2M56B

The structure of the complex of cytochrome p450cam and its electron donor putidaredoxin determined by paramagnetic nmr spectroscopy
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/metal binding protein
molecule keywords Camphor 5-monooxygenase
publication title The Structure of the Cytochrome P450cam-Putidaredoxin Complex Determined by Paramagnetic NMR Spectroscopy and Crystallography.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 22
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2m56B00
1RYJA 2E3TA 2PKOA 4WWMA 1A70A 1WGKA 3P4QB 1IUEA 3L4PA 1FFVA 2PIAA 1SB3C 4WQMA 5EE9A 4C7YA 2L52A 3P4RB 4ZHPA 1E0ZA 2LEKA 1N60A 3P4PB 4JWUC 1NI3A 3FAHA 3LB8C 1YQ3B 2WQYB 2BS2B 5GXGB 3AEDB 4C80A 4ZHOA 1TKYA 1E6EB 1TYGB 1SIJA 2K5PA 3P4SB 5AUIA 2MJEA 5MPOA 3HVZA 2CJOA 1YQ4B 3NVWA 1JQ4A 4IDIA 1YJIA 1NYRA 1E9MA 1UWMA 3AE6B 1RFKA 3CWIA 4N59A 1N63A 3B2GA 3CIRB 1NVID 4ZOHC 3SFDB 2MJ3A 1XO3A 1N5WA 1F0ZA 1QT9A 1N61A 3AECB 3AE9B 1KF6B 2K22A 3AEEB 3KWLA 1JWAD 3AEFB 3P63A 4YSXB 2K9XA 3WCQA 3NS1A 1FMAD 2DWQA 5C2TB 1JRPA 2PVGC 1JWBD 2HTME 2WLBA 3AE1B 2DBYA 1FFUA 1KFYB 4YTPB 1R7SA 1RWSA 2BS3B 5H8YE 4KX6B 1N62A 2Q5WD 2WU5B 2W3RA 2W54A 1E10A 1ROEA 1NYQA 4USAA 1JROA 2G1EA 4P6VF 3LXFA 1ZP0B 2FBWB 1GAQB 4YSYB 4YXDB 3SFEB 1RM6C 2M56B 1SF0A 1FM0D 3AN1A 5G5HA 4YSZB 1XLPA 3SR6A 1FO4A 1DOIA 1FRRA 3BIID 3AE2B 3ZYYX 2CJNA 3AE8B 1FXIA 2Y5CA 3ABVB 3W9CB 3EUB2 2JX5A 1ZUD2 1XLQA 1CJEA 1WRIA 1QLBB 3AE5B 1TKEA 1T3QA 3P1MA 1NENB 4FXCA 4HROA 2PVOD 5EE1A 3VRBB 3AE7B 2M19A 3NVYA 1WYGA 4LTUA 2CU3A 3B2FA 1VLBA 2WP9B 1L5PA 1QOGA 3DWGC 1QOFA 4JX1C 4A9AA 1OQRA 2ACZB 2WDRB 1I7HA 1OQQA 2WDVB 1L6VA 2QJLA 3NVVA 4YT0B 1WWTA 4C7ZA 2BS4B 2W55A 1DOXA 3HRDD 2B76B 3AH7A 1V8CA 2MH7A 3AB5A 2AX5A 2MJDA 3B9JA 4US9A 2BT6A 1DOYA 3NVZA 3VR8B 5H92C 1TKGA 2JQRB 3AEAB 1L6UA 4ITKA 5AUKA 3VRAB 1JALA 1QOBA 3ETRA 2W3SA 1CZPA 2WS3B 1PUTA 1FXAA 3NRZA 5G5GA 1N5XA 1JW9D 2OHFA 3PO0A 1VJKA 2H88B 1GPXA 1NEKB 4N6EB 4N58A 5EE3A 1FRDA 1FIQA 1E7PB 1YJJA 5EE0A 2EKIA 1L0VB 1DGJA 1KRHA 1ZXIA 2WU2B 3AE4B 2N0SB 2QIEB 3AMZA 1XLNA 1TJEA 3HUIA 4JWSC 2H89B 1QF6A 1PDXA 3AE3B 3W5UB 1WXQA 1ZOYB 3AV8A 5C3JB 1J7AA 1VDVA 3AEBB 1AYFA 1J7CA 1PFDA 3RPFC 4US8A 1EWYC 1OFFA 2WDQB 4YTMB 2KAJA 3FC4A 1AWDA 3AM9A 3AEGB 1V97A 2KMMA 4HRSA 1QOAA 3VR9B 3W5VB 1XLOA 4YTNB 1J7BA 2L83A 1B9RA 3DWMA
chains in the Genus database with same CATH superfamily
2PKOA 3IG3A 3WAMA 2BTEA 4NAMA 1C78A 4LJOB 1K8RB 3ZJTA 2WQYB 3TCAA 3T8MA 1TYGB 3HM3A 5AUIA 4GXBA 2NTTA 4D2KA 2NS5A 4I6PA 2INCC 3QHTA 1YNTE 3AE6B 3SFDB 1ZDVA 2N7DA 4UDUC 3ZIMA 3Q8BA 4II2B 4MH0E 4TV3A 2CHZA 4AJYB 3QCAA 1KF6B 1I4GA 3WCQA 1YN5A 3VXWA 3APFA 1MPEA 3ZUNA 5J2RA 4DWFA 1MVKA 2FIFA 3C8YA 1E10A 3L0WB 1VR9A 4HDOA 4RFBA 2Z0EB 5J17A 5C23A 2XBBC 2M56B 1WIAA 1V1PA 3VUYA 2NBWB 3BIID 3PRZA 4MELA 4TQ1A 4QAYA 1ZUD2 1LGRA 4GIVA 2MBOA 2CHXA 1KTKA 2LRUA 4C7ZA 4F7ZA 2O6VA 3PRMB 3HRDD 1WFYA 4X57B 2FUHB 5TSSA 4P16A 5KHQA 4DK5A 4M00A 4YL8A 4HWIB 4RCOA 2LFIA 2LVOA 3I9V1 2NTSA 2N0SB 1TJEA 3R3MA 4BBNC 1QF6A 3MTNB 4BAXA 4ICUA 3HIZA 3VR9B 2VRRB 4MSMB 1UWXA 4A90A 2LVPA 3QARA 3L4PA 2KANA 4OZCA 2OOBB 2PPHA 4P7IA 3FAHA 4LNIA 2CJOA 3QA8A 4KGRA 1YJIA 1E8XA 1VRAB 3PLVA 4HCNB 2LHEA 3M63B 4PT5A 4EUTA 1OTRB 3NS1A 5J18A 4RGOS 2PVGC 3RYTA 2OEDA 2YLMA 3TUOA 1RWSA 1JCKB 2Q5WD 3PSEB 2MP2B 2JPHA 2KQSA 2G1EA 3NG0A 3Q2AC 1EU3A 3IVFA 3ABVB 4L1BA 4MH8A 1XLQA 3AE5B 3P1MA 1RFAA 3PLUA 3QK0A 3B2FA 1E8WA 4K1RB 2I1JA 4DBGA 4RGNA 1F1HA 5JHBA 4NJ7A 4FADA 4HKQA 2AQ3B 3ZRCA 2XK5B 2YVCA 3NZUA 5LXHA 1F52A 2KC1A 1GPXA 2N9LA 4WH4A 3KUCB 1DYQA 1K50A 2INNE 2ZEQA 2WU2B 3UQBA 3AMZA 2LRWA 3NJTA 1TS3A 1UGMA 1FXTB 4IM0A 2M1MA 2ZCBA 3MJ5A 3MHSD 4WQMA 1F2RI 2GB1A 3ZNID 2N9XA 4FULA 4KSLC 1Y8RC 4K7SA 4RGMA 4WJOA 3ZTCA 5DPRA 1IBXA 1XO3A 1V9JA 5JHAA 3PGEA 2INPE 2QHOA 3KYCD 2LD9A 1L4DB 3VHTC 1FFUA 3Q3MC 4YTPB 1S1QB 4AQ7A 2KJRA 2ZCCA 1WYWB 4XX5A 2JVCA 2DYMA 1JROA 1ZKHA 4R3DA 1RM6C 2KMCA 1ISNA 2FNJB 2KVRA 2CU1A 2KYWA 3ZDTA 1C1YB 1ZGUB 5D7GA 2WXKA 4M01A 4PK1A 2BF8B 2WDVB 4GB9A 1SE2A 4LK0M 2M17A 5BYQA 2MH7A 5HKHA 1Q10A 2NMQA 2TSSA 4BOSC 1SJHD 1TKGA 4RF0A 1JALA 4IKGA 2WS3B 1IGCA 4KIKB 2BYVE 4WAAA 2UWQA 1HA5A 3TIXA 4WJQA 1C76A 3FKYA 1WJ6A 4FJVB 3V6EB 1WM2A 1Z5SB 5C3JB 4AP4C 1WMHA 1FCCC 2QMTA 3ZNGC 4ANXA 4YTNB 1TIFA 2GBKA 1RYJA 1P98A 3P4RB 3A9JB 2KKCA 2KX3A 3A1QB 2ZZPB 3DVGX 3CSFA 4KDIC 3AE9B 1JWAD 2WXQA 1JRPA 4XWWA 1KFYB 1I42A 2IDYA 2KTRA 3TMPB 1WI0A 2KJHB 2BKRB 2L05A 1I35A 2RSUA 2KD0A 2RDBC 1KM7A 1NYQA 2HJ1A 4P6VF 3VFKA 2KHWB 4HXDA 2Y5PA 1SF0A 5G5HA 1MG4A 2K1FA 4OVZA 2JZPA 1FRRA 1F77A 2CJNA 3CF6E 2JX5A 5JXVA 1FNVA 1XF5L 3DVNU 2D07B 1EF1A 1WGYA 4K7UA 3FILA 2MBEA 4P1BC 3JVZX 2Z59B 3R7QA 3SD5A 1LFDA 3UINB 2LHDA 3VR8B 1F9JA 2MBQA 2MCNB 3PZDA 3OLMD 3AXCA 2O6VD 2GBRA 4DXGA 2H88B 4H2AA 4MSQB 4JLCA 3V3XA 1XLNA 4XDCA 4GDKA 4GLSC 3DBHI 2L32A 3KLSX 4G50A 2J53A 3DBSA 2BYTA 3HK0A 1EO6A 2AEHA 5AZGA 1FFVA 2WYQA 2L52A 2KWUB 2LEKA 4EE2A 2ONQA 3KWVA 1NI3A 2M8SA 1T6BX 2UYZB 3HVZA 1XCQL 3U7ZA 3ZO5B 1TS2A 1VZ6A 3GS2A 1T0QC 1HEZE 1JRUA 2PMVA 2ZW1A 1E7UA 2GMIC 4MGIE 5KHOA 2WLBA 3IXSA 4W9KA 1B1ZA 4TQ0A 2R2QA 2M0AA 2BQQA 2IZVB 2V9HA 1WE6A 3QAQA 3GE3C 4WQOB 2FE8A 2NPTA 4ZRJA 3JSVA 2K6QA 4LDTD 2DZJA 3ML9A 2LJ5A 2IGDA 1WYGA 3DVGY 1BXTA 1EWCA 2PLPA 1QOFA 2O2VA 3RMKC 1BT0A 2J7QB 4MJSA 2IJ0A 1V8CA 3BVGA 3VUXA 2V3NA 2QSDA 2CS4A 1VCBA 3Q8AA 2IY1B 4DHJB 3ETRA 4IC7B 1PUTA 5DPSA 3OJ4B 2KLGA 4N6EB 1FIQA 1STEA 3L16A 1F2RC 1V6EA 3ZRFA 1RLFA 1E90A 3GOEA 1WGDA 4REZA 4XE0A 2KFKB 1XQQA 1KLVA 5AEKB 4HVBA 3RUIB 1VDVA 5JH5C 1J7CA 2XNAC 3AU4A 2PJHA 3N3KB 4N9F4 3T3OA 3BY4B 4RF1A 1JWUD 