 A;  2LVO A;  5LXH A;  2ONQ A;  2MWS B;  2ACZ B;  3R2T A;  2XK5 B;  1GPX A;  3DHH C;  5IP4 D;  4XZ4 A;  1JRU A;  4GLS C;  4KKI A;  3VVW B;  2N9L A;  2G3Q B;  2NCN A;  3QC8 B;  3Q8F A;  1E7P B;  4ICU A;  2V9H A;  1YMH E;  3BIN A;  2YEP F;  1C1Y B;  1UGM A;  2N7D A;  4ZHO A;  2WXF A;  2K8H A;  3H9D A;  2KNB A;  3W5U B;  5LXI B;  2KQ4 X;  4XWW A;  1RWS A;  2H88 B;  2YEP B;  2VZK D;  3RUI B;  2NTS A;  2V3P A;  2E3T A;  1XLP A;  4KIK A;  2WS3 B;  3WAN A;  2IZV B;  2WDR B;  4MGI E;  2M1M A;  1GUA B;  3FAH A;  4YSY B;  2LJI A;  2PTL A;  4WUR A;  2M19 A;  2AQ2 B;  1AW7 A;  4HWI B;  5TR5 A;  3P4Q B;  2BS2 B;  1TKG A;  3RNF C;  3RNC C;  1JWU D;  1FCC C;  3X23 A;  1OQY A;  3A1Q B;  2C9W B;  1E8W A;  3IFW B;  3HM6 X;  2KMA A;  4RFB A;  4TMA B;  4NAW A;  2K3U A;  4BKG A;  2JZZ A;  4EUT A;  2MRP A;  2J0J A;  4J6I A;  3I9V 1;  3U7D A;  1WR6 E;  4KKJ A;  3GZN I;  5IKC M;  3ZRF A;  2RMM A;  4NY0 A;  2QIL A;  2LJ5 A;  1STE A;  1H8C A;  3N32 A;  4CHK A;  3RZF A;  3Q69 A;  2K5P A;  4GOC A;  3AE6 B;  1K52 A;  1ACC A;  1HZ6 A;  2LI5 A;  4GDK B;  1J7A A;  3URY A;  3MHZ A;  4P1C C;  1JQ4 A;  2NR2 A;  2JZP A;  1PGA A;  3BII D;  2Y3A A;  3NVW A;  1RRB A;  4LDT D;  4C7Y A;  3BYT B;  2LUM A;  2BBC A;  4ZRK A;  3GB1 A;  4G3X B;  1CMX B;  2IPK D;  2V3S A;  4ZYN A;  2KJH B;  1WX8 A;  5BMI A;  4A6Q A;  2MW5 A;  4HPP A;  3RI7 C;  2UU7 A;  1PFD A;  3HUI A;  2DYM A;  4N58 A;  2WXJ A;  1WGG A;  5HHD G;  3KUD B;  4URK A;  4BKS D;  2WU2 B;  3KYD D;  2PW9 A;  2LGS A;  1V8C A;  2WDV B;  2J0K A;  2JYE A;  1F52 A;  1UH6 A;  2H89 B;  2FCN A;  1QOF A;  2D07 B;  2EMT A;  1SB3 C;  4RF0 A;  3N1Y C;  2KLG A;  1SSN A;  3AE3 B;  1E5W A;  2J7Q B;  5HFY A;  1V5O A;  3BZD B;  2JRI B;  4W9F A;  4ASW C;  1I4P A;  4M02 A;  1R7S A;  1P98 A;  1V1P A;  2C7N B;  1FXT B;  1KFY B;  4ARC A;  2KTF A;  3ZJU A;  1WGR A;  3PO0 A;  2V3N A;  3LB8 C;  2AL6 A;  3DBR I;  4IWP A;  4OVU A;  4RCO A;  2FUH B;  3R66 C;  1YN3 A;  3EUB 2;  2GBK A;  1E7U A;  2MBQ A;  1WIA A;  4TQ0 A;  1LO5 D;  2K0P A;  1DYQ A;  1Q1O A;  2IY0 B;  2LXC A;  1TGZ B;  4MJS B;  3KQ4 A;  2L3Z A;  3OLM D;  4X57 B;  5D2M B;  4YL8 A;  1F2R I;  2KYW A;  4KSK C;  1HZ5 A;  2I38 A;  4II3 B;  2LGY A;  4HRS A;  4M01 A;  4XWT A;  3FKY A;  3L4P A;  3TUO A;  3AH7 A;  1BML C;  1JWA D;  4E71 A;  3NS1 A;  2KX0 A;  1ROE A;  3AB5 A;  1K8R B;  1V2Y A;  3CST A;  3V6C B;  3SEB A;  2I1J A;  3AE2 B;  3PZD A;  4JPS A;  4G11 A;  2WXN A;  4DHJ B;  2KO3 A;  2LUE A;  2OED A;  3J9C A;  2L32 A;  1UWX A;  2Z0D B;  2ZPN A;  4K7U A;  2L0F A;  4NAM A;  2K22 A;  4YSZ B;  5FR6 A;  1ZPS A;  2BYT A;  2RSU A;  3B08 A;  2LWP A;  2KC2 A;  4KSL C;  4QAY A;  4EEW A;  1XO3 A;  4C00 A;  2RR9 A;  5JXV A;  2J53 A;  4K3C A;  3ZNI D;  1TZ1 