2I38A

Solution structure of the rrm of srp20
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRDLDGRTLCGCRVRVELSNGEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/chimera
molecule keywords Fusion protein consists of immunoglobulin G-Binding Protein
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2i38A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i38A02
1KD1T 2KG1A 1VBYA 1UAWA 2RRAA 4FXVA 1PO6A 2K8GA 3CULA 2LYVA 1VQ5S 3JB9k 4F25A 2LECA 2ADBA 2RVJA 4TLQA 3J7YU 2VOPA 1QKZA 2KG0A 2J76E 3DXBA 1ZZNA 2M52A 4WCEQ 1A9NB 2DH7A 1K8AT 2QMTA 2J8AA 1FJCA 3CC7S 1UW4A 1U6FA 2MYFA 4C7QA 1N88A 2YH1A 3THPA 2J52A 3K0JA 1DHMA 2LXUA 4YB1P 4YOEA 2L9WA 2QFJA 1DZ5A 2CPXA 2RT3A 3S7RA 1R8HA 1JJHA 4QU6A 2QEXS 3VF0B 2KWDA 2CQHA 5IM0B 2RS8A 3VAIA 1CVJA 2XSFA 3MOJB 5IM0A 3G4SS 4IKGA 2CPYA 2RU3A 2ZW0A 2X1FA 1FCLA 2KQ4X 2FC9A 3S8SA 5ITHA 2YTCA 3GB1A 2KXFA 4A8XA 3VAFA 3NNAA 1U1OA 2L41A 1Q82T 2DNRA 2OEDA 2DIUA 1WHWA 2VODA 2E5JA 2UP1A 1SJRA 4W90B 3NMRA 2AYBA 1P7EA 4WKRA 3DLLQ 2ZJQQ 3RW7A 1U1PA 3EX7B 4EGLA 2DNOA 1IQTA 2N7CA 3P49B 5DDRC 2CPZA 4MACA 2RRBA 3HI9A 1WF2A 1W2BR 2DIVA 5BMHA 3SXLA 2M0GB 2MKIA 1FT8A 4QPTA 3BO4A 1WEZA 1O0PA 1SXLA 1A7GE 1NO8A 2ON8A 1YJNS 4RU2A 3N9UC 4QQBA 1YWXA 3Q2SC 4OZCA 2XS2A 2QSDA 2KU7A 1PGZA 3Q2TC 1K50A 5H1SV 5DDPC 1FJ7A 4U67Q 2KI2A 2F9JA 2HGMA 2HYIB 2DK2A 3VALA 3US5A 2XNRA 2JXTA 2DO4A 1VBZA 2OSRA 4CQ1A 1K51A 1Q10A 1JJ4A 4HKZE 3CCLS 2D3OR 1GB1A 3BEGB 2OSQA 3SDEB 2MMYA 1DRZA 2EELA 2CQDA 2DB1A 4OZ1A 1FJEB 3S6EA 1QVFR 1HZ5A 2M9KA 1YIJS 3UCGA 2GO9A 1X4AA 1H2VZ 1X5SA 1QVGR 2DISA 4Z2XA 2KXNB 1VQ6S 2PEHA 1VQPS 1H2TZ 2N3LA 3CC2S 2ZJPQ 1P1TA 3ZZZA 1RKJA 2WBRA 2FPHX 2L08A 1H6KX 4ZKAA 5GAGU 1BY9A 2K0PA 1WG1A 3EGZA 5DDOC 2CJKA 1HEZE 1VC0A 2JU6X 1WG5A 3TO8A 2FC8A 2LHDA 2DNMA 2LEBA 2OTJS 2M88A 2E5HA 3MURP 5LSOA 2DH9A 3MUMP 1OPIA 2LCWA 1R8PA 4CH1A 1UWXA 2MZRA 1HZ6A 2PW9A 2CQ2A 3CCVS 3CUNA 1VC5A 2BZ2A 3CCSS 2M2BA 5DM7Q 4C4WA 1X4GA 2JVOA 1X4CA 2NMQA 5GADU 2XS7A 1U2FA 5LJ5Y 2MXYA 3L3CA 2LEAA 4IOIE 2DGWA 1VQ4S 5DETA 1M90T 1VQOS 2LA6A 5JVGQ 2JWUA 1OO0B 4WIIA 2DGVA 3U1LA 2HZCA 2I2YA 1NJIT 1G2EA 4WH4A 4Y00A 1WG4A 2CPHA 2MGZB 4C0OC 1M1KT 1FO1A 2MGZA 2M8DB 5HG2A 2AYMA 2DNYA 2DGSA 4KGTA 2J0SD 2MQOA 1MHXA 1N52B 2RQ4A 1KQSR 2G1DA 2CPJA 2CQ1A 2CQIA 1U1NA 3G71S 3MDFA 3NNCA 1PGAA 1FCCC 3TYTA 1Q7YT 2J53A 4LJMA 2DGUA 2KDMA 1C9FA 4WFNQ 3G9CA 1MVKA 2XS5A 5FJ4A 2YH0A 5GVQA 1YJWS 1VQNS 3P3DA 1IGDA 2Q79A 1U1KA 1XCQL 3MI7X 2RMMA 3I56S 1X4EA 3CMAS 2CQPA 4WFAQ 5IQQA 2DNQA 1K53A 2MSTA 2MKHA 2LKZA 4BS2A 1WHVA 2MKJA 2CQGA 3S01A 2VOOA 2RS2A 4Y0FA 1F2RI 4PKDB 3CCRS 5D77A 2G0CA 2IGGA 1X5OA 5GAHU 2MZSA 5HHDG 2N82B 1YTYA 1K9MT 1ZH5A 2LUMA 3VAJA 2BOPA 1XCTL 1WTBA 2CPIA 3G8TA 1FHTA 2N7JA 5BJRA 3D2WA 1YI2S 2GB1A 2E5IA 1ZXHA 2X1GA 5GMKa 2K3KA 2DGTA 2E44A 3HHNB 3G6ES 2OTLS 3CCES 1VQLS 4CIOA 2KT5A 3EGNA 2LHEA 2JSVX 1IBXB 2FY1A 1U1QA 5HL7Q 5LJ3Y 1WELA 2V94A 3G96A 2KFYA 1IBXA 2CPDA 3R1LA 4IOAQ 1UP1A 1AUDA 2DGOA 3MP9A 2MY7A 2HGNA 1P7FA 3SDEA 2N9KA 5LXYA 3UI3A 1U6BA 5CXTA 1B7FA 2YKAA 2MZTA 3J7ZT 2MY8A 4M5DB 2DNNA 1MPEA 1X4FA 2JRSA 3NNHA 2MSSA 4TU7A 1NU4A 1Q86T 1N54B 2AYEA 2M70A 2MZQA 4UY8T 2CQBA 4WFBQ 4HJGE 4KGSA 2NZ4A 1YMHE 2DGXA 1EM7A 1WI8A 5JXVA 3H2UB 5BMGA 3MXHP 3U1MA 1MI0A 1X4BA 2N3OA 3CCQS 4QU7A 4WF9Q 1JJ2R 4TU8A 2LQ5A 2MQPA 2DO0A 3CD6S 2JX2A 2G4BA 1HA1A 2E5GA 1KH0A 3R27A 2PE8A 1D4BA 2RUGA 2PTLA 1OWXA 1X4HA 2DNGA 5HI1A 2HGLA 1PGBA 1VQ9S 2KVIA 4CH0S 1WWHA 2F3JA 3B4DA 1H2UX 1U1LA 4W92B 4OZAA 2ERRA 1SJ4P 2MZ1A 3UD4P 1VBXA 3UE2A 2ADCA 1X0FA 2CPFA 2FHOB 2RNEA 3ULHA 1KOOA 3ZZYA 2CQCA 3OW2R 1S72S 2CQ3A 5HO4A 2JVRA 2LXIA 2IGHA 3UWTA 1KOHA 3MD3A 5D78A 2EK6A 2KXHA 2RQCA 1P27B 2GHPA 5IFMA 1HD0A 3PIOQ 1PGXA 1WEYA 3CF5Q 4V19X 2O3DA 2ZJRQ 4LMZA 2DNPA 3P5TL 5GAEU 2X1AA 1WF1A 1VQMS 2KRRA 3CCUS 3CMES 1XN9A 3CCMS 1U1MA 4PR6A 1M5PC 2HVZA 1HL6A 4IO9Q 1URNA 4ERDA 2AD9A 3UD3P 2DHSA 1WI6A 3FEXB 1M5VC 1FD6A 1D9AA 4UQTA 5CA5A 1WHYA 3THTA 5BMIA 1X5PA 2A3JA 1KC8T 3G8SA 2MQLA 1QM9A 4KGRA 2KM8B 2VONA 2GI9A 1WEXA 2RPVA 2IGDA 1U1RA 3PIPQ 4LIRA 4YUDA 2DHGA 2QA4S 1WHXA 2YWKA 1FNXH 3CC4S 3V3XA 1F2RC 3VAGA 1SJQA 1XF5L 2F9DA 1DBDA 1Q81T 2I38A 1JMLA 1FXLA 4F26A 5JVHQ 2KHCA 2J0QD 3R1HA 4F02A 2KYXA 2DNZA 1X5TA 3NS5A 3FILB 2M7SA 2CQ4A 3BO2A 2N9LA 2DNHA 3SMZA 3FILA 4ED5A 2LA4A 3UCZP 1F9FA 4IOCQ 2OJ3A 2MJNA 1HD1A 2AYGA 1VC6A 2ZW1A 2OIHA 2KN4A 4D2KA 1K52A 1VQKS 2NLWA 2MPUA 2D9OA 2X1BA 2D9PA 4TU9A 4IUFA 2DH8A 2M8HA 4OZ0A 2ONQA 1S79A 3I55S 2KH9A 2CPEA 2PLPA 2MB0B 3MD1A 2MQQA 2DNKA 3CCJS 3VAKA 1VQ7S 1MHHE 2EK1A 3IRWP 4J5OA 2MJUA 1YHQS 3MUTP 1K73T 3V4MA 1M5OC 2LMIA 4P6QA 2KACA 1VQ8S 1M5KC 1IGCA 1OIAA 3FEYB 5HFYA 3B4MA 2B0GA 4OZBA 2MHNA 3BS9A 3VAMA 2DHAA 2CQ0A 2MKCA 1GB4A 2DITA 2EVZA 2XNQA 3CTRA 3CXCR 1YJ9S 1X4DA 1ZZFA 2JZPA 5DDQC 2U1AA 1D8ZA 4GLSC 1SJFA 1YNTE 2MKSA 2MQMA 2DHXA 3BO3A 2KRBA 1JMTA 5LXRA 3RW6A 1SJ3P 2MQNA 3MUVP 5EN1A 4PRFA 1YITS 3TP2A 3LQVA 5DM6Q 2JWNA 2M4MA 3CPWR 2MZJA 3IWNC 4FXWA 2U2FA 2DGQA 1RK8A 1UFWA 5LSLA 1L3KA 3UCUP 2DNLA 5CYJA 3NS6A 2KM8C 3H2VE 3LPYA 2MKKA 3VAHA 5MLCV 3P6YC 2LGIA 2SXLA 1N8RT 2XB2D 1WF0A
