1KH0A

Accurate computer base design of a new backbone conformation in the second turn of protein l
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
EEVTIKANLIFANGSTQTAEFKGTKEKALSEVLAYADTLKKDNGEWTIDKRVTNGVIILNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein L
publication title Accurate computer-based design of a new backbone conformation in the second turn of protein L.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 18
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kh0A00
4MACA 2NMQA 1PGXA 2IGDA 4GLSC 1XCTL 2PLPA 3UI3A 5BMIA 3GB1A 1D4BA 1IGCA 2JWUA 2KDMA 1YNTE 2JSVX 2JU6X 5HHDG 1EM7A 2LHEA 2JZPA 1QKZA 2GB1A 4D2KA 1C9FA 1FCCC 1MHHE 2LHDA 1YMHE 2RMMA 4KGTA 2J52A 4IKGA 1F2RC 5BMGA 2RPVA 1XCQL 2KWDA 2N7JA 2N9KA 1K51A 4OZAA 5JXVA 1IGDA 2GI9A 5HFYA 5HG2A 2PW9A 1F2RI 1UWXA 2QMTA 1ZXHA 2K0PA 2KN4A 2ZW0A 1HZ5A 1FD6A 2JXTA 3MP9A 2I2YA 1Q10A 1JMLA 2IGGA 1K53A 4KGRA 5HI1A 1K52A 1K50A 3V3XA 1HEZE 1MVKA 2KQ4X 2LUMA 1MPEA 2PTLA 2ONQA 1HZ6A 5BMHA 1MHXA 4HKZE 1KH0A 1MI0A 4IOIE 1P7FA 2EELA 1IBXA 4OZBA 1XF5L 4OZCA 1PGBA 4HJGE 2IGHA 2J53A 2ZW1A 2I38A 4WH4A 1GB1A 3FILB 2KACA 1GB4A 1IBXB 2QSDA 1PGAA 2ON8A 2LGIA 2OEDA 3FILA 4KGSA 1P7EA 2N9LA 1FCLA
chains in the Genus database with same CATH superfamily
2FBWB 1FM0D 2X38A 4GLSC 1N62A 2INCC 4LJOB 4AJWA 3NJTA 3QARA 3FAHA 1WE6A 4J6IA 4XE0A 4GSWA 1MG4A 1FCCC 4PYZA 1J7AA 1MHHE 2FUG1 1SE9A 3H6NA 3BYYB 3PRMB 1J0GA 1F9JA 2RR9A 3GE8C 1P98A 3V60A 1KLVA 3RCZA 2I1KA 4M02A 5MPOA 3R2IA 1NENB 2WXRA 3NS8A 5FR6A 1BMLC 3P1MA 3NOBA 3PO0A 5EE9A 2KN4A 2VRRB 5IOIA 2M17A 3BVZA 5IA7A 2WDRB 2ZVOA 3ZW3A 1RYJA 1TS4A 1WF9A 1JMLA 1UF0A 2K1FA 1C1YB 1CK1A 1OEYJ 2FAZA 2INPE 4HKQA 2KVZA 2V3PA 2EKIA 4ZYSA 1NDDA 1T6BX 5E6PA 3ZDTA 2L05A 4M00A 1WSPA 3N1ZC 1WX9A 3W1SC 4P1CC 2WXIA 3QAQA 1D5XC 1LFDA 1TY2A 3JW0X 2WX0A 1XF5L 3TEWA 2BYFA 1KRHA 3RULA 3B08A 3ZNZB 4KZ0A 2V4LA 3M95A 1A5RA 1WXVA 4DHJD 2KFKB 3ML9A 3R8BA 3R7QA 2W9NA 3HK0A 1WGGA 3APFA 1MJDA 5J2RA 4GDLA 4HRSA 1J19A 3PRZA 2REXA 1V2YA 2PLPA 2PE6B 1MFWA 4F7ZA 3SFEB 4USAA 2WXOA 1E8ZA 5IAAC 2INDC 4DHZE 2GB1A 4EUTA 1C9FA 1SE4A 4BOZB 1VZ7A 1BXTA 3BVMA 4WJNA 4MSMB 1YJ1A 1PDXA 1SSNA 2HTHA 4Q2JA 4FXCA 3DDCB 2N9KA 3AI5A 2UWQA 1XXGA 2ZJDA 2KYWA 2EKEC 1E9MA 1F52A 3L4PA 1ZOYB 4BBNF 1WM3A 1STEA 3EC8A 2QHOA 2B76B 5BYRA 1Q10A 1WJNA 2JY6A 1AARA 2JXXA 2H89B 2QEJC 2E3TA 4WURA 3BZDB 2M19A 4REZA 2N9EB 2JYTA 3ZNID 2MBEA 2KN5A 3QCAA 4K81A 4XZ4A 3L08A 3L13A 4HK2A 4RGTA 2LVQA 2K39A 5L83A 1WXSA 2LJ5A 2J53A 1SJHD 2FCSA 4LCDE 3W9CB 1SGHA 2DZKA 1E5WA 3AEDB 4CHKA 2JUOA 4US8A 3A4SC 1IBXB 1ZDVA 1LM8B 2IO3B 3S2AA 2MBOA 1FO4A 2N7DA 4ANUA 4C56C 3FILA 2V3NA 4MM3A 4HPPA 1J7CA 4MACA 3RNEC 1WGRA 2KVRA 3AE3B 2JSVX 2Z0DB 2MA9B 1TZ1A 4AJYB 3QJZA 3DPDA 3PT2B 2WWZA 5AUIA 1JCKB 2HE7A 2PJHA 4EEWA 1KLUD 3WAMA 2AWTA 4TV3A 1YN3A 3ZGZA 4W9DA 5E6OA 1F2RC 2L3ZA 3HVZA 1KM7A 2NTTA 4A90A 1JRUA 1H8CA 4FHKA 2GI9A 2LGXA 2AEHA 1DGJA 4ZOHC 1VJKA 5G55A 3CMMB 2MWSB 2JQRB 2GOWA 2UU7A 4GDKB 2Y5BB 3KYCD 3MP9A 1FMAD 2KDFB 1JWUD 5CHWA 3PLVA 1I7HA 1SIFA 2AQ2B 5CHFA 2INNE 3B9JA 3I9V1 1HEZE 5AZHA 2KQ4X 2MX2A 1DOYA 4MGKE 1JW9D 2IO1B 4N6EB 1AN8A 2CJNA 4LDTD 4LNFA 1L4DB 2BYTA 4K7WA 3NUHB 2GRIA 1MI0A 4MEMA 1KLGD 5JZEB 1T0RC 2FE8A 2WYQA 1IYFA 2LVOA 1WGYA 2KZRA 1WMHA 4JWSC 3AV8A 4M01A 5H92C 2L52A 1V1OA 2KWCA 5FK9C 3C8YA 1WRIA 4LK0M 5DPTA 3IG3A 2A4ZA 1L0XB 3Q3NC 4KZCA 3AU4A 2MCNB 4FADA 1D4BA 3VRBB 1EUVB 4GMVA 3MJWA 2WS3B 4PS7A 2PKOA 2SAKA 2CR5A 3AEGB 3VQIA 2PMVA 2E6XA 3A1QB 2KT7A 3V05A 3GOEA 4JL9A 1H4RA 3M63B 2LASA 3TJPA 1J7BA 1F0ZA 4RGOS 1VDVA 5GXGB 3L54A 2GBRA 2WGSA 3ZLZA 4B9KA 2PW9A 2QMTA 1V81A 1TKGA 3RNGC 1I4HA 4LLGM 1SE2A 4BBNC 2ZCBA 1FNWA 1K53A 4WQOB 5HI1A 4HDOA 2XK5A 1VZ8A 1JQ4A 2ICIA 3WCQA 2ONQA 3Q8CA 2DAFA 5DPRA 4W9CA 4IM0A 1OQYA 3PGEA 2N1VA 3KUDB 2IZVB 4ITKA 3OG5A 3ZO5B 4MT5A 4K3BA 1WGHA 2KJ6A 5LLIA 2WDQB 4EE2A 4TQ0A 3UIPB 3ETRA 1FIQA 2L1AA 1CMXB 4MGYE 3KUCB 3NRZA 4FHJA 2KDEB 2GBJA 4HROA 3AULA 1HQRD 3MTNB 1AYFA 2LZ6A 3OJ4B 1FCLA 2KTFA 2NCNA 1L6VA 1YN5A 4MGZE 2KXJA 1QOFA 3UQAA 1E7UA 1SJED 2L76A 2BWFA 2BKRB 1QOGA 4YL8A 1V80A 3TBLD 1V5TA 3Q2AC 2G4SA 1B1ZA 4W9KA 4GN1A 4D2KA 5TR5A 1EWCA 3UINB 2CHXA 5LXIB 2LI5A 3Q8EA 1YQ3B 3M3JA 1K8RB 1IGDA 1C78A 1TIFA 2NR2A 3DVGY 4YTNB 5TSSA 5BO4B 2AQ3B 1L5PA 3OLMD 4I6NB 2Z59B 3PVLA 3APDA 3IVFA 1F1HA 2I2YA 5T8IA 2O6VA 4FLHA 3KWLA 1RRBA 3N1YC 3TSSA 3NVWA 4IM3A 2C7HA 4XGAB 1RAXA 1KJTA 2WXJA 4OVVA 4A6QA 1XLNA 2FCMA 3SHQA 1RM6C 1NI3A 5LXHA 2KKCA 3ZTDA 1QLBB 1R4NI 2WDTB 3WANA 2JF5A 1D3ZA 3ABVB 5J18A 1VD2A 4DHJB 1WH3A 3RYTA 3ZJUA 4FULA 4IWPA 3CSFA 3RNFC 3I5JC 2NBWB 1WGKA 2WP9B 2J42A 3H7PA 3I3TB 1L0VB 2FNJB 5JHBA 3L16A 2BTEA 1D5MC 2EMTA 1NI2A 3Q69A 3JSVA 2KNBA 2JT4B 3EFUA 2BYVE 4E74A 1FNUA 2K6DB 2LHEA 2KMAA 3WAOA 1GG3A 4RMAA 1QILA 1EF1A 2L8JA 4JWUC 1WRDB 2KFJA 3KYDD 4HPMB 2KJHB 3RUIB 1AWDA 3VH3B 2KWDA 1K51A 1WE7A 3Q3JA 1UD7A 2JPHA 1UWXA 1YQ4B 4DQOC 4X57B 3KW5B 2R2QA 2KWVB 1FXTB 4YXDB 3BIID 3W1SA 1V1PB 2DZIA 1WR6E 4NAMA 1JROA 3AE5B 4A9AA 3N1XC 4NY0A 2LRUA 4RCOA 4M8MA 4JPSA 1WJ6A 4IDIA 2KD0A 1DOXA 4BVUC 2KK8A 2JRIB 1ZPSA 1LGRA 3KWVA 4EZJA 1OGWA 2ZCCA 3MC8A 2M4NA 1R4MI 2KANA 4JIOU 1OQRA 4P1BC 3T9LA 1FRRA 1UNSA 1GJZA 3AEBB 2K25A 1V5OA 3R66C 1Q0WB 2DYOA 3X23A 4WH4A 5CHVC 