2I38A

Solution structure of the rrm of srp20
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRDLDGRTLCGCRVRVELSNGEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion protein consists of immunoglobulin G-Binding Protein
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/chimera
total genus 42
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2i38A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i38A02
1X4EA 4GLSC 2KYXA 5HO4A 3IRWP 3BO2A 3DXBA 4BS2A 2RT3A 3PIPQ 1C9FA 3B4DA 1U1NA 3UCZP 2MY8A 1MVKA 4ERDA 5BMHA 1U6BA 5IM0B 2CPJA 2D9OA 5D77A 3SDEA 1WI6A 2DO0A 2RS2A 2QA4S 3NNHA 3CC2S 3MOJB 1VC6A 1UAWA 2I2YA 1FHTA 3HHNB 2FPHX 2RQ4A 3GB1A 2MZ1A 2LXIA 1X4FA 2KRRA 2ADCA 2DB1A 2DGWA 2MQOA 2FC9A 2B0GA 4KGTA 2DGVA 1M5PC 2CQBA 1W2BR 1WEXA 1VBXA 1NO8A 3LPYA 2KG0A 3S7RA 2DNQA 1OIAA 3CULA 5HI1A 1UW4A 2AYBA 2EELA 2DH8A 4OZCA 2LKZA 2YH1A 2VODA 1N8RT 1U2FA 1AUDA 4QU7A 1VQ6S 2I38A 4IUFA 5MLCV 2QFJA 1VBYA 1U1KA 3N9UC 2KFYA 1MI0A 1VQ4S 2RMMA 3R27A 1VQKS 2GB1A 1URNA 2DNRA 2LEAA 2DNZA 2MHNA 2OTLS 1VQMS 2F3JA 2PW9A 2CQPA 2OSQA 5DM7Q 2DNMA 2XS7A 2KT5A 3PIOQ 2LEBA 3MD1A 1XF5L 1L3KA 2HVZA 4WH4A 3G8SA 1SXLA 1YIJS 2CQ3A 2BOPA 2DNPA 2MQQA 2ZJPQ 1FJ7A 2DNLA 1U6FA 3NS6A 2HZCA 2PE8A 3MUMP 2MSTA 3UD3P 3RW7A 2J0SD 1A9NB 1B7FA 3CMAS 2KWDA 1PGBA 2X1AA 2EVZA 1U1OA 3US5A 3S6EA 5IQQA 4C0OC 1YJWS 2GO9A 2MY7A 1M90T 2DHSA 1HZ6A 2K3KA 3V3XA 1VQNS 1IQTA 2JVOA 1WEZA 3NNCA 1K73T 2CQ0A 2LECA 2M52A 2X1FA 4WFBQ 3H2VE 2LQ5A 5HG2A 1P7EA 2M7SA 4Y0FA 1A7GE 1R8HA 2MPUA 3UCUP 2XS5A 2CJKA 1U1LA 2DGUA 2MSSA 3UWTA 1YI2S 1PGZA 2G1DA 3Q2TC 5FJ4A 2N9LA 4ED5A 2RNEA 2ERRA 2N7CA 1G2EA 2ZW1A 1EM7A 2MZSA 2LCWA 3FEYB 4WFNQ 4WFAQ 4IO9Q 1VQ7S 2M8HA 2J8AA 2JWNA 3EGNA 1R8PA 5DETA 2CQDA 2SXLA 2L08A 2E5GA 3TP2A 5DDPC 1X4DA 4C7QA 1VC0A 4UQTA 1H2VZ 2YKAA 3R1HA 4KGSA 1CVJA 2ZJRQ 4F26A 1YJNS 1X4HA 1SJFA 5CYJA 3G96A 4TU8A 3THTA 4RU2A 2MQNA 1VQ8S 2XB2D 1N88A 1UP1A 4WIIA 2CPZA 5IFMA 5DDOC 1XCTL 1DZ5A 3B4MA 3P5TL 1HEZE 2M70A 3CCES 2NZ4A 2G0CA 4YUDA 1HL6A 4M5DB 4YOEA 1OO0B 1GB1A 1P7FA 4Y00A 2MJNA 3MUVP 3CCVS 5BMGA 5HFYA 2MKJA 2X1BA 1PGAA 5GMKa 5GAGU 3SDEB 2HYIB 1H2TZ 2LA4A 3EGZA 2JXTA 2AYEA 2KG1A 2N3OA 1VQ5S 1FD6A 2RU3A 3SMZA 2M88A 2AYMA 2FY1A 3CMES 1VBZA 3VAFA 1FCLA 2G4BA 1WF1A 2EK6A 3BO3A 3EX7B 2DNOA 1DHMA 2DNGA 2DGXA 2MMYA 2KXNB 1VQLS 2RS8A 5HL7Q 1X4BA 3FILA 1DRZA 1F9FA 2RUGA 2VONA 4D2KA 1HZ5A 2DK2A 1VQPS 4IOCQ 3VAMA 4A8XA 5JVGQ 3P3DA 1ZZFA 2M0GB 1YTYA 2J53A 3CF5Q 2DH9A 1WTBA 2KHCA 2MGZB 1X4CA 1WEYA 2RPVA 4IKGA 2N82B 5H1SV 2J52A 1RK8A 2DGTA 2U1AA 3G6ES 1WG5A 1WHXA 3SXLA 3VAJA 1K53A 2FHOB 1GB4A 3BO4A 3LQVA 2RVJA 1H6KX 1WWHA 1FNXH 3ZZZA 2MKHA 2MZQA 1FCCC 2KDMA 4PR6A 3CCLS 2JZPA 1VQOS 2VOOA 5IM0A 3S8SA 4P6QA 1IBXA 2KU7A 1HA1A 2VOPA 1FT8A 2DGSA 2OJ3A 1MPEA 3CCMS 1N52B 1M5OC 5BJRA 1K9MT 1IGCA 2DHAA 1KOOA 2YWKA 2LGIA 1D8ZA 3UCGA 1PO6A 1K8AT 3CC4S 2K8GA 3TO8A 4CQ1A 1UWXA 3CCSS 3Q2SC 5LJ3Y 1JJ4A 1WELA 1VQ9S 2MZJA 2CQIA 1KQSR 2CPDA 3JB9k 1QKZA 2MKCA 1U1MA 1S72S 2UP1A 2ZW0A 2E44A 3P49B 2DGQA 1YWXA 3MXHP 2LHEA 3G4SS 2MJUA 2OIHA 3CPWR 1X4GA 2DHGA 2JVRA 5LJ5Y 3MD3A 3NS5A 3U1MA 1Q86T 2CPXA 2EK1A 1NU4A 2YH0A 4OZ0A 1SJ3P 4WKRA 5DM6Q 2F9JA 1U1QA 1KC8T 2LUMA 4WCEQ 1IGDA 4QU6A 2KXFA 4OZ1A 2MQLA 3V4MA 1XN9A 2ZJQQ 1Q81T 4YB1P 3MI7X 4UY8T 1JMTA 2LA6A 1K52A 3THPA 4EGLA 5LXRA 3CTRA 3UE2A 1P1TA 2DIUA 2MQMA 2PEHA 4FXVA 5CXTA 2J0QD 3G8TA 2KQ4X 2O3DA 2HGMA 1QVGR 2WBRA 3UD4P 2J76E 1X5TA 2XSFA 1ZH5A 2DNNA 5D78A 4OZBA 1ZXHA 1WG1A 5GVQA 1NJIT 2K0PA 1X5PA 1WHYA 2MYFA 5ITHA 1WF0A 2MXYA 2QSDA 2E5IA 2FC8A 1WF2A 4C4WA 3CD6S 1O0PA 2KN4A 1YMHE 3FILB 2CPEA 2E5JA 2M2BA 3BS9A 2JWUA 4WF9Q 2OTJS 1BY9A 2DNYA 1QM9A 2MQPA 3R1LA 2JRSA 4PRFA 4J5OA 2JSVX 2L9WA 1WI8A 1M5KC 1HD1A 1SJQA 1D4BA 2XNRA 2CQHA 2CPFA 2DIVA 2MKIA 1FO1A 2CQ1A 3L3CA 1Q82T 2DNHA 1OPIA 2U2FA 2LMIA 1M1KT 5CA5A 2YTCA 3VF0B 1YHQS 3CC7S 4HJGE 4IOIE 1N54B 3CCQS 3DLLQ 3HI9A 3UI3A 4TU7A 5EN1A 1F2RC 2LYVA 3J7YU 2DISA 2NLWA 2CQGA 4KGRA 3U1LA 1IBXB 2M4MA 1P27B 2MB0B 1MHXA 4IOAQ 3VAHA 2LXUA 2MZTA 2E5HA 3VAIA 2A3JA 2ON8A 2DNKA 2HGNA 2RQCA 2XS2A 2V94A 3CUNA 1WHWA 2MZRA 3VAKA 2ADBA 2DITA 2MKSA 2Q79A 2IGGA 3CCRS 2QEXS 1SJRA 2CQCA 3ZZYA 3S01A 1U1PA 3CCUS 4F02A 5GAHU 2OEDA 3P6YC 1JMLA 2L41A 4FXWA 2MGZA 4OZAA 3G9CA 4CH0S 4W92B 3MUTP 5HHDG 2D9PA 5LSOA 2RRBA 5DDRC 2CPHA 4TU9A 1M5VC 1Q7YT 3J7ZT 1DBDA 2KI2A 3I55S 1D9AA 4LMZA 3TYTA 3NMRA 2N9KA 3MP9A 3VALA 2CPYA 1FJCA 4HKZE 5DDQC 1PGXA 3CCJS 1UFWA 1SJ4P 4MACA 3ULHA 1VC5A 1QVFR 2JU6X 1KOHA 3I56S 2KM8B 1HD0A 5BMIA 1X4AA 1FXLA 1KD1T 2D3OR 2CQ2A 1H2UX 4QPTA 1WG4A 1WHVA 2KH9A 4QQBA 1X5OA 1S79A 2X1GA 2IGDA 2GHPA 2GI9A 4F25A 2IGHA 2KM8C 1FJEB 4TLQA 4V19X 4PKDB 2DO4A 4U67Q 1X5SA 2XNQA 2M8DB 1YJ9S 2F9DA 2DHXA 5LXYA 2PTLA 5LSLA 2CPIA 1JJ2R 2KRBA 4CH1A 1U1RA 3H2UB 5JXVA 2JX2A 2LHDA 1F2RI 2HGLA 2CQ4A 1KH0A 2NMQA 1YITS 4Z2XA 5JVHQ 5GAEU 4LJMA 2KACA 4CIOA 1X0FA 2BZ2A 3G71S 1YNTE 3VAGA 1K50A 3IWNC 2AYGA 5GADU 3MDFA 3MURP 3K0JA 1JJHA 2DGOA 2N7JA 3CXCR 2AD9A 2M9KA 4LIRA 1K51A 2PLPA 2DH7A 3BEGB 3RW6A 1ZZNA 1MHHE 3NNAA 3D2WA 2QMTA 1OWXA 2KVIA 1RKJA 3OW2R 2RRAA 2N3LA 3FEXB 2MKKA 2ONQA 2KXHA 2OSRA 4W90B 4ZKAA 1Q10A 1XCQL
