2K22A

Automated nmr structure of the ta0895 by fapsy
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
b'MVTVRYYATLRPITKKKEETFNGISKISELLERLKVEYGSEFTKQMYDGNNLFKNVIILVNGNNITSMKGLDTEIKDDDKIDLFPPVAGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein Ta0895
publication title Automated NMR Structure of the TA0895 by FAPSY
rcsb
source organism Thermoplasma acidophilum
molecule tags Unknown function
total genus 10
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k22A00
1OFFA 3NVYA 1AWDA 2KMMA 2M56B 3B2GA 1FIQA 2WLBA 2WDRB 1L5PA 1NYRA 4YTMB 1ZUD2 3NVVA 3AE2B 1T3QA 2JQRB 1JQ4A 2AX5A 3AEAB 1JWBD 3SFEB 3AEDB 1NI3A 3NVWA 1JROA 1AYFA 1XLNA 2W3SA 1DGJA 4HRSA 5G5GA 1NEKB 2K22A 4YXDB 4LTUA 4FXCA 1YQ3B 1E6EB 3AN1A 4C7YA 1QOBA 2K5PA 1KFYB 3ETRA 4USAA 1DOXA 4ZHOA 1FXAA 3AE4B 3B9JA 3FC4A 1FRDA 1ZXIA 3AE3B 3CWIA 1IUEA 1RFKA 4HROA 2WDVB 1ROEA 1SIJA 1QOAA 1UWMA 2BS4B 1WYGA 4YTNB 1PDXA 5AUIA 1JALA 1EWYC 2Q5WD 3P1MA 1TYGB 5C2TB 4YSYB 3ZYYX 4P6VF 3AE6B 3AEBB 3AEGB 2WDQB 2M19A 1TJEA 1RYJA 1V97A 1CZPA 1F0ZA 3L4PA 1QOFA 3AECB 3P4QB 2N0SB 3P4PB 3AB5A 1YJJA 5AUKA 1GAQB 4C7ZA 3CIRB 1XLQA 2ACZB 3ABVB 1V8CA 2PVOD 1GPXA 1KF6B 1R7SA 1FRRA 2WU5B 1OQRA 2W55A 1NVID 4N6EB 1E0ZA 4US8A 2L52A 4A9AA 3AV8A 2BT6A 3KWLA 4JWUC 2QJLA 1JRPA 1L0VB 1XLPA 2CU3A 1J7BA 2WP9B 5EE3A 2PVGC 4IDIA 1FXIA 1TKYA 1YQ4B 1XLOA 2JX5A 1VDVA 1J7AA 1ZP0B 2L83A 2W3RA 3HRDD 4ZOHC 2W54A 2CJNA 4YT0B 3VRBB 1TKGA 1NENB 1JWAD 3DWMA 3VR9B 1N61A 1VJKA 1ZOYB 1CJEA 2KAJA 1SF0A 2WS3B 5G5HA 2LEKA 4WQMA 3RPFC 2PIAA 4KX6B 4ITKA 5EE9A 1TKEA 2PKOA 2H89B 3AEEB 2Y5CA 1DOYA 2QIEB 4WWMA 3PO0A 2K9XA 1L6VA 2HTME 3AMZA 3WCQA 3AH7A 1E9MA 1FO4A 4N58A 1FFVA 3VRAB 1QT9A 4JX1C 1QF6A 1N5XA 2MJEA 4N59A 3AE8B 1A70A 2OHFA 3HUIA 5EE0A 1WGKA 1J7CA 2G1EA 3AE7B 1WXQA 2E3TA 3P4SB 1B9RA 3AE1B 2B76B 2H88B 4JWSC 4YSXB 3HVZA 1NYQA 1XO3A 2CJOA 1YJIA 1E7PB 3FAHA 1RWSA 3SR6A 3DWGC 3AE9B 3B2FA 2DBYA 5H92C 3NVZA 1L6UA 4US9A 4YSZB 1I7HA 3W5VB 1PUTA 1QOGA 1VLBA 1JW9D 1FM0D 1FFUA 1WWTA 1E10A 4YTPB 1OQQA 1N62A 3AEFB 1N63A 3EUB2 3AE5B 3W9CB 2WQYB 5C3JB 3LB8C 3NS1A 1QLBB 3P63A 5EE1A 5H8YE 1DOIA 5GXGB 3SFDB 3LXFA 1FMAD 1RM6C 3AM9A 2EKIA 1WRIA 2MJDA 1SB3C 1PFDA 1N5WA 2MH7A 3BIID 2FBWB 2BS2B 2MJ3A 4C80A 3P4RB 2WU2B 5MPOA 1N60A 3W5UB 1KRHA 4ZHPA 3VR8B 2DWQA 3NRZA 2BS3B
chains in the Genus database with same CATH superfamily
1P0RA 2DYOA 1FIQA 4OZAA 1BXTA 3V6CB 4MT5A 2LGXA 4NNJB 3AE2B 1JQ4A 4L2YA 2JWUA 4DHZE 5C23A 2K3UA 4WAAA 1E6EB 4ZHOA 3AE4B 4L23A 3AE3B 3VXWA 1C3TA 1V1PA 3DVGX 4DDGD 1K52A 2LGYA 2WDQB 3NZ3A 2ASQA 1VZ8A 1ZDXA 3AECB 2L0TA 4O1NA 2CR5A 3L17A 2WXMA 1QQRA 1Q0WB 4OVUA 2MBOA 3B08A 1YX5B 4AUQC 3Q6BA 3R3MA 4REZA 1K51A 1WM3A 1WXMA 4IKGA 3QJZA 3Q8AA 3QCAA 3T3OA 4HKQA 3H9DA 1Y8RC 1UZXB 3Q69A 1AN8A 2DZIA 2RR9A 3QARA 3N32A 3A1QB 4IM0A 2JVCA 2CU1A 2C7NB 4EZKA 2Y5BB 2ZCBA 3SR6A 2DZJA 4GDLB 1HTOA 3OAWA 1N62A 5JZEB 1WGRA 5CTRC 2BB5A 2DYMA 1IYFA 4G50A 3P63A 2KQ7A 4K1RB 2K1FA 1A5RA 4WJOA 2JZPA 4W9DA 2MJDA 3UGBB 3ZRCA 3HHMA 4RM9A 1YOVB 5JXVA 2D11A 3VTVA 3DBLB 2RSUA 1HZ5A 1MFWA 2LVPA 2WX0A 2G4DB 1RLFA 2OOBB 1V1OA 4PS3A 1I4HA 2IGDA 1JROA 2PW9A 3U4EG 2MA9B 2V4LA 4J3OD 1F77A 3ZNGC 3H7SA 3RCZA 1UWMA 2IGHA 1VR9A 3P1MA 2PPHA 3O13A 5CHFA 2N9EB 3P4QB 4HK2A 2CHXA 3B0AA 4AWJA 3M63B 4JWUC 5EE3A 2INDC 2N1VA 2W3RA 2GLSA 2ON8A 3PLUA 2MP2A 4ZOHC 2LD9A 1E7VA 3DWMA 2I1JA 2WDTB 2L8JA 2NBVB 2H89B 3PRZA 1GUAB 2D07B 3ZXRA 2JRIB 3KQ4A 2NVUI 3I9V1 2WXQA 4A20A 2GRIA 2LZ6A 2K8CA 3ZLZA 4IOIE 2PJHA 3BVZA 1FCCC 4M00A 2O6VB 3R2TA 1OQQA 3GP7A 4HWIB 4PS8A 3W9CB 4ZRQA 4ASWC 1WRIA 4CQNA 4OHJA 2Z8LA 5FKAC 3BIID 3NZSA 2V0GA 1C79A 2L7RA 1HA5A 3VR8B 2DWQA 2ZCCA 1D5XC 1T3QA 4TQ1A 2AX5A 2W3SA 5D6JB 5TSSA 4WURA 4WH4A 4ZDVA 3Q3FA 1FXAA 3DBHI 4OZBA 5D94A 2JT4B 4ARCA 2WXPA 4PS7A 5C2TB 1ISNA 1WRDB 2N0SB 2KT7A 4RGOS 3U7DA 4M0WA 2YEPB 2WYQA 3A9KA 1V8CA 2YLMA 2MBQA 4PYUA 1V81A 2FCQA 1FNUA 1ZP0B 1OQYA 1C76A 3KWVA 3RNCC 1AARA 4E71A 3RULA 4OVVA 1UNSA 3VUYA 1C9FA 2L0FA 3ZDMC 5HI1A 1K50A 3NJTA 3PHWB 1A70A 4ANUA 2XEWA 2W9NA 3V61A 1CQVA 1WZ0A 1T5XD 1WJNA 4JWSC 3ZQ4A 3RNEC 3APCA 3TEWA 1RWSA 2NPTB 1UBQA 4F7ZA 3ZDTA 4YSZB 4LNNA 2V9HA 3EA6A 3IG3A 3VTUA 4DXFA 2O2VB 2M17A 4ZRJA 2HTHA 2NR2A 5DPTA 5EE1A 5H8YE 2LRUA 3KVFB 1RM6C 2KXJA 1N5WA 4C80A 3MHZA 3JYUA 3PSEB 3N9YC 1KM7A 3GE3C 2N9XA 5LXIB 3WIMA 3SD5A 3IAM1 1V5TA 3X0WA 1NI3A 2KJRA 1AYFA 4FXCA 3P42A 1QOBA 1XD3B 4W9IA 3B9JA 2L05A 3P2BA 1YNTE 3MJ5A 1SIJA 4ICUA 4YSYB 2FCSA 2VZKD 2PEAA 4XWTA 4K7SA 4M02A 1YX6B 2DENB 4B9KA 4GDKB 4CO7A 3DVNU 3L54A 3ZO5B 2KANA 4US8A 5E6PA 1VD2A 4GDLA 1ENFA 2DYBA 1KLUD 2FAZA 2AQ1B 3TEYA 3NS8A 3AULA 3FILB 5DPWA 1WGHA 3OG5A 4EKUA 1QZEA 5EE9A 1K8RB 2M1MA 4KIKB 3MC9A 1KTKA 2LGDA 3IBEA 4KKJA 2MLBA 3WCQA 3WA0A 4EFOA 3DBRI 2N7DA 1L0XB 3UI3A 3QWZB 5LXHA 3NHEB 3AE1B 2ZZPB 3FAHA 2MBEA 1J19A 3OJ3A 2ZPYA 1LQBA 2WXJA 2BQQA 4A3PA 3IAS1 1YN4A 2L76A 1FD6A 4PYZA 3UQBA 2I1KA 4AJWA 5JHAA 2CHWA 3ZVVA 4IWOA 4MH0E 3AM9A 2PE6B 2NBWB 1F2RI 2KHWB 1ACCA 4BKGA 2WLBA 2WDRB 1L5PA 1C78A 1ZUD2 3O65B 5HKHA 4XZ4A 1ZDVA 4K7UA 1SSNA 3V05A 2BPSA 3BYTB 2BS4B 1WYGA 5DCNA 2Q5WD 3GB1A 1R4MB 2MHJA 2ZVNA 2M19A 3RNAC 3MFGA 4RNAA 1TBEA 3QQ8B 1Y56A 2D10A 3DVNV 4C7ZA 2MX2A 1E7UA 3GOEA 2LI5A 2WU5B 2IYDB 4K7WA 2O6VA 1B9RA 4NJ6A 5BMHA 3NZUA 3KUDB 5C1ZA 2JRHA 3U30A 2BYVE 1NENB 1C4CA 3KH0A 5LNK1 4DQOC 2BYTA 3ZJTA 5BO4B 1H4RA 2MW5A 3Q8EA 4KX6B 2BYFA 3DQVA 4HCPB 4W9CA 3Q3OC 2QIEB 1L6VA 2WXKA 1I42A 4ICVA 1SE2A 1PQSA 2IDYA 2M4NA 2KVZA 2KC2A 2V3SA 2KDBA 2MSED 4EUTA 1UD7A 5I4DA 4MJSA 2AL6A 2M0AA 2HE7A 3JW0X 4C56C 4LNOA 3ENEA 2UU7A 4XYCA 2FUHB 2VZKB 3PZDA 3ZNHB 2FBWB 