1XCQL

Complex hcv core-fab 19d9d6-protein l mutant (d55a,l57h,y64w) in space group p21
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
PKEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALHAKVNGEWTADLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein C
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 8
structure length 66
sequence length 66
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xcqL00
1UWXA 3V3XA 1MPEA 5BMHA 1F2RC 5HHDG 2KDMA 4OZAA 4KGSA 5HI1A 1FD6A 1K50A 2I38A 4MACA 1MVKA 2EELA 1JMLA 5BMGA 2QMTA 5HFYA 1MHHE 2KACA 2ZW0A 1K52A 2NMQA 1YNTE 2PLPA 3MP9A 1IGCA 1PGXA 2JWUA 1KH0A 4OZCA 2ZW1A 2J53A 2LUMA 2IGDA 1P7FA 1PGAA 1FCLA 1GB1A 3GB1A 2QSDA 1C9FA 2N9KA 2GI9A 2RMMA 1YMHE 1HEZE 1QKZA 4OZBA 1FCCC 4GLSC 1EM7A 4KGRA 1K53A 2JZPA 2J52A 4KGTA 1XF5L 4WH4A 1F2RI 1HZ6A 1MHXA 4IKGA 2GB1A 2JXTA 4HJGE 5BMIA 1Q10A 1GB4A 2PW9A 1IGDA 5JXVA 1XCTL 2KQ4X 2N9LA 1IBXA 2LGIA 2JSVX 2IGHA 2JU6X 1MI0A 1IBXB 2IGGA 4D2KA 3FILA 2LHEA 4IOIE 2N7JA 2KWDA 1PGBA 2K0PA 2RPVA 3FILB 1D4BA 2ONQA 1HZ5A 4HKZE 1ZXHA 2KN4A 2ON8A 2PTLA 5HG2A 2LHDA 1K51A 2I2YA 2OEDA 1P7EA 1XCQL 3UI3A
chains in the Genus database with same CATH superfamily
3UINB 3UQBA 3T9LA 1P0RA 3MC0B 3WAPA 1LM8B 2L32A 4AP4C 2VZKD 3IT4B 5H92C 4HK2A 3RNAC 4DXAB 1NDDA 4MM3A 4JPSA 4NAWA 1EO6A 3WCQA 4BOSC 2DX5B 3PLVA 3W5VB 3AMZA 3P4PB 2W9NA 2PE9A 1X1MA 4W9KA 1PFDA 4A6QA 1YNTE 2MW5A 1C1YB 1T0RC 3WA0A 1SE2A 3GZNB 5J18A 5IA7A 4BKGA 4EOYA 2VH1A 2WP9B 2BS2B 1XO3A 2MX2A 2YLMA 1L0XB 2G4DB 2W54A 1FRRA 4C7YA 2J42A 2LUEA 3Q3JA 2FAZA 3URYA 2RDBC 1SIJA 2N4FA 1QF6A 1HEZE 4IW0A 2L00B 4KIKB 3W1YA 1WMHB 1AWDA 2JZPA 3CF6E 1M94A 3QA8A 1D5XC 1NYRA 1TKGA 2HD5B 4NNJB 1WRDB 2WXKA 1TS5A 5G5HA 2KXJA 1N63A 3ALBA 1UBIA 1L0VB 3HM6X 2KQ4X 2XBBC 2IZVB 3VUWA 3PLUA 1KM7A 1V49A 3M3JA 4M8MA 3IHPC 4WJNA 3VAWA 4OVVA 2V3NA 3QCAA 1WXSA 3EC8A 4IC7B 2ZNVB 2FUHB 2KNBA 4NJCA 2V3SA 2BWES 2KWCA 1J0GA 2KQSA 3OG5A 1UZXB 3OJ3A 3VUXA 1P7EA 2VRRB 4URKA 3KW5B 1UNSA 3UI3A 3GP7A 3IFWB 2L05A 3ZNZB 4ASWC 4II2B 1KLGD 2NR2A 1NI3A 2KDIA 3NRZA 1SE3A 4M00A 4M8NA 4GDLB 2KMMA 1JMLA 1I4RA 3BIID 1H4RA 4JQWC 4P1CC 4GOCA 1CJEA 2DENB 1AARA 1XT9B 3LB8C 4JGHB 4FHKA 1WSPA 4MGYE 3PSEB 4WAFA 1I4PA 2MEKA 1SF0A 2NPTB 2M0XA 1FCLA 3AE9B 1TYGB 2L83A 1UELA 1NBFC 4CQNA 1TBEA 2PMVA 4ARCA 3SHQA 4RMAA 2NBVB 2FNJB 1E5WA 2LVQA 3RZFA 1N5XA 5BMIA 2BB6A 1SIFA 1SE4A 3PTFC 4W9EA 3ZJVA 3ECIA 2N9LA 4KDIC 3A4RA 4LLGM 4P1BC 1E90A 3VQIA 3PZ7A 4TV3A 4D2KA 1JALA 1STEA 1WR1A 4NPNA 4WURA 3RMKC 2JZZA 4CHKA 3V6CB 1XQQA 5C3JB 1WJUA 3MJ5A 5E6OA 4RGMA 4DQOC 1V97A 1J19A 2G45B 3W5UB 1FFVA 2KANA 2WGSA 1KLUD 5AUIA 4X57B 4GDKB 3RZWC 1GC6A 3DBHI 4YWGG 2INCC 4FXCA 1ZGUB 4B0EA 2WNMA 5BMHA 1QLBB 2J0JA 2CHZA 5HI1A 1XXGA 4KSLC 2TSSA 1ET6A 1R4MB 4GSWA 1ZOYB 1KOTA 3BVGA 1EUVB 1T5XD 3EECA 3RCZA 4A3OA 1WWTA 2QCZA 2MP2B 1E8ZA 4HPLB 2FCSA 2N9XA 2WS3B 2MHJA 4GMVA 4OZCA 1B1ZA 4KZ0A 4IM0A 3U52E 2Z8LA 4US9A 3AECB 1PGAA 1V8CA 5E6JA 2IBIB 3LJ3A 2HE7A 1ENFA 3GE8C 2FCMA 1QKZA 1RWSA 2ASQA 1IYFA 3HHMA 4W9FA 2AQ2B 1Y56A 2WU5B 2L76A 1WGGA 3IAM1 1MHXA 3Q6BA 2MBEA 1T0YA 4HJGE 3DVNV 1FM0D 3GZNI 2G1EA 3ZLZA 2KTRA 4W9LA 5JHAA 5AZFA 4ZRIA 4Q2JA 3FC4A 4EUTA 3O13A 4K81A 2G9HD 2N7EA 4WJPA 2HJ1A 3Q8EA 2MA9B 2WDRB 1VZ8A 3HK0A 1IBXB 4FADA 3CSTA 2J7QB 4OHJA 2LI5A 2Y5BB 5IOIA 2E3TA 1L0YB 2I1JA 4PYUA 5BO4B 4IM3A 3DHHC 1H8CA 3Q2AC 4BOZB 1F1HA 2BTEA 3UIPB 5G55A 1TS2A 4YSZB 3L13A 2GBJA 4RM9A 4IWQA 2J0MA 5L95C 5HHDG 1EWYC 2EKEC 3PRZA 3KH0A 1L2NA 2LRWA 4LDTD 2IJ0A 2JUOA 4K3CA 4XC2A 2KACA 2ZEQA 1SSNA 1K52A 2WXJA 5LNK1 2MBHA 2GRIA 4B9KA 3NY5A 3KUDB 4ARIA 4F8CB 2JRIB 2ZW1A 5DPSA 5JHBA 3QX1A 2M4NA 3A33B 2PKOA 2H88B 2KMAA 2SEBD 2RDGA 2AEHA 1QQRA 2KYWA 1ACCA 1OGWA 3AEAB 1I35A 2XNAC 1LO5D 2RMMA 3X23A 1YMHE 3WAMA 3U8ZA 2KK8A 1RM6C 2HTME 4GLSC 1KLVA 4JWSC 1E0ZA 3NZSA 4WIPA 3ZDTA 2DZJA 3NVYA 2ZCCA 4JL9A 4P7IA 4AWJA 3ZKJC 3ZTCA 2LD9A 3NOBA 2X8XX 2XK5B 4BKSD 3LDZE 3R7RA 1QILA 1TT5B 1UGMA 3ZNGC 2KLCA 2B3AA 4WWMA 1F52A 4MGIE 4EFOA 4EZJA 3B2GA 1P1AA 1VZ7A 3K9PB 2WDVB 5CHVC 5KHOA 2RPVA 1FXAA 1PDXA 4FJYA 2M8SA 3P42A 1C79A 5HG2A 4PS7A 4BFRA 3EHVA 1B9RA 1J7BA 1KFYB 1TZOA 2UU7A 1XCQL 3GE3C 1WXVA 3Q3MC 5C23A 2DLBA 4B0MA 3PRMB 1F2RC 3QQ8B 2KDMA 4KGSA 4XWTA 1N60A 2LJ5A 1E8XA 5AZGA 3AE7B 1VJKA 3DQVA 3MC8A 1ROEA 3VHTC 4LNIA 1FNUA 3QC8B 2WX1A 4RF1A 4MM3B 3I9V1 4NAWB 2W82A 5BYSA 1WJNA 2IDYA 4MH8A 2ZVOA 3N32A 1J7CA 4P6VF 4DDID 1YJJA 2WXLA 3ETRA 2KFKA 4HEA1 4GN1A 1R4MI 4EE2A 3KQ4A 2BF8B 2FIDA 1N6ZA 2FE8A 2BGFA 3UIOB 3GS2A 2IY0B 5AEKB 2K22A 3W1SC 2NTTA 2SAKA 3SFEB 4A20A 4GIVA 1BT0A 1QOAA 2FCNA 3Q3NC 4KX6B 4J3OD 3TJPA 4A3PA 2LGYA 2OOBB 3RFZB 3RNEC 2CR5A 3EFUA 5KHQA 3WAOA 2KAJA 5IKCM 4ACFA 1BUIC 3SEBA 4H2AA 5CHFA 4YXDB 2M0AA 1VRAB 2N7JA 3ONSA 4HROA 4R3DA 3PREA 3UQAA 3AULA 3FAHA 2DZMA 2V9HA 1RAXA 1UGJA 2PTLA 1YQ4B 3A1QA 1WGDA 3AB5A 3DHGC 2I2YA 2INDC 3IT6B 2CJOA 5D3DA 1AYFA 1MPEA 3HM3A 4REZA 4ZRKA 2C7HA 1E7VA 1YN5A 2CU3A 2LRUA 4BKSA 1KTKA 1N61A 2GBKA 1ZP0B 1MVKA 3AEGB 2A5UA 3H8HA 3ML8A 3RD2A 3NVWA 1ZPSA 2KLGA 3I3TB 1VLBA 3ZVVA 2PLPA 3U7DA 1IGCA 3P63A 3R2IA 5TSSA 1M4VA 1CMXB 1OEYJ 3ZQ4A 3TMPB 4FJVB 3GB1A 3H9DA 2FCQA 1WX7A 1DOYA 2HJ8A 2KD0A 1QOBA 1S3SG 4NQKE 4NZLB 3T3OA 2DYBA 4P16A 4GU2A 1C78A 5I4DA 4A55A 2VZKB 