4YT0B

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-methyl-n-[3-(1-methylethoxy)phenyl]benzamide.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
total genus 54
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4yt0B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4yt0B01
3AE8B 2PVOD 3AEFB 4JWSC 5G5HA 3AEGB 1XLNA 5AUKA 3NVYA 2ACZB 1H7WA 2WQYB 2QJLA 1JWAD 1JROA 1L6UA 4YTMB 1QOBA 3AN1A 3W9CB 1QF6A 1JQ4A 2WDVB 3AEDB 3AEEB 1WXQA 5H92C 2WDQB 1EWYC 2BS2B 1R7SA 1WGKA 2PVGC 5EE3A 3NVZA 1E7PB 4YSZB 1NI3A 2W3RA 3HUIA 1N60A 2MH7A 4P6VF 4YSYB 1NEKB 3AECB 1E10A 4C7ZA 2PKOA 1JRPA 2W54A 3RPFC 1V97A 1JW9D 3PO0A 5G5GA 1SB3C 1FFUA 2M56B 4HRSA 1SF0A 5EE9A 2G1EA 3NRZA 1YQ4B 1GTHA 1H7XA 1FM0D 1FXAA 3P4PB 3W5VB 1B9RA 1TKYA 1IUEA 1QOFA 1FMAD 1CZPA 1CJEA 2N0SB 1NYRA 1KFYB 2WU5B 3AE6B 1ZXIA 3B9JA 2W55A 3L4PA 3AB5A 4JWUC 2JQRB 5AUIA 1DOYA 2HTME 3B2FA 1F0ZA 4WQMA 3SR6A 1KF6B 1AYFA 4USAA 1ZUD2 4WWMA 4ZHPA 1SIJA 1GT8A 2K22A 2M19A 1E9MA 1DGJA 1RFKA 4ZOHC 3AE9B 3CWIA 3AEBB 4LTUA 1FRRA 1NYQA 1QOGA 1FIQA 1JWBD 2QIEB 2AX5A 5GXGB 3FC4A 4IDIA 4A9AA 3ETRA 3LXFA 1NVID 3B2GA 1YJJA 2WS3B 1ROEA 1A70A 1RM6C 3DWGC 4US8A 1ZOYB 4C80A 4YT0B 1VJKA 2WLBA 1DOIA 4YTPB 1J7CA 2CU3A 3W5UB 3AE5B 2LEKA 1XLQA 3WCQA 1WYGA 1VLBA 2Q5WD 3P1MA 1FO4A 1TKGA 3NVVA 1PDXA 5C2TB 1VDVA 1N5XA 2W3SA 1PFDA 3VRBB 2JX5A 1QT9A 4JX1C 1QOAA 1OFFA 2WP9B 4YXDB 3LB8C 3ZYYX 2KAJA 3SFDB 3CF4A 2L83A 1AWDA 1OQRA 1T3QA 1DOXA 3SFEB 2MJDA 1YJIA 1J7AA 3CIRB 3VRAB 1XLOA 2PIAA 3HVZA 5C3JB 4KX6B 4YSXB 3FAHA 4ITKA 2H88B 4YTNB 1FXIA 3NS1A 3AEAB 3EUB2 1YQ3B 4FXCA 3ABVB 2H89B 3AM9A 1L0VB 1FFVA 1J7BA 3P4QB 3NVWA 1TJEA 2L52A 2EKIA 1WRIA 3KWLA 3P4RB 2E3TA 1RWSA 2CJOA 1RYJA 1N61A 2BS3B 1N62A 2MJ3A 4N58A 3AE4B 1GPXA 3AE7B 1N5WA 1L5PA 2BT6A 4ZHOA 5EE0A 4HROA 5MPOA 2K9XA 1NENB 4N6EB 1PUTA 2DBYA 2OHFA 2BS4B 3P4SB 1N63A 1V8CA 3AH7A 2WDRB 3VR9B 1TYGB 1E0ZA 1XO3A 5EE1A 2FBWB 3BIID 1JALA 4US9A 3AE3B 1L6VA 1UWMA 4C7YA 1QLBB 2DWQA 3DWMA 1GAQB 3AMZA 2WU2B 3AE1B 1FRDA 3P63A 5H8YE 1TKEA 3AE2B 3AV8A 1XLPA 2B76B 2CJNA 3VR8B 1WWTA 1OQQA 2Y5CA 1ZP0B 1KRHA 2KMMA 3HRDD 1GTEA 2MJEA 1E6EB 4N59A 1I7HA 2K5PA
chains in the Genus database with same CATH superfamily
4NJ6A 2BPSA 4HKQA 2IGDA 1H7WA 4M02A 3H7SA 1IP9A 3Q3FA 2K25A 1JCKB 1WSPA 1TGZB 4L2YA 1YN5A 2LGDA 2DZKA 3N1XC 1MI0A 1CJEA 1YD8U 2D3CA 2NTSA 4OVVA 1I4XA 4HPLB 4WWMA 2EELA 5E6NA 4EEWA 3PS6A 2WX1A 2RMMA 1R4MI 2KYWA 1QOGA 3PZDA 1VZ8A 4KZ0A 1K52A 3P2BA 4M8MA 1XLQA 4W9KA 3P1MA 5BYQA 4A3PA 1N5XA 1RRBA 3B1LX 2PEAA 3B0AA 1WGRA 4R3DA 1P7FA 1BXTA 3VUXA 2DYOA 1FPYA 2G45B 2B3AA 1EWCA 4G11A 1MHHE 4GDKB 3DVGY 4ZRQA 2R2QA 2BWES 1VCBA 2BBCA 4DWFA 2KX0A 1N63A 1TYGB 2DYMA 4P1BC 2BWFA 5DCNA 3DQVA 3U52E 1UWMA 1PGXA 4HWIB 2MHJA 3AV8A 3SHQA 4DXGA 4EFOA 1UWXA 4PS7A 5D94A 1PYWD 3FKYA 3ZKJC 4XWTA 1WX7A 3M62B 2DLBA 2N1VA 2LWPA 2KFJA 2KQ7A 4A8XC 4OVZA 1IPGA 4IKGA 2G1EA 2XNAC 2J0KA 2D2QA 3TUOA 4X57B 2KZRA 4BBNC 2WU5B 1ZPSA 5T8IA 2WHIA 5BMIA 4BKSD 1WJUA 4JPSA 3EFCA 1WJNA 2PPHA 4JE3B 2KWUB 3L54A 3PZ7A 4NAWB 5GXGB 3M63B 4F7ZA 3HVDA 1J19A 4A9AA 4ZRPA 4JQWC 2REXA 2CU3A 5GMVA 1FO4A 4NPNA 2ICIA 5L95C 3L13A 4RGOS 3QA8A 1OFFA 3WALA 3Q3MC 3R2TA 3UQBA 1J7AA 1L0XB 3ZGZA 3HVZA 3AU5A 1T6BX 2I1JA 2K6QA 4ITKA 5FR3A 1Q10A 5C23A 5DPWA 3EUB2 1GC7A 3U2SC 1L0VB 3UF8A 1J7BA 1HQRD 2PE6B 2LVOA 1T0QC 3NZSA 1XCQL 5KHOA 1N61A 1WZ3A 4KGRA 5CX3A 3HIZA 3DHGC 3W1SC 2CR5A 2KQSA 3JSVB 4BKTA 2BS4B 4BOZB 1JALA 2KMCA 1TZ1A 3ZW3A 1WY8A 4MM3A 1I4GA 1TKEA 1C78A 1ZP0B 2ZCBA 2WWZA 2VZKB 4RM8A 1I7HA 2W82A 2MP2A 1T5XD 2AWTA 1JWSD 3KYDD 5TR5A 2PVOD 4YWGG 1KM7A 3TBLD 2L1AA 2PMVA 2IO0B 3MP9A 3PHWB 4W9FA 4AJYB 5EE3A 4NAWA 4BZAA 1Y56A 3RPFC 2IO3B 2QCZA 3A9JB 2O6VA 1JWMD 3Q3JA 3AB5A 3C19A 4XGAB 4WQMA 3IVFA 3RN9C 1EF5A 1UF0A 4PS8A 2GBNA 1JRUA 3I57A 4M0WB 1KTKA 3HK0A 1UH6A 4NJCA 4EOYA 1K50A 1VJKA 2JRHA 2KT7A 2KHWB 4PYUA 2LGYA 2PW9A 4MSMB 2KLGA 1YMHE 1PDXA 5KHQA 2W3SA 4P1CC 4WAAA 1H8CA 5IKCM 4HJGE 1YJIA 2GBRA 3APCA 4YSXB 2Z59B 1FXIA 4BOSC 1LQBA 1Z5SB 4W9JA 3ML8A 3NVWA 1IGCA 1M94A 2LUMA 3ZTDA 4GU2A 2N9XA 2LVPA 4MJSB 3DVNU 3VFKA 3ECIA 3RNCC 4DDGD 2MWSB 2GMIC 1UD7A 3RT3B 1SGHA 4CQNA 4FJZA 1ZDVA 4WJNA 2HJ8A 1HZ5A 2LUEA 1OTRB 4JWSC 2PTLA 4WJPA 2DZMA 1F77A 4RCOA 3AEDB 3MHZA 3PPAA 1RFAA 1KLGD 1V80A 2NCNA 2W3RA 1N60A 4RF1A 2CKHB 1TS2A 3KH0A 4RGMA 3T3NA 1TS5A 2DX5B 2MBHA 5CHVC 1B9RA 2HD5B 2BKRB 2QMTA 1F52A 4JWUC 1UELA 2JQRB 1WXVA 1STEA 2L7RA 3BWUD 4CO7A 4P16A 2K22A 2JSVX 3HM3A 2KVRA 2UWQA 2GOWA 3D32A 5JZEB 1RM6C 1Y8RC 3QJZA 1SJHD 2G4SA 2JZPA 1TKGA 2IZVB 3I5JC 3QK0A 3T3OA 1E7UA 2MJDA 4HEA1 3BY4B 3VRAB 3PRPB 5BMHA 2KDIA 2EMSA 4TMAB 3VUWA 2H89B 1RLFA 1TJEA 5L83A 2IO1B 1N62A 3AE7B 1T0YA 4L1BA 4ZHOA 5MPOA 1AN8A 4TKNA 4WWOA 1PQSA 5EE1A 3BK2A 4ARCA 2CJNA 4WIPA 1MG8A 1WH3A 3HM6X 4GGQA 4B9KA 2N9EB 3EA6A 1LM8B 1TBEA 4IM3A 1D3ZA 3DPDA 1RAXA 2BS2B 2ONQA 3U7ZA 2YEPB 2VRRB 2M8SA 1HTOA 1C1YB 4RH6A 1V97A 2WX0A 1TY0A 4XYCA 4ZRIA 4HDOA 1P98A 2HE7A 3TJPA 2N7EA 4K1RB 3RNBC 2KNBA 1ZXIA 2WXKA 1ZUD2 5D2MB 2JF5A 2FUG1 2L3ZA 2KQ4X 3AEBB 1NYQA 1ESFA 2O2VB 4IDIA 1VR9A 1NVID 2K3UA 4US8A 1ISNA 2JZZA 3JSVA 3WCQA 3ML9A 4HLEA 4HCNB 4JL9A 3KQ4A 4NZLB 4RM9A 3DBHI 1AWDA 2KLCA 2PIAA 2H88B 3EC8A 1I4QA 2JYTA 2ON8A 3KWLA 3P4RB 2BF8B 4K81A 3Q8AA 2EMTA 2A5UA 2X38A 2GBJA 3P4SB 4MDKE 3SDLC 1AARA 3OAWA 2VZKD 3AE1B 3P63A 4IG7B 3RNGC 4IC7B 1V1OA 1WWTA 1WJ6A 3NJTA 4MACA 2R61A 4RMAA 3AE8B 1L7YA 4I6PA 4S0RA 3V3XA 1P0RA 1DYQA 1R7SA 3NVZA 4NAMA 4GDKA 4LDTD 4BAXA 3AECB 4GMVA 1GC6A 3RCZA 1PGBA 2N1WA 4I6NB 3RNAC 4WQOB 3N20C 4DHJD 1G6JA 1HTQA 2NVUI 2LRWA 1KH0A 5AUIA 4AP4C 3EECA 2QDFA 5HFYA 4EZKA 4K3CA 