2K22A

Automated nmr structure of the ta0895 by fapsy
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
MVTVRYYATLRPITKKKEETFNGISKISELLERLKVEYGSEFTKQMYDGNNLFKNVIILVNGNNITSMKGLDTEIKDDDKIDLFPPVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein Ta0895
publication title Automated NMR Structure of the TA0895 by FAPSY
rcsb
source organism Thermoplasma acidophilum
molecule tags Unknown function
total genus 10
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k22A00
5EE1A 3NVZA 1PFDA 3NVVA 2W54A 2BS4B 4HRSA 1A70A 4US8A 3ZYYX 1QOBA 3B2GA 4A9AA 1DOXA 1FRRA 4KX6B 3AE8B 3AEDB 1RYJA 4YSXB 1FFUA 3B2FA 2B76B 3VR9B 3AMZA 1KFYB 2WDVB 5C2TB 3SR6A 3VRAB 1QOFA 1TKEA 2OHFA 4WWMA 2WDQB 1JALA 1FXIA 1L6UA 3AEFB 2Q5WD 3AEBB 1GPXA 5G5HA 1E7PB 1RM6C 5GXGB 1F0ZA 4IDIA 3DWMA 3AE2B 4YSZB 4YTNB 3P4PB 1J7BA 3NVYA 3P1MA 1FIQA 3AECB 1TKGA 4ZOHC 1QF6A 1FXAA 1IUEA 4JX1C 1B9RA 4C80A 5C3JB 5MPOA 1JW9D 3SFDB 4YTMB 4ZHOA 1L0VB 3PO0A 3W9CB 2G1EA 1SB3C 1N5XA 1WWTA 3AEAB 2Y5CA 4N6EB 1AWDA 1TYGB 1GAQB 1V97A 2WU5B 3HRDD 3AE1B 4WQMA 4ZHPA 1OQRA 2HTME 3DWGC 2MJ3A 1OFFA 3AE5B 1WGKA 1DGJA 1TKYA 3LB8C 1DOYA 3B9JA 1ROEA 2L83A 3L4PA 2ACZB 4US9A 3AB5A 1ZP0B 1T3QA 1YJIA 2H89B 3AE7B 3W5UB 1UWMA 2WDRB 1R7SA 3P4QB 3ABVB 1NENB 1L5PA 1L6VA 1XLNA 1NI3A 1I7HA 1WXQA 1E9MA 1N62A 3P4RB 1PUTA 3NS1A 5AUKA 4C7YA 3P4SB 2JQRB 1ZUD2 3AH7A 3RPFC 2LEKA 3HUIA 1EWYC 1N5WA 2W3RA 3AEGB 1E6EB 2W55A 1YJJA 4USAA 3CIRB 2N0SB 1KF6B 1NEKB 1NYRA 1XO3A 1QLBB 1WYGA 2M56B 2WP9B 1WRIA 3AV8A 3VR8B 2EKIA 2QJLA 1FFVA 2KAJA 4HROA 1J7CA 5EE9A 2H88B 2KMMA 1SIJA 1JRPA 3AM9A 1YQ4B 2WU2B 3SFEB 1QOGA 2CJOA 2WS3B 2FBWB 2JX5A 4P6VF 4JWUC 1E10A 2PVGC 1JWBD 4JWSC 3P63A 1JWAD 1YQ3B 1VDVA 1NYQA 3FAHA 3NRZA 2MH7A 3VRBB 1VLBA 3AE9B 2M19A 2MJDA 5H8YE 1XLQA 2AX5A 2CJNA 2BS2B 4ITKA 4FXCA 4YT0B 4YXDB 2PIAA 3WCQA 3CWIA 1OQQA 1RWSA 1AYFA 1V8CA 3AE3B 1KRHA 1CJEA 1PDXA 5AUIA 2PVOD 1VJKA 3LXFA 1JQ4A 3NVWA 1FMAD 3HVZA 2DBYA 1JROA 5EE0A 5H92C 1N61A 4C7ZA 2BS3B 3KWLA 1XLOA 1J7AA 1FRDA 1QOAA 4YTPB 3FC4A 2DWQA 2MJEA 2E3TA 2QIEB 3BIID 1N63A 1RFKA 1ZXIA 2L52A 1XLPA 2WLBA 4YSYB 2BT6A 1SF0A 5G5GA 1QT9A 1E0ZA 3AN1A 2K9XA 1N60A 1FO4A 1TJEA 2W3SA 2K5PA 3W5VB 3EUB2 5EE3A 4N58A 3AEEB 4N59A 2CU3A 1ZOYB 1NVID 2PKOA 3AE4B 1FM0D 3AE6B 4LTUA 1CZPA 3ETRA 2WQYB 1DOIA 2K22A
chains in the Genus database with same CATH superfamily
1UF0A 1GC7A 4K7UA 2EMTA 4A9AA 1DOXA 3UI3A 2WGSA 3A4SC 4HDQA 3AMZA 4BVUC 4BKTA 3MJ5A 1TT5B 4KIKA 3BYTB 3VQIA 4IDIA 1I4XA 2MP2B 2WHIA 3P1MA 1UBQA 1QF6A 3DVGX 3KUCB 3SFDB 2G1EA 5BYRA 1OTRB 2AWTA 4HJKA 1FXTB 3N9YC 4CHKA 2IGDA 3PLUA 3WAOA 1WR6E 3P4SB 4HK2A 3RYTA 2L1AA 1J0GA 3ZJTA 1ENFA 4QAYA 4NAMA 2EKIA 1Y56A 1F2RI 2RMMA 2FCNA 2RPVA 1SIJA 2C7MB 2DNFA 3MHSD 1GG3A 3FKYA 2G9HD 2JX5A 3UQAA 2GMIC 2KQSA 4MGYE 3NRZA 2Z59B 3H7PB 1VLBA 3JW0X 2BS2B 4FHJA 3JSVA 2IGHA 4DBGA 1KTKA 3NY5A 2NPTA 4NAWA 3HVZA 3WAMA 1GOZA 1C79A 4S17A 4W9JA 4BKGA 2PLPA 5DCNA 1N60A 1MHXA 1JWSD 1WJNA 1EU4A 4N59A 4AJYB 4A55A 5EDSA 2PTLA 2DYBA 3N32A 1FRRA 4TQ0A 3B2FA 2WXHA 4DXGA 2INPE 1XD3B 4PS3A 2C5LC 4BKSD 3NVYA 1ZXHA 2PW9A 4ZOHC 1GB1A 5MPOA 1L0VB 2NTSA 4N6EB 2BYVE 2JYTA 1GAQB 2D5GA 2KZRA 3RCZA 3I9V1 1SSNA 1WSPA 5CX3A 4ZRJA 2O2VA 2KLCA 4RGTA 2K0PA 4ANUA 1PGBA 1I7HA 2IY0B 5T8IA 1FEHA 5BYSA 5JH5C 4PYUA 3OG5A 1E6EB 2JZPA 3RULA 2K6QA 4ICUA 4OVUA 1V80A 2BBCA 2KLGA 2WYQA 3I3TB 4JWSC 5JXVA 2N9LA 1C9FA 3ZDMC 3DBHB 2CJNA 1V1PA 1P1AA 4LLGM 4FA6A 3HM6X 1GJZA 4CO7A 4DWFA 3AE3B 5AUIA 2OJWA 3NVWA 4P1BC 1FMAD 2KOXA 3ZW3A 1HXYD 1UH6A 2RDGA 3IVFA 4LTUA 3BIID 1XLPA 4EZJA 3GS2A 4B6WA 3Q14C 3RNCC 3A1QB 2KFKA 3M62B 5BMIA 2D10A 1PFDA 2L32A 3EC8A 1WGGA 2AL6A 3VR9B 3L10B 3H8HA 3R3MA 1TKEA 5G5HA 1C4CA 3PS6A 5HKHA 3ZQ4A 4B0EA 3ZXVA 3KYCD 2RD0A 5AZFA 1I4GA 2K1FA 2MJ3A 2MW5A 4GDLA 3LB8C 1F2RC 1Y8RC 1PQSA 3V05A 2VH1A 5G55A 3GE8C 1XCTL 1SXTA 3AH7A 4WQOB 4RGOS 4IM0A 2ZEQA 3PHWB 2AYOB 2WDTB 2XEWA 3H9DA 1J7CA 1SE4A 5EE9A 1LQBA 3K9OB 3R2IA 1KLVA 1YQ4B 3RNGC 2AQ3B 4DK5A 2INDC 1OQYA 1T0SC 2J42A 4EFOA 1JWAD 1D5MC 4X57B 3I63C 4BZAA 3QK0A 3UIPB 1YJ1A 3DVNV 3QWZB 2IZVB 3O65B 1N63A 4TV3A 3NZUA 2BT6A 3PTFC 5FKAC 4ICVA 4N58A 1WFYA 3PPAA 1JCKB 1NDDA 1ZW7A 1WE7A 2D2QA 4EEWA 5HI1A 3AE8B 5G2NA 4RNAA 1VZ7A 5HFYA 1TBEA 2MQJA 1A5RA 3Q3MC 2W9NA 4RF0A 3DWMA 3EGRA 1T0RC 4MJSA 4J3OD 4OVVA 3QQ8B 2GB1A 2XN9C 2O6VD 4C80A 2GOWA 2G3QB 1K53A 4JPSA 4BFRA 1SB3C 1WWTA 3M63B 4TUUA 4F7ZA 4KKJA 4CYEA 4NPNA 2NVUI 2QEJC 2NCNA 3W5UB 1UWMA 2WXNA 1WE6A 2WDRB 3ABVB 3KWVA 3Q6BA 5CHVC 3TBLD 3A9JB 2MCNB 4MGZE 2D3AA 5HG2A 3OJ3A 1FCLA 2IY1B 2LEKA 1N5WA 3EFUA 2RSUA 1M94A 1WRIA 2JU6X 4KKIA 4KGSA 3N1XC 2Z0DB 3U2SC 2WU2B 2N7DA 1YN4A 3ML8A 1JWBD 4DHJB 3PRPB 2KVRA 2JZ3B 3LYYA 3EECA 4YXDB 4ZRIA 2G4SA 2JSVX 1E90A 2BWFA 1WM3A 1VJKA 1ZDVA 2UU7A 2QSDA 1JROA 4KVGB 2QHOA 1N61A 2KQ7A 2N9EB 1V2YA 2E3TA 4YSYB 3TMPB 1LGRA 1RFKA 2L52A 3QIJA 1AN8A 1UUPA 2PE9A 1ISNA 3BVMA 2KTFA 1WXMA 2K5PA 3R66C 3IHPC 3AE6B 3U7DA 3RZFA 4BOZB 2KAJA 2KJ6A 1WH3A 3NVVA 2ZVNA 4LK0M 4F1SA 4BBNC 5LXIB 3SR6A 1QOFA 3JVZX 2LGDA 3AEFB 3RMKC 3QJZA 4DQOC 2BF8B 5JHAA 3AE2B 3U30A 1D5XC 2JZZA 4IWQA 3UQBA 1JW9D 2C7HA 4GMVA 5AEKB 2KWCA 1T0YA 2MRPA 3CMMB 2O6VB 1RFAA 4E71A 2JY6A 3PZDA 3NUHB 2H89B 4A3OA 3RT3B 2INCC 1DYQA 4XGAB 4M8NA 5LXHA 1XLNA 2VZKD 2XNAC 3FILB 1NI3A 4YL8A 1PUTA 3X0WA 3ZVVA 3MC9A 2PMVA 3EHVA 4KDIC 3HUIA 3DHGC 1XO3A 3DDCB 4M01A 4RCOA 2K8CA 1ZE3D 4KV2A 1V5TA 1MPEA 2JWZA 3DHHC 1L7YA 2N9XA 2BPSA 3L54A 4ANWA 1SIFA 2V4IB 2FUG1 3R7RA 2GBJA 3LDZE 2PE6B 1AYFA 1WJ6A 4HCPB 2CHXA 1V8CA 3ZO5B 2FIDA 2X8XX 1AW7A 2W82A 2Z8LA 2WXQA 3FC4A 2MJEA 2IO3B 4A90A 4A6QA 5E6OA 1TZOA 2BB5A 