3AE7B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 52
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae7B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae7B01
1L0VB 3AEEB 1FXAA 1TJEA 1UWMA 2G1EA 4JX1C 4N59A 2WDQB 1KFYB 1YJIA 1XLPA 3PO0A 1OQRA 1E10A 4US8A 2WS3B 2PIAA 2QJLA 2PVGC 3AE7B 1RWSA 2W3RA 3FC4A 3AV8A 1AYFA 1GTEA 2BS3B 1FFUA 1VLBA 1YJJA 1ZOYB 1KF6B 5C3JB 1JW9D 2W55A 5EE3A 3AEAB 4N58A 1TYGB 2FBWB 5GXGB 3HRDD 1FRDA 1GT8A 4N6EB 4WQMA 1XO3A 3AE3B 2CJNA 2JQRB 5EE9A 1JWBD 1QOFA 1ZXIA 3AH7A 3AE2B 1SB3C 3AE1B 1JWAD 3CIRB 1CJEA 3AM9A 3VR9B 4P6VF 2K9XA 2MJ3A 3VRBB 2BT6A 2AX5A 2MJEA 3P4PB 2WLBA 3AE9B 1XLNA 2WQYB 1JROA 1L6UA 2H88B 1WXQA 3AEFB 1R7SA 1SIJA 1ZUD2 3CWIA 3HVZA 1B9RA 3VRAB 2L52A 1YQ3B 2KMMA 2LEKA 1NENB 2DWQA 1JRPA 5AUKA 3WCQA 2CU3A 4YTNB 1OFFA 1XLOA 1I7HA 1PDXA 1RM6C 2CJOA 3B9JA 3AEDB 4HROA 1GTHA 3EUB2 1E9MA 2MH7A 3W9CB 1N60A 5EE1A 3P4SB 3L4PA 3P1MA 1FMAD 1FIQA 1FXIA 4ZOHC 2ACZB 1ZP0B 1A70A 1QLBB 1L5PA 3BIID 4ITKA 3W5UB 1QF6A 1PUTA 3B2GA 1QOAA 1F0ZA 1XLQA 3DWGC 3AE4B 3B2FA 3NS1A 1NEKB 2K22A 3ETRA 1N63A 2BS4B 2K5PA 1V8CA 1FRRA 3HUIA 3KWLA 3P4RB 4YSYB 4ZHPA 4JWSC 1QOBA 1H7WA 2W3SA 1VJKA 1H7XA 1PFDA 2HTME 3NVWA 3AEBB 3DWMA 5H8YE 1RYJA 2E3TA 1NYRA 4C7YA 3AECB 1E7PB 1J7BA 1FM0D 3SR6A 1JQ4A 1N61A 1KRHA 4FXCA 1QT9A 2JX5A 1N5WA 1TKYA 1CZPA 3NRZA 3NVVA 3AE5B 4USAA 1AWDA 3RPFC 1OQQA 2WDRB 3ABVB 1N62A 1FO4A 3VR8B 2DBYA 3P63A 4US9A 2OHFA 1VDVA 5MPOA 1TKGA 1V97A 2KAJA 1EWYC 4JWUC 5EE0A 5G5HA 4YTPB 1TKEA 2Y5CA 4HRSA 1T3QA 2WP9B 4YSZB 1DOXA 2M19A 3AE6B 3AE8B 2BS2B 3AN1A 2Q5WD 1E0ZA 1N5XA 1SF0A 1WGKA 1WRIA 4YTMB 3CF4A 4YSXB 1ROEA 2L83A 2QIEB 1NYQA 3AMZA 3NVYA 1NVID 3LXFA 4IDIA 3W5VB 1J7CA 1YQ4B 2W54A 5C2TB 5H92C 2WU5B 1GAQB 3FAHA 3NVZA 2N0SB 1GPXA 4C80A 3SFEB 1FFVA 1RFKA 3LB8C 3P4QB 2WU2B 4C7ZA 2WDVB 1L6VA 2PKOA 4ZHOA 3AEGB 1E6EB 3SFDB 2H89B 1QOGA 5AUIA 4A9AA 3ZYYX 1DOYA 2MJDA 2PVOD 5G5GA 3AB5A 1J7AA 1WWTA 2EKIA 4WWMA 1JALA 1DGJA 1WYGA 1IUEA 4LTUA 4KX6B 4YT0B 4YXDB 1DOIA 2M56B 1NI3A 2B76B
chains in the Genus database with same CATH superfamily
1OQRA 3R2TA 4IG7B 1G6JA 2R2QA 4RF1A 3AEAB 2GBMA 4D2KA 4JE3B 2MBBB 4PS3A 3UQAA 3N1XC 4K81A 3FILA 4LDTB 3NHEB 2K0PA 2AX5A 2INCC 2WLBA 1R4NB 5CHWA 3RNAC 2N9LA 1ZUD2 2KYWA 1P3QU 5E6JA 3MP9A 3VVWB 3B9JA 3KQ4A 3EUB2 3W9CB 3DCGA 5L95C 4KV2A 3W1SC 1F0ZA 1AW7A 4LJPB 1VR9A 3UF8A 1TZ1A 2VH1A 4JWSC 1Q1OA 4TQ0A 4ZRPA 4XWTA 2NBUA 2DYBA 3W2DA 4RH6A 2DYOA 3ML9A 3M3JA 1I4GA 3AXCA 1N5WA 1CZPA 3KH0A 1TY0A 5E6OA 2O2VA 3DBLB 2WDRB 5BYSA 2J0KA 1CK1A 1CMXB 4IC7B 2XBBC 2MX2A 3UINB 2MP2B 1I35A 3QC8B 2M4NA 3A4SC 3AE6B 3PZ8A 1I42A 3BK1A 2KQ7A 4LCDE 5KHOA 4HKQA 4S0RA 5BMGA 5G55A 1FFVA 1ZGUB 2PJHA 4TQ1A 3FKYA 2VZKD 5AUIA 1D5ZC 1DOYA 2EKIA 2DZIA 2GBJA 2KFKA 1HQRD 5D3DA 2Y5PA 4OZBA 4ZRIA 1YJIA 4AQ7A 2N1VA 3OLMD 4FA6A 1IP9A 2INPE 2GBKA 4FHJA 4WQOB 2YEPB 5C3JB 3KLSX 2FBWB 4MGZE 3AE3B 1E90A 2ZVOA 3P2BA 1Z2MA 4C4VB 3M62B 3HM3A 3P4PB 3V61A 1SIJA 1WJ6A 2LMCA 4IW0A 1QZEA 1WGRA 4AJYB 2CU3A 3K9PB 2WXFA 3SU8X 3P1MA 1LM8B 2WWZA 1A70A 1XD3B 2I38A 1FD6A 3DWGC 5CTRC 2PMVA 4CYEA 4RGMA 1NEKB 3PGEA 3BVMA 2K5PA 1CQVA 3L0WB 1RRBA 2GMIC 3RNGC 2FIFA 4WWNA 1GB4A 4IWPA 1L0YB 3FILB 2FAZA 3NVWA 1RYJA 2KTFA 2I1JA 3DPDA 4YWGG 4IWQA 1S1QB 2ZNVB 3JSVA 4BKGA 1UGMA 1V5TA 2Z59B 4OVUA 3U8ZA 1UBIA 3T3OA 4MM3B 2L00B 2IYDB 3C19A 1N5XA 2L83A 2BYFA 2CHWA 1V49A 3R8BA 2KNBA 4LNNA 5LXHA 3ZO5B 3KUZA 4NQLB 3MC8A 5IAAC 5TR5A 1WR6E 3V60A 2K39A 5IOIA 4TSSA 1K52A 4II3B 3LYYA 4KZ0A 4YL8A 2J0JA 5D6JB 2JRHA 2NPTB 2KO3A 2MHJA 1MJDA 5C23A 3A9KB 1JWSD 5GXGB 2WXMA 1GT8A 3N1ZC 5EE9A 2KLCA 4P1CC 3H7PA 3AE2B 3GS2A 4IM3A 3AEFB 1R7SA 5DPTA 4EZLA 4YTNB 1E8WA 2CJOA 2D3CA 2IGDA 4KIKB 1DYQA 4MJSB 2MH7A 5DPWA 3SHQA 4ZOHC 1UELA 3PT2B 2WGSA 3AULA 1P9DU 3PLVA 4BBNC 3DBRI 2LI5A 4RGTA 4NJ6A 3GE3C 1FRRA 2IJ0A 1J19A 1QOBA 1T0SC 3Q3JA 3RD2A 2K1FA 4W9CA 3L10B 2AL3A 2LASA 1ZPSA 4RF0A 4BOSC 4RNAA 3KUCB 2BF8B 3AE5B 3N9YC 3APDA 1UNSA 1FO4A 3OJ4B 3EGRA 2UWQA 4JL9A 2OEDA 4A8XC 2KT7A 5AZFA 3AE8B 2BS2B 3MTNB 1PGXA 1OEYA 1ZKHA 4KSKC 1FCLA 1WY8A 2NCNA 1HE8A 2XNAC 1EO6A 2KJ6A 2W9NA 4M0WA 2KOXA 2K3UA 4ANUA 4B0EA 4FJVB 1F2RC 4ZHOA 1H8CA 1LXDA 1SE3A 4PK1A 1QOGA 3TEYA 5G5GA 3X23A 3Q6BA 3MC9A 1P7EA 1DGJA 5CHFA 3JSVB 3AI5A 1EF1A 2LVOA 3QK0A 4XDDA 2BYEA 1T5XD 2ZJDA 2KK8A 3AV8A 4R3DA 2CU1A 1KF6B 1AN8A 4H2AA 3U2SC 3I57A 1JWBD 2MWSB 1C4CA 2BVCA 3ZXRA 2LGSA 4A6QA 2JZZA 3APCA 5IO9A 1ISNA 3DVNV 3CWIA 4HCPB 3VRAB 5JH5C 4P1BC 1LO5D 4W9KA 3L08A 2MBQA 2BKFA 3P4SB 3NZSA 5FR3A 4IWOA 3B2GA 4TV3A 2PE6B 4DDID 1GJZA 4WJNA 2VH2A 3AE4B 2D07B 3ETRA 4MACA 3NG0A 3KWLA 5BYRA 4MSQB 3HIZA 2BGFA 1H7XA 2HJ1A 3EHVA 4FLHA 5G2NA 1WXVA 3DWMA 4LNIA 2MW5A 1V2YA 3BYYB 1F52A 1F77A 2G4SA 5FKAC 3URYA 4HJGE 1SXTA 5T8IA 2J42A 4LDTD 2LHDA 3IT4B 2IDYA 2NTSA 3VTUA 1UH6A 1T3QA 3A1QA 3IG3A 4YTMB 4LNOA 2Y5BB 1HTQA 1YQ4B 3KYDD 4BBNF 1E7UA 2ZW0A 4M01A 4GSWA 3TEWA 5D2MB 1M94A 2PKOA 3ZRCA 3DHGC 3R7RA 2FUG1 1WWTA 2MQJA 4AWJA 5HG2A 2KMCA 1VLBA 5HI1A 3CMMB 4I6NB 4GU2A 2JWUA 2PTLA 2DZMA 1VZ7A 4OW0A 4US8A 2PLPA 2QJLA 1VCBA 3NUHB 2IO1B 3M63B 4ZYSA 2WDTB 1WE6A 2LHEA 4M0WB 5LNK1 3PZDA 3S2AA 2BT6A 1TS5A 1YN4A 2JPHA 3AE9B 4EE2A 1ET6A 4F7ZA 2KLGA 4KKJA 1YQ3B 3PSEB 1JRPA 3QWZB 1GB1A 2D11A 1WMHA 3L4PA 4HPLB 1D5XC 2LRUA 5D3IB 4HJKA 2MCNB 1IGCA 2CR5A 1SJHD 3ENEA 3EFCA 2KXJA 3KWVA 2BB6A 4WIPA 1VJKA 3DBRB 2KZRA 3L54A 2INNE 1FM0D 3A33B 2MBEA 4IM0A 3IAM1 2JX5A 1TKYA 2M17A 1EM7A 3NVVA 4KGSA 3UIPB 2XEWA 2GLSA 3ZQ4A 2JUOA 1E8ZA 2JXXA 1SF0A 4RM9A 3AMZA 3NVYA 4XYCA 2V9HA 3LXFA 3VH3B 4NAMA 4L23A 1K50A 2C60A 4K7WA 4DHJD 3DVNU 1RFKA 3ZIMA 4IUMB 1WYWB 