2I38A

Solution structure of the rrm of srp20
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
b'MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRDLDGRTLCGCRVRVELSNGEKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion protein consists of immunoglobulin G-Binding Protein
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/chimera
total genus 42
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2i38A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i38A02
2RNEA 1W2BR 2ONQA 1X5TA 2QFJA 1M1KT 2DISA 1OIAA 2CQ1A 1U1PA 3MD3A 1GB1A 3VAFA 3FILB 5CA5A 2CJKA 2CPDA 2D9PA 1QKZA 2N82B 1X5SA 2J52A 2DNMA 3MUTP 1VQLS 2KG1A 2LGIA 1PGBA 3P6YC 2ADCA 3FEYB 3G4SS 1U1QA 1FO1A 1F2RI 3MUMP 2DNGA 3MI7X 5DDPC 2RS2A 4YB1P 3G8SA 3IWNC 1K9MT 2OTLS 1IBXB 2LA6A 2SXLA 1HA1A 4F02A 2L08A 5LSLA 2KM8C 5H1SV 1XN9A 2MZSA 3CC2S 3CCVS 1VQ7S 1WG5A 2RRBA 3MP9A 1VQNS 1YJ9S 5HG2A 4J5OA 1WG4A 2KRBA 1K53A 5DM7Q 4C0OC 4KGSA 2DGSA 2JSVX 4TU9A 2D9OA 2JVOA 1FCCC 4FXVA 2QSDA 1VBYA 1M5VC 2MKHA 2J8AA 1Q86T 1M5PC 3UWTA 3IRWP 4RU2A 4HKZE 1UP1A 1H2TZ 2M4MA 2OSRA 4IO9Q 1UAWA 1VQPS 3CUNA 1U1KA 4QU6A 2ZJRQ 2E5HA 2MQOA 3V3XA 2PEHA 5LSOA 3VAGA 2G0CA 1B7FA 1IGCA 1Q10A 2YTCA 1IQTA 3CCRS 2DGQA 2KYXA 3US5A 1SJQA 2HGLA 1NJIT 2I38A 3H2VE 1GB4A 1WG1A 1X0FA 5D77A 2N7JA 5FJ4A 1X4AA 2LEBA 1VQKS 1VC5A 2DH7A 3CF5Q 4CQ1A 1KD1T 3RW7A 2MKKA 2XB2D 2DNYA 3Q2SC 1VBZA 2XNQA 2EK6A 4W92B 3VF0B 2DGUA 2DGVA 1M5KC 1WHYA 2MYFA 2JWUA 4P6QA 2F9JA 3DLLQ 3VAHA 3THPA 5MLCV 4Y0FA 2CQPA 2MZTA 2OIHA 3UD3P 1U1OA 1QVFR 3UCGA 4F26A 1S72S 1U2FA 1X4HA 1OPIA 1WHWA 1SJ3P 1SJ4P 2A3JA 3VAJA 5HI1A 3B4MA 4CH0S 1U1RA 2N9KA 2XS2A 2DNNA 2MGZB 2X1FA 5HHDG 2RRAA 3EX7B 2MB0B 3H2UB 4OZBA 1X4DA 2DHSA 4QPTA 2KH9A 4WFNQ 5HO4A 2WBRA 2DGOA 2E5IA 1MHXA 2MJUA 1PO6A 4PKDB 2PE8A 3R1LA 2RQ4A 5LXYA 2DIVA 1DBDA 1K51A 3CC4S 3ZZYA 1P27B 2V94A 4PRFA 3V4MA 4CIOA 1FT8A 2MY8A 4LIRA 4F25A 3ULHA 1WF1A 2RS8A 2DNLA 2MKIA 2X1AA 1K8AT 2XS5A 2ZJPQ 1UFWA 4Z2XA 2KM8B 1HZ5A 2KWDA 1RK8A 1N54B 2FPHX 3G8TA 4WKRA 1YNTE 5GAHU 1XCTL 3CTRA 2JVRA 2G1DA 2JU6X 2MZ1A 2E5GA 5DDQC 2DH8A 1JMLA 2RVJA 4C7QA 1P7EA 2Q79A 2N3OA 1FXLA 3SMZA 1FJEB 2XS7A 1X4BA 2VONA 2DO4A 5GVQA 1K73T 1WELA 2AYGA 4TU7A 1VBXA 1AUDA 2ZW0A 2LEAA 4D2KA 4TLQA 1KH0A 2DIUA 1XCQL 1X4CA 1YHQS 2DNRA 3SDEA 4WIIA 2G4BA 1G2EA 1YMHE 1K52A 2U2FA 1WI6A 2J53A 2NMQA 2CQIA 5GADU 4IOAQ 2LKZA 2LXIA 2LYVA 4IUFA 1OO0B 3LQVA 3S7RA 1YTYA 2MHNA 1VQ6S 2ON8A 5D78A 5JVHQ 2XSFA 3I55S 3CMAS 2AYMA 2CPFA 4UY8T 4YOEA 1O0PA 2OSQA 3L3CA 1N52B 2MZQA 3NNCA 5BJRA 1DZ5A 2KXNB 4KGTA 2KVIA 2LQ5A 3UD4P 3JB9k 3TO8A 5EN1A 3DXBA 3GB1A 2K8GA 1KOHA 4WH4A 1YJWS 1KC8T 3BO3A 2DHGA 1MPEA 2MSSA 3NMRA 5ITHA 2KT5A 2DNHA 1JJ2R 2MKSA 3K0JA 2I2YA 1IGDA 2MJNA 5JVGQ 2HZCA 3G71S 2M70A 1H2UX 3I56S 4KGRA 1JMTA 2CQ3A 1KQSR 1XF5L 2FHOB 2KXHA 1WEYA 1P7FA 2AYEA 1VQ8S 3CCJS 2MPUA 2CPIA 2XNRA 2DK2A 1WF0A 5GAEU 2VODA 3CD6S 2M2BA 1A9NB 2PLPA 3LPYA 1MI0A 5DDOC 2MQLA 2ZW1A 1A7GE 3VAMA 4QQBA 4OZCA 2L9WA 5GMKa 3UCZP 2DGWA 2OJ3A 2MSTA 2DNOA 4OZAA 2FC9A 4ZKAA 1Q82T 3MURP 3UE2A 3CCUS 1X4EA 1VQOS 4PR6A 1KOOA 2NZ4A 2JXTA 5BMGA 2K0PA 1SXLA 2L41A 1UWXA 3UI3A 4WFAQ 2N9LA 2HVZA 3P3DA 2RU3A 2F9DA 3MUVP 2CPEA 2LMIA 2NLWA 3MDFA 1URNA 1BY9A 4BS2A 3FEXB 1RKJA 2DNKA 1R8PA 4TU8A 2DNQA 2FC8A 4WFBQ 1VQ4S 2KXFA 3FILA 2M9KA 2VOPA 2DH9A 1H6KX 1NO8A 5JXVA 2KHCA 4WCEQ 1Q7YT 2LCWA 2LUMA 2CPJA 5IM0B 1Q81T 2LECA 1D8ZA 1HD0A 2LXUA 2BOPA 2RPVA 3HHNB 2LHEA 2MQMA 2KI2A 1U1LA 1SJRA 2LA4A 4Y00A 1HL6A 2J76E 2DNZA 1FCLA 1WHVA 2RT3A 2OTJS 1IBXA 3N9UC 3TP2A 1U6BA 3TYTA 2K3KA 1U1MA 5HFYA 2CQ4A 4M5DB 1HD1A 2BZ2A 5DDRC 2GO9A 2MQNA 2MXYA 3EGZA 1NU4A 2E44A 1D4BA 4EGLA 1QM9A 2MY7A 2EVZA 2MKCA 5DM6Q 2HYIB 1VQMS 3PIOQ 3U1LA 5IQQA 2YH0A 1C9FA 3NS5A 5CYJA 2AD9A 1X5OA 2LHDA 2VOOA 1M5OC 2KDMA 2KN4A 3MD1A 3SXLA 2DGTA 2GHPA 4LJMA 1DRZA 2KFYA 1F9FA 1CVJA 4MACA 2KRRA 1X5PA 2MMYA 4IKGA 4V19X 2JZPA 1HZ6A 2CQDA 3G6ES 1FD6A 2CPHA 2QEXS 4IOCQ 1EM7A 3RW6A 1L3KA 2X1GA 2UP1A 2CQCA 1VQ5S 2FY1A 1ZH5A 5LJ3Y 2O3DA 3BO2A 1YITS 4FXWA 3G96A 3NNAA 1DHMA 1WI8A 1YI2S 3P5TL 3CCQS 2DITA 3CULA 2DB1A 1PGZA 2DHXA 3SDEB 2E5JA 4YUDA 3ZZZA 3NS6A 2CQGA 4ERDA 2D3OR 3THTA 1ZZFA 1ZZNA 1YJNS 1S79A 2CQBA 4CH1A 3MXHP 4HJGE 2ADBA 2M8DB 1X4FA 3BO4A 2JWNA 1H2VZ 2IGDA 3CCLS 4UQTA 3J7YU 3U1MA 2GB1A 2YKAA 1X4GA 2MZJA 4OZ1A 3BEGB 1VC6A 5IFMA 2EK1A 2J0SD 1U6FA 2CPXA 2CQ0A 3EGNA 2KG0A 2AYBA 3CCMS 1U1NA 1JJ4A 2ZJQQ 2QMTA 2M8HA 2JRSA 3CPWR 3R27A 1PGXA 1JJHA 2RQCA 2GI9A 1N8RT 3MOJB 1FHTA 5BMHA 3UCUP 2RMMA 2OEDA 2MGZA 2MQQA 3BS9A 2RUGA 3S01A 2N3LA 3VAKA 1UW4A 2DO0A 3CXCR 4QU7A 3G9CA 3J7ZT 3B4DA 1WTBA 2PW9A 1N88A 2IGHA 3CCSS 5BMIA 1OWXA 2CQ2A 3PIPQ 1QVGR 4GLSC 1YIJS 5CXTA 3VALA 2IGGA 2DGXA 2M7SA 2HGNA 2EELA 5LJ5Y 1FJ7A 4ED5A 4W90B 1VC0A 2F3JA 3P49B 2ERRA 2CQHA 2CPZA 3HI9A 5HL7Q 4WF9Q 2DNPA 2X1BA 4U67Q 3CMES 1D9AA 3S8SA 1WWHA 2HGMA 1K50A 2M52A 3R1HA 3NNHA 2KQ4X 2M0GB 3CC7S 1HEZE 3VAIA 5IM0A 1P1TA 3OW2R 1M90T 2U1AA 2DHAA 1F2RC 2MZRA 2JX2A 2N7CA 2MKJA 1WEZA 2M88A 3S6EA 1WF2A 2KACA 1FNXH 4A8XA 1R8HA 1MVKA 1ZXHA 4LMZA 2B0GA 3CCES 3Q2TC 5LXRA 4C4WA 5DETA 2PTLA 1VQ9S 3D2WA 4IOIE 2MQPA 1FJCA 2CPYA 1WHXA 2J0QD 5GAGU 2KU7A 1MHHE 2YWKA 2QA4S 1SJFA 2YH1A 1YWXA 1WEXA 4OZ0A 1PGAA
