3OWEB

Crystal structure of staphylococcal enterotoxin g (seg) in complex with a high affinity mutant mouse t-cell receptor chain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
227
Chain Sequence
AQPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEFGGCCMYGGLTFNSSENRDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-chain
publication title Crystal structure of staphylococcal enterotoxin G (SEG) in complex with a mouse T-cell receptor {beta} chain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 60
structure length 227
sequence length 234
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3oweB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3oweB01
5FKAC 1I4RA 1I4PA 1LTTD 1V1OA 3DWQA 4RGOS 1BCPD 4C56C 1SBBB 3EA6A 1PTOD 1PYWD 1KTKA 1TY0A 1YN4A 4ZYSA 1I4HA 1TS2A 3CHBD 1EU4A 5ELBA 1L0XB 2XRQD 1FNWA 1YN5A 1EEFD 1RF2D 1BCPB 1XTCD 4BWGB 1PTOB 1QILA 2O2LD 2CHBD 1YN3A 1ET9A 3BVGA 1DYQA 1CHQD 4RHSA 3W2DA 1S5BD 1LO5D 1LT4D 1SXTA 1T5XD 1S5DD 5ELFA 1ET6A 1HQRD 3URYA 1DJRD 1JCKB 3O13A 2AQ3B 5FK9C 2SEBD 3OWEB 1UNSA 1SE4A 3DWPA 1LTAD 1PZID 1BCPC 1BXTA 1EWCA 2XNAC 1PTOC 4RCOA 2NTSA 1SJED 1LTID 1I4GA 1UUPA 3V05A 1B1ZA 1STEA 1LT5D 1D5ZC 4OHJA 1D6EC 1B44D 1JWMD 3GP7A 4RGNA 1PRTF 2XN9C 3BZDB 1KLUD 2AQ2B 2IJ0A 1EU3A 4L6TB 2RDGA 1S5FD 1PTOH 1AN8A 1HA5A 4TSSA 1KLGD 1LTSD 4RHRA 5D3DA 1PZJD 4RGTA 5ELEA 1RCVD 1V1PA 3BYTB 3MFGA 4DXGA 1HTLD 1F77A 1TS3A 2QEJC 1ESFA 1LT3D 2AQ1B 1D5MC 3MC0B 1AW7A 1FNUA 1G8ZD 1M4VA 1XXGA 1JQYD 3DWAA 1PRTD 1EFID 1CQVA 1S5ED 1LTRD 1S5CD 1TS4A 4RGMA 2NTTA 4NZLB 1FNVA 2R61A 4RFBA 4UDUC 1EEID 5ELDA 1SE2A 2WV6D 1LT6D 1MD2D 4DXFA 1I4QA 3TSSA 2ICIA 4O1NA 2IPKD 1ENFA 3EFXD 1PRTB 3R8BA 2G9HD 3R2TA 1HXYD 1BCPF 1I4XA 2J4XA 1PTOF 4Z9CB 1GOZA 1L0YB 2QILA 2TSSA 3BVZA 1PZKD 1SJHD 1D5XC 1TY2A 3BYYB 1CT1D 1JWSD 1TS5A 1LLRD 1V1PB 1RDPD 4L63B 5ELCA 1SE3A 1RD9D 1LTBD 1FD7D 2XRSD 5I4DA 2RDHA 5TSSA 1PRTC 2Z8LA 1JWUD 1LTGD 4K6LA 1FGBD 1JR0D 1CK1A 3KLSX 4RH6A 1SEBD 5D3IB 3R2IA 3BVMA 3SEBA 1CHPD
chains in the Genus database with same CATH superfamily
2BCOA 5LMNQ 3KJOA 3KF8B 4ZHOA 3SK6A 1M8AA 4ASWC 5C23A 3EJIA 1AZQA 4LUOA 1U4PA 1MHWC 4A76A 2NBUA 3NVWA 3VRAB 3OG5A 3A7AB 4IWPA 3V62A 5ELBA 2Q8IB 2PE9A 3VR9B 5IODA 2GMIC 4IUMB 2JK8A 3HUIA 3SR1A 1ICFB 4WJQA 3HOVH 1OGWA 2JA5G 5FLMH 1E8ZA 2W3SA 4OL7A 2JU6X 4IFDI 2CQOA 4GDLB 2DZIA 2ZPYA 1MSGA 4P74A 3S1RH 4JPSA 5EJWA 2RSUA 3FAHA 1SYEA 1BNZA 1MHXA 2I5HA 5JHAA 2Y0SE 1JWAD 4A9AA 3I56A 2BH2A 2UWQA 1WF9A 1VQAA 2WX0A 3BS1A 1C4QA 1H9KA 3LB8C 1Y8OB 3M4OH 2WINB 1EWCA 5C3EB 4A3MH 4GN4B 1S1QB 1LTID 5F2DA 4Q5VA 1CUKA 3V05A 4HKQA 1N33L 2DZMA 2ON8A 4HAEA 2INNE 4M00A 4A90A 1B9MA 1EOVA 1YJJA 3I4OA 1WTXA 3AE5B 1FCLA 3C2PA 4L6TB 2JXMB 2CVRA 2F0JA 2L0CA 2RR9A 4A3LH 1GUNA 3H09A 2JY6A 3QJZA 3OLMD 1E2ZA 1N32L 5EKIA 2MHVA 4Y7NH 5ELEA 4MTNA 3CCEA 1SE8A 3K58A 1E7VA 3J7YW 2M0XA 3MFGA 1WTWA 3A4RA 2VUMB 5C4ZA 4KX6B 4HN7A 3RZDB 4XQJA 4HJ9A 5EE0A 2K6QA 5H92C 1TS3A 4R8NA 4NB3A 4MELA 3N20C 2C5LC 1O78A 3DBRB 1ESFA 1V8CA 3N32A 4AUQC 4A3FB 1FRRA 4HPPA 4B9KA 2WXFA 3B0AA 4FF4A 4HEA1 2KEEA 2BYTA 3Q6SA 1QOGA 4QF4A 2LXAA 4C3JH 2HTME 2KC1A 2ZTCA 3Q0AA 3KUZA 1S5CD 5CC4A 2KDIA 1SN8A 2KA7A 1HNZL 4HIKA 1ILQA 4OX9Q 4DHJD 5GAHC 2JX5A 2R6GA 1HZ9A 4L23A 4HCNB 3NELA 1JJ2A 3NOBA 4I65A 1HZAA 1RL2A 3A55A 3R2TA 4XYOA 2N55A 1NI3A 3IAYA 3AN1A 4X3KA 2TSSA 5M3MH 4IFDG 5JJKA 3ND8A 1C8CA 5FO7B 3AFPA 1EYGA 2W55A 3ZIMA 2NZHA 1TS5A 5EBDA 1GB1A 5J17A 3OW7A 4B3TQ 1YBYA 3RLOA 5FJ8H 2NVTH 3A8KE 2AYOB 4WWMA 1O7YA 5FR6A 2N9LA 4HXDA 1GUWA 2F0QA 3ECIA 2RDFA 4DUZL 4MT5A 1LTGD 3KLSX 3CW2C 3B9JA 3ZNZB 4E6IA 4OO1I 2E2IH 1TWHB 3GTPH 1TT2A 1Z47A 3KYHC 2JRIB 2EJFC 1SNOA 2MJEA 4CHKA 1VQ6A 4HVBA 4CDFC 5GXGB 4PNYA 5IP7G 5JH5C 3MFYA 3KH0A 1VQHA 3CHBD 2N78A 1WTQA 4JI4Q 3S17H 2MGSA 3T53B 2Q8RE 1KAWA 3MEFA 1KRTA 3ONAB 3LXFA 2Q8TA 5HHDG 4TRDA 2RKSA 1XLNA 3NZUA 3MTSA 2ZCCA 4E3CA 4RHSA 1OXTA 1LO5D 2D10A 3DLLA 4W9FA 4B95A 4I7ZC 5C3XA 3L2PA 4NW2A 4BKSD 5L37A 5M5WB 2R2OA 5IT9L 1SE4A 3P63A 2OT2A 1WX8A 4IC7B 2B2VC 5I2YA 1X1MA 2DYBA 3IVFA 2FINB 1SJED 1DOLA 1SNCA 1CA5A 4IFDJ 1I4GA 3HOUG 2B2WC 2KVZA 3E9IA 3APCA 4A6QA 3K9PB 2NVUI 3KBXA 1GKHA 1YD8U 4LJPB 4RGNA 1JWMD 5EE9A 2F0MA 2XN9C 2IBIB 4K7SA 1X3EA 3DHGC 2AQ2B 1T0RC 3G4SA 2E74C 2HJ8A 2L76A 3SDZA 3J7AV 4B3RQ 1VQ9A 1WXVA 1J7CA 1AN8A 3CQZB 2DGYA 4TSSA 3NY5A 4FJYA 4WWOA 3TZUA 3VH3B 3MAQA 3ZVVA 1W6JA 3C1FA 2WHIA 1L5PA 2ZVOA 3LJ3A 4BY7B 3ZJTA 2L11A 3MWYW 4ZUJA 1E7ZA 1STYA 4H44C 1FL0A 5EE3A 1ZXTA 4ALPA 2PVGC 2AQ1B 2VS1A 3GDEA 3A5ZB 3CCUA 1RAXA 1TZ1A 2FBWB 2WXQA 1FNUA 4JG2A 2WXKA 1M4VA 2YEPB 2L5TA 2ZJQA 1ZDVA 2EPBA 1Q5WB 3QWZB 1HTOA 1IBXA 4OO1G 3J80i 3KDFA 2CHXA 1KLVA 4M01A 2HD3A 5DM73 1V2YA 4QCLA 5I9OA 1N5WA 3H7SA 3X0WA 2LUMA 3MTNB 4DK0A 1E8WA 3CC7A 2WNMA 3ZO5B 3ZJUA 1IBXB 5I6WA 2K8CA 1TWGB 3KDFB 1P9DU 1MD2D 4BXXG 3SD5A 2MNAA 2PO4A 4LNOA 1XPRA 1Z9FA 4K3BA 3IKJA 3HOXG 5JEAG 2EOTA 3NBHA 2E76C 4ZKCB 3PIPA 1R4QB 4GLVB 3UIOB 4KY7A 4DQOC 2RGFA 4UAIA 1A2TA 2L8JA 2D2CC 4QJFA 1D5XC 1RKNA 3W1SA 3AB5A 4RAUC 2CR5A 1R9TH 3KW5B 1DOXA 4N9TA 3P7JA 3VR4A 3RPFC 3JAME 5C3EH 