1XCQL

Complex hcv core-fab 19d9d6-protein l mutant (d55a,l57h,y64w) in space group p21
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
PKEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALHAKVNGEWTADLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Capsid protein C
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
total genus 8
structure length 66
sequence length 66
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xcqL00
5HFYA 2ZW0A 1XF5L 1IBXA 4KGTA 2KQ4X 2N9KA 1MHXA 2RMMA 4WH4A 2LGIA 2IGGA 1K52A 4D2KA 1MHHE 4GLSC 5HG2A 2JWUA 1MPEA 1HZ5A 2KDMA 4HKZE 1K50A 5JXVA 1PGAA 2JU6X 5HI1A 2JSVX 1YNTE 2KN4A 4KGSA 2NMQA 1FD6A 3FILA 3V3XA 1K51A 3UI3A 2PLPA 1Q10A 2GI9A 5BMIA 4OZBA 2J53A 1P7EA 2GB1A 2PTLA 2PW9A 4OZAA 2J52A 5HHDG 2KACA 2LUMA 1IGDA 1FCLA 1ZXHA 2I2YA 2RPVA 2N9LA 2JZPA 3GB1A 1GB1A 2KWDA 1KH0A 2LHEA 2IGHA 2N7JA 2QMTA 1XCTL 2K0PA 1YMHE 4OZCA 1C9FA 2ONQA 5BMGA 2LHDA 1QKZA 2ZW1A 2QSDA 1FCCC 1IGCA 4MACA 4KGRA 4IOIE 1D4BA 1MVKA 1UWXA 3MP9A 2JXTA 1XCQL 1HEZE 1MI0A 4IKGA 5BMHA 1F2RI 2EELA 2IGDA 1K53A 1JMLA 2OEDA 1GB4A 1IBXB 1PGXA 1EM7A 2ON8A 3FILB 1P7FA 1HZ6A 1F2RC 2I38A 4HJGE 1PGBA
chains in the Genus database with same CATH superfamily
1WY8A 2HJ8A 3RPFC 2NVUI 3TEZA 1OTRB 3NS8A 3HK0A 1WGHA 3PT2B 1VLBA 4MSQB 4DK5A 2W3SA 4JE3B 3IBEA 3SFDB 2JUOA 1ESFA 4BZAA 2WNMA 2I1KA 1YIWA 4FJYA 2WWZA 4FXCA 1WXAA 4MH8A 1P9DU 1I4HA 1OEYJ 3FILA 3MJWA 4IW0A 4RF0A 4AJYB 4LLGM 2ZNVB 3N20C 1QT9A 4ARCA 1L0YB 5IKCM 2PPHA 3NJTA 1OFFA 2PW9A 4P6VF 1MG4A 3UIPB 1ZXHA 2JWZA 2WXPA 1WFYA 3MC0B 3P4QB 2RSUA 4HDQA 2MA9B 4WAFA 1ET6A 1SIFA 4W9FA 3SR6A 1WJ6A 3MJ5A 4C4VB 2WXQA 1YQBA 4F8CB 1NYQA 1WGKA 1KM7A 4XYCA 5JH5C 3DCGA 2JF5A 4TV3A 2CHZA 3KLSX 1C78A 1EWCA 2CJNA 1MFWA 3V60A 1WJNA 4Q2JA 4WJOA 1WXQA 2QILA 2JYEA 2B76B 2C60A 2G9HD 2WP9B 3W9CB 1FPYA 2HDEA 4K7UA 3AE2B 2EKEC 1YOVB 3ZNID 1UUPA 1M4VA 2V4IB 1Q0WB 1V1PA 2REXA 3JSVB 4PT5A 4ANWA 4WJQA 1L6UA 1RLFA 4ZRKA 2V9HA 2BWFA 1ZPSA 2KQ4X 3U8ZA 1EO6A 1KLGD 5H8YE 1LO5D 3RNFC 4C80A 3ABVB 4IDIA 1PYWD 2DHZA 2AEHA 3IHPC 1WZ3A 3OJ3A 2OOBB 2M56B 1DOXA 1YNTE 4KZ0A 1SXTA 3SU8X 3VTVA 2L76A 1N60A 1MJDA 4ZYSA 1NEKB 4ZRJA 2M1MA 2RGFA 4HPMB 3WAMA 1UNSA 4W9IA 3ECIA 2FE8A 2GBKA 1WH3A 2JRHA 3QC8B 4G0NB 2N9XA 2W9NA 1C79A 1PQSA 1DOYA 1IGDA 4NAWB 1JRPA 3OJ4B 4AWJA 2OJWA 3ML9A 1C3TA 3DHGC 4A90A 2KQSA 1H8CA 4NZLB 4F7ZA 4I6LB 1WF9A 1E7VA 3ZTDA 1V6EA 2FNJB 1T6BX 2L05A 1K8RB 3VFKA 4PYUA 5H92C 1JROA 2DZJA 5AUIA 4AP4C 2K9XA 3PRMB 1UBIA 4LJPB 3R8BA 1IP9A 4KGRA 4NNJB 3S2AA 4USAA 3MP9A 5FR3A 3RZFA 3EFUA 3I57A 2W55A 3QX1A 2FUG1 1XO3A 2FCMA 3AE7B 1SSNA 1I4QA 3R2IA 3FILB 3VUYA 2CR5A 3VAWA 2LVQA 4L1BA 1DOIA 2MBBB 5J18A 3L54A 3PHXB 4KKJA 5CHWA 2ZVNA 2C7MB 2MH7A 1NI3A 2N9KA 2HTHA 4KV2A 3BWUD 3ZRCA 1BT0A 2LGIA 4GLSC 2AQ2B 4XZ4A 3R3MA 3AMZA 3NVYA 1HQRD 2LGXA 3DBHB 2ZZPB 4B0EA 3BK1A 2JY6A 5DPTA 2DZIA 4NQLB 2BVCA 4K7SA 2BS2B 4DXFA 3W5UB 3Q8EA 2KACA 3I5JC 4P1BC 2D5GA 1TZ1A 1QOGA 4EZLA 3L16A 2RPVA 3RD2A 4A3PA 2KWDA 3T8MA 2WXHA 1AWDA 4HLEA 2DBYA 1YQ3B 2BF8B 2CU1A 3KWLA 3ZYYX 2FIFA 2RDHA 1F0ZA 1J7CA 1ET9A 2MQJA 2KOXA 2KWUB 2KJHB 1KLUD 1WX8A 5FK9C 2NS5A 2PIAA 4ZOHC 3QWZB 5HKHA 1N61A 4IWQA 4RM8A 3RNEC 1ZW7A 4AUQC 2WX1A 3OG5A 5DPSA 3PLVA 1FXTB 3FC4A 3GE8C 1X1MA 1BUIC 1OQYA 2W82A 3AEDB 1VCBA 1XLQA 3PRPB 4KGTA 1IBXA 3NRZA 4CYEA 3HHMA 2CKHB 3BVGA 1MHHE 2ZNVC 1N6ZA 2L8JA 4WWNA 5BYQA 2DWQA 4WJNA 2HD5B 5HI1A 2VH2A 1XEEA 3JYUA 4DDGD 1FNVA 4PK1A 3GZNB 5GXGB 3V3XA 1L7YA 2BYVE 3UI3A 1YN3A 4JWUC 4HXDA 3PZDA 3AE1B 2WGSA 3UF8A 3NVZA 4FLHA 2K22A 2BS4B 1SJED 3RFZB 4ASWC 3MFGA 1YD8U 5TR5A 4AS1A 2D07B 4F1SA 1SE2A 3TEYA 2NBUA 4ANUA 2K39A 3TBLD 4GU2A 3SEBA 1ACCA 5LLIA 1N5XA 1ZDXA 2LHDA 1FCCC 1C1YB 3VRAB 2GOWA 2O2VB 1V5OA 1NBFC 4NQKE 4MJSB 4B0MA 4MM3A 4ANVA 3ZTCA 3LXFA 2JXTA 2I1JA 2BKFA 3KVFB 3ZW3A 2OJRA 3PREA 4EKUA 1JMLA 1I4PA 5IAAC 1E8WA 1SGHA 4OW0A 2WYQA 2LRUA 3W1YA 2SAKA 4EFOA 2DYOA 2I38A 1UGJA 4YTPB 3ZJUA 4A9AA 2QHOA 1R4NI 3IXSA 4ZYNA 1XLNA 4OVUA 4HEA1 3QIJA 1FNWA 5E6OA 4C7YA 4FJVB 3SHQA 5BO4B 1MPEA 1TKEA 1FO4A 2L52A 3QA8A 1QLBB 2L7RA 2ZCCA 4BKGA 4HJKA 2JSVX 3A1QA 1KFYB 1J7AA 1R4MB 4LK0M 4KX6B 5J2RA 1JRUA 2VRRB 4FA6A 1T5XD 2LASA 3N30A 2N4FA 1S1QB 3A9JA 4R3DA 5E6JA 2KWCA 1E0ZA 2GB1A 2DAJA 1FCLA 4KIKA 1KF6B 3BVZA 1OQQA 2KT7A 2MX2A 4GXBA 5FKAC 2PE6B 4BFRA 3MC9A 2JRIB 3MHSD 2EMSA 2KXJA 2Y5PA 1TY2A 4GIVA 1CK1A 3AE9B 2KK8A 3A9KA 4B6WA 2L0TA 1WGRA 4BVUC 3A33B 2IO0B 2WLBA 4XDDA 2WXIA 3GS2A 4I6NB 3VVWB 1FXAA 3ALBA 1P3QU 3AE3B 4HRSA 2QCZA 3ZDTA 5BMHA 2MRPA 1N62A 3PHWB 2MJEA 3PS6A 1V81A 3AV8A 3IG3A 1WM3A 2KMMA 1Z5SB 2DYMA 5DCNA 4A55A 4IC7B 3R7RA 1LXDA 1F2RC 4DXAB 1HTOA 4IWOA 3AI5A 5LNK1 3Q3OC 3PRZA 1UBQA 5G2NA 3MC8A 1F77A 2XN9C 1HXYD 3P4SB 1XF5L 4WJPA 3V6CB 2KDEB 3CF6E 3N1XC 1MHXA 1GPXA 2BYTA 3RCZA 4BKTA 1JWUD 2KJRA 2V4LA 2WU2B 4OVVA 2XK5A 4B95A 3NZUA 3MHZA 5CX3A 2GBNA 3AB5A 3PSEB 3M3JA 2CS4A 1VZ6A 4BKSA 4KGSA 2K5PA 3RMKC 4HCNB 2NMQA 4N58A 3AEGB 4HWIB 4MM3B 4PS8A 1WRDB 2LGYA 2JXXA 2L1AA 4RGTA 2WS3B 1ENFA 4OZAA 3UQBA 4G11A 5HHDG 4WQMA 2JPHA 1JCKB 2IY1B 2J0JA 3J9CA 5D94A 2DZMA 5EE9A 1RM6C 3KYDD 2XBBC 4YSXB 1YMHE 4MGYE 1WMHA 3A4SC 1XT9B 2L0FA 3NG0A 3QHTA 4FHJA 1T0YA 4TKNA 3ZKJC 1WGYA 1NYRA 2WX0A 3GZNI 4ZHOA 1SF0A 3PO0A 3DBLI 4UDUC 3MTNB 