1XCQL

Complex hcv core-fab 19d9d6-protein l mutant (d55a,l57h,y64w) in space group p21
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
PKEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALHAKVNGEWTADLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords Capsid protein C
total genus 8
structure length 66
sequence length 66
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xcqL00
2JXTA 5HHDG 3V3XA 2NMQA 2KQ4X 4IOIE 2N9KA 1MHHE 2PLPA 1KH0A 1HZ5A 4OZCA 2OEDA 1F2RC 4KGSA 1XCQL 1IBXA 1MHXA 1IBXB 1UWXA 2I38A 3GB1A 2J53A 2LHDA 3MP9A 2ZW0A 2KWDA 4OZBA 1HEZE 2J52A 1PGAA 2I2YA 1XF5L 1QKZA 2QSDA 2KACA 4OZAA 2IGDA 2JZPA 2ONQA 1Q10A 5BMIA 1PGBA 5BMHA 3UI3A 5HG2A 2KDMA 5JXVA 4IKGA 2ON8A 1K53A 3FILA 3FILB 2RPVA 1F2RI 1P7FA 4HKZE 2ZW1A 1C9FA 2LHEA 2N9LA 2RMMA 1K51A 1FCCC 1MVKA 1GB1A 1K50A 2LGIA 1YMHE 2PTLA 1FD6A 2GI9A 4D2KA 1PGXA 2PW9A 5HI1A 1EM7A 1IGDA 1D4BA 2EELA 2JSVX 1K52A 4GLSC 1XCTL 4KGTA 2JWUA 2KN4A 1YNTE 2N7JA 4MACA 2LUMA 1HZ6A 1MI0A 1P7EA 1GB4A 5HFYA 2K0PA 1MPEA 2QMTA 1ZXHA 1FCLA 2IGHA 4HJGE 4KGRA 2JU6X 2GB1A 1IGCA 1JMLA 2IGGA 5BMGA 4WH4A
chains in the Genus database with same CATH superfamily
1V6EA 3EHVA 3UQAA 4FLHA 1I7HA 3TMPB 1WR1A 1FFVA 2N9KA 2VH2A 4HPMB 3HHMA 5D2MB 2DZJA 4MH8A 5LNK1 3IHPC 2JY6A 4PYUA 1C4PA 1LXDA 1SGHA 4TUUA 3DDCB 1VRAB 4WQMA 1WXMA 1H4RA 4RH6A 2AQ2B 4KX6B 1T0SC 2M4NA 4KDIC 4DDGD 2V9HA 1ZW7A 4RF1A 3U4EG 4XDDA 3AEEB 2KDFB 3ZNID 3ECIA 2KZRA 3RULA 2J0KA 1L2NA 4FXCA 1UBQA 3IFWB 5J17A 3ZJUA 3IXSA 4XC2A 1P3QU 2CHZA 2LJ5A 4FHJA 2K39A 3APFA 4LNFA 2N9LA 4P1CC 4CO7A 1WXVA 2WXRA 1S1QB 4ANVA 5BO4B 1TKGA 4MJSB 3ZUNA 3L4PA 4ZRIA 2A5UA 4NPNA 5LLIA 1ISNA 4HROA 4RM8A 1V1PA 3KVFB 3QHTA 1V81A 4GB9A 1XCTL 1EF5A 3AXCA 2KWVB 1OFFA 3ZRFA 1F0ZA 4MACA 3CMMB 1EO6A 1LM8B 1ZDXA 2D2QA 2MX2A 2LMCA 3PZDA 2BQQA 4LNOA 2KVZA 4LTUA 2RD0A 2KXJA 2J7QB 2MSED 2JXXA 1ZDVA 4ZYSA 2WU5B 4JPSA 2Z0EB 5LXHA 2W3RA 3JSVA 1TY0A 2JXTA 3Q8EA 3AM9A 3M63B 2WP9B 1KH0A 3Q3FA 2WXGA 4W9LA 4UDUC 4FBJB 3O65B 2KDEB 1UWMA 2D3BA 5HKHA 1WJ6A 4YL8A 2DAFA 3ZKJC 4GU2A 3B08A 1I4HA 2AYOB 2BB6A 2LJIA 4REZA 2W82A 4MM3B 2IY0B 2LXAA 1UZXB 4WURA 2INNE 2UYZB 1KRHA 2FAZA 1K8RB 3KQ4A 2GRIA 2MBBB 1TTNA 1Y8RC 3PS6A 2KJ6A 3V6CB 4OW0A 5BYSA 3C8YA 2HD5B 1TIFA 2ZNVC 5CX3A 3BVZA 4A3OA 3DBHB 2V3SA 2HJ8A 4OVUA 2WX1A 2MRPA 2G4DB 3L54A 4MELA 2QC8A 1K51A 5EE1A 2LVQA 1GUAB 4EEWA 5J18A 2M0XA 1QOFA 2KFJA 3P42A 2D3AA 4KKJA 1YMHE 3VFKA 1JCKB 2AX5A 4A6QA 2GI9A 3PZ8A 1NEKB 2QHOA 5CHVC 2KVRA 2LFIA 1V9JA 3ZW3A 3OG5A 3AE9B 1HA5A 5EE9A 2MBEA 5L95C 1FEHA 2NPTA 1GC6A 2LXCA 5IAAC 4ZDVA 1ZXHA 1F77A 4GDKA 3ZTCA 1ZOYB 3L08A 3NZUA 2IGHA 4HJGE 4BKSD 4IG7B 5BMGA 4EOYA 2EMTA 3PPAA 3APDA 3I9V1 3TEWA 3VH3B 2XK5B 3U7ZA 4DBGA 1M94A 2IBIB 5AZHA 2OEDA 1YJIA 3AE5B 4DXGA 2YLMA 1IBXA 1MHXA 2CHWA 4H2AA 2KWDA 3PO0A 3PZ7A 5G2NA 3IAS1 1CK1A 2I2YA 4LJPB 2Y3AA 2WS3B 1XLPA 2LGDA 2DLBA 2DX5B 2NBUA 3NVVA 3OJ4B 5JZEB 1H8CA 1QOBA 2GBJA 2LASA 2DAJA 1WR6E 1F9JA 2DHZA 3Q2AC 5IO9A 3PLVA 2IJ0A 2KAJA 5AEKB 2M8SA 4NAMA 4PS3A 4C4VA 2KJHB 3PHXB 2L8JA 2UWQA 2INPE 1ENFA 1YQ4B 1LFDA 4LJOB 2N4FA 4EUTA 3NVWA 5BYQA 2WXPA 3O13A 2L52A 4F7ZA 1IGDA 2FNJB 2N7DA 3RFZB 3Q8AA 4KGTA 3VUXA 4FN2A 4J3OD 5IP4D 4HWIB 2NBWB 1YQ3B 3BZDB 3M3JA 2QEJC 3V62A 1MG8A 3BK2A 2JF5A 2IGGA 3RMKC 4W9IA 1SB3C 1AYFA 4RF0A 4K3CA 3TSSA 2MJ3A 1IUEA 3PRPB 4ANUA 4ACFA 1WXSA 4HDOA 1M4VA 2BWFA 2PVGC 1JRPA 1WXAA 2L0FA 1AWDA 4A3PA 3Q3JA 3T3NA 5IOIA 4KSKC 3EGRA 2ZW0A 1WGYA 2PJHA 1C78A 4KZ0A 3E56A 1AN8A 1DGJA 1T0RC 1QOAA 4XE0A 3K9OB 3ZTDA 4GDLA 1N63A 4B6WA 1E9MA 5BMHA 1NI3A 1YJJA 1V86A 2RGFA 2ON8A 1K53A 1P9DU 2MJEA 1WZ3A 1J7CA 3B2GA 2RPVA 2ZEQA 1F2RI 3TIXA 2KWUB 4G3XB 1XLQA 4I6NB 1X1MA 2QILA 2KLGA 2AL3A 3VRAB 2DZMA 4M8NA 1T0YA 1KOTA 2Y5PA 4XWTA 1HQRD 2G4SA 2JT4B 2GBMA 2MJDA 2KK8A 3AULA 4EZJA 4ZRJA 1AARA 2AQ3B 3K9PB 4JIOU 1KM7A 3N9YC 2A4ZA 4J6IA 3M95A 1SE4A 1HE8A 2JRIB 3RN9C 5JHBA 1WGGA 1Q5WB 3IT4B 2BBCA 3IBEA 2J4XA 1WGDA 1FMAD 3CF6E 2OJRA 1EWYC 3ZGZA 4FJYA 1TKYA 2JX5A 1JMLA 3PSEB 1FM0D 3ZXVA 2WU2B 1WJ4A 3BK1A 3HVZA 3T3OA 2BPSA 3PTFC 2Y5BB 3W9CB 5JHAA 3AE2B 1EF1A 4W9EA 3NJTA 4N9F4 3ZNGC 3RCZA 2WLBA 3ZO5B 3JW0X 3Q6BA 4KGSA 4P7IA 2V4LA 1QLBB 2BKFA 3AE6B 2HJ1A 1BMLC 1GJZA 2MBQA 3AEGB 3N32A 3KUZA 3H1UA 3IAM1 2C7HA 3AEAB 4RGOS 2R2OA 4TSSA 3OAWA 3PRZA 2IGDA 4YWGG 1UD7A 2JYTA 2QJLA 1I35A 2CU3A 4B0EA 4MDKE 1KTKA 1FO4A 2KC1A 4IM3A 4N58A 3NY5A 4CYEA 3PGEA 3VUWA 3DBSA 1TZ1A 1OQQA 1VR9A 2GOWA 3NOBA 2L32A 3IG3A 3PHWB 1B9RA 4HLEA 1WGKA 1FRRA 4MJSA 4YT0B 2L83A 1JWUD 4AQ7A 3A9KA 5DCNA 4ICUA 1I42A 4FHKA 4S17A 1FD6A 1C79A 3UF8A 1FNVA 1XLOA 2CU1A 1E8XA 4HJKA 1D5XC 1MG4A 4NAWA 1OTRB 2KN4A 2ZZPB 2N7JA 2K6DB 3TEXA 3BINA 3R3MA 3Q8CA 4A55A 3ZJVA 2WX0A 2KMAA 1WF9A 1ROEA 1SE2A 2BYEA 4JWUC 1ET6A 2N7EA 1FXTB 5L83A 4AJWA 4G50A 3EECA 4DXFA 4XZ4A 3W1YA 3V3XA 3R7QA 1FNWA 2BYFA 4RGMA 1WM2A 1A5RA 2PLPA 4GXBA 1NVID 3LXFA 3VRBB 4MH0E 2V1YA 4DQOC 1WYGA 3MJWA 1UH6A 2KFKB 1WWTA 2KDBA 5KHOA 3VR9B 2OHFA 4BAXA 3R66C 3ONSA 1ESFA 2KKCA 2D11A 1T3QA 2O6VA 4ZHOA 4WJPA 3AMZA 3N20C 3IVFA 3W5UB 2FCNA 3AE8B 2MCNB 4LNNA 2NR2A 3AE1B 1N6ZA 4AWJA 3DHHC 3J9CA 2AL6A 2R61A 2ZCBA 3FILB 5E6NA 1S3SG 1AW7A 2ZPYA 1HTOA 2J0JA 4W9CA 1DOIA 2DENB 1N62A 1WRIA 4S0RA 3JYUA 3LDZE 4ZHPA 1TT5B 4IM2A 