1KH0A

Accurate computer base design of a new backbone conformation in the second turn of protein l
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
EEVTIKANLIFANGSTQTAEFKGTKEKALSEVLAYADTLKKDNGEWTIDKRVTNGVIILNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein L
publication title Accurate computer-based design of a new backbone conformation in the second turn of protein L.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 18
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kh0A00
5JXVA 2ZW1A 1MHXA 1F2RI 2LHEA 5BMIA 1YNTE 2KACA 1FD6A 1Q10A 4OZCA 1P7EA 1QKZA 2JU6X 1PGAA 1YMHE 2RMMA 2K0PA 2N9LA 3FILB 1JMLA 1P7FA 4IKGA 1PGBA 1IGCA 2I38A 2KQ4X 2JXTA 4OZAA 2RPVA 2KDMA 1MI0A 1XCTL 2OEDA 1D4BA 2KWDA 4HKZE 5HFYA 1UWXA 4MACA 1HZ5A 2IGDA 4OZBA 2IGGA 4D2KA 1IGDA 2GI9A 4GLSC 2IGHA 2JZPA 3MP9A 1GB1A 5HHDG 2ON8A 1KH0A 1MHHE 1PGXA 2ZW0A 4KGTA 1IBXA 3FILA 2EELA 1K50A 1K53A 1ZXHA 2QMTA 2PW9A 1HEZE 4WH4A 1MPEA 1MVKA 2NMQA 1HZ6A 2GB1A 1FCCC 2J52A 2PTLA 2I2YA 2KN4A 1K51A 4HJGE 4KGRA 5BMHA 2PLPA 3GB1A 1GB4A 5HG2A 3UI3A 1EM7A 2LUMA 2LHDA 1F2RC 3V3XA 2JSVX 2LGIA 2N7JA 2ONQA 4KGSA 2QSDA 5HI1A 2JWUA 1K52A 1XCQL 4IOIE 1C9FA 1IBXB 2N9KA 2J53A 5BMGA 1FCLA 1XF5L
chains in the Genus database with same CATH superfamily
4YTNB 4LCDE 5LNK1 4YSXB 2L76A 5C1ZA 4TQ0A 2JU6X 3PZ8A 1ET9A 2G45B 3V05A 3V61A 2AWTA 4HEA1 3AEBB 4WWNA 1T0RC 2N9LA 5AZHA 3NJTA 1RRBA 4ICVA 2UU7A 1PGBA 1QOFA 3EC8A 3RT3B 4FJYA 4OZAA 2WX1A 5BO4B 4N59A 2MJDA 3A9KB 2MCNB 3P63A 2DWQA 4IM2A 1UGMA 3AV8A 1ZE3D 1L5PA 1Z2MA 3AM9A 4PT5A 3ZW3A 5JH5C 3Q8FA 4MSQB 4W9GA 2MSED 1MHHE 1OGWA 2MHJA 2KVRA 3CF6E 4PS3A 3SEBA 2GBNA 3P42A 2LVQA 4TMAB 1D6EC 1V81A 4EOYA 4ACFA 5FR6A 1BT0A 3ENEA 2WNMA 1CMXB 1GB4A 5DPWA 4NZLB 3TSSA 2DYBA 4P7IA 2LVPA 4LK0M 1ROEA 1WZ3A 3RPFC 2LFIA 3VUXA 1F52A 2KMAA 2INCC 5L83A 1V1OA 4YTMB 3TJPA 2K39A 2KLGA 2MJEA 5C23A 2DAFA 2J53A 3L54A 5BMGA 1SF0A 1FRDA 4B95A 3L13A 4ZYSA 4HVBA 2PE6B 3N3KB 5BMIA 2YEPF 3GE8C 3QC8B 1WWTA 1PGAA 1L4DB 3B08A 2N7DA 2C7MB 2MQJA 4GGQA 2DX5B 1JWAD 2LASA 3MHSD 3NVVA 4L1BA 1C4CA 1QQRA 3LXFA 4GN1A 2I1KA 1TS4A 2ZVNA 3L08A 4C80A 1XO3A 5EE9A 3VH3B 4M0WB 3DVGX 1NDDA 1WJ6A 2WXHA 1RAXA 2KVZA 2PKOA 1Q0WB 2VRRB 4AUQC 4AQ7A 2ACZB 1XEEA 5AUIA 1VZ7A 2CHWA 3KUDB 1MG4A 2KC1A 1WXVA 2CU3A 3APCA 1GC7A 2K5PA 2LRUA 2W3RA 4IW0A 2KWVB 1WGKA 3RULA 4A9AA 1YIWA 2W82A 3O65B 3DDCB 3P2BA 1TY2A 4LJPB 3BIID 3PHWB 1E90A 2BS3B 1S3SG 3ALBA 2I2YA 3RFZB 1DYQA 4HJGE 4G11A 2KDEB 1C4AA 3KYDD 4E71A 3L4PA 1EM7A 3IFWB 3JSVB 2LUMA 3BZDB 1VJKA 4XC2A 1WX7A 3KUCB 3RNEC 3AE4B 4WJNA 1WRDB 1I4HA 3M62B 2KD0A 3AXCA 3ZTCA 4ICUA 1XCQL 3IT6B 3OAWA 1R4NI 2V3PA 4IG7B 3ZDTA 2K1FA 3D32A 3DCGA 1JWUD 2Z0DB 1DOYA 3JW0X 5BYQA 1J19A 1UGJA 2DAJA 2BKRB 2JY6A 4OZCA 4C56C 1WMHB 5LLIA 1YQBA 3H7PB 3UF8A 2M4NA 1T0QC 3U8ZA 2DZMA 1YN5A 4W9FA 2GBMA 2ZJDA 1VD2A 2LZ6A 4NAWA 1IGCA 4MM3B 3UQBA 2WDVB 2IYDB 1WIAA 1JRUA 3NZUA 3A1QA 3RI7C 2KDMA 4P1CC 1D4BA 1D5XC 1EF1A 2N9XA 3IT4B 1FMAD 3E9SA 2IY0B 4D2KA 3AULA 2JXXA 1MJDA 2Y5PA 1J7CA 4F1SA 1JW9D 2JRHA 4GDLA 4DK5A 1R7SA 3VTWA 4LNOA 4TUUA 1ZGUB 4AJWA 2REXA 1YQ4B 2L05A 2Z8LA 2XK5B 1NI3A 2GOWA 3PRPB 4W9JA 4WH4A 4XWWA 2NMQA 1V97A 3DVNV 4WJPA 1V9JA 2HDEA 3AN1A 1T3QA 3BVGA 4B9KA 4HJKA 2N9PC 4URKA 4TSSA 3SDLC 1RLFA 2NR2A 2KK8A 4WJQA 1UNSA 3AE5B 5HI1A 2N9EB 2KTFA 3I63C 2ZEQA 4HWIB 3W1YA 4N9F4 3RUIB 2J42A 1LO5D 2EMTA 4BKTA 4N6EB 1F0ZA 1FFUA 1LXDA 4BOSC 2RMMA 4MGZE 1X1MA 4ZHPA 1KOTA 5BYRA 1OEYJ 1P7FA 4PYUA 4BBNC 4JE3B 4DXFA 1EO6A 4I6NB 4I6LB 2WDQB 2I38A 2GBJA 2I1JA 2FIFA 1QOBA 5KHQA 2IZVB 2WXPA 3PLUA 3KVFB 4MEMA 2KT7A 3AEGB 3P4SB 4MACA 4CO7A 2WXKA 4ASWC 3SHQA 4FLHA 3M3JA 3ZNHB 2WDRB 4G3XB 3RZFA 5JHAA 4NQLB 1WRIA 2DHZA 2MW5A 4A55A 2QILA 3I9V1 3TL5A 1CZPA 2WXNA 4M02A 2V3SA 2AYOB 3V6CB 2ZZPB 2V4LA 4KDIC 5TSSA 1TIFA 1HTQA 4ZRPA 1HXYD 2M0XA 2CU1A 3NUHB 1R4NB 1YOVB 4A3PA 1FIQA 1J7AA 3JVZX 1FNUA 1YQ3B 2W55A 1F77A 4GDKB 3GB1A 5HG2A 3UI3A 4HLEA 3NS1A 1E6EB 2JVCA 1QLBB 4FA6A 4IWOA 1WX8A 1S1QB 3Q2AC 5G5GA 5FR3A 4IWQA 4WURA 2LWPA 3VTUA 2Z0EB 3VFKA 3GZNI 1QOGA 1ZW7A 3AU4A 1VRAB 3ML9A 1V49A 2RPQA 1KLVA 4L2YA 3W2DA 2BW2A 1FD6A 4O1NA 3ZVVA 4K81A 2L1AA 2C9WB 1YMHE 3AE3B 4FXCA 3N30A 1TZ1A 4HPLB 2C60A 5H8YE 1WX9A 2GRIA 3EHVA 1WGHA 3WALA 1NENB 2BWES 1ZKHA 5D3DA 2BQQA 1FNWA 2WGSA 1UF0A 3Q3NC 5DPSA 4ZDVA 4EKUA 2HD5B 5L95C 2HJ8A 3GOEA 5CHFA 2RPVA 1EUVB 2IO1B 2UWQA 2M19A 1V86A 1PYWD 2KWCA 4E3CA 4US8A 1E8ZA 4OZBA 4MDKE 1KLUD 1QOAA 3JSVA 4LNKA 1WJ4A 2JZPA 1NYQA 1WYGA 3KWLA 4W9IA 1DOIA 2WDTB 1QILA 1N5XA 2DNFA 2AQ1B 3VR8B 1MPEA 4IM0A 3H7SA 3Q3JA 4GB9A 3SD5A 2H89B 2FUG1 3N1YC 3PO0A 1XT9B 1LQBA 3A4RA 1UBQA 3Q6BA 1TT5B 1C3TA 1WMHA 2KAJA 2ZCCA 1C4PA 1JROA 3H7PA 4KDLB 2KDFB 3L16A 2BVCA 2LGIA 2M17A 3KUZA 1FEHA 1SIFA 2XN9C 4A20A 4MM3A 5HKHA 2WQYB 1IBXB 2WXMA 3N9YC 3A1QB 5C2TB 2W3SA 3ZUNA 3RNAC 1I42A 3VAWA 3CIRB 1ZPSA 5JXVA 3S2AA 2VZKD 1WH3A 2KYWA 1ISNA 5CTRC 4BBNF 4I6PA 5C3JB 3MC0B 5J17A 2J0KA 1SGHA 4A6QA 4GDLB 3QAQA 1WGGA 4EE2A 2PMVA 1E9MA 2QDFA 4E74A 4USAA 3NG0A 1K8RB 2LUEA 2N7EA 4NY0A 3PTFC 1YJIA 1Q1OA 2KQSA 1WJNA 3NVWA 1XCTL 2MLBA 4K3CA 2RSUA 1L2NA 4ANVA 3NHEB 1I4PA 3GS2A 3MJWA 2D3GA 4H2AA 3U2SC 3OG5A 1GB1A 4JWUC 1KH0A 2EKEC 1HE8A 1TKYA 3T3OA 4HK2A 1BMLC 3FILA 4HRSA 1K50A 1WYWB 3UQAA 2RDBC 