3T3NA 4CJ0B 1N5XA 3UF8A 3HGBA 3TP6A 3GTMB 3GE3C 4ANWA 5FOBB 4C80A 2WAQG 4AYBE 3OMGA 1V6EA 2JZZA 2C7HA 3AMUA 1WRIA 1J7BA 2KCNA 1GJZA 3QK0A 3TQYA 5EAYA 1CA6A 4P16A 2YYZA 3E9SA 3LYYA 3CXCA 2V0GA 2VY3A 4XYQA 2HQLA 2IGGA 3K81C 1IBLL 1NR2A 3P4SB 2VUMH 4S17A 4CGYB 3RZDH 4OVUA 4B08A 5KNDA 1TS2A 2MBBB 1J7AA 1EU4A 3NBIA 1STBA 3I8ZA 4DR4Q 2EYLA 2K05A 4G0NB 4JIOU 3D4RA 3TDQA 1I3QB 3SK8A 5KEEA 4AQYQ 4A3FH 3P4RB 1J0GA 1VQ8A 1EEFD 4NXML 1T9HA 2Z1CA 4YY3Q 4MNOA 2OTJA 4BA1I 3F2DA 2LRUA 1JRPA 1SYFA 2QCPX 2VQEQ 3FILA 4HKZE 3M4YA 3PREA 1WGYA 2QA4A 5C1ZA 1AYFA 4EZKA 4K8JA 4HPLB 4QMGA 1JCKB 1L0VB 3PIO3 4BBSB 3FILB 2R92G 3K8AA 2IL8A 1NE3A 1N6ZA 2NCNA 2R7FA 3FKYA 3QAQA 5J22A 4KHPQ 4MIUA 2N9EB 2KLCA 2YVCA 2Z6KA 4OHJA 1N63A 3GD7A 4DAVA 3HP3A 1SMYC 2EKIA 4HPMB 1WCMG 1BBXC 2UYZB 4WFN3 3A9JB 3KBGA 2N7JA 3EFCA 5IAAC 3NTHA 2PPBC 3ZNHB 4I6NB 3N1ZC 1JC7A 1Y8PB 2JA6B 4P75A 2MRPA 1PHJA 2NPTB 2EXDA 3EHVA 4LCDE 3RUIB 4HCEA 1LTSD 4GNXA 2K4KA 1UE1A 2FFKB 1HRJA 1EO6A 1L2NA 1JICA 4A3CH 1RCVD 1U4LA 3WCQA 2GB1A 4KN7C 1PH5A 4YT0B 5CTRC 2MUYA 4G57A 1XMQL 4JOIA 1I50B 2ES2A 3HHMA 3TP5A 2SDFA 4WAFA 1TWHH 2N9KA 4LF5Q 3UIPB 2F3VA 4JI8L 3M85A 4JCVE 4A4IA 3OYYA 4HIMA 2K1FA 3Q8BA 1AW7A 4DPGA 1WJ4A 1IP9A 1EYDA 2H1EA 4A3BB 3UE1A 2Q2IA 2QGQA 2LGYA 3LNNA 1S5ED 5KIXA 4LF7Q 3EC8A 4YHHQ 2JJQA 4DR1L 5DM63 2RDBC 1WD1A 2EY5A 4JVZA 1HJPA 4DKAC 5J18A 1PYSB 4UP8A 3T1YQ 4ZK9B 2ICIA 3M9BA 3VYTA 1WRDB 3C1EA 2N88A 2DZKA 2X38A 2LS01 1B70B 3VA7A 1A6XA 3CRKC 3H15A 2HDLA 1CSQA 2MHJA 4K7UA 2N7EA 5IN7A 2EY6A 3GTJH 4J15A 2HD5B 5M5WH 4GOPC 3CIRB 3H8HA 1JWSD 4KJNA 5ELCA 5I2XA 4DV1L 1IGCA 4YXDB 4FXKC 3U7DA 2UU9L 4X64Q 3G7LA 3M4PA 3PSIA 5I4DA 4XDXA 3Q2AC 3DQVA 3VVWB 4DV3Q 4X65Q 4LNFA 3K57A 1XLOA 3WAMA 3HOZG 3PPAA 2KVRA 4US8A 3I4MB 4J1MA 2LGDA 2LFIA 1TKYA 4ZAIA 1PA6A 4DDGD 5C44B 1VQJA 4BBRG 3PO2B 2B76B 4LF8L 3GZNB 5LLIA 3Q22A 4BY7H 3VR5A 1I4HA 4F87A 1A8VA 3MC8A 3VTVA 1DD2A 1FNWA 4PYUA 1HNXQ 4GKKQ 4JI7Q 2PIAA 1TGZB 4YSYB 3PS6A 1F2YA 1Q12A 3U9SA 1DXMA 5GADC 2VNUD 1YN3A 2K52A 1YX6B 3STBC 3ERSX 1A70A 3MA2B 4IZ8A 1T0SC 1ZOYB 4NKLA 2XEWA 1YHAA 5ELOA 4B3MQ 1Q1EA 2E5LQ 2CH4W 3S1MH 2WP8J 4IM2A 2AL6A 1TWGH 4X57B 4ICUA 5G5HA 1E3PA 2DX5B 3O65B 4ACFA 2D5DA 4P1CC 2BWES 2IHEA 1BCPC 2D3AA 2FUG1 2VZKD 1G91A 3KUCB 3PRPB 5LNK1 2UXDL 1TKGA 4GGQA 4WWNA 2V1YA 5KHQA 2SNSA 1VQNA 1E24A 3SHLA 1G51A 3L08A 4BKGA 1Q81C 3ND9A 1EY0A 1HZBA 3RMHA 2DBYA 1VF5C 3L17A 2WKCA 4HDOA 4NQKE 3ZTDA 2KLGA 1I42A 5EPJA 2VZKB 4IOAA 4KK7A 1S5FD 3QJYA 2GVBA 3RFZB 5LMUQ 1PZJD 3FVQA 2KANA 4GN5A 3DHHC 2SNMA 2MBEA 3QG1A 1GG3A 4OXPA 3RNAC 4DXGA 1JROA 1E1TA 4W9LA 3NRZA 5DAUA 1W2BA 4LW1A 2NVQB 3B1LX 2K3UA 1YHQA 2F03A 3SFEB 3W9CB 2KT7A 2L4NA 1SMXA 4DV5L 1X9NA 2QEJC 3GTGB 1B50A 1K8OA 4C1NK 1GUAB 2IO3B 1E0ZA 2B2YA 1WY8A 2ALYB 1MJEA 1SFOH 2K75A 1UBIA 1Z5SB 3AE7B 3QR8A 3PUZA 5IE8A 5LMNL 3Q3OC 1JQYD 4PQXA 4X66L 1C9OA 2MBOA 1HTQA 2L0FA 4ICVA 1QF6A 2F0VA 4IUTA 1SNMA 3PV1A 3M62B 3BK2A 5LL6S 1XCQL 1CM9A 1VQEA 2FCNA 1BQQT 4K1RB 1I3QH 5EDSA 3P42A 5E6OA 2BKRB 1XLPA 2EMTA 2KHWB 3RZFA 2CHWA 3QQ8B 2AWOA 2PW5A 2LGXA 1YNTE 4FN2A 3OMCA 5IYDG 2MCNB 1GUOA 2JEBI 2VXWA 5M5XB 3Q8FA 3RZOB 3CCMA 1I5FA 1K0RA 3T4AC 3ZRCA 2H4OA 2V1CC 2CH4A 1I4XA 2YTYA 3SK4A 2JZPA 4BBSH 1EYAA 1NTGA 1YITA 1DOIA 2IY1B 2K39A 2FAZA 4OZCA 2XGTA 1YOVB 4QY7A 2J0KA 1ZYRD 4L63B 3TUOA 1RDPD 1AARA 5JHBA 1ROEA 3GTQH 1SE3A 4B3SQ 4JBMA 3C19A 3KQ4A 2L3ZA 4R4OA 4EEWA 3H7PB 3KLRA 1VQKA 3BJUA 1WXMA 3WIMA 5TSSA 3S1RB 3QIJA 1U5KA 5IYCH 4F88A 2Q2HA 1UE5A 3BDLA 3CAMA 4N8FA 4I6LB 4JV5L 3RULA 2J42A 4RH6A 3MC9A 1D2BA 3CCVA 1FVIA 4KMUC 4REZA 3UE0A 2JA6H 1PFBA 4C56C 3ULLA 1LQBA 2CS4A 2HIVA 3HOYH 3X3NA 2LSSA 1YIWA 2D3BA 3L7ZC 4ZCKA 1KM7A 1RTNA 4H13C 3HOVG 5FLMG 4IO9A 2XBBC 4IOIE 3ZRFA 3GO5A 1TT5B 4X6AH 5C3WA 1PFNA 2DUDA 2ZJRA 4ZDVA 1L4ZB 4ZQ3A 2K25A 1OEYA 1YN5A 2BYEA 1SB3C 3RNGC 3NP8A 4M8MA 4R9WA 1STNA 4A3BH 3P1HA 3VR3A 4DR2L 2O2LD 4A3KB 4DR3Q 4OVZA 1ET9A 3W2DA 1CHQD 5EKKA 1OQRA 2A5UA 1LT4D 1MSHA 4A3MG 2A6ED 2YV5A 1LFDA 4ULLA 3V96A 2V3NA 5A35A 4XT1B 3K0XA 1CKMA 1QOHA 1TBEA 3TEHB 2PI2A 1GUGA 3VUWA 2PW9A 1ACCA 3DVGY 1VS0A 3Q3JA 4MEMA 3K0YA 3WALA 1QZHA 2PNHA 2QJLA 1G6JA 3AH7A 1ILPA 4C3JB 3B6YA 4JLCA 1NR4A 4DR6L 5KYIA 4WJ3M 4W9IA 2PLPA 5C0XH 1FCCC 2D07B 3EGRA 3EBEA 1B8AA 2MQHA 3ZJVA 2RMMA 2ID0A 3BZDB 1PH2A 2QHOA 3RI7C 2LEKA 1YJ9A 3VFKA 2D11A 4WJPA 3IBEA 3MXGA 3KJPA 2KD0A 2WB1G 4B3TL 1NUCA 1G6PA 4GSWA 3N1YC 3NWTA 4LJZC 3U8ZA 4K2LA 5LXIB 4D2KA 1V80A 2W3RA 4A20A 4DV4Q 4DR7L 2R93B 4GLSC 4HLEA 2ZJPA 4AYBB 2KN5A 3J81E 3DDCB 1QT9A 4C7ZA 4ANVA 2L55A 4A3PA 5AZGA 5M3MB 3CCQA 3RNBC 5KNBA 2N0SB 4JW0A 2R7ZB 2JWUA 2IT1A 1K50A 4JI6Q 3ULJA 4A3DH 1Y8NB 5KRUA 5C44H 3Q69A 5BMHA 3PO2H 3KFUA 2ZTDA 3RD4A 5H1SE 2CJNA 2ZNVB 4GLAC 1EFID 5DEHA 5K36H 4LF6L 1SYGA 1X3FA 4MJSA 4IALA 2B63B 2WGSA 4KV2A 1FRDA 2MH7A 2K1BA 2K5HA 2DYMA 4LWCA 2L12A 1UEAB 4LFCL 3GTPB 2WKDA 3KLSA 4O1NA 1L6UA 1ZGUB 2HDEA 1EOTA 2X69A 4G7ZC 2D2QA 5BO4B 2DZJA 5KGUA 4NAWA 3AMZA 1FO4A 3K6OA 3OSOA 5GAEC 1B53A 4Q0FA 3ALBA 2E3TA 5DNFA 5HFYA 1LLRD 3HKZB 3VR2A 1WE7A 4R4CA 4GN1A 2BE5C 5CHVC 4DDID 4NAWB 2WACA 3S1QB 3WOFA 4DV6L 