3AE7B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 52
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae7B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae7B01
1GTEA 1FIQA 2L83A 3SR6A 1JWBD 1KFYB 2OHFA 2W54A 3AEBB 2L52A 1E7PB 3CF4A 3AMZA 1QLBB 1VJKA 3B2FA 1VLBA 1TKEA 3AN1A 5H92C 1ZOYB 1SIJA 1WWTA 3P4QB 3AE2B 3P4PB 3CIRB 2DBYA 1E6EB 2N0SB 3AE9B 1RFKA 2Q5WD 3AE3B 1YJJA 4US9A 4N6EB 2WS3B 1L6UA 1V8CA 3AE6B 3AEAB 5EE3A 1NENB 1QF6A 2PIAA 1WGKA 3AM9A 3LXFA 3L4PA 1RM6C 3AE8B 3DWMA 1DGJA 4HROA 2WDVB 5AUKA 2JQRB 3ETRA 4YTPB 2ACZB 2CJNA 1RWSA 2PVGC 1XLNA 1J7AA 1TKYA 1WRIA 2MJ3A 3DWGC 5EE9A 1A70A 2MJEA 1VDVA 2E3TA 3AB5A 3NRZA 1NEKB 4US8A 1ROEA 2QIEB 1JRPA 3VRBB 2W3SA 5H8YE 1QOFA 3FC4A 1JWAD 5EE1A 2Y5CA 3ZYYX 1L6VA 1KF6B 2CJOA 1XLOA 2WQYB 2WU5B 3W9CB 1NYRA 2BS2B 1PUTA 4YSXB 3NVWA 2H89B 1FFUA 4ITKA 3NVYA 1T3QA 1V97A 4HRSA 3P63A 2M19A 3B2GA 1J7CA 1NVID 5MPOA 3P1MA 2K9XA 3AE5B 3FAHA 5GXGB 4A9AA 1GAQB 1E0ZA 2MJDA 1JQ4A 2K22A 3AEDB 3AEGB 2BS3B 1OFFA 1OQRA 2PKOA 1NYQA 1FRDA 4N58A 4LTUA 5EE0A 5G5GA 3W5VB 3WCQA 2BS4B 3P4RB 3SFEB 2CU3A 3HRDD 2PVOD 3AE1B 3AECB 1DOIA 1R7SA 4KX6B 3HUIA 1XLPA 2G1EA 1PDXA 1KRHA 2WDQB 3AEEB 1JALA 1FRRA 1SB3C 1I7HA 2H88B 1H7WA 4YXDB 2WDRB 4YTNB 1EWYC 4YSZB 1TKGA 3AH7A 3B9JA 3PO0A 1NI3A 1WYGA 1JW9D 1PFDA 1GTHA 5C3JB 4P6VF 1QOBA 2HTME 4YTMB 3AEFB 1N5WA 1IUEA 1FXIA 2JX5A 4C7ZA 1CZPA 4YT0B 1L5PA 1DOXA 1FO4A 1TYGB 1N61A 2K5PA 1ZUD2 1XO3A 4N59A 2W55A 2WU2B 2KMMA 5AUIA 1XLQA 1RYJA 2LEKA 4ZOHC 1ZP0B 2B76B 1CJEA 2MH7A 3RPFC 1L0VB 3AE7B 3NS1A 4JX1C 1N60A 5C2TB 4C80A 3BIID 4IDIA 1N5XA 3AV8A 3NVZA 1AWDA 4ZHPA 4USAA 1TJEA 1B9RA 1J7BA 2FBWB 1ZXIA 3SFDB 1YQ3B 2WP9B 1QOAA 1FXAA 1H7XA 1OQQA 1WXQA 1JROA 2BT6A 4FXCA 3P4SB 2QJLA 2W3RA 1QOGA 3ABVB 3EUB2 4JWSC 2DWQA 4WWMA 4WQMA 1GT8A 1YJIA 3NVVA 1YQ4B 3CWIA 2AX5A 3VR9B 1FM0D 4YSYB 3AE4B 1N62A 3W5UB 1SF0A 4C7YA 2M56B 1F0ZA 2WLBA 1DOYA 1N63A 3KWLA 1FFVA 5G5HA 3VR8B 1FMAD 3VRAB 1UWMA 3LB8C 1GPXA 1AYFA 4ZHOA 4JWUC 1E10A 2EKIA 1E9MA 2KAJA 3HVZA 1QT9A
chains in the Genus database with same CATH superfamily
1JWBD 4OVVA 3PT2B 1TKEA 3IG3A 4AP4C 3V61A 1AARA 4G50A 3K9PB 1LGRA 2N4FA 1HTOA 4PS7A 2J7QB 3DWMA 1DGJA 1TKYA 1V5OA 2MJEA 3WIMA 4URKA 3VRBB 1ENFA 5G55A 1QOFA 1F52A 3R66C 1TS2A 4M01A 4OVZA 4B6WA 2MRPA 1Q1OA 2KN4A 4YSXB 1TS5A 4HRSA 5E6JA 3ZVVA 4HVBA 1GC7A 2BYTA 2Z59B 1V80A 2N7JA 4N58A 3CF6E 1FRDA 2FCSA 3WCQA 2RD0A 1ZE3D 4IW0A 2ZVOA 5C23A 3BYTB 5C1ZA 1P3QU 2NS5A 5G2NA 1RLFA 5IAAC 3NOBA 4KZ0A 2Y5BB 3X23A 2KJRA 2WXRA 1WYGA 1JW9D 1WM3A 1C78A 1CQVA 4YT0B 1T5XD 2IJ0A 1XO3A 3RD2A 2MCNB 2MSED 2LEKA 1GNUA 2AWTA 5C2TB 4IDIA 1B9RA 3ZDTA 4AJWA 3T3OA 1ET6A 1ZKHA 1GT8A 3ZXVA 1SF0A 2L76A 2LXCA 1N63A 2GBRA 2J0JA 4M0WB 2KOXA 3APFA 3M95A 4P16A 4MH8A 1GTEA 2SEBD 3BINA 2NMQA 5FKAC 4REZA 3AN1A 1G6JA 2EELA 2W82A 5IP4D 2DBYA 2MBOA 1C1YB 2N0SB 1OQYA 5E6OA 5HFYA 1WGKA 3AE8B 4W9LA 1WRDB 2JQRB 4R3DA 1J7AA 2MJ3A 4RF1A 2E3TA 3LJ3A 3NZUA 1D6EC 2ZNVB 1JWAD 5EE1A 2CHZA 3OAWA 4DHJD 2LGDA 1WX9A 1LM8B 4XX5A 4ZDVA 2H89B 3X0WA 1L7YA 2R2QA 3B2GA 1NVID 2K9XA 2O6VB 2PKOA 5EE0A 3TSSA 1I4XA 3HUIA 2DNFA 1RAXA 1SB3C 2XN9C 2NVUI 2WX0A 4RH6A 3L16A 2HTME 3AEFB 3BVZA 1IUEA 1L5PA 2BB6A 1FO4A 1FCLA 1UD7A 2K25A 2QCZA 3VTVA 2MWSB 4XWTA 2C9WB 2X38A 3EGRA 1I4QA 2PJHA 1YQ3B 1V6EA 2LFIA 1H8CA 3IFWB 4GN1A 4WWMA 4IC7B 3A1QA 2AX5A 2FCMA 2V0GA 4C7YA 3DBLB 2C7NB 1LO5D 4X57B 1GPXA 2ZEQA 1E10A 2EKIA 2J0MA 3L0WB 4ZRPA 4FJZA 2O2VB 2K6QA 3NHEB 4ANUA 5KHOA 2FCNA 2DLBA 2KC2A 3IBEA 2QHOA 3MJ5A 3D32A 2INNE 2MQJA 3OJ3A 4LK0M 3N3KB 4EFOA 4IUMB 3VH3B 3Q3OC 5IKCM 4WH4A 4MGYE 1P0RA 1PUTA 3K9OB 3B1LX 1T3QA 4K81A 3AE5B 1MJDA 1M4VA 3W5VB 1V81A 1YN3A 3BY4B 1SE9A 3FILA 4HCNB 1XLPA 3NZ3A 3URYA 2GI9A 2WNMA 3DBLI 2H88B 1WR6E 1S3SG 2WXOA 1WFYA 1GTHA 4FN2A 4DDGD 2ZCBA 1P7EA 1VZ8A 1WR1A 3KUZA 4BAXA 3L08A 1PGAA 1QKZA 2WU2B 2TSSA 4WAAA 4IWOA 3Q14C 1N6ZA 3SDLC 2FAZA 2UWQA 3RMKC 1N5XA 3PV1A 4RF0A 4WWNA 1UBQA 2KO3A 1WXQA 3A4SC 3Q3MC 3PGEA 2UU7A 2FIDA 2GB1A 4P7IA 5JXVA 4EZKA 4KZCA 4RNAA 2GBMA 1ZPSA 2M56B 4KDIC 3EA6A 2DHZA 1WX7A 1IPGA 3H8HA 4NAWB 4BBNF 3VRAB 3PHWB 1NI2A 2KAJA 4GXBA 1FIQA 1KFYB 2L52A 1EWCA 5J17A 2KACA 3Q3NC 3P4PB 1YN4A 4FBJB 1JMLA 1SE4A 4US9A 1WGRA 2RDGA 3IVFA 1JWMD 2WXQA 2LZ6A 1C4PA 2PIAA 4UDUC 1TY0A 3J9CA 1EUVB 2DENB 3DVNU 1WRIA 3AU4A 2IO2B 1V1PA 3NRZA 3V62A 1STEA 3KUCB 3ZYYX 2KZRA 3W1SC 1XLOA 1MG4A 2C7MB 2K1FA 4W9JA 1E8XA 1YNTE 1EF5A 1SE2A 4HJGE 4LCDE 3ONSA 4GMVA 2K22A 4P1BC 2GBNA 2VZKB 4MJSB 1LFDA 2I38A 4MACA 1L0XB 1C9FA 4NZLB 2HE7A 2WXPA 2K39A 4YWGG 3Q69A 1IYFA 3B08A 3AH7A 4ANWA 4FADA 2D2QA 2MLBA 2KT7A 3DBHB 1QOBA 1C76A 2M1MA 4GDKB 4W9IA 4K1RB 2RGFA 2W55A 4W9GA 2XBBC 4NJ7A 3DVGY 1MVKA 4HPPA 3KQ4A 3OJ4B 1N60A 2KLGA 2BBCA 2GRIA 3NVZA 1WGHA 1FXAA 1NDDA 2KK8A 2NPTA 3AI5A 1F1HA 1WE6A 3EHVA 2D07B 2WHIA 1IBXA 2KJ6A 1WJNA 2CKHB 3A9KB 1WWTA 2UYZB 2KFJA 2GMIC 2FCQA 5EE3A 1QF6A 4HROA 2KTRB 2WDVB 1WXVA 1XLNA 1E7UA 4A8XC 4ASWC 5H8YE 2W3SA 1JRPA 4KKIA 1V1OA 3VXWA 2EKEC 2V4LA 3W1YA 3VQIA 1S1QB 4C56C 1VZ6A 4DHZE 1YIWA 3VHTC 1EU3A 1SSNA 2KWVB 2OEDA 4MSMB 3SFEB 1UBIA 3ML8A 1MFWA 2JY6A 4GDKA 3S2AA 4LNOA 2WDQB 1K53A 3ZJTA 2LI5A 2YVCA 1NI3A 2G4DB 3PREA 2FUG1 1GC6A 3H7PA 1I35A 2DAJA 4XYCA 2N9KA 1RFAA 1WGDA 1TYGB 1N61A 1TS3A 2N7DA 2BGFA 3VTWA 4WJNA 4DHJB 3V60A 4JX1C 2CR5A 3V05A 3HHMA 1TJEA 2QC8A 1YJ1A 1JROA 2PE9A 4JQWC 2ZW0A 3M63B 2GOWA 1YJIA 1UH6A 5E6NA 2AL6A 3VR9B 1KJTA 2WLBA 3WA0A 1HZ6A 3QA8A 5BMGA 1YOVB 1X1MA 3TEXA 1KOTA 2W54A 3UF8A 1SIJA 3ZLZA 3OWEB 3TJPA 5FR6A 1L0YB 5DPRA 4OZBA 1RM6C 4HWIB 4ZRIA 1MHXA 4JIOU 4E71A 4AUQC 4US8A 1WZ3A 2QIEB 2BYVE 2JZPA 