3AE7B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 52
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae7B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae7B01
2WP9B 4YT0B 3AE4B 1FFUA 4YXDB 2MJDA 2W54A 5GXGB 1TKYA 3BIID 4C7ZA 4WWMA 2G1EA 4C7YA 1NEKB 3VRBB 2OHFA 1DOXA 1EWYC 1NI3A 1XLQA 2PIAA 3KWLA 1N62A 2KAJA 3CIRB 2E3TA 1NVID 1XO3A 1RYJA 2CJOA 5G5GA 2M56B 3AE9B 4P6VF 2L83A 1YJIA 3P4RB 1OQQA 4YTPB 2Y5CA 3AE2B 3HUIA 1FO4A 2WU5B 4IDIA 1JALA 1VJKA 1WGKA 2AX5A 3B2FA 3HRDD 1NYRA 2CU3A 1J7CA 3AE7B 4JWSC 1J7BA 1JWBD 1R7SA 1FRDA 2DWQA 2W55A 4ZHOA 1TYGB 1ZUD2 2L52A 3FC4A 3VR9B 1IUEA 2WDQB 4YTMB 1AYFA 1KRHA 1T3QA 1XLNA 1FXAA 3P1MA 3WCQA 2Q5WD 1DGJA 1N5WA 1GT8A 2WQYB 2M19A 3FAHA 1WRIA 1CZPA 3B9JA 3AE3B 1A70A 1N60A 3RPFC 1GPXA 2PVGC 1E0ZA 5AUIA 1JWAD 3AE8B 1WYGA 4N58A 3AE6B 2MJ3A 3AEDB 3VR8B 3NVVA 3ABVB 5G5HA 3SR6A 1XLPA 1FMAD 2MH7A 3ETRA 3AEFB 3P4SB 5C3JB 3NVZA 5AUKA 1FM0D 1ZXIA 4US8A 4YSYB 1TJEA 1B9RA 1YQ4B 4C80A 1H7XA 1NENB 1V8CA 2BT6A 2BS2B 3LB8C 3P63A 3AEEB 3AN1A 3AMZA 1GTHA 1SB3C 1CJEA 1FIQA 1L5PA 1PUTA 3AH7A 1L0VB 1FXIA 1QOBA 1VDVA 5EE3A 2DBYA 4KX6B 4N6EB 5H8YE 5H92C 1H7WA 2WS3B 2H88B 4HRSA 2EKIA 2K5PA 2JX5A 1QOAA 2K22A 2N0SB 1TKEA 1YJJA 3ZYYX 3SFDB 1E9MA 3PO0A 3P4PB 1YQ3B 4YSXB 1L6UA 4YTNB 1UWMA 3AE5B 1JRPA 2WU2B 3AEAB 1J7AA 3DWMA 1ZOYB 5MPOA 4YSZB 1JW9D 5EE0A 2MJEA 4JWUC 1QOGA 3HVZA 2K9XA 1FRRA 1JQ4A 4LTUA 3DWGC 1JROA 1RM6C 1SF0A 1PFDA 3NRZA 3NVWA 2PVOD 4HROA 2H89B 4WQMA 2LEKA 1RFKA 2B76B 1SIJA 3B2GA 1XLOA 1KFYB 1E7PB 2W3RA 1GAQB 1GTEA 2WLBA 1NYQA 3AV8A 1AWDA 2JQRB 1ZP0B 5EE9A 4ZHPA 1E10A 1QLBB 2BS4B 2QIEB 1KF6B 1RWSA 3LXFA 2FBWB 1DOIA 1VLBA 1PDXA 3AM9A 3AB5A 2KMMA 3L4PA 3W9CB 4N59A 2WDRB 4A9AA 5EE1A 1FFVA 3AECB 3AEBB 1QOFA 2W3SA 3EUB2 1I7HA 4FXCA 1TKGA 3NVYA 4JX1C 4US9A 3P4QB 1WWTA 3AE1B 2BS3B 2PKOA 1N63A 1L6VA 1ROEA 1E6EB 1V97A 3SFEB 1OFFA 2ACZB 1QT9A 1WXQA 2WDVB 1N5XA 2CJNA 3CWIA 3W5UB 1OQRA 4USAA 4ZOHC 1N61A 3NS1A 3VRAB 4ITKA 3AEGB 5C2TB 1DOYA 3W5VB 1QF6A 2HTME 1F0ZA 3CF4A 2QJLA
chains in the Genus database with same CATH superfamily
3V62A 3AE4B 3V60A 5JHAA 1MI0A 2BYEA 4WWMA 1IGCA 2Y5PA 5IOIA 1NEKB 2J42A 4M8MA 4PS8A 2GBNA 2KANA 5E6PA 1QKZA 2K6QA 1L4ZB 2JY6A 2D3GA 1SIFA 4RGNA 3SEBA 1A5RA 4NJ6A 4IM2A 3NJTA 3PV1A 3W1SC 1IUEA 2WDQB 4KDIC 4HPPA 3U4EG 3NZSA 4HPLB 5DPWA 1FCCC 1A70A 4AOFA 3N3KB 2LJ5A 1WYGA 5G5HA 3ABVB 3ETRA 1PYWD 3NUHB 2AL6A 4C80A 3A9KB 3GP7A 1NENB 4WH4A 3LB8C 5BMIA 1FIQA 1V9JA 2DBYA 2QC8A 1M94A 2K22A 1KLVA 4ZRQA 2Z0EB 3SFDB 1YQ3B 1C3TA 1E8WA 4YL8A 3JVZX 3DWMA 2J0MA 1QZEA 1QOGA 4LDTD 3KVFB 3L08A 4URKA 2ON8A 2RPQA 2RDBC 1AWDA 1CK1A 1WXAA 3IXSA 3ZQ4A 4HCPB 3RMKC 4JGHB 3NY5A 2JVCA 2MSED 3BVMA 2YEPF 3OLMD 4NJ7A 3T8MA 1TS3A 2J53A 4PK1A 2K39A 4GDKA 1RAXA 3NVYA 1WE7A 2I1KA 1HTOA 2PTLA 4ZRIA 2AQ2B 1UBQA 3U2SC 2KWVB 3OG5A 3BINA 5HKHA 1WI0A 3NS1A 1K50A 5I4DA 4GIVA 4BVUC 1XLQA 3TEZA 2KK8A 3ZLZA 2KX3A 5L95C 2M56B 2L1AA 2AX5A 1YJ1A 2M8SA 2NBWB 4F7ZA 4JWSC 1YNTE 2DWQA 1V1PA 1J0GA 4A20A 2RSUA 1I4HA 2C7NB 4RGMA 4W9KA 4LK0M 1IYFA 3HM3A 5E6OA 3Q8EA 3AEEB 2IGHA 3AN1A 1L5PA 5HG2A 1WM2A 2RDHA 4MSMB 4HRSA 1S1QB 4BBNC 4BKSD 4BKTA 3PS6A 4HWIB 4KSLC 4YSXB 3QARA 4P16A 3NS8A 2PMVA 3ALBA 4YSZB 2INNE 2MA9B 4W9IA 4AJYB 3DVNV 4XYCA 1XQQA 2X8XX 1FRRA 1SE2A 2IYDB 1WJ6A 2N7EA 3X0WA 1E8ZA 4KV2A 1WMHB 3KUDB 1LM8B 4FULA 3DOWA 1N6ZA 4IWPA 2QIEB 1DOIA 4BKGA 3ZUNA 3L4PA 2VH1A 4RH6A 1ISNA 1FFVA 4WWOA 2DZIA 1TKGA 3V6EB 1EUVB 3RNCC 1OTRB 3WAOA 2C7HA 4ZOHC 4GDLB 5IA7A 5CHFA 1P0RA 3LDZE 3RI7C 4XWWA 4HJGE 3R66C 2LVPA 2MJDA 1Z2MA 2CU1A 3IAM1 2GB1A 3ONSA 2ZW0A 3EECA 1EWYC 1SGHA 3W1SA 4TSSA 4S17A 2BWFA 3HIZA 3ML8A 3I57A 1EWCA 3Q14C 4L23A 4KKIA 3CSFA 1SE9A 2CKHB 1KH0A 1KOTA 3TL5A 2BVCA 4EZJA 1KRHA 3RUIB 3TEYA 4S0RA 4M8NA 1K53A 3MHZA 1CZPA 4P7IA 1E0ZA 2WXOA 3ZNID 4W9HA 5EDSA 1JWMD 4LJPB 2SAKA 2MJ3A 4QAYA 4WJPA 5C3JB 1MVKA 1Q0WB 1TS5A 4US8A 1XF5L 1Q10A 4K3CA 4EKUA 3AH7A 2IO3B 1V1PB 2GLSA 1C77A 1YJJA 2LGYA 5IKCM 1HEZE 2KQSA 1L6UA 1YOVB 4HK2A 3WIMA 1XXGA 1TZ1A 2RGFA 3H7PA 4HPMB 4KGRA 1JW9D 4G50A 1ZE3D 2ZZPB 1JQ4A 2K8HA 3QQ8B 1FD6A 5TSSA 2LFIA 1GAQB 3U52E 2KOXA 1SEBD 1ZGUB 2O6VB 1ET6A 3RNAC 3L16A 2HDEA 3H7PB 2G9HD 2IDYA 3NZUA 4HXDA 4L2YA 3AEBB 1QOFA 2L3ZA 3IVFA 3ZDMC 3N20C 5L83A 3H8HA 2CJNA 1GB1A 3SD5A 3VRAB 3Q8AA 2J7QB 1E7UA 4G0NB 5KHOA 4L1BA 2NCNA 2G1EA 3ZW3A 2L8JA 4KGSA 3ZKJC 2KLGA 4WWPA 3H7SA 1N62A 3VAWA 4IDIA 2L76A 2WHIA 1J7BA 1TS4A 1PGBA 1ESFA 5FK9C 3ZRFA 4NAWA 2V0GA 3PREA 5AUIA 2KC2A 1OEYJ 2KDBA 3NVZA 3QHTA 1ZXIA 1YQ4B 4TQ0A 1IGDA 2BS2B 3CF6E 4KX6B 2H88B 3JYUA 2LXCA 2WX1A 1STEA 4FHJA 2PW9A 1WGHA 2FNJB 1WJUA 4AJWA 1NDDA 2D3BA 4WJOA 4F8CB 3UF8A 2L0TA 1AARA 2K9XA 2BKRB 4OVZA 3DCGA 4RM8A 4CYEA 1VRAB 4MEMA 1VLBA 1J19A 2CHZA 3PRPB 5J2RA 2I1JA 2C7MB 2W3SA 3PTFC 4NY0A 1AN8A 2MP2B 3UGBB 3AE1B 2J0JA 2O2VA 2QDFA 3GB1A 2GBKA 3SFEB 1OGWA 4W9CA 1N61A 2AL3A 2WXKA 1SE3A 3VTWA 2GMIC 1I4RA 1C78A 2HJ1A 4KKJA 2LUEA 2BWES 3Q3MC 2V4LA 2OHFA 3KUCB 3CIRB 4TV3A 4P6VF 2KX0A 1FO4A 5AZGA 2FIDA 1ENFA 3D32A 2CHXA 3TUOA 1FXTB 2DX5B 3PLUA 3ZTDA 1J7CA 1EO6A 3AE7B 4M00A 2G4SA 1ACCA 2MQJA 3WCQA 1X1MA 2NTTA 1RLFA 4K7WA 4A55A 2WXNA 4N58A 2K0PA 3P2BA 2ZNVB 1FNUA 4WAFA 4DDGD 4KZ0A 5D3DA 4KIKA 3P42A 4K3BA 4EZKA 3WANA 2JX5A 4NQLB 4LNIA 3EC8A 2LUMA 4OVUA 1YN4A 1HQRD 1D5ZC 1WJ4A 5E6JA 3L17A 1TY0A 3VXWA 1RFKA 1V86A 4PYUA 3VTUA 4B95A 1ZKHA 4J6IA 2K8BA 4W9EA 2KD0A 5HHDG 1T6BX 3QA8A 3W9CB 3H1UA 2BB6A 1K51A 2RR9A 3MJWA 4US9A 4LNOA 1L4DB 1N63A 5AZFA 4ANWA 4ICUA 2KWUB 4JIOU 3CWIA 3ZDTA 3R7RA 3Q69A 4FBJB 2JPHA 3BIID 2A5UA 2PLPA 2JUOA 2JT4B 2KAJA 4ANVA 2NS5A 3AE2B 2N7DA 1HE8A 