chains in the Genus database with same CATH superfamily
3Q8YA 1JWWA 2CG4A 2FGOA 4N76A 1SCJB 1FWKA 1I51B 4N41A 5KG2A 1URRA 4IRDA 1AARA 4DSEA 4Y28C 1HTQA 4HI2A 4YHHF 2GHWA 3U8ZA 3ALBA 1VFJA 1FKPB 3UNGC 5HK4A 3TJPA 4IQMA 1UEUA 2IVMA 2JLFA 4NYOA 1HPZB 4KBIA 4NCGA 5J2PB 5AXKA 4C0HA 4WE1B 3QSIA 5IT0A 4RW8B 4HKZE 1CBKA 1Z2MA 2M4MA 2PMWA 1UAWA 2F40A 3CUNA 4US8A 3ZTPA 2L1AA 5LSOA 1HLWA 3AEAB 1L3VA 2RKIB 3NOCA 4K59A 2DGQA 3HX9A 1VRTB 5ETVA 2DJWA 4Q8EA 8RUCA 1X0FA 4C8KA 2OPPA 5HATA 1KBRA 3VR9B 4CQ1A 3PZPA 2P2CB 5AUKA 4X4QA 3IRXB 1H7XA 3P4SB 2D2QA 5BR8J 4ED0A 4JE3B 1U45A 3W8PA 3GFHA 2D7SA 2OIHA 1W7WA 4G6VB 2JC1A 1X4HA 3TVZA 5I4MA 3SQOP 1RQ0A 2YLMA 2KX3A 5D4NA 2CJNA 3CDWA 2X1FA 4X2BA 4ZJQA 3QRPA 1IKVA 4RW7A 4B9VA 2C2MB 3BJYA 1Q8LA 2WBRA 2BE9B 2NBWB 3KJQB 2PE8A 1DBDA 1TS2A 4I6PA 5C42A 4HYKA 4P75A 2J0MA 2VFRA 2UUCF 2MY8A 2X1AA 2DPIA 3MFGA 2FUHB 3BVZA 3BYYB 5C2GA 1HZ5A 2KTRB 2QLXA 4USTA 4LRCA 4BDPA 1R4NB 1I5OB 2V8PA 2Y0SD 4P2SA 1JMLA 4YTNB 3NGDA 1YJ1A 2W4DA 3ABVB 3MEEB 1E6VA 4J9SA 5LT5A 3P45B 3VRAB 2HS0A 4LFBJ 4ZVHA 5IO9A 2PT0A 2PEBA 1XD3B 1VLOA 2RD0A 2EKNA 2FCSA 4M5JA 3H9DA 4ZVRB 2WQYB 2CJOA 2ATCB 2HHSA 2HKEA 3NCQA 7FD1A 1C1CA 3W65A 2EFPA 2LKZA 3K5LA 3F56A 2M19A 4I0WA 4IUFA 1QTNB 1YK9A 3OD2A 3FCHA 2ON8A 3Q69A 4NLVA 2GMLA 4KHPF 4UY8T 1NK4A 1O0PA 3L3CA 2VUGA 1N52B 2MZQA 1JCKB 2AEHA 4MSQB 3A8KA 2L9NA 1S1XA 1VZ7A 4UDUC 4WZQA 1HA5A 1MMDA 3KKFA 3EXCX 1AW0A 4G65A 2BABA 3K58A 1MW7A 3I56S 4B9LA 4KGRA 2CHZA 3ZDMC 2W3RA 5CCLA 3R2TA 2DXFA 4KGZB 1TAQA 4G0NB 3K17A 1XNRF 3UINB 4CT9A 1FTCA 4HKQA 5IOLA 4X4PA 5KFMA 1W26A 1GNUA 2JZZA 4NZLB 5IAAC 1ZW7A 3L0WB 3CVKA 4HL9A 1LGRA 2HVZA 4ZYSA 3P3DA 1L7YA 2LMIA 2V69A 1HXYD 2NLWA 1UFKA 3I9ZA 1D8YA 2MJ3A 1ROEA 3QATA 3AJDA 3AQOA 2QC3A 1L3UA 1HQRD 2AWZA 2XWXA 2KDIA 3OSPA 3SQGA 3A8IA 3TARA 1IKVB 1JXVA 2W3SA 4RW7B 4YSYB 1GTHA 1FX4A 3ILLA 5F8IA 2ZKUA 1WHVA 3QAEA 5C42B 5KT3A 2HBYB 4NMXA 2XN9C 2D1CA 2NXJA 1CJUA 4TY8A 4DR1J 1NSKL 1N56A 2DEJA 1RXOB 1I4GA 5GAEI 3PCOB 2YH0A 2V4RA 3T3OA 5HVGA 1WZ3A 3DN9A 3GIIA 4YY3F 1Y10A 2XZWA 3JXOA 2R4FA 1VDHA 1E6VB 1L3KA 1SSNA 4N8OA 4BBYA 5E0OA 2IDLA 4FHJA 3B2FA 4ZRIA 4L2YA 2DZKA 2R8JA 4DXGA 3MMJA 2DHXA 4LFCJ 1BLUA 2MLBA 2SAKA 4P52A 1TBEA 4LFAF 3PVXA 1C1CB 4CH1A 5C23A 4HJGE 5IC6B 3HK2A 5A0YA 3WIMA 4MFBA 3U1MA 1KFDA 4NRUA 2C22A 3RBZA 4DS4A 1VC6A 3Q8FA 5IFMA 3DGPB 4RO0A 1WDDA 4EUVA 2LXCA 3PYDA 1LQ9A 4Y6IA 1S1XB 2L0TA 2LZ6A 2ZNVB 4LNNA 3QA8A 1JLAA 3N6LA 2FCMA 4RFBA 1FESA 3DCGA 5J1NA 3PIPQ 2CKWA 1EF5A 1TZ0A 1KTKA 2CPZA 4GDKA 2ZNVC 1SJHD 3ML8A 2HHHF 2N0SB 3MR7A 5HJYA 1D5XC 3TIXA 1N32F 3Q2TC 2CPYA 1F2HA 4X62J 1MLAA 3U1NA 5T41A 2ZUAA 3ILJA 5ETQA 2DISA 4DSJA 3G82A 3WIUA 3SQGB 2RSQA 4PWUA 4ZPCA 4NI2A 1U1QA 1F2RI 4TKNA 4Q7AA 5EUHA 1KJTA 4OYIA 3E51A 4K3CA 3BQ1A 2OTLS 4NA2A 1X7VA 2R2OA 2VD3A 3P5BP 3CEDA 1HA1A 3P96A 2FNJB 2L08A 1CLFA 3D0HE 4RL1A 3KHRA 1WG5A 3WIVA 1QSSA 3K9PB 1EKRA 1D5ZC 4CM0A 2KDEB 3WALA 5KFYA 3HHKA 3FSIA 1U6ZA 2FHJD 3RCZA 4JI7F 4AL7A 2H9ZA 1S0MA 4IH5A 3CCRS 3QC8B 3N6MA 3C19A 1UKUA 1NKEA 2LGXA 3CF5Q 3RW7A 4N77A 1TTNA 4TLRA 3VF0B 4DV5F 5A0YB 4MFBB 2DAFA 3DM2A 2VIHA 1RDRA 2G1EA 2HS3A 1MMNA 2Z8QA 1S72S 5EE3A 2PSZA 2F4VF 3TJ8A 1P9DU 4J90A 3LB8C 2V2ZA 3QJPA 3PLUA 3NWGA 4ENOA 5H9EJ 2O2VA 2NBVB 1JLAB 2FGCA 2W8KA 2OMOA 1NPKA 1S5ZA 2DGOA 4HTJA 3V6DA 3W61A 3WX4A 1M0SA 2V4QA 4GDKB 1R6VA 3FBEA 1CJTA 2VPWB 1KEKA 2ZHBA 4JI5J 2KFJA 2R42A 4KHRA 4OL8A 2J0XA 4PPZA 1KQFB 4RUBA 2JVRA 1L0YB 1QDUB 3NBPA 5DDQC 3T8MA 1P7EA 2YVSA 2Q79A 1I94J 5FR3A 3APCA 3W1YC 3BZQA 3D6HB 1RLCL 1L2NA 2Q5WD 1L5UA 1WSPA 5BYRA 2BW2A 2JRIB 2J53A 2DX5B 3G82B 5KFWA 2XQCA 2CQIA 4CI0B 1RWXB 4NI2B 2OJRA 2V9KA 1YJUA 3CWJA 1FXAA 3J7Z5 2FJWA 1SH3A 5EWFA 3LAKA 4ZVPB 3DHXA 1S49A 2L3MA 1ELOA 4KGTA 3GIJA 3AE3B 3DXBA 4QBUA 4ILRA 2IRXA 3I82A 4YSZB 4I67A 2MSSA 5ITHA 3KLHA 3R2DJ 4HT7A 1I4XA 5JVGQ 4XPCA 2H4WB 3N1XC 4FNHA 1UVNA 1PYOB 3RB6A 3ENVA 1SVDA 3KH0A 4J9QA 3MC0B 1EF1A 3KYDD 1MWQA 2KDFB 4ZVOB 2WXHA 3DRXA 1S3SG 2EMTA 3A8EA 3CCUS 5LSRA 2CFXA 2YBVA 4K4UA 4B3TJ 1AZSA 4DI6A 4O44A 1CJVB 2ZH9A 3DM2B 1WC4A 3HKWA 1S97A 2WVBA 2WSEC 4MMOA 3EGVA 3E3XA 2HQIA 1DFDA 2HFZA 4PUOA 4CO0A 2CWXA 4EYHB 1EQMA 1GNKA 3ZIMA 1TGZB 4MKYA 2BQRA 3M8QA 1Q7YT 3QGHA 5IM0B 2QTWA 2L32A 4XE0A 2NS1B 3EVMA 4MIWA 2ZH6A 4YEAA 3DHWC 4OJGA 3JYTA 4MK8A 1M4VA 1SC6A 3V6DB 3QBCA 3E2EA 3TP2A 3I0SB 5HFYA 4F4XA 3IA0A 4MM3A 1TL7A 1X60A 1S10A 2UUAJ 1GT8A 1UFLA 2MKCA 2VQEJ 5DM6Q 3OL6A 2GBJA 2VICA 3ETOA 2VOOA 2K2PA 3NBPB 2KRRA 4ILLA 3D0GE 2V5HG 1QTMA 2GBRA 1O5JA 2Y5PA 3GG0A 4KKOA 5LJ3Y 3CJTA 5E6OA 4YUDA 3D1HA 4IM2A 5CABA 1NK9A 2V3SA 1JB0C 2C7HA 2J6TA 3RAMA 1YX2A 2OFGX 1JQ4A 1GG3A 1AB8A 1TK0A 2RQKA 4F3OA 4U8YA 1H2VZ 4UQTA 2OD6A 1D9FA 4RW6B 1HNZJ 3H59A 4JYAF 1U6FA 4DHZB 1SV5B 2DYAA 2R7OA 4EBDA 1C0TB 2IVFB 1U1NA 2KN5A 3LWLA 4BKTA 2N4FA 4ZLJA 3KLHB 3R7BB 3BS9A 3L95X 4QU7A 4KSLC 3ZZRA 1XMQJ 4NQKE 3G9CA 4GKJF 5F3ZA 1J5OA 2IGHA 5BMIA 2V3NA 2I5JA 1OWXA 1DARA 2WXPA 2YKOA 2EBGA 3RULA 