3OWEB

Crystal structure of staphylococcal enterotoxin g (seg) in complex with a high affinity mutant mouse t-cell receptor chain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
227
Chain Sequence
AQPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEFGGCCMYGGLTFNSSENRDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Beta-chain
publication title Crystal structure of staphylococcal enterotoxin G (SEG) in complex with a mouse T-cell receptor {beta} chain.
pubmed doi rcsb
source organism Mus musculus
total genus 60
structure length 227
sequence length 234
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3oweB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3oweB01
1KLGD 4UDUC 2IPKD 3BVZA 3EA6A 1STEA 1T5XD 2AQ3B 4ZYSA 2O2LD 1V1PA 1B1ZA 1DJRD 3BZDB 1D6EC 5I4DA 4L6TB 4DXGA 2CHBD 1SEBD 1I4RA 1EEID 1FD7D 1KLUD 1AW7A 1EFID 5ELFA 1KTKA 3BVGA 4NZLB 1D5ZC 1TS2A 1EU3A 1HQRD 2Z8LA 1PTOF 1PTOB 1ESFA 1D5MC 4K6LA 1RDPD 4RGTA 1LTAD 1SE3A 1RD9D 1CHQD 1YN4A 1SBBB 1YN3A 1I4HA 1PRTC 1JQYD 1GOZA 5ELCA 4O1NA 1PTOD 2AQ1B 1LTBD 3TSSA 1FNWA 1S5BD 1JWMD 3DWPA 1LTID 2RDHA 5ELDA 1JCKB 4RHRA 1LTSD 2R61A 4RFBA 3O13A 4DXFA 3BYYB 5FKAC 1TY2A 1LT5D 1F77A 4C56C 3R8BA 1S5ED 1TS3A 3GP7A 1I4XA 3DWQA 1L0YB 1ENFA 3BVMA 3KLSX 2G9HD 1I4QA 1HTLD 3MC0B 1BCPF 1PTOH 1BCPB 1PTOC 4RH6A 4TSSA 4BWGB 1MD2D 1SXTA 1BXTA 1JWUD 3V05A 5ELEA 1CHPD 1LT4D 1PZKD 2J4XA 1SE2A 1FNUA 2TSSA 3CHBD 1S5DD 3EFXD 5TSSA 2QILA 1BCPD 1LO5D 1G8ZD 2RDGA 1JWSD 1JR0D 1LT3D 3W2DA 1LTTD 1DYQA 1PZJD 1V1PB 1YN5A 1V1OA 5D3DA 1HXYD 3BYTB 1TS4A 1XXGA 4RGOS 2SEBD 4RCOA 1LTGD 4RGNA 3URYA 1XTCD 1I4PA 2XNAC 1PRTB 1EWCA 1CK1A 1LT6D 1RCVD 1FNVA 1SJHD 1BCPC 1TS5A 3R2TA 4OHJA 1AN8A 3OWEB 1FGBD 1HA5A 3MFGA 1D5XC 1PRTD 2WV6D 1S5CD 2NTTA 1ET9A 1EEFD 4RGMA 1QILA 5ELBA 1CQVA 1TY0A 1RF2D 2IJ0A 1LLRD 1UUPA 1PYWD 5FK9C 2XRSD 1SE4A 2XN9C 2AQ2B 3DWAA 2NTSA 1S5FD 1SJED 1I4GA 4RHSA 1L0XB 2ICIA 1M4VA 1ET6A 3R2IA 4L63B 2XRQD 4Z9CB 1LTRD 3SEBA 1CT1D 2QEJC 1UNSA 1PZID 1EU4A 5D3IB 1PRTF 1B44D
chains in the Genus database with same CATH superfamily
1QUQA 5C4JB 3CCSA 4JI1L 3PHWB 4H13C 4HLEA 4IOAA 3ZIMA 2KDBA 1U4RA 1AH9A 1AFPA 4BKTA 4X6AH 1FFUA 2E6XA 4L23A 4P72A 1PH3A 4OONA 1U4LA 5FLMH 4PV1C 1CA6A 2BS2B 1TYGB 4ZDVA 2LHEA 5KNCA 2CHBD 3RNUA 4IFDI 3A54A 2JA8G 5HURA 3L10B 2FE8A 3QOJA 1FD6A 1ESRA 1CA5A 2GRIA 3RNFC 4QL5A 1GKHA 2L32A 5IWAL 1A8VA 4K7UA 4LLGM 2A6HD 1G2TA 4A3IG 1YJWA 2JUOA 3HOWH 2L0FA 5CR3A 5A2QL 3UIOB 1YEZA 4APVA 1VQ7A 4NXML 1GOZA 2KUMA 2KCMA 2IY5B 5ELCA 2ZPNA 4M02A 2JX5A 5J3BA 3PO2G 2GVAA 1N36L 2L3ZA 4C3IG 3KWVA 4A3DB 2NBVB 3X23A 1EYAA 5CV5A 1OO9B 3PUWA 4ALPA 1KF6B 1UBQA 4DU9A 1Z7TA 2R6GA 3PIOA 3AEGB 5C2TB 2QDLA 1S40A 1WX7A 1YIWA 1XNRQ 1IKMA 4YT0B 1VQAA 1D2BA 1SNOA 1F77A 4DAYA 1C0AA 1UH6A 3PLUA 2A6HC 3AV8A 4GDLA 1I5FA 1XLQA 2NBWB 4EEWA 3ZTDA 5JPNC 1PGBA 5EPKA 1TWAH 3BVMA 3VFKA 2K50A 4YY3Q 3F1ZA 3I55A 3HG9A 4X65Q 1BCPB 1GJXA 3TEHB 4DFAA 2QMTA 1F9QA 1TGZB 1DCZA 4BBSG 1CHPD 1FM0D 1PZKD 2JU6X 1ENCA 1EIHA 2V3SA 4GIVA 2VL6A 2AUJD 2HHHL 3KH0A 1K9MC 1P7FA 1SB3C 4J15A 3WIMA 4QCLA 3VH3B 3CCRA 1HZ9A 3VYSA 1XMOQ 4GKKQ 2H1EA 2AWNA 5C3XA 3DEOA 3CF5A 4DV4Q 1MBYA 1OTCA 5IGEA 4W9LA 1PH5A 1C76A 4OEMB 2JZZA 2O6VB 2KXJA 1YJ1A 5FO8B 3S17B 5FLMG 4HJAA 2OTJA 2WP9B 4OL7A 4RGNA 3HUIA 1KL9A 4A3FG 1XCTL 2A6EC 4JPBW 5E6NA 2VS1A 3G6EA 4BVUC 1YHBA 4H7BA 5K5PA 5IGGA 1SMYD 3T4AC 1YOVB 2PEAA 4CBVA 2R7FA 4A3BB 2DYBA 4C3HH 2EYPA 4EGVA 4A3LH 2R93B 1PFDA 5KYIA 1A3TA 1B9NA 3S2HH 3W5VB 4RKLA 2B2WA 2I07B 3RZFA 1SSNA 2WDVB 3T56B 3CPFA 2LZ6A 3HOWG 4NAMA 1JJCB 3OWFA 4X57B 1X32A 1GG3A 1EY6A 3WDNA 1N34L 1C1YB 2ZZPB 1JALA 5FK9C 4GNXC 1STBA 4HMIA 1SYGA 3X3NA 5D65A 5I6WA 1E7PB 1S3SG 2MBQA 1N36Q 1SMYC 1V81A 3M4YA 4WQOB 1C4PA 2I1KA 1L1OB 2EYOA 2F0TA 1SYDA 4K2LA 4QMGA 3J81c 1JMCA 3C2PA 3KUZA 4IUQA 3KF8A 3IVFA 3S9WA 4HEA1 2IZVB 2Z59B 3AB5A 1EWHA 1X3PA 3BVZA 3PZ8A 1I94L 1HTPA 2Y0SG 4NY0A 1IZ6A 3KDFA 1IPGA 1BNZA 2KX3A 3ZGZA 3CU7A 4GDKA 3J80L 2PPBC 5MPOA 2KWVB 1GUNA 3DWGC 1K3RA 3KFUA 1KHIA 2JN4A 3BVGA 3ZDMC 3JYUA 1HTQA 2M0AA 2HHHQ 4ICUA 4EKUA 4FN2A 2F0FA 3PRPB 4BKSA 4RGTA 4N6EB 5JVH3 1OTRB 2D10A 4C7YA 2Z0SA 3HOVH 5HGTA 1NR2A 1YNND 1T9HA 2Q2IA 1ZOYB 2K39A 3Q8DA 1NJIC 1X6OA 4JK1C 4JI6Q 3RCZA 1I50H 2PW5A 2JEAI 1YMHE 3BINA 3C8YA 3RNEC 1WJUA 5AJ3L 3C1FA 3B08A 4PMBA 2HD3A 3DWPA 3BWUD 3N32A 4LDTD 2WB1E 3CMAA 4HJGE 1TWCB 1V80A 3KOJA 4EZKA 3FMCA 4X64L 1WCMH 4DV3Q 4C3HG 2JVCA 3TEYA 4ODGA 1K8MA 1QZEA 1WGRA 1IW7D 3D4RA 5GADC 4A3LG 1UGJA 4YTNB 2N7JA 2Y0SE 4JVZA 1L6VA 1WJNA 4XE0A 2PW9A 3R8BA 1SIJA 2UUAL 4M01A 4LW1A 1BOSA 2MSED 1TKGA 1IBXB 1CSPA 3NBIA 4WAFA 1N34Q 3W1GA 4BWGB 4BBNF 1ZUD2 4X3SA 4W9CA 3A56A 1GD7A 1VQBA 1Y8PB 3EIVA 2KZRA 2LASA 4XZ4A 1E7ZA 2JT4B 2NVTH 5DEHA 4XQNA 3IL8A 5L95C 2E2IB 2QILA 2Q8TA 3NE5B 3HOXB 3OOCA 5FR6A 2KEDA 3RD2A 3W2DA 1YJ9A 3L17A 2K52A 4RM9A 2UU7A 3AMUA 1WTQA 3SDZA 1LXDA 2VZKB 1A63A 3ZRCA 1RIPA 4NXNL 2K25A 1I94Q 2A5HA 2J53A 3L7ZC 2D5DA 2KDEB 3DCGA 3NZSA 3UI3A 2B2YA 4CQNA 2BE5D 4LWCA 2RSOA 4RGOS 2GBKA 2K6DB 3TUOA 1EIGA 3URYA 1EWYC 4K3CA 4HKZE 1YI2A 1ROEA 1XTCD 2NWGA 2JPHA 