2JYEA

Human granulin a
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
72
structure length
72
Chain Sequence
b'AMDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQKLAAALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granulin A
publication title Structure dissection of human progranulin identifies well-folded granulin/epithelin modules with unique functional activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 3
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00396 Granulin Granulin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.500 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jyeA01
2JYEA 2JYTA
chains in the Genus database with same CATH superfamily
3I5JC 4WAFA 5D94A 5JZEB 1TZ1A 2RR9A 5C23A 4O1NA 1V49A 3AB5A 4TMAB 4AOFA 1EWCA 5CHFA 2R2QA 4PS8A 1YN5A 3O13A 3VVWB 1PGBA 2GBMA 3UQBA 2INCC 2J0KA 4RH6A 1WXAA 3AE2B 3SD5A 2MP2B 4J6IA 2Q5WD 4HDOA 2M8SA 1I35A 3JYUA 2KDFB 2ZCBA 4AJYB 4ANXA 3SFEB 2M19A 2AQ2B 3LJ3A 1VDVA 2A5UA 2NS5A 4PK1A 1FCLA 1NENB 1JROA 3T9LA 4GDLB 5G5GA 4BBNF 2L7RA 3RNFC 3A33B 5AZGA 3A9JB 1WJ4A 1V5TA 4PS7A 2INDC 1I4RA 2KWUB 2KX0A 1FFVA 2L0TA 2NBVB 2QIEB 3QJZA 4MGKE 3KUCB 1Q0WB 3KYCD 5TSSA 4RGTA 4HWIB 3BINA 1TT5B 4GLSC 2JZZA 3ZYYX 2G4DB 3W5VB 4RMAA 3KH0A 2INPE 1C4CA 3BY4B 3NVYA 2KLGA 3Q8EA 3DHHC 4JX1C 2FCMA 4WURA 4II2B 3RMKC 1DGJA 3T3OA 1AARA 1GB1A 3X23A 3DBSA 3V61A 4A6QA 4K7SA 2GLSA 2L76A 3AI5A 1ZOYB 1V9JA 2MEKA 3EUB2 1P3QU 1WI0A 2DZMA 3P4QB 4LNNA 2ZVOA 4JWUC 1KRHA 1V97A 2BGFA 2WXQA 4ZHPA 5BMIA 4EEWA 1UELA 3ALBA 1L7YA 4XX5A 2K0PA 3AXCA 2KVZA 1N63A 3AEBB 3PT2B 2K6QA 3Q3NC 1YIWA 4PYZA 1ZW7A 3U7DA 3LYYA 2NR2A 4F1SA 2LVPA 2HTME 2BWES 2N9PC 1T0QC 3IG3A 4YTNB 2XEWA 2ZCCA 4TQ0A 1WXVA 4C4VB 4KZ0A 4HDQA 4YXDB 2LJ5A 1Z5SB 3PV1A 4YL8A 3ZLZA 1UWMA 5L95C 1MJDA 2C9WB 4FHJA 2BYTA 2C5LC 1YJJA 1JWSD 3PRPB 1KF6B 4ZRQA 4OVZA 3HM3A 2WWZA 3R8BA 4DHJB 3IAS1 1JWMD 2QSDA 2KMCA 4WH4A 3R2IA 1WZ0A 4A55A 2IGGA 3OAWA 1K51A 2V3NA 4K3BA 2K39A 4AP4C 2M1MA 2JXTA 1R4MB 2CU3A 2LRUA 3L54A 3VR9B 2J4XA 1QZEA 5IO9A 3Q8AA 1PYWD 1K8RB 2MBOA 1HTQA 3VXWA 2GBRA 3ZJTA 4DHZB 3N3KB 2EMSA 5H8YE 2G1EA 4LLGM 1UBQA 1E7VA 3P42A 1OQRA 1OEYA 2NBWB 3UIOB 3ZXRA 3T3NA 1FNWA 2LFIA 2RPQA 3DCGA 3V6CB 2MLBA 2K8HA 3DVGY 1S3SG 2OJRA 4LJOB 3LXFA 3B0AA 3L10B 3AEAB 1YJ1A 1J7BA 1IUEA 3P4SB 1WE7A 1E9MA 3B9JA 2FCQA 1EF1A 3GP7A 3ZNHB 1TTNA 2PE9A 2DENB 3I3TB 4FULA 1KM7A 1WZ3A 2MSED 3VUYA 4TQ1A 2VZKD 2JT4B 2TSSA 2KX3A 4JGHB 1WF9A 1IYFA 3L4PA 4BFRA 4GN1A 1DOIA 5BO4B 4MH8A 2J53A 1D4BA 3QCAA 4NQLB 2W3RA 5GMVA 3A9KA 2MA9B 2JZ3B 2QEJC 3HM6X 1FD6A 5HG2A 2QDFA 2BB6A 1WGYA 5GXGB 2CS4A 1ZGUB 4RM8A 1IBXB 1EU3A 3ETRA 2WXJA 2KZRA 2MBQA 3RI7C 3H7SA 2LASA 4EE2A 3H8HA 4EOYA 1UNSA 1YQ4B 4X57B 2Y5PA 2KFKA 2PTLA 1D3ZA 1LGRA 3AE7B 4KGSA 4ARCA 2WXGA 3DHGC 4A3PA 4N6EB 5LLIA 2KDMA 1C4PA 2KDBA 1RWSA 1SSNA 1L4ZB 1FO4A 3Q3MC 4LK0M 1FFUA 3AV8A 3VH3B 2L8JA 1EF5A 5EE3A 2MCNB 1VCBA 3AECB 2J0MA 2W55A 1V81A 1GC7A 1SXTA 1LO5D 4AS1A 1TKGA 1EWYC 1PGAA 1E7PB 3APFA 1UF0A 2ZW1A 4NAWA 1XO3A 2YEPF 1V1PB 3H7PB 4ANVA 2CR5A 1E6EB 2D07B 1NYQA 2DX5B 1XLOA 3A1QA 3MJWA 1QKZA 3IBEA 4HK2A 2N1VA 3BVZA 4ANUA 2FIDA 1OQQA 2DHZA 5AEKB 2MRPA 5BYSA 1HXYD 3IVFA 4XE0A 3EGRA 2KMAA 2OJWA 2WLBA 2GBNA 1YNTE 1WFYA 3T8MA 2B3AA 3N30A 4E71A 2GB1A 2SAKA 4KZCA 4W9HA 3KLSX 3ZIMA 2LWPA 3HVDA 3QWZB 2KFKB 1LXDA 1H4RA 1TS5A 1WJUA 4BKGA 1WR6E 3WAOA 1WXMA 5HHDG 1QOGA 2KJHB 2MWSB 1N5XA 2K6DB 1OGWA 4JLCA 4DXGA 2RDHA 4WJOA 1X1MA 2MX2A 1JRPA 1RYJA 4ZRKA 2I1KA 1RFKA 4S0RA 2ZPNA 2JRHA 4WJNA 2KJ6A 3R3MA 2RMMA 5JHAA 2DNFA 1I4HA 2BKRB 3OG5A 1TGZB 2RDGA 4KKJA 1PDXA 1WWTA 2BYEA 5JXVA 4ZOHC 2BYVE 4NJ6A 3P4RB 1EUVB 4LNKA 4WJQA 1P9DU 1Z2MA 4NAWB 2DYBA 1YJIA 3DDCB 4W9LA 4LDTD 2CJNA 3TCAA 4HKZE 1MVKA 4C00A 4IG7B 3A1QB 3N1YC 4BKSA 3TEYA 3KWLA 2IDYA 2JY6A 3HK0A 1AN8A 1TYGB 1P98A 3X0WA 1S1QB 4OZBA 2FNJB 3JW0X 2Z59B 2A4ZA 2MHJA 1WYWB 1F77A 3RULA 2BF8B 1NVID 1L4DB 3DOWA 2L1AA 1E8YA 1NI2A 2WXOA 2NTTA 3ML8A 3AE5B 2REXA 3BVMA 1RLFA 1Q5WB 4W9CA 3BIID 1MI0A 4HVBA 1WGKA 2LUMA 3VAWA 2JQRB 5MPOA 4MH0E 2IZVB 3Q8BA 4GOCA 3ZRCA 5JH5C 2W9NA 3Q69A 4DXFA 4MSMB 4W9GA 3DWMA 1BT0A 1HE8A 1TBEA 4RF0A 3TIXA 5EE1A 4IOIE 3QK0A 1LFDA 4MJSB 2K5PA 1PQSA 4GDLA 1OFFA 1T0YA 2MJ3A 2N0SB 2C7HA 4US8A 3Q6BA 1FNVA 3ZO5B 2BQQA 3ZXVA 2ICIA 1L0VB 4IM2A 1QLBB 1VZ6A 4ICUA 1F9JA 3GS2A 1FRDA 4ZRPA 3AEFB 2B76B 3KQ4A 4HROA 2DZIA 3MJ5A 4KSKC 1E8ZA 2V9HA 3NZUA 1ACCA 2KYWA 4M00A 4WQOB 1B9RA 2KD0A 2JWUA 2X38A 3GB1A 1VZ7A 4LJPB 3QQ8B 5AUIA 1LQBA 1N62A 2INNE 3VH4B 4BBNC 1J8CA 3U7ZA 2KTRB 3TEXA 2M17A 1SBBB 1WGDA 4IDIA 3R66C 4I6NB 3PHWB 2JXXA 4ZRIA 1OEYJ 1ROEA 3JSVB 2L32A 1TS2A 1AWDA 5AZFA 4DK5A 2QJLA 1FXAA 1L2NA 3DVNU 1T3QA 2LVOA 1WMHA 3SFDB 1K53A 4IC7B 2DYOA 3PO0A 4N59A 5D3DA 1WGRA 2J42A 3RPFC 4YSYB 2LGYA 1H8CA 3EA6A 1V6EA 1E7UA 2KFJA 4RCOA 3Q8CA 4YT0B 5E6JA 3TUOA 4E74A 3EFCA 3NZSA 1WX9A 1GG3A 2WX0A 3U8ZA 3BYYB 2W3SA 3HIZA 3TBLD 2LVQA 4C80A 5C3JB 5FR6A 1JALA 1KJTA 4B9KA 3V62A 4KDIC 2LMCA 1IP9A 1A70A 2D5GA 2LXAA 4C4VA 2V0GA 3N1XC 3UIPB 1JW9D 1KLVA 1LM8B 1WM3A 5E6OA 