2I38A

Solution structure of the rrm of srp20
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRDLDGRTLCGCRVRVELSNGEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/chimera
molecule keywords Fusion protein consists of immunoglobulin G-Binding Protein
total genus 42
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2i38A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i38A02
5IFMA 1OO0B 3CCQS 2O3DA 2X1FA 4OZCA 2CPZA 2MQPA 1ZH5A 4C4WA 1IBXA 1FT8A 2CPYA 2LMIA 2DNZA 1SJ4P 3BS9A 2DNQA 1P27B 2YTCA 2CQ1A 1NO8A 1YHQS 2JXTA 3B4MA 3MI7X 1IBXB 4ZKAA 2L9WA 2M8HA 2PEHA 4YUDA 2KRRA 3CCUS 4IOCQ 4PR6A 2RRAA 1WG1A 1FJEB 1D9AA 2XS5A 3N9UC 4WFAQ 1VQ8S 2LKZA 1B7FA 1WF1A 2GHPA 3ULHA 2V94A 4M5DB 4W92B 1RKJA 1WEZA 1PGAA 5HL7Q 3CCES 4CIOA 2J76E 4OZ0A 1FJCA 2CQHA 3K0JA 1Q10A 1FCLA 3LPYA 3VAFA 1HEZE 2PTLA 3DXBA 1QVGR 3BO2A 4UY8T 1XN9A 2RQ4A 2AYEA 3UWTA 3LQVA 1YTYA 4TU7A 3MDFA 2LGIA 4C7QA 4ED5A 2CQ3A 3P5TL 3JB9k 3CD6S 2M4MA 3MUTP 1FHTA 2KXNB 3SDEB 2KVIA 1QKZA 3G71S 4CH1A 3Q2SC 5DDRC 2J8AA 1VQNS 4WF9Q 3EX7B 2MKSA 2OSRA 3THTA 3MP9A 1ZZFA 4TU8A 2DO0A 2DH9A 4P6QA 4LMZA 3U1MA 2G4BA 3PIOQ 3UD4P 4LIRA 3FILB 2ZJQQ 2AD9A 2N9LA 2DNYA 2J0QD 3S6EA 2MKIA 3D2WA 2MZQA 1VBXA 3H2UB 2LEBA 1X4EA 2E5GA 3NS6A 2MZJA 3RW6A 1M5PC 3VAGA 1YIJS 2DGTA 5JXVA 2DITA 2KG1A 3UD3P 5IQQA 1M5VC 1KH0A 2MZSA 2EELA 3CCJS 1U1KA 1P7EA 3CCLS 2XNQA 3EGNA 2YKAA 1WF2A 2YWKA 1KD1T 4A8XA 5GVQA 3CCRS 4Z2XA 5BJRA 1S79A 2DNLA 1HD0A 3MUMP 1OIAA 2MMYA 1K51A 2DGVA 3CCVS 2QSDA 2DNMA 2VODA 1WG4A 2UP1A 1MI0A 2I38A 2BZ2A 2ONQA 1P1TA 3NNAA 1CVJA 3HI9A 3US5A 2CPEA 4ERDA 2MSSA 2U1AA 2CPJA 1UWXA 4EGLA 5CYJA 2MKHA 1SXLA 1H2TZ 2MKJA 2U2FA 2F9DA 1BY9A 2XS7A 1PGXA 2PW9A 2LCWA 3G9CA 2E5JA 2J52A 1VQLS 5HI1A 2N7CA 3S8SA 1M1KT 4LJMA 1U6FA 1OWXA 3NS5A 2J0SD 5H1SV 2JWNA 1JJ2R 1D8ZA 3VAHA 5LSOA 1GB1A 1UP1A 2DGUA 3G6ES 1VBZA 2MHNA 1K50A 1PGZA 2FC9A 2E44A 5JVGQ 2NZ4A 2LUMA 2CPDA 1L3KA 1VQMS 2RRBA 3R27A 1SJFA 3MD1A 3VALA 2DNGA 2IGHA 2MZ1A 3MOJB 2M88A 3MUVP 2MYFA 3IRWP 1X5PA 4Y0FA 3L3CA 1K9MT 2DISA 2MKCA 2FHOB 2F9JA 3CC2S 2M9KA 2MJUA 2MY8A 1X4CA 1X5OA 2I2YA 1WWHA 1PO6A 3CCMS 4V19X 2YH0A 4QU7A 2DB1A 2LXIA 5IM0A 4F02A 3J7ZT 1Q7YT 2LQ5A 1FCCC 3R1HA 2M8DB 1FJ7A 1M90T 3GB1A 4W90B 1DBDA 1U1PA 2D9OA 2DGXA 2DNHA 2G1DA 3CC7S 2N82B 2KACA 1VQ5S 3UI3A 2XSFA 3THPA 5GAHU 1X4AA 1EM7A 2RU3A 4QU6A 4MACA 1K52A 4RU2A 2KM8C 1WG5A 2HZCA 3CUNA 3V3XA 1VC5A 3CCSS 5LSLA 2AYMA 2K3KA 5ITHA 2HGMA 2RS8A 2KN4A 2DNRA 1X4BA 1X5TA 2XNRA 3SMZA 1YJ9S 4KGRA 4IOIE 2K8GA 5GADU 1Q82T 2GB1A 2DNPA 4Y00A 1VQPS 4TLQA 5DDPC 1ZZNA 2DGSA 1X4DA 3HHNB 2KQ4X 1WHYA 5DM6Q 2WBRA 2QMTA 3TO8A 1A7GE 2X1BA 2OEDA 3ZZYA 3UCUP 4CH0S 5HHDG 3CF5Q 1FXLA 2KG0A 4IKGA 3NNCA 3BO3A 2DK2A 2CQPA 2HGLA 5HFYA 2SXLA 2KU7A 2F3JA 2RS2A 1NU4A 2OTLS 2GO9A 2PE8A 3R1LA 3BEGB 1XCQL 2VOPA 1ZXHA 2MJNA 2ZW0A 3IWNC 3FEYB 5LJ3Y 1U1RA 2ZW1A 2CPXA 2DHAA 2M2BA 4WIIA 2OJ3A 2E5HA 1SJQA 3S7RA 2VONA 2JVRA 2RVJA 3VF0B 5D78A 5DETA 2FPHX 1WELA 4U67Q 1P7FA 1HA1A 2M70A 5CA5A 2CJKA 3NNHA 2ON8A 3I55S 1YI2S 1YMHE 4HKZE 1DRZA 1XCTL 3OW2R 3CPWR 2HYIB 2AYGA 2X1GA 1JMTA 2OTJS 2RUGA 1Q81T 2MQNA 1O0PA 2DH7A 4FXWA 1N52B 2NLWA 1KOOA 1WHWA 3P6YC 2KWDA 1PGBA 1H2UX 1MHXA 2M52A 1RK8A 1VBYA 2DGOA 2CQIA 4IO9Q 3S01A 2JSVX 2M0GB 5LXYA 3H2VE 4C0OC 3DLLQ 3RW7A 2XB2D 2IGGA 2XS2A 2DNOA 1VQKS 1K73T 2CQGA 2LA4A 1WF0A 2KI2A 2MQQA 1N54B 2B0GA 2MGZB 1U1MA 1A9NB 2QFJA 3G96A 2CQ0A 1WTBA 2E5IA 1S72S 1WHVA 2D9PA 4GLSC 5BMGA 2N7JA 2CQBA 1WEYA 1HZ6A 1VQ4S 1U1OA 2LEAA 1KQSR 1F9FA 4D2KA 3CTRA 1U1LA 1R8PA 1UAWA 1DHMA 5GAEU 5MLCV 2A3JA 2MXYA 4YB1P 1X4FA 4QQBA 2DH8A 2JZPA 1K8AT 2MKKA 1FO1A 2RT3A 4OZBA 1DZ5A 1HD1A 2JU6X 3FEXB 1U1NA 2RPVA 2HGNA 3CXCR 4CQ1A 3CMAS 3MXHP 2CPFA 1JMLA 3VAMA 1XF5L 2QA4S 2LHDA 1X4HA 2MQLA 1YWXA 2M7SA 1YITS 4PRFA 1IGCA 1YNTE 3ZZZA 3UE2A 2MPUA 1UW4A 5HO4A 2MZTA 2FY1A 4WFNQ 2ZJPQ 1MVKA 2AYBA 1W2BR 2EK1A 5GAGU 1IGDA 1SJ3P 4IUFA 1VC0A 3BO4A 1WI6A 2CQCA 2LXUA 5DM7Q 2ZJRQ 2RMMA 2LYVA 5JVHQ 3VAIA 2LHEA 2JRSA 1VQOS 3Q2TC 2KFYA 1UFWA 2EK6A 2QEXS 1JJ4A 1U1QA 3CMES 1N8RT 1WI8A 2JX2A 3MURP 1URNA 2KXHA 1HL6A 2VOOA 1VQ7S 2GI9A 2YH1A 4PKDB 2N3LA 4QPTA 2ERRA 3NMRA 2MQOA 2KRBA 3EGZA 3VAJA 3CULA 2X1AA 1VC6A 1K53A 5BMHA 2DGWA 3B4DA 3G8TA 4OZAA 2LA6A 2L08A 2MZRA 5LXRA 2DNKA 5LJ5Y 1SJRA 2DGQA 1VQ6S 2KHCA 2DHXA 2L41A 2EVZA 1WEXA 3P49B 2ADBA 1MHHE 2RNEA 3UCZP 2KH9A 1X0FA 2MQMA 1M5OC 2CQ4A 1YJNS 2IGDA 1X5SA 1KOHA 2OIHA 5EN1A 3MD3A 2ADCA 2CPHA 4HJGE 3TP2A 1VQ9S 2KDMA 1MPEA 3G8SA 4WH4A 1WHXA 1GB4A 5HG2A 5CXTA 1D4BA 2KM8B 1YJWS 1H2VZ 5FJ4A 1F2RC 5BMIA 2MSTA 2CPIA 2DIUA 4BS2A 1X4GA 5GMKa 1NJIT 2DHSA 3FILA 1M5KC 2KT5A 2N9KA 1KC8T 1FD6A 4KGSA 4F26A 3G4SS 1N88A 3PIPQ 3V4MA 2MGZA 4OZ1A 5DDQC 2JVOA 1F2RI 5IM0B 4TU9A 4F25A 2DNNA 2KYXA 1OPIA 4YOEA 5DDOC 3I56S 1C9FA 1Q86T 2NMQA 2DO4A 2PLPA 2OSQA 2CQ2A 1QM9A 2Q79A 2N3OA 1QVFR 1IQTA 1HZ5A 3UCGA 1H6KX 2CQDA 2RQCA 3SDEA 3CC4S 1R8HA 2G0CA 4UQTA 3TYTA 2BOPA 1JJHA 1AUDA 2J53A 1U6BA 2DHGA 3SXLA 4KGTA 3J7YU 4WKRA 2FC8A 2LECA 2K0PA 4J5OA 3U1LA 2MB0B 1G2EA 2MY7A 4FXVA 3P3DA 1U2FA 2DIVA 5D77A 3VAKA 4WCEQ 2JWUA 4WFBQ 2HVZA 1FNXH 2KXFA 2D3OR 4IOAQ
