3AE7B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 52
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae7B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae7B01
1FO4A 3RPFC 1N5XA 1DOYA 1N61A 3CWIA 2W3SA 5G5HA 1TJEA 2CU3A 4YTMB 1J7CA 3KWLA 2HTME 2WDVB 3NVWA 4IDIA 2PIAA 1WGKA 3AV8A 1GPXA 1CZPA 1VLBA 1N63A 1JWBD 1E7PB 1YQ3B 1XLPA 2K22A 2QIEB 3FC4A 3HRDD 2WDQB 2B76B 3DWGC 4ITKA 1NVID 1SB3C 2AX5A 1DOXA 4ZOHC 2N0SB 2L83A 1PFDA 1QOGA 1KF6B 1UWMA 2WLBA 4JWUC 5EE0A 1B9RA 3VRBB 1A70A 2Y5CA 2H88B 3SFDB 4C80A 5MPOA 3AMZA 3HUIA 2BS2B 1WXQA 4LTUA 2BT6A 2CJOA 3CF4A 1FRRA 2EKIA 4N58A 5H92C 3W5VB 1VDVA 2DBYA 1TKYA 3VR9B 1WWTA 1RWSA 3NS1A 2WU2B 5EE9A 1QF6A 5C2TB 1RM6C 4N59A 3AEBB 5EE1A 1FFVA 2FBWB 1KRHA 3W5UB 1FRDA 1OFFA 5C3JB 1OQRA 3AE3B 3PO0A 1NI3A 1RFKA 1QOBA 1H7XA 3AEFB 2L52A 3L4PA 1FXIA 1J7AA 2OHFA 1DOIA 3ABVB 1IUEA 1GTEA 2KMMA 4C7ZA 1DGJA 2WQYB 1XO3A 3AE6B 3EUB2 4US8A 3ETRA 4US9A 1E0ZA 3P4SB 1SF0A 1N5WA 4A9AA 2K5PA 1I7HA 1ZP0B 4HRSA 4C7YA 1YJIA 1EWYC 5H8YE 1L6VA 1QOFA 4HROA 4JX1C 2W55A 2MH7A 2MJEA 2PVGC 4WWMA 3P4PB 2PVOD 1JQ4A 1N62A 1QLBB 1N60A 3CIRB 1SIJA 3ZYYX 3BIID 3AE1B 1E10A 3LB8C 2W3RA 1FFUA 1TYGB 1FM0D 5G5GA 1YQ4B 1QT9A 1XLOA 3NVVA 3SFEB 5AUKA 3AE5B 4KX6B 1AWDA 3AECB 1CJEA 1JALA 1JRPA 1XLNA 3B2FA 4ZHOA 4WQMA 2M56B 1ROEA 1KFYB 2G1EA 2WS3B 1JROA 3AE7B 2CJNA 3WCQA 1V8CA 2WDRB 3AEGB 1RYJA 5GXGB 2DWQA 3AEAB 1GT8A 3AE2B 3P4RB 1GTHA 3AE4B 1FIQA 1JWAD 1L5PA 1ZUD2 2K9XA 2MJDA 5AUIA 4USAA 3VR8B 3AH7A 1XLQA 4YSZB 4ZHPA 2H89B 1FMAD 3P63A 1F0ZA 3HVZA 3B2GA 3DWMA 1ZXIA 2JX5A 1AYFA 4YSXB 2LEKA 2E3TA 4FXCA 3SR6A 1R7SA 4YXDB 3AE9B 3AE8B 1ZOYB 1V97A 1WRIA 2JQRB 2MJ3A 2M19A 3AM9A 3NRZA 1T3QA 2KAJA 2ACZB 3AN1A 1NEKB 1JW9D 1PDXA 1NENB 2BS3B 1QOAA 1NYQA 3AEEB 1VJKA 2WU5B 1OQQA 3AB5A 2PKOA 1TKEA 3VRAB 3AEDB 1J7BA 1L6UA 3B9JA 1WYGA 5EE3A 3FAHA 1PUTA 4P6VF 1NYRA 4N6EB 1L0VB 4YT0B 2BS4B 4YTNB 2WP9B 3P1MA 1YJJA 4YSYB 1H7WA 1GAQB 3NVZA 3W9CB 2W54A 2QJLA 1TKGA 4JWSC 3NVYA 3LXFA 3P4QB 4YTPB 1FXAA 1E6EB 2Q5WD 1E9MA
chains in the Genus database with same CATH superfamily
5KHQA 2KLGA 2LGSA 2KX0A 4ZRKA 1WMHB 1UBQA 3T8MA 3ZTCA 1EU3A 3NS8A 2N9LA 1YQ3B 3K9PB 4ZRQA 3L10B 2WLBA 2ZNVC 2ZPYA 3UIOB 2RD0A 5EE9A 1NI2A 2WXQA 4IUMB 1OQRA 4MGIE 4WH4A 2LFIA 4HK2A 1C77A 3Q69A 2JWZA 3ZTDA 4TQ1A 2M8SA 4BKGA 5L83A 1C4AA 3RZFA 4KZCA 4EEWA 1OTRB 2ZEQA 2DENB 2BVCA 4W9KA 3AE1B 1ZPSA 1P7EA 2LGDA 3LJ3A 2CJNA 2KTFA 5GXGB 1CQVA 3AEAB 3ZRCA 1E8YA 1ZXHA 2Y3AA 3N9YC 1SE2A 1YOVB 2XN9C 1SIFA 1TZ1A 2JX5A 1V9JA 3M95A 2I1KA 1JCKB 2O6VB 2KO3A 2L00B 2ZW0A 4XE0A 4ZRPA 5D2MB 3RYTA 3BY4B 4C4VB 3W1YA 4PYUA 1IGDA 2BS4B 1TT5B 1LXDA 3W9CB 2LD9A 4BOZB 1FXAA 4FJZA 2MEKA 1GOZA 2PW9A 1HEZE 4FULA 4HWIB 1I42A 4G50A 2V3PA 3DBLB 4G0NB 3UF8A 2K22A 5AZGA 2KWDA 2WDQB 4A3OA 4ITKA 2L1AA 3I3TB 1WM3A 2N0SB 3PZDA 1E7UA 4NZLB 2Y5CA 2JZPA 3M3JA 3VDZA 2LRUA 1I4RA 4RFBA 1VDVA 2QSDA 2WU2B 2KKCA 4W9HA 4W9EA 3L4PA 5AEKB 1P1AA 2LVPA 4E74A 2BKFA 2MLBA 2ASQA 3DCGA 1YJIA 1KLGD 3VTWA 2CHWA 4GSWA 3DQVA 3V6CB 4S0RA 3P4PB 1YMHE 4NY0A 2DLBA 3MP9A 1S3SG 1FFUA 4IKGA 4GGQA 1K51A 4NQLB 4WQMA 3DHGC 2CHXA 2G1EA 4KIKA 2FCMA 3RNGC 3DBRB 2MBQA 1TS3A 3A9KA 4USAA 1UGMA 3KW5B 4UDUC 4EE2A 2JF5A 3L16A 3ZO5B 1WX8A 1GB4A 4OVUA 3TCAA 3LDZE 3ZDTA 1T5XD 5TSSA 3KYCD 4M02A 4NAWB 4OZBA 1OQQA 2D10A 4MSQB 1WYGA 4JE3B 1V86A 2AQ1B 4ARCA 2PMVA 4E3CA 2WP9B 2JRIB 1UELA 1B1ZA 5JHBA 4JGHB 1WJNA 1DYQA 1IP9A 2KK8A 3QWZB 1OGWA 2V4LA 3KUDB 4DK5A 5FR3A 2WXMA 2HTME 4A55A 4M8NA 2KDEB 1D3ZA 3R2TA 2KMAA 2JXTA 3ZUNA 3DBHB 3IXSA 3WAOA 4ARIA 1KF6B 1UWMA 2RMMA 3EHVA 1B9RA 1YN4A 2O2VA 3WAMA 4RGTA 1FEHA 1XXGA 3DVNV 3RNFC 3TIXA 2LGXA 1X1MA 4N59A 1RRBA 1F77A 2QDFA 2WWZA 1GJZA 4XYCA 5D3IB 1C76A 2N4FA 1FCCC 3V60A 1TS4A 1N6ZA 2IO3B 2JY6A 2KN5A 3SD5A 3ZNZB 4HROA 2MJEA 1N62A 3MJWA 2KJ6A 3ZVVA 3LB8C 4NAWA 2K0PA 1QT9A 5AUKA 2WXRA 5HI1A 2TSSA 2KXJA 5AZFA 3QIJA 4ZHOA 2RDHA 1WRDB 5IKCM 1C78A 1STEA 4ZYSA 3P4RB 2NBUA 3PGEA 5AUIA 2HJ1A 3PHXB 3DPDA 3TEYA 4PK1A 4FXCA 2EMTA 3DBHI 2INDC 2IY1B 2ACZB 2MP2A 1NENB 1ZDVA 4RGMA 1XQQA 3NY5A 1EF5A 3LYYA 2QMTA 2D07B 1PGXA 2FUHB 3I5JC 1WMHA 1YIWA 5DPWA 2KHWB 3NVZA 4MM3A 1BMLC 3LXFA 4MACA 4HJKA 5DPTA 1MG4A 3FILA 2N9PC 2FCQA 5IA7A 3J9CA 1UD7A 4PS8A 4FBJB 2D2QA 4EZJA 2K8HA 1PFDA 1WIAA 4IW0A 4FLHA 2H88B 2JU6X 2V4IB 5H92C 1P98A 3EFCA 4HCPB 4NAMA 3BK1A 3ZJVA 3PO0A 1WZ3A 2BWES 3MJ5A 1H7XA 2L52A 2IO0B 4DHZB 4NJCA 2K5PA 3C19A 5BYRA 2DYOA 5J17A 1T0QC 2K8CA 2M4NA 4S17A 2KTRB 3OAWA 2IJ0A 2VZKD 1BUIC 3DBLI 1H4RA 2EMSA 1XLNA 2ONQA 3ZJTA 4M0WB 2M17A 1C79A 1XCQL 1KFYB 3H1UA 1PQSA 2G3QB 3EFUA 1EM7A 1WXMA 2ZPNA 3H8HA 2NBWB 3VUXA 3PHWB 1V97A 4EFOA 2LJIA 1HTOA 2PE9A 3PZ8A 5E6OA 5IAAC 2NPTB 3MFGA 4LK0M 2I2YA 3AEDB 3A33B 4P6VF 1KH0A 2INCC 3OG5A 3P1MA 2UWQA 3DOWA 2SAKA 3BYTB 4IM2A 2MBOA 5GMVA 3EECA 2Q5WD 4LNFA 4KSKC 2KQ4X 2LHEA 3PREA 2MA9B 4P7IA 3BZDB 3TMPB 4IDIA 1IGCA 3QJZA 2KZRA 2LGIA 4IWPA 2DZKA 2VZKB 3PLUA 4ANXA 2IGDA 4LLGM 2WXHA 1C9FA 2WYQA 5D6JB 3TL5A 2L0FA 3WA0A 1QOGA 1A70A 1MG8A 3W5UB 1IBXA 1YQBA 2L8JA 2AWTA 3Q3JA 1HE8A 5JH5C 2OHFA 1IUEA 5TR5A 1WXSA 3P4SB 1HXYD 2KLCA 2ZNVB 1K8RB 3A9JA 2K25A 1YJ1A 3NHEB 1SIJA 4WWPA 2K1FA 4JL9A 1SXTA 4LNIA 3ECIA 4DXGA 3SDLC 3NZUA 1JROA 3RD2A 1V8CA 2OEDA 2MRPA 2OOBB 3ONSA 3AE4B 5HFYA 3AH7A 2WXGA 3P63A 1M94A 5D3DA 1ISNA 2RGFA 1YN3A 2MJ3A 2N7JA 3PS6A 2HE7A 2RPVA 1MJDA 1WGHA 2C7HA 1WXAA 1CK1A 1VJKA 2DNFA 4QAYA 3ZJUA 1TKEA 2X8XX 3NJTA 2KANA 1NYRA 2UYZB 3CF6E 1WE6A 1TBEA 1I4GA 1EF1A 3SHQA 4YTPB 3KUCB 4K7UA 4XDCA 2W3SA 2Y5BB 3ZW3A 3N20C 2WX1A 3VH4B 1CZPA 4A20A 2O2VB 1OQYA 3B08A 2FCSA 4A3PA 3ZXRA 3OWEB 2R61A 3R3MA 