4NQKE 3HK0A 2AQ2B 4HKZE 3PZ8A 3P42A 2VZKD 1HEZE 4RGNA 4M00A 4I6PA 2MBEA 1V97A 2Z8LA 1ZDXA 1JQ4A 1E0ZA 5D3IB 2L0TA 3IXSA 4NY0A 4IKGA 3A9JA 1NYQA 3L54A 2YEPF 3AE1B 3PPAA 4OZAA 2ZCCA 4NAMA 1FRRA 3NJTA 2KJHB 3H9DA 1OEYJ 2LGIA 1VD2A 4KSKC 4XWWA 2Z0DB 4AQ7A 5KHQA 3DDCB 2K5PA 4ZRKA 3M3JA 2G45B 2FUHB 4ZOHC 1ZP0B 1CJEA 4DK5A 4B9KA 2KMAA 4C80A 4CYEA 2LVQA 4USAA 3RNCC 2L8JA 2KANA 2RPVA 3U8ZA 3U7DA 3O65B 2BF8B 3OG5A 2DZKA 1YX5B 1KH0A 2L3ZA 2JRHA 4IWQA 3RZFA 4ZRJA 3R2TA 4YSYB 3NS8A 4AOFA 1DOYA 2Y3AA 3RZWC 1FFVA 3JSVA 5G5HA 2J53A 2JU6X 4A3OA 1B1ZA 1C4AA 3PSEB 2KX3A 4WJPA 2KD0A 3SR6A 3CF4A 2XEWA 3RYTA 4QAYA 1L6UA 1BT0A 1OTRB 4Q2JA 2LXAA 3MC9A 2PPHA 1L4DB 2I1JA 2WXJA 4KVGB 4OW0A 2D10A 3SD5A 1SJED 3A1QB 3O13A 2L0FA 2XK5A 1EU4A 3RI7C 2BW2A 4P1CC 1WX8A 2I1KA 1FEHA 4MSQB 4PT5A 3AEDB 4PK1A 2BS3B 1WM2A 1OEYA 4GSWA 2Z0EB 2ZJDA 3HRDD 4RM9A 3AECB 4K7SA 1J8CA 1KRHA 3AEEB 4O1NA 2FNJB 2WXHA 2DX5B 2NBUA 1ACCA 4P6VF 1D5XC 4EEWA 4BZAA 3PRZA 2BKFA 4BKSA 1C79A 3ZNGC 1T0QC 4B95A 3UI3A 2OJRA 3V3XA 2IDYA 2ZZPB 3PZ7A 3GE8C 2GBKA 4OZCA 2V4IB 4KKJA 1J7BA 2L32A 4MEMA 2AQ3B 4MELA 3UIOB 1K50A 1H7XA 4K7WA 3ZW3A 3I9V1 4MGIE 1P7FA 1C3TA 4HLEA 1BMLC 3FILB 3UGBB 2M4NA 2BYFA 2DZJA 3Q8BA 4DDID 5EDSA 2M8SA 3VR8B 4MT5A 1UGMA 3RNEC 3AEBB 1VLBA 4LJPB 5AZHA 1FNUA 1E6EB 2KWDA 1RFKA 2WXMA 4TMAB 3DHGC 3GS2A 5HI1A 4PYUA 1WF9A 3AE6B 1CK1A 1JWUD 2RDBC 3AM9A 3ZRFA 1Z2MA 3N20C 2ON8A 5BYSA 4ICUA 4G3XB 5TSSA 3OLMD 3DPDA 1UNSA 2JPHA 2KDIA 5T8IA 2LGSA 3Q3JA 2EMSA 4NPNA 2WQYB 3CMMB 3U52E 4E3CA 1NYRA 2LGYA 4TKNA 1F77A 4DWFA 3MC0B 1ZGUB 4RGTA 4FHJA 5FK9C 1J7CA 2ZW1A 3GZNB 5LXIB 3ZNID 1GAQB 3BWUD 4HPLB 4RGMA 1R7SA 2MBBB 1WI0A 2YEPB 5LNK1 3ZXRA 2WXFA 5E6PA 3CSFA 3E9SA 4HDOA 2MBHA 3GP7A 2KQSA 4NQLB 4BOZB 1V1PB 4IWPA 2QILA 4BKSD 3V6CB 4LLGM 4W9HA 1L0VB 3SHQA 3KYCD 4XGAB 1FNWA 3ZGZA 3E56A 2PEAA 2ZNVC 3EC8A 2IGGA 1GB4A 4F7ZA 3WALA 3JVZX 3KUDB 3DHIC 1ZW7A 2L05A 2QEJC 4KDLB 3KWLA 1TS4A 4FA6A 2DZIA 5AZGA 1E8WA 1R4MB 2CS4A 5HHDG 1E9MA 4A55A 3MJWA 3GZNI 3APDA 3WAPA 1R4NB 3TMPB 1VJKA 3B2FA 5I4DA 5CTRC 3P4QB 4CQNA 4LDTD 3RNAC 3NUHB 4PYZA 1VZ7A 3LXFA 3L4PA 3RNBC 2RMMA 4A6QA 1WGGA 2INCC 3DVGX 2A5UA 2PVGC 5EE9A 5CHVC 1UUPA 2NTSA 2KQ4X 1ROEA 2KC1A 2NPTB 3DVNV 4GOCA 3FC4A 2PE6B 1KF6B 4LNNA 4ITKA 3L17A 3NVYA 4MDKE 5GXGB 4ANVA 1IBXB 2KFKB 4LTUA 2BS4B 1Y8RC 2DYBA 1GB1A 4II3B 3R7RA 3DBSA 2G1EA 1JALA 4WWPA 3N32A 5AEKB 1H7WA 4YTNB 2R2OA 2WYQA 4YSZB 2XNAC 2J52A 1R4MI 5C3JB 5IA7A 1R4NI 3GE3C 1DOXA 3EECA 3ZRCA 4YL8A 1ZUD2 2JXTA 5HKHA 1XEEA 3RN9C 2IZVB 3PRPB 1V86A 3RPFC 2V9HA 3AE7B 3Q6BA 2BVCA 3BIID 2KWCA 5DCNA 3KYDD 1AWDA 4C4VA 4WQOB 1WGYA 2HJ8A 1V2YA 1K52A 2HD5B 3EUB2 4BOSC 2KNBA 2V1YA 1UGJA 1N62A 1I4GA 3PLUA 3NZSA 2N9EB 1FMAD 4NJCA 4A90A 1IP9A 1E8ZA 1V5TA 3H7PB 1I42A 2GBJA 1HQRD 2OHFA 3AMZA 5BO4B 3AE2B 4OHJA 5JHAA 3CIRB 2JXXA 2Q5WD 3ECIA 3ML9A 4L1BA 3VTUA 1UF0A 5JZEB 2BWFA 4J3OD 3QWZB 4YTPB 1NBFC 2MEKA 5J18A 2WXNA 2Y5PA 1KTKA 1SXTA 2KFKA 1L6VA 4FULA 2WU5B 1SEBD 3T9LA 1QQRA 2HTHA 3N1YC 2MP2A 1MHHE 3AEGB 4XDCA 1Q10A 4HDQA 2ICIA 1D4BA 1I4RA 2J0KA 3P4RB 1T6BX 4ACFA 5GMVA 4EUTA 3IAS1 1XF5L 1ESFA 3TL5A 4YXDB 4DBGA 1YX6B 3IHPC 2IO3B 3VAWA 2QMTA 4YTMB 4DXGA 2LJIA 2REXA 1WMHA 4LNKA 2JYTA 4N59A 3L13A 2VH1A 4XE0A 1Y56A 1FNVA 1YN5A 3NG0A 2IO0B 2LHEA 2BB5A 4GDLA 4ZHPA 1ZXIA 2WP9B 1E5WA 4ZRQA 1K8RB 1GUAB 2BT6A 3A9JB 2DWQA 3TUOA 3NVVA 2ONQA 1EO6A 3W5UB 1JRUA 4OVUA 1TZOA 4BKTA 1F0ZA 1E8YA 3APCA 4W9KA 2AEHA 4CHKA 1UWMA 2K8BA 4S0RA 3PZDA 4ICVA 1KLVA 4H2AA 4K3BA 3ZDMC 4TQ1A 1DYQA 2KKCA 1P1AA 2VH2A 2D11A 4G11A 3GB1A 2CJNA 3DWGC 3UQBA 4G0NB 3R8BA 4IG7B 4NJ6A 4W9CA 1ZDVA 1MPEA 2OJWA 2INPE 1TGZB 3JSVB 2L7RA 4DQOC 3P1MA 5D94A 2KDBA 4A9AA 4RFBA 4XC2A 5BMIA 1OQRA 3BK1A 5G5GA 4KGRA 2KX0A 1TIFA 2PVOD 4RMAA 1U4AA 2WXLA 2W9NA 3PTFC 1P9DU 3Q8CA 4WJQA 2V3PA 4MM3A 3B9JA 3KLSX 2LRWA 2JZZA 2KLCA 4HJKA 2WGSA 1XT9B 4C7ZA 2JWUA 3ZJVA 2L00B 4CO7A 2WDTB 1HE8A 2N7EA 1WE7A 1XLQA 5DPWA 1PQSA 4XZ4A 2MH7A 1L2NA 2XK5B 2G4SA 4TUUA 3QJZA 5JH5C 3T3NA 3WAOA 3PRMB 5CHFA 2CHWA 4FXCA 5DPSA 3DBRI 3PVLA 3TEZA 4JWSC 4TQ0A 2KYWA 2BPSA 2IYDB 4A3PA 3U4EG 4KIKA 3H6NA 1D5MC 1FD6A 2LJ5A 1SGHA 1MG8A 1QT9A 1K51A 4HXDA 3PHXB 5H92C 2WXGA 1ZOYB 3RNFC 4IM0A 5BYRA 1MI0A 3R2IA 1YD8U 4JLCA 1CMXB 3ALBA 4TV3A 4S17A 2WS3B 4FHKA 4L23A 3WANA 4DHZB 1NENB 2QSDA 1WY8A 1TBEA 2IY1B 1IGCA 2ACZB 1V9JA 3DQVA 2HDEA 2Y5CA 2CJOA 2BQQA 3MHZA 1TY2A 3IT6B 5CHWA 1WXMA 3NVWA 2JT4B 2BKRB 2N9LA 3P63A 2G9HD 3FAHA 1UELA 2MJDA 2C7HA 4NNJB 2D3AA 4KSLC 5J2RA 4LDTB 4KX6B 4HK2A 3MFGA 2BTEA 3ZIMA 2AQ1B 3RFZB 2GLSA 3U7ZA 4BBNC 3DHHC 3RNGC 4C00A 3HM6X 3WAMA 2KMMA 3N9YC 1RYJA 2JSVX 3Q8FA 5L83A 3AV8A 1UWXA 2N9XA 4J6IA 1OQQA 2D3CA 2QJLA 4I6NB 2DYOA 3CWIA 2M0XA 4LNIA 4JE3B 2JZ3B 2KHWB 4L2YA 1XD3B 3N1ZC 3MP9A 5D6JB 4N9F4 2KMCA 2KVRA 1ZXHA 1Q5WB 3LYYA 4MGZE 1YJJA 3I5JC 2VRRB 2OOBB 4A20A 3EFUA 3ZUNA 3VFKA 3A4RA 2MW5A 5JHBA 1A5RA 1J19A 4RGOS 1Q0WB 4HEA1 1Z5SB 1P98A 3ZO5B 4KV2A 1FPYA 1VR9A 4ANXA 3ENEA 3V6EB 2PTLA 3I63C 2RR9A 2RSUA 2R61A 2BS2B 3T8MA 3A33B 3IT4B 2KN5A 2KDFB 3ZNHB 3ZTCA 3M62B 4F1SA 1PYWD 2JYEA 3B0AA 1OFFA 1PGBA 4DXAB 3RT3B 2X8XX 3QX1A 4M0WA 1SIFA 3VDZA 1I7HA 4W9EA 1HZ5A 1EWYC 3ZNZB 1OGWA 1TKGA 4II2B 4PS3A 3P2BA 1HA5A 4LJOB 1ET9A 2FIFA 1D5ZC 2AL3A 3C19A 1AN8A 2BWES 5TR5A 3HM3A 1KM7A 4WAFA 2K6DB 5IO9A 3MHSD 3KVFB 4GB9A 2LRUA 3TCAA 3LDZE 3SFDB 3NY5A 4EKUA 1QOAA 4IM2A 4W9FA 2JRIB 1FCCC 1EF1A 3ABVB 3ZTDA 2LMCA 4ARIA 1BUIC 5CX3A 2WXKA 3TBLD 3LB8C 2MX2A 2V3SA 2QDFA 2O6VA 1GOZA 2E6XA 2L83A 4GU2A 2J42A 1F9JA 3L10B 2AYOB 1FXTB 2DAFA 4N6EB 1UZXB 3IAM1 3KH0A 3AEAB 3FKYA 3C0RB 2JWZA 5AUKA 3ETRA 1GJZA 1RWSA 