2KWVB 3M62B 2PIAA 4K7SA 1GB4A 2BYTA 5JXVA 3V05A 3PT2B 3DBLB 3VVWB 1L4ZB 4ZYNA 1LQBA 1PQSA 1MI0A 3ZUNA 1TS4A 1WZ0A 4W9CA 2EMTA 1DOIA 1WFYA 3MJWA 5FR6A 3H7PA 3A9KA 1TZ1A 1L6VA 5D94A 2WWZA 4YT0B 4HVBA 3R3MA 2C60A 3N30A 3DDCB 2IO0B 5FR3A 1ET9A 3PS6A 4QAYA 1UF0A 2IO2B 2J4XA 2FIFA 2KT7A 4LTUA 3I57A 5C2TB 2D07B 3A4SC 3Q8BA 3AEFB 1FD6A 1LGRA 4ZRPA 1YOVB 3ZIMA 1XD3B 1Z2MA 4FN2A 4MSMB 1A70A 3D32A 2MJEA 1J8CA 4XE0A 2Y3AA 1MHHE 3T3NA 1WRIA 4MJSA 2KN5A 2K8CA 4FLHA 2KC1A 5D2MB 1YIWA 3C19A 3R2TA 3RN9C 2Y5CA 4FHJA 3CWIA 4LJPB 2DAJA 3ZNID 1WF9A 3DBRB 3PZ8A 4LCDE 3MFGA 2YEPF 3L0WB 2Z0EB 4LNOA 1XLQA 2QJLA 3B1LX 1P9DU 2CKHB 3AU4A 3R7QA 1P3QU 5BYQA 2UWQA 1GNUA 2BS3B 3QJZA 1JWMD 3SU8X 1YN4A 2MCNB 3BVZA 1JWBD 4BZAA 5FKAC 4ZDVA 1YQ3B 2WYQA 1FIQA 3BY4B 4MELA 3AM9A 4ANWA 2K6QA 5MPOA 1NYQA 2K25A 2KTRB 5T8IA 5DPRA 2LASA 3RYTA 2EKIA 3TSSA 3FILA 2K9XA 3B9JA 3ZGZA 1SEBD 1VZ6A 3S2AA 4MEMA 3JYUA 1HTQA 1JW9D 4JE3B 4BBNF 2IY1B 3Q8FA 3NUHB 2KTFA 2WXFA 2H89B 5EE0A 2ON8A 4BVUC 4ITKA 4NAMA 1WM3A 2I1KA 2M17A 2BYEA 5AUKA 2IO3B 1WXQA 4HXDA 4S17A 4RGOS 1NENB 1CQVA 1JRPA 4GXBA 1YD8U 3FKYA 2DAFA 2N1WA 3WALA 4K7UA 2MWSB 2BYVE 2J0KA 1K50A 5GXGB 2KKCA 2GMIC 4TQ1A 1WJ6A 1MG8A 3DVGX 2QEJC 2XN9C 1XLPA 4E74A 2RSUA 1K8RB 1E7UA 3AE8B 1JROA 3N9YC 3K9OB 1KH0A 3VDZA 4MGZE 3L10B 2QDFA 2DYOA 1XLOA 1WIAA 2JYEA 3R8BA 2MJDA 2D3CA 2JX5A 1SJHD 2MBOA 1XLNA 2N9KA 3VTVA 4IM2A 1TY2A 3Q8CA 2BPSA 4OVUA 3A9JA 3KLSX 4IKGA 2KFJA 2PW9A 1OTRB 4NQLB 1EF5A 3TL5A 4HRSA 2DBYA 3N20C 3QHTA 4BKTA 1WYWB 3V6EB 3JVZX 2D11A 1HA5A 4ZRQA 1ZXIA 4HKQA 4YSXB 2LHDA 3NHEB 4WWOA 1E10A 3VRBB 3QARA 3DBLI 1E8YA 1WJ4A 4M01A 2Q5WD 3BK1A 1UWXA 3QWZB 1HQRD 3AEBB 3VR8B 3BINA 2QILA 3SR6A 4C80A 1PYWD 1V5OA 1PUTA 4CO7A 3OLMD 2JQRB 1JWAD 2KJHB 3ZJUA 3AE4B 4WWNA 5HFYA 2KJRA 2AWTA 2O2VA 1C4AA 2V3PA 4LNKA 4JIOU 2NMQA 1HE8A 2GBRA 5EE9A 2M1MA 4CYEA 4IWOA 2RR9A 1SXTA 1WE6A 2MRPA 2LUMA 4I6LB 1NEKB 4DHZE 2LGDA 2WXMA 1WX8A 2WXPA 1FPYA 2INNE 2KFKB 2L0FA 4ANUA 1ZDXA 2MSED 1EM7A 2D3BA 4HDQA 2PVGC 2J52A 2L0TA 4TKNA 4HPMB 3N1ZC 1F2RI 1IP9A 1YX5B 1ZW7A 3DHIC 4M0WA 4MSQB 2ZVNA 3ML9A 2R2OA 5BYRA 4N6EB 2PVOD 1A5RA 4YTNB 2GOWA 4LDTB 2WXQA 3DBRI 4HCPB 4JX1C 4DXFA 1JRUA 4MH0E 1BXTA 3AXCA 1DGJA 2K0PA 3NS8A 2AQ1B 4ICVA 3QK0A 1C76A 2LWPA 3ZRFA 1V80A 1AN8A 1TKYA 4KZCA 3VXWA 3T8MA 1YQBA 4HPPA 4PK1A 3A1QB 2N0SB 2NVUI 1FFUA 4MT5A 1SB3C 3OAWA 4YSYB 1T0SC 1WYGA 2INPE 1C3TA 4AJWA 2LXAA 2EELA 2ACZB 2WXGA 2WQYB 1C4CA 1SE9A 2Z0DB 2MBQA 2D10A 5E6NA 1KF6B 3B08A 1RLFA 2HDEA 4E71A 1FO4A 3KYCD 5HKHA 2PE6B 3N1XC 3EUB2 4AJYB 4RF0A 1C9FA 2BYFA 4KVGB 1I4GA 2D3AA 2WU2B 3JSVA 3DBSA 1YJ1A 5LXHA 2N7DA 3RULA 3BYYB 3EFCA 4KGRA 3AU5A 5D6JB 3V62A 5DPWA 3KWLA 2D2QA 3AEEB 3EA6A 1S1QB 4N9F4 2JXTA 4FA6A 1Q10A 2JSVX 4WJQA 3L16A 2QC8A 1NVID 2RDHA 2G4SA 1GOZA 2KN4A 4DHJD 1Y8RC 5C1ZA 3PV1A 3H7PB 3A9KB 2WX0A 2WXOA 3ZXVA 1U4AA 1UUPA 1WE7A 3C8YA 1OEYA 3P4RB 3C0RB 3IAS1 3H1UA 3NS1A 4HDOA 1IUEA 4DXGA 2O6VD 3MHSD 3TCAA 2ZPNA 1V5TA 3HVDA 4C4VA 4II3B 2NS5A 1I42A 2BWFA 4EZKA 2KHWB 2VH2A 2BQQA 4YTMB 3CMMB 3QIJA 3TEXA 3NVZA 3AN1A 4EKUA 1V2YA 1JWUD 2HTHA 2XK5A 1KRHA 1QOFA 2V4LA 1D3ZA 4MJSB 3ZTDA 3V60A 1AW7A 4DBGA 1HTOA 4KSKC 2L1AA 4I6NB 5H8YE 2UYZB 3LXFA 3TEYA 2KWUB 4BAXA 4TSSA 2LFIA 4TQ0A 2GI9A 3DWGC 3VH4B 4IWPA 2L3ZA 1FCCC 2FBWB 5DPTA 1FRDA 1K53A 2JVCA 3Q14C 1FXIA 4AUQC 1TIFA 4KV2A 4LJOB 2EMSA 3VTUA 5G2NA 1V81A 2JZ3B 2WHIA 5IP4D 1IGDA 4WQOB 2ZJDA 2CHXA 2Y5PA 3ZDMC 1Z5SB 1P98A 2LXCA 4W9HA 4IOIE 1RYJA 5J2RA 1E7PB 1VD2A 2BVCA 3RNGC 3VTWA 4AOFA 2KWDA 4HWIB 1FXTB 4RCOA 3FILB 5IAAC 4XZ4A 2KDBA 3R66C 2RD0A 2AL3A 3RI7C 3H7SA 2NTSA 2OEDA 3CSFA 2W3SA 4FBJB 1F0ZA 1WXAA 4EEWA 3P4QB 3ZJTA 4L1BA 3BK2A 1NI2A 1E9MA 4TUUA 2WXIA 1GC7A 4NY0A 1OQQA 4ZHOA 1KJTA 3IG3A 1E8WA 1WGRA 5DCNA 2JY6A 2WDQB 4G0NB 1WXMA 2QMTA 2JRHA 3APFA 3W9CB 4XGAB 1TTNA 2MBBB 1T6BX 4J6IA 2GBNA 3VRAB 2IGDA 1P7FA 4G11A 2K3UA 1L6UA 1I4XA 1V1OA 2BS4B 4W9DA 3PHXB 3AE1B 5EE3A 5IN7A 3OWEB 4GGQA 4FJZA 3MHZA 4ZOHC 1MFWA 1WY8A 3RNCC 4K3BA 1FMAD 2AQ3B 3ABVB 1F77A 1ESFA 4HLEA 1ZUD2 1TJEA 3IVFA 4YTPB 1D5MC 4OZBA 2O6VA 2KMCA 4G50A 4WH4A 1J7AA 2LZ6A 2A4ZA 2R61A 2GB1A 3A9JB 5GMVA 2RPQA 1GUAB 3AV8A 4WQMA 1V1PA 2D5GA 3X0WA 2LGIA 1VCBA 2IGHA 2V4IB 1CZPA 2WDTB 4OVZA 3SFDB 4EZLA 2WXRA 4M02A 1R4NB 2C9WB 2QHOA 3BVMA 2IGGA 3TIXA 2N9PC 4F1SA 1L4DB 2C5LC 2OJWA 4I6PA 1TKEA 1VDVA 3L17A 4DWFA 3APDA 4XWWA 3U7ZA 2BKRB 3PVLA 3OJ4B 1OQYA 2C7MB 1T0QC 3DCGA 1TGZB 4US8A 3AE3B 3V3XA 4C56C 1QT9A 4RGTA 3L54A 3PZDA 4OZAA 2LGSA 2IYDB 2KO3A 3CIRB 4A90A 4C7ZA 3MP9A 2O2VB 4LNFA 2NBWB 2JWUA 3MC9A 2KVZA 1QOGA 2J53A 1R7SA 4FULA 1RFAA 4L2YA 4ZYSA 3BZDB 5CHWA 1C4PA 2K1FA 1GB1A 4KIKA 2DZIA 3Q3OC 2QSDA 1WMHA 5G5GA 3BYTB 4DHZB 5CTRC 4XDCA 1FEHA 1YJIA 3E9SA 4GB9A 2K8HA 2BKFA 4RM8A 2L7RA 4KDLB 3AH7A 1TY0A 2DZKA 3BWUD 1WM2A 4USAA 2N9EB 1Q5WB 3AE2B 3WIMA 3ZNHB 4JWUC 3DPDA 4M0WB 3GOEA 1C77A 2K5PA 4IUMB 4G3XB 3AI5A 2JU6X 3APCA 2KVRA 4ANVA 1LFDA 1WH3A 1JQ4A 2OJRA 2Z59B 2ONQA 1VR9A 4LNNA 4HKZE 4W9JA 2KDEB 1K51A 2B76B 3N1YC 2OHFA 3U30A 3EGRA 2ZZPB 2KX3A 3M63B 2WXNA 4YL8A 1D4BA 2JWZA 2XEWA 2JF5A 3NZ3A 2LEKA 2PEAA 4AQ7A 2V0GA 4LK0M 4BBNC 4S0RA 4GDLA 2GBMA 5EE1A 4ICUA 4MACA 1WGYA 3I63C 3NZUA 3Q8AA 3N3KB 2ZW0A 1SJED 1I4HA 2R2QA 2LJIA 1E6EB 3HUIA 3TEWA 2D3GA 2BBCA 