3OWEB

Crystal structure of staphylococcal enterotoxin g (seg) in complex with a high affinity mutant mouse t-cell receptor chain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
227
Chain Sequence
AQPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEFGGCCMYGGLTFNSSENRDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-chain
publication title Crystal structure of staphylococcal enterotoxin G (SEG) in complex with a mouse T-cell receptor {beta} chain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 60
structure length 227
sequence length 234
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3oweB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3oweB01
1LTGD 1ESFA 1ET6A 4C56C 2XN9C 3OWEB 1V1OA 1GOZA 3BZDB 1LTID 1L0YB 4RH6A 1PRTB 1I4XA 1TS4A 1EEID 1SEBD 1V1PB 1YN4A 1SXTA 1PTOD 1STEA 1EU4A 1PTOF 1CK1A 5ELEA 1HQRD 3EA6A 1TS3A 3DWAA 1AN8A 1EWCA 4DXGA 3BVMA 1M4VA 1LLRD 1BCPC 1PTOH 1QILA 2RDHA 2AQ3B 1SE2A 4O1NA 3DWQA 3EFXD 5ELCA 1JWMD 3R2TA 2AQ2B 3BVGA 1KLUD 1PYWD 1LTBD 5D3IB 1I4PA 1I4RA 2IJ0A 4Z9CB 5ELBA 5D3DA 1S5FD 1TY0A 1V1PA 1RDPD 1LO5D 1LTTD 4UDUC 1BCPD 1D5XC 4K6LA 1G8ZD 1BCPF 1ET9A 1I4QA 2XRSD 1LT4D 1CT1D 1FNVA 1HXYD 1I4GA 1KLGD 3O13A 2RDGA 3DWPA 1FNWA 4L63B 4RGMA 4BWGB 4ZYSA 3MFGA 1TS2A 2NTSA 1FGBD 1SE3A 3BYTB 1DJRD 2AQ1B 1SJED 2O2LD 4RFBA 1BCPB 1BXTA 1LT3D 1L0XB 3BVZA 2CHBD 3URYA 1B44D 1EEFD 1PZID 1SJHD 1UNSA 1TS5A 2J4XA 4RGOS 1HTLD 2TSSA 1XTCD 1D6EC 4RGNA 5ELFA 1D5MC 1RCVD 1EU3A 1I4HA 1ENFA 1JQYD 5I4DA 1FNUA 1SE4A 3SEBA 2SEBD 1DYQA 4OHJA 1YN3A 1FD7D 5ELDA 2QEJC 5FK9C 2Z8LA 1MD2D 1RD9D 1PTOC 1D5ZC 1S5DD 1UUPA 3R8BA 3KLSX 1RF2D 1LTAD 1S5ED 1PZJD 3BYYB 1EFID 2G9HD 1KTKA 2XRQD 2XNAC 1SBBB 1YN5A 3GP7A 4NZLB 1PRTC 1XXGA 1CQVA 1T5XD 3CHBD 1TY2A 3V05A 4RHRA 3MC0B 1F77A 1S5CD 4RGTA 1PZKD 1LTRD 3W2DA 2ICIA 1JCKB 2IPKD 1LT5D 2NTTA 2WV6D 4DXFA 1B1ZA 1LT6D 5TSSA 1S5BD 4RHSA 5FKAC 2R61A 1CHQD 1JWUD 1PRTD 3TSSA 1PRTF 3R2IA 1JWSD 1PTOB 1AW7A 1JR0D 1CHPD 4L6TB 2QILA 4TSSA 1HA5A 4RCOA 1LTSD
chains in the Genus database with same CATH superfamily
3ULJA 3HOZH 5M5XB 4B6WA 3H15A 4KI0A 3UDXA 2F4VL 3S2DH 4A3DH 1P0RA 2QGQA 3L3OC 3JW0X 2PZUA 2X6LA 4GKKL 2NN6H 3NHEB 3V3XA 1QJOA 4B0EA 2F0OA 2HUGA 3SD5A 3W5UB 4A3CH 1PTOF 1KAAA 1CK1A 2KC2A 1W3SA 2Q2UA 4YTNB 3T4AC 4X66L 3VH3B 4DBGA 4YWLA 1Y1WG 1UEAB 4W9CA 2IL8A 4C80A 1VQAA 4P6VF 3MJWA 1C9FA 3HEJA 1QE6A 4IALA 1DOIA 4IDIA 5D94A 3NY5A 4P72A 2BS4B 3Q6SA 2LJ5A 2F3VA 1STHA 2CW0C 2Q5WD 1XNRQ 3IAS1 4KKJA 3S2AA 4OGQC 4GNXC 3AEFB 1S5FD 3I4NG 1RDPD 4GN1A 3WA0A 1GO3E 4MM3B 4AS1A 1F2MA 3K7AH 3EJIA 1ET9A 2I5LX 3MTSA 2MNAA 4YY3L 2F0WA 4IO9A 1WY8A 2GLSA 1CT1D 1QVGA 2KAJA 2MBEA 3APFA 3Q6BA 2J52A 1H9RA 4JI4L 4JQWC 3QG1A 3GTPH 1J5EL 3SK8A 5BYSA 3FPPA 4HK2A 3ZNGC 5IN7A 2AEHA 4QIWE 5C4XG 1SROA 1TVXA 1K83B 1MVKA 4U68A 1YITA 1SE9A 1UGJA 3NBIA 1YQ3B 3FEWX 2KMMA 5DPTA 2BE5D 1BXTA 2Q2TA 3LGJA 3J81L 3J7ZC 1IBMQ 2CHBD 2N9PC 3IXSA 2YTXA 5EKLA 3X0WA 3TP6A 3Q0AA 3VDZA 4L5QA 5IYBH 1G6JA 1TS5A 2RDFA 4MHEA 1OTCA 1P7EA 4A55A 4GDKA 1FM0D 1KF6B 3S2HH 1ZDVA 2N49A 4WORA 1YHAA 2PI2E 3SK6A 1W6KA 1LUZA 1VQEA 1YJJA 4ZRPA 1LM0A 3BDLA 2K01A 3M3YB 3RNBC 2HJ1A 2OTLA 1VQGA 3A7AB 2F0HA 1XPUA 2MJDA 4BBSH 4KGRA 3HOUB 5NUCA 2A6HD 2JU6X 2ZXPA 4J15A 4PG3A 1JORA 2R93G 2KOXA 4IUUA 2B3GA 4FXDA 2JYOA 1XNRL 1ISNA 3I90A 4KV2A 2GN5A 1WF9A 4NQKE 2XNAC 4HCSA 4K8JA 3PRZA 3U7ZA 4GNXA 1EQQA 1EOTA 2GBMA 2NVTH 3ALBA 4MELA 4C2MB 1XPOA 1NY4A 1ICWA 4P7IA 4J3OD 2K52A 3APCA 2JJQA 5KYIA 3AE3B 5IODA 3RZDH 3S2DB 3A56A 4ICUA 3IKJA 1WCMB 4ZAIA 4MACA 3H7PA 2NTTA 2KTFA 4BXXG 1LFDA 4HSPA 1KC8C 2AWTA 1UE7A 2UXDQ 3HS0C 2BS3B 3QJZA 3PSIA 3CCLA 2FJ2A 1AZQA 2MWSB 1VQ5A 3ZO5B 1HTQA 2JQRB 3Q3NC 1IBML 5LXHA 5KHOA 3DBHB 1JR0D 2W3SA 4ZOHC 2D5DA 2Q2HA 5JEAJ 2RBMA 1MKHA 2G4SA 4L6TB 1WFYA 3ITPA 2UUBQ 4K0KQ 2RD0A 3C3LA 4FDBA 4CHKA 3BZDB 2N9EB 1O7LA 3T1HQ 2PQAA 2WXJA 2MP2B 3L17A 3Q69A 3K5LA 4IM3A 3R7RA 1PTOD 3S17H 3ZJUA 3PIO3 3EFUA 1B50A 2KX0A 3AXCA 3K7AB 2PYKA 4C00A 1CJEA 1R9TH 2ZEQA 4RF1A 5HG2A 4UP8A 2PMZB 4JI1L 2RKSA 3HOVB 1L5PA 4GSWA 3K5MA 4NB3A 5D3IB 4A3OA 1OQQA 3W3AA 1F9SA 5DPRA 1FR3A 2PPBC 2HDLA 3QB3A 2ZJDA 5DCNA 2WXRA 5E6OA 4A3PA 2A74C 5C6AA 4LJOB 4BY1G 2LGYA 2BE5C 3KLWA 4JK1C 3AFPA 1QZHA 1JB7A 3LX0A 3CAMA 3RMHA 2L00B 5GMVA 3VRAB 1AARA 5IT9E 4A9AA 1YHBA 3B2FA 2YYZA 2GBJA 1GUGA 1OXVA 1I4QA 3M9BA 2XRSD 2HTHA 2WU5B 3IG3A 5EE9A 2E3TA 1KAWA 2GA4B 4DKAC 4LNQA 1E5WA 3ZTDA 2QJLA 4W9DA 1WX8A 3TBIB 3J7A5 1VQOA 1IZ6A 1X3FA 3GDEA 2WXFA 3UGBB 3V61A 4QMGA 4A8XC 3GTQB 4BBSB 4WJOA 3IVFA 3S1MB 3SDLC 3STBD 3S15B 4A3BG 4RF0A 4QAYA 3ER0A 4D2KA 4FYDA 3TUOA 2UUBL 4K0KL 1LGRA 4B3SQ 4RM8A 2D0PA 5FLMH 1RAXA 5JHAA 1KDAA 1EEFD 4K5WA 3PUZA 2BDOA 3T1HL 5M3FB 3MA2B 3Q8FA 1Y8RC 3IBEA 1BUVT 2YTVA 3TEHB 1IL2A 2E2IH 1K8AC 3VFKA 1TT2A 2QW7A 2WXNA 1AYFA 1JT8A 4M8MA 1U4RA 3UDGA 5AJ3Q 2PMZE 2V4LA 3G48A 3DVNV 2BBCA 4A6QA 2QEJC 3CU7A 5HURA 3RZDB 2OEOA 3A55A 4FVMA 2RDBC 1VF7A 3SR1A 3T51B 4B9WA 3AEVA 3HOVG 1K52A 3R3MA 3ZXVA 2KCTA 3EC8A 4O2DA 1NMGA 1EYGA 1VMCA 1PH1A 5BMHA 3CPFA 3D6CA 4XT1B 1CA6A 1VQ6A 2ES2A 2A73B 4YWMA 3ZW3A 1JMLA 