1KH0A

Accurate computer base design of a new backbone conformation in the second turn of protein l
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
EEVTIKANLIFANGSTQTAEFKGTKEKALSEVLAYADTLKKDNGEWTIDKRVTNGVIILNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords protein L
publication title Accurate computer-based design of a new backbone conformation in the second turn of protein L.
pubmed doi rcsb
source organism Finegoldia magna
total genus 18
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kh0A00
5BMGA 1K50A 1KH0A 1GB4A 5JXVA 2I38A 4OZAA 1D4BA 2PW9A 2N9KA 3FILA 1MHXA 1F2RI 2LHDA 2GI9A 2LUMA 2IGGA 2KN4A 2I2YA 1QKZA 2N9LA 2ZW1A 5HI1A 2KDMA 2EELA 1GB1A 1MHHE 3UI3A 4D2KA 4OZBA 1IBXB 2JSVX 1K53A 1P7FA 2PTLA 5HHDG 5BMHA 1PGAA 1F2RC 1PGBA 1YNTE 3V3XA 1MPEA 2J53A 2QMTA 1HZ5A 2QSDA 2ONQA 3MP9A 3GB1A 1MI0A 2N7JA 2KQ4X 2NMQA 2GB1A 1K52A 2LGIA 1P7EA 1XF5L 1JMLA 5HFYA 4IOIE 1MVKA 1K51A 1XCTL 4IKGA 1C9FA 5HG2A 2IGDA 1IBXA 5BMIA 2KWDA 1HEZE 1HZ6A 2J52A 2PLPA 1EM7A 4MACA 1IGDA 3FILB 2LHEA 4KGTA 2ZW0A 1YMHE 2K0PA 4KGSA 1FD6A 4KGRA 2RPVA 2JU6X 1ZXHA 2JWUA 1IGCA 1XCQL 2IGHA 1FCCC 2JZPA 2RMMA 4HKZE 1Q10A 4OZCA 2OEDA 4HJGE 2JXTA 4WH4A 2ON8A 2KACA 1PGXA 1UWXA 1FCLA 4GLSC
chains in the Genus database with same CATH superfamily
4IG7B 4AUQC 2VZKB 4G3XB 4YWGG 5JXVA 4NAWA 3FAHA 4HRSA 4MH0E 4LDTB 1D5XC 1KOTA 3MHSD 3C19A 1WJNA 2BYFA 2JRIB 5CHVC 4PK1A 3NZ3A 5HI1A 3KH0A 2J0KA 2MH7A 1GB1A 1ESFA 2KXJA 3AE1B 4II2B 3IT4B 2KAJA 1L2NA 1IBXB 1B1ZA 3DBRI 3Q3FA 2UYZB 3QJZA 3AU5A 4XGAB 1F9JA 3L54A 3L08A 1YX6B 2ZCCA 4HCNB 1YJIA 5D3DA 2GBJA 4RGTA 2DYMA 4AP4C 2D07B 3RNFC 1R4MI 3U7ZA 1NYQA 2RSUA 2ZCBA 1WGKA 2JF5A 3VUXA 2FE8A 3U30A 3R8BA 3AEDB 2IO0B 3ZGZA 4TUUA 2LJ5A 4E74A 1B9RA 4NQKE 2H89B 4X57B 3BK2A 5AEKB 2KVRA 4IM2A 3TL5A 2G9HD 4FHKA 1YX5B 4YSXB 3NUHB 3ZYYX 3KQ4A 1ZW7A 2KX0A 2BW2A 2C5LC 2MBHA 4US8A 1RYJA 3RI7C 2Z0DB 1WE6A 2K6DB 2PVGC 5BYRA 4YTPB 1SGHA 4OVZA 2AWTA 1ZUD2 3ZNHB 2KHWB 1RLFA 2KD0A 2DBYA 1TT5B 3CF6E 2M17A 2DX5B 2DWQA 3O13A 4OZAA 2PVOD 2KANA 2KWVB 3PSEB 2L83A 1FMAD 1Q5WB 4C7ZA 1T3QA 4R3DA 3QX1A 3BWUD 3TCAA 2MJ3A 4BBNF 2PPHA 4G50A 4LJOB 1D5ZC 1HXYD 4ARCA 4DWFA 1F52A 3P4RB 1I4XA 1UUPA 2KVZA 2WXJA 2N4FA 3AE5B 3NOBA 2L52A 2ZVNA 2LASA 4ZYSA 4M01A 3PREA 5E6NA 4IM3A 1XF5L 3U52E 3WALA 1JCKB 1P3QU 4HJKA 1JMLA 4HPLB 4MM3A 4L23A 4W9CA 5T8IA 1TTNA 2B3AA 2FCMA 1K51A 2KO3A 5C3JB 1C9FA 2BBCA 4LNOA 3V60A 2QILA 3A1QA 4B0EA 1HTOA 2RDBC 2DHZA 5EE1A 1WGHA 4JGHB 3T3NA 2K8HA 2L00B 4KGTA 2VH1A 2Z0EB 5D2MB 2KN5A 1GC6A 1WGDA 4Q2JA 3RNGC 1C77A 2FCSA 1IGCA 1XCQL 2IGHA 1Q10A 3SR6A 2KMAA 3VHTC 2JXTA 1N6ZA 1SSNA 2JZZA 3DHHC 3NZUA 1TS3A 4WQMA 1D3ZA 1UBIA 1VZ8A 1WSPA 2DNFA 3I63C 3H9DA 1E6EB 3Q3NC 1WI0A 2J4XA 2KJHB 2WXFA 4FULA 1QILA 2WNMA 3AN1A 1I4PA 2I2YA 2CHZA 1Z2MA 2K1FA 3H6NA 3Q2AC 4LNIA 4JL9A 4KKJA 2MCNB 2EELA 3T9LA 2SEBD 4ZRJA 3Q69A 1WR6E 3EUB2 1L6UA 3DHIC 2EMTA 5C1ZA 1V97A 3BYTB 1EWCA 1MPEA 1XD3B 3ZLZA 2R2OA 2KTRA 5E6OA 3RMKC 3X23A 1V2YA 2N7JA 5FR6A 1VLBA 2NPTB 1M94A 1T6BX 4HCPB 1WM2A 3DVGX 4HDOA 2WXKA 4LNKA 4K3BA 5BMIA 4NJ6A 2HTHA 3MC9A 4IWOA 3PLVA 1ZKHA 1WMHA 1IP9A 3IT6B 2W9NA 3L10B 3UIOB 3ZTCA 2IY1B 5DPSA 2O6VA 5LLIA 2ZW0A 2LMCA 2KFKA 2L1AA 3A9JA 2KFJA 3ZXRA 4YSZB 3N1XC 2MRPA 1SJED 3EFCA 4KIKB 4F1SA 1KLGD 4N9F4 1FO4A 4ARIA 2LGYA 4LTUA 2IO1B 3QWZB 3ZW3A 2WXIA 2M1MA 1EF1A 2L0TA 4I6LB 1CZPA 4DHZB 2PE6B 4KV2A 2HDEA 1V5OA 3HM3A 4WAAA 4WURA 1YOVB 3BINA 3W1SA 4FXCA 4KZCA 4KX6B 3EFUA 4M8NA 2GOWA 1N62A 1YQ3B 4NNJB 2R61A 1LFDA 4GDLB 2CHXA 2WDTB 1V5TA 2KDIA 4MGIE 3N3KB 3RNEC 4MDKE 2A5UA 2GMIC 2GBRA 1F2RC 1YNTE 2JXXA 4WJPA 4M0WB 2E6XA 4N6EB 1GUAB 2KLCA 3L17A 4REZA 4P1BC 1L0VB 1XQQA 3VFKA 2RGFA 2V9HA 3H7PA 1EU3A 1WJ4A 4B95A 3UINB 5IO9A 2LUEA 2AQ3B 4HVBA 4XC2A 3PHWB 4JLCA 2VZKD 2C9WB 4TV3A 1YJJA 2MBQA 3Q6BA 3V6EB 3B2GA 4RF1A 4LDTD 3DBLI 1JWSD 3OAWA 2CS4A 4PT5A 4GU2A 2KWDA 3DQVA 1C4AA 3Q8EA 3APDA 2PE9A 2BYEA 3IHPC 4KVGB 4CQNA 4AQ7A 2WU2B 3U8ZA 4AJYB 3L16A 2WXHA 1C3TA 1GJZA 1L4ZB 2D3BA 2INNE 1UZXB 1M4VA 2MW5A 2IDYA 1VZ7A 2KK8A 2FAZA 3N32A 1ZOYB 2AL3A 1LO5D 1JWMD 4DHJB 2J42A 3BIID 1ZE3D 1WXVA 1CMXB 1WXAA 1V1PA 4II3B 1MHXA 1CK1A 1AN8A 3CMMB 1I35A 2N9EB 3SEBA 4HPPA 4PS3A 1QKZA 2KJRA 4PS8A 4RM8A 4TQ0A 3Q8CA 1WX8A 4KKIA 1FNVA 1TIFA 3ML9A 2L8JA 1OEYA 1MHHE 3FKYA 4YXDB 5BYSA 3AE8B 3ALBA 1DOIA 2KLGA 1E5WA 3CWIA 4MSMB 1VD2A 1N5WA 5MPOA 2WDRB 1NBFC 1ROEA 2GRIA 4W9LA 3DCGA 2LFIA 2QSDA 1FXTB 5DCNA 3M3JA 4FA6A 4BAXA 4RFBA 3J9CA 1V1OA 1AW7A 2I1KA 4BOSC 1T5XD 3RNBC 1QOBA 1KLUD 3PPAA 2OOBB 1PYWD 2KMMA 2SAKA 2TSSA 5D3IB 4YSYB 1PUTA 1PDXA 4EZKA 3RZFA 1FFVA 4W9HA 3JW0X 4W9JA 3NVYA 1FD6A 3HM6X 2G45B 4RGNA 3AM9A 4GMVA 2AL6A 2CU3A 4JE3B 2MEKA 3P63A 4TQ1A 2L3ZA 1SE9A 3OJ4B 3ZO5B 1L6VA 4HJGE 3VDZA 3ZQ4A 5IA7A 1Q0WB 1ZDXA 5J2RA 4GIVA 1WY8A 1NDDA 2V3SA 4A55A 2K9XA 3A4SC 5AZFA 2ZPYA 3DVGY 1EWYC 1R4NI 2N9KA 1TZOA 3DBLB 1I7HA 3ZTDA 2REXA 1G6JA 2MWSB 2LVQA 4RMAA 2CHWA 1KF6B 4IW0A 5L95C 5CHWA 2WXQA 3DDCB 3DWMA 4D2KA 1PGAA 4FHJA 2CU1A 2LZ6A 2BGFA 5EE3A 4S17A 2ZZPB 5JHBA 1TS4A 1FNUA 1VZ6A 4AS1A 4WWNA 2JPHA 1I4QA 4EUTA 3MP9A 3VQIA 3AE2B 3TEXA 2MBEA 2K8BA 3WANA 4HKQA 3JSVA 2IO2B 5HFYA 3M95A 2MSED 3LJ3A 4WQOB 3QQ8B 2LRUA 3Q8BA 3RYTA 3ML8A 4MJSB 1TGZB 5EE9A 2D3GA 3AECB 1E90A 1BXTA 