3GS2A 4IWQA 4DXFA 1WGKA 1LFDA 1NYRA 3KUZA 1FNVA 3W2DA 1QQRA 1OQYA 4IUMB 4Q2JA 5AEKB 3PSEB 3VR9B 1EU4A 4W9GA 1MPEA 2VRRB 4ANUA 2KQ4X 1N5WA 1UH6A 1GT8A 2I38A 2PVGC 4M02A 1L7YA 2R2OA 3TBLD 3DHIC 4A8XC 3C8YA 3T3OA 1V5TA 1L0VB 3R2TA 5LXIB 4ICVA 3P4PB 3J9CA 2WU2B 2JYTA 4WJNA 1SJHD 3DBRI 4WWNA 2MJEA 3A33B 3UINB 1HZ5A 3DWGC 3FILB 1JROA 1RM6C 3MTNB 4JE3B 4GGQA 1XCQL 4EOYA 2FCQA 4NQKE 2UWQA 2KVZA 3AXCA 4NAWB 4ZHPA 1QLBB 2FAZA 4HDQA 3LJ3A 4NNJB 4A3OA 1V81A 1D4BA 2KFJA 1T0RC 3PRMB 3DBRB 3PGEA 5DPTA 3BZDB 4TKNA 3ENEA 5TR5A 1WGDA 2G4DB 4K7UA 4EZLA 3DVGY 1WM3A 3W5UB 2KC1A 3IT4B 2MLBA 4FA6A 3CF4A 5LLIA 1FFUA 2HTHA 3OWEB 4IWOA 3QAQA 3BYTB 3N1YC 5FR3A 3VDZA 3ZGZA 2BYTA 3MC8A 3PPAA 3KWLA 2NBVB 3DHHC 4ZYSA 2BBCA 3AE9B 3I9V1 3HUIA 4IC7B 1VJKA 2JZZA 1D5MC 5JXVA 2CU3A 5BO4B 2XBBC 2QCZA 3U30A 1ZPSA 1DGJA 4RFBA 2JWUA 3AE6B 3UI3A 3KW5B 5AUKA 3AEFB 3ZRCA 4E3CA 2NPTA 3RNFC 3ZNZB 4XGAB 1GOZA 3DPDA 2MP2A 1C9FA 2L00B 3WA0A 5EE3A 3BYYB 4BBNF 4KSKC 2X38A 1D3ZA 1TIFA 3E56A 1E9MA 1ZDXA 3KLSX 3QX1A 3RT3B 1E90A 3Q8FA 2JU6X 5BMGA 4XDCA 3ZTCA 3NOBA 4EFOA 1WY8A 2H89B 4XE0A 2OJWA 3TIXA 2KN5A 5FKAC 3SU8X 1CQVA 3KH0A 3TCAA 5IN7A 3KYDD 2FBWB 4RM9A 3PZ7A 2MBBB 3CSTA 2FUHB 2KMMA 5CHWA 5J18A 4A9AA 3AECB 1VCBA 1I7HA 1PGXA 4MM3A 3HM6X 2GBMA 4R3DA 4EUTA 1H4RA 3WALA 4K1RB 2EELA 4IKGA 1EM7A 1V97A 2DYMA 3W1YA 3Q8BA 4USAA 2MBQA 2R2QA 4NPNA 2D5GA 1P1AA 3IG3A 3VUYA 4DDID 1TKYA 2YEPB 2L05A 2L0FA 2YVCA 3UIPB 3EFCA 4GN1A 4FJZA 1DOXA 4II3B 2IGDA 1WF9A 1E8XA 3OAWA 1FEHA 3C19A 2IZVB 4I6LB 4A6QA 1FRDA 1JMLA 2L52A 4H2AA 1XLNA 4RGTA 2M17A 4IM0A 4AUQC 4NAMA 3V05A 4KZCA 1I4GA 5DPRA 1HTQA 4II2B 2ZJDA 1FXIA 1VDVA 4N6EB 2VZKB 1QOAA 1WR1A 2KTRA 3DBHB 1Y56A 4FLHA 1ZW7A 3Q6BA 2PPHA 4HVBA 2IPKD 4KVGB 4ZYNA 1FPYA 1D5XC 1WSPA 2SEBD 1DYQA 1FNWA 3H9DA 3MP9A 4PT5A 3C0RB 3V6CB 4AQ7A 4K81A 4FADA 4NJCA 2ZW1A 1KF6B 1RWSA 2M0XA 2MWSB 1SBBB 4XDDA 1B1ZA 4N59A 2WDRB 1HZ6A 2IGGA 1JWUD 4OZAA 2INDC 1T0QC 3N1ZC 1K52A 2BYFA 4OZBA 2AWTA 3VTVA 2JXXA 2NR2A 1WYWB 4LCDE 3U7DA 3T3NA 3A4RA 3PZDA 4EEWA 2WP9B 4YXDB 2WXQA 2W54A 5BYSA 2BQQA 2DZJA 5BMHA 2JRHA 3RYTA 2RMMA 2KDFB 1WX7A 4YTPB 4MGKE 1OEYA 3DHGC 4O1NA 5CHVC 3B2FA 4MJSA 1R7SA 1ZUD2 2DNFA 3VQIA 1EF1A 2IJ0A 3FAHA 1XD3B 4HJKA 4MH8A 1WXVA 4IOIE 1T5XD 1YMHE 4ARCA 2Z59B 4BFRA 2N9KA 4M01A 3T9LA 3AMZA 3PVLA 2EMSA 2KT7A 3I5JC 2B3AA 3O65B 2K5PA 1UWXA 1Z5SB 3EGRA 1Y8RC 2NBUA 3AU5A 3CMMB 3PO0A 3VFKA 1C79A 2WWZA 2OOBB 1V49A 4RF0A 1JRPA 4RGOS 5AZHA 4AP4C 2YLMA 3AEAB 2L32A 5C23A 5MPOA 4I6PA 1YQBA 1C4PA 2J0KA 2GBJA 2KJ6A 3L13A 1KLUD 4OVVA 2W3RA 2Z0DB 3TEXA 3UQAA 2KDEB 1UGJA 2JQRB 2KFKA 2OEDA 2VH2A 1SSNA 1ET9A 2L7RA 3O13A 1C4CA 2D2QA 2BTEA 2V4IB 2LHEA 1VR9A 4DQOC 3R7QA 3A4SC 2ACZB 4CHKA 3VVWB 2VZKD 2WXHA 1R4MI 1WX8A 1WE6A 1P9DU 1I4PA 3PHWB 4W9FA 5IP4D 2TSSA 3R8BA 4C7YA 2BPSA 2WYQA 1TT5B 4PYZA 5CTRC 5G5GA 3ZJTA 3MHSD 2KXJA 3ZJUA 4OHJA 1P7FA 2DYOA 2GOWA 3RULA 4WIPA 3HHMA 4REZA 2DHZA 2Q5WD 1R4MB 1WGRA 2M19A 5D6JB 4FJYA 3B9JA 3QK0A 1HA5A 3APDA 4X57B 4C56C 4AS1A 1JRUA 1C4AA 1IBXB 1P98A 4YSYB 1H7XA 1T0SC 1UF0A 1UGMA 2MBEA 2QMTA 2E6XA 1LGRA 3PZ8A 3VH3B 5J17A 1UELA 2ASQA 2WS3B 1F1HA 1GUAB 2J4XA 4B0MA 3ML9A 4ZRPA 2ZCCA 3ZNHB 2KTFA 3AE5B 1YIWA 4KGTA 5IAAC 3DBSA 2LGXA 2LZ6A 1F2RC 4FN2A 4DWFA 3PRZA 2V3NA 2K25A 1PFDA 4C4VB 4CO7A 2Y3AA 4HKZE 2FCNA 1KFYB 1E7PB 2PJHA 3GE3C 3WAMA 1MHXA 2LD9A 4EE2A 3AB5A 2D07B 4P1CC 1ZDVA 2IBIB 2PKOA 4BZAA 1XCTL 2KACA 1K8RB 2G45B 2KTRB 1E5WA 1N5XA 4WURA 1LQBA 3L0WB 4KDLB 4BKSA 3AEGB 5D7GA 1DOYA 2LWPA 3W5VB 3B0AA 2N9PC 1WGYA 2QJLA 1I4QA 1EF5A 3ZXVA 4HKQA 3BVGA 3ZVVA 2KDIA 2CJOA 3U8ZA 3RCZA 2M0AA 3VUWA 3I63C 1JCKB 4G11A 1C76A 3NHEB 4JL9A 4ZHOA 2INCC 4C00A 3Q2AC 2PEAA 1V6EA 2WQYB 3UIOB 3JSVA 1BMLC 1N60A 5G2NA 2N1VA 1IPGA 2MRPA 3AEDB 3DBLI 3MC0B 2BB5A 2CHWA 5DCNA 1Q5WB 3BK2A 2WDTB 1V8CA 2BT6A 3ECIA 1SB3C 2C60A 2BYVE 3Q3FA 4FHKA 4BOZB 2A4ZA 4ZRKA 2ZPNA 3ZYYX 1UWMA 4DHJD 5IO9A 2AQ1B 2KJHB 5EE0A 1GTEA 2JF5A 2FCSA 4G3XB 1M4VA 2BS4B 3PT2B 3MJ5A 1E7VA 4GB9A 3EUB2 1WH3A 3DVGX 3P4QB 1ROEA 1WR6E 3TSSA 2NVUI 2O6VA 1OQRA 4PS3A 2N9XA 3A9KA 1Q1OA 3EA6A 5BYRA 2KLCA 4YT0B 2C9WB 1C1YB 4ACFA 4MH0E 2LVQA 2XEWA 3K9OB 2Y5CA 1OQQA 1VZ7A 3HRDD 2IY1B 3VUXA 4WQOB 3RN9C 1BXTA 2D3AA 4HLEA 4DK5A 2I2YA 2DLBA 1YD8U 3Q3JA 3IHPC 3VR8B 2PE6B 3NZ3A 2K6DB 4LNFA 1P7EA 4ZRJA 2BKFA 2NMQA 3K9PB 4RF1A 3VHTC 1QOBA 5H8YE 2ZCBA 5H92C 2KZRA 3GE8C 1TKEA 1T0YA 3QJZA 2HD5B 3R3MA 4GDLA 2DENB 4YTNB 5CX3A 2ZPYA 4FJVB 3IBEA 2GI9A 2K1FA 1ZOYB 1VD2A 3FILA 4ASWC 3AU4A 4JWUC 4D2KA 2ZVOA 4LTUA 2LEKA 2MCNB 3QWZB 2IO0B 3B1LX 3EFUA 4A90A 4IM3A 1IP9A 4GSWA 2KHWB 2AYOB 2NTSA 1TGZB 2KNBA 4YWGG 1SE4A 2QEJC 4JX1C 2N1WA 3GOEA 2QILA 2XK5B 3FKYA 5D94A 1I42A 1OFFA 2WDVB 4E71A 4MSQB 4OZCA 3PHXB 2DZMA 1S3SG 4DHJB 4N9F4 2E3TA 4B9KA 3WAPA 2LGDA 2REXA 1TS2A 3P4RB 1WMHA 5DPSA 3QIJA 1JALA 3ZJVA 1GNUA 1UD7A 2W55A 2WXMA 3VH4B 4WAAA 1ZXHA 4DHZE 3FC4A 4I6NB 3MC9A 1T3QA 3JSVB 3A1QB 2LHDA 1WRIA 3AE8B 5FR6A 2NPTB 2D11A 1P3QU 3SR6A 1FM0D 3EHVA 5LNK1 2KVRA 2QSDA 3DBLB 1UZXB 1VZ6A 2AQ3B 1H7WA 4RCOA 3V61A 4GXBA 1UUPA 1F77A 3M3JA 4TQ1A 3RNEC 2WGSA 4CQNA 1GJZA 3RZWC 5JZEB 1KJTA 3NVWA 2O6VD 2PVOD 4BOSC 3OJ4B 4M0WA 4MELA 1I4XA 2ONQA 1SIJA 1V5OA 4MT5A 4XX5A 4C4VA 2JXTA 2HJ8A 3AV8A 1ZP0B 1E10A 2LRWA 2RD0A 3GZNB 3BVZA 1PDXA 2WX0A 1E8YA 4B6WA 1UBIA 2CR5A 5EE1A 3SHQA 1HXYD 1YN3A 1SXTA 2LASA 1TBEA 4A3PA 1LXDA 5GMVA 5C1ZA 2GBRA 1F0ZA 2N9LA 3IAS1 2JWZA 3GZNI 3AULA 2QHOA 4MM3B 1NI3A 2PIAA 4GMVA 2XK5A 1WFYA 1NVID 1XO3A 1RYJA 1FCLA 2WU5B 2UU7A 3HVDA 1JWBD 4XWTA 3S2AA 4JLCA 3X23A 1KLGD 1FXAA 1D6EC 4DHZB 2Z8LA 2FIFA 2MX2A 2N4FA 2KO3A 3RPFC 1MHHE 1JWAD 