1QKZA

Fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
58
structure length
58
Chain Sequence
VTTYKLVINGKTLKGETTTKAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN G-PRIME
publication title Crystal Structure of an Fab Fragment in Complex with a Meningococcal Serosubtype Antigen and a Protein G Domain
pubmed doi rcsb
source organism Streptococcus sp.
total genus 14
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1999-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qkzA00
1FCCC 1HEZE 1K51A 4HKZE 1PGBA 1MPEA 5BMHA 1YMHE 1F2RI 1P7FA 3UI3A 1UWXA 2EELA 4IOIE 4GLSC 1D4BA 1JMLA 3GB1A 1P7EA 2PLPA 4IKGA 2KDMA 2IGHA 1K50A 2KQ4X 2OEDA 2I38A 2J52A 5JXVA 3FILB 2IGGA 2LHEA 2PTLA 2ONQA 1GB4A 2GB1A 1K52A 4KGTA 2J53A 5BMIA 5BMGA 3V3XA 1XCTL 2RMMA 4OZBA 1IBXA 1MVKA 2N7JA 2QSDA 2QMTA 2JWUA 2N9LA 2GI9A 2JSVX 1PGAA 4WH4A 2NMQA 4KGSA 2JU6X 1FCLA 4D2KA 2N9KA 1QKZA 3MP9A 2I2YA 1EM7A 1FD6A 1K53A 2ZW0A 2LUMA 2K0PA 1MI0A 1HZ6A 2IGDA 2RPVA 2LGIA 2PW9A 2JZPA 1YNTE 1C9FA 1F2RC 5HI1A 1HZ5A 5HFYA 4OZAA 5HHDG 1IBXB 5HG2A 1XCQL 1GB1A 2LHDA 2ZW1A 1MHXA 1IGCA 2JXTA 4MACA 4KGRA 4HJGE 2KACA 3FILA 1MHHE 2KWDA 2KN4A 1IGDA 1ZXHA 4OZCA 1XF5L 1Q10A 2ON8A 1PGXA 1KH0A
chains in the Genus database with same CATH superfamily
2XBBC 3AI5A 1XLQA 1T6BX 3AE2B 2IY1B 1GNUA 2AL3A 2HE7A 4B0MA 3KH0A 3N1YC 1D6EC 3P2BA 4MM3B 1V1PA 3EFUA 1C78A 1WSPA 4BKTA 2WYQA 4RMAA 2O2VA 1I7HA 2LGYA 2LWPA 3DOWA 1N63A 4Q2JA 1E8ZA 1JRPA 5D94A 3H8HA 1XLOA 3Q3MC 2BB5A 3EA6A 3VUWA 3UGBB 3MC0B 3ETRA 5BMIA 2JPHA 3ZYYX 1MVKA 1L0XB 2BS4B 1FEHA 2JWUA 3DVNV 3PREA 4KDIC 1TBEA 1RYJA 3L4PA 2HTME 2KN5A 4XZ4A 2WXGA 1Q1OA 4D2KA 4YSXB 2KMAA 1YX5B 3VHTC 2D3AA 1WGRA 2W3SA 3AMZA 2MJDA 1K53A 1ISNA 4FJYA 3X0WA 4CQNA 3ZUNA 4IM0A 3B1LX 1L7YA 1HZ6A 3LXFA 1HXYD 2MQJA 2Y3AA 3UQAA 1TS3A 3ZW3A 3TEZA 4W9CA 3AV8A 5GXGB 4GDKB 5G5GA 1OTRB 3RNGC 1MHXA 2KFKA 1WJ4A 2REXA 1OQYA 4PS3A 2NCNA 5I4DA 4EOYA 3HM3A 1QT9A 1XF5L 4M0WA 3RZWC 3QCAA 4A8XC 4ZOHC 4E3CA 3LJ3A 4TSSA 2KC2A 3WAMA 1R4MB 2WXJA 3OLMD 2DHZA 3RZFA 5EE1A 4DDGD 3W1YA 1R4MI 4GLSC 3RNAC 4BOSC 4TV3A 3RN9C 3MHSD 4ITKA 3ZO5B 4IG7B 4JX1C 2KDMA 3ZRFA 3Q8AA 4O1NA 3RNCC 1YN3A 2DLBA 1LFDA 4YWGG 1JQ4A 2BKRB 1SSNA 4LNOA 2PMVA 2PTLA 2KJRA 1J8CA 1ET9A 3NUHB 1C77A 1E8WA 4A20A 4ANUA 1R4NB 3E9SA 3UIPB 2WXRA 4JL9A 4OVZA 4HEA1 2JSVX 2DAJA 1V1PB 4JWUC 2GBJA 2GRIA 1FCLA 2ICIA 3OJ3A 2W55A 3CF6E 1VCBA 3P4QB 2O2VB 3I63C 4JPSA 1MFWA 3ZJUA 1WJ6A 1I4XA 1P9DU 3AB5A 4GOCA 3ZXVA 3TEXA 2K9XA 2WXQA 2IGDA 2NR2A 2ZPYA 4IM2A 2G4SA 2GLSA 3BIID 1F2RC 3U2SC 3PO0A 4WQMA 1UGMA 3APCA 1NYQA 4GDLA 1XCQL 2XN9C 2CU3A 2ZCBA 2TSSA 3Q8EA 4HCPB 1F0ZA 2EMSA 2KVZA 5MPOA 4ZDVA 3DDCB 3AN1A 1Y8RC 3EFCA 3VTVA 3MJWA 4OW0A 3BYYB 4LJOB 1XXGA 5G5HA 1Q5WB 4HKZE 4K3BA 4WJQA 2MEKA 3W5UB 5LXHA 1UBQA 3GOEA 1VZ7A 2GBMA 2M1MA 2GBKA 5J17A 3BY4B 5IAAC 4MJSA 3RMKC 4YSZB 3GZNB 2FCNA 3DHHC 1WJNA 1D3ZA 3A1QA 1TJEA 2GOWA 2KFJA 3E56A 1VZ6A 2KFKB 4BKGA 2MCNB 5DCNA 4FN2A 1UGJA 1JWUD 2LGSA 1CZPA 4M0WB 1AARA 1TTNA 1QOGA 2KWCA 1OFFA 3DBHB 1N5XA 3JW0X 3DBHI 2FIFA 4K81A 4EFOA 3WANA 2VZKD 2YVCA 2IBIB 2DX5B 3P42A 1DGJA 2RPQA 1ZE3D 2XNAC 2DBYA 4GU2A 1FD6A 4A9AA 3NVVA 4WQOB 3NJTA 2LRWA 3SDLC 2MBEA 3KQ4A 2LGIA 3KWLA 4KZ0A 2MJ3A 3W9CB 3I5JC 1SIJA 2R2OA 4C4VA 4LDTD 3LB8C 5HG2A 2INDC 2LI5A 4WAAA 1P3QU 2LHDA 4P16A 4KGRA 2LXCA 4BKSA 2BS2B 4BFRA 3FILA 1C4AA 1J7AA 3VVWB 1IGDA 2WXLA 3DPDA 4XC2A 4KV2A 2NBWB 5HKHA 2BT6A 1UH6A 3BVGA 4W9IA 2WXKA 1VLBA 2K39A 5C1ZA 2W82A 1SE4A 4GDLB 1EU4A 4WWNA 2J4XA 1JWAD 4W9DA 4B9KA 2L8JA 3R8BA 5E6OA 3NHEB 2DZIA 1NI2A 2KC1A 3ZLZA 1VD2A 2EKEC 4MT5A 3Q8FA 3KW5B 1VR9A 3AECB 4RFBA 3KYCD 4RF0A 2KWUB 4TQ1A 4KGSA 2V3NA 4MJSB 4N59A 3TJPA 4EKUA 2BS3B 2M0XA 2KANA 4ZYNA 3QA8A 3A1QB 3VUXA 4MGYE 4NZLB 3PHWB 3T3NA 5AZHA 3CSTA 2DWQA 3IVFA 1RAXA 3AE1B 3TL5A 2JWZA 2RR9A 1KFYB 1PFDA 3QHTA 1HA5A 4HCNB 4HPPA 1WI0A 1FIQA 5E6JA 5EDSA 2K6DB 1P98A 2PVGC 5L95C 2HDEA 2LVQA 2JZPA 1C9FA 2KDFB 3JVZX 4OZAA 3M62B 5HHDG 2MW5A 5E6PA 3ZNHB 2AYOB 5J2RA 2BKFA 4DQOC 2WU2B 3DWGC 3N9YC 4ZYSA 1WXAA 1KTKA 3DVGX 3HHMA 3M63B 3AU5A 1PGXA 2MBHA 1F9JA 2H88B 3LDZE 2MBOA 3IT6B 4II2B 3R3MA 1TY0A 5C2TB 3O13A 2OOBB 1I42A 4XGAB 4LNNA 1IYFA 2JY6A 4IOIE 3Q2AC 2MLBA 4C4VB 3NZ3A 4IKGA 2K25A 4BBNC 2VZKB 1VDVA 4OVUA 2C5LC 5BYQA 3FILB 1STEA 2N9PC 1RM6C 5D3IB 4W9JA 1GB4A 2AQ1B 2WXNA 4XYCA 2CHZA 1Q0WB 1YQ3B 1D5ZC 2LGDA 3AXCA 1JWMD 4YTMB 2BF8B 3KUCB 2W3RA 2KD0A 2KZRA 4AJWA 4FLHA 3RULA 3H7PA 1PQSA 2UU7A 1PGAA 3B2GA 3SD5A 1WM2A 3APDA 4LDTB 2Y5BB 3TEYA 5C3JB 3CSFA 4MGZE 5T8IA 2RDBC 1JWBD 4GMVA 3GE8C 4ZHOA 1KLUD 2OJWA 2PE9A 3AEBB 2MWSB 5DPWA 4JGHB 4X57B 1V5TA 2MA9B 3DVNU 3WAOA 3ZNZB 2D3CA 1WYGA 3RNFC 2BGFA 3V05A 2O6VD 4KDLB 3UINB 1WGYA 5J18A 3NVYA 3Q3JA 5IO9A 1E8XA 2K1FA 2KNBA 2G3QB 1QOBA 2JXTA 1I4HA 4GGQA 3QAQA 1YQ4B 1JW9D 3GE3C 3L10B 3N20C 1FNVA 1TYGB 3OAWA 4F1SA 3VTWA 4EE2A 2N9XA 1I4GA 2BYFA 1HEZE 2GBRA 3P63A 3AH7A 3KLSX 4C00A 3O65B 3PRZA 4KKIA 5BMHA 1R7SA 1CQVA 2BWES 3RD2A 4ZRKA 1L4DB 2KMCA 4US9A 4BZAA 1Z5SB 3BYTB 4PYZA 1NVID 1EUVB 2VH1A 1LM8B 3V61A 2UWQA 3IT4B 4PK1A 2FUHB 3DWMA 3PTFC 3X23A 2N9EB 4KGTA 1ZXIA 2L05A 1K8RB 5DPSA 1P1AA 4HRSA 1AN8A 2GI9A 1QF6A 1XD3B 3BVZA 4K7WA 4XX5A 2HJ1A 2NMQA 3SR6A 1FRRA 4A3PA 1TGZB 3EUB2 4II3B 1VJKA 4FJVB 2YEPB 