4GMVA 1KLVA 1L0VB 1C1YB 2IY1B 4NJ6A 2K6QA 1V80A 2N0SB 1YN3A 1NENB 2JVCA 5FK9C 4WWPA 2MEKA 4GLSC 3P63A 1J7AA 1E8WA 3DVGY 1YNTE 3C0RB 1I4GA 1P7EA 4OVVA 3HUIA 4F1SA 1SJHD 3DBLB 3V05A 2J0MA 5H8YE 1MJDA 2BS2B 1WXQA 3Q3NC 4DK5A 2IZVB 4IM0A 2QIEB 4XDCA 5D3DA 4K1RB 1DOYA 3AU5A 4MSMB 1KFYB 3T9LA 1WMHB 2WGSA 4OZCA 3U52E 1YJ1A 2FUHB 5MPOA 1N5XA 3A1QA 1C76A 1XCQL 2JZZA 1V97A 1XXGA 1E7VA 2DYBA 3BIID 4OZBA 1VDVA 3I57A 3KWVA 1VJKA 2L76A 2HTHA 4AP4C 2FBWB 2KACA 2ONQA 4WAFA 2KANA 3UIOB 3KLSX 4KSLC 2KQSA 2PE9A 4ZRQA 4B9KA 2MW5A 3Q8FA 3V6EB 1QF6A 1FIQA 2XK5A 2WDVB 3RYTA 2RDHA 4HPLB 3HVDA 4K7UA 1VZ8A 3VTWA 3APCA 2PEAA 4B0MA 5BYRA 3QQ8B 1N60A 4GGQA 4KKIA 1PFDA 1E8YA 3VUYA 3GP7A 1MVKA 2KD0A 3DOWA 2LI5A 3W2DA 2IO3B 3CIRB 4DHZE 4HCNB 2QCZA 4HRSA 5EE3A 5AZGA 1CQVA 2FCSA 3MC8A 3ZRCA 3DPDA 1GNUA 1GPXA 1QILA 2WXIA 4BZAA 2KHWB 1EWCA 4NJ7A 2G9HD 2NTSA 4IW0A 4X57B 3HM3A 2LGXA 3AE7B 4KDLB 4AJYB 3KYCD 4W9GA 4E74A 2JPHA 3R7RA 1RRBA 4RMAA 2ACZB 3H8HA 3AB5A 2CS4A 5E6PA 2BGFA 3ALBA 1UBIA 2WXNA 2D3CA 1QOGA 2BS3B 4EE2A 3RI7C 1TY2A 4A9AA 2KMMA 4BFRA 4JE3B 3KUDB 2INDC 2J52A 4R3DA 4MT5A 1L0YB 4W9HA 3TUOA 2QSDA 1SIFA 3SFEB 1SE9A 1Q10A 3RNGC 2KNBA 3H7PA 2M0AA 4RNAA 2L7RA 2WNMA 4XX5A 3R2TA 1TS3A 4TKNA 4US8A 1OEYA 2K8CA 3VTUA 1ZGUB 2E6XA 1RLFA 4RFBA 3PLUA 3L17A 1ZKHA 2Q5WD 2L0TA 5TSSA 5FKAC 3ETRA 4AUQC 2IYDB 4EFOA 1KLGD 2SEBD 2PPHA 1FRDA 4O1NA 2KDIA 2DZKA 4M02A 4ZYNA 2PKOA 4C7YA 4MM3A 2ZNVB 1JRUA 2VZKD 3DBHI 5C2TB 1PGXA 4LK0M 3DBLI 2JSVX 4TV3A 1OQRA 2BTEA 4PYZA 4YTMB 1UGJA 2O2VB 2M17A 2W54A 4OVZA 3A9JA 2KQ7A 4C80A 1C4AA 3DHIC 3FKYA 3H9DA 1RM6C 2CR5A 4WH4A 1KF6B 1RAXA 1WX7A 4MGIE 5HHDG 2L00B 1R4MB 4KIKA 1ZP0B 4ZOHC 2XNAC 3SFDB 4OHJA 2IO1B 4N6EB 4C7ZA 2K1FA 4W9KA 4A90A 1ZPSA 3W1SC 2VRRB 3WA0A 2FIDA 2MA9B 3AE4B 2I1KA 1I4XA 2LHDA 4DXAB 2GLSA 3GE8C 2MWSB 2K9XA 2BT6A 2I1JA 3C19A 5D6JB 1TS5A 4M01A 2AWTA 4K3BA 4GN1A 3ENEA 4LLGM 2FE8A 3DQVA 1PYWD 4CHKA 1XD3B 4MEMA 2KDMA 5J2RA 4DHJB 4IC7B 4WWNA 2KC2A 3ZJTA 4I6LB 2DBYA 1SBBB 2VZKB 3NHEB 2V3PA 4HK2A 3NS1A 1NDDA 1PUTA 3D32A 1YN4A 3QX1A 2WXLA 3GE3C 1OEYJ 1BT0A 4NNJB 4A20A 1L4DB 3H7SA 4D2KA 2LZ6A 1E8ZA 2IDYA 1EM7A 1WJUA 3DBRI 1RWSA 4M0WA 2JWUA 4BVUC 4YXDB 4JLCA 1D6EC 2L05A 4JL9A 4WWMA 2TSSA 4IWOA 4FJZA 2JYEA 4KZCA 1C4CA 2OOBB 1FCLA 3B2FA 2R2QA 1SIJA 1IGCA 4GSWA 2M56B 3R8BA 1V2YA 4BKSA 1KLUD 2K22A 1WE7A 2WXQA 1V5OA 1FNUA 2ZVNA 1A70A 2J42A 2ZJDA 4XWWA 3NUHB 1HZ5A 3P4QB 4HXDA 2EKEC 3NZSA 4ASWC 3VHTC 3GB1A 2J53A 2PVOD 4GDLB 4EZKA 2G3QB 1J19A 3RNCC 2L1AA 3WCQA 3Q3MC 1VCBA 1C77A 3L16A 2B76B 1VLBA 3RNFC 3X0WA 2D5GA 3MHZA 2MBHA 3VXWA 1EUVB 3N1ZC 3PRMB 2WDRB 3WAPA 1Q1OA 2W9NA 5JXVA 2DZIA 2BYTA 1IP9A 3FILA 4FA6A 5DPWA 1TGZB 3KUCB 3CWIA 1Q0WB 1YD8U 2Y5CA 4N59A 2MP2A 2LHEA 1FPYA 4HCPB 3TCAA 3TL5A 4E71A 4DHJD 1B1ZA 1NI2A 3RUIB 1JW9D 1P98A 1P0RA 3KW5B 2KLCA 3QA8A 2CJOA 2N9XA 2EELA 3EA6A 3QC8B 1UF0A 3RNBC 3H7PB 3P4PB 2HE7A 2ICIA 3PT2B 4JWSC 4BBNC 3M62B 5CTRC 1GB4A 1XO3A 2WXOA 4BOSC 1T5XD 2N1VA 2V0GA 2KT7A 2VH1A 2KJRA 4QAYA 1T6BX 2BB5A 4AOFA 1YIWA 4AS1A 4P16A 3U30A 4XYCA 4BKGA 1CJEA 2MBOA 2K8BA 1WSPA 4IOIE 3SU8X 1NYRA 2DNFA 1ZXIA 2WXHA 1MHHE 5TR5A 1YX5B 1E0ZA 4WQOB 1WIAA 3NVZA 3QJZA 1ET9A 4K7WA 3RZWC 4LNKA 2RR9A 2GBRA 1L6UA 1WGRA 2YEPF 3VTVA 1XT9B 1IBXB 3LB8C 1J7BA 1V1PB 1DOXA 4WIPA 2Z0DB 4PS8A 3WAMA 2H88B 1GOZA 3HIZA 2XEWA 2NCNA 4NY0A 2JQRB 5GXGB 3ZDTA 1STEA 2XBBC 4KVGB 3A33B 3UI3A 2KFKA 2K25A 4PT5A 1V8CA 4HKQA 3CSTA 1TKEA 1JROA 4GIVA 5DPRA 1ZUD2 1XQQA 2WQYB 5IA7A 2IPKD 2OJWA 3E9SA 3JVZX 3Q3OC 3QARA 5DPTA 3VAWA 1L0XB 4DDID 4BBNF 3AECB 1N5WA 1FCCC 4RGTA 1C3TA 4M8MA 4ZRPA 2YVCA 3ZIMA 4E3CA 2V4IB 1RYJA 2PW9A 3PV1A 3RT3B 3VR8B 3A4RA 3TEYA 2E3TA 2K3UA 2KN5A 1HTQA 2WWZA 1OGWA 1EU4A 1R4NI 4HPPA 2PIAA 5EDSA 4LCDE 1F1HA 5G5GA 3FAHA 2LUEA 1I4RA 4KGRA 1JWAD 1RFKA 2ZPNA 1CMXB 2X38A 1WM3A 4MSQB 3MFGA 2NMQA 2KQ4X 2GMIC 1I4PA 2HTME 1UNSA 1BXTA 4II2B 1EU3A 2YEPB 1F2RC 1IPGA 2N9PC 1XEEA 3UIPB 4G0NB 3DWMA 2LRUA 4ANXA 4FADA 3BVGA 5CHFA 5C3JB 2FCQA 1QZEA 2AQ1B 3GZNI 4BKTA 2JZPA 2QDFA 3R2IA 2B3AA 3HRDD 3AU4A 4PS7A 3A1QB 2C5LC 5HG2A 2C9WB 5AUKA 4I6PA 3P2BA 3P4SB 2REXA 3NZ3A 1LO5D 3TJPA 3U8ZA 1WI0A 4L2YA 3UINB 3RD2A 1NBFC 4ANWA 4K7SA 3I63C 2WXFA 3GOEA 3EFUA 2NS5A 4ITKA 2BKRB 2EKIA 3AEFB 4HEA1 4GOCA 3N1YC 2PTLA 1TJEA 3OWEB 5HI1A 3FC4A 1FXAA 5E6OA 2FIFA 4ARIA 4YSXB 3BWUD 2C60A 3BYTB 2O6VB 4NQKE 3QK0A 3UQBA 3AV8A 2MH7A 3QIJA 3CSFA 5E6JA 2ASQA 1D3ZA 3U7DA 3VDZA 2V3NA 2Z59B 2KWCA 2GBNA 1ACCA 1WE6A 4NZLB 3OJ3A 5CHWA 4KIKB 2DWQA 1PQSA 3N1XC 1V5TA 4WJNA 3SR6A 4P6VF 2BWES 2NVUI 3B0AA 4W9JA 2O2VA 1J0GA 2W3SA 1WYWB 2LWPA 3QWZB 2ZCCA 3TBLD 1PGAA 1WRDB 3QAQA 3L10B 2CJNA 4RCOA 4OZAA 3RNEC 5BMIA 3ZNZB 3ZDMC 4W9FA 3HK0A 4USAA 3DVGX 3VVWB 1TS4A 4IUMB 5IN7A 1MFWA 1IYFA 5T8IA 2DYOA 4JGHB 2KTRA 4XGAB 4YSYB 2NTTA 4MGKE 5G55A 4FJVB 3X23A 4HKZE 1C9FA 3ZLZA 4RGNA 3W5VB 1P1AA 2Z8LA 3ZQ4A 4GDKB 3L13A 2MQJA 1YN5A 3A9KB 4B95A 2N1WA 1Y56A 4TMAB 1WFYA 4G11A 4CQNA 3ZXRA 1QQRA 4EZLA 1SXTA 1Z5SB 5LXIB 2KYWA 5I4DA 2L3ZA 3DCGA 4ARCA 3AI5A 3Q69A 2MLBA 2INCC 1TYGB 2KX3A 1GG3A 4LDTD 3VQIA 2CKHB 2QMTA 4L23A 4EKUA 2BF8B 4TQ1A 3WALA 4URKA 1J8CA 1E10A 1LGRA 4A8XC 3JSVB 1E7PB 4Q2JA 3AH7A 1NYQA 3DVNU 4ICVA 3GZNB 3RZFA 1LQBA 2LEKA 4K81A 1WJNA 2KTFA 1L7YA 1SJED 2AEHA 2WHIA 