4H2AA 3KYCD 4C7YA 3JVZX 1XMOL 1FFVA 3ZXRA 5IGBA 2NBVB 4H0LC 3E9HA 4JI5Q 4JI1L 1JR0D 3S9WA 4NXNL 3S1NB 2JSVX 3C46A 1K0SA 5D3IB 1KHIA 2K5QA 1CMXB 1F9JA 5IO9A 2DJGC 4LFAL 3R2IA 4GKJL 1UH6A 2IHFA 1OFFA 2XVSA 3K7UC 5AFWA 4HROA 2EXZA 2EYJA 4EQNA 2L7RA 4RGOS 4QIWB 3A56A 3FC4A 1BCPD 1FXIA 1S4ZA 1SBBB 3H9DA 3QCAA 5HKHA 1A5RA 1FFUA 1HR0L 1I35A 1TY0A 4TVAB 5A2QE 5FO8B 1YN4A 3ETRA 3D8GA 4S3SA 2NVQH 5D94A 5FLXL 3HVDA 2KCCA 1FR3A 1N34Q 3GTGH 3AE1B 3UQBA 1CI3M 1KDBA 4MTKA 1NMGA 1AWDA 4NJCA 4YL8A 1AE3A 1BCPB 1B7YB 2LXJA 2MPMA 1N60A 5CORA 1VLBA 3J81c 4HWIB 2BGFA 1LM0A 3U2SC 2I0QA 4EQOA 4APVA 4B6WA 1CZPA 1WWTA 3NENA 2OWOA 3WDNA 2UUAQ 3T3OA 1X32A 1Q82C 1FXTB 5FK9C 5BMIA 2L0TA 1BVSA 1KL9A 2PMVA 4JBKA 1TQOA 5M5XH 3BY4B 1WOCA 4ME5A 5HGQA 3PGEA 3RZOH 3OWFA 1DGJA 2D3GA 3W1SC 4IM0A 1PFMA 1GD7A 1LT5D 2LASA 3EVQA 4URKA 1D6EC 1WTVA 4A3GH 4M8AA 3DBRI 3UDFA 1XQQA 1JMLA 3RLNA 3CMEA 5ISRA 4A3JB 4KKIA 2J7ZA 3RT3B 1VD2A 2MBQA 2WXJA 1HNWL 4EZJA 3U52E 5BR8Q 3M7NA 1KLGD 1DZ1A 3VRBB 3TS2A 2DHZA 1WE6A 1RHPA 1SROA 2BYVE 2DNCA 1ENCA 1XEEA 2G5DA 1VQ5A 1TU2B 1R9TB 1QZGA 2G3QB 1GUTA 3G71A 4QUCA 2KTFA 2QDBA 2BPSA 4MDKE 3I2ZA 1I94L 5EGTA 1XNRL 2FMCA 4HRSA 5CHWA 1PH6A 2F4VL 4N6EB 4KHVA 3S2AA 3OOCA 3PHXB 4YWGG 1VZ8A 2INDC 2PMZB 3DUZA 5CGKA 3BU2A 4KKTA 1IKMA 4IWQA 1V5OA 2A74C 2KECA 3AE4B 5IYBH 2F0NA 4V190 4A3KH 4YWMA 1J5EL 2ZM6Q 1YNND 2CFMA 1EFWA 2PYKA 5IIFA 2G9HD 4KV6A 5C3EG 5EKLA 3E6ZX 1WD0A 1XJVA 2OJWA 2W82A 1I7HA 5C2TB 5J39A 4M0WA 3PQIA 3N1XC 1PZKD 1KJTA 3MHSD 1B4OA 2JA9A 1J8IA 3A7LA 1KC8C 2D62A 2Z6KC 1E8YA 4J3OD 4WRDA 4M0WB 3PLVA 1HPCA 1QB5D 2NZOA 4K0KQ 1O7IA 4ZRKA 1CFMA 2MO1A 4W9CA 1KNEA 3ITPA 1KXLA 4AH6A 2AWNA 1FGBD 3LWUA 1TWCB 1WVLA 3GTOB 1J6QA 3H1UA 4YCWA 1YNJC 4EGVA 4PS3A 2VUMG 4GNXC 2GBNA 4NPNA 2KJ6A 4IKGA 3AXCA 2KQ3A 3MZ5A 1W6KA 1Y1VB 3OTOQ 2NN6H 1IHZA 1WGHA 3V3XA 1IYJB 3M4QA 1AE2A 2KUMA 3H0GB 4A3FG 4A3EB 2R93H 1PH8A 2OEDA 1CQFA 2UUCQ 4BOSC 1KRHA 4XTCS 1EZ6A 1YJNA 4CDEC 2R7ZH 1VDVA 1F1HA 3HOWB 4IQZA 3F8TA 2XIWA 2N4FA 3MHZA 2VZAA 3HKSA 3MXNA 3I55A 1C1YB 3NHEB 5COYA 2EMSA 1C0AA 2JP1A 4MN3A 4BWGB 4JWSC 1QJOA 2KHIA 4JI2Q 1B3QA 2ASBA 2KFJA 3AULA 5CV7A 4JYAL 3MXNB 2M17A 3QARA 1ONLA 5GAGC 2GN5A 3T51B 4HK2A 4HIDA 2EYFA 2B63H 1EY6A 2FIDA 2RPQA 1HQRD 4IUUA 2IY5B 4FJVB 1VQ4A 1A3TA 2D5GA 1KD1C 4MGKE 1IL8A 2I46A 3W1BA 2UXBQ 1K53A 2BS3B 2BDOA 1MIUA 3AV8A 3ONSA 1PGAA 1M1KC 1NEKB 2H5XA 2CU1A 2Y5CA 1VF7A 3A33B 4WORA 4DUYQ 1YHBA 1PH4A 2ZW0A 1B44D 1Y1WH 1XD3B 1Q7YC 1V5TA 5CV9A 2EELA 4DV2L 2K8BA 4A3CG 1YNXA 2MEKA 1GC7A 1EU3A 3GOEA 3U50C 3S1QH 2G4SA 1PTOH 3C8YA 2IO1B 1K52A 3DOWA 3NUCA 4IUVA 1EM7A 4IJLA 3S1NH 4KKSA 3GTJB 2UXCQ 1ZPSA 1WFYA 1IW7D 1VMPA 1NJIC 2PPHA 2I5LX 2DY8A 3D6WA 4N8X1 3RMKC 2P5ZX 2BVCA 3VA5A 3MXPA 2BE5D 2F0GA 4BA2I 1OTRB 1YZ6A 4X3SA 1EIFA 1P3QU 3AEGB 3CMMB 4XDDA 2G1EA 1IKLA 2NS5A 1S72A 2IX3A 1X65A 3L10B 3OIQA 2N9XA 5AJ3L 4R4QA 3VTWA 2LD9A 2JA7B 4G7OC 3DBLB 2M00A 3K9OB 1MI0A 5ELDA 4W9DA 4CYEA 2K6DB 1QOFA 1LT6D 5C4XH 1Q1BA 3C0RB 5TR5A 2N3SA 3K7AB 1N36L 1WGKA 2JUOA 3CF6E 3VAWA 3GV6A 4C3HB 3AQQA 4HJ5A 1J19A 4L8JA 1EL0A 1NSNS 2HCIA 2KVMA 3PZ7A 1BMLC 1Q0WB 3RN2A 3UINB 4FBJB 1ZE3D 1U4AA 2QILA 4ZKBB 2Q2TA 2GOWA 1D4BA 2FMMA 2AEHA 2E5LL 2FE8A 1CT1D 1AP0A 4F1SA 2AX5A 2WDQB 2E75C 1RYJA 3M3YB 1VZ6A 1ZXIA 2LXCA 3B08A 4EE2A 4AJWA 2DAFA 3T8MA 3QO2A 1STGA 4IUNA 4R4IA 1IUEA 3J81L 1PRTC 2J0JA 2O6VA 3V2TA 5M3FG 1C77A 2JYEA 4OIJA 5GQOA 4A3JH 1Y14B 3S1MB 2KC2A 5H8YE 3NVZA 3JSVA 2W9NA 3ZLZA 3TREA 1CKNA 3K5LA 3N9YC 1OXUA 2F0PA 2KQ7A 3PO0A 3CMAA 4LF4L 2O5JC 1Q46A 3GV3A 4DF7A 3I70A 2QEXA 4L1BA 2PI2E 1FPYA 3JSVB 5LMUL 2B2YC 1CKNB 4GLXA 4OIKA 3H6NA 2C9WB 3PRMB 2EZVA 3NBHB 4HJAA 3DEPA 3RD2A 2HIXA 4ZLTF 2HHHQ 4MH0E 3ENEA 4WQMA 3T1HL 1XTDA 2D0PA 5DLQE 2UUBL 2Z6BA 3TEYA 1YIJA 4K7WA 4XWWA 3CKIB 3EQLC 2WXOA 3BK1A 3D4WA 4HJ8A 4A3IB 2IGHA 2MWSB 1IBKQ 1IBML 1KH0A 1V81A 4TQUS 4ARIA 4OONA 2WXNA 3DBHB 3WOEA 3D31A 3F2UA 1HFGA 5HY6A 3HFZB 1K3RA 4YTPB 3H91A 1O7LA 3GTLB 2CJOA 3RN5A 4EZLA 1P98A 2CQAA 1JWBD 1PH1A 2K6AA 4F8CB 1IYUA 1SFOB 4MACA 2BWFA 1Z6HA 4IJHA 4CDDC 1UGMA 2J0TD 1B1ZA 1E10A 1M94A 1MBYA 5BYQA 3ERQA 1L7YA 2WQYB 1ZYRC 1QNUA 3U30A 3ZNGC 2A68C 1KLUD 2HCCA 2CCZA 2WU2B 2WS3B 4DXAB 3ZNID 1NNXA 1Q86C 2KAJA 2V9HA 4HIOA 1XPOA 3VTUA 2KCTA 2BDNA 3CU7A 2EYHA 3J7A5 2PEAA 1IYVA 2VL6A 3HZXA 5IP9H 1JALA 2KX3A 4RGTA 4RWSC 4N58A 1N33Q 3GTOH 1TWCH 2V3PA 4DK3C 4O2DA 3DVNU 2F0WA 4NP5A 1JORA 4W9EA 4WIPA 4XX5A 3HKZE 5JEAJ 1Y1VH 1K8AC 2KMCA 4WAAA 1BBUA 3P4PB 3VUXA 3GTQB 4RM9A 1MPEA 3H0GH 4A3EH 4G3XB 4KKJA 4C1NI 3TRZA 1N32Q 2M19A 4FJZA 3TEWA 3HOWH 1VQGA 5C0XI 1DM0B 1FJGQ 1LTRD 4ZRQA 4OGQC 4KN4C 4RFBA 4UDUC 1YNJD 4YCVA 2KTRA 3G6EA 5E7NA 3I57A 1Y8RC 3NUHB 4QIWE 2LGIA 1C48A 1A0IA 1KAAA 4BBSG 1EZ8A 3DXJC 5BN5A 1RTOA 2V4DA 2Z0SA 1PVOA 1P7EA 4HDQA 3VQIA 2IPKD 2MFIA 4FHJA 3HOYB 2A6EC 3T56B 1BCPF 5CV8A 2KTRB 2WP9B 3JAMc 1WH3A 3TJPA 2A6HD 4XT3B 3ML8A 1E1OA 1FGUA 4K8IA 4GNXB 1HNZQ 1I6HB 1T6BX 4JWUC 2KWVB 4PMBA 1K8RB 2ZTEA 3I73A 5CYUA 3VYRA 1VZ7A 1UGJA 1C7YA 3GZNI 1KQSA 3UDXA 3UDIA 1F2MA 2JA6G 1NYRA 2D0OA 4EQ5A 1AEXA 4US9A 3LDZE 2CHZA 4LLGM 2BYFA 1TZOA 