1P1AA 3PHXB 2V0GA 3MC9A 1HZ6A 2M1MA 2J52A 1P9DU 4HKQA 1K51A 2G4DB 1NEKB 3M63B 2L8JA 2B76B 3T8MA 3AE9B 3NVZA 1HQRD 1FPYA 1SE9A 2CR5A 1WR6E 1UBIA 2KO3A 1UH6A 1P0RA 1NBFC 3I5JC 1V8CA 2K8HA 2HTME 2BYFA 2KNBA 3X0WA 4CYEA 1FCLA 4CQNA 4MGIE 4AJYB 3AE2B 5D7GA 3C19A 1SB3C 1OQYA 1WXSA 4ZRJA 1IUEA 3RYTA 4AS1A 3NOBA 2NS5A 1Z5SB 3QX1A 4MJSB 3CMMB 3W5UB 2HTHA 4II3B 3KWVA 1YJJA 5FKAC 2KWUB 2W54A 4HDOA 4FBJB 1B9RA 1SXTA 3Q3OC 3Q14C 1WXAA 1MI0A 2KJHB 1UWXA 4YWGG 3ZQ4A 4GDKA 2D3CA 2IGDA 4HPPA 2KLCA 5AEKB 1KJTA 1SSNA 3HVZA 3PREA 3IVFA 4J6IA 2IO2B 2MBBB 3DQVA 4DDGD 2TSSA 1KM7A 4M00A 2AX5A 4NNJB 2EELA 3P4QB 1ZXHA 3NRZA 3U7DA 3KYCD 2NBWB 2D5GA 4LTUA 2LGYA 3FAHA 3OWEB 2WXRA 2B3AA 3BINA 3DBSA 3IXSA 3QK0A 1CK1A 4F7ZA 1N62A 5IP4D 2BWFA 3X23A 2ZCBA 1XLQA 2M8SA 2PEAA 3U52E 3DHIC 3MFGA 2J4XA 4GMVA 3FC4A 3ZO5B 3W1SC 2JYEA 2JWUA 4RNAA 1G6JA 3BK1A 2X38A 3AE8B 1HA5A 1ZP0B 2G4SA 1D3ZA 2QEJC 2OJWA 1QT9A 2FCSA 2PPHA 4AOFA 3BYTB 2DENB 2KQ7A 4FHKA 3PRMB 3MTNB 5D2MB 5E6NA 4JWSC 3HVDA 2MRPA 2SEBD 3K9OB 3AEDB 2CKHB 3PRZA 3EECA 1R4MI 1GC6A 1KLGD 4ARCA 4YSYB 3B0AA 4WIPA 4BKSD 1J0GA 3ZXRA 2M56B 1VDVA 3TBLD 2KQ4X 3AB5A 2MP2A 1JCKB 1GJZA 5DPRA 3WANA 4K7WA 4ZYNA 4K1RB 2O2VA 2K3UA 2MBHA 4RF0A 4IDIA 4FADA 1YN4A 4YTPB 3ETRA 3UINB 4IC7B 4M8MA 2LGSA 1T0YA 2WP9B 3Q3FA 2O6VB 2WU2B 4FULA 5EE3A 4RGMA 5HHDG 2NTTA 2ZW0A 3H8HA 4KGTA 1IBXA 1TY0A 2L3ZA 4KV2A 2WHIA 2WX0A 3VQIA 2NVUI 2PW9A 3TMPB 5EE1A 2WU5B 2O6VD 1MVKA 2Y5BB 3IAM1 1FCCC 3VHTC 2PTLA 2IO3B 2AQ2B 3BK2A 2W9NA 2WXGA 3GP7A 4WQOB 5E6PA 1YX5B 2NPTA 5D3IB 3LB8C 3IAS1 2CHZA 1E7PB 1WR1A 2RGFA 3DBRI 1I4XA 4EFOA 2R2QA 3L10B 4XDDA 1VCBA 2YVCA 3QA8A 2V3NA 2FIDA 4WWMA 4ZRKA 1J7BA 2G1EA 2DZJA 3DBHI 4RF1A 1C9FA 3VRBB 2JF5A 3PT2B 2KFJA 2ASQA 4BAXA 2NBUA 2LGXA 1XF5L 2A5UA 1XD3B 4OVZA 1UZXB 4REZA 3M95A 2KTRA 1JWBD 3A4SC 2JRIB 1SEBD 2K6QA 3HM3A 5KHOA 4G50A 2KDIA 1ZUD2 1M4VA 2MWSB 1JQ4A 3FILB 3DOWA 4W9EA 3AEEB 1VLBA 4IKGA 3UIPB 1YN3A 4ZRQA 3BYYB 3N32A 2YLMA 1ENFA 3ZNID 1TBEA 4DWFA 4LNIA 2UYZB 4ANWA 3H6NA 2KWDA 1C1YB 5HFYA 3V60A 3W9CB 1HZ5A 2BYTA 3ZKJC 2LJIA 3P1MA 2MX2A 2D3BA 3ABVB 4BFRA 4XE0A 5DPTA 2MBOA 4AWJA 2K25A 1C78A 2GLSA 3SFEB 2IDYA 3WCQA 2BB6A 2DBYA 1GOZA 1WFYA 2GBKA 5E6OA 3OJ4B 2WYQA 1E0ZA 3Q69A 2FCMA 2WXFA 1B1ZA 2L0TA 1WSPA 3A9JA 3R2TA 3HHMA 4W9HA 3OJ3A 4TV3A 4MJSA 2N1VA 1YJ1A 2QIEB 3TUOA 2QJLA 3BY4B 3N1ZC 4HROA 4XYCA 1PQSA 3VVWB 1SE2A 3HK0A 4JIOU 4M8NA 3SR6A 2QHOA 2LXAA 5CHVC 4OHJA 3VRAB 3ZTDA 1E8WA 3AECB 1LFDA 2FUHB 1C77A 5TR5A 1XQQA 3CSTA 3SFDB 4EZKA 2G9HD 2LEKA 2PIAA 1D5MC 3EUB2 2Y3AA 2INNE 4MT5A 1E8YA 4L23A 4EEWA 4JX1C 1TS2A 2R2OA 4PS7A 2WXOA 2BF8B 2JYTA 2L00B 2VH2A 3IG3A 4DXGA 3ZJVA 4IUMB 5EDSA 2JZZA 3MHZA 4GOCA 4GIVA 2FE8A 4RGNA 1ET6A 2XEWA 3U7ZA 3UIOB 2V9HA 4HKZE 2G3QB 3NY5A 4OW0A 2WXIA 4A8XC 3DPDA 1Y8RC 4J3OD 3AEFB 1FXAA 5D94A 1AWDA 2IJ0A 4NPNA 4KVGB 1SJED 1L0VB 2LGDA 2VH1A 2KFKA 3W1SA 2IPKD 2INDC 2D07B 3RNCC 1E5WA 1TTNA 4GXBA 3ONSA 1SE4A 1WGYA 4YSZB 4ZRIA 2K22A 2LMCA 1RFAA 1L4ZB 3KW5B 5FK9C 4DDID 1F9JA 3EA6A 2DYOA 2K8BA 4BKSA 2JUOA 3V62A 3HRDD 1UD7A 3R3MA 1STEA 2ICIA 3KQ4A 1LM8B 4C4VA 1D5ZC 3TCAA 3IHPC 4KGRA 5BMHA 2PLPA 4OVUA 4RGOS 3ML8A 2MBQA 3H1UA 3PV1A 4G0NB 1WZ0A 4PS8A 3QQ8B 2MP2B 4C7YA 3E56A 3AH7A 4JPSA 4B0EA 2AQ3B 4JGHB 2V1YA 1PFDA 2DYMA 1JALA 1I4QA 3Q8CA 2O2VB 2ZW1A 3DVNU 4RMAA 2ZPYA 4BZAA 5LXHA 4HDQA 1F2RI 4K7SA 3Q8EA 2E6XA 1WF9A 5G2NA 2VZKB 1XLOA 1WE6A 2O6VA 4KSLC 4DQOC 3DHHC 2LI5A 3TEXA 3ZGZA 2R61A 3AE7B 4RH6A 2K0PA 3FKYA 4X57B 2QCZA 3QHTA 1SJHD 3R66C 4MH0E 1OEYA 1VR9A 1ESFA 5JHBA 3ZXVA 4ITKA 5E6JA 4AP4C 3C0RB 4ANUA 1N5WA 2NPTB 1VZ6A 3PZDA 4GLSC 2WS3B 3T3NA 2OHFA 3ZRCA 2BPSA 4W9DA 2KMMA 2BB5A 5GXGB 1ZDVA 1JWMD 2DZKA 3O13A 2KTRB 4KZCA 4B6WA 2GB1A 4YT0B 1WI0A 3H9DA 4ANXA 2ZNVB 2ZNVC 2X8XX 2HE7A 4ARIA 1V80A 4P1BC 3NZ3A 1LGRA 4II2B 1I4GA 1MG8A 1L6VA 3OLMD 4DHZB 4XDCA 3VXWA 3BVZA 1V5OA 4B0MA 5DCNA 3N1XC 3GZNB 4NJ6A 2Z59B 2KX0A 4W9LA 4KSKC 2WXLA 1H4RA 3AMZA 2KACA 4DBGA 1PDXA 2PE9A 3TEWA 4ZHOA 3L0WB 3HM6X 4WQMA 2ZPNA 3MJ5A 3P4RB 3ZJTA 4NJ7A 1WY8A 2INPE 3B2FA 5H92C 3WIMA 5LXIB 4BOZB 4YL8A 1EU4A 2NCNA 4K3BA 1AW7A 4FJZA 4NQKE 2L7RA 1TGZB 1VZ8A 3DBLI 4BKGA 3A9JB 4P16A 2BBCA 1GUAB 3ZNZB 5IKCM 1FFVA 2AEHA 4JQWC 1P98A 5BYSA 4JL9A 3JYUA 3QWZB 3ZRFA 1SBBB 5MPOA 4EZLA 3PZ7A 3HIZA 5EE0A 4EUTA 3APDA 2PJHA 2KN4A 1ZDXA 3AI5A 1GAQB 2KZRA 4A3OA 1IYFA 3B1LX 3CWIA 1ACCA 1F2RC 1OQRA 4MSMB 3R2IA 1DOXA 3SU8X 4TQ1A 2KKCA 2WWZA 5AZFA 3RNFC 1AN8A 3TIXA 2NBVB 5CHWA 3VUWA 1JRPA 1A70A 2CJOA 3LYYA 2LJ5A 2GBRA 3PS6A 1YNTE 1WE7A 1IPGA 1OTRB 1Q5WB 1AYFA 2KFKB 4NAMA 4FN2A 1UELA 2GMIC 5AZGA 2KANA 2MBEA 1NYRA 4HXDA 5GMVA 5J2RA 3EFCA 1V5TA 2FCQA 1FRRA 2Y5CA 1FXTB 3I3TB 3RNBC 2N1WA 2OEDA 1E8XA 4C4VB 1GG3A 2D3AA 2L0FA 1GPXA 4XWTA 3DVGY 4KIKB 3A33B 1T5XD 4RM8A 4CHKA 5JZEB 2DZIA 1EU3A 4UDUC 4MELA 1N6ZA 3VH4B 1RWSA 1TKEA 1BXTA 3CSFA 2E3TA 4PYZA 2JZ3B 4XGAB 2N4FA 1IP9A 2JWZA 2XNAC 3PLVA 2RDHA 3J9CA 4KGSA 4YXDB 2MEKA 1V1PA 1K52A 1Y56A 2LVOA 1YX6B 1EWYC 4IOIE 5G5HA 4DHZE 3VDZA 1J8CA 4R3DA 3DWGC 1OFFA 2BYVE 4WJOA 5G55A 4C7ZA 4US9A 1C76A 4Q2JA 4RGTA 3QCAA 3R7RA 2C7NB 3Q8BA 5CX3A 3GE3C 1TS3A 1M94A 2LHEA 3R8BA 5J18A 1P7EA 1QKZA 3DBLB 3AU5A 2M0AA 3B9JA 4LJOB 1TS5A 1WXQA 1T6BX 4WAAA 2H88B 1AARA 2JXTA 2MJ3A 4MGYE 2CS4A 2HJ1A 2FAZA 