chains in the Genus database with same CATH superfamily
2KG1A 3AT1B 5HI7A 2K1RB 4GVBA 1U47A 2R7VA 2HS3A 1CLFA 1STEA 2R8IA 2FCQA 1JK9B 1S1VB 2IRYA 3DFEA 1PYOB 3I5CA 3C19A 1NPPA 3D28A 4NRTA 3WIUA 2YX7A 2NPTB 4ZYNA 4KVGB 3MM9A 3O3LA 2HWHA 3KHHA 1X9MA 3MHZA 1IBLF 5HVFA 2WXPA 4YTPB 2VV5A 2RH3A 2BJ8A 2WW4A 3DDNA 4NZ0A 3PYDA 2KWDA 1SEBD 3RBEA 1Q8IA 1HNZF 4C9DA 5I3UA 2X1FA 3UNYA 2K7KA 3I0SA 3OL8A 2G2YA 3IRXB 5DPSA 3DLLQ 2VG5B 1I4PA 2H1YA 3EX7B 2KQSA 2XY6A 1U1PA 2BB6A 4MIWA 4DSKA 1WX7A 3HI9A 4A20A 5EDWA 1FJGF 5CTRC 2QIEB 2E1AA 1RYSA 4N56A 5D4PA 1O0PA 3W66A 1UA1A 3BKFA 3Q2TC 3T8MA 3K5LA 3M63B 3VALA 4N9F4 4YDDB 3RZAA 1RTZA 1S5ZA 3CCLS 1N33F 2FZGB 5LMUF 2ZVSA 4AL7A 3VZIA 2GLSA 4WJOA 3PW5A 4LDTB 2HZVA 2M3DA 1SBRA 3QARA 4F4WA 3OXFA 3QX1A 2LVOA 4FKYA 1RKJA 3VHQA 3QJJA 3QAEA 3KLHB 1IBKJ 5FDLA 5DDOC 2CXEA 4JV5J 1KFSA 1RT1A 4ZHOA 2EFPA 1E8ZA 3DDIA 1NSAA 3FAHA 4KBIA 4LDTD 3NOCA 3R5DA 4AUKA 1I6JA 1SH2A 4A8KA 2M2BA 4C4WA 3C2PA 4YTMB 3L13A 5THWA 1P0RA 4F0HA 3UVJA 1QE1A 3UGBB 1KR4A 3OFHA 2IM1A 4WWOA 4II3B 2DR6A 4MK9A 2OJRA 4J9MA 5HG2A 2CG4A 3SV4A 3GTYX 2MQOA 2RQ4A 2ZKTA 2WAQD 5FIIA 3E01B 2VPYB 1PDXA 4DHJB 3VGVA 4TUUA 3R6LB 4Y2AA 3G9CA 4O3NA 4ILMA 5CHCB 4DQOC 2KMAA 5GVQA 1DAXA 2AYOB 1U1KA 5M2RA 1FNVA 1SCJB 2CR5A 3H8HA 4WJPA 1XTZA 3G86A 4IR9A 1CSJA 5CQGA 1CBKA 2V63A 2KZMA 1WHVA 4L75A 1FWLA 3ZUNA 4ZN1A 1WXQA 4OW0A 4NLPA 1F2RI 2BM0A 2BJDA 4DHJD 3W1YA 5GAHU 3V62A 5E3CA 3PRVA 1WTBA 4KGXB 4OZ5A 4LRBA 5D3IB 5K8OA 1TBEA 3HHNB 3G6ES 4HYKA 3AE8B 3KMQA 1TZ0A 3SFEB 3ZNUA 5KFCA 4LK0M 4M0WB 1RWWB 2APOA 8AT1B 5IN7A 3TEHB 1UJ6A 4PUOA 2N9KA 5CHVC 2XG8A 2HLUA 1MWYA 1S0OA 3O13A 3FKBA 1XBWA 3QIDA 3G2XA 1Q86T 2XI2A 9ATCB 4XZ4A 2OEMA 1R4NI 3UQSA 2N4CA 4KGSA 2QTWA 3KDOA 4ZHRA 1T03B 3ZC4A 2QT7A 1F1BB 4HRSA 5ETLA 5HMYA 1ZXIA 4DPXA 5BMGA 4HHUA 3MXHP 2KVRA 1E7VA 4LF9F 4TU8A 2C7NB 3V6DA 5F0WA 2BANA 2CA9A 3PTFC 4NCBA 3WZ0A 1FWPA 1RAJA 1Y5IB 2F3JA 3BDPA 3VGSA 1SB3C 1AW7A 1WACA 1SJ4P 3GCWP 2K3IA 1FD8A 2CQCA 1S72S 1VIXA 2JHEA 3VUWA 1HARA 4BOZB 3AEEB 5I4MA 1R0AA 1C1CB 2WHIA 5D0RA 4NEZA 1G4CA 2HFZA 2IYGA 3J81U 3FC4A 2ZH5A 2KXHA 3GWCA 1TV6B 3HKWA 3NL0A 2J5AA 3M7VA 4DV1J 1Q1KA 1BHNA 2X1AA 3DCAA 2CG8A 2BTEA 1L3VA 3CMES 4E2FB 3WC0A 4FJYA 1DQ8A 2HFSA 4IH6A 5LT5A 3GG0A 3M1VA 2V68A 1XLOA 3J7AN 2DEIA 1WHYA 3Q2AC 1S6PA 3SV3A 4ETZA 2ZUAA 3SCKE 1X7VA 3SFUA 3IAM9 2D11A 3CWJA 1QAJA 2FHJD 1SKUB 4OYBA 2RHSB 3UQAA 4AL5A 3D54A 4QCLA 4J91A 2Z8QA 2DEJA 4ANXA 1WY8A 2HD5B 2OI2A 2XGPA 4DLGA 4DL6A 2AJ1A 2D9PA 3TJ8A 1U7LA 3TW0A 1S79A 2KH9A 2V2VA 3WDOA 2HHWA 1IKWA 2K39A 1UVJA 2R4FA 4JBCA 1MHHE 1KM7A 1R43A 3M30B 4XIUA 4QBUA 1RCOB 1DGJA 1LXJA 1V6HA 3RRGA 1FFGB 3GFYA 2F65A 4M63A 2OO4A 3BGRB 2BWES 3MM5A 5HP1A 4GLSC 5IC4B 2O01C 1WYWB 3DBLI 2HBZB 3C6TB 1ZM4A 4WK1A 4BHQA 3T1YJ 4DV0F 3I5JC 2V50A 2VKZG 3N1YC 3KK2A 4J7CA 4OHVA 3AOCA 1TL3A 3Q8EA 3B08A 1SKRA 1S57A 1XQIA 4S0MA 4DUZJ 4F4ZA 3MM7B 1DTTA 3R2CJ 2HKEA 3A3PB 3OG5A 5AJ3F 1NHUA 3TARA 1FXRA 3WCQA 3GS2A 2VOPA 1L4ZB 2RD0A 4ZJLA 1ZZNA 1E6YA 3V4IA 3I5AA 4J9QA 3M4XA 3VVUA 5KT5A 2J7UA 3JS9A 2OAUA 3BSOA 2KO1A 4B02A 3HD2A 2ZHOA 3H20A 4O3SA 1JJHA 2ZH3A 1P3QU 1QUVA 1UETA 4LFBF 3PO5A 3S8SA 2YTCA 1SPBP 4CCHA 2J42A 3OFGA 1UWBB 1M0SA 4QR1A 2KL8A 2QSWA 3BREA 4NJ7A 1P7EA 1YN4A 1KLMB 2NXEA 3NBPB 1FDDA 2VZ9A 3M8QA 4FF4A 4PQUA 1W2BR 3GE8C 2DIVA 3PTWA 4WJBA 1AARA 4DL0C 2Y1RI 4CO7A 1GTHA 3ZLZA 3BSAA 4DV5J 3G6YA 1XT9B 2OMLA 1PGZA 4O3QA 2PT0A 4YWGG 3QWUA 2Z30B 5B0DA 1FCAA 4HDOA 1BXNA 3IM8A 1U48A 5B7WA 1I4GA 1MROA 5KFFA 4EOYA 1Q10A 5J2QB 1T9TA 1P8GA 4ZPTR 1DRZA 3DN9A 2YEPF 1HZ5A 1PYSB 1B0PA 5H9FK 1Q95G 3PS6A 1YJVA 1SH0A 5BYQA 4PEOA 5J2MB 4ZCKA 3TWZA 1Q4RA 4URKA 3FQKA 3RJMB 1SGHA 4I6WA 1WC1A 1KFDA 4I69A 4M5NA 4G50A 2VH7A 1WM3A 4YSYB 4HJKA 3MOZA 5AZHA 2PFDA 2IBKA 3PLVA 4LFCJ 3ZQ4A 2BS2B 1F3VA 2DJWA 3MURP 3LWMA 2MBHA 1FE0A 2BZ2A 3FCHA 5HROB 3A9KB 3EZ5A 1T0YA 1LNQA 2XS7A 2C1EB 4EEYA 3TI0A 2DYMA 2GRIA 2CU3A 2JWUA 2DGVA 3KK1B 2DAFA 1IKYB 5KFJA 4WTOB 3AB4B 4BDPA 3C3LA 4XTTA 2Q43A 1JXVA 2ZE2A 4LTUA 3NWRA 2BKFA 4E71A 2ILZA 2WXKA 4LF8F 3OV7A 3CO9A 2WONB 1XLQA 2XLKA 2B9EA 4HEA1 4LF4F 4C7YA 2BE2B 3R7BB 5K14A 2JZZA 4IFVA 1HBOA 5EE9A 1YGYA 2F40A 3WBZA 2R2OA 3TQ1A 4DV3F 1IR1A 5JMNA 1WR1A 4CO2A 4P75A 5DZ7A 1C0TB 2R2UA 2CQGA 4DHVA 2KDIA 4WYWA 2AKWB 5F8LA 3D3BJ 4B3MJ 3R7QA 1JLEB 1PQSA 2H51B 2R7UA 1C4AA 3QIJA 2E44A 3D32A 3NVWA 2Z56B 4IWOA 2MQ8A 3IBWA 5IQ6A 5L9XA 4TYBA 5B0FA 4ZVRB 1F9HA 4B9VA 3NHEB 3OSNA 1U6BA 4OYAA 4LNNA 4M5DB 1N62A 1GXLA 3MR2A 4OYIA 4TU7A 5IT9Y 4OHWA 4RW9A 2GNKA 3VXWA 3GZNB 1FI4A 1WZ0A 1KVJA 2KXJA 1DTQA 3L4BC 5IP4D 1SSNA 2ZBQA 1JJ2R 4KQZA 2A10A 4OYXA 4A4JA 4FVMA 1VOMA 3MAQA 3IT4B 4ZPBA 1ZUD2 2YNHB 2OHFA 1H3DA 2HMIA 2GQCA 5ETKA 2ICIA 2F1FA 3UDLA 3CIRB 5HLFA 3QJZA 3DHIC 2JVRA 2WSCC 4A55A 1IWGA 1FDNA 3KH0A 4ES1A 4K5RA 1U0SA 2IZVB 4L2YA 2BKNA 2C7HA 3MFIA 4B9LA 3M8SA 4WXWA 1S59A 4WP8A 4PXDA 2JYEA 5T8IA 3ELHA 3HT0A 3Q3OC 4JWSC 3LP0B 1YQHA 2B43A 5KFYA 3HHKA 4C4VB 1HWLA 1WUUA 4X65F 7AT1B 3ITHB 2E66A 3PHWB 4ED4A 5EWEA 3Q3JA 1RWSA 1RT4B 3MEEB 1D5ZC 