2K22A

Automated nmr structure of the ta0895 by fapsy
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
MVTVRYYATLRPITKKKEETFNGISKISELLERLKVEYGSEFTKQMYDGNNLFKNVIILVNGNNITSMKGLDTEIKDDDKIDLFPPVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein Ta0895
publication title Automated NMR Structure of the TA0895 by FAPSY
rcsb
source organism Thermoplasma acidophilum
total genus 10
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k22A00
4USAA 2DBYA 4C7ZA 1N5XA 3CWIA 3AMZA 1E0ZA 1QF6A 4YSZB 1QLBB 4IDIA 5GXGB 3AE8B 1E6EB 1WWTA 3VRBB 1FFUA 4ZHOA 2L83A 3NS1A 1NVID 2H88B 1V8CA 2K22A 4YSXB 3AN1A 1FFVA 2N0SB 5EE1A 1FXAA 3VR8B 1SB3C 1ZXIA 3AE5B 3AECB 1QT9A 2QJLA 3P63A 1T3QA 1PDXA 3AE9B 3AH7A 4N6EB 1YQ3B 2WP9B 3AE1B 3FC4A 1L6UA 2K9XA 1QOGA 3AE2B 2FBWB 1JWAD 2WU5B 3W9CB 1JALA 1CZPA 1ROEA 2H89B 2W3RA 3DWGC 1NENB 2WS3B 1RWSA 1WXQA 1ZP0B 1JRPA 2B76B 3EUB2 3NVWA 4YT0B 3W5VB 3ZYYX 1JW9D 1PFDA 1DOIA 1XLNA 2M56B 4YTNB 1KFYB 1R7SA 3VRAB 2KAJA 3P4QB 4LTUA 1E7PB 3AEFB 1NI3A 1NEKB 1RM6C 1SF0A 2BS4B 4C80A 5MPOA 2PVGC 2G1EA 4US8A 1AYFA 2WDVB 2M19A 3L4PA 1OQQA 2EKIA 1WGKA 3LXFA 1ZOYB 1L0VB 1XLOA 3NVYA 2MJ3A 3NVZA 2WU2B 3BIID 4N58A 1N62A 4US9A 1F0ZA 3CIRB 2WDRB 1OFFA 4JWSC 3VR9B 3B9JA 1YJJA 4JX1C 2PVOD 1EWYC 5C2TB 1E9MA 2W54A 1OQRA 1UWMA 3AEAB 4JWUC 3B2GA 3SR6A 1FIQA 1GAQB 1KF6B 1XO3A 2KMMA 3SFEB 3NRZA 1DOXA 4WQMA 1JROA 5H8YE 2ACZB 2OHFA 1IUEA 1QOAA 1L6VA 1RYJA 1VDVA 3W5UB 2JQRB 4KX6B 4YSYB 3P1MA 4ZOHC 5EE9A 2BS2B 1QOFA 2HTME 1V97A 2W3SA 2AX5A 3AV8A 2Q5WD 1FO4A 2E3TA 1KRHA 5EE0A 2WQYB 1CJEA 2CJOA 1N63A 2WLBA 3P4PB 4ZHPA 3KWLA 3AE4B 2K5PA 5AUIA 1WRIA 2DWQA 3AM9A 3HRDD 2Y5CA 3AEBB 4YTMB 1DOYA 1GPXA 1AWDA 1JWBD 2JX5A 1RFKA 3ETRA 1J7AA 1QOBA 1XLQA 1FMAD 4ITKA 1VLBA 3SFDB 4YXDB 3LB8C 1A70A 4YTPB 2MJEA 1YQ4B 1TJEA 1FRRA 1ZUD2 4C7YA 1I7HA 3P4RB 3PO0A 3AE6B 1E10A 1JQ4A 1SIJA 3AEDB 3ABVB 3AB5A 3RPFC 1TKYA 1PUTA 2QIEB 2LEKA 2W55A 1NYRA 1FXIA 3WCQA 2BS3B 5H92C 5G5GA 1B9RA 3AE3B 2WDQB 3AEEB 3DWMA 4WWMA 1TKGA 3FAHA 1VJKA 3HUIA 2CU3A 2MH7A 2PKOA 3B2FA 3NVVA 1NYQA 1J7BA 1WYGA 4N59A 2CJNA 5C3JB 3HVZA 5G5HA 1TKEA 1J7CA 1FRDA 1YJIA 2PIAA 1N61A 1DGJA 2BT6A 3AEGB 4HRSA 1L5PA 4HROA 3AE7B 1XLPA 4FXCA 1N60A 2L52A 2MJDA 4P6VF 3P4SB 5AUKA 5EE3A 1TYGB 1N5WA 4A9AA 1FM0D
chains in the Genus database with same CATH superfamily
4K3BA 1WXMA 1E0ZA 1WMHB 3T9LA 3ZNID 4JIOU 2ZW0A 2MBQA 1SB3C 4KDIC 2J42A 1T3QA 2VH1A 4LNFA 3ZJUA 1ENFA 1TGZB 3DDCB 3I5JC 4MM3A 2N1VA 3EUB2 3VXWA 2C7MB 1JW9D 2O6VA 3UI3A 5LXHA 2BWES 2NS5A 4X57B 3MFGA 5CHWA 4WWOA 3AEFB 1TS5A 1UD7A 3H9DA 1UUPA 4DWFA 2SEBD 3ZQ4A 2A4ZA 1V2YA 2WDVB 1IPGA 4HCNB 3CF6E 2TSSA 1L0XB 4US9A 4LDTB 5IA7A 3V3XA 1Q10A 2PVOD 5C2TB 3NUHB 4EFOA 2JXTA 1UGJA 1SE2A 2NR2A 4WQMA 2ZJDA 1PGAA 4W9KA 3V61A 2BS2B 3OLMD 1E8ZA 1E8WA 2CJOA 1L4DB 4KGRA 4BAXA 3URYA 3EHVA 3N3KB 5HFYA 3DVGX 4YTPB 4NY0A 2KWCA 4H2AA 5TSSA 3OAWA 3AE6B 3LDZE 2I1KA 2W55A 4IKGA 1NYRA 4MGIE 3N30A 4I6LB 1B9RA 3AEEB 4OW0A 3NG0A 2A5UA 4N59A 1KTKA 1H8CA 4NJCA 3GE8C 2BGFA 1K50A 3ZDTA 3AE7B 2RDBC 4RMAA 4L1BA 3RZWC 2EMTA 1WM3A 2LGYA 1QILA 3J9CA 2N9PC 4WAFA 3EECA 2NBVB 3QJZA 2BWFA 1TT5B 4IG7B 4K1RB 1D5ZC 3AE1B 2NPTB 3CSTA 2K9XA 1T0SC 1GC7A 3VUXA 5IP4D 1ZP0B 1F52A 1CQVA 4B9KA 3PLVA 3ALBA 1PFDA 3RNAC 2JVCA 2V1YA 2REXA 4YWGG 4RF1A 1UBIA 3V62A 3VRAB 3VFKA 4D2KA 1WR1A 1WJ6A 5DPSA 4RNAA 4KGTA 1V81A 2KFKB 3MHZA 4PS8A 1N6ZA 2M0XA 4M8NA 4M01A 4JX1C 2MBOA 2K0PA 1GOZA 1EM7A 1MVKA 3TBLD 4KIKB 4MT5A 2ACZB 2INCC 1R4NI 2V9HA 2LJ5A 2LXAA 4YSYB 1GJZA 2AX5A 5JXVA 4IOIE 1KRHA 2D11A 1PGBA 2V3NA 2WXOA 3AM9A 3AEBB 4KZ0A 3ZKJC 5IOIA 1C3TA 2IDYA 3ETRA 1SSNA 1XLQA 1FMAD 4JPSA 3A1QB 4TSSA 4C4VA 3BVGA 4MJSB 1BT0A 2PLPA 3SDLC 1J19A 3BYTB 4S17A 2YEPF 2HE7A 3DHHC 4S0RA 2WXQA 4TQ1A 1FXIA 3GOEA 2LVOA 3ENEA 4WWMA 2L00B 2INPE 4MH8A 5CHFA 2QEJC 4WH4A 3H1UA 1L5PA 2IO2B 4HPMB 2D10A 3C8YA 4P6VF 4USAA 4BKSA 1XD3B 3EC8A 4KDLB 3AMZA 1QLBB 2DZMA 3RFZB 1OEYJ 3KQ4A 4BFRA 2CKHB 2V3PA 4W9EA 2Z0EB 2QJLA 5J17A 3HM6X 1JWAD 2EELA 1CZPA 1VZ8A 5GMVA 1WXQA 1T0YA 3NVWA 3R8BA 2G45B 2GBJA 1Z2MA 1FXTB 5MPOA 1UWXA 4IC7B 2PE9A 2D3CA 2RSUA 1Q5WB 2NVUI 1XCQL 1R4NB 2J0MA 4A90A 3TEZA 3B9JA 2BYVE 1E9MA 1XQQA 2AQ3B 1Y56A 2N9KA 4DHZE 1WMHA 2BYFA 4HDOA 5DCNA 2CU1A 5H8YE 4OVVA 4ZYSA 3P1MA 1AW7A 2KX0A 3V6EB 2CHXA 4RF0A 2JYTA 2MWSB 3JSVB 2GB1A 3R2IA 4EZJA 1JWBD 4URKA 2UU7A 3Q3FA 1FCLA 1WSPA 5CHVC 1EF5A 3DVNU 2M1MA 1ZUD2 2JRIB 3VDZA 2KNBA 2NCNA 1SIJA 1ZPSA 1I4HA 3V6CB 2BW2A 3OJ3A 1RAXA 2OJWA 2WXGA 3HVDA 4DDID 2DLBA 2N9EB 4ZRIA 4FJVB 1FNWA 3KH0A 3R3MA 2CU3A 4W9FA 1NYQA 3BK2A 1HZ5A 2ICIA 4JGHB 1YJIA 1N61A 3OWEB 4NNJB 3IT6B 1WGYA 3PREA 2MJDA 1QZEA 1F77A 4F7ZA 4WAAA 2IJ0A 5GXGB 4FLHA 1V8CA 4J6IA 4WWNA 1IP9A 1ESFA 3TMPB 2UWQA 1QT9A 3L54A 1QKZA 2QCZA 2O2VA 4RM9A 3TUOA 1H4RA 1MJDA 1D5MC 1NENB 2J4XA 3L17A 4ICVA 2IYDB 4P16A 4E71A 3EA6A 2L0FA 1SF0A 3R7QA 3M62B 5HI1A 2M19A 2EKIA 3IG3A 3CMMB 5L83A 2WXKA 1UNSA 1V5TA 2MX2A 1EWYC 5D3IB 3MJWA 3SR6A 1FIQA 1MG4A 3SFEB 2YLMA 1FCCC 1V80A 4ANXA 2MBHA 2WDTB 4XE0A 3E9SA 1QOFA 2W3SA 2NPTA 3KUDB 5FR6A 1WR6E 4IWPA 3Q8CA 2KMCA 2JX5A 4JQWC 1ZDVA 2KVRA 3PHXB 1ET9A 4CYEA 3Q14C 4YXDB 1UELA 2OJRA 1EUVB 2BPSA 5IO9A 2E6XA 4HVBA 4OZBA 5E6JA 3I63C 2BS3B 3QK0A 3DWMA 2FIFA 1YIWA 1FNVA 3B2FA 2PKOA 1J7BA 3APCA 2WXJA 3M63B 4P1CC 4KIKA 2KN5A 5EE3A 2KD0A 1M94A 3HM3A 3UIOB 4AWJA 1LFDA 3NZ3A 5AEKB 2WXFA 1UZXB 2DHZA 2N0SB 2GBKA 1ZXIA 3AECB 5J2RA 2D3AA 5JZEB 4HEA1 1HTQA 1T5XD 4LCDE 1RRBA 1RWSA 2LASA 3P2BA 5KHOA 1C1YB 4DHZB 2JY6A 4F8CB 2LWPA 1FEHA 3VH4B 3GP7A 2IZVB 2BQQA 2N7DA 5IAAC 1VZ7A 3L4PA 2DYBA 1L2NA 1XT9B 3PZDA 2L3ZA 1L0VB 3ZTDA 