3WAPA 1C4AA 4MJSA 2G3QB 3LB8C 3FILB 3ZXVA 2KC1A 1YX6B 4F1SA 3ZDMC 2OEDA 3A9KA 3P4SB 2N9LA 1QOBA 1DYQA 3A9JA 4PS3A 2D3BA 4GOCA 4AS1A 2K3UA 5HKHA 3Q3OC 4AQ7A 4XX5A 4LNNA 3RI7C 4B95A 2W3RA 1UZXB 3FC4A 1PUTA 4MELA 4MH8A 3GS2A 1V97A 3HVDA 4OW0A 1SEBD 1QKZA 1UELA 1TS5A 1I4RA 2OOBB 4GIVA 1N61A 4I6LB 4RF1A 1WZ3A 3ML8A 2DAJA 1DOIA 2J0JA 3TEZA 1ZE3D 4J3OD 1RFKA 2YEPB 2IYDB 1YIWA 3TL5A 1T0QC 1NVID 2WLBA 2NTSA 1JALA 1QF6A 4GXBA 1WXMA 1ZXHA 3KLSX 2NVUI 2JZZA 4M0WA 2FUHB 1GC7A 1HZ5A 1FD6A 3ZYYX 3EECA 1WYGA 2H88B 2JXTA 4W9GA 4DDGD 3H7SA 3N20C 3IXSA 4US9A 2D3GA 3DBLI 1E8WA 4KDIC 4ZRKA 3IAM1 1WI0A 2LXAA 4LDTB 2PTLA 2CU1A 3AEAB 2GBKA 1MHXA 1KF6B 2G45B 4BKGA 2WU2B 4L2YA 2EELA 1NEKB 4OZBA 3URYA 4YSZB 1PGBA 2KTRB 4ANWA 1IP9A 3VTWA 1UUPA 2C7NB 2KOXA 3AE1B 3LDZE 1ZGUB 4JGHB 3LYYA 1Y56A 4W9HA 1SBBB 3I63C 3N3KB 4RGMA 2WU5B 1V49A 3NG0A 2Q5WD 2LGIA 3EUB2 4GB9A 3AB5A 1SF0A 4PT5A 3UI3A 5DCNA 2JYEA 3ZXRA 1HXYD 5HHDG 2AL6A 3C19A 4JQWC 3A33B 1N63A 3QA8A 1TTNA 1WY8A 3NVYA 4S17A 3NZ3A 4A55A 3TUOA 3DVNU 2PIAA 2LHDA 1EWYC 1WJUA 1JWSD 4A3PA 1TBEA 4A20A 3DBRI 2GLSA 3WA0A 3ZIMA 4TUUA 4C4VA 4K7SA 3V61A 2LXCA 1WM2A 2QC8A 4RNAA 1E7VA 3EGRA 3ZJTA 4KIKA 1YD8U 4WWPA 1P0RA 2L32A 3U52E 2MJEA 2N1WA 3RN9C 1JWBD 4MDKE 4PS8A 4IG7B 2EMSA 1HZ6A 3DHGC 3RT3B 5BMHA 1XT9B 2BF8B 3ZVVA 2KFKA 3MHZA 4LJPB 4NJCA 3IBEA 5G2NA 3QQ8B 3SEBA 5D3DA 3RFZB 3DVNV 1UBQA 3VRAB 4BAXA 1N60A 2MJDA 3N9YC 4W9JA 2KC2A 3RMKC 2OJWA 4G0NB 1GB4A 4NJ6A 2QSDA 1X1MA 1TYGB 2RGFA 4W9LA 2CU3A 5J17A 1CJEA 2NBUA 4EKUA 1QOAA 2KQ7A 4CO7A 3GB1A 2IO0B 3MHSD 1I4QA 3SFDB 2L0TA 1FPYA 5AUKA 3PHWB 1XLPA 2NPTB 3DBLB 1YQBA 2MLBA 3KH0A 1ZKHA 3SR6A 1TJEA 4ZHPA 3TEYA 2LGDA 1Y8RC 4XWWA 4AWJA 3IAS1 4WJQA 3OAWA 2RSUA 1P3QU 2BS3B 2N7JA 3VXWA 5HFYA 4PK1A 5JH5C 1AW7A 3SU8X 2JWZA 2MW5A 2VZKD 2K0PA 3EFCA 4KX6B 2KLGA 3CWIA 2KHWB 2O6VB 3U2SC 2N4FA 4WAFA 2IGGA 3NZUA 3IT4B 1MVKA 2DYBA 2G9HD 4WAAA 1V9JA 3PSEB 1C79A 3BWUD 5G5GA 1BUIC 3B1LX 3VH4B 1IBXA 4YTMB 1YJJA 4BFRA 4L23A 2WXNA 3AE4B 3P2BA 2LGYA 1SB3C 5BYSA 2W3SA 2C5LC 4WWOA 3WIMA 4YWGG 4XWTA 3H1UA 3VTUA 3DBRB 3O13A 1UGMA 4HCPB 2WXMA 4C00A 3HHMA 4KGSA 4XDDA 4I6PA 2KMCA 3QC8B 1L0YB 2B3AA 4ARIA 2O2VB 1XCTL 5GMVA 1IPGA 2WHIA 4LTUA 5FR3A 2DNFA 1VR9A 1XLQA 1C77A 2XN9C 3MC0B 2WDVB 3SD5A 2ZPYA 2J4XA 4IUMB 3Q6BA 4WIPA 3UQBA 2W54A 3LJ3A 3UGBB 4B0MA 1WWTA 4GDKA 3RZWC 3VUYA 2N7EA 1XQQA 2V3SA 1FXIA 1HTOA 1TKYA 4AP4C 3FKYA 3Q8FA 4JLCA 1GOZA 1F2RI 3PPAA 3L0WB 1ISNA 2DZMA 4HPLB 2MSED 2C7MB 3T3OA 2N0SB 1T5XD 4BKSA 2RPQA 1C76A 4E3CA 1PFDA 1ZXIA 2KQSA 4EZLA 3O65B 2I1JA 4TSSA 1C4PA 2M8SA 1EF5A 2N9PC 2BT6A 2DHZA 3DWMA 3E56A 4JX1C 2RDBC 2RDHA 4ACFA 2O6VD 2FIDA 5E6JA 2CS4A 2KX0A 5CTRC 4MJSB 3CSTA 3AM9A 1P1AA 1SE3A 3A9KB 3QHTA 4KKIA 2M0AA 4DXFA 3A9JB 1HE8A 2V4IB 2ON8A 2VH1A 3QK0A 1ZUD2 3BK1A 3K9OB 3Q8AA 3D32A 4IC7B 2BGFA 2JX5A 3A1QA 2JRHA 4URKA 2D10A 1UWMA 2HDEA 1VZ6A 3Q8BA 4EZKA 1YX5B 3W5VB 2KJRA 1EM7A 3P63A 1Q1OA 2BKFA 1G6JA 4GDLB 3PV1A 2PVGC 2ASQA 5D94A 2BB5A 2NBVB 1WGDA 2KX3A 5D6JB 1FXAA 4IWOA 2LD9A 2VH2A 3VUWA 4DXGA 3HM3A 4KV2A 2RD0A 1FEHA 4S0RA 1M4VA 4IKGA 2K6QA 4ZYNA 3EA6A 1XCQL 3PZ8A 1YN4A 1WZ0A 5L95C 1V6EA 4M0WB 3ZQ4A 3V6CB 1J8CA 1T0SC 2Y5CA 2IDYA 1NBFC 3NY5A 1HA5A 1I4PA 3DQVA 4MSQB 2J0KA 4KGRA 1SIJA 3BVGA 2DENB 1K50A 2X8XX 2C9WB 1OQQA 2BS4B 4HLEA 1VRAB 4FA6A 4W9IA 4OVZA 3U8ZA 3AE6B 3JVZX 3DBHI 2PE9A 2MQJA 1E8YA 2WX1A 4HJGE 2DWQA 2D3CA 1BT0A 3BINA 2QCZA 4N9F4 1RWSA 4B0EA 1A70A 3KUZA 1GAQB 5LNK1 4DXAB 4HXDA 3DHIC 2R2OA 4G11A 1UBIA 5G5HA 2G1EA 2WXFA 1ZW7A 4K7UA 2OJRA 4II3B 3UIOB 3VR8B 3ZTCA 1L2NA 4OHJA 2K8HA 3V6EB 2TSSA 4ANXA 1ET9A 3AECB 2BWES 2BVCA 3VHTC 3ZUNA 1U4AA 3OWEB 3IT6B 4UDUC 3A4RA 2R61A 1JRPA 3OJ3A 4K1RB 1P9DU 4EFOA 1WR1A 2IO2B 3ZJVA 4MM3B 5C3JB 3VDZA 4ZRIA 4P7IA 2KDIA 4YTPB 4WJOA 2RMMA 4KGTA 2Y3AA 2BW2A 2J52A 4C4VB 2DZJA 4QAYA 2WQYB 1GC6A 4LNOA 3Q14C 4P6VF 1CQVA 2RPVA 4KIKB 4RF0A 5JXVA 4NNJB 2KMMA 1E90A 1TKEA 2LEKA 5HG2A 2MP2A 1TS2A 1GUAB 1ESFA 2M56B 3AE8B 3AU5A 2L0FA 4ASWC 1HTQA 1KFYB 3PRPB 2ZEQA 2BPSA 2ZVNA 4MH0E 3C0RB 2V9HA 1E6EB 5EE3A 2YEPF 5EDSA 2PVOD 4IWQA 4N58A 4JE3B 4H2AA 3U7ZA 1OTRB 2RDGA 1R4NB 3NHEB 1FFUA 2IPKD 1KH0A 2LRWA 4IOIE 4K3CA 2NS5A 1CZPA 2WXGA 1TZOA 2N9XA 1GPXA 1F77A 4ZDVA 2AX5A 2HJ8A 1QQRA 2K8BA 1SXTA 1GB1A 4IM2A 1VCBA 2WXHA 4LNKA 1TT5B 4NAWA 4HEA1 4YSYB 3DHHC 1N6ZA 1WMHB 4P16A 4RGNA 2NMQA 4WJPA 3LXFA 4KVGB 2Z8LA 2GBMA 5BMIA 3VTVA 3DVGX 2JWUA 4GU2A 2KDMA 4DHZB 2MEKA 4II2B 2Z0EB 2JZPA 4LNIA 4HCNB 2K8CA 2KWUB 1RLFA 3TIXA 3KQ4A 4KSLC 2OHFA 1R7SA 3AE7B 2K5PA 4ICVA 1ET6A 4ZRQA 2HD5B 1V1PA 3DBHB 1WX7A 2LVPA 2VZKB 1QT9A 4G50A 2ZW0A 4ICUA 1TS3A 3P42A 1ACCA 1TGZB 2CHWA 2WNMA 2XBBC 1WIAA 4RM8A 3ZNHB 2V0GA 2C60A 2V1YA 4KKJA 2CKHB 5EE1A 4AOFA 4R3DA 1K52A 2FCQA 1LO5D 2BB6A 1R4MB 3HM6X 2YLMA 1I35A 2ZNVB 2J0MA 4TQ1A 2MHJA 3PREA 3BK2A 3QX1A 1UH6A 4KSKC 1OFFA 2A5UA 5H8YE 5I4DA 4ARCA 2UYZB 2XK5B 4OZCA 2W55A 4WQMA 3PHXB 1VLBA 3AXCA 2WXQA 3NVVA 4GGQA 1C4CA 3AE2B 2SEBD 4BOSC 3TEXA 5DPSA 3ZNGC 1FRDA 1EO6A 5IO9A 2KACA 2WXKA 1L4ZB 1ZDXA 3Q3FA 1PGAA 2Y5PA 1XEEA 2AQ1B 1E10A 5AZFA 2WXPA 3HIZA 1B9RA 1P7EA 2IJ0A 2D11A 2GMIC 4IW0A 2IGDA 5JHAA 4CYEA 2ZZPB 1RFAA 2MJ3A 2M1MA 4FJYA 1M94A 4HVBA 2G4DB 3DCGA 2QDFA 1MG8A 3E9SA 2MBBB 4L1BA 2BYEA 4TKNA 3R7RA 3ZRCA 5BMGA 5KHOA 1T3QA 