2DAJA 2O2VB 4LNNA 1R4NI 2KWDA 3TMPB 1FMAD 3A9JB 1B9RA 1UNSA 3ZIMA 3IFWB 1WXSA 3P63A 1GTHA 2JYEA 2EKIA 1MFWA 4LJOB 3PLVA 1I35A 2JRIB 4LNKA 2BF8B 1YN5A 2FUG1 1V2YA 3RD2A 1J7AA 4J3OD 2N9EB 4PS7A 2DZKA 3HVZA 4M0WB 3MFGA 3APFA 5E6NA 4P1BC 2ZEQA 3ZO5B 1U4AA 4ARIA 3JW0X 4MGZE 3A1QA 3M95A 4MDKE 1NYQA 2BW2A 3LXFA 1J8CA 2GRIA 2W9NA 1JWSD 3Q8CA 1WJNA 5BYQA 2WXFA 4WJQA 2WXLA 1F2RI 2BS3B 1VZ8A 4HCNB 3DQVA 1QT9A 1WXQA 4IW0A 3R2IA 1TZOA 2HTME 2WXRA 1L6VA 2IO2B 3M62B 5GXGB 1TTNA 4GLSC 2ICIA 3E9SA 2EMTA 1SJED 3VRBB 2DYBA 1KM7A 2LI5A 2MHJA 1YJIA 2MBHA 2WXJA 2LRUA 4MGIE 2KN4A 1RRBA 1TYGB 1GB4A 4YTMB 2Y5BB 4W9DA 3P1MA 4BAXA 4IG7B 2WNMA 5JH5C 1EU3A 5D2MB 3AE3B 4RMAA 4TMAB 3BWUD 3QC8B 1WRDB 4KIKB 1YX6B 3NVVA 3V3XA 1V80A 1XLPA 2MH7A 2FCMA 2ZVNA 2KDMA 5D3IB 3SDLC 1WZ0A 3KYCD 1PUTA 4JQWC 3KWVA 4GU2A 5LXHA 2V1YA 2M4NA 1LO5D 2OJRA 3N1XC 3Q3OC 4OW0A 2RDGA 3N32A 2BGFA 4ANXA 4ZDVA 3B08A 2W82A 2IO1B 3UQBA 1BT0A 2JZ3B 4HROA 4XC2A 4WQMA 4F1SA 2KFKB 2PE9A 3AI5A 4W9LA 2KWCA 2WLBA 3DBHI 4DXGA 5EE9A 2V9HA 3N30A 3AM9A 2LXAA 4GOCA 1L0XB 3IT6B 3RFZB 2ZNVC 3RNGC 1WWTA 2KQ7A 1QILA 3DVNU 2WXPA 2D10A 1PGAA 1BUIC 2K3UA 2EKEC 3Q3NC 2KKCA 3ZXRA 3A9JA 4HEA1 2MEKA 5C2TB 3OJ3A 1QF6A 4HDOA 3I3TB 1WIAA 3M63B 4C7ZA 2G3QB 1YX5B 1WZ3A 3N9YC 1L0YB 2L83A 2MBOA 3URYA 3RZFA 4LDTB 3DDCB 2DAFA 2RPVA 2C5LC 2J52A 1F9JA 1AYFA 3L54A 4MACA 4GDKB 1NBFC 4UDUC 3RNBC 4B0EA 1GPXA 1CMXB 1G6JA 2K8CA 4MJSB 2LJIA 3NG0A 1GG3A 3P4SB 2UYZB 4E74A 2WXGA 1F52A 1TJEA 1L2NA 1IBXA 2CS4A 2V3SA 1R4NB 2FE8A 4W9JA 1CJEA 1TY2A 1H8CA 3APCA 2LGIA 2LMCA 2N0SB 1XT9B 2IY0B 2KYWA 1MG4A 5KHQA 2INPE 3TEWA 2MW5A 2HE7A 2JSVX 3L10B 1PQSA 1WX9A 2D3CA 3BK1A 3H6NA 4LLGM 3TJPA 4XZ4A 1NI2A 5HI1A 4TUUA 5JHBA 1SF0A 3NRZA 1XEEA 1MG8A 2B76B 2WXIA 3B2GA 1XLOA 4AWJA 3QCAA 4DBGA 5HFYA 1AW7A 1V1OA 2XN9C 5T8IA 4NZLB 2KMCA 5G55A 1KTKA 2N7JA 4K7SA 2LGSA 2LVOA 4DXAB 1GC7A 3HK0A 3LYYA 3BY4B 4FXCA 2KJRA 3U7ZA 1WGGA 2R61A 2KMAA 4JPSA 4RNAA 1E6EB 4MGYE 2JZPA 2V3PA 1MJDA 1WXMA 3ZNGC 2M1MA 2XNAC 4ITKA 1RFAA 3KQ4A 2AEHA 1GC6A
chains in the Genus database with same CATH topology
2WP9B 3AE4B 1SE3A 4YXDB 2WXQA 2W54A 4KKJA 1I4RA 1C78A 1MI0A 4WWMA 1IGCA 2Y5PA 5BYSA 1NEKB 2J42A 2OHFA 5BMHA 3CIRB 1QKZA 2E3TA 1L4ZB 2RMMA 4P6VF 1TS2A 3P4RB 4YTPB 1FO4A 4O1NA 1JALA 1ENFA 3B2FA 3TUOA 1J7CA 3AE7B 4RGNA 3ZJVA 3SEBA 1R7SA 2W55A 2WXMA 1ZXHA 1ZUD2 3FC4A 1ACCA 1IUEA 2WDQB 1T3QA 3WCQA 3U4EG 3VQIA 2LHDA 2IJ0A 3FAHA 1WRIA 2NTTA 1FCCC 1A70A 4A55A 2WXNA 3AE8B 4MH8A 1WYGA 4IOIE 1T5XD 4N58A 1YMHE 5G5HA 3ABVB 2K0PA 3SR6A 4ARCA 3ETRA 1FNUA 4WAFA 1PYWD 1FM0D 3NUHB 5D3DA 2N9KA 4C80A 3GP7A 5LNK1 1NENB 3P42A 2QSDA 3LB8C 4WH4A 3AMZA 5BMIA 1VZ6A 1FIQA 2DBYA 2AQ3B 1H7WA 4RCOA 2K5PA 2JX5A 2K22A 1UWXA 3EGRA 4ZRQA 2LUMA 3SFDB 3PO0A 1YQ3B 1C79A 1YN4A 1UUPA 4RF0A 1JRPA 4RGOS 1HQRD 1F77A 1D5ZC 3AEAB 3DWMA 2L32A 5MPOA 4TQ1A 5E6JA 4CQNA 1C4PA 1QOGA 1TY0A 3NVWA 2PVOD 4M0WA 1RFKA 1I4XA 2ONQA 1SIJA 4MT5A 1KLUD 2W3RA 2ON8A 3TEXA 2JXTA 1UGJA 3AV8A 1AWDA 2JQRB 1ZP0B 1E10A 1CK1A 2OEDA 3IXSA 5HHDG 3BVZA 1T6BX 1PDXA 3ZQ4A 1SSNA 1ET9A 3O13A 3BVMA 1C4CA 2YEPF 3W9CB 2BB6A 5EE1A 1TS3A 1K51A 2J53A 2BTEA 2V4IB 2LHEA 3NVYA 1VR9A 4US9A 1HXYD 2PTLA 1YN3A 1L4DB 1N63A 4DQOC 1SXTA 2AQ2B 2ACZB 3U2SC 3CWIA 2VZKD 1F0ZA 2N9LA 3NS1A 2WXHA 3IAS1 3Q69A 1I4PA 1K50A 2PLPA 3BIID 5I4DA 4MM3B 2TSSA 3R8BA 4C7YA 1NI3A 1XLQA 2PIAA 3TEZA 2KAJA 1NVID 1XO3A 1RYJA 5G5GA 2M56B 3ZJTA 2L1AA 3AE2B 1FCLA 3GS2A 2WU5B 4DXFA 3ZJUA 2AX5A 1WGKA 4OHJA 1NYRA 1P7FA 3HVDA 1FNVA 3W2DA 4JWSC 2DYOA 1QQRA 1JWBD 1YNTE 2DWQA 4XWTA 4Q2JA 4WIPA 3VR9B 1EU4A 1V1PA 1KLGD 1MPEA 1FXAA 1D6EC 2KQ4X 4REZA 2Q5WD 2Z8LA 1N5WA 1GT8A 2M19A 3B9JA 1HA5A 2I38A 2PVGC 1MHHE 3RPFC 1I4HA 1JWAD 4RGMA 4C56C 4AS1A 2KWDA 1C4AA 1FMAD 4LK0M 1IBXB 4YSYB 1B9RA 1H7XA 3Q8EA 1UNSA 4A8XC 3P63A 3AEEB 2IGHA 3C8YA 3AN1A 1GTHA 2JYEA 2E6XA 2QMTA 1L5PA 5HG2A 3T3OA 1L0VB 3PZ8A 2RDHA 2WS3B 4HRSA 2EKIA 2J4XA 4B0MA 3R2TA 4ZRPA 3P4PB 4YSXB 3J9CA 3AE5B 2WU2B 4P16A 2JYTA 1SJHD 1YN5A 2FUG1 4KGTA 1J7AA 4J3OD 1F2RC 2PMVA 4YSZB 2INNE 2MJEA 3HVZA 1HZ5A 3MFGA 1FRRA 2V3NA 3DWGC 3FILB 1JROA 1RM6C 1SE2A 1PFDA 4JE3B 1XCQL 4ARIA 2Y3AA 4HKZE 1KFYB 1E7PB 4NAWB 1NYQA 4ZHPA 1MHXA 1QLBB 2QIEB 2BW2A 3LXFA 2GRIA 1DOIA 1JWSD 4EE2A 3AB5A 3Q8CA 3L4PA 1D4BA 4RH6A 5BYQA 1FFVA 2WXFA 1ZDVA 3BZDB 1TKGA 2WXLA 1F2RI 2PKOA 2BS3B 1VZ8A 1XCTL 2KACA 1QT9A 1WXQA 1N5XA 4WURA 3W5UB 4ZOHC 3IT4B 3R2IA 4GDLB 1TZOA 3AEGB 5D7GA 1DOYA 3W5VB 4XWWA 2HTME 2WXRA 1L6VA 3CF4A 2QJLA 1I4QA 4HJGE 1FFUA 2MJDA 5GXGB 3OWEB 4GLSC 2ICIA 3BYTB 3IAM1 3E9SA 2GB1A 2ZW0A 5FR3A 4HKQA 1SJED 3VRBB 3ZGZA 2BYTA 1EWYC 3W1SA 3BVGA 3KWLA 4ZYSA 2CJOA 2BBCA 3AE9B 3I9V1 4TSSA 1YJIA 2M0AA 3HUIA 3I57A 1VJKA 1D5MC 1JCKB 1EWCA 2WXJA 4L23A 5JXVA 1C76A 4KKIA 2CU3A 4ZHOA 2KN4A 1KH0A 1TYGB 1GB4A 4YTMB 1KRHA 3P1MA 1ZPSA 3TEYA 1DGJA 1K53A 2WQYB 2WNMA 1EU3A 3MHZA 4RFBA 1CZPA 3AE3B 1BMLC 1N60A 1E0ZA 4TMAB 2WXOA 2JWUA 1JWMD 3BWUD 2SAKA 3AE6B 2MJ3A 3AEDB 3UI3A 3MC0B 3NVVA 3V3XA 1XLPA 2BB5A 2MH7A 5AUKA 3AEFB 5C3JB 1MVKA 1TS5A 3BK2A 4US8A 2KDMA 5D3IB 1XF5L 1GOZA 1V8CA 2BT6A 1Q10A 1C9FA 1SB3C 1PUTA 3AH7A 1V1PB 5EE3A 3KWVA 3BYYB 1C77A 2X38A 3E56A 1YJJA 3ZYYX 1E9MA 1ZDXA 1LO5D 1HEZE 3KLSX 1L6UA 1UWMA 4OW0A 2RDGA 2AQ1B 1XXGA 3Q8FA 4KGRA 1JW9D 2JU6X 5EE0A 4XDCA 5BMGA 1ZE3D 2W82A 1JQ4A 4HROA 1FD6A 2H89B 4WQMA 5TSSA 4XE0A 2LFIA 5FKAC 1GAQB 1GTEA 3U52E 1CQVA 2WLBA 4DXGA 1SEBD 5EE9A 1M4VA 2BS4B 1ET6A 2FBWB 3PZ7A 2HDEA 3AM9A 2KMMA 3MJ5A 1L0XB 2G9HD 2IDYA 4A9AA 4L2YA 3AECB 3AEBB 1QOFA 3EUB2 3IT6B 3RFZB 1I7HA 1PGXA 4R3DA 3P4QB 1WWTA 1QILA 2WXPA 1ROEA 1PGAA 1BUIC 2EELA 