3OWEB

Crystal structure of staphylococcal enterotoxin g (seg) in complex with a high affinity mutant mouse t-cell receptor chain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
227
Chain Sequence
AQPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEFGGCCMYGGLTFNSSENRDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of staphylococcal enterotoxin G (SEG) in complex with a mouse T-cell receptor {beta} chain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Beta-chain
total genus 60
structure length 227
sequence length 234
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3oweB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3oweB01
1CT1D 1EEID 1F77A 4DXGA 1JR0D 1BCPF 2R61A 1JWSD 1DYQA 4OHJA 5ELEA 2XN9C 1TY2A 5FK9C 2XRQD 3CHBD 1SJED 2AQ1B 1L0YB 1EU4A 1LTTD 5TSSA 1LT3D 2O2LD 3BYTB 1LO5D 1YN5A 4RGTA 4ZYSA 4RGMA 1EU3A 1I4QA 1JQYD 1PRTB 1V1PA 1I4XA 1SEBD 4UDUC 1I4RA 3DWAA 3MFGA 2QILA 3TSSA 3BYYB 4C56C 1S5BD 1SBBB 1I4GA 1PTOB 3W2DA 1JWUD 1BXTA 1CHQD 1CHPD 4RGNA 1EWCA 1STEA 3MC0B 1PYWD 2XNAC 1D5XC 1ESFA 1CK1A 1EFID 3O13A 1FD7D 2AQ3B 5I4DA 2WV6D 1ET9A 3DWQA 1PZKD 1LTSD 2IJ0A 3DWPA 1HXYD 2ICIA 3R2TA 2G9HD 4L63B 1CQVA 3BVGA 1AW7A 2IPKD 3KLSX 1SE3A 1V1PB 1SE2A 4BWGB 1S5FD 3V05A 1BCPB 1S5DD 1RCVD 1PTOD 1AN8A 1YN4A 1LTAD 4O1NA 2SEBD 1PZJD 4TSSA 1T5XD 3URYA 5ELCA 3OWEB 1LTGD 4RCOA 1HA5A 2RDHA 2XRSD 1L0XB 1FNUA 1LTID 1SXTA 4NZLB 4RGOS 1G8ZD 5FKAC 1PRTC 5D3IB 2QEJC 1FGBD 1RF2D 1XTCD 2Z8LA 1PRTD 1B44D 1PZID 3R2IA 1YN3A 1JWMD 1B1ZA 1PTOH 1DJRD 1ET6A 3EFXD 4DXFA 1FNVA 1D5MC 1RDPD 1S5CD 1PRTF 2NTTA 2NTSA 1JCKB 1UUPA 1KLGD 3BVMA 5ELFA 1LT5D 4RHSA 1TS3A 1LTRD 3R8BA 1ENFA 1MD2D 1LLRD 2CHBD 4L6TB 2AQ2B 1LT6D 2J4XA 2TSSA 1TS5A 5D3DA 3SEBA 1D6EC 1LT4D 1TS4A 2RDGA 4Z9CB 1S5ED 1KLUD 5ELBA 5ELDA 1KTKA 1V1OA 1M4VA 4RFBA 4RH6A 1FNWA 1I4PA 1PTOF 1QILA 1TY0A 1RD9D 3EA6A 3BVZA 1SJHD 1GOZA 1EEFD 4RHRA 1TS2A 1HTLD 1UNSA 1D5ZC 4K6LA 1LTBD 1PTOC 1BCPD 3BZDB 1I4HA 1SE4A 1BCPC 3GP7A 1XXGA 1HQRD
chains in the Genus database with same CATH superfamily
2MCNB 1Q8IA 5HFYA 1V80A 3P4PB 1DOLA 2DZKA 3PV1A 4BBNC 2MNAA 1EZ8A 3FKIG 5M5XB 3VA7A 3M4QA 3D31A 1WD0A 3CD6A 4LFBL 1XLQA 3TEXA 3S2DH 3PLVA 2XK5B 4US8A 5EBDA 4LF7L 1H4RA 1CZWA 5E4WC 3FPUB 4GLXA 2YU9B 3VH4B 1GG3A 1ZXHA 2C7HA 3P4QB 4N9TA 1I35A 4A3CH 3HFZB 2JXTA 2E74C 3NUCA 1ZDVA 1IBKQ 4YCUA 5KNCA 4DXAB 1HEZE 1U5KA 3RT3B 2KDBA 2UWQA 4CJ2C 3S1MH 3PZ7A 1CM9A 1WRIA 1KDBA 2Z4IA 1L6VA 3OJ4B 3IL8A 2AL6A 1D5XC 4C3HG 5I2YA 2NBFA 1HTPA 2K50A 3S9WA 3O13A 1EY0A 1V8QA 1L1OB 3L08A 4CHKA 4B0MA 2E3TA 4ZDVA 4BY7H 3CC4A 3TMPB 4YWLA 2DENB 4HIOA 3VR8B 4FBJB 3KUCB 1HZ6A 2R7FA 2A6HD 1WCMG 3VR2A 4IURA 1K0RA 4DUYL 2J7ZA 1PH6A 2O2VA 1VQ4A 3PIO3 1O78A 3DBHI 1N32Q 2W9NA 4BBRB 2WXGA 2FXQA 2L0FA 3H94A 4WWPA 4H13C 2F03A 1J5EL 4IPHA 1T0QC 1B4OA 3SDLC 1SSOA 4ZHPA 1KAAA 3Q23A 2WXPA 3VYSA 5NUCA 3TS0A 2UU9L 4YWKA 5I9OA 2F0HA 2RDHA 3I56A 1VDVA 3FMCA 3DM3A 1XMOL 3T56B 3W1GA 1E22A 3A5UA 5A2QL 4A90A 4LF7Q 2ZTCA 1U4RA 2LFNA 3ML8A 2BE5C 3KF6A 4C1NK 3I8ZA 3RZDB 3AECB 1QB5D 4USAA 1ONLA 1WOCA 1YN3A 4F1SA 1JWMD 5L37A 2R92G 1GJZA 5BR8L 3HOYG 4DXFA 2O6VA 2JWUA 3GTOH 2ZJRA 1YNJC 3K9OB 1LV9A 3ZIMA 3R8BA 2A8VA 3AE5B 4GNXA 3GV6A 1V86A 2ON8A 4A3BH 2BW2A 2D3GA 4OXPA 2WDTB 5CHVC 3DUZA 2K22A 3ERSX 4ODGA 4ABNA 1ESRA 2LMCB 1DD2A 3JSVB 2KTFA 3A5ZB 1WXQA 2RSUA 4R4IA 2UXBL 1FFVA 3FKYA 5AUKA 2E8GA 1E2VA 3KH0A 3VHTC 1VZ6A 5H8YE 1GXDC 5M3FB 5CV6A 4A3OA 2HT1A 2G1EA 2KMAA 3G4SA 2K04A 1GB1A 4DV2Q 4DUZQ 3QWNA 2XVSA 2ZM6Q 4E6IA 1D5ZC 4IN3A 3J81E 1OTRB 2ICEC 1XQQA 4H2AA 5HGTA 4KHVA 1B70B 2LVQA 4DXGA 4F87A 4LF4Q 3CCUA 3PO2G 2LGIA 1BCPF 1ENAA 3J7YW 2KDIA 2KQSA 1JWSD 1VQEA 2K5VA 2WX0A 2Z59B 4AJYB 2B2UC 1QKZA 1XF5L 2KTRB 1HNZL 4C3IG 2L52A 4GU2A 2G4DB 5E1FA 1VQPA 4NXNQ 3PSEB 3E6ZX 2ZCBA 4HLEA 1YX5B 1N9WA 1LO5D 3F8TA 1E90A 4RGMA 2M56B 2L1BA 1ZKOA 3FRPB 1I4QA 4CKCA 5C3XA 1JQYD 1ZKHA 2AYOB 4OW0A 3UF8A 3RNCC 1WTQA 1FCLA 3J81i 2NVYH 4UP7A 3P4SB 3ZXRA 5C0XI 2LHDA 2N7EA 1DOYA 2AL3A 2MO0A 4LNKA 4DUYQ 4A3GH 5C0XG 2H89B 5JEAG 1IGDA 2YTVA 4BBRH 1WTVA 2PMZE 3HS0C 4K14A 3NVZA 2INPE 4DDGD 5IGCA 1Q12A 1NBWA 1P0RA 4REZA 2K14A 3I91A 1SE9A 1D1IA 3K0YA 4IWQA 3IBEA 2B63H 4B9KA 4KX6B 2SNMA 2MBOA 4A8XC 1WE6A 3NPPA 2PVGC 2KC1A 4A3FB 2PMZB 2ZXRA 3BDCA 3QB3A 1WVLA 1WIAA 2DLBA 2RMMA 3OPOA 2G9HD 2ZVNA 3PTFC 3BVGA 3U4VA 3ULLA 1WH3A 5EE0A 2Y0SG 1BBUA 1C8CA 3KYDD 2E2DC 2A6HC 5JJZA 3QARA 5BMHA 3V05A 4K3BA 2F4IA 2NBUA 1H9JA 3RCZA 4N6EB 1JRPA 1IKMA 1F2MA 2B8FA 2F0SA 4JI5Q 2F3WA 3PGEA 1CZGA 3PQIA 2PQAA 5C23A 3A74A 4JVZA 2W55A 1XX8A 4G7ZC 3UE1A 4LLGM 2JXXA 2XRSD 1OEYJ 1P16A 3VYTA 4KKJA 1A5RA 3C2PA 3DXJC 1P3QU 2DAJA 3RFZB 4X3TA 3L0OA 2F52A 4P74A 2D10A 3MJWA 3ZJYC 2HCIA 5D65A 2K7VA 3OW7A 3FDTA 3HM6X 4L2YA 4P72A 2I0QA 4C4VB 5AZHA 4X62Q 2XWJB 2M00A 3UDXA 2LI5A 2WXHA 4LNNA 4A55A 2QCZA 1IBLQ 3SFDB 3PUZA 1K8GA 1WTWA 4MJSB 2R92B 2KJXA 1Q82C 1IYUA 3SD5A 4S3SA 1ENFA 3SK5A 5JHBA 4MDKE 4OL7A 5JVG3 1VF7A 2X6GA 2Z1CA 4B3RL 1L2FA 4PZ7A 1QNUA 3I7FA 5D3DA 2WQYB 3E9SA 2W82A 5IGEA 2KA7A 1B3AA 5C4HA 3VUYA 4BOSC 1A8VA 3P20A 5FO7B 5BN5A 4WQOB 3SFEB 