3TL5A 3U8ZA 4D2KA 1WXSA 2KDEB 4XDDA 1ROEA 2KDMA 1D6EC 1L4ZB 4YT0B 4OHJA 2MX2A 3W5UB 3M95A 3LYYA 4GXBA 3V62A 1WFYA 3KUDB 1MFWA 3MC0B 2J0MA 3H6NA 3VH3B 3ZO5B 1TZOA 1I35A 2ZJDA 4KSLC 5JHAA 4MELA 3A33B 3PREA 1MJDA 4OZBA 4JLCA 4OZAA 2WDTB 2ZPNA 4RNAA 4N58A 4ZDVA 2N9KA 5EE0A 3IXSA 4HROA 4N6EB 4NQKE 1OEYJ 2AQ2B 1WF9A 3L16A 1SE9A 2AQ3B 4DXFA 4AJWA 1F2RC 1V81A 3M3JA 3VTUA 3UI3A 4AS1A 3RYTA 2WXNA 3WIMA 1E6EB 2O6VD 4BFRA 3R7QA 1K8RB 5G5HA 4RFBA 4K7UA 2AL6A 3SU8X 1QF6A 4MJSA 3QHTA 4IWOA 4LNFA 3MJWA 4K3BA 3X0WA 1R4NI 2LJ5A 2NBUA 3OG5A 3IBEA 3UIPB 4C7ZA 1ENFA 1JRPA 2INPE 2WXOA 2R2OA 2L05A 3NRZA 1FNWA 4B6WA 2D3AA 1C4PA 3DBLB 3AE6B 2V4IB 2ZVNA 5HHDG 2VH2A 3E56A 1E9MA 3J9CA 2KX3A 4FLHA 3FC4A 1J8CA 3LXFA 2WS3B 4KDLB 1OQYA 3GP7A 4B95A 2SEBD 1BUIC 1S3SG 3BZDB 3E9SA 3GZNB 1VLBA 2V9HA 1BMLC 3RFZB 1PFDA 3VRBB 3LB8C 4LJPB 3ZNZB 2Z8LA 2L83A 2IBIB 1OQRA 2MSED 1LFDA 1KOTA 2LVQA 2QSDA 3Q8FA 4TUUA 4GB9A 4RGNA 2RD0A 2KTRA 1ZW7A 2I38A 3FILA 3BK1A 4PYZA 4TQ1A 3DCGA 3AE4B 1TY2A 2C5LC 2FE8A 1WX8A 4XZ4A 4HVBA 3AMZA 2WU2B 2DNFA 2D10A 3TEZA 2KN5A 2V0GA 2GRIA 2BQQA 2KMAA 1EF1A 1WE7A 3L10B 3A4SC 4B0EA 3FILB 3AEEB 5G55A 2WDQB 1EWYC 2CS4A 3KUZA 2MCNB 3AU4A 3T9LA 1SBBB 2ZVOA 4YSYB 4HKZE 5E6OA 3N30A 4HJKA 1FFUA 5EE9A 2GLSA 1H7XA 1EU4A 4RGTA 3R66C 1I4HA 2A4ZA 1C4AA 5IO9A 1CZPA 5AZHA 2KANA 1LO5D 2W55A 1R4MB 5HG2A 1F0ZA 3QQ8B 2L00B 2N4FA 3C0RB 1SIJA 1SSNA 4M01A 3ZJTA 3AE9B 3CWIA 1HE8A 2LXCA 4GN1A 2DAJA 1FRRA 4B0MA 3LJ3A 3DBLI 1UBQA 2J52A 4G3XB 3ZNID 1YIWA 1TT5B 3OWEB 1VRAB 1ZOYB 2C7MB 3OJ4B 1WRDB 3VQIA 2LEKA 4KKIA 1IBXA 1CMXB 1YN3A 4DBGA 2LXAA 2RGFA 2Y5BB 1YN4A 1UNSA 4KV2A 1C77A 2NPTB 3FAHA 3GZNI 4OZCA 5LXHA 3P4QB 3VVWB 2L52A 3GOEA 2LHEA 2XK5B 2BS3B 5CHWA 3I3TB 4E3CA 1WGDA 1PUTA 3L0WB 5JXVA 4FHJA 1GNUA 3A9KB 4W9HA 4IOIE 2YEPF 2J7QB 1GAQB 2FUHB 3JW0X 3AE2B 2KMMA 1GTEA 4BKGA 1UGJA 4LNOA 3UINB 2JU6X 3AEGB 2WQYB 1JWAD 2FAZA 2GBKA 3NZ3A 3VH4B 4K7SA 4MGYE 1D5MC 1WXQA 1JMLA 1XEEA 5JHBA 4ASWC 3R7RA 2D3GA 4G50A 2MW5A 4KSKC 2PKOA 3N32A 1JW9D 1E8YA 2KN4A 4HXDA 4Q2JA 2D5GA 4EUTA 1FXAA 3DBSA 4NQLB 3QX1A 2Y5PA 1QOFA 2BB6A 2L0TA 1SEBD 1WIAA 3N1YC 3TEXA 1V2YA 3RUIB 2WXJA 3VAWA 3BYTB 5D3DA 2V1YA 3O65B 2NPTA 4KZCA 4N9F4 1YX6B 1TTNA 1WGGA 1JWBD 1TS3A 3WAOA 4IM2A 2BYTA 3B2GA 3DWGC 4ICUA 4IUMB 2M1MA 3CF6E 3PHXB 2I1KA 4XC2A 3WANA 1MPEA 4ANXA 2MRPA 1PGAA 3UQAA 2O6VB 2BTEA 3KWVA 2KC1A 2RSUA 5J2RA 2I2YA 1E8XA 3NG0A 3Q3NC 2W9NA 4XX5A 3WA0A 3NS1A 2IGGA 2KACA 3BVGA 1WMHA 1UGMA 1FCLA 2ASQA 2JXXA 1NI2A 4LNNA 1WRIA 2D11A 2MJ3A 1XXGA 2C7NB 5E6PA 1K51A 4ANUA 1V5OA 4E74A 4LNIA 5LLIA 2MBEA 3VHTC 1QLBB 2KFKB 5H8YE 3A9JA 4DHZE 2LRUA 3TEWA 4DK5A 4KIKB 4BVUC 1Q5WB 2KC2A 2NMQA 3AEFB 5AUKA 3NVYA 4KGSA 2ACZB 4YTMB 2QILA 3C8YA 5H92C 3IAS1 4YSZB 2FNJB 1VZ7A 5BYRA 2BKFA 3IT4B 2GI9A 3V05A 3JYUA 3P4PB 2LASA 3ZRFA 1NYRA 2INCC 3B9JA 3GE3C 3VTWA 1DOYA 4HK2A 2LZ6A 2WXMA 4LDTB 4W9CA 3A1QB 3ZRCA 2MLBA 1FIQA 2KTRB 3UGBB 1YJJA 1A70A 5D6JB 1GUAB 2G4DB 1QQRA 1FEHA 2JWUA 2PLPA 2BYEA 4EE2A 2L8JA 2LI5A 2K1FA 4YXDB 1F2RI 2KAJA 3S2AA 3CF4A 1DOXA 5BYSA 2RDGA 2JXTA 2MA9B 1WYWB 5C3JB 3Q6BA 4MGIE 3TMPB 4ANWA 1YQ3B 3X23A 3PLVA 4JGHB 3RNFC 2UYZB 4PK1A 2N7DA 2EKIA 1X1MA 2E3TA 5G2NA 2WNMA 1F9JA 4MM3B 2MBOA 1E0ZA 3BVZA 4EZJA 3BIID 2MBQA 4NNJB 2DWQA 4H2AA 2B76B 1EUVB 1FD6A 3ZUNA 5CHFA 2V3SA 1Z2MA 1HA5A 2DAFA 1ZE3D 2L76A 2KWDA 3KLSX 1XLNA 4WH4A 4E71A 4KKJA 2EKEC 4IWPA 2IGHA 1QOBA 4QAYA 2IYDB 2WDVB 3V60A 3EFUA 4XE0A 5J18A 3APDA 2OJRA 2NBVB 3A4RA 4M8NA 2M56B 4TSSA 1HZ6A 1XF5L 2G3QB 3QCAA 1MHXA 3W5VB 3K9PB 4FBJB 1WR6E 1IUEA 1E90A 4MH8A 2ZW0A 2DENB 3IG3A 3B2FA 4USAA 2JYEA 1ACCA 2M19A 4ZOHC 4LTUA 5C1ZA 2AX5A 2LJIA 2HTHA 3TSSA 3T8MA 2N7JA 4XWWA 1TIFA 2WXGA 2WLBA 3N1ZC 1R4NB 4LK0M 2Q5WD 4HPMB 5C2TB 3ZJVA 1QT9A 1CQVA 1QOAA 1E5WA 2AQ1B 3KYCD 2PJHA 2KKCA 2JY6A 1V86A 1XLOA 3U7DA 1H4RA 2YVCA 1HXYD 1WXMA 3GE8C 3K9OB 3AULA 4DXAB 2FIFA 4II3B 3Q14C 4FA6A 3R2IA 4WWNA 1AW7A 3QARA 1WM2A 4GLSC 1VZ6A 1V8CA 2HJ1A 1OGWA 3H7PB 2NR2A 2M0AA 2AEHA 3ZTCA 1SIFA 5TSSA 1XLPA 3VR8B 2Y5CA 1C4CA 1KRHA 4AUQC 2ZZPB 2ZPYA 1I4RA 3BVMA 1FNVA 2NBWB 3AN1A 4KIKA 1ZGUB 1T0RC 4WJQA 3ALBA 1E7PB 2O2VA 4O1NA 1TS4A 3ENEA 2RDBC 4HRSA 3H7PA 1XCTL 2WXRA 2L0FA 3H1UA 2JWZA 1QKZA 2C60A 2LFIA 1FMAD 2N0SB 1AYFA 4A90A 1C76A 2LD9A 1GOZA 3KVFB 2G9HD 3RZWC 4KDIC 1OEYA 2J4XA 4NY0A 4MH0E 1WZ0A 3OJ3A 3NOBA 1C9FA 1P7EA 4BBNF 2K8HA 2KD0A 4HPPA 3AE5B 2SAKA 4YL8A 4TV3A 3Q8CA 3ZNGC 2LGXA 2KOXA 3Q3OC 3RNEC 4GOCA 3SFDB 1SE3A 4IW0A 3RI7C 1T3QA 4FULA 2IPKD 1Q1OA 4C56C 5I4DA 4DHZB 4A6QA 2FCMA 3Q8BA 4FXCA 1ET6A 4MSQB 5IA7A 3IHPC 2XN9C 4DHJB 2CU1A 5BO4B 1E7VA 5AEKB 2XEWA 2RDHA 2K6DB 2DBYA 1L2NA 5E6JA 1XO3A 1V5TA 1UUPA 4US9A 3AE3B 4C7YA 2LGSA 1UBIA 2KDFB 2Z0DB 2MQJA 3ONSA 5FKAC 3BYYB 1Q0WB 3DBRI 3PLUA 1T0SC 3KW5B 3Q8EA 2WXIA 4MGKE 5EDSA 3BINA 2Z0EB 2K5PA 2IY0B 1WMHB 2WYQA 2IDYA 1I4PA 1FNUA 3NHEB 1L6UA 2AL3A 3DDCB 1CK1A 4ACFA 1WGKA 1ET9A 4MT5A 2DZIA 1WX9A 3A9KA 1GJZA 2AYOB 4WAFA 1EM7A 2W54A 3Q69A 1WE6A 4ZRKA 3EHVA 3KUCB 4WWPA 4A20A 3NZUA 2BB5A 5CTRC 1YJ1A 2HTME 4PT5A 3SR6A 2ZEQA 1SE2A 3SEBA 1GT8A 1DGJA 5JH5C 3PRZA 3ZDTA 4W9GA 2KDBA 2QIEB 1UZXB 3ZXRA 1N6ZA 1ZXHA 5BMGA 4C80A 2JUOA 1SE4A 4ZRJA 4ZYNA 2K39A 2RR9A 2JX5A 3PTFC 5IAAC 2MEKA 2Y3AA 1D5XC 2ZNVB 4ANVA 3DBHB 3ZXVA 5AZFA 4F1SA 3APFA 4OVUA 2IO2B 5LNK1 3SD5A 1RWSA 2BYFA 3GS2A 1N5WA 1QZEA 4WJOA 1V1PB 1NENB 3QIJA 1SXTA 1YNTE 3RMKC 2ZNVC 4OW0A 1WGHA 3VXWA 1L0YB 4FJVB 2FIDA 4M00A 1OQQA 1IYFA 2INDC 2JPHA 4W9IA 2BVCA 2LGIA 4J3OD 2MJEA 4N59A 2ZCCA 1D5ZC 3PV1A 1U4AA 1I42A 2FCNA 5FR6A 4S17A 1EO6A 3CSTA 4CYEA 3PT2B 1JQ4A 1FCCC 1V6EA 3MTNB 4IWQA 4II2B 3HUIA 3H9DA 3B08A 2D3BA 