chains in the Genus database with same CATH superfamily
3FGVA 3PHWB 1NYQA 3GR1A 4C4WA 4G0NB 1FT8A 1CJTB 4Y2AA 1NO8A 3B4MA 5T8IA 3OJSA 5HJYA 2RR9A 4ICLA 4PR6A 2HNYB 2FCMA 2YX1A 1SKWA 2W8KA 3PEJA 4IG3B 1K0VA 1VQYA 1Q1KA 2GVZA 1QAIA 1UNSA 3A8JA 4U7UD 4DS4A 2CJXB 1JK9B 3QAUA 2PTLA 1NK7A 1QVGR 4Q0BB 1JLBA 4UOCA 2IVFB 3AB5A 2J7QB 4ED5A 2V0GA 3OJ4B 2M4MA 2NUHA 3MUTP 1FHTA 3QA8A 3M6XA 2BKRB 1FFUA 4KGMA 3PV1A 3IRXB 2HHHJ 3GB0A 1MMDA 4MKAA 3LP1A 2OPQA 3PIOQ 1QF6A 3UD4P 2WNMA 4GRSA 3LANA 2E1CA 3KHGA 1KFYB 4IW0A 2CVIA 1R8CA 4EFAC 3ENQA 3O13A 3SQOP 3CCJS 2EELA 3CCLS 1L4DB 3APCA 1S6QA 3MC8A 5HMYA 1I4GA 4UOGA 4NQKE 4L73A 3C15B 2IRUA 4TV3A 4UZBA 3MUMP 3DMJB 4H4OB 2FZGB 2VODA 1U6ZA 3MCOA 3HHMA 2JWZA 2JQRB 2U1AA 5IO9A 3Q8YA 2F9DA 2N4CA 2WB1D 3ENAA 4O3QA 2EXUA 3QT8A 1M1KT 4KGVB 3TQ1A 3AD7C 1PYWD 1VBZA 3M2RA 2W2QP 1CC7A 5L1LA 1L3KA 4BWMA 2QA2A 3TJ9A 2C3OA 1N48A 2HAFA 2OHDA 4IQMA 2DR5A 1SB6A 2MKCA 2RF2A 4YTMB 4YB7A 4NAWA 4C97A 4DPYA 4V19X 3PY8A 3VQIA 2AIRB 3MF5A 4DXGA 3Q8FA 4IDKA 1T7PA 3R1HA 3MR7A 2NCNA 2FHKA 1XNQF 3ECIA 1SE4A 2IY5B 4OYMA 4MSMB 1TAQA 2QL7B 1RAIB 1WKKA 1VC5A 3V3XA 2JEFA 3CCSS 1BQNB 3NVVA 3M62B 1RM6C 1FRJA 1M5HA 3X3UA 1WC1A 2EFPA 1CZPA 5EX0A 1KLGD 1YJJA 3Q3NC 5IAAC 1EQ0A 5DM6Q 4M5DA 3CJKA 4DPOA 4TMAB 5AXMA 2W82A 1WXSA 5C24A 1B0VA 1ZM3A 2CG4A 2WGSA 4KSKC 5SZTA 1ZXHA 3DRYA 4J9KA 5F8MA 3IWNC 3GPAA 4NLTA 5LJ3Y 4RFBA 4MH0E 4FS1A 4JX1C 1IKVB 4NI2A 5H8YE 3IBCB 1WGYA 2IJFA 1MG8A 1EKRA 3WCQA 4B3MJ 3GZNB 2OTJS 2CADA 2PMHA 2G4DB 1H98A 1XNRJ 1LWEB 1JWAD 2D3CA 1PGBA 3TWZA 2I8EA 4MM3B 3Q8AA 1Y00A 2ZH5A 4DR2F 3RN9C 1QSSA 4JI2J 2EKIA 2AEHA 1I7HA 4RUHA 3G96A 3M95A 2D9PA 5BMGA 1TK0A 1TL1B 1HWUA 4EYHB 2NXEA 2WSCC 5J2NA 3PHEA 1X4FA 4BZAA 3CDBA 1RISA 4HDHA 4RGTA 1T11A 2VBYA 2C3MA 5H9EJ 3BYPA 1JLCA 3QWZB 2QIFA 2PE6B 2IJ0A 4PRFA 2M7SA 2P8IA 1IGCA 1Z1ZA 2IZVB 2MZTA 2C2NA 2AYBA 1HI1A 2CZ4A 2PE9A 4YFUA 3TUIC 4NLVA 1VDVA 1FFWB 2IC3A 4H4MB 4M0WB 4KQZA 2MCNB 1I35A 1XO3A 2KFYA 5A8WA 3EECA 4DSEA 4ECYA 4LDTB 1X1MA 4ZK7M 3VZHA 2I1KA 5K8NA 2CG8A 2ZNZA 2N4DA 5LJ5Y 2QLXA 3AN1A 4PXDA 2HHUA 5KFRA 4ZVHA 2WB4A 4PG7A 5EN1A 1LNQA 4DDFA 3NS7B 2CR5A 2ZH8A 3G8SA 3ETMA 2QC3A 2LDYA 4IG0B 3GV7B 1D1UA 2G4SA 3G4SS 3LP2B 1CJKB 3KDOA 3N6NA 2YWGA 3PZ8A 3CCTA 4PG4A 1IKWB 4RW6A 2CS4A 2RPQA 3MECA 3BR9A 2Y3AA 1RWOB 4X4RA 2HFZA 3FC9A 2WS3B 2C3UA 2FC8A 1OTRB 4PCQA 2HKEA 4IKAA 4IO1A 1G2EA 1B99A 1GAQB 1LXNA 4QCLA 4BOZB 5FLXU 5HBMB 1Y5LB 5IT9U 4LFAJ 2AEMA 2NZCA 3BYTB 2UUCF 1FXIA 3IT4B 2VQFJ 4DXFA 1FKOB 2ZC4A 1QJHA 2M8HA 3ZW3A 1HWIA 4JI1F 3TARA 2V94A 1QE1B 4GMKA 1K1QA 4DPWA 5LXHA 1YDLA 4ECWA 1FCLA 1FD2A 4I6NB 2KLGA 4TY9A 3R5AA 4KHMA 4UY8T 4L75A 4DV7J 4Z7YA 1NPPA 1H3DA 4OYIA 3MPWA 2HMIB 5D6GA 1Q8BA 5LLIA 3VVTA 2KJRA 3HUIA 4DG1B 1OMSA 1Y11A 4WF9Q 4ZPTR 4GC7A 3W65A 2WXGA 3SV4A 1TZ0A 4ANUA 5KFQA 1NCLA 1MN9A 1CG2A 3U1MA 4OZ2A 1EU3A 1ACCA 3QAQA 3QAEA 2PVOD 5C2GA 4FF4A 2GX8A 1XMOF 2D3BA 3KNGA 4QIFA 2ATCB 3GFZA 4PYZA 3D0IE 2DX5B 4M94A 1KH0A 1S7IA 3IMQJ 3KK2B 1I94J 1RTZA 3JQJA 4P71A 2GMIC 2V8GA 1ZAVA 4A8XA 4WJQA 3QCAA 1WC6A 4P7IA 4HPPA 4B3TJ 3B82A 3RNCC 4ICUA 5DPWA 1ICEB 2NYHA 4OFZA 1FRMA 2MBHA 1SKRA 3M30A 2Z0EB 2V3PA 2KO1A 5J1EA 2QYCA 4ANDA 5D94A 2BJ1A 4QW9A 2WXNA 3S8SA 3RYTA 3MAHA 3G86A 1JJ2R 3VAHA 4P2SA 4Y2MA 2RE1A 1NH7A 1NK8A 4O3RA 3Q3JA 2NPTA 2VV5A 2R7SA 2NZ4A 1RE1B 2XWXA 2WDTB 2EI5A 2COLA 3EM1A 3AT1B 3M2UB 2UU9J 2NTSA 2FHOB 3PDNA 2M9KA 3GP7A 1PYSB 1BMLC 2XM3A 2ZHOA 1RLDA 3PKMA 2OPRA 4DL0C 1PO6A 3PNIA 4MH8A 5HQLA 3UO0A 3K9OB 2HNYA 2MTLA 2WDVB 4YTNB 1NI2A 2V34A 2EFOA 3AMZA 2P6TA 1KR4A 4WU2A 5AZFA 1J7AA 2MQ8A 3QIPA 4EZ6A 2D1CA 2OJRA 3C6TB 4B17A 1CC8A 1WZ3A 3QPIA 4YDXA 4JQWC 4L23A 1GTEA 3HHEA 2AHOB 1WX7A 2DRBA 3W5XA 4USUA 1A7GE 1F1BB 3LTOA 3NGDA 1TV6B 4KVGB 2ABYA 2L7RA 5KFOA 1TS4A 4J91A 1RLFA 4HYKA 4FJZA 1GQEA 2KU7A 4PG8A 1IBKF 3AB4B 4YXDB 4HHJA 3Q23A 2ZM6F 4BBNF 1BUXA 5AUKA 4KIKB 1S1XB 4XAKA 2CJKA 2L48A 3RRKA 3U02A 5EUHA 1KN6A 3OTOF 2KN5A 1HNIB 3UQSA 3CPWR 1IQZA 2NTTA 2PN6A 3QO9B 2BTEA 1O0PA 2ROEA 3C6UB 2BS2B 2LGYA 1LW2A 4MELA 4NYPA 4X4OA 3EVMA 2XMAA 4DJBA 3G6YA 1NKCA 4DFJA 4ENOA 4URGA 3ZKJC 4EWTA 4ZVPB 3QYYA 1KNZA 4A8XC 2KO3A 5JHAA 2KI2A 4OVVA 3HDSA 3H2LA 5J1EB 1RBAA 3FAHA 2YKOA 1R0BG 1KOTA 2AV5A 1X9SA 4R25A 2HQCA 3BSNA 1UAWA 2CDQA 1V3ZA 1S1TA 3DOWA 3RZFA 2MKKA 1C1CB 4OZBA 2RPVA 3IG1A 2MQLA 2HK2A 3ZZZA 4TQ0A 2ZNYA 1RWVB 4XYCA 3CF6E 3OR1B 2W9AA 1WFYA 1N60A 5DRKA 1BMQB 4B9TA 4MEMA 4DFMA 3MM8A 2H5IB 5H9EK 4DMZA 4LREA 1Q8KA 2ZZNA 5F9LA 3FZ2A 3QRQA 3FBEA 2LQ9A 3QFHA 5DQHA 3KQ4A 3RBZA 3AOAA 2D3UA 3OLBA 3UN2A 5A8KB 2NQPA 2YKMA 2FGOA 2FIUA 4ECXA 4OI6A 5IN7A 4YB5A 1YSJA 4CO1A 3H25A 2KX0A 1N5WA 2CPHA 3BWUD 1RBLA 1D9FA 5KG7A 4ETZA 5HG2A 3AXMA 3TUJC 3HHDA 3B6BA 4MJKA 4J7CA 4JI8J 3R5GA 2HNZA 3P96A 2ZVIA 4JI4F 1WRDB 1XXGA 3AV8A 4ETXA 4B6WA 4KX6B 4F3QA 2DPIA 1ZXIA 3PYDA 4A55A 2OSQA 2Q79A 2YWFA 3TYTA 2HHWA 2WXHA 4JYAF 4YHHF 2K0PA 3PS6A 1F5AA 3HX9A 4RNNA 1WNEA 1S9GA 4WCEQ 2JWUA 2IAJA 1V49A 1IBMF 4DUTA 4ID5A 4CYUB 4NY0A 2NCKL 1IBXA 3I82A 3T5HA 4DSLA 3P4QB 