4DXAB 5IA7A 2AL6A 4PK1A 1BUIC 3L17A 2KDBA 2A4ZA 2BKFA 2IO0B 3Q3MC 3URYA 2IGGA 2IY1B 1EWCA 1IGDA 3N20C 2N0SB 1MFWA 1WXMA 4ZOHC 2AL3A 3MP9A 4KKJA 4KZ0A 1I7HA 4F8CB 2DLBA 1N63A 2V4IB 3APFA 2J7QB 4XZ4A 1E10A 1FNVA 2PVOD 1GNUA 1TKGA 3T9LA 2EKIA 4WWOA 3WAMA 1NVID 1N60A 3A9KA 4MGKE 1KTKA 1ZOYB 3IBEA 4N58A 4W9CA 4TKNA 4BVUC 1C79A 1YD8U 2JSVX 1E7UA 1F1HA 2ONQA 1P3QU 1I4RA 2Q5WD 2KX3A 2IBIB 1WM3A 1FM0D 2QC8A 3EGRA 1SE3A 1JWSD 1E7VA 2L52A 3U4EG 3AEAB 3BVMA 2L32A 4RCOA 1TZOA 2FCNA 3KH0A 1MHXA 1CJEA 4RFBA 2JT4B 1NI2A 5IN7A 1Q10A 3MC8A 1ZXIA 2MA9B 5T8IA 2JPHA 3AE6B 3P4PB 2BYEA 3BWUD 4WWPA 1XLNA 4W9KA 3R7QA 2WXQA 3ZNGC 2WXJA 1R4MB 2PVGC 3TEYA 1RFKA 4IM3A 3QARA 3RMKC 4P6VF 4OVVA 1JMLA 3KLSX 4C00A 1H8CA 2MH7A 4K7UA 4DHJB 4LDTB 5IOIA 1V6EA 3DHGC 3WAOA 1CQVA 4HPMB 3W5VB 3WAPA 2WLBA 2FBWB 2BT6A 4HCNB 1WJUA 2GI9A 2K8CA 5AUKA 4DHJD 2IGHA 4LDTD 2KMCA 1WGRA 2JQRB 1XXGA 2ON8A 4JLCA 3U30A 2KXJA 1L0XB 3PPAA 4IWPA 1L7YA 1K53A 1KRHA 3V6EB 3AE1B 2KJRA 1HEZE 2BS4B 2EMSA 2K6DB 1RM6C 2D11A 4M0WA 1SIJA 1A5RA 3ZDMC 3HUIA 1UWMA 4FJVB 1DGJA 3QJZA 2RR9A 3VUYA 2LHDA 3DBRB 4LLGM 1FO4A 1L6UA 4HCPB 2N7JA 1WGDA 3QIJA 4M01A 3RCZA 3NVYA 2D10A 4S0RA 3DBHB 2C7HA 2N9KA 1TYGB 1OQQA 3I57A 1I35A 4GU2A 3ZJUA 2LD9A 4RM9A 2KN5A 4KIKA 3DWMA 2BS2B 2RDGA 2OOBB 3UGBB 3LDZE 3EFUA 3PVLA 2KOXA 4FHJA 4NJCA 2OJRA 4KKIA 1HTOA 4EZJA 2CJNA 4QAYA 3NZSA 3RZWC 2YEPB 4WAFA 3K9PB 2RD0A 3ZLZA 4XX5A 2L83A 2LXCA 2FNJB 1RYJA 1EF5A 1TJEA 1UUPA 1QZEA 3ZIMA 4LNFA 2CHXA 1KF6B 5IAAC 3ECIA 4LNNA 2C5LC 2BTEA 3PSEB 2XBBC 1XLPA 5IO9A 2D2QA 3ZYYX 2J0MA 4GSWA 1N61A 4S17A 2SAKA 1V1PB 1FXIA 1PGXA 2ZVOA 2KC2A 3LJ3A 2QMTA 4NAWB 1KFYB 5D6JB 1QF6A 1U4AA 3VR9B 2BGFA 2K9XA 1V2YA 3WA0A 3PGEA 2NTSA 3RD2A 3Q8AA 2J0JA 1PUTA 3C8YA 3B2GA 4MH8A 3V3XA 3VTVA 1L0YB 3RN9C 5I4DA 2QSDA 1WM2A 3RNGC 2JX5A 1T0SC 4A90A 2KJ6A 3NS8A 2KHWB 4KX6B 3TEZA 2XK5A 2LRWA
chains in the Genus database with same CATH topology
4OVZA 4YTNB 1VRAB 1JRPA 4REZA 1A70A 2CJOA 3LYYA 1JWBD 1SEBD 4L2YA 3W2DA 5LNK1 4YSXB 2BW2A 1YNTE 1FD6A 4O1NA 4TQ0A 2JU6X 3PZ8A 1ET9A 1AYFA 3V05A 2L1AA 4NAMA 1YMHE 3AE3B 1ZUD2 4FXCA 1M4VA 4HEA1 3AEBB 1JQ4A 1NYRA 5H8YE 2GRIA 1NENB 2N9LA 3FILB 5D3DA 3AEEB 1VLBA 1FNWA 4IKGA 1PGBA 1YN3A 1FRRA 4ZRQA 1QOFA 3BYYB 2Y5CA 4OZAA 1ENFA 4N59A 2RPVA 2MJDA 2OEDA 2KWDA 2M19A 3P63A 5HFYA 2DWQA 3AV8A 1GPXA 1ZE3D 3W9CB 1HZ5A 1PYWD 2BYTA 4US8A 4OZBA 1KLUD 4XWTA 1L5PA 1QOAA 2LJIA 1T5XD 3P1MA 3AM9A 3ABVB 4PT5A 1EU3A 2JZPA 4XE0A 1NYQA 3Q8FA 1WYGA 3KWLA 4UDUC 1MHHE 1DOIA 1C78A 3SFEB 2IDYA 1QILA 3WCQA 2BB6A 1N5XA 3SEBA 2DBYA 1GOZA 3P42A 2AQ1B 4TMAB 1D6EC 1RWSA 3VR8B 1MPEA 1TKEA 1BXTA 1E0ZA 2H89B 2FUG1 3PO0A 3Q69A 2E3TA 2WXFA 1B1ZA 1WSPA 2WNMA 2KAJA 3R2TA 1GB4A 1C4PA 1JROA 4NZLB 3TSSA 2XNAC 2LGIA 4LK0M 1ROEA 2QIEB 2RDHA 2QJLA 3TUOA 1FEHA 4HROA 3J9CA 4KGSA 3RPFC 4YXDB 2LFIA 1SE2A 2MEKA 2XN9C 1V1OA 1V1PA 1K52A 1Y56A 1EWYC 4IOIE 5G5HA 4YTMB 2WQYB 2MJEA 2WXMA 3SR6A 1IBXB 3N9YC 5C2TB 2J53A 4R3DA 4OHJA 3DWGC 5BMGA 3VRAB 1OFFA 3AECB 2W3SA 1SF0A 1FRDA 3CIRB 1ZPSA 1C77A 4C7ZA 5JXVA 4US9A 3SFDB 1C76A 4Q2JA 4RGTA 2VZKD 4ZYSA 3Q8BA 2G9HD 2LEKA 2PIAA 1TS3A 1D5MC 2LHEA 5BMIA 3EUB2 2YEPF 3R8BA 5C3JB 1P7EA 3MC0B 1QKZA 1WWTA 1PGAA 1L4DB 4A6QA 4GDLB 2Y3AA 2M0AA 2INNE 4MT5A 1JWAD 4EE2A 2PMVA 3NVVA 3B9JA 4L23A 1E9MA 4L1BA 1C4CA 4JX1C 1TS2A 1QQRA 4USAA 1TS5A 3LXFA 1WXQA 1T6BX 2H88B 2WXOA 1TS4A 2JYTA 4C80A 4DXGA 3ZJVA 2JXTA 2MJ3A 1XO3A 5EE9A 3MHZA 2FE8A 4RGNA 1ET6A 1YJIA 3U7ZA 3NVWA 1XCTL 4HKZE 2WXHA 1BUIC 2PKOA 4OW0A 2WXIA 4A8XC 3URYA 4AQ7A 2IGGA 4J3OD 1EWCA 3AEFB 1FXAA 2ACZB 1AWDA 1IGDA 1XEEA 2N0SB 5AUIA 1I4PA 1VZ7A 2IJ0A 4ZOHC 1SJED 1L0VB 3GS2A 3W1SA 3MP9A 2CU3A 4KKJA 4H2AA 2IPKD 3U2SC 1GB1A 1I7HA 4JWUC 1KH0A 1TKYA 3T3OA 1SE4A 2DLBA 4YSZB 2K5PA 1N63A 2V4IB 2K22A 2LMCA 2W3RA 1BMLC 3FILA 4HRSA 1E10A 1FNVA 1K50A 1L4ZB 1WGKA 2PVOD 4A9AA 2W82A 1TKGA 2EKIA 5FK9C 1NVID 3EA6A 1N60A 2DYOA 1TY2A 2V0GA 3HRDD 3BIID 1HZ6A 2BS3B 2J52A 1STEA 2ICIA 3KQ4A 2I2YA 4HKQA 1K51A 3RFZB 1D5ZC 1DYQA 1KTKA 1NEKB 1ZOYB 4HJGE 4KGRA 4N58A 5BMHA 2B76B 1C4AA 2PLPA 3AE9B 4RGOS 3L4PA 3NVZA 1HQRD 1EM7A 2LUMA 3BZDB 1C79A 1VJKA 2JSVX 3AE4B 2ONQA 1I4HA 1I4RA 2Q5WD 1FM0D 1XCQL 3EGRA 3IT6B 4C7YA 3E56A 3AH7A 4JPSA 4B0EA 1SE3A 1JWSD 2L52A 1V8CA 2AQ3B 2HTME 2V3PA 3U4EG 1PFDA 2DYMA 1FCLA 3AEAB 4CQNA 3BVMA 2L32A 1JALA 1I4QA 3AE2B 5D7GA 1JWUD 3Q8CA 1SB3C 2ZW1A 4RCOA 1TZOA 1MHXA 1DOYA 1CJEA 4RFBA 1F2RI 5BYQA 1UGJA 3Q8EA 1Q10A 4OZCA 1ZXIA 2E6XA 5T8IA 4C56C 3AE6B 1IUEA 4AS1A 3P4PB 3BWUD 2VZKB 1XLOA 4DQOC 1XLNA 2WXQA 3TEXA 3ZGZA 3W5UB 2WXJA 2R61A 3AE7B 4RH6A 2PVGC 3TEYA 1RFKA 2K0PA 3KWVA 4P6VF 1YJJA 1YN5A 1JMLA 5FKAC 2W54A 3KLSX 1IGCA 4MM3B 1B9RA 1SJHD 1SXTA 2MH7A 2WDVB 1VR9A 1ESFA 2KDMA 4ITKA 1MI0A 1D4BA 1D5XC 5E6JA 1CQVA 1UWXA 4YWGG 3ZQ4A 1N5WA 3IT4B 1FMAD 3E9SA 3W5VB 1VZ6A 2IGDA 2WLBA 2FBWB 4D2KA 2BT6A 1SSNA 3HVZA 2GI9A 5AUKA 4GLSC 2WS3B 2Y5PA 3T3NA 1J7CA 2IGHA 1JW9D 2OHFA 1R7SA 2JQRB 2KMMA 1XXGA 2BB5A 2ON8A 5GXGB 2TSSA 1ZDVA 1L0XB 1JWMD 2AX5A 2EELA 1K53A 1KRHA 1YQ4B 2Z8LA 3P4QB 1ZXHA 3AE1B 1NI3A 3O13A 3NRZA 4WH4A 1HEZE 2BS4B 2D5GA 1RM6C 4LTUA 4M0WA 4XWWA 1SIJA 2NMQA 3FAHA 1V97A 2GB1A 3OWEB 2WXRA 4YT0B 2HDEA 3AN1A 3IXSA 1T3QA 3HUIA 1CK1A 1UWMA 1DGJA 1N62A 3BVGA 4ARIA 3NZ3A 1I4GA 1XLQA 