2FCMA 1E6EB 2MJDA 4L1BA 3ZDTA 3SEBA 3KYCD 1ZXHA 1FXAA 5BYQA 2WDQB 2BBCA 2DLBA 2LGXA 2WS3B 2PIAA 4M8NA 2IY1B 2IBIB 3A1QB 4IM2A 2J7QB 5D7GA 1ZOYB 1WI0A 1KOTA 1XT9B 5EE3A 4ZRJA 2X38A 1FRDA 4HXDA 2ZPYA 2PW9A 4G0NB 1ZXIA 3CIRB 4ANWA 4M02A 3DVGY 1MHXA 1VZ8A 4DQOC 1WXQA 2D10A 2EELA 5J2RA 3ZJVA 3KUDB 1R4MI 3EECA 2C7NB 1QLBB 3W5UB 3RT3B 2FNJB 2A5UA 3IBEA 4NAWA 1XLQA 5BO4B 2L76A 3ZTDA 2K22A 3H9DA 1IYFA 2QC8A 1H7WA 4LJOB 4FN2A 4A55A 2KD0A 2JSVX 1J7BA 3ZNGC 4DBGA 1V1PB 3VQIA 4EZJA 1K8RB 1Q5WB 4RMAA 3DQVA 1WMHB 3P63A 1FNVA 4K7SA 4P16A 1JWMD 3DBSA 4UDUC 4YSZB 5D94A 4XWWA 2LWPA 1Q10A 3ECIA 1NYQA 2ON8A 4NY0A 1VD2A 5C2TB 3ZTCA 1A5RA 3FAHA 1T0RC 2KANA 2DX5B 2YLMA 1YN3A 4A90A 2DYMA 4MGIE 3ZVVA 4GMVA 1XF5L 4DXGA 1WM2A 2LXAA 1OEYJ 4JQWC 2RDBC 2C9WB 2KQSA 1U4AA 1GTEA 2BS3B 2LFIA 1YJJA 1JW9D 2W55A 2BW2A 4HDOA 1EWCA 1ET9A 2DAJA 1XO3A 2CJNA 2KJRA 1KLGD 3VHTC 3NS8A 1HTOA 4NQKE 1MG8A 3DVGX 3UGBB 1E7VA 2MJEA 3APFA 2JYTA 4QAYA 2WXOA 4ACFA 1I7HA 2IZVB 2JVCA 3QJZA 4WAFA 1WIAA 3Q8AA 2FUHB 1L5PA 2FCNA 1SEBD 1T0YA 2EMTA 3NJTA 2MEKA 3B2FA 2Z0EB 2RSUA 4REZA 4EOYA 3QIJA 2HE7A 3KW5B 4GDKB 3VTWA 3V05A 2HTHA 3Q3NC 4MGKE 1JQ4A 2MBHA 4FXCA 4G11A 3RPFC 3RULA 4DHJB 3VDZA 1L2NA 4AOFA 4US9A 3Q8BA 2FCQA 1VDVA 4BKSD 2QSDA 2IGGA 4EUTA 3N20C 3WAMA 3R7QA 3BY4B 2OOBB 4NAWB 2QIEB 2WXRA 5E6PA 4HEA1 1YNTE 4RFBA 4WWOA 2KTRA 3LB8C 2D3GA 4HDQA 3AEGB 4A9AA 1WE7A 5I4DA 3MFGA 4W9IA 4Q2JA 3H1UA 4LTUA 4IOIE 2N7DA 2KQ4X 1L0VB 2DZKA 4N59A 2TSSA 2N7JA 3I63C 5LXIB 4PS8A 1E10A 2L1AA 3DDCB 3AU5A 4S17A 1RWSA 1V9JA 2AQ3B 1PGAA 1GC7A 2EKEC 2LGYA 1UF0A 1WJ4A 2G3QB 4BKSA 3IXSA 2BB5A 1YX6B 4OZCA 2MJ3A 1V86A 2O2VB 1RLFA 2KMMA 3RNCC 1NDDA 1OFFA 1WX8A 1UBQA 4HPPA 1D4BA 1RFAA 1WXMA 2ZNVC 1I4HA 4LNKA 1KLUD 2L0FA 1FIQA 3BIID 1V6EA 1WJUA 1R4MB 1QOAA 1UD7A 1C1YB 3LDZE 2MLBA 2JU6X 2M8SA 1UWXA 1WXSA 3R66C 3K9OB 2KFKB 5H8YE 1L7YA 5HHDG 3I9V1 2LGDA 1D5MC 1YMHE 1C77A 2KWCA 1QT9A 2C7MB 4USAA 1OQQA 5BMIA 5MPOA 1MHHE 1BT0A 1V97A 4EKUA 3RI7C 4GLSC 4MELA 4IDIA 4FBJB 3PVLA 2G4DB 4PYZA 1P98A 3PRZA 2O6VA 5LLIA 1YOVB 2WU2B 2MRPA 2V3NA 3NZUA 2CHZA 1MG4A 2N9EB 3PS6A 4GDLA 4DK5A 2DAFA 2NVUI 2WX1A 2E6XA 3VUYA 2V4IB 4JX1C 1WGHA 1B1ZA 2LGIA 2R61A 3EA6A 1TBEA 3BWUD 3IAS1 2FE8A 2GBRA 4HVBA 4B0MA 3H8HA 1RAXA 1WZ3A 1SB3C 1SSNA 2V4LA 2YEPF 4HPMB 1I4PA 3QQ8B 2K9XA 1NI2A 1KLVA 2D3BA 1NENB 2KDEB 2YVCA 1EU3A 4KSLC 1GTHA 1MI0A 3WALA 2IO2B 2V3SA 2AYOB 3RFZB 3MHSD 3TL5A 1WGDA 2V1YA 5E6NA 3HHMA 2W82A 2KC1A 4A3PA 1KM7A 4NJ7A 4M8MA 4ZHPA 5AZHA 1ESFA 3AEBB 2BYVE 1D3ZA 4BVUC 1GNUA 1N61A 4MEMA 5J18A 2GOWA 5IP4D 2JYEA 3WAOA 3VXWA 3EFUA 4WAAA 4GIVA 5EE0A 4HRSA 3N3KB 3B0AA 3H7PB 5CHVC 4N9F4 4M00A 2KJHB 5H92C 2WU5B 2BPSA 2SAKA 3R2IA 4ASWC 5JHBA 3N32A 3MJ5A 1IBXA 2ZCBA 3Q8CA 4WWPA 4WURA 4WWMA 1E8YA 3HK0A 3TEZA 3WAPA 5GMVA 1HZ6A 4MDKE 1ZDVA 5DCNA 1Q0WB 3DOWA 4OHJA 1I4RA 5KHQA 2KFJA 3FC4A 2IO0B 1V1OA 2K8CA 4FULA 1XCQL 5DPRA 3TEXA 3T3NA 1J8CA 3NZ3A 2QCZA 1JWUD 4FHKA 1NBFC 2OJWA 2LZ6A 1L4ZB 3B08A 1FNWA 1QKZA 4ICUA 2WQYB 2V0GA 3C0RB 4DXFA 4J6IA 4AUQC 3U4EG 1K51A 5AUKA 3ZNHB 1OTRB 2NMQA 4GN1A 1RM6C 2KDMA 4P7IA 4ANXA 4CHKA 1E9MA 4CO7A 1MFWA 2NS5A 3W1SA 1FXIA 2KACA 4ITKA 2JT4B 1QF6A 4XC2A 2ONQA 5IN7A 1ENFA 3QX1A 2KDIA 3O65B 1I4XA 1N63A 2B3AA 1SE2A 2J0MA 2JWZA 1AARA 3PZ7A 4WJQA 1NYRA 3WANA 4C56C 3SR6A 2K6QA 2CKHB 1N62A 5C1ZA 3BYTB 4O1NA 2OHFA 1PYWD 3RNFC 3TMPB 4XDCA 2DNFA 1D6EC 4JWUC 2Y5CA 1TZOA 1GG3A 3MHZA 3CF4A 3VTVA 2WXLA 4TKNA 1J7CA 4G50A 3UI3A 2AQ1B 4G3XB 3NY5A 2BKRB 3BINA 4GOCA 1QILA 2NBWB 3QA8A 4AJWA 1HA5A 4W9FA 2M56B 1WX7A 4XZ4A 2KWVB 4II2B 3MC0B 1YN5A 1ZW7A 2JZ3B 1WJNA 2PVGC 2K25A 4C80A 3V6CB 2LXCA 3RYTA 2WX0A 3RZFA 3AE1B 2GRIA 3TSSA 4I6LB 3VRBB 2I2YA 1PQSA 1JROA 3GOEA 3ZNZB 3HVZA 2GBNA 1BXTA 2QILA 4EEWA 4HROA 4TMAB 3L16A 4XE0A 5L83A 3AU4A 3DHIC 4A20A 4MT5A 1XEEA 2HDEA 2JY6A 2ACZB 4J3OD 3X0WA 2KVZA 2AEHA 4MH0E 1I4QA 4OZAA 1FNUA 3GZNI 4EFOA 1GOZA 2LJIA 3P4RB 3ZDMC 4ICVA 2W3SA 3ZNID 3Q8EA 3BK2A 2UU7A 1M4VA 1L0XB 1S3SG 1YX5B 3PV1A 4C4VA 1SGHA 2K6DB 3NRZA 1AWDA 1BMLC 3RZWC 5G5HA 4FJZA 4EZKA 1DOXA 4MSMB 1MPEA 2PE9A 1GUAB 1F9JA 2MA9B 3GE8C 3NVZA 2N0SB 3A9JA 3U52E 3PPAA 1YIWA 2LUEA 1P1AA 2K8HA 1OGWA 4RGOS 2H89B 3Q3MC 3EC8A 4KVGB 4E3CA 2OJRA 1J7AA 4F1SA 1BUIC 3IVFA 2B76B 3AEEB 2NR2A 2ICIA 1ZE3D 1KTKA 3PO0A 1N6ZA 4PYUA 1H4RA 2KHWB 1J0GA 3QAQA 1F2RI 3HRDD 4MM3A 1V80A 2JQRB 3HVDA 4BFRA 4W9HA 3QHTA 1YJ1A 2C7HA 1E5WA 3IT6B 3JYUA 4W9DA 1T0QC 1HEZE 2N1WA 3Q8FA 3BVZA 3Q3FA 4NZLB 2KN4A 2NTTA 4TUUA 4KZCA 1ZP0B 4W9LA 1MVKA 3WA0A 2NPTA 1VZ6A 4DWFA 2HJ8A 3PHWB 4JPSA 3A9KA 1K53A 1WGGA 5HKHA 1PFDA 1KH0A 4C7YA 2L05A 3D32A 2GI9A 3Q3OC 4GXBA 4ZYNA 3ZGZA 2KWDA 5AEKB 4JGHB 2IPKD 1EWYC 1IGDA 2WP9B 1SJED 2A4ZA 3Q14C 2K8BA 4KIKA 4MJSA 1E0ZA 5FK9C 2DHZA 1WRIA 3VFKA 3W5VB 2G9HD 1VRAB 1WXAA 4MH8A 1FCCC 1WFYA 2J53A 1WRDB 1L6VA 4GB9A 3SFDB 3ZYYX 2RDGA 2QHOA 3B1LX 1LGRA 1P0RA 1WYGA 4YXDB 2WXJA 3CF6E 1NI3A 4AS1A 1TJEA 1TS3A 1UGJA 2JRIB 1ACCA 3IHPC 2CS4A 4C00A 3VUXA 3SDLC 4KGTA 2CHXA 2RR9A 1XQQA 2KC2A 4FADA 4PT5A 4HLEA 3U30A 4X57B 3AM9A 3A9JB 3TBLD 1C4PA 1STEA 3VAWA 4A3OA 1XLNA 4L2YA 2H88B 3A4RA 4KGRA 3QCAA 3T8MA 3PLUA 2LD9A 4NPNA 2DWQA 2LUMA 3T9LA 2N9XA 3BZDB 1XLOA 2WXGA 2RPQA 3RN9C 4WJPA 1C78A 1FMAD 5FR6A 2BWFA 2AL6A 3TCAA 2J4XA 2C5LC 1SBBB 2PPHA 1WZ0A 1V8CA 1C4AA 2KX0A 4E74A 3GZNB 2HTME 3VH4B 3VUWA 3QARA 2WHIA 3AECB 1TY2A 2KX3A 3ZLZA 1KRHA 1EF5A 3ABVB 2O6VD 2DBYA 1GC6A 4YTPB 3AN1A 2Q5WD 4YSXB 3ZUNA 2WNMA 2W54A 2IGHA 1EUVB 1GPXA 4C7ZA 2WDVB 5DPSA 1F1HA 2ZCCA 3AB5A 3H6NA 4ARCA 2N4FA 1TS4A 4ANVA 3GP7A 3DBHI 2VRRB 2W3RA 4BOZB 4WH4A 4DXAB 1IPGA 5HFYA 1AYFA 2MSED 1FFUA 