3OWEB

Crystal structure of staphylococcal enterotoxin g (seg) in complex with a high affinity mutant mouse t-cell receptor chain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
227
Chain Sequence
b'AQPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEFGGCCMYGGLTFNSSENRDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-chain
publication title Crystal structure of staphylococcal enterotoxin G (SEG) in complex with a mouse T-cell receptor {beta} chain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 60
structure length 227
sequence length 234
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3oweB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3oweB01
1AN8A 1SEBD 1TS2A 1D5MC 1PRTC 5I4DA 1SXTA 4L63B 1JWMD 1DJRD 2AQ2B 1S5ED 1F77A 1B44D 1I4PA 1M4VA 1PTOH 4RCOA 3R2IA 5ELFA 4DXGA 1ESFA 1HXYD 1LO5D 2O2LD 1LT4D 1SE2A 1EEID 5TSSA 1KLGD 2QILA 1HA5A 3W2DA 2G9HD 1PRTD 5FKAC 1L0XB 2XNAC 3DWPA 2WV6D 1EU4A 1LT6D 1EEFD 2ICIA 3SEBA 1D5XC 1V1OA 3MC0B 1MD2D 2XRQD 1GOZA 3BVMA 1PTOF 1KLUD 1RD9D 1TY2A 3DWAA 1PYWD 3EFXD 4RHRA 5D3IB 1BCPF 1I4RA 1PRTF 3CHBD 1LLRD 1LT5D 1STEA 1I4XA 1CT1D 4RGTA 1XTCD 2IPKD 1PTOB 4K6LA 4OHJA 2QEJC 5FK9C 4C56C 1CQVA 1BCPB 1PRTB 2AQ3B 1UNSA 4DXFA 1ENFA 1D6EC 3GP7A 1RDPD 2TSSA 1AW7A 4RHSA 4RGNA 4O1NA 3TSSA 5D3DA 4RFBA 1PZJD 2XRSD 1QILA 1S5FD 1FGBD 5ELEA 1XXGA 1HTLD 2Z8LA 1YN3A 1I4GA 1YN4A 1ET9A 3KLSX 1JQYD 3URYA 1S5CD 3O13A 1S5DD 1KTKA 1I4HA 1RF2D 1V1PA 1LTBD 1LTID 2AQ1B 2CHBD 2RDHA 3BYTB 1TS5A 1JCKB 3R8BA 1SE3A 1LTAD 1EFID 1CK1A 1BXTA 1ET6A 1TS3A 2NTSA 1FNUA 4Z9CB 4L6TB 1SE4A 1B1ZA 4NZLB 1L0YB 5ELCA 2XN9C 3EA6A 4UDUC 1V1PB 1CHQD 3DWQA 1CHPD 2NTTA 3BYYB 2IJ0A 1JR0D 1TS4A 4RGMA 1YN5A 1LTSD 1I4QA 5ELBA 1EU3A 1SJHD 1FNWA 1PTOC 1PZID 4TSSA 3OWEB 1BCPC 3MFGA 4RH6A 1UUPA 1LT3D 1LTTD 3BVZA 1D5ZC 1SBBB 1G8ZD 1FD7D 2J4XA 1LTGD 2RDGA 3BZDB 1FNVA 1DYQA 1HQRD 1JWUD 4ZYSA 1LTRD 3R2TA 1PTOD 1RCVD 1PZKD 1BCPD 3BVGA 4BWGB 1JWSD 3V05A 1T5XD 5ELDA 1TY0A 4RGOS 1SJED 1S5BD 2SEBD 1EWCA 2R61A
chains in the Genus database with same CATH superfamily
2WXIA 2E76C 1KH0A 3I57A 3KH0A 1OEYJ 2NVQH 1V2YA 1IKMA 3PLVA 1BBUA 1JE4A 3NWSA 5C5LA 2C9WB 1G6JA 1RKNA 4N8X1 2JXTA 1XD3B 3DBLI 3MJWA 2ZVNA 3R66C 1UWXA 4XIGS 4JBKA 4IPGA 1WWTA 5G5HA 2MP2B 2Q2UA 2YU9H 1YZ6A 2VQFL 4OL7A 5EPJA 2LXCA 2FIDA 1YNTE 3ECIA 2IX0A 2QJLA 4HJGE 4P1BC 2IX1A 1X56A 1VDZA 3TEZA 2WDTB 1Z5SB 1JWBD 1ZDXA 3FILA 5ELOA 3KLSA 3KF8A 1RYJA 3APFA 1UE5A 4JE3B 3ULJA 2KZRA 1EEFD 5KYIA 4K3CA 2BA0A 4RF0A 3KUPA 3STBD 3RZDH 3M9BA 1NDDA 3SD5A 1PRTF 1FL0A 4XQQA 2LFIA 1ZKHA 4GDKA 2UXCQ 1F2ZA 5BMHA 2QEJC 3GTLB 3AEDB 1XJVA 3HOUG 3PO3H 3FILB 3KF8B 3GP7A 3EN2A 2G9DA 2TSSA 2I46A 1IBKL 4FO2A 4M1UB 4JGHB 1IZ6A 1HEZE 4ANVA 1Q12A 2DYOA 3KLWA 2KJ6A 1S5FD 3I5JC 2K04A 5CR3A 1P7EA 4GDKB 1PYSB 3GTKH 1HTLD 3NWTA 1ROEA 3UDGA 3WAPA 1Q5WB 1PH1A 3MXGA 3Q6SA 1DXMA 3HVDA 1KTKA 1PH7A 2LGXA 4XGAB 1P1AA 2LY7A 1WRIA 1Q1BA 2ZJPA 2RHSB 1VQ7A 1XNRQ 3APDA 2NVTB 3BYTB 4LMQD 4LUOA 4DQOC 4MTNA 3S1RB 1YBYA 1O7IA 4F87A 2HTME 3VVWB 3ND9A 4GNXC 2TMPA 1TT2A 4HCSA 1Q81C 1QJOA 2LGYA 2MRPA 1N34Q 2KFKB 4NQLB 2VZKD 1G291 5CHFA 1PH4A 4WFN3 1NENB 2AUKA 2ZXOA 2RQXA 2H1EA 2CU1A 2LASA 3SE0A 1ISNA 3DWQA 1V80A 3AQQA 4A3LH 4HMJA 3JAML 4RGMA 2WGSA 4ZKCB 3AMZA 4JI6L 3PUYA 1JOOA 2MA9B 1J8CA 1WJ6A 1ONLA 4K1RB 1YQ3B 2PE6B 3OWEB 1SIJA 3NZSA 5T8IA 1D7QA 3L13A 3HM6X 5I9OA 2OTLA 2DZJA 2V4IB 1T3QA 4AYBG 4DHJB 4KLKA 4QIWE 1O7ZA 1X54A 1ZKOA 1EQRA 3BZCA 3GB1A 4AYBB 2K5DA 2L52A 3Q69A 3T3OA 3RUZA 4E6IA 3T3NA 1LTRD 3TP6A 1FRRA 3PLUA 1IKLA 4FNFA 2EJFC 3VTVA 1RCVD 4UP8A 5DPWA 4UPAA 1MIUA 3ZW3A 1L1OC 5IP7H 1WTWA 2K14A 1N33Q 2N1VA 4TKNA 3AFQA 1EIFA 3E0JA 1IYJB 3IFDA 2KHSA 1WXSA 2Z4HA 4ZRZA 3WOEA 4RKLA 4DV0L 5AZHA 4F1SA 2E75C 2CH4A 3J80E 3BK2A 3C8YA 2RVLA 3MEFA 1W6JA 2ES2A 5BYQA 2QSDA 1K8AC 1Z9FA 1D5MC 4CJ0B 1VQ8A 1G6PA 3AEGB 4TUUA 2ACZB 1JWMD 4HPLB 3VUWA 2GMIC 1WIAA 4RCOA 1I4PA 1TJEA 2D3GA 5G3LF 3A7LA 4FP5D 3V2TA 2XTIA 1J5EL 3NQIA 3ZVVA 3CCEA 2L15A 4KY7A 4YY3Q 4LF6L 1IP9A 2F0SA 1U5KA 2VZAA 3TREA 2Y5PA 3TEWA 2HD5B 2BWFA 2ZEQA 5C4ZA 2O6VD 1NTGA 4MIUA 1FXTB 1D1IA 4YWKA 5E6JA 1E0ZA 4LF4L 2KDIA 5HGQA 5GXGB 2XWBB 3OOCA 2KFJA 2MCNB 1EY9A 4M8AA 1V1OA 1C79A 2B2UC 1UWVA 4HIKA 2JXXA 2R7ZH 1DOLA 3EFXD 3QIJA 4OWWB 1LT5D 3HOZG 5IOIA 3RFZB 4A3EH 4LF9L 1B3QA 1WE6A 3N30A 1NYRA 1FFVA 1PH5A 2JXMB 3HOZB 3K9PB 4JI5Q 1IYUA 4JCVE 4U673 1WR6E 3VFKA 4RA8A 1JOQA 2JQOA 1FO4A 2MBEA 2JE6I 1VF7A 2FBWB 1AW7A 4GIVA 4C3HB 4HPMB 3P63A 5LL6S 3A9KA 3SK5A 2K5HA 3J80c 2CFMA 4C3JG 2M4NA 4DV1L 1ZXTA 1YNNC 1D3ZA 1UGJA 1ILPA 1HZ6A 3URYA 4CDFC 3O13A 4KKSA 3HOVG 1VQ6A 2R93H 2OEDA 2WLBA 1RF2D 2KDFB 1LTBD 2JN4A 4IM2A 4J8QA 3HOVB 1HH2P 2HIVA 4JI2Q 1KFYB 3HOWG 4C3IH 3A9KB 3KYDD 3ZTDA 1EFID 5C4JH 2KK8A 2OHFA 2RD0A 3HOWB 5IGBA 2AKWB 4CJ2C 2JA8H 4HJ5A 2Q8IB 1UWMA 5ELCA 2BYVE 3B1LX 5JHAA 5A35A 1KDCA 3W1GA 4GOPC 4JYAQ 1JMLA 4QB4A 1WTQA 3SVMA 2WXOA 2B2TA 3EJIA 1JC7A 4A4IA 1EUVB 4DK5A 5JXVA 4G57A 1QUQA 4GN3B 3UQAA 1VJKA 4TQUS 3NUCA 3J9CA 3ZKJC 2JX5A 3EFUA 4HEA1 2HT1A 3LB8C 3AU7A 5CORA 1T0SC 1FNWA 2YTVA 3ZIMA 4W9JA 4QIWB 4BKTA 