1HEZE 5LNK1 3Q8EA 4K7SA 1IP9A 4HXDA 2MSED 2MLBA 2D3CA 3VUYA 2N9KA 5L83A 5D3DA 3GZNB 1G6JA 3Q3JA 1I4HA 2DZJA 5C2TB 4ZRKA 1Q0WB 1HE8A 3Q2AC 3N1YC 3TL5A 3VHTC 4EE2A 2C60A 2RDBC 2LJ5A 4ASWC 2LMCA 5C3JB 3APCA 2KACA 3AEAB 3ZUNA 2PPHA 2N1WA 4MELA 3B1LX 1WIAA 4GDKA 3VFKA 4XYCA 1QKZA 4J6IA 4LNNA 5BO4B 1ESFA 3ZNID 3A1QA 4TSSA 2L05A 5IP4D 2IPKD 2MHJA 1YIWA 4RM8A 2V3SA 5IO9A 3ZJVA 1V86A 4MACA 2D11A 1KLGD 2N7JA 1EWYC 4B9KA 5AZGA 2LRUA 1NYRA 2M1MA 2WP9B 3DBRI 4FJZA 1VZ8A 1F52A 3MC8A 3AM9A 4GSWA 4NZLB 2CJOA 3ZDTA 2WS3B 1GNUA 1QILA 1L0YB 2BYTA 5IKCM 3ZGZA 4B95A 4NJCA 2FUHB 5D7GA 1K52A 2RDHA 4WWOA 4HWIB 1YOVB 3ECIA 1HZ5A 3RN9C 3AN1A 4XE0A 1NI2A 4IC7B 4HPMB 2AQ1B 2DAJA 3GP7A 1F0ZA 3W2DA 2BKFA 4FJVB 5GMVA 4NJ7A 1WY8A 1WGHA 1FFUA 2FCQA 2Y5BB 4GOCA 2L0FA 1S1QB 3A33B 1JALA 3DCGA 3L08A 4JIOU 1RM6C 5GXGB 1ET9A 4YWGG 2C9WB 4YSZB 3P4PB 1UGMA 2KT7A 4IW0A 2I1JA 3QHTA 5TR5A 2EELA 3S2AA 4K81A 1WZ0A 3ZTCA 2C7NB 1OQRA 1OFFA 2LWPA 3L4PA 1KJTA 3TEYA 4RFBA 3KLSX 2KMAA 4DXAB 3VDZA 3NHEB 4PT5A 4ARCA 2AQ2B 3URYA 1HQRD 2DAFA 2M56B 3AV8A 2IO1B 3DQVA 1TY0A 2L8JA 4NY0A 1V1OA 2WXMA 1SJHD 2V9HA 4HLEA 1LM8B 1D3ZA 3AI5A 1UNSA 4RF1A 2OJRA 1VDVA 2MH7A 5L95C 1P98A 2LXCA 1I4PA 4GN1A 4W9IA 2L00B 2LUMA 3T3NA 3B0AA 4TQ1A 1ACCA 4K1RB 1S3SG 2LI5A 1JQ4A 1IYFA 1YN5A 4JE3B 2DENB 3A9JA 3RI7C 1J8CA 2LVPA 2BVCA 2K9XA 3AXCA 2W3SA 3VVWB 2DLBA 1TIFA 2ZCBA 1WJUA 4WJPA 2ZPNA 4HPLB 4LCDE 3NVZA 2Y5PA 2BS4B 1L4ZB 3B2GA 2G45B 3QARA 3Q8BA 2K3UA 3VAWA 1HTQA 1E7UA 3APFA 3X23A 3I5JC 5IA7A 1L6UA 1CMXB 3W1SA 2DX5B 2GRIA 3BVZA 3D32A 3IBEA 1E7PB 3PHXB 4M0WB 2ZNVC 3MTNB 4HDOA 2J0KA 4DHZB 3T8MA 2D3GA 4ANXA 2CS4A 2Y5CA 2I2YA 4IWOA 4XWWA 2IGGA 2HTME 2GBMA 3PVLA 3B9JA 3A9KA 4US9A 2ON8A 1ZP0B 3N20C 2EKEC 2PJHA 3Q8CA 3LJ3A 1XF5L 3RNBC 2K8BA 1R4MB 3PZ7A 3AU4A 3BK2A 3NS1A 3ZXRA 1XXGA 3Q3NC 1H4RA 2JQRB 3RNFC 1FNWA 4FULA 3DBHI 1HA5A 5E6NA 3T9LA 3PT2B 2J52A 4C4VB 4JL9A 3TIXA 1U4AA 2H88B 4A20A 1UELA 4W9FA 4RH6A 3VUWA 3VH4B 4MM3B 2OEDA 2KDBA 4D2KA 5D2MB 3K9PB 2FE8A 2LXAA 3AU5A 3QCAA 3EA6A 2K39A 1D4BA 2O6VA 3ZRCA 1CJEA 1WJ4A 2NBVB 1I35A 4ARIA 4C7ZA 2IO2B 2M0XA 3KQ4A 4MEMA 3FILA 4AOFA 4PYZA 4RMAA 4F8CB 2ICIA 4C56C 4LNKA 2DZKA 2K22A 1IGDA 1EF1A 2E6XA 2ZCCA 4KZCA 4LNOA 2BQQA 3JSVB 2NMQA 3QC8B 3RFZB 3O13A 2B76B 4PS8A 2GLSA 1UBIA 1FXIA 3BY4B 1KM7A 1GUAB 4GIVA 4HCNB 2WXOA 3IXSA 1J19A 3N30A 1N6ZA 4OZBA 1XCQL 1E8ZA 5FK9C 4GLSC 4ZHOA 3PO0A 4JGHB 4MSMB 1N5XA 1C4AA 3PGEA 4E74A 4HKZE 4ZRPA 2KTRB 2KX3A 4AUQC 3AB5A 1T5XD 2HE7A 4W9DA 1MHHE 4TKNA 3ZNZB 1WXQA 3SEBA 1Z5SB 1CK1A 3T3OA 1ZUD2 3PV1A 2BB6A 2KKCA 2N0SB 2MX2A 2K8HA 1D6EC 4HJGE 1H8CA 2XBBC 4HROA 3C19A 2M4NA 3R7QA 4LJOB 3P2BA 2DZIA 2DHZA 4II2B 1P0RA 3VRBB 1WR1A 1XLQA 4II3B 2RR9A 2WXLA 4Q2JA 4O1NA 1EWCA 1JMLA 2MBEA 1J7AA 4W9CA 1FRDA 2QIEB 2MP2A 1V49A 5HHDG 3SHQA 2KJHB 1OEYA 1T0QC 4LNIA 2MBBB 4A3PA 2HJ8A 4KDLB 4L23A 2JVCA 3ZNHB 1MVKA 4US8A 4KGRA 4W9GA 2JYEA 2FAZA 1BT0A 1FD6A 2FIFA 2D3BA 5CTRC 3VRAB 2WDQB 4K3CA 2Q5WD 1Q5WB 1R4NB 1TTNA 1J7BA 2I1KA 3N1ZC 4OZAA 3WANA 1FXAA 4JX1C 3OJ4B 4AJWA 2KFKB 2DYMA 1UD7A 2M8SA 3HRDD 2HJ1A 1ZGUB 4ZYNA 3VTUA 3APDA 3H7PA 5IAAC 2A4ZA 1R7SA 2KHWB 1VZ6A 4RGMA 2JUOA 2JRHA 1V9JA 3M95A 2L0TA 2W55A 5C23A 3HK0A 1X1MA 1TS5A 4R3DA 2INNE 2KJRA 1E7VA 1SE3A 2WXIA 1OGWA 1BXTA 1L4DB 1HZ6A 4AWJA 2M19A 2MJDA 2YVCA 1EUVB 2ASQA 2KN4A 2NBUA 4BBNF 4C00A 3V6CB 1OQQA 1RWSA 2Y3AA 4HKQA 3V6EB 3I57A 3IT6B 3V3XA 1IBXB 2ZW0A 4NQKE 2IO0B 3WCQA 2ZJDA 4K7WA 3TEXA 4IM3A 3DOWA 1YQBA 4OZCA 2CHZA 4MGIE 3Q69A 3DBLB 1WGYA 5FR3A 4KZ0A 2VH2A 1FPYA 2KVZA 3DVNU 3E56A 1EO6A 3B08A 3CSTA 1RYJA 2JPHA 1IPGA 2FNJB 3ONSA 1Q10A 3NZ3A 3N3KB 2M17A 1YNTE 2GBRA 5J18A 1TKGA 1B9RA 3KUDB 3L16A 1XT9B 1FNVA 1AWDA 4WQMA 3TEWA 3NOBA 3DWGC 2JRIB 2RGFA 1TY2A 1T3QA 3KH0A 1KOTA 2HDEA 1LXDA 1NENB 2JXXA 1WMHB 1L0XB 1GC6A 2LGIA 4KSKC 4ZDVA 1Q1OA 3E9SA 3KVFB 3V60A 2NR2A 4W9KA 1WF9A 2KDEB 1FFVA 3NZSA 4IM2A 4M0WA 4OVZA 2KWVB 3SFEB 2L7RA 4JWUC 4P1CC 4WWPA 1B1ZA 2SEBD 1T6BX 2LGYA 2AX5A 3OWEB 4FXCA 1SBBB 2PIAA 4WJOA 3KUZA 1TS4A 4HEA1 2VZKB 3LXFA 2NBWB 1WX7A 2WXRA 2KWUB 1F1HA 5I4DA 1SE9A 1I42A 4I6NB 4YT0B 5G5GA 3GZNI 2WXJA 3MHZA 1QT9A 5E6PA 4BKSA 3W5VB 2BWES 2XK5B 1C78A 2CU3A 4IOIE 1YX5B 4XZ4A 3RZWC 2V3PA 1DOIA 4FN2A 1VCBA 4C4VA 3H6NA 1E5WA 4W9LA 2KXJA 2W54A 1QOBA 2MBHA 5DPSA 2L76A 4MM3A 3BYYB 1RLFA 1JWUD 3VTWA 2YEPF 3PRMB 4TMAB 4MSQB 1RAXA 4YTNB 3HM3A 4DDGD 5KHQA 1WRDB 4LJPB 2WWZA 2GBNA 2G4DB 2ZPYA 4YTMB 3MJWA 1CQVA 1P3QU 1I4RA 3W1SC 4ZHPA 1Z2MA 4XC2A 1ROEA 4GU2A 3V61A 2REXA 2AEHA 1SEBD 4LNFA 3WA0A 1STEA 1EF5A 2B3AA 1SJED 2KX0A 4M02A 2J7QB 3ZJUA 1TS3A 5BYQA 1E9MA 3P4RB 4NQLB 2MA9B 2FCSA 3R8BA 5JZEB 2WNMA 4WWNA 2LGXA 2KYWA 4I6LB 4USAA 1C76A 1P7EA 1I4QA 1M4VA 3TEZA 2J0MA 5LLIA 4W9EA 1C3TA 1QOGA 4FLHA 2FBWB 3H7SA 2V1YA 3PZ8A 4EOYA 5H8YE 2KDFB 3PREA 1WI0A 4BOSC 2V3NA 4ITKA 2KTRA 4DDID 3CWIA 5CHWA 1YD8U 1WX9A 3QX1A 3Q8FA 1KRHA 4WURA 3MC0B 2PVOD 4G50A 2YLMA 2DBYA 1WXVA 1VRAB 1WGRA 2CHWA 1YN3A 2DZMA 2MWSB 4YTPB 2DWQA 3GE3C 2WLBA 2LVOA 1SF0A 4L1BA 3L17A 2UWQA 3SDLC 4WAFA 4FBJB 1NBFC 3AEEB 4UDUC 1ZOYB 1NVID 1FM0D 1UZXB 1CZPA 4WJQA 2BTEA 4N9F4 3W1YA 2M0AA 2KMCA 1AARA 2K25A 3L13A 1JRUA 5AZHA 2KO3A 2LHEA 3DBSA 1E8XA 2LASA 3AEBB 3ZIMA 2EMSA 2LZ6A 1V5OA 3QA8A 3RUIB 3U4EG 2RPQA 2N4FA 3NS8A 3AECB 1IGCA 2IJ0A 3MFGA 4AS1A 3IT4B 4I6PA 5D3IB 2JWUA 4G3XB 1WYWB 1TYGB 2ZZPB 2WU5B 4RGNA 1K50A 2WXFA 1WGKA 4S0RA 2BYEA 2MBOA 2ACZB 1GB4A 2OOBB 2WXPA 4MT5A 4REZA 1YJIA 3JYUA 4MGKE 3WALA 3BZDB 1XQQA 4GB9A 4C7YA 1EM7A 3RPFC 4BAXA 1YJJA 1EU3A 1QLBB 1WYGA 2QJLA 4NJ6A 4PS7A 2WX0A 3UGBB 1VD2A 4MDKE 2BKRB 3ALBA 4GDKB 3SD5A 3VH3B 2R61A 3P63A 