chains in the Genus database with same CATH superfamily
4NYPA 1QLNA 3IRWP 3PNIA 3N1YC 4C48A 1VJQA 1J2VA 2XYHB 1I1GA 3VHQA 4IRCA 1WI6A 2LGXA 4M5NA 1RT3A 1JALA 4YSYB 4JV5F 4J91A 1RT6A 1I6JA 2XYGB 3C6UA 4ES3A 1P8GA 4E8UA 2VKZG 4PG4A 3MFGA 1BQNA 2CQBA 2BABA 5KG7A 1HWKA 3ICLA 3S7RA 3RB3A 4KV8B 2OMLA 2I1KA 5FLXY 4FNIA 4DR3F 2R2RA 3H4DA 2ABYA 1MMNA 3KLVA 1JWBD 2KFYA 1VK8A 2K1RB 3HHEA 2AKWB 4LF9F 1XNQF 1RTJB 2PDAA 3FGVA 3DOKB 2PW9A 2HVIA 3L7OA 5HI7A 1VDVA 2B4PA 2IZVB 3HHLC 3KLEA 3UW1A 3R3TA 2RF2B 2AL6A 2YWHA 3SQGA 3RCZA 4K0KJ 1S49A 3JSMB 1IUJA 4KC5A 2X38A 5IQQA 2VFRA 5IZHA 2P9GA 1HZ6A 2XMVA 4F1SA 2KJWA 1J5OA 2CQ0A 1GH8A 3JSBA 3MM9B 4HI1A 3PRBA 1V6EA 2MPUA 3JYUA 2BKOA 2C2EA 3OAWA 5HANA 2RNEA 1G2EA 4F0KA 3QWUA 3P4UB 3DOLA 3JAMU 4YEAA 2NXUA 2WU2B 3D3CJ 2WXPA 4TU8A 2QJLA 2SAKA 2MQNA 4K2XA 4RPFA 2C2RA 3NS1A 1N5SA 1WJ4A 3CCES 4NJ7A 3J7Z5 5C42A 3AE9B 1U25A 4A3PA 3EXYA 4NLQA 1JXVA 3BJYA 3A1YG 1KS2A 4M0WA 5ETMA 1SQEA 2AYMA 1VBZA 4JI1J 1TK0A 1ISNA 1TL3A 4X4OA 4WWSA 4I6PA 3CCTA 1VQLS 4NL5A 3T41A 5CHFA 1CBKA 2DK2A 5DPSA 2COLA 4MAKA 2GRIA 1B9RA 2DH9A 1NSAA 2IAJB 3GYXB 5BR8F 1V80A 1TVRA 4YQWA 2RPVA 4IKGA 8ATCB 2BXJA 1RQ0A 2AGOA 2PMHA 3RN9C 2WXQA 3BVGA 5FKAC 4ZIVA 3QJJA 2VU5A 2RDBC 4A46A 2MKHA 5HSPA 1MG7A 2A2CA 1B70B 3BBCA 1SQGA 2I8EA 4TKTA 1QAXA 3M8PB 4DR1J 2I0XA 1SKRA 1PBAA 3O44A 4LF6F 2VL1A 1K8AT 3PRDA 2MBOA 1AUSL 1R0AA 3BPDA 5KG4A 5LJ3Y 1WELA 3EVMA 3EC8A 2NUHA 4O0IA 3TIXA 3J7YI 2UUCJ 2E7XA 4ZP7A 1ZM3A 4DV6F 4DR7F 2DNFA 3P2BA 4H4KA 3FUYA 4RUBA 3NGUA 2JXXA 1G6BA 2XMTA 2YH0A 3FBBA 4RNMA 1WGGA 5KT7A 1HHTP 4WKRA 3D1HA 2HBQB 4WCEQ 2D1CA 4MJKA 2N7YA 3D0HE 5ETRA 2OEMA 2ZKUA 3FAHA 3UE2A 4NJ6A 2DIUA 3PJWA 5ADZA 3T5KA 2L00B 2B9EA 3G8TA 2O3DA 1NXIA 3LTOA 4DR4J 5J18A 4Y2AA 3K59A 2BJ9A 4GSWA 1YZ7A 1CS4A 3BY4B 1WHYA 2K22A 3W2VA 5DLFA 4GDKA 4FPRA 2MXYA 3A9KA 2V1YA 4HEA1 2IM2A 2E5JA 2B7BB 2JWZA 3IO1A 2KLGA 2MQPA 4FZVA 5KFJA 1SJQA 3GV8B 2XNRA 1Y5IB 3LAMA 2OPRA 2XMAA 3BGLA 4V19J 1OPIA 5DPTA 5CA5A 3IS9A 3DMJA 2D3CA 4P7VA 4DV0J 2DISA 2YNFA 4WYWA 3HF5A 2ZPYA 4KGRA 3U1LA 3PHXB 3DRPB 1HBMA 1P27B 1UBQA 1S1TB 2AMCB 2JLFA 1HPZA 1HFEL 1CQNA 4ANVA 2D69A 4TY8B 5F0WA 2DITA 2FDNA 2MKSA 4XGAB 4J9LA 2UVWA 1HNVA 2HKEA 1L5PA 3ZZYA 1TY0A 3ZTOA 2DHZA 5GAHU 1I35A 3BWUD 3T1YJ 1FIQA 2EWHA 1M5VC 2ZEQA 3RULA 4NXNF 4LTUA 4UOFA 4QYRA 1LO5D 2Y0SD 4U7UD 3HJVA 4NZ6A 1FD2A 1GC7A 1PILA 3L95X 1JRUA 3N6MA 1UEKA 4O3RA 4OMFG 1UNSA 1G3OA 5DG9A 1S1WA 4K4XA 2CQ2A 1CULB 4PPDA 4JI8J 4FF1A 3FKYA 5MAOA 4LBHA 2VBXA 1WX8A 4F67A 2HPUA 1MROB 5CYMA 3KK2B 2BUNA 4KZCA 2YWEA 2YPYA 3ET6A 4BKSD 3I3TB 5LSLA 2KNBA 5LOQA 2N4DA 2HNZB 2R7RA 2B6AB 1FE4A 1R89A 1WM3A 1F2RI 2YKPA 1LFDA 1S9GA 4DPUA 4DQQA 3RAQA 5GADU 3N5BA 4HHJA 1DTTA 2QT7A 2L9DA 4JI5F 2ASLA 4DEZA 2BANB 3BH7B 5F3ZA 3MCMA 3ZNUA 3WCQA 4W9HA 3NZ3A 3QHTA 1LNQA 4PXCA 2XY5A 3QGIA 1RFKA 3N6NA 4N47A 2ZH4A 4BS2A 1XR7A 4JV5J 4C2MA 1NENB 1U1NA 1YQ3B 2QV6A 1YDLA 3IAS1 1U2CA 1GG3A 1S9EA 3SDEA 4HYKA 1E6YB 3NNHA 3PR4A 1RHUB 2VG7A 1V86A 2ROEA 4HPLB 4FKXA 5KT2A 2KRRA 2ADCA 2DGWA 3P4PB 1JWMD 2TSSA 1XNQJ 4C11A 1F9JA 3FCHA 2UVVA 3NAHA 1FRKA 3MWBA 1K8RB 1VIOA 1D5ZC 2V3SA 4CCHA 4KPCA 5KFSA 3ZYYX 3D3BJ 4OLPA 3QT7A 4DV2F 1MMLA 2D3ZA 1T95A 2MLBA 4KB7A 1IKVB 4ZVRB 3QO9B 2MBQA 3DHWC 2LEBA 3GILA 3G8SA 4WH4A 1RT1B 1MN7A 4NA2A 1YN5A 1VD2A 2FZCB 3IC1A 4L3KA 2KWDA 3UDEA 3U2SC 2XN9C 4A48A 4UUWA 3VDZA 4LF1A 1MLAA 3Q8FA 3JVZX 1HNIA 3AODA 3OFHA 1PGZA 2LFVA 1R8BA 4DSKA 3CE8A 2FLPA 5D3IB 1S0MA 2WB1D 2N7CA 4LSLA 4WFAQ 3NL0A 4IDKB 2J8AA 3V2UC 5A8KB 3N30A 1R8PA 2CQDA 3TP2A 3P4RB 1JLAB 3KLIB 3WX8A 2Z0DB 4IW0A 1C0UB 3GFYA 3IG3A 4WIIA 1FEHA 4PT5A 4TLRA 2ZNVC 2LASA 2DPIA 3D54A 2M70A 3TX0A 2G0CA 3G8QA 1GB1A 5A6WA 1WX9A 2MJNA 3PO5A 2X1BA 1KVJA 4MIAA 5J2QB 2VA2A 1I4XA 2OELA 4KGVB 2KG1A 2N0SB 4NMLA 1LW2B 4JI7J 4PQUA 2C7HA 2J9EA 4U6PA 3EHVA 3I0RB 1OS5A 1RJJA 1VCTA 2MLZA 3R6LB 2YQ1A 3IN5A 2EMSA 1UF0A 2E1MC 4IOCQ 1REVB 4ANWA 1SPBP 4ZHRA 1SKSA 2UV8G 3BQ0A 3CF5Q 5KG0A 1RBOB 3PKMA 4HDHA 1FRMA 3GSDA 1WM2A 2J8SA 2MBBB 4XPEA 5JXSA 1R43A 1WWHA 3NWRA 4LF6J 1XQIA 3I9V9 2VIHA 1VQOS 3QIJA 3W2WA 3AE8B 1NSKL 1FT8A 1OMSA 2HHVA 1K9MT 4EUVA 1TKZA 5FR3A 2K2PA 3IHPC 4ED4A 4DV6J 5EHHA 4DR7J 1UWXA 4J7CA 5LL6d 2FHJA 3Q2SC 2JT4B 4DPWA 2KAJA 5HQMA 1SL2A 1KQSR 3NCRA 3BYRA 4CLFA 4XWWA 3X23A 3NVWA 1V1PA 1N0UA 4CLLA 5BYQA 3IT4B 1WXMA 1S6QA 3ECIA 4MKAA 2QMWA 4IYQA 5ETTA 1T0RC 4C7YA 1H4RA 1HNXF 4CP5A 2GMJA 1TS3A 3B78A 3MAAA 5BXIA 4DF8A 3UO0A 1RKIA 4MM3A 1JLFB 1P1TA 4DX6A 1ULRA 2KJVA 1I7HA 2BMBA 2GJFA 4F4AA 2BB6A 2UUTA 1X5TA 1SUQB 2F8EX 2HNDB 5A8WA 1VHIA 1WC0A 1PC5A 4Y6IA 1NJIT 3R6GB 4ZJQA 3GLJA 2VZKB 2H89B 1VRTA 3QARA 2CPEA 2L9NA 3BS9A 3MM6B 4KAIA 2IDEA 1IR0A 4H54A 4IC7B 1T11A 1KLMB 4NAWA 4QOTA 1N60A 1D4BA 3L3CA 2G2YA 3GG0A 4JV0A 2XG8A 4Q45A 3R7BB 4ANDA 4M5DA 3J7YU 2PVGC 4TN2A 2CR5A 2J7KA 4NYZA 3MAHA 1I5OB 1E6EB 1MHXA 4FJZA 4EBCA 3GYNA 2QTWA 4P1CC 3DBHB 3PS6A 3BYTB 4Z7CA 4F4KA 1LQBA 5GMDA 3MMAA 1M5HA 4F4ZA 3KJVB 2CHXA 1SJRA 4AWJA 3NOGA 4ZPTR 2EG1A 4NXNJ 