1QKZA

Fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
58
structure length
58
Chain Sequence
VTTYKLVINGKTLKGETTTKAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G-PRIME
publication title Crystal Structure of an Fab Fragment in Complex with a Meningococcal Serosubtype Antigen and a Protein G Domain
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immune system
total genus 14
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1999-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qkzA00
2IGDA 2PTLA 1K52A 5JXVA 1FD6A 2KQ4X 2N9KA 2J53A 2GI9A 1K53A 2J52A 1MPEA 4GLSC 1K51A 5HG2A 3V3XA 1F2RC 1Q10A 1HEZE 2KACA 2NMQA 1GB4A 4OZCA 5BMHA 2QMTA 1YMHE 2KN4A 1GB1A 1XF5L 2QSDA 2ON8A 1KH0A 1MHXA 4WH4A 1UWXA 1QKZA 1YNTE 1PGAA 3FILA 2OEDA 4MACA 3FILB 2ZW1A 2JZPA 2PW9A 4IOIE 1PGXA 1C9FA 1IBXA 1JMLA 2LHDA 3GB1A 1FCCC 2LGIA 2EELA 4IKGA 4D2KA 5HHDG 2K0PA 2JWUA 1ZXHA 1PGBA 2PLPA 2N9LA 3MP9A 5BMIA 1IGDA 4KGSA 2LUMA 1HZ5A 5HI1A 4OZAA 1MVKA 4HJGE 1P7FA 2IGGA 2RPVA 1XCTL 1MI0A 1K50A 2GB1A 2ONQA 5BMGA 2KDMA 1IBXB 2ZW0A 1MHHE 4KGTA 1HZ6A 2I38A 2KWDA 2JU6X 4HKZE 5HFYA 2I2YA 2LHEA 2RMMA 2JXTA 1D4BA 4OZBA 1FCLA 1XCQL 2JSVX 1IGCA 2IGHA 2N7JA 3UI3A 1EM7A 1F2RI 1P7EA 4KGRA
chains in the Genus database with same CATH superfamily
1KLUD 1Q1OA 3MHSD 2KQ4X 2ZCCA 4MJSB 4HK2A 4KDLB 4QAYA 4GDLB 1JROA 1DOIA 2KC2A 3AE5B 1TT5B 3KWLA 1F2RC 3BVMA 4ANWA 4ANVA 1D3ZA 5CHFA 4OZCA 1AWDA 1G6JA 2KDFB 4MELA 2H89B 3AE1B 5G5HA 1E10A 3NUHB 1KOTA 2CHXA 4RH6A 5LXIB 3Q3OC 2L1AA 4ANUA 2WU2B 5AEKB 3HHMA 1QKZA 3AE7B 4F1SA 1GC6A 2KXJA 4LTUA 3ZKJC 2G4SA 2JZPA 1V1PB 2W9NA 2WXJA 1JMLA 2V3SA 3AE9B 5IAAC 3UINB 4W9DA 3PREA 3H8HA 2PKOA 1XEEA 3NVYA 4OZAA 4TQ1A 2YLMA 1T0SC 4CHKA 2RPVA 3N1XC 4HPLB 3W1YA 2MHJA 3TEZA 3ZJVA 2ONQA 3VXWA 1L7YA 3LXFA 1WWTA 3DVNU 1SE2A 3U4EG 4BZAA 1SEBD 3MTNB 1KF6B 3P4SB 2JPHA 1XQQA 3RNAC 2UU7A 4MGKE 2JXTA 1WJNA 3M63B 2KC1A 3MC0B 4TQ0A 4GDKA 2BTEA 2WXNA 1IUEA 3NRZA 1TS4A 1FD6A 3AN1A 3IG3A 1NYQA 1FO4A 2WXMA 1OEYA 3DVGY 5D7GA 4GB9A 1QOFA 3AEBB 2GBRA 1OGWA 3HIZA 4XZ4A 1E5WA 1XLQA 3ZW3A 5AZHA 2K3UA 2KO3A 3ECIA 2KVRA 5E6PA 4MM3A 1CMXB 2L32A 3PHXB 4X57B 3AEGB 3H7SA 1L6VA 2KWVB 3MC9A 2JY6A 4XGAB 4P1BC 4RM9A 1WGYA 1NDDA 4BOSC 3KH0A 4RF0A 1PGAA 2IY0B 2N7DA 3B9JA 4HPMB 1VLBA 1WMHA 2KAJA 3AB5A 1EWCA 5L95C 4P7IA 3KQ4A 4LLGM 2C7NB 1V81A 5CHWA 1VR9A 2RDGA 3VHTC 4KGSA 2KT7A 1SGHA 1I4QA 1XLNA 1QOAA 2M0AA 4E3CA 1JWMD 2KFKB 4EZJA 1E7VA 1IBXB 5JHBA 1V6EA 3IFWB 2ZJDA 4NJCA 4ZRKA 4XWWA 3AE6B 5LLIA 4ICUA 4WJQA 3PZDA 3OWEB 2DYOA 3RMKC 2MBBB 2WX0A 2LVQA 5JHAA 3RUIB 3R8BA 2RMMA 1JW9D 1P98A 1UD7A 2M17A 2KQSA 2M19A 3VQIA 2M56B 1IP9A 4KIKA 3HK0A 3QA8A 4KGRA 4J6IA 2BYVE 3AMZA 4IUMB 2V0GA 2Q5WD 5IA7A 1UELA 2GI9A 4YSZB 4DHJD 2D2QA 4KV2A 1MG4A 1T0YA 2KACA 1KLGD 2I1KA 3IT6B 3VR8B 2V4LA 2W3SA 1OFFA 1WRDB 2KMAA 4XX5A 3NZUA 2PE6B 2QIEB 2DBYA 1E7UA 2LJ5A 4IM2A 4LNFA 1ZPSA 1STEA 3AU4A 1YOVB 2LGXA 2LGYA 4DHZB 1JWSD 3FILA 3T9LA 3V05A 2KJHB 3U7DA 4IOIE 4RF1A 3ZDMC 2EKEC 1UH6A 2D07B 2WQYB 3HRDD 1FCCC 4W9IA 2BYFA 3NVVA 4M01A 4KSLC 3AI5A 3A9KA 3WANA 2N9LA 2JUOA 1PFDA 2LI5A 3X0WA 3PSEB 3L4PA 3K9OB 1HTQA 2GB1A 1TS2A 3DBLI 3AE4B 1FRDA 4C80A 4PT5A 5FKAC 1ZUD2 3N9YC 4GU2A 1ZDVA 2J42A 2O2VA 1WM3A 2B76B 2N7EA 2KWDA 4WJOA 3NS8A 1MFWA 4MH8A 4AQ7A 2G3QB 4KSKC 2J4XA 3ZXRA 2IY1B 4GIVA 2ZVNA 5L83A 2C7HA 1RFAA 4IW0A 3VDZA 3GE8C 5DPSA 1TKYA 2D3GA 3NS1A 2A4ZA 2N9EB 4NZLB 4RMAA 4K7UA 2E3TA 3DHIC 3VTVA 2L83A 2KDBA 1J19A 3SFDB 3PS6A 4G3XB 2C9WB 3DVGX 4GSWA 2JX5A 3MHZA 1NBFC 2YVCA 1L4ZB 1ET6A 2JF5A 3N1YC 1WYGA 1RWSA 1WZ0A 4BVUC 2K22A 2AQ3B 2CR5A 1ZE3D 2MJDA 1YX5B 4P6VF 3IAS1 2KQ7A 1Z2MA 4II2B 2LEKA 3P1MA 4LDTD 2AQ1B 3QARA 2FIDA 3ZDTA 2HJ8A 4FHKA 4DXAB 2J0KA 1V8CA 4S17A 2Z8LA 1N62A 3Q69A 5D3DA 3CSFA 1SIJA 1WR1A 4D2KA 2D11A 2K0PA 3AULA 2BGFA 1WGRA 4MEMA 2XK5B 4TMAB 1P7FA 1I4RA 2KD0A 2ZEQA 4Q2JA 3JSVB 4K1RB 2NR2A 1YN4A 3P4RB 4AWJA 3BY4B 4L2YA 3B2GA 1SBBB 4AUQC 4AJWA 2IDYA 4FBJB 5IO9A 2I1JA 4B0MA 3UIPB 4FLHA 4A3PA 5J17A 3L16A 1WF9A 2DX5B 2DAJA 2GBMA 3BVGA 4ZYSA 2NTTA 3KW5B 2FBWB 1P1AA 1HTOA 2Y5BB 4KX6B 4DBGA 2D3BA 1E8YA 4F8CB 1ROEA 2BW2A 2D10A 1DOYA 1ISNA 1UZXB 1K8RB 4I6PA 1YIWA 1HA5A 2HE7A 3RNEC 1Q0WB 1SXTA 2V9HA 2BKRB 2KWUB 4A6QA 4MSQB 2C60A 2KTRA 3FAHA 2QMTA 3RNFC 2KOXA 2MH7A 4LCDE 2GMIC 3AEEB 1XLPA 2ON8A 4NAWA 2XNAC 1N5WA 3PGEA 3ZYYX 2INCC 3ML8A 2N1WA 4G11A 4FJZA 2LGDA 4L23A 3GE3C 1I35A 3ZQ4A 3Q6BA 4IKGA 4WWOA 1ESFA 5HHDG 1SB3C 4KDIC 2L00B 4YSYB 4ARCA 3Q3NC 2PE9A 3U30A 3ENEA 2G4DB 3RPFC 1LGRA 2FCSA 2M8SA 3WAPA 3C0RB 1H4RA 5BMGA 2K9XA 2JQRB 1MHHE 4BKGA 4MJSA 3ZO5B 3L13A 3A4SC 4GDLA 3O13A 5AZGA 5AZFA 2TSSA 3RCZA 2MBHA 2INPE 2DENB 2ZZPB 3MJWA 3VFKA 1FCLA 3L17A 2MX2A 1Z5SB 3M3JA 2KANA 3R7QA 2EMSA 2IGDA 2PTLA 3ZLZA 1M4VA 3EFUA 4J3OD 4LJOB 4XDDA 3E9SA 3VRAB 4TV3A 4NY0A 2LXAA 4FJVB 2FUHB 2WX1A 4EE2A 2AQ2B 1V1PA 5IP4D 4M8NA 2JRHA 4YL8A 1YJJA 5MPOA 1PUTA 4A8XC 4USAA 3JYUA 5DCNA 2K5PA 1WGKA 4IWPA 4RGMA 3P4PB 1ENFA 3P42A 2WXIA 2CHZA 4MSMB 2MEKA 3KWVA 2MA9B 4MACA 1D6EC 1JALA 3VVWB 4URKA 2L05A 5TSSA 4HJKA 2XBBC 1C77A 2LHDA 3RZFA 2N1VA 1EF1A 2L52A 2BWES 3NHEB 4C00A 2LGIA 1R4NI 1JCKB 3BYTB 2VH2A 4US8A 1F0ZA 2QC8A 5HI1A 4N6EB 1T5XD 2Y3AA 3DBLB 1K50A 3KUDB 4IDIA 4EEWA 3L10B 3I57A 3TEYA 3E56A 3N32A 