1U2RA 5F8NA 3MHSD 4B3MJ 1BXNA 2X3DA 2W54A 1ZXIA 4DOZA 1NSPA 2NYIA 2DYOA 1AZSB 1WXSA 4O44B 3J80U 3V4IA 1ZXHA 3ZGZA 1VQ9S 2IO2B 4IOIE 2C28A 2MQPA 3IVFA 1FFVA 3L10B 1UL3A 1D0EA 4PUOB 3IP0A 4U6PA 3K2YA 5FDLB 3V81B 2R7VA 1ZM4A 5IT4A 4TY9A 3M8QB 3QIJA 2N82B 1VQLS 4JV1A 6FD1A 1FNVA 4DV0J 3M4XA 4NLGA 1T03A 5M2UA 3OJ4B 3JYTB 3T5HA 5EDWA 3DBHB 3HHLB 3AXMA 1HYSA 4DPWA 2VBYA 1CS4A 4MM3B 2BYCA 1TL7B 3JAMU 3VGSA 1ITPA 3MAHA 3BYPA 2RE1A 1LXDA 3TEZA 2W1BA 4FN2A 4Q0BA 1WG4A 4DHJB 1NVID 2F8MA 3GJTB 2H3EB 8AT1B 4NOHA 1HQ2A 1K44A 1U09A 2AJQA 1RAXA 4DHJD 2WVFA 4KKOB 3CJ5A 1GXLA 1SQEA 2IRUA 1N60A 1PJ5A 5DCNA 1XWLA 1PIEA 5D77A 5KT2A 3VVWB 4P2XA 4DR6J 2GMJA 1SQGA 1YQBA 2QZ8A 1HR0F 1BWVA 4BZAA 2HBZB 4FS2A 5KG5A 2VDHA 3THPA 3MEGA 1AWDA 4WP9A 2R7XA 2J9DA 3CD5A 5LNK1 2MZTA 4HLBA 3UD3P 2Q66A 4FF3A 2AL3A 3IBEA 4RX6A 1NHKL 4EEYA 1XMOF 1SJ4P 1V9JA 2EMSA 5E3PA 4OLPA 2B8QA 3OLBA 4B3OA 3VCDA 3FEZA 2KHDA 3EX7B 3C15A 1HE8A 4PXCA 1ZKHA 2I5JB 5D4PA 1PO6A 2QL7B 3KOAA 1Y7PA 1VJKA 2ASQA 2YEPB 2MHEA 4LBHA 2YX1A 3P4RB 1RHUB 2D07B 2AEFA 3KJFB 1HQEA 3TAQA 1D3WA 2CNLB 1G4CA 1YNTE 2AZ1A 2VZKD 4WPAA 1K1SA 3V4IB 3H20A 4JB8B 4PXEA 4B08A 2LQ8A 5CHWA 5B0CA 2UXDF 2FZGB 3D6FB 1N36J 3SDEA 4F67A 4BWMA 2F63A 4RH6A 4KH1B 4LBPA 4DV2J 4RWWA 2QIEB 5IZHA 2R3VA 3UDLA 1T03B 4EUTA 4GMKA 1XTZA 2LU2A 1GMWD 1U49A 2OEMA 1MN9A 1HYSB 2GO8A 1SE3A 2XGPA 2LEKA 1IPGA 3L4PA 3BSCA 1KOHA 1D3ZA 4Q0BB 1KC8T 2QA1A 3TANA 1RE1B 2DR8A 4EFOA 1JJ2R 1S6OA 3PVLA 3LTOA 3IC1A 2FHOB 4E2FB 4ITKA 2IRYA 1E5WA 4C56C 5HMZA 1OYDA 1T6BX 1WIAA 5GAHI 2I0XA 4DV1F 2K1FA 2MBBB 3IGVA 4K4XA 3NOGA 5FKAC 4OHWA 1WZ0A 3ISZA 3PYGA 1KONA 4USAA 5E33A 3GR0A 2QA2A 1T9XA 3KLIA 3MURP 3H25A 5H92C 4K7SA 1X9WA 1LWEA 5J1EA 4KGKA 1HTOA 5HANA 3TUIC 2C3UA 3ZLZA 3VTUA 5M2RA 4IDKA 2NXNA 4LF8F 3DNCA 2L41A 2I6WA 3LOUA 2DCLA 2ROPA 2MX2A 4MELA 3MEGB 3D6MB 2C2NA 1PYWD 4KT0C 1URNA 2ATLA 3M2UA 4NE9C 1W2IA 4TU8A 2C9WB 3BN4A 3DHHC 1RTIB 1FNMA 4LSLB 3SFDB 2EFNA 4B3OB 4ANUA 2RH3A 3IR7B 4WCEQ 3LAMA 1S6UA 3C15B 5D0RA 1T9VA 5RUBA 3AOBA 2JFKA 2DBYA 1JK9B 2LMCA 4M5KA 3BK2A 1C4AA 4WU3A 4DL5A 3JSVA 1U1MA 1FDNA 4OYZA 1RT7A 2HFNA 2MQNA 2MXYA 3FFIA 3W5UB 1HQEB 4TQ0A 3PW2A 1TQLA 2QMUB 3MD1A 2HVEA 2BRKA 1QSLA 1XEZA 4IOCQ 2KDOA 1CG2A 2HDEA 2D69A 4NXMF 2N9XA 2G2OA 1B0PA 2YNIA 3CCQS 1PGZA 3SDEB 2VBZA 5A6WA 4QJVA 4IC7B 4KJIA 2NPFA 3V6KA 2V6AA 3SIPB 3LH2S 1VYAA 3BM7A 2RDJA 3RNAC 2GVDA 1R7IA 1NPPA 4OV1A 2ZVNA 4A8SA 4DV4F 1EUVB 1T94A 3SZ2A 2WXOA 4YXDB 2JEJA 4YTMB 3DLHA 5K20B 1OFFA 4ZPDA 2ZH5A 1HARA 3R27A 2XBBC 2EKIA 4EO6A 3MFHA 4QYZJ 1XC9A 2DXEA 3KQ4A 4LDTB 2ZH4A 1NZAA 3IM9A 3HP6A 1LWCA 3OVSA 3SEBA 4S0MA 1CSJA 3GIMA 4EYIB 2PW9A 1MWZA 1FD8A 2ZJDA 3RUIB 5LJ5Y 5FR6A 5K8NA 2JLGA 3PX6A 2IJ0A 1KWMA 3Q86A 4GDLA 1U48A 5KFXA 3CMES 2IAJB 1UUPA 2K3UA 5HLFA 3DMJA 2N7YA 2J7UA 5IV4A 5J1EB 5J2MA 1PKUA 1MROA 1RHMB 4AJWA 4IDKB 2ZOMA 4XK8C 3IG3A 2UVWA 3UO0A 4AL6A 3ZNHB 2BS2B 2UVVA 2Q43A 2WXMA 2KVRA 3M2UB 2ZOFA 1HIYA 1X5TA 1NK0A 2CQ1A 2VH1A 2IYIA 3CDBA 3TA1A 1JWSD 2N1WA 1HKAA 4X65F 2H5EA 3APDA 1QD1A 2J52A 4ZP8A 4MYUA 5KT4A 3G4SS 4NA1A 4ECSA 1Q79A 4KPCA 2XO7A 1HNWJ 1TV6A 4KPYA 2F1FA 2YKMA 1TKTB 1PQSA 3HVTA 2LA6A 3R5AA 2DZJA 1WE6A 1RT7B 2QHOA 2BB5A 5DQHA 2HNYA 5L9NA 4MGYE 1JX4A 3DFEA 5DLFA 4P74A 1VQYA 4ECYA 2L3ZA 3PO5A 2GAGC 1A6LA 2I1JA 4USUA 3PZ8A 4F50A 1YN4A 2RILA 3OTBA 1D5MC 4CYUA 2M3DA 4RNNA 1KRPA 4W9GA 2YNIB 4IRCA 2PIAA 4J9LA 2PFDA 1R8CA 3H5SA 3EC8A 1X4AA 4AXIA 1FX2A 4IFVB 4B9TA 4RGMA 4YMEA 5DG9A 2EK6A 3R7RA 2HRUA 3PRMB 2DGUA 3Q0AA 2OHDA 1FVSA 2PMZD 2HHXA 2O1PA 1UBQA 2WB1D 2PDAA 2CJYB 2Z30B 3CJ4A 2FCQA 5FLXY 1OPIA 1H8CA 4ZVUB 1ENFA 2D3ZA 2KMMA 1V8CA 2Y0BB 1Q8BA 5B0GA 5E41A 3LP2A 2DNNA 4ZRQA 4HPLB 4J91A 2MB0B 3HHMA 1KLMB 1RAOA 2H51B 3GONA 1TKEA 2IIHA 2KH9A 4EK2A 1NDDA 2E7WA 3ZXVA 3QJZA 2QT7A 4PKDB 4K5SA 4ANXA 1TY0A 2BQUA 4XZ4A 5KFHA 4WJQA 3K59A 5L38A 3WAMA 1SKSA 2XS5A 4GDLB 1S1TA 3DMJB 5ETPA 1NDKA 5J2MB 4ELVA 1MROB 4RW4A 1QF6A 4DV7F 4CLPA 2KJRA 4OFZA 5B0FA 4OZ2A 1FXLA 4S0RA 3TZYA 3PGEA 2AYGA 1UVIA 3TWZA 2JYTA 2DIUA 3M1VA 5K5MA 2DTJA 2DNRA 2CIMA 5BR8F 1UVLA 4C7YA 3Q22A 1UJ4A 2AKWB 1LV5A 2A1BA 1Y4ZB 2WVDA 2YKMB 2JY6A 3ONSA 3T1HJ 2WVEA 1ESFA 2HK3A 5JVHQ 3CMAS 4J9KA 2AYOB 2QA4G 1VGYA 2HNYB 2BOAA 5D3GA 4EBEA 3PTFC 1HI0P 1TS3A 4NYPA 2VBWA 3PJ9A 2UWQA 1UWMA 4IFYA 3KLEA 2GV1A 1NMEB 4DFKA 2ZFHA 1RT2A 1QE1A 3N4WA 4DEZA 1XF5L 3BBCA 4C3MA 4CYUB 2KDBA 1Y5IB 4DQSA 3V6HA 3CJ8A 1L3SA 4W9LA 2YX4A 2M0XA 3D4JA 4NPNA 2QLWA 4L74A 4YHHJ 1TL4A 2KWVB 2MWSB 2LU1A 2MSTA 1H7WA 2DNOA 1Y56A 1S0NA 2G9HD 1AROP 2M0AA 4HROA 1YIWA 4MIAA 6FDRA 3SCLE 2HQ3A 4NLXA 1N0UA 2DLBA 4WFAQ 2N9LA 2ACZB 2RU3A 1FVQA 4FVCA 1BY9A 3ZTCA 2V2VA 2DCUB 3R8BA 4W9FA 4JWUC 2IFXA 3PRVA 4MTPA 1QUPA 4LRAA 3FMBA 2WXFA 2HZAA 5JXVA 1WACA 3KUEA 1DTTA 2B3AA 6AT1B 1FK9A 4PYUA 5K14B 3GFZA 2AJ2A 3I0RB 1T02A 1XR7A 2CNOB 2LD9A 1S1TB 1NK5A 1GOZA 1UH6A 2VL1A 3CIZA 1JWBD 4RW4B 2IYDB 1M5OC 4LF6J 2JH3A 1T9YA 3N32A 3DLEA 4MACA 5AE3A 3G6ES 1G1XA 1V97A 4JBCA 4HLEA 3DHGC 4FXWA 1FO4A 3M1VB 5IOIA 3CULA 5TR5A 3NP5A 2UUCJ 3Q23A 2FUG1 4URSA 1ZZNA 4QZVB 4I4BA 3BO4A 3KK3B 