1NBWA 2B76B 4F7XA 2EY5A 4DR5Q 4LF7Q 2HHHL 2V1CC 2HDMA 5M3MG 2F0IA 2AHOB 1LT3D 5M3MB 1IUEA 3IXSA 4X62L 3ZXRA 3C1EA 2K8CA 1QUQB 2HQEA 4A3BG 3P4PB 1T5EA 4R4CA 1FMAD 2K4KA 1LXDA 1XCTL 4A3BB 2FMMA 4DR1Q 1WJUA 1WZ0A 1PZKD 1YI2A 2A6EC 1H9RA 3T16A 3B2GA 4BWGB 3GTOB 4MSQB 2EKEC 2BS2B 3HFZB 4OONA 4ICVA 4MSMB 1N9WA 1HCZA 1TWCH 2PMZE 5K36H 4JI4L 3RT3B 4PMBA 4UP7A 1IBML 3NVVA 2KYWA 3AEFB 1HQMC 3A8IE 4KHPL 3DVGX 2AEHA 1HNZQ 4JOIC 1KQSA 1N5XA 2AUJD 3UF8A 3TMEA 2CH4W 4USAA 1R7SA 1KAAA 1B44D 1PTOH 1J19A 4H0LC 3DMUA 4MDKE 2E8GA 2EYJA 4DK0A 4I7AA 2F3IA 1JJCB 3JC66 1U4MA 1A6XA 1E8WA 1FVIA 3LJ3A 1QOAA 3PHWB 2N88A 1OFFA 1A15A 3W2DA 1WGDA 4ITKA 4YWLA 5J18A 2E2HB 2BDOA 3HP3A 5G2NA 2L0CA 2F52A 2R93G 2IWHA 4HK2A 4AP4C 4BA2I 2KVZA 1LT6D 4PMWA 1VZ7A 1C77A 3AU5A 1O78A 1D5XC 4R4OA 2R93B 3X0WA 2ZNVB 1B9RA 2NVQB 4FXKC 1PFDA 1BQQT 2E6XA 1EIHA 4XXEA 1P7FA 2CJOA 5JVG3 4PS8A 3CMAA 2CQOA 1CQVA 2KLGA 2YU9B 1LM8B 3UIPB 1ZP0B 1SYCA 4A3OA 4W9IA 1N63A 3AE3B 5HHDG 3PF5A 3E9IA 1V97A 2C5LC 3EGRA 3PS6A 2PYKA 1CSPA 4IOAA 2WYQA 2N55A 4BXXH 4MJSA 2CCZA 1OXSC 3VRBB 3ZDTA 2XEWA 3RN9C 3EIVA 1YN4A 3KLSX 1YHAA 3RZOH 3RZDB 1Z47A 1EY6A 1S5CD 5TR5A 1S5DD 2NUCA 4TQ0A 1V1PA 2WDVB 4NXNL 2AWTA 5GAHC 1KDAA 1E5WA 3ZNZB 3PO3G 3Q3NC 2FUG1 4FJZA 4YHHQ 2WNMA 4JLCA 3NY5A 3PO3B 2B8FA 3TS2A 2KJHB 4KKUA 4MJSB 3J7A5 2WX1A 1EWIA 3E9HA 4MHEA 3RMHA 4LF5L 1WFYA 2KQ4X 2KVRA 2J42A 3PUWA 3M85A 5LMNL 4A3MG 2VB2X 1R4MB 5AFWA 2DN8A 4BOZB 4DR6L 1Z2MA 4B3SL 4XT3B 1V1PB 3GTKB 1XLNA 3NENA 3NZ3A 4N59A 3TP5A 1TS4A 1M90C 2JSOA 4M02A 2D3AA 2YTXA 5EKIA 2F0DA 3PGZA 1EU3A 5ELBA 1KAWA 5C0XJ 2G1EA 4L5RC 4LAAA 4E71A 2L12A 2Z6KC 3H3VC 2PVGC 5E6OA 4YTMB 1XMQQ 2KMCA 1DCZA 2B2WA 4C00A 2XWJB 1TGZB 4B3TQ 2N0SB 2NBFA 2KQ3A 3A7AB 2UUCQ 3BVZA 2WU5B 3KW5B 4ZRJA 4FDBA 2K9XA 2B39A 3NOBA 5NUCA 4A3LG 4X64L 1PGAA 2R2OA 4REZA 3U4EG 1PH2A 2RCNA 1P3QU 1YNXA 3NBHA 2J0KA 3HIZA 4BAXA 2LJIA 2QDLA 4A3KG 3CSTA 2MJ8A 3Q8CA 2EMSA 4NXMQ 4A3KB 5JZEB 2OQKA 1E10A 1LTLA 1ENCA 2MBHA 4NNJB 3A1QA 3WALA 3AMUA 2H5XA 3W1SA 4JI5L 4OIKA 3N3KB 2LXAA 2ZCCA 1OXUA 4XC2A 3IAS1 3OIQA 2GBRA 3NBHB 2QF7A 3AU4A 2FCMA 1KL9A 1RL2A 1KRTA 3STBC 5L83A 4JI1Q 2NYZD 1T0QC 5IP7G 2NN6I 3FKYA 1OXVA 1LT4D 3PGEA 4PK1A 1NR4A 3A1QB 2EVBA 5TSSA 4W9HA 1EL0A 2JA6H 1PRTD 1SNPA 1M1KC 4XTCS 4NAMA 1STYA 2Z6BA 5EE9A 2N9PC 2IO0B 1EM7A 4P2CB 3JYUA 3QARA 4ABNA 2ZTDA 1V9PA 4JI2L 4FF4A 1FGUA 4WQOB 1WX8A 3IAYA 1I4RA 3AEEB 4K2LA 4GU2A 2A69D 2RSOA 4AQYL 3IFWB 3KDFB 2Y0SE 5FK9C 2AMCB 4GKJQ 2WWZA 1RTOA 2B3GA 4DK1A 1ENFA 3E0EA 2RDBC 2OF1A 4J6HA 4B0MA 3KOJA 5IYCH 3G6JB 4W9EA 2BW2A 1QILA 1L7YA 1QCBD 3ERQA 1I6VC 4K14A 1ICFB 1T0RC 2R7ZG 4B9KA 4DR3L 1QOBA 3U52E 1O80A 2R7ZB 4A3EG 1GUAB 3HZXA 5IP9H 1S4ZA 2KA7A 4WJ4A 1TKYA 2JRHA 4A3EB 5D2MB 1EY5A 3DLLA 1NJIC 3NUHB 4DU9A 2RDHA 3CC7A 4A3GG 1SR3A 5H92C 1WTHA 1Y14B 1GJXA 1LTAD 2N8NA 2RPVA 4PT5A 1SDFA 2X69A 4DR1L 4FF1A 4K8JA 1XPUA 3ALBA 4L5TA 3GZNB 3CC2A 2L1AA 1C4AA 3BDLA 1SB3C 5DPRA 1S3SG 2FE8A 1OQRA 3TEHB 4A93H 5IT9E 4B95A 1VCIA 2VQFQ 4LDTB 4WWOA 1IPGA 2KCNA 5M5XH 1II3A 4I65A 3NBIA 1B70B 4DV5Q 1HNZL 3NVYA 3K5NA 5EAYA 4NAWA 3OW7A 4C3IG 1VD2A 2K6DB 4MGZE 1AFPA 2A4ZA 1XMOQ 3RLOA 4C3IB 4KK7A 4BZAA 4CHKA 5C4JB 1UUPA 3A4RA 5HY6A 1ZW7A 3L54A 3D31A 1KRSA 1SNMA 3OYYA 5JHBA 2ATWA 4NY0A 1YVCA 3H3VH 4ILWA 4KTAA 5AZGA 3KF6A 3G71A 1FNVA 2R7DA 2L11A 4I7ZC 2H88B 4A3IH 4NAWB 1YIJA 2W54A 4LNKA 5C3EH 1BCPD 2KCTA 2K0PA 1F2MA 2J53A 2MSED 1JWSD 1IBKQ 4R4QA 4DNRB 1LGRA 4WJOA 1SFOH 3IT4B 1QLBB 1FCCC 2M56B 3L3OC 2KCMA 1YEZA 1NEKB 2KQ7A 4P71A 1E9MA 3KF6B 4QQBX 4R8NA 1NCVA 3FMCA 1F2LA 1E22A 3CCQA 4TRDA 1K73C 1AZQA 4XX5A 4F8CB 3IRBA 1FXAA 1XCQL 2YLMA 3R2IA 1H9SA 1ESFA 2EDGA 4RMFA 5IT9c 2NVXB 2CJNA 3A54A 3AI5A 3UI3A 1KOTA 2UUAL 2INPE 2R6GA 4MELA 1GPXA 1MHXA 1HA5A 1N6ZA 4EFOA 5K36G 3TL5A 1C8CA 3ZTCA 5FKAC 4F8MA 4UAIA 1TWCB 4K5XA 4XYQA 2Y0SG 5GAGC 2G4DB 2KX3A 3MFYA 1GUTA 2BDNA 3CCJA 4KSKC 4YHHL 4JBMA 2W82A 3E6ZX 1H9SB 3K81C 2AWOA 2FNJB 3W1YA 1HNXL 1STEA 3V6EB 3ZDMC 1TWFH 3FHWA 1F0ZA 5CHWA 1PTOB 1SRUA 3HEJA 4K6LA 4C56C 4ZOHC 3VH4B 2LHEA 3SK8A 3J80i 5I6WA 1FD6A 5CV9A 3QQ8B 1BO0A 4AJWA 2HCIA 3F2UA 2RA4A 2DZMA 1RDPD 4L5QA 3S1QH 3NG0A 4BS9A 5IKCM 1WGRA 4HKZE 5T1GA 2OXPA 4YIJA 4M8NA 1CKOA 4BKSD 3H6MA 4HJKA 1KM7A 1OEYA 3CD6A 4WRDA 3U4VA 3G48A 3PUZA 1G91A 1L6VA 5BYSA 3H7SA 5KHQA 2JF5A 1XMQL 3QC8B 1JROA 3VAWA 5J22A 2GBMA 2UUCL 3S14H 2K8HA 1WGGA 1MJDA 2V0GA 3KJPA 2K28A 1K51A 1SF0A 4BVUC 4DV0Q 3GTPH 4LJPB 4NQKE 2LHDA 2R3ZA 3K80C 2DZKA 3PO0A 2LS01 4ZHPA 3PIP3 4HLEA 5LLIA 1CK1A 3UINB 1TR5A 2Z0DB 1CZPA 4IZ8A 4BXXG 1J7CA 5JVH3 3M95A 4S0RA 1L0VB 1P16A 1WXMA 4GLSC 1I35A 3E5SA 3M3JA 1HHVA 2DWQA 1J5EQ 2MO0A 1QKZA 4IUTA 4LF6Q 3RZOB 1UD7A 1JALA 1LUZA 1I4QA 3M7GA 2KCCA 2RF4A 3I55A 3RN5A 1ZYRD 4MGYE 2N7JA 3PZ8A 3I7FA 1PVOA 2KECA 3WAOA 3CPWA 1DM0B 4IKGA 4GOPA 4WWMA 5LXIB 4YCUA 4JI1L 3H0GH 5H8YE 2MQJA 3UI2A 2DY8A 4NKLA 2UU9L 4P6VF 1Z6HA 5IGEA 4EZLA 2SNSA 3G6EA 1N8RC 1BF4A 4DA2A 4K0KQ 4A3FG 2YVCA 3R2TA 1VQLA 3RZFA 2GBNA 2F03A 5IGDA 1ZXIA 4GOPB 1SROA 1U4RA 4CO7A 2KDEB 3CCUA 5MPOA 4WAAA 3DHGC 3ZUNA 3DUZA 3R93A 4AWJA 4KD4A 2AL6A 4ULLA 1L2NA 