3PS6A 2JF5A 4C4VB 2ZPNA 1ISNA 3AB5A 4F8CB 2KDMA 4WIPA 3I57A 3QARA 2NBWB 1QZEA 4ZYNA 1FFUA 2C60A 1C4CA 1WJ4A 5MPOA 2MBQA 1WH3A 4BKGA 1F2RI 4WURA 3RULA 4ZYSA 1WSPA 3I3TB 5D7GA 3QCAA 1PDXA 2KXJA 3GOEA 4K3CA 3TEWA 2NBVB 2M0AA 1T0RC 1WJUA 2O2VA 3UINB 2ZPYA 3KWVA 1FXIA 1CZPA 3W1SA 4WWOA 5AUIA 4HKQA 1SJHD 4GLSC 3QAQA 2FE8A 3VVWB 1QILA 5AZFA 4MGKE 1AW7A 2C5LC 2EMTA 2FBWB 3BK2A 5LLIA 1TTNA 1VRAB 4DXFA 2MP2B 1WZ0A 2CHXA 2PW9A 3UQAA 3Q8AA 1XCTL 4WQMA 1YQ4B 4GIVA 1JWSD 2B3AA 3AE4B 3AU5A 2HJ1A 1T0YA 3MTNB 2K8HA 1XXGA 1L4ZB 2ZVNA 4AWJA 1TZ1A 5BMHA 4M8NA 2IGHA 4M02A 2O6VD 1E7PB 1F2RC 1WMHB 2ASQA 2BYEA 4IOIE 2LD9A 3Q8EA 1V8CA 1XCQL 2NR2A 4EOYA 5IN7A 3QHTA 4GDLB 3R7QA 3SU8X 3JYUA 4KGTA 1VDVA 3AXCA 4EZJA 1WIAA 3Q2AC 4I6LB 4JGHB 4KGSA 4AJYB 3QQ8B 2K3UA 3DOWA 2RPQA 3VUWA 2KDEB 2M19A 2WX1A 4RCOA 3TIXA 2MA9B 2D3BA 4E74A 2N1VA 2CU3A 5D3DA 5HG2A 1DOIA 1PGXA 3ZJUA 4WJOA 4FJVB 1HTQA 2LVOA 5DPTA 1BXTA 4NAWA 4MH0E 2WDRB 3R3MA 3SEBA 1D3ZA 4FLHA 2CU1A 1PFDA 1N5WA 2LUMA 1RRBA 4K7UA 2A4ZA 2KVZA 3QIJA 1WYWB 2N9PC 1IGDA 4AS1A 2D3GA 1I4HA 2B76B 3NS1A 2LUEA 2D5GA 3VUYA 2LVPA 1EM7A 2JVCA 4B0MA 1KLGD 3TEYA 2I2YA 2W3RA 4B0EA 3ZQ4A 3UIPB 4EZLA 2PLPA 3EFCA 3KW5B 3W2DA 4TSSA 5BYQA 3PLVA 3DBHI 4MM3B 1LXDA 3H7SA 1XQQA 1AYFA 4ZHOA 1V49A 4HPMB 1M94A 3BVMA 3N1XC 3DCGA 4MJSA 1QLBB 4RM8A 3AULA 3HVDA 4LNFA 3AE9B 4PS8A 2N1WA 3AE3B 2WXIA 2J4XA 2YLMA 2IY0B 3RUIB 3C8YA 1I4PA 1LQBA 3BYYB 4D2KA 3HIZA 2K8CA 1HXYD 1A70A 4GGQA 3H1UA 1NEKB 2PMVA 1H4RA 2MHJA 1T0SC 2DZMA 2IPKD 4KIKB 3W9CB 4IM3A 1WXAA 2IBIB 3CSTA 3VUXA 1TT5B 5L95C 4BVUC 3U30A 4JL9A 1JCKB 2LWPA 4W9DA 2LHDA 1SE3A 4XDDA 3BZDB 2WWZA 2SAKA 3DBRB 1YMHE 3ZKJC 1KLUD 2KQ7A 2INDC 3Q3FA 2LASA 1SBBB 3PO0A 1C77A 3U2SC 2KTFA 3VH4B 4M8MA 2JX5A 3A9KA 2L1AA 3QK0A 3N30A 4EE2A 1WXSA 4HCPB 2IGDA 2LGXA 2NCNA 1VCBA 5IOIA 2KTRA 1GG3A 2IO1B 1E7VA 1J0GA 4JPSA 3P4SB 4FJYA 1YQBA 1QOGA 2V3NA 4BFRA 2RDHA 2NTTA 1FM0D 2JUOA 3MC8A 4ARCA 2G3QB 2M17A 5LXHA 2K0PA 1E90A 5FR3A 3BVGA 3QC8B 1WJ6A 5D2MB 2KWUB 4JWUC 3JW0X 3HVZA 2DYMA 3RCZA
chains in the Genus database with same CATH topology
1JWBD 1VJKA 3B2FA 1TKEA 1ZXHA 5I4DA 1WWTA 3P4QB 3LYYA 4CQNA 1YJJA 3NUHB 5EE3A 1QF6A 1VZ7A 3LXFA 3L4PA 4RGOS 3DWMA 1DGJA 2RMMA 2WDVB 4HEA1 4HROA 4A6QA 2PVGC 1XLNA 5EE9A 1TKYA 4A8XC 2MJEA 1VR9A 1UUPA 2NTSA 2KQ4X 1ROEA 2W3SA 1JRPA 3VRBB 1ENFA 1V1OA 1QOFA 4KKIA 5H8YE 2PTLA 3FC4A 3VQIA 1TS2A 4OVZA 1KF6B 4C56C 2R61A 2BS2B 2KN4A 1VZ6A 3IT4B 4YSXB 4ITKA 3NVYA 1TS5A 4HRSA 1PYWD 1EU3A 5E6JA 5GXGB 1SSNA 2BYTA 2JYEA 2N7JA 1OFFA 4N58A 1IBXB 1FRDA 2OEDA 4LTUA 3WCQA 2BS4B 3SFEB 1ZE3D 1GB1A 3BYTB 1PGBA 2G1EA 2WDQB 1K53A 4M0WA 1JALA 3ZJTA 1I7HA 1H7WA 1HZ5A 4YTNB 1EWYC 4YSZB 1TKGA 2XNAC 2J52A 1NI3A 2WXRA 1WYGA 1JW9D 2FUG1 5C3JB 1HA5A 1C78A 2N9KA 1CQVA 4YT0B 1DOXA 1ET9A 1T5XD 1TYGB 1N61A 1TS3A 2IJ0A 1ZUD2 1D5ZC 1XO3A 2JXTA 1AN8A 1XEEA 2LEKA 3RPFC 3AE7B 4JX1C 4WAFA 3V05A 5C2TB 3BIID 4IDIA 1AWDA 1TJEA 1B9RA 3SFDB 1QOAA 1JROA 3T3OA 1ET6A 1K52A 1FCCC 3ABVB 2ZW0A 3EUB2 2LMCA 1GT8A 1YJIA 4ARIA 3VR9B 1UGJA 1N62A 1SF0A 1I4GA 1BUIC 2WLBA 1N63A 2WXKA 1FMAD 4NJCA 3LB8C 4A90A 1HZ6A 5BMGA 4P16A 3TEXA 4MH8A 1GOZA 1GTEA 2E6XA 1HQRD 2L83A 2NMQA 2OHFA 2SEBD 2W54A 5FKAC 3AMZA 4REZA 2J42A 3AN1A 1SIJA 3AE2B 2EELA 2W82A 4OHJA 3CIRB 2DBYA 2N0SB 2Q5WD 3OWEB 4L1BA 4N6EB 1L0YB 5HFYA 3IAM1 3AEAB 1WGKA 4OZBA 1RM6C 3AE8B 4J3OD 5AUKA 2JQRB 3ETRA 4YTPB 4R3DA 1RWSA 1J7AA 2MJ3A 1MHXA 4RF1A 2E3TA 2MEKA 3AB5A 2WXNA 2Y5PA 1KTKA 2KDMA 4WIPA 4US8A 1D6EC 2QIEB 1SXTA 3I57A 1JWAD 2JZPA 5EE1A 1L6VA 2AQ2B 4HKZE 3PZ8A 3P42A 2VZKD 1HEZE 2WU5B 4RGNA 1SEBD 2H89B 1FFUA 1QQRA 1V97A 2Z8LA 1C4CA 1ZDXA 3B2GA 5MPOA 1NVID 2K9XA 1JQ4A 1F2RI 4WURA 1MHHE 5D3IB 1E0ZA 3AEGB 2PKOA 3IXSA 1Q10A 4IKGA 2ICIA 1NYQA 1I4RA 4XDCA 1D4BA 2YEPF 5EE0A 4ZYSA 3P4RB 1WSPA 3AE1B 3TSSA 1I4XA 1T6BX 3HUIA 5D7GA 1PDXA 4OZAA 3IAS1 4NAMA 1FRRA 1XF5L 1ESFA 1SB3C 2XN9C 3TEWA 4YXDB 2M0AA 4RH6A 2LGIA 2HTME 2QMTA 4YTMB 3AEFB 3BVZA 3KWVA 1IUEA 1FXIA 4DXGA 4XWWA 1CZPA 4AQ7A 1L5PA 3W1SA 2BB6A 1FO4A 1FCLA 2LJIA 2K5PA 2JYTA 4N59A 4XWTA 5AUIA 4XE0A 1Y56A 4HKQA 4ZOHC 1ZP0B 1CJEA 1SJHD 4GLSC 2X38A 1FNVA 4C80A 1YN5A 2FE8A 1QILA 2LHEA 2BB5A 4ZHPA 3EGRA 1AW7A 1I4QA 4USAA 2FBWB 1ZXIA 3BK2A 1YQ3B 2WP9B 2RPVA 1VRAB 4ZRQA 4DXFA 2LFIA 2PW9A 2BT6A 3Q8AA 2DWQA 1XCTL 4WWMA 1KH0A 3NVVA 2ONQA 4WQMA 3TUOA 1YQ4B 1JWSD 3R2TA 2AX5A 3W5UB 2V0GA 4YSYB 3AE4B 4C7YA 1TZOA 1F0ZA 1DOYA 2Y3AA 1FFVA 1XXGA 5G5HA 1UWMA 2J53A 2JU6X 1LO5D 1GPXA 1B1ZA 1L4ZB 1C4AA 2EKIA 5BMHA 1E10A 4ZRPA 3SR6A 2IGHA 1E7PB 3CF4A 1F2RC 2DLBA 4H2AA 3MJ5A 4IOIE 4TQ1A 1DYQA 1L6UA 2INNE 1V8CA 3Q8EA 4Q2JA 1XCQL 1L4DB 4GDLB 3GB1A 2CJNA 2WXJA 4LK0M 3DWGC 4KGTA 3R8BA 1VDVA 4OW0A 1ZDVA 1SJED 4KGSA 3O13A 1MPEA 4WH4A 1EU4A 2INPE 1PUTA 2BW2A 1T3QA 2K3UA 2M19A 4DQOC 1FEHA 3P1MA 3AE5B 4A9AA 4RFBA 4PT5A 4RCOA 3AEDB 5BMIA 2BS3B 1OQRA 3BK1A 1M4VA 3W5VB 1YN3A 4KGRA 5G5GA 2CU3A 3HRDD 5D3DA 5HG2A 2PVOD 3AECB 1DOIA 3FILA 1PGXA 3ZJUA 2WXLA 1XLPA 3NZ3A 1KRHA 2GI9A 3URYA 3AEEB 3Q8CA 2V3PA 4O1NA 2WNMA 2WXHA 1BXTA 2H88B 2WDRB 3B9JA 3SEBA 3KLSX 2WXOA 1PFDA 1ACCA 1GTHA 4P6VF 1D5XC 1N5WA 2LUMA 4C7ZA 2JWUA 1P7EA 1VZ8A 3ZJVA 1C79A 1PGAA 1IGDA 2WU2B 1QKZA 3UI3A 4AS1A 1XLQA 1I4HA 3V3XA 2TSSA 2B76B 2MH7A 3NS1A 2IDYA 2D5GA 1N5XA 3PZ7A 4OZCA 2V4IB 4KKJA 4RF0A 1J7BA 1EM7A 2L32A 2AQ3B 3T3NA 1K50A 1WXQA 1H7XA 4B0MA 4FXCA 1KLGD 3TEYA 2I2YA 2GB1A 2W3RA 4B0EA 3ZQ4A 3I9V1 3TEZA 1P7FA 4JWSC 4TQ0A 5JXVA 2PLPA 1BMLC 3FILB 4RNAA 3W2DA 1ZPSA 3U4EG 1D5MC 2M56B 3Q8BA 4TSSA 3EA6A 5BYQA 4MM3B 1FD6A 3H8HA 3VR8B 4NAWB 3VRAB 4MT5A 1AYFA 4ZHOA 2KAJA 1QT9A 1K51A 1FIQA 