2JYEA

Human granulin a
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
72
structure length
72
Chain Sequence
AMDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQKLAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granulin A
publication title Structure dissection of human progranulin identifies well-folded granulin/epithelin modules with unique functional activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 3
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00396 Granulin Granulin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.500 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jyeA01
2JYEA 2JYTA
chains in the Genus database with same CATH superfamily
3ZLZA 4HRSA 1FD6A 1E5WA 3CWIA 4JGHB 3VTUA 2LVOA 2MRPA 4MJSB 5IP4D 2K25A 2LGIA 2LJ5A 3RCZA 2G3QB 3IHPC 2DAJA 3EA6A 4BBNC 4EUTA 2G9HD 2WXKA 4I6NB 3MC0B 2JPHA 3DBLB 3JYUA 3Q3JA 2D5GA 1OFFA 4L2YA 3VH4B 1IPGA 1WI0A 2KVRA 4DXFA 2AEHA 1LM8B 1E8ZA 2BYFA 4BOSC 1Q0WB 5L95C 5TR5A 1WM3A 1F77A 3Q3OC 1E10A 1NVID 2KTRA 4WJOA 4BKGA 1PGAA 2KFJA 5LXHA 4IDIA 3KH0A 1STEA 2ZJDA 2Y3AA 3RZFA 4OZAA 3QARA 3VTVA 4YSXB 4BZAA 1TKYA 3A9KB 1SEBD 3Q8BA 2WGSA 4NAMA 3CSFA 3PT2B 3RNAC 4FA6A 1KLGD 2C9WB 2N0SB 3AXCA 4KSLC 4FADA 2JWZA 2GBJA 4II3B 1KM7A 1GNUA 5CX3A 2EELA 4GXBA 3HUIA 3UQAA 2OJRA 3TEXA 3J9CA 5GMVA 1L2NA 2LVPA 4EKUA 3RNBC 4BBNF 2WXLA 1D5XC 2PPHA 3L17A 3WA0A 1WXAA 2KYWA 3Q8AA 2L7RA 1OEYA 3VAWA 1N5XA 4IWOA 4KDIC 2O2VA 3BK1A 5DPTA 3WAMA 3OJ3A 2C60A 1YD8U 3L08A 3AE8B 3Q8FA 3PVLA 3ZTDA 1R7SA 3RNFC 2HD5B 2ZVOA 1V5OA 4MT5A 3DWGC 1JQ4A 1FM0D 2JRHA 4JLCA 2LXCA 2RMMA 3V62A 1XEEA 2KKCA 2LJIA 3AE7B 3ONSA 4M8MA 1E0ZA 1JWBD 2AWTA 2AQ1B 5J17A 1ISNA 2HJ1A 4I6PA 1T3QA 2KN4A 5IKCM 3R7QA 1RM6C 1GJZA 1QOBA 3ZNGC 1UH6A 2LRWA 3AU4A 5BYSA 5IA7A 3V60A 1UBIA 5TSSA 2KJHB 2BTEA 1I42A 4TUUA 2K8HA 5JZEB 4BVUC 5KHOA 2PVOD 2MBEA 3ML9A 5IOIA 3URYA 4IC7B 1K8RB 1V9JA 4M01A 3TJPA 4NAWA 3LB8C 2XK5A 1TS3A 3H7SA 3IAS1 4GDKA 3AEBB 1WYWB 3V6CB 2BT6A 2C7HA 1WR1A 2J0MA 2HDEA 4PT5A 2REXA 2DZIA 2XBBC 4EFOA 2YEPB 1KOTA 2FCSA 1KTKA 4P7IA 3TUOA 1BXTA 1WY8A 1ZGUB 4F8CB 2V0GA 3UIOB 1YMHE 3AMZA 2KQSA 3FKYA 2L32A 2IO2B 4M00A 3ZDTA 4BAXA 2JF5A 2KJ6A 3T3NA 3PLUA 1EWCA 2KNBA 1UELA 4C00A 2KT7A 2Y5CA 3W5VB 4W9JA 4NJCA 2J4XA 2DNFA 4HDOA 4IG7B 3ZGZA 1V1OA 2DYOA 1H8CA 2ZEQA 2L52A 2KWUB 3ABVB 4KSKC 3RULA 4NQLB 2WQYB 3R2TA 3OAWA 3Q14C 2IZVB 3PHXB 2KAJA 2ZZPB 4CO7A 3DVNU 3MC8A 2MLBA 2ZW1A 1EM7A 3BIID 3FILA 2A4ZA 2DWQA 1LQBA 1TJEA 1V5TA 4K3BA 4OVVA 4FBJB 3GP7A 4REZA 1QOAA 3N20C 1FIQA 2JUOA 5DPSA 2GLSA 4IUMB 2CHZA 4M0WA 3MP9A 5LNK1 2WXQA 4II2B 2JVCA 2WXJA 3NRZA 1V8CA 1TBEA 4ANVA 1TYGB 4LNKA 3QJZA 3RT3B 3L54A 3SD5A 3DCGA 2N9PC 3NHEB 2NPTB 1QF6A 3UIPB 5IN7A 3OLMD 4A9AA 2FUG1 2W54A 4WAAA 2BS2B 3A9JA 1SIJA 1YIWA 1F1HA 3NZ3A 2R2QA 1ACCA 3RUIB 1SE9A 4BKTA 3ENEA 1KFYB 4GSWA 4K3CA 4WWNA 1XCTL 3CF6E 2GBRA 1CJEA 2INNE 2KQ4X 2PMVA 2IPKD 1WE6A 1YJIA 1ENFA 1P3QU 2N1VA 4B9KA 1OGWA 1L7YA 2KJRA 2K8BA 2ICIA 5CHWA 4YXDB 3ZKJC 1Y8RC 1NEKB 1TTNA 1C79A 1C77A 3AH7A 2QJLA 4BOZB 3C8YA 5G5GA 2DAFA 1HZ6A 2GBNA 2MHJA 2WYQA 2WXGA 1NBFC 2DZJA 1FEHA 1V80A 3V61A 2INDC 3LYYA 3R66C 1SJED 2G45B 2YLMA 4N59A 4USAA 4ZRPA 2RPQA 3P4SB 1Z5SB 3H6NA 2GRIA 4GDLA 4FHJA 1J19A 2X38A 3BK2A 2QEJC 1ZP0B 3HVZA 1D3ZA 3RD2A 3N3KB 2KD0A 2GB1A 2MBBB 1C4PA 2KXJA 3ETRA 1HQRD 5FR6A 3TSSA 4IM2A 1ZXHA 3UINB 4XZ4A 3K9OB 2CU1A 3PREA 3QC8B 1AWDA 4B95A 5HHDG 1S1QB 1AW7A 4C7YA 1WX7A 4Q2JA 4AJWA 1SF0A 2ZNVC 5IAAC 2N7EA 4OHJA 2KTFA 4W9EA 2N7JA 4P6VF 3JW0X 4O1NA 4DQOC 3BYTB 4C7ZA 2JWUA 3Q3FA 4RF1A 2BB6A 4DDID 2R61A 2WU5B 2V4LA 3JVZX 2UU7A 3W2DA 4GN1A 1N60A 3QA8A 1J7AA 4MELA 1WJNA 1FNWA 1WXQA 1P7FA 3A33B 2KTRB 1C78A 1T5XD 1JRPA 4J6IA 3Q69A 4LNOA 2D10A 1HTQA 3IFWB 1JWMD 1J8CA 2BYEA 1I4QA 1LGRA 1P9DU 2CJNA 2UWQA 4E3CA 4IWQA 4JX1C 4N9F4 3DVGX 1HXYD 3B2GA 1P7EA 2KDIA 2KDEB 4D2KA 3PV1A 4B0MA 2INCC 3L10B 3SHQA 3CIRB 2N4FA 1VZ7A 4RGNA 2K3UA 4W9KA 3W9CB 1JCKB 3MHZA 3D32A 4AJYB 3GS2A 1NYQA 2KWVB 4M02A 2D3GA 4KGSA 2QMTA 1WXVA 4RM9A 2WXFA 4TQ0A 2JT4B 1A5RA 4FLHA 4OW0A 5AZGA 2GMIC 4MM3A 2BB5A 2M17A 3MFGA 1ROEA 2V3NA 2PJHA 1UWMA 1E7PB 3E9SA 3DPDA 2WS3B 1QZEA 5FK9C 2O2VB 1MPEA 1YN3A 3U4EG 3ZTCA 2UYZB 2BWFA 4A6QA 1NDDA 3QHTA 3PO0A 2IO0B 3V05A 2D2QA 5DCNA 3U30A 1L5PA 1P98A 2V3SA 3L4PA 2BKRB 1OQQA 2VZKB 1QOGA 2M1MA 4PYZA 1UBQA 2BF8B 4M8NA 1TY0A 4TQ1A 4YT0B 1FNVA 2IY1B 3B2FA 4G50A 3CSTA 2DLBA 5AUIA 4NJ6A 2TSSA 2GBMA 2ZW0A 3GB1A 3BYYB 4NZLB 4HCPB 3U7ZA 2WXRA 1WX8A 1RFKA 4E71A 2KC1A 2KANA 2WDTB 2K39A 2PLPA 3DBHB 2O6VA 1T0YA 3ZNZB 2W3SA 2L00B 4P1BC 2LRUA 3PZ8A 1D5MC 2HTME 2YEPF 2ZCCA 2G1EA 2ONQA 1B1ZA 1RAXA 2I38A 1JROA 1IBXB 1TGZB 2I1JA 3NY5A 2AL6A 