2KANA 2MJ3A 3Q3NC 1PYWD 1P0RA 1HXYD 2G9HD 1GAQB 1T0RC 1L6VA 3Q6BA 4XX5A 4W9CA 1F2RI 1V97A 4LDTD 4KV2A 1ZDXA 4PS7A 2ZW1A 2QSDA 1P7EA 1UH6A 1HE8A 2KC1A 3CSFA 3SFDB 2M17A 4J3OD 2FCSA 2XK5B 4W9LA 3RT3B 1WE6A 2LGSA 1I7HA 3PO0A 5E6OA 3Q3OC 1E10A 1EF1A 1Q1OA 3AB5A 4NAMA 3APFA 1RLFA 3TCAA 5D3DA 5CTRC 5AZGA 1R4MI 3WAMA 1SEBD 1OQYA 2BT6A 2J52A 3MHSD 3O13A 1XLPA 1N60A 2PPHA 5AUKA 3AI5A 2EKEC 1ZGUB 2W82A 4A9AA 3H7PA 3RNEC 3CWIA 3ZRCA 2D07B 3T3NA 3JSVA 3QIJA 2ONQA 1QQRA 2LI5A 3ZDMC 1ACCA 4N6EB 3WALA 2FUHB 4UDUC 2ZPNA 4PK1A 1PGXA 3W5VB 2MQJA 2CS4A 3DBHI 3LJ3A 2JZ3B 3WAPA 2SAKA 1TY0A 1WM2A 2PVGC 2K3UA 1UF0A 5IN7A 4HXDA 3GS2A 2MHJA 4GDLB 3A9KA 4WURA 4GU2A 2W54A 4JWUC 4CQNA 5D94A 2KMMA 2XN9C 1HA5A 4E3CA 4M8MA 3W2DA 2R2QA 4A8XC 2GBMA 3GZNI 3RI7C 1LO5D 2FUG1 2QILA 5E6NA 2L0TA 2UYZB 2DWQA 4RGNA 3DQVA 1R4MB 1J7AA 1YX5B 3Q8EA 4OZCA 2WXPA 3JVZX 2IY0B 1PQSA 3AEDB 2AEHA 3WCQA 3DHIC 3HUIA 2LVPA 4DXFA 3O65B 4GDKA 3PSEB 4XWTA 2WNMA 3A4RA 3MC9A 1I42A 4FULA 4G11A 2KKCA 1TZ1A 1X1MA 4M0WB 2D3GA 2MP2A 1NVID 1FFVA 3DBHB 2WXNA 3VR8B 4ANUA 4NZLB 4G3XB 2MSED 3N1ZC 4W9IA 1V1PB 3MTNB 1K53A 3VAWA 4LK0M 5JH5C 4KGSA 3RMKC 1DOIA 2KLGA 2OEDA 3AU5A 1FD6A 3W1SC 2G1EA 3B0AA 4K7SA 1ZOYB 4II2B 3U30A 2KLCA 3Q3MC 4GXBA 1S3SG 4N58A 1XF5L 2GLSA 3ZO5B 3GZNB 3UINB 1UWMA 1DYQA 5J18A 2WX0A 3JW0X 2PMVA 1CK1A 2MCNB 2HJ1A 2KDBA 2K1FA 1F2RC 3IBEA 2LHEA 1N63A 2RDGA 3KWLA 1NDDA 3KYCD 4YTMB 3Q8AA 3QC8B 2ZVOA 1WY8A 3ZLZA 2FE8A 1WYWB 3IAM1 3IHPC 4I6PA 3BYYB 4C7YA 2CR5A 4ZRJA 2IO3B 2LEKA 3B1LX 4MDKE 3N1XC 4FADA 2WDQB 1TKGA 3FAHA 2KMAA 4QAYA 5C3JB 3K9PB 4EEWA 3VUWA 3BWUD 2KHWB 2DYOA 3E56A 2MA9B 1C78A 2GOWA 3WIMA 2LRUA 4EE2A 5E6PA 1QF6A 4M02A 1WXSA 2LXCA 4ARCA 3SHQA 2INNE 4LNNA 2INDC 3P63A 3AE9B 3RNBC 4LLGM 1V5OA 2LJIA 5CX3A 1K8RB 1ROEA 2W3RA 2XK5A 3PRZA 3Q2AC 1JWUD 2WS3B 3RNGC 2B76B 1JWMD 1MFWA 4AUQC 1D6EC 3NJTA 1RM6C 2BVCA 4US8A 3KW5B 3U7ZA 2WXLA 3T3OA 3DBRI 4RGMA 1NBFC 4HKZE 4AS1A 4NJ6A 4ACFA 3A33B 3QA8A 4WJPA 1EU4A 1KF6B 4LJPB 3NY5A 4C00A 4IM3A 1S1QB 1WGGA 2L05A 3K9OB 1RYJA 2JQRB 4KX6B 3RULA 3DVGY 1IBXB 3VH3B 4RGOS 2ZZPB 3W1SA 1RFKA 1QOBA 2GBRA 1I4XA 1TIFA 3M95A 1TJEA 1FRRA 2V4IB 3A9JB 1TKYA 1GG3A 4ANWA 3P42A 1V9JA 3MC0B 5LNK1 1E8XA 1UBQA 2KDFB 1SGHA 1TKEA 5G55A 2BYEA 1DGJA 1C76A 2IY1B 2JF5A 3ZXRA 1WF9A 2KTFA 4FXCA 4OHJA 1TYGB 2C5LC 2DBYA 4C7ZA 2Y5BB 3PZ7A 2GBNA 4JL9A 2H88B 3I57A 4DHJB 1PDXA 1YQ3B 3N1YC 3W9CB 2FCNA 3DBRB 3FILB 3D32A 2DZKA 1LXDA 1E7PB 1NI3A 4TQ0A 5DPWA 2DENB 2C60A 2KN4A 1AYFA 3HIZA 3W1YA 4MH0E 4NQKE 3S2AA 4K3CA 3NVYA 3BZDB 3CIRB 3U8ZA 1I4GA 4DDGD 2I1JA 3EFCA 1OQRA 1WX8A 4R3DA 1D3ZA 1C4CA 1DOXA 2LUEA 1P3QU 2PW9A 4I6NB 3UQAA 5TR5A 2YVCA 1JRUA 3TIXA 3U52E 4KKIA 5EE0A 1TTNA 4GMVA 2K39A 1V1PA 3NZSA 2DAFA 3ZNGC 2LGDA 4WWPA 1A70A 4IWOA 2MJEA 2DAJA 2Z8LA 1SE9A 3RN9C 3KYDD 1FNUA 4GGQA 3N9YC 2L1AA 4ZRQA 2Y3AA 1D5XC 3DCGA 2K6QA 4JE3B 3ZGZA 2MH7A 1WYGA 2I2YA 3HVZA 5DPRA 5EDSA 3UQBA 2PE6B 1T6BX 1L0YB 4IUMB 2JZPA 3ZNHB 1YOVB 3VVWB 3DBSA 4XGAB 3WA0A 4YSZB 2GMIC 2XEWA 3AE8B 1E6EB 2KO3A 3RD2A 3AN1A 4W9JA 2KFKA 2IPKD 4G50A 3TEYA 3L16A 3FC4A 1NI2A 2FBWB 2QDFA 3ZNZB 3PLUA 2L32A 2GI9A 3ECIA 3PGEA 3ML9A 1WX7A 3C0RB 3KVFB 3RZFA 1MHHE 2GRIA 2MW5A 1Z5SB 2OOBB 1TBEA 2W9NA 2Z59B 4ASWC 2WGSA 4NQLB 2IO1B 1F0ZA 5FK9C 4JWSC 2KJ6A 3A1QA 3APDA 4MJSA 3AEAB 4IW0A 5BMHA 1E7UA 1WX9A 3OG5A 2FCMA 4CO7A 5BYSA 5BMIA 3AV8A 4EZLA 4L23A 3R2TA 4HKQA 4ZHPA 1E7VA 3AE4B 2K5PA 3N20C 3RNCC 1DOYA 2G3QB 1GPXA 3TEWA 2JRHA 4B0MA 3X23A 2KACA 1YQ4B 2QHOA 1EWCA 3P4RB 1AARA 2QIEB 4DXGA 1YJ1A 5C23A 3QARA 1C79A 2D5GA 1L7YA 4KSKC 1P1AA 1WXAA 3DOWA 2CJNA 2I38A 1SE4A 2QC8A 1C4PA 2JSVX 4HROA 2LUMA 2AQ2B 4IWQA 4E74A 3TJPA 1I4RA 1P7FA 1WE7A 3GE3C 1MHXA 3M3JA 3BK1A 1IBXA 4L2YA 4PS3A 1WWTA 2R61A 4ZHOA 1VR9A 3EGRA 2LGXA 3AE5B 1BXTA 2LGIA 4OZAA 2K6DB 1L6UA 3AE2B 4PYZA 2KWUB 2ZNVB 2C7NB 2HJ8A 1JRPA 4HDQA 3ZYYX 3QX1A 1GC6A 1XLNA 1D4BA 3ZVVA 3RCZA 4MGYE 4LTUA 1NEKB 2WHIA 4LJOB 2IGHA 2KVZA 2WXIA 3SU8X 4B0EA 5LLIA 4KKJA 2AL3A 5IKCM 2AL6A 3VHTC 3ZW3A 3ONSA 4HWIB 3JYUA 5I4DA 2MLBA 2RDHA 1WGDA 4JLCA 4F1SA 3Q8FA 4GSWA 1IGCA 2LMCA 4BVUC 3OJ4B 1XEEA 5AZFA 1KLGD 1OGWA 3W5UB 1L4ZB 5EE9A 1ZE3D 1HTOA 5D6JB 3AULA 3IT4B 5LXIB 2Y5CA 2KTRB 2L7RA 1AWDA 3FILA 4LNKA 3IFWB 4HK2A 4ITKA 2C7HA 3FKYA 3KLSX 3L08A 3RPFC 4C56C 4HPLB 4PT5A 3R66C 4BBNF 3UGBB 1P9DU 1BUIC 2RR9A 1Y8RC 3C19A 4II3B 2BB6A 2M8SA 1IGDA 1TS2A 2PIAA 3ZTCA 2RPVA 1WGHA 3VTUA 1N5WA 2NTSA 1WGKA 2LRWA 5AZHA 3BINA 4RH6A 2BYTA 1IYFA 1WJ4A 2Y5PA 4WQOB 3NS1A 4YSXB 5T8IA 4CHKA 4XYCA 2KOXA 4Q2JA 1GB1A 1JMLA 2JWUA 4FJYA 1QOGA 1YN4A 1AN8A 2V4LA 3GB1A 3ML8A 1KLUD 4NPNA 4W9GA 1ZKHA 3H7SA 1VRAB 3RUIB 3ZJTA 4EUTA 4P7IA 2VZKD 2ZNVC 3PHWB 3H6NA 2WU2B 4RCOA 1WJNA 2QMTA 2AQ1B 3KWVA 2WDRB 1F1HA 2O2VB 4ZYNA 2M4NA 1YJJA 1YNTE 4P1BC 4LNIA 4HJGE 3NOBA 4HJKA 4G0NB 2WWZA 3U7DA 2BB5A 4FN2A 3TEXA 3MP9A 1C77A 4LNOA 3R7RA 1JROA 2L8JA 2DZIA 4ZRKA 2LVQA 2J53A 2Q5WD 3L10B 2KDEB 3P4PB 2RMMA 4MACA 2WLBA 2KZRA 5AUIA 3Q69A 5D7GA 1WZ3A 2NMQA 4NAWB 5BYQA 4IM2A 3L13A 1CMXB 4FBJB 1WZ0A 4WJNA 5G5GA 3AE3B 1T0QC 4ARIA 1GUAB 3NVVA 1WXVA 3TSSA 2WXHA 4DXAB 2RPQA 3A4SC 4HRSA 3WANA 3U4EG 2JWZA 1TS4A 2ZCCA 3P4SB 2X8XX 4TV3A 1K51A 1SJED 1VCBA 2KFJA 4ANVA 1OTRB 1EO6A 4IDIA 1E90A 2K8CA 2FAZA 2K22A 2NBWB 2KX3A 1FXAA 1WIAA 4W9DA 2N9LA 2KK8A 1P98A 3DWGC 4KVGB 1YQBA 2KJHB 2M56B 4YTNB 2ZEQA 4ZDVA 1KFYB 1R7SA 3P4QB 4DHJD 2CHWA 4XZ4A 4EOYA 3HHMA 2IBIB 2KDIA 2RD0A 3AU4A 2VZKB 1B1ZA 3VR9B 2BBCA 3AXCA 1EU3A 3EFUA 3SEBA 3PRPB 2MBEA 1KH0A 2KQ7A 1YD8U 2E3TA 3SD5A 2D3BA 1CJEA 4OVUA 4TMAB 2KC2A 1WRIA 2WXRA 4BKTA 1STEA 2Z0DB 5HHDG 2DYMA 3B08A 4A55A 