2L32A 4MH8A 4DWFA 1WJUA 3NZUA 2KHWB 2WDQB 1WGDA 3Q8BA 3AULA 2ZNVB 4AJYB 3RI7C 1QZEA 2YEPF 3HUIA 3WIMA 2Z0EB 3H7PB 2EMTA 2QEJC 1GB1A 3AE3B 4ARCA 4I6NB 2X8XX 4TKNA 1ZP0B 4FBJB 1UNSA 4NQKE 1FMAD 4P1BC 4S0RA 3T8MA 3ZJTA 5G55A 3P1MA 2QJLA 1ZUD2 2JXXA 3VFKA 1MPEA 2K3UA 2KJHB 2KJ6A 3VRAB 2WP9B 2RDHA 3MHZA 2V1YA 2LMCA 1XLNA 4YSYB 1EF1A 1I4RA 3HIZA 2IGGA 4HPLB 3QWZB 1WXSA 3N3KB 4N58A 1HTQA 1T0QC 2JYTA 2K5PA 2DZMA 1QOFA 3SHQA 1WY8A 1TS4A 3APFA 4FULA 2PEAA 1XO3A 1SXTA 1TKYA 1KF6B 1B1ZA 1RRBA 3U52E 3Q14C 5FKAC 1KLVA 1QOAA 5JH5C 4H2AA 3ZDTA 2KX0A 2K6QA 4OVVA 4WWOA 3KUDB 2IY0B 2J0KA 3KYDD 2BBCA 3RCZA 2RPVA 4ANXA 2V3PA 2DNFA 2INPE 1NBFC 4RH6A 3H1UA 3A33B 3TIXA 4BBNF 2V0GA 4BVUC 2K8CA 4KSLC 3SFEB 3C19A 3SFDB 4KX6B 3WA0A 1PGBA 4ICVA 4GB9A 2Q5WD 2FIDA 1P7FA 5BO4B 2L76A 2EELA 5LNK1 2K8HA 3VDZA 4P7IA 2N1WA 3ZGZA 3KUZA 1YIWA 2ZEQA 4GN1A 3ML9A 1DYQA 2G9HD 2WDTB 3A4SC 3ZXRA 2ZVOA 1E7UA 3C8YA 2DZJA 3PPAA 5E6NA 2KYWA 4W9EA 2HD5B 1N6ZA 1WGGA 1N61A 2KTRA 2NTTA 4M00A 5FR3A 1WXMA 1XCTL 2RMMA 3FKYA 4PYUA 2Z8LA 1E6EB 1ACCA 4P6VF 2K22A 2D3BA 3DHIC 1V2YA 1JCKB 1ET6A 2VH2A 4I6LB 3S2AA 2L52A 3H6NA 1TY2A 2JRIB 2DYBA 2KXJA 2B3AA 2L0TA 3D32A 4HWIB 2G4DB 3L17A 2RDGA 1C4PA 4G11A 1E7VA 1TS5A 2INNE 2MBQA 4HDQA 4W9LA 2AQ3B 4MH0E 4WJOA 1WZ0A 3Q6BA 2WXPA 5EE3A 2KWDA 3AEFB 1I4PA 3M3JA 3TCAA 3GS2A 1E10A 1DOYA 3I57A 3ZNGC 1HTOA 3ZIMA 4WAFA 4PT5A 1OGWA 3TMPB 3VRBB 1WXQA 2BYTA 2C60A 1V8CA 2LGXA 2LRUA 1FNUA 2CU1A 4AP4C 3Q3OC 4EUTA 2L1AA 1TKGA 5AZGA 4B95A 3NRZA 2LZ6A 1D4BA 1NYRA 4MSMB 3VH4B 2LASA 1E0ZA 3CMMB 4IWQA 2OEDA 2I38A 3VH3B 2FCQA 4ACFA 2I1KA 1BUIC 2BYEA 1AWDA 2L00B 1QQRA 2A5UA 4AOFA 3PLUA 3DQVA 2D5GA 1EU3A 3K9PB 2KTFA 2ZNVC 3MC9A 1MG8A 1MJDA 4KVGB 4DBGA 2N9LA 4WWPA 2WS3B 2FE8A 2KLCA 2LJIA 4K3CA 4W9GA 4WIPA 4IM3A 1SF0A 4ANWA 1KOTA 2A4ZA 4A55A 2J7QB 2LUEA 4TMAB 2IZVB 5H92C 1EWCA 2H89B 2BVCA 1C76A 5IKCM 4PS7A 1FXTB 4W9KA 5LXIB 2CKHB 2QDFA 2KTRB 4JIOU 2L7RA 1RLFA 2BW2A 1UELA 2KQ7A 2KO3A 4A6QA 2B76B 1VZ8A 3Q8CA 5JHBA 3VR8B 1HQRD 2QILA 4M8NA 2MH7A 1IPGA 3R7QA 4LNKA 3CIRB 4NY0A 1C1YB 1EF5A 2IO1B 3HVZA 3AEAB 3PZ8A 3V60A 3PZ7A 3NVZA 4KIKA 2WDVB 2L0FA 3L0WB 3TBLD 4BOZB 5IN7A 1RWSA 3N32A 3VR9B 4JWSC 4LK0M 2PIAA 2ACZB 5AEKB 5IOIA 3NS1A 2PPHA 4ZHPA 3QQ8B 4RGMA 3V6EB 3JSVA 1LXDA 2JRHA 3GB1A 4HK2A 3T9LA 3DBLB 1QLBB 2IGHA 2QC8A 1GUAB 3DBLI 2JYEA 2LVPA 3RNBC 1FXIA 5JXVA 2DAFA 4I6PA 1UUPA 4CYEA 2R61A 2RGFA 5H8YE 3A4RA 1C79A 1TS2A 4OHJA 1ESFA 3UIOB 1FNWA 1WM3A 1WX7A 3L54A 5KHQA 3V3XA 4ASWC 3U7DA 4OZBA 4EZJA 2X38A 1IBXA 1L6VA 2QMTA 4MEMA 2IO0B 4WH4A 2WXFA 3BK2A 1NEKB 4JLCA 2CJOA 3PRPB 2L83A 3CWIA 1KJTA 1V81A 2RD0A 3OJ4B 1T5XD 3IAM1 1IUEA 1KM7A 1ZKHA 2KQSA 4JQWC 4RM9A 2KKCA 4F7ZA 1SJED 1E8YA 1OQRA 4KZCA 4ANVA 4YXDB 4N9F4 3DHGC 4XWWA 2NBUA 2NBVB 4UDUC 1J0GA 2KVRA 4NQLB 1YNTE 1ZW7A 1WGHA 3AE6B 4HROA 3B08A 1XT9B 5HFYA 3PVLA 1PYWD 3PZDA 3T3OA 1T3QA 3MTNB 1I4QA 2Y5PA 3NG0A 1IGCA 3IHPC 1S1QB 3QJZA 4USAA 3FC4A 3R2IA 4LNFA 1ZPSA 1JRUA 2V4IB 1V86A 3EGRA 2SEBD 3IBEA 4OZCA 3W1SA 2G45B 2XK5A 2JZ3B 2KDBA 5L83A 2CS4A 4HLEA 1ENFA 2WNMA 2OHFA 5D7GA 1PDXA 3M95A 3PGEA 1SIFA 4G3XB 2JQRB 2KLGA 2E3TA 2M19A 4RGTA 2WHIA 1XLPA 3J9CA 1ZDXA 5IA7A 1L0YB 1OEYJ 1WE6A 2SAKA 3OWEB 3N1XC 1Y56A 2AWTA 3RT3B 2L3ZA 2M56B 2NTSA 3R2TA 4DHJD 4HJKA 4KIKB 2O6VA 2ONQA 2MSED 3AE7B 1WRDB 2WXMA 3U8ZA 3L08A 3IAS1 3DCGA 2J53A 1FPYA 3BVMA 2WGSA 2N7JA 3QARA 2QSDA 3H9DA 4FA6A 2V9HA 5GMVA 3JSVB 2M8SA 3QIJA 3QX1A 2V4LA 2NPTA 2KOXA 3W2DA 2KT7A 3B9JA 4YT0B 2D10A 4S17A 4IW0A 5CHWA 4C7ZA 2JUOA 2CHXA 1EM7A 1H8CA 5D6JB 2ZZPB 4CO7A 4M02A 1F1HA 4W9FA 4DXFA 5G2NA 2LUMA 2K0PA 2QCZA 4K7SA 1D5MC 5D3DA 4JE3B 5HI1A 4FHJA 1FO4A 1HZ5A 1IBXB 3ZJVA 1E90A 1GOZA 1A70A 1YJJA 3NVWA 4RF1A 2CR5A 1SEBD 3MC8A 4WJNA 3PSEB 3V6CB 1FFVA 1BT0A 1JROA 2KN4A 3H7SA 4ZRJA 3NZSA 2GBNA 1L2NA 2WXOA 1Q10A 3WCQA 2D11A 1U4AA 1ROEA 2NS5A 1UZXB 3QC8B 2ZPNA 2BPSA 1UWXA 4YL8A 2C9WB 3HM6X 2OJRA 2HJ8A 4G50A 3IXSA 5AUKA 3RFZB 1KRHA 4US8A 2BB6A 5CX3A 2PVOD 4NPNA 1RFKA 1J7BA 5EE0A 2XK5B 3ML8A 2GB1A 4LTUA 5TSSA 3LYYA 1K52A 4C80A 2N0SB 2WXIA 3IFWB 2CHWA 2KWVB 4XE0A 4YTPB 3U30A 1FFUA 1OQQA 2DZKA 2FCSA 1LQBA 2XEWA 4A3OA 2YLMA 1QKZA 4MGIE 3OG5A 3N30A 1LO5D 1TT5B 4MELA 1PUTA 2ZW0A 2O6VB 2KK8A 4NJ7A 1GC6A 4EEWA 2GMIC 1MG4A 4NAWA 2C7HA 4IWPA 2KDEB 2LEKA 4AQ7A 2D2QA 4FJZA 1TKEA 1XQQA 2NPTB 4GSWA 4ZRPA 2IJ0A 3P4PB 3N1ZC 2LJ5A 2C7MB 4WWMA 1Z2MA 4ARIA 2K8BA 1KH0A 1M4VA 2PKOA 4DHJB 3AEDB 5LLIA 1YMHE 3UI3A 1H4RA 1N60A 3BWUD 4HKQA 4K1RB 3A9JA 2IDYA 1R4NI 3ZTCA 2IO3B 3PRMB 2KQ4X 5DPTA 1YN4A 1JALA 5JHAA 2BTEA 3TSSA 4RGNA 4DXGA 1V1OA 1HE8A 2M0AA 2FBWB 3R66C 1L6UA 1L4ZB 2WU5B 4J6IA 4RGOS 3BINA 3BZDB 2LXAA 3UQBA 2FAZA 3WAPA 4DHZB 1WH3A 3SU8X 1X1MA 2M4NA 3AE8B 1ZDVA 3R7RA 2AEHA 4M01A 2I2YA 3U7ZA 1T0RC 3I3TB 5BYSA 1WWTA 1GPXA 1SB3C 5JZEB 4RM8A 1J19A 1UBIA 3EECA 1V9JA 4RNAA 3GP7A 4L1BA 3FAHA 1J7CA 1V6EA 5BYRA 5C23A 2LFIA 3HRDD 2EKIA 2KX3A 3URYA 4FADA 3ALBA 3TEWA 4L23A 1P0RA 1DOXA 5TR5A 2ASQA 2PJHA 1ZXHA 3GZNI 5AZFA 2WQYB 3DBSA 4AWJA 1WYWB 4K7UA 3ZDMC 1EWYC 4NAWB 1XEEA 1M94A 4URKA 3AEGB 1E9MA 3NY5A 1K50A 2MX2A 4N6EB 2KDIA 3VTUA 2UYZB 2LVOA 3W5VB 1BMLC 2V3SA 3DVGY 1N5WA 3HK0A 4BKSD 2JZZA 2INCC 4E74A 2M17A 2AX5A 2PE6B 1BXTA 2Y5CA 1WF9A 1C4CA 1WX9A 2FUG1 3KWVA 5FK9C 1C3TA 2J42A 1S3SG 