1QKZA

Fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
58
structure length
58
Chain Sequence
VTTYKLVINGKTLKGETTTKAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G-PRIME
publication title Crystal Structure of an Fab Fragment in Complex with a Meningococcal Serosubtype Antigen and a Protein G Domain
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immune system
total genus 14
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1999-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qkzA00
2JXTA 2NMQA 4WH4A 2J53A 5HFYA 1XCQL 1XCTL 5HI1A 4KGTA 1FCCC 4KGRA 1F2RC 2N7JA 2PTLA 3FILA 2QMTA 4IKGA 4HJGE 4HKZE 1MHXA 2RPVA 2I2YA 1F2RI 5JXVA 1PGAA 4OZAA 2N9LA 1YMHE 3V3XA 1MVKA 5BMIA 2KN4A 2EELA 2JWUA 1C9FA 1YNTE 4IOIE 5BMHA 1HEZE 5BMGA 2LHDA 1FCLA 2JZPA 1K51A 1P7FA 2ZW0A 3MP9A 4OZBA 1HZ5A 2KWDA 1UWXA 1PGBA 3GB1A 2RMMA 2N9KA 1FD6A 2IGDA 4MACA 2PW9A 2KQ4X 5HHDG 2PLPA 1K52A 2LHEA 2I38A 1ZXHA 2LUMA 2LGIA 4D2KA 1GB4A 4GLSC 2GB1A 2GI9A 1K53A 1IGDA 2ONQA 2ON8A 5HG2A 1XF5L 1QKZA 1MPEA 4KGSA 2JU6X 1GB1A 1KH0A 2K0PA 1PGXA 2J52A 1IBXB 2KACA 1K50A 1IGCA 2OEDA 1JMLA 1Q10A 1EM7A 1MHHE 1MI0A 1P7EA 1HZ6A 2IGHA 4OZCA 2JSVX 2KDMA 3UI3A 1IBXA 2QSDA 2ZW1A 2IGGA 1D4BA 3FILB
chains in the Genus database with same CATH superfamily
1TS2A 4G3XB 4MJSA 1OEYA 4US9A 4IC7B 5LXIB 1KLUD 1XCQL 2KVZA 1F0ZA 1KOTA 1WGGA 1VZ8A 4A8XC 1ROEA 2G45B 2MA9B 1P3QU 4ZHPA 3EHVA 2Q5WD 1L7YA 1MJDA 1OEYJ 4RGMA 2KDEB 1NYQA 2KN4A 3WA0A 3SFEB 4TKNA 1WX7A 1TJEA 1NEKB 3VHTC 2EMSA 1I4RA 2CU3A 2G4SA 4PS7A 2K9XA 3PSEB 3AULA 3LJ3A 3TJPA 4JWUC 5EDSA 5JH5C 3VTVA 5TSSA 1CMXB 3AI5A 2RMMA 2KAJA 1D6EC 2L3ZA 2IDYA 3K9PB 3A4SC 3ENEA 3W1SC 1D5XC 2LGXA 2JWZA 2ZZPB 3HM6X 1ESFA 3C0RB 1FM0D 3Q8FA 3CSTA 2D5GA 4WWOA 4H2AA 1WRIA 1I4XA 2BBCA 4I6PA 2X8XX 3L17A 1YN4A 2WDQB 2MQJA 3HIZA 4URKA 1KH0A 2KD0A 2MP2B 4RMAA 1I4QA 1Z2MA 2KXJA 3PGEA 2QC8A 5L95C 3MC9A 1E5WA 4IM3A 2K5PA 4C4VB 1AARA 1WM2A 3VTWA 1ZUD2 4BOSC 3OJ3A 2DZJA 2MBHA 1WX9A 3FAHA 4MH8A 1IUEA 3RNCC 3W1YA 3MHSD 3DQVA 5IKCM 4P1CC 3KWVA 4GDLB 4KV2A 2HTME 3SR6A 1TIFA 1ZW7A 3EFUA 2O6VD 4KGTA 3UQAA 1F2RC 4WQMA 4HPPA 2MWSB 3AEGB 1YQBA 3Q14C 4W9EA 2LVOA 3R3MA 3W5VB 4KSLC 5BMIA 3R2TA 4BBNF 3VAWA 3VH3B 1GC7A 4PYZA 5TR5A 2GBMA 4XDDA 1WX8A 2DZKA 1L6VA 3I9V1 2CKHB 3AV8A 3NS1A 2AL6A 1FXAA 4FJZA 1P7FA 2KDBA 3UGBB 2IZVB 3UIOB 4ZRJA 2XBBC 1UZXB 2L1AA 4EZKA 4DK5A 2LD9A 1I4PA 1K8RB 2KOXA 1P1AA 4AUQC 3U7DA 1FRDA 2DBYA 4FHKA 3TEXA 2K39A 2D07B 2G1EA 4LCDE 2BVCA 1BT0A 2BYFA 2WQYB 3RNAC 2MRPA 2LUMA 1QZEA 4GDKB 2W82A 4F7ZA 2GB1A 2WXLA 1NDDA 3PRMB 2GBRA 1CQVA 1AW7A 4ZYSA 2C9WB 4O1NA 3W1SA 3VDZA 2PVGC 4LK0M 4YSYB 2K8CA 4P1BC 4AOFA 2KLGA 4LNFA 3IT6B 2LVPA 2NS5A 4NZLB 1MHHE 3PO0A 2IGHA 3X0WA 1M4VA 1FNUA 2SEBD 3HRDD 1NI2A 1BUIC 2JXTA 4MGKE 3VRBB 3NZ3A 2L76A 3AM9A 3ZRFA 1I4HA 3JYUA 2MJ3A 3FKYA 5KHQA 4W9LA 2ACZB 2YEPF 2V4IB 2R2OA 3RYTA 4C7ZA 4B6WA 4K7UA 2MEKA 1J0GA 1FNVA 4K1RB 5D6JB 1EO6A 2L05A 4G50A 3ZXRA 2BYVE 4DDGD 4FLHA 2QCZA 4WURA 3Q3MC 4RM9A 1YNTE 1ZOYB 2O6VB 2A5UA 1JWMD 1QOAA 4TQ1A 2KMAA 4DDID 2JZPA 3W9CB 1SE9A 2DNFA 2KZRA 1NVID 4YXDB 1JALA 2VZKD 5D7GA 3H6NA 1J7BA 2W54A 3Q6BA 1Q5WB 2D3BA 4DHZE 3V6EB 5I4DA 2OOBB 3B2GA 1GG3A 3DVGY 1VRAB 1S1QB 3L08A 4FJYA 2KTRA 2NVUI 3U52E 2KHWB 4ZRIA 4ZYNA 4DWFA 3N30A 3PLVA 1E10A 3RNFC 1ET6A 1SJHD 5L83A 5AUKA 4W9FA 3CSFA 4AS1A 2QIEB 4MDKE 3P63A 3TSSA 2QHOA 4DBGA 1JMLA 2BYEA 3NZSA 1WM3A 4HDOA 3IAM1 2O2VB 3ZYYX 1L4DB 5JHBA 4NNJB 4CYEA 4NPNA 2MJDA 3IHPC 4ACFA 4HRSA 4G11A 2ZEQA 1C1YB 3HUIA 4YSZB 4RGOS 3Q3JA 3MC8A 3AE5B 2G3QB 4KKIA 2N7JA 2V3PA 4XWWA 3WANA 4IKGA 3ZJUA 1ACCA 2RPVA 1TKYA 4KX6B 1WXQA 2KN5A 4FA6A 3JW0X 4M0WA 5H8YE 4J6IA 2JWUA 1U4AA 5DPTA 3QK0A 3EC8A 4IOIE 1HEZE 2KWCA 3NS8A 3B9JA 1FCLA 1JWUD 4NAWB 1Q1OA 3CWIA 2NR2A 1WJ4A 3GOEA 1NBFC 3DBLI 4HPLB 4YL8A 3AE2B 2LRUA 4ZHOA 3AEFB 3CMMB 3M95A 1TS3A 4L1BA 2E3TA 3R66C 3HHMA 2LHEA 2JVCA 5BYQA 3APCA 2VZKB 3RULA 4D2KA 3OG5A 3B08A 3ZIMA 1VDVA 2NPTB 3GZNI 2NCNA 1ENFA 3DWMA 3L16A 3RNEC 3IT4B 3APDA 3U2SC 2O2VA 2KX3A 1Q0WB 1RLFA 2FCMA 4WWPA 1SE2A 4EKUA 1V80A 2K6DB 3KW5B 3ALBA 2JYEA 2M1MA 2IYDB 1E7VA 3QIJA 3P4SB 1DOIA 1QT9A 2IO2B 1IBXA 1OFFA 2K8BA 2KJRA 3TIXA 3UIPB 1JRUA 3OJ4B 2CR5A 4C00A 4WIPA 1FRRA 2PVOD 3AU5A 3MTNB 2YVCA 4JE3B 3FILA 2QMTA 3RN9C 2FAZA 3NVVA 2WLBA 2FUG1 4GU2A 4AJWA 4GB9A 3M63B 3PRZA 4JWSC 3A1QB 1TZOA 1HTQA 5FR6A 3VTUA 3FC4A 4YSXB 1WE6A 3WAPA 4K3BA 4LTUA 4RGTA 4M8MA 4A9AA 4MM3A 2LHDA 1X1MA 4ZRQA 1YJIA 1E9MA 1J8CA 4EE2A 3RI7C 3TMPB 2W3SA 2N1VA 1HA5A 1PGBA 2IGDA 3KUCB 2M0AA 2WDTB 1JWBD 2PW9A 2WHIA 2M19A 1XT9B 3DBHI 3KLSX 4NJCA 4KDIC 3TL5A 2WYQA 2KKCA 2AX5A 2KFKA 4X57B 1SIJA 4XYCA 2K3UA 1QOBA 3V61A 1QF6A 2LUEA 2PMVA 1V6EA 5IA7A 2SAKA 3DCGA 4DQOC 1WYWB 2D2QA 1YIWA 2WXHA 3AEBB 4E74A 4LNNA 1IGCA 4TUUA 1V9JA 5BYRA 1M94A 2YEPB 1YOVB 4BKGA 2EKEC 4P16A 1D4BA 2KTFA 4OVUA 2WP9B 2ZNVC 1WRDB 1CK1A 2N0SB 4HVBA 3DVGX 1A5RA 3L4PA 4LDTB 2QILA 4PS8A 2M4NA 4XE0A 3A1QA 4A6QA 3NY5A 3ZXVA 1WH3A 4WQOB 1PQSA 4AJYB 4HKZE 2J0MA 4ZDVA 3N1ZC 4ANUA 2N9LA 3AE8B 3BZDB 5D2MB 2N7DA 5E6OA 3AE7B 5J18A 3OWEB 3DBRI 2ZNVB 1E8YA 1G6JA 1R4NI 2CJNA 2JRIB 4PT5A 5G2NA 4B9KA 5C1ZA 1RAXA 3MHZA 3PHWB 4KZCA 1V5TA 2ZJDA 2V9HA 1T6BX 4JIOU 5D3DA 1E90A 1YJJA 3DHIC 2G9HD 5CHVC 2Z59B 1IPGA 1RYJA 