3IAM1 4C80A 2A1AA 2XNAC 4LFCL 1FEHA 1OQYA 3GE3C 3UINB 4KHVA 1H9KA 3NHEB 1KRHA 2YTVA 4DK3C 1V5OA 1O7YA 5CBAE 4PK1A 1WMHB 4WWNA 3GTOB 2NVYB 4X3UA 1V86A 3DBRB 2F4VQ 1YJNA 4K8IA 2JWUA 1FCCC 3L54A 1VR9A 3HOVG 3RPFC 2EYHA 2LJ5A 2BE5C 4NJ7A 5IT9E 4NJ6A 4HVBA 2HJ1A 2WU5B 1DOYA 2ZTCA 3A8JE 5C4XH 4EQNA 3CF6E 5BYRA 1N5WA 1N6ZA 4IURA 2QCZA 3JAME 1YIJA 3C19A 5AJ3Q 1ZDXA 3FKYA 4US9A 1XPUA 2CH4A 3I90A 3P7JA 2F3VA 2F03A 4MDKE 3MJ5A 4K3BA 3ZW3A 4X64Q 2VXWA 4JI5L 3CKIB 4NMZA 3R7QA 3NHHA 1HPCA 4HJ9A 2AHOB 5G3LF 2ZXRA 4WFN3 4DV7Q 1ZGUB 3I9V1 4IWOA 4REZA 4XC2A 1H9JA 4AWJA 4C7ZA 2UUAQ 5GAGC 3EROA 2J0KA 3BZDB 1EUJA 2BA0A 2MO1A 4TKOB 3J9CA 3PRZA 1K0SA 3CCQA 2IWHA 1V97A 1EFID 2CFMA 3DLLA 3TP5A 1PGXA 2N1WA 1A3VA 1E3PA 1TS2A 1YNXA 3P75A 3EHVA 1NYRA 3N1XC 2KDMA 2K0PA 3W5UB 3EFUA 2B2WC 1H8CA 4Q0FA 2N78A 4L8JA 4LJPB 2VB2X 4JCVE 3AEBB 4FDBA 3PPAA 4ABNA 4IWQA 4OZCA 1E8ZA 3PCOB 1SF0A 4DR7L 4NXNQ 1ZXHA 5BMHA 1I4HA 3H1UA 3D4WA 4ME3A 3K59A 2Z9HA 5EGTA 5IGBA 4A3KH 5K36H 5IP4D 2O5JC 3RLNA 4TRDA 4K81A 2BYVE 2FMCA 2WAQG 1JWMD 3SU8X 2W82A 5IYCG 1Q3LA 1WGKA 4LFCQ 2OOBB 1ZKOA 2M4NA 3OIQA 1DD2A 2UYZB 5JJLA 3VR9B 3QC8B 2RKSA 3H0GH 2D9UA 3K5NA 4IFDH 3VUWA 3PUXA 4XQQA 5M3MH 3BS1A 1QOGA 1Y8RC 1ZW7A 3AE1B 2ZCCA 1GXDC 4R8NA 1ZP0B 4RH6A 1QOHA 4B3SL 1L4ZB 3CW2C 4KHPQ 5C4XG 4YWGG 1H9MA 1JWUD 4WJWA 2AEHA 1FR3A 3PUZA 1Q86C 4G7OC 4JQWC 2TSSA 4FF2A 4KIKB 1EO6A 2MBOA 2DZMA 1VQGA 2EKEC 2EJMA 3GTPB 3AE6B 3R3OA 5C4ZA 4ITKA 4GNXB 3VTUA 3PVLA 1WH3A 3HEJA 1WTOA 1QNKA 3GZNB 1EZ6A 1JICA 4XX5A 1I6HB 4F1SA 3NVZA 3A1QB 5JXVA 1TR5A 1Z47A 1ILPA 2KQ3A 3GTQH 4IM0A 4DPGA 2VQFL 3ZLZA 4YL8A 4FXDA 5J22A 1MKHA 2G1EA 2LUEA 1HA6A 4LCDE 4V0BA 3NEMA 4WJ4A 3N30A 2F0OA 4NPNA 4OHJA 3GD7A 1EY9A 3RZDH 1F2ZA 1H9SB 1FGBD 1KDCA 3TS2A 2UXBQ 2NCNA 2O6VA 1EQTA 3ZNHB 2JQRB 2HDMA 4M8MA 4ZKCB 1WX9A 3HHMA 2DYOA 3MFYA 3S14B 2FUHB 1N62A 2QIEB 3DHIC 2KWUB 5K36G 4A3KG 1SDFA 1Y69U 1YITA 2ACZB 3PZDA 2NR2A 4MJSA 4QY7A 1JC7A 3ND9A 2KENA 4HMJA 1LV9A 1UNSA 2M8SA 2ZCBA 3N3KB 3ZNID 1HFNA 4GN4B 1B44D 4Y7NB 1STGA 5LL6X 2MQJA 3J7ZC 3H0GG 1E2ZA 4IFDG 4NP5A 4CDEC 4DF7A 3HS0C 1STEA 5M3MG 2MLBA 1Q10A 2OT2A 1WI5A 3I4MH 3S16H 4F88A 2BYFA 1XNQQ 3K9PB 1RODA 1B70B 2K75A 2JY6A 2N88A 1OXVA 1EEID 1L1OA 4CDDC 4P75A 5C44B 1IP9A 1JW9D 1YNJD 3MA2B 2WACA 2ZTDA 5M3FB 1GM5A 3V62A 1SYBA 1SNQA 2M0XA 1I6HH 4BY7B 4PYUA 1HZAA 3NSWA 2DLBA 3HKSA 3V2TA 3GOEA 4GMVA 3TN2A 3MWYW 5EBDA 5C5MA 2OTLA 3VUYA 5IKCM 4IJHA 5KNBA 5JHBA 1QE6A 4JPSA 1VCIA 4DAVA 4LDTB 1G291 1Z9FA 2F0NA 2DY8A 4UP9A 4MGZE 3WCQA 4CKCA 2ZJQA 2RSUA 3SR6A 1TIFA 2YU9B 1OEYJ 1IBMQ 1QOFA 5CX3A 4ASWC 2K6QA 3I63C 2EOTA 1YNJC 2IX1A 4KVGB 3STBD 2OJWA 3H7SA 5E4WC 2KHWB 3GTJH 2MNAA 2ENBA 4DK0A 2KJXA 4DXFA 3DM1A 1VQ9A 5HFYA 3JW0X 1EUVB 5EE9A 3TS0A 2JA6G 5G2NA 4CYEA 1FMAD 1E7UA 1JRPA 3CCMA 5FO9B 4LK1C 3H3VH 1PFBA 1I4XA 1HR0Q 1ENFA 2F3IA 4RG1A 4JYAQ 1XWEA 1WSPA 4A9AA 2FBWB 3K57A 4POGA 1PTOH 1J19A 3RMHA 1RM6C 2BBCA 1MHXA 2JF5A 3G7LA 5HKHA 4AQ7A 1GUAB 5C23A 5LMNL 1EY7A 1ZYRC 2CQOA 5AEKB 2E2JB 5IA7A 2C60A 3S2DH 1LYLA 3B2FA 2M1MA 4UP7A 1BMLC 1B9RA 5M5XH 1IYVA 2K5QA 4KI0A 2IO3B 1LT3D 2DN8A 3HP3A 3W9CB 3H91A 4FHJA 2PNHA 3ICEA 5BR8Q 3K7AB 1IBXA 1GC6A 4HJ7A 2VUMH 2UXCQ 3VR4A 3C3LA 3I4MG 3TL5A 1HXYD 4RNAA 1RLFA 3QWZB 1RL2A 2CKZB 5EE0A 1ZDVA 3G48A 2YV5A 2PYKA 3KYCD 3K80C 3PHXB 3NZ3A 2EY5A 1I3QB 3PO3H 2FHTA 1PA6A 1NSNS 1C48A 3E9HA 1HA5A 1VZ8A 1XLPA 2J7QB 1ET9A 1L2NA 1KLVA 4RGMA 2KVZA 2A73B 2OQKA 2OQ0A 1F0ZA 1DXMA 4K5VA 5BN3A 3P1MA 2FFKB 2J0TD 2KJRA 1PH2A 1HZCA 1WX8A 3QR8A 1UEBA 3KQ4A 3J81E 4TV3A 5CHVC 1ET6A 1WMHA 3ZTCA 4ZRJA 1WE6A 2K5DA 1BBWA 4DR3L 1UE7A 4GSWA 1WOCA 1C9OA 1E8XA 3EA6A 2A5UA 1FGUA 3ECIA 4A3GB 5JJZA 2KMMA 1WVLA 1HFGA 3U4EG 4KY5A 4V190 1EY8A 1JOOA 4YXDB 3VRBB 1KABA 4AYBG 4BZAA 4DXGA 2BS3B 3MHBA 5L83A 5G3LD 4ZRQA 3U7ZA 3P2BA 5LMNQ 2PZUA 1SRUA 4LFAL 3H9DA 2FUG1 5GQOA 1MG8A 5IT9c 2K22A 3NBHB 2X6GA 1MHHE 1BDOA 3RZWC 1PTOF 2PMVA 5FJ8H 2YLMA 2QF7A 3IFTA 4HIOA 1J7BA 4URKA 1LTAD 2JA8B 2ZXOA 2EY1A 5EQ0A 4WJOA 4L5RC 1HNZL 1ZXTA 2VUMG 3AEAB 4JX1C 1MHWC 1STYA 3QB3A 1FJGL 4RMAA 1N61A 4RMFA 1E1TA 4BOSC 1FFVA 1T0QC 2QHOA 2L05A 2MP1A 4PNYA 4L5QA 4A3IB 3S1QH 1JRUA 3ZJVA 2F0PA 4GLXA 4HPPA 3PV1A 1J5EQ 3EBEA 5I9PA 3P63A 5DPSA 5EE3A 4WJPA 1TY2A 3PO3G 1DGJA 3N1ZC 3Q8AA 3PO2B 2NVUI 1LUZA 3AQQA 3RLOA 2D5GA 2GI9A 1C4AA 1N60A 5DCNA 3HKZG 1BT0A 3VVWB 3V6EB 3M7GA 2BA1A 3L13A 3V60A 5A2QE 4GXBA 2KBNA 3VHTC 2CHZA 3GV6A 2DNCA 1VQHA 3F2UA 1JE5A 1RWSA 1YQBA 5C0XH 3ENEA 1CKOA 4KDLB 3ONSA 3UQAA 3OMCA 3SK5A 5NUCA 3RZOB 3UGBB 3NK9A 1G6ZA 1PH7A 4E74A 2WXFA 3I57A 3TP7A 1M8AA 3TBLD 1JB3A 1DYQA 5AUIA 5D94A 4HCSA 1KOTA 3S1MH 2ZT9C 4DUYL 5G55A 3SE0A 5CBEE 1RAXA 1WGHA 4FA6A 1VDZA 2WNMA 4J6HA 4C2MB 2GLSA 3GS2A 1G2SA 4XWWA 1LABA 3MHSD 4JG2A 4RCOA 4LK0M 2P5ZX 2C5LC 1DGSA 3GTMH 3FRPB 4KIKA 3T1HQ 4GKJL 1VDVA 3GTLH 4JI0L 2KTFA 1FNVA 4LFAQ 4JI8L 4GN1A 3SR1A 3R2TA 4GNXA 1PHJA 1P98A 1E9MA 4UY8C 1K8GA 5C5LA 1XJVA 2MHJA 3P42A 2ZTEA 4LUVA 3PO0A 1D1KA 1WWTA 5FJ8G 2GBJA 5DNFA 1STAA 1NBWA 5ELBA 4XDXA 1V9PA 1SE8A 1VS0A 2KYWA 1PYWD 3EC8A 2W55A 3A74A 3AE8B 2JP1A 1V1QA 1J0GA 1FJGQ 2BKRB 1SNMA 