1XCQL

Complex hcv core-fab 19d9d6-protein l mutant (d55a,l57h,y64w) in space group p21
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
PKEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALHAKVNGEWTADLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords Capsid protein C
total genus 8
structure length 66
sequence length 66
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xcqL00
3MP9A 5HG2A 1IGCA 2JWUA 2LUMA 1HEZE 2ONQA 1C9FA 4OZCA 4KGTA 2ZW1A 4WH4A 1P7EA 3V3XA 5HFYA 2IGDA 2J53A 4HKZE 4OZAA 1UWXA 2KN4A 1PGAA 2N9LA 1MI0A 2N7JA 2PTLA 2J52A 4IKGA 2KACA 1IBXA 1XCQL 2RPVA 4GLSC 2JXTA 4MACA 1HZ5A 1PGBA 1F2RI 4HJGE 1MHHE 1K53A 1EM7A 2LGIA 2IGGA 3UI3A 1QKZA 3FILA 1K52A 2JZPA 1FCCC 1HZ6A 2GI9A 2NMQA 2ZW0A 2LHDA 1PGXA 5BMHA 2GB1A 1IBXB 1KH0A 2EELA 3GB1A 5BMIA 1K50A 1MPEA 2QSDA 2ON8A 2IGHA 2QMTA 1F2RC 1GB4A 2I38A 4D2KA 1YMHE 5HHDG 1XF5L 5BMGA 1YNTE 2PLPA 2JU6X 2N9KA 1D4BA 4KGSA 3FILB 2LHEA 2K0PA 5JXVA 1JMLA 4KGRA 1K51A 1IGDA 1FCLA 1FD6A 1Q10A 1MVKA 2PW9A 1MHXA 1GB1A 2KWDA 1P7FA 1XCTL 4IOIE 5HI1A 2RMMA 4OZBA 2JSVX 1ZXHA 2KQ4X 2KDMA 2I2YA 2OEDA
chains in the Genus database with same CATH superfamily
3ZLZA 2CS4A 5CX3A 2MHJA 2Y3AA 4K7SA 2EMSA 3RNGC 5D2MB 1OEYJ 3OJ3A 2MBQA 1FRDA 3PPAA 1UBIA 4OVZA 2MP2B 3V6CB 2BYEA 2K39A 3A9KB 3URYA 3ZJTA 4MGZE 4ZRIA 3TL5A 2IO0B 1TS5A 4S0RA 3DDCB 4C7ZA 3S2AA 1K52A 2GI9A 3ZJUA 2GBRA 2X38A 4TV3A 4W9LA 2GB1A 4MSMB 1YX6B 1WJUA 5IOIA 4EOYA 2HE7A 2K6QA 1VZ8A 3EHVA 1MG4A 2DAFA 2J0MA 1C78A 1IPGA 3CMMB 2E6XA 1WF9A 4EZLA 5HHDG 4KKIA 1YNTE 1UGJA 3IT6B 2FUG1 1P1AA 2LHEA 4REZA 5H8YE 3UF8A 5H92C 5JXVA 4MSQB 3MHZA 1K51A 1PDXA 1N5WA 1GB1A 4K7UA 2KWDA 3A1QB 2L83A 4ARIA 1WGDA 2G1EA 3Q14C 2WXHA 2DZJA 4GXBA 3TMPB 3ABVB 2KDBA 1NYQA 1JRPA 3AEGB 1WJNA 3Q3JA 1I42A 2I1JA 4FN2A 5MPOA 2C7MB 4ZYSA 3ECIA 3DVGX 1RWSA 1XQQA 3IG3A 2L05A 1IP9A 3A33B 1QT9A 1OFFA 3QHTA 2BBCA 2JVCA 2KLGA 3SDLC 3DVNU 3OAWA 4DXAB 2H88B 2KN4A 2FAZA 2QILA 4KX6B 1UZXB 1V49A 5DPTA 3KLSX 4RM8A 3A9JB 1ZE3D 4FA6A 5C3JB 2KMMA 1WYWB 1N5XA 1YJIA 1WSPA 1M4VA 4JIOU 4LDTD 1T6BX 4JGHB 2MP2A 2X8XX 1TY2A 3VTUA 2FCMA 2E3TA 1OQRA 3EFCA 3ZXRA 3WCQA 2PVOD 4FBJB 2J4XA 4N9F4 1SE9A 3SFDB 2N9XA 1TY0A 1JWMD 2LMCA 1EO6A 1SXTA 2CHXA 4PS7A 2NBUA 4IG7B 4TKNA 5LXIB 4LNNA 2NPTA 2LJIA 4HPMB 2ON8A 4RMAA 3QARA 3ZNZB 3VFKA 4MJSA 4HKQA 1QOGA 4W9GA 1TS4A 4MELA 2TSSA 4MM3A 3RNBC 5EDSA 2LVOA 3R2TA 1NYRA 1WX7A 3NVZA 1WXQA 2LUEA 4KGSA 5E6OA 4WQMA 4HWIB 3BZDB 2PEAA 4K7WA 1YN5A 2YEPB 3CF6E 4ZRPA 1HTOA 4KGRA 1WRDB 2FE8A 1RFKA 3Q2AC 3O13A 1KLGD 1TGZB 2XEWA 2Y5CA 1OQYA 3GP7A 3HHMA 3Q3FA 4M00A 4BOSC 4US9A 5FR3A 2PJHA 2O2VA 2K8BA 1L7YA 1T3QA 3AM9A 2LJ5A 3NJTA 1MFWA 1KLVA 4EZJA 5AZHA 2MWSB 2QC8A 2M4NA 1HA5A 2IGDA 4WJQA 5HKHA 1FIQA 1P0RA 3W1SA 1E0ZA 4A20A 3WIMA 4IDIA 2MQJA 5D7GA 2PTLA 3VHTC 1WY8A 2ZCCA 4WAAA 1XCQL 3M62B 3PO0A 4ZRJA 2JX5A 1L2NA 1FEHA 1AN8A 2V3NA 3N30A 5J2RA 4LNIA 5TSSA 3TJPA 4LLGM 1V6EA 4P7IA 2NMQA 2OJRA 3ZIMA 4MEMA 3NHEB 3TSSA 2PKOA 4YSYB 5JZEB 2BTEA 3JSVA 1WGYA 1V9JA 2N1WA 4QAYA 3DWMA 1WE7A 2KD0A 1WXAA 2N7DA 4WWPA 1D4BA 2JF5A 2KDFB 3ZYYX 3BK1A 2K0PA 1DGJA 2KWCA 2KT7A 3IAM1 1VD2A 1FD6A 3GE3C 2IZVB 1PQSA 1A70A 2INNE 4JPSA 3D32A 2UU7A 2RMMA 2A4ZA 1UELA 1WE6A 4RCOA 1T0RC 4EKUA 3W5UB 2LXCA 2KDEB 4WWNA 2JWUA 2Z0EB 3ZRFA 3P63A 1FNUA 4LDTB 4M8NA 2PE6B 4I6NB 1V5OA 3AE3B 4NJ6A 4KZCA 4IM2A 3MTNB 2KFKB 4HXDA 4DXGA 3UQAA 5G5HA 2GBJA 2AL6A 2JXTA 1D6EC 2MEKA 5CTRC 2HTME 2YLMA 3BY4B 3UGBB 1EM7A 4YTPB 4MDKE 2LGIA 1TBEA 5IA7A 4C4VB 1V1OA 4ARCA 2QCZA 1TS2A 2JZPA 1ZUD2 1LO5D 1SIJA 3TEYA 3GZNI 1WX8A 2C9WB 5JHAA 3OLMD 1D5ZC 2VZKB 1KH0A 3GB1A 2BB5A 4NAWA 2IGHA 2QMTA 3IHPC 2D11A 2VH1A 3NRZA 2JXXA 3H7PB 4BKGA 3AE1B 3Q6BA 1TZ1A 2AQ1B 1E9MA 2WU5B 3SR6A 1L4ZB 1QQRA 4ZDVA 4MH0E 3RZFA 1C77A 4TQ1A 3HVDA 2MBOA 1Q10A 1AYFA 1VLBA 2IPKD 4GSWA 1R7SA 4RGNA 3I9V1 4JWUC 1JALA 1ACCA 4ZHOA 1ZPSA 1SE3A 1D5MC 1V86A 3ONSA 3EUB2 5G55A 3UIPB 2JWZA 4J3OD 4E71A 3W2DA 1Z2MA 3MFGA 4WH4A 4WQOB 5TR5A 3P4PB 5DPRA 2DWQA 2LEKA 2XNAC 4KZ0A 1I4QA 5C23A 1PYWD 1F1HA 3AE8B 4K1RB 2AQ2B 3ZDTA 5FK9C 2VRRB 5JH5C 2RGFA 1EWYC 3Q8FA 1LFDA 1KOTA 1T5XD 3KW5B 3PRZA 3HIZA 4RM9A 4P6VF 1NBFC 3DBRB 4RNAA 2WXRA 4EZKA 4ZHPA 1JRUA 4Q2JA 3IT4B 1YN4A 1UUPA 1KJTA 3Q8EA 2KWVB 3APFA 3R66C 1UF0A 2WXPA 3DVNV 4LNKA 2QSDA 2ZJDA 4NAMA 2K9XA 2AQ3B 2DX5B 1JCKB 1F2RC 1GNUA 2CJNA 2MH7A 3BYYB 1WJ6A 2JZ3B 3VVWB 1RLFA 3AXCA 1YQ4B 2GBKA 4A9AA 1L6UA 2FIFA 2BS2B 3KH0A 4WWMA 3VAWA 2SAKA 1CMXB 4IUMB 1WYGA 1J7BA 5AZFA 2K3UA 1MG8A 4DXFA 1MHXA 3N32A 1JWBD 1P7FA 3DQVA 1XCTL 4IOIE 2NS5A 4OZBA 2ZVNA 2R61A 1WIAA 1ZOYB 3B2GA 1KFYB 2W55A 3I3TB 2GMIC 1WFYA 3VRAB 4LTUA 5J18A 1ET9A 2AYOB 3P4RB 2ZW1A 5FR6A 4B0EA 3RYTA 2WXJA 4IW0A 4OZAA 3DBHB 3HK0A 3AE2B 4BOZB 2O2VB 4CYEA 3ZTDA 1FM0D 1KF6B 4CHKA 2WHIA 1MHHE 4ICVA 4R3DA 4EFOA 1V81A 1N60A 1V8CA 2L7RA 2WLBA 3UI3A 1BUIC 4HCPB 2KK8A 1FCCC 2FIDA 1HZ6A 2IYDB 2ZEQA 2HJ8A 2M0XA 2L52A 1WGRA 5CHVC 1TIFA 4L23A 4MJSB 5LLIA 4EEWA 1WGHA 2WNMA 5EE0A 1FFVA 3HVZA 2IO1B 3C8YA 4HVBA 2DZMA 2LWPA 2FNJB 3OJ4B 1GG3A 3AU4A 4XWTA 1T0SC 2RDHA 1CQVA 3RNFC 2EKIA 2DLBA 4KV2A 3DHIC 3RI7C 5E6JA 3RPFC 1WJ4A 1SSNA 3ZXVA 2JYEA 3ZO5B 3PGEA 2KNBA 2KC1A 2OOBB 1WXMA 4AUQC 1ZKHA 1K8RB 4ZRQA 3V6EB 2WXMA 1J7CA 1DOYA 3MP9A 4KDLB 