4HPLB 1SE9A 4JQWC 3VRBB 1WXVA 3N3KB 3AMZA 1YX5B 2M0XA 3CF4A 2EKIA 1TKYA 1WWTA 3QX1A 4MT5A 1Q10A 5EE1A 1FFVA 2CHZA 1FRDA 2M0AA 1V80A 2MCNB 2D5GA 3Q3MC 4EZLA 1FXIA 1F2RC 2J42A 3BVMA 4US8A 3APCA 1FCLA 1Z2MA 5H8YE 2ZVNA 3AI5A 4WWMA 1J0GA 1WF9A 2KDIA 1E10A 2KT7A 1FM0D 4K7SA 2QCZA 4IWQA 1P9DU 3AE5B 4KX6B 1CJEA 5DCNA 2PPHA 2KJHB 2M56B 3DVGY 3WCQA 3A4SC 4MGYE 2WDRB 2SEBD 1V2YA 2M1MA 1ZUD2 3ZKJC 2BBCA 3X23A 1C4PA 3P2BA 3TSSA 3HIZA 1J8CA 1WM2A 2YLMA 4WJNA 3Q14C 3UQBA 4MELA 2DYBA 3AULA 1TTNA 3VUYA 2NTSA 4MH8A 2GBJA 1TY0A 4GIVA 1JWMD 2G4SA 2KX3A 3KQ4A 1WI0A 2GMIC 4WJQA 4IOIE 1VRAB 4HKQA 3K9OB 1FO4A 2WHIA 3RPFC 4BBNC 2J52A 5CHWA 1ET6A 2YEPB 3WANA 2ICIA 1XEEA 4W9LA 4FA6A 3ZDMC 2WXOA 1SGHA 3DWGC 2BPSA 4MM3B 3B0AA 2AX5A 4RF1A 2N7DA 3DBRI 3JYUA 4KKIA 2GI9A 4HJGE 2DBYA 3NS1A 1T0SC 2KFKB 5I4DA 1I35A 2NCNA 1QOBA 2D3GA 4LDTD 4A6QA 5DPRA 4RNAA 3ABVB 4DXAB 4MDKE 2WQYB 1YD8U 3O13A 3ETRA 4HEA1 4A9AA 1N5WA 3BINA 4F1SA 4X57B 4HRSA 5HKHA 1AARA 2E6XA 2WXKA 3U7ZA 2IZVB 1WE7A 3PV1A 3Q8AA 4FHKA 1QZEA 3KH0A 3RULA 3UQAA 1YQ4B 1WSPA 1XCTL 2CU1A 3BYYB 2QEJC 5IO9A 4HPMB 2WS3B 1SJED 3KWVA 2BWFA 4RM9A 4FHJA 2BGFA 4B95A 4GDLA 2AL6A 3WIMA 3BVZA 4RCOA 5LXIB 3ML9A 4II3B 1UBIA 1SJHD 1PGAA 1V5TA 1AYFA 3SR6A 2JVCA 4YXDB 3BK2A 2J7QB 2YEPF 1F9JA 3U4EG 2WU5B 4I6LB 4WQOB 2JXXA 3TJPA 3RMKC 4GMVA 2AL3A 3HM3A 3ZNHB 3E9SA 1TZOA 3RN9C 2K3UA 5BYSA 3QARA 1YJJA 2KWVB 2NVUI 1E90A 3NOBA 2FIFA 3WAPA 1WJ4A 4K7WA 1ENFA 2EELA 3QC8B 2JWUA 2LXCA 4K1RB 2LVOA 1N61A 1ZGUB 2R2QA 4AJWA 2CU3A 3WALA 4YTMB 2IYDB 1WGDA 4M00A 4RGOS 2L3ZA 1E5WA 1WGRA 1HTQA 2L76A 2BF8B 3U7DA 1SB3C 3VQIA 1OEYJ 1CMXB 2NPTA 4II2B 3H7PB 4MGZE 5LXHA 2Z0DB 2JYEA 4HCNB 2MHJA 1FRRA 2KN4A 1C3TA 3VXWA 3V61A 4FN2A 4N9F4 2FBWB 4W9IA 1OFFA 2KWUB 2LWPA 3L17A 3Q8FA 3AU5A 3Q3FA 3V05A 3IBEA 2KVRA 5BMIA 1WX7A 1XO3A 3U8ZA 1I7HA 2C9WB 1OEYA 2Z8LA 2MH7A 5CHFA 3U30A 4DDID 2NBVB 1PGBA 4BKSD 1P0RA 3UI3A 4HVBA 3VAWA 1A5RA 2IY0B 1WGGA 4TUUA 1ROEA 2WXIA 2N7EA 2Y5PA 1EU4A 3AXCA 4M8MA 2MJDA 2RDBC 5G2NA 4XZ4A 2ZW1A 4LNOA 1F0ZA 3PRZA 1LO5D 2KC2A 3RCZA 2L32A 3QA8A 3VVWB 3NRZA 4DDGD 2M19A 1GC6A 1S1QB 3GZNI 4YWGG 4B0EA 1GNUA 3Q6BA 4K3CA 5LLIA 3ZIMA 3RFZB 1FNUA 4J3OD 1K50A 4AUQC 2D3BA 2G9HD 4JIOU 1E8XA 2WX0A 2AYOB 2KWCA 4JWSC 3VUWA 2LZ6A 2W82A 4CO7A 1Y56A 5G5HA 2ZJDA 3M62B 1LQBA 4BBNF 3C0RB 3NVWA 3IAS1 3GE3C 2PIAA 4G3XB 4WIPA 2N9XA 3HRDD 1ZDXA 1WYWB 1NVID 3OJ3A 1EWCA 5EE0A 4DBGA 4AQ7A 2A5UA 2BW2A 3Q8BA 4C7YA 2NTTA 2JT4B 2PLPA 2WXJA 3MTNB 2INNE 3IFWB 1TIFA 3JVZX 1DOIA 4IM3A 2KMMA 1UWXA 1DGJA 1ZKHA 3GZNB 3H7SA 4GDKB 3IVFA 2WGSA 1RAXA 3I9V1 2ZVOA 4B9KA 2IPKD 2NR2A 4AOFA 4JX1C 2GBKA 4R3DA 3N32A 3QK0A 5J2RA 1TS5A 3RUIB 4REZA 4ICUA 3SFEB 1V1PA 4B6WA 1T0YA 4KIKB 2RDGA 4EZKA 3A9KB 3MHZA 4XX5A 4KZ0A 4IM0A 3VR8B 1XLQA 1ZXIA 5D94A 3JW0X 4GU2A 2BYEA 2HJ8A 3AE9B 1ZOYB 3DHHC 4ANUA 1VR9A 2BQQA 2V1YA 1JWSD 1H7WA 1GAQB 2QJLA 1TKGA 3P4QB 1E6EB 2L7RA 4O1NA 1F52A 5BO4B 1J7CA 2YVCA 4LJOB 3DHIC 4OVZA 2C5LC 4CQNA 4IG7B 4C56C 4ZOHC 2ZCBA 2L83A 3TEXA 2JZ3B 1IPGA 1P3QU 2LJ5A 2BS2B 1KLUD 3V6EB 2BB6A 3W5VB 2QC8A 4FJVB 2D3AA 4LJPB 1VZ8A 3AE3B 3KUZA 4URKA 4OHJA 2L0TA 2HD5B 2MW5A 1AW7A 3X0WA 4WAFA 1D6EC 3I63C 3ZXVA 1EWYC 2JUOA 2AQ3B 3M63B 3H6NA 3DVGX 1WFYA 4DHJD 1F2RI 1Q0WB 2IBIB 1I4XA 3PT2B 1JMLA 1XT9B 1JWUD 2C7MB 1ET9A 2LRWA 4BZAA 2PEAA 1E8ZA 3ZNGC 3DWMA 3H9DA 2JQRB 3AE8B 4HDQA 3RNAC 5AZHA 3GE8C 2KYWA 3AN1A 3NUHB 4BVUC 2IO2B 1NYQA 3AEEB 1WX9A 3R8BA 3VRAB 2O6VD 1SE3A 2BYFA 3SEBA 3KVFB 4DQOC 1ZW7A 4WJPA 2K6QA 2KMCA 1NBFC 4BAXA 4GXBA 3GOEA 2J0KA 1FPYA 1WJ6A 3ZQ4A 2IGHA 3I57A 1N5XA 1R4NB 1GC7A 3PLVA 4WURA 1ACCA 3PVLA 1RFAA 2DZIA 2K39A 4P1CC 3QAQA 1H8CA 2VH2A 3V62A 1U4AA 4TQ0A 4LTUA 4A90A 4M01A 3BVGA 1D5MC 1WZ0A 3IG3A 1KRHA 3L0WB 2RSUA 4F7ZA 1M4VA 3AEFB 3RNCC 2LGYA 4MGKE 4XC2A 2KD0A 4RH6A 4YL8A 3EUB2 4LCDE 1BXTA 2LHDA 4DHJB 1L6VA 3IT4B 1QOFA 4AP4C 2REXA 2W55A 2BYTA 2PVGC 3SU8X 1JQ4A 2JPHA 3URYA 4M0WA 4WWNA 2W3RA 2ON8A 1TYGB 2FUG1 3UIPB 2GOWA 1FNVA 2MX2A 3ZLZA 1EO6A 4C00A 2KFJA 3AE7B 1RLFA 1I4PA 1KM7A 3RT3B 1GT8A 2DYMA 1JWAD 1L5PA 4D2KA 3EGRA 3APDA 2K8BA 3V3XA 3B2GA 2LEKA 1MPEA 1QKZA 4IWOA 3T3NA 2KAJA 1D5XC 3KLSX 1SSNA 1EUVB 2KNBA 2PKOA 1UF0A 3FAHA 2GB1A 2UU7A 2MBHA 5FKAC 4W9GA 1PYWD 3EC8A 5E6JA 5CTRC 4W9FA 4IC7B 1IYFA 1QQRA 4TKNA 1T6BX 5G55A 1L0YB 3EA6A 3KWLA 2KACA 1UGJA 4BFRA 3FC4A 4CHKA 4NPNA 2GLSA 5T8IA 4ZRJA 3APFA 4P1BC 4JWUC 3L08A 4BKTA 3SFDB 1VZ6A 2Z0EB 3HUIA 1WXQA 5BMHA 2WNMA 1LGRA 1V5OA 1HA5A 1WY8A 4BOSC 2ZZPB 4BKSA 1TY2A 2PTLA 1F1HA 2PJHA 1SF0A 2VH1A 4PS7A 3MC8A 2J4XA 3ALBA 1I4QA 4HPPA 1Y8RC 3QCAA 2PVOD 2LXAA 2FE8A 3BIID 1Q5WB 3TUOA 2FAZA 2NMQA 5CX3A 3NG0A 3U2SC 3Q8CA 3NVVA 4PS3A 1AWDA 2JYTA 2QILA 1JALA 2WXPA 3L13A 2R2OA 1KLVA 4EKUA 5E6NA 2XEWA 4J6IA 4W9DA 3AEGB 1LM8B 2VRRB 3AE2B 3KYDD 3Q3OC 1GB1A 3VFKA 4YSZB 2BYVE 3BWUD 3Q8EA 2XK5B 4JLCA 1HZ6A 2J0MA 1V1PB 5E6PA 3AM9A 2JSVX 2CR5A 2I1JA 4WWOA 4KKJA 4F8CB 2V9HA 2KTRA 1J7BA 4Q2JA 5EE3A 4DWFA 1UNSA 4N6EB 5D7GA 1L0VB 2KC1A 3Q3NC 2C60A 3NZ3A 2LI5A 4NJ7A 4XGAB 1SEBD 1I4HA 3AV8A 1GPXA 2FIDA 3ZNID 3W2DA 1Z5SB 1XLPA 2QIEB 3FKYA 4ZRIA 1MHXA 1WR1A 3VHTC 1R4MB 2BT6A 3TBLD 3VR9B 4W9CA 2FCNA 5HHDG 1RFKA 3MC9A 4C7ZA 3AE6B 2N9KA 4MJSB 3VH3B 5LNK1 1Q1OA 2G45B 3S2AA 3RI7C 2LASA 2MQJA 1YNTE 3N30A 3AECB 1KJTA 4HDOA 1T0RC 2IGGA 4MEMA 3RZWC 4GB9A 2CKHB 2WXFA 4DXFA 1AN8A 4LNNA 3R66C 1BT0A 1K52A 4RF0A 4TSSA 1R7SA 4GOCA 2GRIA 4CYEA 4L23A 1D5ZC 2J53A 2KFKA 2L05A 5FK9C 5C23A 2KDBA 3AB5A 3IAM1 2CS4A 1KOTA 4AWJA 4HXDA 1MVKA 4YT0B 4OZAA 4ACFA 1D4BA 2V3SA 3OJ4B 2KDFB 2V0GA 1TS2A 1GG3A 1V6EA 3IT6B 1FXTB 3CWIA 1HQRD 4NJ6A 3ZGZA 3ML8A 1R4NI 