4YT0B

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-methyl-n-[3-(1-methylethoxy)phenyl]benzamide.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 54
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4yt0B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4yt0B01
1JW9D 2ACZB 4YT0B 2MJEA 2JQRB 1FFVA 2E3TA 2WDRB 1TKEA 1JWBD 4IDIA 2BS2B 2LEKA 1KFYB 1QOFA 4ZOHC 1V97A 4A9AA 2QIEB 1WXQA 1QOGA 1TYGB 3AEEB 1JALA 1DOIA 3NVWA 5AUIA 3AB5A 3NVVA 2DBYA 2WDVB 2JX5A 1WRIA 3NVZA 1YJIA 1FIQA 5C2TB 1WGKA 3ZYYX 3PO0A 3HRDD 3AE4B 4P6VF 4C80A 2KAJA 1J7BA 4YXDB 2CU3A 4JWUC 1E9MA 3P4PB 1J7CA 4WQMA 3P4RB 1YJJA 2KMMA 2W3SA 2WS3B 1SIJA 1IUEA 1JRPA 3AM9A 4N58A 1DOYA 4ZHOA 3W9CB 1RYJA 1QT9A 3AEGB 1R7SA 1XLPA 3VRAB 4WWMA 2QJLA 2H88B 1QOAA 3VR9B 1AYFA 2M56B 5H92C 1ZUD2 1NVID 1QF6A 1NYRA 5EE9A 4C7YA 1H7XA 3CWIA 4KX6B 3SFDB 1FRDA 1DOXA 1GTEA 3AV8A 1I7HA 3W5VB 1T3QA 4N59A 1FXIA 1VDVA 3HUIA 1PDXA 3P1MA 1GPXA 3AE6B 4YSZB 1SF0A 2BS4B 1ZP0B 1XLOA 2HTME 5H8YE 2FBWB 3AE7B 4YTMB 2BS3B 1RFKA 1B9RA 1ZOYB 3FAHA 1N61A 3KWLA 2DWQA 1PUTA 1XO3A 3NS1A 2PIAA 5G5GA 1FO4A 1YQ3B 3AECB 5AUKA 2WU5B 2OHFA 1QOBA 3B2FA 3EUB2 3RPFC 3VR8B 3VRBB 4LTUA 1E7PB 1FFUA 5G5HA 1WWTA 1EWYC 2W3RA 1OFFA 3LXFA 3CF4A 2WDQB 1VLBA 2MH7A 3LB8C 2CJNA 3NRZA 1KF6B 4ITKA 3SR6A 1RM6C 1N5WA 2EKIA 3DWGC 1WYGA 4YSYB 2N0SB 3ETRA 1DGJA 3AE8B 1FXAA 3FC4A 1NI3A 1AWDA 1TJEA 3BIID 1H7WA 1GT8A 2W55A 1CJEA 2PKOA 2K22A 4US8A 1E10A 1ZXIA 3B9JA 1JQ4A 3AEBB 1N62A 3WCQA 4YSXB 2B76B 1KRHA 3NVYA 4JX1C 5EE3A 1GAQB 5C3JB 1XLNA 2WLBA 3P63A 3AEAB 1TKGA 3AMZA 1FRRA 3L4PA 1L6UA 1VJKA 2AX5A 3HVZA 3AE9B 3W5UB 1YQ4B 1UWMA 2H89B 2WU2B 1L6VA 4HROA 4N6EB 5MPOA 4C7ZA 1N60A 3AN1A 2K9XA 3ABVB 1L0VB 1JROA 1V8CA 4HRSA 4JWSC 3DWMA 3AE5B 1J7AA 1GTHA 1NEKB 4YTNB 2L83A 2MJDA 2Q5WD 2W54A 1A70A 5EE0A 2PVGC 1FM0D 3AE1B 2WP9B 2L52A 4USAA 1N5XA 4ZHPA 1RWSA 3P4SB 4FXCA 1NENB 5EE1A 2WQYB 3P4QB 1L5PA 4US9A 2CJOA 1JWAD 1F0ZA 2G1EA 3CIRB 1E0ZA 5GXGB 1XLQA 3AEDB 1OQRA 1QLBB 2PVOD 3B2GA 3AEFB 1NYQA 2MJ3A 2K5PA 1FMAD 1SB3C 1CZPA 1N63A 2M19A 2Y5CA 1OQQA 1ROEA 1TKYA 4YTPB 2BT6A 3AH7A 3AE2B 3AE3B 1PFDA 1E6EB 3SFEB
chains in the Genus database with same CATH superfamily
2KWUB 4N9F4 1TZOA 1B1ZA 2NVUI 2ZEQA 1Y56A 4IDIA 2KJRA 3I63C 2KACA 2INPE 1WX9A 4GU2A 4XWWA 3AB5A 2BGFA 4ICVA 4PYUA 1TY2A 2Z0DB 3NHEB 1AARA 1M4VA 1T0RC 4XZ4A 2RPVA 3U8ZA 1RRBA 3J9CA 2JZPA 4GN1A 3AEGB 2QCZA 3VRAB 1TS2A 2QJLA 1CMXB 1V2YA 3RNBC 2I38A 2MX2A 3I9V1 1WXVA 3PS6A 4CHKA 2IBIB 1ESFA 2KO3A 2LFIA 3AE7B 1JQ4A 2D3BA 1XO3A 4MGZE 3QA8A 3N30A 2HDEA 4TUUA 3APFA 2D2QA 2V3PA 2J42A 1EO6A 2GMIC 2OEDA 1KF6B 2WDTB 2KQSA 3O65B 1YN5A 4XWTA 2WWZA 2WXLA 2MWSB 2KC2A 2NPTB 4A3PA 4TV3A 2AL3A 2C9WB 2JWUA 3C19A 4ZRIA 1X1MA 2LZ6A 2LXAA 2WLBA 4GXBA 3AMZA 3L4PA 2KFJA 3TL5A 1D5MC 2WXKA 2K9XA 5HI1A 3ZJTA 4HPLB 2LI5A 3APDA 3A1QA 2PMVA 1UZXB 2LGXA 3ZTDA 2C60A 4REZA 1E5WA 1JRUA 4IM3A 2AYOB 4AOFA 2L76A 4A8XC 4KGSA 2MBHA 3DVNV 3AXCA 3KLSX 3ZDMC 4ZRJA 2ACZB 1FFVA 5BMIA 1GOZA 2LEKA 3KUZA 3PT2B 2RD0A 3N9YC 1E8XA 1WXQA 1TGZB 3OLMD 3AEEB 1K51A 5C23A 4NPNA 3MTNB 2DBYA 3NVZA 5J17A 2KK8A 4ZYNA 2FCSA 2QILA 4LNKA 3ZKJC 2BTEA 1KJTA 2XEWA 1SIJA 3ZVVA 3EGRA 3GOEA 3WALA 4E74A 3PREA 1T0SC 1PQSA 3APCA 1ZW7A 2LGYA 4W9LA 2D10A 3RNCC 1Q10A 3CWIA 2KJHB 4WAAA 1P9DU 2L00B 2ZVOA 4WAFA 1WIAA 2KN4A 4P16A 2N9EB 2JY6A 1ZOYB 2PIAA 5G5GA 4C00A 3BVMA 1K52A 2KC1A 3KUCB 1WGDA 1C4AA 3NRZA 2RPQA 4DBGA 4EEWA 4MACA 2N0SB 3ZNHB 3A9KA 3U2SC 5CHVC 1V6EA 4M01A 3AEBB 1YNTE 1UELA 3DBRB 3AE9B 4N6EB 4WJOA 1V49A 4C7ZA 1UUPA 1TS4A 3ABVB 4I6LB 4HRSA 4X57B 3DWMA 3N32A 2ONQA 1V1OA 4EZJA 2L52A 1PYWD 4BKSA 1H4RA 3VUYA 3VVWB 2LVQA 5GXGB 3B2GA 2N1VA 1BUIC 2N1WA 5TSSA 1R4NI 3DHIC 1C9FA 3VH4B 4FJYA 1HXYD 3H9DA 2KDEB 1RLFA 2INNE 1MI0A 4CYEA 4GDKB 2FCNA 3DBHB 4M0WB 2N7JA 4MJSA 2V9HA 4KSKC 1BMLC 1LGRA 3ZYYX 3HRDD 4OVUA 4YXDB 3DVGX 2PE9A 3DHHC 3PRMB 3KUDB 4B9KA 2OJWA 3MC0B 2BQQA 3AM9A 2BW2A 2WXHA 4MM3B 1VR9A 1YX6B 2XBBC 1P3QU 3BK2A 1IBXB 2LD9A 5EE9A 1U4AA 3MC9A 2GI9A 3EA6A 3AE6B 4MELA 2DZIA 4L2YA 3QWZB 2PTLA 2GBRA 2DWQA 4MSQB 4DHZE 3AECB 3AU5A 3H1UA 4EFOA 1EWYC 2KNBA 4MEMA 1WF9A 4XDCA 4NZLB 3WAMA 3LB8C 5G55A 3SR6A 3DVGY 3N3KB 1E8WA 4YSYB 3T9LA 1P98A 1HTOA 5IP4D 1N62A 4YSXB 2SEBD 3AULA 4ZRKA 1FRRA 5FR6A 1WX7A 2FE8A 1GUAB 4FULA 3D32A 3KWVA 2PVGC 4RH6A 1C78A 3ZJUA 1XEEA 3ZUNA 1NENB 2VZKB 4M0WA 5D3IB 5JHBA 2CJOA 4JGHB 3AEDB 1K50A 2N9PC 4PK1A 1ROEA 2FNJB 3AH7A 1D5ZC 1N6ZA 3ZNID 4YT0B 4MM3A 2KVZA 4TQ0A 3DCGA 1FCCC 1IBXA 2D5GA 4L1BA 4J6IA 4EE2A 5IN7A 4ZRPA 4GIVA 4ZYSA 1UD7A 5AZFA 3TBLD 3HHMA 4NJCA 2ZW1A 2XN9C 1YJJA 2C7NB 1G6JA 5FK9C 1K8RB 2XK5B 3BY4B 1NVID 4W9JA 4IW0A 3QAQA 4B0EA 3IT4B 1XF5L 5IOIA 1MG4A 3W5VB 2JF5A 4KGRA 4HCNB 3NY5A 3P1MA 5L83A 4J3OD 5JZEB 5TR5A 2LXCA 1V1PA 5H8YE 3VQIA 2IDYA 3NS1A 3RPFC 1WJUA 2Y5PA 3VDZA 3VRBB 1UGJA 3PVLA 3BVZA 4WH4A 3CF4A 2NR2A 4XGAB 3LYYA 3DWGC 1WYGA 1NI3A 3Q69A 1SSNA 1UWXA 1YJ1A 2R2QA 3DBLB 1NDDA 3B9JA 1I4HA 3JYUA 1LO5D 3P63A 4W9EA 3JW0X 3K9PB 4OHJA 4B6WA 5MPOA 2KQ4X 1V8CA 3P2BA 2K8CA 1IP9A 4I6PA 2V4IB 2D3GA 4H2AA 3IBEA 5AZGA 4USAA 2JYTA 4HVBA 4HDQA 2G1EA 3ZXRA 2CHZA 1C4CA 1D4BA 2IZVB 2E6XA 2FCQA 3FILB 1ZKHA 1KH0A 3QK0A 5BMGA 2RGFA 1E6EB 1C76A 1E8YA 2FUG1 5BYRA 3VTUA 1SIFA 2MRPA 4ZOHC 4FA6A 1TYGB 4HJGE 4W9IA 1D3ZA 5IKCM 1OEYA 1MVKA 1F2RC 2G9HD 5GMVA 1FIQA 2ASQA 3H7PB 3AE4B 1P7EA 3PRZA 2QHOA 1E9MA 3P4PB 1D5XC 3ZQ4A 2LRUA 3TEWA 1IGDA 4GGQA 4GSWA 2IO1B 1QOAA 4K3BA 1NBFC 4BOZB 2K3UA 3HUIA 2DNFA 2V3NA 4AJYB 1UBQA 1WZ0A 3ZNZB 3HIZA 2LMCA 4NAWB 1I42A 4WWPA 2ON8A 5IA7A 4AQ7A 1I4PA 1C79A 2M4NA 1A5RA 1WWTA 3EECA 3DHGC 2LGDA 1WX8A 4ASWC 