A;  1WWT A;  2IYD B;  4N9F 4;  2K8B A;  2ICI A;  2LRW A;  1HQR D;  2L7R A;  4G0N B;  5CHW A;  1RFK A;  2GBN A;  2WXO A;  5C3J B;  4DWF A;  3VH4 B;  4XDD A;  4A55 A;  3T9L A;  4MH0 E;  2E6X A;  1GNU A;  2WU5 B;  4HJK A;  1E7V A;  4DHJ D;  1UNS A;  1WXV A;  4IM3 A;  3NVZ A;  4WWN A;  1SBB B;  1ZDX A;  1L4D B;  1FM0 D;  1E8Y A;  2DAJ A;  1L6U A;  4MAC A;  5CHF A;  2QIE B;  1QQR A;  1IYF A;  2ZNV B;  3P4R B;  2QDF A;  3TJP A;  4HK2 A;  5L95 C;  1ESF A;  1I7H A;  3TIX A;  3NRZ A;  1F77 A;  1SJH D;  4JE3 B;  3OG5 A;  4DDI D;  4HKQ A;  2BS3 B;  1QLB B;  1FNW A;  5DCN A;  3NY5 A;  1BT0 A;  4LLG M;  2GRI A;  2MH7 A;  4IWQ A;  3FC4 A;  2KN5 A;  4BFR A;  1YN4 A;  3SHQ A;  1MVK A;  3QIJ A;  1V5T A;  3AE8 B;  3APD A;  1XCT L;  4LTU A;  3IG3 A;  1D5X C;  4BKS A;  1HE8 A;  1XLQ A;  3ZJV A;  2MJ3 A;  2CHW A;  3CSF A;  1TZO A;  4TSS A;  1B9R A;  1TS4 A;  3W2D A;  2O2V B;  3HRD D;  1SIF A;  3Q3O C;  4G50 A;  2B3A A;  2REX A;  5AUI A;  5TSS A;  3AEA B;  4WQO B;  4KV2 A;  2JY6 A;  3PTF C;  2KWC A;  2V4I B;  3NHE B;  3IT6 B;  4OW0 A;  2JYT A;  1DOI A;  4WJP A;  4NZL B;  3TEY A;  2UWQ A;  4AJW A;  3GP7 A;  1T0Y A;  3RNE C;  3NOB A;  3RN9 C;  4KGR A;  5EE9 A;  1UZX B;  3U52 E;  3AE1 B;  2GOW A;  3EA6 A;  3T3O A;  2ZNV C;  2KHW B;  3KLS X;  1GB1 A;  2OOB B;  4NJ7 A;  2N9X A;  3TSS A;  2L00 B;  1RAX A;  2RDG A;  2D2Q A;  3VXW A;  1GOZ A;  2JSV X;  2V0G A;  2IO2 B;  5G5G A;  1JWM D;  1NBF C;  3PLV A;  1WR1 A;  3R2I A;  2C7H A;  4RGN A;  5C23 A;  3PHX B;  3TEX A;  1S3S G;  4AJY B;  2XNA C;  4GDL B;  4NQK E;  1TS3 A;  4FAD A;  3V3X A;  3ZNH B;  2DBY A;  3MHS D;  4MJS A;  4TKN A;  3R8B A;  3ZO5 B;  1ZW7 A;  2D10 A;  4HRO A;  4TV3 A;  1MHH E;  3AXC A;  1JW9 D;  2MBE A;  4ZRI A;  4F8C B;  2EMS A;  3HVZ A;  5H92 C;  4DHZ E;  2J0M A;  3N1Z C;  4GGQ A;  2W82 A;  2V4L A;  1I4R A;  4I6N B;  4B9K A;  2BS4 B;  4IM0 A;  3ZTC A;  4NJ6 A;  1VDV A;  2GBM A;  3DWG C;  4EE2 A;  3UI3 A;  4DQO C;  2LGX A;  3AV8 A;  5JH5 C;  3E9S A;  3Q3N C;  4WH4 A;  2KQS A;  1RM6 C;  3KWV A;  2IDY A;  1FRD A;  1V80 A;  1IGD A;  3ZTD A;  2N1V A;  4HVB A;  3U7Z A;  5E6O A;  3PRE A;  4I6P A;  2G45 B;  2AWT A;  4P16 A;  1WGD A;  3ZIM A;  4EKU A;  2KZR A;  3H7P B;  1WX9 A;  3VR9 B;  3LYY A;  1SGH A;  1TKE A;  3BK2 A;  3AM9 A;  2EEL A;  4M8N A;  2LHE A;  1L6V A;  1T3Q A;  3GOE A;  3T8M A;  2K39 A;  1VRA B;  5GMV A;  2G9H D;  1TIF A;  1WFY A;  3Q6B A;  1YNT E;  1FXA A;  2BWF A;  4PS8 A;  2VZK B;  1LFD A;  5D7G A;  1WZ3 A;  2ZEQ A;  2VRR B;  5H8Y E;  4AWJ A;  3RYT A;  4USA A;  2IO1 B;  3P2B A;  1Z2M A;  1QOB A;  1WXS A;  1P0R A;  1UWM A;  4I6L B;  1WJ4 A;  2LZ6 A;  2KOX A;  5C1Z A;  3U4E G;  4NPN A;  2L52 A;  2X8X X;  2JWU A;  3X0W A;  3ZKJ C;  1FO4 A;  2FUG 1;  