1C9FA 3I3TB 1FEHA 5JHAA 2JXTA 1QOFA 2QEJC 1CJEA 3E9SA 3RMKC 3VR9B 3V62A 3ZKJC 2BWES 2KKCA 2BYTA 2L0TA 1JMLA 3TJPA 5EDSA 1PDXA 1TGZB 3Q2AC 2FCSA 4HCNB 1KJTA 3E56A 4OVVA 4AP4C 2NBVB 2WYQA 2ZZPB 2G45B 4URKA 3JVZX 2JZPA 2VZKB 2AQ2B 5JXVA 1WR1A 1QQRA 1UZXB 3HM6X 3L17A 3NS1A 2KTRB 1C3TA 1WSPA 1FXTB 3IFWB 4LLGM 3W1YA 2HD5B 4DHZE 3P42A 2KMAA 5J17A 1E8XA 3U7ZA 2E3TA 1E7PB 2N9KA 3N1YC 3RUIB 2J52A 1YQBA 1WH3A 2MBOA 2RPVA 3N30A 4ARIA 4KDIC 2Z0DB 1Y56A 3R3MA 4XGAB 2M19A 4OVZA 1WGKA 1WX9A 1ROEA 3WIMA 4IKGA 3Q69A 4KDLB 3M95A 2REXA 2RGFA 2GB1A 3U7DA 3SFEB 2RDHA 1LQBA 3CSTA 1UUPA 3RNEC 1L4DB 2L3ZA 2DENB 4KX6B 1DOIA 4RGNA 2KWUB 3OG5A 1FPYA 1XXGA 1KFYB 1WF9A 1XLPA 2WXIA 3PRPB 1ZDXA 2I1KA 1TS2A 3AE7B 2AWTA 2LVPA 1LFDA 2M1MA 4N6EB 2ZW1A 4W9GA 3V6EB 3ALBA 1R4NI 1JWAD 4B95A 1XCTL 4MGYE 4B6WA 3ZJUA 3WCQA 2L52A 2LEKA 4WJOA 4ZDVA 4RM8A 2LRWA 1WM3A 3KVFB 1PGBA 4NNJB 1JRUA 3J9CA 1YD8U 5TSSA 3PREA 2O6VB 3HUIA 2INDC 3ZXVA 2M0AA 2XK5A 4GDLB 3ONSA 2WXHA 3TIXA 5AZGA 2N9PC 3DBLI 2ZPNA 4BAXA 2L32A 5BMHA 2ZVNA 2JF5A 3PTFC 2L7RA 3VR8B 3JW0X 2EMSA 2IY0B 1TKEA 4FJYA 4BZAA 3H7SA 4CQNA 4I6PA 4W9EA 2Y3AA 2QMTA 1TT5B 3I5JC 1X1MA 1NVID 2FIDA 4K3CA 4BKTA 2SEBD 1GAQB 3ZRFA 5IKCM 4E71A 2KDBA 4DDGD 4JLCA 3CSFA 1EU4A 2PVOD 2N7EA 2UYZB 3PRMB 1Z5SB 1IUEA 1SE9A 4ZRKA 3GB1A 1SE4A 1UWMA 3OWEB 2G1EA 1V1PA 4HKZE 2WXQA 1TIFA 1Y8RC 4N58A 1TYGB 4WQMA 3DBHB 2IO3B 2L8JA 4JIOU 5CX3A 1WGYA 3AH7A 2WXKA 2KN5A 1SIFA 4P6VF 4K1RB 3BVGA 1L6UA 3RCZA 4K7UA 1V5OA 1B9RA 1C76A 2QDFA 3TUOA 1C79A 3O13A 4B9KA 2BQQA 2WXPA 4XX5A 3AEDB 3NOBA 1N60A 4NJCA 5EE1A 2MP2A 2LJ5A 2D5GA 4KKIA 1PUTA 3L13A 2BS4B 2V3PA 2Z8LA 2BTEA 3ML8A 4YSYB 3PHXB 4K3BA 1IBXB 3UQBA 2WXNA 2RMMA 4RCOA 2X8XX 1JCKB 5IA7A 3UIOB 3MJWA 3C8YA 3DHHC 1HZ5A 3ZW3A 2D2QA 3V3XA 1OQYA 2DZJA 4W9JA 2ZEQA 2M0XA 4HK2A 2ASQA 1P7FA 1TKGA 2LVQA 2KAJA 4GGQA 1V81A 4F8CB 2PEAA 1HXYD 4PS7A 2KDFB 5JZEB 3LJ3A 4DHZB 4LNFA 2XN9C 2XK5B 2D3AA 4ZRQA 3P4QB 1T6BX 4LK0M 3RNBC 3ZJTA 2KVRA 2RD0A 3SD5A 1TTNA 3OJ3A 1JALA 3OAWA 4GDKA 4YT0B 4HWIB 2R2OA
chains in the Genus database with same CATH topology
4AS1A 2V4IB 5HI1A 1TJEA 1TS3A 1UGJA 1B1ZA 4JX1C 2LGIA 2JWUA 2R61A 1ACCA 2PTLA 3EA6A 1OQRA 1VZ7A 4OW0A 3R2TA 3BWUD 3IAS1 4US8A 2FE8A 2PLPA 2QJLA 4KGTA 3NUHB 4RF1A 3AEAB 4ZYSA 4B0MA 3H8HA 4D2KA 4PT5A 4JE3B 1SB3C 1SSNA 2LHEA 5LNK1 2YEPF 1I4PA 3FILA 3AM9A 2K9XA 2K0PA 2BT6A 1TS5A 2AX5A 1C4PA 1STEA 2WLBA 1YN4A 4EE2A 3AE9B 1XLNA 4L2YA 1ET6A 2N9LA 2H88B 4KGRA 1ZUD2 4KKJA 1YQ3B 1NENB 2DWQA 1JRPA 2LUMA 3BZDB 5E6JA 3MP9A 1XLOA 2WXGA 1EU3A 3B9JA 1GB1A 3KQ4A 1GTHA 3EUB2 3W9CB 3L4PA 1C78A 1FMAD 1MI0A 1D5XC 3RFZB 1F0ZA 1AW7A 5D3IB 2J4XA 1VR9A 1SBBB 1IGCA 2W82A 1V8CA 1SJHD 1C4AA 4ZHPA 4JWSC 4WIPA 3KWVA 2BB6A 4TQ0A 4ZRPA 1VJKA 2HTME 4XWTA 1ESFA 3AEBB 2INNE 3W2DA 3AECB 4RH6A 1FM0D 1TY2A 2DYOA 1N61A 1KRHA 3IAM1 1I4GA 2JX5A 1N5WA 1TKYA 1CZPA 1EM7A 3NVVA 1TY0A 2WDRB 3ABVB 2JYEA 5BYSA 4KGSA 2DBYA 1CK1A 5EE0A 3ZQ4A 4YTPB 4HRSA 3PZ8A 3AE6B 3BK1A 3AN1A 2Q5WD 1SF0A 3AMZA 3NVYA 4YSXB 3LXFA 2WNMA 4HKQA 2W54A 2IGHA 5H92C 2WU5B 4NAMA 5BMGA 4L23A 1K50A 1GPXA 1FFVA 1RFKA 2SAKA 4TQ1A 4C7ZA 2WDVB 2VZKD 3R2IA 3MJ5A 1E6EB 5AUIA 1D5ZC 1IBXA 3Q8CA 1DOYA 2MJDA 4WURA 3AB5A 2EKIA 4WWMA 4L1BA 4ARCA 1HQRD 5D3DA 2Y5PA 4OZBA 3TEZA 3SEBA 1TS4A 1ZXHA 1FXAA 5BYQA 2WDQB 1HZ6A 1YJIA 1ZDVA 4AQ7A 2BBCA 3GP7A 2DLBA 4OHJA 1I4RA 2WS3B 2PIAA 2INPE 3FC4A 2W3RA 5HFYA 4WH4A 1C9FA 1AYFA 1FFUA 2YEPB 5D7GA 1ZOYB 5C3JB 1FEHA 5EE3A 3KLSX 2X38A 1V1OA 2FBWB 1XCQL 1FRDA 3TEXA 3T3NA 2JXTA 2PW9A 3AE3B 3NZ3A 1QOFA 1ZXIA 2QEJC 1JWUD 3CIRB 1CJEA 3E9SA 3VR9B 1L4ZB 1FNWA 3P4PB 1QKZA 1MHXA 1VZ8A 2WQYB 4DQOC 2BYTA 2V0GA 1WXQA 1SIJA 2LMCA 4DXFA 3U4EG 1K51A 5AUKA 2EELA 1JMLA 2CU3A 2NMQA 1PDXA 1RM6C 3ZJVA 2KDMA 2WXFA 3E56A 1E9MA 3P1MA 3W1SA 1FXIA 2KACA 4ITKA 1A70A 1QLBB 2I38A 2JZPA 3W5UB 1QF6A 2ONQA 2VZKB 2AQ2B 5JXVA 1FD6A 1XLQA 1QQRA 3DWGC 1ENFA 2PMVA 3NS1A 4RGMA 1NEKB 2K22A 1I4XA 1N63A 1WSPA 3BVMA 2K5PA 1CQVA 4LLGM 1SE2A 1GB4A 1L0YB 1H7WA 3FILB 3P42A 4A55A 2JSVX 3NVWA 1RYJA 3U7ZA 3PZ7A 2E3TA 1NYRA 1E7PB 1J7BA 3SR6A 4C56C 2N9KA 4YWGG 1V1PB 2J52A 3VQIA 2RPVA 4ARIA 1N62A 3BYTB 4O1NA 3P63A 1FNVA 2OHFA 1Y56A 1PYWD 4XDCA 1D6EC 4JWUC 4P16A 2Y5CA 1JWMD 4UDUC 3T3OA 4YSZB 1TZOA 4MM3B 2M19A 3MHZA 4OVZA 1N5XA 4XWWA 1WGKA 2L83A 3CF4A 1ROEA 1Q10A 1NYQA 2WXLA 4IKGA 3R8BA 2ON8A 1J7CA 3Q69A 3UI3A 5C2TB 3FAHA 2AQ1B 2GB1A 3SFEB 2RDHA 1YN3A 4A90A 2DYMA 1QILA 1UUPA 1XF5L 4DXGA 1L4DB 4TSSA 1HA5A 1K52A 3LYYA 4KX6B 2M56B 1DOIA 4RGNA 1XXGA 1KFYB 3MC0B 1XLPA 2WXIA 1YN5A 1ZDXA 2PVGC 1TS2A 3AE7B 1GTEA 2BS3B 2LFIA 1YJJA 1JW9D 1JWSD 2BW2A 2W55A 5GXGB 4C80A 1EWCA 1ET9A 2WXMA 1GT8A 4N6EB 2ZW1A 1XO3A 2CJNA 5EE9A 1KLGD 3AE2B 3AE1B 1JWAD 2GRIA 3GS2A 3TSSA 1XCTL 3VRBB 2I2YA 2MJEA 1JROA 2JYTA 3AEFB 1R7SA 3HVZA 3ZJUA 3WCQA 2L52A 2LEKA 1BXTA 2WXOA 4YTNB 1I7HA 2CJOA 2QILA 4HROA 4TMAB 2IGDA 4XE0A 1DYQA 2MH7A 1PGBA 4WAFA 3Q8AA 1XEEA 2HDEA 4MT5A 2ACZB 4J3OD 3J9CA 1L5PA 4ZOHC 1SEBD 5TSSA 1I4QA 2MEKA 4OZAA 3B2FA 1FNUA 4RGTA 3HUIA 1GOZA 1FRRA 2LJIA 3P4RB 2IJ0A 2M0AA 4REZA 1QOBA 4GDLB 2W3SA 2WXHA 4GDKB 3Q8EA 3BK2A 1M4VA 3V05A 1ZPSA 1L0XB 4RF0A 1JQ4A 4RNAA 2L32A 4FXCA 5BMHA 3RPFC 3NRZA 3AE5B 1AWDA 3N9YC 1BMLC 1UNSA 1FO4A 3VR8B 4US9A 3EGRA 3Q8BA 1VDVA 5G5HA 2QSDA 2IGGA 1TKEA 2OEDA 4A8XC 1DOXA 4CQNA 3AE8B 2BS2B 2Y3AA 1MPEA 2QMTA 4NAWB 1PGXA 2QIEB 2WXRA 1FCLA 1NVID 4HEA1 2XNAC 1YNTE 2SEBD 1GAQB 4RFBA 4M0WA 2K3UA 3NVZA 2N0SB 3LB8C 4B0EA 3U52E 4ZHOA 1F2RC 4RGOS 1SE3A 3AEGB 2H89B 1QOGA 4A9AA 5I4DA 3TEYA 3MFGA 1EU4A 2PVOD 5G5GA 1J7AA 4Q2JA 1P7EA 1DGJA 4LTUA 1IUEA 4IOIE 1BUIC 2B76B 