1P27B 4ZCIA 4JPSA 2R8JA 4M02A 4TUUA 2OP5A 1PIEA 4DBGA 2LVQA 4ZKAA 2KRRA 4JL9A 3I9V1 4WFAQ 1I4HA 4KYZA 3PJ9A 1U45A 2K6QA 1PGAA 3A3NB 3PFOA 5CABA 4NMLA 5FK9C 5BYQA 2AZ3A 3BO2A 1N5VA 1YTYA 1RUSA 4HDGA 1RAXA 4CLLA 4F2SA 4Q0BA 3KUGA 3ZIMA 3W2WA 5B0CA 3Q2AC 4NRTA 2M1MA 3NZ3A 2ZOGA 3J80Y 3N5BA 2Z8QA 2XYGB 2L8JA 2WXMA 4LMZA 2Q3PA 3QGGA 1U7LA 2FD2A 2GHWA 5DS7A 3D2WA 4F04B 1FDAA 5C42A 2YNGB 3DRRA 4RW8A 3PW5A 1WSRA 2W9BB 3VTVA 4N58A 3KTQA 3RBEA 1RAAB 4PUOB 4NXNF 1IKXA 4DL2A 4OI1A 5HVGA 4TQSA 1ZM4A 3FUYA 1TVRB 4IH7A 2J6TA 5H9FJ 2HG4A 4OHXA 3IBFB 1R4NB 3UINB 3G82A 1UL3A 4WZQA 2VPXB 1FCAA 3H0PA 4N8OA 1I94F 4RJVA 1F3FA 3NAHA 3R2DJ 4HVZA 2CPJA 4EGLA 2R3VA 2CRLA 4KPCA 2GC8A 1V5TA 3NG8A 1X7VA 1WY8A 1PFDA 2J52A 5IOIA 4CLPA 4NZLB 5HI1A 1VQLS 4ELTA 4GDLA 1GB1A 1Y3KA 3NP5A 1EP4B 4LTUA 1LW2B 2ACZB 2RRBA 1TU0B 5HSPA 4ECSA 1RYSA 3NCPA 1XERA 2CDRB 3ABVB 3DLEB 3GV8B 4ZVUB 1RFAA 1TAUA 2F9JA 3IC1A 3CC2S 1F9JA 4IR9A 3ZQ4A 3LJ3A 2I2YA 2C22A 1ZM2A 1RWSA 2IY1B 2J6UA 3M63B 4WJNA 1HFEL 3J81j 4XWWA 2LXIA 1IKYA 1FCCC 2M8DB 4Q2LA 2EC0A 2ZKTA 5JZEB 4K2XA 3SCLE 2MKYA 2DNHA 5EE3A 4I6PA 5D7GA 1FRIA 2YEPB 4XIUA 4MACA 3CJTA 1K52A 3VR1A 3D67A 3Q8PB 2FCSA 3NGUA 5F8GA 2NS1B 3KXDA 2O6VA 2K8GA 1KEKA 3ILLA 3QIDA 4J9QA 1NDPA 3B8HA 4I2QA 4GDKA 3KLGB 2LLZA 1RTIB 3ITHB 4IFVA 3R8BA 4ZYSA 2QMTA 2UXCJ 2M5YA 2UVUA 4DX8H 5HFYA 1VCTA 2UUBJ 3LGHA 1NAQA 2ALZA 3PVXA 4HJKA 1VK3A 4F8RA 2R2QA 3Q8UA 1RTJB 3GS2A 3UVJB 4I68A 2AX0A 1CBKA 2VJVA 1D3ZA 4U67Q 3I4PA 3HSJA 1PJ7A 4L2YA 2C2KB 4P52A 5G0RA 1JWBD 1Q81T 2WU2B 3DOKA 3FMWA 4URSA 4JI5J 2YEPF 3AEAB 1JXVA 2HFUA 3MM7B 2G0JA 3VGVA 1FKAF 1FESA 2QDFA 3RD2A 4HCPB 1U26A 4OJ1A 2B51A 1RWUA 4ED4A 3DM2A 2CQGA 3TVKA 1WKJA 2R2TA 1KTQA 1U1MA 3Q83A 4L3KA 1HNWJ 3PPAA 1IP9A 2I6WA 4C56C 3JSBA 1HZ6A 1WZ0A 4LNKA 1U1OA 5AE1A 1TKXA 3NVYA 4F4ZA 1D5XC 2INNE 1SF0A 2W9CA 5A76A 1KLMB 1ROFA 4B95A 4EBDA 1DZ5A 3HSZA 1UZDA 1K8RB 2ROGA 3UE2A 3KK2A 4ZIWA 1EZZB 1RT5B 3JYTB 4B9LA 2FZKB 2LVWA 3L95X 3TOQA 1EP4A 4DSKA 2C7NB 1VLBA 1F77A 3GQCA 3TZYA 4ZRIA 1MROA 2E7VA 4K3CA 1VQOS 1C4AA 3LP2A 1D6EC 1WJ9A 2Z4PA 3DI6B 2ERRA 3CWJA 3DRSA 3R7QA 3TAMA 2C2DA 2D3AA 2V6AA 4TKNA 3B4DA 3M4XA 3T9ZA 3VUWA 1RT4B 2KHCA 2DT9A 3IP0A 2Y1RI 4Z37A 5A8RA 1N6QB 4TKTA 3IAS9 4HK2A 1YJWS 1V5OA 3ZFVA 1B4SA 2KZMA 1R4NI 2NSCA 2V8DA 1F2RC 4K81A 2DRDA 1D5ZC 3ZNHB 2ZBPA 2PIAA 3BQ0A 4K7WA 1Q53A 5H92C 2ACMA 1OYEA 1HHQA 1UJ4A 5HI7A 1AYEA 1DARA 2E1AA 4H4OA 4MM3A 3UCGA 3I57A 1TS5A 1Q1OA 2LGDA 3MR6A 2G45B 3HSGA 3DGPA 2QE5A 1LOUA 2LECA 2EKYA 2D3ZA 1PJ5A 5LMNJ 3ZLZA 3ZTRA 3H1UA 1M1GA 2VPWB 1IYFA 5A2QU 5FIIA 4UDUC 4PWWA 3PZ7A 3PRVA 3DLKB 4MKVA 1DAXA 2DNQA 3MMJA 2PEAA 3RBDA 3DLKA 1CMXB 2X8XX 3ZZOA 3EUNA 1HW8A 2NXJA 4F4YA 2INCC 3GFYA 2CNNB 2W9NA 1KTVA 4IM2A 5BXIA 1H0HB 4C80A 1ZP0B 3L9ZA 4HL9A 4YT0B 1UGJA 3K0JA 4WJBA 3AQPA 8RUCA 4E71A 4NCGA 1LWCA 2W2PP 2WVCA 1N0UA 1VMBA 4R0JA 3DLBA 2GA7A 3KK1B 3QIPB 1OQ6A 2IFXA 4X4SA 2AMCB 3V6DA 3UIPB 3PR5B 1UD7A 2YNGA 3MP9A 3W2VB 4TU8A 3I0RB 2FLNA 3MMBA 4HTJA 2B4VA 3GIRA 4RNHA 1H7XA 4ECTA 5KFAA 4USWA 3CJ5A 1B70B 2N9LA 4ED7A 4TVAB 3N01A 1M5PC 4WWOA 1JXEA 2KG1A 5KG4A 4B3MF 3TA0A 5B0DA 2X51A 2C28A 2ZDOA 1ZA2B 2B4OA 1SV5B 3P45B 3EVOA 3F0NA 5KFMA 2V2KA 3K5NA 3CCVS 2XEXA 3ZTOA 4BFRA 3TJ8A 3DOLB 1K0TA 2KQ7A 2YLMA 1D0EA 4WP8A 3OHBA 3EXYA 1H2TZ 4I0WA 2DZMA 1BY9A 1PGXA 1MWQA 5EE1A 4E3CA 1G3OA 2IO1B 3T19A 2J0JA 1UP1A 3AHPA 2VIHA 4R5PA 3HSDA 4HR2A 2BE2A 4F7ZA 5HVHA 4A20A 1HQRD 2OFGX 4V19J 1X5PA 1SPBP 4A4JA 4MK8A 3O44A 3NOGA 2ZNVB 4C6AA 2GBMA 1C79A 3B9JA 3NMAA 2DYAA 3RB6A 2I1RA 4AD6A 2OKQA 5HP1B 1WXAA 3NOBA 3AU5A 2KK8A 4EO6A 3TA2A 2Z58B 4WBFA 4Y6IA 2GRIA 1S0NA 2BVZA 3QFWA 5D3IB 2RQMA 3MHSD 3PYGA 3F44A 1RT3A 2IAJB 5CH7B 1WYGA 1P1LA 3CO0P 3NHEB 2KN4A 5KHOA 1VQSA 4DQIA 5G5GA 2KTQA 1NB7A 4KFBA 3HHNB 2SAKA 1J19A 2MBEA 3H5XA 3U1NA 4TNOA 4TYAA 2HHQA 5DJBA 4P16A 4P7TA 1WD6A 3K59A 2V4QA 4FULA 4I6WA 5HROB 1VRUA 4DHVA 1TTHB 2HGLA 5JJBA 2SXLA 4XPCA 2OTLS 1UJ5A 6FDRA 2DENB 3R1LA 2LRWA 1FA0A 2F8EX 1WJ4A 2H88B 3IWLA 4OX7A 1KQGB 2IYDB 2ZW1A 3OXFA 4IG0A 2LGXA 3W7BA 4ES1A 4C11B 4MGYE 2FPHX 4C2MA 3BV8A 2M70A 3GIIA 1V9OA 3IXSA 3EMTA 3GCWP 3O65B 2AYGA 3ICLA 3JAMU 4O3OA 5K14A 1PUTA 1VRTB 1HXYD 4EFOA 3U7ZA 4XK8C 4K7QA 5K20B 3DBHB 4ITKA 4JUZA 1T3QA 2RQKA 4E2FB 4C0OC 3HK0A 4C98A 3RNGC 2LA4A 4Q2MA 3IS9A 1N54B 1WJ6A 1MG7A 4MKBA 2ZDPA 2E5IA 1Z2LA 1WHVA 3Q8SB 3IS9B 3ZNUA 4GKJF 3MM5A 2EKEC 1Q95G 4F3MA 4ZP9A 3FK4A 3Q3OC 1UVLA 1RGVA 1UWBB 1TL3B 4NX9A 4BBYA 2WOMA 1GX6A 2LXCA 3LXFA 2WAQD 4Y34A 1PC4A 4LRFA 1T94A 2LFVA 3OVAA 2IO0B 5E41A 1W2BR 4FPIA 4DR4J 1HPZA 2DYOA 1A5RA 4WAAA 3UGBB 5A2QY 2VICA 4NI2B 4KJIA 1FNOA 1ZGUB 4NLXA 3RR8A 2QSWA 1F2GA 1Y5IB 2BACA 4JI8F 1ET9A 5E3AA 4NLQA 1WI0A 2JX2A 3W63A 2D69A 4URKA 4B3SJ 3KJNB 3NMRA 3A8KA 3UN5A 2BQQA 2KT3A 5C25A 1J0GA 4YN3B 3MMCA 2Y1JA 3HF5A 1XR7A 2DAJA 1JLBB 4B3OA 1NRKA 3QRRA 1EKSA 2KH9A 3BYYB 1YJNS 1P6TA 3CT9A 3OL9A 2ZHBA 4TLRA 3SFEB 2HFVA 3OSNA 5D15A 5HQMA 3Q8RB 2MX2A 2O5DA 4AUQC 2UXBJ 4DR3J 3N1ZC 2KT5A 3VTWA 4FXDA 4FF2A 1Q0WB 4ZPDA 5E7OB 2DR8A 1N5YB 2IDEA 1TV6A 4HT5A 2QN6B 2DBYA 