1D5XC 1ZXIA 1D3ZA 1V2YA 5T8IA 3PZ8A 3R3MA 5LNK1 2WQYB 1GAQB 2MLBA 1N61A 3H6NA 2J53A 2SEBD 2L76A 3DWGC 2IJ0A 3Q8AA 2IY1B 2ZVOA 2MBHA 1C1YB 3QA8A 2JZZA 2N9LA 1MI0A 2BWFA 2J52A 2B3AA 5AEKB 2KQ7A 3ZJVA 3PLUA 3TUOA 1HXYD 1YD8U 3NOBA 2CHZA 3MJWA 2REXA 4MH8A 4RGTA 3T8MA 4M02A 5D6JB 3PVLA 3TEZA 3GE8C 1WZ0A 4WIPA 4DBGA 2L8JA 5IP4D 2LRWA 1E8YA 2YVCA 3W9CB 1PGXA 2KKCA 3N20C 3BIID 3C19A 4CO7A 3DHGC 3APDA 3HM6X 4B9KA 2RD0A 2BW2A 3AEFB 3AN1A 1UWMA 1AARA 3FAHA 3VTVA 5G5GA 2KXJA 4G11A 2WDVB 3AEEB 3M3JA 1TS3A 1B9RA 3N1YC 3AB5A 4YSZB 3T3NA 2EKEC 3ETRA 3R2IA 2GBMA 5D3DA 1TJEA 3WAPA 2KX0A 2J42A 1RYJA 2KFJA 2AEHA 4M0WA 3DBSA 2V1YA 3CSFA 4IM3A 4HJKA 2DYOA 4HPPA 4ACFA 2K25A 4L1BA 3U7ZA 2Z59B 1YIWA 1WGGA 1L5PA 1HEZE 2DENB 2IDYA 5E6PA 2LVQA 1ESFA 1P7EA 2YEPF 1YJ1A 2MBEA 1L0XB 2WX0A 4XZ4A 5BYQA 2R2QA 4BBNC 2DZKA 5EE3A 1Z5SB 4UDUC 1BT0A 4GLSC 4MACA 4JX1C 1F2RI 2NCNA 2XBBC 2K5PA 4G50A 1K53A 1ZP0B 1GC7A 1XLPA 2BQQA 3RZWC 3FC4A 2HTHA 2WYQA 4XC2A 2BGFA 2VH2A 3WA0A 4I6PA 4IWQA 3PT2B 2J0JA 4GDLA 1TTNA 2MSED 5CHFA 5BMHA 3PREA 1FO4A 1N63A 2XK5B 4YTMB 2WGSA 3RFZB 1E8XA 3N1ZC 1P9DU 2N4FA 4C00A 3M95A 3NZ3A 2BVCA 3RUIB 1GB4A 4OVVA 3NUHB 2LASA 4A55A 2KTRA 2KANA 4DQOC 1NI2A 4GU2A 3LDZE 1C4AA 4OVUA 5IAAC 4GDLB 1TYGB 4JL9A 2JPHA 2WXFA 4AS1A 1YJJA 3RNAC 4W9KA 2C60A 3ZTCA 3BWUD 3L13A 2JRIB 4H2AA 5KHOA 4LK0M 2J0KA 4G0NB 4X57B 1I4GA 1M94A 3KVFB 1E7PB 3TCAA 1L0VB 2MBBB 1VZ7A 4GDKA 1OTRB 4HRSA 2NBVB 2V4IB 2UWQA 3WANA 1C3TA 4MGKE 2M56B 2N7EA 1WXSA 1FXIA 3KUDB 4BKSA 3VXWA 3RN9C 2L00B 2BKRB 1N6ZA 3ML9A 2M1MA 2KO3A 4WWOA 2BPSA 3DCGA 4IKGA 2WXKA 2L3ZA 1PGBA 1QILA 1XLOA 2KC2A 1FNWA 3LJ3A 3V05A 4G3XB 3BVGA 4DHJD 2AWTA 2JY6A 3LB8C 3DOWA 2WDQB 1HQRD 3DVGY 1I4RA 2D3BA 4NQLB 3TEXA 3PLVA 4RH6A 3E9SA 1FFUA 2ASQA 2W3RA 3BYTB 3U2SC 4NY0A 1DOIA 1MPEA 3KYDD 4K3CA 2WX1A 4NAWB 4ZYNA 1WZ3A 1I35A 5E6NA 1XF5L 2IBIB 5AZGA 2HJ1A 3L17A 2LRUA 4WAFA 5J17A 1SGHA 4N6EB 2JUOA 3U7DA 1SBBB 5IN7A 2D2QA 4A6QA 2M8SA 2WXLA 5G2NA 2CU3A 4J6IA 1J19A 3H7PA 2JSVX 2KQ4X 3E56A 3A9KA 4LJPB 4PS3A 2ZPYA 2CJOA 4XE0A 1EWCA 4GOCA 2CU1A 4KGTA 2J7QB 1STEA 3KQ4A 2BYTA 5BYSA 1YX5B 4HKZE 4ITKA 1UWXA 2G4SA 1Q1OA 4OW0A 1IUEA 1PGAA 3M63B 2LGYA 2ICIA 2XK5A 2V3SA 4W9DA 1C79A 4KVGB 3JW0X 2RDGA 4MGYE 4HJGE 1FXTB 4DDGD 2FCSA 2WWZA 3EGRA 3SU8X 2KTRB 4AOFA 3BINA 1UH6A 1R4MI 1E10A 4KSLC 3KWVA 4II2B 3B9JA 4ANUA 2KTFA 2EELA 3OWEB 1JW9D 4FHJA 2AX5A 2O6VA 2EMTA 4FLHA 4P1BC 1S3SG 2JT4B 1EF5A 4WJPA 1I4PA 3PRPB 4DHZE 3U8ZA 3RNCC 1L4DB 2C7HA 3L10B 2PLPA 3AH7A 2ACZB 2ZZPB 3WAMA 3U52E 4TSSA 4DHJB 2WP9B 2FBWB 5L95C 1JQ4A 2INDC 1I7HA 4GB9A 1IGDA 4I6LB 4USAA 1MVKA 3A4RA 2KDIA 3V60A 3N3KB 5EE1A 1SJHD 2N0SB 3EA6A 1CJEA 3SHQA 3FKYA 1E90A 2D5GA 3CWIA 4GGQA 3AE4B 4YT0B 1IGCA 3EC8A 4LJOB 4YWGG 1R4MB 4ZOHC 3SFEB 1J8CA 1F0ZA 3IVFA 2Y5BB 1KRHA 1AW7A 1WM2A 3V3XA 3AE7B 4E3CA 5HFYA 3VR8B 4EE2A 2UYZB 2QIEB 4N58A 2Q5WD 3GOEA 1WH3A 3RT3B 4XDDA 1ENFA 3N1XC 4YXDB 1TZOA 2WXQA 3ZW3A 5D3IB 4KKJA 1EF1A 1ZGUB 1ZDXA 1S1QB 5FKAC 1R4NB 2MW5A 3L08A 2Y5PA 4MM3B 4A3PA 1KM7A 3FILA 3L16A 1FRRA 2KFKA 3VH3B 3VR9B 1WRIA 2WS3B 2CKHB 2Z8LA 2L1AA 3BK2A 3ML8A 3KUZA 2I1KA 3JVZX 4AQ7A 4MGIE 2MJDA 5DPWA 1UGMA 2IY0B 3L0WB 5DPSA 5BMGA 2G9HD 1R4NI 2JU6X 3LXFA 4LNFA 4HDQA 2KMCA 3N9YC 1FCLA 3PHXB 2DBYA 2O6VD 3R7RA 4IC7B 2OHFA 4B6WA 2WXNA 2BYVE 4RGOS 3ZDMC 3DPDA 4F1SA 4EUTA 3NVYA 4KIKA 1Y56A 1RRBA 1V80A 2BB6A 4PYZA 2NPTB 3CSTA 3R8BA 4LNOA 4F8CB 1V5TA 2KJHB 4XYCA 3VTWA 1TKEA 2RDBC 2FCQA 3JSVB 2IO2B 1FMAD 1WI0A 2KVRA 2BWES 5CHWA 2HD5B 1C4PA 3Q8BA 3P2BA 4WURA 1C76A 2M19A 2A5UA 4C7YA 4GIVA 1J0GA 2KZRA 2K6DB 5LXHA 2RSUA 4K81A 1GPXA 2KACA 3AEAB 1ISNA 3PS6A 1ZW7A 2V0GA 3AE6B 2GOWA 2N1VA 2KN5A 2NTSA 1E8WA 4A8XC 1C4CA 4PK1A 4ANXA 2H89B 3AECB 1WMHA 3ALBA 5C2TB 2QDFA 2JYTA 3QWZB 4YL8A 3MC9A 4E74A 2NR2A 2PVGC 3AEBB 1XEEA 4ANWA 4HDOA 1E5WA 1XLNA 4JLCA 1VR9A 5EE9A 2G4DB 4FULA 2W9NA 2ZNVB 4FXCA 5C1ZA 3U30A 2R2OA 3FILB 4C4VA 3T9LA 1VZ6A 1TT5B 1OGWA 1Q5WB 3MC8A 3NS8A 1BXTA 3T3OA 2KYWA 2L32A 3NVVA 3AU5A 1GOZA 1SIFA 4YTNB 3NY5A 1ET6A 4RGMA 5HI1A 2RR9A 1FPYA 3VH4B 3IBEA 2PE9A 4FJZA 2BYFA 2WU2B 3B1LX 2PMVA 1U4AA 2D3GA 4XGAB 4HLEA 3APCA 3Q69A 3ZNID 1QF6A 2DNFA 2IO3B 1EU3A 2BS3B 4PYUA 3TBLD 2KX3A 1UBQA 2LZ6A 2N7JA 2DZIA 1HTQA 4KDIC 1IBXA 4AP4C 3UQBA 3IXSA 2G45B 2KLCA 4FJVB 3PSEB 2WDTB 4PT5A 1WX9A 4URKA 1P3QU 3PTFC 3RULA 4XX5A 4FJYA 3HM3A 4L2YA 4S17A 3CIRB 2WXOA 4M01A 3ENEA 1WR1A 3Q3MC 1SE4A 2KHWB 1B1ZA 2N9EB 1QOBA 3Q8CA 1IBXB 4AJWA 1WM3A 2KJRA 2KAJA 2L0FA 1E6EB 4W9HA 4NJCA 4P1CC 2I38A 2GRIA 1YMHE 1ZDVA 5AUKA 4D2KA 1T0QC 1CK1A 3R7QA 3B08A 2AL3A 4KSKC 3AE9B 3K9OB 4P16A 1NENB 2B76B 1EUVB 3L54A 1GUAB 2C7NB 4US8A 1LXDA 3AI5A 2GBNA 1SF0A 2DYMA 4HEA1 1VDVA 4A3OA 3W5VB 1T0YA 1FXAA 1LGRA 3O65B 4IM0A 4NJ7A 4DWFA 3VDZA 3WAOA 3VUYA 2MRPA 4ZRKA 3DBLB 3VRBB 3QX1A 1IYFA 3PZDA 1SB3C 2KOXA 4HPLB 3JYUA 2N9PC 3RCZA 1I4HA 2K1FA 2JQRB 5HG2A 1E7VA 4HROA 2QJLA 4TMAB 2ONQA 1YOVB 1HE8A 4RF1A 4JQWC 1E7UA 3ZVVA 2K22A 3DBRI 3I63C 1EU4A 2M17A 2FUHB 4C56C 2HDEA 3C0RB 2DAJA 2NTTA 3KUCB 1LM8B 2VZKD 2BS4B 1HZ5A 3PRMB 2NBWB 1L6VA 3QK0A 3DHHC 3QIJA 3ZNGC 1NEKB 1X1MA 3L4PA 3H8HA 3Q3OC 4W9FA 5D94A 1OQQA 4W9EA 2FCNA 2LD9A 1YN3A 3KYCD 3HUIA 1QKZA 1YQ3B 1N62A 5KHQA 1KLUD 4NPNA 1Y8RC 3H7SA 2ZW0A 4BVUC 1LQBA 3BVMA 