2JT4B 3VR9B 4ANXA 2W55A 2NPTA 3IBEA 4ZRJA 2KZRA 2L52A 2WLBA 5TR5A 2N1VA 3U4EG 1GPXA 2AYOB 3W1SA 2X38A 3DWMA 3PHWB 4KKIA 5AZHA 1UD7A 3DVNU 1JWSD 4K1RB 4KGTA 4L23A 3JSVB 4O1NA 4N59A 4RFBA 4RGNA 1D6EC 3O65B 4XDDA 1YN3A 4OW0A 1SBBB 1HXYD 3MTNB 3KUZA 1SGHA 3L4PA 2LHEA 3LYYA 3ZRCA 4W9GA 5FK9C 2K8BA 1MG4A 4JLCA 1N62A 3TEZA 4DK5A 1PGBA 2RGFA 1GJZA 2IO1B 4HJKA 4XYCA 1HZ5A 4PYZA 2M56B 3P4SB 4GDKA 5LLIA 3Q69A 3NJTA 1RRBA 1RFKA 2CHWA 3SD5A 4HCNB 1Q0WB 2KX0A 1R4NI 2MH7A 3VH3B 4ZHPA 1Q1OA 2FUG1 5D7GA 3ZXRA 1V6EA 2V1YA 2C7NB 2I38A 2W3RA 2MP2A 2YVCA 1IPGA 4C00A 1DYQA 1ZKHA 1UH6A 1WGKA 1EWCA 3P1MA 4A9AA 4NJ6A 4C4VB 1UBQA 1EU4A 3NVVA 2BT6A 3RT3B 2G3QB 2KQ7A 2WXHA 3P2BA 2K6DB 4PS3A 2ICIA 3NG0A 3RNFC 1TS3A 4WAAA 3PO0A 2PPHA 2KC2A 1CK1A 3AE6B 5IO9A 2ZPYA 4UDUC 5EDSA 4TMAB 3HVZA 1FNVA 5D3IB 3TUOA 3HIZA 1XF5L 1HZ6A 1ISNA 1L7YA 1V9JA 4RH6A 2LVPA 1FNWA 3HRDD 3WANA 3TBLD 2ZNVC 1XCTL 2JYTA 1IBXA 4B6WA 3QAQA 3ENEA 3PPAA 2IPKD 2LMCA 3ZW3A 2DNFA 1F9JA 4DDGD 1XEEA 1OQRA 3VUYA 2AX5A 1GAQB 2QIEB 3KYDD 5CX3A 2K39A 1ZXHA 3KUCB 4AS1A 1I7HA 3AE5B 2YEPB 2DWQA 4MGKE 2REXA 3ZYYX 1N5WA 1ZE3D 3UGBB 3KVFB 1EF1A 1WX9A 2LGXA 4W9IA 4PT5A 3SDLC 2KDFB 3L08A 3B0AA 3IXSA 3KWVA 1OFFA 2NCNA 2AL6A 3AEDB 1GG3A 1MJDA 4A8XC 3V61A 2M19A 1UWMA 4E3CA 4F7ZA 4N58A 3I5JC 1BMLC 4KKJA 3H6NA 2GLSA 3RUIB 5J17A 5BMGA 2JPHA 3Q3FA 1I4QA 1L5PA 1T3QA 3J9CA 4B95A 1WGHA 3VFKA 1PGXA 3U2SC 1WI0A 5E6PA 4XX5A 3ZO5B 3JW0X 5L83A 1ZDVA 4DHJB 2E6XA 1D5ZC 2KOXA 2ZCBA 3PRPB 4WJOA 2DYMA 1QZEA 4IDIA 2MJ3A 5JZEB 3PGEA 1YX6B 5LXIB 1DOXA 4WWPA 2O6VB 2BW2A 2BB5A 2MQJA 2LVOA 4PS8A 3W2DA 1LXDA 3DBHB 3B2FA 5JH5C 3E56A 1WZ3A 1V1PB 2CS4A 2MLBA 3RPFC 3RNBC 4MDKE 4RNAA 1JCKB 2CU1A 2L8JA 1V86A 4IG7B 2CJNA 1WR6E 4K7WA 3M95A 3UF8A 2JXXA 3DVGY 1G6JA 2PJHA 1EU3A 2KJ6A 3DOWA 2NBUA 4NJ7A 2DHZA
chains in the Genus database with same CATH topology
1UWXA 2DLBA 3AE3B 3V3XA 4C56C 1QT9A 4RGTA 4B0MA 3MC0B 1F2RC 1HQRD 2L32A 3AEBB 3VR8B 2KDMA 4OZAA 4KGSA 2VZKD 4XWTA 3IT4B 1N60A 5H92C 2QILA 3SR6A 4C80A 1PYWD 4JPSA 3AE7B 1VJKA 3WCQA 1PUTA 1ROEA 3W5VB 3AMZA 3P4PB 2JQRB 1FNUA 1JWAD 3ZJUA 3AE4B 5HFYA 4RF1A 4MM3B 3I9V1 1C4AA 4NAWB 2W82A 2V3PA 1PFDA 3CIRB 4A6QA 2NMQA 5BYSA 4A90A 5EE9A 4C7ZA 2IDYA 4MH8A 1YNTE 3MP9A 1J7CA 4P6VF 2JWUA 1SE2A 1QOGA 2J53A 1SXTA 1R7SA 2LUMA 1NEKB 1YJJA 2WXLA 2WP9B 3ETRA 2BS2B 1XO3A 4HEA1 4L2YA 4ZYSA 3BZDB 2WXMA 4EE2A 1C4PA 1L0XB 1GB1A 2W54A 3KQ4A 1FRRA 4C7YA 2WXPA 2QSDA 2J42A 2FE8A 2INNE 5G5GA 3BYTB 3URYA 1SIJA 4XDCA 1FEHA 1YJIA 1HEZE 3E9SA 1ZDXA 1QF6A 3GS2A 1EM7A 1AWDA 2JZPA 2PVGC 2J52A 1D5XC 3AH7A 1TY0A 1F2RI 1NYRA 1TKGA 2K22A 3BWUD 4M0WA 2WXKA 2NTTA 2SAKA 1TS5A 3SFEB 4USAA 5G5HA 1QOAA 3AE2B 4KX6B 4J3OD 5BYRA 1N63A 4JWUC 1L0VB 4N6EB 2PVOD 3RFZB 2KQ4X 4YTNB 1C77A 2K5PA 2WXQA 2JU6X 2KAJA 1BUIC 3SEBA 4H2AA 4JX1C 4DXFA 4YXDB 2M0AA 1VRAB 2N7JA 4HROA 1BXTA 4R3DA 1DGJA 2V3NA 1JQ4A 2K0PA 2AQ1B 3FAHA 2ONQA 1VR9A 4HKZE 1UGJA 1C76A 2PTLA 1YQ4B 1AN8A 1TKYA 1K51A 2B76B 4NJCA 2OHFA 3AB5A 2I2YA 3EGRA 1P7EA 2CJOA 2WXNA 3IT6B 5D3DA 1UNSA 3UI3A 1D4BA 1AYFA 2N0SB 3NZ3A 3GP7A 1FFUA 2LEKA 1MPEA 4AQ7A 2V0GA 4LK0M 4MT5A 4REZA 1SB3C 1YN5A 1KLGD 2CU3A 5EE1A 1NI3A 3NRZA 1KTKA 4YSYB 1N61A 1SE3A 1WYGA 2INPE 4MACA 1ZP0B 1MVKA 4GDLB 2KMMA 2EELA 2ACZB 3AEGB 2WXGA 1JMLA 2WQYB 3Q8AA 3H8HA 1C4CA 1I4RA 3BIID 2ZW0A 1SJED 1I4HA 3NVWA 1ZPSA 1KF6B 2LJIA 1CJEA 1E6EB 3HUIA 3TEWA 1VLBA 2PLPA 1IGCA 2BBCA 3P63A 2HDEA 3VR9B 1FO4A 3R2IA 3LB8C 2W55A 5TSSA 1M4VA 2L52A 1WSPA 3ZQ4A 2WLBA 4WAFA 1I4PA 2MEKA 1SF0A 1FCLA 3EUB2 3U4EG 3GB1A 3AE9B 1GPXA 1TYGB 2L83A 4RF0A 1C9FA 3W1SA 2X38A 3DWMA 1I4GA 4CQNA 1DOYA 2PMVA 4ARCA 2WU2B 1QOBA 4KKIA 4NZLB 3BYYB 4KGRA 3T3OA 1JWSD 4KGTA 4P16A 3KWLA 4L23A 1C78A 3AEEB 3EA6A 5I4DA 4O1NA 4N59A 4RFBA 2JXTA 1N5XA 4A55A 5BMIA 1Q10A 2BB6A 2VZKB 4RGNA 1SE4A 2PIAA 1GB4A 1D6EC 2BYTA 5JXVA 3V05A 4XDDA 3ZJVA 2N9LA 1YN3A 4OW0A 2JSVX 1SBBB 1HXYD 1L4ZB 4LLGM 3L4PA 3VQIA 3PZ7A 1MI0A 4D2KA 1JALA 1STEA 2LHEA 3LYYA 4WURA 1TS4A 5FK9C 1N62A 1DOIA 3TEZA 5C3JB 1PGBA 1NVID 3MJ5A 2RDHA 1GOZA 4RGMA 1HZ5A 1L6VA 2KN4A 4DQOC 1V97A 4YT0B 2M56B 3P4SB 3W5UB 3Q69A 1FFVA 2WXOA 5FR3A 1RFKA 1KLUD 5AUIA 1ET9A 4GDKB 1UUPA 3C8YA 4YWGG 3P4RB 2MH7A 2J4XA 4FXCA 3IAS1 4B0EA 3NS1A 4ZHPA 2FUG1 1IUEA 4DXGA 5D7GA 2WNMA 5BMHA 4LTUA 1QLBB 3I57A 5C2TB 3R8BA 5HI1A 3Q8BA 1XXGA 3AEFB 2TSSA 1FD6A 1ET6A 4ZRPA 2I38A 2W3RA 3HVDA 1ZOYB 1A70A 1DYQA 3BVGA 1WGKA 1T5XD 2MJEA 4YTMB 4XE0A 1WWTA 2Y3AA 1EWCA 3P1MA 1MHHE 4A9AA 3T3NA 3TEXA 1WRIA 1EU4A 3NVZA 3AN1A 3NVVA 2BT6A 1JWUD 1KRHA 1QOFA 2WS3B 2WXHA 4OZCA 1B1ZA 3R2TA 2ICIA 1AW7A 1TS3A 2Y5CA 3PO0A 2L1AA 3U52E 2Z8LA 4US9A 3AE6B 1CK1A 3AECB 3CWIA 1PGAA 1V8CA 5E6JA 5H8YE 3LXFA 3PZ8A 3TEYA 3MFGA 1ENFA 2YEPF 4UDUC 4TSSA 1XLQA 2QJLA 4TMAB 2LFIA 4TQ0A 2GI9A 3DWGC 3HVZA 1FNVA 5D3IB 1QKZA 3TUOA 1RWSA 5BYQA 1FCCC 2FBWB 1FRDA 2BS3B 1K53A 2AQ2B 1FXIA 1XF5L 1Y56A 1JWMD 2WU5B 1HZ6A 3IAM1 1MHXA 1YN4A 4HJGE 4RH6A 1FM0D 3BVZA 1JWBD 2G1EA 5FKAC 1IGDA 1FNWA 3HRDD 1XCTL 2JYTA 3FC4A 4Q2JA 1IBXA 1YQ3B 2Y5PA 3O13A 1FIQA 2IPKD 2G9HD 3AM9A 2LMCA 3Q8EA 1NYQA 5T8IA 5MPOA 2WDRB 1VZ8A 1OQRA 1XEEA 2EKIA 1IBXB 3TSSA 3FILA 4IOIE 1RYJA 2K9XA 3B9JA 1E7PB 1SEBD 3ZGZA 4OHJA 1VZ6A 2AX5A 1GAQB 2QIEB 1JW9D 2KWDA 4JE3B 3Q8FA 4RCOA 3FILB 