2WWZA 2ZZPB 3K59A 3ZXVA 4NQLB 4O0AA 3VDYA 4EQPA 4EFOA 3S2HH 4IURA 2RHQB 2F0HA 2ZNVC 4W9JA 3OAWA 3CC4A 2IX0A 3A1QA 4DUZQ 5EPKA 4A3BG 2Z59B 3IAS1 5KYLA 2GLSA 4YIJA 5D14A 2KDBA 2OJRA 1G2SA 2N7DA 3UQAA 4JPBW 4DA2A 1W3SA 1XTCD 3NS1A 3A1QB 3VUYA 2H88B 3M95A 4IDIA 4R8IA 1FMAD 4LUZA 4BVUC 2LMCA 2RPVA 4P73A 1FD6A 1G291 4JI0L 2KJHB 1VQOA 5ELFA 2JA7H 1SDFA 4BY1B 1S5DD 2L15A 4DU9A 3PSEB 3L9AX 2JN4A 4MHEA 2LMCB 2Y0SG 2PQAA 3K7AH 2L05A 4KHZA 2YU9B 3V60A 2C9OA 5C0XG 2MQJA 4C3HH 1KOTA 4DR5L 2J7QB 4A3DB 1CZGA 1PTOC 2F0IA 4UP9A 4CQNA 4JI3L 3TP7A 4BBRB 1YQ4B 2F0TA 1X55A 1UUPA 2PQAB 2PMZE 4LMQD 4AQ7A 1E9MA 4HMJA 1PV4A 1GC6A 1LGRA 2LXKA 3AI5A 2RVLA 3M3YH 2LFNA 5CV5A 3RNUA 3I4NB 1E2VA 2Q2UA 4XIGS 5M5YB 5HGTA 1HA5A 1Q8IA 4FNFA 5EQ0A 1SAPA 2QIEB 5D3DA 4C3IB 4LF9L 3I4MG 4EOYA 4OELB 1H8CA 1TYGB 3X23A 2ZT9C 4AS1A 2K5NA 2N9PC 3PO2G 1ZUD2 4HSPA 1SSNA 2LGSA 4XZ4A 2MP2A 4BXXH 4FULA 1L1OA 3NPPA 1VMCA 2O5IC 3HOXH 5K36G 1LT3D 2BS2B 2VQFL 4ANXA 4CO7A 4LK1C 1BT0A 1NMFA 2MP2B 2R7DA 1L1OB 4CDCC 1C78A 1PRTD 4A93G 5LHY1 2GBMA 2NBFA 3S14B 5BYSA 1VDZA 3H3VH 2YLMA 5AUIA 3PRZA 1PH3A 2B2UA 4RKLA 4DFAA 1MKHA 1SE2A 2B8FA 3G48A 3NE5B 4WJ4A 5C6AA 3QA8A 1I4QA 1CKOA 2QW7A 3BZCA 4A3IH 4HSVA 1ENFA 5G3LD 3R8BA 1PRTB 4W9KA 1E5WA 3S24A 3PIP3 2LZ6A 4AOFA 2FHTA 1HXYD 2JE6I 2K01A 3PTFC 4RF1A 3TBLD 2OTLA 1GOZA 1GPXA 1JQ4A 4HJ7A 4AP4C 3GTLH 1CZWA 2WDTB 4LFBQ 3CD6A 1PDXA 2UUAL 1GHKA 4JI5L 4FLHA 1L4DB 4FXCA 4DV0L 2HT1A 1QVCA 1QLBB 3A4SC 4Q2JA 2RQXA 1DGSA 1FD7D 2KBNA 1AZPA 1EWIA 3D4DA 1R4MI 2WXGA 4FA6A 1Q10A 2DNFA 2BOSA 1ICWA 1SSOA 3QHTA 2Z4HA 4WWPA 2BS4B 3P75A 2BF8B 1QUQA 3AEDB 5JVG3 1EY9A 5C5MA 2D9UA 1I4RA 5JJIA 1B3AA 1X54A 2AKWB 2RSNA 1A3UA 4CKEA 2A69D 1E6EB 1MG8A 3TMEA 1WXAA 4HJGE 3JAMi 1WGGA 2TMPA 1EQQA 3GTKB 1K83B 3AEBB 3W1YA 1GVPA 2A19A 4A3GB 3SXHA 1TWFB 1SR3A 3IRBA 3PF4A 2A68D 1EY8A 1D8LA 1F9RA 4JX1C 4MGYE 1Q3LA 1JW9D 3GQBA 4B0EA 3PO3B 3BVGA 1IBLQ 2L9HA 3PUXA 2XTIA 2K50A 2IO0B 1MGSA 2IDYA 2WIIB 4B9XA 5EE1A 1JRUA 2N1VA 3O13A 2PKOA 1HQMC 5KNCA 2NN6I 2ZXOA 1YNNC 4NXMQ 2Y5PA 2Z9HA 3VYSA 2X8XX 1PZID 4J6IA 4PZ6A 1KABA 3DWMA 1TJEA 2ZJDA 4RF0A 2MW5A 1STEA 5CV6A 2E2DC 1I6HH 1R4MB 1YI2A 2F3WA 2LUEA 5E6JA 4AJYB 1LV9A 1MJDA 2IZVB 4DAMA 1DONA 3NXWA 4TKOB 1BUVT 2AWTA 2LJIA 5M9OA 2IO2B 3HM3A 5CR3A 1TIFA 4DNTB 3KF6A 4LNQA 2Y3AA 3Q3FA 4PZ7A 1P7FA 3F1ZA 3CC2A 2YEPF 2EIFA 1XYIA 1V1PA 3BYTB 5BN3A 3DMUA 3K5NA 1QVGA 4M02A 4B9WA 3JAML 2JA8B 1V43A 3KF6B 1X3PA 1STAA 3T13A 2E8GA 3CRLC 2H89B 2ICEC 4KSKC 4WJNA 2JXXA 4OX9L 4K6DA 5IKCM 2FJ2A 4U68A 5IT9E 4ID6A 1T3QA 4A3LG 1EUJA 2NMQA 3AB9A 4HCSA 2I2YA 5IYBG 3BDOA 3K5MA 4DK6C 1UELA 2IWHA 2JWZA 4L2YA 2WXRA 1F0ZA 1ZKOA 1XMQQ 2B29A 2CWPA 1EEID 3OJ3A 5BMGA 4JI8Q 1F52A 1SF0A 3KWLA 4BBNC 1O7ZA 5G55A 1VRAB 3DPDA 1K51A 3RYTA 5DPRA 4BY1H 1S3OA 1CJEA 2K9XA 3HRDD 4R1JA 1C4AA 3Q8AA 3BVZA 2OOBB 4DR1Q 3HOZH 4C3JG 1TY2A 5IGCA 5IGEA 3NQTA 2F0SA 2YU9H 1WMHA 2MSED 4GU2A 1WZ0A 4BBRH 2Z4IA 1D1IA 2F4IA 3TMPB 1IYFA 4E74A 5T8IA 2O4XA 1WMHB 1BOSA 2NN6G 1JWUD 1F2ZA 1YX5B 4J6HA 1K73C 3AE3B 1SNDA 1HEZE 2R93G 2LVPA 2A1AA 1IPGA 4AYBG 4LAAA 4JI4L 2Y5BB 3V61A 3BZKA 3I4NH 1F2RC 2KMAA 5AUKA 5M3MG 4ILWA 5M5YH 4P2CB 5JPMC 2R7ZG 2KQSA 5FKAC 2L1BA 4MJSB 2OQKA 4C3IH 1G6ZA 4OWTB 1R4NB 1UBQA 1PTOD 1T5EA 1MFWA 4CKBA 4YCUA 1A62A 3AECB 3IHPC 2K33A 5FJ8G 1HR0W 2OHFA 4ZYSA 1IW7C 4PV1C 2KDEB 4KSLC 4KGSA 1WFQA 1Y1WB 1BBWA 3J9CA 1TVXA 4ZOHC 4GS3A 1N61A 1F9SA 2B63G 1UEBA 1LACA 1PTOB 4ZHPA 1DCZA 1NCVA 2F1MA 3CF5A 3L13A 4KZCA 1U9RA 4LNIA 1PYBA 3KLWA 1WI0A 2B3AA 1RODA 3S14H 4LF8Q 3I90A 4WJOA 1S5BD 2KHSA 4BFRA 2M56B 4JQWC 2PTLA 3ULPA 3ZJYC 5C4JB 3OPOA 1PMRA 2AQ3B 1UZXB 4GZYC 2LVQA 1ZP0B 1PDQA 4B3RL 4QUFA 2ZCBA 3HKZG 2AHOB 3P20A 4RCOA 2L1AA 3CCSA 1WTHA 4DHZB 1NVID 4ABNA 3DBSA 1HCZA 1Y69U 4K5XA 5CMDA 5C3JB 2M8SA 1II3A 4ZRPA 2KWDA 4RKBA 4ITKA 1ESRA 2M2LA 4X62Q 5C4XB 3KOJA 3J80E 3B2GA 2UXDQ 3RR5A 3HG9A 3FPPA 1SNPA 2L83A 2VH1A 3CPFA 3HM6X 3FKIB 2GBRA 2KK8A 4L5QA 1B9NA 5J1ZA 4K14A 2NUCA 3Q24A 4TUUA 4FHKA 3I4LA 2JVCA 2QC8A 3H3VC 4F7XA 1EF5A 2BKFA 3PUWA 3W5UB 5DPTA 1H9SA 1GAQB 3N6RA 1D5MC 4KKUA 4YWLA 2FNJB 3GTKH 2E6XA 1K83H 4QAYA 1KDAA 3PZ8A 1TKEA 1H9SB 1EUVB 1HUMA 1TWFH 1BO0A 1Z7TA 4RGMA 3QOJA 5JPNC 2L00B 4MH8A 4RMFA 4BAXA 2JA5B 2DJFC 5JJZA 3QIAA 2EQSA 4DV5Q 2C7NB 3NS8A 5JOBA 2KZRA 2K28A 5IGDA 3VR6A 2C60A 3RCZA 2LI5A 2KMMA 3U9OA 5IP4D 3PO3H 1GJXA 2OQ0A 1F9PA 3DM1A 1HUNA 2KNBA 4X3TA 4X66Q 3AEAB 4LJOB 3A8JE 3PV0A 3SR6A 5GMVA 2J4XA 1X6OA 4KY6A 2HTHA 3VDZA 2B2TA 2KYWA 1HZCA 4KD3A 4A3OA 1IBKL 3BYYB 1YQ3B 4GDLA 2MJDA 2VH2A 4KD4A 4RA8A 2MJ8A 1RD9D 3R93A 4A3JG 4GN3B 3VH4B 2A73B 1UE7A 2K5PA 3C3LA 4MSMB 4FADA 1PXUA 2JF5A 4WJWA 4DR4L 1ZEQX 1RFKA 1WTRA 2GI9A 2J0MA 2I1JA 2KXJA 2ZEQA 3B2FA 4AQYL 5CX3A 4PMCA 4E71A 4YSZB 4BOZB 3SEBA 2NVXB 2INCC 3WAOA 1CHPD 5MPOA 1I4PA 3DWQA 1QE6A 5NUCA 1BR9A 4YY3L 4C00A 1RWSA 2NR2A 2VQEL 2M9VA 2ASQA 2ATWA 1WIAA 2JA8H 4JV5Q 3CSFA 2MJ3A 1AH9A 3V6CB 3E0JA 3J80c 2A8VA 3J7AF 5KHOA 3QX1A 1NENB 3AEVA 3I7FA 2EKEC 1LTLA 2G45B 4K3CA 4MGZE 2Z0DB 3AU5A 1RLFA 4FF2A 2KKCA 3SHQA 3M63B 2KFKA 3U4EG 4KHPL 5J3BA 1T5XD 5L83A 3NQIA 2DWQA 2LVOA 