3VR3A 4IJLA 1HR0W 1NMFA 1VQGA 4GKJL 4DV1Q 1TS2A 1TIFA 3PZDA 4GGQA 3IVFA 2E5LL 4L63B 2NZ1D 2Q2IA 2CU3A 3PZ7A 3AV8A 2JSVX 5C0XH 4KKJA 2WP9B 2WS3B 5AJ3L 4LK1C 1WXVA 5DPTA 2KO3A 2L3ZA 1PXUA 1KIXA 3RD2A 5EE3A 2K6QA 3PUXA 1EYCA 2MGSA 3ML8A 1YNJD 2L4NA 4IWQA 1C9FA 3CSFA 1H9JA 1A3UA 1ICWA 1VCBA 1Q90A 2KNBA 1MHWC 1EWHA 2EZVA 2XNAC 2WAQE 2KQSA 2V3NA 2C5CA 1E7PB 4LCDE 1QVGA 3R3OA 1QZEA 1T0YA 3U9SA 3H6NA 1R4MI 1HE8A 2MNAA 1N36L 5IO9A 3T4AC 3A5UA 3QO2A 4LFCL 2CKZB 4KV6A 1GUNA 4ZRPA 1L2FA 3UGBB 2WACA 1ENAA 2ON8A 2D5GA 3ERSX 2JUOA 1E1TA 1I7HA 1E0BA 2HHHQ 3E56A 5IA7A 4ANWA 3ULLA 2JA6G 4US9A 4DHZE 3F2BA 1WOCA 2OQ0A 2B2VC 5KNCA 4PZ7A 2JA6B 4X62Q 3QWZB 3RNBC 5BN4A 2PQEA 2OOBB 4DV5L 3WA0A 3AFPA 2IDYA 3IL8A 3CMEA 3NS1A 5C23A 1CUKA 1W2BA 1PMRA 3A74A 1XMOL 1PDQA 3K5LA 1V86A 4B3RL 3QX1A 2IBIB 1DOMA 3WAMA 4DV4Q 3DXJC 2MO1A 3K5OA 2FCQA 4JI4Q 4ARCA 2PCFB 4JI7L 3OMGA 1IBMQ 3EFCA 1HTOA 5D7GA 2OCEA 5IYCG 3S15H 3S2HH 4KHPQ 1T6BX 1F9PA 3PREA 3SU8X 1NE3A 3F1ZA 1EQQA 2JZZA 3JAME 4R4TA 2LVOA 4YCVA 2FMCA 2A5HA 1ILQA 1HZ9A 2DNCA 2XGTA 2INNE 5IGFA 1EYGA 3V6CB 5EDSA 2LRWA 4A3PA 2NR2A 2NTTA 5IP9G 4W9FA 1Y1VH 1EY8A 1PGBA 4OW0A 2HDEA 3Q8BA 4YCWA 2PE9A 4DNIA 1Y8OB 1EY4A 2NN6G 3CW2C 3OIPA 5GADC 2NPTA 5FO9B 1PZID 1B9MA 4PS3A 4LNQA 2K39A 4JIOU 1FM0D 1VMPA 1YJNA 3OSOA 4BBSH 2D5DA 4LTUA 1X3EA 3RN2A 4IFDI 2UXBL 2KT7A 2MBQA 4DAMA 3KFUA 4DAYA 1TKEA 2NBWB 4A93G 3A5ZB 2WDRB 1HQRD 4CYEA 2HCCA 3CAMA 2NPTB 4A93B 2L8JA 1D8LA 3KLRA 2EELA 5IYDH 4OO1H 3BVGA 2LWPA 3KWVA 3PRZA 1K0RA 3K57A 5CV6A 1WD0A 5BYRA 1A2TA 4I6NB 4M00A 4EQ5A 4K81A 1SAPA 4DAYB 1O7LA 5FLMH 1GJZA 2DAFA 4F7ZA 1HRJA 2WXLA 1AYFA 1YMHE 1PRTC 2FXQA 3CCMA 2I0QA 2MBBB 1S72A 3QOLA 3JAMc 4IUMB 1NI2A 2A5UA 1A3VA 1F1HA 4OVVA 4A3IG 4NXNQ 2QDBA 4EUTA 2WAQG 1I3QH 1N5WA 5C3EG 1SIFA 3M7NA 4A3IB 2D10A 4V0BA 2WAQB 3RULA 2LVQA 2A69C 2K50A 4J15A 5C3EB 4LF5Q 2F0EA 3Q14C 5LMNQ 1SFOB 2IY1B 2PIAA 2ZW1A 1C4PA 1M94A 3DVNV 4ICUA 3EECA 3CF6E 4DR6Q 4JW0A 4B3SQ 3NS8A 2M0AA 4FXGC 3GZNI 4AQ7A 4IFDH 1UZXB 1PH9A 3AE1B 1WZ3A 4UY8C 1PYWD 3A0JA 3TBIB 1BCPF 1YQ4B 3I90A 3CHBD 3MZ5A 4FVMA 4XZ4A 1K0SA 4DHZB 3V3XA 4KY6A 2XIWA 3BG3A 1JB7A 1XWEA 2K3UA 3PRMB 2E2JH 1KABA 2GBJA 1EOVA 3ZO5B 3DHQA 1U4AA 4JI3L 2MBOA 1HTQA 2ZPYA 4LWCA 1PH6A 5JEAJ 4CDEC 2DAJA 2IHFA 3P1MA 1Q10A 2JEBI 5L37A 4DK3C 4X64Q 1AH9A 3UE1A 4PG3A 1QE6A 1E6EB 3F2DA 2BTEA 1EO6A 3P42A 2C9OA 1IW7D 1TWFB 5IGCA 3EUB2 4KDIC 1NNXA 4N8FA 2ZJQA 5D94A 1TYGB 4RM9A 3WOFA 1TS5A 1JCKB 4K0KL 2VH2A 1WR1A 1V49A 1HNWL 2V3PA 1XYIA 3P1HA 2G3QB 5HKHA 5EE0A 3RZWC 2QEXA 4C3HG 5CV8A 1KJTA 3D3RA 1E1OA 2JYEA 3DPDA 2R92H 3KJOA 4HN7A 3N20C 1EUJA 3U9OA 1WSPA 3H7PA 3ZRCA 1J6QA 3S14B 2Z59B 5CMDA 1GHKA 2M0XA 4PV1C 3ICEA 3AB9A 1BCPC 3GTPB 3PUVA 2LXKA 3J80L 3B2FA 3DM3A 1IHZA 1U4LA 3U58A 3N1ZC 2YEPF 1R4PB 4X65Q 3OTOQ 2WDQB 4MM3A 1MJCA 1E7UA 4AQYQ 1IYVA 3L9AX 3IG3A 3H7PB 4C80A 3GS2A 1SYEA 3I3CA 3M4PA 3CU7A 4WORA 3PIO3 2A68D 1QVFA 5C3XA 2SDFA 4IO9A 2IYDB 2VXWA 1X55A 2IHEA 4EOYA 2EYOA 4EQNA 2N4FA 5ELDA 3M4OH 1TY0A 4HCEA 2X6GA 3KUCB 1YHBA 1WGKA 4MM3B 4K5WA 4QGUA 1EF5A 4ZRKA 4A90A 3W5OA 4DR3Q 4XDDA 4K3BA 2RDFA 1OXXK 1FJGL 1X3GA 2AQ2B 2LMCA 2RPQA 4NPNA 1A5RA 2B29A 4RMAA 4ZUJA 1HFGA 4N58A 3FEWX 3L2PA 4DAPA 1E7ZA 5KRUA 4GXBA 2ZTCA 3V96A 4GDLA 2RBMA 4RNAA 1YD8U 2WXFA 4GKKL 3ML9A 3KWLA 2B8GA 1KLGD 2O6VA 5IE8A 1VS0A 2G9HD 1OTRB 4B0EA 1ZPSA 4MH0E 4IPHA 4C7YA 2B2YA 3L7ZC 1UEAB 3GO5A 3MTSA 1VR9A 1YOVB 2DHZA 2KEDA 2LMCB 3AEBB 1F9SA 2NVYB 4DV4L 1SE8A 3T1HL 4FN2A 3T8MA 4M8MA 4HWIB 1WJ4A 3QB3A 3E9SA 2NZHA 1ZGUB 5C0XG 3J7ZC 5EBCA 1XQQA 1Q8KA 1PFMA 1C48A 2O6VB 2BYTA 1YX6B 2VY3A 1KC8C 2BPSA 1UNSA 1YHQA 2X38A 1WI5A 3UIOB 3D4DA 2I5LX 3CCRA 3LDZE 2GRIA 2QC8A 1RJTA 2F0UA 4HTHA 4POFA 2KX0A 5CV5A 4IUVA 1YX5B 3MC9A 4DDID 3VR9B 5DLQE 1EFWA 2K01A 2MFIA 1XXGA 2MP1A 1STGA 3T56B 1OGWA 1SMYD 3J7AF 3SGIA 2EY1A 1VQFA 4HIDA 2KVMA 1TKGA 5J3BA 4WQMA 1RHPA 1HUNA 4EQPA 4AOFA 2REXA 5IWAQ 3WDNA 2DENB 2F4IA 5BN3A 3PIOA 1WYDA 1Y8NB 3I2ZA 1SE3A 4NW2A 1BR9A 5HI1A 4JV5L 1ZYRC 1C9OA 1X65A 3UE0A 2W3SA 4OXPA 3CCSA 4DUZL 4A3CH 2NS5A 2H4OA 3QG1A 3LWEA 3VUXA 4EKUA 2MLBA 2KHWB 2RSUA 4JG2A 5E6NA 4DR2Q 2UUAQ 4K8IA 1Q0WB 2G5DA 3MWYW 3LGJA 3MEHA 2W9NA 1K3BC 1MBYA 3VA5A 1F2RC 2XK5A 2MHJA 4JWSC 1UBIA 3K7AH 4DPGA 1CMXB 4PYZA 2C7MB 4QCLA 2KC1A 3CC4A 3S2HB 3S15B 4XYOA 1WXAA 2ASBA 1JJ2A 3IT6B 3TEYA 1TZ1A 2RR9A 1HNXQ 3VA7A 4G0NB 1R9TH 1GM5A 1STNA 1STBA 2F0QA 2XK5B 1MSHA 3IAM1 2C7NB 1F9RA 2PTLA 1LYLA 5CGKA 4L5SA 4DR4L 3C0RB 1CKMA 3B9JA 1UEBA 2KEEA 4G11A 3TP7A 1X3FA 5IY0A 2JU6X 1M8AA 1VQMA 2Z1CA 3HUIA 1EYAA 2JA7H 1DGSA 4DUYL 4YXDB 1YNJC 4IUNA 4O42A 4BBSG 3U7DA 1MJEA 2Z0EB 2MHVA 1WTOA 2CKHB 3DQVA 3D4WA 3IBEA 4BBSB 2A1AA 3CWIA 5G5GA 2GLSA 4KIKA 1SNQA 4IOCA 4FHKA 3W9CB 3G7LA 5A2QE 3S1MH 4DV2L 2KWVB 2V3SA 4CKCA 4C7ZA 3VDYA 2L76A 2KDMA 1RODA 5ELFA 4IURA 5HURA 4NJ6A 3H1UA 1UE1A 4R9WA 1B4OA 3U4ZA 2FINB 4FA6A 4MH8A 3C19A 3CF5A 1ZUD2 2DLBA 3DWPA 5FLMG 4KGRA 4KIKB 5J1ZA 4C1NK 4GN1A 3T51B 2CR5A 4KN4C 1SNOA 2QKIC 2K03A 4OWXB 1GUWA 2FJ2A 1JRPA 1GOZA 2F0OA 4CHTB 3VR2A 5IOCA 3Q24A 3WCQA 2KHIA 1P9DU 2LUMA 2RHQB 4DK6C 1VQKA 4B6WA 1H95A 