2K3UA 3VHTC 3L4PA 2M17A 1WYGA 2M19A 4YSYB 4RF1A 3A1QB 2EELA 2J0MA 2MBQA 4HDOA 1V80A 1J7BA 4IM3A 4NJ7A 5L95C 3TCAA 5EE1A 1WZ0A 2L3ZA 2IBIB 4JLCA 4FN2A 2LJ5A 4K3BA 3B2GA 3U7ZA 2AYOB 1CZPA 3PTFC 1I4RA 3DDCB 3N1YC 4XDCA 2BQQA 3L10B 2QIEB 3TL5A 2HJ1A 2R2OA 4HPLB 5JXVA 3ZJTA 5GMVA 2X8XX 1TZOA 2RD0A 2KMCA 3A9KB 3VH3B 2CHWA 2K8CA 4YSZB 3E56A 2KX3A 3DOWA 3TJPA 2NPTA 2N9PC 4KSKC 1EF1A 3EHVA 4MH0E 3ZGZA 2ZJDA 5G5GA 2PVOD 1TJEA 3EA6A 2G4DB 3DVNU 1TT5B 3PLUA 4LNIA 4MSMB 3W5VB 2DENB 3ML8A 3H7PA 4BBNC 3ZIMA 1CQVA 3ZXVA 2XNAC 3EFCA 4M02A 1RFKA 1XCTL 3P2BA 1SB3C 2KTFA 1KJTA 3Q14C 2CU3A 5C23A 2ONQA 3N3KB 2Z0EB 2ZW1A 3AE4B 2NCNA 2RPQA 5CHFA 1WJ4A 1V86A 2LD9A 3APDA 3V61A 2WXFA 4RM9A 4N6EB 4S0RA 2YLMA 3QAQA 4US9A 3NVVA 1YX5B 1MI0A 2UWQA 4JL9A 4BAXA 1E8XA 1V49A 3BZDB 2L00B 4M0WA 2D2QA 4KDIC 4GDLA 1HZ6A 2AX5A 1WGDA 4FHKA 3AN1A 3IAS1 2YVCA 1S3SG 5T8IA 3U2SC 4ZRQA 3OLMD 3IT4B 3T3NA 3Q8BA 3BVMA 2BBCA 3JVZX 1WR1A 1C4CA 1ISNA 2JQRB 2INPE 5E6PA 1E10A 3FKYA 5D6JB 4HKZE 1PGAA 3TUOA 5DPRA 1E9MA 4K81A 3V6EB 2YEPB 3AXCA 2N9EB 4NJ6A 1L5PA 2AQ1B 2D11A 1L2NA 2M4NA 4PYZA 5G55A 4RCOA 2LGSA 1WXMA 3DBRB 2V1YA 4ICUA 3N9YC 3P42A 3B08A 3EGRA 3AU5A 2WDVB 4P7IA 5IO9A 2LJIA 2LVPA 1ZOYB 4JX1C 4DHZE 2GBMA 5G5HA 2C7HA 3Q3JA 2DZKA 2LUEA 3B9JA 4B9KA 3K9PB 1F52A 4WWOA 3KW5B 2AL3A 4DQOC 3SDLC 2WXOA 1UWXA 4GGQA 4RFBA 1HEZE 5MPOA 4WWPA 4FULA 1V1PB 3LB8C 4YT0B 4CQNA 1J19A 4NPNA 1JWAD 4M8NA 1WX9A 1T0SC 3WALA 1J8CA 2NPTB 3BIID 4WWMA 4II3B 3P1MA 2G45B 2LEKA 4HJGE 4X57B 1PGBA 2ZW0A 4W9CA 3C8YA 1WSPA 2MP2A 1IPGA 3M62B 3CWIA 1XLOA 4KVGB 2RMMA 2JWUA 3LYYA 1H4RA 1K50A 3VR8B 1UWMA 1P98A 3DHHC 4P1CC 2WDQB 4XC2A 2OHFA 2VH1A 1V5TA 4RGNA 3UIOB 4W9HA 2EKIA 2BS3B 1VZ7A 1DGJA 4A3OA 3P4RB 2M8SA 1VDVA 3RUIB 1FRRA 3WIMA 2AL6A 4CHKA 1P7EA 2J52A 4L23A 1KLVA 2WXGA 2WQYB 1TS2A 1L4DB 3TEWA 4DBGA 4GDLB 1I4GA 5BYSA 2KTRA 1V2YA 2MBEA 2GBRA 3UGBB 4JIOU 2CJOA 5BMGA 2PVGC 4W9DA 1E90A 3ZNGC 2MHJA 2N1VA 2QSDA 4MACA 1D6EC 3H1UA 1UH6A 4ZRIA 3VQIA 2IDYA 2IJ0A 5CTRC 4XGAB 1L4ZB 1AYFA 3WAPA 3DQVA 5FR6A 1LFDA 5DPWA 2GLSA 2MBOA 3RYTA 1V9JA 4JWSC 2K6QA 2Z59B 3P4PB 2DNFA 4ZDVA 2WXRA 1P7FA 2K1FA 4N9F4 5EE3A 1GG3A 2BYFA 2J4XA 4EE2A 2FAZA 4EUTA 3H8HA 2O6VA 2A4ZA 4DXGA 1K52A 4IUMB 2KKCA 1HZ5A 1SIJA 2KDMA 4MELA 4E71A 1V1OA 2IO3B 4BKSD 4HPPA 4CO7A 2KZRA 4C56C 3ZXRA 2KLCA 4LTUA 2LWPA 3CIRB 3ZO5B 1RFAA 2DAFA 2CHXA 3Q8CA 1XQQA 2JX5A 1WJUA 1PUTA 3W1SC 1P1AA 2RR9A 4J3OD 1TGZB 2RDGA 3ZDMC 1D5MC 2ASQA 4JQWC 3NVWA 2UU7A 4QAYA 2LI5A 1SJHD 3PPAA 2KNBA 2LUMA 2E6XA 2N7EA 3P63A 3H6NA 3GOEA 2N9LA 2AQ3B 4P16A 4PS3A 3W2DA 3GB1A 5D3DA 1WM2A 1YJIA 2ZVOA 2IGHA 2KQ7A 1M94A 4YWGG 1VJKA 1EF5A 1WGGA 3SD5A 2D3BA 4ICVA 3DBSA 2MP2B 2ZEQA 2JYTA 4A20A 4LCDE 4XWTA 2KDBA 4YL8A 4TQ1A 3I9V1 3Q8FA 4REZA 1Y8RC 1JWSD 5KHOA 4M8MA 4EZKA 3DWGC 1E5WA 1N5WA 3UINB 4IWPA 1V97A 2PJHA 1F2RI 1WXVA 1WI0A 1EU3A 3OAWA 1EUVB 4MGKE 1STEA 1IBXB 4HVBA 3DBHI 1Y56A 2J0KA 2WDRB 1ROEA 2MWSB 2KC2A 3BK2A 4LNNA 3O13A 5E6NA 2ZPYA 5L83A 3AECB 2MW5A 1FXIA 2PMVA 1SE3A 1WXSA 2LXCA 3Q3MC 3JSVA 4JGHB 4A6QA 5LXHA 2MEKA 4MGIE 1WR6E 2Y5CA 1UELA 3PV1A 2D3CA 4TQ0A 3DVGX 1TIFA 1FNUA 3IFWB 2BW2A 3KYCD 4TSSA 1FD6A 3WCQA 2TSSA 3V62A 4DHJD 5LXIB 3I63C 3N1ZC 2NBVB 1K51A 4FJZA 4G3XB 4XE0A 2WU5B 2J53A 2PTLA 1F1HA 2KFKA 3DVNV 1JWBD 1TY0A 2LZ6A 3EC8A 4M01A 1D5ZC 1ZUD2 3DVGY 2BT6A 2M0AA 1TYGB 3WANA 2L83A 5C1ZA 1BMLC 2NR2A 3H9DA 5EE0A 1YJ1A 2FBWB 2G4SA 2R2QA 4NAWA 2G3QB 3QARA 3AEFB 3B0AA 5D3IB 3RNBC 1NDDA 4FADA 2O6VB 4XX5A 1RAXA 2KX0A 1IUEA 1MVKA 4H2AA 2MJDA 3AU4A 4AJWA 1GC7A 5CHVC 5AZGA 1GC6A 3L0WB 3DWMA 1UZXB 4ZRPA 1AARA 4DDID 2KDIA 1JWMD 3NOBA 5J17A 4DHZB 3ZJVA 4TMAB 2JVCA 1SBBB 1GAQB 2KJ6A 4ACFA 1ZXIA 1UF0A 3PZ7A 3AULA 3H7SA 2ACZB 4KKIA 4WH4A 4XWWA 3HRDD 4D2KA 4M00A 3KUCB 2KVZA 2MJ3A 3V05A 4BBNF 2BPSA 2JU6X 2IPKD 3SFEB 4YTMB 2FCQA 2G1EA 3URYA 4IM2A 3A9JB 4OHJA 5BYRA 3K9OB 2WHIA 3EECA 4RMAA 4HKQA 2LFIA 4KIKB 1FEHA 3U4EG 1WE6A 2FIDA 4BOZB 5BMIA 2GMIC 4RGMA 3X0WA 1YQ4B 1GJZA 3KUZA 5AUKA 2QDFA 1GUAB 3IT6B 5AZHA 4LJOB 5IN7A 2R61A 4E3CA 1GB1A 2KD0A 3FAHA 2FCSA 1HE8A 1AN8A 1SEBD 2JZZA 2BGFA 4GDKA 1L0XB 2BWES 2Y3AA 2J7QB 4IOIE 3ZNZB 1E7PB 1EWYC 4O1NA 1FM0D 1J0GA 4E74A 3Q3NC 5IP4D 3DHIC 1OEYA 2GBJA 3CSFA 1MG8A 1R7SA 2MLBA 3VRBB 4YTNB 3VTWA 1E7UA 1I42A 3CMMB 3KUDB 5TSSA 2MCNB 3GP7A 4MEMA 1VD2A 4JPSA 1R4MI 2LGDA 1TKYA 3TSSA 3ZNHB 1F9JA 4MDKE 2V3SA 4EEWA 2FCNA 2XK5B 3ZQ4A 2KFKB 4LNOA 1QF6A 1I7HA 2IGGA 2EMTA 5HG2A 4BOSC 3Q8AA 3U52E 2PEAA 4GMVA 1PDXA 4GSWA 2BB6A 2K8BA 3E9SA 3ZLZA 1TS3A 4OVZA 4PS7A 3X23A 1KTKA 3RZWC 4ARIA 4GN1A 3NUHB 4C00A 1R4NB 1TS5A 5JHBA 2H88B 3ZRFA 4LNKA 2PLPA 1C76A 1Q10A 3CSTA 2ZCBA 4C7ZA 2LVOA 4W9LA 1VR9A 2JT4B 1A5RA 1WMHB 4MT5A 3HVZA 1YX6B 2NBWB 4J6IA 2E3TA 2NTTA 4LDTB 2C7NB 2K0PA 1BXTA 2V0GA 4OZCA 3AM9A 4FBJB 1C9FA 1TKGA 3T9LA 3Q2AC 3RN9C 2HTME 1QOAA 2AWTA 3HIZA 2KN5A 3Q69A 2H89B 2D3AA 1FFVA 3TIXA 2INDC 4S17A 2KFJA 2C9WB 1VRAB 2V3PA 4IKGA 4I6PA 2W3RA 2O2VA 1K53A 2WXKA 2VZKB 2J42A 3C0RB 4WAAA 4MJSA 3Q6BA 1JQ4A 1WWTA 3A4RA 5D7GA 1WYWB 2Z0DB 2BTEA 2KYWA 3PVLA 1TS4A 3AE8B 2WXMA 2N1WA 1HTQA 1P0RA 2O6VD 4DWFA 1FMAD 2IYDB 3NY5A 1AW7A 2LMCA 2QJLA 4AOFA 1XD3B 1IYFA 2WXJA 1WRIA 3BY4B 1Z2MA 1XLPA 1QILA 2IZVB 4GDKB 2BYEA 4K3CA 1YN5A 3U30A 4DHJB 1FIQA 1LM8B 2HE7A 2KMAA 