1GC7A 4GIVA 4IWOA 1V49A 1L5PA 3AM9A 1WXVA 2MHJA 1YX6B 1WFYA 3KVFB 1ZGUB 3A9JB 4TUUA 3MJ5A 3ZRCA 4A90A 2Z0DB 5D2MB 2BQQA 2WDRB 3PT2B 4IDIA 2N4FA 2HTHA 1YOVB 1YJ1A 3SEBA 1L0VB 3P4RB 3MFGA 4EZKA 1GG3A 2JVCA 2AL6A 2CJNA 1AYFA 1IP9A 2D3GA 2PW9A 3A9KA 2IPKD 3RYTA 2E6XA 1WGKA 3ECIA 3U4EG 4MACA 1VRAB 2KAJA 2N7DA 2JT4B 1FM0D 1B9RA 4DHZE 1T0SC 1SE3A 4HPMB 3V62A 1LGRA 2J0JA 4NNJB 3AE9B 4LLGM 3Q3FA 4DK5A 3W1SC 1SE2A 3PS6A 1WMHA 3I9V1 2G1EA 2IO2B 3ZQ4A 1JMLA 1UD7A 1T0YA 1RFAA 2C7NB 5DPRA 4QAYA 4P1CC 1E5WA 2J52A 3VXWA 3VAWA 2BYVE 4MSQB 1CMXB 1V97A 2LD9A 4XDDA 1NENB 5AUIA 3ZVVA 2QHOA 2LHEA 3HVDA 1FRDA 3ZKJC 1TIFA 4GXBA 1D5XC 3VQIA 2AQ2B 4ZRQA 2WX0A 3P4SB 5BMGA 4CHKA 1F77A 3DBRB 1V80A 2MP2A 1KLGD 3PLVA 1EO6A 1YQBA 3DBRI 3ABVB 1UWMA 3RNEC 4HXDA 4NJCA 2ZVNA 4KKJA 1WR6E 4YTNB 4ZRIA 3QK0A 4XWTA 1ZOYB 1YJIA 1OEYA 5EE9A 4KSKC 2J0MA 1WR1A 5IP4D 1WRIA 1NDDA 3AU4A 4PS8A 4MGKE 4WJPA 4MM3A 2WX1A 2N1VA 4LJPB 4AUQC 5CTRC 2W9NA 4IC7B 4B6WA 4J3OD 3IG3A 3NS8A 3ENEA 2QIEB 4G0NB 2WWZA 2WLBA 2W54A 4HJGE 2KACA 4DDID 4XDCA 2MJEA 3NOBA 1CJEA 4C7YA 4NAMA 3RUIB 1V5OA 4AS1A 1A5RA 1FCCC 1K51A 1QILA 2R2QA 4DXAB 2MBBB 2DYMA 4NJ6A 1YD8U 1TZOA 4R3DA 1F2RI 5CHFA 2ZJDA 3A9KB 3EHVA 1WE7A 3ZTDA 3L16A 2FNJB 3ZNID 2ZCCA 1I35A 2D07B 1P7EA 2PLPA 1FXAA 4MDKE 3EC8A 4FHKA 1G6JA 3WALA 3TUOA 4HVBA 1WX8A 4W9HA 4B0EA 1DOIA 4HDOA 1SJHD 4RCOA 1YN5A 4EZLA 2IYDB 5FR6A 1GJZA 3BK1A 3C0RB 1UF0A 4F8CB 1AW7A 3B0AA 2JF5A 3AEEB 1WMHB 2I1JA 2RSUA 4GDKA 2DYOA 3VUYA 4ICUA 2JU6X 2WXHA 1JWSD 1N62A 3PV1A 2NVUI 2N9KA 1SGHA 3AE5B 3K9OB 3MP9A 4E71A 1SE9A 3RPFC 1WZ3A 2JX5A 2Z59B 1CK1A 2N7EA 4LNIA 1F52A 1MI0A 1WIAA 1TZ1A 4WURA 4FXCA 3Q69A 3UF8A 2FCMA 1E7PB 4REZA 4LCDE 2MP2B 2MRPA 4M8MA 1NI3A 1GAQB 4TQ0A 2ZW1A 2DENB 3B2FA 4L2YA 3JYUA 2VRRB 1SBBB 3Q3NC 4BAXA 3L13A 1MHHE 3AE4B 4C56C 5KHOA 2BWFA 3PHXB 4IUMB 3ONSA 2ON8A 5CHVC 2KMMA
chains in the Genus database with same CATH topology
4WAFA 4PT5A 3VRBB 1XLQA 1WXQA 1T6BX 2H88B 1M4VA 2BYTA 3AE2B 2PKOA 1V8CA 3AEDB 3IT6B 1TY0A 4B0MA 5C2TB 1FNUA 3O13A 1YMHE 1D6EC 3UI3A 1N60A 2L1AA 1TKGA 3BWUD 4HKQA 3NRZA 4MM3B 4IOIE 1V1PA 1D4BA 1C78A 1NYRA 1WSPA 2IDYA 3NZ3A 1E0ZA 4IKGA 2KQ4X 2OEDA 2I38A 1YN4A 2VZKB 1I7HA 1JALA 1N63A 1VDVA 2BTEA 4Q2JA 5BYQA 3FILB 1STEA 3TSSA 4RGNA 1JRPA 4DXGA 1V1OA 1BUIC 2M0AA 1RM6C 2FBWB 1AWDA 5D3IB 1L6UA 3H8HA 1XLOA 1QQRA 1GB4A 2AQ1B 1L4ZB 2WU5B 2BB5A 2D5GA 2WXNA 3EA6A 4RGOS 3BZDB 1EU3A 1YQ3B 1D5ZC 3MC0B 3ETRA 5BMIA 1JWMD 4YTMB 3ZYYX 2W3RA 1MVKA 1L0XB 2BS4B 1FEHA 2JWUA 2N9LA 1PGAA 2WS3B 2FE8A 3B2GA 3AE8B 1ZDVA 2LJIA 4WIPA 1RYJA 1SF0A 3TEYA 3L4PA 2HTME 5C3JB 5T8IA 2WXGA 4D2KA 1JWBD 4YSXB 4A55A 4ZHOA 1KLUD 3AEBB 4TMAB 2I2YA 5H92C 3U7ZA 1EWCA 2H89B 2W3SA 3AMZA 2MJDA 5BYSA 1C76A 1K53A 4CQNA 1WWTA 1GPXA 1SB3C 1WYGA 1HZ6A 3LXFA 1HXYD 2Y3AA 3V05A 1TS3A 2BW2A 4A6QA 4RNAA 2B76B 1VZ8A 3GP7A 3NVYA 3Q8CA 3TEZA 4L1BA 3AV8A 5GXGB 3VR8B 1HQRD 3FAHA 1J7CA 2QILA 4GDKB 5G5GA 5BYRA 2MH7A 1QOBA 3CIRB 1MHXA 2JXTA 1I4HA 2LFIA 3HRDD 3HVZA 2EKIA 3URYA 3AEAB 3PZ8A 5I4DA 1YQ4B 1JW9D 3TEWA 4L23A 3PZ7A 3NVZA 1DOXA 1FNVA 1TYGB 1ZXHA 1QT9A 1XF5L 2WDVB 4M0WA 4EE2A 1I4GA 4A8XC 4ZOHC 1HEZE 4TSSA 1RWSA 2WQYB 3VR9B 4JWSC 3P63A 3AH7A 3KLSX 4LK0M 5BMHA 4KKIA 2PIAA 2ACZB 2WXJA 1R7SA 1CQVA 5EE1A 3NS1A 4GLSC 4ZHPA 1EWYC 4NAWB 4RGMA 1XEEA 1L4DB 4US9A 3GB1A 3BYTB 4ITKA 1QLBB 3AEGB 4JX1C 1E9MA 2KDMA 2IGHA 1K50A 4N6EB 1NVID 3Q8AA 4O1NA 3W5VB 2JYEA 1BMLC 1YN3A 1FXIA 2DLBA 1N5WA 4YWGG 5JXVA 1JQ4A 1UUPA 3IT4B 1SSNA 2R61A 2PMVA 2AX5A 2PTLA 5H8YE 3DWMA 1C79A 1TS2A 1ET9A 1BXTA 2Y5CA 3NUHB 1C77A 4OHJA 1ESFA 1C4CA 1FNWA 4KGTA 2FUG1 3KWVA 1ZXIA 3E9SA 5FK9C 3V3XA 2WXRA 4OZBA 2J42A 4HRSA 1AN8A 2X38A 4OVZA 1IBXA 1L6VA 2QMTA 4HEA1 1L5PA 2GI9A 2JSVX 3AM9A 4WH4A 1V1PB 3BVZA 1QF6A 2WXFA 3BK2A 2NMQA 3SR6A 1NEKB 4JWUC 1FRRA 2CJOA 3MJ5A 4A90A 2GRIA 1FCLA 2ICIA 3EUB2 2L83A 1VJKA 2WDRB 2W55A 3CWIA 3P4QB 2YEPB 4JPSA 1T5XD 3IAM1 1IUEA 4IDIA 2L32A 4MH8A 3ZJUA 3SEBA 2WDQB 1L0VB 3MFGA 1I4XA 1SJED 3P4RB 1OQRA 3AB5A 4YXDB 3Q8BA 3TEXA 2CJNA 1AYFA 2K9XA 2WXQA 4XWWA 2IGDA 4UDUC 2PW9A 2IPKD 1YNTE 3BIID 2E6XA 1F2RC 2YEPF 3U2SC 3PO0A 3HUIA 3AE6B 4HROA 4WQMA 1WGKA 5HFYA 1NYQA 1PYWD 1XCQL 3T3OA 1T3QA 2QEJC 1GB1A 3AE3B 1I4QA 4ARCA 2Y5PA 3U4EG 1IGCA 4MACA 4USAA 1VRAB 2CU3A 2XN9C 2KAJA 2TSSA 3FC4A 3Q8EA 3R2IA 1F0ZA 1ZPSA 1FM0D 2V4IB 1B9RA 3EGRA 5MPOA 2SEBD 3AN1A 1ZP0B 1UNSA 3ZJTA 1FMAD 4OZCA 1SE3A 3W1SA 3P1MA 2QJLA 3AE9B 4OW0A 3BYYB 1XXGA 1ZUD2 5G5HA 4LLGM 4HKZE 2MEKA 1MPEA 3W5UB 1ENFA 2WNMA 2OHFA 5D7GA 1PDXA 1SE2A 2K3UA 1VZ7A 3I9V1 3VRAB 2JQRB 2G1EA 3ZQ4A 1JMLA 2E3TA 2M19A 4RGTA 2WP9B 4YSZB 2RDHA 3MHZA 1XLPA 2LMCA 1XLNA 1TJEA 3J9CA 1ZDXA 4YSYB 3E56A 1VZ6A 2J52A 1I4RA 1L0YB 2SAKA 3OWEB 1Y56A 1V97A 1UGJA 2IGGA 1JWUD 4XDDA 5AUIA 1NENB 2M56B 2NTSA 2LHEA 3R2TA 1CZPA 3HVDA 1FRDA 2ONQA 3AE7B 4N58A 2WXMA 1D5XC 3VQIA 2AQ2B 2JYTA 2K5PA 1QOFA 3IAS1 1QOGA 4ZRQA 2J53A 1TS4A 3P4SB 5BMGA 1F77A 1OFFA 1XO3A 3BVMA 1KLGD 1N5XA 1SXTA 2N7JA 2QSDA 1TKYA 1KF6B 3ABVB 1UWMA 1B1ZA 4NJCA 3U52E 2VZKD 4KKJA 5FKAC 1QOAA 4YTNB 3W2DA 3B9JA 4H2AA 4YT0B 4XWTA 1ZOYB 4C7ZA 3P42A 1DGJA 1EM7A 1YJIA 1ZE3D 2XNAC 2DBYA 1FD6A 5EE9A 4A9AA 3NVVA 4DXFA 2LUMA 2K0PA 3KQ4A 2BBCA 2RPVA 2V3PA 1WRIA 2LGIA 3KWLA 1D5MC 5D3DA 4JE3B 2MJ3A 3W9CB 