1JOKA 4IG7B 1VMPA 2K6AA 4RAUC 1Q1EA 3IKJA 4YTNB 5D2MB 1HNXL 2N9KA 3V3XA 2K5QA 1F9PA 4JC0A 2DY7A 4JI7Q 1HZ5A 2ZVOA 3ZTDA 3C46A 3J7A5 1Q5WB 3OSOA 2A1AA 4JIOU 1B9RA 1S40A 2CCZA 3U4EG 3QWZB 3MXGA 4K6LA 1BDOA 4YIJA 3OHXC 1CKNA 1EWHA 5MPOA 5J2RA 2G5DA 1X9NA 2L5TA 2JSVX 3R3MA 4LK0M 1UGMA 4ICVA 3I73A 4QIWB 3GTGH 1CKOA 3S1QH 1OXXK 5EE9A 3A8IE 1IBKL 2R61A 2TMPA 4TVAB 2XN9C 2FE8A 2M0AA 2V3SA 3S14B 2MBQA 3C0RB 5C3EH 1JOQA 5A2QE 1LTTD 2KFKB 3GTJB 4G7HC 4E74A 3OMGA 2MSED 1SLJA 4AH6A 1WY8A 1YI2A 1F1HA 4GB9A 3DBRB 4H44C 4XT1B 3J80i 3VYUA 3H6MA 1XNQQ 4EEWA 3G7LA 2F0JA 3LGJA 2QILA 1UD7A 4JI4L 1MG8A 2AWTA 4X3UA 2M0XA 1T0RC 1WR6E 1SYFA 4DR1Q 2RD0A 4KK7A 2I1JA 4NMZA 4EX5A 1ISNA 1XO3A 3TJPA 1WM2A 1H8CA 1IXRA 3DM1A 1MG4A 4WWNA 4YY3Q 3T1YQ 5H1SE 2K75A 3EIVA 4IALA 3WOEA 4AYBE 4OVZA 1Z47A 1E1TA 1CK1A 2KBNA 1I6VC 2KVMA 5M3MG 4JI0Q 4OO1G 1JALA 2JF5A 4B3SQ 1B7YB 4A3IG 1PZKD 4H7BA 2MJ8A 5JEAH 1WJ6A 4TMAB 1RLFA 4YL8A 3Q22A 4LF6Q 1RTNA 4DU9A 1L4ZB 2J0MA 5IP9H 3V6EB 1RM6C 1PYBA 4KD4A 1QVGA 3A4RA 1PH7A 1NI2A 3H7PA 4HCNB 2CH4A 3J81L 4JI3L 3F2DA 1WYWB 3EJIA 1YJWA 1AN8A 1F0ZA 3IFDA 3Q3OC 4DR3Q 1BT0A 4MIUA 2VUMH 2HE7A 4M02A 1SB3C 2WXIA 4HVBA 3TUOA 1NJIC 4A93H 1EQQA 1YQ4B 4W9FA 3T51B 2V4IB 5IT9c 1K0SA 5AFWA 4IO9A 1QZGA 1T0SC 2BWES 4ZUIA 2MP2A 2RPQA 2CU3A 3STBC 2WDQB 3SGIA 2UU9Q 4IQZA 4AWJA 3J9CA 2OEOA 2C5LC 2DBYA 2RDBC 2IGGA 3ZTCA 3UQBA 3S1QB 3A9JA 5F2DA 1MSGA 1RDPD 1S5CD 2RHQB 4R4OA 4LFCQ 4JW0A 5KHOA 4WWMA 4JV5Q 1XLPA 4J6IA 4BA1I 5M3FH 3NELA 2CHBD 1QF6A 2UUBL 4A3JG 2V4LA 2WWZA 3A4SC 4C4VA 1N60A 2AHOB 4DK0A 3OIQA 3JAMc 2RKSA 1KLUD 1QZHA 2HDLA 3B2GA 3Q14C 2EOTA 2OEDA 1IPGA 2WNMA 4ALPA 4ZRZA 4DAYA 2VQFL 2PZWA 1KJTA 5ISRA 5FJ8G 1WJ4A 2KCCA 4OO1I 4DV3L 4YSYB 2I5HA 2BS3B 3ND8A 5G2NA 3QHTA 3CKIB 3K7UC 2MA9B 2MLBA 2BVCA 4A3GG 2LVPA 2QJLA 5E4XA 3ALBA 4DV7Q 2UXDQ 1YNTE 2NPTB 4YWGG 3GP7A 2B2TC 3CRLC 3H15A 2J42A 1F77A 3H9DA 4BZAA 2B2VA 3MJ5A 4POGA 3RN2A 4YXDB 5IE8A 3HOXH 1DYQA 4K0KL 3RI7C 1K8AC 1VQFA 1E2ZA 2GBRA 2JQRB 3NZSA 5DPTA 2EY6A 1SYGA 3PMFA 1EU4A 4A3FG 4K0KQ 4J8QA 1GUAB 2GRIA 2VZKB 2KCMA 2IBIB 3T3OA 1GHJA 2PNRC 4G4KA 2ACZB 1EU3A 1K50A 2K8HA 2EDGA 2JJQA 1SEBD 1S3OA 4NP5A 4P71A 3PO2H 4B3ML 5LMNQ 2X6LA 2W3SA 2UUCQ 1S5BD 4FNFA 4A93G 3FVQA 1YNXA 1IYJB 4ZK9B 5JHAA 2FBWB 1JWUD 2R7ZH 1CHPD 4AQYL 3GS2A 2D5DA 5DAUA 3AEVA 5DPSA 1Y14B 5DNFA 1Y8NB 2MQHA 5IA7A 3HK0A 2MX2A 1ESFA 4ID6A 3BS1A 1VQAA 2ASBA 3ML9A 2CWAA 2XSCA 4DNTB 1LTSD 4TKOB 2NCNA 2JA5B 2Z0DB 4JI2Q 2NVTB 2B3GA 2KCTA 5J3BA 1OQRA 3VUWA 1AW7A 3A7AB 2B63B 3S1MB 1FRDA 3JYUA 2VB2X 4CGYB 2MJDA 5EKKA 3I55A 1RCVD 4A3IB 3RNGC 1RFKA 2Y5BB 3HOZH 1LM0A 1J6QA 1EY5A 1MBYA 3UIPB 3UDIA 1WXAA 3S1RH 2NZHA 2K5PA 4RF0A 1H95A 3KDFB 4N8FA 1W3SA 2KUMA 1EO6A 2JN4A 1RODA 4R3DA 2OOBB 4M8MA 3GTMH 1RRBA 1OTCA 3AYHB 2GA4B 5CHFA 2PZUA 4FXGC 1CA6A 5GAHC 1A6XA 1L6UA 1M8AA 5DPRA 3UGBB 1JJ2A 3GTLB 2K25A 3R93A 2M1MA 1P9DU 4FDBA 3I4NG 1IHZA 1H9KA 3TREA 2EELA 3ECIA 3T8MA 5IYBH 4DV1L 4DV0L 1JMCA 2Y3AA 3GZNB 3WDNA 1PV4A 1LTRD 3OOCA 2QA4A 1TWCH 3B08A 2KX0A 3RUIB 2E6XA 4NDXA 4RMAA 1E8YA 5IO9A 3D3RA 1EYCA 2L9HA 3B6YA 3SDZA 3ZYYX 4DK3C 5FOBB 4LWCA 3ENEA 2JA6H 3SHLA 3TBLD 1S5ED 4D2KA 4JI0L 1K53A 3J7AF 4K5XA 4CO7A 1HUNA 4YCVA 4ILWA 3M4PA 3UI2A 2K5NA 1TIFA 1TT5B 2UUAQ 3B9JA 4LNOA 1YHBA 1WYDA 1X3QA 2H1EA 5JPNC 4DHZB 5IYBG 4IKGA 3L13A 3WCQA 1WFQA 2EYMA 4C3HH 1LGRA 1EEFD 4A3BB 2MH7A 1IZ6A 2CKZB 1QLBB 3OG5A 1UNSA 3Q8CA 1E0ZA 3VDZA 3D4RA 3QOJA 3RZOB 2NVXB 1DZ1A 1YJIA 1STAA 2D3BA 4DR1L 3PRZA 4DHZE 4MTNA 4OIKA 1HQMC 4RKBA 4LFCL 1HQRD 5KNDA 4JI4Q 4CDDC 2ONQA 4GZYC 3DVNV 2IGDA 4LJZC 3Q24A 1NBFC 3EBEA 2BBCA 3W5UB 2DUDA 3IXSA 3QR8A 1H9SB 2L1AA 4ASWC 4EFOA 5AJ3Q 1TY2A 4L8JA 5C4JH 3K5NA 2B3AA 1SJED 1JJGA 4A3EG 1J7CA 5E3FA 4XT3B 3L16A 1Z7TA 1HNZQ 2BS2B 2O2LD 5J22A 1PFSA 1LABA 2Q2UA 4CDFC 2OJRA 5GAGC 4HDOA 2K5HA 1JORA 1KXLA 4W9IA 3OLMD 4YSXB 2EMTA 1B9MA 4UDUC 4NAWA 1I4RA 2F3IA 4QMGA 3EC8A 3I57A 2L0TA 5T1GA 4CQNA 4EUTA 3HVDA 4FYDA 3Q8EA 1N34L 2WU5B 3JAML 1IYVA 2EQSA 4FF1A 1Q1BA 4MGZE 1WZ3A 1CHQD 1HPCA 2HJ8A 2ASQA 2ZM6L 4LNIA 2QCPX 2WP8J 3PF5A 1E2WA 1A3VA 3J7ZC 2LGSA 1ZP0B 1KLVA 3MXUA 3I4MH 4ZAIA 3HOWG 3AI5A 3SVMA 4A3DH 1QUQB 1S1QB 4DK5A 5L83A 4DV6L 3A1QA 4LFAL 1L7YA 4KDIC 3FEWX 5BN4A 1FRRA 5JEAJ 2NUCA 4X64Q 1PH9A 3S1RB 3MHSD 3PZ8A 3R2TA 4B3SL 2N9XA 2XK5A 1PH4A 4KN7C 4B3RQ 2BH8A 1I3QB 4HK2A 2DNCA 4DAVA 4IUNA 3VTWA 1RYJA 3TS2A 2CS4A 2KDFB 4K7SA 4I6LB 1PTOD 5IOCA 3MVVA 3T53B 2UUCL 2HQLA 2JA8B 1X55A 2XWBB 1T5XD 2RR9A 4BS9A 3EFCA 4HEDA 3OWEB 3EN2A 3I4NH 2OXPA 3HOXG 4CKEA 3H3VC 1VQ7A 1X3PA 3AFPA 2EKIA 1A3UA 3VTVA 2K33A 1PRTC 4JG2A 1OXUA 2PEAA 4OZCA 4DK1A 2WAQG 3RN9C 4C3JG 5IP7G 1WTPA 2KLGA 1P98A 3NQIA 4EVOA 3I63C 3EHVA 5J1ZA 3M85A 2UXCQ 1R4NI 3GZNI 1PRTF 2F3VA 2K01A 2LXKA 5HY6A 3IAYA 4FF4A 3M3YH 1YIJA 4A20A 1CUKA 2WINB 2M17A 3BY4B 1CQFA 5J18A 1EL0A 4TRDA 4IFDH 2RBMA 5M5WH 1L5PA 2PMVA 4JI1Q 5CHWA 3H8HA 3LB8C 4HJ9A 1PH2A 5KRUA 4RCNA 2OTJA 1G91A 3SU8X 2ZXPA 4FO2A 1YQBA 4J3OD 1X3GA 1KF6B 4YTMB 4RNAA 5JJLA 1DCZA 3LWUA 2UYZB 4KMUC 1RD9D 4A3JB 4EKUA 3NQTA 2DNFA 1DOKA 4ITKA 2KANA 4PV1C 3WWVA 1ZE3D 5G5GA 4ZOHC 3KJPA 