3P4PB 2EKIA 1C76A 1BXTA 4HJKA 2BKFA 3RNEC 1BMLC 3QA8A 3OWEB 2L83A 2R61A 2CHZA 1FEHA 2N7EA 3N1ZC 2WXPA 2MBHA 3ONSA 4GXBA 4IW0A 3ZTDA 1RM6C 1WMHB 4HEA1 5BYQA 3ENEA 2I1JA 3EFUA 1I4PA 4KGTA 2JUOA 2Z0DB 2I2YA 3IT6B 3U30A 3ZQ4A 2UWQA 3HVZA 1T6BX 3IAM1 1E0ZA 2JVCA 5TR5A 1FCCC 1ZKHA 1B1ZA 2N9LA 2AL6A 1T0SC 4ZHOA 1V1OA 4K81A 4R3DA 4IM0A 3GE3C 2AQ1B 2D10A 1IPGA 3ZDMC 2VRRB 3BK2A 3B2GA 4PT5A 3ZGZA 4DDID 4M02A 3GZNI 3ZNZB 4RF1A 4WQMA 3PSEB 1XQQA 3GE8C 1QOFA 1UWXA 1JWAD 2KOXA 4KV2A 5EDSA 2K1FA 3VR8B 3PS6A 3AE3B 3N9YC 3TMPB 1C4AA 3OLMD 2IO2B 5LNK1 3MFGA 3ZDTA 2J0JA 3Q3OC 4P1CC 3VTWA 3AU5A 4GDKA 3K9PB 1KLGD 2V4LA 2KT7A 5AUKA 2J7QB 2BB5A 5L83A 1HQRD 3FKYA 1XEEA 2PPHA 4EZJA 2SEBD 3NS1A 2KN4A 3QHTA 2KQ4X 1NYRA 1VLBA 4F8CB 2X8XX 1EM7A 2WX1A 3HHMA 5G55A 4C7ZA 5FR3A 1C1YB 1IBXA 4KDLB 4I6LB 2EKEC 4DHZE 2WS3B 4WAAA 2JYEA 1C3TA 2FUHB 3A4RA 5LXHA 4JPSA 5CTRC 1ZPSA 2BS3B 2KWDA 4NAMA 1UD7A 2I38A 3ZTCA 4URKA 1E10A 3OJ3A 2LHEA 2ZJDA 1HTOA 1FMAD 1RAXA 1QQRA 5J17A 1NBFC 2NTSA 4K7UA 3SU8X 3N32A 4YSZB 1V86A 5E6PA 2JPHA 4DQOC 1GB4A 2L52A 3SEBA 4B0EA 1GJZA 4EFOA 1GNUA 1GC6A 2YEPB 2LGSA 3RN9C 1NEKB 1WXQA 3MC0B 2MBEA 1ISNA 3ZW3A 2WDTB 4K3CA 2XNAC 4C56C 4A20A 1ENFA 2LI5A 4G11A 1P0RA 4EKUA 4GDKB 1V1PA 3H7PA 2LGDA 4CYEA 2BTEA 2QMTA 2K8CA 4ACFA 4W9IA 5DPWA 2XN9C 3NZ3A 3R7QA 2KJRA 3NVVA 1QILA 1R4NB 1WGHA 3PLVA 4FXCA 4MSQB 4USAA 1KH0A 3I63C 5FKAC 5LXIB 2DAFA 4CQNA 1T0RC 5EE0A 4MACA 2CU1A 2KHWB 1ZP0B 4IKGA 1WX7A 3E56A 3LB8C 2BPSA 3Q2AC 2ZW0A 3M95A 2WQYB 4HXDA 3PZ8A 4Q2JA 2N1WA 4B95A 2C60A 2CHXA 4KSLC 2YLMA 3TL5A 1Q10A 4UDUC 1R7SA 4W9KA 2KK8A 1L6UA 3AEDB 1XXGA 4IWQA 2ON8A 3B1LX 4G0NB 3DBHB 2MJEA 2O2VB 4AUQC 1M94A 2WXRA 2LGXA 1ZE3D 4OHJA 2N4FA 3NVZA 4KKIA 3HRDD 1IGDA 1TKYA 2OHFA 1P7FA 4HPLB 1SIFA 2KDIA 3Q8FA 3H9DA 3W1SC 1PFDA 2KLCA 2HD5B 4FJYA 3S2AA 4OVVA 3RUIB 3ABVB 2ZNVC 3KWVA 1YD8U 2BS4B 2CKHB 3M63B 3FC4A 4G50A 2C7NB 4W9FA 2BWFA 4II3B 2IGDA 3APCA 3AE1B 2PKOA 1F2RC 3UQAA 2JRIB 5D2MB 2K22A 5J18A 2NVUI 4IWOA 1V8CA 2CHWA 5DPTA 4I6PA 3URYA 2D11A 3KYDD 2VZKB 3UGBB 4KGRA 2KO3A 1TIFA 2V3SA 2N7JA 3WIMA 2G45B 1PGXA 3M62B 1SB3C 1CMXB 2K9XA 2JSVX 3DPDA 5CHWA 5T8IA 3NVWA 3W9CB 3Q14C 1FXTB 1AYFA 1UGMA 1VJKA 4MJSA 2LUEA 2M4NA 3AULA 3SR6A 1GUAB 1IGCA 2WXNA 1I4GA 1R4MI 3DHIC 1JRUA 2KN5A 2Y5BB 4J3OD 1WRIA 2WDRB 4LCDE 1NDDA 1HZ5A 2L00B 2N9KA 4MDKE 3PTFC 2NPTA 4JQWC 4BKSD 2H88B 1TZOA 2HE7A 3L08A 5IN7A 1SJHD 4C7YA 1CZPA 1WJ6A 4B0MA 2LGIA 3MP9A 1WH3A 1YN4A 4TUUA 2KMMA 1YQBA 5J2RA 2PEAA 3W1YA 4A8XC 2JYTA 4HCPB 3WAMA 2LXCA 2DZKA 2KTRA 4N9F4 5EE9A 1EO6A 4NPNA 3ZUNA 1I4XA 3JSVA 1VZ8A 1RRBA 2WXFA 2XK5A 3ZNGC 3NUHB 1QOBA 3V6EB 4P1BC 2WXKA 3O65B 1TY2A 3MTNB 2KC1A 1U4AA 2KKCA 1XT9B 1SE2A 3RNGC 2PLPA 1QT9A 3DVGX 3I57A 4FA6A 2G9HD 1XF5L 1TS4A 1OQYA 1CQVA 1STEA 1YN3A 3AMZA 3RZFA 1ZUD2 4KIKA 1RFAA 4W9EA 3AM9A 2GOWA 1FM0D 1JMLA 1SGHA 3R7RA 1TKEA 5KHOA 3H1UA 4KX6B 1R4NI 1YMHE 4NQKE 4HPMB 4ZYNA 1UH6A 3CF6E 3AEEB 2G3QB 2PVOD 3DQVA 2PE6B 2BYFA 4DWFA 3PZ7A 2D2QA 3L16A 1XCTL 1J7CA 1PUTA 2NPTB 1G6JA 1GPXA 2J52A 3MHZA 3IFWB 2O6VA 2XBBC 1CK1A 1E5WA 4FLHA 2YVCA 2FBWB 4JIOU 1SE4A 2G4SA 2KQ7A 3DBHI 3VQIA 3AU4A 3NRZA 2XK5B 3TEZA 1E8WA 3WALA 4EZKA 1SJED 2W82A 1YQ3B 2EMTA 1YX5B 1Y8RC 3RD2A 2QILA 4WJPA 5IAAC 4BOSC 4LDTB 2LJIA 3SHQA 1ZXIA 2L3ZA 3PGEA 2IO0B 4KIKB 2Y3AA 4L2YA 4HLEA 5C2TB 4K7WA 1FNUA 3AE6B 2DYMA 3RZWC 4LNOA 5DPRA 4XDDA 1DOXA 4L1BA 3CMMB 4ZYSA 2IYDB 4JE3B 4YTPB 4H2AA 2IJ0A 5D7GA 3QC8B 2RD0A 4BVUC 2DZJA 3PPAA 4FADA 3ZJUA 3MC8A 2L0FA 1WIAA 4NNJB 2MQJA 1SE9A 4AWJA 1WSPA 4DHJD 2WU5B 1TY0A 1P7EA 3QAQA 4LNFA 5D6JB 4A3OA 1C79A 2O6VB 3P1MA 1KLUD 1I42A 2EELA 4F7ZA 2D3BA 4IWPA 2DAJA 4M0WA 3DVNV 2AX5A 2IO3B 2KACA 4OW0A 5G5HA 1EU4A 3VTUA 1L0XB 4TSSA 3ECIA 4NZLB 3N20C 3NJTA 2DLBA 3B08A 3VUWA 4BOZB 4RGNA 1FRRA 4MEMA 3CIRB 1WGGA 1E8XA 4MM3A 1F0ZA 1WYGA 2LHDA 4NY0A 5HKHA 3J9CA 2WXMA 3RT3B 1GAQB 3IHPC 2MW5A 1SIJA 2ZZPB 3Q3FA 4RFBA 1K52A 4XWTA 2HJ8A 4MGZE 2NCNA 3VRAB 2KVRA 1Y56A 3R2TA 3VUXA 2JU6X 1L6VA 1WXSA 4K1RB 4AQ7A 4GMVA 3RCZA 1FPYA 2GMIC 2WNMA 2LD9A 5H92C 2HTHA 2FCNA 1WE6A 2C7MB 1XLPA 5DCNA 3PLUA 4QAYA 2JX5A 4ZDVA 1QF6A 1Q1OA 4S17A 1N60A 4DDGD 3U52E 4DBGA 4P16A 3UF8A 2JWZA 3DBLB 3ZKJC 1D6EC 4NJ7A 3L0WB 1L0YB 1BUIC 1JWUD 3PHXB 3RFZB 3UI3A 1D5MC 2GRIA 4XGAB 3VDZA 2WXHA 3MC9A 5HI1A 4PS3A 2M56B 5HFYA 4JWSC 1MHHE 3C0RB 4M0WB 3UINB 1SF0A 1C9FA 2DWQA 2WXLA 3H6NA 4P6VF 1WRDB 2M0XA 2V3PA 4IUMB 4XWWA 5IOIA 3NG0A 4TV3A 2WP9B 1DYQA 2IGHA 1F52A 3NY5A 4ARIA 3IXSA 1ET6A 2WYQA 4FBJB 3C8YA 3DWGC 4MM3B 2FCSA 1WY8A 1UZXB 4GB9A 1OTRB 1T5XD 1WX8A 3BZDB 1SEBD 5BMGA 3W1SA 4IM3A 4BAXA 2BW2A 3FILA 3JVZX 2FAZA 2RSUA 3CSFA 1F1HA 1UBIA 2K8BA 3EHVA 1C78A 2KC2A 2FE8A 2QC8A 1J0GA 1KFYB 3RNCC 4HRSA 3KW5B 2NBUA 2R2OA 4P7IA 3TSSA 2LRWA 4RGOS 4FN2A 3BWUD 1HEZE 2O2VA 1K50A 2KTFA 3WCQA 1MG4A 3ZRFA 4CHKA 2N7DA 3BYTB 2WDVB 3V05A 4G3XB 2VH1A 4GSWA 2IY0B 2FIFA 4ANWA 4PYUA 2Z8LA 4HKQA 4OZAA 3ZJVA 2IO1B 4MGYE 4WWNA 1FXIA 2WXIA 1VD2A 3TEWA 3CWIA 5C1ZA 3V60A 1J7AA 3MHSD 2WHIA 1HZ6A 1JQ4A 2E6XA 3LDZE 4LTUA 3Q3JA 3BK1A 2MH7A 2RGFA 3B2FA 5G2NA 