3HK0A 2O6VD 3LB8C 3QAQA 2WYQA 3QHTA 2KQ4X 2KWDA 1LGRA 1C4AA 1VZ6A 5G2NA 5D2MB 2DX5B 2IGGA 5BO4B 4MSQB 1U4AA 2JXXA 1LM8B 1FPYA 3V05A 2DNFA 5JHBA 1V1OA 2JZZA 3PZ8A 1TY2A 2K25A 4A3OA 4FJZA 2N1WA 3V60A 1N5XA 3KUCB 3VRBB 2L83A 4GDLA 2KTRA 4NJ7A 4KZCA 4FA6A 3VTVA 2WP9B 4IM0A 2V3SA 1HEZE 2MBBB 2BKFA 4ICUA 1KOTA 1V6EA 3QQ8B 4YT0B 3VTWA 1SIFA 1YN5A 2J0JA 2L76A 3H7PB 1RFAA 2BS4B 4HPPA 1E8YA 1OQQA 1SE3A 2D2QA 2VH2A 3LXFA 3MJ5A 2MEKA 1MPEA 1OFFA 4GB9A 2B3AA 3ZIMA 5KHQA 5JHAA 2DZJA 1F9JA 4RM8A 2OHFA 2WXMA 1IUEA 1VDVA 2G4DB 5BMGA 4MEMA 3L0WB 3H8HA 4HCPB 2WQYB 1WJUA 1WFYA 4DQOC 4WJOA 3A9KB 1A5RA 1V86A 2ZVNA 4XDCA 2IGDA 4EZKA 4MM3B 4M0WA 1WH3A 1MG8A 3ABVB 2O6VB 1PUTA 1JWSD 4N9F4 4XDDA 2FCQA 5H92C 2KYWA 1I4PA 3PT2B 4AOFA 3PTFC 4A3PA 2G4SA 2NTTA 2IO0B 2JYEA 1FRDA 3AEGB 3DHGC 2EMSA 1GNUA 2VRRB 4B6WA 3DBLI 3BY4B 1SBBB 1C9FA 2LD9A 3NZUA 2N4FA 3DPDA 2PTLA 2J0KA 3Q3JA 5FR3A 5EE1A 1JCKB 3Q8BA 3AH7A 4BZAA 4GOCA 5HG2A 2WU5B 3PV1A 1JALA 4NAWA 2H89B 1M4VA 4GDKB 3UIPB 3I9V1 3PRMB 3ZUNA 1TZOA 3IXSA 3QCAA 5FKAC 4C80A 4W9HA 2X38A 2MP2B 3T8MA 3NVZA 3BIID 3VUYA 1N62A 1E5WA 1XCTL 2JT4B 2K8BA 1XXGA 4GN1A 2WX1A 2CHZA 3B2GA 4BKSD 4K81A 3LYYA 3IVFA 3KUZA 1ZXHA 5L95C 1QOAA 4TUUA 2N7JA 1K52A 4M00A 4FHJA 4WJQA 2KDMA 1FO4A 4BBNC 2XBBC 4EKUA 2ZCBA 3X0WA 4K7WA 2C9WB 4BOSC 2FIDA 1VD2A 3PS6A 1BMLC 2HDEA 4OVZA 4ZRPA 1OEYA 1I35A 1HQRD 1JQ4A 2ZPYA 1TS3A 1J0GA 3ZXVA 1ET6A 2LHDA 1Q0WB 3DBLB 2KJRA 3BVMA 2BKRB 1VJKA 2ON8A 1I4QA 4A6QA 1YN3A 5G5HA 2RGFA 1J7CA 4KSLC 4AJYB 4WIPA 2JPHA 2R2OA 2HTHA 1WI0A 2L52A 4REZA 3PVLA 4BKGA 3QWZB 3RNFC 3ZJVA 1FM0D 2ASQA 4DK5A 3VQIA 2KQSA 4A20A 3ZRFA 1FFUA 3NHEB 2V0GA 4XC2A 4GLSC 3U2SC 2YEPB 1KLVA 1WGRA 4DBGA 4AP4C 3PPAA 4MSMB 2BF8B 2PEAA 2N9XA 1KM7A 2M0AA 4MGZE 4GIVA 4YL8A 4C4VB 2KAJA 2AYOB 4AQ7A 4RFBA 1XLOA 2LZ6A 1YX6B 3RYTA 1G6JA 4RGTA 3DVNV 4XWWA 2KT7A 4AJWA 3MC8A 1GB4A 1ZW7A 4B95A 4MGKE 2N7EA 1XO3A 3A9JA 4TKNA 2JUOA 4HLEA 3NRZA 2KXJA 3WAOA 3I3TB 1SXTA 4O1NA 2BTEA 4BOZB 4ZOHC 3BVZA 4K7UA 2HTME 2K8HA 3HRDD 5HKHA 4MELA 2XNAC 5C1ZA 1VLBA 3N32A 2FNJB 1J8CA 1ISNA 1KJTA 2MRPA 1V49A 4FHKA 2KWVB 2NBUA 1MI0A 2J7QB 1YMHE 5BYRA 1HZ6A 1WRDB 3TL5A 3IAS1 2JU6X 2HD5B 2PJHA 1LQBA 4PYUA 1UGMA 3UF8A 5DPTA 2LFIA 1SJHD 2AWTA 3NS8A
chains in the Genus database with same CATH topology
1K51A 1SJED 2DBYA 4C7ZA 1E0ZA 3PZ7A 4IDIA 3NZ3A 2WXFA 2ZW0A 2H88B 3I57A 2K22A 2N0SB 1FXAA 1SB3C 1ZXIA 3AECB 2J42A 1T3QA 1PDXA 1YQ3B 3ZJUA 1ENFA 4HEA1 2N9LA 3W9CB 1T5XD 3DWGC 1RWSA 3FILB 3EUB2 1JW9D 3UI3A 1FEHA 2M56B 4YTNB 1KFYB 1R7SA 3GP7A 3MFGA 3P4QB 1E7PB 3AEFB 1NI3A 1TS5A 4TQ0A 1UUPA 1VZ7A 2SEBD 3ZQ4A 2KN4A 1AYFA 2WDVB 3L4PA 1L0VB 3NVYA 2MJ3A 1L0XB 2TSSA 3BZDB 4US9A 3CIRB 1I4GA 1PYWD 2VZKB 1B1ZA 3VR9B 2BBCA 3V3XA 1Q10A 2PVOD 5C2TB 1OQRA 3NUHB 2JXTA 1UGJA 1HXYD 2G9HD 1EU3A 1GAQB 3SEBA 4R3DA 1SE2A 1C4CA 1DOXA 4WQMA 1PGAA 2PW9A 1L6VA 1KH0A 2BS2B 1F2RI 1V97A 3U52E 2E3TA 4KKIA 1ZDXA 5EE0A 1CJEA 2CJOA 1L4DB 1P7EA 2QSDA 2ZW1A 4KGRA 4TMAB 1WRIA 2WXRA 1V1PA 3URYA 1STEA 5HFYA 5HHDG 2DYMA 3SFDB 4A55A 4J3OD 3LB8C 1A70A 4YTPB 2MJEA 2Z8LA 4H2AA 5TSSA 2KQ4X 1I7HA 3PO0A 1FNUA 3AE6B 1E10A 2KWDA 3AB5A 4NAMA 3N9YC 2W55A 2L1AA 4ZRQA 2Y3AA 1NYRA 1C4AA 4IKGA 1VZ6A 1D5XC 2IGGA 1B9RA 3AEEB 5D3DA 4JE3B 3ZGZA 1SEBD 2MH7A 4OW0A 1WYGA 4N59A 1KTKA 2I2YA 4NJCA 3HVZA 3V05A 2BT6A 1K50A 2J52A 3O13A 1V1OA 3AE7B 1XLPA 1T6BX 3PZ8A 1N60A 1L0YB 5AUKA 4L1BA 1TY2A 2W82A 4A9AA 2JZPA 1N5XA 3CWIA 4YSZB 1QILA 3J9CA 3AE8B 1E6EB 3VRBB 4WAFA 2L83A 3T3NA 3AN1A 2ONQA 2IPKD 1QQRA 3TEYA 1ACCA 4N6EB 1D5ZC 2WP9B 3AE1B 1HEZE 3FC4A 2K9XA 2FBWB 4UDUC 1ZP0B 1CQVA 1PGXA 4YT0B 3W5VB 1PFDA 1YN5A 2L32A 2GI9A 4YWGG 4RF1A 3VRAB 2SAKA 1TY0A 2BS4B 1MHHE 2GRIA 2PVGC 4D2KA 2K3UA 1OQQA 1SE3A 3GS2A 3LXFA 4RNAA 4KGTA 4GDLB 4WURA 3MHZA 3MJ5A 2MEKA 1MPEA 1F0ZA 5FK9C 1OFFA 4JWSC 4JX1C 2K0PA 2W54A 1GOZA 1EM7A 3AEAB 4JWUC 4CQNA 1MVKA 5BMHA 2KMMA 2XN9C 1HA5A 4MT5A 2ACZB 2OHFA 2WXMA 3W2DA 1IUEA 1VDVA 5BYSA 4A8XC 5BMGA 4YSYB 5BMIA 3H8HA 3AV8A 2AX5A 5JXVA 4IOIE 4L23A 3R2TA 1KRHA 4HKQA 4ZHPA 2WQYB 1PGBA 2V3NA 1LO5D 2FUG1 2QILA 2WXOA 3AE4B 2K5PA 2DWQA 3AM9A 4DQOC 3AEBB 4RGNA 1DOYA 1GPXA 3TEWA 2IDYA 1J7AA 3ETRA 1SSNA 1XLQA 1FMAD 4JPSA 4B0MA 2KACA 3Q8EA 4TSSA 1YQ4B 3BVGA 4OZCA 2IGDA 4XDCA 2PLPA 2WXPA 1EWCA 4MM3B 3P4RB 4M0WA 3AEDB 3ABVB 3BYTB 1PUTA 1JWSD 2QIEB 2YEPF 4DXGA 4XDDA 2WXQA 4TQ1A 1FXIA 3WCQA 1C79A 5H92C 2D5GA 4WWMA 1I4PA 3HUIA 4DXFA 2INPE 2CJNA 2I38A 1SE4A 4MH8A 2NTTA 2JYEA 1FRDA 1C4PA 2JSVX 3AEGB 2LUMA 2AQ2B 2QEJC 4HROA 4WH4A 1L5PA 4XWTA 2WNMA 1I4RA 1P7FA 3C8YA 4P6VF 1MHXA 4USAA 1SBBB 1C9FA 3BK1A 3AMZA 1IBXA 4L2YA 1QLBB 3RFZB 1WWTA 2PTLA 2R61A 4ZHOA 3KQ4A 1NVID 1VR9A 1FFVA 2V3PA 2WXNA 3EGRA 5EE1A 5FR3A 3VR8B 3AE5B 1JCKB 3Q8BA 1BXTA 2QJLA 2LGIA 3AH7A 4NZLB 4OZAA 5HG2A 1L6UA 3AE2B 1JWAD 2WU5B 1JALA 1CZPA 2EELA 1M4VA 1V1PB 2H89B 4GDKB 1K53A 1VZ8A 4LK0M 1WXQA 3R8BA 1JRPA 3NVWA 3ZYYX 3I9V1 4KGSA 1DOIA 1XLNA 1D4BA 1TZOA 2OEDA 4LTUA 3IXSA 1NEKB 5FKAC 1UWXA 4C80A 5MPOA 2IGHA 1FD6A 2G1EA 2WXIA 2X38A 1XCQL 1ZOYB 4B0EA 4KKJA 3NVZA 3BIID 4N58A 1N62A 1XF5L 4A90A 3TEZA 3B9JA 1XCTL 1XXGA 1E9MA 1UWMA 2AQ3B 1Y56A 1DYQA 3B2GA 5I4DA 2N9KA 2RDHA 3LYYA 2PMVA 1CK1A 3Q8FA 1IGCA 2LMCA 5H8YE 1XEEA 1ZXHA 1KLGD 1QOAA 4ZYSA 3W5UB 2N7JA 1K52A 3P1MA 1AW7A 1L4ZB 5EE9A 1F2RC 1ZE3D 2KDMA 1FO4A 2LHEA 1N63A 2RDGA 4RF0A 3KWLA 3IT4B 2JYTA 4YTMB 2Y5CA 3Q8AA 2GB1A 3R2IA 1AWDA 1JWBD 3FILA 1BMLC 2HDEA 1FCLA 2FE8A 4ITKA 1WSPA 3IAM1 4OVZA 4ZRPA 3BYYB 1ZUD2 4C7YA 3KLSX 1HQRD 1JQ4A 1SIJA 1TS3A 3RPFC 1ZPSA 1I4HA 4C56C 2BW2A 1ET6A 2LEKA 2LHDA 4PT5A 2WXGA 3HVDA 2DLBA 2WDQB 1TKGA 