2LHDA 4LLGM 1FO4A 3U52E 3MFGA 1L6UA 2J4XA 4TSSA 2N7JA 1L6VA 3FC4A 2JYEA 1UNSA 2JWUA 3AE5B 4XDCA 5HI1A 3BVZA 4RNAA 3NVYA 3BK1A 4B0MA 2X38A 2N9KA 3AE8B 1HA5A 1ZP0B 1TYGB 2QEJC 1QT9A 1OQQA 3I57A 3ZJUA 3BYTB 2J42A 2WXLA 1LO5D 3DWMA 2BS2B 3AMZA 2KACA 2RDGA 4JWSC 4N6EB 3HVDA 1F0ZA 2SEBD 1FFUA 1PDXA 3AEDB 3TEWA 2RMMA 4ZHOA 1KLGD 4ARCA 4YSYB 4NJCA 4WIPA 4KKIA 4WQMA 2CJNA 4ZHPA 2M56B 5BYRA 1VDVA 3MJ5A 3P4RB 3ZJTA 1P7FA 2YEPB 4WAFA 4JE3B 4DXFA 2WDQB 2INPE 3B2FA 2I38A 2KQ4X 3AB5A 5H92C 1JCKB 2L83A 1QOBA 1EU4A 2WXPA 1AW7A 1RYJA 1TJEA 1UUPA 1VZ8A 3AEGB 3P4SB 1KF6B 4MACA 2BBCA 2WXKA 4P16A 2K3UA 4RF0A 4IDIA 2WDRB 1FFVA 1YN4A 4YTPB 3ETRA 2BTEA 1XLPA 1WRIA 2WP9B 4A55A 3ZYYX 2QILA 2WU2B 1N61A 3I9V1 5EE3A 5BYSA 1CZPA 4RGMA 2SAKA 5HHDG 1V1PB 1FXIA 2NTTA 2WXNA 1PGXA 2ZW0A 3H8HA 4KGTA 1SBBB 1IBXA 1TY0A 5MPOA 3VQIA 2QMTA 5TSSA 3PZ7A 2PW9A 4NAWB 5EE0A 4ZRPA 1HXYD 5EE1A 2WU5B 3NUHB 1KFYB 1MVKA 1QF6A 3VR9B 3IAM1 1FCCC 1FIQA 1J7AA 2PTLA 2K9XA 2KN4A 1ZDXA 2AQ2B 3BK2A 1FNUA 2WXGA 1YQ3B 3GP7A 2W55A 2NTSA 1F77A 3Q8AA 3GB1A 1GAQB 4GDKB 5D3IB 5HG2A 3UI3A 1PUTA 3CWIA 3C8YA 1ACCA 3LB8C 3IAS1 3NS1A 1E7PB 3B2GA 4MH8A 1E6EB 1I4XA 1F2RC 3V3XA 1QLBB 1OQRA 1L0YB 5I4DA 3R2IA 4XDDA 5G5GA 2QSDA 5FR3A 1DOXA 2V3NA 4TQ1A 4WURA 4WWMA 1J7BA 2G1EA 2JX5A 4RF1A 1C9FA 3VRBB 4A90A 4KX6B 1AN8A 3TEZA 1QOGA 1XF5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JXV A;  2ZW1 A;  1MHX A;  1F2R I;  2LHE A;  5BMI A;  1YNT E;  2KAC A;  1FD6 A;  1Q10 A;  4OZC A;  1P7E A;  1QKZ A;  2JU6 X;  1PGA A;  1YMH E;  2RMM A;  2K0P A;  2N9L A;  3FIL B;  1JML A;  1P7F A;  4IKG A;  1PGB A;  1IGC A;  2I38 A;  2KQ4 X;  2JXT A;  4OZA A;  2RPV A;  2KDM A;  1MI0 A;  1XCT L;  2OED A;  1D4B A;  2KWD A;  4HKZ E;  5HFY A;  1UWX A;  4MAC A;  1HZ5 A;  2IGD A;  4OZB A;  2IGG A;  4D2K A;  1IGD A;  2GI9 A;  4GLS C;  2IGH A;  2JZP A;  3MP9 A;  1GB1 A;  5HHD G;  2ON8 A;  1KH0 A;  1MHH E;  1PGX A;  2ZW0 A;  4KGT A;  1IBX A;  3FIL A;  2EEL A;  1K50 A;  1K53 A;  1ZXH A;  2QMT A;  2PW9 A;  1HEZ E;  4WH4 A;  1MPE A;  1MVK A;  2NMQ A;  1HZ6 A;  2GB1 A;  1FCC C;  2J52 A;  2PTL A;  2I2Y A;  2KN4 A;  1K51 A;  4HJG E;  4KGR A;  5BMH A;  2PLP A;  3GB1 A;  1GB4 A;  5HG2 A;  3UI3 A;  1EM7 A;  2LUM A;  2LHD A;  1F2R C;  3V3X A;  2JSV X;  2LGI A;  2N7J A;  2ONQ A;  4KGS A;  2QSD A;  5HI1 A;  2JWU A;  1K52 A;  1XCQ L;  4IOI E;  1C9F A;  1IBX B;  2N9K A;  2J53 A;  5BMG A;  1FCL A;  1XF5 L; 
#chains in the Genus database with same CATH topology
 4YTN B;  4LCD E;  5LNK 1;  4YSX B;  2L76 A;  5C1Z A;  4TQ0 A;  2JU6 X;  3PZ8 A;  1ET9 A;  2G45 B;  3V05 A;  3V61 A;  2AWT A;  4HEA 1;  3AEB B;  4WWN A;  1T0R C;  2N9L A;  5AZH A;  3NJT A;  1RRB A;  4ICV A;  2UU7 A;  1PGB A;  1QOF A;  3EC8 A;  3RT3 B;  4FJY A;  4OZA A;  2WX1 A;  5BO4 B;  4N59 A;  2MJD A;  3A9K B;  2MCN B;  3P63 A;  2DWQ A;  4IM2 A;  1UGM A;  3AV8 A;  1ZE3 D;  1L5P A;  1Z2M A;  3AM9 A;  4PT5 A;  3ZW3 A;  5JH5 C;  3Q8F A;  4MSQ B;  4W9G A;  2MSE D;  1MHH E;  1OGW A;  2MHJ A;  2KVR A;  3CF6 E;  4PS3 A;  3SEB A;  2GBN A;  3P42 A;  2LVQ A;  4TMA B;  1D6E C;  1V81 A;  4EOY A;  4ACF A;  5FR6 A;  1BT0 A;  3ENE A;  2WNM A;  1CMX B;  1GB4 A;  5DPW A;  4NZL B;  3TSS A;  2DYB A;  4P7I A;  2LVP A;  4LK0 M;  1ROE A;  1WZ3 A;  3RPF C;  2LFI A;  3VUX A;  1F52 A;  2KMA A;  2INC C;  5L83 A;  1V1O A;  4YTM B;  3TJP A;  2K39 A;  2KLG A;  2MJE A;  5C23 A;  2DAF A;  2J53 A;  3L54 A;  5BMG A;  1SF0 A;  1FRD A;  4B95 A;  3L13 A;  4ZYS A;  4HVB A;  2PE6 B;  3N3K B;  5BMI A;  2YEP F;  3GE8 C;  3QC8 B;  1WWT A;  1PGA A;  1L4D B;  3B08 A;  2N7D A;  2C7M B;  2MQJ A;  4GGQ A;  2DX5 B;  1JWA D;  2LAS A;  3MHS D;  3NVV A;  4L1B A;  1C4C A;  1QQR A;  3LXF A;  4GN1 A;  2I1K A;  1TS4 A;  2ZVN A;  3L08 A;  4C80 A;  1XO3 A;  5EE9 A;  3VH3 B;  4M0W B;  3DVG X;  1NDD A;  1WJ6 A;  2WXH A;  1RAX A;  2KVZ A;  2PKO A;  1Q0W B;  2VRR B;  4AUQ C;  4AQ7 A;  2ACZ B;  1XEE A;  5AUI A;  1VZ7 A;  2CHW A;  3KUD B;  1MG4 A;  2KC1 A;  1WXV A;  2CU3 A;  3APC A;  1GC7 A;  2K5P A;  2LRU A;  2W3R A;  4IW0 A;  2KWV B;  1WGK A;  3RUL A;  4A9A A;  1YIW A;  2W82 A;  3O65 B;  3DDC B;  3P2B A;  1TY2 A;  4LJP B;  3BII D;  3PHW B;  1E90 A;  2BS3 B;  1S3S G;  3ALB A;  2I2Y A;  3RFZ B;  1DYQ A;  4HJG E;  4G11 A;  2KDE B;  1C4A A;  3KYD D;  4E71 A;  3L4P A;  1EM7 A;  3IFW B;  3JSV B;  2LUM A;  3BZD B;  1VJK A;  4XC2 A;  1WX7 A;  3KUC B;  3RNE C;  3AE4 B;  4WJN A;  1WRD B;  1I4H A;  3M62 B;  2KD0 A;  3AXC A;  3ZTC A;  4ICU A;  1XCQ L;  3IT6 B;  3OAW A;  1R4N I;  2V3P A;  4IG7 B;  3ZDT A;  2K1F A;  3D32 A;  3DCG A;  1JWU D;  2Z0D B;  1DOY A;  3JW0 X;  5BYQ A;  1J19 A;  1UGJ A;  2DAJ A;  2BKR B;  2JY6 A;  4OZC A;  4C56 C;  1WMH B;  5LLI A;  1YQB A;  3H7P B;  3UF8 A;  2M4N A;  1T0Q C;  3U8Z A;  2DZM A;  1YN5 A;  4W9F A;  2GBM A;  2ZJD A;  1VD2 A;  2LZ6 A;  4NAW A;  1IGC A;  4MM3 B;  3UQB A;  2WDV B;  2IYD B;  1WIA A;  1JRU A;  3NZU A;  3A1Q A;  3RI7 C;  2KDM A;  4P1C C;  1D4B A;  1D5X C;  1EF1 A;  2N9X A;  3IT4 B;  1FMA D;  3E9S A;  2IY0 B;  4D2K A;  3AUL A;  2JXX A;  1MJD A;  2Y5P A;  1J7C A;  4F1S A;  1JW9 D;  2JRH A;  4GDL A;  4DK5 A;  1R7S A;  3VTW A;  4LNO A;  4TUU A;  1ZGU B;  4AJW A;  2REX A;  1YQ4 B;  