1QKZA

Fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
58
structure length
58
Chain Sequence
b'VTTYKLVINGKTLKGETTTKAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G-PRIME
publication title Crystal Structure of an Fab Fragment in Complex with a Meningococcal Serosubtype Antigen and a Protein G Domain
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immune system
total genus 14
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1999-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qkzA00
2JSVX 4IOIE 5HI1A 2I38A 1IBXB 1C9FA 5BMIA 4KGSA 1PGBA 1Q10A 2JWUA 1MPEA 2EELA 1P7FA 2PTLA 2LGIA 1FCLA 2IGGA 1IGCA 2PLPA 2KACA 2LHEA 2JU6X 2KDMA 2KQ4X 1JMLA 2JXTA 4OZCA 4HJGE 1K51A 1P7EA 4HKZE 1F2RC 3FILA 5BMHA 2QMTA 5JXVA 1K50A 2I2YA 2J52A 2ZW0A 1XF5L 1YMHE 2N9LA 1EM7A 1MHXA 4D2KA 2JZPA 1UWXA 1KH0A 2QSDA 2K0PA 4KGTA 5HG2A 2LHDA 1K52A 2LUMA 1FCCC 2N7JA 1GB4A 4MACA 3V3XA 1HZ6A 1F2RI 1HEZE 1XCQL 2ON8A 5BMGA 3FILB 3UI3A 1GB1A 2KN4A 2N9KA 3GB1A 2J53A 2RMMA 4IKGA 4OZAA 5HFYA 2RPVA 2PW9A 2NMQA 4KGRA 2OEDA 2GI9A 2GB1A 1PGAA 1XCTL 2ZW1A 1IBXA 1QKZA 1ZXHA 1MI0A 2ONQA 1IGDA 4GLSC 5HHDG 2IGHA 1K53A 4OZBA 1MVKA 1MHHE 2KWDA 1YNTE 3MP9A 4WH4A 1PGXA 1FD6A 1D4BA 2IGDA 1HZ5A
chains in the Genus database with same CATH superfamily
4WURA 2PPHA 4AUQC 5JZEB 3ZYYX 4ANUA 4WJOA 4N58A 3RN9C 3PTFC 4FN2A 3AEBB 1L4ZB 1EF5A 4BBNC 2ZJDA 4WAFA 2DENB 2ZZPB 5CX3A 2AEHA 4P16A 3VTUA 3U8ZA 3ZNZB 4WWPA 1K51A 1F2RC 2O6VA 2BS4B 3FKYA 3ZDMC 3CMMB 3KH0A 4ZRQA 3Q8AA 1XF5L 1JRUA 4FJYA 4MEMA 2KHWB 3MC8A 2WYQA 3VDZA 1KH0A 2K25A 2XEWA 3DVGY 2SEBD 1V97A 3V3XA 2LEKA 4EFOA 2BBCA 3DPDA 4HPMB 1QF6A 1ACCA 1E6EB 4B9KA 2CHXA 3BVZA 2KC1A 2KFKA 3IT4B 2DNFA 1N63A 1UBQA 4OZAA 4HLEA 3NHEB 1FMAD 2V4LA 1VD2A 3JVZX 1WE6A 5DPSA 2XBBC 3IAS1 4CYEA 1WZ0A 4A55A 4A6QA 1Q1OA 4HJKA 2IGHA 5C1ZA 2OHFA 2RDGA 3TEXA 2W3SA 1EU3A 1SEBD 3DBLB 1TGZB 1VZ8A 1C76A 4PS7A 3EA6A 3IT6B 3QARA 2AL3A 2MX2A 4IG7B 5JHBA 4MM3A 3MHZA 2IGDA 2L83A 4EZLA 3DHHC 2BPSA 5H92C 4HKQA 4GOCA 1WR1A 5J17A 1WIAA 4JGHB 4YL8A 2LJ5A 1F77A 3HVDA 1TY2A 3A4RA 3ZVVA 1TS4A 4GSWA 3KWVA 4E74A 1JQ4A 4MGYE 2KWVB 1TKYA 2KFKB 4HROA 1XQQA 4IM0A 2GBJA 2JXTA 2CJOA 3IXSA 1ZP0B 3HM3A 4C56C 4KKJA 3QA8A 4W9JA 4YSXB 4XGAB 3OJ3A 2K5PA 2JRIB 2MBQA 1V1PA 2Y5PA 3QX1A 2KVZA 2KQ7A 3QAQA 1V8CA 3ZNHB 2RGFA 1I4QA 3N32A 2LGDA 2BF8B 4GXBA 5L95C 2Y5CA 2ZNVB 5IOIA 1B9RA 4MSMB 1SXTA 4EZJA 2BWFA 1DOYA 2D07B 4G11A 1YN4A 4YTMB 1E0ZA 2Z0EB 2WXGA 1YQ3B 3WANA 3MC0B 1T5XD 2K6DB 2NTSA 4ZRPA 1DGJA 1XCTL 3ZGZA 3BZDB 2ACZB 4B0MA 3PZ8A 2KMMA 2TSSA 4KZ0A 3Q8BA 4NAWA 1WE7A 4M00A 5HHDG 3PS6A 3AU4A 2V9HA 2KJHB 5EE3A 4GDLA 2L05A 2CR5A 2V3NA 1V1PB 1PGXA 4LLGM 2LWPA 2L0TA 1D4BA 2JSVX 1OFFA 3ZLZA 5IA7A 4LDTB 1TZOA 3SDLC 1TBEA 3IVFA 2JT4B 3LYYA 1OTRB 3ML8A 4IC7B 5G55A 3MC9A 1MPEA 1P7FA 4NY0A 2K9XA 2CS4A 2KTFA 3DHGC 4A3PA 4W9LA 4YTPB 4II3B 3HM6X 2N1WA 4LJPB 4TQ0A 3PVLA 2BYVE 1WZ3A 2KDEB 1P7EA 1V80A 5BMHA 1V86A 4W9FA 4HK2A 1VDVA 3SU8X 2LGSA 4F8CB 2ZVOA 3E9SA 4WWNA 3V05A 3L10B 2LVOA 2AL6A 2C9WB 1V49A 2N7EA 1DOXA 3ENEA 2WU2B 2WXKA 3H8HA 5FR6A 5AZHA 1E90A 3SEBA 3HIZA 3URYA 4KDIC 3DBRI 2KDFB 2AQ3B 5MPOA 2JQRB 2KDIA 2LJIA 2N9KA 1T0SC 3A1QA 1K8RB 5BYSA 1UD7A 3O13A 1LXDA 1YN3A 2BT6A 1NI3A 5D3DA 4JQWC 3PHXB 2KC2A 3RNAC 3M63B 2MBHA 5G5GA 1AW7A 2MA9B 2N4FA 1D5XC 1QKZA 4GGQA 3PZDA 3RCZA 1ZXHA 2D3GA 4W9GA 1MI0A 4PS3A 4N9F4 1D5ZC 1MJDA 1WM3A 1E8WA 2DZJA 2KLGA 4IWPA 4JPSA 1JWSD 1FO4A 1LFDA 2LXCA 2O2VA 3CWIA 1FPYA 1GNUA 3JW0X 1WYGA 3TBLD 1GC6A 2FIDA 4I6NB 2L1AA 2VZKD 2PJHA 1KLUD 4JL9A 1VJKA 1L6UA 3T8MA 2JZZA 1C9FA 1I4XA 1V9JA 2KDBA 2WNMA 3LXFA 4JWUC 1Q5WB 4XYCA 2BYEA 5IKCM 3SFEB 2PLPA 1WX9A 4RMAA 2QJLA 2VH1A 1Z5SB 4MELA 1E9MA 3R66C 4DHZE 5JXVA 3DBLI 4JIOU 2NPTA 3Q69A 2DYMA 1YIWA 1PYWD 4RH6A 5FR3A 2ZPYA 1HTQA 2M0AA 4L23A 2HTME 1KTKA 2QEJC 4L2YA 4E71A 2MJ3A 2O2VB 1VZ6A 1C1YB 5C3JB 4FULA 3AN1A 3ZNID 1TIFA 5H8YE 4XX5A 3LB8C 4WQMA 1WXVA 2WDQB 1ZDXA 2JZ3B 2GB1A 3PHWB 1Z2MA 3NJTA 2HJ1A 1WXQA 3PLVA 5J2RA 2X8XX 3NVZA 2KTRB 1UBIA 1WMHA 2K8BA 3WCQA 3ZJUA 4G0NB 4ZOHC 3NS8A 3VUYA 2NPTB 2LRWA 3DVNU 4HXDA 5LXIB 2I1KA 3APCA 4DHJD 3J9CA 4EEWA 4MSQB 2Z0DB 3AEAB 2V4IB 4ICUA 1KJTA 3VAWA 2MBOA 5IO9A 1UNSA 1FNUA 4TSSA 2CHWA 3RT3B 2K6QA 3DHIC 3B1LX 4K81A 3BINA 4WAAA 3APFA 2JU6X 4BOZB 1V81A 3RI7C 4FJVB 1BMLC 4HCPB 3GE8C 2FCSA 3U30A 2WXJA 2BWES 3UQBA 3Q3FA 2ZW0A 1TKGA 1T0RC 3RD2A 3PZ7A 1RWSA 2ZNVC 4ACFA 3ECIA 2XNAC 4L1BA 1ET9A 2JXXA 2YEPB 4BVUC 1K52A 3N9YC 2JX5A 4MACA 2L0FA 4EZKA 2KQSA 1E8XA 4NQKE 1E7UA 1R4MB 4US9A 3KUZA 2W9NA 3PRMB 2M19A 1JCKB 4K3CA 2GRIA 2RMMA 4HPLB 2VRRB 1RAXA 1RYJA 1V5OA 2FCMA 3DBHI 2OEDA 2BVCA 2DZIA 3NY5A 3U4EG 2K8CA 1ZKHA 2K8HA 1I4HA 2PKOA 4US8A 1QZEA 2BTEA 4M02A 4LNKA 3CSFA 2ZEQA 2LRUA 1RFAA 4OZBA 3NZ3A 1C77A 4G3XB 3P1MA 3CF6E 2FCNA 2C60A 3W2DA 3AEGB 5EDSA 4S0RA 2KX0A 1S3SG 3AM9A 2KFJA 3BVGA 1F1HA 2JWUA 3UINB 1WI0A 1YQ4B 4WQOB 2MH7A 4IWQA 5LNK1 2M17A 2RPQA 1J8CA 2KDMA 3N1ZC 4F7ZA 3AECB 4N6EB 2XN9C 1FXTB 5FKAC 1YX5B 4MGZE 4FADA 3NRZA 1K50A 4YWGG 3DQVA 1UH6A 2JPHA 3ZJTA 5D3IB 3K9PB 4OVUA 3L4PA 1TS2A 2N9LA 2OJWA 3DDCB 3DBRB 3EHVA 3WAPA 4TMAB 5C23A 3C0RB 2IO2B 3PSEB 3AE9B 2PVOD 2KNBA 2JF5A 3L13A 3ZIMA 4QAYA 1FCCC 2BQQA 4MGIE 2MEKA 3KWLA 2LUEA 3ZKJC 2D3BA 2QHOA 3AB5A 4LNNA 