2FUG1 1TY0A 2JT4B 1TYGB 3GS2A 3UF8A 3Q3OC 4MACA 1IGDA 1AARA 4ICVA 2OJRA 4DXGA 3VH3B 3U7DA 2K0PA 4DK5A 4KGSA 2PKOA 2KWCA 4URKA 2GBNA 1MG8A 4OVVA 2DZKA 4OZCA 3ZRCA 4DQOC 4K3CA 3RCZA 3JYUA 4W9FA 3A9KB 4P7IA 2I1JA 3RUIB 4HDQA 2WLBA 1A5RA 4XWTA 1OQYA 2B76B 4ZRPA 1K50A 4AOFA 4ITKA 4W9KA 2PW9A 4TKNA 4BKGA 4XZ4A 1V86A 1ACCA 2N9LA 4KDLB 3AEEB 3SFEB 4MELA 2FBWB 4EZJA 5DPRA 3OG5A 2L05A 3W1YA 1V6EA 2BPSA 4OVUA 3VXWA 3OWEB 3R66C 1ZPSA 2YEPF 2XN9C 3UQBA 1GOZA 2FCQA 4CHKA 2QIEB 3GE3C 4FLHA 3IBEA 4IUMB 2DAFA 3NZSA 2MJEA 1Q1OA 1WJUA 2MA9B 1YN3A 2BYVE 3VR9B 2LI5A 3OLMD 2KC2A 4JPSA 3I9V1 1T0SC 2D3AA 2Y5CA 1SBBB 1GG3A 3ZUNA 4RGOS 1E9MA 3T8MA 3AH7A 5EE0A 3KWVA 1FXIA 3C8YA 1FPYA 1MVKA 4MSQB 1NEKB 3HUIA 2D3CA 3QIJA 2CKHB 1P0RA 3Q8AA 5G5GA 1SE2A 4HEA1 4J3OD 2N0SB 2IBIB 3WAOA 2DENB 3P4SB 4LJPB 4NQLB 1Y8RC 1XLNA 3P2BA 2MLBA 1XLOA 1FM0D 2RMMA 5EDSA 4KZ0A 2Z8LA 1WXMA 1CQVA 3R7QA 4M00A 3W9CB 2WU5B 1WWTA 3WCQA 4ANWA 3R2TA 2PJHA 4EFOA 1P1AA 1D6EC 2I38A 4F7ZA 4NAMA 3PS6A 2M0XA 3DBRB 1WZ3A 3KW5B 3FILA 2GI9A 2V4LA 4WIPA 5JZEB 1L5PA 1NENB 1VCBA 3HK0A 5LXHA 2KDMA 1VR9A 3LDZE 2N7EA 1R4MB 2DYBA 3EECA 2WP9B 1TKYA 2BKRB 3DBHI 4HXDA 4OZBA 1K53A 2PTLA 3MTNB 4K7UA 4BFRA 3U2SC 2DZJA 3V3XA 2ASQA 3PVLA 2IYDB 1WRDB 2D11A 4P1CC 3KUDB 3V62A 2NMQA 4RGMA 1P7EA 4FJYA 2D2QA 2WXPA 1WYWB 4DHJD 1XT9B 3DVNU 1JALA 3DVNV 1XLPA 1U4AA 4ZDVA 1E10A 2K8CA 2RDGA 3UGBB 4KSLC 2KTFA 2YVCA 1MJDA 1C4PA 2KMCA 2MP2B 3OJ3A 4B9KA 1SB3C 2N9XA 4NAWB 3TUOA 3V05A 2GBKA 1BUIC 3RN9C 2MJDA 3ZDMC 3AXCA 5BYQA 1QOFA 2K22A 4EEWA 2KNBA 1TJEA 4I6PA 2V3PA 4KGRA 3HRDD 4C4VA 1BT0A 3PV1A 3B08A 2JWUA 2KDEB 4G11A 2JUOA 2JZPA 2BS4B 3AE6B 1UNSA 1OEYJ 3HVZA 4ZOHC 2M8SA 3AE7B 2BS3B 1BMLC 5BMGA 1SEBD 4JWUC 3KYDD 5DPWA 3AE3B 3Q3JA 1UD7A 5IAAC 4WWMA 2LHDA 3LYYA 3AEAB 2BB6A 3AEFB 2C7NB 2C60A 2R2QA 2AQ1B 2XK5A 1E8WA 3UQAA 2RD0A 1YN4A 3L0WB 3DOWA 2EKEC 4CO7A 4RM9A 1TZ1A 2JQRB 2FUHB 3Q14C 3AEGB 2WDVB 2O2VA 1EF5A 2N1VA 5TSSA 1L4DB 1PGBA 2AYOB 3ZVVA 2NBWB 3T3OA 3ENEA 5CX3A 3IAM1 2MHJA 2JY6A 3AE9B 3RT3B 1GNUA 1MI0A 1IPGA 2KZRA 4DXAB 2DZMA 3MFGA 4H2AA 2V1YA 4LCDE 1XLQA 2G3QB 3WA0A 5E6JA 1NVID 4BKSD 4BVUC 3PRZA 4C56C 1IBXA 5DPTA 3P1MA 1DOXA 2J52A 1F77A 1V9JA 1L0YB 4MGZE 3BK1A 1OFFA 4UDUC 1H8CA 1FRDA 1YMHE 3W1SC 1WM3A 3RNCC 3B1LX 5AZHA 4JIOU 1T0QC 2DAJA 2RPVA 1YJ1A 3EGRA 2W54A 5FK9C 3ZKJC 4LNNA 2MBBB 3BVMA 3VRAB 1RRBA 1SIJA 3NVVA 1J19A 2ON8A 3RULA 4K7SA 4WWPA 4MGKE 4GSWA 1TBEA 2ACZB 4ACFA 4N58A 2XEWA 3ZNGC 4PYUA 1JQ4A 5L83A 1D4BA 2QEJC 2BB5A 2YLMA 5FR3A 5C2TB 4ANXA 2AX5A 1F2RI 1QOAA 3UIPB 1JWAD 1WGYA 4HROA 2KOXA 4MM3B 3KYCD 3VUWA 3VR8B 2WQYB 3AMZA 2LEKA 2L7RA 2HJ1A 5H92C 4B6WA 3A1QB 2HJ8A 3N1YC 2KQ7A 2WWZA 3K9PB 3V61A 2L0FA 1SXTA 2BKFA 3VH4B 1HZ5A 2X38A 4JQWC 1WX7A 2ONQA 4M8MA 1IUEA 2KJ6A 3SDLC 4EOYA 5IP4D 4K7WA 1E8ZA 1K52A 5KHOA 2NR2A 4NJCA 4FJVB 4XX5A 1WX9A 3AE4B 2IY0B 1RWSA 1FRRA 3IXSA 1V8CA 3I5JC 1XEEA 1C79A 1YD8U 2WYQA 5G5HA 3RFZB 2IGDA 5LXIB 3PZ7A 3ECIA 3BVGA 4NJ7A 3DPDA 3CIRB 4K1RB 2WXLA 3ZJTA 1WJ6A 1UGMA 5IOIA 4BOZB 1GAQB 3NG0A 2FIFA 3AEBB 2FIDA 3VRBB 2ZVOA 2NBVB 2M4NA 3BY4B 4HKZE 1KM7A 1C76A 1R7SA 3IAS1 1Z5SB 1FCLA 3TSSA 3E56A 1P98A 2LGXA 3ABVB 2KTRB 2LVPA 2M19A 2ZJDA 3P4PB 1UELA 1WGGA 5G55A 4W9IA 3TEYA 4ZRKA 3QCAA 4EZLA 1JROA 1F1HA 3QAQA 3APCA 4IC7B 3FC4A 2DYOA 5TR5A 3VTVA 2J53A 1RFAA 2Q5WD 1WMHB 2MBOA 3C0RB 2M56B 1WE7A 2O6VB 1L7YA 4HWIB 3P4QB 2KFKB 4FBJB 3A9JB 4K81A 3RZWC 3APFA 2WX0A 3NRZA 1TY2A 2KYWA 1AYFA 1PQSA 3BZDB 4XWWA 1DGJA 3Q8FA 2NS5A 5IN7A 3W2DA 5GMVA 3GE8C 3N30A 3U4EG 1C4CA 1TKGA 2BQQA 5AUKA 1HEZE 1WF9A 2KWUB 2PLPA 4ICUA 1WR1A 2MP2A 3AULA 4BKTA 3ZIMA 3ETRA 4MEMA 4F8CB 4ASWC 3NJTA 3ZNID 2QC8A 3M63B 2EMSA 2NPTA 1FCCC 4DBGA 3TMPB 1E8YA 2CR5A 2J7QB 2QHOA 2K39A 3B9JA 3NVWA 3ONSA 2LD9A 1GB4A 1WRIA 2WXMA 1RM6C 2KC1A 2Y5PA 4HPMB 3H7PB 2LUMA 2N9PC 5AZGA 2AQ2B 3L4PA 4DDGD 4RNAA 2KKCA 4E3CA 3TEZA 3EA6A 3NVZA 4KIKA 3MJWA 1X1MA 3CSTA 2X8XX 3URYA 1EO6A 1QLBB 2JZ3B 1RAXA 3TEWA 1KRHA 2YEPB 4GGQA 3AU4A 1STEA 3PRPB 2QMTA 1WYGA 1TS2A 3KUZA 3GZNI 3D32A 4ZRIA 5LNK1 3ZXVA 1V80A 4ZHPA 3GP7A 1UGJA 2KQ4X 2WXRA 1ENFA 1DYQA 4ZRQA 4PYZA 4OW0A 3W5UB 1HQRD 1WXQA 4GDLA 2LXAA 2WDQB 1SJHD 2ZNVC 3VTUA 2M0AA 5CHFA 3PZDA 2PIAA 4M0WA 1HTQA 1N60A 1V1PB 5D94A 2WS3B 3AV8A 1R4NB 2G4DB 2V0GA 5C23A 3PT2B 1LM8B 3JVZX 4GDKB 3QK0A 1FNWA 3TBLD 3WIMA 4XDCA 2KACA 4WJQA 4EE2A 2QDFA 3MHZA 5D6JB 3R3MA 3KUCB 2IPKD 4LNFA 2LJIA 1ZGUB 2FCNA 4GB9A 4CYEA 4MT5A 1OTRB 1JRUA 2LGSA 3CSFA 3IVFA 4GXBA 4WWOA 3UI3A 2LGDA 3EC8A 4W9EA 3DBSA 2INDC 3IG3A 3NS1A 5JH5C 3WAMA 2HD5B 3SFDB 4ANVA 4L2YA 1TKEA 2XNAC 3O65B 4WJNA 2JYTA 3R7RA 5BO4B 1MFWA 1XXGA 1XO3A 3NS8A 2BYTA 4A20A 4YL8A 1E7PB 1PFDA 2LXCA 4IWQA 1N5XA 4NPNA 4O1NA 2ICIA 3VAWA 1ET6A 4DHZE 1EU4A 1XCTL 1D5MC 1N63A 5HG2A 1YQ4B 1CJEA 4YTMB 2WGSA 1P9DU 3A33B 4OHJA 5KHQA 3H8HA 1KTKA 1N61A 2K3UA 2NVUI 2LRWA 3MC8A 4WJOA 2LVOA 4RF0A 2W3RA 3R2IA 4P6VF 4WAFA 3ZNZB 4G0NB 2N1WA 4A3OA 4XYCA 2VH2A 3S2AA 4XDDA 2JU6X 2W82A 3N9YC 2PMVA 4KSKC 1UH6A 3GZNB 2D10A 2OEDA 3MC0B 1SE3A 4NY0A 4WH4A 1PGXA 1UWXA 4GOCA 2LWPA 3ZJUA 2NCNA 2QCZA 3NY5A 2CJOA 2PEAA 2AEHA 2IO3B 5I4DA 1QZEA 3QC8B 2CJNA 1VRAB 1MG4A 1V81A 1J7BA 1UF0A 1SE4A 3HIZA 1T0RC 2KN4A 3H7SA 3JSVB 3E9SA 2RPQA 1SIFA 3AB5A 1YIWA 2KX3A 2L76A 5J18A 3VTWA 4DXFA 1QOGA 