4RHSA 2Y5PA 4PS8A 4H0LC 2M19A 3NUHB 1KNEA 1H9SA 3R2IA 2KKCA 3HOWB 5D3IB 4C3IH 4ZCKA 4DK6C 4OELB 2IO2B 3GE8C 1F2MA 3H8HA 4BY1H 5GXGB 3F8TA 4K8JA 3S2AA 3OG5A 1K51A 1V9JA 4B3TL 2IPKD 3D6CA 4B9WA 4K5WA 4FLHA 3VRAB 2MFIA 4OWWB 2FCNA 5I4DA 2L83A 4KY6A 2NVXH 2PQAB 1FYCA 3EQLC 5ELFA 3OTOL 4LF7Q 2BKFA 1DOXA 5C0XG 4EUTA 1NVID 1XLOA 3A8KE 4A4IA 1CMXB 1TWAB 2E76C 4BBSH 4A3EH 1CM9A 1MSHA 2MGSA 3AB9A 1U4MA 1ESFA 3J81i 3BZKA 2XTIA 3TP8A 3AU5A 4NDXA 4LF4L 4W9IA 1Y1WH 2JRHA 4LNIA 4A3OA 2PVOD 4ILWA 4IUUA 1F52A 3T16A 1OQRA 4O1NA 2OWOA 1QB5D 1PH9A 1FXTB 1WM3A 2QSDA 4DK5A 3TSSA 1D4BA 1PYSB 4AJWA 2W3RA 4GKJQ 1YQ4B 3J80E 2MBHA 3AE2B 2BTEA 1E8WA 4EE2A 3I3TB 4A3FH 1IXRA 4JI8Q 1HHVA 3P4PB 2FAZA 2XK5B 4POFA 2NS5A 2V4DA 5CMDA 3PT2B 4DA2A 4DR6L 1F2YA 4RCNA 2ZW0A 4FF3A 3D4DA 3SVMA 1DOIA 3RYTA 1LGRA 4ANXA 1GUWA 4I6LB 1LM8B 2K04A 1VQCA 2RSNA 4FXCA 4DR2Q 4C3HB 2AX5A 2N8NA 4O42A 5D14A 3EVQA 3S2HB 4R8IA 2IGHA 3NTKA 3SD5A 3ULLA 1NENB 2HE7A 4B08A 2IT1A 3NWTA 1R4MB 2B8FA 1LTTD 1SSOA 4PQXA 2VB3X 4BY1G 1V2YA 2K5PA 2RA4A 4TQ0A 2JWZA 4QQBX 3ML9A 5J2RA 4ARCA 2PMZE 4B3TQ 4MIUA 3ZO5B 1D3ZA 5DM73 1HRJA 1FIQA 4NQKE 2DNEA 1TS4A 3HK0A 4DHZE 1WF9A 5E6JA 1Q1BA 4S0RA 3CCLA 2DX5B 2RDBC 3H94A 2EYMA 1NE3A 2K1BA 4N9F4 3NY5A 3QWNA 3OTOQ 4DR4Q 2KANA 1E24A 1G51A 3V96A 3KW5B 3V3XA 1E90A 3AE3B 3CSTA 3SHLA 4A3EG 1WJ6A 4WAAA 1TZ1A 4G4KA 3HOUH 1Z2MA 4II2B 3R93A 4P1CC 1SFOH 4KZ0A 2JE6I 1PDXA 1FXIA 3RUZA 1Y1WG 2JZ3B 2PE6B 4HSPA 2K6AA 2MJ8A 1BBUA 3JSVB 3RFZB 3DWAA 4JOIA 2IHFA 4A3JH 4JI1Q 4BKGA 3OSOA 5JEAH 2F0SA 2OXPA 3VA5A 1MG4A 4DNIA 2VZAA 2J0MA 4CJ1B 5DM63 4H44C 3VXWA 4KGRA 3HOVB 2RR9A 1EU4A 2ZJRA 1FO4A 2MBEA 1SIFA 2FXQA 1I50B 4QF4A 4UDUC 3AXCA 1MI2A 3AE4B 1TT5B 4DR6Q 2KCTA 2KC1A 2F0HA 2V4LA 4P7IA 2BYEA 4XT1B 2WX0A 3BDCA 1G6JA 1JORA 4A3MH 3TRZA 1DJRD 1KC8C 1YJIA 1E0BA 2OCEA 1WCMB 2CH4W 5IWAQ 4JI2L 3CRLC 1TKWB 2ZJDA 2X69A 4AUQC 4M00A 2Z6BA 3IAYA 4NXMQ 2KNBA 2F0KA 2KVRA 3BK1A 3N20C 4S3SA 2GA4B 3VR3A 1WXQA 2WXMA 4L1BA 2KTRB 2LMCB 4XYQA 4UAIA 2KLCA 1JOQA 5AZGA 1RDPD 5CV8A 2E2HH 3ZUNA 4WURA 1OQQA 3K5LA 3K8AA 2NVQH 1O7ZA 2F4IA 5LMUL 3LJ3A 2BF8B 1YN3A 4M0WB 2WB1G 2NVTB 3CAMA 5C3WA 2J52A 4IALA 2NPTA 2F0MA 4W9KA 1PTOD 1K53A 1T3QA 4LJOB 4FXGC 2XVSA 5T1GA 5H1SE 2MEKA 2OHFA 3S1NH 3GZNI 4ZOHC 1XCQL 1GUGA 2CKHB 3NBHA 1AE3A 2AMCB 4ZLTF 4DV5L 2GBMA 1NYQA 4ZUJA 5FKAC 3A7LA 4DR1L 3UDFA 2DZKA 3BY4B 3DVGY 1LM0A 5EE1A 1F2RC 2V3PA 2PJHA 3HOUG 3CXCA 1HR0W 4C3JH 3PV0A 3H3VC 3AULA 4AP4C 2WAQB 4GS3A 4B6WA 2B63H 1KDBA 3M7NA 2MX2A 4AOFA 1K52A 4DUZL 1PTOC 4DV0L 4TSSA 3A9JB 2ZXPA 3AU4A 4ZUIA 4HJ5A 4A3JG 3K9OB 5GAHC 4ZYNA 2NZOA 4M1UB 5JEAG 3KJOA 1F1HA 2BOSA 4HDOA 2R3ZA 1V8CA 4IG7B 4KGSA 1WGYA 3H09A 4HPMB 1UD7A 2MHVA 4X66L 3MJWA 4K1RB 1NI3A 3U58A 3HVDA 1HJPA 2DJGC 5C4XB 1KH0A 1HUMA 2ZPYA 1XD3B 2NZ1D 2N9XA 1E8YA 3K6OA 2AL3A 1KQSA 4EZJA 3I7FA 1L5PA 3ALBA 1X65A 4A3MG 3BYTB 1T6BX 4IKGA 3E9IA 4KX6B 4LFBL 1RTOA 4ID6A 4MH8A 4JI2Q 1YNNC 2BYTA 2B76B 3T53B 3BG3A 3NG0A 3GO5A 1A0IA 1BR9A 1HZ5A 1QOBA 2ZEQA 1I42A 2EY2A 4YCVA 3UDIA 5EDSA 4M8AA 3QOLA 2KACA 3GTKH 2PZWA 5EKIA 1IL2A 1E7VA 2INPE 1IW7C 3K5OA 3ONAB 2ZM6L 2IO1B 3DEPA 2LJIA 4EFOA 2PQEA 1B8AA 3MTNB 5LMUQ 1LLRD 4UHVA 1QF6A 1O7IA 1Q81C 1E6EB 1B4OA 2MP2B 2AWTA 2ZVNA 2DY7A 4L5TA 3PIO3 1P3QU 3DQVA 3W1BA 4IO9A 3DDCB 1L0XB 4LNFA 4KD3A 4DV5Q 2QC8A 2JXTA 1JJGA 5IYCH 1MI0A 2D2QA 3IG3A 2KFKB 3DBLB 2NZHA 3UI2A 4A3KB 3BIID 4IUTA 4KV6A 3K5MA 1PFNA 4C3JG 3AFPA 2JSVX 3IAS1 3J7AV 2AQ3B 1D1IA 4ZYSA 2B63G 1A70A 1V1PA 1RJTA 5CYUA 4DHJD 4LMQD 5IP7H 4L6TB 5J18A 4DUZQ 5LMNW 2JYOA 2QGQA 1WXAA 2H5XA 1EYDA 4CKBA 1XPOA 1OFFA 1Y1VH 1UE5A 3H0GB 2TMPA 3J7A5 5M3MB 3A4SC 3OAWA 1BBXC 1TWFH 1C79A 4HJKA 1DM0B 1HCZA 3AECB 3TBIB 1N33L 4X66Q 2AWOA 4X3KA 2NN6I 3W3AA 2K05A 1VF7A 3T9LA 2I0QA 1Q90A 4YSYB 1Y14B 3T3OA 4KV2A 1C4QA 4IUNA 1LQBA 5T8IA 2PQAA 4JOIC 1TXYA 1WTWA 2GMIC 4EQOA 4WJNA 5H92C 2V0GA 5KHOA 2M56B 3DHQA 1LTBD 3J7YW 5A35A 4PZ7A 2NUCA 1UEAB 1VQJA 3A8IE 2DNFA 1LTID 4KJOA 2PCFB 1Q1OA 2KO3A 2LEKA 1JCKB 3RLFA 4BA2I 4JI4L 3DVNV 2KQ7A 5BYQA 3B9JA 3I4OA 3OW7A 2I2YA 1AARA 3M95A 5IY0A 3GTQB 3A33B 2K8BA 3WANA 3IBEA 2UUBL 1VCBA 2UU9L 2ZM6Q 1NUCA 4HJ8A 1PYBA 2PI2A 1SXTA 1VRAB 4WIPA 3RZDB 1QQRA 4LNNA 2FNJB 3MEFA 1TQOA 1V6EA 3DBHI 3OYYA 2FCSA 2L76A 1GAQB 2XWBB 4DV6L 1SE2A 4KHZA 3NTHA 3FEWX 3U50C 2XK5A 3TEWA 4K14A 1JWBD 1Q5WB 2OF1A 3CCVA 1B53A 1ZKHA 3CC2A 2E75C 1PZJD 3J80c 4UPAA 1YHAA 4IPDA 1IBLL 4GN5A 3WOEA 3IRBA 2A74C 4HRSA 5IP7G 1AYFA 2RCNA 1VQIA 3HOZH 2BB5A 1EOTA 1N32L 3NVWA 1LT6D 1L4DB 2ON8A 3AI5A 1Y1VG 3DM3A 4JLCA 2WYQA 4R1JA 2SNMA 3Q3NC 1U5KA 1UELA 3KBGA 3VUXA 2IX0A 3I4MB 3S16B 3RULA 4ZKBB 4B0EA 1HH2P 3OJ3A 1Q0WB 1TVXA 4IFDJ 4FJVB 2NMQA 2WV6D 1S5CD 4ARIA 3E5SA 1EEFD 1NMGA 1UWXA 2WKDA 2IL8A 4FXKC 1JWAD 2L7RA 3ER0A 4JI5Q 4PMWA 4GZYC 3W1SA 3X0WA 4BKSD 4KTAA 1SYEA 4P1BC 2IDYA 4LNQA 1GUSA 2NTSA 3NVVA 1QWYA 4KZCA 5CV7A 1NBFC 4D2KA 2K7VA 2F0DA 4P2CB 4L5SA 2DYMA 1JROA 1KXLA 1T0RC 3TZDA 3OIPA 5CV6A 4RF0A 4MEMA 1LTRD 3RUIB 2V3NA 3WOFA 3EN2A 1Q46A 4II3B 4RWSC 4P6VF 3T51B 3HM6X 1CFMA 3AEVA 4KMUC 3SHQA 2I1JA 3U30A 2L12A 2KA7A 3JSVA 2JA6H 4IPHA 5G5HA 