1B1ZA 2BBCA 4WIPA 4XWTA 1L0YB 2LVPA 3DWMA 1I4HA 1D5ZC 1I4XA 1MJDA 1WGDA 1I4PA 2AWTA 4P16A 3BZDB 2ZPNA 3SHQA 1IGCA 3U8ZA 5FK9C 2JT4B 2LASA 1GC7A 2BF8B 2YEPB 2E6XA 3NZ3A 1NI3A 3AU5A 3PTFC 1BXTA 3L08A 1AARA 5KHQA 1OTRB 3Q8BA 3IHPC 3V3XA 3VTWA 2KFJA 4PS3A 4NJ7A 1NENB 2DYMA 1AW7A 3Q3FA 3TEWA 4WURA 4W9LA 1SJED 3ZJTA 4LJPB 1FXIA 4K3CA 1WXAA 3H7PB 3VTUA 3W5VB 2QSDA 4EZKA 1UGJA 1T0QC 3X23A 5BYRA 4YTMB 2DYBA 1Q5WB 2ZPYA 1Y8RC 2AEHA 4DK5A 4RGTA 4I6NB 4PYZA 2KFKA 5G5GA 2PW9A 4CQNA 2YEPF 4ZHOA 1QZEA 1IBXA 3UGBB 2KJ6A 4DHJB 2WXFA 1E8WA 2JRIB 2ZCBA 3L54A 2AL6A 2WXHA 3PVLA 4W9CA 2KLGA 1U4AA 2WXKA 5EE9A 4AJYB 2KX3A 3AE8B 3C19A 1A70A 4EOYA 2WU5B 3GZNI 5C1ZA 3P2BA 4FXCA 2BS4B 1F9JA 4GOCA 3VUWA 3OLMD 4B0EA 3NOBA 4NPNA 3O65B 4MGYE 3BK2A 1XT9B 4MGZE 5HFYA 4UDUC 2WS3B 1QOGA 3QAQA 4AS1A 4WWPA 2LVOA 4LNNA 1C78A 2J0MA 2BS3B 3GOEA 3KYDD 3DOWA 4GDKB 3B0AA 2EMTA 2NVUI 3ZTCA 2BWFA 2RD0A 4LNOA 5FR6A 3PLUA 3DBHI 4I6LB 1UBQA 1WX9A 3B08A 4ANXA 2W82A 2BYTA 3VUYA 2Z0DB 2N9PC 5C2TB 2KDIA 1RAXA 3EC8A 2L76A 3BVZA 2QEJC 3JVZX 2KN4A 1S1QB 3KYCD 1KH0A 2DZKA 5BYQA 3A4RA 4ITKA 4JPSA 3C8YA 2AYOB 4WQMA 1GPXA 1YNTE 4IM3A 2WGSA 3MFGA 3VUXA 2INDC 2G1EA 5G2NA 1UNSA 4LK0M 2DWQA 1UWMA 3B2FA 4HDQA 4N59A 1EUVB 4L1BA 3T3NA 2JWUA 5DPTA 1PGBA 4IWQA 1LM8B 4BOZB 2V3NA 1HZ5A 2AX5A 2VZKD 3SEBA 1WXVA 4HKQA 1WYWB 4WWNA 4ARIA 4P1CC 3RD2A 4BFRA 1WFYA 4RGNA 2RR9A 4EZLA 1KM7A 4LDTB 4DXGA 4M0WB 1HZ6A 3ZJUA 1FXTB 2BQQA 2L7RA 3A1QB 4YTPB 4M00A 1ZOYB 3CSTA 2K6DB 1D4BA 5HKHA 4K3BA 2W55A 4DHZE 1F2RI 3TL5A 2ZVOA 4BKSA 2DNFA 4PS7A 3OJ3A 5JXVA 1TKGA 4JX1C 1C4PA 1KLVA 3OG5A 1VCBA 4MGIE 2O6VB 1ZP0B 2WXOA 1GB4A 5CX3A 2OJRA 2CU3A 4A9AA 4E74A 2DLBA 1WJUA 1LFDA 5J18A 5JZEB 2LFIA 1JRPA 1SE4A 4RM8A 2WDVB 3V6EB 2OJWA 1V1OA 3PPAA 1VD2A 2XK5A 4C7YA 2IO1B 3DQVA 1OQQA 4LNIA 3JSVA 2NPTB 2OEDA 4WJNA 3FILB 2ZW1A 3AEFB 3FKYA 4GGQA 2RDHA 1E8ZA 2JYTA 2IJ0A 4B9KA 3H9DA 4JE3B 3IT4B 4C56C 4G50A 1ZXHA 4M02A 2R2QA 1P9DU 3ZIMA 1T3QA 2WXGA 1L0VB 4WJPA 2QILA 3HM6X 1AN8A 2DZMA 2V3PA 4KKIA 1VZ6A 4KVGB 4ASWC 4K7SA 2V1YA 2BB5A 3ZGZA 2M4NA 1EF5A 1SE9A 2MBQA 3I9V1 4FHJA 2H88B 5FR3A 1GOZA 4PYUA 1R7SA 3VAWA 4IC7B 1V97A 2NBUA 4JIOU 4FADA 1FIQA 5DPRA 1RFKA 2KKCA 2NBWB 2HTME 2UWQA 4HCPB 1P7EA 2WWZA 1LO5D 3IAM1 2X38A 1J7BA 2N9KA 1QILA 3V60A 3RNBC 2PVOD 4H2AA 3HVDA 1K53A 1WXMA 5BYSA 3LDZE 2CKHB 1WXSA 1LQBA 2NMQA 4DWFA 2AL3A 3DDCB 1N6ZA 3TEXA 3A9JA 1R4MI 4W9FA 4ZRQA 2LUEA 1KFYB 3RYTA 3V61A 2G9HD 1UF0A 1XF5L 1TTNA 2R2OA 5IOIA 4RCOA 4ZRPA 2VH1A 2GRIA 2WDRB 2NTSA 4HPPA 3WAOA 4E71A 2M0XA 1SSNA 3AH7A 5H92C 3AE2B 2MBOA 1N61A 1V9JA 2LJIA 3DCGA 1J7AA 2PVGC 3DBRI 4G0NB 5EE0A 5E6JA 3GB1A 2QJLA 3RT3B 1JQ4A 4NAMA 4JWSC 2Z59B 3B1LX 4JGHB 5GXGB 5D6JB 3TUOA 3UQAA 1FNVA 1MVKA 4BKSD 3R2IA 1Y56A 3APCA 2DHZA 4TSSA 1MI0A 1XXGA 2R61A 4XDCA 1L0XB 3Q8AA 2MP2B 1CJEA 2KMMA 1WX8A 3URYA 4K81A 2MRPA 1IYFA 1L2NA 1FFUA 1GNUA 4MDKE 2CJOA 2I38A 3HVZA 1PQSA 1D5XC 2IO0B 2KTFA 3W1SC 3VH3B 4HLEA 1XD3B 3TSSA 2X8XX 3ZUNA 4C4VB 5BO4B 3PZ7A 3RI7C 3TMPB 2KHWB 5DPWA 5EE1A 2WYQA 2JXXA 3M95A 1KRHA 1UBIA 3WALA 5LXHA 4K7WA 2D5GA 1C4CA 2GOWA 1JWUD 4KZCA 3QHTA 1GG3A 3Q8CA 4OHJA 2UYZB 2MQJA 5AUIA 1YJIA 2JZZA 1TKEA 1HQRD 1GB1A 1N5XA 1CZPA 1GAQB 2BKFA 3W5UB 2D3AA 1FXAA 4OVZA 3NZSA 2DZJA 4HCNB 1F52A 2WXPA 2LXCA 1OQRA 1VJKA 3CF6E 3PLVA 4WQOB 4PS8A 1PGXA 1RM6C 2V4IB 2ZNVC 2WP9B 3VR9B 1PDXA 1J7CA 2ZNVB 4JWUC 1V80A 2WXLA 2BT6A 1XLOA 2GBNA 1YJ1A 2CJNA 2NBVB 3BINA 1C4AA 3A33B 1FNUA 1XCTL 2K1FA 2BPSA 4GXBA 3DVNV 4HWIB 4A90A 5GMVA 1FEHA 3WA0A 3RNCC 2CHWA 3PHWB 2CS4A 2J0JA 2WXQA 3VRBB 3RN9C 3OAWA 1SE3A 4W9GA 1OQYA 3GS2A 4ACFA 4W9KA 4LNKA 4ZDVA 2K39A 4DDGD 4N58A 3H6NA 1GUAB 3ABVB 3AE3B 1T6BX 2MJEA 3H7PA 5JH5C 2HJ1A 2K25A 4YT0B 4HVBA 3NG0A 3N3KB 3NJTA 4M8MA 1OEYJ 4BBNC 2WHIA 2Y5CA 1YQ3B 1PYWD 4NQLB 1J0GA 2J52A 1EWYC 4FA6A 1J8CA 2K8HA 3ML9A 3WAMA 3HUIA 2WXRA 3M62B 1T0RC 3K9PB 3JW0X 3DHHC 1P3QU 1WJ6A 1ACCA 4C7ZA 1WJ4A 1F77A 1BMLC 2MLBA 2KYWA 4KZ0A 1D5MC 2WDTB 1KTKA 3D32A 1DYQA 2RPQA 3EUB2 3ALBA 4MT5A 3TIXA 1SJHD 4HROA 2WLBA 1WSPA 4RNAA 1N63A 2IBIB 1E6EB 4II3B 4BBNF 3Q3MC 4IG7B 2L8JA 4AOFA 2ZW0A 1E0ZA 3Q8FA 4HRSA 3N1ZC 3AEDB 1I7HA 3HM3A 5KHOA 1P0RA 4HEA1 2QCZA 3RULA 2KK8A 1JWAD 3CMMB 2IPKD 2LHEA 4NNJB 2LGSA 1EU3A 1ZGUB 3SU8X 1V5OA 3UI3A 1EM7A 2BS2B 2J7QB 1I42A 4BAXA 3Q14C 4B95A 5C3JB 3NVWA 2ACZB 1C79A 2VZKB 1VZ8A 4CYEA 1FMAD 1S3SG 4ZRJA 4GLSC 1K51A 1WE7A 5EDSA 1H8CA 1HEZE 2RDBC 4YWGG 2MW5A 1EU4A 1R4MB 2W3RA 1I4GA 3ZRFA 2JZ3B 3RFZB 3ZNHB 1ZKHA 1TY0A 3WIMA 1EO6A 1TZOA 3UIOB 3TJPA 4XC2A 1WM2A 4WH4A 4WWMA 3APFA 3EHVA 4YTNB 2B3AA 4YSXB 1C3TA 1YQ4B 3PRPB 3KUZA 1YN5A 4OVUA 3DBRB 3KVFB 3EFCA 3IVFA 5D3IB 3R2TA 1C9FA 2LRWA 2MBEA 1CK1A 3SDLC 1E90A 1X1MA 4MM3B 2GBKA 2KNBA 1LXDA 1C1YB 2C5LC 1ZW7A 2WNMA 4M0WA 4ZHPA 3N20C 3N30A 4B6WA 3ZNID 2OHFA 2IO3B 5E6NA 3QK0A 2IO2B 3A1QA 1V2YA 2SEBD 4FULA 2L3ZA 1E8XA 4FJYA 3U52E 4A3OA 4EFOA 2DZIA 3BWUD 2PJHA 2LZ6A 3QCAA 2NS5A 2FCNA 3EA6A 1WMHB 3DHGC 1SF0A 2OOBB 1YQBA 4FN2A 2K8BA 4A55A 4YXDB 3VH4B 2D3CA 1QF6A 3S2AA 1FNWA 2O6VA 4NQKE 3Q2AC 1RRBA 1FRRA 3H1UA 1FFVA 2N7JA 3PZ8A 3PV1A 1HXYD 4ZRIA 2BYEA 3EGRA 2QDFA 3QC8B 3V6CB 5IKCM 1MPEA 5LNK1 1WXQA 3U7ZA 4S0RA 3PRZA 2NPTA 4US9A 4IWOA 2INNE 4JLCA 5T8IA 4ICVA 4A20A 1F1HA 2N0SB 3MC8A 4KIKB 4JL9A 1QT9A 2FE8A 