2P2CB 3HM9A 1QY7A 3CWIA 4PZVA 4FXWA 4KYZA 2JLGA 3PW4A 4LSNB 1NI3A 2BA9A 1U48A 2DR6A 3UQAA 2ZH8A 3H5XA 3HSZA 2Z30B 1S0NA 2Q66A 3NMRA 1WOSA 1PQSA 3DI6B 4O1NA 2CPYA 1K44A 3LAKA 4DCOB 3K7RA 2V0GA 3W7BA 2HQ3A 4JI2F 3RFZB 3ADAC 4O3OA 4IM0A 3C16A 4F3MA 2NXCA 3KK3A 4X4NA 4E74A 3HVDA 4Y3CA 4RGTA 4LNOA 1S79A 1BWVA 3SFGA 1CMXB 3NGSA 3DDKA 4C8MA 4NLOA 1Y10A 2W2MP 3OWEB 4V19X 5CABA 1PYWD 1ZM2A 2PTLA 4JI5J 4BC7A 1QF6A 1FESA 1VQSA 3N4WA 2LHDA 2YQ3A 1X0FA 3ISNC 3KG1A 3T5JA 2ZZNA 3V4IA 3F56A 3RW6A 1X1MA 2ZH3A 4KZ0A 2CYYA 2ILYA 4W4MA 1TK8A 3P4QB 3MR5A 4DHZE 3RBDA 1HI8A 2AIRB 1S4FA 3ZZUA 3RNFC 4P2MA 3FQLA 4KGXB 1XCQL 4OZ3A 4WYLA 1KRPA 2CADA 2L0FA 1RHQB 3FBEA 3BK1A 3CD0A 3MCSA 4ZOHC 2KOXA 2P6SA 4GMVA 5D77A 1Q78A 4JBCA 2HBYB 4MGZE 2A4ZA 3FVYA 4LVOP 2W55A 1AN8A 4IRKA 1VLYA 1P1AA 4L23A 2MZ1A 5HN0A 2JPHA 4OJGA 2E7WA 1M5PC 4JE3B 3K5OA 2KT2A 5H9EJ 2VA3A 4FLHA 3DHHC 2HK2A 2Y3YA 4DV2J 5KFMA 1CJUB 1SIJA 3PREA 1XEZA 4QAYA 2O6VB 2ROPA 4PWWA 4ICVA 3W8GA 1A0OB 5KHOA 1VQ4S 3PTWA 2YKQA 1URNA 1FVSA 2DNZA 1L7YA 1UETA 2H48B 3RU0A 1XMOJ 1Y0HA 2D7SA 3KKFA 2OHDA 3PIOQ 7FDRA 3K5PA 2CJOA 4A3OA 2MQQA 5C25A 2ATLA 2VV5A 2ZM6F 2HIQA 3RW7A 4WZMA 3BZDB 4LSZB 4AQYF 3PW7A 3FZBA 3V3XA 4CM0A 5DJBA 2F63A 2WYQA 1IJEB 1P7EA 4Y0FA 4FF3A 3PW5A 4UQGA 2ZHAA 1G1XA 2V3PA 4NLUA 2OI2A 3P4SB 3CJ0A 3ALBA 2YKAA 2FVSA 4EKUA 4OZ5A 3THTA 3ONSA 1QJHA 5E41A 1NK6A 5FR6A 1FRLA 1R27B 3AU5A 2WAQD 1JW9D 1DZ5A 5E6JA 1N56A 4Y00A 3MUVP 3TBLD 2MKJA 1N6ZA 2F8HA 4B3MF 4L76A 4G1IA 4ZRQA 1UVJA 3NHEB 3MEDA 3ZJVA 1TQLA 5C24A 2YKOA 4KV2A 2KL8A 4GVBA 2R7TA 1YJIA 3N1ZC 4F04B 1AXQA 4I2PB 4P10A 3VRBB 2J53A 2J9DE 2MGZB 1OQRA 3AJ1A 1YIWA 5GXGB 3D7SB 1S3SG 1T02A 3BPSP 3QWZB 2RVJA 4XIUA 4MT5A 4C8KA 4AFFA 5D6JB 2HHXA 4HLBA 1KF6B 2JZPA 1ZDXA 2L76A 3UFCX 3HHLB 1IBXA 2HHSA 2GMLA 2YLMA 3AE2B 3TJ9A 3MZIA 4ARIA 1MWQA 2HVHA 3CIRB 2KZZA 3D32A 2IBIB 2CKWA 3UNYA 2SEBD 2MKCA 4KV8A 5F8JA 2RRNA 4A8SA 2GAHC 4IH6A 3W5YA 1VZ6A 2RUSA 1FWPA 1HNXJ 3RYTA 2Y3AA 5AE3A 4A8FA 2DHGA 3AE4B 5AE1A 2EK1A 2NVUI 2MA9B 2K1RA 3D68A 3OHAA 4ZVSB 2BE2A 1RTJA 2LUMA 4K7QA 2KXFA 3DOKA 3J81j 4XE0A 3TEZA 4ELUA 2ZBPA 3T6JA 1UVLA 1M94A 1JMTA 4NRUA 2RD0A 2E29A 2F7VA 2B5JA 4A8YA 2J0QD 4QWCA 5E6OA 1QVGR 3LXFA 4RWXA 3JSMA 3J81U 3GR1A 1FXIA 1NHUA 4CRJA 4YN3B 3BVMA 1PCAA 5E3RA 1WXSA 2KO1A 4D3HA 4KDIC 1TU0B 5CZXA 1HNZF 2AQ1B 3TVYA 3SCKE 1IYFA 3PY8A 1C78A 4J5OA 1WORA 4DFJA 2WLBA 5HK4A 1N5VA 1KVIA 1E6VB 1I94F 3FSIA 2BV3A 4RL1A 2WQYB 3DGVA 4KTQA 5K20B 2ALYB 1F9EB 1F5BA 1UCNA 3KK1B 1V5TA 4YSXB 1R6YA 2MZTA 1DGJA 5HMXA 3TAQA 5EE3A 2FAZA 2E5LF 2HHTA 2WVDA 3MHYA 5MPOA 4ED2A 4PYUA 4CLSA 4BVUC 4IG0B 3MJ5A 2IAJA 4L75A 1UWAA 4RZRA 4W92B 2YY3A 5HHDG 3CIZA 2B51A 3I55S 3B6BA 1L0YB 2AX0A 3ENQA 3A4RA 1QSYA 3TQ1A 2PA3A 2XY7A 2NS1B 4HKZE 1PGXA 1FA0A 2PEBA 3H7HB 1RHMB 1QVFR 1WOOA 2HD5B 2YX1A 1F1HA 3IWXA 5E6NA 2IJNA 3SSRA 3SU8X 4ZVGA 3LGMA 2J7UA 3WIVA 1KD1T 4K4WA 1H2UX 4EZ6A 4ES1A 3I87A 4JV2A 1S59A 3ITHB 3EXCX 4F4XA 2GA7A 4ZVQB 4ANXA 3NJTA 4U67Q 5C5JA 1RU1A 4FP9A 4OYOA 2PJHA 3UR0A 1JKHB 2VKRA 3TUPA 3I32A 1UA0A 1T0TV 1S6OA 4M00A 1V5IB 2H4YB 3DVNU 2WXMA 1NM2A 1K51A 2PLPA 1B0VA 2XZWA 3QFHA 2WOMB 4K4VA 1GUAB 1OYDA 2PFFB 2MKKA 2NYHA 5L83A 4ZJOA 2DZIA 2CKHB 3BSNA 1T3QA 2XC9A 5KG5A 3QFWA 5HP1B 4GKJJ 4A8OA 2BX6A 2D9OA 2W1BA 2RS2A 3RZAA 1RLDA 1VC6A 4DFPA 1S99A 4M8NA 3TSSA 4DXLA 2R61A 2WBMA 4A20A 3K5MA 3VTIA 1RZMA 1X4FA 4QBUA 3D6TB 1W2BR 5JZEB 1V6HA 3GONA 4UT4A 4KDLB 2YH1A 4KSLC 1GXUA 1VQ6S 2ZDOA 2V2VA 1U1KA 3K9OB 1B4SA 2UXDF 3DRPA 2Y1LB 3R7SB 1YBUA 1S1TA 2L0TA 4A4JA 1HR0J 3UIPB 2YNGB 1FDDA 3KXDA 5J1PA 4TY8A 2XS7A 3LYYA 3M2RB 2EFVA 1OGWA 2HAFA 3MEEA 1WXQA 3UN2A 3GIJA 1DY3A 1WDTA 5E3QA 2KFZA 1YJVA 2GO9A 3R7RA 3IFWB 5HKHA 3ML8A 4Z37A 4Y28C 3AI5A 1NK8A 1A7GE 3AB2B 1DAXA 5AXLA 1H38A 1XLPA 1I4GA 2E9RX 1VQ7S 2W9BB 2SXLA 1IKXB 3SFEB 4NZLB 2FZGB 2LRWA 2BW7A 2GBJA 5I4DA 5HBMB 2YNHB 1CULA 1SJED 3NKYA 2MHEA 3WC0A 5EX0A 3KH0A 3P5TL 3V62A 1VI7A 2GHVC 4YUDA 1OO0B 4MK9A 4I6NB 4R8UB 3VTWA 3KK2A 1GPXA 2B4UA 3HVAA 4K4UA 2M3DA 4WKYA 4CNYA 1NPPA 2R8JA 4PG5A 2HNZA 3O5TB 2B6AA 1QZEA 4RUHA 3DLEB 3EX7B 2YNIB 5E5NA 2I1JA 3SHQA 5I3PA 2XSJA 1X4BA 3GZNB 4M01A 4HL9A 1PAEX 2BANA 2QYCA 4RM9A 3KDOA 1SE3A 4AOFA 1RWMB 2OPQB 1F52A 1YRUA 3VTUA 2U1AA 2MSED 3TI0A 4YWGG 2EEYA 2QA2A 1RTIA 3RG6A 3WC2A 4REZA 4NAMA 2KKCA 3BGUA 4DPXA 4DQPA 5IT9Y 1BQXA 2K7KA 4ECVA 4CI0B 3MEKA 6AT1B 4DK5A 4EZ9A 2GVZB 4ICUA 3Q8QB 3DLKB 2BKPA 3CCSS 4EUTA 1TJEA 1VQ9S 4M5LA 1BQMB 1QKZA 3OV7A 2LJIA 4MDKE 1WDDA 3MTNB 3PV1A 2MJUA 5KFQA 4PYAA 4WTYA 1HQRD 1IKVA 4KHMA 3QO9A 4P74A 2LGSA 4PEOA 4FS2A 1Q81T 3O8WA 1RT1A 1SC6A 1T9TA 2NR2A 3WAMA 2ZNVB 1TL5A 2G9HD 1LQ9A 1UZHA 2JUOA 5HJXA 1XD3B 3UD4P 5AXNA 4TSSA 1HNZJ 3U02A 3RT3B 1FVQA 5B0DA 4OZBA 5TSSA 3GU0A 4CLYA 2RU9A 2B9WA 3H4BA 4KBIA 4NLRA 5HVFA 2DPJA 1WF0A 1O0PA 2ASJA 3I6PA 2KFKB 1I94J 2DNYA 3OFEA 5A8KA 1I4HA 4PRFA 3JXOA 4M5GA 4RUCA 4B08A 3V6EB 1JLAA 4K3BA 2IY1B 3KLIA 2CQ1A 4L3NA 1ENFA 1P1LA 4IM2A 2JNJA 4NCGB 4I67A 2KHWB 3A3NB 2IMWP 3UI3A 1Z2LA 3O65B 4TVAB 4ZPAA 3DBHI 1ZPWX 4MT1A 3MR2A 1EHWA 4BCAA 1U02A 2ZC4A 