3I63C 1XXGA 4AS1A 1FIQA 2INNE 3RNFC 2PE6B 4M0WA 4OVVA 2LFIA 3QIJA 5CHVC 3AI5A 5T8IA 3AE2B 1WGDA 2QIEB 1SE9A 3M95A 2WDTB 3R2IA 4DXAB 1WM2A 2B3AA 4OW0A 1ZDVA 2J4XA 3NS1A 4IM2A 1NVID 1FNVA 3NVWA 4TUUA 1WXMA 3APDA 1LM8B 3R7QA 2JVCA 3Q3JA 3TJPA 2LD9A 4KVGB 3Q3MC 4NPNA 3OJ4B 1C4CA 3UF8A 1XEEA 1PUTA 3AH7A 2LI5A 4JLCA 1OEYA 2NS5A 4YXDB 3U52E 1GPXA 3AE5B 3A4SC 2D11A 3OG5A 2DAJA 2PTLA 1FFUA 3ONSA 1FCLA 3EECA 2KACA 1SF0A 3V62A 3H7PB 3IBEA 4HJGE 3IFWB 5IAAC 2FIFA 1YJJA 4M0WB 1TKEA 3EGRA 2I2YA 1XLOA 2MLBA 2HJ8A 4AJYB 2KAJA 4DHJB 3ZQ4A 1R7SA 2KXJA 3AE8B 3N30A 1YN5A 2N7DA 4Q2JA 2KMCA 3TEZA 5C2TB 1ET6A 2IBIB 1IP9A 4JWSC 3RNGC 4BFRA 2LUMA 2KANA 3AEEB 2VH2A 1JALA 1UELA 3Q3OC 1XCQL 1RFKA 4F1SA 1QT9A 1YJIA 4BKGA 5JH5C 2J7QB 2WXIA 4RFBA 4XE0A 2MJEA 4TKNA 3O65B 4BKSA 3P4RB 1I4RA 1M4VA 4RGOS 2IPKD 3DWMA 4LTUA 5E6PA 4HCNB 2WS3B 4W9EA 3B2FA 5D94A 1WYWB 1IPGA 2DYOA 3C8YA 5IP4D 3TMPB 3HHMA 3M3JA 4W9DA 2PMVA 4BAXA 3L54A 1BXTA 5L83A 2GMIC 1E7PB 3AEFB 2J0KA 2K1FA 2KWDA 3RZFA 1YNTE 1JRPA 2BGFA 2LVPA 4S17A 3SD5A 4MJSB 1R4MI 1UGMA 3S2AA 4PT5A 2W55A 5HI1A 4WWOA 1L2NA 3HUIA 1QOFA 2I38A 3W1SC 1EWYC 1F52A 2CHZA 2X38A 4KGSA 3AEDB 2PVGC 1ZXIA 2G4SA 2WX0A 2WXQA 2IGGA 1C78A 1N5XA 3AE4B 2EKIA 5GMVA 1CMXB 2B76B 3B08A 3AE3B 4HKZE 2AQ1B 4WJNA 1RM6C 2HDEA 3ZXRA 2IY0B 2CU1A 2MHJA 1KM7A 1YMHE 3IG3A 1EM7A 1Y8RC 4M8MA 2KT7A 2INPE 4CQNA 4W9IA 2QSDA 1V6EA 4WJQA 1X1MA 2YVCA 2K0PA 2M0XA 4PK1A 3TL5A 1ZE3D 1HZ6A 4ASWC 2DBYA 3DBHB 2WDVB 4LCDE 4IM3A 4EUTA 4K7SA 1HTOA 4TV3A 2OJRA 2G1EA 1WGKA 2N9PC 4KGRA 1UWMA 2FE8A 2D3CA 2D10A 4ZRIA 2L00B 3P4SB 1IGDA 3P42A 4PYUA 3ZDTA 4EOYA 4RM9A 2C7MB 2KK8A 1MHHE 4BOSC 2ZPNA 4ARIA 3WA0A 3MP9A 3AULA 4HWIB 4XDCA 1N6ZA 1HXYD 1L5PA 3MJWA 1SBBB 3VR8B 1SIFA 4I6PA 2KYWA 3MJ5A 1MG4A 1JWBD 5LXHA 1F9JA 3P2BA 4UDUC 1KRHA 3UIPB 1Q10A 2KMAA 1JWAD 4IW0A 4FXCA 2IO0B 1IGCA 4I6LB 1NYQA 2WHIA 2GLSA 1ZOYB 3N1YC 1WGRA 4NAMA 1WY8A 2WU5B 3V6CB 2KKCA 2WP9B 3U7DA 2EKEC 2MBBB 1LGRA 4NJCA 4DK5A 2BS2B 4YTNB 4H2AA 4FLHA 3DVNV 3PRPB 1FNWA 2N1VA 3GZNI 3QCAA 1NEKB 3R3MA 2LZ6A 1NBFC 1CK1A 2KTRA 3VVWB 1P3QU 3ZO5B 2WXPA 1C4PA 4GB9A 4CO7A 4ZHOA 1L0YB 5BMGA 2EMTA 4NJ7A 3GOEA 1IYFA 4P1CC 3VRAB 3NUHB 1NDDA 3BYYB 1VZ7A 4B6WA 1SIJA 2RPVA 1D6EC 1I4GA 2RSUA 4PYZA 4FBJB 3H7SA 3ETRA 4KIKB 1N62A 2FUHB 2AX5A 3W9CB 4DDGD 2AQ2B 3MFGA 3MHSD 4MGKE 4GMVA 3EFCA 3CSTA 2JYTA 3BYTB 1ROEA 2MRPA 4RGTA 1FXAA 2L8JA 3T3OA 3I9V1 1HZ5A 1J0GA 4ICVA 3RYTA 3VTVA 4P7IA 1YX6B 2L52A 2KJ6A 2M56B 4XC2A 4LK0M 1IBXB 3ALBA 1L0VB 4A90A 4K7UA 4P1BC 5I4DA 4A9AA 2LHEA 1JWUD 1VR9A 5AUIA 5D6JB 1GUAB 4E3CA 4M01A 1L7YA 3E56A 2O6VD 2KD0A 3LDZE 1GAQB 2Y3AA 1F0ZA 1NYRA 2KZRA 3TUOA 3HRDD 1SJHD 1LQBA 1A5RA 2WXLA 3PRZA 5HKHA 3WIMA 4M8NA 1BT0A 4AWJA 3B0AA 3JYUA 4ANVA 2KWCA 4K3BA 2IZVB 4J3OD 1T0YA 3VRBB 5EE9A 3ZUNA 3AU5A 4KSKC 5DPTA 3KLSX 2DX5B 3L17A 4AP4C 3MTNB 2FAZA 1GB1A 3Q6BA 3BK1A 5DCNA 1TT5B 3OLMD 4K7WA 1NENB 1KF6B 2IJ0A 2PW9A 2NMQA 1YJ1A 2WX1A 1YOVB 3KW5B 1KOTA 1SJED 2KOXA 2NBVB 4N59A 4GLSC 4IDIA 1FRRA 1FM0D 3I5JC 3BVMA 2FCQA 1E7VA 2BB6A 2L3ZA 2IYDB 1HQRD 5DPWA 3DVGX 2YEPF 2MWSB 2RDHA 4IOIE 2MCNB 3JSVB 1A70A 3UQAA 5IN7A 3QJZA 2M4NA 2NBWB 1JROA 1PGBA 2MBEA 3R2TA 4KSLC 1Q0WB 4K1RB 1GOZA 3QC8B 1FRDA 3AE7B 2D3AA 2R2OA 3N1XC 4RGMA 1T6BX 1N60A 4KKIA 1KFYB 5KHOA 2ZCBA 4A8XC 1C79A 4LJOB 1HE8A 2L32A 3PGEA 3RPFC 1AWDA 3Q3NC 2W82A 2ASQA 2MSED 2DYBA 2DLBA 3NOBA 4D2KA 2JZPA 1UWXA 3L16A 4RCOA 1P0RA 3AV8A 4DBGA 1SSNA 2D2QA 1E5WA 3ZJVA 2AYOB 5D7GA 3VXWA 1F2RI 1HEZE 3W5UB 4HDQA 3PO0A 1E10A 1STEA 3I57A 3FC4A 2GOWA 3FILB 4DXGA 1EF1A 2WDRB 2KN4A 1WWTA 2VZKB 3K9OB 5DPRA 1EU4A 2PEAA 2GBKA 2MJDA 3BY4B 3QHTA 4DDID 2BS3B 4ZRKA 4R3DA 1T0QC 1AARA 3AXCA 3ML9A 2KWUB 4GDKB 4KX6B 2JRHA 2V1YA 1FEHA 2E3TA 2UWQA 2GBRA 3T3NA 1GG3A 3Q8FA 3GP7A 4ZYNA 3PPAA 3QWZB 1R4NI 3H7PA 5GXGB 3L0WB 3W1YA 1ZPSA 2LASA 3VR9B 4WJPA 1FD6A 2N0SB 2INDC 2QCZA 3P4PB 4USAA 4DXFA 4B0EA 2K39A 3V60A 4DQOC 1WJNA 1E8ZA 1IUEA 4MT5A 1UF0A 3DBSA 3QQ8B 3ZXVA 2KLCA 4XZ4A 2LGIA 4IWOA 4C80A 2D5GA 3GS2A 4GU2A 3U7ZA 2KQ4X 1JMLA 2KX3A 2SAKA 1GC7A 2QMTA 3V61A 2J52A 3GZNB 3B2GA 3A9JA 2N9EB 3BWUD 3PREA 2NTTA 4ZRJA 2YLMA 4WWMA 1U4AA 2NR2A 1PFDA 5HG2A 2LHDA 4DHZB 2N7JA 1FXIA 2KVRA 3Q2AC 4GN1A 4XDDA 4NNJB 4NJ6A 1VCBA 3GE3C 3ZTDA 1D3ZA 4C4VA 3KYCD 2O6VB 3WAMA 1HA5A 2CKHB 2H88B 1PQSA 3UIOB 2DWQA 2K3UA 3IAM1 4MJSA 3I3TB 1BUIC 1T3QA 2WXRA 3R8BA 3HK0A 1PGAA 2WLBA 3QK0A 4FA6A 1UZXB 2HE7A 3RNCC 1I4PA 2L76A 2K22A 1LO5D 3AE6B 2MW5A 5EE0A 3ZTCA 3A9JB 1V2YA 4II2B 2Q5WD 1GJZA 3BIID 1XLNA 2IY1B 4RM8A 3TCAA 1XO3A 4OHJA 2W3RA 1G6JA 4RF1A 3N20C 2RD0A 3SHQA 2OOBB 4DWFA 4KDLB 2WXMA 1WSPA 2V0GA 2UU7A 3EC8A 4C4VB 2EELA 3B9JA 3LJ3A 2G45B 3P63A 1QQRA 4IUMB 4C7YA 1DOIA 1QOGA 4OZCA 5CTRC 5CHFA 2M1MA 4PS8A 1EWCA 3Q14C 5AZGA 4MM3B 2GBNA 2LXAA 4W9HA 3W5VB 1WF9A 2R2QA 4MH0E 5G5HA 2WXNA 2GBMA 4NZLB 1TYGB 1MFWA 1OQRA 1OQQA 2LMCA 1TJEA 4ITKA 5E6OA 1ENFA 3ABVB 2PE9A 1TS3A 2LGXA 4KGTA 1KLVA 2NVUI 1XD3B 4LNIA 4O1NA 3PT2B 2ON8A 1V5TA 1ISNA 4J6IA 4G50A 4RNAA 4A3OA 3RNEC 2J53A 3R7RA 2HD5B 1YQBA 2KO3A 2BKFA 4HRSA 1M94A 1WX8A 4HVBA 3X23A 2BB5A 1L0XB 1EO6A 1CQVA 4KZCA 4AOFA 4RF0A 4JE3B 1NI2A 3AMZA 3DOWA 3EUB2 2CU3A 1K53A 2R61A 4KV2A 4EKUA 1J19A 3VHTC 3TEYA 5E6JA 1WRDB 3U2SC 5EE1A 3T9LA 2ICIA 4W9KA 3VUXA 2L7RA 5TR5A 