4P74A 2RCFA 1SNCA 3RNAC 3GTJB 3IXSA 5CV9A 5IYBH 1B1ZA 1W3SA 3IFWB 3B6YA 3A7AB 2DZJA 3I72A 3G4SA 2KQSA 4TUUA 3VR8B 2K5VA 4KKUA 4DR7Q 3Q2AC 4HDQA 3Q8EA 4DV6Q 1KIXA 3NRZA 2SOBA 3L0WB 1JB7A 1EY4A 4AYBB 1PTOB 3QARA 3CC4A 3AYHB 3QQ8B 1RD9D 3N52A 2IGDA 1YN4A 3FAHA 2VNUD 3I4NH 3S2DB 1FL0A 5FR3A 1N8RC 2Z6KA 3RNGC 5M5XB 4QIWB 2RD0A 2ID0A 4O2DA 1B7YB 3HOZG 1BF4A 1O7LA 1WYGA 1S5BD 4YHHL 1VQNA 3CRKC 4HXDA 1HEZE 1OXTA 4QB4A 2LFIA 4B3SQ 2VUMB 4DKAC 2HCCA 3OJ4B 1LT5D 5AZFA 1FVIA 5FOBB 1RHPA 5KYLA 2D3CA 4M0WA 3MC8A 3GB1A 1B3QA 2QKIC 4MNOA 1K83H 2WXRA 4MT5A 1Q1EA 3JAMi 1WFQA 3C1EA 2FINB 3PO3B 1XX8A 4ZRZA 4PMCA 2VRRB 2D2CC 2BT6A 1SNPA 5M5YH 2HTHA 4W9HA 5BN5A 3HKZB 1GO3E 4HPLB 2VQFQ 1BUIC 2PZTA 5COYA 2Q2TA 1JR0D 2KVMA 3V6CB 1JOKA 1TWHH 2PO4A 2MH7A 2F0QA 2K14A 1QCBD 2B2TC 2MPMA 1P9DU 3A9JA 3VQIA 1KRSA 3FKIH 2WIIB 5IYBG 2KFJA 4R4IA 1DOMA 2SEBD 2G4SA 4E6IA 2RF4A 4RKBA 3CC7A 1RRBA 1L2FA 2K4KA 5IODA 2B2UA 3W5OA 1CSQA 3UE0A 3STBC 2BH8A 1PGAA 1GJZA 5JVG3 4L2YA 5EPJA 4PZ6A 3QK0A 4ME5A 1W2BA 4P73A 3FHWA 2B29A 2DUDA 3HOYH 3I4NG 1E5WA 1LTLA 1XPRA 2LGXA 4MM3B 2KHJA 5BMGA 3LB8C 2Z4HA 1R9TH 2BGFA 1SE9A 2DZIA 2K9XA 2R92H 3ML8A 1XMQL 4YHHQ 1FXAA 5FLXL 4PS3A 2ICIA 3SEBA 3E9SA 1KD1C 2C5CA 2K8HA 3N6RA 1UWVA 1A2TA 4DAYB 2O2VB 4J3OD 4DHJB 4HIMA 3TEZA 3A0JA 4HEDA 1X1MA 4OZBA 4BBNC 1T5XD 4HK2A 2INDC 1RKNA 4BBRH 2B8GA 3S1QB 2MP2A 1D6EC 4A76A 5I6YA 2CJOA 2B39A 2KOXA 1WXMA 3M9BA 4CGYB 2ZW1A 1FD7D 2KDFB 2WS3B 2BH2A 2VQEL 1KTKA 1ZPSA 5ELOA 1OGWA 1EIFA 3I4LA 4IC7B 2N9PC 1EU3A 4WORA 1UWMA 4LF8L 4IM2A 3LX0A 1UAPA 3M4OB 1D5MC 1TWGH 4P71A 4FNFA 4G3XB 1CHQD 2GBRA 3W1SC 2AKWB 5EKKA 5CHWA 4BOZB 3CPWA 1ISNA 3AE7B 1E2VA 3FKIG 2HT1A 2LHDA 5C3JB 1TTNA 3WWVA 1WZ0A 1R4MI 1G91A 3PLVA 1STNA 1EIYB 3VYRA 3P20A 4DV1L 3A9KB 4JBWA 3E56A 3G6JB 1NCVA 2RDHA 3MVVA 3S1MB 2KC2A 1EYGA 3L0OA 1U9RA 1VQ6A 4DBGA 1UE6A 3UE1A 4C56C 1F9JA 3E3XA 4A3PA 1TS3A 2N0SB 4ZK9B 3GTMB 2Y5BB 4KKTA 5DPWA 1BUVT 3GTLB 1MVKA 3HOYG 1QJOA 4HIDA 3UDGA 3A5ZB 2V1CC 2KHIA 1LFDA 2QEXA 2CJNA 2R92G 5M5WH 4F8MA 2LGIA 3NS1A 3CHBD 1P16A 3IT4B 3J7AF 1CZPA 3EFXD 2M9VA 4R4QA 2BS4B 2KJ6A 5JZEB 4OX9L 2MW5A 1K28A 5IP9H 3TREA 4A90A 5JHAA 3PIPA 3AFQA 1UF0A 3VDZA 5C3EH 3AEDB 3S15H 2Z6KC 1YN5A 2CW0D 2PE9A 2JQOA 4MN3A 4XT3B 4A93H 1OXXK 1PV4A 4BBRG 3CQZB 1K8RB 2G3QB 5LXIB 2CWPA 4WJ3M 1DONA 3T1YL 4C3IB 3U4ZA 2AL6A 4BY1B 1I4PA 4A8XC 2Z0EB 2X8XX 1CK1A 5JPMC 4C1NI 3M4OH 4LNOA 1EOVA 1EWIA 3KJPA 4WJQA 1H4RA 3RT3B 3ZVVA 3DOWA 3EECA 3OWEB 4HCNB 4ZAIA 4GGQA 5CHFA 4ZRIA 4FVMA 4DNRB 4ZHPA 1NAPA 1T5EA 4BY7G 2NVXB 2KCNA 1E0ZA 1PRTD 3L2PA 3M3YB 4LF9L 4I6NB 4LNKA 1BQQT 4YIJA 4G7ZC 1WY8A 2R7ZH 4B3RL 2N4FA 1XF5L 4DR3Q 5TR5A 3IKJA 3KLRA 2AQ2B 3HM3A 2WX1A 1QG7A 1VQEA 2CVRA 4KN7C 4BBSB 1MFWA 4A3EB 2C7NB 2CHXA 2BDNA 4EQPA 3VA7A 2H88B 4EZLA 4US8A 1J7AA 1E10A 5C0XJ 1WJJA 1JMLA 1IKLA 1I6VC 4CJ0B 4DV1Q 2MJ3A 3KVFB 2WKCA 5C1ZA 2XRQD 3H7PB 1Y1WB 2L15A 2JA7H 2JYEA 3E0EA 4F87A 4AQYL 1WTXA 1VLBA 4OZAA 1A6XA 3Q8FA 1VQ5A 4QUCA 2QCPX 1OEYA 5EBCA 2O2LD 3DUZA 2L8JA 3T13A 4OO1I 4ACFA 2GOWA 4A3FB 3A1QA 2PTLA 1A3UA 2Q2HA 3AH7A 4PYZA 3KLWA 2B2UC 2QDBA 1HNZQ 4CDCC 2Y5CA 3LDZE 1D5ZC 1PDQA 4NNJB 2D62A 4MH0E 4IPGA 3SK4A 2Z8LA 4E71A 5KEEA 1J7CA 2EKIA 4OX9Q 2F0WA 5IP9G 1A62A 3CQZH 5LHY1 3AEEB 2WWZA 2UUCL 5C3EG 1HE8A 1EL0A 2LRUA 3HIZA 5IN7A 3MHZA 4DAMA 2L1BA 3AM9A 2LKVA 3QJYA 1NTGA 3S1RH 4A93G 2L1AA 5IAAC 2VW9A 3E0JA 3AE9B 1B9MA 2VY3A 3P4RB 2PVGC 2BCOA 5KIXA 2QDFA 3T1YQ 2B2VC 2L9HA 1EQRA 1FNWA 1PFSA 2A68D 2JJQA 5I2YA 1QKZA 3Q3OC 3ZQ4A 2BW2A 2XSCA 2UWQA 4ZHOA 1GUTA 2L55A 4RHRA 1EFWA 2R61A 4IQZA 3M3YH 2LVOA 1FCLA 2WDRB 4GOPC 2WB1B 1C3TA 2MWSB 4JI7L 1WTVA 3VR5A 3I3CA 4C1NK 4QAYA 4IOIE 4DN4M 1E22A 2F0GA 2QA4A 1A2UA 1CKMA 2Y0SB 4J1MA 3L08A 3MC9A 1I7HA 5AFWA 2R7ZG 4DDGD 5HI1A 2CU3A 2ASBA 2JA5H 2LVPA 3ZJYC 2A68C 4DUYQ 4JBMA 2HCIA 1X3QA 3HOUB 2BWFA 4XTCS 4TQUS 1SFOB 3DBSA 4U68A 3CMEA 1EF5A 5TSSA 3EUB2 2JA7G 3V61A 3J81j 4ANUA 4A20A 5IO9A 4X65L 4AQYQ 4A3JB 1H9RA 4OGQC 1QNUA 2KECA 1PH4A 4JI0Q 3TMEA 5DPTA 2N49A 1FPYA 4AJYB 5JJIA 1SR3A 3TCAA 4QGUA 1CTMA 2R2OA 2FIFA 1QZHA 5IYDH 3DPDA 1OXSC 1XXGA 2RHSB 3RNBC 1IUEA 3D8GA 1HNWL 2KAJA 3SGIA 5J39A 3DBLI 3NJTA 4IWPA 4GKKL 5DPRA 3Q6SA 2Q5WD 2HUGA 2G9DA 4DV4L 2F1MA 2X38A 3B1LX 5CORA 2XIWA 1IHZA 2L00B 1WRDB 3DBRI 1VQPA 1ICFB 5T1IA 3NUCA 3NP8A 5EJWA 4XYOA 4A3MB 3Q69A 3ERSX 3QA8A 3VTWA 1P8LA 4Q5VA 2CHWA 1V8QA 2NTTA 4O0AA 2SNSA 1N63A 2ES2A 2UUCQ 3IT6B 4WQMA 2WGSA 1TY0A 1RF2D 2K8CA 3QAQA 1SE4A 2LWPA 1E1OA 3VDYA 2JYTA 2WQYB 2LXCA 3PIP3 4I65A 4CKEA 2DAFA 3CCEA 3FILB 1PH1A 2E2HB 4ANWA 2EJFC 4KSLC 1YZ6A 2HIVA 2NVQB 2QEJC 2DENB 4JWSC 4FADA 1VF5C 2B3AA 4JI7Q 1IL8A 2A69D 4GLVB 1KLGD 2KN4A 2DAJA 1TJEA 4MM3A 3ZXRA 1V43A 1HQMC 3S1NB 1YVCA 5E4XA 2A8VA 1Y8NB 3SDLC 2Z1CA 2I5HA 3H6MA 4IM3A 4R4TA 2JA5G 5EKLA 4I6PA 1SEBD 4N8FA 3U9OA 4IW0A 4LF4Q 1KLUD 2BWES 2KOLA 1AW7A 5IGDA 4C3JB 4W9EA 3RMKC 2O2VA 3ZNGC 2J42A 5BO4B 4B9KA 4DDID 1SGHA 2ZVOA 4JL9A 5J17A 2B63B 2M2LA 1K0RA 1KFYB 2L0TA 2WDQB 3MZ5A 3SFDB 2A69C 3HRDD 4K6LA 2MBBB 5JH5C 3Q8CA 4WRDA 2E5LL 1S3OA 3M85A 2A6ED 2RBMA 2EY6A 4X62L 4G7HC 1YX6B 3NXWA 4BFRA 