4RGNA 4EUTA 1KTKA 3CSTA 4XDDA 2G4DB 1E7VA 4LNKA 4OZCA 1ZE3D 1HZ5A 2AQ2B 5MPOA 3VTVA 2KDMA 3MC0B 1RWSA 4ASWC 4A8XC 1JRUA 2INPE 5IP4D 4KDLB 3QHTA 1GTEA 1QILA 4FJYA 2RPQA 4EOYA 2NS5A 2EKEC 3Q2AC 5JHAA 2W9NA 3L54A 1QLBB 3QQ8B 1N60A 5L95C 2XK5A 1XD3B 4L1BA 2K6DB 4AS1A 2OJWA 4FADA 4OVVA 2IO1B 2V3NA 3W1SA 3DDCB 3HM6X 3B2FA 1WH3A 3TEWA 4GDLB 1WGYA 4ZYNA 2QHOA 4PT5A 2N1VA 2K9XA 3R7QA 2LUEA 4HKZE 1FMAD 3HVZA 4GLSC 5FR6A 3TEZA 1SBBB 2XNAC 3W1SC 3GS2A 1T3QA 5JZEB 1R4MI 1JW9D 1PDXA 1UZXB 4AJYB 1PUTA 5EDSA 4WAAA 2RR9A 2MWSB 3N1XC 4YTNB 1C4CA 4YSYB 3PRPB 2LMCA 2W54A 3R7RA 1FNWA 4US9A 2FNJB 4JPSA 4KSLC 1DOYA 2MSED 1L4DB 5IOIA 2A4ZA 2PE6B 1WGKA 1VLBA 3P42A 1MI0A 3IHPC 4TMAB 3JSVB 3H7PA 2DAJA 3R2IA 4KGRA 1E8WA 4TV3A 1DOXA 3DVNU 3HVDA 4LDTB 4MH0E 4C80A 2BTEA 2D11A 3FILB 2CJOA 4KGTA 3PPAA 1RM6C 2JZZA 3AEBB 5C3JB 2WXLA 3GB1A 4I6PA 1J7AA 4XWTA 2HDEA 4B0MA 1ESFA 1MHHE 2KQ7A 3E56A 1V49A 4KDIC 2B3AA 1J19A 3HHMA 5J18A 1ZP0B 1C1YB 3NZSA 4L2YA 3PSEB 2O6VA 3CMMB 3N1ZC 1TGZB 1MFWA 3CIRB 3PTFC 1UH6A 3ZYYX 2C7NB 1GUAB 5G5GA 5JXVA 2MBBB 1XLOA 2KJRA 3RNBC 1JRPA 2GBMA 4ANVA 4MJSA 3A1QB 3U52E 2XBBC 1RYJA 2DWQA 3A9JB 1VCBA 1FIQA 4XWWA 4NQKE 5CHVC 4YSXB 2DX5B 4KGSA 1QF6A 2DHZA 5BYQA 1VZ7A 1VD2A 4GN1A 1L0XB 3OLMD 2N9EB 3DBSA 5HG2A 4GDKA 2DAFA 4KV2A 3RNEC 4ICVA 2KQSA 3B9JA 1LFDA 2BKRB 2LUMA 3CSFA 3NVYA 1L4ZB 2HTHA 1E9MA 1FD6A 4WJOA 4DHZE 1TJEA 4KVGB 2N1WA 3UGBB 2DZMA 2WDVB 1YN5A 1N63A 1JWBD 1E7PB 4C4VA 2Z59B 5C1ZA 2B76B 3ZRFA 4I6NB 1NDDA 3AU4A 3GP7A 4K3BA 2I38A 2JRHA 4W9JA 1L7YA 1SE4A 4N58A 4ZDVA 4K81A 2ZCCA 5C2TB 1NI3A 3N1YC 2X38A 1XF5L 3A4RA 4E71A 1E0ZA 4P16A 2KVZA 3HK0A 1V1OA 4MSMB 3B1LX 3UINB 3VTUA 4NNJB 3A1QA 2GBNA 2MP2B 2OJRA 2BB5A 3O65B 4HLEA 3PZ7A 1WJUA 2KOXA 1WR6E 2J0JA 5BMGA 4RM8A 4G11A 3T9LA 1GTHA 2IDYA 2MBEA 5DPSA 1YX6B 1UUPA 1G6JA 3D32A 4ZHPA 2H89B 2AEHA 5IN7A 2GBRA 2E3TA 1P7FA 2WXNA 1WRIA 4OW0A 4ANWA 4PYZA 1NEKB 2DZJA 2BS3B 1QOAA 2D3CA 4RMAA 3MHSD 1L6UA 2LVQA 4H2AA 1K53A 1L2NA 3C8YA 3PRMB 2WDTB 3JSVA 1V81A 3T3OA 3ENEA 1IBXB 5KHOA
chains in the Genus database with same CATH topology
2W82A 1Y56A 5G5HA 2KQ4X 2LHEA 3BZDB 3NVWA 3IAS1 4IDIA 2PIAA 1IGCA 1I4HA 1SEBD 2LGIA 3AV8A 1GPXA 2VZKB 3W2DA 1EU3A 2IGDA 2N9LA 4LLGM 1YQ3B 1XLPA 2QIEB 4WIPA 3HRDD 1ZDXA 2WXHA 1NVID 1C9FA 4ZRQA 1MHXA 1QOGA 1EWCA 2WLBA 5EE0A 1A70A 4AQ7A 2BW2A 3Q8BA 3W5UB 4C7YA 2BT6A 2NTTA 1IBXA 3VR9B 5EE9A 2WXQA 2PLPA 1OQRA 4WH4A 2WXJA 5HHDG 1RFKA 2LFIA 2INNE 1C77A 3Q69A 2OHFA 1DOIA 1IUEA 4C7ZA 2KMMA 1UWXA 1DGJA 4TQ1A 3AE6B 2N9KA 3P4SB 1HXYD 4GDKB 3I9V1 1C4AA 2IPKD 5LNK1 4JX1C 4R3DA 1SIJA 3AE1B 1YNTE 1ZPSA 1TS5A 1P7EA 4REZA 3SFEB 1SXTA 1V1PA 3AECB 4DXGA 1JROA 2CJNA 2RDGA 1V8CA 2IGGA 5GXGB 1CQVA 3AEAB 2OEDA 3MHZA 1ZXHA 3AE4B 2Y3AA 5HFYA 2WXFA 3VR8B 3AH7A 2WXGA 1XLQA 4DXFA 1AN8A 3P63A 3N9YC 1SE2A 2XN9C 5D3DA 1ZXIA 2JX5A 4RF0A 1K52A 4TSSA 1R7SA 3AE9B 1YN3A 1ZOYB 2MJ3A 1JCKB 2N7JA 2GRIA 2ZW0A 2RPVA 1VR9A 1D5ZC 4L23A 2J53A 4XE0A 4ZRPA 5FK9C 1CK1A 1VJKA 3AB5A 3IAM1 3ZJUA 1TKEA 1NYRA 1MVKA 1IGDA 4YT0B 2BS4B 4OZAA 1JWSD 1D4BA 1H7WA 1GAQB 3W9CB 2QJLA 1I4GA 1TKGA 3P4QB 4YTPB 1FXAA 1E6EB 1TS2A 2V0GA 3IT6B 4O1NA 2MEKA 4XDCA 1GOZA 2PW9A 2W3SA 3CWIA 1HQRD 1HEZE 3ZGZA 1J7CA 4RGNA 1CZPA 2V3PA 1KTKA 4OVZA 2K22A 4XDDA 2KWDA 2WDQB 4CQNA 4ITKA 2L1AA 3OWEB 2R61A 4C56C 4ZOHC 2N0SB 2L83A 4OZCA 4NZLB 3TEXA 1ZE3D 3VRBB 2Y5CA 2JZPA 1HZ5A 2AQ2B 5MPOA 3AMZA 2BS2B 1I4RA 1KLUD 2BB6A 3W5VB 3CF4A 2EKIA 2KDMA 4RFBA 1VDVA 3MC0B 1TKYA 1WWTA 1RWSA 2QSDA 2WU2B 4MT5A 1Q10A 5EE1A 1FFVA 1FRDA 1VZ8A 2M0AA 4A8XC 3AE3B 2INPE 2D5GA 4OHJA 3L4PA 1FXIA 1AW7A 1F2RC 2J42A 1GTEA 3BVMA 1QILA 4WAFA 4US8A 1D6EC 1FCLA 1YJIA 1EWYC 1KLGD 5H8YE 2AQ3B 4WWMA 3P4PB 1QLBB 1N60A 1YMHE 2DLBA 3MP9A 4L1BA 1E10A 1F2RI 4AS1A 1FFUA 4IKGA 1FM0D 1I4XA 2V3NA 3W1SA 1K51A 3TEWA 3AE5B 4KX6B 1CJEA 3B2FA 4GDLB 1JMLA 4WQMA 2M56B 2G1EA 3WCQA 1JWUD 2WDRB 2SEBD 4PT5A 1ET9A 2K9XA 1ZUD2 2BBCA 4HKZE 1TS3A 1C4PA 4USAA 3TSSA 1FMAD 4UDUC 4EE2A 3HVZA 3DWMA 4GLSC 3TEZA 1SBBB 2XNAC 2JQRB 3AE8B 1GB4A 3GS2A 1T3QA 1T5XD 3AN1A 1JW9D 1PDXA 5TSSA 4NAWB 3NUHB 2NTSA 4MH8A 1NYQA 3AEEB 4OZBA 1OQQA 1TY0A 3R8BA 3VRAB 1JWMD 1WYGA 1PUTA 1SE3A 4JE3B 2AQ1B 4ARCA 3SEBA 4DQOC 3KQ4A 2PMVA 4YTNB 2WP9B 1C4CA 4YSYB 2LMCA 2W54A 4IOIE 1B1ZA 1VRAB 4HKQA 1FNWA 1DYQA 4US9A 3ZQ4A 2IGHA 1FO4A 3I57A 3RPFC 1N5XA 4JPSA 1DOYA 5FR3A 2J52A 1L4DB 2WXMA 2HTME 1ET6A 2YEPB 2ICIA 1XEEA 4A55A 1WGKA 3R2TA 4WURA 1ACCA 1VLBA 3P42A 1MI0A 2JXTA 2WXOA 4TMAB 3DWGC 4MM3B 3R2IA 2AX5A 4KGRA 4RF1A 1DOXA 3HVDA 3IXSA 4ARIA 1KF6B 1UWMA 2RMMA 1B9RA 4C80A 2BTEA 1YN4A 4TQ0A 4RGTA 1FEHA 4LTUA 3FILB 2CJOA 4KKIA 1XXGA 2GI9A 4HJGE 2DBYA 3NS1A 3BVGA 4KGTA 1D5MC 4A90A 1RM6C 4N59A 3AEBB 1KRHA 5I4DA 5C3JB 1F77A 1M4VA 1QOBA 2WXLA 3AEFB 3GB1A 4A6QA 1J7AA 4XWTA 2HDEA 4RNAA 3ABVB 4B0MA 4RH6A 1ESFA 2WQYB 1MHHE 3EUB2 3O13A 1BXTA 3ETRA 4HEA1 3E56A 4A9AA 1N5WA 5D3IB 1C76A 2LHDA 1FCCC 1ZP0B 4HRSA 1TS4A 1L6VA 3IT4B 1QOFA 4L2YA 4HROA 2E6XA 2W55A 2WXKA 2MJEA 2BYTA 2PVGC 3U7ZA 1JQ4A 1N62A 3CIRB 3Q8AA 3ZYYX 3URYA 4M0WA 3LB8C 2W3RA 2ON8A 1TYGB 5G5GA 2K0PA 2FUG1 5JXVA 1YQ4B 1QT9A 1WSPA 1XCTL 1XLOA 3BYYB 2QEJC 5AUKA 2WXRA 1FNVA 5HI1A 2TSSA 1JRPA 4ZHOA 2RDHA 2WS3B 1SJED 3AE7B 3KWVA 3U52E 1I4PA 1RYJA 1C78A 1STEA 2DWQA 4ZYSA 1GT8A 3P4RB 2DYMA 3BVZA 4RCOA 1JWAD 1FIQA 1L5PA 4D2KA 3EGRA 5AUIA 4XWWA 1SJHD 3V3XA 1PGAA 3B2GA 3TEYA 1AYFA 4YSXB 2LEKA 4FXCA 1MPEA 3SR6A 4KGSA 4YXDB 1QF6A 1QKZA 5BYQA 1VZ7A 3BK2A 3T3NA 2KAJA 2ACZB 1L0XB 1D5XC 1NENB 2YEPF 1ZDVA 3KLSX 1SSNA 5HG2A 3U4EG 2WU5B 4RGMA 2PKOA 3B9JA 3FAHA 2GB1A 3E9SA 1TZOA 3LYYA 2QMTA 2K3UA 5BYSA 1PGXA 