1UBIA 3A9JA 3NOBA 1XEEA 2NBVB 2QEJC 2WS3B 2LGIA 4HWIB 4REZA 3KVFB 4ICVA 3HVDA 4GLSC 3ZDTA 4BKSA 3VUWA 4S17A 1MG8A 2HTHA 4ICUA 3EECA 3VUXA 4LNOA 2ON8A 3U30A 2XNAC 2BS4B 3PZDA 2OHFA 1WMHA 5G55A 3ZNHB 4KSKC 2H89B 1WR1A 1Z5SB 3UF8A 2K0PA 2WXKA 1PGXA 3MC0B 4IM0A 3VFKA 3IXSA 1E8ZA 4ASWC 1EM7A 1ZKHA 3NUHB 4NQKE 1E8WA 2C7NB 1P7EA 4PK1A 2BGFA 2W55A 1V1OA 2JSVX 4M02A 1QOGA 5IAAC 1UD7A 2ICIA 4YWGG 3ML9A 3X23A 2WXOA 1ZPSA 2K6QA 4YTNB 1T3QA 4WH4A 2J53A 3M3JA 2L83A 1B9RA 3ZQ4A 4BOZB 4IG7B 2KWUB 3MJWA 4MSQB 2N4FA 2Y5PA 1KLGD 1GOZA 1SF0A 2ZCBA 4HROA 1EU4A 2KT7A 1T0YA 4W9KA 1KF6B 4A90A 1UH6A 2KVRA 2J42A 3DWGC 1KLVA 4N58A 3EGRA 1WXMA 4TSSA 2JF5A 3GS2A 1XLOA 4WJPA 2CHWA 1YJ1A 4HXDA 1T0RC 1JROA 3AEEB 3NVYA 2ZVOA 1YQ3B 3H8HA 2JYTA 4DHJD 4XGAB 4LNKA 5AZFA 4GXBA 4M8NA 5EE1A 3R7QA 4FADA 2LMCA 1TGZB 1GB1A 2FCSA 2GLSA 3ETRA 3ECIA 4GIVA 2AQ3B 2GOWA 1F1HA 1R4MI 3T3OA 3KH0A 4YTMB 2MSED 3U7ZA 2E6XA 3DHHC 1MI0A 2MP2A 2ZCCA 2EMTA 4W9HA 2HD5B 1SE3A 3UI3A 4N6EB 2DLBA 4C4VA 2KC1A 4JQWC 1UF0A 4W9IA 3NG0A 2NMQA 4LLGM 2RDHA 4II3B 2L7RA 1AN8A 4MGZE 2IJ0A 2J0JA 1E7PB 1IYFA 2OJRA 1ZP0B 2B3AA 4GDLA 1YMHE 4KIKB 3Q3FA 4LNIA 3N9YC 2N9PC 3ZNGC 5BMGA 5EE9A 3VUYA 3PVLA 3L0WB 1C76A 1C4AA 1VZ6A 1FFUA 4YT0B 3ONSA 4HJKA 1YX6B 1UWXA 2GBKA 2DYBA 3DBLB 3RD2A 2WXQA 1TYGB 3Q3NC 3BWUD 2KK8A 2KQ4X 1FFVA 1VJKA 1AYFA 3PRPB 2DAJA 1WE7A 4B0MA 1CZPA 1N63A 1WXAA 5C3JB 5IO9A 3P4PB 1DOYA 4M00A 3NZUA 4MT5A 1BMLC 2INPE 2L32A 1V49A 2INDC 3LB8C 3N32A 2XK5B 3GZNB 4M01A 3J9CA 5DPRA 1XF5L 1MPEA 2J0KA 5CX3A 2UWQA 3BYTB 4GDKA 4US8A 4DHJB 3A9KB 3AXCA 1XQQA 2M8SA 2D3AA 1VD2A 1V1PB 2BB6A 4CQNA 4ARIA 1UGMA 1NYRA 2RGFA 2INNE 1WIAA 3PLUA 2K25A 3PREA 2PPHA 1EWCA 1GUAB 5FR3A 3HK0A 1HE8A 2LGSA 3JSVB 1OQQA 3VXWA 1VR9A 4ZRKA 2LFIA 5D3IB 2FCQA 1MG4A 4A55A 2KQ7A 1N60A 1D5ZC 3PPAA 3UQBA 2W9NA 1WZ0A 4ITKA 1GJZA 2WXMA 3EUB2 1XCTL 2Z0EB 4RFBA 1TBEA 1I7HA 2FBWB 3V62A 5CHFA 1F2RI 3KUZA 3RNGC 1UWMA 2BWES 3DVNV 2BW2A 4K3CA 3KYCD 4DXFA 5BMHA 3K9OB 3Q8EA 4P7IA 3QAQA 4KVGB 3B2FA 2RSUA 2JUOA 4W9DA 1F9JA 2MLBA 2O6VA 1RWSA 3ZJTA 1FD6A 4R3DA 5EE3A 1UUPA 1YQ4B 3AECB 3AH7A 2PLPA 3DBHB 2J4XA 2I38A 1ZXHA 1V86A 5J2RA 2H88B 1H4RA 4GN1A 4MELA 1I35A 4TMAB 1C4CA 3N1YC 3QQ8B 4TV3A 1OQRA 2WDVB 4E3CA 5AZGA 2J7QB 1V1PA 3DBSA 3NHEB 4W9GA 3QC8B 1KFYB 5LLIA 4WJQA 4JL9A 2V1YA 2MBOA 3IFWB 1J7AA 3N3KB 3SD5A 1GC6A 3EA6A 2WU2B 3T3NA 1C78A 1EF5A 1WGKA 1L0XB 1SGHA 2KDMA 2FCNA 3BVMA 2D3GA 2C60A 1RRBA 4BBNC 1FXIA 2CS4A 5JHAA 2IY1B 1YN5A 2VRRB 1WI0A 4N9F4 2Y5CA 1TTNA 3N1XC 2BTEA 2I1JA 3RMKC 1MHXA 5JXVA 1PGAA 1UELA 2KO3A 1TY0A 2RD0A 1PDXA 4XC2A 4IWOA 1JWAD 1V5OA 3WAMA 1WFYA 1R4NB 3CIRB 3V6CB 1N61A 4FBJB 2HE7A 2Z8LA 5BO4B 1HZ5A 2FIDA 2KQSA 3W2DA 3NJTA 1PUTA 3AE1B 4ANWA 1WGYA 3B1LX 4MH0E 3BVGA 4FXCA 4FHJA 4ANXA 3V05A 4USAA 3VQIA 1EU3A 4NAWA 5AUIA 3Q2AC 4LJPB 2BWFA 4KZ0A 2CJOA 3AMZA 1TS4A 4BAXA 3H7PB 4GSWA 1MFWA 5T8IA 2NTTA 4CHKA 2DWQA 5E6JA 1FIQA 3DVNU 1ZE3D 2GRIA 4KGSA 3BVZA 2UYZB 1YD8U 5E6PA 2CU1A 4LJOB 1L0VB 5KHOA 4C7YA 2V0GA 2NPTA 3L54A 4TQ0A 4IDIA 4HDQA 4F8CB 1FMAD 1WJNA 4XX5A 3U4EG 4MJSB 2BB5A 2KLCA 2WXGA 4GGQA 3PTFC 4BVUC 2MCNB 4HLEA 2MBQA 4AWJA 4Q2JA 2KYWA 2IGGA 3ZTCA 1IP9A 4JLCA 4HPMB 2LJ5A 2D11A 1N62A 2RDBC 1TZ1A 2KNBA 1TY2A 2G4DB 3V3XA 1C9FA 2MH7A 3D32A 3QJZA 4EUTA 4KKJA 2IO1B 4DXGA 2DZIA 2GMIC 2N9EB 2WXNA 2MBBB 4E71A 1WF9A 4HCPB 4FJVB 5IOIA 5JZEB 2L0TA 1F52A 3GB1A 3I63C 3WCQA 2KANA 2K1FA 4I6NB 4OHJA 2JQRB 2OJWA 1WY8A 3AE4B 1K52A 3R8BA 3SHQA 3ZNID 1HTOA 4RM8A 4I6LB 3NVWA 5CTRC 1GNUA 1SE4A 4BZAA 2CHZA 2C7MB 1SJED 5CHWA 3HVZA 3Q69A 1P0RA 3RFZB 4OVZA 1JW9D 2FUHB 1C79A 2A4ZA 1R4MB 4RNAA 3ZJVA 3ML8A 3AE3B 4HCNB 3QCAA 1HZ6A 5EE0A 3BK1A 1KRHA 2MW5A 1E6EB 3ZNZB 1V8CA 4EOYA 4B95A 2KC2A 2WWZA 1LO5D 2RR9A 4OW0A 4NJ6A 2DZMA 2ZPYA 2JZZA 2KJ6A 1QILA 1C77A 2WXIA 4NJ7A 1D5MC 5GMVA 2M0XA 3AN1A 2V4LA 2VH2A 1TKEA 1P98A 2Y5BB 4JX1C 4P6VF 2RDGA 3ABVB 3ZLZA 1H8CA 5GXGB 2BT6A 2LGYA 1J19A 3P4RB 4WJNA 3DPDA 2IPKD 2ZW0A 4HK2A 2L8JA 3QA8A 1FEHA 3BK2A 3BYYB 3H1UA 1B1ZA 1RFAA 2GBNA 1OQYA 5HHDG 4DHZB 3O13A 1V2YA 4K81A 4IWQA 4FULA 3CF6E 4NY0A 2LGDA 4YTPB 3VH4B 3IBEA 2HJ1A 2JPHA 1P9DU 2LASA 1K53A 1V97A 2LRWA 1SSNA 1SEBD 3M62B 4JGHB 3Q3OC 5C23A 4ANVA 4XWTA 1FNWA 1WJ6A 1C3TA 2HJ8A 5DPSA 5BYSA 2J52A 2BKRB 1K50A 1ET9A 1Q10A 3P4QB 1HQRD 3PT2B 3Q8BA 3SU8X 3ZGZA 3RUIB 4OZCA 4C80A 3RPFC 4BFRA 2BQQA 2LXCA 2NBUA 3RCZA 1T0SC 3WIMA 4RGNA 3GE3C 5MPOA 1QOFA 1VZ7A 2IBIB 2BF8B 1BXTA 1L6UA 4II2B 2R61A 2C7HA 1E7UA 5HI1A 3GP7A 2TSSA 2WXRA 1OGWA 1XD3B 1SB3C 1WJUA 3BINA 2I2YA 2C5LC 4IW0A 2DX5B 2INCC 3S2AA 3DHGC 1VLBA 4IM2A 1KM7A 1LXDA 4A3PA 3TEWA 1LFDA 3MP9A 2PEAA 1V81A 1PYWD 1YX5B 2KMMA 3QARA 2KTRB 4K7SA 2EKIA 4PS3A 3NRZA 2X38A 2ZVNA 1ZDVA 4L23A 3O65B 4A20A 3P2BA 3AU4A 2WNMA 4WAFA 2REXA 2L00B 1I4GA 2ZPNA 2LXAA 2NTSA 2D10A 3A33B 2JY6A 4RF0A 4CO7A 3A4RA 3BY4B 5HG2A 1QKZA 1XXGA 4WJOA 2K22A 1LQBA 4EFOA 2YLMA 1SIFA 4WWMA 1Y8RC 3MJ5A 4EZLA 2V3NA 1NENB 1JRPA 1D3ZA 2JX5A 1I42A 1XO3A 4S0RA 5J17A 4J3OD 1DGJA 3ZW3A 2QSDA 5FK9C 4K7WA 1N5WA 2WXFA 1LGRA 1JCKB 2KX0A 3KYDD 3RZWC 1JQ4A 4RH6A 1T5XD 1ZXIA 3VVWB 3ZUNA 3LDZE 1WXSA 2N1WA 1NI3A 4M0WB 1ZDXA 5DPWA 3IAS1 2MHJA 2WDRB 3KWLA 1FCCC 1UGJA 3AEDB 4KGRA 2JZ3B 3SEBA 1CJEA 1E0ZA 4OZAA 2DYMA 2PE6B 3RZFA 2BS3B 3TBLD 3QX1A 1L0YB 3Q8AA 