3NUHB 2WXFA 2H89B 2E3TA 1L0YB 1ZXHA 5EE0A 2ON8A 4AS1A 1I7HA 3AE5B 4ITKA 2YEPB 4NAMA 2DWQA 3ZYYX 2NTSA 1N5WA 1ZE3D 2OEDA 5AUKA 2BTEA 2W3SA 1WXQA 1F0ZA 4PT5A 1TS2A 4YSZB 3P4QB 4RGOS 1NENB 1CQVA 1JRPA 3ZJTA 3IXSA 3KWVA 1OFFA 4L1BA 3BK2A 3AEDB 5HHDG 1EWYC 1E9MA 4A8XC 2WXIA 2M19A 1UWMA 4N58A 1K50A 1BMLC 5GXGB 4KKJA 1OQQA 4ZHOA 5BMGA 2IJ0A 2WDQB 2QMTA 4TQ1A 2KACA 1SSNA 1K52A 1I4QA 2QEJC 1L5PA 2XN9C 1XLPA 2WXJA 3W9CB 1T3QA 3J9CA 5LNK1 3AE8B 2GRIA 1JROA 1T6BX 1PGXA 3N9YC 3U2SC 1KH0A 4ARIA 2ZW1A 3VRAB 2IGDA 1P7FA 2DYOA 2K3UA 1XLOA 2JYEA 1L6UA 1ZDVA 1I4XA 1V1OA 2H88B 2MJDA 2BS4B 2PKOA 2RDGA 2SEBD 2E6XA 3AE1B 5EE3A 3OWEB 1D5ZC 2JX5A 3MHZA 1QQRA 1ACCA 1SJHD 4ZOHC 3AEAB 1XLNA 2XNAC 1FMAD 2N9KA 1LO5D 2AQ3B 3ABVB 1F77A 1ESFA 2RMMA 1ZUD2 1TJEA 1YMHE 2DYMA 4YTPB 1TY2A 1D5MC 4OZBA 1RM6C 2HTME 4GLSC 4IDIA 2MJ3A 4JWSC 3Q8CA 1E0ZA 4WIPA 1DOXA 3NVYA 4WH4A 1J7AA 3KLSX 2BW2A 4IKGA 2R61A 2GB1A 2BB5A 2PW9A 3AV8A 4WQMA 1V1PA 2D5GA 1QILA 3W2DA 2LGIA 4WWMA 2IGHA 2V4IB 4HRSA 1CZPA 4OVZA 2DBYA 3SFDB 3B2FA 2WXRA 3B2GA 3E56A 1V1PB 3BVMA 2IGGA 3RPFC 1VZ7A 4RNAA 1HA5A 1JCKB 2WDVB 4ZRQA 1L4DB 1ZXIA 2CJNA 4HKQA 2RPVA 1FXAA 1PDXA 1TKEA 1VDVA 3P42A 1C79A 4YSXB 5HG2A 2LHDA 1EU3A 4XWWA 3U7ZA 1E10A 3VRBB 1B9RA 1J7BA 1KFYB 2Q5WD 1TZOA 1XCQL 3BK1A 4US8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWX A;  3V3X A;  1MPE A;  5BMH A;  1F2R C;  5HHD G;  2KDM A;  4OZA A;  4KGS A;  5HI1 A;  1FD6 A;  1K50 A;  2I38 A;  4MAC A;  1MVK A;  2EEL A;  1JML A;  5BMG A;  2QMT A;  5HFY A;  1MHH E;  2KAC A;  2ZW0 A;  1K52 A;  2NMQ A;  1YNT E;  2PLP A;  3MP9 A;  1IGC A;  1PGX A;  2JWU A;  1KH0 A;  4OZC A;  2ZW1 A;  2J53 A;  2LUM A;  2IGD A;  1P7F A;  1PGA A;  1FCL A;  1GB1 A;  3GB1 A;  2QSD A;  1C9F A;  2N9K A;  2GI9 A;  2RMM A;  1YMH E;  1HEZ E;  1QKZ A;  4OZB A;  1FCC C;  4GLS C;  1EM7 A;  4KGR A;  1K53 A;  2JZP A;  2J52 A;  4KGT A;  1XF5 L;  4WH4 A;  1F2R I;  1HZ6 A;  1MHX A;  4IKG A;  2GB1 A;  2JXT A;  4HJG E;  5BMI A;  1Q10 A;  1GB4 A;  2PW9 A;  1IGD A;  5JXV A;  1XCT L;  2KQ4 X;  2N9L A;  1IBX A;  2LGI A;  2JSV X;  2IGH A;  2JU6 X;  1MI0 A;  1IBX B;  2IGG A;  4D2K A;  3FIL A;  2LHE A;  4IOI E;  2N7J A;  2KWD A;  1PGB A;  2K0P A;  2RPV A;  3FIL B;  1D4B A;  2ONQ A;  1HZ5 A;  4HKZ E;  1ZXH A;  2KN4 A;  2ON8 A;  2PTL A;  5HG2 A;  2LHD A;  1K51 A;  2I2Y A;  2OED A;  1P7E A;  1XCQ L;  3UI3 A; 
#chains in the Genus database with same CATH topology
 3UIN B;  3UQB A;  3T9L A;  1P0R A;  3MC0 B;  3WAP A;  1LM8 B;  2L32 A;  4AP4 C;  2VZK D;  3IT4 B;  5H92 C;  4HK2 A;  3RNA C;  4DXA B;  1NDD A;  4MM3 A;  4JPS A;  4NAW A;  1EO6 A;  3WCQ A;  4BOS C;  2DX5 B;  3PLV A;  3W5V B;  3AMZ A;  3P4P B;  2W9N A;  2PE9 A;  1X1M A;  4W9K A;  1PFD A;  4A6Q A;  1YNT E;  2MW5 A;  1C1Y B;  1T0R C;  3WA0 A;  1SE2 A;  3GZN B;  5J18 A;  5IA7 A;  4BKG A;  4EOY A;  2VH1 A;  2WP9 B;  2BS2 B;  1XO3 A;  2MX2 A;  2YLM A;  1L0X B;  2G4D B;  2W54 A;  1FRR A;  4C7Y A;  2J42 A;  2LUE A;  3Q3J A;  2FAZ A;  3URY A;  2RDB C;  1SIJ A;  2N4F A;  1QF6 A;  1HEZ E;  4IW0 A;  2L00 B;  4KIK B;  3W1Y A;  1WMH B;  1AWD A;  2JZP A;  3CF6 E;  1M94 A;  3QA8 A;  1D5X C;  1NYR A;  1TKG A;  2HD5 B;  4NNJ B;  1WRD B;  2WXK A;  1TS5 A;  5G5H A;  2KXJ A;  1N63 A;  3ALB A;  1UBI A;  1L0V B;  3HM6 X;  2KQ4 X;  2XBB C;  2IZV B;  3VUW A;  3PLU A;  1KM7 A;  1V49 A;  3M3J A;  4M8M A;  3IHP C;  4WJN A;  3VAW A;  4OVV A;  2V3N A;  3QCA A;  1WXS A;  3EC8 A;  4IC7 B;  2ZNV B;  2FUH B;  2KNB A;  4NJC A;  2V3S A;  2BWE S;  2KWC A;  1J0G A;  2KQS A;  3OG5 A;  1UZX B;  3OJ3 A;  3VUX A;  1P7E A;  2VRR B;  4URK A;  3KW5 B;  1UNS A;  3UI3 A;  3GP7 A;  3IFW B;  2L05 A;  3ZNZ B;  4ASW C;  4II2 B;  1KLG D;  2NR2 A;  1NI3 A;  2KDI A;  3NRZ A;  1SE3 A;  4M00 A;  4M8N A;  4GDL B;  2KMM A;  1JML A;  1I4R A;  3BII D;  1H4R A;  4JQW C;  4P1C C;  4GOC A;  1CJE A;  2DEN B;  1AAR A;  1XT9 B;  3LB8 C;  4JGH B;  4FHK A;  1WSP A;  4MGY E;  3PSE B;  4WAF A;  1I4P A;  2MEK A;  1SF0 A;  2NPT B;  2M0X A;  1FCL A;  3AE9 B;  1TYG B;  2L83 A;  1UEL A;  1NBF C;  4CQN A;  1TBE A;  2PMV A;  4ARC A;  3SHQ A;  4RMA A;  2NBV B;  2FNJ B;  1E5W A;  2LVQ A;  3RZF A;  1N5X A;  5BMI A;  2BB6 A;  1SIF A;  1SE4 A;  3PTF C;  4W9E A;  3ZJV A;  3ECI A;  2N9L A;  4KDI C;  3A4R A;  4LLG M;  4P1B C;  1E90 A;  3VQI A;  3PZ7 A;  4TV3 A;  4D2K A;  1JAL A;  1STE A;  1WR1 A;  4NPN A;  4WUR A;  3RMK C;  2JZZ A;  4CHK A;  3V6C B;  1XQQ A;  5C3J B;  1WJU A;  3MJ5 A;  5E6O A;  4RGM A;  4DQO C;  1V97 A;  1J19 A;  2G45 B;  3W5U B;  1FFV A;  2KAN A;  2WGS A;  1KLU D;  5AUI A;  4X57 B;  4GDK B;  3RZW C;  1GC6 A;  3DBH I;  4YWG G;  2INC C;  4FXC A;  1ZGU B;  4B0E A;  2WNM A;  5BMH A;  1QLB B;  2J0J A;  2CHZ A;  5HI1 A;  1XXG A;  4KSL C;  2TSS A;  1ET6 A;  1R4M B;  4GSW A;  1ZOY B;  1KOT A;  3BVG A;  1EUV B;  1T5X D;  3EEC A;  3RCZ A;  4A3O A;  1WWT A;  2QCZ A;  2MP2 B;  1E8Z A;  4HPL B;  2FCS A;  2N9X A;  2WS3 B;  2MHJ A;  4GMV A;  4OZC A;  1B1Z A;  4KZ0 A;  4IM0 A;  3U52 E;  2Z8L A;  4US9 A;  3AEC B;  1PGA A;  1V8C A;  5E6J A;  2IBI B;  3LJ3 A;  2HE7 A;  1ENF A;  3GE8 C;  2FCM A;  1QKZ A;  1RWS A;  2ASQ A;  1IYF A;  3HHM A;  4W9F A;  2AQ2 B;  1Y56 A;  2WU5 B;  