1SE2A 5BO4B 3RUIB 5D2MB 4FJZA 1TS5A 2NBUA 3OWEB 1WGHA 2G9HD 2INCC 3NG0A 2NCNA 5BMIA 1UUPA 4NAWB 1RLFA 3OAWA 2AWTA 1WGGA 2J42A 4W9CA 3KYDD 3P4QB 1J7BA 2V3SA 4GDLB 2IO3B 4OVZA 1P1AA 3KUCB 3A9KA 2Z59B 2G4DB 3WALA 2J0JA 2M8SA 3RNBC 5AZFA 1ZGUB 1VLBA 2WXOA 1ZW7A 1SE3A 4KIKA 4BBNF 2RR9A 2DZKA 1WFYA 2I1JA 4ARCA 2XK5A 2RDBC 3GB1A 2G3QB 3VQIA 1I42A 4FHJA 5HFYA 1JWMD 1WXSA 1QOAA 5TSSA 2GI9A 1P98A 1QOBA 1TZ1A 3FAHA 1E8YA 3VFKA 2IDYA 1R4NB 1SGHA 1IBXA 3PLUA 3NVVA 5BYRA 4AQ7A 4ZYSA 2FUG1 2ONQA 4WIPA 4B95A 1WR6E 1MVKA 4FHKA 1J7AA 1WH3A 3A9KB 1J7CA 1WXAA 4A20A 3A1QB 1N5WA 2FNJB 3NZSA 4WH4A 3SR6A 3C19A 3UGBB 4URKA 2CJNA 4ANWA 3RFZB 4HPPA 1H8CA 1H4RA 4GIVA 3ZRCA 4ANXA 1L4DB 1CJEA 1TY0A 4HEA1 1RRBA 2JWZA 1OGWA 3ZNGC 3EFUA 1QILA 2DHZA 2XK5B 4P6VF 4CHKA 5LLIA 2FBWB 1C3TA 1WJ6A 3X0WA 2J0MA 2QDFA 3WAOA 2C7HA 4XWWA 3TSSA 3W1SA 1KLGD 1MHXA 2EMSA 3VUWA 2DZMA 4C7ZA 1FFVA 4LNFA 2WQYB 3Q8CA 4YSZB 3V6EB 2QC8A 2REXA 4HDOA 1XT9B 4ZHPA 2BYTA 4BKTA 3UI3A 2Y5BB 1D5MC 3Q8EA 2LGYA 4XWTA 3ZRFA 1OEYJ 4LNOA 2C7NB 1DYQA 5G2NA 3D32A 4IKGA 3AE1B 1SE4A 4X57B 3CIRB 2W54A 3JSVA 2LVQA 1ZUD2 3PV1A 1WX7A 4YSYB 5J18A 4C00A 2ZVNA 2MP2A 4TQ1A 1PDXA 2A4ZA 2DAFA 1UGJA 5CHWA 1AYFA 2MQJA 1TTNA 3DCGA 3KUDB 5FK9C 2JYEA 1WGYA 2JUOA 3BK2A 3TEWA 3L08A 1V1OA 3H1UA 4AJWA 5BYQA 2WXFA 3RULA 2N9XA 2JY6A 1XLQA 1ESFA 4REZA 3VTWA 3HVZA 2KN5A 3TIXA 1WMHB 4MH8A 5E6NA 3KVFB 1XLPA 3IHPC 1B1ZA 1I7HA 3M62B 5JHAA 2BYFA 1AN8A 3FILA 2IO1B 4YT0B 1WRIA 3N3KB 2V3PA 3RMKC 2Z8LA 3DWGC 3RZWC 2MP2B 2PIAA 2UYZB 4MDKE 1WJUA 3KQ4A 4GDKA 2KJRA 1MG8A 2WWZA 1L6VA 1GB4A 5KHQA 1CZPA 2WXHA 1SB3C 5AUKA 2QILA 1JW9D 1YD8U 2A5UA 4BKSD 3NVYA 3VH4B 1VRAB 3H6NA 1N61A 3NZUA 1EUVB 3VH3B 4BZAA 5AEKB 4LDTD 3H9DA 1P9DU 3A33B 1QLBB 4ZDVA 2ZW1A 4NQLB 2HTHA 1Y56A 1S1QB 2BKRB 2E6XA 2H89B 1WJ4A 4RGNA 2BW2A 2WGSA 2ZCCA 3ZW3A 1C4AA 1OQYA 4JX1C 3SFDB 1I35A 4EE2A 2C5LC
chains in the Genus database with same CATH topology
1L5PA 2W3RA 4WURA 3J9CA 1SBBB 3VR8B 4RF1A 3AEAB 2V4IB 3ZYYX 3MJ5A 1JWBD 1UNSA 4N58A 1FNUA 4TSSA 4UDUC 1KRHA 2WXMA 1WSPA 3AEBB 1Q10A 2V0GA 1L4ZB 2EELA 3B9JA 1JWAD 4WAFA 4FXCA 1IGCA 2JU6X 3P63A 1QQRA 4P16A 4C7YA 1BMLC 1NYQA 1DOIA 1ZOYB 1QOGA 4OZCA 1K51A 1F2RC 1EWCA 4NAMA 2BS4B 2WXJA 4MM3B 2ZW0A 1TKGA 2WU5B 3W5VB 2WP9B 3PZ7A 4ZRQA 1RWSA 3Q8AA 5G5HA 2WXNA 1XF5L 2XNAC 4L1BA 4NJCA 4NZLB 1TYGB 1OQRA 1ET9A 2BS2B 4YTNB 1OQQA 2LMCA 4H2AA 1TJEA 4ITKA 1KH0A 1ENFA 2YEPB 1FNWA 3ABVB 4KGTA 1TS3A 1K52A 3N9YC 1NEKB 2JX5A 1CK1A 2SEBD 4MACA 1V97A 3V3XA 2LEKA 4O1NA 2WXPA 1C4PA 2BBCA 4ZHOA 1L0YB 2ON8A 5BMGA 1ACCA 1E6EB 1QF6A 3BVZA 4US9A 4RNAA 3VRAB 2M19A 3NUHB 2J53A 1JCKB 2GRIA 2RMMA 3BYYB 3IT4B 1RYJA 1N63A 1VZ7A 4OZAA 1SIJA 2RPVA 2OEDA 1D6EC 1I4GA 1FMAD 4HRSA 2BB5A 3U4EG 1L0XB 1CQVA 3IAS1 1I4HA 2PKOA 3ETRA 4RF0A 4US8A 3ZGZA 4JE3B 4A55A 2BTEA 4A6QA 3AMZA 1N62A 3EUB2 2CU3A 2IGHA 1K53A 2R61A 2AX5A 2OHFA 2RDGA 3TEXA 2AQ2B 2W3SA 3W9CB 3MFGA 1EU3A 3NZ3A 1SEBD 4OZBA 1C77A 3TEYA 1VZ8A 1C76A 3P1MA 2JYTA 3EA6A 3IT6B 5E6JA 3U2SC 3BYTB 1ROEA 5EE1A 2ICIA 3W2DA 4RGTA 1FXAA 3AEGB 3T3OA 3MHZA 2IGDA 2L83A 1HZ5A 3I9V1 1SE2A 5H92C 4HKQA 1TS5A 3AM9A 3OWEB 2G9HD 2L52A 2M56B 4LK0M 1IBXB 3BVGA 5BMIA 1F77A 3HVDA 1UUPA 1TY2A 4NAWB 1L0VB 1TS4A 2JWUA 4A90A 3KWVA 1JQ4A 5I4DA 1YQ4B 4A9AA 2MH7A 5LNK1 1TKYA 2LHEA 2J42A 1JWUD 1VR9A 4HROA 2KDMA 3P4QB 1J7BA 5AUIA 4GDLB 3AECB 2JXTA 4N6EB 2XN9C 5FKAC 2CJOA 3E56A 3IXSA 1ZP0B 4C56C 4OVZA 3NRZA 1GAQB 1K50A 4KKJA 4YWGG 4YSXB 2Y3AA 1F0ZA 2K5PA 3ZJTA 5D3IB 1NYRA 3TUOA 1V1PA 2Y5PA 3L4PA 3HRDD 1SJHD 1TS2A 2WXLA 2N9LA 1V8CA 4TMAB 1VLBA 2WXOA 1I4QA 3AE9B 2PVOD 2Y5CA 1SE3A 1FCCC 4J3OD 1B9RA 3VRBB 5EE9A 1SXTA 2MEKA 3KLSX 1DOYA 4ARCA 1GB1A 3KWLA 1YN4A 3AB5A 3BK1A 4YTMB 1E0ZA 2WXGA 3GB1A 1YQ3B 1XXGA 4AS1A 1FIQA 1NENB 2INNE 1KF6B 3VQIA 3MC0B 1T5XD 2IJ0A 5HFYA 4M0WA 2NTSA 2PW9A 2NMQA 1JWMD 1QOAA 2LFIA 4ZRPA 2GI9A 5TSSA 1IBXA 1DGJA 1QOBA 3FAHA 1XCTL 5T8IA 2IDYA 2ACZB 3AE2B 2QIEB 1SJED 3BZDB 3PZ8A 4B0MA 2KMMA 3NVVA 5BYRA 2TSSA 4AQ7A 4ZYSA 3R2IA 3Q8BA 2FUG1 2ONQA 4N59A 4OW0A 4WIPA 1ZDVA 2J4XA 4GLSC 4IDIA 1FRRA 3NS1A 1FM0D 5HHDG 1NVID 1FNVA 3NVWA 1MVKA 1J7AA 3BVMA 1J7CA 2BB6A 5EE3A 2V3NA 1V1PB 1N5WA 4WH4A 1PGXA 1HQRD 4EE2A 4LLGM 3SR6A 2CJNA 2YEPF 1C4CA 1D4BA 3RFZB 2RDHA 1XEEA 2JSVX 1OFFA 4IOIE 1PUTA 3AH7A 1A70A 1TZOA 3LYYA 1L4DB 1CJEA 1TY0A 1JROA 1PGBA 3R2TA 4HEA1 3U52E 4YXDB 1GPXA 3AE5B 1MPEA 2PTLA 1P7FA 1FFUA 1QILA 2K9XA 1FCLA 1GOZA 4P6VF 2KACA 1FRDA 4YTPB 1SF0A 3AE7B 4RGMA 4TQ0A 1T6BX 1N60A 4KKIA 1KFYB 2FBWB 4HJGE 1P7EA 1YJJA 5BMHA 1TKEA 4A8XC 3EGRA 1C79A 2I2YA 1XLOA 1VDVA 4OHJA 2L32A 2KAJA 3RPFC 4XWWA 3E9SA 1AWDA 3ZQ4A 3TSSA 1R7SA 3W1SA 3V05A 2W82A 3AE8B 2DLBA 1YN5A 1KLGD 1MHXA 4D2KA 4Q2JA 2JZPA 1UWXA 1DOXA 4C7ZA 1FFVA 2WU2B 2WXKA 5C2TB 3H8HA 3TEZA 1ET6A 4RCOA 3AV8A 1SSNA 4JWSC 3SEBA 2WQYB 3Q8CA 4YSZB 2LUMA 3ZJVA 5D7GA 3AEEB 1JALA 3URYA 1F2RI 1HEZE 3W5UB 3PO0A 1E10A 1XCQL 1STEA 1RFKA 4ZHPA 2BYTA 1QT9A 3FC4A 2AQ3B 1YJIA 3FILB 3I57A 2JQRB 3UI3A 1D5MC 3Q8EA 2LJIA 2WDRB 2WXIA 2KN4A 2N9KA 4RFBA 4DXGA 1WWTA 2VZKB 4XE0A 4XWTA 2MJEA 1EU4A 5BYSA 3O13A 1YN3A 2MJDA 2BT6A 1NI3A 5D3DA 1DYQA 3P4RB 2BS3B 4IKGA 1I4RA 1M4VA 1SE4A 2IPKD 3AE1B 4RGOS 3DWMA 4LTUA 3CIRB 4R3DA 2W54A 5G5GA 1ZUD2 1AW7A 4YSYB 2WS3B 3B2FA 1D5XC 1QKZA 