2EMTA 5CHFA 4YWGG 2NBUA 2B3AA 2FCQA 2DZMA 2E3TA 3Q8EA 4NJ6A 3P4QB 1IUEA 5BMIA 4LLGM 1N60A 1SEBD 5LNK1 3DBHB 4KZ0A 5E6PA 3WA0A 2MX2A 3NVWA 1JQ4A 1HTQA 2I38A 4M0WB 4OW0A 3WALA 3B2GA 4HEA1 1FNUA 2BB6A 2E6XA 3RNBC 1YMHE 2JUOA 3UI3A 3AEFB 2JY6A 4ZYSA 2IGGA 1LM8B 1WY8A 3Q69A 1JWBD 1V2YA 2WXOA 4PYUA 1I4HA 4M8MA 2J42A 4KGTA 2L0TA 3IHPC 2YEPF 4NJCA 1YN4A 3KUDB 2AL6A 3RULA 1V1OA 2M19A 3A9KB 3PZ7A 2JXTA 2LXAA 2C9WB 4FN2A 5D3DA 4YT0B 5EDSA 1AN8A 3EFCA 4L23A 2OJRA 1QKZA 3I3TB 2RR9A 3O13A 3W2DA 3RT3B 5CTRC 3H7PB 3NRZA 2HE7A 1N5XA 2BYEA 2L76A 5IN7A 4WJNA 1VJKA 4P1CC 2BWFA 1R4MI 3DPDA 3WANA 4CQNA 4IWOA 3AE3B 2N4FA 4K3CA 4A55A 2ON8A 1T0SC 1SBBB 3Q3NC 2CHWA 3GP7A 3UGBB 1J7BA 4RMAA 4CYEA 2WNMA 4C4VA 3N32A 2JF5A 4DXFA 4OZAA 2D2QA 1XEEA 1V81A 1PYWD 4C7YA 2KDIA 1HE8A 3T9LA 4ZRIA 3R2TA 4JWUC 2PE6B 1J8CA 3IT6B 1HQRD 3ZNHB 3IAS1 1E8ZA 3KVFB 1UWMA 3URYA 1RFKA 2BB5A 1YX5B 1F0ZA 1D4BA 5IAAC 1SE3A 2LUEA 4KVGB 4LNNA 1BMLC 1N6ZA 3O65B 3PS6A 2DAFA 2KZRA 1K51A 4S0RA 2ICIA 2MA9B 3KYDD 3PREA 3R7RA 1BUIC 1QQRA 5G55A 4JPSA 3H1UA 2AQ1B 1ZDXA 1WX8A 2Y5CA 4NAWA 1P3QU 1MHXA 3EFUA 3EHVA 2XN9C 2JYEA 4FBJB 1IP9A 1WRIA 3VUWA 1VZ8A 1WE7A 3NVYA 3Q3OC 4EZKA 2IY0B 2M4NA 2PW9A 2LMCA 2AX5A 1GB1A 3DDCB 3PTFC 1V5TA 4KKJA 3VTUA 4JE3B 4XGAB 1X1MA 2Z0DB 4L2YA 1EF5A 3TEWA 2OHFA 3IAM1 2FCNA 3MFGA 3Q6BA 3AU5A 4EOYA 4WWNA 4II3B 2L1AA 1YQBA 4FLHA 4PS3A 3WAPA 5TR5A 2BBCA 1CQVA 1WGGA 3DBRI 2KTFA 2KAJA 5IA7A 5LLIA 1R4MB 2LGXA 2KK8A 2K0PA 3VQIA 3AI5A 4GN1A 1E0ZA 5GMVA 3APCA 3Q8CA 3ZLZA 1WH3A 2K5PA 2JXXA 4M8NA 3V62A 2LJIA 1NYRA 4N59A 5CHWA 3BYTB 3CIRB 4PS8A 1E8YA 2V1YA 2C7HA 2KTRB 5AZHA 4GGQA 1GNUA 3LDZE 3KWLA 4WWOA 3KH0A 2DWQA 2KOXA 5IO9A 5CHVC 2DYBA 5BYRA 2DBYA 1J0GA 4JGHB 4KX6B 1TTNA 1N62A 1L0XB 3ML8A 4ICVA 1ROEA 4BKSD 2MWSB 4YXDB 2G3QB 3QQ8B 1P7EA 2N9KA 1P7FA 4HPPA 3NZ3A 1SSNA 3U2SC 3AE2B 4PS7A 3ZYYX 3W9CB 4W9CA 1TBEA 1QLBB 5H92C 3VH4B 2SAKA 4LNFA 2JYTA 1K53A 3X23A 1YN3A 1OQQA 3NVVA 4KGSA 3RNCC 2WWZA 2KMAA 3BVZA 4LNOA 3NVZA 3OWEB 1AW7A 3AEAB 1L6UA 4RH6A 1WRDB 3DVNV 3L08A 1PGXA 3V6CB 1CZPA 2L3ZA 1KH0A 4GDKB 4MGZE 1EU4A 1VZ7A 4HJGE 1SJED 1S3SG 4WAFA 2N7EA 2C60A 2EKIA 3ZGZA 2L8JA 3BYYB 4JWSC 1HZ6A 1AARA 4IG7B 1UELA 1AYFA 4AUQC 1OFFA 3KW5B 4MGKE 2G9HD 1P1AA 4FHJA 2L83A 2ASQA 3DWMA 3EA6A 4ACFA 1GG3A 1A70A 1SB3C 3QX1A 5FR3A 3RCZA 3RFZB 1MG8A 1YQ3B 5GXGB 1FEHA 1TKYA 2J4XA 5MPOA 3DBRB 4KZCA 1YQ4B 2D3BA 1SGHA 5HG2A 5IOIA 2GBJA 4B9KA 4TKNA 2VZKD 2YEPB 4FJYA 4AWJA 1I4RA 2MP2A 4MGYE 2N1VA 1GC7A 1R7SA 2BS3B 2JWUA 2W54A 1TZOA 4F8CB 4G11A 4B0EA 4YSYB 1MJDA 4AS1A 1WXAA 3RI7C 2MBHA 4MJSB 1C9FA 2WDTB 3NZSA 3VRBB 4NZLB 5EE1A 3RD2A 4MM3A 2QILA 2PVOD 1VLBA 1UH6A 2WP9B 2ZNVB 3DWGC 2N7JA 5DPWA 4M02A 2FCSA 1WWTA 2BS4B 3PHXB 2KDBA 3N20C 2K8HA 2AL3A 4BKGA 1DOYA 1GOZA 2INDC 4ZRPA 3RZFA 4ITKA 1D6EC 4XDDA 4DXAB 1FXAA 3JYUA 4DDGD 2M0XA 1MI0A 2DENB 5E6OA 3LYYA 1UZXB 5LXIB 2IO2B 1ZXIA 3MJWA 4IWPA 3MC0B 1WJ4A 4HCPB 3AEBB 4O1NA 1E5WA 2N9PC 1V97A 3U8ZA 2BW2A 2EKEC 4A6QA 3H7SA 3SEBA 3DBLB 2A5UA 2ZW0A 3ZXRA 2AYOB 5EE9A 3I57A 4TSSA 4ANVA 4Q2JA 1UUPA 4OZBA 1TS5A 4W9DA 3HHMA 4IDIA 2LASA 1N63A 4ZOHC 2DYOA 2LVQA 2NBVB 2BKFA 1N61A 2HTHA 3GE8C 2JRIB 1WX9A 4W9EA 2C5LC 2HDEA 2HD5B 4HDQA 3I5JC 3BVMA 3M95A 1KJTA 1IGDA 1T0YA 3KQ4A 3ONSA 2VH2A 2FUG1 2JT4B 2MW5A 1ZP0B 2BVCA 3RNAC 4GDLA 2EELA 1GC6A 4DHJD 2LWPA 1LQBA 3EUB2 4A8XC 2RPVA 1IPGA 4BKSA 1I4PA 4FXCA 2QCZA 4K7WA 4LTUA 1YD8U 2DX5B 2MHJA 3EC8A 1V1PB 2WDRB 1WGRA 2R2OA 1WZ3A 1UF0A 2WXFA 2MJDA 4G3XB 1U4AA 3M3JA 4IM3A 4EZJA 2O6VB 1TY0A 2LUMA 5G5GA 1GUAB 2AQ2B 2KNBA 2WXNA 3HVDA 1EM7A 2EMSA 1V5OA 2H89B 4C4VB 2LGYA 2QC8A 1ZOYB 3ECIA 2WXGA 4ASWC 2JWZA 2QDFA 3FC4A 2GLSA 3AM9A 4B0MA 3N9YC 4NY0A 1B9RA 5I4DA 1WM3A 3VDZA 2MLBA 4B6WA 4W9JA 4EKUA 3DCGA 3NOBA 1MHHE 2MJEA 2ZPNA 5BYSA 2ZNVC 4IWQA 2D3GA 3ZVVA 2HJ8A 1TZ1A 2KWDA 2IBIB 3GB1A 4W9HA 3TL5A 4BVUC 4ZRQA 5H8YE 2JZZA 2X38A 3ZNZB 4USAA 1OEYJ 4A3OA 2RMMA 4RM8A 3Q8FA 3AN1A 3V05A 2MRPA 2MQJA 2Y5BB 2KDFB 4LDTB 5CX3A 1ZXHA 4HROA 3AE7B 3ALBA 3AULA 4AJWA 4C56C 2GI9A 2G45B 4A9AA 2RPQA 3ZW3A 4JL9A 3ZDMC 1WGHA 4GU2A 1V49A 3ZJUA 4EFOA 3W1SC 2REXA 4OVUA 3ZKJC 3H9DA 3BK2A 1WJUA 1R4NI 3VRAB 4IW0A 1T0RC 1I4QA 2IO3B 2N1WA 3ZTDA 4W9FA 4OVVA 2V0GA 3N1YC 1H4RA 2R61A 5D6JB 1EWYC 2KN4A 4HK2A 2K8BA 3AEGB 5HFYA 2K3UA 3R2IA 1YX6B 1WGKA 4US8A 2PIAA 1L2NA 4HKZE 2RGFA 4ZHPA 1TGZB 1C77A 4NPNA 4XWTA 1ZPSA 2BS2B 2PE9A 3DHIC 3R8BA 1A5RA 1XD3B 2DZKA 3PV1A 4ARCA 2NVUI 4CHKA 3W1YA 2OJWA 3AEEB 4EZLA 4YSXB 3GZNI 1UBIA 4G0NB 1C79A 1Q5WB 2KC2A 1M4VA 2HTME 4OHJA 2DAJA 5T8IA 1J19A 3P2BA 1IBXB 2A4ZA 1YIWA 3APDA 1FD6A 4NQLB 2KDEB 4HPMB 2DNFA 1V80A 1ESFA 5DPTA 1C4AA 2DHZA 1XLPA 1PQSA 4LCDE 1FO4A 1JWMD 3A4SC 5E6NA 1WXVA 3AE8B 2KFJA 1SE4A 1TKEA 4KV2A 1PGAA 2ZPYA 2I2YA 2GBMA 3BWUD 2CR5A 4ANWA 2GRIA 2ACZB 4DQOC 1WJNA 2FIDA 3SHQA 2LGIA 1XT9B 3EECA 3MC8A 2J0MA 5DCNA 2KFKA 4URKA 1GB4A 1IYFA 4WWPA 1NEKB 3NS8A 5BO4B 1Q0WB 3K9PB 4WJPA 1I4XA 1ZW7A 1R4NB 3CMMB 3CSTA 3OJ3A 1Y56A 3IBEA 3RPFC 2KMMA 2G4DB 2AWTA 3Q14C 1C4CA 4TUUA 2KACA 4M0WA 2JU6X 4WWMA 3DQVA 1WMHB 3N1ZC 3BK1A 4C80A 2KJ6A 2WGSA 3B08A 2SEBD 3TEZA 2L00B 1WF9A 2LGSA 2BYFA 2MJ3A 3U7DA 1SIFA 1WXMA 2PTLA 2RDGA 2K6DB 1QT9A 4XYCA 2NCNA 4W9GA 4BOZB 2K22A 2MSED 2L0FA 3VTWA 4K81A 2J52A 2RD0A 2BWES 2QEJC 4J6IA 3RZWC 5D3IB 3PHWB 3NHEB 4MM3B 2FBWB 1XXGA 3A9KA 3U4EG 1FM0D 2KQ4X 3GZNB 4YSZB 3SR6A 4I6NB 3IT4B 4ARIA 3RN9C 4BBNF 1CJEA 1HXYD 4BKTA 1T3QA 3MHZA 1NENB 1OGWA 2J0JA 1OQRA 1I7HA 3R66C 3H7PA 2QJLA 1L7YA 2WX0A 5IP4D 1TY2A 3PT2B 2JQRB 4BFRA 1EUVB 1QOBA 1PGBA 3QWZB 3OG5A 3FILB 1UNSA 3QIJA 1QILA 2J0KA 1JW9D 4FHKA 5HHDG 2LI5A 2L7RA 1V86A 