4FJZA 4OZAA 3NZSA 1FNVA 2KO3A 1N5WA 3RZFA 5CX3A 4BZAA 3CF6E 1WJ4A 4ZRJA 3ONSA 4HWIB 3H8HA 2AL3A 2M0XA 2IBIB 3N30A 3IHPC 1XD3B 4G3XB 3ECIA 3R2TA 5BYQA 2QILA 2KTRA 1I4GA 2J7QB 3V3XA 1E8XA 3EHVA 4CQNA 3U30A 1IUEA 2LUEA 2QJLA 3VR9B 2DBYA 1V8CA 2YVCA 2QIEB 1P7FA 3ENEA 1WYWB 3N32A 2CHZA 2IGHA 1D6EC 2XEWA 1N5XA 4FN2A 4EOYA 3VUXA 3APCA 1KTKA 3WALA 1GNUA 1XO3A 3TCAA 4NZLB 4W9FA 3VFKA 3SDLC 1UGJA 3GZNI 4ZRPA 1Z5SB 4YSXB 2DX5B 4A3OA 3UF8A 4B6WA 3H9DA 3IFWB 1WFYA 2MRPA 2L83A 1YOVB 3RNCC 3GE3C 4XC2A 4C7YA 3P4QB 1E0ZA 4C80A 4O1NA 1IGCA 3BYTB 5EE0A 1QZEA 3P4RB 3PZ7A 2GBNA 1V86A 4PYUA 3AEFB 3CIRB 3H7PB 5AEKB 3PS6A 3AEEB 4NQKE 3JSVB 5AZGA 2WXLA 3L10B 5D2MB 3PLUA 3AN1A 1NYRA 2AYOB 4A8XC 3M62B 3W5UB 3ZRFA 2L00B 2DLBA 3W2DA 2PEAA 3X0WA 4RFBA 1I4XA 3U4EG 4XYCA 3ALBA 1WXAA 4RH6A 5IP4D 2KAJA 1E7PB 3KVFB 2K22A 4YT0B 1Z2MA 2KLCA 2ZNVC 3TMPB 2LUMA 3ZKJC 4WWNA 1KOTA 4M8NA 1XLOA 2BQQA 2W82A 3VVWB 4ZHOA 3J9CA 1NYQA 4HKZE 3BY4B 4NJ7A 1LQBA 2DYMA 1ZP0B 2HJ1A 3T8MA 3MC9A 2BS2B 4BKSD 1L7YA 2ZW1A 4OVUA 3DOWA 4MGIE 3HRDD 3PZDA 2ZPNA 3DWGC 1Q5WB 4E71A 2JZ3B 4TMAB 4RM9A 3PTFC 2NPTA 4C7ZA 4FBJB 5IN7A 2PPHA 2XNAC 3JYUA 1OEYA 1FFVA 1PGXA 1PQSA 4F8CB 2LGSA 4W9EA 3VAWA 1PYWD 4HJKA 4N59A 4NQLB 1YNTE 2JU6X 2KDBA 4NPNA 3K9PB 1ROEA 3B2FA 3Q3MC 3RPFC 5E6NA 1L6UA 1WXQA 1YMHE 4DDID 1I42A 2L7RA 3NS1A 2D07B 3T3NA 3L17A 2MP2B 3AE9B 2LWPA 2FIFA 2ACZB 3B0AA 4DWFA 2HTME 4ANVA 1JWMD 3NVZA 4KDLB 4DBGA 3QWZB 1S3SG 1JWAD 2K9XA 4WWMA 3B2GA 5D3IB 5D7GA 5KHQA 3GZNB 3P4PB 5C1ZA 3W1YA 5IKCM 2MBQA 1ENFA 3U7DA 4BKTA 2LMCA 5FKAC 1MPEA 2LFIA 2CJOA 1EU3A 1TY0A 5DPWA 1YJIA 4DK5A 3QIJA 2IY1B 1LXDA 4XDCA 3DBSA 5C23A 3R3MA 2I38A 2D2QA 4HDQA 4AUQC 3HUIA 1EU4A 3I57A 2D5GA 1S1QB 2O2VA 1WX8A 3RNBC 3GP7A 4FJVB 1D5ZC 2MH7A 4NAWB 2JVCA 3V62A 2LJIA 2D3AA 1T0YA 2FCNA 3RNAC 2IY0B 3AH7A 3AMZA 3RD2A 3MFGA 5C2TB 2MBHA 1C3TA 2BBCA 3MJ5A
chains in the Genus database with same CATH topology
1CJEA 2FBWB 1FM0D 4P16A 4RGNA 1L6VA 1YN5A 2NMQA 2X38A 1QOFA 3LXFA 1QOAA 1N62A 2Z8LA 4GLSC 1SJED 5BMIA 3GB1A 1QOGA 1I4QA 2JWUA 2KDMA 3SFDB 3FAHA 2MEKA 5AUKA 1XLPA 1B1ZA 2JZPA 4XE0A 3KQ4A 4D2KA 3SR6A 1TJEA 1FCCC 1EWCA 1J7AA 1MHHE 2FUG1 4ZHPA 3BYYB 3TEYA 2OHFA 4XWWA 1R7SA 3AE7B 2K5PA 1ET6A 3IAS1 3Q8EA 4ZRQA 1V1PA 2BS3B 2N7JA 3R2IA 5MPOA 1NENB 1YQ3B 2WXRA 1BMLC 1IGDA 1C78A 5HFYA 2VZKB 3P1MA 1QT9A 1AW7A 4YTNB 5TSSA 2AQ3B 3PO0A 1L5PA 2VZKD 2K0PA 2KN4A 5EE9A 2ZW0A 4KX6B 1TS3A 3P42A 3BVZA 3CWIA 1ACCA 2WNMA 2WDRB 3U2SC 2V0GA 1RYJA 1TS4A 2I2YA 4KKJA 5T8IA 1JMLA 4WAFA 2IGGA 5EE1A 3IT4B 3KWLA 4R3DA 1K52A 1CK1A 2INPE 4HKQA 1LO5D 2BB6A 2V3PA 1MVKA 3TSSA 2EKIA 4ZYSA 3NVWA 4TQ1A 1T6BX 3BK2A 2G9HD 2WXJA 1WSPA 1C79A 4A6QA 1XLNA 3BWUD 5G5GA 1OFFA 2WXIA 1D5XC 1BUIC 1RM6C 5H8YE 1TY2A 1NI3A 5I4DA 1IBXA 4ARCA 4YTMB 1YJJA 1XF5L 3TEWA 4OZCA 4L23A 2W55A 2WXNA 4WQMA 1QLBB 3AE4B 1KRHA 1VLBA 3ABVB 2WXQA 1SB3C 3NVVA 5BYSA 2W3SA 1C4CA 3ZJUA 3AE2B 2SEBD 4YWGG 3TEXA 4XWTA 1FRDA 2KACA 2WXKA 1L4ZB 1ZDXA 3R8BA 1PGAA 2Y5PA 1XEEA 2AQ1B 1E10A 3O13A 2WXPA 2WXMA 1WGKA 2WP9B 4KGSA 4XDDA 1B9RA 2J42A 1P7EA 4HRSA 2IJ0A 1L0VB 2BTEA 1L0YB 1D5MC 2IGDA 3Q69A 4ARIA 1XCTL 2PLPA 3SFEB 4USAA 4LTUA 5FR3A 2WXOA 1FNUA 1VR9A 1XLQA 1C77A 2LHEA 2XN9C 3MC0B 2WDVB 2MJ3A 2J4XA 2GB1A 1C9FA 1SE4A 1QILA 1VZ7A 4WIPA 2W54A 1BXTA 3BVMA 3E9SA 4L1BA 4JWUC 4B0MA 1WWTA 1PDXA 1SSNA 5BMGA 4Q2JA 4FXCA 1AWDA 1T3QA 4OZAA 2KWDA 2N9KA 1FXIA 1K51A 1TKYA 1FNVA 1XXGA 1N5WA 3Q8FA 1GOZA 1F2RI 1UWXA 1YQ4B 4DQOC 1E9MA 3L4PA 1ZOYB 3H8HA 4YXDB 1STEA 3T3OA 3BIID 2B76B 5BYRA 1V1PB 1T5XD 1Q10A 2N0SB 3W1SA 4NAMA 1C76A 1JROA 1PFDA 3AE5B 3R2TA 2H89B 2QEJC 4A9AA 5BYQA 1ZXIA 2QILA 1I4GA 2E3TA 3V3XA 4WURA 4RCOA 3BZDB 2M19A 4REZA 4JPSA 4IDIA 4TSSA 1C4PA 2JYTA 1DOXA 1ZPSA 2BT6A 4CQNA 3KWVA 1IUEA 2QJLA 3DWMA 3VR9B 2DBYA 1V8CA 3E56A 4JX1C 1OQRA 4RGTA 2QIEB 1P7FA 1FRRA 2RDHA 2IGHA 2J53A 1UNSA 1SJHD 5E6JA 1D6EC 3AEBB 1N5XA 3W9CB 3AM9A 1KTKA 2DYOA 3AEDB 1XO3A 4WH4A 4NZLB 1C4AA 1SE3A 4US8A 3LB8C 3FILB 1UGJA 1IBXB 4KKIA 2M0AA 4DXFA 2V4IB 4ZRPA 1ZDVA 2ON8A 4YSXB 1FO4A 4C56C 1ZUD2 3BK1A 2OEDA 2V3NA 3FILA 3P4SB 2N9LA 3Q8AA 1QOBA 1DYQA 2JX5A 2L83A 1J7CA 4MACA 4AS1A 2K3UA 4C7YA 1UWMA 2HDEA 3P4QB 4AQ7A 1VZ6A 1E0ZA 4C80A 4O1NA 1IGCA 3AE3B 3Q8BA 3BYTB 2W3RA 5EE0A 2JSVX 1PUTA 3FC4A 3W5VB 3P4RB 3PZ7A 4MH8A 1EM7A 3GS2A 3AEFB 1V97A 3HVDA 4OW0A 3CIRB 3P63A 1SEBD 1QKZA 4GDLB 1TS5A 2PVGC 1I4RA 1N61A 2BB5A 3AEEB 4RF1A 5AUIA 1JCKB 1FXAA 1KLUD 2WXLA 4DXGA 1YN3A 1DOIA 1FEHA 3TEZA 3ZGZA 1M4VA 1ZE3D 4IKGA 1F2RC 3AN1A 1NYRA 3HVZA 2NTTA 4A90A 4A8XC 3EA6A 3W5UB 1XCQL 3PZ8A 1YN4A 4J3OD 1RFKA 2YEPB 3ZQ4A 2GI9A 1NVID 1DGJA 2WLBA 4ZOHC 1VJKA 1JALA 2IDYA 2NTSA 2Y5CA 1QF6A 2DLBA 1ZXHA 2JQRB 3KLSX 3W2DA 4M0WA 1HA5A 4GDKB 1HZ5A 1I4PA 1FD6A 3ZYYX 4RFBA 1I4XA 3U4EG 1WYGA 2H88B 2JXTA 3MP9A 1FMAD 1JWUD 3IXSA 4US9A 4RH6A 4KGRA 1SIJA 3BVGA 1I7HA 2KAJA 1E7PB 1K50A 2AQ2B 2INNE 2K22A 3B9JA 1OQQA 3IAM1 4YT0B 3I9V1 2BS4B 1HEZE 2KQ4X 2LUMA 1DOYA 1VRAB 1JW9D 2PTLA 1AN8A 4N6EB 4OVZA 2CJNA 3AEAB 1XLOA 2W82A 4ZHOA 1MHXA 3AE6B 3J9CA 1L4DB 1NYQA 1KF6B 4HKZE 2BYTA 3NUHB 2WU2B 2GRIA 1MI0A 2DYMA 1ZP0B 4L2YA 2EELA 1NEKB 4OZBA 1KLGD 3URYA 2BS2B 4YSZB 1PGBA 4HJGE 2DWQA 1UUPA 2FE8A 2ZW1A 3AE1B 1RWSA 4B0EA 1A70A 4JWSC 1GAQB 3LYYA 1Y56A 3AV8A 5LNK1 3HRDD 