1L6UA 1L0VB 2WU5B 2MB0B 2WXOA 3DFEA 3C15B 3N1XC 2UYZB 4LNNA 3I0RA 2O5DA 2ZDPA 1XO3A 1KQKA 2KC1A 2Q79A 2QEXS 1QOFA 4KRWA 1REVA 2W4DA 2QYGA 5GAGI 1RB0A 3AMZA 2IC3B 1CSJA 1CQVA 3BSCA 4Q7AA 5C3JB 2FHJD 3AEAB 2HG4A 1IKYA 4TYAA 2VG5B 3M2VA 4HVBA 3KQ4A 1KBRA 3AD8C 2JEJA 4R0EA 2AEHA 1MJDA 1VC5A 4MGIE 4C3MA 2JU6X 3VCDA 5K8MA 1KOHA 1TS4A 3K8VA 5BMIA 3HD2A 3RYLA 2LJ5A 1WHVA 1SIWB 3RRKA 1Q7LB 2GHPA 3N0VA 1RYSA 5AJ3F 3PZDA 4RW8A 3AHPA 5AUIA 3H5YA 1U1RA 5JXVA 1YSJA 3VGUA 4BFRA 3DN9A 3NG0A 1NZ8A 3OVSA 4DUYF 1OPZA 3VAGA 2JX5A 1JLBB 2R9LA 4CO4A 4LIRA 3WAPA 4OQJA 3D2WA 1U0HA 1CJKB 1JLFA 4KO0B 3DRRB 2J9DA 5J2PB 2NUUG 3IM8A 3L4BC 2BJ3A 3V6HA 3G6YA 1SBBB 4YB5A 3VFKA 2ZITA 1BHNA 2HNDA 1TT5B 3N9UC 2BEFA 3VVTA 2AQ4A 3OXGA 3VTVA 3G2XA 5AE2A 2F5GA 4WJBA 4B3OA 4QYZJ 4N77A 5D6GA 5JUMA 2RDIA 3MM6A 4KE5A 4B95A 3K89A 1YJUA 2PKOA 1KLMA 4ZP6A 2MQOA 4C8ZA 4IWPA 1WGKA 4K3CA 3ZO7A 2UXDJ 4EI2A 3SCIE 5DO2A 4ER8A 4OX9J 1F1BB 1H7WA 2AV5A 4ACFA 3PYDA 4KH1B 2GO8A 1Q8KA 3R27A 3OJUA 1VQKS 4DHJB 3IMQJ 3AEDB 2ZFHA 2J6UA 3VUWA 3AB5A 4OZ2A 2R7OA 4DX8H 2LDYA 2AZ1A 1U4BA 1Q5WB 1SEBD 2AGQA 1LFWA 4DUTA 5ETPA 1SXLA 2NYIA 2ZKTA 1RAJA 2BOPA 3SEBA 2CUYA 5KFRA 3KJVA 1U6FA 1KQGB 3PHEA 3W62A 2C3MA 1QOGA 4ED7A 1B7FA 4CO2A 4BAXA 3MM8B 5KFGA 1C4PA 4AJWA 1HIYA 1WF9A 2DHSA 4FF2A 1NK7A 4IR1A 2HQIA 1REGX 3IP0A 3B54A 2XEWA 3TJ8A 5ETQA 3P5BP 1U1LA 3SDLC 3DI6A 1S1XA 4DPOA 3HD1A 1N33F 3AA9A 4WFNQ 1C1BB 2L08A 1R4NB 2UUBF 5KFZA 3M6UA 1J27A 3L10B 3EYZA 4RU2A 2CPZA 2UXBJ 1EETB 2OEKA 1TUVA 1WYGA 2MJEA 4WQOB 3JAMY 3DPDA 2DXEA 4GGQA 1SH0A 1P7FA 4TMAB 2C2OB 3MOZA 3CCVS 3ILJA 1E8YA 1PGAA 4DXGA 4RH6A 2JXTA 1JLGB 1FM0D 4GC7A 2BVCA 2RU3A 3OHBA 1Z2ZA 3FRYA 1RT6B 1WE7A 1VJWA 1WF1A 2FNJB 3H5UA 4XYCA 2DKOB 1UJ4A 2NPTB 3IR7B 1DRZA 1BQNB 4IQMA 4A8XA 2AQ2B 4OI6A 3TUJC 1ZZFA 1FCAA 1JX4A 5H1SV 2MEKA 1BLUA 2P9CA 1E7VA 2AT1B 3J80U 3I0SB 5EE1A 2BACA 2OAUA 1EU4A 2KTFA 3HMJG 1UGJA 2G0JA 3PX0A 2JYTA 5DG8A 2X3GA 4DDGD 1WSPA 4ECXA 1PAUB 5KOWA 1IQZA 3T6BA 3KLEB 2KU7A 1S77D 4WWMA 3SQGB 3UINB 2DHHA 2YWKA 3M63B 1J7AA 5KT3A 1PJ6A 2BRKA 4W9EA 1I51B 3FC9A 2BTEA 1MFWA 1J0GA 3T8MA 4I6WA 2NCNA 3VWSA 3D6MB 1CJUA 4HHUA 3Q8CA 2VG6B 5KOXA 3HO1A 2Z8LA 5LJ5Y 2NXEA 5DM6Q 1O51A 3DOLB 3Q8SB 5E0OA 4O3SA 1YOVB 2LVWA 4USUA 1D9FA 2KHDA 4DJBA 3CTRA 3OG5A 2HHPA 2OH2A 4I68A 5CXTA 3GFZA 3AD9C 4IH7A 5KFNA 4KT0C 2RSQA 2WBRA 4A6QA 1SXTA 2XSFA 4KGMA 1QDUB 2R2OA 1HW8A 1GFWB 2UU9J 4NEZA 4M0WB 2K0PA 3AOCA 3D4JA 2HMIB 2INDC 3NGRA 1Q5VA 3EGWB 1M1HA 2KX0A 2INPE 5H9EK 2XHWA 1L5UA 3QNWB 1EKSA 1M5KC 2JFDA 3VR9B 2V8VA 3UDCA 2W2PP 2AL3A 3TEYA 3FEZA 3C3LA 3NS8A 4OV6A 4N41A 1HBNB 3CC7S 4F2RA 1MG4A 3ZRCA 1N54B 1S5ZA 5B7WA 4ELTA 1V49A 3OJ4B 2WXFA 1WI0A 1N48A 3SSQA 2BW2A 2IPOB 1CK1A 2CHZA 2LXUA 1JB0C 3MMCB 1JLEB 2E9TA 1WHWA 3KFWX 1R0AB 2E1RA 4I2PA 2CVEA 1UUPA 3D67A 4ID8A 3RRHA 1U1PA 2JZZA 1CC8A 2B8PA 3BH6B 3R5AA 2H65B 5HVGA 4YXDB 5K8NA 3P6YC 1EQ0A 2MGZA 1BC6A 1YLXA 2RRBA 1Q7YT 3NCQA 2NR0A 4DV1F 4LBPA 2NS5A 3FBFA 4A8MP 2QILA 2I9SA 3UQSA 3HHLA 3RNGC 2EFGA 1F6TA 3O13A 2DAFA 3LWMA 2WCXA 3M32A 3UN3A 1GOZA 5AJ3J 3EICA 1YX6B 3VAWA 2QMXA 3TJPA 4EFOA 1S6UA 3IGVA 4HCPB 3PKYA 4J9VA 3L4PA 4RGOS 1CS4B 2DO4A 4DUYJ 3A9KB 4LCDE 1YJ9S 3N3KB 1JXEA 4H4MB 3LP2A 4ECRA 2V8GA 2WB4A 1Q0NA 3IWNC 2N7JA 2Q1LA 3CXCR 2DH7A 3IS9B 3J9CA 1M5SA 1OWXA 3ZRFA 2RHSB 2WXKA 1V2YA 2RSUA 3B1LX 3HX9A 2P8IA 1Q10A 2D2QA 3GP9A 3BREA 1UTAA 4PYDA 1U7LA 2KYXA 2JEGA 3R2CJ 4K8RA 4USJC 3VGVA 3NS7B 2L32A 3ABVB 2JL9A 2OP5A 4F4WA 2OD4A 4CO7A 4F7VA 4U7UK 1U6BA 3ENAA 4GDLA 2DJWA 3AY0A 3GE3C 2BQUA 2RJZA 1HNVB 1E10A 2BWFA 2XQCA 1WYWB 1HBOB 1IR2A 1EF1A 4WQMA 3RPFC 4U7CA 4BOSC 2EMTA 1NO8A 1EB0A 2W2NP 4YTPB 2C7NB 4MH8A 2FJWA 2LKZA 3I5AA 2LQ9A 1N8RT 3GCXP 1LXJA 1Y3JA 1WE6A 3QLHA 2FVCA 4IFVB 4TQ1A 3PYGA 1RSCA 3GS2A 4LQ3A 1IN0A 1VGYA 3EFCA 1EIYB 4FN2A 3FFIA 3LOUA 4WJQA 3ETMA 4KHRA 3PACA 4IG0A 3KLGA 1YJWS 1AW7A 3ET6B 1NJZA 1N33J 4RCOA 4RBUA 3C6TA 1ZETA 1K73T 4EO8A 1SKWA 5G0RB 3A1QB 2XO7A 2UUBJ 4ECYA 1CPZA 2K6QA 4HDGA 1UJ5A 3Q2TC 1VMBA 1LEOA 4OHWA 4HH1A 1DTTB 1SF0A 1AZSB 2JWNA 2RGFA 5DETA 4JYAF 5DDPC 3PTFC 1RAFB 1H98A 3Q83A 2MX2A 4CYEA 5CYJA 2JDJA 3RJMB 3SYZA 4II2B 3B2GA 1SE2A 5BYRA 2YKNA 3B4MA 3OLMD 4YOEA 3T3FA 2FZKB 2C2ZB 4B02A 1S9EB 3SDEB 3GZNI 3EGZA 1KLGD 4GO5X 2VB6A 2M88A 3X3UA 3KUHA 2G4BA 3OTBA 4YHHF 3ILLA 5T8IA 1V9OA 4F0HA 4P1BC 4KQZA 4F50A 1AT1B 1HZ5A 3Q24A 3R9LA 2QZ8A 4CLZA 5IOLA 1SE4A 2WOMA 1YN4A 4DZ6A 2BKNA 3MFHA 3SXLA 4B3TF 5IT0A 3RR8A 4ED8A 3D6HB 5BYSA 4N56A 2GZOA 3AE7B 4P2SA 3QBCA 2WK4A 4HEA9 4NLGA 4PYZA 4BBNC 3CSKA 4P6QA 4BDPA 4B3RF 2REXA 2JSXA 2AJQA 1EARA 2VOPA 1C4CA 2C1EB 3TEXA 4AUKA 1E8WA 2KQ7A 3TO8A 4YTMB 1UW9A 1YJRA 4CT9A 4HACA 1J8CA 2UP1A 4XTTA 1HNIB 4NXMF 2DYBA 4TYBA 1X4GA 1HW9A 4ZDNA 1QLBB 3MC9A 2Q5WD 2YNGA 3L54A 1OEYA 3M2RA 3W64A 3ZFVA 5L38A 5LXRA 2FGCA 3Q69A 4XC2A 2R2TA 2KQ4X 1HWLA 2HGMA 1U09A 2J76E 3DNCA 4TQSA 2IPKD 4X62F 1EP4A 3M9NB 5IP4D 2F4VF 2CU1A 4DOZA 4A8QA 4Y2MA 4DR2F 4FYVB 1AYFA 4K4TA 2W3SA 4OV1A 1N0VC 4GB9A 3CD6S 2E6XA 4ZHRB 3MEGA 4DQRA 1N36F 1IKXA 3JTNA 3AU4A 3HT3A 5KFTA 1Y00A 3VGSA 4C3KA 