4RGTA 4IJHA 2L55A 1FFUA 2KWDA 1CKNA 3RNUA 1I3QB 2BF8B 3QR8A 2IGHA 4MGKE 2F0KA 5I2YA 2QDFA 1E24A 4LUZA 1BBXC 2UU9Q 2EJMA 2FCSA 2KDBA 3BY4B 3JW0X 2PW9A 4J3OD 4O1NA 3KVFB 4GB9A 3KUDB 2ZJDA 1WYWB 4IFDG 1BBWA 4POGA 2HJ8A 3RPFC 1K50A 3ONAB 1HUMA 1CKNB 4X6AH 4BY1H 1EF1A 1D2BA 1ET9A 1WCMH 2JK8A 4JBJA 3OW2A 3GD7A 2L1BA 5C44H 3DWMA 4DNTB 4Q2JA 3FKIH 4WIPA 4KGSA 5JJZA 4FHJA 4X65L 3OTOL 4BY7H 4W9DA 2K6AA 4ZLTF 3J81E 3MC8A 2AQ1B 1C7YA 4WJNA 1UE7A 1LFDA 2E2JB 1WI0A 4X66Q 1ET6A 2JYTA 3ITPA 4CGYB 2VW9A 4L6TB 1SE4A 4HMIA 4BBNF 4E74A 1L0YB 1TWGH 2E5LQ 3S16H 4P73A 1STAA 1MG4A 5CTRC 1ASYA 4GLVB 3H15A 2R2QA 5AJ3Q 1JMCA 1SYGA 3P2BA 4QF4A 5IYBH 2EXZA 2IY0B 3H3VI 2GVAA 3N52A 1K8MA 3P4QB 4P16A 2K5VA 1IBXA 4PQXA 2DNEA 2WKCA 2JPHA 1NMGA 1YN5A 3Q6BA 2R7FA 4JC0A 4K6DA 1JW9D 3J81j 3MA2B 1G51A 1Q3LA 3NVWA 2IX3A 5JEAH 1ACCA 4II2B 3PO2H 1UELA 4OZCA 3SK4A 1N36Q 1LTTD 3PPAA 1FR3A 1X32A 5FLXL 3MHBA 1G8ZD 4LFCQ 3VYUA 1IBXB 3A55A 1LTGD 2W55A 4G50A 4AJYB 2GBKA 3NSWA 3PF4A 1YJ9A 4GS3A 4ZYSA 5M5YH 3NE5B 2BA1A 3HOUH 2R92B 5BMGA 1KDBA 4KY5A 3AN1A 1PTOD 3QHTA 2PW5A 2J7QB 4P74A 3D4RA 1TQOA 2BQQA 4R3DA 4ZK9B 4FJVB 4FULA 1HR0L 4MN3A 1RRBA 4RGOS 4KV2A 1PFNA 1VQHA 2CVRA 2F0TA 4TVAB 5D65A 3J81c 2JWUA 2WXJA 3ZNHB 4GNXA 2PNHA 4FF2A 2X8XX 2BOSA 1SEBD 2KWUB 2MH7A 1V5OA 2FIFA 4KKIA 4JK1C 2JA8G 3NXWA 3RNEC 3C1FA 3P7JA 4B3RQ 2VQEL 2GOWA 1M4VA 1KRHA 2JY6A 2KN4A 3TZDA 2JA8B 5KHOA 2NB0A 4BBNC 3ZJUA 2D3CA 2ZT9C 3EVQA 4JI7Q 1SGHA 3HOXH 3D8GA 2Q5WD 2ZZPB 1PHJA 4GNXB 4PS7A 4MACA 2LJ5A 5EQ0A 1BVSA 1SSOA 1SYDA 2KJXA 2DGYA 3M4OB 1IBLL 4K7SA 4ASWC 5AEKB 5J17A 1QF6A 3I4OA 4ODGA 2K1BA 3MC0B 2NWGA 5IWAL 2C60A 2WXHA 1I6HH 1RM6C 3S24A 4HRSA 1CZGA 2LKVA 3DWAA 4RHRA 5LHY1 1JRUA 1ZXHA 3A56A 3ER0A 2W3RA 2B2TC 1XLOA 1BNZA 2D0OA 1AE3A 4DV6L 3NELA 1IGCA 1L1OA 2V4DA 1PRTB 2XVSA 5EJWA 2N9LA 1VDVA 2KACA 3BS1A 2BKRB 5JJLA 3AE2B 1K9MC 1IW7C 5CYUA 5LMUQ 2KC2A 1QZGA 4MGIE 3VQIA 4DR2L 2UXBQ 2JYOA 3Q22A 3HVZA 4WAFA 5JPNC 1PZJD 4HIOA 4YSZB 1A62A 1CJEA 4B9WA 2Z8LA 1YN3A 3KQ4A 5IT9L 5BR8L 1L1OB 5GROA 5FO8B 4DR7L 1Y56A 3RMKC 3DEOA 3I4NH 4ANXA 5J39A 2PVOD 1OQQA 5C6AA 2PO4A 5IP4D 3DEPA 3JSVA 4QJFA 4TQ1A 2CHBD 2WX0A 3GTMH 3VYTA 3C2PA 2NBUA 4DBGA 3I73A 4A55A 3MHZA 1J7AA 3I63C 2L5TA 4LUVA 1FNUA 4F88A 3TRZA 3H91A 3I8ZA 1VQPA 4HCPB 3RNCC 4H44C 3HG9A 1V8CA 2L7RA 3I70A 3Q3MC 2B2UA 4LNNA 2A19A 3HKZE 2KMMA 3T9LA 1GUOA 2WXRA 3JSVB 5C3JB 1JR0D 2M8SA 2BE5D 4LK0M 2ZNVC 1CZWA 2B63H 2JVCA 4ZHOA 2K1FA 3TMPB 1ESRA 3QK0A 1C3TA 1EYDA 2EYMA 1ML0D 2K33A 5EKKA 1K53A 2A68C 4OX9L 4QUFA 1A2UA 5D6JB 3CCVA 1GNUA 1W6KA 4DKAC 3MFGA 2K5PA 2MJ3A 1J9OA 3EQLC 3KYHC 5CBAE 4Q5VA 1A70A 1OTCA 3EROA 2LGSA 3RR5A 2HD3A 1D5ZC 1QWYA 1SBBB 2CQAA 2E2IH 2QCZA 1DOIA 1WTRA 4HPPA 1JB3A 2EXDA 2F0LA 3D6CA 1EOTA 4IW0A 5IAAC 4K7WA 5C0XI 4NMZA 1WH3A 1AP0A 1QNKA 4KSLC 1NVID 3DBSA 1GC7A 3H94A 4DXAB 2RMMA 1JICA 3UDIA 1VQ5A 1PUTA 1F9QA 3IFTA 4JI3Q 3GTQH 2M9VA 1NY4A 3K7AB 2NVUI 2K32A 2WFWA 1TWAH 5KGUA 4C3JH 2IGGA 2IO2B 1TBEA 3PCOB 2MX2A 4EQOA 2SOBA 3C3LA 4DWFA 2IY5B 3RLFA 2EYFA 2WU2B 2I5HA 2FHTA 4N9TA 2KOXA 3GTJH 2QCPX 5DPSA 1DJRD 2J0JA 1R9TB 3T1YQ 1BMLC 1XO3A 3JVZX 3U7ZA 1SE2A 1HNWQ 2LD9A 5DEHA 3PSEB 2N7EA 1EIGA 1Y69U 2JA7G 2BH2A 4C2MH 2D9UA 1SNCA 4O2DA 4PMCA 3SDLC 5LNK1 3GQBA 2JA7B 4JQWC 4X3SA 3M62B 1MPEA 5M3FH 1WX9A 1VF5C 5JJIA 4IG7B 3QA8A 4LLGM 2WKDA 5L95C 3QAQA 5M5WH 5D14A 5HGTA 4JBWA 3NTIA 2DZIA 4KMUC 4X66L 1BUIC 3S1MB 1CT1D 1LM0A 5E7NA 3A8JE 1XTCD 4FBJB 1FPYA 3VUYA 1B3AA 3Q8FA 4FYDA 1V5TA 1SMYC 4CQNA 4DXFA 3NHHA 2EY6A 5FR3A 3AE8B 4RAUC 2KJRA 2D2CC 2K52A 3QIAA 4LFAQ 2KENA 3BU2A 2B2WC 2INDC 3AEAB 4JI8L 3RNFC 2K5NA 4BKSA 1LABA 3TSSA 2M19A 2PEAA 4JOIA 1MFWA 3KUZA 3NRZA 1EQVA 2OTJA 3E3XA 2Y5CA 1WTVA 4K5VA 3P4SB 2O5IC 2WXGA 3VR4A 4XQNA 4A6QA 1GXDC 1MG8A 1ZE3D 4QAYA 4CKEA 4A3DH 2WB1B 1EY7A 3O65B 3HKZG 4EEWA 2K5WA 3R8BA 4OZBA 4XDCA 1CTMA 3M3YH 1TS3A 3HKZB 4WH4A 1V8QA 4NP5A 3KBGA 4IM0A 1H8CA 5EPLA 3G4SA 1UF0A 2HUGA 3PVLA 4I6LB 4Y7NH 3H09A 1FJGQ 2CWAA 2XN9C 1I42A 3K9OB 3VRAB 4Y52H 4BY1G 3V60A 1FCLA 3FDTA 1CHQD 1DZ1A 1MGSA 1WCMG 4DHJD 3BYYB 3VXWA 5C44G 3VYRA 4BY1B 2ZM6Q 3FKIG 2E2HH 1JT8A 4C4VA 1WCMB 2IW3A 4GKKQ 1E8XA 1GB1A 4P75A 1QVCA 5C44B 4BY7G 3FKIB 2P5ZX 3DWGC 5KEEA 4BY7B 1K28A 4OO1I 3B0AA 2F0NA 1QOHA 5CV4A 2JA5H 3T1HQ 4JX1C 3RLNA 3K59A 2PW7A 5FJ8H 1L5PA 4HKQA 2BKFA 1IL8A 2F4VL 1TWGB 4KJOA 4C1NI 3S16B 4FF3A 4XT1B 1KF6B 3AULA 3M63B 3FPPA 1N32Q 2AX5A 2RDGA 5IYBG 3BZDB 3N1YC 3AE7B 4C4VB 4AS1A 1Z7TA 3DOWA 1JWUD 1GUGA 4G7HC 1L4DB 2KLCA 1C76A 2MW5A 2JWZA 4BKGA 2L9HA 1NBFC 1AEXA 2WXMA 3VR8B 2INCC 4ID6A 1DGJA 4V190 3V05A 5JEAG 2O2VA 3HRZC 1TTNA 1TZOA 5C4XH 5KIXA 1PGXA 3PO2G 2BGFA 2BH8A 3DBRB 5DM73 3PO2B 3RD4A 1C4QA 1YJ1A 4P72A 4FLHA 4KD3A 4IOIE 3PMFA 1JQ4A 2EIFA 4JVZA 3QJYA 1QB5D 1NAPA 2J0MA 5LMUL 1QG7A 1FIQA 3SFEB 1B8AA 2AWNA 2KAJA 4WURA 2O2VB 1E2WA 3AEVA 3HOUB 3X3MA 5M5YB 2IO3B 2JZPA 3RNAC 3ZXVA 5E4WC 2KKCA 2O2LD 2F0WA 2YYZA 3ZLZA 4FXCA 5I6YA 2UUBL 4WJWA 4JV5Q 1VRAB 2QILA 4A3MH 1TT5B 1N60A 4HCNB 2Z6KA 2WP8J 4DUZQ 2DUDA 1L4ZB 5AUIA 5M5XB 1F52A 3Q8AA 2JP1A 3NZUA 2KFKA 3S1NH 3SFDB 2PNRC 1N61A 2XRQD 3I91A 