2IJ0A 1KLUD 5IN7A 3PVLA 2ZW1A 1SB3C 2GBMA 4JIOU 4MGZE 2OEDA 1BT0A 2OOBB 1IBXB 1GB1A 2IY1B 4ZHPA 3MHSD 4DQOC 1E8ZA 2KWVB 2N9PC 1VD2A 1HEZE 4HCPB 2XK5A 2WXLA 4FN2A 3ZLZA 4BKSA 2V3NA 4TQ0A 1VDVA 3DHIC 3PGEA 3V6CB 4GIVA 1WI0A 3CIRB 2KJ6A 1C3TA 3N9YC 3ABVB 4EZLA 3ZNHB 1MVKA 1FFVA 4GSWA 2L32A 5LXIB 2LMCA 2KXJA 2CJOA 3DVGX 1C79A 1KJTA 1L5PA 3URYA 3WAMA 2OHFA 3AH7A 4REZA 4LLGM 2WDRB 2CHWA 3MC8A 5DPTA 1S1QB 1FRDA 4DDID 1KLVA 1K53A 2V4LA 1XQQA 3U4EG 5D3IB 3AXCA 1ZKHA 3MJ5A 2MBBB 1WGYA 2QJLA 1JROA 5HKHA 1NBFC 1B1ZA 4ICVA 2JZ3B 3Q2AC 5HI1A 4P6VF 2MH7A 1YQBA 3NS8A 3IFWB 3ZQ4A 3DOWA 3HHMA 4LJOB 5D7GA 3WAPA 1FM0D 1F1HA 2FCQA 2KWCA 1TKYA 3ZVVA 3L4PA 3ZJUA 5J17A 1P9DU 1KF6B 1V49A 2RPVA 2FCSA 3ZDMC 3TEYA 1RFKA 1XD3B 1YOVB 2VH1A 4FADA 4C4VA 2JVCA 5AZGA 3ETRA 3RD2A 1QILA 3V61A 2UU7A 3LDZE 3RZFA 4HDQA 2V3PA 3L17A 2D07B 4YTPB 4XDCA 2J42A 4M0WA 2M4NA 1D4BA 5DPRA 3R8BA 1P3QU 4P7IA 3ZYYX 2JRIB 1NDDA 2KFKA 3TCAA 3VTVA 3I9V1 3RULA 4AWJA 3L08A 2WXPA 4AOFA 3NY5A 2CHXA 2QEJC 3IAM1 3AEAB 4A3OA 2WXQA 3AM9A 2GB1A 1WJ4A 2YLMA 4WURA 2KJHB 2NS5A 1XT9B 3MFGA 1RYJA 4URKA 1GPXA 3DVNV 2K9XA 4C00A 3PSEB 2FBWB 4IM0A 1WXAA 4UDUC 2WGSA 4AQ7A 4MEMA 4KVGB 2M0XA 2WXHA 4FJYA 3QAQA 2C9WB 1A5RA 3V6EB 1L4DB 2N9LA 3W1YA 4W9DA 3PRMB 3W9CB 4RF0A 2KK8A 3DHHC 2PVGC 2QHOA 1NI3A 2BGFA 1JWUD 4I6LB 4C4VB 2KO3A 1NEKB 2WXFA 1E10A 3CSFA 5G5GA 3PO0A 4CHKA 4EKUA 2NTTA 1SF0A 1YQ4B 1GTHA 3TIXA 3P42A 1P1AA 4LCDE 3ZIMA 4J6IA 1EU3A 2RPQA 1KFYB 2CHZA 2MP2B 3W1SA 4K7WA 2KJRA 4A55A 2OJWA 4ARIA 3I63C 3QWZB 1V9JA 3OLMD 5FK9C 3N3KB 4F8CB 2K8BA 1FXTB 3DBRB 3H8HA 1GG3A 4GDLB 2JT4B 3UIOB 4FHKA 1WM3A 3GB1A 4L23A 2XBBC 1DOIA 1J7CA 1YX5B 3VDZA 3CMMB 1MG4A 1WYGA 2K0PA 1V1PA 3NVVA 2E6XA 5IOIA 1IGDA 1M4VA 2DYBA 3R3MA 2DZJA 4JX1C 2WP9B 1ZDXA 2TSSA 3SFEB 3QC8B 4LNKA 4GDLA 3U30A 4KX6B 2PE9A 3VUYA 2DHZA 4YTNB 5DPSA 3A1QA 2LHDA 3O13A 3MC9A 2KTFA 2J0JA 4KGTA 2K8CA 2X8XX 3IT6B 3AI5A 2BT6A 3NUHB 2QC8A 1E8WA 4PS3A 2C7HA 3VR9B 4ZYSA 3PZ8A 1L6VA 4W9EA 1GB4A 2M17A 3EGRA 3DWMA 3JVZX 5IP4D 3W2DA 1LXDA 4NJ7A 2BW2A 1SJED 1J0GA 2INNE 4G0NB 3HRDD 1LGRA 2BYVE 2KVZA 4W9LA 2J53A 1WR1A 2HDEA
chains in the Genus database with same CATH topology
1UGJA 3EA6A 2IDYA 1I4PA 1FNUA 2JU6X 3AEGB 4HKQA 2IGDA 1H7WA 2WQYB 1JWAD 1L6UA 3NZ3A 1CK1A 1D5MC 1WXQA 1WGKA 1JMLA 2BS2B 1XEEA 2ONQA 3U7ZA 1JCKB 1ET9A 1WSPA 4MT5A 2YEPB 4L2YA 4RH6A 1YN5A 2PKOA 4WAFA 1EM7A 2W54A 1V97A 1JW9D 1TY0A 3Q69A 2KN4A 4Q2JA 2D5GA 1FXAA 2Y5PA 2BB6A 1MI0A 1QOFA 1CJEA 2BB5A 1ZXIA 1SEBD 3TEXA 2WXKA 2HTME 2NTSA 4PT5A 3SR6A 1I4XA 1ZUD2 4WWMA 2EELA 2WXJA 1SE2A 3SEBA 1GT8A 2FUG1 2KQ4X 1DGJA 3BYTB 5D3DA 3AEBB 2RMMA 1NYQA 1QOGA 1ESFA 1JWBD 1TS3A 2QIEB 4IDIA 1VR9A 1NVID 2BYTA 3B2GA 1ZXHA 1VZ8A 2K3UA 3DWGC 4US8A 5BMGA 4C80A 1SE4A 1K52A 1MPEA 1XLQA 3WCQA 3P1MA 5BYQA 1PGAA 1N5XA 2BTEA 2JX5A 3KWVA 3KQ4A 4NZLB 1AWDA 2MEKA 2I2YA 4R3DA 2Y3AA 2PIAA 1P7FA 1D5XC 2H88B 1BXTA 3NS1A 2IGGA 2DYOA 1I4QA 2KACA 3BVGA 1FCLA 2JYTA 5LNK1 1EWCA 1WRIA 2ON8A 1MHHE 3KWLA 3P4RB 4GDKB 1RWSA 2MJ3A 1XXGA 3Q8AA 4ZRQA 3GS2A 1K51A 1N5WA 2X38A 1V1PB 1NENB 2BBCA 3P4SB 1N63A 1SXTA 1TYGB 1YNTE 2DYMA 3U52E 1UWMA 1QLBB 2VZKD 3AE1B 1PGXA 3P63A 4OW0A 5H8YE 1L0YB 3AV8A 1V1OA 1WWTA 1OQQA 4DXGA 3TEWA 2LGIA 4J3OD 2MJEA 4MACA 2R61A 1UWXA 4N59A 1D5ZC 1PYWD 3AE8B 2NMQA 3AEFB 5AUKA 3NVYA 4KGSA 2ACZB 4XWTA 4YTMB 2QILA 1FCCC 1JQ4A 3V3XA 3C8YA 1DYQA 5H92C 1R7SA 2DLBA 3IAS1 3NVZA 4NAMA 4YSZB 3HUIA 1VZ7A 5BYRA 4A8XC 3AECB 2IJ0A 4OVZA 1KLUD 4IKGA 1PGBA 2ZW1A 1SB3C 2G1EA 2OEDA 3IT4B 2GI9A 2XNAC 3V05A 3TUOA 3P4PB 1NYRA 2WU5B 3B9JA 1IBXB 1KH0A 1GB1A 5AUIA 1DOYA 1ZPSA 5T8IA 5BMIA 5HFYA 4ZHPA 2WXMA 4DQOC 4JPSA 4JE3B 1FIQA 3PZ7A 4NAWB 5GXGB 4D2KA 3HVDA 4A9AA 4XDDA 4ZRPA 1YJJA 1HEZE 1ROEA 2KDMA 1A70A 1D6EC 1L4ZB 4YT0B 1QQRA 1FEHA 2CU3A 4OHJA 2JWUA 3W5UB 2WXLA 2PLPA 3LYYA 1FO4A 2V3NA 4TQ0A 2ICIA 1VDVA 4RGOS 4EE2A 3MC0B 1OFFA 4YXDB 1F2RI 2KAJA 3CF4A 1TZOA 1DOXA 5BYSA 3R2TA 1J7AA 3CIRB 1L0XB 2RDGA 3ZGZA 2JXTA 3HVZA 3N9YC 5C3JB 1T6BX 5FR3A 4ITKA 1Q10A 3EUB2 1YQ3B 3ABVB 4OZBA 1MVKA 3U2SC 1L0VB 4OZAA 1FFVA 1J7BA 2L32A 2EKIA 1HQRD 2LMCA 2E3TA 1XCQL 4RNAA 2CJOA 4N58A 1N61A 1C79A 2WNMA 4KGRA 2N9KA 4MM3B 1L5PA 3URYA 5EE0A 3IXSA 4HROA 4N6EB 2OHFA 3AH7A 2BS4B 2AQ2B 4REZA 3BVZA 4LLGM 2WDRB 1E0ZA 3BIID 1JALA 2AQ3B 4DXFA 2DWQA 4H2AA 1F2RC 1FRDA 1I4GA 1TKEA 3UI3A 1C78A 4AS1A 2B76B 1K53A 1FD6A 1ZP0B 2WXNA 2VZKB 3U4EG 1E6EB 1I7HA 5D3IB 2W82A 1HA5A 1T5XD 1ZE3D 1JWSD 2KWDA 2PVOD 3KLSX 4YWGG 3MJ5A 5G5HA 4RFBA 1XLNA 2L1AA 4WH4A 4KKJA 2QJLA 2IGHA 1JROA 1QOBA 2PMVA 1QF6A 3MP9A 2WDVB 5EE3A 1B1ZA 4XE0A 5HI1A 4P6VF 2MH7A 1Y56A 4C7ZA 1ENFA 1JRPA 3RPFC 2INPE 3ZQ4A 2WXOA 2M56B 4TSSA 1HZ6A 3NRZA 5D7GA 1FNWA 1FM0D 1XF5L 1MHXA 3W5VB 1TKYA 1IUEA 4MH8A 1JWMD 2ZW0A 1C4PA 3L4PA 3AE6B 2V4IB 3ZJUA 3AB5A 3B2FA 4WQMA 1KF6B 4USAA 2JYEA 2RPVA 1ACCA 5HHDG 2M19A 3E56A 3TEYA 1E9MA 1RFKA 3J9CA 4ZOHC 4LTUA 2AX5A 2LJIA 3FC4A 3ETRA 3I57A 3LXFA 1QILA 3TSSA 1KTKA 2N7JA 2WS3B 4XWWA 3GP7A 4NJCA 2WXGA 1K50A 1VJKA 2V3PA 2SEBD 2WLBA 1BUIC 4YTPB 4XDCA 3BZDB 3E9SA 4LK0M 2PW9A 2J42A 1VLBA 2Q5WD 1YMHE 4M0WA 1BMLC 1PDXA 1D4BA 5C2TB 3R8BA 2W3SA 3RFZB 1PFDA 3VRBB 3ZJVA 1QT9A 1CQVA 1QOAA 3LB8C 2AQ1B 3ZYYX 2Z8LA 4HJGE 2L83A 1OQRA 1YJIA 1XLOA 3I9V1 2QSDA 3Q8FA 4YSXB 2WXPA 2QEJC 3IAM1 1FXIA 3AEAB 4RGNA 1HXYD 2WXQA 3AM9A 2GB1A 2I38A 3FILA 3BK1A 3NVWA 4WURA 1IGCA 2LUMA 3MFGA 4TQ1A 1RYJA 3R2IA 3AE4B 1TY2A 1GPXA 1AW7A 2K9XA 4GLSC 1VZ6A 2FE8A 1V8CA 2FBWB 2M0AA 4UDUC 3AMZA 2WU2B 4AQ7A 5TSSA 4CQNA 1XLPA 3VR8B 3TEZA 2Y5CA 1C4CA 1KRHA 1ZDVA 2WXHA 1I4RA 2V0GA 3BVMA 1HZ5A 2GRIA 1L4DB 1FNVA 4JWSC 2PTLA 2N9LA 