1XCQL

Complex hcv core-fab 19d9d6-protein l mutant (d55a,l57h,y64w) in space group p21
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
b'PKEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALHAKVNGEWTADLEDGGNHMNIKFAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein C
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 8
structure length 66
sequence length 66
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xcqL00
1IBXA 1FD6A 1ZXHA 2LUMA 5HHDG 2JZPA 1XCTL 1XCQL 1FCCC 2JXTA 4KGSA 2LGIA 1D4BA 1P7FA 2ON8A 1XF5L 2LHDA 1YMHE 1K52A 2KACA 4GLSC 2J53A 4MACA 2PW9A 1UWXA 1K53A 5BMIA 2N9LA 1IGDA 1FCLA 5BMGA 3GB1A 4HJGE 4WH4A 5HFYA 4HKZE 2N9KA 5JXVA 1MHXA 3V3XA 2I38A 1MI0A 4OZBA 2KWDA 1QKZA 2IGDA 2IGGA 2QMTA 1KH0A 1MHHE 2ZW0A 1F2RC 1P7EA 4D2KA 2K0PA 1HEZE 1MPEA 1K50A 5HG2A 1HZ5A 3UI3A 2ZW1A 2N7JA 4OZAA 1K51A 1IGCA 2QSDA 2IGHA 1GB1A 2KN4A 1PGXA 1JMLA 3MP9A 2LHEA 2I2YA 2KQ4X 2ONQA 1MVKA 4OZCA 2J52A 1PGAA 5BMHA 4IOIE 3FILB 1Q10A 4IKGA 2PTLA 2JU6X 1YNTE 2JWUA 3FILA 1C9FA 2NMQA 4KGTA 2GI9A 2RMMA 2GB1A 1GB4A 2KDMA 2OEDA 1IBXB 2PLPA 2JSVX 2RPVA 1F2RI 2EELA 1PGBA 1EM7A 4KGRA 5HI1A 1HZ6A
chains in the Genus database with same CATH superfamily
5JH5C 1L6VA 1VDVA 2JXXA 3NHEB 1FO4A 1J0GA 3RNBC 1V97A 3OWEB 1RFAA 2LVPA 4I6PA 1DOIA 1OFFA 4WQMA 3Q8EA 1AN8A 1CQVA 4DXGA 3NVYA 1TYGB 3RNCC 1WMHA 2IY0B 3BVGA 4HWIB 3KW5B 1UH6A 4FXCA 3P42A 1EWYC 1AYFA 3OAWA 2L76A 4US8A 2QEJC 3WCQA 2FE8A 3VH3B 2XEWA 3AN1A 3ZRCA 1KM7A 2AWTA 2MRPA 4M8NA 3WALA 4S0RA 4EZLA 2N9PC 4B9KA 3Q3NC 5H92C 1HE8A 2WXIA 3L17A 1ZKHA 4F8CB 5HG2A 4IC7B 2NTTA 2KAJA 3IAM1 1TZ1A 2BTEA 2RSUA 2N7JA 3AE6B 1WX8A 4XWWA 2LUEA 2X8XX 1ENFA 1UELA 2WU2B 3I3TB 2H88B 3ZKJC 3MP9A 4DXAB 1YN3A 4K3CA 4ZHPA 4HCNB 1UD7A 2UWQA 3DBLB 3K9PB 1XEEA 3T8MA 3R2IA 1WJ4A 2QIEB 4FJVB 4OVZA 1EO6A 4KGTA 2GI9A 3A4SC 1S1QB 2YEPF 5D94A 4RGNA 1KF6B 2JYEA 2FCMA 3TSSA 1UUPA 4G11A 1IBXA 2PIAA 1P3QU 2LXAA 1ZXHA 1NDDA 4N9F4 4B0EA 2ZPNA 4LNNA 3KLSX 4FHJA 3HHMA 3L08A 4UDUC 1CJEA 2REXA 2KTRA 3ZDMC 4HKQA 2ZCCA 4HK2A 2W55A 2KWVB 1IYFA 3CF6E 2MBOA 4WJQA 3DBLI 2D3CA 4EZKA 4G3XB 1FPYA 3NVWA 3HM6X 4II3B 1VCBA 4I6LB 2N1VA 3AEGB 2NS5A 4DDGD 3A33B 4ITKA 5HFYA 4RGTA 2HJ1A 1GUAB 5E6NA 5C3JB 5AUKA 2D3BA 2C60A 3DCGA 3MJ5A 3PO0A 2WDTB 2NBVB 2RDGA 3KWLA 1SE4A 1MPEA 2MWSB 1WX9A 4PK1A 4AQ7A 4ANVA 3HK0A 3M62B 2D2QA 4NY0A 1T0RC 2KX0A 3GZNB 4OZAA 1K51A 4DBGA 1C3TA 2SAKA 2O6VA 4TUUA 4PS7A 3BINA 1E0ZA 2K6QA 3OG5A 3TEWA 2MH7A 1T6BX 1YIWA 3APFA 1ZOYB 3R7QA 4RCOA 1I4PA 3DVGX 2BB5A 3HUIA 1FNWA 3RYTA 3OJ3A 2INCC 4A20A 2JWUA 1EUVB 2UYZB 1HA5A 1FM0D 4IM0A 3MC0B 3RZWC 3U2SC 3VDZA 3ZO5B 2B76B 3BK1A 2IO2B 4L1BA 1PFDA 3DBSA 4A8XC 1IUEA 3H9DA 2RPVA 1V5OA 1JWAD 4M0WB 2DLBA 1NI3A 2CR5A 2L3ZA 3QQ8B 2RD0A 3SD5A 2BPSA 4KGSA 4XC2A 3QCAA 1SE9A 4FADA 1WGYA 2CS4A 3U30A 2Z0DB 1L6UA 4W9EA 3W1SC 1BT0A 2DHZA 4TV3A 1SJED 1FRDA 2BYFA 3VRAB 2VZKD 3A1QA 3N20C 2KMCA 3L4PA 4C4VA 1SXTA 1LO5D 3GB1A 3L16A 1H8CA 3IVFA 1QZEA 2MJ3A 5J18A 3ZXRA 4EKUA 4YXDB 4E71A 1FXIA 4NAMA 1N5WA 1WSPA 2KX3A 3ZLZA 4HRSA 2QJLA 2D3GA 1FNVA 1I4GA 1WGDA 4K3BA 2RDBC 3DHIC 2W82A 1OGWA 1I42A 4NQLB 3IHPC 3Q8BA 4KX6B 3ETRA 3WAOA 1SEBD 3ZIMA 2BS4B 2A5UA 2FCQA 1IGCA 2IGHA 3NG0A 4KV2A 2JT4B 2M0XA 3TJPA 1YD8U 3PHWB 4MGIE 1WXAA 4OZCA 3GE3C 4RFBA 3H6NA 3VR8B 1KJTA 5AUIA 2PMVA 4C00A 1WJ6A 2W3RA 3H7PA 1C9FA 2L83A 1TS4A 2LGSA 1XD3B 2NMQA 1XLPA 2JRIB 3TCAA 4M01A 2KFJA 3P63A 4K7UA 4N59A 1SJHD 3SR6A 1BUIC 2GMIC 2LEKA 2WWZA 1PGBA 1R4MB 3P4PB 2EMSA 3Q8AA 2L32A 3ZGZA 1FCCC 3C19A 2CHZA 2LFIA 3L10B 3P4QB 2LGXA 4LDTD 1N62A 1YMHE 5LNK1 1L7YA 1M4VA 4JLCA 1MFWA 3KYCD 2K5PA 3AE2B 5G5HA 1ZXIA 2KTFA 4DDID 3NZSA 4E74A 3EC8A 1YJJA 1VD2A 2Y5CA 1ET9A 3ENEA 4MM3A 1R4MI 3PPAA 3IBEA 1EU3A 2Z59B 3EUB2 3P2BA 3AV8A 3UQBA 2KD0A 5IP4D 1F9JA 2DZMA 3ALBA 3B2FA 1VRAB 1D5XC 2WHIA 3NUHB 4KZCA 1DYQA 3UQAA 1GC6A 4NAWA 4HJKA 3DVNV 4TQ1A 3CIRB 4ACFA 1J8CA 2GBRA 4FLHA 5E6JA 5G5GA 2KJHB 3RCZA 2KFKA 1E5WA 3NY5A 3W1YA 1E9MA 4J3OD 1JWMD 3N30A 4KVGB 2KYWA 4DWFA 4WWNA 3PRZA 1V86A 2WX1A 3PGEA 4HPLB 2LD9A 2JU6X 2ZJDA 1YJIA 2JZ3B 3TEZA 3O65B 1TS3A 2DZKA 3URYA 4MSQB 4XGAB 1NVID 3NJTA 2RR9A 4ZHOA 2JSVX 1R4NI 1ZUD2 3ONSA 5AZHA 3M3JA 1RWSA 4KKJA 3GP7A 2LUMA 4ZRIA 2J4XA 2WX0A 3VR9B 3JVZX 3RD2A 4OW0A 4YWGG 1K52A 3V6EB 3N1ZC 2KWUB 1NENB 3UIOB 3DHHC 2H89B 2W3SA 4WAAA 3GS2A 1RLFA 5CTRC 4YSXB 1Y8RC 4XYCA 4MELA 5MPOA 4EUTA 2I38A 2JX5A 3A4RA 2IGDA 4IW0A 4EEWA 4WJNA 3JW0X 3NZUA 1LQBA 2MEKA 2L00B 4JX1C 3QAQA 2M1MA 3M63B 3PVLA 2RDHA 3L13A 2CJNA 1ZDVA 3HVDA 2KKCA 3UI3A 3NVZA 4REZA 2AQ1B 1FXTB 3MC9A 2NPTB 2G3QB 1PGXA 2KLCA 1TKYA 1C4CA 2DX5B 3Q2AC 5JHAA 2AEHA 1WM2A 4A6QA 4HCPB 1TS5A 1XQQA 1OQRA 1SIFA 2IY1B 4M00A 3V60A 4AWJA 2DYBA 2INPE 2Z8LA 2N4FA 2IZVB 3RNFC 2K8CA 2GLSA 3P4RB 4US9A 2WQYB 4L23A 2SEBD 1FD6A 2O2VB 1YQ4B 2BGFA 3R7RA 4GDKA 4KIKA 1JCKB 2KDEB 2KQSA 4N58A 4C56C 2BYVE 2LMCA 1VZ7A 3H1UA 3PSEB 3PLVA 3VUYA 2J0KA 1NYRA 4WURA 3VQIA 2DZJA 1WZ0A 4MGZE 2WS3B 1IGDA 1L4DB 5TR5A 3SEBA 2Y5BB 1MG4A 1NYQA 3AE8B 3MC8A 4YTNB 2FUG1 1P9DU 3W1SA 3I9V1 3VTUA 2NTSA 3EHVA 3UF8A 2ZNVB 3ZXVA 4MGKE 2NBWB 3VTWA 1NEKB 2WXFA 1KLVA 3VFKA 3NS1A 2MJEA 2MP2B 3R8BA 2L7RA 5GXGB 1Y56A 1V1PA 5IO9A 1TBEA 4LNFA 4II2B 2M0AA 1I4RA 1L0VB 1Q0WB 4HVBA 2XN9C 4PS8A 5E6OA 