4IKGA 1EM7A 1V97A 2DYMA 2K3UA 3TSSA 3H8HA 2CJNA 1OQRA 4HEA1 3Q8BA 4USAA 1GB1A 2MEKA 3VRAB 5C2TB 3Q8AA 3EA6A 1QF6A 2D5GA 5BYRA 4YT0B 1TKYA 2YEPB 4L1BA 4C7ZA 2G1EA 4KGSA 1DOXA 2IGDA 1N62A 3N9YC 1L0YB 1FEHA 2L83A 2Y5CA 1OQQA 3URYA 4IDIA 1VZ7A 3HRDD 4A6QA 1J7BA 1FRDA 1BXTA 2RPVA 1JMLA 2L52A 1TS4A 4H2AA 2J52A 1AYFA 1PGBA 1ESFA 1XLNA 4MACA 4RGTA 5FK9C 2DLBA 2I2YA 4GDKB 2V0GA 4UDUC 4B0EA 1GPXA 4NAMA 5AUIA 3VR8B 2LJIA 3NVZA 3NZ3A 3V05A 3P4SB 1P7EA 1ZXIA 2WXGA 1TJEA 2NMQA 1YQ4B 1I4GA 4TQ0A 1IGDA 2BS2B 4RF1A 1IBXA 2FE8A 1CJEA 1FXIA 1QOBA 1VDVA 5H8YE 1TY2A 4KX6B 4N6EB 5H92C 2LGIA 2H88B 2LMCA 2VZKB 2N0SB 1QOAA 1TKEA 1STEA 1Y56A 2INPE 2PW9A 3TEWA 4YTNB 2JSVX 2GI9A 3BK1A 4LLGM 2IPKD 1ZOYB 3FILA 4JWUC 4D2KA 1D5XC 5HI1A 2K9XA 1WSPA 4LTUA 2SEBD 1SF0A 1DYQA 1FNWA 3NRZA 3MP9A 4PT5A 2LEKA 4OVZA 1XEEA 2WXIA 2B76B 4AQ7A 3B2GA 1XLOA 5HFYA 1AW7A 1V1OA 4A90A 4NJCA 2XN9C 1VRAB 5T8IA 4NZLB 2ZW1A 1KF6B 1RWSA 1KTKA 2N7JA 2NTSA 1VLBA 1SBBB 4XDDA 1B1ZA 4N59A 2WDRB 2W3SA 1HZ6A 3LYYA 2IGGA 1JWUD 4YWGG 4OZAA 1AN8A 1SE4A 4FXCA 3U7ZA 2QEJC 4JX1C 2R61A 2QILA 1K52A 3AE1B 4JPSA 4RNAA 3GB1A 1E6EB 2JZPA 3SFEB 1OFFA 4OZBA 2WDVB 2V3PA 1N61A 4OZCA 2XNAC 4ITKA 3KQ4A 3T3NA 2WXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP9 B;  4YT0 B;  3AE4 B;  1FFU A;  4YXD B;  2MJD A;  2W54 A;  5GXG B;  1TKY A;  3BII D;  4C7Z A;  4WWM A;  2G1E A;  4C7Y A;  1NEK B;  3VRB B;  2OHF A;  1DOX A;  1EWY C;  1NI3 A;  1XLQ A;  2PIA A;  3KWL A;  1N62 A;  2KAJ A;  3CIR B;  2E3T A;  1NVI D;  1XO3 A;  1RYJ A;  2CJO A;  5G5G A;  2M56 B;  3AE9 B;  4P6V F;  2L83 A;  1YJI A;  3P4R B;  1OQQ A;  4YTP B;  2Y5C A;  3AE2 B;  3HUI A;  1FO4 A;  2WU5 B;  4IDI A;  1JAL A;  1VJK A;  1WGK A;  2AX5 A;  3B2F A;  3HRD D;  1NYR A;  2CU3 A;  1J7C A;  3AE7 B;  4JWS C;  1J7B A;  1JWB D;  1R7S A;  1FRD A;  2DWQ A;  2W55 A;  4ZHO A;  1TYG B;  1ZUD 2;  2L52 A;  3FC4 A;  3VR9 B;  1IUE A;  2WDQ B;  4YTM B;  1AYF A;  1KRH A;  1T3Q A;  1XLN A;  1FXA A;  3P1M A;  3WCQ A;  2Q5W D;  1DGJ A;  1N5W A;  1GT8 A;  2WQY B;  2M19 A;  3FAH A;  1WRI A;  1CZP A;  3B9J A;  3AE3 B;  1A70 A;  1N60 A;  3RPF C;  1GPX A;  2PVG C;  1E0Z A;  5AUI A;  1JWA D;  3AE8 B;  1WYG A;  4N58 A;  3AE6 B;  2MJ3 A;  3AED B;  3VR8 B;  3NVV A;  3ABV B;  5G5H A;  3SR6 A;  1XLP A;  1FMA D;  2MH7 A;  3ETR A;  3AEF B;  3P4S B;  5C3J B;  3NVZ A;  5AUK A;  1FM0 D;  1ZXI A;  4US8 A;  4YSY B;  1TJE A;  1B9R A;  1YQ4 B;  4C80 A;  1H7X A;  1NEN B;  1V8C A;  2BT6 A;  2BS2 B;  3LB8 C;  3P63 A;  3AEE B;  3AN1 A;  3AMZ A;  1GTH A;  1SB3 C;  1CJE A;  1FIQ A;  1L5P A;  1PUT A;  3AH7 A;  1L0V B;  1FXI A;  1QOB A;  1VDV A;  5EE3 A;  2DBY A;  4KX6 B;  4N6E B;  5H8Y E;  5H92 C;  1H7W A;  2WS3 B;  2H88 B;  4HRS A;  2EKI A;  2K5P A;  2JX5 A;  1QOA A;  2K22 A;  2N0S B;  1TKE A;  1YJJ A;  3ZYY X;  3SFD B;  1E9M A;  3PO0 A;  3P4P B;  1YQ3 B;  4YSX B;  1L6U A;  4YTN B;  1UWM A;  3AE5 B;  1JRP A;  2WU2 B;  3AEA B;  1J7A A;  3DWM A;  1ZOY B;  5MPO A;  4YSZ B;  1JW9 D;  5EE0 A;  2MJE A;  4JWU C;  1QOG A;  3HVZ A;  2K9X A;  1FRR A;  1JQ4 A;  4LTU A;  3DWG C;  1JRO A;  1RM6 C;  1SF0 A;  1PFD A;  3NRZ A;  3NVW A;  2PVO D;  4HRO A;  2H89 B;  4WQM A;  2LEK A;  1RFK A;  2B76 B;  1SIJ A;  3B2G A;  1XLO A;  1KFY B;  1E7P B;  2W3R A;  1GAQ B;  1GTE A;  2WLB A;  1NYQ A;  3AV8 A;  1AWD A;  2JQR B;  1ZP0 B;  5EE9 A;  4ZHP A;  1E10 A;  1QLB B;  2BS4 B;  2QIE B;  1KF6 B;  1RWS A;  3LXF A;  2FBW B;  1DOI A;  1VLB A;  1PDX A;  3AM9 A;  3AB5 A;  2KMM A;  3L4P A;  3W9C B;  4N59 A;  2WDR B;  4A9A A;  5EE1 A;  1FFV A;  3AEC B;  3AEB B;  1QOF A;  2W3S A;  3EUB 2;  1I7H A;  4FXC A;  1TKG A;  3NVY A;  4JX1 C;  4US9 A;  3P4Q B;  1WWT A;  3AE1 B;  2BS3 B;  2PKO A;  1N63 A;  1L6V A;  1ROE A;  1E6E B;  1V97 A;  3SFE B;  1OFF A;  2ACZ B;  1QT9 A;  1WXQ A;  2WDV B;  1N5X A;  2CJN A;  3CWI A;  3W5U B;  1OQR A;  4USA A;  4ZOH C;  1N61 A;  3NS1 A;  3VRA B;  4ITK A;  3AEG B;  5C2T B;  1DOY A;  3W5V B;  1QF6 A;  2HTM E;  1F0Z A;  3CF4 A;  2QJL A; 
#chains in the Genus database with same CATH topology
 3V62 A;  3AE4 B;  3V60 A;  5JHA A;  1MI0 A;  2BYE A;  4WWM A;  1IGC A;  2Y5P A;  5IOI A;  1NEK B;  2J42 A;  4M8M A;  4PS8 A;  2GBN A;  2KAN A;  5E6P A;  1QKZ A;  2K6Q A;  1L4Z B;  2JY6 A;  2D3G A;  1SIF A;  4RGN A;  3SEB A;  1A5R A;  4NJ6 A;  4IM2 A;  3NJT A;  3PV1 A;  3W1S C;  1IUE A;  2WDQ B;  4KDI C;  4HPP A;  3U4E G;  3NZS A;  4HPL B;  5DPW A;  1FCC C;  1A70 A;  4AOF A;  3N3K B;  2LJ5 A;  1WYG A;  5G5H A;  3ABV B;  3ETR A;  1PYW D;  3NUH B;  2AL6 A;  4C80 A;  3A9K B;  3GP7 A;  1NEN B;  4WH4 A;  3LB8 C;  5BMI A;  1FIQ A;  1V9J A;  2DBY A;  2QC8 A;  1M94 A;  2K22 A;  1KLV A;  4ZRQ A;  2Z0E B;  3SFD B;  1YQ3 B;  1C3T A;  1E8W A;  4YL8 A;  3JVZ X;  3DWM A;  2J0M A;  1QZE A;  1QOG A;  4LDT D;  3KVF B;  3L08 A;  4URK A;  2ON8 A;  2RPQ A;  2RDB C;  1AWD A;  1CK1 A;  1WXA A;  3IXS A;  3ZQ4 A;  4HCP B;  3RMK C;  4JGH B;  3NY5 A;  2JVC A;  2MSE D;  3BVM A;  2YEP F;  3OLM D;  4NJ7 A;  3T8M A;  1TS3 A;  2J53 A;  4PK1 A;  2K39 A;  4GDK A;  1RAX A;  3NVY A;  1WE7 A;  2I1K A;  1HTO A;  2PTL A;  4ZRI A;  2AQ2 B;  1UBQ A;  3U2S C;  2KWV B;  3OG5 A;  3BIN A;  5HKH A;  1WI0 A;  3NS1 A;  1K50 A;  5I4D A;  4GIV A;  4BVU C;  1XLQ A;  3TEZ A;  2KK8 A;  3ZLZ A;  2KX3 A;  5L95 C;  2M56 B;  2L1A A;  2AX5 A;  1YJ1 A;  2M8S A;  2NBW B;  4F7Z A;  4JWS C;  1YNT E;  2DWQ A;  1V1P A;  1J0G A;  4A20 A;  2RSU A;  1I4H A;  2C7N B;  4RGM A;  4W9K A;  4LK0 M;  1IYF A;  3HM3 A;  5E6O A;  3Q8E A;  3AEE B;  2IGH A;  3AN1 A;  1L5P A;  