4B6WA 3W5UB 3VDZA 1YN4A 1UF0A 4XWWA 1DOXA 1GPXA 1L6VA 2K9XA 3AE1B 4EZLA 3IT6B 3DHIC 3N32A 4NAWB 3ZUNA 3B9JA 2XK5B 3N9YC 4GDKB 1CMXB 4AS1A 1PGXA 2D3BA 4ZDVA 3PTFC 1XQQA 4DWFA 3NVVA 2LD9A 3Q8CA 1N61A 2ZPNA 2MEKA 4WJQA 3AEAB 3HM3A 2KMCA 1YQ4B 1OQYA 1GOZA 4K81A 1FRDA 3KUZA 4KX6B 1VZ8A 3WCQA 2L3ZA 4HJKA 1CQVA 1J7CA 3X0WA 1YNTE 2JYTA 2M19A 4E74A 4ICVA 1KH0A 3P4PB 5J18A 1UGMA 3R8BA 4ANUA 4W9FA 4S0RA 4LLGM 2MBHA 3AECB 4LJPB 3M3JA 1UGJA 3ECIA 4WJPA 2HJ8A 4K7UA 4EEWA 2WU2B 2K0PA 3U8ZA 5AZFA 1L0YB 4RFBA 3HIZA 2WXMA 1T6BX 2SAKA 4XGAB 3FILB 1FXTB 1WX9A 3AEEB 2LGSA 3TMPB 2MJDA 3VR8B 1KLUD 5BYQA 1YQBA 5CHVC 2IO1B 1HEZE 3HHMA 2RPVA 1TKGA 2N9KA 4M0WB 2RSUA 3NUHB 3R3MA 3AE3B 5HG2A 2DZKA 1V81A 4YL8A 2WLBA 1KJTA 1XLPA 1I4PA 3WALA 1E8YA 1BUIC 4EZKA 4GMVA 2V3PA 3ML8A 5T8IA 5D7GA 2ZNVB 1L0VB 2WXIA 3QK0A 4A8XC 1WF9A 2BBCA 1RFAA 3QWZB 1E7UA 4HPPA 4DK5A 5LLIA 4LCDE 2D11A 2K1FA 3GZNI 1C1YB 3A9JB 1GUAB 5AUKA 2LI5A 2J53A 3WAPA 3C0RB 4GOCA 5HFYA 4HK2A 5D3IB 2JYEA 3B08A 1P1AA 1JALA 1WIAA 1Q1OA 4IM3A 2IGDA 2KO3A 4ARIA 4G0NB 3DBSA 2BQQA 2C7NB 1F52A 2EMTA 4WQOB 1EUVB 3Q3MC 3AE2B 4KVGB 3RZWC 1SB3C 2KMMA 4H2AA 3DBRI 3O65B 2KMAA 2M8SA 2FE8A 3H8HA 4L1BA 4US8A 2LZ6A 2CR5A 2DZMA 1TKEA 2IBIB 2CU3A 4CHKA 3M95A 1D6EC 2MSED 1ZE3D 4MSMB 4OZBA 2MQJA 3APDA 3AE6B 1ZUD2 4LNFA 2IO3B 1VCBA 1IYFA 4RGMA 2WDRB 3SEBA 1WR6E 1FXAA 2KDBA 1D5ZC 1V1PA 4GDLB 4W9DA 1YQ3B 2KLCA 2RGFA 1WXMA 3IVFA 3N30A 1E7VA 1NI3A 3GE3C 3ZJTA 1GB1A 1C9FA 1I4HA 3ZNID 1SJHD 5H92C 3K9PB 3UF8A 5JHBA 2G4SA 1WGGA 2LFIA 4PS7A 2NBWB 4FN2A 1FFUA 1TS4A 2Y5BB 3Q2AC 2GI9A 3RFZB 1HE8A 1MG4A 1IUEA 4JL9A 2IYDB 3UGBB 3H9DA 1FCCC 4DBGA 4PK1A 4F1SA 3SFDB 2CS4A 2BS4B 3I3TB 2RDHA 1N63A 3VRBB 4BKSD 3ZQ4A 5I4DA 1SE4A 3BWUD 4AP4C 1QLBB 3PZDA 2FNJB 2IGGA 1I4GA 3APCA 4W9HA 2G4DB 1SXTA 4B0EA 3VTWA 2LVQA 3V6EB 2PTLA 1E6EB 1NENB 1N5WA 2LHEA 4JQWC 5JHAA 1F2RI 3QAQA 4DHZE 2N1WA 4HXDA 3I5JC 1WMHA 4MACA 3NS8A 4FXCA 2LXAA 2QHOA 3PRMB 4MGZE 1LFDA 2KZRA 4DDGD 5E6JA 1F0ZA 3AB5A 3QIJA 4HDQA 1K50A 1WM2A 2K8CA 1VD2A 2FIFA 4FJZA 2C7MB 1VDVA 4IKGA 3KUDB 4ZHPA 5EE1A 4C4VA 3OWEB 2Q5WD 4KIKA 4GLSC 4MM3B 3TEZA 4IW0A 1WJ4A 2N7DA 3SFEB 3EHVA 4NY0A 2WXOA 4KGRA 3H1UA 3RI7C 1YOVB 5IO9A 1F9JA 1MI0A 1FXIA 2W9NA 4HKZE 3PPAA 2DBYA 2J42A 2WX0A 3ALBA 3VUYA 1R4MI 4JE3B 1YJJA 4LDTB 3DVNV 4XDDA 3NZUA 4A90A 4MGIE 4A3PA 1R4NI 2RD0A 2KFKB 5JXVA 5E6NA 2MX2A 4MDKE 4YSYB 3M62B 3EUB2 2AX5A 3T8MA 4LTUA 3VR9B 1WXSA 2PKOA 4DXAB 2BS3B 2WDQB 2LGXA 2KC2A 1RRBA 2MJEA 3VFKA 3AEFB 4FJVB 4YTNB 1UUPA 2O6VB 1WYGA 3MHSD 1N62A 2C5LC 2ASQA 1A70A 3I9V1 2MP2A 4MGYE 3S2AA 3PRPB 1OEYJ 4ITKA 3DWMA 3ZVVA 5JH5C 5AEKB 2BYVE 3AEDB 4AWJA 2KOXA 1JWAD 4N6EB 1HZ5A 1CZPA 2B76B 4XYCA 2LASA 3MJ5A 5CHFA 1E8XA 1WGHA 1TT5B 4P16A 3C19A 3RN9C 3NVYA 1TIFA 3KVFB 4ZHOA 3EGRA 2KQ7A 2NCNA 2V1YA 2ZCBA 3U52E 4JIOU 1FPYA 2W3RA 2DYMA 2KDFB 3MJWA 3A4RA 3NVWA 4WWMA 5FR3A 4ZRKA 4GU2A 1TS2A 2WNMA 1DYQA 5KHQA 3SDLC 1GB4A 5FKAC 3SU8X 2JY6A 2NTSA 1SIFA 2V4IB 1E90A 4KZ0A 3AE4B 1ESFA 1JMLA 1U4AA 3X23A 2BWES 3MTNB 4RM8A 5DPWA 3EC8A 4G11A 4HVBA 2K22A 4RF0A 3N1ZC 1C4CA 4HLEA 1XLQA 4NJ7A 5G5HA 2FCNA 5AZHA 1HA5A 1ZKHA 1T0SC 5H8YE 3V3XA 4S17A 4WJNA 4YTMB 1IGCA 3VRAB 2KHWB 2FCMA 2LMCA 2M0AA 3DBLI 1TZ1A 1VZ6A 3DBHI 2V9HA 2M0XA 1V6EA 3HRDD 2WXPA 1XF5L 1WJUA 3FAHA 1C76A 3EFCA 1OTRB 1FCLA 2W82A 2B3AA 1LO5D 1HTOA 4PS3A 2AL3A 2MCNB 1EF5A 1WH3A 4XWTA 3AN1A 1G6JA 5D3DA 3AE5B 2L0FA 1QT9A 3KYDD 3A1QA 4X57B 3ZRFA 3VUWA 1MHXA 4IM0A 1AARA 2MBOA 2K6QA 1Q5WB 3W1SA 5BO4B 1I4RA 4HWIB 1V49A 4LJOB 3PGEA 1ZDVA 1MG8A 2KWCA 4GB9A 2JRIB 1YX5B 1T0QC 2EKEC 3N1XC 3KLSX 1CK1A 4WWPA 4DHJD 4XE0A 4GIVA 2KWDA 2MJ3A 1JWUD 3VH3B 1Y56A 3AU5A 1ET6A 1OQRA 2OEDA 4JPSA 2XN9C 3GOEA 3ZRCA 4BFRA 1UNSA 5E6OA 4PS8A 1XO3A 3JSVA 4DXGA 5EE9A 3ZXVA 4AUQC 1EU4A 1WGRA 1D4BA 2PIAA 3BY4B 5C3JB 1M94A 2L8JA 3I63C 1VR9A 3AEGB 1YN5A 1V97A 1RWSA 3W1YA 4KKIA 3RNCC 2JXXA 2DYBA 1KRHA 1LXDA 3E56A 1XT9B 1MFWA 1E8WA 1PYWD 3VVWB 5GXGB 1V1PB 5G55A 3IBEA 5EDSA 2E6XA 3TL5A 2QILA 4KZCA 2N9EB 2EKIA 3ZO5B 3P4RB 2QDFA 1JWSD 5C1ZA 3R7RA 4AOFA 4A55A 3BVMA 3P63A 4XX5A 1F2RC 4CYEA 1KF6B 1RLFA 3CMMB 4MH8A 4WURA 1WGYA 1TZOA 5C2TB 3DHGC 1RYJA 2MA9B 4RGTA 3NZSA 1KLVA 1J7BA 2FAZA 3NVZA 3RMKC 3VHTC 2KVZA 2OHFA 2LHDA 2M4NA 2VZKD 3IT4B 4HJGE 1WE7A 2IJ0A 3DDCB 4AQ7A 3U2SC 2J0JA 3W1SC 3GE8C 2DHZA 1JW9D 3OG5A 1EU3A 3QCAA 2A5UA 1C4AA 2Z0EB 3H7PA 3ZDMC 3AI5A 4ZYSA 4G3XB 1EF1A 3UQBA 2N9XA 1WGKA 2JXTA 3EECA 3ZNHB 3DOWA 4JWSC 3T9LA 2PE9A 1WMHB 1ZXIA 2DENB 3FC4A 2GBKA 4LNIA 3B1LX 1DGJA 3OJ4B 1EO6A 2KDMA 1NI2A 2WXNA 5BMGA 4HPLB 4NQKE 2L05A 4XC2A 2L76A 3KWLA 4MJSA 1QKZA 1PGBA 3QX1A 1BMLC 3ZIMA 4YTPB 2KLGA 4HPMB 1YJ1A 1QQRA 2XEWA 5C23A 4L23A 2NR2A 