1KFYB 3BVMA 3AEBB 2L52A 1QLBB 1VLBA 5H92C 2WXGA 1ZOYB 1EWCA 2KACA 1MI0A 5BYRA 3P4PB 3HVDA 3R2IA 1FNUA 1E6EB 1YN4A 3AE9B 1RFKA 2KWDA 2WXMA 1JMLA 3AE3B 4TMAB 1SE4A 4US9A 3GS2A 2WXIA 5HI1A 2RDGA 2WS3B 1JWMD 2J4XA 2WXQA 4L23A 3AE6B 1C4PA 1NENB 1CK1A 2QSDA 1I4PA 1JWUD 2PIAA 3C8YA 3AM9A 4UDUC 3BYYB 1TY0A 3J9CA 4D2KA 2ON8A 1IGCA 2ACZB 5BYSA 1WRIA 1HXYD 1A70A 1V1PA 3NRZA 1NEKB 2PMVA 1STEA 5TSSA 1UNSA 2HDEA 5T8IA 2Y5CA 3ZYYX 2CJOA 2IPKD 1XLOA 2WQYB 3MHZA 3U52E 3W9CB 1NYRA 1TY2A 3IT6B 1YNTE 3NVWA 1F77A 1SE2A 3MC0B 2N9LA 3P63A 4HJGE 4RGTA 5FK9C 1J7CA 2ZW1A 2G9HD 3FAHA 1JCKB 1GAQB 2MJDA 3BWUD 2K22A 2LHDA 2VZKB 1SE3A 4XDDA 2I38A 4MACA 1L0XB 3BZDB 4RGMA 1R7SA 1C9FA 4NZLB 4KX6B 2WXPA 3MFGA 2SAKA 2BTEA 1YMHE 2AQ1B 4YWGG 1KLUD 3RFZB 3Q69A 3AH7A 1SBBB 3PO0A 1C77A 2YEPB 5LNK1 3U7ZA 3U2SC 2WXFA 1QOBA 1C76A 3E9SA 4GDKB 3GP7A 2JX5A 1V1PB 2L1AA 2QILA 4EE2A 2IGDA 2W55A 2KMMA 3N9YC 1RYJA 2JSVX 4LLGM 1MVKA 3Q8FA 1L0VB 3KQ4A 1N60A 1FNWA 2BBCA 3ZGZA 2GRIA 3AV8A 3NVZA 1UWXA 3E56A 2IGGA 1GB4A 1FXAA 1OQQA 4JPSA 3P4SB 2QJLA 1QOGA 2V3NA 2RDHA 2DYOA 3CWIA 2NTTA 1FM0D 4ARCA 2QEJC 4JE3B 1TS4A 3KWLA 2K0PA 5FR3A 4L2YA 3BVGA 4JWUC 5HHDG 1E9MA 4A55A 3HVZA 3MP9A 2DYMA 1IBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTE A;  1FIQ A;  2L83 A;  3SR6 A;  1JWB D;  1KFY B;  2OHF A;  2W54 A;  3AEB B;  2L52 A;  1E7P B;  3CF4 A;  3AMZ A;  1QLB B;  1VJK A;  3B2F A;  1VLB A;  1TKE A;  3AN1 A;  5H92 C;  1ZOY B;  1SIJ A;  1WWT A;  3P4Q B;  3AE2 B;  3P4P B;  3CIR B;  2DBY A;  1E6E B;  2N0S B;  3AE9 B;  1RFK A;  2Q5W D;  3AE3 B;  1YJJ A;  4US9 A;  4N6E B;  2WS3 B;  1L6U A;  1V8C A;  3AE6 B;  3AEA B;  5EE3 A;  1NEN B;  1QF6 A;  2PIA A;  1WGK A;  3AM9 A;  3LXF A;  3L4P A;  1RM6 C;  3AE8 B;  3DWM A;  1DGJ A;  4HRO A;  2WDV B;  5AUK A;  2JQR B;  3ETR A;  4YTP B;  2ACZ B;  2CJN A;  1RWS A;  2PVG C;  1XLN A;  1J7A A;  1TKY A;  1WRI A;  2MJ3 A;  3DWG C;  5EE9 A;  1A70 A;  2MJE A;  1VDV A;  2E3T A;  3AB5 A;  3NRZ A;  1NEK B;  4US8 A;  1ROE A;  2QIE B;  1JRP A;  3VRB B;  2W3S A;  5H8Y E;  1QOF A;  3FC4 A;  1JWA D;  5EE1 A;  2Y5C A;  3ZYY X;  1L6V A;  1KF6 B;  2CJO A;  1XLO A;  2WQY B;  2WU5 B;  3W9C B;  1NYR A;  2BS2 B;  1PUT A;  4YSX B;  3NVW A;  2H89 B;  1FFU A;  4ITK A;  3NVY A;  1T3Q A;  1V97 A;  4HRS A;  3P63 A;  2M19 A;  3B2G A;  1J7C A;  1NVI D;  5MPO A;  3P1M A;  2K9X A;  3AE5 B;  3FAH A;  5GXG B;  4A9A A;  1GAQ B;  1E0Z A;  2MJD A;  1JQ4 A;  2K22 A;  3AED B;  3AEG B;  2BS3 B;  1OFF A;  1OQR A;  2PKO A;  1NYQ A;  1FRD A;  4N58 A;  4LTU A;  5EE0 A;  5G5G A;  3W5V B;  3WCQ A;  2BS4 B;  3P4R B;  3SFE B;  2CU3 A;  3HRD D;  2PVO D;  3AE1 B;  3AEC B;  1DOI A;  1R7S A;  4KX6 B;  3HUI A;  1XLP A;  2G1E A;  1PDX A;  1KRH A;  2WDQ B;  3AEE B;  1JAL A;  1FRR A;  1SB3 C;  1I7H A;  2H88 B;  1H7W A;  4YXD B;  2WDR B;  4YTN B;  1EWY C;  4YSZ B;  1TKG A;  3AH7 A;  3B9J A;  3PO0 A;  1NI3 A;  1WYG A;  1JW9 D;  1PFD A;  1GTH A;  5C3J B;  4P6V F;  1QOB A;  2HTM E;  4YTM B;  3AEF B;  1N5W A;  1IUE A;  1FXI A;  2JX5 A;  4C7Z A;  1CZP A;  4YT0 B;  1L5P A;  1DOX A;  1FO4 A;  1TYG B;  1N61 A;  2K5P A;  1ZUD 2;  1XO3 A;  4N59 A;  2W55 A;  2WU2 B;  2KMM A;  5AUI A;  1XLQ A;  1RYJ A;  2LEK A;  4ZOH C;  1ZP0 B;  2B76 B;  1CJE A;  2MH7 A;  3RPF C;  1L0V B;  3AE7 B;  3NS1 A;  4JX1 C;  1N60 A;  5C2T B;  4C80 A;  3BII D;  4IDI A;  1N5X A;  3AV8 A;  3NVZ A;  1AWD A;  4ZHP A;  4USA A;  1TJE A;  1B9R A;  1J7B A;  2FBW B;  1ZXI A;  3SFD B;  1YQ3 B;  2WP9 B;  1QOA A;  1FXA A;  1H7X A;  1OQQ A;  1WXQ A;  1JRO A;  2BT6 A;  4FXC A;  3P4S B;  2QJL A;  2W3R A;  1QOG A;  3ABV B;  3EUB 2;  4JWS C;  2DWQ A;  4WWM A;  4WQM A;  1GT8 A;  1YJI A;  3NVV A;  1YQ4 B;  3CWI A;  2AX5 A;  3VR9 B;  1FM0 D;  4YSY B;  3AE4 B;  1N62 A;  3W5U B;  1SF0 A;  4C7Y A;  2M56 B;  1F0Z A;  2WLB A;  1DOY A;  1N63 A;  3KWL A;  1FFV A;  5G5H A;  3VR8 B;  1FMA D;  3VRA B;  1UWM A;  3LB8 C;  1GPX A;  1AYF A;  4ZHO A;  4JWU C;  1E10 A;  2EKI A;  1E9M A;  2KAJ A;  3HVZ A;  1QT9 A; 
#chains in the Genus database with same CATH topology
 1JWB D;  4OVV A;  3PT2 B;  1TKE A;  3IG3 A;  4AP4 C;  3V61 A;  1AAR A;  4G50 A;  3K9P B;  1LGR A;  2N4F A;  1HTO A;  4PS7 A;  2J7Q B;  3DWM A;  1DGJ A;  1TKY A;  1V5O A;  2MJE A;  3WIM A;  4URK A;  3VRB B;  1ENF A;  5G55 A;  1QOF A;  1F52 A;  3R66 C;  1TS2 A;  4M01 A;  4OVZ A;  4B6W A;  2MRP A;  1Q1O A;  2KN4 A;  4YSX B;  1TS5 A;  4HRS A;  5E6J A;  3ZVV A;  4HVB A;  1GC7 A;  2BYT A;  2Z59 B;  1V80 A;  2N7J A;  4N58 A;  3CF6 E;  1FRD A;  2FCS A;  3WCQ A;  2RD0 A;  1ZE3 D;  4IW0 A;  2ZVO A;  5C23 A;  3BYT B;  5C1Z A;  1P3Q U;  2NS5 A;  5G2N A;  1RLF A;  5IAA C;  3NOB A;  4KZ0 A;  2Y5B B;  3X23 A;  2KJR A;  2WXR A;  1WYG A;  1JW9 D;  1WM3 A;  1C78 A;  1CQV A;  4YT0 B;  1T5X D;  2IJ0 A;  1XO3 A;  3RD2 A;  2MCN B;  2MSE D;  2LEK A;  1GNU A;  2AWT A;  5C2T B;  4IDI A;  1B9R A;  3ZDT A;  4AJW A;  3T3O A;  1ET6 A;  1ZKH A;  1GT8 A;  3ZXV A;  1SF0 A;  2L76 A;  2LXC A;  1N63 A;  2GBR A;  2J0J A;  4M0W B;  2KOX A;  3APF A;  3M95 A;  4P16 A;  4MH8 A;  1GTE A;  2SEB D;  3BIN A;  2NMQ A;  5FKA C;  4REZ A;  3AN1 A;  1G6J A;  2EEL A;  2W82 A;  5IP4 D;  2DBY A;  2MBO A;  1C1Y B;  2N0S B;  1OQY A;  5E6O A;  5HFY A;  1WGK A;  3AE8 B;  4W9L A;  1WRD B;  2JQR B;  4R3D A;  1J7A A;  2MJ3 A;  4RF1 A;  2E3T A;  3LJ3 A;  3NZU A;  1D6E C;  2ZNV B;  1JWA D;  5EE1 A;  2CHZ A;  3OAW A;  4DHJ D;  2LGD A;  1WX9 A;  1LM8 B;  4XX5 A;  4ZDV A;  2H89 B;  3X0W A;  1L7Y A;  2R2Q A;  3B2G A;  1NVI D;  2K9X A;  2O6V B;  2PKO A;  5EE0 A;  