1SE4A 2KQ4X 3GB1A 1L0VB 3AEEB 1UWMA 3OWEB 2G1EA 1V1PA 4N59A 2ICIA 2TSSA 2N7JA 1ZE3D 4HKZE 1KTKA 3PO0A 1E10A 2L1AA 4XDDA 2WXQA 1T5XD 1RWSA 3AV8A 4R3DA 2AQ3B 1PGAA 1F2RI 1KF6B 4N58A 1TYGB 3HRDD 4WQMA 1AN8A 2JQRB 4H2AA 3HVDA 3I57A 3IXSA 1JWBD 2BB5A 3AH7A 3U2SC 2WXKA 4OZCA 4P6VF 2MJ3A 1C4CA 3BVGA 4A6QA 1L6UA 3IT6B 3CWIA 1B9RA 3VRAB 2KMMA 1HEZE 3Q8FA 1C76A 3BVZA 1OFFA 4NZLB 3TUOA 1C79A 3O13A 2WXPA 3AEDB 1D4BA 1LO5D 2KN4A 2NTTA 1I4HA 1N60A 4NJCA 5EE1A 1KLUD 3P4SB 1FIQA 1ZP0B 2D5GA 3BIID 5FR3A 4KKIA 1PUTA 1MVKA 3B2GA 1QOAA 1VZ6A 3AE4B 2JU6X 3ETRA 4MACA 2BS4B 2V3PA 3KWLA 2Z8LA 1UWXA 4JPSA 5BYRA 2BTEA 4YSYB 1K53A 1IBXB 2WXNA 2RMMA 1H7XA 1PFDA 4RCOA 1KH0A 1JCKB 3DWMA 5H8YE 5HHDG 3I9V1 3C8YA 1D5MC 3BYYB 4C7YA 1F77A 1HZ5A 1C77A 1YMHE 5FKAC 3URYA 4HJGE 1QT9A 1SXTA 3V3XA 2GI9A 4USAA 5T8IA 1OQQA 2J42A 3ZGZA 2KWDA 5BMIA 2LHDA 3IT4B 2IPKD 1P7FA 5MPOA 1MHHE 1TKGA 1V97A 2IDYA 2KAJA 1EWYC 2NTSA 1IGDA 1T3QA 2WP9B 1SJED 4GLSC 1E0ZA 5FK9C 1WRIA 4YTMB 3W5VB 4IDIA 1HXYD 2G9HD 1YQ4B 1VRAB 4MH8A 2ZW0A 1FCCC 2XN9C 3TEWA 2J53A 4ZRQA 3P4QB 2WU2B 2V3NA 1T6BX 2PKOA 1L6VA 4LK0M 3ZJTA 3SFDB 3ZYYX 2RDGA 2FUG1 1WWTA 1JALA 2E6XA 1WYGA 4YT0B 4YXDB 5HG2A 2WXJA 1NI3A 1VLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0V B;  3AEE B;  1FXA A;  1TJE A;  1UWM A;  2G1E A;  4JX1 C;  4N59 A;  2WDQ B;  1KFY B;  1YJI A;  1XLP A;  3PO0 A;  1OQR A;  1E10 A;  4US8 A;  2WS3 B;  2PIA A;  2QJL A;  2PVG C;  3AE7 B;  1RWS A;  2W3R A;  3FC4 A;  3AV8 A;  1AYF A;  1GTE A;  2BS3 B;  1FFU A;  1VLB A;  1YJJ A;  1ZOY B;  1KF6 B;  5C3J B;  1JW9 D;  2W55 A;  5EE3 A;  3AEA B;  4N58 A;  1TYG B;  2FBW B;  5GXG B;  3HRD D;  1FRD A;  1GT8 A;  4N6E B;  4WQM A;  1XO3 A;  3AE3 B;  2CJN A;  2JQR B;  5EE9 A;  1JWB D;  1QOF A;  1ZXI A;  3AH7 A;  3AE2 B;  1SB3 C;  3AE1 B;  1JWA D;  3CIR B;  1CJE A;  3AM9 A;  3VR9 B;  4P6V F;  2K9X A;  2MJ3 A;  3VRB B;  2BT6 A;  2AX5 A;  2MJE A;  3P4P B;  2WLB A;  3AE9 B;  1XLN A;  2WQY B;  1JRO A;  1L6U A;  2H88 B;  1WXQ A;  3AEF B;  1R7S A;  1SIJ A;  1ZUD 2;  3CWI A;  3HVZ A;  1B9R A;  3VRA B;  2L52 A;  1YQ3 B;  2KMM A;  2LEK A;  1NEN B;  2DWQ A;  1JRP A;  5AUK A;  3WCQ A;  2CU3 A;  4YTN B;  1OFF A;  1XLO A;  1I7H A;  1PDX A;  1RM6 C;  2CJO A;  3B9J A;  3AED B;  4HRO A;  1GTH A;  3EUB 2;  1E9M A;  2MH7 A;  3W9C B;  1N60 A;  5EE1 A;  3P4S B;  3L4P A;  3P1M A;  1FMA D;  1FIQ A;  1FXI A;  4ZOH C;  2ACZ B;  1ZP0 B;  1A70 A;  1QLB B;  1L5P A;  3BII D;  4ITK A;  3W5U B;  1QF6 A;  1PUT A;  3B2G A;  1QOA A;  1F0Z A;  1XLQ A;  3DWG C;  3AE4 B;  3B2F A;  3NS1 A;  1NEK B;  2K22 A;  3ETR A;  1N63 A;  2BS4 B;  2K5P A;  1V8C A;  1FRR A;  3HUI A;  3KWL A;  3P4R B;  4YSY B;  4ZHP A;  4JWS C;  1QOB A;  1H7W A;  2W3S A;  1VJK A;  1H7X A;  1PFD A;  2HTM E;  3NVW A;  3AEB B;  3DWM A;  5H8Y E;  1RYJ A;  2E3T A;  1NYR A;  4C7Y A;  3AEC B;  1E7P B;  1J7B A;  1FM0 D;  3SR6 A;  1JQ4 A;  1N61 A;  1KRH A;  4FXC A;  1QT9 A;  2JX5 A;  1N5W A;  1TKY A;  1CZP A;  3NRZ A;  3NVV A;  3AE5 B;  4USA A;  1AWD A;  3RPF C;  1OQQ A;  2WDR B;  3ABV B;  1N62 A;  1FO4 A;  3VR8 B;  2DBY A;  3P63 A;  4US9 A;  2OHF A;  1VDV A;  5MPO A;  1TKG A;  1V97 A;  2KAJ A;  1EWY C;  4JWU C;  5EE0 A;  5G5H A;  4YTP B;  1TKE A;  2Y5C A;  4HRS A;  1T3Q A;  2WP9 B;  4YSZ B;  1DOX A;  2M19 A;  3AE6 B;  3AE8 B;  2BS2 B;  3AN1 A;  2Q5W D;  1E0Z A;  1N5X A;  1SF0 A;  1WGK A;  1WRI A;  4YTM B;  3CF4 A;  4YSX B;  1ROE A;  2L83 A;  2QIE B;  1NYQ A;  3AMZ A;  3NVY A;  1NVI D;  3LXF A;  4IDI A;  3W5V B;  1J7C A;  1YQ4 B;  2W54 A;  5C2T B;  5H92 C;  2WU5 B;  1GAQ B;  3FAH A;  3NVZ A;  2N0S B;  1GPX A;  4C80 A;  3SFE B;  1FFV A;  1RFK A;  3LB8 C;  3P4Q B;  2WU2 B;  4C7Z A;  2WDV B;  1L6V A;  2PKO A;  4ZHO A;  3AEG B;  1E6E B;  3SFD B;  2H89 B;  1QOG A;  5AUI A;  4A9A A;  3ZYY X;  1DOY A;  2MJD A;  2PVO D;  5G5G A;  3AB5 A;  1J7A A;  1WWT A;  2EKI A;  4WWM A;  1JAL A;  1DGJ A;  1WYG A;  1IUE A;  4LTU A;  4KX6 B;  4YT0 B;  4YXD B;  1DOI A;  2M56 B;  1NI3 A;  2B76 B; 
#chains in the Genus database with same CATH topology
 1OQR A;  3R2T A;  4IG7 B;  1G6J A;  2R2Q A;  4RF1 A;  3AEA B;  2GBM A;  4D2K A;  4JE3 B;  2MBB B;  4PS3 A;  3UQA A;  3N1X C;  4K81 A;  3FIL A;  4LDT B;  3NHE B;  2K0P A;  2AX5 A;  2INC C;  2WLB A;  1R4N B;  5CHW A;  3RNA C;  2N9L A;  1ZUD 2;  2KYW A;  1P3Q U;  5E6J A;  3MP9 A;  3VVW B;  3B9J A;  3KQ4 A;  3EUB 2;  3W9C B;  3DCG A;  5L95 C;  4KV2 A;  3W1S C;  1F0Z A;  1AW7 A;  4LJP B;  1VR9 A;  3UF8 A;  1TZ1 A;  2VH1 A;  4JWS C;  1Q1O A;  4TQ0 A;  4ZRP A;  4XWT A;  2NBU A;  2DYB A;  3W2D A;  4RH6 A;  2DYO A;  3ML9 A;  3M3J A;  1I4G A;  3AXC A;  1N5W A;  1CZP A;  3KH0 A;  1TY0 A;  5E6O A;  2O2V A;  3DBL B;  2WDR B;  5BYS A;  2J0K A;  1CK1 A;  1CMX B;  4IC7 B;  2XBB C;  2MX2 A;  3UIN B;  2MP2 B;  1I35 A;  3QC8 B;  2M4N A;  3A4S C;  3AE6 B;  3PZ8 A;  1I42 A;  3BK1 A;  2KQ7 A;  4LCD E;  5KHO A;  4HKQ A;  4S0R A;  5BMG A;  5G55 A;  1FFV A;  1ZGU B;  2PJH A;  4TQ1 A;  3FKY A;  2VZK D;  5AUI A;  1D5Z C;  1DOY A;  2EKI A;  2DZI A;  2GBJ A;  2KFK A;  1HQR D;  5D3D A;  2Y5P A;  4OZB A;  4ZRI A;  1YJI A;  4AQ7 A;  2N1V A;  3OLM D;  4FA6 A;  1IP9 A;  2INP E;  2GBK A;  4FHJ A;  4WQO B;  2YEP B;  5C3J B;  3KLS X;  2FBW B;  4MGZ E;  3AE3 B;  1E90 A;  2ZVO A;  3P2B A;  1Z2M A;  4C4V B;  3M62 B;  3HM3 A;  3P4P B;  3V61 A;  1SIJ A;  1WJ6 A;  2LMC A;  4IW0 A;  1QZE A;  1WGR A;  4AJY B;  2CU3 A;  3K9P B;  2WXF A;  3SU8 X;  3P1M A;  1LM8 B;  2WWZ A;  1A70 A;  1XD3 B;  2I38 A;  1FD6 A;  3DWG C;  5CTR C;  2PMV A;  4CYE A;  