3KYCD 5MPOA 3ZNZB 2QDFA 2KFKB 2KWCA 1VCBA 2G4SA 3FKYA 4MM3B 3U8ZA 3KUCB 3ALBA 5G5GA 4YXDB 4GN1A 3MC0B 2ONQA 3JSVB 1RFKA 1ROEA 1QOAA 4E3CA 4TSSA 1WF9A 1TYGB 2BWES 3Q14C 1GJZA 3C8YA 1GB1A 2QMTA 5DPSA 5AUKA 4IG7B 4M01A 5CX3A 3R8BA 4IWQA 2BB6A 3K9OB 1JRPA 1C4AA 2CU3A 3DDCB 1YQ4B 1XLOA 1YN5A 2JX5A 1TS5A 1X1MA 2J7QB 2RPVA 2GBNA 4HLEA 1ZOYB 3M95A 3QK0A 2D3AA 3R2IA 2RMMA 4ITKA 2PKOA 3AEEB 2DZKA 3RNGC 2FE8A 1E5WA 2KYWA 1EF1A 2OJWA 2GOWA 1WI0A 3HUIA 4LCDE 3VUWA 2KD0A 1L2NA 4YSXB 1CMXB 3RYTA 3TEZA 3UIOB 4W9KA 1EM7A 1JWUD 3DHHC 3TEXA 5G55A 3W1SA 3NS1A 2PLPA 1RRBA 1L4ZB 2MH7A 2KFJA 4DBGA 2KLCA 1IBXB 3WAPA 2AYOB 1GG3A 1SGHA 2KMMA 2GBJA 3B2GA 4MGIE 4XX5A 2L00B 3OJ4B 2MQJA 4FLHA 5KHQA 1DGJA 4B95A 2BKRB 4KDLB 1KH0A 1QILA 4C7YA 2K5PA 2KK8A 1XCTL 2LXAA 1JWMD 4KIKA 4P1BC 5TR5A 3RNBC 1D3ZA 3WAOA 2FNJB 4ZRIA 2B3AA 3AE6B 3AEGB 2L3ZA 1IPGA 1CZPA 3AB5A 4JQWC 4BVUC 1D5MC 5KHOA 2KOXA 2BT6A 1XLPA 1UH6A 2PVGC 1VDVA 2KLGA 4KSKC 4YT0B 2WXNA 3VUXA 2IJ0A 3APFA 2IO2B 1XEEA 2IBIB 5E6JA 1T0QC 4WWMA 3AMZA 2HTME 2KZRA 4BKTA 4N59A 3QC8B 2NTSA 3A9JB 5D3DA 2JXXA 4KDIC 4GXBA 4LLGM 5D2MB 1YJIA 1PYWD 3UQAA 1AW7A 3HM3A 1STEA 4BKSA 1L6UA 4US9A 3GZNI 1QKZA 2Z0DB 4Q2JA 1E10A 3PLVA 3EUB2 2HJ8A 1N63A 2WXIA 3ZTDA 4OW0A 1C4PA 2ICIA 2JU6X 3HK0A 1E8YA 2C60A 4OZCA 1ET6A 3BVGA 1XXGA 4HDQA 1ZPSA 5J17A 3A4RA 2M8SA 2G3QB 2A5UA 4E74A 4BBNF 4HEA1 2JZ3B 4PT5A 1MHXA 2BGFA 3T9LA 4KGTA 1D6EC 2LUEA 3QIJA 5IAAC 1NEKB 2XNAC 4HDOA 3GE8C 4RFBA 4RH6A 1L7YA 1KFYB 1H8CA 3SEBA 3H1UA 3UIPB 1WMHB 1TIFA 2ZEQA 4GSWA 1R4NI 1F0ZA 2KTRB 2LJ5A 2V4IB 3AXCA 3MP9A 4LDTD 1MI0A 3L0WB 1SE4A 2UYZB 3RFZB 4N6EB 3DVGY 3U2SC 2QJLA 1IP9A 2J0MA 2WXRA 2WXFA 4XWWA 5J18A 2W54A 4B0EA 2CJNA 3T8MA 4D2KA 1DYQA 3V62A 4II2B 1WX7A 2PIAA 3I5JC 1VZ7A 1WFYA 3IXSA 3AH7A 2KFKA 1N5XA 4MM3A 3MTNB 3H7PB 4AS1A 2B76B 3WAMA 2N1WA 3JSVA 1V5OA 2KKCA 1JW9D 4DDID 1JMLA 2JWZA 4QAYA 1HQRD 1ZW7A 4P7IA 4RF1A 1WXAA 3R66C 2FCNA 3KLSX 1FNWA 4UDUC 2ZW1A 5FR3A 2PMVA 4N9F4 5HHDG 1TGZB 2G9HD 2BS3B 3IVFA 1ESFA 4WWPA 2XK5B 1YN3A 2QSDA 1KLGD 2R2OA 1MG8A 3AEAB 1I4QA 3PS6A 2DZMA 3R7RA 2KWUB 1EWCA 1UBIA 3PZ8A 5JHBA 1I35A 3VVWB 4ZRKA 3W1YA 1PGXA 2K8HA 2MWSB 4AJYB 1KOTA 1HEZE 1I4PA 1SBBB 3DOWA 4KGSA 1QOFA 3CMMB 4A3OA 3ABVB 2ZNVC 2W55A 2INCC 3NY5A 1WR1A 4LNFA 3L10B 1TKGA 4HCNB 3RMKC 1JWAD 2IO1B 3I63C 4DXAB 4W9EA 3A1QA 4F8CB 3ZJVA 2HDEA 5BYSA 3DBLI 5IO9A 1LGRA 1KLVA 3TSSA 2LGSA 3DHGC 1PGAA 3ONSA 1FFVA 1NDDA 2JPHA 2DX5B 3ZXVA 2K6DB 2C5LC 1V86A 3Q3MC 5EDSA 1HXYD 3HVZA 1XO3A 3VHTC 4B0MA 1WGGA 2KN4A 2RGFA 3E56A 3IHPC 1WJ6A 4NQKE 1FM0D 1L4DB 2QILA 2KN5A 2RD0A 2ZVOA 4A90A 3EGRA 2XN9C 3ZW3A 1TS4A 1I4XA 3Q8FA 4WJPA 4BOZB 4CHKA 2M56B 3WALA 1BT0A 1OEYA 3TBLD 1LFDA 2LVQA 1NYRA 1E8ZA 3SFEB 1JWBD 3TCAA 3NVWA 4M8NA 2KDIA 1TZOA 3VH3B 3ETRA 4USAA 1T0RC 3EFUA 4P1CC 2REXA 4FJVB 2WDVB 1T6BX 4G11A 3Q3JA 5AUIA 1UUPA 3R7QA 3V6EB 3ZYYX 3EC8A 4P6VF 3A9JA 4ZYNA 2NTTA 4HPPA 1V49A 2IPKD 3S2AA 1L0YB 1K53A 4HPMB 4NJCA 2R61A 5BMIA 3AV8A 4G0NB 3SDLC 3NG0A 2MCNB 4L1BA 3Q8CA 1UWXA 2V1YA 2NCNA 2BF8B 4RMAA 2GBMA 1F2RC 2WS3B 4AP4C 3RPFC 1HZ6A 2LVOA 2MP2B 2WX1A 5BYQA 3MJWA 3PT2B 1U4AA 1FEHA 2DAJA 5FK9C 5EE0A 2N9KA 2WHIA 4NPNA 2G1EA 3AE7B 2E3TA 3BZDB 4EE2A 2JXTA 3PVLA 1NYQA 4I6NB 3N1XC 3U52E 3C19A 1UGMA 3Q8BA 1BUIC 1MVKA 1WSPA 2KMCA 3AE9B 2JF5A 3GS2A 5AZGA 3NVZA 2N9LA 3PREA 3BYYB 4JL9A 2RPQA 4KKIA 1WWTA 2MRPA 3AE5B 1WMHA 5AZFA 3LB8C 2LHDA 4BZAA 2AEHA 1V9JA 4DHZB 3SFDB 4JGHB 5GXGB 2KTRA 5BYRA 3TL5A 1IGDA 3NUHB 4PK1A 1VZ6A 4F1SA 1KRHA 2OJRA 4AQ7A 1J8CA 2GBKA 4KZ0A 2DAFA 3VH4B 4K81A 3RN9C 4URKA 1ZE3D 2C9WB 3BVMA 1JCKB 2UWQA 4KV2A 4MSQB 2BKFA 3AN1A 3RT3B 4LNIA 1FRDA 3ZGZA 2Z59B 1JRUA 2KNBA 3QA8A 2IO0B 1C77A 3H7PA 3L4PA 2WXGA 4KGRA 3KW5B 3M3JA 3N1ZC 3ZTCA 1F52A 1P9DU 3KWLA 1L0VB 1UF0A 1ZXHA 1TKYA 3HRDD 3RZWC 3K9PB 3A9KB 3QHTA 4KSLC 3VR9B 4H2AA 4AOFA 4MDKE 3LDZE 2A4ZA 2LEKA 4ARIA 2JSVX 4C00A 3CSFA 4A6QA 2I38A 1S1QB 1GOZA 3OLMD 1FNVA 3DBHB 3TJPA 2XK5A 3KYDD 5IOIA 1F9JA 2NPTA 1Z5SB 4EEWA 4IM2A 3N3KB 3NOBA 1HTQA 3QX1A 1HE8A 2O2VA 2MBHA 2Y3AA 3PRMB 4S17A 3I3TB 4HJGE 4NAMA 1PUTA 2RDHA 3RI7C 2SAKA 1WE7A 1FFUA 1WE6A 4YTPB 3AEFB 4WIPA 1WH3A 2LUMA 4EZLA 5HG2A 2Z0EB 1QLBB 4GOCA 4NAWB 4CYEA 2EKIA 3RZFA 2O6VD 1SB3C 3BWUD 1MJDA 5E6NA 1OGWA 1RAXA 3J9CA 3PRPB 3NRZA 2VRRB 3HVDA 3SHQA 1KJTA 3PTFC 4GGQA 3VAWA 3AEDB 4BBNC 1FCLA 4HRSA 3W1SC 3ZIMA 1TZ1A 2IGGA 2KJHB 4BOSC 4LK0M 3CWIA 4K3CA 4GDKA 3CSTA 2ZNVB 3AEBB 4WWNA 1V97A 4I6PA 4TMAB 2INNE 1YJJA 2LXCA 5LLIA 4R3DA 1GPXA 2PVOD 2YEPF 5BMGA 3FILA 1FRRA 1YQBA 1XCQL 2KVRA 1T0YA 1E0ZA 2SEBD 2VH1A 5D3IB 2WP9B 3CF6E 1J7AA 2WXOA 2BYEA 1WR6E 1SE3A 2D3GA 1Q1OA 1SF0A 3EHVA 4WQMA 1WGDA 4WJNA 1DOYA 2JUOA 3ZNID 2K9XA 4ZYSA 3VRAB 1QF6A 1GB4A 1M94A 3AE8B 3VTWA 3T3NA 2K6QA 2KWDA 2H88B 1ZGUB 3ML9A 1E7PB 2Y5PA 3B2FA 2DBYA 5H92C 3Q3NC 3D32A 1WX8A 3W5VB 1R4MI 4RGMA 1D5ZC 1TT5B 4BFRA 3BINA 2BWFA 2ZW0A 1DOIA 3PZ7A 3PGEA 4FBJB 1FMAD 1OTRB 2W82A 1Z2MA 4NJ7A 3N20C 3P4RB 1OEYJ 1N60A 2WGSA 1P7FA 4KVGB 2N7JA 2JYEA 4YTMB 4MGZE 2JQRB 3DBRB 2KMAA 2IO3B 4I6LB 2K22A 5D7GA 1TS3A 4LTUA 2CHZA 2J53A 1NI2A 1EU4A 3HIZA 4BAXA 3TMPB 3BK1A 4WQOB 4G3XB 1IUEA 4TUUA 4GIVA 3A33B 1PDXA 2BTEA 1JALA 2FUG1 2DNFA 3U7ZA 3H6NA 4NZLB 2DHZA 4RGNA 4ZRPA 3P4PB 4C4VB 2JYTA 2QEJC 1G6JA 3B1LX 1OQRA 1RFAA 2K0PA 2X8XX 5G2NA 4HXDA 3VRBB 4IDIA 1WZ3A 4RM8A 5AZHA 3PPAA 4DHJD 4LJOB 3EECA 2V3NA 4IW0A 2BW2A 4ANWA 2IZVB 3OWEB 4HPLB 4HKZE 5G5HA 3E9SA 4WAFA 1XT9B 2MBBB 2Y5CA 3PO0A 2NMQA 4FULA 1SJHD 5T8IA 2LMCA 4JE3B 1FO4A 1C1YB 1E9MA 2RDBC 2V3PA 2WNMA 2BVCA 1LXDA 3AU5A 2KDEB 2TSSA 1WGKA 4K3BA 2R2QA 1V2YA 2J0KA 4HJKA 3APDA 3A4SC 3QAQA 