3TSS A;  1I4X A;  3HUI A;  2DNF A;  1RAX A;  1SB3 C;  2XN9 C;  2NVU I;  2WX0 A;  4RH6 A;  3L16 A;  2HTM E;  3AEF B;  3BVZ A;  1IUE A;  1L5P A;  2BB6 A;  1FO4 A;  1FCL A;  1UD7 A;  2K25 A;  2QCZ A;  3VTV A;  2MWS B;  4XWT A;  2C9W B;  2X38 A;  3EGR A;  1I4Q A;  2PJH A;  1YQ3 B;  1V6E A;  2LFI A;  1H8C A;  3IFW B;  4GN1 A;  4WWM A;  4IC7 B;  3A1Q A;  2AX5 A;  2FCM A;  2V0G A;  4C7Y A;  3DBL B;  2C7N B;  1LO5 D;  4X57 B;  1GPX A;  2ZEQ A;  1E10 A;  2EKI A;  2J0M A;  3L0W B;  4ZRP A;  4FJZ A;  2O2V B;  2K6Q A;  3NHE B;  4ANU A;  5KHO A;  2FCN A;  2DLB A;  2KC2 A;  3IBE A;  2QHO A;  3MJ5 A;  3D32 A;  2INN E;  2MQJ A;  3OJ3 A;  4LK0 M;  3N3K B;  4EFO A;  4IUM B;  3VH3 B;  3Q3O C;  5IKC M;  4WH4 A;  4MGY E;  1P0R A;  1PUT A;  3K9O B;  3B1L X;  1T3Q A;  4K81 A;  3AE5 B;  1MJD A;  1M4V A;  3W5V B;  1V81 A;  1YN3 A;  3BY4 B;  1SE9 A;  3FIL A;  4HCN B;  1XLP A;  3NZ3 A;  3URY A;  2GI9 A;  2WNM A;  3DBL I;  2H88 B;  1WR6 E;  1S3S G;  2WXO A;  1WFY A;  1GTH A;  4FN2 A;  4DDG D;  2ZCB A;  1P7E A;  1VZ8 A;  1WR1 A;  3KUZ A;  4BAX A;  3L08 A;  1PGA A;  1QKZ A;  2WU2 B;  2TSS A;  4WAA A;  4IWO A;  3Q14 C;  1N6Z A;  3SDL C;  2FAZ A;  2UWQ A;  3RMK C;  1N5X A;  3PV1 A;  4RF0 A;  4WWN A;  1UBQ A;  2KO3 A;  1WXQ A;  3A4S C;  3Q3M C;  3PGE A;  2UU7 A;  2FID A;  2GB1 A;  4P7I A;  5JXV A;  4EZK A;  4KZC A;  4RNA A;  2GBM A;  1ZPS A;  2M56 B;  4KDI C;  3EA6 A;  2DHZ A;  1WX7 A;  1IPG A;  3H8H A;  4NAW B;  4BBN F;  3VRA B;  3PHW B;  1NI2 A;  2KAJ A;  4GXB A;  1FIQ A;  1KFY B;  2L52 A;  1EWC A;  5J17 A;  2KAC A;  3Q3N C;  3P4P B;  1YN4 A;  4FBJ B;  1JML A;  1SE4 A;  4US9 A;  1WGR A;  2RDG A;  3IVF A;  1JWM D;  2WXQ A;  2LZ6 A;  1C4P A;  2PIA A;  4UDU C;  1TY0 A;  3J9C A;  1EUV B;  2DEN B;  3DVN U;  1WRI A;  3AU4 A;  2IO2 B;  1V1P A;  3NRZ A;  3V62 A;  1STE A;  3KUC B;  3ZYY X;  2KZR A;  3W1S C;  1XLO A;  1MG4 A;  2C7M B;  2K1F A;  4W9J A;  1E8X A;  1YNT E;  1EF5 A;  1SE2 A;  4HJG E;  4LCD E;  3ONS A;  4GMV A;  2K22 A;  4P1B C;  2GBN A;  2VZK B;  4MJS B;  1LFD A;  2I38 A;  4MAC A;  1L0X B;  1C9F A;  4NZL B;  2HE7 A;  2WXP A;  2K39 A;  4YWG G;  3Q69 A;  1IYF A;  3B08 A;  3AH7 A;  4ANW A;  4FAD A;  2D2Q A;  2MLB A;  2KT7 A;  3DBH B;  1QOB A;  1C76 A;  2M1M A;  4GDK B;  4W9I A;  4K1R B;  2RGF A;  2W55 A;  4W9G A;  2XBB C;  4NJ7 A;  3DVG Y;  1MVK A;  4HPP A;  3KQ4 A;  3OJ4 B;  1N60 A;  2KLG A;  2BBC A;  2GRI A;  3NVZ A;  1WGH A;  1FXA A;  1NDD A;  2KK8 A;  2NPT A;  3AI5 A;  1F1H A;  1WE6 A;  3EHV A;  2D07 B;  2WHI A;  1IBX A;  2KJ6 A;  1WJN A;  2CKH B;  3A9K B;  1WWT A;  2UYZ B;  2KFJ A;  2GMI C;  2FCQ A;  5EE3 A;  1QF6 A;  4HRO A;  2KTR B;  2WDV B;  1WXV A;  1XLN A;  1E7U A;  4A8X C;  4ASW C;  5H8Y E;  2W3S A;  1JRP A;  4KKI A;  1V1O A;  3VXW A;  2EKE C;  2V4L A;  3W1Y A;  3VQI A;  1S1Q B;  4C56 C;  1VZ6 A;  4DHZ E;  1YIW A;  3VHT C;  1EU3 A;  1SSN A;  2KWV B;  2OED A;  4MSM B;  3SFE B;  1UBI A;  3ML8 A;  1MFW A;  2JY6 A;  4GDK A;  3S2A A;  4LNO A;  2WDQ B;  1K53 A;  3ZJT A;  2LI5 A;  2YVC A;  1NI3 A;  2G4D B;  3PRE A;  2FUG 1;  1GC6 A;  3H7P A;  1I35 A;  2DAJ A;  4XYC A;  2N9K A;  1RFA A;  1WGD A;  1TYG B;  1N61 A;  1TS3 A;  2N7D A;  2BGF A;  3VTW A;  4WJN A;  4DHJ B;  3V60 A;  4JX1 C;  2CR5 A;  3V05 A;  3HHM A;  1TJE A;  2QC8 A;  1YJ1 A;  1JRO A;  2PE9 A;  4JQW C;  2ZW0 A;  3M63 B;  2GOW A;  1YJI A;  1UH6 A;  5E6N A;  2AL6 A;  3VR9 B;  1KJT A;  2WLB A;  3WA0 A;  1HZ6 A;  3QA8 A;  5BMG A;  1YOV B;  1X1M A;  3TEX A;  1KOT A;  2W54 A;  3UF8 A;  1SIJ A;  3ZLZ A;  3OWE B;  3TJP A;  5FR6 A;  1L0Y B;  5DPR A;  4OZB A;  1RM6 C;  4HWI B;  4ZRI A;  1MHX A;  4JIO U;  4E71 A;  4AUQ C;  4US8 A;  1WZ3 A;  2QIE B;  2BYV E;  2JZP A;  4NQK E;  3HK0 A;  2AQ2 B;  4HKZ E;  3PZ8 A;  3P42 A;  2VZK D;  1HEZ E;  4RGN A;  4M00 A;  4I6P A;  2MBE A;  1V97 A;  2Z8L A;  1ZDX A;  1JQ4 A;  1E0Z A;  5D3I B;  2L0T A;  3IXS A;  4NY0 A;  4IKG A;  3A9J A;  1NYQ A;  3L54 A;  2YEP F;  3AE1 B;  3PPA A;  4OZA A;  2ZCC A;  4NAM A;  1FRR A;  3NJT A;  2KJH B;  3H9D A;  1OEY J;  2LGI A;  1VD2 A;  4KSK C;  4XWW A;  2Z0D B;  4AQ7 A;  5KHQ A;  3DDC B;  2K5P A;  4ZRK A;  3M3J A;  2G45 B;  2FUH B;  4ZOH C;  1ZP0 B;  1CJE A;  4DK5 A;  4B9K A;  2KMA A;  4C80 A;  4CYE A;  2LVQ A;  4USA A;  3RNC C;  2L8J A;  2KAN A;  2RPV A;  3U8Z A;  3U7D A;  3O65 B;  2BF8 B;  3OG5 A;  2DZK A;  1YX5 B;  1KH0 A;  2L3Z A;  2JRH A;  4IWQ A;  3RZF A;  4ZRJ A;  3R2T A;  4YSY B;  3NS8 A;  4AOF A;  1DOY A;  2Y3A A;  3RZW C;  1FFV A;  3JSV A;  5G5H A;  2J53 A;  2JU6 X;  4A3O A;  1B1Z A;  1C4A A;  3PSE B;  2KX3 A;  4WJP A;  2KD0 A;  3SR6 A;  3CF4 A;  2XEW A;  3RYT A;  4QAY A;  1L6U A;  1BT0 A;  1OTR B;  4Q2J A;  2LXA A;  3MC9 A;  2PPH A;  1L4D B;  2I1J A;  2WXJ A;  4KVG B;  4OW0 A;  2D10 A;  3SD5 A;  1SJE D;  3A1Q B;  3O13 A;  2L0F A;  2XK5 A;  1EU4 A;  3RI7 C;  2BW2 A;  4P1C C;  1WX8 A;  2I1K A;  1FEH A;  4MSQ B;  4PT5 A;  3AED B;  4PK1 A;  2BS3 B;  1WM2 A;  1OEY A;  4GSW A;  2Z0E B;  2ZJD A;  3HRD D;  4RM9 A;  3AEC B;  4K7S A;  1J8C A;  1KRH A;  3AEE B;  4O1N A;  2FNJ B;  2WXH A;  2DX5 B;  2NBU A;  1ACC A;  4P6V F;  1D5X C;  4EEW A;  4BZA A;  3PRZ A;  2BKF A;  4BKS A;  1C79 A;  3ZNG C;  1T0Q C;  4B95 A;  3UI3 A;  2OJR A;  3V3X A;  2IDY A;  2ZZP B;  3PZ7 A;  3GE8 C;  2GBK A;  4OZC A;  2V4I B;  4KKJ A;  1J7B A;  2L32 A;  4MEM A;  2AQ3 B;  4MEL A;  3UIO B;  1K50 A;  1H7X A;  4K7W A;  3ZW3 A;  3I9V 1;  4MGI E;  1P7F A;  1C3T A;  4HLE A;  1BML C;  3FIL B;  3UGB B;  2M4N A;  2BYF A;  2DZJ A;  3Q8B A;  4DDI D;  5EDS