1FNWA 3BVMA 3FAHA 1VJKA 1BUIC 2CU3A 2ON8A 1I4QA 1NYQA 4A6QA 1YN3A 2BB6A 3BK2A 5C3JB 5G5HA 1HZ5A 1IGDA 2ICIA 1J7CA 1TS2A 1YJIA 1N61A 2PIAA 4WIPA 3BWUD 3OWEB 2RPVA 2DYOA 3E56A 3IT6B 1C78A 4REZA 2L52A 2MJDA 1N5WA 2NTSA 1WGKA 1FM0D 3ZJVA 4EE2A 1F77A 3VQIA 4RH6A 1QF6A 2BYTA 2IJ0A 5GXGB 1FFUA 4ARCA 2Y5PA 3NS1A 4YSXB 5T8IA 1V8CA 2INNE 2V0GA 1ESFA 1QT9A 4GLSC 1QKZA 3P63A 3U2SC 3AE9B 4Q2JA 2YEPB 1GB1A 1JMLA 4LLGM 2JWUA 2LJIA 1QOGA 3TUOA 1YN4A 1AN8A 1ROEA 2W3RA 1D5MC 3GB1A 1JWUD 1NENB 2WS3B 2J4XA 2B76B 2M0AA 1JWMD 1KLUD 4P16A 1D6EC 2KAJA 3EA6A 1RM6C 1SF0A 1VRAB 5HI1A 3ZJTA 4US8A 3U7ZA 2M19A 2VZKD 2EKIA 2WXLA 3T3OA 4AQ7A 4RGMA 4RFBA 1XLOA 4RCOA 2WU2B 2WXKA 2QMTA 2AQ1B 1UNSA 2WDRB 3KWVA 4HKZE 4AS1A 4RGTA 4XWWA 1YJJA 1YNTE 1GB4A 1EWYC 4HJGE 5D3IB 1EU4A 3SR6A 1FIQA 1KF6B 1XO3A 2BB5A 3SFEB 3TEXA 3NRZA 3MP9A 1C77A 1JROA 1FCCC 1SXTA 1RYJA 4O1NA 4XE0A 2JQRB 4KX6B 2BTEA 3E9SA 4ZOHC 3BVZA 1IBXB 1QOFA 2HTME 2J53A 2W3SA 4RGOS 2Q5WD 3W1SA 3P4PB 2RMMA 4MACA 2WLBA 5AUIA 3HRDD 3Q8CA 2XNAC 2JX5A 3Q69A 1ZDVA 1RFKA 1QOBA 1ET9A 1VLBA 1I4XA 5D7GA 4YXDB 2NMQA 1TJEA 4NAWB 1FRRA 2V4IB 5BYQA 1MI0A 1TKYA 1YMHE 2E6XA 5BYRA 4OZBA 5E6JA 3P42A 3MC0B 2BS3B 1HZ6A 5G5GA 3AE3B 3DWMA 4ARIA 5LNK1 3IAS1 1FNVA 2JU6X 3B2FA 2PKOA 3NVVA 1J7BA 3TSSA 2WXHA 1TKEA 1DGJA 4HRSA 2WXJA 3U4EG 1C76A 1TS4A 4FXCA 2LFIA 4OHJA 3P4SB 5EE3A 1SJHD 1TYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USA A;  2DBY A;  4C7Z A;  1N5X A;  3CWI A;  3AMZ A;  1E0Z A;  1QF6 A;  4YSZ B;  1QLB B;  4IDI A;  5GXG B;  3AE8 B;  1E6E B;  1WWT A;  3VRB B;  1FFU A;  4ZHO A;  2L83 A;  3NS1 A;  1NVI D;  2H88 B;  1V8C A;  2K22 A;  4YSX B;  3AN1 A;  1FFV A;  2N0S B;  5EE1 A;  1FXA A;  3VR8 B;  1SB3 C;  1ZXI A;  3AE5 B;  3AEC B;  1QT9 A;  2QJL A;  3P63 A;  1T3Q A;  1PDX A;  3AE9 B;  3AH7 A;  4N6E B;  1YQ3 B;  2WP9 B;  3AE1 B;  3FC4 A;  1L6U A;  2K9X A;  1QOG A;  3AE2 B;  2FBW B;  1JWA D;  2WU5 B;  3W9C B;  1JAL A;  1CZP A;  1ROE A;  2H89 B;  2W3R A;  3DWG C;  1NEN B;  2WS3 B;  1RWS A;  1WXQ A;  1ZP0 B;  1JRP A;  2B76 B;  3EUB 2;  3NVW A;  4YT0 B;  3W5V B;  3ZYY X;  1JW9 D;  1PFD A;  1DOI A;  1XLN A;  2M56 B;  4YTN B;  1KFY B;  1R7S A;  3VRA B;  2KAJ A;  3P4Q B;  4LTU A;  1E7P B;  3AEF B;  1NI3 A;  1NEK B;  1RM6 C;  1SF0 A;  2BS4 B;  4C80 A;  5MPO A;  2PVG C;  2G1E A;  4US8 A;  1AYF A;  2WDV B;  2M19 A;  3L4P A;  1OQQ A;  2EKI A;  1WGK A;  3LXF A;  1ZOY B;  1L0V B;  1XLO A;  3NVY A;  2MJ3 A;  3NVZ A;  2WU2 B;  3BII D;  4N58 A;  1N62 A;  4US9 A;  1F0Z A;  3CIR B;  2WDR B;  1OFF A;  4JWS C;  3VR9 B;  3B9J A;  1YJJ A;  4JX1 C;  2PVO D;  1EWY C;  5C2T B;  1E9M A;  2W54 A;  1OQR A;  1UWM A;  3AEA B;  4JWU C;  3B2G A;  3SR6 A;  1FIQ A;  1GAQ B;  1KF6 B;  1XO3 A;  2KMM A;  3SFE B;  3NRZ A;  1DOX A;  4WQM A;  1JRO A;  5H8Y E;  2ACZ B;  2OHF A;  1IUE A;  1QOA A;  1L6V A;  1RYJ A;  1VDV A;  3W5U B;  2JQR B;  4KX6 B;  4YSY B;  3P1M A;  4ZOH C;  5EE9 A;  2BS2 B;  1QOF A;  2HTM E;  1V97 A;  2W3S A;  2AX5 A;  3AV8 A;  2Q5W D;  1FO4 A;  2E3T A;  1KRH A;  5EE0 A;  2WQY B;  1CJE A;  2CJO A;  1N63 A;  2WLB A;  3P4P B;  4ZHP A;  3KWL A;  3AE4 B;  2K5P A;  5AUI A;  1WRI A;  2DWQ A;  3AM9 A;  3HRD D;  2Y5C A;  3AEB B;  4YTM B;  1DOY A;  1GPX A;  1AWD A;  1JWB D;  2JX5 A;  1RFK A;  3ETR A;  1J7A A;  1QOB A;  1XLQ A;  1FMA D;  4ITK A;  1VLB A;  3SFD B;  4YXD B;  3LB8 C;  1A70 A;  4YTP B;  2MJE A;  1YQ4 B;  1TJE A;  1FRR A;  1ZUD 2;  4C7Y A;  1I7H A;  3P4R B;  3PO0 A;  3AE6 B;  1E10 A;  1JQ4 A;  1SIJ A;  3AED B;  3ABV B;  3AB5 A;  3RPF C;  1TKY A;  1PUT A;  2QIE B;  2LEK A;  2W55 A;  1NYR A;  1FXI A;  3WCQ A;  2BS3 B;  5H92 C;  5G5G A;  1B9R A;  3AE3 B;  2WDQ B;  3AEE B;  3DWM A;  4WWM A;  1TKG A;  3FAH A;  1VJK A;  3HUI A;  2CU3 A;  2MH7 A;  2PKO A;  3B2F A;  3NVV A;  1NYQ A;  1J7B A;  1WYG A;  4N59 A;  2CJN A;  5C3J B;  3HVZ A;  5G5H A;  1TKE A;  1J7C A;  1FRD A;  1YJI A;  2PIA A;  1N61 A;  1DGJ A;  2BT6 A;  3AEG B;  4HRS A;  1L5P A;  4HRO A;  3AE7 B;  1XLP A;  4FXC A;  1N60 A;  2L52 A;  2MJD A;  4P6V F;  3P4S B;  5AUK A;  5EE3 A;  1TYG B;  1N5W A;  4A9A A;  1FM0 D; 
#chains in the Genus database with same CATH topology
 4K3B A;  1WXM A;  1E0Z A;  1WMH B;  3T9L A;  3ZNI D;  4JIO U;  2ZW0 A;  2MBQ A;  1SB3 C;  4KDI C;  2J42 A;  1T3Q A;  2VH1 A;  4LNF A;  3ZJU A;  1ENF A;  1TGZ B;  3DDC B;  3I5J C;  4MM3 A;  2N1V A;  3EUB 2;  3VXW A;  2C7M B;  1JW9 D;  2O6V A;  3UI3 A;  5LXH A;  2BWE S;  2NS5 A;  4X57 B;  3MFG A;  5CHW A;  4WWO A;  3AEF B;  1TS5 A;  1UD7 A;  3H9D A;  1UUP A;  4DWF A;  2SEB D;  3ZQ4 A;  2A4Z A;  1V2Y A;  2WDV B;  1IPG A;  4HCN B;  3CF6 E;  2TSS A;  1L0X B;  4US9 A;  4LDT B;  5IA7 A;  3V3X A;  1Q10 A;  2PVO D;  5C2T B;  3NUH B;  4EFO A;  2JXT A;  1UGJ A;  1SE2 A;  2NR2 A;  4WQM A;  2ZJD A;  1PGA A;  4W9K A;  3V61 A;  2BS2 B;  3OLM D;  1E8Z A;  1E8W A;  2CJO A;  1L4D B;  4KGR A;  4BAX A;  3URY A;  3EHV A;  3N3K B;  5HFY A;  3DVG X;  4YTP B;  4NY0 A;  2KWC A;  4H2A A;  5TSS A;  3OAW A;  3AE6 B;  3LDZ E;  2I1K A;  2W55 A;  4IKG A;  1NYR A;  4MGI E;  3N30 A;  4I6L B;  1B9R A;  3AEE B;  4OW0 A;  3NG0 A;  2A5U A;  4N59 A;  1KTK A;  1H8C A;  4NJC A;  3GE8 C;  2BGF A;  1K50 A;  3ZDT A;  3AE7 B;  2RDB C;  4RMA A;  4L1B A;  3RZW C;  2EMT A;  1WM3 A;  2LGY A;  1QIL A;  3J9C A;  2N9P C;  4WAF A;  3EEC A;  2NBV B;  3QJZ A;  2BWF A;  1TT5 B;  4IG7 B;  4K1R B;  1D5Z C;  3AE1 B;  2NPT B;  3CST A;  2K9X A;  1T0S C;  1GC7 A;  3VUX A;  5IP4 D;  1ZP0 B;  1F52 A;  1CQV A;  4B9K A;  3PLV A;  3ALB A;  1PFD A;  3RNA C;  