5HG2 A;  1WM2 A;  2RDH A;  4MSM B;  4HRS A;  1S1Q B;  4BBN C;  4BKS D;  4BKT A;  3PS6 A;  4HWI B;  4KSL C;  4YSX B;  3QAR A;  4P16 A;  3NS8 A;  2PMV A;  3ALB A;  4YSZ B;  2INN E;  2MA9 B;  4W9I A;  4AJY B;  3DVN V;  4XYC A;  1XQQ A;  2X8X X;  1FRR A;  1SE2 A;  2IYD B;  1WJ6 A;  2N7E A;  3X0W A;  1E8Z A;  4KV2 A;  1WMH B;  3KUD B;  1LM8 B;  4FUL A;  3DOW A;  1N6Z A;  4IWP A;  2QIE B;  1DOI A;  4BKG A;  3ZUN A;  3L4P A;  2VH1 A;  4RH6 A;  1ISN A;  1FFV A;  4WWO A;  2DZI A;  1TKG A;  3V6E B;  1EUV B;  3RNC C;  1OTR B;  3WAO A;  2C7H A;  4ZOH C;  4GDL B;  5IA7 A;  5CHF A;  1P0R A;  3LDZ E;  3RI7 C;  4XWW A;  4HJG E;  3R66 C;  2LVP A;  2MJD A;  1Z2M A;  2CU1 A;  3IAM 1;  2GB1 A;  3ONS A;  2ZW0 A;  3EEC A;  1EWY C;  1SGH A;  3W1S A;  4TSS A;  4S17 A;  2BWF A;  3HIZ A;  3ML8 A;  3I57 A;  1EWC A;  3Q14 C;  4L23 A;  4KKI A;  3CSF A;  1SE9 A;  2CKH B;  1KH0 A;  1KOT A;  3TL5 A;  2BVC A;  4EZJ A;  1KRH A;  3RUI B;  3TEY A;  4S0R A;  4M8N A;  1K53 A;  3MHZ A;  1CZP A;  4P7I A;  1E0Z A;  2WXO A;  3ZNI D;  4W9H A;  5EDS A;  1JWM D;  4LJP B;  2SAK A;  2MJ3 A;  4QAY A;  4WJP A;  5C3J B;  1MVK A;  1Q0W B;  1TS5 A;  4US8 A;  1XF5 L;  1Q10 A;  4K3C A;  4EKU A;  3AH7 A;  2IO3 B;  1V1P B;  2GLS A;  1C77 A;  1YJJ A;  2LGY A;  5IKC M;  1HEZ E;  2KQS A;  1L6U A;  1YOV B;  4HK2 A;  3WIM A;  1XXG A;  1TZ1 A;  2RGF A;  3H7P A;  4HPM B;  4KGR A;  1JW9 D;  4G50 A;  1ZE3 D;  2ZZP B;  1JQ4 A;  2K8H A;  3QQ8 B;  1FD6 A;  5TSS A;  2LFI A;  1GAQ B;  3U52 E;  2KOX A;  1SEB D;  1ZGU B;  2O6V B;  1ET6 A;  3RNA C;  3L16 A;  2HDE A;  3H7P B;  2G9H D;  2IDY A;  3NZU A;  4HXD A;  4L2Y A;  3AEB B;  1QOF A;  2L3Z A;  3IVF A;  3ZDM C;  3N20 C;  5L83 A;  3H8H A;  2CJN A;  1GB1 A;  3SD5 A;  3VRA B;  3Q8A A;  2J7Q B;  1E7U A;  4G0N B;  5KHO A;  4L1B A;  2NCN A;  2G1E A;  3ZW3 A;  2L8J A;  4KGS A;  3ZKJ C;  2KLG A;  4WWP A;  3H7S A;  1N62 A;  3VAW A;  4IDI A;  2L76 A;  2WHI A;  1J7B A;  1TS4 A;  1PGB A;  1ESF A;  5FK9 C;  3ZRF A;  4NAW A;  2V0G A;  3PRE A;  5AUI A;  2KC2 A;  1OEY J;  2KDB A;  3NVZ A;  3QHT A;  1ZXI A;  1YQ4 B;  4TQ0 A;  1IGD A;  2BS2 B;  3CF6 E;  4KX6 B;  2H88 B;  3JYU A;  2LXC A;  2WX1 A;  1STE A;  4FHJ A;  2PW9 A;  1WGH A;  2FNJ B;  1WJU A;  4AJW A;  1NDD A;  2D3B A;  4WJO A;  4F8C B;  3UF8 A;  2L0T A;  1AAR A;  2K9X A;  2BKR B;  4OVZ A;  3DCG A;  4RM8 A;  4CYE A;  1VRA B;  4MEM A;  1VLB A;  1J19 A;  2CHZ A;  3PRP B;  5J2R A;  2I1J A;  2C7M B;  2W3S A;  3PTF C;  4NY0 A;  1AN8 A;  2MP2 B;  3UGB B;  3AE1 B;  2J0J A;  2O2V A;  2QDF A;  3GB1 A;  2GBK A;  3SFE B;  1OGW A;  4W9C A;  1N61 A;  2AL3 A;  2WXK A;  1SE3 A;  3VTW A;  2GMI C;  1I4R A;  1C78 A;  2HJ1 A;  4KKJ A;  2LUE A;  2BWE S;  3Q3M C;  2V4L A;  2OHF A;  3KUC B;  3CIR B;  4TV3 A;  4P6V F;  2KX0 A;  1FO4 A;  5AZG A;  2FID A;  1ENF A;  3D32 A;  2CHX A;  3TUO A;  1FXT B;  2DX5 B;  3PLU A;  3ZTD A;  1J7C A;  1EO6 A;  3AE7 B;  4M00 A;  2G4S A;  1ACC A;  2MQJ A;  3WCQ A;  1X1M A;  2NTT A;  1RLF A;  4K7W A;  4A55 A;  2WXN A;  4N58 A;  2K0P A;  3P2B A;  2ZNV B;  1FNU A;  4WAF A;  4DDG D;  4KZ0 A;  5D3D A;  4KIK A;  3P42 A;  4K3B A;  4EZK A;  3WAN A;  2JX5 A;  4NQL B;  4LNI A;  3EC8 A;  2LUM A;  4OVU A;  1YN4 A;  1HQR D;  1D5Z C;  1WJ4 A;  5E6J A;  3L17 A;  1TY0 A;  3VXW A;  1RFK A;  1V86 A;  4PYU A;  3VTU A;  4B95 A;  1ZKH A;  4J6I A;  2K8B A;  4W9E A;  2KD0 A;  5HHD G;  1T6B X;  3QA8 A;  3W9C B;  3H1U A;  2BB6 A;  1K51 A;  2RR9 A;  3MJW A;  4US9 A;  4LNO A;  1L4D B;  1N63 A;  5AZF A;  4ANW A;  4ICU A;  2KWU B;  4JIO U;  3CWI A;  3ZDT A;  3R7R A;  3Q69 A;  4FBJ B;  2JPH A;  3BII D;  2A5U A;  2PLP A;  2JUO A;  2JT4 B;  2KAJ A;  4ANV A;  2NS5 A;  3AE2 B;  2N7D A;  1HE8 A;  3GS2 A;  4IWQ A;  4DXF A;  1WGK A;  1LFD A;  1NYR A;  3KUZ A;  1FNV A;  3W2D A;  1QQR A;  1OQY A;  4IUM B;  4Q2J A;  5AEK B;  3PSE B;  3VR9 B;  1EU4 A;  4W9G A;  1MPE A;  2VRR B;  4ANU A;  2KQ4 X;  1N5W A;  1UH6 A;  1GT8 A;  2I38 A;  2PVG C;  4M02 A;  1L7Y A;  2R2O A;  3TBL D;  3DHI C;  4A8X C;  3C8Y A;  3T3O A;  1V5T A;  1L0V B;  3R2T A;  5LXI B;  4ICV A;  3P4P B;  3J9C A;  2WU2 B;  2JYT A;  4WJN A;  1SJH D;  3DBR I;  4WWN A;  2MJE A;  3A33 B;  3UIN B;  1HZ5 A;  3DWG C;  3FIL B;  1JRO A;  1RM6 C;  3MTN B;  4JE3 B;  4GGQ A;  1XCQ L;  4EOY A;  2FCQ A;  4NQK E;  2UWQ A;  2KVZ A;  3AXC A;  4NAW B;  4ZHP A;  1QLB B;  2FAZ A;  4HDQ A;  3LJ3 A;  4NNJ B;  4A3O A;  1V81 A;  1D4B A;  2KFJ A;  1T0R C;  3PRM B;  3DBR B;  3PGE A;  5DPT A;  3BZD B;  4TKN A;  3ENE A;  5TR5 A;  1WGD A;  2G4D B;  4K7U A;  4EZL A;  3DVG Y;  1WM3 A;  3W5U B;  2KC1 A;  3IT4 B;  2MLB A;  4FA6 A;  3CF4 A;  5LLI A;  1FFU A;  2HTH A;  3OWE B;  4IWO A;  3QAQ A;  3BYT B;  3N1Y C;  5FR3 A;  3VDZ A;  3ZGZ A;  2BYT A;  3MC8 A;  3PPA A;  3KWL A;  2NBV B;  3DHH C;  4ZYS A;  2BBC A;  3AE9 B;  3I9V 1;  3HUI A;  4IC7 B;  1VJK A;  2JZZ A;  1D5M C;  5JXV A;  2CU3 A;  5BO4 B;  2XBB C;  2QCZ A;  3U30 A;  1ZPS A;  1DGJ A;  4RFB A;  2JWU A;  3AE6 B;  3UI3 A;  3KW5 B;  5AUK A;  3AEF B;  3ZRC A;  4E3C A;  2NPT A;  3RNF C;  3ZNZ B;  4XGA B;  1GOZ A;  3DPD A;  2MP2 A;  1C9F A;  2L00 B;  3WA0 A;  5EE3 A;  3BYY B;  4BBN F;  4KSK C;  2X38 A;  1D3Z A;  1TIF A;  3E56 A;  1E9M A;  1ZDX A;  3KLS X;  3QX1 A;  3RT3 B;  1E90 A;  3Q8F A;  2JU6 X;  5BMG A;  4XDC A;  3ZTC A;  3NOB A;  4EFO A;  1WY8 A;  2H89 B;  4XE0 A;  2OJW A;  3TIX A;  2KN5 A;  5FKA C;  3SU8 X;  1CQV A;  3KH0 A;  3TCA A;  5IN7 A;  3KYD D;  2FBW B;  4RM9 A;  3PZ7 A;  2MBB B;  3CST A;  2FUH B;  2KMM A;  5CHW A;  5J18 A;  4A9A