5HI1A 1FO4A 1SIJA 1HZ5A 2INPE 1IBXB 3ZJVA 3LB8C 4J3OD 5HG2A 1GOZA 1A70A 1YJJA 3NVWA 4RF1A 4RH6A 2QIEB 2LHDA 4P16A 2WLBA 1SEBD 2W54A 4KGRA 4HJGE 2KACA 2BS2B 4XDCA 3FILA 2MJEA 1FFVA 1C4AA 1J7AA 1JROA 2KN4A 2V0GA 1IGDA 2WXLA 2WXOA 1CJEA 1Q10A 4C7YA 4NAMA 3SFEB 4AS1A 3WCQA 1FCCC 3SFDB 4KX6B 1K51A 1QILA 1ROEA 1PGBA 2BT6A 2DYMA 2Q5WD 3BVGA 1TZOA 4R3DA 1F2RI 1P7FA 2WXKA 1VLBA 1UWXA 2EELA 5LNK1 2W82A 1SE4A 3ZGZA 4GDLB 1EU4A 1P7EA 2PLPA 1FXAA 2J4XA 1JWAD 3TUOA 1DYQA 2G9HD 3IXSA 5AUKA 3R8BA 1DOIA 4B0EA 3RFZB 1KRHA 1SJHD 4US8A 2BB6A 3C8YA 4RCOA 1YN5A 2PVOD 1RFKA 1J7BA 5EE0A 2GB1A 1N61A 3BK1A 4LTUA 5TSSA 3LYYA 1K52A 4C80A 2N0SB 2NTTA 5FR3A 2WXIA 1XCTL 1AW7A 4MT5A 3Q8FA 2RMMA 1VR9A 3AEEB 4XE0A 4YTPB 3AECB 1FFUA 1OQQA 2DYOA 4RFBA 4RF0A 2Z8LA 1E6EB 4TQ1A 4KGSA 2V3NA 4N59A 1ACCA 4P6VF 2JU6X 2WXHA 1JWSD 2BS3B 2K22A 1N62A 1JCKB 2N9KA 1QKZA 3AE5B 1ET6A 3MP9A 4NZLB 3T3NA 2DWQA 2L52A 3AE1B 1TY2A 3RPFC 2JX5A 1LO5D 1KFYB 1PFDA 1CK1A 1HA5A 1FIQA 1PUTA 2ZW0A 5E6JA 1MI0A 2RDGA 2PVGC 1C4PA 1TS5A 4WURA 2INNE 2HDEA 4FXCA 2JZPA 3Q69A 1C9FA 1E7PB 4REZA 4OZAA 5HHDG 2AQ3B 2LEKA 4AQ7A 1NI3A 1GAQB 1TKEA 4TQ0A 2ZW1A 4DQOC 3B2FA 4L2YA 2WU2B 3DWGC 3N9YC 1SBBB 4ZYSA 4ZRPA 2WXPA 5EE3A 1MHHE 2IJ0A 2KWDA 3P4PB 3AE4B 3AEFB 4C56C 1I4PA 1KTKA 3GS2A 4WWMA 1E10A 1DOYA 3I57A 2ON8A 2KMMA 4ARIA 1PGXA 1KH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCC C;  1HEZ E;  1K51 A;  4HKZ E;  1PGB A;  1MPE A;  5BMH A;  1YMH E;  1F2R I;  1P7F A;  3UI3 A;  1UWX A;  2EEL A;  4IOI E;  4GLS C;  1D4B A;  1JML A;  3GB1 A;  1P7E A;  2PLP A;  4IKG A;  2KDM A;  2IGH A;  1K50 A;  2KQ4 X;  2OED A;  2I38 A;  2J52 A;  5JXV A;  3FIL B;  2IGG A;  2LHE A;  2PTL A;  2ONQ A;  1GB4 A;  2GB1 A;  1K52 A;  4KGT A;  2J53 A;  5BMI A;  5BMG A;  3V3X A;  1XCT L;  2RMM A;  4OZB A;  1IBX A;  1MVK A;  2N7J A;  2QSD A;  2QMT A;  2JWU A;  2N9L A;  2GI9 A;  2JSV X;  1PGA A;  4WH4 A;  2NMQ A;  4KGS A;  2JU6 X;  1FCL A;  4D2K A;  2N9K A;  1QKZ A;  3MP9 A;  2I2Y A;  1EM7 A;  1FD6 A;  1K53 A;  2ZW0 A;  2LUM A;  2K0P A;  1MI0 A;  1HZ6 A;  2IGD A;  2RPV A;  2LGI A;  2PW9 A;  2JZP A;  1YNT E;  1C9F A;  1F2R C;  5HI1 A;  1HZ5 A;  5HFY A;  4OZA A;  5HHD G;  1IBX B;  5HG2 A;  1XCQ L;  1GB1 A;  2LHD A;  2ZW1 A;  1MHX A;  1IGC A;  2JXT A;  4MAC A;  4KGR A;  4HJG E;  2KAC A;  3FIL A;  1MHH E;  2KWD A;  2KN4 A;  1IGD A;  1ZXH A;  4OZC A;  1XF5 L;  1Q10 A;  2ON8 A;  1PGX A;  1KH0 A; 
#chains in the Genus database with same CATH topology
 2XBB C;  3AI5 A;  1XLQ A;  1T6B X;  3AE2 B;  2IY1 B;  1GNU A;  2AL3 A;  2HE7 A;  4B0M A;  3KH0 A;  3N1Y C;  1D6E C;  3P2B A;  4MM3 B;  1V1P A;  3EFU A;  1C78 A;  1WSP A;  4BKT A;  2WYQ A;  4RMA A;  2O2V A;  1I7H A;  2LGY A;  2LWP A;  3DOW A;  1N63 A;  4Q2J A;  1E8Z A;  1JRP A;  5D94 A;  3H8H A;  1XLO A;  3Q3M C;  2BB5 A;  3EA6 A;  3VUW A;  3UGB B;  3MC0 B;  3ETR A;  5BMI A;  2JPH A;  3ZYY X;  1MVK A;  1L0X B;  2BS4 B;  1FEH A;  2JWU A;  3DVN V;  3PRE A;  4KDI C;  1TBE A;  1RYJ A;  3L4P A;  2HTM E;  2KN5 A;  4XZ4 A;  2WXG A;  1Q1O A;  4D2K A;  4YSX B;  2KMA A;  1YX5 B;  3VHT C;  2D3A A;  1WGR A;  2W3S A;  3AMZ A;  2MJD A;  1K53 A;  1ISN A;  4FJY A;  3X0W A;  4CQN A;  3ZUN A;  4IM0 A;  3B1L X;  1L7Y A;  1HZ6 A;  3LXF A;  1HXY D;  2MQJ A;  2Y3A A;  3UQA A;  1TS3 A;  3ZW3 A;  3TEZ A;  4W9C A;  3AV8 A;  5GXG B;  4GDK B;  5G5G A;  1OTR B;  3RNG C;  1MHX A;  2KFK A;  1WJ4 A;  2REX A;  1OQY A;  4PS3 A;  2NCN A;  5I4D A;  4EOY A;  3HM3 A;  1QT9 A;  1XF5 L;  4M0W A;  3RZW C;  3QCA A;  4A8X C;  4ZOH C;  4E3C A;  3LJ3 A;  4TSS A;  2KC2 A;  3WAM A;  1R4M B;  2WXJ A;  3OLM D;  2DHZ A;  3RZF A;  5EE1 A;  4DDG D;  3W1Y A;  1R4M I;  4GLS C;  3RNA C;  4BOS C;  4TV3 A;  3RN9 C;  3MHS D;  4ITK A;  3ZO5 B;  4IG7 B;  4JX1 C;  2KDM A;  3ZRF A;  3Q8A A;  4O1N A;  3RNC C;  1YN3 A;  2DLB A;  1LFD A;  4YWG G;  1JQ4 A;  2BKR B;  1SSN A;  4LNO A;  2PMV A;  2PTL A;  2KJR A;  1J8C A;  1ET9 A;  3NUH B;  1C77 A;  1E8W A;  4A20 A;  4ANU A;  1R4N B;  3E9S A;  3UIP B;  2WXR A;  4JL9 A;  4OVZ A;  4HEA 1;  2JSV X;  2DAJ A;  1V1P B;  4JWU C;  2GBJ A;  2GRI A;  1FCL A;  2ICI A;  3OJ3 A;  2W55 A;  3CF6 E;  1VCB A;  3P4Q B;  2O2V B;  3I63 C;  4JPS A;  1MFW A;  3ZJU A;  1WJ6 A;  1I4X A;  1P9D U;  3AB5 A;  4GOC A;  3ZXV A;  3TEX A;  2K9X A;  2WXQ A;  2IGD A;  2NR2 A;  2ZPY A;  4IM2 A;  2G4S A;  2GLS A;  3BII D;  1F2R C;  3U2S C;  3PO0 A;  4WQM A;  1UGM A;  3APC A;  1NYQ A;  4GDL A;  1XCQ L;  2XN9 C;  2CU3 A;  2ZCB A;  2TSS A;  3Q8E A;  4HCP B;  1F0Z A;  2EMS A;  2KVZ A;  5MPO A;  4ZDV A;  3DDC B;  3AN1 A;  1Y8R C;  3EFC A;  3VTV A;  3MJW A;  4OW0 A;  3BYY B;  4LJO B;  1XXG A;  5G5H A;  1Q5W B;  4HKZ E;  4K3B A;  4WJQ A;  2MEK A;  3W5U B;  5LXH A;  1UBQ A;  3GOE A;  1VZ7 A;  2GBM A;  2M1M A;  2GBK A;  5J17 A;  3BY4 B;  5IAA C;  4MJS A;  3RMK C;  4YSZ B;  3GZN B;  2FCN A;  3DHH C;  1WJN A;  1D3Z A;  3A1Q A;  1TJE A;  2GOW A;  2KFJ A;  3E56 A;  1VZ6 A;  2KFK B;  4BKG A;  2MCN B;  5DCN A;  4FN2 A;  1UGJ A;  1JWU D;  2LGS A;  1CZP A;  4M0W B;  1AAR A;  1TTN A;  1QOG A;  2KWC A;  1OFF A;  3DBH B;  1N5X A;  3JW0 X;  3DBH I;  2FIF A;  4K81 A;  4EFO A;  3WAN A;  2VZK D;  2YVC A;  2IBI B;  2DX5 B;  3P42 A;  