2JVC A;  2V1Y A;  2REX A;  4YWG G;  4RF1 A;  1UBI A;  3V62 A;  3VRA B;  3VFK A;  4D2K A;  1WR1 A;  1WJ6 A;  5DPS A;  4RNA A;  4KGT A;  1V81 A;  2KFK B;  3MHZ A;  4PS8 A;  1N6Z A;  2M0X A;  4M8N A;  4M01 A;  4JX1 C;  2MBO A;  2K0P A;  1GOZ A;  1EM7 A;  1MVK A;  3TBL D;  4KIK B;  4MT5 A;  2ACZ B;  2INC C;  1R4N I;  2V9H A;  2LJ5 A;  2LXA A;  4YSY B;  1GJZ A;  2AX5 A;  5JXV A;  4IOI E;  1KRH A;  2D11 A;  1PGB A;  2V3N A;  2WXO A;  3AM9 A;  3AEB B;  4KZ0 A;  3ZKJ C;  5IOI A;  1C3T A;  2IDY A;  3ETR A;  1SSN A;  1XLQ A;  1FMA D;  4JPS A;  3A1Q B;  4TSS A;  4C4V A;  3BVG A;  4MJS B;  1BT0 A;  2PLP A;  3SDL C;  1J19 A;  3BYT B;  4S17 A;  2YEP F;  2HE7 A;  3DHH C;  4S0R A;  2WXQ A;  4TQ1 A;  1FXI A;  3GOE A;  2LVO A;  3ENE A;  4WWM A;  2L00 B;  2INP E;  4MH8 A;  5CHF A;  2QEJ C;  4WH4 A;  3H1U A;  1L5P A;  2IO2 B;  4HPM B;  2D10 A;  3C8Y A;  4P6V F;  4USA A;  4BKS A;  1XD3 B;  3EC8 A;  4KDL B;  3AMZ A;  1QLB B;  2DZM A;  3RFZ B;  1OEY J;  3KQ4 A;  4BFR A;  2CKH B;  2V3P A;  4W9E A;  2Z0E B;  2QJL A;  5J17 A;  3HM6 X;  1JWA D;  2EEL A;  1CZP A;  1VZ8 A;  5GMV A;  1WXQ A;  1T0Y A;  3NVW A;  3R8B A;  2G45 B;  2GBJ A;  1Z2M A;  1FXT B;  5MPO A;  1UWX A;  4IC7 B;  2PE9 A;  2D3C A;  2RSU A;  1Q5W B;  2NVU I;  1XCQ L;  1R4N B;  2J0M A;  4A90 A;  3TEZ A;  3B9J A;  2BYV E;  1E9M A;  1XQQ A;  2AQ3 B;  1Y56 A;  2N9K A;  4DHZ E;  1WMH A;  2BYF A;  4HDO A;  5DCN A;  2CU1 A;  5H8Y E;  4OVV A;  4ZYS A;  3P1M A;  1AW7 A;  2KX0 A;  3V6E B;  2CHX A;  4RF0 A;  2JYT A;  2MWS B;  3JSV B;  2GB1 A;  3R2I A;  4EZJ A;  1JWB D;  4URK A;  2UU7 A;  3Q3F A;  1FCL A;  1WSP A;  5CHV C;  1EF5 A;  3DVN U;  2M1M A;  1ZUD 2;  2JRI B;  3VDZ A;  2KNB A;  2NCN A;  1SIJ A;  1ZPS A;  1I4H A;  3V6C B;  2BW2 A;  3OJ3 A;  1RAX A;  2OJW A;  2WXG A;  3HVD A;  4DDI D;  2DLB A;  2N9E B;  4ZRI A;  4FJV B;  1FNW A;  3KH0 A;  3R3M A;  2CU3 A;  4W9F A;  1NYQ A;  3BK2 A;  1HZ5 A;  2ICI A;  4JGH B;  1YJI A;  1N61 A;  3OWE B;  4NNJ B;  3IT6 B;  1WGY A;  3PRE A;  2MJD A;  1QZE A;  1F77 A;  4F7Z A;  4WAA A;  2IJ0 A;  5GXG B;  4FLH A;  1V8C A;  4J6I A;  4WWN A;  1IP9 A;  1ESF A;  3TMP B;  2UWQ A;  1QT9 A;  3L54 A;  1QKZ A;  2QCZ A;  2O2V A;  4RM9 A;  3TUO A;  1H4R A;  1MJD A;  1D5M C;  1NEN B;  2J4X A;  3L17 A;  4ICV A;  2IYD B;  4P16 A;  4E71 A;  3EA6 A;  2L0F A;  1SF0 A;  3R7Q A;  3M62 B;  5HI1 A;  2M19 A;  2EKI A;  3IG3 A;  3CMM B;  5L83 A;  2WXK A;  1UNS A;  1V5T A;  2MX2 A;  1EWY C;  5D3I B;  3MJW A;  3SR6 A;  1FIQ A;  1MG4 A;  3SFE B;  2YLM A;  1FCC C;  1V80 A;  4ANX A;  2MBH A;  2WDT B;  4XE0 A;  3E9S A;  1QOF A;  2W3S A;  2NPT A;  3KUD B;  5FR6 A;  1WR6 E;  4IWP A;  3Q8C A;  2KMC A;  2JX5 A;  4JQW C;  1ZDV A;  2KVR A;  3PHX B;  1ET9 A;  4CYE A;  3Q14 C;  4YXD B;  1UEL A;  2OJR A;  1EUV B;  2BPS A;  5IO9 A;  2E6X A;  4HVB A;  4OZB A;  5E6J A;  3I63 C;  2BS3 B;  3QK0 A;  3DWM A;  2FIF A;  1YIW A;  1FNV A;  3B2F A;  2PKO A;  1J7B A;  3APC A;  2WXJ A;  3M63 B;  4P1C C;  4KIK A;  2KN5 A;  5EE3 A;  2KD0 A;  1M94 A;  3HM3 A;  3UIO B;  4AWJ A;  1LFD A;  3NZ3 A;  5AEK B;  2WXF A;  1UZX B;  2DHZ A;  2N0S B;  2GBK A;  1ZXI A;  3AEC B;  5J2R A;  2D3A A;  5JZE B;  4HEA 1;  1HTQ A;  1T5X D;  4LCD E;  1RRB A;  1RWS A;  2LAS A;  3P2B A;  5KHO A;  1C1Y B;  4DHZ B;  2JY6 A;  4F8C B;  2LWP A;  1FEH A;  3VH4 B;  3GP7 A;  2IZV B;  2BQQ A;  2N7D A;  5IAA C;  1VZ7 A;  3L4P A;  2DYB A;  1L2N A;  1XT9 B;  3PZD A;  2L3Z A;  1L0V B;  3ZTD A;  2KAN A;  2MJ3 A;  3Q3N C;  1PYW D;  1P0R A;  1HXY D;  2G9H D;  1GAQ B;  1T0R C;  1L6V A;  3Q6B A;  4XX5 A;  4W9C A;  1F2R I;  1V97 A;  4LDT D;  4KV2 A;  1ZDX A;  4PS7 A;  2ZW1 A;  2QSD A;  1P7E A;  1UH6 A;  1HE8 A;  2KC1 A;  3CSF A;  3SFD B;  2M17 A;  4J3O D;  2FCS A;  2XK5 B;  4W9L A;  3RT3 B;  1WE6 A;  2LGS A;  1I7H A;  3PO0 A;  5E6O A;  3Q3O C;  1E10 A;  1EF1 A;  1Q1O A;  3AB5 A;  4NAM A;  3APF A;  1RLF A;  3TCA A;  5D3D A;  5CTR C;  5AZG A;  1R4M I;  3WAM A;  1SEB D;  1OQY A;  2BT6 A;  2J52 A;  3MHS D;  3O13 A;  1XLP A;  1N60 A;  2PPH A;  5AUK A;  3AI5 A;  2EKE C;  1ZGU B;  2W82 A;  4A9A A;  3H7P A;  3RNE C;  3CWI A;  3ZRC A;  2D07 B;  3T3N A;  3JSV A;  3QIJ A;  2ONQ A;  1QQR A;  2LI5 A;  3ZDM C;  1ACC A;  4N6E B;  3WAL A;  2FUH B;  4UDU C;  2ZPN A;  4PK1 A;  1PGX A;  3W5V B;  2MQJ A;  2CS4 A;  3DBH I;  3LJ3 A;  2JZ3 B;  3WAP A;  2SAK A;  1TY0 A;  1WM2 A;  2PVG C;  2K3U A;  1UF0 A;  5IN7 A;  4HXD A;  3GS2 A;  2MHJ A;  4GDL B;  3A9K A;  4WUR A;  4GU2 A;  2W54 A;  4JWU C;  4CQN A;  5D94 A;  2KMM A;  2XN9 C;  1HA5 A;  4E3C A;  4M8M A;  3W2D A;  2R2Q A;  4A8X C;  2GBM A;  3GZN I;  3RI7 C;  1LO5 D;  2FUG 1;  2QIL A;  5E6N A;  2L0T A;  2UYZ B;  2DWQ A;  4RGN A;  3DQV A;  1R4M B;  1J7A A;  1YX5 B;  3Q8E A;  4OZC A;  2WXP A;  3JVZ X;  2IY0 B;  1PQS A;  3AED B;  2AEH A;  3WCQ A;  3DHI C;  3HUI A;  2LVP A;  4DXF A;  3O65 B;  4GDK A;  3PSE B;  4XWT A;  2WNM A;  3A4R A;  3MC9 A;  1I42 A;  4FUL A;  4G11 A;  2KKC A;  1TZ1 A;  1X1M A;  4M0W B;  2D3G A;  2MP2 A;  1NVI D;  1FFV A;  3DBH B;  2WXN A;  3VR8 B;  4ANU A;  4NZL B;  4G3X B;  2MSE D;  3N1Z C;  4W9I A;  1V1P B;  3MTN B;  1K53 A;  3VAW A;  4LK0 M;  5JH5 C;  4KGS A;  3RMK C;  1DOI A;  2KLG A;  2OED A;  3AU5 A;  1FD6 A;  3W1S C;  2G1E A;  3B0A A;  4K7S A;  1ZOY B;  4II2 B;  3U30 A;  2KLC A;  3Q3M C;  4GXB A;  1S3S G;  4N58 A;  1XF5 L;  2GLS A;  3ZO5 B;  3GZN B;  3UIN B;  1UWM A;  1DYQ A;  5J18 A;  2WX0 A;  3JW0 X;  2PMV A;  1CK1 A;  2MCN B;  2HJ1 A;  2KDB A;  2K1F A;  1F2R C;  3IBE A;  2LHE A;  1N63 A;  2RDG