4ARCA 3I5JC 4IUMB 3IG3A 1EUVB 3ZDMC 4RF1A 2I1KA 4KIKA 2HDEA 3E56A 4AP4C 2CHXA 2GBJA 5G5GA 2KWDA 3AE9B 4MACA 1DOXA 4OVVA 2R2QA 3QHTA 1S3SG 4WWNA 1E8XA 2KDIA 5IP4D 1FO4A 3HM3A 3MFGA 4MGIE 3UINB 4HKQA 1RM6C 4BKTA 3Q8CA 2MX2A 1EWYC 4N59A 5H92C 3OLMD 5E6NA 1F77A 1SXTA 2WGSA 2AL3A 4MGYE 1XLQA 1GPXA 3KQ4A 2XK5A 4EZJA 1IBXB 2PKOA 2KACA 4HEA1 2OEDA 2AEHA 4A3OA 2QDFA 3A9KA 4NAMA 2JRHA 5HKHA 2BKFA 3LXFA 1TKGA 4W9CA 3TUOA 1VCBA 3FILB 1RFKA 1KTKA 2B76B 2LEKA 3APFA 2WX1A 1N5XA 1N6ZA 3WAOA 3JSVA 5HFYA 3KUDB 1L5PA 1UNSA 2WXPA 3ZVVA 2RPQA 1C4PA 3C19A 2BPSA 4HJGE 1L4ZB 3GE8C 3ZKJC 1WGDA 4MM3B 2FE8A 4XZ4A 1WSPA 2M17A 2K8HA 2MJEA 3IVFA 2L0FA 4BKSD 3T8MA 3PZ7A 2PJHA 1K51A 3DDCB 3AB5A 1R7SA 2WU5B 1TT5B 3ZRCA 5IN7A 2FNJB 4MSMB 2N9KA 4L2YA 3SDLC 2IO0B 4RCOA 2BS2B 1SBBB 2KFKB 3E9SA 2LI5A 1WXVA 4JPSA 3DBRB 2D3CA 3N20C 3VR8B 1WYGA 2IO3B 1QQRA 4W9JA 1FPYA 2AYOB 3R7RA 1GB4A 2UU7A 2XN9C 3I3TB 4LDTD 4AQ7A 1UBQA 2GI9A 1HXYD 2DYOA 2AWTA 2KJHB 5G5HA 1LM8B 3PZ8A 1J7CA 3P1MA 4ZRPA 5AZHA 2V3SA 2KMCA 3OAWA 3TEYA 3NVZA 2DENB 1Y56A 2WX0A 3P42A 4FN2A 3H7SA 2AQ2B 2QJLA 1STEA 4MEMA 4C56C 2VH1A 2FIFA 1PFDA 4XDCA 1WGHA 3L10B 2KDFB 2N7EA 2LWPA 2PE9A 3DOWA 2AQ1B 3VRAB 3RT3B 3LYYA 2LJIA 4QAYA 2PIAA 2L52A 2LZ6A 2XEWA 1EF1A 3SFDB 2LVQA 3ZTDA 2MBEA 3ZO5B 1WGRA 1ISNA 2PTLA 1KJTA 2Z0DB 5AEKB 1T0QC 1L2NA 2IY0B 1WR6E 2DAFA 1MVKA 4KDLB 1ZGUB 2EELA 3BIID 2JXXA 4WAAA 3QWZB 3EFCA 4NQLB 5FKAC 3U8ZA 1FXTB 5DCNA 3TCAA 4GOCA 4OZBA 2KWVB 3C8YA 3AE6B 1QLBB 3TEZA 1GAQB 1DYQA 3A9JB 1YN3A 3VR9B 5LNK1 1A70A 4UDUC 3L13A 3AEAB 4GMVA 3PHXB 3WALA 1XLNA 3R2IA 3URYA 1XLPA 1WMHB 2WXJA 2KFJA 4F1SA 3PS6A 1IGDA 3W5UB 2ONQA 4G0NB 3RNBC 1TS5A 3JVZX 4B0EA 2JU6X 2Y3AA 1WWTA 2W3RA 3I57A 2N9XA 3H7PA 2JT4B 2M56B 3V60A 3PV1A 4PYUA 2NBWB 1WZ3A 4ZOHC 3T9LA 5LXHA 1AWDA 4EEWA 2BYTA 3H9DA 4IWPA 5C2TB 1JWSD 4DXAB 2ASQA 5D94A 1OTRB 2ZW1A 3B0AA 2DHZA
chains in the Genus database with same CATH topology
1D5ZC 1TS2A 4RGNA 5MPOA 1QOFA 4US9A 1VZ7A 4WIPA 4ITKA 1BXTA 1L6UA 1FRRA 1KLUD 2PVOD 2WXMA 2R61A 1XCQL 3EUB2 1F0ZA 1XCTL 5HI1A 3GP7A 1VZ8A 2TSSA 2WXRA 4JE3B 4RFBA 4A8XC 3FILA 1ROEA 1I7HA 2QMTA 1SB3C 3NVVA 2FBWB 2WLBA 2FUG1 4ZHPA 2I2YA 1F2RI 2Q5WD 4JWSC 4RGMA 1UWMA 1NYQA 2KN4A 1TZOA 3SFEB 2BW2A 3FC4A 4YSXB 1TJEA 1NEKB 1VLBA 4DXFA 5BMHA 4LTUA 1I4RA 2CU3A 3Q8EA 2K9XA 4RGTA 4A9AA 2LHDA 3TEWA 3B2FA 4ZRQA 3MP9A 1YJIA 1E9MA 1PYWD 4JWUC 2KMMA 4EE2A 2W3SA 1HA5A 5TSSA 1PGBA 2EKIA 1RWSA 2RMMA 2KAJA 3NRZA 3ZJTA 1FD6A 4R3DA 2X38A 2IGDA 1D6EC 1ZDVA 2M0AA 4L23A 5EE3A 1JWBD 1UUPA 2IDYA 2PW9A 1YQ4B 2WNMA 3AECB 3AH7A 2M19A 2PLPA 1D5XC 2J4XA 2I38A 4WAFA 3KLSX 1ZXHA 4NJCA 1I4GA 1ESFA 2H88B 1FM0D 4TMAB 1C4CA 3Q8FA 2NTSA 2AX5A 1SIJA 4RF0A 2K3UA 1OQRA 2D5GA 2WDVB 4H2AA 1QOBA 1WRIA 1V1PA 1I4XA 2BBCA 5HG2A 1QKZA 1XXGA 1QF6A 1YN4A 1KFYB 2WDQB 2K22A 2PMVA 2SAKA 1KH0A 4WWMA 1I4QA 4DQOC 2WXHA 3AEBB 2K5PA 1J7AA 3MJ5A 1IGCA 3EA6A 2WU2B 3T3NA 1ZUD2 2V3NA 1NENB 1JRPA 1C78A 5BYRA 1WGKA 3FAHA 4MH8A 2YEPB 2JX5A 1IUEA 1L0XB 1XO3A 2KDMA 4P16A 4J3OD 3BVMA 1DGJA 2QSDA 5FK9C 1N5WA 1D4BA 2WXFA 2WP9B 1JCKB 1JQ4A 1FXIA 1CK1A 3KWVA 2N0SB 4GDLB 4RH6A 2HTME 3L4PA 1T5XD 1ZXIA 3SR6A 1YN5A 2QILA 1NI3A 1ZDXA 4XE0A 3IAS1 2WDRB 2Y5CA 3KWLA 4KGTA 4A6QA 1FCCC 1UGJA 3AEDB 1F2RC 4KGRA 4WQMA 2BTEA 3SEBA 1CJEA 4HKZE 3AEGB 1E0ZA 1MHXA 5JXVA 1PGAA 4OZAA 2N9LA 2DYMA 3AE8B 2BS3B 3W5VB 3BZDB 5BMIA 3R2TA 1TY0A 1L0YB 1PDXA 3AE7B 3Q8AA 4ARCA 3OWEB 1JWAD 4XDDA 1L6VA 3CIRB 3I9V1 3NS1A 3AV8A 1N61A 4RF1A 1FXAA 1P7FA 2CJNA 2HDEA 3E56A 4PT5A 2Z8LA 2L1AA 1HZ5A 3MHZA 5G5GA 3W2DA 2KWDA 1I4PA 3AE9B 1PUTA 3AE1B 3BVGA 4FXCA 3V05A 1FRDA 2DBYA 4USAA 5D3DA 3VQIA 4MACA 3TEXA 1EU3A 1DOXA 1YJJA 2G9HD 5AUIA 1RYJA 2G1EA 2WQYB 1XEEA 1FO4A 2CJOA 2LUMA 2QEJC 2WS3B 1TS4A 3AMZA 4GDKB 2W82A 2LGIA 3MFGA 4HKQA 4REZA 1RM6C 3HVDA 4GLSC 5T8IA 2NTTA 2GB1A 2WXLA 1CQVA 3Q8CA 2DWQA 1EWYC 1AW7A 4N59A 5H92C 4ZYSA 2ON8A 4O1NA 5E6JA 1FIQA 3W1SA 1F77A 1SXTA 1ZE3D 2GRIA 3BVZA 4KGSA 2XNAC 2PVGC 4LK0M 2BS4B 2OHFA 1L0VB 1XLQA 4YSYB 4C7YA 2V0GA 1GPXA 2H89B 3KQ4A 4TQ0A 2K0PA 4IDIA 2WXKA 1PGXA 3MC0B 2PKOA 1IBXB 2KACA 4HEA1 2OEDA 1FMAD 3IT6B 3IXSA 1EM7A 3NUHB 3U4EG 4NZLB 1MHHE 1P7EA 2BB5A 3PO0A 4NAMA 2WXGA 2IGHA 2W55A 1V1OA 2JSVX 3LXFA 1M4VA 1TKGA 1FNUA 1QOGA 2SEBD 3TUOA 4Q2JA 3HRDD 2IGGA 3FILB 2ICIA 4YWGG 1RFKA 1KTKA 2WXOA 1BUIC 1ZPSA 2JXTA 2B76B 2LEKA 3VRBB 4YTNB 3NZ3A 1N5XA 3AM9A 1T3QA 4WH4A 2J53A 1N62A 5HFYA 2L83A 1L5PA 1B9RA 3ZQ4A 1I4HA 1UNSA 2MJ3A 2WXPA 2ACZB 2YEPF 1C4PA 2V4IB 4C7ZA 1L4ZB 4HJGE 2MEKA 1KLGD 2Y5PA 1FNVA 1GOZA 4MM3B 2FE8A 1SF0A 1TY2A 3V3XA 1WSPA 4HROA 1EU4A 1C9FA 2MJEA 4WURA 1KF6B 1YNTE 2MH7A 1ZOYB 4A90A 4KKJA 4DXGA 1JWMD 1QOAA 4TQ1A 3PZ7A 2WXNA 2JZPA 1K51A 2J42A 3AB5A 3DWGC 1R7SA 3W9CB 4N58A 2WU5B 3EGRA 1NVID 4YXDB 1JALA 2VZKD 5D7GA 1J7BA 2W54A 4TSSA 3GB1A 3WCQA 2N9KA 4L2YA 3GS2A 4RCOA 1XLOA 5I4DA 2BS2B 3B2GA 4OHJA 1SBBB 2JQRB 3E9SA 1VRAB 4JPSA 1JROA 3AE4B 3AEEB 1K52A 3NVYA 3R8BA 3VR8B 1YQ3B 3H8HA 2JYTA 1WYGA 3U52E 1QQRA 3NVWA 1GB4A 2XN9C 1SE4A 4AQ7A 2GI9A 2DYOA 1HXYD 1E10A 1SJED 1ET6A 1SJHD 5EE1A 5G5HA 3HVZA 3PZ8A 3Q69A 1J7CA 3P1MA 5AUKA 2LMCA 3RFZB 4OVZA 4ZRPA 1GB1A 4AS1A 2QIEB 1JW9D 3ETRA 3P63A 2AQ3B 3TSSA 3TEYA 1C79A 3NVZA 1Y56A 4RNAA 3T3OA 1JMLA 3ZJVA 4YTMB 3P42A 3U7ZA 2E6XA 