4K2XA 2Z0DB 3NS1A 4YB5A 4EOYA 2BWFA 3GJQB 1N5VA 2BF8B 2PVOD 5HMWA 1AT1B 3KK1A 3N28A 3NVVA 2P6TA 3V62A 3CF6E 1TVRA 2AP6A 1JJHA 4X4TA 4IFYB 1WJUA 3KLEB 4MK7A 2J8SA 3IO1A 1RT2B 2ZM6F 1QE1B 1P1AA 1VK3A 3PYFA 2XYHB 1RFKA 3TJAA 3D7SB 3THVA 3X1LB 3UPFA 1W25A 3KHLA 1RYRA 3OHAA 1FJ7A 2IO0B 2QL5B 5HL7Q 3LXFA 4KHPJ 1F2GA 1JNRB 1PBAA 5A8RB 2Q6CA 2GIQA 4ASWC 2MKJA 2M88A 4OMFG 3VR8B 3N0VA 3TR5A 3RNFC 4CHKA 3HK0A 2Q3PA 5LXRA 1UF0A 3QZ7A 1MHHE 1U2CA 2WXQA 4J37A 1RHJB 2VG5A 4OZJA 3ZJUA 2ONQA 1WX8A 1NKBA 4CM2A 1XNRJ 2DNMA 1PGBA 2R7QA 2FJDB 1DTTB 3MUMP 2DNGA 4KIAA 3BGFA 1FK9B 3L09A 1KS2A 3A8JA 2J42A 3KMSA 4ECXA 2KT7A 5LSLA 1DQ8A 4X4NA 3W2DA 2RRBA 1RU1A 3Q8EA 5TSSA 4L3KA 1HMVA 4BKGA 2GMHA 5DO2A 1M5VC 3DLEB 1WM3A 4BFRA 2KQ7A 4XC2A 4PG6A 1UP1A 2LJIA 2Z59B 4P2FA 4C4VA 3J81j 3FRZA 4CLLA 4ES1A 4Q43A 5MPOA 2IC3A 1NENB 2DH7A 3CJKA 1RADB 2PE9A 4QR1A 1J7CA 3Q2SC 4X62F 1EQ0A 2BACA 2PI4A 5KT5A 4URQU 1Y5NB 3AE9B 2GFFA 2YWWA 1PAUB 1Z5SB 3PO4A 4YY3J 4ZK7M 4I64A 5GMDA 1RCXB 4GMVA 3BYTB 2R9LA 4ED6A 4W9IA 5GXGB 1TVRB 1KTVA 2YQ3A 2L05A 3R5CA 1U1RA 2BV3A 3NLCA 4I69A 1V1PA 5EWGA 2LFVA 1AYEA 4MDKE 2LRUA 3PLVA 1DQ9A 3DVGX 5BYSA 3R1LA 3ENAA 3RNCC 3ZZYA 4M5DA 3V4MA 1FT8A 3ZZOA 1YBUA 1YDLA 3QWPA 2MEWA 4U8VA 2INCC 5KHOA 2KWDA 1HW9A 3H7HB 2WX0A 4DDGD 3W1SA 3NAHA 4C8OA 3L7UA 4IH6A 4G11A 2EG2A 4P1BC 5KFZA 3CB4A 1RAIB 2ZW0A 3SR6A 3AI5A 2WXIA 4ZDVA 1G2EA 4DBGA 3FBBA 3KVFB 4JI4F 4EMDA 1CULA 3MMAA 4MJSA 1WX7A 4OZ5A 1K1QA 3A4RA 3S7RA 1J19A 3QJLA 2HHHJ 3QFWA 1GTEA 4USHA 2LQ5A 1HQUA 1FKAF 3WX8A 2ZH2A 1ZPVA 2WXLA 1WKLA 1MPEA 4IW0A 2VDIA 3SYZA 2EI5A 2RDDA 1IGDA 1HMVB 1JMTA 1KQSR 4TQRA 1WEYA 1RWSA 2OEJA 2JXXA 2AJ1A 4C4VB 3PV1A 4WZMA 1XBWA 1A9NB 3LPYA 3M8PA 3NRBA 1NK6A 1QLNA 4QQBA 3B9JA 4G1QA 3VXWA 3UCZP 2DGWA 2IC3B 1OTRB 3L13A 3NY5A 1I94F 2E1CA 5IWAJ 3U7ZA 3BGOP 2MDAA 2RHSB 5E3RA 3Q8AA 3I9V1 4KC5A 1IBLF 2OPQA 1NI2A 3M9OB 4R3DA 4KIKB 4ECRA 4BS2A 3LO3A 1IN0A 2KD0A 3MTNB 4OYOA 4JI7J 4TMAB 5IKCM 2BM1A 3EA6A 5D7GA 3RBXA 4F04B 1N5QA 4ED2A 1WKJA 5DG7A 2LP4A 1V1PB 3D1QA 3MJ5A 3W62A 3OJSA 2ZVSA 1CEZA 2OH2A 4KSKC 1HL6A 4RM8A 3EPIA 1O8BA 4F4AA 3TYTA 3IGNA 4M5DB 1VZ8A 1FI4A 1Z2ZA 1ZPWX 1OJ4A 2B5JB 4WWNA 1XQQA 2ZHAA 2ASJA 2O66A 4DSIA 2H89B 1MWYA 3QIPB 4BHQA 5HQMA 1XK8A 1HNXJ 3ZNID 4DR4F 2F4VJ 1UPPA 4J7CA 2XEWA 4ZHRB 3EXYA 2MMYA 4LREA 1NB2A 2CWKA 4JI0F 1Y8RC 1YG0A 1HBOA 3OXGA 4LQ9A 2UP1A 3MM8A 2MP2A 3BO2A 3H5YA 4DUTA 1KNZA 5E6JA 2GNKA 2DB1A 4FKYA 4M01A 1GFWB 2WXGA 1CULB 4B9KA 3MMAB 1OQRA 4MJSB 3WCQA 3M30A 2KMCA 2IGDA 3VQIA 3U4EG 4OZ1A 1H0HB 2LVOA 3CDEA 2K7KA 2V2QA 2NYHA 3OFHA 3TUJC 1CC8A 4FYWB 3RD2A 2DD8S 4X4VA 4UOCA 4MAKA 2ZJQQ 2ZEJA 2GJ2A 1UETA 4RJVA 1N5TA 4DV6J 3LP1A 4K7WA 2MGZA 4PYZA 3Q8QB 3JSRA 5GMEA 5ETLA 3MHZA 2UUAF 2IDYA 1QVGR 1VDVA 3VALA 4A3OA 4NEZA 2E1PA 3L7OA 5GMVA 2W2NP 1VC0A 2F5GA 4G1QB 2CQHA 3DLGA 4WF9Q 2E9ZA 4NX9A 2YPYA 2MJEA 4ZN3A 2M0GB 3VAIA 1M90T 3IG1A 2JX2A 4HHJA 4NLPA 1WEZA 4A8XA 2OPQB 3GQCA 3B6BA 3P4QB 1T95A 2HRTA 1JXEA 3IR6B 3A33B 2J0QD 3TQ1A 4UY85 1WEXA 4IR1A 4XWTA 1KFSA 2GQ2A 4X64F 4DR2F 2NR2A 2YWEA 1WGGA 1QKZA 2HBQB 2HLUA 3HHDA 4CDIA 2DR9A 5J18A 1OQQA 2C1EB 5I3UA 2CG8A 1DOYA 4ID8A 5L83A 2YEPF 5DDPC 3SV3A 3ILIA 5KG6A 4P7VA 1H38A 3BGUA 4RUCA 3WAPA 2RQMA 3CD0A 2JYEA 2KM8C 5H1SV 4GO5X 1RU2A 3HD2A 4DG1A 3DWGC 1VQNS 2YKNA 1XMQF 1QILA 3AT1B 4KGSA 2DGSA 2E66A 4PS3A 1UJ5A 3D3CJ 2G4DB 4WXWA 1M5PC 3IRWP 2NVUI 1IBCB 2XHWA 3TZXA 3LF0A 3J81Y 2RDHA 3V3XA 2HNDA 3MM8B 2MP2B 3NRZA 2MBQA 2YPZA 2L00B 4ZHOA 4NZ6A 2ROEA 2B43A 3PS6A 2QMXA 1GB4A 1BHNA 3T1YF 2ZHOA 5HKHA 1CMXB 4DR7J 1R31A 3KHHA 3M30B 1NDPA 1WHYA 2F9JA 3W9JA 3Q8VA 3VAHA 3U2SC 2EWHA 2QSWA 5MLCV 3IN5A 1J7BA 2V4LA 3ZNGC 1E8XA 3RBDA 4K0KF 1R4MB 1RGVA 3ENWA 4ALZA 4ANDA 4ETXA 3C3LA 4O3QA 2A3JA 4CLFA 3B4MA 3LP1B 4C97A 3A3PB 2MGZB 2O5DA 1TL5A 1BE4A 1YX5B 3UNYA 4QPTA 1VRUA 4I7FB 1SGHA 4HI1A 2J7WA 3L17A 4EBCA 4P9SA 3WZ0A 3PPAA 3R5DA 1REVB 4WFZA 2VFTA 1SL1A 1K51A 5J2NA 2VZ9A 1ZDXA 3RGIA 4JIOU 3MCMA 4F25A 1WF1A 4JYAJ 1UFWA 1ZS6A 4I6WA 5A6PA 3PACA 1H73A 3DVNV 4PYDA 2D3CA 3ZDTA 5HQ8A 3W5XA 1XCTL 4PWDA 2QLJB 1NRKA 2GW8A 2W55A 4R25A 5B7WA 4BVUC 2JDJA 5KFBA 3OAWA 3G8QA 3UD5A 5LM7E 4K81A 2XS7A 2MBHA 2GQCA 4GKJJ 1NXIA 2HNZA 3EFUA 1XCQL 3SFEB 4OX9J 2G4BA 1RAHB 2V2KA 3ZXRA 1YMHE 4LJPB 4M5HA 1TMMA 1VRQC 4DX8H 1J5EF 5DGAA 2OHFA 2B9YA 4OZ3A 3E8OA 2VH2A 4KGVB 5I3UB 3K5PA 1TK5A 3K5NA 4OX6A 4IOBA 1X0PA 3H40A 4HTIA 1YJ7A 3FUYA 2XMWA 2D11A 4LF7F 4NLOA 1DZ5A 3U7JA 1RM6C 1BQXA 4DG1B 3IBWA 2JFDA 1SJ1A 1YJWS 2YKNB 3KTQA 2EG1A 3AV8A 4N59A 3NMRA 1A0OB 1V5TA 2MJNA 2KT3A 1LW0A 2RUSA 4RBUA 4KR0B 3NWRA 2GLSA 2W9CA 3E9SA 1T05A 2D3GA 2RDGA 1U26A 2VODA 5T14A 2M2BA 2N7DA 2RJZA 2W24A 3IMQJ 2FIFA 2L9WA 2L7RA 1GXTA 3MHYA 1NHVA 2IM3A 5G5HA 5CHCB 4QWBA 3NXZA 4W9CA 3QGGA 2E1RA 4A3PA 2JXTA 3QT6A 4RF0A 1G7CB 3TSSA 2RR9A 1RT5A 4MJKA 5D6GA 3M6XA 3UI3A 4ZLPA 4KV2A 4QR2A 2MLZA 3PV8A 1DQAA 1RKJA 1R0AA 1N6QB 4DV2F 4DU8A 1GAQB 3KYLA 5I4DA 3CDUA 3RJMB 4DL2A 4WWMA 4YDXA 1BQNA 4A8YA 3HHNB 4K3BA 2WAQD 3OLAA 3M3JA 2RT3A 1WSRA 2Y3AA 5J2NB 3VR1A 3V6JA 4G3XB 4DK5A 4DV3J 1S9GB 4MK9A 3N1ZC 2LJ5A 