3L0W B;  4OZA A;  3CMM B;  2XN9 C;  4JWU C;  2HJ1 A;  2QEJ C;  1JWB D;  4OHJ A;  3JYU A;  4ZYS A;  3N9Y C;  4LNI A;  1N62 A;  2ZVN A;  1YX5 B;  4IDI A;  3ENE A;  4UDU C;  3N3K B;  1C3T A;  3B1L X;  1WE6 A;  2AYO B;  3ONS A;  3CWI A;  1SE4 A;  3RD2 A;  2J4X A;  1XF5 L;  2DAF A;  3OJ4 B;  5AZH A;  1NEK B;  2BPS A;  2V1Y A;  2NPT B;  2KVR A;  4OZB A;  2VH1 A;  3MC9 A;  3AN1 A;  1KLG D;  2JXX A;  2O2V A;  2QHO A;  3N1X C;  3VUX A;  1GB4 A;  5J18 A;  2WXH A;  4KZ0 A;  3BVG A;  1SIJ A;  2K6D B;  4LDT B;  1KTK A;  2KAC A;  1FCL A;  5DPT A;  3ZVV A;  1UD7 A;  2SAK A;  3GE3 C;  4BZA A;  2JWZ A;  4IG7 B;  3JW0 X;  2CS4 A;  2K8C A;  3EC8 A;  2YLM A;  3V60 A;  3JVZ X;  2QC8 A;  1I4X A;  1MG4 A;  1RLF A;  2A4Z A;  1L4Z B;  2K9X A;  2LMC A;  4M8M A;  2AEH A;  4P7I A;  3VUY A;  4C80 A;  3B9J A;  2CKH B;  4XGA B;  2JPH A;  2J52 A;  3MP9 A;  1JWS D;  2WXP A;  1A5R A;  1FRR A;  1QOG A;  1EO6 A;  1OQR A;  4KZC A;  3AEC B;  5J2R A;  1QIL A;  2MP2 A;  4GIV A;  3VTU A;  3AUL A;  2CJN A;  4RGM A;  5EDS A;  1JRO A;  1MPE A;  4ZRP A;  3AEG B;  2KTR A;  2AX5 A;  3A9J B;  2KXJ A;  4MGY E;  3V05 A;  1ZKH A;  1R4M B;  1CK1 A;  3APF A;  2ZW0 A;  1C78 A;  4PYZ A;  1SEB D;  1XQQ A;  3QHT A;  1OFF A;  3R7Q A;  2DLB A;  4WAF A;  1CJE A;  3DBL B;  3MFG A;  3QA8 A;  3EHV A;  4EOY A;  1XEE A;  1YD8 U;  5IN7 A;  1VJK A;  4W9I A;  2R2Q A;  3KWL A;  4K1R B;  4RM9 A;  3ZRC A;  3IHP C;  2N7J A;  3AEB B;  1WRI A;  4HPM B;  2JRH A;  4ZDV A;  2MX2 A;  3E56 A;  3AEE B;  3P1M A;  1Q0W B;  3WA0 A;  2EKE C;  1WSP A;  3T3N A;  2IO3 B;  2IND C;  3DOW A;  1P9D U;  1TS5 A;  4XX5 A;  3AMZ A;  2W3R A;  3OWE B;  3TEZ A;  1D5M C;  1ZXH A;  3IAM 1;  2WNM A;  3GS2 A;  5J17 A;  3HIZ A;  2JF5 A;  3HK0 A;  3Q8C A;  3ZUN A;  4A8X C;  2ZCB A;  4JLC A;  5KHO A;  1M4V A;  3Q14 C;  3MC0 B;  1P7F A;  4BOZ B;  3NUH B;  2NTT A;  3AE9 B;  4MDK E;  3ZLZ A;  3M3J A;  2NBW B;  4C7Z A;  1R4N B;  2CHZ A;  1RFA A;  3L16 A;  3SR6 A;  5BMH A;  3LJ3 A;  2PVO D;  2W55 A;  4W9L A;  1ET9 A;  2ZPY A;  3NJT A;  4ACF A;  2FE8 A;  4YXD B;  1WY8 A;  4ANU A;  2BYE A;  2WXL A;  4HJG E;  3EGR A;  4N6E B;  1I4G A;  3QCA A;  1PGX A;  5MPO A;  4S17 A;  3DVN V;  3GE8 C;  1TBE A;  2FNJ B;  2FAZ A;  5EE1 A;  3AE4 B;  2M0A A;  3I63 C;  4RM8 A;  5DPS A;  1NEN B;  3H7P A;  1P3Q U;  3Q8A A;  4M00 A;  1NDD A;  2M8S A;  3DVG Y;  3VQI A;  4EFO A;  3ZGZ A;  2WXM A;  2INP E;  2PMV A;  1XT9 B;  1IPG A;  2BYF A;  2WLB A;  1C4P A;  3KH0 A;  2CHX A;  3O13 A;  2PIA A;  3ECI A;  1CQV A;  3ALB A;  3VR8 B;  4JWS C;  1L0V B;  1IBX B;  3MJW A;  4W9K A;  4CQN A;  3L08 A;  3UIP B;  4NJC A;  2A5U A;  4JIO U;  1EF1 A;  4US8 A;  1YJ1 A;  2KQ7 A;  1GC7 A;  1ZXI A;  2ZJD A;  1N5W A;  1SXT A;  3W1Y A;  4BKT A;  