3V6DB 3E9SA 3IWLA 3TA0A 5HBMA 2NCKL 1YHQS 3H59A 3V05A 2GS8A 1FKOB 2VBWA 1ZPSA 3QWPA 2XGPA 1KDNA 3PO0A 3B0AA 2M5YA 2AJ1A 4B9UA 2HHUA 4R8UA 1ZBTA 1R8CA 1WGHA 2P6TA 5D7GA 4I7FA 3MAQA 2ON8A 5BO4B 3DLEA 4KHPF 3A8IA 2YNIA 4CT8A 4YTNB 3W5UB 3MR6A 5AZGA 1HMVA 5D3DA 4RUAA 3IRXB 1Z4UA 3B82A 2BF8B 1PC4A 5E33A 1RXOB 1NBFC 1EWYC 2PMZD 4DV1J 2LEPA 3Q8UA 2OPQA 3N9YC 3H98A 2DR5A 1TKTB 1KFSA 1S6QB 1VR6A 4H2AA 1S7IA 4M02A 2CJ9A 4WURA 2DXDA 5G5GA 2WDVB 3TYTA 3IAS9 1RA6A 5JHAA 4J37A 3SBMA 5HVHA 4DL6A 1NSPA 3MAAB 3ULHA 3HSDA 2YBVA 2BQRA 1R8AA 4QWBA 4LNIA 4X4UA 4XK8C 4FXDA 4K1RB 2D3O1 5K14B 5A8WB 2XCPA 2K8HA 5C1ZA 3SFDB 2F1FA 2W4CA 1ACMB 2OPPB 1R7SA 2IGHA 3M6XA 2RD5C 2VC0A 4TLQA 1R0BG 5EWGA 2QGFB 3TUOA 1C2PA 4I56A 3HULA 1VRTB 4IO1A 5KFBA 4GMKA 2DY1A 5LXYA 3NG8A 1U47A 1VJKA 4B9LA 4A9AA 2DAJA 2WVBA 3TX8A 1HWIA 1DTQB 2D3AA 3W66A 3BIID 2HVDA 4ZYSA 2G45B 2ZH2A 4WP9A 3OTDA 1U4AA 3TAPA 1ITPA 3CDUA 3NP5A 3DXBA 3KMSA 1VRUB 1YX2A 4J3OD 3ZLZA 1PJ5A 2AJ0A 3ZTQA 4RGMA 2KMAA 2AGPA 3PJXA 2KFKA 2EPIA 2V4JB 4ZRPA 2HS0A 3D0IE 2XULA 3W9IA 4BZAA 2HAIA 1VBXA 4NCGA 1OIAA 4ILMA 1IVZA 1AFIA 3O3LA 4IUFA 2Z56B 2Y0BB 2M56B 4S0MA 2QA1A 2DNRA 2MHNA 4P52A 5KHQA 1RADB 1EJ7L 5DM7Q 3KHGA 3PV8A 1GNKA 3WQPA 1XF5L 4HRSA 2CZVC 3BBFA 5LMNF 1UPPA 1FJ7A 4OI0A 2FJBB 1WFYA 4FHJA 4RNHA 2X3DA 3OXLA 4YY3F 2J0SD 3Q3JA 3HVWA 4USTA 1DOXA 2EVZA 1Y5LB 1E7UA 2WX0A 1WIAA 2IC3A 2GOWA 2R7VA 3C19A 2LECA 1UVNA 1R4NI 2LQ5A 4CZCA 4FBUA 1I4RA 4WJOA 2N9LA 2VG5A 2CFXA 2VPXB 2G4DB 5GAHI 2XLIA 1J5EF 1WXVA 3M2UA 2GNKA 4MIBA 3NGDA 2FUG1 2J7QB 4M5KA 1X4HA 4C97A 2DVIA 3PRZA 2WONB 1HKAA 3M9MB 1ZW7A 2W8LA 3CVKA 3KHLA 4ECQA 2VUGA 2IJ0A 4YHHJ 1RI7A 4EYHB 1D9DA 2YKMA 3QMQA 3PRPB 4DL4A 1RT5B 1FRRA 3FILA 1JLBA 3CMMB 3IBEA 4LJPB 2VZKD 1CJKA 4KO0A 2A6OA 5J2PA 2V6AA 5KT5A 1Q0WB 1WEYA 1X4CA 2WVCA 4CLPA 1MMDA 3M6VA 4B3RJ 3I9ZA 1S1UB 3OL9A 3NZUA 2EFQA 4IQXA 5GADI 3HFVA 2KDMA 4PR6A 1EUVB 4GXBA 1JLCA 4B9KA 2FIUA 3BDEA 4PCQA 5C25B 1HQ2A 1SV5B 2DHAA 4DN9A 3Q3OC 1TY2A 4NXMJ 3CC4S 3ZZPA 1C3TA 3EVOA 2VPYB 4LF8F 2C3YA 3RI7C 1V81A 3JB9k 4PS3A 1ESFA 2ZW0A 1QAYA 1E90A 1HA5A 2OIHA 1YJ7A 3DU6A 4HPMB 4MKYA 4TV3A 3NVVA 4JI6J 3R5JB 3PM9A 3HM3A 1N6QA 4Q2JA 2QG9B 5F41A 3H20A 2ZH1A 3ZNZB 4QIEA 1Q8BA 3IM9A 4NLVA 4X62J 2KFJA 2F4VJ 4DV5F 3PX4A 5LM7E 2MQJA 3SCLE 4FVCA 4DUZF 4FYYB 1XQQA 1QUPA 1FRHA 3AQOA 4CO1A 3MM8A 2N4FA 5K5MA 2FCMA 1T0YA 1FKPB 2A10A 4IG7B 1VLBA 4FYDA 1RISA 2ZE2A 3T1HJ 5C24B 2DRDA 4GVBB 1EWCA 2CJBA 2R7UA 1KN6A 4JGHB 1V9JA 1WF2A 3J81Y 4JI4F 1F3VA 2WNMA 1YN3A 3Q2AC 4ZIWA 2DBYA 2FJXA 5L8RC 1WNEA 2IYDB 2HFUA 3H9DA 2VRRB 4FBJB 4ZS6A 1GK8A 1LV5A 1M1KT 1UVKA 1EETA 3W9CB 4IOIE 4KHPJ 2GV1A 4RBTA 4NQKE 1PDXA 2Z2MA 1IR1A 4M63A 3U30A 2R42A 1IBXB 2JF5A 3CEDA 1JLGA 1QT9A 5GAEI 2J0MA 1PG5B 2XS2A 1YRXA 1YQBA 2JHEA 4ENOA 1WZ3A 1L3SA 2CDQA 2NPTA 3CCZA 4FKYA 2FCSA 1D5XC 2QFIA 2VZ9A 3OFFA 3S01A 1IBLF 1ZP0B 1UGMA 2DBBA 4B17A 4F02A 2OEDA 3N01A 3KWVA 5C2GA 4OZAA 1FX4A 3D0GE 1N61A 3QCAA 5DCNA 4IUMB 4O44A 5L95C 4YR3A 2BE2B 3PHWB 4ZN1A 3I0SA 5D4OA 5L1KA 4RMAA 2HHWA 3FSYA 3FNNA 1IJFB 3APCA 1N63A 4J9SA 3EZOA 2O6VD 4UOHA 2B5JB 3Q8RB 1XTZA 1HD0A 3DKDA 1NUEA 4FHKA 4GKKJ 5E3AA 1L0XB 2ZCCA 1JNZB 4QIFA 4Q2MA 2JOQA 5LSRA 3N5FA 1FJEB 1LW0A 1FFGB 3CGIA 4ICLB 4PKDB 1KNZA 3R8YA 3FDSA 2XNQA 2WTFA 2N9XA 2VG6A 4USKA 2WXJA 3POTA 4ZPWR 3NOBA 3R5CA 4R3DA 2CQ4A 4DR6J 1RBLA 3PRMB 4CIOA 3G71S 4BWJA 3DQVA 3R2DJ 2R8GA 1XJWB 1NJYA 2BQQA 4IFYB 2HDEA 1TR0A 2LI5A 2QLFB 3W9JA 3NXZA 2LQ8A 3HHKA 4DL5A 2FE8A 4P6VF 3QGPA 5HO4A 2PO4A 1HWJA 4PXDA 3MPYA 1IWAA 3PIPQ 2RILA 3CO9A 2HMIA 2E7VA 3GOEA 1E8XA 1P9DU 3MOJB 2JC0A 1TV6B 4ZVPB 4ZRKA 2FPHX 1RACB 3ZJTA 1KTQA 2J0JA 1S48A 1ZUD2 1EO6A 2H1YA 2EG2A 4QW8A 2BKFA 3SD5A 2H5EA 1HBNA 4X66J 2XCAA 2KDOA 3TNVA 3K5LA 2JY6A 3VZIA 2QL9B 2XM3A 2I38A 4J9MA 1VBYA 5AZFA 2RMMA 4L2YA 2GGPA 5LMNJ 2LUEA 2K8CA 4K2JA 2VH7A 3W60A 1RAOA 2LEAA 4C9DA 1YK9A 2GC8A 3MMCA 4YY3J 2OTLS 1JLEA 4ZCMA 4K7UA 4QR1A 2OSQA 2V2KA 2DNMA 4DLGA 2H88B 4G3IA 2XBBC 4IR9A 2XWYA 3PW2A 1A6LA 1AYEA 1T0SC 3MUMP 2MSTA 4CHKA 3I4HX 2V63A 3HHLD 3KHRA 4NZ0A 2KDFB 5A0YA 3Q3MC 5K9FA 1ZAXA 3HZEA 3P42A 1N5QA 2VF3A 4N58A 5HG2A 3T3OA 2M7SA 3CJRA 4ECZA 2PE6B 1NNDA 1HQEB 3URYA 2CJKA 3RZWC 2QN6B 2BPSA 2Z2LA 2KDIA 5IC6B 4DBQA 4HT7A 2ZW1A 1E8ZA 3Q22A 4ZOSA 4DX7A 1X9SA 3X1LB 2WWZA 3I5CA 3W5XA 3CDEA 3AE3B 2ZZMA 1GTHA 5LNK1 3CB4A 4LF4F 3A33B 2K3IA 3HSGA 2HTME 2B3TB 2QLXA 4KJIA 2JC1A 4FF4A 1HL6A 3OL7A 4DV7J 4IKAA 5IWAF 2C60A 2OPSB 4H4MA 3HK0A 3GQCA 2QEJC 2ZVNA 1S0VA 3SMZA 4DWFA 3CMES 2CZ4A 3MHSD 3VAFA 2JEIA 3BO3A 1R3NA 3H8HA 4OYAA 2VONA 2RUGA 1FXDA 2BYEA 4OVUA 4YB6A 3TA2A 5I42A 5A6PA 5JVGQ 4M8MA 2OKQA 4LQ9A 2HNYB 2HHHJ 1IBKJ 3L17A 3ZKJC 4LDTB 4J90A 1XC9A 2FHOB 3B08A 1CC7A 3BO4A 3JSVB 4WBFA 3SFUA 1XT9B 2CG8A 3TEGA 2OHFA 2CVIA 2N7EA 5DQGA 4LF7F 1FRDA 3MEEB 3WZ0A 3LF0A 1KOOA 3UCGA 1HBOA 3W3SA 1P9QC 2BBCA 2JZ3B 5D2MB 1NK4A 3JSRA 4LUBA 1A5RA 1KLVA 4P2XA 2KC2A 2KANA 4O3PA 3RBXA 2Y1IA 1FK9B 4EEYA 2ACZB 4DV5J 1FEEA 1FXTB 1GJZA 2FLOA 4IFVA 4DUZJ 4QU6A 4WK3A 3VUXA 2OJRA 2KO3A 4YB1P 1KSPA 4P72A 3V6KA 3OSPA 1RA7A 