3BVMA 2BS3B 4NDXA 1PTOF 1RD9D 2PMVA 2FUHB 2WXNA 4JPSA 4GZYC 2LRUA 5E4XA 2F0VA 1PH8A 5AZFA 4FADA 2IPKD 1VQ9A 4XQJA 1AE2A 1QOFA 1C78A 3HOXG 2F1MA 5I9PA 2VB3X 3PV1A 5JAVA 1AZPA 1DOYA 2BB5A 1D6EC 2K75A 3HOXB 3MAQA 4US8A 3I4MH 4HJ9A 1B2TA 3MP9A 4S3SA 2HQLA 4FXDA 1JOKA 5K5PA 4JL9A 3ZJTA 3IKJA 1FGBD 4HVBA 2A6HD 3SHQA 1FEHA 1I6HB 4FJYA 4A3KH 1JQYD 4OGQC 4DR4Q 1X3QA 2IL8A 1N62A 1P98A 3ZNID 2QIEB 3P75A 5FO7B 3HRDD 4WWNA 4B3ML 4ALPA 5EKLA 5EGTA 4DUYQ 4ZAIA 1J8IA 2VNUD 4H2AA 2NTSA 1K52A 2D3BA 3X23A 3D32A 4DGZA 3Q3OC 3RCZA 3D6WA 4LFBL 2XSCA 3OJ4B 4DV2Q 2V4LA 5LL6X 3PHXB 1B50A 1SN8A 2PZWA 4LJZC 1WVLA 1MI2A 1WTPA 1KXLA 4D2KA 1CHPD 3I4NG 2NCNA 2KXJA 3NTKA 4RCNA 2OT2A 2LGIA 4BFRA 3TQYA 3J7YW 3I4NB 3A9JA 1Y8PB 1STHA 3CPFA 1SJHD 1UE6A 5J2RA 2M2LA 1PTOC 4TKOB 5BN5A 1QZHA 2DYMA 5EE1A 3OPOA 5CV7A 3GTMB 1SYBA 3T13A 3T1YL 4YT0B 3W5UB 1J0GA 3GE8C 1G2TA 4II3B 4BBRH 3L0OA 3DM1A 1C0AA 2BBCA 4IUUA 2J52A 3NVZA 3DVGY 2UXDL 2QMTA 3AH7A 3BWUD 4GN4B 1WJNA 3IHPC 1XNQL 3S1QB 3KBXA 3J81i 1HFNA 3A9JB 3M4YA 2Q8RE 4KZ0A 1WX7A 4K2KA 3MJ5A 2PZUA 4R8IA 2DBYA 3TN2A 2B63G 3ONSA 1YJJA 1GD7A 2KTRA 5C2TB 1WE7A 2B63B 1HZAA 4W9LA 2KBNA 3PQIA 4NPSA 1D4BA 1NSNS 1K83H 3NK9A 2EKIA 2ZPNA 3HGBA 1L0WA 1OO9B 3S17H 1PQSA 4ME3A 2ID0A 1EQTA 1EWCA 2N7DA 4JI0Q 1HZBA 1GUSA 1RFKA 2L32A 1F2YA 3HKSA 4GLXA 1ZEQX 1VQCA 2MWSB 2VZKB 5CX3A 4A3JH 4WJ3M 2UYZB 2E2IB 5C3WA 2KTRB 5CC4A 4KHVA 4LFAL 2GVBA 4A3GH 4N9F4 3N6RA 1HXYD 2JEAI 2CS4A 3Q2AC 2F0PA 3W1BA 1S1QB 1I94L 2Q2TA 2DY7A 2F0JA 1O7YA 2D0PA 3U30A 4APVA 3GTQB 1GVPA 1PYBA 1HPCA 1TWAB 2WV6D 1EU4A 3QWNA 4C3JB 1HA6A 3SEBA 4OEMB 4JWUC 4R1JA 1TY2A 1WTXA 1XEEA 3H0GG 1GKHA 4ARIA 3MTNB 3GTJB 3GTGH 2QHOA 1I4XA 3MHSD 3H0GB 1C1YB 2WQYB 4OHJA 2GA4B 2MUYA 3ULPA 4DV3L 3B08A 1KLVA 1RTNA 3V61A 4YWGG 2F3WA 1IL2A 3H9DA 3TEXA 4TMAB 3HS0C 3K0YA 1HTPA 4N9PA 2ZM6L 4UHVA 4HSPA 3BZKA 4C2MB 3MXNA 5M3FG 4BOSC 1SSNA 5M3FB 1WYGA 3AB5A 3KYCD 4IUPA 5M5WB 4HEDA 5DM63 1CSQA 4HDOA 3NJTA 5GAEC 1R4NI 2LZ6A 4ZKBB 2AL3A 4PNYA 4O0AA 5C4HA 4AIMA 2FAZA 4GOCA 1HR0Q 4GDLB 5E3FA 1WFQA 1N32L 2BE5C 2ONQA 3MXNB 3K0XA 2CHXA 1JJGA 3DCGA 4KHZA 4NJ7A 3R7RA 4ACFA 1BXTA 5JPMC 1V6EA 4H13C 2E74C 3SHLA 2JRIB 1BKBA 2CHZA 2NVXH 4HJAA 2DNFA 1B9NA 1TIID 3EA6A 4ZQ3A 1WGHA 2LEKA 2VQEQ 4XWWA 5KNBA 5BMIA 2I38A 2OJWA 1WMHA 1SNDA 1QT9A 3L16A 1WJJA 3LWUA 3VYSA 2J0TD 1OXTA 2FFKB 4X3UA 4M01A 3BIID 3VH3B 1X9NA 4XYCA 3NQTA 2UU7A 3Q8DA 1CFMA 3I72A 4A3DG 2UXCL 5C5MA 1V1QA 3A8KE 2LXJA 1VQEA 4CJ1B 1LQBA 2KANA 4CKBA 1IBLQ 4LNFA 4A3DB 3PTFC 2SNMA 2KMAA 1CM9A 1SLJA 1IXRA 2X6LA 3GV6A 3M3YB 1WMHB 4GSWA 3HOYH 5IN7A 1E90A 3OAWA 1T9HA 3R7QA 1H9KA 4A75A 1GG3A 4A8XC 3WWVA 1CA5A 4L1BA 4Y7NB 1FD7D 4DV7Q 1KD1C 3ETRA 4DV6Q 3HM3A 4HIMA 4LJOB 1X3PA 1C4CA 3QJZA 2VUMH 1A8VA 1I50H 1Q1EA 4HSVA 1VQIA 4OWTB 3WANA 1PLFA 2KUMA 1T5XD 2BS4B 1DD2A 4OELB 1XNRL 2A73B 2JA5G 2BYFA 1KHIA 3BDOA 3K58A 1NI3A 5FJ8G 2JA5B 4S17A 4EGVA 2OWOA 2ZXRA 1AN8A 1E3PA 3ZJYC 5BR8Q 4DR7Q 2ALYB 2N3SA 1OQYA 1EZ6A 1N34L 3VR5A 2DJFC 5GMVA 2CW0D 1XTDA 1F77A 3NPPA 1XX8A 3TP8A 1H4RA 5JOBA 3EHVA 4L23A 1QOGA 3ZRFA 5HFYA 2BWES 3FP9A 1D1KA 2JQRB 1PFBA 2Q8TA 1EEID 1Y1VG 1Q7YC 5C4XG 1QQRA 2ZXPA 4M0WA 1WF9A 2L00B 2E3TA 1XLPA 1Y1VB 5C4XB 1L0XB 3ZYYX 2ICIA 3Q8EA 2HDLA 4MTKA 4XDXA 4B08A 1V9JA 4KGTA 4RF1A 4XE0A 1KNAA 3S2DH 2NBVB 4QY7A 1E7VA 2CWPA 3DBHB 1UAPA 4YWMA 3ENEA 3L4PA 4W9KA 1LLRD 3GV3A 3TIXA 1SYFA 2B3AA 4OZAA 3LXFA 5ISRA 3DHIC 3OWFA 1RLFA 2WHIA 3V62A 4EZJA 3SDZA 3R3MA 4M0WB 1A0IA 2AQ3B 3MXUA 4OX9Q 2XBBC 4AUQC 4ZRQA 2JJQA 2N9EB 2QA4A 1N33L 1PH3A 3AM9A 1YITA 4YSYB 5IYDG 3CQZH 4OO1G 2M1MA 4A3MB 1IYFA 4LNIA 1Q82C 5GQOA 3Q0AA 1DONA 4A3FH 1Q46A 5ELEA 1EWYC 1WGYA 3OMCA 3S1NB 1VLBA 3DBLB 1I4GA 4HROA 3Q3JA 4ZUIA 1G2SA 2F0GA 4MEMA 3MXPA 3U50C 3CMMB 4IWPA 4X57B 3VR6A 1I4HA 1J7BA 2L83A 1Y1WH 1H9MA 1F9JA 4HJ8A 2Y3AA 5E6PA 1HZ5A 4LDTD 2MQHA 4YY3L 3CCLA 1UGMA 3I4MG 1VZ6A 4KZCA 1L6UA 5BO4B 4U68A 1G6ZA 1ZDVA 3DBRI 3K8AA 3NTHA 4IPDA 3I4MB 3FC4A 2QW7A 3LX0A 5E1FA 2IZVB 1F2RI 3T53B 2PMZB 1TWHH 3TZUA 2C35B 4IDIA 3OG5A 3PT2B 1WD1A 3I4LA 1GC6A 3AE9B 2IJ0A 1WXQA 4R4IA 1ZOYB 3DHHC 3FAHA 4JI0L 1VMCA 1NR2A 4GLAC 5IGGA 4PZ6A 4CDDC 1DOXA 2F0FA 1YJIA 3ND8A 4H7BA 3QCAA 2O4XA 5FLXE 4DDGD 2B2VA 1GAQB 4EZKA 4ZRIA 2ICEC 2Z0SA 3Q3FA 5A2QL 4LW1A 3BK1A 2EOTA 4OVZA 2RGFA 1U4PA 1DYQA 3B6YA 3NEMA 3KDFA 3CXCA 5DCNA 3L0WB 4ZDVA 4UP9A 1XT9B 4BA1I 2EE1A 2K05A 4AH6A 2ZW0A 2K22A 2SAKA 4X3KA 5CHVC 4YL8A 4KVGB 4CDCC 4JI8Q 2FCNA 2ZTEA 2EYHA 5EBDA 5F2DA 2D11A 5FR6A 3I9V1 2SEBD 1CA6A 4BBRG 4YTNB 2R61A 4CBVA 2V9HA 4G7OC 3N1XC 4BBRB 5I4DA 1AARA 2GB1A 4W9CA 2OEOA 4L8JA 1S5ED 2MPMA 3BDCA 4JYAL 2O5JC 3ABVB 3GTLH 1YQBA 3GOEA 5FOBB 1P8LA 4KN7C 1B7YB 5KYLA 2R92G 4E3CA 1V81A 1K8RB 3L10B 3J7AV 2QGQA 3VHTC 1SE9A 3PSIA 3SK6A 4A76A 1E8ZA 4A9AA 2KHJA 3NHEB 5KNDA 4B9XA 2Y5BB 1K83B 2BT6A 1E8YA 4LF8Q 1IGDA 4DR5L 4LF7L 4KX6B 3S17B 1LACA 5FLXc 3JAMi 1XPOA 3S2AA 5CBEE 4URKA 2WXPA 1S3OA 2F3VA 4A3JG 1MHHE 1KLUD 1TKWB 1W3SA 5D3IB 1EIYB 2BVCA 4A3JB 2NN6H 1XF5L 4QUCA 1I5FA 2A6HC 4W9GA 2WXQA 4GN5A 4A3GB 2NVTH 3J81L 3D0FA 3ZGZA 4XWTA 1RWSA 2KOLA 3S1RH 3C46A 4G3XB 2NMQA 2N78A 