5L83A 2PEAA 1L0VB 1KRHA 3PPAA 1G6JA 2FCMA 2D3AA 2ZJDA 1FCLA 1WZ0A 1PDXA 2K8CA 3NY5A 3VTVA 4YTMB 4PYZA 1AWDA 1D5MC 1XLOA 4XZ4A 2NR2A 1P0RA 2VH1A 4C00A 5FR6A 1TT5B 3TBLD 3UIPB 3MP9A 3E9SA 4TMAB 4ZHOA 3DBLI 1E6EB 1KLGD 1SIJA 4KSKC 4IM2A 2BPSA 1E9MA 1ET6A 1XCTL 2D10A 3A33B 3PRPB 4IUMB 4IOIE 3TEXA 3P63A 2K9XA 2V3PA 4GMVA 4GDLB 3AE1B 2LXCA 1HZ5A 3J9CA 3WIMA 2WXRA 5JZEB 1UGJA 4B95A 3U30A 1UD7A 1CMXB 3LXFA 4MDKE 1Z2MA 4WURA 1FPYA 2DLBA 1FXIA 4NQKE 1MFWA 4J3OD 1NDDA 2X8XX 1E7VA 2CU3A 4E3CA 3L13A 2IO0B 3ZJVA 2KDMA 1NI2A 2IPKD 3I63C 3TSSA 2NPTB 4CO7A 2K39A 3JSVB 1DOXA 1C3TA 1SXTA 3KUZA 2WXIA 2WXMA 2B76B 4K3BA 4MACA 1FNWA 3L54A 2JRHA 4WIPA 1CK1A 2WXLA 2O2VB 3DOWA 4A3PA 5IKCM 5BMGA 2WXPA 1L0YB 3PO0A 4N58A 1FRDA 2WXHA 1E7PB 1YJJA 1DGJA 2W9NA 3QC8B 3VVWB 4F1SA 4JIOU 1ENFA 2XK5A 3TEYA 3ZQ4A 5D94A 1NBFC 3AV8A 4EEWA 1J7AA 1SE9A 4KKIA 3K9OB 2JZ3B 5FK9C 2D5GA 4I6LB 2WHIA 4HRSA 1D5XC 4W9IA 3BINA 4E71A 2GBNA 3L10B 2D3CA 2KT7A 3A4RA 3E56A 2CKHB 3P4SB 3DHHC 1KOTA 3PVLA 2KVZA 4RM9A 2IYDB 5C1ZA 2G4SA 3PZ8A 2VZKB 2W82A 3AECB 1JWSD 1OEYA 2DZIA 2MEKA 3RNGC 4BZAA 2I1KA 2KWVB 3TJPA 1FMAD 4MEMA 4A20A 2JSVX 2BGFA 2XEWA 2N9EB 1VD2A 4GOCA 3BZDB 3EGRA 5AZFA 4S17A 2WU5B 4MT5A 3LJ3A 4HPLB 1WX7A 3T3NA 5BMHA 1DOIA 5FKAC 3WAOA 3SFEB 2C7NB 3N30A 1WR1A 4RGTA 1YOVB 2V4LA 1L5PA 3UIOB 1QOGA 5G2NA 3AH7A 3QJZA 5L95C 3NUHB 3AB5A 1D3ZA 3B9JA 4US9A 3SDLC 1WXSA 3HM6X 4E74A 5AUKA 3Q3JA 2LGDA 3M62B 3ENEA 4AOFA 2IO1B 5EE3A 2ZVOA 2KN5A 3AE4B 3JW0X 2QIEB 3Q3FA 3HUIA 4HJKA 1GJZA 4KIKA 4DDID 1KLUD 1WXQA 2IGHA 3V60A 2KLCA 2WDQB 2Z8LA 3B1LX 3DHGC 2D11A 3RNEC 1RRBA 2UU7A 3X0WA 5HI1A 3S2AA 2KQ7A 3VAWA 1LXDA 3P4PB 3LB8C 3AEDB 1QZEA 4KDLB 2WXJA 2RDHA 3CWIA 4W9LA 4ANUA 1NVID 4XC2A 1N5WA 1K52A 1P9DU 2V3SA 2FAZA 2KXJA 4ZRKA 3V61A 2V4IB 3A9JA 3A1QA 3C0RB 5C2TB 1WSPA 3H6NA 2ZVNA 3U52E 1WR6E 3D32A 2LZ6A 2GOWA 4HLEA 1D5ZC 2W3RA 1C4PA 5E6JA 3C19A 3UQAA 1GAQB 1JMLA 4FJZA 1RAXA 1LO5D 1HTOA 1T5XD 2K25A 4LNKA 3L17A 2KX0A 4JQWC 4ZYNA 2KO3A 3IFWB 3H8HA 2WX1A 1H8CA 1OQYA 2MBBB 4JX1C 3SU8X 4FA6A 2C7MB 1L6VA 1Q1OA 4NAWB 1M94A 1L4ZB 2W55A 4NNJB 3UF8A 1ZE3D 5D2MB 1YJ1A 2BT6A 3RNFC 1ET9A 4GSWA 3ZXVA 3OAWA 4ZDVA 2W3SA 3B0AA 4DHZB 4RNAA 1UBQA 2KWCA 4DHZE 4LJPB 5EE0A 3N1XC 2Y3AA 3P42A 1TS4A 3W5UB 3MC9A 1ACCA 1PFDA 3W1SA 3VH3B 1QOAA 3W5VB
chains in the Genus database with same CATH topology
2PKOA 4M0WA 2JU6X 4NAMA 1A70A 4WWMA 2BTEA 1FFVA 1C78A 1SB3C 3ZJTA 2L52A 5FR3A 2LEKA 4EE2A 2ONQA 3KWVA 1NI3A 3RFZB 3BK1A 1YQ3B 2WQYB 5GXGB 4C80A 1FEHA 1TKYA 1TYGB 2J4XA 1T6BX 2SEBD 5AUIA 5MPOA 3TEZA 2NTTA 4D2KA 3HVZA 1YQ4B 1XCQL 3U7ZA 1YNTE 3AE6B 5HG2A 3SFDB 1ZDVA 4UDUC 2MJ3A 3Q8BA 1TS2A 1VZ6A 2PTLA 2RDGA 1QT9A 2VZKD 3GS2A 2YEPB 1KF6B 2K22A 1I4RA 2ZW1A 1HEZE 2PMVA 1I4GA 3WCQA 1YN5A 2WLBA 1MPEA 3IXSA 2J52A 1B1ZA 1R7SA 4TQ0A 2BS3B 2M0AA 2JWUA 2QEJC 1MVKA 3C8YA 2W54A 1E10A 5D3IB 1VR9A 4MM3B 4RFBA 1TZOA 2FBWB 4B0EA 4YSYB 1XXGA 2M56B 3U4EG 2FE8A 1FM0D 2KQ4X 4YSZB 4AS1A 3SR6A 3IT4B 1V1PA 4ARIA 3BIID 4TQ1A 1C9FA 1ZUD2 1HXYD 1CJEA 3VRBB 1T3QA 3MHZA 4NZLB 1NENB 2QILA 5EE1A 2PVOD 2IGDA 1WYGA 1VLBA 2WP9B 1BXTA 1EWCA 2PLPA 3DWGC 1QOFA 2N7JA 1KTKA 1OQRA 1I7HA 4C7ZA 2QJLA 1WWTA 2BS4B 3HRDD 2IJ0A 1V8CA 3BVGA 1DOYA 2V3NA 1GOZA 1TY2A 2QSDA 4ZRPA 5TSSA 4P16A 3Q8AA 2JQRB 4ITKA 1QOBA 1D6EC 1PGBA 3ETRA 4XDDA 3FILB 1UNSA 1PUTA 1FXAA 1QILA 1JW9D 5HHDG 4RCOA 4N6EB 1FIQA 1MI0A 1STEA 2LFIA 3I9V1 1F2RC 1L0VB 3LYYA 1KRHA 1ZXIA 2NTSA 2N0SB 3MC0B 1TJEA 1FCLA 4REZA 4XE0A 1QF6A 1PDXA 1VDVA 3AEBB 4O1NA 1J7CA 2XNAC 4YTMB 1AWDA 3T3OA 1V97A 3VR9B 2BW2A 4A6QA 4RF1A 1D5MC 1JWUD 1XLOA 3SEBA 1UWXA 4YWGG 4A90A 2E3TA 3Q8EA 2ZW0A 3P4QB 1IUEA 3L4PA 5EE9A 4OZCA 5BMIA 4LLGM 3MP9A 1N60A 1SEBD 3I57A 3E9SA 3FAHA 4TMAB 4Q2JA 4TSSA 1UUPA 4ZHOA 5LNK1 4OZBA 1E6EB 1KLGD 1TS5A 1SIJA 2CJOA 4KGRA 3NVWA 1JQ4A 4IDIA 1YJIA 2I38A 1E9MA 4OW0A 1N63A 3B2GA 1ET6A 1VRAB 1XCTL 1FNUA 2DYOA 4HEA1 4ZOHC 2BB6A 2E6XA 2LHEA 1N61A 1YMHE 4IOIE 4PT5A 3UI3A 3TEXA 3AEFB 3P63A 4ZYSA 2IGGA 2K9XA 3NS1A 2V3PA 4RGOS 3Q69A 2PVGC 1JWBD 2HDEA 4GDLB 3BVMA 3AE1B 2OEDA 1HZ5A 3J9CA 2WXOA 1IGDA 3TUOA 1RWSA 2WXRA 1JCKB 1UGJA 2Q5WD 1I4HA 3KQ4A 2J42A 4KGTA 2G1EA 2FUG1 3LXFA 1ZP0B 1EU3A 2YEPF 4WURA 4NJCA 1YN4A 2EELA 2DLBA 1FXIA 3ABVB 4L1BA 3EUB2 4MH8A 4A8XC 1XLQA 2RPVA 3AE5B 3P1MA 1I4PA 1V1OA 4FXCA 4J3OD 2M19A 4LTUA 2CU3A 3B2FA 3PZ7A 2JXTA 3ZJVA 2KDMA 2IPKD 1V1PB 3TSSA 2WDRB 5D3DA 4YT0B 1DOXA 1SXTA 2WXIA 2WXMA 2B76B 4RGNA 2WXFA 2MJDA 1FNWA 1AN8A 4MACA 4L23A 1QKZA 3O13A 4WIPA 1CK1A 3W2DA 2WXLA 4HKQA 2AQ3B 5BMGA 1TY0A 2LUMA 3NRZA 5G5GA 1N5XA 1L0YB 2WXPA 2AQ2B 3PO0A 1VJKA 1GPXA 4N58A 2WXNA 1FRDA 2N9LA 2WXHA 1E7PB 1YJJA 4WH4A 1DYQA 3HVDA 1DGJA 1K50A 2INNE 1EM7A 2WU2B 4CQNA 3AMZA 1ENFA 2H89B 3TEYA 3AE3B 1TS3A 3ZQ4A 4A55A 1ZOYB 3AV8A 1J7AA 2ON8A 4KKIA 2WXGA 1SBBB 5FK9C 2D5GA 3FC4A 3GP7A 3AM9A 4HRSA 4B0MA 1D5XC 3N9YC 1J7BA 1B9RA 5I4DA 2WNMA 4DXFA 3MJ5A 4OZAA 4WQMA 1XEEA 1F2RI 1PYWD 2GB1A 4C7YA 3R2TA 4JWUC 3E56A 1MHHE 3IT6B 1HQRD 3P4SB 2MJEA 3IAS1 4RGMA 5BYSA 1UWMA 3URYA 1RFKA 2BB5A 3PZ8A 1IBXA 1XO3A 1F0ZA 1D4BA 2VZKB 2W82A 3AECB 1JWSD 2INPE 2MEKA 1SE3A 3EA6A 2KWDA 1FMAD 2JSVX 1BMLC 3GB1A 1L4DB 1FFUA 4YTPB 4ZRQA 5H8YE 3BZDB 4AQ7A 3EGRA 2WU5B 2X38A 4MT5A 1K51A 2DYMA 2ICIA 1JROA 4USAA 2RMMA 4R3DA 1BUIC 1RM6C 3Q8FA 1QQRA 3AN1A 3T3NA 3V05A 5BMHA 4JPSA 1DOIA 2AQ1B 5FKAC 1ZDXA 2Y5CA 1MHXA 2XN9C 2JYEA 1WRIA 3SFEB 1ZXHA 4HROA 1VZ8A 3AE7B 3NVYA 4RGTA 5D7GA 2WXKA 4C56C 2GI9A 1L5PA 1QOGA 4A9AA 2PW9A 2WDVB 1SE2A 4LK0M 2LMCA 3AH7A 5BYQA 3ZJUA 2MH7A 3NUHB 3AB5A 2AX5A 3B9JA 4US9A 1GB1A 1Q10A 2NMQA 2TSSA 1SJHD 1TKGA 4KKJA 3BK2A 4JE3B 