2QCZA 2ONQA 3GOEA 3PZDA 1WM2A 2KWCA 5BYRA 2BBCA 4YTMB 4GU2A 4FHKA 5AZHA 1N61A 3DBRB 3FILB 4W9JA 1J19A 3ZNID 3WANA 5CHVC 1AW7A 2RDBC 2ZNVB 4RM9A 4M01A 3RNBC 3KVFB 2ACZB 3U2SC 2JZPA 1YOVB 3V3XA 2PJHA 5IP4D 4HCNB 4ASWC 3RYTA 4CO7A 3EECA 5I4DA 2MJDA 1WR1A 1SE3A 2KNBA 1MG8A 1XCQL 4REZA 4LNIA 1ESFA 3VRBB 1VR9A 4XZ4A 1V2YA 3APDA 4E3CA 2HJ1A 1JWBD 3U4EG 3AN1A 4BKTA 3PREA 3QARA 1TS3A 5DPSA 2KAJA 2IPKD 3P2BA 2N9EB 4M8NA 2KWVB 2KQSA 2OEDA 4HPPA 3VHTC 3SDLC 4GGQA 1A5RA 3KUZA 2DBYA 2ZVNA 3QIJA 1JCKB 5D3IB 1DOYA 1M4VA 3PRZA 3OJ4B 2IBIB 1UUPA 1YX6B 4YWGG 3DBLI 4WWOA 5JHBA 3A9KB 1ZDVA 2QHOA 3AE8B 4A9AA 2GBKA 4FJVB 4W9DA 1NI3A 2M0AA 2KANA 3A4SC 1XD3B 4TKNA 1P1AA 4M8MA 4MGIE 3AH7A 2ASQA 2WDQB 4MT5A 2PVGC 2IY1B 4N58A 2AWTA 1QOAA 2FUG1 2WU2B 1ZDXA 3AE4B 1MHXA 1I7HA 2HDEA 2H89B 4NJCA 4YSXB 5IKCM 3BVGA 3EC8A 1CJEA 4ICVA 3IT4B 3WAPA 1V5OA 4WIPA 3FAHA 2BS2B 5CX3A 3AEGB 4L23A 3AE9B 2D3CA 2PW9A 4DXAB 1C77A 2AYOB 4XDCA 3HUIA 3TJPA 1KOTA 2LEKA 1WJNA 3WA0A 2KXJA 1ET9A 1D5ZC 3L17A 3W5UB 2AEHA 2D3AA 2PMVA 3E9SA 1V80A 4A90A 2PIAA 4MELA 4ZRJA 4JL9A 1N5WA 4BZAA 2V4IB 1MFWA 2AL3A 5IA7A 3KUDB 4EZLA 3CSTA 2KDEB 2UU7A 3VFKA 2CJOA 2GBJA 2ZEQA 2BT6A 5FK9C 3PVLA 3GZNB 1E90A 4D2KA 2L05A 4HJGE 1TJEA 3W2DA 1VRAB 1KTKA 3ML9A 1XLQA 4OVUA 2MP2A 1ZXHA 4XYCA 1HA5A 4OZCA 1I4QA 4WWPA 3M3JA 4ITKA 4XC2A 2D3GA 2V1YA 2K25A 4RGMA 3NHEB 2BVCA 2MBBB 1UGJA 3C19A 2O6VD 4GIVA 2LZ6A 4B6WA 1XLNA 2RPVA 3QX1A 3RNAC 1L5PA 3NS8A 2K3UA 3DBRI 5E6NA 2UYZB 3NOBA 3A9JA 5BMHA 3PRMB 4RNAA 2Z0EB 2JF5A 4AJWA 2OOBB 2ZPYA 4EUTA 1FIQA 5KHQA 4US9A 3VTVA 1GOZA 2Y5CA 3ZVVA 4WWMA 2GI9A 2E3TA 3I9V1 3L13A 1F2RI 2W54A 3D32A 3P63A 2AQ3B 4FJZA 1MPEA 4KVGB 1N6ZA 2VH2A 2WGSA 1D5XC 2N9XA 2NMQA 3K9OB
chains in the Genus database with same CATH topology
2WNMA 4DXGA 2RDHA 5H92C 4WAFA 3NVVA 1QILA 1JRPA 1RYJA 1XLPA 1RFKA 4O1NA 4FXCA 2JX5A 3AB5A 4USAA 1KH0A 4TMAB 5FKAC 1QF6A 1N60A 3U52E 1EWCA 4CQNA 2RMMA 4P16A 5EE0A 4MACA 1I4HA 1ZP0B 1D6EC 4IKGA 1YN5A 2RDGA 3E56A 3LB8C 3O13A 1PDXA 4KKJA 1PGBA 1L0YB 1WWTA 2ZW0A 2WQYB 4RH6A 5JXVA 1BUIC 3AE2B 1JWUD 4ZOHC 3RFZB 3PZ8A 3UI3A 1D5MC 3P4RB 4Q2JA 2GRIA 4NAWB 2Q5WD 1YJIA 2WXHA 5HI1A 2M56B 5HFYA 4JWSC 1MHHE 2CJNA 1SF0A 1MVKA 4HKZE 1Q10A 4UDUC 1R7SA 1C9FA 1L6UA 2DWQA 2WXLA 3AEDB 1XXGA 3SFEB 2ON8A 4P6VF 2V3PA 2M19A 3TEYA 2AQ2B 1VDVA 3KWLA 4XWWA 2IDYA 1FCLA 1NENB 1JROA 2WP9B 1DYQA 1AN8A 2IGHA 1TYGB 4ARIA 3IXSA 4OZBA 2MJEA 4GDLB 1ET6A 5G5GA 2WXRA 3C8YA 3DWGC 1ZE3D 4MM3B 4OHJA 1F77A 3NVZA 4KKIA 3HRDD 1IGDA 1NVID 1L4DB 1TKYA 2L1AA 2OHFA 1P7FA 1T5XD 1I4RA 2WXOA 1SEBD 2NTTA 3BZDB 5BMGA 3W1SA 1FFVA 3Q8FA 2BW2A 3FILA 3AE5B 2QIEB 3BVMA 1PFDA 3BIID 1MI0A 5TSSA 4RGTA 1WGKA 3ABVB 2LUMA 2JQRB 5MPOA 1C78A 3KWVA 2BS4B 3Q8BA 2FE8A 3FC4A 3Q69A 4DXFA 1KFYB 4GLSC 2IGDA 4HRSA 3DWMA 3ZYYX 3W5VB 3AE1B 4RF0A 5EE1A 4IOIE 3TSSA 2INPE 1C4CA 2PKOA 3NVYA 3Q8EA 4RGOS 3BWUD 2K5PA 1F2RC 1HEZE 1OFFA 1K50A 4JX1C 3WCQA 2MJ3A 2K22A 2N0SB 4WURA 4US8A 1DGJA 1FNVA 3T3OA 3BYTB 1V8CA 2WDVB 2ICIA 1GB1A 3V05A 1L0VB 4A6QA 1QLBB 1VZ6A 3URYA 3GS2A 1FRDA 2VZKB 4ZRPA 3AEFB 2B76B 3KQ4A 4HROA 4KGRA 2Z8LA 2N7JA 4HKQA 4OZAA 3MJ5A 1ZOYB 2MEKA 3ZJVA 1PGXA 1ACCA 1SB3C 3EUB2 2K9XA 2JSVX 3P4QB 1B9RA 1FXIA 2WXIA 4JWUC 1KRHA 2JWUA 3TEWA 2X38A 3GB1A 5T8IA 1VZ7A 1V97A 3NVWA 2WXQA 5AUIA 3W9CB 3CWIA 4ZHPA 1N62A 2INNE 5BMIA 1J7AA 1HZ6A 1AYFA 1JQ4A 2E6XA 4LTUA 3U7ZA 1VJKA 3SR6A 3TEXA 2K0PA 3BK1A 2MH7A 1SBBB 4IDIA 1N63A 3AEBB 1ROEA 3B2FA 1IGCA 2L32A 2WXNA 1TS2A 1I4GA 2ONQA 1AWDA 4J3OD 5BYRA 2QJLA 1FXAA 1WRIA 2WDRB 3LYYA 1T3QA 3SFDB 2BBCA 1HZ5A 1K53A 2N9KA 2DYOA 3PO0A 4YTMB 2HTME 4N59A 5D3DA 4YTNB 2H88B 1N61A 3FILB 1TZOA 4TQ0A 2J42A 3RPFC 1SJHD 1AW7A 4C7YA 4YSYB 1CZPA 4B0MA 2ACZB 2LGIA 3U2SC 3EA6A 4YXDB 3MP9A 1YN4A 2JZPA 2KMMA 4RCOA 3Q8CA 1UWMA 3V3XA 2BYTA 4A8XC 2JYTA 4YT0B 5E6JA 3TUOA 1YJJA 1JWSD 5EE9A 1KF6B 4ZRQA 5I4DA 4OVZA 2MJDA 3R8BA 3BYYB 1I4XA 1SE3A 3IAS1 1JWMD 1VZ8A 1XCQL 2W3SA 2WXFA 4REZA 2QSDA 3NUHB 1QOBA 1ESFA 4C80A 4WH4A 5C3JB 3R2IA 1JALA 3VRBB 1VR9A 4A55A 2WXKA 2IGGA 1JWBD 1TY2A 1K51A 2V3NA 2LMCA 3U4EG 3AN1A 1A70A 2D5GA 1SE2A 2JXTA 2CU3A 2PLPA 3VR9B 1QT9A 1TS3A 3I57A 2V0GA 2G9HD 1JW9D 1XF5L 1TS4A 2KAJA 2J4XA 2IPKD 1CQVA 1STEA 1YN3A 2OEDA 3AMZA 3Q8AA 1PYWD 3P4PB 2EKIA 1C76A 1ZUD2 1BXTA 3AM9A 1BMLC 3OWEB 3ZJTA 2L83A 1FM0D 1JMLA 2DBYA 2R61A 1FEHA 5H8YE 2G1EA 1TKEA 1JCKB 4KX6B 1YMHE 4LLGM 5D3IB 1DOYA 2WXPA 1M4VA 1OQRA 3P42A 3AEEB 3T3NA 1FNWA 2PVOD 1UUPA 2LFIA 4YWGG 3PZ7A 1RM6C 1ZDVA 4HEA1 3AE8B 3LXFA 4A9AA 1XCTL 5BYQA 1J7CA 1PUTA 3AEAB 1J7BA 1NI3A 1IUEA 1GPXA 1I4PA 4KGTA 2J52A 2M0AA 3P4SB 1E9MA 3B9JA 3MHZA 3GP7A 2I2YA 3IT6B 3ZQ4A 3HVZA 3AH7A 1T6BX 3IAM1 1CK1A 1E0ZA 2WDQB 4MT5A 2PVGC 4N58A 1FCCC 1B1ZA 4TQ1A 2VZKD 2FBWB 2N9LA 2TSSA 1SE4A 1QOAA 4ZHOA 1V1OA 2FUG1 1ZDXA 2WU2B 3AE4B 3L4PA 1MHXA 4R3DA 1DOIA 1I7HA 2AQ1B 3VQIA 3NRZA 3BK2A 4MH8A 2J53A 3TEZA 2HDEA 2H89B 3B2GA 4NJCA 4YSXB 4PT5A 3BVGA 3ZGZA 1D4BA 1SJED 2W3RA 1CJEA 4RF1A 3IT4B 2QEJC 4WQMA 2W82A 1YQ3B 1QOFA 1FD6A 1UWXA 1JWAD 5HG2A 4WIPA 2BB6A 3FAHA 2BS2B 5GXGB 3VR8B 2QILA 