2EYOA 4HIMA 1YJ1A 1D3ZA 3JAME 5KYLA 5TR5A 3Q8CA 3ZNZB 5CHFA 2E2HB 4I65A 1X3GA 2F0GA 1B9RA 3IL8A 3DPDA 2LRWA 1QVFA 1UE5A 4FNFA 3VUWA 3RPFC 4XE0A 1GHKA 1BNZA 1EY7A 3D6WA 1VQPA 4QUFA 1GAQB 1O7YA 1OFFA 3PRMB 2JPHA 3L0WB 3TDQA 3RT3B 4DR3Q 1GUOA 3AN1A 2BGFA 4S0RA 2VH2A 4AIMA 1PGXA 5G2NA 1Q46A 2KHJA 3W1BA 4HJ5A 3G4SA 1DOKA 1MSHA 5L95C 3I4MG 2ONQA 4ALPA 1HZ9A 2JYTA 4B3SL 4OVUA 3HZXA 1HPCA 4IOAA 5AEKB 2C5CA 5M3FG 4DV6Q 4HEDA 5DPSA 4PS8A 3P63A 1L4ZB 3PIOA 1SN8A 2IHEA 4OL7A 4KKUA 3M63B 3OWEB 3QOJA 4C3JB 3A33B 1I4XA 5AJ3L 4A3KB 4TMAB 5CBEE 4B3TL 1EF1A 3D32A 3Q2AC 4KDIC 5EE3A 3VTUA 3Q8DA 1STEA 3CMMB 1EU4A 2XWJB 4XTCS 2J0TD 1NVID 2WKDA 5ELEA 3A5UA 4W9IA 1UBQA 2PQEA 1JWAD 3C46A 2F0MA 4HJ7A 4JI5Q 1JQ4A 2RDHA 3UI2A 1HNZQ 4PMCA 4YL8A 1ENAA 1Y69U 3HGBA 1EY5A 1IPGA 3B08A 5DNFA 4KX6B 3TP7A 1IGDA 2DX5B 2D3AA 4A3IH 3DBHI 4ZK9B 4ZRIA 1I4RA 3HOYB 1WOCA 1IL8A 2JN4A 3NTHA 5ELBA 1E7UA 2N1VA 1WR1A 1VMPA 2EYFA 3MZ5A 4R4OA 3STBC 1CSPA 1AE3A 1YJNA 2JA5H 1VD2A 3I57A 3PIPA 1VQKA 2SNMA 3QARA 4PMBA 3P75A 4UP9A 1N63A 1UZXB 3ZRFA 1B8AA 4DR3L 2PI2A 1ASYA 1FEHA 3PV1A 4ASWC 1EQVA 3N30A 4BWGB 3GTMH 2DUDA 2DWQA 4H02A 1OTRB 1WGKA 1WI5A 4A75A 2KVMA 2D3GA 4KK7A 5BN4A 2L32A 3AE6B 5FLXL 4WWMA 2C9OA 2ICEC 1NI2A 5H8YE 5C3WA 1Q8KA 5JVH3 5EQ0A 2EMTA 4WFN3 2K4KA 4DV6L 3CQZB 1GB1A 3UIPB 2I07B 3ZUNA 4K3BA 1ZPSA 4CBVA 1FCCC 4C3JG 2Q8IB 4MM3A 4X65Q 4DNRB 3P4QB 4A3KG 4GXBA 4ZLTF 2J4XA 4P16A 1VF5C 2BWES 4OELB 4DNIA 1IBXA 2CFMA 3RN2A 4R8IA 1VR9A 4JL9A 3N52A 1AFPA 1KRHA 3AU7A 4OHJA 2BKFA 1P3QU 4JI5L 2IO1B 5J18A 1TWGH 1HNZL 4AUQC 2F0FA 1SMXA 1HA6A 3ERSX 5BN3A 2WXIA 3DHGC 3T3OA 2Y5CA 4DAVA 2PE6B 3VVWB 1WYWB 2XK5B 1FFVA 2WDTB 3HOYG 2N55A 3B2GA 3I63C 1HR0W 4IUTA 1PXUA 1K0RA 3BYYB 3H0GH 2N7DA 1H9JA 2W55A 4IN3A 2CWAA 1HR0Q 3JSVB 1XQQA 1SBBB 1WJJA 3TMEA 1YN5A 2D3BA 1VQ8A 3KWLA 3TIXA 1WTWA 4B08A 3VR9B 1I94Q 3DXJC 3GB1A 3U2SC 2IT1A 2CHXA 2PW9A 4K8IA 2VRRB 3I3TB 2KXJA 5LXIB 1JCKB 1SNPA 2B2VC 3OSOA 1JALA 1TKWB 4X64Q 3PUWA 1EYCA 1GVPA 5JAVA 2I38A 3VUXA 3D4WA 2V4IB 2EXDA 1EFWA 3NVWA 3H91A 2JUOA 4GN3B 2F4IA 3N1YC 3PRPB 5EJWA 4CJ0B 2PVOD 4PZ7A 2Z0SA 2JK8A 1TTNA 4A3JB 1YI2A 1YZ6A 1N33Q 4JBKA 3NZ3A 3NG0A 5E6NA 1K0SA 5IYDH 4X65L 4L23A 4M0WB 3ERQA 4Y7NH 3VH4B 5CR3A 1EUJA 3P2BA 2L55A 3TREA 4HIDA 4A3IB 2WXPA 1ET6A 4C56C 2KKCA 1ZOYB 1SNCA 1Y1VG 1KDBA 1A8VA 1R4MB 3E9IA 2WXKA 4JI8Q 2FMCA 1XCQL 3WDNA 4G7HC 1Q3LA 4I6PA 5AZFA 1VQCA 2E2JH 4C3IH 3QCAA 4KKIA 1WZ3A 3MHZA 4X3TA 3PVLA 1FJGQ 4NXMQ 5J39A 4CDFC 3AB5A 5EBDA 1VS0A 1WTXA 4PQXA 3NE5B 3PT2B 1HR0L 3ZXRA 2NVQH 1A63A 2PPHA 1TJEA 4QF4A 4MH0E 1IP9A 2V3PA 1PFNA 1EF5A 2MX2A 1STGA 2MP2A 1I94L 1G6ZA 1JJCB 5HGQA 3JAMi 4LNNA 4QJFA 4QGUA 2MJ8A 4K1RB 3GS2A 2D5GA 2CQAA 4HMJA 1SYEA 4X64L 4A3FB 2B2VA 4HMIA 1XNQQ 1UELA 4YWKA 1I4GA 2VZAA 2KOLA 5CV8A 3UE1A 4OO1G 5BYRA 3BWUD 5LL6S 2MUYA 3W5OA 4DPGA 1F9PA 5JEAH 4A3JG 1Z2MA 3FAHA 3I5JC 2MBQA 4LUOA 4OONA 1N33L 1DOXA 3OTOQ 4KD4A 1N5WA 5IIFA 3B0AA 1L0XB 1P8LA 2Q2IA 3W9CB 3PREA 3DUZA 2EYHA 4N8FA 1J7CA 1UE6A 3IAYA 5C4JH 1DCZA 2LS01 4DV2Q 2K3UA 1WXVA 3EROA 2ZJPA 4JI8L 1VQMA 2L05A 3OMGA 4HIOA 1KNEA 1MSGA 2TSSA 1PH3A 2KQSA 4M8NA 1D5MC 2DZMA 4A3EG 1XO3A 1ENFA 4BZAA 4A93H 2LKVA 3KLSA 1R4QB 3QIJA 3EFCA 5FO9B 1FJGL 2UWQA 4NXML 1YN3A 4KY6A 5ELDA 3FPUB 2AL3A 1EQTA 1S3SG 4N58A 1D5ZC 3KYCD 1TR5A 1S5DD 3AYHB 3SXHA 4CKCA 5M9OA 3J80L 3HOXH 4LF6Q 5EKKA 4A3LH 1PVOA 4K7UA 3HKZB 2ATWA 2ZVNA 1V9PA 1C76A 1F2LA 2MPMA 1U4PA 4ULLA 1WRDB 5E4XA 4XIGS 3CF5A 3AULA 2E6XA 4ANVA 3HG9A 3CHBD 2B2UC 4Y7NB 3DVNU 4RHRA 2RSOA 4A3FG 3FKYA 1F77A 3RCZA 1F1HA 3PUYA 4BKTA 2HD3A 1WVLA 1XNQL 2D3CA 1IYVA 2WP9B 1QZEA 2WS3B 5M3MG 4PZ6A 3OWFA 4PMWA 4K81A 1ZXTA 3T13A 1STYA 3PUXA 5KRUA 3OTOL 2ALYB 1PH5A 1OEYJ 4OXPA 2M0XA 3SFDB 1UD7A 1JE4A 1FIQA 3HM3A 1VQFA 5GAEC 1VQLA 1SB3C 4CO7A 1E22A 4DV2L 4JWUC 4Q0FA 5IWAQ 3MEHA 3S1NB 4KN7C 5C44G 5FR6A 4A3MB 3A8IE 2X69A 5CTRC 3W1YA 5I4DA 4RCOA 4KDLB 4ZRJA 1LTGD 5AZGA 3J7AV 3ZNHB 3MWYW 1NI3A 4KIKA 2GBKA 1V1PB 1RRBA 2LFNA 5CBAE 4NJ7A 4NNJB 2M56B 4TRDA 2AX5A 4KV6A 1YOVB 1J7BA 3T8MA 4F8CB 3HKZE 1A62A 3DWAA 5BMIA 4MTKA 2Q8TA 1QOGA 2DAFA 1JOOA 4LF6L 4OZAA 3HKZG 2DZKA 3J81i 3HOWH 4DV5Q 4NXNQ 2JSOA 1F9JA 4O1NA 2XBBC 2O5IC 3SHQA 1PH7A 3HRZC 3BVGA 1JJ2A 4LF4Q 4OVVA 1IBXB 5L83A 4BOSC 4X62Q 1I7HA 4HPMB 2WAQE 3VYSA 3MAQA 3J7AF 2WDVB 1OXUA 2A8VA 3C1FA 3E0JA 4XT3B 2WAQG 4BY7H 1DOYA 2B2UA 1SFOH 1J0GA 1CUKA 3LJ3A 1A3TA 4XQJA 2JSVX 3KOJA 2UU7A 5D65A 3OJ3A 1R4MI 2Z0DB 1SF0A 2NPTA 2B2YC 2XSCA 3D4DA 3IFDA 2Z1CA 3PMFA 1CMXB 3ZDTA 1IW7C 2D11A 1Q90A 1C4PA 2WB1B 2KANA 1CKNA 1YQBA 3AEAB 4IUNA 5JHBA 4GN5A 2KJHB 1YNND 3MFGA 3H3VI 3S16H 1VDVA 1TS2A 3UQAA 2FNJB 1ZE3D 5IT9L 3ZLZA 2BH8A 1TWCB 4IPCA 4IPDA 1TWAH 5IWAL 2UYZB 1IXRA 3A1QB 3NS8A 3Q3FA 3FHWA 1PQSA 4Q2JA 2RQXA 3T3NA 3Q3JA 2EKIA 2AYOB 3HM6X 4DR7Q 2BKRB 2FIDA 2EKEC 2C7NB 3S24A 2LGSA 5IYCH 1N36Q 1C3TA 4DFAA 2OQKA 2R92H 4NY0A 1EU3A 3IRBA 4LWCA 4MNOA 4POGA 3SEBA 3IHPC 2X38A 4HKZE 4IW0A 1E10A 1LM8B 4FULA 1NCVA 2MHVA 2WWZA 2YEPB 3CWIA 4DV5L 4NXNL 2Z8LA 1TWHB 3VR2A 4LF4L 4IC7B 2IY1B 1E8XA 3BDOA 4X62L 4ARIA 2K5DA 2BTEA 4G0NB 4FO2A 3AI5A 2G9HD 5C3EB 