4OZC A;  4HPL B;  4W9E A;  5GXG B;  4E74 A;  4FN2 A;  2Y5P A;  3PGE A;  2DNF A;  2JX5 A;  4MGK E;  1N61 A;  1PDX A;  2XK5 A;  3AU4 A;  2RGF A;  4ZRQ A;  2W54 A;  3CF6 E;  3ZXV A;  2BVC A;  1WXM A;  4GXB A;  2AQ3 B;  2KFK B;  5CHV C;  2KAN A;  1LGR A;  2BQQ A;  4CYE A;  4C4V B;  1JCK B;  1WH3 A;  2WHI A;  3L10 B;  4JX1 C;  1E10 A;  2KN4 A;  3NZU A;  4LNF A;  3A9K B;  4ZRJ A;  2R61 A;  2O6V D;  1HTQ A;  2ON8 A;  3A33 B;  1ZGU B;  3RZW C;  2DZK A;  1SF0 A;  4CO7 A;  1T5X D;  2KMM A;  3BY4 B;  1TKY A;  1PYW D;  4GB9 A;  1WYG A;  2DZM A;  3M95 A;  2PLP A;  4ANW A;  1A70 A;  2L1A A;  1WXQ A;  3DBH B;  1HEZ E;  2UYZ B;  1HXY D;  3ZJT A;  5AZG A;  3A1Q A;  3KUZ A;  1YQB A;  3DDC B;  2WGS A;  3Q3M C;  2WDT B;  2N4F A;  2IJ0 A;  4K7W A;  3PZ7 A;  3KUC B;  1VR9 A;  4AQ7 A;  4W9G A;  2I1K A;  3NVY A;  3ZDM C;  2XEW A;  5JHB A;  4ICV A;  3ZQ4 A;  1WF9 A;  1VZ6 A;  2WP9 B;  3VAW A;  2MA9 B;  4KX6 B;  4PYU A;  2AQ1 B;  3DVN U;  4WWP A;  5FR3 A;  4A9A A;  4GDK A;  4P6V F;  4LNN A;  4DXF A;  1LXD A;  2KWD A;  3VH3 B;  4YWG G;  3C8Y A;  1H4R A;  5JHA A;  3Q8B A;  3NZS A;  4IUM B;  3AE7 B;  2L76 A;  1BXT A;  4WQM A;  3RT3 B;  2BB6 A;  2DX5 B;  2PPH A;  3IT4 B;  4R3D A;  2GMI C;  1SE3 A;  1S1Q B;  4GMV A;  1FXI A;  3PVL A;  4F7Z A;  5FKA C;  2NBU A;  4B0E A;  1JRP A;  2LEK A;  1ZP0 B;  4XC2 A;  3KVF B;  2Z59 B;  2HTM E;  1NI3 A;  3NG0 A;  2KMC A;  2N7E A;  1ISN A;  1T0S C;  2D3C A;  4K7S A;  2NS5 A;  3OJ3 A;  2W9N A;  5IAA C;  1OEY J;  2GI9 A;  1JML A;  1WGH A;  1P7E A;  2WQY B;  1WM2 A;  1FMA D;  1OQQ A;  5D94 A;  5BYQ A;  2LRU A;  4RMA A;  1WGK A;  2KFJ A;  3C0R B;  4W9C A;  2JT4 B;  2MCN B;  1UBQ A;  2CR5 A;  1T0R C;  4K3B A;  4IOI E;  3H1U A;  3RNB C;  1G6J A;  2N9E B;  3PRP B;  1Y8R C;  2DZI A;  2K6Q A;  4ANV A;  2INN E;  3W1S C;  3UQB A;  4J3O D;  1X1M A;  3DWM A;  4RNA A;  2OJW A;  2LGI A;  1I42 A;  3RNA C;  4MEL A;  1L0X B;  2FID A;  2L83 A;  3L17 A;  2GBR A;  1AWD A;  2SEB D;  5E6P A;  2MSE D;  2BKF A;  3EEC A;  2KKC A;  1B1Z A;  3MC8 A;  2N1W A;  4ZHP A;  1WGY A;  2LVP A;  4KGS A;  2J42 A;  2R2O A;  4XE0 A;  3QWZ B;  4ARI A;  3VTV A;  4YTN B;  4B6W A;  3ZNZ B;  4RGT A;  4GSW A;  2Q5W D;  1V1P B;  3DBL I;  4W9J A;  2QSD A;  1XXG A;  3DCG A;  5L83 A;  3PV1 A;  4YTP B;  3DVG X;  2KWU B;  1C79 A;  1TYG B;  2JUO A;  1KOT A;  2Z0E B;  1L5P A;  2KJR A;  1J0G A;  1F2R C;  2M17 A;  5E6J A;  1YJI A;  3ML8 A;  4JL9 A;  1GJZ A;  2PJH A;  4WJN A;  2LGD A;  3M63 B;  3UIN B;  1WJU A;  1WJ6 A;  2KFK A;  1AAR A;  3LXF A;  3UIO B;  1C77 A;  3RUL A;  4DXA B;  3PS6 A;  3WAM A;  2KDM A;  1KRH A;  2MEK A;  2NMQ A;  3A9K A;  4FBJ B;  3TCA A;  1KM7 A;  3BYY B;  1TY2 A;  3JSV B;  4LK0 M;  2XBB C;  2KDF B;  1TTN A;  4FJV B;  1C9F