2NBUA 4ACFA 1HZ5A 3KVFB 1H7WA 4TKNA 2J0JA 2PPHA 2NCNA 3FILA 4FHJA 2EELA 1S1QB 2MA9B 3L13A 4F7ZA 4W9CA 4BVUC 1TIFA 3DDCB 3ZW3A 3MHZA 2W54A 3I5JC 4LDTD 2K1FA 1WI0A 4RM9A 2AWTA 2YEPB 3H6NA 3EFCA 1SJED 2IPKD 3A4RA 1XCTL 4BFRA 1LM8B 2NS5A 2DHZA 1TKYA 4YTPB 2MJEA 4ARCA 5BYQA 1TBEA 1P7FA 3ECIA 3ZLZA 4OVZA 3ML9A 1Q5WB 3DPDA 4C4VB 2JXTA 4HKZE 4DDID 4LNOA 4AUQC 4WQOB 2FCMA 4P6VF 2CU3A 2RDHA 5DPSA 2J53A 4G11A 3MC8A 1WE6A 2HJ1A 3EC8A 4E71A 1IUEA 1SE2A 4N58A 1XLPA 4BBNF 2H88B 2M56B 1E7VA 3ZO5B 2PW9A 1TT5B 2KN5A 3UQAA 3BINA 2L05A 3TEZA 5HFYA 1SE9A 4CQNA 1GPXA 2O6VB 2DX5B 1XCQL 2RR9A 3IG3A 1FNUA 3BWUD 3UF8A 3BZDB 4WJPA 5LNK1 4W9HA 1OFFA 2BBCA 4KDLB 4WURA 4M8MA 2FAZA 4M00A 2JSVX 5JXVA 1I35A 2JZ3B 4MH0E 3AU4A 2W55A 2ZZPB 1YX5B 2MBEA 2QDFA 3AEAB 5BYSA 3N20C 3W5UB 1L6VA 1N60A 2KMAA 1JROA 2QMTA 4HEA1 4JLCA 2GB1A 1J7AA 1S3SG 3U7ZA 1UGMA 3T3NA 3SDLC 4ZHPA 3JSVA 1RWSA 2KXJA 5CHWA 4BAXA 4URKA 4II2B 3DBHI 1JWAD 4E3CA 1GC6A 4WJNA 3VTWA 2PVOD 1KLUD 3WAPA 3A9JA 2J52A 1GB4A 1WMHB 2CU1A 3TUOA 4G3XB 4K7SA 3C8YA 3U7DA 3AE3B 2BWFA 1PFDA 1FXTB 4L23A 2K6QA 4HJKA 1KFYB 3T3OA 4LDTB 2KHWB 4NAMA 4DXGA 2JVCA 4RNAA 2IY1B 2KJ6A 1V81A 4P1BC 1AW7A 3KH0A 3CSTA 1Y8RC 1IPGA 2M0AA 1J7BA 1F52A 2AQ2B 4B95A 3IAS1 3EHVA 4A6QA 1JRPA 5CHFA 3VAWA 2ZCBA 2GBKA 2MCNB 2GRIA 3DQVA 2LVPA 3OAWA 3AV8A 3E9SA 1FXIA 3OWEB 1WYWB 1ZP0B 1XLOA 1MHXA 2AQ1B 2Z59B 4YTMB 1SE4A 5LXHA 3N1YC 2WU5B 1UBIA 4PT5A 4R3DA 1F77A 3TJPA 4DDGD 4OVVA 2G45B 3Q8EA 1FXAA 1TJEA 2WYQA 4DHJD 2NPTA 5E6PA 1VD2A 2B76B 5EE3A 4MGYE 1UF0A 2HE7A 4DWFA 1VJKA 2AX5A 1C4PA 4OZAA 4WIPA 3RD2A 1WH3A 4IKGA 2OOBB 4NY0A 2VH1A 2WP9B 3E56A 3HVDA 4ANVA 3SU8X 1I4XA 2I1KA 2VZKD 2R2OA 5DPWA 3Q8CA 2ZVNA 1J0GA 2BYVE 2AL6A 4MGKE 1ZDXA 3TCAA 1EWCA 1CZPA 1T0YA 2G3QB 2MHJA 2JQRB 2C7HA 4ANXA 2WXJA 3UGBB 1DYQA 2LVOA 3NVWA 3KYDD 3IVFA 1WXSA 4RCOA 2BVCA 1D6EC 4BKGA 4AS1A 1C1YB 4BBNC 5I4DA 2N7EA 1J7CA 3HK0A 4I6NB 2N9XA 3TEXA 2K39A 2JRHA 4ZHOA 1Z2MA 3UIOB 1VZ6A 3WA0A 2KLCA 4ARIA 3NZSA 3ALBA 1DOXA 3RNGC 1VRAB 2DAFA 2WXMA 5D6JB 2JRIB 1N61A 2V1YA 1H8CA 2KX0A 2WXGA 3KQ4A 4LTUA 1KOTA 3TSSA 3MJWA 2IO2B 2M17A 1R4MI 2MH7A 2IGHA 2JU6X 2N9LA 4M02A 2WGSA 3W2DA 1C3TA 2FIDA 2LJIA 3WANA 1I4RA 3GB1A 1WR6E 4IWQA 1GT8A 5FKAC 1CJEA 4DHZB 1GC7A 1KRHA 3NVYA 4UDUC 1L6UA 2ZNVB 4P1CC 2PE6B 3L10B 4PS8A 1L4ZB 1V86A 3HM3A 3FKYA 1GJZA 3RFZB 4LLGM 1A70A 5EE0A 3NUHB 4FJZA 3V6EB 4IG7B 2RMMA 1XD3B 4DHJB 1L0XB 4O1NA 1J19A 2OJRA 5D2MB 3QC8B 1CK1A 2KLGA 2KKCA 3RNFC 3Q3OC 2L0TA 2BF8B 4IM2A 1ZDVA 1BXTA 1FPYA 2BS2B 2G4SA 3V62A 1JALA 2FUHB 3Q2AC 4GDKA 4KDIC 4FADA 4NJ7A 1PGAA 5C2TB 1FCLA 2YLMA 3W1SA 1WGYA 1OEYJ 1GB1A 2KWVB 4LK0M 2DZMA 2IO0B 4WWOA 3VR9B 1ET6A 1NYRA 3L17A 2D3CA 1GTEA 2L32A 2Z8LA 2DENB 2HTME 3B0AA 3VFKA 2FBWB 4RGNA 1Q1OA 3NZ3A 1PUTA 2JUOA 1AN8A 1FO4A 4NJ6A 3VR8B 1IYFA 2N4FA 2MLBA 5D94A 4MT5A 2CJNA 2DYBA 3NJTA 2IJ0A 3URYA 5D7GA 2CS4A 1E10A 2KD0A 4KSLC 1WJ4A 3RUIB 1ISNA 1WM3A 2I1JA 1QQRA 4ANWA 1I4GA 3RULA 2LASA 4MDKE 3PZ8A 3W1SC 2MJDA 4HKQA 2KOXA 3P4QB 4LNFA 4FJVB 3RNAC 2HD5B 3V3XA 3LDZE 3RT3B 2M1MA 2BB6A 2BT6A 1QKZA 2G4DB 3PTFC 1SGHA 5D3DA 1KLVA 4LCDE 3H7SA 4EKUA 2E3TA 2VH2A 3VXWA 4ZDVA 3ENEA 2CHXA 3K9OB 1YN3A 4NQKE 1RFAA 2ZPNA 3SHQA 1HTQA 2CKHB 3C0RB 4HDOA 3M95A 1WXAA 4RFBA 2KDBA 2WX1A 3RMKC 3SEBA 2LWPA 2DYOA 2NMQA 2X8XX 2LHDA 4XE0A 4F1SA 4A20A 2XK5A 2J7QB 4S17A 4KX6B 2BYFA 2O6VD 1OGWA 1B9RA 3FAHA 3WIMA 4JQWC 1YQ3B 5AUKA 1ACCA 2QC8A 2DZJA 2GOWA 2YEPF 1VLBA 1GNUA 2HTHA 2JWZA 3Q8FA 1XQQA 2A5UA 1HE8A 2JYEA 1WRDB 4KIKB 2DYMA 2NTSA 3UI3A 4AP4C 5C3JB 1YIWA 2WNMA 5G2NA 2LJ5A 4HCPB 1V80A 2WXIA 2KVRA 3KW5B 4KVGB 3RCZA 1GTHA 3VHTC 2DZKA 2L7RA 1OTRB 3GZNB 1EF1A 4PS3A 1V5OA 1NYQA 2MP2B 4PS7A 1SBBB 2ICIA 1VCBA 3QARA 3RNEC 1MPEA 1JWBD 3Q3NC 3DOWA 3QCAA 1ENFA 4LNIA 2V0GA 3ZRFA 3I57A 3H7PA 2KMCA 4A3OA 4WQMA 3P4RB 2AEHA 4GDLB 1DOYA 1RYJA 2L3ZA 1QF6A 2YVCA 1FRDA 3PLVA 2PJHA 4FN2A 3QIJA 5E6JA 1E7UA 1WSPA 1WE7A 1L2NA 1SXTA 1M94A 1QILA 5J18A 2JT4B 4YL8A 4NAWA 4CO7A 3Q8AA 1T6BX 1FFUA 4MH8A 1EU4A 4BKSD 3NZUA 1WFYA 3PHXB 3NS8A 2WXFA 2X38A 3AE8B 1EU3A 1JMLA 3R2IA 2L8JA 1TY0A 1ZE3D 2WXNA 1YOVB 3Q6BA 3ZIMA 4OZBA 4JE3B 2RSUA 3DBRI 2IO3B 5BMHA 1UNSA 1NEKB 4YTNB 2L83A 1FM0D 3A1QB 2GBJA 5LLIA 3VUXA 2INDC 1L5PA 4US9A 3X23A 3L08A 3VTVA 1OQRA 3AEFB 2K5PA 1SB3C 3NVVA 1JW9D 3NG0A 4IWPA 4GDLA 5AEKB 4DXAB 4W9FA 1SJHD 4BKTA 1ZGUB 4KV2A 5DPRA 4GLSC 3N1ZC 3SD5A 5AUIA 4YWGG 2WDVB 4C4VA 2BKRB 2K25A 1YJIA 2IY0B 1WGKA 3PO0A 2XNAC 3N1XC 2PEAA 2KAJA 2BYEA 4XDDA 4A90A 1E8ZA 3PRPB 5IO9A 1TS3A 4DXFA 1F9JA 3W9CB 2M0XA 1QT9A 1YN4A 2BYTA 4EUTA 1H7XA 2LGIA 3M3JA 1PGXA 1T3QA 1F1HA 4OW0A 4EZKA 3L16A 1SF0A 4YSZB 1QZEA 2BS4B 2O6VA 2BS3B 4RF1A 2KYWA 1E7PB 1MG8A 1RM6C 1L0YB 3Q3MC 3L0WB 4XX5A 3A9KB 3ZNGC 2M8SA 4JX1C 5IAAC 5CX3A 1YQ4B 1UWMA 3RZWC 3R66C 3QX1A 2VRRB 4GOCA 4NQLB 2C5LC 1KTKA 2JPHA 5J2RA 3TIXA 1EUVB 1VZ8A 2Q5WD 2N7DA 4HPMB 2MBOA 1F2RI 4BZAA 2D11A 2R61A 2WQYB 3QHTA 4XYCA 1FD6A 1XLQA 2RDBC 5C1ZA 4HK2A 4MGIE 1WMHA 1FNWA 4IC7B 2KWDA 2UU7A 3IT6B 4ICUA 2D3AA 3AI5A 2N9KA 3R7QA 2ZCCA 1CQVA 3ONSA 5E6NA 4A9AA 1HZ6A 2QIEB 1MHHE 1DOIA 2JX5A 2SAKA 4MJSB 1WRIA 3BYYB 3T8MA 1I4QA 1L4DB 4K7WA 5HHDG 3TEYA 2W82A 4RGTA 2JZZA 5JHAA 2W3SA 2WS3B 4B0MA 1HEZE 2IYDB 1R7SA 3V61A 5AZHA 1ZUD2 3ZGZA 3SFDB 1SE3A 3OJ3A 1Q0WB 2GBNA 2PLPA 1IGCA 3DBSA 3Q8BA 2Y3AA 3KWLA 1KLGD 2MEKA 2CR5A 4WJQA 3ZDTA 2OHFA 4GMVA 2ZPYA 3LJ3A 4KKIA 3H8HA 3GS2A 4TMAB 2Z0EB 2ZW0A 2WXPA 4RGMA 1BT0A 4W9KA 1N5WA 3V6CB 1WGGA 3EFUA 3PLUA 2KT7A 1DGJA 3IHPC 3BIID 3RZFA 4TSSA 3DBLI 4K3CA 1WGRA 2DAJA 2C7MB 1TKGA 2H89B 5DPTA 1LXDA 2ZJDA 4A55A 1EF5A 3CF6E 1WY8A 1L7YA 3AE1B 1OQYA 4RF0A 