2K8CA 1WH3A 3DBSA 4JQWC 4EKUA 2KJRA 1FPYA 1A5RA 2FAZA 2VRRB 2LMCA 1TZ1A 2IZVB 4BKTA 3GP7A 1TBEA 4DQOC 1ZXIA 1VDVA 1UGMA 2XEWA 2KWCA 5G55A 4RFBA 2WDQB 3DPDA 2EELA 3BYYB 3LJ3A 1FM0D 1XO3A 3AM9A 3QJZA 4CO7A 1WI0A 4DDID 4TKNA 5BMIA 1IGDA 2LUMA 3PRMB 1C76A 1JRUA 1VRAB 3QWZB 5D2MB 5CHVC 2KX0A 3Q3JA 5EE3A 4RGOS 1V86A 1YX6B 1IPGA 3CIRB 1KJTA 1R4NB 4HDOA 1TYGB 4W9HA 2REXA 3MJ5A 3WCQA 1WGGA 3LB8C 4KGTA 1YD8U 1VZ7A 3A9KB 3W9CB 2JU6X 4HKZE 2HD5B 4OW0A 1V49A 3ZNZB 2BB6A 2G45B 2QHOA 4OZBA 1XCQL 2JSVX 2KDEB 2MWSB 2IGHA 4GN1A 1N60A 4O1NA 4W9JA 2KVZA 3ZNGC 2FNJB 1TS3A 5CTRC 4AP4C 2O2VB 1UUPA 4WAAA 1ZDXA 5HG2A 3SD5A 1SIFA 1M94A 4HXDA 1TY2A 3ZRCA 4DXFA 4XYCA 2CU1A 3AV8A 3P63A 1WY8A 2RGFA 3PO0A 3T8MA 2KMCA 2M1MA 3RNGC 1AYFA 2A5UA 4IM0A 2FCQA 1MHXA 2NCNA 2FCMA 2Z0EB 3W2DA 3QX1A 3KUCB 4ZOHC 5D94A 1TS5A 2MP2A 2SAKA 2O6VD 2PMVA 4PK1A 2FIFA 1WE6A 5E6OA 3UF8A 1MG8A 1E7PB 2MSED 1ET9A 1V5TA 2LWPA 4KKJA 1L4DB 4ZYNA 3ZTDA 2ASQA 4HJGE 4NJ6A 1BT0A 2JVCA 1WIAA 2EKIA 2PIAA 4MH0E 3W1SA 1TGZB 3I3TB 1E9MA 4C4VA 2KDMA 3R3MA 1TIFA 5IN7A 3TCAA 2KZRA 3AEAB 3SR6A 5J2RA 1BUIC 1QQRA 1WZ3A 3UQBA 2DAFA 1RLFA 1L5PA 2HTHA 3U2SC 3FC4A 1WRIA 3I5JC 2N4FA 3GZNB 2MJ3A 3QIJA 1DOXA 2LD9A 3APDA 4F7ZA 4WAFA 1GJZA 3SFEB 5H8YE 1WGHA 2PEAA 2W54A 1K52A 2FUG1 2J53A 2GLSA 4R3DA 2PPHA 1NYRA 3NY5A 3ZXVA 1RYJA 1Q10A 4N9F4 1B9RA 4TUUA 2LRUA 3ZVVA 2BVCA 3AXCA 3IXSA 2KN5A 5BMHA 3A9JB 3TBLD 1WX7A 3QQ8B 3OJ4B 1YMHE 2RSUA 2HDEA 4EUTA 1YN3A 2JWZA 3Q8EA 3RZWC 2GBJA 3DBHB 2L0FA 1WR6E 2N9XA 1HE8A 3EECA 1UWXA 3T3OA 2C7MB 3I63C 2IYDB 3P4QB 2Y5PA 3L0WB 2K6QA 3ONSA 1JWBD 3IBEA 4XE0A 4GMVA 2KTRB 2JYEA 1CQVA 5I4DA 2L0TA 2XN9C 1NEKB 3NVZA 2PLPA 4NAWB 2MCNB 3MP9A 4W9EA 3AECB 1NI2A 1L6UA 3KLSX 1NVID 3BIID 2IGGA 4REZA 3V62A 1QOBA 1QLBB 1TJEA 3ETRA 3R66C 3R7RA 3BK1A 3CWIA 2ICIA 5C23A 5AUKA 2I2YA 1DGJA 3DWGC 5TR5A 3LYYA 3J9CA 4OVVA 2KLCA 3PT2B
chains in the Genus database with same CATH topology
1ROEA 2BW2A 1KLUD 5C3JB 3NVWA 1DOYA 5JXVA 2ACZB 1C79A 2KQ4X 2VZKB 1VZ8A 1TKGA 4JX1C 1C4PA 1FMAD 1JROA 4GDLB 1DOIA 4GLSC 1K51A 3AE5B 3KWLA 1F2RC 1HA5A 1HEZE 4YWGG 3BVMA 1ZP0B 2WXOA 1EU4A 1SXTA 1GB4A 4A6QA 2W3RA 2CU3A 1AWDA 4OZCA 4A9AA 1I4GA 2DLBA 2H89B 3AE1B 5G5HA 3FAHA 1E10A 2QMTA 3RFZB 3NUHB 1TY0A 2LFIA 2MH7A 4RH6A 3AEEB 1JRPA 1XLPA 1SE4A 2ON8A 1TZOA 2L1AA 2WDVB 2XNAC 1V1OA 1N5WA 2WU2B 4WH4A 4WWMA 4YTNB 3ZYYX 4C7YA 1QKZA 3AE7B 4YSXB 1YQ4B 1OQQA 1YN5A 2OEDA 4LTUA 3FILB 2ZW1A 2JZPA 3AEFB 1V1PB 5D3IB 3R2TA 2RDHA 2WXJA 1C9FA 1JMLA 3AE9B 4L23A 1CK1A 2JYTA 2IJ0A 4MM3B 3ZQ4A 4JE3B 3IT4B 3H8HA 4IKGA 2WNMA 4M0WA 4C56C 1ESFA 4ZHPA 5HHDG 2PKOA 1SB3C 1XEEA 1ZXHA 2OHFA 3NVYA 4YSYB 1T3QA 2WXGA 1L0VB 4OZAA 4ARCA 2SEBD 4TQ1A 2QILA 1AN8A 3U52E 2RPVA 2V3PA 3RPFC 4KKIA 1VZ6A 3TEZA 3ZJVA 3BWUD 2ONQA 2BB5A 5BMGA 3ZGZA 3LXFA 1WWTA 2K9XA 3EA6A 2JQRB 3I9V1 1MHHE 1SE2A 1SF0A 3U4EG 2H88B 5FR3A 4A55A 4YXDB 1GOZA 1SEBD 3O13A 1R7SA 2TSSA 1KF6B 3P4SB 1QF6A 1V97A 2INPE 1FNWA 1FIQA 1FRRA 1RFKA 2JXTA 1FFVA 1FCLA 2N7JA 2HTME 3MC0B 3PZ8A 4TQ0A 1HXYD 1P7EA 2BTEA 3EGRA 2WXNA 1LO5D 1IUEA 3NRZA 1TS4A 2IGDA 2PTLA 3IAM1 1M4VA 2X38A 4J3OD 1FD6A 3AN1A 1J7BA 2N9KA 1QILA 1NYQA 2PVOD 3HVDA 4H2AA 2WXMA 1K53A 3E9SA 4XDDA 1FO4A 5D7GA 3VRAB 1MPEA 1QOFA 5LNK1 3AEBB 1WXQA 5BYSA 3U7ZA 4EE2A 4US9A 2AQ2B 1V1PA 2INNE 5T8IA 2NMQA 1XLQA 2N0SB 3TEXA 2K3UA 4ZRQA 1KFYB 1YJJA 1QT9A 5MPOA 2FE8A 2L32A 1PUTA 2G9HD 4A8XC 1XF5L 3AEGB 4USAA 1L6VA 2K5PA 1WGKA 4RGMA 4RCOA 4ZRPA 3P4PB 1ENFA 3P42A 2WXIA 2GRIA 2WDRB 2NTSA 1SSNA 3AH7A 1PGAA 2LMCA 2MEKA 4RF0A 3KWVA 5H92C 3AE2B 3GP7A 4MACA 4DQOC 1D6EC 1JALA 1ZXIA 1N61A 3B9JA 2LJIA 5TSSA 1VLBA 1J7AA 1VDVA 2PVGC 5EE0A 1C77A 2LHDA 5E6JA 3GB1A 2QJLA 4RFBA 2L52A 2KAJA 2WDQB 4NAMA 1JQ4A 3AB5A 1EWCA 2LGIA 2EELA 4JWSC 3KQ4A 3BYYB 1FM0D 1XO3A 3AM9A 1JCKB 4LLGM 5GXGB 3BYTB 3TUOA 4US8A 1VR9A 2RDGA 5BMIA 1IGDA 1F0ZA 4KGSA 2LUMA 5HI1A 1FNVA 1MVKA 4N6EB 1C76A 1I4QA 1QOAA 1XLNA 2M0AA 3R2IA 1Y56A 1T5XD 2Y3AA 1VRAB 1JWMD 4TSSA 1MI0A 1K50A 5EE3A 4IDIA 1XXGA 2R61A 4RGOS 4XDCA 1IBXB 1L0XB 3Q8AA 1CJEA 2KMMA 3I57A 3CIRB 3TEYA 3E56A 4NJCA 3URYA 1TYGB 3AE6B 4XWWA 1B1ZA 2BBCA 4WIPA 3MJ5A 1FFUA 3WCQA 4XWTA 1L0YB 3OWEB 3LB8C 2DYOA 4KGTA 2CJOA 1VZ7A 2I38A 3HVZA 2JU6X 1I4HA 3DWMA 1D5ZC 1I4XA 4HKZE 3W9CB 1D5XC 4OW0A 3R8BA 1I4PA 2RMMA 4P16A 1JW9D 3BZDB 2BB6A 4OZBA 1XCQL 2M19A 2JSVX 1IGCA 2IGHA 3VQIA 2M56B 3TSSA 5FK9C 1N60A 4KGRA 3PZ7A 4O1NA 3AMZA 2YEPB 2E6XA 1TS3A 1NI3A 3NZ3A 2V0GA 2Q5WD 1BXTA 5EE1A 1UUPA 2GI9A 4YSZB 1KRHA 3Q8BA 1ZDXA 5HG2A 3V3XA 2D5GA 1C4CA 1JWUD 1TY2A 4DXFA 2KACA 3AV8A 3Q8CA 3P63A 4OHJA 1NENB 2DYMA 1AW7A 1KLGD 3TEWA 3IT6B 3PO0A 4WURA 1SJED 3VR8B 3ZJTA 2W3SA 5AUIA 1YJIA 1FXIA 1OFFA 1TKEA 1AYFA 1HQRD 1GB1A 1N5XA 1CZPA 1GAQB 3W5UB 3W5VB 2QSDA 2QIEB 1FXAA 2DBYA 4OVZA 1UGJA 1MHXA 5BYRA 4YTMB 1ZPSA 1STEA 2WXPA 4RGTA 1JWSD 1OQRA 1VJKA 3FILA 5G5GA 3W2DA 3V05A 2PW9A 4ZOHC 2YEPF 4IOIE 4RF1A 4ZHOA 4CQNA 1PGXA 1TS5A 1RM6C 2V4IB 1IBXA 3HRDD 2WQYB 2SAKA 2WXFA 1FCCC 2PMVA 2WP9B 3VR9B 3NVVA 1PDXA 2WXHA 1E7PB 1J7CA 1ET9A 4JWUC 2WXLA 2BT6A 1XLOA 2WXKA 5EE9A 2N9LA 4KKJA 1L4DB 1PFDA 2CJNA 3AE8B 1A70A 4HJGE 1C4AA 1FNUA 1XCTL 2EKIA 2PIAA 3W1SA 2WU5B 4A90A 1E9MA 1FEHA 3L4PA 2GB1A 1TS2A 3AE4B 1FRDA 2KDMA 4FXCA 2BS4B 2WXQA 4C80A 4PT5A 5FKAC 3VRBB 