4AL7A 3THPA 4EGLA 2KN5A 2DEIA 2XMKA 2PEHA 3M6WA 3KUCB 2AJFE 3JQMA 4JI4J 4BKGA 2FJEB 5G55A 3SI8A 1L2NA 5G0RA 1XNRF 2XLJA 3A1QA 2FC8A 3OR2B 4HI2A 2XSJB 1STEA 2C2DA 3IBFB 2MDAA 2HQDA 3D6FB 5HQLA 2C2NA 1AZSA 3UQBA 5B0BA 4N9F4 1P0RA 4U9RA 1RAXA 1KKHA 1Y9OA 1NZAA 3A3PB 3MFIA 1CJVA 2DNHA 4RLEA 3CJSA 4FJYA 1FXRA 2ZH5A 3R3MA 1RT4B 3DLLQ 1RTIB 2WW8A 1OSCA 2CNNB 3RBZA 1IKWB 2L52A 1UMJA 2C7MB 3LGNA 4CTAB 1NMEB 2ILZA 1L3VA 1IXKA 1SE9A 2C3UA 1PFDA 2OFGX 4HXDA 2RQCA 1WC5A 4IOBA 5LMUF 5IXUA 1WSRA 4DR3J 2HS4A 2ADBA 2FY8A 2IGGA 2VHGA 3OTCA 4LF9J 5CZVA 4YDDB 3R97A 4HLEA 2GIRA 1BD6A 3EZUA 3H8YA 3QGHA 5D4PA 1IPGA 1X60A 5LSOA 3QC8B 2KI2A 3BBBA 1D9AA 3HM6X 2K6DB 5D0GA 4ID5A 4ELVA 2LD9A 3ZTSA 3FKBA 4DHZB 4RR5A 4EEWA 1RWXB 2GQQA 1FNVA 1ZM9A 3H90A 4L74A 4NLYA 4QW9A 1P98A 3VV2B 5FK9C 2MQ8A 2JFKA 5KT4A 2LFIA 2ZUAA 5CYQB 2LXAA 4JX1C 2DHXA 5KFPA 2UVRA 2OUGA 3RD2A 4DG1A 5GAEU 1LXNA 1N5TA 1K50A 1UZXB 2DGOA 2DCLA 1SL1A 2AD9A 1CJTB 2MLXA 3R7NB 2FJAB 3X0WA 5DZ6A 4ZITA 3FEXB 3CNQP 2WVFA 3QRQA 5J17A 2OSRA 4ZKAA 4QR0A 2KTQA 3DRSB 3DLHA 2C2MB 4X4QA 3AE6B 4Q8FA 2C3PA 5CQGA 3EDRB 1MN9A 4LRBA 3HKZD 4GIVA 1C9FA 3JTOA 3ZUNA 3UCZP 5DPRA 5BR8J 2IDYA 4EZLA 3V60A 3DBLI 3GJTB 4ZPVR 2EKEC 3CMQA 4I1TA 3HPOA 2W25A 4O4RA 3QIPB 4OHJA 1XERA 1HBUB 2GFFA 4F3QA 1UD7A 1OYEA 2HIYA 2LXIA 3ETRA 4RWWA 4ZCLA 1QILA 3NBPB 4E0DA 2DGVA 2ZH6A 3V6DA 1WEXA 1FNMA 1LKZA 3Q89A 4PAAA 2V4QA 1RAIB 2APOA 5HMZA 1FKOA 1HQUB 1UW4A 1IKYB 3QATA 2YWGA 3M2VB 2BM1A 1MI0A 2LWPA 5L46A 2KMMA 2FHMA 8AT1B 2I6WA 1VDHA 2W82A 3GIIA 3QSIA 4FNHA 4OW0A 4JI3F 2GQCA 4DS5A 3GG1A 1ZA2B 4MK8A 4OYBA 4JI0F 2HVZA 3H40A 4OHYA 4HVZA 5I3QA 3IRXA 3UD3P 4PWDA 1A9NB 3CW2C 1RTDB 5I3UA 4RW8B 3QYYA 4LF5F 3OJSA 4QIVA 2W9AA 4UOCA 4H4OB 1TKTA 5KFXA 2QLWA 2FB0A 2X1FA 2CDRB 1YQ4B 4A55A 1S10A 1R0CB 3GR0A 4IO9Q 4ED6A 4IG3B 3HHMA 1U0HB 4ZPBA 4X65F 1O5JA 1PUTA 4X2BA 4KGSA 4X4TA 1BWEA 1HYSB 1MSWD 2PVOD 3G96A 3ZIMA 5IWAJ 3B9JA 1SIZA 5K14A 2WDQB 3I5JC 1FDBA 1EAYC 3IXQA 2Q6BA 2OPPA 5F8NA 5J2NA 3DRYA 2BM0A 1T3OA 4Y65A 2VQFF 3M8QB 4P7IA 1P6TA 4B3OB 3ENVA 3T5HA 3F44A 4X64F 2DRAA 2IVYA 4I69A 4KH0B 3OQ2A 2DNOA 5CD4A 1Z1ZA 3MM7B 2AW0A 3PHTA 1JWSD 1DTQA 3ISZA 4X4VA 3P3DA 4ES2A 1C0TB 5DGBA 2M1MA 1TKYA 1RK8A 2DGTA 1K53A 3ETOA 2BYFA 3L16A 1VRUA 1KHVA 4HROA 3RNAC 3PR5B 1S7HA 3BGRB 3HKWA 2HQCA 3J80Y 3H7PA 3LB8C 3PDNA 2V4JA 1D0EA 2B4VA 5B0CA 3IAM9 3LUYA 2BGFA 3NY0A 2FD2A 1ZDVA 2DR8A 3VR8B 3DBSA 1Q1KA 2CPDA 3PZPA 5KFAA 1S72S 4E98A 1YWXA 2C2KB 2RMLA 2B9YA 4UOGA 1S1XB 4Q5VA 2IY5B 2GVDB 1TFWA 2ZBQA 5IV3A 2CPXA 3Q8YA 4OZ0A 4GOCA 5D0RA 3DGPB 1IGDA 3M1VA 2ASQA 5HROA 3OTEA 3LWLA 2CU3A 1SGHA 1T6BX 1XN9A 1TELA 3AA8A 1NK9A 1XMQF 4HPPA 4DL3A 2MQMA 5D15A 4F3OA 1XNRJ 2K39A 2MP2B 3T1AA 4U95A 1FDAA 4NEYA 5D78A 4JP8A 1N34F 4MFBB 1XLQA 1LOUA 1D5MC 1IBMF 5KFEA 2VFTA 2VFVA 4AL5A 3LANA 2KYZA 3QAUA 2EBEA 1M1GA 4X4SA 1FO1A 2WONA 1NVID 1S97A 5CTRC 2V8PA 1TAQA 5KFYA 1UELA 3KLSX 1RAEB 1TMMA 3QZ7A 3KJQB 1KJTA 3VQIA 5LMUJ 2D5GA 5CCLA 2ACMA 5GMEA 1JJCB 5K8OA 3Q86A 4DFKA 3GZ7A 5D3GB 3ML9A 2IM3A 5E2QA 1RDRA 1RHRB 2HGNA 4FYXB 1NJXA 2Q3PA 1PSDA 1RT5A 3W1YA 1TZ1A 4G11A 2W9CB 2N1WA 4DXFA 5ETVA 5HQ8A 3LALA 4LNKA 4DF4A 2CQCA 5DQHA 2XMWA 3BR9A 4NASA 1QTMA 4BHQA 3H42A 1JMLA 4WXWA 4ANEA 4CH0S 2IDLA 2HS3A 2G0IA 2BJEA 5KFKA 1SH3A 1S1UA 5J2MA 5L9NA 3M3JA 5DS7A 2O01C 4QR2A 4DQIA 2A18A 2PMVA 4J9OA 3NRZA 4RBVA 3D9BA 3AT1B 5JMNA 4CO5A 1WD6A 4KKIA 2UUCF 4IRDA 1L4DB 2AX5A 4N59A 2GHWA 4C0BA 4ZN3A 2KM8B 5B0FA 2IIHA 1SV5A 4I6AA 4DHJD 3HFZB 3HHDA 4QQBA 4F8CB 4LF2A 1V3ZA 4J9UE 2ZHOA 4F25A 3IR6B 3QRRA 5KG3A 2CJQA 1GQEA 3C8YA 3KYDD 2PI5A 2DCUB 4G50A 2JX2A 3K57A 2BKRB 4AUQC 4DFMA 4LJMA 2HQGA 5EDSA 2QIFA 2K9XA 3MDFA 3CT9A 3QQ8B 4Y2IA 1PIEA 2WRMA 4P75A 3BEGB 1U6ZA 3ISND 3WIMA 1RU2A 3A8EA 4DL2A 3DDCB 2ONQA 1W26A 4X57B 2KDEB 1JQ4A 2YPZA 1FKPA 2XGQA 3UVJB 5ETSA 3Q8PB 2DTJA 3JQJA 4ZLNA 2W54A 4NOHA 2RT3A 2NTTA 2YVSA 3Q3FA 2HVEA 3TWZA 2FHKA 2GJIA 1AWDA 3LA0A 4BWMA 1FHTA 2GBKA 4TQRA 1YQHA 3GB1A 3DCAA 4DV0F 3FQKA 1XK8A 2B0GA 4LFBF 2R2SA 1D1UA 1RWUA 3CDWA 2EW9A 4JI3J 1K0TA 3D66A 4FDFA 4ZLJA 1AUDA 2BYTA 4JI0J 4O23A 3U8ZA 4LRAA 1K47A 3HCXA 3M32B 2ZNYA 1D8YA 4KGZB 3THVA 2KX3A 2AYOB 4FJVB 2DNPA 2ZJPQ 4PS7A 2XZTB 1LFPA 3N20C 1HI0P 2MKYA 2LVOA 2IMOA 1YJ1A 3HRDD 4C0OC 2MY7A 1IQTA 4NCAA 1UKUA 2HFOA 1U8SA 3OD2A 3LP2B 3ZXRA 3HXMA 3H2VE 3GIKA 1TFYA 1RAGB 2K7JA 2V2QA 3J7A1 2HEKA 3R5BA 2XEXA 2RDGA 4NCBA 4HTIA 3R1HA 3D1OA 4F26A 2Q6CA 2XNAC 2VQFJ 3NGKA 1VQ8S 3EECA 3ZTPA 2QCZA 4X64J 5DDOC 1XCTL 1F5CA 4EZJA 4WP3A 2KD0A 3T19A 1NSQA 4ICLA 2QO3A 4F8RA 3SR6A 4GDLB 4NPOA 5U47A 2WDTB 2POKA 1VQ5S 1FD6A 5AXMA 3MMBB 3SSSA 2J0XA 2CHWA 3CWJA 3PRVA 2RS8A 4GN1A 2V68A 5A2QU 2BYVE 3TOQA 2KMCA 3WALA 4IFYA 2M4NA 5AT1B 2VC1A 3BB5A 4AT1B 3SV3A 5DZ7A 2QSFA 3N79A 4G0NB 3QLHB 4A8KA 4WFYA 1TTHB 3AXCA 3KYCD 2B76B 3CCLS 4ED1A 3U4EG 3EMTA 3G86A 5HJYA 1FFUA 5GMVA 3GE9A 2D10A 5D4NA 1FRIA 2BVZA 4UZBA 1MPEA 3MC8A 1F0ZA 1LK5A 3FFIB 3IT6B 1TV6A 2B3AA 1WKJA 3KUEA 1NJWA 2ZCBA 3KLGB 4CQ1A 1RT7B 4YT0B 4P7TA 2FVPA 3C6TB 4MSQB 2RIJA 3PYEA 4JI2J 5A76A 2WVEA 4PXEA 4ANCA 2LU2A 