4W9GA 3RI7C 4P7IA 4RM8A 3PZDA 1P1AA 3I3TB 1OQQA 4BOSC 3S2AA 4F8CB 1V9JA 1TKEA 2K8BA 3UQBA 4JPSA 3NOBA 4C56C 2WHIA 2L1AA 3W1YA 2V4LA 3RYTA 4W9DA 3CMMB 1LQBA 4HPPA 2KFKB 4K81A 2B3AA 4C80A 3CSFA 2INCC 3GE8C 1TZ1A 3DVNU 3VH3B 2RDGA 1WZ3A 1K53A 4EOYA 2J0MA 2QSDA 2BKFA 4QAYA 2BWES 2BPSA 5H92C 1RAXA 4C7YA 1EM7A 2WX0A 1SEBD 1V1PB 3B08A 4DQOC 1TTNA 2LHEA 4LJOB 1WXMA 2MQJA 3EUB2 1QOBA 2WXQA 3B2FA 3BYTB 4AWJA 3ZRCA 5G5HA 2BB5A 3GZNI 2EKIA 4HXDA 1AWDA 5E6OA 3IXSA 3BVGA 4US8A 2NBWB 2IGDA 2QEJC 4KGTA 3R3MA 5T8IA 5DCNA 4IWOA 1VZ7A 3HVZA 3GE3C 4HROA 2WU2B 3AN1A 4JWSC 1L0VB 2K6DB 3AE5B 3ML8A 4JIOU 4LNNA 1GG3A 1JWMD 3ZXVA 4DK5A 3CIRB 4IOIE 3Q3FA 2L0FA 1QLBB 2EMTA 2KFKA 2KX3A 2V3SA 3UINB 4HWIB 1YD8U 1FMAD 2M19A 2K8HA 1J8CA 2TSSA 2WDRB 2MW5A 1QOFA 2UYZB 1V97A 3PSEB 3PV1A 1QOGA 3MFGA 2Y5BB 4JL9A 1JWSD 3GP7A 1R4NB 1LFDA 4FLHA 4IM0A 4AJWA 3OG5A 2KWCA 4K7UA 2MBBB 3O13A 3L54A 2MSED 1YQBA 3M62B 4HLEA 2ZNVC 4WWMA 2UWQA 1MFWA 3VUWA 5HG2A 2KANA 3V60A 3U52E 4G50A 2J0KA 1NI2A 2GLSA 3RN9C 4MSMB 3M63B 4ZRQA 3PZ7A 2REXA 2O2VB 4M8NA 4LJPB 3HM6X 2W3RA 1XT9B 1R4MB 4Q2JA 2J4XA 4ITKA 2KZRA 3P42A 3FC4A 3B1LX 1XXGA 2K22A 1ZXIA 1FNVA 3MP9A 3WCQA 2EMSA 5LXIB 3R7RA 2KDMA 1JCKB 1P0RA 2JXXA 3Q14C 2LRWA 3IFWB 2NTTA 2FIFA 4FBJB 2HJ8A 1T0QC 1YMHE 3ZJVA 1ZXHA 2KDIA 2WXOA 4IUMB 3UIPB 3V05A 3PGEA 1E0ZA 2EKEC 1MJDA 4RMAA 2I2YA 5CTRC 3WAOA 1WJNA 2Y5CA 4KZ0A 2LUEA 4N59A 1PDXA 4GB9A 5JH5C 5BO4B 1PGBA 4D2KA 4KKJA 2LGSA 4TQ1A 3U30A 3KYCD 3BK1A 3JVZX 3IAM1 4JWUC 5FR3A 1WM2A 5KHOA 4EZLA 3A33B 1HQRD 1UH6A 2KMMA 2KTRB 2O2VA 2NBVB 2GBMA 4PYZA 4RGOS 3Q3JA 4XC2A 2CHWA 5EDSA 1AYFA 1V5TA 2K0PA 2KDFB 4II3B 3X0WA 3PHWB 5KHQA 3PPAA 1I7HA 3QQ8B 3R2TA 1STEA 1VDVA 1JWUD 3TMPB 3AE2B 2W9NA 1TS5A 1RFKA 1WR1A 2DLBA 4G0NB 3U4EG 1C77A 2AQ3B 1ET9A 3LXFA 2KQ7A 2WDQB 4ANUA 3MJ5A 1T5XD 3MHSD 3A4SC 2D07B 2LUMA 3ETRA 2IGGA 2PKOA 3QJZA 1E90A 1ZPSA 4KIKA 5HKHA 1HA5A 1GAQB 1XLNA 1Z5SB 4S0RA 4NNJB 2KTFA 3ZTCA 2WXRA 3JSVB 4K1RB 3R8BA 1N5XA 3P4SB 4FXCA 4WWNA 5EE1A 5L95C 1WGHA 4OZCA 1F0ZA 1KM7A 3A9JB 4FHKA 2MJ3A 1WJ6A 1FEHA 2MP2A 3OJ4B 2MBQA 4KZCA 1N63A 2KTRA 3SFEB 2A4ZA
chains in the Genus database with same CATH topology
1ZDVA 1BXTA 2FUG1 5BYRA 1TZOA 1B1ZA 2N9KA 4IDIA 1Y56A 1CQVA 2BS2B 4ZOHC 4A9AA 1HZ6A 2QIEB 2KACA 1TYGB 1MHHE 1JALA 2INPE 4HJGE 1DOIA 4XWWA 3AB5A 2JX5A 2SAKA 1MVKA 1F2RC 1WRIA 2G9HD 3BYYB 1PGAA 1FIQA 5C2TB 1I4QA 1L4DB 5HHDG 1TY2A 3TEYA 3AE4B 1P7EA 1FCLA 1M4VA 2W82A 1E9MA 4RGTA 3P4PB 1D5XC 3W1SA 3ZQ4A 2RPVA 2W3SA 3TEWA 1GB1A 2WS3B 4B0MA 1HEZE 3J9CA 2JZPA 4LK0M 1IGDA 3AEGB 1R7SA 3VRAB 1TS2A 2QJLA 1QOAA 3VR9B 1ET6A 1ZUD2 1NYRA 3ZGZA 3SFDB 2K3UA 2I38A 1GTEA 2L32A 1SE3A 2PLPA 3HUIA 3I9V1 2V3NA 2Z8LA 1IGCA 1ESFA 2HTME 2LFIA 3Q8BA 2FBWB 3AE7B 2Y3AA 1JQ4A 3KWLA 4RGNA 1KLGD 3NZ3A 1PUTA 1XO3A 2MEKA 1AN8A 1FO4A 2LMCA 2OHFA 4NAWB 2ON8A 3VR8B 4AQ7A 2HDEA 1I4PA 1C79A 4KKIA 3H8HA 1WWTA 3GS2A 4TMAB 2ZW0A 2V3PA 4MT5A 2J42A 2WXPA 2CJNA 4RGMA 2OEDA 1KF6B 1YN5A 2IJ0A 1N5WA 4XWTA 3URYA 1DGJA 2WXLA 1HZ5A 5D7GA 3BIID 1H7WA 2JWUA 1E10A 4TSSA 3FILA 2WLBA 2EELA 1TKGA 3AMZA 3L4PA 2H89B 1D5MC 1QQRA 1I4GA 2WXKA 2K9XA 3PZ8A 5HI1A 4A55A 3MHZA 2MJDA 2W54A 3ZJTA 3AE1B 2YEPB 4HKQA 2PMVA 4RF0A 3P4QB 1SJED 2IPKD 1XCTL 3V3XA 4REZA 2BB6A 4A8XC 4KGSA 1OQQA 1TKYA 1QKZA 4YTPB 2BT6A 5D3DA 3KLSX 2MJEA 2ACZB 1FFVA 2E3TA 5BMIA 4ARCA 1TKEA 1GOZA 5BYQA 2LEKA 1P7FA 4OVZA 4JPSA 3N9YC 1WXQA 4C56C 1YN3A 2L1AA 3AEEB 1K51A 2DBYA 2JXTA 3NVZA 4HKZE 4C80A 4P6VF 2QILA 2CU3A 2RDHA 4RFBA 2J53A 2BTEA 3SEBA 2DYOA 2RDGA 2NMQA 1SIJA 3EGRA 1IUEA 1K53A 1SE2A 4N58A 2QSDA 1XLPA 2LHDA 4XE0A 2H88B 2M56B 2PW9A 5H92C 1Q10A 1EM7A 3CWIA 4KX6B 4C7YA 3TEZA 5HFYA 1SEBD 4CQNA 1V1PB 4WAFA 1GPXA 2KN4A 4DQOC 4P16A 1XCQL 1B9RA 1ZOYB 3FAHA 2LHEA 1FNUA 2PIAA 5G5GA 1YQ3B 5AUKA 1ACCA 3EUB2 1QOBA 2WXQA 3B2FA 3BYTB 3BWUD 5G5HA 3BZDB 5LNK1 1OFFA 3BVMA 2BBCA 1K52A 2YEPF 1VLBA 2BB5A 1C4AA 3NRZA 4WURA 3Q8FA 2JSVX 5JXVA 2EKIA 4MACA 2N0SB 1AWDA 3IXSA 2W55A 3BVGA 2JYEA 3U2SC 4US8A 2IGDA 2DYMA 3AEBB 2NTSA 3UI3A 1YNTE 2QEJC 5C3JB 4KGTA 3AEAB 5T8IA 5BYSA 1VZ7A 2WNMA 3HVZA 3W5UB 3AE9B 4HROA 4N6EB 2WU2B 1L6VA 4C7ZA 1N60A 2WXIA 1UUPA 3AN1A 1TS4A 3ABVB 1L0VB 1JROA 4JWSC 4HRSA 2QMTA 4HEA1 3DWMA 3AE5B 2GB1A 1J7AA 1GTHA 3U7ZA 2ONQA 3T3NA 1V1OA 2L52A 4ZHPA 1PYWD 1JWMD 1RWSA 1JWAD 3CIRB 4IOIE 5GXGB 2PVOD 3B2GA 1KLUD 1QLBB 2J52A 1NYQA 1BUIC 1GB4A 5TSSA 3TUOA 1FMAD 2M19A 1C9FA 1SBBB 2ICIA 3AE3B 2TSSA 3C8YA 1PFDA 4L23A 1HXYD 2WDRB 1MPEA 1JWBD 1KFYB 1QOFA 2INNE 3T3OA 1V97A 1MI0A 4NAMA 1QOGA 3MFGA 4GDKB 4DXGA 1JWSD 4RNAA 2N7JA 1AW7A 1ENFA 3GP7A 2V0GA 1BMLC 3ZYYX 3HRDD 3I57A 2M0AA 1J7BA 4YXDB 2AQ2B 3IAS1 4WQMA 3P4RB 3O13A 4A6QA 3MC0B 4GDLB 1JRPA 3AM9A 1DOYA 2BW2A 2WXHA 1RYJA 4MM3B 1VR9A 4WWMA 3BK2A 5HG2A 1QF6A 1IBXB 2GRIA 5EE9A 1FRDA 3AV8A 2GI9A 3E9SA 1FXIA 3EA6A 3U52E 5E6JA 3AE6B 3OWEB 1WSPA 1SXTA 1ZP0B 1XLOA 1MHXA 2AQ1B 4YTMB 1SE4A 4L2YA 2PTLA 2DWQA 1QILA 3AECB 4ZRQA 2WU5B 3PZ7A 4PT5A 3Q8AA 1T6BX 1FFUA 4MH8A 1EWYC 2W3RA 4R3DA 4Q2JA 4XDCA 1EU4A 4NZLB 1F77A 3LB8C 2J4XA 4ITKA 3SR6A 3P42A 3Q8EA 4YSYB 2WXFA 2X38A 3FC4A 3AE8B 1EU3A 1FXAA 1JMLA 3R2IA 1TJEA 1XXGA 2K22A 1TY0A 1ZE3D 1ZXIA 2WXNA 1FNVA 1N62A 3MP9A 4YSXB 2SEBD 2B76B 5EE3A 3WCQA 1FRRA 4OZBA 4JE3B 1VJKA 2AX5A 1C4PA 4OZAA 2KDMA 1JCKB 5BMHA 2FE8A 1UNSA 4WIPA 3KWVA 4IKGA 1NEKB 4YTNB 2L83A 2NTTA 2PVGC 1FM0D 2WP9B 4RH6A 1C78A 3E56A 1XEEA 3HVDA 3ZJUA 1NENB 1YMHE 2VZKB 4M0WA 1I4XA 2VZKD 1L5PA 4US9A 1ZXHA 5D3IB 2CJOA 2WXOA 3ZJVA 3V05A 3Q8CA 1E0ZA 3AEDB 1OQRA 1K50A 3AEFB 2K5PA 1ZDXA 2I2YA 1EWCA 1SB3C 1CZPA 2Y5CA 3NVVA 1ROEA 3AH7A 4N59A 1PDXA 1D5ZC 1JW9D 4YT0B 