3DDCB 1SGHA 1WSPA 4IFDG 2BTEA 2PE6B 1BCPC 1Z5SB 3W5OA 2ZJDA 4W9KA 2QEXA 4GSWA 1V5TA 2GBJA 4LF9L 1TIID 1TWFH 1JR0D 1XNRL 4BAXA 1DGJA 3ZRFA 2EYOA 1CSQA 2E2HH 1HZAA 4XX5A 2ALYB 3AEGB 1BBWA 1BKBA 2NPTA 2K3UA 3AULA 3BDLA 4BXXG 3PHXB 1C77A 3CCVA 4R4QA 2MBEA 3OAWA 2YTXA 4A3LG 4QCLA 3STBD 5G55A 3KVFB 3ZGZA 4HKZE 4HPMB 4C00A 2LUMA 4MGYE 2K1FA 4OWXB 3TSSA 3AE8B 2K03A 1UBIA 2JXMB 1PDXA 1WZ0A 2EZVA 1KDCA 3E9HA 1NUCA 3KK7A 2QHOA 4TUUA 3AE7B 4E3CA 5BYSA 4F8MA 2F4VL 1WWTA 3MA2B 1U4PA 4GDKA 4M0WB 5IP4D 1VMCA 3BG3A 5I4DA 3DBLB 1ET9A 3P1MA 4HCEA 1Y1VG 3RUZA 1V97A 4C7ZA 3ERQA 5EAYA 4YWMA 4L63B 3ULJA 4PS3A 3CW2C 2N9LA 4KY7A 4M8AA 3M62B 1N61A 1I42A 1SNQA 1CJEA 5CORA 5G5HA 4ANUA 1TWFB 1SAPA 2VNUD 4S17A 3IG3A 4DR6L 2B8GA 5M5YB 4OWWB 3T13A 1HJPA 4A76A 2UXCL 3HM3A 1WR1A 1VF5C 4B3MQ 2ZNVC 3WALA 2I5LX 4WURA 2J0TD 1XNQL 2YVCA 5C2TB 4NAMA 1LTAD 3L7ZC 2MWSB 2WXFA 1VR9A 3CU7A 4ARCA 4AUQC 1H9RA 1FXIA 2LXJA 1IBML 1TZOA 3CCLA 3UINB 2DYBA 2E2IB 1EIFA 1J0GA 2LGDA 2Y0SE 5EBCA 2YLMA 5FKAC 3HOUH 3IFTA 3GTQH 2CH4W 3CCMA 5EJWA 2YYZA 5AJ3L 2XTIA 1MVKA 1PRTD 1FJGQ 2DY8A 4LF5Q 3R3OA 2VQEQ 4IPGA 5HGQA 2L76A 3NE5B 4ZYNA 1FNVA 1C4CA 3Q6SA 4GLVB 5CGKA 4B3TQ 2KVRA 3M63B 3JAME 1TXYA 3H0GB 5E7NA 3UIOB 4K3CA 4JBWA 2AQ2B 4DUZL 3DBSA 4W9GA 1E10A 1WE7A 3NBIA 4MNOA 4JI7L 1OGWA 1CI3M 1LYLA 3TMEA 3S14H 4GKJQ 1V1OA 3TP8A 3I70A 4DFAA 4L5RC 1STGA 1MHXA 5BN3A 1I4PA 4IUQA 2C5CA 4HR7B 2JYTA 4ANVA 2N55A 4DR5Q 1TS2A 3I3CA 4BKSD 1E9MA 2JA6G 3KF6B 2F0WA 2C7NB 4MTKA 2HJ1A 1GUWA 4RM8A 2JA8H 4NXMQ 2BS4B 4GKKQ 4WORA 4KD3A 1D7QA 2NVQH 2IHEA 4KVGB 4TQ1A 3N32A 1PH5A 1EF5A 2LXAA 4EGVA 2JRIB 3PO3H 4GOCA 3QG1A 5ELEA 5JXVA 1K8MA 1SYCA 4WJWA 2F0KA 4P1CC 3KWVA 4GN5A 5M5WB 3VAWA 2UU7A 3WAPA 5E6OA 3BYTB 3TP6A 2BF8B 4X6AH 3H09A 2FMMA 3HOWB 3S17H 2F0OA 4IW0A 4POFA 1I4XA 3DWAA 2PQAB 2DGYA 3RMHA 1F52A 4JK1C 2KDEB 4XE0A 3UDGA 1TT2A 5I2XA 4XQJA 2KTRA 3VQIA 5JJKA 1AH9A 4UHVA 4RWSC 1MKHA 4IOAA 3N6RA 4LUOA 4A3KG 1PLFA 2FFKB 4HSPA 3MXPA 3A0JA 1OXTA 3T16A 4MEMA 5DPWA 2DYMA 2BCOA 2WFWA 4A3KB 3TCAA 1C9OA 1XCTL 2E5LL 1LFDA 1UWXA 4PYZA 1PFMA 2MGSA 1BUIC 3CQZB 3DWPA 4KN4C 1TU2B 1HXYD 4RKLA 2HUGA 4DV6Q 1AEXA 1K8RB 2QMTA 2Y5PA 5M3FG 3QK0A 5KYIA 4NPNA 5KEEA 4QJFA 3IHPC 1V49A 2IGHA 3IAM1 1JC7A 1KABA 2VW9A 3CMAA 1XEEA 3S2AA 4F8CB 3RR5A 5J39A 4IJHA 3CC2A 2LRWA 2KWVB 1OO9B 3GTKH 3P2BA 1TKGA 1TQOA 1NAPA 4O1NA 2KECA 3BU2A 3K7AB 4GN4B 5LMNL 3HKSA 5EPJA 2N1VA 1WXMA 4DR2L 1E8XA 3KLWA 3N1ZC 1GNUA 2KX3A 5BO4B 3DQVA 4R4TA 3E56A 1UEAB 2VS1A 2KWCA 3PT2B 3AU7A 3W5VB 3HOYB 1EIHA 2Q8IB 4C3IB 3NBHB 2XBBC 4C2MH 4L23A 3TQYA 4HDQA 3E3XA 3D8GA 1V43A 1UF0A 3APDA 4FULA 4MSQB 3TEHB 2JA6B 1QCBD 4GIVA 4RG1A 3R2IA 1WXSA 5GXGB 3N3KB 2YV5A 3IFWB 1UZXB 2LVOA 4V190 2B39A 1UBQA 1C79A 2DYOA 4JWSC 2AWNA 4QGUA 2V0GA 1WXVA 1KLGD 4GKKL 1G2TA 3U9OA 1P7FA 3L54A 1BR9A 1E7ZA 2K52A 4L6TB 2J4XA 3ULPA 3CMMB 4KDLB 4I7AA 1I6HB 4P6VF 1NY4A 1KRHA 1F2RI 4JWUC 4L5SA 1IBXA 5I9PA 5LLIA 4OO1H 3PCOB 4IFDI 4GGQA 2G9DA 1ZYRC 3E5SA 2JZZA 3QOLA 3MAQA 1IBXB 3A54A 4HCPB 1LUZA 3J80c 2L32A 1TY0A 3C1FA 5C3JB 1SMXA 5G3LD 3UDFA 2F0EA 1VCBA 2UUBQ 2IT1A 4OWTB 1DOIA 4PZ8A 1X3EA 1I94L 2OQ0A 3PIOA 1VZ8A 4PMBA 3VVWB 3BZDB 1NCVA 4PZ6A 2EJFC 3NG0A 4C3HB 1XTCD 2PPHA 4WJNA 3ZVVA 1ASZA 1E7PB 1ZGUB 1EEID 4W9JA 1JWAD 2KMMA 5C4XB 1HFNA 2KQ7A 3V60A 3Q2AC 1JICA 4OHJA 3OJ3A 1RIPA 3ER0A 2E2JH 2ZJQA 2O5IC 3GOEA 4W9LA 1SNCA 2XRQD 4H02A 2CQAA 4BA2I 2SDFA 1P1AA 3HIZA 3KUZA 3N30A 3QQ8B 3DVGY 1YN5A 3R7QA 1JROA 2RQXA 1BVSA 1EQVA 4GXBA 4XQQA 3OMCA 1WMHB 2IX3A 1X54A 2EIFA 1Y1WB 4RMFA 3AE6B 3WA0A 1K3RA 3HRDD 2IX0A 2J0KA 1SBBB 1KIXA 5CBEE 2RDFA 1GB4A 2VUMG 3A55A 3QC8B 1MSHA 1STEA 2VQFQ 4KJOA 5K5PA 2KT7A 1EYGA 4IOCA 2CKHB 2LSSA 4UPAA 3HOWH 3GTMB 3S17B 5L95C 5A35A 1K3BC 2NR2A 4NQKE 4DNRB 4WH4A 4EZJA 1HA6A 4WFN3 1E8WA 2R7DA 4FLHA 1TKEA 4V0BA 2O6VB 1FGUA 4XC2A 4GOPC 4ZLTF 3HOZB 1CA5A 2JPHA 1AWDA 4Y52H 4MGIE 4A3IH 2RPVA 3X23A 1NMGA 3VA5A 1ZUD2 1TWGH 1Y8OB 1JE5A 2EJMA 1PYSB 2VY3A 5IGBA 2OJWA 4WAAA 2NVQB 1B2TA 4X66L 2L83A 3ABVB 1L1OC 1D2BA 3GE8C 1XCQL 3DOWA 3CP0A 1QG7A 3SR1A 4ANWA 4TV3A 3URYA 1XLNA 3LWEA 4JPSA 1VQNA 2LGYA 3CCRA 4QQBX 2WAQB 1EUVB 2AUKA 2JSOA 4RA8A 3RMKC 3AMZA 1Q90A 1ROEA 5IODA 4KKUA 3PF4A 4FXKC 1FNUA 2HTHA 1BOSA 4JQWC 2DJFC 2L7RA 3DBLI 3M4OH 4JBJA 3JW0X 1UEBA 3MHBA 1FL0A 4WWOA 3R7RA 3M4YA 2Z8LA 3RLOA 5DM63 3AE9B 1LM8B 4JOIA 2R7ZB 4G7OC 1YD8U 3LJ3A 2M8SA 3MFYA 4FF2A 3KQ4A 3DEOA 3C8YA 1D5MC 1ACCA 4CHTB 2NTSA 3ND9A 2D3CA 4JI5L 3FHWA 2WXRA 1EM7A 1GAQB 4S0RA 2L8JA 3KBGA 4K7WA 1CSPA 1L1OA 3CPFA 4L5TA 2GN5A 4EQOA 2ZW0A 1TS5A 4H0LC 4US9A 4LTUA 3D6CA 2UXBQ 1LTLA 2AKWB 2EY2A 5IKCM 3I4OA 1YITA 2KHJA 4F88A 2DX5B 1AE3A 3HOXB 2LASA 2CQOA 2F0QA 3PRPB 1AZPA 1A0IA 2EY5A 2E2IH 1QOBA 3AEEB 3U7ZA 2BA1A 2NS5A 4DHJD 4NKLA 1FFUA 4KKTA 4UY8C 1E5WA 2KXJA 2F0TA 4C7YA 3I4MG 4JBMA 3Q0AA 1N8RC 1ASYA 1A15A 4JOIC 2AX5A 2YEPF 1HH2P 1PTOC 1PGXA 4NW2A 3AEDB 3DBHB 3K8AA 4R1JA 4A9AA 3T9LA 3MFGA 1SDFA 3DPDA 2R93G 4EE2A 4KI0A 4GN1A 3RYTA 3ZLZA 2JA7H 1Q0WB 3RZFA 5M5YH 1F9JA 4OVUA 4JCVE 4B0EA 3LNNA 4P7IA 3RD4A 1RJTA 2J52A 2K5WA 4GS3A 2WB1B 3BINA 2WKDA 4XGAB 1RAXA 