2AQ2B 3IAM1 2QJLA 3AE3B 1STEA 4C56C 1MI0A 3ZYYX 1HZ6A 1L4DB 5EE0A 1PFDA 3BK1A 4XDCA 1KRHA 1E6EB 2MJDA 1SE3A 1V8CA 4HRSA 3UI3A 4N6EB 2AQ1B 2DLBA 3VRAB 3HUIA 4YSZB 4RGOS 1LO5D 2NMQA 4OW0A 3LYYA 2LJIA 4LLGM 2RDHA 3AE5B 2PIAA 2L52A 3SFDB 4KKIA 1QILA 1C77A 2WXIA 1AN8A 1D5MC 2IJ0A 2N7JA 2PTLA 2V3PA 4XWWA 1E7PB 4IKGA 3ZJUA 1ACCA 1ZP0B 2RPVA 3AN1A 1TKYA 4KX6B 1WXQA 1YMHE 1TKEA 4JX1C 4M0WA 1MVKA 5H8YE 2EELA 2JWUA 3BIID 4P6VF 3N9YC 2RDGA 3ABVB 5FKAC 4IOIE 5GXGB 2BT6A 1HEZE 5BMGA 5EE9A 3P4RB 3B9JA 1FCLA 1JWUD 2IPKD 4NAWB 2ZW0A 4OZBA 1C76A 3C8YA 3AE6B 1QLBB 1C4AA 3TEZA 1FFUA 1GAQB 1VZ6A 1DYQA 4YT0B 3CWIA 1UWXA 1YN3A 3VR9B 1FEHA 2WXQA 1TYGB 3AE2B 1A70A 3BK2A 4ZHOA 4UDUC 5LNK1 3AEFB 3BYYB 3BWUD 1B1ZA 1TS3A 2KQ4X 1FFVA 1VJKA 4L1BA 1AYFA 2E3TA 5HHDG 3AEAB 3O13A 4B0MA 1CZPA 1N63A 2LHEA 5BYQA 5C3JB 1XLNA 3R2IA 3P4PB 3URYA 2VZKB 1DOYA 4MT5A 4YTPB 1BMLC 2INPE 1XLPA 2L32A 4D2KA 2WXJA 3LB8C 1K53A 1V97A 1VDVA 1SSNA 1IGDA 3W5UB 3J9CA 1SEBD 2ONQA 1ENFA 1XF5L 1TS5A 3DWMA 1MPEA 4B0EA 2JU6X 2Y3AA 1WWTA 3BYTB 2W3RA 4US8A 3I57A 4XWTA 3IT4B 3U2SC 1FNWA 2M56B 5BYSA 1V1PB 2BB6A 4CQNA 2J52A 4ARIA 1SE2A 1K50A 1NYRA 1ET9A 2INNE 1Q10A 3P4QB 2JYEA 4ZOHC 1HQRD 3Q8BA 1EWCA 1AWDA 3ZGZA 5FR3A 2BYTA 4OZCA 3P4SB 4C80A 3RPFC 5C2TB 1OQQA 1JWSD 1VR9A 1DOIA 1QT9A 1IBXA 1OFFA 2LFIA 5D3IB 2ZW1A 4A55A 1T6BX 1N60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXT A;  2NMQ A;  4WH4 A;  2J53 A;  5HFY A;  1XCQ L;  1XCT L;  5HI1 A;  4KGT A;  1FCC C;  4KGR A;  1F2R C;  2N7J A;  2PTL A;  3FIL A;  2QMT A;  4IKG A;  4HJG E;  4HKZ E;  1MHX A;  2RPV A;  2I2Y A;  1F2R I;  5JXV A;  1PGA A;  4OZA A;  2N9L A;  1YMH E;  3V3X A;  1MVK A;  5BMI A;  2KN4 A;  2EEL A;  2JWU A;  1C9F A;  1YNT E;  4IOI E;  5BMH A;  1HEZ E;  5BMG A;  2LHD A;  1FCL A;  2JZP A;  1K51 A;  1P7F A;  2ZW0 A;  3MP9 A;  4OZB A;  1HZ5 A;  2KWD A;  1UWX A;  1PGB A;  3GB1 A;  2RMM A;  2N9K A;  1FD6 A;  2IGD A;  4MAC A;  2PW9 A;  2KQ4 X;  5HHD G;  2PLP A;  1K52 A;  2LHE A;  2I38 A;  1ZXH A;  2LUM A;  2LGI A;  4D2K A;  1GB4 A;  4GLS C;  2GB1 A;  2GI9 A;  1K53 A;  1IGD A;  2ONQ A;  2ON8 A;  5HG2 A;  1XF5 L;  1QKZ A;  1MPE A;  4KGS A;  2JU6 X;  1GB1 A;  1KH0 A;  2K0P A;  1PGX A;  2J52 A;  1IBX B;  2KAC A;  1K50 A;  1IGC A;  2OED A;  1JML A;  1Q10 A;  1EM7 A;  1MHH E;  1MI0 A;  1P7E A;  1HZ6 A;  2IGH A;  4OZC A;  2JSV X;  2KDM A;  3UI3 A;  1IBX A;  2QSD A;  2ZW1 A;  2IGG A;  1D4B A;  3FIL B; 
#chains in the Genus database with same CATH topology
 1TS2 A;  4G3X B;  4MJS A;  1OEY A;  4US9 A;  4IC7 B;  5LXI B;  1KLU D;  1XCQ L;  2KVZ A;  1F0Z A;  1KOT A;  1WGG A;  1VZ8 A;  4A8X C;  1ROE A;  2G45 B;  2MA9 B;  1P3Q U;  4ZHP A;  3EHV A;  2Q5W D;  1L7Y A;  1MJD A;  1OEY J;  4RGM A;  2KDE B;  1NYQ A;  2KN4 A;  3WA0 A;  3SFE B;  4TKN A;  1WX7 A;  1TJE A;  1NEK B;  3VHT C;  2EMS A;  1I4R A;  2CU3 A;  2G4S A;  4PS7 A;  2K9X A;  3PSE B;  3AUL A;  3LJ3 A;  3TJP A;  4JWU C;  5EDS A;  5JH5 C;  3VTV A;  5TSS A;  1CMX B;  3AI5 A;  2RMM A;  2KAJ A;  1D6E C;  2L3Z A;  2IDY A;  3K9P B;  3A4S C;  3ENE A;  3W1S C;  1D5X C;  2LGX A;  2JWZ A;  2ZZP B;  3HM6 X;  1ESF A;  3C0R B;  1FM0 D;  3Q8F A;  3CST A;  2D5G A;  4WWO A;  4H2A A;  1WRI A;  1I4X A;  2BBC A;  4I6P A;  2X8X X;  3L17 A;  1YN4 A;  2WDQ B;  2MQJ A;  3HIZ A;  4URK A;  1KH0 A;  2KD0 A;  2MP2 B;  4RMA A;  1I4Q A;  1Z2M A;  2KXJ A;  3PGE A;  2QC8 A;  5L95 C;  3MC9 A;  1E5W A;  4IM3 A;  2K5P A;  4C4V B;  1AAR A;  1WM2 A;  3VTW A;  1ZUD 2;  4BOS C;  3OJ3 A;  2DZJ A;  2MBH A;  1WX9 A;  3FAH A;  4MH8 A;  1IUE A;  3RNC C;  3W1Y A;  3MHS D;  3DQV A;  5IKC M;  4P1C C;  3KWV A;  4GDL B;  4KV2 A;  2HTM E;  3SR6 A;  1TIF A;  1ZW7 A;  3EFU A;  2O6V D;  4KGT A;  3UQA A;  1F2R C;  4WQM A;  4HPP A;  2MWS B;  3AEG B;  1YQB A;  3Q14 C;  4W9E A;  2LVO A;  3R3M A;  3W5V B;  4KSL C;  5BMI A;  3R2T A;  4BBN F;  3VAW A;  3VH3 B;  1GC7 A;  4PYZ A;  5TR5 A;  2GBM A;  4XDD A;  1WX8 A;  2DZK A;  1L6V A;  3I9V 1;  2CKH B;  3AV8 A;  3NS1 A;  2AL6 A;  1FXA A;  4FJZ A;  1P7F A;  2KDB A;  3UGB B;  2IZV B;  3UIO B;  4ZRJ A;  2XBB C;  1UZX B;  2L1A A;  4EZK A;  4DK5 A;  2LD9 A;  1I4P A;  1K8R B;  2KOX A;  1P1A A;  4AUQ C;  3U7D A;  1FRD A;  2DBY A;  4FHK A;  3TEX A;  2K39 A;  2D07 B;  2G1E A;  4LCD E;  2BVC A;  1BT0 A;  2BYF A;  2WQY B;  3RNA C;  2MRP A;  2LUM A;  1QZE A;  4GDK B;  2W82 A;  4F7Z A;  2GB1 A;  2WXL A;  1NDD A;  3PRM B;  2GBR A;  1CQV A;  1AW7 A;  4ZYS A;  2C9W B;  4O1N A;  3W1S A;  3VDZ A;  2PVG C;  4LK0 M;  4YSY B;  2K8C A;  4P1B C;  4AOF A;  2KLG A;  4LNF A;  3IT6 B;  2LVP A;  2NS5 A;  4NZL B;  1MHH E;  3PO0 A;  2IGH A;  3X0W A;  1M4V A;  1FNU A;  2SEB D;  3HRD D;  1NI2 A;  1BUI C;  2JXT A;  4MGK E;  3VRB B;  3NZ3 A;  2L76 A;  3AM9 A;  3ZRF A;  1I4H A;  3JYU A;  2MJ3 A;  3FKY A;  5KHQ A;  4W9L A;  2ACZ B;  2YEP F;  2V4I B;  2R2O A;  3RYT A;  4C7Z A;  4B6W A;  4K7U A;  2MEK A;  1J0G A;  1FNV A;  4K1R B;  5D6J B;  1EO6 A;  2L05 A;  4G50 A;  3ZXR A;  2BYV E;  4DDG D;  4FLH A;  2QCZ A;  4WUR A;  3Q3M C;  4RM9 A;  1YNT E;  1ZOY B;  2O6V B;  2A5U A;  1JWM D;  1QOA A;  4TQ1 A;  2KMA A;  4DDI D;  2JZP A;  3W9C B;  1SE9 A;  2DNF A;  2KZR A;  1NVI D;  4YXD B;  1JAL A;  2VZK D;  5D7G