1HXYD 2RPQA 1FXIA 1QKZA 5D94A 3KWLA 1R7SA 3AE3B 2D07B 1JQ4A 5FR3A 1KJTA 2RDGA 2PE6B 4HDQA 2ZVOA 3AN1A 3EFCA 1UUPA 2WXMA 2KTRB 1Z2MA 2BVCA 3HM6X 4US9A 3MJ5A 3T8MA 4HVBA 3WIMA 4C00A 2NPTB 2RSUA 1N61A 3MHSD 1P7FA 1E90A 3SHQA 2RMMA 2NBVB 3EUB2 3N30A 4FULA 4W9DA 2O6VD 2LGYA 2JUOA 2M1MA 3H6NA 2D3GA 1QT9A 3AEDB 1SF0A 4P1BC 2IO0B 2XN9C 4M00A 4MGYE 3ZNHB 1TS2A 3ML9A 1JWMD 2JRHA 1V1OA 3GS2A 2LUMA 2K0PA 1WGHA 5IKCM 2UU7A 5C1ZA 5C23A 1L4ZB 3DWGC 2BW2A 3A9JB 3V61A 2PMVA 1SEBD 2WYQA 3W1SA 4DHZB 4DWFA 1GAQB 1ZE3D 4M0WB 3ABVB 1PDXA 2M19A 2WXKA 3DVNV 3NS8A 4MGZE 1F52A 1WMHA 1G6JA 2LRWA 2DYMA 3DBRB 3QCAA 3S2AA 3LJ3A 1R4MI 2I38A 2KX0A 4L1BA 4YTNB 4BOZB 2LVPA 2G45B 1WX8A 1UGMA 3SDLC 4YSZB 1D5ZC 1V49A 1E6EB 2CHXA 3NVYA 2K8HA 1E7UA 1TBEA 2C7MB 2FCMA 3N3KB 3UGBB 1YQBA 2WXJA 1L6VA 3URYA 4LDTB 3RPFC 4IDIA 5D3IB 2KO3A 1E5WA 5DPSA 1OQYA 3Q8BA 2ZW1A 3L0WB 4C4VB 4II3B 5AZFA 1YX6B 1FFUA 2N9EB 5EE0A 3MTNB 2JZ3B 1K50A 2WDQB 4NQLB 2HDEA 5GMVA 5D7GA 1D4BA 1JWSD 3TEZA 3SEBA 2SAKA 2WDTB 1CZPA 5JH5C 3LYYA 4YTPB 3OLMD 4F8CB 1HZ6A 1L5PA 1MI0A 1WY8A 3I3TB 1WZ0A 2JWZA 3BY4B 3P4RB 4IWQA 1MPEA 3EC8A 3PREA 4ZRKA 4C56C 3BYYB 1WX9A 3AEBB 2GB1A 2LGSA 3RNAC 2G1EA 3NRZA 1VZ7A 3B9JA 1JWBD 2W55A 3VH4B 4WJQA 1UELA 4KV2A 5H92C 3IT6B 3KYDD 3WAOA 3SD5A 3A4SC 2H89B 1T0QC 3ZYYX 2MHJA 1JALA 2GBKA 2LVOA 2BS4B 1UWXA 4NJCA 3V60A 1I4QA 1SSNA 3MP9A 3MC9A 4PK1A 1HEZE 4LNIA 1TZOA 1XF5L 3PVLA 4TQ0A 1PGBA 2EMSA 5AUIA 1YOVB 2MP2B 1U4AA 2C7NB 3ML8A 4IKGA 4JQWC 5FR6A 3WANA 5KHQA 2K5PA 3P1MA 4NAWB 1BUIC 3U2SC 2KMCA 1SE3A 3KH0A 1GB1A 2D10A 1R4NB 2LGIA 1RFAA 3I5JC 4JX1C 2FUG1 1VD2A 2RDBC 1K52A 2BYVE 1DYQA 1GC7A 1XLNA 3DHGC 3B1LX 5G5HA 3NG0A 2KOXA 3Q14C 5HFYA 3BVMA 3MC0B 3ZVVA 4IWPA 1WH3A 4WWOA 1D5MC 4RM9A 2X8XX 2LD9A 4WJOA 2JU6X 2IO2B 1VZ6A 4WAAA
chains in the Genus database with same CATH topology
3HVZA 5HHDG 3T3OA 3W9CB 3AE2B 1I7HA 4NZLB 1FFVA 2N9KA 1ZP0B 4ZOHC 2XNAC 3SFDB 2DWQA 4OHJA 4N6EB 2WLBA 4C7ZA 4MH8A 5LNK1 4A90A 3SR6A 4P6VF 1ZPSA 4KGSA 1C4PA 1QLBB 1VRAB 4WQMA 3AE6B 2W3SA 1BMLC 3AE4B 1I4XA 2LHDA 4RH6A 2AQ2B 2K9XA 2BT6A 3AEGB 1PGAA 4KX6B 3IAM1 2CJNA 3AEAB 4RCOA 4RGOS 4YWGG 4TSSA 4OZAA 2IGDA 4RF1A 3U4EG 4XDDA 1TS5A 3AEEB 5BMIA 4LLGM 2FE8A 1PYWD 2JYTA 2QJLA 2CU3A 4B0EA 2KDMA 4USAA 1KTKA 1TS4A 4FXCA 1FO4A 4N58A 5T8IA 3ZJTA 2DYOA 2DBYA 3ZJUA 3IXSA 1SBBB 2VZKB 4YSYB 1OQQA 1VR9A 2NTTA 2V3PA 3NS1A 1PUTA 4HKZE 1C9FA 2N9LA 1YN4A 2L32A 2WXLA 4RGNA 2WXRA 3W5VB 1B9RA 1TKGA 2Z8LA 1WGKA 1FRRA 3ZQ4A 4GDKB 1YN5A 4YT0B 2L83A 3L4PA 1JWUD 4AQ7A 1Y56A 1L4DB 4TMAB 4CQNA 1FD6A 1C79A 1QQRA 1FNVA 4D2KA 1SXTA 2IDYA 1XLOA 4HROA 1EM7A 1V1PA 5I4DA 1D5XC 1XCTL 1RWSA 4M0WA 2JWUA 2KN4A 1OFFA 2N7JA 4YXDB 3TEXA 1F0ZA 4ARCA 3Q69A 3Q8CA 4MACA 1ZDXA 1D6EC 1TYGB 4A55A 3ZJVA 2LMCA 4WWMA 2TSSA 3VQIA 2JYEA 4LTUA 1C4CA 2QMTA 4L23A 1ROEA 1SE2A 1FCLA 3B2FA 4TQ1A 1ZDVA 1SIJA 4ZYSA 2WU5B 1IGCA 4JPSA 4JWUC 1E10A 1ET6A 2W3RA 2M56B 3R8BA 4A8XC 1TY0A 2JXTA 1E7PB 1KLUD 2K22A 3Q8EA 3AM9A 4DXFA 2WXQA 4Q2JA 3V3XA 1FNWA 3AH7A 1FNUA 4RGMA 1NYQA 1A70A 2J42A 2PLPA 1NVID 2WP9B 4XWWA 1KH0A 3LXFA 2LEKA 2WXGA 3NUHB 1HZ5A 3P4QB 3VRBB 1WYGA 4DQOC 4UDUC 1WWTA 1SJED 1UWMA 3VR9B 3GB1A 2J53A 2PVOD 4GDLB 1HXYD 2OHFA 1I4HA 2BB6A 2LJIA 1FXIA 1QKZA 4REZA 2W82A 4MM3B 2L1AA 3KWLA 3WCQA 1R7SA 1C77A 1ESFA 3AE3B 2B76B 1JQ4A 1T3QA 1VLBA 5FR3A 2D5GA 4WURA 3MHZA 2INNE 2RDGA 4ZHOA 1KRHA 3AMZA 2GRIA 3AN1A 3KQ4A 1UUPA 2WXMA 2WDRB 3W5UB 5BYSA 3AE8B 4OW0A 3AE1B 3C8YA 4US9A 5JXVA 3BVZA 3MJ5A 2BYTA 3J9CA 3FILA 2R61A 3FILB 3CWIA 1N61A 2Y5CA 1P7FA 4N59A 1AW7A 2LHEA 2RMMA 1K51A 1DOIA 5EE1A 3EUB2 1N62A 1B1ZA 1WRIA 1QOFA 4ZHPA 1JW9D 3P42A 4KKJA 1YMHE 1JCKB 2AX5A 4A6QA 1L0VB 2GI9A 3PZ8A 1QT9A 1NEKB 2N0SB 1SF0A 3AEDB 1YN3A 1NENB 2CJOA 2LFIA 5FK9C 2EELA 2MEKA 2XN9C 3EA6A 3P63A 4GLSC 1J7AA 1TS2A 3P4PB 1JWMD 1YNTE 2ICIA 4JWSC 1I4GA 3AE9B 1V1OA 1HA5A 3GS2A 2LUMA 5EE9A 1P7EA 1GB4A 1XO3A 1FEHA 2K0PA 2WXOA 1SJHD 3HUIA 1T5XD 2V0GA 1ZXHA 1F77A 3V05A 1ZOYB 1T6BX 2BB5A 2BS2B 2IGHA 4HJGE 1L4ZB 5H8YE 3DWGC 1WXQA 2BW2A 4AS1A 4P16A 2PMVA 1SEBD 5BMGA 2QIEB 3W1SA 4XDCA 1GAQB 5D3DA 1CJEA 1ZE3D 1DOYA 3ABVB 3I9V1 3TEWA 1PDXA 2M19A 2WXKA 1WSPA 4IOIE 1NYRA 1ZXIA 1KFYB 2WXHA 1MHHE 3U7ZA 1E0ZA 4OZCA 3U52E 2OEDA 1YJIA 2DYMA 3AE5B 3NVZA 1ET9A 5MPOA 1N5XA 1C76A 4DXGA 1L6UA 1XCQL 2YEPF 1IBXA 1MHXA 1V97A 3LB8C 1XXGA 2I38A 1IBXB 1J7BA 4H2AA 2KWDA 4L1BA 3PO0A 3BIID 4OZBA 1V1PB 3PZ7A 4YTNB 1DOXA 3IAS1 1VDVA 4WIPA 1CK1A 3I57A 3KWVA 2I2YA 1VJKA 4YSZB 2H88B 1GOZA 2FBWB 1D5ZC 1E6EB 2KACA 2WS3B 1XLPA 2Y3AA 2ONQA 3NVYA 4WAFA 2DLBA 2JQRB 3KLSX 5GXGB 1STEA 3NVVA 4ZRQA 3UI3A 2WXJA 1L6VA 3Q8FA 4PT5A 1QF6A 1QOBA 1FIQA 3URYA 1V8CA 3RPFC 2WDVB 2RDHA 4IDIA 4HKQA 1TKEA 1JROA 3HVDA 5D3IB 1ZUD2 2IJ0A 2KAJA 2WQYB 1VZ8A 2IPKD 2ZW1A 3Q8BA 3E9SA 4NAMA 4B0MA 5BYRA 1N60A 1L0XB 4KKIA 1PFDA 1FFUA 3AECB 1N5WA 2INPE 3GP7A 5EE0A 1ENFA 1FCCC 1MVKA 1YQ4B 4RGTA 1K50A 2WDQB 3W2DA 3CIRB 4ZRPA 3NVWA 5BYQA 2V4IB 2WXPA 3O13A 4HRSA 2HDEA 2L52A 1RYJA 1CQVA 2PW9A 5EE3A 3VR8B 3TEYA 1IGDA 5D7GA 2E3TA 3RFZB 1D4BA 1JWSD 2K3UA 3Q8AA 3TEZA 3SEBA 4KGTA 2SAKA 1CZPA 4J3OD 1EU4A 3LYYA 4YTPB 2PIAA 1HZ6A 1L5PA 1MI0A 1GPXA 1QILA 5G5GA 2WXIA 3P4RB 1MPEA 1YQ3B 1EWCA 3FAHA 2G9HD 2NTSA 3BZDB 2QEJC 4C56C 1I4RA 4KGRA 