3J9CA 5BMIA 4XDCA 3DBLI 5IKCM 4N59A 1RAXA 3RNEC 2DYBA 1A5RA 4II3B 1XT9B 1JWUD 1SJED 4NZLB 5BO4B 1SEBD 4NQKE 4W9IA 5IO9A 2MX2A 2QHOA 4DHZB 3EECA 2N9KA 1WMHB 1CZPA 1F52A 4LCDE 2C5LC 1JMLA 3AEDB 2K8CA 2WXGA 1KTKA 2DHZA 4GN1A 4KIKB 5I4DA 4WJOA 2PW9A 1QOFA 3RMKC 2BF8B 3W1YA 4FHKA 2CR5A 4A90A 1V1PA 3NG0A 1H8CA 3P4SB 1ZXHA 4IWOA 2LVPA 3DBHI 5L83A 3X0WA 1DOXA 2LUMA 3QJZA 1WGKA 1PFDA 1C9FA 4OZCA 3NZSA 3LYYA 3MHSD 3I57A 3UINB 1XXGA 3SD5A 3MJ5A 3PZ7A 2D3CA 1RM6C 1QLBB 2XN9C 4YSXB 2V3PA 1DYQA 1GJZA 2MCNB 3TEWA 2LGXA 3X23A 2G3QB 3NZUA 2OJWA 3P1MA 1TKYA 2WXIA 3ZUNA 2INCC 1YQBA 3K9PB 3Q3NC 2LXAA 4DDID 5DCNA 3WALA 2BKFA 1XD3B 2MJEA 4BBNF 4IWPA 4BZAA 1QZEA 1JROA 4AWJA 1JWAD 2KWUB 1E8ZA 3MC0B 4GMVA 3IFWB 2LHDA 3PV1A 1Q0WB 1G6JA 1K50A 4TQ0A 1UD7A 2KMAA 1WR6E 2MA9B 2NVUI 1VCBA 1RFAA 2LI5A 1P98A 1J7AA 4M8MA 4W9CA 1GC6A 5GMVA 3A1QA 3B2FA 2PPHA 1WXVA 1V1PB 3UIOB 4RF0A 4BAXA 2L0TA 4W9JA 3ZKJC 3P4QB 2LGDA 3GS2A 2KJ6A 4HCNB 3I5JC 2MJ3A 4BKTA 3AULA 3AMZA 3OG5A 2I2YA 2OEDA 3AE5B 1ROEA 1QOAA 4O1NA 1OEYA 3NS1A 2LGSA 2WDRB 3VQIA 1MJDA 1VRAB 2QEJC 3BVZA 2JRHA 1I4XA 2D07B 4F7ZA 3ZGZA 3B0AA 3EFUA 1XO3A 1XLQA 2KVZA 2RPQA 4WJNA 2Z0DB 2D10A 4ANVA 3W1SC 1V97A 3QC8B 4MT5A 2W54A 2RPVA 2INPE 4M0WB 4ASWC 1JWSD 1H4RA 1VJKA 3QCAA 1PUTA 2GLSA 3VUWA 2ZPNA 4DK5A 1FNVA 3P42A 4BFRA 4ICUA 2IGGA 3PHWB 3AV8A 4K3BA 4CQNA 4AJYB 4BKSD 2ZNVC 1TKGA 2W82A 4JWSC 2O6VB 1L0YB 4RFBA 1NVID 3H1UA 3H9DA 2CHWA 4PS8A 4XWWA 1NDDA 2D3AA 3HRDD 1F9JA 3SEBA 3VUXA 1SE2A 4GDKB 4C80A 2BT6A 2V9HA 1NI3A 2KQSA 4HK2A 2ZCBA 3TIXA 1UNSA 2PIAA 3V62A 4B95A 1BMLC 3KWLA 3ZRCA 5AUIA 5JHBA 3ZNHB 2W3SA 1AWDA 3RD2A 4JE3B 2LFIA 1WWTA 3U4EG 4FADA 3A4SC 3GZNB 2K8HA 5BYRA 4OHJA 3QQ8B 4TUUA 2M0AA 3A9JA 1F77A 3NVWA 4B0MA 2V4LA 5GXGB 4NNJB 3V61A 3QAQA 2KDMA 3IAS1 3ZQ4A
chains in the Genus database with same CATH topology
1L0VB 3EUB2 4J3OD 1VZ7A 3W2DA 2Y3AA 4HRSA 3MFGA 2V4IB 4WH4A 3P4PB 2DWQA 2LEKA 3Q69A 2M56B 2XNAC 1QF6A 1I4QA 1PYWD 1FXIA 1FRDA 3AE8B 1EU3A 2AQ2B 5FK9C 2BS3B 4OVZA 2N7JA 1EWYC 4IKGA 1IBXA 3Q8FA 3IXSA 2WXKA 1T5XD 1PGBA 1QILA 3URYA 1XLOA 3ZJTA 4PT5A 1FNWA 4P6VF 4RNAA 3V05A 2WXRA 3BVGA 4ZHPA 1TS5A 3LB8C 4Q2JA 3IT4B 4L2YA 5G5HA 1YN4A 1UUPA 3CIRB 4C7ZA 2WXOA 2WDQB 3Q8EA 1HQRD 1K52A 1I4RA 3IAS1 2GI9A 3TEXA 3ZJUA 1SE4A 1B1ZA 4RH6A 3E9SA 1FFUA 2W3RA 3BYTB 2WXPA 3U2SC 2X38A 1QOBA 2GB1A 3Q8CA 1IBXB 1DOIA 1MPEA 2QSDA 4NAMA 2KAJA 2K9XA 2AQ3B 1E6EB 1JCKB 1F2RC 1VZ8A 2MH7A 2CJNA 3BYYB 1C78A 4NAWB 4NJCA 2E6XA 2I38A 2GRIA 1YMHE 1ZDVA 5AUKA 4D2KA 1CK1A 5HHDG 1YQ4B 1XF5L 4KKIA 4A9AA 3AE9B 1YNTE 1UGJA 1L6UA 1NENB 3IT6B 4P16A 2BS2B 2FUG1 4WAFA 4WWMA 2B76B 2SAKA 4N6EB 2LHEA 4REZA 4US8A 5H8YE 5H92C 1WYGA 5JXVA 1SF0A 2DYMA 3MHZA 1J7BA 1K51A 4HEA1 1VDVA 2K3UA 1SBBB 1PDXA 1N5WA 4DXFA 3W5VB 1MHXA 1GB1A 1FXAA 1JWBD 2KWDA 1P7FA 1XCTL 2L83A 4ARIA 2G1EA 4A6QA 4IOIE 2WXLA 2WXHA 2CU3A 3ABVB 3VRBB 4OZBA 2JSVX 2R61A 1NYQA 1ZOYB 1JRPA 2KQ4X 3B2GA 1KFYB 3E56A 1SB3C 2W55A 3AEGB 1I4HA 2JQRB 5HG2A 5MPOA 4HROA 3VRAB 4ZYSA 2QJLA 4LTUA 4TMAB 1RWSA 2CJOA 2ONQA 1ET9A 1QT9A 4XE0A 4RF1A 1EWCA 1OFFA 3P4RB 4KGTA 2ZW1A 1STEA 2BBCA 2K22A 3KQ4A 2BYTA 4B0EA 5BYSA 2WXJA 1EU4A 4HKZE 4C56C 2HDEA 4OZAA 4ITKA 1UWXA 2H88B 2KN4A 4OW0A 2NTTA 2QILA 4KX6B 1IUEA 1PGAA 2ICIA 3AE2B 3KLSX 1ZE3D 2VZKD 2BS4B 5C3JB 2KMMA 1C79A 1HZ5A 1N5XA 1L6VA 1YJIA 1FM0D 1WSPA 2RDGA 1KF6B 1M4VA 4HJGE 1T6BX 1MHHE 1NEKB 4R3DA 3L4PA 1TY2A 3H8HA 1N60A 3EGRA 1V8CA 1OQQA 2E3TA 1OQRA 2WLBA 1YN3A 3WCQA 3HUIA 3UI3A 1QKZA 2PVOD 1YQ3B 2J4XA 1BUIC 1N62A 3SFDB 1TY0A 1JWMD 1KLUD 2LMCA 1FCCC 1E10A 1HZ6A 1SXTA 2ZW0A 3KWVA 2L52A 3B9JA 4L23A 2EELA 3BVMA 2LJIA 3J9CA 1JW9D 3OWEB 4XDCA 5BMIA 4N59A 2AX5A 2ON8A 2WNMA 5EE0A 1FFVA 3HVZA 3C8YA 1JWUD 1SJED 4NZLB 4HKQA 1SEBD 1QOGA 1I4PA 4XWTA 1TS4A 2RDHA 1L4DB 2TSSA 2PLPA 3AH7A 1CQVA 2ACZB 3R2TA 1NYRA 3U52E 2EKIA 3NVZA 1WXQA 2N9KA 4TSSA 2DLBA 4KGSA 1CZPA 4WQMA 2WP9B 3BZDB 2FBWB 1JMLA 1YN5A 2YEPB 4ZRPA 3AEDB 1JQ4A 4KGRA 2WXGA 1I7HA 5E6JA 1IGDA 1KTKA 2FE8A 1RFKA 3RPFC 5I4DA 4USAA 1MVKA 1SSNA 2JYEA 2PW9A 3O13A 1KLGD 1QOFA 2Y5CA 3GP7A 5EE1A 1SJHD 4A90A 1V1PA 2N0SB 4US9A 3EA6A 1CJEA 5FR3A 2D5GA 3P4SB 3CWIA 1ZXHA 4ZRQA 1T3QA 3AE4B 2WXMA 1J7CA 1DOYA 3MP9A 4YT0B 1D5XC 3AM9A 1DOXA 1IGCA 1ZXIA 2LUMA 4YWGG 1WGKA 1PFDA 4ZOHC 1C9FA 3SFEB 4OZCA 3LYYA 1F0ZA 5T8IA 3PZ8A 5LNK1 1KRHA 1AW7A 2WQYB 3I57A 3AE7B 1XXGA 3V3XA 1GAQB 3VR8B 1N61A 3MJ5A 5HFYA 1HA5A 2IGDA 2J53A 2QIEB 2SEBD 3DWGC 3PZ7A 4EE2A 4N58A 2IJ0A 1FIQA 2Q5WD 3Q8AA 1RM6C 1QLBB 4XDDA 2XN9C 3W1SA 1ENFA 4YSXB 2V3PA 4YXDB 1E0ZA 1TZOA 1DYQA 2N9LA 4IDIA 1MI0A 2WXQA 5D7GA 3TEWA 2PTLA 2J52A 5D3IB 1XCQL 3PO0A 4KKJA 3ZJVA 1ZDXA 1HXYD 3P1MA 3TUOA 2JX5A 5FKAC 1TKYA 2WXIA 1FEHA 4MH8A 1AN8A 4RGTA 2V3NA 2Y5PA 4MM3B 2MJEA 3FILA 3TEZA 5TSSA 1JROA 4WIPA 4LLGM 1JWAD 3MC0B 2NMQA 3ZQ4A 1FRRA 2LHDA 3VR9B 3W9CB 1PGXA 1WRIA 3TSSA 2WS3B 1K50A 2PKOA 4TQ0A 2Z8LA 2L1AA 3BIID 4YSYB 2BTEA 3BK2A 4AQ7A 2BW2A 3AEFB 2MJDA 3DWMA 3AN1A 1J7AA 1UWMA 3FAHA 5BMGA 3B2FA 2G9HD 2JU6X 5G5GA 2WDVB 1D4BA 3LXFA 3ZYYX 1V1PB 3AEEB 3BK1A 2K0PA 1DGJA 1TS3A 1B9RA 3IAM1 3AB5A 4RF0A 4YSZB 3T3NA 3ETRA 3N9YC 3R2IA 1FCLA 5D3DA 1FD6A 1TJEA 2DBYA 3P4QB 2J42A 1A70A 1RYJA 2OHFA 2INNE 2WXNA 3GS2A 4M0WA 4JPSA 4RGOS 2MJ3A 2RMMA 2DYOA 