4RF0A 5AUKA 4L2YA 1JALA 3VRAB 4IKGA 2WS3B 1IGCA 1HA5A 3TEWA 2OHFA 3IAM1 3MFGA 5EE3A 1I4QA 1C76A 2L1AA 3AE4B 2QIEB 3HUIA 2V0GA 2R61A 1KLUD 1WXQA 5C3JB 2IGHA 2BBCA 1CQVA 1EWYC 2KN4A 2WDQB 1FCCC 2KAJA 2QMTA 2Z8LA 3AEGB 5HFYA 4YTNB 2K3UA 3R2IA 5HI1A 1RYJA 1WGKA 2K0PA 4US8A 2PIAA 3VQIA 4HKZE 3P4RB 4ZHPA 1C77A 1E0ZA 3P4PB 3Q8CA 4XWTA 3LB8C 1ZPSA 2BS2B 3AEDB 3R8BA 2K5PA 2WXJA 4ARCA 2LJIA 1NYRA 2RDHA 3CWIA 4N59A 3BYTB 3CIRB 1NVID 1N5WA 1K52A 2V4IB 3AEEB 3AE9B 3KWLA 1JWAD 4YSXB 2DWQA 2WXQA 1C79A 1WSPA 5C2TB 1JRPA 1M4VA 2HTME 4OHJA 4XWWA 5BYRA 2DBYA 5T8IA 3U52E 1KFYB 1IBXB 2IDYA 4KX6B 1FD6A 1N62A 1L0XB 1D5ZC 2W3RA 1ROEA 1ESFA 1C4PA 1NYQA 5E6JA 4P6VF 4YXDB 1GAQB 1C4AA 1JMLA 2Y5PA 1SF0A 1P7EA 5G5HA 2N9KA 1P7FA 1XLPA 3NZ3A 1FO4A 4OVZA 2JZPA 1FRRA 1JWMD 1LO5D 1SSNA 1T5XD 3AE2B 3U2SC 1F77A 2CJNA 3AE8B 3ZYYX 3W9CB 2JX5A 5JXVA 1QLBB 1SE4A 1TKEA 1FNVA 1XF5L 5H92C 1PGAA 2SAKA 2I2YA 3BWUD 3H8HA 2JYTA 2GRIA 1K53A 4JX1C 1YN3A 2ACZB 1OQQA 1L6VA 4DQOC 3NVVA 3FILA 4KGSA 4NAWB 2W55A 1L4ZB 1ZE3D 2LGIA 3BVZA 2BT6A 3NVZA 3OWEB 1ET9A 1AW7A 2LHDA 3VR8B 3AEAB 1L6UA 4RH6A 1PGXA 2W3SA 1CZPA 1KH0A 4RNAA 4GDKB 1GB4A 1EU4A 1VZ7A 4HJGE 2H88B 1SJED 1NEKB 4H2AA 4DXGA 4WAFA 5EE0A 2EKIA 3ZGZA 3V3XA 2Y3AA 3BYYB 1XLNA 4JWSC 4XDCA 3P42A 1TS4A 1I4XA 3W5UB 1HZ6A 4GLSC 2L32A 1ACCA 1AYFA 3KLSX 1PFDA 1Y56A 3RPFC 1OFFA 2J53A 3W1SA 2BYTA 2G9HD 2KMMA 1QOAA 3W5VB 2L83A 1C4CA 3DWMA 2KACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYJ A;  2E3T A;  2PKO A;  4WWM A;  1A70 A;  1WGK A;  3P4Q B;  1IUE A;  3L4P A;  1FFV A;  2PIA A;  1SB3 C;  4WQM A;  5EE9 A;  4C7Y A;  2L52 A;  3P4R B;  4ZHP A;  1E0Z A;  2LEK A;  1N60 A;  3P4P B;  4JWU C;  1NI3 A;  3FAH A;  3LB8 C;  1YQ3 B;  2WQY B;  2BS2 B;  5GXG B;  3AED B;  4C80 A;  4ZHO A;  1TKY A;  1E6E B;  1TYG B;  1SIJ A;  2K5P A;  3P4S B;  5AUI A;  2MJE A;  5MPO A;  3HVZ A;  2CJO A;  1YQ4 B;  3NVW A;  1JQ4 A;  4IDI A;  1YJI A;  1NYR A;  1E9M A;  1UWM A;  3AE6 B;  1RFK A;  3CWI A;  4N59 A;  1N63 A;  3B2G A;  3CIR B;  1NVI D;  4ZOH C;  3SFD B;  2MJ3 A;  1XO3 A;  1N5W A;  1F0Z A;  1QT9 A;  1N61 A;  3AEC B;  3AE9 B;  1KF6 B;  2K22 A;  3AEE B;  3KWL A;  1JWA D;  3AEF B;  3P63 A;  4YSX B;  2K9X A;  3WCQ A;  3NS1 A;  1FMA D;  2DWQ A;  5C2T B;  1JRP A;  2PVG C;  1JWB D;  2HTM E;  2WLB A;  3AE1 B;  2DBY A;  1FFU A;  1KFY B;  4YTP B;  1R7S A;  1RWS A;  2BS3 B;  5H8Y E;  4KX6 B;  1N62 A;  2Q5W D;  2WU5 B;  2W3R A;  2W54 A;  1E10 A;  1ROE A;  1NYQ A;  4USA A;  1JRO A;  2G1E A;  4P6V F;  3LXF A;  1ZP0 B;  2FBW B;  1GAQ B;  4YSY B;  4YXD B;  3SFE B;  1RM6 C;  2M56 B;  1SF0 A;  1FM0 D;  3AN1 A;  5G5H A;  4YSZ B;  1XLP A;  3SR6 A;  1FO4 A;  1DOI A;  1FRR A;  3BII D;  3AE2 B;  3ZYY X;  2CJN A;  3AE8 B;  1FXI A;  2Y5C A;  3ABV B;  3W9C B;  3EUB 2;  2JX5 A;  1ZUD 2;  1XLQ A;  1CJE A;  1WRI A;  1QLB B;  3AE5 B;  1TKE A;  1T3Q A;  3P1M A;  1NEN B;  4FXC A;  4HRO A;  2PVO D;  5EE1 A;  3VRB B;  3AE7 B;  2M19 A;  3NVY A;  1WYG A;  4LTU A;  2CU3 A;  3B2F A;  1VLB A;  2WP9 B;  1L5P A;  1QOG A;  3DWG C;  1QOF A;  4JX1 C;  4A9A A;  1OQR A;  2ACZ B;  2WDR B;  1I7H A;  1OQQ A;  2WDV B;  1L6V A;  2QJL A;  3NVV A;  4YT0 B;  1WWT A;  4C7Z A;  2BS4 B;  2W55 A;  1DOX A;  3HRD D;  2B76 B;  3AH7 A;  1V8C A;  2MH7 A;  3AB5 A;  2AX5 A;  2MJD A;  3B9J A;  4US9 A;  2BT6 A;  1DOY A;  3NVZ A;  3VR8 B;  5H92 C;  1TKG A;  2JQR B;  3AEA B;  1L6U A;  4ITK A;  5AUK A;  3VRA B;  1JAL A;  1QOB A;  3ETR A;  2W3S A;  1CZP A;  2WS3 B;  1PUT A;  1FXA A;  3NRZ A;  5G5G A;  1N5X A;  1JW9 D;  2OHF A;  3PO0 A;  1VJK A;  2H88 B;  1GPX A;  1NEK B;  4N6E B;  4N58 A;  5EE3 A;  1FRD A;  1FIQ A;  1E7P B;  1YJJ A;  5EE0 A;  2EKI A;  1L0V B;  1DGJ A;  1KRH A;  1ZXI A;  2WU2 B;  3AE4 B;  2N0S B;  2QIE B;  3AMZ A;  1XLN A;  1TJE A;  3HUI A;  4JWS C;  2H89 B;  1QF6 A;  1PDX A;  3AE3 B;  3W5U B;  1WXQ A;  1ZOY B;  3AV8 A;  5C3J B;  1J7A A;  1VDV A;  3AEB B;  1AYF A;  1J7C A;  1PFD A;  3RPF C;  4US8 A;  1EWY C;  1OFF A;  2WDQ B;  4YTM B;  2KAJ A;  3FC4 A;  1AWD A;  3AM9 A;  3AEG B;  1V97 A;  2KMM A;  4HRS A;  1QOA A;  3VR9 B;  3W5V B;  1XLO A;  4YTN B;  1J7B A;  2L83 A;  1B9R A;  3DWM A; 
#chains in the Genus database with same CATH topology
 2PKO A;  3IG3 A;  3WAM A;  2BTE A;  4NAM A;  1C78 A;  4LJO B;  1K8R B;  3ZJT A;  2WQY B;  3TCA A;  3T8M A;  1TYG B;  3HM3 A;  5AUI A;  4GXB A;  2NTT A;  4D2K A;  2NS5 A;  4I6P A;  2INC C;  3QHT A;  1YNT E;  3AE6 B;  3SFD B;  1ZDV A;  2N7D A;  4UDU C;  3ZIM A;  3Q8B A;  4II2 B;  4MH0 E;  4TV3 A;  2CHZ A;  4AJY B;  3QCA A;  1KF6 B;  1I4G A;  3WCQ A;  1YN5 A;  3VXW A;  3APF A;  1MPE A;  3ZUN A;  5J2R A;  4DWF A;  1MVK A;  2FIF A;  3C8Y A;  1E10 A;  3L0W B;  1VR9 A;  4HDO A;  4RFB A;  2Z0E B;  5J17 A;  5C23 A;  2XBB C;  2M56 B;  1WIA A;  1V1P A;  3VUY A;  2NBW B;  3BII D;  3PRZ A;  4MEL A;  4TQ1 A;  4QAY A;  1ZUD 2;  1LGR A;  4GIV A;  2MBO A;  2CHX A;  1KTK A;  2LRU A;  4C7Z A;  4F7Z A;  2O6V A;  3PRM B;  3HRD D;  1WFY A;  4X57 B;  2FUH B;  5TSS A;  4P16 A;  5KHQ A;  4DK5 A;  4M00 A;  4YL8 A;  4HWI B;  4RCO A;  2LFI A;  2LVO A;  3I9V 1;  2NTS A;  2N0S B;  1TJE A;  3R3M A;  4BBN C;  1QF6 A;  3MTN B;  4BAX A;  4ICU A;  3HIZ A;  3VR9 B;  2VRR B;  4MSM B;  1UWX A;  4A90 A;  2LVP A;  3QAR A;  3L4P A;  2KAN A;  4OZC A;  2OOB B;  2PPH A;  4P7I A;  3FAH A;  4LNI A;  2CJO A;  3QA8 A;  4KGR A;  1YJI A;  1E8X A;  1VRA B;  3PLV A;  4HCN B;  2LHE A;  3M63 B;  4PT5 A;  4EUT A;  1OTR B;  3NS1 A;  5J18 A;  4RGO S;  2PVG C;  3RYT A;  2OED A;  2YLM A;  3TUO A;  1RWS A;  1JCK B;  