4ACFA 1N61A 3TP5A 3N1ZC 3HKSA 3GP7A 1KIXA 3RMKC 1CFMA 3PO0A 3K57A 3GE8C 4EZJA 2WB1E 1SMYD 4GZYC 1GC7A 1C7YA 2JA8G 3AH7A 5E6JA 1IGCA 3M4QA 2WB1G 4ZKBB 1PLFA 2B2YA 5CORA 2K04A 1S5CD 3T56B 1PDQA 2RSUA 3H3VC 1EIGA 1GM5A 1LTRD 1MBYA 2F4VQ 4USAA 4ARCA 3CW2C 1FRDA 2JY6A 4PT5A 2G3QB 3W1GA 2NR2A 2XK5A 4DNTB 2Z9HA 4IWPA 4DHJB 1S72A 1C48A 1KRTA 2JZZA 1KJTA 2BF8B 3ZJTA 1FPYA 3PS6A 2V1CC 2R6GA 2ZVOA 4J6IA 1X65A 1PYBA 2DYOA 1Z6HA 4DR7L 1NNXA 2L52A 4I6LB 5I9PA 2A6EC 1C8CA 3G6EA 1SLJA 1MI2A 3U50C 4JBJA 4RH6A 1BBXC 1KLVA 4WQOB 2V3SA 3VA5A 1SFOB 1V86A 4BVUC 3CSFA 3DM3A 4KKSA 4NMZA 1FO4A 1K8OA 1MHHE 3VHTC 4DXGA 2ZNVB 3SDZA 3A8JE 4HVBA 1NBFC 1RODA 1TT5B 4RKBA 4DR1Q 1P9DU 2LHEA 4W9FA 2RA4A 3S16B 5ELCA 5M5WH 2NBWB 5C3EG 4M0WA 3QC8B 4A76A 2BT6A 1YNNC 3NXWA 4KD3A 4P74A 4LNOA 2ZTCA 3N3KB 2FFKB 3KK7A 3CRKC 4L5SA 1HUMA 1HFGA 1I3QH 1YX6B 1EL0A 3D8GA 4J8QA 1LYLA 2MQHA 1MJCA 1YNJD 2FCQA 4ICVA 5C1ZA 2JXMB 2JF5A 2WU2B 4US9A 2MP1A 1JMCA 2N7EA 2IX0A 3G6JB 4AWJA 1KLGD 1YNTE 1QLBB 2KWUB 2VQFQ 1QT9A 4B3MQ 3ENEA 1WX7A 3RZFA 3UI3A 5EPLA 3RYTA 4EQ5A 1V5TA 2I5HA 1SJED 1T0QC 4JBWA 1WGYA 2W82A 4M01A 2K14A 4H44C 5T1GA 2DNFA 3QJYA 1HTOA 4JW0A 3KBGA 4BY1H 3AMUA 1E7PB 2JP1A 2KJRA 4KGTA 4KN4C 2PKOA 4RGOS 3D0FA 1NBWA 2PZTA 2TMPA 1QOBA 1VQHA 2FCSA 1H9SB 2PJHA 2SEBD 2WXGA 2N1WA 1SMYC 5IP9H 2PTLA 5C3XA 3M85A 3PQIA 4DR1L 1BO0A 1SGHA 2DZIA 2H88B 3GV3A 1YIJA 2KCNA 1E0ZA 4A3BH 2BOSA 3H09A 4NW2A 3H7SA 3WOFA 1QNKA 2VXWA 1QOAA 2CU1A 3LXFA 1RF2D 1T6BX 1QCBD 2LVPA 2YU9H 3RNAC 1V6EA 2WX1A 3OIQA 1CI3M 4NZLB 1J7AA 3DOWA 4L2YA 4DHJD 3RLFA 2RPVA 1WM2A 2CKZB 4CYEA 1EQRA 1TIID 1YQ4B 1QF6A 2AKWB 3QWNA 5E1FA 4EQOA 4LUVA 5GAGC 2HQEA 3CCRA 3R3OA 3J80E 4FJVB 4C7ZA 4DGZA 5HGTA 1ZGUB 5IP7G 3RNEC 2VQFL 5A2QE 4B3ML 4LF5Q 4GS3A 3FVQA 1L6VA 4DXFA 3WAPA 3PO2B 4FHJA 4RNAA 1S5BD 3RUZA 2LHDA 1WYDA 3GTGB 1OGWA 2QSDA 2M4NA 5EAYA 2JA9A 3DMUA 4LUZA 2K5HA 4JI1Q 2EY1A 1PA6A 1QQRA 1KD1C 1NDDA 3B1LX 5IY0A 1BVSA 3NUCA 2PCFB 4UAIA 2XN9C 2VUMH 5F2DA 1GOZA 1AZPA 1H8CA 3H9DA 1F2RI 1GUNA 4JI3L 1TS4A 3CMEA 3HFZB 2VW9A 3P4PB 3HOZB 1NR4A 1SXTA 4JPBW 5IGFA 4B3RQ 3A9KA 4FADA 3NOBA 4A3DB 4US8A 3EA6A 4B9KA 3NWSA 4M02A 1YNXA 1M90C 4LK1C 1EIHA 1EWCA 1YNJC 1E2WA 1C79A 2BPSA 2HD5B 1Z47A 4IWOA 1GB4A 4BBRH 4JCVE 3A74A 4R4QA 1R4NI 3NUHB 4ZRKA 4ME5A 1HTPA 2AMCB 2IO3B 2KMAA 3C19A 1NYQA 3K6OA 3KWVA 4EX5A 4YWGG 3SR6A 4DU9A 1IKMA 1NENB 4OIJA 1Q7YC 4G7OC 4PZ8A 2E2DC 1V1PA 1QKZA 3RI7C 4DN4M 2UUCQ 4HCEA 1WIAA 2HIVA 3TP8A 4R4CA 3PO3H 4M00A 3CCJA 3VR4A 1G8ZD 4LF5L 1FCLA 1CZGA 3PO2G 4XYQA 5H92C 1EZ8A 1WD0A 1CZPA 1FNVA 1RHPA 3MXUA 3HOUG 4G11A 2RDGA 4YCVA 3K8AA 4YSZB 3RLOA 1ILQA 2DBYA 3BK2A 4K3CA 4LNIA 4LCDE 5FJ8G 2VB2X 3GTPB 2O2LD 2RGFA 3RR5A 4GN4B 1D7QA 1N6ZA 1DM0B 4R1JA 4EGVA 3SU8X 2D9UA 4B95A 5BN5A 1F2RC 1RM6C 3CRLC 4TKOB 4IFDH 3M7NA 2UXCQ 2DNEA 3HRDD 3VYTA 1A5RA 3ND9A 2MHJA 4H0LC 3HOZG 2DYMA 2GRIA 4GGQA 5DPWA 4A3DG 4B3RL 4W9LA 1WCMG 2O6VB 2NN6G 2OF1A 4PV1C 4KVGB 3DVGY 4KLKA 4A3CG 2DN8A 1BOSA 3S2HB 2WP8J 1NE3A 2INDC 3I4OA 3EUB2 4DF7A 5JVG3 3NK9A 4HTHA 2BB5A 2BYEA 4PYUA 3U30A 3EN2A 4ZHOA 1G51A 2J0JA 3VTVA 1KQSA 1K8RB 2D62A 2O4XA 5CC4A 2N3SA 1TQOA 4YCUA 2VQEQ 2DY7A 1TGZB 3PZ8A 3Q3MC 4KSLC 3RZOH 3K59A 4HCPB 2UUCL 2PNRC 1VDZA 4R8NA 2DJGC 4RGTA 1SNOA 3E3XA 2NVTB 2IGDA 5IE8A 2DGYA 2ZNVC 3AM9A 3S1RH 4B3TQ 2GBRA 4WWNA 4MGKE 1A3UA 5JPNC 2LMCA 1YJ9A 2ZCBA 1JWUD 4WIPA 1ZXHA 4MT5A 4BBRB 1K9MC 2E5LQ 2KNBA 4I6NB 2SDFA 2UXCL 4WURA 2K32A 1VQDA 3H6NA 3BY4B 2A1AA 2QILA 2RCFA 2HE7A 2KDMA 4AJYB 4RKLA 5IYBG 5KGUA 1EYDA 3BZKA 3L7ZC 2EYPA 4WWPA 3TEXA 3H6MA 3KQ4A 1SEBD 4WJPA 1VQIA 3OJ4B 1YHQA 1YJWA 3MC9A 2PW5A 3A0JA 1QZGA 3S17B 4ZUJA 2NBUA 4BBSG 2F0DA 2G45B 4MGYE 4EZKA 2H89B 2BYTA 2AQ3B 4LW1A 4TQ1A 2VQEL 2F0NA 3MXNB 1R9TB 1Y8PB 4ZRZA 5LLIA 4TQ0A 2BA1A 2L12A 3MXPA 3NSWA 1RFAA 2EMSA 5GADC 5FR3A 1FXAA 1D1KA 3C2PA 2K33A 1HRJA 1JC7A 1WE7A 3T16A 2QF7A 4DUYQ 4BS9A 3PHWB 3QK0A 1GXDC 5LMNW 2NB0A 3BU2A 1E8WA 2Y5BB 5HFYA 5J1ZA 2IY5B 2H1EA 1G6PA 1HFNA 1JW9D 2R7ZH 1X3QA 3SGIA 5LMNQ 4MEMA 4W9HA 1GPXA 3J80i 1FL0A 4RGMA 3Q8AA 3DWPA 4QQBX 1E7ZA 1U4MA 3QR8A 2BWFA 3DBSA 1WD1A 2NN6I 2MBHA 2KTRB 3P1HA 3NHHA 3K5NA 1PH8A 4YCWA 3R7QA 3GV6A 1TKYA 2E5LL 1U4AA 4C1NK 2W9NA 2AQ1B 1KL9A 4F88A 1STBA 2R2OA 2O6VD 1E24A 3ONSA 2LVOA 4RAUC 5JOBA 2KN5A 2C7HA 3QQ8B 4DDID 1EWHA 3KBXA 2PVGC 2AHOB 1HCZA 2AUKA 1N8RC 2VL6A 3RZOB 3ZGZA 1D6EC 1XX8A 4RG1A 3ZVVA 1KOTA 4R3DA 5G5HA 4KJNA 1GUSA 1I5FA 4IZ8A 1U0LA 1N32Q 3NS1A 2E2IB 1TZOA 2KMCA 3N32A 1PV4A 5JJLA 3S1RB 1O80A 2BYFA 2O2VB 3GTJH 1HZCA 2FHTA 4DR2Q 2L5TA 2MH7A 4GLVB 1XMQQ 2WYQA 4FN2A 1P7FA 4DUYL 5K36H 3TS0A 1JE5A 1WMHB 2JA6H 4JIOU 3OMCA 1T5XD 2M00A 3KW5B 4FJYA 3U7DA 4KGSA 1H9SA 2KC1A 3U52E 5LMNL 1SE8A 3M62B 2J0MA 2R7FA 4AQYQ 2D07B 3L2PA 3KDFB 3CF6E 1ZKOA 1DONA 2HDEA 3OLMD 2L8JA 1NAPA 1HE8A 3RFZB 1WWTA 2PEAA 2F0KA 2JE6I 2VY3A 4X3UA 2LGIA 3S1QH 3PF5A 4GLAC 3J81j 3TSSA 1PRTF 3U4VA 4KY7A 4CKEA 1GD7A 2N4FA 5C0XH 2PO4A 1CHPD 2K6DB 2NVXH 4JBMA 5G5GA 2MLBA 4IJLA 3M4OH 2K9XA 2EPBA 3WWVA 5FLMG 4A3GH 2O5JC 1GUTA 4IOCA 1PDXA 2OOBB 1QNUA 3NZSA 1BT0A 1MPEA 4ODGA 1L0YB 1PRTB 4NPSA 3RLNA 3AE8B 