4GDKB 1ZXHA 4KX6B 4TQ1A 2DYOA 1FEHA 1MI0A 3C8YA 1PDXA 1UGJA 1AYFA 2E3TA 2PMVA 1D5ZC 3T3NA 1BXTA 3Q8FA 1E7PB 5FK9C 2JYEA 3AEFB 3GP7A 3BK2A 2KWDA 3TEWA 1YNTE 1JRPA 4JPSA 1JWSD 5GXGB 1FO4A 5MPOA 1V1OA 3CWIA 5BYQA 1ZPSA 1WYGA 3VR9B 2WXFA 2N0SB 1FD6A 4PT5A 1XLQA 2W55A 1ESFA 2L1AA 2VZKD 3P4PB 5HI1A 1KLUD 4USAA 1VJKA 1L6UA 4REZA 4DXFA 3HUIA 1QOFA 4B0EA 4DQOC 2I38A 3HVZA 1IUEA 1EWYC 1I4XA 2X38A 4MT5A 4KGSA 1C9FA 2WNMA 3LXFA 4JWUC 3AEDB 2PVGC 1ZXIA 4MH8A 2LGIA 1XLPA 3SFEB 2WXQA 4C80A 2D5GA 2IGGA 1C78A 2PLPA 3GS2A 3U7ZA 1N5XA 2QJLA 2KQ4X 1JMLA 3AE4B 2EKIA 1B1ZA 1I7HA 2B76B 2SAKA 3AE3B 4HKZE 1AN8A 3FILA 1E9MA 2QMTA 4YT0B 1WRIA 2AQ1B 5JXVA 2V3PA 2J52A 2Z8LA 3B2GA 3DWGC 1RM6C 2HDEA 2DYMA 3Q69A 1PYWD 2PIAA 1YMHE 4RH6A 3BWUD 5FR3A 1EM7A 2NTTA 4CQNA 2INPE 4WWMA 2QSDA 2M0AA 3KQ4A 1PFDA 4L23A 2HTME 1KTKA 2K0PA 5HG2A 2LHDA 2QEJC 4L2YA 1L6VA 2N7JA 1GB4A 1FXIA 1ZE3D 1CZPA 1HZ6A 2MJ3A 4XDDA 1VZ6A 2WXHA 1SB3C 2DBYA 2WDVB 5C3JB 5AUKA 2QILA 1JW9D 3AN1A 1HA5A 2H88B 5H8YE 3LB8C 2G1EA 2DWQA 3NVYA 4WQMA 1VRAB 1WGKA 1N61A 2K3UA 3IAM1 2WDQB 1BUIC 4KGRA 1T3QA 1ZDXA 1UWMA 2WXRA 3R8BA 2FE8A 2GB1A 1PGAA 1QLBB 2WLBA 2ZW1A 1WXQA 1I4PA 3P4SB 2K22A 1LO5D 3NVZA 1IGDA 1Y56A 3P42A 3AE6B 2E6XA 2H89B 3WCQA 5EE0A 4RGNA 2BW2A 3ZJUA 1MHHE 4ZOHC 4ARIA 3MP9A 1C4AA 2Q5WD 4JX1C 3SFDB 4XDCA 3BIID 1XLNA 1XO3A 1HXYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSV X;  4IOI E;  5HI1 A;  2I38 A;  1IBX B;  1C9F A;  5BMI A;  4KGS A;  1PGB A;  1Q10 A;  2JWU A;  1MPE A;  2EEL A;  1P7F A;  2PTL A;  2LGI A;  1FCL A;  2IGG A;  1IGC A;  2PLP A;  2KAC A;  2LHE A;  2JU6 X;  2KDM A;  2KQ4 X;  1JML A;  2JXT A;  4OZC A;  4HJG E;  1K51 A;  1P7E A;  4HKZ E;  1F2R C;  3FIL A;  5BMH A;  2QMT A;  5JXV A;  1K50 A;  2I2Y A;  2J52 A;  2ZW0 A;  1XF5 L;  1YMH E;  2N9L A;  1EM7 A;  1MHX A;  4D2K A;  2JZP A;  1UWX A;  1KH0 A;  2QSD A;  2K0P A;  4KGT A;  5HG2 A;  2LHD A;  1K52 A;  2LUM A;  1FCC C;  2N7J A;  1GB4 A;  4MAC A;  3V3X A;  1HZ6 A;  1F2R I;  1HEZ E;  1XCQ L;  2ON8 A;  5BMG A;  3FIL B;  3UI3 A;  1GB1 A;  2KN4 A;  2N9K A;  3GB1 A;  2J53 A;  2RMM A;  4IKG A;  4OZA A;  5HFY A;  2RPV A;  2PW9 A;  2NMQ A;  4KGR A;  2OED A;  2GI9 A;  2GB1 A;  1PGA A;  1XCT L;  2ZW1 A;  1IBX A;  1QKZ A;  1ZXH A;  1MI0 A;  2ONQ A;  1IGD A;  4GLS C;  5HHD G;  2IGH A;  1K53 A;  4OZB A;  1MVK A;  1MHH E;  2KWD A;  1YNT E;  3MP9 A;  4WH4 A;  1PGX A;  1FD6 A;  1D4B A;  2IGD A;  1HZ5 A; 
#chains in the Genus database with same CATH topology
 4WUR A;  2PPH A;  4AUQ C;  5JZE B;  3ZYY X;  4ANU A;  4WJO A;  4N58 A;  3RN9 C;  3PTF C;  4FN2 A;  3AEB B;  1L4Z B;  1EF5 A;  4BBN C;  2ZJD A;  4WAF A;  2DEN B;  2ZZP B;  5CX3 A;  2AEH A;  4P16 A;  3VTU A;  3U8Z A;  3ZNZ B;  4WWP A;  1K51 A;  1F2R C;  2O6V A;  2BS4 B;  3FKY A;  3ZDM C;  3CMM B;  3KH0 A;  4ZRQ A;  3Q8A A;  1XF5 L;  1JRU A;  4FJY A;  4MEM A;  2KHW B;  3MC8 A;  2WYQ A;  3VDZ A;  1KH0 A;  2K25 A;  2XEW A;  3DVG Y;  2SEB D;  1V97 A;  3V3X A;  2LEK A;  4EFO A;  2BBC A;  3DPD A;  4HPM B;  1QF6 A;  1ACC A;  1E6E B;  4B9K A;  2CHX A;  3BVZ A;  2KC1 A;  2KFK A;  3IT4 B;  2DNF A;  1N63 A;  1UBQ A;  4OZA A;  4HLE A;  3NHE B;  1FMA D;  2V4L A;  1VD2 A;  3JVZ X;  1WE6 A;  5DPS A;  2XBB C;  3IAS 1;  4CYE A;  1WZ0 A;  4A55 A;  4A6Q A;  1Q1O A;  4HJK A;  2IGH A;  5C1Z A;  2OHF A;  2RDG A;  3TEX A;  2W3S A;  1EU3 A;  1SEB D;  3DBL B;  1TGZ B;  1VZ8 A;  1C76 A;  4PS7 A;  3EA6 A;  3IT6 B;  3QAR A;  2AL3 A;  2MX2 A;  4IG7 B;  5JHB A;  4MM3 A;  3MHZ A;  2IGD A;  2L83 A;  4EZL A;  3DHH C;  2BPS A;  5H92 C;  4HKQ A;  4GOC A;  1WR1 A;  5J17 A;  1WIA A;  4JGH B;  4YL8 A;  2LJ5 A;  1F77 A;  3HVD A;  1TY2 A;  3A4R A;  3ZVV A;  1TS4 A;  4GSW A;  3KWV A;  4E74 A;  1JQ4 A;  4MGY E;  2KWV B;  1TKY A;  2KFK B;  4HRO A;  1XQQ A;  4IM0 A;  2GBJ A;  2JXT A;  2CJO A;  3IXS A;  1ZP0 B;  3HM3 A;  4C56 C;  4KKJ A;  3QA8 A;  4W9J A;  4YSX B;  4XGA B;  3OJ3 A;  2K5P A;  2JRI B;  2MBQ A;  1V1P A;  2Y5P A;  3QX1 A;  2KVZ A;  2KQ7 A;  3QAQ A;  1V8C A;  3ZNH B;  2RGF A;  1I4Q A;  3N32 A;  2LGD A;  2BF8 B;  4GXB A;  5L95 C;  2Y5C A;  2ZNV B;  5IOI A;  1B9R A;  4MSM B;  1SXT A;  4EZJ A;  2BWF A;  1DOY A;  2D07 B;  4G11 A;  1YN4 A;  4YTM B;  1E0Z A;  2Z0E B;  2WXG A;  1YQ3 B;  3WAN A;  3MC0 B;  1T5X D;  2K6D B;  2NTS A;  4ZRP A;  1DGJ A;  1XCT L;  3ZGZ A;  3BZD B;  2ACZ B;  4B0M A;  3PZ8 A;  2KMM A;  2TSS A;  4KZ0 A;  3Q8B A;  4NAW A;  1WE7 A;  4M00 A;  5HHD G;  3PS6 A;  3AU4 A;  2V9H A;  2KJH B;  5EE3 A;  4GDL A;  2L05 A;  2CR5 A;  2V3N A;  1V1P B;  1PGX A;  4LLG M;  2LWP A;  2L0T A;  1D4B A;  2JSV X;  1OFF A;  3ZLZ A;  5IA7 A;  4LDT B;  1TZO A;  3SDL C;  1TBE A;  3IVF A;  2JT4 B;  3LYY A;  1OTR B;  3ML8 A;  4IC7 B;  5G55 A;  3MC9 A;  1MPE A;  1P7F A;  4NY0 A;  2K9X A;  2CS4 A;  2KTF A;  3DHG C;  4A3P A;  4W9L A;  4YTP B;  4II3 B;  3HM6 X;  2N1W A;  4LJP B;  4TQ0 A;  3PVL A;  2BYV E;  1WZ3 A;  2KDE B;  1P7E A;  1V80 A;  5BMH A;  1V86 A;  4W9F A;  4HK2 A;  1VDV A;  3SU8 X;  2LGS A;  4F8C B;  2ZVO A;  3E9S A;  4WWN A;  3V05 A;  3L10 B;  2LVO A;  2AL6 A;  2C9W B;  1V49 A;  2N7E A;  1DOX A;  3ENE A;  2WU2 B;  2WXK A;  3H8H A;  5FR6 A;  5AZH A;  1E90 A;  3SEB A;  3HIZ A;  3URY A;  4KDI