4WH4A 4EZLA 4KIKB 1WM2A 4GGQA 3Q3FA 1TGZB 3UINB 2LGSA 4XDCA 1D5ZC 4ANVA 4P16A 1E0ZA 3J9CA 2J0JA 4LDTD 2LD9A 3SU8X 5C1ZA 2WXKA 3C8YA 3ETRA 4G0NB 3DHIC 3PSEB 5EE1A 2KK8A 1RRBA 2CR5A 4HRSA 4WAAA 2ONQA 2JT4B 4KX6B 3WAPA 3AEDB 3QAQA 4YSXB 1KFYB 1YX6B 3P42A 3TSSA 1BUIC 4JLCA 4CQNA 2A5UA 2L3ZA 1FIQA 4XWTA 3IFWB 4RM9A 1R4MI 3W9CB 1IBXA 1WZ3A 1C4PA 5DPRA 1P7FA 1V97A 3BVGA 3AE1B 2CU1A 4DHJD 3AE5B 4GXBA 1DGJA 1TKYA 3U7ZA 2NPTB 4NAWB 1TS2A 3AE7B 3AULA 3Q3OC 3P4QB 5TSSA 3PRZA 2LFIA 1L5PA 2IDYA 2KN5A 2R2OA 1F77A 1UWXA 3U8ZA 3AEGB 2TSSA 2R2QA 2GBKA 1JRPA 3GB1A 2V4LA 4XDDA 4WJNA 1KH0A 4DXFA 3TJPA 3FAHA 4G11A 2MEKA 1TZ1A 3RD2A 1C77A 4EKUA 3ML9A 2IYDB 4H2AA 3HIZA 1SGHA 1PDXA 2PEAA 1PGAA 3TUOA 5EE0A 2LRWA 4M00A 3C0RB 4KGTA 4W9HA 3NJTA 1WMHA 4IG7B 1QOAA 1UGJA 1ZXIA 4AQ7A 4OHJA 3M3JA 5EE3A 2YEPB 2O2VB 1PGXA 3ZKJC 3ZNGC 2QCZA 2WQYB 5E6JA 3VUXA 1FNUA 4LDTB 4A8XC 1A70A 1OEYJ 4URKA 2WDVB 4K3BA 4WWMA 2OHFA 1SE2A 3IAS1 4JQWC 2BGFA 3RNAC 1K8RB 1MJDA 1MFWA 4FADA 3IAM1 2CKHB 4XX5A 1IUEA 2KQ4X 4EUTA 5JHBA 3DPDA 1V1PB 3DVGY 4FJYA 1WGDA 2XK5A 3ENEA 2L83A 3EFCA 4KSLC 2N1VA 2D07B 4PK1A 1F9JA 3ZLZA 1N62A 3H1UA 3UF8A 3U52E 3Q8AA 2W3RA 1MG8A 1C1YB 2KD0A 3CSFA 3CIRB 2N7EA 3GOEA 2ZW1A 4EZKA 5J2RA 5IOIA 4OW0A 1WXSA 1QZEA 3HVDA 3KW5B 3MP9A 1E10A 2QDFA 3A9KB 1YQ3B 1NYQA 4DHZE 3AE9B 3BINA 1LFDA 2HD5B 2K6DB 4IKGA 4B0MA 2FCMA 3CF6E 5BMHA 2QILA 5H92C 2LHDA 3ZTDA 3KWLA 1XLOA 5IN7A 4AP4C 5CHFA 2VRRB 3RNEC 5DPWA 2JF5A 4GDLB 2N9PC 2WX1A 3VXWA 4ZYSA 3ZRFA 2NS5A 2WXGA 1R4NI 2J53A 3ZYYX 3OAWA 3OLMD 1LO5D 4IUMB 1VR9A 2V0GA 2ZVOA 5DPTA 5J17A 4WIPA 1P9DU 2AL3A 2QMTA 4ZRQA 3WIMA 1GPXA 1MI0A 2KDMA 1ZPSA 2Z0EB 1YMHE 2KC1A 2SAKA 1XEEA 1JWMD 4NNJB 5BMGA 2KNBA 1KLUD 1BMLC 1DOYA 2NTTA 3A4RA 2HTHA 4M8MA 1PYWD 3R2TA 1E8WA 3BWUD 1WXAA 1L6VA 4L2YA 5D6JB 4HVBA 5KHOA 4ACFA 3L0WB 3NG0A 4FHKA 3UIOB 2JXTA 1E8YA 5AUKA 2DYOA 1V6EA 1MG4A 1V81A 2KWDA 1KF6B 1NEKB 3VR8B 2LUEA 2KDIA 1QQRA 1WX8A 1HTOA 2KMMA 2ZNVB 4MH8A 3KYDD 2IBIB 4E3CA 2LVQA 2BW2A 4IWPA 4P6VF 3HHMA 2PVGC 2KANA 2UYZB 5D94A 2GI9A 2KC2A 3DBLI 4MH0E 2MBQA 3DBRB 3BK1A 4MJSB 3VTVA 4HPPA 3IG3A 2I38A 2QC8A 1K51A 2J4XA 1FCCC 2BS3B 1ZKHA 4P7IA 3TCAA 5FR6A 1FO4A 1TJEA 1ZDXA 2LJIA 3PLVA 1ET6A 3EUB2 1L2NA 3V62A 2KFJA 2PKOA 3AE4B 2BYFA 2X38A
chains in the Genus database with same CATH topology
1IGDA 2BTEA 2E6XA 2M0AA 3NVVA 4A9AA 1DOXA 2NMQA 3UI3A 3RFZB 3O13A 4LK0M 2B76B 3AMZA 3SR6A 1QOFA 2LHEA 3MJ5A 1FXIA 3BYTB 3AEFB 4DQOC 3AEBB 3VQIA 4IDIA 3AE2B 3U4EG 1I4XA 2WXOA 3P1MA 3AECB 3IXSA 1D5XC 1QF6A 4OZBA 1IGCA 2IJ0A 1XCQL 3MFGA 1JW9D 5FK9C 3SFDB 4GLSC 4AS1A 4ZHOA 3PO0A 3IT4B 5D3IB 2G1EA 1C4AA 1N5XA 2JWUA 5BYRA 4HKZE 1TYGB 2WU5B 4RGNA 4ZRPA 1K50A 2WXFA 3N9YC 1WGKA 2ACZB 1GB4A 2WXPA 3AB5A 4MT5A 1YJIA 1T5XD 2H89B 3NUHB 4REZA 2IGDA 1DYQA 1MHHE 1XLNA 2VZKD 2XNAC 3FILB 3BZDB 1NI3A 1WXQA 3SEBA 1PUTA 4C7YA 1CK1A 3P4SB 2PMVA 1EM7A 3T3OA 1ZUD2 3RPFC 3HUIA 2L1AA 2BB6A 1YJJA 2N0SB 3ZJTA 1ENFA 1XO3A 1EU3A 1D6EC 1QLBB 1WYGA 4HJGE 4NAMA 2EKIA 4RCOA 2QJLA 4HROA 1Y56A 1ZE3D 1F2RI 2RMMA 1MPEA 2RPVA 1SIJA 4GDKB 2G9HD 2JX5A 2R61A 3P63A 4WH4A 3NRZA 3VRBB 1VLBA 1XLQA 2BS2B 2V4IB 2FUG1 2IGHA 1KTKA 1AYFA 2WXLA 1V8CA 4Q2JA 4O1NA 3HVZA 1AW7A 1EWCA 1JMLA 2W82A 2Z8LA 4XDCA 1GOZA 2WXQA 1J7AA 1FRDA 1C79A 1D5ZC 3FC4A 2MJEA 2QIEB 4P16A 4A90A 4A6QA 1E0ZA 3J9CA 2PLPA 5HHDG 1N60A 1TZOA 2BB5A 1HEZE 1MHXA 1JWSD 5LNK1 1EU4A 3Q8EA 4N59A 2WXKA 4A55A 3C8YA 3ETRA 5EE1A 4L23A 2PTLA 1MVKA 2N9KA 4HRSA 4US8A 4KGRA 2ONQA 1FRRA 4KX6B 4TQ0A 3AEDB 5D3DA 4YSXB 3B2FA 2JYEA 2WXHA 4DXGA 1I4HA 2INPE 1FD6A 1KFYB 5C2TB 3VRAB 2WDQB 3P42A 2Q5WD 3TSSA 1BUIC 1J7BA 3NVYA 4CQNA 1FIQA 4EE2A 1ZXHA 2PW9A 4XWTA 4OZAA 4ZOHC 1GB1A 1FXAA 4JX1C 2LMCA 5C3JB 5MPOA 1L0VB 2NTSA 3W9CB 1IBXA 2KACA 3AEAB 1C4PA 4N6EB 2DYMA 2JYTA 1GAQB 1P7FA 1V97A 2D5GA 3AE1B 3BVGA 3HRDD 3I9V1 1SSNA 3AE5B 1WSPA 1DGJA 1TKYA 3U7ZA 4NAWB 1QKZA 1TS2A 1ESFA 3AE7B 4TSSA 1R7SA 3P4QB 5TSSA 4RGTA 2LFIA 1L5PA 2K0PA 1VZ6A 2IPKD 2IDYA 1PGBA 1I7HA 3ZJVA 4RGMA 5T8IA 1FEHA 4MACA 5BYSA 1KLGD 2N7JA 1EWYC 1F77A 1UWXA 3AEGB 1E6EB 2W55A 1NYRA 1TS5A 4R3DA 2JZPA 2WP9B 2INNE 2TSSA 1SE3A 1VZ8A 2BBCA 1JRPA 2WXIA 3AM9A 4NZLB 2CJOA 2WS3B 1BXTA 1QILA 3GB1A 1L0YB 2BYTA 1L4DB 4XDDA 4JWSC 1HZ6A 1KH0A 4DXFA 5JXVA 3ZGZA 2N9LA 3FAHA 1C9FA 2M19A 2MEKA 2MJDA 4NJCA 2CJNA 1V1PA 2KN4A 4LLGM 1C77A 1OQQA 1RWSA 2Y3AA 5D7GA 4HKQA 4H2AA 3AE3B 5AUIA 1PDXA 3I57A 1PGAA 3NVWA 1K52A 1FMAD 3TUOA 2RDHA 3IT6B 5EE0A 4KGTA 3V3XA 1HXYD 1IBXB 2ZW0A 1QOAA 2RDGA 1HZ5A 4LTUA 3BIID 1UGJA 3WCQA 1ZXIA 1XLPA 3TEXA 4AQ7A 3GS2A 3AN1A 4XE0A 4OZCA 4OHJA 3Q69A 5EE3A 2AQ1B 2YEPB 1PGXA 5BMIA 5FR3A 3GP7A 2WQYB 5E6JA 1F0ZA 3W2DA 1FNUA 3E56A 4A8XC 1PFDA 2L32A 1A70A 1RYJA 1FFUA 3VR9B 2WDVB 3H8HA 4WWMA 1TKEA 2OHFA 1SE2A 3IAS1 1JALA 1Q10A 3NZ3A 5G5HA 1RM6C 1YNTE 5GXGB 1ET9A 4YWGG 1C4CA 4YSZB 3P4PB 3ZQ4A 3IAM1 4B0EA 1TKGA 1B9RA 1IUEA 2KQ4X 1FNVA 1I4GA 1AWDA 1V1PB 2EELA 4WQMA 3TEWA 1OQRA 3DWGC 2MJ3A 1OFFA 3LB8C 1F2RC 2L83A 3L4PA 1TY2A 3TEYA 1T3QA 2HDEA 4RFBA 3V05A 1NENB 3KLSX 1L0XB 2LGIA 1N62A 3E9SA 3U52E 1XCTL 1SXTA 3AH7A 3Q8AA 4PT5A 4RGOS 4ARCA 2W3RA 2AQ2B 3URYA 1HQRD 3CIRB 2M56B 3AV8A 1FFVA 1TY0A 1J7CA 1SE4A 2ZW1A 5EE9A 1V1OA 2WXMA 3R2IA 4M0WA 1SJHD 4OVZA 4OW0A 3SFEB 1YQ4B 2AQ3B 3HVDA 3MP9A 4JWUC 1E10A 1UNSA 2J42A 4RF1A 1JWAD 1D5MC 1YQ3B 1VDVA 1B1ZA 1NYQA 2MH7A 1T6BX 2SEBD 3AE9B 1I4PA 2AX5A 2LUMA 3OWEB 4FXCA 1SBBB 4IKGA 3T3NA 2PIAA 4TQ1A 1TS4A 4HEA1 4B0MA 1ACCA 2VZKB 3LXFA 2QILA 5BMHA 1JQ4A 1YN5A 2WXRA 5H92C 2LHDA 3KWLA 1XLOA 5I4DA 4JE3B 4YT0B 1N63A 5G5GA 2BT6A 2WXJA 3MHZA 1QT9A 2K9XA 4GDLB 2W3SA 3W5VB 5FKAC 