4RCOA 1I7HA 1XQQA 5CHWA 5C3JB 3JVZX 3Q2AC 4MJSB 3LXFA 4NY0A 2L32A 4MSMB 3RD2A 1D4BA 2NS5A 2WU2B 2GI9A 4DK5A 5DPRA 2QC8A 4ZHPA 2KQ4X 2L52A 1TTNA 2JY6A 1WGYA 4XE0A 4JIOU 2J42A 3NVVA 3C0RB 5E6OA 3DHIC 2WXLA 2WXHA 2NBUA 2ZJDA 1UGJA 4XDCA 2IY0B 3BK2A 4MGKE 2XBBC 1E90A 1PGBA 4IUMB 4HROA 4RGTA 4YTNB 1MG4A 1WX9A 1EWYC 3MC8A 1I4RA 4FJZA 1VRAB 2GMIC 2LGIA 3TIXA 5HFYA 2QHOA 4BKSD 4J6IA 1FXTB 2CS4A 2LHEA 4FADA 1XLQA 2LFIA 2AWTA 1R7SA 1SIFA 2J4XA 4FN2A 4A9AA 2J52A 1GNUA 3IT4B 4TQ0A 2KC1A 5L95C 3URYA 2ZPNA 4NAWA 4FA6A 1P98A 3VDZA 4LNKA 3AU4A 1ZKHA 3X23A 2LASA 4FJYA 1V1PB 4DWFA 1EUVB 1FPYA 2GBRA 4JX1C 2C7MB 2MJEA 1WXVA 5IN7A 4W9GA 4XC2A 5GMVA 2E6XA 2CJOA 2D3BA 1SE9A 4ACFA 1LM8B 3N30A 3W2DA 2D5GA 1QOGA 1IBXA 1YIWA 1WJUA 4IWPA 1SJED 2FIDA 2L1AA 2K8BA 3IFWB 4P16A 2BS2B 1N6ZA 1T0SC 1WYWB 3LYYA 1OFFA 4MACA 1AWDA 4IC7B 1TS2A 4YWGG 3RNFC 3RUIB 2J0JA 1XLNA 5J2RA 4DHJB 2LWPA 4EZJA 2M0XA 1WJ4A 3UINB 1Q10A 2K39A 2KACA 1MPEA 1ZXIA 4LDTB 1YMHE 2JZZA 2D2QA 1P1AA 2HJ1A 2VH2A 1P7EA 4W9LA 4ANXA 5L83A 1RYJA 1WIAA 3ZJUA 1UELA 3PV1A 5JH5C 4YL8A 2ACZB 2KX0A 4A8XC 1KF6B 3IT6B 4GLSC 1NVID 4B6WA 3L08A 4ANVA 1YJ1A 4M8MA 4W9FA 1FXIA 1EO6A 2L83A 4HVBA 2K25A 2KDFB 1CK1A 3DBSA 1CJEA 2KAJA 4MH8A 2N7EA 2KQSA 1TKEA 4EOYA 2EMTA 4KZCA 4MEMA 1S3SG 2GB1A 4GB9A 4WWOA 4A55A 4N58A 2EKEC 2CKHB 1QT9A 3BY4B 4GMVA 3WANA 1XF5L 2OHFA 3PHXB 1IGCA 3M62B 4S0RA 2OEDA 3V60A 3DPDA 1WXQA 2N4FA 4XDDA 3L16A 2I2YA 2EELA 1TY0A 2X38A 2N9PC 4TKNA 4XGAB 3UF8A 4GU2A 1E8XA 4W9JA 1NBFC 2AQ3B 2RDGA 3ZUNA 3L13A 2AQ2B 2LRWA 3V3XA 4DXGA 2KJ6A 4C4VA 1PFDA 1P3QU 2HD5B 3ML8A 3W5UB 4II3B 3LJ3A 4JLCA 3NVYA 1J0GA 4W9HA 1TY2A 2MEKA 3DCGA 1Q5WB 1F1HA 1E8WA 1WY8A 2KDMA 5CHVC 2YVCA 1I4GA 4JPSA 1YQ3B 1DOXA 3FC4A 1EU3A 3VFKA 1GC7A 2LJIA 4TV3A 3GZNB 4WJQA 1ET9A 2FIFA 1TJEA 3SU8X 3AI5A 4FHKA 1GAQB 3CIRB 3H8HA 1YD8U 5IA7A 2C7HA 3HM6X 1SXTA 2BBCA 3EFCA 1J7BA 1WM2A 4LJPB 1JWSD 5AEKB 1V80A 4MGYE 1N61A 1VJKA 4X57B 1M4VA 2D3CA 2IY1B 1MHHE 3MHSD 2QCZA 2KO3A 2DLBA 5IKCM 4RF0A 2KWVB 4FHJA 1B1ZA 1J7CA 3P4SB 5IP4D 1R4NB 2KTFA 3KUZA 4M0WB 4IM3A 2WWZA 3DWGC 2FCMA 2EMSA 1GC6A 3N1YC 1EF5A 1SEBD 2AL3A 3ZRFA 1VLBA 2INPE 1BMLC 2WQYB 1LO5D 3VQIA 2KX3A 3TUOA 3ECIA 1WXSA 2PE9A 4NQLB 1V6EA 2G45B 2MJ3A 4OVZA 5FR6A 3ZKJC 2PTLA 4MELA 3I57A
chains in the Genus database with same CATH topology
1ACCA 1P7FA 2N7JA 2DYOA 1FIQA 4OZAA 1YN3A 2WLBA 2WDRB 1L5PA 1BXTA 2QSDA 1KLGD 2JYEA 4MT5A 1C78A 1ZUD2 4YTMB 3AE2B 2JQRB 1JQ4A 4L2YA 3AEAB 2JWUA 1I4QA 4TQ0A 2K22A 1ZDVA 1TS3A 5D7GA 4LTUA 2K3UA 2J53A 1E6EB 1EU4A 1EWCA 1SSNA 3V05A 3AE4B 3BK1A 4L23A 4ZHOA 3PZ8A 3AE3B 1IUEA 3BYTB 1V1PA 2BS4B 1WYGA 1K52A 2BTEA 1PDXA 1JALA 2Q5WD 2FUG1 1PGXA 3GB1A 3U7ZA 1ESFA 4NZLB 1HEZE 2WDQB 2M19A 3NZ3A 3MFGA 1I4PA 4RGNA 4RNAA 1SBBB 1VZ8A 1ZDXA 4KGSA 1QOFA 3AECB 4ZRPA 3P4PB 4O1NA 1Y56A 4C7ZA 3ABVB 2JYTA 2QEJC 2WU5B 2WXMA 1OQRA 1QQRA 2K0PA 2W55A 1B9RA 3VRBB 5BMHA 4IDIA 1TKGA 1NENB 1JWAD 1C4CA 4REZA 2V3NA 1K51A 2BW2A 5LNK1 4DQOC 4IKGA 3OWEB 2BYTA 3ZJVA 3ZJTA 4HKZE 5G5HA 3E9SA 2HDEA 3Q8AA 3T3OA 5BYSA 4HKQA 3Q8EA 4WAFA 4KX6B 2Y5CA 3Q69A 2QIEB 1AN8A 3PO0A 2NMQA 1SJHD 1L6VA 5T8IA 2LMCA 2WXKA 4JE3B 1E9MA 3TSSA 1FO4A 1PGAA 1FFVA 2V3PA 2WNMA 1SE2A 2TSSA 1WGKA 2IDYA 1HXYD 3HVZA 1XO3A 5I4DA 2M0AA 4B0MA 3SR6A 4C56C 2KN4A 4RCOA 3E56A 4GDLB 1I7HA 1FM0D 1L4DB 1N62A 2BB5A 2QILA 5C3JB 2DYMA 4A90A 3EGRA 2VZKB 3P63A 2XN9C 3LXFA 2JZPA 2MJDA 2L32A 1D4BA 2FBWB 2WU2B 5MPOA 2GI9A 5JXVA 1TS4A 1I4XA 4ZHPA 2KQ4X 3Q8FA 2L52A 1HZ5A 2M56B 4XE0A 1NYRA 2J42A 3NVVA 1V1OA 1I4HA 2WXLA 2WXHA 1JWBD 3SFEB 4MM3B 2IGDA 3NVWA 1JROA 2PW9A 5G5GA 3U4EG 1UGJA 4XDCA 1TZOA 4YXDB 3BK2A 4J3OD 3ETRA 4USAA 3MC0B 2ONQA 1F77A 1PGBA 1RFKA 4HROA 4RGTA 2WDVB 1ROEA 1T6BX 1QOAA 1UWMA 4YTNB 2IGHA 5AUIA 1VR9A 4TSSA 1EWYC 1UUPA 3P1MA 1TYGB 1I4RA 3ZYYX 1VRAB 4P6VF 2LGIA 2NTTA 3C8YA 3O13A 5HFYA 1GB1A 3P4QB 2IPKD 2QMTA 2LHEA 5AUKA 1L0YB 1XLQA 1K53A 2LFIA 4NJCA 1R7SA 3R8BA 2R61A 2J4XA 2BB6A 5BMIA 4A9AA 2J52A 3AV8A 4JWUC 5EE3A 1JRPA 1C4AA 2CU3A 3IT4B 1YQ4B 4L1BA 1XLOA 1YN5A 2JX5A 2W3RA 1TS5A 1UWXA 2ON8A 3Q8CA 4ZOHC 3URYA 2RPVA 3DWMA 1ZOYB 1F2RC 2WS3B 3RPFC 3R2IA 2RMMA 1HZ6A 4ITKA 2PKOA 2H89B 3AEEB 1V1PB 2FE8A 5BYQA 4JX1C 2MJEA 3KQ4A 1FEHA 5FK9C 3HUIA 5EE0A 2N9KA 3I9V1 2WXQA 2G1EA 3AE7B 2E3TA 3BZDB 2GRIA 4EE2A 2E6XA 4YSXB 2JXTA 1NYQA 2CJOA 4IOIE 3U52E 3Q8BA 1BUIC 1MVKA 3BVZA 1WSPA 3TEZA 3AE9B 3GS2A 1EM7A 1FCCC 3NVZA 3W2DA 2N9LA 1JWUD 2D5GA 3BYYB 1QOGA 3R2TA 4KKIA 1WWTA 1OQQA 1IBXA 3AE5B 3GP7A 3W9CB 3TEXA 3LB8C 4ZRQA 3W1SA 3NS1A 2LHDA 1SJED 3SFDB 5GXGB 2PLPA 5BYRA 1IGDA 2L1AA 1WRIA 4CQNA 1L4ZB 4OHJA 2Z8LA 2MH7A 4P16A 3BIID 5FKAC 2BS2B 3NUHB 2V0GA 1VZ6A 1C79A 1HA5A 1KRHA 1IBXB 3VR8B 2DWQA 3LYYA 1OFFA 4MACA 1AWDA 2KMMA 4AQ7A 3B2GA 1D5XC 1TS2A 4YWGG 1T3QA 4TQ1A 2AX5A 1XLNA 2W3SA 1DGJA 1ZE3D 3BVMA 1JCKB 5TSSA 4WURA 4WH4A 1KH0A 1QILA 3AN1A 4C7YA 2K5PA 1XCTL 1FXAA 1Q10A 1FRDA 1JWMD 2KACA 3ZGZA 1MPEA 1ZXIA 4OZBA 1YMHE 4ARCA 2WXPA 5C2TB 1P7EA 3AE6B 3AEGB 1C77A 1RYJA 1CZPA 3L4PA 3ZJUA 2N0SB 2WXGA 4RGOS 3AB5A 4KGRA 1D5MC 2YEPB 4M0WA 2ACZB 4A8XC 1V8CA 1KF6B 3IT6B 4GLSC 1NVID 2BT6A 3KWLA 1L0VB 1XLPA 2PVGC 1FXIA 1TKYA 1ZXHA 1VDVA 2L83A 1FNUA 1ZP0B 3HRDD 1C76A 3KWVA 4YT0B 1UNSA 3VR9B 4H2AA 2WXNA 1C9FA 2IJ0A 5HI1A 1CK1A 1CJEA 2KAJA 2LEKA 4ARIA 2JSVX 1XEEA 4MH8A 5E6JA 1TKEA 1K50A 4A6QA 2I38A 4WWMA 1GOZA 2GB1A 3AMZA 1FNVA 2HTME 4A55A 4N58A 1QT9A 4N59A 1A70A 1XF5L 2NTSA 2OHFA 5D3DA 1IGCA 2OEDA 1CQVA 1WXQA 1T5XD 4XDDA 4JWSC 2I2YA 2EELA 1TY0A 3ZQ4A 4LLGM 2X38A 1YJIA 1PYWD 3TEWA 1AW7A 1RWSA 2Y3AA 1STEA 1L6UA 4US9A 4YSZB 4HJGE 4NAMA 1QKZA 1PUTA 2AQ3B 