1JWAD 1RFKA 3BYYB 3AEBB 2GB1A 3AE7B 3BK2A 2X38A 2IGGA 2G1EA 1SB3C 1AYFA 3NRZA 4RF0A 3MFGA 1VZ7A 3B9JA 1JWBD 3TSSA 2W55A 2NMQA 2KQ4X 2ACZB 3H8HA 2MJ3A 1IUEA 1I4PA 1UNSA 2HTME 5H92C 3IT6B 3AB5A 1BXTA 1EU3A 2H89B 2YEPB 1M4VA 1F2RC 2PVGC 3ZYYX 2WXNA 1JRPA 1AWDA 1JALA 2BS4B 1QOGA 3T3NA 1UWXA 2BS3B 1XEEA 1I4QA 4NJCA 4EE2A 3EGRA 3DWMA 1SSNA 1TY2A 2ZW0A 3MP9A 4A9AA 2KMMA 4JE3B 1HEZE 3BVGA 1C78A 2J52A 4R3DA 4MT5A 1TZOA 1XF5L 1L0YB 5C3JB 3E56A 1AN8A 4TQ0A 1DGJA 1QOAA 3TUOA 2QSDA 4XE0A 2AQ1B 3SFEB 2JZPA 3R2IA 1Q10A 3HRDD 1PGBA 1N63A 5AUIA 1E9MA 5BMHA 1NI3A 1YJJA 2M0AA 4RNAA 5HG2A 5AUKA 2WNMA 3R2TA 1TS3A 3P4SB 4US8A 2ON8A 4IKGA 1K53A 3NZ3A 2MJEA 1J7CA 3B2GA 2RPVA 1LO5D 1F2RI 2E6XA 4L2YA 4RFBA 1XLQA 2K5PA 2Q5WD 2QILA 3P1MA 4NAWB 3VRAB 1BUIC 2WXFA 5TSSA 5FKAC 3ETRA 2Y5PA 1KLGD 3U2SC 4XWTA 1HQRD 2SEBD 1SE3A 4ITKA 1FRDA 4O1NA 1GB1A 2EKIA 3AEFB 2MJDA 4HEA1 2PKOA 2LGIA 4C7YA 2VZKD 2PTLA 2AQ3B 1TJEA 5C2TB 1PGXA 3OWEB 4JX1C 5HI1A 3FC4A 4LK0M 2FUG1 1FXAA 3N9YC 2JSVX 1K52A 4ARIA 1OQRA 2BTEA 1DYQA 1SE4A 4YSXB 1XLNA 3BWUD 4YTMB 1UGJA 2W54A 3BYTB 4OVZA 5G5HA 4C80A 3IT4B 2BBCA 3AV8A 2J4XA 5HFYA 3BVMA 3MC0B 2MH7A 1FMAD 1C4AA 1EWYC 5E6JA 3ZGZA 2JX5A 1D5MC 1TKYA 2JU6X 2V3NA 1JMLA 1RM6C 1FM0D 1VZ6A 2WU2B 4WH4A 1KF6B 1ACCA 3BK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXT A;  5HHD G;  3V3X A;  2NMQ A;  2KQ4 X;  4IOI E;  2N9K A;  1MHH E;  2PLP A;  1KH0 A;  1HZ5 A;  4OZC A;  2OED A;  1F2R C;  4KGS A;  1XCQ L;  1IBX A;  1MHX A;  1IBX B;  1UWX A;  2I38 A;  3GB1 A;  2J53 A;  2LHD A;  3MP9 A;  2ZW0 A;  2KWD A;  4OZB A;  1HEZ E;  2J52 A;  1PGA A;  2I2Y A;  1XF5 L;  1QKZ A;  2QSD A;  2KAC A;  4OZA A;  2IGD A;  2JZP A;  2ONQ A;  1Q10 A;  5BMI A;  1PGB A;  5BMH A;  3UI3 A;  5HG2 A;  2KDM A;  5JXV A;  4IKG A;  2ON8 A;  1K53 A;  3FIL A;  3FIL B;  2RPV A;  1F2R I;  1P7F A;  4HKZ E;  2ZW1 A;  1C9F A;  2LHE A;  2N9L A;  2RMM A;  1K51 A;  1FCC C;  1MVK A;  1GB1 A;  1K50 A;  2LGI A;  1YMH E;  2PTL A;  1FD6 A;  2GI9 A;  4D2K A;  1PGX A;  2PW9 A;  5HI1 A;  1EM7 A;  1IGD A;  1D4B A;  2EEL A;  2JSV X;  1K52 A;  4GLS C;  1XCT L;  4KGT A;  2JWU A;  2KN4 A;  1YNT E;  2N7J A;  4MAC A;  2LUM A;  1HZ6 A;  1MI0 A;  1P7E A;  1GB4 A;  5HFY A;  2K0P A;  1MPE A;  2QMT A;  1ZXH A;  1FCL A;  2IGH A;  4HJG E;  4KGR A;  2JU6 X;  2GB1 A;  1IGC A;  1JML A;  2IGG A;  5BMG A;  4WH4 A; 
#chains in the Genus database with same CATH topology
 1V6E A;  3EHV A;  3UQA A;  4FLH A;  1I7H A;  3TMP B;  1WR1 A;  1FFV A;  2N9K A;  2VH2 A;  4HPM B;  3HHM A;  5D2M B;  2DZJ A;  4MH8 A;  5LNK 1;  3IHP C;  2JY6 A;  4PYU A;  1C4P A;  1LXD A;  1SGH A;  4TUU A;  3DDC B;  1VRA B;  4WQM A;  1WXM A;  1H4R A;  4RH6 A;  2AQ2 B;  4KX6 B;  1T0S C;  2M4N A;  4KDI C;  4DDG D;  2V9H A;  1ZW7 A;  4RF1 A;  3U4E G;  4XDD A;  3AEE B;  2KDF B;  3ZNI D;  3ECI A;  2KZR A;  3RUL A;  2J0K A;  1L2N A;  4FXC A;  1UBQ A;  3IFW B;  5J17 A;  3ZJU A;  3IXS A;  4XC2 A;  1P3Q U;  2CHZ A;  2LJ5 A;  4FHJ A;  2K39 A;  3APF A;  4LNF A;  2N9L A;  4P1C C;  4CO7 A;  1WXV A;  2WXR A;  1S1Q B;  4ANV A;  5BO4 B;  1TKG A;  4MJS B;  3ZUN A;  3L4P A;  4ZRI A;  2A5U A;  4NPN A;  5LLI A;  1ISN A;  4HRO A;  4RM8 A;  1V1P A;  3KVF B;  3QHT A;  1V81 A;  4GB9 A;  1XCT L;  1EF5 A;  3AXC A;  2KWV B;  1OFF A;  3ZRF A;  1F0Z A;  4MAC A;  3CMM B;  1EO6 A;  1LM8 B;  1ZDX A;  2D2Q A;  2MX2 A;  2LMC A;  3PZD A;  2BQQ A;  4LNO A;  2KVZ A;  4LTU A;  2RD0 A;  2KXJ A;  2J7Q B;  2MSE D;  2JXX A;  1ZDV A;  4ZYS A;  2WU5 B;  4JPS A;  2Z0E B;  5LXH A;  2W3R A;  3JSV A;  1TY0 A;  2JXT A;  3Q8E A;  3AM9 A;  3M63 B;  2WP9 B;  1KH0 A;  3Q3F A;  2WXG A;  4W9L A;  4UDU C;  4FBJ B;  3O65 B;  2KDE B;  1UWM A;  2D3B A;  5HKH A;  1WJ6 A;  4YL8 A;  2DAF A;  3ZKJ C;  4GU2 A;  3B08 A;  1I4H A;  2AYO B;  2BB6 A;  2LJI A;  4REZ A;  2W82 A;  4MM3 B;  2IY0 B;  2LXA A;  1UZX B;  4WUR A;  2INN E;  2UYZ B;  1KRH A;  2FAZ A;  1K8R B;  3KQ4 A;  2GRI A;  2MBB B;  1TTN A;  1Y8R C;  3PS6 A;  2KJ6 A;  3V6C B;  4OW0 A;  5BYS A;  3C8Y A;  2HD5 B;  1TIF A;  2ZNV C;  5CX3 A;  3BVZ A;  4A3O A;  3DBH B;  2V3S A;  2HJ8 A;  4OVU A;  2WX1 A;  2MRP A;  2G4D B;  3L54 A;  4MEL A;  2QC8 A;  1K51 A;  5EE1 A;  2LVQ A;  1GUA B;  4EEW A;  5J18 A;  2M0X A;  1QOF A;  2KFJ A;  3P42 A;  2D3A A;  4KKJ A;  1YMH E;  3VFK A;  1JCK B;  2AX5 A;  4A6Q A;  2GI9 A;  3PZ8 A;  1NEK B;  2QHO A;  5CHV C;  2KVR A;  2LFI A;  1V9J A;  3ZW3 A;  3OG5 A;  3AE9 B;  1HA5 A;  5EE9 A;  2MBE A;  5L95 C;  1FEH A;  2NPT A;  1GC6 A;  2LXC A;  5IAA C;  4ZDV A;  1ZXH A;  1F77 A;  4GDK A;  3ZTC A;  1ZOY B;  3L08 A;  3NZU A;  2IGH A;  4HJG E;  4BKS D;  4IG7 B;  5BMG A;  4EOY A;  2EMT A;  3PPA A;  3APD A;  3I9V 1;  3TEW A;  3VH3 B;  2XK5 B;  3U7Z A;  4DBG A;  1M94 A;  2IBI B;  5AZH A;  2OED A;  1YJI A;  3AE5 B;  4DXG A;  2YLM A;  1IBX A;  1MHX A;  2CHW A;  4H2A A;  2KWD A;  3PO0 A;  3PZ7 A;  5G2N A;  3IAS 1;  1CK1 A;  2I2Y A;  4LJP B;  2Y3A A;  2WS3 B;  1XLP A;  2LGD A;  2DLB A;  2DX5 B;  2NBU A;  3NVV A;  3OJ4 B;  5JZE B;  1H8C A;  1QOB A;  2GBJ A;  2LAS A;  2DAJ A;  1WR6 E;  1F9J A;  2DHZ A;  3Q2A C;  5IO9 A;  3PLV A;  2IJ0 A;  2KAJ A;  5AEK B;  2M8S A;  4NAM A;  4PS3 A;  4C4V A;  2KJH B;  3PHX