3AE3B 2LJIA 3N9YC 1C4AA 3AEGB 1IBXB 5LNK1 4L23A 1ZXIA 3MFGA 1EU3A 3AE9B 3ETRA 2WXJA 2PW9A 1C77A 4XDCA 4EE2A 3HUIA 2Y3AA 3H8HA 4L2YA 5C2TB 1UNSA 1YQ4B 1FNUA 2LEKA 1KLGD 2DYMA 3AE6B 1ET9A 2Y5PA 1D5ZC 3W5UB 2PTLA 2PMVA 5AUKA 3AE7B 2BB5A 4KGSA 4XDDA 1DOXA 3E9SA 1HQRD 4ARCA 4L1BA 4A90A 2PIAA 1XEEA 4ZYSA 4JE3B 1N5WA 2V4IB 2SEBD 2WXGA 4YTPB 4H2AA 3NS1A 2IJ0A 5D7GA 2KN4A 4N6EB 2KQ4X 2KDMA 1C4PA 1NYRA 1VLBA 1RWSA 1SSNA 1L4ZB 1FO4A 3ZJUA 1EM7A 4C7ZA 4LK0M 5FR3A 1FFUA 3AV8A 2CJOA 1WSPA 5EE3A 1IBXA 2WU5B 1TY0A 1P7EA 3AECB 2W55A 2BT6A 5FK9C 4D2KA 2WS3B 1SXTA 4HJGE 2JYEA 1C79A 1TJEA 3W2DA 3P1MA 1LO5D 4AS1A 1VRAB 1TKGA 1KLUD 1EWYC 1KTKA 1PGAA 1E7PB 1XLQA 4JPSA 2EELA 1ZXHA 1ZPSA 1HA5A 2BS3B 1I4QA 2KWDA 4OZCA 2ZW1A 4NAMA 2I38A 4ITKA 1XO3A 2YEPF 1E10A 1V1PB 2LHEA 4M0WA 2AX5A 1E6EB 1FMAD 1QQRA 1NYQA 2KACA 4OW0A 1XLOA 4RGMA 5G5HA 1EU4A 1QKZA 2NTSA 1L0XB 4TSSA 1UGJA 4NZLB 3BVZA 4YSZB 1XLNA 2RPVA 1OQQA 1L5PA 2DLBA 2K3UA 4DQOC 1GB4A 2L52A 3SEBA 4RGNA 1FRRA 4B0EA 3CIRB 5BYSA 1HXYD 1F0ZA 1WYGA 2YEPB 2LHDA 5BMHA 1NEKB 4XE0A 1WXQA 4RNAA 3MC0B 3EGRA 3J9CA 2WXMA 2WLBA 1YNTE 1FIQA 1GAQB 2XNAC 4US9A 1GOZA 4C56C 1ENFA 2Y5CA 2GB1A 2SAKA 1SIJA 4WWMA 3KLSX 2GI9A 4RFBA 4GDKB 2E3TA 1V1PA 3HVDA 1K52A 3I9V1 4XWTA 1F2RI 2W54A 2BTEA 3P63A 2AQ3B 3VRAB 2QMTA 1TS5A 1MPEA 1Y56A 3R2TA 2JU6X 1L6VA 5HHDG 1QOGA 1D5XC 1N5XA 2NMQA 2XN9C 4AQ7A 3NZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYE A;  2JYT A; 
#chains in the Genus database with same CATH topology
 3I5J C;  4WAF A;  5D94 A;  5JZE B;  1TZ1 A;  2RR9 A;  5C23 A;  4O1N A;  1V49 A;  3AB5 A;  4TMA B;  4AOF A;  1EWC A;  5CHF A;  2R2Q A;  4PS8 A;  1YN5 A;  3O13 A;  3VVW B;  1PGB A;  2GBM A;  3UQB A;  2INC C;  2J0K A;  4RH6 A;  1WXA A;  3AE2 B;  3SD5 A;  2MP2 B;  4J6I A;  2Q5W D;  4HDO A;  2M8S A;  1I35 A;  3JYU A;  2KDF B;  2ZCB A;  4AJY B;  4ANX A;  3SFE B;  2M19 A;  2AQ2 B;  3LJ3 A;  1VDV A;  2A5U A;  2NS5 A;  4PK1 A;  1FCL A;  1NEN B;  1JRO A;  3T9L A;  4GDL B;  5G5G A;  4BBN F;  2L7R A;  3RNF C;  3A33 B;  5AZG A;  3A9J B;  1WJ4 A;  1V5T A;  4PS7 A;  2IND C;  1I4R A;  2KWU B;  2KX0 A;  1FFV A;  2L0T A;  2NBV B;  2QIE B;  3QJZ A;  4MGK E;  3KUC B;  1Q0W B;  3KYC D;  5TSS A;  4RGT A;  4HWI B;  3BIN A;  1TT5 B;  4GLS C;  2JZZ A;  3ZYY X;  2G4D B;  3W5V B;  4RMA A;  3KH0 A;  2INP E;  1C4C A;  3BY4 B;  3NVY A;  2KLG A;  3Q8E A;  3DHH C;  4JX1 C;  2FCM A;  4WUR A;  4II2 B;  3RMK C;  1DGJ A;  3T3O A;  1AAR A;  1GB1 A;  3X23 A;  3DBS A;  3V61 A;  4A6Q A;  4K7S A;  2GLS A;  2L76 A;  3AI5 A;  1ZOY B;  1V9J A;  2MEK A;  3EUB 2;  1P3Q U;  1WI0 A;  2DZM A;  3P4Q B;  4LNN A;  2ZVO A;  4JWU C;  1KRH A;  1V97 A;  2BGF A;  2WXQ A;  4ZHP A;  5BMI A;  4EEW A;  1UEL A;  3ALB A;  1L7Y A;  4XX5 A;  2K0P A;  3AXC A;  2KVZ A;  1N63 A;  3AEB B;  3PT2 B;  2K6Q A;  3Q3N C;  1YIW A;  4PYZ A;  1ZW7 A;  3U7D A;  3LYY A;  2NR2 A;  4F1S A;  2LVP A;  2HTM E;  2BWE S;  2N9P C;  1T0Q C;  3IG3 A;  4YTN B;  2XEW A;  2ZCC A;  4TQ0 A;  1WXV A;  4C4V B;  4KZ0 A;  4HDQ A;  4YXD B;  2LJ5 A;  1Z5S B;  3PV1 A;  4YL8 A;  3ZLZ A;  1UWM A;  5L95 C;  1MJD A;  2C9W B;  4FHJ A;  2BYT A;  2C5L C;  1YJJ A;  1JWS D;  3PRP B;  1KF6 B;  4ZRQ A;  4OVZ A;  3HM3 A;  2WWZ A;  3R8B A;  4DHJ B;  3IAS 1;  1JWM D;  2QSD A;  2KMC A;  4WH4 A;  3R2I A;  1WZ0 A;  4A55 A;  2IGG A;  3OAW A;  1K51 A;  2V3N A;  4K3B A;  2K39 A;  4AP4 C;  2M1M A;  2JXT A;  1R4M B;  2CU3 A;  2LRU A;  3L54 A;  3VR9 B;  2J4X A;  1QZE A;  5IO9 A;  3Q8A A;  1PYW D;  1K8R B;  2MBO A;  1HTQ A;  3VXW A;  2GBR A;  3ZJT A;  4DHZ B;  3N3K B;  2EMS A;  5H8Y E;  2G1E A;  4LLG M;  1UBQ A;  1E7V A;  3P42 A;  1OQR A;  1OEY A;  2NBW B;  3UIO B;  3ZXR A;  3T3N A;  1FNW A;  2LFI A;  2RPQ A;  3DCG A;  3V6C B;  2MLB A;  2K8H A;  3DVG Y;  1S3S G;  2OJR A;  4LJO B;  3LXF A;  3B0A A;  3L10 B;  3AEA B;  1YJ1 A;  1J7B A;  1IUE A;  3P4S B;  1WE7 A;  1E9M A;  3B9J A;  2FCQ A;  1EF1 A;  3GP7 A;  3ZNH B;  1TTN A;  2PE9 A;  2DEN B;  3I3T B;  4FUL A;  1KM7 A;  1WZ3 A;  2MSE D;  3VUY A;  4TQ1 A;  2VZK D;  2JT4 B;  2TSS A;  2KX3 A;  4JGH B;  1WF9 A;  1IYF A;  3L4P A;  4BFR A;  4GN1 A;  1DOI A;  5BO4 B;  4MH8 A;  2J53 A;  1D4B A;  3QCA A;  4NQL B;  2W3R A;  5GMV A;  3A9K A;  2MA9 B;  2JZ3 B;  2QEJ C;  3HM6 X;  1FD6 A;  5HG2 A;  2QDF A;  2BB6 A;  1WGY A;  5GXG B;  2CS4 A;  1ZGU B;  4RM8 A;  1IBX B;  1EU3 A;  3ETR A;  2WXJ A;  2KZR A;  2MBQ A;  3RI7 C;  3H7S A;  2LAS A;  4EE2 A;  3H8H A;  4EOY A;  1UNS A;  1YQ4 B;  4X57 B;  2Y5P A;  2KFK A;  2PTL A;  1D3Z A;  1LGR A;  3AE7 B;  4KGS A;  4ARC A;  2WXG A;  3DHG C;  4A3P A;  4N6E B;  5LLI A;  2KDM A;  1C4P A;  2KDB A;  1RWS A;  1SSN A;  1L4Z B;  1FO4 A;  3Q3M C;  4LK0 M;  1FFU A;  3AV8 A;  3VH3 B;  2L8J A;  1EF5 A;  5EE3 A;  2MCN B;  1VCB A;  3AEC B;  2J0M A;  2W55 A;  1V81 A;  1GC7 A;  1SXT A;  1LO5 D;  4AS1 A;  1TKG A;  1EWY C;  1PGA A;  1E7P B;  3APF A;  1UF0 A;  2ZW1 A;  4NAW A;  1XO3 A;  2YEP F;  1V1P B;  3H7P B;  4ANV A;  2CR5 A;  1E6E B;  2D07 B;  1NYQ A;  2DX5 