A;  3H6N A;  1J7B A;  2W54 A;  3Q6B A;  1Q5W B;  2D3B A;  4DHZ E;  3V6E B;  5I4D A;  2OOB B;  3B2G A;  1GG3 A;  3DVG Y;  1VRA B;  1S1Q B;  3L08 A;  4FJY A;  2KTR A;  2NVU I;  3U52 E;  2KHW B;  4ZRI A;  4ZYN A;  4DWF A;  3N30 A;  3PLV A;  1E10 A;  3RNF C;  1ET6 A;  1SJH D;  5L83 A;  5AUK A;  4W9F A;  3CSF A;  4AS1 A;  2QIE B;  4MDK E;  3P63 A;  3TSS A;  2QHO A;  4DBG A;  1JML A;  2BYE A;  3NZS A;  1WM3 A;  4HDO A;  3IAM 1;  2O2V B;  3ZYY X;  1L4D B;  5JHB A;  4NNJ B;  4CYE A;  4NPN A;  2MJD A;  3IHP C;  4ACF A;  4HRS A;  4G11 A;  2ZEQ A;  1C1Y B;  3HUI A;  4YSZ B;  4RGO S;  3Q3J A;  3MC8 A;  3AE5 B;  2G3Q B;  4KKI A;  2N7J A;  2V3P A;  4XWW A;  3WAN A;  4IKG A;  3ZJU A;  1ACC A;  2RPV A;  1TKY A;  4KX6 B;  1WXQ A;  2KN5 A;  4FA6 A;  3JW0 X;  4M0W A;  5H8Y E;  4J6I A;  2JWU A;  1U4A A;  5DPT A;  3QK0 A;  3EC8 A;  4IOI E;  1HEZ E;  2KWC A;  3NS8 A;  3B9J A;  1FCL A;  1JWU D;  4NAW B;  1Q1O A;  3CWI A;  2NR2 A;  1WJ4 A;  3GOE A;  1NBF C;  3DBL I;  4HPL B;  4YL8 A;  3AE2 B;  2LRU A;  4ZHO A;  3AEF B;  3CMM B;  3M95 A;  1TS3 A;  4L1B A;  2E3T A;  3R66 C;  3HHM A;  2LHE A;  2JVC A;  5BYQ A;  3APC A;  2VZK B;  3RUL A;  4D2K A;  3OG5 A;  3B08 A;  3ZIM A;  1VDV A;  2NPT B;  3GZN I;  2NCN A;  1ENF A;  3DWM A;  3L16 A;  3RNE C;  3IT4 B;  3APD A;  3U2S C;  2O2V A;  2KX3 A;  1Q0W B;  1RLF A;  2FCM A;  4WWP A;  1SE2 A;  4EKU A;  1V80 A;  2K6D B;  3KW5 B;  3ALB A;  2JYE A;  2M1M A;  2IYD B;  1E7V A;  3QIJ A;  3P4S B;  1DOI A;  1QT9 A;  2IO2 B;  1IBX A;  1OFF A;  2K8B A;  2KJR A;  3TIX A;  3UIP B;  1JRU A;  3OJ4 B;  2CR5 A;  4C00 A;  4WIP A;  1FRR A;  2PVO D;  3AU5 A;  3MTN B;  2YVC A;  4JE3 B;  3FIL A;  2QMT A;  3RN9 C;  2FAZ A;  3NVV A;  2WLB A;  2FUG 1;  4GU2 A;  4AJW A;  4GB9 A;  3M63 B;  3PRZ A;  4JWS C;  3A1Q B;  1TZO A;  1HTQ A;  5FR6 A;  3VTU A;  3FC4 A;  4YSX B;  1WE6 A;  3WAP A;  4K3B A;  4LTU A;  4RGT A;  4M8M A;  4A9A A;  4MM3 A;  2LHD A;  1X1M A;  4ZRQ A;  1YJI A;  1E9M A;  1J8C A;  4EE2 A;  3RI7 C;  3TMP B;  2W3S A;  2N1V A;  1HA5 A;  1PGB A;  2IGD A;  3KUC B;  2M0A A;  2WDT B;  1JWB D;  2PW9 A;  2WHI A;  2M19 A;  1XT9 B;  3DBH I;  3KLS X;  4NJC A;  4KDI C;  3TL5 A;  2WYQ A;  2KKC A;  2AX5 A;  2KFK A;  4X57 B;  1SIJ A;  4XYC A;  2K3U A;  1QOB A;  3V61 A;  1QF6 A;  2LUE A;  2PMV A;  1V6E A;  5IA7 A;  2SAK A;  3DCG A;  4DQO C;  1WYW B;  2D2Q A;  1YIW A;  2WXH A;  3AEB B;  4E74 A;  4LNN A;  1IGC A;  4TUU A;  1V9J A;  5BYR A;  1M94 A;  2YEP B;  1YOV B;  4BKG A;  2EKE C;  4P16 A;  1D4B A;  2KTF A;  4OVU A;  2WP9 B;  2ZNV C;  1WRD B;  1CK1 A;  2N0S B;  4HVB A;  3DVG X;  1A5R A;  3L4P A;  4LDT B;  2QIL A;  4PS8 A;  2M4N A;  4XE0 A;  3A1Q A;  4A6Q A;  3NY5 A;  3ZXV A;  1WH3 A;  4WQO B;  1PQS A;  4AJY B;  4HKZ E;  2J0M A;  4ZDV A;  3N1Z C;  4ANU A;  2N9L A;  3AE8 B;  3BZD B;  5D2M B;  2N7D A;  5E6O A;  3AE7 B;  5J18 A;  3OWE B;  3DBR I;  2ZNV B;  1E8Y A;  1G6J A;  1R4N I;  2CJN A;  2JRI B;  4PT5 A;  5G2N A;  4B9K A;  5C1Z A;  1RAX A;  3MHZ A;  3PHW B;  4KZC A;  1V5T A;  2ZJD A;  2V9H A;  1T6B X;  4JIO U;  5D3D A;  1E90 A;  1YJJ A;  3DHI C;  2G9H D;  5CHV C;  2Z59 B;  1IPG A;  1RYJ A;  1UBI A;  3A9J A;  3NOB A;  1XEE A;  2NBV B;  2QEJ C;  2WS3 B;  2LGI A;  4HWI B;  4REZ A;  3KVF B;  4ICV A;  3HVD A;  4GLS C;  3ZDT A;  4BKS A;  3VUW A;  4S17 A;  1MG8 A;  2HTH A;  4ICU A;  3EEC A;  3VUX A;  4LNO A;  2ON8 A;  3U30 A;  2XNA C;  2BS4 B;  3PZD A;  2OHF A;  1WMH A;  5G55 A;  3ZNH B;  4KSK C;  2H89 B;  1WR1 A;  1Z5S B;  3UF8 A;  2K0P A;  2WXK A;  1PGX A;  3MC0 B;  4IM0 A;  3VFK A;  3IXS A;  1E8Z A;  4ASW C;  1EM7 A;  1ZKH A;  3NUH B;  4NQK E;  1E8W A;  2C7N B;  1P7E A;  4PK1 A;  2BGF A;  2W55 A;  1V1O A;  2JSV X;  4M02 A;  1QOG A;  5IAA C;  1UD7 A;  2ICI A;  4YWG G;  3ML9 A;  3X23 A;  2WXO A;  1ZPS A;  2K6Q A;  4YTN B;  1T3Q A;  4WH4 A;  2J53 A;  3M3J A;  2L83 A;  1B9R A;  3ZQ4 A;  4BOZ B;  4IG7 B;  2KWU B;  3MJW A;  4MSQ B;  2N4F A;  2Y5P A;  1KLG D;  1GOZ A;  1SF0 A;  2ZCB A;  4HRO A;  1EU4 A;  2KT7 A;  1T0Y A;  4W9K A;  1KF6 B;  4A90 A;  1UH6 A;  2KVR A;  2J42 A;  3DWG C;  1KLV A;  4N58 A;  3EGR A;  1WXM A;  4TSS A;  2JF5 A;  3GS2 A;  1XLO A;  4WJP A;  2CHW A;  1YJ1 A;  4HXD A;  1T0R C;  1JRO A;  3AEE B;  3NVY A;  2ZVO A;  1YQ3 B;  3H8H A;  2JYT A;  4DHJ D;  4XGA B;  4LNK A;  5AZF A;  4GXB A;  4M8N A;  5EE1 A;  3R7Q A;  4FAD A;  2LMC A;  1TGZ B;  1GB1 A;  2FCS A;  2GLS A;  3ETR A;  3ECI A;  4GIV A;  2AQ3 B;  2GOW A;  1F1H A;  1R4M I;  3T3O A;  3KH0 A;  4YTM B;  2MSE D;  3U7Z A;  2E6X A;  3DHH C;  1MI0 A;  2MP2 A;  2ZCC A;  2EMT A;  4W9H A;  2HD5 B;  1SE3 A;  3UI3 A;  4N6E B;  2DLB A;  4C4V A;  2KC1 A;  4JQW C;  1UF0 A;  4W9I A;  3NG0 A;  2NMQ A;  4LLG M;  2RDH A;  4II3 B;  2L7R A;  1AN8 A;  4MGZ E;  2IJ0 A;  2J0J A;  1E7P B;  1IYF A;  2OJR A;  1ZP0 B;  2B3A A;  4GDL A;  1YMH E;  4KIK B;  3Q3F A;  4LNI A;  3N9Y C;  2N9P C;  3ZNG C;  5BMG A;  5EE9 A;  3VUY A;  3PVL A;  3L0W B;  1C76 A;  1C4A A;  1VZ6 A;  1FFU A;  4YT0 B;  3ONS A;  4HJK A;  1YX6 B;  1UWX A;  2GBK A;  2DYB A;  3DBL B;  3RD2 A;  2WXQ A;  1TYG B;  3Q3N C;  3BWU D;  2KK8 A;  2KQ4 X;  1FFV A;  1VJK A;  1AYF A;  3PRP B;  2DAJ A;  1WE7 A;  4B0M A;  