4RGM A;  1NEK B;  3PGE A;  3BVM A;  2K5P A;  1CQV A;  3L0W B;  1RRB A;  2GMI C;  3RNG C;  2FIF A;  4WWN A;  1GB4 A;  4IWP A;  1L0Y B;  3FIL B;  2FAZ A;  3NVW A;  1RYJ A;  2KTF A;  2I1J A;  3DPD A;  4YWG G;  4IWQ A;  1S1Q B;  2ZNV B;  3JSV A;  4BKG A;  1UGM A;  1V5T A;  2Z59 B;  4OVU A;  3U8Z A;  1UBI A;  3T3O A;  4MM3 B;  2L00 B;  2IYD B;  3C19 A;  1N5X A;  2L83 A;  2BYF A;  2CHW A;  1V49 A;  3R8B A;  2KNB A;  4LNN A;  5LXH A;  3ZO5 B;  3KUZ A;  4NQL B;  3MC8 A;  5IAA C;  5TR5 A;  1WR6 E;  3V60 A;  2K39 A;  5IOI A;  4TSS A;  1K52 A;  4II3 B;  3LYY A;  4KZ0 A;  4YL8 A;  2J0J A;  5D6J B;  2JRH A;  2NPT B;  2KO3 A;  2MHJ A;  1MJD A;  5C23 A;  3A9K B;  1JWS D;  5GXG B;  2WXM A;  1GT8 A;  3N1Z C;  5EE9 A;  2KLC A;  4P1C C;  3H7P A;  3AE2 B;  3GS2 A;  4IM3 A;  3AEF B;  1R7S A;  5DPT A;  4EZL A;  4YTN B;  1E8W A;  2CJO A;  2D3C A;  2IGD A;  4KIK B;  1DYQ A;  4MJS B;  2MH7 A;  5DPW A;  3SHQ A;  4ZOH C;  1UEL A;  3PT2 B;  2WGS A;  3AUL A;  1P9D U;  3PLV A;  4BBN C;  3DBR I;  2LI5 A;  4RGT A;  4NJ6 A;  3GE3 C;  1FRR A;  2IJ0 A;  1J19 A;  1QOB A;  1T0S C;  3Q3J A;  3RD2 A;  2K1F A;  4W9C A;  3L10 B;  2AL3 A;  2LAS A;  1ZPS A;  4RF0 A;  4BOS C;  4RNA A;  3KUC B;  2BF8 B;  3AE5 B;  3N9Y C;  3APD A;  1UNS A;  1FO4 A;  3OJ4 B;  3EGR A;  2UWQ A;  4JL9 A;  2OED A;  4A8X C;  2KT7 A;  5AZF A;  3AE8 B;  2BS2 B;  3MTN B;  1PGX A;  1OEY A;  1ZKH A;  4KSK C;  1FCL A;  1WY8 A;  2NCN A;  1HE8 A;  2XNA C;  1EO6 A;  2KJ6 A;  2W9N A;  4M0W A;  2KOX A;  2K3U A;  4ANU A;  4B0E A;  4FJV B;  1F2R C;  4ZHO A;  1H8C A;  1LXD A;  1SE3 A;  4PK1 A;  1QOG A;  3TEY A;  5G5G A;  3X23 A;  3Q6B A;  3MC9 A;  1P7E A;  1DGJ A;  5CHF A;  3JSV B;  3AI5 A;  1EF1 A;  2LVO A;  3QK0 A;  4XDD A;  2BYE A;  1T5X D;  2ZJD A;  2KK8 A;  3AV8 A;  4R3D A;  2CU1 A;  1KF6 B;  1AN8 A;  4H2A A;  3U2S C;  3I57 A;  1JWB D;  2MWS B;  1C4C A;  2BVC A;  3ZXR A;  2LGS A;  4A6Q A;  2JZZ A;  3APC A;  5IO9 A;  1ISN A;  3DVN V;  3CWI A;  4HCP B;  3VRA B;  5JH5 C;  4P1B C;  1LO5 D;  4W9K A;  3L08 A;  2MBQ A;  2BKF A;  3P4S B;  3NZS A;  5FR3 A;  4IWO A;  3B2G A;  4TV3 A;  2PE6 B;  4DDI D;  1GJZ A;  4WJN A;  2VH2 A;  3AE4 B;  2D07 B;  3ETR A;  4MAC A;  3NG0 A;  3KWL A;  5BYR A;  4MSQ B;  3HIZ A;  2BGF A;  1H7X A;  2HJ1 A;  3EHV A;  4FLH A;  5G2N A;  1WXV A;  3DWM A;  4LNI A;  2MW5 A;  1V2Y A;  3BYY B;  1F52 A;  1F77 A;  2G4S A;  5FKA C;  3URY A;  4HJG E;  1SXT A;  5T8I A;  2J42 A;  4LDT D;  2LHD A;  3IT4 B;  2IDY A;  2NTS A;  3VTU A;  1UH6 A;  1T3Q A;  3A1Q A;  3IG3 A;  4YTM B;  4LNO A;  2Y5B B;  1HTQ A;  1YQ4 B;  3KYD D;  4BBN F;  1E7U A;  2ZW0 A;  4M01 A;  4GSW A;  3TEW A;  5D2M B;  1M94 A;  2PKO A;  3ZRC A;  3DHG C;  3R7R A;  2FUG 1;  1WWT A;  2MQJ A;  4AWJ A;  5HG2 A;  2KMC A;  1VLB A;  5HI1 A;  3CMM B;  4I6N B;  4GU2 A;  2JWU A;  2PTL A;  2DZM A;  1VZ7 A;  4OW0 A;  4US8 A;  2PLP A;  2QJL A;  1VCB A;  3NUH B;  2IO1 B;  3M63 B;  4ZYS A;  2WDT B;  1WE6 A;  2LHE A;  4M0W B;  5LNK 1;  3PZD A;  3S2A A;  2BT6 A;  1TS5 A;  1YN4 A;  2JPH A;  3AE9 B;  4EE2 A;  1ET6 A;  4F7Z A;  2KLG A;  4KKJ A;  1YQ3 B;  3PSE B;  1JRP A;  3QWZ B;  1GB1 A;  2D11 A;  1WMH A;  3L4P A;  4HPL B;  1D5X C;  2LRU A;  5D3I B;  4HJK A;  2MCN B;  1IGC A;  2CR5 A;  1SJH D;  3ENE A;  3EFC A;  2KXJ A;  3KWV A;  2BB6 A;  4WIP A;  1VJK A;  3DBR B;  2KZR A;  3L54 A;  2INN E;  1FM0 D;  3A33 B;  2MBE A;  4IM0 A;  3IAM 1;  2JX5 A;  1TKY A;  2M17 A;  1EM7 A;  3NVV A;  4KGS A;  3UIP B;  2XEW A;  2GLS A;  3ZQ4 A;  2JUO A;  1E8Z A;  2JXX A;  1SF0 A;  4RM9 A;  3AMZ A;  3NVY A;  4XYC A;  2V9H A;  3LXF A;  3VH3 B;  4NAM A;  4L23 A;  1K50 A;  2C60 A;  4K7W A;  4DHJ D;  3DVN U;  1RFK A;  3ZIM A;  4IUM B;  1WYW B;  2FCM A;  1E6E B;  2MJD A;  4L1B A;  3ZDT A;  3SEB A;  3KYC D;  1ZXH A;  1FXA A;  5BYQ A;  2WDQ B;  2BBC A;  2DLB A;  2LGX A;  2WS3 B;  2PIA A;  4M8N A;  2IY1 B;  2IBI B;  3A1Q B;  4IM2 A;  2J7Q B;  5D7G A;  1ZOY B;  1WI0 A;  1KOT A;  1XT9 B;  5EE3 A;  4ZRJ A;  2X38 A;  1FRD A;  4HXD A;  2ZPY A;  2PW9 A;  4G0N B;  1ZXI A;  3CIR B;  4ANW A;  4M02 A;  3DVG Y;  1MHX A;  1VZ8 A;  4DQO C;  1WXQ A;  2D10 A;  2EEL A;  5J2R A;  3ZJV A;  3KUD B;  1R4M I;  3EEC A;  2C7N B;  1QLB B;  3W5U B;  3RT3 B;  2FNJ B;  2A5U A;  3IBE A;  4NAW A;  1XLQ A;  5BO4 B;  2L76 A;  3ZTD A;  2K22 A;  3H9D A;  1IYF A;  2QC8 A;  1H7W A;  4LJO B;  4FN2 A;  4A55 A;  2KD0 A;  2JSV X;  1J7B A;  3ZNG C;  4DBG A;  1V1P B;  3VQI A;  4EZJ A;  1K8R B;  1Q5W B;  4RMA A;  3DQV A;  1WMH B;  3P63 A;  1FNV A;  4K7S A;  4P16 A;  1JWM D;  3DBS A;  4UDU C;  4YSZ B;  5D94 A;  4XWW A;  2LWP A;  1Q10 A;  3ECI A;  1NYQ A;  2ON8 A;  4NY0 A;  1VD2 A;  5C2T B;  3ZTC A;  1A5R A;  3FAH A;  1T0R C;  2KAN A;  2DX5 B;  2YLM A;  1YN3 A;  4A90 A;  2DYM A;  4MGI E;  3ZVV A;  4GMV A;  1XF5 L;  4DXG A;  1WM2 A;  2LXA A;  1OEY J;  4JQW C;  2RDB C;  2C9W B;  2KQS A;  1U4A A;  1GTE A;  2BS3 B;  2LFI A;  1YJJ A;  1JW9 D;  2W55 A;  2BW2 A;  4HDO A;  1EWC A;  1ET9 A;  2DAJ A;  1XO3 A;  2CJN A;  2KJR A;  1KLG D;  3VHT C;  3NS8 A;  1HTO A;  4NQK E;  1MG8 A;  3DVG X;  3UGB B;  1E7V A;  2MJE A;  3APF A;  2JYT A;  4QAY A;  2WXO A;  4ACF A;  1I7H A;  2IZV B;  2JVC A;  3QJZ A;  4WAF A;  1WIA A;  3Q8A A;  2FUH B;  1L5P A;  2FCN A;  1SEB D;  1T0Y A;  2EMT A;  3NJT A;  2MEK A;  3B2F A;  2Z0E B;  2RSU A;  4REZ A;  4EOY A;  3QIJ A;  2HE7 A;  3KW5 B;  4GDK B;  3VTW A;  3V05 A;  2HTH A;  3Q3N C;  4MGK E;  1JQ4 A;  2MBH A;  4FXC A;  4G11 A;  3RPF C;  3RUL A;  4DHJ B;  3VDZ A;  1L2N A;  4AOF A;  4US9 A;  3Q8B