B;  2L8J A;  2UWQ A;  2INP E;  1ENF A;  1YQ4 B;  1LFD A;  4LJO B;  2N4F A;  4EUT A;  3NVW A;  5BYQ A;  2WXP A;  3O13 A;  2L52 A;  4F7Z A;  1IGD A;  2FNJ B;  2N7D A;  3RFZ B;  3Q8A A;  4KGT A;  3VUX A;  4FN2 A;  4J3O D;  5IP4 D;  4HWI B;  2NBW B;  1YQ3 B;  3BZD B;  3M3J A;  2QEJ C;  3V62 A;  1MG8 A;  3BK2 A;  2JF5 A;  2IGG A;  3RMK C;  4W9I A;  1SB3 C;  1AYF A;  4RF0 A;  4K3C A;  3TSS A;  2MJ3 A;  1IUE A;  3PRP B;  4ANU A;  4ACF A;  1WXS A;  4HDO A;  1M4V A;  2BWF A;  2PVG C;  1JRP A;  1WXA A;  2L0F A;  1AWD A;  4A3P A;  3Q3J A;  3T3N A;  5IOI A;  4KSK C;  3EGR A;  2ZW0 A;  1WGY A;  2PJH A;  1C78 A;  4KZ0 A;  3E56 A;  1AN8 A;  1DGJ A;  1T0R C;  1QOA A;  4XE0 A;  3K9O B;  3ZTD A;  4GDL A;  1N63 A;  4B6W A;  1E9M A;  5BMH A;  1NI3 A;  1YJJ A;  1V86 A;  2RGF A;  2ON8 A;  1K53 A;  1P9D U;  2MJE A;  1WZ3 A;  1J7C A;  3B2G A;  2RPV A;  2ZEQ A;  1F2R I;  3TIX A;  2KWU B;  4G3X B;  1XLQ A;  4I6N B;  1X1M A;  2QIL A;  2KLG A;  2AL3 A;  3VRA B;  2DZM A;  4M8N A;  1T0Y A;  1KOT A;  2Y5P A;  4XWT A;  1HQR D;  2G4S A;  2JT4 B;  2GBM A;  2MJD A;  2KK8 A;  3AUL A;  4EZJ A;  4ZRJ A;  1AAR A;  2AQ3 B;  3K9P B;  4JIO U;  1KM7 A;  3N9Y C;  2A4Z A;  4J6I A;  3M95 A;  1SE4 A;  1HE8 A;  2JRI B;  3RN9 C;  5JHB A;  1WGG A;  1Q5W B;  3IT4 B;  2BBC A;  3IBE A;  2J4X A;  1WGD A;  1FMA D;  3CF6 E;  2OJR A;  1EWY C;  3ZGZ A;  4FJY A;  1TKY A;  2JX5 A;  1JML A;  3PSE B;  1FM0 D;  3ZXV A;  2WU2 B;  1WJ4 A;  3BK1 A;  3HVZ A;  3T3O A;  2BPS A;  3PTF C;  2Y5B B;  3W9C B;  5JHA A;  3AE2 B;  1EF1 A;  4W9E A;  3NJT A;  4N9F 4;  3ZNG C;  3RCZ A;  2WLB A;  3ZO5 B;  3JW0 X;  3Q6B A;  4KGS A;  4P7I A;  2V4L A;  1QLB B;  2BKF A;  3AE6 B;  2HJ1 A;  1BML C;  1GJZ A;  2MBQ A;  3AEG B;  3N32 A;  3KUZ A;  3H1U A;  3IAM 1;  2C7H A;  3AEA B;  4RGO S;  2R2O A;  4TSS A;  3OAW A;  3PRZ A;  2IGD A;  4YWG G;  1UD7 A;  2JYT A;  2QJL A;  1I35 A;  2CU3 A;  4B0E A;  4MDK E;  1KTK A;  1FO4 A;  2KC1 A;  4IM3 A;  4N58 A;  3NY5 A;  4CYE A;  3PGE A;  3VUW A;  3DBS A;  1TZ1 A;  1OQQ A;  1VR9 A;  2GOW A;  3NOB A;  2L32 A;  3IG3 A;  3PHW B;  1B9R A;  4HLE A;  1WGK A;  1FRR A;  4MJS A;  4YT0 B;  2L83 A;  1JWU D;  4AQ7 A;  3A9K A;  5DCN A;  4ICU A;  1I42 A;  4FHK A;  4S17 A;  1FD6 A;  1C79 A;  3UF8 A;  1FNV A;  1XLO A;  2CU1 A;  1E8X A;  4HJK A;  1D5X C;  1MG4 A;  4NAW A;  1OTR B;  2KN4 A;  2ZZP B;  2N7J A;  2K6D B;  3TEX A;  3BIN A;  3R3M A;  3Q8C A;  4A55 A;  3ZJV A;  2WX0 A;  2KMA A;  1WF9 A;  1ROE A;  1SE2 A;  2BYE A;  4JWU C;  1ET6 A;  2N7E A;  1FXT B;  5L83 A;  4AJW A;  4G50 A;  3EEC A;  4DXF A;  4XZ4 A;  3W1Y A;  3V3X A;  3R7Q A;  1FNW A;  2BYF A;  4RGM A;  1WM2 A;  1A5R A;  2PLP A;  4GXB A;  1NVI D;  3LXF A;  3VRB B;  4MH0 E;  2V1Y A;  4DQO C;  1WYG A;  3MJW A;  1UH6 A;  2KFK B;  1WWT A;  2KDB A;  5KHO A;  3VR9 B;  2OHF A;  4BAX A;  3R66 C;  3ONS A;  1ESF A;  2KKC A;  2D11 A;  1T3Q A;  2O6V A;  4ZHO A;  4WJP A;  3AMZ A;  3N20 C;  3IVF A;  3W5U B;  2FCN A;  3AE8 B;  2MCN B;  4LNN A;  2NR2 A;  3AE1 B;  1N6Z A;  4AWJ A;  3DHH C;  3J9C A;  2AL6 A;  2R61 A;  2ZCB A;  3FIL B;  5E6N A;  1S3S G;  1AW7 A;  2ZPY A;  1HTO A;  2J0J A;  4W9C A;  1DOI A;  2DEN B;  1N62 A;  1WRI A;  4S0R A;  3JYU A;  3LDZ E;  4ZHP A;  1TT5 B;  4IM2 A;  4GMV A;  1KLV A;  1L0V B;  1C1Y B;  2IY1 B;  4NJ6 A;  2K6Q A;  1V80 A;  2N0S B;  1YN3 A;  1NEN B;  2JVC A;  5FK9 C;  4WWP A;  2MEK A;  4GLS C;  3P63 A;  1J7A A;  1E8W A;  3DVG Y;  1YNT E;  3C0R B;  1I4G A;  1P7E A;  4OVV A;  3HUI A;  4F1S A;  1SJH D;  3DBL B;  3V05 A;  2J0M A;  5H8Y E;  1MJD A;  2BS2 B;  1WXQ A;  3Q3N C;  4DK5 A;  2IZV B;  4IM0 A;  2QIE B;  4XDC A;  5D3D A;  4K1R B;  1DOY A;  3AU5 A;  4MSM B;  1KFY B;  3T9L A;  1WMH B;  2WGS A;  4OZC A;  3U52 E;  1YJ1 A;  2FUH B;  5MPO A;  1N5X A;  3A1Q A;  1C76 A;  1XCQ L;  2JZZ A;  1V97 A;  1XXG A;  1E7V A;  2DYB A;  3BII D;  4OZB A;  1VDV A;  3I57 A;  3KWV A;  1VJK A;  2L76 A;  2HTH A;  4AP4 C;  2FBW B;  2KAC A;  2ONQ A;  4WAF A;  2KAN A;  3UIO B;  3KLS X;  4KSL C;  2KQS A;  2PE9 A;  4ZRQ A;  4B9K A;  2MW5 A;  3Q8F A;  3V6E B;  1QF6 A;  1FIQ A;  2XK5 A;  2WDV B;  3RYT A;  2RDH A;  4HPL B;  3HVD A;  4K7U A;  1VZ8 A;  3VTW A;  3APC A;  2PEA A;  4B0M A;  5BYR A;  3QQ8 B;  1N60 A;  4GGQ A;  4KKI A;  1PFD A;  1E8Y A;  3VUY A;  3GP7 A;  1MVK A;  2KD0 A;  3DOW A;  2LI5 A;  3W2D A;  2IO3 B;  3CIR B;  4DHZ E;  4HCN B;  2QCZ A;  4HRS A;  5EE3 A;  5AZG A;  1CQV A;  2FCS A;  3MC8 A;  3ZRC A;  3DPD A;  1GNU A;  1GPX A;  1QIL A;  2WXI A;  4BZA A;  2KHW B;  1EWC A;  4NJ7 A;  2G9H D;  2NTS A;  4IW0 A;  4X57 B;  3HM3 A;  2LGX A;  3AE7 B;  4KDL B;  4AJY B;  3KYC D;  4W9G A;  4E74 A;  2JPH A;  3R7R A;  1RRB A;  4RMA A;  2ACZ B;  3H8H A;  3AB5 A;  2CS4 A;  5E6P A;  2BGF A;  3ALB A;  1UBI A;  2WXN A;  2D3C A;  1QOG A;  2BS3 B;  4EE2 A;  3RI7 C;  1TY2 A;  4A9A A;  2KMM A;  4BFR A;  4JE3 B;  3KUD B;  2IND C;  2J52 A;  4R3D A;  4MT5 A;  1L0Y B;  4W9H A;  3TUO A;  2QSD A;  1SIF A;  3SFE B;  1SE9 A;  1Q10 A;  3RNG C;  2KNB A;  3H7P A;  2M0A A;  4RNA A;  2L7R A;  2WNM A;  4XX5 A;  3R2T A;  1TS3 A;  4TKN A;  4US8 A;  1OEY A;  2K8C A;  3VTU A;  1ZGU B;  2E6X A;  1RLF A;  4RFB A;  3PLU A;  3L17 A;  