3DWGC 1SBBB 5H92C 2L52A 4RGMA 5G5HA 2G1EA 2WXFA 2WU5B 4TMAB 1V1OA 3VR8B 2Q5WD 4C7ZA 2LGIA 5FK9C 3C8YA 4OHJA 1WRIA 2XNAC 2TSSA 3EUB2 4LK0M 3AB5A 1ET9A 3AECB 1L0XB 1SF0A 1FFVA 1PGXA 4PT5A 3UI3A 2JYEA 1D4BA 3OWEB 3IT6B 4UDUC 1PYWD 3VRBB 4N59A 1YNTE 1JRPA 2R61A 1HXYD 2JU6X 5HHDG 2WS3B 2PKOA 1ROEA 1N63A 2SAKA 3B2FA 3NVYA 3ZJVA 3NZ3A 4MM3B 5C3JB 3AEGB 3VQIA 4A55A 2PMVA 2E6XA 3TUOA 3RPFC 1L6UA 2PIAA 1WXQA 1YMHE 2LHDA 1EWYC 4YTPB 3V05A 1JWSD 2RMMA 4KGTA 2Y3AA 1J7BA 2BW2A 2J52A 3NS1A 1F0ZA 4RGOS 1VDVA 3T3NA 2WQYB 5GXGB 4P6VF 3AE9B 1CQVA 2RPVA 4RF0A 5JXVA 2KMMA 1TKEA 2LEKA 2ACZB 5HG2A 2PW9A 1TS2A 4RNAA 2HTME 1ESFA 2M56B 3AE8B 1JWMD 3EGRA 3ZJTA 2QMTA 3NVZA 1KFYB 1TKGA 1I4HA 4LLGM 1SE2A 1JWAD 2K9XA 2L32A 4WWMA 3U52E 2MJEA 3B2GA 5D3IB 1JWBD 1E6EB 1FNWA 1K53A 5EE3A 5D7GA 5HI1A 2YEPF 3P4PB 1VZ8A 1ENFA 1JQ4A 2LMCA 5FKAC 1MPEA 2PVOD 4N58A 2ICIA 2LFIA 3WCQA 2CJOA 2ONQA 4JE3B 3Q8CA 4H2AA 1HZ6A 5BMHA 1EU3A 3U7ZA 2RDGA 1TY0A 1FFUA 2IPKD 1KH0A 1YJIA 4IOIE 3MHZA 4NJCA 4ITKA 1CZPA 4XDCA 4MT5A 3SEBA 5D3DA 2WXGA 1TZOA 2I38A 2WDQB 4EE2A 4TQ0A 3RFZB 1F77A 1GPXA 3HUIA 1EU4A 3I57A 3ETRA 3VRAB 1FIQA 2AX5A 1N60A 2D5GA 1QQRA 2MJDA 3GP7A 3N9YC 1D5ZC 1SXTA 2L1AA 1GB1A 2MH7A 1GB4A 4NAWB 2QSDA 2LJIA 1TYGB 3NRZA 4HROA 3AH7A 3AMZA 1HQRD 2WXHA 3MFGA 5C2TB 1AYFA 4HEA1 4YSYB 1FCLA 2BBCA 3MJ5A 2CU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAC A;  2NMQ A;  1PGX A;  2IGD A;  4GLS C;  1XCT L;  2PLP A;  3UI3 A;  5BMI A;  3GB1 A;  1D4B A;  1IGC A;  2JWU A;  2KDM A;  1YNT E;  2JSV X;  2JU6 X;  5HHD G;  1EM7 A;  2LHE A;  2JZP A;  1QKZ A;  2GB1 A;  4D2K A;  1C9F A;  1FCC C;  1MHH E;  2LHD A;  1YMH E;  2RMM A;  4KGT A;  2J52 A;  4IKG A;  1F2R C;  5BMG A;  2RPV A;  1XCQ L;  2KWD A;  2N7J A;  2N9K A;  1K51 A;  4OZA A;  5JXV A;  1IGD A;  2GI9 A;  5HFY A;  5HG2 A;  2PW9 A;  1F2R I;  1UWX A;  2QMT A;  1ZXH A;  2K0P A;  2KN4 A;  2ZW0 A;  1HZ5 A;  1FD6 A;  2JXT A;  3MP9 A;  2I2Y A;  1Q10 A;  1JML A;  2IGG A;  1K53 A;  4KGR A;  5HI1 A;  1K52 A;  1K50 A;  3V3X A;  1HEZ E;  1MVK A;  2KQ4 X;  2LUM A;  1MPE A;  2PTL A;  2ONQ A;  1HZ6 A;  5BMH A;  1MHX A;  4HKZ E;  1KH0 A;  1MI0 A;  4IOI E;  1P7F A;  2EEL A;  1IBX A;  4OZB A;  1XF5 L;  4OZC A;  1PGB A;  4HJG E;  2IGH A;  2J53 A;  2ZW1 A;  2I38 A;  4WH4 A;  1GB1 A;  3FIL B;  2KAC A;  1GB4 A;  1IBX B;  2QSD A;  1PGA A;  2ON8 A;  2LGI A;  2OED A;  3FIL A;  4KGS A;  1P7E A;  2N9L A;  1FCL A; 
#chains in the Genus database with same CATH topology
 2FBW B;  1FM0 D;  2X38 A;  4GLS C;  1N62 A;  2INC C;  4LJO B;  4AJW A;  3NJT A;  3QAR A;  3FAH A;  1WE6 A;  4J6I A;  4XE0 A;  4GSW A;  1MG4 A;  1FCC C;  4PYZ A;  1J7A A;  1MHH E;  2FUG 1;  1SE9 A;  3H6N A;  3BYY B;  3PRM B;  1J0G A;  1F9J A;  2RR9 A;  3GE8 C;  1P98 A;  3V60 A;  1KLV A;  3RCZ A;  2I1K A;  4M02 A;  5MPO A;  3R2I A;  1NEN B;  2WXR A;  3NS8 A;  5FR6 A;  1BML C;  3P1M A;  3NOB A;  3PO0 A;  5EE9 A;  2KN4 A;  2VRR B;  5IOI A;  2M17 A;  3BVZ A;  5IA7 A;  2WDR B;  2ZVO A;  3ZW3 A;  1RYJ A;  1TS4 A;  1WF9 A;  1JML A;  1UF0 A;  2K1F A;  1C1Y B;  1CK1 A;  1OEY J;  2FAZ A;  2INP E;  4HKQ A;  2KVZ A;  2V3P A;  2EKI A;  4ZYS A;  1NDD A;  1T6B X;  5E6P A;  3ZDT A;  2L05 A;  4M00 A;  1WSP A;  3N1Z C;  1WX9 A;  3W1S C;  4P1C C;  2WXI A;  3QAQ A;  1D5X C;  1LFD A;  1TY2 A;  3JW0 X;  2WX0 A;  1XF5 L;  3TEW A;  2BYF A;  1KRH A;  3RUL A;  3B08 A;  3ZNZ B;  4KZ0 A;  2V4L A;  3M95 A;  1A5R A;  1WXV A;  4DHJ D;  2KFK B;  3ML9 A;  3R8B A;  3R7Q A;  2W9N A;  3HK0 A;  1WGG A;  3APF A;  1MJD A;  5J2R A;  4GDL A;  4HRS A;  1J19 A;  3PRZ A;  2REX A;  1V2Y A;  2PLP A;  2PE6 B;  1MFW A;  4F7Z A;  3SFE B;  4USA A;  2WXO A;  1E8Z A;  5IAA C;  2IND C;  4DHZ E;  2GB1 A;  4EUT A;  1C9F A;  1SE4 A;  4BOZ B;  1VZ7 A;  1BXT A;  3BVM A;  4WJN A;  4MSM B;  1YJ1 A;  1PDX A;  1SSN A;  2HTH A;  4Q2J A;  4FXC A;  3DDC B;  2N9K A;  3AI5 A;  2UWQ A;  1XXG A;  2ZJD A;  2KYW A;  2EKE C;  1E9M A;  1F52 A;  3L4P A;  1ZOY B;  4BBN F;  1WM3 A;  1STE A;  3EC8 A;  2QHO A;  2B76 B;  5BYR A;  1Q10 A;  1WJN A;  2JY6 A;  1AAR A;  2JXX A;  2H89 B;  2QEJ C;  2E3T A;  4WUR A;  3BZD B;  2M19 A;  4REZ A;  2N9E B;  2JYT A;  3ZNI D;  2MBE A;  2KN5 A;  3QCA A;  4K81 A;  4XZ4 A;  3L08 A;  3L13 A;  4HK2 A;  4RGT A;  2LVQ A;  2K39 A;  5L83 A;  1WXS A;  2LJ5 A;  2J53 A;  1SJH D;  2FCS A;  4LCD E;  3W9C B;  1SGH A;  2DZK A;  1E5W A;  3AED B;  4CHK A;  2JUO A;  4US8 A;  3A4S C;  1IBX B;  1ZDV A;  1LM8 B;  2IO3 B;  3S2A A;  2MBO A;  1FO4 A;  2N7D A;  4ANU A;  4C56 C;  3FIL A;  2V3N A;  4MM3 A;  4HPP A;  1J7C A;  4MAC A;  3RNE C;  1WGR A;  2KVR A;  3AE3 B;  2JSV X;  2Z0D B;  2MA9 B;  1TZ1 A;  4AJY B;  3QJZ A;  3DPD A;  3PT2 B;  2WWZ A;  5AUI A;  1JCK B;  2HE7 A;  2PJH A;  4EEW A;  1KLU D;  3WAM A;  2AWT A;  4TV3 A;  1YN3 A;  3ZGZ A;  4W9D A;  5E6O A;  1F2R C;  2L3Z A;  3HVZ A;  1KM7 A;  2NTT A;  4A90 A;  1JRU A;  1H8C A;  4FHK A;  2GI9 A;  2LGX A;  2AEH A;  1DGJ A;  4ZOH C;  1VJK A;  5G55 A;  3CMM B;  2MWS B;  2JQR B;  2GOW A;  2UU7 A;  4GDK B;  2Y5B B;  3KYC D;  3MP9 A;  1FMA D;  2KDF B;  1JWU D;  5CHW A;  3PLV A;  1I7H A;  1SIF A;  2AQ2 B;  5CHF A;  2INN E;  3B9J A;  3I9V 1;  1HEZ E;  5AZH A;  2KQ4 X;  2MX2 A;  