A;  2FCQ A;  1VDV A;  4BKS D;  2QSD A;  2IGG A;  4EUT A;  3N20 C;  3WAM A;  3R7Q A;  3BY4 B;  2OOB B;  4NAW B;  2QIE B;  2WXR A;  5E6P A;  4HEA 1;  1YNT E;  4RFB A;  4WWO A;  2KTR A;  3LB8 C;  2D3G A;  4HDQ A;  3AEG B;  4A9A A;  1WE7 A;  5I4D A;  3MFG A;  4W9I A;  4Q2J A;  3H1U A;  4LTU A;  4IOI E;  2N7D A;  2KQ4 X;  1L0V B;  2DZK A;  4N59 A;  2TSS A;  2N7J A;  3I63 C;  5LXI B;  4PS8 A;  1E10 A;  2L1A A;  3DDC B;  3AU5 A;  4S17 A;  1RWS A;  1V9J A;  2AQ3 B;  1PGA A;  1GC7 A;  2EKE C;  2LGY A;  1UF0 A;  1WJ4 A;  2G3Q B;  4BKS A;  3IXS A;  2BB5 A;  1YX6 B;  4OZC A;  2MJ3 A;  1V86 A;  2O2V B;  1RLF A;  2KMM A;  3RNC C;  1NDD A;  1OFF A;  1WX8 A;  1UBQ A;  4HPP A;  1D4B A;  1RFA A;  1WXM A;  2ZNV C;  1I4H A;  4LNK A;  1KLU D;  2L0F A;  1FIQ A;  3BII D;  1V6E A;  1WJU A;  1R4M B;  1QOA A;  1UD7 A;  1C1Y B;  3LDZ E;  2MLB A;  2JU6 X;  2M8S A;  1UWX A;  1WXS A;  3R66 C;  3K9O B;  2KFK B;  5H8Y E;  1L7Y A;  5HHD G;  3I9V 1;  2LGD A;  1D5M C;  1YMH E;  1C77 A;  2KWC A;  1QT9 A;  2C7M B;  4USA A;  1OQQ A;  5BMI A;  5MPO A;  1MHH E;  1BT0 A;  1V97 A;  4EKU A;  3RI7 C;  4GLS C;  4MEL A;  4IDI A;  4FBJ B;  3PVL A;  2G4D B;  4PYZ A;  1P98 A;  3PRZ A;  2O6V A;  5LLI A;  1YOV B;  2WU2 B;  2MRP A;  2V3N A;  3NZU A;  2CHZ A;  1MG4 A;  2N9E B;  3PS6 A;  4GDL A;  4DK5 A;  2DAF A;  2NVU I;  2WX1 A;  2E6X A;  3VUY A;  2V4I B;  4JX1 C;  1WGH A;  1B1Z A;  2LGI A;  2R61 A;  3EA6 A;  1TBE A;  3BWU D;  3IAS 1;  2FE8 A;  2GBR A;  4HVB A;  4B0M A;  3H8H A;  1RAX A;  1WZ3 A;  1SB3 C;  1SSN A;  2V4L A;  2YEP F;  4HPM B;  1I4P A;  3QQ8 B;  2K9X A;  1NI2 A;  1KLV A;  2D3B A;  1NEN B;  2KDE B;  2YVC A;  1EU3 A;  4KSL C;  1GTH A;  1MI0 A;  3WAL A;  2IO2 B;  2V3S A;  2AYO B;  3RFZ B;  3MHS D;  3TL5 A;  1WGD A;  2V1Y A;  5E6N A;  3HHM A;  2W82 A;  2KC1 A;  4A3P A;  1KM7 A;  4NJ7 A;  4M8M A;  4ZHP A;  5AZH A;  1ESF A;  3AEB B;  2BYV E;  1D3Z A;  4BVU C;  1GNU A;  1N61 A;  4MEM A;  5J18 A;  2GOW A;  5IP4 D;  2JYE A;  3WAO A;  3VXW A;  3EFU A;  4WAA A;  4GIV A;  5EE0 A;  4HRS A;  3N3K B;  3B0A A;  3H7P B;  5CHV C;  4N9F 4;  4M00 A;  2KJH B;  5H92 C;  2WU5 B;  2BPS A;  2SAK A;  3R2I A;  4ASW C;  5JHB A;  3N32 A;  3MJ5 A;  1IBX A;  2ZCB A;  3Q8C A;  4WWP A;  4WUR A;  4WWM A;  1E8Y A;  3HK0 A;  3TEZ A;  3WAP A;  5GMV A;  1HZ6 A;  4MDK E;  1ZDV A;  5DCN A;  1Q0W B;  3DOW A;  4OHJ A;  1I4R A;  5KHQ A;  2KFJ A;  3FC4 A;  2IO0 B;  1V1O A;  2K8C A;  4FUL A;  1XCQ L;  5DPR A;  3TEX A;  3T3N A;  1J8C A;  3NZ3 A;  2QCZ A;  1JWU D;  4FHK A;  1NBF C;  2OJW A;  2LZ6 A;  1L4Z B;  3B08 A;  1FNW A;  1QKZ A;  4ICU A;  2WQY B;  2V0G A;  3C0R B;  4DXF A;  4J6I A;  4AUQ C;  3U4E G;  1K51 A;  5AUK A;  3ZNH B;  1OTR B;  2NMQ A;  4GN1 A;  1RM6 C;  2KDM A;  4P7I A;  4ANX A;  4CHK A;  1E9M A;  4CO7 A;  1MFW A;  2NS5 A;  3W1S A;  1FXI A;  2KAC A;  4ITK A;  2JT4 B;  1QF6 A;  4XC2 A;  2ONQ A;  5IN7 A;  1ENF A;  3QX1 A;  2KDI A;  3O65 B;  1I4X A;  1N63 A;  2B3A A;  1SE2 A;  2J0M A;  2JWZ A;  1AAR A;  3PZ7 A;  4WJQ A;  1NYR A;  3WAN A;  4C56 C;  3SR6 A;  2K6Q A;  2CKH B;  1N62 A;  5C1Z A;  3BYT B;  4O1N A;  2OHF A;  1PYW D;  3RNF C;  3TMP B;  4XDC A;  2DNF A;  1D6E C;  4JWU C;  2Y5C A;  1TZO A;  1GG3 A;  3MHZ A;  3CF4 A;  3VTV A;  2WXL A;  4TKN A;  1J7C A;  4G50 A;  3UI3 A;  2AQ1 B;  4G3X B;  3NY5 A;  2BKR B;  3BIN A;  4GOC A;  1QIL A;  2NBW B;  3QA8 A;  4AJW A;  1HA5 A;  4W9F A;  2M56 B;  1WX7 A;  4XZ4 A;  2KWV B;  4II2 B;  3MC0 B;  1YN5 A;  1ZW7 A;  2JZ3 B;  1WJN A;  2PVG C;  2K25 A;  4C80 A;  3V6C B;  2LXC A;  3RYT A;  2WX0 A;  3RZF A;  3AE1 B;  2GRI A;  3TSS A;  4I6L B;  3VRB B;  2I2Y A;  1PQS A;  1JRO A;  3GOE A;  3ZNZ B;  3HVZ A;  2GBN A;  1BXT A;  2QIL A;  4EEW A;  4HRO A;  4TMA B;  3L16 A;  4XE0 A;  5L83 A;  3AU4 A;  3DHI C;  4A20 A;  4MT5 A;  1XEE A;  2HDE A;  2JY6 A;  2ACZ B;  4J3O D;  3X0W A;  2KVZ A;  2AEH A;  4MH0 E;  1I4Q A;  4OZA A;  1FNU A;  3GZN I;  4EFO A;  1GOZ A;  2LJI A;  3P4R B;  3ZDM C;  4ICV A;  2W3S A;  3ZNI D;  3Q8E A;  3BK2 A;  2UU7 A;  1M4V A;  1L0X B;  1S3S G;  1YX5 B;  3PV1 A;  4C4V A;  1SGH A;  2K6D B;  3NRZ A;  1AWD A;  1BML C;  3RZW C;  5G5H A;  4FJZ A;  4EZK A;  1DOX A;  4MSM B;  1MPE A;  2PE9 A;  1GUA B;  1F9J A;  2MA9 B;  3GE8 C;  3NVZ A;  2N0S B;  3A9J A;  3U52 E;  3PPA A;  1YIW A;  2LUE A;  1P1A A;  2K8H A;  1OGW A;  4RGO S;  2H89 B;  3Q3M C;  3EC8 A;  4KVG B;  4E3C A;  2OJR A;  1J7A A;  4F1S A;  1BUI C;  3IVF A;  2B76 B;  3AEE B;  2NR2 A;  2ICI A;  1ZE3 D;  1KTK A;  3PO0 A;  1N6Z A;  4PYU A;  1H4R A;  2KHW B;  1J0G A;  3QAQ A;  1F2R I;  3HRD D;  4MM3 A;  1V80 A;  2JQR B;  3HVD A;  4BFR A;  4W9H A;  3QHT A;  1YJ1 A;  2C7H A;  1E5W A;  3IT6 B;  3JYU A;  4W9D A;  1T0Q C;  1HEZ E;  2N1W A;  3Q8F A;  3BVZ A;  3Q3F A;  4NZL B;  2KN4 A;  2NTT A;  4TUU A;  4KZC A;  1ZP0 B;  4W9L A;  1MVK A;  3WA0 A;  2NPT A;  1VZ6 A;  4DWF A;  2HJ8 A;  3PHW B;  4JPS A;  3A9K A;  1K53 A;  1WGG A;  5HKH A;  1PFD A;  1KH0 A;  4C7Y A;  2L05 A;  3D32 A;  2GI9 A;  3Q3O C;  4GXB A;  4ZYN A;  3ZGZ A;  2KWD A;  5AEK B;  4JGH B;  2IPK D;  1EWY C;  1IGD A;  2WP9 B;  1SJE D;  2A4Z A;  3Q14 C;  2K8B A;  4KIK A;  4MJS A;  1E0Z A;  5FK9 C;  2DHZ A;  1WRI A;  3VFK A;  3W5V B;  2G9H D;  1VRA B;  1WXA A;  4MH8 A;  1FCC C;  1WFY A;  2J53 A;  1WRD B;  1L6V A;  4GB9 A;  3SFD B;  3ZYY X;  2RDG A;  2QHO A;  3B1L X;  1LGR A;  1P0R A;  1WYG A;  4YXD B;  2WXJ A;  3CF6 E;  1NI3 A;  4AS1 A;  1TJE A;  1TS3 A;  1UGJ A;  2JRI B;  1ACC A;  3IHP C;  2CS4 A;  4C00 A;  3VUX A;  3SDL C;  4KGT A;  