1ZUD2 3N9YC 3AEAB 1SE3A 1ZDVA 2J42A 4B0EA 3SR6A 1BUIC 3GS2A 2B76B 1QQRA 2KWDA 3BK2A 1L5PA 4MH8A 4N58A 5HFYA 4UDUC 3U2SC 4AQ7A 2WS3B 3FC4A 3ABVB 1QOGA 2J4XA 1WRIA 1T6BX 3AE3B 4AS1A 2MJEA 1C78A 2MJ3A 1DOXA 4YT0B 2BS3B 4WAFA 4GDKB 3SFEB 1TKYA 5H8YE 2W54A 1K52A 2FUG1 2J53A 2Y5CA 1YQ3B 1PYWD 4R3DA 2J52A 1EWYC 1NYRA 3NS1A 1RYJA 2W82A 1Q10A 4NZLB 2BYTA 1B9RA 3HUIA 2WXRA 2E3TA 2L83A 5C2TB 3SFDB 3IXSA 1ACCA 5BMHA 3MHZA 2JX5A 4C7ZA 3BVZA 1YMHE 2QEJC 1L4ZB 1F77A 2KN4A 1ET6A 1BMLC 2HDEA 1WYGA 1YN3A 3Q8EA 1RWSA 1D5MC 1KH0A 5BYQA 4ITKA 4JPSA 2K22A 3C8YA 2AQ3B 1ZE3D 1KTKA 2MJDA 4WQMA 1UWXA 3T3OA 1GPXA 4P6VF 3IAS1 1YNTE 1DYQA 3EUB2 3MFGA 3P4QB 2LEKA 3P1MA 2Y5PA 2AQ1B 2G1EA 4MT5A 1UNSA 1SJHD 1JWBD 4LK0M 4HROA 4XE0A 2WLBA 1WSPA 2DWQA 1UWMA 2JYEA 3B2FA 4RNAA 1N63A 1E6EB 4N59A 1V8CA 2Z8LA 1CQVA 4L1BA 1N62A 3Q69A 5D3DA 4D2KA 1SIJA 5I4DA 2K0PA 2JWUA 2XN9C 1NEKB 3T3NA 3NVZA 1PGBA 2PLPA 4NAWB 3MP9A 3AECB 2V3NA 1L6UA 1HZ5A 3KLSX 4TMAB 1NVID 2AX5A 3BIID 1P7FA 2IGGA 2VZKD 3SEBA 4HKQA 1I4RA 4Q2JA 4REZA 4ARIA 1YN4A 3P4RB 1QOBA 1QLBB 1TJEA 3ETRA 4L2YA 3B2GA 1SBBB 2ZW0A 3Q8FA 1E0ZA 4HRSA 3AEDB 1I7HA 2IDYA 4RGNA 4HEA1 3BK1A 4B0MA 4DXGA 3CWIA 2ICIA 5AUKA 1HZ6A 3ZJUA 1JWAD 2IPKD 2I2YA 1DGJA 2LHEA 3DWGC 4YTPB 3BVGA 1EU3A 1ZOYB 1D4BA 3LYYA 2W55A 4ZYSA 3J9CA 2NTTA 3UI3A 2FBWB 1EM7A 2BS2B 1F2RI 4KX6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGD A;  2PTL A;  1K52 A;  5JXV A;  1FD6 A;  2KQ4 X;  2N9K A;  2J53 A;  2GI9 A;  1K53 A;  2J52 A;  1MPE A;  4GLS C;  1K51 A;  5HG2 A;  3V3X A;  1F2R C;  1Q10 A;  1HEZ E;  2KAC A;  2NMQ A;  1GB4 A;  4OZC A;  5BMH A;  2QMT A;  1YMH E;  2KN4 A;  1GB1 A;  1XF5 L;  2QSD A;  2ON8 A;  1KH0 A;  1MHX A;  4WH4 A;  1UWX A;  1QKZ A;  1YNT E;  1PGA A;  3FIL A;  2OED A;  4MAC A;  3FIL B;  2ZW1 A;  2JZP A;  2PW9 A;  4IOI E;  1PGX A;  1C9F A;  1IBX A;  1JML A;  2LHD A;  3GB1 A;  1FCC C;  2LGI A;  2EEL A;  4IKG A;  4D2K A;  5HHD G;  2K0P A;  2JWU A;  1ZXH A;  1PGB A;  2PLP A;  2N9L A;  3MP9 A;  5BMI A;  1IGD A;  4KGS A;  2LUM A;  1HZ5 A;  5HI1 A;  4OZA A;  1MVK A;  4HJG E;  1P7F A;  2IGG A;  2RPV A;  1XCT L;  1MI0 A;  1K50 A;  2GB1 A;  2ONQ A;  5BMG A;  2KDM A;  1IBX B;  2ZW0 A;  1MHH E;  4KGT A;  1HZ6 A;  2I38 A;  2KWD A;  2JU6 X;  4HKZ E;  5HFY A;  2I2Y A;  2LHE A;  2RMM A;  2JXT A;  1D4B A;  4OZB A;  1FCL A;  1XCQ L;  2JSV X;  1IGC A;  2IGH A;  2N7J A;  3UI3 A;  1EM7 A;  1F2R I;  1P7E A;  4KGR A; 
#chains in the Genus database with same CATH topology
 1KLU D;  1Q1O A;  3MHS D;  2KQ4 X;  2ZCC A;  4MJS B;  4HK2 A;  4KDL B;  4QAY A;  4GDL B;  1JRO A;  1DOI A;  2KC2 A;  3AE5 B;  1TT5 B;  3KWL A;  1F2R C;  3BVM A;  4ANW A;  4ANV A;  1D3Z A;  5CHF A;  4OZC A;  1AWD A;  1G6J A;  2KDF B;  4MEL A;  2H89 B;  3AE1 B;  5G5H A;  1E10 A;  3NUH B;  1KOT A;  2CHX A;  4RH6 A;  5LXI B;  3Q3O C;  2L1A A;  4ANU A;  2WU2 B;  5AEK B;  3HHM A;  1QKZ A;  3AE7 B;  4F1S A;  1GC6 A;  2KXJ A;  4LTU A;  3ZKJ C;  2G4S A;  2JZP A;  1V1P B;  2W9N A;  2WXJ A;  1JML A;  2V3S A;  3AE9 B;  5IAA C;  3UIN B;  4W9D A;  3PRE A;  3H8H A;  2PKO A;  1XEE A;  3NVY A;  4OZA A;  4TQ1 A;  2YLM A;  1T0S C;  4CHK A;  2RPV A;  3N1X C;  4HPL B;  3W1Y A;  2MHJ A;  3TEZ A;  3ZJV A;  2ONQ A;  3VXW A;  1L7Y A;  3LXF A;  1WWT A;  3DVN U;  1SE2 A;  3U4E G;  4BZA A;  1SEB D;  3MTN B;  1KF6 B;  3P4S B;  2JPH A;  1XQQ A;  3RNA C;  2UU7 A;  4MGK E;  2JXT A;  1WJN A;  3M63 B;  2KC1 A;  3MC0 B;  4TQ0 A;  4GDK A;  2BTE A;  2WXN A;  1IUE A;  3NRZ A;  1TS4 A;  1FD6 A;  3AN1 A;  3IG3 A;  1NYQ A;  1FO4 A;  2WXM A;  1OEY A;  3DVG Y;  5D7G A;  4GB9 A;  1QOF A;  3AEB B;  2GBR A;  1OGW A;  3HIZ A;  4XZ4 A;  1E5W A;  1XLQ A;  3ZW3 A;  5AZH A;  2K3U A;  2KO3 A;  3ECI A;  2KVR A;  5E6P A;  4MM3 A;  1CMX B;  2L32 A;  3PHX B;  4X57 B;  3AEG B;  3H7S A;  1L6V A;  2KWV B;  3MC9 A;  2JY6 A;  4XGA B;  4P1B C;  4RM9 A;  1WGY A;  1NDD A;  4BOS C;  3KH0 A;  4RF0 A;  1PGA A;  2IY0 B;  2N7D A;  3B9J A;  4HPM B;  1VLB A;  1WMH A;  2KAJ A;  3AB5 A;  1EWC A;  5L95 C;  4P7I A;  3KQ4 A;  4LLG M;  2C7N B;  1V81 A;  5CHW A;  1VR9 A;  2RDG A;  3VHT C;  4KGS A;  2KT7 A;  1SGH A;  1I4Q A;  1XLN A;  1QOA A;  2M0A A;  4E3C A;  1JWM D;  2KFK B;  4EZJ A;  1E7V A;  1IBX B;  5JHB A;  1V6E A;  3IFW B;  2ZJD A;  4NJC A;  4ZRK A;  4XWW A;  3AE6 B;  5LLI A;  4ICU A;  4WJQ A;  3PZD A;  3OWE B;  2DYO A;  3RMK C;  2MBB B;  2WX0 A;  2LVQ A;  5JHA A;  3RUI B;  3R8B A;  2RMM A;  1JW9 D;  1P98 A;  1UD7 A;  2M17 A;  2KQS A;  2M19 A;  3VQI A;  2M56 B;  1IP9 A;  4KIK A;  3HK0 A;  3QA8 A;  4KGR A;  4J6I A;  2BYV E;  3AMZ A;  4IUM B;  2V0G A;  2Q5W D;  5IA7 A;  1UEL A;  2GI9 A;  4YSZ B;  4DHJ D;  2D2Q A;  4KV2 A;  1MG4 A;  1T0Y A;  2KAC A;  1KLG D;  2I1K A;  3IT6 B;  3VR8 B;  2V4L A;  2W3S A;  1OFF A;  1WRD B;  2KMA A;  4XX5 A;  3NZU A;  2PE6 B;  2QIE B;  2DBY A;  1E7U A;  2LJ5 A;  4IM2 A;  4LNF A;  1ZPS A;  1STE A;  3AU4 A;  1YOV B;  2LGX A;  2LGY A;  4DHZ B;  1JWS D;  3FIL A;  3T9L A;  3V05 A;  2KJH B;  3U7D A;  4IOI E;  4RF1 A;  3ZDM C;  2EKE C;  1UH6 A;  2D07 B;  2WQY B;  3HRD D;  1FCC C;  4W9I A;  2BYF A;  3NVV A;  4M01 A;  4KSL C;  3AI5 A;  3A9K A;  3WAN A;  2N9L A;  2JUO A;  1PFD A;  2LI5 A;  3X0W A;  3PSE