1JLGA 3KLSX 3N01A 1TUGB 1XMOJ 2AD9A 1X5OA 2BM0A 3MOZA 1HHQA 4NXNF 3LP0A 3TW0A 1CVJA 2CA9A 1TY2A 3KHGA 3ZJTA 1RISA 4IG0A 1E0ZA 1R3NA 1ULRA 1VZ6A 1CQNA 2R7TA 2C42A 3G96A 3P5TL 3R2IA 3H4DA 3W5ZA 1ZA1B 1WC1A 4NLUA 5D2MB 3UVJB 1EAYC 4E74A 2WOMB 2UUTA 2IPKD 5KG3A 2Y1JA 4B6WA 1H74A 1UGMA 5KFCA 4BBNF 4ZVQB 4CQNA 2C7MB 2DHHA 3PW7A 2KG0A 2AYBA 1NEKB 4CLYA 3HXMA 3NVYA 2R8IA 4ZOHC 5D15A 1UWBA 4ED3A 3JSBA 1V2YA 4J9VA 1WUUA 1SEBD 1PGXA 3W2VA 2UXDJ 3N5FA 3ZTSA 1NKCA 1FHTA 2H1YA 3MGJA 1LW0B 4K4YA 5G55A 2N3LA 1UW4A 3VFKA 3B4DA 1R43A 1KRHA 2B9XA 3CCSS 1N4LA 1U47A 2XHCA 2W2MP 3JSMA 1MG4A 2K9XA 4W90B 4HCPB 2OELA 4V1Ak 3M6UA 2AWTA 2X1BA 1OQ6A 4DQRA 3D0IE 1BUIC 2K06A 3CC7S 2R2TA 2KK8A 4JP8A 1RYSA 3DBRB 4WWOA 1RT5B 1MG7A 1IWGA 2K7JA 3P4UB 1IJEB 5KFEA 4C48A 3KJVA 1R0AB 2N9EB 1FRIA 3SSQA 1XLOA 2FJEB 1F9EB 2IA6A 4YB6A 2VG6A 2KG1A 1F5BA 3DGVA 2NPTA 4P10A 3VHTC 1V86A 2ZWPA 1RBOB 1YBTA 2AIRB 1PSDA 4LF8J 4OW0A 1EWCA 4ECZA 3GSDA 4PQUA 2XWYA 3CGIA 1SIZA 3QARA 4EZ6A 1WR6E 3MAAA 4OZLA 2BJ1A 1V49A 4FPIA 1ROFA 2JVOA 2G9OA 3LP0B 2J8AA 1FRJA 3NS8A 3C16B 2R2RA 3OVAA 4JV0A 3VAGA 3BR8A 3OJUA 2QYGA 1TKGA 5E5NA 4K4WA 2FZCB 3GPAA 2CR5A 3K5MA 2HGLA 3I57A 1WC5A 1VC5A 4BAXA 1KD1T 4DL7A 4PS8A 2B4VA 3X0WA 2XNQA 2BQQA 2LDYA 3K57A 5C2CA 4NQLB 2IO1B 2DGVA 2AEMA 2JWUA 3N20C 2AZ3A 3W7BA 1FRLA 5IC4B 2K25A 3KWVA 3A3NB 3HIZA 4ANCA 2BGFA 1FRHA 2JVCA 1UWBB 4NXMJ 1HNWF 3VAJA 2PJHA 3W2VB 1JQGA 2RIJA 4H4KA 2J0JA 4GRSA 4WFNQ 1Y11A 5HO4A 2E5IA 3PYEA 4RZRA 2KL8A 1SC4B 4JGHB 1WXVA 3SCJE 4CIOA 3EFCA 1RRBA 3H42A 1FEHA 2KJVA 4OI2A 5E3CA 2JEGA 3KG1A 2OKQA 3GS2A 1B0TA 3FDSA 1C78A 3TEHB 4HR2A 4AQYF 3Q3NC 1NJZA 1ACCA 1X4BA 3BYRA 1YN3A 1K73T 3HVWA 1WELA 3CJSA 3KJVB 3PXGa 4CLKA 2HIQA 1R4MI 3QHTA 4GC6A 1PFDA 4CTAB 3RUBL 2L48A 3ITHA 3AHPA 4Y65A 1VJWA 2VG6B 3BR9A 2ACYA 4WE1A 3OT9A 5B0BA 3NZSA 5AUIA 4Y34A 4RW8A 4A8OA 3Q8PB 2CUYA 2IM0A 4MSMB 2BT6A 2JZ5A 1VQ6S 4P2MA 2Y1LB 2XSFA 2BBCA 2R8KA 1ACMB 3GSIA 1TFWA 2K5PA 4OI4A 3IFEA 4NJ7A 2J7QB 4CCHA 4Y2MA 2E6XA 3O2IA 3IRXA 2BMBA 1LK7A 2G2YA 4KV8B 2KANA 1WYWB 3ZTDA 2HZCA 3BH6B 1IQZA 1QAYA 2XMTA 5DS7A 4FJZA 2MBOA 1VQ8S 2XNRA 3AE2B 2CJBA 2ZH8A 2PLPA 3H7SA 4ED8A 3VUWA 3QWZB 4NY0A 1IBKF 3VQSA 3H2LA 4DPYA 1Q4RA 2YVCA 2R7RA 3NAIA 2PGCA 3UE2A 1ZA2B 1X4EA 3O3LA 4CO5A 2WWZA 2PPHA 3M2RB 5G4DA 4HRSA 2DNFA 1WJNA 1SIWB 3MDFA 3B1LX 3SD5A 4ZP6A 1FXRA 4NMLA 1IUEA 1UZDA 1MG8A 2VC0A 4WFBQ 4LVOP 1VQ4S 2VOPA 2DH9A 4BC9A 2ALYB 3AEGB 2FVQA 1H4RA 3AEBB 5F8JA 4L75A 1RTZA 5I42A 3IM8A 3IHPC 1RTHA 1FE4A 3AJ1A 2PMVA 3TA2A 1U6BA 4ZPVR 5B0AA 3M62B 4DL0C 2XO6A 1S7IA 1EX8A 3EZUA 5A2QY 4ZCMA 4H4KC 3MFIA 4Q2LA 3RBEA 2GHPA 1YKWA 2K1RB 4O0NA 4BCAA 3DI6A 2CQDA 2A6MA 3NNAA 1HBUB 1TT5B 4KO0A 4UUXA 3MR5A 4KKIA 3EHVA 4Q8FA 2BYTA 2NXCA 4USKA 1RT6B 3ITHB 3RAXA 3T3NA 2KZRA 3R7QA 2ILYA 3SSRA 2C2RA 1U25A 3EM1A 2GB1A 4FS1A 2KOXA 1S9EA 4DV7J 2EKEC 3GYGA 1KF6B 2P9EA 2WZ1A 4C8MA 2HVIA 2CQ0A 3KW5B 3FAHA 1HNVA 2WW8A 4GU2A 3KLFA 3QFHA 3C0RB 3I63C 2FHKA 1SE4A 3CJRA 3UN5A 4O3SA 3CPWR 3H6NA 2ZDPA 3RNGC 2CDRB 1U4AA 3VAKA 2JRHA 1TUWA 3PEHA 3C66A 3H4BA 4RGTA 1LFDA 1CJKA 1ZOYB 3MR3A 2IGGA 2AQ2B 3AE6B 1JKHA 3LGHA 4LF6F 2JOQA 1FM0D 3QLHA 5JH5C 2HGMA 4N5SA 1JLBA 1V6EA 3NNHA 1CPZA 2BE7D 1LOUA 4M00A 3V61A 2DHAA 2XLJA 2MZRA 3F0NA 4QW9A 1KKHA 3L9ZA 4PG7A 2GMIC 1WFYA 1UBIA 4C8YA 4G50A 5HROA 2AQ3B 3MPDA 2YH1A 3IXQA 1YQHA 4OZ0A 2ZH7A 1W2BR 1M1KT 1DJ0A 2BANA 1U1PA 1VCBA 1RWKB 4R0JA 3HVDA 2J6UA 3DRRA 1S12A 3E56A 4F36A 2H88B 2W2PP 1PJ7A 4A46A 4JI6F 5I42B 1ZTTA 2OEKA 2NREA 1RTHB 5EE9A 4NJ6A 4DX6A 4C8ZA 2YXLA 3B78A 4CO3A 4A8WA 1N33J 4UTGA 3VAWA 3AD7C 2JSVX 1MNEA 1IJFB 2KLGA 2SEBD 1MJDA 4ICLA 5CZVA 1BQMA 1NYQA 4MGIE 3DI6B 3AOCA 1Q0NA 2ZJRQ 3DGPA 3K7RA 1I6JA 1SI9A 4LF5F 3DLKB 4LRFA 1S6QA 1B7FA 3NCRA 4AUQC 1Q10A 4DL3A 4KO0B 4FJYA 1I4PA 1NJIT 2I38A 3A4TA 4F4ZA 2AQ4A 5CTRC 4GVLA 1WWTA 2YWGA 3FSYA 2NUUG 4H4OA 2IHR1 3I4PA 3SI8A 4V19J 3PKYA 2XC9A 1JLQA 2I8EA 5L8RC 2PMHA 4C7ZA 1S9EB 4CNYA 3DCAA 1OSDA 1GJZA 1HNVB 2C2DA 3I96A 3KLFB 3UCGA 4KGMA 3RB4A 4Y2IA 3DDNA 5J17A 2HHUA 5HI1A 1VLBA 3WQPA 4CH0S 4URKA 4OJ3A 2WSFC 3RYTA 4MKAA 2N9PC 2F65A 3QRRA 2IYGA 5H9FK 1DOIA 5T7LA 2MJUA 1KTQA 1CJKB 2VFUA 3MM5B 1SH0A 1LK5A 4PRFA 1IKXA 3HSJA 1P6TA 1JKHB 3HZEA 2A0FB 2RS8A 2N4CA 4XAKA 2VF3A 3QLHB 1M5SA 1JLBB 3PG9A 5LMNF 4ZJOA 2E7XA 4WKRA 2LVQA 4K4VA 2HFSA 4TNOA 5JXSA 5LLIA 3ZO5B 4OX7A 1RT3A 4C7QA 5KFIA 2MBEA 4I2PA 3SMZA 3LA0A 2ZM6J 2UV8A 5HROB 1Z4UA 2ZCBA 1YJVA 3GE9A 3NGTA 2Z8LA 5DPSA 3KUGA 2FVPA 1UMJA 2BANB 3OWEB 4FF2A 3DRRB 3ETMA 1WH3A 5D3IB 2XMVA 3NGKA 1HFEL 2B51A 2LYVA 3MM7A 3DKDA 3K9OB 3HRDD 1IKWB 3WDOA 1YJIA 1EJ7L 2DZMA 1RBLA 2AYMA 5IQ6A 2CU3A 2AW0A 1FKOA 3NNCA 1QOAA 4LCDE 1IXKA 3RTVA 2DBBA 4HDHA 3FNNA 4I2QB 3EDRB 4L73A 1C3TA 2DNHA 2AJ4A 3QO9B 4ICLB 4ZRJA 2FLOA 4ARIA 5KFTA 1BQMB 2W01A 4NZ7A 5HQLA 5BYQA 3M9MB 2UVRA 3CD6S 1S6QB 5DPRA 5DJBA 2MQLA 1QSYA 4QCLA 2HIYA 1UTAA 1V9OA 4ED7A 3DWMA 2XCPA 5HMXA 3RRHA 1AUSL 2FUG9 3TRGA 4NAWA 4H4OB 3V60A 2NZ4A 1C79A 2VPZB 3MMBA 2KLCA 4CT8A 5C5JA 4DX5A 4K7QA 1JLQB 4HT5A 2X8XX 3GE8C 2ASYA 3Q83A 4TVAB 3HUIA 4GGQA 4M1KA 3QJJA 