2JF5A 2GGPA 5CZXA 1I3OB 1Q16B 2BWFA 5B0BA 1XNRF 3VGUA 2QCZA 5B09A 1M1GA 1WJ4A 1DBDA 4LSZB 5DQGA 3BINA 3HVTB 3TEGA 1RTJA 5DLFA 1TL1A 2X38A 3MPDA 1RBLA 2I1JA 4NXMF 4TNOA 3FILA 2EI5A 2MEWA 2ZBPA 9RUBA 1K52A 3W1SC 1QUPA 2MPUA 4F4YA 2B51A 1VISA 3X23A 1H38A 3KNAA 2QLXA 3I31A 3VAKA 1VQ7S 2EK1A 2C2RA 2KACA 2ALZA 4DV7F 1ZYQA 1RT7B 2GZOA 3AD7C 3AD9C 2B4PA 4DU7A 3QWZB 1TVRB 1ACMB 3HMJG 1D8ZA 5KG2A 2LD9A 2DHXA 3FRZA 3R8YA 2VH1A 4Q7AA 1SBBB 2PKOA 2PN6A 1RU2A 3H2VE 1DQAA 3O65B 1T8EA 2LMCA 4RUCA 4ED7A 2HEKA 3Q3NC 2VKRA 4OLOA 3VUXA 3EC8A 3ZVVA 3QAUA 2BE9B 2MKYA 2RILA 2B6AA 2XCPA 4TLQA 1LM8B 5BYRA 4DG1A 4WCEQ 2MQJA 3BQ2A 4FJVB 1C3TA 1IJEB 4KH1B 1E0ZA 4DV4F 3DBLB 3WIVA 1NK8A 3F73A 4NLSA 1GC6A 2L3MA 1J7AA 3VVWB 1F5CA 1F5BA 4C0HA 4ZVUB 1HBMB 4B95A 1RHQB 3T3OA 2KQ4X 3CD5A 3W2VB 2GQQA 3AE9B 2Y0SD 1TGZB 3QC8B 1ET6A 1B70B 3D1QA 4CLKA 1NK6A 3PX6A 2MLYA 1UZHA 1FXAA 2KO3A 1YJ7A 4EGLA 2VBWA 4ECZA 2VIHA 2LU1A 1V2YA 1HI8A 2RKIA 5IV3A 3D6MB 1UH6A 4OZCA 3PFEA 4IH5A 2G9OA 3CJ8A 2D07B 3A33B 4IG0B 4DSEA 3EGRA 3HZGA 4YHHF 1D3WA 2ZEJA 1I4HA 3JYTA 4DV6J 1N5YB 3V61A 1SE2A 3KMSA 2NTSA 3APFA 3ZTDA 3UO0A 2OSQA 4R8UB 4ED2A 1KLVA 4DK5A 2MMYA 1VZ6A 4NZ7A 2N0SB 3C46A 4K7WA 4OZNA 1KHWA 2I5JA 3NWGA 3H40A 2BEFA 5KFSA 3A8IA 4I7FB 1IKVA 2E6XA 3NGTA 4X64F 4BKSD 1BXTA 4PYUA 3K5PA 3Q8YA 1P1AA 4DR6J 3MF5A 2KHWB 1VC0A 4DSFA 3MPWA 2FC8A 2D3ZA 2EKIA 1RFKA 3J80Y 4WKYA 3WANA 1R8PA 1BUXA 2P2CB 1A70A 4PWDA 4G1QB 3E56A 2BE7D 3PRPB 1MMNA 2LXFA 1GH8A 1CPZA 1RLCL 2OD4A 1ROFA 5JVGQ 2NPIA 4LBHA 4KGMA 2Z58B 2K22A 2WXQA 5J2RA 1NSPA 3GIMA 3OR2B 4Y00A 4Q44A 1FO1A 2PA3A 4ANUA 1B9RA 2DNYA 4EI2A 2V4QA 4BVUC 5AT1B 1N5WA 1E8YA 4N58A 1J7CA 5KG3A 4RBTA 1N36J 4J9SA 2J0JA 1F2GA 3CO0P 4LF7J 5FJ4A 1FKOA 5KFBA 2Q79A 3R3MA 2RMMA 5F9NA 1H98A 5IT9U 4MGIE 2V8GA 1N32J 4JI3F 3CMAS 4FF1A 4KO0A 4QW9A 2O5DA 2MSED 5B0AA 5RUBA 4DQQA 4WE1A 4JI2J 4OMFG 1V3SA 2UUCJ 4DSIA 2WVEA 2N82B 1YTYA 4NWBA 5MPOA 2HBQB 4IO1A 2KX3A 2UUAF 4QW8A 2WVCA 3L16A 4EFAC 4NE9C 4DN9A 2KT5A 1ZPWX 3BK2A 1Z1ZA 2EFGA 3R5JB 5HL7Q 1V81A 4KDIC 3R1LA 2LVQA 5D8HB 1IP9A 2DR7A 1S9GA 1EP4A 4RNFA 3IVFA 2B3TB 3V6KA 4LVNP 4X4SA 1NH7A 4EBEA 2CJ9A 1A0OB 4WFBQ 2QMUB 4GRSA 3QSYB 2A2CA 3D0IE 2ZCBA 2IVMA 5IOLA 4GGQA 3OR1A 1HHTP 2QC3A 2DNGA 2WXIA 1YX6B 4OYMA 1UBQA 4FYWB 1FD2A 3A3NB 4JI5J 3UE2A 4FXCA 3W2WB 1X0FA 2CPFA 3IHPC 2K6QA 2BDPA 4DV2J 2O2VA 3RRKA 3O8WA 1GFWB 3OTDA 2GA7A 1N4LA 2VJUA 5LXIB 4P6VF 4WU2A 4N59A 3GYNA 1NHKL 3VH4B 3PCOB 2XBBC 4KSKC 3DNCA 1XN9A 4PR6A 3OVBA 4PCQA 2HVZA 4ERDA 4A8OA 1BQMA 1X31C 2ZITA 1JIHA 4DFPA 3GB0A 1ZDXA 1KC8T 1UWAA 4PWUA 1EUVB 3Q8RB 1KQKA 1S1TB 2YX1A 1FPYA 1HMVB 2KJ6A 2KHCA 3L09A 3P96A 4YMEA 4HR2A 2NQPA 1XC9A 1YX5B 1Q79A 4RGMA 2C2NA 2LA4A 5D0HA 1TELA 3V81B 2WB4A 4ZYSA 2KN4A 3EHVA 5CCMA 2R7WA 4O44B 3SR6A 5CYQA 3FSIA 1ZTWA 1WYGA 2MJUA 4ZDNA 1RHUB 3B4MA 1RE1B 2J7KA 2EVZA 2C3MA 2LI5A 3B8HA 2NS5A 2MX2A 2E3TA 3G82A 3CSKA 4OZJA 4HH0A 1OQRA 5KFIA 1CJVB 3Q8BA 2F63A 3TP2A 4KYZA 1WH3A 2JWNA 3CPWR 1I5OB 1IWAA 1UFWA 4CLUA 3L9ZA 2MEKA 3A1QA 3LPYA 1JKHB 4NAWB 1KFYB 2LGIA 4NI2B 1IBKF 2XLJA 4JV5F 3OVAA 2GIQA 4WXOA 1PO6A 3A9JA 2J6UA 4ITKA 3B0AA 3A1YG 3GFXA 4EBCA 5L1LA 1JLAA 4HPLB 1YQ4B 3VTIA 3RR7A 1GAQB 1RISA 3MWBA 4JOUA 3IGNA 2V2KA 1WXAA 8ATCB 2J52A 2C22A 1DHMA 5G0RA 1FVSA 1U8WA 2QFJA 2RT3A 1TK0A 2DR9A 2EPIA 4MFBA 2RS8A 5A8KB 4ZP7A 3DLGA 4J9UE 4NLQA 2HE7A 1VDHA 4QWDA 3TIXA 3VAFA 1E9MA 3EYZA 2FJVA 2UP1A 1U02A 3UR3C 2GBMA 1HR0J 4P2SA 3WX4A 3RB4A 2AJFE 4K8RA 1Q7LB 4KIKB 1JWMD 4M8NA 3AEDB 1N63A 1FKPB 3QAQA 1GMWD 2L9NA 2EEYA 3J80U 1NO8A 1YJNS 4RFBA 2YKMB 4P2FA 1OS5A 1P6TA 1R6VA 1AYEA 5L38A 1MWQA 2DR8A 1V1PB 4MTPA 4PXEA 1TJEA 2KJHB 1TUWA 5FR3A 1AROP 2D3OR 3T9LA 2GFFA 2C2ZB 4YS2A 2KYWA 5D2MB 2JNJA 1OPZA 2M9KA 3MAHA 5IA7A 4KIAA 5IZHA 1X5SA 3HUIA 4PG7A 3LAKA 4WU3A 4P74A 2CJBA 1UVLA 1HEZE 4LQ9A 2EFQA 1U0HA 2LEBA 5EUHA 2VF3A 4B9UA 4KV8B 5EGYA 2WXOA 1X4CA 2NMQA 2OEJA 1R7IA 3CT9A 1E90A 1RBAA 3APCA 3N5BA 5DETA 2QL9B 4DL5A 5B0CA 2FHKA 5GAEI 2JFKA 1M1KT 3GJQB 1YSJA 3Q69A 1X8DA 4GSWA 3BJYA 3H4DA 2HRYA 1WD6A 3P8BB 3OVSA 5E3AA 1U1NA 4DV1F 5LM7E 1J5OB 1D5XC 2QJLA 3TJ9A 1J27A 1YZ7A 1SH3A 1WOSA 3GYXB 1KQFB 5ETVA 3TRGA 1XR5A 4QYRA 2PA8D 1QD1A 5IAAC 1OQ3A 2R8GA 4USUA 2FCSA 1WJ9A 2HW3A 2VC0A 4NLXA 2Y8YA 3IBFB 1HBNB 2C2MB 2IGGA 1T95A 3W64A 1K9MT 4GKKJ 4N8NA 3OLAA 2AJ0A 2VJVA 3G8TA 4IM2A 3HHEA 2K3KA 2ZH7A 1HTOA 1ACCA 1S1QB 3SD5A 3IR6B 4DXLA 5HMWA 3ZRCA 2C3PA 5T41A 2W9CA 3M8ZA 4UOFA 2KFKB 1IBMJ 1U1QA 2V94A 5EX0A 2VFUA 2XEXA 2MY7A 4E98A 2G3QB 3D7SB 2D3UA 1B7FA 2YKAA 1OQ6A 3R8BA 3FEZA 2O6VA 1MPEA 1GNKA 2HQFA 1NK0A 1OSCA 2R7OA 2A2DA 1FRJA 2BQUA 1CC7A 2ACZB 1SIJA 3KTQA 3U1MA 2N3OA 4QU7A 4OX6A 5KOWA 1GPXA 2MLZA 1OWXA 3HDSA 4IWPA 5HI1A 3UDEA 5C25A 2MHEA 1N5TA 3M3JA 2NS1B 3MMCA 5HQMA 3T1YF 1VJQA 4ZRPA 2DNFA 2VH2A 1XD3B 2BUNA 4JV1A 1RTHA 3NY0A 3BSNA 1KOHA 5KG6A 4DUZF 4FYYB 2ACMA 3A12A 3NVVA 1CG2A 1FTCA 5C5JA 3H5XA 2O3DA 4LMZA 4I6AA 1S4FA 3MHYA 3AEBB 4DF4A 3TEZA 2AD9A 2M5YA 3PO4A 1ET9A 5B0GA 1HPZA 1JLBB 3RRHA 1VI7A 2I8EA 1CQVA 2M17A 3TCAA 5HVHA 1KOTA 4DHZB 4F3OA 4KHPJ 