1F77A 3AN1A 4B0EA 3W9CB 3FILB 4RCOA 3AEDB 3AEEB 4RF0A 2WDQB 1EWYC 3MHZA 2PVGC 1E7PB 1KLGD 1NI3A 2W3RA 1N60A 1SBBB 1JWUD 4RF1A 4YSYB 4HKZE 1NEKB 1TS2A 2WXFA 4O1NA 1TS4A 1E10A 4RGMA 5G5GA 1TS5A 3PO0A 3T3NA 2NTTA 1FFUA 4HRSA 1SF0A 1XCTL 5EE9A 2WXRA 1YQ4B 1GTHA 1H7XA 3P42A 1EU4A 4RGTA 1I4HA 1QKZA 2LFIA 1B9RA 1C4AA 2QMTA 1EU3A 1FMAD 1CZPA 2N0SB 1KFYB 3W1SA 1LO5D 4JWUC 2W55A 2JQRB 4A55A 5HG2A 1F0ZA 1AYFA 1STEA 4ARIA 4A90A 1SIJA 3BWUD 1C76A 1SSNA 4P16A 2K22A 3ZJTA 5FK9C 1GOZA 3AE9B 3CWIA 2G9HD 2JSVX 1FRRA 4B0MA 3H8HA 4GDLB 2J4XA 2J52A 1C9FA 1P7EA 1RM6C 3OWEB 1VRAB 1ZOYB 3GB1A 1SJHD 4L23A 1DOIA 1J7CA 3VQIA 3AE5B 2SAKA 2LEKA 2JZPA 1WYGA 2K0PA 4KKIA 1V1PA 3Q8CA 1IBXA 1TKGA 1YN3A 2E6XA 3NVVA 1IGDA 1M4VA 4JX1C 1YN4A 3T3OA 2WP9B 1ZDXA 3SFDB 1UNSA 1SE3A 2TSSA 1T3QA 3SFEB 2MJDA 4HEA1 1C77A 3VRAB 2IPKD 5BMHA 4C56C 5I4DA 4KX6B 3FAHA 4OZCA 4TMAB 4A6QA 4YTNB 2LHDA 3Q8BA 4FXCA 2H89B 1ET6A 3O13A 3P4QB 1TJEA 2L52A 4KGTA 2LHEA 2XN9C 1N62A 2BS3B 3IT6B 3AE7B 4L1BA 4ZHOA 2BT6A 3NUHB 5MPOA 2RDHA 1PUTA 2DBYA 1AN8A 5E6JA 3VR9B 4ZYSA 3PZ8A 1XO3A 5EE1A 1UUPA 4US9A 5JXVA 3AE3B 1L6VA 4C7YA 5FKAC 1GB4A 4IOIE 3BYYB 3EGRA 2YEPF 3DWMA 1GAQB 3BK2A 3W2DA 4ARCA 2BW2A 3AE2B 1SJED 2CJNA 4WIPA 3Q8EA 2KMMA 2INNE 2WXIA 3HRDD 1GTEA 2J53A 2HDEA 2K5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE8 B;  2PVO D;  3AEF B;  4JWS C;  5G5H A;  3AEG B;  1XLN A;  5AUK A;  3NVY A;  2ACZ B;  1H7W A;  2WQY B;  2QJL A;  1JWA D;  1JRO A;  1L6U A;  4YTM B;  1QOB A;  3AN1 A;  3W9C B;  1QF6 A;  1JQ4 A;  2WDV B;  3AED B;  3AEE B;  1WXQ A;  5H92 C;  2WDQ B;  1EWY C;  2BS2 B;  1R7S A;  1WGK A;  2PVG C;  5EE3 A;  3NVZ A;  1E7P B;  4YSZ B;  1NI3 A;  2W3R A;  3HUI A;  1N60 A;  2MH7 A;  4P6V F;  4YSY B;  1NEK B;  3AEC B;  1E10 A;  4C7Z A;  2PKO A;  1JRP A;  2W54 A;  3RPF C;  1V97 A;  1JW9 D;  3PO0 A;  5G5G A;  1SB3 C;  1FFU A;  2M56 B;  4HRS A;  1SF0 A;  5EE9 A;  2G1E A;  3NRZ A;  1YQ4 B;  1GTH A;  1H7X A;  1FM0 D;  1FXA A;  3P4P B;  3W5V B;  1B9R A;  1TKY A;  1IUE A;  1QOF A;  1FMA D;  1CZP A;  1CJE A;  2N0S B;  1NYR A;  1KFY B;  2WU5 B;  3AE6 B;  1ZXI A;  3B9J A;  2W55 A;  3L4P A;  3AB5 A;  4JWU C;  2JQR B;  5AUI A;  1DOY A;  2HTM E;  3B2F A;  1F0Z A;  4WQM A;  3SR6 A;  1KF6 B;  1AYF A;  4USA A;  1ZUD 2;  4WWM A;  4ZHP A;  1SIJ A;  1GT8 A;  2K22 A;  2M19 A;  1E9M A;  1DGJ A;  1RFK A;  4ZOH C;  3AE9 B;  3CWI A;  3AEB B;  4LTU A;  1FRR A;  1NYQ A;  1QOG A;  1FIQ A;  1JWB D;  2QIE B;  2AX5 A;  5GXG B;  3FC4 A;  4IDI A;  4A9A A;  3ETR A;  3LXF A;  1NVI D;  3B2G A;  1YJJ A;  2WS3 B;  1ROE A;  1A70 A;  1RM6 C;  3DWG C;  4US8 A;  1ZOY B;  4C80 A;  4YT0 B;  1VJK A;  2WLB A;  1DOI A;  4YTP B;  1J7C A;  2CU3 A;  3W5U B;  3AE5 B;  2LEK A;  1XLQ A;  3WCQ A;  1WYG A;  1VLB A;  2Q5W D;  3P1M A;  1FO4 A;  1TKG A;  3NVV A;  1PDX A;  5C2T B;  1VDV A;  1N5X A;  2W3S A;  1PFD A;  3VRB B;  2JX5 A;  1QT9 A;  4JX1 C;  1QOA A;  1OFF A;  2WP9 B;  4YXD B;  3LB8 C;  3ZYY X;  2KAJ A;  3SFD B;  3CF4 A;  2L83 A;  1AWD A;  1OQR A;  1T3Q A;  1DOX A;  3SFE B;  2MJD A;  1YJI A;  1J7A A;  3CIR B;  3VRA B;  1XLO A;  2PIA A;  3HVZ A;  5C3J B;  4KX6 B;  4YSX B;  3FAH A;  4ITK A;  2H88 B;  4YTN B;  1FXI A;  3NS1 A;  3AEA B;  3EUB 2;  1YQ3 B;  4FXC A;  3ABV B;  2H89 B;  3AM9 A;  1L0V B;  1FFV A;  1J7B A;  3P4Q B;  3NVW A;  1TJE A;  2L52 A;  2EKI A;  1WRI A;  3KWL A;  3P4R B;  2E3T A;  1RWS A;  2CJO A;  1RYJ A;  1N61 A;  2BS3 B;  1N62 A;  2MJ3 A;  4N58 A;  3AE4 B;  1GPX A;  3AE7 B;  1N5W A;  1L5P A;  2BT6 A;  4ZHO A;  5EE0 A;  4HRO A;  5MPO A;  2K9X A;  1NEN B;  4N6E B;  1PUT A;  2DBY A;  2OHF A;  2BS4 B;  3P4S B;  1N63 A;  1V8C A;  3AH7 A;  2WDR B;  3VR9 B;  1TYG B;  1E0Z A;  1XO3 A;  5EE1 A;  2FBW B;  3BII D;  1JAL A;  4US9 A;  3AE3 B;  1L6V A;  1UWM A;  4C7Y A;  1QLB B;  2DWQ A;  3DWM A;  1GAQ B;  3AMZ A;  2WU2 B;  3AE1 B;  1FRD A;  3P63 A;  5H8Y E;  1TKE A;  3AE2 B;  3AV8 A;  1XLP A;  2B76 B;  2CJN A;  3VR8 B;  1WWT A;  1OQQ A;  2Y5C A;  1ZP0 B;  1KRH A;  2KMM A;  3HRD D;  1GTE A;  2MJE A;  1E6E B;  4N59 A;  1I7H A;  2K5P A; 
#chains in the Genus database with same CATH topology
 4NJ6 A;  2BPS A;  4HKQ A;  2IGD A;  1H7W A;  4M02 A;  3H7S A;  1IP9 A;  3Q3F A;  2K25 A;  1JCK B;  1WSP A;  1TGZ B;  4L2Y A;  1YN5 A;  2LGD A;  2DZK A;  3N1X C;  1MI0 A;  1CJE A;  1YD8 U;  2D3C A;  2NTS A;  4OVV A;  1I4X A;  4HPL B;  4WWM A;  2EEL A;  5E6N A;  4EEW A;  3PS6 A;  2WX1 A;  2RMM A;  1R4M I;  2KYW A;  1QOG A;  3PZD A;  1VZ8 A;  4KZ0 A;  1K52 A;  3P2B A;  4M8M A;  1XLQ A;  4W9K A;  3P1M A;  5BYQ A;  4A3P A;  1N5X A;  1RRB A;  3B1L X;  2PEA A;  3B0A A;  1WGR A;  4R3D A;  1P7F A;  1BXT A;  3VUX A;  2DYO A;  1FPY A;  2G45 B;  2B3A A;  1EWC A;  4G11 A;  1MHH E;  4GDK B;  3DVG Y;  4ZRQ A;  2R2Q A;  2BWE S;  1VCB A;  2BBC A;  4DWF A;  2KX0 A;  1N63 A;  1TYG B;  2DYM A;  4P1B C;  2BWF A;  5DCN A;  3DQV A;  3U52 E;  1UWM A;  1PGX A;  4HWI B;  2MHJ A;  3AV8 A;  3SHQ A;  4DXG A;  4EFO A;  1UWX A;  4PS7 A;  5D94 A;  1PYW D;  3FKY A;  3ZKJ C;  4XWT A;  1WX7 A;  3M62 B;  2DLB A;  2N1V A;  2LWP A;  2KFJ A;  2KQ7 A;  4A8X C;  4OVZ A;  1IPG A;  4IKG A;  2G1E A;  2XNA C;  2J0K A;  2D2Q A;  3TUO A;  4X57 B;  2KZR A;  4BBN C;  2WU5 B;  1ZPS A;  5T8I A;  2WHI A;  5BMI A;  4BKS D;  1WJU A;  4JPS A;  3EFC A;  1WJN A;  2PPH A;  4JE3 B;  2KWU B;  3L54 A;  3PZ7 A;  4NAW B;  5GXG B;  3M63 B;  4F7Z A;  3HVD A;  1J19 A;  4A9A A;  4ZRP A;  4JQW C;  2REX A;  2CU3 A;  5GMV A;  1FO4 A;  4NPN A;  2ICI A;  5L95 C;  3L13 A;  4RGO S;  3QA8 A;  1OFF A;  3WAL A;  3Q3M