3NVYA 4RCOA 3AMZA 1Y56A 3W5UB 4L1BA 2I2YA 2OEDA 3AE5B 1ROEA 3U7ZA 1QOAA 4O1NA 2BB6A 2JWUA 1L5PA 1HEZE 3R8BA 1TKEA 2IDYA 3P63A 1ESFA 1FNUA 1FMAD 3NS1A 1P7EA 2WDRB 3VQIA 1C4PA 1VRAB 3AE3B 3Q8BA 4WURA 2QEJC 3BVZA 1C76A 2M19A 2YEPF 1I4XA 3ZGZA 4C7YA 1L0XB 1XO3A 4DXGA 1XLQA 5BYQA 5EE3A 1GPXA 1V97A 2KACA 2W54A 2RPVA 4MT5A 2INPE 4UDUC 4GLSC 3AEAB 2JXTA 1D6EC 2MEKA 1JWSD 4MACA 2HTME 1VJKA 4JX1C 1PUTA 2V0GA 1F2RI 3AE6B 2K5PA 1K53A 2NTSA 1EM7A 4YTPB 1FNVA 3P42A 1ZP0B 2LGIA 1XLPA 4A8XC 2IGGA 1C4CA 1V1OA 3FC4A 4ARCA 2H89B 3AECB 3AV8A 1TS2A 2JZPA 1ZUD2 4CQNA 1LO5D 1SIJA 3TEYA 1TKGA 2W82A 4JWSC 4RFBA 1L0YB 1NVID 5C2TB 5BMHA 1FO4A 1N63A 1D5ZC 2VZKB 1KH0A 3GB1A 4YTMB 2BB5A 2JYTA 3RFZB 4XWWA 2IGHA 2QMTA 3NZ3A 3HRDD 3NRZA 2PVGC 3AEBB 3SEBA 1XEEA 1GB4A 3NUHB 1SE2A 1XLNA 4GDKB 4C80A 3AE1B 2BT6A 4A55A 1VR9A 1NI3A 5EE9A 2AQ1B 4DQOC 1UNSA 2PIAA 4FXCA 1BMLC 1E9MA 2WU5B 3KWLA 3FILB 1C4AA 5AUIA 3SR6A 1L4ZB 4GDLB 1QQRA 2W3SA 1AWDA 1VZ6A 1TYGB 4JE3B 1C77A 3HVDA 4TQ1A 2WXFA 4AS1A 1Q10A 1YJJA 2LFIA 1AYFA 1BXTA 1WWTA 3U4EG 1VLBA 3T3OA 2IPKD 2L32A 1R7SA 4RGNA 3I9V1 3BWUD 3NVVA 1GOZA 4JWUC 1JALA 4YTNB 5BYRA 4OHJA 1ACCA 4H2AA 2M0AA 1ET6A 4RGMA 5HI1A 4ZHOA 1F77A 3NVWA 4B0MA 4LK0M 5GXGB 1ZPSA 1SE3A 1I4GA 1D5MC 2WU2B 2KDMA 1E7PB 2PMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP9 A;  5HG2 A;  1IGC A;  2JWU A;  2LUM A;  1HEZ E;  2ONQ A;  1C9F A;  4OZC A;  4KGT A;  2ZW1 A;  4WH4 A;  1P7E A;  3V3X A;  5HFY A;  2IGD A;  2J53 A;  4HKZ E;  4OZA A;  1UWX A;  2KN4 A;  1PGA A;  2N9L A;  1MI0 A;  2N7J A;  2PTL A;  2J52 A;  4IKG A;  2KAC A;  1IBX A;  1XCQ L;  2RPV A;  4GLS C;  2JXT A;  4MAC A;  1HZ5 A;  1PGB A;  1F2R I;  4HJG E;  1MHH E;  1K53 A;  1EM7 A;  2LGI A;  2IGG A;  3UI3 A;  1QKZ A;  3FIL A;  1K52 A;  2JZP A;  1FCC C;  1HZ6 A;  2GI9 A;  2NMQ A;  2ZW0 A;  2LHD A;  1PGX A;  5BMH A;  2GB1 A;  1IBX B;  1KH0 A;  2EEL A;  3GB1 A;  5BMI A;  1K50 A;  1MPE A;  2QSD A;  2ON8 A;  2IGH A;  2QMT A;  1F2R C;  1GB4 A;  2I38 A;  4D2K A;  1YMH E;  5HHD G;  1XF5 L;  5BMG A;  1YNT E;  2PLP A;  2JU6 X;  2N9K A;  1D4B A;  4KGS A;  3FIL B;  2LHE A;  2K0P A;  5JXV A;  1JML A;  4KGR A;  1K51 A;  1IGD A;  1FCL A;  1FD6 A;  1Q10 A;  1MVK A;  2PW9 A;  1MHX A;  1GB1 A;  2KWD A;  1P7F A;  1XCT L;  4IOI E;  5HI1 A;  2RMM A;  4OZB A;  2JSV X;  1ZXH A;  2KQ4 X;  2KDM A;  2I2Y A;  2OED A; 
#chains in the Genus database with same CATH topology
 3ZLZ A;  2CS4 A;  5CX3 A;  2MHJ A;  2Y3A A;  4K7S A;  2EMS A;  3RNG C;  5D2M B;  1OEY J;  3OJ3 A;  2MBQ A;  1FRD A;  3PPA A;  1UBI A;  4OVZ A;  2MP2 B;  3V6C B;  2BYE A;  2K39 A;  3A9K B;  3URY A;  3ZJT A;  4MGZ E;  4ZRI A;  3TL5 A;  2IO0 B;  1TS5 A;  4S0R A;  3DDC B;  4C7Z A;  3S2A A;  1K52 A;  2GI9 A;  3ZJU A;  2GBR A;  2X38 A;  4TV3 A;  4W9L A;  2GB1 A;  4MSM B;  1YX6 B;  1WJU A;  5IOI A;  4EOY A;  2HE7 A;  2K6Q A;  1VZ8 A;  3EHV A;  1MG4 A;  2DAF A;  2J0M A;  1C78 A;  1IPG A;  3CMM B;  2E6X A;  1WF9 A;  4EZL A;  5HHD G;  4KKI A;  1YNT E;  1UGJ A;  3IT6 B;  2FUG 1;  1P1A A;  2LHE A;  4REZ A;  5H8Y E;  3UF8 A;  5H92 C;  5JXV A;  4MSQ B;  3MHZ A;  1K51 A;  1PDX A;  1N5W A;  1GB1 A;  4K7U A;  2KWD A;  3A1Q B;  2L83 A;  4ARI A;  1WGD A;  2G1E A;  3Q14 C;  2WXH A;  2DZJ A;  4GXB A;  3TMP B;  3ABV B;  2KDB A;  1NYQ A;  1JRP A;  3AEG B;  1WJN A;  3Q3J A;  1I42 A;  2I1J A;  4FN2 A;  5MPO A;  2C7M B;  4ZYS A;  3ECI A;  3DVG X;  1RWS A;  1XQQ A;  3IG3 A;  2L05 A;  1IP9 A;  3A33 B;  1QT9 A;  1OFF A;  3QHT A;  2BBC A;  2JVC A;  2KLG A;  3SDL C;  3DVN U;  3OAW A;  4DXA B;  2H88 B;  2KN4 A;  2FAZ A;  2QIL A;  4KX6 B;  1UZX B;  1V49 A;  5DPT A;  3KLS X;  4RM8 A;  3A9J B;  1ZE3 D;  4FA6 A;  5C3J B;  2KMM A;  1WYW B;  1N5X A;  1YJI A;  1WSP A;  1M4V A;  4JIO U;  4LDT D;  1T6B X;  4JGH B;  2MP2 A;  2X8X X;  1TY2 A;  3VTU A;  2FCM A;  2E3T A;  1OQR A;  3EFC A;  3ZXR A;  3WCQ A;  2PVO D;  4FBJ B;  2J4X A;  4N9F 4;  1SE9 A;  3SFD B;  2N9X A;  1TY0 A;  1JWM D;  2LMC A;  1EO6 A;  1SXT A;  2CHX A;  4PS7 A;  2NBU A;  4IG7 B;  4TKN A;  5LXI B;  4LNN A;  2NPT A;  2LJI A;  4HPM B;  2ON8 A;  4RMA A;  3QAR A;  3ZNZ B;  3VFK A;  4MJS A;  4HKQ A;  1QOG A;  4W9G A;  1TS4 A;  4MEL A;  2TSS A;  4MM3 A;  3RNB C;  5EDS A;  2LVO A;  3R2T A;  1NYR A;  1WX7 A;  3NVZ A;  1WXQ A;  2LUE A;  4KGS A;  5E6O A;  4WQM A;  4HWI B;  3BZD B;  2PEA A;  4K7W A;  1YN5 A;  2YEP B;  3CF6 E;  4ZRP A;  1HTO A;  4KGR A;  1WRD B;  2FE8 A;  1RFK A;  3Q2A C;  3O13 A;  1KLG D;  1TGZ B;  2XEW A;  2Y5C A;  1OQY A;  3GP7 A;  3HHM A;  3Q3F A;  4M00 A;  4BOS C;  4US9 A;  5FR3 A;  2PJH A;  2O2V A;  2K8B A;  1L7Y A;  1T3Q A;  3AM9 A;  2LJ5 A;  3NJT A;  1MFW A;  1KLV A;  4EZJ A;  5AZH A;  2MWS B;  2QC8 A;  2M4N A;  1HA5 A;  2IGD A;  4WJQ A;  5HKH A;  1FIQ A;  1P0R A;  3W1S A;  1E0Z A;  4A20 A;  3WIM A;  4IDI A;  2MQJ A;  5D7G A;  2PTL A;  3VHT C;  1WY8 A;  2ZCC A;  4WAA A;  1XCQ L;  3M62 B;  3PO0 A;  4ZRJ A;  2JX5 A;  1L2N A;  1FEH A;  1AN8 A;  2V3N A;  3N30 A;  5J2R A;  4LNI A;  5TSS A;  3TJP A;  4LLG M;  1V6E A;  4P7I A;  2NMQ A;  2OJR A;  3ZIM A;  4MEM A;  3NHE B;  3TSS A;  2PKO A;  4YSY B;  5JZE B;  2BTE A;  3JSV A;  1WGY A;  1V9J A;  2N1W A;  4QAY A;  3DWM A;  1WE7 