3A9KA 1N9WA 3I91A 2QCZA 4OVVA 4OZBA 1FJGL 4P7IA 3PIOA 2LY7A 2SEBD 4GXBA 1BDOA 2NVYH 4A75A 1MG4A 1QOBA 2KFKB 2RD0A 1LYLA 4JOIC 2K5WA 3AU7A 4ZRZA 2MP1A 4LDTD 1BXTA 1GO3E 2EYMA 4DR2Q 2PZUA 5IWAQ 2ZPNA 3A9KB 1G2TA 1XF5L 5C4HA 2WFWA 3HVZA 2A6HC 5LXHA 1V1QA 1F2RI 3GP7A 5IP9G 1MHHE 1PRTF 3IFWB 3T9LA 2N49A 4LF5L 2IJ0A 4LDTB 3TN2A 2GBJA 3W1GA 1C4PA 1WR1A 4RMAA 2F0KA 1XPUA 4OZAA 1A15A 4LNKA 2HQEA 1UWXA 2WDVB 1Y1VG 2R2QA 4KIKA 2C5CA 4RHRA 2PZWA 1EQVA 3DBLI 3Q8CA 1SGHA 3H0GG 4A3EG 4DNRB 5G3LF 4DR6Q 2NBWB 4II2B 4GMVA 4LF7L 3PT2B 2I5MX 4YHHL 4UY8C 2WXLA 2KWUB 3CP0A 1D1KA 1WJNA 4YTMB 4KIKB 1M90C 3AU4A 2BA0A 3AE9B 3HOWG 5JZEB 4ANUA 2RA4A 4AIMA 1A3VA 3T1YL 3MC0B 4NMZA 4QB4A 4DAPA 4DHJB 1XXGA 3LGJA 2QSDA 1WI5A 1EWYC 3L54A 2BBCA 4YWKA 4DR7Q 4GOCA 4L5TA 5E4WC 3LWEA 1FYCA 1WTOA 2AUJD 5HG2A 2EYPA 5J2RA 1TS4A 3N30A 1H9RA 1NY4A 1YVCA 3J81i 2J52A 2F0UA 2B8GA 3U7ZA 1L2FA 5CBEE 2MBHA 4M1UB 1XT9B 4FXDA 4A55A 1O80A 2K04A 4EX5A 4DXFA 4B0MA 4GB9A 3ZGZA 3RNFC 3FHWA 4RCNA 3TEXA 3S2HB 2FCMA 3ZKJC 3APFA 4X64L 3APDA 1PGBA 4FYDA 4AWJA 5C4JH 2M4NA 4LF6Q 4DV3L 4X65L 3K80C 2JYTA 2WXIA 3Q14C 3SDLC 3CCLA 4OEMB 4DV7Q 2KDFB 3AM9A 4G50A 1OO9B 2ENBA 2YTXA 4LFCQ 2QF7A 1QNKA 2GRIA 3ZW3A 3HOUB 3KVFB 4EUTA 4R3DA 2XRSD 4V0BA 1V49A 1T0YA 3NWSA 4RG1A 1WX9A 1V9JA 3H3VI 2KQ4X 1HHVA 2X6LA 3QB3A 5G2NA 3SU8X 2JT4B 2V3SA 2F0FA 2F52A 4HR7B 1HNXL 3DVGX 3BVMA 2XWBB 4GKKL 4JI7L 1UD7A 3OW2A 2V4LA 2DLBA 1E2WA 4FO2A 3ZQ4A 2EY1A 1LTTD 2JRHA 4DV6Q 3S15B 4BKSA 2J53A 2RF4A 3FKIH 1XMOQ 3DBHI 1L1OC 4DBGA 5D6JB 3M3JA 3E5SA 4MZ9A 3D6CA 4B3ML 4JI1Q 1VQ7A 5CV4A 4NXNQ 1XNQQ 4XC2A 2NYZD 1L0XB 3R66C 1IZ6A 4LFAQ 4GKJQ 2KHJA 2JA7G 1V97A 4PK1A 3OHXC 2Z0EB 2O6VD 4XXEA 3RN9C 4IM3A 1LUZA 2EJMA 3PMFA 2B2UC 1WYGA 3PHWB 1HR0Q 1DYQA 3L0OA 4C3HG 2KDMA 4M8NA 1SXTA 1A2UA 5M3FB 3RLFA 4QQBX 2JA5H 1EQTA 1KDCA 4HCPB 3URYA 1JE4A 1DJRD 1H9MA 4I7AA 4JK1C 4BY7G 2OXPA 3DVNV 1K3BC 1VJKA 2CW0D 2ZXPA 2O6VB 3A54A 3OWEB 5AZFA 2F0LA 3HOXB 2JXTA 2WYQA 2ZW1A 5DCNA 3K5OA 4TQ0A 1ZXHA 4UP7A 2WLBA 3Q3MC 3W5VB 3VR8B 1Z2MA 3FMCA 1OTCA 1PUTA 3BINA 3ZDMC 5JXVA 4IOCA 3VHTC 2HJ1A 4OWXB 3U58A 1D5ZC 3I3TB 3GS2A 1EF1A 3HK0A 1VR9A 4RM8A 4KI0A 2EYOA 2WB1E 4PS8A 3DHIC 2RDGA 4LFBL 1NBWA 2SOBA 1PH9A 1TKWB 2WAQB 3N52A 2BQQA 2E2JB 3IL8A 1HZ6A 4DGZA 3CWIA 3PZDA 4DK5A 4L5SA 3VYUA 1YJIA 5E1FA 3J7ZC 1WJJA 1U4MA 4H7BA 4DWFA 1F77A 1ASZA 2KOXA 1XWEA 2NVXH 4XQQA 3EFUA 4JBWA 4H02A 4IPGA 1R4PB 3KUDB 3R3OA 4CHTB 3RNCC 2A69C 1C76A 2VW9A 1HNWQ 2JEAI 3JYUA 4XE0A 1K8MA 3FRPB 1H9JA 1L0WA 1PFSA 3D32A 1GUSA 2F0DA 4A3IG 1JJGA 4NZLB 4N9F4 5JAVA 2R61A 4KVGB 1P0RA 2D3CA 2QMTA 3CPWA 1RIPA 1F9QA 4B3SL 5T1IA 1WX7A 3E56A 1I94Q 1CSPA 5A2QL 1XNRQ 3TIXA 4HJKA 5EPLA 3ABVB 2VB2X 2F4VQ 5EBCA 4G11A 4R4TA 3TS0A 1PTOF 1C9FA 4O42A 2A4ZA 3SGIA 4WURA 2F0OA 5IGGA 2R92B 1JT8A 2L52A 4C2MB 2E2HB 1I6VC 1SYDA 1V9PA 3DWGC 3AEFB 3J80L 2QKIC 1SYBA 3NZ3A 1J5EQ 5DPWA 1MI2A 1HH2P 1JOKA 4IFDH 2IYDB 2ACZB 2RDHA 4ME3A 2Z8LA 1WCMB 1JB3A 3RZWC 4K81A 1YJ1A 3GB1A 4N59A 2OEOA 1CK1A 1A63A 2KCMA 2LKVA 3H94A 2MX2A 2BW2A 1ZDXA 3PUYA 1BUIC 4BZAA 1JMCA 1QKZA 1TTNA 2NWGA 1V1OA 3ZDTA 4DHZE 1PYWD 3PLUA 4DR3L 1GXDC 3A9JA 1S40A 3NVYA 4MSQB 2JQOA 2EVBA 2M1MA 2Q5WD 1QQRA 1Q90A 4IPDA 2NPTA 5IYCG 1VQLA 3TBIB 2EY2A 2YTVA 1CTMA 1EIYB 2F0EA 5IP7H 3WAPA 1WYDA 5AEKB 2IY0B 3A5UA 1QILA 3FPUB 2PE6B 3S16B 2K0PA 2CHBD 2I07B 2QDFA 5D7GA 4ZUIA 4IWOA 1NI2A 1Y56A 2LJ5A 3U4ZA 4F7ZA 1OXSC 4IW0A 3HOYG 3E0EA 3Q8EA 2KACA 3TL5A 1XCTL 1D3ZA 1EY4A 1UNSA 1C4CA 2FCSA 1H4RA 1P8LA 4N9PA 1GNUA 3KUPA 1EYCA 4DK1A 1K8GA 3AYHB 4JYAQ 4NJ6A 4XWTA 1P16A 3PGZA 4DV4L 5E6NA 2EE1A 3AFQA 4USAA 1TWAB 3WANA 1C3TA 2ZXRA 4NDXA 2WDRB 4KGTA 4EVOA 3ML9A 5FLXE 1OQQA 2BA1A 3HOUH 4PMWA 4OWWB 1TR5A 3TP8A 3PVLA 4JI6L 2WX1A 3FEWX 1LXDA 2SAKA 3HS0C 2FCQA 4KDLB 1C79A 2KJXA 1XO3A 5L95C 1HTPA 3HOZB 4DV2Q 2Y0SB 1YJWA 3IXSA 3UI3A 2NB0A 1GM5A 1QCBD 2CKZB 3Q3NC 2M0AA 1TXYA 3S15H 3TEZA 2NZ1D 5FR3A 1FEHA 1BF4A 1YEZA 4A8XC 3JW0X 1YMHE 3UGBB 3FDTA 5D65A 3W5OA 2GBKA 1YQBA 1CQVA 3U4VA 4BY1G 1VCIA 3HIZA 2WV6D 2RCFA 4OO1H 2PCFB 4LUVA 4FDBA 1ISNA 1UF0A 1OXXK 1UWVA 2HDMA 3CQZH 1EY7A 1VQDA 2K5DA 2I1KA 2MO0A 2IW3A 1V8QA 3NK9A 5M3FH 4A3DG 5C44G 3QOLA 2V4IB 5HI1A 4Z9CB 4IG7B 3RNEC 1BKBA 4K2KA 1EIGA 5AJ3Q 3TCAA 3EROA 1FXAA 2B2VA 2FXQA 3SK5A 4HTHA 3MXUA 3RUZA 3NHHA 2B2WA 5JEAH 1HZ5A 3PCOB 4LK0M 3H6MA 2B39A 3D0FA 4J8QA 1N36Q 4QL5A 5LMNW 2K7VA 2IX1A 3I4NG 1LABA 1Q8KA 2PW7A 2ONQA 3DCGA 2BB6A 3UI2A 4A93B 4C3IG 3Q6BA 3Q8DA 3SVMA 1WTPA 3EECA 4FF1A 1N62A 1SNQA 1N34L 4NNJB 3ZUNA 2AL3A 3F2CA 1VQPA 3QC8B 4FXGC 5IGFA 4TQ1A 4JGHB 4DAYA 2KWCA 3IFTA 1QG7A 3MJWA 2GVAA 2XWJB 5FO9B 1VQFA 4X62L 3EA6A 2E2JH 4EKUA 1SLJA 2AMCB 4ODGA 1KFYB 2G9DA 2XSCA 2CU3A 2K32A 4FF3A 1EY5A 1X3QA 4KJOA 4DAYB 2DN8A 5FLXc 5C0XJ 3CCJA 2WU5B 2K22A 5BN4A 1HE8A 2F3IA 2XRQD 4CBVA 2BH8A 1RF2D 4X3UA 4LF4Q 2MLBA 3I72A 2KOLA 4BBNF 3GTMH 3L4PA 3L0WB 1VQCA 1IGDA 1PGXA 1ET6A 1IL2A 2K8HA 3CSTA 1MJCA 2GA4B 3PUVA 1QZEA 3T1HQ 2JYOA 1JOOA 5E3FA 3A74A 2UUBQ 4KTAA 3P2BA 1H95A 4LNNA 4PS7A 2B2TC 2PZTA 3L16A 5G5GA 2DAJA 5BR8L 4KGRA 4CKCA 1V86A 1SYCA 2NTSA 4TKNA 4ZRIA 1QUQB 4BS9A 