5FKAC 1PYWD 2LUMA 1YJJA 5E6JA 3NVZA 1BMLC 1L4ZB 3NVYA 3LXFA 1QQRA 4MACA 1E9MA 1FD6A 3FILA 1ENFA 2EELA 1T6BX 2JWUA 1N61A 1TJEA 2CU3A 3J9CA 4YTMB 1L0YB 3EA6A 3KWLA 2KACA 2WDVB 1UGJA 1YN5A 4RGOS 1N63A 1JWBD 1E7PB 3FC4A 2B76B 5T8IA 1SB3C 3VQIA 3GP7A 1PFDA 4JWUC 2H88B 3SFDB 1VZ6A 2I38A 2JU6X 2JYEA 2V4IB 3HUIA 1WXQA 1SE4A 4N58A 5H92C 1FRRA 2KN4A 5BMHA 2WNMA 5C2TB 4NAMA 2FBWB 1HA5A 1OFFA 3BK1A 3ZJVA 3PO0A 1NI3A 3MJ5A 3Q8FA 1TY2A 3V05A 1H7XA 2L52A 2X38A 1XF5L 2PTLA 5BMIA 1XO3A 4NJCA 1E0ZA 1SF0A 4P16A 2K5PA 1I7HA 2J4XA 5BYRA 1V1OA 2DYOA 2Z8LA 1I4QA 2MH7A 2PVOD 2IJ0A 2FE8A 2VZKD 3BIID 1BUIC 1PGBA 3TUOA 2NMQA 3U2SC 3Q8CA 2BB5A 3NVVA 3UI3A 1AWDA 1XLNA 2JYTA 2ONQA 1JALA 2QILA 2WXPA 3PZ7A 3ZJTA 1C79A 1XCQL 1ROEA 1KFYB 2WXIA 3AEGB 2Y5PA 5BMGA 1EU4A 3AE2B 1GTHA 1EM7A 2MJDA 2IDYA 1GB1A 1UUPA 4YSZB 4ZHPA 2H89B 1F0ZA 2ZW1A 3H8HA 1LO5D 3BWUD 2E3TA 3Q8EA 2L32A 1HZ6A 1P7FA 1V1PB 1V97A 2WXNA 1WRIA 3AM9A 3NRZA 2M19A 4OW0A 2JSVX 2LJIA 1NEKB 3PZ8A 4KKJA 2BS3B 1QOAA 3MFGA 4YWGG 4B0EA 4LK0M 2I2YA 1J7BA 3AEDB 3RFZB 1L6UA 4Q2JA 5EE3A 4P6VF 1KH0A 4H2AA 1K53A 1FNUA 1UNSA 4N6EB 5D7GA 1L0VB 1K50A 4J3OD 2G9HD 3C8YA 3P1MA 2SAKA 3BYTB 3NZ3A 4JWSC 3T3OA 1IBXB 2Q5WD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FO4 A;  3RPF C;  1N5X A;  1DOY A;  1N61 A;  3CWI A;  2W3S A;  5G5H A;  1TJE A;  2CU3 A;  4YTM B;  1J7C A;  3KWL A;  2HTM E;  2WDV B;  3NVW A;  4IDI A;  2PIA A;  1WGK A;  3AV8 A;  1GPX A;  1CZP A;  1VLB A;  1N63 A;  1JWB D;  1E7P B;  1YQ3 B;  1XLP A;  2K22 A;  2QIE B;  3FC4 A;  3HRD D;  2WDQ B;  2B76 B;  3DWG C;  4ITK A;  1NVI D;  1SB3 C;  2AX5 A;  1DOX A;  4ZOH C;  2N0S B;  2L83 A;  1PFD A;  1QOG A;  1KF6 B;  1UWM A;  2WLB A;  4JWU C;  5EE0 A;  1B9R A;  3VRB B;  1A70 A;  2Y5C A;  2H88 B;  3SFD B;  4C80 A;  5MPO A;  3AMZ A;  3HUI A;  2BS2 B;  1WXQ A;  4LTU A;  2BT6 A;  2CJO A;  3CF4 A;  1FRR A;  2EKI A;  4N58 A;  5H92 C;  3W5V B;  1VDV A;  2DBY A;  1TKY A;  3VR9 B;  1WWT A;  1RWS A;  3NS1 A;  2WU2 B;  5EE9 A;  1QF6 A;  5C2T B;  1RM6 C;  4N59 A;  3AEB B;  5EE1 A;  1FFV A;  2FBW B;  1KRH A;  3W5U B;  1FRD A;  1OFF A;  5C3J B;  1OQR A;  3AE3 B;  3PO0 A;  1NI3 A;  1RFK A;  1QOB A;  1H7X A;  3AEF B;  2L52 A;  3L4P A;  1FXI A;  1J7A A;  2OHF A;  1DOI A;  3ABV B;  1IUE A;  1GTE A;  2KMM A;  4C7Z A;  1DGJ A;  2WQY B;  1XO3 A;  3AE6 B;  3EUB 2;  4US8 A;  3ETR A;  4US9 A;  1E0Z A;  3P4S B;  1SF0 A;  1N5W A;  4A9A A;  2K5P A;  1I7H A;  1ZP0 B;  4HRS A;  4C7Y A;  1YJI A;  1EWY C;  5H8Y E;  1L6V A;  1QOF A;  4HRO A;  4JX1 C;  2W55 A;  2MH7 A;  2MJE A;  2PVG C;  4WWM A;  3P4P B;  2PVO D;  1JQ4 A;  1N62 A;  1QLB B;  1N60 A;  3CIR B;  1SIJ A;  3ZYY X;  3BII D;  3AE1 B;  1E10 A;  3LB8 C;  2W3R A;  1FFU A;  1TYG B;  1FM0 D;  5G5G A;  1YQ4 B;  1QT9 A;  1XLO A;  3NVV A;  3SFE B;  5AUK A;  3AE5 B;  4KX6 B;  1AWD A;  3AEC B;  1CJE A;  1JAL A;  1JRP A;  1XLN A;  3B2F A;  4ZHO A;  4WQM A;  2M56 B;  1ROE A;  1KFY B;  2G1E A;  2WS3 B;  1JRO A;  3AE7 B;  2CJN A;  3WCQ A;  1V8C A;  2WDR B;  3AEG B;  1RYJ A;  5GXG B;  2DWQ A;  3AEA B;  1GT8 A;  3AE2 B;  3P4R B;  1GTH A;  3AE4 B;  1FIQ A;  1JWA D;  1L5P A;  1ZUD 2;  2K9X A;  2MJD A;  5AUI A;  4USA A;  3VR8 B;  3AH7 A;  1XLQ A;  4YSZ B;  4ZHP A;  2H89 B;  1FMA D;  3P63 A;  1F0Z A;  3HVZ A;  3B2G A;  3DWM A;  1ZXI A;  2JX5 A;  1AYF A;  4YSX B;  2LEK A;  2E3T A;  4FXC A;  3SR6 A;  1R7S A;  4YXD B;  3AE9 B;  3AE8 B;  1ZOY B;  1V97 A;  1WRI A;  2JQR B;  2MJ3 A;  2M19 A;  3AM9 A;  3NRZ A;  1T3Q A;  2KAJ A;  2ACZ B;  3AN1 A;  1NEK B;  1JW9 D;  1PDX A;  1NEN B;  2BS3 B;  1QOA A;  1NYQ A;  3AEE B;  1VJK A;  2WU5 B;  1OQQ A;  3AB5 A;  2PKO A;  1TKE A;  3VRA B;  3AED B;  1J7B A;  1L6U A;  3B9J A;  1WYG A;  5EE3 A;  3FAH A;  1PUT A;  4P6V F;  1NYR A;  4N6E B;  1L0V B;  4YT0 B;  2BS4 B;  4YTN B;  2WP9 B;  3P1M A;  1YJJ A;  4YSY B;  1H7W A;  1GAQ B;  3NVZ A;  3W9C B;  2W54 A;  2QJL A;  1TKG A;  4JWS C;  3NVY A;  3LXF A;  3P4Q B;  4YTP B;  1FXA A;  1E6E B;  2Q5W D;  1E9M A; 
#chains in the Genus database with same CATH topology
 5KHQ A;  2KLG A;  2LGS A;  2KX0 A;  4ZRK A;  1WMH B;  1UBQ A;  3T8M A;  3ZTC A;  1EU3 A;  3NS8 A;  2N9L A;  1YQ3 B;  3K9P B;  4ZRQ A;  3L10 B;  2WLB A;  2ZNV C;  2ZPY A;  3UIO B;  2RD0 A;  5EE9 A;  1NI2 A;  2WXQ A;  4IUM B;  1OQR A;  4MGI E;  4WH4 A;  2LFI A;  4HK2 A;  1C77 A;  3Q69 A;  2JWZ A;  3ZTD A;  4TQ1 A;  2M8S A;  4BKG A;  5L83 A;  1C4A A;  3RZF A;  4KZC A;  4EEW A;  1OTR B;  2ZEQ A;  2DEN B;  2BVC A;  4W9K A;  3AE1 B;  1ZPS A;  1P7E A;  2LGD A;  3LJ3 A;  2CJN A;  2KTF A;  5GXG B;  1CQV A;  3AEA B;  3ZRC A;  1E8Y A;  1ZXH A;  2Y3A A;  3N9Y C;  1SE2 A;  1YOV B;  2XN9 C;  1SIF A;  1TZ1 A;  2JX5 A;  1V9J A;  3M95 A;  2I1K A;  1JCK B;  2O6V B;  2KO3 A;  2L00 B;  2ZW0 A;  4XE0 A;  4ZRP A;  5D2M B;  3RYT A;  3BY4 B;  4C4V B;  3W1Y A;  4PYU A;  1IGD A;  2BS4 B;  1TT5 B;  1LXD A;  3W9C B;  2LD9 A;  4BOZ B;  1FXA A;  4FJZ A;  2MEK A;  1GOZ A;  2PW9 A;  1HEZ E;  4FUL A;  4HWI B;  1I42 A;  4G50 A;  2V3P A;  3DBL B;  4G0N B;  3UF8 A;  2K22 A;  5AZG A;  2KWD A;  2WDQ B;  4A3O A;  4ITK A;  2L1A A;  3I3T B;  1WM3 A;  2N0S B;  3PZD A;  1E7U A;  4NZL B;  2Y5C A;  2JZP A;  3M3J A;  3VDZ A;  2LRU A;  1I4R A;  4RFB A;  1VDV A;  2QSD A;  2WU2 B;  2KKC A;  4W9H A;  4W9E A;  3L4P A;  5AEK B;  1P1A A;  2LVP A;  4E74 A;  2BKF A;  2MLB A;  2ASQ A;  3DCG A;  1YJI A;  1KLG D;  3VTW A;  2CHW A;  4GSW A;  3DQV A;  3V6C B;  4S0R A;  3P4P B;  1YMH E;  4NY0 A;  2DLB A;  3MP9 A;  1S3S G;  1FFU A;  4IKG A;  4GGQ A;  1K51 A;  