C;  3R2T A;  3UQB A;  1J7A A;  1L0X B;  3ZGZ A;  3HVZ A;  3AU5 A;  1T6B X;  2I1J A;  2K6Q A;  4ITK A;  5FR3 A;  1Q10 A;  5C23 A;  5DPW A;  3EUB 2;  1GC7 A;  3U2S C;  1L0V B;  3UF8 A;  1J7B A;  1HQR D;  2PE6 B;  2LVO A;  1T0Q C;  3NZS A;  1XCQ L;  5KHO A;  1N61 A;  1WZ3 A;  4KGR A;  5CX3 A;  3HIZ A;  3DHG C;  3W1S C;  2CR5 A;  2KQS A;  3JSV B;  4BKT A;  2BS4 B;  4BOZ B;  1JAL A;  2KMC A;  1TZ1 A;  3ZW3 A;  1WY8 A;  4MM3 A;  1I4G A;  1TKE A;  1C78 A;  1ZP0 B;  2ZCB A;  2WWZ A;  2VZK B;  4RM8 A;  1I7H A;  2W82 A;  2MP2 A;  1T5X D;  2AWT A;  1JWS D;  3KYD D;  5TR5 A;  2PVO D;  4YWG G;  1KM7 A;  3TBL D;  2L1A A;  2PMV A;  2IO0 B;  3MP9 A;  3PHW B;  4W9F A;  4AJY B;  5EE3 A;  4NAW A;  4BZA A;  1Y56 A;  3RPF C;  2IO3 B;  2QCZ A;  3A9J B;  2O6V A;  1JWM D;  3Q3J A;  3AB5 A;  3C19 A;  4XGA B;  4WQM A;  3IVF A;  3RN9 C;  1EF5 A;  1UF0 A;  4PS8 A;  2GBN A;  1JRU A;  3I57 A;  4M0W B;  1KTK A;  3HK0 A;  1UH6 A;  4NJC A;  4EOY A;  1K50 A;  1VJK A;  2JRH A;  2KT7 A;  2KHW B;  4PYU A;  2LGY A;  2PW9 A;  4MSM B;  2KLG A;  1YMH E;  1PDX A;  5KHQ A;  2W3S A;  4P1C C;  4WAA A;  1H8C A;  5IKC M;  4HJG E;  1YJI A;  2GBR A;  3APC A;  4YSX B;  2Z59 B;  1FXI A;  4BOS C;  1LQB A;  1Z5S B;  4W9J A;  3ML8 A;  3NVW A;  1IGC A;  1M94 A;  2LUM A;  3ZTD A;  4GU2 A;  2N9X A;  2LVP A;  4MJS B;  3DVN U;  3VFK A;  3ECI A;  3RNC C;  4DDG D;  2MWS B;  2GMI C;  1UD7 A;  3RT3 B;  1SGH A;  4CQN A;  4FJZ A;  1ZDV A;  4WJN A;  2HJ8 A;  1HZ5 A;  2LUE A;  1OTR B;  4JWS C;  2PTL A;  4WJP A;  2DZM A;  1F77 A;  4RCO A;  3AED B;  3MHZ A;  3PPA A;  1RFA A;  1KLG D;  1V80 A;  2NCN A;  2W3R A;  1N60 A;  4RF1 A;  2CKH B;  1TS2 A;  3KH0 A;  4RGM A;  3T3N A;  1TS5 A;  2DX5 B;  2MBH A;  5CHV C;  1B9R A;  2HD5 B;  2BKR B;  2QMT A;  1F52 A;  4JWU C;  1UEL A;  2JQR B;  1WXV A;  1STE A;  2L7R A;  3BWU D;  4CO7 A;  4P16 A;  2K22 A;  2JSV X;  3HM3 A;  2KVR A;  2UWQ A;  2GOW A;  3D32 A;  5JZE B;  1RM6 C;  1Y8R C;  3QJZ A;  1SJH D;  2G4S A;  2JZP A;  1TKG A;  2IZV B;  3I5J C;  3QK0 A;  3T3O A;  1E7U A;  2MJD A;  4HEA 1;  3BY4 B;  3VRA B;  3PRP B;  5BMH A;  2KDI A;  2EMS A;  4TMA B;  3VUW A;  2H89 B;  1RLF A;  1TJE A;  5L83 A;  2IO1 B;  1N62 A;  3AE7 B;  1T0Y A;  4L1B A;  4ZHO A;  5MPO A;  1AN8 A;  4TKN A;  4WWO A;  1PQS A;  5EE1 A;  3BK2 A;  4ARC A;  2CJN A;  4WIP A;  1MG8 A;  1WH3 A;  3HM6 X;  4GGQ A;  4B9K A;  2N9E B;  3EA6 A;  1LM8 B;  1TBE A;  4IM3 A;  1D3Z A;  3DPD A;  1RAX A;  2BS2 B;  2ONQ A;  3U7Z A;  2YEP B;  2VRR B;  2M8S A;  1HTO A;  1C1Y B;  4RH6 A;  1V97 A;  2WX0 A;  1TY0 A;  4XYC A;  4ZRI A;  4HDO A;  1P98 A;  2HE7 A;  3TJP A;  2N7E A;  4K1R B;  3RNB C;  2KNB A;  1ZXI A;  2WXK A;  1ZUD 2;  5D2M B;  2JF5 A;  2FUG 1;  2L3Z A;  2KQ4 X;  3AEB B;  1NYQ A;  1ESF A;  2O2V B;  4IDI A;  1VR9 A;  1NVI D;  2K3U A;  4US8 A;  1ISN A;  2JZZ A;  3JSV A;  3WCQ A;  3ML9 A;  4HLE A;  4HCN B;  4JL9 A;  3KQ4 A;  4NZL B;  4RM9 A;  3DBH I;  1AWD A;  2KLC A;  2PIA A;  2H88 B;  3EC8 A;  1I4Q A;  2JYT A;  2ON8 A;  3KWL A;  3P4R B;  2BF8 B;  4K81 A;  3Q8A A;  2EMT A;  2A5U A;  2X38 A;  2GBJ A;  3P4S B;  4MDK E;  3SDL C;  1AAR A;  3OAW A;  2VZK D;  3AE1 B;  3P63 A;  4IG7 B;  3RNG C;  4IC7 B;  1V1O A;  1WWT A;  1WJ6 A;  3NJT A;  4MAC A;  2R61 A;  4RMA A;  3AE8 B;  1L7Y A;  4I6P A;  4S0R A;  3V3X A;  1P0R A;  1DYQ A;  1R7S A;  3NVZ A;  4NAM A;  4GDK A;  4LDT D;  4BAX A;  3AEC B;  4GMV A;  1GC6 A;  3RCZ A;  1PGB A;  2N1W A;  4I6N B;  3RNA C;  4WQO B;  3N20 C;  4DHJ D;  1G6J A;  1HTQ A;  2NVU I;  2LRW A;  1KH0 A;  5AUI A;  4AP4 C;  3EEC A;  2QDF A;  5HFY A;  4EZK A;  4K3C A;  3TL5 A;  3U8Z A;  4D2K A;  1WXS A;  2KDE B;  4XDD A;  1ROE A;  2KDM A;  1D6E C;  1L4Z B;  4YT0 B;  4OHJ A;  2MX2 A;  3W5U B;  3M95 A;  3LYY A;  4GXB A;  3V62 A;  1WFY A;  3KUD B;  1MFW A;  3MC0 B;  2J0M A;  3H6N A;  3VH3 B;  3ZO5 B;  1TZO A;  1I35 A;  2ZJD A;  4KSL C;  5JHA A;  4MEL A;  3A33 B;  3PRE A;  1MJD A;  4OZB A;  4JLC A;  4OZA A;  2WDT B;  2ZPN A;  4RNA A;  4N58 A;  4ZDV A;  2N9K A;  5EE0 A;  3IXS A;  4HRO A;  4N6E B;  4NQK E;  1OEY J;  2AQ2 B;  1WF9 A;  3L16 A;  1SE9 A;  2AQ3 B;  4DXF A;  4AJW A;  1F2R C;  1V81 A;  3M3J A;  3VTU A;  3UI3 A;  4AS1 A;  3RYT A;  2WXN A;  3WIM A;  1E6E B;  2O6V D;  4BFR A;  3R7Q A;  1K8R B;  5G5H A;  4RFB A;  4K7U A;  2AL6 A;  3SU8 X;  1QF6 A;  4MJS A;  3QHT A;  4IWO A;  4LNF A;  3MJW A;  4K3B A;  3X0W A;  1R4N I;  2LJ5 A;  2NBU A;  3OG5 A;  3IBE A;  3UIP B;  4C7Z A;  1ENF A;  1JRP A;  2INP E;  2WXO A;  2R2O A;  2L05 A;  3NRZ A;  1FNW A;  4B6W A;  2D3A A;  1C4P A;  3DBL B;  3AE6 B;  2V4I B;  2ZVN A;  5HHD G;  2VH2 A;  3E56 A;  1E9M A;  3J9C A;  2KX3 A;  4FLH A;  3FC4 A;  1J8C A;  3LXF A;  2WS3 B;  4KDL B;  1OQY A;  3GP7 A;  4B95 A;  2SEB D;  1BUI C;  1S3S G;  3BZD B;  3E9S A;  3GZN B;  1VLB A;  2V9H A;  1BML C;  3RFZ B;  1PFD A;  3VRB B;  3LB8 C;  4LJP B;  3ZNZ B;  2Z8L A;  2L83 A;  2IBI B;  1OQR A;  2MSE D;  1LFD A;  1KOT A;  2LVQ A;  2QSD A;  3Q8F A;  4TUU A;  4GB9 A;  4RGN A;  2RD0 A;  2KTR A;  1ZW7 A;  2I38 A;  3FIL A;  3BK1 A;  4PYZ A;  4TQ1 A;  3DCG A;  3AE4 B;  1TY2 A;  2C5L C;  2FE8 A;  1WX8 A;  4XZ4 A;  4HVB A;  3AMZ A;  2WU2 B;  2DNF A;  2D10 A;  3TEZ A;  2KN5 A;  2V0G A;  2GRI A;  2BQQ A;  2KMA A;  1EF1 A;  1WE7 A;  3L10 B;  3A4S C;  4B0E A;  3FIL B;  3AEE B;  5G55 A;  2WDQ B;  1EWY C;  2CS4 A;  3KUZ A;  2MCN B;  3AU4 A;  3T9L A;  1SBB B;  2ZVO A;  4YSY B;  4HKZ E;  5E6O A;  3N30 A;  4HJK A;  1FFU A;  5EE9 A;  2GLS A;  1H7X A;  1EU4 A;  4RGT A;  3R66 C;  1I4H A;  2A4Z A;  1C4A