1CZP A;  1N63 A;  1WXA A;  5C3J B;  5IO9 A;  3P4P B;  1DOY A;  4M00 A;  3NZU A;  4MT5 A;  1BML C;  2INP E;  2L32 A;  1V49 A;  2IND C;  3LB8 C;  3N32 A;  2XK5 B;  3GZN B;  4M01 A;  3J9C A;  5DPR A;  1XF5 L;  1MPE A;  2J0K A;  5CX3 A;  2UWQ A;  3BYT B;  4GDK A;  4US8 A;  4DHJ B;  3A9K B;  3AXC A;  1XQQ A;  2M8S A;  2D3A A;  1VD2 A;  1V1P B;  2BB6 A;  4CQN A;  4ARI A;  1UGM A;  1NYR A;  2RGF A;  2INN E;  1WIA A;  3PLU A;  2K25 A;  3PRE A;  2PPH A;  1EWC A;  1GUA B;  5FR3 A;  3HK0 A;  1HE8 A;  2LGS A;  3JSV B;  1OQQ A;  3VXW A;  1VR9 A;  4ZRK A;  2LFI A;  5D3I B;  2FCQ A;  1MG4 A;  4A55 A;  2KQ7 A;  1N60 A;  1D5Z C;  3PPA A;  3UQB A;  2W9N A;  1WZ0 A;  4ITK A;  1GJZ A;  2WXM A;  3EUB 2;  1XCT L;  2Z0E B;  4RFB A;  1TBE A;  1I7H A;  2FBW B;  3V62 A;  5CHF A;  1F2R I;  3KUZ A;  3RNG C;  1UWM A;  2BWE S;  3DVN V;  2BW2 A;  4K3C A;  3KYC D;  4DXF A;  5BMH A;  3K9O B;  3Q8E A;  4P7I A;  3QAQ A;  4KVG B;  3B2F A;  2RSU A;  2JUO A;  4W9D A;  1F9J A;  2MLB A;  2O6V A;  1RWS A;  3ZJT A;  1FD6 A;  4R3D A;  5EE3 A;  1UUP A;  1YQ4 B;  3AEC B;  3AH7 A;  2PLP A;  3DBH B;  2J4X A;  2I38 A;  1ZXH A;  1V86 A;  5J2R A;  2H88 B;  1H4R A;  4GN1 A;  4MEL A;  1I35 A;  4TMA B;  1C4C A;  3N1Y C;  3QQ8 B;  4TV3 A;  1OQR A;  2WDV B;  4E3C A;  5AZG A;  2J7Q B;  1V1P A;  3DBS A;  3NHE B;  4W9G A;  3QC8 B;  1KFY B;  5LLI A;  4WJQ A;  4JL9 A;  2V1Y A;  2MBO A;  3IFW B;  1J7A A;  3N3K B;  3SD5 A;  1GC6 A;  3EA6 A;  2WU2 B;  3T3N A;  1C78 A;  1EF5 A;  1WGK A;  1L0X B;  1SGH A;  2KDM A;  2FCN A;  3BVM A;  2D3G A;  2C60 A;  1RRB A;  4BBN C;  1FXI A;  2CS4 A;  5JHA A;  2IY1 B;  1YN5 A;  2VRR B;  1WI0 A;  4N9F 4;  2Y5C A;  1TTN A;  3N1X C;  2BTE A;  2I1J A;  3RMK C;  1MHX A;  5JXV A;  1PGA A;  1UEL A;  2KO3 A;  1TY0 A;  2RD0 A;  1PDX A;  4XC2 A;  4IWO A;  1JWA D;  1V5O A;  3WAM A;  1WFY A;  1R4N B;  3CIR B;  3V6C B;  1N61 A;  4FBJ B;  2HE7 A;  2Z8L A;  5BO4 B;  1HZ5 A;  2FID A;  2KQS A;  3W2D A;  3NJT A;  1PUT A;  3AE1 B;  4ANW A;  1WGY A;  3B1L X;  4MH0 E;  3BVG A;  4FXC A;  4FHJ A;  4ANX A;  3V05 A;  4USA A;  3VQI A;  1EU3 A;  4NAW A;  5AUI A;  3Q2A C;  4LJP B;  2BWF A;  4KZ0 A;  2CJO A;  3AMZ A;  1TS4 A;  4BAX A;  3H7P B;  4GSW A;  1MFW A;  5T8I A;  2NTT A;  4CHK A;  2DWQ A;  5E6J A;  1FIQ A;  3DVN U;  1ZE3 D;  2GRI A;  4KGS A;  3BVZ A;  2UYZ B;  1YD8 U;  5E6P A;  2CU1 A;  4LJO B;  1L0V B;  5KHO A;  4C7Y A;  2V0G A;  2NPT A;  3L54 A;  4TQ0 A;  4IDI A;  4HDQ A;  4F8C B;  1FMA D;  1WJN A;  4XX5 A;  3U4E G;  4MJS B;  2BB5 A;  2KLC A;  2WXG A;  4GGQ A;  3PTF C;  4BVU C;  2MCN B;  4HLE A;  2MBQ A;  4AWJ A;  4Q2J A;  2KYW A;  2IGG A;  3ZTC A;  1IP9 A;  4JLC A;  4HPM B;  2LJ5 A;  2D11 A;  1N62 A;  2RDB C;  1TZ1 A;  2KNB A;  1TY2 A;  2G4D B;  3V3X A;  1C9F A;  2MH7 A;  3D32 A;  3QJZ A;  4EUT A;  4KKJ A;  2IO1 B;  4DXG A;  2DZI A;  2GMI C;  2N9E B;  2WXN A;  2MBB B;  4E71 A;  1WF9 A;  4HCP B;  4FJV B;  5IOI A;  5JZE B;  2L0T A;  1F52 A;  3GB1 A;  3I63 C;  3WCQ A;  2KAN A;  2K1F A;  4I6N B;  4OHJ A;  2JQR B;  2OJW A;  1WY8 A;  3AE4 B;  1K52 A;  3R8B A;  3SHQ A;  3ZNI D;  1HTO A;  4RM8 A;  4I6L B;  3NVW A;  5CTR C;  1GNU A;  1SE4 A;  4BZA A;  2CHZ A;  2C7M B;  1SJE D;  5CHW A;  3HVZ A;  3Q69 A;  1P0R A;  3RFZ B;  4OVZ A;  1JW9 D;  2FUH B;  1C79 A;  2A4Z A;  1R4M B;  4RNA A;  3ZJV A;  3ML8 A;  3AE3 B;  4HCN B;  3QCA A;  1HZ6 A;  5EE0 A;  3BK1 A;  1KRH A;  2MW5 A;  1E6E B;  3ZNZ B;  1V8C A;  4EOY A;  4B95 A;  2KC2 A;  2WWZ A;  1LO5 D;  2RR9 A;  4OW0 A;  4NJ6 A;  2DZM A;  2ZPY A;  2JZZ A;  2KJ6 A;  1QIL A;  1C77 A;  2WXI A;  4NJ7 A;  1D5M C;  5GMV A;  2M0X A;  3AN1 A;  2V4L A;  2VH2 A;  1TKE A;  1P98 A;  2Y5B B;  4JX1 C;  4P6V F;  2RDG A;  3ABV B;  3ZLZ A;  1H8C A;  5GXG B;  2BT6 A;  2LGY A;  1J19 A;  3P4R B;  4WJN A;  3DPD A;  2IPK D;  2ZW0 A;  4HK2 A;  2L8J A;  3QA8 A;  1FEH A;  3BK2 A;  3BYY B;  3H1U A;  1B1Z A;  1RFA A;  2GBN A;  1OQY A;  5HHD G;  4DHZ B;  3O13 A;  1V2Y A;  4K81 A;  4IWQ A;  4FUL A;  3CF6 E;  4NY0 A;  2LGD A;  4YTP B;  3VH4 B;  3IBE A;  2HJ1 A;  2JPH A;  1P9D U;  2LAS A;  1K53 A;  1V97 A;  2LRW A;  1SSN A;  1SEB D;  3M62 B;  4JGH B;  3Q3O C;  5C23 A;  4ANV A;  4XWT A;  1FNW A;  1WJ6 A;  1C3T A;  2HJ8 A;  5DPS A;  5BYS A;  2J52 A;  2BKR B;  1K50 A;  1ET9 A;  1Q10 A;  3P4Q B;  1HQR D;  3PT2 B;  3Q8B A;  3SU8 X;  3ZGZ A;  3RUI B;  4OZC A;  4C80 A;  3RPF C;  4BFR A;  2BQQ A;  2LXC A;  2NBU A;  3RCZ A;  1T0S C;  3WIM A;  4RGN A;  3GE3 C;  5MPO A;  1QOF A;  1VZ7 A;  2IBI B;  2BF8 B;  1BXT A;  1L6U A;  4II2 B;  2R61 A;  2C7H A;  1E7U A;  5HI1 A;  3GP7 A;  2TSS A;  2WXR A;  1OGW A;  1XD3 B;  1SB3 C;  1WJU A;  3BIN A;  2I2Y A;  2C5L C;  4IW0 A;  2DX5 B;  2INC C;  3S2A A;  3DHG C;  1VLB A;  4IM2 A;  1KM7 A;  1LXD A;  4A3P A;  3TEW A;  1LFD A;  3MP9 A;  2PEA A;  1V81 A;  1PYW D;  1YX5 B;  2KMM A;  3QAR A;  2KTR B;  4K7S A;  2EKI A;  4PS3 A;  3NRZ A;  2X38 A;  2ZVN A;  1ZDV A;  4L23 A;  3O65 B;  4A20 A;  3P2B A;  3AU4 A;  2WNM A;  4WAF A;  2REX A;  2L00 B;  1I4G A;  2ZPN A;  2LXA A;  2NTS A;  2D10 A;  3A33 B;  2JY6 A;  4RF0 A;  4CO7 A;  3A4R A;  3BY4 B;  5HG2 A;  1QKZ A;  1XXG A;  4WJO A;  2K22 A;  1LQB A;  4EFO A;  2YLM A;  1SIF A;  