1DGJ A;  2RPQ A;  1ZE3 D;  2XNA C;  2DBY A;  4GU2 A;  1FD6 A;  4A9A A;  3NVV A;  4WQO B;  3NJT A;  2LRW A;  3SDL C;  2MBE A;  3KQ4 A;  2LGI A;  3KWL A;  4KZ0 A;  2MJ3 A;  3W9C B;  3I5J C;  1SIJ A;  2R2O A;  4C4V A;  4LDT D;  3LB8 C;  5HG2 A;  2IND C;  2LI5 A;  4WAA A;  1P3Q U;  2LHD A;  4P16 A;  4KGR A;  2LXC A;  4BKS A;  2BS2 B;  4BFR A;  3FIL A;  1C4A A;  1J7A A;  3VVW B;  1IGD A;  2WXL A;  3DPD A;  4XC2 A;  4KV2 A;  2NBW B;  5HKH A;  2BT6 A;  1UH6 A;  3BVG A;  4W9I A;  2WXK A;  1VLB A;  2K39 A;  5C1Z A;  2W82 A;  1SE4 A;  4GDL B;  1EU4 A;  4WWN A;  2J4X A;  1JWA D;  4W9D A;  4B9K A;  2L8J A;  3R8B A;  5E6O A;  3NHE B;  2DZI A;  1NI2 A;  2KC1 A;  3ZLZ A;  1VD2 A;  2EKE C;  4MT5 A;  3Q8F A;  3KW5 B;  1VR9 A;  3AEC B;  4RFB A;  3KYC D;  4RF0 A;  2KWU B;  4TQ1 A;  4KGS A;  2V3N A;  4MJS B;  4N59 A;  3TJP A;  4EKU A;  2BS3 B;  2M0X A;  2KAN A;  4ZYN A;  3QA8 A;  3A1Q B;  3VUX A;  4MGY E;  4NZL B;  3PHW B;  3T3N A;  5AZH A;  3CST A;  2DWQ A;  3IVF A;  1RAX A;  3AE1 B;  3TL5 A;  2JWZ A;  2RR9 A;  1KFY B;  1PFD A;  3QHT A;  1HA5 A;  4HCN B;  4HPP A;  1WI0 A;  1FIQ A;  5E6J A;  5EDS A;  2K6D B;  1P98 A;  2PVG C;  5L95 C;  2HDE A;  2LVQ A;  2JZP A;  1C9F A;  2KDF B;  3JVZ X;  4OZA A;  3M62 B;  5HHD G;  2MW5 A;  5E6P A;  3ZNH B;  2AYO B;  5J2R A;  2BKF A;  4DQO C;  2WU2 B;  3DWG C;  3N9Y C;  4ZYS A;  1WXA A;  1KTK A;  3DVG X;  3HHM A;  3M63 B;  3AU5 A;  1PGX A;  2MBH A;  1F9J A;  2H88 B;  3LDZ E;  2MBO A;  3IT6 B;  4II2 B;  3R3M A;  1TY0 A;  5C2T B;  3O13 A;  2OOB B;  1I42 A;  4XGA B;  4LNN A;  1IYF A;  2JY6 A;  4IOI E;  3Q2A C;  2MLB A;  4C4V B;  3NZ3 A;  4IKG A;  2K25 A;  4BBN C;  2VZK B;  1VDV A;  4OVU A;  2C5L C;  5BYQ A;  3FIL B;  1STE A;  2N9P C;  1RM6 C;  5D3I B;  4W9J A;  1GB4 A;  2AQ1 B;  2WXN A;  4XYC A;  2CHZ A;  1Q0W B;  1YQ3 B;  1D5Z C;  2LGD A;  3AXC A;  1JWM D;  4YTM B;  2BF8 B;  3KUC B;  2W3R A;  2KD0 A;  2KZR A;  4AJW A;  4FLH A;  3RUL A;  3H7P A;  1PQS A;  2UU7 A;  1PGA A;  3B2G A;  3SD5 A;  1WM2 A;  3APD A;  4LDT B;  2Y5B B;  3TEY A;  5C3J B;  3CSF A;  4MGZ E;  5T8I A;  2RDB C;  1JWB D;  4GMV A;  3GE8 C;  4ZHO A;  1KLU D;  2OJW A;  2PE9 A;  3AEB B;  2MWS B;  5DPW A;  4JGH B;  4X57 B;  1V5T A;  2MA9 B;  3DVN U;  3WAO A;  3ZNZ B;  2D3C A;  1WYG A;  3RNF C;  2BGF A;  3V05 A;  2O6V D;  4KDL B;  3UIN B;  1WGY A;  5J18 A;  3NVY A;  3Q3J A;  5IO9 A;  1E8X A;  2K1F A;  2KNB A;  2G3Q B;  1QOB A;  2JXT A;  1I4H A;  4GGQ A;  3QAQ A;  1YQ4 B;  1JW9 D;  3GE3 C;  3L10 B;  3N20 C;  1FNV A;  1TYG B;  3OAW A;  4F1S A;  3VTW A;  4EE2 A;  2N9X A;  1I4G A;  2BYF A;  1HEZ E;  2GBR A;  3P63 A;  3AH7 A;  3KLS X;  4C00 A;  3O65 B;  3PRZ A;  4KKI A;  5BMH A;  1R7S A;  1CQV A;  2BWE S;  3RD2 A;  4ZRK A;  1L4D B;  2KMC A;  4US9 A;  4BZA A;  1Z5S B;  3BYT B;  4PYZ A;  1NVI D;  1EUV B;  2VH1 A;  1LM8 B;  3V61 A;  2UWQ A;  3IT4 B;  4PK1 A;  2FUH B;  3DWM A;  3PTF C;  3X23 A;  2N9E B;  4KGT A;  1ZXI A;  2L05 A;  1K8R B;  5DPS A;  1P1A A;  4HRS A;  1AN8 A;  2GI9 A;  1QF6 A;  1XD3 B;  3BVZ A;  4K7W A;  4XX5 A;  2HJ1 A;  2NMQ A;  3SR6 A;  1FRR A;  4A3P A;  1TGZ B;  3EUB 2;  4II3 B;  1VJK A;  4FJV B;  2YEP B;  2L32 A;  4MH8 A;  4DWF A;  1WJU A;  3NZU A;  2KHW B;  2WDQ B;  1WGD A;  3Q8B A;  3AUL A;  2ZNV B;  4AJY B;  3RI7 C;  1QZE A;  2YEP F;  3HUI A;  3WIM A;  2Z0E B;  3H7P B;  2EMT A;  2QEJ C;  1GB1 A;  3AE3 B;  4ARC A;  4I6N B;  2X8X X;  4TKN A;  1ZP0 B;  4FBJ B;  1UNS A;  4NQK E;  1FMA D;  4P1B C;  4S0R A;  3T8M A;  3ZJT A;  5G55 A;  3P1M A;  2QJL A;  1ZUD 2;  2JXX A;  3VFK A;  1MPE A;  2K3U A;  2KJH B;  2KJ6 A;  3VRA B;  2WP9 B;  2RDH A;  3MHZ A;  2V1Y A;  2LMC A;  1XLN A;  4YSY B;  1EF1 A;  1I4R A;  3HIZ A;  2IGG A;  4HPL B;  3QWZ B;  1WXS A;  3N3K B;  4N58 A;  1HTQ A;  1T0Q C;  2JYT A;  2K5P A;  2DZM A;  1QOF A;  3SHQ A;  1WY8 A;  1TS4 A;  3APF A;  4FUL A;  2PEA A;  1XO3 A;  1SXT A;  1TKY A;  1KF6 B;  1B1Z A;  1RRB A;  3U52 E;  3Q14 C;  5FKA C;  1KLV A;  1QOA A;  5JH5 C;  4H2A A;  3ZDT A;  2KX0 A;  2K6Q A;  4OVV A;  4WWO A;  3KUD B;  2IY0 B;  2J0K A;  3KYD D;  2BBC A;  3RCZ A;  2RPV A;  4ANX A;  2V3P A;  2DNF A;  2INP E;  1NBF C;  4RH6 A;  3H1U A;  3A33 B;  3TIX A;  4BBN F;  2V0G A;  4BVU C;  2K8C A;  4KSL C;  3SFE B;  3C19 A;  3SFD B;  4KX6 B;  3WA0 A;  1PGB A;  4ICV A;  4GB9 A;  2Q5W D;  2FID A;  1P7F A;  5BO4 B;  2L76 A;  2EEL A;  5LNK 1;  2K8H A;  3VDZ A;  4P7I A;  2N1W A;  3ZGZ A;  3KUZ A;  1YIW A;  2ZEQ A;  4GN1 A;  3ML9 A;  1DYQ A;  2G9H D;  2WDT B;  3A4S C;  3ZXR A;  2ZVO A;  1E7U A;  3C8Y A;  2DZJ A;  3PPA A;  5E6N A;  2KYW A;  4W9E A;  2HD5 B;  1N6Z A;  1WGG A;  1N61 A;  2KTR A;  2NTT A;  4M00 A;  5FR3 A;  1WXM A;  1XCT L;  2RMM A;  3FKY A;  4PYU A;  2Z8L A;  1E6E B;  1ACC A;  4P6V F;  2K22 A;  2D3B A;  3DHI C;  1V2Y A;  1JCK B;  1ET6 A;  2VH2 A;  4I6L B;  3S2A A;  2L52 A;  3H6N A;  1TY2 A;  2JRI B;  2DYB A;  2KXJ A;  2B3A A;  2L0T A;  3D32 A;  4HWI B;  2G4D B;  3L17 A;  2RDG A;  1C4P A;  4G11 A;  1E7V A;  1TS5 A;  2INN E;  2MBQ A;  4HDQ A;  4W9L A;  2AQ3 B;  4MH0 E;  4WJO A;  1WZ0 A;  3Q6B A;  2WXP A;  5EE3 A;  2KWD A;  3AEF B;  1I4P A;  3M3J A;  3TCA A;  3GS2 A;  1E10 A;  1DOY A;  3I57 A;  3ZNG C;  