3L0WB 2K3UA 3D32A 4MJSB 3Q14C 2PKOA 4ZRKA 2G4DB 2WXGA 2KQ4X 2UU7A 3AEDB 2BYTA 1N63A 3BZDB 3KWVA 3I5JC 1FRRA 1GNUA 3GE8C 2Y3AA 4RGMA 5D3IB 1OQYA 2V4LA 3SFEB 3UGBB 1C4PA 1E6EB 1DOYA 1B1ZA 3SFDB 3ZVVA 1SSNA 1V81A 1MJDA 4W9IA 1DOXA 4WWMA 1GJZA 2MQJA 1M94A 1EM7A 1GAQB 1P1AA 4OVUA 4RGOS 5CHFA 4JWUC 4LNOA 4YSZB 1LFDA 3VXWA 2LGIA 1P7FA 2M17A 2Q5WD 1XO3A 5IKCM 2J53A 1OTRB 2INNE 3RULA 5DPTA 1ET6A 2KOXA 2FAZA 5DPSA 1FCLA 3NOBA 3V05A 2A4ZA 1EF1A 1I4HA 2VZKB 3OLMD 2ZVOA 1N5XA 4J6IA 4A9AA 2AQ2B 1VR9A 2FIFA 1J7CA 5G2NA 2LGYA 4TKNA 2QCZA 3KH0A 2EMTA 1ACCA 1X1MA 2LASA 1QOAA 1Z2MA 4LK0M 4HEA1 4D2KA 5FR3A 4WWOA 1WI0A 4G50A 2KVRA 3KUDB 3I57A 2WXHA 1FEHA 2KC1A 3VTVA 3B2GA 3AU5A 1V8CA 4IDIA 4HPPA 3RZFA 3KVFB 4ARIA 2I1KA 2C9WB 3AE5B 4GDLB 3JSVB 3PHXB 4BKTA 1T0SC 5DPRA 4FJYA 4S17A 4XE0A 3GOEA 2HE7A 4A90A 1OQQA 1J7BA 3N1YC 3AE9B 2FIDA 3AE1B 2KMMA 4CQNA 5C23A 4DHJD 4ANUA 2G9HD 5CHVC 1F0ZA 2JF5A 1F2RI 3L54A 5D6JB 3B1LX 5BYQA 4EZJA 5HI1A 1HZ6A 1D3ZA 2KANA 3EFUA 4NJCA 4XDDA 3QK0A 3U8ZA 1WXMA 2WDRB 3MHZA 4NNJB 4NQKE 4IWOA 3P4SB 2K25A 3U7ZA 1WMHB 2JYTA 4CYEA 4LDTB 1E7PB 2LRWA 1RFKA 4B0MA 4B95A 2IDYA 3ML8A 2FCNA 4YSYB 1WM3A 2XK5A 4X57B 2HD5B 4HJGE 3Q8CA 3GZNI 4XX5A 3JYUA 1AWDA 2LJ5A 4PYZA 4BKGA 2FUHB 2WXMA 3NRZA 5KHQA 2KZRA 4YL8A 3RPFC 1AW7A 1WGRA 3BWUD 1WFYA 3BVMA 5TSSA 4QAYA 2AYOB 1E8XA 4F1SA 2C7NB 2KO3A 2K0PA 1HEZE 3BK2A 4LLGM 3NZ3A 3Q3OC 3H7SA 4W9GA 1TGZB 3A9KA 1P0RA 3AU4A 1ZP0B 3RFZB 4GIVA 4IWPA 3QHTA 2L1AA 4IUMB 1ESFA 3IXSA 1UGMA 2C5LC 4MH0E 1WRIA 3RNEC 3DQVA 5C1ZA 3AI5A 5E6PA 3DWMA 3DOWA 4HDOA 1PDXA 3FILA 1JWBD 4W9KA 4XWTA 2DZIA 3C8YA 3BY4B 2GOWA 2GB1A 1IBXB 2PLPA 2DNFA 2BT6A 1STEA 3IT4B 4IG7B 1G6JA 1WYWB 3LXFA 2Z0EB 2QILA 2M19A 2WLBA 2KC2A 2KTRB 2W54A 3LJ3A 1XCQL 3IT6B 2RGFA 1B9RA 2ON8A 5L83A 2EKEC 5EE9A 3WAMA 1ZE3D 1HXYD 2KT7A 4ZDVA 1CK1A 3CSTA 2MA9B 4RH6A 4AS1A 3E9SA 2KVZA 3RMKC 3ECIA 3QIJA 1D6EC 4AOFA 5G55A 3TUOA 3SDLC 3V3XA 4H2AA 2WXQA 1GPXA 2KWDA 3X23A 2HTME 1ROEA 5DCNA 2CJOA 2K39A 1E90A 2IO0B 2XBBC 4ZRPA 3PTFC 2QDFA 3BVZA 2KQ7A 2O6VB 1TY2A 3B9JA 1K50A 1R7SA 3C0RB 2D10A 3DBRB 1CMXB 4P1BC 1U4AA 3ZTDA 1GB1A 3UIPB 2KN5A 1F77A 1KFYB 3KUZA 1MVKA 3U4EG 2QC8A 2MCNB 2KK8A 3HRDD 5BYSA 2V0GA 4ICUA 3AE7B 4NJ7A 2BWES 4AUQC 3V61A 5I4DA 3R3MA 2YVCA 4ANWA 1DGJA 3ZNZB 3U52E 1SBBB 5LXIB 1HTOA 2DENB 4KDLB 4IM3A 3HIZA 4M02A 4TMAB 2G45B 3DBRI 2DBYA 1ISNA 1XCTL 4PYUA 4C80A 2LXCA 3A9JA 3ABVB 4KKIA 4ZOHC 1PYWD 3NVVA 1ZGUB 3AE3B 4G0NB 3A1QB 2WNMA 2ASQA 4C4VB 2YEPB 3TMPB 4MDKE 1K53A 2IBIB 2IYDB 5BMGA 1KRHA 1T0QC 3RNAC 2PE9A 1RYJA 1KTKA 3QJZA 2E3TA 2OOBB 4GMVA 3AB5A 3EGRA 1GG3A 1MI0A 3BYTB 2C7HA 3EFCA 4HPMB 3FAHA 3MTNB 2KJRA 3APCA 1L5PA 2CU1A 1ZPSA 2KWCA 1YOVB 2ZZPB 3ZRFA 2GRIA 1EU4A 4XZ4A 2LI5A 3S2AA 3MJWA 1GOZA 2QSDA 2OJRA 2KN4A 1TT5B 3PRMB 3DVNU 4BKSA 3N3KB 1JMLA 1E8YA 2R2OA 2ONQA 1VZ6A 4BAXA 4A3OA 3H7PB 2O6VD 1GC7A 3RT3B 2M8SA 4BZAA 5L95C 1TKGA 2DAJA 1QT9A 3H8HA 4LJOB 3T3NA 1J7AA 1E8ZA 2HTHA 1Q1OA 2YLMA 3AXCA 2N7EA 3IAS1 3ML9A 2J0MA 4GOCA 4BOZB 1E7UA 1T3QA 3ZJVA 1YJ1A 4LNIA 5IN7A 4EOYA 2J42A 2LWPA 4FJZA 3NS8A 1SIJA 2V9HA 1N60A 4AJYB 1D4BA 2FCSA 2K8HA 3SHQA 4CHKA 4IM2A 3X0WA 3J9CA 1TTNA 3OJ4B 4P1CC 3ZNHB 2GBKA 1ZDXA 5BMIA 2WXOA 4GGQA 4MM3B 1WE6A 4WH4A 2N9KA 1WH3A 3ZQ4A 2WXKA 3IFWB 4K81A 2BW2A 1WF9A 3I63C 1WX7A 1VLBA 5GMVA 4YTMB 2N7DA 1QILA 4OZBA 1FFUA 2G4SA 1LGRA 2QMTA 4NAWB 4GXBA 1P98A 3CSFA 4C7ZA 4DHZB 2WXPA 1T0YA 1QOFA 2MBHA 3Q69A 3QA8A 3QARA 2WYQA 2MBBB 5DPWA 1JALA 4W9HA 2LHEA 3RI7C 3ZUNA 2MBEA 4OVVA 2J52A 3AEFB 1PGAA 2D3AA 2DWQA 2PTLA 5H8YE 5D3DA 3PZ7A 3CMMB 1OEYJ 2MX2A 2N9XA 1FMAD 1SE2A 1C76A 4C7YA 2V3PA 4DHZE 2IPKD 1RAXA 1KLGD 2R2QA 4W9LA 3FKYA 4E3CA 4ZYNA 2JWZA 2R61A 4PT5A 4ZRJA 1FXAA 4KSKC 2M4NA 2KHWB 4W9FA 4DHJB 4O1NA 2KNBA 2K6DB 4JWSC 3E56A 5HHDG 3T9LA 4EFOA 2JZPA 4M0WA 4HXDA 3WA0A 2EKIA 3ZNGC 5IAAC 4CO7A 1F1HA 3ZTCA 1QOBA 3V6CB 3LB8C 1XXGA 4GLSC 2LVQA 2NR2A 1IP9A 5JHBA 2IJ0A 1HQRD 4FA6A 3PS6A 1QF6A 1I7HA 2N9EB 5EE0A 2RPQA 2WP9B 4HKZE 2ZNVC 4FN2A 4TSSA 1A5RA 1WJNA 4AP4C 3PZDA 2ZCBA 1E7VA 4LCDE 1QKZA 4I6NB 2IGGA 4YT0B 4WJOA 1H4RA 2AX5A 1BMLC 3N32A 1MHHE 2WXNA 4W9DA 2QHOA 4KZ0A 4EE2A 5FKAC 1WGKA 4FULA 3VH4B 3AH7A 2WGSA 1TKEA 2NVUI 1WY8A 3QWZB 3PZ8A 5EDSA 1QQRA 1D5MC 2I2YA 3RUIB 4A55A 4WWPA 2OHFA 4JE3B 1XLNA 4N6EB 4IKGA 1UNSA 1YNTE 2N0SB 3K9OB 2GBNA 1KLUD 5CX3A 2JVCA 4NZLB 1YN4A 2DYOA 1D5ZC 5J2RA 1SGHA 3CWIA 3Q3JA 1FNUA 1JROA 3AEBB 4GDKB 2HJ8A 1HTQA 4KIKB 4KGRA 3VUXA 2JRHA 1UGJA 1JRUA 2JY6A 1FIQA 4ICVA 3Q8FA 4HROA 4OHJA 5IOIA 1XF5L 3AEEB 1WGHA 2ACZB 2BBCA 3N9YC 4A3PA 4HDQA 4MACA 4XDCA 2JQRB 1UWXA 3QC8B 3ZNID 3VRBB 4MEMA 3P1MA 2ZVNA 3Q3MC 2OJWA 1UF0A 4JL9A 1WJUA 5KHOA 2ZPYA 2MJDA 2CHWA 1YX5B 5T8IA 1UBQA 2MLBA 1WRDB 2MHJA 3KQ4A 1V1PB 5HKHA 2FBWB 2CHXA 3EECA 3W5UB 2VH2A 1V6EA 4BBNC 2TSSA 4LTUA 1V9JA 2ZW0A 1F2RC 1P7EA 4RF1A 4MSMB 4BBNF 4BKSD 4P7IA 2K1FA 3PT2B 4ARCA 1OEYA 2M56B 2BKRB 1VJKA 2D07B 5J17A 4AJWA 3KUCB 3R2TA 1C4AA 1Q10A 2PVGC 4WIPA 3HVZA 4RM8A 2J0JA 2N1WA 2I1JA 1I4QA 2K8BA 3V62A 5AEKB 2CKHB 1C79A 2PPHA 1TJEA 4KDIC 2OEDA 5D2MB 1T5XD 2C7MB 4ANXA 3TIXA 2BVCA 1F52A 1WZ3A 2ZEQA 2VH1A 2DYMA 5BYRA 2B3AA 1RRBA 4KSLC 3DPDA 3VHTC 2KMAA 3HM3A 4FHKA 4DXFA 2JXTA 2LZ6A 3ZJUA 1WXSA 3MFGA 4RMAA 1TZOA 4WQOB 1C1YB 2Y5PA 2WXJA 