1P7FA 4S0RA 2H88B 4JWSC 1WIAA 5FKAC 2BTEA 1WXSA 2HTME 4RCOA 4BKSA 4E71A 3GB1A 1IYFA 2WXOA 2LGIA 1I4HA 1FEHA 1RFKA 1KFYB 4YT0B 1J7AA 4GN1A 1NYRA 4IOIE 1OQRA 2EKIA 3P42A 2JX5A 2UU7A 2K25A 2NBUA 2ZNVB 4C7YA 4AJWA 4US9A 2HE7A 3Q3MC 4C80A 4FN2A 1AWDA 2BWFA 3HVDA 3VVWB 3W5VB 1H4RA 2L32A 1EM7A 2JYEA 2V4IB 5AUIA 4A3PA 3PZ8A 1WGRA 2ZEQA 1C1YB 4IWPA 2W55A 1ZXHA 3A4RA 3RD2A 3PTFC 4W9GA 2G4SA 1F0ZA 3EHVA 2O6VD 2NTSA 2MQJA 4GLSC 4MJSA 3DBHB 3QA8A 1E8XA 1JWBD 1S1QB 1WFYA 4MGYE 5G2NA 2JWZA 4JX1C 4ANUA 4DDID 4MH8A 3I3TB 2BS2B 1VJKA 2NTTA 1S3SG 3LB8C 4KDIC 2IGGA 2JVCA 1OGWA 1FXAA 3BVZA 3KLSX 2GLSA 1I42A 4TSSA 3VUYA 1ZXIA 2KT7A 2VRRB 1WH3A 1TS5A 3A9KA 2JSVX 1GC7A 2BWES 5GXGB 5HHDG 2KDBA 4C00A 2J0MA 2C7MB 2Y3AA 3SU8X 1ET9A 4XE0A 2Z59B 3L13A 2OJWA 2GB1A 1YQBA 3PGEA 4N59A 1NI3A 3B2FA 4I6NB 5IKCM 4IDIA 2E3TA 3N20C 3QHTA 4P16A 4B0MA 3HHMA 4QAYA 3DHGC 3PO0A 5D7GA 2DLBA 3PRMB 1FFUA 2WHIA 1LXDA 2RDHA 3DWGC 2D5GA 4IM0A 3GOEA 3RPFC 2INPE 4A6QA 3FILB 2LHEA 4W9DA 5CTRC 1KJTA 4BZAA 1JW9D 1J0GA 2BF8B 1T0YA 2MX2A 2ZPNA 1E7UA 1JRPA 2XBBC 3I57A 3ZDTA 2OHFA 1I4RA 4HK2A 2QJLA 1LQBA 1V49A 4HLEA 4PS7A 3PLUA 3X0WA 5J17A 4GDKA 1I4GA 1L0XB 1UBQA 1LGRA 1GPXA 2FNJB 1J7CA 4BBNC 2KQSA 1KH0A 1QT9A 2WXNA 1Y56A 3K9OB 1ISNA 2JRHA 2C7HA 3IFWB 2ZW1A 4A9AA 3TIXA 4ZYNA 2V3NA 3V6CB 4M02A 5E6PA 1FIQA 3TJPA 1HA5A 3KWLA 1QF6A 1EUVB 2J0JA 1E0ZA 4YTNB 5BMHA 1DOYA 3H1UA 3LXFA 2UWQA 3B0AA 5H8YE 4EKUA 3ZRFA 1UWMA 3ZJVA 1OQQA 4L1BA 2K6QA 3QARA 1ZP0B 4C4VB 4FADA 1SF0A 3MJ5A 4A8XC 1JWUD 3AI5A 4RH6A 1ZDVA 2A4ZA 4LK0M 4FJZA 4J6IA 5HKHA 3SD5A 4TMAB 2WX1A 4IKGA 3SHQA 2BVCA 2G1EA 3NHEB 3M62B 2IZVB 4ZHOA 3RNAC 1E7VA 2N7DA 4NZLB 4A90A 1KLVA 2WXGA 2DZIA 1HZ6A 4USAA 1K8RB 3BYYB 2Y5BB 4LLGM 2KDFB 2K5PA 5JHAA 2XK5B 1WZ0A 2W3SA 2BT6A 1C78A 1NI2A 3WAPA 1YN5A 2RR9A 3N1ZC 3PHXB 4AWJA 2O2VB 2GBMA 3KVFB 1HE8A 1QQRA 2INCC 1VDVA 2IJ0A 1A70A 1J8CA
chains in the Genus database with same CATH topology
1BMLC 5BMGA 1SEBD 4JWUC 2VZKB 4YWGG 5JXVA 3BIID 1ZE3D 3FAHA 2IPKD 1V1PA 3AE3B 4HRSA 1MHXA 4WWMA 2LJIA 1D5XC 2LHDA 3LYYA 1CK1A 3AEAB 1AN8A 2BB6A 3AEFB 3SEBA 4MT5A 2AQ1B 1QKZA 3NZ3A 4TQ0A 5HI1A 3Q8CA 1YN4A 4KKIA 1FNVA 2MH7A 1GB1A 2JQRB 1ESFA 1MHHE 3AE1B 3UI3A 4YXDB 3AE8B 5BYSA 3AEGB 2KAJA 2WDVB 3IT4B 1DOIA 1IBXB 5TSSA 3CWIA 1L4DB 3NS1A 1B1ZA 3SFDB 4L2YA 1TKEA 1PGBA 1N5WA 5MPOA 2XNAC 2WDRB 2JYTA 1ROEA 2GRIA 3T3OA 2LFIA 1XXGA 2QSDA 3IAM1 1XO3A 3AE9B 1YJIA 5D3DA 2BYTA 1MI0A 4RGTA 2DYMA 1E7PB 4RFBA 1PFDA 3U7ZA 1NYQA 3J9CA 1N5XA 3MFGA 1V1OA 1WGKA 1AW7A 4O1NA 4H2AA 2FE8A 2ICIA 1XLQA 1ET6A 3R8BA 3AEDB 1EU4A 5E6JA 1NVID 1XCTL 1D5MC 1N63A 3ZGZA 1T5XD 1YQ4B 5HG2A 1B9RA 1CJEA 4YTMB 1QOBA 4C56C 1IBXA 4OHJA 1KLUD 3H8HA 3P1MA 2H89B 1PYWD 1DOXA 1KTKA 2KMMA 2SAKA 2TSSA 1N61A 3BK2A 5D3IB 2J52A 2K3UA 1F77A 4YSYB 1L0YB 2G9HD 1PUTA 1PDXA 4RF0A 2W3RA 3R2IA 4P6VF 3BK1A 1OFFA 1FFVA 4UDUC 4WAFA 4YSXB 3NUHB 1FRDA 1YMHE 3ZYYX 3KQ4A 3NVYA 2BW2A 1FD6A 4US8A 1RYJA 4XDDA 2RPVA 2JU6X 2W82A 3N9YC 2PMVA 4RGNA 3AM9A 3EGRA 2W54A 5FK9C 2CU3A 4JE3B 2MEKA 3P63A 2PVGC 3BVMA 4TQ1A 3VRAB 1SIJA 2OEDA 4YTPB 5BYRA 1L6VA 3NVVA 3MC0B 1SE3A 4OVZA 1ZUD2 4HJGE 4WH4A 3ZQ4A 2ON8A 1ZDXA 2DBYA 1PGXA 1UWXA 3ZJUA 2ACZB 4A55A 2K9XA 2CJOA 4N58A 1EWYC 2DWQA 3O13A 1JQ4A 4OZAA 2PVOD 5I4DA 1D4BA 2QEJC 2BB5A 2N9KA 2L83A 1FMAD 2CJNA 1TZOA 1VRAB 1I7HA 4C7ZA 5FR3A 5C2TB 1T3QA 2AX5A 1F2RI 1J7BA 4R3DA 1QOAA 1SE4A 2KN4A 1JWAD 4HROA 3BWUD 3E9SA 2MJ3A 4MM3B 3AB5A 1KF6B 3VR8B 2WQYB 1D5ZC 3AMZA 2LEKA 2WXQA 1HXYD 3DWMA 4D2KA 4ARCA 5H92C 4DXFA 3P4RB 1I4XA 1UUPA 1QOGA 1P7FA 2WXJA 2H88B 1PGAA 4JWSC 1SXTA 3AE5B 5FKAC 2BTEA 5EE3A 1HZ5A 2X38A 1TS4A 1FNUA 1VZ6A 2L52A 4AS1A 2HTME 2ONQA 1I4QA 1IUEA 4RCOA 4ZYSA 3MP9A 3VQIA 3GB1A 3AE2B 2WXOA 3TEXA 1K52A 2LGIA 1XF5L 1I4HA 4NJCA 3U52E 4HKQA 1JCKB 1FEHA 1JMLA 1RFKA 1KFYB 3AE4B 4L23A 4YT0B 1J7AA 1RWSA 5HFYA 1NYRA 4IOIE 5T8IA 1FRRA 2EKIA 1OQRA 1K51A 3IXSA 3P42A 5C3JB 1V8CA 2JX5A 1C9FA 1XEEA 1C79A 2BBCA 4C7YA 5G5HA 2QILA 2IGDA 4US9A 3Q8BA 3PZ7A 3RFZB 4B0EA 4C80A 1AWDA 3BVGA 3HVDA 3W5VB 5EE9A 2L32A 1BXTA 2FUG1 1TY0A 3AECB 1EM7A 1TYGB 2JYEA 3CIRB 2V4IB 3GS2A 5EE1A 2WXLA 4MACA 1IGDA 3ZJTA 3T3NA 5AUIA 4KGTA 3PZ8A 4DXGA 1GAQB 2K0PA 3AEBB 4KGSA 2PKOA 4Q2JA 3VRBB 2W55A 1C77A 1ZXHA 1IGCA 1XCQL 2IGHA 4HKZE 1Q10A 4OZCA 3SR6A 4DQOC 1F0ZA 1C76A 1R7SA 3IAS1 2JXTA 2NTSA 1SSNA 4WQMA 1TS3A 2WLBA 1VZ8A 4XWTA 1FCLA 1WSPA 4GLSC 2B76B 1E6EB 3TSSA 3E56A 4ZRPA 1JWBD 1K50A 2J4XA 4JX1C 4ITKA 4MH8A 3ABVB 2PW9A 2WXFA 2M19A 2BS2B 1VJKA 2NTTA 3P4PB 3LB8C 1QILA 2IGGA 2WNMA 3AN1A 1ACCA 1I4PA 2I2YA 2N9LA 3TEYA 1FXAA 3BVZA 3KLSX 3AEEB 3SFEB 4KKJA 2FBWB 1JROA 2EELA 4TSSA 1ZXIA 2SEBD 3OWEB 3Q69A 1ZPSA 2YEPF 2XN9C 1TS5A 3EUB2 1GOZA 1L6UA 2QIEB 2JSVX 5GXGB 1V97A 5HHDG 3FC4A 2DYOA 2MJEA 3BYTB 1EWCA 1YN3A 2Y3AA 1MPEA 3VR9B 2J53A 2Q5WD 1ET9A 4XE0A 2M56B 4JPSA 3I9V1 3P4QB 2N7JA 2GB1A 4N59A 2Y5CA 1SBBB 4RGOS 1E9MA 1NI3A 3AH7A 1VLBA 3B2FA 5EE0A 2E3TA 4IDIA 3NRZA 1TY2A 1T6BX 1AYFA 3BZDB 4P16A 4XWWA 3KWVA 1DGJA 1FXIA 3C8YA 4B0MA 3Q8FA 1MVKA 1NEKB 3HUIA 3PO0A 5D7GA 3W2DA 2DLBA 2WXKA 1FFUA 5BMIA 2RDHA 3U4EG 1C4CA 1TKGA 3DWGC 5AUKA 3Q8AA 1HEZE 5G5GA 1SE2A 2D5GA 2PLPA 4HEA1 4J3OD 2N0SB 3RPFC 2INPE 4A6QA 3FILB 3P4SB 2LHEA 3IT6B 1JW9D 3ETRA 2ZW0A 2LMCA 2L1AA 1JRPA 4YSZB 