1HTO A;  3ZIM A;  4WAF A;  4PT5 A;  1OGW A;  3TMP B;  3VRB B;  1WXQ A;  2BYT A;  2C60 A;  1V8C A;  2LGX A;  2LRU A;  1FNU A;  2CU1 A;  4AP4 C;  3Q3O C;  4EUT A;  2L1A A;  1TKG A;  5AZG A;  4B95 A;  3NRZ A;  2LZ6 A;  1D4B A;  1NYR A;  4MSM B;  3VH4 B;  2LAS A;  1E0Z A;  3CMM B;  4IWQ A;  2OED A;  2I38 A;  3VH3 B;  2FCQ A;  4ACF A;  2I1K A;  1BUI C;  2BYE A;  1AWD A;  2L00 B;  1QQR A;  2A5U A;  4AOF A;  3PLU A;  3DQV A;  2D5G A;  1EU3 A;  3K9P B;  2KTF A;  2ZNV C;  3MC9 A;  1MG8 A;  1MJD A;  4KVG B;  4DBG A;  2N9L A;  4WWP A;  2WS3 B;  2FE8 A;  2KLC A;  2LJI A;  4K3C A;  4W9G A;  4WIP A;  4IM3 A;  1SF0 A;  4ANW A;  1KOT A;  2A4Z A;  4A55 A;  2J7Q B;  2LUE A;  4TMA B;  2IZV B;  5H92 C;  1EWC A;  2H89 B;  2BVC A;  1C76 A;  5IKC M;  4PS7 A;  1FXT B;  4W9K A;  5LXI B;  2CKH B;  2QDF A;  2KTR B;  4JIO U;  2L7R A;  1RLF A;  2BW2 A;  1UEL A;  2KQ7 A;  2KO3 A;  4A6Q A;  2B76 B;  1VZ8 A;  3Q8C A;  5JHB A;  3VR8 B;  1HQR D;  2QIL A;  4M8N A;  2MH7 A;  1IPG A;  3R7Q A;  4LNK A;  3CIR B;  4NY0 A;  1C1Y B;  1EF5 A;  2IO1 B;  3HVZ A;  3AEA B;  3PZ8 A;  3V60 A;  3PZ7 A;  3NVZ A;  4KIK A;  2WDV B;  2L0F A;  3L0W B;  3TBL D;  4BOZ B;  5IN7 A;  1RWS A;  3N32 A;  3VR9 B;  4JWS C;  4LK0 M;  2PIA A;  2ACZ B;  5AEK B;  5IOI A;  3NS1 A;  2PPH A;  4ZHP A;  3QQ8 B;  4RGM A;  3V6E B;  3JSV A;  1LXD A;  2JRH A;  3GB1 A;  4HK2 A;  3T9L A;  3DBL B;  1QLB B;  2IGH A;  2QC8 A;  1GUA B;  3DBL I;  2JYE A;  2LVP A;  3RNB C;  1FXI A;  5JXV A;  2DAF A;  4I6P A;  1UUP A;  4CYE A;  2R61 A;  2RGF A;  5H8Y E;  3A4R A;  1C79 A;  1TS2 A;  4OHJ A;  1ESF A;  3UIO B;  1FNW A;  1WM3 A;  1WX7 A;  3L54 A;  5KHQ A;  3V3X A;  4ASW C;  3U7D A;  4OZB A;  4EZJ A;  2X38 A;  1IBX A;  1L6V A;  2QMT A;  4MEM A;  2IO0 B;  4WH4 A;  2WXF A;  3BK2 A;  1NEK B;  4JLC A;  2CJO A;  3PRP B;  2L83 A;  3CWI A;  1KJT A;  1V81 A;  2RD0 A;  3OJ4 B;  1T5X D;  3IAM 1;  1IUE A;  1KM7 A;  1ZKH A;  2KQS A;  4JQW C;  4RM9 A;  2KKC A;  4F7Z A;  1SJE D;  1E8Y A;  1OQR A;  4KZC A;  4ANV A;  4YXD B;  4N9F 4;  3DHG C;  4XWW A;  2NBU A;  2NBV B;  4UDU C;  1J0G A;  2KVR A;  4NQL B;  1YNT E;  1ZW7 A;  1WGH A;  3AE6 B;  4HRO A;  3B08 A;  1XT9 B;  5HFY A;  3PVL A;  1PYW D;  3PZD A;  3T3O A;  1T3Q A;  3MTN B;  1I4Q A;  2Y5P A;  3NG0 A;  1IGC A;  3IHP C;  1S1Q B;  3QJZ A;  4USA A;  3FC4 A;  3R2I A;  4LNF A;  1ZPS A;  1JRU A;  2V4I B;  1V86 A;  3EGR A;  2SEB D;  3IBE A;  4OZC A;  3W1S A;  2G45 B;  2XK5 A;  2JZ3 B;  2KDB A;  5L83 A;  2CS4 A;  4HLE A;  1ENF A;  2WNM A;  2OHF A;  5D7G A;  1PDX A;  3M95 A;  3PGE A;  1SIF A;  4G3X B;  2JQR B;  2KLG A;  2E3T A;  2M19 A;  4RGT A;  2WHI A;  1XLP A;  3J9C A;  1ZDX A;  5IA7 A;  1L0Y B;  1OEY J;  1WE6 A;  2SAK A;  3OWE B;  3N1X C;  1Y56 A;  2AWT A;  3RT3 B;  2L3Z A;  2M56 B;  2NTS A;  3R2T A;  4DHJ D;  4HJK A;  4KIK B;  2O6V A;  2ONQ A;  2MSE D;  3AE7 B;  1WRD B;  2WXM A;  3U8Z A;  3L08 A;  3IAS 1;  3DCG A;  2J53 A;  1FPY A;  3BVM A;  2WGS A;  2N7J A;  3QAR A;  2QSD A;  3H9D A;  4FA6 A;  2V9H A;  5GMV A;  3JSV B;  2M8S A;  3QIJ A;  3QX1 A;  2V4L A;  2NPT A;  2KOX A;  3W2D A;  2KT7 A;  3B9J A;  4YT0 B;  2D10 A;  4S17 A;  4IW0 A;  5CHW A;  4C7Z A;  2JUO A;  2CHX A;  1EM7 A;  1H8C A;  5D6J B;  2ZZP B;  4CO7 A;  4M02 A;  1F1H A;  4W9F A;  4DXF A;  5G2N A;  2LUM A;  2K0P A;  2QCZ A;  4K7S A;  1D5M C;  5D3D A;  4JE3 B;  5HI1 A;  4FHJ A;  1FO4 A;  1HZ5 A;  1IBX B;  3ZJV A;  1E90 A;  1GOZ A;  1A70 A;  1YJJ A;  3NVW A;  4RF1 A;  2CR5 A;  1SEB D;  3MC8 A;  4WJN A;  3PSE B;  3V6C B;  1FFV A;  1BT0 A;  1JRO A;  2KN4 A;  3H7S A;  4ZRJ A;  3NZS A;  2GBN A;  1L2N A;  2WXO A;  1Q10 A;  3WCQ A;  2D11 A;  1U4A A;  1ROE A;  2NS5 A;  1UZX B;  3QC8 B;  2ZPN A;  2BPS A;  1UWX A;  4YL8 A;  2C9W B;  3HM6 X;  2OJR A;  2HJ8 A;  4G50 A;  3IXS A;  5AUK A;  3RFZ B;  1KRH A;  4US8 A;  2BB6 A;  5CX3 A;  2PVO D;  4NPN A;  1RFK A;  1J7B A;  5EE0 A;  2XK5 B;  3ML8 A;  2GB1 A;  4LTU A;  5TSS A;  3LYY A;  1K52 A;  4C80 A;  2N0S B;  2WXI A;  3IFW B;  2CHW A;  2KWV B;  4XE0 A;  4YTP B;  3U30 A;  1FFU A;  1OQQ A;  2DZK A;  2FCS A;  1LQB A;  2XEW A;  4A3O A;  2YLM A;  1QKZ A;  4MGI E;  3OG5 A;  3N30 A;  1LO5 D;  1TT5 B;  4MEL A;  1PUT A;  2ZW0 A;  2O6V B;  2KK8 A;  4NJ7 A;  1GC6 A;  4EEW A;  2GMI C;  1MG4 A;  4NAW A;  2C7H A;  4IWP A;  2KDE B;  2LEK A;  4AQ7 A;  2D2Q A;  4FJZ A;  1TKE A;  1XQQ A;  2NPT B;  4GSW A;  4ZRP A;  2IJ0 A;  3P4P B;  3N1Z C;  2LJ5 A;  2C7M B;  4WWM A;  1Z2M A;  4ARI A;  2K8B A;  1KH0 A;  1M4V A;  2PKO A;  4DHJ B;  3AED B;  5LLI A;  1YMH E;  3UI3 A;  1H4R A;  1N60 A;  3BWU D;  4HKQ A;  4K1R B;  3A9J A;  2IDY A;  1R4N I;  3ZTC A;  2IO3 B;  3PRM B;  2KQ4 X;  5DPT A;  1YN4 A;  1JAL A;  5JHA A;  2BTE A;  3TSS A;  4RGN A;  4DXG A;  1V1O A;  1HE8 A;  2M0A A;  2FBW B;  3R66 C;  1L6U A;  1L4Z B;  2WU5 B;  4J6I A;  4RGO S;  3BIN A;  3BZD B;  2LXA A;  3UQB A;  2FAZ A;  3WAP A;  4DHZ B;  1WH3 A;  3SU8 X;  1X1M A;  2M4N A;  3AE8 B;  1ZDV A;  3R7R A;  2AEH A;  4M01 A;  2I2Y A;  3U7Z A;  1T0R C;  3I3T B;  5BYS A;  1WWT A;  1GPX A;  1SB3 C;  5JZE B;  4RM8 A;  1J19 A;  1UBI A;  3EEC A;  1V9J A;  4RNA A;  3GP7 A;  4L1B A;  3FAH A;  1J7C A;  1V6E A;  5BYR A;  5C23 A;  2LFI