A;  5IO9 A;  1CZP A;  5AZH A;  2KAN A;  1LO5 D;  2W55 A;  1R4M B;  5HG2 A;  1F0Z A;  3QQ8 B;  2L00 B;  2N4F A;  3C0R B;  1SIJ A;  1SSN A;  4M01 A;  3ZJT A;  3AE9 B;  3CWI A;  1HE8 A;  2LXC A;  4GN1 A;  2DAJ A;  1FRR A;  4B0M A;  3LJ3 A;  3DBL I;  1UBQ A;  2J52 A;  4G3X B;  3ZNI D;  1YIW A;  1TT5 B;  3OWE B;  1VRA B;  1ZOY B;  2C7M B;  3OJ4 B;  1WRD B;  3VQI A;  2LEK A;  4KKI A;  1IBX A;  1CMX B;  1YN3 A;  4DBG A;  2LXA A;  2RGF A;  2Y5B B;  1YN4 A;  1UNS A;  4KV2 A;  1C77 A;  2NPT B;  3FAH A;  3GZN I;  4OZC A;  5LXH A;  3P4Q B;  3VVW B;  2L52 A;  3GOE A;  2LHE A;  2XK5 B;  2BS3 B;  5CHW A;  3I3T B;  4E3C A;  1WGD A;  1PUT A;  3L0W B;  5JXV A;  4FHJ A;  1GNU A;  3A9K B;  4W9H A;  4IOI E;  2YEP F;  2J7Q B;  1GAQ B;  2FUH B;  3JW0 X;  3AE2 B;  2KMM A;  1GTE A;  4BKG A;  1UGJ A;  4LNO A;  3UIN B;  2JU6 X;  3AEG B;  2WQY B;  1JWA D;  2FAZ A;  2GBK A;  3NZ3 A;  3VH4 B;  4K7S A;  4MGY E;  1D5M C;  1WXQ A;  1JML A;  1XEE A;  5JHB A;  4ASW C;  3R7R A;  2D3G A;  4G50 A;  2MW5 A;  4KSK C;  2PKO A;  3N32 A;  1JW9 D;  1E8Y A;  2KN4 A;  4HXD A;  4Q2J A;  2D5G A;  4EUT A;  1FXA A;  3DBS A;  4NQL B;  3QX1 A;  2Y5P A;  1QOF A;  2BB6 A;  2L0T A;  1SEB D;  1WIA A;  3N1Y C;  3TEX A;  1V2Y A;  3RUI B;  2WXJ A;  3VAW A;  3BYT B;  5D3D A;  2V1Y A;  3O65 B;  2NPT A;  4KZC A;  4N9F 4;  1YX6 B;  1TTN A;  1WGG A;  1JWB D;  1TS3 A;  3WAO A;  4IM2 A;  2BYT A;  3B2G A;  3DWG C;  4ICU A;  4IUM B;  2M1M A;  3CF6 E;  3PHX B;  2I1K A;  4XC2 A;  3WAN A;  1MPE A;  4ANX A;  2MRP A;  1PGA A;  3UQA A;  2O6V B;  2BTE A;  3KWV A;  2KC1 A;  2RSU A;  5J2R A;  2I2Y A;  1E8X A;  3NG0 A;  3Q3N C;  2W9N A;  4XX5 A;  3WA0 A;  3NS1 A;  2IGG A;  2KAC A;  3BVG A;  1WMH A;  1UGM A;  1FCL A;  2ASQ A;  2JXX A;  1NI2 A;  4LNN A;  1WRI A;  2D11 A;  2MJ3 A;  1XXG A;  2C7N B;  5E6P A;  1K51 A;  4ANU A;  1V5O A;  4E74 A;  4LNI A;  5LLI A;  2MBE A;  3VHT C;  1QLB B;  2KFK B;  5H8Y E;  3A9J A;  4DHZ E;  2LRU A;  3TEW A;  4DK5 A;  4KIK B;  4BVU C;  1Q5W B;  2KC2 A;  2NMQ A;  3AEF B;  5AUK A;  3NVY A;  4KGS A;  2ACZ B;  4YTM B;  2QIL A;  3C8Y A;  5H92 C;  3IAS 1;  4YSZ B;  2FNJ B;  1VZ7 A;  5BYR A;  2BKF A;  3IT4 B;  2GI9 A;  3V05 A;  3JYU A;  3P4P B;  2LAS A;  3ZRF A;  1NYR A;  2INC C;  3B9J A;  3GE3 C;  3VTW A;  1DOY A;  4HK2 A;  2LZ6 A;  2WXM A;  4LDT B;  4W9C A;  3A1Q B;  3ZRC A;  2MLB A;  1FIQ A;  2KTR B;  3UGB B;  1YJJ A;  1A70 A;  5D6J B;  1GUA B;  2G4D B;  1QQR A;  1FEH A;  2JWU A;  2PLP A;  2BYE A;  4EE2 A;  2L8J A;  2LI5 A;  2K1F A;  4YXD B;  1F2R I;  2KAJ A;  3S2A A;  3CF4 A;  1DOX A;  5BYS A;  2RDG A;  2JXT A;  2MA9 B;  1WYW B;  5C3J B;  3Q6B A;  4MGI E;  3TMP B;  4ANW A;  1YQ3 B;  3X23 A;  3PLV A;  4JGH B;  3RNF C;  2UYZ B;  4PK1 A;  2N7D A;  2EKI A;  1X1M A;  2E3T A;  5G2N A;  2WNM A;  1F9J A;  4MM3 B;  2MBO A;  1E0Z A;  3BVZ A;  4EZJ A;  3BII D;  2MBQ A;  4NNJ B;  2DWQ A;  4H2A A;  2B76 B;  1EUV B;  1FD6 A;  3ZUN A;  5CHF A;  2V3S A;  1Z2M A;  1HA5 A;  2DAF A;  1ZE3 D;  2L76 A;  2KWD A;  3KLS X;  1XLN A;  4WH4 A;  4E71 A;  4KKJ A;  2EKE C;  4IWP A;  2IGH A;  1QOB A;  4QAY A;  2IYD B;  2WDV B;  3V60 A;  3EFU A;  4XE0 A;  5J18 A;  3APD A;  2OJR A;  2NBV B;  3A4R A;  4M8N A;  2M56 B;  4TSS A;  1HZ6 A;  1XF5 L;  2G3Q B;  3QCA A;  1MHX A;  3W5V B;  3K9P B;  4FBJ B;  1WR6 E;  1IUE A;  1E90 A;  4MH8 A;  2ZW0 A;  2DEN B;  3IG3 A;  3B2F A;  4USA A;  2JYE A;  1ACC A;  2M19 A;  4ZOH C;  4LTU A;  5C1Z A;  2AX5 A;  2LJI A;  2HTH A;  3TSS A;  3T8M A;  2N7J A;  4XWW A;  1TIF A;  2WXG A;  2WLB A;  3N1Z C;  1R4N B;  4LK0 M;  2Q5W D;  4HPM B;  5C2T B;  3ZJV A;  1QT9 A;  1CQV A;  1QOA A;  1E5W A;  2AQ1 B;  3KYC D;  2PJH A;  2KKC A;  2JY6 A;  1V86 A;  1XLO A;  3U7D A;  1H4R A;  2YVC A;  1HXY D;  1WXM A;  3GE8 C;  3K9O B;  3AUL A;  4DXA B;  2FIF A;  4II3 B;  3Q14 C;  4FA6 A;  3R2I A;  4WWN A;  1AW7 A;  3QAR A;  1WM2 A;  4GLS C;  1VZ6 A;  1V8C A;  2HJ1 A;  1OGW A;  3H7P B;  2NR2 A;  2M0A A;  2AEH A;  3ZTC A;  1SIF A;  5TSS A;  1XLP A;  3VR8 B;  2Y5C A;  1C4C A;  1KRH A;  4AUQ C;  2ZZP B;  2ZPY A;  1I4R A;  3BVM A;  1FNV A;  2NBW B;  3AN1 A;  4KIK A;  1ZGU B;  1T0R C;  4WJQ A;  3ALB A;  1E7P B;  2O2V A;  4O1N A;  1TS4 A;  3ENE A;  2RDB C;  4HRS A;  3H7P A;  1XCT L;  2WXR A;  2L0F A;  3H1U A;  2JWZ A;  1QKZ A;  2C60 A;  2LFI A;  1FMA D;  2N0S B;  1AYF A;  4A90 A;  1C76 A;  2LD9 A;  1GOZ A;  3KVF B;  2G9H D;  3RZW C;  4KDI C;  1OEY A;  2J4X A;  4NY0 A;  4MH0 E;  1WZ0 A;  3OJ3 A;  3NOB A;  1C9F A;  1P7E A;  4BBN F;  2K8H A;  2KD0 A;  4HPP A;  3AE5 B;  2SAK A;  4YL8 A;  4TV3 A;  3Q8C A;  3ZNG C;  2LGX A;  2KOX A;  3Q3O C;  3RNE C;  4GOC A;  3SFD B;  1SE3 A;  4IW0 A;  3RI7 C;  1T3Q A;  4FUL A;  2IPK D;  1Q1O A;  4C56 C;  5I4D A;  4DHZ B;  4A6Q A;  2FCM A;  3Q8B A;  4FXC A;  1ET6 A;  4MSQ B;  5IA7 A;  3IHP C;  2XN9 C;  4DHJ B;  2CU1 A;  5BO4 B;  1E7V A;  5AEK B;  2XEW A;  2RDH A;  2K6D B;  2DBY A;  1L2N A;  5E6J A;  1XO3 A;  1V5T A;  1UUP A;  4US9 A;  3AE3 B;  4C7Y A;  2LGS A;  1UBI A;  2KDF B;  2Z0D B;  2MQJ A;  3ONS A;  5FKA C;  3BYY B;  1Q0W B;  3DBR I;  3PLU A;  1T0S C;  3KW5 B;  3Q8E A;  2WXI A;  4MGK E;  5EDS A;  3BIN A;  2Z0E B;  2K5P A;  2IY0 B;  1WMH B;  2WYQ A;  2IDY A;  1I4P A;  1FNU A;  3NHE B;  1L6U A;  2AL3 A;  3DDC B;  1CK1 A;  4ACF A;  1WGK A;  1ET9 A;  4MT5 A;  2DZI A;  1WX9 A;  3A9K A;  1GJZ A;  2AYO B;  4WAF A;  1EM7 A;  2W54 A;  3Q69 A;  1WE6 A;  4ZRK A;  3EHV A;  3KUC B;  4WWP A;  4A20 A;  3NZU A;  2BB5 A;  5CTR C;  1YJ1 A;  2HTM E;  4PT5 A;  3SR6 A;  2ZEQ A;  1SE2 A;  3SEB