B;  1XLO A;  3A1Q A;  3MJW A;  1QKZ A;  3IBE A;  4HK2 A;  2N1V A;  3BVZ A;  4ANU A;  2FID A;  1OQQ A;  2DHZ A;  5AEK B;  2MRP A;  5BYS A;  1HXY D;  3IVF A;  4XE0 A;  3EGR A;  2KMA A;  2OJW A;  2WLB A;  2GBN A;  1YNT E;  1WFY A;  3T8M A;  2B3A A;  3N30 A;  4E71 A;  2GB1 A;  2SAK A;  4KZC A;  4W9H A;  3KLS X;  3ZIM A;  2LWP A;  3HVD A;  3QWZ B;  2KFK B;  1LXD A;  1H4R A;  1TS5 A;  1WJU A;  4BKG A;  1WR6 E;  3WAO A;  1WXM A;  5HHD G;  1QOG A;  2KJH B;  2MWS B;  1N5X A;  2K6D B;  1OGW A;  4JLC A;  4DXG A;  2RDH A;  4WJO A;  1X1M A;  2MX2 A;  1JRP A;  1RYJ A;  4ZRK A;  2I1K A;  1RFK A;  4S0R A;  2ZPN A;  2JRH A;  4WJN A;  2KJ6 A;  3R3M A;  2RMM A;  5JHA A;  2DNF A;  1I4H A;  2BKR B;  3OG5 A;  1TGZ B;  2RDG A;  4KKJ A;  1PDX A;  1WWT A;  2BYE A;  5JXV A;  4ZOH C;  2BYV E;  4NJ6 A;  3P4R B;  1EUV B;  4LNK A;  4WJQ A;  1P9D U;  1Z2M A;  4NAW B;  2DYB A;  1YJI A;  3DDC B;  4W9L A;  4LDT D;  2CJN A;  3TCA A;  4HKZ E;  1MVK A;  4C00 A;  4IG7 B;  3A1Q B;  3N1Y C;  4BKS A;  3TEY A;  3KWL A;  2IDY A;  2JY6 A;  3HK0 A;  1AN8 A;  1TYG B;  1P98 A;  3X0W A;  1S1Q B;  4OZB A;  2FNJ B;  3JW0 X;  2Z59 B;  2A4Z A;  2MHJ A;  1WYW B;  1F77 A;  3RUL A;  2BF8 B;  1NVI D;  1L4D B;  3DOW A;  2L1A A;  1E8Y A;  1NI2 A;  2WXO A;  2NTT A;  3ML8 A;  3AE5 B;  2REX A;  3BVM A;  1RLF A;  1Q5W B;  4W9C A;  3BII D;  1MI0 A;  4HVB A;  1WGK A;  2LUM A;  3VAW A;  2JQR B;  5MPO A;  4MH0 E;  2IZV B;  3Q8B A;  4GOC A;  3ZRC A;  5JH5 C;  2W9N A;  3Q69 A;  4DXF A;  4MSM B;  4W9G A;  3DWM A;  1BT0 A;  1HE8 A;  1TBE A;  4RF0 A;  3TIX A;  5EE1 A;  4IOI E;  3QK0 A;  1LFD A;  4MJS B;  2K5P A;  1PQS A;  4GDL A;  1OFF A;  1T0Y A;  2MJ3 A;  2N0S B;  2C7H A;  4US8 A;  3Q6B A;  1FNV A;  3ZO5 B;  2BQQ A;  3ZXV A;  2ICI A;  1L0V B;  4IM2 A;  1QLB B;  1VZ6 A;  4ICU A;  1F9J A;  3GS2 A;  1FRD A;  4ZRP A;  3AEF B;  2B76 B;  3KQ4 A;  4HRO A;  2DZI A;  3MJ5 A;  4KSK C;  1E8Z A;  2V9H A;  3NZU A;  1ACC A;  2KYW A;  4M00 A;  4WQO B;  1B9R A;  2KD0 A;  2JWU A;  2X38 A;  3GB1 A;  1VZ7 A;  4LJP B;  3QQ8 B;  5AUI A;  1LQB A;  1N62 A;  2INN E;  3VH4 B;  4BBN C;  1J8C A;  3U7Z A;  2KTR B;  3TEX A;  2M17 A;  1SBB B;  1WGD A;  4IDI A;  3R66 C;  4I6N B;  3PHW B;  2JXX A;  4ZRI A;  1OEY J;  1ROE A;  3JSV B;  2L32 A;  1TS2 A;  1AWD A;  5AZF A;  4DK5 A;  2QJL A;  1FXA A;  1L2N A;  3DVN U;  1T3Q A;  2LVO A;  1WMH A;  3SFD B;  1K53 A;  4IC7 B;  2DYO A;  3PO0 A;  4N59 A;  5D3D A;  1WGR A;  2J42 A;  3RPF C;  4YSY B;  2LGY A;  1H8C A;  3EA6 A;  1V6E A;  1E7U A;  2KFJ A;  4RCO A;  3Q8C A;  4YT0 B;  5E6J A;  3TUO A;  4E74 A;  3EFC A;  3NZS A;  1WX9 A;  1GG3 A;  2WX0 A;  3U8Z A;  3BYY B;  2W3S A;  3HIZ A;  3TBL D;  2LVQ A;  4C80 A;  5C3J B;  5FR6 A;  1JAL A;  1KJT A;  4B9K A;  3V62 A;  4KDI C;  2LMC A;  1IP9 A;  1A70 A;  2D5G A;  2LXA A;  4C4V A;  2V0G A;  3N1X C;  3UIP B;  1JW9 D;  1KLV A;  1LM8 B;  1WM3 A;  5E6O A;  3P4P B;  2EKI A;  1C76 A;  1BXT A;  4HJK A;  2BKF A;  3RNE C;  1BML C;  3QA8 A;  3OWE B;  2L83 A;  2R61 A;  2CHZ A;  1FEH A;  2N7E A;  3N1Z C;  2WXP A;  2MBH A;  3ONS A;  4GXB A;  4IW0 A;  3ZTD A;  1RM6 C;  1WMH B;  4HEA 1;  5BYQ A;  3ENE A;  2I1J A;  3EFU A;  1I4P A;  4KGT A;  2JUO A;  2Z0D B;  2I2Y A;  3IT6 B;  3U30 A;  3ZQ4 A;  2UWQ A;  3HVZ A;  1T6B X;  3IAM 1;  1E0Z A;  2JVC A;  5TR5 A;  1FCC C;  1ZKH A;  1B1Z A;  2N9L A;  2AL6 A;  1T0S C;  4ZHO A;  1V1O A;  4K81 A;  4R3D A;  4IM0 A;  3GE3 C;  2AQ1 B;  2D10 A;  1IPG A;  3ZDM C;  2VRR B;  3BK2 A;  3B2G A;  4PT5 A;  3ZGZ A;  4DDI D;  4M02 A;  3GZN I;  3ZNZ B;  4RF1 A;  4WQM A;  3PSE B;  1XQQ A;  3GE8 C;  1QOF A;  1UWX A;  1JWA D;  2KOX A;  4KV2 A;  5EDS A;  2K1F A;  3VR8 B;  3PS6 A;  3AE3 B;  3N9Y C;  3TMP B;  1C4A A;  3OLM D;  2IO2 B;  5LNK 1;  3MFG A;  3ZDT A;  2J0J A;  3Q3O C;  4P1C C;  3VTW A;  3AU5 A;  4GDK A;  3K9P B;  1KLG D;  2V4L A;  2KT7 A;  5AUK A;  2J7Q B;  2BB5 A;  5L83 A;  1HQR D;  3FKY A;  1XEE A;  2PPH A;  4EZJ A;  2SEB D;  3NS1 A;  2KN4 A;  3QHT A;  2KQ4 X;  1NYR A;  1VLB A;  4F8C B;  2X8X X;  1EM7 A;  2WX1 A;  3HHM A;  5G55 A;  4C7Z A;  5FR3 A;  1C1Y B;  1IBX A;  4KDL B;  4I6L B;  2EKE C;  4DHZ E;  2WS3 B;  4WAA A;  2JYE A;  1C3T A;  2FUH B;  3A4R A;  5LXH A;  4JPS A;  5CTR C;  1ZPS A;  2BS3 B;  2KWD A;  4NAM A;  1UD7 A;  2I38 A;  3ZTC A;  4URK A;  1E10 A;  3OJ3 A;  2LHE A;  2ZJD A;  1HTO A;  1FMA D;  1RAX A;  1QQR A;  5J17 A;  1NBF C;  2NTS A;  4K7U A;  3SU8 X;  3N32 A;  4YSZ B;  1V86 A;  5E6P A;  2JPH A;  4DQO C;  1GB4 A;  2L52 A;  3SEB A;  4B0E A;  1GJZ A;  4EFO A;  1GNU A;  1GC6 A;  2YEP B;  2LGS A;  3RN9 C;  1NEK B;  1WXQ A;  3MC0 B;  2MBE A;  1ISN A;  3ZW3 A;  2WDT B;  4K3C A;  2XNA C;  4C56 C;  4A20 A;  1ENF A;  2LI5 A;  4G11 A;  1P0R A;  4EKU A;  4GDK B;  1V1P A;  3H7P A;  2LGD A;  4CYE A;  2BTE A;  2QMT A;  2K8C A;  4ACF A;  4W9I A;  5DPW A;  2XN9 C;  3NZ3 A;  3R7Q A;  2KJR A;  3NVV A;  1QIL A;  1R4N B;  1WGH A;  3PLV A;  4FXC A;  4MSQ B;  4USA A;  1KH0 A;  3I63 C;  5FKA C;  5LXI B;  2DAF A;  4CQN