2L05 A;  2Z8L A;  2XK5 B;  1NI3 A;  2GOW A;  3PRP B;  4W9J A;  4WH4 A;  4XWW A;  2NMQ A;  1V97 A;  3DVN V;  4WJP A;  1V9J A;  2HDE A;  3AN1 A;  1T3Q A;  3BVG A;  4B9K A;  4HJK A;  2N9P C;  4URK A;  4TSS A;  3SDL C;  1RLF A;  2NR2 A;  2KK8 A;  4WJQ A;  1UNS A;  3AE5 B;  5HI1 A;  2N9E B;  2KTF A;  3I63 C;  2ZEQ A;  4HWI B;  3W1Y A;  4N9F 4;  3RUI B;  2J42 A;  1LO5 D;  2EMT A;  4BKT A;  4N6E B;  1F0Z A;  1FFU A;  1LXD A;  4BOS C;  2RMM A;  4MGZ E;  1X1M A;  4ZHP A;  1KOT A;  5BYR A;  1OEY J;  1P7F A;  4PYU A;  4BBN C;  4JE3 B;  4DXF A;  1EO6 A;  4I6N B;  4I6L B;  2WDQ B;  2I38 A;  2GBJ A;  2I1J A;  2FIF A;  1QOB A;  5KHQ A;  2IZV B;  2WXP A;  3PLU A;  3KVF B;  4MEM A;  2KT7 A;  3AEG B;  3P4S B;  4MAC A;  4CO7 A;  2WXK A;  4ASW C;  3SHQ A;  4FLH A;  3M3J A;  3ZNH B;  2WDR B;  4G3X B;  3RZF A;  5JHA A;  4NQL B;  1WRI A;  2DHZ A;  2MW5 A;  4A55 A;  2QIL A;  3I9V 1;  3TL5 A;  1CZP A;  2WXN A;  4M02 A;  2V3S A;  2AYO B;  3V6C B;  2ZZP B;  2V4L A;  4KDI C;  5TSS A;  1TIF A;  1HTQ A;  4ZRP A;  1HXY D;  2M0X A;  2CU1 A;  3NUH B;  1R4N B;  1YOV B;  4A3P A;  1FIQ A;  1J7A A;  3JVZ X;  1FNU A;  1YQ3 B;  2W55 A;  1F77 A;  4GDK B;  3GB1 A;  5HG2 A;  3UI3 A;  4HLE A;  3NS1 A;  1E6E B;  2JVC A;  1QLB B;  4FA6 A;  4IWO A;  1WX8 A;  1S1Q B;  3Q2A C;  5G5G A;  5FR3 A;  4IWQ A;  4WUR A;  2LWP A;  3VTU A;  2Z0E B;  3VFK A;  3GZN I;  1QOG A;  1ZW7 A;  3AU4 A;  1VRA B;  3ML9 A;  1V49 A;  2RPQ A;  1KLV A;  4L2Y A;  3W2D A;  2BW2 A;  1FD6 A;  4O1N A;  3ZVV A;  4K81 A;  2L1A A;  2C9W B;  1YMH E;  3AE3 B;  4FXC A;  3N30 A;  1TZ1 A;  4HPL B;  2C60 A;  5H8Y E;  1WX9 A;  2GRI A;  3EHV A;  1WGH A;  3WAL A;  1NEN B;  2BWE S;  1ZKH A;  5D3D A;  2BQQ A;  1FNW A;  2WGS A;  1UF0 A;  3Q3N C;  5DPS A;  4ZDV A;  4EKU A;  2HD5 B;  5L95 C;  2HJ8 A;  3GOE A;  5CHF A;  2RPV A;  1EUV B;  2IO1 B;  2UWQ A;  2M19 A;  1V86 A;  1PYW D;  2KWC A;  4E3C A;  4US8 A;  1E8Z A;  4OZB A;  4MDK E;  1KLU D;  1QOA A;  3JSV A;  4LNK A;  1WJ4 A;  2JZP A;  1NYQ A;  1WYG A;  3KWL A;  4W9I A;  1DOI A;  2WDT B;  1QIL A;  1N5X A;  2DNF A;  2AQ1 B;  3VR8 B;  1MPE A;  4IM0 A;  3H7S A;  3Q3J A;  4GB9 A;  3SD5 A;  2H89 B;  2FUG 1;  3N1Y C;  3PO0 A;  1XT9 B;  1LQB A;  3A4R A;  1UBQ A;  3Q6B A;  1TT5 B;  1C3T A;  1WMH A;  2KAJ A;  2ZCC A;  1C4P A;  1JRO A;  3H7P A;  4KDL B;  2KDF B;  3L16 A;  2BVC A;  2LGI A;  2M17 A;  3KUZ A;  1FEH A;  1SIF A;  2XN9 C;  4A20 A;  4MM3 A;  5HKH A;  2WQY B;  1IBX B;  2WXM A;  3N9Y C;  3A1Q B;  5C2T B;  2W3S A;  3ZUN A;  3RNA C;  1I42 A;  3VAW A;  3CIR B;  1ZPS A;  5JXV A;  3S2A A;  2VZK D;  1WH3 A;  2KYW A;  1ISN A;  5CTR C;  4BBN F;  4I6P A;  5C3J B;  3MC0 B;  5J17 A;  2J0K A;  1SGH A;  4A6Q A;  4GDL B;  3QAQ A;  1WGG A;  4EE2 A;  2PMV A;  1E9M A;  2QDF A;  4E74 A;  4USA A;  3NG0 A;  1K8R B;  2LUE A;  2N7E A;  4NY0 A;  3PTF C;  1YJI A;  1Q1O A;  2KQS A;  1WJN A;  3NVW A;  1XCT L;  2MLB A;  4K3C A;  2RSU A;  1L2N A;  4ANV A;  3NHE B;  1I4P A;  3GS2 A;  3MJW A;  2D3G A;  4H2A A;  3U2S C;  3OG5 A;  1GB1 A;  4JWU C;  1KH0 A;  2EKE C;  1HE8 A;  1TKY A;  3T3O A;  4HK2 A;  1BML C;  3FIL A;  4HRS A;  1K50 A;  1WYW B;  3UQA A;  2RDB C;  1P1A A;  3PHX B;  2V0G A;  3MC9 A;  1HZ6 A;  2M1M A;  2J52 A;  1P9D U;  4HKQ A;  1K51 A;  2G4D B;  1NEK B;  3M63 B;  2L8J A;  2B76 B;  3T8M A;  3AE9 B;  3NVZ A;  1HQR D;  1FPY A;  1SE9 A;  2CR5 A;  1WR6 E;  1UBI A;  2KO3 A;  1UH6 A;  1P0R A;  1NBF C;  3I5J C;  1V8C A;  2K8H A;  2HTM E;  2BYF A;  2KNB A;  3X0W A;  4CYE A;  1FCL A;  4CQN A;  4MGI E;  4AJY B;  3AE2 B;  5D7G A;  3C19 A;  1SB3 C;  1OQY A;  1WXS A;  4ZRJ A;  1IUE A;  3RYT A;  4AS1 A;  3NOB A;  2NS5 A;  1Z5S B;  3QX1 A;  4MJS B;  3CMM B;  3W5U B;  2HTH A;  4II3 B;  3KWV A;  1YJJ A;  5FKA C;  2KWU B;  2W54 A;  4HDO A;  4FBJ B;  1B9R A;  1SXT A;  3Q3O C;  3Q14 C;  1WXA A;  1MI0 A;  2KJH B;  1UWX A;  4YWG G;  3ZQ4 A;  4GDK A;  2D3C A;  2IGD A;  4HPP A;  2KLC A;  5AEK B;  1KJT A;  1SSN A;  3HVZ A;  3PRE A;  3IVF A;  4J6I A;  2IO2 B;  2MBB B;  3DQV A;  4DDG D;  2TSS A;  1KM7 A;  4M00 A;  2AX5 A;  4NNJ B;  2EEL A;  3P4Q B;  1ZXH A;  3NRZ A;  3U7D A;  3KYC D;  2NBW B;  2D5G A;  4LTU A;  2LGY A;  3FAH A;  3OWE B;  2WXR A;  2B3A A;  3BIN A;  3DBS A;  3IXS A;  3QK0 A;  1CK1 A;  4F7Z A;  1N62 A;  5IP4 D;  2BWF A;  3X23 A;  2ZCB A;  1XLQ A;  2M8S A;  2PEA A;  3U52 E;  3DHI C;  3MFG A;  2J4X A;  4GMV A;  3FC4 A;  3ZO5 B;  3W1S C;  2JYE A;  2JWU A;  4RNA A;  1G6J A;  3BK1 A;  2X38 A;  3AE8 B;  1HA5 A;  1ZP0 B;  2G4S A;  1D3Z A;  2QEJ C;  2OJW A;  1QT9 A;  2FCS A;  2PPH A;  4AOF A;  3BYT B;  2DEN B;  2KQ7 A;  4FHK A;  3PRM B;  3MTN B;  5D2M B;  5E6N A;  4JWS C;  3HVD A;  2MRP A;  2SEB D;  3K9O B;  3AED B;  2CKH B;  3PRZ A;  3EEC A;  1R4M I;  1GC6 A;  1KLG D;  4ARC A;  4YSY B;  3B0A A;  4WIP A;  4BKS D;  1J0G A;  3ZXR A;  2M56 B;  1VDV A;  3TBL D;  2KQ4 X;  3AB5 A;  2MP2 A;  1JCK B;  1GJZ A;  5DPR A;  3WAN A;  4K7W A;  4ZYN A;  4K1R B;  2O2V A;  2K3U A;  2MBH A;  4RF0 A;  4IDI A;  4FAD A;  1YN4 A;  4YTP B;  3ETR A;  3UIN B;  4IC7 B;  4M8M A;  2LGS A;  1T0Y A;  2WP9 B;  3Q3F A;  2O6V B;  2WU2 B;  4FUL A;  5EE3 A;  4RGM A;  5HHD G;  2NTT A;  2ZW0 A;  3H8H A;  4KGT