A;  2M8S A;  3VR8 B;  4MT5 A;  1UGM A;  3RNE C;  3AEB B;  1VLB A;  4LJP B;  5AZH A;  1FNU A;  1E6E B;  2KWD A;  1RFK A;  2WXM A;  4TMA B;  3DHG C;  3GS2 A;  5HI1 A;  4PYU A;  1WF9 A;  3AE6 B;  1CK1 A;  1JWU D;  2RDB C;  3AM9 A;  3ZRF A;  1Z2M A;  3N20 C;  2ON8 A;  5BYS A;  4ICU A;  4G3X B;  5TSS A;  3OLM D;  3DPD A;  1UNS A;  2JPH A;  2KDI A;  5T8I A;  2LGS A;  3Q3J A;  2EMS A;  4NPN A;  2WQY B;  3CMM B;  3U52 E;  4E3C A;  1NYR A;  2LGY A;  4TKN A;  1F77 A;  4DWF A;  3MC0 B;  1ZGU B;  4RGT A;  4FHJ A;  5FK9 C;  1J7C A;  2ZW1 A;  3GZN B;  5LXI B;  3ZNI D;  1GAQ B;  3BWU D;  4HPL B;  4RGM A;  1R7S A;  2MBB B;  1WI0 A;  2YEP B;  5LNK 1;  3ZXR A;  2WXF A;  5E6P A;  3CSF A;  3E9S A;  4HDO A;  2MBH A;  3GP7 A;  2KQS A;  4NQL B;  4BOZ B;  1V1P B;  4IWP A;  2QIL A;  4BKS D;  3V6C B;  4LLG M;  4W9H A;  1L0V B;  3SHQ A;  3KYC D;  4XGA B;  1FNW A;  3ZGZ A;  3E56 A;  2PEA A;  2ZNV C;  3EC8 A;  2IGG A;  1GB4 A;  4F7Z A;  3WAL A;  3JVZ X;  3KUD B;  3DHI C;  1ZW7 A;  2L05 A;  2QEJ C;  4KDL B;  3KWL A;  1TS4 A;  4FA6 A;  2DZI A;  5AZG A;  1E8W A;  1R4M B;  2CS4 A;  5HHD G;  1E9M A;  4A55 A;  3MJW A;  3GZN I;  3APD A;  3WAP A;  1R4N B;  3TMP B;  1VJK A;  3B2F A;  5I4D A;  5CTR C;  3P4Q B;  4CQN A;  4LDT D;  3RNA C;  3NUH B;  4PYZ A;  1VZ7 A;  3LXF A;  3L4P A;  3RNB C;  2RMM A;  4A6Q A;  1WGG A;  2INC C;  3DVG X;  2A5U A;  2PVG C;  5EE9 A;  5CHV C;  1UUP A;  2NTS A;  2KQ4 X;  1ROE A;  2KC1 A;  2NPT B;  3DVN V;  4GOC A;  3FC4 A;  2PE6 B;  1KF6 B;  4LNN A;  4ITK A;  3L17 A;  3NVY A;  4MDK E;  5GXG B;  4ANV A;  1IBX B;  2KFK B;  4LTU A;  2BS4 B;  1Y8R C;  2DYB A;  1GB1 A;  4II3 B;  3R7R A;  3DBS A;  2G1E A;  1JAL A;  4WWP A;  3N32 A;  5AEK B;  1H7W A;  4YTN B;  2R2O A;  2WYQ A;  4YSZ B;  2XNA C;  2J52 A;  1R4M I;  5C3J B;  5IA7 A;  1R4N I;  3GE3 C;  1DOX A;  3EEC A;  3ZRC A;  4YL8 A;  1ZUD 2;  2JXT A;  5HKH A;  1XEE A;  3RN9 C;  2IZV B;  3PRP B;  1V86 A;  3RPF C;  2V9H A;  3AE7 B;  3Q6B A;  2BVC A;  3BII D;  2KWC A;  5DCN A;  3KYD D;  1AWD A;  4C4V A;  4WQO B;  1WGY A;  2HJ8 A;  1V2Y A;  1K52 A;  2HD5 B;  3EUB 2;  4BOS C;  2KNB A;  2V1Y A;  1UGJ A;  1N62 A;  1I4G A;  3PLU A;  3NZS A;  2N9E B;  1FMA D;  4NJC A;  4A90 A;  1IP9 A;  1E8Z A;  1V5T A;  3H7P B;  1I42 A;  2GBJ A;  1HQR D;  2OHF A;  3AMZ A;  5BO4 B;  3AE2 B;  4OHJ A;  5JHA A;  3CIR B;  2JXX A;  2Q5W D;  3ECI A;  3ML9 A;  4L1B A;  3VTU A;  1UF0 A;  5JZE B;  2BWF A;  4J3O D;  3QWZ B;  4YTP B;  1NBF C;  2MEK A;  5J18 A;  2WXN A;  2Y5P A;  1KTK A;  1SXT A;  2KFK A;  1L6V A;  4FUL A;  2WU5 B;  1SEB D;  3T9L A;  1QQR A;  2HTH A;  3N1Y C;  2MP2 A;  1MHH E;  3AEG B;  4XDC A;  1Q10 A;  4HDQ A;  2ICI A;  1D4B A;  1I4R A;  2J0K A;  3P4R B;  1T6B X;  4ACF A;  5GMV A;  4EUT A;  3IAS 1;  1XF5 L;  1ESF A;  3TL5 A;  4YXD B;  4DBG A;  1YX6 B;  3IHP C;  2IO3 B;  3VAW A;  2QMT A;  4YTM B;  4DXG A;  2LJI A;  2REX A;  1WMH A;  4LNK A;  2JYT A;  4N59 A;  3L13 A;  2VH1 A;  4XE0 A;  1Y56 A;  1FNV A;  1YN5 A;  3NG0 A;  2IO0 B;  2LHE A;  2BB5 A;  4GDL A;  4ZHP A;  1ZXI A;  2WP9 B;  1E5W A;  4ZRQ A;  1K8R B;  1GUA B;  2BT6 A;  3A9J B;  2DWQ A;  3TUO A;  3NVV A;  2ONQ A;  1EO6 A;  3W5U B;  1JRU A;  4OVU A;  1TZO A;  4BKT A;  1F0Z A;  1E8Y A;  3APC A;  4W9K A;  2AEH A;  4CHK A;  1UWM A;  2K8B A;  4S0R A;  3PZD A;  4ICV A;  1KLV A;  4H2A A;  4K3B A;  3ZDM C;  4TQ1 A;  1DYQ A;  2KKC A;  1P1A A;  2VH2 A;  2D11 A;  4G11 A;  3GB1 A;  2CJN A;  3DWG C;  3UQB A;  4G0N B;  3R8B A;  4IG7 B;  4NJ6 A;  4W9C A;  1ZDV A;  1MPE A;  2OJW A;  2INP E;  1TGZ B;  3JSV B;  2L7R A;  4DQO C;  3P1M A;  5D94 A;  2KDB A;  4A9A A;  4RFB A;  4XC2 A;  5BMI A;  1OQR A;  3BK1 A;  5G5G A;  4KGR A;  2KX0 A;  1TIF A;  2PVO D;  4RMA A;  1U4A A;  2WXL A;  2W9N A;  3PTF C;  1P9D U;  3Q8C A;  4WJQ A;  2V3P A;  4MM3 A;  3B9J A;  3KLS X;  2LRW A;  2JZZ A;  2KLC A;  4HJK A;  2WGS A;  1XT9 B;  4C7Z A;  2JWU A;  3ZJV A;  2L00 B;  4CO7 A;  2WDT B;  1HE8 A;  2N7E A;  1WE7 A;  1XLQ A;  5DPW A;  1PQS A;  4XZ4 A;  2MH7 A;  1L2N A;  2XK5 B;  2G4S A;  4TUU A;  3QJZ A;  5JH5 C;  3T3N A;  3WAO A;  3PRM B;  5CHF A;  2CHW A;  4FXC A;  5DPS A;  3DBR I;  3PVL A;  3TEZ A;  4JWS C;  4TQ0 A;  2KYW A;  2BPS A;  2IYD B;  4A3P A;  3U4E G;  4KIK A;  3H6N A;  1D5M C;  1FD6 A;  2LJ5 A;  1SGH A;  1MG8 A;  1QT9 A;  1K51 A;  4HXD A;  3PHX B;  5H92 C;  2WXG A;  1ZOY B;  3RNF C;  4IM0 A;  5BYR A;  1MI0 A;  3R2I A;  1YD8 U;  4JLC A;  1CMX B;  3ALB A;  4TV3 A;  4S17 A;  2WS3 B;  4FHK A;  4L23 A;  3WAN A;  4DHZ B;  1NEN B;  2QSD A;  1WY8 A;  1TBE A;  2IY1 B;  1IGC A;  2ACZ B;  1V9J A;  3DQV A;  2HDE A;  2Y5C A;  2CJO A;  2BQQ A;  3MHZ A;  1TY2 A;  3IT6 B;  5CHW A;  1WXM A;  3NVW A;  2JT4 B;  2BKR B;  2N9L A;  3P63 A;  2G9H D;  3FAH A;  1UEL A;  2MJD A;  2C7H A;  4NNJ B;  2D3A A;  4KSL C;  5J2R A;  4LDT B;  4KX6 B;  4HK2 A;  3MFG A;  2BTE A;  3ZIM A;  2AQ1 B;  3RFZ B;  2GLS A;  3U7Z A;  4BBN C;  3DHH C;  3RNG C;  4C00 A;  3HM6 X;  3WAM A;  2KMM A;  3N9Y C;  1RYJ A;  2JSV X;  3Q8F A;  5L83 A;  3AV8 A;  1UWX A;  2N9X A;  4J6I A;  1OQQ A;  2D3C A;  2QJL A;  4I6N B;  2DYO A;  3CWI A;  2M0X A;  4LNI A;  4JE3 B;  2JZ3 B;  2KHW B;  4L2Y A;  1XD3 B;  3N1Z C;  3MP9 A;  5D6J B;  4N9F 4;  2KMC A;  2KVR A;  1ZXH A;  1Q5W B;  3LYY A;  4MGZ E;  1YJJ A;  3I5J C;  2VRR B;  2OOB B;  4A20 A;  3EFU A;  3ZUN A;  3VFK A;  3A4R A;  2MW5 A;  5JHB A;  1A5R A;  1J19 A;  4RGO S;  1Q0W B;  4HEA 1;  1Z5S B;  1P98 A;  3ZO5 B;  4KV2 A;  1FPY A;  1VR9 A;  4ANX A;  3ENE A;  3V6E B;  2PTL A;  3I63 C;  