2Q5W D;  3PSE B;  2MP2 B;  2JPH A;  2KQS A;  2G1E A;  3NG0 A;  3Q2A C;  1EU3 A;  3IVF A;  3ABV B;  4L1B A;  4MH8 A;  1XLQ A;  3AE5 B;  3P1M A;  1RFA A;  3PLU A;  3QK0 A;  3B2F A;  1E8W A;  4K1R B;  2I1J A;  4DBG A;  4RGN A;  1F1H A;  5JHB A;  4NJ7 A;  4FAD A;  4HKQ A;  2AQ3 B;  3ZRC A;  2XK5 B;  2YVC A;  3NZU A;  5LXH A;  1F52 A;  2KC1 A;  1GPX A;  2N9L A;  4WH4 A;  3KUC B;  1DYQ A;  1K50 A;  2INN E;  2ZEQ A;  2WU2 B;  3UQB A;  3AMZ A;  2LRW A;  3NJT A;  1TS3 A;  1UGM A;  1FXT B;  4IM0 A;  2M1M A;  2ZCB A;  3MJ5 A;  3MHS D;  4WQM A;  1F2R I;  2GB1 A;  3ZNI D;  2N9X A;  4FUL A;  4KSL C;  1Y8R C;  4K7S A;  4RGM A;  4WJO A;  3ZTC A;  5DPR A;  1IBX A;  1XO3 A;  1V9J A;  5JHA A;  3PGE A;  2INP E;  2QHO A;  3KYC D;  2LD9 A;  1L4D B;  3VHT C;  1FFU A;  3Q3M C;  4YTP B;  1S1Q B;  4AQ7 A;  2KJR A;  2ZCC A;  1WYW B;  4XX5 A;  2JVC A;  2DYM A;  1JRO A;  1ZKH A;  4R3D A;  1RM6 C;  2KMC A;  1ISN A;  2FNJ B;  2KVR A;  2CU1 A;  2KYW A;  3ZDT A;  1C1Y B;  1ZGU B;  5D7G A;  2WXK A;  4M01 A;  4PK1 A;  2BF8 B;  2WDV B;  4GB9 A;  1SE2 A;  4LK0 M;  2M17 A;  5BYQ A;  2MH7 A;  5HKH A;  1Q10 A;  2NMQ A;  2TSS A;  4BOS C;  1SJH D;  1TKG A;  4RF0 A;  1JAL A;  4IKG A;  2WS3 B;  1IGC A;  4KIK B;  2BYV E;  4WAA A;  2UWQ A;  1HA5 A;  3TIX A;  4WJQ A;  1C76 A;  3FKY A;  1WJ6 A;  4FJV B;  3V6E B;  1WM2 A;  1Z5S B;  5C3J B;  4AP4 C;  1WMH A;  1FCC C;  2QMT A;  3ZNG C;  4ANX A;  4YTN B;  1TIF A;  2GBK A;  1RYJ A;  1P98 A;  3P4R B;  3A9J B;  2KKC A;  2KX3 A;  3A1Q B;  2ZZP B;  3DVG X;  3CSF A;  4KDI C;  3AE9 B;  1JWA D;  2WXQ A;  1JRP A;  4XWW A;  1KFY B;  1I42 A;  2IDY A;  2KTR A;  3TMP B;  1WI0 A;  2KJH B;  2BKR B;  2L05 A;  1I35 A;  2RSU A;  2KD0 A;  2RDB C;  1KM7 A;  1NYQ A;  2HJ1 A;  4P6V F;  3VFK A;  2KHW B;  4HXD A;  2Y5P A;  1SF0 A;  5G5H A;  1MG4 A;  2K1F A;  4OVZ A;  2JZP A;  1FRR A;  1F77 A;  2CJN A;  3CF6 E;  2JX5 A;  5JXV A;  1FNV A;  1XF5 L;  3DVN U;  2D07 B;  1EF1 A;  1WGY A;  4K7U A;  3FIL A;  2MBE A;  4P1B C;  3JVZ X;  2Z59 B;  3R7Q A;  3SD5 A;  1LFD A;  3UIN B;  2LHD A;  3VR8 B;  1F9J A;  2MBQ A;  2MCN B;  3PZD A;  3OLM D;  3AXC A;  2O6V D;  2GBR A;  4DXG A;  2H88 B;  4H2A A;  4MSQ B;  4JLC A;  3V3X A;  1XLN A;  4XDC A;  4GDK A;  4GLS C;  3DBH I;  2L32 A;  3KLS X;  4G50 A;  2J53 A;  3DBS A;  2BYT A;  3HK0 A;  1EO6 A;  2AEH A;  5AZG A;  1FFV A;  2WYQ A;  2L52 A;  2KWU B;  2LEK A;  4EE2 A;  2ONQ A;  3KWV A;  1NI3 A;  2M8S A;  1T6B X;  2UYZ B;  3HVZ A;  1XCQ L;  3U7Z A;  3ZO5 B;  1TS2 A;  1VZ6 A;  3GS2 A;  1T0Q C;  1HEZ E;  1JRU A;  2PMV A;  2ZW1 A;  1E7U A;  2GMI C;  4MGI E;  5KHO A;  2WLB A;  3IXS A;  4W9K A;  1B1Z A;  4TQ0 A;  2R2Q A;  2M0A A;  2BQQ A;  2IZV B;  2V9H A;  1WE6 A;  3QAQ A;  3GE3 C;  4WQO B;  2FE8 A;  2NPT A;  4ZRJ A;  3JSV A;  2K6Q A;  4LDT D;  2DZJ A;  3ML9 A;  2LJ5 A;  2IGD A;  1WYG A;  3DVG Y;  1BXT A;  1EWC A;  2PLP A;  1QOF A;  2O2V A;  3RMK C;  1BT0 A;  2J7Q B;  4MJS A;  2IJ0 A;  1V8C A;  3BVG A;  3VUX A;  2V3N A;  2QSD A;  2CS4 A;  1VCB A;  3Q8A A;  2IY1 B;  4DHJ B;  3ETR A;  4IC7 B;  1PUT A;  5DPS A;  3OJ4 B;  2KLG A;  4N6E B;  1FIQ A;  1STE A;  3L16 A;  1F2R C;  1V6E A;  3ZRF A;  1RLF A;  1E90 A;  3GOE A;  1WGD A;  4REZ A;  4XE0 A;  2KFK B;  1XQQ A;  1KLV A;  5AEK B;  4HVB A;  3RUI B;  1VDV A;  5JH5 C;  1J7C A;  2XNA C;  3AU4 A;  2PJH A;  3N3K B;  4N9F 4;  3T3O A;  3BY4 B;  4RF1 A;  1JWU D;  2EMT A;  5CHF A;  4YWG G;  2NBU A;  2B3A A;  2FCQ A;  2DZM A;  2E3T A;  3Q8E A;  4NJ6 A;  3P4Q B;  1IUE A;  5BMI A;  4LLG M;  1N60 A;  1SEB D;  5LNK 1;  3DBH B;  4KZ0 A;  5E6P A;  3WA0 A;  2MX2 A;  3NVW A;  1JQ4 A;  1HTQ A;  2I38 A;  4M0W B;  4OW0 A;  3WAL A;  3B2G A;  4HEA 1;  1FNU A;  2BB6 A;  2E6X A;  3RNB C;  1YMH E;  2JUO A;  3UI3 A;  3AEF B;  2JY6 A;  4ZYS A;  2IGG A;  1LM8 B;  1WY8 A;  3Q69 A;  1JWB D;  1V2Y A;  2WXO A;  4PYU A;  1I4H A;  4M8M A;  2J42 A;  4KGT A;  2L0T A;  3IHP C;  2YEP F;  4NJC A;  1YN4 A;  3KUD B;  2AL6 A;  3RUL A;  1V1O A;  2M19 A;  3A9K B;  3PZ7 A;  2JXT A;  2LXA A;  2C9W B;  4FN2 A;  5D3D A;  4YT0 B;  5EDS A;  1AN8 A;  3EFC A;  4L23 A;  2OJR A;  1QKZ A;  3I3T B;  2RR9 A;  3O13 A;  3W2D A;  3RT3 B;  5CTR C;  3H7P B;  3NRZ A;  2HE7 A;  1N5X A;  2BYE A;  2L76 A;  5IN7 A;  4WJN A;  1VJK A;  4P1C C;  2BWF A;  1R4M I;  3DPD A;  3WAN A;  4CQN A;  4IWO A;  3AE3 B;  2N4F A;  4K3C A;  4A55 A;  2ON8 A;  1T0S C;  1SBB B;  3Q3N C;  2CHW A;  3GP7 A;  3UGB B;  1J7B A;  4RMA A;  4CYE A;  2WNM A;  4C4V A;  3N32 A;  2JF5 A;  4DXF A;  4OZA A;  2D2Q A;  1XEE A;  1V81 A;  1PYW D;  4C7Y A;  2KDI A;  1HE8 A;  3T9L A;  4ZRI A;  3R2T A;  4JWU C;  2PE6 B;  1J8C A;  3IT6 B;  1HQR D;  3ZNH B;  3IAS 1;  1E8Z A;  3KVF B;  1UWM A;  3URY A;  1RFK A;  2BB5 A;  1YX5 B;  1F0Z A;  1D4B A;  5IAA C;  1SE3 A;  2LUE A;  4KVG B;  4LNN A;  1BML C;  1N6Z A;  3O65 B;  3PS6 A;  2DAF A;  2KZR A;  1K51 A;  4S0R A;  2ICI A;  2MA9 B;  3KYD D;  3PRE A;  3R7R A;  1BUI C;  1QQR A;  5G55 A;  4JPS A;  3H1U A;  2AQ1 B;  1ZDX A;  1WX8 A;  2Y5C A;  4NAW A;  1P3Q U;  1MHX A;  3EFU A;  3EHV A;  2XN9 C;  2JYE A;  4FBJ B;  1IP9 A;  1WRI A;  3VUW A;  1VZ8 A;  1WE7 A;  3NVY A;  3Q3O C;  4EZK A;  2IY0 B;  2M4N A;  2PW9 A;  2LMC A;  2AX5 A;  1GB1 A;  3DDC B;  3PTF C;  1V5T A;  4KKJ A;  3VTU A;  4JE3 B;  4XGA B;  1X1M A;  2Z0D B;  4L2Y A;  1EF5 A;  3TEW A;  2OHF A;  3IAM 1;  2FCN A;  3MFG A;  3Q6B A;  3AU5 A;  4EOY A;  4WWN A;  4II3 B;  2L1A A;  1YQB A;  4FLH A;  4PS3 A;  3WAP A;  5TR5 A;  2BBC A;  1CQV A;  1WGG A;  3DBR I;  2KTF A;  2KAJ A;  5IA7 A;  5LLI