5IYDG 2JSOA 5C4JH 1IBKL 2C7MB 3NVYA 3P4SB 5E7NA 1VMCA 3RN9C 2AQ1B 5JEAJ 4H02A 1HZ6A 1CKNB 1HNWQ 5I2XA 2SDFA 2IO0B 4B95A 2I5LX 5ELDA 1WGGA 2FJ2A 3NPPA 4WWMA 1DZ1A 1LTSD 2C9OA 4A3CH 1WIAA 2LI5A 1K3BC 2EYJA 3S24A 4MHEA 4KSKC 4W9DA 4JI6L 1GPXA 4CDFC 3RR5A 3M3JA 3GP7A 4YWLA 2WXKA 1KDAA 1WR1A 2WINB 1R4NB 2HTME 2M17A 2G9HD 5BYSA 3G71A 1I4QA 3MC0B 1CQFA 4GU2A 3AU7A 4DV3L 1BO0A 1QZGA 2RMMA 1MD2D 3A9KA 4MJSB 3EGRA 2J7ZA 4X3TA 2F52A 3W1YA 2WU2B 4HCPB 2IX3A 3VH4B 4FBJB 3GTKB 4HR7B 1FNUA 3GTGB 4R4OA 2RDFA 1L7YA 2WLBA 1WZ3A 1G8ZD 2QW7A 1D8LA 5KNDA 1ASYA 4A3DH 3PTFC 3U9SA 2JRIB 3I73A 2EVBA 2ZNVC 1GNUA 1VQFA 3MP9A 4NQLB 4AIMA 4DAPA 2PPHA 5D3DA 4TVAB 2BB6A 2WXHA 2MQHA 1P0RA 3H15A 2INNE 1J6QA 1J9OA 1MSGA 2PNRC 4OIJA 4R3DA 1IGCA 3K0XA 3GQBA 4YCWA 4MGYE 1ENAA 1PRTB 4BA1I 3HGBA 3PMFA 2MRPA 4JV5L 3KWLA 4G0NB 4RF1A 4DV2L 1SJHD 3VR2A 4CHKA 3F2CA 1G6PA 1MIUA 1AN8A 3NQIA 2XGTA 2OEOA 4DWFA 5BMIA 2LXKA 3VYUA 4IUPA 1K73C 1YQ3B 2RPQA 1SN8A 5IIFA 1F2RI 3OLMD 4FHKA 1RFKA 3DWMA 1MJCA 3H3VI 2E5LQ 3D32A 3BZCA 1Y1VB 3LYYA 2YTYA 3J80i 2KDIA 4X62Q 2INCC 1TWFB 2XN9C 2XRSD 1X56A 2LY7A 3KF6B 4N9PA 1IBKQ 5GAEC 1S5FD 1ONLA 4EQ5A 3NZUA 4I7ZC 2F4VL 3S17H 1YJJA 4L63B 3FPUB 5ELNA 3RN5A 1WXSA 4A3CG 1SROA 2D3GA 4MELA 2RHQB 4MTNA 4FP5D 2H4OA 3M4PA 5LL6S 3VTVA 4A3BH 4MACA 5IOIA 3VAWA 3T3NA 3F2BA 2LFNA 2R93H 1ZXIA 3PREA 2ALYB 4KGTA 3M4QA 2D11A 2N7EA 2IW3A 1KAAA 4IZ8A 1KRTA 3GTGH 4GOPB 4A6QA 1K50A 2GBNA 3L16A 3L4PA 2KK8A 5I9OA 4R9WA 4F7ZA 3H7PA 3KUPA 4DV7L 3MXNB 1S1QB 2IBIB 2O5IC 1XO3A 3N9YC 5CC4A 3M63B 1IYJB 1HQRD 1SMXA 4JGHB 2Q2UA 2MA9B 4NAWB 4A3DG 1VQLA 2LGYA 1TIID 4CHTB 3IFDA 4QJFA 2MJDA 1SBBB 2KLGA 1EF1A 1YX5B 4DR1Q 1JQYD 3HVZA 1AEXA 1PLFA 1EY0A 2PI2E 1AE2A 3HRZC 2MJEA 3M62B 2WXGA 4KY7A 5KHQA 2GVBA 3N1YC 4DNTB 3VR6A 4K2KA 1KJTA 2LUMA 4GOCA 2WFWA 1STHA 4JV5Q 4DV0Q 4DV2Q 2A19A 3Q0AA 1NMFA 4OO1H 2EYLA 1GB4A 3RN2A 2F0UA 4B9XA 4ANVA 1XLNA 4KKIA 1UE1A 3HOZB 5E6OA 2D3AA 2CWAA 1ASZA 2JEBI 1WE7A 3Q3JA 4W9FA 2WP8J 1L0YB 4FF1A 4C4VB 3KLSX 1FRDA 1WYDA 5FO7B 2HJ8A 1BCPF 2NBUA 1EZ8A 2I38A 3Q8BA 1KM7A 4XYCA 1ILQA 3NOBA 1UZXB 2B2TA 3AE5B 4EOYA 1N5XA 5ELEA 2J4XA 3P1HA 1VQDA 4IDIA 5M9OA 3D3RA 1R4PB 4LFBQ 2K01A 2RDGA 3BU2A 3FVQA 1Z5SB 2GN5A 1PH6A 2JXXA 4IPCA 4ZRKA 4MGIE 5JAVA 1TWCH 3A55A 4KHPL 5HG2A 1U0LA 1L0WA 4A3BG 2O4XA 3KK7A 2KWDA 2E3TA 2R93G 4FJZA 4TMAB 2D3BA 2KMAA 3CMMB 1WCMG 2J0JA 3K7UC 4KD4A 4YSXB 2RVLA 2H89B 1GUOA 5D7GA 3OW2A 2JA6B 2K1FA 4C00A 1S4ZA 3BDLA 2K5NA 1U4PA 3KBXA 1TT2A 4XXEA 4LAAA 3MFGA 4WWPA 2DGYA 2W54A 4DR5L 1A5RA 5HY6A 3KLSA 3AEFB 3CIRB 4MGKE 4OWXB 1Q12A 2E2IH 3BK2A 3Q6BA 4W9GA 4TKNA 3HOXH 3X3MA 3SFEB 1S72A 2WDTB 5IGCA 2JA9A 2N7DA 4PG3A 1XQQA 2DWQA 4XDDA 1T0YA 3EJIA 1ML0D 1IGDA 1GB1A 3APDA 4RAUC 4NB3A 1IYUA 2UXBL 2EIFA 3ZKJC 1O78A 4AS1A 4KK7A 5C0XI 3DHHC 1CT1D 3WA0A 1OXUA 1PZID 3R66C 2EPBA 3I4NB 5E1FA 4YTPB 1PRTF 1EM7A 1PQSA 4OO1G 3LXFA 1CZGA 1TZOA 2BPSA 1HNXL 4LTUA 1K8OA 1CI3M 2K5WA 4KN4C 4B3ML 1AZQA 2D07B 1CJEA 1PMRA 2MO0A 5KGUA 1N33Q 1M90C 1H95A 3U52E 2KHSA 3KUDB 3OPOA 3WAPA 3GTOH 2NVYH 3FILA 3PGEA 2W3SA 4MZ9A 1MGSA 2NBFA 2AYOB 3H6NA 2IYDB 3U4VA 3NS8A 4NZLB 1PFMA 3TQYA 4FYDA 1K83B 4K6DA 1SLJA 2IGGA 5C4HA 2WXOA 1XNQL 5FLXE 3MXGA 3CWIA 4YSZB 3CP0A 3QCAA 5KRUA 2Q8IB 1X3EA 4JI4Q 3ZJUA 3ETRA 1J8CA 2HIXA 2ASQA 2DBYA 2EELA 4NPSA 2EYFA 5M5YB 2YYZA 2WHIA 1WFYA 3CSFA 1Y56A 3SK8A 2I46A 3ZNZB 4HN7A 2EXZA 1VQOA 2UUBQ 4JW0A 4J8QA 2UU9Q 3ABVB 1TWHB 3ZXVA 2ZNVB 1NI2A 1NY4A 4YCUA 3O13A 1D7QA 2VH1A 4ZQ3A 3EFCA 2BVCA 4TQ1A 3PQIA 3FKIB 2AUKA 2EDGA 2KQ4X 2WAQE 4LUOA 2MCNB 1IBML 1S5ED 4BS9A 4DR5Q 1CZWA 3PRMB 1ZEQX 4OVUA 5G5GA 5CTRC 2N9KA 2VH2A 3HOXG 1HTLD 4N8X1 2RPVA 2L0CA 1CKNA 3BJUA 1YHQA 2HDEA 3K58A 3O65B 4WWOA 1F2LA 4IUVA 3NQTA 3QIJA 1SAPA 2L5TA 4MSQB 3ULPA 4JWUC 1PH8A 1DOLA 1II3A 1HTOA 2KEEA 1BVSA 1IBLQ 4RM8A 4ULLA 3RI7C 1C77A 1EYCA 3FPPA 1SYFA 3MXPA 1HR0L 4JYAL 1LO5D 3PSIA 1MJDA 1MPEA 4FO2A 3HOYB 4HROA 4PS7A 1JWSD 4AH6A 2BQQA 1QVGA 1N32Q 1VQ4A 1HNXQ 2KTRA 1R9TB 2JK8A 3K0YA 3NWSA 5IT9L 1VJKA 3ITPA 2LMCA 2V1YA 3D31A 4B3MQ 4DGZA 4QUFA 1WTRA 2R92B 5CGKA 1V1OA 1JT8A 1WJ4A 4GN3B 2REXA 2V9HA 1NEKB 3JAML 4XWTA 1LTGD 3E6ZX 3KYDD 5D6JB 3AMZA 4J6IA 2B3GA 2N3SA 2HD5B 2CQAA 5BR8L 3PF5A 3PSEB 4PT5A 1F9RA 4IUMB 2UXCL 3OMGA 4BAXA 1Q82C 2B2YC 4BBRB 1X55A 5IGFA 3LWUA 4NJCA 3QX1A 1D5XC 1EQVA 4USAA 4GLAC 4G57A 4CO7A 2N9LA 3B2GA 2RQXA 3ZDTA 1QUQB 2YTXA 3F2DA 2OJRA 1C9FA 3I70A 3I5JC 4DXAB 2N55A 2NYZD 4KJNA 3GTPH 4RA8A 1GVPA 3I91A 5GMVA 2Z0DB 1F9PA 2K5HA 4EVOA 1SJED 1TWGB 3P4QB 3MXUA 3TEXA 4HIKA 3PZ7A 1M4VA 4Z9CB 5LNK1 4HAEA 3A4RA 2C7HA 3OHXC 3I8ZA 3LGJA 2EMSA 4B0MA 3B0AA 3L9AX 2EMTA 4FULA 1ZYRD 3KF6A 3PUYA 4UP8A 1R7SA 1JJ2A 4K7WA 1RTNA 3QHTA 1P7EA 4OVVA 3UIPB 3QIAA 1GHKA 1I4RA 1ACCA 2EJGC 3Q3FA 4LUZA 2WXJA 2LXAA 2KN5A 1QVCA 3R7RA 1EQQA 1W6JA 2F0LA 3S14H 3QJZA 1UBIA 2OEDA 5IOCA 3CCUA 3ZYYX 2B2VA 2F0VA 1TU2B 2EXDA 4FJYA 1HUNA 4K7SA 5IE8A 4JI3L 4IJLA 4GDLB 3GV3A 4YWKA 4GOPA 2Q8RE 4N9TA 1SYCA 1PXUA 5ISRA 5M5WB 4Y7NH 1B2TA 1AZPA 1VQ8A 1B3AA 1WXVA 3MXNA 2NB0A 5J1ZA 4HWIB 4LJZC 2A4ZA 1YD8U 1M94A 2KD0A 2K28A 5AZHA 5C3EB 3T8MA 1TKEA 