B;  3L4P A;  3K9O B;  1HTQ A;  2GB1 A;  1TS2 A;  3DBL I;  3AE4 B;  1FRD A;  4C80 A;  4PT5 A;  5FKA C;  1ZUD 2;  3N9Y C;  4GU2 A;  1ZDV A;  2J42 A;  2O2V A;  1WM3 A;  2B76 B;  2N7E A;  2KWD A;  4WJO A;  3NS8 A;  1MFW A;  4MH8 A;  4AQ7 A;  2G3Q B;  4KSK C;  2J4X A;  3ZXR A;  2IY1 B;  4GIV A;  2ZVN A;  5L83 A;  2C7H A;  1RFA A;  4IW0 A;  3VDZ A;  3GE8 C;  5DPS A;  1TKY A;  2D3G A;  3NS1 A;  2A4Z A;  2N9E B;  4NZL B;  4RMA A;  4K7U A;  2E3T A;  3DHI C;  3VTV A;  2L83 A;  2KDB A;  1J19 A;  3SFD B;  3PS6 A;  4G3X B;  2C9W B;  3DVG X;  4GSW A;  2JX5 A;  3MHZ A;  1NBF C;  2YVC A;  1L4Z B;  1ET6 A;  2JF5 A;  3N1Y C;  1WYG A;  1RWS A;  1WZ0 A;  4BVU C;  2K22 A;  2AQ3 B;  2CR5 A;  1ZE3 D;  2MJD A;  1YX5 B;  4P6V F;  3IAS 1;  2KQ7 A;  1Z2M A;  4II2 B;  2LEK A;  3P1M A;  4LDT D;  2AQ1 B;  3QAR A;  2FID A;  3ZDT A;  2HJ8 A;  4FHK A;  4DXA B;  2J0K A;  1V8C A;  4S17 A;  2Z8L A;  1N62 A;  3Q69 A;  5D3D A;  3CSF A;  1SIJ A;  1WR1 A;  4D2K A;  2D11 A;  2K0P A;  3AUL A;  2BGF A;  1WGR A;  4MEM A;  2XK5 B;  4TMA B;  1P7F A;  1I4R A;  2KD0 A;  2ZEQ A;  4Q2J A;  3JSV B;  4K1R B;  2NR2 A;  1YN4 A;  3P4R B;  4AWJ A;  3BY4 B;  4L2Y A;  3B2G A;  1SBB B;  4AUQ C;  4AJW A;  2IDY A;  4FBJ B;  5IO9 A;  2I1J A;  4B0M A;  3UIP B;  4FLH A;  4A3P A;  5J17 A;  3L16 A;  1WF9 A;  2DX5 B;  2DAJ A;  2GBM A;  3BVG A;  4ZYS A;  2NTT A;  3KW5 B;  2FBW B;  1P1A A;  1HTO A;  2Y5B B;  4KX6 B;  4DBG A;  2D3B A;  1E8Y A;  4F8C B;  1ROE A;  2BW2 A;  2D10 A;  1DOY A;  1ISN A;  1UZX B;  1K8R B;  4I6P A;  1YIW A;  1HA5 A;  2HE7 A;  3RNE C;  1Q0W B;  1SXT A;  2V9H A;  2BKR B;  2KWU B;  4A6Q A;  4MSQ B;  2C60 A;  2KTR A;  3FAH A;  2QMT A;  3RNF C;  2KOX A;  2MH7 A;  4LCD E;  2GMI C;  3AEE B;  1XLP A;  2ON8 A;  4NAW A;  2XNA C;  1N5W A;  3PGE A;  3ZYY X;  2INC C;  3ML8 A;  2N1W A;  4G11 A;  4FJZ A;  2LGD A;  4L23 A;  3GE3 C;  1I35 A;  3ZQ4 A;  3Q6B A;  4IKG A;  4WWO A;  1ESF A;  5HHD G;  1SB3 C;  4KDI C;  2L00 B;  4YSY B;  4ARC A;  3Q3N C;  2PE9 A;  3U30 A;  3ENE A;  2G4D B;  3RPF C;  1LGR A;  2FCS A;  2M8S A;  3WAP A;  3C0R B;  1H4R A;  5BMG A;  2K9X A;  2JQR B;  1MHH E;  4BKG A;  4MJS A;  3ZO5 B;  3L13 A;  3A4S C;  4GDL A;  3O13 A;  5AZG A;  5AZF A;  2TSS A;  3RCZ A;  2MBH A;  2INP E;  2DEN B;  2ZZP B;  3MJW A;  3VFK A;  1FCL A;  3L17 A;  2MX2 A;  1Z5S B;  3M3J A;  2KAN A;  3R7Q A;  2EMS A;  2IGD A;  2PTL A;  3ZLZ A;  1M4V A;  3EFU A;  4J3O D;  4LJO B;  4XDD A;  3E9S A;  3VRA B;  4TV3 A;  4NY0 A;  2LXA A;  4FJV B;  2FUH B;  2WX1 A;  4EE2 A;  2AQ2 B;  1V1P A;  5IP4 D;  4M8N A;  2JRH A;  4YL8 A;  1YJJ A;  5MPO A;  1PUT A;  4A8X C;  4USA A;  3JYU A;  5DCN A;  2K5P A;  1WGK A;  4IWP A;  4RGM A;  3P4P B;  1ENF A;  3P42 A;  2WXI A;  2CHZ A;  4MSM B;  2MEK A;  3KWV A;  2MA9 B;  4MAC A;  1D6E C;  1JAL A;  3VVW B;  4URK A;  2L05 A;  5TSS A;  4HJK A;  2XBB C;  1C77 A;  2LHD A;  3RZF A;  2N1V A;  1EF1 A;  2L52 A;  2BWE S;  3NHE B;  4C00 A;  2LGI A;  1R4N I;  1JCK B;  3BYT B;  2VH2 A;  4US8 A;  1F0Z A;  2QC8 A;  5HI1 A;  4N6E B;  1T5X D;  2Y3A A;  3DBL B;  1K50 A;  3KUD B;  4IDI A;  4EEW A;  3L10 B;  3I57 A;  3TEY A;  3E56 A;  3N32 A;  1B1Z A;  2BBC A;  4WIP A;  4XWT A;  1L0Y B;  2LVP A;  3DWM A;  1I4H A;  1D5Z C;  1I4X A;  1MJD A;  1WGD A;  1I4P A;  2AWT A;  4P16 A;  3BZD B;  2ZPN A;  3SHQ A;  1IGC A;  3U8Z A;  5FK9 C;  2JT4 B;  2LAS A;  1GC7 A;  2BF8 B;  2YEP B;  2E6X A;  3NZ3 A;  1NI3 A;  3AU5 A;  3PTF C;  1BXT A;  3L08 A;  1AAR A;  5KHQ A;  1OTR B;  3Q8B A;  3IHP C;  3V3X A;  3VTW A;  2KFJ A;  4PS3 A;  4NJ7 A;  1NEN B;  2DYM A;  1AW7 A;  3Q3F A;  3TEW A;  4WUR A;  4W9L A;  1SJE D;  3ZJT A;  4LJP B;  1FXI A;  4K3C A;  1WXA A;  3H7P B;  3VTU A;  3W5V B;  2QSD A;  4EZK A;  1UGJ A;  1T0Q C;  3X23 A;  5BYR A;  4YTM B;  2DYB A;  1Q5W B;  2ZPY A;  1Y8R C;  2AEH A;  4DK5 A;  4RGT A;  4I6N B;  4PYZ A;  2KFK A;  5G5G A;  2PW9 A;  4CQN A;  2YEP F;  4ZHO A;  1QZE A;  1IBX A;  3UGB B;  2KJ6 A;  4DHJ B;  2WXF A;  1E8W A;  2JRI B;  2ZCB A;  3L54 A;  2AL6 A;  2WXH A;  3PVL A;  4W9C A;  2KLG A;  1U4A A;  2WXK A;  5EE9 A;  4AJY B;  2KX3 A;  3AE8 B;  3C19 A;  1A70 A;  4EOY A;  2WU5 B;  3GZN I;  5C1Z A;  3P2B A;  4FXC A;  2BS4 B;  1F9J A;  4GOC A;  3VUW A;  3OLM D;  4B0E A;  3NOB A;  4NPN A;  3O65 B;  4MGY E;  3BK2 A;  1XT9 B;  4MGZ E;  5HFY A;  4UDU C;  2WS3 B;  1QOG A;  3QAQ A;  4AS1 A;  4WWP A;  2LVO A;  4LNN A;  1C78 A;  2J0M A;  2BS3 B;  3GOE A;  3KYD D;  3DOW A;  4GDK B;  3B0A A;  2EMT A;  2NVU I;  3ZTC A;  2BWF A;  2RD0 A;  4LNO A;  5FR6 A;  3PLU A;  3DBH I;  4I6L B;  1UBQ A;  1WX9 A;  3B08 A;  4ANX A;  2W82 A;  2BYT A;  3VUY A;  2Z0D B;  2N9P C;  5C2T B;  2KDI A;  1RAX A;  3EC8 A;  2L76 A;  3BVZ A;  2QEJ C;  3JVZ X;  2KN4 A;  1S1Q B;  3KYC D;  1KH0 A;  2DZK A;  5BYQ A;  3A4R A;  4ITK A;  4JPS A;  3C8Y A;  2AYO B;  4WQM A;  1GPX A;  1YNT E;  4IM3 A;  2WGS A;  3MFG A;  3VUX A;  2IND C;  2G1E A;  5G2N A;  1UNS A;  4LK0 M;  2DWQ A;  1UWM A;  3B2F A;  4HDQ A;  4N59 A;  1EUV B;  4L1B A;  3T3N A;  2JWU A;  5DPT A;  1PGB A;  4IWQ A;  1LM8 B;  4BOZ B;  2V3N A;  1HZ5 A;  2AX5 A;  2VZK D;  3SEB A;  1WXV A;  4HKQ A;  1WYW B;  4WWN A;  4ARI A;  4P1C C;  3RD2 A;  4BFR A;  