1S40A 3U8ZA 1N32L 1D8LA 2KQ7A 5C5LA 5AFWA 2LVQA 3GD7A 5FLXc 3ZKJC 2B63H 4PS3A 1ML0D 2NVYH 3RD4A 2JA7H 1PFDA 1PH2A 1TS3A 2K5NA 2NUCA 3DDCB 1WFQA 3FKIH 1KRSA 4ZQ3A 3OAWA 4DR2L 4TUUA 4YSYB 1YVCA 1GNUA 1EY0A 4HCNB 1V97A 1XMQL 2CH4A 1KDCA 1B9MA 4DV4Q 5CV7A 1DZ1A 2OQ0A 1WSPA 2KQ4X 5JZEB 3VR3A 1YEZA 1L0VB 4DA2A 5BMGA 2KBNA 3EVQA 1NTGA 4GB9A 5IAAC 2IJ0A 1DD2A 1KM7A 3A54A 2CU3A 2KZRA 3CXCA 4HJAA 4W9KA 5E3FA 2MW5A 4AQYL 3C0RB 4WH4A 3D4RA 2E8GA 4UDUC 4G7ZC 2FUHB 3IAM1 2JA5B 1II3A 2DENB 2W54A 5AZHA 2RCNA 4FLHA 4MSQB 2FUG1 1L6UA 2NTSA 1K8MA 2LXJA 3I2ZA 2KDEB 3D3RA 1EY8A 5FOBB 2INNE 1AE2A 1JROA 3GTMB 3P42A 4N59A 1FD6A 3UE0A 2OT2A 1WJUA 3SFEB 2QEXA 3L54A 3BVZA 4F87A 3GTJB 1FYCA 2GI9A 4WJWA 3KH0A 4JI7Q 2RHSB 1WXMA 2JZPA 2VZKB 1D1IA 3VYUA 3E9SA 1TZ1A 2BW2A 1TWFH 2GVBA 2N78A 3M4PA 1DOMA 1XLPA 3L13A 4BKSD 5EGTA 1A2UA 4ZHPA 1U4LA 3WIMA 2VNUD 2E74C 5CV4A 5FK9C 4CJ1B 1VRAB 2BYVE 3A9JB 4DV4L 4HJ8A 1E3PA 1TWGB 4YXDB 4C3HH 3TZUA 3CCEA 2L1AA 4H2AA 5G3LD 4DDGD 4E3CA 4A3IG 1JOQA 4RCNA 3MFYA 2NZOA 1FRRA 1ZW7A 1CQVA 1IW7D 3H0GB 2LFIA 2O6VA 2WDRB 1ZDXA 4LF7Q 3M3JA 4HEA1 2HCCA 2JA5G 1TY2A 4JI0Q 2MBBB 4II2B 1BUIC 2LXAA 1WZ0A 1I6HH 1XLOA 1CKOA 1J6QA 4L1BA 1HZBA 3BK1A 3AB9A 2OWOA 4G3XB 1B1ZA 3ONAB 2LEKA 2KLCA 4LNFA 3DQVA 2JA7B 4KSKC 2D2QA 3RNFC 1MHXA 1PRTD 1WGHA 1LACA 2H5XA 4B9XA 2L1BA 1JRUA 1HQMC 1VLBA 2KDFB 1AW7A 5EE0A 5A2QL 3RNCC 3LNNA 3V2TA 4JI7L 1P1AA 2L3ZA 4AP4C 2DYBA 4C4VB 4TSSA 1LTSD 4OZBA 1V8QA 1PHJA 2Z6KC 3NTKA 2CH4W 4HLEA 1VQ7A 1BBWA 2KWCA 4X3SA 5D14A 4DV7Q 1J8IA 1GJZA 3NQIA 1IBLQ 1RTOA 1N9WA 1FXTB 2LGXA 2FAZA 4MDKE 1YN4A 1B7YB 3Q8BA 1UWMA 1D2BA 3JYUA 5DM73 1O7IA 1JJGA 3I9V1 4YT0B 3TBLD 3KF6B 2UXBQ 2E2JB 4C3IB 3OG5A 1WYGA 1SE2A 2OJRA 3PTFC 2HDMA 2N7JA 2F0IA 1FMAD 2J0KA 4HN7A 2MJEA 2F0JA 1BMLC 1WTVA 3H0GG 5E4WC 2QCPX 4HDOA 3F2UA 4LF7L 2MGSA 2NVQB 4JI0L 1V43A 1XCTL 1B3AA 3K5OA 3KYDD 4F7ZA 3J9CA 2GMIC 2EYLA 4EQPA 4IQZA 1JICA 4NP5A 2K22A 1OEYA 3GOEA 4TVAB 4QB4A 1HZ5A 5JJIA 4IFDJ 1TKEA 1L0WA 1XF5L 2M1MA 2K8HA 3MXNA 2ZW1A 3X23A 2VZKD 2L9HA 1SE3A 4IPHA 3NVVA 3VQIA 1JWBD 5I2XA 2A6ED 2F52A 3PZ7A 1GKHA 1X32A 2I0QA 3W5VB 2ZTDA 2F1MA 4CGYB 5IYDG 1TXYA 2P5ZX 4C3HB 2JZ3B 3TZDA 5BR8Q 4AYBB 2JYEA 5I9OA 1BKBA 2K8CA 4ILWA 2Z6KA 4DV7L 2KDBA 4EQNA 1IBLL 2HJ8A 4XWWA 3CCSA 2JXTA 2EIFA 4IUQA 5C4JB 2F3IA 2JEBI 1PUTA 4RGNA 3U58A 3IFTA 2B3AA 1I4HA 2RPQA 4DR6Q 2KCCA 1SE4A 3NJTA 4GOCA 2KTRA 1DYQA 3AE7B 1RFKA 3UQBA 1STAA 1I6HB 4OWXB 4C3IG 2A5UA 1Y1WH 2UXBL 2LZ6A 1UBIA 4A93B 3HK0A 3U4EG 4BA2I 1D4BA 5T1IA 2YV5A 4DAPA 2KQ3A 1I35A 4RM9A 4DK6C 4ANXA 1UEBA 1VZ6A 4NPNA 1LTAD 4A3MG 1HHVA 3LWEA 3HOXB 2LRUA 1HUNA 1Y56A 3DHIC 3Q8EA 4EUTA 5LNK1 2RF4A 2HIXA 1KTKA 3PF4A 1E7VA 1DOLA 4IURA 3IFWB 1F2ZA 1PRTC 3P4SB 3I4NH 4NAMA 1B9NA 3A8KE 2YEPF 2XEWA 2BVCA 2EELA 3BZCA 2D10A 1W2BA 3LWUA 3MC0B 5CYUA 1GJXA 2FBWB 3DBLB 1NYRA 3N9YC 2CKHB 1CQFA 4TV3A 1PGAA 4JI2L 4XYCA 2O2VA 4BKGA 2DNCA 2MO1A 4L8JA 1QB5D 2F03A 2IYDB 4YTMB 5TSSA 3GTOH 2WQYB 4BOZB 4BFRA 5C4XH 5JEAG 1MJEA 3ZRCA 1XYIA 4BKSA 2ASQA 4AYBE 2R2QA 3N20C 5C2TB 3R2IA 4UY8C 1KHIA 4AYBG 3OHXC 4PK1A 5M5XH 5BR8L 3I55A 1KXLA 2WHIA 3M4YA 2ZXRA 2DY8A 1X3EA 2CJOA 2XIWA 1EM7A 5GXGB 4U673 3KDFA 1GC6A 3QX1A 4MZ9A 2M17A 4DR6L 1Q1BA 4PNYA 4RMAA 2K05A 1X6OA 4L5RC 4MGZE 1Q12A 1CZWA 4A93G 5IT9c 4V0BA 3BIID 3SK4A 4K5XA 1HQRD 3ULLA 1MIUA 4EFOA 2RR9A 1B4OA 2M9VA 2X6GA 4ABNA 4E71A 1PTOH 1T3QA 2LY7A 1OXSC 1V2YA 2R93H 1TBEA 5EPKA 3AE4B 4NAWB 5KNBA 3T1YL 4TKNA 4A3LG 3BINA 4EVOA 1KLUD 3JSVA 2QDBA 3HOWB 3DBRB 2K39A 2K6QA 3ZJVA 1WJ4A 4HROA 3DWGC 3H8HA 1BQQT 1U5KA 1F9QA 3UDIA 4DK3C 4FXGC 1LTTD 1E8ZA 3ECIA 4KHPQ 4NJCA 2A4ZA 2I46A 4BY7B 2MEKA 5FO7B 1V49A 3PLVA 4LMQD 3R93A 4BXXH 2B8FA 4L63B 4WWOA 1B3QA 4K14A 3NEMA 1K83H 2C9WB 1FNWA 1RKNA 2ASBA 4OWWB 3X3NA 4UP7A 3ZTCA 1ILPA 1ZYRD 5I2YA 1Y1WB 5HY6A 1PH9A 4FHKA 3L08A 3VRBB 1T5EA 4DUZQ 3N6RA 1ROEA 1M8AA 3G7LA 1QG7A 1V81A 1O78A 2FE8A 5AUKA 4GMVA 1WTQA 1EOVA 1X9NA 3V62A 4V190 4DR5Q 1TWAB 1DXMA 2KWVB 4K6DA 1UNSA 2NBVB 2K5WA 1OXTA 2R3ZA 2K1FA 1K3RA 3JAMc 2UU9Q 4PS7A 1Y8NB 2KJXA 3TJPA 5KEEA 1E2ZA 2LASA 4GKJQ 3CCVA 3M3YH 3I4NB 2BS2B 1YJIA 1P16A 2M0AA 3EBEA 1ZEQX 1SDFA 1HEZE 1FNUA 5IGDA 4HJKA 4P1BC 2JT4B 2KD0A 2R92B 2ZCCA 2D2CC 1G291 2MJ3A 1X3PA 4WAAA 2KEDA 5FJ8H 2E75C 2N9LA 4W9EA 5D6JB 2H4OA 3HOWG 5IA7A 1L4DB 5LL6X 4LLGM 2M8SA 2OTJA 4OZCA 2Z59B 1MG4A 3WAOA 4IUPA 3PGZA 5D7GA 4DK5A 4F8MA 4QIWB 2KHWB 4C2MH 2CHWA 1NMFA 2WLBA 4LDTB 2XRQD 3P7JA 1YBYA 4OX9Q 1S1QB 4W9JA 1K8GA 3CP0A 4DR4Q 4GU2A 1K28A 3E5SA 4KHPL 1VQJA 1EZ6A 1BF4A 4BY7G 2XWBB 1WCMH 4GOPB 5C0XJ 1FXIA 3W2DA 4JI3Q 3TN2A 3A9JA 3QO2A 2V3NA 4WJ4A 3K0XA 4N9PA 2INPE 1WE6A 4KJOA 3I3CA 5K5PA 2LD9A 4DUZL 1GUWA 2BDNA 5FKAC 2KFJA 5BO4B 3GO5A 3SK5A 3AE2B 4IWQA 1L2FA 1I6VC 3CMAA 1PTOB 3VAWA 4DR5L 2R93B 4G4KA 4YIJA 1ZXIA 2LXKA 2F0TA 3DVGX 3NWTA 2Y0SB 1E1OA 1O7ZA 3ZYYX 2UU9L 2CWPA 4GKJL 3PZDA 5JJZA 5IYCG 1EEID 2KENA 2GB1A 2KFKB 2JXXA 2R92G 3I7FA 1SNMA 3DBLI 1SSNA 2Z4HA 2YTYA 3MVVA 4XQQA 2ZZPB 5IGEA 1K3BC 1RLFA 5CMDA 3QA8A 3BVMA 3MXGA 4H13C 3HOVH 1LLRD 4P71A 2FCMA 1Y8OB 2PE9A 4K7SA 3FP9A 4AJWA 4F7XA 1VQNA 4NQLB 4C4VA 