1W2BA 1D8LA 1EYDA 2AQ1B 2RSOA 4DPGA 2WYQA 4AJWA 4IUTA 3OTOL 5TSSA 2D11A 4W9CA 4LFBQ 4RGTA 1IBMQ 4J6HA 3HOUG 1QOAA 1X65A 2HDMA 4II3B 5JZEB 2IO0B 4JI3Q 1TKWB 3GV3A 2IY5B 2KMCA 2IDYA 5EKIA 1VD2A 2GB1A 2N0SB 2R93H 4GLAC 3Q3FA 1WD1A 3OW2A 1EY4A 3TBIB 1TVXA 1ZEQX 4DR6Q 3MP9A 3MC0B 1PYWD 2RF4A 3J80L 1NVID 2B2VC 4FN2A 4GDLA 2UUAL 2K8BA 4LF6L 4ARIA 2QDFA 1YBYA 2JUOA 2R2QA 1DM0B 2WV6D 2WXLA 3Q3MC 5IGGA 1MI2A 4PS8A 2MHVA 1QQRA 2PW5A 3F2UA 1Q1OA 1XPOA 4HMIA 1VDZA 2IPKD 5C44H 2FAZA 1NR2A 1MHWC 4LUVA 2N9EB 1SE2A 1F2YA 4P75A 4HIMA 1E24A 2JEAI 4TKNA 1VQMA 1FVIA 3NTHA 1N63A 3AE3B 3J81c 4HKQA 2PPBC 3SXHA 3TEZA 3EUB2 2K39A 4WAFA 4BBRG 4AOFA 3KWLA 2QKIC 1Y69U 1A70A 4X65Q 4EOYA 3PHWB 1HTOA 1C1YB 1TTNA 1IP9A 3OIPA 4LF8Q 4OVVA 1T0YA 4JL9A 1RHPA 2KVZA 4A3MG 3NWTA 2KEEA 3AXCA 5M9OA 2I07B 1SXTA 2KENA 4UAIA 4NZLB 1D3ZA 3MTNB 3QJYA 4C3JB 3P1HA 4RM9A 2BGFA 3DBRI 2V3PA 4HMJA 2QEJC 2HQEA 1QNKA 2EE1A 1PVOA 1HTQA 4KLKA 3NK9A 1EYAA 1U0LA 4BOZB 2A4ZA 2PIAA 2K6DB 5FLXc 2AEHA 1ILQA 5EQ0A 5CYUA 3NZUA 1OQYA 4W9DA 3KW5B 1SYEA 1UUPA 1E7VA 4G3XB 1NI3A 2MJ3A 1CZPA 1WCMH 3SHQA 3KJOA 3ONAB 1MD2D 1AFPA 1F9RA 3EVQA 2KZRA 1EOTA 2Z0SA 3M95A 4FA6A 1TGZB 3AV8A 3ZJVA 4XIGS 4DHJB 3P4RB 4KHZA 1C76A 4K5VA 1EY6A 1XJVA 5C3EB 1L0VB 2C7MB 4HEA1 5ELBA 3RNFC 2K8CA 4ZRIA 1Q10A 2VRRB 1C0AA 2OF1A 4RH6A 1WGYA 4BFRA 4MHEA 5EE1A 1GUNA 1PFDA 3GTGB 3S24A 1WJUA 4N58A 1R4MI 4JI1L 1B50A 3RLNA 1SYBA 4ICUA 3DVGX 4II2B 1SJHD 3I4NB 4AQ7A 5EE3A 3H3VH 2OHFA 4N9F4 3RNAC 1SNDA 2KO3A 1VQGA 1VQKA 3KLSA 1LTBD 1RTOA 2A69D 4FJYA 3W1SA 1WJJA 2KHSA 1SE4A 3HEJA 4K8JA 3SK6A 1E3PA 2ZJPA 4N59A 2BQQA 1GC7A 2GLSA 3RNEC 2L3ZA 1O7YA 4FP5D 2PW7A 2Q5WD 5C3WA 4K7UA 3PREA 1ENCA 2OQKA 2X69A 1V2YA 2M4NA 1KDAA 3Q8BA 3KF8B 4JE3B 4RF1A 2MBBB 1YJ1A 1VQIA 4C3JH 5IP7H 2L0CA 4A3FH 2JYOA 4GOPA 4WJPA 3F2CA 3FPPA 4ZYSA 2H5XA 1GUOA 4DR3L 2R3ZA 3AB9A 1HFGA 1I50B 4L1BA 4DV7L 5IYCH 2UXDL 2F0IA 1EUJA 1WTHA 4A3MH 3AH7A 1Q3LA 2BYTA 2VZKD 1R9TH 4A3GB 1I94Q 4M8NA 4BVUC 2JA5G 4KSKC 3TL5A 5E6JA 2O5JC 3I4LA 4PMCA 1SYDA 2XEWA 4HPPA 2NVUI 2XNAC 5FLMH 3MZ5A 1WRDB 1EWIA 1XPRA 1Y56A 4FF3A 3Q8AA 5HKHA 1SNPA 3ITPA 4E71A 2YTYA 1E6EB 4KZ0A 3A7LA 5C4JB 5FO9B 4KY5A 4EZKA 3R66C 5HHDG 2RCFA 1R4QB 4WRDA 4YHHL 1KH0A 3CSTA 3ZDMC 1NYRA 4JV5L 4DV0Q 4IDIA 2KN5A 4A3DG 3NVVA 1DONA 3JVZX 2EXDA 1VS0A 1VQOA 5BYRA 1X32A 1K83B 1AE2A 4U68A 4PG3A 5KYLA 5K36H 3B2FA 2IY0B 1SE8A 3RZOH 1Q8KA 2F1MA 2INCC 2A6EC 4XWTA 1WX9A 3EQLC 1SNOA 2RCNA 2I38A 2NBVB 1QJOA 2K28A 4KTAA 3WIMA 3I72A 4IWOA 4HCSA 4B9XA 2FUHB 2R2OA 1J8IA 3SK8A 1WTRA 2SNSA 1A2TA 5C4XH 2W3RA 2RGFA 4DR2Q 5CV7A 2PJHA 4WJ4A 1AYFA 1B44D 2DAFA 2KLCA 2BYFA 4IPCA 4HJAA 1QE6A 2QSDA 2ID0A 2NVYB 1MFWA 4ME3A 1WYGA 3QIJA 4BKSA 4LK1C 2V3NA 2OTLA 1ICFB 2K32A 4KHPL 1LT5D 1K73C 1EY8A 2B29A 3EGRA 1IGCA 3VR4A 3GTOB 1LLRD 2DZJA 3HKZG 2INNE 3J80E 4YSZB 3AEFB 3MWYW 5CV9A 3S16B 4XTCS 3ZQ4A 3ZRCA 4CDEC 1MHHE 4I65A 1Q7YC 1ZPSA 3NOBA 3GTLH 5CTRC 1V81A 4IOIE 2C60A 2WXOA 5CX3A 1YMHE 3LXFA 3N1YC 4C1NI 5C0XJ 1KHIA 4AQYQ 2CHWA 4OGQC 2EKEC 2Z0EB 3C1EA 1R7SA 3I2ZA 2V9HA 4WQMA 3O65B 2WS3B 1HTLD 5H92C 3H7PB 3ZUNA 1BCPD 4NY0A 3K59A 4BBSB 1EOVA 5C4ZA 4MM3A 1CT1D 4HJ5A 3PO0A 4O0AA 1FO4A 4FJVB 2EYPA 2KWUB 2BB6A 3X3MA 2MJEA 3MC9A 3D32A 4MM3B 4ANXA 5E6NA 1WFYA 2LMCA 3Q3JA 3M4OB 2MQJA 5I6YA 2F0VA 2CHZA 1ZXTA 1PFNA 4Y7NB 5C3EG 1A3TA 4A4IA 1WGGA 2L15A 1EZ6A 4MACA 5GAEC 1C3TA 2B2WC 1V1PA 2JQOA 1XNRQ 1K83H 2JU6X 1S3SG 3ZW3A 4DV4Q 4TQUS 2ES2A 3APCA 3K57A 2LRUA 1I4GA 2LFIA 2B2TA 3W2DA 2OT2A 3CF5A 2GMIC 4R4CA 1DOMA 4RGNA 1N32L 1TWGB 3HOZG 2GBKA 4DV2L 2NB0A 2B63G 3DHQA 5EPKA 2D9UA 4Q5VA 3GTPH 2ZEQA 4K5WA 1FIQA 3NVYA 3K58A 2NN6I 2AQ3B 2Z6KC 4XWWA 2R6GA 1N33Q 2IJ0A 2KQ4X 3DCGA 4KGTA 1QOHA 3T3NA 1VRAB 3NXWA 3CC7A 2ZW1A 4HSVA 1V9JA 3APFA 2WKCA 1HZBA 3D0FA 2IO2B 1UAPA 3QA8A 1IKLA 1VQHA 1WM3A 1U4LA 3AMUA 4GN3B 2GI9A 3M7NA 3BZCA 1EWYC 4DN4M 1QUQA 3M7GA 5CV5A 3U52E 4DGZA 1FJGL 3M9BA 1DOXA 1BBXC 2R7ZG 1Y1WH 4HJ8A 2X8XX 4XZ4A 2A6ED 3QO2A 4BY7B 2VB3X 1N36Q 4X3SA 2BKFA 4JBKA 2LJIA 3GQBA 3BZKA 4LF8L 3VTUA 3PO3B 2N9PC 1VQ6A 5CC4A 4ULLA 3HVZA 3KBXA 1MJEA 5GROA 2M9VA 3NHHA 3L10B 4FJZA 5J17A 1GPXA 4MN3A 4HJGE 4OEMB 4DKAC 1PUTA 4HJ7A 1O7LA 3K81C 3KFUA 3K5OA 1WGHA 2G45B 3PUVA 2RA4A 2Z9HA 1SIJA 1PGBA 1ZW7A 5AZGA 1IYFA 3Q8DA 4RHSA 5KIXA 1W6KA 1HR0L 2KD0A 1IW7D 5FLXE 4OX9L 2BYEA 1HNWQ 2V1YA 1G6JA 2L55A 1WTOA 2LD9A 2PKOA 2K6QA 1KRSA 1EY9A 3P42A 1R4NB 2TSSA 3CPWA 5DCNA 1KC8C 2GBMA 4XDXA 4K81A 3P63A 2Z6KA 1VQCA 4B95A 2WHIA 3QIAA 3OYYA 5ELDA 5IN7A 3MTSA 4QUFA 4X64L 5FJ8H 1Y1VH 2CR5A 1K28A 4MJSA 2SAKA 2PCFB 1HHVA 4I6PA 5E6PA 1XYIA 3EA6A 2PW9A 3BVZA 2WB1G 4FVMA 4LCDE 2KN4A 2NN6G 3S15H 1GOZA 3H0GH 3K0XA 3Q3NC 4AS1A 3J81j 3N20C 2DNEA 2VUMB 3U7DA 1C78A 4KV6A 2JP1A 3OWFA 1Y8RC 3FILB 1BQQT 1Z9FA 3KF8A 3NJTA 1STHA 1STYA 3CSFA 3AB5A 4Q2JA 5BYQA 1IBLL 5EPLA 5CBAE 3RLFA 2HD5B 4A75A 4OONA 3HOUB 4LF5L 5KNBA 4ZRQA 4DDID 2FIFA 2RHSB 1SMYC 4A3LH 4LJOB 2KOXA 2EYHA 3AQQA 2ZT9C 3PUYA 4IC7B 5DM73 3HKZE 2CJNA 3RN5A 4C3IH 5IWAL 3AEAB 4IWPA 4CJ1B 1NYQA 3WAMA 1YNND 1J7AA 2J53A 1PRTB 2SOBA 1FXTB 2KFKA 3C19A 3IAS1 4QL5A 5C6AA 3MEFA 1MJCA 