2M56B 3IXSA 1ET9A 3UI3A 2Z8LA 3WIMA 4RCOA 4W9GA 2IGHA 4C4VB 4C80A 4KIKB 1QOFA 4CQNA 1BT0A 1T0RC 1XCQL 1IBXA 2BYTA 2CKHB 2H89B 1UWXA 3T3OA 4KV2A 3ZJVA 1XD3B 4FULA 3WANA 2JX5A 3LJ3A 1MHHE 1AN8A 2FUHB 1M4VA 1DOYA 1K52A 4XDCA 2QC8A 1J0GA 2PW9A 2PEAA 3TBLD 4RH6A 4ZOHC 4N58A 4R3DA 2L83A 1IP9A 4YSZB 1ZPSA 3GZNB 2ZVNA 1L4DB 2RDGA 1TS5A 3RNEC 2JU6X 3A9KA 5CTRC 1S3SG 1H4RA 5EE3A 2NMQA 3TCAA 3ZJUA 4ZRIA 1C3TA 2E3TA 2KX0A 1WJ6A 4IWPA 2LUMA 2ON8A 3PZ7A 2RDBC 4ZRQA 3HK0A 2X8XX 3AV8A 1Q10A 4LNNA 3RNGC 4KDLB 2FIDA 2JSVX 1V2YA 1Z2MA 5D6JB 3SR6A 1PUTA 2MP2B 2R2OA 2WWZA 2D07B 3DBRB 4EZJA 4US9A 3AULA 2J7QB 1DOIA 4TV3A 1VJKA 2AYOB 2IDYA 2QIEB 1QILA 4MH0E 2MH7A 4QAYA 2LEKA 3P2BA 5G2NA 1I7HA 4FHKA 4FJYA 1UD7A 2L1AA 4EOYA 4HEA1 1JRUA 4ACFA 1YX6B 3Q3NC 4F7ZA 1VRAB 2MW5A 2YVCA 3P42A 4NNJB 4ZRJA 1WZ0A 2BW2A 3O13A 3KW5B 4K7WA 2K6DB 1WSPA 2D3CA 4WWOA 3BVZA 1GC6A 4BKSA 1TY2A 2CHXA 2NBVB 2CHWA 2MBQA 1WFYA 3ZW3A 2VRRB 3N1YC 5HI1A 2WXHA 4ARCA 1IGDA 2KX3A 5D2MB 3PRZA 1UZXB 1GG3A 3Q6BA 4OVZA 3P4QB 2WX1A 4GGQA 1N6ZA 2LWPA 3DVGY 3P1MA 3IG3A 4K7SA 2INPE 4OVUA 1FNUA 3RYTA 3PS6A 3KQ4A 3LDZE 4EE2A 2MWSB 2Z59B 3RPFC 3L0WB 2H88B 3BINA 3VXWA 2QCZA 2HE7A 1FRRA 2FCQA 3APFA 2FBWB 1NYRA 2LGYA 2ZPYA 2BKFA 3IAM1 4WH4A 2BPSA 5J2RA 1XXGA 2Y5PA 1ZDXA 2AQ2B 4A3OA 2CJOA 4I6LB 4TMAB 4LK0M 1V86A 2D3AA 1K53A 2RR9A 3EFUA 3QQ8B 3B0AA 1SGHA 4NPNA 5E6PA 2QSDA 2L0TA 2PE6B 4YWGG 4WQMA 1L4ZB 2NVUI 4JWUC 1K51A 1WGDA 2ACZB 2KK8A 3Q8EA 1MVKA 5DPRA 2VH2A 4KGTA 3A1QB 3ZYYX 3KYCD 1PFDA 2WDVB 1ZOYB 3TEYA 1SBBB 3I57A 2J52A 5HKHA 2KACA 4J3OD 4ZYNA 2PVGC 2OOBB 1PDXA 1WWTA 3ZXRA 2NTTA 4A20A 3TIXA 2JZ3B 4DHZB 2EMSA 2W55A 3HVDA 4IOIE 3R2IA 4W9LA 4KKJA 2I2YA 3NS1A 4UDUC 5BMHA 4ANWA 1SE3A 2SEBD 2J0KA 1R4MB 1WRIA 3JSVB 1SSNA 3VQIA 3U7DA 2JZZA 2LGDA 1FMAD 3KUCB 1R4NB 3VUXA 4W9IA 4HKQA 3DHHC 1P0RA 4OZCA 3PLVA 4DHJB 2BVCA 2XNAC 5LXIB 2OJWA 4RMAA 1EWYC 3WAOA 2KN5A 4ANXA 4MSQB 1I4XA 1L0XB 1GAQB 4URKA 5MPOA 3A4SC 1L6UA 5BYRA 3AE9B 3TEWA 1GC7A 2NPTA 2WP9B 2JQRB 1XLOA 4HCNB 2GOWA 3LXFA 3L16A 1SE2A 1XLNA 2AQ3B 1E9MA 5EE0A 2VH1A 1WZ3A 4K1RB 4PYUA 3BZDB 2LUEA 1B9RA 4WIPA 3KWVA 4RNAA 2N9LA 4W9CA 3NOBA 2HTHA 4MGKE 1FO4A 3BVGA 1VLBA 3MC9A 1X1MA 4MEMA 3PSEB 4LDTD 2WHIA 2IY0B 4HROA 3M63B 2NS5A 3NJTA 3L13A 3HM6X 4ICUA 5D94A 2DX5B 2Z0DB 1MJDA 2JZPA 2I1KA 4C56C 3H7PB 1FFVA 2BGFA 4ASWC 3AM9A 4WAFA 5L83A 1AYFA 5BMIA 2NBUA 3PHWB 2K5PA 1PQSA 1WRDB 1ZW7A 3NG0A 2O6VD 1I35A 4P1CC 4RGOS 3DQVA 2KFKA 4TSSA 4TKNA
chains in the Genus database with same CATH topology
4HRSA 2BS4B 1FD6A 2RDHA 1AW7A 1N63A 1WGKA 4C7YA 4Q2JA 3VRBB 2JXTA 3CWIA 3ZQ4A 1SF0A 5I4DA 4JWSC 4OHJA 1SE4A 3BWUD 2LGIA 1QLBB 2N7JA 4P6VF 4O1NA 4DQOC 3BYTB 2IGGA 1I4GA 4C7ZA 1ZXIA 2JWUA 3EA6A 3FC4A 4RF1A 1SXTA 2BB6A 4B0EA 2G9HD 2WXKA 3MC0B 2R61A 2WU5B 1DGJA 2KDMA 2D5GA 2WXNA 5BMGA 3W2DA 1N60A 1OFFA 4L2YA 1J7AA 2PTLA 3KWLA 1E6EB 1NENB 1PGBA 1N5WA 1QKZA 2LHEA 1BMLC 1FNWA 1F2RI 4DXFA 4YTPB 1WXQA 1P7FA 1C78A 1T5XD 1JRPA 1QQRA 4MACA 4FXCA 4L23A 3Q69A 2M56B 3IXSA 1ET9A 3UI3A 2Z8LA 1F77A 4RCOA 5E6JA 1F0ZA 3AB5A 2IGHA 1E10A 1JWMD 1K50A 4C80A 1QOFA 1NVID 1I4QA 2CJNA 4CQNA 1XCQL 1IBXA 2BYTA 2H89B 1PGAA 4JX1C 1UWXA 1HXYD 3B2GA 3T3OA 4IDIA 1STEA 3ZJVA 1P7EA 4D2KA 1VDVA 4B0MA 2JX5A 2Y3AA 1MHHE 4OZAA 4IKGA 1AN8A 4ZHPA 3CIRB 5EE1A 1VZ7A 4RGNA 4YSXB 2K3UA 1M4VA 1DOYA 3OWEB 1K52A 2Q5WD 1JCKB 3MHZA 3W9CB 4GLSC 4MM3B 3TEZA 1TKYA 1SEBD 3GS2A 3Q8BA 4XDCA 3SFEB 4NAMA 2PW9A 1NYQA 4KGSA 2QMTA 1KLGD 2WXOA 4RH6A 4ZOHC 4N58A 2WXFA 4R3DA 4TQ0A 4KGRA 2L83A 2N0SB 4YSZB 1ZPSA 1L4DB 2RDGA 4OW0A 1TS5A 1MI0A 1FXIA 2JU6X 4HKZE 2BB5A 2DBYA 2J42A 3MFGA 2EELA 5EE3A 1ROEA 2V3NA 2NMQA 3HUIA 1UWMA 1E7PB 4JE3B 3E9SA 3ZJUA 1YJJA 3TEXA 4XDDA 2WS3B 2E3TA 3J9CA 4A90A 5FK9C 2LUMA 2ON8A 1MPEA 1YN3A 3PZ7A 3U4EG 5JXVA 4ZRQA 4A6QA 3AV8A 3PO0A 2WXLA 1D5XC 1Q10A 4YSYB 3V05A 3EUB2 2AX5A 3Q8AA 1L5PA 1N5XA 3L4PA 2JSVX 3SR6A 1PUTA 4LTUA 3VR9B 4US9A 3BK1A 1OQQA 2PKOA 2VZKB 1DOIA 2BS3B 1QOGA 2WDQB 1VJKA 2IDYA 3AE8B 3Q8FA 2MJEA 3AEFB 2QIEB 1QILA 1TY0A 1UUPA 4YTNB 1R7SA 2MH7A 4TQ1A 4YT0B 1WYGA 1FNVA 2LEKA 3B2FA 1N62A 2DLBA 5AUIA 1A70A 1I7HA 3I9V1 2TSSA 2ZW0A 4MT5A 3DWGC 3GB1A 3BYYB 4NZLB 1JQ4A 2L1AA 3U7ZA 2WXRA 1FM0D 4HEA1 1RFKA 4ITKA 3DWMA 2RMMA 2PLPA 1VRAB 1XEEA 2LJIA 2W3SA 3AE7B 3AEDB 3P42A 3PZ8A 1D5MC 1E0ZA 1JWBD 2HTME 2YEPF 2BW2A 1JWAD 2AQ1B 3O13A 4N6EB 1HZ5A 2G1EA 2ONQA 1B1ZA 2I38A 1CZPA 1JROA 1WSPA 1IBXB 1T3QA 2KN4A 2B76B 3BVZA 3W5UB 3MJ5A 1RM6C 1YN4A 1TY2A 1QOBA 4XWWA 1DOXA 1GPXA 4P16A 5BYSA 1L6VA 2K9XA 3AE1B 3NVYA 3IT6B 5TSSA 4ZHOA 4NAWB 3EGRA 3B9JA 2BTEA 5HI1A 2WXHA 4ARCA 3N9YC 1IGDA 4GDKB 3U52E 4AS1A 1PGXA 4OVZA 3P4QB 2PVOD 3URYA 2W3RA 2DYMA 3NVVA 4WWMA 