A;  2FCQ A;  3V6E B;  2YVC A;  3P4P B;  3DQV A;  5C2T B;  1E6E B;  3AEF B;  1D4B A;  2KDI A;  4IW0 A;  1WYW B;  5G55 A;  1EWC A;  1V9J A;  3VUW A;  4A90 A;  2KC1 A;  3N20 C;  5JZE B;  3VRB B;  4P1B C;  4LCD E;  2PE9 A;  3VHT C;  1F1H A;  2KD0 A;  1DOX A;  2KDE B;  5EE3 A;  2KVZ A;  1VCB A;  4NQL B;  4WIP A;  1V49 A;  4LJO B;  1E8X A;  2Y5B B;  3VFK A;  4XDC A;  3OAW A;  1YOV B;  1LQB A;  1V86 A;  1N5X A;  5HI1 A;  3W1S A;  2DWQ A;  2D3B A;  2CU3 A;  2DZJ A;  2QJL A;  5IO9 A;  1J19 A;  2HTH A;  4REZ A;  5AUK A;  3NVV A;  2B76 B;  3B0A A;  1YQ4 B;  1YIW A;  2BKR B;  4AOF A;  1CZP A;  2DEN B;  3PLU A;  2BB5 A;  1WJN A;  3P42 A;  1L0Y B;  1Z5S B;  4F1S A;  2LAS A;  3UF8 A;  1UUP A;  1D3Z A;  2WDQ B;  1TJE A;  1E0Z A;  2VH2 A;  2KLC A;  5IA7 A;  3BWU D;  2GBJ A;  4M0W B;  1WXA A;  3DBS A;  3W9C B;  5BYS A;  1VZ8 A;  4B95 A;  2JU6 X;  3N30 A;  1D6E C;  1WE7 A;  5DPR A;  1TS2 A;  4MEM A;  1Q5W B;  4FLH A;  1EM7 A;  4AS1 A;  1KJT A;  1OEY A;  4PK1 A;  4EZK A;  1F9J A;  2WXK A;  1C4C A;  3B2G A;  3M62 B;  3WAO A;  3H8H A;  3A4S C;  4EZJ A;  2PEA A;  3PZ8 A;  4Q2J A;  2LVQ A;  1NYR A;  3DBH I;  4A3P A;  2MHJ A;  2MBH A;  4ZOH C;  2IGD A;  2MLB A;  2ZW1 A;  1V97 A;  1QT9 A;  3TL5 A;  2Y5C A;  3B2F A;  2DYB A;  1K51 A;  5G5H A;  2KK8 A;  3ETR A;  4GDL A;  3WAP A;  1GC6 A;  3QX1 A;  4W9D A;  4EZL A;  5AZF A;  3QQ8 B;  3U30 A;  2X38 A;  4IM2 A;  4DBG A;  4US9 A;  1V1O A;  3I3T B;  3EFC A;  1YQ3 B;  4MH8 A;  3DPD A;  3U2S C;  2IO0 B;  1EUV B;  3ZDT A;  1KH0 A;  1ZDV A;  2PE6 B;  1E8Z A;  5EE0 A;  1KF6 B;  1M94 A;  1WZ0 A;  1YN5 A;  4RF1 A;  4FHK A;  1QOA A;  1I4H A;  2IGG A;  1IUE A;  2N9P C;  4HLE A;  2BF8 B;  1V81 A;  2D5G A;  3K9P B;  3SDL C;  3PSE B;  5I4D A;  1I35 A;  4MSM B;  3RNG C;  4WWM A;  1OTR B;  1BUI C;  3KYC D;  2LHD A;  1YJJ A;  3TMP B;  5CX3 A;  2DHZ A;  4MSQ B;  2KJ6 A;  1ZE3 D;  2M56 B;  4MM3 B;  4DK5 A;  3BVM A;  2GLS A;  1PUT A;  2WXQ A;  1YX6 B;  1XD3 B;  4FJZ A;  3R7R A;  3DHG C;  3I5J C;  2FBW B;  2WXI A;  1IP9 A;  1L2N A;  5D3D A;  1TY0 A;  1QF6 A;  3K9O B;  1HTO A;  2D11 A;  4YT0 B;  1ENF A;  3WAL A;  1JAL A;  1XCQ L;  2WXG A;  3DHI C;  4HCN B;  1EWY C;  5FK9 C;  2KWV B;  2O6V B;  4FUL A;  2Z8L A;  2MQJ A;  1UEL A;  4E3C A;  3RFZ B;  3HVD A;  3JSV A;  1EU4 A;  2KAJ A;  2JXT A;  3S2A A;  1IGC A;  2ASQ A;  4K81 A; 
#chains in the Genus database with same CATH homology