2L76 A;  1WGG A;  3IAM 1;  1MHX A;  3Q6B A;  2MBE A;  1T0Y A;  4HJG E;  3DVN V;  1FM0 D;  3GZN I;  2G1E A;  3ZLZ A;  2KTR A;  4W9L A;  5JHA A;  5AZF A;  4ZRI A;  4Q2J A;  3FC4 A;  4EUT A;  3O13 A;  4K81 A;  2G9H D;  2N7E A;  4WJP A;  2HJ1 A;  3Q8E A;  2MA9 B;  2WDR B;  1VZ8 A;  3HK0 A;  1IBX B;  4FAD A;  3CST A;  2J7Q B;  4OHJ A;  2LI5 A;  2Y5B B;  5IOI A;  2E3T A;  1L0Y B;  2I1J A;  4PYU A;  5BO4 B;  4IM3 A;  3DHH C;  1H8C A;  3Q2A C;  4BOZ B;  1F1H A;  2BTE A;  3UIP B;  5G55 A;  1TS2 A;  4YSZ B;  3L13 A;  2GBJ A;  4RM9 A;  4IWQ A;  2J0M A;  5L95 C;  5HHD G;  1EWY C;  2EKE C;  3PRZ A;  3KH0 A;  1L2N A;  2LRW A;  4LDT D;  2IJ0 A;  2JUO A;  4K3C A;  4XC2 A;  2KAC A;  2ZEQ A;  1SSN A;  1K52 A;  2WXJ A;  5LNK 1;  2MBH A;  2GRI A;  4B9K A;  3NY5 A;  3KUD B;  4ARI A;  4F8C B;  2JRI B;  2ZW1 A;  5DPS A;  5JHB A;  3QX1 A;  2M4N A;  3A33 B;  2PKO A;  2H88 B;  2KMA A;  2SEB D;  2RDG A;  2AEH A;  1QQR A;  2KYW A;  1ACC A;  1OGW A;  3AEA B;  1I35 A;  2XNA C;  1LO5 D;  2RMM A;  3X23 A;  1YMH E;  3WAM A;  3U8Z A;  2KK8 A;  1RM6 C;  2HTM E;  4GLS C;  1KLV A;  4JWS C;  1E0Z A;  3NZS A;  4WIP A;  3ZDT A;  2DZJ A;  3NVY A;  2ZCC A;  4JL9 A;  4P7I A;  4AWJ A;  3ZKJ C;  3ZTC A;  2LD9 A;  3NOB A;  2X8X X;  2XK5 B;  4BKS D;  3LDZ E;  3R7R A;  1QIL A;  1TT5 B;  1UGM A;  3ZNG C;  2KLC A;  2B3A A;  4WWM A;  1F52 A;  4MGI E;  4EFO A;  4EZJ A;  3B2G A;  1P1A A;  1VZ7 A;  3K9P B;  2WDV B;  5CHV C;  5KHO A;  2RPV A;  1FXA A;  1PDX A;  4FJY A;  2M8S A;  3P42 A;  1C79 A;  5HG2 A;  4PS7 A;  4BFR A;  3EHV A;  1B9R A;  1J7B A;  1KFY B;  1TZO A;  2UU7 A;  1XCQ L;  3GE3 C;  1WXV A;  3Q3M C;  5C23 A;  2DLB A;  4B0M A;  3PRM B;  1F2R C;  3QQ8 B;  2KDM A;  4KGS A;  4XWT A;  1N60 A;  2LJ5 A;  1E8X A;  5AZG A;  3AE7 B;  1VJK A;  3DQV A;  3MC8 A;  1ROE A;  3VHT C;  4LNI A;  1FNU A;  3QC8 B;  2WX1 A;  4RF1 A;  4MM3 B;  3I9V 1;  4NAW B;  2W82 A;  5BYS A;  1WJN A;  2IDY A;  4MH8 A;  2ZVO A;  3N32 A;  1J7C A;  4P6V F;  4DDI D;  1YJJ A;  2WXL A;  3ETR A;  2KFK A;  4HEA 1;  4GN1 A;  1R4M I;  4EE2 A;  3KQ4 A;  2BF8 B;  2FID A;  1N6Z A;  2FE8 A;  2BGF A;  3UIO B;  3GS2 A;  2IY0 B;  5AEK B;  2K22 A;  3W1S C;  2NTT A;  2SAK A;  3SFE B;  4A20 A;  4GIV A;  1BT0 A;  1QOA A;  2FCN A;  3Q3N C;  4KX6 B;  4J3O D;  3TJP A;  4A3P A;  2LGY A;  2OOB B;  3RFZ B;  3RNE C;  2CR5 A;  3EFU A;  5KHQ A;  3WAO A;  2KAJ A;  5IKC M;  4ACF A;  1BUI C;  3SEB A;  4H2A A;  5CHF A;  4YXD B;  2M0A A;  1VRA B;  2N7J A;  3ONS A;  4HRO A;  4R3D A;  3PRE A;  3UQA A;  3AUL A;  3FAH A;  2DZM A;  2V9H A;  1RAX A;  1UGJ A;  2PTL A;  1YQ4 B;  3A1Q A;  1WGD A;  3AB5 A;  3DHG C;  2I2Y A;  2IND C;  3IT6 B;  2CJO A;  5D3D A;  1AYF A;  1MPE A;  3HM3 A;  4REZ A;  4ZRK A;  2C7H A;  1E7V A;  1YN5 A;  2CU3 A;  2LRU A;  4BKS A;  1KTK A;  1N61 A;  2GBK A;  1ZP0 B;  1MVK A;  3AEG B;  2A5U A;  3H8H A;  3ML8 A;  3RD2 A;  3NVW A;  1ZPS A;  2KLG A;  3I3T B;  1VLB A;  3ZVV A;  2PLP A;  3U7D A;  1IGC A;  3P63 A;  3R2I A;  5TSS A;  1M4V A;  1CMX B;  1OEY J;  3ZQ4 A;  3TMP B;  4FJV B;  3GB1 A;  3H9D A;  2FCQ A;  1WX7 A;  1DOY A;  2HJ8 A;  2KD0 A;  1QOB A;  1S3S G;  4NQK E;  4NZL B;  3T3O A;  2DYB A;  4P16 A;  4GU2 A;  1C78 A;  5I4D A;  4A55 A;  2VZK B;  2KWV B;  3M62 B;  2PIA A;  4K7S A;  1GB4 A;  2BYT A;  5JXV A;  3V05 A;  3PT2 B;  3DBL B;  3VVW B;  1L4Z B;  4ZYN A;  1LQB A;  1PQS A;  1MI0 A;  3ZUN A;  1TS4 A;  1WZ0 A;  4W9C A;  2EMT A;  1DOI A;  1WFY A;  3MJW A;  5FR6 A;  3H7P A;  3A9K A;  1TZ1 A;  1L6V A;  5D94 A;  2WWZ A;  4YT0 B;  4HVB A;  3R3M A;  2C60 A;  3N30 A;  3DDC B;  2IO0 B;  5FR3 A;  1ET9 A;  3PS6 A;  4QAY A;  1UF0 A;  2IO2 B;  2J4X A;  2FIF A;  2KT7 A;  4LTU A;  3I57 A;  5C2T B;  2D07 B;  3A4S C;  3Q8B A;  3AEF B;  1FD6 A;  1LGR A;  4ZRP A;  1YOV B;  3ZIM A;  1XD3 B;  1Z2M A;  4FN2 A;  4MSM B;  1A70 A;  3D32 A;  2MJE A;  1J8C A;  4XE0 A;  2Y3A A;  1MHH E;  3T3N A;  1WRI A;  4MJS A;  2KN5 A;  2K8C A;  4FLH A;  2KC1 A;  5D2M B;  1YIW A;  3C19 A;  3R2T A;  3RN9 C;  2Y5C A;  4FHJ A;  3CWI A;  4LJP B;  2DAJ A;  3ZNI D;  1WF9 A;  3DBR B;  3PZ8 A;  4LCD E;  3MFG A;  2YEP F;  3L0W B;  2Z0E B;  4LNO A;  1XLQ A;  2QJL A;  3B1L X;  1P9D U;  2CKH B;  3AU4 A;  3R7Q A;  1P3Q U;  5BYQ A;  2UWQ A;  1GNU A;  2BS3 B;  3QJZ A;  1JWM D;  3SU8 X;  1YN4 A;  2MCN B;  3BVZ A;  1JWB D;  4BZA A;  5FKA C;  4ZDV A;  1YQ3 B;  2WYQ A;  1FIQ A;  3BY4 B;  4MEL A;  3AM9 A;  4ANW A;  2K6Q A;  5MPO A;  1NYQ A;  2K25 A;  2KTR B;  5T8I A;  5DPR A;  2LAS A;  3RYT A;  2EKI A;  3TSS A;  3FIL A;  2K9X A;  3B9J A;  3ZGZ A;  1SEB D;  1VZ6 A;  3S2A A;  4MEM A;  3JYU A;  1HTQ A;  1JW9 D;  4JE3 B;  4BBN F;  2IY1 B;  3Q8F A;  3NUH B;  2KTF A;  2WXF A;  2H89 B;  5EE0 A;  2ON8 A;  4BVU C;  4ITK A;  4NAM A;  1WM3 A;  2I1K A;  2M17 A;  2BYE A;  5AUK A;  2IO3 B;  1WXQ A;  4HXD A;  4S17 A;  4RGO S;  1NEN B;  1CQV A;  1JRP A;  4GXB A;  1YD8 U;  3FKY A;  2DAF A;  2N1W A;  3WAL A;  4K7U A;  2MWS B;  2BYV E;  2J0K A;  1K50 A;  5GXG B;  2KKC A;  2GMI C;  4TQ1 A;  1WJ6 A;  1MG8 A;  3DVG X;  2QEJ C;  2XN9 C;  1XLP A;  4E74 A;  2RSU A;  1K8R B;  1E7U A;  3AE8 B;  1JRO A;  3N9Y C;  3K9O B;  1KH0 A;  3VDZ A;  4MGZ E;  3L10 B;  2QDF A;  