3S15B 3C0RB 4NAWA 4A93B 2YVCA 4FF4A 1W6KA 4M8NA 2E8GA 5C44H 3AN1A 1EY5A 1XYIA 2I5MX 2LS01 4GB9A 2W9NA 3TDQA 5M3FH 2KFKA 4OVZA 4ICVA 4JE3B 4BY7H 2PKOA 1KNAA 1NNXA 1WTPA 5HHDG 4OXPA 1J5EL 2EE1A 1GHJA 4HKQA 4K0KL 1NDDA 2F0IA 4OW0A 1UGMA 4I7AA 3WAOA 2K32A 3UF8A 2XEWA 3RD4A 1LT4D 2ATWA 2V4IB 5JOBA 3D0FA 3DBHB 2FMMA 3DHGC 5HGQA 1S5DD 2KMCA 1XEEA 1V49A 2Y3AA 5CV4A 3ZRFA 1U4AA 2YU9H 1BCPD 2LD9A 3UQBA 2R7ZB 4JC0A 5DLQE 3RNCC 3TJPA 3PGZA 4Q2JA 4JBJA 4OIKA 2X6LA 3TIXA 1PVOA 1AP0A 4C4VA 2C9WB 4EX5A 2XBBC 3FC4A 3CD6A 1WGDA 2UXDL 4XDCA 4DQOC 1NR4A 3Q24A 2QJLA 2PMZB 1Q8KA 2LXJA 1C4CA 4A75A 4N58A 2JA7B 3K81C 4PZ8A 4DHZB 1B50A 1QT9A 4JIOU 1YNTE 1RCVD 2YEPB 3APFA 4LF6L 2K33A 2O6VD 2IY1B 1Q7YC 1WM2A 1BCPC 4W9JA 2NN6H 2LGDA 3WALA 4P16A 2E2JH 1V5TA 3NTIA 3KF8B 1T0SC 2E74C 1XMQQ 1X3FA 3DMUA 4KKJA 2LSSA 5E6PA 2JXMB 4HSVA 3MEHA 1X9NA 3U8ZA 3T1HL 1XTDA 2NPTB 1A15A 1CQVA 2IJ0A 1WD1A 3NENA 1M1KC 3QO2A 4JI3Q 1UUPA 1C78A 2G4DB 3SXHA 3HZXA 4BXXH 4GLSC 2CCZA 3U7DA 3U2SC 4YTMB 3KDFB 1ZE3D 1X3GA 1VZ7A 3MAQA 3K7AH 2DHZA 4GDKB 1X54A 2E2DC 4ZRPA 2KCCA 2D0OA 2JZPA 5LXHA 4KDIC 3JAMc 2WXQA 3ZJTA 5D2MB 3APCA 5DAUA 4G50A 3S1RB 2D0PA 3FP9A 2VQEQ 5C44G 2SAKA 3IHPC 1QLBB 2MUYA 2BDOA 4YWMA 5M3FG 3QG1A 1I3QH 2CR5A 4XIGS 4XGAB 4LF8Q 2G5DA 3ND8A 3I56A 4HCEA 2CW0C 4HTHA 1TBEA 1IYFA 4K0KQ 4NKLA 1VMPA 3JC66 2C35B 1P1AA 1R4NI 1F9SA 5EPLA 4DK1A 4AYBE 4WH4A 2R2QA 3MTSA 3Q22A 3LNNA 1I35A 3Q3MC 1FRRA 3KYHC 1VZ6A 1C8CA 4G11A 2JA5B 4E3CA 4KLKA 1L1OC 1SE3A 4K5XA 1XT9B 1PUTA 1WD0A 2N9EB 4LF7L 2UXDQ 2IY0B 3DXJC 4QIWE 3PF4A 4Y52H 1PRTC 3TP6A 2PLPA 1WYWB 4XQJA 1WTHA 3GDEA 1L0VB 4MTKA 4OWTB 3NELA 4A3GH 2N1VA 4LF5L 1VQKA 2RGFA 3DVNU 2PIAA 2L4NA 1WI0A 4IN3A 4N59A 4LF6Q 4CJ2C 4RFBA 3BYYB 2LRWA 3HFZB 2NN6G 5EAYA 3TZUA 1L6UA 1LACA 1CUKA 5C6AA 1JE4A 1ICWA 1R4QB 1Y8OB 3DWQA 3FDTA 2CS4A 2FIDA 2WXIA 5LLIA 1MJEA 5FLXc 1VD2A 2XWJB 4BXXG 5H8YE 1JQ4A 2K03A 1K8AC 1BXTA 2HDLA 3V05A 3C46A 2ZJPA 3UDXA 4NW2A 2JA8H 3HKZE 5AUKA 5E3FA 5GROA 2EQSA 2Z4IA 2WXNA 2KX0A 2K3UA 3Q14C 3PUVA 1Q8IA 1KAWA 4DR2L 2GB1A 4MSMB 1QVFA 3ULJA 2HQLA 5BN4A 4A3IH 3I2ZA 3JVZX 1V1PB 3CCJA 1O80A 1WR6E 4F8CB 1BKBA 2KWCA 2ONQA 5F2DA 1VQMA 2G45B 1RYJA 2WXLA 4F7XA 1J8IA 3VYTA 2R7DA 3PO2H 2F0JA 3J81L 1AWDA 2HQEA 1TKYA 4LF9Q 5JJKA 1C7YA 2FCQA 2FCMA 2LVQA 2F3WA 3PS6A 2VZKD 2PW7A 4U673 1EWCA 3KUCB 3ERQA 3SK6A 4B3RQ 3L3OC 2F0EA 3LWEA 1WRIA 3R3MA 1TS5A 4H2AA 1XNRL 4R4CA 3Q23A 2L52A 4A55A 4IOCA 1DOKA 2L11A 3A5UA 2M00A 1QOAA 2KJHB 2EZVA 1E2WA 3D6WA 4KKSA 1QILA 4YY3L 3RZOH 2KT7A 2ICEC 4DR4L 2CU1A 2LGSA 5L37A 1N9WA 1RFAA 1SNDA 1GC7A 4S17A 4JBKA 3DVGX 1Z6HA 1I4GA 2WXPA 4A3GG 4C2MH 3BDOA 4LF5Q 2IHEA 3TMPB 2DJFC 1YBYA 1HZBA 1XMOL 3WAMA 2YEPF
chains in the Genus database with same CATH topology
5C4JB 4H13C 1U4RA 1AFPA 1FFUA 2E6XA 4L23A 1U4LA 4PV1C 1CA6A 2BS2B 1TYGB 2LHEA 5KNCA 2CHBD 4IFDI 3A54A 5HURA 2FE8A 3QOJA 1FD6A 1ESRA 1CA5A 2GRIA 2L32A 4LLGM 2A6HD 1G2TA 5CR3A 5A2QL 1GOZA 2KUMA 5ELCA 2JX5A 4C3IG 3KWVA 4A3DB 1EYAA 5CV5A 1OO9B 3PUWA 1KF6B 4DU9A 1Z7TA 2R6GA 3AEGB 5C2TB 4YT0B 1IKMA 1D2BA 1SNOA 1F77A 4DAYA 2A6HC 3AV8A 1XLQA 5JPNC 1PGBA 5EPKA 3BVMA 3HG9A 1BCPB 1GJXA 4DFAA 2QMTA 1F9QA 1DCZA 1CHPD 1FM0D 1PZKD 2JU6X 1ENCA 1EIHA 2AUJD 1P7FA 1SB3C 4QCLA 3VYSA 2H1EA 2AWNA 5C3XA 3DEOA 1MBYA 5IGEA 1C76A 5FO8B 3S17B 2WP9B 4OL7A 4RGNA 3HUIA 1XCTL 2A6EC 4H7BA 5K5PA 5IGGA 1SMYD 3T4AC 3MHZA 4CBVA 4A3BB 2EYPA 4EGVA 2R93B 1PFDA 5KYIA 1A3TA 1B9NA 4RKLA 2B2WA 2I07B 1SSNA 2WDVB 3T56B 4NAMA 3OWFA 1X32A 1EY6A 3WDNA 1JALA 5FK9C 1STBA 4HMIA 1SYGA 3X3NA 5D65A 5I6WA 1E7PB 1SMYC 3M4YA 1C4PA 2EYOA 2F0TA 1SYDA 4K2LA 4QMGA 3C2PA 4IUQA 3KF8A 3S9WA 4HEA1 3AB5A 1EWHA 1X3PA 3BVZA 3PZ8A 1HTPA 3ZGZA 1BNZA 3CU7A 3J80L 2PPBC 5MPOA 1GUNA 3DWGC 3BVGA 2M0AA 2F0FA 4RGTA 4N6EB 5JVH3 4C7YA 5HGTA 1NR2A 1YNND 1ZOYB 4JK1C 1YMHE 2PW5A 2JEAI 3C8YA 3C1FA 4PMBA 3DWPA 3BWUD 4HJGE 1TWCB 3FMCA 3TEYA 4C3HG 4ODGA 1K8MA 4YTNB 1IW7D 3D4RA 1UGJA 2N7JA 1L6VA 4XE0A 2PW9A 3R8BA 1SIJA 1BOSA 1TKGA 1IBXB 3NBIA 4WAFA 4BWGB 1ZUD2 4X3SA 3A56A 1Y8PB 5DEHA 4XQNA 3IL8A 2E2IB 2QILA 2Q8TA 3NE5B 3HOXB 3OOCA 2KEDA 3W2DA 3AMUA 1WTQA 3SDZA 2VZKB 2A5HA 2J53A 3L7ZC 2D5DA 3UI3A 4CQNA 2B2YA 2BE5D 2RSOA 4RGOS 3TUOA 1EIGA 3URYA 1EWYC 4HKZE 1ROEA 1XTCD 2NWGA 3IAM1 4C80A 2XNAC 1FEHA 4KHVA 1H9KA 1KRHA 1O7YA 5CBAE 3GTOB 2NVYB 4X3UA 4K8IA 2JWUA 1FCCC 1VR9A 3RPFC 2EYHA 2BE5C 5IT9E 2WU5B 1DOYA 3A8JE 4EQNA 5BYRA 1N5WA 4IURA 3JAME 1ZDXA 4US9A 3I90A 3P7JA 2F3VA 2F03A 3MJ5A 2VXWA 3CKIB 4NMZA 3NHHA 1HPCA 3I9V1 5G3LF 2ZXRA 4WFN3 4REZA 1H9JA 4C7ZA 3EROA 3BZDB 2BA0A 4TKOB 3J9CA 2IWHA 1V97A 1EFID 3TP5A 1PGXA 1A3VA 1TS2A 3P75A 1NYRA 2KDMA 2K0PA 3W5UB 2B2WC 4Q0FA 4L8JA 2VB2X 3AEBB 4ABNA 4OZCA 1SF0A 1ZXHA 5BMHA 1I4HA 3D4WA 3K59A 5K36H 5EGTA 5IGBA 2O5JC 4TRDA 2FMCA 1JWMD 2W82A 1Q3LA 1WGKA 1ZKOA 3OIQA 1DD2A 3VR9B 2RKSA 2D9UA 3K5NA 4IFDH 3PUXA 4XQQA 3BS1A 1QOGA 3AE1B 1GXDC 4R8NA 1ZP0B 4RH6A 1QOHA 1L4ZB 4YWGG 1H9MA 1JWUD 4WJWA 1FR3A 3PUZA 4G7OC 2TSSA 4FF2A 2EJMA 3GTPB 3AE6B 3R3OA 5C4ZA 4ITKA 3HEJA 1WTOA 1QNKA 1EZ6A 1JICA 1I6HB 3NVZA 5JXVA 1TR5A 1Z47A 1ILPA 2KQ3A 4FXDA 5J22A 2G1EA 