 3WIM A;  2KX3 A;  4GOC A;  4GMV A;  4M8N A;  3PVL A;  3GOE A;  4F7Z A;  5AEK B;  2KDB A;  3T8M A;  2K39 A;  3V61 A;  2LI5 A;  2NBU A;  1LM8 B;  4GDK B;  5GMV A;  3Q3F A;  1GG3 A;  1WFY A;  5BO4 B;  4XC2 A;  3KVF B;  2Z59 B;  2NR2 A;  1PQS A;  2BWF A;  4PS8 A;  1UBI A;  1LFD A;  1RRB A;  4LDT D;  2MBB B;  2KMC A;  2ZCC A;  1WZ3 A;  5D7G A;  1WMH B;  2N7E A;  2VRR B;  2ZEQ A;  1ISN A;  4AWJ A;  4K7S A;  4ZRK A;  2NS5 A;  3OJ3 A;  2W9N A;  4PS3 A;  3RYT A;  5IAA C;  2L8J A;  4G3X B;  1OEY J;  1CMX B;  2IO1 B;  3UGB B;  3P2B A;  2V3S A;  2HJ8 A;  1WGH A;  1WXS A;  1Z2M A;  1P0R A;  3ML9 A;  4ZYN A;  2KJH B;  4I6L B;  1WJ4 A;  1WX8 A;  2LZ6 A;  2KOX A;  4W9H A;  5C1Z A;  2MW5 A;  1WM2 A;  5D94 A;  2NPT A;  2LRU A;  4RMA A;  2KFJ A;  2DYM A;  4FA6 A;  2ZVO A;  3C0R B;  4NPN A;  4NNJ B;  4W9C A;  3X0W A;  1WGG A;  2JT4 B;  3ZKJ C;  3VTW A;  3KUD B;  1UBQ A;  2MCN B;  4JQW C;  4URK A;  3L0W B;  2CR5 A;  4BKS D;  2CU1 A;  2OJR A;  3KYD D;  5LLI A;  3CMM B;  3LDZ E;  4GN1 A;  3HM3 A;  2J0K A;  4BOS C;  5D6J B;  1UH6 A;  3H1U A;  1WX7 A;  2FCN A;  3JYU A;  2D07 B;  3EFU A;  2EMT A;  2ZVN A;  1G6J A;  1YX5 B;  2N9E B;  3PRP B;  1Y8R C;  2KLG A;  3ENE A;  2DZI A;  2K6Q A;  4ANV A;  1E5W A;  2J7Q B;  1V5O A;  4FJY A;  4OVV A;  3W1S C;  3UQB A;  2JRI B;  1X1M A;  3N3K B;  4W9F A;  4ASW C;  3B1L X;  1WE6 A;  2AYO B;  3ONS A;  4WWO A;  1C3T A;  3QK0 A;  3RD2 A;  4HXD A;  1I42 A;  3OJ4 B;  2DAF A;  3ZW3 A;  5AZH A;  1P98 A;  4BBN F;  4MEL A;  2C7N B;  1FXT B;  2BPS A;  2V1Y A;  2NPT B;  2FID A;  2K1F A;  2KTF A;  1WGR A;  3L17 A;  2KVR A;  2GBR A;  5E6P A;  2MSE D;  2BKF A;  3EEC A;  2KKC A;  2AL6 A;  3DBR I;  4HDO A;  4IWP A;  4OVU A;  4A3O A;  1U4A A;  2FUH B;  3R66 C;  1WI0 A;  2JZ3 B;  2N1W A;  1WGY A;  2LVP A;  2JXX A;  2O2V A;  2BGF A;  2GBK A;  4JGH B;  2QHO A;  3L54 A;  3VUX A;  2NBV B;  2R2O A;  1E7U A;  2BYV E;  1WIA A;  2MBQ A;  4TQ0 A;  5J18 A;  4KZ0 A;  4DDG D;  1Q1O A;  2IY0 B;  2LXC A;  3QWZ B;  1TGZ B;  4MJS B;  2K6D B;  2L3Z A;  4LDT B;  3OLM D;  4X57 B;  5DPT A;  3ZVV A;  1UD7 A;  5D2M B;  3VTV A;  4YL8 A;  4IC7 B;  4KSK C;  4B6W A;  3ZNZ B;  4GSW A;  1OGW A;  2JWZ A;  4IG7 B;  3IVF A;  3DBL I;  3JW0 X;  4II3 B;  2LGY A;  4KVG B;  4W9J A;  2K8C A;  2CS4 A;  3EC8 A;  2YLM A;  3V60 A;  3JVZ X;  4FHJ A;  2L0T A;  3DCG A;  4AP4 C;  5L83 A;  1RLF A;  3PV1 A;  2A4Z A;  3DVG X;  4KIK B;  2KWU B;  2JUO A;  3A9J A;  2Z0E B;  1KOT A;  2KJR A;  1J0G A;  4M8M A;  2AEH A;  4P7I A;  3VUY A;  4E71 A;  2M17 A;  2KX0 A;  2CKH B;  3IBE A;  1K8R B;  3QAR A;  1V2Y A;  3PT2 B;  3CST A;  2JPH A;  3V6C B;  2LD9 A;  3ML8 A;  4JL9 A;  1GJZ A;  1A5R A;  2PJH A;  4WJN A;  2LGD A;  2I1J A;  3PZD A;  3M63 B;  4G11 A;  4DHJ B;  2LXA A;  2KO3 A;  2LUE A;  1EO6 A;  4KZC A;  3UIN B;  2Z0D B;  1WJU A;  2ZPN A;  4K7U A;  5J2R A;  2MP2 A;  4GIV A;  3VTU A;  2L0F A;  3AUL A;  4NAW B;  1WJ6 A;  2KFK A;  1AAR A;  5FR6 A;  3UIO B;  5EDS A;  2RSU A;  2WX1 A;  3B08 A;  3RUL A;  2KTR A;  2LWP A;  5KHQ A;  2KC2 A;  3A9J B;  2KXJ A;  4MGY E;  1ZKH A;  