4FN5A 4F0MA 2JQRB 4W9DA 2N1VA 4WWSA 1PCAA 4WP8A 1V3SA 3A13A 1VBKA 1DGJA 2M56B 2LCWA 2G1HA 2LXUA 3M2VA 2JEFA 2G0IA 2KI2A 4ILMA 3WHIA 4TV3A 2VBXA 1GK8A 5T7LB 2XY7A 4J3OD 4PK1A 1T0SC 1IKXB 2BBEA 1SJED 4B9SA 4OHVA 1D4BA 1B0VA 4N6EB 3RZWC 1UWAA 3EDQB 4UOGA 4GB9A 4LRDA 2LHDA 4U9RA 4QAYA 1RT3B 1X5PA 4NRTA 4I2PB 1HZ6A 1WJ6A 1RLDA 5CYMA 4YSXB 2K8CA 3CO9A 2H48B 1ZH5A 3IR5B 4JI8F 5IWAF 4FULA 1YI2S 3OL8A 2DITA 2ZBIA 2VU5A 1R6YA 3ZTQA 2EBEA 3THTA 4FDFA 4B95A 2QJLA 2Z2LA 2BS3B 3B0AA 1M94A 2IMWP 3MM7B 1NSAA 5LL6d 3LALA 1KVJA 2C60A 4P7IA 4O23A 5F3TA 1IWAA 3TZWA 3HFKA 3L16A 3C8YA 1FKOB 3HSDA 4QOTA 2QMTA 1JROA 2JRSA 3EZOA 4TQ1A 1V80A 2V34A 2KXJA 3GR1A 3AE1B 2LFIA 4WYWA 4YQWA 3PHEA 1CJVA 4DSKA 4JI4J 1WTBA 1GPXA 3DOKA 3TBLD 1HNXF 2YQ0A 2HGNA 2EELA 4S17A 3QAQA 1ZDVA 2ERRA 4J9UE 3LYYA 4RNAA 1D9AA 3FRYA 3BDPA 1EWYC 4NLRA 4NAWB 5IM0A 5A8WA 3MMBB 2O6VA 3HFZB 1EETA 3VZHA 2B0GA 5DETA 2YNHB 3I0SA 2PD1A 3BIID 4ZVTB 3UIPB 3FK4A 3A12A 1PGAA 2RNEA 4F2RA 2P9GA 1ZE3D 4I68A 2QGFB 3MECB 3LJ3A 2ZVIA 2CJKA 2D9PA 3MTKA 1J7AA 1JLFB 4QWCA 1Y3JA 3M2VB 4TSSA 2OO4A 1YLXA 2Z0GA 2HVDA 1E90A 1VHFA 1F9HA 4DF4A 2VPXB 2VA3A 1IBLJ 5E2QA 3G2XA 4DV6F 4NCAA 5LXIB 4MH0E 3OVBA 1Q1KA 4HH1A 1B99A 1TKZB 5SUHA 4J5OA 3SU8X 2ZBPA 4FBUA 5AT1B 1JNZB 1UGJA 5J1PA 4RW6A 4ED1A 1NYRA 2B9EA 4DBQA 4EO8A 5CYMB 1SL0A 4QU6A 4OZNA 3HJVA 2Z4PA 1SV5A 1C0TA 1L6VA 2OGUA 4A47A 4CLTA 3PO0A 3VVUA 2LQJA 3IAS1 3RB0A 4DFPA 3Q8BA 3JTNA 4DSLA 1S1WA 3TQEA 5HP1B 4U7UK 3AY0A 4M02A 1R4NI 2FZKB 4W92B 2Z2ZA 1JLEA 2HVHA 2ACMA 4DR4J 2K22A 3TNVA 3V5RA 3GV7B 4EZKA 1QVFR 1N61A 4EI2A 4JI0J 4DUYJ 1IP9A 3O6QA 2J0KA 4Q5VA 4ANEA 3U30A 2WVCA 3K5OA 3S1TA 1X4DA 4K7UA 3MPUB 3AB2B 3DOKB 1MHXA 3FCVA 3RZFA 4E8UA 1LEOA 5KFNA 2OMLA 3AB4B 3RPFC 2HEKA 3IS9A 5FDLA 3V81A 3AOAA 2V4JA 2I9SA 3OSNA 2FPHX 2FLPA 2JNJA 5A8WB 2ZC4A 4MYTA 3VH4B 2J9CA 3CTRA 3OTEA 4WK1A 2O6VB 2PIIA 5HI7A 1EETB 3I9V9 1NAQA 2KAJA 3HHLA 2OP5A 1PAEX 2DY9A 2MA9B 4WKYA 2G45B 3M32B 4OHXA 2I1KA 4X4RA 4DR7F 3FC9A 2HQDA 1KR4A 4IWQA 3M8ZA 2HD5B 4ARCA 4NASA 3PTWA 4YWGG 4ZS6A 1P9QC 5D0EA 3A9KB 3NZ3A 1Q1OA 1X9MA 1C1BA 3AM9A 3GTYX 1S48A 4DL4A 3VGVA 5D78A 5KFOA 1XERA 5LOQA 5BJRA 2K3IA 4QIFA 2FB0A 1KHVA 4B3RF 2VASA 1IYFA 1EHWA 5KHQA 1Q7LB 1KLGD 2W2OP 4WH4A 3K8VA 4M0WA 1OS5A 1Q8IA 2DENB 2DHGA 2KT5A 2I2YA 1L6UA 4C0BA 4DR2J 4X64J 4ES3A 1H2UX 3M9NB 2JL9A 2PC6A 3CIMA 1YJJA 2PKOA 5DLGA 5GAEU 1WF0A 1QQRA 4ZVEA 2WHOA 2ZD1B 4QIVA 1IKYB 2WS3B 1TL3A 4BC7A 3OTOJ 2HWHA 5GMKa 3VZIA 4A6QA 3QX1A 1S1WB 1Q82T 2D5GA 2EW9A 4OYMA 4JL9A 3UDVA 4AP4C 2M4NA 1FEEA 4PAAA 3ZO7A 1JLEB 2UVUA 2K0PA 2JEIA 2X51A 4MEMA 4LRBA 5HN0A 3HM9A 5FLXU 4OX9F 2ZVOA 2A2DA 4DR3F 2CPEA 4PQAA 1S77D 1VS3A 1GH8A 3EMTA 3FEXB 4XO0A 3VQTA 5HBMA 1D6EC 1WGRA 2CPJA 4E71A 3T1YJ 3BZDB 4G3IA 2LHEA 1SJRA 2FD2A 2COLA 1RZMA 2C3OA 3JS9A 1IBXA 2LVPA 2K3KA 1M5HA 2BZ2A 2V50A 3IS9B 4PG5A 3N5BA 3NHEB 2MY7A 2V4JB 3N6NA 4K0KJ 3EGRA 5F9LA 4RPFA 3RR8A 4Q2MA 4WURA 2LXAA 4DMZA 4LUBA 3GFYA 1DRZA 2KFYA 2ZNYA 3J9CA 3BBBA 5L1IA 4YT0B 1QAXA 3VHQA 3RW6A 2X1GA 2CQCA 1NUEA 4DF8A 5HJXA 2BEFA 2BTEA 3AE7B 1K47A 3HHLD 1FJGF 4LNFA 1DYQA 4M63A 2HWTA 1Y00A 3CCLS 1NLKL 3HHLC 1C1BB 1X4GA 3HDSA 4TYBA 4YTPB 1GC7A 2DHZA 4K1RB 1SC1B 2WW4A 3GG1A 2KO1A 4F8RA 1JJ4A 4PG8A 4M0WB 3MOJB 5BMHA 2OEDA 2PA8D 1GEHA 1SE2A 1KLNA 1WOPA 2DKOB 2OJWA 4DV3F 2NCKL 4DZDA 3BKUA 1J5EJ 4IG7B 2VRRB 1RAGB 4GLSC 2HG4A 2DGXA 1RTIA 4BLGA 3MTJA 2F3JA 1HHSA 1WD6A 4F8CB 1TL3B 1FD2A 4LSLA 4JV2A 4JI1F 1NJXA 2CS4A 3C6TA 1RAFB 1LQBA 1MN7A 4LF7J 4OVUA 4ZPBA 2WDRB 1P1TA 3QWUA 1UEKA 2IZVB 4NZ0A 2IJRA 3RRGA 2BKRB 2REXA 2KACA 3D66A 3GLJA 2K6QA 3BGLA 2WGSA 4ZN1A 3CCES 1WR1A 4GXBA 3CSKA 1WNEA 1FJCA 2JF5A 2ZPYA 2FLLA 1UEVA 3BREA 4WJNA 2QV6A 4IYQA 5G2NA 4X57B 3DOLA 1N5YA 4UOHA 1GB1A 2XY5A 5HBMB 2KNBA 2JLEA 2CHXA 3VUXA 1VJQA 5IT9Y 1UZHA 1T0RC 4C11A 4KH0B 2GBMA 2R2QA 2J7KA 1WC3A 3AMZA 4NLWA 3RU0A 3PX4A 4DQOC 5C25A 4YN3B 5I3PA 4J6IA 4G1PA 3OUYA 3HZGA 3ENEA 1IBXB 1U0HA 1YD8U 4DPTA 4J9PA 3ZZTA 1LO5D 1RP5A 5FK9C 1YZ6A 3V2UC 4OVVA 3PRDA 3SBMA 3B82A 2Q6BA 3KUZA 1WXMA 1J27A 3AD8C 2GZOA 3N9YC 4FXVA 2QSDA 3PW4A 2E1MC 4RU2A 4F4WA 4CLSA 4J9NA 1O51A 2MQOA 3HF5A 2HFUA 1ZUD2 3MMCA 2H54B 3BF4A 4K2JA 2BKPA 2KYXA 3PSEB 2NXUA 4DPXA 2VPYB 3HMJG 1VHIA 1C77A 1FRRA 1NEEA 3NZUA 5EX3A 4P6QA 3CD7A 4NXNJ 2Y1RI 2HWIA 2RGFA 3OR1A 2XMKA 1P9YA 3AXCA 4W9HA 5B09A 3PFEA 4F26A 4GKKF 3AH7A 2IAJA 1WY8A 2FJBB 3ZFVA 1SJ3P 4ES2A 5F8LA 2BJ7A 1FRXA 5E7OB 4Q45A 2ZDOA 2HLTA 5B0DA 3OJ3A 2RRAA 3P2BA 2NPIA 4OZBA 3BQ2A 4ZPAA 5AXNA 2PEAA 3QPIA 3GZNB 2L8JA 4UF4A 3GIRA 1R8AA 4HDQA 1JALA 1N5SA 3OPKA 2KJ6A 2MKIA 3UQSA 3C6TB 7FDRA 3Q24A 4Z2XA 2L9DA 2KTQA 3EICA 4QIWD 1YN5A 3NG0A 2XEXA 3T3FA 1TKTA 3BKTA 4RM9A 2XM3A 4N56A 2BE2A 4D2KA 1BC6A 1KH0A 5HMYA 3RZAA 3W9CB 3DOLB 3FSXA 1N5YB 1BUXA 1Q53A 1VRAB 4ECQA 1K52A 4TN2A 5E3AA 3AODA 3TCAA 1G6JA 2X3GA 2HPUA 3IBFB 4C11B 2UU9F 4LR8A 3I5AA 2LXIA 2QLBB 3SFGA 5EHHA 3DBSA 1N0VC 4UOFA 3O13A 1GMVA 1EP4A 2FVCA 5C25B 2P6SA 4RNFA 5EWEA 3OUYB 4ATNA 4YL8A 3UQAA 1U0HB 3IBCB 2RB7A 1V5VA 2W4CA 2BUNA 2MCNB 5L46A 3H5XA 3TO8A 4WJBA 1S1UB 4IFVA 