A;  2KD0 A;  1WXA A;  2N7D A;  4WWP A;  1D4B A;  2JF5 A;  2KDF B;  3ZYY X;  3BK1 A;  2K0P A;  1DGJ A;  2KWC A;  2KT7 A;  3IAM 1;  1VD2 A;  1FD6 A;  3GE3 C;  2IZV B;  1PQS A;  1A70 A;  2INN E;  4JPS A;  3D32 A;  2UU7 A;  2RMM A;  2A4Z A;  1UEL A;  1WE6 A;  4RCO A;  1T0R C;  4EKU A;  3W5U B;  2LXC A;  2KDE B;  4WWN A;  2JWU A;  2Z0E B;  3ZRF A;  3P63 A;  1FNU A;  4LDT B;  4M8N A;  2PE6 B;  4I6N B;  1V5O A;  3AE3 B;  4NJ6 A;  4KZC A;  4IM2 A;  3MTN B;  2KFK B;  4HXD A;  4DXG A;  3UQA A;  5G5H A;  2GBJ A;  2AL6 A;  2JXT A;  1D6E C;  2MEK A;  5CTR C;  2HTM E;  2YLM A;  3BY4 B;  3UGB B;  1EM7 A;  4YTP B;  4MDK E;  2LGI A;  1TBE A;  5IA7 A;  4C4V B;  1V1O A;  4ARC A;  2QCZ A;  1TS2 A;  2JZP A;  1ZUD 2;  1LO5 D;  1SIJ A;  3TEY A;  3GZN I;  1WX8 A;  2C9W B;  5JHA A;  3OLM D;  1D5Z C;  2VZK B;  1KH0 A;  3GB1 A;  2BB5 A;  4NAW A;  2IGH A;  2QMT A;  3IHP C;  2D11 A;  2VH1 A;  3NRZ A;  2JXX A;  3H7P B;  4BKG A;  3AE1 B;  3Q6B A;  1TZ1 A;  2AQ1 B;  1E9M A;  2WU5 B;  3SR6 A;  1L4Z B;  1QQR A;  4ZDV A;  4MH0 E;  3RZF A;  1C77 A;  4TQ1 A;  3HVD A;  2MBO A;  1Q10 A;  1AYF A;  1VLB A;  2IPK D;  4GSW A;  1R7S A;  4RGN A;  3I9V 1;  4JWU C;  1JAL A;  1ACC A;  4ZHO A;  1ZPS A;  1SE3 A;  1D5M C;  1V86 A;  3ONS A;  3EUB 2;  5G55 A;  3UIP B;  2JWZ A;  4J3O D;  4E71 A;  3W2D A;  1Z2M A;  3MFG A;  4WH4 A;  4WQO B;  5TR5 A;  3P4P B;  5DPR A;  2DWQ A;  2LEK A;  2XNA C;  4KZ0 A;  1I4Q A;  5C23 A;  1PYW D;  1F1H A;  3AE8 B;  4K1R B;  2AQ2 B;  3ZDT A;  5FK9 C;  2VRR B;  5JH5 C;  2RGF A;  1EWY C;  3Q8F A;  1LFD A;  1KOT A;  1T5X D;  3KW5 B;  3PRZ A;  3HIZ A;  4RM9 A;  4P6V F;  1NBF C;  3DBR B;  4RNA A;  2WXR A;  4EZK A;  4ZHP A;  1JRU A;  4Q2J A;  3IT4 B;  1YN4 A;  1UUP A;  1KJT A;  3Q8E A;  2KWV B;  3APF A;  3R66 C;  1UF0 A;  2WXP A;  3DVN V;  4LNK A;  2QSD A;  2ZJD A;  4NAM A;  2K9X A;  2AQ3 B;  2DX5 B;  1JCK B;  1F2R C;  1GNU A;  2CJN A;  2MH7 A;  3BYY B;  1WJ6 A;  2JZ3 B;  3VVW B;  1RLF A;  3AXC A;  1YQ4 B;  2GBK A;  4A9A A;  1L6U A;  2FIF A;  2BS2 B;  3KH0 A;  4WWM A;  3VAW A;  2SAK A;  1CMX B;  4IUM B;  1WYG A;  1J7B A;  5AZF A;  2K3U A;  1MG8 A;  4DXF A;  1MHX A;  3N32 A;  1JWB D;  1P7F A;  3DQV A;  1XCT L;  4IOI E;  2NS5 A;  4OZB A;  2ZVN A;  2R61 A;  1WIA A;  1ZOY B;  3B2G A;  1KFY B;  2W55 A;  3I3T B;  2GMI C;  1WFY A;  3VRA B;  4LTU A;  5J18 A;  1ET9 A;  2AYO B;  3P4R B;  2ZW1 A;  5FR6 A;  4B0E A;  3RYT A;  2WXJ A;  4IW0 A;  4OZA A;  3DBH B;  3HK0 A;  3AE2 B;  4BOZ B;  2O2V B;  4CYE A;  3ZTD A;  1FM0 D;  1KF6 B;  4CHK A;  2WHI A;  1MHH E;  4ICV A;  4R3D A;  4EFO A;  1V81 A;  1N60 A;  1V8C A;  2L7R A;  2WLB A;  3UI3 A;  1BUI C;  4HCP B;  2KK8 A;  1FCC C;  2FID A;  1HZ6 A;  2IYD B;  2ZEQ A;  2HJ8 A;  2M0X A;  2L52 A;  1WGR A;  5CHV C;  1TIF A;  4L23 A;  4MJS B;  5LLI A;  4EEW A;  1WGH A;  2WNM A;  5EE0 A;  1FFV A;  3HVZ A;  2IO1 B;  3C8Y A;  4HVB A;  2DZM A;  2LWP A;  2FNJ B;  3OJ4 B;  1GG3 A;  3AU4 A;  4XWT A;  1T0S C;  2RDH A;  1CQV A;  3RNF C;  2EKI A;  2DLB A;  4KV2 A;  3DHI C;  3RI7 C;  5E6J A;  3RPF C;  1WJ4 A;  1SSN A;  3ZXV A;  2JYE A;  3ZO5 B;  3PGE A;  2KNB A;  2KC1 A;  2OOB B;  1WXM A;  4AUQ C;  1ZKH A;  1K8R B;  4ZRQ A;  3V6E B;  2WXM A;  1J7C A;  1DOY A;  3MP9 A;  4KDL B;  1D5X C;  1ZXI A;  1D3Z A;  1V2Y A;  5T8I A;  3PZ8 A;  3R3M A;  5LNK 1;  2WQY B;  1GAQ B;  2MLB A;  1N61 A;  3H6N A;  2J53 A;  2SEB D;  2L76 A;  3DWG C;  2IJ0 A;  3Q8A A;  2IY1 B;  2ZVO A;  2MBH A;  1C1Y B;  3QA8 A;  2JZZ A;  2N9L A;  1MI0 A;  2BWF A;  2J52 A;  2B3A A;  5AEK B;  2KQ7 A;  3ZJV A;  3PLU A;  3TUO A;  1HXY D;  1YD8 U;  3NOB A;  2CHZ A;  3MJW A;  2REX A;  4MH8 A;  4RGT A;  3T8M A;  4M02 A;  5D6J B;  3PVL A;  3TEZ A;  3GE8 C;  1WZ0 A;  4WIP A;  4DBG A;  2L8J A;  5IP4 D;  2LRW A;  1E8Y A;  2YVC A;  3W9C B;  1PGX A;  2KKC A;  3N20 C;  3BII D;  3C19 A;  4CO7 A;  3DHG C;  3APD A;  3HM6 X;  4B9K A;  2RD0 A;  2BW2 A;  3AEF B;  3AN1 A;  1UWM A;  1AAR A;  3FAH A;  3VTV A;  5G5G A;  2KXJ A;  4G11 A;  2WDV B;  3AEE B;  3M3J A;  1TS3 A;  1B9R A;  3N1Y C;  3AB5 A;  4YSZ B;  3T3N A;  2EKE C;  3ETR A;  3R2I A;  2GBM A;  5D3D A;  1TJE A;  3WAP A;  2KX0 A;  2J42 A;  1RYJ A;  2KFJ A;  2AEH A;  4M0W A;  3DBS A;  2V1Y A;  3CSF A;  4IM3 A;  4HJK A;  2DYO A;  4HPP A;  4ACF A;  2K25 A;  4L1B A;  3U7Z A;  2Z59 B;  1YIW A;  1WGG A;  1L5P A;  1HEZ E;  2DEN B;  2IDY A;  5E6P A;  2LVQ A;  1ESF A;  1P7E A;  2YEP F;  1YJ1 A;  2MBE A;  1L0X B;  2WX0 A;  4XZ4 A;  5BYQ A;  2R2Q A;  4BBN C;  2DZK A;  5EE3 A;  1Z5S B;  4UDU C;  1BT0 A;  4GLS C;  4MAC A;  4JX1 C;  1F2R I;  2NCN A;  2XBB C;  2K5P A;  4G50 A;  1K53 A;  1ZP0 B;  1GC7 A;  1XLP A;  2BQQ A;  3RZW C;  3FC4 A;  2HTH A;  2WYQ A;  4XC2 A;  2BGF A;  2VH2 A;  3WA0 A;  4I6P A;  4IWQ A;  3PT2 B;  2J0J A;  4GDL A;  1TTN A;  2MSE D;  5CHF A;  5BMH A;  3PRE A;  1FO4 A;  1N63 A;  2XK5 B;  4YTM B;  2WGS A;  3RFZ B;  1E8X A;  3N1Z C;  1P9D U;  2N4F A;  4C00 A;  3M95 A;  3NZ3 A;  2BVC A;  3RUI B;  1GB4 A;  4OVV A;  3NUH B;  2LAS A;  4A55 A;  2KTR A;  2KAN A;  4DQO C;  1NI2 A;  4GU2 A;  3LDZ E;  1C4A A;  4OVU A;  5IAA C;  4GDL B;  1TYG B;  4JL9 A;  2JPH A;  2WXF A;  4AS1 A;  1YJJ A;  3RNA C;  4W9K A;  