3TMPB 2Z8LA 3H7PB 2KLGA 3ENEA 4TUUA 3VR9B 1ZDVA 4W9EA 3AEEB 3M95A 3AE5B 3KQ4A 4KDLB 1WE7A 3NS1A 1YN4A 1Q5WB 4GOCA 4EOYA 2KC1A 1VZ8A 2N7JA 2INNE 2QEJC 1N63A 3AEBB 4W9GA 4N59A 3L17A 4NJCA 3VTUA 4W9KA 1QKZA 2D3GA 1V8CA 3RNAC 3WAOA 2WXLA 1U4AA 2ICIA 3ETRA 2XEWA 4M0WB 5JZEB 3HM3A 3QJZA 1OQRA 1I4XA 3O65B 4ZHPA 4NY0A 1JALA 2IY0B 2WDTB 3OWEB 2IGDA 2W54A 3GE3C 3RULA 2OEDA 3AE6B 1CMXB 1QZEA 1G6JA 1C77A 2KO3A 2INCC 1QQRA 2IO1B 3HM6X 1UGMA 3JW0X 4KZCA 3NZSA 1YJJA 5HFYA 3APFA 3VH4B 3L08A 3VDZA 1LQBA 2D10A 2JZ3B 3TEXA 3T3OA 3BYTB 3RI7C 3DBLB 1ZGUB 4US8A 3N32A 4HCPB 1TTNA 4IG7B 1TBEA 3AEAB 2KDFB 2DX5B 2KAJA 3VUXA 2PE9A 1ZKHA 2IO2B 4HROA 1SE9A 4URKA 2N7DA 1PFDA 5KHQA 2KANA 2Q5WD 1L0VB 4RGOS 1JW9D 2WXNA 4MGZE 1NI2A 2V3NA 4W9JA 1E8ZA 4ANXA 3UQAA 3L13A 2KHWB 3U7DA 1T3QA 1GNUA 2X38A 2KVRA 1QOFA 1A70A 1NVID 5IA7A 2FUHB 4RNAA 2BKRB 5C3JB 2I2YA 3EUB2 5C2TB 1ZE3D 3M63B 1QOBA 2MSED 2LHEA 2GRIA 3AH7A 4II2B 1D3ZA 1LGRA 2N0SB 1SE4A 1I35A 3B2FA 3RT3B 3LJ3A 3IVFA 1T0QC 1DYQA 2YEPF 4WIPA 4WQOB 1D4BA 4G50A 4K7WA 3WA0A 1FRDA 2LRWA 4YXDB 3RNCC 3NZ3A 1E6EB 5AZFA 3KH0A 3APCA 5EDSA 3C19A 3VXWA 5JHAA 4LDTD 1D5XC 3KWVA 4RH6A 3HVDA 3ONSA 1B1ZA 2ON8A 3QQ8B 4GB9A 1EU4A 2B3AA 2UYZB 4LNFA 5AEKB 4C4VA 2MBHA 4K1RB 1B9RA 3DBRI 5I4DA 3HUIA 2Y5BB 1C4AA 1L6VA 3BINA 2C5LC 2VZKD 2ZPNA 1XXGA 1NENB 3QCAA 4L2YA 5D2MB 1RRBA 2LXAA 3PZ8A 3NHEB 3D32A 1KRHA 1HA5A 3BYYB 2KWVB 2KN4A 1UD7A 4AQ7A 1WIAA 2A5UA 3PGEA 1ZP0B 3IAM1 3ZVVA 2QC8A 2KTRB 2GI9A 2L32A 4OZBA 1KOTA 4WURA 3DPDA 3VUWA 2K25A 2DYBA 2BB5A 2JZPA 1KH0A 1C4PA 3QK0A 2QMTA 4HK2A 2NTSA 2SEBD 1RWSA 4KSLC 4A8XC 2M0XA 4ITKA 3LDZE 3B1LX 1IGCA 2DLBA 3W1SA 1FFUA 1T0RC 4EZJA 1CJEA 1OGWA 4NAMA 1WX7A 2K6DB 4IM0A 3Q3FA 2RDBC 3ZUNA 3R7QA 1XCQL 2K8HA 1RYJA 3RNGC 1Q1OA 3I3TB 1E8YA 5IOIA 1GB4A 3R2TA 1PGXA 3R66C 1EM7A 1GOZA 2PKOA
chains in the Genus database with same CATH topology
4A9AA 3IXSA 3TSSA 1XLNA 3RPFC 2ZW0A 4HEA1 3TEZA 3C8YA 1FNWA 1WSPA 3ZQ4A 4C7YA 1QF6A 3CWIA 1I7HA 1XLOA 1VLBA 2RMMA 2IGGA 2W3SA 4JE3B 5HG2A 2JWUA 3Q8AA 3U52E 3LYYA 1MPEA 1K50A 1PDXA 1TKEA 3VR8B 3SFDB 1FO4A 1UWMA 2L52A 1ESFA 1QLBB 2WNMA 2BB6A 2JSVX 3E9SA 1KFYB 1TS3A 4OVZA 2WDQB 4FXCA 1KTKA 2OHFA 4ARIA 1J7AA 3NUHB 4MH8A 4RGNA 4LK0M 1I4HA 4KX6B 2EKIA 2BS3B 3FILA 1VZ7A 1DGJA 3P4RB 1TS5A 4RF0A 1VDVA 1T5XD 4LLGM 2H88B 2PLPA 1C76A 1QT9A 1Q10A 4ARCA 1L0YB 1FRRA 4C7ZA 4R3DA 1OFFA 1P7EA 5E6JA 1E0ZA 2GB1A 2PW9A 1VR9A 2J52A 4L23A 4P6VF 1FCLA 2WXGA 2WQYB 4MT5A 1ZXHA 1KF6B 3HVZA 3BVZA 1TS2A 1L4DB 3TEWA 1OQQA 2WXPA 4GDLB 1I4GA 3MC0B 5FKAC 5BYSA 2E3TA 3P4QB 4WAFA 1ET6A 2NTTA 3SR6A 2K0PA 1BXTA 2V0GA 3MJ5A 4OZCA 3AM9A 1C9FA 2WXQA 1TKGA 2CJOA 2Y5PA 1NYQA 1WGKA 1TY2A 5BMGA 2PVGC 1CK1A 3AE9B 2HTME 2QSDA 3KLSX 1QOAA 1C78A 2WLBA 1EWCA 2CJNA 3Q69A 4MACA 4XDDA 2WXIA 3GS2A 1D6EC 4Q2JA 2H89B 1WXQA 1FFVA 3VQIA 2QILA 2IDYA 2IJ0A 1FXAA 2JYEA 1L4ZB 1AYFA 1VRAB 3AE3B 4HRSA 2V3PA 2B76B 4IKGA 5BMHA 2W3RA 1K53A 2WXKA 2VZKB 2J42A 2G9HD 1N62A 2WP9B 3W9CB 2HDEA 2MJEA 3AV8A 3AE2B 4JWSC 2KMMA 1UUPA 2DYMA 3P4PB 4A55A 1M4VA 1WWTA 1JQ4A 2WXRA 1P7FA 2V4IB 5D7GA 1F2RC 2BTEA 5LNK1 1TS4A 1V1PA 3AE8B 2WXMA 1F77A 2XN9C 5EE3A 1HXYD 4PT5A 3P4SB 1L6UA 1XF5L 1FMAD 1ZPSA 2J4XA 2KQ4X 1AW7A 2LMCA 2QJLA 4EE2A 1KLGD 1MHXA 5H8YE 3H8HA 1GPXA 4DXGA 2BYTA 1LO5D 1K52A 2WXJA 1WRIA 1JWUD 4C80A 2WU2B 1HZ5A 1SIJA 2KDMA 3ABVB 4IDIA 1PYWD 1V1OA 1XLPA 1QILA 4C56C 3MHZA 4GDKB 2M56B 1DOXA 1YNTE 4LTUA 3AB5A 3CIRB 1SXTA 1VZ6A 1YN5A 3Q8CA 4KGSA 2JX5A 2K5PA 2NMQA 1FIQA 4N58A 1N60A 1PUTA 4ZYSA 1NEKB 2Z8LA 3AEGB 4MM3B 1UNSA 4J3OD 2FE8A 1ZDVA 2RDGA 3VR9B 3AEEB 1D5MC 3NVWA 2L1AA 4RGTA 2WS3B 1ENFA 1C79A 4OZAA 1SJHD 3AE5B 5HHDG 1DOYA 4WQMA 3KQ4A 1IGDA 2E6XA 2LUMA 1JCKB 4NAWB 3NS1A 3J9CA 1YN4A 3P63A 1JRPA 4A90A 2N9LA 5EE9A 2AQ3B 4NZLB 4P16A 3W2DA 3GB1A 5D3DA 1RM6C 1YJIA 2IGHA 1VZ8A 2N7JA 4YWGG 1VJKA 2INNE 2QEJC 1N63A 4YSXB 1YMHE 3AEBB 4N59A 4NJCA 1T6BX 1QKZA 5H92C 1JROA 1V8CA 5AUIA 2JYTA 2K9XA 1NYRA 3R8BA 2WXLA 4KGRA 4XWTA 4TQ1A 3I9V1 4ZHOA 2ICIA 1SF0A 3Q8FA 3ETRA 3PO0A 4REZA 4UDUC 1JWSD 4USAA 2K3UA 1OQRA 1I4XA 3MP9A 3L4PA 5FR3A 3DWGC 1N5WA 4ZHPA 1V97A 1WYGA 2M19A 1JALA 4YSYB 3I57A 3OWEB 4RF1A 1F2RI 2EELA 2W55A 2IGDA 1EU3A 2FUG1 2W54A 1J7BA 2OEDA 1XO3A 3AE7B 3AE6B 1STEA 1SSNA 1IBXB 1Y56A 1I4QA 3R2IA 1C77A 2WDRB 3FILB 5EE1A 1ROEA 1QQRA 4L1BA 1DOIA 1YJJA 5HFYA 3BK2A 3B2GA 3U7ZA 3O13A 1CZPA 4KKJA 1I4RA 3AECB 3TEXA 2MH7A 1NI3A 2N9KA 3T3OA 3BYTB 3BWUD 1FXIA 4XDCA 2PMVA 2LGIA 1SE3A 4US8A 4GLSC 4A6QA 2MEKA 2QIEB 2AQ2B 5JXVA 3ZJTA 2Y5CA 3AMZA 3AEAB 3NVYA 4TQ0A 2KAJA 1TZOA 4HROA 1HQRD 1FNUA 2BW2A 1PFDA 4TSSA 4YSZB 3E56A 2Q5WD 1L0VB 4RGOS 1JW9D 4B0EA 1FD6A 3BK1A 3WCQA 2WXNA 2V3NA 2TSSA 3ZGZA 1K51A 5G5GA 2PVOD 1T3QA 1TJEA 3EA6A 2X38A 2BS2B 4DXFA 3W5UB 4XE0A 1QOFA 2WU5B 2J53A 1A70A 1NVID 3W5VB 2PTLA 3Q8EA 2KACA 4RNAA 1JWBD 5C3JB 2D5GA 1TY0A 2I2YA 3EUB2 1QOGA 1ZE3D 5C2TB 1D5ZC 1ZUD2 1CQVA 2BT6A 2RPVA 2M0AA 1QOBA 2XNAC 1TYGB 2L83A 2KWDA 1RFKA 1BMLC 2LHEA 2GRIA 2WXHA 3AH7A 1AWDA 1XCTL 1SB3C 5EE0A 2DBYA 2N0SB 2FBWB 2CU3A 1YQ3B 2ONQA 3KWLA 1SE4A 3ZYYX 3B2FA 2ZW1A 3AEFB 3AE4B 5D3IB 2RDHA 1F0ZA 1DYQA 2YEPF 1J7CA 4WIPA 1ET9A 2WXFA 1D4BA 1IUEA 4N6EB 1FRDA 1MVKA 1KLUD 4YXDB 4H2AA 4US9A 2MJDA 3NVVA 1MI0A 3NZ3A 5FK9C 1E6EB 2PIAA 