2RDHA 2SAKA 3EA6A 1FFUA 4Q2JA 2RDGA 4YTPB 3AEFB 3EUB2 4DXFA 1N63A 1E10A 4WIPA 2WXIA 2LUMA 4OW0A 5HG2A 1C4PA 2ICIA 2JU6X 1QLBB 2AQ2B 4NAWB 5EE1A 5H8YE 3V3XA 1RM6C 4DXGA 2EKIA 4OZCA 1ET6A 3BVGA 1SB3C 1PFDA 1N5WA 1XXGA 3BWUD 1ZPSA 4C80A 3MHZA 3W5UB 3J9CA 3N9YC 3NRZA 4HEA1 3NVYA 4PT5A 1MHXA 3HVDA 1TY2A 2MEKA 4KGTA 1D6EC 3IAM1 3AEDB 1NI3A 1AYFA 1FCLA 2KDMA 4HRSA 1NEKB 2XNAC 1I4GA 4RFBA 4RH6A 4FXCA 4JPSA 1YQ3B 3P42A 1QOBA 1KFYB 2IGGA 1DOXA 3B9JA 3FC4A 1EU3A 1YNTE 3CWIA 4LK0M 3MJ5A 1SIJA 3SEBA 2LJIA 1ET9A 4YSYB 2VZKD 3AEBB 1TJEA 1V97A 4TMAB 1F0ZA 2INNE 2V4IB 3MP9A 4XWTA 1MI0A 1YJJA 1SE4A 1GAQB 4R3DA 4GDKB 3CIRB 1GPXA 2PVOD 2YEPF 5BMGA 3H8HA 3FILA 1FRRA 3RFZB 1XCQL 4N6EB 1E0ZA 4US8A 2SEBD 1ENFA 1SXTA 5D3IB 3U2SC 2QJLA 2BBCA 1J7BA 2WP9B 1KLUD 2WXRA 2WXFA 1JWSD 4XWWA 1J7AA 2W54A 2WXOA 2AQ1B 2CJNA 4B0EA 4D2KA 3TEYA 1DYQA 1SE3A 3FILB 1N61A 1VJKA 1M4VA 1SF0A 4WQMA 1MHHE 2PIAA 5EE9A 2DLBA 1KTKA 1VZ7A 1DOYA 4KKJA 2K9XA 3IXSA 3WCQA 4ZYSA 3AH7A 4RF0A 3VRAB 1QF6A 1N5XA 1GB4A 3AE8B 1B1ZA 1L0XB 3T3NA 1J7CA 3UI3A 3P4SB 4AS1A 3AE1B 2KWDA 2B76B 2H88B 1E7PB 3FAHA 2Y5PA 3DWGC 3B2FA 2DBYA 5H92C 1SEBD 2WXJA 3IAS1 3W5VB 1VLBA 2INPE 1JW9D 1YN4A 1JMLA 1FD6A 1BMLC 4RGMA 2WQYB 1D5ZC 1HQRD 4RF1A 1LO5D 3VQIA 2ZW0A 1DOIA 3PZ7A 3TUOA 1FMAD 3AM9A 2W82A 3KLSX 2MJ3A 1FNWA 4OVZA 3P4RB 4UDUC 1N60A 2ZW1A 5FR3A 2PMVA 2PTLA 1F2RI 5HHDG 2G9HD 3I57A 2BS3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OFF A;  3NVY A;  1AWD A;  2KMM A;  2M56 B;  3B2G A;  1FIQ A;  2WLB A;  2WDR B;  1L5P A;  1NYR A;  4YTM B;  1ZUD 2;  3NVV A;  3AE2 B;  1T3Q A;  2JQR B;  1JQ4 A;  2AX5 A;  3AEA B;  1JWB D;  3SFE B;  3AED B;  1NI3 A;  3NVW A;  1JRO A;  1AYF A;  1XLN A;  2W3S A;  1DGJ A;  4HRS A;  5G5G A;  1NEK B;  2K22 A;  4YXD B;  4LTU A;  4FXC A;  1YQ3 B;  1E6E B;  3AN1 A;  4C7Y A;  1QOB A;  2K5P A;  1KFY B;  3ETR A;  4USA A;  1DOX A;  4ZHO A;  1FXA A;  3AE4 B;  3B9J A;  3FC4 A;  1FRD A;  1ZXI A;  3AE3 B;  3CWI A;  1IUE A;  1RFK A;  4HRO A;  2WDV B;  1ROE A;  1SIJ A;  1QOA A;  1UWM A;  2BS4 B;  1WYG A;  4YTN B;  1PDX A;  5AUI A;  1JAL A;  1EWY C;  2Q5W D;  3P1M A;  1TYG B;  5C2T B;  4YSY B;  3ZYY X;  4P6V F;  3AE6 B;  3AEB B;  3AEG B;  2WDQ B;  2M19 A;  1TJE A;  1RYJ A;  1V97 A;  1CZP A;  1F0Z A;  3L4P A;  1QOF A;  3AEC B;  3P4Q B;  2N0S B;  3P4P B;  3AB5 A;  1YJJ A;  5AUK A;  1GAQ B;  4C7Z A;  3CIR B;  1XLQ A;  2ACZ B;  3ABV B;  1V8C A;  2PVO D;  1GPX A;  1KF6 B;  1R7S A;  1FRR A;  2WU5 B;  1OQR A;  2W55 A;  1NVI D;  4N6E B;  1E0Z A;  4US8 A;  2L52 A;  4A9A A;  3AV8 A;  2BT6 A;  3KWL A;  4JWU C;  2QJL A;  1JRP A;  1L0V B;  1XLP A;  2CU3 A;  1J7B A;  2WP9 B;  5EE3 A;  2PVG C;  4IDI A;  1FXI A;  1TKY A;  1YQ4 B;  1XLO A;  2JX5 A;  1VDV A;  1J7A A;  1ZP0 B;  2L83 A;  2W3R A;  3HRD D;  4ZOH C;  2W54 A;  2CJN A;  4YT0 B;  3VRB B;  1TKG A;  1NEN B;  1JWA D;  3DWM A;  3VR9 B;  1N61 A;  1VJK A;  1ZOY B;  1CJE A;  2KAJ A;  1SF0 A;  2WS3 B;  5G5H A;  2LEK A;  4WQM A;  3RPF C;  2PIA A;  4KX6 B;  4ITK A;  5EE9 A;  1TKE A;  2PKO A;  2H89 B;  3AEE B;  2Y5C A;  1DOY A;  2QIE B;  4WWM A;  3PO0 A;  2K9X A;  1L6V A;  2HTM E;  3AMZ A;  3WCQ A;  3AH7 A;  1E9M A;  1FO4 A;  4N58 A;  1FFV A;  3VRA B;  1QT9 A;  4JX1 C;  1QF6 A;  1N5X A;  2MJE A;  4N59 A;  3AE8 B;  1A70 A;  2OHF A;  3HUI A;  5EE0 A;  1WGK A;  1J7C A;  2G1E A;  3AE7 B;  1WXQ A;  2E3T A;  3P4S B;  1B9R A;  3AE1 B;  2B76 B;  2H88 B;  4JWS C;  4YSX B;  3HVZ A;  1NYQ A;  1XO3 A;  2CJO A;  1YJI A;  1E7P B;  3FAH A;  1RWS A;  3SR6 A;  3DWG C;  3AE9 B;  3B2F A;  2DBY A;  5H92 C;  3NVZ A;  1L6U A;  4US9 A;  4YSZ B;  1I7H A;  3W5V B;  1PUT A;  1QOG A;  1VLB A;  1JW9 D;  1FM0 D;  1FFU A;  1WWT A;  1E10 A;  4YTP B;  1OQQ A;  1N62 A;  3AEF B;  1N63 A;  3EUB 2;  3AE5 B;  3W9C B;  2WQY B;  5C3J B;  3LB8 C;  3NS1 A;  1QLB B;  3P63 A;  5EE1 A;  5H8Y E;  1DOI A;  5GXG B;  3SFD B;  3LXF A;  1FMA D;  1RM6 C;  3AM9 A;  2EKI A;  1WRI A;  2MJD A;  1SB3 C;  1PFD A;  1N5W A;  2MH7 A;  3BII D;  2FBW B;  2BS2 B;  2MJ3 A;  4C80 A;  3P4R B;  2WU2 B;  5MPO A;  1N60 A;  3W5U B;  1KRH A;  4ZHP A;  3VR8 B;  2DWQ A;  3NRZ A;  2BS3 B; 
#chains in the Genus database with same CATH topology
 1P0R A;  2DYO A;  1FIQ A;  4OZA A;  1BXT A;  3V6C B;  4MT5 A;  2LGX A;  4NNJ B;  3AE2 B;  1JQ4 A;  4L2Y A;  2JWU A;  4DHZ E;  5C23 A;  2K3U A;  4WAA A;  1E6E B;  4ZHO A;  3AE4 B;  4L23 A;  3AE3 B;  3VXW A;  1C3T A;  1V1P A;  3DVG X;  4DDG D;  1K52 A;  2LGY A;  2WDQ B;  3NZ3 A;  2ASQ A;  1VZ8 A;  1ZDX A;  3AEC B;  2L0T A;  4O1N A;  2CR5 A;  3L17 A;  2WXM A;  1QQR A;  1Q0W B;  4OVU A;  2MBO A;  3B08 A;  1YX5 B;  4AUQ C;  3Q6B A;  3R3M A;  4REZ A;  1K51 A;  1WM3 A;  1WXM A;  4IKG A;  3QJZ A;  3Q8A A;  3QCA A;  3T3O A;  4HKQ A;  3H9D A;  1Y8R C;  1UZX B;  3Q69 A;  1AN8 A;  2DZI A;  2RR9 A;  3QAR A;  3N32 A;  3A1Q B;  4IM0 A;  2JVC A;  2CU1 A;  2C7N B;  4EZK A;  2Y5B B;  2ZCB A;  3SR6 A;  2DZJ A;  4GDL B;  1HTO A;  3OAW A;  1N62 A;  5JZE B;  1WGR A;  5CTR C;  2BB5 A;  2DYM A;  1IYF A;  4G50 A;  3P63 A;  2KQ7 A;  4K1R B;  2K1F A;  1A5R A;  4WJO A;  2JZP A;  4W9D A;  2MJD A;  3UGB B;  3ZRC A;  3HHM A;  4RM9 A;  1YOV B;  5JXV A;  2D11 A;  3VTV A;  3DBL B;  2RSU A;  1HZ5 A;  1MFW A;  2LVP A;  2WX0 A;  2G4D B;  1RLF A;  2OOB B;  1V1O A;  4PS3 A;  1I4H A;  2IGD A;  1JRO A;  2PW9 A;  3U4E G;  2MA9 B;  2V4L A;  4J3O D;  1F77 A;  3ZNG C;  3H7S A;  3RCZ A;  1UWM A;  2IGH A;  1VR9 A;  3P1M A;  2PPH A;  3O13 A;  5CHF A;  2N9E B;  3P4Q B;  4HK2 A;  2CHX A;  3B0A A;  4AWJ A;  3M63 B;  4JWU C;  5EE3 