2C60 A;  3ZTC A;  3BWU D;  3L13 A;  2JRI B;  4H2A A;  5KHO A;  4LK0 M;  2J0K A;  4G0N B;  4X57 B;  1I4G A;  1M94 A;  3KVF B;  1E7P B;  3TCA A;  1L0V B;  2MBB B;  1VZ7 A;  4GDK A;  1OTR B;  4HRS A;  2NBV B;  2V4I B;  2UWQ A;  3WAN A;  1C3T A;  4MGK E;  2M56 B;  2N7E A;  1WXS A;  1FXI A;  3KUD B;  4BKS A;  3VXW A;  3RN9 C;  2L00 B;  2BKR B;  1N6Z A;  3ML9 A;  2M1M A;  2KO3 A;  4WWO A;  2BPS A;  3DCG A;  4IKG A;  2WXK A;  2L3Z A;  1PGB A;  1QIL A;  1XLO A;  2KC2 A;  1FNW A;  3LJ3 A;  3V05 A;  4G3X B;  3BVG A;  4DHJ D;  2AWT A;  2JY6 A;  3LB8 C;  3DOW A;  2WDQ B;  1HQR D;  3DVG Y;  1I4R A;  2D3B A;  4NQL B;  3TEX A;  3PLV A;  4RH6 A;  3E9S A;  1FFU A;  2ASQ A;  2W3R A;  3BYT B;  3U2S C;  4NY0 A;  1DOI A;  1MPE A;  3KYD D;  4K3C A;  2WX1 A;  4NAW B;  4ZYN A;  1WZ3 A;  1I35 A;  5E6N A;  1XF5 L;  2IBI B;  5AZG A;  2HJ1 A;  3L17 A;  2LRU A;  4WAF A;  5J17 A;  1SGH A;  4N6E B;  2JUO A;  3U7D A;  1SBB B;  5IN7 A;  2D2Q A;  4A6Q A;  2M8S A;  2WXL A;  5G2N A;  2CU3 A;  4J6I A;  1J19 A;  3H7P A;  2JSV X;  2KQ4 X;  3E56 A;  3A9K A;  4LJP B;  4PS3 A;  2ZPY A;  2CJO A;  4XE0 A;  1EWC A;  4GOC A;  2CU1 A;  4KGT A;  2J7Q B;  1STE A;  3KQ4 A;  2BYT A;  5BYS A;  1YX5 B;  4HKZ E;  4ITK A;  1UWX A;  2G4S A;  1Q1O A;  4OW0 A;  1IUE A;  1PGA A;  3M63 B;  2LGY A;  2ICI A;  2XK5 A;  2V3S A;  4W9D A;  1C79 A;  4KVG B;  3JW0 X;  2RDG A;  4MGY E;  4HJG E;  1FXT B;  4DDG D;  2FCS A;  2WWZ A;  3EGR A;  3SU8 X;  2KTR B;  4AOF A;  3BIN A;  1UH6 A;  1R4M I;  1E10 A;  4KSL C;  3KWV A;  4II2 B;  3B9J A;  4ANU A;  2KTF A;  2EEL A;  3OWE B;  1JW9 D;  4FHJ A;  2AX5 A;  2O6V A;  2EMT A;  4FLH A;  4P1B C;  1S3S G;  2JT4 B;  1EF5 A;  4WJP A;  1I4P A;  3PRP B;  4DHZ E;  3U8Z A;  3RNC C;  1L4D B;  2C7H A;  3L10 B;  2PLP A;  3AH7 A;  2ACZ B;  2ZZP B;  3WAM A;  3U52 E;  4TSS A;  4DHJ B;  2WP9 B;  2FBW B;  5L95 C;  1JQ4 A;  2IND C;  1I7H A;  4GB9 A;  1IGD A;  4I6L B;  4USA A;  1MVK A;  3A4R A;  2KDI A;  3V60 A;  3N3K B;  5EE1 A;  1SJH D;  2N0S B;  3EA6 A;  1CJE A;  3SHQ A;  3FKY A;  1E90 A;  2D5G A;  3CWI A;  4GGQ A;  3AE4 B;  4YT0 B;  1IGC A;  3EC8 A;  4LJO B;  4YWG G;  1R4M B;  4ZOH C;  3SFE B;  1J8C A;  1F0Z A;  3IVF A;  2Y5B B;  1KRH A;  1AW7 A;  1WM2 A;  3V3X A;  3AE7 B;  4E3C A;  5HFY A;  3VR8 B;  4EE2 A;  2UYZ B;  2QIE B;  4N58 A;  2Q5W D;  3GOE A;  1WH3 A;  3RT3 B;  4XDD A;  1ENF A;  3N1X C;  4YXD B;  1TZO A;  2WXQ A;  3ZW3 A;  5D3I B;  4KKJ A;  1EF1 A;  1ZGU B;  1ZDX A;  1S1Q B;  5FKA C;  1R4N B;  2MW5 A;  3L08 A;  2Y5P A;  4MM3 B;  4A3P A;  1KM7 A;  3FIL A;  3L16 A;  1FRR A;  2KFK A;  3VH3 B;  3VR9 B;  1WRI A;  2WS3 B;  2CKH B;  2Z8L A;  2L1A A;  3BK2 A;  3ML8 A;  3KUZ A;  2I1K A;  3JVZ X;  4AQ7 A;  4MGI E;  2MJD A;  5DPW A;  1UGM A;  2IY0 B;  3L0W B;  5DPS A;  5BMG A;  2G9H D;  1R4N I;  2JU6 X;  3LXF A;  4LNF A;  4HDQ A;  2KMC A;  3N9Y C;  1FCL A;  3PHX B;  2DBY A;  2O6V D;  3R7R A;  4IC7 B;  2OHF A;  4B6W A;  2WXN A;  2BYV E;  4RGO S;  3ZDM C;  3DPD A;  4F1S A;  4EUT A;  3NVY A;  4KIK A;  1Y56 A;  1RRB A;  1V80 A;  2BB6 A;  4PYZ A;  2NPT B;  3CST A;  3R8B A;  4LNO A;  4F8C B;  1V5T A;  2KJH B;  4XYC A;  3VTW A;  1TKE A;  2RDB C;  2FCQ A;  3JSV B;  2IO2 B;  1FMA D;  1WI0 A;  2KVR A;  2BWE S;  5CHW A;  2HD5 B;  1C4P A;  3Q8B A;  3P2B A;  4WUR A;  1C76 A;  2M19 A;  2A5U A;  4C7Y A;  4GIV A;  1J0G A;  2KZR A;  2K6D B;  5LXH A;  2RSU A;  4K81 A;  1GPX A;  2KAC A;  3AEA B;  1ISN A;  3PS6 A;  1ZW7 A;  2V0G A;  3AE6 B;  2GOW A;  2N1V A;  2KN5 A;  2NTS A;  1E8W A;  4A8X C;  1C4C A;  4PK1 A;  4ANX A;  2H89 B;  3AEC B;  1WMH A;  3ALB A;  5C2T B;  2QDF A;  2JYT A;  3QWZ B;  4YL8 A;  3MC9 A;  4E74 A;  2NR2 A;  2PVG C;  3AEB B;  1XEE A;  4ANW A;  4HDO A;  1E5W A;  1XLN A;  4JLC A;  1VR9 A;  5EE9 A;  2G4D B;  4FUL A;  2W9N A;  2ZNV B;  4FXC A;  5C1Z A;  3U30 A;  2R2O A;  3FIL B;  4C4V A;  3T9L A;  1VZ6 A;  1TT5 B;  1OGW A;  1Q5W B;  3MC8 A;  3NS8 A;  1BXT A;  3T3O A;  2KYW A;  2L32 A;  3NVV A;  3AU5 A;  1GOZ A;  1SIF A;  4YTN B;  3NY5 A;  1ET6 A;  4RGM A;  5HI1 A;  2RR9 A;  1FPY A;  3VH4 B;  3IBE A;  2PE9 A;  4FJZ A;  2BYF A;  2WU2 B;  3B1L X;  2PMV A;  1U4A A;  2D3G A;  4XGA B;  4HLE A;  3APC A;  3Q69 A;  3ZNI D;  1QF6 A;  2DNF A;  2IO3 B;  1EU3 A;  2BS3 B;  4PYU A;  3TBL D;  2KX3 A;  1UBQ A;  2LZ6 A;  2N7J A;  2DZI A;  1HTQ A;  4KDI C;  1IBX A;  4AP4 C;  3UQB A;  3IXS A;  2G45 B;  2KLC A;  4FJV B;  3PSE B;  2WDT B;  4PT5 A;  1WX9 A;  4URK A;  1P3Q U;  3PTF C;  3RUL A;  4XX5 A;  4FJY A;  3HM3 A;  4L2Y A;  4S17 A;  3CIR B;  2WXO A;  4M01 A;  3ENE A;  1WR1 A;  3Q3M C;  1SE4 A;  2KHW B;  1B1Z A;  2N9E B;  1QOB A;  3Q8C A;  1IBX B;  4AJW A;  1WM3 A;  2KJR A;  2KAJ A;  2L0F A;  1E6E B;  4W9H A;  4NJC A;  4P1C C;  2I38 A;  2GRI A;  1YMH E;  1ZDV A;  5AUK A;  4D2K A;  1T0Q C;  1CK1 A;  3R7Q A;  3B08 A;  2AL3 A;  4KSK C;  3AE9 B;  3K9O B;  4P16 A;  1NEN B;  2B76 B;  1EUV B;  3L54 A;  1GUA B;  2C7N B;  4US8 A;  1LXD A;  3AI5 A;  2GBN A;  1SF0 A;  2DYM A;  4HEA 1;  1VDV A;  4A3O A;  3W5V B;  1T0Y A;  1FXA A;  1LGR A;  3O65 B;  4IM0 A;  4NJ7 A;  4DWF A;  3VDZ A;  3WAO A;  3VUY A;  2MRP A;  4ZRK A;  3DBL B;  3VRB B;  3QX1 A;  1IYF A;  