3T9NA 3IFWB 3RAQA 2RSUA 2FBWB 3M95A 2V63A 3DVGY 4EKUA 3PZDA 1P7FA 5AXMA 2RPQA 3FBFA 3MMCB 3A1QA 4F4KA 2QCZA 3CSFA 1F0ZA 4OZCA 4CWBA 5C24B 5KFQA 4OZAA 5J2QB 1JXLA 4GO7X 4GN1A 2GJFA 1KLMA 3BINA 4IM3A 3T5JA 4F3QA 4OX8A 3SHQA 3IT4B 2NZCA 3OR1B 3PW5A 4LDTD 3OFEA 1S4FA 1R8PA 1NI3A 3ICLA 5CD4A 3A1YG 1RWNB 2RAQA 4USVA 4B3SJ 1RABB 1E6EB 3ET6A 4F0HA 1IM4A 3MPVA 1I1GA 1RT1A 1T3OA 2GVZA 1OYEA 5AZFA 4LF1A 4B9UA 1T9TA 3OXFA 2CJXB 4WFYA 2RF2A 2RD5C 4Y00A 2UUWA 2DNZA 2QE5A 4WP3A 2X7IA 2TSSA 4AXJA 2MTLA 3UW1A 1NK8A 1QM9A 2OUGA 5CAAA 2HYIB 2CHWA 1PDXA 5C7PA 4CLUA 3BV8A 2LRWA 1WF9A 2NXEA 3TEYA 4KRWA 1RHRB 3N3KB 4WK3A 1F9FA 1QJHA 5KG4A 1IR1A 4DJBA 5DZ7A 2DYBA 4WQMA 4WAAA 1KOTA 2QEXS 1FD6A 4FNIA 3RNBC 4FZVA 3M63B 3PREA 2YWFA 4DQQA 2BE2B 1TELA 3UGBB 3I5BA 1FNWA 1SBBB 2KVQE 3GYXB 1WC0A 4NCGB 2Y8YA 1Q95G 4RCOA 3NS7B 1F9JA 3EYZA 1EP4B 3W63A 3DU6A 4BBNC 3BVMA 4L6V3 3CCMS 4AQYJ 4LT6A 1RWUA 2M8HA 3PEJA 1NHUA 4TQSA 3MCSA 2OPPB 3D5MA 1AA1B 3PHTA 3UCUP 2RMMA 3QZ8A 1X9SA 4YS2A 3EUNA 4F2SA 4K50A 3FKBA 3DBHI 2FJAB 4ZITA 2B76B 1QOGA 1Q5YA 4Q44A 4A9AA 3A1QB 3I5CA 4M5NA 1V3RA 2AT1B 3JTPA 3HVRA 4U67Q 2WCXA 2KZMA 2XMAA 5KFUA 2F8EX 4RUAA 3WANA 4RBTA 1RAAB 3LGMA 4OYPA 5KFRA 5D0HA 2V3PA 2ILZA 4FVMA 2G0JA 3RNEC 5K14A 1U4BA 4KKJA 1F52A 1WHXA 3I0RA 3RRKA 1RWWB 2DR6A 3MD3A 3VAFA 2F4FA 2ZZMA 2FHJA 3ET6B 3M8WA 1RT1B 2L83A 1UA1A 2GVZB 1IBKJ 2KJWA 2BDPA 3MUTP 3P6YC 5F0WA 1WE7A 1G6BA 1SBRA 1RWVB 2RF2B 3KUHA 4Y2AA 1CJEA 3G8SA 1R7SA 2KJHB 3FZ2A 3OR2A 4JI3F 2QYCA 2WNMA 1XN9A 4E3CA 5F8GA 2KRBA 2V8DA 5DM7Q 1R0BG 3J7A1 2V9WA 3JQMA 3KK3A 1N5WA 5D8HB 3ELHA 1YQ3B 4AFFA 5D94A 3KG4A 4M8LA 1LXJA 1UVJA 2BVCA 1VQPS 2OSRA 2QLFB 4KX6B 1KDNA 1HW8A 1FRKA 1TS5A 2Y9HA 2HJ8A 4KZCA 3TVKA 3OV7A 1RHQB 3US5A 1SJQA 2E7VA 2LI5A 3G6XA 4PZVA 3NOBA 4AOFA 2R7WA 2V8HA 3RN9C 5CH7B 4NLDA 1PC4A 4P71A 3MWBA 3MR2A 2A5UA 3NCPA 2FVRA 5F8HA 9ATCB 5D4OA 1EB0A 4WYLA 4P1CC 2WU2B 3FC4A 3J7AN 1S1QB 4MKBA 3W1YA 1E8WA 4MH8A 3U7DA 2V8VA 2ZITA 3M6VA 5A8RA 3NVWA 4AUKA 1AFIA 2VG7A 4DN9A 3JW0X 2Y8WA 3DU5A 3BGRA 4ECVA 1HHTP 2NSCA 1R89A 5FD1A 4JI2J 1N33F 5LXYA 4MGZE 4KTQA 3O1LA 1T8EA 4CO2A 4ZRPA 2QL9B 2AGOA 2FY8A 3W9HA 2GQQA 4AD6A 2NTTA 3VUYA 2ZBQA 3BSNA 4EZJA 2GCFA 3FZBA 5GAHU 4FXDA 3POTA 2E5GA 3TEWA 4OYXA 2RVJA 2ZBRA 3TMPB 1FJEB 2KB2A 4OI0A 3R7NB 2MJDA 1ZGUB 1CJUB 4TY8B 1YHQS 4FF1A 4ZYNA 1ZM3A 4WIIA 2P8IA 1APSA 4A8QA 4C00A 2HBRB 3OG5A 1Q5WB 2CYYA 5C3JB 4ZOSA 1IBMJ 4IOAQ 2HHWA 4JUZA 2OOBB 2INDC 1YZ7A 3GZNI 1Y3KA 2KMAA 3OR2B 1HBNA 4ZVSB 4W9EA 1PILA 3HULA 3GB0A 1TIFA 3ZZ0A 1JWAD 4NL5A 1SE9A 3R8YA 1TR0A 4HHHA 5HVFA 3UQBA 1WKKA 3ENQA 1N34F 4EZLA 4DX7A 4HJKA 3J81U 3FKYA 1OY6A 1VCTA 5C1ZA 4LIWA 4RMAA 2YNGA 3PT2B 2CPIA 2MPUA 1AXQA 3T1AA 4JI6J 3PM9A 1TZ1A 5DDOC 1NJWA 3T6JA 2W2QP 1FE0A 2FC9A 2GC8A 1NB7A 4NAMA 1PC5A 1PYTA 4Z7CA 3BPDA 3VWSA 4HVBA 2XMJA 1WOOA 1C0UA 3W9IA 1T0QC 3HPOA 3EVWA 1S57A 2WP9B 2GIFA 1HWUA 4LF5J 1S1VA 1HWIA 4DN0A 4F4YA 1XJWB 4PCQA 1QOFA 2YWHA 5KFAA 1QY7A 4LNIA 2VG7B 1TS4A 1XO3A 3UN2A 2Q1LA 3BGRB 3QCAA 4C98A 4L72B 1FDAA 3O8WA 3N9UC 5EGYA 3EGZA 1M1GA 1XLPA 5G5GA 2N7EA 1KFYB 1NBFC 1KQKA 2FHMA 2KN4A 2HFVA 3POTB 1T0TV 2UYZB 3CDAA 4NCBA 1XNQF 1I4QA 4IKGA 2W7AA 2CU1A 2JZPA 2VB6A 1EKSA 2DY1A 2D10A 3E01A 1MFWA 2O3DA 1RA6A 4RNMA 4LQ3A 3MC9A 5F8MA 1SC3B 4MT5A 3CCTA 4WBFA 4ERDA 2D3OR 3KUDB 2WB4A 2W7OA 1YJNS 4NYZA 4DUZF 2AL6A 5LMNJ 3VRBB 1OMSA 4DCJB 3GZ7A 3KUCB 5KFPA 5ADZA 1HBNB 2ZE2A 4UT4A 3Q8CA 2CJ9A 1NCLA 4LNOA 4LSZB 1XT9B 2B3TB 2R7SA 4AYBD 5A8KA 1RWMB 3TAMA 4I1TA 4P73A 4HVZA 1ISNA 2RUGA 1EZZB 2DO0A 1FFWB 1E10A 1I7HA 3TZZA 1WOSA 2YNGB 3LPEA 4KIKA 3U02A 1UW9A 1Q0WB 2GBNA 3H0PA 1HWJA 3VV2B 4ED5A 4ID5A 3P1MA 3HI9A 2B4OA 4FLHA 3RI7C 2KQ4X 3UDEA 1K8RB 1U24A 1OEYJ 4WTOB 2C2EA 2C3MA 4LF4F 3MEKA 3P4PB 1OGWA 2XBPA 2O2VB 2YX7A 2JX5A 3P8BB 4LK0M 1C0UB 3QT7A 2D74B 1XR6A 4KQZA 4HWIB 2XLKA 4WAFA 2J5AA 3V6EB 2B5JA 1AFJA 2RMLA 3P63A 1TUVA 3NGRA 2V67A 1S1VB 3SFUA 3QIPA 4GC7A 4REZA 1OEYA 3K8WA 4Z7YA 2AQ1B 1CJTB 1RB0A 2HSEB 2BKFA 5EX0A 3MPYA 4M5GA 5IA7A 1L0VB 2ADCA 4ZHRA 4R5PA 3R2CJ 1JWUD 2ZH3A 2DAJA 1UPMB 3UN3A 1FXIA 3MI7X 1IVZA 2CVEA 1VMBA 1KLVA 4DFMA 4UUWA 4DR5F 2AGPA 2WXKA 2MZSA 4JX1C 1DY3A 5JHAA 2W9NA 3CCVS 3FBCA 1FXDA 5CYQA 2VV5A 1RTDA 1S99A 3EZ5A 1Q86T 3UWTA 1H2TZ 1FFSB 4FJVB 3OBIA 5IXUA 4IO9Q 2E5HA 3E01B 2KX0A 4HCNB 1IGCA 1WGDA 1DTQA 4OI1A 3QYYA 3URYA 2C5LC 3H2VE 2FTRA 3BSAA 1JW9D 3NL0A 4W9JA 1DLOA 2UXBF 2MKKA 2ZZTA 2DNYA 5D4LA 1VBZA 2PFFB 1JWMD 3CSTA 2XI3A 1RT4A 2QIFA 3D28A 1ET6A 2MSED 2J9EA 5SZTA 1GMUA 2K8BA 2QFIA 2A2CA 2ZE2B 3KDNA 1LNQA 5H9EK 3H8YA 3CWIA 4TUUA 1FWPA 3KJNB 1WHWA 3X3UA 1T3NA 1WJ9A 2O67A 4JI8J 3DLJA 5A8KB 3TAMB 3RB3A 4ZVFA 2VQFF 4HPMB 2Z2MA 2NBUA 2MQJA 4FF4A 1L4ZB 4EZ9A 4LSNA 3ZYYX 2EXUA 1B3TA 2CJQA 2DIVA 1UJ6A 1P27B 2UUBJ 4FKXA 1SF0A 4ID5B 2H4YB 3Q14C 2HS4A 2LUEA 3JTOA 1TTHB 2NCNA 1XQIA 3I4HX 5I3QA 1SL2A 1UD7A 1GMWA 3PKMA 4USJC 1V1OA 2WDVB 3APFA 4F0KA 1JIHA 2VJVA 4A55A 1QOBA 5BO4B 4DDFA 1SB3C 2ALZA 1MMLA 1SKUB 5GVQA 3UDCA 4URGA 4AL5A 3MJWA 3H7PA 1RWOB 2HZVA 1NM2A 4RGNA 1SUQA 1PYSB 5D3DA 2XYPB 4ER8A 3R6GB 3NKYA 1WI6A 