4ZOHC 3BZDB 3DWMA 1D5XC 1N61A 3KWVA 4ZRPA 4M0WA 4RH6A 3HVDA 1JWMD 1B1ZA 2ON8A 1HZ6A 3ZJVA 4TMAB 2AX5A 1EU4A 1SBBB 3AN1A 3IAS1 1GAQB 5T8IA 3FC4A 1ZXIA 2W82A 1BUIC 3U2SC 3PZ7A 3AEDB 1XLQA 1B9RA 4KGTA 4ZRQA 1IBXA 5I4DA 3IT4B 3NRZA 2ACZB 3T3NA 3HUIA 3Q8BA 3BVGA 4KKIA 3BVMA 2BBCA 1C4AA 4WH4A 4XWWA 3HRDD 1C4CA 4D2KA 1L6VA 1MHHE 2JQRB 2INPE 1E10A 2VZKD 1XXGA 1NENB 4HKZE 4L2YA 2MJ3A 3V05A 5BYQA 2DWQA 1PGAA 3TUOA 3PZ8A 2JU6X 2IPKD 3SFEB 5HI1A 1E9MA 4YTMB 1KRHA 2G1EA 1HA5A 2YEPB 3BYYB 3URYA 2KN4A 1XEEA 4OHJA 5BYRA 1FNVA 1L5PA 2AQ1B 4AQ7A 5GXGB 3V3XA 1ZP0B 3IAM1 4HKQA 2LFIA 4RCOA 1FEHA 3UI3A 3U4EG 1YN3A 4JWUC 3AE1B 2GI9A 5BMIA 2L32A 3N9YC 4OZBA 3P42A 4WURA 3NVZA 4RGMA 2K22A 2BS4B 1YQ4B 1SJED 3EGRA 2WDVB 5AUKA 3RFZB 3IT6B 3MFGA 2LJIA 2BB5A 4AS1A 2JZPA 1SE2A 1ZOYB 2R61A 3TEYA 4JX1C 1KH0A 1GB1A 1C4PA 2QMTA 3FAHA 5G5HA 2NTSA 2SEBD 3SEBA 1RWSA 1ACCA 1AN8A 1SEBD 1N5XA 3B9JA 4A8XC 1L0XB 1ZDXA 2LHDA 4ITKA 2Y3AA 1FCCC 3VRAB 1IGCA 2DLBA 3W1SA 1FFUA 4IOIE 1E7PB 1EWYC 4O1NA 4DQOC 1FM0D 2WXOA 4B0MA 1CJEA 4NAMA 1UWXA 3LXFA 2JXTA 1XCQL 1RYJA 4RFBA 1HEZE 1R7SA 5MPOA 1V1PB 3VRBB 3LB8C 4YT0B 4YTNB 4CQNA 1JMLA 1I4PA 1JWAD 1GB4A 3R2TA 5TSSA 4OW0A 3GP7A 1PGXA 3BIID 4WWMA 1EM7A 1GOZA 2SAKA 3P1MA 2DYOA 2PKOA 2I38A 4JPSA 1UGJA 2LEKA 4YTPB 4HJGE 3ZJUA 1TKYA 1PGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFY A;  2ZW0 A;  1XF5 L;  1IBX A;  4KGT A;  2KQ4 X;  2N9K A;  1MHX A;  2RMM A;  4WH4 A;  2LGI A;  2IGG A;  1K52 A;  4D2K A;  1MHH E;  4GLS C;  5HG2 A;  2JWU A;  1MPE A;  1HZ5 A;  2KDM A;  4HKZ E;  1K50 A;  5JXV A;  1PGA A;  2JU6 X;  5HI1 A;  2JSV X;  1YNT E;  2KN4 A;  4KGS A;  2NMQ A;  1FD6 A;  3FIL A;  3V3X A;  1K51 A;  3UI3 A;  2PLP A;  1Q10 A;  2GI9 A;  5BMI A;  4OZB A;  2J53 A;  1P7E A;  2GB1 A;  2PTL A;  2PW9 A;  4OZA A;  2J52 A;  5HHD G;  2KAC A;  2LUM A;  1IGD A;  1FCL A;  1ZXH A;  2I2Y A;  2RPV A;  2N9L A;  2JZP A;  3GB1 A;  1GB1 A;  2KWD A;  1KH0 A;  2LHE A;  2IGH A;  2N7J A;  2QMT A;  1XCT L;  2K0P A;  1YMH E;  4OZC A;  1C9F A;  2ONQ A;  5BMG A;  2LHD A;  1QKZ A;  2ZW1 A;  2QSD A;  1FCC C;  1IGC A;  4MAC A;  4KGR A;  4IOI E;  1D4B A;  1MVK A;  1UWX A;  3MP9 A;  2JXT A;  1XCQ L;  1HEZ E;  1MI0 A;  4IKG A;  5BMH A;  1F2R I;  2EEL A;  2IGD A;  1K53 A;  1JML A;  2OED A;  1GB4 A;  1IBX B;  1PGX A;  1EM7 A;  2ON8 A;  3FIL B;  1P7F A;  1HZ6 A;  1F2R C;  2I38 A;  4HJG E;  1PGB A; 
#chains in the Genus database with same CATH topology
 1WY8 A;  2HJ8 A;  3RPF C;  2NVU I;  3TEZ A;  1OTR B;  3NS8 A;  3HK0 A;  1WGH A;  3PT2 B;  1VLB A;  4MSQ B;  4DK5 A;  2W3S A;  4JE3 B;  3IBE A;  3SFD B;  2JUO A;  1ESF A;  4BZA A;  2WNM A;  2I1K A;  1YIW A;  4FJY A;  2WWZ A;  4FXC A;  1WXA A;  4MH8 A;  1P9D U;  1I4H A;  1OEY J;  3FIL A;  3MJW A;  4IW0 A;  4RF0 A;  4AJY B;  4LLG M;  2ZNV B;  3N20 C;  1QT9 A;  4ARC A;  1L0Y B;  5IKC M;  2PPH A;  3NJT A;  1OFF A;  2PW9 A;  4P6V F;  1MG4 A;  3UIP B;  1ZXH A;  2JWZ A;  2WXP A;  1WFY A;  3MC0 B;  3P4Q B;  2RSU A;  4HDQ A;  2MA9 B;  4WAF A;  1ET6 A;  1SIF A;  4W9F A;  3SR6 A;  1WJ6 A;  3MJ5 A;  4C4V B;  2WXQ A;  1YQB A;  4F8C B;  1NYQ A;  1WGK A;  1KM7 A;  4XYC A;  5JH5 C;  3DCG A;  2JF5 A;  4TV3 A;  2CHZ A;  3KLS X;  1C78 A;  1EWC A;  2CJN A;  1MFW A;  3V60 A;  1WJN A;  4Q2J A;  4WJO A;  1WXQ A;  2QIL A;  2JYE A;  2B76 B;  2C60 A;  2G9H D;  2WP9 B;  3W9C B;  1FPY A;  2HDE A;  4K7U A;  3AE2 B;  2EKE C;  1YOV B;  3ZNI D;  1UUP A;  1M4V A;  2V4I B;  1Q0W B;  1V1P A;  2REX A;  3JSV B;  4PT5 A;  4ANW A;  4WJQ A;  1L6U A;  1RLF A;  4ZRK A;  2V9H A;  2BWF A;  1ZPS A;  2KQ4 X;  3U8Z A;  1EO6 A;  1KLG D;  5H8Y E;  1LO5 D;  3RNF C;  4C80 A;  3ABV B;  4IDI A;  1PYW D;  2DHZ A;  2AEH A;  3IHP C;  1WZ3 A;  3OJ3 A;  2OOB B;  2M56 B;  1DOX A;  1YNT E;  4KZ0 A;  1SXT A;  3SU8 X;  3VTV A;  2L76 A;  1N60 A;  1MJD A;  4ZYS A;  1NEK B;  4ZRJ A;  2M1M A;  2RGF A;  4HPM B;  3WAM A;  1UNS A;  4W9I A;  3ECI A;  2FE8 A;  2GBK A;  1WH3 A;  2JRH A;  3QC8 B;  4G0N B;  2N9X A;  2W9N A;  1C79 A;  1PQS A;  1DOY A;  1IGD A;  4NAW B;  1JRP A;  3OJ4 B;  4AWJ A;  2OJW A;  3ML9 A;  1C3T A;  3DHG C;  4A90 A;  2KQS A;  1H8C A;  4NZL B;  4F7Z A;  4I6L B;  1WF9 A;  1E7V A;  3ZTD A;  1V6E A;  2FNJ B;  1T6B X;  2L05 A;  1K8R B;  3VFK A;  4PYU A;  5H92 C;  1JRO A;  2DZJ A;  5AUI A;  4AP4 C;  2K9X A;  3PRM B;  1UBI A;  4LJP B;  3R8B A;  1IP9 A;  4KGR A;  4NNJ B;  3S2A A;  4USA A;  3MP9 A;  5FR3 A;  3RZF A;  3EFU A;  3I57 A;  2W55 A;  3QX1 A;  2FUG 1;  1XO3 A;  2FCM A;  3AE7 B;  1SSN A;  1I4Q A;  3R2I A;  3FIL B;  3VUY A;  2CR5 A;  3VAW A;  2LVQ A;  4L1B A;  1DOI A;  2MBB B;  5J18 A;  3L54 A;  3PHX B;  4KKJ A;  5CHW A;  2ZVN A;  2C7M B;  2MH7 A;  1NI3 A;  2N9K A;  2HTH A;  4KV2 A;  3BWU D;  3ZRC A;  1BT0 A;  2LGI A;  4GLS C;  2AQ2 B;  4XZ4 A;  3R3M A;  3AMZ A;  3NVY A;  1HQR D;  2LGX A;  3DBH B;  2ZZP B;  4B0E A;  3BK1 A;  2JY6 A;  5DPT A;  2DZI A;  4NQL B;  2BVC A;  4K7S A;  2BS2 B;  4DXF A;  3W5U B;  3Q8E A;  2KAC A;  3I5J C;  4P1B C;  2D5G A;  1TZ1 A;  1QOG A;  4EZL A;  3L16 A;  2RPV A;  3RD2 A;  4A3P A;  2KWD A;  3T8M A;  2WXH A;  1AWD A;  4HLE A;  2DBY A;  1YQ3 B;  2BF8 B;  2CU1 A;  3KWL A;  3ZYY X;  2FIF A;  2RDH A;  1F0Z A;  