3G4SS 4W9DA 1SI9A 1EKRA 2OJWA 1XMQJ 1OEYJ 3MPDA 1TL7A 5J1EB 3LPEA 1Y56A 4LRFA 1NEEA 1L3UA 4X4RA 1FD8A 4DV4F 2ZJQQ 4QWDA 1RLCL 1N34J 2GW8A 2YKNB 3D28A 2DENB 1NDPA 4KFBB 3H0PA 1IBMJ 3VH3B 1OQ6A 2WXNA 2PC6A 1YG0A 3M8WA 3AEEB 1Z5SB 1KOTA 2MYFA 1UFKA 3RGIA 2B43A 3RBEA 1VFJA 1HQEA 5F8HA 2QSDA 1KWMA 2QC3A 3O2IA 4RF1A 1GEHA 4ECSA 4B3SF 3DHIC 3VGTA 3DRXA 1H0HB 2KT3A 1HHQA 5FIIA 5JHBA 4N76A 3DLGA 3A8KA 3CJ2A 4V1Ak 3RB0A 4JI7F 1UWMA 3P96A 3CCQS 3KNGA 3Q8AA 4BC9A 2X8XX 2AWTA 3M7VA 2LYVA 2ZWPA 2NLWA 3IFEA 2V0NA 3IXSA 1GMVA 4NNJB 2V8DA 2M4MA 5F9LA 2MJDA 2GIFA 1GXTA 4IOAQ 3KYLA 2OPSA 1E0ZA 3KUGA 2EI5A 3V5RA 1F2HA 1F2GA 4MK7A 3ZZTA 2FLLA 2ZEJA 3TAMB 1JWWA 3VAKA 3V81A 1UH6A 4RFBA 1WX7A 3EPIA 3GPAA 4HACB 3DYAA 1WMHA 2LRUA 5A8RB 2HNYA 3CJ3A 2VJVA 2HURA 2MBEA 3JYTA 2VPWB 3IG1B 1WACA 2CPHA 3DOMB 3C46A 1WC3A 3JSVA 2ZM6J 2PPHA 3GFXA 4P73A 2R7SA 4LFAF 2W7AA 2G2ZA 1FJCA 4AQYJ 5B0EA 5DDQC 2K8BA 2DXFA 2H51B 1UBIA 2WDRB 2EFPA 5B0GA 3I56S 2Y9HA 3EFUA 4QCLA 1EP4B 4O3QA 2X1GA 1BMLC 2GI9A 1YZ6A 4W9FA 3U52E 4NY0A 1HARA 2GAGC 2JVCA 1FF2A 1N32F 1FK9A 2JEFA 1SC3B 2AWZA 3MEGB 2JJ4D 3UPFA 5JVHQ 2V4IB 1T7PA 1WKLA 2QLBB 2AYGA 1RP5A 4B3MJ 3AJDA 1IP9A 2FCNA 1KQFB 2K1FA 3BQ2A 2L83A 2E1AA 4AYBD 2HZAA 3NNAA 1MHHE 1BXTA 4NA3A 3CF6E 5F0UA 4OJHA 1FERA 2RRAA 4OX7A 1SH2A 4HDOA 2ZH7A 3TMPB 4W90B 3A13A 4I7FB 3BO2A 4EE2A 3BGOP 3NUHB 2MY8A 4ERDA 4RW9B 1AA1B 1F5AA 3OR2A 4NA1A 1HMVB 3T9ZA 4LFBJ 1T9WA 2H9ZA 1UAWA 3MECB 3MJWA 1QOAA 2RR9A 2RQ4A 4XDDA 4ZK7M 4Q2LA 1RM6C 4ILRA 1FNUA 4JV1A 3PVXA 5AUKA 2W8KA 3EUNA 2V3NA 4AXIA 1NYRA 1ZXIA 4XAKA 3LPYA 2V2ZA 1KVKA 1KLUD 2DNQA 2W9NA 3VVWB 1RT4A 1RCOB 2Y5BB 2W24A 4OZCA 2VODA 3PSEB 5KTQA 4QU7A 2V34A 2WGSA 2YVCA 1NI2A 1IKWA 2GB1A 4CTAA 1KHWA 4ZYNA 3NCPA 6FD1A 4J6IA 4KSKC 1RABB 3MD1A 4MEMA 3AM9A 3FMBA 4X4PA 1YKWA 3GSIA 4JOUA 4DLEA 4ETXA 3SCJE 2R8KA 4WAAA 4RJVA 3CMAS 3MC0B 3R2TA 2PA8D 1C77A 2AJ4A 4ZDVA 1S12A 2DZMA 1VQNS 1RWKB 2EKIA 3GWCA 1NBEB 3M9OB 4WFBQ 3KJFB 2A6MA 4DN0A 2L1AA 2W7OA 3UWTA 2HFZA 3C66A 2ERRA 5C2CA 4US9A 2MHJA 2MZSA 4W9GA 1B1ZA 1X4DA 1KTVA 1T8EA 2Z0GA 2ZOFA 1X31C 4I6YA 2ZJRQ 2XYPB 5LXHA 1N88A 4OZLA 5EGYA 2BJ8A 3B8HA 5CX3A 3BV8A 4K4ZA 3J7AN 1HEZE 3P45B 5J1NA 5L39A 1MNEA 5CYQA 1FE0A 1V5OA 2HYIB 3NEKA 1OQQA 3APDA 3HVZA 4LRDA 1L3TA 4K81A 4DI6A 5EX3A 4WU2A 4ITSA 2V9KA 4XX5A 1KEKA 3W1SC 1CJTA 3RR7A 2W2OP 2XZDB 1YTYA 2WXLA 2RHQB 5LLIA 4OVZA 5TR5A 2BJDA 4LIWA 4DS4A 2E5LJ 3DRSA 2G1HA 1NDLA 3ZTRA 3AOAA 3NY5A 4DQOC 1OY6A 3DCGA 1FNXH 2MZQA 4KR0B 5SUHA 1DLOB 1W7WA 2VOOA 1IM4A 1V3SA 1S6PB 5DLGA 1WGRA 1T03B 3CCMS 3R5GA 1S9FA 2FJVA 1IGCA 2NPIA 1D8ZA 4N6EB 2DRBA 3QIPA 4S0RA 1HBUA 4TUUA 4DPYA 3NBPA 3AH6A 1O8BA 4CO3A 3EE3A 3DXSX 2A1BA 5M2PA 1HQUA 3E01B 1XMOF 1C79A 4DV4J 3BINA 3Q14C 3UN5A 3WIUA 2JVRA 1T9VA 4CYUB 3D1QA 2F65A 3T5LA 2F9JA 4KIKA 2EKYA 3Q8VA 3M62B 3KNAA 3P63A 4YDXA 3M2UB 3LDZE 4HK2A 5EE0A 1FNOA 2OMOA 4UY8T 1UFLA 2RDJA 2KDBA 1K52A 3M30B 2DR7A 1H3DA 2C28A 1EX8A 4RW7B 2UUAF 1RTDA 2MW5A 2NQPA 3DDIA 5EWFA 2BE9B 1CLFA 4B3SJ 4P2FA 2DNNA 3D5MA 1ZXHA 1D6EC 4H4OA 3SZ2A 2YKMB 1X5PA 4DSEA 2HJ1A 1T05B 3GJRB 1ZTWA 3IBWA 2BWES 4C4WA 3PPAA 3FILB 2KWCA 1SBRA 2M2BA 3H1UA 2IYIA 3FBCA 4N8NA 1QM9A 2V50A 2KK8A 2CIMA 2JRSA 4IG3A 2Y1JA 4L1BA 3PO4A 2CPFA 3PW0A 2ZBIA 5D0EA 4Q8EA 3GV7B 2ASDA 1HYSA 1Q82T 5C7PA 1ZKHA 1WJUA 3BDPA 2CNKB 3Q23A 3QT8A 1VRQC 5F9NA 4EO6A 4HJGE 3TANA 2E9ZA 2MCNB 4URSA 2JRHA 4F36A 1CG2A 1GNUA 1DARA 1JLCB 2G4SA 3M8QA 3U1NA 2XBPA 1ZOTA 4MKBA 5L1IA 3MHZA 1S4EA 1S1VB 3JTPA 4FYWB 2DZKA 2ZBRA 3MM7A 4DZDA 4CM2A 1R31A 3CD7A 4LFAJ 1C0TA 2ZOMA 2FVQA 2UU7A 4UTGA 2J9CA 3PXGa 4LT6A 1N6QB 5CAAA 3ZDTA 2OO4A 2W4PA 4DR5F 1ZAVA 3TQEA 1TUWA 3CCJS 4GU2A 3ZNHB 3BGRA 1PYOB 2R7XA 3NMAA 5JH5C 4KX6B 3OTOF 4PG7A 2K5PA 3KG4A 1AROP 4WJPA 4DDID 1OQYA 2AEJA 4QPTA 1VRAB 1N32J 4USVA 2IGDA 2WXRA 2HK3A 2XI3A 2ZE2B 2FTRA 2G2OA 4DQSA 2ZOGA 1E9MA 2GMIC 1NCLA 2R8IA 1RBAA 1JK9B 2CPIA 2GVDA 2J5AA 5B08A 2ALZA 2KB2A 1RWVB 2QSWA 4ECWA 3DGPA 4WFZA 1XEEA 2KACA 2BZ2A 1B0TA 4OHXA 1JRPA 4RNAA 1TKGA 1FXAA 1KLNA 3AQPA 5T41A 3A9JB 5KFWA 2HBRB 4MSMB 3CD5A 4RF0A 2MP2A 1QD1A 5H9FJ 3NWGA 3A8JA 4C3LA 1X4EA 4NWBA 4GLSC 4MFBA 4C8OA 2NZCA 2OGUA 5HLFB 2R2QA 2QMUB 1MVKA 3TA1A 1QOBA 5BMHA 2CPJA 3AE1B 2AP6A 2QA4S 3G6VA 3F41A 2UXCF 2KFNA 2JQRB 2FUG9 5CHVC 3OBIA 2WXIA 2L05A 4KGTA 2RDHA 4O44B 3V6CB 4GRSA 4GC6A 5KFIA 2IA6A 3CULA 4OI2A 5CD4H 5IOIA 4USAA 2VDHA 1TKDA 5D3GA 1UWBB 2PEAA 9RUBA 1RWWB 5IA7A 2ZD1B 1G4CA 1TL4A 2KT5A 2HFNA 2QL5B 2XMMA 2W9CA 3PGEA 1NPRA 2GBNA 2XHCA 5KAKA 1F60B 2Y5CA 1FFWB 1FTCA 1WJ6A 1N5WA 1LW0B 2KKHA 1YJTA 3MGJA 1U1OA 1UL3A 3NZSA 4N7TA 1M90T 3CIMA 2KVZA 3POTB 2FJDB 4PABA 5IKCM 2CA9A 4WWPA 2ZHBA 4DWIA 3TZXA 2XMUA 1UVIA 2MSSA 4FA6A 4ZLLA 5FJ4A 2UVUA 5K8PA 1EM7A 2VDIA 2UUWA 3BN7A 1BT0A 5F8LA 1VYAA 2LQBA 1IUEA 1T9UA 2WSFC 2IO3B 3AAWB 5B0AA 1CVJA 2QL7B 3ZXWA 3C14B 4O4GB 3KWLA 1VS3A 1TAUA 3H2LA 3WAOA 1ZS6A 4R25A 5BMGA 5HFYA 1X7VA 1H2TZ 1DQ9A 2LA4A 2AYEA 2XY6A 3SEOA 3ZNID 4AS1A 4AXJA 1FCLA 2I5JB 4DL7A 3T9LA 4II3B 2DNGA 2K3UA 2MMYA 2DZJA 2N9EB 2VH2A 3RB6A 4DCJB 4D2KA 2M0AA 3OPKA 