1XLNA 3I57A 1XLOA 1FM0D 1FCCC 2OHFA 2RMMA 1SJED 2Z8LA 1I4RA 2QJLA 1CQVA 3W9CB 1KLGD 3B9JA 2WU5B 1FO4A 1I4GA 4ARIA 1L0XB 1WWTA 3WCQA 3NVWA 4LTUA 1GPXA 3R2TA 1J7CA 2WXIA 1KH0A 1CZPA 1GB4A 1D6EC 2I38A 1QT9A 2WXNA 1WRIA 4NAMA 1Y56A 2WXMA 2HDEA 1RM6C 4WURA 2Y5PA 3FILA 2GI9A 2LUMA 3W1SA 4FXCA 4WIPA 1L5PA 1NENB 2AQ2B 4KX6B 3L4PA 2ZW1A 4A9AA 4RNAA 2V3NA 2KDMA 1N62A 1VR9A 1YQ3B 3TEZA 2R61A 3EA6A 3NVZA 1FIQA 4GDLB 1HA5A 2WP9B 3KWLA 1TKYA 1QF6A 4OZBA 1E0ZA 3URYA 1QLBB 4YTNB 1K53A 2PTLA 5BMHA 3TEWA 1KRHA 1DOYA 1F2RC 1YNTE 2YEPB 3LXFA 3U2SC 2E6XA 4N6EB 5H8YE 3V3XA 1STEA 4REZA 2QMTA 1WYGA 1TS2A 1UWMA 3ZJVA 1OQQA 4L1BA 1L0VB 5LNK1 4ZHPA 3GP7A 1UGJA 1EU3A 2KQ4X 2NMQA 2WXRA 1ZP0B 4RGMA 1P7EA 2AQ3B 1ENFA 1SF0A 2WXPA 3MJ5A 1DYQA 1JWUD 4A8XC 4ZRQA 1JALA 1ZDVA 4LK0M 4RH6A 4OW0A 1XLPA 2VZKD 1E10A 2RDGA 3W5UB 1HQRD 1YJJA 4TMAB 1WXQA 3B2GA 4IKGA 4RF1A 2WDQB 2G1EA 1SJHD 1JWSD 1C4PA 4ZHOA 4NZLB 2M0AA 4A90A 4PT5A 2KWDA 2WXGA 2PIAA 1SB3C 1HZ6A 4M0WA 4USAA 1N60A 4NAWB 3TUOA 3V05A 1C4AA 3Q8EA 1V1PB 1BUIC 3BYYB 4LLGM 2MJDA 5BYQA 2K5PA 4AQ7A 4CQNA 2WU2B 1QOFA 2K22A 2WS3B 3AV8A 1TJEA 2WXHA 2V0GA 2V3PA 2W3SA 3HRDD 4KGRA 2BT6A 1L4ZB 2JWUA 2JZPA 2BS4B 2INNE 4GDKB 1FNWA 1C78A 3AE6B 1UNSA 1M4VA 1YN5A 2IDYA 1VZ7A 3HVZA 4XDCA 4ZOHC 2KACA 1QQRA 1ZOYB 4EE2A 1VDVA 3AE7B 1LO5D 1JWMD 2BS3B 2IJ0A 3MHZA 1A70A 2J42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMG A;  1K50 A;  1KH0 A;  1GB4 A;  5JXV A;  2I38 A;  4OZA A;  1D4B A;  2PW9 A;  2N9K A;  3FIL A;  1MHX A;  1F2R I;  2LHD A;  2GI9 A;  2LUM A;  2IGG A;  2KN4 A;  2I2Y A;  1QKZ A;  2N9L A;  2ZW1 A;  5HI1 A;  2KDM A;  2EEL A;  1GB1 A;  1MHH E;  3UI3 A;  4D2K A;  4OZB A;  1IBX B;  2JSV X;  1K53 A;  1P7F A;  2PTL A;  5HHD G;  5BMH A;  1PGA A;  1F2R C;  1PGB A;  1YNT E;  3V3X A;  1MPE A;  2J53 A;  2QMT A;  1HZ5 A;  2QSD A;  2ONQ A;  3MP9 A;  3GB1 A;  1MI0 A;  2N7J A;  2KQ4 X;  2NMQ A;  2GB1 A;  1K52 A;  2LGI A;  1P7E A;  1XF5 L;  1JML A;  5HFY A;  4IOI E;  1MVK A;  1K51 A;  1XCT L;  4IKG A;  1C9F A;  5HG2 A;  2IGD A;  1IBX A;  5BMI A;  2KWD A;  1HEZ E;  1HZ6 A;  2J52 A;  2PLP A;  1EM7 A;  4MAC A;  1IGD A;  3FIL B;  2LHE A;  4KGT A;  2ZW0 A;  1YMH E;  2K0P A;  4KGS A;  1FD6 A;  4KGR A;  2RPV A;  2JU6 X;  1ZXH A;  2JWU A;  1IGC A;  1XCQ L;  2IGH A;  1FCC C;  2JZP A;  2RMM A;  4HKZ E;  1Q10 A;  4OZC A;  2OED A;  4HJG E;  2JXT A;  4WH4 A;  2ON8 A;  2KAC A;  1PGX A;  1UWX A;  1FCL A;  4GLS C; 
#chains in the Genus database with same CATH topology
 4IG7 B;  4AUQ C;  2VZK B;  4G3X B;  4YWG G;  5JXV A;  4NAW A;  3FAH A;  4HRS A;  4MH0 E;  4LDT B;  1D5X C;  1KOT A;  3MHS D;  3C19 A;  1WJN A;  2BYF A;  2JRI B;  5CHV C;  4PK1 A;  3NZ3 A;  5HI1 A;  3KH0 A;  2J0K A;  2MH7 A;  1GB1 A;  1ESF A;  2KXJ A;  3AE1 B;  4II2 B;  3IT4 B;  2KAJ A;  1L2N A;  1IBX B;  1B1Z A;  3DBR I;  3Q3F A;  2UYZ B;  3QJZ A;  3AU5 A;  4XGA B;  1F9J A;  3L54 A;  3L08 A;  1YX6 B;  2ZCC A;  4HCN B;  1YJI A;  5D3D A;  2GBJ A;  4RGT A;  2DYM A;  4AP4 C;  2D07 B;  3RNF C;  1R4M I;  3U7Z A;  1NYQ A;  2RSU A;  2ZCB A;  1WGK A;  2JF5 A;  3VUX A;  2FE8 A;  3U30 A;  3R8B A;  3AED B;  2IO0 B;  3ZGZ A;  4TUU A;  2LJ5 A;  4E74 A;  1B9R A;  4NQK E;  2H89 B;  4X57 B;  3BK2 A;  5AEK B;  2KVR A;  4IM2 A;  3TL5 A;  2G9H D;  4FHK A;  1YX5 B;  4YSX B;  3NUH B;  3ZYY X;  3KQ4 A;  1ZW7 A;  2KX0 A;  2BW2 A;  2C5L C;  2MBH A;  4US8 A;  1RYJ A;  3RI7 C;  2Z0D B;  1WE6 A;  2K6D B;  2PVG C;  5BYR A;  4YTP B;  1SGH A;  4OVZ A;  2AWT A;  1ZUD 2;  3ZNH B;  2KHW B;  1RLF A;  2KD0 A;  2DBY A;  1TT5 B;  3CF6 E;  2M17 A;  2DX5 B;  2DWQ A;  3O13 A;  4OZA A;  2PVO D;  2KAN A;  2KWV B;  3PSE B;  2L83 A;  1FMA D;  1Q5W B;  4C7Z A;  1T3Q A;  4R3D A;  3QX1 A;  3BWU D;  3TCA A;  2MJ3 A;  4BBN F;  2PPH A;  4G50 A;  4LJO B;  1D5Z C;  1HXY D;  4ARC A;  4DWF A;  1F52 A;  3P4R B;  1I4X A;  1UUP A;  2KVZ A;  2WXJ A;  2N4F A;  3AE5 B;  3NOB A;  2L52 A;  2ZVN A;  2LAS A;  4ZYS A;  4M01 A;  3PRE A;  5E6N A;  4IM3 A;  1XF5 L;  3U52 E;  3WAL A;  1JCK B;  1P3Q U;  4HJK A;  1JML A;  4HPL B;  4MM3 A;  4L23 A;  4W9C A;  5T8I A;  1TTN A;  2B3A A;  2FCM A;  1K51 A;  2KO3 A;  5C3J B;  1C9F A;  2BBC A;  4LNO A;  3V60 A;  2QIL A;  3A1Q A;  4B0E A;  1HTO A;  2RDB C;  2DHZ A;  5EE1 A;  1WGH A;  4JGH B;  3T3N A;  2K8H A;  2L00 B;  4KGT A;  2VH1 A;  2Z0E B;  5D2M B;  2KN5 A;  1GC6 A;  1WGD A;  4Q2J A;  3RNG C;  1C77 A;  2FCS A;  1IGC A;  1XCQ L;  2IGH A;  1Q10 A;  3SR6 A;  2KMA A;  3VHT C;  2JXT A;  1N6Z A;  1SSN A;  2JZZ A;  3DHH C;  3NZU A;  1TS3 A;  4WQM A;  1D3Z A;  1UBI A;  1VZ8 A;  1WSP A;  2DNF A;  3I63 C;  3H9D A;  1E6E B;  3Q3N C;  1WI0 A;  2J4X A;  2KJH B;  2WXF A;  4FUL A;  1QIL A;  2WNM A;  3AN1 A;  1I4P A;  2I2Y A;  2CHZ A;  1Z2M A;  2K1F A;  3H6N A;  3Q2A C;  4LNI A;  4JL9 A;  4KKJ A;  2MCN B;  2EEL A;  3T9L A;  2SEB D;  4ZRJ A;  3Q69 A;  1WR6 E;  3EUB 2;  1L6U A;  3DHI C;  2EMT A;  5C1Z A;  1V97 A;  3BYT B;  1EWC A;  1MPE A;  1XD3 B;  3ZLZ A;  2R2O A;  2KTR A;  5E6O A;  3RMK C;  3X23 A;  1V2Y A;  2N7J A;  5FR6 A;  1VLB A;  2NPT B;  1M94 A;  1T6B X;  4HCP B;  1WM2 A;  3DVG X;  4HDO A;  2WXK A;  4LNK A;  4K3B A;  5BMI A;  4NJ6 A;  2HTH A;  3MC9 A;  4IWO A;  3PLV A;  1ZKH A;  