2DLBA 4N58A 1C78A 4ZYSA 2CU3A 4IOIE 2V3PA 1JCKB 1DOIA 2WXGA 3NVZA 2Y5PA 2J53A 2BS4B 2W54A 1L4ZB 3ZYYX 1QOBA 3B2GA 5HI1A 1LO5D 3AE8B 1VR9A 2V0GA 3Q8BA 4WIPA 2K3UA 4RNAA 3BYYB 1VZ7A 1JWUD 5HFYA 1L6UA 3W1SA 2GRIA 2QMTA 3BVZA 4ZRQA 1GPXA 2YEPF 4TMAB 1E7PB 1MI0A 4RF0A 3DWMA 2KDMA 1ZPSA 3EGRA 4YTNB 1YMHE 4J3OD 2GB1A 2XN9C 4C80A 2SAKA 1K53A 1XEEA 4JPSA 4YTMB 1CQVA 1SB3C 1JWMD 1WWTA 2Y5CA 5BMGA 1I4RA 2I2YA 1KLUD 4XWWA 4KKJA 4ZHPA 2IGGA 2HTME 1BMLC 1DOYA 3B9JA 1ROEA 2NTTA 2QEJC 4US9A 2ON8A 1ZP0B 1PYWD 3W5UB 1UWMA 1SEBD 2WDRB 2WXNA 3ABVB 3KWVA 3Q8CA 3BWUD 1STEA 3R2TA 1L6VA 1XF5L 4L2YA 1SJED 3ZJUA 1TS3A 5BYQA 3PZ7A 1E9MA 3BK2A 3P4RB 3NS1A 1XXGA 2JXTA 5AUKA 5HG2A 2JQRB 1FNWA 2DYOA 3R8BA 1FCLA 2LEKA 1N5WA 1HA5A 2WNMA 2KWDA 4USAA 1KF6B 1NEKB 1C76A 1P7EA 2J52A 1I4QA 1M4VA 1WRIA 3VR8B 2JU6X 4KKIA 3TEZA 4KGSA 1QQRA 2H88B 4RH6A 2KMMA 4MH8A 3U2SC 2WU2B 1QOGA 2BW2A 2FBWB 1YN4A 4P6VF 4MM3B 2OEDA 2PVGC 1JWBD 4D2KA 2GI9A 3PZ8A 2FE8A 5H8YE 2V3NA 4ITKA 3EA6A 3LYYA 4YXDB 3CWIA 1D4BA 3BK1A 2JSVX 3Q8FA 1KRHA 1CJEA 3MC0B 4WURA 2PVOD 1VJKA 1ZDVA 2I38A 2QSDA 1K51A 2DBYA 1JROA 2J4XA 1FCCC 1VRAB 4ARIA 1N61A 4C7ZA 2BS3B 3KQ4A 1YN3A 4YTPB 2DWQA 2E3TA 3FILA 4YSYB 1RFKA 2L52A 2WLBA 1AN8A 1UUPA 1SF0A 4L1BA 1FO4A 3BVMA 1TJEA 1ZDXA 2LJIA 2K5PA 1ET6A 3EUB2 4WAFA 2ICIA 4C56C 3AEEB 4UDUC 1ZOYB 1NVID 2PKOA 3AE4B 1FM0D 3AE6B 1CZPA 2X38A 2KAJA 2K22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE1 A;  3NVZ A;  1PFD A;  3NVV A;  2W54 A;  2BS4 B;  4HRS A;  1A70 A;  4US8 A;  3ZYY X;  1QOB A;  3B2G A;  4A9A A;  1DOX A;  1FRR A;  4KX6 B;  3AE8 B;  3AED B;  1RYJ A;  4YSX B;  1FFU A;  3B2F A;  2B76 B;  3VR9 B;  3AMZ A;  1KFY B;  2WDV B;  5C2T B;  3SR6 A;  3VRA B;  1QOF A;  1TKE A;  2OHF A;  4WWM A;  2WDQ B;  1JAL A;  1FXI A;  1L6U A;  3AEF B;  2Q5W D;  3AEB B;  1GPX A;  5G5H A;  1E7P B;  1RM6 C;  5GXG B;  1F0Z A;  4IDI A;  3DWM A;  3AE2 B;  4YSZ B;  4YTN B;  3P4P B;  1J7B A;  3NVY A;  3P1M A;  1FIQ A;  3AEC B;  1TKG A;  4ZOH C;  1QF6 A;  1FXA A;  1IUE A;  4JX1 C;  1B9R A;  4C80 A;  5C3J B;  5MPO A;  1JW9 D;  3SFD B;  4YTM B;  4ZHO A;  1L0V B;  3PO0 A;  3W9C B;  2G1E A;  1SB3 C;  1N5X A;  1WWT A;  3AEA B;  2Y5C A;  4N6E B;  1AWD A;  1TYG B;  1GAQ B;  1V97 A;  2WU5 B;  3HRD D;  3AE1 B;  4WQM A;  4ZHP A;  1OQR A;  2HTM E;  3DWG C;  2MJ3 A;  1OFF A;  3AE5 B;  1WGK A;  1DGJ A;  1TKY A;  3LB8 C;  1DOY A;  3B9J A;  1ROE A;  2L83 A;  3L4P A;  2ACZ B;  4US9 A;  3AB5 A;  1ZP0 B;  1T3Q A;  1YJI A;  2H89 B;  3AE7 B;  3W5U B;  1UWM A;  2WDR B;  1R7S A;  3P4Q B;  3ABV B;  1NEN B;  1L5P A;  1L6V A;  1XLN A;  1NI3 A;  1I7H A;  1WXQ A;  1E9M A;  1N62 A;  3P4R B;  1PUT A;  3NS1 A;  5AUK A;  4C7Y A;  3P4S B;  2JQR B;  1ZUD 2;  3AH7 A;  3RPF C;  2LEK A;  3HUI A;  1EWY C;  1N5W A;  2W3R A;  3AEG B;  1E6E B;  2W55 A;  1YJJ A;  4USA A;  3CIR B;  2N0S B;  1KF6 B;  1NEK B;  1NYR A;  1XO3 A;  1QLB B;  1WYG A;  2M56 B;  2WP9 B;  1WRI A;  3AV8 A;  3VR8 B;  2EKI A;  2QJL A;  1FFV A;  2KAJ A;  4HRO A;  1J7C A;  5EE9 A;  2H88 B;  2KMM A;  1SIJ A;  1JRP A;  3AM9 A;  1YQ4 B;  2WU2 B;  3SFE B;  1QOG A;  2CJO A;  2WS3 B;  2FBW B;  2JX5 A;  4P6V F;  4JWU C;  1E10 A;  2PVG C;  1JWB D;  4JWS C;  3P63 A;  1JWA D;  1YQ3 B;  1VDV A;  1NYQ A;  3FAH A;  3NRZ A;  2MH7 A;  3VRB B;  1VLB A;  3AE9 B;  2M19 A;  2MJD A;  5H8Y E;  1XLQ A;  2AX5 A;  2CJN A;  2BS2 B;  4ITK A;  4FXC A;  4YT0 B;  4YXD B;  2PIA A;  3WCQ A;  3CWI A;  1OQQ A;  1RWS A;  1AYF A;  1V8C A;  3AE3 B;  1KRH A;  1CJE A;  1PDX A;  5AUI A;  2PVO D;  1VJK A;  3LXF A;  1JQ4 A;  3NVW A;  1FMA D;  3HVZ A;  2DBY A;  1JRO A;  5EE0 A;  5H92 C;  1N61 A;  4C7Z A;  2BS3 B;  3KWL A;  1XLO A;  1J7A A;  1FRD A;  1QOA A;  4YTP B;  3FC4 A;  2DWQ A;  2MJE A;  2E3T A;  2QIE B;  3BII D;  1N63 A;  1RFK A;  1ZXI A;  2L52 A;  1XLP A;  2WLB A;  4YSY B;  2BT6 A;  1SF0 A;  5G5G A;  1QT9 A;  1E0Z A;  3AN1 A;  2K9X A;  1N60 A;  1FO4 A;  1TJE A;  2W3S A;  2K5P A;  3W5V B;  3EUB 2;  5EE3 A;  4N58 A;  3AEE B;  4N59 A;  2CU3 A;  1ZOY B;  1NVI D;  2PKO A;  3AE4 B;  1FM0 D;  3AE6 B;  4LTU A;  1CZP A;  3ETR A;  2WQY B;  1DOI A;  2K22 A; 
#chains in the Genus database with same CATH topology
 1UF0 A;  1GC7 A;  4K7U A;  2EMT A;  4A9A A;  1DOX A;  3UI3 A;  2WGS A;  3A4S C;  4HDQ A;  3AMZ A;  4BVU C;  4BKT A;  3MJ5 A;  1TT5 B;  4KIK A;  3BYT B;  3VQI A;  4IDI A;  1I4X A;  2MP2 B;  2WHI A;  3P1M A;  1UBQ A;  1QF6 A;  3DVG X;  3KUC B;  3SFD B;  2G1E A;  5BYR A;  1OTR B;  2AWT A;  4HJK A;  1FXT B;  3N9Y C;  4CHK A;  2IGD A;  3PLU A;  3WAO A;  1WR6 E;  3P4S B;  4HK2 A;  3RYT A;  2L1A A;  1J0G A;  3ZJT A;  1ENF A;  4QAY A;  4NAM A;  2EKI A;  1Y56 A;  1F2R I;  2RMM A;  2FCN A;  2RPV A;  1SIJ A;  2C7M B;  2DNF A;  3MHS D;  1GG3 A;  3FKY A;  2G9H D;  2JX5 A;  3UQA A;  2GMI C;  2KQS A;  4MGY E;  3NRZ A;  2Z59 B;  3H7P B;  1VLB A;  3JW0 X;  2BS2 B;  4FHJ A;  3JSV A;  2IGH A;  4DBG A;  1KTK A;  3NY5 A;  2NPT A;  4NAW A;  3HVZ A;  3WAM A;  1GOZ A;  1C79 A;  4S17 A;  4W9J A;  4BKG A;  2PLP A;  5DCN A;  1N60 A;  1MHX A;  1JWS D;  1WJN A;  1EU4 A;  4N59 A;  4AJY B;  4A55 A;  5EDS A;  2PTL A;  2DYB A;  3N32 A;  1FRR A;  4TQ0 A;  3B2F A;  2WXH A;  4DXG A;  2INP E;  1XD3 B;  4PS3 A;  2C5L C;  4BKS D;  3NVY A;  1ZXH A;  2PW9 A;  4ZOH C;  1GB1 A;  5MPO A;  1L0V B;  2NTS A;  4N6E B;  2BYV E;  2JYT A;  1GAQ B;  2D5G A;  2KZR A;  3RCZ A;  3I9V 1;  1SSN A;  1WSP A;  5CX3 A;  4ZRJ A;  2O2V A;  2KLC A;  4RGT A;  2K0P A;  4ANU A;  1PGB A;  1I7H A;  2IY0 B;  5T8I A;  1FEH A;  5BYS A;  5JH5 C;  4PYU