1GB4A 4IM3A 2WXKA 1TVXA 4G7ZC 1XPRA 2IGDA 2EYPA 2LGDA 3AXCA 2F4VQ 4RGNA 3VTWA 3ZQ4A 4YTPB 4EX5A 4RFBA 2HIXA 2YTYA 2D07B 1MI0A 4KI0A 1HJPA 1TU2B 2I5MX 3DVNU 1K3RA 1P0RA 3AE5B 3GE3C 3EBEA 3F2CA 3GTGB 3RI7C 4HAEA 1PV4A 3L08A 1K8GA 3AECB 4TV3A 4DF7A 1U0LA 5HG2A 4KKTA 2LSSA 4EE2A 4DV7L 2VH1A 2F0HA 4RM8A 5H1SE 3DDCB 3EC8A 2K5QA 4Z9CB 3CIRB 2IT1A 2BCOA 4NZLB 3H8HA 1YNND 4G4KA 1NUCA 2GN5A 2K8BA 2LVPA 2EPBA 2A74C 3SXHA 2PJHA 3TDQA 4IFDJ 4N6EB 3UQBA 4DAVA 2BB6A 3UDFA 5LMNW 1WM2A 2D2QA 5ELNA 2KTFA 3FPUB 1LTSD 4DN4M 2UUBQ 3TCAA 1XLQA 1U9RA 5G3LD 2RKSA 2GI9A 4TSSA 1PA6A 5JJKA 1Q8IA 2RCFA 3LYYA 1BT0A 3VTUA 2YV5A 2B2YC 2PPHA 1RFAA 2PQAA 4Q0FA 1GHJA 3OJ3A 5JH5C 4J1MA 2ENBA 3N9YC 3Q23A 3FRPB 1NYQA 3F8TA 2J4XA 3W5VB 3P4RB 4PZ8A 3RUIB 2WB1E 4ZCKA 2N9KA 3APCA 2V1YA 2ZVOA 5M9OA 3TJPA 1MKHA 2M00A 2L0TA 2I1KA 2LFNA 1SMXA 3GDEA 4HJ7A 3UDXA 2BYEA 3PV0A 1CI3M 2E2DC 3AE4B 2JZ3B 2DYBA 5COYA 2PQAB 4IQZA 3QOJA 1MSGA 2Y0SB 1YJWA 3KK7A 2M17A 1SJED 2CHWA 3OHXC 4QMGA 1WY8A 2I2YA 1TXYA 2MJEA 3HOYG 4JI6Q 3TUOA 2PZTA 4IUQA 3HOYB 2EYLA 1SXTA 4H02A 4RG1A 4RWSC 4X3TA 2F0MA 2A6ED 4OIJA 4A3CG 1WRDB 2C7HA 2EJGC 4OVUA 3HOZH 1FYCA 4EVOA 1Y8RC 3AYHB 1LV9A 4DXGA 4B3MQ 2KWCA 1B53A 2VUMG 2PI2E 1LO5D 3AE6B 4IC7B 1R4NB 3X3NA 3HK0A 4WJPA 3P20A 2VUMB 2EY2A 1I50B 2L0FA 2G45B 4HXDA 4IWOA 2H89B 4WJQA 4C3HH 1CQFA 4LFBQ 1RIPA 2VL6A 1UBQA 2EQSA 2MEKA 1ASZA 2KN5A 3L17A 4B3TL 1MD2D 1R4QB 2DJGC 2Z4IA 1UH6A 3BINA 3RNGC 5C1ZA 2ZJRA 1E2ZA 1YIWA 2IO1B 1K8OA 5LXHA 2A8VA 1VQBA 3HOVH 1BCPB 3PRPB 1PFSA 2JT4B 3U8ZA 1KNEA 1VQDA 5IIFA 3HOWH 3ZNGC 4NXML 4RHSA 1V43A 4RKBA 1VQJA 5D3DA 2XRSD 2UXDQ 1X1MA 4P1CC 3NP8A 1XNQQ 1PDXA 3TBLD 2L05A 2N9XA 4J6IA 4A20A 3ZJVA 1VQAA 3S2DB 2J7ZA 3I3TB 4GMVA 3TS0A 4ANUA 1EY0A 2N49A 2Q2HA 4HR7B 4LF4Q 3M4QA 2I1JA 3CRKC 1LTID 2MJDA 2HE7A 4IPCA 2UWQA 4P7IA 2NZOA 2PKOA 5EPKA 1HZCA 4WWPA 2ZCBA 1GO3E 4KJNA 4LF9Q 5M3MH 3CQZB 1B1ZA 3K6OA 2WIIB 1EZ8A 4IALA 1VQOA 3OLMD 2G4SA 2VS1A 3A4SC 3SR6A 4UDUC 2DX5B 3CRLC 1X6OA 4A3FB 3HHMA 4L2YA 4A3BH 4IN3A 4HDQA 3W3AA 4JPBW 2I07B 5I2XA 1VQNA 1BDOA 1A3TA 3CP0A 3K5MA 3A33B 1DOKA 3U2SC 1QNUA 2RSNA 3WIMA 3GTOH 3FVQA 4PYUA 1Y1WG 5DNFA 1I94Q 1BOSA 2NVYH 1S40A 2VRRB 1BUVT 1Y1WB 2HTHA 2K25A 1VQ4A 2PPBC 3I56A 1A63A 2K7VA 5T1IA 3BJUA 4ZYNA 2WB1G 4KDLB 2PLPA 4RH6A 4MZ9A 3MVVA 2D62A 1FRDA 2LUEA 4YSXB 1WM3A 4LNOA 2AYOB 3CKIB 1JWAD 4QL5A 1Q86C 2HJ1A 2OJRA 2N1WA 4DFAA 3K7UC 4ME5A 1TWHB 3SR1A 1VZ8A 3DBHI 2YEPB 4NB3A 3S9WA 3N32A 4I6PA 4K7UA 5AUKA 4LF8L 3W1SC 2Z9HA 4DV3Q 5G55A 2PI2A 4NJCA 1AWDA 5DAUA 1RAXA 2CW0C 4AYBE 3RYTA 1E2VA 2ASQA 1JORA 2LI5A 2MP2A 2WINB 1JE5A 1FXIA 2EMTA 5IODA 3PIPA 1MVKA 2KD0A 4MNOA 1Q1OA 3LNNA 3VDZA 1S5BD 4MT5A 2JA9A
chains in the Genus database with same CATH topology
2WXIA 2E76C 1KH0A 3I57A 1IKMA 1JE4A 3NWSA 5C5LA 1RKNA 2JXTA 1UWXA 4XIGS 1WWTA 5G5HA 4OL7A 5EPJA 1YNTE 2IX0A 2QJLA 4HJGE 2IX1A 1VDZA 3TEZA 1JWBD 1ZDXA 3FILA 3KLSA 3KF8A 1RYJA 4JE3B 1EEFD 5KYIA 2BA0A 4RF0A 3KUPA 1PRTF 4XQQA 2LFIA 1F2ZA 5BMHA 2QEJC 3GTLB 3AEDB 3FILB 3GP7A 2G9DA 2TSSA 2I46A 4FO2A 4M1UB 1HEZE 1Q12A 2DYOA 1S5FD 2K04A 5CR3A 1P7EA 4GDKB 1HTLD 3NWTA 1ROEA 3MXGA 3Q6SA 1DXMA 3HVDA 1KTKA 2LY7A 1WRIA 1Q1BA 2NVTB 3BYTB 4LMQD 4DQOC 3S1RB 4F87A 2HTME 3ND9A 2TMPA 1TT2A 4HCSA 1QJOA 2VZKD 1G291 4WFN3 1NENB 2AUKA 2ZXOA 2RQXA 2H1EA 3SE0A 3DWQA 4HMJA 3JAML 4RGMA 4ZKCB 3AMZA 3PUYA 1JOOA 1ONLA 1YQ3B 3OWEB 1SIJA 5T8IA 5I9OA 2V4IB 1T3QA 1O7ZA 1ZKOA 3GB1A 4AYBB 2K5DA 2L52A 3Q69A 3T3OA 3RUZA 4E6IA 3T3NA 1LTRD 3TP6A 1FRRA 1IKLA 4FNFA 2EJFC 1RCVD 1WTWA 3E0JA 3IFDA 2KHSA 2Z4HA 4ZRZA 3WOEA 4RKLA 2E75C 3J80E 3BK2A 3C8YA 2RVLA 1W6JA 5BYQA 2QSDA 1D5MC 4CJ0B 3AEGB 2ACZB 1JWMD 4RCOA 1I4PA 1TJEA 5G3LF 3A7LA 4FP5D 3V2TA 3NQIA 4KY7A 2F0SA 2Y5PA 3TEWA 5C4ZA 4MIUA 1D1IA 5E6JA 1E0ZA 5GXGB 2XWBB 3OOCA 1EY9A 4M8AA 1V1OA 1C79A 2B2UC 1DOLA 3EFXD 1LT5D 3RFZB 1NYRA 1FFVA 2JXMB 3HOZB 1IYUA 4U673 4RA8A 1JOQA 1FO4A 2JE6I 1VF7A 2FBWB 1AW7A 4C3HB 3P63A 5LL6S 3SK5A 4C3JG 1ZXTA 1YNNC 1UGJA 1ILPA 1HZ6A 3URYA 3O13A 4KKSA 2OEDA 2WLBA 1RF2D 1LTBD 4J8QA 3HOVB 1KFYB 1EFID 2OHFA 3HOWB 5IGBA 4CJ2C 2Q8IB 1UWMA 5ELCA 5A35A 1KDCA 1JMLA 4QB4A 1WTQA 3SVMA 2WXOA 2B2TA 3EJIA 1JC7A 4G57A 1VJKA 4TQUS 3NUCA 3J9CA 2JX5A 4HEA1 3LB8C 5CORA 3AU7A 1FNWA 4QIWB 2B76B 4F7XA 2EY5A 2HDMA 2F0IA 1LT3D 5M3MB 1IUEA 3IXSA 3C1EA 3P4PB 2HQEA 1T5EA 1FMAD 1XCTL 4A3BB 2FMMA 1PZKD 3B2GA 2A6EC 1H9RA 3T16A 4BWGB 3GTOB 2BS2B 1HCZA 5K36H 4PMBA 3NVVA 3AEFB 1HQMC 3A8IE 1N5XA 2AUJD 3TMEA 4USAA 1R7SA 1KAAA 1B44D 1PTOH 4H0LC 3DMUA 2EYJA 4DK0A 1U4MA 1A6XA 1QOAA 2N88A 1OFFA 1A15A 3W2DA 4ITKA 2E2HB 2BDOA 3HP3A 2L0CA 2IWHA 4BA2I 1LT6D 4PMWA 1VZ7A 1C77A 1O78A 1D5XC 2R93B 1B9RA 2NVQB 4FXKC 1PFDA 1BQQT 2E6XA 1EIHA 4XXEA 1P7FA 2CJOA 5JVG3 1CQVA 2YU9B 1ZP0B 1SYCA 1N63A 3AE3B 5HHDG 1V97A 3EGRA 2PYKA 2N55A 1OXSC 3VRBB 1YN4A 3KLSX 3RZDB 1Z47A 1EY6A 1S5CD 4TQ0A 1S5DD 2NUCA 1V1PA 2WDVB 1KDAA 2FUG1 2WNMA 3PO3B 2B8FA 4KKUA 4MHEA 3RMHA 2KQ4X 2J42A 3PUWA 3M85A 2VB2X 5AFWA 2DN8A 4XT3B 1V1PB 3GTKB 1XLNA 3NZ3A 4N59A 3TP5A 1TS4A 2JSOA 5EKIA 2F0DA 5ELBA 1EU3A 5C0XJ 2G1EA 4LAAA 2L12A 3H3VC 2PVGC 