2RQCA 4DG1A 1YGYA 9RUBA 4CWBA 4KGTA 4KR0B 2FE8A 3DU6A 4GVLA 4A3OA 1BWEA 1QD1A 3DLGA 2AU0A 4RU9A 4D3HA 2I5JB 5CYQB 2X38A 3VAKA 1VK8A 4GOCA 4QR2A 4QWBA 4QYRA 2Q6BA 3M2VA 4JE3B 4IOAQ 4LF2A 4OI2A 2WDQB 4I2PA 3MPVA 3T1HF 2J7WA 2LMIA 2OD6A 1TJEA 3QJPA 2HURA 2KDOA 3LH2S 3MI7X 3QLHA 3I5JC 1WX9A 1IBXB 3M6UA 2Y5CA 1YQ3B 3ZC4A 2XZDB 4ED2A 2KHDA 1D9AA 2GJFA 5L9NA 2YX4A 2LKZA 1XWLA 3I3TB 2YPYA 4UUXA 2IVYA 3W60A 4CIOA 2K7KA 1YJRA 3CD7A 3AA9A 3VGUA 3I31A 2RQ4A 3VV2B 4DX6A 5F8NA 2JOQA 1JWMD 3MMAA 2GMLA 3CVKA 3DLHA 1QKZA 4WPAA 1WR1A 3AEFB 2MKSA 4ZLNA 2DH9A 3KWLA 1UBQA 1DQ8A 1NJWA 2J0QD 4E74A 3M30B 2VJUA 2MKIA 5M2RA 2LEBA 1KJTA 1UWAA 2J4XA 4NAMA 4MJSA 3OVBA 4EE2A 5JXVA 2BOAA 3R5CA 1EF1A 4K4ZA 1RB0A 1P7EA 1YBAA 2Q6CA 1Q5WB 1TL7B 2KFKB 1WF2A 1N56A 4S17A 3DVGY 2N4FA 1HBUA 5GVQA 2H9ZA 2C9WB 4WYWA 4REZA 3CNQP 4FNIA 3KHLA 2P2CB 2QSDA 2E6XA 1MI0A 3HHLC 4CI0B 3Q8QB 4G3IA 3DVNV 4U8VA 4WQOB 2L32A 4ERDA 2HTME 3Q69A 4ZDNA 1JLAA 5KG5A 3GIKA 4W9HA 4OW0A 1IN0A 3NWRA 3ILJA 1I4RA 4FYXB 5L95C 4LJMA 3MOZA 1IJFB 2MHNA 1I4PA 1PGZA 2JDJA 4O4GB 1N34F 1LXJA 2C60A 4F7VA 3JAMY 2MYFA 1DFDA 4Y0FA 3RB4A 1SIJA 3G8QA 3HXMA 4DSIA 1Q4RA 4B3RJ 3FKYA 1QE1A 3HVRA 2O67A 1VOMA 5LL6d 1N5QA 1QOGA 1UEKA 4IC7B 3M9OB 2OD4A 3Q8EA 1N62A 4ARCA 5HBMA 3OWEB 4RGNA 3Q22A 2EMSA 2YPZA 2AKWB 2FVCA 1WJUA 3MTNB 2C2RA 1Y9OA 3DHIC 3ZTDA 2XNRA 3SQGB 3T1YF 4ZHRB 2NXUA 3O5TB 4W9EA 2M56B 2N9XA 2GS8A 1QTNB 4P1CC 4DV3J 1HBOB 2R7UA 5HAOA 3H5YA 2Y8WA 2BF8B 4A8WA 2WBRA 4ZJQA 3IN5A 1ZTWA 5CX3A 2PO4A 4CH0S 4EZJA 3HO1A 1UW9A 4ICLB 2N1WA 5A8WB 2PE8A 3CD0A 3FEYB 1PBUA 1SKSA 1YBTA 2Y0SD 2M2BA 2OJ3A 2RSQA 4DQRA 1N4LA 2C2MB 1U0SA 4K4XA 4I1TA 5B0BA 2FHJD 4FVCA 3D7SB 2Z56B 2ACYA 3H7PA 3IT6B 2RDHA 3ZXVA 4DXAB 2Z2ZA 2F40A 3VXWA 1R7IA 2YWEA 4ZS6A 2D11A 5HK4A 3ADAC 1JRUA 7FD1A 2DD8S 3N3KB 3E56A 3AOBA 4DU8A 2GVDB 4M0WA 5KT2A 2CJNA 2GV1A 2LRUA 4ZJOA 2CQBA 4F3OA 2LQJA 5CAAA 4CO5A 2JEJA 1B9RA 3KUCB 3W1SC 5U47A 1B1ZA 4HI1A 3QT5A 3MXHP 2XCAA 5FD1A 2WVEA 1S9EB 4JGHB 5F0UA 1TS2A 2NPTB 1Z5SB 1DTTB 2IYIA 1KHVA 5CCLA 3AE7B 2EK1A 1KWMA 2XC9A 2IDLA 2XWYA 5C2TB 3TX0A 3QJZA 2VZKD 3PRDA 3GLJA 3H9DA 1RXOB 3SD5A 2QEXS 2IO2B 1ZA1B 2GHVC 4KH1B 3MAQA 2ZKUA 1NNDA 1YJIA 4DR6F 3BBCA 3B2FA 3W5UB 1V3SA 1QSLA 5DGAA 3V61A 1U47A 4CLFA 2DHXA 3P49B 3HVDA 3HT0A 4I67A 3VDZA 2MQMA 3QT7A 1S6PB 1XQQA 1ZKHA 2OEJA 3Q8CA 3DNCA 2ILZA 2V63A 3QNWB 2KYZA 2QA4G 3R5JB 4WH4A 3FMBA 2CZVC 1TKXB 5I4MA 3GONA 3FBCA 3BR8A 1YX5B 5BMIA 2MSTA 3CDUA 5KFKA 2GAGC 1GNUA 3DRXA 3DOMA 5AJ3J 1RT6A 5GAGI 4NOHA 1FD6A 2GNKA 4I2PB 1F2RI 4KRWA 2V2VA 4USJC 2CJAA 3W9CB 3ZRCA 4KKJA 4LR8A 3Q24A 2G0CA 2JYTA 2DAFA 1JJHA 2HDEA 4BAXA 2DHGA 3SEBA 4LT6A 4WKRA 3BBFA 4LF8F 1VJKA 4OZJA 2B56A 2JEIA 1CJEA 1RDRA 3AI5A 3NOCA 1NBEB 2QGFB 2B9YA 5ETPA 3T6BA 1RWWB 2R2UA 3HP6A 4JI5F 4J6IA 3R66C 2NBVB 3WX4A 3B0AA 4DCOB 2CQ1A 1YN4A 2XTJP 1S76D 1GOZA 2C3YA 4IOCQ 4IDKB 5KOWA 2XY5A 5HJXA 2QC8A 5KFNA 3GFHA 2V8PA 4L72B 1T9VA 4EUTA 1MMLA 3GZNI 1UKUA 3JSVA 4II2B 3LPYA 3KK3B 1NK0A 4AT1B 4PG5A 3HHLB 2CQ3A 3JYUA 2BA9A 3IR5B 1QSYA 3KLHA 2F4VJ 5C25B 4DOZA 4IH6A 2W2MP 3EX7B 5J2NB 2ZD1A 2H51B 4KKOA 3U27A 1J5OA 4O3NA 1PYOB 3HM6X 4IWOA 5IT9Y 4W9CA 3ETOA 2F8HA 3PACA 2POKA 1RHJB 4DPUA 3AJ1A 3NAIA 2AQ1B 3BN7A 2E5GA 1WTFA 4RZRA 5T14A 3RZWC 4NMXA 4CT8A 4QIWD 3UD3P 5A8RB 2N7EA 2V68A 2XNQA 1RT5A 3OPKA 1JWUD 3NKYA 5C5JA 4HLEA 4YSXB 2E1RA 2GLSA 1I42A 2QFIA 4RL1A 5K8PA 1GEHA 1NPKA 5IA7A 3ZVVA 2G9HD 1ZS6A 4EO8A 3ONQA 1QILA 3R5BA 5K5MA 3CW2C 4JYAJ 3EICA 4MKYA 3DRSB 2MSSA 3DYAA 2KNBA 4RX6A 2J0MA 2MKJA 4LF5F 1QTMA 2BS3B 3PVLA 3RCZA 4EU0A 4K4UA 3IG3A 1WORA 1NJXA 4JI4J 3VH4B 4YL8A 2VFSA 5JVGQ 2CPDA 4RUCA 1VQMS 4N8NA 1LFWA 4DR5F 1PCAA 2KDBA 3TZWA 1K9MT 3SQGA 3C3LA 2ZNVC 3PW0A 3RUBL 2K6DB 1WWHA 3OD2A 3DRRB 4RW8B 3PREA 2DLBA 4GB9A 4F02A 3R7SB 5TR5A 4F0MA 2VG7A 4CTAA 4CH7A 2N82B 4MYTA 1VQ5S 1FRRA 4NLSA 5HMWA 4WAFA 1P3QU 5IC4B 2HHVA 4RNMA 2FNJB 4FF1A 3D9BA 1TKYA 3E2EA 2BQ3A 1E5WA 1M4VA 4P72A 2Z30B 3ZZYA 4RUAA 2ZZPB 4K4TA 1DOXA 3DI6A 3FFIB 4L76A 3CCZA 4M1KA 4ZLPA 1RHUB 1PG5B 4F0HA 3ZZTA 2F3JA 4QPXA 3BDPA 3CJ0A 2VOPA 3TZZA 1U1RA 1MSWD 3JSMB 2HIYA 3VF0B 1XNRF 3WZ0A 4W9GA 3PRBA 5KFXA 2E66A 2F4VF 5IWAF 3NNHA 1SIFA 1F60B 2KWCA 3K17A 1T03A 2XGPA 2MHJA 5CYMB 3QARA 3QZ7A 4X4NA 1B0TA 1FXAA 4YR0A 1NMEB 3UDLA 5ETMA 4DZ6A 4DQQA 4PS3A 1JLQA 2SEBD 4FXCA 5LSRA 1MHXA 1FMAD 3MFIA 2B3TB 3H2VE 2R8KA 4QZVB 2W4DA 2YNHA 5J18A 2R7RA 1CQNA 5ETVA 2L3ZA 1NBFC 2WX0A 2Y1IA 5ETKA 1S0OA 4W9LA 2LQBA 3DHHC 2G2YA 5L39A 2HFSA 3N6MA 3FZBA 3LPEA 1VQ4S 1BGXT 2LEAA 4KSEB 3QT6A 4RW4A 3Q14C 2KJWA 1J7CA 3BK1A 4U7CA 2RT3A 4EYIB 1SSNA 2V50A 3R2CJ 4CQ1A 1RLCL 5KHQA 2LHDA 2V4IB 4IFYB 4DUYJ 3WQPA 1F52A 5HO4A 1XC9A 2FY1A 4LSZB 1S77D 4BWJA 2A6OA 1G6JA 4HEA9 5F8LA 3VQSA 3PYFA 4XPEA 1MNEA 1XNQJ 4JI7J 4GO7X 4ZVEA 3FRYA 5JVHQ 1BE4A 1Z4UA 2R8GA 1HNWF 2A0FB 2QHOA 2Z2YB 3AU4A 1VQ7S 2GMHA 1CJVA 3U7JA 2X7IA 3AEEB 2WVFA 3KK1A 4I6YA 3W9IA 2MRPA 2GAHC 3KLHB 2XY7A 5AT1B 3T3FA 1N5SA 2HQDA 4QYZJ 5F8IA 2ZHAA 2WWZA 5K14B 1DQAA 1V86A 1QT9A 1VYAA 1YJ1A 2KDEB 1EO6A 4KGZB 1WIAA 4WQMA 1C1BA 4OI4A 