3PZD A;  1SB3 C;  2KOX A;  4HPL B;  3JYU A;  2N9P C;  3RCZ A;  1I4H A;  2K1F A;  2JQR B;  5HG2 A;  1E7V A;  4HRO A;  2QJL A;  4TMA B;  2ONQ A;  1YOV B;  1HE8 A;  4RF1 A;  4JQW C;  1E7U A;  3ZVV A;  2K22 A;  3DBR I;  3I63 C;  1EU4 A;  2M17 A;  2FUH B;  4C56 C;  2HDE A;  3C0R B;  2DAJ A;  2NTT A;  3KUC B;  1LM8 B;  2VZK D;  2BS4 B;  1HZ5 A;  3PRM B;  2NBW B;  1L6V A;  3QK0 A;  3DHH C;  3QIJ A;  3ZNG C;  1NEK B;  1X1M A;  3L4P A;  3H8H A;  3Q3O C;  4W9F A;  5D94 A;  1OQQ A;  4W9E A;  2FCN A;  2LD9 A;  1YN3 A;  3KYC D;  3HUI A;  1QKZ A;  1YQ3 B;  1N62 A;  5KHQ A;  1KLU D;  4NPN A;  1Y8R C;  3H7S A;  2ZW0 A;  4BVU C;  1LQB A;  3BVM A;  3J9C A;  5BMI A;  4XDC A;  3DBL I;  5IKC M;  4N59 A;  1RAX A;  3RNE C;  2DYB A;  1A5R A;  4II3 B;  1XT9 B;  1JWU D;  1SJE D;  4NZL B;  5BO4 B;  1SEB D;  4NQK E;  4W9I A;  5IO9 A;  2MX2 A;  2QHO A;  4DHZ B;  3EEC A;  2N9K A;  1WMH B;  1CZP A;  1F52 A;  4LCD E;  2C5L C;  1JML A;  3AED B;  2K8C A;  2WXG A;  1KTK A;  2DHZ A;  4GN1 A;  4KIK B;  5I4D A;  4WJO A;  2PW9 A;  1QOF A;  3RMK C;  2BF8 B;  3W1Y A;  4FHK A;  2CR5 A;  4A90 A;  1V1P A;  3NG0 A;  1H8C A;  3P4S B;  1ZXH A;  4IWO A;  2LVP A;  3DBH I;  5L83 A;  3X0W A;  1DOX A;  2LUM A;  3QJZ A;  1WGK A;  1PFD A;  1C9F A;  4OZC A;  3NZS A;  3LYY A;  3MHS D;  3I57 A;  3UIN B;  1XXG A;  3SD5 A;  3MJ5 A;  3PZ7 A;  2D3C A;  1RM6 C;  1QLB B;  2XN9 C;  4YSX B;  2V3P A;  1DYQ A;  1GJZ A;  2MCN B;  3TEW A;  2LGX A;  3X23 A;  2G3Q B;  3NZU A;  2OJW A;  3P1M A;  1TKY A;  2WXI A;  3ZUN A;  2INC C;  1YQB A;  3K9P B;  3Q3N C;  2LXA A;  4DDI D;  5DCN A;  3WAL A;  2BKF A;  1XD3 B;  2MJE A;  4BBN F;  4IWP A;  4BZA A;  1QZE A;  1JRO A;  4AWJ A;  1JWA D;  2KWU B;  1E8Z A;  3MC0 B;  4GMV A;  3IFW B;  2LHD A;  3PV1 A;  1Q0W B;  1G6J A;  1K50 A;  4TQ0 A;  1UD7 A;  2KMA A;  1WR6 E;  2MA9 B;  2NVU I;  1VCB A;  1RFA A;  2LI5 A;  1P98 A;  1J7A A;  4M8M A;  4W9C A;  1GC6 A;  5GMV A;  3A1Q A;  3B2F A;  2PPH A;  1WXV A;  1V1P B;  3UIO B;  4RF0 A;  4BAX A;  2L0T A;  4W9J A;  3ZKJ C;  3P4Q B;  2LGD A;  3GS2 A;  2KJ6 A;  4HCN B;  3I5J C;  2MJ3 A;  4BKT A;  3AUL A;  3AMZ A;  3OG5 A;  2I2Y A;  2OED A;  3AE5 B;  1ROE A;  1QOA A;  4O1N A;  1OEY A;  3NS1 A;  2LGS A;  2WDR B;  3VQI A;  1MJD A;  1VRA B;  2QEJ C;  3BVZ A;  2JRH A;  1I4X A;  2D07 B;  4F7Z A;  3ZGZ A;  3B0A A;  3EFU A;  1XO3 A;  1XLQ A;  2KVZ A;  2RPQ A;  4WJN A;  2Z0D B;  2D10 A;  4ANV A;  3W1S C;  1V97 A;  3QC8 B;  4MT5 A;  2W54 A;  2RPV A;  2INP E;  4M0W B;  4ASW C;  1JWS D;  1H4R A;  1VJK A;  3QCA A;  1PUT A;  2GLS A;  3VUW A;  2ZPN A;  4DK5 A;  1FNV A;  3P42 A;  4BFR A;  4ICU A;  2IGG A;  3PHW B;  3AV8 A;  4K3B A;  4CQN A;  4AJY B;  4BKS D;  2ZNV C;  1TKG A;  2W82 A;  4JWS C;  2O6V B;  1L0Y B;  4RFB A;  1NVI D;  3H1U A;  3H9D A;  2CHW A;  4PS8 A;  4XWW A;  1NDD A;  2D3A A;  3HRD D;  1F9J A;  3SEB A;  3VUX A;  1SE2 A;  4GDK B;  4C80 A;  2BT6 A;  2V9H A;  1NI3 A;  2KQS A;  4HK2 A;  2ZCB A;  3TIX A;  1UNS A;  2PIA A;  3V62 A;  4B95 A;  1BML C;  3KWL A;  3ZRC A;  5AUI A;  5JHB A;  3ZNH B;  2W3S A;  1AWD A;  3RD2 A;  4JE3 B;  2LFI A;  1WWT A;  3U4E G;  4FAD A;  3A4S C;  3GZN B;  2K8H A;  5BYR A;  4OHJ A;  3QQ8 B;  4TUU A;  2M0A A;  3A9J A;  1F77 A;  3NVW A;  4B0M A;  2V4L A;  5GXG B;  4NNJ B;  3V61 A;  3QAQ A;  2KDM A;  3IAS 1;  3ZQ4 A; 
#chains in the Genus database with same CATH homology
 1L0V B;  3EUB 2;  4J3O D;  1VZ7 A;  3W2D A;  2Y3A A;  4HRS A;  3MFG A;  2V4I B;  4WH4 A;  3P4P B;  2DWQ A;  2LEK A;  3Q69 A;  2M56 B;  2XNA C;  1QF6 A;  1I4Q A;  1PYW D;  1FXI A;  1FRD A;  3AE8 B;  1EU3 A;  2AQ2 B;  5FK9 C;  2BS3 B;  4OVZ A;  2N7J A;  1EWY C;  4IKG A;  1IBX A;  3Q8F A;  3IXS A;  2WXK A;  1T5X D;  1PGB A;  1QIL A;  3URY A;  1XLO A;  3ZJT A;  4PT5 A;  1FNW A;  4P6V F;  4RNA A;  3V05 A;  2WXR A;  3BVG A;  4ZHP A;  1TS5 A;  3LB8 C;  4Q2J A;  3IT4 B;  4L2Y A;  5G5H A;  1YN4 A;  1UUP A;  3CIR B;  4C7Z A;  2WXO A;  2WDQ B;  3Q8E A;  1HQR D;  1K52 A;  1I4R A;  3IAS 1;  2GI9 A;  3TEX A;  3ZJU A;  1SE4 A;  1B1Z A;  4RH6 A;  3E9S A;  1FFU A;  2W3R A;  3BYT B;  2WXP A;  3U2S C;  2X38 A;  1QOB A;  2GB1 A;  3Q8C A;  1IBX B;  1DOI A;  1MPE A;  2QSD A;  4NAM A;  2KAJ A;  2K9X A;  2AQ3 B;  1E6E B;  1JCK B;  1F2R C;  1VZ8 A;  2MH7 A;  2CJN A;  3BYY B;  1C78 A;  4NAW B;  4NJC A;  2E6X A;  2I38 A;  2GRI A;  1YMH E;  1ZDV A;  5AUK A;  4D2K A;  1CK1 A;  5HHD G;  1YQ4 B;  1XF5 L;  4KKI A;  4A9A A;  3AE9 B;  1YNT E;  1UGJ A;  1L6U A;  1NEN B;  3IT6 B;  4P16 A;  2BS2 B;  2FUG 1;  4WAF A;  4WWM A;  2B76 B;  2SAK A;  4N6E B;  2LHE A;  4REZ A;  4US8 A;  5H8Y E;  5H92 C;  1WYG A;  5JXV A;  1SF0 A;  2DYM A;  3MHZ A;  1J7B A;  1K51 A;  4HEA 1;  1VDV A;  2K3U A;  1SBB B;  1PDX A;  1N5W A;  4DXF A;  3W5V B;  1MHX A;  1GB1 A;  1FXA A;  1JWB D;  2KWD A;  1P7F A;  1XCT L;  2L83 A;  4ARI A;  2G1E A;  4A6Q A;  4IOI E;  2WXL A;  2WXH A;  2CU3 A;  3ABV B;  3VRB B;  4OZB A;  2JSV X;  2R61 A;  1NYQ A;  1ZOY B;  1JRP A;  2KQ4 X;  3B2G A;  1KFY B;  3E56 A;  1SB3 C;  2W55 A;  3AEG B;  1I4H A;  2JQR B;  5HG2 A;  5MPO A;  4HRO A;  3VRA B;  4ZYS A;  2QJL A;  4LTU A;  4TMA B;  1RWS A;  2CJO A;  2ONQ A;  1ET9 A;  1QT9 A;  4XE0 