4NQL B;  4WQM A;  3DHG C;  2CHX A;  2G1E A;  4KIK A;  2FCM A;  3RNG C;  3DBR B;  2MBQ A;  1TS3 A;  3A9K A;  4USA A;  1UGM A;  3KW5 B;  4UDU C;  4EE2 A;  2JF5 A;  3L16 A;  3ZO5 B;  1WX8 A;  1GB4 A;  4OVU A;  3TCA A;  3LDZ E;  3ZDT A;  1T5X D;  5TSS A;  3KYC D;  4M02 A;  4NAW B;  4OZB A;  1OQQ A;  2D10 A;  4MSQ B;  1WYG A;  4JE3 B;  1V86 A;  2AQ1 B;  4ARC A;  2PMV A;  4E3C A;  2WP9 B;  2JRI B;  1UEL A;  1B1Z A;  5JHB A;  4JGH B;  1WJN A;  1DYQ A;  1IP9 A;  2KK8 A;  3QWZ B;  1OGW A;  2V4L A;  3KUD B;  4DK5 A;  5FR3 A;  2WXM A;  2HTM E;  4A55 A;  4M8N A;  2KDE B;  1D3Z A;  3R2T A;  2KMA A;  2JXT A;  3ZUN A;  3DBH B;  3IXS A;  3WAO A;  4ARI A;  1KF6 B;  1UWM A;  2RMM A;  3EHV A;  1B9R A;  1YN4 A;  2O2V A;  3WAM A;  4RGT A;  1FEH A;  1XXG A;  3DVN V;  3RNF C;  3TIX A;  2LGX A;  1X1M A;  4N59 A;  1RRB A;  1F77 A;  2QDF A;  2WWZ A;  1GJZ A;  4XYC A;  5D3I B;  1C76 A;  2N4F A;  1FCC C;  3V60 A;  1TS4 A;  1N6Z A;  2IO3 B;  2JY6 A;  2KN5 A;  3SD5 A;  3ZNZ B;  4HRO A;  2MJE A;  1N62 A;  3MJW A;  2KJ6 A;  3ZVV A;  3LB8 C;  4NAW A;  2K0P A;  1QT9 A;  5AUK A;  2WXR A;  5HI1 A;  2TSS A;  2KXJ A;  5AZF A;  3QIJ A;  4ZHO A;  2RDH A;  1WRD B;  5IKC M;  1C78 A;  1STE A;  4ZYS A;  3P4R B;  2NBU A;  3PGE A;  5AUI A;  2HJ1 A;  3PHX B;  3DPD A;  3TEY A;  4PK1 A;  4FXC A;  2EMT A;  3DBH I;  2IND C;  2IY1 B;  2ACZ B;  2MP2 A;  1NEN B;  1ZDV A;  4RGM A;  1XQQ A;  3NY5 A;  1EF5 A;  3LYY A;  2QMT A;  2D07 B;  1PGX A;  2FUH B;  3I5J C;  1WMH A;  1YIW A;  5DPW A;  2KHW B;  3NVZ A;  4MM3 A;  1BML C;  3LXF A;  4MAC A;  4HJK A;  5DPT A;  1MG4 A;  3FIL A;  2N9P C;  2FCQ A;  5IA7 A;  3J9C A;  1UD7 A;  4PS8 A;  4FBJ B;  2D2Q A;  4EZJ A;  2K8H A;  1PFD A;  1WIA A;  4IW0 A;  4FLH A;  2H88 B;  2JU6 X;  2V4I B;  5H92 C;  1P98 A;  3EFC A;  4HCP B;  4NAM A;  3BK1 A;  3ZJV A;  3PO0 A;  1WZ3 A;  2BWE S;  3MJ5 A;  1H7X A;  2L52 A;  2IO0 B;  4DHZ B;  4NJC A;  2K5P A;  3C19 A;  5BYR A;  2DYO A;  5J17 A;  1T0Q C;  2K8C A;  2M4N A;  4S17 A;  2KTR B;  3OAW A;  2IJ0 A;  2VZK D;  1BUI C;  3DBL I;  1H4R A;  2EMS A;  1XLN A;  2ONQ A;  3ZJT A;  4M0W B;  2M17 A;  1C79 A;  1XCQ L;  1KFY B;  3H1U A;  1PQS A;  2G3Q B;  3EFU A;  1EM7 A;  1WXM A;  2ZPN A;  3H8H A;  2NBW B;  3VUX A;  3PHW B;  1V97 A;  4EFO A;  2LJI A;  1HTO A;  2PE9 A;  3PZ8 A;  5E6O A;  5IAA C;  2NPT B;  3MFG A;  4LK0 M;  2I2Y A;  3AED B;  3A33 B;  4P6V F;  1KH0 A;  2INC C;  3OG5 A;  3P1M A;  2UWQ A;  3DOW A;  2SAK A;  3BYT B;  4IM2 A;  2MBO A;  5GMV A;  3EEC A;  2Q5W D;  4LNF A;  4KSK C;  2KQ4 X;  2LHE A;  3PRE A;  2MA9 B;  4P7I A;  3BZD B;  3TMP B;  4IDI A;  1IGC A;  3QJZ A;  2KZR A;  2LGI A;  4IWP A;  2DZK A;  2VZK B;  3PLU A;  4ANX A;  2IGD A;  4LLG M;  2WXH A;  1C9F A;  2WYQ A;  5D6J B;  3TL5 A;  2L0F A;  3WA0 A;  1QOG A;  1A70 A;  1MG8 A;  3W5U B;  1IBX A;  1YQB A;  2L8J A;  2AWT A;  3Q3J A;  1HE8 A;  5JH5 C;  2OHF A;  1IUE A;  5TR5 A;  1WXS A;  3P4S B;  1HXY D;  2KLC A;  2ZNV B;  1K8R B;  3A9J A;  2K25 A;  1YJ1 A;  3NHE B;  1SIJ A;  4WWP A;  2K1F A;  4JL9 A;  1SXT A;  4LNI A;  3ECI A;  4DXG A;  3SDL C;  3NZU A;  1JRO A;  3RD2 A;  1V8C A;  2OED A;  2MRP A;  2OOB B;  3ONS A;  3AE4 B;  5HFY A;  3AH7 A;  2WXG A;  3P63 A;  1M94 A;  5D3D A;  1ISN A;  2RGF A;  1YN3 A;  2MJ3 A;  2N7J A;  3PS6 A;  2HE7 A;  2RPV A;  1MJD A;  1WGH A;  2C7H A;  1WXA A;  1CK1 A;  1VJK A;  2DNF A;  4QAY A;  3ZJU A;  1TKE A;  2X8X X;  3NJT A;  2KAN A;  1NYR A;  2UYZ B;  3CF6 E;  1WE6 A;  1TBE A;  1I4G A;  1EF1 A;  3SHQ A;  4YTP B;  3KUC B;  4K7U A;  4XDC A;  2W3S A;  2Y5B B;  3ZW3 A;  3N20 C;  2WX1 A;  3VH4 B;  1CZP A;  4A20 A;  2O2V B;  1OQY A;  3B08 A;  2FCS A;  4A3P A;  3ZXR A;  3OWE B;  2R61 A;  3R3M A;  4HPL B;  1SE9 A;  4JQW C;  3VRB B;  1WXV A;  3N3K B;  3AMZ A;  1YX5 B;  2M0X A;  3CF4 A;  2EKI A;  1TKY A;  1WWT A;  3QX1 A;  4MT5 A;  1Q10 A;  5EE1 A;  1FFV A;  2CHZ A;  1FRD A;  2M0A A;  1V80 A;  2MCN B;  2D5G A;  3Q3M C;  4EZL A;  1FXI A;  1F2R C;  2J42 A;  3BVM A;  4US8 A;  3APC A;  1FCL A;  1Z2M A;  5H8Y E;  2ZVN A;  3AI5 A;  4WWM A;  1J0G A;  1WF9 A;  2KDI A;  1E10 A;  2KT7 A;  1FM0 D;  4K7S A;  2QCZ A;  4IWQ A;  1P9D U;  3AE5 B;  4KX6 B;  1CJE A;  5DCN A;  2PPH A;  2KJH B;  2M56 B;  3DVG Y;  3WCQ A;  3A4S C;  4MGY E;  2WDR B;  2SEB D;  1V2Y A;  2M1M A;  1ZUD 2;  3ZKJ C;  2BBC A;  3X23 A;  1C4P A;  3P2B A;  3TSS A;  3HIZ A;  1J8C A;  1WM2 A;  2YLM A;  4WJN A;  3Q14 C;  3UQB A;  4MEL A;  2DYB A;  3AUL A;  1TTN A;  3VUY A;  2NTS A;  4MH8 A;  2GBJ A;  1TY0 A;  4GIV A;  1JWM D;  2G4S A;  2KX3 A;  3KQ4 A;  1WI0 A;  2GMI C;  4WJQ A;  4IOI E;  1VRA B;  4HKQ A;  3K9O B;  1FO4 A;  2WHI A;  3RPF C;  4BBN C;  2J52 A;  5CHW A;  1ET6 A;  2YEP B;  3WAN A;  2ICI A;  1XEE A;  4W9L A;  4FA6 A;  3ZDM C;  2WXO A;  1SGH A;  3DWG C;  2BPS A;  4MM3 B;  3B0A A;  2AX5 A;  4RF1 A;  2N7D A;  3DBR I;  3JYU A;  4KKI A;  2GI9 A;  4HJG E;  2DBY A;  3NS1 A;  1T0S C;  2KFK B;  5I4D A;  1I35 A;  2NCN A;  1QOB A;  2D3G A;  4LDT D;  4A6Q A;  5DPR A;  4RNA A;  3ABV B;  4DXA B;  4MDK E;  2WQY B;  1YD8 U;  3O13 A;  3ETR A;  4HEA 1;  4A9A A;  1N5W A;  3BIN A;  4F1S A;  4X57 B;  4HRS A;  5HKH A;  1AAR A;  2E6X A;  2WXK A;  3U7Z A;  2IZV B;  1WE7 A;  3PV1 A;  3Q8A A;  4FHK A;  1QZE A;  3KH0 A;  3RUL A;  3UQA A;  1YQ4 B;  1WSP A;  1XCT L;  2CU1 A;  3BYY B;  2QEJ C;  5IO9 A;  4HPM B;  2WS3 B;  1SJE D;  3KWV A;  2BWF A;  4RM9 A;  4FHJ A;  2BGF A;  4B95 A;  4GDL A;  2AL6 A;  3WIM A;  3BVZ A;  4RCO A;  5LXI B;  3ML9 A;  4II3 B;  1UBI A;  1SJH D;  1PGA A;  1V5T