2IO3B 2KKCA 1S49A 2DHSA 4F26A 2QMUB 3DGVA 1S1WA 1RTDB 1E7PB 2JVOA 3I0SA 2DPJA 2ROPA 2RUSA 3J7AN 1D5MC 1AA1B 3WA0A 4LBPA 5HROA 2A4ZA 3SDEA 1LXDA 4F4KA 4UQTA 2XGQA 1EIYB 2VA3A 1TVRA 2GBNA 1XLPA 1I6JA 4DK5A 2R9LA 2BGFA 2ZZTA 3KLEB 3TAQA 4NYOA 4Q44A 2HNDA 4LVNP 1V97A 3SR6A 1KLMA 2HVZA 3RNFC 3MM5B 3KUEA 2FTRA 3CEDA 5A0YA 2DNZA 2YTCA 3TSSA 2QT7A 2BWES 2RU9A 4W98A 1E6EB 3GE9A 3N9UC 3N6LA 1KVKA 3CSTA 1Y7PA 4RWXA 2XYPB 3EFCA 2IMWP 2UU7A 4NJ7A 1EUVB 1FJCA 3C66A 4NLOA 4X4VA 3R97A 3HFZB 4EZ9A 2V2ZA 3Q3FA 3LQVA 2WXFA 2LGIA 1V6HA 4C3MA 5GADI 1Q78A 2L83A 1AWDA 1OFFA 3Q2SC 3PW7A 2J8AA 3KFWX 2G0IA 2WCXA 2DO0A 3HVWA 1TL1A 5F3TA 4CRJA 2MDAA 3SSRA 4DV0F 5C3JB 4LIRA 1JJCB 2KXJA 3BKTA 2GIRA 5CD4A 2WU5B 1ZM9A 4DR1F 1P9DU 1S9GB 4EEWA 4FPRA 2NXCA 3R7BB 3R6LB 1FEEA 3BGOP 3FBFA 3OR1A 4LF6F 2D10A 3W5VB 2DXEA 2QJ3A 3EZUA 4Q8FA 3NVWA 4ECUA 1TR0A 1WM2A 3JXOA 3PW4A 1N6ZA 1FIQA 2OJWA 3PFEA 4YSZB 4RNAA 4OYAA 3NNAA 1CVJA 4ILMA 1MU2A 3A8IA 4M5LA 2D41A 3AA8A 2MKHA 3M8PA 2KZRA 1FX4A 3I32A 1IR1A 1E90A 4CDIA 1U6FA 4RW9A 1VLYA 3W2VA 2JWNA 2YKNB 5LSOA 4OI3A 3A3PB 1K50A 3PR4A 2M4NA 2UXDF 2AJ4A 1SJFA 1T0SC 5KFDA 2AZ1A 5IV4A 3OQ2A 2GBKA 1WDDA 2GQQA 5IP4D 5D3DA 2LQ8A 3MJWA 3WX8A 1Q7YT 2ASQA 2G1HA 3PO0A 4W90B 1LQ9A 1FERA 1SL0A 1S0MA 3UI3A 2XSFA 4F0KA 1BHNA 4B3SF 1URRA 2HIQA 2IVMA 3DOLA 1J5OB 4ZRQA 2ZD1B 3CUNA 2G13A 4ILLA 1D3WA 3FBBA 5C2CA 3KOAA 4RW7B 3SMZA 4KGRA 3IWXA 2JSXA 4WP9A 4ELVA 4K5RA 5G0RB 1WE6A 2BV3A 4L1BA 1ENFA 2ZWOA 4AWJA 3QK0A 2VDIA 4PYAA 2ZOMA 5T7LB 2JX5A 3W64A 2OEDA 3E3XA 3RJMB 1VIOA 2XLKA 2XZTB 2BJ9A 2EC2A 2OPSA 3BEGB 2GVDA 3KLSX 3ML9A 4FBJB 3OVSA 1RYJA 2V0NA 4GKKJ 4N76A 3D1QA 1FE4A 3UDCA 2VHGA 2W7AA 4DSJA 3A3OB 1P7FA 3H42A 1YMHE 4N77A 1UVIA 4U9RA 2VPZB 2CXEA 4DR2J 1DLOB 2HAIA 3HHLA 2W24A 3J7YI 3KLIA 3M8WA 4ZPCA 1WWTA 3S01A 3JSRA 3AECB 4LRCA 4I6AA 1RT1B 1WACA 2HPUA 4KIAA 4NXMF 3QSIA 3D4JA 4NXNJ 2B0GA 3C8YA 4NZ6A 4FYYB 2H89B 1WTBA 1QOFA 4QWAA 4YEAA 3M9NB 4FS2A 3ZYYX 3MEDA 3VUXA 3CJ8A 3EPIA 4FLHA 3OUYB 5KFPA 4W9IA 3FEXB 2RKIB 2ZH3A 3CMAS 4OMFG 1X4HA 1DLOA 3UFCX 1GC7A 4NQLB 3D68A 3BY4B 3SCIE 5GAGU 2K3UA 4A9AA 3RNBC 3IBEA 4PYDA 1E7VA 1XT9B 1D9DA 3L4BC 3AEGB 3BH7B 2CQCA 2BJ7A 2IM1A 3A4TA 3TJPA 2KC1A 2RMMA 2HHHF 3G87A 1UUPA 1JJ4A 2MQJA 1HL6A 1SVDA 2WTFA 1HHSA 2DCUB 2OELA 4MGKE 4HACA 3KLIB 3MC9A 3RRGA 2LGSA 4NEZA 2KWVB 2N0SB 2JLFA 7FDRA 4DZDA 1FDDA 4JLCA 3HFVA 3K9PB 4NLPA 5KT7A 1IKXB 2BANB 1HBMB 2IGDA 1SBRA 2L0FA 1UPMB 3PLUA 3GMGA 2F65A 2UUAF 2ZBCA 1SCJB 2QYGA 4LBIA 1TY2A 1X4GA 1NJIT 4M8MA 2V9WA 1FKOA 2OMOA 3RYLA 3R7RA 1DJ0A 1Z2MA 2B4PA 1Q5YA 2DNNA 1OPIA 5DDOC 1IUJA 2NMQA 3DXSX 3NBPA 1UMJA 1X0PA 2Q5WD 4YS2A 4NAWB 1SE9A 3DQVA 3KKFA 3SXLA 3M2UA 4BLGA 5I4DA 3JW0X 2MW5A 1UZHA 2HZVA 4OYZA 4GSWA 1KONA 5CZVA 3BB5A 1RFKA 2DR7A 4OZ3A 3EDRB 2BE9B 2KXFA 4KGKA 5AE3A 1TZOA 3CCQS 3J81U 2FIDA 4ARIA 2VBWA 1FNVA 2ALYB 1WXVA 3PXGa 2JC1A 1SUQA 3UDEA 1JQ4A 4G1QB 3GR0A 1WG1A 3CJ2A 5RUBA 4F2RA 3JYTA 2VFRA 3IAM1 1R8BA 4DPTA 3CCES 1NENB 1W26A 2CQHA 2L76A 2ZC3A 1OS5A 2CWKA 4OZLA 3OFEA 1QLBB 3C6UA 5DLFA 2IM3A 4TU7A 4K8RA 2VBXA 4P2XA 3B2GA 1WC0A 2CYYA 5DQGA 4KPYA 3SDEB 3MMCB 1FRLA 1LWFA 2IRXA 3G71S 2ZH9A 2HWIA 4LF1A 2EWHA 3V81A 1RAEB 4K5SA 2BB5A 3WANA 2F1FA 1YVFA 4NLDA 2OI2A 2JZ5A 4C4VB 4LQ3A 4USHA 2PI4A 2IPOB 4DLEA 4ZVTB 4KV2A 5IQQA 2I5JA 5CYQA 4O3SA 1FNWA 1RHRB 3JVZX 4GKKF 3HFKA 1KSPA 2I1JA 4WK1A 3VZIA 2Z0DB 2WQYB 2O6VB 3AAWB 2W54A 4C8MA 4HACB 2PEBA 2UP1A 3MGJA 2W3RA 1K47A 3US5A 3UVJA 3N32A 1FK9A 1R0CB 1ZAXA 3A8EA 4DDGD 3POTA 2L0TA 2U2FA 2PW9A 3R3MA 4F36A 2W4CA 4ED0A 2V1YA 1Y5NB 4YB6A 1SXTA 1JLEA 4ZHPA 3GG1A 1HKAA 2DNGA 2MZ1A 2FY8A 4MT5A 2KANA 4P9SA 4PWDA 2Z57B 5FR6A 5KFTA 4KV8A 2VL1A 4NCAA 1H72C 2WK4A 5DPSA 2Y8YA 1UBIA 1X4CA 1S1XA 3G6XA 1XMQJ 1NHVA 2DB1A 3J7Z5 5IM0A 4C8OA 1M90T 2RSUA 1DBDA 2WRMA 3V2UC 2KDFB 4JBCA 4OV1A 4NPNA 4IQXA 3FVYA 1EM7A 4PZVA 4RR5A 4ED1A 4H2AA 1O5JA 2JRHA 4KB7A 3TI0A 4A6QA 1WRIA 5ITHA 4MIWA 1AYFA 3TUOA 1RCOB 2RS8A 2XMKA 2QIEB 1KKHA 1SQGA 3N9YC 2KJVA 4O1NA 1S10A 4ZHRA 4QWCA 1REVA 1R4MI 3MEEB 4KDLB 1IR0A 3PLVA 3JTOA 2DK2A 3AE9B 1QQRA 5C42B 4HCNB 1IXKA 3TCAA 2W3SA 1IBMJ 3IR6B 2NVUI 5D0GA 4ITSA 3W9JA 4KH0B 2VFVA 2KLCA 4Q45A 1TKGA 3LA0A 3L7OA 2ZCCA 1FFSB 5CQGA 5J1NA 5B7WA 1SC1B 1DOYA 3OW2R 1FXDA 1W2IA 1U49A 1F0ZA 3VTUA 2VASA 1RAOA 3M9MB 2MQNA 5FDLA 2BKFA 4OX8A 2DYMA 4YTPB 2YNFA 1UTAA 4J9OA 1J27A 2XMTA 3AE5B 5B0AA 5KFUA 1VR6A 3MEKA 2Y5PA 2JJ4D 4IO9Q 1OEYJ 2XB2D 3OR2A 2MQQA 1PAEX 2CQ0A 2KFJA 5I3PA 3ZZRA 3TW0A 3J7A1 4ZVOB 4CTAB 3AEDB 5KFVA 1BUIC 4U8YA 2R42A 1S57A 1KQSR 4PPDA 1JIHA 3CTRA 3M32B 4FKXA 3TEZA 1IBLF 1VZ6A 2ZUAA 4QQBA 3CD5A 2VD3A 3DDNA 3ZUNA 4FNHA 1TKZA 1P98A 1XF5L 3EVWA 3M8YA 4Q8EA 2FJXA 4F4WA 4P10A 1SIZA 2OEKA 1SV5A 3DBLB 2MPUA 4FKYA 4DQPA 5B0FA 2J0XA 2X3GA 1OQQA 5KT6A 1VZ7A 4CLKA 4IUFA 3BO4A 1WI6A 3H59A 1TT5B 2RGFA 2V4RA 2PSZA 3VAIA 2ZH1A 5HKHA 3PSEB 1S59A 4BDPA 1T9WA 1UVNA 4CO3A 3CMES 4WE1B 4DBQA 3MURP 4ZYNA 2ZEQA 5J1PA 2X1AA 2GJIA 4FA6A 4AJWA 2JRIB 3DLEA 5I3UA 4O4RA 4C48A 4WXWA 4JV5J 1WEXA 5FR3A 1B0PA 2WVBA 1MHHE 3UCZP 1TL3A 1RWNB 4C7ZA 4HDQA 