A;  3AEC B;  1VCB A;  1I7H A;  1PGX A;  4MM3 A;  3HM6 X;  2GBM A;  4R3D A;  4EUT A;  1H4R A;  3WAL A;  4K1R B;  2EEL A;  4IKG A;  1EM7 A;  1V97 A;  2DYM A;  3W1Y A;  3Q8B A;  4USA A;  2MBQ A;  2R2Q A;  4NPN A;  2D5G A;  1P1A A;  3IG3 A;  3VUY A;  4DDI D;  1TKY A;  2YEP B;  2L05 A;  2L0F A;  2YVC A;  3UIP B;  3EFC A;  4GN1 A;  4FJZ A;  1DOX A;  4II3 B;  2IGD A;  1WF9 A;  1E8X A;  3OAW A;  1FEH A;  3C19 A;  2IZV B;  4I6L B;  4A6Q A;  1FRD A;  1JML A;  2L52 A;  4H2A A;  1XLN A;  4RGT A;  2M17 A;  4IM0 A;  4AUQ C;  4NAM A;  3V05 A;  4KZC A;  1I4G A;  5DPR A;  1HTQ A;  4II2 B;  2ZJD A;  1FXI A;  1VDV A;  4N6E B;  2VZK B;  1QOA A;  1WR1 A;  2KTR A;  3DBH B;  1Y56 A;  4FLH A;  1ZW7 A;  3Q6B A;  2PPH A;  4HVB A;  2IPK D;  4KVG B;  4ZYN A;  1FPY A;  1D5X C;  1WSP A;  2SEB D;  1DYQ A;  1FNW A;  3H9D A;  3MP9 A;  4PT5 A;  3C0R B;  3V6C B;  4AQ7 A;  4K81 A;  4FAD A;  4NJC A;  2ZW1 A;  1KF6 B;  1RWS A;  2M0X A;  2MWS B;  1SBB B;  4XDD A;  1B1Z A;  4N59 A;  2WDR B;  1HZ6 A;  2IGG A;  1JWU D;  4OZA A;  2IND C;  1T0Q C;  3N1Z C;  1K52 A;  2BYF A;  4OZB A;  2AWT A;  3VTV A;  2JXX A;  2NR2 A;  1WYW B;  4LCD E;  3U7D A;  3T3N A;  3A4R A;  3PZD A;  4EEW A;  2WP9 B;  4YXD B;  2WXQ A;  2W54 A;  5BYS A;  2BQQ A;  2DZJ A;  5BMH A;  2JRH A;  3RYT A;  2RMM A;  2KDF B;  1WX7 A;  4YTP B;  4MGK E;  1OEY A;  3DHG C;  4O1N A;  5CHV C;  3B2F A;  4MJS A;  1R7S A;  1ZUD 2;  2DNF A;  3VQI A;  1EF1 A;  2IJ0 A;  3FAH A;  1XD3 B;  4HJK A;  4MH8 A;  1WXV A;  4IOI E;  1T5X D;  1YMH E;  4ARC A;  2Z59 B;  4BFR A;  2N9K A;  4M01 A;  3T9L A;  3AMZ A;  3PVL A;  2EMS A;  2KT7 A;  3I5J C;  2B3A A;  3O65 B;  2K5P A;  1UWX A;  1Z5S B;  3EGR A;  1Y8R C;  2NBU A;  3AU5 A;  3CMM B;  3PO0 A;  3VFK A;  1C79 A;  2WWZ A;  2OOB B;  1V49 A;  4RF0 A;  1JRP A;  4RGO S;  5AZH A;  4AP4 C;  2YLM A;  3AEA B;  2L32 A;  5C23 A;  5MPO A;  4I6P A;  1YQB A;  1C4P A;  2J0K A;  2GBJ A;  2KJ6 A;  3L13 A;  1KLU D;  4OVV A;  2W3R A;  2Z0D B;  3TEX A;  3UQA A;  2KDE B;  1UGJ A;  2JQR B;  2KFK A;  2OED A;  2VH2 A;  1SSN A;  1ET9 A;  2L7R A;  3O13 A;  1C4C A;  2D2Q A;  2BTE A;  2V4I B;  2LHE A;  1VR9 A;  4DQO C;  3R7Q A;  3A4S C;  2ACZ B;  4CHK A;  3VVW B;  2VZK D;  2WXH A;  1R4M I;  1WX8 A;  1WE6 A;  1P9D U;  1I4P A;  3PHW B;  4W9F A;  5IP4 D;  2TSS A;  3R8B A;  4C7Y A;  2BPS A;  2WYQ A;  1TT5 B;  4PYZ A;  5CTR C;  5G5G A;  3ZJT A;  3MHS D;  2KXJ A;  3ZJU A;  4OHJ A;  1P7F A;  2DYO A;  2GOW A;  3RUL A;  4WIP A;  3HHM A;  4REZ A;  2DHZ A;  2Q5W D;  1R4M B;  1WGR A;  2M19 A;  5D6J B;  4FJY A;  3B9J A;  3QK0 A;  1HA5 A;  3APD A;  4X57 B;  4C56 C;  4AS1 A;  1JRU A;  1C4A A;  1IBX B;  1P98 A;  4YSY B;  1H7X A;  1T0S C;  1UF0 A;  1UGM A;  2MBE A;  2QMT A;  2E6X A;  1LGR A;  3PZ8 A;  3VH3 B;  5J17 A;  1UEL A;  2ASQ A;  2WS3 B;  1F1H A;  1GUA B;  2J4X A;  4B0M A;  3ML9 A;  4ZRP A;  2ZCC A;  3ZNH B;  2KTF A;  3AE5 B;  1YIW A;  4KGT A;  5IAA C;  3DBS A;  2LGX A;  2LZ6 A;  1F2R C;  4FN2 A;  4DWF A;  3PRZ A;  2V3N A;  2K25 A;  1PFD A;  4C4V B;  4CO7 A;  2Y3A A;  4HKZ E;  2FCN A;  1KFY B;  1E7P B;  2PJH A;  3GE3 C;  3WAM A;  1MHX A;  2LD9 A;  4EE2 A;  3AB5 A;  2D07 B;  4P1C C;  1ZDV A;  2IBI B;  2PKO A;  4BZA A;  1XCT L;  2KAC A;  1K8R B;  2G45 B;  2KTR B;  1E5W A;  1N5X A;  4WUR A;  1LQB A;  3L0W B;  4KDL B;  4BKS A;  3AEG B;  5D7G A;  1DOY A;  2LWP A;  3W5V B;  3B0A A;  2N9P C;  1WGY A;  2QJL A;  1I4Q A;  1EF5 A;  3ZXV A;  4HKQ A;  3BVG A;  3ZVV A;  2KDI A;  2CJO A;  3U8Z A;  3RCZ A;  2M0A A;  3VUW A;  3I63 C;  1JCK B;  4G11 A;  1C76 A;  3NHE B;  4JL9 A;  4ZHO A;  2INC C;  4C00 A;  3Q2A C;  2PEA A;  1V6E A;  2WQY B;  3UIO B;  3JSV A;  1BML C;  1N60 A;  5G2N A;  2N1V A;  1IPG A;  2MRP A;  3AED B;  3DBL I;  3MC0 B;  2BB5 A;  2CHW A;  5DCN A;  1Q5W B;  3BK2 A;  2WDT B;  1V8C A;  2BT6 A;  3ECI A;  1SB3 C;  2C60 A;  2BYV E;  3Q3F A;  4FHK A;  4BOZ B;  2A4Z A;  4ZRK A;  2ZPN A;  3ZYY X;  1UWM A;  4DHJ D;  5IO9 A;  2AQ1 B;  2KJH B;  5EE0 A;  1GTE A;  2JF5 A;  2FCS A;  4G3X B;  1M4V A;  2BS4 B;  3PT2 B;  3MJ5 A;  1E7V A;  4GB9 A;  3EUB 2;  1WH3 A;  3DVG X;  3P4Q B;  1ROE A;  1WR6 E;  3TSS A;  2NVU I;  2O6V A;  1OQR A;  4PS3 A;  2N9X A;  3A9K A;  1Q1O A;  3EA6 A;  5BYR A;  2KLC A;  4YT0 B;  2C9W B;  1C1Y B;  4ACF A;  4MH0 E;  2LVQ A;  2XEW A;  3K9O B;  2Y5C A;  1OQQ A;  1VZ7 A;  3HRD D;  2IY1 B;  3VUX A;  4WQO B;  3RN9 C;  1BXT A;  2D3A A;  4HLE A;  4DK5 A;  2I2Y A;  2DLB A;  1YD8 U;  3Q3J A;  3IHP C;  3VR8 B;  2PE6 B;  3NZ3 A;  2K6D B;  4LNF A;  1P7E A;  4ZRJ A;  2BKF A;  2NMQ A;  3K9P B;  4RF1 A;  3VHT C;  1QOB A;  5H8Y E;  2ZCB A;  5H92 C;  2KZR A;  3GE8 C;  1TKE A;  1T0Y A;  3QJZ A;  2HD5 B;  3R3M A;  4GDL A;  2DEN B;  4YTN B;  5CX3 A;  2ZPY A;  4FJV B;  3IBE A;  2GI9 A;  2K1F A;  1ZOY B;  1VD2 A;  3FIL A;  4ASW C;  3AU4 A;  4JWU C;  4D2K A;  2ZVO A;  4LTU A;  2LEK A;  2MCN B;  3QWZ B;  2IO0 B;  3B1L X;  3EFU A;  4A90 A;  4IM3 A;  1IP9 A;  4GSW A;  2KHW B;  2AYO B;  2NTS A;  1TGZ B;  2KNB A;  4YWG G;  1SE4 A;  2QEJ C;  4JX1 C;  2N1W A;  3GOE A;  2QIL A;  2XK5 B;  3FKY A;  5D94 A;  1I42 A;  1OFF A;  2WDV B;  4E71 A;  4MSQ B;  4OZC A;  3PHX B;  2DZM A;  1S3S G;  4DHJ B;  4N9F 4;  2E3T A;  4B9K A;  3WAP A;  2LGD A;  2REX A;  1TS2 A;  3P4R B;  1WMH A;  5DPS A;  3QIJ A;  1JAL A;  3ZJV A;  1GNU A;  1UD7 A;  2W55 A;  2WXM A;  3VH4 B;  4WAA A;  1ZXH A;  4DHZ E;  3FC4 A;  4I6N B;  3MC9 A;  1T3Q A;  3JSV B;  3A1Q B;  2LHD A;  1WRI A;  3AE8 B;  5FR6 A;  2NPT B;  2D11 A;  1P3Q U;  3SR6 A;  1FM0 D;  3EHV A;  