A;  1IBX A;  1TY0 A;  2L3Z A;  4KV2 A;  2WHI A;  2WX0 A;  3VQI A;  2NVU I;  2PW9 A;  3TMP B;  5EE1 A;  2WU5 B;  2O6V D;  1MVK A;  2Y5B B;  3IAM 1;  1FCC C;  3VHT C;  2PTL A;  2IO3 B;  2AQ2 B;  3BK2 A;  2W9N A;  2WXG A;  3GP7 A;  4WQO B;  5E6P A;  1YX5 B;  2NPT A;  5D3I B;  3LB8 C;  3IAS 1;  2CHZ A;  1E7P B;  1WR1 A;  2RGF A;  3DBR I;  1I4X A;  4EFO A;  2R2Q A;  3L10 B;  4XDD A;  1VCB A;  2YVC A;  3QA8 A;  2V3N A;  2FID A;  4WWM A;  4ZRK A;  1J7B A;  2G1E A;  2DZJ A;  3DBH I;  4RF1 A;  1C9F A;  3VRB B;  2JF5 A;  3PT2 B;  2KFJ A;  2ASQ A;  4BAX A;  2NBU A;  2LGX A;  1XF5 L;  2A5U A;  1XD3 B;  4OVZ A;  1UZX B;  4REZ A;  3M95 A;  2KTR A;  1JWB D;  3A4S C;  2JRI B;  1SEB D;  2K6Q A;  3HM3 A;  5KHO A;  4G50 A;  2KDI A;  1ZUD 2;  1M4V A;  2MWS B;  1JQ4 A;  3FIL B;  3DOW A;  4W9E A;  3AEE B;  1VLB A;  4IKG A;  3UIP B;  1YN3 A;  4ZRQ A;  3BYY B;  3N32 A;  2YLM A;  1ENF A;  3ZNI D;  1TBE A;  4DWF A;  4LNI A;  2UYZ B;  4ANW A;  3H6N A;  2KWD A;  1C1Y B;  5HFY A;  3V60 A;  3W9C B;  1HZ5 A;  2BYT A;  3ZKJ C;  2LJI A;  3P1M A;  2MX2 A;  2D3B A;  3ABV B;  4BFR A;  4XE0 A;  5DPT A;  2MBO A;  4AWJ A;  2K25 A;  1C78 A;  2GLS A;  3SFE B;  2IDY A;  3WCQ A;  2BB6 A;  2DBY A;  1GOZ A;  1WFY A;  2GBK A;  5E6O A;  3OJ4 B;  2WYQ A;  1E0Z A;  3Q69 A;  2FCM A;  2WXF A;  1B1Z A;  2L0T A;  1WSP A;  3A9J A;  3R2T A;  3HHM A;  4W9H A;  3OJ3 A;  4TV3 A;  4MJS A;  2N1V A;  1YJ1 A;  2QIE B;  3TUO A;  2QJL A;  3BY4 B;  3N1Z C;  4HRO A;  4XYC A;  1PQS A;  3VVW B;  1SE2 A;  3HK0 A;  4JIO U;  4M8N A;  3SR6 A;  2QHO A;  2LXA A;  5CHV C;  4OHJ A;  3VRA B;  3ZTD A;  1E8W A;  3AEC B;  1LFD A;  2FUH B;  1C77 A;  5TR5 A;  1XQQ A;  3CST A;  3SFD B;  4EZK A;  2G9H D;  2LEK A;  2PIA A;  1D5M C;  3EUB 2;  2Y3A A;  2INN E;  4MT5 A;  1E8Y A;  4L23 A;  4EEW A;  4JX1 C;  1TS2 A;  2R2O A;  4PS7 A;  2WXO A;  2BF8 B;  2JYT A;  2L00 B;  2VH2 A;  3IG3 A;  4DXG A;  3ZJV A;  4IUM B;  5EDS A;  2JZZ A;  3MHZ A;  4GOC A;  4GIV A;  2FE8 A;  4RGN A;  1ET6 A;  2XEW A;  3U7Z A;  3UIO B;  2V9H A;  4HKZ E;  2G3Q B;  3NY5 A;  4OW0 A;  2WXI A;  4A8X C;  3DPD A;  1Y8R C;  4J3O D;  3AEF B;  1FXA A;  5D94 A;  1AWD A;  2IJ0 A;  4NPN A;  4KVG B;  1SJE D;  1L0V B;  2LGD A;  2VH1 A;  2KFK A;  3W1S A;  2IPK D;  2IND C;  2D07 B;  3RNC C;  1E5W A;  1TTN A;  4GXB A;  3ONS A;  1SE4 A;  1WGY A;  4YSZ B;  4ZRI A;  2K22 A;  2LMC A;  1RFA A;  1L4Z B;  3KW5 B;  5FK9 C;  4DDI D;  1F9J A;  3EA6 A;  2DYO A;  2K8B A;  4BKS A;  2JUO A;  3V62 A;  3HRD D;  1UD7 A;  3R3M A;  1STE A;  2ICI A;  3KQ4 A;  1LM8 B;  4C4V A;  1D5Z C;  3TCA A;  3IHP C;  4KGR A;  5BMH A;  2PLP A;  4OVU A;  4RGO S;  3ML8 A;  2MBQ A;  3H1U A;  3PV1 A;  4G0N B;  1WZ0 A;  4PS8 A;  3QQ8 B;  2MP2 B;  4C7Y A;  3E56 A;  3AH7 A;  4JPS A;  4B0E A;  2AQ3 B;  4JGH B;  2V1Y A;  1PFD A;  2DYM A;  1JAL A;  1I4Q A;  3Q8C A;  2O2V B;  2ZW1 A;  3DVN U;  4RMA A;  2ZPY A;  4BZA A;  5LXH A;  4HDQ A;  1F2R I;  4K7S A;  3Q8E A;  2E6X A;  1WF9 A;  5G2N A;  2VZK B;  1XLO A;  1WE6 A;  2O6V A;  4KSL C;  4DQO C;  3DHH C;  2LI5 A;  3TEX A;  3ZGZ A;  2R61 A;  3AE7 B;  4RH6 A;  2K0P A;  3FKY A;  4X57 B;  2QCZ A;  3QHT A;  1SJH D;  3R66 C;  4MH0 E;  1OEY A;  1VR9 A;  1ESF A;  5JHB A;  3ZXV A;  4ITK A;  5E6J A;  4AP4 C;  3C0R B;  4ANU A;  1N5W A;  2NPT B;  1VZ6 A;  3PZD A;  4GLS C;  2WS3 B;  3T3N A;  2OHF A;  3ZRC A;  2BPS A;  4W9D A;  2KMM A;  2BB5 A;  5GXG B;  1ZDV A;  1JWM D;  2DZK A;  3O13 A;  2KTR B;  4KZC A;  4B6W A;  2GB1 A;  4YT0 B;  1WI0 A;  3H9D A;  4ANX A;  2ZNV B;  2ZNV C;  2X8X X;  2HE7 A;  4ARI A;  1V80 A;  4P1B C;  3NZ3 A;  1LGR A;  4II2 B;  1I4G A;  1MG8 A;  1L6V A;  3OLM D;  4DHZ B;  4XDC A;  3VXW A;  3BVZ A;  1V5O A;  4B0M A;  5DCN A;  3N1X C;  3GZN B;  4NJ6 A;  2Z59 B;  2KX0 A;  4W9L A;  4KSK C;  2WXL A;  1H4R A;  3AMZ A;  2KAC A;  4DBG A;  1PDX A;  2PE9 A;  3TEW A;  4ZHO A;  3L0W B;  3HM6 X;  4WQM A;  2ZPN A;  3MJ5 A;  3P4R B;  3ZJT A;  4NJ7 A;  1WY8 A;  2INP E;  3B2F A;  5H92 C;  3WIM A;  5LXI B;  4BOZ B;  4YL8 A;  1EU4 A;  2NCN A;  4K3B A;  1AW7 A;  4FJZ A;  4NQK E;  2L7R A;  1TGZ B;  1VZ8 A;  3DBL I;  4BKG A;  3A9J B;  4P16 A;  2BBC A;  1GUA B;  3ZNZ B;  5IKC M;  1FFV A;  2AEH A;  4JQW C;  1P98 A;  5BYS A;  4JL9 A;  3JYU A;  3QWZ B;  3ZRF A;  1SBB B;  5MPO A;  4EZL A;  3PZ7 A;  3HIZ A;  5EE0 A;  4EUT A;  3APD A;  2PJH A;  2KN4 A;  1ZDX A;  3AI5 A;  1GAQ B;  2KZR A;  4A3O A;  1IYF A;  3B1L X;  3CWI A;  1ACC A;  1F2R C;  1OQR A;  4MSM B;  3R2I A;  1DOX A;  3SU8 X;  4TQ1 A;  2KKC A;  2WWZ A;  5AZF A;  3RNF C;  1AN8 A;  3TIX A;  2NBV B;  5CHW A;  3VUW A;  1JRP A;  1A70 A;  2CJO A;  3LYY A;  2LJ5 A;  2GBR A;  3PS6 A;  1YNT E;  1WE7 A;  1IPG A;  1OTR B;  1Q5W B;  1AYF A;  2KFK B;  4NAM A;  4FN2 A;  1UEL A;  2GMI C;  5AZG A;  2KAN A;  2MBE A;  1NYR A;  4HXD A;  5GMV A;  5J2R A;  3EFC A;  1V5T A;  2FCQ A;  1FRR A;  2Y5C A;  1FXT B;  3I3T B;  3RNB C;  2N1W A;  2OED A;  1E8X A;  4C4V B;  1GG3 A;  2D3A A;  2L0F A;  1GPX A;  4XWT A;  3DVG Y;  4KIK B;  3A33 B;  1T5X D;  4RM8 A;  4CHK A;  5JZE B;  2DZI A;  1EU3 A;  4UDU C;  4MEL A;  1N6Z A;  3VH4 B;  1RWS A;  1TKE A;  1BXT A;  3CSF A;  2E3T A;  4PYZ A;  2JZ3 B;  4XGA B;  2N4F A;  1IP9 