A;  3KWL A;  1NDD A;  3KYC D;  4YTM B;  3Q8A A;  3QC8 B;  2ZVO A;  1WY8 A;  3ZLZ A;  2FE8 A;  1WYW B;  3IAM 1;  3IHP C;  4I6P A;  3BYY B;  4C7Y A;  2CR5 A;  4ZRJ A;  2IO3 B;  2LEK A;  3B1L X;  4MDK E;  3N1X C;  4FAD A;  2WDQ B;  1TKG A;  3FAH A;  2KMA A;  4QAY A;  5C3J B;  3K9P B;  4EEW A;  3VUW A;  3BWU D;  2KHW B;  2DYO A;  3E56 A;  2MA9 B;  1C78 A;  2GOW A;  3WIM A;  2LRU A;  4EE2 A;  5E6P A;  1QF6 A;  4M02 A;  1WXS A;  2LXC A;  4ARC A;  3SHQ A;  2INN E;  4LNN A;  2IND C;  3P63 A;  3AE9 B;  3RNB C;  4LLG M;  1V5O A;  2LJI A;  5CX3 A;  1K8R B;  1ROE A;  2W3R A;  2XK5 A;  3PRZ A;  3Q2A C;  1JWU D;  2WS3 B;  3RNG C;  2B76 B;  1JWM D;  1MFW A;  4AUQ C;  1D6E C;  3NJT A;  1RM6 C;  2BVC A;  4US8 A;  3KW5 B;  3U7Z A;  2WXL A;  3T3O A;  3DBR I;  4RGM A;  1NBF C;  4HKZ E;  4AS1 A;  4NJ6 A;  4ACF A;  3A33 B;  3QA8 A;  4WJP A;  1EU4 A;  1KF6 B;  4LJP B;  3NY5 A;  4C00 A;  4IM3 A;  1S1Q B;  1WGG A;  2L05 A;  3K9O B;  1RYJ A;  2JQR B;  4KX6 B;  3RUL A;  3DVG Y;  1IBX B;  3VH3 B;  4RGO S;  2ZZP B;  3W1S A;  1RFK A;  1QOB A;  2GBR A;  1I4X A;  1TIF A;  3M95 A;  1TJE A;  1FRR A;  2V4I B;  3A9J B;  1TKY A;  1GG3 A;  4ANW A;  3P42 A;  1V9J A;  3MC0 B;  5LNK 1;  1E8X A;  1UBQ A;  2KDF B;  1SGH A;  1TKE A;  5G55 A;  2BYE A;  1DGJ A;  1C76 A;  2IY1 B;  2JF5 A;  3ZXR A;  1WF9 A;  2KTF A;  4FXC A;  4OHJ A;  1TYG B;  2C5L C;  2DBY A;  4C7Z A;  2Y5B B;  3PZ7 A;  2GBN A;  4JL9 A;  2H88 B;  3I57 A;  4DHJ B;  1PDX A;  1YQ3 B;  3N1Y C;  3W9C B;  2FCN A;  3DBR B;  3FIL B;  3D32 A;  2DZK A;  1LXD A;  1E7P B;  1NI3 A;  4TQ0 A;  5DPW A;  2DEN B;  2C60 A;  2KN4 A;  1AYF A;  3HIZ A;  3W1Y A;  4MH0 E;  4NQK E;  3S2A A;  4K3C A;  3NVY A;  3BZD B;  3CIR B;  3U8Z A;  1I4G A;  4DDG D;  2I1J A;  3EFC A;  1OQR A;  1WX8 A;  4R3D A;  1D3Z A;  1C4C A;  1DOX A;  2LUE A;  1P3Q U;  2PW9 A;  4I6N B;  3UQA A;  5TR5 A;  2YVC A;  1JRU A;  3TIX A;  3U52 E;  4KKI A;  5EE0 A;  1TTN A;  4GMV A;  2K39 A;  1V1P A;  3NZS A;  2DAF A;  3ZNG C;  2LGD A;  4WWP A;  1A70 A;  4IWO A;  2MJE A;  2DAJ A;  2Z8L A;  1SE9 A;  3RN9 C;  3KYD D;  1FNU A;  4GGQ A;  3N9Y C;  2L1A A;  4ZRQ A;  2Y3A A;  1D5X C;  3DCG A;  2K6Q A;  4JE3 B;  3ZGZ A;  2MH7 A;  1WYG A;  2I2Y A;  3HVZ A;  5DPR A;  5EDS A;  3UQB A;  2PE6 B;  1T6B X;  1L0Y B;  4IUM B;  2JZP A;  3ZNH B;  1YOV B;  3VVW B;  3DBS A;  4XGA B;  3WA0 A;  4YSZ B;  2GMI C;  2XEW A;  3AE8 B;  1E6E B;  2KO3 A;  3RD2 A;  3AN1 A;  4W9J A;  2KFK A;  2IPK D;  4G50 A;  3TEY A;  3L16 A;  3FC4 A;  1NI2 A;  2FBW B;  2QDF A;  3ZNZ B;  3PLU A;  2L32 A;  2GI9 A;  3ECI A;  3PGE A;  3ML9 A;  1WX7 A;  3C0R B;  3KVF B;  3RZF A;  1MHH E;  2GRI A;  2MW5 A;  1Z5S B;  2OOB B;  1TBE A;  2W9N A;  2Z59 B;  4ASW C;  2WGS A;  4NQL B;  2IO1 B;  1F0Z A;  5FK9 C;  4JWS C;  2KJ6 A;  3A1Q A;  3APD A;  4MJS A;  3AEA B;  4IW0 A;  5BMH A;  1E7U A;  1WX9 A;  3OG5 A;  2FCM A;  4CO7 A;  5BYS A;  5BMI A;  3AV8 A;  4EZL A;  4L23 A;  3R2T A;  4HKQ A;  4ZHP A;  1E7V A;  3AE4 B;  2K5P A;  3N20 C;  3RNC C;  1DOY A;  2G3Q B;  1GPX A;  3TEW A;  2JRH A;  4B0M A;  3X23 A;  2KAC A;  1YQ4 B;  2QHO A;  1EWC A;  3P4R B;  1AAR A;  2QIE B;  4DXG A;  1YJ1 A;  5C23 A;  3QAR A;  1C79 A;  2D5G A;  1L7Y A;  4KSK C;  1P1A A;  1WXA A;  3DOW A;  2CJN A;  2I38 A;  1SE4 A;  2QC8 A;  1C4P A;  2JSV X;  4HRO A;  2LUM A;  2AQ2 B;  4IWQ A;  4E74 A;  3TJP A;  1I4R A;  1P7F A;  1WE7 A;  3GE3 C;  1MHX A;  3M3J A;  3BK1 A;  1IBX A;  4L2Y A;  4PS3 A;  1WWT A;  2R61 A;  4ZHO A;  1VR9 A;  3EGR A;  2LGX A;  3AE5 B;  1BXT A;  2LGI A;  4OZA A;  2K6D B;  1L6U A;  3AE2 B;  4PYZ A;  2KWU B;  2ZNV B;  2C7N B;  2HJ8 A;  1JRP A;  4HDQ A;  3ZYY X;  3QX1 A;  1GC6 A;  1XLN A;  1D4B A;  3ZVV A;  3RCZ A;  4MGY E;  4LTU A;  1NEK B;  2WHI A;  4LJO B;  2IGH A;  2KVZ A;  2WXI A;  3SU8 X;  4B0E A;  5LLI A;  4KKJ A;  2AL3 A;  5IKC M;  2AL6 A;  3VHT C;  3ZW3 A;  3ONS A;  4HWI B;  3JYU A;  5I4D A;  2MLB A;  2RDH A;  1WGD A;  4JLC A;  4F1S A;  3Q8F A;  4GSW A;  1IGC A;  2LMC A;  4BVU C;  3OJ4 B;  1XEE A;  5AZF A;  1KLG D;  1OGW A;  3W5U B;  1L4Z B;  5EE9 A;  1ZE3 D;  1HTO A;  5D6J B;  3AUL A;  3IT4 B;  5LXI B;  2Y5C A;  2KTR B;  2L7R A;  1AWD A;  3FIL A;  4LNK A;  3IFW B;  4HK2 A;  4ITK A;  2C7H A;  3FKY A;  3KLS X;  3L08 A;  3RPF C;  4C56 C;  4HPL B;  4PT5 A;  3R66 C;  4BBN F;  3UGB B;  1P9D U;  1BUI C;  2RR9 A;  1Y8R C;  3C19 A;  4II3 B;  2BB6 A;  2M8S A;  1IGD A;  1TS2 A;  2PIA A;  3ZTC A;  2RPV A;  1WGH A;  3VTU A;  1N5W A;  2NTS A;  1WGK A;  2LRW A;  5AZH A;  3BIN A;  4RH6 A;  2BYT A;  1IYF A;  1WJ4 A;  2Y5P A;  4WQO B;  3NS1 A;  4YSX B;  5T8I A;  4CHK A;  4XYC A;  2KOX A;  4Q2J A;  1GB1 A;  1JML A;  2JWU A;  4FJY A;  1QOG A;  1YN4 A;  1AN8 A;  2V4L A;  3GB1 A;  3ML8 A;  1KLU D;  4NPN A;  4W9G A;  1ZKH A;  3H7S A;  1VRA B;  3RUI B;  3ZJT A;  4EUT A;  4P7I A;  2VZK D;  2ZNV C;  3PHW B;  3H6N A;  2WU2 B;  4RCO A;  1WJN A;  2QMT A;  2AQ1 B;  3KWV A;  2WDR B;  1F1H A;  2O2V B;  4ZYN A;  2M4N A;  1YJJ A;  1YNT E;  4P1B C;  4LNI A;  4HJG E;  3NOB A;  4HJK A;  4G0N B;  2WWZ A;  3U7D A;  2BB5 A;  4FN2 A;  3TEX A;  3MP9 A;  1C77 A;  4LNO A;  3R7R A;  1JRO A;  2L8J A;  2DZI A;  4ZRK A;  2LVQ A;  2J53 A;  2Q5W D;  3L10 B;  2KDE B;  3P4P B;  2RMM A;  4MAC A;  2WLB A;  2KZR A;  5AUI A;  3Q69 A;  5D7G A;  1WZ3 A;  2NMQ A;  4NAW B;  5BYQ A;  4IM2 A;  3L13 A;  1CMX B;  4FBJ B;  1WZ0 A;  4WJN A;  5G5G A;  3AE3 B;  1T0Q C;  4ARI A;  1GUA B;  3NVV A;  1WXV A;  3TSS A;  2WXH A;  4DXA B;  2RPQ A;  3A4S C;  4HRS A;  3WAN A;  3U4E G;  2JWZ A;  