4GMVA 4DAYB 4ZRPA 3BYYB 1OQQA 1UWMA 3W1YA 3ZJUA 1R4PB 3A1QB 1WGKA 4JI8Q 1HUMA 2EPBA 5GADC 4XYQA 2KACA 3QX1A 4BKTA 4LNQA 4DWFA 5FR6A 2JE6I 5C44B 4BY7G 1EWCA 2N88A 4JYAL 2BWFA 1YVCA 1KL9A 4NJCA 3AU5A 3CIRB 4B08A 2KHIA 3V61A 2MUYA 1LACA 1KAWA 1FD7D 1PQSA 1B8AA 5IT9L 4YTPB 5IP9G 4KY6A 2PLPA 2ICIA 3CQZH 5EKLA 3ETRA 3CXCA 4HTHA 4DR7Q 2PO4A 4R9WA 1YIWA 3U58A 1T3QA 2VL6A 3TZDA 2MP1A 5M3MH 1S5FD 1BCPB 5IOIA 1NTGA 4DK6C 1QT9A 1UE5A 4ZKCB 1YJJA 1GC6A 2EJGC 4KHPQ 1C48A 2A69C 4X62L 1YQ3B 4DV1Q 2KK8A 4F7ZA 4TSSA 2W54A 1KNEA 2QIEB 1B9NA 2JY6A 3B0AA 5ELCA 2B2UA 1I50H 2JA9A 4NJ7A 3FKIH 2Y5CA 1HA5A 3GO5A 2CWPA 2KJHB 3ZJTA 3ICEA 2AMCB 4JPBW 2IHFA 4KZCA 2J0JA 1S72A 4BY1B 1IUEA 4RGOS 4K1RB 1HCZA 2E76C 4GNXB 2KFJA 1RF2D 1VQDA 4NPSA 4IJLA 4L5QA 4O42A 4WJ3M 4LF9Q 1PTOH 1TKYA 5LL6X 1ET6A 1T5EA 2L00B 2GVBA 1PH8A 1X1MA 2A73B 3HOVH 1WGRA 1JCKB 2I1KA 2WXNA 2VH1A 3IVFA 2NYZD 1TS3A 2BYVE 1YNJD 1YX6B 3BDOA 2FINB 1GO3E 4JLCA 3WAOA 1HE8A 1GUTA 3NVWA 1SN8A 3DHHC 2AWOA 3VH3B 1P8LA 1V9PA 2KQ3A 4AP4C 1ZYRD 1G6PA 5AEKB 2PYKA 2IY1B 1GVPA 1VCIA 3NEMA 3PIPA 1J9OA 1KTKA 3V62A 2I5MX 4RFBA 1VJKA 3IT6B 2Q8TA 4P16A 4P2CB 4NJ6A 2B2WA 1QILA 4PYUA 2QC8A 5C0XH 1KRTA 1PXUA 1I7HA 2Q2HA 1IL2A 5BMIA 2V1CC 1UE7A 4RHRA 1U4MA 4QAYA 1TWAH 4PK1A 3P7JA 4B3TL 2DWQA 1TWAB 2GOWA 4WIPA 3TIXA 3G6JB 1PDQA 4LDTB 4DR4Q 5CMDA 1FMAD 1FR3A 4PT5A 2NWGA 2QDBA 4JX1C 4DV4L 2A74C 3E9IA 4LNFA 3TEWA 5BR8Q 1JJCB 1J8CA 1AARA 2HDEA 5C5LA 4KJNA 1QWYA 4A3CG 1NMFA 3GTQB 1KM7A 2N1WA 5G3LF 2KAJA 3MXNA 4QIWE 1SROA 1LT3D 3BJUA 1YJ9A 4MH0E 1GM5A 4LF4L 2N7DA 5C4XG 3GB1A 4P73A 1QVFA 2D5GA 3W1SC 3G6EA 2CJOA 1HRJA 4IUPA 2NVXH 3I9V1 3VR9B 4C56C 1EFWA 1PTOB 4DR4L 1D1KA 1WI0A 3GDEA 3TP5A 1RWSA 2IO1B 3LDZE 3D4DA 5FLXL 1OXSC 4DNIA 1DXMA 1TYGB 4IZ8A 5K36G 1N62A 3P75A 3DEPA 2LKVA 1TBEA 4BY1H 3U2SC 3CRKC 2A19A 3TEYA 4CKBA 3NSWA 4HWIB 3NTIA 4URKA 3KYHC 1ZDXA 3FKIB 2IZVB 1KD1C 3I90A 5D94A 3ZDTA 3TRZA 1PGAA 3K9PB 4OZAA 1XWEA 2MW5A 3VXWA 1XTDA 1SE3A 2EYLA 3A8JE 1V1PB 1L0WA 2VZAA 3VR3A 2I46A 3L4PA 2MRPA 3Q8FA 4HRSA 1V5OA 3SR6A 2ZTDA 2JWZA 3CAMA 5LNK1 5M3MB 2A5HA 4XXEA 4DV5Q 3S1NB 1JRUA 2BA0A 4IUVA 5FLMG 1TZ1A 3AU4A 4HROA 2BDNA 1CFMA 2Q2IA 2D62A 1N34Q 1GJXA 2MBHA 1JMLA 4P1BC 2F0DA 1QOFA 4G57A 3RULA 3OTOQ 2FUG1 3MC8A 1JWBD 5T8IA 1WTXA 1PA6A 2ZXOA 5IYCG 3TZUA 2E2JB 1LTID 2G4SA 2ZZPB 4DBGA 2WXMA 4KGRA 3DLLA 1X6OA 4PNYA 1FGBD 2B2YC 3E0JA 2WLBA 2ZPYA 1OEYA 2XIWA 2KC2A 4F7XA 4XQNA 3ONSA 2LHEA 4X65L 3H0GG 2HHHL 2KWDA 2K5DA 1U4AA 2LWPA 5DLQE 2NTTA 2JA7B 3EECA 1D4BA 1JOOA 2EXZA 5ELFA 4LJPB 4HIKA 1O7ZA 4NAWB 3FP9A 4YHHQ 1UE6A 4W9HA 4QY7A 4C80A 3T4AC 1C4QA 2CVRA 1WJNA 1KNAA 3VUXA 4J15A 4A3EB 1K51A 3HP3A 1D6EC 5CV8A 4A3JH 1M90C 1Q86C 2E5LQ 3RZDH 4HXDA 3VRAB 5IT9E 2OCEA 3ZNHB 2ZCCA 1L2NA 2VXWA 4IFDJ 3AE2B 4GDKB 2MO1A 4M0WA 4X3KA 2NMQA 4OIJA 1XT9B 3HHMA 1TWCB 3BWUD 2CHXA 1B3QA 5GQOA 3U9SA 2FMCA 1RKNA 5DEHA 4MELA 4ACFA 4EQPA 5IY0A 2LZ6A 4JI6Q 2O6VD 1Q81C 1XD3B 4YT0B 4XYCA 1E7UA 1FXAA 2BDOA 2MPMA 5EGTA 1EIGA 1TWHH 3KUPA 3S2HB 4JI8L 4A3BG 4IM0A 3W9CB 4ZHOA 4MGKE 5LL6S 3NUHB 3PRMB 1PHJA 1YHAA 1Y1VB 3TP7A 4C2MB 4ZRKA 3HOYH 5LMUL 1N5WA 2WGSA 3A33B 3CHBD 1G6ZA 3NBHA 3ZO5B 2GVAA 3NZ3A 3CCSA 3PV0A 3UQAA 2CW0D 4GLSC 4HPLB 1C4PA 5D14A 3HG9A 1PMRA 2PI2E 3K7AH 2NBWB 3H91A 3GTKB 4G0NB 1II3A 1J5EQ 3L0WB 5JH5C 3QJZA 1YHQA 4X66Q 1GD7A 3HRZC 1BUVT 1EF1A 3TDQA 4CBVA 2JT4B 3Q69A 1OXVA 2C9OA 5D6JB 3WOFA 1PH1A 3ZNZB 2FCQA 4O2DA 3E0EA 2NVTH 1WMHA 1H9MA 2NN6H 4DAMA 3ZKJC 3VDYA 1I3QH 5C5MA 2JK8A 3IT4B 2JRHA 1EFID 3PZDA 2IYDB 4X57B 3X0WA 2QDLA 4A3KH 4XDCA 3DWQA 5JAVA 1XMQQ 3CCJA 4W9EA 1V6EA 1F9SA 3G71A 2YU9H 1N33L 3NP8A 3MHZA 2B2YA 3S2DB 1G291 1NDDA 2FJ2A 3IRBA 4FADA 5M5XH 4ZUJA 4DA2A 1AZQA 4R8IA 1WF9A 4BWGB 2JEBI 1YZ6A 3HOVG 4KSLC 2WAQE 1E8ZA 3EROA 2JVCA 1EY7A 4I6NB 3L17A 1J7BA 2C35B 2HD3A 3F1ZA 5C1ZA 3S2HH 3ZNGC 2SEBD 4ME5A 1UH6A 3ZNID 3CCEA 4LW1A 2YEPB 1LQBA 3V96A 1HZCA 2K4KA 4RCOA 4GNXC 1VQLA 3GE3C 4CJ0B 4IM2A 4IPDA 5LMUQ 1SMYD 2EMSA 3GTPB 5IGDA 2BH2A 2Z6BA 2ENBA 2FCMA 5D3IB 1K8OA 5IIFA 3LX0A 4A3EH 3JC66 1B1ZA 1YNNC 4BBSG 1VQ9A 3VR6A 1FEHA 2K1BA 2DHZA 1WX7A 3JAMi 1EQRA 4NXML 1O7IA 3PIP3 1JB3A 2JA7G 4DF7A 4Y7NH 3FC4A 3PPAA 3U8ZA 1LT6D 3PUWA 4HIDA 3RNUA 2ZTEA 3V2TA 3CMEA 4DV3Q 3I5JC 1XPUA 1F2RC 3PUXA 4QB4A 5LHY1 1VQ5A 1JW9D 4Z9CB 1TS4A 1V8CA 3FILA 3NRZA 5HG2A 3V6CB 4A6QA 5LMNW 3L3OC 2LEKA 2D2QA 4ZRJA 1HZ9A 1S4ZA 1AP0A 1XMQL 4OZBA 1PTOF 3T1YL 4DAPA 3PGZA 2FIDA 3DHGC 1A63A 3NS8A 4HN7A 2FCNA 1VLBA 4BBSH 3U50C 3VFKA 2D07B 4B6WA 1I6HH 1WI5A 1TWHB 1NNXA 5IYDH 4NB3A 2A5UA 2L12A 3JSVA 2KEDA 2WB1E 3UE0A 4HAEA 3C3LA 2PVOD 1JB7A 2HHHQ 4M00A 1I4HA 2QW7A 1KFYB 1NENB 2REXA 4K6DA 2EY1A 2AUJD 3A8KE 1STNA 1U9RA 3NTKA 2K0PA 3J7AV 3RD2A 2WACA 1HR0W 4KIKB 3RZWC 4NQLB 3H7SA 3S16H 2IL8A 4A93B 3I3TB 1F9QA 1STBA 2BE5D 2F0LA 3PVLA 2LUEA 3K5MA 2EVBA 2PE9A 2D2CC 2CW0C 3EFUA 3SE0A 2B76B 1JT8A 1L4DB 4U673 4GOPB 3PO3G 2F0PA 2P5ZX 3A9KB 4FHJA 1F2ZA 1DGSA 1M94A 5JOBA 3T1HQ 2N7JA 3VYRA 1SFOH 2ATWA 3A9KA 1IW7C 1BXTA 2EYJA 5JVH3 2BPSA 1O80A 2N8NA 4ZCKA 4XDDA 5GMVA 2DZIA 4M01A 5TR5A 2VH2A 3NS1A 2MP2B 4OELB 1IL8A 1KQSA 