4C7YA 1S4ZA 4P2CB 2LJIA 3R2TA 3Q22A 2IGGA 1LV9A 2KA7A 3KF8B 1MG8A 3VDYA 4ZUIA 2IHFA 2XGTA 4OX9L 4IJHA 4DR4L 1RL2A 1ZYRC 3AQQA 5M5WB 1A6XA 2EJGC 1PGBA 2MRPA 1MGSA 1K51A 2N9XA 4OIKA 1PYSB 3ZIMA 1TY0A 2NWGA 1ESRA 2MBOA 3H1UA 1NSNS 1G2SA 1D5XC 2A68D 4K6LA 2F0QA 2MSED 3EECA 1I3QB 4IKGA 3AU5A 1ICFB 1LT4D 2EOTA 3KF6A 4LFBQ 2Y5PA 4XDDA 2PZWA 1SSOA 3GTQH 5COYA 3WANA 3S1MH 1YIWA 1P98A 4WJQA 3S15H 3J81c 1FGBD 2QDFA 3I4MH 3CKIB 3V96A 2YVCA 2Y0SE 3M7GA 1Q1EA 4JE3B 5DAUA 2WDQB 2Y0SG 3E6ZX 3DWMA 4QY7A 3VXWA 1YX5B 5M3FH 3DBRI 3BG3A 1XPRA 5GAHC 1B44D 3VTWA 3TMPB 4DQOC 5JH5C 2CR5A 1PZID 1SJHD 2AWOA 4R9WA 4FP5D 4CDDC 1Q81C 1LTLA 4LNKA 1FGUA 4BY1B 4DAYB 1WJNA 5E6PA 3WAMA 5KNCA 1JQYD 3CCQA 5KNDA 1WTPA 2SAKA 2WKCA 2IBIB 1RJTA 1NR2A 4LDTD 1TU2B 4O42A 3U4ZA 2V4DA 1HZ6A 1Q5WB 2LI5A 4XDXA 3K9PB 4LFCQ 2DAJA 3V6EB 1L1OB 3ND8A 4I7ZC 1MI0A 3K80C 4QCLA 3AE1B 1TKGA 3DCGA 5C5MA 3IT6B 1ENCA 2F3WA 4CKBA 3KLSX 2E2HH 1G2TA 3JVZX 1PZJD 3D31A 4A3BB 3MP9A 1HNWQ 5GQOA 1VZ8A 1WGDA 2K03A 2K25A 2IGHA 1K53A 1Q0WB 2L0TA 2YU9B 1J9OA 3AEEB 2F0VA 3Q24A 3EHVA 2OEDA 4FF1A 4LFBL 4PYZA 3I56A 2AWNA 1T0YA 3V6CB 1EIFA 2VB3X 2IPKD 2VS1A 1HZAA 2JEAI 1YD8U 5CGKA 2CCZA 1N60A 4QL5A 1E90A 3AECB 1ZP0B 1WH3A 2I2YA 5A35A 1XLQA 3A1QA 3B6YA 1J19A 4DK0A 3QWZB 3RN5A 2ON8A 3S9WA 3MHBA 1PH4A 1RYJA 3RN9C 2HHHQ 1UE1A 4C3JH 3F2DA 1V5OA 1KNAA 4CQNA 4LJZC 4KKTA 3OYYA 3RNGC 4A3KH 4IM0A 1VJKA 2M19A 1WXAA 2CS4A 4JOIC 1LTID 4LJPB 5EBCA 3C8YA 4UHVA 4DWFA 4KZCA 1SIFA 2VUMB 2UXDL 3NENA 2QDLA 1Y14B 2K7VA 3AFQA 2K5PA 3CCUA 2NMQA 3R66C 4YSXB 1XMOQ 4LFCL 3PIP3 3KYHC 1EY6A 1UAPA 3NELA 4O0AA 2IWHA 5IP9G 4WJ3M 2X8XX 5CHVC 3CC4A 3QAQA 3DHQA 2N9KA 1KABA 2ZPNA 2KLGA 2A68C 3I70A 1STNA 3DWQA 1N5XA 3HOYH 3ABVB 1JWMD 5T8IA 1OQRA 4S3SA 2HQLA 4II3B 1AEXA 1VCBA 3I4MB 1AH9A 1HNWL 4X6AH 1LTBD 2A6HC 2SOBA 1IUEA 4URKA 4YTPB 5KHQA 1X55A 3NTIA 1SRUA 4XGAB 2E76C 2YLMA 3KVFB 1SYFA 2ZW0A 1IYJB 1WRIA 1B70B 1FFUA 2IY0B 2FMMA 3F2BA 2ZM6Q 1LABA 4LAAA 5ELOA 4BAXA 3K7UC 5I6WA 3TRZA 3EQLC 1BCPF 3WALA 4A90A 3HP3A 3VYRA 4CDCC 3TEYA 1H95A 3NZUA 3NBHB 1HXYD 1E9MA 3PO3B 2SNSA 4NAWA 2K75A 2KX3A 1XTDA 3JC66 1M1KC 1K73C 2FXQA 3APDA 4IUMB 2KUMA 1PFBA 3CQZH 3HIZA 1QVCA 3ZDMC 2C7MB 2KVRA 4LF9Q 4RFBA 5L37A 1BCPB 5EPJA 2HHHL 1UF0A 2OHFA 3FILB 1C4QA 3AMZA 3PGEA 1CTMA 1H9MA 3FDTA 1KFYB 1ACCA 1WXQA 2DLBA 2EY5A 5C4HA 2QA4A 2WXHA 1T9HA 3URYA 1XT9B 1SYCA 4GOPC 2HTME 1Y1VH 2MA9B 1C9OA 1IKLA 4JOIA 4MN3A 5DLQE 1C4CA 2VUMG 5E7NA 2FCNA 3RNUA 1SR3A 2XVSA 5ELFA 2B2WC 4IPGA 2Z6BA 3T9LA 1XMOL 1F52A 3S14H 5BYQA 3NQTA 2JWUA 2WFWA 4Y52H 3A7LA 3PV0A 4S17A 2KK8A 1VQ9A 4XYOA 4JC0A 4Q5VA 4JYAQ 4MIUA 4KIKB 3MC8A 4XDCA 2K50A 2V1YA 2F0EA 1X1MA 4OWTB 1PTOC 4G57A 1TYGB 4BBRG 4EEWA 2KN4A 3GTKH 3NP8A 2DJFC 1UUPA 3R8BA 1WGRA 4QUCA 2K0PA 4HR7B 1S5ED 3CSTA 4GDLB 2F0SA 4ZCKA 3GZNB 3ML8A 3TEZA 1DGSA 4AH6A 1Q1OA 4JX1C 4P75A 2ZM6L 5IP4D 1LXDA 3FMCA 3V05A 3E9HA 3CC2A 1MJDA 3I72A 2EY6A 3PO3G 1IBKQ 4I7AA 3GTLH 4OW0A 4FA6A 5EDSA 2ACZB 2NPTB 4BBNF 1EWIA 2WV6D 4OO1H 2EYMA 4NKLA 3TL5A 3MTNB 3TEWA 2I1JA 3AEGB 4FBJB 1CKNB 4A3JH 2Z4IA 2L7RA 3AEDB 4LF9L 1OQYA 4EE2A 1CHQD 5CV6A 3Q14C 4EOYA 4JWSC 4BA1I 1JB3A 2Y3AA 1JWSD 2KCMA 2L15A 4J1MA 5ISRA 3J7YW 1WX9A 2QKIC 4YHHQ 2HCIA 4MTNA 3SVMA 4GOPA 4E74A 5G3LF 2BB6A 2NZ1D 2WIIB 1BDOA 4L5TA 4IFDG 1EY4A 1CM9A 4X57B 2NYZD 4A3EH 2B2WA 2J53A 4MGIE 3H3VH 4RWSC 1Z7TA 1A3VA 4JYAL 2LUEA 2MQJA 1SYDA 2KJ6A 1RWSA 1AN8A 3NVYA 1M4VA 3VA7A 4LFAQ 1SNDA 2ZXOA 2RHQB 3KJOA 1QILA 4XZ4A 1I42A 1MHWC 2MO0A 2WXLA 3E0EA 1WI0A 2W3RA 3I8ZA 1NEKB 2IZVB 1RTNA 1I4PA 2RVLA 3RUIB 4ANWA 3ZQ4A 2F0LA 3CPWA 2LXCA 2NZHA 4Z9CB 1N34Q 3AV8A 2KFKA 5D3DA 4G50A 4XWTA 1G91A 4A3FH 4HJGE 1IBKL 1Y1VB 3KFUA 1SYBA 2Q8RE 4E6IA 1UH6A 2JWZA 1BCPD 1WTRA 4JVZA 3NPPA 3K9OB 3J81E 3O13A 2ZJRA 5M3MH 1RIPA 1C1YB 1L1OC 3X3MA 1GHJA 4ZYSA 3S14B 2R7ZB 1Z5SB 2I5MX 3KF8A 1C78A 1K50A 4MJSB 5I6YA 1X54A 3KJPA 1NUCA 1EUVB 5CX3A 1TIFA 3PPAA 3HVZA 3U9OA 3CCMA 2L76A 4YHHL 2LUMA 4DXAB 4DV1Q 4LK0M 4DV3Q 5C3JB 3GTKB 5C44H 2EZVA 2CJNA 1W6JA 3A4RA 2QIEB 2N88A 2R7DA 3L9AX 2NS5A 2K1BA 4ZYNA 1F2YA 1R4PB 2L0CA 4IUVA 1QOFA 1EIYB 2IW3A 1XWEA 2KWDA 4LTUA 2IO0B 1I50H 4JG2A 4XC2A 3I73A 1YMHE 1QUQB 1CKMA 3F1ZA 2D0OA 3NVZA 2FIFA 3Q23A 1Q86C 4LFAL 2G9DA 4F1SA 4CHTB 3GTLB 2K28A 1N62A 1M94A 3K81C 4JPSA 2NBFA 1PFSA 3MHSD 3BDCA 5M5YH 1WTOA 3DEOA 4N8X1 2KDIA 3QIAA 1EFID 1N34L 1EY9A 2WXQA 1C4AA 2GBNA 1HH2P 4DAYA 3LDZE 1XXGA 2V0GA 1AP0A 2JA6B 5IGGA 1JOKA 4IFDI 1U9RA 1VQBA 4P1CC 2R7ZG 4A3EB 4ITKA 3SE0A 1J8CA 1NJIC 3ULPA 2KEEA 1L1OA 4FF2A 1UWXA 2J7ZA 3ETRA 3QHTA 4IOIE 1LT6D 1C77A 4MH8A 4RHSA 1MFWA 2WX0A 1S3OA 2VH1A 2R61A 2BH2A 1ASZA 3S1NH 4ZDVA 3PSEB 4DV1L 4DV3L 3TS2A 2GVAA 4A3MH 2LWPA 5MPOA 4JI6Q 3S1QB 2FINB 1E8YA 2B8GA 3HHMA 1Q8IA 4KTAA 2WXOA 3LB8C 4B0MA 2INCC 3GZNI 3UDFA 4HKQA 4MSMB 1ESFA 2NVXB 1XEEA 5HHDG 3AU4A 5FO8B 3M4OB 2QMTA 3P1MA 1XLNA 4A3GB 3OPOA 5HKHA 4ME3A 4W9GA 5DM63 4TQUS 2B2TC 2ZPYA 2JQOA 3K0YA 4H7BA 1V8CA 2DZJA 2REXA 3KUPA 2GOWA 2K5QA 3BS1A 1ONLA 3FRPB 1AWDA 1BCPC 5M3MB 2B63B 1X56A 2A69D 2KECA 2NVYB 2AL6A 2C60A 3EFXD 1WXSA 4R4TA 5J22A 4WQMA 2AQ2B 3FKIB 4HIKA 