1WFY A;  4RGN A;  2RR9 A;  4EZL A;  1KM7 A;  4LDT B;  4DXG A;  4M0W B;  1HZ6 A;  3ZJU A;  1FXT B;  2BQQ A;  2L7R A;  3A1Q B;  4YTP B;  4M00 A;  1ZOY B;  3CST A;  2K6D B;  1D4B A;  5HKH A;  4K3B A;  2W55 A;  4DHZ E;  1F2R I;  3TL5 A;  2ZVO A;  4BKS A;  2DNF A;  4PS7 A;  3OJ3 A;  5JXV A;  1TKG A;  4JX1 C;  1C4P A;  1KLV A;  3OG5 A;  1VCB A;  4MGI E;  2O6V B;  1ZP0 B;  2WXO A;  1GB4 A;  5CX3 A;  2OJR A;  2CU3 A;  4A9A A;  4E74 A;  2DLB A;  1WJU A;  1LFD A;  5J18 A;  5JZE B;  2LFI A;  1JRP A;  1SE4 A;  4RM8 A;  2WDV B;  3V6E B;  2OJW A;  1V1O A;  3PPA A;  1VD2 A;  2XK5 A;  4C7Y A;  2IO1 B;  3DQV A;  1OQQ A;  4LNI A;  3JSV A;  2NPT B;  2OED A;  4WJN A;  3FIL B;  2ZW1 A;  3AEF B;  3FKY A;  4GGQ A;  2RDH A;  1E8Z A;  2JYT A;  2IJ0 A;  4B9K A;  3H9D A;  4JE3 B;  3IT4 B;  4C56 C;  4G50 A;  1ZXH A;  4M02 A;  2R2Q A;  1P9D U;  3ZIM A;  1T3Q A;  2WXG A;  1L0V B;  4WJP A;  2QIL A;  3HM6 X;  1AN8 A;  2DZM A;  2V3P A;  4KKI A;  1VZ6 A;  4KVG B;  4ASW C;  4K7S A;  2V1Y A;  2BB5 A;  3ZGZ A;  2M4N A;  1EF5 A;  1SE9 A;  2MBQ A;  3I9V 1;  4FHJ A;  2H88 B;  5FR3 A;  1GOZ A;  4PYU A;  1R7S A;  3VAW A;  4IC7 B;  1V97 A;  2NBU A;  4JIO U;  4FAD A;  1FIQ A;  5DPR A;  1RFK A;  2KKC A;  2NBW B;  2HTM E;  2UWQ A;  4HCP B;  1P7E A;  2WWZ A;  1LO5 D;  3IAM 1;  2X38 A;  1J7B A;  2N9K A;  1QIL A;  3V60 A;  3RNB C;  2PVO D;  4H2A A;  3HVD A;  1K53 A;  1WXM A;  5BYS A;  3LDZ E;  2CKH B;  1WXS A;  1LQB A;  2NMQ A;  4DWF A;  2AL3 A;  3DDC B;  1N6Z A;  3TEX A;  3A9J A;  1R4M I;  4W9F A;  4ZRQ A;  2LUE A;  1KFY B;  3RYT A;  3V61 A;  2G9H D;  1UF0 A;  1XF5 L;  1TTN A;  2R2O A;  5IOI A;  4RCO A;  4ZRP A;  2VH1 A;  2GRI A;  2WDR B;  2NTS A;  4HPP A;  3WAO A;  4E71 A;  2M0X A;  1SSN A;  3AH7 A;  5H92 C;  3AE2 B;  2MBO A;  1N61 A;  1V9J A;  2LJI A;  3DCG A;  1J7A A;  2PVG C;  3DBR I;  4G0N B;  5EE0 A;  5E6J A;  3GB1 A;  2QJL A;  3RT3 B;  1JQ4 A;  4NAM A;  4JWS C;  2Z59 B;  3B1L X;  4JGH B;  5GXG B;  5D6J B;  3TUO A;  3UQA A;  1FNV A;  1MVK A;  4BKS D;  3R2I A;  1Y56 A;  3APC A;  2DHZ A;  4TSS A;  1MI0 A;  1XXG A;  2R61 A;  4XDC A;  1L0X B;  3Q8A A;  2MP2 B;  1CJE A;  2KMM A;  1WX8 A;  3URY A;  4K81 A;  2MRP A;  1IYF A;  1L2N A;  1FFU A;  1GNU A;  4MDK E;  2CJO A;  2I38 A;  3HVZ A;  1PQS A;  1D5X C;  2IO0 B;  2KTF A;  3W1S C;  3VH3 B;  4HLE A;  1XD3 B;  3TSS A;  2X8X X;  3ZUN A;  4C4V B;  5BO4 B;  3PZ7 A;  3RI7 C;  3TMP B;  2KHW B;  5DPW A;  5EE1 A;  2WYQ A;  2JXX A;  3M95 A;  1KRH A;  1UBI A;  3WAL A;  5LXH A;  4K7W A;  2D5G A;  1C4C A;  2GOW A;  1JWU D;  4KZC A;  3QHT A;  1GG3 A;  3Q8C A;  4OHJ A;  2UYZ B;  2MQJ A;  5AUI A;  1YJI A;  2JZZ A;  1TKE A;  1HQR D;  1GB1 A;  1N5X A;  1CZP A;  1GAQ B;  2BKF A;  3W5U B;  2D3A A;  1FXA A;  4OVZ A;  3NZS A;  2DZJ A;  4HCN B;  1F52 A;  2WXP A;  2LXC A;  1OQR A;  1VJK A;  3CF6 E;  3PLV A;  4WQO B;  4PS8 A;  1PGX A;  1RM6 C;  2V4I B;  2ZNV C;  2WP9 B;  3VR9 B;  1PDX A;  1J7C A;  2ZNV B;  4JWU C;  1V80 A;  2WXL A;  2BT6 A;  1XLO A;  2GBN A;  1YJ1 A;  2CJN A;  2NBV B;  3BIN A;  1C4A A;  3A33 B;  1FNU A;  1XCT L;  2K1F A;  2BPS A;  4GXB A;  3DVN V;  4HWI B;  4A90 A;  5GMV A;  1FEH A;  3WA0 A;  3RNC C;  2CHW A;  3PHW B;  2CS4 A;  2J0J A;  2WXQ A;  3VRB B;  3RN9 C;  3OAW A;  1SE3 A;  4W9G A;  1OQY A;  3GS2 A;  4ACF A;  4W9K A;  4LNK A;  4ZDV A;  2K39 A;  4DDG D;  4N58 A;  3H6N A;  1GUA B;  3ABV B;  3AE3 B;  1T6B X;  2MJE A;  3H7P A;  5JH5 C;  2HJ1 A;  2K25 A;  4YT0 B;  4HVB A;  3NG0 A;  3N3K B;  3NJT A;  4M8M A;  1OEY J;  4BBN C;  2WHI A;  2Y5C A;  1YQ3 B;  1PYW D;  4NQL B;  1J0G A;  2J52 A;  1EWY C;  4FA6 A;  1J8C A;  2K8H A;  3ML9 A;  3WAM A;  3HUI A;  2WXR A;  3M62 B;  1T0R C;  3K9P B;  3JW0 X;  3DHH C;  1P3Q U;  1WJ6 A;  1ACC A;  4C7Z A;  1WJ4 A;  1F77 A;  1BML C;  2MLB A;  2KYW A;  4KZ0 A;  1D5M C;  2WDT B;  1KTK A;  3D32 A;  1DYQ A;  2RPQ A;  3EUB 2;  3ALB A;  4MT5 A;  3TIX A;  1SJH D;  4HRO A;  2WLB A;  1WSP A;  4RNA A;  1N63 A;  2IBI B;  1E6E B;  4II3 B;  4BBN F;  3Q3M C;  4IG7 B;  2L8J A;  4AOF A;  2ZW0 A;  1E0Z A;  3Q8F A;  4HRS A;  3N1Z C;  3AED B;  1I7H A;  3HM3 A;  5KHO A;  1P0R A;  4HEA 1;  2QCZ A;  3RUL A;  2KK8 A;  1JWA D;  3CMM B;  2IPK D;  2LHE A;  4NNJ B;  2LGS A;  1EU3 A;  1ZGU B;  3SU8 X;  1V5O A;  3UI3 A;  1EM7 A;  2BS2 B;  2J7Q B;  1I42 A;  4BAX A;  3Q14 C;  4B95 A;  5C3J B;  3NVW A;  2ACZ B;  1C79 A;  2VZK B;  1VZ8 A;  4CYE A;  1FMA D;  1S3S G;  4ZRJ A;  4GLS C;  1K51 A;  1WE7 A;  5EDS A;  1H8C A;  1HEZ E;  2RDB C;  4YWG G;  2MW5 A;  1EU4 A;  1R4M B;  2W3R A;  1I4G A;  3ZRF A;  2JZ3 B;  3RFZ B;  3ZNH B;  1ZKH A;  1TY0 A;  3WIM A;  1EO6 A;  1TZO A;  3UIO B;  3TJP A;  4XC2 A;  1WM2 A;  4WH4 A;  4WWM A;  3APF A;  3EHV A;  4YTN B;  2B3A A;  4YSX B;  1C3T A;  1YQ4 B;  3PRP B;  3KUZ A;  1YN5 A;  4OVU A;  3DBR B;  3KVF B;  3EFC A;  3IVF A;  5D3I B;  3R2T A;  1C9F A;  2LRW A;  2MBE A;  1CK1 A;  3SDL C;  1E90 A;  1X1M A;  4MM3 B;  2GBK A;  2KNB A;  1LXD A;  1C1Y B;  2C5L C;  1ZW7 A;  2WNM A;  4M0W A;  4ZHP A;  3N20 C;  3N30 A;  4B6W A;  3ZNI D;  2OHF A;  2IO3 B;  5E6N A;  3QK0 A;  2IO2 B;  3A1Q A;  1V2Y A;  2SEB D;  4FUL A;  2L3Z A;  1E8X A;  4FJY A;  3U52 E;  4A3O A;  4EFO A;  2DZI A;  