C;  3DBR I;  2KDF B;  2AQ3 B;  5MPO A;  2JQR B;  2KDI A;  2LJI A;  2N9K A;  1T0S C;  3A1Q A;  1K8R B;  5BYS A;  1UD7 A;  3O13 A;  1LXD A;  1YN3 A;  2BT6 A;  1NI3 A;  5D3D A;  4JQW C;  3PHX B;  2KC2 A;  3RNA C;  3M63 B;  2MBH A;  5G5G A;  1AW7 A;  2MA9 B;  2N4F A;  1D5X C;  1QKZ A;  4GGQ A;  3PZD A;  3RCZ A;  1ZXH A;  2D3G A;  4W9G A;  1MI0 A;  4PS3 A;  4N9F 4;  1D5Z C;  1MJD A;  1WM3 A;  1E8W A;  2DZJ A;  2KLG A;  4IWP A;  4JPS A;  1JWS D;  1FO4 A;  1LFD A;  2LXC A;  2O2V A;  3CWI A;  1FPY A;  1GNU A;  3JW0 X;  1WYG A;  3TBL D;  1GC6 A;  2FID A;  4I6N B;  2L1A A;  2VZK D;  2PJH A;  1KLU D;  4JL9 A;  1VJK A;  1L6U A;  3T8M A;  2JZZ A;  1C9F A;  1I4X A;  1V9J A;  2KDB A;  2WNM A;  3LXF A;  4JWU C;  1Q5W B;  4XYC A;  2BYE A;  5IKC M;  3SFE B;  2PLP A;  1WX9 A;  4RMA A;  2QJL A;  2VH1 A;  1Z5S B;  4MEL A;  1E9M A;  3R66 C;  4DHZ E;  5JXV A;  3DBL I;  4JIO U;  2NPT A;  3Q69 A;  2DYM A;  1YIW A;  1PYW D;  4RH6 A;  5FR3 A;  2ZPY A;  1HTQ A;  2M0A A;  4L23 A;  2HTM E;  1KTK A;  2QEJ C;  4L2Y A;  4E71 A;  2MJ3 A;  2O2V B;  1VZ6 A;  1C1Y B;  5C3J B;  4FUL A;  3AN1 A;  3ZNI D;  1TIF A;  5H8Y E;  4XX5 A;  3LB8 C;  4WQM A;  1WXV A;  2WDQ B;  1ZDX A;  2JZ3 B;  2GB1 A;  3PHW B;  1Z2M A;  3NJT A;  2HJ1 A;  1WXQ A;  3PLV A;  5J2R A;  2X8X X;  3NVZ A;  2KTR B;  1UBI A;  1WMH A;  2K8B A;  3WCQ A;  3ZJU A;  4G0N B;  4ZOH C;  3NS8 A;  3VUY A;  2NPT B;  2LRW A;  3DVN U;  4HXD A;  5LXI B;  2I1K A;  3APC A;  4DHJ D;  3J9C A;  4EEW A;  4MSQ B;  2Z0D B;  3AEA B;  2V4I B;  4ICU A;  1KJT A;  3VAW A;  2MBO A;  5IO9 A;  1UNS A;  1FNU A;  4TSS A;  2CHW A;  3RT3 B;  2K6Q A;  3DHI C;  3B1L X;  4K81 A;  3BIN A;  4WAA A;  3APF A;  2JU6 X;  4BOZ B;  1V81 A;  3RI7 C;  4FJV B;  1BML C;  4HCP B;  3GE8 C;  2FCS A;  3U30 A;  2WXJ A;  2BWE S;  3UQB A;  3Q3F A;  2ZW0 A;  1TKG A;  1T0R C;  3RD2 A;  3PZ7 A;  1RWS A;  2ZNV C;  4ACF A;  3ECI A;  2XNA C;  4L1B A;  1ET9 A;  2JXX A;  2YEP B;  4BVU C;  1K52 A;  3N9Y C;  2JX5 A;  4MAC A;  2L0F A;  4EZK A;  2KQS A;  1E8X A;  4NQK E;  1E7U A;  1R4M B;  4US9 A;  3KUZ A;  2W9N A;  3PRM B;  2M19 A;  1JCK B;  4K3C A;  2GRI A;  2RMM A;  4HPL B;  2VRR B;  1RAX A;  1RYJ A;  1V5O A;  2FCM A;  3DBH I;  2OED A;  2BVC A;  2DZI A;  3NY5 A;  3U4E G;  2K8C A;  1ZKH A;  2K8H A;  1I4H A;  2PKO A;  4US8 A;  1QZE A;  2BTE A;  4M02 A;  4LNK A;  3CSF A;  2ZEQ A;  2LRU A;  1RFA A;  4OZB A;  3NZ3 A;  1C77 A;  4G3X B;  3P1M A;  3CF6 E;  2FCN A;  2C60 A;  3W2D A;  3AEG B;  5EDS A;  4S0R A;  2KX0 A;  1S3S G;  3AM9 A;  2KFJ A;  3BVG A;  1F1H A;  2JWU A;  3UIN B;  1WI0 A;  1YQ4 B;  4WQO B;  2MH7 A;  4IWQ A;  5LNK 1;  2M17 A;  2RPQ A;  1J8C A;  2KDM A;  3N1Z C;  4F7Z A;  3AEC B;  4N6E B;  2XN9 C;  1FXT B;  5FKA C;  1YX5 B;  4MGZ E;  4FAD A;  3NRZ A;  1K50 A;  4YWG G;  3DQV A;  1UH6 A;  2JPH A;  3ZJT A;  5D3I B;  3K9P B;  4OVU A;  3L4P A;  1TS2 A;  2N9L A;  2OJW A;  3DDC B;  3DBR B;  3EHV A;  3WAP A;  4TMA B;  5C23 A;  3C0R B;  2IO2 B;  3PSE B;  3AE9 B;  2PVO D;  2KNB A;  2JF5 A;  3L13 A;  3ZIM A;  4QAY A;  1FCC C;  2BQQ A;  4MGI E;  2MEK A;  3KWL A;  2LUE A;  3ZKJ C;  2D3B A;  2QHO A;  3AB5 A;  4LNN A;  3I63 C;  1XXG A;  4AS1 A;  1FIQ A;  2INN E;  3RNF C;  2PE6 B;  4M0W A;  4OVV A;  2LFI A;  3QIJ A;  5CHV C;  3AI5 A;  5T8I A;  3AE2 B;  1WGD A;  2QIE B;  1SE9 A;  3M95 A;  2WDT B;  3R2I A;  4DXA B;  1WM2 A;  2B3A A;  4OW0 A;  1ZDV A;  2J4X A;  3NS1 A;  4IM2 A;  1NVI D;  1FNV A;  3NVW A;  4TUU A;  1WXM A;  3APD A;  1LM8 B;  3R7Q A;  2JVC A;  3Q3J A;  3TJP A;  2LD9 A;  4KVG B;  3Q3M C;  4NPN A;  3OJ4 B;  1C4C A;  3UF8 A;  1XEE A;  1PUT A;  3AH7 A;  2LI5 A;  4JLC A;  1OEY A;  2NS5 A;  4YXD B;  3U52 E;  1GPX A;  3AE5 B;  3A4S C;  2D11 A;  3OG5 A;  2DAJ A;  2PTL A;  1FFU A;  3ONS A;  1FCL A;  3EEC A;  2KAC A;  1SF0 A;  3V62 A;  3H7P B;  3IBE A;  4HJG E;  3IFW B;  5IAA C;  2FIF A;  1YJJ A;  4M0W B;  1TKE A;  3EGR A;  2I2Y A;  1XLO A;  2MLB A;  2HJ8 A;  4AJY B;  2KAJ A;  4DHJ B;  3ZQ4 A;  1R7S A;  2KXJ A;  3AE8 B;  3N30 A;  1YN5 A;  2N7D A;  4Q2J A;  2KMC A;  3TEZ A;  5C2T B;  1ET6 A;  2IBI B;  1IP9 A;  4JWS C;  3RNG C;  4BFR A;  2LUM A;  2KAN A;  3AEE B;  2VH2 A;  1JAL A;  1UEL A;  3Q3O C;  1XCQ L;  1RFK A;  4F1S A;  1QT9 A;  1YJI A;  4BKG A;  5JH5 C;  2J7Q B;  2WXI A;  4RFB A;  4XE0 A;  2MJE A;  4TKN A;  3O65 B;  4BKS A;  3P4R B;  1I4R A;  1M4V A;  4RGO S;  2IPK D;  3DWM A;  4LTU A;  5E6P A;  4HCN B;  2WS3 B;  4W9E A;  3B2F A;  5D94 A;  1WYW B;  1IPG A;  2DYO A;  3C8Y A;  5IP4 D;  3TMP B;  3HHM A;  3M3J A;  4W9D A;  2PMV A;  4BAX A;  3L54 A;  1BXT A;  5L83 A;  2GMI C;  1E7P B;  3AEF B;  2J0K A;  2K1F A;  2KWD A;  3RZF A;  1YNT E;  1JRP A;  2BGF A;  2LVP A;  4S17 A;  3SD5 A;  4MJS B;  1R4M I;  1UGM A;  3S2A A;  4PT5 A;  2W55 A;  5HI1 A;  4WWO A;  1L2N A;  3HUI A;  1QOF A;  2I38 A;  3W1S C;  1EWY C;  1F52 A;  2CHZ A;  2X38 A;  4KGS A;  3AED B;  2PVG C;  1ZXI A;  2G4S A;  2WX0 A;  2WXQ A;  2IGG A;  1C78 A;  1N5X A;  3AE4 B;  2EKI A;  5GMV A;  1CMX B;  2B76 B;  3B08 A;  3AE3 B;  4HKZ E;  2AQ1 B;  4WJN A;  1RM6 C;  2HDE A;  3ZXR A;  2IY0 B;  2CU1 A;  2MHJ A;  1KM7 A;  1YMH E;  3IG3 A;  1EM7 A;  1Y8R C;  4M8M A;  2KT7 A;  2INP E;  