A;  2IND C;  2N1V A;  2W3R A;  2GLS A;  2ON8 A;  3PLU A;  2MP2 A;  4ZOH C;  2LD9 A;  1E7V A;  3DWM A;  2I1J A;  2WDT B;  2L8J A;  2NBV B;  2H89 B;  3PRZ A;  1GUA B;  2D07 B;  3ZXR A;  2JRI B;  3KQ4 A;  2NVU I;  3I9V 1;  2WXQ A;  4A20 A;  2GRI A;  2LZ6 A;  2K8C A;  3ZLZ A;  4IOI E;  2PJH A;  3BVZ A;  1FCC C;  4M00 A;  2O6V B;  3R2T A;  1OQQ A;  3GP7 A;  4HWI B;  4PS8 A;  3W9C B;  4ZRQ A;  4ASW C;  1WRI A;  4CQN A;  4OHJ A;  2Z8L A;  5FKA C;  3BII D;  3NZS A;  2V0G A;  1C79 A;  2L7R A;  1HA5 A;  3VR8 B;  2DWQ A;  2ZCC A;  1D5X C;  1T3Q A;  4TQ1 A;  2AX5 A;  2W3S A;  5D6J B;  5TSS A;  4WUR A;  4WH4 A;  4ZDV A;  3Q3F A;  1FXA A;  3DBH I;  4OZB A;  5D94 A;  2JT4 B;  4ARC A;  2WXP A;  4PS7 A;  5C2T B;  1ISN A;  1WRD B;  2N0S B;  2KT7 A;  4RGO S;  3U7D A;  4M0W A;  2YEP B;  2WYQ A;  3A9K A;  1V8C A;  2YLM A;  2MBQ A;  4PYU A;  1V81 A;  2FCQ A;  1FNU A;  1ZP0 B;  1OQY A;  1C76 A;  3KWV A;  3RNC C;  1AAR A;  4E71 A;  3RUL A;  4OVV A;  1UNS A;  3VUY A;  1C9F A;  2L0F A;  3ZDM C;  5HI1 A;  1K50 A;  3NJT A;  3PHW B;  1A70 A;  4ANU A;  2XEW A;  2W9N A;  3V61 A;  1CQV A;  1WZ0 A;  1T5X D;  1WJN A;  4JWS C;  3ZQ4 A;  3RNE C;  3APC A;  3TEW A;  1RWS A;  2NPT B;  1UBQ A;  4F7Z A;  3ZDT A;  4YSZ B;  4LNN A;  2V9H A;  3EA6 A;  3IG3 A;  3VTU A;  4DXF A;  2O2V B;  2M17 A;  4ZRJ A;  2HTH A;  2NR2 A;  5DPT A;  5EE1 A;  5H8Y E;  2LRU A;  3KVF B;  1RM6 C;  2KXJ A;  1N5W A;  4C80 A;  3MHZ A;  3JYU A;  3PSE B;  3N9Y C;  1KM7 A;  3GE3 C;  2N9X A;  5LXI B;  3WIM A;  3SD5 A;  3IAM 1;  1V5T A;  3X0W A;  1NI3 A;  2KJR A;  1AYF A;  4FXC A;  3P42 A;  1QOB A;  1XD3 B;  4W9I A;  3B9J A;  2L05 A;  3P2B A;  1YNT E;  3MJ5 A;  1SIJ A;  4ICU A;  4YSY B;  2FCS A;  2VZK D;  2PEA A;  4XWT A;  4K7S A;  4M02 A;  1YX6 B;  2DEN B;  4B9K A;  4GDK B;  4CO7 A;  3DVN U;  3L54 A;  3ZO5 B;  2KAN A;  4US8 A;  5E6P A;  1VD2 A;  4GDL A;  1ENF A;  2DYB A;  1KLU D;  2FAZ A;  2AQ1 B;  3TEY A;  3NS8 A;  3AUL A;  3FIL B;  5DPW A;  1WGH A;  3OG5 A;  4EKU A;  1QZE A;  5EE9 A;  1K8R B;  2M1M A;  4KIK B;  3MC9 A;  1KTK A;  2LGD A;  3IBE A;  4KKJ A;  2MLB A;  3WCQ A;  3WA0 A;  4EFO A;  3DBR I;  2N7D A;  1L0X B;  3UI3 A;  3QWZ B;  5LXH A;  3NHE B;  3AE1 B;  2ZZP B;  3FAH A;  2MBE A;  1J19 A;  3OJ3 A;  2ZPY A;  1LQB A;  2WXJ A;  2BQQ A;  4A3P A;  3IAS 1;  1YN4 A;  2L76 A;  1FD6 A;  4PYZ A;  3UQB A;  2I1K A;  4AJW A;  5JHA A;  2CHW A;  3ZVV A;  4IWO A;  4MH0 E;  3AM9 A;  2PE6 B;  2NBW B;  1F2R I;  2KHW B;  1ACC A;  4BKG A;  2WLB A;  2WDR B;  1L5P A;  1C78 A;  1ZUD 2;  3O65 B;  5HKH A;  4XZ4 A;  1ZDV A;  4K7U A;  1SSN A;  3V05 A;  2BPS A;  3BYT B;  2BS4 B;  1WYG A;  5DCN A;  2Q5W D;  3GB1 A;  1R4M B;  2MHJ A;  2ZVN A;  2M19 A;  3RNA C;  3MFG A;  4RNA A;  1TBE A;  3QQ8 B;  1Y56 A;  2D10 A;  3DVN V;  4C7Z A;  2MX2 A;  1E7U A;  3GOE A;  2LI5 A;  2WU5 B;  2IYD B;  4K7W A;  2O6V A;  1B9R A;  4NJ6 A;  5BMH A;  3NZU A;  3KUD B;  5C1Z A;  2JRH A;  3U30 A;  2BYV E;  1NEN B;  1C4C A;  3KH0 A;  5LNK 1;  4DQO C;  2BYT A;  3ZJT A;  5BO4 B;  1H4R A;  2MW5 A;  3Q8E A;  4KX6 B;  2BYF A;  3DQV A;  4HCP B;  4W9C A;  3Q3O C;  2QIE B;  1L6V A;  2WXK A;  1I42 A;  4ICV A;  1SE2 A;  1PQS A;  2IDY A;  2M4N A;  2KVZ A;  2KC2 A;  2V3S A;  2KDB A;  2MSE D;  4EUT A;  1UD7 A;  5I4D A;  4MJS A;  2AL6 A;  2M0A A;  2HE7 A;  3JW0 X;  4C56 C;  4LNO A;  3ENE A;  2UU7 A;  4XYC A;  2FUH B;  2VZK B;  3PZD A;  3ZNH B;  2FBW B;  3KYC D;  5MPO A;  3ZNZ B;  2QDF A;  2KFK B;  2KWC A;  1VCB A;  2G4S A;  3FKY A;  4MM3 B;  3U8Z A;  3KUC B;  3ALB A;  5G5G A;  4YXD B;  4GN1 A;  3MC0 B;  2ONQ A;  3JSV B;  1RFK A;  1ROE A;  1QOA A;  4E3C A;  4TSS A;  1WF9 A;  1TYG B;  2BWE S;  3Q14 C;  1GJZ A;  3C8Y A;  1GB1 A;  2QMT A;  5DPS A;  5AUK A;  4IG7 B;  4M01 A;  5CX3 A;  3R8B A;  4IWQ A;  2BB6 A;  3K9O B;  1JRP A;  1C4A A;  2CU3 A;  3DDC B;  1YQ4 B;  1XLO A;  1YN5 A;  2JX5 A;  1TS5 A;  1X1M A;  2J7Q B;  2RPV A;  2GBN A;  4HLE A;  1ZOY B;  3M95 A;  3QK0 A;  2D3A A;  3R2I A;  2RMM A;  4ITK A;  2PKO A;  3AEE B;  2DZK A;  3RNG C;  2FE8 A;  1E5W A;  2KYW A;  1EF1 A;  2OJW A;  2GOW A;  1WI0 A;  3HUI A;  4LCD E;  3VUW A;  2KD0 A;  1L2N A;  4YSX B;  1CMX B;  3RYT A;  3TEZ A;  3UIO B;  4W9K A;  1EM7 A;  1JWU D;  3DHH C;  3TEX A;  5G55 A;  3W1S A;  3NS1 A;  2PLP A;  1RRB A;  1L4Z B;  2MH7 A;  2KFJ A;  4DBG A;  2KLC A;  1IBX B;  3WAP A;  2AYO B;  1GG3 A;  1SGH A;  2KMM A;  2GBJ A;  3B2G A;  4MGI E;  4XX5 A;  2L00 B;  3OJ4 B;  2MQJ A;  4FLH A;  5KHQ A;  1DGJ A;  4B95 A;  2BKR B;  4KDL B;  1KH0 A;  1QIL A;  4C7Y A;  2K5P A;  2KK8 A;  1XCT L;  2LXA A;  1JWM D;  4KIK A;  4P1B C;  5TR5 A;  3RNB C;  1D3Z A;  3WAO A;  2FNJ B;  4ZRI A;  2B3A A;  3AE6 B;  3AEG B;  2L3Z A;  1IPG A;  1CZP A;  3AB5 A;  4JQW C;  4BVU C;  1D5M C;  5KHO A;  2KOX A;  2BT6 A;  1XLP A;  1UH6 A;  2PVG C;  1VDV A;  2KLG A;  4KSK C;  4YT0 B;  2WXN A;  3VUX A;  2IJ0 A;  3APF A;  2IO2 B;  1XEE A;  2IBI B;  5E6J A;  1T0Q C;  4WWM A;  3AMZ A;  2HTM E;  2KZR A;  4BKT A;  4N59 A;  3QC8 B;  2NTS A;  3A9J B;  5D3D A;  2JXX A;  4KDI C;  4GXB A;  4LLG M;  5D2M B;  1YJI A;  1PYW D;  3UQA A;  1AW7 A;  3HM3 A;  1STE A;  4BKS A;  1L6U A;  4US9 A;  3GZN I;  1QKZ A;  2Z0D B;  4Q2J A;  1E10 A;  3PLV A;  3EUB 2;  2HJ8 A;  1N63 A;  2WXI A;  3ZTD A;  4OW0 A;  1C4P A;  2ICI A;  2JU6 X;  3HK0 A;  1E8Y A;  2C60 A;  4OZC A;  1ET6 A;  3BVG A;  1XXG A;  4HDQ A;  1ZPS A;  5J17 A;  3A4R A;  2M8S A;  2G3Q B;  2A5U A;  4E74 A;  4BBN F;  4HEA 1;  2JZ3 B;  4PT5 A;  1MHX A;  2BGF A;  3T9L A;  4KGT A;  1D6E C;  