1ZKH A;  2Q5W D;  2L0T A;  5TSS A;  5FKA C;  3ETR A;  4AUQ C;  2IYD B;  4EFO A;  1KLG D;  2SEB D;  2PPH A;  1FRD A;  4O1N A;  2KDI A;  2DZK A;  4M02 A;  4ZYN A;  2PKO A;  4C7Y A;  4MM3 A;  2ZNV B;  1JRU A;  2VZK D;  3DBH I;  5C2T B;  1PGX A;  4LK0 M;  3DBL I;  2JSV X;  4TV3 A;  1OQR A;  2BTE A;  4PYZ A;  4YTM B;  1UGJ A;  2O2V B;  2M17 A;  2W54 A;  4OVZ A;  3A9J A;  2KQ7 A;  4C80 A;  1C4A A;  3DHI C;  3FKY A;  3H9D A;  1RM6 C;  2CR5 A;  4WH4 A;  1KF6 B;  1RAX A;  1WX7 A;  4MGI E;  5HHD G;  2L00 B;  1R4M B;  4KIK A;  1ZP0 B;  4ZOH C;  2XNA C;  3SFD B;  4OHJ A;  2IO1 B;  4N6E B;  4C7Z A;  2K1F A;  4W9K A;  4A90 A;  1ZPS A;  3W1S C;  2VRR B;  3WA0 A;  2FID A;  2MA9 B;  3AE4 B;  2I1K A;  1I4X A;  2LHD A;  4DXA B;  2GLS A;  3GE8 C;  2MWS B;  2K9X A;  2BT6 A;  2I1J A;  3C19 A;  5D6J B;  1TS5 A;  4M01 A;  2AWT A;  4K3B A;  4GN1 A;  3ENE A;  4LLG M;  2FE8 A;  3DQV A;  1PYW D;  4CHK A;  1XD3 B;  4MEM A;  2KDM A;  5J2R A;  4DHJ B;  4IC7 B;  4WWN A;  2KC2 A;  3ZJT A;  4I6L B;  2DBY A;  1SBB B;  2VZK B;  3NHE B;  2V3P A;  4HK2 A;  3NS1 A;  1NDD A;  1PUT A;  3D32 A;  1YN4 A;  3QX1 A;  2WXL A;  3GE3 C;  1OEY J;  1BT0 A;  4NNJ B;  4A20 A;  1L4D B;  3H7S A;  4D2K A;  2LZ6 A;  1E8Z A;  2IDY A;  1EM7 A;  1WJU A;  3DBR I;  1RWS A;  4M0W A;  2JWU A;  4BVU C;  4YXD B;  4JLC A;  1D6E C;  2L05 A;  4JL9 A;  4WWM A;  2TSS A;  4IWO A;  4FJZ A;  2JYE A;  4KZC A;  1C4C A;  2OOB B;  1FCL A;  3B2F A;  2R2Q A;  1SIJ A;  1IGC A;  4GSW A;  2M56 B;  3R8B A;  1V2Y A;  4BKS A;  1KLU D;  2K22 A;  1WE7 A;  2WXQ A;  1V5O A;  1FNU A;  2ZVN A;  1A70 A;  2J42 A;  2ZJD A;  4XWW A;  3NUH B;  1HZ5 A;  3P4Q B;  4HXD A;  2EKE C;  3NZS A;  4ASW C;  3VHT C;  3GB1 A;  2J53 A;  2PVO D;  4GDL B;  4EZK A;  2G3Q B;  1J19 A;  3RNC C;  2L1A A;  3WCQ A;  3Q3M C;  1VCB A;  1C77 A;  3L16 A;  2B76 B;  1VLB A;  3RNF C;  3X0W A;  2D5G A;  3MHZ A;  2MBH A;  3VXW A;  1EUV B;  3N1Z C;  3PRM B;  2WDR B;  3WAP A;  1Q1O A;  2W9N A;  5JXV A;  2DZI A;  2BYT A;  1IP9 A;  3FIL A;  4FA6 A;  5DPW A;  1TGZ B;  3KUC B;  3CWI A;  1Q0W B;  1YD8 U;  2Y5C A;  4N59 A;  2MP2 A;  2LHE A;  1FPY A;  4HCP B;  3TCA A;  3TL5 A;  4E71 A;  4DHJ D;  1B1Z A;  1NI2 A;  3RUI B;  1JW9 D;  1P98 A;  1P0R A;  3KW5 B;  2KLC A;  3QA8 A;  2CJO A;  2N9X A;  2EEL A;  3EA6 A;  3QC8 B;  1UF0 A;  3RNB C;  3H7P B;  3P4P B;  2HE7 A;  2ICI A;  3PT2 B;  4JWS C;  4BBN C;  3M62 B;  5CTR C;  1GB4 A;  1XO3 A;  2WXO A;  4BOS C;  1T5X D;  2N1V A;  2V0G A;  2KT7 A;  2VH1 A;  2KJR A;  4QAY A;  1T6B X;  2BB5 A;  4AOF A;  1YIW A;  4AS1 A;  4P16 A;  3U30 A;  4XYC A;  4BKG A;  1CJE A;  2MBO A;  2K8B A;  1WSP A;  4IOI E;  3SU8 X;  1NYR A;  2DNF A;  1ZXI A;  2WXH A;  1MHH E;  5TR5 A;  1YX5 B;  1E0Z A;  4WQO B;  1WIA A;  3NVZ A;  3QJZ A;  1ET9 A;  4K7W A;  3RZW C;  4LNK A;  2RR9 A;  2GBR A;  1L6U A;  1WGR A;  2YEP F;  3VTV A;  1XT9 B;  1IBX B;  3LB8 C;  1J7B A;  1V1P B;  1DOX A;  4WIP A;  2Z0D B;  4PS8 A;  3WAM A;  2H88 B;  1GOZ A;  3HIZ A;  2XEW A;  2NCN A;  4NY0 A;  2JQR B;  5GXG B;  3ZDT A;  1STE A;  2XBB C;  4KVG B;  3A33 B;  3UI3 A;  2KFK A;  2K25 A;  4PT5 A;  1V8C A;  4HKQ A;  3CST A;  1TKE A;  1JRO A;  4GIV A;  5DPR A;  1ZUD 2;  1XQQ A;  2WQY B;  5IA7 A;  2IPK D;  2OJW A;  3E9S A;  3JVZ X;  3Q3O C;  3QAR A;  5DPT A;  3VAW A;  1L0X B;  4DDI D;  4BBN F;  3AEC B;  1N5W A;  1FCC C;  4RGT A;  1C3T A;  4M8M A;  4ZRP A;  2YVC A;  3ZIM A;  4E3C A;  2V4I B;  1RYJ A;  2PW9 A;  3PV1 A;  3RT3 B;  3VR8 B;  3A4R A;  3TEY A;  2E3T A;  2K3U A;  2KN5 A;  1HTQ A;  2WWZ A;  1OGW A;  1EU4 A;  1R4N I;  4HPP A;  2PIA A;  5EDS A;  4LCD E;  1F1H A;  5G5G A;  3FAH A;  2LUE A;  1I4R A;  4KGR A;  1JWA D;  1RFK A;  2ZPN A;  1CMX B;  2X38 A;  1WM3 A;  4MSQ B;  3MFG A;  2NMQ A;  2KQ4 X;  2GMI C;  1I4P A;  2HTM E;  1UNS A;  1BXT A;  4II2 B;  1EU3 A;  2YEP B;  1F2R C;  1IPG A;  2N9P C;  1XEE A;  3UIP B;  4G0N B;  3DWM A;  2LRU A;  4ANX A;  4FAD A;  3BVG A;  5CHF A;  5C3J B;  2FCQ A;  1QZE A;  2AQ1 B;  3GZN I;  4BKT A;  2JZP A;  2QDF A;  3R2I A;  2B3A A;  3HRD D;  3AU4 A;  4PS7 A;  3A1Q B;  2C5L C;  5HG2 A;  2C9W B;  5AUK A;  4I6P A;  3P2B A;  3P4S B;  2REX A;  3NZ3 A;  1LO5 D;  3TJP A;  3U8Z A;  1WI0 A;  4L2Y A;  3UIN B;  3RD2 A;  1NBF C;  4ANW A;  4K7S A;  3I63 C;  2WXF A;  3GOE A;  3EFU A;  2NS5 A;  4ITK A;  2BKR B;  2EKI A;  3AEF B;  4HEA 1;  4GOC A;  3N1Y C;  2PTL A;  1TJE A;  3OWE B;  5HI1 A;  3FC4 A;  1FXA A;  5E6O A;  2FIF A;  4ARI A;  4YSX B;  3BWU D;  2C60 A;  3BYT B;  2O6V B;  4NQK E;  3QK0 A;  3UQB A;  3AV8 A;  2MH7 A;  3QIJ A;  3CSF A;  5E6J A;  2ASQ A;  1D3Z A;  3U7D A;  3VDZ A;  2V3N A;  2Z59 B;  2KWC A;  2GBN A;  1ACC A;  1WE6 A;  4NZL B;  3OJ3 A;  5CHW A;  4KIK B;  2DWQ A;  1PQS A;  3N1X C;  1V5T A;  4WJN A;  3SR6 A;  4P6V F;  2BWE S;  2NVU I;  3B0A A;  4W9J A;  2O2V A;  1J0G A;  2W3S A;  1WYW B;  2LWP A;  3QWZ B;  2ZCC A;  3TBL D;  1PGA A;  1WRD B;  3QAQ A;  3L10 B;  2CJN A;  4RCO A;  4OZA A;  3RNE C;  5BMI A;  3ZNZ B;  3ZDM C;  4W9F A;  3HK0 A;  4USA A;  3DVG X;  3VVW B;  1TS4 A;  4IUM B;  5IN7 A;  1MFW A;  1IYF A;  5T8I A;  2DYO A;  4JGH B;  2KTR A;  4XGA B;  4YSY B;  2NTT A;  4MGK E;  5G55 A;  4FJV B;  