A;  1AYF A;  3SR6 A;  2JVC A;  4YXD B;  3BK2 A;  2J7Q B;  2YEP F;  1F9J A;  3U4E G;  2WU5 B;  4I6L B;  4WQO B;  2JXX A;  3TJP A;  3RMK C;  4GMV A;  2AL3 A;  3HM3 A;  3ZNH B;  3E9S A;  1TZO A;  3RN9 C;  2K3U A;  5BYS A;  3QAR A;  1YJJ A;  2KWV B;  2NVU I;  1E90 A;  3NOB A;  2FIF A;  3WAP A;  1WJ4 A;  4K7W A;  1ENF A;  2EEL A;  3QC8 B;  2JWU A;  2LXC A;  4K1R B;  2LVO A;  1N61 A;  1ZGU B;  2R2Q A;  4AJW A;  2CU3 A;  3WAL A;  4YTM B;  2IYD B;  1WGD A;  4M00 A;  4RGO S;  2L3Z A;  1E5W A;  1WGR A;  1HTQ A;  2L76 A;  2BF8 B;  3U7D A;  1SB3 C;  3VQI A;  1OEY J;  1CMX B;  2NPT A;  4II2 B;  3H7P B;  4MGZ E;  5LXH A;  2Z0D B;  2JYE A;  4HCN B;  2MHJ A;  1FRR A;  2KN4 A;  1C3T A;  3VXW A;  3V61 A;  4FN2 A;  4N9F 4;  2FBW B;  4W9I A;  1OFF A;  2KWU B;  2LWP A;  3L17 A;  3Q8F A;  3AU5 A;  3Q3F A;  3V05 A;  3IBE A;  2KVR A;  5BMI A;  1WX7 A;  1XO3 A;  3U8Z A;  1I7H A;  2C9W B;  1OEY A;  2Z8L A;  2MH7 A;  5CHF A;  3U30 A;  4DDI D;  2NBV B;  1PGB A;  4BKS D;  1P0R A;  3UI3 A;  4HVB A;  3VAW A;  1A5R A;  2IY0 B;  1WGG A;  4TUU A;  1ROE A;  2WXI A;  2N7E A;  2Y5P A;  1EU4 A;  3AXC A;  4M8M A;  2MJD A;  2RDB C;  5G2N A;  4XZ4 A;  2ZW1 A;  4LNO A;  1F0Z A;  3PRZ A;  1LO5 D;  2KC2 A;  3RCZ A;  2L32 A;  3QA8 A;  3VVW B;  3NRZ A;  4DDG D;  2M19 A;  1GC6 A;  1S1Q B;  3GZN I;  4YWG G;  4B0E A;  1GNU A;  3Q6B A;  4K3C A;  5LLI A;  3ZIM A;  3RFZ B;  1FNU A;  4J3O D;  1K50 A;  4AUQ C;  2D3B A;  2G9H D;  4JIO U;  1E8X A;  2WX0 A;  2AYO B;  2KWC A;  4JWS C;  3VUW A;  2LZ6 A;  2W82 A;  4CO7 A;  1Y56 A;  5G5H A;  2ZJD A;  3M62 B;  1LQB A;  4BBN F;  3C0R B;  3NVW A;  3IAS 1;  3GE3 C;  2PIA A;  4G3X B;  4WIP A;  2N9X A;  3HRD D;  1ZDX A;  1WYW B;  1NVI D;  3OJ3 A;  1EWC A;  5EE0 A;  4DBG A;  4AQ7 A;  2A5U A;  2BW2 A;  3Q8B A;  4C7Y A;  2NTT A;  2JT4 B;  2PLP A;  2WXJ A;  3MTN B;  2INN E;  3IFW B;  1TIF A;  3JVZ X;  1DOI A;  4IM3 A;  2KMM A;  1UWX A;  1DGJ A;  1ZKH A;  3GZN B;  3H7S A;  4GDK B;  3IVF A;  2WGS A;  1RAX A;  3I9V 1;  2ZVO A;  4B9K A;  2IPK D;  2NR2 A;  4AOF A;  4JX1 C;  2GBK A;  4R3D A;  3N32 A;  3QK0 A;  5J2R A;  1TS5 A;  3RUI B;  4REZ A;  4ICU A;  3SFE B;  1V1P A;  4B6W A;  1T0Y A;  4KIK B;  2RDG A;  4EZK A;  3A9K B;  3MHZ A;  4XX5 A;  4KZ0 A;  4IM0 A;  3VR8 B;  1XLQ A;  1ZXI A;  5D94 A;  3JW0 X;  4GU2 A;  2BYE A;  2HJ8 A;  3AE9 B;  1ZOY B;  3DHH C;  4ANU A;  1VR9 A;  2BQQ A;  2V1Y A;  1JWS D;  1H7W A;  1GAQ B;  2QJL A;  1TKG A;  3P4Q B;  1E6E B;  2L7R A;  4O1N A;  1F52 A;  5BO4 B;  1J7C A;  2YVC A;  4LJO B;  3DHI C;  4OVZ A;  2C5L C;  4CQN A;  4IG7 B;  4C56 C;  4ZOH C;  2ZCB A;  2L83 A;  3TEX A;  2JZ3 B;  1IPG A;  1P3Q U;  2LJ5 A;  2BS2 B;  1KLU D;  3V6E B;  2BB6 A;  3W5V B;  2QC8 A;  4FJV B;  2D3A A;  4LJP B;  1VZ8 A;  3AE3 B;  3KUZ A;  4URK A;  4OHJ A;  2L0T A;  2HD5 B;  2MW5 A;  1AW7 A;  3X0W A;  4WAF A;  1D6E C;  3I63 C;  3ZXV A;  1EWY C;  2JUO A;  2AQ3 B;  3M63 B;  3H6N A;  3DVG X;  1WFY A;  4DHJ D;  1F2R I;  1Q0W B;  2IBI B;  1I4X A;  3PT2 B;  1JML A;  1XT9 B;  1JWU D;  2C7M B;  1ET9 A;  2LRW A;  4BZA A;  2PEA A;  1E8Z A;  3ZNG C;  3DWM A;  3H9D A;  2JQR B;  3AE8 B;  4HDQ A;  3RNA C;  5AZH A;  3GE8 C;  2KYW A;  3AN1 A;  3NUH B;  4BVU C;  2IO2 B;  1NYQ A;  3AEE B;  1WX9 A;  3R8B A;  3VRA B;  2O6V D;  1SE3 A;  2BYF A;  3SEB A;  3KVF B;  4DQO C;  1ZW7 A;  4WJP A;  2K6Q A;  2KMC A;  1NBF C;  4BAX A;  4GXB A;  3GOE A;  2J0K A;  1FPY A;  1WJ6 A;  3ZQ4 A;  2IGH A;  3I57 A;  1N5X A;  1R4N B;  1GC7 A;  3PLV A;  4WUR A;  1ACC A;  3PVL A;  1RFA A;  2DZI A;  2K39 A;  4P1C C;  3QAQ A;  1H8C A;  2VH2 A;  3V62 A;  1U4A A;  4TQ0 A;  4LTU A;  4A90 A;  4M01 A;  3BVG A;  1D5M C;  1WZ0 A;  3IG3 A;  1KRH A;  3L0W B;  2RSU A;  4F7Z A;  1M4V A;  3AEF B;  3RNC C;  2LGY A;  4MGK E;  4XC2 A;  2KD0 A;  4RH6 A;  4YL8 A;  3EUB 2;  4LCD E;  1BXT A;  2LHD A;  4DHJ B;  1L6V A;  3IT4 B;  1QOF A;  4AP4 C;  2REX A;  2W55 A;  2BYT A;  2PVG C;  3SU8 X;  1JQ4 A;  2JPH A;  3URY A;  4M0W A;  4WWN A;  2W3R A;  2ON8 A;  1TYG B;  2FUG 1;  3UIP B;  2GOW A;  1FNV A;  2MX2 A;  3ZLZ A;  1EO6 A;  4C00 A;  2KFJ A;  3AE7 B;  1RLF A;  1I4P A;  1KM7 A;  3RT3 B;  1GT8 A;  2DYM A;  1JWA D;  1L5P A;  4D2K A;  3EGR A;  3APD A;  2K8B A;  3V3X A;  3B2G A;  2LEK A;  1MPE A;  1QKZ A;  4IWO A;  3T3N A;  2KAJ A;  1D5X C;  3KLS X;  1SSN A;  1EUV B;  2KNB A;  2PKO A;  1UF0 A;  3FAH A;  2GB1 A;  2UU7 A;  2MBH A;  5FKA C;  4W9G A;  1PYW D;  3EC8 A;  5E6J A;  5CTR C;  4W9F A;  4IC7 B;  1IYF A;  1QQR A;  4TKN A;  1T6B X;  5G55 A;  1L0Y B;  3EA6 A;  3KWL A;  2KAC A;  1UGJ A;  4BFR A;  3FC4 A;  4CHK A;  4NPN A;  2GLS A;  5T8I A;  4ZRJ A;  3APF A;  4P1B C;  4JWU C;  3L08 A;  4BKT A;  3SFD B;  1VZ6 A;  2Z0E B;  3HUI A;  1WXQ A;  5BMH A;  2WNM A;  1LGR A;  1V5O A;  1HA5 A;  1WY8 A;  4BOS C;  2ZZP B;  4BKS A;  1TY2 A;  2PTL A;  1F1H A;  2PJH A;  1SF0 A;  2VH1 A;  4PS7 A;  3MC8 A;  2J4X A;  3ALB A;  1I4Q A;  4HPP A;  1Y8R C;  3QCA A;  2PVO D;  2LXA A;  2FE8 A;  3BII D;  1Q5W B;  3TUO A;  2FAZ A;  2NMQ A;  5CX3 A;  3NG0 A;  3U2S C;  3Q8C A;  3NVV A;  4PS3 A;  1AWD A;  2JYT A;  2QIL A;  1JAL A;  2WXP A;  3L13 A;  2R2O A;  1KLV A;  4EKU A;  5E6N A;  2XEW A;  4J6I A;  4W9D A;  3AEG B;  1LM8 B;  2VRR B;  3AE2 B;  3KYD D;  3Q3O C;  1GB1 A;  3VFK A;  4YSZ B;  2BYV E;  3BWU D;  3Q8E A;  2XK5 B;  4JLC A;  1HZ6 A;  2J0M A;  1V1P B;  5E6P A;  3AM9 A;  2JSV X;  2CR5 A;  2I1J A;  4WWO A;  4KKJ A;  4F8C B;  2V9H A;  2KTR A;  1J7B A;  4Q2J A;  5EE3 A;  4DWF A;  1UNS A;  4N6E B;  5D7G A;  1L0V B;  2KC1 A;  