3S2DB 3JC66 1FIQA 4TMAB 1XLQA 5GROA 2C7MB 1IBMQ 2R92H 3WWVA 3AE6B 1OQYA 4C2MH 4P71A 3X3MA 2E2HH 1RM6C 2RHSB 1RJTA 5I9PA 1D7QA 4P72A 1WSPA 1HFNA 1NBFC 3NG0A 1WJ6A 3NSWA 4GIVA 4XQNA 3DM3A 3T16A 4XGAB 3M7GA 1WCMH 1ML0D 1E8XA 1DOMA 3PF5A 2LHDA 4CJ1B 1L6VA 3MJ5A 4W9HA 4PG3A 1HTLD 2K14A 2LHEA 3P1MA 4UHVA 3H7PA 3D3RA 4A3GG 1ZKHA 2O2VA 1NDDA 1UE6A 4POGA 4MM3A 4Y52H 3HOVB 5AZHA 3E3XA 3ZYYX 2ZM6L 1KRSA 3EN2A 2EJGC 3N3KB 3DWAA 3OIPA 1E90A 5IY0A 2KJRA 2O2VB 3PO3G 4G4KA 5K5PA 3FP9A 1SRUA 2JSOA 1ZW7A 3IFDA 2WXHA 4MM3B 4TV3A 4KDIC 2A5HA 4P1BC 1HA6A 5IA7A 3ICEA 3S16H 2KX0A 3TSSA 1WGRA 4KLKA 4P6VF 2MA9B 4ARCA 4K0KL 3M4OB 5JJLA 5CHFA 4A3MB 4NY0A 4CJ2C 3G6JB 1E7UA 2X6GA 1WJUA 2KO3A 3R7RA 1I50H 3IAM1 1SJHD 1SMYD 1J9OA 2JPHA 4K5WA 3KWVA 1V1PB 5CBAE 1R4NI 1ASYA 1LM8B 2PQEA 1WM3A 3OTOL 2INPE 1WZ3A 1LTBD 3SE0A 2WXMA 3DEOA 3DHQA 1U4RA 4L5RC 1DOYA 4A3KG 5ELNA 5IWAL 1MVKA 2UUCL 1FM0D 1TWAH 3AE8B 1EWHA 4Y7NB 1VCBA 4W9GA 3R7QA 1KNAA 1PQSA 1B9RA 1SEBD 3A0JA 5HURA 2PVOD 3SFDB 4IUQA 4WQOB 2WB1B 4OW0A 2NVYB 3W3AA 2JA8G 1EQRA 1E0BA 1NAPA 1X3GA 1E7PB 3BIID 4JI2L 4F8MA 3NJTA 4JE3B 3IT4B 1DOKA 1KTKA 2B3GA 3BWUD 3QWNA 3MP9A 3AE2B 1UWMA 4POFA 4I6PA 2L32A 3F2BA 4NJ7A 2I38A 1JOQA 2OF1A 3MVVA 2FUHB 1PLFA 1K9MC 5DPSA 2UXBL 1R7SA 3AEEB 2R3ZA 1XX8A 4YTNB 2WAQE 1Q1OA 3KYDD 4KZ0A 3NTKA 2HUGA 2K03A 3LX0A 4JC0A 2DY7A 3NTIA 1QVFA 1RRBA 4KY5A 3IT6B 4WH4A 2G4DB 5BYRA 3ER0A 4IUPA 3BG3A 2DENB 1ENAA 2VB3X 4DUYL 4UPAA 3J81j 4MGIE 4PYZA 3I63C 3HRZC 4RNAA 2BT6A 3ZTCA 3R3MA 4U673 4II3B 4C4VA 4DV1Q 4HEDA 3TZDA 4NAMA 3EIVA 2UU7A 5D2MB 2OCEA 3DWPA 4DNIA 1N8RC 4JL9A 3I4MH 1LTAD 2UU9Q 5IOIA 1WXSA 2DNEA 4GOPA 2XNAC 4XDCA 4IPHA 1UAPA 4C4VB 2NVTB 4IPCA 4FP5D 4JI0Q 1OXVA 1QOAA 2LWPA 1QWYA 2N8NA 1VQBA 2UXCL 4BKTA 1E22A 2BB5A 1K28A 4GOPB 1B2TA 5LL6X 3NZSA 2KN4A 2RSOA 4NPSA 3WA0A 4DR5Q 4DV7L 2E2IB 1T0QC 4PZ8A 3I5JC 3I3CA 1JJCB 2C35B 4QGUA 4A93H 4JI3Q 1OEYJ 5E4XA 1EIHA 2RBMA 3NVVA 2KENA 3VXWA 1JB7A 2IGDA 2VRRB 5I6YA 5IT9c 3P4QB 1F2LA 1P1AA 3CCRA 1Y1WG 3S17B 1G8ZD 4PT5A 2PNRC 5E6PA 4LF9Q 3OJ4B 4YSXB 3Q23A 1WGDA 1WXQA 1X56A 3STBD 2K5VA 1TIID 4FVMA 2NTTA 1J8CA 1FNVA 1STHA 2JQRB 2XK5A 1SIJA 2DYOA 1XNQL 1RFAA 2ZVNA 2BTEA 2QDLA 5C5LA 2VQFQ 2CKHB 3GE8C 2EDGA 5T1GA 3KK7A 2JZ3B 2N1WA 3EFXD 2XK5B 1GHJA 5IOCA 1AFPA 2PJHA 3I9V1 1U0LA 4GDKA 4S0RA 1SIFA 3A8IE 4G7HC 1PH7A 1VQIA 1L0YB 1KF6B 1NYQA 2CW0C 4IN3A 5IYDH 2W54A 1WYWB 3IG3A 3L3OC 2RCNA 2AUKA 2LRWA 4HMIA 4LTUA 3EUB2 2HE7A 4GDKB 1WR6E 4ZYNA 5JVH3 1JE5A 3MHBA 1GB4A 2REXA 2CWAA 3S2DH 5C4XG 4ZRJA 4DN4M 1SE9A 3UDGA 4K5VA 1IXRA 3HEJA 3MEHA 2KEDA 4JBJA 1WM2A 3KF8A 4K6LA 1VQMA 1PFDA 3BDCA 4XYCA 3FKIG 3NEMA 2HHHL 2FIFA 1KIXA 2WXPA 3V6EB 4DV0Q 1S3SG
chains in the Genus database with same CATH topology
2BCOA 4ZHOA 3SK6A 1M8AA 3EJIA 1AZQA 3NVWA 1U4PA 3VRAB 3A7AB 5ELBA 2Q8IB 3VR9B 5IODA 3HUIA 3SR1A 2W3SA 4OL7A 2JU6X 4IFDI 4GDLB 1MSGA 4JPSA 5EJWA 3FAHA 1SYEA 1BNZA 1MHXA 1JWAD 4A9AA 3BS1A 1C4QA 1H9KA 3LB8C 1Y8OB 2WINB 1EWCA 5C3EB 1LTID 5F2DA 4Q5VA 3V05A 2ON8A 4HAEA 2INNE 4A90A 1B9MA 1YJJA 1WTXA 3AE5B 1FCLA 3C2PA 4L6TB 2JXMB 2CVRA 2F0JA 2L0CA 1GUNA 3H09A 1E2ZA 5EKIA 2MHVA 5ELEA 3K58A 3J7YW 3MFGA 1WTWA 4KX6B 2VUMB 5C4ZA 4HN7A 3RZDB 4XQJA 5EE0A 5H92C 1TS3A 4R8NA 1O78A 1ESFA 1V8CA 4A3FB 1FRRA 2WXFA 4FF4A 4HEA1 2KEEA 2BYTA 3Q6SA 1QOGA 4QF4A 2HTME 3Q0AA 1S5CD 5CC4A 2KA7A 1ILQA 2JX5A 2R6GA 4L23A 4I65A 3A55A 3R2TA 4XYOA 2N55A 1NI3A 3IAYA 3AN1A 4X3KA 2TSSA 4IFDG 3ND8A 1C8CA 5FO7B 2W55A 5EBDA 1TS5A 1GB1A 3OW7A 3A8KE 4WWMA 1O7YA 2N9LA 1GUWA 2F0QA 4MT5A 2RDFA 1LTGD 3KLSX 3B9JA 4E6IA 4OO1I 1TWHB 1TT2A 1Z47A 2EJFC 1SNOA 2MJEA 5GXGB 4PNYA 3MFYA 3CHBD 1WTQA 2MGSA 3T53B 2Q8RE 3ONAB 3LXFA 2Q8TA 5HHDG 4TRDA 2RKSA 1XLNA 3MTSA 4RHSA 1OXTA 1LO5D 4I7ZC 5C3XA 4NW2A 5M5WB 5IT9L 1SE4A 3P63A 2OT2A 2B2VC 5I2YA 2FINB 1SJED 1DOLA 1SNCA 1CA5A 4IFDJ 1I4GA 4A6QA 2B2WC 3KBXA 5EE9A 4RGNA 1JWMD 2F0MA 2XN9C 2AQ2B 2E74C 3SDZA 3J7AV 1J7CA 1AN8A 3CQZB 4TSSA 3TZUA 3MAQA 1W6JA 3C1FA 1L5PA 4BY7B 3ZJTA 2L11A 3MWYW 4ZUJA 1STYA 4H44C 5EE3A 1ZXTA 2PVGC 2AQ1B 2FBWB 2WXQA 2WXKA 1FNUA 2YEPB 1M4VA 2L5TA 1ZDVA 2EPBA 1IBXA 4OO1G 5DM73 4QCLA 5I9OA 1N5WA 2LUMA 4DK0A 2WNMA 3ZJUA 1IBXB 5I6WA 1TWGB 1MD2D 2PO4A 3IKJA 5JEAG 2EOTA 3NBHA 2E76C 4ZKCB 1R4QB 4KY7A 4DQOC 4UAIA 1A2TA 2D2CC 1D5XC 1RKNA 3W1SA 3AB5A 4RAUC 1DOXA 4N9TA 3P7JA 3VR4A 3RPFC 3JAME 3T3NA 4CJ0B 1N5XA 3HGBA 3TP6A 3GTMB 5FOBB 4C80A 3OMGA 3AMUA 1WRIA 1J7BA 2KCNA 1CA6A 4P16A 2YYZA 3E9SA 3LYYA 2V0GA 4XYQA 2IGGA 1NR2A 3P4SB 4CGYB 4B08A 5KNDA 1TS2A 1J7AA 1EU4A 1STBA 3NBIA 3I8ZA 2EYLA 2K05A 3D4RA 3TDQA 1I3QB 3SK8A 5KEEA 3P4RB 1EEFD 2Z1CA 4BA1I 1JRPA 1SYFA 2QCPX 3FILA 4HKZE 3M4YA 1AYFA 4K8JA 4QMGA 1JCKB 1L0VB 3PIO3 4BBSB 3FILB 2IL8A 5J22A 4MIUA 1N63A 4OHJA 3GD7A 4DAVA 3HP3A 1SMYC 2EKIA 1BBXC 4WFN3 3KBGA 2N7JA 3NTHA 2PPBC 1JC7A 1Y8PB 2JA6B 4HCEA 1LTSD 1HRJA 2FFKB 1JICA 3WCQA 1RCVD 1U4LA 2GB1A 4KN7C 4YT0B 2MUYA 4G57A 1I50B 3TP5A 2SDFA 4WAFA 2N9KA 2F3VA 3M85A 3Q8BA 1AW7A 1EYDA 2H1EA 4A3BB 3LNNA 1S5ED 5KIXA 5DM63 1WD1A 2EY5A 4ZK9B 2ICIA 3VYTA 3C1EA 2N88A 2X38A 2LS01 1A6XA 3VA7A 3CRKC 2HDLA 2EY6A 