A;  1GT8 A;  1DGJ A;  5JH5 C;  3PRZ A;  3ZDT A;  4W9G A;  2KDB A;  2QIE B;  1UZX B;  3ZXR A;  1N6Z A;  1ZXH A;  5BMG A;  4C80 A;  2JUO A;  1SE4 A;  4ZRJ A;  4ZYN A;  2K39 A;  2RR9 A;  2JX5 A;  3PTF C;  5IAA C;  2MEK A;  2Y3A A;  1D5X C;  2ZNV B;  4ANV A;  3DBH B;  3ZXV A;  5AZF A;  4F1S A;  3APF A;  4OVU A;  2IO2 B;  5LNK 1;  3SD5 A;  1RWS A;  2BYF A;  3GS2 A;  1N5W A;  1QZE A;  4WJO A;  1V1P B;  1NEN B;  3QIJ A;  1SXT A;  1YNT E;  3RMK C;  2ZNV C;  4OW0 A;  1WGH A;  3VXW A;  1L0Y B;  4FJV B;  2FID A;  4M00 A;  1OQQ A;  1IYF A;  2IND C;  2JPH A;  4W9I A;  2BVC A;  2LGI A;  4J3O D;  2MJE A;  4N59 A;  2ZCC A;  1D5Z C;  3PV1 A;  1U4A A;  1I42 A;  2FCN A;  5FR6 A;  4S17 A;  1EO6 A;  3CST A;  4CYE A;  3PT2 B;  1JQ4 A;  1FCC C;  1V6E A;  3MTN B;  4IWQ A;  4II2 B;  3HUI A;  3H9D A;  3B08 A;  2D3B A;  2IJ0 A;  1KLU D;  5IN7 A;  3PVL A;  2ZW1 A;  1SB3 C;  2GBM A;  4JIO U;  4MGZ E;  2OED A;  1BT0 A;  2OOB B;  1IBX B;  1GB1 A;  2IY1 B;  4ZHP A;  3MHS D;  4DQO C;  1E8Z A;  2KWV B;  2N9P C;  1VD2 A;  1HEZ E;  4HCP B;  2XK5 A;  2WXL A;  4FN2 A;  3ZLZ A;  4BKS A;  2V3N A;  4TQ0 A;  1VDV A;  3DHI C;  3PGE A;  3V6C B;  4GIV A;  1WI0 A;  3CIR B;  2KJ6 A;  1C3T A;  3N9Y C;  3ABV B;  4EZL A;  3ZNH B;  1MVK A;  1FFV A;  4GSW A;  2L32 A;  5LXI B;  2LMC A;  2KXJ A;  2CJO A;  3DVG X;  1C79 A;  1KJT A;  1L5P A;  3URY A;  3WAM A;  2OHF A;  3AH7 A;  4REZ A;  4LLG M;  2WDR B;  2CHW A;  3MC8 A;  5DPT A;  1S1Q B;  1FRD A;  4DDI D;  1KLV A;  1K53 A;  2V4L A;  1XQQ A;  3U4E G;  5D3I B;  3AXC A;  1ZKH A;  3MJ5 A;  2MBB B;  1WGY A;  2QJL A;  1JRO A;  5HKH A;  1NBF C;  1B1Z A;  4ICV A;  2JZ3 B;  3Q2A C;  5HI1 A;  4P6V F;  2MH7 A;  1YQB A;  3NS8 A;  3IFW B;  3ZQ4 A;  3DOW A;  3HHM A;  4LJO B;  5D7G A;  3WAP A;  1FM0 D;  1F1H A;  2FCQ A;  2KWC A;  1TKY A;  3ZVV A;  3L4P A;  3ZJU A;  5J17 A;  1P9D U;  1KF6 B;  1V49 A;  2RPV A;  2FCS A;  3ZDM C;  3TEY A;  1RFK A;  1XD3 B;  1YOV B;  2VH1 A;  4FAD A;  4C4V A;  2JVC A;  5AZG A;  3ETR A;  3RD2 A;  1QIL A;  3V61 A;  2UU7 A;  3LDZ E;  3RZF A;  4HDQ A;  2V3P A;  3L17 A;  2D07 B;  4YTP B;  4XDC A;  2J42 A;  4M0W A;  2M4N A;  1D4B A;  5DPR A;  3R8B A;  1P3Q U;  4P7I A;  3ZYY X;  2JRI B;  1NDD A;  2KFK A;  3TCA A;  3VTV A;  3I9V 1;  3RUL A;  4AWJ A;  3L08 A;  2WXP A;  4AOF A;  3NY5 A;  2CHX A;  2QEJ C;  3IAM 1;  3AEA B;  4A3O A;  2WXQ A;  3AM9 A;  2GB1 A;  1WJ4 A;  2YLM A;  4WUR A;  2KJH B;  2NS5 A;  1XT9 B;  3MFG A;  1RYJ A;  4URK A;  1GPX A;  3DVN V;  2K9X A;  4C00 A;  3PSE B;  2FBW B;  4IM0 A;  1WXA A;  4UDU C;  2WGS A;  4AQ7 A;  4MEM A;  4KVG B;  2M0X A;  2WXH A;  4FJY A;  3QAQ A;  2C9W B;  1A5R A;  3V6E B;  1L4D B;  2N9L A;  3W1Y A;  4W9D A;  3PRM B;  3W9C B;  4RF0 A;  2KK8 A;  3DHH C;  2PVG C;  2QHO A;  1NI3 A;  2BGF A;  1JWU D;  4I6L B;  4C4V B;  2KO3 A;  1NEK B;  2WXF A;  1E10 A;  3CSF A;  5G5G A;  3PO0 A;  4CHK A;  4EKU A;  2NTT A;  1SF0 A;  1YQ4 B;  1GTH A;  3TIX A;  3P42 A;  1P1A A;  4LCD E;  3ZIM A;  4J6I A;  1EU3 A;  2RPQ A;  1KFY B;  2CHZ A;  2MP2 B;  3W1S A;  4K7W A;  2KJR A;  4A55 A;  2OJW A;  4ARI A;  3I63 C;  3QWZ B;  1V9J A;  3OLM D;  5FK9 C;  3N3K B;  4F8C B;  2K8B A;  1FXT B;  3DBR B;  3H8H A;  1GG3 A;  4GDL B;  2JT4 B;  3UIO B;  4FHK A;  1WM3 A;  3GB1 A;  4L23 A;  2XBB C;  1DOI A;  1J7C A;  1YX5 B;  3VDZ A;  3CMM B;  1MG4 A;  1WYG A;  2K0P A;  1V1P A;  3NVV A;  2E6X A;  5IOI A;  1IGD A;  1M4V A;  2DYB A;  3R3M A;  2DZJ A;  4JX1 C;  2WP9 B;  1ZDX A;  2TSS A;  3SFE B;  3QC8 B;  4LNK A;  4GDL A;  3U30 A;  4KX6 B;  2PE9 A;  3VUY A;  2DHZ A;  4YTN B;  5DPS A;  3A1Q A;  2LHD A;  3O13 A;  3MC9 A;  2KTF A;  2J0J A;  4KGT A;  2K8C A;  2X8X X;  3IT6 B;  3AI5 A;  2BT6 A;  3NUH B;  2QC8 A;  1E8W A;  4PS3 A;  2C7H A;  3VR9 B;  4ZYS A;  3PZ8 A;  1L6V A;  4W9E A;  1GB4 A;  2M17 A;  3EGR A;  3DWM A;  3JVZ X;  5IP4 D;  3W2D A;  1LXD A;  4NJ7 A;  2BW2 A;  1SJE D;  1J0G A;  2INN E;  4G0N B;  3HRD D;  1LGR A;  2BYV E;  2KVZ A;  4W9L A;  2J53 A;  1WR1 A;  2HDE A; 
#chains in the Genus database with same CATH homology
 1UGJ A;  3EA6 A;  2IDY A;  1I4P A;  1FNU A;  2JU6 X;  3AEG B;  4HKQ A;  2IGD A;  1H7W A;  2WQY B;  1JWA D;  1L6U A;  3NZ3 A;  1CK1 A;  1D5M C;  1WXQ A;  1WGK A;  1JML A;  2BS2 B;  1XEE A;  2ONQ A;  3U7Z A;  1JCK B;  1ET9 A;  1WSP A;  4MT5 A;  2YEP B;  4L2Y A;  4RH6 A;  1YN5 A;  2PKO A;  4WAF A;  1EM7 A;  2W54 A;  1V97 A;  1JW9 D;  1TY0 A;  3Q69 A;  2KN4 A;  4Q2J A;  2D5G A;  1FXA A;  2Y5P A;  2BB6 A;  1MI0 A;  1QOF A;  1CJE A;  2BB5 A;  1ZXI A;  1SEB D;  3TEX A;  2WXK A;  2HTM E;  2NTS A;  4PT5 A;  3SR6 A;  1I4X A;  1ZUD 2;  4WWM A;  2EEL A;  2WXJ A;  1SE2 A;  3SEB A;  1GT8 A;  2FUG 1;  2KQ4 X;  1DGJ A;  3BYT B;  5D3D A;  3AEB B;  2RMM A;  1NYQ A;  1QOG A;  1ESF A;  1JWB D;  1TS3 A;  2QIE B;  4IDI A;  1VR9 A;  1NVI D;  2BYT A;  3B2G A;  1ZXH A;  1VZ8 A;  2K3U A;  3DWG C;  4US8 A;  5BMG A;  4C80 A;  1SE4 A;  1K52 A;  1MPE A;  1XLQ A;  3WCQ A;  3P1M A;  5BYQ A;  1PGA A;  1N5X A;  2BTE A;  2JX5 A;  3KWV A;  3KQ4 A;  4NZL B;  1AWD A;  2MEK A;  2I2Y A;  4R3D A;  2Y3A A;  2PIA A;  1P7F A;  1D5X C;  2H88 B;  1BXT A;  3NS1 A;  2IGG A;  2DYO A;  1I4Q A;  2KAC A;  3BVG A;  1FCL A;  2JYT A;  5LNK 1;  1EWC A;  1WRI A;  2ON8 A;  1MHH E;  3KWL A;  3P4R B;  4GDK B;  1RWS A;  2MJ3 A;  1XXG A;  3Q8A A;  4ZRQ A;  3GS2 A;  1K51 A;  1N5W A;  2X38 A;  1V1P B;  1NEN B;  2BBC A;  3P4S B;  1N63 A;  1SXT A;  1TYG B;  1YNT E;  2DYM A;  3U52 E;  1UWM A;  1QLB B;  2VZK D;  3AE1 B;  1PGX A;  3P63 A;  4OW0 A;  5H8Y E;  1L0Y B;  3AV8 