4CQN A;  4W9I A;  2QSD A;  1V6E A;  4WJQ A;  1X1M A;  2YVC A;  2K0P A;  2M0X A;  4PK1 A;  3TL5 A;  1ZE3 D;  1HZ6 A;  4ASW C;  2DBY A;  3DBH B;  2WDV B;  4LCD E;  4IM3 A;  4EUT A;  4K7S A;  1HTO A;  4TV3 A;  2OJR A;  2G1E A;  1WGK A;  2N9P C;  4KGR A;  1UWM A;  2FE8 A;  2D3C A;  2D10 A;  4ZRI A;  2L00 B;  3P4S B;  1IGD A;  3P42 A;  4PYU A;  3ZDT A;  4EOY A;  4RM9 A;  2C7M B;  2KK8 A;  1MHH E;  4BOS C;  2ZPN A;  4ARI A;  3WA0 A;  3MP9 A;  3AUL A;  4HWI B;  4XDC A;  1N6Z A;  1HXY D;  1L5P A;  3MJW A;  1SBB B;  3VR8 B;  1SIF A;  4I6P A;  2KYW A;  3MJ5 A;  1MG4 A;  1JWB D;  5LXH A;  1F9J A;  3P2B A;  4UDU C;  1KRH A;  3UIP B;  1Q10 A;  2KMA A;  1JWA D;  4IW0 A;  4FXC A;  2IO0 B;  1IGC A;  4I6L B;  1NYQ A;  2WHI A;  2GLS A;  1ZOY B;  3N1Y C;  1WGR A;  4NAM A;  1WY8 A;  2WU5 B;  3V6C B;  2KKC A;  2WP9 B;  3U7D A;  2EKE C;  2MBB B;  1LGR A;  4NJC A;  4DK5 A;  2BS2 B;  4YTN B;  4H2A A;  4FLH A;  3DVN V;  3PRP B;  1FNW A;  2N1V A;  3GZN I;  3QCA A;  1NEK B;  3R3M A;  2LZ6 A;  1NBF C;  1CK1 A;  2KTR A;  3VVW B;  1P3Q U;  3ZO5 B;  2WXP A;  1C4P A;  4GB9 A;  4CO7 A;  4ZHO A;  1L0Y B;  5BMG A;  2EMT A;  4NJ7 A;  3GOE A;  1IYF A;  4P1C C;  3VRA B;  3NUH B;  1NDD A;  3BYY B;  1VZ7 A;  4B6W A;  1SIJ A;  2RPV A;  1D6E C;  1I4G A;  2RSU A;  4PYZ A;  4FBJ B;  3H7S A;  3ETR A;  4KIK B;  1N62 A;  2FUH B;  2AX5 A;  3W9C B;  4DDG D;  2AQ2 B;  3MFG A;  3MHS D;  4MGK E;  4GMV A;  3EFC A;  3CST A;  2JYT A;  3BYT B;  1ROE A;  2MRP A;  4RGT A;  1FXA A;  2L8J A;  3T3O A;  3I9V 1;  1HZ5 A;  1J0G A;  4ICV A;  3RYT A;  3VTV A;  4P7I A;  1YX6 B;  2L52 A;  2KJ6 A;  2M56 B;  4XC2 A;  4LK0 M;  1IBX B;  3ALB A;  1L0V B;  4A90 A;  4K7U A;  4P1B C;  5I4D A;  4A9A A;  2LHE A;  1JWU D;  1VR9 A;  5AUI A;  5D6J B;  1GUA B;  4E3C A;  4M01 A;  1L7Y A;  3E56 A;  2O6V D;  2KD0 A;  3LDZ E;  1GAQ B;  2Y3A A;  1F0Z A;  1NYR A;  2KZR A;  3TUO A;  3HRD D;  1SJH D;  1LQB A;  1A5R A;  2WXL A;  3PRZ A;  5HKH A;  3WIM A;  4M8N A;  1BT0 A;  4AWJ A;  3B0A A;  3JYU A;  4ANV A;  2KWC A;  4K3B A;  2IZV B;  4J3O D;  1T0Y A;  3VRB B;  5EE9 A;  3ZUN A;  3AU5 A;  4KSK C;  5DPT A;  3KLS X;  2DX5 B;  3L17 A;  4AP4 C;  3MTN B;  2FAZ A;  1GB1 A;  3Q6B A;  3BK1 A;  5DCN A;  1TT5 B;  3OLM D;  4K7W A;  1NEN B;  1KF6 B;  2IJ0 A;  2PW9 A;  2NMQ A;  1YJ1 A;  2WX1 A;  1YOV B;  3KW5 B;  1KOT A;  1SJE D;  2KOX A;  2NBV B;  4N59 A;  4GLS C;  4IDI A;  1FRR A;  1FM0 D;  3I5J C;  3BVM A;  2FCQ A;  1E7V A;  2BB6 A;  2L3Z A;  2IYD B;  1HQR D;  5DPW A;  3DVG X;  2YEP F;  2MWS B;  2RDH A;  4IOI E;  2MCN B;  3JSV B;  1A70 A;  3UQA A;  5IN7 A;  3QJZ A;  2M4N A;  2NBW B;  1JRO A;  1PGB A;  2MBE A;  3R2T A;  4KSL C;  1Q0W B;  4K1R B;  1GOZ A;  3QC8 B;  1FRD A;  3AE7 B;  2D3A A;  2R2O A;  3N1X C;  4RGM A;  1T6B X;  1N60 A;  4KKI A;  1KFY B;  5KHO A;  2ZCB A;  4A8X C;  1C79 A;  4LJO B;  1HE8 A;  2L32 A;  3PGE A;  3RPF C;  1AWD A;  3Q3N C;  2W82 A;  2ASQ A;  2MSE D;  2DYB A;  2DLB A;  3NOB A;  4D2K A;  2JZP A;  1UWX A;  3L16 A;  4RCO A;  1P0R A;  3AV8 A;  4DBG A;  1SSN A;  2D2Q A;  1E5W A;  3ZJV A;  2AYO B;  5D7G A;  3VXW A;  1F2R I;  1HEZ E;  3W5U B;  4HDQ A;  3PO0 A;  1E10 A;  1STE A;  3I57 A;  3FC4 A;  2GOW A;  3FIL B;  4DXG A;  1EF1 A;  2WDR B;  2KN4 A;  1WWT A;  2VZK B;  3K9O B;  5DPR A;  1EU4 A;  2PEA A;  2GBK A;  2MJD A;  3BY4 B;  3QHT A;  4DDI D;  2BS3 B;  4ZRK A;  4R3D A;  1T0Q C;  1AAR A;  3AXC A;  3ML9 A;  2KWU B;  4GDK B;  4KX6 B;  2JRH A;  2V1Y A;  1FEH A;  2E3T A;  2UWQ A;  2GBR A;  3T3N A;  1GG3 A;  3Q8F A;  3GP7 A;  4ZYN A;  3PPA A;  3QWZ B;  1R4N I;  3H7P A;  5GXG B;  3L0W B;  3W1Y A;  1ZPS A;  2LAS A;  3VR9 B;  4WJP A;  1FD6 A;  2N0S B;  2IND C;  2QCZ A;  3P4P B;  4USA A;  4DXF A;  4B0E A;  2K39 A;  3V60 A;  4DQO C;  1WJN A;  1E8Z A;  1IUE A;  4MT5 A;  1UF0 A;  3DBS A;  3QQ8 B;  3ZXV A;  2KLC A;  4XZ4 A;  2LGI A;  4IWO A;  4C80 A;  2D5G A;  3GS2 A;  4GU2 A;  3U7Z A;  2KQ4 X;  1JML A;  2KX3 A;  2SAK A;  1GC7 A;  2QMT A;  3V61 A;  2J52 A;  3GZN B;  3B2G A;  3A9J A;  2N9E B;  3BWU D;  3PRE A;  2NTT A;  4ZRJ A;  2YLM A;  4WWM A;  1U4A A;  2NR2 A;  1PFD A;  5HG2 A;  2LHD A;  4DHZ B;  2N7J A;  1FXI A;  2KVR A;  3Q2A C;  4GN1 A;  4XDD A;  4NNJ B;  4NJ6 A;  1VCB A;  3GE3 C;  3ZTD A;  1D3Z A;  4C4V A;  3KYC D;  2O6V B;  3WAM A;  1HA5 A;  2CKH B;  2H88 B;  1PQS A;  3UIO B;  2DWQ A;  2K3U A;  3IAM 1;  4MJS A;  3I3T B;  1BUI C;  1T3Q A;  2WXR A;  3R8B A;  3HK0 A;  1PGA A;  2WLB A;  3QK0 A;  4FA6 A;  1UZX B;  2HE7 A;  3RNC C;  1I4P A;  2L76 A;  2K22 A;  1LO5 D;  3AE6 B;  2MW5 A;  5EE0 A;  3ZTC A;  3A9J B;  1V2Y A;  4II2 B;  2Q5W D;  1GJZ A;  3BII D;  1XLN A;  2IY1 B;  4RM8 A;  3TCA A;  1XO3 A;  4OHJ A;  2W3R A;  1G6J A;  4RF1 A;  3N20 C;  2RD0 A;  3SHQ A;  2OOB B;  4DWF A;  4KDL B;  2WXM A;  1WSP A;  2V0G A;  2UU7 A;  3EC8 A;  4C4V B;  2EEL A;  3B9J A;  3LJ3 A;  2G45 B;  3P63 A;  1QQR A;  4IUM B;  4C7Y A;  1DOI A;  1QOG A;  4OZC A;  5CTR C;  5CHF A;  2M1M A;  4PS8 A;  1EWC A;  3Q14 C;  5AZG A;  4MM3 B;  2GBN A;  2LXA A;  4W9H A;  3W5V B;  1WF9 A;  2R2Q A;  4MH0 E;  5G5H A;  2WXN A;  2GBM A;  4NZL B;  1TYG B;  1MFW A;  1OQR A;  1OQQ A;  2LMC A;  1TJE A;  4ITK A;  5E6O A;  1ENF A;  