1J7C A;  1ET9 A;  2MQJ A;  2KOX A;  2KWU B;  2KJH B;  1KLU D;  1WX8 A;  5FK9 C;  2NS5 A;  2PIA A;  4ZOH C;  3QWZ B;  5HKH A;  1N61 A;  4IWQ A;  4RM8 A;  3RNE C;  1ZW7 A;  4AUQ C;  2WX1 A;  3OG5 A;  5DPS A;  3PLV A;  1FXT B;  3FC4 A;  3GE8 C;  1X1M A;  1BUI C;  1OQY A;  2W82 A;  3AED B;  1VCB A;  1XLQ A;  3PRP B;  4KGT A;  1IBX A;  3NRZ A;  4CYE A;  3HHM A;  2CKH B;  3BVG A;  1MHH E;  2ZNV C;  1N6Z A;  2L8J A;  4WWN A;  5BYQ A;  2DWQ A;  4WJN A;  2HD5 B;  5HI1 A;  2VH2 A;  1XEE A;  3JYU A;  4DDG D;  1FNV A;  4PK1 A;  3GZN B;  5GXG B;  3V3X A;  1L7Y A;  2BYV E;  3UI3 A;  1YN3 A;  4JWU C;  4HXD A;  3PZD A;  3AE1 B;  2WGS A;  3UF8 A;  3NVZ A;  4FLH A;  2K22 A;  2BS4 B;  1SJE D;  3RFZ B;  4ASW C;  3MFG A;  1YD8 U;  5TR5 A;  4AS1 A;  2D07 B;  4F1S A;  1SE2 A;  3TEY A;  2NBU A;  4ANU A;  2K39 A;  3TBL D;  4GU2 A;  3SEB A;  1ACC A;  5LLI A;  1N5X A;  1ZDX A;  2LHD A;  1FCC C;  1C1Y B;  3VRA B;  2GOW A;  2O2V B;  1V5O A;  1NBF C;  4NQK E;  4MJS B;  4B0M A;  4MM3 A;  4ANV A;  3ZTC A;  3LXF A;  2JXT A;  2I1J A;  2BKF A;  3KVF B;  3ZW3 A;  2OJR A;  3PRE A;  4EKU A;  1JML A;  1I4P A;  5IAA C;  1E8W A;  1SGH A;  4OW0 A;  2WYQ A;  2LRU A;  3W1Y A;  2SAK A;  4EFO A;  2DYO A;  2I38 A;  1UGJ A;  4YTP B;  3ZJU A;  4A9A A;  2QHO A;  1R4N I;  3IXS A;  4ZYN A;  1XLN A;  4OVU A;  4HEA 1;  3QIJ A;  1FNW A;  5E6O A;  4C7Y A;  4FJV B;  3SHQ A;  5BO4 B;  1MPE A;  1TKE A;  1FO4 A;  2L52 A;  3QA8 A;  1QLB B;  2L7R A;  2ZCC A;  4BKG A;  4HJK A;  2JSV X;  3A1Q A;  1KFY B;  1J7A A;  1R4M B;  4LK0 M;  4KX6 B;  5J2R A;  1JRU A;  2VRR B;  4FA6 A;  1T5X D;  2LAS A;  3N30 A;  2N4F A;  1S1Q B;  3A9J A;  4R3D A;  5E6J A;  2KWC A;  1E0Z A;  2GB1 A;  2DAJ A;  1FCL A;  4KIK A;  1KF6 B;  3BVZ A;  1OQQ A;  2KT7 A;  2MX2 A;  4GXB A;  5FKA C;  2PE6 B;  4BFR A;  3MC9 A;  2JRI B;  3MHS D;  2EMS A;  2KXJ A;  2Y5P A;  1TY2 A;  4GIV A;  1CK1 A;  3AE9 B;  2KK8 A;  3A9K A;  4B6W A;  2L0T A;  1WGR A;  4BVU C;  3A33 B;  2IO0 B;  2WLB A;  4XDD A;  2WXI A;  3GS2 A;  4I6N B;  3VVW B;  1FXA A;  3ALB A;  1P3Q U;  3AE3 B;  4HRS A;  2QCZ A;  3ZDT A;  5BMH A;  2MRP A;  1N62 A;  3PHW B;  2MJE A;  3PS6 A;  1V81 A;  3AV8 A;  3IG3 A;  1WM3 A;  2KMM A;  1Z5S B;  2DYM A;  5DCN A;  4A55 A;  4IC7 B;  3R7R A;  1LXD A;  1F2R C;  4DXA B;  1HTO A;  4IWO A;  3AI5 A;  5LNK 1;  3Q3O C;  3PRZ A;  1UBQ A;  5G2N A;  3MC8 A;  1F77 A;  2XN9 C;  1HXY D;  3P4S B;  1XF5 L;  4WJP A;  3V6C B;  2KDE B;  3CF6 E;  3N1X C;  1MHX A;  1GPX A;  2BYT A;  3RCZ A;  4BKT A;  1JWU D;  2KJR A;  2V4L A;  2WU2 B;  4OVV A;  2XK5 A;  4B95 A;  3NZU A;  3MHZ A;  5CX3 A;  2GBN A;  3AB5 A;  3PSE B;  3M3J A;  2CS4 A;  1VZ6 A;  4BKS A;  4KGS A;  2K5P A;  3RMK C;  4HCN B;  2NMQ A;  4N58 A;  3AEG B;  4HWI B;  4MM3 B;  4PS8 A;  1WRD B;  2LGY A;  2JXX A;  2L1A A;  4RGT A;  2WS3 B;  1ENF A;  4OZA A;  3UQB A;  4G11 A;  5HHD G;  4WQM A;  2JPH A;  1JCK B;  2IY1 B;  2J0J A;  3J9C A;  5D94 A;  2DZM A;  5EE9 A;  1RM6 C;  3KYD D;  2XBB C;  4YSX B;  1YMH E;  4MGY E;  1WMH A;  3A4S C;  1XT9 B;  2L0F A;  3NG0 A;  3QHT A;  4FHJ A;  1T0Y A;  4TKN A;  3ZKJ C;  1WGY A;  1NYR A;  2WX0 A;  3GZN I;  4ZHO A;  1SF0 A;  3PO0 A;  3DBL I;  4UDU C;  3MTN B;  2K3U A;  3VHT C;  3L4P A;  2M17 A;  1WYG A;  2M19 A;  4YSY B;  4RF1 A;  3A1Q B;  2EEL A;  2J0M A;  2MBQ A;  4HDO A;  1V80 A;  1J7B A;  4IM3 A;  4NJ7 A;  5L95 C;  3TCA A;  5EE1 A;  1WZ0 A;  2L3Z A;  2IBI B;  4JLC A;  4FN2 A;  2LJ5 A;  4K3B A;  3B2G A;  3U7Z A;  2AYO B;  1CZP A;  3PTF C;  1I4R A;  3DDC B;  3N1Y C;  4XDC A;  2BQQ A;  3L10 B;  2QIE B;  3TL5 A;  2HJ1 A;  2R2O A;  4HPL B;  5JXV A;  3ZJT A;  5GMV A;  2X8X X;  1TZO A;  2RD0 A;  2KMC A;  3A9K B;  3VH3 B;  2CHW A;  2K8C A;  4YSZ B;  3E56 A;  2KX3 A;  3DOW A;  3TJP A;  2NPT A;  2N9P C;  4KSK C;  1EF1 A;  3EHV A;  4MH0 E;  3ZGZ A;  2ZJD A;  5G5G A;  2PVO D;  1TJE A;  3EA6 A;  2G4D B;  3DVN U;  1TT5 B;  3PLU A;  4LNI A;  4MSM B;  3W5V B;  2DEN B;  3ML8 A;  3H7P A;  4BBN C;  3ZIM A;  1CQV A;  3ZXV A;  2XNA C;  3EFC A;  4M02 A;  1RFK A;  1XCT L;  3P2B A;  1SB3 C;  2KTF A;  1KJT A;  3Q14 C;  2CU3 A;  5C23 A;  2ONQ A;  3N3K B;  2Z0E B;  2ZW1 A;  3AE4 B;  2NCN A;  2RPQ A;  5CHF A;  1WJ4 A;  1V86 A;  2LD9 A;  3APD A;  3V61 A;  2WXF A;  4RM9 A;  4N6E B;  4S0R A;  2YLM A;  3QAQ A;  4US9 A;  3NVV A;  1YX5 B;  1MI0 A;  2UWQ A;  4JL9 A;  4BAX A;  1E8X A;  1V49 A;  3BZD B;  2L00 B;  4M0W A;  2D2Q A;  4KDI C;  4GDL A;  1HZ6 A;  2AX5 A;  1WGD A;  4FHK A;  3AN1 A;  3IAS 1;  2YVC A;  1S3S G;  5T8I A;  3U2S C;  4ZRQ A;  3OLM D;  3IT4 B;  3T3N A;  3Q8B A;  3BVM A;  2BBC A;  3JVZ X;  1WR1 A;  1C4C A;  1ISN A;  2JQR B;  2INP E;  5E6P A;  1E10 A;  3FKY A;  5D6J B;  4HKZ E;  1PGA A;  3TUO A;  5DPR A;  1E9M A;  4K81 A;  3V6E B;  2YEP B;  3AXC A;  2N9E B;  4NJ6 A;  1L5P A;  2AQ1 B;  2D11 A;  1L2N A;  2M4N A;  4PYZ A;  5G55 A;  4RCO A;  2LGS A;  1WXM A;  3DBR B;  2V1Y A;  4ICU A;  3N9Y C;  3P42 A;  3B08 A;  3EGR A;  3AU5 A;  2WDV B;  4P7I A;  5IO9 A;  2LJI A;  2LVP A;  1ZOY B;  4JX1 C;  4DHZ E;  2GBM A;  5G5H A;  2C7H A;  3Q3J A;  2DZK A;  2LUE A;  3B9J A;  4B9K A;  3K9P B;  1F52 A;  4WWO A;  3KW5 B;  2AL3 A;  4DQO C;  3SDL C;  2WXO A;  