1TS4 A;  2ZCC A;  3P4S B;  2X8X X;  4TV3 A;  1K51 A;  1SJE D;  1VCB A;  2KFJ A;  4ANV A;  1OTR B;  1EO6 A;  4IDI A;  1E90 A;  2K8C A;  2FAZ A;  2K22 A;  2NBW B;  2KX3 A;  1FXA A;  1WIA A;  4W9D A;  2N9L A;  2KK8 A;  1P98 A;  3DWG C;  4KVG B;  1YQB A;  2KJH B;  2M56 B;  4YTN B;  2ZEQ A;  4ZDV A;  1KFY B;  1R7S A;  3P4Q B;  4DHJ D;  2CHW A;  4XZ4 A;  4EOY A;  3HHM A;  2IBI B;  2KDI A;  2RD0 A;  3AU4 A;  2VZK B;  1B1Z A;  3VR9 B;  2BBC A;  3AXC A;  1EU3 A;  3EFU A;  3SEB A;  3PRP B;  2MBE A;  1KH0 A;  2KQ7 A;  1YD8 U;  2E3T A;  3SD5 A;  2D3B A;  1CJE A;  4OVU A;  4TMA B;  2KC2 A;  1WRI A;  2WXR A;  4BKT A;  1STE A;  2Z0D B;  5HHD G;  2DYM A;  3B08 A;  4A55 A;  3HK0 A;  2O6V D;  3LB8 C;  3QAQ A;  2WYQ A;  3QHT A;  2KQ4 X;  2KWD A;  1LGR A;  1C4A A;  1VZ6 A;  5G2N A;  5D2M B;  2DX5 B;  2IGG A;  5BO4 B;  4MSQ B;  1U4A A;  2JXX A;  1LM8 B;  1FPY A;  3V05 A;  2DNF A;  5JHB A;  1V1O A;  2JZZ A;  3PZ8 A;  1TY2 A;  2K25 A;  4A3O A;  4FJZ A;  2N1W A;  3V60 A;  1N5X A;  3KUC B;  3VRB B;  2L83 A;  4GDL A;  2KTR A;  4NJ7 A;  4KZC A;  4FA6 A;  3VTV A;  2WP9 B;  4IM0 A;  2V3S A;  1HEZ E;  2MBB B;  2BKF A;  4ICU A;  1KOT A;  1V6E A;  3QQ8 B;  4YT0 B;  3VTW A;  1SIF A;  1YN5 A;  2J0J A;  2L76 A;  3H7P B;  1RFA A;  2BS4 B;  4HPP A;  1E8Y A;  1OQQ A;  1SE3 A;  2D2Q A;  2VH2 A;  3LXF A;  3MJ5 A;  2MEK A;  1MPE A;  1OFF A;  4GB9 A;  2B3A A;  3ZIM A;  5KHQ A;  5JHA A;  2DZJ A;  1F9J A;  4RM8 A;  2OHF A;  2WXM A;  1IUE A;  1VDV A;  2G4D B;  5BMG A;  4MEM A;  3L0W B;  3H8H A;  4HCP B;  2WQY B;  1WJU A;  1WFY A;  4DQO C;  4WJO A;  3A9K B;  1A5R A;  1V86 A;  2ZVN A;  4XDC A;  2IGD A;  4EZK A;  4MM3 B;  4M0W A;  1WH3 A;  1MG8 A;  3ABV B;  2O6V B;  1PUT A;  1JWS D;  4N9F 4;  4XDD A;  2FCQ A;  5H92 C;  2KYW A;  1I4P A;  3PT2 B;  4AOF A;  3PTF C;  4A3P A;  2G4S A;  2NTT A;  2IO0 B;  2JYE A;  1FRD A;  3AEG B;  3DHG C;  2EMS A;  1GNU A;  2VRR B;  4B6W A;  3DBL I;  3BY4 B;  1SBB B;  1C9F A;  2LD9 A;  3NZU A;  2N4F A;  3DPD A;  2PTL A;  2J0K A;  3Q3J A;  5FR3 A;  5EE1 A;  1JCK B;  3Q8B A;  3AH7 A;  4BZA A;  4GOC A;  5HG2 A;  2WU5 B;  3PV1 A;  1JAL A;  4NAW A;  2H89 B;  1M4V A;  4GDK B;  3UIP B;  3I9V 1;  3PRM B;  3ZUN A;  1TZO A;  3IXS A;  3QCA A;  5FKA C;  4C80 A;  4W9H A;  2X38 A;  2MP2 B;  3T8M A;  3NVZ A;  3BII D;  3VUY A;  1N62 A;  1E5W A;  1XCT L;  2JT4 B;  2K8B A;  1XXG A;  4GN1 A;  2WX1 A;  2CHZ A;  3B2G A;  4BKS D;  4K81 A;  3LYY A;  3IVF A;  3KUZ A;  1ZXH A;  5L95 C;  1QOA A;  4TUU A;  2N7J A;  1K52 A;  4M00 A;  4FHJ A;  4WJQ A;  2KDM A;  1FO4 A;  4BBN C;  2XBB C;  4EKU A;  2ZCB A;  3X0W A;  4K7W A;  2C9W B;  4BOS C;  2FID A;  1VD2 A;  3PS6 A;  1BML C;  2HDE A;  4OVZ A;  4ZRP A;  1OEY A;  1I35 A;  1HQR D;  1JQ4 A;  2ZPY A;  1TS3 A;  1J0G A;  3ZXV A;  1ET6 A;  2LHD A;  1Q0W B;  3DBL B;  2KJR A;  3BVM A;  2BKR B;  1VJK A;  2ON8 A;  1I4Q A;  4A6Q A;  1YN3 A;  5G5H A;  2RGF A;  1J7C A;  4KSL C;  4AJY B;  4WIP A;  2JPH A;  2R2O A;  2HTH A;  1WI0 A;  2L52 A;  4REZ A;  3PVL A;  4BKG A;  3QWZ B;  3RNF C;  3ZJV A;  1FM0 D;  2ASQ A;  4DK5 A;  3VQI A;  2KQS A;  4A20 A;  3ZRF A;  1FFU A;  3NHE B;  2V0G A;  4XC2 A;  4GLS C;  3U2S C;  2YEP B;  1KLV A;  1WGR A;  4DBG A;  4AP4 C;  3PPA A;  4MSM B;  2BF8 B;  2PEA A;  2N9X A;  1KM7 A;  2M0A A;  4MGZ E;  4GIV A;  4YL8 A;  4C4V B;  2KAJ A;  2AYO B;  4AQ7 A;  4RFB A;  1XLO A;  2LZ6 A;  1YX6 B;  3RYT A;  1G6J A;  4RGT A;  3DVN V;  4XWW A;  2KT7 A;  4AJW A;  3MC8 A;  1GB4 A;  1ZW7 A;  4B95 A;  4MGK E;  2N7E A;  1XO3 A;  3A9J A;  4TKN A;  2JUO A;  4HLE A;  3NRZ A;  2KXJ A;  3WAO A;  3I3T B;  1SXT A;  4O1N A;  2BTE A;  4BOZ B;  4ZOH C;  3BVZ A;  4K7U A;  2HTM E;  2K8H A;  3HRD D;  5HKH A;  4MEL A;  2XNA C;  5C1Z A;  1VLB A;  3N32 A;  2FNJ B;  1J8C A;  1ISN A;  1KJT A;  2MRP A;  1V49 A;  4FHK A;  2KWV B;  2NBU A;  1MI0 A;  2J7Q B;  1YMH E;  5BYR A;  1HZ6 A;  1WRD B;  3TL5 A;  3IAS 1;  2JU6 X;  2HD5 B;  2PJH A;  1LQB A;  4PYU A;  1UGM A;  3UF8 A;  5DPT A;  2LFI A;  1SJH D;  2AWT A;  3NS8 A; 
#chains in the Genus database with same CATH homology
 1K51 A;  1SJE D;  2DBY A;  4C7Z A;  1E0Z A;  3PZ7 A;  4IDI A;  3NZ3 A;  2WXF A;  2ZW0 A;  2H88 B;  3I57 A;  2K22 A;  2N0S B;  1FXA A;  1SB3 C;  1ZXI A;  3AEC B;  2J42 A;  1T3Q A;  1PDX A;  1YQ3 B;  3ZJU A;  1ENF A;  4HEA 1;  2N9L A;  3W9C B;  1T5X D;  3DWG C;  1RWS A;  3FIL B;  3EUB 2;  1JW9 D;  3UI3 A;  1FEH A;  2M56 B;  4YTN B;  1KFY B;  1R7S A;  3GP7 A;  3MFG A;  3P4Q B;  1E7P B;  3AEF B;  1NI3 A;  1TS5 A;  4TQ0 A;  1UUP A;  1VZ7 A;  2SEB D;  3ZQ4 A;  2KN4 A;  1AYF A;  2WDV B;  3L4P A;  1L0V B;  3NVY A;  2MJ3 A;  1L0X B;  2TSS A;  3BZD B;  4US9 A;  3CIR B;  1I4G A;  1PYW D;  2VZK B;  1B1Z A;  3VR9 B;  2BBC A;  3V3X A;  1Q10 A;  2PVO D;  5C2T B;  1OQR A;  3NUH B;  2JXT A;  1UGJ A;  1HXY D;  2G9H D;  1EU3 A;  1GAQ B;  3SEB A;  4R3D A;  1SE2 A;  1C4C A;  1DOX A;  4WQM A;  1PGA A;  2PW9 A;  1L6V A;  1KH0 A;  2BS2 B;  1F2R I;  1V97 A;  3U52 E;  2E3T A;  4KKI A;  1ZDX A;  5EE0 A;  1CJE A;  2CJO A;  1L4D B;  1P7E A;  2QSD A;  2ZW1 A;  4KGR A;  4TMA B;  1WRI A;  2WXR A;  1V1P A;  3URY A;  1STE A;  5HFY A;  5HHD G;  2DYM A;  3SFD B;  4A55 A;  4J3O D;  3LB8 C;  1A70 A;  4YTP B;  2MJE A;  2Z8L A;  4H2A A;  5TSS A;  2KQ4 X;  1I7H A;  3PO0 A;  1FNU A;  3AE6 B;  1E10 A;  2KWD A;  3AB5 A;  4NAM A;  3N9Y C;  2W55 A;  2L1A A;  4ZRQ A;  2Y3A A;  1NYR A;  1C4A A;  4IKG A;  1VZ6 A;  1D5X C;  2IGG A;  1B9R A;  3AEE B;  5D3D A;  4JE3 B;  3ZGZ A;  1SEB D;  2MH7 A;  4OW0 A;  1WYG A;  