2CHX A;  2RR9 A;  1XQQ A;  2KC2 A;  4FAD A;  4PT5 A;  4HLE A;  3U30 A;  4X57 B;  3AM9 A;  3A9J B;  3TBL D;  1C4P A;  1STE A;  3VAW A;  4A3O A;  1XLN A;  4L2Y A;  2H88 B;  3A4R A;  4KGR A;  3QCA A;  3T8M A;  3PLU A;  2LD9 A;  4NPN A;  2DWQ A;  2LUM A;  3T9L A;  2N9X A;  3BZD B;  1XLO A;  2WXG A;  2RPQ A;  3RN9 C;  4WJP A;  1C78 A;  1FMA D;  5FR6 A;  2BWF A;  2AL6 A;  3TCA A;  2J4X A;  2C5L C;  1SBB B;  2PPH A;  1WZ0 A;  1V8C A;  1C4A A;  2KX0 A;  4E74 A;  3GZN B;  2HTM E;  3VH4 B;  3VUW A;  3QAR A;  2WHI A;  3AEC B;  1TY2 A;  2KX3 A;  3ZLZ A;  1KRH A;  1EF5 A;  3ABV B;  2O6V D;  2DBY A;  1GC6 A;  4YTP B;  3AN1 A;  2Q5W D;  4YSX B;  3ZUN A;  2WNM A;  2W54 A;  2IGH A;  1EUV B;  1GPX A;  4C7Z A;  2WDV B;  5DPS A;  1F1H A;  2ZCC A;  3AB5 A;  3H6N A;  4ARC A;  2N4F A;  1TS4 A;  4ANV A;  3GP7 A;  3DBH I;  2VRR B;  2W3R A;  4BOZ B;  4WH4 A;  4DXA B;  1IPG A;  5HFY A;  1AYF A;  2MSE D;  1FFU A;  1C9F A;  3I3T B;  1FEH A;  5JHA A;  2JXT A;  1QOF A;  2QEJ C;  1CJE A;  3E9S A;  3RMK C;  3VR9 B;  3V62 A;  3ZKJ C;  2BWE S;  2KKC A;  2BYT A;  2L0T A;  1JML A;  3TJP A;  5EDS A;  1PDX A;  1TGZ B;  3Q2A C;  2FCS A;  4HCN B;  1KJT A;  3E56 A;  4OVV A;  4AP4 C;  2NBV B;  2WYQ A;  2ZZP B;  2G45 B;  4URK A;  3JVZ X;  2JZP A;  2VZK B;  2AQ2 B;  5JXV A;  1WR1 A;  1QQR A;  1UZX B;  3HM6 X;  3L17 A;  3NS1 A;  2KTR B;  1C3T A;  1WSP A;  1FXT B;  3IFW B;  4LLG M;  3W1Y A;  2HD5 B;  4DHZ E;  3P42 A;  2KMA A;  5J17 A;  1E8X A;  3U7Z A;  2E3T A;  1E7P B;  2N9K A;  3N1Y C;  3RUI B;  2J52 A;  1YQB A;  1WH3 A;  2MBO A;  2RPV A;  3N30 A;  4ARI A;  4KDI C;  2Z0D B;  1Y56 A;  3R3M A;  4XGA B;  2M19 A;  4OVZ A;  1WGK A;  1WX9 A;  1ROE A;  3WIM A;  4IKG A;  3Q69 A;  4KDL B;  3M95 A;  2REX A;  2RGF A;  2GB1 A;  3U7D A;  3SFE B;  2RDH A;  1LQB A;  3CST A;  1UUP A;  3RNE C;  1L4D B;  2L3Z A;  2DEN B;  4KX6 B;  1DOI A;  4RGN A;  2KWU B;  3OG5 A;  1FPY A;  1XXG A;  1KFY B;  1WF9 A;  1XLP A;  2WXI A;  3PRP B;  1ZDX A;  2I1K A;  1TS2 A;  3AE7 B;  2AWT A;  2LVP A;  1LFD A;  2M1M A;  4N6E B;  2ZW1 A;  4W9G A;  3V6E B;  3ALB A;  1R4N I;  1JWA D;  4B95 A;  1XCT L;  4MGY E;  4B6W A;  3ZJU A;  3WCQ A;  2L52 A;  2LEK A;  4WJO A;  4ZDV A;  4RM8 A;  2LRW A;  1WM3 A;  3KVF B;  1PGB A;  4NNJ B;  1JRU A;  3J9C A;  1YD8 U;  5TSS A;  3PRE A;  2O6V B;  3HUI A;  2IND C;  3ZXV A;  2M0A A;  2XK5 A;  4GDL B;  3ONS A;  2WXH A;  3TIX A;  5AZG A;  2N9P C;  3DBL I;  2ZPN A;  4BAX A;  2L32 A;  5BMH A;  2ZVN A;  2JF5 A;  3PTF C;  2L7R A;  3VR8 B;  3JW0 X;  2EMS A;  2IY0 B;  1TKE A;  4FJY A;  4BZA A;  3H7S A;  4CQN A;  4I6P A;  4W9E A;  2Y3A A;  2QMT A;  1TT5 B;  3I5J C;  1X1M A;  1NVI D;  2FID A;  4K3C A;  4BKT A;  2SEB D;  1GAQ B;  3ZRF A;  5IKC M;  4E71 A;  2KDB A;  4DDG D;  4JLC A;  3CSF A;  1EU4 A;  2PVO D;  2N7E A;  2UYZ B;  3PRM B;  1Z5S B;  1IUE A;  1SE9 A;  4ZRK A;  3GB1 A;  1SE4 A;  1UWM A;  3OWE B;  2G1E A;  1V1P A;  4HKZ E;  2WXQ A;  1TIF A;  1Y8R C;  4N58 A;  1TYG B;  4WQM A;  3DBH B;  2IO3 B;  2L8J A;  4JIO U;  5CX3 A;  1WGY A;  3AH7 A;  2WXK A;  2KN5 A;  1SIF A;  4P6V F;  4K1R B;  3BVG A;  1L6U A;  3RCZ A;  4K7U A;  1V5O A;  1B9R A;  1C76 A;  2QDF A;  3TUO A;  1C79 A;  3O13 A;  4B9K A;  2BQQ A;  2WXP A;  4XX5 A;  3AED B;  3NOB A;  1N60 A;  4NJC A;  5EE1 A;  2MP2 A;  2LJ5 A;  2D5G A;  4KKI A;  1PUT A;  3L13 A;  2BS4 B;  2V3P A;  2Z8L A;  2BTE A;  3ML8 A;  4YSY B;  3PHX B;  4K3B A;  1IBX B;  3UQB A;  2WXN A;  2RMM A;  4RCO A;  2X8X X;  1JCK B;  5IA7 A;  3UIO B;  3MJW A;  3C8Y A;  3DHH C;  1HZ5 A;  3ZW3 A;  2D2Q A;  3V3X A;  1OQY A;  2DZJ A;  4W9J A;  2ZEQ A;  2M0X A;  4HK2 A;  2ASQ A;  1P7F A;  1TKG A;  2LVQ A;  2KAJ A;  4GGQ A;  1V81 A;  4F8C B;  2PEA A;  1HXY D;  4PS7 A;  2KDF B;  5JZE B;  3LJ3 A;  4DHZ B;  4LNF A;  2XN9 C;  2XK5 B;  2D3A A;  4ZRQ A;  3P4Q B;  1T6B X;  4LK0 M;  3RNB C;  3ZJT A;  2KVR A;  2RD0 A;  3SD5 A;  1TTN A;  3OJ3 A;  1JAL A;  3OAW A;  4GDK A;  4YT0 B;  4HWI B;  2R2O A; 
#chains in the Genus database with same CATH homology
 4AS1 A;  2V4I B;  5HI1 A;  1TJE A;  1TS3 A;  1UGJ A;  1B1Z A;  4JX1 C;  2LGI A;  2JWU A;  2R61 A;  1ACC A;  2PTL A;  3EA6 A;  1OQR A;  1VZ7 A;  4OW0 A;  3R2T A;  3BWU D;  3IAS 1;  4US8 A;  2FE8 A;  2PLP A;  2QJL A;  4KGT A;  3NUH B;  4RF1 A;  3AEA B;  4ZYS A;  4B0M A;  3H8H A;  4D2K A;  4PT5 A;  4JE3 B;  1SB3 C;  1SSN A;  2LHE A;  5LNK 1;  2YEP F;  1I4P A;  3FIL A;  3AM9 A;  2K9X A;  2K0P A;  2BT6 A;  1TS5 A;  2AX5 A;  1C4P A;  1STE A;  2WLB A;  1YN4 A;  4EE2 A;  3AE9 B;  1XLN A;  4L2Y A;  1ET6 A;  2N9L A;  2H88 B;  4KGR A;  1ZUD 2;  4KKJ A;  1YQ3 B;  1NEN B;  2DWQ A;  1JRP A;  2LUM A;  3BZD B;  5E6J A;  3MP9 A;  1XLO A;  2WXG A;  1EU3 A;  3B9J A;  1GB1 A;  3KQ4 A;  1GTH A;  3EUB 2;  3W9C B;  3L4P A;  1C78 A;  1FMA D;  1MI0 A;  1D5X C;  3RFZ B;  1F0Z A;  1AW7 A;  5D3I B;  2J4X A;  1VR9 A;  1SBB B;  1IGC A;  2W82 A;  1V8C A;  1SJH D;  1C4A A;  4ZHP A;  4JWS C;  4WIP A;  3KWV A;  2BB6 A;  4TQ0 A;  4ZRP A;  1VJK A;  2HTM E;  4XWT A;  1ESF A;  3AEB B;  2INN E;  3W2D A;  3AEC B;  4RH6 A;  1FM0 D;  1TY2 A;  2DYO A;  1N61 A;  1KRH A;  3IAM 1;  1I4G A;  2JX5 A;  1N5W A;  1TKY A;  1CZP A;  1EM7 A;  3NVV A;  1TY0 A;  2WDR B;  3ABV B;  2JYE A;  5BYS A;  4KGS A;  2DBY A;  1CK1 A;  5EE0 A;  3ZQ4 A;  4YTP B;  4HRS A;  3PZ8 A;  3AE6 B;  3BK1 A;  3AN1 A;  2Q5W D;  1SF0 A;  3AMZ A;  3NVY A;  4YSX B;  3LXF A;  2WNM A;  4HKQ A;  2W54 A;  2IGH A;  5H92 C;  2WU5 B;  4NAM A;  5BMG A;  4L23 A;  1K50 A;  1GPX A;  1FFV A;  1RFK A;  2SAK A;  