1UWX A;  4GGQ A;  4RFB A;  1HEZ E;  5MPO A;  4WWP A;  4FUL A;  1V1P B;  3LB8 C;  4YT0 B;  4CQN A;  1J19 A;  4NPN A;  1JWA D;  4M8N A;  1WX9 A;  1T0S C;  3WAL A;  1J8C A;  2NPT B;  3BII D;  4WWM A;  4II3 B;  3P1M A;  2G45 B;  2LEK A;  4HJG E;  4X57 B;  1PGB A;  2ZW0 A;  4W9C A;  3C8Y A;  1WSP A;  2MP2 A;  1IPG A;  3M62 B;  3CWI A;  1XLO A;  4KVG B;  2RMM A;  2JWU A;  3LYY A;  1H4R A;  1K50 A;  3VR8 B;  1UWM A;  1P98 A;  3DHH C;  4P1C C;  2WDQ B;  4XC2 A;  2OHF A;  2VH1 A;  1V5T A;  4RGN A;  3UIO B;  4W9H A;  2EKI A;  2BS3 B;  1VZ7 A;  1DGJ A;  4A3O A;  3P4R B;  2M8S A;  1VDV A;  3RUI B;  1FRR A;  3WIM A;  2AL6 A;  4CHK A;  1P7E A;  2J52 A;  4L23 A;  1KLV A;  2WXG A;  2WQY B;  1TS2 A;  1L4D B;  3TEW A;  4DBG A;  4GDL B;  1I4G A;  5BYS A;  2KTR A;  1V2Y A;  2MBE A;  2GBR A;  3UGB B;  4JIO U;  2CJO A;  5BMG A;  2PVG C;  4W9D A;  1E90 A;  3ZNG C;  2MHJ A;  2N1V A;  2QSD A;  4MAC A;  1D6E C;  3H1U A;  1UH6 A;  4ZRI A;  3VQI A;  2IDY A;  2IJ0 A;  5CTR C;  4XGA B;  1L4Z B;  1AYF A;  3WAP A;  3DQV A;  5FR6 A;  1LFD A;  5DPW A;  2GLS A;  2MBO A;  3RYT A;  1V9J A;  4JWS C;  2K6Q A;  2Z59 B;  3P4P B;  2DNF A;  4ZDV A;  2WXR A;  1P7F A;  2K1F A;  4N9F 4;  5EE3 A;  1GG3 A;  2BYF A;  2J4X A;  4EE2 A;  2FAZ A;  4EUT A;  3H8H A;  2O6V A;  2A4Z A;  4DXG A;  1K52 A;  4IUM B;  2KKC A;  1HZ5 A;  1SIJ A;  2KDM A;  4MEL A;  4E71 A;  1V1O A;  2IO3 B;  4BKS D;  4HPP A;  4CO7 A;  2KZR A;  4C56 C;  3ZXR A;  2KLC A;  4LTU A;  2LWP A;  3CIR B;  3ZO5 B;  1RFA A;  2DAF A;  2CHX A;  3Q8C A;  1XQQ A;  2JX5 A;  1WJU A;  1PUT A;  3W1S C;  1P1A A;  2RR9 A;  4J3O D;  1TGZ B;  2RDG A;  3ZDM C;  1D5M C;  2ASQ A;  4JQW C;  3NVW A;  2UU7 A;  4QAY A;  2LI5 A;  1SJH D;  3PPA A;  2KNB A;  2LUM A;  2E6X A;  2N7E A;  3P63 A;  3H6N A;  3GOE A;  2N9L A;  2AQ3 B;  4P16 A;  4PS3 A;  3W2D A;  3GB1 A;  5D3D A;  1WM2 A;  1YJI A;  2ZVO A;  2IGH A;  2KQ7 A;  1M94 A;  4YWG G;  1VJK A;  1EF5 A;  1WGG A;  3SD5 A;  2D3B A;  4ICV A;  3DBS A;  2MP2 B;  2ZEQ A;  2JYT A;  4A20 A;  4LCD E;  4XWT A;  2KDB A;  4YL8 A;  4TQ1 A;  3I9V 1;  3Q8F A;  4REZ A;  1Y8R C;  1JWS D;  5KHO A;  4M8M A;  4EZK A;  3DWG C;  1E5W A;  1N5W A;  3UIN B;  4IWP A;  1V97 A;  2PJH A;  1F2R I;  1WXV A;  1WI0 A;  1EU3 A;  3OAW A;  1EUV B;  4MGK E;  1STE A;  1IBX B;  4HVB A;  3DBH I;  1Y56 A;  2J0K A;  2WDR B;  1ROE A;  2MWS B;  2KC2 A;  3BK2 A;  4LNN A;  3O13 A;  5E6N A;  2ZPY A;  5L83 A;  3AEC B;  2MW5 A;  1FXI A;  2PMV A;  1SE3 A;  1WXS A;  2LXC A;  3Q3M C;  3JSV A;  4JGH B;  4A6Q A;  5LXH A;  2MEK A;  4MGI E;  1WR6 E;  2Y5C A;  1UEL A;  3PV1 A;  2D3C A;  4TQ0 A;  3DVG X;  1TIF A;  1FNU A;  3IFW B;  2BW2 A;  3KYC D;  4TSS A;  1FD6 A;  3WCQ A;  2TSS A;  3V62 A;  4DHJ D;  5LXI B;  3I63 C;  3N1Z C;  2NBV B;  1K51 A;  4FJZ A;  4G3X B;  4XE0 A;  2WU5 B;  2J53 A;  2PTL A;  1F1H A;  2KFK A;  3DVN V;  1JWB D;  1TY0 A;  2LZ6 A;  3EC8 A;  4M01 A;  1D5Z C;  1ZUD 2;  3DVG Y;  2BT6 A;  2M0A A;  1TYG B;  3WAN A;  2L83 A;  5C1Z A;  1BML C;  2NR2 A;  3H9D A;  5EE0 A;  1YJ1 A;  2FBW B;  2G4S A;  2R2Q A;  4NAW A;  2G3Q B;  3QAR A;  3AEF B;  3B0A A;  5D3I B;  3RNB C;  1NDD A;  4FAD A;  2O6V B;  4XX5 A;  1RAX A;  2KX0 A;  1IUE A;  1MVK A;  4H2A A;  2MJD A;  3AU4 A;  4AJW A;  1GC7 A;  5CHV C;  5AZG A;  1GC6 A;  3L0W B;  3DWM A;  1UZX B;  4ZRP A;  1AAR A;  4DDI D;  2KDI A;  1JWM D;  3NOB A;  5J17 A;  4DHZ B;  3ZJV A;  4TMA B;  2JVC A;  1SBB B;  1GAQ B;  2KJ6 A;  4ACF A;  1ZXI A;  1UF0 A;  3PZ7 A;  3AUL A;  3H7S A;  2ACZ B;  4KKI A;  4WH4 A;  4XWW A;  3HRD D;  4D2K A;  4M00 A;  3KUC B;  2KVZ A;  2MJ3 A;  3V05 A;  4BBN F;  2BPS A;  2JU6 X;  2IPK D;  3SFE B;  4YTM B;  2FCQ A;  2G1E A;  3URY A;  4IM2 A;  3A9J B;  4OHJ A;  5BYR A;  3K9O B;  2WHI A;  3EEC A;  4RMA A;  4HKQ A;  2LFI A;  4KIK B;  1FEH A;  3U4E G;  1WE6 A;  2FID A;  4BOZ B;  5BMI A;  2GMI C;  4RGM A;  3X0W A;  1YQ4 B;  1GJZ A;  3KUZ A;  5AUK A;  2QDF A;  1GUA B;  3IT6 B;  5AZH A;  4LJO B;  5IN7 A;  2R61 A;  4E3C A;  1GB1 A;  2KD0 A;  3FAH A;  2FCS A;  1HE8 A;  1AN8 A;  1SEB D;  2JZZ A;  2BGF A;  4GDK A;  1L0X B;  2BWE S;  2Y3A A;  2J7Q B;  4IOI E;  3ZNZ B;  1E7P B;  1EWY C;  4O1N A;  1FM0 D;  1J0G A;  4E74 A;  3Q3N C;  5IP4 D;  3DHI C;  1OEY A;  2GBJ A;  3CSF A;  1MG8 A;  1R7S A;  2MLB A;  3VRB B;  4YTN B;  3VTW A;  1E7U A;  1I42 A;  3CMM B;  3KUD B;  5TSS A;  2MCN B;  3GP7 A;  4MEM A;  1VD2 A;  4JPS A;  1R4M I;  2LGD A;  1TKY A;  3TSS A;  3ZNH B;  1F9J A;  4MDK E;  2V3S A;  4EEW A;  2FCN A;  2XK5 B;  3ZQ4 A;  2KFK B;  4LNO A;  1QF6 A;  1I7H A;  2IGG A;  2EMT A;  5HG2 A;  4BOS C;  3Q8A A;  3U52 E;  2PEA A;  4GMV A;  1PDX A;  4GSW A;  2BB6 A;  2K8B A;  3E9S A;  3ZLZ A;  1TS3 A;  4OVZ A;  4PS7 A;  3X23 A;  1KTK A;  3RZW C;  4ARI A;  4GN1 A;  3NUH B;  4C00 A;  1R4N B;  1TS5 A;  5JHB A;  2H88 B;  3ZRF A;  4LNK A;  2PLP A;  1C76 A;  1Q10 A;  3CST A;  2ZCB A;  4C7Z A;  2LVO A;  4W9L A;  1VR9 A;  2JT4 B;  1A5R A;  1WMH B;  4MT5 A;  3HVZ A;  1YX6 B;  2NBW B;  4J6I A;  2E3T A;  2NTT A;  4LDT B;  2C7N B;  2K0P A;  1BXT A;  2V0G A;  4OZC A;  3AM9 A;  4FBJ B;  1C9F A;  1TKG A;  3T9L A;  3Q2A C;  3RN9 C;  2HTM E;  1QOA A;  2AWT A;  3HIZ A;  2KN5 A;  