3ABV B;  2PE9 A;  1TS3 A;  2LGX A;  4KGT A;  1KLV A;  2NVU I;  1XD3 B;  4LNI A;  4O1N A;  3PT2 B;  2ON8 A;  1V5T A;  1ISN A;  4J6I A;  4G50 A;  4RNA A;  4A3O A;  3RNE C;  2J53 A;  3R7R A;  2HD5 B;  1YQB A;  2KO3 A;  2BKF A;  4HRS A;  1M94 A;  1WX8 A;  4HVB A;  3X23 A;  2BB5 A;  1L0X B;  1EO6 A;  1CQV A;  4KZC A;  4AOF A;  4RF0 A;  4JE3 B;  1NI2 A;  3AMZ A;  3DOW A;  3EUB 2;  2CU3 A;  1K53 A;  2R61 A;  4KV2 A;  4EKU A;  1J19 A;  3VHT C;  3TEY A;  5E6J A;  1WRD B;  3U2S C;  5EE1 A;  3T9L A;  2ICI A;  4W9K A;  3VUX A;  2L7R A;  5TR5 A;  1SE2 A;  5BO4 B;  3RUI B;  5D2M B;  4FJZ A;  1TS5 A;  2NBU A;  3OWE B;  1WGH A;  2G9H D;  2INC C;  3NG0 A;  2NCN A;  5BMI A;  1UUP A;  4NAW B;  1RLF A;  3OAW A;  2AWT A;  1WGG A;  2J42 A;  4W9C A;  3KYD D;  3P4Q B;  1J7B A;  2V3S A;  4GDL B;  2IO3 B;  4OVZ A;  1P1A A;  3KUC B;  3A9K A;  2Z59 B;  2G4D B;  3WAL A;  2J0J A;  2M8S A;  3RNB C;  5AZF A;  1ZGU B;  1VLB A;  2WXO A;  1ZW7 A;  1SE3 A;  4KIK A;  4BBN F;  2RR9 A;  2DZK A;  1WFY A;  2I1J A;  4ARC A;  2XK5 A;  2RDB C;  3GB1 A;  2G3Q B;  3VQI A;  1I42 A;  4FHJ A;  5HFY A;  1JWM D;  1WXS A;  1QOA A;  5TSS A;  2GI9 A;  1P98 A;  1QOB A;  1TZ1 A;  3FAH A;  1E8Y A;  3VFK A;  2IDY A;  1R4N B;  1SGH A;  1IBX A;  3PLU A;  3NVV A;  5BYR A;  4AQ7 A;  4ZYS A;  2FUG 1;  2ONQ A;  4WIP A;  4B95 A;  1WR6 E;  1MVK A;  4FHK A;  1J7A A;  1WH3 A;  3A9K B;  1J7C A;  1WXA A;  4A20 A;  3A1Q B;  1N5W A;  2FNJ B;  3NZS A;  4WH4 A;  3SR6 A;  3C19 A;  3UGB B;  4URK A;  2CJN A;  4ANW A;  3RFZ B;  4HPP A;  1H8C A;  1H4R A;  4GIV A;  3ZRC A;  4ANX A;  1L4D B;  1CJE A;  1TY0 A;  4HEA 1;  1RRB A;  2JWZ A;  1OGW A;  3ZNG C;  3EFU A;  1QIL A;  2DHZ A;  2XK5 B;  4P6V F;  4CHK A;  5LLI A;  2FBW B;  1C3T A;  1WJ6 A;  3X0W A;  2J0M A;  2QDF A;  3WAO A;  2C7H A;  4XWW A;  3TSS A;  3W1S A;  1KLG D;  1MHX A;  2EMS A;  3VUW A;  2DZM A;  4C7Z A;  1FFV A;  4LNF A;  2WQY B;  3Q8C A;  4YSZ B;  3V6E B;  2QC8 A;  2REX A;  4HDO A;  1XT9 B;  4ZHP A;  2BYT A;  4BKT A;  3UI3 A;  2Y5B B;  1D5M C;  3Q8E A;  2LGY A;  4XWT A;  3ZRF A;  1OEY J;  4LNO A;  2C7N B;  1DYQ A;  5G2N A;  3D32 A;  4IKG A;  3AE1 B;  1SE4 A;  4X57 B;  3CIR B;  2W54 A;  3JSV A;  2LVQ A;  1ZUD 2;  3PV1 A;  1WX7 A;  4YSY B;  5J18 A;  4C00 A;  2ZVN A;  2MP2 A;  4TQ1 A;  1PDX A;  2A4Z A;  2DAF A;  1UGJ A;  5CHW A;  1AYF A;  2MQJ A;  1TTN A;  3DCG A;  3KUD B;  5FK9 C;  2JYE A;  1WGY A;  2JUO A;  3BK2 A;  3TEW A;  3L08 A;  1V1O A;  3H1U A;  4AJW A;  5BYQ A;  2WXF A;  3RUL A;  2N9X A;  2JY6 A;  1XLQ A;  1ESF A;  4REZ A;  3VTW A;  3HVZ A;  2KN5 A;  3TIX A;  1WMH B;  4MH8 A;  5E6N A;  3KVF B;  1XLP A;  3IHP C;  1B1Z A;  1I7H A;  3M62 B;  5JHA A;  2BYF A;  1AN8 A;  3FIL A;  2IO1 B;  4YT0 B;  1WRI A;  3N3K B;  2V3P A;  3RMK C;  2Z8L A;  3DWG C;  3RZW C;  2MP2 B;  2PIA A;  2UYZ B;  4MDK E;  1WJU A;  3KQ4 A;  4GDK A;  2KJR A;  1MG8 A;  2WWZ A;  1L6V A;  1GB4 A;  5KHQ A;  1CZP A;  2WXH A;  1SB3 C;  5AUK A;  2QIL A;  1JW9 D;  1YD8 U;  2A5U A;  4BKS D;  3NVY A;  3VH4 B;  1VRA B;  3H6N A;  1N61 A;  3NZU A;  1EUV B;  3VH3 B;  4BZA A;  5AEK B;  4LDT D;  3H9D A;  1P9D U;  3A33 B;  1QLB B;  4ZDV A;  2ZW1 A;  4NQL B;  2HTH A;  1Y56 A;  1S1Q B;  2BKR B;  2E6X A;  2H89 B;  1WJ4 A;  4RGN A;  2BW2 A;  2WGS A;  2ZCC A;  3ZW3 A;  1C4A A;  1OQY A;  4JX1 C;  3SFD B;  1I35 A;  4EE2 A;  2C5L C; 
#chains in the Genus database with same CATH homology
 1L5P A;  2W3R A;  4WUR A;  3J9C A;  1SBB B;  3VR8 B;  4RF1 A;  3AEA B;  2V4I B;  3ZYY X;  3MJ5 A;  1JWB D;  1UNS A;  4N58 A;  1FNU A;  4TSS A;  4UDU C;  1KRH A;  2WXM A;  1WSP A;  3AEB B;  1Q10 A;  2V0G A;  1L4Z B;  2EEL A;  3B9J A;  1JWA D;  4WAF A;  4FXC A;  1IGC A;  2JU6 X;  3P63 A;  1QQR A;  4P16 A;  4C7Y A;  1BML C;  1NYQ A;  1DOI A;  1ZOY B;  1QOG A;  4OZC A;  1K51 A;  1F2R C;  1EWC A;  4NAM A;  2BS4 B;  2WXJ A;  4MM3 B;  2ZW0 A;  1TKG A;  2WU5 B;  3W5V B;  2WP9 B;  3PZ7 A;  4ZRQ A;  1RWS A;  3Q8A A;  5G5H A;  2WXN A;  1XF5 L;  2XNA C;  4L1B A;  4NJC A;  4NZL B;  1TYG B;  1OQR A;  1ET9 A;  2BS2 B;  4YTN B;  1OQQ A;  2LMC A;  4H2A A;  1TJE A;  4ITK A;  1KH0 A;  1ENF A;  2YEP B;  1FNW A;  3ABV B;  4KGT A;  1TS3 A;  1K52 A;  3N9Y C;  1NEK B;  2JX5 A;  1CK1 A;  2SEB D;  4MAC A;  1V97 A;  3V3X A;  2LEK A;  4O1N A;  2WXP A;  1C4P A;  2BBC A;  4ZHO A;  1L0Y B;  2ON8 A;  5BMG A;  1ACC A;  1E6E B;  1QF6 A;  3BVZ A;  4US9 A;  4RNA A;  3VRA B;  2M19 A;  3NUH B;  2J53 A;  1JCK B;  2GRI A;  2RMM A;  3BYY B;  3IT4 B;  1RYJ A;  1N63 A;  1VZ7 A;  4OZA A;  1SIJ A;  2RPV A;  2OED A;  1D6E C;  1I4G A;  1FMA D;  4HRS A;  2BB5 A;  3U4E G;  1L0X B;  1CQV A;  3IAS 1;  1I4H A;  2PKO A;  3ETR A;  4RF0 A;  4US8 A;  3ZGZ A;  4JE3 B;  4A55 A;  2BTE A;  4A6Q A;  3AMZ A;  1N62 A;  3EUB 2;  2CU3 A;  2IGH A;  1K53 A;  2R61 A;  2AX5 A;  2OHF A;  2RDG A;  3TEX A;  2AQ2 B;  2W3S A;  3W9C B;  3MFG A;  1EU3 A;  3NZ3 A;  1SEB D;  4OZB A;  1C77 A;  3TEY A;  1VZ8 A;  1C76 A;  3P1M A;  2JYT A;  3EA6 A;  3IT6 B;  5E6J A;  3U2S C;  3BYT B;  1ROE A;  5EE1 A;  2ICI A;  3W2D A;  4RGT A;  1FXA A;  3AEG B;  3T3O A;  3MHZ A;  2IGD A;  2L83 A;  1HZ5 A;  3I9V 1;  1SE2 A;  5H92 C;  4HKQ A;  1TS5 A;  3AM9 A;  3OWE B;  2G9H D;  