2LUE A;  3QIJ A;  5IAA C;  1NEK B;  2XNA C;  4HDO A;  3GE8 C;  4RFB A;  4RH6 A;  1L7Y A;  1KFY B;  1H8C A;  3SEB A;  3H1U A;  3UIP B;  1WMH B;  1TIF A;  2ZEQ A;  4GSW A;  1R4N I;  1F0Z A;  2KTR B;  2LJ5 A;  2V4I B;  3AXC A;  3MP9 A;  4LDT D;  1MI0 A;  3L0W B;  1SE4 A;  2UYZ B;  3RFZ B;  4N6E B;  3DVG Y;  3U2S C;  2QJL A;  1IP9 A;  2J0M A;  2WXR A;  2WXF A;  4XWW A;  5J18 A;  2W54 A;  4B0E A;  2CJN A;  3T8M A;  4D2K A;  1DYQ A;  3V62 A;  4II2 B;  1WX7 A;  2PIA A;  3I5J C;  1VZ7 A;  1WFY A;  3IXS A;  3AH7 A;  2KFK A;  1N5X A;  4MM3 A;  3MTN B;  3H7P B;  4AS1 A;  2B76 B;  3WAM A;  2N1W A;  3JSV A;  1V5O A;  2KKC A;  1JW9 D;  4DDI D;  1JML A;  2JWZ A;  4QAY A;  1HQR D;  1ZW7 A;  4P7I A;  4RF1 A;  1WXA A;  3R66 C;  2FCN A;  3KLS X;  1FNW A;  4UDU C;  2ZW1 A;  5FR3 A;  2PMV A;  4N9F 4;  5HHD G;  1TGZ B;  2G9H D;  2BS3 B;  3IVF A;  1ESF A;  4WWP A;  2XK5 B;  1YN3 A;  2QSD A;  1KLG D;  2R2O A;  1MG8 A;  3AEA B;  1I4Q A;  3PS6 A;  2DZM A;  3R7R A;  2KWU B;  1EWC A;  1UBI A;  3PZ8 A;  5JHB A;  1I35 A;  3VVW B;  4ZRK A;  3W1Y A;  1PGX A;  2K8H A;  2MWS B;  4AJY B;  1KOT A;  1HEZ E;  1I4P A;  1SBB B;  3DOW A;  4KGS A;  1QOF A;  3CMM B;  4A3O A;  3ABV B;  2ZNV C;  2W55 A;  2INC C;  3NY5 A;  1WR1 A;  4LNF A;  3L10 B;  1TKG A;  4HCN B;  3RMK C;  1JWA D;  2IO1 B;  3I63 C;  4DXA B;  4W9E A;  3A1Q A;  4F8C B;  3ZJV A;  2HDE A;  5BYS A;  3DBL I;  5IO9 A;  1LGR A;  1KLV A;  3TSS A;  2LGS A;  3DHG C;  1PGA A;  3ONS A;  1FFV A;  1NDD A;  2JPH A;  2DX5 B;  3ZXV A;  2K6D B;  2C5L C;  1V86 A;  3Q3M C;  5EDS A;  1HXY D;  3HVZ A;  1XO3 A;  3VHT C;  4B0M A;  1WGG A;  2KN4 A;  2RGF A;  3E56 A;  3IHP C;  1WJ6 A;  4NQK E;  1FM0 D;  1L4D B;  2QIL A;  2KN5 A;  2RD0 A;  2ZVO A;  4A90 A;  3EGR A;  2XN9 C;  3ZW3 A;  1TS4 A;  1I4X A;  3Q8F A;  4WJP A;  4BOZ B;  4CHK A;  2M56 B;  3WAL A;  1BT0 A;  1OEY A;  3TBL D;  1LFD A;  2LVQ A;  1NYR A;  1E8Z A;  3SFE B;  1JWB D;  3TCA A;  3NVW A;  4M8N A;  2KDI A;  1TZO A;  3VH3 B;  3ETR A;  4USA A;  1T0R C;  3EFU A;  4P1C C;  2REX A;  4FJV B;  2WDV B;  1T6B X;  4G11 A;  3Q3J A;  5AUI A;  1UUP A;  3R7Q A;  3V6E B;  3ZYY X;  3EC8 A;  4P6V F;  3A9J A;  4ZYN A;  2NTT A;  4HPP A;  1V49 A;  2IPK D;  3S2A A;  1L0Y B;  1K53 A;  4HPM B;  4NJC A;  2R61 A;  5BMI A;  3AV8 A;  4G0N B;  3SDL C;  3NG0 A;  2MCN B;  4L1B A;  3Q8C A;  1UWX A;  2V1Y A;  2NCN A;  2BF8 B;  4RMA A;  2GBM A;  1F2R C;  2WS3 B;  4AP4 C;  3RPF C;  1HZ6 A;  2LVO A;  2MP2 B;  2WX1 A;  5BYQ A;  3MJW A;  3PT2 B;  1U4A A;  1FEH A;  2DAJ A;  5FK9 C;  5EE0 A;  2N9K A;  2WHI A;  4NPN A;  2G1E A;  3AE7 B;  2E3T A;  3BZD B;  4EE2 A;  2JXT A;  3PVL A;  1NYQ A;  4I6N B;  3N1X C;  3U52 E;  3C19 A;  1UGM A;  3Q8B A;  1BUI C;  1MVK A;  1WSP A;  2KMC A;  3AE9 B;  2JF5 A;  3GS2 A;  5AZG A;  3NVZ A;  2N9L A;  3PRE A;  3BYY B;  4JL9 A;  2RPQ A;  4KKI A;  1WWT A;  2MRP A;  3AE5 B;  1WMH A;  5AZF A;  3LB8 C;  2LHD A;  4BZA A;  2AEH A;  1V9J A;  4DHZ B;  3SFD B;  4JGH B;  5GXG B;  2KTR A;  5BYR A;  3TL5 A;  1IGD A;  3NUH B;  4PK1 A;  1VZ6 A;  4F1S A;  1KRH A;  2OJR A;  4AQ7 A;  1J8C A;  2GBK A;  4KZ0 A;  2DAF A;  3VH4 B;  4K81 A;  3RN9 C;  4URK A;  1ZE3 D;  2C9W B;  3BVM A;  1JCK B;  2UWQ A;  4KV2 A;  4MSQ B;  2BKF A;  3AN1 A;  3RT3 B;  4LNI A;  1FRD A;  3ZGZ A;  2Z59 B;  1JRU A;  2KNB A;  3QA8 A;  2IO0 B;  1C77 A;  3H7P A;  3L4P A;  2WXG A;  4KGR A;  3KW5 B;  3M3J A;  3N1Z C;  3ZTC A;  1F52 A;  1P9D U;  3KWL A;  1L0V B;  1UF0 A;  1ZXH A;  1TKY A;  3HRD D;  3RZW C;  3K9P B;  3A9K B;  3QHT A;  4KSL C;  3VR9 B;  4H2A A;  4AOF A;  4MDK E;  3LDZ E;  2A4Z A;  2LEK A;  4ARI A;  2JSV X;  4C00 A;  3CSF A;  4A6Q A;  2I38 A;  1S1Q B;  1GOZ A;  3OLM D;  1FNV A;  3DBH B;  3TJP A;  2XK5 A;  3KYD D;  5IOI A;  1F9J A;  2NPT A;  1Z5S B;  4EEW A;  4IM2 A;  3N3K B;  3NOB A;  1HTQ A;  3QX1 A;  1HE8 A;  2O2V A;  2MBH A;  2Y3A A;  3PRM B;  4S17 A;  3I3T B;  4HJG E;  4NAM A;  1PUT A;  2RDH A;  3RI7 C;  2SAK A;  1WE7 A;  1FFU A;  1WE6 A;  4YTP B;  3AEF B;  4WIP A;  1WH3 A;  2LUM A;  4EZL A;  5HG2 A;  2Z0E B;  1QLB B;  4GOC A;  4NAW B;  4CYE A;  2EKI A;  3RZF A;  2O6V D;  1SB3 C;  3BWU D;  1MJD A;  5E6N A;  1OGW A;  1RAX A;  3J9C A;  3PRP B;  3NRZ A;  2VRR B;  3HVD A;  3SHQ A;  1KJT A;  3PTF C;  4GGQ A;  3VAW A;  3AED B;  4BBN C;  1FCL A;  4HRS A;  3W1S C;  3ZIM A;  1TZ1 A;  2IGG A;  2KJH B;  4BOS C;  4LK0 M;  3CWI A;  4K3C A;  4GDK A;  3CST A;  2ZNV B;  3AEB B;  4WWN A;  1V97 A;  4I6P A;  4TMA B;  2INN E;  1YJJ A;  2LXC A;  5LLI A;  4R3D A;  1GPX A;  2PVO D;  2YEP F;  5BMG A;  3FIL A;  1FRR A;  1YQB A;  1XCQ L;  2KVR A;  1T0Y A;  1E0Z A;  2SEB D;  2VH1 A;  5D3I B;  2WP9 B;  3CF6 E;  1J7A A;  2WXO A;  2BYE A;  1WR6 E;  1SE3 A;  2D3G A;  1Q1O A;  1SF0 A;  3EHV A;  4WQM A;  1WGD A;  4WJN A;  1DOY A;  2JUO A;  3ZNI D;  2K9X A;  4ZYS A;  3VRA B;  1QF6 A;  1GB4 A;  1M94 A;  3AE8 B;  3VTW A;  3T3N A;  2K6Q A;  2KWD A;  2H88 B;  1ZGU B;  3ML9 A;  1E7P B;  2Y5P A;  3B2F A;  2DBY A;  5H92 C;  3Q3N C;  3D32 A;  1WX8 A;  3W5V B;  1R4M I;  4RGM A;  1D5Z C;  1TT5 B;  4BFR A;  3BIN A;  2BWF A;  2ZW0 A;  1DOI A;  3PZ7 A;  3PGE A;  4FBJ B;  1FMA D;  1OTR B;  2W82 A;  1Z2M A;  4NJ7 A;  3N20 C;  3P4R B;  1OEY J;  1N60 A;  2WGS A;  1P7F A;  4KVG B;  2N7J A;  2JYE A;  4YTM B;  4MGZ E;  2JQR B;  3DBR B;  2KMA A;  2IO3 B;  4I6L B;  2K22 A;  5D7G A;  1TS3 A;  4LTU A;  2CHZ A;  2J53 A;  1NI2 A;  1EU4 A;  3HIZ A;  4BAX A;  3TMP B;  3BK1 A;  4WQO B;  4G3X B;  1IUE A;  4TUU A;  4GIV A;  3A33 B;  1PDX A;  2BTE A;  1JAL A;  