A;  1R4M B;  2LGX A;  2KK8 A;  2K0P A;  3VQI A;  3AI5 A;  4GN1 A;  1E0Z A;  5GMV A;  3APC A;  3Q8C A;  3ZLZ A;  1WH3 A;  2K5P A;  2JXX A;  4M8N A;  3V62 A;  2LJI A;  1NYR A;  4N59 A;  5CHW A;  3BYT B;  3CIR B;  4PS8 A;  1E8Y A;  2V1Y A;  2C7H A;  2KTR B;  5AZH A;  4GGQ A;  1GNU A;  3LDZ E;  3KWL A;  4WWO A;  3KH0 A;  2DWQ A;  2KOX A;  5IO9 A;  5CHV C;  2DYB A;  5BYR A;  2DBY A;  1J0G A;  4JGH B;  4KX6 B;  1TTN A;  1N62 A;  1L0X B;  3ML8 A;  4ICV A;  1ROE A;  4BKS D;  2MWS B;  4YXD B;  2G3Q B;  3QQ8 B;  1P7E A;  2N9K A;  1P7F A;  4HPP A;  3NZ3 A;  1SSN A;  3U2S C;  3AE2 B;  4PS7 A;  3ZYY X;  3W9C B;  4W9C A;  1TBE A;  1QLB B;  5H92 C;  3VH4 B;  2SAK A;  4LNF A;  2JYT A;  1K53 A;  3X23 A;  1YN3 A;  1OQQ A;  3NVV A;  4KGS A;  3RNC C;  2WWZ A;  2KMA A;  3BVZ A;  4LNO A;  3NVZ A;  3OWE B;  1AW7 A;  3AEA B;  1L6U A;  4RH6 A;  1WRD B;  3DVN V;  3L08 A;  1PGX A;  3V6C B;  1CZP A;  2L3Z A;  1KH0 A;  4GDK B;  4MGZ E;  1EU4 A;  1VZ7 A;  4HJG E;  1SJE D;  1S3S G;  4WAF A;  2N7E A;  2C60 A;  2EKI A;  3ZGZ A;  2L8J A;  3BYY B;  4JWS C;  1HZ6 A;  1AAR A;  4IG7 B;  1UEL A;  1AYF A;  4AUQ C;  1OFF A;  3KW5 B;  4MGK E;  2G9H D;  1P1A A;  4FHJ A;  2L83 A;  2ASQ A;  3DWM A;  3EA6 A;  4ACF A;  1GG3 A;  1A70 A;  1SB3 C;  3QX1 A;  5FR3 A;  3RCZ A;  3RFZ B;  1MG8 A;  1YQ3 B;  5GXG B;  1FEH A;  1TKY A;  2J4X A;  5MPO A;  3DBR B;  4KZC A;  1YQ4 B;  2D3B A;  1SGH A;  5HG2 A;  5IOI A;  2GBJ A;  4B9K A;  4TKN A;  2VZK D;  2YEP B;  4FJY A;  4AWJ A;  1I4R A;  2MP2 A;  4MGY E;  2N1V A;  1GC7 A;  1R7S A;  2BS3 B;  2JWU A;  2W54 A;  1TZO A;  4F8C B;  4G11 A;  4B0E A;  4YSY B;  1MJD A;  4AS1 A;  1WXA A;  3RI7 C;  2MBH A;  4MJS B;  1C9F A;  2WDT B;  3NZS A;  3VRB B;  4NZL B;  5EE1 A;  3RD2 A;  4MM3 A;  2QIL A;  2PVO D;  1VLB A;  1UH6 A;  2WP9 B;  2ZNV B;  3DWG C;  2N7J A;  5DPW A;  4M02 A;  2FCS A;  1WWT A;  2BS4 B;  3PHX B;  2KDB A;  3N20 C;  2K8H A;  2AL3 A;  4BKG A;  1DOY A;  1GOZ A;  2IND C;  4ZRP A;  3RZF A;  4ITK A;  1D6E C;  4XDD A;  4DXA B;  1FXA A;  3JYU A;  4DDG D;  2M0X A;  1MI0 A;  2DEN B;  5E6O A;  3LYY A;  1UZX B;  5LXI B;  2IO2 B;  1ZXI A;  3MJW A;  4IWP A;  3MC0 B;  1WJ4 A;  4HCP B;  3AEB B;  4O1N A;  1E5W A;  2N9P C;  1V97 A;  3U8Z A;  2BW2 A;  2EKE C;  4A6Q A;  3H7S A;  3SEB A;  3DBL B;  2A5U A;  2ZW0 A;  3ZXR A;  2AYO B;  5EE9 A;  3I57 A;  4TSS A;  4ANV A;  4Q2J A;  1UUP A;  4OZB A;  1TS5 A;  4W9D A;  3HHM A;  4IDI A;  2LAS A;  1N63 A;  4ZOH C;  2DYO A;  2LVQ A;  2NBV B;  2BKF A;  1N61 A;  2HTH A;  3GE8 C;  2JRI B;  1WX9 A;  4W9E A;  2C5L C;  2HDE A;  2HD5 B;  4HDQ A;  3I5J C;  3BVM A;  3M95 A;  1KJT A;  1IGD A;  1T0Y A;  3KQ4 A;  3ONS A;  2VH2 A;  2FUG 1;  2JT4 B;  2MW5 A;  1ZP0 B;  2BVC A;  3RNA C;  4GDL A;  2EEL A;  1GC6 A;  4DHJ D;  2LWP A;  1LQB A;  3EUB 2;  4A8X C;  2RPV A;  1IPG A;  4BKS A;  1I4P A;  4FXC A;  2QCZ A;  4K7W A;  4LTU A;  1YD8 U;  2DX5 B;  2MHJ A;  3EC8 A;  1V1P B;  2WDR B;  1WGR A;  2R2O A;  1WZ3 A;  1UF0 A;  2WXF A;  2MJD A;  4G3X B;  1U4A A;  3M3J A;  4IM3 A;  4EZJ A;  2O6V B;  1TY0 A;  2LUM A;  5G5G A;  1GUA B;  2AQ2 B;  2KNB A;  2WXN A;  3HVD A;  1EM7 A;  2EMS A;  1V5O A;  2H89 B;  4C4V B;  2LGY A;  2QC8 A;  1ZOY B;  3ECI A;  2WXG A;  4ASW C;  2JWZ A;  2QDF A;  3FC4 A;  2GLS A;  3AM9 A;  4B0M A;  3N9Y C;  4NY0 A;  1B9R A;  5I4D A;  1WM3 A;  3VDZ A;  2MLB A;  4B6W A;  4W9J A;  4EKU A;  3DCG A;  3NOB A;  1MHH E;  2MJE A;  2ZPN A;  5BYS A;  2ZNV C;  4IWQ A;  2D3G A;  3ZVV A;  2HJ8 A;  1TZ1 A;  2KWD A;  2IBI B;  3GB1 A;  4W9H A;  3TL5 A;  4BVU C;  4ZRQ A;  5H8Y E;  2JZZ A;  2X38 A;  3ZNZ B;  4USA A;  1OEY J;  4A3O A;  2RMM A;  4RM8 A;  3Q8F A;  3AN1 A;  3V05 A;  2MRP A;  2MQJ A;  2Y5B B;  2KDF B;  4LDT B;  5CX3 A;  1ZXH A;  4HRO A;  3AE7 B;  3ALB A;  3AUL A;  4AJW A;  4C56 C;  2GI9 A;  2G45 B;  4A9A A;  2RPQ A;  3ZW3 A;  4JL9 A;  3ZDM C;  1WGH A;  4GU2 A;  1V49 A;  3ZJU A;  4EFO A;  3W1S C;  2REX A;  4OVU A;  3ZKJ C;  3H9D A;  3BK2 A;  1WJU A;  1R4N I;  3VRA B;  4IW0 A;  1T0R C;  1I4Q A;  2IO3 B;  2N1W A;  3ZTD A;  4W9F A;  4OVV A;  2V0G A;  3N1Y C;  1H4R A;  2R61 A;  5D6J B;  1EWY C;  2KN4 A;  4HK2 A;  2K8B A;  3AEG B;  5HFY A;  2K3U A;  3R2I A;  1YX6 B;  1WGK A;  4US8 A;  2PIA A;  1L2N A;  4HKZ E;  2RGF A;  4ZHP A;  1TGZ B;  1C77 A;  4NPN A;  4XWT A;  1ZPS A;  2BS2 B;  2PE9 A;  3DHI C;  3R8B A;  1A5R A;  1XD3 B;  2DZK A;  3PV1 A;  4ARC A;  2NVU I;  4CHK A;  3W1Y A;  2OJW A;  3AEE B;  4EZL A;  4YSX B;  3GZN I;  1UBI A;  4G0N B;  1C79 A;  1Q5W B;  2KC2 A;  1M4V A;  2HTM E;  4OHJ A;  2DAJ A;  5T8I A;  1J19 A;  3P2B A;  1IBX B;  2A4Z A;  1YIW A;  3APD A;  1FD6 A;  4NQL B;  2KDE B;  4HPM B;  2DNF A;  1V80 A;  1ESF A;  5DPT A;  1C4A A;  2DHZ A;  1XLP A;  1PQS A;  4LCD E;  1FO4 A;  1JWM D;  3A4S C;  5E6N A;  1WXV A;  3AE8 B;  2KFJ A;  1SE4 A;  1TKE A;  4KV2 A;  1PGA A;  2ZPY A;  2I2Y A;  2GBM A;  3BWU D;  2CR5 A;  4ANW A;  2GRI A;  2ACZ B;  4DQO C;  1WJN A;  2FID A;  3SHQ A;  2LGI A;  1XT9 B;  3EEC A;  3MC8 A;  2J0M A;  5DCN A;  2KFK A;  4URK A;  1GB4 A;  1IYF A;  4WWP A;  1NEK B;  3NS8 A;  5BO4 B;  1Q0W B;  3K9P B;  4WJP A;  1I4X A;  1ZW7 A;  1R4N B;  3CMM B;  3CST A;  3OJ3 A;  1Y56 A;  3IBE A;  3RPF C;  2KMM A;  2G4D B;  2AWT A;  3Q14 C;  1C4C A;  4TUU A;  2KAC A;  4M0W A;  2JU6 X;  4WWM A;  3DQV A;  1WMH B;  3N1Z C;  3BK1 A;  4C80 A;  2KJ6 A;  2WGS A;  3B08 A;  2SEB D;  3TEZ A;  2L00 B;  1WF9 A;  2LGS A;  2BYF A;  2MJ3 A;  3U7D A;  1SIF A;  1WXM A;  2PTL A;  2RDG A;  2K6D B;  1QT9 A;  4XYC A;  2NCN A;  4W9G A;  