1VD2 A;  4DXA B;  1EF5 A;  3PS6 A;  1WRD B;  4KSL C;  3WAM A;  4EEW A;  3APF A;  4PYZ A;  3A9K A;  3KW5 B;  2M0X A;  2RR9 A;  3TCA A;  4FBJ B;  1XQQ A;  3ZNI D;  1KM7 A;  1WM3 A;  1TZ1 A;  3JSV B;  3QHT A;  2XBB C;  2KDF B;  2IYD B;  4IWO A;  3R7Q A;  1TTN A;  4FJV B;  4WAA A;  3NS8 A;  2FCQ A;  1SE9 A;  4N9F 4;  3V6E B;  2YVC A;  2K8B A;  3QA8 A;  3APC A;  3EHV A;  2LRW A;  3DQV A;  1KLV A;  2L7R A;  4G0N B;  3TBL D;  4EOY A;  1YD8 U;  5CHW A;  2KDI A;  2MP2 B;  2C60 A;  2GBN A;  3L13 A;  2C5L C;  4W9I A;  2R2Q A;  2G4D B;  3VH4 B;  4DWF A;  4K1R B;  4RM9 A;  4BBN C;  3ZRC A;  4IW0 A;  1WYW B;  5G55 A;  3IHP C;  2NVU I;  2KTR B;  3T9L A;  3Q3J A;  3QJZ A;  4MH0 E;  1GNU A;  4HPM B;  2JRH A;  4HJK A;  4ZDV A;  2MX2 A;  1E7V A;  4DHJ D;  2D3G A;  2RD0 A;  1V9J A;  1Q0W B;  3VUW A;  3WA0 A;  1MG8 A;  2KC1 A;  1WXV A;  2EKE C;  4DHZ B;  5JZE B;  4IM3 A;  3H7S A;  2IO3 B;  4WWN A;  4LCD E;  2G4S A;  2PE9 A;  3DOW A;  1P9D U;  4II2 B;  4LJP B;  3VHT C;  4XX5 A;  1V6E A;  1E90 A;  1E8Y A;  2KD0 A;  3AU5 A;  3SD5 A;  2DAJ A;  2KDE B;  2WX0 A;  4TQ1 A;  1VCB A;  5CHF A;  5J17 A;  3HIZ A;  4NQL B;  2ZNV B;  1IYF A;  2JF5 A;  1V49 A;  1QZE A;  3HK0 A;  4LJO B;  3ZUN A;  2ZCB A;  4MM3 A;  3TJP A;  4JLC A;  2JVC A;  4HK2 A;  1E8X A;  5KHO A;  5L95 C;  2Y5B B;  4HCP B;  4A20 A;  4BOZ B;  3D32 A;  3VFK A;  2L05 A;  4MDK E;  3TIX A;  3M3J A;  2MBO A;  3OAW A;  3ZLZ A;  4MGZ E;  3SU8 X;  1LQB A;  2NBW B;  1V86 A;  2CHZ A;  1RFA A;  3L16 A;  3W1S A;  3LJ3 A;  4DDI D;  4W9L A;  3PRZ A;  1R4M I;  2ZPY A;  2DZJ A;  1J19 A;  2AL3 A;  5DCN A;  2HTH A;  3NY5 A;  1BT0 A;  2WWZ A;  1WY8 A;  3B0A A;  4IWQ A;  4ANU A;  2BYE A;  2O6V A;  1YIW A;  2BKR B;  3QCA A;  3U8Z A;  4BVU C;  5DPW A;  2KN5 A;  4BFR A;  3UQA A;  4AOF A;  3HHM A;  5CTR C;  2DEN B;  3PLU A;  3SHQ A;  3DVN V;  1WJN A;  4WJO A;  3QIJ A;  1TBE A;  1V5T A;  3APD A;  1P1A A;  1Z5S B;  4F1S A;  3IG3 A;  2FNJ B;  2LAS A;  3UF8 A;  2FAZ A;  1HE8 A;  4BKS A;  2CHW A;  3O65 B;  4RM8 A;  5DPS A;  1D3Z A;  3V62 A;  3CSF A;  3VDZ A;  3H7P A;  1P3Q U;  3RCZ A;  2ZZP B;  4KDI C;  1NDD A;  2M8S A;  2KLC A;  5IA7 A;  2O2V B;  2DYO A;  3DVG Y;  3H6N A;  3VQI A;  1SIF A;  4KDL B;  4EFO A;  2GBJ A;  4M0W B;  1WXA A;  4G50 A;  3DBS A;  2B3A A;  2REX A;  5E6N A;  1XT9 B;  5G2N A;  2FCS A;  2C7M B;  4WQO B;  4KV2 A;  1IPG A;  2BYF A;  4B95 A;  2CHX A;  2JY6 A;  3KH0 A;  3N30 A;  3PTF C;  1WE7 A;  2KWC A;  3ALB A;  3ECI A;  4MEM A;  5DPR A;  1L7Y A;  1Q5W B;  3MJW A;  4W9K A;  3L08 A;  4FLH A;  3AI5 A;  3NHE B;  1KJT A;  1OEY A;  3R3M A;  3UIP B;  2A5U A;  1WMH A;  4JIO U;  4EZK A;  1EF1 A;  1F9J A;  3PPA A;  1YJ1 A;  2BWE S;  4WJP A;  2WYQ A;  3M62 B;  2KQ7 A;  3WAO A;  