A;  3OG5 A;  1E6E B;  2JZP A;  3RUL A;  2K6Q A;  4ICU A;  4OVU A;  1V80 A;  2BBC A;  2KLG A;  2WYQ A;  3I3T B;  4JWS C;  5JXV A;  2N9L A;  1C9F A;  3ZDM C;  3DBH B;  2CJN A;  1V1P A;  1P1A A;  4LLG M;  4FA6 A;  3HM6 X;  1GJZ A;  4CO7 A;  4DWF A;  3AE3 B;  5AUI A;  2OJW A;  3NVW A;  4P1B C;  1FMA D;  2KOX A;  3ZW3 A;  1HXY D;  1UH6 A;  2RDG A;  3IVF A;  4LTU A;  3BII D;  1XLP A;  4EZJ A;  3GS2 A;  4B6W A;  3Q14 C;  3RNC C;  3A1Q B;  2KFK A;  3M62 B;  5BMI A;  2D10 A;  1PFD A;  2L32 A;  3EC8 A;  1WGG A;  2AL6 A;  3VR9 B;  3L10 B;  3H8H A;  3R3M A;  1TKE A;  5G5H A;  1C4C A;  3PS6 A;  5HKH A;  3ZQ4 A;  4B0E A;  3ZXV A;  3KYC D;  2RD0 A;  5AZF A;  1I4G A;  2K1F A;  2MJ3 A;  2MW5 A;  4GDL A;  3LB8 C;  1F2R C;  1Y8R C;  1PQS A;  3V05 A;  2VH1 A;  5G55 A;  3GE8 C;  1XCT L;  1SXT A;  3AH7 A;  4WQO B;  4RGO S;  4IM0 A;  2ZEQ A;  3PHW B;  2AYO B;  2WDT B;  2XEW A;  3H9D A;  1J7C A;  1SE4 A;  5EE9 A;  1LQB A;  3K9O B;  3R2I A;  1KLV A;  1YQ4 B;  3RNG C;  2AQ3 B;  4DK5 A;  2IND C;  1OQY A;  1T0S C;  2J42 A;  4EFO A;  1JWA D;  1D5M C;  4X57 B;  3I63 C;  4BZA A;  3QK0 A;  3UIP B;  1YJ1 A;  3DVN V;  3QWZ B;  2IZV B;  3O65 B;  1N63 A;  4TV3 A;  3NZU A;  2BT6 A;  3PTF C;  5FKA C;  4ICV A;  4N58 A;  1WFY A;  3PPA A;  1JCK B;  1NDD A;  1ZW7 A;  1WE7 A;  2D2Q A;  4EEW A;  5HI1 A;  3AE8 B;  5G2N A;  4RNA A;  1VZ7 A;  5HFY A;  1TBE A;  2MQJ A;  1A5R A;  3Q3M C;  2W9N A;  4RF0 A;  3DWM A;  3EGR A;  1T0R C;  4MJS A;  4J3O D;  4OVV A;  3QQ8 B;  2GB1 A;  2XN9 C;  2O6V D;  4C80 A;  2GOW A;  2G3Q B;  1K53 A;  4JPS A;  4BFR A;  1SB3 C;  1WWT A;  3M63 B;  4TUU A;  4F7Z A;  4KKJ A;  4CYE A;  4NPN A;  2NVU I;  2QEJ C;  2NCN A;  3W5U B;  1UWM A;  2WXN A;  1WE6 A;  2WDR B;  3ABV B;  3KWV A;  3Q6B A;  5CHV C;  3TBL D;  3A9J B;  2MCN B;  4MGZ E;  2D3A A;  5HG2 A;  3OJ3 A;  1FCL A;  2IY1 B;  2LEK A;  1N5W A;  3EFU A;  2RSU A;  1M94 A;  1WRI A;  2JU6 X;  4KKI A;  4KGS A;  3N1X C;  2Z0D B;  3U2S C;  2WU2 B;  2N7D A;  1YN4 A;  3ML8 A;  1JWB D;  4DHJ B;  3PRP B;  2KVR A;  2JZ3 B;  3LYY A;  3EEC A;  4YXD B;  4ZRI A;  2G4S A;  2JSV X;  1E90 A;  2BWF A;  1WM3 A;  1VJK A;  1ZDV A;  2UU7 A;  2QSD A;  1JRO A;  4KVG B;  2QHO A;  1N61 A;  2KQ7 A;  2N9E B;  1V2Y A;  2E3T A;  4YSY B;  3TMP B;  1LGR A;  1RFK A;  2L52 A;  3QIJ A;  1AN8 A;  1UUP A;  2PE9 A;  1ISN A;  3BVM A;  2KTF A;  1WXM A;  2K5P A;  3R66 C;  3IHP C;  3AE6 B;  3U7D A;  3RZF A;  4BOZ B;  2KAJ A;  2KJ6 A;  1WH3 A;  3NVV A;  2ZVN A;  4LK0 M;  4F1S A;  4BBN C;  5LXI B;  3SR6 A;  1QOF A;  3JVZ X;  2LGD A;  3AEF B;  3RMK C;  3QJZ A;  4DQO C;  2BF8 B;  5JHA A;  3AE2 B;  3U30 A;  1D5X C;  2JZZ A;  4IWQ A;  3UQB A;  1JW9 D;  2C7H A;  4GMV A;  5AEK B;  2KWC A;  1T0Y A;  2MRP A;  3CMM B;  2O6V B;  1RFA A;  4E71 A;  2JY6 A;  3PZD A;  3NUH B;  2H89 B;  4A3O A;  3RT3 B;  2INC C;  1DYQ A;  4XGA B;  4M8N A;  5LXH A;  1XLN A;  2VZK D;  2XNA C;  3FIL B;  1NI3 A;  4YL8 A;  1PUT A;  3X0W A;  3ZVV A;  3MC9 A;  2PMV A;  3EHV A;  4KDI C;  3HUI A;  3DHG C;  1XO3 A;  3DDC B;  4M01 A;  4RCO A;  2K8C A;  1ZE3 D;  4KV2 A;  1V5T A;  1MPE A;  2JWZ A;  3DHH C;  1L7Y A;  2N9X A;  2BPS A;  3L54 A;  4ANW A;  1SIF A;  2V4I B;  2FUG 1;  3R7R A;  2GBJ A;  3LDZ E;  2PE6 B;  1AYF A;  1WJ6 A;  4HCP B;  2CHX A;  1V8C A;  3ZO5 B;  2FID A;  2X8X X;  1AW7 A;  2W82 A;  2Z8L A;  2WXQ A;  3FC4 A;  2MJE A;  2IO3 B;  4A90 A;  4A6Q A;  5E6O A;  1TZO A;  2BB5 A;  1HEZ E;  5LNK 1;  3Q8E A;  4K7S A;  1IP9 A;  4HXD A;  2MSE D;  2MLB A;  2D3C A;  3VUY A;  2N9K A;  5L83 A;  5D3D A;  3GZN B;  1G6J A;  3Q3J A;  1I4H A;  2DZJ A;  5C2T B;  4ZRK A;  1Q0W B;  1HE8 A;  3Q2A C;  3N1Y C;  3TL5 A;  3VHT C;  4EE2 A;  2C60 A;  2RDB C;  2LJ5 A;  4ASW C;  2LMC A;  5C3J B;  3APC A;  2KAC A;  3AEA B;  3ZUN A;  2PPH A;  2N1W A;  4MEL A;  3B1L X;  1WIA A;  4GDK A;  3VFK A;  4XYC A;  1QKZ A;  4J6I A;  4LNN A;  5BO4 B;  1ESF A;  3ZNI D;  3A1Q A;  4TSS A;  2L05 A;  5IP4 D;  2IPK D;  2MHJ A;  1YIW A;  4RM8 A;  2V3S A;  5IO9 A;  3ZJV A;  1V86 A;  4MAC A;  2D11 A;  1KLG D;  2N7J A;  1EWY C;  4B9K A;  5AZG A;  2LRU A;  1NYR A;  2M1M A;  2WP9 B;  3DBR I;  4FJZ A;  1VZ8 A;  1F52 A;  3MC8 A;  3AM9 A;  4GSW A;  4NZL B;  2CJO A;  3ZDT A;  2WS3 B;  1GNU A;  1QIL A;  1L0Y B;  2BYT A;  5IKC M;  3ZGZ A;  4B95 A;  4NJC A;  2FUH B;  5D7G A;  1K52 A;  2RDH A;  4WWO A;  4HWI B;  1YOV B;  3ECI A;  1HZ5 A;  3RN9 C;  3AN1 A;  4XE0 A;  1NI2 A;  4IC7 B;  4HPM B;  2AQ1 B;  2DAJ A;  3GP7 A;  1F0Z A;  3W2D A;  2BKF A;  4FJV B;  5GMV A;  4NJ7 A;  1WY8 A;  1WGH A;  1FFU A;  2FCQ A;  2Y5B B;  4GOC A;  2L0F A;  1S1Q B;  3A33 B;  1JAL A;  3DCG A;  3L08 A;  4JIO U;  1RM6 C;  5GXG B;  1ET9 A;  4YWG G;  2C9W B;  4YSZ B;  3P4P B;  1UGM A;  2KT7 A;  4IW0 A;  2I1J A;  3QHT A;  5TR5 A;  2EEL A;  3S2A A;  4K81 A;  1WZ0 A;  3ZTC A;  2C7N B;  1OQR A;  1OFF A;  2LWP A;  3L4P A;  1KJT A;  3TEY A;  4RFB A;  3KLS X;  2KMA A;  4DXA B;  3VDZ A;  3NHE B;  4PT5 A;  4ARC A;  2AQ2 B;  3URY A;  1HQR D;  2DAF A;  2M56 B;  3AV8 A;  2IO1 B;  3DQV A;  1TY0 A;  2L8J A;  4NY0 A;  1V1O A;  2WXM A;  1SJH D;  2V9H A;  4HLE A;  1LM8 B;  1D3Z A;  3AI5 A;  1UNS A;  4RF1 A;  2OJR A;  1VDV A;  2MH7 A;  5L95 C;  1P98 A;  2LXC A;  1I4P A;  4GN1 A;  4W9I A;  2L00 B;  2LUM A;  3T3N A;  3B0A A;  4TQ1 A;  1ACC A;  4K1R B;  1S3S G;  2LI5 A;  1JQ4 A;  1IYF A;  1YN5 A;  4JE3 B;  2DEN B;  3A9J A;  3RI7 C;  1J8C A;  2LVP A;  2BVC A;  2K9X A;  3AXC A;  2W3S A;  3VVW B;  2DLB A;  1TIF A;  2ZCB A;  1WJU A;  4WJP A;  2ZPN A;  4HPL B;  4LCD E;  3NVZ A;  2Y5P A;  2BS4 B;  1L4Z B;  3B2G A;  2G45 B;  3QAR A;  3Q8B A;  2K3U A;  3VAW A;  1HTQ A;  1E7U A;  3APF A;  3X23 A;  3I5J C;  5IA7 A;  1L6U A;  1CMX B;  3W1S A;  2DX5 B;  2GRI A;  3BVZ A;  3D32 A;  3IBE A;  1E7P B;  3PHX B;  4M0W B;  2ZNV C;  3MTN B;  4HDO A;  2J0K A;  4DHZ B;  3T8M A;  2D3G A;  4ANX A;  2CS4 A;  2Y5C A;  2I2Y A;  4IWO A;  4XWW A;  2IGG A;  2HTM E;  2GBM A;  3PVL A;  3B9J A;  3A9K A;  4US9 A;  2ON8 A;  1ZP0 B;  3N20 C;  2EKE C;  2PJH A;  3Q8C A;  3LJ3 A;  1XF5 L;  3RNB C;  2K8B A;  1R4M B;  3PZ7 A;  3AU4 A;  3BK2 A;  3NS1 A;  3ZXR A;  1XXG A;  3Q3N C;  1H4R A;  2JQR B;  3RNF C;  1FNW A;  4FUL A;  3DBH I;  1HA5 A;  5E6N A;  3T9L A;  3PT2 B;  2J52 A;  4C4V B;  4JL9 A;  3TIX A;  1U4A A;  2H88 B;  4A20 A;  1UEL A;  4W9F A;  4RH6 A;  3VUW A;  3VH4 B;  4MM3 B;  2OED A;  2KDB A;  4D2K A;  5D2M B;  3K9P B;  2FE8 A;  2LXA A;  3AU5 A;  3QCA A;  3EA6 A;  2K39 A;  1D4B A;  2O6V A;  3ZRC A;  1CJE A;  1WJ4 A;  2NBV B;  1I35 A;  4ARI A;  4C7Z A;  2IO2 B;  2M0X A;  3KQ4 A;  4MEM A;  3FIL A;  4AOF A;  4PYZ A;  4RMA A;  4F8C B;  2ICI A;  4C56 C;  4LNK A;  2DZK A;  2K22 A;  1IGD A;  1EF1 A;  2E6X A;  2ZCC A;  4KZC A;  4LNO A;  2BQQ A;  3JSV B;  2NMQ A;  3QC8 B;  3RFZ B;  3O13 A;  2B76 B;  4PS8 A;  2GLS A;  1UBI A;  1FXI A;  3BY4 B;  1KM7 A;  1GUA B;  4GIV A;  4HCN B;  2WXO A;  3IXS A;  1J19 A;  3N30 A;  1N6Z A;  4OZB A;  1XCQ L;  1E8Z A;  5FK9 C;  4GLS C;  4ZHO A;  3PO0 A;  4JGH B;  4MSM B;  1N5X A;  1C4A A;  3PGE A;  4E74 A;  4HKZ E;  4ZRP A;  2KTR B;  2KX3 A;  4AUQ C;  3AB5 A;  1T5X D;  2HE7 A;  4W9D A;  1MHH E;  4TKN A;  3ZNZ B;  1WXQ A;  3SEB A;  1Z5S B;  1CK1 A;  3T3O A;  1ZUD 2;  3PV1 A;  2BB6 A;  2KKC A;  2N0S B;  2MX2 A;  2K8H A;  1D6E C;  4HJG E;  1H8C A;  2XBB C;  4HRO A;  3C19 A;  2M4N A;  3R7Q A;  4LJO B;  3P2B A;  2DZI A;  2DHZ A;  4II2 B;  1P0R A;  3VRB B;  1WR1 A;  1XLQ A;  4II3 B;  2RR9 A;  2WXL A;  4Q2J A;  4O1N A;  1EWC A;  1JML A;  2MBE A;  1J7A A;  4W9C A;  1FRD A;  2QIE B;  2MP2 A;  1V49 A;  5HHD G;  3SHQ A;  2KJH B;  1OEY A;  1T0Q C;  4LNI A;  2MBB B;  4A3P A;  2HJ8 A;  4KDL B;  4L23 A;  2JVC A;  3ZNH B;  1MVK A;  4US8 A;  4KGR A;  4W9G A;  2JYE A;  2FAZ A;  1BT0 A;  1FD6 A;  2FIF A;  2D3B A;  5CTR C;  3VRA B;  2WDQ B;  4K3C A;  2Q5W D;  1Q5W B;  1R4N B;  1TTN A;  1J7B A;  2I1K A;  3N1Z C;  4OZA A;  3WAN A;  1FXA A;  4JX1 C;  3OJ4 B;  4AJW A;  2KFK B;  2DYM A;  1UD7 A;  2M8S A;  3HRD D;  2HJ1 A;  1ZGU B;  4ZYN A;  3VTU A;  3APD A;  3H7P A;  5IAA C;  2A4Z A;  1R7S A;  2KHW B;  1VZ6 A;  4RGM A;  2JUO A;  2JRH A;  1V9J A;  3M95 A;  2L0T A;  2W55 A;  5C23 A;  3HK0 A;  1X1M A;  1TS5 A;  4R3D A;  2INN E;  2KJR A;  1E7V A;  1SE3 A;  2WXI A;  1OGW A;  1BXT A;  1L4D B;  1HZ6 A;  4AWJ A;  2M19 A;  2MJD A;  2YVC A;  1EUV B;  2ASQ A;  2KN4 A;  2NBU A;  4BBN F;  4C00 A;  3V6C B;  1OQQ A;  1RWS A;  2Y3A A;  4HKQ A;  3V6E B;  3I57 A;  3IT6 B;  3V3X A;  1IBX B;  2ZW0 A;  4NQK E;  2IO0 B;  3WCQ A;  2ZJD A;  4K7W A;  3TEX A;  4IM3 A;  3DOW A;  1YQB A;  4OZC A;  2CHZ A;  4MGI E;  3Q69 A;  3DBL B;  1WGY A;  5FR3 A;  4KZ0 A;  2VH2 A;  1FPY A;  2KVZ A;  3DVN U;  3E56 A;  1EO6 A;  3B08 A;  3CST A;  1RYJ A;  2JPH A;  1IPG A;  2FNJ B;  3ONS A;  1Q10 A;  3NZ3 A;  3N3K B;  2M17 A;  1YNT E;  2GBR A;  5J18 A;  1TKG A;  1B9R A;  3KUD B;  3L16 A;  1XT9 B;  1FNV A;  1AWD A;  4WQM A;  3TEW A;  3NOB A;  3DWG C;  2JRI B;  2RGF A;  1TY2 A;  1T3Q A;  3KH0 A;  1KOT A;  2HDE A;  1LXD A;  1NEN B;  2JXX A;  1WMH B;  1L0X B;  1GC6 A;  2LGI A;  4KSK C;  4ZDV A;  1Q1O A;  3E9S A;  3KVF B;  3V60 A;  2NR2 A;  4W9K A;  1WF9 A;  2KDE B;  1FFV A;  3NZS A;  4IM2 A;  4M0W A;  4OVZ A;  2KWV B;  3SFE B;  2L7R A;  4JWU C;  4P1C C;  4WWP A;  1B1Z A;  2SEB D;  1T6B X;  2LGY A;  2AX5 A;  3OWE B;  4FXC A;  1SBB B;  2PIA A;  4WJO A;  3KUZ A;  1TS4 A;  4HEA 1;  2VZK B;  3LXF A;  2NBW B;  1WX7 A;  2WXR A;  2KWU B;  1F1H A;  5I4D A;  1SE9 A;  1I42 A;  4I6N B;  4YT0 B;  5G5G A;  3GZN I;  2WXJ A;  3MHZ A;  1QT9 A;  5E6P A;  4BKS A;  3W5V B;  2BWE S;  2XK5 B;  1C78 A;  2CU3 A;  4IOI E;  1YX5 B;  4XZ4 A;  3RZW C;  2V3P A;  1DOI A;  4FN2 A;  1VCB A;  4C4V A;  3H6N A;  1E5W A;  4W9L A;  2KXJ A;  2W54 A;  1QOB A;  2MBH A;  5DPS A;  2L76 A;  4MM3 A;  3BYY B;  1RLF A;  1JWU D;  3VTW A;  2YEP F;  3PRM B;  4TMA B;  4MSQ B;  1RAX A;  4YTN B;  3HM3 A;  4DDG D;  5KHQ A;  1WRD B;  4LJP B;  2WWZ A;  2GBN A;  2G4D B;  2ZPY A;  4YTM B;  3MJW A;  1CQV A;  1P3Q U;  1I4R A;  3W1S C;  4ZHP A;  1Z2M A;  4XC2 A;  1ROE A;  4GU2 A;  3V61 A;  2REX A;  2AEH A;  1SEB D;  4LNF A;  3WA0 A;  1STE A;  1EF5 A;  2B3A A;  1SJE D;  2KX0 A;  4M02 A;  2J7Q B;  3ZJU A;  1TS3 A;  5BYQ A;  1E9M A;  3P4R B;  4NQL B;  2MA9 B;  2FCS A;  3R8B A;  5JZE B;  2WNM A;  4WWN A;  2LGX A;  2KYW A;  4I6L B;  4USA A;  1C76 A;  1P7E A;  1I4Q A;  1M4V A;  3TEZ A;  2J0M A;  5LLI A;  4W9E A;  1C3T A;  1QOG A;  4FLH A;  2FBW B;  3H7S A;  2V1Y A;  3PZ8 A;  4EOY A;  5H8Y E;  2KDF B;  3PRE A;  1WI0 A;  4BOS C;  2V3N A;  4ITK A;  2KTR A;  4DDI D;  3CWI A;  5CHW A;  1YD8 U;  1WX9 A;  3QX1 A;  3Q8F A;  1KRH A;  4WUR A;  3MC0 B;  2PVO D;  4G50 A;  2YLM A;  2DBY A;  1WXV A;  1VRA B;  1WGR A;  2CHW A;  1YN3 A;  2DZM A;  2MWS B;  4YTP B;  2DWQ A;  3GE3 C;  2WLB A;  2LVO A;  1SF0 A;  4L1B A;  3L17 A;  2UWQ A;  3SDL C;  4WAF A;  4FBJ B;  1NBF C;  3AEE B;  4UDU C;  1ZOY B;  1NVI D;  1FM0 D;  1UZX B;  1CZP A;  4WJQ A;  2BTE A;  4N9F 4;  3W1Y A;  2M0A A;  2KMC A;  1AAR A;  2K25 A;  3L13 A;  1JRU A;  5AZH A;  2KO3 A;  