3NVWA 3Q8CA 1N61A 5FR3A 3P1MA 1TS2A 2MEKA 3AEAB 2INPE 2WNMA 1DYQA 1FNUA 1GB4A 3KQ4A 5FKAC 2NTSA 3LB8C 2V4IB 4EE2A 1YQ4B 1TS3A 3RPFC 3IAS1 3AE4B 1ESFA 1JMLA 1GOZA 2H88B 3AEBB 1FRDA 4KX6B 1VZ8A 3WCQA 2BT6A 1CQVA 1J7CA 1YNTE 2HDEA 2JYTA 2M19A 1FRRA 4PT5A 1KH0A 2YEPB 2FBWB 2K22A 4RF0A 1NYRA 1KTKA 3P4PB 1C4CA 1XLQA 3IAM1 4WH4A 3TUOA 3R8BA 1BXTA 1XXGA 2Y5PA 1ZDXA 2AQ2B 2V0GA 4LLGM 2CJOA 3AECB 1YMHE 4TMAB 3AMZA 4LK0M 5G5HA 1HA5A 1UGJA 2L32A 5H8YE 3V3XA 1K53A 4YTMB 1IGCA 3VRAB 3T3NA 1EWCA 2QSDA 2LMCA 2M0AA 1VZ6A 2K0PA 2WU2B 4YWGG 4WQMA 2Y5CA 3W5VB 1L4ZB 4NJCA 3HRDD 2J4XA 4JWUC 1K51A 1L0YB 2WXPA 4RFBA 1XF5L 2WXMA 2ACZB 3ZGZA 1V1OA 1T6BX 2DYOA 1C76A 2SAKA 3FAHA 3Q8EA 1FCLA 1MVKA 2W82A 3AEEB 3FILB 4KGTA 1LO5D 2L52A 2MJDA 1KLUD 3VR8B 3ZYYX 3ABVB 1PFDA 5BYQA 2WQYB 3R2TA 2WDVB 1HEZE 1ZOYB 3TEYA 1SBBB 3I57A 4XWTA 2J52A 3AN1A 2KAJA 2RPVA 1TKGA 2ZW1A 2KACA 5D3DA 3AE5B 2N9KA 3NUHB 1EM7A 3AE3B 1QT9A 3BIID 4J3OD 2PVGC 3FILA 2DWQA 5HG2A 1PDXA 1TJEA 1WWTA 2WLBA 1XLPA 1MHXA 2NTTA 1I4PA 3GP7A 4REZA 1QOAA 1BUIC 2V3PA 2W55A 3HVDA 3W1SA 4IOIE 5T8IA 1FIQA 3R2IA 5D7GA 4KKJA 2I2YA 1I4RA 1L0VB 2WXIA 4M0WA 4A8XC 3MP9A 3NS1A 5LNK1 2WXQA 4UDUC 1ZDVA 2BBCA 5BMHA 2WXJA 3NRZA 1V8CA 1SE3A 2SEBD 3KLSX 1TYGB 1WRIA 1CK1A 1SSNA 3VQIA 4XE0A 2KWDA 2MJ3A 1JWUD 1FMAD 1Y56A 5AUKA 1ET6A 2J53A 1OQRA 2OEDA 4JPSA 2XN9C 5HFYA 4HKQA 1QF6A 5D3IB 2JYEA 4OZCA 1UNSA 4A9AA 2FUG1 2XNAC 1XO3A 2W54A 1JALA 4DXGA 2BS2B 5EE9A 1EWYC 2IGDA 4ARIA 1SIJA 1EU4A 3NZ3A 1ACCA 1I4XA 2PIAA 1D4BA 1KFYB 5C3JB 1L0XB 1GAQB 1VR9A 1XCTL 3AEGB 5MPOA 1L6UA 5BYRA 3AE9B 3TEWA 1CJEA 2INNE 2KQ4X 1YN5A 1V97A 1RWSA 2PMVA 2JQRB 2WP9B 3AE2B 1XLOA 2IPKD 1YJIA 1SB3C 4KKIA 2KMMA 3LXFA 1ENFA 4H2AA 1SE2A 1KRHA 1XLNA 2FE8A 3H8HA 2AQ3B 1E9MA 5EE0A 3E56A 4L1BA 4US8A 3BZDB 2ICIA 1PYWD 1TKEA 1B9RA 4WIPA 3KWVA 2CU3A 5GXGB 4YXDB 4RNAA 1D6EC 1V1PB 1NEKB 1C79A 1C77A 2N9LA 3AH7A 2QJLA 1ZE3D 2E6XA 2QILA 4OZBA 3C8YA 5G5GA 1FO4A 2EKIA 3P4RB 3AE6B 3BVGA 1VLBA 1ZUD2 1JWSD 1HZ6A 4RGMA 2WDRB 3SEBA 1FXAA 4A55A 1D5ZC 1V1PA 2WXGA 3BVMA 3P63A 4GDLB 4HROA 1YQ3B 1F2RC 1FEHA 1KF6B 4MH8A 4WURA 1TZOA 1NI3A 5C2TB 3LYYA 1RYJA 3ZJTA 4RGTA 1SJED 4N59A 4USAA 4ZRPA 1J7BA 3P4SB 3NVZA 1GB1A 1C9FA 2JZPA 1I4HA 1SJHD 2GRIA 5H92C 4C56C 1FFVA 2OHFA 2LFIA 2LHDA 2X38A 2VZKD 3AM9A 3IT4B 4WAFA 3BK2A 1AYFA 4HJGE 1FFUA 1TS4A 1ZP0B 2QEJC 3HVZA 5BMIA 2IJ0A 4AQ7A 2GB1A 3U2SC 2K5PA 2GI9A 3RFZB 1JW9D 1IUEA 1C4PA 1EU3A 3ETRA 1HQRD 4RGOS 1FCCC 1C4AA 3TSSA 1ZXHA 4TSSA 4ZYSA 1AWDA 3SFDB 5HHDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYE A;  2JYT A; 
#chains in the Genus database with same CATH topology
 3ZLZ A;  4HRS A;  1FD6 A;  1E5W A;  3CWI A;  4JGH B;  3VTU A;  2LVO A;  2MRP A;  4MJS B;  5IP4 D;  2K25 A;  2LGI A;  2LJ5 A;  3RCZ A;  2G3Q B;  3IHP C;  2DAJ A;  3EA6 A;  4BBN C;  4EUT A;  2G9H D;  2WXK A;  4I6N B;  3MC0 B;  2JPH A;  3DBL B;  3JYU A;  3Q3J A;  2D5G A;  1OFF A;  4L2Y A;  3VH4 B;  1IPG A;  1WI0 A;  2KVR A;  4DXF A;  2AEH A;  1LM8 B;  1E8Z A;  2BYF A;  4BOS C;  1Q0W B;  5L95 C;  5TR5 A;  1WM3 A;  1F77 A;  3Q3O C;  1E10 A;  1NVI D;  2KTR A;  4WJO A;  4BKG A;  1PGA A;  2KFJ A;  5LXH A;  4IDI A;  3KH0 A;  1STE A;  2ZJD A;  2Y3A A;  3RZF A;  4OZA A;  3QAR A;  3VTV A;  4YSX B;  4BZA A;  1TKY A;  3A9K B;  1SEB D;  3Q8B A;  2WGS A;  4NAM A;  3CSF A;  3PT2 B;  3RNA C;  4FA6 A;  1KLG D;  2C9W B;  2N0S B;  3AXC A;  4KSL C;  4FAD A;  2JWZ A;  2GBJ A;  4II3 B;  1KM7 A;  1GNU A;  5CX3 A;  2EEL A;  4GXB A;  3HUI A;  3UQA A;  2OJR A;  3TEX A;  3J9C A;  5GMV A;  1L2N A;  2LVP A;  4EKU A;  3RNB C;  4BBN F;  2WXL A;  1D5X C;  2PPH A;  3L17 A;  3WA0 A;  1WXA A;  2KYW A;  3Q8A A;  2L7R A;  1OEY A;  3VAW A;  1N5X A;  4IWO A;  4KDI C;  2O2V A;  3BK1 A;  5DPT A;  3WAM A;  3OJ3 A;  2C60 A;  1YD8 U;  3L08 A;  3AE8 B;  3Q8F A;  3PVL A;  3ZTD A;  1R7S A;  3RNF C;  2HD5 B;  2ZVO A;  1V5O A;  4MT5 A;  3DWG C;  1JQ4 A;  1FM0 D;  2JRH A;  4JLC A;  2LXC A;  2RMM A;  3V62 A;  1XEE A;  2KKC A;  2LJI A;  3AE7 B;  3ONS A;  4M8M A;  1E0Z A;  1JWB D;  2AWT A;  2AQ1 B;  5J17 A;  1ISN A;  2HJ1 A;  4I6P A;  1T3Q A;  2KN4 A;  5IKC M;  3R7Q A;  1RM6 C;  1GJZ A;  1QOB A;  3ZNG C;  1UH6 A;  2LRW A;  3AU4 A;  5BYS A;  5IA7 A;  3V60 A;  1UBI A;  5TSS A;  2KJH B;  2BTE A;  1I42 A;  4TUU A;  2K8H A;  5JZE B;  4BVU C;  5KHO A;  2PVO D;  2MBE A;  3ML9 A;  5IOI A;  3URY A;  4IC7 B;  1K8R B;  1V9J A;  4M01 A;  3TJP A;  4NAW A;  3LB8 C;  2XK5 A;  1TS3 A;  3H7S A;  3IAS 1;  4GDK A;  3AEB B;  1WYW B;  3V6C B;  2BT6 A;  2C7H A;  1WR1 A;  2J0M A;  2HDE A;  4PT5 A;  2REX A;  2DZI A;  2XBB C;  4EFO A;  2YEP B;  1KOT A;  2FCS A;  1KTK A;  