4N59 A;  1KTK A;  2I2Y A;  4NJC A;  3HVZ A;  3V05 A;  2BT6 A;  1K50 A;  2J52 A;  3O13 A;  1V1O A;  3AE7 B;  1XLP A;  1T6B X;  3PZ8 A;  1N60 A;  1L0Y B;  5AUK A;  4L1B A;  1TY2 A;  2W82 A;  4A9A A;  2JZP A;  1N5X A;  3CWI A;  4YSZ B;  1QIL A;  3J9C A;  3AE8 B;  1E6E B;  3VRB B;  4WAF A;  2L83 A;  3T3N A;  3AN1 A;  2ONQ A;  2IPK D;  1QQR A;  3TEY A;  1ACC A;  4N6E B;  1D5Z C;  2WP9 B;  3AE1 B;  1HEZ E;  3FC4 A;  2K9X A;  2FBW B;  4UDU C;  1ZP0 B;  1CQV A;  1PGX A;  4YT0 B;  3W5V B;  1PFD A;  1YN5 A;  2L32 A;  2GI9 A;  4YWG G;  4RF1 A;  3VRA B;  2SAK A;  1TY0 A;  2BS4 B;  1MHH E;  2GRI A;  2PVG C;  4D2K A;  2K3U A;  1OQQ A;  1SE3 A;  3GS2 A;  3LXF A;  4RNA A;  4KGT A;  4GDL B;  4WUR A;  3MHZ A;  3MJ5 A;  2MEK A;  1MPE A;  1F0Z A;  5FK9 C;  1OFF A;  4JWS C;  4JX1 C;  2K0P A;  2W54 A;  1GOZ A;  1EM7 A;  3AEA B;  4JWU C;  4CQN A;  1MVK A;  5BMH A;  2KMM A;  2XN9 C;  1HA5 A;  4MT5 A;  2ACZ B;  2OHF A;  2WXM A;  3W2D A;  1IUE A;  1VDV A;  5BYS A;  4A8X C;  5BMG A;  4YSY B;  5BMI A;  3H8H A;  3AV8 A;  2AX5 A;  5JXV A;  4IOI E;  4L23 A;  3R2T A;  1KRH A;  4HKQ A;  4ZHP A;  2WQY B;  1PGB A;  2V3N A;  1LO5 D;  2FUG 1;  2QIL A;  2WXO A;  3AE4 B;  2K5P A;  2DWQ A;  3AM9 A;  4DQO C;  3AEB B;  4RGN A;  1DOY A;  1GPX A;  3TEW A;  2IDY A;  1J7A A;  3ETR A;  1SSN A;  1XLQ A;  1FMA D;  4JPS A;  4B0M A;  2KAC A;  3Q8E A;  4TSS A;  1YQ4 B;  3BVG A;  4OZC A;  2IGD A;  4XDC A;  2PLP A;  2WXP A;  1EWC A;  4MM3 B;  3P4R B;  4M0W A;  3AED B;  3ABV B;  3BYT B;  1PUT A;  1JWS D;  2QIE B;  2YEP F;  4DXG A;  4XDD A;  2WXQ A;  4TQ1 A;  1FXI A;  3WCQ A;  1C79 A;  5H92 C;  2D5G A;  4WWM A;  1I4P A;  3HUI A;  4DXF A;  2INP E;  2CJN A;  2I38 A;  1SE4 A;  4MH8 A;  2NTT A;  2JYE A;  1FRD A;  1C4P A;  2JSV X;  3AEG B;  2LUM A;  2AQ2 B;  2QEJ C;  4HRO A;  4WH4 A;  1L5P A;  4XWT A;  2WNM A;  1I4R A;  1P7F A;  3C8Y A;  4P6V F;  1MHX A;  4USA A;  1SBB B;  1C9F A;  3BK1 A;  3AMZ A;  1IBX A;  4L2Y A;  1QLB B;  3RFZ B;  1WWT A;  2PTL A;  2R61 A;  4ZHO A;  3KQ4 A;  1NVI D;  1VR9 A;  1FFV A;  2V3P A;  2WXN A;  3EGR A;  5EE1 A;  5FR3 A;  3VR8 B;  3AE5 B;  1JCK B;  3Q8B A;  1BXT A;  2QJL A;  2LGI A;  3AH7 A;  4NZL B;  4OZA A;  5HG2 A;  1L6U A;  3AE2 B;  1JWA D;  2WU5 B;  1JAL A;  1CZP A;  2EEL A;  1M4V A;  1V1P B;  2H89 B;  4GDK B;  1K53 A;  1VZ8 A;  4LK0 M;  1WXQ A;  3R8B A;  1JRP A;  3NVW A;  3ZYY X;  3I9V 1;  4KGS A;  1DOI A;  1XLN A;  1D4B A;  1TZO A;  2OED A;  4LTU A;  3IXS A;  1NEK B;  5FKA C;  1UWX A;  4C80 A;  5MPO A;  2IGH A;  1FD6 A;  2G1E A;  2WXI A;  2X38 A;  1XCQ L;  1ZOY B;  4B0E A;  4KKJ A;  3NVZ A;  3BII D;  4N58 A;  1N62 A;  1XF5 L;  4A90 A;  3TEZ A;  3B9J A;  1XCT L;  1XXG A;  1E9M A;  1UWM A;  2AQ3 B;  1Y56 A;  1DYQ A;  3B2G A;  5I4D A;  2N9K A;  2RDH A;  3LYY A;  2PMV A;  1CK1 A;  3Q8F A;  1IGC A;  2LMC A;  5H8Y E;  1XEE A;  1ZXH A;  1KLG D;  1QOA A;  4ZYS A;  3W5U B;  2N7J A;  1K52 A;  3P1M A;  1AW7 A;  1L4Z B;  5EE9 A;  1F2R C;  1ZE3 D;  2KDM A;  1FO4 A;  2LHE A;  1N63 A;  2RDG A;  4RF0 A;  3KWL A;  3IT4 B;  2JYT A;  4YTM B;  2Y5C A;  3Q8A A;  2GB1 A;  3R2I A;  1AWD A;  1JWB D;  3FIL A;  1BML C;  2HDE A;  1FCL A;  2FE8 A;  4ITK A;  1WSP A;  3IAM 1;  4OVZ A;  4ZRP A;  3BYY B;  1ZUD 2;  4C7Y A;  3KLS X;  1HQR D;  1JQ4 A;  1SIJ A;  1TS3 A;  3RPF C;  1ZPS A;  1I4H A;  4C56 C;  2BW2 A;  1ET6 A;  2LEK A;  2LHD A;  4PT5 A;  2WXG A;  3HVD A;  2DLB A;  2WDQ B;  1TKG A;  1FNW A;  3BVM A;  3FAH A;  1VJK A;  1BUI C;  2CU3 A;  2ON8 A;  1I4Q A;  1NYQ A;  4A6Q A;  1YN3 A;  2BB6 A;  3BK2 A;  5C3J B;  5G5H A;  1HZ5 A;  1IGD A;  2ICI A;  1J7C A;  1TS2 A;  1YJI A;  1N61 A;  2PIA A;  4WIP A;  3BWU D;  3OWE B;  2RPV A;  2DYO A;  3E56 A;  3IT6 B;  1C78 A;  4REZ A;  2L52 A;  2MJD A;  1N5W A;  2NTS A;  1WGK A;  1FM0 D;  3ZJV A;  4EE2 A;  1F77 A;  3VQI A;  4RH6 A;  1QF6 A;  2BYT A;  2IJ0 A;  5GXG B;  1FFU A;  4ARC A;  2Y5P A;  3NS1 A;  4YSX B;  5T8I A;  1V8C A;  2INN E;  2V0G A;  1ESF A;  1QT9 A;  4GLS C;  1QKZ A;  3P63 A;  3U2S C;  3AE9 B;  4Q2J A;  2YEP B;  1GB1 A;  1JML A;  4LLG M;  2JWU A;  2LJI A;  1QOG A;  3TUO A;  1YN4 A;  1AN8 A;  1ROE A;  2W3R A;  1D5M C;  3GB1 A;  1JWU D;  1NEN B;  2WS3 B;  2J4X A;  2B76 B;  2M0A A;  1JWM D;  1KLU D;  4P16 A;  1D6E C;  2KAJ A;  3EA6 A;  1RM6 C;  1SF0 A;  1VRA B;  5HI1 A;  3ZJT A;  4US8 A;  3U7Z A;  2M19 A;  2VZK D;  2EKI A;  2WXL A;  3T3O A;  4AQ7 A;  4RGM A;  4RFB A;  1XLO A;  4RCO A;  2WU2 B;  2WXK A;  2QMT A;  2AQ1 B;  1UNS A;  2WDR B;  3KWV A;  4HKZ E;  4AS1 A;  4RGT A;  4XWW A;  1YJJ A;  1YNT E;  1GB4 A;  1EWY C;  4HJG E;  5D3I B;  1EU4 A;  3SR6 A;  1FIQ A;  1KF6 B;  1XO3 A;  2BB5 A;  3SFE B;  3TEX A;  3NRZ A;  3MP9 A;  1C77 A;  1JRO A;  1FCC C;  1SXT A;  1RYJ A;  4O1N A;  4XE0 A;  2JQR B;  4KX6 B;  2BTE A;  3E9S A;  4ZOH C;  3BVZ A;  1IBX B;  1QOF A;  2HTM E;  2J53 A;  2W3S A;  4RGO S;  2Q5W D;  3W1S A;  3P4P B;  2RMM A;  4MAC A;  2WLB A;  5AUI A;  3HRD D;  3Q8C A;  2XNA C;  2JX5 A;  3Q69 A;  1ZDV A;  1RFK A;  1QOB A;  1ET9 A;  1VLB A;  1I4X A;  5D7G A;  4YXD B;  2NMQ A;  1TJE A;  4NAW B;  1FRR A;  2V4I B;  5BYQ A;  1MI0 A;  1TKY A;  1YMH E;  2E6X A;  5BYR A;  4OZB A;  5E6J A;  3P42 A;  3MC0 B;  2BS3 B;  1HZ6 A;  5G5G A;  3AE3 B;  3DWM A;  4ARI A;  5LNK 1;  3IAS 1;  1FNV A;  2JU6 X;  3B2F A;  2PKO A;  3NVV A;  1J7B A;  3TSS A;  2WXH A;  1TKE A;  1DGJ A;  4HRS A;  2WXJ A;  3U4E G;  1C76 A;  1TS4 A;  4FXC A;  2LFI A;  4OHJ A;  3P4S B;  5EE3 A;  1SJH D;  1TYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...