A;  1V1O A;  1WWT A;  1OQQ A;  4DXG A;  3TEW A;  2LGI A;  4J3O D;  2MJE A;  4MAC A;  2R61 A;  1UWX A;  4N59 A;  1D5Z C;  1PYW D;  3AE8 B;  2NMQ A;  3AEF B;  5AUK A;  3NVY A;  4KGS A;  2ACZ B;  4XWT A;  4YTM B;  2QIL A;  1FCC C;  1JQ4 A;  3V3X A;  3C8Y A;  1DYQ A;  5H92 C;  1R7S A;  2DLB A;  3IAS 1;  3NVZ A;  4NAM A;  4YSZ B;  3HUI A;  1VZ7 A;  5BYR A;  4A8X C;  3AEC B;  2IJ0 A;  4OVZ A;  1KLU D;  4IKG A;  1PGB A;  2ZW1 A;  1SB3 C;  2G1E A;  2OED A;  3IT4 B;  2GI9 A;  2XNA C;  3V05 A;  3TUO A;  3P4P B;  1NYR A;  2WU5 B;  3B9J A;  1IBX B;  1KH0 A;  1GB1 A;  5AUI A;  1DOY A;  1ZPS A;  5T8I A;  5BMI A;  5HFY A;  4ZHP A;  2WXM A;  4DQO C;  4JPS A;  4JE3 B;  1FIQ A;  3PZ7 A;  4NAW B;  5GXG B;  4D2K A;  3HVD A;  4A9A A;  4XDD A;  4ZRP A;  1YJJ A;  1HEZ E;  1ROE A;  2KDM A;  1A70 A;  1D6E C;  1L4Z B;  4YT0 B;  1QQR A;  1FEH A;  2CU3 A;  4OHJ A;  2JWU A;  3W5U B;  2WXL A;  2PLP A;  3LYY A;  1FO4 A;  2V3N A;  4TQ0 A;  2ICI A;  1VDV A;  4RGO S;  4EE2 A;  3MC0 B;  1OFF A;  4YXD B;  1F2R I;  2KAJ A;  3CF4 A;  1TZO A;  1DOX A;  5BYS A;  3R2T A;  1J7A A;  3CIR B;  1L0X B;  2RDG A;  3ZGZ A;  2JXT A;  3HVZ A;  3N9Y C;  5C3J B;  1T6B X;  5FR3 A;  4ITK A;  1Q10 A;  3EUB 2;  1YQ3 B;  3ABV B;  4OZB A;  1MVK A;  3U2S C;  1L0V B;  4OZA A;  1FFV A;  1J7B A;  2L32 A;  2EKI A;  1HQR D;  2LMC A;  2E3T A;  1XCQ L;  4RNA A;  2CJO A;  4N58 A;  1N61 A;  1C79 A;  2WNM A;  4KGR A;  2N9K A;  4MM3 B;  1L5P A;  3URY A;  5EE0 A;  3IXS A;  4HRO A;  4N6E B;  2OHF A;  3AH7 A;  2BS4 B;  2AQ2 B;  4REZ A;  3BVZ A;  4LLG M;  2WDR B;  1E0Z A;  3BII D;  1JAL A;  2AQ3 B;  4DXF A;  2DWQ A;  4H2A A;  1F2R C;  1FRD A;  1I4G A;  1TKE A;  3UI3 A;  1C78 A;  4AS1 A;  2B76 B;  1K53 A;  1FD6 A;  1ZP0 B;  2WXN A;  2VZK B;  3U4E G;  1E6E B;  1I7H A;  5D3I B;  2W82 A;  1HA5 A;  1T5X D;  1ZE3 D;  1JWS D;  2KWD A;  2PVO D;  3KLS X;  4YWG G;  3MJ5 A;  5G5H A;  4RFB A;  1XLN A;  2L1A A;  4WH4 A;  4KKJ A;  2QJL A;  2IGH A;  1JRO A;  1QOB A;  2PMV A;  1QF6 A;  3MP9 A;  2WDV B;  5EE3 A;  1B1Z A;  4XE0 A;  5HI1 A;  4P6V F;  2MH7 A;  1Y56 A;  4C7Z A;  1ENF A;  1JRP A;  3RPF C;  2INP E;  3ZQ4 A;  2WXO A;  2M56 B;  4TSS A;  1HZ6 A;  3NRZ A;  5D7G A;  1FNW A;  1FM0 D;  1XF5 L;  1MHX A;  3W5V B;  1TKY A;  1IUE A;  4MH8 A;  1JWM D;  2ZW0 A;  1C4P A;  3L4P A;  3AE6 B;  2V4I B;  3ZJU A;  3AB5 A;  3B2F A;  4WQM A;  1KF6 B;  4USA A;  2JYE A;  2RPV A;  1ACC A;  5HHD G;  2M19 A;  3E56 A;  3TEY A;  1E9M A;  1RFK A;  3J9C A;  4ZOH C;  4LTU A;  2AX5 A;  2LJI A;  3FC4 A;  3ETR A;  3I57 A;  3LXF A;  1QIL A;  3TSS A;  1KTK A;  2N7J A;  2WS3 B;  4XWW A;  3GP7 A;  4NJC A;  2WXG A;  1K50 A;  1VJK A;  2V3P A;  2SEB D;  2WLB A;  1BUI C;  4YTP B;  4XDC A;  3BZD B;  3E9S A;  4LK0 M;  2PW9 A;  2J42 A;  1VLB A;  2Q5W D;  1YMH E;  4M0W A;  1BML C;  1PDX A;  1D4B A;  5C2T B;  3R8B A;  2W3S A;  3RFZ B;  1PFD A;  3VRB B;  3ZJV A;  1QT9 A;  1CQV A;  1QOA A;  3LB8 C;  2AQ1 B;  3ZYY X;  2Z8L A;  4HJG E;  2L83 A;  1OQR A;  1YJI A;  1XLO A;  3I9V 1;  2QSD A;  3Q8F A;  4YSX B;  2WXP A;  2QEJ C;  3IAM 1;  1FXI A;  3AEA B;  4RGN A;  1HXY D;  2WXQ A;  3AM9 A;  2GB1 A;  2I38 A;  3FIL A;  3BK1 A;  3NVW A;  4WUR A;  1IGC A;  2LUM A;  3MFG A;  4TQ1 A;  1RYJ A;  3R2I A;  3AE4 B;  1TY2 A;  1GPX A;  1AW7 A;  2K9X A;  4GLS C;  1VZ6 A;  2FE8 A;  1V8C A;  2FBW B;  2M0A A;  4UDU C;  3AMZ A;  2WU2 B;  4AQ7 A;  5TSS A;  4CQN A;  1XLP A;  3VR8 B;  3TEZ A;  2Y5C A;  1C4C A;  1KRH A;  1ZDV A;  2WXH A;  1I4R A;  2V0G A;  3BVM A;  1HZ5 A;  2GRI A;  1L4D B;  1FNV A;  4JWS C;  2PTL A;  2N9L A;  1F77 A;  3AN1 A;  4B0E A;  3W9C B;  3FIL B;  4RCO A;  3AED B;  3AEE B;  4RF0 A;  2WDQ B;  1EWY C;  3MHZ A;  2PVG C;  1E7P B;  1KLG D;  1NI3 A;  2W3R A;  1N60 A;  1SBB B;  1JWU D;  4RF1 A;  4YSY B;  4HKZ E;  1NEK B;  1TS2 A;  2WXF A;  4O1N A;  1TS4 A;  1E10 A;  4RGM A;  5G5G A;  1TS5 A;  3PO0 A;  3T3N A;  2NTT A;  1FFU A;  4HRS A;  1SF0 A;  1XCT L;  5EE9 A;  2WXR A;  1YQ4 B;  1GTH A;  1H7X A;  3P42 A;  1EU4 A;  4RGT A;  1I4H A;  1QKZ A;  2LFI A;  1B9R A;  1C4A A;  2QMT A;  1EU3 A;  1FMA D;  1CZP A;  2N0S B;  1KFY B;  3W1S A;  1LO5 D;  4JWU C;  2W55 A;  2JQR B;  4A55 A;  5HG2 A;  1F0Z A;  1AYF A;  1STE A;  4ARI A;  4A90 A;  1SIJ A;  3BWU D;  1C76 A;  1SSN A;  4P16 A;  2K22 A;  3ZJT A;  5FK9 C;  1GOZ A;  3AE9 B;  3CWI A;  2G9H D;  2JSV X;  1FRR A;  4B0M A;  3H8H A;  4GDL B;  2J4X A;  2J52 A;  1C9F A;  1P7E A;  1RM6 C;  3OWE B;  1VRA B;  1ZOY B;  3GB1 A;  1SJH D;  4L23 A;  1DOI A;  1J7C A;  3VQI A;  3AE5 B;  2SAK A;  2LEK A;  2JZP A;  1WYG A;  2K0P A;  4KKI A;  1V1P A;  3Q8C A;  1IBX A;  1TKG A;  1YN3 A;  2E6X A;  3NVV A;  1IGD A;  1M4V A;  4JX1 C;  1YN4 A;  3T3O A;  2WP9 B;  1ZDX A;  3SFD B;  1UNS A;  1SE3 A;  2TSS A;  1T3Q A;  3SFE B;  2MJD A;  4HEA 1;  1C77 A;  3VRA B;  2IPK D;  5BMH A;  4C56 C;  5I4D A;  4KX6 B;  3FAH A;  4OZC A;  4TMA B;  4A6Q A;  4YTN B;  2LHD A;  3Q8B A;  4FXC A;  2H89 B;  1ET6 A;  3O13 A;  3P4Q B;  1TJE A;  2L52 A;  4KGT A;  2LHE A;  2XN9 C;  1N62 A;  2BS3 B;  3IT6 B;  3AE7 B;  4L1B A;  4ZHO A;  2BT6 A;  3NUH B;  5MPO A;  2RDH A;  1PUT A;  2DBY A;  1AN8 A;  5E6J A;  3VR9 B;  4ZYS A;  3PZ8 A;  1XO3 A;  5EE1 A;  1UUP A;  4US9 A;  5JXV A;  3AE3 B;  1L6V A;  4C7Y A;  5FKA C;  1GB4 A;  4IOI E;  3BYY B;  3EGR A;  2YEP F;  3DWM A;  1GAQ B;  3BK2 A;  3W2D A;  4ARC A;  2BW2 A;  3AE2 B;  1SJE D;  2CJN A;  4WIP A;  3Q8E A;  2KMM A;  2INN E;  2WXI A;  3HRD D;  1GTE A;  2J53 A;  2HDE A;  2K5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...