4P7I A;  3TUO A;  1BXT A;  1WY8 A;  1ZGU B;  4F8C B;  2V0G A;  3UIO B;  1YMH E;  3AMZ A;  2KQS A;  3FKY A;  2L32 A;  2IO2 B;  4M00 A;  3ZDT A;  4BAX A;  2JF5 A;  2KJ6 A;  3T3N A;  3PLU A;  1EWC A;  2KNB A;  1UEL A;  4C00 A;  2KT7 A;  2Y5C A;  3W5V B;  4W9J A;  4NJC A;  2J4X A;  2DNF A;  4HDO A;  4IG7 B;  3ZGZ A;  1V1O A;  2DYO A;  1H8C A;  2ZEQ A;  2L52 A;  2KWU B;  3ABV B;  4KSK C;  3RUL A;  4NQL B;  2WQY B;  3R2T A;  3OAW A;  3Q14 C;  2IZV B;  3PHX B;  2KAJ A;  2ZZP B;  4CO7 A;  3DVN U;  3MC8 A;  2MLB A;  2ZW1 A;  1EM7 A;  3BII D;  3FIL A;  2A4Z A;  2DWQ A;  1LQB A;  1TJE A;  1V5T A;  4K3B A;  4OVV A;  4FBJ B;  3GP7 A;  4REZ A;  1QOA A;  3N20 C;  1FIQ A;  2JUO A;  5DPS A;  2GLS A;  4IUM B;  2CHZ A;  4M0W A;  3MP9 A;  5LNK 1;  2WXQ A;  4II2 B;  2JVC A;  2WXJ A;  3NRZ A;  1V8C A;  1TBE A;  4ANV A;  1TYG B;  4LNK A;  3QJZ A;  3RT3 B;  3L54 A;  3SD5 A;  3DCG A;  2N9P C;  3NHE B;  2NPT B;  1QF6 A;  3UIP B;  5IN7 A;  3OLM D;  4A9A A;  2FUG 1;  2W54 A;  4WAA A;  2BS2 B;  3A9J A;  1SIJ A;  1YIW A;  1F1H A;  3NZ3 A;  2R2Q A;  1ACC A;  3RUI B;  1SE9 A;  4BKT A;  3ENE A;  1KFY B;  4GSW A;  4K3C A;  4WWN A;  1XCT L;  3CF6 E;  2GBR A;  1CJE A;  2INN E;  2KQ4 X;  2PMV A;  2IPK D;  1WE6 A;  1YJI A;  1ENF A;  1P3Q U;  2N1V A;  4B9K A;  1OGW A;  1L7Y A;  2KJR A;  2K8B A;  2ICI A;  5CHW A;  4YXD B;  3ZKJ C;  1Y8R C;  1NEK B;  1TTN A;  1C79 A;  1C77 A;  3AH7 A;  2QJL A;  4BOZ B;  3C8Y A;  5G5G A;  2DAF A;  1HZ6 A;  2GBN A;  2MHJ A;  2WYQ A;  2WXG A;  1NBF C;  2DZJ A;  1FEH A;  1V80 A;  3V61 A;  2IND C;  3LYY A;  3R66 C;  1SJE D;  2G45 B;  2YLM A;  4N59 A;  4USA A;  4ZRP A;  2RPQ A;  3P4S B;  1Z5S B;  3H6N A;  2GRI A;  4GDL A;  4FHJ A;  1J19 A;  2X38 A;  3BK2 A;  2QEJ C;  1ZP0 B;  3HVZ A;  1D3Z A;  3RD2 A;  3N3K B;  2KD0 A;  2GB1 A;  2MBB B;  1C4P A;  2KXJ A;  3ETR A;  1HQR D;  5FR6 A;  3TSS A;  4IM2 A;  1ZXH A;  3UIN B;  4XZ4 A;  3K9O B;  2CU1 A;  3PRE A;  3QC8 B;  1AWD A;  4B95 A;  5HHD G;  1S1Q B;  1AW7 A;  4C7Y A;  1WX7 A;  4Q2J A;  4AJW A;  1SF0 A;  2ZNV C;  5IAA C;  2N7E A;  4OHJ A;  2KTF A;  4W9E A;  2N7J A;  4P6V F;  3JW0 X;  4O1N A;  4DQO C;  3BYT B;  4C7Z A;  2JWU A;  3Q3F A;  4RF1 A;  2BB6 A;  4DDI D;  2R61 A;  2WU5 B;  2V4L A;  3JVZ X;  2UU7 A;  3W2D A;  4GN1 A;  1N60 A;  3QA8 A;  1J7A A;  4MEL A;  1WJN A;  1FNW A;  1WXQ A;  1P7F A;  3A33 B;  2KTR B;  1C78 A;  1T5X D;  1JRP A;  4J6I A;  3Q69 A;  4LNO A;  2D10 A;  1HTQ A;  3IFW B;  1JWM D;  1J8C A;  2BYE A;  1I4Q A;  1LGR A;  1P9D U;  2CJN A;  2UWQ A;  4E3C A;  4IWQ A;  4JX1 C;  4N9F 4;  3DVG X;  1HXY D;  3B2G A;  1P7E A;  2KDI A;  2KDE B;  4D2K A;  3PV1 A;  4B0M A;  2INC C;  3L10 B;  3SHQ A;  3CIR B;  2N4F A;  1VZ7 A;  4RGN A;  2K3U A;  4W9K A;  3W9C B;  1JCK B;  3MHZ A;  3D32 A;  4AJY B;  3GS2 A;  1NYQ A;  2KWV B;  4M02 A;  2D3G A;  4KGS A;  2QMT A;  1WXV A;  4RM9 A;  2WXF A;  4TQ0 A;  2JT4 B;  1A5R A;  4FLH A;  4OW0 A;  5AZG A;  2GMI C;  4MM3 A;  2BB5 A;  2M17 A;  3MFG A;  1ROE A;  2V3N A;  2PJH A;  1UWM A;  1E7P B;  3E9S A;  3DPD A;  2WS3 B;  1QZE A;  5FK9 C;  2O2V B;  1MPE A;  1YN3 A;  3U4E G;  3ZTC A;  2UYZ B;  2BWF A;  4A6Q A;  1NDD A;  3QHT A;  3PO0 A;  2IO0 B;  3V05 A;  2D2Q A;  5DCN A;  3U30 A;  1L5P A;  1P98 A;  2V3S A;  3L4P A;  2BKR B;  1OQQ A;  2VZK B;  1QOG A;  2M1M A;  4PYZ A;  1UBQ A;  2BF8 B;  4M8N A;  1TY0 A;  4TQ1 A;  4YT0 B;  1FNV A;  2IY1 B;  3B2F A;  4G50 A;  3CST A;  2DLB A;  5AUI A;  4NJ6 A;  2TSS A;  2GBM A;  2ZW0 A;  3GB1 A;  3BYY B;  4NZL B;  4HCP B;  3U7Z A;  2WXR A;  1WX8 A;  1RFK A;  4E71 A;  2KC1 A;  2KAN A;  2WDT B;  2K39 A;  2PLP A;  3DBH B;  2O6V A;  1T0Y A;  3ZNZ B;  2W3S A;  2L00 B;  4P1B C;  2LRU A;  3PZ8 A;  1D5M C;  2HTM E;  2YEP F;  2ZCC A;  2G1E A;  2ONQ A;  1B1Z A;  1RAX A;  2I38 A;  1JRO A;  1IBX B;  1TGZ B;  2I1J A;  3NY5 A;  2AL6 A;  4B6W A;  3W5U B;  3VDZ A;  1YN4 A;  1UF0 A;  4XWW A;  1DOX A;  1GPX A;  1L6V A;  2K9X A;  3AE1 B;  4EZL A;  3IT6 B;  3DHI C;  3N32 A;  4NAW B;  3ZUN A;  3B9J A;  2XK5 B;  3N9Y C;  4GDK B;  1CMX B;  4AS1 A;  1PGX A;  2D3B A;  4ZDV A;  3PTF C;  1XQQ A;  4DWF A;  3NVV A;  2LD9 A;  3Q8C A;  1N61 A;  2ZPN A;  2MEK A;  4WJQ A;  3AEA B;  3HM3 A;  2KMC A;  1YQ4 B;  1OQY A;  1GOZ A;  4K81 A;  1FRD A;  3KUZ A;  4KX6 B;  1VZ8 A;  3WCQ A;  2L3Z A;  4HJK A;  1CQV A;  1J7C A;  3X0W A;  1YNT E;  2JYT A;  2M19 A;  4E74 A;  4ICV A;  1KH0 A;  3P4P B;  5J18 A;  1UGM A;  3R8B A;  4ANU A;  4W9F A;  4S0R A;  4LLG M;  2MBH A;  3AEC B;  4LJP B;  3M3J A;  1UGJ A;  3ECI A;  4WJP A;  2HJ8 A;  4K7U A;  4EEW A;  2WU2 B;  2K0P A;  3U8Z A;  5AZF A;  1L0Y B;  4RFB A;  