A;  2JWZ A;  2XNA C;  3PLV A;  2RDH A;  3J9C A;  4KGS A;  4YXD B;  2MEK A;  1V1P A;  1K52 A;  1Y56 A;  2LVO A;  1YX6 B;  1EWY C;  4IOI E;  5G5H A;  4DHZ E;  3VDZ A;  1J8C A;  4R3D A;  3DWG C;  1OFF A;  2BYV E;  4WJO A;  5G55 A;  4C7Z A;  4US9 A;  1C76 A;  4Q2J A;  4RGT A;  3QCA A;  3R7R A;  2C7N B;  3Q8B A;  5CX3 A;  3GE3 C;  1TS3 A;  1M94 A;  2LHE A;  3R8B A;  5J18 A;  1P7E A;  1QKZ A;  3DBL B;  3AU5 A;  2M0A A;  3B9J A;  4LJO B;  1TS5 A;  1WXQ A;  1T6B X;  4WAA A;  2H88 B;  1AAR A;  2JXT A;  2MJ3 A;  4MGY E;  2CS4 A;  2HJ1 A;  2FAZ A;  4DXA B;  5IA7 A;  2AL6 A;  4PK1 A;  1BUI C;  3L17 A;  2KDB A;  2A4Z A;  2BKF A;  2IO0 B;  3Q3M C;  3URY A;  2IGG A;  2IY1 B;  1EWC A;  1IGD A;  3N20 C;  2N0S B;  1MFW A;  1WXM A;  4ZOH C;  2AL3 A;  3MP9 A;  4KKJ A;  4KZ0 A;  1I7H A;  4F8C B;  2DLB A;  1N63 A;  2V4I B;  3APF A;  2J7Q B;  4XZ4 A;  1E10 A;  1FNV A;  2PVO D;  1GNU A;  1TKG A;  3T9L A;  2EKI A;  4WWO A;  3WAM A;  1NVI D;  1N60 A;  3A9K A;  4MGK E;  1KTK A;  1ZOY B;  3IBE A;  4N58 A;  4W9C A;  4TKN A;  4BVU C;  1C79 A;  1YD8 U;  2JSV X;  1E7U A;  1F1H A;  2ONQ A;  1P3Q U;  1I4R A;  2Q5W D;  2KX3 A;  2IBI B;  1WM3 A;  1FM0 D;  2QC8 A;  3EGR A;  1SE3 A;  1JWS D;  1E7V A;  2L52 A;  3U4E G;  3AEA B;  3BVM A;  2L32 A;  4RCO A;  1TZO A;  2FCN A;  3KH0 A;  1MHX A;  1CJE A;  4RFB A;  2JT4 B;  1NI2 A;  5IN7 A;  1Q10 A;  3MC8 A;  1ZXI A;  2MA9 B;  5T8I A;  2JPH A;  3AE6 B;  3P4P B;  2BYE A;  3BWU D;  4WWP A;  1XLN A;  4W9K A;  3R7Q A;  2WXQ A;  3ZNG C;  2WXJ A;  1R4M B;  2PVG C;  3TEY A;  1RFK A;  4IM3 A;  3QAR A;  3RMK C;  4P6V F;  4OVV A;  1JML A;  3KLS X;  4C00 A;  1H8C A;  2MH7 A;  4K7U A;  4DHJ B;  4LDT B;  5IOI A;  1V6E A;  3DHG C;  3WAO A;  1CQV A;  4HPM B;  3W5V B;  3WAP A;  2WLB A;  2FBW B;  2BT6 A;  4HCN B;  1WJU A;  2GI9 A;  2K8C A;  5AUK A;  4DHJ D;  2IGH A;  4LDT D;  2KMC A;  1WGR A;  2JQR B;  1XXG A;  2ON8 A;  4JLC A;  3U30 A;  2KXJ A;  1L0X B;  3PPA A;  4IWP A;  1L7Y A;  1K53 A;  1KRH A;  3V6E B;  3AE1 B;  2KJR A;  1HEZ E;  2BS4 B;  2EMS A;  2K6D B;  1RM6 C;  2D11 A;  4M0W A;  1SIJ A;  1A5R A;  3ZDM C;  3HUI A;  1UWM A;  4FJV B;  1DGJ A;  3QJZ A;  2RR9 A;  3VUY A;  2LHD A;  3DBR B;  4LLG M;  1FO4 A;  1L6U A;  4HCP B;  2N7J A;  1WGD A;  3QIJ A;  4M01 A;  3RCZ A;  3NVY A;  2D10 A;  4S0R A;  3DBH B;  2C7H A;  2N9K A;  1TYG B;  1OQQ A;  3I57 A;  1I35 A;  4GU2 A;  3ZJU A;  2LD9 A;  4RM9 A;  2KN5 A;  4KIK A;  3DWM A;  2BS2 B;  2RDG A;  2OOB B;  3UGB B;  3LDZ E;  3EFU A;  3PVL A;  2KOX A;  4FHJ A;  4NJC A;  2OJR A;  4KKI A;  1HTO A;  4EZJ A;  2CJN A;  4QAY A;  3NZS A;  3RZW C;  2YEP B;  4WAF A;  3K9P B;  2RD0 A;  3ZLZ A;  4XX5 A;  2L83 A;  2LXC A;  2FNJ B;  1RYJ A;  1EF5 A;  1TJE A;  1UUP A;  1QZE A;  3ZIM A;  4LNF A;  2CHX A;  1KF6 B;  5IAA C;  3ECI A;  4LNN A;  2C5L C;  2BTE A;  3PSE B;  2XBB C;  1XLP A;  5IO9 A;  2D2Q A;  3ZYY X;  2J0M A;  4GSW A;  1N61 A;  4S17 A;  2SAK A;  1V1P B;  1FXI A;  1PGX A;  2ZVO A;  2KC2 A;  3LJ3 A;  2QMT A;  4NAW B;  1KFY B;  5D6J B;  1QF6 A;  1U4A A;  3VR9 B;  2BGF A;  2K9X A;  1V2Y A;  3WA0 A;  3PGE A;  2NTS A;  3RD2 A;  3Q8A A;  2J0J A;  1PUT A;  3C8Y A;  3B2G A;  4MH8 A;  3V3X A;  3VTV A;  1L0Y B;  3RN9 C;  5I4D A;  2QSD A;  1WM2 A;  3RNG C;  2JX5 A;  1T0S C;  4A90 A;  2KJ6 A;  3NS8 A;  2KHW B;  4KX6 B;  3TEZ A;  2XK5 A;  2LRW A; 
#chains in the Genus database with same CATH homology
 4OVZ A;  4YTN B;  1VRA B;  1JRP A;  4REZ A;  1A70 A;  2CJO A;  3LYY A;  1JWB D;  1SEB D;  4L2Y A;  3W2D A;  5LNK 1;  4YSX B;  2BW2 A;  1YNT E;  1FD6 A;  4O1N A;  4TQ0 A;  2JU6 X;  3PZ8 A;  1ET9 A;  1AYF A;  3V05 A;  2L1A A;  4NAM A;  1YMH E;  3AE3 B;  1ZUD 2;  4FXC A;  1M4V A;  4HEA 1;  3AEB B;  1JQ4 A;  1NYR A;  5H8Y E;  2GRI A;  1NEN B;  2N9L A;  3FIL B;  5D3D A;  3AEE B;  1VLB A;  1FNW A;  4IKG A;  1PGB A;  1YN3 A;  1FRR A;  4ZRQ A;  1QOF A;  3BYY B;  2Y5C A;  4OZA A;  1ENF A;  4N59 A;  2RPV A;  2MJD A;  2OED A;  2KWD A;  2M19 A;  3P63 A;  5HFY A;  2DWQ A;  3AV8 A;  1GPX A;  1ZE3 D;  3W9C B;  1HZ5 A;  1PYW D;  2BYT A;  4US8 A;  4OZB A;  1KLU D;  4XWT A;  1L5P A;  1QOA A;  2LJI A;  1T5X D;  3P1M A;  3AM9 A;  3ABV B;  4PT5 A;  1EU3 A;  2JZP A;  4XE0 A;  1NYQ A;  3Q8F A;  1WYG A;  3KWL A;  4UDU C;  1MHH E;  1DOI A;  1C78 A;  3SFE B;  2IDY A;  1QIL A;  3WCQ A;  2BB6 A;  1N5X A;  3SEB A;  2DBY A;  1GOZ A;  3P42 A;  2AQ1 B;  4TMA B;  1D6E C;  1RWS A;  3VR8 B;  1MPE A;  1TKE A;  1BXT A;  1E0Z A;  2H89 B;  2FUG 1;  3PO0 A;  3Q69 A;  2E3T A;  2WXF A;  1B1Z A;  1WSP A;  2WNM A;  2KAJ A;  3R2T A;  1GB4 A;  1C4P A;  1JRO A;  4NZL B;  3TSS A;  2XNA C;  2LGI A;  4LK0 M;  1ROE A;  2QIE B;  2RDH A;  2QJL A;  3TUO A;  1FEH A;  4HRO A;  3J9C A;  4KGS A;  3RPF C;  4YXD B;  2LFI A;  1SE2 A;  2MEK A;  2XN9 C;  1V1O A;  1V1P A;  1K52 A;  1Y56 A;  1EWY C;  4IOI E;  5G5H A;  4YTM B;  2WQY B;  2MJE A;  2WXM A;  3SR6 A;  1IBX B;  3N9Y C;  5C2T B;  2J53 A;  4R3D A;  4OHJ A;  3DWG C;  5BMG A;  3VRA B;  1OFF A;  3AEC B;  2W3S A;  1SF0 A;  1FRD A;  3CIR B;  1ZPS A;  1C77 A;  4C7Z A;  5JXV A;  4US9 A;  3SFD B;  1C76 A;  4Q2J A;  4RGT A;  2VZK D;  4ZYS A;  3Q8B A;  2G9H D;  2LEK A;  2PIA A;  1TS3 A;  1D5M C;  