5LNK 1;  2KVR A;  2QSD A;  3DBL B;  1UZX B;  1VZ6 A;  2AQ3 B;  1H7W A;  4RCO A;  3V61 A;  4GXB A;  1UUP A;  1F77 A;  3M3J A;  4TQ1 A;  3RNE C;  2WGS A;  4CQN A;  1GJZ A;  3RZW C;  5JZE B;  1KJT A;  3NVW A;  2O6V D;  2PVO D;  4BOS C;  3OJ4 B;  4M0W A;  4MEL A;  1I4X A;  2ONQ A;  1SIJ A;  1V5O A;  4MT5 A;  4XX5 A;  4C4V A;  2JXT A;  2HJ8 A;  3AV8 A;  1ZP0 B;  1E10 A;  2LRW A;  2RD0 A;  3GZN B;  3BVZ A;  1PDX A;  2WX0 A;  1E8Y A;  4B6W A;  1UBI A;  2CR5 A;  5EE1 A;  3SHQ A;  1HXY D;  1YN3 A;  1SXT A;  2LAS A;  1TBE A;  4A3P A;  1LXD A;  5GMV A;  5C1Z A;  2GBR A;  1F0Z A;  2N9L A;  3IAS 1;  2JWZ A;  3GZN I;  3AUL A;  2QHO A;  4MM3 B;  1NI3 A;  2PIA A;  4GMV A;  2XK5 A;  1WFY A;  1NVI D;  1XO3 A;  1RYJ A;  1FCL A;  2WU5 B;  2UU7 A;  3HVD A;  1JWB D;  4XWT A;  3S2A A;  4JLC A;  3X23 A;  1KLG D;  1FXA A;  1D6E C;  4DHZ B;  2Z8L A;  2FIF A;  2MX2 A;  2N4F A;  2KO3 A;  3RPF C;  1MHH E;  1JWA D;  2DAJ A;  2O2V B;  4LNN A;  1R4N I;  2KWD A;  3TMP B;  1FMA D;  3A9J B;  1B9R A;  1UNS A;  3ZIM A;  3IFW B;  1WXS A;  3P63 A;  1GTH A;  2JYE A;  2EKI A;  1MFW A;  4LJO B;  3PLV A;  1I35 A;  2JRI B;  4LNK A;  2BF8 B;  1YN5 A;  2FUG 1;  1V2Y A;  3RD2 A;  1J7A A;  4J3O D;  2N9E B;  4PS7 A;  2DZK A;  3HVZ A;  4M0W B;  3MFG A;  3APF A;  5E6N A;  4P1B C;  2ZEQ A;  3ZO5 B;  1U4A A;  4ARI A;  3JW0 X;  4MGZ E;  3A1Q A;  3M95 A;  4MDK E;  1NYQ A;  2BW2 A;  3LXF A;  1J8C A;  2GRI A;  2W9N A;  1JWS D;  3Q8C A;  1WJN A;  5BYQ A;  2WXF A;  4WJQ A;  2WXL A;  1F2R I;  2BS3 B;  1VZ8 A;  4HCN B;  3DQV A;  1QT9 A;  1WXQ A;  4IW0 A;  3R2I A;  1TZO A;  2HTM E;  2WXR A;  1L6V A;  2IO2 B;  3M62 B;  5GXG B;  1TTN A;  4GLS C;  2ICI A;  3E9S A;  2EMT A;  1SJE D;  3VRB B;  2DYB A;  1KM7 A;  2LI5 A;  2MHJ A;  1YJI A;  2MBH A;  2WXJ A;  2LRU A;  4MGI E;  2KN4 A;  1RRB A;  1TYG B;  1GB4 A;  4YTM B;  2Y5B B;  4W9D A;  3P1M A;  4BAX A;  4IG7 B;  2WNM A;  5JH5 C;  1EU3 A;  5D2M B;  3AE3 B;  4RMA A;  4TMA B;  3BWU D;  3QC8 B;  1WRD B;  4KIK B;  1YX6 B;  3NVV A;  3V3X A;  1V80 A;  1XLP A;  2MH7 A;  2FCM A;  2ZVN A;  2KDM A;  5D3I B;  3SDL C;  1WZ0 A;  3KYC D;  1PUT A;  4JQW C;  3KWV A;  4GU2 A;  5LXH A;  2V1Y A;  2M4N A;  1LO5 D;  2OJR A;  3N1X C;  3Q3O C;  4OW0 A;  2RDG A;  3N32 A;  2BGF A;  4ANX A;  4ZDV A;  3B08 A;  2W82 A;  2IO1 B;  3UQB A;  1BT0 A;  2JZ3 B;  4HRO A;  4XC2 A;  4WQM A;  4F1S A;  2KFK B;  2PE9 A;  3AI5 A;  4W9L A;  2KWC A;  2WLB A;  3DBH I;  4DXG A;  5EE9 A;  2V9H A;  3N30 A;  3AM9 A;  2LXA A;  4GOC A;  1L0X B;  3IT6 B;  3RFZ B;  2ZNV C;  3RNG C;  1WWT A;  2KQ7 A;  1QIL A;  3DVN U;  2WXP A;  2D10 A;  1PGA A;  1BUI C;  2K3U A;  2EKE C;  3Q3N C;  2KKC A;  3ZXR A;  3A9J A;  4HEA 1;  2MEK A;  5C2T B;  3OJ3 A;  1QF6 A;  4HDO A;  3I3T B;  1WIA A;  3M63 B;  4C7Z A;  2G3Q B;  1YX5 B;  1WZ3 A;  3N9Y C;  1L0Y B;  2L83 A;  2MBO A;  3URY A;  3RZF A;  4LDT B;  3DDC B;  2DAF A;  2RPV A;  2C5L C;  2J52 A;  1F9J A;  1AYF A;  3L54 A;  4MAC A;  4GDK B;  1NBF C;  4UDU C;  3RNB C;  4B0E A;  1GPX A;  1CMX B;  1G6J A;  2K8C A;  4MJS B;  2LJI A;  3NG0 A;  1GG3 A;  3P4S B;  2UYZ B;  4E74 A;  2WXG A;  1F52 A;  1TJE A;  1L2N A;  1IBX A;  2CS4 A;  2V3S A;  1R4N B;  2FE8 A;  4W9J A;  1CJE A;  1TY2 A;  1H8C A;  3APC A;  2LGI A;  2LMC A;  2N0S B;  1XT9 B;  2IY0 B;  2KYW A;  1MG4 A;  5KHQ A;  2INP E;  3TEW A;  2MW5 A;  2HE7 A;  2JSV X;  3L10 B;  1PQS A;  1WX9 A;  2D3C A;  3BK1 A;  3H6N A;  4LLG M;  3TJP A;  4XZ4 A;  1NI2 A;  5HI1 A;  4TUU A;  5JHB A;  1SF0 A;  3NRZ A;  1XEE A;  1MG8 A;  2B76 B;  2WXI A;  3B2G A;  1XLO A;  4AWJ A;  3QCA A;  4DBG A;  5HFY A;  1AW7 A;  1V1O A;  2XN9 C;  5T8I A;  4NZL B;  2KMC A;  5G55 A;  1KTK A;  2N7J A;  4K7S A;  2LGS A;  2LVO A;  4DXA B;  1GC7 A;  3HK0 A;  3LYY A;  3BY4 B;  4FXC A;  2KJR A;  3U7Z A;  1WGG A;  2R61 A;  2KMA A;  4JPS A;  4RNA A;  1E6E B;  4MGY E;  2JZP A;  2V3P A;  1MJD A;  1WXM A;  3ZNG C;  2M1M A;  2XNA C;  4ITK A;  1RFA A;  3KQ4 A;  2AEH A;  1GC6 A; 
#chains in the Genus database with same CATH homology
 2WP9 B;  3AE4 B;  1SE3 A;  4YXD B;  2WXQ A;  2W54 A;  4KKJ A;  1I4R A;  1C78 A;  1MI0 A;  4WWM A;  1IGC A;  2Y5P A;  5BYS A;  1NEK B;  2J42 A;  2OHF A;  5BMH A;  3CIR B;  1QKZ A;  2E3T A;  1L4Z B;  2RMM A;  4P6V F;  1TS2 A;  3P4R B;  4YTP B;  1FO4 A;  4O1N A;  1JAL A;  1ENF A;  3B2F A;  3TUO A;  1J7C A;  3AE7 B;  4RGN A;  3ZJV A;  3SEB A;  1R7S A;  2W55 A;  2WXM A;  1ZXH A;  1ZUD 2;  3FC4 A;  1ACC A;  1IUE A;  2WDQ B;  1T3Q A;  3WCQ A;  3U4E G;  3VQI A;  2LHD A;  2IJ0 A;  3FAH A;  1WRI A;  2NTT A;  1FCC C;  1A70 A;  4A55 A;  2WXN A;  3AE8 B;  4MH8 A;  1WYG A;  4IOI E;  1T5X D;  4N58 A;  1YMH E;  5G5H A;  3ABV B;  2K0P A;  3SR6 A;  4ARC A;  3ETR A;  1FNU A;  4WAF A;  1PYW D;  1FM0 D;  3NUH B;  5D3D A;  2N9K A;  4C80 A;  3GP7 A;  5LNK 1;  1NEN B;  3P42 A;  2QSD A;  3LB8 C;  4WH4 A;  3AMZ A;  5BMI A;  1VZ6 A;  1FIQ A;  2DBY A;  2AQ3 B;  1H7W A;  4RCO A;  2K5P A;  2JX5 A;  2K22 A;  1UWX A;  3EGR A;  4ZRQ A;  2LUM A;  3SFD B;  3PO0 A;  1YQ3 B;  1C79 A;  1YN4 A;  1UUP A;  4RF0 A;  1JRP A;  4RGO S;  1HQR D;  1F77 A;  1D5Z C;  3AEA B;  3DWM A;  2L32 A;  5MPO A;  4TQ1 A;  5E6J A;  4CQN A;  1C4P A;  1QOG A;  1TY0 A;  3NVW A;  2PVO D;  4M0W A;  1RFK A;  1I4X A;  2ONQ A;  1SIJ A;  4MT5 A;  1KLU D;  2W3R A;  2ON8 A;  3TEX A;  2JXT A;  1UGJ A;  3AV8 A;  1AWD A;  2JQR B;  1ZP0 B;  1E10 A;  1CK1 A;  2OED A;  3IXS A;  5HHD G;  3BVZ A;  1T6B X;  1PDX A;  3ZQ4 A;  1SSN A;  1ET9 A;  3O13 A;  3BVM A;  1C4C A;  2YEP F;  3W9C B;  2BB6 A;  