A;  4RF1 A;  1EWC A;  1OFF A;  3P4R B;  4KGT A;  2ZW1 A;  1STE A;  2BBC A;  2K22 A;  3KQ4 A;  2BYT A;  4B0E A;  5BYS A;  2WXJ A;  1EU4 A;  4HKZ E;  4C56 C;  2HDE A;  4OZA A;  4ITK A;  1UWX A;  2H88 B;  2KN4 A;  4OW0 A;  2NTT A;  2QIL A;  4KX6 B;  1IUE A;  1PGA A;  2ICI A;  3AE2 B;  3KLS X;  1ZE3 D;  2VZK D;  2BS4 B;  5C3J B;  2KMM A;  1C79 A;  1HZ5 A;  1N5X A;  1L6V A;  1YJI A;  1FM0 D;  1WSP A;  2RDG A;  1KF6 B;  1M4V A;  4HJG E;  1T6B X;  1MHH E;  1NEK B;  4R3D A;  3L4P A;  1TY2 A;  3H8H A;  1N60 A;  3EGR A;  1V8C A;  1OQQ A;  2E3T A;  1OQR A;  2WLB A;  1YN3 A;  3WCQ A;  3HUI A;  3UI3 A;  1QKZ A;  2PVO D;  1YQ3 B;  2J4X A;  1BUI C;  1N62 A;  3SFD B;  1TY0 A;  1JWM D;  1KLU D;  2LMC A;  1FCC C;  1E10 A;  1HZ6 A;  1SXT A;  2ZW0 A;  3KWV A;  2L52 A;  3B9J A;  4L23 A;  2EEL A;  3BVM A;  2LJI A;  3J9C A;  1JW9 D;  3OWE B;  4XDC A;  5BMI A;  4N59 A;  2AX5 A;  2ON8 A;  2WNM A;  5EE0 A;  1FFV A;  3HVZ A;  3C8Y A;  1JWU D;  1SJE D;  4NZL B;  4HKQ A;  1SEB D;  1QOG A;  1I4P A;  4XWT A;  1TS4 A;  2RDH A;  1L4D B;  2TSS A;  2PLP A;  3AH7 A;  1CQV A;  2ACZ B;  3R2T A;  1NYR A;  3U52 E;  2EKI A;  3NVZ A;  1WXQ A;  2N9K A;  4TSS A;  2DLB A;  4KGS A;  1CZP A;  4WQM A;  2WP9 B;  3BZD B;  2FBW B;  1JML A;  1YN5 A;  2YEP B;  4ZRP A;  3AED B;  1JQ4 A;  4KGR A;  2WXG A;  1I7H A;  5E6J A;  1IGD A;  1KTK A;  2FE8 A;  1RFK A;  3RPF C;  5I4D A;  4USA A;  1MVK A;  1SSN A;  2JYE A;  2PW9 A;  3O13 A;  1KLG D;  1QOF A;  2Y5C A;  3GP7 A;  5EE1 A;  1SJH D;  4A90 A;  1V1P A;  2N0S B;  4US9 A;  3EA6 A;  1CJE A;  5FR3 A;  2D5G A;  3P4S B;  3CWI A;  1ZXH A;  4ZRQ A;  1T3Q A;  3AE4 B;  2WXM A;  1J7C A;  1DOY A;  3MP9 A;  4YT0 B;  1D5X C;  3AM9 A;  1DOX A;  1IGC A;  1ZXI A;  2LUM A;  4YWG G;  1WGK A;  1PFD A;  4ZOH C;  1C9F A;  3SFE B;  4OZC A;  3LYY A;  1F0Z A;  5T8I A;  3PZ8 A;  5LNK 1;  1KRH A;  1AW7 A;  2WQY B;  3I57 A;  3AE7 B;  1XXG A;  3V3X A;  1GAQ B;  3VR8 B;  1N61 A;  3MJ5 A;  5HFY A;  1HA5 A;  2IGD A;  2J53 A;  2QIE B;  2SEB D;  3DWG C;  3PZ7 A;  4EE2 A;  4N58 A;  2IJ0 A;  1FIQ A;  2Q5W D;  3Q8A A;  1RM6 C;  1QLB B;  4XDD A;  2XN9 C;  3W1S A;  1ENF A;  4YSX B;  2V3P A;  4YXD B;  1E0Z A;  1TZO A;  1DYQ A;  2N9L A;  4IDI A;  1MI0 A;  2WXQ A;  5D7G A;  3TEW A;  2PTL A;  2J52 A;  5D3I B;  1XCQ L;  3PO0 A;  4KKJ A;  3ZJV A;  1ZDX A;  1HXY D;  3P1M A;  3TUO A;  2JX5 A;  5FKA C;  1TKY A;  2WXI A;  1FEH A;  4MH8 A;  1AN8 A;  4RGT A;  2V3N A;  2Y5P A;  4MM3 B;  2MJE A;  3FIL A;  3TEZ A;  5TSS A;  1JRO A;  4WIP A;  4LLG M;  1JWA D;  3MC0 B;  2NMQ A;  3ZQ4 A;  1FRR A;  2LHD A;  3VR9 B;  3W9C B;  1PGX A;  1WRI A;  3TSS A;  2WS3 B;  1K50 A;  2PKO A;  4TQ0 A;  2Z8L A;  2L1A A;  3BII D;  4YSY B;  2BTE A;  3BK2 A;  4AQ7 A;  2BW2 A;  3AEF B;  2MJD A;  3DWM A;  3AN1 A;  1J7A A;  1UWM A;  3FAH A;  5BMG A;  3B2F A;  2G9H D;  2JU6 X;  5G5G A;  2WDV B;  1D4B A;  3LXF A;  3ZYY X;  1V1P B;  3AEE B;  3BK1 A;  2K0P A;  1DGJ A;  1TS3 A;  1B9R A;  3IAM 1;  3AB5 A;  4RF0 A;  4YSZ B;  3T3N A;  3ETR A;  3N9Y C;  3R2I A;  1FCL A;  5D3D A;  1FD6 A;  1TJE A;  2DBY A;  3P4Q B;  2J42 A;  1A70 A;  1RYJ A;  2OHF A;  2INN E;  2WXN A;  3GS2 A;  4M0W A;  4JPS A;  4RGO S;  2MJ3 A;  2RMM A;  2DYO A;  3NVY A;  4RCO A;  3AMZ A;  1Y56 A;  3W5U B;  4L1B A;  2I2Y A;  2OED A;  3AE5 B;  1ROE A;  3U7Z A;  1QOA A;  4O1N A;  2BB6 A;  2JWU A;  1L5P A;  1HEZ E;  3R8B A;  1TKE A;  2IDY A;  3P63 A;  1ESF A;  1FNU A;  1FMA D;  3NS1 A;  1P7E A;  2WDR B;  3VQI A;  1C4P A;  1VRA B;  3AE3 B;  3Q8B A;  4WUR A;  2QEJ C;  3BVZ A;  1C76 A;  2M19 A;  2YEP F;  1I4X A;  3ZGZ A;  4C7Y A;  1L0X B;  1XO3 A;  4DXG A;  1XLQ A;  5BYQ A;  5EE3 A;  1GPX A;  1V97 A;  2KAC A;  2W54 A;  2RPV A;  4MT5 A;  2INP E;  4UDU C;  4GLS C;  3AEA B;  2JXT A;  1D6E C;  2MEK A;  1JWS D;  4MAC A;  2HTM E;  1VJK A;  4JX1 C;  1PUT A;  2V0G A;  1F2R I;  3AE6 B;  2K5P A;  1K53 A;  2NTS A;  1EM7 A;  4YTP B;  1FNV A;  3P42 A;  1ZP0 B;  2LGI A;  1XLP A;  4A8X C;  2IGG A;  1C4C A;  1V1O A;  3FC4 A;  4ARC A;  2H89 B;  3AEC B;  3AV8 A;  1TS2 A;  2JZP A;  1ZUD 2;  4CQN A;  1LO5 D;  1SIJ A;  3TEY A;  1TKG A;  2W82 A;  4JWS C;  4RFB A;  1L0Y B;  1NVI D;  5C2T B;  5BMH A;  1FO4 A;  1N63 A;  1D5Z C;  2VZK B;  1KH0 A;  3GB1 A;  4YTM B;  2BB5 A;  2JYT A;  3RFZ B;  4XWW A;  2IGH A;  2QMT A;  3NZ3 A;  3HRD D;  3NRZ A;  2PVG C;  3AEB B;  3SEB A;  1XEE A;  1GB4 A;  3NUH B;  1SE2 A;  1XLN A;  4GDK B;  4C80 A;  3AE1 B;  2BT6 A;  4A55 A;  1VR9 A;  1NI3 A;  5EE9 A;  2AQ1 B;  4DQO C;  1UNS A;  2PIA A;  4FXC A;  1BML C;  1E9M A;  2WU5 B;  3KWL A;  3FIL B;  1C4A A;  5AUI A;  3SR6 A;  1L4Z B;  4GDL B;  1QQR A;  2W3S A;  1AWD A;  1VZ6 A;  1TYG B;  4JE3 B;  1C77 A;  3HVD A;  4TQ1 A;  2WXF A;  4AS1 A;  1Q10 A;  1YJJ A;  2LFI A;  1AYF A;  1BXT A;  1WWT A;  3U4E G;  1VLB A;  3T3O A;  2IPK D;  2L32 A;  1R7S A;  4RGN A;  3I9V 1;  3BWU D;  3NVV A;  1GOZ A;  4JWU C;  1JAL A;  4YTN B;  5BYR A;  4OHJ A;  1ACC A;  4H2A A;  2M0A A;  1ET6 A;  4RGM A;  5HI1 A;  4ZHO A;  1F77 A;  3NVW A;  4B0M A;  4LK0 M;  5GXG B;  1ZPS A;  1SE3 A;  1I4G A;  1D5M C;  2WU2 B;  2KDM A;  1E7P B;  2PMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...