1J5EJ 2A3JA 2DCUB 3BPDA 4LR9A 2LEKA 3DRSA 2W7AA 4KGZB 1IM6A 4CT9A 3V6CB 3K9PB 3V2UC 2AW0A 2IM0A 1Y5LB 2CZVC 4F02A 1VHFA 2DNZA 2EKEC 2WDTB 4F2SA 2LQBA 2OEKA 4CYEA 3JW0X 4WYLA 2Y1LB 2OPPB 1FNOA 1REVA 1UVIA 2VL1A 1YN5A 1S1UA 3BGLA 3N30A 2EXUA 4CLSA 2BW2A 2XBPA 5KAKA 1HBUB 2WP9B 3MPYA 3TA0A 4EK2A 4DV5F 2MBBB 3GJSB 2PMZD 4W98A 1GQEA 1RBOB 1GMVA 2MKCA 3DYAA 4H4OA 2R2SA 1OEYA 4KKJA 3OHAA 2GCFA 4HHJA 2W2QP 2FB0A 4A8WA 1RT2A 2UV8A 2MKSA 1QOBA 1LWCA 4DN0A 1YJRA 5D3GA 4FPIA 1QT9A 2RB7A 3TZZA 5C42B 1R8AA 3BN7A 4CLFA 1RQ0A 3FUYA 1PAEX 5CYJA 5A0YA 4MKBA 4CM0A 3ML9A 3GPAA 3P6YC 1N5QA 2MJ3A 1LEOA 4GVBB 1WE6A 3RYLA 4PK1A 4OHYA 2GAGC 1QLNA 4GDKA 4LFCF 2FJAB 3M9MB 4XPEA 1P9YA 4KZCA 3MM9B 2M52A 3IG1A 2DZIA 2QMTA 3VAWA 4OHZA 1G1XA 1KTVA 1N0UA 1N88A 3IMQJ 3KLVA 2OMOA 5LLIA 1JLFA 1RWXB 1OY6A 1HQEA 2XMTA 2QA4G 3GP7A 2A6MA 2MBEA 4QU6A 3VAIA 5IM0A 1DOIA 2E1PA 3KWMA 4I6YA 4A8XA 4DQRA 1PJ5A 2OEDA 3I0SB 4WWSA 4RM8A 1MN9A 1NJXA 1X9SA 1UEUA 4ANWA 1B99A 1SKSA 2UXBJ 1P1LA 1AFIA 4ZCMA 3IAS1 4NLTA 1Y10A 1IQTA 4LLGM 4MACA 3F41A 4DI6A 1OYEA 1TT5B 2ZC3A 3PR5B 1KRPA 2ASYA 2K8BA 2YNIA 3VR8B 3AB2B 3H5YA 1ITPA 4J9RA 2Q6CA 1UPMB 1C2PA 1K1QA 1ZAWA 1FXTB 2KU7A 3D6HB 5AXNA 4B3MF 1Y3JA 1JRUA 1VZ8A 2I1RA 1TL4A 4CQ1A 1JJ4A 2W7PA 1J0GA 5FLXY 3KYCD 1HE8A 5A2QY 2FBWB 1UJ5A 3HZEA 3NAIA 1YBAA 3NZ3A 3RZFA 2DISA 4US9A 3IXSA 1VQ6S 3W9CB 1HNIA 1WGRA 4HVZA 5FDLB 2Y5PA 2K0PA 2B5JA 3HFVA 3ILLA 3VTVA 2N4DA 2L52A 1FESA 1LXDA 3ZTQA 4ALZA 3BZDB 1AUSL 1HYSA 1F9JA 2UYZB 4CH1A 1RTIA 4ZRIA 3TAMA 3ETMA 3UVJB 1QE1B 3L3CA 3NS7B 3W9HA 1M90T 2ASQA 4YP3A 1U49A 3I96A 2I2YA 4MJKA 3ZO5B 4HI2A 1KN6A 3LDZE 4N8OA 1K47A 2Z59B 1FERA 2WOMB 5JZEB 2AL3A 2AGPA 1T02A 1QSLA 4FNHA 1C77A 1C9FA 4C2MA 2XS5A 3LJ3A 3LXFA 1FF2A 3MI7X 3ZDTA 1UVKA 4WFAQ 5H9EK 4ES2A 1L3TA 1T9YA 4WURA 2OHDA 1B0TA 3AH6A 4JI0J 2YWFA 4V1Ak 3TX8A 4YR2A 4HROA 4W9CA 5E6JA 4DPTA 2MZSA 3MFGA 3LP1A 4B0EA 2N7JA 5BJRA 3M62B 3OHBA 4J90A 2V3PA 5EE0A 1S9EA 2MTLA 1S97A 2XNAC 4AS1A 1WDDA 2V6AA 4PZVA 3QFWA 3ZW3A 3WAMA 4PUOB 3X3UA 1UUPA 4RPFA 2R3VA 3NKYA 4RKUC 2CHZA 4ZHRB 4EUVA 2DWQA 2NZ4A 1KTKA 3I9V1 3GR1A 2SEBD 4J9NA 3V6DB 2B4UA 1NSQA 2BV3A 2RR9A 2BANB 1OFFA 1QY7A 4FYVB 3MZIA 1VQ9S 4JB8B 3B4DA 4OX7A 3GIIA 4Y6IA 2AZ1A 4OX9F 3KYLA 2R7QA 5KG7A 2FUG1 2PE9A 2RNEA 1R0AB 2NCNA 3J9CA 2LXIA 2AU0A 1RYJA 5KFMA 4DUYJ 1D3ZA 3MD3A 1NSKL 3VFKA 1UZDA 2VU5A 1Q53A 2Y5CA 1HD0A 3LOUA 1PGXA 3MEGA 2DRAA 3R9LA 1WF1A 2KRRA 2FGCA 4HEA9 4LF6J 4RNNA 1ZAVA 3M1VB 4YB6A 5L8RC 2EMSA 1LFDA 4Q5VA 4CO1A 1RXOB 5B0EA 3FC9A 1S6PB 1Q1OA 3U1NA 4USHA 3P45B 3WIMA 3RG6A 3PIPQ 4G1PA 4YY3J 2DHGA 2WCXA 3DU6A 1TKTB 5K8PA 1JNZB 1HQ2A 1PKUA 3BO2A 3MJWA 5E6NA 5IT4A 2CZ4A 5D7GA 1BWVA 1YD8U 1UEVA 4L74A 1HD1A 1RCXB 1QDUB 1FTRA 1VQKS 2X1BA 1TKEA 4KZ0A 1IKWB 3GONA 1IBCB 3OT9A 5BR8J 4J5OA 5ETMA 5L9NA 1M5KC 4QIVA 4BBNC 3MCOA 4ELUA 4RNOA 3L7PA 3NMAA 2MHNA 5FR6A 2HRTA 2CQ0A 2DITA 3KLSX 3OFEA 3DOLA 4DV6F 3MM5B 5HP1B 4J37A 4DHZE 4F50A 2VG7A 3AI5A 2MQMA 2G9HD 2Z2ZA 2C3UA 2QRRA 3QMQA 3KK2B 2V4IB 1TL3B 4B3OB 1R31A 2DGQA 4OLPA 1BWEA 2K2PA 4UTGA 1T9VA 3LGNA 2MKKA 3PW0A 1XNQJ 3LP2A 1FRIA 2OUGA 1DTTB 3PXGa 4DR6F 3W1YC 3MJ5A 2K8GA 4ZA1A 3I57A 4MYTA 2VHGA 2DY9A 3FCVA 4YQWA 2OFGX 4QYZJ 3PDNA 3N32A 1FNMA 1SIWB 3V4IB 3CVKA 2HFUA 4OYZA 1TKXA 3TANA 3MEKA 4IWQA 2MYFA 2WXMA 2WDQB 3RNGC 4AT1B 3K0JA 4M5HA 5MAOA 3BGFA 1MG4A 3GIRA 1BD6A 1C1BA 3M2UA 2OOBB 4PXCA 2QEXS 1L3SA 2HVDA 1QLBB 5FD1A 1C79A 3K5MA 2ZW0A 5FLXU 2D74B 4WZMA 2G4DB 2KXFA 3ZJUA 4UZCA 5A2QU 2WB1D 2X3GA 1N36F 1S99A 3CJ0A 5J1EA 4LF7F 1SL1A 4WQOB 2EBEA 2HPUA 2HNZA 3M8QB 3RW7A 4PQUB 2I9SA 4HI1A 1N32F 1H4RA 1XERA 2J0MA 4J3OD 4W4MA 2HURA 1FT8A 5HANA 4F8CB 1TYGB 4JI2F 1W7WA 1SXLA 1UJ4A 3M32A 4EBDA 1TS3A 3LH2S 1MJDA 3B82A 3AD8C 2UUCF 1EKRA 2EMTA 4IG7B 1B7YB 2F9JA 4C0BA 3M6UA 1MROB 1FA0A 2ZKUA 4G11A 3PHXB 2I1KA 4BC9A 2FLOA 1YDLA 2ZHAA 3K58A 4Q0BA 1XLNA 1CQMA 3BH6B 1RT3A 4JE3B 1X4AA 2JLGA 1CS4A 2KXNB 4RF1A 1NKEA 2N3LA 2GAHC 2IIHA 3BM7A 1P1TA 4DS4A 1V6EA 4YB5A 3PY8A 4ID8A 2FD2A 2JU6X 4MH0E 1T0TV 2LHDA 2DNMA 3HJVA 3BYPA 1QJHA 4NCAA 2VFTA 4XDCA 2C7MB 2DH9A 3SDLC 4BBYA 2KWUB 1HI1A 1HWKA 1UWXA 4MIBA 3ZIMA 1V49A 1VC5A 3RZWC 5K8MA 4O4RA 3FFIA 2FLNA 4W9DA 1S1VA 2Y5BB 2DGWA 2HNDB 2GJ2A 1PC4A 2VZKB 1OQQA 3R5BA 1K44A 1BMQB 4JI5F 1HI0P 4ASWC 5CH7B 4GO7X 1N61A 1L0XB 4USIA 5A8WB 1B64A 2ZE2B 5AXMA 4DZDA 2ASLA 1GJZA 4YEAA 5DG9A 3MPUB 4DV2F 1SJED 1KF6B 3NCQA 4B0MA 2G13A 4KGTA 2EWHA 5ETPA 1VYAA 3I82A 3TYTA 1RLDA 2FVRA 4ANCA 4IFVB 2PJHA 4BKGA 2VZKD 1CJEA 3CEDA 1HBOB 2KTFA 4M5IA 5D4NA 3M8PA 4GVLA 5IQQA 4LF5J 2C2DA 2AL6A 1DJ0A 2LRWA 4RNHA 4MKAA 3DLHA 3ECIA 2CDQA 3MECA 3DRXA 1O51A 3TVZA 4BC7A 4BWMA 2W25A 1P9DU 3KYDD 2X1GA 3X1LB 4F0KA 2AEFA 1F52A 2W8KA 2XI3A 3O5TB 4LBIA 3R97A 5F3ZA 4FDFA 4FF2A 4K5SA 3TMPB 5LJ3Y 2KFYA 4IOAQ 2Y9HA 2KANA 2FY8A 4LRCA 1Y3KA 1UEKA 1HKAA 4RW9B 2MSSA 4TY8A 2QIFA 3GFZA 4II2B 1Q5WB 3SI8A 2IO1B 3DBRI 4ZDVA 3AB5A 4EZ9A 3T3FA 3PZPA 2BXJA 4CNZA 1DTQB 3AE7B 3KLHA 1ZP0B 4EFOA 1X4BA 4IDKA 5F41A 2DO0A 3CW2C 3IT6B 4A48A 3BF4A 4L23A 4JX1C 1FK9A 1TAUA 2KVIA 4US8A 1RABB 2HMIB 