4WWM A;  1Y8R C;  3MJ5 A;  4EZL A;  2V3N A;  1NEN B;  1JRP A;  1D3Z A;  2JX5 A;  1I42 A;  1XO3 A;  4S0R A;  5J17 A;  4J3O D;  1DGJ A;  3ZW3 A;  2QSD A;  5FK9 C;  4K7W A;  1N5W A;  2WXF A;  1LGR A;  1JCK B;  2KX0 A;  3KYD D;  3RZW C;  1JQ4 A;  4RH6 A;  1T5X D;  1ZXI A;  3VVW B;  3ZUN A;  3LDZ E;  1WXS A;  2N1W A;  1NI3 A;  4M0W B;  1ZDX A;  5DPW A;  3IAS 1;  2MHJ A;  2WDR B;  3KWL A;  1FCC C;  1UGJ A;  3AED B;  4KGR A;  2JZ3 B;  3SEB A;  1CJE A;  1E0Z A;  4OZA A;  2DYM A;  2PE6 B;  3RZF A;  2BS3 B;  3TBL D;  3QX1 A;  1L0Y B;  3Q8A A;  4ARC A;  3I5J C;  4IUM B;  3IG3 A;  1EUV B;  3ZDM C;  4RF1 A;  2I1K A;  4KIK A;  2HDE A;  3E56 A;  4AP4 C;  2CHX A;  2GBJ A;  5G5G A;  2KWD A;  3AE9 B;  4MAC A;  1DOX A;  4OVV A;  2R2Q A;  3QHT A;  1S3S G;  4WWN A;  1E8X A;  2KDI A;  5IP4 D;  1FO4 A;  3HM3 A;  3MFG A;  4MGI E;  3UIN B;  4HKQ A;  1RM6 C;  4BKT A;  3Q8C A;  2MX2 A;  1EWY C;  4N59 A;  5H92 C;  3OLM D;  5E6N A;  1F77 A;  1SXT A;  2WGS A;  2AL3 A;  4MGY E;  1XLQ A;  1GPX A;  3KQ4 A;  2XK5 A;  4EZJ A;  1IBX B;  2PKO A;  2KAC A;  4HEA 1;  2OED A;  2AEH A;  4A3O A;  2QDF A;  3A9K A;  4NAM A;  2JRH A;  5HKH A;  2BKF A;  3LXF A;  1TKG A;  4W9C A;  3TUO A;  1VCB A;  3FIL B;  1RFK A;  1KTK A;  2B76 B;  2LEK A;  3APF A;  2WX1 A;  1N5X A;  1N6Z A;  3WAO A;  3JSV A;  5HFY A;  3KUD B;  1L5P A;  1UNS A;  2WXP A;  3ZVV A;  2RPQ A;  1C4P A;  3C19 A;  2BPS A;  4HJG E;  1L4Z B;  3GE8 C;  3ZKJ C;  1WGD A;  4MM3 B;  2FE8 A;  4XZ4 A;  1WSP A;  2M17 A;  2K8H A;  2MJE A;  3IVF A;  2L0F A;  4BKS D;  3T8M A;  3PZ7 A;  2PJH A;  1K51 A;  3DDC B;  3AB5 A;  1R7S A;  2WU5 B;  1TT5 B;  3ZRC A;  5IN7 A;  2FNJ B;  4MSM B;  2N9K A;  4L2Y A;  3SDL C;  2IO0 B;  4RCO A;  2BS2 B;  1SBB B;  2KFK B;  3E9S A;  2LI5 A;  1WXV A;  4JPS A;  3DBR B;  2D3C A;  3N20 C;  3VR8 B;  1WYG A;  2IO3 B;  1QQR A;  4W9J A;  1FPY A;  2AYO B;  3R7R A;  1GB4 A;  2UU7 A;  2XN9 C;  3I3T B;  4LDT D;  4AQ7 A;  1UBQ A;  2GI9 A;  1HXY D;  2DYO A;  2AWT A;  2KJH B;  5G5H A;  1LM8 B;  3PZ8 A;  1J7C A;  3P1M A;  4ZRP A;  5AZH A;  2V3S A;  2KMC A;  3OAW A;  3TEY A;  3NVZ A;  2DEN B;  1Y56 A;  2WX0 A;  3P42 A;  4FN2 A;  3H7S A;  2AQ2 B;  2QJL A;  1STE A;  4MEM A;  4C56 C;  2VH1 A;  2FIF A;  1PFD A;  4XDC A;  1WGH A;  3L10 B;  2KDF B;  2N7E A;  2LWP A;  2PE9 A;  3DOW A;  2AQ1 B;  3VRA B;  3RT3 B;  3LYY A;  2LJI A;  4QAY A;  2PIA A;  2L52 A;  2LZ6 A;  2XEW A;  1EF1 A;  3SFD B;  2LVQ A;  3ZTD A;  2MBE A;  3ZO5 B;  1WGR A;  1ISN A;  2PTL A;  1KJT A;  2Z0D B;  5AEK B;  1T0Q C;  1L2N A;  2IY0 B;  1WR6 E;  2DAF A;  1MVK A;  4KDL B;  1ZGU B;  2EEL A;  3BII D;  2JXX A;  4WAA A;  3QWZ B;  3EFC A;  4NQL B;  5FKA C;  3U8Z A;  1FXT B;  5DCN A;  3TCA A;  4GOC A;  4OZB A;  2KWV B;  3C8Y A;  3AE6 B;  1QLB B;  3TEZ A;  1GAQ B;  1DYQ A;  3A9J B;  1YN3 A;  3VR9 B;  5LNK 1;  1A70 A;  4UDU C;  3L13 A;  3AEA B;  4GMV A;  3PHX B;  3WAL A;  1XLN A;  3R2I A;  3URY A;  1XLP A;  1WMH B;  2WXJ A;  2KFJ A;  4F1S A;  3PS6 A;  1IGD A;  3W5U B;  2ONQ A;  4G0N B;  3RNB C;  1TS5 A;  3JVZ X;  4B0E A;  2JU6 X;  2Y3A A;  1WWT A;  2W3R A;  3I57 A;  2N9X A;  3H7P A;  2JT4 B;  2M56 B;  3V60 A;  3PV1 A;  4PYU A;  2NBW B;  1WZ3 A;  4ZOH C;  3T9L A;  5LXH A;  1AWD A;  4EEW A;  2BYT A;  3H9D A;  4IWP A;  5C2T B;  1JWS D;  4DXA B;  2ASQ A;  5D94 A;  1OTR B;  2ZW1 A;  3B0A A;  2DHZ A; 
#chains in the Genus database with same CATH homology
 1D5Z C;  1TS2 A;  4RGN A;  5MPO A;  1QOF A;  4US9 A;  1VZ7 A;  4WIP A;  4ITK A;  1BXT A;  1L6U A;  1FRR A;  1KLU D;  2PVO D;  2WXM A;  2R61 A;  1XCQ L;  3EUB 2;  1F0Z A;  1XCT L;  5HI1 A;  3GP7 A;  1VZ8 A;  2TSS A;  2WXR A;  4JE3 B;  4RFB A;  4A8X C;  3FIL A;  1ROE A;  1I7H A;  2QMT A;  1SB3 C;  3NVV A;  2FBW B;  2WLB A;  2FUG 1;  4ZHP A;  2I2Y A;  1F2R I;  2Q5W D;  4JWS C;  4RGM A;  1UWM A;  1NYQ A;  2KN4 A;  1TZO A;  3SFE B;  2BW2 A;  3FC4 A;  4YSX B;  1TJE A;  1NEK B;  1VLB A;  4DXF A;  5BMH A;  4LTU A;  1I4R A;  2CU3 A;  3Q8E A;  2K9X A;  4RGT A;  4A9A A;  2LHD A;  3TEW A;  3B2F A;  4ZRQ A;  3MP9 A;  1YJI A;  1E9M A;  1PYW D;  4JWU C;  2KMM A;  4EE2 A;  2W3S A;  1HA5 A;  5TSS A;  1PGB A;  2EKI A;  1RWS A;  2RMM A;  2KAJ A;  3NRZ A;  3ZJT A;  1FD6 A;  4R3D A;  2X38 A;  2IGD A;  1D6E C;  1ZDV A;  2M0A A;  4L23 A;  5EE3 A;  1JWB D;  1UUP A;  2IDY A;  2PW9 A;  1YQ4 B;  2WNM A;  3AEC B;  3AH7 A;  2M19 A;  2PLP A;  1D5X C;  2J4X A;  2I38 A;  4WAF A;  3KLS X;  1ZXH A;  4NJC A;  1I4G A;  1ESF A;  2H88 B;  1FM0 D;  4TMA B;  1C4C A;  3Q8F A;  2NTS A;  2AX5 A;  1SIJ A;  4RF0 A;  2K3U A;  1OQR A;  2D5G A;  2WDV B;  4H2A A;  1QOB A;  1WRI A;  1V1P A;  1I4X A;  2BBC A;  5HG2 A;  1QKZ A;  1XXG A;  1QF6 A;  1YN4 A;  1KFY B;  2WDQ B;  2K22 A;  2PMV A;  2SAK A;  1KH0 A;  4WWM A;  1I4Q A;  4DQO C;  2WXH A;  3AEB B;  2K5P A;  1J7A A;  3MJ5 A;  1IGC A;  3EA6 A;  2WU2 B;  3T3N A;  1ZUD 2;  2V3N A;  1NEN B;  1JRP A;  1C78 A;  5BYR A;  1WGK A;  3FAH A;  4MH8 A;  2YEP B;  2JX5 A;  1IUE A;  1L0X B;  1XO3 A;  2KDM A;  4P16 A;  4J3O D;  3BVM A;  1DGJ A;  2QSD A;  5FK9 C;  1N5W A;  1D4B A;  2WXF A;  2WP9 B;  1JCK B;  1JQ4 A;  1FXI A;  1CK1 A;  3KWV A;  2N0S B;  4GDL B;  4RH6 A;  2HTM E;  3L4P A;  1T5X D;  