4BOZ B;  2K22 A;  2MSE D;  2L0F A;  3VTW A;  4K81 A;  2J52 A;  2RD0 A;  2BWE S;  2QEJ C;  4J6I A;  3RZW C;  5D3I B;  3PHW B;  3NHE B;  4MM3 B;  2FBW B;  1XXG A;  3A9K A;  3U4E G;  1FM0 D;  2KQ4 X;  3GZN B;  4YSZ B;  3SR6 A;  4I6N B;  3IT4 B;  4ARI A;  3RN9 C;  4BBN F;  1CJE A;  1HXY D;  4BKT A;  1T3Q A;  3MHZ A;  1NEN B;  1OGW A;  2J0J A;  1OQR A;  1I7H A;  3R66 C;  3H7P A;  2QJL A;  1L7Y A;  2WX0 A;  5IP4 D;  1TY2 A;  3PT2 B;  2JQR B;  4BFR A;  1EUV B;  1QOB A;  1PGB A;  3QWZ B;  3OG5 A;  3FIL B;  1UNS A;  3QIJ A;  1QIL A;  2J0K A;  1JW9 D;  4FHK A;  5HHD G;  2LI5 A;  2L7R A;  1V86 A;  5L83 A;  2PEA A;  1L0V B;  1KRH A;  3PPA A;  1G6J A;  2FCM A;  2D3A A;  2ZJD A;  1FCL A;  1WZ0 A;  1PDX A;  2K8C A;  3NY5 A;  3VTV A;  4YTM B;  4PYZ A;  1AWD A;  1D5M C;  1XLO A;  4XZ4 A;  2NR2 A;  1P0R A;  2VH1 A;  4C00 A;  5FR6 A;  1TT5 B;  3TBL D;  3UIP B;  3MP9 A;  3E9S A;  4TMA B;  4ZHO A;  3DBL I;  1E6E B;  1KLG D;  1SIJ A;  4KSK C;  4IM2 A;  2BPS A;  1E9M A;  1ET6 A;  1XCT L;  2D10 A;  3A33 B;  3PRP B;  4IUM B;  4IOI E;  3TEX A;  3P63 A;  2K9X A;  2V3P A;  4GMV A;  4GDL B;  3AE1 B;  2LXC A;  1HZ5 A;  3J9C A;  3WIM A;  2WXR A;  5JZE B;  1UGJ A;  4B95 A;  3U30 A;  1UD7 A;  1CMX B;  3LXF A;  4MDK E;  1Z2M A;  4WUR A;  1FPY A;  2DLB A;  1FXI A;  4NQK E;  1MFW A;  4J3O D;  1NDD A;  2X8X X;  1E7V A;  2CU3 A;  4E3C A;  3L13 A;  2IO0 B;  3ZJV A;  2KDM A;  1NI2 A;  2IPK D;  3I63 C;  3TSS A;  2NPT B;  4CO7 A;  2K39 A;  3JSV B;  1DOX A;  1C3T A;  1SXT A;  3KUZ A;  2WXI A;  2WXM A;  2B76 B;  4K3B A;  4MAC A;  1FNW A;  3L54 A;  2JRH A;  4WIP A;  1CK1 A;  2WXL A;  2O2V B;  3DOW A;  4A3P A;  5IKC M;  5BMG A;  2WXP A;  1L0Y B;  3PO0 A;  4N58 A;  1FRD A;  2WXH A;  1E7P B;  1YJJ A;  1DGJ A;  2W9N A;  3QC8 B;  3VVW B;  4F1S A;  4JIO U;  1ENF A;  2XK5 A;  3TEY A;  3ZQ4 A;  5D94 A;  1NBF C;  3AV8 A;  4EEW A;  1J7A A;  1SE9 A;  4KKI A;  3K9O B;  2JZ3 B;  5FK9 C;  2D5G A;  4I6L B;  2WHI A;  4HRS A;  1D5X C;  4W9I A;  3BIN A;  4E71 A;  2GBN A;  3L10 B;  2D3C A;  2KT7 A;  3A4R A;  3E56 A;  2CKH B;  3P4S B;  3DHH C;  1KOT A;  3PVL A;  2KVZ A;  4RM9 A;  2IYD B;  5C1Z A;  2G4S A;  3PZ8 A;  2VZK B;  2W82 A;  3AEC B;  1JWS D;  1OEY A;  2DZI A;  2MEK A;  3RNG C;  4BZA A;  2I1K A;  2KWV B;  3TJP A;  1FMA D;  4MEM A;  4A20 A;  2JSV X;  2BGF A;  2XEW A;  2N9E B;  1VD2 A;  4GOC A;  3BZD B;  3EGR A;  5AZF A;  4S17 A;  2WU5 B;  4MT5 A;  3LJ3 A;  4HPL B;  1WX7 A;  3T3N A;  5BMH A;  1DOI A;  5FKA C;  3WAO A;  3SFE B;  2C7N B;  3N30 A;  1WR1 A;  4RGT A;  1YOV B;  2V4L A;  1L5P A;  3UIO B;  1QOG A;  5G2N A;  3AH7 A;  3QJZ A;  5L95 C;  3NUH B;  3AB5 A;  1D3Z A;  3B9J A;  4US9 A;  3SDL C;  1WXS A;  3HM6 X;  4E74 A;  5AUK A;  3Q3J A;  2LGD A;  3M62 B;  3ENE A;  4AOF A;  2IO1 B;  5EE3 A;  2ZVO A;  2KN5 A;  3AE4 B;  3JW0 X;  2QIE B;  3Q3F A;  3HUI A;  4HJK A;  1GJZ A;  4KIK A;  4DDI D;  1KLU D;  1WXQ A;  2IGH A;  3V60 A;  2KLC A;  2WDQ B;  2Z8L A;  3B1L X;  3DHG C;  2D11 A;  3RNE C;  1RRB A;  2UU7 A;  3X0W A;  5HI1 A;  3S2A A;  2KQ7 A;  3VAW A;  1LXD A;  3P4P B;  3LB8 C;  3AED B;  1QZE A;  4KDL B;  2WXJ A;  2RDH A;  3CWI A;  4W9L A;  4ANU A;  1NVI D;  4XC2 A;  1N5W A;  1K52 A;  1P9D U;  2V3S A;  2FAZ A;  2KXJ A;  4ZRK A;  3V61 A;  2V4I B;  3A9J A;  3A1Q A;  3C0R B;  5C2T B;  1WSP A;  3H6N A;  2ZVN A;  3U52 E;  1WR6 E;  3D32 A;  2LZ6 A;  2GOW A;  4HLE A;  1D5Z C;  2W3R A;  1C4P A;  5E6J A;  3C19 A;  3UQA A;  1GAQ B;  1JML A;  4FJZ A;  1RAX A;  1LO5 D;  1HTO A;  1T5X D;  2K25 A;  4LNK A;  3L17 A;  2KX0 A;  4JQW C;  4ZYN A;  2KO3 A;  3IFW B;  3H8H A;  2WX1 A;  1H8C A;  1OQY A;  2MBB B;  4JX1 C;  3SU8 X;  4FA6 A;  2C7M B;  1L6V A;  1Q1O A;  4NAW B;  1M94 A;  1L4Z B;  2W55 A;  4NNJ B;  3UF8 A;  1ZE3 D;  5D2M B;  1YJ1 A;  2BT6 A;  3RNF C;  1ET9 A;  4GSW A;  3ZXV A;  3OAW A;  4ZDV A;  2W3S A;  3B0A A;  4DHZ B;  4RNA A;  1UBQ A;  2KWC A;  4DHZ E;  4LJP B;  5EE0 A;  3N1X C;  2Y3A A;  3P42 A;  1TS4 A;  3W5U B;  3MC9 A;  1ACC A;  1PFD A;  3W1S A;  3VH3 B;  1QOA A;  3W5V B; 
#chains in the Genus database with same CATH homology
 2PKO A;  4M0W A;  2JU6 X;  4NAM A;  1A70 A;  4WWM A;  2BTE A;  1FFV A;  1C78 A;  1SB3 C;  3ZJT A;  2L52 A;  5FR3 A;  2LEK A;  4EE2 A;  2ONQ A;  3KWV A;  1NI3 A;  3RFZ B;  3BK1 A;  1YQ3 B;  2WQY B;  5GXG B;  4C80 A;  1FEH A;  1TKY A;  1TYG B;  2J4X A;  1T6B X;  2SEB D;  5AUI A;  5MPO A;  3TEZ A;  2NTT A;  4D2K A;  3HVZ A;  1YQ4 B;  1XCQ L;  3U7Z A;  1YNT E;  3AE6 B;  5HG2 A;  3SFD B;  1ZDV A;  4UDU C;  2MJ3 A;  3Q8B A;  1TS2 A;  1VZ6 A;  2PTL A;  2RDG A;  1QT9 A;  2VZK D;  3GS2 A;  2YEP B;  1KF6 B;  2K22 A;  1I4R A;  2ZW1 A;  1HEZ E;  2PMV A;  1I4G A;  3WCQ A;  1YN5 A;  2WLB A;  1MPE A;  3IXS A;  2J52 A;  1B1Z A;  1R7S A;  4TQ0 A;  2BS3 B;  2M0A A;  2JWU A;  2QEJ C;  1MVK A;  3C8Y A;  2W54 A;  1E10 A;  5D3I B;  1VR9 A;  4MM3 B;  4RFB A;  1TZO A;  2FBW B;  4B0E A;  4YSY B;  1XXG A;  2M56 B;  3U4E G;  2FE8 A;  1FM0 D;  2KQ4 X;  4YSZ B;  4AS1 A;  3SR6 A;  3IT4 B;  1V1P A;  4ARI A;  3BII D;  4TQ1 A;  1C9F A;  1ZUD 2;  1HXY D;  1CJE A;  3VRB B;  1T3Q A;  3MHZ A;  4NZL B;  1NEN B;  2QIL A;  5EE1 A;  2PVO D;  2IGD A;  1WYG A;  1VLB A;  2WP9 B;  1BXT A;  1EWC A;  2PLP A;  3DWG C;  1QOF A;  2N7J A;  1KTK A;  1OQR A;  1I7H A;  4C7Z A;  2QJL A;  1WWT A;  2BS4 B;  3HRD D;  2IJ0 A;  1V8C A;  3BVG A;  1DOY A;  2V3N A;  1GOZ A;  1TY2 A;  2QSD A;  4ZRP A;  5TSS A;  4P16 A;  3Q8A A;  2JQR B;  4ITK A;  1QOB A;  1D6E C;  1PGB A;  3ETR A;  4XDD A;  3FIL B;  1UNS A;  1PUT A;  