1GC7 A;  4PS7 A;  2IBI B;  2UWQ A;  4ANX A;  4AJW A;  2RPQ A;  3A4S C;  2ZJD A;  3W1Y A;  3PRM B;  4BKT A;  1T0Y A;  4HPL B;  4HDQ A;  4EZJ A;  2PEA A;  2HE7 A;  4W9E A;  3NOB A;  4E74 A;  1R4N I;  2LVQ A;  3DBH I;  4A3P A;  2FCM A;  4FN2 A;  1UZX B;  2MBH A;  3ZNG C;  3PHW B;  2MLB A;  3QAQ A;  4WJQ A;  5HKH A;  3PGE A;  2GOW A;  4AUQ C;  2FIF A;  4MGK E;  3AU4 A;  2ZNV C;  2IY1 B;  2XK5 A;  2KHW B;  2RGF A;  3CF6 E;  2OOB B;  4NJ7 A;  1WXM A;  2N9X A;  3TL5 A;  4GXB A;  2DYB A;  2KFK B;  5CHV C;  2KK8 A;  2KAN A;  2HD5 B;  3MTN B;  4GDL A;  2L00 B;  1GC6 A;  1RAX A;  3QX1 A;  4W9D A;  2K25 A;  3WAP A;  4CYE A;  4EZL A;  2D2Q A;  2M4N A;  3VXW A;  5AZF A;  4TUU A;  1WH3 A;  3L10 B;  3QQ8 B;  3U30 A;  3NZU A;  3A4R A;  2IO2 B;  3A9K B;  4ZRJ A;  4GU2 A;  1NBF C;  2O6V D;  3PLV A;  4IM2 A;  3A33 B;  1WR1 A;  4DBG A;  1ZGU B;  2C7H A;  1J8C A;  1NI2 A;  3RZW C;  2DZK A;  5LXH A;  2LVO A;  3I3T B;  4CO7 A;  2MWS B;  2XK5 B;  3BY4 B;  3DPD A;  2IO0 B;  1EUV B;  5C23 A;  3ZDT A;  4XZ4 A;  1JRU A;  2PE6 B;  3PHX B;  3VVW B;  4GB9 A;  2G3Q B;  2NCN A;  2DZM A;  3QC8 B;  1S3S G;  1E8Z A;  4AJY B;  4GDL B;  3M95 A;  4ICU A;  3BIN A;  4NQK E;  4ANW A;  1C1Y B;  4FAD A;  1M94 A;  1UGM A;  2N7D A;  3ZNH B;  3MHS D;  1WZ0 A;  4MJS A;  2K8H A;  3H9D A;  4FHK A;  4TKN A;  2KNB A;  2UYZ B;  5LXI B;  3ZO5 B;  2N9P C;  4HLE A;  5AZG A;  2BF8 B;  1ZW7 A;  3A1Q A;  1V81 A;  2D10 A;  3KUZ A;  4TV3 A;  3AXC A;  3K9P B;  3SDL C;  3PSE B;  1YQB A;  3DDC B;  2MBE A;  4ZRI A;  4F8C B;  1I35 A;  2EMS A;  4MSM B;  2WDT B;  2N4F A;  3RUI B;  1OTR B;  4DHZ E;  3KYC D;  2J0M A;  4K7W A;  4GGQ A;  4KIK A;  2V4L A;  4I6N B;  4B9K A;  3KUC B;  3TMP B;  3WAN A;  2IZV B;  5CX3 A;  4MGI E;  2DHZ A;  4W9G A;  2I1K A;  2M1M A;  1GUA B;  4MSQ B;  2KJ6 A;  4DK5 A;  3ZDM C;  2XEW A;  4IM0 A;  3ZTC A;  4HWI B;  4NJ6 A;  5JHB A;  5TR5 A;  2GBM A;  1YX6 B;  4ICV A;  1WF9 A;  1XD3 B;  3VAW A;  4FJZ A;  3R7R A;  2MA9 B;  3X23 A;  1OQY A;  1IP9 A;  2LGX A;  1L2N A;  3A1Q B;  2C9W B;  1E8W A;  4PYU A;  3IFW B;  3DVN U;  2KMA A;  3HM6 X;  3K9O B;  4WWP A;  5JH5 C;  2D11 A;  4NAW A;  4GDK A;  3WAL A;  4BKG A;  2JZZ A;  4EUT A;  2MRP A;  1LXD A;  2J0J A;  2KQS A;  3VH3 B;  4J6I A;  4HCN B;  3U7D A;  1V80 A;  2KWV B;  1WR6 E;  2O6V B;  1H4R A;  5JHA A;  4FUL A;  3ZTD A;  3GZN I;  2MQJ A;  1UEL A;  3NZS A;  2N1V A;  4IUM B;  3ZRF A;  4E3C A;  4HVB A;  4NY0 A;  5E6O A;  3PRE A;  4I6P A;  2G45 B;  2AWT A;  2LJ5 A;  2L76 A;  1WGD A;  3ZIM A;  3JSV A;  1H8C A;  4EKU A;  3N32 A;  4CHK A;  2KZR A;  3RT3 B;  3H7P B;  1WX9 A;  3S2A A;  2DX5 B;  2PPH A;  1SGH A;  2GMI C;  2ASQ A;  4K81 A;  1S1Q B;  3RZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...