3Q69 A;  2H89 B;  2D3A A;  1FFV A;  3TIX A;  2IND C;  4S17 A;  2KFJ A;  2C9W B;  1VRA B;  2V3P A;  4IKG A;  4I6P A;  2W3R A;  2O2V A;  1K53 A;  2WXK A;  2VZK B;  2J42 A;  3C0R B;  4WAA A;  4MJS A;  3Q6B A;  1JQ4 A;  1WWT A;  3A4R A;  5D7G A;  1WYW B;  2Z0D B;  2BTE A;  2KYW A;  3PVL A;  1TS4 A;  3AE8 B;  2WXM A;  2N1W A;  1HTQ A;  1P0R A;  2O6V D;  4DWF A;  1FMA D;  2IYD B;  3NY5 A;  1AW7 A;  2LMC A;  2QJL A;  4AOF A;  1XD3 B;  1IYF A;  2WXJ A;  1WRI A;  3BY4 B;  1Z2M A;  1XLP A;  1QIL A;  2IZV B;  4GDK B;  2BYE A;  4K3C A;  1YN5 A;  3U30 A;  4DHJ B;  1FIQ A;  1LM8 B;  2HE7 A;  2KMA A;  3TMP B;  2Z8L A;  3H7P B;  2KLG A;  3ENE A;  4TUU A;  3VR9 B;  1ZDV A;  4W9E A;  3AEE B;  3M95 A;  3AE5 B;  3KQ4 A;  4KDL B;  1WE7 A;  3NS1 A;  1YN4 A;  1Q5W B;  4GOC A;  4EOY A;  2KC1 A;  1VZ8 A;  2N7J A;  2INN E;  2QEJ C;  1N63 A;  3AEB B;  4W9G A;  4N59 A;  3L17 A;  4NJC A;  3VTU A;  4W9K A;  1QKZ A;  2D3G A;  1V8C A;  3RNA C;  3WAO A;  2WXL A;  1U4A A;  2ICI A;  3ETR A;  2XEW A;  4M0W B;  5JZE B;  3HM3 A;  3QJZ A;  1OQR A;  1I4X A;  3O65 B;  4ZHP A;  4NY0 A;  1JAL A;  2IY0 B;  2WDT B;  3OWE B;  2IGD A;  2W54 A;  3GE3 C;  3RUL A;  2OED A;  3AE6 B;  1CMX B;  1QZE A;  1G6J A;  1C77 A;  2KO3 A;  2INC C;  1QQR A;  2IO1 B;  3HM6 X;  1UGM A;  3JW0 X;  4KZC A;  3NZS A;  1YJJ A;  5HFY A;  3APF A;  3VH4 B;  3L08 A;  3VDZ A;  1LQB A;  2D10 A;  2JZ3 B;  3TEX A;  3T3O A;  3BYT B;  3RI7 C;  3DBL B;  1ZGU B;  4US8 A;  3N32 A;  4HCP B;  1TTN A;  4IG7 B;  1TBE A;  3AEA B;  2KDF B;  2DX5 B;  2KAJ A;  3VUX A;  2PE9 A;  1ZKH A;  2IO2 B;  4HRO A;  1SE9 A;  4URK A;  2N7D A;  1PFD A;  5KHQ A;  2KAN A;  2Q5W D;  1L0V B;  4RGO S;  1JW9 D;  2WXN A;  4MGZ E;  1NI2 A;  2V3N A;  4W9J A;  1E8Z A;  4ANX A;  3UQA A;  3L13 A;  2KHW B;  3U7D A;  1T3Q A;  1GNU A;  2X38 A;  2KVR A;  1QOF A;  1A70 A;  1NVI D;  5IA7 A;  2FUH B;  4RNA A;  2BKR B;  5C3J B;  2I2Y A;  3EUB 2;  5C2T B;  1ZE3 D;  3M63 B;  1QOB A;  2MSE D;  2LHE A;  2GRI A;  3AH7 A;  4II2 B;  1D3Z A;  1LGR A;  2N0S B;  1SE4 A;  1I35 A;  3B2F A;  3RT3 B;  3LJ3 A;  3IVF A;  1T0Q C;  1DYQ A;  2YEP F;  4WIP A;  4WQO B;  1D4B A;  4G50 A;  4K7W A;  3WA0 A;  1FRD A;  2LRW A;  4YXD B;  3RNC C;  3NZ3 A;  1E6E B;  5AZF A;  3KH0 A;  3APC A;  5EDS A;  3C19 A;  3VXW A;  5JHA A;  4LDT D;  1D5X C;  3KWV A;  4RH6 A;  3HVD A;  3ONS A;  1B1Z A;  2ON8 A;  3QQ8 B;  4GB9 A;  1EU4 A;  2B3A A;  2UYZ B;  4LNF A;  5AEK B;  4C4V A;  2MBH A;  4K1R B;  1B9R A;  3DBR I;  5I4D A;  3HUI A;  2Y5B B;  1C4A A;  1L6V A;  3BIN A;  2C5L C;  2VZK D;  2ZPN A;  1XXG A;  1NEN B;  3QCA A;  4L2Y A;  5D2M B;  1RRB A;  2LXA A;  3PZ8 A;  3NHE B;  3D32 A;  1KRH A;  1HA5 A;  3BYY B;  2KWV B;  2KN4 A;  1UD7 A;  4AQ7 A;  1WIA A;  2A5U A;  3PGE A;  1ZP0 B;  3IAM 1;  3ZVV A;  2QC8 A;  2KTR B;  2GI9 A;  2L32 A;  4OZB A;  1KOT A;  4WUR A;  3DPD A;  3VUW A;  2K25 A;  2DYB A;  2BB5 A;  2JZP A;  1KH0 A;  1C4P A;  3QK0 A;  2QMT A;  4HK2 A;  2NTS A;  2SEB D;  1RWS A;  4KSL C;  4A8X C;  2M0X A;  4ITK A;  3LDZ E;  3B1L X;  1IGC A;  2DLB A;  3W1S A;  1FFU A;  1T0R C;  4EZJ A;  1CJE A;  1OGW A;  4NAM A;  1WX7 A;  2K6D B;  4IM0 A;  3Q3F A;  2RDB C;  3ZUN A;  3R7Q A;  1XCQ L;  2K8H A;  1RYJ A;  3RNG C;  1Q1O A;  3I3T B;  1E8Y A;  5IOI A;  1GB4 A;  3R2T A;  1PGX A;  3R66 C;  1EM7 A;  1GOZ A;  2PKO A; 
#chains in the Genus database with same CATH homology
 4A9A A;  3IXS A;  3TSS A;  1XLN A;  3RPF C;  2ZW0 A;  4HEA 1;  3TEZ A;  3C8Y A;  1FNW A;  1WSP A;  3ZQ4 A;  4C7Y A;  1QF6 A;  3CWI A;  1I7H A;  1XLO A;  1VLB A;  2RMM A;  2IGG A;  2W3S A;  4JE3 B;  5HG2 A;  2JWU A;  3Q8A A;  3U52 E;  3LYY A;  1MPE A;  1K50 A;  1PDX A;  1TKE A;  3VR8 B;  3SFD B;  1FO4 A;  1UWM A;  2L52 A;  1ESF A;  1QLB B;  2WNM A;  2BB6 A;  2JSV X;  3E9S A;  1KFY B;  1TS3 A;  4OVZ A;  2WDQ B;  4FXC A;  1KTK A;  2OHF A;  4ARI A;  1J7A A;  3NUH B;  4MH8 A;  4RGN A;  4LK0 M;  1I4H A;  4KX6 B;  2EKI A;  2BS3 B;  3FIL A;  1VZ7 A;  1DGJ A;  3P4R B;  1TS5 A;  4RF0 A;  1VDV A;  1T5X D;  4LLG M;  2H88 B;  2PLP A;  1C76 A;  1QT9 A;  1Q10 A;  4ARC A;  1L0Y B;  1FRR A;  4C7Z A;  4R3D A;  1OFF A;  1P7E A;  5E6J A;  1E0Z A;  2GB1 A;  2PW9 A;  1VR9 A;  2J52 A;  4L23 A;  4P6V F;  1FCL A;  2WXG A;  2WQY B;  4MT5 A;  1ZXH A;  1KF6 B;  3HVZ A;  3BVZ A;  1TS2 A;  1L4D B;  3TEW A;  1OQQ A;  2WXP A;  4GDL B;  1I4G A;  3MC0 B;  5FKA C;  5BYS A;  2E3T A;  3P4Q B;  4WAF A;  1ET6 A;  2NTT A;  3SR6 A;  2K0P A;  1BXT A;  2V0G A;  3MJ5 A;  4OZC A;  3AM9 A;  1C9F A;  2WXQ A;  1TKG A;  2CJO A;  2Y5P A;  1NYQ A;  1WGK A;  1TY2 A;  5BMG A;  2PVG C;  1CK1 A;  3AE9 B;  2HTM E;  2QSD A;  3KLS X;  1QOA A;  1C78 A;  2WLB A;  1EWC A;  2CJN A;  3Q69 A;  4MAC A;  4XDD A;  2WXI A;  3GS2 A;  1D6E C;  4Q2J A;  2H89 B;  1WXQ A;  1FFV A;  3VQI A;  2QIL A;  2IDY A;  2IJ0 A;  1FXA A;  2JYE A;  1L4Z B;  1AYF A;  1VRA B;  3AE3 B;  4HRS A;  2V3P A;  2B76 B;  4IKG A;  5BMH A;  2W3R A;  1K53 A;  2WXK A;  2VZK B;  2J42 A;  2G9H D;  1N62 A;  2WP9 B;  3W9C B;  2HDE A;  2MJE A;  3AV8 A;  3AE2 B;  4JWS C;  2KMM A;  1UUP A;  2DYM A;  3P4P B;  4A55 A;  1M4V A;  1WWT A;  1JQ4 A;  2WXR A;  1P7F A;  2V4I B;  5D7G A;  1F2R C;  2BTE