1HA6A 4V0BA 2F0OA 4OHJA 3GD7A 1EY9A 1F2ZA 1H9SB 1FGBD 1KDCA 1EQTA 2JQRB 2HDMA 4ZKCB 2DYOA 3MFYA 3S14B 2QIEB 1N62A 5K36G 1Y69U 1SDFA 2ACZB 1JC7A 3ND9A 4HMJA 1LV9A 1UNSA 1HFNA 1B44D 4Y7NB 1STGA 5LL6X 1E2ZA 4IFDG 4NP5A 4DF7A 3HS0C 1STEA 1Q10A 2OT2A 4F88A 1RODA 2N88A 1OXVA 1EEID 5C44B 1JW9D 1YNJD 3MA2B 2WACA 5M3FB 1SYBA 1SNQA 4BY7B 3NSWA 2DLBA 3V2TA 3TN2A 3MWYW 5EBDA 5C5MA 5KNBA 1QE6A 4JPSA 1VCIA 4DAVA 1G291 2F0NA 2DY8A 3WCQA 4CKCA 3SR6A 2YU9B 1QOFA 2EOTA 1YNJC 2IX1A 5E4WC 2ENBA 4DK0A 2KJXA 4DXFA 3DM1A 5HFYA 5EE9A 1FMAD 1JRPA 5FO9B 4LK1C 1PFBA 1I4XA 1ENFA 1XWEA 1WSPA 4A9AA 2FBWB 3K57A 1RM6C 1PTOH 3RMHA 2BBCA 1MHXA 4AQ7A 3G7LA 1EY7A 1ZYRC 2E2JB 3B2FA 1BMLC 1B9RA 1IYVA 2K5QA 4KI0A 1LT3D 2DN8A 3HP3A 3W9CB 3H91A 3K7AB 1IBXA 3VR4A 3C3LA 1HXYD 4RNAA 5EE0A 1ZDVA 2PYKA 3NZ3A 2EY5A 1I3QB 2FHTA 1NSNS 1C48A 1HA5A 1VZ8A 1XLPA 1ET9A 4RGMA 2A73B 1F0ZA 1DXMA 4K5VA 5BN3A 3P1MA 2FFKB 2J0TD 3KQ4A 3J81E 1ET6A 2K5DA 3EA6A 4A3GB 5JJZA 2KMMA 1WVLA 1HFGA 3U4EG 4KY5A 4V190 1EY8A 1JOOA 4YXDB 3VRBB 1KABA 4DXGA 2BS3B 3MHBA 5G3LD 4ZRQA 3U7ZA 2PZUA 2FUG1 2K22A 2X6GA 1MHHE 1BDOA 1PTOF 2PMVA 2QF7A 3IFTA 1J7BA 1LTAD 2JA8B 2ZXOA 2EY1A 5EQ0A 1ZXTA 3AEAB 4JX1C 1STYA 3QB3A 1N61A 1FFVA 2MP1A 4PNYA 4A3IB 3ZJVA 2F0PA 5I9PA 5EE3A 1TY2A 1DGJA 3Q8AA 3PO2B 2D5GA 2GI9A 1C4AA 1N60A 3M7GA 2BA1A 5A2QE 3GV6A 2DNCA 3F2UA 1RWSA 5C0XH 3OMCA 3SK5A 5NUCA 3RZOB 3NK9A 1G6ZA 2WXFA 3I57A 3TP7A 1M8AA 1JB3A 1DYQA 5AUIA 4HCSA 2ZT9C 3SE0A 5CBEE 1VDZA 2WNMA 4J6HA 4C2MB 3GS2A 1G2SA 4XWWA 1LABA 4RCOA 4LK0M 3FRPB 1VDVA 1FNVA 3SR1A 3R2TA 1E9MA 5C5LA 3P42A 3PO0A 1D1KA 1WWTA 5DNFA 1STAA 5ELBA 4XDXA 1PYWD 2W55A 3AE8B 2JP1A 1SNMA 4RHSA 2Y5PA 4H0LC 2M19A 3NUHB 1KNEA 1H9SA 3R2IA 3HOWB 5D3IB 1F2MA 3H8HA 5GXGB 4K8JA 1K51A 2IPKD 3D6CA 4B9WA 4K5WA 3VRAB 5I4DA 2L83A 4KY6A 1FYCA 3EQLC 5ELFA 1DOXA 5C0XG 1NVID 1XLOA 3A8KE 1TWAB 2E76C 1CM9A 1MSHA 2MGSA 3AB9A 1U4MA 1ESFA 3TP8A 4NDXA 2PVOD 4ILWA 4IUUA 3T16A 1OQRA 4O1NA 1QB5D 2QSDA 3TSSA 1D4BA 2W3RA 2BTEA 1YQ4B 3J80E 3AE2B 4EE2A 1HHVA 3P4PB 2V4DA 5CMDA 4DA2A 1F2YA 4RCNA 2ZW0A 4FF3A 3D4DA 3SVMA 1DOIA 1GUWA 2K04A 2RSNA 4FXCA 4C3HB 2AX5A 5D14A 4O42A 3EVQA 3S2HB 4R8IA 2IGHA 3NTKA 1NENB 4B08A 2IT1A 3NWTA 2B8FA 1LTTD 1SSOA 4PQXA 2VB3X 4TQ0A 2K5PA 2RA4A 4ARCA 4MIUA 5DM73 1HRJA 1FIQA 2DNEA 1TS4A 5E6JA 1Q1BA 3H94A 2EYMA 2K1BA 3QWNA 3V3XA 3V96A 3AE3B 3SHLA 4G4KA 3R93A 2JE6I 1PDXA 1FXIA 3RUZA 4HSPA 2K6AA 2MJ8A 3RFZB 3DWAA 3OSOA 5JEAH 2F0SA 2OXPA 3VA5A 4CJ1B 5DM63 4H44C 4KGRA 3HOVB 1EU4A 1FO4A 1I50B 4QF4A 4UDUC 1MI2A 3AE4B 2F0HA 4XT1B 3BDCA 1JORA 1DJRD 1YJIA 1E0BA 1WCMB 3CRLC 1TKWB 2X69A 3IAYA 2F0KA 3BK1A 4S3SA 2GA4B 3VR3A 1WXQA 2WXMA 4L1BA 4XYQA 2LMCB 4UAIA 1JOQA 1RDPD 5CV8A 4WURA 1OQQA 3K5LA 1O7ZA 2F4IA 1YN3A 2NVTB 5C3WA 2J52A 4IALA 2F0MA 1PTOD 1K53A 1T3QA 4FXGC 5T1GA 2XVSA 2MEKA 2OHFA 4ZOHC 1XCQL 1GUGA 3NBHA 4ZLTF 1NYQA 4ZUJA 5FKAC 3A7LA 5EE1A 1F2RC 2V3PA 3PV0A 3H3VC 2WAQB 1KDBA 3M7NA 1K52A 1PTOC 4TSSA 2ZXPA 4ZUIA 4M1UB 5JEAG 2BOSA 2R3ZA 1V8CA 4KGSA 3H09A 2MHVA 1NI3A 3HVDA 5C4XB 1KH0A 1HUMA 2NZ1D 3K6OA 1L5PA 1T6BX 3BYTB 4IKGA 4KX6B 1RTOA 4ID6A 4MH8A 1YNNC 2BYTA 2B76B 3T53B 3BG3A 3GO5A 1BR9A 1HZ5A 1QOBA 2EY2A 4M8AA 3QOLA 2KACA 2PZWA 5EKIA 2LJIA 2INPE 3P63A 1IW7C 3K5OA 3ONAB 3DEPA 2PQEA 1LLRD 1E6EB 1B4OA 2DY7A 3PIO3 1L0XB 4KD3A 2JXTA 1MI0A 3UI2A 4A3KB 3BIID 4IUTA 4KV6A 3K5MA 1PFNA 4C3JG 3IAS1 2JSVX 3J7AV 2AQ3B 1D1IA 4ZYSA 1A70A 1V1PA 1RJTA 5CYUA 4LMQD 4L6TB 2JYOA 1EYDA 4CKBA 1OFFA 3H0GB 2TMPA 5M3MB 1BBXC 1C79A 1DM0B 1HCZA 3AECB 3TBIB 2AWOA 4X3KA 2NN6I 3W3AA 2K05A 1VF7A 1Q90A 4YSYB 3T3OA 1C4QA 4IUNA 5T8IA 1WTWA 4EQOA 5H92C 2V0GA 2M56B 3DHQA 1LTBD 3J7YW 5A35A 2NUCA 1UEAB 3A8IE 1LTID 4KJOA 2PCFB 2LEKA 1JCKB 3RLFA 4BA2I 5BYQA 3B9JA 3OW7A 2I2YA 3GTQB 1NUCA 1SXTA 1VRAB 4WIPA 3RZDB 1QQRA 1TQOA 1GAQB 2XWBB 1SE2A 4KHZA 3NTHA 3FEWX 3TEWA 4K14A 1JWBD 2OF1A 1B53A 2E75C 1PZJD 3WOEA 2A74C 4HRSA 1AYFA 2BB5A 1EOTA 3NVWA 1LT6D 1L4DB 2ON8A 2SNMA 3KBGA 2IX0A 3I4MB 3S16B 4ZKBB 4B0EA 1TVXA 4IFDJ 2NMQA 2WV6D 1S5CD 4ARIA 3E5SA 1EEFD 1UWXA 2WKDA 2IL8A 4FXKC 1JWAD 4PMWA 4GZYC 3W1SA 4KTAA 1SYEA 2IDYA 1GUSA 2NTSA 3NVVA 1QWYA 5CV7A 4D2KA 2K7VA 2F0DA 4P2CB 2DYMA 1JROA 4RF0A 3TZDA 3OIPA 5CV6A 1LTRD 2V3NA 3WOFA 4P6VF 4RWSC 3T51B 1CFMA 4KMUC 2L12A 2KA7A 5G5HA 1SNCA 3GTJB 3IXSA 5CV9A 1B1ZA 3A7AB 3I72A 3VR8B 4KKUA 3Q8EA 3NRZA 2SOBA 1EY4A 4AYBB 1PTOB 1RD9D 3N52A 2IGDA 1YN4A 3FAHA 2VNUD 3S2DB 5FR3A 5M5XB 4QIWB 2ID0A 1BF4A 1O7LA 1WYGA 1S5BD 3CRKC 1HEZE 1OXTA 4QB4A 2LFIA 2VUMB 2HCCA 1LT5D 5FOBB 1RHPA 5KYLA 4M0WA 3GB1A 2QKIC 2WXRA 4MT5A 1Q1EA 3C1EA 2FINB 3PO3B 1XX8A 4ZRZA 4PMCA 2D2CC 2BT6A 1SNPA 5BN5A 3HKZB 1BUIC 2PZTA 5COYA 1JR0D 2KVMA 1JOKA 2PO4A 2MH7A 2F0QA 1QCBD 2B2TC 2MPMA 3VQIA 2WIIB 1DOMA 2SEBD 4E6IA 4RKBA 5IODA 2B2UA 1PGAA 5JVG3 4L2YA 5EPJA 4ME5A 4MM3B 5BMGA 3LB8C 2Z4HA 2K9XA 1FXAA 5FLXL 2ICIA 3SEBA 3E9SA 2C5CA 3N6RA 1A2TA 4J3OD 3TEZA 4HEDA 4OZBA 1T5XD 1RKNA 2B8GA 3S1QB 1D6EC 5I6YA 2CJOA 2B39A 4CGYB 2ZW1A 1FD7D 2WS3B 1KTKA 1ZPSA 3I4LA 1EU3A 4WORA 1UWMA 3LX0A 1UAPA 3M4OB 1D5MC 4FNFA 1CHQD 5EKKA 3AE7B 5C3JB 1E2VA 2LHDA 1G91A 