4NJ6A 1EF5A 1WXVA 4URKA 1WIAA 3AMZA 2L8JA 2X38A 3VUWA 2BQQA 2VRRB 2LGDA 3B0AA 3M95A 3ZDTA 1TY0A 3AULA 1MHXA 3W9CB 3VVWB 4RM9A 3TEXA 2E6XA 2J7QB 1J19A 3AE4B 4ZYSA 3DWGC 1TS2A 3ZJTA 3QX1A 1KH0A 4JQWC 3RNGC 1WGGA 4ZRQA 3DVGY 4GN1A 1HZ5A 1YQ3B 1WR6E 2PEAA 2GBJA 4RNAA 2GBMA 2L0FA 3WAPA 2BYEA 2LJIA 2AQ3B 1SB3C 2NPTA 3BIID 1EWCA 3AM9A 4YTPB 3UINB 3AECB 2JPHA 2PJHA 1A70A 2AL3A 2KXJA 1L2NA 1JWSD 2WU5B 3TBLD 4R3DA 5C2TB 1JWUD 3BYYB 3W5VB 1GB4A 1NBFC 1WXQA 2L52A 5BO4B 2K9XA 1E8WA 4P16A 3SU8X 1N6ZA 3DDCB 1V2YA 5D7GA 5FK9C 3VAWA 5CHWA 2O2VA 4IWQA 4LJPB 4PS3A 1WR1A 1K8RB 2JUOA 2KACA 4DK5A 2XK5B 2V4IB 4JIOU 1BXTA 2V1YA 4USAA 1JQ4A 2PW9A 4FBJB 2BWFA 1KOTA 1XLOA 3DHGC 2N9LA 4JPSA 5EE3A 2LVOA 1YQBA 2KDBA 1R4NB 4K7SA 5EE1A 2AL6A 1LXDA 2WXLA 3DBHB 4DQOC 2MSED 3WIMA 2L0TA 2BS2B 1V1OA 2CU3A 2DAFA 3FC4A 2V3NA 4GSWA 2BB6A 3IG3A 2V3SA 4L2YA 3A9KB 3ZW3A 4B6WA 1I4XA 1L4ZB 2MP2A 1WYGA 1V5TA 2KLGA 1YN5A 2WDQB 4TQ0A 1TIFA 1WWTA 1UZXB 1CZPA 2JZZA 1LM8B 3PREA 3DBHI 4BVUC 4MJSA 3PRPB 5AZFA 3B08A 1ZW7A 5BMHA 1UBIA 3FILB 3U7DA 2MBQA 2NCNA 2KDFB 3ZYYX 2FNJB 2G1EA 2K22A 4M8MA 5IA7A 3EA6A 2RMMA 3WANA 2PVOD 4P6VF 2KDMA 4Q2JA 2WDVB 1Z5SB 1IPGA 2D5GA 2LRUA 1L0XB 2INDC 3TL5A 1Q5WB 1V49A 4WAFA 4RF0A 1FFVA 1N61A 2NBUA 1L0YB 1MG8A 5AZGA 3W2DA 4NPNA 5FR6A 2LHDA 1PQSA 4BFRA 1E10A 4K1RB 5LLIA 2KDIA 4HLEA 1JRPA 4GU2A 1XLQA 1C77A 4BOSC 3LYYA 3Q3FA 2W9NA 5JXVA 1QLBB 3MHSD 1RM6C 4K7WA 2D11A 5LXHA 3APDA 4F7ZA 3LDZE 1VZ8A 1C78A 1SE3A 1UWMA 3TEYA 2KJ6A 4MT5A 3N1XC 1YX6B 2MW5A 1S3SG 2IO1B 2BF8B 3Q6BA 4LNKA 4ASWC 2ZW1A 3AEAB 4WJPA 1NI2A 4MH8A 2L05A 2HDEA 1XT9B 4W9CA 4W9JA 1QOGA 3O13A 3RN9C 4IOIE 1AARA 4JGHB 1JW9D 2XNAC 4MGYE 3T3OA 2BKFA 2PE6B 2KFKB 4GDLA 3JSVA 3PLUA 4GB9A 1V80A 2WXRA 1WE7A 1I35A 2BS3B 3KYDD 2ICIA 2IO3B 1PUTA 5JZEB 2EELA 3R66C 1SF0A 3A9JB 3PV1A
chains in the Genus database with same CATH topology
2M19A 4KKJA 1UGJA 2WLBA 3GP7A 1L6VA 1VDVA 2LUMA 1FIQA 2W54A 3Q8FA 4HROA 2J4XA 1XCQL 3IT6B 4OHJA 3VR9B 1FO4A 1B9RA 1V97A 3OWEB 2ON8A 5EE9A 1XF5L 3AEEB 4OW0A 2ACZB 4YWGG 1K52A 1DOIA 2BBCA 3N9YC 1OFFA 4WQMA 1ZE3D 4MACA 1HXYD 1AN8A 3Q8EA 2JQRB 1CQVA 1NENB 1UWXA 1CK1A 1TYGB 3NVYA 4XDCA 4DXGA 4RH6A 4AS1A 3BVGA 3E9SA 3VRBB 2H89B 2W3SA 3GS2A 3P1MA 4FXCA 4YSXB 3P42A 1EWYC 1D6EC 1AYFA 5MPOA 4US8A 3TUOA 2QEJC 3WCQA 2FE8A 3V3XA 2I38A 2MJDA 2WXQA 4H2AA 5T8IA 2JX5A 3AN1A 2KWDA 1GPXA 2HTME 2IGDA 1ROEA 3KQ4A 1V1PB 2CJOA 2FBWB 2MEKA 4ZRPA 3W5UB 4JX1C 2TSSA 4LTUA 2ZW0A 1F2RC 1P7EA 4RF1A 3BVZA 5H92C 1TY2A 4ARCA 2RDHA 2WXIA 3B9JA 1K50A 2CJNA 1R7SA 1ZDVA 2M56B 5HG2A 3HVDA 2NTTA 3UI3A 2KAJA 3IAM1 3NVZA 4REZA 1VJKA 2AQ1B 2BTEA 2N7JA 3AE6B 4XWWA 1GB1A 1ENFA 1PGXA 2WU2B 2H88B 3MP9A 1YN3A 1TKYA 1F77A 1C4CA 1KFYB 1MVKA 3U4EG 4ZHPA 3R2TA 3HRDD 5BYSA 2V0GA 1C4AA 1Q10A 2PVGC 4A6QA 3AE7B 4WIPA 1TS5A 1XEEA 3HVZA 3R2IA 2QIEB 1I4QA 4OVZA 4KGTA 1OQRA 5I4DA 2GI9A 1C79A 2INPE 1TJEA 2Z8LA 2OEDA 1DGJA 2YEPF 1T5XD 3U52E 1SBBB 4RGNA 2JYEA 1KF6B 3P4RB 4US9A 1UUPA 3TSSA 4TMAB 2DYMA 2WQYB 5BYRA 4L23A 2SEBD 2DBYA 2PIAA 1IBXA 1FD6A 1ZXHA 1YQ4B 4DXFA 1XCTL 4B0EA 4C80A 3ABVB 2JXTA 3KLSX 4KKIA 3ZJUA 3MFGA 1JCKB 4ZOHC 1PYWD 3NVVA 4N58A 4UDUC 1CJEA 4C56C 1TZOA 2LMCA 1VZ7A 3AE3B 4HKQA 2W55A 2WNMA 2Y5PA 2WXJA 2YEPB 1NYRA 3NVWA 4WURA 1K53A 3VQIA 3AMZA 2WS3B 1IGDA 1L4DB 2X38A 5BMGA 1KRHA 3AEGB 3SEBA 1NYQA 1RYJA 3AE8B 4ITKA 4YTNB 5HFYA 4RGTA 2FUG1 1KTKA 3W1SA 5C3JB 3I9V1 2E3TA 2NTSA 5AUKA 1TY0A 1MHXA 3AB5A 3W9CB 3EGRA 1MI0A 3TEXA 2E6XA 3BYTB 1NEKB 2WXFA 3AE4B 4ZYSA 3DWGC 1TS2A 3ZJTA 3MJ5A 3NS1A 1KH0A 3PO0A 2MJEA 3FAHA 3R8BA 2RDGA 3KWLA 1L5PA 1ZPSA 5GXGB 1Y56A 1SE4A 1MPEA 1V1PA 4ZRQA 2M0AA 4AQ7A 1I4RA 1L0VB 1HZ5A 1YQ3B 2GRIA 1EU4A 2XN9C 2K3UA 4OZAA 4RNAA 1K51A 1GOZA 2SAKA 2QSDA 1E0ZA 2KN4A 3TEWA 2MH7A 1T6BX 1JMLA 2PKOA 2LJIA 2AQ3B 2WXGA 2KQ4X 3AEDB 2ONQA 1ZOYB 1SB3C 2BYTA 1VZ6A 1N63A 3BIID 3BZDB 3KWVA 1EWCA 3AM9A 4YTPB 4RCOA 1FRRA 1I4PA 3AECB 2Y3AA 2BB5A 3HUIA 4RGMA 1FNWA 1A70A 2JWUA 5D3IB 1HA5A 1TKGA 1FM0D 3SFEB 3MC0B 3U2SC 1JWSD 2WU5B 1C4PA 1E6EB 2B76B 1QT9A 4R3DA 1B1ZA 1DOYA 5C2TB 3H8HA 3SFDB 3BK1A 3T3NA 1J7AA 4L1BA 1PFDA 1SSNA 1JWUD 3BYYB 3W5VB 1DOXA 1GB4A 4WWMA 4A8XC 1WXQA 2L52A 1IUEA 2K9XA 3IAS1 2RPVA 1T3QA 3ZJVA 1JWAD 4P16A 2DLBA 1EM7A 2J42A 1NI3A 5D7GA 1GAQB 5FK9C 4RGOS 4JWUC 1SIJA 4YSZB 4KGSA 1N60A 2LGIA 1D4BA 1P7FA 2Q5WD 1XO3A 1L6UA 2KACA 3J9CA 2V4IB 2J53A 2INNE 1BXTA 4USAA 1ET6A 1JQ4A 2PW9A 1SJED 1FRDA 1ZDXA 3VRAB 1XLOA 5BMIA 2N9LA 4JPSA 2VZKD 5EE3A 1FCLA 3L4PA 3V05A 1SXTA 1LO5D 3GB1A 2WXOA 4MM3B 1I4HA 2VZKB 4WH4A 5EE1A 2N9KA 3ZQ4A 2WXLA 2WXKA 1N5XA 2BW2A 4DQOC 2MJ3A 1VLBA 4YXDB 4A9AA 2AQ2B 1VR9A 4YTMB 1J7CA 1FXIA 4NAMA 2BS2B 1QILA 4OZBA 1N5WA 1V1OA 2CU3A 1WSPA 3FC4A 1FFUA 2V3NA 2QMTA 1ACCA 4NAWB 2BB6A 4HRSA 1QOAA 4LK0M 4C7ZA 2QJLA 4HEA1 4D2KA 1FNVA 5FR3A 1I4GA 4L2YA 1I4XA 2WXPA 1QOFA 2W82A 1L4ZB 3I57A 3Q8BA 1WYGA 2WXHA 4KX6B 3ETRA 1SEBD 3Q69A 1FEHA 2BS4B 1YN5A 2WDQB 1IGCA 3B2GA 4TQ0A 2IGHA 1JALA 1V8CA 1WWTA 4IDIA 2LHEA 4ARIA 1CZPA 4OZCA 4RFBA 2J52A 3AE5B 3AEFB 4GDLB 1PGAA 5BMHA 3FILB 3VR8B 2DWQA 2PTLA 5H8YE 5D3DA 3PZ7A 5AUIA 2PMVA 4XE0A 3ZYYX 4A90A 2G1EA 1FMAD 1SE2A 1C76A 2W3RA 1OQQA 1C9FA 1J7BA 2L83A 3AE9B 2K22A 1TS4A 2NMQA 4C7YA 2V3PA 2IPKD 1XLPA 3EA6A 3AE1B 1KLGD 2RMMA 2KMMA 2PVOD 4CQNA 4P6VF 2KDMA 3P63A 4Q2JA 4N59A 1SJHD 4PT5A 2R61A 1BUIC 2WDVB 3SR6A 2D5GA 2G9HD 1F0ZA 1L0XB 1F2RI 2LEKA 1FXAA 5BYQA 1PGBA 4WAFA 5HI1A 1HZ6A 4O1NA 4RF0A 3P4PB 4NJCA 4JWSC 3E56A 4XDDA 5HHDG 3Q8AA 1FFVA 2JZPA 2WDRB 3MHZA 4M0WA 1N61A 2L32A 1L0YB 3ZGZA 1FCCC 3P4QB 2LFIA 2EKIA 3W2DA 3P4SB 1N62A 2LHDA 3U7ZA 1QOBA 1YMHE 3LB8C 5LNK1 1XXGA 2JYTA 4GLSC 1E7PB 1E10A 1RFKA 4B0MA 1M4VA 2IJ0A 1HQRD 2IDYA 1QF6A 1I7HA 1JRPA 4YSYB 5EE0A 2K5PA 4HJGE 2WP9B 3AE2B 3Q8CA 5G5HA 1ZXIA 1AWDA 1XLQA 4HKZE 1C77A 1YJJA 3LYYA 2Y5CA 2WXMA 1ET9A 5JXVA 3NRZA 4TSSA 1QLBB 3RPFC 1AW7A 3BWUD 1RM6C 3BVMA 5TSSA 1QKZA 1EU3A 2IGGA 4YT0B 3EUB2 3AV8A 2AX5A 1BMLC 1MHHE 2WXNA 1VZ8A 3B2FA 1C78A 1SE3A 1VRAB 1D5XC 1UWMA 2K0PA 3NUHB 4EE2A 3TEYA 1HEZE 3BK2A 1DYQA 5FKAC 4MT5A 1WGKA 4LLGM 4TQ1A 3CIRB 3NZ3A 5E6JA 5G5GA 3AH7A 1TKEA 2ZW1A 3AEAB 1ZP0B 3RFZB 3PZ8A 1E9MA 4MH8A 4J3OD 1JWMD 1QQRA 2HDEA 2L1AA 1D5MC 1ESFA 3IXSA 2I2YA 1WRIA 4A55A 1QOGA 3O13A 2OHFA 4IOIE 4JE3B 1XLNA 4N6EB 4IKGA 1JW9D 2XNAC 3T3OA 1UNSA 3DWMA 2JU6X 1YNTE 1PDXA 2N0SB 1YJIA 3FILA 2WXRA 1JWBD 1KLUD 4XWTA 3TEZA 3C8YA 1TS3A 3URYA 2GB1A 2BS3B 4NZLB 1YN4A 1NVID 1D5ZC 2DYOA 2ICIA 1PUTA 2PLPA 1IBXB 3CWIA 4ZHOA 2JSVX 2BT6A 1STEA 1FNUA 1ZUD2 3IT4B 2EELA 1JROA 3AEBB 1SF0A 4GDKB 3LXFA 1RWSA 4KGRA 2QILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBX A;  1FD6 A;  1ZXH A;  2LUM A;  5HHD G;  2JZP A;  1XCT L;  1XCQ L;  1FCC C;  2JXT A;  4KGS A;  2LGI A;  1D4B A;  1P7F A;  2ON8 A;  1XF5 L;  2LHD A;  1YMH E;  1K52 A;  2KAC A;  4GLS C;  2J53 A;  4MAC A;  2PW9 A;  1UWX A;  1K53 A;  5BMI A;  2N9L A;  1IGD A;  1FCL A;  5BMG A;  3GB1 A;  4HJG E;  4WH4 A;  5HFY A;  4HKZ E;  2N9K A;  5JXV A;  1MHX A;  3V3X A;  2I38 A;  1MI0 A;  4OZB A;  2KWD A;  1QKZ A;  2IGD A;  2IGG A;  2QMT A;  1KH0 A;  1MHH E;  2ZW0 A;  1F2R C;  1P7E A;  4D2K A;  2K0P A;  1HEZ E;  1MPE A;  1K50 A;  5HG2 A;  1HZ5 A;  3UI3 A;  2ZW1 A;  2N7J A;  4OZA A;  1K51 A;  1IGC A;  2QSD A;  2IGH A;  1GB1 A;  2KN4 A;  1PGX A;  1JML A;  3MP9 A;  2LHE A;  2I2Y A;  2KQ4 X;  2ONQ A;  1MVK A;  4OZC A;  2J52 A;  1PGA A;  5BMH A;  4IOI E;  3FIL B;  1Q10 A;  4IKG A;  2PTL A;  2JU6 X;  1YNT E;  2JWU A;  3FIL A;  1C9F A;  2NMQ A;  4KGT A;  2GI9 A;  2RMM A;  2GB1 A;  1GB4 A;  2KDM A;  2OED A;  1IBX B;  2PLP A;  2JSV X;  2RPV A;  1F2R I;  2EEL A;  1PGB A;  1EM7 A;  4KGR A;  5HI1 A;  1HZ6 A; 
#chains in the Genus database with same CATH topology
 5JH5 C;  1L6V A;  1VDV A;  2JXX A;  3NHE B;  1FO4 A;  1J0G A;  3RNB C;  1V97 A;  3OWE B;  1RFA A;  2LVP A;  4I6P A;  1DOI A;  1OFF A;  4WQM A;  3Q8E A;  1AN8 A;  1CQV A;  4DXG A;  3NVY A;  1TYG B;  3RNC C;  1WMH A;  2IY0 B;  3BVG A;  4HWI B;  3KW5 B;  1UH6 A;  4FXC A;  3P42 A;  1EWY C;  1AYF A;  3OAW A;  2L76 A;  4US8 A;  2QEJ C;  3WCQ A;  2FE8 A;  3VH3 B;  2XEW A;  3AN1 A;  3ZRC A;  1KM7 A;  2AWT A;  2MRP A;  4M8N A;  3WAL A;  4S0R A;  4EZL A;  2N9P C;  4B9K A;  3Q3N C;  5H92 C;  1HE8 A;  2WXI A;  3L17 A;  1ZKH A;  4F8C B;  5HG2 A;  4IC7 B;  2NTT A;  2KAJ A;  3IAM 1;  1TZ1 A;  2BTE A;  2RSU A;  2N7J A;  3AE6 B;  1WX8 A;  4XWW A;  2LUE A;  2X8X X;  1ENF A;  1UEL A;  2WU2 B;  3I3T B;  2H88 B;  3ZKJ C;  3MP9 A;  4DXA B;  1YN3 A;  4K3C A;  4ZHP A;  4HCN B;  1UD7 A;  2UWQ A;  3DBL B;  3K9P B;  1XEE A;  3T8M A;  3R2I A;  1WJ4 A;  2QIE B;  4FJV B;  4OVZ A;  1EO6 A;  4KGT A;  2GI9 A;  3A4S C;  1S1Q B;  2YEP F;  5D94 A;  4RGN A;  1KF6 B;  2JYE A;  2FCM A;  3TSS A;  1UUP A;  4G11 A;  1IBX A;  2PIA A;  1P3Q U;  2LXA A;  1ZXH A;  1NDD A;  4N9F 4;  4B0E A;  2ZPN A;  4LNN A;  3KLS X;  4FHJ A;  3HHM A;  3L08 A;  4UDU C;  1CJE A;  2REX A;  2KTR A;  3ZDM C;  4HKQ A;  2ZCC A;  4HK2 A;  2W55 A;  2KWV B;  1IYF A;  3CF6 E;  2MBO A;  4WJQ A;  3DBL I;  2D3C A;  4EZK A;  4G3X B;  1FPY A;  3NVW A;  3HM6 X;  4II3 B;  1VCB A;  4I6L B;  2N1V A;  3AEG B;  2NS5 A;  4DDG D;  3A33 B;  4ITK A;  5HFY A;  4RGT A;  2HJ1 A;  1GUA B;  5E6N A;  5C3J B;  5AUK A;  2D3B A;  2C60 A;  3DCG A;  3MJ5 A;  3PO0 A;  2WDT B;  2NBV B;  2RDG A;  3KWL A;  1SE4 A;  1MPE A;  2MWS B;  1WX9 A;  4PK1 A;  4AQ7 A;  4ANV A;  3HK0 A;  3M62 B;  2D2Q A;  4NY0 A;  1T0R C;  2KX0 A;  3GZN B;  4OZA A;  1K51 A;  4DBG A;  1C3T A;  2SAK A;  2O6V A;  4TUU A;  4PS7 A;  3BIN A;  1E0Z A;  2K6Q A;  3OG5 A;  3TEW A;  2MH7 A;  1T6B X;  1YIW A;  3APF A;  1ZOY B;  3R7Q A;  4RCO A;  1I4P A;  3DVG X;  2BB5 A;  3HUI A;  1FNW A;  3RYT A;  3OJ3 A;  2INC C;  4A20 A;  2JWU A;  1EUV B;  2UYZ B;  1HA5 A;  1FM0 D;  4IM0 A;  3MC0 B;  3RZW C;  3U2S C;  3VDZ A;  3ZO5 B;  2B76 B;  3BK1 A;  2IO2 B;  4L1B A;  1PFD A;  3DBS A;  4A8X C;  1IUE A;  3H9D A;  2RPV A;  1V5O A;  1JWA D;  4M0W B;  2DLB A;  1NI3 A;  2CR5 A;  2L3Z A;  3QQ8 B;  2RD0 A;  3SD5 A;  2BPS A;  4KGS A;  4XC2 A;  3QCA A;  1SE9 A;  4FAD A;  1WGY A;  2CS4 A;  3U30 A;  2Z0D B;  1L6U A;  4W9E A;  3W1S C;  1BT0 A;  2DHZ A;  4TV3 A;  1SJE D;  1FRD A;  2BYF A;  3VRA B;  2VZK D;  3A1Q A;  3N20 C;  2KMC A;  3L4P A;  4C4V A;  1SXT A;  1LO5 D;  3GB1 A;  3L16 A;  1H8C A;  3IVF A;  1QZE A;  2MJ3 A;  5J18 A;  3ZXR A;  4EKU A;  4YXD B;  4E71 A;  1FXI A;  4NAM A;  1N5W A;  1WSP A;  2KX3 A;  3ZLZ A;  4HRS A;  2QJL A;  2D3G A;  1FNV