4JI1J 2GJFA 2QMXA 3TQEA 4KFBA 3W5XA 4MELA 5HLFB 2E29A 2ADCA 3GSDA 2Z0EB 5ADZA 2CJNA 2H88B 4NZLB 1JALA 5HO4A 1T0RC 2AF6A 3MR7A 1GXTA 2YEPB 3FSXA 3IFEA 4U9RA 1WEYA 4V19X 3HM3A 2ZJRQ 4ED0A 3N6NA 3V05A 4YT0B 1WFYA 2LWPA 1FIQA 3OLMD 2KT3A 3H2LA 2DHSA 3AAWB 1PUTA 1D9AA 3ZTSA 4CNYA 1Q78A 2G2OA 3URYA 2GGPB 1CMXB 1L5PA 2RF2B 5HKHA 1YX2A 1SL0A 2JLEA 4X4VA 4MIAA 4LIRA 4PWWA 5C24A 1FNXH 2HNYB 2D3GA 1RTJB 1TL1B 4CHKA 3OQ2A 1PILA 3IA0A 1X9WA 1FNWA 3TJPA 3FILB 2CQ4A 4FS2A 2DNHA 2GVDA 4IOCQ 2B76B 2MLXA 3ADAC 4A6QA 1HR0F 3N1ZC 3CDAA 2D9OA 1VRUB 3KK3A 5IXUA 2CJQA 4NZ6A 3CJRA 3I55S 1WRIA 2EFVA 3PJXA 5DGAA 4J9KA 1X0PA 3NGDA 4G1IA 3RGIA 3O1LA 2FTRA 4LR7A 4OZBA 3ZZUA 1GB4A 2XNQA 3LB8C 2AP6A 5J1NA 2IBOA 3K8WA 2XMUA 1ZZFA 1C0UB 1NBFC 1YNTE 2KRBA 3KG4A 4K59A 2HQCA 4RNMA 1NH8A 3IWNC 5FKAC 4KHRA 4TN2A 2DNLA 4G0NB 1JJCB 1AWDA 3A4SC 2PEBA 4XGAB 2X7IA 2BQ3A 2IFXA 1RSCA 4HHHA 2IYDB 1YKWA 2HJ8A 2M0AA 3CULA 3OTCA 2B6AB 3HHDA 4ELTA 1T9UA 4WFYA 4NCGB 2PI5A 3EGVA 4DG1B 4ZVFA 2DZMA 4IYQA 2LFIA 1SB6A 3RNCC 2CFXA 4ILLA 2DYOA 4N77A 4PG4A 4I67A 2DPJA 1D9DA 3D5MA 1NYQA 2IJ0A 4YB1P 4TSSA 2CPXA 3JYUA 3KLIB 1IN0A 3OJSA 4HTJA 3RFZB 2XSFA 4OI2A 5ETRA 4C8OA 3HSGA 2CPYA 3RN9C 3SQGA 1Q82T 2COLA 3IC1A 4PG8A 5DLGA 3AULA 5I4DA 3D3CJ 3B2FA 1WGGA 1V5TA 1K0VA 2GO8A 3ML8A 1V9OA 4W90B 2AYBA 4WAAA 2H3EB 1MMLA 3BB5A 2X3DA 4EU0A 5J2NA 1RWVB 2YVSA 3HVRA 4KHMA 1XO3A 2FNJB 2RKIB 4ZCLA 1T7PA 1VRTA 4F8RA 2RDIA 1KLNA 1PIEA 3ENEA 3EMTA 3HK2A 1AFJA 3P5BP 1S0MA 5DDPC 4WK3A 3JYTB 4WZQA 2E9RX 4C48A 2DK2A 4MEMA 1RP5A 3DRYA 4O4GA 3I0RB 5M2UA 2QA2A 4PS3A 4OZ1A 1IBMF 1FDAA 3I4PA 2I5JB 1T3NA 3BGRA 3EICA 2GO9A 1IKVB 3MTKA 1DYQA 2LGXA 2G4SA 4X4NA 5FK9C 3C6TA 1VQPS 3DLKA 3QGGA 4A46A 2WBRA 2L08A 4CLLA 1RHJB 3QRPA 4DEZA 4XE0A 4BOSC 1T9WA 2BQRA 1M1HA 3PACA 3OTBA 2DPIA 3AJDA 4IC7B 1UF0A 4OIXA 4PWDB 1UMJA 3KLEA 2EG1A 3F0NA 1WOOA 1KKHA 4NLDA 3DOWA 3C16A 1NNDA 2J9EA 1N48A 3ZZPA 3DWGC 3RPFC 1WG4A 3LW5C 4O23A 4K4VA 1R7SA 4ZRJA 4XWTA 2P9CA 2L7RA 3HHLC 2G1DA 2CQ1A 4YSXB 2PIAA 4RX6A 4A8QA 1H7WA 2J53A 4W9GA 2GJIA 4F7VA 3T6JA 1FKOB 4TYAA 3ABVB 2OJWA 4NYOA 5G4DA 3SSSA 2JEIA 3EZUA 4AJWA 3SZ2A 5KFAA 4AD6A 2OPRA 4KO0B 2UVWA 1S77D 4WE1B 4KHPF 2MSTA 4ZVGA 1J5EF 4BS2A 3HD1A 2HRUA 5G5HA 4C56C 4LSLA 4K1RB 1N60A 3QIPA 1EARA 2NSCA 2SAKA 4USMA 1N5VA 2BKOA 4DS5A 2JEJA 1T0SC 3ZNHB 3J81Y 3P4UB 4KH0B 1WORA 1CJUB 2DAJA 2V9WA 3EFCA 5J2QA 2GV1A 2ZDOA 1XR7A 1S9GB 1EP4B 2JRSA 2A18A 2UZAA 1NU4A 2BJ9A 1XQQA 4UY8T 3A8EA 1PFDA 1B3TA 4REZA 3H2UB 3RNEC 1JLQA 3IS9A 3BYYB 1LQ9A 3EECA 1YRXA 3NVYA 3NY5A 1MU2A 4JI8J 2CVIA 3OR1B 3SYZA 3CD6S 1WSPA 2RUGA 2CNKB 4PABA 3K2YA 5L1IA 3TZYA 3W7BA 2IM2A 1WJNA 3N20C 3W1SA 3OW2R 1NKCA 5L39A 4TQSA 3DM2A 1AA1B 2O2VB 3H4BA 2WXGA 4Q2MA 1IKYA 3LUYA 1T3OA 1Y0HA 2ILYA 5IFMA 1FX2A 4EMDA 4OI3A 3CF5Q 5CAAA 1R3NA 3CCUS 5EWFA 3RTVA 4QIEA 1Q0WB 2WONA 4U95A 1URNA 3G8QA 1BQMB 3DI6B 1WGHA 1M5VC 4GN1A 3R5CA 3D0GE 4MK8A 1X5PA 4K2XA 4D3GA 3BGOP 3O2IA 1XMOJ 2KFJA 2GI9A 4A9AA 4NLOA 4GKJJ 4ID5A 2R9LA 1C0TA 4AL6A 1M94A 3K5NA 4A90A 3IAM1 1JMLA 4PAAA 4NLGA 4B3TJ 4KDLB 4ED5A 2UXBF 2IJNA 3QLHB 4HTIA 3E8OA 2RGFA 3P4QB 2AQ4A 2UVUA 4D2KA 4FKXA 5CYQB 3FQLA 2RDJA 5DCNA 4TY9A 3VV2B 4ZLLA 4RR5A 2MB0B 2MQQA 3CCJS 3FVYA 4OYOA 4KB7A 2FZKB 1K73T 4HCNB 2QLFB 3V4MA 1VQ8S 1IGCA 4OX8A 4FBTA 3VAMA 3T5JA 4PG6A 3G82B 4AYBD 4M01A 4NJ6A 5K8NA 1XK8A 3M8YA 2K06A 4FPRA 2GW8A 3RW6A 1AB8A 5DM6Q 3S1TA 5A76A 2H4YB 3A1QB 2P9EA 1ZTTA 1NK4A 5LOQA 4L76A 4P16A 3MCNA 1WF0A 2ZVNA 1KD1T 3W2DA 3DRRA 2RRAA 3A9JB 1SIFA 1JLAB 2UVVA 4F25A 2LECA 2RVJA 3P2BA 1O8BA 4KKOA 2HQDA 5D15A 3J7YU 2J76E 2QYGA 2VQFJ 4AUQC 3HSJA 3DBSA 3QCAA 3H5UA 2YH1A 1B0VA 2FGOA 5CCLA 5L1JA 5F8MA 3A8KA 1B1ZA 3UFCX 1DZ5A 1V1OA 3ITHA 4NLYA 4Q2JA 4MFBB 3DLGB 1O5JA 1TU0B 3RU0A 1CVJA 4IKAA 4Q2LA 1Q8BA 1RT4A 3M2RA 2IDYA 4JPSA 2FC9A 3Q22A 3NNAA 1U1OA 2AQ2B 2L41A 3TAPA 4LRFA 2HHSA 1IYFA 2XO7A 1WGDA 4ZMMA 2DIUA 3VZHA 4CLWA 3WC2A 3OL7A 3HVTA 2XMMA 2ZM6J 3FBFA 1JLCB 1R6YA 4PG5A 3MMAB 1YQ3B 1EHWA 2BS3B 4WJNA 3MEDA 2CPZA 3R5GA 3CDBA 5BMHA 1EU4A 3OPKA 2IPOB 2HQ3A 4JI0F 1EJ7L 1HWUA 2KJVA 1R4MI 2WK4A 2MP2A 5IV4A 1CJTA 1YG0A 1OY8A 3AEFB 4C8LA 3I63C 2ZVIA 4EYHB 2KT2A 3ZTPA 4ANVA 3TVKA 2DY1A 3MMBA 3HFZB 2B8PA 4GMVA 1EWYC 1KLGD 1VJKA 2LXCA 2JC1A 3C0RB 4I6NB 2W9AA 4WPAA 2LVWA 1QVGR 5HJXA 2GHVC 1H2TZ 5HSPA 2P6SA 3UR0A 3ISND 3T6BA 1E7UA 1VQYA 2CUYA 3FDSA 1BY9A 1U0HB 2QLJB 4DBQA 1WG5A 3SHQA 4KSEB 1RT6A 1VK8A 5KFHA 2OTJS 1FMAD 3BH7B 3CJKA 3EPGA 1UFKA 2FE8A 2PMWA 3JSYA 4QIGA 3QT6A 2W9NA 2B7BB 2RE1A 3KLGA 3KJFB 4USVA 1SI9A 2LA6A 4RBVA 2Z4PA 2CNLB 3BBFA 4WJQA 2EBGA 3A4RA 1NJIT 4JGHB 1K1SA 1OMSA 4MM3A 5EE3A 4ZVHA 5I3QA 4DUYF 3MAAA 1VCBA 4P9SA 1UW9A 1KQSR 1QQRA 2CQIA 3PEJA 3NS8A 1LWEA 3H7HB 4ZHPA 1N6ZA 2JXXA 1MVKA 4LF6F 2YH0A 1OEYJ 3JTNA 3OLBA 1NDDA 2Z2MA 1W26A 2LUEA 3R7SB 2GBJA 3IWLA 3IAS9 2O67A 1K53A 3DDCB 3WA0A 4RCOA 2MKJA 2VOOA 2ZHBA 4YY3F 2L05A 5HHDG 2BOPA 3VAJA 2NYHA 4LQ3A 1YN3A 1Y4ZB 2ZH6A 2W9CB 2DGTA 4KPCA 3BVGA 4K4YA 4Q8EA 3UIPB 3QGIA 3NS1A 3AE3B 2N1VA 3ILJA 4RH6A 1YQBA 1Q8KA 4IOBA 3MR3A 3NEKA 5LXYA 2C42A 