2DYO A;  1XLO A;  1WIA A;  2JYE A;  3R8B A;  2MJD A;  2D3C A;  2JX5 A;  1SJH D;  2MBO A;  1XLN A;  2N9K A;  3VTV A;  4IM2 A;  1TY2 A;  3Q8C A;  2BPS A;  4OVU A;  3A9J A;  3KLS X;  4IKG A;  2KFJ A;  2PW9 A;  1OTR B;  4NQL B;  1EF5 A;  3TL5 A;  4HRS A;  2DBY A;  3N20 C;  3QHT A;  4BKT A;  1WYW B;  3V6E B;  3JVZ X;  2D11 A;  1HA5 A;  4ZRQ A;  1ZXI A;  4HKQ A;  4YSX B;  2LHD A;  3NHE B;  4WWO A;  1E10 A;  3VRB B;  3QAR A;  3DBL I;  1E8Y A;  1WJ4 A;  4M01 A;  2Q5W D;  3BK1 A;  1UWX A;  3QWZ B;  1HQR D;  3AEB B;  3VR8 B;  3BIN A;  2QIL A;  3SR6 A;  4C80 A;  1PYW D;  1V5O A;  1PUT A;  4CO7 A;  3OLM D;  2JQR B;  1JWA D;  2KJH B;  3ZJU A;  3AE4 B;  4WWN A;  5HFY A;  2KJR A;  2AWT A;  2O2V A;  1C4A A;  2V3P A;  4LNK A;  4JIO U;  2NMQ A;  1HE8 A;  2GBR A;  5EE9 A;  2M1M A;  4CYE A;  4IWO A;  2RR9 A;  1SXT A;  1WE6 A;  2MRP A;  2LUM A;  4I6L B;  1NEK B;  4DHZ E;  2LGD A;  2WXM A;  1WX8 A;  2WXP A;  1FPY A;  2INN E;  2KFK B;  2L0F A;  4ANU A;  1ZDX A;  2MSE D;  1EM7 A;  2D3B A;  4HDQ A;  2PVG C;  2J52 A;  2L0T A;  4TKN A;  4HPM B;  3N1Z C;  1F2R I;  1IP9 A;  1YX5 B;  1ZW7 A;  3DHI C;  4M0W A;  4MSQ B;  2ZVN A;  3ML9 A;  2R2O A;  5BYR A;  4N6E B;  2PVO D;  1A5R A;  4YTN B;  2GOW A;  4LDT B;  2WXQ A;  3DBR I;  4HCP B;  4JX1 C;  4DXF A;  1JRU A;  4MH0 E;  1BXT A;  3AXC A;  1DGJ A;  2K0P A;  3NS8 A;  2AQ1 B;  4ICV A;  3QK0 A;  1C76 A;  2LWP A;  3ZRF A;  1V80 A;  1AN8 A;  1TKY A;  4KZC A;  3VXW A;  3T8M A;  1YQB A;  4HPP A;  4PK1 A;  3A1Q B;  2N0S B;  2NVU I;  1FFU A;  4MT5 A;  1SB3 C;  3OAW A;  4YSY B;  1T0S C;  1WYG A;  2INP E;  1C3T A;  4AJW A;  2LXA A;  2EEL A;  2ACZ B;  2WXG A;  2WQY B;  1C4C A;  1SE9 A;  2Z0D B;  2MBQ A;  2D10 A;  5E6N A;  1KF6 B;  3B08 A;  1RLF A;  2HDE A;  4E71 A;  1FO4 A;  3KYC D;  5HKH A;  2PE6 B;  3N1X C;  3EUB 2;  4AJY B;  4RF0 A;  1C9F A;  2BYF A;  4KVG B;  1I4G A;  2D3A A;  2WU2 B;  3JSV A;  3DBS A;  1YJ1 A;  5LXH A;  2N7D A;  3RUL A;  3BYY B;  3EFC A;  4KGR A;  3AU5 A;  5D6J B;  3V62 A;  5DPW A;  3KWL A;  2D2Q A;  3AEE B;  3EA6 A;  1S1Q B;  4N9F 4;  2JXT A;  4FA6 A;  1Q10 A;  2JSV X;  4WJQ A;  3L16 A;  2QC8 A;  1NVI D;  2RDH A;  2G4S A;  1GOZ A;  2KN4 A;  4DHJ D;  1Y8R C;  5C1Z A;  3PV1 A;  3H7P B;  3A9K B;  2WX0 A;  2WXO A;  3ZXV A;  1U4A A;  1UUP A;  1WE7 A;  3C8Y A;  1OEY A;  3P4R B;  3C0R B;  3IAS 1;  3H1U A;  3NS1 A;  4HDO A;  1IUE A;  4DXG A;  2O6V D;  3MHS D;  3TCA A;  2ZPN A;  1V5T A;  3HVD A;  4C4V A;  4II3 B;  2NS5 A;  1I42 A;  2BWF A;  4EZK A;  2KHW B;  2VH2 A;  2BQQ A;  4YTM B;  3CMM B;  3QIJ A;  3TEX A;  3NVZ A;  3AN1 A;  4EKU A;  1V2Y A;  1JWU D;  2HTH A;  2XK5 A;  1KRH A;  1QOF A;  2V4L A;  1D3Z A;  4MJS B;  3ZTD A;  3V60 A;  1AW7 A;  4DBG A;  1HTO A;  4KSK C;  2L1A A;  4I6N B;  5H8Y E;  2UYZ B;  3LXF A;  3TEY A;  2KWU B;  4BAX A;  4TSS A;  2LFI A;  4TQ0 A;  2GI9 A;  3DWG C;  3VH4 B;  4IWP A;  2L3Z A;  1FCC C;  2FBW B;  5DPT A;  1FRD A;  1K53 A;  2JVC A;  3Q14 C;  1FXI A;  4AUQ C;  1TIF A;  4KV2 A;  4LJO B;  2EMS A;  3VTU A;  5G2N A;  1V81 A;  2JZ3 B;  2WHI A;  5IP4 D;  1IGD A;  4WQO B;  2ZJD A;  2CHX A;  2Y5P A;  3ZDM C;  1Z5S B;  1P98 A;  2LXC A;  4W9H A;  4IOI E;  1RYJ A;  5J2R A;  1E7P B;  1VD2 A;  2BVC A;  3RNG C;  3VTW A;  4AOF A;  2KWD A;  4HWI B;  1FXT B;  4RCO A;  3FIL B;  5IAA C;  4XZ4 A;  2KDB A;  3R66 C;  2RD0 A;  2AL3 A;  3RI7 C;  3H7S A;  2NTS A;  2OED A;  3CSF A;  2W3S A;  4FBJ B;  1F0Z A;  1WXA A;  4EEW A;  3P4Q B;  3ZJT A;  4L1B A;  3BK2 A;  1NI2 A;  1E9M A;  4TUU A;  2WXI A;  1GC7 A;  4NY0 A;  1OQQ A;  4ZHO A;  1KJT A;  3IG3 A;  1E8W A;  1WGR A;  5DCN A;  2JY6 A;  2WDQ B;  4G0N B;  1WXM A;  2QMT A;  2JRH A;  3APF A;  3W9C B;  4XGA B;  1TTN A;  2MBB B;  1T6B X;  4J6I A;  2GBN A;  3VRA B;  2IGD A;  1P7F A;  4G11 A;  2K3U A;  1L6U A;  1I4X A;  1V1O A;  2BS4 B;  4W9D A;  3PHX B;  3AE1 B;  5EE3 A;  5IN7 A;  3OWE B;  4GGQ A;  4FJZ A;  3MHZ A;  4ZOH C;  1MFW A;  1WY8 A;  3RNC C;  4K3B A;  1FMA D;  2AQ3 B;  3ABV B;  1F77 A;  1ESF A;  4HLE A;  1ZUD 2;  1TJE A;  3IVF A;  4YTP B;  1D5M C;  4OZB A;  2O6V A;  2KMC A;  4G50 A;  4WH4 A;  1J7A A;  2LZ6 A;  2A4Z A;  2R61 A;  2GB1 A;  3A9J B;  5GMV A;  2RPQ A;  1GUA B;  3AV8 A;  4WQM A;  1V1P A;  2D5G A;  3X0W A;  2LGI A;  1VCB A;  2IGH A;  2V4I B;  1CZP A;  2WDT B;  4OVZ A;  3SFD B;  4EZL A;  2WXR A;  4M02 A;  1R4N B;  2C9W B;  2QHO A;  3BVM A;  2IGG A;  3TIX A;  2N9P C;  4F1S A;  1L4D B;  2C5L C;  2OJW A;  4I6P A;  1TKE A;  1VDV A;  3L17 A;  4DWF A;  3APD A;  4XWW A;  3U7Z A;  2BKR B;  3PVL A;  3OJ4 B;  1OQY A;  2C7M B;  1T0Q C;  3DCG A;  1TGZ B;  4US8 A;  3AE3 B;  3V3X A;  4C56 C;  1QT9 A;  4RGT A;  3L54 A;  3PZD A;  4OZA A;  2LGS A;  2IYD B;  2KO3 A;  3CIR B;  4A90 A;  4C7Z A;  3MP9 A;  2O2V B;  4LNF A;  2NBW B;  2JWU A;  3MC9 A;  2KVZ A;  1QOG A;  2J53 A;  1R7S A;  4FUL A;  1RFA A;  4L2Y A;  4ZYS A;  3BZD B;  5CHW A;  1C4P A;  2K1F A;  1GB1 A;  4KIK A;  2DZI A;  3Q3O C;  2QSD A;  1WMH A;  5G5G A;  3BYT B;  4DHZ B;  5CTR C;  4XDC A;  1FEH A;  1YJI A;  3E9S A;  4GB9 A;  2K8H A;  2BKF A;  4RM8 A;  2L7R A;  4KDL B;  3AH7 A;  1TY0 A;  2DZK A;  3BWU D;  1WM2 A;  4USA A;  2N9E B;  1Q5W B;  3AE2 B;  3WIM