4YTMB 1DCZA 2B2WA 2XWJB 2N0SB 2NBFA 2KQ3A 3A7AB 3BVZA 2WU5B 2K9XA 2B39A 5NUCA 1PGAA 4REZA 3U4EG 3NBHA 2LJIA 2MJ8A 3Q8CA 4A3KB 1E10A 1ENCA 3AMUA 3W1SA 4OIKA 1OXUA 3IAS1 3OIQA 2QF7A 2NYZD 2NN6I 1OXVA 1LT4D 1NR4A 2EVBA 5TSSA 1EL0A 1PRTD 1SNPA 4NAMA 4XTCS 1STYA 5EE9A 1EM7A 4P2CB 4ABNA 4FF4A 3IAYA 1I4RA 3AEEB 4K2LA 2A69D 2RSOA 5FK9C 1RTOA 4DK1A 1ENFA 2OF1A 4J6HA 4B0MA 3G6JB 2BW2A 1QILA 1QCBD 3ERQA 1I6VC 4K14A 1QOBA 3U52E 1O80A 2R7ZB 3HZXA 1S4ZA 2KA7A 1TKYA 4A3EB 1EY5A 3NUHB 4DU9A 2RDHA 5H92C 1GJXA 1LTAD 2RPVA 4PT5A 1SDFA 2X69A 4FF1A 4K8JA 2L1AA 1C4AA 3BDLA 1SB3C 2FE8A 1OQRA 5IT9E 1VCIA 2KCNA 1II3A 4I65A 3NBIA 3NVYA 3K5NA 3OW7A 4C3IG 1AFPA 4C3IB 4KK7A 5C4JB 1UUPA 3D31A 1SNMA 4ILWA 4KTAA 1FNVA 2L11A 4I7ZC 2H88B 4NAWB 2W54A 1BCPD 2K0PA 1F2MA 2J53A 1JWSD 4DNRB 3IT4B 1QLBB 1FCCC 2M56B 3L3OC 1NEKB 1E9MA 4R8NA 1NCVA 3FMCA 1F2LA 1AZQA 4TRDA 1FXAA 1XCQL 3R2IA 1H9SA 1ESFA 2EDGA 2NVXB 2CJNA 3UI3A 3A54A 2INPE 2R6GA 1GPXA 1MHXA 1HA5A 5K36G 1C8CA 5FKAC 4F8MA 4UAIA 1TWCB 4K5XA 4XYQA 4EE2A 3MFYA 1GUTA 2BDNA 2W82A 3E6ZX 1H9SB 2AWOA 1STEA 1F0ZA 1PTOB 3HEJA 4K6LA 4C56C 4ZOHC 2LHEA 3SK8A 5I6WA 1FD6A 5CV9A 1BO0A 2HCIA 3F2UA 2RA4A 1RDPD 4BS9A 4HKZE 5T1GA 2OXPA 4YIJA 3H6MA 4WRDA 3PUZA 1G91A 1L6VA 5BYSA 1JROA 5J22A 2V0GA 1K51A 2K28A 1SF0A 2LHDA 2R3ZA 3PO0A 2LS01 3PIP3 1CK1A 1TR5A 1CZPA 4IZ8A 1J7CA 5JVH3 1L0VB 4GLSC 3E5SA 1HHVA 2DWQA 1QKZA 4IUTA 3RZOB 1JALA 1I4QA 3M7GA 2KCCA 1ZYRD 2N7JA 3PZ8A 2KECA 1DM0B 4IKGA 4WWMA 5H8YE 3UI2A 2DY8A 4NKLA 4P6VF 1Z6HA 5IGEA 2SNSA 1BF4A 4DA2A 3R2TA 2F03A 5IGDA 1ZXIA 1U4RA 5MPOA 3DUZA 3R93A 4KD4A 4ULLA 3VR3A 1TS2A 4L63B 2NZ1D 2CU3A 3PZ7A 3AV8A 2JSVX 5C0XH 4KKJA 2WP9B 2WS3B 4LK1C 1PXUA 5EE3A 3PUXA 1EYCA 2MGSA 1C9FA 1YNJD 2L4NA 1H9JA 1A3UA 1ICWA 1Q90A 1EWHA 2EZVA 2XNAC 2V3NA 2C5CA 1E7PB 3R3OA 3U9SA 3T4AC 3QO2A 4KV6A 1GUNA 4ZRPA 2WACA 1ENAA 2ON8A 2D5GA 1I7HA 1E0BA 3E56A 4US9A 2B2VC 5KNCA 2JA6B 5BN4A 2PQEA 2IDYA 3IL8A 3NS1A 1PMRA 1PDQA 3K5LA 1DOMA 3DXJC 3K5OA 4ARCA 2PCFB 3OMGA 5D7GA 1T6BX 1F9PA 3JAME 2FMCA 2A5HA 1ILQA 2DNCA 2INNE 5IGFA 2NTTA 1EY8A 1PGBA 4OW0A 2HDEA 3Q8BA 1Y8OB 1EY4A 2NN6G 3OIPA 5FO9B 1PZID 1B9MA 1FM0D 1VMPA 3OSOA 2D5DA 4LTUA 4IFDI 4DAYA 1TKEA 2WDRB 1HQRD 2HCCA 4A93B 3KLRA 2EELA 4OO1H 3BVGA 3KWVA 3K57A 5CV6A 1WD0A 5BYRA 1A2TA 1SAPA 1O7LA 1HRJA 2WXLA 1AYFA 1YMHE 1PRTC 3QOLA 1A3VA 2QDBA 1N5WA 3M7NA 4A3IB 4V0BA 2WAQB 2A69C 5C3EB 2F0EA 1SFOB 2PIAA 2ZW1A 1C4PA 4AQ7A 2M0AA 4FXGC 4IFDH 3AE1B 1PYWD 3TBIB 1BCPF 1YQ4B 3I90A 3CHBD 3MZ5A 4FVMA 3V3XA 4KY6A 2XIWA 3BG3A 1XWEA 2K3UA 1KABA 3DHQA 5JEAJ 3P1MA 1Q10A 2JEBI 1QE6A 1E6EB 2BTEA 3P42A 2C9OA 1IW7D 1TWFB 5IGCA 3EUB2 1TYGB 3WOFA 1TS5A 1JCKB 2V3PA 1XYIA 3P1HA 5EE0A 4C3HG 5CV8A 3D3RA 2JYEA 4HN7A 3U9OA 1WSPA 3S14B 5CMDA 1GHKA 4PV1C 3AB9A 1BCPC 3GTPB 3PUVA 3J80L 3B2FA 1IHZA 1U4LA 2YEPF 1R4PB 2WDQB 1IYVA 3L9AX 4C80A 3GS2A 1SYEA 3I3CA 3PIO3 3CU7A 4WORA 2A68D 5C3XA 2SDFA 2VXWA 2EYOA 4EQNA 5ELDA 1TY0A 4HCEA 2X6GA 1WGKA 4MM3B 4K5WA 4A90A 4XDDA 2RDFA 1OXXK 2AQ2B 2LMCA 4ZUJA 1HFGA 4N58A 3FEWX 4DAPA 5KRUA 3V96A 2RBMA 4RNAA 2WXFA 3KWLA 2B8GA 1KLGD 2G9HD 4B0EA 1ZPSA 4C7YA 2B2YA 3GO5A 1UEAB 3L7ZC 3MTSA 1VR9A 3AEBB 2KEDA 2LMCB 1F9SA 2NVYB 3QB3A 3E9SA 5C0XG 5EBCA 1PFMA 1C48A 2BYTA 1UNSA 2X38A 3D4DA 2GRIA 1RJTA 2F0UA 4HTHA 5CV5A 4IUVA 3VR9B 2K01A 1XXGA 2MP1A 1STGA 3T56B 1SMYD 3J7AF 2EY1A 2KVMA 1TKGA 4WQMA 1RHPA 1HUNA 4EQPA 3WDNA 2F4IA 5BN3A 1Y8NB 1SE3A 4NW2A 1BR9A 5HI1A 1ZYRC 2W3SA 2H4OA 3QG1A 3LWEA 4K8IA 3MWYW 3MEHA 1MBYA 3VA5A 1F2RC 4JWSC 4QCLA 3S2HB 3S15B 4XYOA 3IT6B 3TEYA 3VA7A 1STNA 1STBA 2F0QA 1MSHA 3IAM1 1F9RA 2PTLA 5CGKA 3B9JA 2KEEA 3TP7A 2JU6X 1M8AA 3HUIA 2Z1CA 1EYAA 4YXDB 1YNJC 4IUNA 4O42A 2MHVA 1WTOA 3D4WA 4BBSB 3CWIA 5G5GA 1SNQA 3W9CB 3G7LA 5A2QE 4CKCA 4C7ZA 2KDMA 1RODA 5ELFA 4IURA 5HURA 4R9WA 1B4OA 2FINB 4MH8A 1ZUD2 2DLBA 3DWPA 4KGRA 5J1ZA 4C1NK 3T51B 4KN4C 1SNOA 2QKIC 2K03A 1GUWA 2FJ2A 1JRPA 1GOZA 2F0OA 4CHTB 3VR2A 5IOCA 3Q24A 3WCQA 2LUMA 4RGTA 2L55A 1FFUA 2KWDA 1I3QB 2IGHA 2F0KA 5I2YA 1BBXC 2EJMA 4J3OD 2PW9A 4O1NA 4IFDG 3RPFC 1K50A 3ONAB 1HUMA 1D2BA 1ET9A 3GD7A 2L1BA 3DWMA 4WIPA 4DNTB 4KGSA 5JJZA 2K6AA 4ZLTF 3J81E 2AQ1B 2E2JB 1ET6A 2JYTA 3ITPA 4CGYB 4L6TB 1SE4A 4HMIA 1L0YB 1STAA 1SYGA 4QF4A 2EXZA 3N52A 1K8MA 3P4QB 4P16A 1IBXA 4PQXA 2DNEA 2WKCA 1YN5A 4K6DA 1JW9D 3MA2B 1Q3LA 3NVWA 2IX3A 5JEAH 1ACCA 4OZCA 3SK4A 1LTTD 1FR3A 1X32A 5FLXL 3MHBA 1G8ZD 3VYUA 1IBXB 3A55A 1LTGD 2W55A 3NSWA 4ZYSA 3NE5B 2BA1A 2R92B 5BMGA 1KDBA 4KY5A 3AN1A 1PTOD 2PW5A 3D4RA 1TQOA 4R3DA 4ZK9B 4MN3A 4RGOS 1PFNA 2CVRA 5D65A 2F0TA 2WXJA 2JWUA 4FF2A 2BOSA 1SEBD 2MH7A 4KKIA 4JK1C 3NXWA 3C1FA 3P7JA 1M4VA 1KRHA 2KN4A 3TZDA 2JA8B 2NB0A 3ZJUA 2ZT9C 3EVQA 2Q5WD 3D8GA 4MACA 5EQ0A 1SSOA 1SYDA 2KJXA 3M4OB 1QF6A 4ODGA 2K1BA 3MC0B 2NWGA 2WXHA 1RM6C 4HRSA 1CZGA 2LKVA 3DWAA 4RHRA 5LHY1 1ZXHA 3A56A 2W3RA 2B2TC 1XLOA 1BNZA 1IGCA 2V4DA 1PRTB 2XVSA 5EJWA 2N9LA 1VDVA 2KACA 3BS1A 3AE2B 1IW7C 5CYUA 3VQIA 3HVZA 2JYOA 3Q22A 4WAFA 5JPNC 1PZJD 4YSZB 1CJEA 4B9WA 2Z8LA 1YN3A 3KQ4A 5IT9L 5FO8B 1Y56A 3DEOA 5J39A 2PVOD 1OQQA 5C6AA 2PO4A 3DEPA 4TQ1A 2CHBD 3VYTA 