1DOY A;  4MGK E;  1JW9 D;  2IO1 B;  4N6E B;  1AN8 A;  2CJN A;  4LDT D;  4LNF A;  1L4D B;  2BYT A;  4K7W A;  3NUH B;  2GRI A;  1MI0 A;  4MEM A;  1KLG D;  5JZE B;  1T0R C;  2FE8 A;  2WYQ A;  1IYF A;  2LVO A;  1WGY A;  2KZR A;  1WMH A;  4JWS C;  3AV8 A;  4M01 A;  5H92 C;  2L52 A;  1V1O A;  2KWC A;  5FK9 C;  3C8Y A;  1WRI A;  4LK0 M;  5DPT A;  3IG3 A;  2A4Z A;  1L0X B;  3Q3N C;  4KZC A;  3AU4 A;  2MCN B;  4FAD A;  1D4B A;  3VRB B;  1EUV B;  4GMV A;  3MJW A;  2WS3 B;  4PS7 A;  2PKO A;  2SAK A;  2CR5 A;  3AEG B;  3VQI A;  2PMV A;  2E6X A;  3A1Q B;  2KT7 A;  3V05 A;  3GOE A;  4JL9 A;  1H4R A;  3M63 B;  2LAS A;  3TJP A;  1J7B A;  1F0Z A;  4RGO S;  1VDV A;  5GXG B;  3L54 A;  2GBR A;  2WGS A;  3ZLZ A;  4B9K A;  2PW9 A;  2QMT A;  1V81 A;  1TKG A;  3RNG C;  1I4H A;  4LLG M;  1SE2 A;  4BBN C;  2ZCB A;  1FNW A;  1K53 A;  4WQO B;  5HI1 A;  4HDO A;  2XK5 A;  1VZ8 A;  1JQ4 A;  2ICI A;  3WCQ A;  2ONQ A;  3Q8C A;  2DAF A;  5DPR A;  4W9C A;  4IM0 A;  1OQY A;  3PGE A;  2N1V A;  3KUD B;  2IZV B;  4ITK A;  3OG5 A;  3ZO5 B;  4MT5 A;  4K3B A;  1WGH A;  2KJ6 A;  5LLI A;  2WDQ B;  4EE2 A;  4TQ0 A;  3UIP B;  3ETR A;  1FIQ A;  2L1A A;  1CMX B;  4MGY E;  3KUC B;  3NRZ A;  4FHJ A;  2KDE B;  2GBJ A;  4HRO A;  3AUL A;  1HQR D;  3MTN B;  1AYF A;  2LZ6 A;  3OJ4 B;  1FCL A;  2KTF A;  2NCN A;  1L6V A;  1YN5 A;  4MGZ E;  2KXJ A;  1QOF A;  3UQA A;  1E7U A;  1SJE D;  2L76 A;  2BWF A;  2BKR B;  1QOG A;  4YL8 A;  1V80 A;  3TBL D;  1V5T A;  3Q2A C;  2G4S A;  1B1Z A;  4W9K A;  4GN1 A;  4D2K A;  5TR5 A;  1EWC A;  3UIN B;  2CHX A;  5LXI B;  2LI5 A;  3Q8E A;  1YQ3 B;  3M3J A;  1K8R B;  1IGD A;  1C78 A;  1TIF A;  2NR2 A;  3DVG Y;  4YTN B;  5TSS A;  5BO4 B;  2AQ3 B;  1L5P A;  3OLM D;  4I6N B;  2Z59 B;  3PVL A;  3APD A;  3IVF A;  1F1H A;  2I2Y A;  5T8I A;  2O6V A;  4FLH A;  3KWL A;  1RRB A;  3N1Y C;  3TSS A;  3NVW A;  4IM3 A;  2C7H A;  4XGA B;  1RAX A;  1KJT A;  2WXJ A;  4OVV A;  4A6Q A;  1XLN A;  2FCM A;  3SHQ A;  1RM6 C;  1NI3 A;  5LXH A;  2KKC A;  3ZTD A;  1QLB B;  1R4N I;  2WDT B;  3WAN A;  2JF5 A;  1D3Z A;  3ABV B;  5J18 A;  1VD2 A;  4DHJ B;  1WH3 A;  3RYT A;  3ZJU A;  4FUL A;  4IWP A;  3CSF A;  3RNF C;  3I5J C;  2NBW B;  1WGK A;  2WP9 B;  2J42 A;  3H7P A;  3I3T B;  1L0V B;  2FNJ B;  5JHB A;  3L16 A;  2BTE A;  1D5M C;  2EMT A;  1NI2 A;  3Q69 A;  3JSV A;  2KNB A;  2JT4 B;  3EFU A;  2BYV E;  4E74 A;  1FNU A;  2K6D B;  2LHE A;  2KMA A;  3WAO A;  1GG3 A;  4RMA A;  1QIL A;  1EF1 A;  2L8J A;  4JWU C;  1WRD B;  2KFJ A;  3KYD D;  4HPM B;  2KJH B;  3RUI B;  1AWD A;  3VH3 B;  2KWD A;  1K51 A;  1WE7 A;  3Q3J A;  1UD7 A;  2JPH A;  1UWX A;  1YQ4 B;  4DQO C;  4X57 B;  3KW5 B;  2R2Q A;  2KWV B;  1FXT B;  4YXD B;  3BII D;  3W1S A;  1V1P B;  2DZI A;  1WR6 E;  4NAM A;  1JRO A;  3AE5 B;  4A9A A;  3N1X C;  4NY0 A;  2LRU A;  4RCO A;  4M8M A;  4JPS A;  1WJ6 A;  4IDI A;  2KD0 A;  1DOX A;  4BVU C;  2KK8 A;  2JRI B;  1ZPS A;  1LGR A;  3KWV A;  4EZJ A;  1OGW A;  2ZCC A;  3MC8 A;  2M4N A;  1R4M I;  2KAN A;  4JIO U;  1OQR A;  4P1B C;  3T9L A;  1FRR A;  1UNS A;  1GJZ A;  3AEB B;  2K25 A;  1V5O A;  3R66 C;  1Q0W B;  2DYO A;  3X23 A;  4WH4 A;  5CHV C;  3WAP A;  1C4A A;  4MJS A;  2G3Q B;  3LB8 C;  3FIL B;  3ZXV A;  2KC1 A;  1YX6 B;  4F1S A;  3ZDM C;  2OED A;  3A9K A;  3P4S B;  2N9L A;  1QOB A;  1DYQ A;  3A9J A;  4PS3 A;  2D3B A;  4GOC A;  4AS1 A;  2K3U A;  5HKH A;  3Q3O C;  4AQ7 A;  4XX5 A;  4LNN A;  3RI7 C;  4B95 A;  2W3R A;  1UZX B;  3FC4 A;  1PUT A;  4MEL A;  4MH8 A;  3GS2 A;  1V97 A;  3HVD A;  4OW0 A;  1SEB D;  1QKZ A;  1UEL A;  1TS5 A;  1I4R A;  2OOB B;  4GIV A;  1N61 A;  4I6L B;  4RF1 A;  1WZ3 A;  3ML8 A;  2DAJ A;  1DOI A;  2J0J A;  3TEZ A;  1ZE3 D;  4J3O D;  1RFK A;  2YEP B;  2IYD B;  1YIW A;  3TL5 A;  1T0Q C;  1NVI D;  2WLB A;  2NTS A;  1JAL A;  1QF6 A;  4GXB A;  1WXM A;  1ZXH A;  3KLS X;  2NVU I;  2JZZ A;  4M0W A;  2FUH B;  1GC7 A;  1HZ5 A;  1FD6 A;  3ZYY X;  3EEC A;  1WYG A;  2H88 B;  2JXT A;  4W9G A;  4DDG D;  3H7S A;  3N20 C;  3IXS A;  4US9 A;  2D3G A;  3DBL I;  1E8W A;  4KDI C;  4ZRK A;  3IAM 1;  1WI0 A;  2LXA A;  4LDT B;  2PTL A;  2CU1 A;  3AEA B;  2GBK A;  1MHX A;  1KF6 B;  2G45 B;  4BKG A;  2WU2 B;  4L2Y A;  2EEL A;  1NEK B;  4OZB A;  3URY A;  4YSZ B;  1PGB A;  2KTR B;  4ANW A;  1IP9 A;  3VTW A;  1UUP A;  2C7N B;  2KOX A;  3AE1 B;  3LDZ E;  1ZGU B;  4JGH B;  3LYY A;  1Y56 A;  4W9H A;  1SBB B;  3I63 C;  3N3K B;  4RGM A;  2WU5 B;  1V49 A;  3NG0 A;  2Q5W D;  2LGI A;  3EUB 2;  4GB9 A;  3AB5 A;  1SF0 A;  4PT5 A;  3UI3 A;  5DCN A;  2JYE A;  3ZXR A;  1HXY D;  5HHD G;  2AL6 A;  3C19 A;  4JQW C;  3A33 B;  1N63 A;  3QA8 A;  1TTN A;  1WY8 A;  3NVY A;  4S17 A;  3NZ3 A;  4A55 A;  3TUO A;  3DVN U;  2PIA A;  2LHD A;  1EWY C;  1WJU A;  1JWS D;  4A3P A;  1TBE A;  4A20 A;  3DBR I;  2GLS A;  3WA0 A;  3ZIM A;  4TUU A;  4C4V A;  4K7S A;  3V61 A;  2LXC A;  1WM2 A;  2QC8 A;  4RNA A;  1E7V A;  3EGR A;  3ZJT A;  4KIK A;  1YD8 U;  4WWP A;  1P0R A;  2L32 A;  3U52 E;  2MJE A;  2N1W A;  3RN9 C;  1JWB D;  4MDK E;  4PS8 A;  4IG7 B;  2EMS A;  1HZ6 A;  3DHG C;  3RT3 B;  5BMH A;  1XT9 B;  2BF8 B;  3ZVV A;  2KFK A;  3MHZ A;  4LJP B;  4NJC A;  3IBE A;  5G2N A;  3QQ8 B;  3SEB A;  5D3D