3CIRB 3H8HA 1JWSD 5I2XA 4KJNA 5ELCA 1IGCA 4YXDB 4FXKC 3G7LA 5I4DA 4XDXA 3K57A 1XLOA 4US8A 3I4MB 4J1MA 2LFIA 1TKYA 4ZAIA 5C44B 3PO2B 2B76B 3Q22A 3VR5A 1I4HA 4F87A 1DD2A 1FNWA 2PIAA 4YSYB 1F2YA 1Q12A 3U9SA 1DXMA 2VNUD 1YN3A 1A70A 3MA2B 4IZ8A 1ZOYB 4NKLA 1Q1EA 2WP8J 5G5HA 2D5DA 1BCPC 2VZKD 2FUG1 1G91A 5LNK1 1TKGA 2SNSA 3SHLA 3ND9A 1EY0A 2DBYA 3RMHA 1VF5C 2WKCA 5EPJA 2VZKB 4KK7A 1S5FD 3QJYA 3RFZB 1PZJD 3FVQA 2SNMA 3QG1A 4DXGA 1JROA 3NRZA 5DAUA 2NVQB 2K3UA 3W9CB 2F03A 3SFEB 2L4NA 1B50A 3GTGB 1K8OA 2QEJC 4FXCA 4C1NK 1E0ZA 2B2YA 4IOIE 3PUZA 1JQYD 4PQXA 1QF6A 2F0VA 4IUTA 1SNMA 3BK2A 5LL6S 1XCQL 1CM9A 1BQQT 3P42A 1XLPA 2AWOA 2PW5A 1YNTE 3OMCA 1GUOA 2JEBI 2VXWA 5M5XB 3Q8FA 3RZOB 3T4AC 2H4OA 1I4XA 3SK4A 2JZPA 1EYAA 1DOIA 4OZCA 1ZYRD 4L63B 3TUOA 1RDPD 1ROEA 1SE3A 3KQ4A 3KLRA 5TSSA 3S1RB 4F88A 3BDLA 2J42A 4RH6A 1D2BA 4KMUC 4REZA 1PFBA 4C56C 3X3NA 3AM9A 3L7ZC 1RTNA 4H13C 3GO5A 5C3WA 1PFNA 1L4ZB 4ZQ3A 1YN5A 1SB3C 3NP8A 4R9WA 1STNA 3P1HA 3VR3A 2O2LD 4A3KB 1ET9A 3W2DA 1CHQD 5EKKA 1OQRA 1LT4D 1MSHA 2A6ED 4ULLA 3V96A 2V3NA 5A35A 4XT1B 1QOHA 1GUGA 2PW9A 1ACCA 3K0YA 2QJLA 3AH7A 1ILPA 4C3JB 1NR4A 5KYIA 2PLPA 5C0XH 1FCCC 3EGRA 3ZJVA 2RMMA 2ID0A 3BZDB 2LEKA 3MXGA 1NUCA 3NWTA 4LJZC 4K2LA 4D2KA 2W3RA 2R93B 4GLSC 4AYBB 3J81E 4C7ZA 1QT9A 2L55A 5M3MB 5KNBA 2N0SB 2R7ZB 2JWUA 2IT1A 1K50A 1Y8NB 5KRUA 3Q69A 5BMHA 3RD4A 2CJNA 1EFID 5DEHA 5K36H 1SYGA 4IALA 2B63B 1FRDA 2MH7A 2K1BA 2DYMA 2L12A 1UEAB 3GTPB 2WKDA 3KLSA 4O1NA 1L6UA 2HDEA 1EOTA 2X69A 4G7ZC 5KGUA 3AMZA 1FO4A 3K6OA 3OSOA 1B53A 4Q0FA 2E3TA 5DNFA 5HFYA 1LLRD 3HKZB 3VR2A 2BE5C 4NAWB 2WACA 3S1QB 3WOFA 4H2AA 4C7YA 1FFVA 5IGBA 4H0LC 1JR0D 3S9WA 3S1NB 2JSVX 3C46A 5D3IB 2K5QA 3R2IA 1OFFA 2XVSA 5AFWA 4HROA 2EXZA 2EYJA 4EQNA 3FC4A 4RGOS 4QIWB 3A56A 1BCPD 1FXIA 1S4ZA 1SBBB 1FFUA 1TY0A 5A2QE 5FO8B 1YN4A 3ETRA 3D8GA 4S3SA 5FLXL 3HVDA 2KCCA 1FR3A 3AE1B 1CI3M 1KDBA 1AWDA 4NJCA 1BCPB 2MPMA 1N60A 5CORA 1VLBA 3U2SC 4EQOA 1CZPA 1WWTA 3WDNA 3T3OA 1X32A 5FK9C 5BMIA 2PMVA 1TQOA 4ME5A 3OWFA 1DGJA 1PFMA 1LT5D 3EVQA 1D6EC 1WTVA 4M8AA 1JMLA 5ISRA 4A3JB 4KKIA 2J7ZA 2WXJA 3U52E 3M7NA 1KLGD 1DZ1A 3VRBB 1RHPA 2DNCA 1ENCA 1XEEA 1TU2B 1R9TB 1GUTA 4QUCA 2QDBA 5EGTA 2FMCA 4HRSA 4N6EB 4KHVA 3OOCA 4YWGG 1VZ8A 2PMZB 3DUZA 5CGKA 4KKTA 1IKMA 2A74C 2KECA 3AE4B 2F0NA 4V190 1YNND 2PYKA 5IIFA 2G9HD 4KV6A 1WD0A 5EKLA 3E6ZX 2W82A 5C2TB 1I7HA 5J39A 4M0WA 1PZKD 1B4OA 1J8IA 3A7LA 2D62A 4J3OD 4WRDA 1HPCA 1QB5D 1CFMA 1KNEA 3ITPA 1WVLA 2AWNA 1FGBD 3LWUA 1TWCB 3GTOB 1YNJC 4EGVA 4IKGA 2KQ3A 3MZ5A 1W6KA 1Y1VB 2NN6H 1IHZA 3V3XA 2KUMA 3H0GB 4A3EB 2OEDA 1CQFA 1KRHA 4XTCS 1EZ6A 1VDVA 3HOWB 4IQZA 3MHZA 2XIWA 4OVZA 3MXNA 5COYA 2JP1A 4MN3A 4BWGB 4JWSC 1QJOA 5CV7A 1ONLA 3T51B 2EYFA 1EY6A 1HQRD 4IUUA 2D5GA 1A3TA 1IL8A 2I46A 1K53A 2BS3B 2BDOA 3AV8A 1PGAA 1NEKB 2Y5CA 1VF7A 4WORA 2ZW0A 1B44D 2EELA 5CV9A 2MEKA 1EU3A 3C8YA 1PTOH 1K52A 3NUCA 4IUVA 1EM7A 4KKSA 3GTJB 1ZPSA 1IW7D 1VMPA 2DY8A 3D6WA 3VA5A 3MXPA 2BE5D 2F0GA 4BA2I 3AEGB 4X3SA 4XDDA 2G1EA 1IKLA 2IX3A 3OIQA 2JA7B 4G7OC 2M00A 1MI0A 5ELDA 1QOFA 1LT6D 1Q1BA 3K7AB 1WGKA 3GV6A 4C3HB 4L8JA 1EL0A 1NSNS 2HCIA 2KVMA 3PZ7A 1BMLC 1ZE3D 2QILA 4ZKBB 1D4BA 2FMMA 2FE8A 1CT1D 1AP0A 2AX5A 2WDQB 2E75C 1RYJA 3M3YB 1VZ6A 1ZXIA 4EE2A 3QO2A 1STGA 4IUNA 1IUEA 3J81L 1PRTC 3V2TA 1C77A 2JYEA 4OIJA 3S1MB 5H8YE 3NVZA 3K5LA 3N9YC 1OXUA 2F0PA 3PO0A 2O5JC 3GV3A 4DF7A 3I70A 4L1BA 2B2YC 4OIKA 2EZVA 3DEPA 4ZLTF 4WQMA 3TEYA 4XWWA 3CKIB 3EQLC 2WXOA 3BK1A 3D4WA 4A3IB 2IGHA 1KH0A 4TQUS 4ARIA 2WXNA 3WOEA 3D31A 3F2UA 1HFGA 4YTPB 3H91A 1O7LA 3GTLB 2CJOA 2CQAA 1JWBD 2K6AA 1IYUA 1SFOB 4MACA 1Z6HA 2J0TD 1B1ZA 1E10A 1MBYA 5BYQA 3ERQA 2WQYB 1ZYRC 1QNUA 2A68C 1KLUD 2HCCA 2WU2B 2WS3B 2KAJA 2BDNA 3CU7A 2EYHA 1IYVA 1JALA 3HZXA 4RGTA 4RWSC 4N58A 2V3PA 2F0WA 4NP5A 1JORA 4WIPA 5JEAJ 3P4PB 3GTQB 1MPEA 4KKJA 4C1NI 2M19A 3TEWA 5C0XI 1DM0B 1LTRD 4ZRQA 4OGQC 4KN4C 4RFBA 4UDUC 1YNJD 3I57A 3NUHB 2LGIA 5HI1A 1C48A 1KAAA 1EZ8A 3DXJC 5BN5A 1RTOA 2V4DA 3VQIA 1P7EA 2IPKD 3HOYB 2A6EC 3T56B 1BCPF 5CV8A 2WP9B 2A6HD 4XT3B 1T6BX 4K8IA 1I6HB 4JWUC 4PMBA 3I73A 5CYUA 3VYRA 1VZ7A 1UGJA 1F2MA 1NYRA 4US9A 1AEXA 1TZOA 3K59A 4EQPA 4IURA 2F0HA 2IX0A 5EPKA 3IAS1 5KYLA 4YIJA 5D14A 1G2SA 4DA2A 1XTCD 3NS1A 2H88B 4IDIA 4R8IA 1FMAD 2LMCA 2RPVA 1FD6A 1G291 5ELFA 1SDFA 4BY1B 1S5DD 4DU9A 3L9AX 4MHEA 2LMCB 4KHZA 2YU9B 2C9OA 5C0XG 4A3DB 1CZGA 1PTOC 2F0IA 4CQNA 4BBRB 3TP7A 1YQ4B 2F0TA 1UUPA 4LMQD 4AQ7A 1E9MA 4HMJA 2RVLA 2LFNA 5CV5A 3I4NB 1E2VA 4XIGS 5M5YB 5HGTA 1HA5A 1Q8IA 4FNFA 5EQ0A 1SAPA 2QIEB 5D3DA 4C3IB 1TYGB 2ZT9C 4AS1A 1ZUD2 4HSPA 1SSNA 3NPPA 1VMCA 2O5IC 5K36G 1LT3D 2BS2B 4LK1C 1C78A 1PRTD 5LHY1 2NBFA 3S14B 5BYSA 1VDZA 5AUIA 2B2UA 4RKLA 4DFAA 1SE2A 2B8FA 3NE5B 5C6AA 1I4QA 4HSVA 1ENFA 5G3LD 3R8BA 1PRTB 3PIP3 2FHTA 1HXYD 2JE6I 2K01A 4RF1A 1GOZA 1GPXA 1JQ4A 1CZWA 1PDXA 1GHKA 1L4DB 1QLBB 4Q2JA 2RQXA 1FD7D 1AZPA 3D4DA 2WXGA 1Q10A 2BOSA 1ICWA 1SSOA 2Z4HA 2BS4B 3P75A 3AEDB 5JVG3 1EY9A 5C5MA 2D9UA 1I4RA 1B3AA 4CKEA 2RSNA 4HJGE 1A3UA 1E6EB 2A69D 3TMEA 2TMPA 3GTKB 1K83B 3AEBB 4A3GB 3SXHA 1TWFB 2A68D 1EY8A 1F9RA 4JX1C 1Q3LA 