5EE1 A;  1TS3 A;  1K51 A;  2J53 A;  2BTE A;  2V4I B;  2LHE A;  3NVY A;  1VR9 A;  4US9 A;  1HXY D;  2PTL A;  1YN3 A;  1L4D B;  1N63 A;  4DQO C;  1SXT A;  2AQ2 B;  2ACZ B;  3U2S C;  3CWI A;  2VZK D;  1F0Z A;  2N9L A;  3NS1 A;  2WXH A;  3IAS 1;  3Q69 A;  1I4P A;  1K50 A;  2PLP A;  3BII D;  5I4D A;  4MM3 B;  2TSS A;  3R8B A;  4C7Y A;  1NI3 A;  1XLQ A;  2PIA A;  3TEZ A;  2KAJ A;  1NVI D;  1XO3 A;  1RYJ A;  5G5G A;  2M56 B;  3ZJT A;  2L1A A;  3AE2 B;  1FCL A;  3GS2 A;  2WU5 B;  4DXF A;  3ZJU A;  2AX5 A;  1WGK A;  4OHJ A;  1NYR A;  1P7F A;  3HVD A;  1FNV A;  3W2D A;  4JWS C;  2DYO A;  1QQR A;  1JWB D;  1YNT E;  2DWQ A;  4XWT A;  4Q2J A;  4WIP A;  3VR9 B;  1EU4 A;  1V1P A;  1KLG D;  1MPE A;  1FXA A;  1D6E C;  2KQ4 X;  4REZ A;  2Q5W D;  2Z8L A;  1N5W A;  1GT8 A;  2M19 A;  3B9J A;  1HA5 A;  2I38 A;  2PVG C;  1MHH E;  3RPF C;  1I4H A;  1JWA D;  4RGM A;  4C56 C;  4AS1 A;  2KWD A;  1C4A A;  1FMA D;  4LK0 M;  1IBX B;  4YSY B;  1B9R A;  1H7X A;  3Q8E A;  1UNS A;  4A8X C;  3P63 A;  3AEE B;  2IGH A;  3C8Y A;  3AN1 A;  1GTH A;  2JYE A;  2E6X A;  2QMT A;  1L5P A;  5HG2 A;  3T3O A;  1L0V B;  3PZ8 A;  2RDH A;  2WS3 B;  4HRS A;  2EKI A;  2J4X A;  4B0M A;  3R2T A;  4ZRP A;  3P4P B;  4YSX B;  3J9C A;  3AE5 B;  2WU2 B;  4P16 A;  2JYT A;  1SJH D;  1YN5 A;  2FUG 1;  4KGT A;  1J7A A;  4J3O D;  1F2R C;  2PMV A;  4YSZ B;  2INN E;  2MJE A;  3HVZ A;  1HZ5 A;  3MFG A;  1FRR A;  2V3N A;  3DWG C;  3FIL B;  1JRO A;  1RM6 C;  1SE2 A;  1PFD A;  4JE3 B;  1XCQ L;  4ARI A;  2Y3A A;  4HKZ E;  1KFY B;  1E7P B;  4NAW B;  1NYQ A;  4ZHP A;  1MHX A;  1QLB B;  2QIE B;  2BW2 A;  3LXF A;  2GRI A;  1DOI A;  1JWS D;  4EE2 A;  3AB5 A;  3Q8C A;  3L4P A;  1D4B A;  4RH6 A;  5BYQ A;  1FFV A;  2WXF A;  1ZDV A;  3BZD B;  1TKG A;  2WXL A;  1F2R I;  2PKO A;  2BS3 B;  1VZ8 A;  1XCT L;  2KAC A;  1QT9 A;  1WXQ A;  1N5X A;  4WUR A;  3W5U B;  4ZOH C;  3IT4 B;  3R2I A;  4GDL B;  1TZO A;  3AEG B;  5D7G A;  1DOY A;  3W5V B;  4XWW A;  2HTM E;  2WXR A;  1L6V A;  3CF4 A;  2QJL A;  1I4Q A;  4HJG E;  1FFU A;  2MJD A;  5GXG B;  3OWE B;  4GLS C;  2ICI A;  3BYT B;  3IAM 1;  3E9S A;  2GB1 A;  2ZW0 A;  5FR3 A;  4HKQ A;  1SJE D;  3VRB B;  3ZGZ A;  2BYT A;  1EWY C;  3W1S A;  3BVG A;  3KWL A;  4ZYS A;  2CJO A;  2BBC A;  3AE9 B;  3I9V 1;  4TSS A;  1YJI A;  2M0A A;  3HUI A;  3I57 A;  1VJK A;  1D5M C;  1JCK B;  1EWC A;  2WXJ A;  4L23 A;  5JXV A;  1C76 A;  4KKI A;  2CU3 A;  4ZHO A;  2KN4 A;  1KH0 A;  1TYG B;  1GB4 A;  4YTM B;  1KRH A;  3P1M A;  1ZPS A;  3TEY A;  1DGJ A;  1K53 A;  2WQY B;  2WNM A;  1EU3 A;  3MHZ A;  4RFB A;  1CZP A;  3AE3 B;  1BML C;  1N60 A;  1E0Z A;  4TMA B;  2WXO A;  2JWU A;  1JWM D;  3BWU D;  2SAK A;  3AE6 B;  2MJ3 A;  3AED B;  3UI3 A;  3MC0 B;  3NVV A;  3V3X A;  1XLP A;  2BB5 A;  2MH7 A;  5AUK A;  3AEF B;  5C3J B;  1MVK A;  1TS5 A;  3BK2 A;  4US8 A;  2KDM A;  5D3I B;  1XF5 L;  1GOZ A;  1V8C A;  2BT6 A;  1Q10 A;  1C9F A;  1SB3 C;  1PUT A;  3AH7 A;  1V1P B;  5EE3 A;  3KWV A;  3BYY B;  1C77 A;  2X38 A;  3E56 A;  1YJJ A;  3ZYY X;  1E9M A;  1ZDX A;  1LO5 D;  1HEZ E;  3KLS X;  1L6U A;  1UWM A;  4OW0 A;  2RDG A;  2AQ1 B;  1XXG A;  3Q8F A;  4KGR A;  1JW9 D;  2JU6 X;  5EE0 A;  4XDC A;  5BMG A;  1ZE3 D;  2W82 A;  1JQ4 A;  4HRO A;  1FD6 A;  2H89 B;  4WQM A;  5TSS A;  4XE0 A;  2LFI A;  5FKA C;  1GAQ B;  1GTE A;  3U52 E;  1CQV A;  2WLB A;  4DXG A;  1SEB D;  5EE9 A;  1M4V A;  2BS4 B;  1ET6 A;  2FBW B;  3PZ7 A;  2HDE A;  3AM9 A;  2KMM A;  3MJ5 A;  1L0X B;  2G9H D;  2IDY A;  4A9A A;  4L2Y A;  3AEC B;  3AEB B;  1QOF A;  3EUB 2;  3IT6 B;  3RFZ B;  1I7H A;  1PGX A;  4R3D A;  3P4Q B;  1WWT A;  1QIL A;  2WXP A;  1ROE A;  1PGA A;  1BUI C;  2EEL A;  4IKG A;  1EM7 A;  1V97 A;  2DYM A;  2K3U A;  3TSS A;  3H8H A;  2CJN A;  1OQR A;  4HEA 1;  3Q8B A;  4USA A;  1GB1 A;  2MEK A;  3VRA B;  5C2T B;  3Q8A A;  3EA6 A;  1QF6 A;  2D5G A;  5BYR A;  4YT0 B;  1TKY A;  2YEP B;  4L1B A;  4C7Z A;  2G1E A;  4KGS A;  1DOX A;  2IGD A;  1N62 A;  3N9Y C;  1L0Y B;  1FEH A;  2L83 A;  2Y5C A;  1OQQ A;  3URY A;  4IDI A;  1VZ7 A;  3HRD D;  4A6Q A;  1J7B A;  1FRD A;  1BXT A;  2RPV A;  1JML A;  2L52 A;  1TS4 A;  4H2A A;  2J52 A;  1AYF A;  1PGB A;  1ESF A;  1XLN A;  4MAC A;  4RGT A;  5FK9 C;  2DLB A;  2I2Y A;  4GDK B;  2V0G A;  4UDU C;  4B0E A;  1GPX A;  4NAM A;  5AUI A;  3VR8 B;  2LJI A;  3NVZ A;  3NZ3 A;  3V05 A;  3P4S B;  1P7E A;  1ZXI A;  2WXG A;  1TJE A;  2NMQ A;  1YQ4 B;  1I4G A;  4TQ0 A;  1IGD A;  2BS2 B;  4RF1 A;  1IBX A;  2FE8 A;  1CJE A;  1FXI A;  1QOB A;  1VDV A;  5H8Y E;  1TY2 A;  4KX6 B;  4N6E B;  5H92 C;  2LGI A;  2H88 B;  2LMC A;  2VZK B;  2N0S B;  1QOA A;  1TKE A;  1STE A;  1Y56 A;  2INP E;  2PW9 A;  3TEW A;  4YTN B;  2JSV X;  2GI9 A;  3BK1 A;  4LLG M;  2IPK D;  1ZOY B;  3FIL A;  4JWU C;  4D2K A;  1D5X C;  5HI1 A;  2K9X A;  1WSP A;  4LTU A;  2SEB D;  1SF0 A;  1DYQ A;  1FNW A;  3NRZ A;  3MP9 A;  4PT5 A;  2LEK A;  4OVZ A;  1XEE A;  2WXI A;  2B76 B;  4AQ7 A;  3B2G A;  1XLO A;  5HFY A;  1AW7 A;  1V1O A;  4A90 A;  4NJC A;  2XN9 C;  1VRA B;  5T8I A;  4NZL B;  2ZW1 A;  1KF6 B;  1RWS A;  1KTK A;  2N7J A;  2NTS A;  1VLB A;  1SBB B;  4XDD A;  1B1Z A;  4N59 A;  2WDR B;  2W3S A;  1HZ6 A;  3LYY A;  2IGG A;  1JWU D;  4YWG G;  4OZA A;  1AN8 A;  1SE4 A;  4FXC A;  3U7Z A;  2QEJ C;  4JX1 C;  2R61 A;  2QIL A;  1K52 A;  3AE1 B;  4JPS A;  4RNA A;  3GB1 A;  1E6E B;  2JZP A;  3SFE B;  1OFF A;  4OZB A;  2WDV B;  2V3P A;  1N61 A;  4OZC A;  2XNA C;  4ITK A;  3KQ4 A;  3T3N A;  2WXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...