A;  3RFZ B;  3DVN V;  1UBQ A;  3VRA B;  4BAX A;  1N60 A;  2MJD A;  3N9Y C;  4W9J A;  2KC2 A;  3RMK C;  2OJW A;  4G0N B;  1GB4 A;  4NJ6 A;  2QSD A;  1X1M A;  1TYG B;  2RGF A;  4W9L A;  2CU3 A;  5J17 A;  1CJE A;  2NBU A;  4EKU A;  1QOA A;  2KQ7 A;  4CO7 A;  3GB1 A;  2IO0 B;  3MHS D;  1I4Q A;  3SFD B;  2L0T A;  1FPY A;  5AUK A;  3PHW B;  1XLP A;  2NPT B;  3DBL B;  1YQB A;  2MLB A;  3KH0 A;  1ZKH A;  3SR6 A;  1TJE A;  4ZHP A;  3TEY A;  2LGD A;  1Y8R C;  4XWW A;  4AWJ A;  3IAS 1;  4WJQ A;  3OAW A;  2RSU A;  1P3Q U;  2BS3 B;  2N7J A;  3VXW A;  5HFY A;  4PK1 A;  5JH5 C;  1AW7 A;  3SU8 X;  2JWZ A;  2MW5 A;  2VZK D;  2K0P A;  3EFC A;  4KX6 B;  2KLG A;  3CWI A;  2KHW B;  2O6V B;  3U2S C;  2N4F A;  4WAF A;  2IGG A;  3NZU A;  3IT4 B;  1MVK A;  2DYB A;  2G9H D;  4WAA A;  1V9J A;  3PSE B;  1C79 A;  3BWU D;  5G5G A;  1BUI C;  3B1L X;  3VH4 B;  1IBX A;  4YTM B;  1YJJ A;  4BFR A;  4L23 A;  2WXN A;  3AE4 B;  3P2B A;  2LGY A;  1SB3 C;  5BYS A;  2W3S A;  2C5L C;  4WWO A;  3WIM A;  4YWG G;  4XWT A;  3H1U A;  3VTU A;  3DBR B;  3O13 A;  1UGM A;  4HCP B;  2WXM A;  4C00 A;  3HHM A;  4KGS A;  4XDD A;  4I6P A;  2KMC A;  3QC8 B;  1L0Y B;  2B3A A;  4ARI A;  2O2V B;  1XCT L;  5GMV A;  1IPG A;  2WHI A;  4LTU A;  5FR3 A;  2DNF A;  1VR9 A;  1XLQ A;  1C77 A;  2XN9 C;  3MC0 B;  2WDV B;  3SD5 A;  2ZPY A;  2J4X A;  4IUM B;  3Q6B A;  4WIP A;  3UQB A;  2W54 A;  3LJ3 A;  3UGB B;  4B0M A;  1WWT A;  4GDK A;  3RZW C;  3VUY A;  2N7E A;  1XQQ A;  2V3S A;  1FXI A;  1HTO A;  1TKY A;  4AP4 C;  3FKY A;  3Q8F A;  4JLC A;  1GOZ A;  1F2R I;  3PPA A;  3L0W B;  1ISN A;  2DZM A;  4HPL B;  2MSE D;  2C7M B;  3T3O A;  2N0S B;  1T5X D;  4BKS A;  2RPQ A;  1C76 A;  4E3C A;  1PFD A;  1ZXI A;  2KQS A;  4EZL A;  3O65 B;  2I1J A;  4TSS A;  1C4P A;  2M8S A;  1EF5 A;  2N9P C;  2BT6 A;  2DHZ A;  3DWM A;  3E56 A;  4JX1 C;  2RDB C;  2RDH A;  4ACF A;  2O6V D;  2FID A;  5E6J A;  2CS4 A;  2KX0 A;  5CTR C;  4MJS B;  3CST A;  3AM9 A;  1P1A A;  1SE3 A;  3A9K B;  3QHT A;  4KKI A;  2M0A A;  4DXF A;  3A9J B;  1HE8 A;  2V4I B;  2ON8 A;  2VH1 A;  3QK0 A;  1ZUD 2;  3BK1 A;  3K9O B;  3Q8A A;  3D32 A;  4IC7 B;  2BGF A;  2JX5 A;  3A1Q A;  2JRH A;  4URK A;  2D10 A;  1UWM A;  2HDE A;  1VZ6 A;  3Q8B A;  4EZK A;  1YX5 B;  3W5V B;  2KJR A;  1EM7 A;  3P63 A;  1Q1O A;  2BKF A;  1G6J A;  4GDL B;  3PV1 A;  2PVG C;  2ASQ A;  5D94 A;  2BB5 A;  2NBV B;  1WGD A;  2KX3 A;  5D6J B;  1FXA A;  4IWO A;  2LD9 A;  2VH2 A;  3VUW A;  4DXG A;  3HM3 A;  4KV2 A;  2RD0 A;  1FEH A;  4S0R A;  1M4V A;  4IKG A;  2K6Q A;  4ZYN A;  3EA6 A;  1XCQ L;  3PZ8 A;  1YN4 A;  1WZ0 A;  5L95 C;  1V6E A;  4M0W B;  3ZQ4 A;  3V6C B;  1J8C A;  1T0S C;  2Y5C A;  2IDY A;  1NBF C;  3NY5 A;  1HA5 A;  1I4P A;  3DQV A;  4MSQ B;  2J0K A;  4KGR A;  1SIJ A;  3BVG A;  2DEN B;  1K50 A;  2X8X X;  2C9W B;  1OQQ A;  2BS4 B;  4HLE A;  1VRA B;  4FA6 A;  4W9I A;  4OVZ A;  3U8Z A;  3AE6 B;  3JVZ X;  3DBH I;  2PE9 A;  2MQJ A;  1E8Y A;  2WX1 A;  4HJG E;  2DWQ A;  2D3C A;  1BT0 A;  3BIN A;  2QCZ A;  4N9F 4;  1RWS A;  4B0E A;  1A70 A;  3KUZ A;  1GAQ B;  5LNK 1;  4DXA B;  4HXD A;  3DHI C;  2R2O A;  4G11 A;  1UBI A;  5G5H A;  2G1E A;  2WXF A;  1ZW7 A;  4K7U A;  2OJR A;  4II3 B;  3UIO B;  3VR8 B;  3ZTC A;  1L2N A;  4OHJ A;  2K8H A;  3V6E B;  2TSS A;  4ANX A;  1ET9 A;  3AEC B;  2BWE S;  2BVC A;  3VHT C;  3ZUN A;  1U4A A;  3OWE B;  3IT6 B;  4UDU C;  3A4R A;  2R61 A;  1JRP A;  3OJ3 A;  4K1R B;  1P9D U;  4EFO A;  1WR1 A;  2IO2 B;  3ZJV A;  4MM3 B;  5C3J B;  3VDZ A;  4ZRI A;  4P7I A;  2KDI A;  4YTP B;  4WJO A;  2RMM A;  4KGT A;  2Y3A A;  2BW2 A;  2J52 A;  4C4V B;  2DZJ A;  4QAY A;  2WQY B;  1GC6 A;  4LNO A;  3Q14 C;  4P6V F;  1CQV A;  2RPV A;  4KIK B;  4RF0 A;  5JXV A;  4NNJ B;  2KMM A;  1E90 A;  1TKE A;  2LEK A;  5HG2 A;  2MP2 A;  1TS2 A;  1GUA B;  1ESF A;  2M56 B;  3AE8 B;  3AU5 A;  2L0F A;  4ASW C;  1HTQ A;  1KFY B;  3PRP B;  2ZEQ A;  2BPS A;  2ZVN A;  4MH0 E;  3C0R B;  2V9H A;  1E6E B;  5EE3 A;  2YEP F;  5EDS A;  2PVO D;  4IWQ A;  4N58 A;  4JE3 B;  4H2A A;  3U7Z A;  1OTR B;  2RDG A;  1R4N B;  3NHE B;  1FFU A;  2IPK D;  1KH0 A;  2LRW A;  4IOI E;  4K3C A;  2NS5 A;  1CZP A;  2WXG A;  1TZO A;  2N9X A;  1GPX A;  1F77 A;  4ZDV A;  2AX5 A;  2HJ8 A;  1QQR A;  2K8B A;  1SXT A;  1GB1 A;  4IM2 A;  1VCB A;  2WXH A;  4LNK A;  1TT5 B;  4NAW A;  4HEA 1;  4YSY B;  3DHH C;  1N6Z A;  1WMH B;  4P16 A;  4RGN A;  2NMQ A;  4WJP A;  3LXF A;  4KVG B;  2Z8L A;  2GBM A;  5BMI A;  3VTV A;  3DVG X;  2JWU A;  4GU2 A;  2KDM A;  4DHZ B;  2MEK A;  4II2 B;  2Z0E B;  2JZP A;  4LNI A;  4HCN B;  2K8C A;  2KWU B;  1RLF A;  3TIX A;  3KQ4 A;  4KSL C;  2OHF A;  1R7S A;  3AE7 B;  2K5P A;  4ICV A;  1ET6 A;  4ZRQ A;  2HD5 B;  1V1P A;  3DBH B;  1WX7 A;  2LVP A;  2VZK B;  1QT9 A;  4G50 A;  2ZW0 A;  4ICU A;  1TS3 A;  3P42 A;  1ACC A;  1TGZ B;  2CHW A;  2WNM A;  2XBB C;  1WIA A;  4RM8 A;  3ZNH B;  2V0G A;  2C60 A;  2V1Y A;  4KKJ A;  2CKH B;  5EE1 A;  4AOF A;  4R3D A;  1K52 A;  2FCQ A;  1LO5 D;  2BB6 A;  1R4M B;  3HM6 X;  2YLM A;  1I35 A;  2ZNV B;  2J0M A;  4TQ1 A;  2MHJ A;  3PRE A;  3BK2 A;  3QX1 A;  1UH6 A;  4KSK C;  1OFF A;  2A5U A;  5H8Y E;  5I4D A;  4ARC A;  2UYZ B;  2XK5 B;  4OZC A;  2W55 