2L52 A;  2M56 B;  4LK0 M;  1IBX B;  3BVG A;  5BMI A;  1F77 A;  3HVD A;  1UUP A;  1TY2 A;  4NAW B;  1L0V B;  1TS4 A;  2JWU A;  4A90 A;  3KWV A;  1JQ4 A;  5I4D A;  1YQ4 B;  4A9A A;  2MH7 A;  5LNK 1;  1TKY A;  2LHE A;  2J42 A;  1JWU D;  1VR9 A;  4HRO A;  2KDM A;  3P4Q B;  1J7B A;  5AUI A;  4GDL B;  3AEC B;  2JXT A;  4N6E B;  2XN9 C;  5FKA C;  2CJO A;  3E56 A;  3IXS A;  1ZP0 B;  4C56 C;  4OVZ A;  3NRZ A;  1GAQ B;  1K50 A;  4KKJ A;  4YWG G;  4YSX B;  2Y3A A;  1F0Z A;  2K5P A;  3ZJT A;  5D3I B;  1NYR A;  3TUO A;  1V1P A;  2Y5P A;  3L4P A;  3HRD D;  1SJH D;  1TS2 A;  2WXL A;  2N9L A;  1V8C A;  4TMA B;  1VLB A;  2WXO A;  1I4Q A;  3AE9 B;  2PVO D;  2Y5C A;  1SE3 A;  1FCC C;  4J3O D;  1B9R A;  3VRB B;  5EE9 A;  1SXT A;  2MEK A;  3KLS X;  1DOY A;  4ARC A;  1GB1 A;  3KWL A;  1YN4 A;  3AB5 A;  3BK1 A;  4YTM B;  1E0Z A;  2WXG A;  3GB1 A;  1YQ3 B;  1XXG A;  4AS1 A;  1FIQ A;  1NEN B;  2INN E;  1KF6 B;  3VQI A;  3MC0 B;  1T5X D;  2IJ0 A;  5HFY A;  4M0W A;  2NTS A;  2PW9 A;  2NMQ A;  1JWM D;  1QOA A;  2LFI A;  4ZRP A;  2GI9 A;  5TSS A;  1IBX A;  1DGJ A;  1QOB A;  3FAH A;  1XCT L;  5T8I A;  2IDY A;  2ACZ B;  3AE2 B;  2QIE B;  1SJE D;  3BZD B;  3PZ8 A;  4B0M A;  2KMM A;  3NVV A;  5BYR A;  2TSS A;  4AQ7 A;  4ZYS A;  3R2I A;  3Q8B A;  2FUG 1;  2ONQ A;  4N59 A;  4OW0 A;  4WIP A;  1ZDV A;  2J4X A;  4GLS C;  4IDI A;  1FRR A;  3NS1 A;  1FM0 D;  5HHD G;  1NVI D;  1FNV A;  3NVW A;  1MVK A;  1J7A A;  3BVM A;  1J7C A;  2BB6 A;  5EE3 A;  2V3N A;  1V1P B;  1N5W A;  4WH4 A;  1PGX A;  1HQR D;  4EE2 A;  4LLG M;  3SR6 A;  2CJN A;  2YEP F;  1C4C A;  1D4B A;  3RFZ B;  2RDH A;  1XEE A;  2JSV X;  1OFF A;  4IOI E;  1PUT A;  3AH7 A;  1A70 A;  1TZO A;  3LYY A;  1L4D B;  1CJE A;  1TY0 A;  1JRO A;  1PGB A;  3R2T A;  4HEA 1;  3U52 E;  4YXD B;  1GPX A;  3AE5 B;  1MPE A;  2PTL A;  1P7F A;  1FFU A;  1QIL A;  2K9X A;  1FCL A;  1GOZ A;  4P6V F;  2KAC A;  1FRD A;  4YTP B;  1SF0 A;  3AE7 B;  4RGM A;  4TQ0 A;  1T6B X;  1N60 A;  4KKI A;  1KFY B;  2FBW B;  4HJG E;  1P7E A;  1YJJ A;  5BMH A;  1TKE A;  4A8X C;  3EGR A;  1C79 A;  2I2Y A;  1XLO A;  1VDV A;  4OHJ A;  2L32 A;  2KAJ A;  3RPF C;  4XWW A;  3E9S A;  1AWD A;  3ZQ4 A;  3TSS A;  1R7S A;  3W1S A;  3V05 A;  2W82 A;  3AE8 B;  2DLB A;  1YN5 A;  1KLG D;  1MHX A;  4D2K A;  4Q2J A;  2JZP A;  1UWX A;  1DOX A;  4C7Z A;  1FFV A;  2WU2 B;  2WXK A;  5C2T B;  3H8H A;  3TEZ A;  1ET6 A;  4RCO A;  3AV8 A;  1SSN A;  4JWS C;  3SEB A;  2WQY B;  3Q8C A;  4YSZ B;  2LUM A;  3ZJV A;  5D7G A;  3AEE B;  1JAL A;  3URY A;  1F2R I;  1HEZ E;  3W5U B;  3PO0 A;  1E10 A;  1XCQ L;  1STE A;  1RFK A;  4ZHP A;  2BYT A;  1QT9 A;  3FC4 A;  2AQ3 B;  1YJI A;  3FIL B;  3I57 A;  2JQR B;  3UI3 A;  1D5M C;  3Q8E A;  2LJI A;  2WDR B;  2WXI A;  2KN4 A;  2N9K A;  4RFB A;  4DXG A;  1WWT A;  2VZK B;  4XE0 A;  4XWT A;  2MJE A;  1EU4 A;  5BYS A;  3O13 A;  1YN3 A;  2MJD A;  2BT6 A;  1NI3 A;  5D3D A;  1DYQ A;  3P4R B;  2BS3 B;  4IKG A;  1I4R A;  1M4V A;  1SE4 A;  2IPK D;  3AE1 B;  4RGO S;  3DWM A;  4LTU A;  3CIR B;  4R3D A;  2W54 A;  5G5G A;  1ZUD 2;  1AW7 A;  4YSY B;  2WS3 B;  3B2F A;  1D5X C;  1QKZ A;  4GDK B;  1ZXH A;  4KX6 B;  4TQ1 A;  2DYO A;  1FEH A;  1MI0 A;  3C8Y A;  1PDX A;  1UGJ A;  1AYF A;  2E3T A;  2PMV A;  1D5Z C;  3T3N A;  1BXT A;  3Q8F A;  1E7P B;  5FK9 C;  2JYE A;  3AEF B;  3GP7 A;  3BK2 A;  2KWD A;  3TEW A;  1YNT E;  1JRP A;  4JPS A;  1JWS D;  5GXG B;  1FO4 A;  5MPO A;  1V1O A;  3CWI A;  5BYQ A;  1ZPS A;  1WYG A;  3VR9 B;  2WXF A;  2N0S B;  1FD6 A;  4PT5 A;  1XLQ A;  2W55 A;  1ESF A;  2L1A A;  2VZK D;  3P4P B;  5HI1 A;  1KLU D;  4USA A;  1VJK A;  1L6U A;  4REZ A;  4DXF A;  3HUI A;  1QOF A;  4B0E A;  4DQO C;  2I38 A;  3HVZ A;  1IUE A;  1EWY C;  1I4X A;  2X38 A;  4MT5 A;  4KGS A;  1C9F A;  2WNM A;  3LXF A;  4JWU C;  3AED B;  2PVG C;  1ZXI A;  4MH8 A;  2LGI A;  1XLP A;  3SFE B;  2WXQ A;  4C80 A;  2D5G A;  2IGG A;  1C78 A;  2PLP A;  3GS2 A;  3U7Z A;  1N5X A;  2QJL A;  2KQ4 X;  1JML A;  3AE4 B;  2EKI A;  1B1Z A;  1I7H A;  2B76 B;  2SAK A;  3AE3 B;  4HKZ E;  1AN8 A;  3FIL A;  1E9M A;  2QMT A;  4YT0 B;  1WRI A;  2AQ1 B;  5JXV A;  2V3P A;  2J52 A;  2Z8L A;  3B2G A;  3DWG C;  1RM6 C;  2HDE A;  2DYM A;  3Q69 A;  1PYW D;  2PIA A;  1YMH E;  4RH6 A;  3BWU D;  5FR3 A;  1EM7 A;  2NTT A;  4CQN A;  2INP E;  4WWM A;  2QSD A;  2M0A A;  3KQ4 A;  1PFD A;  4L23 A;  2HTM E;  1KTK A;  2K0P A;  5HG2 A;  2LHD A;  2QEJ C;  4L2Y A;  1L6V A;  2N7J A;  1GB4 A;  1FXI A;  1ZE3 D;  1CZP A;  1HZ6 A;  2MJ3 A;  4XDD A;  1VZ6 A;  2WXH A;  1SB3 C;  2DBY A;  2WDV B;  5C3J B;  5AUK A;  2QIL A;  1JW9 D;  3AN1 A;  1HA5 A;  2H88 B;  5H8Y E;  3LB8 C;  2G1E A;  2DWQ A;  3NVY A;  4WQM A;  1VRA B;  1WGK A;  1N61 A;  2K3U A;  3IAM 1;  2WDQ B;  1BUI C;  4KGR A;  1T3Q A;  1ZDX A;  1UWM A;  2WXR A;  3R8B A;  2FE8 A;  2GB1 A;  1PGA A;  1QLB B;  2WLB A;  2ZW1 A;  1WXQ A;  1I4P A;  3P4S B;  2K22 A;  1LO5 D;  3NVZ A;  1IGD A;  1Y56 A;  3P42 A;  3AE6 B;  2E6X A;  2H89 B;  3WCQ A;  5EE0 A;  4RGN A;  2BW2 A;  3ZJU A;  1MHH E;  4ZOH C;  4ARI A;  3MP9 A;  1C4A A;  2Q5W D;  4JX1 C;  3SFD B;  4XDC A;  3BII D;  1XLN A;  1XO3 A;  1HXY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...