2O6VB 3TNVA 3BVMA 2XMJA 3CJQA 1RWPB 4TXSA 5BR8F 2YPZA 3PHTA 3W5YA 4GC6A 1SJ1A 1SF0A 1WJ6A 3Q8UA 4CI0B 2C60A 2I0XA 1FNUA 5JHAA 4PPZA 2KDBA 2MHJA 2CHXA 3OJ4B 3TUOA 1NENB 2JRHA 4P72A 5A6WA 2H9ZA 1HQUA 1S1WA 4WWMA 4ZK7M 1HA1A 2A4ZA 5KFZA 1QF6A 1KNZA 1LW2B 2F4VJ 2O6VD 1CC8A 3MMCB 4UZBA 4HPMB 2ZNVB 3ZNZB 2ERRA 2MZ1A 2V4JA 2XO6A 1RTHB 2HIQA 3ZZYA 2AJ4A 3ULHA 3WAOA 5J17A 4CM2A 2E1CA 2ZWPA 1XNQF 4UUWA 1LK7A 4ECVA 3KNGA 2QHOA 2D7SA 4F3MA 2BR0A 3D67A 1DY3A 1N34F 2Z8LA 4IO9Q 4KY3A 2YKNA 5SUHA 2H65B 1VMBA 1HPZB 1HNXJ 4OI0A 1I94J 1SJHD 4UQTA 3SQOP 3THTA 1S12A 5M2PA 3PZ8A 1NZAA 1Y00A 2WU5B 3PFOA 3QBCA 2A6OA 3NAHA 2YWKA 5KFDA 3O44A 3D6FB 1QSSA 1JRPA 3VRAB 5ETQA 1EO6A 3QQ8B 2BBEA 1IJFB 3IR5B 2ZH4A 1S6UA 4DWFA 4R25A 4EZJA 2C2KB 3L4PA 1LOUA 3DQVA 3L17A 3RR8A 5J2PA 1F9FA 4LCDE 2IAJA 4JIOU 1VC6A 1S1UB 1NDCA 4FNIA 2W24A 2ZVOA 4I6PA 5D6GA 2W4PA 1J2VA 3N4WA 4U7CA 2DR5A 1OIAA 2ZWOA 2B0GA 3DYAB 3BS9A 2M1MA 3RNBC 2V8VA 1LQBA 3I9V9 2BT6A 4DX6A 1S1XB 1RT2B 2E1RA 1KVKA 2WX1A 1LWCB 4MH8A 2RMLA 2F8HA 3W9IA 2IY1B 4NQKE 1MMDA 1ESFA 3LQVA 4MGYE 2CDRB 4XAKA 2MZJA 2U2FA 5A0YB 4ECWA 4XK8C 4ECRA 1APSA 3NS6A 2AZ3A 2LZ6A 2FUG9 3UPFA 1N8RT 1WRDB 2DZKA 1T05A 2AV5A 4ICUA 1JNRB 4C8MA 3DOKA 4MGZE 2BMBA 4GDKB 3JB9k 5A8RB 2QDFA 3OTEA 1Y5NB 2KNBA 3IG1B 1QKZA 3H6NA 5DO2A 1L7YA 2NREA 4E3CA 3DPDA 3EXCX 2NUHA 4HPPA 2D69A 1KEKA 5KFPA 3LANA 5D0EA 1JLFB 1UVNA 3THPA 1HQEB 1A5RA 2LXUA 1V3ZA 3U27A 3OL9A 1K8RB 1VDVA 1VR9A 2G0IA 4FHKA 3NCRA 5IM0B 3CD7A 1WWTA 3G4SS 4HCPB 4GIVA 2V8DA 3GB1A 3IO1A 2WRMA 1I1GA 4FA6A 3H25A 3JSMA 5H9FJ 2VODA 1S0VA 3QT5A 3JTOA 3Q8VA 2WXHA 2VPWB 5DDRC 1SQFA 1UVMA 1EQ0A 3ZJVA 4ZVQB 4LF5F 2NVUI 2ZFHA 2YNIB 4K4SA 2ZNVC 1L4DB 2EKYA 3L54A 3JQMA 2KZZA 2E5LJ 3DU5A 2Q66A 4DQPA 3AMZA 1WE7A 5HBMA 2XS2A 1K50A 3OBIA 4O3PA 2MWSB 5KHOA 1VLOA 5KFTA 3ZRFA 2XNRA 4R3DA 2FJXA 2NZCA 2OSRA 3EA6A 1X1MA 2GS8A 3HM9A 5IC6B 2XYPB 3AY0A 1JB0C 2J9DA 2OELA 4WFZA 3UCGA 3ZDMC 1HNIB 5JUMA 3SSRA 2PEHA 3D1HA 4C8NA 4F36A 4RJVA 1URRA 4H4KC 2B5JB 4GU2A 5KT7A 5KHQA 2ZBIA 4YDXA 1UNSA 1R4MB 4CP5A 4NPNA 1HYSB 2M88A 1RTIB 1MWZA 3TAMB 3TR5A 3CUNA 2PW9A 3CCVS 3KOAA 2YVCA 4UF4A 1YVFA 2JFDA 2JVOA 2J7WA 2MXYA 4JI1F 2KDFB 1OO0B 3EVOA 5D94A 2DHHA 5BXIA 4C00A 1QAIA 1U2RA 3C14A 3RNFC 4U6PA 1SIZA 2MGZA 4F67A 1R4NB 4RW7A 3N9YC 4P71A 4MMOA 4HK2A 3T1HJ 5KG5A 1KWMA 1BQNA 3KKFA 4OVZA 2YWGA 1TTHB 1NPKA 1VIOA 1PAUB 3RAXA 1RGVA 1XCQL 3BY4B 1NZ8A 4JYAJ 3I56S 1X4EA 1NVID 5E0OA 3Q8PB 2BYCA 4IFYB 3IWXA 2AWTA 5KFKA 5KT6A 4WBFA 1F60B 1WSVA 1TKGA 3PR4A 2H5IB 1C4PA 4R5PA 4J9LA 3LP1B 2FHMA 4MKYA 2WGSA 1IPGA 4A3PA 1FKPA 2JSXA 5DQHA 4ED1A 1XCTL 3F44A 1C78A 1WXMA 3A4TA 3FNNA 1RAAB 3MR6A 2F8MA 1LO5D 1GOZA 2LHEA 4CH7A 2IO0B 1YLXA 4Q45A 2XMAA 1EETA 1S7IA 3MCSA 3GJTB 3IBCB 2GVZA 2MY8A 3VR9B 3OWEB 4A8SA 3RCZA 2M8SA 1F0XA 2LDYA 3WAPA 4EWTA 2ZOFA 1N54B 1RM6C 1KLUD 4JL9A 5KFOA 2DRDA 4YXDB 2WDVB 1R89A 1UGMA 2PC6A 2QC8A 2ZPNA 3Q8QB 2DZJA 1RWMB 4C3MA 4JI4J 1KQGB 3MTJA 4RUBA 1RWNB 4OX9J 5ETOA 3ZZTA 3P42A 1R0BG 3BGUA 3HM6X 2J0KA 2QL7B 1UZXB 4M5KA 2R61A 3TEYA 3SSQA 3PT2B 3QT8A 3HIZA 2W2OP 3HJFA 3PEHA 2CQ3A 4B08A 2MW5A 2N9PC 5F8NA 2NBUA 3H9DA 3MEGB 2CVEA 4LF2A 3DGVA 4V19J 3GE9A 3TL5A 1UPPA 1JQGA 1NEKB 2C3YA 3CCMS 1Q0NA 1M5PC 2WSFC 1HWJA 1VQSA 1ZPVA 2V2QA 1V3RA 1JLGB 1J7BA 1FD6A 3HX9A 4C80A 5KG4A 3JSVA 1C76A 3V5RA 4IUMB 3MGJA 2RQKA 2JLFA 5F8JA 2MBQA 4OFZA 4KSLC 2KM8B 3RUBL 4IG3A 2RPVA 5KFVA 1V5IB 3AXCA 4OVUA 3G6XA 3WALA 1F2RC 4A3OA 4EYIB 2I38A 1DURA 4E0DA 1SE9A 4C11A 1RHMB 4YTNB 2YQ1A 1RUSA 3NOGA 2MJNA 2HZAA 3HXMA 4J6IA 3S2AA 1FVQA 1FRLA 3E9SA 4LSNA 2GIRA 1SE4A 2FJWA 1RAXA 1YJIA 4KGVB 5DRKA 3KG1A 3FEYB 1CZPA 2JRIB 3DOLB 3R6GB 2CYYA 1QAYA 2B8QA 3HRDD 2EC0A 2VG7B 2JZPA 1G7CB 1PBUA 4K4XA 1D9FA 3CCZA 2RD5C 1SJ3P 2MQNA 4IRKA 1C1YB 4JLCA 1AXQA 1JWAD 4WWPA 1TKDA 1KP6A 5IS2A 2PIIA 3V6HA 2JY6A 3CJSA 1WKLA 2QYCA 1L3KA 3UCUP 2ZH8A 3BYTB 2Y1IA 3LP2B 5E2QA 2JZ3B 2IM3A 4NX9A 2V2ZA 1VBYA 4OL8A 2MJEA 4AE5A 3UINB 4P7VA 1S6QB 4DR5J 5D0GA 1D1UA 2ADBA 4DLEA 3E2EA 2GMHA 2N7EA 1TKXB 4ZIWA 1ZW7A 4HACA 1FJCA 2FVPA 3ONQA 2W82A 2C3OA 1MG8A 3M9OB 2IC3A 2KK8A 2FVQA 5CD4A 1N0VC 4UUXA 1C1BB 3VRBB 2M0XA 5D3DA 4OZ2A 3GIKA 2W1BA 2Q6BA 3VF0B 2HS4A 1SKWA 1EX8A 2YNGB 2WVDA 4MAKA 2IMOA 4IKGA 3H8YA 1QAXA 1R27B 4EE2A 3KJVA 3X0WA 3WHIA 4MT1A 1FXDA 5I42A 1JWSD 4GMKA 1RRBA 3AOAA 5J1EB 2VC1A 2E5JA 2HNZB 3LYYA 3KHRA 3IBEA 4NLRA 2BYEA 2K6DB 1QTNB 1VD2A 3DOMA 2DNOA 4CYUA 5GAHI 1ZM9A 1EWCA 2KHDA 1TZ1A 2CNOB 1HQRD 3QQCD 3M32B 4ILRA 4RU2A 2ON8A 4HKQA 3GFHA 5F8HA 1UA0A 4W9EA 2WVBA 1WC3A 1FJ7A 4CLYA 2DCLA 4DL2A 2JXTA 2DO4A 4CO3A 3E3XA 1WC5A 2BA9A 3ENQA 4KE5A 2XK5A 4DF8A 2EELA 2IPKD 3QHTA 2WSEC 3DXSX 1YIJS 2WHOA 4URSA 1CS4B 1DARA 2UXCJ 3LA0A 1H2VZ 5HAOA 4JP8A 1AN8A 3VQTA 2DBBA 4RMAA 2QEJC 3CC2S 2ZJPQ 3AU5A 2W4CA 4W9LA 1QTMA 2ZC4A 3JSRA 3W5UB 3TO8A 4XWWA 1E10A 3KG0A 3ZXRA 4HLBA 4JI8F 2RDDA 2KDOA 2AQ1B 4WTYA 3BKTA 2MLBA 3FFIB 4KX6B 5AZFA 2B7CB 3PHEA 2N1WA 1FKAF 2LEAA 4X4UA 2CHWA 1PJ7A 2GBKA 4HXDA 4ZP8A 1IKXA 3K89A 1Z5SB 3OJ3A 5U47A 1S4EA 2J6SA 4HLEA 2AYMA 4KKIA 2DGSA 1T0QC 1I35A 1WX9A 