1PGBA 2JQRB 1SJHD 4D2KA 4KKJA 4TQ0A 2WXJA 1FCCC 4TQ1A 1IBXA 1DYQA 2D5GA 4L1BA 4GLSC 3NVWA 4EE2A 4ZRPA 5AUIA 4YWGG 2WDVB 4ZYSA 4RCOA 3BK1A 1YJIA 1D6EC 1WGKA 4AS1A 3PO0A 2XNAC 4NJCA 2KAJA 2ZW1A 3IAM1 5I4DA 4XDDA 4JWUC 5FR3A 2XN9C 1J7CA 4A90A 3TEXA 1HQRD 1YJJA 2KMMA 4RGOS 1TS3A 4DXFA 5FK9C 4ZHOA 3W9CB 1QT9A 1YN4A 2BYTA 1AYFA 1VZ6A 4ARIA 1NVID 2K0PA 4B0EA 3IT4B 1H7XA 2LGIA 1XF5L 1DOXA 1PGXA 3W5VB 1I7HA 4KGRA 1T3QA 4OW0A 3R2TA 1STEA 1VDVA 3P1MA 1JWUD 1VRAB 1SF0A 4YSZB 4J3OD 2BS4B 1V1PA 2WXMA 5H8YE 1TS5A 3VQIA 1RFKA 2BS3B 4RF1A 1N61A 2DLBA 2IDYA 2WXGA 3NS1A 3U4EG 3RPFC 1C77A 3KQ4A 2Y5PA 2AQ3B 3VRBB 1ET9A 4LTUA 1E7PB 1UGJA 3BVZA 3TSSA 3LXFA 4WH4A 3CF4A 2WDQB 2MH7A 2IGHA 2JU6X 2N9LA 3W2DA 3MJ5A 1T5XD 1RM6C 1L0YB 3DWGC 2LJIA 3LYYA 1WYGA 1I4RA 2LUMA 3ETRA 3GB1A 1NI3A 3Q69A 1SSNA 1UWXA 2IGGA 1GT8A 5FKAC 1CJEA 2PKOA 3B9JA 1I4HA 1ZPSA 1HA5A 1KRHA 3NVYA 4JX1C 1GAQB 1LO5D 1XLNA 3P63A 4UDUC 1L6UA 4OHJA 1YQ4B 1UWMA 1L4ZB 5MPOA 2KQ4X 1V8CA 1KTKA 2V4IB 1VZ8A 4H2AA 3RFZB 2Q5WD 4LLGM 2WXRA 1A70A 5EE0A 3NUHB 4USAA 3R8BA 1N5XA 3P4SB 2JYTA 4FXCA 1F2RI 5EE1A 2R61A 2WQYB 4OZCA 2RMMA 1F0ZA 1FD6A 2G1EA 1D4BA 1XLQA 1C4CA 1L0XB 4O1NA 2MJ3A 2E6XA 1FEHA 3FILB 1CK1A 1KH0A 1FNWA 1N63A 2KWDA 5BMGA 3IT6B 3AE2B 1E6EB 3SFEB 1C76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JW9 D;  2ACZ B;  4YT0 B;  2MJE A;  2JQR B;  1FFV A;  2E3T A;  2WDR B;  1TKE A;  1JWB D;  4IDI A;  2BS2 B;  2LEK A;  1KFY B;  1QOF A;  4ZOH C;  1V97 A;  4A9A A;  2QIE B;  1WXQ A;  1QOG A;  1TYG B;  3AEE B;  1JAL A;  1DOI A;  3NVW A;  5AUI A;  3AB5 A;  3NVV A;  2DBY A;  2WDV B;  2JX5 A;  1WRI A;  3NVZ A;  1YJI A;  1FIQ A;  5C2T B;  1WGK A;  3ZYY X;  3PO0 A;  3HRD D;  3AE4 B;  4P6V F;  4C80 A;  2KAJ A;  1J7B A;  4YXD B;  2CU3 A;  4JWU C;  1E9M A;  3P4P B;  1J7C A;  4WQM A;  3P4R B;  1YJJ A;  2KMM A;  2W3S A;  2WS3 B;  1SIJ A;  1IUE A;  1JRP A;  3AM9 A;  4N58 A;  1DOY A;  4ZHO A;  3W9C B;  1RYJ A;  1QT9 A;  3AEG B;  1R7S A;  1XLP A;  3VRA B;  4WWM A;  2QJL A;  2H88 B;  1QOA A;  3VR9 B;  1AYF A;  2M56 B;  5H92 C;  1ZUD 2;  1NVI D;  1QF6 A;  1NYR A;  5EE9 A;  4C7Y A;  1H7X A;  3CWI A;  4KX6 B;  3SFD B;  1FRD A;  1DOX A;  1GTE A;  3AV8 A;  1I7H A;  3W5V B;  1T3Q A;  4N59 A;  1FXI A;  1VDV A;  3HUI A;  1PDX A;  3P1M A;  1GPX A;  3AE6 B;  4YSZ B;  1SF0 A;  2BS4 B;  1ZP0 B;  1XLO A;  2HTM E;  5H8Y E;  2FBW B;  3AE7 B;  4YTM B;  2BS3 B;  1RFK A;  1B9R A;  1ZOY B;  3FAH A;  1N61 A;  3KWL A;  2DWQ A;  1PUT A;  1XO3 A;  3NS1 A;  2PIA A;  5G5G A;  1FO4 A;  1YQ3 B;  3AEC B;  5AUK A;  2WU5 B;  2OHF A;  1QOB A;  3B2F A;  3EUB 2;  3RPF C;  3VR8 B;  3VRB B;  4LTU A;  1E7P B;  1FFU A;  5G5H A;  1WWT A;  1EWY C;  2W3R A;  1OFF A;  3LXF A;  3CF4 A;  2WDQ B;  1VLB A;  2MH7 A;  3LB8 C;  2CJN A;  3NRZ A;  1KF6 B;  4ITK A;  3SR6 A;  1RM6 C;  1N5W A;  2EKI A;  3DWG C;  1WYG A;  4YSY B;  2N0S B;  3ETR A;  1DGJ A;  3AE8 B;  1FXA A;  3FC4 A;  1NI3 A;  1AWD A;  1TJE A;  3BII D;  1H7W A;  1GT8 A;  2W55 A;  1CJE A;  2PKO A;  2K22 A;  4US8 A;  1E10 A;  1ZXI A;  3B9J A;  1JQ4 A;  3AEB B;  1N62 A;  3WCQ A;  4YSX B;  2B76 B;  1KRH A;  3NVY A;  4JX1 C;  5EE3 A;  1GAQ B;  5C3J B;  1XLN A;  2WLB A;  3P63 A;  3AEA B;  1TKG A;  3AMZ A;  1FRR A;  3L4P A;  1L6U A;  1VJK A;  2AX5 A;  3HVZ A;  3AE9 B;  3W5U B;  1YQ4 B;  1UWM A;  2H89 B;  2WU2 B;  1L6V A;  4HRO A;  4N6E B;  5MPO A;  4C7Z A;  1N60 A;  3AN1 A;  2K9X A;  3ABV B;  1L0V B;  1JRO A;  1V8C A;  4HRS A;  4JWS C;  3DWM A;  3AE5 B;  1J7A A;  1GTH A;  1NEK B;  4YTN B;  2L83 A;  2MJD A;  2Q5W D;  2W54 A;  1A70 A;  5EE0 A;  2PVG C;  1FM0 D;  3AE1 B;  2WP9 B;  2L52 A;  4USA A;  1N5X A;  4ZHP A;  1RWS A;  3P4S B;  4FXC A;  1NEN B;  5EE1 A;  2WQY B;  3P4Q B;  1L5P A;  4US9 A;  2CJO A;  1JWA D;  1F0Z A;  2G1E A;  3CIR B;  1E0Z A;  5GXG B;  1XLQ A;  3AED B;  1OQR A;  1QLB B;  2PVO D;  3B2G A;  3AEF B;  1NYQ A;  2MJ3 A;  2K5P A;  1FMA D;  1SB3 C;  1CZP A;  1N63 A;  2M19 A;  2Y5C A;  1OQQ A;  1ROE A;  1TKY A;  4YTP B;  2BT6 A;  3AH7 A;  3AE2 B;  3AE3 B;  1PFD A;  1E6E B;  3SFE B; 
#chains in the Genus database with same CATH topology
 2KWU B;  4N9F 4;  1TZO A;  1B1Z A;  2NVU I;  2ZEQ A;  1Y56 A;  4IDI A;  2KJR A;  3I63 C;  2KAC A;  2INP E;  1WX9 A;  4GU2 A;  4XWW A;  3AB5 A;  2BGF A;  4ICV A;  4PYU A;  1TY2 A;  2Z0D B;  3NHE B;  1AAR A;  1M4V A;  1T0R C;  4XZ4 A;  2RPV A;  3U8Z A;  1RRB A;  3J9C A;  2JZP A;  4GN1 A;  3AEG B;  2QCZ A;  3VRA B;  1TS2 A;  2QJL A;  1CMX B;  1V2Y A;  3RNB C;  2I38 A;  2MX2 A;  3I9V 1;  1WXV A;  3PS6 A;  4CHK A;  2IBI B;  1ESF A;  2KO3 A;  2LFI A;  3AE7 B;  1JQ4 A;  2D3B A;  1XO3 A;  4MGZ E;  3QA8 A;  3N30 A;  2HDE A;  4TUU A;  3APF A;  2D2Q A;  2V3P A;  2J42 A;  1EO6 A;  2GMI C;  2OED A;  1KF6 B;  2WDT B;  2KQS A;  3O65 B;  1YN5 A;  4XWT A;  2WWZ A;  2WXL A;  2MWS B;  2KC2 A;  2NPT B;  4A3P A;  4TV3 A;  2AL3 A;  2C9W B;  2JWU A;  3C19 A;  4ZRI A;  1X1M A;  2LZ6 A;  2LXA A;  2WLB A;  4GXB A;  3AMZ A;  3L4P A;  2KFJ A;  3TL5 A;  1D5M C;  2WXK A;  2K9X A;  5HI1 A;  3ZJT A;  4HPL B;  2LI5 A;  3APD A;  3A1Q A;  2PMV A;  1UZX B;  2LGX A;  3ZTD A;  2C60 A;  4REZ A;  1E5W A;  1JRU A;  4IM3 A;  2AYO B;  4AOF A;  2L76 A;  4A8X C;  4KGS A;  2MBH A;  3DVN V;  3AXC A;  3KLS X;  3ZDM C;  4ZRJ A;  2ACZ B;  1FFV A;  5BMI A;  1GOZ A;  2LEK A;  3KUZ A;  3PT2 B;  2RD0 A;  3N9Y C;  1E8X A;  1WXQ A;  1TGZ B;  3OLM D;  3AEE B;  1K51 A;  5C23 A;  4NPN A;  3MTN B;  2DBY A;  3NVZ A;  5J17 A;  2KK8 A;  4ZYN A;  2FCS A;  2QIL A;  4LNK A;  3ZKJ C;  2BTE A;  1KJT A;  2XEW A;  1SIJ A;  3ZVV A;  3EGR A;  3GOE A;  3WAL A;  4E74 A;  3PRE A;  1T0S C;  1PQS A;  3APC A;  1ZW7 A;  2LGY A;  4W9L A;  2D10 A;  3RNC C;  1Q10 A;  3CWI A;  2KJH B;  4WAA A;  1P9D U;  2L00 B;  2ZVO A;  4WAF A;  1WIA A;  2KN4 A;  4P16 A;  2N9E B;  2JY6 A;  1ZOY B;  2PIA A;  5G5G A;  4C00 A;  3BVM A;  1K52 A;  2KC1 A;  3KUC B;  1WGD A;  1C4A A;  3NRZ A;  2RPQ A;  4DBG A;  4EEW A;  4MAC A;  2N0S B;  3ZNH B;  3A9K A;  3U2S C;  5CHV C;  1V6E A;  4M01 A;  3AEB B;  1YNT E;  1UEL A;  3DBR B;  3AE9 B;  4N6E B;  4WJO A;  1V49 A;  4C7Z A;  1UUP A;  1TS4 A;  3ABV B;  4I6L B;  4HRS A;  4X57 B;  3DWM A;  3N32 A;  2ONQ A;  1V1O A;  4EZJ A;  2L52 A;  1PYW D;  4BKS A;  1H4R A;  3VUY A;  3VVW B;  2LVQ A;  5GXG B;  3B2G A;  2N1V A;  1BUI C;  2N1W A;  5TSS A;  1R4N I;  3DHI C;  1C9F A;  3VH4 B;  4FJY A;  1HXY D;  3H9D A;  2KDE B;  1RLF A;  2INN E;  1MI0 A;  4CYE A;  4GDK B;  2FCN A;  3DBH B;  4M0W B;  2N7J A;  4MJS A;  2V9H A;  4KSK C;  1BML C;  1LGR A;  3ZYY X;  3HRD D;  4OVU A;  4YXD B;  3DVG X;  2PE9 A;  3DHH C;  3PRM B;  3KUD B;  4B9K A;  2OJW A;  3MC0 B;  2BQQ A;  3AM9 A;  2BW2 A;  2WXH A;  4MM3 B;  1VR9 A;  1YX6 B;  2XBB C;  1P3Q U;  3BK2 A;  1IBX B;  2LD9 A;  5EE9 A;  1U4A A;  3MC9 A;  2GI9 A;  3EA6 A;  3AE6 B;  4MEL A;  2DZI A;  4L2Y A;  3QWZ B;  2PTL A;  2GBR A;  2DWQ A;  4MSQ B;  4DHZ E;  3AEC B;  3AU5 A;  3H1U A;  4EFO A;  1EWY C;  2KNB A;  4MEM A;  1WF9 A;  4XDC A;  4NZL B;  3WAM A;  3LB8 C;  5G55 A;  3SR6 A;  3DVG Y;  3N3K B;  1E8W A;  4YSY B;  3T9L A;  1P98 A;  1HTO A;  5IP4 D;  1N62 A;  4YSX B;  2SEB D;  3AUL A;  4ZRK A;  1FRR A;  5FR6 A;  1WX7 A;  2FE8 A;  1GUA B;  4FUL A;  3D32 A;  3KWV A;  2PVG C;  4RH6 A;  1C78 A;  3ZJU A;  1XEE A;  3ZUN A;  1NEN B;  2VZK B;  4M0W A;  5D3I B;  5JHB A;  2CJO A;  4JGH B;  3AED B;  1K50 A;  2N9P C;  4PK1 A;  1ROE A;  2FNJ B;  3AH7 A;  1D5Z C;  1N6Z A;  3ZNI D;  4YT0 B;  4MM3 A;  2KVZ A;  4TQ0 A;  3DCG A;  1FCC C;  1IBX A;  2D5G A;  4L1B A;  4J6I A;  4EE2 A;  5IN7 A;  4ZRP A;  4GIV A;  4ZYS A;  1UD7 A;  5AZF A;  3TBL D;  3HHM A;  4NJC A;  2ZW1 A;  2XN9 C;  1YJJ A;  2C7N B;  1G6J A;  5FK9 C;  1K8R B;  2XK5 B;  3BY4 B;  1NVI D;  4W9J A;  4IW0 A;  3QAQ A;  4B0E A;  3IT4 B;  1XF5 L;  5IOI A;  1MG4 A;  3W5V B;  2JF5 A;  4KGR A;  4HCN B;  3NY5 A;  3P1M A;  5L83 A;  4J3O D;  5JZE B;  5TR5 A;  2LXC A;  1V1P A;  5H8Y E;  3VQI A;  2IDY A;  3NS1 A;  3RPF C;  1WJU A;  2Y5P A;  3VDZ A;  3VRB B;  1UGJ A;  3PVL A;  3BVZ A;  4WH4 A;  3CF4 A;  2NR2 A;  4XGA B;  3LYY A;  3DWG C;  1WYG A;  1NI3 A;  3Q69 A;  1SSN A;  1UWX A;  1YJ1 A;  2R2Q A;  3DBL B;  1NDD A;  3B9J A;  1I4H A;  3JYU A;  1LO5 D;  3P63 A;  4W9E A;  3JW0 X;  3K9P B;  4OHJ A;  4B6W A;  5MPO A;  2KQ4 X;  1V8C A;  3P2B A;  2K8C A;  1IP9 A;  4I6P A;  2V4I B;  2D3G A;  4H2A A;  3IBE A;  5AZG A;  4USA A;  2JYT A;  4HVB A;  4HDQ A;  2G1E A;  3ZXR A;  2CHZ A;  1C4C A;  1D4B A;  2IZV B;  2E6X A;  2FCQ A;  3FIL B;  1ZKH A;  1KH0 A;  3QK0 A;  5BMG A;  2RGF A;  1E6E B;  1C76 A;  1E8Y A;  2FUG 1;  5BYR A;  3VTU A;  1SIF A;  2MRP A;  4ZOH C;  4FA6 A;  1TYG B;  4HJG E;  4W9I A;  1D3Z A;  5IKC M;  1OEY A;  1MVK A;  1F2R C;  2G9H D;  5GMV A;  1FIQ A;  2ASQ A;  3H7P B;  3AE4 B;  1P7E A;  3PRZ A;  2QHO A;  1E9M A;  3P4P B;  1D5X C;  3ZQ4 A;  2LRU A;  3TEW A;  1IGD A;  4GGQ A;  4GSW A;  2IO1 B;  1QOA A;  4K3B A;  1NBF C;  4BOZ B;  2K3U A;  3HUI A;  2DNF A;  2V3N A;  4AJY B;  1UBQ A;  1WZ0 A;  3ZNZ B;  3HIZ A;  2LMC A;  4NAW B;  1I42 A;  4WWP A;  2ON8 A;  5IA7 A;  4AQ7 A;  1I4P A;  1C79 A;  2M4N A;  1A5R A;  1WWT A;  3EEC A;  3DHG C;  2LGD A;  1WX8 A;  4ASW C;  2NBU A;  4ACF A;  1HZ5 A;  3KVF B;  1H7W A;  4TKN A;  2J0J A;  2PPH A;  2NCN A;  3FIL A;  4FHJ A;  2EEL A;  1S1Q B;  2MA9 B;  3L13 A;  4F7Z A;  4W9C A;  4BVU C;  1TIF A;  3DDC B;  3ZW3 A;  3MHZ A;  2W54 A;  3I5J C;  4LDT D;  2K1F A;  1WI0 A;  4RM9 A;  2AWT A;  2YEP B;  3H6N A;  3EFC A;  1SJE D;  2IPK D;  3A4R A;  1XCT L;  4BFR A;  1LM8 B;  2NS5 A;  2DHZ A;  1TKY A;  4YTP B;  2MJE A;  4ARC A;  5BYQ A;  1TBE A;  1P7F A;  3ECI A;  3ZLZ A;  4OVZ A;  3ML9 A;  1Q5W B;  3DPD A;  4C4V B;  2JXT A;  4HKZ E;  4DDI D;  4LNO A;  4AUQ C;  4WQO B;  2FCM A;  4P6V F;  2CU3 A;  2RDH A;  5DPS A;  2J53 A;  4G11 A;  3MC8 A;  1WE6 A;  2HJ1 A;  3EC8 A;  4E71 A;  1IUE A;  1SE2 A;  4N58 A;  1XLP A;  4BBN F;  2H88 B;  2M56 B;  1E7V A;  3ZO5 B;  2PW9 A;  1TT5 B;  2KN5 A;  3UQA A;  3BIN A;  2L05 A;  3TEZ A;  5HFY A;  1SE9 A;  4CQN A;  1GPX A;  2O6V B;  2DX5 B;  1XCQ L;  2RR9 A;  3IG3 A;  1FNU A;  3BWU D;  3UF8 A;  3BZD B;  4WJP A;  5LNK 1;  4W9H A;  1OFF A;  2BBC A;  4KDL B;  4WUR A;  4M8M A;  2FAZ A;  4M00 A;  2JSV X;  5JXV A;  1I35 A;  2JZ3 B;  4MH0 E;  3AU4 A;  2W55 A;  2ZZP B;  1YX5 B;  2MBE A;  2QDF A;  3AEA B;  5BYS A;  3N20 C;  3W5U B;  1L6V A;  1N60 A;  2KMA A;  1JRO A;  2QMT A;  4HEA 1;  4JLC A;  2GB1 A;  1J7A A;  1S3S G;  3U7Z A;  1UGM A;  3T3N A;  3SDL C;  4ZHP A;  3JSV A;  1RWS A;  2KXJ A;  5CHW A;  4BAX A;  4URK A;  4II2 B;  3DBH I;  1JWA D;  4E3C A;  1GC6 A;  4WJN A;  3VTW A;  2PVO D;  1KLU D;  3WAP A;  3A9J A;  2J52 A;  1GB4 A;  1WMH B;  2CU1 A;  3TUO A;  4G3X B;  4K7S A;  3C8Y A;  3U7D A;  3AE3 B;  2BWF A;  1PFD A;  1FXT B;  4L23 A;  2K6Q A;  4HJK A;  1KFY B;  3T3O A;  4LDT B;  2KHW B;  4NAM A;  4DXG A;  2JVC A;  4RNA A;  2IY1 B;  2KJ6 A;  1V81 A;  4P1B C;  1AW7 A;  3KH0 A;  3CST A;  1Y8R C;  1IPG A;  2M0A A;  1J7B A;  1F52 A;  2AQ2 B;  4B95 A;  3IAS 1;  3EHV A;  4A6Q A;  1JRP A;  5CHF A;  3VAW A;  2ZCB A;  2GBK A;  2MCN B;  