A;  3HRD D;  2EKI A;  2KX3 A;  3URY A;  4FAD A;  3ALB A;  3TEW A;  4L23 A;  1P0R A;  1DOX A;  5TR5 A;  2ASQ A;  2PJH A;  1ZXH A;  3GZN I;  5AZF A;  2WQY B;  3DBS A;  4AWJ A;  1WYW B;  4K7U A;  3ZDM C;  1EWY C;  4NAW B;  1XEE A;  1M94 A;  4URK A;  3AEG B;  1E9M A;  3NY5 A;  1K50 A;  2MX2 A;  4N6E B;  2KDI A;  3VTU A;  2UYZ B;  2LVO A;  3W5V B;  1BML C;  2V3S A;  3DVG Y;  1N5W A;  3HK0 A;  4BKS D;  2JZZ A;  2INC C;  4E74 A;  2M17 A;  2AX5 A;  2PE6 B;  1BXT A;  2Y5C A;  1WF9 A;  1C4C A;  1WX9 A;  2FUG 1;  3KWV A;  5FK9 C;  1C3T A;  2J42 A;  1S3S G;  1GC7 A;  4GIV A;  4IWO A;  1V49 A;  1L5P A;  3AM9 A;  1WXV A;  2MHJ A;  1YX6 B;  1WFY A;  3KVF B;  1ZGU B;  3A9J B;  4TUU A;  3MJ5 A;  3ZRC A;  4A90 A;  2Z0D B;  5D2M B;  2BQQ A;  2WDR B;  3PT2 B;  4IDI A;  2N4F A;  2HTH A;  1YOV B;  1YJ1 A;  3SEB A;  1L0V B;  3P4R B;  3MFG A;  4EZK A;  1GG3 A;  2JVC A;  2AL6 A;  2CJN A;  1AYF A;  1IP9 A;  2D3G A;  2PW9 A;  3A9K A;  2IPK D;  3RYT A;  2E6X A;  1WGK A;  3ECI A;  3U4E G;  4MAC A;  1VRA B;  2KAJ A;  2N7D A;  2JT4 B;  1FM0 D;  1B9R A;  4DHZ E;  1T0S C;  1SE3 A;  4HPM B;  3V62 A;  1LGR A;  2J0J A;  4NNJ B;  3AE9 B;  4LLG M;  3Q3F A;  4DK5 A;  3W1S C;  1SE2 A;  3PS6 A;  1WMH A;  3I9V 1;  2G1E A;  2IO2 B;  3ZQ4 A;  1JML A;  1UD7 A;  1T0Y A;  1RFA A;  2C7N B;  5DPR A;  4QAY A;  4P1C C;  1E5W A;  2J52 A;  3VXW A;  3VAW A;  2BYV E;  4MSQ B;  1CMX B;  1V97 A;  2LD9 A;  4XDD A;  1NEN B;  5AUI A;  3ZVV A;  2QHO A;  2LHE A;  3HVD A;  1FRD A;  3ZKJ C;  1TIF A;  4GXB A;  1D5X C;  3VQI A;  2AQ2 B;  4ZRQ A;  2WX0 A;  3P4S B;  5BMG A;  4CHK A;  1F77 A;  3DBR B;  1V80 A;  2MP2 A;  1KLG D;  3PLV A;  1EO6 A;  1YQB A;  3DBR I;  3ABV B;  1UWM A;  3RNE C;  4HXD A;  4NJC A;  2ZVN A;  4KKJ A;  1WR6 E;  4YTN B;  4ZRI A;  3QK0 A;  4XWT A;  1ZOY B;  1YJI A;  1OEY A;  5EE9 A;  4KSK C;  2J0M A;  1WR1 A;  5IP4 D;  1WRI A;  1NDD A;  3AU4 A;  4PS8 A;  4MGK E;  4WJP A;  4MM3 A;  2WX1 A;  2N1V A;  4LJP B;  4AUQ C;  5CTR C;  2W9N A;  4IC7 B;  4B6W A;  4J3O D;  3IG3 A;  3NS8 A;  3ENE A;  2QIE B;  4G0N B;  2WWZ A;  2WLB A;  2W54 A;  4HJG E;  2KAC A;  4DDI D;  4XDC A;  2MJE A;  3NOB A;  1CJE A;  4C7Y A;  4NAM A;  3RUI B;  1V5O A;  4AS1 A;  1A5R A;  1FCC C;  1K51 A;  1QIL A;  2R2Q A;  4DXA B;  2MBB B;  2DYM A;  4NJ6 A;  1YD8 U;  1TZO A;  4R3D A;  1F2R I;  5CHF A;  2ZJD A;  3A9K B;  3EHV A;  1WE7 A;  3ZTD A;  3L16 A;  2FNJ B;  3ZNI D;  2ZCC A;  1I35 A;  2D07 B;  1P7E A;  2PLP A;  1FXA A;  4MDK E;  3EC8 A;  4FHK A;  1G6J A;  3WAL A;  3TUO A;  4HVB A;  1WX8 A;  4W9H A;  4B0E A;  1DOI A;  4HDO A;  1SJH D;  4RCO A;  1YN5 A;  4EZL A;  2IYD B;  5FR6 A;  1GJZ A;  3BK1 A;  3C0R B;  1UF0 A;  4F8C B;  1AW7 A;  3B0A A;  2JF5 A;  3AEE B;  1WMH B;  2I1J A;  2RSU A;  4GDK A;  2DYO A;  3VUY A;  4ICU A;  2JU6 X;  2WXH A;  1JWS D;  1N62 A;  3PV1 A;  2NVU I;  2N9K A;  1SGH A;  3AE5 B;  3K9O B;  3MP9 A;  4E71 A;  1SE9 A;  3RPF C;  1WZ3 A;  2JX5 A;  2Z59 B;  1CK1 A;  2N7E A;  4LNI A;  1F52 A;  1MI0 A;  1WIA A;  1TZ1 A;  4WUR A;  4FXC A;  3Q69 A;  3UF8 A;  2FCM A;  1E7P B;  4REZ A;  4LCD E;  2MP2 B;  2MRP A;  4M8M A;  1NI3 A;  1GAQ B;  4TQ0 A;  2ZW1 A;  2DEN B;  3B2F A;  4L2Y A;  3JYU A;  2VRR B;  1SBB B;  3Q3N C;  4BAX A;  3L13 A;  1MHH E;  3AE4 B;  4C56 C;  5KHO A;  2BWF A;  3PHX B;  4IUM B;  3ONS A;  2ON8 A;  5CHV C;  2KMM A; 
#chains in the Genus database with same CATH homology
 4WAF A;  4PT5 A;  3VRB B;  1XLQ A;  1WXQ A;  1T6B X;  2H88 B;  1M4V A;  2BYT A;  3AE2 B;  2PKO A;  1V8C A;  3AED B;  3IT6 B;  1TY0 A;  4B0M A;  5C2T B;  1FNU A;  3O13 A;  1YMH E;  1D6E C;  3UI3 A;  1N60 A;  2L1A A;  1TKG A;  3BWU D;  4HKQ A;  3NRZ A;  4MM3 B;  4IOI E;  1V1P A;  1D4B A;  1C78 A;  1NYR A;  1WSP A;  2IDY A;  3NZ3 A;  1E0Z A;  4IKG A;  2KQ4 X;  2OED A;  2I38 A;  1YN4 A;  2VZK B;  1I7H A;  1JAL A;  1N63 A;  1VDV A;  2BTE A;  4Q2J A;  5BYQ A;  3FIL B;  1STE A;  3TSS A;  4RGN A;  1JRP A;  4DXG A;  1V1O A;  1BUI C;  2M0A A;  1RM6 C;  2FBW B;  1AWD A;  5D3I B;  1L6U A;  3H8H A;  1XLO A;  1QQR A;  1GB4 A;  2AQ1 B;  1L4Z B;  2WU5 B;  2BB5 A;  2D5G A;  2WXN A;  3EA6 A;  4RGO S;  3BZD B;  1EU3 A;  1YQ3 B;  1D5Z C;  3MC0 B;  3ETR A;  5BMI A;  1JWM D;  4YTM B;  3ZYY X;  2W3R A;  1MVK A;  1L0X B;  2BS4 B;  1FEH A;  2JWU A;  2N9L A;  1PGA A;  2WS3 B;  2FE8 A;  3B2G A;  3AE8 B;  1ZDV A;  2LJI A;  4WIP A;  1RYJ A;  1SF0 A;  3TEY A;  3L4P A;  2HTM E;  5C3J B;  5T8I A;  2WXG A;  4D2K A;  1JWB D;  4YSX B;  4A55 A;  4ZHO A;  1KLU D;  3AEB B;  4TMA B;  2I2Y A;  5H92 C;  3U7Z A;  1EWC A;  2H89 B;  2W3S A;  3AMZ A;  2MJD A;  5BYS A;  1C76 A;  1K53 A;  4CQN A;  1WWT A;  1GPX A;  1SB3 C;  1WYG A;  1HZ6 A;  3LXF A;  1HXY D;  2Y3A A;  3V05 A;  1TS3 A;  2BW2 A;  4A6Q A;  4RNA A;  2B76 B;  1VZ8 A;  3GP7 A;  3NVY A;  3Q8C A;  3TEZ A;  4L1B A;  3AV8 A;  5GXG B;  3VR8 B;  1HQR D;  3FAH A;  1J7C A;  2QIL A;  4GDK B;  5G5G A;  5BYR A;  2MH7 A;  1QOB A;  3CIR B;  1MHX A;  2JXT A;  1I4H A;  2LFI A;  3HRD D;  3HVZ A;  2EKI A;  3URY A;  3AEA B;  3PZ8 A;  5I4D A;  1YQ4 B;  1JW9 D;  3TEW A;  4L23 A;  3PZ7 A;  3NVZ A;  1DOX A;  1FNV A;  1TYG B;  1ZXH A;  1QT9 A;  1XF5 L;  2WDV B;  4M0W A;  4EE2 A;  1I4G A;  