2LHE A;  3DBS A;  1E8X A;  2LAS A;  3AEB B;  3ZIM A;  2EMS A;  2LZ6 A;  1V5O A;  3QA8 A;  3RUI B;  3U4E G;  2RPQ A;  2N4F A;  3NS8 A;  3AEC B;  1IGC A;  2IJ0 A;  3MFG A;  4AS1 A;  3IT4 B;  4I6P A;  5D3I B;  2JWU A;  4G3X B;  1WYW B;  1TYG B;  2ZZP B;  2WU5 B;  4RGN A;  1K50 A;  2WXF A;  1WGK A;  4S0R A;  2BYE A;  2MBO A;  2ACZ B;  1GB4 A;  2OOB B;  2WXP A;  4MT5 A;  4REZ A;  1YJI A;  3JYU A;  4MGK E;  3WAL A;  3BZD B;  1XQQ A;  4GB9 A;  4C7Y A;  1EM7 A;  3RPF C;  4BAX A;  1YJJ A;  1EU3 A;  1QLB B;  1WYG A;  2QJL A;  4NJ6 A;  4PS7 A;  2WX0 A;  3UGB B;  1VD2 A;  4MDK E;  2BKR B;  3ALB A;  4GDK B;  3SD5 A;  3VH3 B;  2R61 A;  3P63 A;  4WH4 A;  4EZL A;  4KIK B;  1WM2 A;  4GGQ A;  3Q3F A;  1TGZ B;  3UIN B;  2LGS A;  4XDC A;  1D5Z C;  4ANV A;  4P16 A;  1E0Z A;  3J9C A;  2J0J A;  4LDT D;  2LD9 A;  3SU8 X;  5C1Z A;  2WXK A;  3C8Y A;  3ETR A;  4G0N B;  3DHI C;  3PSE B;  5EE1 A;  2KK8 A;  1RRB A;  2CR5 A;  4HRS A;  4WAA A;  2ONQ A;  2JT4 B;  4KX6 B;  3WAP A;  3AED B;  3QAQ A;  4YSX B;  1KFY B;  1YX6 B;  3P42 A;  3TSS A;  1BUI C;  4JLC A;  4CQN A;  2A5U A;  2L3Z A;  1FIQ A;  4XWT A;  3IFW B;  4RM9 A;  1R4M I;  3W9C B;  1IBX A;  1WZ3 A;  1C4P A;  5DPR A;  1P7F A;  1V97 A;  3BVG A;  3AE1 B;  2CU1 A;  4DHJ D;  3AE5 B;  4GXB A;  1DGJ A;  1TKY A;  3U7Z A;  2NPT B;  4NAW B;  1TS2 A;  3AE7 B;  3AUL A;  3Q3O C;  3P4Q B;  5TSS A;  3PRZ A;  2LFI A;  1L5P A;  2IDY A;  2KN5 A;  2R2O A;  1F77 A;  1UWX A;  3U8Z A;  3AEG B;  2TSS A;  2R2Q A;  2GBK A;  1JRP A;  3GB1 A;  2V4L A;  4XDD A;  4WJN A;  1KH0 A;  4DXF A;  3TJP A;  3FAH A;  4G11 A;  2MEK A;  1TZ1 A;  3RD2 A;  1C77 A;  4EKU A;  3ML9 A;  2IYD B;  4H2A A;  3HIZ A;  1SGH A;  1PDX A;  2PEA A;  1PGA A;  3TUO A;  5EE0 A;  2LRW A;  4M00 A;  3C0R B;  4KGT A;  4W9H A;  3NJT A;  1WMH A;  4IG7 B;  1QOA A;  1UGJ A;  1ZXI A;  4AQ7 A;  4OHJ A;  3M3J A;  5EE3 A;  2YEP B;  2O2V B;  1PGX A;  3ZKJ C;  3ZNG C;  2QCZ A;  2WQY B;  5E6J A;  3VUX A;  1FNU A;  4LDT B;  4A8X C;  1A70 A;  1OEY J;  4URK A;  2WDV B;  4K3B A;  4WWM A;  2OHF A;  1SE2 A;  3IAS 1;  4JQW C;  2BGF A;  3RNA C;  1K8R B;  1MJD A;  1MFW A;  4FAD A;  3IAM 1;  2CKH B;  4XX5 A;  1IUE A;  2KQ4 X;  4EUT A;  5JHB A;  3DPD A;  1V1P B;  3DVG Y;  4FJY A;  1WGD A;  2XK5 A;  3ENE A;  2L83 A;  3EFC A;  4KSL C;  2N1V A;  2D07 B;  4PK1 A;  1F9J A;  3ZLZ A;  1N62 A;  3H1U A;  3UF8 A;  3U52 E;  3Q8A A;  2W3R A;  1MG8 A;  1C1Y B;  2KD0 A;  3CSF A;  3CIR B;  2N7E A;  3GOE A;  2ZW1 A;  4EZK A;  5J2R A;  5IOI A;  4OW0 A;  1WXS A;  1QZE A;  3HVD A;  3KW5 B;  3MP9 A;  1E10 A;  2QDF A;  3A9K B;  1YQ3 B;  1NYQ A;  4DHZ E;  3AE9 B;  3BIN A;  1LFD A;  2HD5 B;  2K6D B;  4IKG A;  4B0M A;  2FCM A;  3CF6 E;  5BMH A;  2QIL A;  5H92 C;  2LHD A;  3ZTD A;  3KWL A;  1XLO A;  5IN7 A;  4AP4 C;  5CHF A;  2VRR B;  3RNE C;  5DPW A;  2JF5 A;  4GDL B;  2N9P C;  2WX1 A;  3VXW A;  4ZYS A;  3ZRF A;  2NS5 A;  2WXG A;  1R4N I;  2J53 A;  3ZYY X;  3OAW A;  3OLM D;  1LO5 D;  4IUM B;  1VR9 A;  2V0G A;  2ZVO A;  5DPT A;  5J17 A;  4WIP A;  1P9D U;  2AL3 A;  2QMT A;  4ZRQ A;  3WIM A;  1GPX A;  1MI0 A;  2KDM A;  1ZPS A;  2Z0E B;  1YMH E;  2KC1 A;  2SAK A;  1XEE A;  1JWM D;  4NNJ B;  5BMG A;  2KNB A;  1KLU D;  1BML C;  1DOY A;  2NTT A;  3A4R A;  2HTH A;  4M8M A;  1PYW D;  3R2T A;  1E8W A;  3BWU D;  1WXA A;  1L6V A;  4L2Y A;  5D6J B;  4HVB A;  5KHO A;  4ACF A;  3L0W B;  3NG0 A;  4FHK A;  3UIO B;  2JXT A;  1E8Y A;  5AUK A;  2DYO A;  1V6E A;  1MG4 A;  1V81 A;  2KWD A;  1KF6 B;  1NEK B;  3VR8 B;  2LUE A;  2KDI A;  1QQR A;  1WX8 A;  1HTO A;  2KMM A;  2ZNV B;  4MH8 A;  3KYD D;  2IBI B;  4E3C A;  2LVQ A;  2BW2 A;  4IWP A;  4P6V F;  3HHM A;  2PVG C;  2KAN A;  2UYZ B;  5D94 A;  2GI9 A;  2KC2 A;  3DBL I;  4MH0 E;  2MBQ A;  3DBR B;  3BK1 A;  4MJS B;  3VTV A;  4HPP A;  3IG3 A;  2I38 A;  2QC8 A;  1K51 A;  2J4X A;  1FCC C;  2BS3 B;  1ZKH A;  4P7I A;  3TCA A;  5FR6 A;  1FO4 A;  1TJE A;  1ZDX A;  2LJI A;  3PLV A;  1ET6 A;  3EUB 2;  1L2N A;  3V62 A;  2KFJ A;  2PKO A;  3AE4 B;  2BYF A;  2X38 A; 
#chains in the Genus database with same CATH homology
 1IGD A;  2BTE A;  2E6X A;  2M0A A;  3NVV A;  4A9A A;  1DOX A;  2NMQ A;  3UI3 A;  3RFZ B;  3O13 A;  4LK0 M;  2B76 B;  3AMZ A;  3SR6 A;  1QOF A;  2LHE A;  3MJ5 A;  1FXI A;  3BYT B;  3AEF B;  4DQO C;  3AEB B;  3VQI A;  4IDI A;  3AE2 B;  3U4E G;  1I4X A;  2WXO A;  3P1M A;  3AEC B;  3IXS A;  1D5X C;  1QF6 A;  4OZB A;  1IGC A;  2IJ0 A;  1XCQ L;  3MFG A;  1JW9 D;  5FK9 C;  3SFD B;  4GLS C;  4AS1 A;  4ZHO A;  3PO0 A;  3IT4 B;  5D3I B;  2G1E A;  1C4A A;  1N5X A;  2JWU A;  5BYR A;  4HKZ E;  1TYG B;  2WU5 B;  4RGN A;  4ZRP A;  1K50 A;  2WXF A;  3N9Y C;  1WGK A;  2ACZ B;  1GB4 A;  2WXP A;  3AB5 A;  4MT5 A;  1YJI A;  1T5X D;  2H89 B;  3NUH B;  4REZ A;  2IGD A;  1DYQ A;  1MHH E;  1XLN A;  2VZK D;  2XNA C;  3FIL B;  3BZD B;  1NI3 A;  1WXQ A;  3SEB A;  1PUT A;  4C7Y A;  1CK1 A;  3P4S B;  2PMV A;  1EM7 A;  3T3O A;  1ZUD 2;  3RPF C;  3HUI A;  2L1A A;  2BB6 A;  1YJJ A;  2N0S B;  3ZJT A;  1ENF A;  1XO3 A;  1EU3 A;  1D6E C;  1QLB B;  1WYG A;  4HJG E;  4NAM A;  2EKI A;  4RCO A;  2QJL A;  4HRO A;  1Y56 A;  1ZE3 D;  1F2R I;  2RMM A;  1MPE A;  2RPV A;  1SIJ A;  4GDK B;  2G9H D;  2JX5 A;  2R61 A;  3P63 A;  4WH4 A;  3NRZ A;  3VRB B;  1VLB A;  1XLQ A;  2BS2 B;  2V4I B;  2FUG 1;  2IGH A;  1KTK A;  1AYF A;  2WXL A;  1V8C A;  4Q2J A;  4O1N A;  3HVZ A;  1AW7 A;  1EWC A;  1JML A;  2W82 A;  2Z8L A;  4XDC A;  1GOZ A;  2WXQ A;  1J7A A;  1FRD A;  1C79 A;  1D5Z C;  3FC4 A;  2MJE A;  2QIE B;  4P16 A;  