3HIZ A;  2WXM A;  1T6B X;  2SAK A;  4XGA B;  3FIL B;  1FXT B;  1WX9 A;  3AEE B;  2LGS A;  3TMP B;  2MJD A;  3VR8 B;  1KLU D;  5BYQ A;  1YQB A;  5CHV C;  2IO1 B;  1HEZ E;  3HHM A;  2RPV A;  1TKG A;  2N9K A;  4M0W B;  2RSU A;  3NUH B;  3R3M A;  3AE3 B;  5HG2 A;  2DZK A;  1V81 A;  4YL8 A;  2WLB A;  1KJT A;  1XLP A;  1I4P A;  3WAL A;  1E8Y A;  1BUI C;  4EZK A;  4GMV A;  2V3P A;  3ML8 A;  5T8I A;  5D7G A;  2ZNV B;  1L0V B;  2WXI A;  3QK0 A;  4A8X C;  1WF9 A;  2BBC A;  1RFA A;  3QWZ B;  1E7U A;  4HPP A;  4DK5 A;  5LLI A;  4LCD E;  2D11 A;  2K1F A;  3GZN I;  1C1Y B;  3A9J B;  1GUA B;  5AUK A;  2LI5 A;  2J53 A;  3WAP A;  3C0R B;  4GOC A;  5HFY A;  4HK2 A;  5D3I B;  2JYE A;  3B08 A;  1P1A A;  1JAL A;  1WIA A;  1Q1O A;  4IM3 A;  2IGD A;  2KO3 A;  4ARI A;  4G0N B;  3DBS A;  2BQQ A;  2C7N B;  1F52 A;  2EMT A;  4WQO B;  1EUV B;  3Q3M C;  3AE2 B;  4KVG B;  3RZW C;  1SB3 C;  2KMM A;  4H2A A;  3DBR I;  3O65 B;  2KMA A;  2M8S A;  2FE8 A;  3H8H A;  4L1B A;  4US8 A;  2LZ6 A;  2CR5 A;  2DZM A;  1TKE A;  2IBI B;  2CU3 A;  4CHK A;  3M95 A;  1D6E C;  2MSE D;  1ZE3 D;  4MSM B;  4OZB A;  2MQJ A;  3APD A;  3AE6 B;  1ZUD 2;  4LNF A;  2IO3 B;  1VCB A;  1IYF A;  4RGM A;  2WDR B;  3SEB A;  1WR6 E;  1FXA A;  2KDB A;  1D5Z C;  1V1P A;  4GDL B;  4W9D A;  1YQ3 B;  2KLC A;  2RGF A;  1WXM A;  3IVF A;  3N30 A;  1E7V A;  1NI3 A;  3GE3 C;  3ZJT A;  1GB1 A;  1C9F A;  1I4H A;  3ZNI D;  1SJH D;  5H92 C;  3K9P B;  3UF8 A;  5JHB A;  2G4S A;  1WGG A;  2LFI A;  4PS7 A;  2NBW B;  4FN2 A;  1FFU A;  1TS4 A;  2Y5B B;  3Q2A C;  2GI9 A;  3RFZ B;  1HE8 A;  1MG4 A;  1IUE A;  4JL9 A;  2IYD B;  3UGB B;  3H9D A;  1FCC C;  4DBG A;  4PK1 A;  4F1S A;  3SFD B;  2CS4 A;  2BS4 B;  3I3T B;  2RDH A;  1N63 A;  3VRB B;  4BKS D;  3ZQ4 A;  5I4D A;  1SE4 A;  3BWU D;  4AP4 C;  1QLB B;  3PZD A;  2FNJ B;  2IGG A;  1I4G A;  3APC A;  4W9H A;  2G4D B;  1SXT A;  4B0E A;  3VTW A;  2LVQ A;  3V6E B;  2PTL A;  1E6E B;  1NEN B;  1N5W A;  2LHE A;  4JQW C;  5JHA A;  1F2R I;  3QAQ A;  4DHZ E;  2N1W A;  4HXD A;  3I5J C;  1WMH A;  4MAC A;  3NS8 A;  4FXC A;  2LXA A;  2QHO A;  3PRM B;  4MGZ E;  1LFD A;  2KZR A;  4DDG D;  5E6J A;  1F0Z A;  3AB5 A;  3QIJ A;  4HDQ A;  1K50 A;  1WM2 A;  2K8C A;  1VD2 A;  2FIF A;  4FJZ A;  2C7M B;  1VDV A;  4IKG A;  3KUD B;  4ZHP A;  5EE1 A;  4C4V A;  3OWE B;  2Q5W D;  4KIK A;  4GLS C;  4MM3 B;  3TEZ A;  4IW0 A;  1WJ4 A;  2N7D A;  3SFE B;  3EHV A;  4NY0 A;  2WXO A;  4KGR A;  3H1U A;  3RI7 C;  1YOV B;  5IO9 A;  1F9J A;  1MI0 A;  1FXI A;  2W9N A;  4HKZ E;  3PPA A;  2DBY A;  2J42 A;  2WX0 A;  3ALB A;  3VUY A;  1R4M I;  4JE3 B;  1YJJ A;  4LDT B;  3DVN V;  4XDD A;  3NZU A;  4A90 A;  4MGI E;  4A3P A;  1R4N I;  2RD0 A;  2KFK B;  5JXV A;  5E6N A;  2MX2 A;  4MDK E;  4YSY B;  3M62 B;  3EUB 2;  2AX5 A;  3T8M A;  4LTU A;  3VR9 B;  1WXS A;  2PKO A;  4DXA B;  2BS3 B;  2WDQ B;  2LGX A;  2KC2 A;  1RRB A;  2MJE A;  3VFK A;  3AEF B;  4FJV B;  4YTN B;  1UUP A;  2O6V B;  1WYG A;  3MHS D;  1N62 A;  2C5L C;  2ASQ A;  1A70 A;  3I9V 1;  2MP2 A;  4MGY E;  3S2A A;  3PRP B;  1OEY J;  4ITK A;  3DWM A;  3ZVV A;  5JH5 C;  5AEK B;  2BYV E;  3AED B;  4AWJ A;  2KOX A;  1JWA D;  4N6E B;  1HZ5 A;  1CZP A;  2B76 B;  4XYC A;  2LAS A;  3MJ5 A;  5CHF A;  1E8X A;  1WGH A;  1TT5 B;  4P16 A;  3C19 A;  3RN9 C;  3NVY A;  1TIF A;  3KVF B;  4ZHO A;  3EGR A;  2KQ7 A;  2NCN A;  2V1Y A;  2ZCB A;  3U52 E;  4JIO U;  1FPY A;  2W3R A;  2DYM A;  2KDF B;  3MJW A;  3A4R A;  3NVW A;  4WWM A;  5FR3 A;  4ZRK A;  4GU2 A;  1TS2 A;  2WNM A;  1DYQ A;  5KHQ A;  3SDL C;  1GB4 A;  5FKA C;  3SU8 X;  2JY6 A;  2NTS A;  1SIF A;  2V4I B;  1E90 A;  4KZ0 A;  3AE4 B;  1ESF A;  1JML A;  1U4A A;  3X23 A;  2BWE S;  3MTN B;  4RM8 A;  5DPW A;  3EC8 A;  4G11 A;  4HVB A;  2K22 A;  4RF0 A;  3N1Z C;  1C4C A;  4HLE A;  1XLQ A;  4NJ7 A;  5G5H A;  2FCN A;  5AZH A;  1HA5 A;  1ZKH A;  1T0S C;  5H8Y E;  3V3X A;  4S17 A;  4WJN A;  4YTM B;  1IGC A;  3VRA B;  2KHW B;  2FCM A;  2LMC A;  2M0A A;  3DBL I;  1TZ1 A;  1VZ6 A;  3DBH I;  2V9H A;  2M0X A;  1V6E A;  3HRD D;  2WXP A;  1XF5 L;  1WJU A;  3FAH A;  1C76 A;  3EFC A;  1OTR B;  1FCL A;  2W82 A;  2B3A A;  1LO5 D;  1HTO A;  4PS3 A;  2AL3 A;  2MCN B;  1EF5 A;  1WH3 A;  4XWT A;  3AN1 A;  1G6J A;  5D3D A;  3AE5 B;  2L0F A;  1QT9 A;  3KYD D;  3A1Q A;  4X57 B;  3ZRF A;  3VUW A;  1MHX A;  4IM0 A;  1AAR A;  2MBO A;  2K6Q A;  1Q5W B;  3W1S A;  5BO4 B;  1I4R A;  4HWI B;  1V49 A;  4LJO B;  3PGE A;  1ZDV A;  1MG8 A;  2KWC A;  4GB9 A;  2JRI B;  1YX5 B;  1T0Q C;  2EKE C;  3N1X C;  3KLS X;  1CK1 A;  4WWP A;  4DHJ D;  4XE0 A;  4GIV A;  2KWD A;  2MJ3 A;  1JWU D;  3VH3 B;  