3X23 A;  4HKZ E;  1C9F A;  3ZLZ A;  4RGN A;  3W5V B;  1P1A A;  2Z8L A;  3ZQ4 A;  4GDK B;  3L13 A;  2MQJ A;  1YN5 A;  3A9K B;  4B95 A;  2N1W A;  1Y56 A;  4TMA B;  1WFY A;  4G11 A;  4CQN A;  3ZXR A;  1QQR A;  4EZL A;  1SXT A;  1Z5S B;  5LXI B;  2KYW A;  5I4D A;  2L3Z A;  3DCG A;  4ARC A;  3AI5 A;  3Q69 A;  2MLB A;  2INC C;  1TYG B;  2KX3 A;  1GG3 A;  4LDT D;  3VQI A;  2CKH B;  2QMT A;  4L23 A;  4EKU A;  2BF8 B;  4TQ1 A;  3WAL A;  4URK A;  1J8C A;  1E10 A;  1LGR A;  4A8X C;  3JSV B;  1E7P B;  4Q2J A;  3AH7 A;  1NYQ A;  3DVN U;  4ICV A;  3GZN B;  3RZF A;  1LQB A;  2LEK A;  4K81 A;  1WJN A;  2KTF A;  1L7Y A;  1SJE D;  2AEH A;  2WHI A;  1HXY D;  2RPQ A;  1FXI A;  1QKZ A;  5D94 A;  3KWL A;  1R7S A;  3AE3 B;  2D07 B;  1JQ4 A;  5FR3 A;  1KJT A;  2RDG A;  2PE6 B;  4HDQ A;  2ZVO A;  3AN1 A;  3EFC A;  1UUP A;  2WXM A;  2KTR B;  1Z2M A;  2BVC A;  3HM6 X;  4US9 A;  3MJ5 A;  3T8M A;  4HVB A;  3WIM A;  4C00 A;  2NPT B;  2RSU A;  1N61 A;  3MHS D;  1P7F A;  1E90 A;  3SHQ A;  2RMM A;  2NBV B;  3EUB 2;  3N30 A;  4FUL A;  4W9D A;  2O6V D;  2LGY A;  2JUO A;  2M1M A;  3H6N A;  2D3G A;  1QT9 A;  3AED B;  1SF0 A;  4P1B C;  2IO0 B;  2XN9 C;  4M00 A;  4MGY E;  3ZNH B;  1TS2 A;  3ML9 A;  1JWM D;  2JRH A;  1V1O A;  3GS2 A;  2LUM A;  2K0P A;  1WGH A;  5IKC M;  2UU7 A;  5C1Z A;  5C23 A;  1L4Z B;  3DWG C;  2BW2 A;  3A9J B;  3V61 A;  2PMV A;  1SEB D;  2WYQ A;  3W1S A;  4DHZ B;  4DWF A;  1GAQ B;  1ZE3 D;  4M0W B;  3ABV B;  1PDX A;  2M19 A;  2WXK A;  3DVN V;  3NS8 A;  4MGZ E;  1F52 A;  1WMH A;  1G6J A;  2LRW A;  2DYM A;  3DBR B;  3QCA A;  3S2A A;  3LJ3 A;  1R4M I;  2I38 A;  2KX0 A;  4L1B A;  4YTN B;  4BOZ B;  2LVP A;  2G45 B;  1WX8 A;  1UGM A;  3SDL C;  4YSZ B;  1D5Z C;  1V49 A;  1E6E B;  2CHX A;  3NVY A;  2K8H A;  1E7U A;  1TBE A;  2C7M B;  2FCM A;  3N3K B;  3UGB B;  1YQB A;  2WXJ A;  1L6V A;  3URY A;  4LDT B;  3RPF C;  4IDI A;  5D3I B;  2KO3 A;  1E5W A;  5DPS A;  1OQY A;  3Q8B A;  2ZW1 A;  3L0W B;  4C4V B;  4II3 B;  5AZF A;  1YX6 B;  1FFU A;  2N9E B;  5EE0 A;  3MTN B;  2JZ3 B;  1K50 A;  2WDQ B;  4NQL B;  2HDE A;  5GMV A;  5D7G A;  1D4B A;  1JWS D;  3TEZ A;  3SEB A;  2SAK A;  2WDT B;  1CZP A;  5JH5 C;  3LYY A;  4YTP B;  3OLM D;  4F8C B;  1HZ6 A;  1L5P A;  1MI0 A;  1WY8 A;  3I3T B;  1WZ0 A;  2JWZ A;  3BY4 B;  3P4R B;  4IWQ A;  1MPE A;  3EC8 A;  3PRE A;  4ZRK A;  4C56 C;  3BYY B;  1WX9 A;  3AEB B;  2GB1 A;  2LGS A;  3RNA C;  2G1E A;  3NRZ A;  1VZ7 A;  3B9J A;  1JWB D;  2W55 A;  3VH4 B;  4WJQ A;  1UEL A;  4KV2 A;  5H92 C;  3IT6 B;  3KYD D;  3WAO A;  3SD5 A;  3A4S C;  2H89 B;  1T0Q C;  3ZYY X;  2MHJ A;  1JAL A;  2GBK A;  2LVO A;  2BS4 B;  1UWX A;  4NJC A;  3V60 A;  1I4Q A;  1SSN A;  3MP9 A;  3MC9 A;  4PK1 A;  1HEZ E;  4LNI A;  1TZO A;  1XF5 L;  3PVL A;  4TQ0 A;  1PGB A;  2EMS A;  5AUI A;  1YOV B;  2MP2 B;  1U4A A;  2C7N B;  3ML8 A;  4IKG A;  4JQW C;  5FR6 A;  3WAN A;  5KHQ A;  2K5P A;  3P1M A;  4NAW B;  1BUI C;  3U2S C;  2KMC A;  1SE3 A;  3KH0 A;  1GB1 A;  2D10 A;  1R4N B;  2LGI A;  1RFA A;  3I5J C;  4JX1 C;  2FUG 1;  1VD2 A;  2RDB C;  1K52 A;  2BYV E;  1DYQ A;  1GC7 A;  1XLN A;  3DHG C;  3B1L X;  5G5H A;  3NG0 A;  2KOX A;  3Q14 C;  5HFY A;  3BVM A;  3MC0 B;  3ZVV A;  4IWP A;  1WH3 A;  4WWO A;  1D5M C;  4RM9 A;  2X8X X;  2LD9 A;  4WJO A;  2JU6 X;  2IO2 B;  1VZ6 A;  4WAA A; 
#chains in the Genus database with same CATH homology
 3HVZ A;  5HHD G;  3T3O A;  3W9C B;  3AE2 B;  1I7H A;  4NZL B;  1FFV A;  2N9K A;  1ZP0 B;  4ZOH C;  2XNA C;  3SFD B;  2DWQ A;  4OHJ A;  4N6E B;  2WLB A;  4C7Z A;  4MH8 A;  5LNK 1;  4A90 A;  3SR6 A;  4P6V F;  1ZPS A;  4KGS A;  1C4P A;  1QLB B;  1VRA B;  4WQM A;  3AE6 B;  2W3S A;  1BML C;  3AE4 B;  1I4X A;  2LHD A;  4RH6 A;  2AQ2 B;  2K9X A;  2BT6 A;  3AEG B;  1PGA A;  4KX6 B;  3IAM 1;  2CJN A;  3AEA B;  4RCO A;  4RGO S;  4YWG G;  4TSS A;  4OZA A;  2IGD A;  4RF1 A;  3U4E G;  4XDD A;  1TS5 A;  3AEE B;  5BMI A;  4LLG M;  2FE8 A;  1PYW D;  2JYT A;  2QJL A;  2CU3 A;  4B0E A;  2KDM A;  4USA A;  1KTK A;  1TS4 A;  4FXC A;  1FO4 A;  4N58 A;  5T8I A;  3ZJT A;  2DYO A;  2DBY A;  3ZJU A;  3IXS A;  1SBB B;  2VZK B;  4YSY B;  1OQQ A;  1VR9 A;  2NTT A;  2V3P A;  3NS1 A;  1PUT A;  4HKZ E;  1C9F A;  2N9L A;  1YN4 A;  2L32 A;  2WXL A;  4RGN A;  2WXR A;  3W5V B;  1B9R A;  1TKG A;  2Z8L A;  1WGK A;  1FRR A;  3ZQ4 A;  4GDK B;  1YN5 A;  4YT0 B;  2L83 A;  3L4P A;  1JWU D;  4AQ7 A;  1Y56 A;  1L4D B;  4TMA B;  4CQN A;  1FD6 A;  1C79 A;  1QQR A;  1FNV A;  4D2K A;  1SXT A;  2IDY A;  1XLO A;  4HRO A;  1EM7 A;  1V1P A;  5I4D A;  1D5X C;  1XCT L;  1RWS A;  4M0W A;  2JWU A;  2KN4 A;  1OFF A;  2N7J A;  4YXD B;  3TEX A;  1F0Z A;  4ARC A;  3Q69 A;  3Q8C A;  4MAC A;  1ZDX A;  1D6E C;  1TYG B;  4A55 A;  3ZJV A;  2LMC A;  4WWM A;  2TSS A;  3VQI A;  2JYE A;  4LTU A;  1C4C A;  2QMT A;  4L23 A;  1ROE A;  1SE2 A;  1FCL A;  3B2F A;  4TQ1 A;  1ZDV A;  1SIJ A;  4ZYS A;  2WU5 B;  1IGC A;  4JPS A;  4JWU C;  1E10 A;  1ET6 A;  2W3R A;  2M56 B;  3R8B A;  4A8X C;  1TY0 A;  2JXT A;  1E7P B;  1KLU D;  2K22 A;  3Q8E A;  3AM9 A;  4DXF A;  2WXQ A;  4Q2J A;  3V3X A;  1FNW A;  3AH7 A;  1FNU A;  4RGM A;  1NYQ A;  1A70 A;  2J42 A;  2PLP A;  1NVI D;  2WP9 