3Q3N C;  2C60 A;  3NZ3 A;  2LI5 A;  4NJ7 A;  4XGA B;  1SEB D;  1I4H A;  3AV8 A;  1GPX A;  2FID A;  3ZNI D;  3W2D A;  1Z5S B;  1XLP A;  2QIE B;  3FKY A;  4ZRI A;  1MHX A;  1WR1 A;  3VHT C;  1R4M B;  2BT6 A;  3TBL D;  3VR9 B;  4W9C A;  2FCN A;  5HHD G;  1RFK A;  3MC9 A;  4C7Z A;  3AE6 B;  2N9K A;  4MJS B;  3VH3 B;  5LNK 1;  1Q1O A;  2G45 B;  3S2A A;  3RI7 C;  2LAS A;  2MQJ A;  1YNT E;  3N30 A;  3AEC B;  1KJT A;  4HDO A;  1T0R C;  2IGG A;  4MEM A;  3RZW C;  4GB9 A;  2CKH B;  2WXF A;  4DXF A;  1AN8 A;  4LNN A;  3R66 C;  1BT0 A;  1K52 A;  4RF0 A;  4TSS A;  1R7S A;  4GOC A;  2GRI A;  4CYE A;  4L23 A;  1D5Z C;  2J53 A;  2KFK A;  2L05 A;  5FK9 C;  5C23 A;  2KDB A;  3AB5 A;  3IAM 1;  2CS4 A;  1KOT A;  4AWJ A;  4HXD A;  1MVK A;  4YT0 B;  4OZA A;  4ACF A;  1D4B A;  2V3S A;  3OJ4 B;  2KDF B;  2V0G A;  1TS2 A;  1GG3 A;  1V6E A;  3IT6 B;  1FXT B;  3CWI A;  1HQR D;  4NJ6 A;  3ZGZ A;  3ML8 A;  1R4N I;  4RGN A;  4EUT A;  1KTK A;  3CST A;  4XDD A;  2G4D B;  1E7V A;  4LNK A;  4OZC A;  1ZE3 D;  1HZ5 A;  2AQ2 B;  5MPO A;  3VTV A;  2KDM A;  3MC0 B;  1RWS A;  4ASW C;  4A8X C;  1JRU A;  2INP E;  5IP4 D;  4KDL B;  3QHT A;  1GTE A;  1QIL A;  4FJY A;  2RPQ A;  4EOY A;  2NS5 A;  2EKE C;  3Q2A C;  5JHA A;  2W9N A;  3L54 A;  1QLB B;  3QQ8 B;  1N60 A;  5L95 C;  2XK5 A;  1XD3 B;  4L1B A;  2K6D B;  4AS1 A;  2OJW A;  4FAD A;  4OVV A;  2IO1 B;  2V3N A;  3W1S A;  3DDC B;  3HM6 X;  3B2F A;  1WH3 A;  3TEW A;  4GDL B;  1WGY A;  4ZYN A;  2QHO A;  4PT5 A;  2N1V A;  2K9X A;  3R7Q A;  2LUE A;  4HKZ E;  1FMA D;  3HVZ A;  4GLS C;  5FR6 A;  3TEZ A;  1SBB B;  2XNA C;  3W1S C;  3GS2 A;  1T3Q A;  5JZE B;  1R4M I;  1JW9 D;  1PDX A;  1UZX B;  4AJY B;  1PUT A;  5EDS A;  4WAA A;  2RR9 A;  2MWS B;  3N1X C;  4YTN B;  1C4C A;  4YSY B;  3PRP B;  2LMC A;  2W54 A;  3R7R A;  1FNW A;  4US9 A;  2FNJ B;  4JPS A;  4KSL C;  1DOY A;  2MSE D;  1L4D B;  5IOI A;  2A4Z A;  2PE6 B;  1WGK A;  1VLB A;  3P42 A;  1MI0 A;  3IHP C;  4TMA B;  3JSV B;  3H7P A;  2DAJ A;  3R2I A;  4KGR A;  1E8W A;  4TV3 A;  1DOX A;  3DVN U;  3HVD A;  4LDT B;  4MH0 E;  4C80 A;  2BTE A;  2D11 A;  3FIL B;  2CJO A;  4KGT A;  3PPA A;  1RM6 C;  2JZZ A;  3AEB B;  5C3J B;  2WXL A;  3GB1 A;  4I6P A;  1J7A A;  4XWT A;  2HDE A;  4B0M A;  1ESF A;  1MHH E;  2KQ7 A;  3E56 A;  1V49 A;  4KDI C;  2B3A A;  1J19 A;  3HHM A;  5J18 A;  1ZP0 B;  1C1Y B;  3NZS A;  4L2Y A;  3PSE B;  2O6V A;  3CMM B;  3N1Z C;  1TGZ B;  1MFW A;  3CIR B;  3PTF C;  1UH6 A;  3ZYY X;  2C7N B;  1GUA B;  5G5G A;  5JXV A;  2MBB B;  1XLO A;  2KJR A;  3RNB C;  1JRP A;  2GBM A;  4ANV A;  4MJS A;  3A1Q B;  3U52 E;  2XBB C;  1RYJ A;  2DWQ A;  3A9J B;  1VCB A;  1FIQ A;  4XWW A;  4NQK E;  5CHV C;  4YSX B;  2DX5 B;  4KGS A;  1QF6 A;  2DHZ A;  5BYQ A;  1VZ7 A;  1VD2 A;  4GN1 A;  1L0X B;  3OLM D;  2N9E B;  3DBS A;  5HG2 A;  4GDK A;  2DAF A;  4KV2 A;  3RNE C;  4ICV A;  2KQS A;  3B9J A;  1LFD A;  2BKR B;  2LUM A;  3CSF A;  3NVY A;  1L4Z B;  2HTH A;  1E9M A;  1FD6 A;  4WJO A;  4DHZ E;  1TJE A;  4KVG B;  2N1W A;  3UGB B;  2DZM A;  2WDV B;  1YN5 A;  1N63 A;  1JWB D;  1E7P B;  4C4V A;  2Z59 B;  5C1Z A;  2B76 B;  3ZRF A;  4I6N B;  1NDD A;  3AU4 A;  3GP7 A;  4K3B A;  2I38 A;  2JRH A;  4W9J A;  1L7Y A;  1SE4 A;  4N58 A;  4ZDV A;  4K81 A;  2ZCC A;  5C2T B;  1NI3 A;  3N1Y C;  2X38 A;  1XF5 L;  3A4R A;  4E71 A;  1E0Z A;  4P16 A;  2KVZ A;  3HK0 A;  1V1O A;  4MSM B;  3B1L X;  3UIN B;  3VTU A;  4NNJ B;  3A1Q A;  2GBN A;  2MP2 B;  2OJR A;  2BB5 A;  3O65 B;  4HLE A;  3PZ7 A;  1WJU A;  2KOX A;  1WR6 E;  2J0J A;  5BMG A;  4RM8 A;  4G11 A;  3T9L A;  1GTH A;  2IDY A;  2MBE A;  5DPS A;  1YX6 B;  1UUP A;  1G6J A;  3D32 A;  4ZHP A;  2H89 B;  2AEH A;  5IN7 A;  2GBR A;  2E3T A;  1P7F A;  2WXN A;  1WRI A;  4OW0 A;  4ANW A;  4PYZ A;  1NEK B;  2DZJ A;  2BS3 B;  1QOA A;  2D3C A;  4RMA A;  3MHS D;  1L6U A;  2LVQ A;  4H2A A;  1K53 A;  1L2N A;  3C8Y A;  3PRM B;  2WDT B;  3JSV A;  1V81 A;  3T3O A;  3ENE A;  1IBX B;  5KHO A; 
#chains in the Genus database with same CATH homology
 2W82 A;  1Y56 A;  5G5H A;  2KQ4 X;  2LHE A;  3BZD B;  3NVW A;  3IAS 1;  4IDI A;  2PIA A;  1IGC A;  1I4H A;  1SEB D;  2LGI A;  3AV8 A;  1GPX A;  2VZK B;  3W2D A;  1EU3 A;  2IGD A;  2N9L A;  4LLG M;  1YQ3 B;  1XLP A;  2QIE B;  4WIP A;  3HRD D;  1ZDX A;  2WXH A;  1NVI D;  1C9F A;  4ZRQ A;  1MHX A;  1QOG A;  1EWC A;  2WLB A;  5EE0 A;  1A70 A;  4AQ7 A;  2BW2 A;  3Q8B A;  3W5U B;  4C7Y A;  2BT6 A;  2NTT A;  1IBX A;  3VR9 B;  5EE9 A;  2WXQ A;  2PLP A;  1OQR A;  4WH4 A;  2WXJ A;  5HHD G;  1RFK A;  2LFI A;  2INN E;  1C77 A;  3Q69 A;  2OHF A;  1DOI A;  1IUE A;  4C7Z A;  2KMM A;  1UWX A;  1DGJ A;  4TQ1 A;  3AE6 B;  2N9K A;  3P4S B;  1HXY D;  4GDK B;  3I9V 1;  1C4A A;  2IPK D;  5LNK 1;  4JX1 C;  4R3D A;  1SIJ A;  3AE1 B;  1YNT E;  1ZPS A;  1TS5 A;  1P7E A;  4REZ A;  3SFE B;  1SXT A;  1V1P A;  3AEC B;  4DXG A;  1JRO A;  2CJN A;  2RDG A;  1V8C A;  2IGG A;  5GXG B;  1CQV A;  3AEA B;  2OED A;  3MHZ A;  1ZXH A;  3AE4 B;  2Y3A A;  5HFY A;  2WXF A;  3VR8 B;  3AH7 A;  2WXG A;  1XLQ A;  4DXF A;  1AN8 A;  3P63 A;  3N9Y C;  1SE2 A;  2XN9 C;  5D3D A;  1ZXI A;  2JX5 A;  4RF0 A;  1K52 A;  4TSS A;  1R7S A;  3AE9 B;  1YN3 A;  1ZOY B;  2MJ3 A;  1JCK B;  2N7J A;  2GRI A;  2ZW0 A;  2RPV A;  1VR9 A;  1D5Z C;  4L23 A;  2J53 A;  4XE0 A;  4ZRP A;  5FK9 C;  1CK1 A;  1VJK A;  3AB5 A;  3IAM 1;  3ZJU A;  1TKE A;  1NYR A;  1MVK A;  1IGD A;  4YT0 B;  2BS4 B;  4OZA A;  1JWS D;  1D4B A;  1H7W A;  1GAQ B;  3W9C B;  2QJL A;  1I4G A;  1TKG A;  3P4Q B;  4YTP B;  1FXA