A;  3ZNH B;  4JWU C;  3DPD A;  4M0W B;  3GOE A;  1C77 A;  2K5P A;  4IUM B;  4G3X B;  3AI5 A;  2JU6 X;  3APC A;  2KVR A;  4ANV A;  1LFD A;  1WH3 A;  1JQ4 A;  2OJR A;  2Z59 B;  2ONQ A;  1VR9 A;  4LNN A;  4HKZ E;  4W9J A;  2KDE B;  1K51 A;  2B76 B;  3N1Y C;  2OHF A;  3U30 A;  3EGR A;  2ZZP B;  2KX3 A;  3M63 B;  2WXN A;  4YL8 A;  1D4B A;  2JWZ A;  2XEW A;  2JF5 A;  3NZ3 A;  2LEK A;  2PEA A;  4AQ7 A;  2V0G A;  4LK0 M;  4BBN C;  4S0R A;  4GDL A;  2GBM A;  5EE1 A;  4ICU A;  4MAC A;  1WGY A;  3I63 C;  3NZU A;  3Q8A A;  3N3K B;  2ZW0 A;  1SJE D;  1I4H A;  2R2Q A;  2LJI A;  1E6E B;  3HUI A;  3TEW A;  2D3G A;  2BBC A;  2JT4 B;  3VR9 B;  4ANX A;  2W55 A;  2NPT A;  3IBE A;  4ZRJ A;  2KZR A;  2L52 A;  2WLB A;  5TR5 A;  2N1V A;  3U4E G;  1GPX A;  2AYO B;  3W1S A;  2X38 A;  3DWM A;  3PHW B;  4KKI A;  5AZH A;  1UD7 A;  3DVN U;  1JWS D;  4K1R B;  4KGT A;  4L23 A;  3JSV B;  4O1N A;  4N59 A;  4RFB A;  4RGN A;  1D6E C;  3O65 B;  4XDD A;  1YN3 A;  4OW0 A;  1SBB B;  1HXY D;  3MTN B;  3KUZ A;  1SGH A;  3L4P A;  2LHE A;  3LYY A;  3ZRC A;  4W9G A;  5FK9 C;  2K8B A;  1MG4 A;  4JLC A;  1N62 A;  3TEZ A;  4DK5 A;  1PGB A;  2RGF A;  1GJZ A;  2IO1 B;  4HJK A;  4XYC A;  1HZ5 A;  4PYZ A;  2M56 B;  3P4S B;  4GDK A;  5LLI A;  3Q69 A;  3NJT A;  1RRB A;  1RFK A;  2CHW A;  3SD5 A;  4HCN B;  1Q0W B;  2KX0 A;  1R4N I;  2MH7 A;  3VH3 B;  4ZHP A;  1Q1O A;  2FUG 1;  5D7G A;  3ZXR A;  1V6E A;  2V1Y A;  2C7N B;  2I38 A;  2W3R A;  2MP2 A;  2YVC A;  1IPG A;  4C00 A;  1DYQ A;  1ZKH A;  1UH6 A;  1WGK A;  1EWC A;  3P1M A;  4A9A A;  4NJ6 A;  4C4V B;  1UBQ A;  1EU4 A;  3NVV A;  2BT6 A;  3RT3 B;  2G3Q B;  2KQ7 A;  2WXH A;  3P2B A;  2K6D B;  4PS3 A;  2ICI A;  3NG0 A;  3RNF C;  1TS3 A;  4WAA A;  3PO0 A;  2PPH A;  2KC2 A;  1CK1 A;  3AE6 B;  5IO9 A;  2ZPY A;  4UDU C;  5EDS A;  4TMA B;  3HVZ A;  1FNV A;  5D3I B;  3TUO A;  3HIZ A;  1XF5 L;  1HZ6 A;  1ISN A;  1L7Y A;  1V9J A;  4RH6 A;  2LVP A;  1FNW A;  3HRD D;  3WAN A;  3TBL D;  2ZNV C;  1XCT L;  2JYT A;  1IBX A;  4B6W A;  3QAQ A;  3ENE A;  3PPA A;  2IPK D;  2LMC A;  3ZW3 A;  2DNF A;  1F9J A;  4DDG D;  1XEE A;  1OQR A;  3VUY A;  2AX5 A;  1GAQ B;  2QIE B;  3KYD D;  5CX3 A;  2K39 A;  1ZXH A;  3KUC B;  4AS1 A;  1I7H A;  3AE5 B;  2YEP B;  2DWQ A;  4MGK E;  2REX A;  3ZYY X;  1N5W A;  1ZE3 D;  3UGB B;  3KVF B;  1EF1 A;  1WX9 A;  2LGX A;  4W9I A;  4PT5 A;  3SDL C;  2KDF B;  3L08 A;  3B0A A;  3IXS A;  3KWV A;  1OFF A;  2NCN A;  2AL6 A;  3AED B;  1GG3 A;  1MJD A;  4A8X C;  3V61 A;  2M19 A;  1UWM A;  4E3C A;  4F7Z A;  4N58 A;  3I5J C;  1BML C;  4KKJ A;  3H6N A;  2GLS A;  3RUI B;  5J17 A;  5BMG A;  2JPH A;  3Q3F A;  1I4Q A;  1L5P A;  1T3Q A;  3J9C A;  4B95 A;  1WGH A;  3VFK A;  1PGX A;  3U2S C;  1WI0 A;  5E6P A;  4XX5 A;  3ZO5 B;  3JW0 X;  5L83 A;  1ZDV A;  4DHJ B;  2E6X A;  1D5Z C;  2KOX A;  2ZCB A;  3PRP B;  4WJO A;  2DYM A;  1QZE A;  4IDI A;  2MJ3 A;  5JZE B;  3PGE A;  1YX6 B;  5LXI B;  1DOX A;  4WWP A;  2O6V B;  2BW2 A;  2BB5 A;  2MQJ A;  2LVO A;  4PS8 A;  3W2D A;  1LXD A;  3DBH B;  3B2F A;  5JH5 C;  3E56 A;  1WZ3 A;  1V1P B;  2CS4 A;  2MLB A;  3RPF C;  3RNB C;  4MDK E;  4RNA A;  1JCK B;  2CU1 A;  2L8J A;  1V86 A;  4IG7 B;  2CJN A;  1WR6 E;  4K7W A;  3M95 A;  3UF8 A;  2JXX A;  3DVG Y;  1G6J A;  2PJH A;  1EU3 A;  2KJ6 A;  3DOW A;  2NBU A;  4NJ7 A;  2DHZ A; 
#chains in the Genus database with same CATH homology
 1UWX A;  2DLB A;  3AE3 B;  3V3X A;  4C56 C;  1QT9 A;  4RGT A;  4B0M A;  3MC0 B;  1F2R C;  1HQR D;  2L32 A;  3AEB B;  3VR8 B;  2KDM A;  4OZA A;  4KGS A;  2VZK D;  4XWT A;  3IT4 B;  1N60 A;  5H92 C;  2QIL A;  3SR6 A;  4C80 A;  1PYW D;  4JPS A;  3AE7 B;  1VJK A;  3WCQ A;  1PUT A;  1ROE A;  3W5V B;  3AMZ A;  3P4P B;  2JQR B;  1FNU A;  1JWA D;  3ZJU A;  3AE4 B;  5HFY A;  4RF1 A;  4MM3 B;  3I9V 1;  1C4A A;  4NAW B;  2W82 A;  2V3P A;  1PFD A;  3CIR B;  4A6Q A;  2NMQ A;  5BYS A;  4A90 A;  5EE9 A;  4C7Z A;  2IDY A;  4MH8 A;  1YNT E;  3MP9 A;  1J7C A;  4P6V F;  2JWU A;  1SE2 A;  1QOG A;  2J53 A;  1SXT A;  1R7S A;  2LUM A;  1NEK B;  1YJJ A;  2WXL A;  2WP9 B;  3ETR A;  2BS2 B;  1XO3 A;  4HEA 1;  4L2Y A;  4ZYS A;  3BZD B;  2WXM A;  4EE2 A;  1C4P A;  1L0X B;  1GB1 A;  2W54 A;  3KQ4 A;  1FRR A;  4C7Y A;  2WXP A;  2QSD A;  2J42 A;  2FE8 A;  2INN E;  5G5G A;  3BYT B;  3URY A;  1SIJ A;  4XDC A;  1FEH A;  1YJI A;  1HEZ E;  3E9S A;  1ZDX A;  1QF6 A;  3GS2 A;  1EM7 A;  1AWD A;  2JZP A;  2PVG C;  2J52 A;  1D5X C;  3AH7 A;  1TY0 A;  1F2R I;  1NYR A;  1TKG A;  2K22 A;  3BWU D;  4M0W A;  2WXK A;  2NTT A;  2SAK A;  1TS5 A;  3SFE B;  4USA A;  5G5H A;  1QOA A;  3AE2 B;  4KX6 B;  4J3O D;  5BYR A;  1N63 A;  4JWU C;  1L0V B;  4N6E B;  2PVO D;  3RFZ B;  2KQ4 X;  4YTN B;  1C77 A;  2K5P A;  2WXQ A;  2JU6 X;  2KAJ A;  1BUI C;  3SEB A;  4H2A A;  4JX1 C;  4DXF A;  4YXD B;  2M0A A;  1VRA B;  2N7J A;  4HRO A;  1BXT A;  4R3D A;  1DGJ A;  2V3N A;  1JQ4 A;  2K0P A;  2AQ1 B;  3FAH A;  2ONQ A;  1VR9 A;  4HKZ E;  1UGJ A;  1C76 A;  2PTL A;  1YQ4 B;  1AN8 A;  1TKY A;  1K51 A;  2B76 B;  4NJC A;  2OHF A;  3AB5 A;  2I2Y A;  3EGR A;  1P7E A;  2CJO A;  2WXN A;  3IT6 B;  5D3D A;  1UNS A;  3UI3 A;  1D4B A;  1AYF A;  2N0S B;  3NZ3 A;  3GP7 A;  