A;  1T0R C;  5EE0 A;  4MAC A;  2CU1 A;  2KHW B;  1ZP0 B;  4IKG A;  1WX7 A;  3E56 A;  3LB8 C;  2BPS A;  3Q2A C;  2ZW0 A;  3M95 A;  2WQY B;  4HXD A;  3PZ8 A;  4Q2J A;  2N1W A;  4B95 A;  2C60 A;  2CHX A;  4KSL C;  2YLM A;  3TL5 A;  1Q10 A;  4UDU C;  1R7S A;  4W9K A;  2KK8 A;  1L6U A;  3AED B;  1XXG A;  4IWQ A;  2ON8 A;  3B1L X;  4G0N B;  3DBH B;  2MJE A;  2O2V B;  4AUQ C;  1M94 A;  2WXR A;  2LGX A;  1ZE3 D;  4OHJ A;  2N4F A;  3NVZ A;  4KKI A;  3HRD D;  1IGD A;  1TKY A;  2OHF A;  1P7F A;  4HPL B;  1SIF A;  2KDI A;  3Q8F A;  3H9D A;  3W1S C;  1PFD A;  2KLC A;  2HD5 B;  4FJY A;  3S2A A;  4OVV A;  3RUI B;  3ABV B;  2ZNV C;  3KWV A;  1YD8 U;  2BS4 B;  2CKH B;  3M63 B;  3FC4 A;  4G50 A;  2C7N B;  4W9F A;  2BWF A;  4II3 B;  2IGD A;  3APC A;  3AE1 B;  2PKO A;  1F2R C;  3UQA A;  2JRI B;  5D2M B;  2K22 A;  5J18 A;  2NVU I;  4IWO A;  1V8C A;  2CHW A;  5DPT A;  4I6P A;  3URY A;  2D11 A;  3KYD D;  2VZK B;  3UGB B;  4KGR A;  2KO3 A;  1TIF A;  2V3S A;  2N7J A;  3WIM A;  2G45 B;  1PGX A;  3M62 B;  1SB3 C;  1CMX B;  2K9X A;  2JSV X;  3DPD A;  5CHW A;  5T8I A;  3NVW A;  3W9C B;  3Q14 C;  1FXT B;  1AYF A;  1UGM A;  1VJK A;  4MJS A;  2LUE A;  2M4N A;  3AUL A;  3SR6 A;  1GUA B;  1IGC A;  2WXN A;  1I4G A;  1R4M I;  3DHI C;  1JRU A;  2KN5 A;  2Y5B B;  4J3O D;  1WRI A;  2WDR B;  4LCD E;  1NDD A;  1HZ5 A;  2L00 B;  2N9K A;  4MDK E;  3PTF C;  2NPT A;  4JQW C;  4BKS D;  2H88 B;  1TZO A;  2HE7 A;  3L08 A;  5IN7 A;  1SJH D;  4C7Y A;  1CZP A;  1WJ6 A;  4B0M A;  2LGI A;  3MP9 A;  1WH3 A;  1YN4 A;  4TUU A;  2KMM A;  1YQB A;  5J2R A;  2PEA A;  3W1Y A;  4A8X C;  2JYT A;  4HCP B;  3WAM A;  2LXC A;  2DZK A;  2KTR A;  4N9F 4;  5EE9 A;  1EO6 A;  4NPN A;  3ZUN A;  1I4X A;  3JSV A;  1VZ8 A;  1RRB A;  2WXF A;  2XK5 A;  3ZNG C;  3NUH B;  1QOB A;  3V6E B;  4P1B C;  2WXK A;  3O65 B;  1TY2 A;  3MTN B;  2KC1 A;  1U4A A;  2KKC A;  1XT9 B;  1SE2 A;  3RNG C;  2PLP A;  1QT9 A;  3DVG X;  3I57 A;  4FA6 A;  2G9H D;  1XF5 L;  1TS4 A;  1OQY A;  1CQV A;  1STE A;  1YN3 A;  3AMZ A;  3RZF A;  1ZUD 2;  4KIK A;  1RFA A;  4W9E A;  3AM9 A;  2GOW A;  1FM0 D;  1JML A;  1SGH A;  3R7R A;  1TKE A;  5KHO A;  3H1U A;  4KX6 B;  1R4N I;  1YMH E;  4NQK E;  4HPM B;  4ZYN A;  1UH6 A;  3CF6 E;  3AEE B;  2G3Q B;  2PVO D;  3DQV A;  2PE6 B;  2BYF A;  4DWF A;  3PZ7 A;  2D2Q A;  3L16 A;  1XCT L;  1J7C A;  1PUT A;  2NPT B;  1G6J A;  1GPX A;  2J52 A;  3MHZ A;  3IFW B;  2O6V A;  2XBB C;  1CK1 A;  1E5W A;  4FLH A;  2YVC A;  2FBW B;  4JIO U;  1SE4 A;  2G4S A;  2KQ7 A;  3DBH I;  3VQI A;  3AU4 A;  3NRZ A;  2XK5 B;  3TEZ A;  1E8W A;  3WAL A;  4EZK A;  1SJE D;  2W82 A;  1YQ3 B;  2EMT A;  1YX5 B;  1Y8R C;  3RD2 A;  2QIL A;  4WJP A;  5IAA C;  4BOS C;  4LDT B;  2LJI A;  3SHQ A;  1ZXI A;  2L3Z A;  3PGE A;  2IO0 B;  4KIK B;  2Y3A A;  4L2Y A;  4HLE A;  5C2T B;  4K7W A;  1FNU A;  3AE6 B;  2DYM A;  3RZW C;  4LNO A;  5DPR A;  4XDD A;  1DOX A;  4L1B A;  3CMM B;  4ZYS A;  2IYD B;  4JE3 B;  4YTP B;  4H2A A;  2IJ0 A;  5D7G A;  3QC8 B;  2RD0 A;  4BVU C;  2DZJ A;  3PPA A;  4FAD A;  3ZJU A;  3MC8 A;  2L0F A;  1WIA A;  4NNJ B;  2MQJ A;  1SE9 A;  4AWJ A;  1WSP A;  4DHJ D;  2WU5 B;  1TY0 A;  1P7E A;  3QAQ A;  4LNF A;  5D6J B;  4A3O A;  1C79 A;  2O6V B;  3P1M A;  1KLU D;  1I42 A;  2EEL A;  4F7Z A;  2D3B A;  4IWP A;  2DAJ A;  4M0W A;  3DVN V;  2AX5 A;  2IO3 B;  2KAC A;  4OW0 A;  5G5H A;  1EU4 A;  3VTU A;  1L0X B;  4TSS A;  3ECI A;  4NZL B;  3N20 C;  3NJT A;  2DLB A;  3B08 A;  3VUW A;  4BOZ B;  4RGN A;  1FRR A;  4MEM A;  3CIR B;  1WGG A;  1E8X A;  4MM3 A;  1F0Z A;  1WYG A;  2LHD A;  4NY0 A;  5HKH A;  3J9C A;  2WXM A;  3RT3 B;  1GAQ B;  3IHP C;  2MW5 A;  1SIJ A;  2ZZP B;  3Q3F A;  4RFB A;  1K52 A;  4XWT A;  2HJ8 A;  4MGZ E;  2NCN A;  3VRA B;  2KVR A;  1Y56 A;  3R2T A;  3VUX A;  2JU6 X;  1L6V A;  1WXS A;  4K1R B;  4AQ7 A;  4GMV A;  3RCZ A;  1FPY A;  2GMI C;  2WNM A;  2LD9 A;  5H92 C;  2HTH A;  2FCN A;  1WE6 A;  2C7M B;  1XLP A;  5DCN A;  3PLU A;  4QAY A;  2JX5 A;  4ZDV A;  1QF6 A;  1Q1O A;  4S17 A;  1N60 A;  4DDG D;  3U52 E;  4DBG A;  4P16 A;  3UF8 A;  2JWZ A;  3DBL B;  3ZKJ C;  1D6E C;  4NJ7 A;  3L0W B;  1L0Y B;  1BUI C;  1JWU D;  3PHX B;  3RFZ B;  3UI3 A;  1D5M C;  2GRI A;  4XGA B;  3VDZ A;  2WXH A;  3MC9 A;  5HI1 A;  4PS3 A;  2M56 B;  5HFY A;  4JWS C;  1MHH E;  3C0R B;  4M0W B;  3UIN B;  1SF0 A;  1C9F A;  2DWQ A;  2WXL A;  3H6N A;  4P6V F;  1WRD B;  2M0X A;  2V3P A;  4IUM B;  4XWW A;  5IOI A;  3NG0 A;  4TV3 A;  2WP9 B;  1DYQ A;  2IGH A;  1F52 A;  3NY5 A;  4ARI A;  3IXS A;  1ET6 A;  2WYQ A;  4FBJ B;  3C8Y A;  3DWG C;  4MM3 B;  2FCS A;  1WY8 A;  1UZX B;  4GB9 A;  1OTR B;  1T5X D;  1WX8 A;  3BZD B;  1SEB D;  5BMG A;  3W1S A;  4IM3 A;  4BAX A;  2BW2 A;  3FIL A;  3JVZ X;  2FAZ A;  2RSU A;  3CSF A;  1F1H A;  1UBI A;  2K8B A;  3EHV A;  1C78 A;  2KC2 A;  2FE8 A;  2QC8 A;  1J0G A;  1KFY B;  3RNC C;  4HRS A;  3KW5 B;  2NBU A;  2R2O A;  4P7I A;  3TSS A;  2LRW A;  4RGO S;  4FN2 A;  3BWU D;  1HEZ E;  2O2V A;  1K50 A;  2KTF A;  