2FUG 1;  2DNF A;  3U7Z A;  3H6N A;  4NZL B;  2DHZ A;  4RGN A;  4ZRP A;  3P4P B;  4C4V B;  2JYT A;  2QEJ C;  1G6J A;  3B1L X;  1OQR A;  1RFA A;  2K0P A;  2X8X X;  5G2N A;  4HXD A;  3VRB B;  4IDI A;  1WZ3 A;  4RM8 A;  5AZH A;  3PPA A;  4DHJ D;  4LJO B;  3EEC A;  2V3N A;  4IW0 A;  2BW2 A;  4ANW A;  2IZV B;  3OWE B;  4HPL B;  4HKZ E;  5G5H A;  3E9S A;  4WAF A;  1XT9 B;  2MBB B;  2Y5C A;  3PO0 A;  2NMQ A;  4FUL A;  1SJH D;  5T8I A;  2LMC A;  4JE3 B;  1FO4 A;  1C1Y B;  1E9M A;  2RDB C;  2V3P A;  2WNM A;  2BVC A;  1LXD A;  3AU5 A;  2KDE B;  2TSS A;  1WGK A;  4K3B A;  2R2Q A;  1V2Y A;  2J0K A;  4HJK A;  3APD A;  3A4S C;  3QAQ A;  4RCO A;  1I7H A;  1XQQ A;  5CHW A;  5C3J B;  3JVZ X;  3Q2A C;  4MJS B;  3LXF A;  4NY0 A;  2L32 A;  4MSM B;  3RD2 A;  1D4B A;  2NS5 A;  2WU2 B;  2GI9 A;  4DK5 A;  5DPR A;  2QC8 A;  4ZHP A;  2KQ4 X;  2L52 A;  1TTN A;  2JY6 A;  1WGY A;  4XE0 A;  4JIO U;  2J42 A;  3NVV A;  3C0R B;  5E6O A;  3DHI C;  2WXL A;  2WXH A;  2NBU A;  2ZJD A;  1UGJ A;  4XDC A;  2IY0 B;  3BK2 A;  4MGK E;  2XBB C;  1E90 A;  1PGB A;  4IUM B;  4HRO A;  4RGT A;  4YTN B;  1MG4 A;  1WX9 A;  1EWY C;  3MC8 A;  1I4R A;  4FJZ A;  1VRA B;  2GMI C;  2LGI A;  3TIX A;  5HFY A;  2QHO A;  4BKS D;  4J6I A;  1FXT B;  2CS4 A;  2LHE A;  4FAD A;  1XLQ A;  2LFI A;  2AWT A;  1R7S A;  1SIF A;  2J4X A;  4FN2 A;  4A9A A;  2J52 A;  1GNU A;  3IT4 B;  4TQ0 A;  2KC1 A;  5L95 C;  3URY A;  2ZPN A;  4NAW A;  4FA6 A;  1P98 A;  3VDZ A;  4LNK A;  3AU4 A;  1ZKH A;  3X23 A;  2LAS A;  4FJY A;  1V1P B;  4DWF A;  1EUV B;  1FPY A;  2GBR A;  4JX1 C;  2C7M B;  2MJE A;  1WXV A;  5IN7 A;  4W9G A;  4XC2 A;  5GMV A;  2E6X A;  2CJO A;  2D3B A;  1SE9 A;  4ACF A;  1LM8 B;  3N30 A;  3W2D A;  2D5G A;  1QOG A;  1IBX A;  1YIW A;  1WJU A;  4IWP A;  1SJE D;  2FID A;  2L1A A;  2K8B A;  3IFW B;  4P16 A;  2BS2 B;  1N6Z A;  1T0S C;  1WYW B;  3LYY A;  1OFF A;  4MAC A;  1AWD A;  4IC7 B;  1TS2 A;  4YWG G;  3RNF C;  3RUI B;  2J0J A;  1XLN A;  5J2R A;  4DHJ B;  2LWP A;  4EZJ A;  2M0X A;  1WJ4 A;  3UIN B;  1Q10 A;  2K39 A;  2KAC A;  1MPE A;  1ZXI A;  4LDT B;  1YMH E;  2JZZ A;  2D2Q A;  1P1A A;  2HJ1 A;  2VH2 A;  1P7E A;  4W9L A;  4ANX A;  5L83 A;  1RYJ A;  1WIA A;  3ZJU A;  1UEL A;  3PV1 A;  5JH5 C;  4YL8 A;  2ACZ B;  2KX0 A;  4A8X C;  1KF6 B;  3IT6 B;  4GLS C;  1NVI D;  4B6W A;  3L08 A;  4ANV A;  1YJ1 A;  4M8M A;  4W9F A;  1FXI A;  1EO6 A;  2L83 A;  4HVB A;  2K25 A;  2KDF B;  1CK1 A;  3DBS A;  1CJE A;  2KAJ A;  4MH8 A;  2N7E A;  2KQS A;  1TKE A;  4EOY A;  2EMT A;  4KZC A;  4MEM A;  1S3S G;  2GB1 A;  4GB9 A;  4WWO A;  4A55 A;  4N58 A;  2EKE C;  2CKH B;  1QT9 A;  3BY4 B;  4GMV A;  3WAN A;  1XF5 L;  2OHF A;  3PHX B;  1IGC A;  3M62 B;  4S0R A;  2OED A;  3V60 A;  3DPD A;  1WXQ A;  2N4F A;  4XDD A;  3L16 A;  2I2Y A;  2EEL A;  1TY0 A;  2X38 A;  2N9P C;  4TKN A;  4XGA B;  3UF8 A;  4GU2 A;  1E8X A;  4W9J A;  1NBF C;  2AQ3 B;  2RDG A;  3ZUN A;  3L13 A;  2AQ2 B;  2LRW A;  3V3X A;  4DXG A;  2KJ6 A;  4C4V A;  1PFD A;  1P3Q U;  2HD5 B;  3ML8 A;  3W5U B;  4II3 B;  3LJ3 A;  4JLC A;  3NVY A;  1J0G A;  4W9H A;  1TY2 A;  2MEK A;  3DCG A;  1Q5W B;  1F1H A;  1E8W A;  1WY8 A;  2KDM A;  5CHV C;  2YVC A;  1I4G A;  4JPS A;  1YQ3 B;  1DOX A;  3FC4 A;  1EU3 A;  3VFK A;  1GC7 A;  2LJI A;  4TV3 A;  3GZN B;  4WJQ A;  1ET9 A;  2FIF A;  1TJE A;  3SU8 X;  3AI5 A;  4FHK A;  1GAQ B;  3CIR B;  3H8H A;  1YD8 U;  5IA7 A;  2C7H A;  3HM6 X;  1SXT A;  2BBC A;  3EFC A;  1J7B A;  1WM2 A;  4LJP B;  1JWS D;  5AEK B;  1V80 A;  4MGY E;  1N61 A;  1VJK A;  4X57 B;  1M4V A;  2D3C A;  2IY1 B;  1MHH E;  3MHS D;  2QCZ A;  2KO3 A;  2DLB A;  5IKC M;  4RF0 A;  2KWV B;  4FHJ A;  1B1Z A;  1J7C A;  3P4S B;  5IP4 D;  1R4N B;  2KTF A;  3KUZ A;  4M0W B;  4IM3 A;  2WWZ A;  3DWG C;  2FCM A;  2EMS A;  1GC6 A;  3N1Y C;  1EF5 A;  1SEB D;  2AL3 A;  3ZRF A;  1VLB A;  2INP E;  1BML C;  2WQY B;  1LO5 D;  3VQI A;  2KX3 A;  3TUO A;  3ECI A;  1WXS A;  2PE9 A;  4NQL B;  1V6E A;  2G45 B;  2MJ3 A;  4OVZ A;  5FR6 A;  3ZKJ C;  2PTL A;  4MEL A;  3I57 A; 
#chains in the Genus database with same CATH homology
 1ACC A;  1P7F A;  2N7J A;  2DYO A;  1FIQ A;  4OZA A;  1YN3 A;  2WLB A;  2WDR B;  1L5P A;  1BXT A;  2QSD A;  1KLG D;  2JYE A;  4MT5 A;  1C78 A;  1ZUD 2;  4YTM B;  3AE2 B;  2JQR B;  1JQ4 A;  4L2Y A;  3AEA B;  2JWU A;  1I4Q A;  4TQ0 A;  2K22 A;  1ZDV A;  1TS3 A;  5D7G A;  4LTU A;  2K3U A;  2J53 A;  1E6E B;  1EU4 A;  1EWC A;  1SSN A;  3V05 A;  3AE4 B;  3BK1 A;  4L23 A;  4ZHO A;  3PZ8 A;  3AE3 B;  1IUE A;  3BYT B;  1V1P A;  2BS4 B;  1WYG A;  1K52 A;  2BTE A;  1PDX A;  1JAL A;  2Q5W D;  2FUG 1;  1PGX A;  3GB1 A;  3U7Z A;  1ESF A;  4NZL B;  1HEZ E;  2WDQ B;  2M19 A;  3NZ3 A;  3MFG A;  1I4P A;  4RGN A;  4RNA A;  1SBB B;  1VZ8 A;  1ZDX A;  4KGS A;  1QOF A;  3AEC B;  4ZRP A;  3P4P B;  4O1N A;  1Y56 A;  4C7Z A;  3ABV B;  2JYT A;  2QEJ C;  2WU5 B;  2WXM A;  1OQR A;  1QQR A;  2K0P A;  2W55 A;  1B9R A;  3VRB B;  5BMH A;  4IDI A;  1TKG A;  1NEN B;  1JWA D;  1C4C A;  4REZ A;  2V3N A;  1K51 A;  2BW2 A;  5LNK 1;  4DQO C;  4IKG A;  3OWE B;  2BYT A;  3ZJV A;  3ZJT A;  4HKZ E;  5G5H A;  3E9S A;  2HDE A;  3Q8A A;  3T3O A;  5BYS A;  4HKQ A;  3Q8E A;  4WAF A;  4KX6 B;  2Y5C A;  3Q69 A;  2QIE B;  1AN8 A;  3PO0 A;  2NMQ A;  1SJH D;  1L6V A;  5T8I A;  2LMC A;  2WXK A;  4JE3 B;  1E9M A;  3TSS A;  1FO4 A;  1PGA A;  1FFV A;  2V3P A;  2WNM A;  1SE2 A;  2TSS A;  1WGK A;  2IDY A;  1HXY D;  3HVZ A;  1XO3 A;  5I4D A;  2M0A A;  4B0M A;  3SR6 A;  4C56 C;  2KN4 A;  4RCO A;  3E56 A;  4GDL B;  1I7H A;  