1FFU A;  2LEK A;  1MPE A;  4AQ7 A;  2V0G A;  4LK0 M;  4MT5 A;  4REZ A;  1SB3 C;  1YN5 A;  1KLG D;  2CU3 A;  5EE1 A;  1NI3 A;  3NRZ A;  1KTK A;  4YSY B;  1N61 A;  1SE3 A;  1WYG A;  2INP E;  4MAC A;  1ZP0 B;  1MVK A;  4GDL B;  2KMM A;  2EEL A;  2ACZ B;  3AEG B;  2WXG A;  1JML A;  2WQY B;  3Q8A A;  3H8H A;  1C4C A;  1I4R A;  3BII D;  2ZW0 A;  1SJE D;  1I4H A;  3NVW A;  1ZPS A;  1KF6 B;  2LJI A;  1CJE A;  1E6E B;  3HUI A;  3TEW A;  1VLB A;  2PLP A;  1IGC A;  2BBC A;  3P63 A;  2HDE A;  3VR9 B;  1FO4 A;  3R2I A;  3LB8 C;  2W55 A;  5TSS A;  1M4V A;  2L52 A;  1WSP A;  3ZQ4 A;  2WLB A;  4WAF A;  1I4P A;  2MEK A;  1SF0 A;  1FCL A;  3EUB 2;  3U4E G;  3GB1 A;  3AE9 B;  1GPX A;  1TYG B;  2L83 A;  4RF0 A;  1C9F A;  3W1S A;  2X38 A;  3DWM A;  1I4G A;  4CQN A;  1DOY A;  2PMV A;  4ARC A;  2WU2 B;  1QOB A;  4KKI A;  4NZL B;  3BYY B;  4KGR A;  3T3O A;  1JWS D;  4KGT A;  4P16 A;  3KWL A;  4L23 A;  1C78 A;  3AEE B;  3EA6 A;  5I4D A;  4O1N A;  4N59 A;  4RFB A;  2JXT A;  1N5X A;  4A55 A;  5BMI A;  1Q10 A;  2BB6 A;  2VZK B;  4RGN A;  1SE4 A;  2PIA A;  1GB4 A;  1D6E C;  2BYT A;  5JXV A;  3V05 A;  4XDD A;  3ZJV A;  2N9L A;  1YN3 A;  4OW0 A;  2JSV X;  1SBB B;  1HXY D;  1L4Z B;  4LLG M;  3L4P A;  3VQI A;  3PZ7 A;  1MI0 A;  4D2K A;  1JAL A;  1STE A;  2LHE A;  3LYY A;  4WUR A;  1TS4 A;  5FK9 C;  1N62 A;  1DOI A;  3TEZ A;  5C3J B;  1PGB A;  1NVI D;  3MJ5 A;  2RDH A;  1GOZ A;  4RGM A;  1HZ5 A;  1L6V A;  2KN4 A;  4DQO C;  1V97 A;  4YT0 B;  2M56 B;  3P4S B;  3W5U B;  3Q69 A;  1FFV A;  2WXO A;  5FR3 A;  1RFK A;  1KLU D;  5AUI A;  1ET9 A;  4GDK B;  1UUP A;  3C8Y A;  4YWG G;  3P4R B;  2MH7 A;  2J4X A;  4FXC A;  3IAS 1;  4B0E A;  3NS1 A;  4ZHP A;  2FUG 1;  1IUE A;  4DXG A;  5D7G A;  2WNM A;  5BMH A;  4LTU A;  1QLB B;  3I57 A;  5C2T B;  3R8B A;  5HI1 A;  3Q8B A;  1XXG A;  3AEF B;  2TSS A;  1FD6 A;  1ET6 A;  4ZRP A;  2I38 A;  2W3R A;  3HVD A;  1ZOY B;  1A70 A;  1DYQ A;  3BVG A;  1WGK A;  1T5X D;  2MJE A;  4YTM B;  4XE0 A;  1WWT A;  2Y3A A;  1EWC A;  3P1M A;  1MHH E;  4A9A A;  3T3N A;  3TEX A;  1WRI A;  1EU4 A;  3NVZ A;  3AN1 A;  3NVV A;  2BT6 A;  1JWU D;  1KRH A;  1QOF A;  2WS3 B;  2WXH A;  4OZC A;  1B1Z A;  3R2T A;  2ICI A;  1AW7 A;  1TS3 A;  2Y5C A;  3PO0 A;  2L1A A;  3U52 E;  2Z8L A;  4US9 A;  3AE6 B;  1CK1 A;  3AEC B;  3CWI A;  1PGA A;  1V8C A;  5E6J A;  5H8Y E;  3LXF A;  3PZ8 A;  3TEY A;  3MFG A;  1ENF A;  2YEP F;  4UDU C;  4TSS A;  1XLQ A;  2QJL A;  4TMA B;  2LFI A;  4TQ0 A;  2GI9 A;  3DWG C;  3HVZ A;  1FNV A;  5D3I B;  1QKZ A;  3TUO A;  1RWS A;  5BYQ A;  1FCC C;  2FBW B;  1FRD A;  2BS3 B;  1K53 A;  2AQ2 B;  1FXI A;  1XF5 L;  1Y56 A;  1JWM D;  2WU5 B;  1HZ6 A;  3IAM 1;  1MHX A;  1YN4 A;  4HJG E;  4RH6 A;  1FM0 D;  3BVZ A;  1JWB D;  2G1E A;  5FKA C;  1IGD A;  1FNW A;  3HRD D;  1XCT L;  2JYT A;  3FC4 A;  4Q2J A;  1IBX A;  1YQ3 B;  2Y5P A;  3O13 A;  1FIQ A;  2IPK D;  2G9H D;  3AM9 A;  2LMC A;  3Q8E A;  1NYQ A;  5T8I A;  5MPO A;  2WDR B;  1VZ8 A;  1OQR A;  1XEE A;  2EKI A;  1IBX B;  3TSS A;  3FIL A;  4IOI E;  1RYJ A;  2K9X A;  3B9J A;  1E7P B;  1SEB D;  3ZGZ A;  4OHJ A;  1VZ6 A;  2AX5 A;  1GAQ B;  2QIE B;  1JW9 D;  2KWD A;  4JE3 B;  3Q8F A;  4RCO A;  3FIL B;  3NUH B;  2WXF A;  2H89 B;  2E3T A;  1L0Y B;  1ZXH A;  5EE0 A;  2ON8 A;  4AS1 A;  1I7H A;  3AE5 B;  4ITK A;  2YEP B;  4NAM A;  2DWQ A;  3ZYY X;  2NTS A;  1N5W A;  1ZE3 D;  2OED A;  5AUK A;  2BTE A;  2W3S A;  1WXQ A;  1F0Z A;  4PT5 A;  1TS2 A;  4YSZ B;  3P4Q B;  4RGO S;  1NEN B;  1CQV A;  1JRP A;  3ZJT A;  3IXS A;  3KWV A;  1OFF A;  4L1B A;  3BK2 A;  3AED B;  5HHD G;  1EWY C;  1E9M A;  4A8X C;  2WXI A;  2M19 A;  1UWM A;  4N58 A;  1K50 A;  1BML C;  5GXG B;  4KKJ A;  1OQQ A;  4ZHO A;  5BMG A;  2IJ0 A;  2WDQ B;  2QMT A;  4TQ1 A;  2KAC A;  1SSN A;  1K52 A;  1I4Q A;  2QEJ C;  1L5P A;  2XN9 C;  1XLP A;  2WXJ A;  3W9C B;  1T3Q A;  3J9C A;  5LNK 1;  3AE8 B;  2GRI A;  1JRO A;  1T6B X;  1PGX A;  3N9Y C;  3U2S C;  1KH0 A;  4ARI A;  2ZW1 A;  3VRA B;  2IGD A;  1P7F A;  2DYO A;  2K3U A;  1XLO A;  2JYE A;  1L6U A;  1ZDV A;  1I4X A;  1V1O A;  2H88 B;  2MJD A;  2BS4 B;  2PKO A;  2RDG A;  2SEB D;  2E6X A;  3AE1 B;  5EE3 A;  3OWE B;  1D5Z C;  2JX5 A;  3MHZ A;  1QQR A;  1ACC A;  1SJH D;  4ZOH C;  3AEA B;  1XLN A;  2XNA C;  1FMA D;  2N9K A;  1LO5 D;  2AQ3 B;  3ABV B;  1F77 A;  1ESF A;  2RMM A;  1ZUD 2;  1TJE A;  1YMH E;  2DYM A;  4YTP B;  1TY2 A;  1D5M C;  4OZB A;  1RM6 C;  2HTM E;  4GLS C;  4IDI A;  2MJ3 A;  4JWS C;  3Q8C A;  1E0Z A;  4WIP A;  1DOX A;  3NVY A;  4WH4 A;  1J7A A;  3KLS X;  2BW2 A;  4IKG A;  2R61 A;  2GB1 A;  2BB5 A;  2PW9 A;  3AV8 A;  4WQM A;  1V1P A;  2D5G A;  1QIL A;  3W2D A;  2LGI A;  4WWM A;  2IGH A;  2V4I B;  4HRS A;  1CZP A;  4OVZ A;  2DBY A;  3SFD B;  3B2F A;  2WXR A;  3B2G A;  3E56 A;  1V1P B;  3BVM A;  2IGG A;  3RPF C;  1VZ7 A;  4RNA A;  1HA5 A;  1JCK B;  2WDV B;  4ZRQ A;  1L4D B;  1ZXI A;  2CJN A;  4HKQ A;  2RPV A;  1FXA A;  1PDX A;  1TKE A;  1VDV A;  3P42 A;  1C79 A;  4YSX B;  5HG2 A;  2LHD A;  1EU3 A;  4XWW A;  3U7Z A;  1E10 A;  3VRB B;  1B9R A;  1J7B A;  1KFY B;  2Q5W D;  1TZO A;  1XCQ L;  3BK1 A;  4US8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...