2ZVNA 1I4QA 2APOA 3BGRB 4LFCF 3TP2A 3KWVA 1YBUA 3LALA 2K1RA 2Q66A 5E3CA 2LDIA 2BJ3A 5KOXA 2BX6A 1N36J 2YY3A 3ENVA 1V3RA 3C2PA 3CIZA 2XN9C 1KC8T 3PIPQ 5E6PA 4UOFA 2MGZA 1GXUA 3LYYA 3ZZUA 3WAOA 4X2BA 2ASYA 4KKOB 4LRAA 1VCBA 1IQTA 4FP9A 2K8BA 3DHXA 1H6KX 3IR7B 5FLXY 1PDXA 2J9DE 4U96A 4OZ5A 3ZTCA 4DR1J 4J9RA 2V67A 2FJAB 3RI7C 3BZDB 5D4NA 5DZ6A 4FBTA 2J9DA 5DCNA 4MGIE 3EUB2 3K8WA 2FUG9 2GIQA 1HYSA 3OBIA 5CCMA 4HKQA 5KG6A 2NBUA 5EWFA 1RWMB 3A4RA 2J76E 4OZ0A 5I42B 1Q10A 4JIOU 4EZLA 2V4JA 1NXIA 4U6PA 4GO5X 2V4JB 4IWPA 2RDIA 4PAAA 4DF8A 1E0ZA 1HW9A 5HN0A 1HTOA 1XLOA 2KXNB 4DL6A 1PYTA 3OUYA 3WAMA 4C0BA 5BO4B 4I7FB 3I87A 1FRDA 1LK7A 3CWIA 3QBCA 1BWVA 1HMVA 2G4BA 3K2YA 3FILB 2Q43A 2XMWA 3A12A 2N1VA 2GW8A 1SH0A 2BYTA 1RT1A 2W1BA 4LFBJ 4UF4A 1UPPA 3SV3A 2AJFE 3RAXA 3TA1A 3VAGA 4KHRA 1VS3A 2L00B 2LXFA 4ID8A 3AH7A 1UWMA 4TQ1A 2VQEJ 3O8WA 2JZ3B 4CYEA 3VVUA 3BSAA 3CCRS 4LF7J 1N5TA 5BJRA 3C19A 2DNLA 4S0MA 1HD0A 3RULA 1GMUA 1FM0D 3ZZPA 2HVDA 2DNMA 1EWCA 2KJ6A 4FHJA 1WH3A 2IM0A 4AJYB 2FBWB 2B6AB 2BKPA 2KVQE 1NLKL 3GJRB 5KFLA 4US8A 4ES3A 3H8YA 2RIJA 1KDNA 4IH5A 5E3PA 5EGYA 2JEGA 1HWLA 4MDKE 3A33B 2R7WA 3T1AA 2DRAA 1JLFB 3BGUA 1FVQA 4RBTA 3W5ZA 3TNVA 3MD1A 3QGHA 3VALA 1JWWA 1HNXF 3HULA 4ZVGA 1Q8LA 4DFKA 3R7NB 1DY3A 4LR7A 1QUVA 1DOIA 2KT2A 3ZRFA 3EC8A 3AEBB 2MY8A 1X5OA 4MFBB 2IIHA 2IJNA 1BQNA 3U4EG 3J7ZT 2K8HA 2XSJA 5J2QB 2DHHA 2W01A 1PJ6A 1MG4A 1UEUA 2VFUA 3LDZE 3OR2B 1YQ4B 3L7PA 1CULB 5LSLA 3MMAB 1Y8RC 1WM3A 1T9YA 2KJHB 2K8CA 3X0WA 1I5OB 3BVMA 5J2MA 4K4YA 2CJQA 4DQOC 1TKZB 1ZZNA 4DDID 3HCXA 2XG8A 1PBAA 3LP0B 4QAYA 4JV1A 1JRPA 1WHYA 3BM7A 3DU5A 3MECB 2X1BA 2IPKD 1T9UA 2XK5B 4MJSB 3CF5Q 4RW9B 3K5LA 5D8HB 1XIQA 1NU4A 5GMDA 3T5KA 4DV3F 2C2EA 1XCQL 1RT6B 1RAJA 2WXOA 3BSCA 4M5KA 2XNAC 3GTYX 3W2DA 2KT7A 4Y2CA 2E5HA 4AXJA 3S7RA 3U52E 5DETA 1UGMA 3EYZA 5KAKA 2E5LJ 2K2PA 4YR2A 4ECVA 3IA0A 1QUPA 1MFWA 4BKTA 4WWSA 4ANCA 3GG0A 3PRPB 3UR0A 2O6VD 4L6V3 2UVWA 3CE8A 1JX4A 3T9LA 1H2UX 4EMDA 1VRAB 1RK8A 4ANVA 1LQBA 3EFUA 4A8OA 2CQIA 3K58A 3SFDB 1AROP 1SQFA 4J9NA 2HQ3A 1IJEB 2VBZA 1JKHB 3KJFB 1VZ8A 2CA9A 3A9JA 1NJZA 2ZJDA 2HJ8A 5GAEU 1WC3A 1YJ7A 2DEIA 2IDYA 2JU6X 5D0HA 2HGNA 1V8CA 4QWDA 3NZSA 1YITS 3SDLC 2QG9B 3W1YA 3OLMD 1FRKA 1HWJA 1RU1A 3NZUA 1H73A 4IM3A 3WHIA 1V5IB 4BVUC 2F5GA 2AJQA 3UPFA 3PZDA 1MN7A 5KFBA 4HRSA 1HYSB 4LK0M 3ZGZA 3KH0A 1RWKB 1X9MA 1WI8A 2CNLB 3RNAC 3GJSB 1S3SG 4QPTA 4A8FA 1TFWA 3S1TA 1KRHA 1E6VB 3CDEA 3VAJA 2BQRA 3CULA 2KAJA 4HLBA 2XQCA 5KFFA 3PCOB 2FJDB 4M5HA 4PWDB 4IOBA 1NYRA 1T02A 2VC1A 3QC8B 2ADBA 3KJVB 1S6QB 2H65B 1CQMA 5I3UB 3KLFA 1TL7A 1KVJA 4HJGE 4X65J 5L83A 3MEDB 2JUOA 5CXTA 3AJDA 2QZ8A 2VPYB 3C16A 4IRCA 4ALZA 1FD8A 3FDSA 4EI2A 3VRAB 2DIUA 1QOAA 5GMKa 3EA6A 1MMNA 2NPFA 2UUCJ 4CHKA 5IM0B 1Q8IA 4YMEA 3M1VB 2HS3A 1JALA 4P7VA 3FC4A 2PLPA 2CQ2A 1QM9A 3NGSA 4XO0A 2CQDA 5ETTA 3MM7A 4ZRKA 4YQWA 1J8CA 4RMAA 3KK3A 3DOKB 1HBUB 2FAZA 3NGTA 3U1LA 1LO5D 3T5JA 2MA9B 4LFCJ 2LMCA 1SEBD 3M6VA 2DIVA 4URQU 4KZCA 1U8WA 4F1SA 4K2JA 3H7SA 2C7MB 1FNXH 2G1EA 2CIMA 2DBBA 2X1FA 3M3JA 1APSA 4GMVA 1C3TA 2CPYA 2FHMA 4GXBA 1R8AA 1I4XA 1BLUA 2HZAA 3RAQA 3PEHA 1RWXB 4DXLA 2LD9A 4YUDA 4C0HA 2UVVA 4FJVB 1AZSA 2XS5A 1N5XA 5HP1A 1K44A 1C4CA 2KTRA 3ULHA 3WIVA 1RKJA 3H5UA 3GU0A 2AWZA 2WXKA 3U2SC 2HBYB 1IUEA 4B9VA 4RPFA 2V69A 1E6YB 2IRYA 2QRRA 2YNFB 2ASLA 1T8EA 2UUTA 3UWTA 3TAPA 3MDFA 2YNIB 3CD6S 3IM9A 3HMJG 4CLYA 5C23A 2NR0A 4DV2J 3ZXRA 1ZZFA 3OL7A 2GJ2A 1UA1A 2B5JA 1ET6A 2H4WB 4QW8A 2YQ1A 5EWGA 3BKFA 1M1HA 3DHGC 2I0XA 5BR8F 2GBRA 1IKYB 5KFJA 1S6OA 2V4LA 2WVDA 5BYRA 1RKIA 3BKUA 3O3LA 2DITA 5D3GA 5ETQA 4ZCKA 1M5VC 2MZSA 1HNZF 2DXFA 4WXOA 4XX5A 2N9EB 2B9WA 1G7CB 2YWKA 1KD1T 2V8VA 4KFBB 4LLGM 3P2BA 3UD5A 4NA1A 2MMYA 5KT3A 4M8NA 4R5PB 2JLGA 3APDA 2HRUA 3I9ZA 8AT1B 2WYQA 1NEKB 3RT3B 3K8VA 3AOCA 3M1VA 4HHUA 2XMVA 1WR6E 4II3B 1CK1A 3EGWB 2CUYA 3TZXA 3N79A 4USKA 2AGQA 1UETA 3MJ5A 1WYWB 4DL5A 3FFIA 1IWAA 2BRLA 3MWBA 3G6ES 2RDJA 4B3RF 2XMJA 2GZOA 2VG6A 4WTYA 2VQEF 2B4UA 1WOSA 4H4KC 5FDLB 3LWLA 2L05A 3KLEA 4DSFA 3MOJB 5ETLA 4NCGB 1Y0HA 1KRPA 2BUNA 4ATNA 3DPDA 2YKMB 1EU4A 5AEKB 2J5AA 2KFNA 4OHVA 4ZOSA 3I6PA 4AUKA 4DV4F 3J80U 4K1RB 1FI4A 4PS7A 4OVUA 1WX8A 1NHKL 2EFQA 3CCMS 3APFA 4ECRA 4QU7A 3W1YC 4J9VA 1GPXA 1LWXA 4PT5A 1CJUA 3OTDA 5LMUJ 1GX5A 1P9QC 3CSKA 3E8OA 3UNGC 3MEGA 2C7HA 2IC3B 3TVZA 1FFGB 1WG5A 2HZCA 4R8UA 4LRBA 2VZKB 1HBMA 2N9PC 3W1SA 3DMJA 3KMSA 3DHWC 4WWPA 1RSCA 3SBMA 4LJOB 1NK5A 1Q82T 2WX1A 4KV8B 2IBIB 2V3NA 2VUGA 4CNYA 1E9MA 4PQUB 4USMA 4NEYA 2EFVA 3P5BP 4IG7B 3UCUP 3CMQA 1X9WA 4AS1A 2QL5B 3MHYA 2CQPA 3MM6B 4ZVFA 2L1AA 5BR8J 2ICIA 3K57A 3L54A 1I51B 5HANA 5E5NA 1ZPSA 2OPSB 3AODA 1KM7A 1QAXA 3W61A 4TQRA 1P1AA 3I55S 3ZTQA 1GJZA 1B7YB 4J9LA 3AQOA 2HYIB 4DV7F 4J9SA 4OX6A 4A8MP 3VCDA 2WZ1A 3TUZC 2RKIA 3PRZA 2AX5A 1TK5A 5D0EA 3UQBA 5I42A 3IGNA 2PMVA 3AFGA 1R6VA 4I64A 2L9DA 3RB3A 2XLJA 4KIKA 2YX7A 4RGOS 1FFVA 1H38A 5B08A 3RW7A 1VHFA 1WF0A 1L3VA 4PXEA 1D09B 4JOUA 2MJDA 2INPE 2N7JA 2EKNA 5G2NA 2WONB 4HDOA 3HZGA 1HQUB 2FGCA 1R8PA 5E6JA 4JV5F 1DHMA 2IYGA 2MP2A 5L8RC 2XO6A 