1FM0 D;  1L4D B;  1N62 A;  2BB5 A;  2QIL A;  5C3J B;  2DYM A;  4A90 A;  3EGR A;  2VZK B;  3P63 A;  2XN9 C;  3LXF A;  2JZP A;  2MJD A;  2L32 A;  1D4B A;  2FBW B;  2WU2 B;  5MPO A;  2GI9 A;  5JXV A;  1TS4 A;  1I4X A;  4ZHP A;  2KQ4 X;  3Q8F A;  2L52 A;  1HZ5 A;  2M56 B;  4XE0 A;  1NYR A;  2J42 A;  3NVV A;  1V1O A;  1I4H A;  2WXL A;  2WXH A;  1JWB D;  3SFE B;  4MM3 B;  2IGD A;  3NVW A;  1JRO A;  2PW9 A;  5G5G A;  3U4E G;  1UGJ A;  4XDC A;  1TZO A;  4YXD B;  3BK2 A;  4J3O D;  3ETR A;  4USA A;  3MC0 B;  2ONQ A;  1F77 A;  1PGB A;  1RFK A;  4HRO A;  4RGT A;  2WDV B;  1ROE A;  1T6B X;  1QOA A;  1UWM A;  4YTN B;  2IGH A;  5AUI A;  1VR9 A;  4TSS A;  1EWY C;  1UUP A;  3P1M A;  1TYG B;  1I4R A;  3ZYY X;  1VRA B;  4P6V F;  2LGI A;  2NTT A;  3C8Y A;  3O13 A;  5HFY A;  1GB1 A;  3P4Q B;  2IPK D;  2QMT A;  2LHE A;  5AUK A;  1L0Y B;  1XLQ A;  1K53 A;  2LFI A;  4NJC A;  1R7S A;  3R8B A;  2R61 A;  2J4X A;  2BB6 A;  5BMI A;  4A9A A;  2J52 A;  3AV8 A;  4JWU C;  5EE3 A;  1JRP A;  1C4A A;  2CU3 A;  3IT4 B;  1YQ4 B;  4L1B A;  1XLO A;  1YN5 A;  2JX5 A;  2W3R A;  1TS5 A;  1UWX A;  2ON8 A;  3Q8C A;  4ZOH C;  3URY A;  2RPV A;  3DWM A;  1ZOY B;  1F2R C;  2WS3 B;  3RPF C;  3R2I A;  2RMM A;  1HZ6 A;  4ITK A;  2PKO A;  2H89 B;  3AEE B;  1V1P B;  2FE8 A;  5BYQ A;  4JX1 C;  2MJE A;  3KQ4 A;  1FEH A;  5FK9 C;  3HUI A;  5EE0 A;  2N9K A;  3I9V 1;  2WXQ A;  2G1E A;  3AE7 B;  2E3T A;  3BZD B;  2GRI A;  4EE2 A;  2E6X A;  4YSX B;  2JXT A;  1NYQ A;  2CJO A;  4IOI E;  3U52 E;  3Q8B A;  1BUI C;  1MVK A;  3BVZ A;  1WSP A;  3TEZ A;  3AE9 B;  3GS2 A;  1EM7 A;  1FCC C;  3NVZ A;  3W2D A;  2N9L A;  1JWU D;  2D5G A;  3BYY B;  1QOG A;  3R2T A;  4KKI A;  1WWT A;  1OQQ A;  1IBX A;  3AE5 B;  3GP7 A;  3W9C B;  3TEX A;  3LB8 C;  4ZRQ A;  3W1S A;  3NS1 A;  2LHD A;  1SJE D;  3SFD B;  5GXG B;  2PLP A;  5BYR A;  1IGD A;  2L1A A;  1WRI A;  4CQN A;  1L4Z B;  4OHJ A;  2Z8L A;  2MH7 A;  4P16 A;  3BII D;  5FKA C;  2BS2 B;  3NUH B;  2V0G A;  1VZ6 A;  1C79 A;  1HA5 A;  1KRH A;  1IBX B;  3VR8 B;  2DWQ A;  3LYY A;  1OFF A;  4MAC A;  1AWD A;  2KMM A;  4AQ7 A;  3B2G A;  1D5X C;  1TS2 A;  4YWG G;  1T3Q A;  4TQ1 A;  2AX5 A;  1XLN A;  2W3S A;  1DGJ A;  1ZE3 D;  3BVM A;  1JCK B;  5TSS A;  4WUR A;  4WH4 A;  1KH0 A;  1QIL A;  3AN1 A;  4C7Y A;  2K5P A;  1XCT L;  1FXA A;  1Q10 A;  1FRD A;  1JWM D;  2KAC A;  3ZGZ A;  1MPE A;  1ZXI A;  4OZB A;  1YMH E;  4ARC A;  2WXP A;  5C2T B;  1P7E A;  3AE6 B;  3AEG B;  1C77 A;  1RYJ A;  1CZP A;  3L4P A;  3ZJU A;  2N0S B;  2WXG A;  4RGO S;  3AB5 A;  4KGR A;  1D5M C;  2YEP B;  4M0W A;  2ACZ B;  4A8X C;  1V8C A;  1KF6 B;  3IT6 B;  4GLS C;  1NVI D;  2BT6 A;  3KWL A;  1L0V B;  1XLP A;  2PVG C;  1FXI A;  1TKY A;  1ZXH A;  1VDV A;  2L83 A;  1FNU A;  1ZP0 B;  3HRD D;  1C76 A;  3KWV A;  4YT0 B;  1UNS A;  3VR9 B;  4H2A A;  2WXN A;  1C9F A;  2IJ0 A;  5HI1 A;  1CK1 A;  1CJE A;  2KAJ A;  2LEK A;  4ARI A;  2JSV X;  1XEE A;  4MH8 A;  5E6J A;  1TKE A;  1K50 A;  4A6Q A;  2I38 A;  4WWM A;  1GOZ A;  2GB1 A;  3AMZ A;  1FNV A;  2HTM E;  4A55 A;  4N58 A;  1QT9 A;  4N59 A;  1A70 A;  1XF5 L;  2NTS A;  2OHF A;  5D3D A;  1IGC A;  2OED A;  1CQV A;  1WXQ A;  1T5X D;  4XDD A;  4JWS C;  2I2Y A;  2EEL A;  1TY0 A;  3ZQ4 A;  4LLG M;  2X38 A;  1YJI A;  1PYW D;  3TEW A;  1AW7 A;  1RWS A;  2Y3A A;  1STE A;  1L6U A;  4US9 A;  4YSZ B;  4HJG E;  4NAM A;  1QKZ A;  1PUT A;  2AQ3 B;  2RDH A;  2SAK A;  3EA6 A;  1FFU A;  4Q2J A;  2RDG A;  4YTP B;  3AEF B;  3EUB 2;  4DXF A;  1N63 A;  1E10 A;  4WIP A;  2WXI A;  2LUM A;  4OW0 A;  5HG2 A;  1C4P A;  2ICI A;  2JU6 X;  1QLB B;  2AQ2 B;  4NAW B;  5EE1 A;  5H8Y E;  3V3X A;  1RM6 C;  4DXG A;  2EKI A;  4OZC A;  1ET6 A;  3BVG A;  1SB3 C;  1PFD A;  1N5W A;  1XXG A;  3BWU D;  1ZPS A;  4C80 A;  3MHZ A;  3W5U B;  3J9C A;  3N9Y C;  3NRZ A;  4HEA 1;  3NVY A;  4PT5 A;  1MHX A;  3HVD A;  1TY2 A;  2MEK A;  4KGT A;  1D6E C;  3IAM 1;  3AED B;  1NI3 A;  1AYF A;  1FCL A;  2KDM A;  4HRS A;  1NEK B;  2XNA C;  1I4G A;  4RFB A;  4RH6 A;  4FXC A;  4JPS A;  1YQ3 B;  3P42 A;  1QOB A;  1KFY B;  2IGG A;  1DOX A;  3B9J A;  3FC4 A;  1EU3 A;  1YNT E;  3CWI A;  4LK0 M;  3MJ5 A;  1SIJ A;  3SEB A;  2LJI A;  1ET9 A;  4YSY B;  2VZK D;  3AEB B;  1TJE A;  1V97 A;  4TMA B;  1F0Z A;  2INN E;  2V4I B;  3MP9 A;  4XWT A;  1MI0 A;  1YJJ A;  1SE4 A;  1GAQ B;  4R3D A;  4GDK B;  3CIR B;  1GPX A;  2PVO D;  2YEP F;  5BMG A;  3H8H A;  3FIL A;  1FRR A;  3RFZ B;  1XCQ L;  4N6E B;  1E0Z A;  4US8 A;  2SEB D;  1ENF A;  1SXT A;  5D3I B;  3U2S C;  2QJL A;  2BBC A;  1J7B A;  2WP9 B;  1KLU D;  2WXR A;  2WXF A;  1JWS D;  4XWW A;  1J7A A;  2W54 A;  2WXO A;  2AQ1 B;  2CJN A;  4B0E A;  4D2K A;  3TEY A;  1DYQ A;  1SE3 A;  3FIL B;  1N61 A;  1VJK A;  1M4V A;  1SF0 A;  4WQM A;  1MHH E;  2PIA A;  5EE9 A;  2DLB A;  1KTK A;  1VZ7 A;  1DOY A;  4KKJ A;  2K9X A;  3IXS A;  3WCQ A;  4ZYS A;  3AH7 A;  4RF0 A;  3VRA B;  1QF6 A;  1N5X A;  1GB4 A;  3AE8 B;  1B1Z A;  1L0X B;  3T3N A;  1J7C A;  3UI3 A;  3P4S B;  4AS1 A;  3AE1 B;  2KWD A;  2B76 B;  2H88 B;  1E7P B;  3FAH A;  2Y5P A;  3DWG C;  3B2F A;  2DBY A;  5H92 C;  1SEB D;  2WXJ A;  3IAS 1;  3W5V B;  1VLB A;  2INP E;  1JW9 D;  1YN4 A;  1JML A;  1FD6 A;  1BML C;  4RGM A;  2WQY B;  1D5Z C;  1HQR D;  4RF1 A;  1LO5 D;  3VQI A;  2ZW0 A;  1DOI A;  3PZ7 A;  3TUO A;  1FMA D;  3AM9 A;  2W82 A;  3KLS X;  2MJ3 A;  1FNW A;  4OVZ A;  3P4R B;  4UDU C;  1N60 A;  2ZW1 A;  5FR3 A;  2PMV A;  2PTL A;  1F2R I;  5HHD G;  2G9H D;  3I57 A;  2BS3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...