2I1KA 1L7YA 2B29A 3AE9B 1BBUA 1SAPA 4EZLA 2UUAQ 5K36G 2BA0A 5IOCA 3M95A 5J17A 2JA6G 5C44B 2C5LC 2JA8H 2K8BA 1LO5D 1EO6A 3GQBA 1ZKHA 3CIRB 4GLSC 2EY2A 4REZA 2L4NA 2PNHA 2MCNB 4AQ7A 1I50B 5J3BA 4GDKB 1E6EB 5CHWA 2IO2B 1IYUA 2M2LA 5G55A 2IX3A 1TWCH 3GE3C 4K2LA 4X3KA 3K58A 2KT7A 3RD2A 5JJKA 5GROA 1C0AA 5IGBA 2KACA 4JI6L 3BYTB 2DHZA 4AOFA 3KUCB 1EYAA 2KVZA 1LT3D 3UINB 1V1QA 2EQSA 4J6HA 1FVIA 2LGDA 5C0XG 3L4PA 5CV9A 4CDEC 5IGCA 1WJ6A 5M5YB 1QOHA 2F0UA 2A19A 5C4ZA 3NRZA 4A3GG 4DK1A 4WAFA 1H9KA 2L11A 5IOIA 2WAQB 3OW2A 1E1TA 3NBHA 4GNXB 1RCVD 2KYWA 2B2TA 2HT1A 4KMUC 1BR9A 1TWHH 3TCAA 2BCOA 4ANUA 3J80c 2B63G 1TWFB 2JA7G 4JI2Q 3A9KB 4FXCA 3CD6A 4P73A 1MD2D 1RD9D 3FKIG 1HNXQ 4FF3A 3FILA 1SNQA 3H7PB 4EKUA 4BBNC 5C3EH 1SYGA 3I4LA 4JV5Q 4NJ6A 3E56A 4K2KA 2UUAL 5LHY1 2V9HA 2KHIA 4WRDA 4M8AA 4HJ9A 1R7SA 3DLLA 1V9JA 3RULA 2WINB 2JRHA 3N1XC 2CHZA 2RMMA 4XXEA 3EGRA 3P20A 1V80A 3AE5B 2WXMA 3WOEA 4GIVA 1B53A 4DHZB 4IG7B 2PMVA 1L2NA 2C35B 3SHLA 3L0OA 2PQAB 3KLRA 3TQYA 2BQQA 1LT5D 1QWYA 1Q10A 1T0RC 3WCQA 4M1UB 1IYFA 4KHVA 3VR6A 4GDLA 5IKCM 4OO1I 2J7QB 1WTHA 5LMUQ 2ZTEA 1Z9FA 1A70A 1OXXK 4HXDA 3Q3OC 3T1YQ 1SIJA 4A20A 3RZWC 4XX5A 5JXVA 2A69C 3I91A 1HA5A 1VQ4A 3HUIA 3QOLA 2NCNA 4RMFA 2JVCA 2PIAA 1V1OA 1VZ7A 3A5ZB 3OIPA 2JA8B 3F2CA 2L83A 3F8TA 5CV5A 4LF8Q 5EE1A 4POFA 3MJ5A 4RA8A 1HNXL 3PUVA 4GLXA 2IX1A 2OCEA 3VR8B 5J2RA 4ID6A 5DEHA 2EJFC 2NVUI 4JV5L 3W1SC 4OEMB 2PW7A 3ZJYC 2F0PA 1Q82C 3PCOB 2JRIB 1T0SC 1PYWD 4C3HG 1WMHA 3U9SA 3DHHC 2ID0A 4XQNA 1F9RA 1HJPA 3UIOB 3BJUA 2QCZA 5AUIA 3P4RB 1CA5A 1PMRA 1XJVA 2Z0EB 4DHZE 3HVDA 3C1EA 1WM3A 2PLPA 5C0XI 5C23A 4CJ2C 1XD3B 5FLXE 2L0FA 5IP7H 4R4IA 3PHXB 4FF4A 2ENBA 3KUZA 4K5VA 2KO3A 2KHSA 2EE1A 2EXZA 2OXPA 5JPMC 4JLCA 1H4RA 2CW0D 5LMUL 4ZRQA 4FJZA 1DGJA 2LMCB 4KY5A 1DJRD 3VUYA 3HOXG 2N0SB 3L10B 2QC8A 3EIVA 1PH6A 4OVZA 4DV0Q 2EYJA 2A5HA 5H1SE 2EJMA 4KHZA 1HTLD 2G4DB 1XTCD 4IM2A 2IDYA 4LF8L 4JGHB 3JAML 4ZKCB 5KIXA 4HSVA 4GKKQ 4HRSA 3DEPA 2WACA 1WGGA 1FD7D 2J42A 4MJSA 2CQOA 5ELNA 4HPLB 1R4NB 4KZ0A 4C1NI 4X66Q 3B9JA 1JRPA 3W1SA 3OW7A 4N9F4 3V60A 2K5VA 4NDXA 1GUAB 5HI1A 4HWIB 3OOCA 2OJWA 1OO9B 4HDQA 3VR5A 4APVA 2AUJD 3A4SC 4N6EB 1A2TA 2G1EA 4HAEA 2ZJQA 2QHOA 3ML9A 2WNMA 1PFMA 1N36L 3H94A 3O65B 1E0BA 1LQBA 1QUQA 3T53B 3IT4B 1UGMA 3PLUA 4K7WA 2B76B 1VCIA 1UWVA 3G71A 2LSSA 3LYYA 4N9TA 1EWYC 2ZT9C 1PZKD 1WR6E 2N8NA 5EKIA 3PO2H 4HPPA 2CVRA 2ICIA 3HOUH 4DAMA 2JX5A 2XTIA 1GG3A 4WJNA 1F0ZA 3CC7A 4YY3Q 3GTGH 5IO9A 1B2TA 4JI4Q 1E2VA 3ICEA 3UF8A 2B39A 1A0IA 1IHZA 2K6AA 4A4IA 1J5EQ 1ZUD2 1A15A 1CSQA 2RSNA 1KH0A 2G5DA 3DM1A 4UPAA 3GTOB 5C4XB 4DV0L 2EDGA 2EVBA 3L16A 3ZNID 3MEFA 3FC4A 2MFIA 4FXKC 2WGSA 3AEBB 5D2MB 3KUDB
chains in the Genus database with same CATH topology
5M5XB 4KI0A 3L3OC 2PZUA 2X6LA 2NN6H 3V3XA 1QJOA 4B0EA 2F0OA 2HUGA 3W5UB 1PTOF 1KAAA 1CK1A 4YTNB 3T4AC 1UEAB 2IL8A 4C80A 4P6VF 1C9FA 3HEJA 1QE6A 4IALA 1DOIA 4IDIA 2BS4B 3Q6SA 2F3VA 1STHA 2CW0C 2Q5WD 3IAS1 4KKJA 4OGQC 3AEFB 1S5FD 1RDPD 4MM3B 4AS1A 1F2MA 3EJIA 1ET9A 3MTSA 1IBXB 2F0WA 2KAJA 1CT1D 2J52A 1H9RA 3QG1A 3SK8A 5BYSA 3FPPA 1TVXA 1MVKA 1K83B 1YQ3B 4U68A 1UGJA 2KMMA 3NBIA 3FEWX 2BE5D 1BXTA 3J81L 2CHBD 3IXSA 5EKLA 3TP6A 3Q0AA 1TS5A 2RDFA 4MHEA 1P7EA 4A55A 1FM0D 1KF6B 1ZDVA 4WORA 4ZRPA 3SK6A 1W6KA 1YJJA 3BDLA 2K01A 3M3YB 3A7AB 2F0HA 2MJDA 4KGRA 3HOUB 5NUCA 2A6HD 2JU6X 2ZXPA 1JORA 4IUUA 4FXDA 2JYOA 3I90A 3U7ZA 2XNAC 4HCSA 4K8JA 1EOTA 4C2MB 1ICWA 4J3OD 3AE3B 5KYIA 5IODA 3S2DB 3A56A 3IKJA 1WCMB 4ZAIA 4MACA 2NTTA 4HSPA 3HS0C 2BS3B 2FJ2A 1AZQA 2JQRB 1JR0D 2W3SA 4ZOHC 2D5DA 5JEAJ 2RBMA 4L6TB 3ITPA 3C3LA 3BZDB 1O7LA 2WXJA 3Q69A 3K5LA 1PTOD 3ZJUA 3PIO3 1B50A 3K7AB 2PYKA 1CJEA 4RF1A 5HG2A 2PMZB 2RKSA 3HOVB 1L5PA 3K5MA 5D3IB 1OQQA 3W3AA 1F9SA 1FR3A 2PPBC 2HDLA 3QB3A 2WXRA 2A74C 5C6AA 2BE5C 4JK1C 3LX0A 3RMHA 3VRAB 4A9AA 5IT9E 3B2FA 2YYZA 1GUGA 1OXVA 1I4QA 2XRSD 5EE9A 2WU5B 2E3TA 2GA4B 2QJLA 3TBIB 2WXFA 4QMGA 4A8XC 3GTQB 4BBSB 3S1MB 3S15B 4RF0A 4D2KA 4FYDA 3TUOA 1KDAA 1EEFD 4K5WA 3PUZA 2BDOA 5M3FB 3MA2B 3Q8FA 1BUVT 1TT2A 2WXNA 1AYFA 1U4RA 4A6QA 2BBCA 2QEJC 3CU7A 5HURA 3RZDB 2OEOA 3A55A 4FVMA 1VF7A 3SR1A 3T51B 4B9WA 1K52A 1VMCA 5BMHA 3D6CA 4XT1B 1CA6A 2A73B 1JMLA 2EYOA 3JAME 5KYLA 3Q8CA 2E2HB 4I65A 2F0GA 1B9RA 3IL8A 4FNFA 3RPFC 4XE0A 1GHKA 1BNZA 1EY7A 3D6WA 1GAQB 4QUFA 1OFFA 1O7YA 3TDQA 1GUOA 3AN1A 1PGXA 1DOKA 1MSHA 2ONQA 2JYTA 3HZXA 1HPCA 2C5CA 4HEDA 3P63A 1L4ZB 4OL7A 4KKUA 3OWEB 3QOJA 4C3JB 1I4XA 4A3KB 5EE3A 4TMAB 5CBEE 1STEA 1EU4A 2XWJB 4XTCS 2J0TD 1NVID 2WKDA 5ELEA 2PQEA 1JWAD 3C46A 2F0MA 1JQ4A 2RDHA 3UI2A 4PMCA 1ENAA 1Y69U 3HGBA 1EY5A 5DNFA 4KX6B 3TP7A 1IGDA 4ZK9B 1I4RA 3HOYB 1IL8A 3NTHA 5ELBA 1VMPA 2EYFA 3MZ5A 3I57A 2SNMA 4PMBA 3P75A 1N63A 1FEHA 1EQVA 4BWGB 2DWQA 1WGKA 2L32A 3AE6B 2KVMA 4WWMA 4KK7A 5BN4A 5FLXL 2C9OA 2ICEC 5H8YE 5C3WA 5JVH3 5EQ0A 4WFN3 3CQZB 1GB1A 2I07B 1ZPSA 4CBVA 1FCCC 4C3JG 2Q8IB 4DNRB 3P4QB 4P16A 4ZLTF 2J4XA 1VF5C 1IBXA 4R8IA 1VR9A 3N52A 1AFPA 1KRHA 3AU7A 4OHJA 2F0FA 1HA6A 5BN3A 2WXIA 3T3OA 2Y5CA 4DAVA 1FFVA 2N55A 3B2GA 4IUTA 1PXUA 3BYYB 2W55A 1H9JA 4IN3A 1YN5A 1SBBB 3TMEA 