1VFJA 2QLWA 7FD1A 2YQ0A 3ET6A 3MDFA 3L7UA 2JUOA 1Q7YT 2KFZA 3E51A 3POTB 2EKNA 3M8PB 1IGDA 3F56A 2HK2A 3QNWB 2DNQA 2XSJA 5CZVA 2R2QA 1UBIA 4U7UD 4DL4A 4GDLA 1XMOF 4K4WA 2WU2B 3MECB 4GKJF 2ZEQA 2IMWP 3RULA 2BPSA 2KTQA 3HT3A 4BKTA 4B3TF 2MH7A 3AFGA 2D3O1 2FUHB 3GV5B 4Q43A 4PXBA 2VBYA 3UIOB 1IBXA 1E6EB 1UP1A 1AYFA 5K5MA 4FXDA 5DQIA 2WQYB 3MP9A 2OPSA 2Z0DB 5T7LA 4H4MA 1YZ6A 3LF0A 4TY8B 1CULA 4OHJA 2LJIA 4HDGA 2XULA 3NVZA 1DLOA 4ZRKA 2EFNA 2P6TA 4M5LA 4MGKE 4HJGE 3R7NB 1WIAA 3VQIA 2VG6A 4IDKB 4RW8A 5CYMB 3RB3A 1LWFB 4Y2MA 4M5MA 3UN3A 1S7HA 4KAIA 2PE8A 1D4BA 5KFLA 1FK9B 4FZVA 4KFBB 2HTHA 4N47A 4M95A 2D1CA 2OP5A 4ER8A 2XZDB 5GADI 1XXGA 2AEJA 4ECQA 5B08A 4B9MA 2ZPYA 3CDEA 2C5LC 4NXNJ 1V5OA 4RBUA 3C15A 2BYVE 3M95A 1ZAXA 1JWWA 3HVZA 1B4SA 1Y7PA 3K7RA 3DVNU 2DXDA 1HL6A 1WOPA 2WOMA 3N6LA 2VQFF 3PV1A 3ISZA 3RYTA 1NJZA 2BVCA 3BQ1A 5BMIA 3TUIC 5BO4B 3DVGX 3FJ2A 5C24B 1I4RA 1GMUA 3FSYA 2KZRA 1Z2ZA 1UWMA 3GZNI 4PQAA 3V3XA 3GCXP 2XMWA 1N6QA 4B17A 3AA8A 1X5TA 3PW7A 3MFHA 1MSWD 3CNQP 2N9LA 5KG1A 2WXRA 2BACA 2GVDB 4ICLA 1XMQJ 2VRRB 2L76A 4WP9A 3QA8A 2ZM6F 5F8IA 3MC8A 1SV5A 4DPYA 4W9FA 3KK3B 3T5KA 3AN1A 2DH8A 2M8HA 2P8IA 2ZBRA 4NNJB 1XLPA 2UU7A 2BQQA 1H7XA 2HHUA 1Q5YA 3MUTP 3TVYA 2FIDA 3ZZOA 3FZ2A 2V3SA 5HATA 2EC2A 3ZZRA 1HNWJ 3LO3A 3DGPA 4DCOB 1U8SA 5AXKA 3B54A 1G6BA 3O6QA 4WIPA 4LREA 2WS3B 5EN1A 1VRAB 3U7JA 1OGWA 4ZCIA 5LSLA 3B2GA 1KRHA 4ZRQA 2IY5B 3EUNA 4E8UA 1IM4A 1L6UA 2X8XX 3NUHB 2RU9A 3L0WB 3PGEA 3EVMA 2FZCB 2RPQA 1H72C 3HLUA 2QMWA 4FBJB 1WMHA 2BJ3A 1K8AT 4XX5A 2J8AA 4ZP9A 4C7QA 5TSSA 4X4TA 4CTAA 3H7PA 3CDWA 3S7RA 1R8HA 1EKSA 3OSPA 2HVEA 1RTDB 4O0IA 3SQGB 1FEHA 4ED6A 5EE1A 1F6TA 1FRHA 2WTFA 1TKTA 1WHWA 3LWLA 4ZLPA 3NMRA 2BJ7A 3IN5A 4WKRA 2WXLA 5J2NB 1YK9A 3R2IA 1U6ZA 2N9EB 3NRZA 3B9JA 1MLAA 3SXLA 1VRTB 4EO8A 2QFIA 4M8MA 2XY7A 3D1OA 4QQBA 2JEGA 4X4PA 5DG8A 1TFYA 3QSIA 1NDKA 2HGMA 1ZBTA 1E6VB 4O4GB 6FDRA 3R3TA 5KFQA 5KFXA 4K4UA 3U02A 3PV8A 2XLIA 2UU9F 1GB1A 2L00B 3SDEB 2W3RA 4OZ3A 4JUZA 3KJQB 2K3UA 4JI6F 1WKKA 1CQNA 1ROEA 3DLKB 4ZPAA 3ZZ0A 4K0KJ 3D4JA 1E8WA 1YOVB 5A6PA 4BCAA 3V60A 3A3OB 2K7JA 3ZZZA 3N79A 4B3OA 1GC7A 2DBYA 1WTFA 2CJKA 1RDRA 3MM8A 4LIWA 4YL8A 3BDEA 3VH3B 3ALBA 3KLEB 4DOZA 3MUMP 2G45B 2VDIA 2L0TA 4I2PA 3CCSS 5GADU 2X51A 2F4VF 3C16B 5LJ5Y 4P2MA 2WX0A 2ZH1A 3I9ZA 3Q23A 2RDHA 3BV8A 2UUWA 2R7SA 4P2XA 4F4AA 3TEXA 2AJ2A 3BKUA 2M8DB 2DKOB 2JOQA 4L72B 4LF1A 1EIYB 4W9KA 2ZNZA 1N5SA 1AZSA 3MM6A 3Q6BA 3T1AA 2AMCB 3AH7A 1RT5A 2JEFA 2KDMA 2YY3A 4ZOHC 1GG3A 2OPRB 3H90A 1VQNS 4HT5A 4M8LA 1TAQA 1HNXF 1I94F 3NXZA 3KHGA 3NRBA 3L95X 3EFUA 2RDBC 3QZ8A 4LSLB 3AXMA 3NZSA 3EDRB 3QIPB 1TL5A 1S76D 1SVDA 5E3PA 1X5OA 2NXCA 3LGHA 4RUHA 2RSQA 2JL9A 1FRDA 4USJC 2CPIA 1YI2S 3AHPA 2KQ7A 2VBXA 4I2QA 3I87A 1OYDA 4RWXA 4KC5A 1WELA 4R0EA 2CPDA 2R7XA 2HGNA 3UN2A 3QZ7A 3UI3A 1A6LA 1TUGB 2ASJA 2ZD1A 1IVZA 4DXGA 3B78A 4Y65A 4DX7A 2K5PA 4DX5A 3PX0A 4DL3A 2M70A 3CJTA 5E7OB 2QLBB 1JLQB 3IS9B 1MU2B 1LWXA 2Y8WA 3RB6A 1GNUA 2MQPA 5L95C 3MR5A 2NTTA 1VLBA 3CGIA 3FBEA 2ZUGA 4QZVB 2HGLA 2UUBJ 2IBIB 2JZ5A 3PX4A 2A0FB 4X62J 4OV1A 1U1LA 2ZNYA 3N6MA 1NB7A 4OYWA 4EUTA 1SQGA 1VBXA 2Y0BB 5G5GA 3DM2B 1KOOA 3CJ5A 2HNDA 3PYFA 2WXNA 4I4BA 4DR1J 2V34A 4ZVTB 5A8WA 1VJWA 1E7PB 1I4QA 4B3RJ 3PIOQ 3HVDA 1HFEL 4OVVA 1KJTA 3CIMA 6FD1A 4TKNA 2DNPA 5GAEU 1ZDVA 3CSTA 5CHFA 4DFKA 1RI7A 1U1MA 3QRQA 3FEXB 4M00A 4DCPB 3PG9A 2UXDJ 1WSRA 3G8SA 4FADA 2UV8G 3D68A 5I3UB 4ID5B 1U1RA 5TR5A 3B6BA 1AW0A 1Q81T 1XF5L 1TQLA 4QWAA 5T14A 3R1HA 4K81A 5EX3A 1VHIA 4RW6A 4DR4J 1JXEA 4N41A 4Z7CA 1ZGUB 3VDZA 1U26A 4MSQB 2IA6A 4QIWD 4P7TA 2CIMA 3EE3A 3KLFA 3PO0A 2NLWA 4OZ0A 5LNK1 4TQ0A 1YIWA 1MW7A 2DNKA 4ECSA 4X84A 2FLLA 3IRWP 2O1PA 2E5LF 2H5JB 3CB4A 2MBOA 2LMIA 1WF9A 2OGUA 3EDQB 5DJBA 4ZPDA 2KWCA 4I68A 1PBAA 3RT3B 2KJWA 3H0PA 3CTRA 2J9CA 1VR6A 1GTEA 4ZITA 3Q3MC 4DR3J 3Q8AA 1SJFA 2FLPA 5HJYA 3CMQA 5LXRA 4CWBA 4EZ6A 4F3QA 1NLKL 4NA2A 2CU1A 4LR8A 2ZDPA 4BWJA 2Z2YB 3HVWA 2YWHA 1RT1B 3ICLA 3VAHA 2LVPA 3PRBA 4C8YA 3DRRB 2RSUA 2XB2D 2M7SA 3CE8A 2PDAA 4UQGA 4W9JA 4UY85 4UW2A 2EFOA 3GIJA 4KKOB 2POKA 3JAMY 2DENB 3W8PA 1TK8A 2W9BA 5JXSA 2IA0A 4DR2J 2QX0A 4DXFA 4JWUC 2PMHA 3DXBA 1A9NB 4CLZA 1RAOA 3W5ZA 1HIYA 2BVZA 2NXJA 2KVZA 1FM0D 2CAJA 4YOEA 1TL7A 1NB2A 4MJSA 2IJFA 5GMEA 3AQPA 1SUQA 3M2RB 3MOJB 2ABYA 1SC1B 2M4NA 1EU3A 2BBCA 5ITHA 3I3TB 2RF2A 4L3NA 1BT0A 3T1HF 2WYQA 4XDDA 2HNYA 1TY2A 1GX6A 5KFUA 3DWMA 2AX1A 4CT8A 2ZJQQ 3QATA 4MYUA 3IP0A 1V80A 1LV5A 4O1NA 1XJWB 3MEDB 3TUJC 4DDID 4JYAF 2ATLA 3GJRB 4IDIA 2YNFA 2VDHA 1CEZA 5DPTA 3CCTA 4AJYB 3ZNID 2BF8B 4FLHA 2MP2B 2P5VA 1CJTB 5AZGA 1A7GE 1VRUA 3Q83A 5ETNA 2V4RA 4U67Q 2NSBA 3AJ2A 3Q8SB 4J9PA 1XR6A 2HYIB 3MMBB 3US5A 3ILIA 3NLCA 3DLEA 4LNOA 3HHLA 3M6WA 3M2VA 4ZPCA 2CKWA 4BZAA 1HNVA 2EG2A 1NKBA 4M02A 3QFHA 1FJEB 2H89B 4OJ1A 5D4OA 1IQZA 1NBEB 1BMLC 3PPAA 1C0UA 2OPQA 4DPOA 2YX4A 3Q86A 4OZLA 4C98A 3DRPA 5LMNJ 3T9ZA 4KRWA 2D3CA 4ZKAA 4HWIB 3EGZA 3BK1A 3J7Z5 1RT6B 5H92C 3FKYA 5C3JB 3OUYA 3CJKB 3TZWA 3VWSA 2IVYA 2JQRB 3RB0A 5E3QA 2LQ9A 4JI4F 4K2JA 1RHRB 3KLGB 4LVOP 3G87A 2K25A 