A;  5LNK 1;  1TS4 A;  1V1P A;  3AE8 B;  2WXM A;  1F77 A;  2XN9 C;  5EE3 A;  1HXY D;  4PT5 A;  3P4S B;  1L6U A;  1XF5 L;  1FMA D;  1ZPS A;  2J4X A;  2KQ4 X;  1AW7 A;  2LMC A;  2QJL A;  4EE2 A;  1KLG D;  1MHX A;  5H8Y E;  3H8H A;  1GPX A;  4DXG A;  2BYT A;  1LO5 D;  1K52 A;  2WXJ A;  1WRI A;  1JWU D;  4C80 A;  2WU2 B;  1HZ5 A;  1SIJ A;  2KDM A;  3ABV B;  4IDI A;  1PYW D;  1V1O A;  1XLP A;  1QIL A;  4C56 C;  3MHZ A;  4GDK B;  2M56 B;  1DOX A;  1YNT E;  4LTU A;  3AB5 A;  3CIR B;  1SXT A;  1VZ6 A;  1YN5 A;  3Q8C A;  4KGS A;  2JX5 A;  2K5P A;  2NMQ A;  1FIQ A;  4N58 A;  1N60 A;  1PUT A;  4ZYS A;  1NEK B;  2Z8L A;  3AEG B;  4MM3 B;  1UNS A;  4J3O D;  2FE8 A;  1ZDV A;  2RDG A;  3VR9 B;  3AEE B;  1D5M C;  3NVW A;  2L1A A;  4RGT A;  2WS3 B;  1ENF A;  1C79 A;  4OZA A;  1SJH D;  3AE5 B;  5HHD G;  1DOY A;  4WQM A;  3KQ4 A;  1IGD A;  2E6X A;  2LUM A;  1JCK B;  4NAW B;  3NS1 A;  3J9C A;  1YN4 A;  3P63 A;  1JRP A;  4A90 A;  2N9L A;  5EE9 A;  2AQ3 B;  4NZL B;  4P16 A;  3W2D A;  3GB1 A;  5D3D A;  1RM6 C;  1YJI A;  2IGH A;  1VZ8 A;  2N7J A;  4YWG G;  1VJK A;  2INN E;  2QEJ C;  1N63 A;  4YSX B;  1YMH E;  3AEB B;  4N59 A;  4NJC A;  1T6B X;  1QKZ A;  5H92 C;  1JRO A;  1V8C A;  5AUI A;  2JYT A;  2K9X A;  1NYR A;  3R8B A;  2WXL A;  4KGR A;  4XWT A;  4TQ1 A;  3I9V 1;  4ZHO A;  2ICI A;  1SF0 A;  3Q8F A;  3ETR A;  3PO0 A;  4REZ A;  4UDU C;  1JWS D;  4USA A;  2K3U A;  1OQR A;  1I4X A;  3MP9 A;  3L4P A;  5FR3 A;  3DWG C;  1N5W A;  4ZHP A;  1V97 A;  1WYG A;  2M19 A;  1JAL A;  4YSY B;  3I57 A;  3OWE B;  4RF1 A;  1F2R I;  2EEL A;  2W55 A;  2IGD A;  1EU3 A;  2FUG 1;  2W54 A;  1J7B A;  2OED A;  1XO3 A;  3AE7 B;  3AE6 B;  1STE A;  1SSN A;  1IBX B;  1Y56 A;  1I4Q A;  3R2I A;  1C77 A;  2WDR B;  3FIL B;  5EE1 A;  1ROE A;  1QQR A;  4L1B A;  1DOI A;  1YJJ A;  5HFY A;  3BK2 A;  3B2G A;  3U7Z A;  3O13 A;  1CZP A;  4KKJ A;  1I4R A;  3AEC B;  3TEX A;  2MH7 A;  1NI3 A;  2N9K A;  3T3O A;  3BYT B;  3BWU D;  1FXI A;  4XDC A;  2PMV A;  2LGI A;  1SE3 A;  4US8 A;  4GLS C;  4A6Q A;  2MEK A;  2QIE B;  2AQ2 B;  5JXV A;  3ZJT A;  2Y5C A;  3AMZ A;  3AEA B;  3NVY A;  4TQ0 A;  2KAJ A;  1TZO A;  4HRO A;  1HQR D;  1FNU A;  2BW2 A;  1PFD A;  4TSS A;  4YSZ B;  3E56 A;  2Q5W D;  1L0V B;  4RGO S;  1JW9 D;  4B0E A;  1FD6 A;  3BK1 A;  3WCQ A;  2WXN A;  2V3N A;  2TSS A;  3ZGZ A;  1K51 A;  5G5G A;  2PVO D;  1T3Q A;  1TJE A;  3EA6 A;  2X38 A;  2BS2 B;  4DXF A;  3W5U B;  4XE0 A;  1QOF A;  2WU5 B;  2J53 A;  1A70 A;  1NVI D;  3W5V B;  2PTL A;  3Q8E A;  2KAC A;  4RNA A;  1JWB D;  5C3J B;  2D5G A;  1TY0 A;  2I2Y A;  3EUB 2;  1QOG A;  1ZE3 D;  5C2T B;  1D5Z C;  1ZUD 2;  1CQV A;  2BT6 A;  2RPV A;  2M0A A;  1QOB A;  2XNA C;  1TYG B;  2L83 A;  2KWD A;  1RFK A;  1BML C;  2LHE A;  2GRI A;  2WXH A;  3AH7 A;  1AWD A;  1XCT L;  1SB3 C;  5EE0 A;  2DBY A;  2N0S B;  2FBW B;  2CU3 A;  1YQ3 B;  2ONQ A;  3KWL A;  1SE4 A;  3ZYY X;  3B2F A;  2ZW1 A;  3AEF B;  3AE4 B;  5D3I B;  2RDH A;  1F0Z A;  1DYQ A;  2YEP F;  1J7C A;  4WIP A;  1ET9 A;  2WXF A;  1D4B A;  1IUE A;  4N6E B;  1FRD A;  1MVK A;  1KLU D;  4YXD B;  4H2A A;  4US9 A;  2MJD A;  3NVV A;  1MI0 A;  3NZ3 A;  5FK9 C;  1E6E B;  2PIA A;  4ZOH C;  3BZD B;  3DWM A;  1D5X C;  1N61 A;  3KWV A;  4ZRP A;  4M0W A;  4RH6 A;  3HVD A;  1JWM D;  1B1Z A;  2ON8 A;  1HZ6 A;  3ZJV A;  4TMA B;  2AX5 A;  1EU4 A;  1SBB B;  3AN1 A;  3IAS 1;  1GAQ B;  5T8I A;  3FC4 A;  1ZXI A;  2W82 A;  1BUI C;  3U2S C;  3PZ7 A;  3AED B;  1XLQ A;  1B9R A;  4KGT A;  4ZRQ A;  1IBX A;  5I4D A;  3IT4 B;  3NRZ A;  2ACZ B;  3T3N A;  3HUI A;  3Q8B A;  3BVG A;  4KKI A;  3BVM A;  2BBC A;  1C4A A;  4WH4 A;  4XWW A;  3HRD D;  1C4C A;  4D2K A;  1L6V A;  1MHH E;  2JQR B;  2INP E;  1E10 A;  2VZK D;  1XXG A;  1NEN B;  4HKZ E;  4L2Y A;  2MJ3 A;  3V05 A;  5BYQ A;  2DWQ A;  1PGA A;  3TUO A;  3PZ8 A;  2JU6 X;  2IPK D;  3SFE B;  5HI1 A;  1E9M A;  4YTM B;  1KRH A;  2G1E A;  1HA5 A;  2YEP B;  3BYY B;  3URY A;  2KN4 A;  1XEE A;  4OHJ A;  5BYR A;  1FNV A;  1L5P A;  2AQ1 B;  4AQ7 A;  5GXG B;  3V3X A;  1ZP0 B;  3IAM 1;  4HKQ A;  2LFI A;  4RCO A;  1FEH A;  3UI3 A;  3U4E G;  1YN3 A;  4JWU C;  3AE1 B;  2GI9 A;  5BMI A;  2L32 A;  3N9Y C;  4OZB A;  3P42 A;  4WUR A;  3NVZ A;  4RGM A;  2K22 A;  2BS4 B;  1YQ4 B;  1SJE D;  3EGR A;  2WDV B;  5AUK A;  3RFZ B;  3IT6 B;  3MFG A;  2LJI A;  2BB5 A;  4AS1 A;  2JZP A;  1SE2 A;  1ZOY B;  2R61 A;  3TEY A;  4JX1 C;  1KH0 A;  1GB1 A;  1C4P A;  2QMT A;  3FAH A;  5G5H A;  2NTS A;  2SEB D;  3SEB A;  1RWS A;  1ACC A;  1AN8 A;  1SEB D;  1N5X A;  3B9J A;  4A8X C;  1L0X B;  1ZDX A;  2LHD A;  4ITK A;  2Y3A A;  1FCC C;  3VRA B;  1IGC A;  2DLB A;  3W1S A;  1FFU A;  4IOI E;  1E7P B;  1EWY C;  4O1N A;  4DQO C;  1FM0 D;  2WXO A;  4B0M A;  1CJE A;  4NAM A;  1UWX A;  3LXF A;  2JXT A;  1XCQ L;  1RYJ A;  4RFB A;  1HEZ E;  1R7S A;  5MPO A;  1V1P B;  3VRB B;  3LB8 C;  4YT0 B;  4YTN B;  4CQN A;  1JML A;  1I4P A;  1JWA D;  1GB4 A;  3R2T A;  5TSS A;  4OW0 A;  3GP7 A;  1PGX A;  3BII D;  4WWM A;  1EM7 A;  1GOZ A;  2SAK A;  3P1M A;  2DYO A;  2PKO A;  2I38 A;  4JPS A;  1UGJ A;  2LEK A;  4YTP B;  4HJG E;  3ZJU A;  1TKY A;  1PGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...