1Y56 A;  3AU5 A;  1ET6 A;  1OQR A;  2OED A;  4JPS A;  2XN9 C;  3GOE A;  3ZRC A;  4BFR A;  1UNS A;  5E6O A;  4PS8 A;  1XO3 A;  3JSV A;  4DXG A;  5EE9 A;  3ZXV A;  4AUQ C;  1EU4 A;  1WGR A;  1D4B A;  2PIA A;  3BY4 B;  5C3J B;  1M94 A;  2L8J A;  3I63 C;  1VR9 A;  3AEG B;  1YN5 A;  1V97 A;  1RWS A;  3W1Y A;  4KKI A;  3RNC C;  2JXX A;  2DYB A;  1KRH A;  1LXD A;  3E56 A;  1XT9 B;  1MFW A;  1E8W A;  1PYW D;  3VVW B;  5GXG B;  1V1P B;  5G55 A;  3IBE A;  5EDS A;  2E6X A;  3TL5 A;  2QIL A;  4KZC A;  2N9E B;  2EKI A;  3ZO5 B;  3P4R B;  2QDF A;  1JWS D;  5C1Z A;  3R7R A;  4AOF A;  4A55 A;  3BVM A;  3P63 A;  4XX5 A;  1F2R C;  4CYE A;  1KF6 B;  1RLF A;  3CMM B;  4MH8 A;  4WUR A;  1WGY A;  1TZO A;  5C2T B;  3DHG C;  1RYJ A;  2MA9 B;  4RGT A;  3NZS A;  1KLV A;  1J7B A;  2FAZ A;  3NVZ A;  3RMK C;  3VHT C;  2KVZ A;  2OHF A;  2LHD A;  2M4N A;  2VZK D;  3IT4 B;  4HJG E;  1WE7 A;  2IJ0 A;  3DDC B;  4AQ7 A;  3U2S C;  2J0J A;  3W1S C;  3GE8 C;  2DHZ A;  1JW9 D;  3OG5 A;  1EU3 A;  3QCA A;  2A5U A;  1C4A A;  2Z0E B;  3H7P A;  3ZDM C;  3AI5 A;  4ZYS A;  4G3X B;  1EF1 A;  3UQB A;  2N9X A;  1WGK A;  2JXT A;  3EEC A;  3ZNH B;  3DOW A;  4JWS C;  3T9L A;  2PE9 A;  1WMH B;  1ZXI A;  2DEN B;  3FC4 A;  2GBK A;  4LNI A;  3B1L X;  1DGJ A;  3OJ4 B;  1EO6 A;  2KDM A;  1NI2 A;  2WXN A;  5BMG A;  4HPL B;  4NQK E;  2L05 A;  4XC2 A;  2L76 A;  3KWL A;  4MJS A;  1QKZ A;  1PGB A;  3QX1 A;  1BML C;  3ZIM A;  4YTP B;  2KLG A;  4HPM B;  1YJ1 A;  1QQR A;  2XEW A;  5C23 A;  4L23 A;  2NR2 A;  2M56 B;  3IXS A;  1ET9 A;  3UI3 A;  2Z8L A;  3WIM A;  4RCO A;  4W9G A;  2IGH A;  4C4V B;  4C80 A;  4KIK B;  1QOF A;  4CQN A;  1BT0 A;  1T0R C;  1XCQ L;  1IBX A;  2BYT A;  2CKH B;  2H89 B;  1UWX A;  3T3O A;  4KV2 A;  3ZJV A;  1XD3 B;  4FUL A;  3WAN A;  2JX5 A;  3LJ3 A;  1MHH E;  1AN8 A;  2FUH B;  1M4V A;  1DOY A;  1K52 A;  4XDC A;  2QC8 A;  1J0G A;  2PW9 A;  2PEA A;  3TBL D;  4RH6 A;  4ZOH C;  4N58 A;  4R3D A;  2L83 A;  1IP9 A;  4YSZ B;  1ZPS A;  3GZN B;  2ZVN A;  1L4D B;  2RDG A;  1TS5 A;  3RNE C;  2JU6 X;  3A9K A;  5CTR C;  1S3S G;  1H4R A;  5EE3 A;  2NMQ A;  3TCA A;  3ZJU A;  4ZRI A;  1C3T A;  2E3T A;  2KX0 A;  1WJ6 A;  4IWP A;  2LUM A;  2ON8 A;  3PZ7 A;  2RDB C;  4ZRQ A;  3HK0 A;  2X8X X;  3AV8 A;  1Q10 A;  4LNN A;  3RNG C;  4KDL B;  2FID A;  2JSV X;  1V2Y A;  1Z2M A;  5D6J B;  3SR6 A;  1PUT A;  2MP2 B;  2R2O A;  2WWZ A;  2D07 B;  3DBR B;  4EZJ A;  4US9 A;  3AUL A;  2J7Q B;  1DOI A;  4TV3 A;  1VJK A;  2AYO B;  2IDY A;  2QIE B;  1QIL A;  4MH0 E;  2MH7 A;  4QAY A;  2LEK A;  3P2B A;  5G2N A;  1I7H A;  4FHK A;  4FJY A;  1UD7 A;  2L1A A;  4EOY A;  4HEA 1;  1JRU A;  4ACF A;  1YX6 B;  3Q3N C;  4F7Z A;  1VRA B;  2MW5 A;  2YVC A;  3P42 A;  4NNJ B;  4ZRJ A;  1WZ0 A;  2BW2 A;  3O13 A;  3KW5 B;  4K7W A;  2K6D B;  1WSP A;  2D3C A;  4WWO A;  3BVZ A;  1GC6 A;  4BKS A;  1TY2 A;  2CHX A;  2NBV B;  2CHW A;  2MBQ A;  1WFY A;  3ZW3 A;  2VRR B;  3N1Y C;  5HI1 A;  2WXH A;  4ARC A;  1IGD A;  2KX3 A;  5D2M B;  3PRZ A;  1UZX B;  1GG3 A;  3Q6B A;  4OVZ A;  3P4Q B;  2WX1 A;  4GGQ A;  1N6Z A;  2LWP A;  3DVG Y;  3P1M A;  3IG3 A;  4K7S A;  2INP E;  4OVU A;  1FNU A;  3RYT A;  3PS6 A;  3KQ4 A;  3LDZ E;  4EE2 A;  2MWS B;  2Z59 B;  3RPF C;  3L0W B;  2H88 B;  3BIN A;  3VXW A;  2QCZ A;  2HE7 A;  1FRR A;  2FCQ A;  3APF A;  2FBW B;  1NYR A;  2LGY A;  2ZPY A;  2BKF A;  3IAM 1;  4WH4 A;  2BPS A;  5J2R A;  1XXG A;  2Y5P A;  1ZDX A;  2AQ2 B;  4A3O A;  2CJO A;  4I6L B;  4TMA B;  4LK0 M;  1V86 A;  2D3A A;  1K53 A;  2RR9 A;  3EFU A;  3QQ8 B;  3B0A A;  1SGH A;  4NPN A;  5E6P A;  2QSD A;  2L0T A;  2PE6 B;  4YWG G;  4WQM A;  1L4Z B;  2NVU I;  4JWU C;  1K51 A;  1WGD A;  2ACZ B;  2KK8 A;  3Q8E A;  1MVK A;  5DPR A;  2VH2 A;  4KGT A;  3A1Q B;  3ZYY X;  3KYC D;  1PFD A;  2WDV B;  1ZOY B;  3TEY A;  1SBB B;  3I57 A;  2J52 A;  5HKH A;  2KAC A;  4J3O D;  4ZYN A;  2PVG C;  2OOB B;  1PDX A;  1WWT A;  3ZXR A;  2NTT A;  4A20 A;  3TIX A;  2JZ3 B;  4DHZ B;  2EMS A;  2W55 A;  3HVD A;  4IOI E;  3R2I A;  4W9L A;  4KKJ A;  2I2Y A;  3NS1 A;  4UDU C;  5BMH A;  4ANW A;  1SE3 A;  2SEB D;  2J0K A;  1R4M B;  1WRI A;  3JSV B;  1SSN A;  3VQI A;  3U7D A;  2JZZ A;  2LGD A;  1FMA D;  3KUC B;  1R4N B;  3VUX A;  4W9I A;  4HKQ A;  3DHH C;  1P0R A;  4OZC A;  3PLV A;  4DHJ B;  2BVC A;  2XNA C;  5LXI B;  2OJW A;  4RMA A;  1EWY C;  3WAO A;  2KN5 A;  4ANX A;  4MSQ B;  1I4X A;  1L0X B;  1GAQ B;  4URK A;  5MPO A;  3A4S C;  1L6U A;  5BYR A;  3AE9 B;  3TEW A;  1GC7 A;  2NPT A;  2WP9 B;  2JQR B;  1XLO A;  4HCN B;  2GOW A;  3LXF A;  3L16 A;  1SE2 A;  1XLN A;  2AQ3 B;  1E9M A;  5EE0 A;  2VH1 A;  1WZ3 A;  4K1R B;  4PYU A;  3BZD B;  2LUE A;  1B9R A;  4WIP A;  3KWV A;  4RNA A;  2N9L A;  4W9C A;  3NOB A;  2HTH A;  4MGK E;  1FO4 A;  3BVG A;  1VLB A;  3MC9 A;  1X1M A;  4MEM A;  3PSE B;  4LDT D;  2WHI A;  2IY0 B;  4HRO A;  3M63 B;  2NS5 A;  3NJT A;  3L13 A;  3HM6 X;  4ICU A;  5D94 A;  2DX5 B;  2Z0D B;  1MJD A;  2JZP A;  2I1K A;  4C56 C;  3H7P B;  1FFV A;  2BGF A;  4ASW C;  3AM9 A;  4WAF A;  5L83 A;  1AYF A;  5BMI A;  2NBU A;  3PHW B;  2K5P A;  1PQS A;  1WRD B;  1ZW7 A;  3NG0 A;  2O6V D;  1I35 A;  4P1C C;  4RGO S;  3DQV A;  2KFK A;  4TSS A;  4TKN A; 