3C2PA 3I73A 4A55A 3MHZA 1J7AA 2L5TA 1FNUA 4F88A 3H91A 3I8ZA 4H44C 3HG9A 1V8CA 3I70A 2B2UA 2KMMA 1GUOA 2WXRA 5C3JB 1JR0D 2BE5D 4LK0M 4ZHOA 1CZWA 1ESRA 1EYDA 2EYMA 1ML0D 2K33A 5EKKA 1K53A 2A68C 4QUFA 1A2UA 1W6KA 2K5PA 3MFGA 2MJ3A 1J9OA 3EQLC 5CBAE 4Q5VA 1A70A 3EROA 1D5ZC 1QWYA 1SBBB 2CQAA 1DOIA 1WTRA 1JB3A 2F0LA 3D6CA 1EOTA 5C0XI 4NMZA 1AP0A 1QNKA 1NVID 3H94A 2RMMA 1JICA 4ZHPA 1PUTA 1F9QA 3IFTA 2M9VA 3K7AB 2K32A 5KGUA 5JXVA 2IGGA 4EQOA 2SOBA 3C3LA 3RLFA 2EYFA 2WU2B 2FHTA 4N9TA 2QCPX 1DJRD 1R9TB 1BMLC 1XO3A 3U7ZA 1SE2A 5DEHA 1EIGA 1Y69U 2D9UA 1SNCA 4PMCA 5LNK1 3GQBA 2JA7B 4X3SA 1MPEA 1VF5C 4LLGM 2WKDA 5D14A 5HGTA 4JBWA 3NTIA 4KMUC 1BUIC 3S1MB 1CT1D 3A8JE 1XTCD 1B3AA 3Q8FA 4FYDA 1SMYC 4CQNA 4DXFA 3NHHA 2EY6A 5FR3A 3AE8B 4RAUC 2D2CC 3QIAA 2B2WC 3AEAB 1LABA 3TSSA 2M19A 3NRZA 1EQVA 2Y5CA 1WTVA 4K5VA 3P4SB 2O5IC 2WXGA 3VR4A 4XQNA 4A6QA 1GXDC 1ZE3D 4CKEA 2WB1B 1EY7A 2K5WA 3R8BA 4OZBA 4XDCA 1CTMA 4WH4A 1TS3A 3HKZB 1V8QA 4NP5A 3KBGA 5EPLA 2HUGA 3H09A 2XN9C 3VRAB 1FCLA 3FDTA 1CHQD 1DZ1A 1MGSA 3BYYB 3VYRA 4BY1B 1WCMB 2IW3A 1GB1A 5C44B 3FKIB 3DWGC 5KEEA 4BY7B 4OO1I 2F0NA 1QOHA 5CV4A 4JX1C 3K59A 2PW7A 1L5PA 4HKQA 1IL8A 1KF6B 1TWGB 4KJOA 4C1NI 3S16B 4FF3A 4XT1B 3FPPA 2AX5A 2RDGA 3BZDB 4AS1A 3AE7B 1Z7TA 1JWUD 1GUGA 4G7HC 1L4DB 1C76A 2L9HA 2WXMA 1AEXA 3VR8B 4ID6A 1DGJA 4V190 3V05A 5JEAG 3HRZC 1TZOA 5KIXA 1PGXA 5DM73 3PO2B 3RD4A 1C4QA 4KD3A 4IOIE 3PMFA 1JQ4A 3QJYA 1QB5D 1NAPA 1QG7A 1FIQA 3SFEB 2AWNA 2KAJA 4WURA 1E2WA 3HOUB 3X3MA 5M5YB 2JZPA 5E4WC 2O2LD 2F0WA 2YYZA 4FXCA 5I6YA 4WJWA 1VRAB 2QILA 1N60A 2WP8J 1L4ZB 5AUIA 5M5XB 3Q8AA 2JP1A 3SFDB 2PNRC 1N61A 2XRQD 3I91A 3BVMA 2BS3B 4NDXA 1PTOF 1RD9D 2PMVA 2WXNA 4JPSA 4GZYC 5E4XA 2F0VA 2IPKD 4XQJA 1QOFA 1C78A 2F1MA 5I9PA 2VB3X 5JAVA 1AZPA 1DOYA 2BB5A 1D6EC 3HOXB 3MAQA 4US8A 1B2TA 3MP9A 4S3SA 4FXDA 1JOKA 5K5PA 3ZJTA 3IKJA 1FGBD 2A6HD 1FEHA 1I6HB 1JQYD 4OGQC 1X3QA 2IL8A 1N62A 2QIEB 3P75A 5FO7B 3HRDD 5EKLA 5EGTA 4ZAIA 1J8IA 2VNUD 4H2AA 2NTSA 1K52A 4DGZA 3D6WA 2XSCA 5LL6X 1B50A 2PZWA 4LJZC 1WVLA 1MI2A 1WTPA 4D2KA 1CHPD 3NTKA 4RCNA 2OT2A 2LGIA 3J7YW 3I4NB 1Y8PB 1STHA 1SJHD 2M2LA 1PTOC 4TKOB 5BN5A 2DYMA 5EE1A 3OPOA 5CV7A 3GTMB 1SYBA 3T13A 4YT0B 3W5UB 1G2TA 3DM1A 2BBCA 4IUUA 2J52A 3NVZA 2QMTA 3AH7A 3BWUD 3S1QB 3KBXA 1HFNA 3M4YA 2Q8RE 4K2KA 3MJ5A 2PZUA 4R8IA 2DBYA 3TN2A 1YJJA 5C2TB 2B63B 1D4BA 1NSNS 3NK9A 2EKIA 3HGBA 1OO9B 2ID0A 1EQTA 1EWCA 1RFKA 1GUSA 2L32A 1F2YA 1ZEQX 2VZKB 2E2IB 5C3WA 5CC4A 4KHVA 3N6RA 1HXYD 2JEAI 2F0PA 2DY7A 2F0JA 1O7YA 3GTQB 1HPCA 1TWAB 2WV6D 1EU4A 3QWNA 4C3JB 1HA6A 3SEBA 4JWUC 1TY2A 1WTXA 1XEEA 4ARIA 3GTJB 1I4XA 3H0GB 2WQYB 4OHJA 2GA4B 2MUYA 1RTNA 4YWGG 2F3WA 3TEXA 4TMAB 3HS0C 3K0YA 1HTPA 4N9PA 4HSPA 4C2MB 3MXNA 1SSNA 5M3FB 1WYGA 3AB5A 4IUPA 5M5WB 4HEDA 5DM63 4ZKBB 4PNYA 5C4HA 4GDLB 5E3FA 2BE5C 2ONQA 4KHZA 1BXTA 5JPMC 4H13C 2E74C 3SHLA 2LEKA 1B9NA 1TIID 3EA6A 4ZQ3A 4XWWA 5KNBA 5BMIA 2I38A 1SNDA 1QT9A 3LWUA 3VYSA 2J0TD 1OXTA 2FFKB 4X3UA 3BIID 3NQTA 1CFMA 3I72A 5C5MA 3A8KE 4CJ1B 4CKBA 4A3DB 2SNMA 1CM9A 2X6LA 3GV6A 3M3YB 1H9KA 4A8XC 1CA5A 4L1BA 4Y7NB 1FD7D 3ETRA 1X3PA 1C4CA 1Q1EA 4HSVA 1PLFA 2KUMA 1T5XD 2BS4B 1DD2A 2A73B 3BDOA 3K58A 1NI3A 2JA5B 4EGVA 1AN8A 2ZXRA 1EZ6A 3VR5A 2CW0D 1F77A 3NPPA 1XX8A 3TP8A 4L23A 5JOBA 5HFYA 1QOGA 1D1KA 2JQRB 1PFBA 2Q8TA 1EEID 1QQRA 2ZXPA 4M0WA 2E3TA 1XLPA 1Y1VB 5C4XB 1L0XB 3ZYYX 2ICIA 3Q8EA 2HDLA 4XDXA 4B08A 4RF1A 4KGTA 4XE0A 1KNAA 1UAPA 3L4PA 1LLRD 3GV3A 1SYFA 4OZAA 3LXFA 5ISRA 3OWFA 3SDZA 3MXUA 2AQ3B 4ZRQA 3AM9A 4YSYB 4OO1G 4A3MB 3Q0AA 1DONA 5ELEA 1EWYC 3OMCA 3S1NB 1VLBA 1I4GA 4HROA 4ZUIA 1G2SA 2F0GA 3MXPA 3VR6A 1I4HA 1J7BA 2L83A 2Y3AA 1H9MA 1HZ5A 1VZ6A 1L6UA 4U68A 1G6ZA 1ZDVA 3NTHA 3I4MB 3FC4A 3LX0A 5E1FA 1F2RI 3T53B 2PMZB 3TZUA 4IDIA 1WD1A 3I4LA 3AE9B 2IJ0A 1WXQA 1ZOYB 3FAHA 1VMCA 1NR2A 5IGGA 1DOXA 2F0FA 1YJIA 3ND8A 4H7BA 2O4XA 5FLXE 2B2VA 1GAQB 2ICEC 5A2QL 3BK1A 2EOTA 4OVZA 1U4PA 1DYQA 4BA1I 2EE1A 2K05A 2ZW0A 2K22A 2SAKA 4X3KA 2EYHA 5EBDA 5F2DA 3I9V1 2SEBD 1CA6A 4YTNB 2R61A 4CBVA 4G7OC 4BBRB 5I4DA 2GB1A 2OEOA 4L8JA 1S5ED 2MPMA 3BDCA 2O5JC 3ABVB 5FOBB 4KN7C 5KYLA 3J7AV 3SK6A 4A9AA 5KNDA 4B9XA 1K83B 2BT6A 1IGDA 4KX6B 3S17B 1LACA 5CBEE 2WXPA 2F3VA 1MHHE 1KLUD 1TKWB 5D3IB 4A3JB 2NN6H 1XF5L 4QUCA 2A6HC 2WXQA 4A3GB 3J81L 3ZGZA 4XWTA 1RWSA 2KOLA 3C46A 2NMQA 1GB4A 2WXKA 1TVXA 4G7ZC 2IGDA 3ZQ4A 2EYPA 4RGNA 4YTPB 4RFBA 1MI0A 4KI0A 1TU2B 3AE5B 3GTGB 4HAEA 3AECB 5HG2A 4DF7A 4KKTA 2F0HA 2K5QA 4Z9CB 3CIRB 2IT1A 2BCOA 4NZLB 3H8HA 1YNND 4G4KA 1NUCA 2EPBA 2A74C 3SXHA 3TDQA 4IFDJ 4N6EB 4DAVA 2BB6A 3FPUB 1LTSD 4DN4M 1XLQA 1U9RA 5G3LD 2RKSA 2GI9A 4TSSA 1Q8IA 3LYYA 2B2YC 4Q0FA 1GHJA 4J1MA 2ENBA 3N9YC 3Q23A 3FRPB 1NYQA 2J4XA 3W5VB 3P4RB 2N9KA 5M9OA 2M00A 2LFNA 4Q2JA 3AE4B 3PV0A 1CI3M 2E2DC 5COYA 4IQZA 3QOJA 1MSGA 2Y0SB 3KK7A 1SJED 3OHXC 4QMGA 2I2YA 2MJEA 3TUOA 2PZTA 4IUQA 3HOYB 2EYLA 1SXTA 4RWSC 4X3TA 2F0MA 2A6ED 4OIJA 2EJGC 1FYCA 4EVOA 1LV9A 4DXGA 1B53A 1LO5D 3AE6B 3X3NA 3P20A 2VUMB 2EY2A 1I50B 2H89B 1CQFA 2MEKA 1MD2D 1R4QB 2Z4IA 1E2ZA 1K8OA 1BCPB 1KNEA 5IIFA 4RHSA 1V43A 4RKBA 5D3DA 2XRSD 3NP8A