3DN9A 2FJBB 1TKDA 1JMLA 2YBVA 4DV5J 3Q3MC 4Y3CA 4S0RA 3ALBA 1XLQA 3I9V9 4N41A 2WXLA 1KVIA 4OQJA 4WIQA 4DV6F 3MEGB 1JNZB 1F9HA 4DCJB 5DM7Q 5DG7A 4HTIA 3N1YC 2JRSA 2FVPA 1HBNB 3GJTB 3QLHB 2RB7A 2H4YB 3CDAA 1U1QA 3QWUA 2XCPA 1TP7A 2KXHA 2B76B 2P9CA 4O44A 2WLBA 3EZOA 2BXJA 1ZPWX 4OV6A 2A1BA 5T41A 1GAOA 4E0DA 4ZP7A 1V1OA 4LFBF 3VAWA 2NS5A 1RT2B 5IS2A 2LUEA 2A2DA 2EVZA 5L1JA 3ETRA 4LF9F 1RT2A 2W2OP 1M5OC 2X3DA 1U24A 3EZ5A 2OIHA 4UQGA 1L0VB 4YP3A 3OXGA 1MPEA 4RF0A 1GB4A 3M2RB 3L10B 2K7JA 1FRXA 4ANWA 1XEZA 3K5PA 3VHTC 5D4OA 2D2QA 3BH6B 3Q0AA 3HPOA 3VGSA 1YX2A 2OMLA 3ET6A 2H3EB 2F7VA 4KGSA 3MPDA 1YLXA 1OQ3A 2XK5A 1RAFB 2C5LC 3C14A 3L08A 3NWGA 1E8ZA 5DPRA 1WC5A 3MEEA 1DTQB 3CC4S 2R7QA 1SQEA 1UCNA 3LWMA 3NEKA 2UV8G 2QCZA 3KLGA 2BS4B 2KMAA 1NI3A 2RDGA 4M5NA 2MLZA 2OGUA 4J9UE 3WC2A 4DV4J 4WIPA 3JSMA 2HHTA 2C1EB 4KT0C 5D6JB 1FNMA 4A8KA 4B9KA 2RMLA 2HJ1A 1GMWD 1VQ8S 4N9F4 2QILA 1B7FA 4W92B 2ZBRA 1FKPB 2XULA 2BANA 3WIMA 5KT4A 2QMWA 2W8LA 3RNEC 3DXBA 2FB0A 1R27B 2HBRB 2AYEA 4KE5A 3OTEA 2GBJA 1UWBA 1PKUA 3NBPB 3W8PA 3KWMA 2LU1A 4CH1A 3FSYA 5DDRC 5IWAJ 3RAMA 1AT1B 3L16A 4RWWA 3HHKA 1BC6A 4ZDVA 2Z8LA 1TKTB 5JHBA 2XHWA 3S6EA 3MMBB 3D6MB 5H9FK 1YIJS 3ZJTA 3L7UA 1OEYA 5THWA 1LKZA 2DGTA 3CMMB 5IOLA 4I4BA 1QAJA 1C1BB 2JFKA 3N5FA 1NDKA 2E9ZA 4PQUA 4EUVA 4AQ7A 1SKUB 2DR6A 4C8ZA 3IBWA 4OL8A 2H54B 1V1PA 1UH6A 5AXNA 2NR2A 1YN3A 1OIAA 5E0OA 3W5YA 4CNZA 4O4GA 2I38A 4KSLC 4NJCA 3PX4A 4M8LA 1CJKA 1XMOJ 4QOTA 1SXLA 1ZPVA 1Z2ZA 1S5ZA 4HH0A 3G9CA 3SI8A 2E5JA 1YRXA 2ZUGA 4UW2A 2N7CA 1SH2A 2YNHB 4LF4F 3TEYA 2K9XA 1RQ0A 3DLJA 2FQQB 2BEFA 3FNNA 1V80A 1F3VA 4X64F 2MSED 1NVID 1YG0A 2ZOFA 4USIA 3PRMB 1YK9A 1F6TA 3IRWP 3L3CA 4HPLB 2MJUA 1T6BX 1NK6A 3RTVA 4MT1A 4MK7A 3AY0A 1NSQA 3UR3C 3RPFC 2LQ5A 3JTPA 3ISND 4FHKA 1FJGF 4OHJA 3AE8B 1TKTA 3O6QA 4DEZA 2M8SA 4OYWA 2VKZG 4XC2A 5IC6B 3HK2A 2Z59B 2B3AA 2OPPB 2KM8C 2WBMA 2HK3A 4OJHA 2JXXA 3GSDA 4C8NA 3KDNA 5CHCB 2DNRA 1SBBB 1KQKA 1QLNA 5GADU 4USVA 1NK9A 4Y00A 3R9LA 2C2ZB 2EBGA 2DGSA 4TN2A 3TEHB 2IBOA 2EMTA 3EGRA 2UU9F 5HHDG 2W55A 1E7UA 1XEEA 1LM8B 3TQEA 3WIUA 3BO3A 2E7WA 4ICVA 2EFNA 3CCWA 2CNKB 1SI9A 1W25A 2P6SA 2LWPA 2PI5A 3IAM9 2CAJA 1TIFA 1UVJA 4FF3A 4EBEA 1HBNA 3OFHA 5EWEA 1R0AA 1Y4ZB 3MPYA 3KJQB 5GMEA 1N6QA 1RZMA 3F56A 4EEYA 3N0VA 3ZO5B 1AFJA 1YI2S 4HKZE 2XMMA 3G6VA 2G2OA 3E51A 2VZ9A 5L9XA 1ZE3D 2RUGA 4GDKB 3QJJA 3MTJA 2V9HA 3I96A 3AJ2A 1FPYA 1N52B 1XR6A 5HMXA 5DG8A 2KWDA 2M52A 5G5HA 1WSPA 3D0GE 3H7HB 5JUMA 2JSVX 2M0GB 2KDIA 1VI7A 3H6NA 2EG2A 2IGGA 1VQKS 1NZAA 2HVEA 1W7WA 3QMQA 2QFJA 5E33A 1YJVA 3SSSA 1F2HA 4HROA 4DL7A 2IY0B 1WGHA 4D2KA 1U1LA 1LWFB 3V6KA 2KVRA 4PYUA 4ASWC 1WOOA 3BZQA 2LEPA 1JLQB 2WSEC 4M63A 5CZXA 2CHZA 4OHWA 5KG2A 3E9SA 2V5HG 1AXQA 2LP4A 5EHHA 2ZJPQ 1O6XA 3V5RA 3FQLA 3AM9A 2MWSB 3D1OA 1NKEA 3HVAA 1S99A 4GC6A 4O44B 2LXAA 3D6TB 3OHAA 3TIXA 4RLEA 1AW7A 2XY6A 2LZ6A 4O3PA 2HBQB 1N36F 2JHEA 1YQHA 2BVCA 2UUWA 3AXKA 1BT0A 1VJWA 3ISNC 5HLFB 1RAGB 4FYDA 5BMHA 2VFTA 2ZH4A 4OZAA 2AQ3B 5KFGA 4MIAA 2G2ZA 4PABA 2MZRA 3SSQA 1SJRA 1L0YB 1AW0A 2AQ2B 1T0TV 3KYDD 3GZ7A 3GYNA 4ECQA 1T05A 1GH8A 3BGLA 4AL5A 2QLWA 3NXZA 2UWQA 4NXMJ 1AN8A 5FJ4A 3BSOA 1L3UA 2CPIA 3VVWB 3GSIA 4Q5VA 2IA6A 1M5KC 4K4SA 4TY8B 3JTNA 1N88A 4PXCA 3LGMA 2A10A 4M00A 1HNVA 3I5AA 1J7BA 2OPRB 1VLOA 2A18A 2N3OA 1HARA 3PGEA 5AZHA 2ZCBA 4IFVB 4X84A 1U6BA 2XYHB 2O1PA 3CJSA 2XI2A 1BXNA 4OJGA 1O8BA 1EF5A 1SB3C 1N32J 2J0WA 2MP2B 4B9NA 4J9PA 3W8GA 2QL9B 4DX7A 2VG6B 4I56A 1IBLJ 2A6MA 4OI0A 5IFMA 1WGRA 3I0SB 1N63A 3RU0A 2M0XA 4K0KF 2LVPA 4TXSA 2R7XA 3MR5A 4C7YA 1GMWA 1LFDA 3QATA 4CM0A 2HWTA 2IM2A 3W2WB 4H4KA 4XE0A 2GIFA 2YKPA 2BPSA 3HVZA 4Q43A 3JSVB 2KFKA 3TJAA 3AB2B 2W4PA 4QJVA 2R8IA 1WE7A 1RTDA 1MJDA 2R61A 4X66F 4G1PA 2CWXA 2JZZA 1U0HB 3OTBA 4W9FA 2FCQA 2WXPA 5ETSA 4W9KA 3T1YJ 5LMNF 3CJ3A 3WC0A 5E6OA 1Y56A 2QMXA 3DBRI 2HFNA 1E8YA 3KHHA 2GGPB 5HMZA 3ZZ0A 3ILOA 1SE2A 3D6HB 2KB2A 1RADB 1S79A 2HD5B 2ZE2A 3EE3A 3GJQB 2MBQA 4BKSD 4RW7A 4PUOA 1NZ8A 2VG5B 2RDBC 5F41A 4ELUA 4RGMA 1BXTA 1DTQA 2E3TA 1WG4A 3M8ZA 2BZ2A 3P63A 1JCKB 2BWFA 1RCXB 1RU2A 3HI9A 2XI3A 1CULA 3VHQA 5L46A 3QWPA 2EW9A 3WAPA 3D6FB 3DOMB 2BW7A 2JH3A 3BVZA 2MJEA 4NL5A 3UDVA 1VRUB 1N34J 5H1SV 4LCDE 2DGUA 2QLFB 4O0IA 1VJQA 2E44A 1S48A 1E8WA 3IVFA 3H40A 3IHPC 5E6NA 3NGKA 5EE0A 5IZHA 2UUAJ 2CHWA 3QGPA 4ZOHC 3MUVP 2WXJA 2O66A 4X57B 4AQYF 2CFXA 4ILRA 4JI0F 1WMHA 1FKPA 5KFYA 4IRKA 1C1CA 4C8LA 4E8UA 3D0HE 2YH0A 2KTRB 1R7SA 4N59A 1FWKA 2FYXA 1EQMA 3I5BA 4DS5A 1A6LA 3FSXA 5HVFA 1HA5A 5IT0A 1X60A 4P2FA 3OJ3A 4CLTA 2KACA 4X4PA 4O0NA 3EPGA 3VTIA 3PM9A 3O1LA 4KZ0A 4RU2A 3FQKA 4G50A 2OEMA 2KC2A 1WC4A 4QR1A 3W62A 2K3KA 4K0KJ 2PVGC 1X4BA 2BABA 1YJ9S 4FBUA 1ZOYB 3CJQA 4N6EB 1P9YA 5KFZA 2HNDB 2GB1A 1SC6A 4PG6A 5AJ3F 5DQIA 1XBWA 2B7BB 4JI6J 1YN5A 4TSSA 3QJLA 1Q0NA 2NBWB 1GK8A 2M0AA 2ZFHA 4IKGA 1IKWA 4RW6B 1OPZA 1HNXJ 2FLLA 2DNFA 3TR5A 1JW9D 2RS2A 3KUZA 5LMUF 2GO9A 3GIMA 2CU1A 2Y9HA 2HNZB 2ZW0A 1N33F 1I1GA 3DFEA 4C3LA 1E8XA 1S4EA 4JI1J 4J37A 3P4PB 2R2OA 2VONA 2JVRA 3D3CJ 4CO4A 1XMBA 5DLGA 4DV1F 4AE5A 2BYEA 2B7CB 2HHPA 