2NMQA 4HXDA 4KGXB 1YQ4B 5AZGA 4R5PB 2KHWB 2VKRA 2CNNB 4DUYF 4NLTA 4G1IA 4OYAA 2AF6A 5KOWA 2XY6A 2IBOA 2IVYA 1TYGB 5CZXA 4OLOA 4ELUA 4ZP9A 3EE3A 2KVIA 1ZAXA 2X38A 4QWEA 3PR5B 3AQPA 3I31A 3NG8A 2FJXA 3Q8UA 2H5IB 4FPRA 5CYQB 1N62A 1LFWA 2MKSA 3K0JA 3W1SC 3MM6A 1RTDB 3F41A 2MLYA 2KXHA 4USIA 4TYAA 3IT6B 4DLGA 4D3HA 3SDLC 2XK5A 1TL1A 2W7PA 1DTQB 2RDIA 2B7BB 2ZW1A 2HRYA 3AB5A 2ZC3A 1FIQA 1V3ZA 2C2ZB 2HAIA 2L0FA 4DWFA 3LGNA 3EUB2 1DLOB 4I7FA 4OQJA 5AE2A 1RT4B 2W82A 3FQLA 1REVA 4JWSC 3GP9A 1J5OB 1S59A 4O0IA 1Q8KA 4N8NA 2VZKB 4MIBA 2DNQA 3D1OA 3CJ0A 4JV5J 3H1UA 4YDDB 3T6BA 2VKZG 2P5VA 3L54A 2RHQB 2LECA 4B9MA 3LWMA 2BR0A 4II3B 4LSNB 4YFUA 2LA4A 5DPTA 4HEA1 2OI2A 5THWA 2LLZA 2FIDA 4IQXA 4RLEA 2CQ4A 4BKSA 2GO9A 2WSCC 1RJJA 3S2AA 3DQVA 1LKZA 5J2RA 1YX6B 4PWWA 2OFHX 8ATCB 1VQMS 1KSPA 1GAOA 2D3AA 5CYJA 3DDIA 4ZRKA 4DPUA 2KDMA 1U8SA 2Y3YA 3GMGA 3R3TA 2HHQA 5HSPA 3OTOF 4P16A 2A18A 1VQ5S 3H7PB 1TKXA 4K8RA 3SEOA 1ZBTA 1SH2A 1CS4B 4R8UA 2QC8A 3ZTOA 2DPJA 1SUQB 2E5JA 2ASLA 5JHBA 1PJ6A 3ECIA 3AULA 2BKOA 1ZZFA 4A20A 1KVKA 1FDBA 4IUMB 3HKZD 4M5IA 3J7YU 3KNAA 2E29A 4LF9J 2YKAA 1R27B 3F73A 1TKDA 2BQ3A 4OHZA 1R0CB 2EK1A 2CPXA 3BK1A 5KFGA 4ZA1A 3KK2A 4L3NA 2OPRA 1F60B 2RQCA 4KY3A 4CZCA 3MM6B 1HNIA 2FE8A 5CHVC 4FYYB 3JVZX 3S01A 3QT5A 2D3UA 4B0MA 4AWJA 2ZNZA 2FJVA 1FA0A 3X23A 2XK5B 1TL1B 1N6QA 3ETRA 1F5CA 4F1SA 4ETZA 1SB6A 3P49B 3QGPA 3IAS9 2UXCF 2IBIB 4ZCKA 3FJ2A 3R1HA 3VGUA 3QGIA 4B3RJ 5KFDA 4L1BA 4OI3A 1ZOTA 1ET9A 4AJYB 3QQCD 5DQIA 1FNXH 1EU3A 3D2WA 3AN1A 5L1KA 5A76A 1S9GA 1JRUA 3AH6A 9RUBA 1RLFA 1TMJA 2DVIA 2QFJA 5ETTA 1GX6A 4YP3A 2ZCCA 2HHVA 3M05A 4EFAC 1X8DA 4M95A 4O3OA 4XIUA 2RS2A 3GCWP 3ZNUA 5A2QU 2WRMA 2DT9A 2WTFA 3VTIA 4WFXA 1RFAA 3ILOA 2CRLA 2VFVA 4DR3J 3PY8A 4OYBA 2FDNA 2WXNA 2HURA 1DOXA 3CC2S 3Q8SB 3NVZA 4IWOA 1HWKA 4DCPB 1EARA 2ICIA 1CZPA 3UVJA 2WOMA 4A8XC 2D9OA 4BKSD 3FQKA 1F77A 3MAQA 5KG1A 4L76A 1C76A 5ETKA 4OVZA 1U1KA 1WXQA 1BT0A 3MCOA 2E9TA 3IAM1 2PEHA 1FRDA 1TKXB 2JWZA 3TUZC 2YTCA 4R8UB 1QAJA 4K4ZA 4DCOB 3MPWA 4OIXA 4TKTA 1FWLA 5FJ4A 2LEBA 3DXSX 3QK0A 3CJQA 2XB2D 1Y9OA 5AJ3F 3FMWA 4P6VF 5AXLA 4BWJA 1XR5A 1M5KC 2HMIA 1B7YB 2VH7A 1F6TA 1TFYA 4UZBA 3ZNZB 3KK2B 3ML9A 4LR7A 1WGYA 3CMQA 2OPRB 5B0EA 3I6PA 4DSFA 5FIIA 3ZKJC 3GFXA 4DZ6A 1HNIB 3KLIB 5HHDG 1E7PB 1LWEB 4IDIA 2RRNA 2DHSA 1FJGJ 3GILA 3MEDA 2LGDA 1PBUA 3R5GA 4USWA 2A6OA 3KWLA 2KFNA 2DR5A 1NNDA 3FGVA 3CC4S 1I4RA 3VTWA 1FNOA 3W60A 4LIRA 4ZIVA 1I35A 2ZJPQ 3QT8A 1E6YA 3DC2A 5ETOA 3DRPA 3G8TA 5LMUF 1M1HA 3QMQA 2C7NB 3Q2AC 2EFGA 1T5XD 2V0GA 4M94A 4R0EA 3PFOA 2N3OA 2HAFA 2XYGB 5H8YE 3TOQA 3HM6X 4FYVB 1VBXA 3BBFA 3A9JA 3JSVB 2UV8G 3PX0A 3F44A 4X66F 1X1MA 3FFIB 3VTVA 1N63A 4YR2A 3HJFA 3GU0A 1WXAA 3GE3C 4JI1J 4II2B 2ZZPB 5GADU 3HT0A 1YGYA 1YTYA 2MHNA 3C16A 4ZPWR 1KP6A 3O65B 1T0YA 4CO4A 2OSQA 2IY1B 5EN1A 3Q3OC 3AEEB 3BN7A 5D6JB 5E6NA 2IA0A 3GOEA 4N47A 3PRBA 3U52E 1B9RA 2E5LF 1FFUA 2Y5CA 4E98A 3TUPA 3L08A 3DDKA 3G71S 4HPPA 3T5LA 4A8KA 1TJEA 2Z57B 1GQEA 1VISA 4X4SA 3CCJS 1Y5LB 3GIKA 2DK2A 2GVDB 3W3SA 3HFVA 2LVWA 2W8LA 2Z2YB 3U27A 4HH0A 4I6YA 3KWMA 1L4DB 1TZOA 1WMHA 2YKPA 4JPSA 1T9UA 3C46A 1H72C 2INPE 4OV6A 3IWLA 4U95A 1QAIA 4PR6A 2MLXA 1KOOA 4KYZA 3BSOA 3OL7A 2J6SA 4Z37A 2HMIB 4OYWA 1LWCB 2XGQA 1S6PA 2M8SA 3N30A 3TX8A 3J80Y 3Q3MC 1S4EA 5KT6A 3PNIA 4I56A 3QSYB 2AHOB 2BJ8A 3FILA 3BB5A 2YKQA 4DQPA 4NLSA 5HLFB 2F7VA 1D8ZA 1HD0A 2B8PA 3MEDB 2RPVA 4AS1A 4DU7A 1R8BA 4HACA 4N7TA 4NA3A 2J76E 1L3TA 3KNGA 1FCLA 5IS2A 1NSQA 2H5JB 2EFVA 5DDRC 2CZ9A 2GS8A 1NBEB 4CTAA 3RFZB 2NTSA 5MAOA 5KTQA 5G0RA 1E6YB 3NEKA 5E3QA 1YJTA 3DRPB 2XMMA 2YY3A 3D54A 3U1LA 4CNZA 5M2PA 3PIOQ 4GKKJ 1TAUA 3NS5A 2QN6B 3JAMY 3OL9A 3R97A 3LUYA 2WXJA 2ZKTA 4W98A 4HK2A 3NY0A 4V19X 1TV6B 5KT7A 2W4PA 1WI0A 3HVTB 4JLCA 3V6CB 3A9JB 3TUOA 1WI8A 1NZ8A 4A4JA 2QILA 4ED4A 4QYRA 4OJHA 4J9RA 1FFGB 4KV8A 2UZAA 1XLNA 1YJRA 3MR6A 4K4TA 1X4FA 2CZ4A 5KFFA 1LWXA 3L7PA 4B3SF 2GX8A 2BKNA 1WYGA 1PUTA 1FDDA 4DS5A 2BJDA 4KHMA 4QYZK 2YNFA 1OQ3A 4IKAA 2B4PA 4GIVA 1NH8A 1RUSA 4FYXB 2JC0A 1N8RT 1NDLA 3BY4B 4XX5A 4FA6A 3LW5C 1G3OA 3MCNA 2BJ3A 5ETMA 3CXCR 3M2RA 3J7ZT 4O4RA 1XXGA 1WSVA 2UU9J 3R6LB 3PDNA 4LFBF 2WONA 2V9HA 3M7VA 5HAOA 1B64A 1FRMA 3JYUA 2QJ3A 3AU5A 1WMHB 2HQCA 3EGWB 1T7PA 1WWHA 1ZAWA 1K50A 1U0SA 3CNQP 5CCMA 3WAOA 3W5VB 3GJSB 5F0UA 4CLZA 2U1AA 3GJRB 3LP2B 2IY5B 1WF2A 2Y1IA 3V05A 4DL6A 1D1UA 3NGSA 5IV3A 2PTLA 1S6PB 4GVBA 4K5RA 3IWXA 4RW9A 3W64A 2R2SA 1GX5A 1KN6A 3FILB 4X4OA 2CPDA 2FYXA 3PR4A 1U02A 2DWQA 3TA0A 3TL5A 1X5SA 4JOUA 1FNUA 4P72A 1YVFA 2K1RA 5DQGA 2BJEA 4HACB 4O1NA 3EJMA 4C3LA 1XLQA 2BYFA 2MKYA 2XG8A 1HBUA 5BXIA 2HTME 2PE6B 3MF5A 3ZC4A 3AE8B 2G2ZA 2DEIA 5G0RB 2ZH1A 2WX1A 2QDFA 1RT6A 4C6AA 1VQ7S 2BX6A 3ZW3A 1SQFA 3SSSA 1K53A 2E9RX 4B17A 4TU9A 1FCCC 4EE2A 1VBYA 5K9FA 2MKHA 1ICEB 3CMMB 5AEKB 1NDCA 1ZTWA 3B54A 2G0CA 1I3OB 3K89A 5L1LA 1IQTA 2NQPA 5D3GB 1H98A 1K0VA 4W9KA 2KTFA 1SPBP 2MRPA 3OLMD 4XDCA 4HDOA 1RBAA 4AQ7A 4HDGA 1OQYA 3VGTA 2MYFA 2MW5A 5CHFA 3N79A 4DR1F 3DLLQ 2GBKA 2VJUA 2WK4A 4QWAA 3GP7A 2KKHA 5KG7A 2GJIA 3KFWX 3H5UA 1U2FA 2YNFB 2K6DB 3AECB