2N9XA 2PPHA 3HO1A 2HAFA 3LGMA 2I6WA 5H9EJ 4NCGA 2DHZA 1VQOS 3QO9A 1RA7A 4U7UK 1F9EB 4MM3B 4F04B 2A5UA 4K7SA 4WH4A 4N6EB 3W3SA 3MAAB 3GQCA 4NMLA 2C9WB 3W8GA 1FRMA 2QO3A 1FFWB 2J0SD 1WZ3A 2G1EA 4DFMA 3DHGC 3KLIA 2OD6A 1LWEB 1WR6E 3G71S 1FCCC 3ZYYX 2AX0A 1WXVA 1PC5A 2XCAA 2E7VA 2F4FA 4K7UA 3TUZC 3SU8X 4CLTA 1ZKHA 5HVGA 2UWQA 2YQ3A 4ED3A 3K17A 2WLBA 2CQPA 4LNFA 2J8SA 3VCDA 4B3SJ 4A8MP 4AXIA 4M94A 4PYAA 3UNGC 2JJ4D 2KTRA 5JJBA 4OJGA 1TR0A 4NPOA 1JQ4A 5IOIA 3KDNA 1ZOTA 4NLWA 4CRJA 2KLGA 2GB1A 2XTJP 5JH5C 1NK9A 3CCES 1VQLS 3KUGA 1FFVA 3EGNA 4OI1A 2FY1A 5IWAJ 2KC2A 2C2EA 3PREA 1TKZA 3I0RA 2J6TA 3AXKA 2JT4B 1P7FA 3OTOF 4CQNA 2BX6A 2E7WA 2NUUG 1DOXA 4P7IA 2CWKA 3AODA 1YMHE 2DGXA 3EXYA 1FXIA 4OHXA 1JXLA 1HQUB 1S1WB 4XPCA 3JXOA 3C6UA 3T5LA 4RO0A 1NCLA 1WC0A 1NK5A 5DPWA 1FWKA 3QYYA 2V8HA 2V4JB 2IO2B 2FJDB 4M5GA 3PNIA 3UWTA 2D41A 2BYTA 1N34J 2RQCA 4U96A 2QILA 1P27B 4LJOB 5HMXA 3D9BA 5IKCM 1E6YB 2AIRB 1H8CA 3ZJTA 4DR5F 2KKCA 2YBVA 1RAEB 2FCNA 4ECYA 4OV6A 1RZMA 2YKNB 1HA5A 1T11A 4ZVPB 2ZBCA 2H48B 2Z0GA 4DXAB 1TKYA 4LT6A 2VQEJ 2NPFA 2WXJA 1U24A 4DDGD 2MQLA 4RW4A 2HJ1A 3K59A 2Q1LA 3M9NB 4KGRA 3RD2A 2N4FA 2VONA 1LW0A 1T3QA 2GMIC 1SJQA 2KFNA 1E5WA 1MNEA 5JVHQ 1SE3A 3AE5B 3T41A 2J0QD 5LSRA 2PFFB 2AGQA 3RMKC 2E9TA 2XWXA 2KC1A 5J2PB 2IAJB 3UCZP 3DBHI 4GC7A 4Y2KA 1GEHA 5C2TB 1N5XA 2V4LA 3FGVA 2YWWA 5K20B 4K3CA 1CJUA 2KT7A 4XO0A 1Z2MA 1JCKB 3JAMU 5HK4A 1M5OC 3PZDA 4I56A 1Z2LA 4N76A 2DHAA 3FBBA 1RB0A 2EW9A 3DVGY 3K8VA 2R7RA 4ZJOA 4XYCA 2PMVA 3MUVP 4NY0A 1Z4UA 1WM2A 2GBNA 4LNIA 4EEWA 3SIPB 1JWBD 2UXCF 4L73A 4F4KA 4C3KA 3T5HA 3C66A 2L83A 2YPYA 4ZVEA 1T05B 4FHJA 1CJKA 2IRXA 1JX4A 3NOBA 2FAZA 2QZ8A 4X66J 3DMJA 3DOKB 1XEZA 3LPEA 2INPE 1OQYA 4FXVA 1VRQC 2FIUA 2R2RA 4ACFA 2BABA 2K1RA 4QWEA 1VZ7A 4LRAA 1NAQA 1T94A 3PRZA 4B9NA 2NPTA 4GO5X 6AT1B 3CF6E 5E41A 1RFAA 1UELA 5JHBA 2RHQB 3DI6A 3OXLA 3HP6A 4NL5A 1QOGA 3Q8FA 2IDEA 3KUEA 4ETXA 2J4XA 4K4ZA 5K14B 2JVCA 2ROPA 3N28A 3JSMB 3QK0A 2R42A 1TTNA 3CJ2A 3EJMA 1TS5A 4DFJA 2YWEA 4L6V3 1SJRA 4I64A 3IRXA 3AU4A 2VG5A 3IR7B 2N7CA 1DOYA 2RRBA 2CJYB 4UOCA 2M0GB 3QLHA 4UOHA 2E7XA 1REGX 4DR7J 3RNAC 5HBMB 3H7SA 1YWXA 1ZM3A 2LP4A 4PS8A 3TOQA 3OL6A 3MMJA 2NYIA 4C8ZA 1K51A 2IYIA 3TBLD 2CQDA 1QVFR 4USAA 2HG4A 4K4TA 2DLBA 4F4XA 1TY0A 5KFRA 3L08A 1YJUA 2FPHX 1H6KX 4O3RA 1WG1A 1GAOA 2HSEB 5GMVA 4OJ3A 5EDSA 4S17A 7FDRA 3FMWA 2XN9C 2ZZTA 1YJJA 3VR1A 2PVOD 1F3FA 4H2AA 1OPIA 5F0UA 5CHWA 3P4PB 3SFGA 3CJ4A 2PGCA 3ZKJC 1X4GA 1NHVA 3DLJA 3ZXWA 3TAQA 4CLPA 3BSCA 1VQ4S 1LFPA 3C14B 3BQ0A 4OI4A 5EHHA 4GOCA 4P1CC 2MGZB 1Y9OA 3UQBA 3I4HX 4RW7B 1BQNB 1WC6A 4DSLA 3AM9A 3Q14C 1MHXA 4NXNF 1DQ9A 2W2PP 5KFWA 4OQJA 4ZN3A 4ES3A 3E01A 2RIJA 3DDKA 1V8CA 2DGUA 3HPOA 3IM9A 1YJWS 5J18A 1NDLA 3NGSA 2GMLA 3T9NA 3TA2A 5C1ZA 1JLCA 2VD3A 3MPVA 4IQXA 2LKZA 3KXDA 3MMAA 4R5PB 3HCXA 3CCRS 4NA3A 2VFVA 4HDQA 1U4BA 4TQRA 4LNKA 1N56A 2LUMA 3ZFVA 1FHTA 3D2WA 2KN5A 2E5IA 1NXIA 5C2CA 2MA9B 2HQIA 4Y3CA 4CIOA 5AUIA 1EETB 1XMQF 2JSVX 3WQPA 3BWUD 2INNE 3JTPA 4NYPA 4MK7A 5DZ6A 2DYAA 1NYRA 2K9XA 4M0WA 2GVZB 2YKOA 1NDPA 5CXTA 2W8LA 3AE4B 3GP9A 3QGHA 4LRDA 3M05A 2GX8A 3ONSA 4Y2IA 2MZQA 3GU0A 4WWNA 1QOFA 1NUEA 1T03A 4MSMB 3NGRA 2TSSA 2ZH9A 2HHTA 1PCAA 1HNWF 2HVIA 4OYPA 1ZPSA 5GAGI 2B3AA 1SC3B 3R27A 3QJPA 4IM0A 3Q8CA 2K8CA 2PTLA 2LGSA 2V67A 3J81j 3QT7A 5IT0A 4P52A 2JWZA 3HSDA 2JDJA 5E6PA 3N3KB 2GOWA 3BYRA 3Q3FA 2FHOB 2J0WA 1QSYA 4WQMA 4RLEA 1NMEB 5E33A 1C1CA 3W5VB 2GHPA 1TV6A 4X4OA 1PSDA 2RDGA 1XWLA 2LQJA 5KOXA 5H8YE 2DTJA 2FHJA 3J7A1 3UF8A 4ZS6A 1WI6A 5I3PA 1CK1A 3JSVB 3HHMA 2D10A 1YJ1A 4AP4C 5G2NA 4AFFA 4IR1A 4IG3B 3U30A 4JI7J 1WEXA 1S3SG 3PLUA 2QA4S 1KDNA 3CC4S 1RU1A 5KT3A 4PPDA 3TJAA 1WNEA 4CDIA 4C11B 2ZZNA 2KWVB 2XZWA 4QJVA 3BR8A 3G6VA 1QZEA 2GQ2A 2W2MP 4C97A 2HHHJ 1EAYC 4N5SA 3AV8A 4PYZA 4LSNB 1ZA2B 2AWZA 2LXAA 2CPEA 4YN3B 3H42A 3M30A 4TV3A 4TQ1A 1NJYA 1YJ9S 3MTNB 2GHWA 5DDQC 1XMBA 1JMTA 4ARIA 4S0RA 2QN6B 2AX5A 1RA6A 5C7PA 3GLJA 4FN2A 1FFSB 4KPYA 3DBHB 2YLMA 1LW2A 2HS0A 3SFDB 4AQYJ 4K0KF 1ELOA 3CIZA 5MLCV 4ICVA 1UAWA 3QPIA 3DLBA 4UOGA 1XIQA 2LYVA 1VQ5S 2LLZA 2LDIA 3MM7A 2KMCA 4L3KA 3AOBA 2VA2A 1V86A 1GT8A 5KFGA 3BVZA 3W63A 4HACB 2KG0A 4RWWA 3U7DA 4KJIA 3W61A 3NG0A 4DCJB 2IC3B 2DVIA 1R8BA 2A1BA 1AT1B 2VASA 2KMMA 3GE3C 3CSFA 4W9HA 3KQ4A 3ZTCA 3SCIE 1C4CA 1HWIA 2AT1B 4NA1A 3PVXA 2JPHA 4H4KA 2L0FA 3ZXVA 3OFFA 4ZPVR 3KJVB 1FCLA 3KUCB 5I42B 2PD1A 2DNRA 1IR2A 2QSFA 1UWBA 3OD2A 1PJ6A 3SEBA 3DOMB 2FDNA 4CYUB 1FRRA 1OSDA 5BYSA 4LUBA 1KLMA 4G65A 4ZVOB 3TZXA 3NBPA 2Q5WD 5F8GA 4CO5A 4FBUA 3OAWA 2HK3A 3BO4A 1WEZA 4NLUA 2ATCB 4ZLNA 2QSDA 1NM2A 4KT0C 2KI2A 2VFSA 3N0VA 1LXNA 4ATNA 1ENFA 4LBPA 5K9FA 4LFAJ 4NASA 1VBZA 2RJZA 1TZOA 2XK5B 4HKZE 3BEGB 3IFWB 4U8YA 2QJ3A 3EM1A 1S1XA 4MDKE 2MJDA 3GV8B 4Z2XA 4IRDA 2ZCCA 5J2MA 1QOAA 4BLGA 3M8WA 5GAGU 1FE4A 1NI3A 2AEMA 4K7QA 2V3NA 1MN7A 1FDBA 2L3ZA 1TS2A 3VUYA 1ZETA 4F7ZA 3IXQA 3UN5A 3N1XC 3UD5A 2E5HA 3ENWA 5LSOA 2KLCA 2PI4A 2PO4A 4BFRA 3ZGZA 1RADB 1BUIC 2MZRA 1TMJA 3C8YA 3U7ZA 1ZA1B 3BZQA 5A8RA 5HROA 3A9KA 4RM9A 2E1MC 4H54A 1U2FA 2UUBF 1D09B