1NB7A 4EBDA 4RW4B 1MW7A 3RRGA 4GKJF 4XDCA 2KHCA 2N82B 3VH4B 1J7BA 1H8CA 2GGPB 3UVJA 1GB4A 3RAMA 4DV3F 5IO9A 4DCPB 1JXLA 4YR0A 1FCCC 4LR7A 2Z59B 3QJLA 2MJ3A 2KJRA 5AZHA 5FD1A 3L7UA 4AJYB 2R8HA 2B8QA 4MGKE 1HA1A 2AF6A 4NLPA 1OFFA 4FULA 1TZOA 3TUZC 5A0YB 4OYPA 1SJ1A 5KFHA 4MIWA 3HP6A 5T7LB 1UZDA 1B3TA 2KT7A 2CNOB 2ZVSA 1HR0F 3EPGA 1JLQB 1U1MA 4ZVOB 3MXHP 2LHEA 4NE9C 4G3XB 2UWQA 3GMGA 1Q86T 2ZZTA 3MD3A 3U1MA 5L1LA 4ZHOA 3OR1B 4O0NA 4K4YA 2KJHB 4ITKA 1I4QA 2UUAJ 4OL8A 3R8BA 2BE7D 2ZZPB 3MI7X 4K7SA 2ZWOA 5E6PA 2BJ7A 1X9WA 1XXGA 3I96A 3A4TA 2QA4G 3ONQA 4I6LB 1HXYD 1ZH5A 4J9RA 3WANA 3U7JA 4TKNA 2ACYA 1U0SA 2EXUA 6FDRA 3OL6A 3WHIA 2H5IB 1OTRB 3ENWA 3I57A 1WKKA 1YMHE 1KFDA 2OTJS 4N5SA 5I42B 1RWPB 2NPFA 4QWEA 5IV4A 5KG1A 1JROA 3E3XA 1TK5A 3GB0A 3QA8A 4FVMA 4OIXA 2ZPNA 4ALZA 3TJAA 1LWEA 1H73A 4B6WA 4WPAA 1JIHA 4PUOB 3AV8A 3A12A 1TKEA 3MR3A 5L9XA 4BLGA 4OI3A 3VAHA 2LXFA 4WFXA 2A3JA 5I4MA 3BKUA 3MMBA 4FN5A 3ZTDA 3EWGA 3WDOA 4FS1A 1NKCA 1QE1B 2LP4A 1SL0A 1G6JA 4DR5J 2L41A 3AD7C 1BMQB 1OY8A 3CJTA 3B2FA 1T3NA 2B7CB 2IM0A 2FCQA 3W9HA 4LMZA 9ATCB 3OTOJ 3MP9A 5G4DA 3UF8A 2LGDA 4H4KC 3K9PB 3LGHA 2KWVB 1X8DA 4WAFA 1KRHA 3BVZA 3KLFB 4EBEA 2R7WA 4PK1A 1X4AA 3JQKA 4DBGA 1RT7A 1X5OA 3CO0P 2RF2A 3HVTB 2Z2ZA 2IO2B 4LFCF 1N5YB 5KG2A 2YWFA 4DSJA 2F9DA 4RW6B 1WXAA 2RQKA 3TL5A 2JH3A 3KMQA 3MM9A 1NPKA 4QJVA 5J1EA 1ZYQA 1NDCA 2L3MA 3TCAA 1CJVB 2PN6A 4DSIA 1L6VA 3TZYA 1T9XA 2OD6A 4KFBA 2LQJA 1B99A 1GTEA 2KXHA 4Z7YA 1MWYA 2MEWA 4DX5A 1XMBA 2F8MA 2UXCJ 2HQFA 4S17A 1E7PB 2AEMA 2FGOA 3ZZ0A 3B4DA 2VFSA 1WWTA 2D3GA 3N32A 4IM3A 5IM0B 4JIOU 1WRIA 2VD3A 2RE1A 2E66A 2Q43A 2NTSA 1RUSA 1U45A 1DOYA 3IR5B 1VHFA 5FLXU 2D11A 2NREA 2HWHA 4X84A 3PLUA 3V6JA 2AYBA 4ZA1A 4ID5B 3R2IA 2RKIB 3VQTA 5D94A 1RYJA 4LDTD 2NBVB 1DQ8A 3TAMA 2G9OA 3OXFA 4I2QB 2CQ3A 2IRYA 3KW5B 3M8PA 2VICA 3VRAB 1OY9A 1VBKA 4ARCA 5M2UA 5A8RA 4OX8A 4G65A 3GIRA 3S6EA 4IWQA 2WSCC 1UJ6A 3ZC4A 2EKNA 3KTQA 3IG1A 3L13A 3DOMA 1LK7A 4DG1B 1R8HA 3UCUP 2XS5A 2DGUA 4K50A 4ED5A 3PX6A 1MG8A 1P9YA 3KWMA 3OUYB 2F4FA 1O6XA 1E5WA 2LCWA 1SJHD 5DG7A 2M8HA 3MPUB 3AOBA 3QT5A 4MYTA 4CLTA 1HE8A 4UQTA 1NB2A 2A0FB 3G6XA 3LJ3A 2F40A 2P9EA 3QPIA 1LM8B 3KDNA 1I3OB 3CJ8A 3S1TA 3HK2A 1XLOA 4C4VB 1BGXT 4DPTA 5GMKa 2IBOA 4R5PB 3VHTC 1PYSB 5F8GA 1ET9A 4JB8B 2H3EB 2EK6A 3BK2A 1C4AA 4PG8A 4NI2B 2KWUB 5HL7Q 3I31A 5IC4B 3BGFA 2ZH9A 1ZE3D 4B9NA 3KOAA 1WJ9A 4DV3J 3VQSA 5CHCB 4W9LA 4DSLA 4ZMMA 3PEJA 2J52A 1CQMA 2ZBCA 2HJ8A 3HFKA 4CO0A 4RU9A 1Q53A 1KR4A 3HZGA 3CJQA 5IQ6A 1H6KX 2O1PA 2ICIA 2BJ1A 3OJ3A 5M2RA 5EUHA 4WK1A 4RW9A 3JW0X 3AXMA 1WY8A 4ZJLA 2DGSA 4OVVA 4OX9F 3TR5A 4C6AA 2CNLB 3MECA 2LGIA 1QSLA 4PWDB 2DR9A 5I3UB 3K8WA 4EMDA 4HTJA 1JJ4A 4FBTA 4MMOA 2HE7A 3PFOA 4AE5A 3HLUA 4KKOB 3CPWR 4J9QA 1T9YA 1SJ3P 2QX0A 3ZXVA 1U49A 4ZCKA 4URKA 3K5NA 2MQLA 3DVNV 4WXOA 4AP4C 4O3NA 2Z4PA 1FJGF 3W5VB 2D3BA 3FCVA 4WIPA 2ASYA 3PFEA 5J2NB 1TL1B 3BF4A 5D0HA 2M0XA 1GX5A 1F77A 2HRTA 5IN7A 4HT5A 2PI4A 5IAAC 4WTOB 3NOCA 3AFGA 4RKUC 3TVZA 2INNE 2IHR1 5ITHA 1H72C 2BS2B 4MJSB 1MROA 2E5IA 3DDNA 1PKUA 3G82B 3I9V1 2KN4A 4B0MA 3CJ4A 2UXBF 2PE9A 4NLSA 2ROGA 3UD5A 2K06A 2AJ2A 4E3CA 1SKUB 3QQCD 3ZQ4A 3AEFB 4WWOA 5KT6A 4A8WA 1ZGUB 2NXNA 1TKXB 3DHXA 1FDNA 1RT2B 3DHGC 7FD1A 1VQYA 1ELOA 1RWSA 1R6VA 1GX6A 1T5XD 2WHIA 3E8OA 1F2RC 3HIZA 2EBGA 3GP7A 3P8BB 4LVNP 2J0WA 4NQLB 1VR9A 1D3WA 3H7PB 1GC6A 2M8SA 4FXCA 4NX9A 7AT1B 2G13A 3LP0B 4LRCA 5HATA 1E6YA 3RNCC 2O2VB 2PSZA 3GTYX 1C1CB 2L7RA 3CCUS 1WGDA 2V9WA 4M94A 3NLCA 1M0SA 5AEKB 2IRXA 3UR3C 2Y8WA 3G9CA 3AE5B 2ZVIA 1OSDA 2D9PA 3K58A 4DDFA 4PQAA 1UEUA 3U7DA 3BQ1A 4OYWA 1HLWA 2AEFA 3M1VB 5HROB 3VALA 1YX5B 1NKEA 1DLOA 1FRXA 1RWOB 3VVUA 2FVRA 4Y34A 1JWAD 5DRKA 3L08A 1S6PA 2IM1A 1WR6E 1T03A 2V9HA 3ZO5B 4E2FB 3QRPA 4LFCJ 1JCKB 2BRLA 2BDPA 4HKQA 2XMJA 1FTRA 2LDIA 4UUXA 2KVQE 2V67A 3MF5A 1WG4A 4KVGB 4HHHA 3W5ZA 3BSOA 1UVMA 5KFCA 4JYAJ 2QJ3A 3E01A 1V5VA 1X5SA 1FWKA 1GMWA 2CG4A 5T14A 4K59A 1JQGA 4CYUA 3H2UB 2CAJA 4QWAA 1F9HA 3RNBC 2EFOA 2NMQA 4OYMA 4Z2XA 2YX7A 2R3VA 2UU9F 4PXBA 4IDKA 3CDBA 3M30A 4WIQA 1RKJA 4C98A 1K0VA 4RW7A 1GAOA 2RDDA 5H8YE 1APSA 3UGBB 1C0UA 3IAM1 2J6SA 3DM2B 2CWXA 3R66C 5FDLB 4G1QB 4EWTA 1T05A 3RMKC 1DYQA 5IT4A 4D3GA 5J2QA 2DO0A 4ZVEA 1U2RA 3QT6A 5ETNA 3TVKA 1FFSB 2I2YA 1LW2A 3H25A 3GJQB 4UY85 2ZJDA 4B3TJ 1AARA 2KTRB 2LZ6A 2W3RA 5LT5A 2DB1A 3F73A 4YR2A 1OJ4A 2E1CA 4ZLPA 2MBHA 4NLWA 2HTHA 4ZVHA 5J2MB 2DH8A 4ZPDA 3QAEA 3TRGA 1LWFB 5HAOA 2IJFA 4MELA 1EZZB 4M5IA 3TEHB 4BBNF 2IBKA 4OJ1A 2UV8A 4XWTA 1WUUA 1S1VA 3FC4A 1ZAWA 1ZM4A 3CDAA 1L3KA 1YIJS 3NS6A 1QAJA 1NDDA 2PE8A 2QDFA 2N7DA 4EOYA 1YD8U 1JWUD 2L8JA 3L0WB 2RPQA 3IVFA 3NNCA 2M52A 4GVLA 3MM5B 1ZOYB 1H74A 3KVFB 2G1DA 2DWQA 1RTHB 2RQMA 4ATNA 3E2EA 2RB7A 3FEYB 3OFGA 3EGNA 2KYWA 5EWEA 1GXLA 3H7SA 1XIQA 4DR2J 3DOWA 1D3ZA 2BR0A 2BS4B 3VZHA 1SJFA 1B0PA 1SC4B 1UP1A 4CDIA 4QYZK 2GBMA 2XTJP 4NRTA 3FJ2A 4CNZA 2BOAA 4ZP9A 3FMWA 1N36J 1Q16B 2J0KA 1SUQA 4K7WA 4EYIB 3EGRA 5G2NA 1MU2B 4C8NA 1G7CB 3VXWA 2AU0A 5E7OB 4HJKA 2HW3A 2DGXA 1U24A 1VQPS 2HFVA 2LGYA 2MWSB 4MYUA 2N9PC 2BQ3A 1LXDA 3W1YC