1ZXI A;  3SR6 A;  1YN5 A;  2QIL A;  1NI3 A;  1ZDX A;  4XE0 A;  3IAS 1;  2WDR B;  2Y5C A;  3KWL A;  4KGT A;  4A6Q A;  1FCC C;  1UGJ A;  3AED B;  1F2R C;  4KGR A;  4WQM A;  2BTE A;  3SEB A;  1CJE A;  4HKZ E;  3AEG B;  1E0Z A;  1MHX A;  5JXV A;  1PGA A;  4OZA A;  2N9L A;  2DYM A;  3AE8 B;  2BS3 B;  3W5V B;  3BZD B;  5BMI A;  3R2T A;  1TY0 A;  1L0Y B;  1PDX A;  3AE7 B;  3Q8A A;  4ARC A;  3OWE B;  1JWA D;  4XDD A;  1L6V A;  3CIR B;  3I9V 1;  3NS1 A;  3AV8 A;  1N61 A;  4RF1 A;  1FXA A;  1P7F A;  2CJN A;  2HDE A;  3E56 A;  4PT5 A;  2Z8L A;  2L1A A;  1HZ5 A;  3MHZ A;  5G5G A;  3W2D A;  2KWD A;  1I4P A;  3AE9 B;  1PUT A;  3AE1 B;  3BVG A;  4FXC A;  3V05 A;  1FRD A;  2DBY A;  4USA A;  5D3D A;  3VQI A;  4MAC A;  3TEX A;  1EU3 A;  1DOX A;  1YJJ A;  2G9H D;  5AUI A;  1RYJ A;  2G1E A;  2WQY B;  1XEE A;  1FO4 A;  2CJO A;  2LUM A;  2QEJ C;  2WS3 B;  1TS4 A;  3AMZ A;  4GDK B;  2W82 A;  2LGI A;  3MFG A;  4HKQ A;  4REZ A;  1RM6 C;  3HVD A;  4GLS C;  5T8I A;  2NTT A;  2GB1 A;  2WXL A;  1CQV A;  3Q8C A;  2DWQ A;  1EWY C;  1AW7 A;  4N59 A;  5H92 C;  4ZYS A;  2ON8 A;  4O1N A;  5E6J A;  1FIQ A;  3W1S A;  1F77 A;  1SXT A;  1ZE3 D;  2GRI A;  3BVZ A;  4KGS A;  2XNA C;  2PVG C;  4LK0 M;  2BS4 B;  2OHF A;  1L0V B;  1XLQ A;  4YSY B;  4C7Y A;  2V0G A;  1GPX A;  2H89 B;  3KQ4 A;  4TQ0 A;  2K0P A;  4IDI A;  2WXK A;  1PGX A;  3MC0 B;  2PKO A;  1IBX B;  2KAC A;  4HEA 1;  2OED A;  1FMA D;  3IT6 B;  3IXS A;  1EM7 A;  3NUH B;  3U4E G;  4NZL B;  1MHH E;  1P7E A;  2BB5 A;  3PO0 A;  4NAM A;  2WXG A;  2IGH A;  2W55 A;  1V1O A;  2JSV X;  3LXF A;  1M4V A;  1TKG A;  1FNU A;  1QOG A;  2SEB D;  3TUO A;  4Q2J A;  3HRD D;  2IGG A;  3FIL B;  2ICI A;  4YWG G;  1RFK A;  1KTK A;  2WXO A;  1BUI C;  1ZPS A;  2JXT A;  2B76 B;  2LEK A;  3VRB B;  4YTN B;  3NZ3 A;  1N5X A;  3AM9 A;  1T3Q A;  4WH4 A;  2J53 A;  1N62 A;  5HFY A;  2L83 A;  1L5P A;  1B9R A;  3ZQ4 A;  1I4H A;  1UNS A;  2MJ3 A;  2WXP A;  2ACZ B;  2YEP F;  1C4P A;  2V4I B;  4C7Z A;  1L4Z B;  4HJG E;  2MEK A;  1KLG D;  2Y5P A;  1FNV A;  1GOZ A;  4MM3 B;  2FE8 A;  1SF0 A;  1TY2 A;  3V3X A;  1WSP A;  4HRO A;  1EU4 A;  1C9F A;  2MJE A;  4WUR A;  1KF6 B;  1YNT E;  2MH7 A;  1ZOY B;  4A90 A;  4KKJ A;  4DXG A;  1JWM D;  1QOA A;  4TQ1 A;  3PZ7 A;  2WXN A;  2JZP A;  1K51 A;  2J42 A;  3AB5 A;  3DWG C;  1R7S A;  3W9C B;  4N58 A;  2WU5 B;  3EGR A;  1NVI D;  4YXD B;  1JAL A;  2VZK D;  5D7G A;  1J7B A;  2W54 A;  4TSS A;  3GB1 A;  3WCQ A;  2N9K A;  4L2Y A;  3GS2 A;  4RCO A;  1XLO A;  5I4D A;  2BS2 B;  3B2G A;  4OHJ A;  1SBB B;  2JQR B;  3E9S A;  1VRA B;  4JPS A;  1JRO A;  3AE4 B;  3AEE B;  1K52 A;  3NVY A;  3R8B A;  3VR8 B;  1YQ3 B;  3H8H A;  2JYT A;  1WYG A;  3U52 E;  1QQR A;  3NVW A;  1GB4 A;  2XN9 C;  1SE4 A;  4AQ7 A;  2GI9 A;  2DYO A;  1HXY D;  1E10 A;  1SJE D;  1ET6 A;  1SJH D;  5EE1 A;  5G5H A;  3HVZ A;  3PZ8 A;  3Q69 A;  1J7C A;  3P1M A;  5AUK A;  2LMC A;  3RFZ B;  4OVZ A;  4ZRP A;  1GB1 A;  4AS1 A;  2QIE B;  1JW9 D;  3ETR A;  3P63 A;  2AQ3 B;  3TSS A;  3TEY A;  1C79 A;  3NVZ A;  1Y56 A;  4RNA A;  3T3O A;  1JML A;  3ZJV A;  4YTM B;  3P42 A;  3U7Z A;  2E6X A;  2AQ2 B;  3IAM 1;  2QJL A;  3AE3 B;  1STE A;  4C56 C;  1MI0 A;  3ZYY X;  1HZ6 A;  1L4D B;  5EE0 A;  1PFD A;  3BK1 A;  4XDC A;  1KRH A;  1E6E B;  2MJD A;  1SE3 A;  1V8C A;  4HRS A;  3UI3 A;  4N6E B;  2AQ1 B;  2DLB A;  3VRA B;  3HUI A;  4YSZ B;  4RGO S;  1LO5 D;  2NMQ A;  4OW0 A;  3LYY A;  2LJI A;  4LLG M;  2RDH A;  3AE5 B;  2PIA A;  2L52 A;  3SFD B;  4KKI A;  1QIL A;  1C77 A;  2WXI A;  1AN8 A;  1D5M C;  2IJ0 A;  2N7J A;  2PTL A;  2V3P A;  4XWW A;  1E7P B;  4IKG A;  3ZJU A;  1ACC A;  1ZP0 B;  2RPV A;  3AN1 A;  1TKY A;  4KX6 B;  1WXQ A;  1YMH E;  1TKE A;  4JX1 C;  4M0W A;  1MVK A;  5H8Y E;  2EEL A;  2JWU A;  3BII D;  4P6V F;  3N9Y C;  2RDG A;  3ABV B;  5FKA C;  4IOI E;  5GXG B;  2BT6 A;  1HEZ E;  5BMG A;  5EE9 A;  3P4R B;  3B9J A;  1FCL A;  1JWU D;  2IPK D;  4NAW B;  2ZW0 A;  4OZB A;  1C76 A;  3C8Y A;  3AE6 B;  1QLB B;  1C4A A;  3TEZ A;  1FFU A;  1GAQ B;  1VZ6 A;  1DYQ A;  4YT0 B;  3CWI A;  1UWX A;  1YN3 A;  3VR9 B;  1FEH A;  2WXQ A;  1TYG B;  3AE2 B;  1A70 A;  3BK2 A;  4ZHO A;  4UDU C;  5LNK 1;  3AEF B;  3BYY B;  3BWU D;  1B1Z A;  1TS3 A;  2KQ4 X;  1FFV A;  1VJK A;  4L1B A;  1AYF A;  2E3T A;  5HHD G;  3AEA B;  3O13 A;  4B0M A;  1CZP A;  1N63 A;  2LHE A;  5BYQ A;  5C3J B;  1XLN A;  3R2I A;  3P4P B;  3URY A;  2VZK B;  1DOY A;  4MT5 A;  4YTP B;  1BML C;  2INP E;  1XLP A;  2L32 A;  4D2K A;  2WXJ A;  3LB8 C;  1K53 A;  1V97 A;  1VDV A;  1SSN A;  1IGD A;  3W5U B;  3J9C A;  1SEB D;  2ONQ A;  1ENF A;  1XF5 L;  1TS5 A;  3DWM A;  1MPE A;  4B0E A;  2JU6 X;  2Y3A A;  1WWT A;  3BYT B;  2W3R A;  4US8 A;  3I57 A;  4XWT A;  3IT4 B;  3U2S C;  1FNW A;  2M56 B;  5BYS A;  1V1P B;  2BB6 A;  4CQN A;  2J52 A;  4ARI A;  1SE2 A;  1K50 A;  1NYR A;  1ET9 A;  2INN E;  1Q10 A;  3P4Q B;  2JYE A;  4ZOH C;  1HQR D;  3Q8B A;  1EWC A;  1AWD A;  3ZGZ A;  5FR3 A;  2BYT A;  4OZC A;  3P4S B;  4C80 A;  3RPF C;  5C2T B;  1OQQ A;  1JWS D;  1VR9 A;  1DOI A;  1QT9 A;  1IBX A;  1OFF A;  2LFI A;  5D3I B;  2ZW1 A;  4A55 A;  1T6B X;  1N60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...