3WCQ A;  1MG4 A;  3ZRF A;  4CHK A;  2N7D A;  3BYT B;  2WDV B;  3V05 A;  4G3X B;  2VH1 A;  4GSW A;  2IY0 B;  2FIF A;  4ANW A;  4PYU A;  2Z8L A;  4HKQ A;  4OZA A;  3ZJV A;  2IO1 B;  4MGY E;  4WWN A;  1FXI A;  2WXI A;  1VD2 A;  3TEW A;  3CWI A;  5C1Z A;  3V60 A;  1J7A A;  3MHS D;  2WHI A;  1HZ6 A;  1JQ4 A;  2E6X A;  3LDZ E;  4LTU A;  3Q3J A;  3BK1 A;  2MH7 A;  2RGF A;  3B2F A;  5G2N A;  2QCZ A;  2ONQ A;  3GOE A;  3PZD A;  1WM2 A;  2KWC A;  5BYR A;  2BBC A;  4YTM B;  4GU2 A;  4FHK A;  5AZH A;  1N61 A;  3DBR B;  3FIL B;  4W9J A;  1J19 A;  3ZNI D;  3WAN A;  5CHV C;  1AW7 A;  2RDB C;  2ZNV B;  4RM9 A;  4M01 A;  3RNB C;  3KVF B;  2ACZ B;  3U2S C;  2JZP A;  1YOV B;  3V3X A;  2PJH A;  5IP4 D;  4HCN B;  4ASW C;  3RYT A;  4CO7 A;  3EEC A;  5I4D A;  2MJD A;  1WR1 A;  1SE3 A;  2KNB A;  1MG8 A;  1XCQ L;  4REZ A;  4LNI A;  1ESF A;  3VRB B;  1VR9 A;  4XZ4 A;  1V2Y A;  3APD A;  4E3C A;  2HJ1 A;  1JWB D;  3U4E G;  3AN1 A;  4BKT A;  3PRE A;  3QAR A;  1TS3 A;  5DPS A;  2KAJ A;  2IPK D;  3P2B A;  2N9E B;  4M8N A;  2KWV B;  2KQS A;  2OED A;  4HPP A;  3VHT C;  3SDL C;  4GGQ A;  1A5R A;  3KUZ A;  2DBY A;  2ZVN A;  3QIJ A;  1JCK B;  5D3I B;  1DOY A;  1M4V A;  3PRZ A;  3OJ4 B;  2IBI B;  1UUP A;  1YX6 B;  4YWG G;  3DBL I;  4WWO A;  5JHB A;  3A9K B;  1ZDV A;  2QHO A;  3AE8 B;  4A9A A;  2GBK A;  4FJV B;  4W9D A;  1NI3 A;  2M0A A;  2KAN A;  3A4S C;  1XD3 B;  4TKN A;  1P1A A;  4M8M A;  4MGI E;  3AH7 A;  2ASQ A;  2WDQ B;  4MT5 A;  2PVG C;  2IY1 B;  4N58 A;  2AWT A;  1QOA A;  2FUG 1;  2WU2 B;  1ZDX A;  3AE4 B;  1MHX A;  1I7H A;  2HDE A;  2H89 B;  4NJC A;  4YSX B;  5IKC M;  3BVG A;  3EC8 A;  1CJE A;  4ICV A;  3IT4 B;  3WAP A;  1V5O A;  4WIP A;  3FAH A;  2BS2 B;  5CX3 A;  3AEG B;  4L23 A;  3AE9 B;  2D3C A;  2PW9 A;  4DXA B;  1C77 A;  2AYO B;  4XDC A;  3HUI A;  3TJP A;  1KOT A;  2LEK A;  1WJN A;  3WA0 A;  2KXJ A;  1ET9 A;  1D5Z C;  3L17 A;  3W5U B;  2AEH A;  2D3A A;  2PMV A;  3E9S A;  1V80 A;  4A90 A;  2PIA A;  4MEL A;  4ZRJ A;  4JL9 A;  1N5W A;  4BZA A;  2V4I B;  1MFW A;  2AL3 A;  5IA7 A;  3KUD B;  4EZL A;  3CST A;  2KDE B;  2UU7 A;  3VFK A;  2CJO A;  2GBJ A;  2ZEQ A;  2BT6 A;  5FK9 C;  3PVL A;  3GZN B;  1E90 A;  4D2K A;  2L05 A;  4HJG E;  1TJE A;  3W2D A;  1VRA B;  1KTK A;  3ML9 A;  1XLQ A;  4OVU A;  2MP2 A;  1ZXH A;  4XYC A;  1HA5 A;  4OZC A;  1I4Q A;  4WWP A;  3M3J A;  4ITK A;  4XC2 A;  2D3G A;  2V1Y A;  2K25 A;  4RGM A;  3NHE B;  2BVC A;  2MBB B;  1UGJ A;  3C19 A;  2O6V D;  4GIV A;  2LZ6 A;  4B6W A;  1XLN A;  2RPV A;  3QX1 A;  3RNA C;  1L5P A;  3NS8 A;  2K3U A;  3DBR I;  5E6N A;  2UYZ B;  3NOB A;  3A9J A;  5BMH A;  3PRM B;  4RNA A;  2Z0E B;  2JF5 A;  4AJW A;  2OOB B;  2ZPY A;  4EUT A;  1FIQ A;  5KHQ A;  4US9 A;  3VTV A;  1GOZ A;  2Y5C A;  3ZVV A;  4WWM A;  2GI9 A;  2E3T A;  3I9V 1;  3L13 A;  1F2R I;  2W54 A;  3D32 A;  3P63 A;  2AQ3 B;  4FJZ A;  1MPE A;  4KVG B;  1N6Z A;  2VH2 A;  2WGS A;  1D5X C;  2N9X A;  2NMQ A;  3K9O B; 
#chains in the Genus database with same CATH homology
 2WNM A;  4DXG A;  2RDH A;  5H92 C;  4WAF A;  3NVV A;  1QIL A;  1JRP A;  1RYJ A;  1XLP A;  1RFK A;  4O1N A;  4FXC A;  2JX5 A;  3AB5 A;  4USA A;  1KH0 A;  4TMA B;  5FKA C;  1QF6 A;  1N60 A;  3U52 E;  1EWC A;  4CQN A;  2RMM A;  4P16 A;  5EE0 A;  4MAC A;  1I4H A;  1ZP0 B;  1D6E C;  4IKG A;  1YN5 A;  2RDG A;  3E56 A;  3LB8 C;  3O13 A;  1PDX A;  4KKJ A;  1PGB A;  1L0Y B;  1WWT A;  2ZW0 A;  2WQY B;  4RH6 A;  5JXV A;  1BUI C;  3AE2 B;  1JWU D;  4ZOH C;  3RFZ B;  3PZ8 A;  3UI3 A;  1D5M C;  3P4R B;  4Q2J A;  2GRI A;  4NAW B;  2Q5W D;  1YJI A;  2WXH A;  5HI1 A;  2M56 B;  5HFY A;  4JWS C;  1MHH E;  2CJN A;  1SF0 A;  1MVK A;  4HKZ E;  1Q10 A;  4UDU C;  1R7S A;  1C9F A;  1L6U A;  2DWQ A;  2WXL A;  3AED B;  1XXG A;  3SFE B;  2ON8 A;  4P6V F;  2V3P A;  2M19 A;  3TEY A;  2AQ2 B;  1VDV A;  3KWL A;  4XWW A;  2IDY A;  1FCL A;  1NEN B;  1JRO A;  2WP9 B;  1DYQ A;  1AN8 A;  2IGH A;  1TYG B;  4ARI A;  3IXS A;  4OZB A;  2MJE A;  4GDL B;  1ET6 A;  5G5G A;  2WXR A;  3C8Y A;  3DWG C;  1ZE3 D;  4MM3 B;  4OHJ A;  1F77 A;  3NVZ A;  4KKI A;  3HRD D;  1IGD A;  1NVI D;  1L4D B;  1TKY A;  2L1A A;  2OHF A;  1P7F A;  1T5X D;  1I4R A;  2WXO A;  1SEB D;  2NTT A;  3BZD B;  5BMG A;  3W1S A;  1FFV A;  3Q8F A;  2BW2 A;  3FIL A;  3AE5 B;  2QIE B;  3BVM A;  1PFD A;  3BII D;  1MI0 A;  5TSS A;  4RGT A;  1WGK A;  3ABV B;  2LUM A;  2JQR B;  5MPO A;  1C78 A;  3KWV A;  2BS4 B;  3Q8B A;  2FE8 A;  3FC4 A;  3Q69 A;  4DXF A;  1KFY B;  4GLS C;  2IGD A;  4HRS A;  3DWM A;  3ZYY X;  3W5V B;  3AE1 B;  4RF0 A;  5EE1 A;  4IOI E;  3TSS A;  2INP E;  1C4C A;  2PKO A;  3NVY A;  3Q8E A;  4RGO S;  3BWU D;  2K5P A;  1F2R C;  1HEZ E;  1OFF A;  1K50 A;  4JX1 C;  3WCQ A;  2MJ3 A;  2K22 A;  2N0S B;  4WUR A;  4US8 A;  1DGJ A;  1FNV A;  3T3O A;  3BYT B;  1V8C A;  2WDV B;  2ICI A;  1GB1 A;  3V05 A;  1L0V B;  4A6Q A;  1QLB B;  1VZ6 A;  3URY A;  3GS2 A;  1FRD A;  2VZK B;  4ZRP A;  3AEF B;  2B76 B;  3KQ4 A;  4HRO A;  4KGR A;  2Z8L A;  2N7J