3KWLA 1WTWA 4B08A 3VR9B 3DXJC 3GB1A 3U2SC 2IT1A 2PW9A 4K8IA 1JCKB 1SNPA 2B2VC 3OSOA 1JALA 1TKWB 3PUWA 1EYCA 5JAVA 2I38A 3D4WA 2V4IB 3NVWA 3H91A 2F4IA 5EJWA 4CJ0B 2PVOD 4A3JB 3NZ3A 4L23A 3ERQA 5CR3A 2L55A 4A3IB 2WXPA 1ET6A 4C56C 1ZOYB 1SNCA 1KDBA 2WXKA 2FMCA 1XCQL 3WDNA 4G7HC 1Q3LA 4KKIA 3MHZA 4X3TA 5J39A 3AB5A 5EBDA 1WTXA 4PQXA 3NE5B 1TJEA 4QF4A 2V3PA 1PFNA 1STGA 1G6ZA 2MJ8A 3GS2A 2D5GA 2CQAA 4HMJA 1SYEA 4A3FB 2B2VA 4HMIA 1I4GA 2KOLA 5CV8A 4OO1G 5BYRA 3BWUD 5LL6S 2MUYA 5JEAH 3FAHA 1F9PA 1DOXA 1N5WA 4KD4A 5IIFA 1L0XB 3W9CB 3DUZA 2EYHA 1J7CA 3IAYA 1DCZA 2LS01 2K3UA 3EROA 3OMGA 1KNEA 1MSGA 2TSSA 1D5MC 1XO3A 1ENFA 2LKVA 3KLSA 1R4QB 5FO9B 1YN3A 4KY6A 5ELDA 3FPUB 1EQTA 4N58A 1D5ZC 1TR5A 1S5DD 3SXHA 3J80L 4CKCA 5M9OA 5EKKA 3HKZB 1C76A 1F2LA 2MPMA 1U4PA 4ULLA 5E4XA 4XIGS 2E6XA 3HG9A 3CHBD 2B2UC 4Y7NB 4RHRA 2RSOA 1F77A 3PUYA 1WVLA 1IYVA 2WP9B 2WS3B 3OWFA 4PMWA 1ZXTA 3T13A 1STYA 3PUXA 5KRUA 3SFDB 1JE4A 1FIQA 1SB3C 4JWUC 4Q0FA 3S1NB 3MEHA 4KN7C 4A3MB 3A8IE 2X69A 5I4DA 4RCOA 1LTGD 3J7AV 3MWYW 1NI3A 1V1PB 2LFNA 5CBAE 2M56B 4TRDA 2AX5A 4KV6A 1J7BA 3DWAA 5BMIA 2Q8TA 1QOGA 1JOOA 4OZAA 2JSOA 4O1NA 2O5IC 3HRZC 3BVGA 1I7HA 3J7AF 3VYSA 3MAQA 2WDVB 1OXUA 3C1FA 3E0JA 4XT3B 1DOYA 2B2UA 1A3TA 4XQJA 2JSVX 5D65A 1SF0A 2B2YC 2XSCA 3D4DA 3IFDA 2Z1CA 3PMFA 1IW7C 1Q90A 1C4PA 2WB1B 3AEAB 4IUNA 1YNND 3MFGA 1VDVA 1TS2A 1ZE3D 5IT9L 1TWCB 4Q2JA 2RQXA 3T3NA 2EKIA 4DFAA 1EU3A 3SEBA 2X38A 4HKZE 1E10A 1NCVA 2MHVA 2YEPB 3CWIA 2Z8LA 1TWHB 3VR2A 3BDOA 4ARIA 2K5DA 2BTEA 4FO2A 2G9HD 5C3EB 1N61A 3TP5A 3GP7A 1CFMA 3PO0A 3K57A 1SMYD 4GZYC 3AH7A 5E6JA 1IGCA 4ZKBB 1PLFA 2B2YA 5CORA 2K04A 1S5CD 3T56B 1PDQA 3H3VC 1EIGA 1LTRD 1MBYA 4USAA 4ARCA 1FRDA 4PT5A 4DNTB 1C48A 3ZJTA 2R6GA 2DYOA 1Z6HA 2L52A 5I9PA 2A6EC 1C8CA 1MI2A 4RH6A 1BBXC 3VA5A 1SFOB 4KKSA 4NMZA 1FO4A 1K8OA 1MHHE 4DXGA 3SDZA 3A8JE 1RODA 4RKBA 2LHEA 2RA4A 3S16B 5ELCA 4M0WA 2BT6A 1YNNC 3NXWA 4KD3A 2FFKB 3KK7A 3CRKC 1HUMA 1HFGA 1EL0A 3D8GA 4J8QA 1YNJD 2JXMB 2WU2B 4US9A 2MP1A 2IX0A 3G6JB 1KLGD 1YNTE 1QLBB 1QT9A 3UI3A 5EPLA 1SJED 4JBWA 2W82A 4H44C 5T1GA 3QJYA 3KBGA 3AMUA 1E7PB 2JP1A 4KN4C 2PKOA 4RGOS 2PZTA 2TMPA 1QOBA 1H9SB 2WXGA 2SEBD 1SMYC 2PTLA 5C3XA 3M85A 1BO0A 2H88B 3GV3A 1E0ZA 2KCNA 2BOSA 3H09A 4NW2A 3WOFA 1QNKA 2VXWA 1QOAA 3LXFA 1RF2D 1T6BX 1QCBD 3OIQA 1CI3M 4NZLB 1J7AA 4L2YA 3RLFA 2RPVA 1QF6A 1TIID 1YQ4B 3QWNA 5E1FA 4EQOA 2HQEA 4C7ZA 3R3OA 3J80E 4DGZA 5HGTA 5A2QE 3FVQA 1L6VA 4DXFA 3PO2B 4RNAA 1S5BD 3RUZA 2LHDA 3GTGB 2QSDA 3DMUA 2EY1A 1QQRA 3NUCA 2PCFB 4UAIA 2XN9C 5F2DA 1GOZA 1AZPA 1F2RI 1GUNA 1TS4A 3P4PB 3HOZB 1NR4A 1SXTA 5IGFA 4A3DB 4US8A 3EA6A 3NWSA 1EIHA 4LK1C 1EWCA 1YNJC 1E2WA 1C79A 1Z47A 1GB4A 3NUHB 4ME5A 1HTPA 1NYQA 3K6OA 3KWVA 4YWGG 3SR6A 4DU9A 1IKMA 1NENB 4OIJA 4G7OC 2E2DC 1V1PA 1QKZA 4DN4M 4HCEA 3TP8A 3VR4A 1G8ZD 1FCLA 1CZGA 5H92C 4XYQA 1EZ8A 1WD0A 1CZPA 1FNVA 1RHPA 3MXUA 4YSZB 2RDGA 2DBYA 1ILQA 3BK2A 2VB2X 3GTPB 2O2LD 1DM0B 4EGVA 2D9UA 5BN5A 1F2RC 1RM6C 3CRLC 4TKOB 4IFDH 3M7NA 3HRDD 2DNEA 3VYTA 3ND9A 4H0LC 2DYMA 2GRIA 2NN6G 2OF1A 4PV1C 2DN8A 1BOSA 3S2HB 2WP8J 3EUB2 4DF7A 5JVG3 3NK9A 4HTHA 2BB5A 4ZHOA 2D62A 2O4XA 5CC4A 1TQOA 2DY7A 3PZ8A 3K59A 2PNRC 1VDZA 4R8NA 4RGTA 1SNOA 2NVTB 2IGDA 3AM9A 1A3UA 5JPNC 2LMCA 1JWUD 4WIPA 1ZXHA 4MT5A 4BBRB 2SDFA 4WURA 2K32A 2QILA 2KDMA 4RKLA 5KGUA 1EYDA 3L7ZC 2EYPA 3TEXA 3H6MA 3KQ4A 1SEBD 2PW5A 3S17B 4ZUJA 2F0DA 2BYTA 2H89B 2AQ3B 4TQ1A 2F0NA 1R9TB 1Y8PB 4ZRZA 4TQ0A 2BA1A 2L12A 3MXPA 3NSWA 5FR3A 1FXAA 1D1KA 3C2PA 2K33A 1HRJA 1JC7A 3T16A 2QF7A 4BS9A 1GXDC 5HFYA 2NB0A 5J1ZA 2H1EA 1HFNA 1JW9D 1X3QA 1GPXA 4RGMA 3Q8AA 3DWPA 1U4MA 1WD1A 2NN6I 3P1HA 3NHHA 3K5NA 3GV6A 1TKYA 4C1NK 2AQ1B 4F88A 1STBA 4RAUC 5JOBA 1EWHA 3KBXA 2PVGC 1HCZA 2AUKA 3RZOB 3ZGZA 1D6EC 1XX8A 4R3DA 5G5HA 4KJNA 1GUSA 4IZ8A 3NS1A 2E2IB 1TZOA 3S1RB 1O80A 2FHTA 2L5TA 2MH7A 1P7FA 5K36H 3OMCA 1T5XD 2M00A 4KGSA 1H9SA 3U52E 1ZKOA 1DONA 2HDEA 1NAPA 3RFZB 1WWTA 2F0KA 2JE6I 4X3UA 2LGIA 3TSSA 1PRTF 4KY7A 4CKEA 5C0XH 2PO4A 1CHPD 5G5GA 2K9XA 2EPBA 2O5JC 1GUTA 1PDXA 1QNUA 1MPEA 4ODGA 1L0YB 1PRTB 3AE8B 5C5LA 5AFWA 3GD7A 1ML0D 3RD4A 1PFDA 1TS3A 2NUCA 4ZQ3A 4YSYB 1EY0A 1V97A 1KDCA 1B9MA 5CV7A 1DZ1A 1WSPA 2KQ4X 3VR3A 1L0VB 4DA2A 5BMGA 3EVQA 2IJ0A 1DD2A 3A54A 2CU3A 4WH4A 5E3FA 3D4RA 4UDUC 4G7ZC 3IAM1 2JA5B 1II3A 2W54A 2FUG1 1L6UA 2NTSA 1K8MA 3D3RA 1EY8A 5FOBB 2INNE 1JROA 3GTMB 3P42A 4N59A 1FD6A 2OT2A 3SFEB 3BVZA 4F87A 3GTJB 1FYCA 2GI9A 4WJWA 2JZPA 2VZKB 1D1IA 3VYUA 3E9SA 2BW2A 1XLPA 1DOMA 5EGTA 1A2UA 4ZHPA 1U4LA 2VNUD 2E74C 5CV4A 5FK9C 4CJ1B 1VRAB 1TWGB 4YXDB 3TZUA 2L1AA 4H2AA 5G3LD 1JOQA 4RCNA 3MFYA 1FRRA 1CQVA 1IW7D 3H0GB 2LFIA 2WDRB 1ZDXA 4HEA1 2HCCA 1TY2A 1BUIC 1XLOA 4L1BA 3BK1A 3AB9A 1B1ZA 3ONAB 2LEKA 2JA7B 1MHXA 1PRTD 1LACA 4B9XA 2L1BA 1HQMC 1VLBA 1AW7A 5A2QL 3LNNA 3V2TA 4TSSA 1LTSD 4OZBA 1V8QA 3NTKA 4X3SA 5D14A 1J8IA 3NQIA 1RTOA 1YN4A 3Q8BA 1UWMA 1D2BA 5DM73 4YT0B 3I9V1 2E2JB 4C3IB 1WYGA 1SE2A 2HDMA 2N7JA 2F0IA 1FMAD 4HN7A 2MJEA 2F0JA 1BMLC 1WTVA 5E4WC 2QCPX 3F2UA 2MGSA 2NVQB 1V43A 1XCTL 1B3AA 3K5OA 3J9CA 2EYLA 4EQPA 4IQZA 1JICA 4NP5A 2K22A 4QB4A 