2RR9 A;  2RSU A;  2R61 A;  2BS2 B;  3T8M A;  3A33 B;  3IT4 B;  2KN5 A;  2KDF B;  3ZNH B;  3ZTC A;  3M62 B;  4F1S A;  1PYW D;  2JYE A;  3B0A A;  1OFF A;  1PGB A;  4DXA B;  3RT3 B;  2X8X X;  3QX1 A;  4M0W A;  1SIF A;  3VDZ A;  1I7H A;  4W9E A;  1HZ5 A;  1EWY C;  3ZNZ B;  1OGW A;  1TKG A;  4II2 B;  4PS3 A;  3P2B A;  1HA5 A;  4LJO B;  1ET9 A;  2FIF A;  1D5Z C;  2AL3 A;  3C19 A;  1AN8 A;  2BWE S;  5TR5 A;  3HM3 A;  1KM7 A;  4WAF A;  2K6D B;  5IO9 A;  3MHS D;  3KVF B;  4GB9 A;  2LRU A;  3TCA A;  3LDZ E;  3SFD B;  3NY5 A;  4EKU A;  1QOA A;  4IM2 A;  4W9F A;  2JRI B;  1FCC C;  1EF1 A;  3ABV B;  3ZTD A;  2LMC A;  4ARI A;  1BUI C;  5CX3 A;  2WXK A;  3TBL D;  3LB8 C;  2MX2 A;  2V3S A;  2QDF A;  2O6V A;  1GOZ A;  2E6X A;  2L83 A;  4GU2 A;  2J42 A;  1F9J A;  3L10 B;  2AYO B;  1FXT B;  2DAF A;  4N6E B;  1UZX B;  3IAM 1;  3KH0 A;  3AEA B;  3FKY A;  3C0R B;  2JWZ A;  5AUK A;  3ETR A;  1GJZ A;  1RWS A;  3PS6 A;  2JF5 A;  4C4V B;  2ZPN A;  1ISN A;  3AB5 A;  4F8C B;  2KDM A;  4WIP A;  3I57 A;  3QAR A;  2NBW B;  1QZE A;  4ZYN A;  1FFU A;  2C60 A;  1C4C A;  1WJ4 A;  5MPO A;  2MBQ A;  1WH3 A;  4BKG A;  1F2R I;  4WUR A;  3RUL A;  4ZYS A;  1WSP A;  3I3T B;  5D7G A;  3QCA A;  1PDX A;  2KXJ A;  3GOE A;  4K3C A;  3TEW A;  2NBV B;  2M0A A;  1T0R C;  1WJU A;  2O2V A;  3UIN B;  2ZPY A;  3KWV A;  1FXI A;  1CZP A;  3W1S A;  4WWO A;  5AUI A;  4HKQ A;  1SJH D;  4GLS C;  3QAQ A;  2FE8 A;  3VVW B;  1QIL A;  5AZF A;  4MGK E;  1AW7 A;  2C5L C;  2EMT A;  2FBW B;  3BK2 A;  5LLI A;  1TTN A;  1VRA B;  4DXF A;  2MP2 B;  1WZ0 A;  2CHX A;  2PW9 A;  3UQA A;  3Q8A A;  1XCT L;  4WQM A;  1YQ4 B;  4GIV A;  1JWS D;  2B3A A;  3AE4 B;  3AU5 A;  2HJ1 A;  1T0Y A;  3MTN B;  2K8H A;  1XXG A;  1L4Z B;  2ZVN A;  4AWJ A;  1TZ1 A;  5BMH A;  4M8N A;  2IGH A;  4M02 A;  2O6V D;  1E7P B;  1F2R C;  1WMH B;  2ASQ A;  2BYE A;  4IOI E;  2LD9 A;  3Q8E A;  1V8C A;  1XCQ L;  2NR2 A;  4EOY A;  5IN7 A;  3QHT A;  4GDL B;  3R7Q A;  3SU8 X;  3JYU A;  4KGT A;  1VDV A;  3AXC A;  4EZJ A;  1WIA A;  3Q2A C;  4I6L B;  4JGH B;  4KGS A;  4AJY B;  3QQ8 B;  2K3U A;  3DOW A;  2RPQ A;  3VUW A;  2KDE B;  2M19 A;  2WX1 A;  4RCO A;  3TIX A;  2MA9 B;  2D3B A;  4E74 A;  2N1V A;  2CU3 A;  5D3D A;  5HG2 A;  1DOI A;  1PGX A;  3ZJU A;  4WJO A;  4FJV B;  1HTQ A;  2LVO A;  5DPT A;  1BXT A;  4NAW A;  4MH0 E;  2WDR B;  3R3M A;  3SEB A;  1D3Z A;  4FLH A;  2CU1 A;  1PFD A;  1N5W A;  2LUM A;  1RRB A;  4K7U A;  2A4Z A;  2KVZ A;  3QIJ A;  1WYW B;  2N9P C;  1IGD A;  4AS1 A;  2D3G A;  1I4H A;  2B76 B;  3NS1 A;  2LUE A;  2D5G A;  3VUY A;  2LVP A;  1EM7 A;  2JVC A;  4B0M A;  1KLG D;  3TEY A;  2I2Y A;  2W3R A;  4B0E A;  3ZQ4 A;  3UIP B;  4EZL A;  2PLP A;  3EFC A;  3KW5 B;  3W2D A;  4TSS A;  5BYQ A;  3PLV A;  3DBH I;  4MM3 B;  1LXD A;  3H7S A;  1XQQ A;  1AYF A;  4ZHO A;  1V49 A;  4HPM B;  1M94 A;  3BVM A;  3N1X C;  3DCG A;  4MJS A;  1QLB B;  4RM8 A;  3AUL A;  3HVD A;  4LNF A;  3AE9 B;  4PS8 A;  2N1W A;  3AE3 B;  2WXI A;  2J4X A;  2YLM A;  2IY0 B;  3RUI B;  3C8Y A;  1I4P A;  1LQB A;  3BYY B;  4D2K A;  3HIZ A;  2K8C A;  1HXY D;  1A70 A;  4GGQ A;  3H1U A;  1NEK B;  2PMV A;  1H4R A;  2MHJ A;  1T0S C;  2DZM A;  2IPK D;  4KIK B;  3W9C B;  4IM3 A;  1WXA A;  2IBI B;  3CST A;  3VUX A;  1TT5 B;  5L95 C;  4BVU C;  3U30 A;  4JL9 A;  1JCK B;  2LWP A;  4W9D A;  2LHD A;  1SE3 A;  4XDD A;  3BZD B;  2WWZ A;  2SAK A;  3DBR B;  1YMH E;  3ZKJ C;  1KLU D;  2KQ7 A;  2IND C;  3Q3F A;  2LAS A;  1SBB B;  3PO0 A;  1C77 A;  3U2S C;  2KTF A;  3VH4 B;  4M8M A;  2JX5 A;  3A9K A;  2L1A A;  3QK0 A;  3N30 A;  4EE2 A;  1WXS A;  4HCP B;  2IGD A;  2LGX A;  2NCN A;  1VCB A;  5IOI A;  2KTR A;  1GG3 A;  2IO1 B;  1E7V A;  1J0G A;  4JPS A;  3P4S B;  4FJY A;  1YQB A;  1QOG A;  2V3N A;  4BFR A;  2RDH A;  2NTT A;  1FM0 D;  2JUO A;  3MC8 A;  4ARC A;  2G3Q B;  2M17 A;  5LXH A;  2K0P A;  1E90 A;  5FR3 A;  3BVG A;  3QC8 B;  1WJ6 A;  5D2M B;  2KWU B;  4JWU C;  3JW0 X;  3HVZ A;  2DYM A;  3RCZ A; 
#chains in the Genus database with same CATH homology
 1JWB D;  1VJK A;  3B2F A;  1TKE A;  1ZXH A;  5I4D A;  1WWT A;  3P4Q B;  3LYY A;  4CQN A;  1YJJ A;  3NUH B;  5EE3 A;  1QF6 A;  1VZ7 A;  3LXF A;  3L4P A;  4RGO S;  3DWM A;  1DGJ A;  2RMM A;  2WDV B;  4HEA 1;  4HRO A;  4A6Q A;  2PVG C;  1XLN A;  5EE9 A;  1TKY A;  4A8X C;  2MJE A;  1VR9 A;  1UUP A;  2NTS A;  2KQ4 X;  1ROE A;  2W3S A;  1JRP A;  3VRB B;  1ENF A;  1V1O A;  1QOF A;  4KKI A;  5H8Y E;  2PTL A;  3FC4 A;  3VQI A;  1TS2 A;  4OVZ A;  1KF6 B;  4C56 C;  2R61 A;  2BS2 B;  2KN4 A;  1VZ6 A;  3IT4 B;  4YSX B;  4ITK A;  3NVY A;  1TS5 A;  4HRS A;  1PYW D;  1EU3 A;  5E6J A;  5GXG B;  1SSN A;  2BYT A;  2JYE A;  2N7J A;  1OFF A;  4N58 A;  1IBX B;  1FRD A;  2OED A;  4LTU A;  3WCQ A;  2BS4 B;  3SFE B;  1ZE3 D;  1GB1 A;  3BYT B;  1PGB A;  2G1E A;  2WDQ B;  1K53 A;  4M0W A;  1JAL A;  3ZJT A;  1I7H A;  1H7W A;  1HZ5 A;  4YTN B;  1EWY C;  4YSZ B;  1TKG A;  2XNA C;  2J52 A;  1NI3 A;  2WXR A;  1WYG A;  1JW9 D;  2FUG 1;  5C3J B;  1HA5 A;  1C78 A;  2N9K A;  1CQV A;  4YT0 B;  1DOX A;  1ET9 A;  1T5X D;  1TYG B;  1N61 A;  1TS3 A;  2IJ0 A;  1ZUD 2;  1D5Z C;  1XO3 A;  2JXT A;  1AN8 A;  1XEE A;  2LEK A;  3RPF C;  3AE7 B;  4JX1 C;  4WAF A;  3V05 A;  5C2T B;  3BII D;  4IDI A;  1AWD A;  1TJE A;  1B9R A;  3SFD B;  1QOA A;  1JRO A;  3T3O A;  1ET6 A;  1K52 A;  1FCC C;  3ABV B;  2ZW0 A;  3EUB 2;  2LMC A;  1GT8 A;  1YJI A;  4ARI A;  3VR9 B;  1UGJ A;  1N62 A;  1SF0 A;  1I4G A;  1BUI C;  2WLB A;  1N63 A;  2WXK A;  1FMA D;  4NJC A;  3LB8 C;  4A90 A;  