3ITHA 2P9GA 2AQ4A 2VH1A 1P0RA 3GOEA 2DH7A 1T95A 4FXWA 4CO2A 3DGPB 3PG9A 2NLWA 1OGWA 2G3QB 5M2UA 2DEJA 2LASA 3DVNU 2GVZB 4LQ9A 1OSDA 2DCLA 5LXYA 5L1IA 1HWKA 4AXIA 1SJED 2K5PA 3A9JB 3TEXA 1R43A 3ZNZB 4DPXA 4DWFA 2MGZB 2AX1A 4Q2JA 1SC3B 4OX9J 1S72S 1GNKA 2AWTA 1IVZA 1WEYA 4R0EA 4H4MA 5KG1A 4HT7A 4ZVQB 4CCHA 1D8YA 2BYFA 2HHSA 1TY0A 3PT2B 2M3DA 4NZ7A 2A3JA 4B3TF 1V5VA 2JZPA 4JB8B 5J2PB 4E98A 4CQNA 3RGIA 3CXCR 3R2IA 1FDBA 1YWXA 3PX0A 5KG0A 5F3ZA 3SIPB 5HQ8A 1FXRA 4ACFA 5G55A 3V4IA 4N47A 1MVKA 5G4DA 2PJHA 3BYRA 2DHZA 4J90A 4AYBD 4B02A 1UVKA 5I3QA 4WJPA 4QIGA 2VKRA 3MAAA 2LYVA 4WE1A 2FHJA 3DCGA 3L17A 3MAAB 1NM2A 3G2XA 3K7RA 4WWNA 2B43A 1HPZB 4UT4A 2MQOA 1XLNA 4DCPB 3CB4A 4RBVA 5LXRA 3KG4A 4ECZA 1VFJA 4M01A 3DWMA 4HEA1 3H5SA 4PXBA 2CZ9A 1OY9A 1H8CA 2FJEB 1N0VC 3BINA 3BQ2A 1X5SA 4WWMA 3RG6A 2KQSA 2CVEA 1DQ9A 1YJTA 1GFWB 2MLBA 1S1VA 2KM8B 2FUG1 1RT3B 4LSNB 2ASDA 4CLWA 1NKBA 3JQMA 4UOHA 5K8OA 2F8MA 5L38A 2FLPA 3GP9A 3V05A 3BPDA 1PILA 4TU9A 4LR9A 4KHPJ 4A47A 4MYUA 2DO4A 2RAQA 4DFPA 2WSFC 3NL0A 1HI8A 1TUWA 1QY7A 2J53A 1STEA 2FCNA 1S6PA 1K1SA 3I4HX 2HLTA 1IPGA 4DX5A 3W66A 1AFIA 4F50A 3UNYA 4FXVA 1YZ6A 1B3TA 1WXQA 3DBSA 3DRPB 4B9SA 4IR1A 5DZ7A 1OO0B 1ZETA 4KC5A 4KO0B 1ZH5A 1M94A 3SCKE 2JXTA 1HIYA 4FJYA 1L0XB 2L9WA 3CCUS 4YY3J 3MM9B 4J9MA 2QTWA 2YWWA 2EBEA 2GHPA 2B9XA 4NZ0A 5KFHA 5HL7Q 3SFUA 3ZNJ1 2ZZMA 2AYOB 3NY0A 3LOUA 1HEZE 5LM7E 2LJ5A 1Q16B 1U02A 2OLWA 4I2QB 2PMZD 3BF4A 2V8HA 5CYMA 4C7QA 1C76A 3OTOJ 5B09A 3NUHB 1JLFA 1HE8A 3JQKA 3CSFA 2VA2A 3MTKA 2HEKA 4MK9A 3VGTA 2H1YA 2HS4A 3MR2A 2ZJQQ 3A9KB 3I5CA 3HKWA 1IBKJ 1S4FA 2MZQA 3ENWA 4QIEA 3I0RA 3M7VA 2BJ8A 3DBHI 3DRPA 2PIIA 2CJ9A 2BKNA 4RBUA 2G9OA 1RA6A 4MGZE 2LFIA 2H48B 4IWQA 4EZKA 1PQSA 2GCFA 2UZAA 3BBBA 2VU5A 5K9FA 3UQAA 1FX2A 1R6YA 3M32A 1N5YA 1P1TA 1FF2A 2CPEA 2QLJB 4DR7F 5F8JA 1S97A 3BQ1A 3BGFA 1HHTP 1RP5A 4NRUA 1AB8A 2OOBB 1FK9B 3NS5A 1KTKA 3MM6A 3C16B 3H8HA 3KVFB 1EAYC 4I7FA 2M19A 2HMIA 4BOSC 1ZBTA 3KLFB 4DL4A 4BKSA 2IGHA 1V1PB 1LW0A 4QBUA 3U8ZA 4RM9A 1ELOA 4FDFA 1FO4A 5TSSA 2FVQA 2HBZB 1Q79A 2DISA 4OLOA 1T0QC 4OJ3A 1E6VA 2W9BA 1F5CA 3M05A 1U1PA 2BJDA 2D9OA 4M5MA 2DGXA 1JKHA 4ZJLA 1JQGA 5A0YB 5GAHU 4ED8A 4QU6A 3V81B 1RA7A 1XJWB 1NB2A 2D7SA 2R7TA 2K1RB 1QOBA 1T0RC 4W9JA 2J42A 2HHXA 1WSVA 3BN4A 2BM1A 2NXNA 1TFYA 3VFKA 4RUBA 4GN1A 2Z0GA 4WTOB 2Y0BB 2PT0A 2NSBA 2F4FA 2V2QA 4MMOA 4DLGA 4LF8J 5HLFA 4YHHJ 2DJWA 3T3OA 4GGQA 4XTTA 5LNK1 2KG0A 4ZN1A 2AW0A 3NNCA 5GMVA 4HVBA 1XR5A 9ATCB 2KTFA 4ED6A 1H4RA 4OYBA 1N61A 4MAKA 4CLUA 2MJNA 1S12A 3CGIA 2OPQB 4PQAA 2MEWA 3K5MA 3QQCD 5J2RA 2RVJA 5D78A 1HNZJ 3L0WB 1U2CA 4NJ6A 1YQBA 2O01C 2LU2A 2J9EA 2K22A 2NREA 4USTA 2FZCB 1YZ7A 1JMTA 2AEFA 3BIID 3KHRA 3RRHA 1KOOA 1V9JA 2KHWB 1OSCA 4FVMA 3H4DA 1HQEB 1SE3A 2LI5A 3P4RB 2XEWA 5CHWA 4X4QA 4QYZK 2DNOA 1K73T 2EG1A 2ZVSA 4NLUA 5AZGA 4QR0A 4XGAB 1GMVA 4P6VF 4FN2A 2HTHA 2RD0A 3MCNA 3P4UB 2BJEA 3EJMA 3FCVA 3L13A 3PHXB 1VBKA 2K06A 4DWIA 1VRTA 3ZDMC 2AP6A 1NUEA 1WMHB 2A5UA 2DZIA 2YNIA 1PC5A 2QA4S 3DKDA 3SU8X 2KZZA 2HWHA 5C7PA 1IGDA 4LJPB 5BYSA 1VC0A 3RUIB 4XDDA 1BQMB 2ZJRQ 1U2RA 3AULA 2LHEA 4ZP6A 3ZJVA 3T3NA 3Q2TC 1JLAB 4ZPAA 4WKYA 5E2QA 1HQ2A 2HW3A 4MTPA 3NRBA 1TS3A 3M6WA 1QAYA 1SH3A 3KYLA 2DXDA 1YRUA 2HRYA 3SHQA 4F67A 2HQFA 3PTFC 1VC6A 3R3TA 5KFSA 2QA1A 2UXDJ 1REVB 2LA6A 2DR9A 3A1QA 2L08A 2P9EA 2ZBQA 5IXUA 2N7DA 2DGQA 1VQ6S 2D3GA 4B9MA 3M8SA 3A1QB 3D54A 2L3MA 4JV0A 2IJRA 1NSKL 2ZITA 3GV5B 3TBLD 1KOHA 1VQ9S 1KP6A 1P8GA 2KDMA 4XDCA 2UXBF 2B9EA 2AEJA 3OJUA 5J17A 1UELA 1NDDA 4CLSA 4EOYA 1SUQB 1NDLA 1CLFA 1FXTB 4JI3F 4OHZA 2MBOA 3JS9A 1JROA 3CJ4A 5IKCM 3BVGA 2KYXA 3M8RA 1T3NA 3CJKB 5KFIA 3URYA 3OLAA 1Q86T 1XD3B 3EXCX 1TUVA 3V6DB 1DTTA 1VHIA 1ZYQA 2WHOA 1T3OA 1GG3A 4K50A 4MSQB 3TEGA 5J2MB 1IWGA 3P3DA 2PD1A 1KF6B 3A13A 3N28A 4DV0J 2D3OR 4G3XB 3MM9A 2LVOA 4OZCA 3NVZA 2CPZA 2QLBB 1TBEA 3ZJUA 1U0HA 4DUZF 4DUYF 1EB0A 2XHCA 1F0XA 1NH8A 4KO0A 2PEHA 4NE9C 1CJTA 5D4PA 4P75A 2HFOA 1HMVB 1RHQB 1WF1A 4LVOP 3DLGB 2PDAA 1LWCB 1R3NA 3VAFA 4ZMMA 4WFZA 1HI0P 5MPOA 3PO4A 2DKOB 1XN9A 3DVGX 1LW0B 3ZTPA 3SZ2A 2HSEB 4GKJJ 5GXGB 4GU2A 3JB9k 2KWUB 3THVA 1H74A 1SJHD 1R31A 1WGDA 1VQNS 3T6JA 2OPPA 3FEZA 1JNRB 3P8BB 3THTA 3HM9A 1IM4A 1L6VA 2DZKA 4P6QA 1U09A 2CU3A 2AD9A 5D4LA 1CJUB 2KVZA 3P4SB 4HPMB 3GFXA 3H2UB 2CNOB 3GWCA 1X4EA 2JLEA 1KLVA 2MZJA 1MW7A 4RH6A 5A6PA 4FYWB 1U1KA 3BGRA 3EGNA 2VRRB 1MLAA 2BMBA 4ZP8A 4A90A 4Z2XA 2XLIA 5J2PA 3KMQA 1RT4A 3CIRB 1K51A 2DGVA 5JMNA 1PAUB 1XQIA 3TUPA 3PJXA 4PK1A 3AE6B 1L6UA 1WDTA 4C9DA 2WXQA 3VRBB 5CYJA 3PX6A 1S0VA 2DVIA 2XS7A 4YSYB 2LCWA 3S2AA 2PA3A 1MROB 3L4PA 1MWZA 5E3QA 2J0SD 5C24B 2R4FA 1D8ZA 1TQLA 3N20C 4FYVB 2VB6A 1T05B 1N33J 1TELA 4ZRPA 2J9CA 4BHQA 1F1HA 2EEYA 5FKAC 2KOXA 4Y65A 2AJ0A 2OHFA 4W9DA 4A48A 4K3BA 1MWYA 2M88A 5ETOA 4DV2F 1C77A 2BR0A 5SUHA 1TZ1A 2VH2A 2MBBB 1OJ4A 2HQIA 1T03B 4C4VA 1U8SA 2ZM6J 2GQ2A 4LUBA 2R8HA 4K7SA 3CO9A 1C2PA 4Q7AA 4JWUC 2RDDA 2HRTA 4DHZB 4LF4J 2WXIA 2OH2A 2GQCA 1TMJA 2JT4B 4NLRA 3THPA 4DR5J 1X4AA 4A8YA 2RU3A 4ZCLA 5J2QA 4OHYA 4DHJB 1MU2B 1J5EF 1UVMA 4YDDB 1XK8A