4A8X C;  4ZOH C;  1HEZ E;  4TSS A;  1RWS A;  2WQY B;  3VR9 B;  4JWS C;  3P63 A;  3AH7 A;  3KLS X;  4LK0 M;  5BMH A;  4KKI A;  2PIA A;  2ACZ B;  2WXJ A;  1R7S A;  1CQV A;  5EE1 A;  3NS1 A;  4GLS C;  4ZHP A;  1EWY C;  4NAW B;  4RGM A;  1XEE A;  1L4D B;  4US9 A;  3GB1 A;  3BYT B;  4ITK A;  1QLB B;  3AEG B;  4JX1 C;  1E9M A;  2KDM A;  2IGH A;  1K50 A;  4N6E B;  1NVI D;  3Q8A A;  4O1N A;  3W5V B;  2JYE A;  1BML C;  1YN3 A;  1FXI A;  2DLB A;  1N5W A;  4YWG G;  5JXV A;  1JQ4 A;  1UUP A;  3IT4 B;  1SSN A;  2R61 A;  2PMV A;  2AX5 A;  2PTL A;  5H8Y E;  3DWM A;  1C79 A;  1TS2 A;  1ET9 A;  1BXT A;  2Y5C A;  3NUH B;  1C77 A;  4OHJ A;  1ESF A;  1C4C A;  1FNW A;  4KGT A;  2FUG 1;  3KWV A;  1ZXI A;  3E9S A;  5FK9 C;  3V3X A;  2WXR A;  4OZB A;  2J42 A;  4HRS A;  1AN8 A;  2X38 A;  4OVZ A;  1IBX A;  1L6V A;  2QMT A;  4HEA 1;  1L5P A;  2GI9 A;  2JSV X;  3AM9 A;  4WH4 A;  1V1P B;  3BVZ A;  1QF6 A;  2WXF A;  3BK2 A;  2NMQ A;  3SR6 A;  1NEK B;  4JWU C;  1FRR A;  2CJO A;  3MJ5 A;  4A90 A;  2GRI A;  1FCL A;  2ICI A;  3EUB 2;  2L83 A;  1VJK A;  2WDR B;  2W55 A;  3CWI A;  3P4Q B;  2YEP B;  4JPS A;  1T5X D;  3IAM 1;  1IUE A;  4IDI A;  2L32 A;  4MH8 A;  3ZJU A;  3SEB A;  2WDQ B;  1L0V B;  3MFG A;  1I4X A;  1SJE D;  3P4R B;  1OQR A;  3AB5 A;  4YXD B;  3Q8B A;  3TEX A;  2CJN A;  1AYF A;  2K9X A;  2WXQ A;  4XWW A;  2IGD A;  4UDU C;  2PW9 A;  2IPK D;  1YNT E;  3BII D;  2E6X A;  1F2R C;  2YEP F;  3U2S C;  3PO0 A;  3HUI A;  3AE6 B;  4HRO A;  4WQM A;  1WGK A;  5HFY A;  1NYQ A;  1PYW D;  1XCQ L;  3T3O A;  1T3Q A;  2QEJ C;  1GB1 A;  3AE3 B;  1I4Q A;  4ARC A;  2Y5P A;  3U4E G;  1IGC A;  4MAC A;  4USA A;  1VRA B;  2CU3 A;  2XN9 C;  2KAJ A;  2TSS A;  3FC4 A;  3Q8E A;  3R2I A;  1F0Z A;  1ZPS A;  1FM0 D;  2V4I B;  1B9R A;  3EGR A;  5MPO A;  2SEB D;  3AN1 A;  1ZP0 B;  1UNS A;  3ZJT A;  1FMA D;  4OZC A;  1SE3 A;  3W1S A;  3P1M A;  2QJL A;  3AE9 B;  4OW0 A;  3BYY B;  1XXG A;  1ZUD 2;  5G5H A;  4LLG M;  4HKZ E;  2MEK A;  1MPE A;  3W5U B;  1ENF A;  2WNM A;  2OHF A;  5D7G A;  1PDX A;  1SE2 A;  2K3U A;  1VZ7 A;  3I9V 1;  3VRA B;  2JQR B;  2G1E A;  3ZQ4 A;  1JML A;  2E3T A;  2M19 A;  4RGT A;  2WP9 B;  4YSZ B;  2RDH A;  3MHZ A;  1XLP A;  2LMC A;  1XLN A;  1TJE A;  3J9C A;  1ZDX A;  4YSY B;  3E56 A;  1VZ6 A;  2J52 A;  1I4R A;  1L0Y B;  2SAK A;  3OWE B;  1Y56 A;  1V97 A;  1UGJ A;  2IGG A;  1JWU D;  4XDD A;  5AUI A;  1NEN B;  2M56 B;  2NTS A;  2LHE A;  3R2T A;  1CZP A;  3HVD A;  1FRD A;  2ONQ A;  3AE7 B;  4N58 A;  2WXM A;  1D5X C;  3VQI A;  2AQ2 B;  2JYT A;  2K5P A;  1QOF A;  3IAS 1;  1QOG A;  4ZRQ A;  2J53 A;  1TS4 A;  3P4S B;  5BMG A;  1F77 A;  1OFF A;  1XO3 A;  3BVM A;  1KLG D;  1N5X A;  1SXT A;  2N7J A;  2QSD A;  1TKY A;  1KF6 B;  3ABV B;  1UWM A;  1B1Z A;  4NJC A;  3U52 E;  2VZK D;  4KKJ A;  5FKA C;  1QOA A;  4YTN B;  3W2D A;  3B9J A;  4H2A A;  4YT0 B;  4XWT A;  1ZOY B;  4C7Z A;  3P42 A;  1DGJ A;  1EM7 A;  1YJI A;  1ZE3 D;  2XNA C;  2DBY A;  1FD6 A;  5EE9 A;  4A9A A;  3NVV A;  4DXF A;  2LUM A;  2K0P A;  3KQ4 A;  2BBC A;  2RPV A;  2V3P A;  1WRI A;  2LGI A;  3KWL A;  1D5M C;  5D3D A;  4JE3 B;  2MJ3 A;  3W9C B;  5HI1 A;  1FO4 A;  1SIJ A;  1HZ5 A;  2INP E;  1IBX B;  3ZJV A;  3LB8 C;  4J3O D;  5HG2 A;  1GOZ A;  1A70 A;  1YJJ A;  3NVW A;  4RF1 A;  4RH6 A;  2QIE B;  2LHD A;  4P16 A;  2WLB A;  1SEB D;  2W54 A;  4KGR A;  4HJG E;  2KAC A;  2BS2 B;  4XDC A;  3FIL A;  2MJE A;  1FFV A;  1C4A A;  1J7A A;  1JRO A;  2KN4 A;  2V0G A;  1IGD A;  2WXL A;  2WXO A;  1CJE A;  1Q10 A;  4C7Y A;  4NAM A;  3SFE B;  4AS1 A;  3WCQ A;  1FCC C;  3SFD B;  4KX6 B;  1K51 A;  1QIL A;  1ROE A;  1PGB A;  2BT6 A;  2DYM A;  2Q5W D;  3BVG A;  1TZO A;  4R3D A;  1F2R I;  1P7F A;  2WXK A;  1VLB A;  1UWX A;  2EEL A;  5LNK 1;  2W82 A;  1SE4 A;  3ZGZ A;  4GDL B;  1EU4 A;  1P7E A;  2PLP A;  1FXA A;  2J4X A;  1JWA D;  3TUO A;  1DYQ A;  2G9H D;  3IXS A;  5AUK A;  3R8B A;  1DOI A;  4B0E A;  3RFZ B;  1KRH A;  1SJH D;  4US8 A;  2BB6 A;  3C8Y A;  4RCO A;  1YN5 A;  2PVO D;  1RFK A;  1J7B A;  5EE0 A;  2GB1 A;  1N61 A;  3BK1 A;  4LTU A;  5TSS A;  3LYY A;  1K52 A;  4C80 A;  2N0S B;  2NTT A;  5FR3 A;  2WXI A;  1XCT L;  1AW7 A;  4MT5 A;  3Q8F A;  2RMM A;  1VR9 A;  3AEE B;  4XE0 A;  4YTP B;  3AEC B;  1FFU A;  1OQQ A;  2DYO A;  4RFB A;  4RF0 A;  2Z8L A;  1E6E B;  4TQ1 A;  4KGS A;  2V3N A;  4N59 A;  1ACC A;  4P6V F;  2JU6 X;  2WXH A;  1JWS D;  2BS3 B;  2K22 A;  1N62 A;  1JCK B;  2N9K A;  1QKZ A;  3AE5 B;  1ET6 A;  3MP9 A;  4NZL B;  3T3N A;  2DWQ A;  2L52 A;  3AE1 B;  1TY2 A;  3RPF C;  2JX5 A;  1LO5 D;  1KFY B;  1PFD A;  1CK1 A;  1HA5 A;  1FIQ A;  1PUT A;  2ZW0 A;  5E6J A;  1MI0 A;  2RDG A;  2PVG C;  1C4P A;  1TS5 A;  4WUR A;  2INN E;  2HDE A;  4FXC A;  2JZP A;  3Q69 A;  1C9F A;  1E7P B;  4REZ A;  4OZA A;  5HHD G;  2AQ3 B;  2LEK A;  4AQ7 A;  1NI3 A;  1GAQ B;  1TKE A;  4TQ0 A;  2ZW1 A;  4DQO C;  3B2F A;  4L2Y A;  2WU2 B;  3DWG C;  3N9Y C;  1SBB B;  4ZYS A;  4ZRP A;  2WXP A;  5EE3 A;  1MHH E;  2IJ0 A;  2KWD A;  3P4P B;  3AE4 B;  3AEF B;  4C56 C;  1I4P A;  1KTK A;  3GS2 A;  4WWM A;  1E10 A;  1DOY A;  3I57 A;  2ON8 A;  2KMM A;  4ARI A;  1PGX A;  1KH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...