1FXA A;  1QIL A;  1JW9 D;  5HHD G;  4RCO A;  4N6E B;  1FIQ A;  1MI0 A;  1STE A;  2LFI A;  3I9V 1;  1F2R C;  1L0V B;  3LYY A;  1KRH A;  1ZXI A;  2NTS A;  2N0S B;  3MC0 B;  1TJE A;  1FCL A;  4REZ A;  4XE0 A;  1QF6 A;  1PDX A;  1VDV A;  3AEB B;  4O1N A;  1J7C A;  2XNA C;  4YTM B;  1AWD A;  3T3O A;  1V97 A;  3VR9 B;  2BW2 A;  4A6Q A;  4RF1 A;  1D5M C;  1JWU D;  1XLO A;  3SEB A;  1UWX A;  4YWG G;  4A90 A;  2E3T A;  3Q8E A;  2ZW0 A;  3P4Q B;  1IUE A;  3L4P A;  5EE9 A;  4OZC A;  5BMI A;  4LLG M;  3MP9 A;  1N60 A;  1SEB D;  3I57 A;  3E9S A;  3FAH A;  4TMA B;  4Q2J A;  4TSS A;  1UUP A;  4ZHO A;  5LNK 1;  4OZB A;  1E6E B;  1KLG D;  1TS5 A;  1SIJ A;  2CJO A;  4KGR A;  3NVW A;  1JQ4 A;  4IDI A;  1YJI A;  2I38 A;  1E9M A;  4OW0 A;  1N63 A;  3B2G A;  1ET6 A;  1VRA B;  1XCT L;  1FNU A;  2DYO A;  4HEA 1;  4ZOH C;  2BB6 A;  2E6X A;  2LHE A;  1N61 A;  1YMH E;  4IOI E;  4PT5 A;  3UI3 A;  3TEX A;  3AEF B;  3P63 A;  4ZYS A;  2IGG A;  2K9X A;  3NS1 A;  2V3P A;  4RGO S;  3Q69 A;  2PVG C;  1JWB D;  2HDE A;  4GDL B;  3BVM A;  3AE1 B;  2OED A;  1HZ5 A;  3J9C A;  2WXO A;  1IGD A;  3TUO A;  1RWS A;  2WXR A;  1JCK B;  1UGJ A;  2Q5W D;  1I4H A;  3KQ4 A;  2J42 A;  4KGT A;  2G1E A;  2FUG 1;  3LXF A;  1ZP0 B;  1EU3 A;  2YEP F;  4WUR A;  4NJC A;  1YN4 A;  2EEL A;  2DLB A;  1FXI A;  3ABV B;  4L1B A;  3EUB 2;  4MH8 A;  4A8X C;  1XLQ A;  2RPV A;  3AE5 B;  3P1M A;  1I4P A;  1V1O A;  4FXC A;  4J3O D;  2M19 A;  4LTU A;  2CU3 A;  3B2F A;  3PZ7 A;  2JXT A;  3ZJV A;  2KDM A;  2IPK D;  1V1P B;  3TSS A;  2WDR B;  5D3D A;  4YT0 B;  1DOX A;  1SXT A;  2WXI A;  2WXM A;  2B76 B;  4RGN A;  2WXF A;  2MJD A;  1FNW A;  1AN8 A;  4MAC A;  4L23 A;  1QKZ A;  3O13 A;  4WIP A;  1CK1 A;  3W2D A;  2WXL A;  4HKQ A;  2AQ3 B;  5BMG A;  1TY0 A;  2LUM A;  3NRZ A;  5G5G A;  1N5X A;  1L0Y B;  2WXP A;  2AQ2 B;  3PO0 A;  1VJK A;  1GPX A;  4N58 A;  2WXN A;  1FRD A;  2N9L A;  2WXH A;  1E7P B;  1YJJ A;  4WH4 A;  1DYQ A;  3HVD A;  1DGJ A;  1K50 A;  2INN E;  1EM7 A;  2WU2 B;  4CQN A;  3AMZ A;  1ENF A;  2H89 B;  3TEY A;  3AE3 B;  1TS3 A;  3ZQ4 A;  4A55 A;  1ZOY B;  3AV8 A;  1J7A A;  2ON8 A;  4KKI A;  2WXG A;  1SBB B;  5FK9 C;  2D5G A;  3FC4 A;  3GP7 A;  3AM9 A;  4HRS A;  4B0M A;  1D5X C;  3N9Y C;  1J7B A;  1B9R A;  5I4D A;  2WNM A;  4DXF A;  3MJ5 A;  4OZA A;  4WQM A;  1XEE A;  1F2R I;  1PYW D;  2GB1 A;  4C7Y A;  3R2T A;  4JWU C;  3E56 A;  1MHH E;  3IT6 B;  1HQR D;  3P4S B;  2MJE A;  3IAS 1;  4RGM A;  5BYS A;  1UWM A;  3URY A;  1RFK A;  2BB5 A;  3PZ8 A;  1IBX A;  1XO3 A;  1F0Z A;  1D4B A;  2VZK B;  2W82 A;  3AEC B;  1JWS D;  2INP E;  2MEK A;  1SE3 A;  3EA6 A;  2KWD A;  1FMA D;  2JSV X;  1BML C;  3GB1 A;  1L4D B;  1FFU A;  4YTP B;  4ZRQ A;  5H8Y E;  3BZD B;  4AQ7 A;  3EGR A;  2WU5 B;  2X38 A;  4MT5 A;  1K51 A;  2DYM A;  2ICI A;  1JRO A;  4USA A;  2RMM A;  4R3D A;  1BUI C;  1RM6 C;  3Q8F A;  1QQR A;  3AN1 A;  3T3N A;  3V05 A;  5BMH A;  4JPS A;  1DOI A;  2AQ1 B;  5FKA C;  1ZDX A;  2Y5C A;  1MHX A;  2XN9 C;  2JYE A;  1WRI A;  3SFE B;  1ZXH A;  4HRO A;  1VZ8 A;  3AE7 B;  3NVY A;  4RGT A;  5D7G A;  2WXK A;  4C56 C;  2GI9 A;  1L5P A;  1QOG A;  4A9A A;  2PW9 A;  2WDV B;  1SE2 A;  4LK0 M;  2LMC A;  3AH7 A;  5BYQ A;  3ZJU A;  2MH7 A;  3NUH B;  3AB5 A;  2AX5 A;  3B9J A;  4US9 A;  1GB1 A;  1Q10 A;  2NMQ A;  2TSS A;  1SJH D;  1TKG A;  4KKJ A;  3BK2 A;  4JE3 B;  4RF0 A;  5AUK A;  4L2Y A;  1JAL A;  3VRA B;  4IKG A;  2WS3 B;  1IGC A;  1HA5 A;  3TEW A;  2OHF A;  3IAM 1;  3MFG A;  5EE3 A;  1I4Q A;  1C76 A;  2L1A A;  3AE4 B;  2QIE B;  3HUI A;  2V0G A;  2R61 A;  1KLU D;  1WXQ A;  5C3J B;  2IGH A;  2BBC A;  1CQV A;  1EWY C;  2KN4 A;  2WDQ B;  1FCC C;  2KAJ A;  2QMT A;  2Z8L A;  3AEG B;  5HFY A;  4YTN B;  2K3U A;  3R2I A;  5HI1 A;  1RYJ A;  1WGK A;  2K0P A;  4US8 A;  2PIA A;  3VQI A;  4HKZ E;  3P4R B;  4ZHP A;  1C77 A;  1E0Z A;  3P4P B;  3Q8C A;  4XWT A;  3LB8 C;  1ZPS A;  2BS2 B;  3AED B;  3R8B A;  2K5P A;  2WXJ A;  4ARC A;  2LJI A;  1NYR A;  2RDH A;  3CWI A;  4N59 A;  3BYT B;  3CIR B;  1NVI D;  1N5W A;  1K52 A;  2V4I B;  3AEE B;  3AE9 B;  3KWL A;  1JWA D;  4YSX B;  2DWQ A;  2WXQ A;  1C79 A;  1WSP A;  5C2T B;  1JRP A;  1M4V A;  2HTM E;  4OHJ A;  4XWW A;  5BYR A;  2DBY A;  5T8I A;  3U52 E;  1KFY B;  1IBX B;  2IDY A;  4KX6 B;  1FD6 A;  1N62 A;  1L0X B;  1D5Z C;  2W3R A;  1ROE A;  1ESF A;  1C4P A;  1NYQ A;  5E6J A;  4P6V F;  4YXD B;  1GAQ B;  1C4A A;  1JML A;  2Y5P A;  1SF0 A;  1P7E A;  5G5H A;  2N9K A;  1P7F A;  1XLP A;  3NZ3 A;  1FO4 A;  4OVZ A;  2JZP A;  1FRR A;  1JWM D;  1LO5 D;  1SSN A;  1T5X D;  3AE2 B;  3U2S C;  1F77 A;  2CJN A;  3AE8 B;  3ZYY X;  3W9C B;  2JX5 A;  5JXV A;  1QLB B;  1SE4 A;  1TKE A;  1FNV A;  1XF5 L;  5H92 C;  1PGA A;  2SAK A;  2I2Y A;  3BWU D;  3H8H A;  2JYT A;  2GRI A;  1K53 A;  4JX1 C;  1YN3 A;  2ACZ B;  1OQQ A;  1L6V A;  4DQO C;  3NVV A;  3FIL A;  4KGS A;  4NAW B;  2W55 A;  1L4Z B;  1ZE3 D;  2LGI A;  3BVZ A;  2BT6 A;  3NVZ A;  3OWE B;  1ET9 A;  1AW7 A;  2LHD A;  3VR8 B;  3AEA B;  1L6U A;  4RH6 A;  1PGX A;  2W3S A;  1CZP A;  1KH0 A;  4RNA A;  4GDK B;  1GB4 A;  1EU4 A;  1VZ7 A;  4HJG E;  2H88 B;  1SJE D;  1NEK B;  4H2A A;  4DXG A;  4WAF A;  5EE0 A;  2EKI A;  3ZGZ A;  3V3X A;  2Y3A A;  3BYY B;  1XLN A;  4JWS C;  4XDC A;  3P42 A;  1TS4 A;  1I4X A;  3W5U B;  1HZ6 A;  4GLS C;  2L32 A;  1ACC A;  1AYF A;  3KLS X;  1PFD A;  1Y56 A;  3RPF C;  1OFF A;  2J53 A;  3W1S A;  2BYT A;  2G9H D;  2KMM A;  1QOA A;  3W5V B;  2L83 A;  1C4C A;  3DWM A;  2KAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...