A;  1E6E B;  1TS2 A;  2V0G A;  3IT6 B;  4O1N A;  2MEK A;  4XDC A;  1GOZ A;  2PW9 A;  2W3S A;  3CWI A;  1HQR D;  1HEZ E;  3ZGZ A;  1J7C A;  4RGN A;  1CZP A;  2V3P A;  1KTK A;  4OVZ A;  2K22 A;  4XDD A;  2KWD A;  2WDQ B;  4CQN A;  4ITK A;  2L1A A;  3OWE B;  2R61 A;  4C56 C;  4ZOH C;  2N0S B;  2L83 A;  4OZC A;  4NZL B;  3TEX A;  1ZE3 D;  3VRB B;  2Y5C A;  2JZP A;  1HZ5 A;  2AQ2 B;  5MPO A;  3AMZ A;  2BS2 B;  1I4R A;  1KLU D;  2BB6 A;  3W5V B;  3CF4 A;  2EKI A;  2KDM A;  4RFB A;  1VDV A;  3MC0 B;  1TKY A;  1WWT A;  1RWS A;  2QSD A;  2WU2 B;  4MT5 A;  1Q10 A;  5EE1 A;  1FFV A;  1FRD A;  1VZ8 A;  2M0A A;  4A8X C;  3AE3 B;  2INP E;  2D5G A;  4OHJ A;  3L4P A;  1FXI A;  1AW7 A;  1F2R C;  2J42 A;  1GTE A;  3BVM A;  1QIL A;  4WAF A;  4US8 A;  1D6E C;  1FCL A;  1YJI A;  1EWY C;  1KLG D;  5H8Y E;  2AQ3 B;  4WWM A;  3P4P B;  1QLB B;  1N60 A;  1YMH E;  2DLB A;  3MP9 A;  4L1B A;  1E10 A;  1F2R I;  4AS1 A;  1FFU A;  4IKG A;  1FM0 D;  1I4X A;  2V3N A;  3W1S A;  1K51 A;  3TEW A;  3AE5 B;  4KX6 B;  1CJE A;  3B2F A;  4GDL B;  1JML A;  4WQM A;  2M56 B;  2G1E A;  3WCQ A;  1JWU D;  2WDR B;  2SEB D;  4PT5 A;  1ET9 A;  2K9X A;  1ZUD 2;  2BBC A;  4HKZ E;  1TS3 A;  1C4P A;  4USA A;  3TSS A;  1FMA D;  4UDU C;  4EE2 A;  3HVZ A;  3DWM A;  4GLS C;  3TEZ A;  1SBB B;  2XNA C;  2JQR B;  3AE8 B;  1GB4 A;  3GS2 A;  1T3Q A;  1T5X D;  3AN1 A;  1JW9 D;  1PDX A;  5TSS A;  4NAW B;  3NUH B;  2NTS A;  4MH8 A;  1NYQ A;  3AEE B;  4OZB A;  1OQQ A;  1TY0 A;  3R8B A;  3VRA B;  1JWM D;  1WYG A;  1PUT A;  1SE3 A;  4JE3 B;  2AQ1 B;  4ARC A;  3SEB A;  4DQO C;  3KQ4 A;  2PMV A;  4YTN B;  2WP9 B;  1C4C A;  4YSY B;  2LMC A;  2W54 A;  4IOI E;  1B1Z A;  1VRA B;  4HKQ A;  1FNW A;  1DYQ A;  4US9 A;  3ZQ4 A;  2IGH A;  1FO4 A;  3I57 A;  3RPF C;  1N5X A;  4JPS A;  1DOY A;  5FR3 A;  2J52 A;  1L4D B;  2WXM A;  2HTM E;  1ET6 A;  2YEP B;  2ICI A;  1XEE A;  4A55 A;  1WGK A;  3R2T A;  4WUR A;  1ACC A;  1VLB A;  3P42 A;  1MI0 A;  2JXT A;  2WXO A;  4TMA B;  3DWG C;  4MM3 B;  3R2I A;  2AX5 A;  4KGR A;  4RF1 A;  1DOX A;  3HVD A;  3IXS A;  4ARI A;  1KF6 B;  1UWM A;  2RMM A;  1B9R A;  4C80 A;  2BTE A;  1YN4 A;  4TQ0 A;  4RGT A;  1FEH A;  4LTU A;  3FIL B;  2CJO A;  4KKI A;  1XXG A;  2GI9 A;  4HJG E;  2DBY A;  3NS1 A;  3BVG A;  4KGT A;  1D5M C;  4A90 A;  1RM6 C;  4N59 A;  3AEB B;  1KRH A;  5I4D A;  5C3J B;  1F77 A;  1M4V A;  1QOB A;  2WXL A;  3AEF B;  3GB1 A;  4A6Q A;  1J7A A;  4XWT A;  2HDE A;  4RNA A;  3ABV B;  4B0M A;  4RH6 A;  1ESF A;  2WQY B;  1MHH E;  3EUB 2;  3O13 A;  1BXT A;  3ETR A;  4HEA 1;  3E56 A;  4A9A A;  1N5W A;  5D3I B;  1C76 A;  2LHD A;  1FCC C;  1ZP0 B;  4HRS A;  1TS4 A;  1L6V A;  3IT4 B;  1QOF A;  4L2Y A;  4HRO A;  2E6X A;  2W55 A;  2WXK A;  2MJE A;  2BYT A;  2PVG C;  3U7Z A;  1JQ4 A;  1N62 A;  3CIR B;  3Q8A A;  3ZYY X;  3URY A;  4M0W A;  3LB8 C;  2W3R A;  2ON8 A;  1TYG B;  5G5G A;  2K0P A;  2FUG 1;  5JXV A;  1YQ4 B;  1QT9 A;  1WSP A;  1XCT L;  1XLO A;  3BYY B;  2QEJ C;  5AUK A;  2WXR A;  1FNV A;  5HI1 A;  2TSS A;  1JRP A;  4ZHO A;  2RDH A;  2WS3 B;  1SJE D;  3AE7 B;  3KWV A;  3U52 E;  1I4P A;  1RYJ A;  1C78 A;  1STE A;  2DWQ A;  4ZYS A;  1GT8 A;  3P4R B;  2DYM A;  3BVZ A;  4RCO A;  1JWA D;  1FIQ A;  1L5P A;  4D2K A;  3EGR A;  5AUI A;  4XWW A;  1SJH D;  3V3X A;  1PGA A;  3B2G A;  3TEY A;  1AYF A;  4YSX B;  2LEK A;  4FXC A;  1MPE A;  3SR6 A;  4KGS A;  4YXD B;  1QF6 A;  1QKZ A;  5BYQ A;  1VZ7 A;  3BK2 A;  3T3N A;  2KAJ A;  2ACZ B;  1L0X B;  1D5X C;  1NEN B;  2YEP F;  1ZDV A;  3KLS X;  1SSN A;  5HG2 A;  3U4E G;  2WU5 B;  4RGM A;  2PKO A;  3B9J A;  3FAH A;  2GB1 A;  3E9S A;  1TZO A;  3LYY A;  2QMT A;  2K3U A;  5BYS A;  1PGX A;  5FKA C;  1PYW D;  2LUM A;  1YJJ A;  5E6J A;  3NVZ A;  1BML C;  1L4Z B;  3NVY A;  3LXF A;  1QQR A;  4MAC A;  1E9M A;  1FD6 A;  3FIL A;  1ENF A;  2EEL A;  1T6B X;  2JWU A;  1N61 A;  1TJE A;  2CU3 A;  3J9C A;  4YTM B;  1L0Y B;  3EA6 A;  3KWL A;  2KAC A;  2WDV B;  1UGJ A;  1YN5 A;  4RGO S;  1N63 A;  1JWB D;  1E7P B;  3FC4 A;  2B76 B;  5T8I A;  1SB3 C;  3VQI A;  3GP7 A;  1PFD A;  4JWU C;  2H88 B;  3SFD B;  1VZ6 A;  2I38 A;  2JU6 X;  2JYE A;  2V4I B;  3HUI A;  1WXQ A;  1SE4 A;  4N58 A;  5H92 C;  1FRR A;  2KN4 A;  5BMH A;  2WNM A;  5C2T B;  4NAM A;  2FBW B;  1HA5 A;  1OFF A;  3BK1 A;  3ZJV A;  3PO0 A;  1NI3 A;  3MJ5 A;  3Q8F A;  1TY2 A;  3V05 A;  1H7X A;  2L52 A;  2X38 A;  1XF5 L;  2PTL A;  5BMI A;  1XO3 A;  4NJC A;  1E0Z A;  1SF0 A;  4P16 A;  2K5P A;  1I7H A;  2J4X A;  5BYR A;  1V1O A;  2DYO A;  2Z8L A;  1I4Q A;  2MH7 A;  2PVO D;  2IJ0 A;  2FE8 A;  2VZK D;  3BII D;  1BUI C;  1PGB A;  3TUO A;  2NMQ A;  3U2S C;  3Q8C A;  2BB5 A;  3NVV A;  3UI3 A;  1AWD A;  1XLN A;  2JYT A;  2ONQ A;  1JAL A;  2QIL A;  2WXP A;  3PZ7 A;  3ZJT A;  1C79 A;  1XCQ L;  1ROE A;  1KFY B;  2WXI A;  3AEG B;  2Y5P A;  5BMG A;  1EU4 A;  3AE2 B;  1GTH A;  1EM7 A;  2MJD A;  2IDY A;  1GB1 A;  1UUP A;  4YSZ B;  4ZHP A;  2H89 B;  1F0Z A;  2ZW1 A;  3H8H A;  1LO5 D;  3BWU D;  2E3T A;  3Q8E A;  2L32 A;  1HZ6 A;  1P7F A;  1V1P B;  1V97 A;  2WXN A;  1WRI A;  3AM9 A;  3NRZ A;  2M19 A;  4OW0 A;  2JSV X;  2LJI A;  1NEK B;  3PZ8 A;  4KKJ A;  2BS3 B;  1QOA A;  3MFG A;  4YWG G;  4B0E A;  4LK0 M;  2I2Y A;  1J7B A;  3AED B;  3RFZ B;  1L6U A;  4Q2J A;  5EE3 A;  4P6V F;  1KH0 A;  4H2A A;  1K53 A;  1FNU A;  1UNS A;  4N6E B;  5D7G A;  1L0V B;  1K50 A;  4J3O D;  2G9H D;  3C8Y A;  3P1M A;  2SAK A;  3BYT B;  3NZ3 A;  4JWS C;  3T3O A;  1IBX B;  2Q5W D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...