A;  4WQM A;  3PHX B;  1VLB A;  3AXC A;  2WXQ A;  3NVV A;  4GGQ A;  1C4C A;  3AE2 B;  2SEB D;  4BOS C;  3TEX A;  5DPS A;  3ZNG C;  1FRD A;  1EO6 A;  5IO9 A;  2KAC A;  2WXK A;  1L4Z B;  1ZDX A;  3Q3F A;  1PGA A;  2Y5P A;  1XEE A;  2AQ1 B;  1E10 A;  5AZF A;  2WXP A;  3HIZ A;  1B9R A;  1P7E A;  2IJ0 A;  2D11 A;  2GMI C;  4IW0 A;  2IGD A;  5JHA A;  4CYE A;  2ZZP B;  1RFA A;  2MJ3 A;  2M1M A;  4FJY A;  1M94 A;  4HVB A;  2G4D B;  3DCG A;  2QDF A;  1MG8 A;  3E9S A;  2MBB B;  4L1B A;  2BYE A;  4TKN A;  3R7R A;  3ZRC A;  5BMG A;  5KHO A;  1T3Q A;  4FJZ A;  4OZA A;  3NZS A;  1FNV A;  2KO3 A;  1N5W A;  3RZF A;  5CX3 A;  4BZA A;  3CF6 E;  1WJ4 A;  4ZRJ A;  3ONS A;  4HWI B;  3H8H A;  2AL3 A;  2M0X A;  2IBI B;  3N30 A;  3IHP C;  1XD3 B;  4G3X B;  3ECI A;  3R2T A;  5BYQ A;  2QIL A;  2KTR A;  1I4G A;  2J7Q B;  3V3X A;  1E8X A;  3EHV A;  4CQN A;  3U30 A;  1IUE A;  2LUE A;  2QJL A;  3VR9 B;  2DBY A;  1V8C A;  2YVC A;  2QIE B;  1P7F A;  3ENE A;  1WYW B;  3N32 A;  2CHZ A;  2IGH A;  1D6E C;  2XEW A;  1N5X A;  4FN2 A;  4EOY A;  3VUX A;  3APC A;  1KTK A;  3WAL A;  1GNU A;  1XO3 A;  3TCA A;  4NZL B;  4W9F A;  3VFK A;  3SDL C;  1UGJ A;  3GZN I;  4ZRP A;  1Z5S B;  4YSX B;  2DX5 B;  4A3O A;  3UF8 A;  4B6W A;  3H9D A;  3IFW B;  1WFY A;  2MRP A;  2L83 A;  1YOV B;  3RNC C;  3GE3 C;  4XC2 A;  4C7Y A;  3P4Q B;  1E0Z A;  4C80 A;  4O1N A;  1IGC A;  3BYT B;  5EE0 A;  1QZE A;  3P4R B;  3PZ7 A;  2GBN A;  1V86 A;  4PYU A;  3AEF B;  3CIR B;  3H7P B;  5AEK B;  3PS6 A;  3AEE B;  4NQK E;  3JSV B;  5AZG A;  2WXL A;  3L10 B;  5D2M B;  3PLU A;  3AN1 A;  1NYR A;  2AYO B;  4A8X C;  3M62 B;  3W5U B;  3ZRF A;  2L00 B;  2DLB A;  3W2D A;  2PEA A;  3X0W A;  4RFB A;  1I4X A;  3U4E G;  4XYC A;  3ALB A;  1WXA A;  4RH6 A;  5IP4 D;  2KAJ A;  1E7P B;  3KVF B;  2K22 A;  4YT0 B;  1Z2M A;  2KLC A;  2ZNV C;  3TMP B;  2LUM A;  3ZKJ C;  4WWN A;  1KOT A;  4M8N A;  1XLO A;  2BQQ A;  2W82 A;  3VVW B;  4ZHO A;  3J9C A;  1NYQ A;  4HKZ E;  3BY4 B;  4NJ7 A;  1LQB A;  2DYM A;  1ZP0 B;  2HJ1 A;  3T8M A;  3MC9 A;  2BS2 B;  4BKS D;  1L7Y A;  2ZW1 A;  4OVU A;  3DOW A;  4MGI E;  3HRD D;  3PZD A;  2ZPN A;  3DWG C;  1Q5W B;  4E71 A;  2JZ3 B;  4TMA B;  4RM9 A;  3PTF C;  2NPT A;  4C7Z A;  4FBJ B;  5IN7 A;  2PPH A;  2XNA C;  3JYU A;  1OEY A;  1FFV A;  1PGX A;  1PQS A;  4F8C B;  2LGS A;  4W9E A;  3VAW A;  1PYW D;  4HJK A;  4N59 A;  4NQL B;  1YNT E;  2JU6 X;  2KDB A;  4NPN A;  3K9P B;  1ROE A;  3B2F A;  3Q3M C;  3RPF C;  5E6N A;  1L6U A;  1WXQ A;  1YMH E;  4DDI D;  1I42 A;  2L7R A;  3NS1 A;  2D07 B;  3T3N A;  3L17 A;  2MP2 B;  3AE9 B;  2LWP A;  2FIF A;  2ACZ B;  3B0A A;  4DWF A;  2HTM E;  4ANV A;  1JWM D;  3NVZ A;  4KDL B;  4DBG A;  3QWZ B;  1S3S G;  1JWA D;  2K9X A;  4WWM A;  3B2G A;  5D3I B;  5D7G A;  5KHQ A;  3GZN B;  3P4P B;  5C1Z A;  3W1Y A;  5IKC M;  2MBQ A;  1ENF A;  3U7D A;  4BKT A;  2LMC A;  5FKA C;  1MPE A;  2LFI A;  2CJO A;  1EU3 A;  1TY0 A;  5DPW A;  1YJI A;  4DK5 A;  3QIJ A;  2IY1 B;  1LXD A;  4XDC A;  3DBS A;  5C23 A;  3R3M A;  2I38 A;  2D2Q A;  4HDQ A;  4AUQ C;  3HUI A;  1EU4 A;  3I57 A;  2D5G A;  1S1Q B;  2O2V A;  1WX8 A;  3RNB C;  3GP7 A;  4FJV B;  1D5Z C;  2MH7 A;  4NAW B;  2JVC A;  3V62 A;  2LJI A;  2D3A A;  1T0Y A;  2FCN A;  3RNA C;  2IY0 B;  3AH7 A;  3AMZ A;  3RD2 A;  3MFG A;  5C2T B;  2MBH A;  1C3T A;  2BBC A;  3MJ5 A; 
#chains in the Genus database with same CATH homology
 1CJE A;  2FBW B;  1FM0 D;  4P16 A;  4RGN A;  1L6V A;  1YN5 A;  2NMQ A;  2X38 A;  1QOF A;  3LXF A;  1QOA A;  1N62 A;  2Z8L A;  4GLS C;  1SJE D;  5BMI A;  3GB1 A;  1QOG A;  1I4Q A;  2JWU A;  2KDM A;  3SFD B;  3FAH A;  2MEK A;  5AUK A;  1XLP A;  1B1Z A;  2JZP A;  4XE0 A;  3KQ4 A;  4D2K A;  3SR6 A;  1TJE A;  1FCC C;  1EWC A;  1J7A A;  1MHH E;  2FUG 1;  4ZHP A;  3BYY B;  3TEY A;  2OHF A;  4XWW A;  1R7S A;  3AE7 B;  2K5P A;  1ET6 A;  3IAS 1;  3Q8E A;  4ZRQ A;  1V1P A;  2BS3 B;  2N7J A;  3R2I A;  5MPO A;  1NEN B;  1YQ3 B;  2WXR A;  1BML C;  1IGD A;  1C78 A;  5HFY A;  2VZK B;  3P1M A;  1QT9 A;  1AW7 A;  4YTN B;  5TSS A;  2AQ3 B;  3PO0 A;  1L5P A;  2VZK D;  2K0P A;  2KN4 A;  5EE9 A;  2ZW0 A;  4KX6 B;  1TS3 A;  3P42 A;  3BVZ A;  3CWI A;  1ACC A;  2WNM A;  2WDR B;  3U2S C;  2V0G A;  1RYJ A;  1TS4 A;  2I2Y A;  4KKJ A;  5T8I A;  1JML A;  4WAF A;  2IGG A;  5EE1 A;  3IT4 B;  3KWL A;  4R3D A;  1K52 A;  1CK1 A;  2INP E;  4HKQ A;  1LO5 D;  2BB6 A;  2V3P A;  1MVK A;  3TSS A;  2EKI A;  4ZYS A;  3NVW A;  4TQ1 A;  1T6B X;  3BK2 A;  2G9H D;  2WXJ A;  1WSP A;  1C79 A;  4A6Q A;  1XLN A;  3BWU D;  5G5G A;  1OFF A;  2WXI A;  1D5X C;  1BUI C;  1RM6 C;  5H8Y E;  1TY2 A;  1NI3 A;  5I4D A;  1IBX A;  4ARC A;  4YTM B;  1YJJ A;  1XF5 L;  3TEW A;  4OZC A;  4L23 A;  2W55 A;  2WXN A;  4WQM A;  1QLB B;  3AE4 B;  1KRH A;  1VLB A;  3ABV B;  2WXQ A;  1SB3 C;  3NVV A;  5BYS A;  2W3S A;  1C4C A;  3ZJU A;  3AE2 B;  2SEB D;  4YWG G;  3TEX A;  4XWT A;  1FRD A;  2KAC A;  2WXK A;  1L4Z B;  1ZDX A;  3R8B A;  1PGA A;  2Y5P A;  1XEE A;  2AQ1 B;  1E10 A;  3O13 A;  2WXP A;  2WXM A;  1WGK A;  2WP9 B;  4KGS A;  4XDD A;  1B9R A;  2J42 A;  1P7E A;  4HRS A;  2IJ0 A;  1L0V B;  2BTE A;  1L0Y B;  1D5M C;  2IGD A;  3Q69 A;  4ARI A;  1XCT L;  