1R4MB 2FHTA 3NY5A 2MEKA 1YOVB 4KV2A 1KOTA 3RPFC 3MXNB 2JZPA 2WDVB 1E0BA 2KOLA 4K2KA 2F0FA 2JA5H 3KYCD 2QF7A 2WIIB 1GUGA 2KCNA 3F2BA 1CQVA 2V4DA 1E1OA 4AYBB 1V1QA 4B9WA 3PS6A 3QAQA 1Q46A 1I5FA 1X56A 2XGTA 3DMUA 1J19A 4UP8A 2J7QB 2BOSA 3S1NH 4CYEA 1A62A 3N52A 5ELOA 3FAHA 3LYYA 2M19A 4MT5A 1XLOA 1GKHA 4QUCA 3X3NA 2NZ1D 2CFMA 3D4WA 3AEBB 1PZJD 2KNBA 1VQ8A 3PO2B 3GTJH 1GHKA 4KKSA 3DWGC 1PH3A 4LMQD 3CWIA 5LXIB 1TR5A 3RNBC 5AUIA 2ZPNA 1A2UA 3D6WA 4EQNA 4NNJB 3TN2A 1L0XB 1SNMA 1NE3A 2E2HB 5CR3A 1Y1WG 2H88B 3HUIA 4DQOC 2E75C 1N36L 1Z6HA 3L9AX 2JX5A 1DJRD 1R9TB 5COYA 2A68C 1ML0D 3EFXD 3H3VI 2F0NA 2ZNVB 4A3MB 4PMWA 3HZXA 1NSNS 3A56A 3NENA 3DHIC 1VQBA 1UGJA 4MSMB 1JE4A 4DV5L 2KJ6A 3HOVB 1C7YA 3AE4B 2G3QB 1G2SA 2D0OA 3SEBA 2DJGC 2K05A 2PNHA 2RDGA 4M1UB 5T1IA 4MZ9A 1BNZA 4GKJL 2MHJA 1K9MC 1QZEA 3B1LX 5HI1A 4A3PA 2PZTA 1M4VA 3KDFA 3W1BA 1FNWA 2KYWA 1ZXIA 3AN1A 2N49A 4N9PA 5I6WA 4JYAQ 4AIMA 4QF4A 3KOJA 3CCQA 2FNJB 2WXKA 3N9YC 1JQ4A 2R92H 3M3YB 3BK1A 3K80C 1Z2MA 5IAAC 4WJQA 3T1HL 4IUMB 2VQEL 4KKIA 1C4AA 1MI0A 4GDLB 3A9JB 1XXGA 3K5LA 1FD6A 3PLUA 2C9WB 5BMGA 4I7ZC 4LAAA 3HKZB 2JZ3B 5IWAQ 2N78A 1SF0A 1NEKB 2K9XA 2HIVA 1SSNA 2PQEA 1WGDA 4K8IA 4NXNL 2LGXA 1K52A 1SR3A 2DZMA 3BIID 2Q8RE 2Z4HA 4WJOA 2BB5A 3HGBA 2Q2TA 2D3AA 5FK9C 3QCAA 1QVCA 1BO0A 3H1UA 2NZOA 4LDTD 1N6ZA 4BXXH 1L0YB 3NHEB 2N3SA 1G51A 1T6BX 5FO8B 2RVLA 1PFBA 2F0UA 3CF6E 2L4NA 4FXCA 1UE1A 4IUUA 1WCMB 4IM3A 5LXHA 3DVNU 1YEZA 4KGSA 3AM9A 3NWSA 2JA8G 5FR3A 5KGUA 3VRBB 5C44G 4KIKA 4PQXA 4EZLA 5IYDG 3PSIA 1F2LA 1CKMA 1SFOB 4HJKA 5D7GA 4K2LA 4FHKA 4R8NA 4JI6L 1N5XA 4DR5L 2JYEA 2WP9B 2MFIA 1RFAA 3AE1B 1FYCA 3N1XC 5KHQA 1FCCC 2INDC 1ICWA 2L11A 2IX1A 4BY1G 2LS01 4DR7L 2KDMA 4ZQ3A 1B53A 4UP9A 2LJ5A 1VQJA 5JJIA 1M1KC 4A3DB 1FM0D 1EIYB 2PI2A 1LXDA 2KJRA 1SRUA 3I4MB 4LFAQ 2F4VQ 1WX8A 2O2VB 4EQ5A 1NR4A 2KKCA 5ELNA 3KLSX 1CTMA 4LUZA 4TQ0A 2HTME 1HR0Q 4ZKBB 1BMLC 3H6NA 2WX1A 4PS7A 2WDRB 1S5DD 1MJDA 4G11A 2EYFA 1MIUA 2L05A 1MGSA 1ZOYB 1X3FA 4BKGA 3UI3A 4BBNF 4YCWA 5JPMC 1YN4A 2O4XA 2Y0SB 2HIXA 1EQTA 3L2PA 2WU2B 1TJEA 2CU1A 1MPEA 1LTGD 2IO3B 4G50A 2QGQA 4Q0FA 1T9HA 1P7EA 1RL2A 2HCCA 3G48A 1XMOQ 1YJNA 1Y8PB 4FXDA 1CMXB 3BK2A 1QOGA 2D0PA 1G8ZD 2M2LA 1W6JA 2BT6A 1PZID 1VZ7A 5EDSA 2R93B 2KHWB 1SIFA 2X38A 4AYBG 2F0GA 1ILPA 2I2YA 2LY7A 3AFQA 4JGHB 1CKNB 2A68D 5CV4A 4MH8A 3BVMA 2H4OA 2IWHA 1C9FA 3Q6BA 4CDCC 3U30A 5HURA 4XYOA 3KLRA 1HNXQ 3U4ZA 2GBNA 1OFFA 4N8X1 4JI2L 2WXJA 1LT4D 2IW3A 2BKRB 2RSNA 3WANA 4APVA 2F0MA 5IGFA 3MEHA 1UWVA 2OWOA 3KUDB 2N4FA 2DN8A 1HNWL 3ZXVA 3SK4A 1FPYA 4J1MA 1BF4A 3DWMA 4YY3L 3M3JA 4OX9Q 5AZFA 3GD7A 2LXCA 1GUSA 2PTLA 3W3AA 3S15B 3VR5A 1UELA 2FCSA 2WXQA 3K6OA 1H9SA
chains in the Genus database with same CATH topology
5HFYA 1Q8IA 3P4PB 1DOLA 1EZ8A 5M5XB 3VA7A 3D31A 1WD0A 1XLQA 3TEXA 4US8A 5EBDA 1CZWA 5E4WC 3FPUB 2YU9B 1ZXHA 3P4QB 4N9TA 2JXTA 2E74C 3NUCA 1ZDVA 5KNCA 1HEZE 4CJ2C 3PZ7A 1CM9A 1WRIA 1KDBA 2Z4IA 1L6VA 3IL8A 1D5XC 4C3HG 5I2YA 2NBFA 1HTPA 3S9WA 3O13A 1EY0A 1V8QA 4B0MA 2E3TA 3VR8B 1HZ6A 2A6HD 3VR2A 4IURA 2J7ZA 3PIO3 1O78A 2WXGA 4BBRB 3H94A 4H13C 2F03A 1B4OA 1SSOA 4ZHPA 1KAAA 3Q23A 2WXPA 3VYSA 5NUCA 5I9OA 2F0HA 2RDHA 1VDVA 3FMCA 3T56B 5A2QL 4A90A 1U4RA 2LFNA 2BE5C 4C1NK 3RZDB 3I8ZA 3AECB 1QB5D 4USAA 1ONLA 1YN3A 1JWMD 4DXFA 2JWUA 1YNJC 1LV9A 3R8BA 3AE5B 3GV6A 2ON8A 2BW2A 3DUZA 2K22A 4ODGA 4ABNA 1ESRA 2LMCB 1DD2A 1WXQA 1FFVA 5AUKA 1E2VA 1VZ6A 5H8YE 1GXDC 5M3FB 5CV6A 2G1EA 2K04A 1GB1A 3QWNA 2XVSA 4E6IA 1D5ZC 4IN3A 3J81E 2ICEC 4H2AA 5HGTA 4KHVA 4DXGA 4F87A 2LGIA 4MACA 1BCPF 1ENAA 3J7YW 1JWSD 2B2UC 1QKZA 1XF5L 4C3IG 2L52A 5E1FA 3E6ZX 1LO5D 4RGMA 2M56B 4CKCA 2L1BA 1ZKOA 1I4QA 3FRPB 5C3XA 1JQYD 4OW0A 1WTQA 1FCLA 3P4SB 5C0XI 2LHDA 1DOYA 2H89B 5C0XG 5JEAG 1IGDA 1WTVA 3NVZA 3HS0C 4K14A 2INPE 5IGCA 1Q12A 4REZA 3I91A 1D1IA 3K0YA 4KX6B 2SNMA 4A8XC 3NPPA 2PVGC 4A3FB 2PMZB 2ZXRA 3BDCA 3QB3A 1WVLA 2DLBA 2RMMA 3OPOA 2G9HD 3BVGA 5EE0A 1C8CA 2E2DC 2A6HC 5JJZA 5BMHA 3V05A 2F4IA 1H9JA 4N6EB 1JRPA 1IKMA 1F2MA 2B8FA 2F0SA 2F3WA 1CZGA 2W55A 1XX8A 4G7ZC 4LLGM 2XRSD 3VYTA 4KKJA 3C2PA 3DXJC 3RFZB 4X3TA 2HCIA 5D65A 2K7VA 3OW7A 3FDTA 4L2YA 2XWJB 2M00A 2WXHA 4A55A 3SFDB 3PUZA 1WTWA 2R92B 2KJXA 1IYUA 4S3SA 1ENFA 3SK5A 4OL7A 5JVG3 1VF7A 2X6GA 2Z1CA 1QNUA 2WQYB 5D3DA 3E9SA 2W82A 5IGEA 5C4HA 2KA7A 1B3AA 3P20A 5FO7B 5BN5A 3SFEB 1JOKA 1VMPA 2K6AA 4RAUC 1Q1EA 3IKJA 4YTNB 2N9KA 3V3XA 2K5QA 1F9PA 1HZ5A 2DY7A 3C46A 3OSOA 1B9RA 3U4EG 3MXGA 4K6LA 1BDOA 4YIJA 3OHXC 1EWHA 5MPOA 2L5TA 2JSVX 4LK0M 3I73A 4QIWB 1OXXK 5EE9A 3A8IE 2R61A 2TMPA 2FE8A 2XN9C 2M0AA 3S14B 1JOQA 5A2QE 1LTTD 3GTJB 4G7HC 3OMGA 4H44C 4XT1B 3VYUA 3H6MA 3G7LA 2F0JA 2QILA 4X3UA 1SYFA 4KK7A 4NMZA 1XO3A 3DM1A 4IALA 3WOEA 4OVZA 1Z47A 1CK1A 2KVMA 1I6VC 4OO1G 1JALA 1PZKD 5JEAH 2MJ8A 4H7BA 4TMAB 3Q22A 1RTNA 4DU9A 1L4ZB 1RM6C 4KD4A 3J81L 3EJIA 1AN8A 1F0ZA 3IFDA 4MIUA 1SB3C 2WXIA 3TUOA 1YQ4B 3T51B 2V4IB 5AFWA 4ZUIA 2CU3A 2WDQB 4IQZA 3J9CA 2OEOA 2DBYA 2IGGA 3S1QB 5F2DA 1MSGA 1RDPD 1S5CD 4WWMA 1XLPA 4BA1I 2CHBD 1QF6A 1N60A 4DK0A 3OIQA 2RKSA 1KLUD 3B2GA 2HDLA 2EOTA 2OEDA 2WNMA 4ZRZA 4DAYA 