1WMH A;  1IP9 A;  3IT6 B;  2W9N A;  3L10 B;  3UIO B;  3ZTC A;  2IY1 B;  5DPS A;  2O6V A;  5LLI A;  2ZW0 A;  2LMC A;  2KFK A;  2L1A A;  3A9J A;  2KFJ A;  3ZXR A;  4YSZ B;  3N1X C;  2MRP A;  1SJE D;  3EFC A;  4KIK B;  4F1S A;  1KLG D;  4N9F 4;  1FO4 A;  4ARI A;  2LGY A;  4LTU A;  2IO1 B;  3QWZ B;  3ZW3 A;  2WXI A;  2M1M A;  1EF1 A;  2L0T A;  4I6L B;  1CZP A;  4DHZ B;  2PE6 B;  4KV2 A;  2HDE A;  1V5O A;  3HM3 A;  4WAA A;  4WUR A;  1YOV B;  3BIN A;  3W1S A;  4FXC A;  4KZC A;  4KX6 B;  3EFU A;  4M8N A;  2GOW A;  1N62 A;  1YQ3 B;  4NNJ B;  2R61 A;  1LFD A;  4GDL B;  2CHX A;  2WDT B;  1V5T A;  2KDI A;  4MGI E;  3N3K B;  3RNE C;  4MDK E;  2A5U A;  2GMI C;  2GBR A;  1F2R C;  1YNT E;  2JXX A;  4WJP A;  4M0W B;  2E6X A;  4N6E B;  1GUA B;  2KLC A;  3L17 A;  4REZ A;  4P1B C;  1L0V B;  1XQQ A;  3VFK A;  2RGF A;  2V9H A;  3H7P A;  1EU3 A;  1WJ4 A;  4B95 A;  3UIN B;  5IO9 A;  2LUE A;  2AQ3 B;  4HVB A;  4XC2 A;  3PHW B;  4JLC A;  2VZK D;  2C9W B;  4TV3 A;  1YJJ A;  2MBQ A;  3Q6B A;  3V6E B;  3B2G A;  4RF1 A;  4LDT D;  3DBL I;  1JWS D;  3OAW A;  2CS4 A;  4PT5 A;  4GU2 A;  2KWD A;  3DQV A;  1C4A A;  3Q8E A;  3APD A;  2PE9 A;  2BYE A;  3IHP C;  4KVG B;  4CQN A;  4AQ7 A;  2WU2 B;  3U8Z A;  4AJY B;  3L16 A;  2WXH A;  1C3T A;  1GJZ A;  1L4Z B;  2D3B A;  2INN E;  1UZX B;  1M4V A;  2MW5 A;  2IDY A;  1VZ7 A;  2KK8 A;  2FAZ A;  3N32 A;  1ZOY B;  2AL3 A;  1LO5 D;  1JWM D;  4DHJ B;  2J42 A;  3BII D;  1ZE3 D;  1WXV A;  1CMX B;  1WXA A;  1V1P A;  4II3 B;  1MHX A;  1CK1 A;  1AN8 A;  3CMM B;  1I35 A;  2N9E B;  3SEB A;  4HPP A;  4PS3 A;  1QKZ A;  2KJR A;  4PS8 A;  4RM8 A;  4TQ0 A;  3Q8C A;  1WX8 A;  4KKI A;  1FNV A;  1TIF A;  3ML9 A;  2L8J A;  1OEY A;  1MHH E;  3FKY A;  4YXD B;  5BYS A;  3AE8 B;  3ALB A;  1DOI A;  2KLG A;  1E5W A;  3CWI A;  4MSM B;  1VD2 A;  1N5W A;  5MPO A;  2WDR B;  1NBF C;  1ROE A;  2GRI A;  4W9L A;  3DCG A;  2LFI A;  2QSD A;  1FXT B;  5DCN A;  3M3J A;  4FA6 A;  4BAX A;  4RFB A;  3J9C A;  1V1O A;  1AW7 A;  2I1K A;  4BOS C;  1T5X D;  3RNB C;  1QOB A;  1KLU D;  3PPA A;  2OOB B;  1PYW D;  2KMM A;  2SAK A;  2TSS A;  5D3I B;  4YSY B;  1PUT A;  1PDX A;  4EZK A;  3RZF A;  1FFV A;  4W9H A;  3JW0 X;  4W9J A;  3NVY A;  1FD6 A;  3HM6 X;  2G45 B;  4RGN A;  3AM9 A;  4GMV A;  2AL6 A;  2CU3 A;  4JE3 B;  2MEK A;  3P63 A;  4TQ1 A;  2L3Z A;  1SE9 A;  3OJ4 B;  3ZO5 B;  1L6V A;  4HJG E;  3VDZ A;  3ZQ4 A;  5IA7 A;  1Q0W B;  1ZDX A;  5J2R A;  4GIV A;  1WY8 A;  1NDD A;  2V3S A;  4A55 A;  2K9X A;  3A4S C;  5AZF A;  2ZPY A;  3DVG Y;  1EWY C;  1R4N I;  2N9K A;  1TZO A;  3DBL B;  1I7H A;  3ZTD A;  2REX A;  1G6J A;  2MWS B;  2LVQ A;  4RMA A;  2CHW A;  1KF6 B;  4IW0 A;  5L95 C;  5CHW A;  2WXQ A;  3DDC B;  3DWM A;  4D2K A;  1PGA A;  4FHJ A;  2CU1 A;  2LZ6 A;  2BGF A;  5EE3 A;  4S17 A;  2ZZP B;  5JHB A;  1TS4 A;  1FNU A;  1VZ6 A;  4AS1 A;  4WWN A;  2JPH A;  1I4Q A;  4EUT A;  3MP9 A;  3VQI A;  3AE2 B;  3TEX A;  2MBE A;  2K8B A;  3WAN A;  4HKQ A;  3JSV A;  2IO2 B;  5HFY A;  3M95 A;  2MSE D;  3LJ3 A;  4WQO B;  3QQ8 B;  2LRU A;  3Q8B A;  3RYT A;  3ML8 A;  4MJS B;  1TGZ B;  5EE9 A;  2D3G A;  3AEC B;  1E90 A;  1BXT A;  2FUG 1;  1TY0 A;  2JT4 B;  1TYG B;  3GS2 A;  3UF8 A;  3Q3O C;  4MAC A;  1IGD A;  1AAR A;  4ICV A;  2OJR A;  4DXG A;  3VH3 B;  3U7D A;  2K0P A;  4DK5 A;  4KGS A;  2PKO A;  2KWC A;  4URK A;  2GBN A;  1MG8 A;  4OVV A;  2DZK A;  4OZC A;  3ZRC A;  4DQO C;  4K3C A;  3RCZ A;  3JYU A;  4W9F A;  3A9K B;  4P7I A;  2I1J A;  3RUI B;  4HDQ A;  2WLB A;  1A5R A;  4XWT A;  1OQY A;  2B76 B;  4ZRP A;  1K50 A;  4AOF A;  4ITK A;  4W9K A;  2PW9 A;  4TKN A;  4BKG A;  4XZ4 A;  1V86 A;  1ACC A;  2N9L A;  4KDL B;  3AEE B;  3SFE B;  4MEL A;  2FBW B;  4EZJ A;  5DPR A;  3OG5 A;  2L05 A;  3W1Y A;  1V6E A;  2BPS A;  4OVU A;  3VXW A;  3OWE B;  3R66 C;  1ZPS A;  2YEP F;  2XN9 C;  3UQB A;  1GOZ A;  2FCQ A;  4CHK A;  2QIE B;  3GE3 C;  4FLH A;  3IBE A;  4IUM B;  2DAF A;  3NZS A;  2MJE A;  1Q1O A;  1WJU A;  2MA9 B;  1YN3 A;  2BYV E;  3VR9 B;  2LI5 A;  3OLM D;  2KC2 A;  4JPS A;  3I9V 1;  1T0S C;  2D3A A;  2Y5C A;  1SBB B;  1GG3 A;  3ZUN A;  4RGO S;  1E9M A;  3T8M A;  3AH7 A;  5EE0 A;  3KWV A;  1FXI A;  3C8Y A;  1FPY A;  1MVK A;  4MSQ B;  1NEK B;  3HUI A;  2D3C A;  3QIJ A;  2CKH B;  1P0R A;  3Q8A A;  5G5G A;  1SE2 A;  4HEA 1;  4J3O D;  2N0S B;  2IBI B;  3WAO A;  2DEN B;  3P4S B;  4LJP B;  4NQL B;  1Y8R C;  1XLN A;  3P2B A;  2MLB A;  1XLO A;  1FM0 D;  2RMM A;  5EDS A;  4KZ0 A;  2Z8L A;  1WXM A;  1CQV A;  3R7Q A;  4M00 A;  3W9C B;  2WU5 B;  1WWT A;  3WCQ A;  4ANW A;  3R2T A;  2PJH A;  4EFO A;  1P1A A;  1D6E C;  2I38 A;  4F7Z A;  4NAM A;  3PS6 A;  2M0X A;  3DBR B;  1WZ3 A;  3KW5 B;  3FIL A;  2GI9 A;  2V4L A;  4WIP A;  5JZE B;  1L5P A;  1NEN B;  1VCB A;  3HK0 A;  5LXH A;  2KDM A;  1VR9 A;  3LDZ E;  2N7E A;  1R4M B;  2DYB A;  3EEC A;  2WP9 B;  1TKY A;  2BKR B;  3DBH I;  4HXD A;  4OZB A;  1K53 A;  2PTL A;  3MTN B;  4K7U A;  4BFR A;  3U2S C;  2DZJ A;  3V3X A;  2ASQ A;  3PVL A;  2IYD B;  1WRD B;  2D11 A;  4P1C C;  3KUD B;  3V62 A;  2NMQ A;  4RGM A;  1P7E A;  4FJY A;  2D2Q A;  2WXP A;  1WYW B;  4DHJ D;  1XT9 B;  3DVN U;  1JAL A;  3DVN V;  1XLP A;  1U4A A;  4ZDV A;  1E10 A;  2K8C A;  2RDG A;  3UGB B;  4KSL C;  2KTF A;  2YVC A;  1MJD A;  1C4P A;  2KMC A;  2MP2 B;  3OJ3 A;  4B9K A;  1SB3 C;  2N9X A;  4NAW B;  3TUO A;  3V05 A;  2GBK A;  1BUI C;  3RN9 C;  2MJD A;  3ZDM C;  3AXC A;  5BYQ A;  1QOF A;  2K22 A;  4EEW A;  2KNB A;  1TJE A;  4I6P A;  2V3P A;  4KGR A;  3HRD D;  4C4V A;  1BT0 A;  3PV1 A;  3B08 A;  2JWU A;  2KDE B;  4G11 A;  2JUO A;  2JZP A;  2BS4 B;  3AE6 B;  1UNS A;  1OEY J;  3HVZ A;  4ZOH C;  2M8S A;  3AE7 B;  2BS3 B;  1BML C;  5BMG A;  1SEB D;  4JWU C;  3KYD D;  5DPW A;  3AE3 B;  3Q3J A;  1UD7 A;  5IAA C;  4WWM A;  2LHD A;  3LYY A;  3AEA B;  2BB6 A;  3AEF B;  2C7N B;  2C60 A;  2R2Q A;  2AQ1 B;  2XK5 A;  1E8W A;  3UQA A;  2RD0 A;  1YN4 A;  3L0W B;  3DOW A;  2EKE C;  4CO7 A;  4RM9 A;  1TZ1 A;  2JQR B;  2FUH B;  3Q14 C;  3AEG B;  2WDV B;  2O2V A;  1EF5 A;  2N1V A;  5TSS A;  1L4D B;  1PGB A;  2AYO B;  3ZVV A;  2NBW B;  3T3O A;  3ENE A;  5CX3 A;  3IAM 1;  2MHJ A;  2JY6 A;  3AE9 B;  3RT3 B;  1GNU A;  1MI0 A;  1IPG A;  2KZR A;  4DXA B;  2DZM A;  3MFG A;  4H2A A;  2V1Y A;  4LCD E;  1XLQ A;  2G3Q B;  3WA0 A;  5E6J A;  1NVI D;  4BKS D;  4BVU C;  3PRZ A;  4C56 C;  1IBX A;  5DPT A;  3P1M A;  1DOX A;  2J52 A;  1F77 A;  1V9J A;  1L0Y B;  4MGZ E;  3BK1 A;  1OFF A;  4UDU C;  1H8C A;  1FRD A;  1YMH E;  3W1S C;  1WM3 A;  3RNC C;  3B1L X;  5AZH A;  4JIO U;  1T0Q C;  2DAJ A;  2RPV A;  1YJ1 A;  3EGR A;  2W54 A;  5FK9 C;  3ZKJ C;  4LNN A;  2MBB B;  3BVM A;  3VRA B;  1RRB A;  1SIJ A;  3NVV A;  1J19 A;  2ON8 A;  3RUL A;  4K7S A;  4WWP A;  4MGK E;  4GSW A;  1TBE A;  2ACZ B;  4ACF A;  4N58 A;  2XEW A;  3ZNG C;  4PYU A;  1JQ4 A;  5L83 A;  1D4B A;  2QEJ C;  2BB5 A;  2YLM A;  5FR3 A;  5C2T B;  4ANX A;  2AX5 A;  1F2R I;  1QOA A;  3UIP B;  1JWA D;  1WGY A;  4HRO A;  2KOX A;  4MM3 B;  3KYC D;  3VUW A;  3VR8 B;  2WQY B;  3AMZ A;  2LEK A;  2L7R A;  2HJ1 A;  5H92 C;  4B6W A;  3A1Q B;  2HJ8 A;  3N1Y C;  2KQ7 A;  2WWZ A;  3K9P B;  3V61 A;  2L0F A;  1SXT A;  2BKF A;  3VH4 B;  1HZ5 A;  2X38 A;  4JQW C;  1WX7 A;  2ONQ A;  4M8M A;  1IUE A;  2KJ6 A;  3SDL C;  4EOY A;  5IP4 D;  4K7W A;  1E8Z A;  1K52 A;  5KHO A;  2NR2 A;  4NJC A;  4FJV B;  4XX5 A;  1WX9 A;  3AE4 B;  2IY0 B;  1RWS A;  1FRR A;  3IXS A;  1V8C A;  3I5J C;  1XEE A;  1C79 A;  1YD8 U;  2WYQ A;  5G5H A;  3RFZ B;  2IGD A;  5LXI B;  3PZ7 A;  3ECI A;  3BVG A;  4NJ7 A;  3DPD A;  3CIR B;  4K1R B;  2WXL A;  3ZJT A;  1WJ6 A;  1UGM A;  5IOI A;  4BOZ B;  1GAQ B;  3NG0 A;  2FIF A;  3AEB B;  2FID A;  3VRB B;  2ZVO A;  2NBV B;  2M4N A;  3BY4 B;  4HKZ E;  1KM7 A;  1C76 A;  1R7S A;  3IAS 1;  1Z5S B;  1FCL A;  3TSS A;  3E56 A;  1P98 A;  2LGX A;  3ABV B;  2KTR B;  2LVP A;  2M19 A;  2ZJD A;  3P4P B;  1UEL A;  1WGG A;  5G55 A;  4W9I A;  3TEY A;  4ZRK A;  3QCA A;  4EZL A;  1JRO A;  1F1H A;  3QAQ A;  3APC A;  4IC7 B;  3FC4 A;  2DYO A;  5TR5 A;  3VTV A;  2J53 A;  1RFA A;  2Q5W D;  1WMH B;  2MBO A;  3C0R B;  2M56 B;  1WE7 A;  2O6V B;  1L7Y A;  4HWI B;  3P4Q B;  2KFK B;  4FBJ B;  3A9J B;  4K81 A;  3RZW C;  3APF A;  2WX0 A;  3NRZ A;  1TY2 A;  2KYW A;  1AYF A;  1PQS A;  3BZD B;  4XWW A;  1DGJ A;  3Q8F A;  2NS5 A;  5IN7 A;  3W2D A;  5GMV A;  3GE8 C;  3N30 A;  3U4E G;  1C4C A;  1TKG A;  2BQQ A;  5AUK A;  1HEZ E;  1WF9 A;  2KWU B;  2PLP A;  4ICU A;  1WR1 A;  2MP2 A;  3AUL A;  4BKT A;  3ZIM A;  3ETR A;  4MEM A;  4F8C B;  4ASW C;  3NJT A;  3ZNI D;  2QC8 A;  3M63 B;  2EMS A;  2NPT A;  1FCC C;  4DBG A;  3TMP B;  1E8Y A;  2CR5 A;  2J7Q B;  2QHO A;  2K39 A;  3B9J A;  3NVW A;  3ONS A;  2LD9 A;  1GB4 A;  1WRI A;  2WXM A;  1RM6 C;  2KC1 A;  2Y5P A;  4HPM B;  3H7P B;  2LUM A;  2N9P C;  5AZG A;  2AQ2 B;  3L4P A;  4DDG D;  4RNA A;  2KKC A;  4E3C A;  3TEZ A;  3EA6 A;  3NVZ A;  4KIK A;  3MJW A;  1X1M A;  3CST A;  2X8X X;  3URY A;  1EO6 A;  1QLB B;  2JZ3 B;  1RAX A;  3TEW A;  1KRH A;  2YEP B;  4GGQ A;  3AU4 A;  1STE A;  3PRP B;  2QMT A;  1WYG A;  1TS2 A;  3KUZ A;  3GZN I;  3D32 A;  4ZRI A;  5LNK 1;  3ZXV A;  1V80 A;  4ZHP A;  3GP7 A;  1UGJ A;  2KQ4 X;  2WXR A;  1ENF A;  1DYQ A;  4ZRQ A;  4PYZ A;  4OW0 A;  3W5U B;  1HQR D;  1WXQ A;  4GDL A;  2LXA A;  2WDQ B;  1SJH D;  2ZNV C;  3VTU A;  2M0A A;  5CHF A;  3PZD A;  2PIA A;  4M0W A;  1HTQ A;  1N60 A;  1V1P B;  5D94 A;  2WS3 B;  3AV8 A;  1R4N B;  2G4D B;  2V0G A;  5C23 A;  3PT2 B;  1LM8 B;  3JVZ X;  4GDK B;  3QK0 A;  1FNW A;  3TBL D;  3WIM A;  4XDC A;  2KAC A;  4WJQ A;  4EE2 A;  2QDF A;  3MHZ A;  5D6J B;  3R3M A;  3KUC B;  2IPK D;  4LNF A;  2LJI A;  1ZGU B;  2FCN A;  4GB9 A;  4CYE A;  4MT5 A;  1OTR B;  1JRU A;  2LGS A;  3CSF A;  3IVF A;  4GXB A;  4WWO A;  3UI3 A;  2LGD A;  3EC8 A;  4W9E A;  3DBS A;  2IND C;  3IG3 A;  3NS1 A;  5JH5 C;  3WAM A;  2HD5 B;  3SFD B;  4ANV A;  4L2Y A;  1TKE A;  2XNA C;  3O65 B;  4WJN A;  2JYT A;  3R7R A;  5BO4 B;  1MFW A;  1XXG A;  1XO3 A;  3NS8 A;  2BYT A;  4A20 A;  4YL8 A;  1E7P B;  1PFD A;  2LXC A;  4IWQ A;  1N5X A;  4NPN A;  4O1N A;  2ICI A;  3VAW A;  1ET6 A;  4DHZ E;  1EU4 A;  1XCT L;  1D5M C;  1N63 A;  5HG2 A;  1YQ4 B;  1CJE A;  4YTM B;  2WGS A;  1P9D U;  3A33 B;  4OHJ A;  5KHQ A;  3H8H A;  1KTK A;  1N61 A;  2K3U A;  2NVU I;  2LRW A;  3MC8 A;  4WJO A;  2LVO A;  4RF0 A;  2W3R A;  3R2I A;  4P6V F;  4WAF A;  