B;  4XWW A;  1KH0 A;  3LXF A;  2LEK A;  2WXG A;  3NUH B;  1HZ5 A;  3P4Q B;  3VRB B;  1WYG A;  4DQO C;  4UDU C;  1WWT A;  1SJE D;  1UWM A;  3VR9 B;  3GB1 A;  2J53 A;  2PVO D;  4GDL B;  1HXY D;  2OHF A;  1I4H A;  2BB6 A;  2LJI A;  1FXI A;  1QKZ A;  4REZ A;  2W82 A;  4MM3 B;  2L1A A;  3KWL A;  3WCQ A;  1R7S A;  1C77 A;  1ESF A;  3AE3 B;  2B76 B;  1JQ4 A;  1T3Q A;  1VLB A;  5FR3 A;  2D5G A;  4WUR A;  3MHZ A;  2INN E;  2RDG A;  4ZHO A;  1KRH A;  3AMZ A;  2GRI A;  3AN1 A;  3KQ4 A;  1UUP A;  2WXM A;  2WDR B;  3W5U B;  5BYS A;  3AE8 B;  4OW0 A;  3AE1 B;  3C8Y A;  4US9 A;  5JXV A;  3BVZ A;  3MJ5 A;  2BYT A;  3J9C A;  3FIL A;  2R61 A;  3FIL B;  3CWI A;  1N61 A;  2Y5C A;  1P7F A;  4N59 A;  1AW7 A;  2LHE A;  2RMM A;  1K51 A;  1DOI A;  5EE1 A;  3EUB 2;  1N62 A;  1B1Z A;  1WRI A;  1QOF A;  4ZHP A;  1JW9 D;  3P42 A;  4KKJ A;  1YMH E;  1JCK B;  2AX5 A;  4A6Q A;  1L0V B;  2GI9 A;  3PZ8 A;  1QT9 A;  1NEK B;  2N0S B;  1SF0 A;  3AED B;  1YN3 A;  1NEN B;  2CJO A;  2LFI A;  5FK9 C;  2EEL A;  2MEK A;  2XN9 C;  3EA6 A;  3P63 A;  4GLS C;  1J7A A;  1TS2 A;  3P4P B;  1JWM D;  1YNT E;  2ICI A;  4JWS C;  1I4G A;  3AE9 B;  1V1O A;  1HA5 A;  3GS2 A;  2LUM A;  5EE9 A;  1P7E A;  1GB4 A;  1XO3 A;  1FEH A;  2K0P A;  2WXO A;  1SJH D;  3HUI A;  1T5X D;  2V0G A;  1ZXH A;  1F77 A;  3V05 A;  1ZOY B;  1T6B X;  2BB5 A;  2BS2 B;  2IGH A;  4HJG E;  1L4Z B;  5H8Y E;  3DWG C;  1WXQ A;  2BW2 A;  4AS1 A;  4P16 A;  2PMV A;  1SEB D;  5BMG A;  2QIE B;  3W1S A;  4XDC A;  1GAQ B;  5D3D A;  1CJE A;  1ZE3 D;  1DOY A;  3ABV B;  3I9V 1;  3TEW A;  1PDX A;  2M19 A;  2WXK A;  1WSP A;  4IOI E;  1NYR A;  1ZXI A;  1KFY B;  2WXH A;  1MHH E;  3U7Z A;  1E0Z A;  4OZC A;  3U52 E;  2OED A;  1YJI A;  2DYM A;  3AE5 B;  3NVZ A;  1ET9 A;  5MPO A;  1N5X A;  1C76 A;  4DXG A;  1L6U A;  1XCQ L;  2YEP F;  1IBX A;  1MHX A;  1V97 A;  3LB8 C;  1XXG A;  2I38 A;  1IBX B;  1J7B A;  4H2A A;  2KWD A;  4L1B A;  3PO0 A;  3BII D;  4OZB A;  1V1P B;  3PZ7 A;  4YTN B;  1DOX A;  3IAS 1;  1VDV A;  4WIP A;  1CK1 A;  3I57 A;  3KWV A;  2I2Y A;  1VJK A;  4YSZ B;  2H88 B;  1GOZ A;  2FBW B;  1D5Z C;  1E6E B;  2KAC A;  2WS3 B;  1XLP A;  2Y3A A;  2ONQ A;  3NVY A;  4WAF A;  2DLB A;  2JQR B;  3KLS X;  5GXG B;  1STE A;  3NVV A;  4ZRQ A;  3UI3 A;  2WXJ A;  1L6V A;  3Q8F A;  4PT5 A;  1QF6 A;  1QOB A;  1FIQ A;  3URY A;  1V8C A;  3RPF C;  2WDV B;  2RDH A;  4IDI A;  4HKQ A;  1TKE A;  1JRO A;  3HVD A;  5D3I B;  1ZUD 2;  2IJ0 A;  2KAJ A;  2WQY B;  1VZ8 A;  2IPK D;  2ZW1 A;  3Q8B A;  3E9S A;  4NAM A;  4B0M A;  5BYR A;  1N60 A;  1L0X B;  4KKI A;  1PFD A;  1FFU A;  3AEC B;  1N5W A;  2INP E;  3GP7 A;  5EE0 A;  1ENF A;  1FCC C;  1MVK A;  1YQ4 B;  4RGT A;  1K50 A;  2WDQ B;  3W2D A;  3CIR B;  4ZRP A;  3NVW A;  5BYQ A;  2V4I B;  2WXP A;  3O13 A;  4HRS A;  2HDE A;  2L52 A;  1RYJ A;  1CQV A;  2PW9 A;  5EE3 A;  3VR8 B;  3TEY A;  1IGD A;  5D7G A;  2E3T A;  3RFZ B;  1D4B A;  1JWS D;  2K3U A;  3Q8A A;  3TEZ A;  3SEB A;  4KGT A;  2SAK A;  1CZP A;  4J3O D;  1EU4 A;  3LYY A;  4YTP B;  2PIA A;  1HZ6 A;  1L5P A;  1MI0 A;  1GPX A;  1QIL A;  5G5G A;  2WXI A;  3P4R B;  1MPE A;  1YQ3 B;  1EWC A;  3FAH A;  2G9H D;  2NTS A;  3BZD B;  2QEJ C;  4C56 C;  1I4R A;  4KGR A;  1JWA D;  1RFK A;  3BYY B;  3AEB B;  2GB1 A;  3AE7 B;  3BK2 A;  2X38 A;  2IGG A;  2G1E A;  1SB3 C;  1AYF A;  3NRZ A;  4RF0 A;  3MFG A;  1VZ7 A;  3B9J A;  1JWB D;  3TSS A;  2W55 A;  2NMQ A;  2KQ4 X;  2ACZ B;  3H8H A;  2MJ3 A;  1IUE A;  1I4P A;  1UNS A;  2HTM E;  5H92 C;  3IT6 B;  3AB5 A;  1BXT A;  1EU3 A;  2H89 B;  2YEP B;  1M4V A;  1F2R C;  2PVG C;  3ZYY X;  2WXN A;  1JRP A;  1AWD A;  1JAL A;  2BS4 B;  1QOG A;  3T3N A;  1UWX A;  2BS3 B;  1XEE A;  1I4Q A;  4NJC A;  4EE2 A;  3EGR A;  3DWM A;  1SSN A;  1TY2 A;  2ZW0 A;  3MP9 A;  4A9A A;  2KMM A;  4JE3 B;  1HEZ E;  3BVG A;  1C78 A;  2J52 A;  4R3D A;  4MT5 A;  1TZO A;  1XF5 L;  1L0Y B;  5C3J B;  3E56 A;  1AN8 A;  4TQ0 A;  1DGJ A;  1QOA A;  3TUO A;  2QSD A;  4XE0 A;  2AQ1 B;  3SFE B;  2JZP A;  3R2I A;  1Q10 A;  3HRD D;  1PGB A;  1N63 A;  5AUI A;  1E9M A;  5BMH A;  1NI3 A;  1YJJ A;  2M0A A;  4RNA A;  5HG2 A;  5AUK A;  2WNM A;  3R2T A;  1TS3 A;  3P4S B;  4US8 A;  2ON8 A;  4IKG A;  1K53 A;  3NZ3 A;  2MJE A;  1J7C A;  3B2G A;  2RPV A;  1LO5 D;  1F2R I;  2E6X A;  4L2Y A;  4RFB A;  1XLQ A;  2K5P A;  2Q5W D;  2QIL A;  3P1M A;  4NAW B;  3VRA B;  1BUI C;  2WXF A;  5TSS A;  5FKA C;  3ETR A;  2Y5P A;  1KLG D;  3U2S C;  4XWT A;  1HQR D;  2SEB D;  1SE3 A;  4ITK A;  1FRD A;  4O1N A;  1GB1 A;  2EKI A;  3AEF B;  2MJD A;  4HEA 1;  2PKO A;  2LGI A;  4C7Y A;  2VZK D;  2PTL A;  2AQ3 B;  1TJE A;  5C2T B;  1PGX A;  3OWE B;  4JX1 C;  5HI1 A;  3FC4 A;  4LK0 M;  2FUG 1;  1FXA A;  3N9Y C;  2JSV X;  1K52 A;  4ARI A;  1OQR A;  2BTE A;  1DYQ A;  1SE4 A;  4YSX B;  1XLN A;  3BWU D;  4YTM B;  1UGJ A;  2W54 A;  3BYT B;  4OVZ A;  5G5H A;  4C80 A;  3IT4 B;  2BBC A;  3AV8 A;  2J4X A;  5HFY A;  3BVM A;  3MC0 B;  2MH7 A;  1FMA D;  1C4A A;  1EWY C;  5E6J A;  3ZGZ A;  2JX5 A;  1D5M C;  1TKY A;  2JU6 X;  2V3N A;  1JML A;  1RM6 C;  1FM0 D;  1VZ6 A;  2WU2 B;  4WH4 A;  1KF6 B;  1ACC A;  3BK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...