A;  1I4G A;  1WGD A;  4K3B A;  2RDB C;  3DHI C;  2W82 A;  1OGW A;  1I42 A;  4NQL B;  3IHP C;  3Q8B A;  4KX6 B;  3ETR A;  3WAO A;  1SEB D;  3ZIM A;  2BS4 B;  2A5U A;  2FCQ A;  1IGC A;  2IGH A;  3NG0 A;  4KV2 A;  2JT4 B;  2M0X A;  3TJP A;  1YD8 U;  3PHW B;  4MGI E;  1WXA A;  4OZC A;  3GE3 C;  4RFB A;  3H6N A;  3VR8 B;  1KJT A;  5AUI A;  2PMV A;  4C00 A;  1WJ6 A;  2W3R A;  3H7P A;  1C9F A;  2L83 A;  1TS4 A;  2LGS A;  1XD3 B;  2NMQ A;  1XLP A;  2JRI B;  3TCA A;  4M01 A;  2KFJ A;  3P63 A;  4K7U A;  4N59 A;  1SJH D;  3SR6 A;  1BUI C;  2GMI C;  2LEK A;  2WWZ A;  1PGB A;  1R4M B;  3P4P B;  2EMS A;  3Q8A A;  2L32 A;  3ZGZ A;  1FCC C;  3C19 A;  2CHZ A;  2LFI A;  3L10 B;  3P4Q B;  2LGX A;  4LDT D;  1N62 A;  1YMH E;  5LNK 1;  1L7Y A;  1M4V A;  4JLC A;  1MFW A;  3KYC D;  2K5P A;  3AE2 B;  5G5H A;  1ZXI A;  2KTF A;  4DDI D;  3NZS A;  4E74 A;  3EC8 A;  1YJJ A;  1VD2 A;  2Y5C A;  1ET9 A;  3ENE A;  4MM3 A;  1R4M I;  3PPA A;  3IBE A;  1EU3 A;  2Z59 B;  3EUB 2;  3P2B A;  3AV8 A;  3UQB A;  2KD0 A;  5IP4 D;  1F9J A;  2DZM A;  3ALB A;  3B2F A;  1VRA B;  1D5X C;  2WHI A;  3NUH B;  4KZC A;  1DYQ A;  3UQA A;  1GC6 A;  4NAW A;  4HJK A;  3DVN V;  4TQ1 A;  3CIR B;  4ACF A;  1J8C A;  2GBR A;  4FLH A;  5E6J A;  5G5G A;  2KJH B;  3RCZ A;  2KFK A;  1E5W A;  3NY5 A;  3W1Y A;  1E9M A;  4J3O D;  1JWM D;  3N30 A;  4KVG B;  2KYW A;  4DWF A;  4WWN A;  3PRZ A;  1V86 A;  2WX1 A;  3PGE A;  4HPL B;  2LD9 A;  2JU6 X;  2ZJD A;  1YJI A;  2JZ3 B;  3TEZ A;  3O65 B;  1TS3 A;  2DZK A;  3URY A;  4MSQ B;  4XGA B;  1NVI D;  3NJT A;  2RR9 A;  4ZHO A;  2JSV X;  1R4N I;  1ZUD 2;  3ONS A;  5AZH A;  3M3J A;  1RWS A;  4KKJ A;  3GP7 A;  2LUM A;  4ZRI A;  2J4X A;  2WX0 A;  3VR9 B;  3JVZ X;  3RD2 A;  4OW0 A;  4YWG G;  1K52 A;  3V6E B;  3N1Z C;  2KWU B;  1NEN B;  3UIO B;  3DHH C;  2H89 B;  2W3S A;  4WAA A;  3GS2 A;  1RLF A;  5CTR C;  4YSX B;  1Y8R C;  4XYC A;  4MEL A;  5MPO A;  4EUT A;  2I38 A;  2JX5 A;  3A4R A;  2IGD A;  4IW0 A;  4EEW A;  4WJN A;  3JW0 X;  3NZU A;  1LQB A;  2MEK A;  2L00 B;  4JX1 C;  3QAQ A;  2M1M A;  3M63 B;  3PVL A;  2RDH A;  3L13 A;  2CJN A;  1ZDV A;  3HVD A;  2KKC A;  3UI3 A;  3NVZ A;  4REZ A;  2AQ1 B;  1FXT B;  3MC9 A;  2NPT B;  2G3Q B;  1PGX A;  2KLC A;  1TKY A;  1C4C A;  2DX5 B;  3Q2A C;  5JHA A;  2AEH A;  1WM2 A;  4A6Q A;  4HCP B;  1TS5 A;  1XQQ A;  1OQR A;  1SIF A;  2IY1 B;  4M00 A;  3V60 A;  4AWJ A;  2DYB A;  2INP E;  2Z8L A;  2N4F A;  2IZV B;  3RNF C;  2K8C A;  2GLS A;  3P4R B;  4US9 A;  2WQY B;  4L23 A;  2SEB D;  1FD6 A;  2O2V B;  1YQ4 B;  2BGF A;  3R7R A;  4GDK A;  4KIK A;  1JCK B;  2KDE B;  2KQS A;  4N58 A;  4C56 C;  2BYV E;  2LMC A;  1VZ7 A;  3H1U A;  3PSE B;  3PLV A;  3VUY A;  2J0K A;  1NYR A;  4WUR A;  3VQI A;  2DZJ A;  1WZ0 A;  4MGZ E;  2WS3 B;  1IGD A;  1L4D B;  5TR5 A;  3SEB A;  2Y5B B;  1MG4 A;  1NYQ A;  3AE8 B;  3MC8 A;  4YTN B;  2FUG 1;  1P9D U;  3W1S A;  3I9V 1;  3VTU A;  2NTS A;  3EHV A;  3UF8 A;  2ZNV B;  3ZXV A;  4MGK E;  2NBW B;  3VTW A;  1NEK B;  2WXF A;  1KLV A;  3VFK A;  3NS1 A;  2MJE A;  2MP2 B;  3R8B A;  2L7R A;  5GXG B;  1Y56 A;  1V1P A;  5IO9 A;  1TBE A;  4LNF A;  4II2 B;  2M0A A;  1I4R A;  1L0V B;  1Q0W B;  4HVB A;  2XN9 C;  4PS8 A;  5E6O A;  3L0W B;  2K3U A;  3D32 A;  4MJS B;  3Q14 C;  2PKO A;  4ZRK A;  2G4D B;  2WXG A;  2KQ4 X;  2UU7 A;  3AED B;  2BYT A;  1N63 A;  3BZD B;  3KWV A;  3I5J C;  1FRR A;  1GNU A;  3GE8 C;  2Y3A A;  4RGM A;  5D3I B;  1OQY A;  2V4L A;  3SFE B;  3UGB B;  1C4P A;  1E6E B;  1DOY A;  1B1Z A;  3SFD B;  3ZVV A;  1SSN A;  1V81 A;  1MJD A;  4W9I A;  1DOX A;  4WWM A;  1GJZ A;  2MQJ A;  1M94 A;  1EM7 A;  1GAQ B;  1P1A A;  4OVU A;  4RGO S;  5CHF A;  4JWU C;  4LNO A;  4YSZ B;  1LFD A;  3VXW A;  2LGI A;  1P7F A;  2M17 A;  2Q5W D;  1XO3 A;  5IKC M;  2J53 A;  1OTR B;  2INN E;  3RUL A;  5DPT A;  1ET6 A;  2KOX A;  2FAZ A;  5DPS A;  1FCL A;  3NOB A;  3V05 A;  2A4Z A;  1EF1 A;  1I4H A;  2VZK B;  3OLM D;  2ZVO A;  1N5X A;  4J6I A;  4A9A A;  2AQ2 B;  1VR9 A;  2FIF A;  1J7C A;  5G2N A;  2LGY A;  4TKN A;  2QCZ A;  3KH0 A;  2EMT A;  1ACC A;  1X1M A;  2LAS A;  1QOA A;  1Z2M A;  4LK0 M;  4HEA 1;  4D2K A;  5FR3 A;  4WWO A;  1WI0 A;  4G50 A;  2KVR A;  3KUD B;  3I57 A;  2WXH A;  1FEH A;  2KC1 A;  3VTV A;  3B2G A;  3AU5 A;  1V8C A;  4IDI A;  4HPP A;  3RZF A;  3KVF B;  4ARI A;  2I1K A;  2C9W B;  3AE5 B;  4GDL B;  3JSV B;  3PHX B;  4BKT A;  1T0S C;  5DPR A;  4FJY A;  4S17 A;  4XE0 A;  3GOE A;  2HE7 A;  4A90 A;  1OQQ A;  1J7B A;  3N1Y C;  3AE9 B;  2FID A;  3AE1 B;  2KMM A;  4CQN A;  5C23 A;  4DHJ D;  4ANU A;  2G9H D;  5CHV C;  1F0Z A;  2JF5 A;  1F2R I;  3L54 A;  5D6J B;  3B1L X;  5BYQ A;  4EZJ A;  5HI1 A;  1HZ6 A;  1D3Z A;  2KAN A;  3EFU A;  4NJC A;  4XDD A;  3QK0 A;  3U8Z A;  1WXM A;  2WDR B;  3MHZ A;  4NNJ B;  4NQK E;  4IWO A;  3P4S B;  2K25 A;  3U7Z A;  1WMH B;  2JYT A;  4CYE A;  4LDT B;  1E7P B;  2LRW A;  1RFK A;  4B0M A;  4B95 A;  2IDY A;  3ML8 A;  2FCN A;  4YSY B;  1WM3 A;  2XK5 A;  4X57 B;  2HD5 B;  4HJG E;  3Q8C A;  3GZN I;  4XX5 A;  3JYU A;  1AWD A;  2LJ5 A;  4PYZ A;  4BKG A;  2FUH B;  2WXM A;  3NRZ A;  5KHQ A;  2KZR A;  4YL8 A;  3RPF C;  1AW7 A;  1WGR A;  3BWU D;  1WFY A;  3BVM A;  