1HZ5A 4IFDJ 1TKEA 1XF5L 3MXNA 2ZW1A 2VZKD 2L9HA 1SE3A 3NVVA 3VQIA 1JWBD 5I2XA 2A6ED 3PZ7A 1X32A 3W5VB 4CGYB 2F1MA 4C3HB 3TZDA 4AYBB 2JYEA 5I9OA 4ILWA 4EQNA 4XWWA 2JXTA 4IUQA 5C4JB 2JEBI 1PUTA 4RGNA 3IFTA 1I4HA 2KCCA 1SE4A 1DYQA 3AE7B 1RFKA 1STAA 1I6HB 4C3IG 4A93B 3U4EG 4BA2I 1D4BA 5T1IA 4DAPA 2KQ3A 1VZ6A 1LTAD 1HHVA 3LWEA 3HOXB 1HUNA 1Y56A 3Q8EA 5LNK1 1KTKA 1DOLA 4IURA 1F2ZA 1PRTC 3P4SB 4NAMA 1B9NA 3A8KE 2YEPF 2EELA 3LWUA 3MC0B 5CYUA 1GJXA 2FBWB 3N9YC 1NYRA 1CQFA 1PGAA 2DNCA 4L8JA 1QB5D 2F03A 4YTMB 5TSSA 2WQYB 5JEAG 1XYIA 5C2TB 3R2IA 3OHXC 3M4YA 2ZXRA 2DY8A 2CJOA 2XIWA 1EM7A 5GXGB 4U673 1Q1BA 4PNYA 2K05A 1Q12A 1CZWA 3BIID 4V0BA 3SK4A 4K5XA 1HQRD 1B4OA 2M9VA 2X6GA 4ABNA 1PTOH 1T3QA 2LY7A 1OXSC 3AE4B 4NAWB 5EPKA 5KNBA 4EVOA 1KLUD 2QDBA 3HOWB 3ZJVA 4HROA 3DWGC 3H8HA 1BQQT 1F9QA 4FXGC 1LTTD 4NJCA 2I46A 4BY7B 2MEKA 5FO7B 4LMQD 3R93A 2B8FA 4L63B 4K14A 1FNWA 1RKNA 3X3NA 1ILPA 1ZYRD 5I2YA 1Y1WB 3VRBB 1T5EA 3N6RA 1ROEA 1M8AA 3G7LA 1QG7A 2FE8A 1O78A 5AUKA 1WTQA 4V190 1TWAB 1DXMA 4K6DA 1UNSA 2K5WA 1OXTA 2R3ZA 1Y8NB 2KJXA 5KEEA 1E2ZA 3HUIA 4KGTA 2BS2B 3I4NB 1YJIA 2M0AA 1ZEQX 1SDFA 1HEZE 1FNUA 5IGDA 2R92B 2D2CC 1G291 2MJ3A 1X3PA 2KEDA 2N9LA 2E75C 2H4OA 1L4DB 5LL6X 4LLGM 4OZCA 4IUPA 5D7GA 4F8MA 4QIWB 2WLBA 2XRQD 3P7JA 3E5SA 1BF4A 1EZ6A 2XWBB 5C0XJ 1FXIA 3W2DA 3TN2A 3QO2A 2V3NA 2INPE 4N9PA 4KJOA 3I3CA 5K5PA 1GUWA 2BDNA 5FKAC 3GO5A 3SK5A 3AE2B 1I6VC 1PTOB 2R93B 4G4KA 4YIJA 1ZXIA 2F0TA 3NWTA 2Y0SB 1O7ZA 3ZYYX 5JJZA 1EEID 2GB1A 1SNMA 1SSNA 2Z4HA 3MVVA 4XQQA 5IGEA 5CMDA 3BVMA 3MXGA 4H13C 1LLRD 1Y8OB 4F7XA 4C7YA 1S4ZA 4P2CB 2LJIA 3R2TA 3Q22A 2IGGA 1LV9A 2KA7A 4ZUIA 1ZYRC 5M5WB 1A6XA 1PGBA 2EJGC 1MGSA 1K51A 4OIKA 1TY0A 2NWGA 1ESRA 1NSNS 1G2SA 1D5XC 2A68D 4K6LA 2F0QA 1I3QB 4IKGA 2Y5PA 1LT4D 2EOTA 4XDDA 2PZWA 1SSOA 5COYA 1FGBD 3CKIB 3V96A 3M7GA 1Q1EA 4JE3B 5DAUA 2WDQB 3E6ZX 3DWMA 3BG3A 1B44D 4DQOC 1PZID 1SJHD 2AWOA 4R9WA 4FP5D 4BY1B 5KNCA 1JQYD 5KNDA 1WTPA 2SAKA 2WKCA 1RJTA 1NR2A 1TU2B 4O42A 1HZ6A 2V4DA 4XDXA 3ND8A 4I7ZC 1MI0A 4QCLA 3AE1B 1TKGA 5C5MA 3IT6B 1ENCA 2F3WA 4CKBA 3KLSX 1G2TA 1PZJD 3D31A 4A3BB 3MP9A 1VZ8A 2K03A 2IGHA 1K53A 2YU9B 1J9OA 3AEEB 2F0VA 3Q24A 2OEDA 4FF1A 2AWNA 2VB3X 2IPKD 2JEAI 5CGKA 1N60A 3AECB 1ZP0B 2I2YA 5A35A 1XLQA 4DK0A 2ON8A 3S9WA 3MHBA 1RYJA 1KNAA 4CQNA 4LJZC 4KKTA 1VJKA 2M19A 1LTID 5EBCA 3C8YA 2VUMB 2K7VA 2K5PA 2NMQA 4YSXB 3PIP3 1EY6A 1UAPA 2IWHA 3DHQA 2N9KA 1KABA 2A68C 3I70A 1STNA 3DWQA 1N5XA 3ABVB 1JWMD 5T8IA 1OQRA 4S3SA 1AEXA 3I4MB 1LTBD 2A6HC 2SOBA 1IUEA 4YTPB 3NTIA 2E76C 1SYFA 2ZW0A 1WRIA 1FFUA 2FMMA 1LABA 4LAAA 5I6WA 3EQLC 1BCPF 3TEYA 4A90A 3HP3A 3VYRA 1HXYD 1E9MA 3PO3B 2SNSA 2KUMA 1PFBA 4RFBA 1BCPB 5EPJA 2OHFA 3FILB 1C4QA 3AMZA 1CTMA 1H9MA 3FDTA 1KFYB 1ACCA 1WXQA 2DLBA 2EY5A 5C4HA 2WXHA 3URYA 2HTME 1SYCA 1IKLA 4MN3A 1C4CA 2XVSA 5ELFA 2B2WC 5BYQA 3NQTA 2JWUA 3A7LA 3PV0A 4XYOA 4Q5VA 4MIUA 4XDCA 2F0EA 1PTOC 4G57A 1TYGB 2KN4A 3NP8A 1UUPA 3R8BA 4QUCA 2K0PA 4HR7B 1S5ED 4GDLB 2F0SA 3TEZA 4JX1C 3FMCA 3V05A 3I72A 2EY6A 4OW0A 2ACZB 2WV6D 4OO1H 2EYMA 4NKLA 3TEWA 3AEGB 2Z4IA 3AEDB 4EE2A 1CHQD 5CV6A 4JWSC 4BA1I 1JB3A 2Y3AA 1JWSD 4J1MA 5ISRA 3J7YW 2QKIC 2HCIA 3SVMA 5G3LF 2BB6A 2NZ1D 2WIIB 1BDOA 4IFDG 1EY4A 1CM9A 2NYZD 2B2WA 2J53A 4RWSC 1Z7TA 1A3VA 1SYDA 1RWSA 1AN8A 3NVYA 1M4VA 3VA7A 1SNDA 2ZXOA 1QILA 2WXLA 2W3RA 3I8ZA 1NEKB 1RTNA 1I4PA 2RVLA 3ZQ4A 2F0LA 4Z9CB 3AV8A 5D3DA 4XWTA 1G91A 4HJGE 1Y1VB 1SYBA 2Q8RE 4E6IA 1BCPD 1WTRA 3NPPA 3J81E 3O13A 3X3MA 1GHJA 4ZYSA 3S14B 2R7ZB 3KF8A 1C78A 1K50A 5I6YA 1NUCA 3HVZA 3U9OA 2LUMA 4LK0M 5C3JB 3GTKB 2EZVA 2CJNA 1W6JA 2QIEB 2N88A 3L9AX 2K1BA 1F2YA 1R4PB 2L0CA 4IUVA 1QOFA 2IW3A 1XWEA 2KWDA 4LTUA 3I73A 1YMHE 3NVZA 3Q23A 2G9DA 4CHTB 3GTLB 2K28A 1N62A 4JPSA 2NBFA 3BDCA 1WTOA 3DEOA 3QIAA 1EFID 1EY9A 2WXQA 1C4AA 4DAYA 1XXGA 2V0GA 1AP0A 2JA6B 5IGGA 1JOKA 4IFDI 1U9RA 4A3EB 4ITKA 3SE0A 2KEEA 4FF2A 1UWXA 2J7ZA 3ETRA 4IOIE 1LT6D 1C77A 4MH8A 4RHSA 2R61A 5MPOA 3S1QB 2FINB 2B8GA 1Q8IA 4KTAA 2WXOA 3LB8C 4B0MA 4HKQA 1ESFA 2NVXB 1XEEA 5HHDG 5FO8B 3M4OB 2QMTA 3P1MA 1XLNA 4A3GB 3OPOA 5DM63 4TQUS 2B2TC 3K0YA 4H7BA 1V8CA 3KUPA 2K5QA 3BS1A 1ONLA 3FRPB 1AWDA 1BCPC 5M3MB 2B63B 2A69D 2KECA 2NVYB 3EFXD 5J22A 4WQMA 2AQ2B 3FKIB 3AE9B 1SAPA 5K36G 2BA0A 5IOCA 5C44B 1LO5D 4GLSC 3GQBA 3CIRB 2EY2A 4REZA 2L4NA 4AQ7A 1I50B 4GDKB 1E6EB 1IYUA 2M2LA 2IX3A 4K2LA 4X3KA 3K58A 5IGBA 2KACA 3BYTB 1EYAA 1LT3D 4J6HA 5C0XG 3L4PA 5CV9A 5IGCA 5M5YB 1QOHA 2F0UA 5C4ZA 3NRZA 4DK1A 4WAFA 1H9KA 2L11A 2WAQB 3NBHA 1RCVD 2B2TA 4KMUC 1BR9A 2BCOA 1TWFB 4FXCA 1MD2D 1RD9D 4FF3A 3FILA 1SNQA 1SYGA 3I4LA 3E56A 4K2KA 5LHY1 4WRDA 4M8AA 1R7SA 2WINB 2RMMA 4XXEA 3EGRA 3P20A 3AE5B 2WXMA 3WOEA 1B53A 2PMVA 3SHLA 3KLRA 1LT5D 1QWYA 1Q10A 3WCQA 4M1UB 4KHVA 3VR6A 4OO1I 1A70A 1OXXK 1SIJA 5JXVA 2A69C 3I91A 1HA5A 3QOLA 2PIAA 1V1OA 1VZ7A 3OIPA 2JA8B 2L83A 5CV5A 5EE1A 3MJ5A 4RA8A 3VR8B 3PUVA 2IX1A 4ID6A 5DEHA 2EJFC 2PW7A 2F0PA 1PYWD 4C3HG 3U9SA 2ID0A 4XQNA 1F9RA 5AUIA 3P4RB 1CA5A 1PMRA 3HVDA 3C1EA 2PLPA 5C0XI 4CJ2C 5FLXE 4FF4A 2ENBA 4K5VA 2KHSA 2EE1A 2EXZA 2OXPA 5JPMC 2CW0D 4ZRQA 1DGJA 2LMCB