4TQ1 A;  4C7Z A;  2WDV B;  2VZK D;  3R2I A;  3MJ5 A;  1E6E B;  5AUI A;  1D5Z C;  1IBX A;  3Q8C A;  1DOY A;  2MJD A;  4WUR A;  3AB5 A;  2EKI A;  4WWM A;  4L1B A;  4ARC A;  1HQR D;  5D3D A;  2Y5P A;  4OZB A;  3TEZ A;  3SEB A;  1TS4 A;  1ZXH A;  1FXA A;  5BYQ A;  2WDQ B;  1HZ6 A;  1YJI A;  1ZDV A;  4AQ7 A;  2BBC A;  3GP7 A;  2DLB A;  4OHJ A;  1I4R A;  2WS3 B;  2PIA A;  2INP E;  3FC4 A;  2W3R A;  5HFY A;  4WH4 A;  1C9F A;  1AYF A;  1FFU A;  2YEP B;  5D7G A;  1ZOY B;  5C3J B;  1FEH A;  5EE3 A;  3KLS X;  2X38 A;  1V1O A;  2FBW B;  1XCQ L;  1FRD A;  3TEX A;  3T3N A;  2JXT A;  2PW9 A;  3AE3 B;  3NZ3 A;  1QOF A;  1ZXI A;  2QEJ C;  1JWU D;  3CIR B;  1CJE A;  3E9S A;  3VR9 B;  1L4Z B;  1FNW A;  3P4P B;  1QKZ A;  1MHX A;  1VZ8 A;  2WQY B;  4DQO C;  2BYT A;  2V0G A;  1WXQ A;  1SIJ A;  2LMC A;  4DXF A;  3U4E G;  1K51 A;  5AUK A;  2EEL A;  1JML A;  2CU3 A;  2NMQ A;  1PDX A;  1RM6 C;  3ZJV A;  2KDM A;  2WXF A;  3E56 A;  1E9M A;  3P1M A;  3W1S A;  1FXI A;  2KAC A;  4ITK A;  1A70 A;  1QLB B;  2I38 A;  2JZP A;  3W5U B;  1QF6 A;  2ONQ A;  2VZK B;  2AQ2 B;  5JXV A;  1FD6 A;  1XLQ A;  1QQR A;  3DWG C;  1ENF A;  2PMV A;  3NS1 A;  4RGM A;  1NEK B;  2K22 A;  1I4X A;  1N63 A;  1WSP A;  3BVM A;  2K5P A;  1CQV A;  4LLG M;  1SE2 A;  1GB4 A;  1L0Y B;  1H7W A;  3FIL B;  3P42 A;  4A55 A;  2JSV X;  3NVW A;  1RYJ A;  3U7Z A;  3PZ7 A;  2E3T A;  1NYR A;  1E7P B;  1J7B A;  3SR6 A;  4C56 C;  2N9K A;  4YWG G;  1V1P B;  2J52 A;  3VQI A;  2RPV A;  4ARI A;  1N62 A;  3BYT B;  4O1N A;  3P63 A;  1FNV A;  2OHF A;  1Y56 A;  1PYW D;  4XDC A;  1D6E C;  4JWU C;  4P16 A;  2Y5C A;  1JWM D;  4UDU C;  3T3O A;  4YSZ B;  1TZO A;  4MM3 B;  2M19 A;  3MHZ A;  4OVZ A;  1N5X A;  4XWW A;  1WGK A;  2L83 A;  3CF4 A;  1ROE A;  1Q10 A;  1NYQ A;  2WXL A;  4IKG A;  3R8B A;  2ON8 A;  1J7C A;  3Q69 A;  3UI3 A;  5C2T B;  3FAH A;  2AQ1 B;  2GB1 A;  3SFE B;  2RDH A;  1YN3 A;  4A90 A;  2DYM A;  1QIL A;  1UUP A;  1XF5 L;  4DXG A;  1L4D B;  4TSS A;  1HA5 A;  1K52 A;  3LYY A;  4KX6 B;  2M56 B;  1DOI A;  4RGN A;  1XXG A;  1KFY B;  3MC0 B;  1XLP A;  2WXI A;  1YN5 A;  1ZDX A;  2PVG C;  1TS2 A;  3AE7 B;  1GTE A;  2BS3 B;  2LFI A;  1YJJ A;  1JW9 D;  1JWS D;  2BW2 A;  2W55 A;  5GXG B;  4C80 A;  1EWC A;  1ET9 A;  2WXM A;  1GT8 A;  4N6E B;  2ZW1 A;  1XO3 A;  2CJN A;  5EE9 A;  1KLG D;  3AE2 B;  3AE1 B;  1JWA D;  2GRI A;  3GS2 A;  3TSS A;  1XCT L;  3VRB B;  2I2Y A;  2MJE A;  1JRO A;  2JYT A;  3AEF B;  1R7S A;  3HVZ A;  3ZJU A;  3WCQ A;  2L52 A;  2LEK A;  1BXT A;  2WXO A;  4YTN B;  1I7H A;  2CJO A;  2QIL A;  4HRO A;  4TMA B;  2IGD A;  4XE0 A;  1DYQ A;  2MH7 A;  1PGB A;  4WAF A;  3Q8A A;  1XEE A;  2HDE A;  4MT5 A;  2ACZ B;  4J3O D;  3J9C A;  1L5P A;  4ZOH C;  1SEB D;  5TSS A;  1I4Q A;  2MEK A;  4OZA A;  3B2F A;  1FNU A;  4RGT A;  3HUI A;  1GOZ A;  1FRR A;  2LJI A;  3P4R B;  2IJ0 A;  2M0A A;  4REZ A;  1QOB A;  4GDL B;  2W3S A;  2WXH A;  4GDK B;  3Q8E A;  3BK2 A;  1M4V A;  3V05 A;  1ZPS A;  1L0X B;  4RF0 A;  1JQ4 A;  4RNA A;  2L32 A;  4FXC A;  5BMH A;  3RPF C;  3NRZ A;  3AE5 B;  1AWD A;  3N9Y C;  1BML C;  1UNS A;  1FO4 A;  3VR8 B;  4US9 A;  3EGR A;  3Q8B A;  1VDV A;  5G5H A;  2QSD A;  2IGG A;  1TKE A;  2OED A;  4A8X C;  1DOX A;  4CQN A;  3AE8 B;  2BS2 B;  2Y3A A;  1MPE A;  2QMT A;  4NAW B;  1PGX A;  2QIE B;  2WXR A;  1FCL A;  1NVI D;  4HEA 1;  2XNA C;  1YNT E;  2SEB D;  1GAQ B;  4RFB A;  4M0W A;  2K3U A;  3NVZ A;  2N0S B;  3LB8 C;  4B0E A;  3U52 E;  4ZHO A;  1F2R C;  4RGO S;  1SE3 A;  3AEG B;  2H89 B;  1QOG A;  4A9A A;  5I4D A;  3TEY A;  3MFG A;  1EU4 A;  2PVO D;  5G5G A;  1J7A A;  4Q2J A;  1P7E A;  1DGJ A;  4LTU A;  1IUE A;  4IOI E;  1BUI C;  2B76 B;  1SE4 A;  2KQ4 X;  3GB1 A;  1L0V B;  3AEE B;  1UWM A;  3OWE B;  2G1E A;  1V1P A;  4N59 A;  2ICI A;  2TSS A;  2N7J A;  1ZE3 D;  4HKZ E;  1KTK A;  3PO0 A;  1E10 A;  2L1A A;  4XDD A;  2WXQ A;  1T5X D;  1RWS A;  3AV8 A;  4R3D A;  2AQ3 B;  1PGA A;  1F2R I;  1KF6 B;  4N58 A;  1TYG B;  3HRD D;  4WQM A;  1AN8 A;  2JQR B;  4H2A A;  3HVD A;  3I57 A;  3IXS A;  1JWB D;  2BB5 A;  3AH7 A;  3U2S C;  2WXK A;  4OZC A;  4P6V F;  2MJ3 A;  1C4C A;  3BVG A;  4A6Q A;  1L6U A;  3IT6 B;  3CWI A;  1B9R A;  3VRA B;  2KMM A;  1HEZ E;  3Q8F A;  1C76 A;  3BVZ A;  1OFF A;  4NZL B;  3TUO A;  1C79 A;  3O13 A;  2WXP A;  3AED B;  1D4B A;  1LO5 D;  2KN4 A;  2NTT A;  1I4H A;  1N60 A;  4NJC A;  5EE1 A;  1KLU D;  3P4S B;  1FIQ A;  1ZP0 B;  2D5G A;  3BII D;  5FR3 A;  4KKI A;  1PUT A;  1MVK A;  3B2G A;  1QOA A;  1VZ6 A;  3AE4 B;  2JU6 X;  3ETR A;  4MAC A;  2BS4 B;  2V3P A;  3KWL A;  2Z8L A;  1UWX A;  4JPS A;  5BYR A;  2BTE A;  4YSY B;  1K53 A;  1IBX B;  2WXN A;  2RMM A;  1H7X A;  1PFD A;  4RCO A;  1KH0 A;  1JCK B;  3DWM A;  5H8Y E;  5HHD G;  3I9V 1;  3C8Y A;  1D5M C;  3BYY B;  4C7Y A;  1F77 A;  1HZ5 A;  1C77 A;  1YMH E;  5FKA C;  3URY A;  4HJG E;  1QT9 A;  1SXT A;  3V3X A;  2GI9 A;  4USA A;  5T8I A;  1OQQ A;  2J42 A;  3ZGZ A;  2KWD A;  5BMI A;  2LHD A;  3IT4 B;  2IPK D;  1P7F A;  5MPO A;  1MHH E;  1TKG A;  1V97 A;  2IDY A;  2KAJ A;  1EWY C;  2NTS A;  1IGD A;  1T3Q A;  2WP9 B;  1SJE D;  4GLS C;  1E0Z A;  5FK9 C;  1WRI A;  4YTM B;  3W5V B;  4IDI A;  1HXY D;  2G9H D;  1YQ4 B;  1VRA B;  4MH8 A;  2ZW0 A;  1FCC C;  2XN9 C;  3TEW A;  2J53 A;  4ZRQ A;  3P4Q B;  2WU2 B;  2V3N A;  1T6B X;  2PKO A;  1L6V A;  4LK0 M;  3ZJT A;  3SFD B;  3ZYY X;  2RDG A;  2FUG 1;  1WWT A;  1JAL A;  2E6X A;  1WYG A;  4YT0 B;  4YXD B;  5HG2 A;  2WXJ A;  1NI3 A;  1VLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...