1STNA 3VYRA 3P20A 4JBWA 3E56A 3G6JB 1NCVA 2RDHA 3MVVA 3S1MB 1U9RA 4C56C 1TS3A 2N0SB 4ZK9B 3GTMB 4KKTA 1BUVT 3GTLB 1MVKA 1QJOA 2CJNA 2LGIA 3NS1A 4F8MA 3CHBD 3IT4B 3J7AF 1CZPA 3EFXD 2M9VA 2BS4B 4A90A 3AEDB 1YN5A 2CW0D 4MN3A 4XT3B 1OXXK 3CQZB 1DONA 4C3IB 4BY1B 1I4PA 4A8XC 1CK1A 5JPMC 4C1NI 3OWEB 4ZAIA 4FVMA 4DNRB 4ZHPA 1NAPA 1T5EA 2NVXB 2KCNA 1E0ZA 1PRTD 3M3YB 1BQQT 4YIJA 4G7ZC 1XF5L 3IKJA 3KLRA 2AQ2B 1QG7A 2CVRA 4BBSB 4KN7C 4A3EB 2BDNA 4EQPA 3VA7A 2H88B 4US8A 1E10A 1J7AA 5C0XJ 1JMLA 1IKLA 1I6VC 4CJ0B 2MJ3A 2WKCA 2XRQD 1Y1WB 2JYEA 4F87A 1WTXA 1VLBA 4OZAA 1A6XA 3Q8FA 4QUCA 2QCPX 5EBCA 2O2LD 3DUZA 3T13A 4OO1I 4A3FB 2PTLA 1A3UA 3AH7A 2B2UC 2QDBA 2Y5CA 1D5ZC 1PDQA 2D62A 3SK4A 2Z8LA 5KEEA 1J7CA 2EKIA 2F0WA 5LHY1 3AEEB 1EL0A 2L1BA 3AM9A 2LKVA 3QJYA 2L1AA 3AE9B 3E0JA 3P4RB 1B9MA 2PVGC 5KIXA 2BCOA 2B2VC 2L9HA 1FNWA 2A68D 1QKZA 5I2YA 3ZQ4A 2BW2A 2XSCA 4ZHOA 1GUTA 2L55A 4RHRA 2R61A 4IQZA 1FCLA 2WDRB 2WB1B 1WTVA 3VR5A 3I3CA 4C1NK 4IOIE 4DN4M 2F0GA 1A2UA 2Y0SB 4J1MA 1I7HA 5AFWA 5HI1A 2CU3A 2A68C 2HCIA 1X3QA 3HOUB 4XTCS 4TQUS 1SFOB 4U68A 5TSSA 3EUB2 4A3JB 1H9RA 4OGQC 1QNUA 2KECA 3TMEA 1CTMA 1OXSC 1XXGA 1IUEA 3D8GA 3W5VB 2KAJA 5J39A 3Q6SA 2Q5WD 2HUGA 2G9DA 2F1MA 2X38A 5CORA 2XIWA 1IHZA 5T1IA 5D7GA 3NUCA 3NP8A 5EJWA 4XYOA 4A3MB 3Q69A 4Q5VA 1V8QA 2NTTA 2SNSA 1N63A 3IT6B 4WQMA 1TY0A 1RF2D 1SE4A 2JYTA 2WQYB 3PIP3 4I65A 4CKEA 3FILB 2E2HB 2EJFC 2NVQB 2QEJC 4JWSC 1VF5C 1IL8A 2A69D 2KN4A 1KLGD 1TJEA 1V43A 1HQMC 3S1NB 5E4XA 1Y8NB 2Z1CA 3H6MA 5EKLA 1SEBD 3U9OA 1KLUD 2KOLA 1AW7A 5IGDA 4C3JB 2J42A 2B63B 2M2LA 1KFYB 2WDQB 3MZ5A 3SFDB 2A69C 3HRDD 4K6LA 3Q8CA 4WRDA 3M85A 2A6ED 2RBMA 2EY6A 4G7HC 3NXWA 2JSOA 3NVYA 3P4SB 1VMCA 2AQ1B 5JEAJ 1HZ6A 5I2XA 2SDFA 5ELDA 4WWMA 2FJ2A 3NPPA 1DZ1A 1LTSD 2C9OA 2EYJA 4MHEA 1GPXA 3GP7A 2WXKA 1KDAA 2WINB 2HTME 5BYSA 2G9HD 1I4QA 3MC0B 1CQFA 3AU7A 1BO0A 2RMMA 1MD2D 3EGRA 2J7ZA 4X3TA 2WU2B 2IX3A 3GTKB 4HR7B 1FNUA 3GTGB 2WLBA 2RDFA 1G8ZD 5KNDA 3U9SA 3I73A 2EVBA 3MP9A 4DAPA 5D3DA 2BB6A 2WXHA 2INNE 1J9OA 2PNRC 1MSGA 4R3DA 4OIJA 1IGCA 3GQBA 4BA1I 1ENAA 1PRTB 3HGBA 3PMFA 4RF1A 3KWLA 1SJHD 3VR2A 1AN8A 3NQIA 2OEOA 5BMIA 3VYUA 4IUPA 1YQ3B 5IIFA 1F2RI 1RFKA 3DWMA 1Y1VB 3LYYA 1TWFB 2XN9C 2XRSD 2LY7A 4N9PA 1S5FD 1ONLA 4I7ZC 1YJJA 4L63B 3FPUB 4FP5D 2H4OA 5LL6S 4MACA 3T3NA 1ZXIA 2LFNA 4KGTA 2IW3A 1KAAA 4IZ8A 4A6QA 1K50A 3L4PA 5I9OA 4R9WA 3KUPA 2O5IC 1XO3A 3N9YC 5CC4A 1HQRD 4NAWB 1TIID 4CHTB 3IFDA 2MJDA 1SBBB 1JQYD 3HVZA 1AEXA 1PLFA 1EY0A 3HRZC 2MJEA 2WXGA 4KY7A 4DNTB 3VR6A 4K2KA 2LUMA 1STHA 3Q0AA 4OO1H 2EYLA 1GB4A 2F0UA 4B9XA 1XLNA 4KKIA 3HOZB 2JEBI 2WP8J 1L0YB 4FF1A 3KLSX 1FRDA 5FO7B 1BCPF 1EZ8A 2I38A 3Q8BA 1ILQA 3AE5B 2B2TA 1N5XA 5ELEA 2J4XA 3P1HA 4IDIA 5M9OA 3D3RA 1R4PB 2K01A 2RDGA 3FVQA 5JAVA 3A55A 5HG2A 2O4XA 3KK7A 2KWDA 2E3TA 4TMAB 4KD4A 4YSXB 2RVLA 2H89B 1GUOA 2JA6B 1S4ZA 3BDLA 1U4PA 3KBXA 1TT2A 4XXEA 4LAAA 3MFGA 1QF6A 2W54A 3KLSA 3AEFB 3CIRB 1Q12A 3BK2A 3X3MA 3SFEB 5IGCA 2DWQA 4XDDA 3EJIA 1ML0D 1IGDA 1GB1A 4RAUC 1IYUA 1O78A 4AS1A 4KK7A 5C0XI 1CT1D 1OXUA 1PZID 4YTPB 2EPBA 3I4NB 5E1FA 1PRTF 1EM7A 4OO1G 3LXFA 1CZGA 1TZOA 4LTUA 1K8OA 1CI3M 2K5WA 4KN4C 1AZQA 1CJEA 1PMRA 5KGUA 3U52E 2KHSA 3OPOA 3FILA 2W3SA 1MGSA 2NBFA 4NZLB 1PFMA 4FYDA 1K83B 4K6DA 2IGGA 5C4HA 2WXOA 5FLXE 3MXGA 3CWIA 4YSZB 5KRUA 2Q8IB 3ZJUA 3ETRA 2DBYA 2EELA 2EYFA 5M5YB 2YYZA 1Y56A 3SK8A 2I46A 4HN7A 2EXZA 4J8QA 3ABVB 1TWHB 3O13A 4ZQ3A 4TQ1A 3FKIB 2AUKA 2EDGA 2KQ4X 1S5ED 4BS9A 1CZWA 1ZEQX 5G5GA 2N9KA 1HTLD 2RPVA 2L0CA 2HDEA 3K58A 1F2LA 4IUVA 3NQTA 1SAPA 2L5TA 4JWUC 1DOLA 1II3A 2KEEA 4ULLA 1C77A 1EYCA 3FPPA 1SYFA 3MXPA 1MPEA 1LO5D 4FO2A 3HOYB 4HROA 1JWSD 1R9TB 3K0YA 3NWSA 5IT9L 2LMCA 1VJKA 3ITPA 3D31A 4DGZA 4QUFA 1WTRA 2R92B 5CGKA 1V1OA 1NEKB 3JAML 4XWTA 1LTGD 3E6ZX 3AMZA 2CQAA 4PT5A 1F9RA 3OMGA 2B2YC 4BBRB 5IGFA 3LWUA 4NJCA 1D5XC 1EQVA 4USAA 4G57A 2N9LA 3B2GA 2RQXA 1C9FA 3I70A 2N55A 2NYZD 4KJNA 4RA8A 3I91A 1F9PA 4EVOA 1SJED 1TWGB 3P4QB 3MXUA 3TEXA 3PZ7A 1M4VA 4Z9CB 5LNK1 4HAEA 3OHXC 3I8ZA 4B0MA 3L9AX 1ZYRD 3PUYA 1R7SA 1RTNA 1P7EA 3QIAA 1GHKA 1I4RA 1ACCA 2EJGC 2WXJA 1W6JA 2F0LA 2OEDA 5IOCA 3ZYYX 2B2VA 2F0VA 1TU2B 1HUNA 4GDLB 3GV3A 2Q8RE 4N9TA 1SYCA 1PXUA 5ISRA 5M5WB 1B2TA 1AZPA 1B3AA 3MXNA 2NB0A 5J1ZA 4LJZC 2K28A 5C3EB 1TKEA 3S15B 4A93B 4FF4A 1W6KA 3AN1A 1EY5A 1XYIA 2LS01 3TDQA 4OVZA 4JE3B 2PKOA 1KNAA 1WTPA 5HHDG 2EE1A 1GHJA 4HKQA 2F0IA 4OW0A 2K32A 3RD4A 1LT4D 2V4IB 5JOBA 2FMMA 2Y3AA 1S5DD 1XEEA 5CV4A 1BCPD 2R7ZB 4Q2JA 4OIKA 2X6LA 1AP0A 3FC4A 4XDCA 4DQOC 1NR4A 3Q24A 2QJLA 2PMZB 4N58A 1C4CA 2JA7B 1B50A 1QT9A 1YNTE 1RCVD 2YEPB 2K33A 1BCPC 2NN6H 4P16A 3NTIA 2E74C 3DMUA 4KKJA 2JXMB 4HSVA 3MEHA 1A15A 1CQVA 2IJ0A 1WD1A 3QO2A 1UUPA 1C78A 3U2SC 3SXHA 3HZXA 4GLSC 4YTMB 1ZE3D 1VZ7A 3MAQA 4GDKB 2E2DC 4ZRPA 2KCCA 2JZPA 2WXQA 3ZJTA 5DAUA 3S1RB 2SAKA 1QLBB 2MUYA 2BDOA 3QG1A 4XIGS 3ND8A 4HCEA 2CW0C 4HTHA 4NKLA 1VMPA 1F9SA 5EPLA 4DK1A 4WH4A 3MTSA 3Q22A 3LNNA 1FRRA 1VZ6A 1C8CA 2JA5B 1SE3A 4K5XA 1PUTA 1WD0A 3DXJC 1PRTC 3TP6A 2PLPA 4XQJA 1L0VB 2PIAA 2L4NA 4IN3A 4N59A 4CJ2C 4RFBA 3BYYB 2NN6G 3TZUA 1L6UA 1LACA 5C6AA