3ZNZ B;  4G0N B;  2N1W A;  4A3O A;  4XYC A;  2VH2 A;  3S2A A;  4XDD A;  2JU6 X;  2W82 A;  3N9Y C;  2PMV A;  4KSK C;  1UH6 A;  3GZN B;  2D10 A;  2OED A;  3MC0 B;  1SE3 A;  4NY0 A;  4WH4 A;  1PGX A;  1UWX A;  4GOC A;  2LWP A;  3ZJU A;  2NCN A;  2QCZ A;  3NY5 A;  2CJO A;  2PEA A;  2AEH A;  2IO3 B;  5I4D A;  1QZE A;  3QC8 B;  2CJN A;  1VRA B;  1MG4 A;  1V81 A;  1J7B A;  1UF0 A;  1SE4 A;  3HIZ A;  1T0R C;  2KN4 A;  3H7S A;  3JSV B;  3E9S A;  2RPQ A;  1SIF A;  3AB5 A;  1YIW A;  2KX3 A;  2L76 A;  5J18 A;  3VTW A;  4DXF A;  1QOG A;  1P7F A;  4S0R A;  2H88 B;  4JWS C;  1WIA A;  5FKA C;  2BTE A;  1WXS A;  2HTM E;  4RCO A;  4BKS A;  4E71 A;  3GB1 A;  1IYF A;  2WXO A;  2LGI A;  1I4H A;  1FEH A;  1RFK A;  1KFY B;  4YT0 B;  1J7A A;  4GN1 A;  1NYR A;  4IOI E;  1OQR A;  2EKI A;  3P42 A;  2JX5 A;  2UU7 A;  2K25 A;  2NBU A;  2ZNV B;  4C7Y A;  4AJW A;  4US9 A;  2HE7 A;  3Q3M C;  4C80 A;  4FN2 A;  1AWD A;  2BWF A;  3HVD A;  3VVW B;  3W5V B;  1H4R A;  2L32 A;  1EM7 A;  2JYE A;  2V4I B;  5AUI A;  4A3P A;  3PZ8 A;  1WGR A;  2ZEQ A;  1C1Y B;  4IWP A;  2W55 A;  1ZXH A;  3A4R A;  3RD2 A;  3PTF C;  4W9G A;  2G4S A;  1F0Z A;  3EHV A;  2O6V D;  2NTS A;  2MQJ A;  4GLS C;  4MJS A;  3DBH B;  3QA8 A;  1E8X A;  1JWB D;  1S1Q B;  1WFY A;  4MGY E;  5G2N A;  2JWZ A;  4JX1 C;  4ANU A;  4DDI D;  4MH8 A;  3I3T B;  2BS2 B;  1VJK A;  2NTT A;  1S3S G;  3LB8 C;  4KDI C;  2IGG A;  2JVC A;  1OGW A;  1FXA A;  3BVZ A;  3KLS X;  2GLS A;  1I42 A;  4TSS A;  3VUY A;  1ZXI A;  2KT7 A;  2VRR B;  1WH3 A;  1TS5 A;  3A9K A;  2JSV X;  1GC7 A;  2BWE S;  5GXG B;  5HHD G;  2KDB A;  4C00 A;  2J0M A;  2C7M B;  2Y3A A;  3SU8 X;  1ET9 A;  4XE0 A;  2Z59 B;  3L13 A;  2OJW A;  2GB1 A;  1YQB A;  3PGE A;  4N59 A;  1NI3 A;  3B2F A;  4I6N B;  5IKC M;  4IDI A;  2E3T A;  3N20 C;  3QHT A;  4P16 A;  4B0M A;  3HHM A;  4QAY A;  3DHG C;  3PO0 A;  5D7G A;  2DLB A;  3PRM B;  1FFU A;  2WHI A;  1LXD A;  2RDH A;  3DWG C;  2D5G A;  4IM0 A;  3GOE A;  3RPF C;  2INP E;  4A6Q A;  3FIL B;  2LHE A;  4W9D A;  5CTR C;  1KJT A;  4BZA A;  1JW9 D;  1J0G A;  2BF8 B;  1T0Y A;  2MX2 A;  2ZPN A;  1E7U A;  1JRP A;  2XBB C;  3I57 A;  3ZDT A;  2OHF A;  1I4R A;  4HK2 A;  2QJL A;  1LQB A;  1V49 A;  4HLE A;  4PS7 A;  3PLU A;  3X0W A;  5J17 A;  4GDK A;  1I4G A;  1L0X B;  1UBQ A;  1LGR A;  1GPX A;  2FNJ B;  1J7C A;  4BBN C;  2KQS A;  1KH0 A;  1QT9 A;  2WXN A;  1Y56 A;  3K9O B;  1ISN A;  2JRH A;  2C7H A;  3IFW B;  2ZW1 A;  4A9A A;  3TIX A;  4ZYN A;  2V3N A;  3V6C B;  4M02 A;  5E6P A;  1FIQ A;  3TJP A;  1HA5 A;  3KWL A;  1QF6 A;  1EUV B;  2J0J A;  1E0Z A;  4YTN B;  5BMH A;  1DOY A;  3H1U A;  3LXF A;  2UWQ A;  3B0A A;  5H8Y E;  4EKU A;  3ZRF A;  1UWM A;  3ZJV A;  1OQQ A;  4L1B A;  2K6Q A;  3QAR A;  1ZP0 B;  4C4V B;  4FAD A;  1SF0 A;  3MJ5 A;  4A8X C;  1JWU D;  3AI5 A;  4RH6 A;  1ZDV A;  2A4Z A;  4LK0 M;  4FJZ A;  4J6I A;  5HKH A;  3SD5 A;  4TMA B;  2WX1 A;  4IKG A;  3SHQ A;  2BVC A;  2G1E A;  3NHE B;  3M62 B;  2IZV B;  4ZHO A;  3RNA C;  1E7V A;  2N7D A;  4NZL B;  4A90 A;  1KLV A;  2WXG A;  2DZI A;  1HZ6 A;  4USA A;  1K8R B;  3BYY B;  2Y5B B;  4LLG M;  2KDF B;  2K5P A;  5JHA A;  2XK5 B;  1WZ0 A;  2W3S A;  2BT6 A;  1C78 A;  1NI2 A;  3WAP A;  1YN5 A;  2RR9 A;  3N1Z C;  3PHX B;  4AWJ A;  2O2V B;  2GBM A;  3KVF B;  1HE8 A;  1QQR A;  2INC C;  1VDV A;  2IJ0 A;  1A70 A;  1J8C A; 
#chains in the Genus database with same CATH homology
 1BML C;  5BMG A;  1SEB D;  4JWU C;  2VZK B;  4YWG G;  5JXV A;  3BII D;  1ZE3 D;  3FAH A;  2IPK D;  1V1P A;  3AE3 B;  4HRS A;  1MHX A;  4WWM A;  2LJI A;  1D5X C;  2LHD A;  3LYY A;  1CK1 A;  3AEA B;  1AN8 A;  2BB6 A;  3AEF B;  3SEB A;  4MT5 A;  2AQ1 B;  1QKZ A;  3NZ3 A;  4TQ0 A;  5HI1 A;  3Q8C A;  1YN4 A;  4KKI A;  1FNV A;  2MH7 A;  1GB1 A;  2JQR B;  1ESF A;  1MHH E;  3AE1 B;  3UI3 A;  4YXD B;  3AE8 B;  5BYS A;  3AEG B;  2KAJ A;  2WDV B;  3IT4 B;  1DOI A;  1IBX B;  5TSS A;  3CWI A;  1L4D B;  3NS1 A;  1B1Z A;  3SFD B;  4L2Y A;  1TKE A;  1PGB A;  1N5W A;  5MPO A;  2XNA C;  2WDR B;  2JYT A;  1ROE A;  2GRI A;  3T3O A;  2LFI A;  1XXG A;  2QSD A;  3IAM 1;  1XO3 A;  3AE9 B;  1YJI A;  5D3D A;  2BYT A;  1MI0 A;  4RGT A;  2DYM A;  1E7P B;  4RFB A;  1PFD A;  3U7Z A;  1NYQ A;  3J9C A;  1N5X A;  3MFG A;  1V1O A;  1WGK A;  1AW7 A;  4O1N A;  4H2A A;  2FE8 A;  2ICI A;  1XLQ A;  1ET6 A;  3R8B A;  3AED B;  1EU4 A;  5E6J A;  1NVI D;  1XCT L;  1D5M C;  1N63 A;  3ZGZ A;  1T5X D;  1YQ4 B;  5HG2 A;  1B9R A;  1CJE A;  4YTM B;  1QOB A;  4C56 C;  1IBX A;  4OHJ A;  1KLU D;  3H8H A;  3P1M A;  2H89 B;  1PYW D;  1DOX A;  1KTK A;  2KMM A;  2SAK A;  2TSS A;  1N61 A;  3BK2 A;  5D3I B;  2J52 A;  2K3U A;  1F77 A;  4YSY B;  1L0Y B;  2G9H D;  1PUT A;  1PDX A;  4RF0 A;  2W3R A;  3R2I A;  4P6V F;  3BK1 A;  1OFF A;  1FFV A;  4UDU C;  4WAF A;  4YSX B;  3NUH B;  1FRD A;  1YMH E;  3ZYY X;  3KQ4 A;  3NVY A;  2BW2 A;  1FD6 A;  4US8 A;  1RYJ A;  4XDD A;  2RPV A;  2JU6 X;  2W82 A;  3N9Y C;  2PMV A;  4RGN A;  3AM9 A;  3EGR A;  2W54 A;  5FK9 C;  2CU3 A;  4JE3 B;  2MEK A;  3P63 A;  2PVG C;  3BVM A;  4TQ1 A;  3VRA B;  1SIJ A;  2OED A;  4YTP B;  5BYR A;  1L6V A;  3NVV A;  3MC0 B;  1SE3 A;  4OVZ A;  1ZUD 2;  4HJG E;  4WH4 A;  3ZQ4 