3BWU D;  2PJH A;  2LZ6 A;  3QCA A;  2NS5 A;  2FCN A;  3EA6 A;  1WMH B;  3DHG C;  1SF0 A;  2OOB B;  1YQB A;  4FN2 A;  2K8B A;  4A55 A;  4YXD B;  3VH4 B;  2D3C A;  1QF6 A;  3S2A A;  1FNW A;  2O6V A;  4NQK E;  3Q2A C;  1RRB A;  1FRR A;  3H1U A;  1FFV A;  2N7J A;  3PZ8 A;  3PV1 A;  1HXY D;  4ZRI A;  2BYE A;  3EGR A;  2QDF A;  3QC8 B;  3V6C B;  5IKC M;  1MPE A;  5LNK 1;  1WXQ A;  3U7Z A;  4S0R A;  3PRZ A;  2NPT A;  4US9 A;  4IWO A;  2INN E;  4JLC A;  5T8I A;  4ICV A;  4A20 A;  1F1H A;  2N0S B;  3MC8 A;  4KIK B;  4JL9 A;  1QT9 A;  2FE8 A;  2K8C A;  1WH3 A;  3DBS A;  4JQW C;  4EKU A;  2KJR A;  1FPY A;  1A5R A;  2FAZ A;  2VRR B;  2LMC A;  1TZ1 A;  2IZV B;  4BKT A;  3GP7 A;  1TBE A;  4DQO C;  1ZXI A;  1VDV A;  1UGM A;  2XEW A;  2KWC A;  5G55 A;  4RFB A;  2WDQ B;  3DPD A;  2EEL A;  3BYY B;  3LJ3 A;  1FM0 D;  1XO3 A;  3AM9 A;  3QJZ A;  4CO7 A;  1WI0 A;  4DDI D;  4TKN A;  5BMI A;  1IGD A;  2LUM A;  3PRM B;  1C76 A;  1JRU A;  1VRA B;  3QWZ B;  5D2M B;  5CHV C;  2KX0 A;  3Q3J A;  5EE3 A;  4RGO S;  1V86 A;  1YX6 B;  1IPG A;  3CIR B;  1KJT A;  1R4N B;  4HDO A;  1TYG B;  4W9H A;  2REX A;  3MJ5 A;  3WCQ A;  1WGG A;  3LB8 C;  4KGT A;  1YD8 U;  1VZ7 A;  3A9K B;  3W9C B;  2JU6 X;  4HKZ E;  2HD5 B;  4OW0 A;  1V49 A;  3ZNZ B;  2BB6 A;  2G45 B;  2QHO A;  4OZB A;  1XCQ L;  2JSV X;  2KDE B;  2MWS B;  2IGH A;  4GN1 A;  1N60 A;  4O1N A;  4W9J A;  2KVZ A;  3ZNG C;  2FNJ B;  1TS3 A;  5CTR C;  4AP4 C;  2O2V B;  1UUP A;  4WAA A;  1ZDX A;  5HG2 A;  3SD5 A;  1SIF A;  1M94 A;  4HXD A;  1TY2 A;  3ZRC A;  4DXF A;  4XYC A;  2CU1 A;  3AV8 A;  3P63 A;  1WY8 A;  2RGF A;  3PO0 A;  3T8M A;  2KMC A;  2M1M A;  3RNG C;  1AYF A;  2A5U A;  4IM0 A;  2FCQ A;  1MHX A;  2NCN A;  2FCM A;  2Z0E B;  3W2D A;  3QX1 A;  3KUC B;  4ZOH C;  5D94 A;  1TS5 A;  2MP2 A;  2SAK A;  2O6V D;  2PMV A;  4PK1 A;  2FIF A;  1WE6 A;  5E6O A;  3UF8 A;  1MG8 A;  1E7P B;  2MSE D;  1ET9 A;  1V5T A;  2LWP A;  4KKJ A;  1L4D B;  4ZYN A;  3ZTD A;  2ASQ A;  4HJG E;  4NJ6 A;  1BT0 A;  2JVC A;  1WIA A;  2EKI A;  2PIA A;  4MH0 E;  3W1S A;  1TGZ B;  3I3T B;  1E9M A;  4C4V A;  2KDM A;  3R3M A;  1TIF A;  5IN7 A;  3TCA A;  2KZR A;  3AEA B;  3SR6 A;  5J2R A;  1BUI C;  1QQR A;  1WZ3 A;  3UQB A;  2DAF A;  1RLF A;  1L5P A;  2HTH A;  3U2S C;  3FC4 A;  1WRI A;  3I5J C;  2N4F A;  3GZN B;  2MJ3 A;  3QIJ A;  1DOX A;  2LD9 A;  3APD A;  4F7Z A;  4WAF A;  1GJZ A;  3SFE B;  5H8Y E;  1WGH A;  2PEA A;  2W54 A;  1K52 A;  2FUG 1;  2J53 A;  2GLS A;  4R3D A;  2PPH A;  1NYR A;  3NY5 A;  3ZXV A;  1RYJ A;  1Q10 A;  4N9F 4;  1B9R A;  4TUU A;  2LRU A;  3ZVV A;  2BVC A;  3AXC A;  3IXS A;  2KN5 A;  5BMH A;  3A9J B;  3TBL D;  1WX7 A;  3QQ8 B;  3OJ4 B;  1YMH E;  2RSU A;  2HDE A;  4EUT A;  1YN3 A;  2JWZ A;  3Q8E A;  3RZW C;  2GBJ A;  3DBH B;  2L0F A;  1WR6 E;  2N9X A;  1HE8 A;  3EEC A;  1UWX A;  3T3O A;  2C7M B;  3I63 C;  2IYD B;  3P4Q B;  2Y5P A;  3L0W B;  2K6Q A;  3ONS A;  1JWB D;  3IBE A;  4XE0 A;  4GMV A;  2KTR B;  2JYE A;  1CQV A;  5I4D A;  2L0T A;  2XN9 C;  1NEK B;  3NVZ A;  2PLP A;  4NAW B;  2MCN B;  3MP9 A;  4W9E A;  3AEC B;  1NI2 A;  1L6U A;  3KLS X;  1NVI D;  3BII D;  2IGG A;  4REZ A;  3V62 A;  1QOB A;  1QLB B;  1TJE A;  3ETR A;  3R66 C;  3R7R A;  3BK1 A;  3CWI A;  2ICI A;  5C23 A;  5AUK A;  2I2Y A;  1DGJ A;  3DWG C;  5TR5 A;  3LYY A;  3J9C A;  4OVV A;  2KLC A;  3PT2 B; 
#chains in the Genus database with same CATH homology
 1ROE A;  2BW2 A;  1KLU D;  5C3J B;  3NVW A;  1DOY A;  5JXV A;  2ACZ B;  1C79 A;  2KQ4 X;  2VZK B;  1VZ8 A;  1TKG A;  4JX1 C;  1C4P A;  1FMA D;  1JRO A;  4GDL B;  1DOI A;  4GLS C;  1K51 A;  3AE5 B;  3KWL A;  1F2R C;  1HA5 A;  1HEZ E;  4YWG G;  3BVM A;  1ZP0 B;  2WXO A;  1EU4 A;  1SXT A;  1GB4 A;  4A6Q A;  2W3R A;  2CU3 A;  1AWD A;  4OZC A;  4A9A A;  1I4G A;  2DLB A;  2H89 B;  3AE1 B;  5G5H A;  3FAH A;  1E10 A;  2QMT A;  3RFZ B;  3NUH B;  1TY0 A;  2LFI A;  2MH7 A;  4RH6 A;  3AEE B;  1JRP A;  1XLP A;  1SE4 A;  2ON8 A;  1TZO A;  2L1A A;  2WDV B;  2XNA C;  1V1O A;  1N5W A;  2WU2 B;  4WH4 A;  4WWM A;  4YTN B;  3ZYY X;  4C7Y A;  1QKZ A;  3AE7 B;  4YSX B;  1YQ4 B;  1OQQ A;  1YN5 A;  2OED A;  4LTU A;  3FIL B;  2ZW1 A;  2JZP A;  3AEF B;  1V1P B;  5D3I B;  3R2T A;  2RDH A;  2WXJ A;  1C9F A;  1JML A;  3AE9 B;  4L23 A;  1CK1 A;  2JYT A;  2IJ0 A;  4MM3 B;  3ZQ4 A;  4JE3 B;  3IT4 B;  3H8H A;  4IKG A;  2WNM A;  4M0W A;  4C56 C;  1ESF A;  4ZHP A;  5HHD G;  2PKO A;  1SB3 C;  1XEE A;  1ZXH A;  2OHF A;  3NVY A;  4YSY B;  1T3Q A;  2WXG A;  1L0V B;  4OZA A;  4ARC A;  2SEB D;  4TQ1 A;  2QIL A;  1AN8 A;  3U52 E;  2RPV A;  2V3P A;  3RPF C;  4KKI A;  1VZ6 A;  3TEZ A;  3ZJV A;  3BWU D;  2ONQ A;  2BB5 A;  5BMG A;  3ZGZ A;  3LXF A;  1WWT A;  2K9X A;  3EA6 A;  2JQR B;  3I9V 1;  1MHH E;  1SE2 A;  1SF0 A;  3U4E G;  2H88 B;  5FR3 A;  4A55 A;  4YXD B;  1GOZ A;  1SEB D;  3O13 A;  1R7S A;  2TSS A;  1KF6 B;  3P4S B;  1QF6 A;  1V97 A;  2INP E;  1FNW A;  1FIQ A;  1FRR A;  1RFK A;  2JXT A;  1FFV A;  1FCL A;  2N7J A;  2HTM E;  3MC0 B;  3PZ8 A;  4TQ0 A;  1HXY D;  1P7E A;  2BTE A;  3EGR A;  2WXN A;  1LO5 D;  1IUE A;  3NRZ A;  1TS4 A;  2IGD A;  2PTL A;  3IAM 1;  1M4V A;  2X38 A;  4J3O D;  1FD6 A;  3AN1 A;  1J7B A;  2N9K A;  