2GRI A;  3DQV A;  2LVP A;  3OAW A;  3AV8 A;  3E9S A;  1FXI A;  3OWE B;  1WYW B;  1ZP0 B;  1XLO A;  1MHX A;  2AQ1 B;  2Z59 B;  4YTM B;  1SE4 A;  5LXH A;  3N1Y C;  2WU5 B;  1UBI A;  4PT5 A;  4R3D A;  1F77 A;  3TJP A;  4DDG D;  4OVV A;  2G45 B;  3Q8E A;  1FXA A;  1TJE A;  2WYQ A;  4DHJ D;  2NPT A;  5E6P A;  1VD2 A;  2B76 B;  5EE3 A;  4MGY E;  1UF0 A;  2HE7 A;  4DWF A;  1VJK A;  2AX5 A;  1C4P A;  4OZA A;  4WIP A;  3RD2 A;  1WH3 A;  4IKG A;  2OOB B;  4NY0 A;  2VH1 A;  2WP9 B;  3E56 A;  3HVD A;  4ANV A;  3SU8 X;  1I4X A;  2I1K A;  2VZK D;  2R2O A;  5DPW A;  3Q8C A;  2ZVN A;  1J0G A;  2BYV E;  2AL6 A;  4MGK E;  1ZDX A;  3TCA A;  1EWC A;  1CZP A;  1T0Y A;  2G3Q B;  2MHJ A;  2JQR B;  2C7H A;  4ANX A;  2WXJ A;  3UGB B;  1DYQ A;  2LVO A;  3NVW A;  3KYD D;  3IVF A;  1WXS A;  4RCO A;  2BVC A;  1D6E C;  4BKG A;  4AS1 A;  1C1Y B;  4BBN C;  5I4D A;  2N7E A;  1J7C A;  3HK0 A;  4I6N B;  2N9X A;  3TEX A;  2K39 A;  2JRH A;  4ZHO A;  1Z2M A;  3UIO B;  1VZ6 A;  3WA0 A;  2KLC A;  4ARI A;  3NZS A;  3ALB A;  1DOX A;  3RNG C;  1VRA B;  2DAF A;  2WXM A;  5D6J B;  2JRI B;  1N61 A;  2V1Y A;  1H8C A;  2KX0 A;  2WXG A;  3KQ4 A;  4LTU A;  1KOT A;  3TSS A;  3MJW A;  2IO2 B;  2M17 A;  1R4M I;  2MH7 A;  2IGH A;  2JU6 X;  2N9L A;  4M02 A;  2WGS A;  3W2D A;  1C3T A;  2FID A;  2LJI A;  3WAN A;  1I4R A;  3GB1 A;  1WR6 E;  4IWQ A;  1GT8 A;  5FKA C;  1CJE A;  4DHZ B;  1GC7 A;  1KRH A;  3NVY A;  4UDU C;  1L6U A;  2ZNV B;  4P1C C;  2PE6 B;  3L10 B;  4PS8 A;  1L4Z B;  1V86 A;  3HM3 A;  3FKY A;  1GJZ A;  3RFZ B;  4LLG M;  1A70 A;  5EE0 A;  3NUH B;  4FJZ A;  3V6E B;  4IG7 B;  2RMM A;  1XD3 B;  4DHJ B;  1L0X B;  4O1N A;  1J19 A;  2OJR A;  5D2M B;  3QC8 B;  1CK1 A;  2KLG A;  2KKC A;  3RNF C;  3Q3O C;  2L0T A;  2BF8 B;  4IM2 A;  1ZDV A;  1BXT A;  1FPY A;  2BS2 B;  2G4S A;  3V62 A;  1JAL A;  2FUH B;  3Q2A C;  4GDK A;  4KDI C;  4FAD A;  4NJ7 A;  1PGA A;  5C2T B;  1FCL A;  2YLM A;  3W1S A;  1WGY A;  1OEY J;  1GB1 A;  2KWV B;  4LK0 M;  2DZM A;  2IO0 B;  4WWO A;  3VR9 B;  1ET6 A;  1NYR A;  3L17 A;  2D3C A;  1GTE A;  2L32 A;  2Z8L A;  2DEN B;  2HTM E;  3B0A A;  3VFK A;  2FBW B;  4RGN A;  1Q1O A;  3NZ3 A;  1PUT A;  2JUO A;  1AN8 A;  1FO4 A;  4NJ6 A;  3VR8 B;  1IYF A;  2N4F A;  2MLB A;  5D94 A;  4MT5 A;  2CJN A;  2DYB A;  3NJT A;  2IJ0 A;  3URY A;  5D7G A;  2CS4 A;  1E10 A;  2KD0 A;  4KSL C;  1WJ4 A;  3RUI B;  1ISN A;  1WM3 A;  2I1J A;  1QQR A;  4ANW A;  1I4G A;  3RUL A;  2LAS A;  4MDK E;  3PZ8 A;  3W1S C;  2MJD A;  4HKQ A;  2KOX A;  3P4Q B;  4LNF A;  4FJV B;  3RNA C;  2HD5 B;  3V3X A;  3LDZ E;  3RT3 B;  2M1M A;  2BB6 A;  2BT6 A;  1QKZ A;  2G4D B;  3PTF C;  1SGH A;  5D3D A;  1KLV A;  4LCD E;  3H7S A;  4EKU A;  2E3T A;  2VH2 A;  3VXW A;  4ZDV A;  3ENE A;  2CHX A;  3K9O B;  1YN3 A;  4NQK E;  1RFA A;  2ZPN A;  3SHQ A;  1HTQ A;  2CKH B;  3C0R B;  4HDO A;  3M95 A;  1WXA A;  4RFB A;  2KDB A;  2WX1 A;  3RMK C;  3SEB A;  2LWP A;  2DYO A;  2NMQ A;  2X8X X;  2LHD A;  4XE0 A;  4F1S A;  4A20 A;  2XK5 A;  2J7Q B;  4S17 A;  4KX6 B;  2BYF A;  2O6V D;  1OGW A;  1B9R A;  3FAH A;  3WIM A;  4JQW C;  1YQ3 B;  5AUK A;  1ACC A;  2QC8 A;  2DZJ A;  2GOW A;  2YEP F;  1VLB A;  1GNU A;  2HTH A;  2JWZ A;  3Q8F A;  1XQQ A;  2A5U A;  1HE8 A;  2JYE A;  1WRD B;  4KIK B;  2DYM A;  2NTS A;  3UI3 A;  4AP4 C;  5C3J B;  1YIW A;  2WNM A;  5G2N A;  2LJ5 A;  4HCP B;  1V80 A;  2WXI A;  2KVR A;  3KW5 B;  4KVG B;  3RCZ A;  1GTH A;  3VHT C;  2DZK A;  2L7R A;  1OTR B;  3GZN B;  1EF1 A;  4PS3 A;  1V5O A;  1NYQ A;  2MP2 B;  4PS7 A;  1SBB B;  2ICI A;  1VCB A;  3QAR A;  3RNE C;  1MPE A;  1JWB D;  3Q3N C;  3DOW A;  3QCA A;  1ENF A;  4LNI A;  2V0G A;  3ZRF A;  3I57 A;  3H7P A;  2KMC A;  4A3O A;  4WQM A;  3P4R B;  2AEH A;  4GDL B;  1DOY A;  1RYJ A;  2L3Z A;  1QF6 A;  2YVC A;  1FRD A;  3PLV A;  2PJH A;  4FN2 A;  3QIJ A;  5E6J A;  1E7U A;  1WSP A;  1WE7 A;  1L2N A;  1SXT A;  1M94 A;  1QIL A;  5J18 A;  2JT4 B;  4YL8 A;  4NAW A;  4CO7 A;  3Q8A A;  1T6B X;  1FFU A;  4MH8 A;  1EU4 A;  4BKS D;  3NZU A;  1WFY A;  3PHX B;  3NS8 A;  2WXF A;  2X38 A;  3AE8 B;  1EU3 A;  1JML A;  3R2I A;  2L8J A;  1TY0 A;  1ZE3 D;  2WXN A;  1YOV B;  3Q6B A;  3ZIM A;  4OZB A;  4JE3 B;  2RSU A;  3DBR I;  2IO3 B;  5BMH A;  1UNS A;  1NEK B;  4YTN B;  2L83 A;  1FM0 D;  3A1Q B;  2GBJ A;  5LLI A;  3VUX A;  2IND C;  1L5P A;  4US9 A;  3X23 A;  3L08 A;  3VTV A;  1OQR A;  3AEF B;  2K5P A;  1SB3 C;  3NVV A;  1JW9 D;  3NG0 A;  4IWP A;  4GDL A;  5AEK B;  4DXA B;  4W9F A;  1SJH D;  4BKT A;  1ZGU B;  4KV2 A;  5DPR A;  4GLS C;  3N1Z C;  3SD5 A;  5AUI A;  4YWG G;  2WDV B;  4C4V A;  2BKR B;  2K25 A;  1YJI A;  2IY0 B;  1WGK A;  3PO0 A;  2XNA C;  3N1X C;  2PEA A;  2KAJ A;  2BYE A;  4XDD A;  4A90 A;  1E8Z A;  3PRP B;  5IO9 A;  1TS3 A;  4DXF A;  1F9J A;  3W9C B;  2M0X A;  1QT9 A;  1YN4 A;  2BYT A;  4EUT A;  1H7X A;  2LGI A;  3M3J A;  1PGX A;  1T3Q A;  1F1H A;  4OW0 A;  4EZK A;  3L16 A;  1SF0 A;  4YSZ B;  1QZE A;  2BS4 B;  2O6V A;  2BS3 B;  4RF1 A;  2KYW A;  1E7P B;  1MG8 A;  1RM6 C;  1L0Y B;  3Q3M C;  3L0W B;  4XX5 A;  3A9K B;  3ZNG C;  2M8S A;  4JX1 C;  5IAA C;  5CX3 A;  1YQ4 B;  1UWM A;  3RZW C;  3R66 C;  3QX1 A;  2VRR B;  4GOC A;  4NQL B;  2C5L C;  1KTK A;  2JPH A;  5J2R A;  3TIX A;  1EUV B;  1VZ8 A;  2Q5W D;  2N7D A;  4HPM B;  2MBO A;  1F2R I;  4BZA A;  2D11 A;  2R61 A;  2WQY B;  3QHT A;  4XYC A;  1FD6 A;  1XLQ A;  2RDB C;  5C1Z A;  4HK2 A;  4MGI E;  1WMH A;  1FNW A;  4IC7 B;  2KWD A;  2UU7 A;  3IT6 B;  4ICU A;  2D3A A;  3AI5 A;  2N9K A;  3R7Q A;  2ZCC A;  1CQV A;  3ONS A;  