2PZWA 5ISRA 2KCCA 4OO1I 4YSYB 2BS3B 3ND8A 3CKIB 2QJLA 5E4XA 1YNTE 4YWGG 3GP7A 2B2TC 3CRLC 2J42A 1F77A 2B2VA 3MJ5A 4YXDB 1DYQA 1E2ZA 2JQRB 2EY6A 1SYGA 3PMFA 1EU4A 2VZKB 2GRIA 4J8QA 3T3OA 1GHJA 2PNRC 4G4KA 2ACZB 1EU3A 1K50A 2EDGA 1SEBD 4NP5A 2X6LA 2W3SA 1S5BD 4FNFA 3FVQA 4ZK9B 2FBWB 1JWUD 1CHPD 3GS2A 2D5DA 5DAUA 5DNFA 1Y8NB 1ESFA 4ID6A 3BS1A 2XSCA 4DNTB 1LTSD 4TKOB 2JA5B 2NVTB 1OQRA 1AW7A 3A7AB 2B63B 3S1MB 1FRDA 2VB2X 4CGYB 2MJDA 5EKKA 1RCVD 4A3IB 1RFKA 1EY5A 1MBYA 2K5PA 4RF0A 2KUMA 1RODA 4R3DA 2GA4B 2PZUA 4FXGC 1CA6A 1L6UA 1A6XA 1M8AA 3GTLB 3R93A 1IHZA 1H9KA 2EELA 2Y3AA 3WDNA 1LTRD 3OOCA 2E6XA 4NDXA 3D3RA 1EYCA 2L9HA 3SDZA 3ZYYX 5FOBB 3SHLA 1S5ED 4D2KA 1K53A 3J7AF 4K5XA 1HUNA 3B9JA 4ILWA 3UI2A 2H1EA 1X3QA 5JPNC 4IKGA 3WCQA 2EYMA 1EEFD 4A3BB 2MH7A 1QLBB 3Q8CA 1E0ZA 1UNSA 3D4RA 3QOJA 3RZOB 2NVXB 1DZ1A 1YJIA 1STAA 4OIKA 1HQMC 4RKBA 5KNDA 1HQRD 2ONQA 4GZYC 2IGDA 4LJZC 3Q24A 3W5UB 2BBCA 3IXSA 1H9SB 2L1AA 1TY2A 4L8JA 3K5NA 1SJED 1J7CA 5E3FA 4XT3B 1Z7TA 2BS2B 2O2LD 5J22A 1LABA 1JORA 4YSXB 1B9MA 4UDUC 1I4RA 4QMGA 3I57A 5T1GA 4CQNA 3HVDA 4FYDA 3Q8EA 2WU5B 3JAML 1IYVA 4FF1A 1Q1BA 1CHQD 1HPCA 2QCPX 2WP8J 1E2WA 1A3VA 1ZP0B 3MXUA 4ZAIA 3SVMA 3FEWX 5BN4A 1FRRA 5JEAJ 2NUCA 3S1RB 3PZ8A 3R2TA 4KN7C 1I3QB 2DNCA 4DAVA 4IUNA 1RYJA 1PTOD 5IOCA 3MVVA 3T53B 2JA8B 2XWBB 1T5XD 4BS9A 4HEDA 3OWEB 2OXPA 4CKEA 3H3VC 1X3PA 2EKIA 1A3UA 2K33A 1PRTC 1OXUA 4OZCA 4DK1A 4C3JG 1WTPA 3NQIA 4EVOA 5J1ZA 3M85A 1PRTF 2F3VA 2K01A 3IAYA 4FF4A 2WINB 1CQFA 1EL0A 4TRDA 4IFDH 2RBMA 1L5PA 2PMVA 3H8HA 3LB8C 1G91A 5KRUA 4RCNA 2ZXPA 4FO2A 4J3OD 1KF6B 4YTMB 4RNAA 1DCZA 3LWUA 4KMUC 1RD9D 4A3JB 3NQTA 1DOKA 4ITKA 4PV1C 1ZE3D 5G5GA 4ZOHC 1WSPA 4IFDG 2BTEA 1BCPC 1TIID 1JR0D 1DGJA 2EYOA 3AEGB 2K3UA 3BDLA 1C77A 4QCLA 3ZGZA 4HKZE 2LUMA 3TSSA 3AE8B 2K03A 2JXMB 1PDXA 2EZVA 1KDCA 1NUCA 3KK7A 3AE7B 5BYSA 4F8MA 1WWTA 3MA2B 1U4PA 1VMCA 3BG3A 5I4DA 1ET9A 3P1MA 4HCEA 1V97A 3RUZA 4C7ZA 3ERQA 4L63B 2N9LA 4KY7A 4M8AA 1N61A 1SNQA 1CJEA 5CORA 5G5HA 1TWFB 1SAPA 2VNUD 2B8GA 5M5YB 3T13A 1VF5C 4WURA 2J0TD 5C2TB 4NAMA 1LTAD 3L7ZC 2WXFA 1VR9A 3CU7A 4ARCA 1H9RA 1FXIA 1TZOA 2E2IB 5EBCA 5FKAC 3IFTA 5EJWA 2YYZA 1MVKA 1PRTD 2DY8A 3R3OA 3NE5B 1FNVA 1C4CA 3Q6SA 5CGKA 3JAME 3H0GB 4JBWA 2AQ2B 1E10A 3NBIA 1CI3M 3TMEA 1V1OA 3TP8A 3I70A 4DFAA 1STGA 1MHXA 5BN3A 1I4PA 4IUQA 2C5CA 4HR7B 2JYTA 2N55A 1TS2A 3I3CA 1E9MA 2F0WA 1GUWA 2BS4B 4WORA 4KD3A 4TQ1A 4EGVA 3QG1A 5ELEA 5JXVA 1K8MA 1SYCA 4WJWA 2F0KA 3KWVA 5M5WB 3BYTB 3TP6A 3H09A 2FMMA 3HOWB 2F0OA 1I4XA 3DWAA 3RMHA 4JK1C 4XE0A 1TT2A 5I2XA 4XQJA 3VQIA 4RWSC 3N6RA 1PLFA 2FFKB 4HSPA 3MXPA 1OXTA 3T16A 2DYMA 2BCOA 4A3KB 1XCTL 1UWXA 1PFMA 2MGSA 1BUIC 3CQZB 3DWPA 4KN4C 4RKLA 1TU2B 1HXYD 2HUGA 1AEXA 2QMTA 2Y5PA 5KYIA 5KEEA 2IGHA 3IAM1 1JC7A 1KABA 1XEEA 5J39A 1OO9B 1TKGA 1TQOA 1NAPA 2KECA 3K7AB 4O1NA 4ZRPA 5EPJA 3E56A 1UEAB 3AU7A 3W5VB 3HOYB 1EIHA 2Q8IB 4C3IB 4L23A 3D8GA 1V43A 2JA6B 1QCBD 5GXGB 3R2IA 4V190 2B39A 1C79A 2DYOA 4JWSC 2AWNA 2V0GA 1KLGD 1G2TA 3U9OA 1P7FA 1BR9A 4L6TB 2J4XA 4P6VF 1I6HB 1KRHA 1F2RI 4JWUC 1IBXA 5I9PA 4OO1H 4IFDI 2G9DA 1ZYRC 3E5SA 3QOLA 3MAQA 1IBXB 3A54A 2L32A 1TY0A 3C1FA 5C3JB 5G3LD 2F0EA 2IT1A 1DOIA 1VZ8A 4PMBA 3BZDB 1NCVA 2EJFC 4C3HB 1XTCD 1E7PB 1EEID 1JWAD 2KMMA 5C4XB 1HFNA 1JICA 4OHJA 2O5IC 1SNCA 2XRQD 2CQAA 4BA2I 2SDFA 1YN5A 1JROA 2RQXA 1EQVA 4XQQA 3OMCA 2IX3A 1Y1WB 3AE6B 3HRDD 2IX0A 1SBBB 5CBEE 2RDFA 1GB4A 3A55A 1MSHA 1STEA 4KJOA 5K5PA 3S17B 3GTMB 5A35A 4DNRB 4WH4A 1HA6A 4WFN3 1TKEA 4V0BA 4ZLTF 3HOZB 1CA5A 1AWDA 2RPVA 3VA5A 1ZUD2 1Y8OB 2EJMA 5IGBA 2NVQB 1B2TA 2L83A 3ABVB 1D2BA 1XCQL 1QG7A 3SR1A 3URYA 1XLNA 3LWEA 4JPSA 2WAQB 2AUKA 2JSOA 4RA8A 3AMZA 1Q90A 1ROEA 5IODA 4KKUA 4FXKC 1FNUA 1BOSA 3MHBA 3M4YA 2Z8LA 5DM63 3AE9B 2R7ZB 4G7OC 3MFYA 4FF2A 3KQ4A 3DEOA 3C8YA 1D5MC 1ACCA 4CHTB 2NTSA 3ND9A 2WXRA 1EM7A 1GAQB 3KBGA 4EQOA 2ZW0A 1TS5A 4H0LC 4US9A 4LTUA 3D6CA 2EY2A 4F88A 3HOXB 2F0QA 1AZPA 2EY5A 1QOBA 3U7ZA 3AEEB 2BA1A 4NKLA 1FFUA 4KKTA 4C7YA 2F0TA 3Q0AA 1A15A 2AX5A 2YEPF 1PTOC 1PGXA 4NW2A 3AEDB 4A9AA 3MFGA 1SDFA 4EE2A 4KI0A 4B0EA 3LNNA 3RD4A 1RJTA 2J52A 2K5WA 2WB1B 2WKDA 2RSOA 1EYDA 2AQ1B 4IUTA 5TSSA 4RGTA 4J6HA 1QOAA 2HDMA 1TKWB 3GV3A 2IDYA 5EKIA 2GB1A 2N0SB 1WD1A 1EY4A 3TBIB 1TVXA 1ZEQX 3MP9A 3MC0B 1PYWD 3J80L 1NVID 2B2VC 4ARIA 1DM0B 2WV6D 2WXLA 5IGGA 1MI2A 2MHVA 1QQRA 2PW5A 3F2UA 2IPKD 1VDZA 4HMIA 1NR2A 1SE2A 1F2YA 2JEAI 3NTHA 1N63A 3AE3B 4HKQA 2PPBC 3SXHA 3TEZA 3EUB2 4WAFA 3KWLA 2QKIC 1Y69U 1A70A 3OIPA 1RHPA 3NWTA 2KEEA 5M9OA 2I07B 1SXTA 4UAIA 4NZLB 3QJYA 4C3JB 3P1HA 2V3PA 4HMJA 2QEJC 2HQEA 1QNKA 2EE1A 3NK9A 1EYAA 2PIAA 1ILQA 5EQ0A 5CYUA 1SYEA 1UUPA 1NI3A 2MJ3A 1CZPA 3ONAB 1MD2D 1AFPA 1F9RA 3EVQA 1EOTA 3AV8A 4XIGS 3P4RB 4KHZA 1C76A 4K5VA 1EY6A 5C3EB 1L0VB 4HEA1 5ELBA 1Q10A 2OF1A 4RH6A 4MHEA 5EE1A 1GUNA 1PFDA 3GTGB 4N58A 1B50A 1SYBA 3ZJVA 1SJHD 3I4NB 4AQ7A 5EE3A 2OHFA 1SNDA 3KLSA 1LTBD 1RTOA 2A69D 3W1SA 2KHSA 1SE4A 3HEJA 4K8JA 3SK6A 4N59A 1O7YA 4FP5D 2PW7A 2Q5WD 5C3WA 1ENCA 2X69A 3Q8BA 4JE3B 1KDAA 4RF1A 2L0CA 2JYOA 3FPPA 4ZYSA 1GUOA 2R3ZA 3AB9A 1HFGA 1I50B 4L1BA 2F0IA 