5TSS A;  4QAY A;  2AYO B;  1E8X A;  4F1S A;  2C7N B;  2KO3 A;  2K0P A;  1HEZ E;  3BK2 A;  4LLG M;  3NZ3 A;  3Q3O C;  3H7S A;  4W9G A;  1TGZ B;  3A9K A;  1P0R A;  3AU4 A;  1ZP0 B;  3RFZ B;  4GIV A;  4IWP A;  3QHT A;  2L1A A;  4IUM B;  1ESF A;  3IXS A;  1UGM A;  2C5L C;  4MH0 E;  1WRI A;  3RNE C;  3DQV A;  5C1Z A;  3AI5 A;  5E6P A;  3DWM A;  3DOW A;  4HDO A;  1PDX A;  3FIL A;  1JWB D;  4W9K A;  4XWT A;  2DZI A;  3C8Y A;  3BY4 B;  2GOW A;  2GB1 A;  1IBX B;  2PLP A;  2DNF A;  2BT6 A;  1STE A;  3IT4 B;  4IG7 B;  1G6J A;  1WYW B;  3LXF A;  2Z0E B;  2QIL A;  2M19 A;  2WLB A;  2KC2 A;  2KTR B;  2W54 A;  3LJ3 A;  1XCQ L;  3IT6 B;  2RGF A;  1B9R A;  2ON8 A;  5L83 A;  2EKE C;  5EE9 A;  3WAM A;  1ZE3 D;  1HXY D;  2KT7 A;  4ZDV A;  1CK1 A;  3CST A;  2MA9 B;  4RH6 A;  4AS1 A;  3E9S A;  2KVZ A;  3RMK C;  3ECI A;  3QIJ A;  1D6E C;  4AOF A;  5G55 A;  3TUO A;  3SDL C;  3V3X A;  4H2A A;  2WXQ A;  1GPX A;  2KWD A;  3X23 A;  2HTM E;  1ROE A;  5DCN A;  2CJO A;  2K39 A;  1E90 A;  2IO0 B;  2XBB C;  4ZRP A;  3PTF C;  2QDF A;  3BVZ A;  2KQ7 A;  2O6V B;  1TY2 A;  3B9J A;  1K50 A;  1R7S A;  3C0R B;  2D10 A;  3DBR B;  1CMX B;  4P1B C;  1U4A A;  3ZTD A;  1GB1 A;  3UIP B;  2KN5 A;  1F77 A;  1KFY B;  3KUZ A;  1MVK A;  3U4E G;  2QC8 A;  2MCN B;  2KK8 A;  3HRD D;  5BYS A;  2V0G A;  4ICU A;  3AE7 B;  4NJ7 A;  2BWE S;  4AUQ C;  3V61 A;  5I4D A;  3R3M A;  2YVC A;  4ANW A;  1DGJ A;  3ZNZ B;  3U52 E;  1SBB B;  5LXI B;  1HTO A;  2DEN B;  4KDL B;  4IM3 A;  3HIZ A;  4M02 A;  4TMA B;  2G45 B;  3DBR I;  2DBY A;  1ISN A;  1XCT L;  4PYU A;  4C80 A;  2LXC A;  3A9J A;  3ABV B;  4KKI A;  4ZOH C;  1PYW D;  3NVV A;  1ZGU B;  3AE3 B;  4G0N B;  3A1Q B;  2WNM A;  2ASQ A;  4C4V B;  2YEP B;  3TMP B;  4MDK E;  1K53 A;  2IBI B;  2IYD B;  5BMG A;  1KRH A;  1T0Q C;  3RNA C;  2PE9 A;  1RYJ A;  1KTK A;  3QJZ A;  2E3T A;  2OOB B;  4GMV A;  3AB5 A;  3EGR A;  1GG3 A;  1MI0 A;  3BYT B;  2C7H A;  3EFC A;  4HPM B;  3FAH A;  3MTN B;  2KJR A;  3APC A;  1L5P A;  2CU1 A;  1ZPS A;  2KWC A;  1YOV B;  2ZZP B;  3ZRF A;  2GRI A;  1EU4 A;  4XZ4 A;  2LI5 A;  3S2A A;  3MJW A;  1GOZ A;  2QSD A;  2OJR A;  2KN4 A;  1TT5 B;  3PRM B;  3DVN U;  4BKS A;  3N3K B;  1JML A;  1E8Y A;  2R2O A;  2ONQ A;  1VZ6 A;  4BAX A;  4A3O A;  3H7P B;  2O6V D;  1GC7 A;  3RT3 B;  2M8S A;  4BZA A;  5L95 C;  1TKG A;  2DAJ A;  1QT9 A;  3H8H A;  4LJO B;  3T3N A;  1J7A A;  1E8Z A;  2HTH A;  1Q1O A;  2YLM A;  3AXC A;  2N7E A;  3IAS 1;  3ML9 A;  2J0M A;  4GOC A;  4BOZ B;  1E7U A;  1T3Q A;  3ZJV A;  1YJ1 A;  4LNI A;  5IN7 A;  4EOY A;  2J42 A;  2LWP A;  4FJZ A;  3NS8 A;  1SIJ A;  2V9H A;  1N60 A;  4AJY B;  1D4B A;  2FCS A;  2K8H A;  3SHQ A;  4CHK A;  4IM2 A;  3X0W A;  3J9C A;  1TTN A;  3OJ4 B;  4P1C C;  3ZNH B;  2GBK A;  1ZDX A;  5BMI A;  2WXO A;  4GGQ A;  4MM3 B;  1WE6 A;  4WH4 A;  2N9K A;  1WH3 A;  3ZQ4 A;  2WXK A;  3IFW B;  4K81 A;  2BW2 A;  1WF9 A;  3I63 C;  1WX7 A;  1VLB A;  5GMV A;  4YTM B;  2N7D A;  1QIL A;  4OZB A;  1FFU A;  2G4S A;  1LGR A;  2QMT A;  4NAW B;  4GXB A;  1P98 A;  3CSF A;  4C7Z A;  4DHZ B;  2WXP A;  1T0Y A;  1QOF A;  2MBH A;  3Q69 A;  3QA8 A;  3QAR A;  2WYQ A;  2MBB B;  5DPW A;  1JAL A;  4W9H A;  2LHE A;  3RI7 C;  3ZUN A;  2MBE A;  4OVV A;  2J52 A;  3AEF B;  1PGA A;  2D3A A;  2DWQ A;  2PTL A;  5H8Y E;  5D3D A;  3PZ7 A;  3CMM B;  1OEY J;  2MX2 A;  2N9X A;  1FMA D;  1SE2 A;  1C76 A;  4C7Y A;  2V3P A;  4DHZ E;  2IPK D;  1RAX A;  1KLG D;  2R2Q A;  4W9L A;  3FKY A;  4E3C A;  4ZYN A;  2JWZ A;  2R61 A;  4PT5 A;  4ZRJ A;  1FXA A;  4KSK C;  2M4N A;  2KHW B;  4W9F A;  4DHJ B;  4O1N A;  2KNB A;  2K6D B;  4JWS C;  3E56 A;  5HHD G;  3T9L A;  4EFO A;  2JZP A;  4M0W A;  4HXD A;  3WA0 A;  2EKI A;  3ZNG C;  5IAA C;  4CO7 A;  1F1H A;  3ZTC A;  1QOB A;  3V6C B;  3LB8 C;  1XXG A;  4GLS C;  2LVQ A;  2NR2 A;  1IP9 A;  5JHB A;  2IJ0 A;  1HQR D;  4FA6 A;  3PS6 A;  1QF6 A;  1I7H A;  2N9E B;  5EE0 A;  2RPQ A;  2WP9 B;  4HKZ E;  2ZNV C;  4FN2 A;  4TSS A;  1A5R A;  1WJN A;  4AP4 C;  3PZD A;  2ZCB A;  1E7V A;  4LCD E;  1QKZ A;  4I6N B;  2IGG A;  4YT0 B;  4WJO A;  1H4R A;  2AX5 A;  1BML C;  3N32 A;  1MHH E;  2WXN A;  4W9D A;  2QHO A;  4KZ0 A;  4EE2 A;  5FKA C;  1WGK A;  4FUL A;  3VH4 B;  3AH7 A;  2WGS A;  1TKE A;  2NVU I;  1WY8 A;  3QWZ B;  3PZ8 A;  5EDS A;  1QQR A;  1D5M C;  2I2Y A;  3RUI B;  4A55 A;  4WWP A;  2OHF A;  4JE3 B;  1XLN A;  4N6E B;  4IKG A;  1UNS A;  1YNT E;  2N0S B;  3K9O B;  2GBN A;  1KLU D;  5CX3 A;  2JVC A;  4NZL B;  1YN4 A;  2DYO A;  1D5Z C;  5J2R A;  1SGH A;  3CWI A;  3Q3J A;  1FNU A;  1JRO A;  3AEB B;  4GDK B;  2HJ8 A;  1HTQ A;  4KIK B;  4KGR A;  3VUX A;  2JRH A;  1UGJ A;  1JRU A;  2JY6 A;  1FIQ A;  4ICV A;  3Q8F A;  4HRO A;  4OHJ A;  5IOI A;  1XF5 L;  3AEE B;  1WGH A;  2ACZ B;  2BBC A;  3N9Y C;  4A3P A;  4HDQ A;  4MAC A;  4XDC A;  2JQR B;  1UWX A;  3QC8 B;  3ZNI D;  3VRB B;  4MEM A;  3P1M A;  2ZVN A;  3Q3M C;  2OJW A;  1UF0 A;  4JL9 A;  1WJU A;  5KHO A;  2ZPY A;  2MJD A;  2CHW A;  1YX5 B;  5T8I A;  1UBQ A;  2MLB A;  1WRD B;  2MHJ A;  3KQ4 A;  1V1P B;  5HKH A;  2FBW B;  2CHX A;  3EEC A;  3W5U B;  2VH2 A;  1V6E A;  4BBN C;  2TSS A;  4LTU A;  1V9J A;  2ZW0 A;  1F2R C;  1P7E A;  4RF1 A;  