4A90 A;  4A6Q A;  1E0Z A;  3J9C A;  2PLP A;  5HHD G;  1N60 A;  1TZO A;  2BB5 A;  1HEZ E;  1MHX A;  1JWS D;  5LNK 1;  1EU4 A;  3Q8E A;  4N59 A;  2WXK A;  4A55 A;  3C8Y A;  3ETR A;  5EE1 A;  4L23 A;  2PTL A;  1MVK A;  2N9K A;  4HRS A;  4US8 A;  4KGR A;  2ONQ A;  1FRR A;  4KX6 B;  4TQ0 A;  3AED B;  5D3D A;  4YSX B;  3B2F A;  2JYE A;  2WXH A;  4DXG A;  1I4H A;  2INP E;  1FD6 A;  1KFY B;  5C2T B;  3VRA B;  2WDQ B;  3P42 A;  2Q5W D;  3TSS A;  1BUI C;  1J7B A;  3NVY A;  4CQN A;  1FIQ A;  4EE2 A;  1ZXH A;  2PW9 A;  4XWT A;  4OZA A;  4ZOH C;  1GB1 A;  1FXA A;  4JX1 C;  2LMC A;  5C3J B;  5MPO A;  1L0V B;  2NTS A;  3W9C B;  1IBX A;  2KAC A;  3AEA B;  1C4P A;  4N6E B;  2DYM A;  2JYT A;  1GAQ B;  1P7F A;  1V97 A;  2D5G A;  3AE1 B;  3BVG A;  3HRD D;  3I9V 1;  1SSN A;  3AE5 B;  1WSP A;  1DGJ A;  1TKY A;  3U7Z A;  4NAW B;  1QKZ A;  1TS2 A;  1ESF A;  3AE7 B;  4TSS A;  1R7S A;  3P4Q B;  5TSS A;  4RGT A;  2LFI A;  1L5P A;  2K0P A;  1VZ6 A;  2IPK D;  2IDY A;  1PGB A;  1I7H A;  3ZJV A;  4RGM A;  5T8I A;  1FEH A;  4MAC A;  5BYS A;  1KLG D;  2N7J A;  1EWY C;  1F77 A;  1UWX A;  3AEG B;  1E6E B;  2W55 A;  1NYR A;  1TS5 A;  4R3D A;  2JZP A;  2WP9 B;  2INN E;  2TSS A;  1SE3 A;  1VZ8 A;  2BBC A;  1JRP A;  2WXI A;  3AM9 A;  4NZL B;  2CJO A;  2WS3 B;  1BXT A;  1QIL A;  3GB1 A;  1L0Y B;  2BYT A;  1L4D B;  4XDD A;  4JWS C;  1HZ6 A;  1KH0 A;  4DXF A;  5JXV A;  3ZGZ A;  2N9L A;  3FAH A;  1C9F A;  2M19 A;  2MEK A;  2MJD A;  4NJC A;  2CJN A;  1V1P A;  2KN4 A;  4LLG M;  1C77 A;  1OQQ A;  1RWS A;  2Y3A A;  5D7G A;  4HKQ A;  4H2A A;  3AE3 B;  5AUI A;  1PDX A;  3I57 A;  1PGA A;  3NVW A;  1K52 A;  1FMA D;  3TUO A;  2RDH A;  3IT6 B;  5EE0 A;  4KGT A;  3V3X A;  1HXY D;  1IBX B;  2ZW0 A;  1QOA A;  2RDG A;  1HZ5 A;  4LTU A;  3BII D;  1UGJ A;  3WCQ A;  1ZXI A;  1XLP A;  3TEX A;  4AQ7 A;  3GS2 A;  3AN1 A;  4XE0 A;  4OZC A;  4OHJ A;  3Q69 A;  5EE3 A;  2AQ1 B;  2YEP B;  1PGX A;  5BMI A;  5FR3 A;  3GP7 A;  2WQY B;  5E6J A;  1F0Z A;  3W2D A;  1FNU A;  3E56 A;  4A8X C;  1PFD A;  2L32 A;  1A70 A;  1RYJ A;  1FFU A;  3VR9 B;  2WDV B;  3H8H A;  4WWM A;  1TKE A;  2OHF A;  1SE2 A;  3IAS 1;  1JAL A;  1Q10 A;  3NZ3 A;  5G5H A;  1RM6 C;  1YNT E;  5GXG B;  1ET9 A;  4YWG G;  1C4C A;  4YSZ B;  3P4P B;  3ZQ4 A;  3IAM 1;  4B0E A;  1TKG A;  1B9R A;  1IUE A;  2KQ4 X;  1FNV A;  1I4G A;  1AWD A;  1V1P B;  2EEL A;  4WQM A;  3TEW A;  1OQR A;  3DWG C;  2MJ3 A;  1OFF A;  3LB8 C;  1F2R C;  2L83 A;  3L4P A;  1TY2 A;  3TEY A;  1T3Q A;  2HDE A;  4RFB A;  3V05 A;  1NEN B;  3KLS X;  1L0X B;  2LGI A;  1N62 A;  3E9S A;  3U52 E;  1XCT L;  1SXT A;  3AH7 A;  3Q8A A;  4PT5 A;  4RGO S;  4ARC A;  2W3R A;  2AQ2 B;  3URY A;  1HQR D;  3CIR B;  2M56 B;  3AV8 A;  1FFV A;  1TY0 A;  1J7C A;  1SE4 A;  2ZW1 A;  5EE9 A;  1V1O A;  2WXM A;  3R2I A;  4M0W A;  1SJH D;  4OVZ A;  4OW0 A;  3SFE B;  1YQ4 B;  2AQ3 B;  3HVD A;  3MP9 A;  4JWU C;  1E10 A;  1UNS A;  2J42 A;  4RF1 A;  1JWA D;  1D5M C;  1YQ3 B;  1VDV A;  1B1Z A;  1NYQ A;  2MH7 A;  1T6B X;  2SEB D;  3AE9 B;  1I4P A;  2AX5 A;  2LUM A;  3OWE B;  4FXC A;  1SBB B;  4IKG A;  3T3N A;  2PIA A;  4TQ1 A;  1TS4 A;  4HEA 1;  4B0M A;  1ACC A;  2VZK B;  3LXF A;  2QIL A;  5BMH A;  1JQ4 A;  1YN5 A;  2WXR A;  5H92 C;  2LHD A;  3KWL A;  1XLO A;  5I4D A;  4JE3 B;  4YT0 B;  1N63 A;  5G5G A;  2BT6 A;  2WXJ A;  3MHZ A;  1QT9 A;  2K9X A;  4GDL B;  2W3S A;  3W5V B;  5FKA C;  2DLB A;  4N58 A;  1C78 A;  4ZYS A;  2CU3 A;  4IOI E;  2V3P A;  1JCK B;  1DOI A;  2WXG A;  3NVZ A;  2Y5P A;  2J53 A;  2BS4 B;  2W54 A;  1L4Z B;  3ZYY X;  1QOB A;  3B2G A;  5HI1 A;  1LO5 D;  3AE8 B;  1VR9 A;  2V0G A;  3Q8B A;  4WIP A;  2K3U A;  4RNA A;  3BYY B;  1VZ7 A;  1JWU D;  5HFY A;  1L6U A;  3W1S A;  2GRI A;  2QMT A;  3BVZ A;  4ZRQ A;  1GPX A;  2YEP F;  4TMA B;  1E7P B;  1MI0 A;  4RF0 A;  3DWM A;  2KDM A;  1ZPS A;  3EGR A;  4YTN B;  1YMH E;  4J3O D;  2GB1 A;  2XN9 C;  4C80 A;  2SAK A;  1K53 A;  1XEE A;  4JPS A;  4YTM B;  1CQV A;  1SB3 C;  1JWM D;  1WWT A;  2Y5C A;  5BMG A;  1I4R A;  2I2Y A;  1KLU D;  4XWW A;  4KKJ A;  4ZHP A;  2IGG A;  2HTM E;  1BML C;  1DOY A;  3B9J A;  1ROE A;  2NTT A;  2QEJ C;  4US9 A;  2ON8 A;  1ZP0 B;  1PYW D;  3W5U B;  1UWM A;  1SEB D;  2WDR B;  2WXN A;  3ABV B;  3KWV A;  3Q8C A;  3BWU D;  1STE A;  3R2T A;  1L6V A;  1XF5 L;  4L2Y A;  1SJE D;  3ZJU A;  1TS3 A;  5BYQ A;  3PZ7 A;  1E9M A;  3BK2 A;  3P4R B;  3NS1 A;  1XXG A;  2JXT A;  5AUK A;  5HG2 A;  2JQR B;  1FNW A;  2DYO A;  3R8B A;  1FCL A;  2LEK A;  1N5W A;  1HA5 A;  2WNM A;  2KWD A;  4USA A;  1KF6 B;  1NEK B;  1C76 A;  1P7E A;  2J52 A;  1I4Q A;  1M4V A;  1WRI A;  3VR8 B;  2JU6 X;  4KKI A;  3TEZ A;  4KGS A;  1QQR A;  2H88 B;  4RH6 A;  2KMM A;  4MH8 A;  3U2S C;  2WU2 B;  1QOG A;  2BW2 A;  2FBW B;  1YN4 A;  4P6V F;  4MM3 B;  2OED A;  2PVG C;  1JWB D;  4D2K A;  2GI9 A;  3PZ8 A;  2FE8 A;  5H8Y E;  2V3N A;  4ITK A;  3EA6 A;  3LYY A;  4YXD B;  3CWI A;  1D4B A;  3BK1 A;  2JSV X;  3Q8F A;  1KRH A;  1CJE A;  3MC0 B;  4WUR A;  2PVO D;  1VJK A;  1ZDV A;  2I38 A;  2QSD A;  1K51 A;  2DBY A;  1JRO A;  2J4X A;  1FCC C;  1VRA B;  4ARI A;  1N61 A;  4C7Z A;  2BS3 B;  3KQ4 A;  1YN3 A;  4YTP B;  2DWQ A;  2E3T A;  3FIL A;  4YSY B;  1RFK A;  2L52 A;  2WLB A;  1AN8 A;  1UUP A;  1SF0 A;  4L1B A;  1FO4 A;  3BVM A;  1TJE A;  1ZDX A;  2LJI A;  2K5P A;  1ET6 A;  3EUB 2;  4WAF A;  2ICI A;  4C56 C;  3AEE B;  4UDU C;  1ZOY B;  1NVI D;  2PKO A;  3AE4 B;  1FM0 D;  3AE6 B;  1CZP A;  2X38 A;  2KAJ A;  2K22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...