1HZ6 A;  5BMG A;  4P16 A;  3TEX A;  4MH8 A;  1GOZ A;  1GTE A;  2E6X A;  1HQR D;  2L83 A;  2NMQ A;  2OHF A;  2SEB D;  2W54 A;  5FKA C;  3AMZ A;  4REZ A;  2J42 A;  3AN1 A;  1SIJ A;  3AE2 B;  2EEL A;  2W82 A;  4OHJ A;  3CIR B;  2DBY A;  2N0S B;  2Q5W D;  3OWE B;  4L1B A;  4N6E B;  1L0Y B;  5HFY A;  3IAM 1;  3AEA B;  1WGK A;  4OZB A;  1RM6 C;  3AE8 B;  4J3O D;  5AUK A;  2JQR B;  3ETR A;  4YTP B;  4R3D A;  1RWS A;  1J7A A;  2MJ3 A;  1MHX A;  4RF1 A;  2E3T A;  2MEK A;  3AB5 A;  2WXN A;  2Y5P A;  1KTK A;  2KDM A;  4WIP A;  4US8 A;  1D6E C;  2QIE B;  1SXT A;  3I57 A;  1JWA D;  2JZP A;  5EE1 A;  1L6V A;  2AQ2 B;  4HKZ E;  3PZ8 A;  3P42 A;  2VZK D;  1HEZ E;  2WU5 B;  4RGN A;  1SEB D;  2H89 B;  1FFU A;  1QQR A;  1V97 A;  2Z8L A;  1C4C A;  1ZDX A;  3B2G A;  5MPO A;  1NVI D;  2K9X A;  1JQ4 A;  1F2R I;  4WUR A;  1MHH E;  5D3I B;  1E0Z A;  3AEG B;  2PKO A;  3IXS A;  1Q10 A;  4IKG A;  2ICI A;  1NYQ A;  1I4R A;  4XDC A;  1D4B A;  2YEP F;  5EE0 A;  4ZYS A;  3P4R B;  1WSP A;  3AE1 B;  3TSS A;  1I4X A;  1T6B X;  3HUI A;  5D7G A;  1PDX A;  4OZA A;  3IAS 1;  4NAM A;  1FRR A;  1XF5 L;  1ESF A;  1SB3 C;  2XN9 C;  3TEW A;  4YXD B;  2M0A A;  4RH6 A;  2LGI A;  2HTM E;  2QMT A;  4YTM B;  3AEF B;  3BVZ A;  3KWV A;  1IUE A;  1FXI A;  4DXG A;  4XWW A;  1CZP A;  4AQ7 A;  1L5P A;  3W1S A;  2BB6 A;  1FO4 A;  1FCL A;  2LJI A;  2K5P A;  2JYT A;  4N59 A;  4XWT A;  5AUI A;  4XE0 A;  1Y56 A;  4HKQ A;  4ZOH C;  1ZP0 B;  1CJE A;  1SJH D;  4GLS C;  2X38 A;  1FNV A;  4C80 A;  1YN5 A;  2FE8 A;  1QIL A;  2LHE A;  2BB5 A;  4ZHP A;  3EGR A;  1AW7 A;  1I4Q A;  4USA A;  2FBW B;  1ZXI A;  3BK2 A;  1YQ3 B;  2WP9 B;  2RPV A;  1VRA B;  4ZRQ A;  4DXF A;  2LFI A;  2PW9 A;  2BT6 A;  3Q8A A;  2DWQ A;  1XCT L;  4WWM A;  1KH0 A;  3NVV A;  2ONQ A;  4WQM A;  3TUO A;  1YQ4 B;  1JWS D;  3R2T A;  2AX5 A;  3W5U B;  2V0G A;  4YSY B;  3AE4 B;  4C7Y A;  1TZO A;  1F0Z A;  1DOY A;  2Y3A A;  1FFV A;  1XXG A;  5G5H A;  1UWM A;  2J53 A;  2JU6 X;  1LO5 D;  1GPX A;  1B1Z A;  1L4Z B;  1C4A A;  2EKI A;  5BMH A;  1E10 A;  4ZRP A;  3SR6 A;  2IGH A;  1E7P B;  3CF4 A;  1F2R C;  2DLB A;  4H2A A;  3MJ5 A;  4IOI E;  4TQ1 A;  1DYQ A;  1L6U A;  2INN E;  1V8C A;  3Q8E A;  4Q2J A;  1XCQ L;  1L4D B;  4GDL B;  3GB1 A;  2CJN A;  2WXJ A;  4LK0 M;  3DWG C;  4KGT A;  3R8B A;  1VDV A;  4OW0 A;  1ZDV A;  1SJE D;  4KGS A;  3O13 A;  1MPE A;  4WH4 A;  1EU4 A;  2INP E;  1PUT A;  2BW2 A;  1T3Q A;  2K3U A;  2M19 A;  4DQO C;  1FEH A;  3P1M A;  3AE5 B;  4A9A A;  4RFB A;  4PT5 A;  4RCO A;  3AED B;  5BMI A;  2BS3 B;  1OQR A;  3BK1 A;  1M4V A;  3W5V B;  1YN3 A;  4KGR A;  5G5G A;  2CU3 A;  3HRD D;  5D3D A;  5HG2 A;  2PVO D;  3AEC B;  1DOI A;  3FIL A;  1PGX A;  3ZJU A;  2WXL A;  1XLP A;  3NZ3 A;  1KRH A;  2GI9 A;  3URY A;  3AEE B;  3Q8C A;  2V3P A;  4O1N A;  2WNM A;  2WXH A;  1BXT A;  2H88 B;  2WDR B;  3B9J A;  3SEB A;  3KLS X;  2WXO A;  1PFD A;  1ACC A;  1GTH A;  4P6V F;  1D5X C;  1N5W A;  2LUM A;  4C7Z A;  2JWU A;  1P7E A;  1VZ8 A;  3ZJV A;  1C79 A;  1PGA A;  1IGD A;  2WU2 B;  1QKZ A;  3UI3 A;  4AS1 A;  1XLQ A;  1I4H A;  3V3X A;  2TSS A;  2B76 B;  2MH7 A;  3NS1 A;  2IDY A;  2D5G A;  1N5X A;  3PZ7 A;  4OZC A;  2V4I B;  4KKJ A;  4RF0 A;  1J7B A;  1EM7 A;  2L32 A;  2AQ3 B;  3T3N A;  1K50 A;  1WXQ A;  1H7X A;  4B0M A;  4FXC A;  1KLG D;  3TEY A;  2I2Y A;  2GB1 A;  2W3R A;  4B0E A;  3ZQ4 A;  3I9V 1;  3TEZ A;  1P7F A;  4JWS C;  4TQ0 A;  5JXV A;  2PLP A;  1BML C;  3FIL B;  4RNA A;  3W2D A;  1ZPS A;  3U4E G;  1D5M C;  2M56 B;  3Q8B A;  4TSS A;  3EA6 A;  5BYQ A;  4MM3 B;  1FD6 A;  3H8H A;  3VR8 B;  4NAW B;  3VRA B;  4MT5 A;  1AYF A;  4ZHO A;  2KAJ A;  1QT9 A;  1K51 A;  1FIQ A;  1KFY B;  3BVM A;  3AEB B;  2L52 A;  1QLB B;  1VLB A;  5H92 C;  2WXG A;  1ZOY B;  1EWC A;  2KAC A;  1MI0 A;  5BYR A;  3P4P B;  3HVD A;  3R2I A;  1FNU A;  1E6E B;  1YN4 A;  3AE9 B;  1RFK A;  2KWD A;  2WXM A;  1JML A;  3AE3 B;  4TMA B;  1SE4 A;  4US9 A;  3GS2 A;  2WXI A;  5HI1 A;  2RDG A;  2WS3 B;  1JWM D;  2J4X A;  2WXQ A;  4L23 A;  3AE6 B;  1C4P A;  1NEN B;  1CK1 A;  2QSD A;  1I4P A;  1JWU D;  2PIA A;  3C8Y A;  3AM9 A;  4UDU C;  3BYY B;  1TY0 A;  3J9C A;  4D2K A;  2ON8 A;  1IGC A;  2ACZ B;  5BYS A;  1WRI A;  1HXY D;  1A70 A;  1V1P A;  3NRZ A;  1NEK B;  2PMV A;  1STE A;  5TSS A;  1UNS A;  2HDE A;  5T8I A;  2Y5C A;  3ZYY X;  2CJO A;  2IPK D;  1XLO A;  2WQY B;  3MHZ A;  3U52 E;  3W9C B;  1NYR A;  1TY2 A;  3IT6 B;  1YNT E;  3NVW A;  1F77 A;  1SE2 A;  3MC0 B;  2N9L A;  3P63 A;  4HJG E;  4RGT A;  5FK9 C;  1J7C A;  2ZW1 A;  2G9H D;  3FAH A;  1JCK B;  1GAQ B;  2MJD A;  3BWU D;  2K22 A;  2LHD A;  2VZK B;  1SE3 A;  4XDD A;  2I38 A;  4MAC A;  1L0X B;  3BZD B;  4RGM A;  1R7S A;  1C9F A;  4NZL B;  4KX6 B;  2WXP A;  3MFG A;  2SAK A;  2BTE A;  1YMH E;  2AQ1 B;  4YWG G;  1KLU D;  3RFZ B;  3Q69 A;  3AH7 A;  1SBB B;  3PO0 A;  1C77 A;  2YEP B;  5LNK 1;  3U7Z A;  3U2S C;  2WXF A;  1QOB A;  1C76 A;  3E9S A;  4GDK B;  3GP7 A;  2JX5 A;  1V1P B;  2L1A A;  2QIL A;  4EE2 A;  2IGD A;  2W55 A;  2KMM A;  3N9Y C;  1RYJ A;  2JSV X;  4LLG M;  1MVK A;  3Q8F A;  1L0V B;  3KQ4 A;  1N60 A;  1FNW A;  2BBC A;  3ZGZ A;  2GRI A;  3AV8 A;  3NVZ A;  1UWX A;  3E56 A;  2IGG A;  1GB4 A;  1FXA A;  1OQQ A;  4JPS A;  3P4S B;  2QJL A;  1QOG A;  2V3N A;  2RDH A;  2DYO A;  3CWI A;  2NTT A;  1FM0 D;  4ARC A;  2QEJ C;  4JE3 B;  1TS4 A;  3KWL A;  2K0P A;  5FR3 A;  4L2Y A;  3BVG A;  4JWU C;  5HHD G;  1E9M A;  4A55 A;  3HVZ A;  3MP9 A;  2DYM A;  1IBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...