5E6N A;  4A9A A;  1HZ6 A;  2QIE B;  1MHH E;  1DOI A;  2JX5 A;  2SAK A;  4MJS B;  1WRI A;  3BYY B;  3T8M A;  1I4Q A;  1L4D B;  4K7W A;  5HHD G;  3TEY A;  2W82 A;  4RGT A;  2JZZ A;  5JHA A;  2W3S A;  2WS3 B;  4B0M A;  1HEZ E;  2IYD B;  1R7S A;  3V61 A;  5AZH A;  1ZUD 2;  3ZGZ A;  3SFD B;  1SE3 A;  3OJ3 A;  1Q0W B;  2GBN A;  2PLP A;  1IGC A;  3DBS A;  3Q8B A;  2Y3A A;  3KWL A;  1KLG D;  2MEK A;  2CR5 A;  4WJQ A;  3ZDT A;  2OHF A;  4GMV A;  2ZPY A;  3LJ3 A;  4KKI A;  3H8H A;  3GS2 A;  4TMA B;  2Z0E B;  2ZW0 A;  2WXP A;  4RGM A;  1BT0 A;  4W9K A;  1N5W A;  3V6C B;  1WGG A;  3EFU A;  3PLU A;  2KT7 A;  1DGJ A;  3IHP C;  3BII D;  3RZF A;  4TSS A;  3DBL I;  4K3C A;  1WGR A;  2DAJ A;  2C7M B;  1TKG A;  2H89 B;  5DPT A;  1LXD A;  2ZJD A;  4A55 A;  1EF5 A;  3CF6 E;  1WY8 A;  1L7Y A;  3AE1 B;  1OQY A;  4RF0 A;  4W9G A;  3RI7 C;  4P7I A;  4RM8 A;  3PZD A;  1P1A A;  3I3T B;  1OQQ A;  4BOS C;  3S2A A;  4F8C B;  1V9J A;  1TKE A;  2K8B A;  3UQB A;  4JPS A;  3NOB A;  4C56 C;  2WHI A;  2L1A A;  3W1Y A;  2V4L A;  3RYT A;  4W9D A;  3CMM B;  1LQB A;  4HPP A;  2KFK B;  4K81 A;  2B3A A;  4C80 A;  3CSF A;  2INC C;  3GE8 C;  1TZ1 A;  3DVN U;  3VH3 B;  2RDG A;  1WZ3 A;  1K53 A;  4EOY A;  2J0M A;  2QSD A;  2BKF A;  4QAY A;  2BWE S;  2BPS A;  5H92 C;  1RAX A;  4C7Y A;  1EM7 A;  2WX0 A;  1SEB D;  1V1P B;  3B08 A;  4DQO C;  1TTN A;  2LHE A;  4LJO B;  1WXM A;  2MQJ A;  3EUB 2;  1QOB A;  2WXQ A;  3B2F A;  3BYT B;  4AWJ A;  3ZRC A;  5G5H A;  2BB5 A;  3GZN I;  2EKI A;  4HXD A;  1AWD A;  5E6O A;  3IXS A;  3BVG A;  4US8 A;  2NBW B;  2IGD A;  2QEJ C;  4KGT A;  3R3M A;  5T8I A;  5DCN A;  4IWO A;  1VZ7 A;  3HVZ A;  3GE3 C;  4HRO A;  2WU2 B;  3AN1 A;  4JWS C;  1L0V B;  2K6D B;  3AE5 B;  3ML8 A;  4JIO U;  4LNN A;  1GG3 A;  1JWM D;  3ZXV A;  4DK5 A;  3CIR B;  4IOI E;  3Q3F A;  2L0F A;  1QLB B;  2EMT A;  2KFK A;  2KX3 A;  2V3S A;  3UIN B;  4HWI B;  1YD8 U;  1FMA D;  2M19 A;  2K8H A;  1J8C A;  2TSS A;  2WDR B;  2MW5 A;  1QOF A;  2UYZ B;  1V97 A;  3PSE B;  3PV1 A;  1QOG A;  3MFG A;  2Y5B B;  4JL9 A;  1JWS D;  3GP7 A;  1R4N B;  1LFD A;  4FLH A;  4IM0 A;  4AJW A;  3OG5 A;  2KWC A;  4K7U A;  2MBB B;  3O13 A;  3L54 A;  2MSE D;  1YQB A;  3M62 B;  4HLE A;  2ZNV C;  4WWM A;  2UWQ A;  1MFW A;  3VUW A;  5HG2 A;  2KAN A;  3V60 A;  3U52 E;  4G50 A;  2J0K A;  1NI2 A;  2GLS A;  3RN9 C;  4MSM B;  3M63 B;  4ZRQ A;  3PZ7 A;  2REX A;  2O2V B;  4M8N A;  4LJP B;  3HM6 X;  2W3R A;  1XT9 B;  1R4M B;  4Q2J A;  2J4X A;  4ITK A;  2KZR A;  3P42 A;  3FC4 A;  3B1L X;  1XXG A;  2K22 A;  1ZXI A;  1FNV A;  3MP9 A;  3WCQ A;  2EMS A;  5LXI B;  3R7R A;  2KDM A;  1JCK B;  1P0R A;  2JXX A;  3Q14 C;  2LRW A;  3IFW B;  2NTT A;  2FIF A;  4FBJ B;  2HJ8 A;  1T0Q C;  1YMH E;  3ZJV A;  1ZXH A;  2KDI A;  2WXO A;  4IUM B;  3UIP B;  3V05 A;  3PGE A;  1E0Z A;  2EKE C;  1MJD A;  4RMA A;  2I2Y A;  5CTR C;  3WAO A;  1WJN A;  2Y5C A;  4KZ0 A;  2LUE A;  4N59 A;  1PDX A;  4GB9 A;  5JH5 C;  5BO4 B;  1PGB A;  4D2K A;  4KKJ A;  2LGS A;  4TQ1 A;  3U30 A;  3KYC D;  3BK1 A;  3JVZ X;  3IAM 1;  4JWU C;  5FR3 A;  1WM2 A;  5KHO A;  4EZL A;  3A33 B;  1HQR D;  1UH6 A;  2KMM A;  2KTR B;  2O2V A;  2NBV B;  2GBM A;  4PYZ A;  4RGO S;  3Q3J A;  4XC2 A;  2CHW A;  5EDS A;  1AYF A;  1V5T A;  2K0P A;  2KDF B;  4II3 B;  3X0W A;  3PHW B;  5KHQ A;  3PPA A;  1I7H A;  3QQ8 B;  3R2T A;  1STE A;  1VDV A;  1JWU D;  3TMP B;  3AE2 B;  2W9N A;  1TS5 A;  1RFK A;  1WR1 A;  2DLB A;  4G0N B;  3U4E G;  1C77 A;  2AQ3 B;  1ET9 A;  3LXF A;  2KQ7 A;  2WDQ B;  4ANU A;  3MJ5 A;  1T5X D;  3MHS D;  3A4S C;  2D07 B;  2LUM A;  3ETR A;  2IGG A;  2PKO A;  3QJZ A;  1E90 A;  1ZPS A;  4KIK A;  5HKH A;  1HA5 A;  1GAQ B;  1XLN A;  1Z5S B;  4S0R A;  4NNJ B;  2KTF A;  3ZTC A;  2WXR A;  3JSV B;  4K1R B;  3R8B A;  1N5X A;  3P4S B;  4FXC A;  4WWN A;  5EE1 A;  5L95 C;  1WGH A;  4OZC A;  1F0Z A;  1KM7 A;  3A9J B;  4FHK A;  2MJ3 A;  1WJ6 A;  1FEH A;  2MP2 A;  3OJ4 B;  2MBQ A;  4KZC A;  1N63 A;  2KTR A;  3SFE B;  2A4Z A; 
#chains in the Genus database with same CATH homology
 1ZDV A;  1BXT A;  2FUG 1;  5BYR A;  1TZO A;  1B1Z A;  2N9K A;  4IDI A;  1Y56 A;  1CQV A;  2BS2 B;  4ZOH C;  4A9A A;  1HZ6 A;  2QIE B;  2KAC A;  1TYG B;  1MHH E;  1JAL A;  2INP E;  4HJG E;  1DOI A;  4XWW A;  3AB5 A;  2JX5 A;  2SAK A;  1MVK A;  1F2R C;  1WRI A;  2G9H D;  3BYY B;  1PGA A;  1FIQ A;  5C2T B;  1I4Q A;  1L4D B;  5HHD G;  1TY2 A;  3TEY A;  3AE4 B;  1P7E A;  1FCL A;  1M4V A;  2W82 A;  1E9M A;  4RGT A;  3P4P B;  1D5X C;  3W1S A;  3ZQ4 A;  2RPV A;  2W3S A;  3TEW A;  1GB1 A;  2WS3 B;  4B0M A;  1HEZ E;  3J9C A;  2JZP A;  4LK0 M;  1IGD A;  3AEG B;  1R7S A;  3VRA B;  1TS2 A;  2QJL A;  1QOA A;  3VR9 B;  1ET6 A;  1ZUD 2;  1NYR A;  3ZGZ A;  3SFD B;  2K3U A;  2I38 A;  1GTE A;  2L32 A;  1SE3 A;  2PLP A;  3HUI A;  3I9V 1;  2V3N A;  2Z8L A;  1IGC A;  1ESF A;  2HTM E;  2LFI A;  3Q8B A;  2FBW B;  3AE7 B;  2Y3A A;  1JQ4 A;  3KWL A;  4RGN A;  1KLG D;  3NZ3 A;  1PUT A;  1XO3 A;  2MEK A;  1AN8 A;  1FO4 A;  2LMC A;  2OHF A;  4NAW B;  2ON8 A;  3VR8 B;  4AQ7 A;  2HDE A;  1I4P A;  1C79 A;  4KKI A;  3H8H A;  1WWT A;  3GS2 A;  4TMA B;  2ZW0 A;  2V3P A;  4MT5 A;  2J42 A;  2WXP A;  2CJN A;  4RGM A;  2OED A;  1KF6 B;  1YN5 A;  2IJ0 A;  1N5W A;  4XWT A;  3URY A;  1DGJ A;  2WXL A;  1HZ5 A;  5D7G A;  3BII D;  1H7W A;  2JWU A;  1E10 A;  4TSS A;  3FIL A;  2WLB A;  2EEL A;  1TKG A;  3AMZ A;  3L4P A;  2H89 B;  1D5M C;  1QQR A;  1I4G A;  2WXK A;  2K9X A;  3PZ8 A;  5HI1 A;  4A55 A;  3MHZ A;  2MJD A;  2W54 A;  3ZJT A;  3AE1 B;  2YEP B;  