4MSM B;  4BBN F;  4BKS D;  4P7I A;  2K1F A;  3PT2 B;  4ARC A;  1OEY A;  2M56 B;  2BKR B;  1VJK A;  2D07 B;  5J17 A;  4AJW A;  3KUC B;  3R2T A;  1C4A A;  1Q10 A;  2PVG C;  4WIP A;  3HVZ A;  4RM8 A;  2J0J A;  2N1W A;  2I1J A;  1I4Q A;  2K8B A;  3V62 A;  5AEK B;  2CKH B;  1C79 A;  2PPH A;  1TJE A;  4KDI C;  2OED A;  5D2M B;  1T5X D;  2C7M B;  4ANX A;  3TIX A;  2BVC A;  1F52 A;  1WZ3 A;  2ZEQ A;  2VH1 A;  2DYM A;  5BYR A;  2B3A A;  1RRB A;  4KSL C;  3DPD A;  3VHT C;  2KMA A;  3HM3 A;  4FHK A;  4DXF A;  2JXT A;  2LZ6 A;  3ZJU A;  1WXS A;  3MFG A;  4RMA A;  1TZO A;  4WQO B;  1C1Y B;  2Y5P A;  2WXJ A;  4NJ6 A;  1EF5 A;  1WXV A;  4URK A;  1WIA A;  3AMZ A;  2L8J A;  2X38 A;  3VUW A;  2BQQ A;  2VRR B;  2LGD A;  3B0A A;  3M95 A;  3ZDT A;  1TY0 A;  3AUL A;  1MHX A;  3W9C B;  3VVW B;  4RM9 A;  3TEX A;  2E6X A;  2J7Q B;  1J19 A;  3AE4 B;  4ZYS A;  3DWG C;  1TS2 A;  3ZJT A;  3QX1 A;  1KH0 A;  4JQW C;  3RNG C;  1WGG A;  4ZRQ A;  3DVG Y;  4GN1 A;  1HZ5 A;  1YQ3 B;  1WR6 E;  2PEA A;  2GBJ A;  4RNA A;  2GBM A;  2L0F A;  3WAP A;  2BYE A;  2LJI A;  2AQ3 B;  1SB3 C;  2NPT A;  3BII D;  1EWC A;  3AM9 A;  4YTP B;  3UIN B;  3AEC B;  2JPH A;  2PJH A;  1A70 A;  2AL3 A;  2KXJ A;  1L2N A;  1JWS D;  2WU5 B;  3TBL D;  4R3D A;  5C2T B;  1JWU D;  3BYY B;  3W5V B;  1GB4 A;  1NBF C;  1WXQ A;  2L52 A;  5BO4 B;  2K9X A;  1E8W A;  4P16 A;  3SU8 X;  1N6Z A;  3DDC B;  1V2Y A;  5D7G A;  5FK9 C;  3VAW A;  5CHW A;  2O2V A;  4IWQ A;  4LJP B;  4PS3 A;  1WR1 A;  1K8R B;  2JUO A;  2KAC A;  4DK5 A;  2XK5 B;  2V4I B;  4JIO U;  1BXT A;  2V1Y A;  4USA A;  1JQ4 A;  2PW9 A;  4FBJ B;  2BWF A;  1KOT A;  1XLO A;  3DHG C;  2N9L A;  4JPS A;  5EE3 A;  2LVO A;  1YQB A;  2KDB A;  1R4N B;  4K7S A;  5EE1 A;  2AL6 A;  1LXD A;  2WXL A;  3DBH B;  4DQO C;  2MSE D;  3WIM A;  2L0T A;  2BS2 B;  1V1O A;  2CU3 A;  2DAF A;  3FC4 A;  2V3N A;  4GSW A;  2BB6 A;  3IG3 A;  2V3S A;  4L2Y A;  3A9K B;  3ZW3 A;  4B6W A;  1I4X A;  1L4Z B;  2MP2 A;  1WYG A;  1V5T A;  2KLG A;  1YN5 A;  2WDQ B;  4TQ0 A;  1TIF A;  1WWT A;  1UZX B;  1CZP A;  2JZZ A;  1LM8 B;  3PRE A;  3DBH I;  4BVU C;  4MJS A;  3PRP B;  5AZF A;  3B08 A;  1ZW7 A;  5BMH A;  1UBI A;  3FIL B;  3U7D A;  2MBQ A;  2NCN A;  2KDF B;  3ZYY X;  2FNJ B;  2G1E A;  2K22 A;  4M8M A;  5IA7 A;  3EA6 A;  2RMM A;  3WAN A;  2PVO D;  4P6V F;  2KDM A;  4Q2J A;  2WDV B;  1Z5S B;  1IPG A;  2D5G A;  2LRU A;  1L0X B;  2IND C;  3TL5 A;  1Q5W B;  1V49 A;  4WAF A;  4RF0 A;  1FFV A;  1N61 A;  2NBU A;  1L0Y B;  1MG8 A;  5AZG A;  3W2D A;  4NPN A;  5FR6 A;  2LHD A;  1PQS A;  4BFR A;  1E10 A;  4K1R B;  5LLI A;  2KDI A;  4HLE A;  1JRP A;  4GU2 A;  1XLQ A;  1C77 A;  4BOS C;  3LYY A;  3Q3F A;  2W9N A;  5JXV A;  1QLB B;  3MHS D;  1RM6 C;  4K7W A;  2D11 A;  5LXH A;  3APD A;  4F7Z A;  3LDZ E;  1VZ8 A;  1C78 A;  1SE3 A;  1UWM A;  3TEY A;  2KJ6 A;  4MT5 A;  3N1X C;  1YX6 B;  2MW5 A;  1S3S G;  2IO1 B;  2BF8 B;  3Q6B A;  4LNK A;  4ASW C;  2ZW1 A;  3AEA B;  4WJP A;  1NI2 A;  4MH8 A;  2L05 A;  2HDE A;  1XT9 B;  4W9C A;  4W9J A;  1QOG A;  3O13 A;  3RN9 C;  4IOI E;  1AAR A;  4JGH B;  1JW9 D;  2XNA C;  4MGY E;  3T3O A;  2BKF A;  2PE6 B;  2KFK B;  4GDL A;  3JSV A;  3PLU A;  4GB9 A;  1V80 A;  2WXR A;  1WE7 A;  1I35 A;  2BS3 B;  3KYD D;  2ICI A;  2IO3 B;  1PUT A;  5JZE B;  2EEL A;  3R66 C;  1SF0 A;  3A9J B;  3PV1 A; 
#chains in the Genus database with same CATH homology
 2M19 A;  4KKJ A;  1UGJ A;  2WLB A;  3GP7 A;  1L6V A;  1VDV A;  2LUM A;  1FIQ A;  2W54 A;  3Q8F A;  4HRO A;  2J4X A;  1XCQ L;  3IT6 B;  4OHJ A;  3VR9 B;  1FO4 A;  1B9R A;  1V97 A;  3OWE B;  2ON8 A;  5EE9 A;  1XF5 L;  3AEE B;  4OW0 A;  2ACZ B;  4YWG G;  1K52 A;  1DOI A;  2BBC A;  3N9Y C;  1OFF A;  4WQM A;  1ZE3 D;  4MAC A;  1HXY D;  1AN8 A;  3Q8E A;  2JQR B;  1CQV A;  1NEN B;  1UWX A;  1CK1 A;  1TYG B;  3NVY A;  4XDC A;  4DXG A;  4RH6 A;  4AS1 A;  3BVG A;  3E9S A;  3VRB B;  2H89 B;  2W3S A;  3GS2 A;  3P1M A;  4FXC A;  4YSX B;  3P42 A;  1EWY C;  1D6E C;  1AYF A;  5MPO A;  4US8 A;  3TUO A;  2QEJ C;  3WCQ A;  2FE8 A;  3V3X A;  2I38 A;  2MJD A;  2WXQ A;  4H2A A;  5T8I A;  2JX5 A;  3AN1 A;  2KWD A;  1GPX A;  2HTM E;  2IGD A;  1ROE A;  3KQ4 A;  1V1P B;  2CJO A;  2FBW B;  2MEK A;  4ZRP A;  3W5U B;  4JX1 C;  2TSS A;  4LTU A;  2ZW0 A;  1F2R C;  1P7E A;  4RF1 A;  3BVZ A;  5H92 C;  1TY2 A;  4ARC A;  2RDH A;  2WXI A;  3B9J A;  1K50 A;  2CJN A;  1R7S A;  1ZDV A;  2M56 B;  5HG2 A;  3HVD A;  2NTT A;  3UI3 A;  2KAJ A;  3IAM 1;  3NVZ A;  4REZ A;  1VJK A;  2AQ1 B;  2BTE A;  2N7J A;  3AE6 B;  4XWW A;  1GB1 A;  1ENF A;  1PGX A;  2WU2 B;  2H88 B;  3MP9 A;  1YN3 A;  1TKY A;  1F77 A;  1C4C A;  1KFY B;  1MVK A;  3U4E G;  4ZHP A;  3R2T A;  3HRD D;  5BYS A;  2V0G A;  1C4A A;  1Q10 A;  2PVG C;  4A6Q A;  3AE7 B;  4WIP A;  1TS5 A;  1XEE A;  3HVZ A;  3R2I A;  2QIE B;  1I4Q A;  4OVZ A;  4KGT A;  1OQR A;  5I4D A;  2GI9 A;  1C79 A;  2INP E;  1TJE A;  2Z8L A;  2OED A;  1DGJ A;  2YEP F;  1T5X D;  3U52 E;  1SBB B;  4RGN A;  2JYE A;  1KF6 B;  3P4R B;  4US9 A;  1UUP A;  3TSS A;  4TMA B;  2DYM A;  2WQY B;  5BYR A;  4L23 A;  2SEB D;  2DBY A;  2PIA A;  1IBX A;  1FD6 A;  1ZXH A;  1YQ4 B;  4DXF A;  1XCT L;  4B0E A;  4C80 A;  3ABV