A;  4HKQ A;  4OZA A;  3MJ5 A;  1ZOY B;  2MEK A;  3ZJV A;  1PGX A;  1ACC A;  1SB3 C;  3EUB 2;  2K9X A;  2JSV X;  3P4Q B;  1B9R A;  1FXI A;  2WXI A;  4JWU C;  1KRH A;  2JWU A;  3TEW A;  2X38 A;  3GB1 A;  5T8I A;  1VZ7 A;  1V97 A;  3NVW A;  2WXQ A;  5AUI A;  3W9C B;  3CWI A;  4ZHP A;  1N62 A;  2INN E;  5BMI A;  1J7A A;  1HZ6 A;  1AYF A;  1JQ4 A;  2E6X A;  4LTU A;  3U7Z A;  1VJK A;  3SR6 A;  3TEX A;  2K0P A;  3BK1 A;  2MH7 A;  1SBB B;  4IDI A;  1N63 A;  3AEB B;  1ROE A;  3B2F A;  1IGC A;  2L32 A;  2WXN A;  1TS2 A;  1I4G A;  2ONQ A;  1AWD A;  4J3O D;  5BYR A;  2QJL A;  1FXA A;  1WRI A;  2WDR B;  3LYY A;  1T3Q A;  3SFD B;  2BBC A;  1HZ5 A;  1K53 A;  2N9K A;  2DYO A;  3PO0 A;  4YTM B;  2HTM E;  4N59 A;  5D3D A;  4YTN B;  2H88 B;  1N61 A;  3FIL B;  1TZO A;  4TQ0 A;  2J42 A;  3RPF C;  1SJH D;  1AW7 A;  4C7Y A;  4YSY B;  1CZP A;  4B0M A;  2ACZ B;  2LGI A;  3U2S C;  3EA6 A;  4YXD B;  3MP9 A;  1YN4 A;  2JZP A;  2KMM A;  4RCO A;  3Q8C A;  1UWM A;  3V3X A;  2BYT A;  4A8X C;  2JYT A;  4YT0 B;  5E6J A;  3TUO A;  1YJJ A;  1JWS D;  5EE9 A;  1KF6 B;  4ZRQ A;  5I4D A;  4OVZ A;  2MJD A;  3R8B A;  3BYY B;  1I4X A;  1SE3 A;  3IAS 1;  1JWM D;  1VZ8 A;  1XCQ L;  2W3S A;  2WXF A;  4REZ A;  2QSD A;  3NUH B;  1QOB A;  1ESF A;  4C80 A;  4WH4 A;  5C3J B;  3R2I A;  1JAL A;  3VRB B;  1VR9 A;  4A55 A;  2WXK A;  2IGG A;  1JWB D;  1TY2 A;  1K51 A;  2V3N A;  2LMC A;  3U4E G;  3AN1 A;  1A70 A;  2D5G A;  1SE2 A;  2JXT A;  2CU3 A;  2PLP A;  3VR9 B;  1QT9 A;  1TS3 A;  3I57 A;  2V0G A;  2G9H D;  1JW9 D;  1XF5 L;  1TS4 A;  2KAJ A;  2J4X A;  2IPK D;  1CQV A;  1STE A;  1YN3 A;  2OED A;  3AMZ A;  3Q8A A;  1PYW D;  3P4P B;  2EKI A;  1C76 A;  1ZUD 2;  1BXT A;  3AM9 A;  1BML C;  3OWE B;  3ZJT A;  2L83 A;  1FM0 D;  1JML A;  2DBY A;  2R61 A;  1FEH A;  5H8Y E;  2G1E A;  1TKE A;  1JCK B;  4KX6 B;  1YMH E;  4LLG M;  5D3I B;  1DOY A;  2WXP A;  1M4V A;  1OQR A;  3P42 A;  3AEE B;  3T3N A;  1FNW A;  2PVO D;  1UUP A;  2LFI A;  4YWG G;  3PZ7 A;  1RM6 C;  1ZDV A;  4HEA 1;  3AE8 B;  3LXF A;  4A9A A;  1XCT L;  5BYQ A;  1J7C A;  1PUT A;  3AEA B;  1J7B A;  1NI3 A;  1IUE A;  1GPX A;  1I4P A;  4KGT A;  2J52 A;  2M0A A;  3P4S B;  1E9M A;  3B9J A;  3MHZ A;  3GP7 A;  2I2Y A;  3IT6 B;  3ZQ4 A;  3HVZ A;  3AH7 A;  1T6B X;  3IAM 1;  1CK1 A;  1E0Z A;  2WDQ B;  4MT5 A;  2PVG C;  4N58 A;  1FCC C;  1B1Z A;  4TQ1 A;  2VZK D;  2FBW B;  2N9L A;  2TSS A;  1SE4 A;  1QOA A;  4ZHO A;  1V1O A;  2FUG 1;  1ZDX A;  2WU2 B;  3AE4 B;  3L4P A;  1MHX A;  4R3D A;  1DOI A;  1I7H A;  2AQ1 B;  3VQI A;  3NRZ A;  3BK2 A;  4MH8 A;  2J53 A;  3TEZ A;  2HDE A;  2H89 B;  3B2G A;  4NJC A;  4YSX B;  4PT5 A;  3BVG A;  3ZGZ A;  1D4B A;  1SJE D;  2W3R A;  1CJE A;  4RF1 A;  3IT4 B;  2QEJ C;  4WQM A;  2W82 A;  1YQ3 B;  1QOF A;  1FD6 A;  1UWX A;  1JWA D;  5HG2 A;  4WIP A;  2BB6 A;  3FAH A;  2BS2 B;  5GXG B;  3VR8 B;  2QIL A;  3AE3 B;  2LJI A;  3N9Y C;  1C4A A;  3AEG B;  1IBX B;  5LNK 1;  4L23 A;  1ZXI A;  3MFG A;  1EU3 A;  3AE9 B;  3ETR A;  2WXJ A;  2PW9 A;  1C77 A;  4XDC A;  4EE2 A;  3HUI A;  2Y3A A;  3H8H A;  4L2Y A;  5C2T B;  1UNS A;  1YQ4 B;  1FNU A;  2LEK A;  1KLG D;  2DYM A;  3AE6 B;  1ET9 A;  2Y5P A;  1D5Z C;  3W5U B;  2PTL A;  2PMV A;  5AUK A;  3AE7 B;  2BB5 A;  4KGS A;  4XDD A;  1DOX A;  3E9S A;  1HQR D;  4ARC A;  4L1B A;  4A90 A;  2PIA A;  1XEE A;  4ZYS A;  4JE3 B;  1N5W A;  2V4I B;  2SEB D;  2WXG A;  4YTP B;  4H2A A;  3NS1 A;  2IJ0 A;  5D7G A;  2KN4 A;  4N6E B;  2KQ4 X;  2KDM A;  1C4P A;  1NYR A;  1VLB A;  1RWS A;  1SSN A;  1L4Z B;  1FO4 A;  3ZJU A;  1EM7 A;  4C7Z A;  4LK0 M;  5FR3 A;  1FFU A;  3AV8 A;  2CJO A;  1WSP A;  5EE3 A;  1IBX A;  2WU5 B;  1TY0 A;  1P7E A;  3AEC B;  2W55 A;  2BT6 A;  5FK9 C;  4D2K A;  2WS3 B;  1SXT A;  4HJG E;  2JYE A;  1C79 A;  1TJE A;  3W2D A;  3P1M A;  1LO5 D;  4AS1 A;  1VRA B;  1TKG A;  1KLU D;  1EWY C;  1KTK A;  1PGA A;  1E7P B;  1XLQ A;  4JPS A;  2EEL A;  1ZXH A;  1ZPS A;  1HA5 A;  2BS3 B;  1I4Q A;  2KWD A;  4OZC A;  2ZW1 A;  4NAM A;  2I38 A;  4ITK A;  1XO3 A;  2YEP F;  1E10 A;  1V1P B;  2LHE A;  4M0W A;  2AX5 A;  1E6E B;  1FMA D;  1QQR A;  1NYQ A;  2KAC A;  4OW0 A;  1XLO A;  4RGM A;  5G5H A;  1EU4 A;  1QKZ A;  2NTS A;  1L0X B;  4TSS A;  1UGJ A;  4NZL B;  3BVZ A;  4YSZ B;  1XLN A;  2RPV A;  1OQQ A;  1L5P A;  2DLB A;  2K3U A;  4DQO C;  1GB4 A;  2L52 A;  3SEB A;  4RGN A;  1FRR A;  4B0E A;  3CIR B;  5BYS A;  1HXY D;  1F0Z A;  1WYG A;  2YEP B;  2LHD A;  5BMH A;  1NEK B;  4XE0 A;  1WXQ A;  4RNA A;  3MC0 B;  3EGR A;  3J9C A;  2WXM A;  2WLB A;  1YNT E;  1FIQ A;  1GAQ B;  2XNA C;  4US9 A;  1GOZ A;  4C56 C;  1ENF A;  2Y5C A;  2GB1 A;  2SAK A;  1SIJ A;  4WWM A;  3KLS X;  2GI9 A;  4RFB A;  4GDK B;  2E3T A;  1V1P A;  3HVD A;  1K52 A;  3I9V 1;  4XWT A;  1F2R I;  2W54 A;  2BTE A;  3P63 A;  2AQ3 B;  3VRA B;  2QMT A;  1TS5 A;  1MPE A;  1Y56 A;  3R2T A;  2JU6 X;  1L6V A;  5HHD G;  1QOG A;  1D5X C;  1N5X A;  2NMQ A;  2XN9 C;  4AQ7 A;  3NZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...