A;  2ON8 A;  1ZDX A;  2DBY A;  1PGX A;  1UWX A;  3ZJU A;  2ACZ B;  4A55 A;  2K9X A;  2CJO A;  4N58 A;  1EWY C;  2DWQ A;  3O13 A;  1JQ4 A;  4OZA A;  2PVO D;  5I4D A;  1D4B A;  2QEJ C;  2BB5 A;  2N9K A;  2L83 A;  1FMA D;  2CJN A;  1TZO A;  1VRA B;  1I7H A;  4C7Z A;  5FR3 A;  5C2T B;  1T3Q A;  2AX5 A;  1F2R I;  1J7B A;  4R3D A;  1QOA A;  1SE4 A;  2KN4 A;  1JWA D;  4HRO A;  3BWU D;  3E9S A;  2MJ3 A;  4MM3 B;  3AB5 A;  1KF6 B;  3VR8 B;  2WQY B;  1D5Z C;  3AMZ A;  2LEK A;  2WXQ A;  1HXY D;  3DWM A;  4D2K A;  4ARC A;  5H92 C;  4DXF A;  3P4R B;  1I4X A;  1UUP A;  1QOG A;  1P7F A;  2WXJ A;  2H88 B;  1PGA A;  4JWS C;  1SXT A;  3AE5 B;  5FKA C;  2BTE A;  5EE3 A;  1HZ5 A;  2X38 A;  1TS4 A;  1FNU A;  1VZ6 A;  2L52 A;  4AS1 A;  2HTM E;  2ONQ A;  1I4Q A;  1IUE A;  4RCO A;  4ZYS A;  3MP9 A;  3VQI A;  3GB1 A;  3AE2 B;  2WXO A;  3TEX A;  1K52 A;  2LGI A;  1XF5 L;  1I4H A;  4NJC A;  3U52 E;  4HKQ A;  1JCK B;  1FEH A;  1JML A;  1RFK A;  1KFY B;  3AE4 B;  4L23 A;  4YT0 B;  1J7A A;  1RWS A;  5HFY A;  1NYR A;  4IOI E;  5T8I A;  1FRR A;  2EKI A;  1OQR A;  1K51 A;  3IXS A;  3P42 A;  5C3J B;  1V8C A;  2JX5 A;  1C9F A;  1XEE A;  1C79 A;  2BBC A;  4C7Y A;  5G5H A;  2QIL A;  2IGD A;  4US9 A;  3Q8B A;  3PZ7 A;  3RFZ B;  4B0E A;  4C80 A;  1AWD A;  3BVG A;  3HVD A;  3W5V B;  5EE9 A;  2L32 A;  1BXT A;  2FUG 1;  1TY0 A;  3AEC B;  1EM7 A;  1TYG B;  2JYE A;  3CIR B;  2V4I B;  3GS2 A;  5EE1 A;  2WXL A;  4MAC A;  1IGD A;  3ZJT A;  3T3N A;  5AUI A;  4KGT A;  3PZ8 A;  4DXG A;  1GAQ B;  2K0P A;  3AEB B;  4KGS A;  2PKO A;  4Q2J A;  3VRB B;  2W55 A;  1C77 A;  1ZXH A;  1IGC A;  1XCQ L;  2IGH A;  4HKZ E;  1Q10 A;  4OZC A;  3SR6 A;  4DQO C;  1F0Z A;  1C76 A;  1R7S A;  3IAS 1;  2JXT A;  2NTS A;  1SSN A;  4WQM A;  1TS3 A;  2WLB A;  1VZ8 A;  4XWT A;  1FCL A;  1WSP A;  4GLS C;  2B76 B;  1E6E B;  3TSS A;  3E56 A;  4ZRP A;  1JWB D;  1K50 A;  2J4X A;  4JX1 C;  4ITK A;  4MH8 A;  3ABV B;  2PW9 A;  2WXF A;  2M19 A;  2BS2 B;  1VJK A;  2NTT A;  3P4P B;  3LB8 C;  1QIL A;  2IGG A;  2WNM A;  3AN1 A;  1ACC A;  1I4P A;  2I2Y A;  2N9L A;  3TEY A;  1FXA A;  3BVZ A;  3KLS X;  3AEE B;  3SFE B;  4KKJ A;  2FBW B;  1JRO A;  2EEL A;  4TSS A;  1ZXI A;  2SEB D;  3OWE B;  3Q69 A;  1ZPS A;  2YEP F;  2XN9 C;  1TS5 A;  3EUB 2;  1GOZ A;  1L6U A;  2QIE B;  2JSV X;  5GXG B;  1V97 A;  5HHD G;  3FC4 A;  2DYO A;  2MJE A;  3BYT B;  1EWC A;  1YN3 A;  2Y3A A;  1MPE A;  3VR9 B;  2J53 A;  2Q5W D;  1ET9 A;  4XE0 A;  2M56 B;  4JPS A;  3I9V 1;  3P4Q B;  2N7J A;  2GB1 A;  4N59 A;  2Y5C A;  1SBB B;  4RGO S;  1E9M A;  1NI3 A;  3AH7 A;  1VLB A;  3B2F A;  5EE0 A;  2E3T A;  4IDI A;  3NRZ A;  1TY2 A;  1T6B X;  1AYF A;  3BZD B;  4P16 A;  4XWW A;  3KWV A;  1DGJ A;  1FXI A;  3C8Y A;  4B0M A;  3Q8F A;  1MVK A;  1NEK B;  3HUI A;  3PO0 A;  5D7G A;  3W2D A;  2DLB A;  2WXK A;  1FFU A;  5BMI A;  2RDH A;  3U4E G;  1C4C A;  1TKG A;  3DWG C;  5AUK A;  3Q8A A;  1HEZ E;  5G5G A;  1SE2 A;  2D5G A;  2PLP A;  4HEA 1;  4J3O D;  2N0S B;  3RPF C;  2INP E;  4A6Q A;  3FIL B;  3P4S B;  2LHE A;  3IT6 B;  1JW9 D;  3ETR A;  2ZW0 A;  2LMC A;  2L1A A;  1JRP A;  4YSZ B;  1XLN A;  3I57 A;  1XLO A;  1FM0 D;  1FCC C;  2OHF A;  2RMM A;  1SJE D;  2Z8L A;  1I4R A;  2QJL A;  1CQV A;  3W9C B;  1KLG D;  3B9J A;  2WU5 B;  1FO4 A;  1I4G A;  4ARI A;  1L0X B;  1WWT A;  3WCQ A;  3NVW A;  4LTU A;  1GPX A;  3R2T A;  1J7C A;  2WXI A;  1KH0 A;  1CZP A;  1GB4 A;  1D6E C;  2I38 A;  1QT9 A;  2WXN A;  1WRI A;  4NAM A;  1Y56 A;  2WXM A;  2HDE A;  1RM6 C;  4WUR A;  2Y5P A;  3FIL A;  2GI9 A;  2LUM A;  3W1S A;  4FXC A;  4WIP A;  1L5P A;  1NEN B;  2AQ2 B;  4KX6 B;  3L4P A;  2ZW1 A;  4A9A A;  4RNA A;  2V3N A;  2KDM A;  1N62 A;  1VR9 A;  1YQ3 B;  3TEZ A;  2R61 A;  3EA6 A;  3NVZ A;  1FIQ A;  4GDL B;  1HA5 A;  2WP9 B;  3KWL A;  1TKY A;  1QF6 A;  4OZB A;  1E0Z A;  3URY A;  1QLB B;  4YTN B;  1K53 A;  2PTL A;  5BMH A;  3TEW A;  1KRH A;  1DOY A;  1F2R C;  1YNT E;  2YEP B;  3LXF A;  3U2S C;  2E6X A;  4N6E B;  5H8Y E;  3V3X A;  1STE A;  4REZ A;  2QMT A;  1WYG A;  1TS2 A;  1UWM A;  3ZJV A;  1OQQ A;  4L1B A;  1L0V B;  5LNK 1;  4ZHP A;  3GP7 A;  1UGJ A;  1EU3 A;  2KQ4 X;  2NMQ A;  2WXR A;  1ZP0 B;  4RGM A;  1P7E A;  2AQ3 B;  1ENF A;  1SF0 A;  2WXP A;  3MJ5 A;  1DYQ A;  1JWU D;  4A8X C;  4ZRQ A;  1JAL A;  1ZDV A;  4LK0 M;  4RH6 A;  4OW0 A;  1XLP A;  2VZK D;  1E10 A;  2RDG A;  3W5U B;  1HQR D;  1YJJ A;  4TMA B;  1WXQ A;  3B2G A;  4IKG A;  4RF1 A;  2WDQ B;  2G1E A;  1SJH D;  1JWS D;  1C4P A;  4ZHO A;  4NZL B;  2M0A A;  4A90 A;  4PT5 A;  2KWD A;  2WXG A;  2PIA A;  1SB3 C;  1HZ6 A;  4M0W A;  4USA A;  1N60 A;  4NAW B;  3TUO A;  3V05 A;  1C4A A;  3Q8E A;  1V1P B;  1BUI C;  3BYY B;  4LLG M;  2MJD A;  5BYQ A;  2K5P A;  4AQ7 A;  4CQN A;  2WU2 B;  1QOF A;  2K22 A;  2WS3 B;  3AV8 A;  1TJE A;  2WXH A;  2V0G A;  2V3P A;  2W3S A;  3HRD D;  4KGR A;  2BT6 A;  1L4Z B;  2JWU A;  2JZP A;  2BS4 B;  2INN E;  4GDK B;  1FNW A;  1C78 A;  3AE6 B;  1UNS A;  1M4V A;  1YN5 A;  2IDY A;  1VZ7 A;  3HVZ A;  4XDC A;  4ZOH C;  2KAC A;  1QQR A;  1ZOY B;  4EE2 A;  1VDV A;  3AE7 B;  1LO5 D;  1JWM D;  2BS3 B;  2IJ0 A;  3MHZ A;  1A70 A;  2J42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...