1QIL A;  1NYQ A;  2PVO D;  3HVD A;  4H2A A;  2WXM A;  1K53 A;  3E9S A;  4XDD A;  1FO4 A;  5D7G A;  3VRA B;  1MPE A;  1QOF A;  5LNK 1;  3AEB B;  1WXQ A;  5BYS A;  3U7Z A;  4EE2 A;  4US9 A;  2AQ2 B;  1V1P A;  2INN E;  5T8I A;  2NMQ A;  1XLQ A;  2N0S B;  3TEX A;  2K3U A;  4ZRQ A;  1KFY B;  1YJJ A;  1QT9 A;  5MPO A;  2FE8 A;  2L32 A;  1PUT A;  2G9H D;  4A8X C;  1XF5 L;  3AEG B;  4USA A;  1L6V A;  2K5P A;  1WGK A;  4RGM A;  4RCO A;  4ZRP A;  3P4P B;  1ENF A;  3P42 A;  2WXI A;  2GRI A;  2WDR B;  2NTS A;  1SSN A;  3AH7 A;  1PGA A;  2LMC A;  2MEK A;  4RF0 A;  3KWV A;  5H92 C;  3AE2 B;  3GP7 A;  4MAC A;  4DQO C;  1D6E C;  1JAL A;  1ZXI A;  1N61 A;  3B9J A;  2LJI A;  5TSS A;  1VLB A;  1J7A A;  1VDV A;  2PVG C;  5EE0 A;  1C77 A;  2LHD A;  5E6J A;  3GB1 A;  2QJL A;  4RFB A;  2L52 A;  2KAJ A;  2WDQ B;  4NAM A;  1JQ4 A;  3AB5 A;  1EWC A;  2LGI A;  2EEL A;  4JWS C;  3KQ4 A;  3BYY B;  1FM0 D;  1XO3 A;  3AM9 A;  1JCK B;  4LLG M;  5GXG B;  3BYT B;  3TUO A;  4US8 A;  1VR9 A;  2RDG A;  5BMI A;  1IGD A;  1F0Z A;  4KGS A;  2LUM A;  5HI1 A;  1FNV A;  1MVK A;  4N6E B;  1C76 A;  1I4Q A;  1QOA A;  1XLN A;  2M0A A;  3R2I A;  1Y56 A;  1T5X D;  2Y3A A;  1VRA B;  1JWM D;  4TSS A;  1MI0 A;  1K50 A;  5EE3 A;  4IDI A;  1XXG A;  2R61 A;  4RGO S;  4XDC A;  1IBX B;  1L0X B;  3Q8A A;  1CJE A;  2KMM A;  3I57 A;  3CIR B;  3TEY A;  3E56 A;  4NJC A;  3URY A;  1TYG B;  3AE6 B;  4XWW A;  1B1Z A;  2BBC A;  4WIP A;  3MJ5 A;  1FFU A;  3WCQ A;  4XWT A;  1L0Y B;  3OWE B;  3LB8 C;  2DYO A;  4KGT A;  2CJO A;  1VZ7 A;  2I38 A;  3HVZ A;  2JU6 X;  1I4H A;  3DWM A;  1D5Z C;  1I4X A;  4HKZ E;  3W9C B;  1D5X C;  4OW0 A;  3R8B A;  1I4P A;  2RMM A;  4P16 A;  1JW9 D;  3BZD B;  2BB6 A;  4OZB A;  1XCQ L;  2M19 A;  2JSV X;  1IGC A;  2IGH A;  3VQI A;  2M56 B;  3TSS A;  5FK9 C;  1N60 A;  4KGR A;  3PZ7 A;  4O1N A;  3AMZ A;  2YEP B;  2E6X A;  1TS3 A;  1NI3 A;  3NZ3 A;  2V0G A;  2Q5W D;  1BXT A;  5EE1 A;  1UUP A;  2GI9 A;  4YSZ B;  1KRH A;  3Q8B A;  1ZDX A;  5HG2 A;  3V3X A;  2D5G A;  1C4C A;  1JWU D;  1TY2 A;  4DXF A;  2KAC A;  3AV8 A;  3Q8C A;  3P63 A;  4OHJ A;  1NEN B;  2DYM A;  1AW7 A;  1KLG D;  3TEW A;  3IT6 B;  3PO0 A;  4WUR A;  1SJE D;  3VR8 B;  3ZJT A;  2W3S A;  5AUI A;  1YJI A;  1FXI A;  1OFF A;  1TKE A;  1AYF A;  1HQR D;  1GB1 A;  1N5X A;  1CZP A;  1GAQ B;  3W5U B;  3W5V B;  2QSD A;  2QIE B;  1FXA A;  2DBY A;  4OVZ A;  1UGJ A;  1MHX A;  5BYR A;  4YTM B;  1ZPS A;  1STE A;  2WXP A;  4RGT A;  1JWS D;  1OQR A;  1VJK A;  3FIL A;  5G5G A;  3W2D A;  3V05 A;  2PW9 A;  4ZOH C;  2YEP F;  4IOI E;  4RF1 A;  4ZHO A;  4CQN A;  1PGX A;  1TS5 A;  1RM6 C;  2V4I B;  1IBX A;  3HRD D;  2WQY B;  2SAK A;  2WXF A;  1FCC C;  2PMV A;  2WP9 B;  3VR9 B;  3NVV A;  1PDX A;  2WXH A;  1E7P B;  1J7C A;  1ET9 A;  4JWU C;  2WXL A;  2BT6 A;  1XLO A;  2WXK A;  5EE9 A;  2N9L A;  4KKJ A;  1L4D B;  1PFD A;  2CJN A;  3AE8 B;  1A70 A;  4HJG E;  1C4A A;  1FNU A;  1XCT L;  2EKI A;  2PIA A;  3W1S A;  2WU5 B;  4A90 A;  1E9M A;  1FEH A;  3L4P A;  2GB1 A;  1TS2 A;  3AE4 B;  1FRD A;  2KDM A;  4FXC A;  2BS4 B;  2WXQ A;  4C80 A;  4PT5 A;  5FKA C;  3VRB B;  1ZUD 2;  3N9Y C;  3AEA B;  1SE3 A;  1ZDV A;  2J42 A;  4B0E A;  3SR6 A;  1BUI C;  3GS2 A;  2B76 B;  1QQR A;  2KWD A;  3BK2 A;  1L5P A;  4MH8 A;  4N58 A;  5HFY A;  4UDU C;  3U2S C;  4AQ7 A;  2WS3 B;  3FC4 A;  3ABV B;  1QOG A;  2J4X A;  1WRI A;  1T6B X;  3AE3 B;  4AS1 A;  2MJE A;  1C78 A;  2MJ3 A;  1DOX A;  4YT0 B;  2BS3 B;  4WAF A;  4GDK B;  3SFE B;  1TKY A;  5H8Y E;  2W54 A;  1K52 A;  2FUG 1;  2J53 A;  2Y5C A;  1YQ3 B;  1PYW D;  4R3D A;  2J52 A;  1EWY C;  1NYR A;  3NS1 A;  1RYJ A;  2W82 A;  1Q10 A;  4NZL B;  2BYT A;  1B9R A;  3HUI A;  2WXR A;  2E3T A;  2L83 A;  5C2T B;  3SFD B;  3IXS A;  1ACC A;  5BMH A;  3MHZ A;  2JX5 A;  4C7Z A;  3BVZ A;  1YMH E;  2QEJ C;  1L4Z B;  1F77 A;  2KN4 A;  1ET6 A;  1BML C;  2HDE A;  1WYG A;  1YN3 A;  3Q8E A;  1RWS A;  1D5M C;  1KH0 A;  5BYQ A;  4ITK A;  4JPS A;  2K22 A;  3C8Y A;  2AQ3 B;  1ZE3 D;  1KTK A;  2MJD A;  4WQM A;  1UWX A;  3T3O A;  1GPX A;  4P6V F;  3IAS 1;  1YNT E;  1DYQ A;  3EUB 2;  3MFG A;  3P4Q B;  2LEK A;  3P1M A;  2Y5P A;  2AQ1 B;  2G1E A;  4MT5 A;  1UNS A;  1SJH D;  1JWB D;  4LK0 M;  4HRO A;  4XE0 A;  2WLB A;  1WSP A;  2DWQ A;  1UWM A;  2JYE A;  3B2F A;  4RNA A;  1N63 A;  1E6E B;  4N59 A;  1V8C A;  2Z8L A;  1CQV A;  4L1B A;  1N62 A;  3Q69 A;  5D3D A;  4D2K A;  1SIJ A;  5I4D A;  2K0P A;  2JWU A;  2XN9 C;  1NEK B;  3T3N A;  3NVZ A;  1PGB A;  2PLP A;  4NAW B;  3MP9 A;  3AEC B;  2V3N A;  1L6U A;  1HZ5 A;  3KLS X;  4TMA B;  1NVI D;  2AX5 A;  3BII D;  1P7F A;  2IGG A;  2VZK D;  3SEB A;  4HKQ A;  1I4R A;  4Q2J A;  4REZ A;  4ARI A;  1YN4 A;  3P4R B;  1QOB A;  1QLB B;  1TJE A;  3ETR A;  4L2Y A;  3B2G A;  1SBB B;  2ZW0 A;  3Q8F A;  1E0Z A;  4HRS A;  3AED B;  1I7H A;  2IDY A;  4RGN A;  4HEA 1;  3BK1 A;  4B0M A;  4DXG A;  3CWI A;  2ICI A;  5AUK A;  1HZ6 A;  3ZJU A;  1JWA D;  2IPK D;  2I2Y A;  1DGJ A;  2LHE A;  3DWG C;  4YTP B;  3BVG A;  1EU3 A;  1ZOY B;  1D4B A;  3LYY A;  2W55 A;  4ZYS A;  3J9C A;  2NTT A;  3UI3 A;  2FBW B;  1EM7 A;  2BS2 B;  1F2R I;  4KX6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...