2PLP A;  3SFE B;  4USA A;  4LTU A;  5FR3 A;  2WXO A;  1FNU A;  1VR9 A;  1XLQ A;  1C77 A;  2LHE A;  2XN9 C;  3MC0 B;  2WDV B;  2MJ3 A;  2J4X A;  2GB1 A;  1C9F A;  1SE4 A;  1QIL A;  1VZ7 A;  4WIP A;  2W54 A;  1BXT A;  3BVM A;  3E9S A;  4L1B A;  4JWU C;  4B0M A;  1WWT A;  1PDX A;  1SSN A;  5BMG A;  4Q2J A;  4FXC A;  1AWD A;  1T3Q A;  4OZA A;  2KWD A;  2N9K A;  1FXI A;  1K51 A;  1TKY A;  1FNV A;  1XXG A;  1N5W A;  3Q8F A;  1GOZ A;  1F2R I;  1UWX A;  1YQ4 B;  4DQO C;  1E9M A;  3L4P A;  1ZOY B;  3H8H A;  4YXD B;  1STE A;  3T3O A;  3BII D;  2B76 B;  5BYR A;  1V1P B;  1T5X D;  1Q10 A;  2N0S B;  3W1S A;  4NAM A;  1C76 A;  1JRO A;  1PFD A;  3AE5 B;  3R2T A;  2H89 B;  2QEJ C;  4A9A A;  5BYQ A;  1ZXI A;  2QIL A;  1I4G A;  2E3T A;  3V3X A;  4WUR A;  4RCO A;  3BZD B;  2M19 A;  4REZ A;  4JPS A;  4IDI A;  4TSS A;  1C4P A;  2JYT A;  1DOX A;  1ZPS A;  2BT6 A;  4CQN A;  3KWV A;  1IUE A;  2QJL A;  3DWM A;  3VR9 B;  2DBY A;  1V8C A;  3E56 A;  4JX1 C;  1OQR A;  4RGT A;  2QIE B;  1P7F A;  1FRR A;  2RDH A;  2IGH A;  2J53 A;  1UNS A;  1SJH D;  5E6J A;  1D6E C;  3AEB B;  1N5X A;  3W9C B;  3AM9 A;  1KTK A;  2DYO A;  3AED B;  1XO3 A;  4WH4 A;  4NZL B;  1C4A A;  1SE3 A;  4US8 A;  3LB8 C;  3FIL B;  1UGJ A;  1IBX B;  4KKI A;  2M0A A;  4DXF A;  2V4I B;  4ZRP A;  1ZDV A;  2ON8 A;  4YSX B;  1FO4 A;  4C56 C;  1ZUD 2;  3BK1 A;  2OED A;  2V3N A;  3FIL A;  3P4S B;  2N9L A;  3Q8A A;  1QOB A;  1DYQ A;  2JX5 A;  2L83 A;  1J7C A;  4MAC A;  4AS1 A;  2K3U A;  4C7Y A;  1UWM A;  2HDE A;  3P4Q B;  4AQ7 A;  1VZ6 A;  1E0Z A;  4C80 A;  4O1N A;  1IGC A;  3AE3 B;  3Q8B A;  3BYT B;  2W3R A;  5EE0 A;  2JSV X;  1PUT A;  3FC4 A;  3W5V B;  3P4R B;  3PZ7 A;  4MH8 A;  1EM7 A;  3GS2 A;  3AEF B;  1V97 A;  3HVD A;  4OW0 A;  3CIR B;  3P63 A;  1SEB D;  1QKZ A;  4GDL B;  1TS5 A;  2PVG C;  1I4R A;  1N61 A;  2BB5 A;  3AEE B;  4RF1 A;  5AUI A;  1JCK B;  1FXA A;  1KLU D;  2WXL A;  4DXG A;  1YN3 A;  1DOI A;  1FEH A;  3TEZ A;  3ZGZ A;  1M4V A;  1ZE3 D;  4IKG A;  1F2R C;  3AN1 A;  1NYR A;  3HVZ A;  2NTT A;  4A90 A;  4A8X C;  3EA6 A;  3W5U B;  1XCQ L;  3PZ8 A;  1YN4 A;  4J3O D;  1RFK A;  2YEP B;  3ZQ4 A;  2GI9 A;  1NVI D;  1DGJ A;  2WLB A;  4ZOH C;  1VJK A;  1JAL A;  2IDY A;  2NTS A;  2Y5C A;  1QF6 A;  2DLB A;  1ZXH A;  2JQR B;  3KLS X;  3W2D A;  4M0W A;  1HA5 A;  4GDK B;  1HZ5 A;  1I4P A;  1FD6 A;  3ZYY X;  4RFB A;  1I4X A;  3U4E G;  1WYG A;  2H88 B;  2JXT A;  3MP9 A;  1FMA D;  1JWU D;  3IXS A;  4US9 A;  4RH6 A;  4KGR A;  1SIJ A;  3BVG A;  1I7H A;  2KAJ A;  1E7P B;  1K50 A;  2AQ2 B;  2INN E;  2K22 A;  3B9J A;  1OQQ A;  3IAM 1;  4YT0 B;  3I9V 1;  2BS4 B;  1HEZ E;  2KQ4 X;  2LUM A;  1DOY A;  1VRA B;  1JW9 D;  2PTL A;  1AN8 A;  4N6E B;  4OVZ A;  2CJN A;  3AEA B;  1XLO A;  2W82 A;  4ZHO A;  1MHX A;  3AE6 B;  3J9C A;  1L4D B;  1NYQ A;  1KF6 B;  4HKZ E;  2BYT A;  3NUH B;  2WU2 B;  2GRI A;  1MI0 A;  2DYM A;  1ZP0 B;  4L2Y A;  2EEL A;  1NEK B;  4OZB A;  1KLG D;  3URY A;  2BS2 B;  4YSZ B;  1PGB A;  4HJG E;  2DWQ A;  1UUP A;  2FE8 A;  2ZW1 A;  3AE1 B;  1RWS A;  4B0E A;  1A70 A;  4JWS C;  1GAQ B;  3LYY A;  1Y56 A;  3AV8 A;  5LNK 1;  3HRD D;  3DWG C;  1SBB B;  5H92 C;  2L52 A;  4RGM A;  5G5H A;  2G1E A;  2WXF A;  2WU5 B;  4TMA B;  1V1O A;  3VR8 B;  2Q5W D;  4C7Z A;  2LGI A;  5FK9 C;  3C8Y A;  4OHJ A;  1WRI A;  2XNA C;  2TSS A;  3EUB 2;  4LK0 M;  3AB5 A;  1ET9 A;  3AEC B;  1L0X B;  1SF0 A;  1FFV A;  1PGX A;  4PT5 A;  3UI3 A;  2JYE A;  1D4B A;  3OWE B;  3IT6 B;  4UDU C;  1PYW D;  3VRB B;  4N59 A;  1YNT E;  1JRP A;  2R61 A;  1HXY D;  2JU6 X;  5HHD G;  2WS3 B;  2PKO A;  1ROE A;  1N63 A;  2SAK A;  3B2F A;  3NVY A;  3ZJV A;  3NZ3 A;  4MM3 B;  5C3J B;  3AEG B;  3VQI A;  4A55 A;  2PMV A;  2E6X A;  3TUO A;  3RPF C;  1L6U A;  2PIA A;  1WXQ A;  1YMH E;  2LHD A;  1EWY C;  4YTP B;  3V05 A;  1JWS D;  2RMM A;  4KGT A;  2Y3A A;  1J7B A;  2BW2 A;  2J52 A;  3NS1 A;  1F0Z A;  4RGO S;  1VDV A;  3T3N A;  2WQY B;  5GXG B;  4P6V F;  3AE9 B;  1CQV A;  2RPV A;  4RF0 A;  5JXV A;  2KMM A;  1TKE A;  2LEK A;  2ACZ B;  5HG2 A;  2PW9 A;  1TS2 A;  4RNA A;  2HTM E;  1ESF A;  2M56 B;  3AE8 B;  1JWM D;  3EGR A;  3ZJT A;  2QMT A;  3NVZ A;  1KFY B;  1TKG A;  1I4H A;  4LLG M;  1SE2 A;  1JWA D;  2K9X A;  2L32 A;  4WWM A;  3U52 E;  2MJE A;  3B2G A;  5D3I B;  1JWB D;  1E6E B;  1FNW A;  1K53 A;  5EE3 A;  5D7G A;  5HI1 A;  2YEP F;  3P4P B;  1VZ8 A;  1ENF A;  1JQ4 A;  2LMC A;  5FKA C;  1MPE A;  2PVO D;  4N58 A;  2ICI A;  2LFI A;  3WCQ A;  2CJO A;  2ONQ A;  4JE3 B;  3Q8C A;  4H2A A;  1HZ6 A;  5BMH A;  1EU3 A;  3U7Z A;  2RDG A;  1TY0 A;  1FFU A;  2IPK D;  1KH0 A;  1YJI A;  4IOI E;  3MHZ A;  4NJC A;  4ITK A;  1CZP A;  4XDC A;  4MT5 A;  3SEB A;  5D3D A;  2WXG A;  1TZO A;  2I38 A;  2WDQ B;  4EE2 A;  4TQ0 A;  3RFZ B;  1F77 A;  1GPX A;  3HUI A;  1EU4 A;  3I57 A;  3ETR A;  3VRA B;  1FIQ A;  2AX5 A;  1N60 A;  2D5G A;  1QQR A;  2MJD A;  3GP7 A;  3N9Y C;  1D5Z C;  1SXT A;  2L1A A;  1GB1 A;  2MH7 A;  1GB4 A;  4NAW B;  2QSD A;  2LJI A;  1TYG B;  3NRZ A;  4HRO A;  3AH7 A;  3AMZ A;  1HQR D;  2WXH A;  3MFG A;  5C2T B;  1AYF A;  4HEA 1;  4YSY B;  1FCL A;  2BBC A;  3MJ5 A;  2CU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...