3AH7A 1Q3LA 2BYTA 2VZKD 4A3GB 5E6JA 2O5JC 3I4LA 4PMCA 1SYDA 2XNAC 3MZ5A 1Y56A 4FF3A 3Q8AA 1SNPA 3ITPA 1E6EB 3A7LA 5C4JB 5FO9B 4KY5A 5HHDG 1R4QB 4WRDA 1KH0A 1NYRA 4IDIA 3NVVA 1DONA 5BYRA 1X32A 1K83B 4U68A 5KYLA 5K36H 3B2FA 2F1MA 2A6EC 4XWTA 3EQLC 1SNOA 2I38A 1QJOA 2K28A 4KTAA 3I72A 4HCSA 4B9XA 1J8IA 3SK8A 1WTRA 2SNSA 1A2TA 2W3RA 5CV7A 1AYFA 1B44D 1QE6A 2QSDA 2ID0A 2NVYB 1WYGA 4LK1C 2V3NA 2K32A 1LT5D 1EY8A 3EGRA 1IGCA 3VR4A 3GTOB 1LLRD 2INNE 3J80E 4YSZB 3AEFB 3MWYW 5CV9A 3S16B 4XTCS 3ZQ4A 1MHHE 4I65A 1ZPSA 4IOIE 2WXOA 1YMHE 3LXFA 4C1NI 5C0XJ 4WQMA 4OGQC 3C1EA 1R7SA 2WS3B 1HTLD 5H92C 1BCPD 3K59A 4BBSB 5C4ZA 1CT1D 3PO0A 1FO4A 2EYPA 4MM3B 2BB6A 3X3MA 2MJEA 2LMCA 3M4OB 5I6YA 2F0VA 1ZXTA 1PFNA 4Y7NB 1A3TA 1EZ6A 2B2WC 1V1PA 2JU6X 4TQUS 3K57A 1I4GA 2LFIA 2B2TA 3W2DA 2OT2A 1DOMA 4RGNA 1TWGB 2NB0A 3DHQA 5EPKA 2D9UA 4Q5VA 4K5WA 1FIQA 3NVYA 3K58A 2NN6I 2AQ3B 4XWWA 2R6GA 2IJ0A 2KQ4X 4KGTA 1QOHA 3T3NA 1VRAB 3NXWA 2ZW1A 4HSVA 2WKCA 1UAPA 1IKLA 1U4LA 3AMUA 2GI9A 3M7NA 1EWYC 4DN4M 3M7GA 5CV5A 3U52E 4DGZA 1DOXA 1BBXC 2A6ED 3QO2A 4BY7B 2VB3X 4X3SA 2LJIA 3GQBA 3PO3B 5CC4A 4ULLA 3HVZA 3KBXA 2M9VA 3NHHA 1GPXA 4MN3A 4HJGE 1PUTA 1O7LA 3K5OA 3PUVA 2RA4A 1SIJA 1PGBA 4RHSA 5KIXA 1W6KA 1IW7D 5FLXE 2L55A 1WTOA 2PKOA 1EY9A 3P42A 2TSSA 4XDXA 3P63A 3QIAA 5ELDA 3MTSA 4QUFA 2SAKA 2PCFB 1HHVA 1XYIA 3EA6A 2PW9A 3BVZA 4FVMA 2KN4A 2NN6G 1GOZA 4AS1A 2DNEA 2VUMB 1C78A 4KV6A 2JP1A 3OWFA 3FILB 1BQQT 3KF8A 1STHA 1STYA 4Q2JA 3AB5A 5BYQA 5EPLA 5CBAE 3RLFA 3HOUB 5KNBA 4ZRQA 1SMYC 2EYHA 2ZT9C 3PUYA 5DM73 2CJNA 3AEAB 4CJ1B 1NYQA 1YNND 1J7AA 2J53A 1PRTB 2SOBA 3IAS1 5C6AA 3BYYB 1OQQA 1UWMA 3ZJUA 1R4PB 1WGKA 1HUMA 2EPBA 2KACA 4XYQA 2JE6I 5C44B 1EWCA 2N88A 4NJCA 3CIRB 4B08A 2MUYA 1LACA 1FD7D 5IT9L 4YTPB 4KY6A 2PLPA 2ICIA 3ETRA 5EKLA 4HTHA 2PO4A 4R9WA 1T3QA 3TZDA 2MP1A 1S5FD 1BCPB 1QT9A 4ZKCB 1YJJA 1YQ3B 2EJGC 1C48A 2A69C 4TSSA 2W54A 1KNEA 2QIEB 1B9NA 5ELCA 2B2UA 2Y5CA 1HA5A 3GO5A 3ZJTA 4BY1B 1IUEA 4RGOS 1HCZA 2E76C 1RF2D 4O42A 1TKYA 1PTOH 5LL6X 1ET6A 1T5EA 2A73B 1JCKB 2WXNA 2NYZD 1TS3A 1YNJD 3BDOA 2FINB 1GUTA 3NVWA 2AWOA 2KQ3A 1ZYRD 2PYKA 1VCIA 1J9OA 1KTKA 1VJKA 4RFBA 3IT6B 2Q8TA 4P16A 4P2CB 2B2WA 1QILA 5C0XH 1PXUA 1I7HA 5BMIA 4RHRA 1U4MA 3P7JA 2DWQA 1TWAB 4WIPA 3G6JB 1PDQA 5CMDA 1FMAD 1FR3A 4PT5A 2NWGA 2QDBA 4JX1C 3TEWA 2A74C 2HDEA 5C5LA 4KJNA 1QWYA 3GTQB 5G3LF 2KAJA 3MXNA 1LT3D 3GB1A 2D5GA 2CJOA 1HRJA 4IUPA 3I9V1 3VR9B 4C56C 1PTOB 1D1KA 3TP5A 1RWSA 3D4DA 5FLXL 1OXSC 1TYGB 1DXMA 4IZ8A 5K36G 1N62A 3P75A 3DEPA 2LKVA 3U2SC 3CRKC 3TEYA 4CKBA 3NSWA 3NTIA 1ZDXA 3FKIB 3I90A 1PGAA 4OZAA 1XWEA 1SE3A 2EYLA 3A8JE 1V1PB 3VR3A 2I46A 3L4PA 3Q8FA 4HRSA 3SR6A 5LNK1 5M3MB 2A5HA 4XXEA 3S1NB 2BA0A 4IUVA 4HROA 2BDNA 1CFMA 1GJXA 2D62A 1JMLA 2F0DA 1QOFA 4G57A 2FUG1 1JWBD 5T8IA 1WTXA 2ZXOA 3TZUA 2E2JB 1LTID 2WXMA 4KGRA 4PNYA 1FGBD 2B2YC 3E0JA 2WLBA 2XIWA 4F7XA 4XQNA 2LHEA 2KWDA 2K5DA 2NTTA 2JA7B 1D4BA 1JOOA 2EXZA 5ELFA 1O7ZA 4NAWB 4C80A 3T4AC 1C4QA 2CVRA 1KNAA 4A3EB 1K51A 3HP3A 1D6EC 5CV8A 3VRAB 5IT9E 2VXWA 4IFDJ 3AE2B 4GDKB 4M0WA 4X3KA 2NMQA 4OIJA 1TWCB 3BWUD 3U9SA 2FMCA 1RKNA 5DEHA 4EQPA 4YT0B 1FXAA 2BDOA 2MPMA 5EGTA 1EIGA 3KUPA 3S2HB 4ZHOA 3W9CB 5LL6S 3NUHB 3TP7A 1Y1VB 4C2MB 1N5WA 3CHBD 1G6ZA 3NBHA 3NZ3A 3PV0A 2CW0D 4GLSC 1C4PA 5D14A 3HG9A 1PMRA 3H91A 3GTKB 1II3A 3HRZC 1BUVT 3TDQA 4CBVA 3Q69A 1OXVA 2C9OA 3WOFA 1H9MA 2NN6H 5C5MA 3IT4B 1EFID 4XDCA 3DWQA 5JAVA 1F9SA 3NP8A 3MHZA 2B2YA 3S2DB 1G291 2FJ2A 4ZUJA 4DA2A 1AZQA 4R8IA 4BWGB 2JEBI 3EROA 1EY7A 1J7BA 2SEBD 4ME5A 2YEPB 3V96A 4RCOA 4CJ0B 1SMYD 3GTPB 5IGDA 2ENBA 5D3IB 1K8OA 5IIFA 3LX0A 1B1ZA 1YNNC 3VR6A 1FEHA 2K1BA 3PIP3 1JB3A 4DF7A 3FC4A 1LT6D 3PUWA 3V2TA 1F2RC 3PUXA 4QB4A 5LHY1 1JW9D 1V8CA 4Z9CB 1TS4A 3FILA 3NRZA 5HG2A 4A6QA 3L3OC 2LEKA 1S4ZA 1AP0A 4OZBA 1PTOF 4DAPA 4HN7A 1VLBA 1TWHB 2L12A 2KEDA 2PVOD 4HAEA 3C3LA 1I4HA 1KFYB 1NENB 4K6DA 2EY1A 2AUJD 3A8KE 1STNA 1U9RA 3NTKA 2K0PA 3J7AV 2WACA 2IL8A 4A93B 1F9QA 1STBA 2BE5D 2F0LA 3K5MA 2EVBA 2D2CC 2CW0C 3SE0A 2B76B 1L4DB 4U673 2F0PA 1F2ZA 2N7JA 5JOBA 3VYRA 1IW7C 1BXTA 2EYJA 5JVH3 1O80A 4XDDA 3NS1A 1IL8A 2FHTA 2MEKA 3RPFC 2JZPA 2WDVB 1E0BA 2KOLA 4K2KA 2F0FA 2QF7A 2WIIB 1GUGA 2KCNA 1CQVA 2V4DA 4AYBB 4B9WA 3DMUA 2BOSA 3FAHA 3N52A 4MT5A 3LYYA 2M19A 1XLOA 4QUCA 3X3NA 2NZ1D 3D4WA 3AEBB 1PZJD 3PO2B 1GHKA 4KKSA 3DWGC 4LMQD 3CWIA 1TR5A 5AUIA 1A2UA 3D6WA 4EQNA 3TN2A 1L0XB 1SNMA 2E2HB 5CR3A 2H88B 3HUIA 4DQOC 2E75C 1Z6HA 3L9AX 2JX5A 1DJRD 1R9TB 5COYA 2A68C 1ML0D 3EFXD 2F0NA 4A3MB 4PMWA 3HZXA 1NSNS 3A56A 1UGJA 1JE4A 3HOVB 3AE4B 1G2SA 3SEBA 2K05A 2RDGA 1BNZA 4M1UB 5T1IA 5HI1A 2PZTA 1M4VA 1FNWA 1ZXIA 3AN1A 4N9PA 5I6WA 4QF4A 2WXKA 3N9YC 1JQ4A 3M3YB 3BK1A 4KKIA 1C4AA 1MI0A 4GDLB 1XXGA 3K5LA 1FD6A 5BMGA 4I7ZC 4LAAA 3HKZB 1SF0A 1NEKB 2K9XA 1SSNA 2PQEA 3BIID 4K8IA 1K52A 2Q8RE 2Z4HA 2BB5A 3HGBA 5FK9C 1BO0A 1L0YB 1T6BX 5FO8B 2RVLA 1PFBA 2F0UA 4FXCA 2L4NA 4IUUA 1WCMB 4KGSA 3AM9A 3NWSA 5FR3A 5KGUA 3VRBB 4PQXA 1F2LA 1SFOB 5D7GA 4K2LA 4R8NA 2JYEA 1N5XA 2WP9B 3AE1B 1FYCA 1FCCC 1ICWA 2L11A 2IX1A 2LS01 2KDMA 4ZQ3A 1B53A 4A3DB 1FM0D 3I4MB 1NR4A 3KLSX