4HKQ A;  2PMV A;  4RF0 A;  3P4Q B;  1SJE D;  2IPK D;  1XCT L;  3V3X A;  4REZ A;  2BB6 A;  4A8X C;  4KGS A;  1OQQ A;  1TKY A;  1QKZ A;  4YTP B;  2BT6 A;  5D3D A;  3KLS X;  2MJE A;  2ACZ B;  1FFV A;  2E3T A;  5BMI A;  4ARC A;  1TKE A;  1GOZ A;  5BYQ A;  2LEK A;  1P7F A;  4OVZ A;  4JPS A;  3N9Y C;  1WXQ A;  4C56 C;  1YN3 A;  2L1A A;  3AEE B;  1K51 A;  2DBY A;  2JXT A;  3NVZ A;  4HKZ E;  4C80 A;  4P6V F;  2QIL A;  2CU3 A;  2RDH A;  4RFB A;  2J53 A;  2BTE A;  3SEB A;  2DYO A;  2RDG A;  2NMQ A;  1SIJ A;  3EGR A;  1IUE A;  1K53 A;  1SE2 A;  4N58 A;  2QSD A;  1XLP A;  2LHD A;  4XE0 A;  2H88 B;  2M56 B;  2PW9 A;  5H92 C;  1Q10 A;  1EM7 A;  3CWI A;  4KX6 B;  4C7Y A;  3TEZ A;  5HFY A;  1SEB D;  4CQN A;  1V1P B;  4WAF A;  1GPX A;  2KN4 A;  4DQO C;  4P16 A;  1XCQ L;  1B9R A;  1ZOY B;  3FAH A;  2LHE A;  1FNU A;  2PIA A;  5G5G A;  1YQ3 B;  5AUK A;  1ACC A;  3EUB 2;  1QOB A;  2WXQ A;  3B2F A;  3BYT B;  3BWU D;  5G5H A;  3BZD B;  5LNK 1;  1OFF A;  3BVM A;  2BBC A;  1K52 A;  2YEP F;  1VLB A;  2BB5 A;  1C4A A;  3NRZ A;  4WUR A;  3Q8F A;  2JSV X;  5JXV A;  2EKI A;  4MAC A;  2N0S B;  1AWD A;  3IXS A;  2W55 A;  3BVG A;  2JYE A;  3U2S C;  4US8 A;  2IGD A;  2DYM A;  3AEB B;  2NTS A;  3UI3 A;  1YNT E;  2QEJ C;  5C3J B;  4KGT A;  3AEA B;  5T8I A;  5BYS A;  1VZ7 A;  2WNM A;  3HVZ A;  3W5U B;  3AE9 B;  4HRO A;  4N6E B;  2WU2 B;  1L6V A;  4C7Z A;  1N60 A;  2WXI A;  1UUP A;  3AN1 A;  1TS4 A;  3ABV B;  1L0V B;  1JRO A;  4JWS C;  4HRS A;  2QMT A;  4HEA 1;  3DWM A;  3AE5 B;  2GB1 A;  1J7A A;  1GTH A;  3U7Z A;  2ONQ A;  3T3N A;  1V1O A;  2L52 A;  4ZHP A;  1PYW D;  1JWM D;  1RWS A;  1JWA D;  3CIR B;  4IOI E;  5GXG B;  2PVO D;  3B2G A;  1KLU D;  1QLB B;  2J52 A;  1NYQ A;  1BUI C;  1GB4 A;  5TSS A;  3TUO A;  1FMA D;  2M19 A;  1C9F A;  1SBB B;  2ICI A;  3AE3 B;  2TSS A;  3C8Y A;  1PFD A;  4L23 A;  1HXY D;  2WDR B;  1MPE A;  1JWB D;  1KFY B;  1QOF A;  2INN E;  3T3O A;  1V97 A;  1MI0 A;  4NAM A;  1QOG A;  3MFG A;  4GDK B;  4DXG A;  1JWS D;  4RNA A;  2N7J A;  1AW7 A;  1ENF A;  3GP7 A;  2V0G A;  1BML C;  3ZYY X;  3HRD D;  3I57 A;  2M0A A;  1J7B A;  4YXD B;  2AQ2 B;  3IAS 1;  4WQM A;  3P4R B;  3O13 A;  4A6Q A;  3MC0 B;  4GDL B;  1JRP A;  3AM9 A;  1DOY A;  2BW2 A;  2WXH A;  1RYJ A;  4MM3 B;  1VR9 A;  4WWM A;  3BK2 A;  5HG2 A;  1QF6 A;  1IBX B;  2GRI A;  5EE9 A;  1FRD A;  3AV8 A;  2GI9 A;  3E9S A;  1FXI A;  3EA6 A;  3U52 E;  5E6J A;  3AE6 B;  3OWE B;  1WSP A;  1SXT A;  1ZP0 B;  1XLO A;  1MHX A;  2AQ1 B;  4YTM B;  1SE4 A;  4L2Y A;  2PTL A;  2DWQ A;  1QIL A;  3AEC B;  4ZRQ A;  2WU5 B;  3PZ7 A;  4PT5 A;  3Q8A A;  1T6B X;  1FFU A;  4MH8 A;  1EWY C;  2W3R A;  4R3D A;  4Q2J A;  4XDC A;  1EU4 A;  4NZL B;  1F77 A;  3LB8 C;  2J4X A;  4ITK A;  3SR6 A;  3P42 A;  3Q8E A;  4YSY B;  2WXF A;  2X38 A;  3FC4 A;  3AE8 B;  1EU3 A;  1FXA A;  1JML A;  3R2I A;  1TJE A;  1XXG A;  2K22 A;  1TY0 A;  1ZE3 D;  1ZXI A;  2WXN A;  1FNV A;  1N62 A;  3MP9 A;  4YSX B;  2SEB D;  2B76 B;  5EE3 A;  3WCQ A;  1FRR A;  4OZB A;  4JE3 B;  1VJK A;  2AX5 A;  1C4P A;  4OZA A;  2KDM A;  1JCK B;  5BMH A;  2FE8 A;  1UNS A;  4WIP A;  3KWV A;  4IKG A;  1NEK B;  4YTN B;  2L83 A;  2NTT A;  2PVG C;  1FM0 D;  2WP9 B;  4RH6 A;  1C78 A;  3E56 A;  1XEE A;  3HVD A;  3ZJU A;  1NEN B;  1YMH E;  2VZK B;  4M0W A;  1I4X A;  2VZK D;  1L5P A;  4US9 A;  1ZXH A;  5D3I B;  2CJO A;  2WXO A;  3ZJV A;  3V05 A;  3Q8C A;  1E0Z A;  3AED B;  1OQR A;  1K50 A;  3AEF B;  2K5P A;  1ZDX A;  2I2Y A;  1EWC A;  1SB3 C;  1CZP A;  2Y5C A;  3NVV A;  1ROE A;  3AH7 A;  4N59 A;  1PDX A;  1D5Z C;  1JW9 D;  4YT0 B;  1PGB A;  2JQR B;  1SJH D;  4D2K A;  4KKJ A;  4TQ0 A;  2WXJ A;  1FCC C;  4TQ1 A;  1IBX A;  1DYQ A;  2D5G A;  4L1B A;  4GLS C;  3NVW A;  4EE2 A;  4ZRP A;  5AUI A;  4YWG G;  2WDV B;  4ZYS A;  4RCO A;  3BK1 A;  1YJI A;  1D6E C;  1WGK A;  4AS1 A;  3PO0 A;  2XNA C;  4NJC A;  2KAJ A;  2ZW1 A;  3IAM 1;  5I4D A;  4XDD A;  4JWU C;  5FR3 A;  2XN9 C;  1J7C A;  4A90 A;  3TEX A;  1HQR D;  1YJJ A;  2KMM A;  4RGO S;  1TS3 A;  4DXF A;  5FK9 C;  4ZHO A;  3W9C B;  1QT9 A;  1YN4 A;  2BYT A;  1AYF A;  1VZ6 A;  4ARI A;  1NVI D;  2K0P A;  4B0E A;  3IT4 B;  1H7X A;  2LGI A;  1XF5 L;  1DOX A;  1PGX A;  3W5V B;  1I7H A;  4KGR A;  1T3Q A;  4OW0 A;  3R2T A;  1STE A;  1VDV A;  3P1M A;  1JWU D;  1VRA B;  1SF0 A;  4YSZ B;  4J3O D;  2BS4 B;  1V1P A;  2WXM A;  5H8Y E;  1TS5 A;  3VQI A;  1RFK A;  2BS3 B;  4RF1 A;  1N61 A;  2DLB A;  2IDY A;  2WXG A;  3NS1 A;  3U4E G;  3RPF C;  1C77 A;  3KQ4 A;  2Y5P A;  2AQ3 B;  3VRB B;  1ET9 A;  4LTU A;  1E7P B;  1UGJ A;  3BVZ A;  3TSS A;  3LXF A;  4WH4 A;  3CF4 A;  2WDQ B;  2MH7 A;  2IGH A;  2JU6 X;  2N9L A;  3W2D A;  3MJ5 A;  1T5X D;  1RM6 C;  1L0Y B;  3DWG C;  2LJI A;  3LYY A;  1WYG A;  1I4R A;  2LUM A;  3ETR A;  3GB1 A;  1NI3 A;  3Q69 A;  1SSN A;  1UWX A;  2IGG A;  1GT8 A;  5FKA C;  1CJE A;  2PKO A;  3B9J A;  1I4H A;  1ZPS A;  1HA5 A;  1KRH A;  3NVY A;  4JX1 C;  1GAQ B;  1LO5 D;  1XLN A;  3P63 A;  4UDU C;  1L6U A;  4OHJ A;  1YQ4 B;  1UWM A;  1L4Z B;  5MPO A;  2KQ4 X;  1V8C A;  1KTK A;  2V4I B;  1VZ8 A;  4H2A A;  3RFZ B;  2Q5W D;  4LLG M;  2WXR A;  1A70 A;  5EE0 A;  3NUH B;  4USA A;  3R8B A;  1N5X A;  3P4S B;  2JYT A;  4FXC A;  1F2R I;  5EE1 A;  2R61 A;  2WQY B;  4OZC A;  2RMM A;  1F0Z A;  1FD6 A;  2G1E A;  1D4B A;  1XLQ A;  1C4C A;  1L0X B;  4O1N A;  2MJ3 A;  2E6X A;  1FEH A;  3FIL B;  1CK1 A;  1KH0 A;  1FNW A;  1N63 A;  2KWD A;  5BMG A;  3IT6 B;  3AE2 B;  1E6E B;  3SFE B;  1C76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...