1JW9D 3GQBA 4B0EA 3PO3B 3BVGA 2L9HA 3PUXA 1MGSA 2IDYA 2WIIB 4B9XA 5EE1A 3O13A 2PKOA 1HQMC 5KNCA 2NN6I 2ZXOA 1YNNC 2Y5PA 3VYSA 1PZID 1KABA 3DWMA 1TJEA 4RF0A 1STEA 5CV6A 2E2DC 2F3WA 5E6JA 1LV9A 1DONA 3NXWA 4TKOB 1BUVT 2LJIA 5M9OA 5CR3A 4DNTB 2Y3AA 1P7FA 2YEPF 1XYIA 1V1PA 3BYTB 5BN3A 3DMUA 3K5NA 4B9WA 3JAML 2JA8B 1V43A 1X3PA 1STAA 3T13A 3CRLC 2H89B 2ICEC 4K6DA 2FJ2A 4U68A 5IT9E 4ID6A 1T3QA 2NMQA 3AB9A 4HCSA 2I2YA 3BDOA 3K5MA 2IWHA 4L2YA 2WXRA 1F0ZA 1ZKOA 1EEID 5BMGA 1SF0A 3KWLA 1O7ZA 1VRAB 1K51A 1CJEA 2K9XA 3HRDD 1C4AA 3Q8AA 3BVZA 4C3JG 5IGEA 1TY2A 5IGCA 3NQTA 2F0SA 2Z4IA 1D1IA 2F4IA 5T8IA 2O4XA 1BOSA 2NN6G 1JWUD 1F2ZA 3AE3B 4J6HA 1SNDA 1HEZE 4LAAA 1F2RC 5AUKA 4ILWA 5JPMC 4P2CB 5FKAC 2L1BA 1G6ZA 4LLGM 1PTOD 1T5EA 4CKBA 3AECB 2K33A 2OHFA 4ZYSA 1IW7C 4PV1C 4KGSA 1Y1WB 3J9CA 1TVXA 4ZOHC 1N61A 1F9SA 1LACA 1PTOB 4ZHPA 1DCZA 1NCVA 2F1MA 1U9RA 1RODA 3I90A 1S5BD 2KHSA 2M56B 2PTLA 5C4JB 3OPOA 1PMRA 2AQ3B 4GZYC 1ZP0B 1PDQA 4QUFA 4RCOA 2L1AA 3P20A 1NVID 4ABNA 1HCZA 1Y69U 4K5XA 5CMDA 5C3JB 1II3A 4ZRPA 2KWDA 4RKBA 4ITKA 1ESRA 2M2LA 5C4XB 3J80E 3B2GA 3HG9A 3FPPA 1SNPA 2L83A 3FKIB 3Q24A 1B9NA 5J1ZA 4K14A 2NUCA 3I4LA 3H3VC 4F7XA 3PUWA 3W5UB 1H9SA 1GAQB 3N6RA 1D5MC 4KKUA 2E6XA 1KDAA 3PZ8A 1TKEA 1H9SB 1HUMA 1BO0A 1Z7TA 4RGMA 3QOJA 5JPNC 4MH8A 2JA5B 5JJZA 3QIAA 5JOBA 2K28A 5IGDA 3VR6A 2KMMA 3U9OA 1GJXA 1F9PA 3DM1A 1HUNA 3AEAB 4X3TA 3A8JE 3PV0A 3SR6A 2J4XA 4KY6A 2B2TA 4KD3A 3BYYB 1YQ3B 2MJDA 4KD4A 4RA8A 2MJ8A 1RD9D 3R93A 2A73B 2K5PA 3C3LA 1PXUA 4WJWA 3AE7B 1ZEQX 1RFKA 1WTRA 2GI9A 3B2FA 4YSZB 4PMCA 3SEBA 2NVXB 5MPOA 1CHPD 1I4PA 3DWQA 1QE6A 5NUCA 1BR9A 1RWSA 2M9VA 2MJ3A 3E0JA 3J7AF 1NENB 4FF2A 3U4EG 1T5XD 3NQIA 2DWQA 3I91A 4OZBA 2LY7A 2SEBD 1BDOA 1QOBA 4ZRZA 2K5WA 3AU7A 2MP1A 1BXTA 2EYMA 2PZUA 1G2TA 1XF5L 5C4HA 3HVZA 2A6HC 1F2RI 3GP7A 1MHHE 1PRTF 2IJ0A 3TN2A 1C4PA 2F0KA 4OZAA 1A15A 2HQEA 1UWXA 2WDVB 2C5CA 4RHRA 2PZWA 1EQVA 3Q8CA 4DNRB 5G3LF 2WXLA 1D1KA 4YTMB 2BA0A 3AE9B 2RA4A 1A3VA 3MC0B 4NMZA 4QB4A 4DAPA 1XXGA 2QSDA 1EWYC 2BBCA 5E4WC 3LWEA 1FYCA 1WTOA 2AUJD 5HG2A 2EYPA 1TS4A 1H9RA 3U7ZA 2J52A 2F0UA 2B8GA 5CBEE 4M1UB 4FXDA 4A55A 1O80A 2K04A 4DXFA 4B0MA 3ZGZA 4RCNA 3TEXA 3S2HB 1PGBA 4FYDA 2WXIA 2JYTA 1OO9B 2ENBA 2GRIA 2QF7A 1QNKA 3HOUB 4R3DA 2XRSD 4V0BA 3NWSA 2KQ4X 1HHVA 2X6LA 3QB3A 2F0FA 4HR7B 3BVMA 2XWBB 2DLBA 1E2WA 4FO2A 3ZQ4A 2EY1A 1LTTD 3S15B 2J53A 3E5SA 3D6CA 5CV4A 2NYZD 1L0XB 1V97A 3OHXC 4XXEA 2EJMA 3PMFA 2B2UC 1WYGA 1DYQA 4C3HG 2KDMA 1SXTA 1A2UA 5M3FB 3RLFA 1EQTA 1KDCA 3URYA 1JE4A 1DJRD 1H9MA 4JK1C 2OXPA 1VJKA 2CW0D 2ZXPA 3A54A 3OWEB 2F0LA 3HOXB 2JXTA 2ZW1A 3K5OA 4TQ0A 1ZXHA 2WLBA 3W5VB 3VR8B 3FMCA 5JXVA 1PUTA 1D5ZC 3GS2A 1VR9A 4KI0A 2EYOA 2RDGA 2SOBA 1TKWB 2WAQB 3N52A 2E2JB 3IL8A 1HZ6A 4DGZA 3CWIA 3VYUA 1YJIA 5E1FA 1U4MA 4H7BA 1F77A 1XWEA 4XQQA 4JBWA 1R4PB 3R3OA 4CHTB 2A69C 1C76A 2JEAI 4XE0A 1K8MA 3FRPB 1H9JA 1GUSA 2F0DA 4NZLB 5JAVA 2R61A 2QMTA 1F9QA 5T1IA 3E56A 5A2QL 5EPLA 3ABVB 2VB2X 5EBCA 1PTOF 1C9FA 4O42A 4WURA 2F0OA 5IGGA 2R92B 2L52A 4C2MB 2E2HB 1I6VC 1SYDA 3DWGC 3AEFB 3J80L 2QKIC 1SYBA 3NZ3A 1MI2A 1JOKA 4IFDH 2ACZB 2RDHA 2Z8LA 1WCMB 1JB3A 3GB1A 4N59A 2OEOA 1CK1A 3H94A 2LKVA 2BW2A 1ZDXA 3PUYA 1BUIC 1QKZA 2NWGA 1V1OA 1PYWD 1GXDC 3NVYA 2EVBA 2Q5WD 1QQRA 1Q90A 3TBIB 2EY2A 1CTMA 2F0EA 1QILA 3FPUB 3S16B 2K0PA 2CHBD 2I07B 5D7GA 4ZUIA 1Y56A 1OXSC 3Q8EA 2KACA 1XCTL 1EY4A 1UNSA 1C4CA 4N9PA 3KUPA 1EYCA 4DK1A 4XWTA 2EE1A 4USAA 1TWAB 2ZXRA 4NDXA 2WDRB 4KGTA 4EVOA 5FLXE 1OQQA 2BA1A 4PMWA 1TR5A 3TP8A 3FEWX 2SAKA 3HS0C 1C79A 2KJXA 1XO3A 1HTPA 3HOZB 2Y0SB 3IXSA 3UI3A 2NB0A 1QCBD 2M0AA 3TEZA 2NZ1D 5FR3A 1FEHA 1BF4A 4A8XC 1YMHE 3FDTA 5D65A 1CQVA 1VCIA 2WV6D 4OO1H 2PCFB 1OXXK 2HDMA 1EY7A 2K5DA 2IW3A 1V8QA 3NK9A 2V4IB 3QOLA 4Z9CB 4K2KA 1EIGA 3EROA 1FXAA 2B2VA 3SK5A 4HTHA 3MXUA 3RUZA 3NHHA 2B2WA 5JEAH 1HZ5A 4LK0M 3H6MA 2B39A 4J8QA 2K7VA 2IX1A 1LABA 2PW7A 2ONQA 2BB6A 3UI2A 4A93B 4C3IG 3SVMA 1WTPA 4FF1A 1N62A 1SNQA 4TQ1A 4FXGC 5IGFA 4DAYA 3IFTA 1QG7A 2XWJB 5FO9B 3EA6A 4ODGA 1KFYB 2G9DA 2XSCA 2CU3A 2K32A 4FF3A 1EY5A 1X3QA 4KJOA 5C0XJ 2DN8A 2WU5B 2K22A 5BN4A 2XRQD 4CBVA 1RF2D 4X3UA 3I72A 2KOLA 3L4PA 1IGDA 1PGXA 1ET6A 2GA4B 3PUVA 2JYOA 1JOOA 5E3FA 4KTAA 2B2TC 2PZTA 5G5GA 4KGRA 4CKCA 1SYCA 2NTSA 4BS9A 3S2DB 1FIQA 4TMAB 1XLQA 3AE6B 3X3MA 1RM6C 1RJTA 5I9PA 1WSPA 1HFNA 3NSWA 4XQNA 3T16A 3M7GA 1ML0D 1DOMA 2LHDA 4CJ1B 1L6VA 3MJ5A 1HTLD 3P1MA 2LHEA 3D3RA 3HOVB 3ZYYX 2EJGC 3DWAA 3OIPA 4G4KA 5K5PA 2JSOA 4MM3B 3IFDA 2WXHA 2A5HA 1HA6A 3TSSA 4P6VF 4ARCA 3M4OB 4A3MB 4CJ2C 3G6JB 2X6GA 3IAM1 1SJHD 1SMYD 1J9OA 4K5WA 3KWVA 1V1PB 5CBAE 2PQEA 2INPE 2WXMA 1LTBD 3SE0A 3DEOA 3DHQA 1U4RA 1DOYA 1MVKA 1FM0D 3AE8B 1EWHA 4Y7NB 1KNAA 1B9RA 1SEBD 5HURA 2PVOD 3SFDB 4IUQA 2WB1B 4OW0A 2NVYB 3W3AA 1NAPA 1E0BA 1E7PB 3BIID 4JE3B 4F8MA 3IT4B 1DOKA 1KTKA 3BWUD 3MP9A 3QWNA 3AE2B 1UWMA 2L32A 2I38A 1JOQA 2OF1A 3MVVA 1PLFA 1R7SA 3AEEB 2R3ZA 1XX8A 4YTNB 3NTKA 2HUGA 2K03A 3LX0A 3IT6B 2DY7A 3NTIA 4WH4A 4HKQA 4KY5A 5BYRA 4IUPA 3BG3A 1ENAA 2VB3X 4RNAA 3HRZC 2BT6A 4U673 4HEDA 3TZDA 4NAMA 3DWPA 1LTAD 2DNEA 2XNAC 4XDCA 1UAPA 2NVTB