2LHE A;  5BMI A;  3EUB 2;  2YEP F;  3R8B A;  5C3J B;  1P7E A;  3MC0 B;  1QKZ A;  1WWT A;  1PGA A;  1L4D B;  4A6Q A;  4GDL B;  2Y3A A;  2M0A A;  2INN E;  4MT5 A;  1JWA D;  4EE2 A;  2PMV A;  3NVV A;  3B9J A;  4L23 A;  1E9M A;  4L1B A;  1C4C A;  4JX1 C;  1TS2 A;  1QQR A;  4USA A;  1TS5 A;  3LXF A;  1WXQ A;  1T6B X;  2H88 B;  2WXO A;  1TS4 A;  2JYT A;  4C80 A;  4DXG A;  3ZJV A;  2JXT A;  2MJ3 A;  1XO3 A;  5EE9 A;  3MHZ A;  2FE8 A;  4RGN A;  1ET6 A;  1YJI A;  3U7Z A;  3NVW A;  1XCT L;  4HKZ E;  2WXH A;  1BUI C;  2PKO A;  4OW0 A;  2WXI A;  4A8X C;  3URY A;  4AQ7 A;  2IGG A;  4J3O D;  1EWC A;  3AEF B;  1FXA A;  2ACZ B;  1AWD A;  1IGD A;  1XEE A;  2N0S B;  5AUI A;  1I4P A;  1VZ7 A;  2IJ0 A;  4ZOH C;  1SJE D;  1L0V B;  3GS2 A;  3W1S A;  3MP9 A;  2CU3 A;  4KKJ A;  4H2A A;  2IPK D;  3U2S C;  1GB1 A;  1I7H A;  4JWU C;  1KH0 A;  1TKY A;  3T3O A;  1SE4 A;  2DLB A;  4YSZ B;  2K5P A;  1N63 A;  2V4I B;  2K22 A;  2LMC A;  2W3R A;  1BML C;  3FIL A;  4HRS A;  1E10 A;  1FNV A;  1K50 A;  1L4Z B;  1WGK A;  2PVO D;  4A9A A;  2W82 A;  1TKG A;  2EKI A;  5FK9 C;  1NVI D;  3EA6 A;  1N60 A;  2DYO A;  1TY2 A;  2V0G A;  3HRD D;  3BII D;  1HZ6 A;  2BS3 B;  2J52 A;  1STE A;  2ICI A;  3KQ4 A;  2I2Y A;  4HKQ A;  1K51 A;  3RFZ B;  1D5Z C;  1DYQ A;  1KTK A;  1NEK B;  1ZOY B;  4HJG E;  4KGR A;  4N58 A;  5BMH A;  2B76 B;  1C4A A;  2PLP A;  3AE9 B;  4RGO S;  3L4P A;  3NVZ A;  1HQR D;  1EM7 A;  2LUM A;  3BZD B;  1C79 A;  1VJK A;  2JSV X;  3AE4 B;  2ONQ A;  1I4H A;  1I4R A;  2Q5W D;  1FM0 D;  1XCQ L;  3EGR A;  3IT6 B;  4C7Y A;  3E56 A;  3AH7 A;  4JPS A;  4B0E A;  1SE3 A;  1JWS D;  2L52 A;  1V8C A;  2AQ3 B;  2HTM E;  2V3P A;  3U4E G;  1PFD A;  2DYM A;  1FCL A;  3AEA B;  4CQN A;  3BVM A;  2L32 A;  1JAL A;  1I4Q A;  3AE2 B;  5D7G A;  1JWU D;  3Q8C A;  1SB3 C;  2ZW1 A;  4RCO A;  1TZO A;  1MHX A;  1DOY A;  1CJE A;  4RFB A;  1F2R I;  5BYQ A;  1UGJ A;  3Q8E A;  1Q10 A;  4OZC A;  1ZXI A;  2E6X A;  5T8I A;  4C56 C;  3AE6 B;  1IUE A;  4AS1 A;  3P4P B;  3BWU D;  2VZK B;  1XLO A;  4DQO C;  1XLN A;  2WXQ A;  3TEX A;  3ZGZ A;  3W5U B;  2WXJ A;  2R61 A;  3AE7 B;  4RH6 A;  2PVG C;  3TEY A;  1RFK A;  2K0P A;  3KWV A;  4P6V F;  1YJJ A;  1YN5 A;  1JML A;  5FKA C;  2W54 A;  3KLS X;  1IGC A;  4MM3 B;  1B9R A;  1SJH D;  1SXT A;  2MH7 A;  2WDV B;  1VR9 A;  1ESF A;  2KDM A;  4ITK A;  1MI0 A;  1D4B A;  1D5X C;  5E6J A;  1CQV A;  1UWX A;  4YWG G;  3ZQ4 A;  1N5W A;  3IT4 B;  1FMA D;  3E9S A;  3W5V B;  1VZ6 A;  2IGD A;  2WLB A;  2FBW B;  4D2K A;  2BT6 A;  1SSN A;  3HVZ A;  2GI9 A;  5AUK A;  4GLS C;  2WS3 B;  2Y5P A;  3T3N A;  1J7C A;  2IGH A;  1JW9 D;  2OHF A;  1R7S A;  2JQR B;  2KMM A;  1XXG A;  2BB5 A;  2ON8 A;  5GXG B;  2TSS A;  1ZDV A;  1L0X B;  1JWM D;  2AX5 A;  2EEL A;  1K53 A;  1KRH A;  1YQ4 B;  2Z8L A;  3P4Q B;  1ZXH A;  3AE1 B;  1NI3 A;  3O13 A;  3NRZ A;  4WH4 A;  1HEZ E;  2BS4 B;  2D5G A;  1RM6 C;  4LTU A;  4M0W A;  4XWW A;  1SIJ A;  2NMQ A;  3FAH A;  1V97 A;  2GB1 A;  3OWE B;  2WXR A;  4YT0 B;  2HDE A;  3AN1 A;  3IXS A;  1T3Q A;  3HUI A;  1CK1 A;  1UWM A;  1DGJ A;  1N62 A;  3BVG A;  4ARI A;  3NZ3 A;  1I4G A;  1XLQ A;  2LHD A;  4LLG M;  1FO4 A;  3U52 E;  3MFG A;  1L6U A;  2J4X A;  4TSS A;  2N7J A;  1L6V A;  3FC4 A;  2JYE A;  1UNS A;  2JWU A;  3AE5 B;  4XDC A;  5HI1 A;  3BVZ A;  4RNA A;  3NVY A;  3BK1 A;  4B0M A;  2X38 A;  2N9K A;  3AE8 B;  1HA5 A;  1ZP0 B;  1TYG B;  2QEJ C;  1QT9 A;  1OQQ A;  3I57 A;  3ZJU A;  3BYT B;  2J42 A;  2WXL A;  1LO5 D;  3DWM A;  2BS2 B;  3AMZ A;  2KAC A;  2RDG A;  4JWS C;  4N6E B;  3HVD A;  1F0Z A;  2SEB D;  1FFU A;  1PDX A;  3AED B;  3TEW A;  2RMM A;  4ZHO A;  1KLG D;  4ARC A;  4YSY B;  4NJC A;  4WIP A;  4KKI A;  4WQM A;  2CJN A;  4ZHP A;  2M56 B;  5BYR A;  1VDV A;  3MJ5 A;  3P4R B;  3ZJT A;  1P7F A;  2YEP B;  4WAF A;  4JE3 B;  4DXF A;  2WDQ B;  2INP E;  3B2F A;  2I38 A;  2KQ4 X;  3AB5 A;  5H92 C;  1JCK B;  2L83 A;  1QOB A;  1EU4 A;  2WXP A;  1AW7 A;  1RYJ A;  1TJE A;  1UUP A;  1VZ8 A;  3AEG B;  3P4S B;  1KF6 B;  4MAC A;  2BBC A;  2WXK A;  4P16 A;  2K3U A;  4RF0 A;  4IDI A;  2WDR B;  1FFV A;  1YN4 A;  4YTP B;  3ETR A;  2BTE A;  1XLP A;  1WRI A;  2WP9 B;  4A55 A;  3ZYY X;  2QIL A;  2WU2 B;  1N61 A;  3I9V 1;  5EE3 A;  5BYS A;  1CZP A;  4RGM A;  2SAK A;  5HHD G;  1V1P B;  1FXI A;  2NTT A;  2WXN A;  1PGX A;  2ZW0 A;  3H8H A;  4KGT A;  1SBB B;  1IBX A;  1TY0 A;  5MPO A;  3VQI A;  2QMT A;  5TSS A;  3PZ7 A;  2PW9 A;  4NAW B;  5EE0 A;  4ZRP A;  1HXY D;  5EE1 A;  2WU5 B;  3NUH B;  1KFY B;  1MVK A;  1QF6 A;  3VR9 B;  3IAM 1;  1FCC C;  1FIQ A;  1J7A A;  2PTL A;  2K9X A;  2KN4 A;  1ZDX A;  2AQ2 B;  3BK2 A;  1FNU A;  2WXG A;  1YQ3 B;  3GP7 A;  2W55 A;  2NTS A;  1F77 A;  3Q8A A;  3GB1 A;  1GAQ B;  4GDK B;  5D3I B;  5HG2 A;  3UI3 A;  1PUT A;  3CWI A;  3C8Y A;  1ACC A;  3LB8 C;  3IAS 1;  3NS1 A;  1E7P B;  3B2G A;  4MH8 A;  1E6E B;  1I4X A;  1F2R C;  3V3X A;  1QLB B;  1OQR A;  1L0Y B;  5I4D A;  3R2I A;  4XDD A;  5G5G A;  2QSD A;  5FR3 A;  1DOX A;  2V3N A;  4TQ1 A;  4WUR A;  4WWM A;  1J7B A;  2G1E A;  2JX5 A;  4RF1 A;  1C9F A;  3VRB B;  4A90 A;  4KX6 B;  1AN8 A;  3TEZ A;  1QOG A;  1XF5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...