B;  2JXT A;  3KLS X;  4KKI A;  3ZJU A;  3MFG A;  1JCK B;  4ZOH C;  1PYW D;  3NVV A;  4N58 A;  4UDU C;  1CJE A;  4C56 C;  1TZO A;  2LMC A;  1VZ7 A;  3AE3 B;  4HKQ A;  2W55 A;  2WNM A;  2Y5P A;  2WXJ A;  2YEP B;  1NYR A;  3NVW A;  4WUR A;  1K53 A;  3VQI A;  3AMZ A;  2WS3 B;  1IGD A;  1L4D B;  2X38 A;  5BMG A;  1KRH A;  3AEG B;  3SEB A;  1NYQ A;  1RYJ A;  3AE8 B;  4ITK A;  4YTN B;  5HFY A;  4RGT A;  2FUG 1;  1KTK A;  3W1S A;  5C3J B;  3I9V 1;  2E3T A;  2NTS A;  5AUK A;  1TY0 A;  1MHX A;  3AB5 A;  3W9C B;  3EGR A;  1MI0 A;  3TEX A;  2E6X A;  3BYT B;  1NEK B;  2WXF A;  3AE4 B;  4ZYS A;  3DWG C;  1TS2 A;  3ZJT A;  3MJ5 A;  3NS1 A;  1KH0 A;  3PO0 A;  2MJE A;  3FAH A;  3R8B A;  2RDG A;  3KWL A;  1L5P A;  1ZPS A;  5GXG B;  1Y56 A;  1SE4 A;  1MPE A;  1V1P A;  4ZRQ A;  2M0A A;  4AQ7 A;  1I4R A;  1L0V B;  1HZ5 A;  1YQ3 B;  2GRI A;  1EU4 A;  2XN9 C;  2K3U A;  4OZA A;  4RNA A;  1K51 A;  1GOZ A;  2SAK A;  2QSD A;  1E0Z A;  2KN4 A;  3TEW A;  2MH7 A;  1T6B X;  1JML A;  2PKO A;  2LJI A;  2AQ3 B;  2WXG A;  2KQ4 X;  3AED B;  2ONQ A;  1ZOY B;  1SB3 C;  2BYT A;  1VZ6 A;  1N63 A;  3BII D;  3BZD B;  3KWV A;  1EWC A;  3AM9 A;  4YTP B;  4RCO A;  1FRR A;  1I4P A;  3AEC B;  2Y3A A;  2BB5 A;  3HUI A;  4RGM A;  1FNW A;  1A70 A;  2JWU A;  5D3I B;  1HA5 A;  1TKG A;  1FM0 D;  3SFE B;  3MC0 B;  3U2S C;  1JWS D;  2WU5 B;  1C4P A;  1E6E B;  2B76 B;  1QT9 A;  4R3D A;  1B1Z A;  1DOY A;  5C2T B;  3H8H A;  3SFD B;  3BK1 A;  3T3N A;  1J7A A;  4L1B A;  1PFD A;  1SSN A;  1JWU D;  3BYY B;  3W5V B;  1DOX A;  1GB4 A;  4WWM A;  4A8X C;  1WXQ A;  2L52 A;  1IUE A;  2K9X A;  3IAS 1;  2RPV A;  1T3Q A;  3ZJV A;  1JWA D;  4P16 A;  2DLB A;  1EM7 A;  2J42 A;  1NI3 A;  5D7G A;  1GAQ B;  5FK9 C;  4RGO S;  4JWU C;  1SIJ A;  4YSZ B;  4KGS A;  1N60 A;  2LGI A;  1D4B A;  1P7F A;  2Q5W D;  1XO3 A;  1L6U A;  2KAC A;  3J9C A;  2V4I B;  2J53 A;  2INN E;  1BXT A;  4USA A;  1ET6 A;  1JQ4 A;  2PW9 A;  1SJE D;  1FRD A;  1ZDX A;  3VRA B;  1XLO A;  5BMI A;  2N9L A;  4JPS A;  2VZK D;  5EE3 A;  1FCL A;  3L4P A;  3V05 A;  1SXT A;  1LO5 D;  3GB1 A;  2WXO A;  4MM3 B;  1I4H A;  2VZK B;  4WH4 A;  5EE1 A;  2N9K A;  3ZQ4 A;  2WXL A;  2WXK A;  1N5X A;  2BW2 A;  4DQO C;  2MJ3 A;  1VLB A;  4YXD B;  4A9A A;  2AQ2 B;  1VR9 A;  4YTM B;  1J7C A;  1FXI A;  4NAM A;  2BS2 B;  1QIL A;  4OZB A;  1N5W A;  1V1O A;  2CU3 A;  1WSP A;  3FC4 A;  1FFU A;  2V3N A;  2QMT A;  1ACC A;  4NAW B;  2BB6 A;  4HRS A;  1QOA A;  4LK0 M;  4C7Z A;  2QJL A;  4HEA 1;  4D2K A;  1FNV A;  5FR3 A;  1I4G A;  4L2Y A;  1I4X A;  2WXP A;  1QOF A;  2W82 A;  1L4Z B;  3I57 A;  3Q8B A;  1WYG A;  2WXH A;  4KX6 B;  3ETR A;  1SEB D;  3Q69 A;  1FEH A;  2BS4 B;  1YN5 A;  2WDQ B;  1IGC A;  3B2G A;  4TQ0 A;  2IGH A;  1JAL A;  1V8C A;  1WWT A;  4IDI A;  2LHE A;  4ARI A;  1CZP A;  4OZC A;  4RFB A;  2J52 A;  3AE5 B;  3AEF B;  4GDL B;  1PGA A;  5BMH A;  3FIL B;  3VR8 B;  2DWQ A;  2PTL A;  5H8Y E;  5D3D A;  3PZ7 A;  5AUI A;  2PMV A;  4XE0 A;  3ZYY X;  4A90 A;  2G1E A;  1FMA D;  1SE2 A;  1C76 A;  2W3R A;  1OQQ A;  1C9F A;  1J7B A;  2L83 A;  3AE9 B;  2K22 A;  1TS4 A;  2NMQ A;  4C7Y A;  2V3P A;  2IPK D;  1XLP A;  3EA6 A;  3AE1 B;  1KLG D;  2RMM A;  2KMM A;  2PVO D;  4CQN A;  4P6V F;  2KDM A;  3P63 A;  4Q2J A;  4N59 A;  1SJH D;  4PT5 A;  2R61 A;  1BUI C;  2WDV B;  3SR6 A;  2D5G A;  2G9H D;  1F0Z A;  1L0X B;  1F2R I;  2LEK A;  1FXA A;  5BYQ A;  1PGB A;  4WAF A;  5HI1 A;  1HZ6 A;  4O1N A;  4RF0 A;  3P4P B;  4NJC A;  4JWS C;  3E56 A;  4XDD A;  5HHD G;  3Q8A A;  1FFV A;  2JZP A;  2WDR B;  3MHZ A;  4M0W A;  1N61 A;  2L32 A;  1L0Y B;  3ZGZ A;  1FCC C;  3P4Q B;  2LFI A;  2EKI A;  3W2D A;  3P4S B;  1N62 A;  2LHD A;  3U7Z A;  1QOB A;  1YMH E;  3LB8 C;  5LNK 1;  1XXG A;  2JYT A;  4GLS C;  1E7P B;  1E10 A;  1RFK A;  4B0M A;  1M4V A;  2IJ0 A;  1HQR D;  2IDY A;  1QF6 A;  1I7H A;  1JRP A;  4YSY B;  5EE0 A;  2K5P A;  4HJG E;  2WP9 B;  3AE2 B;  3Q8C A;  5G5H A;  1ZXI A;  1AWD A;  1XLQ A;  4HKZ E;  1C77 A;  1YJJ A;  3LYY A;  2Y5C A;  2WXM A;  1ET9 A;  5JXV A;  3NRZ A;  4TSS A;  1QLB B;  3RPF C;  1AW7 A;  3BWU D;  1RM6 C;  3BVM A;  5TSS A;  1QKZ A;  1EU3 A;  2IGG A;  4YT0 B;  3EUB 2;  3AV8 A;  2AX5 A;  1BML C;  1MHH E;  2WXN A;  1VZ8 A;  3B2F A;  1C78 A;  1SE3 A;  1VRA B;  1D5X C;  1UWM A;  2K0P A;  3NUH B;  4EE2 A;  3TEY A;  1HEZ E;  3BK2 A;  1DYQ A;  5FKA C;  4MT5 A;  1WGK A;  4LLG M;  4TQ1 A;  3CIR B;  3NZ3 A;  5E6J A;  5G5G A;  3AH7 A;  1TKE A;  2ZW1 A;  3AEA B;  1ZP0 B;  3RFZ B;  3PZ8 A;  1E9M A;  4MH8 A;  4J3O D;  1JWM D;  1QQR A;  2HDE A;  2L1A A;  1D5M C;  1ESF A;  3IXS A;  2I2Y A;  1WRI A;  4A55 A;  1QOG A;  3O13 A;  2OHF A;  4IOI E;  4JE3 B;  1XLN A;  4N6E B;  4IKG A;  1JW9 D;  2XNA C;  3T3O A;  1UNS A;  3DWM A;  2JU6 X;  1YNT E;  1PDX A;  2N0S B;  1YJI A;  3FIL A;  2WXR A;  1JWB D;  1KLU D;  4XWT A;  3TEZ A;  3C8Y A;  1TS3 A;  3URY A;  2GB1 A;  2BS3 B;  4NZL B;  1YN4 A;  1NVI D;  1D5Z C;  2DYO A;  2ICI A;  1PUT A;  2PLP A;  1IBX B;  3CWI A;  4ZHO A;  2JSV X;  2BT6 A;  1STE A;  1FNU A;  1ZUD 2;  3IT4 B;  2EEL A;  1JRO A;  3AEB B;  1SF0 A;  4GDK B;  3LXF A;  1RWS A;  4KGR A;  2QIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...