#chains in the Genus database with same CATH homology
 4HRS A;  2BS4 B;  1FD6 A;  2RDH A;  1AW7 A;  1N63 A;  1WGK A;  4C7Y A;  4Q2J A;  3VRB B;  2JXT A;  3CWI A;  3ZQ4 A;  1SF0 A;  5I4D A;  4JWS C;  4OHJ A;  1SE4 A;  3BWU D;  2LGI A;  1QLB B;  2N7J A;  4P6V F;  4O1N A;  4DQO C;  3BYT B;  2IGG A;  1I4G A;  4C7Z A;  1ZXI A;  2JWU A;  3EA6 A;  3FC4 A;  4RF1 A;  1SXT A;  2BB6 A;  4B0E A;  2G9H D;  2WXK A;  3MC0 B;  2R61 A;  2WU5 B;  1DGJ A;  2KDM A;  2D5G A;  2WXN A;  5BMG A;  3W2D A;  1N60 A;  1OFF A;  4L2Y A;  1J7A A;  2PTL A;  3KWL A;  1E6E B;  1NEN B;  1PGB A;  1N5W A;  1QKZ A;  2LHE A;  1BML C;  1FNW A;  1F2R I;  4DXF A;  4YTP B;  1WXQ A;  1P7F A;  1C78 A;  1T5X D;  1JRP A;  1QQR A;  4MAC A;  4FXC A;  4L23 A;  3Q69 A;  2M56 B;  3IXS A;  1ET9 A;  3UI3 A;  2Z8L A;  1F77 A;  4RCO A;  5E6J A;  1F0Z A;  3AB5 A;  2IGH A;  1E10 A;  1JWM D;  1K50 A;  4C80 A;  1QOF A;  1NVI D;  1I4Q A;  2CJN A;  4CQN A;  1XCQ L;  1IBX A;  2BYT A;  2H89 B;  1PGA A;  4JX1 C;  1UWX A;  1HXY D;  3B2G A;  3T3O A;  4IDI A;  1STE A;  3ZJV A;  1P7E A;  4D2K A;  1VDV A;  4B0M A;  2JX5 A;  2Y3A A;  1MHH E;  4OZA A;  4IKG A;  1AN8 A;  4ZHP A;  3CIR B;  5EE1 A;  1VZ7 A;  4RGN A;  4YSX B;  2K3U A;  1M4V A;  1DOY A;  3OWE B;  1K52 A;  2Q5W D;  1JCK B;  3MHZ A;  3W9C B;  4GLS C;  4MM3 B;  3TEZ A;  1TKY A;  1SEB D;  3GS2 A;  3Q8B A;  4XDC A;  3SFE B;  4NAM A;  2PW9 A;  1NYQ A;  4KGS A;  2QMT A;  1KLG D;  2WXO A;  4RH6 A;  4ZOH C;  4N58 A;  2WXF A;  4R3D A;  4TQ0 A;  4KGR A;  2L83 A;  2N0S B;  4YSZ B;  1ZPS A;  1L4D B;  2RDG A;  4OW0 A;  1TS5 A;  1MI0 A;  1FXI A;  2JU6 X;  4HKZ E;  2BB5 A;  2DBY A;  2J42 A;  3MFG A;  2EEL A;  5EE3 A;  1ROE A;  2V3N A;  2NMQ A;  3HUI A;  1UWM A;  1E7P B;  4JE3 B;  3E9S A;  3ZJU A;  1YJJ A;  3TEX A;  4XDD A;  2WS3 B;  2E3T A;  3J9C A;  4A90 A;  5FK9 C;  2LUM A;  2ON8 A;  1MPE A;  1YN3 A;  3PZ7 A;  3U4E G;  5JXV A;  4ZRQ A;  4A6Q A;  3AV8 A;  3PO0 A;  2WXL A;  1D5X C;  1Q10 A;  4YSY B;  3V05 A;  3EUB 2;  2AX5 A;  3Q8A A;  1L5P A;  1N5X A;  3L4P A;  2JSV X;  3SR6 A;  1PUT A;  4LTU A;  3VR9 B;  4US9 A;  3BK1 A;  1OQQ A;  2PKO A;  2VZK B;  1DOI A;  2BS3 B;  1QOG A;  2WDQ B;  1VJK A;  2IDY A;  3AE8 B;  3Q8F A;  2MJE A;  3AEF B;  2QIE B;  1QIL A;  1TY0 A;  1UUP A;  4YTN B;  1R7S A;  2MH7 A;  4TQ1 A;  4YT0 B;  1WYG A;  1FNV A;  2LEK A;  3B2F A;  1N62 A;  2DLB A;  5AUI A;  1A70 A;  1I7H A;  3I9V 1;  2TSS A;  2ZW0 A;  4MT5 A;  3DWG C;  3GB1 A;  3BYY B;  4NZL B;  1JQ4 A;  2L1A A;  3U7Z A;  2WXR A;  1FM0 D;  4HEA 1;  1RFK A;  4ITK A;  3DWM A;  2RMM A;  2PLP A;  1VRA B;  1XEE A;  2LJI A;  2W3S A;  3AE7 B;  3AED B;  3P42 A;  3PZ8 A;  1D5M C;  1E0Z A;  1JWB D;  2HTM E;  2YEP F;  2BW2 A;  1JWA D;  2AQ1 B;  3O13 A;  4N6E B;  1HZ5 A;  2G1E A;  2ONQ A;  1B1Z A;  2I38 A;  1CZP A;  1JRO A;  1WSP A;  1IBX B;  1T3Q A;  2KN4 A;  2B76 B;  3BVZ A;  3W5U B;  3MJ5 A;  1RM6 C;  1YN4 A;  1TY2 A;  1QOB A;  4XWW A;  1DOX A;  1GPX A;  4P16 A;  5BYS A;  1L6V A;  2K9X A;  3AE1 B;  3NVY A;  3IT6 B;  5TSS A;  4ZHO A;  4NAW B;  3EGR A;  3B9J A;  2BTE A;  5HI1 A;  2WXH A;  4ARC A;  3N9Y C;  1IGD A;  4GDK B;  3U52 E;  4AS1 A;  1PGX A;  4OVZ A;  3P4Q B;  2PVO D;  3URY A;  2W3R A;  2DYM A;  3NVV A;  4WWM A;  3NVW A;  3Q8C A;  1N61 A;  5FR3 A;  3P1M A;  1TS2 A;  2MEK A;  3AEA B;  2INP E;  2WNM A;  1DYQ A;  1FNU A;  1GB4 A;  3KQ4 A;  5FKA C;  2NTS A;  3LB8 C;  2V4I B;  4EE2 A;  1YQ4 B;  1TS3 A;  3RPF C;  3IAS 1;  3AE4 B;  1ESF A;  1JML A;  1GOZ A;  2H88 B;  3AEB B;  1FRD A;  4KX6 B;  1VZ8 A;  3WCQ A;  2BT6 A;  1CQV A;  1J7C A;  1YNT E;  2HDE A;  2JYT A;  2M19 A;  1FRR A;  4PT5 A;  1KH0 A;  2YEP B;  2FBW B;  2K22 A;  4RF0 A;  1NYR A;  1KTK A;  3P4P B;  1C4C A;  1XLQ A;  3IAM 1;  4WH4 A;  3TUO A;  3R8B A;  1BXT A;  1XXG A;  2Y5P A;  1ZDX A;  2AQ2 B;  2V0G A;  4LLG M;  2CJO A;  3AEC B;  1YMH E;  4TMA B;  3AMZ A;  4LK0 M;  5G5H A;  1HA5 A;  1UGJ A;  2L32 A;  5H8Y E;  3V3X A;  1K53 A;  4YTM B;  1IGC A;  3VRA B;  3T3N A;  1EWC A;  2QSD A;  2LMC A;  2M0A A;  1VZ6 A;  2K0P A;  2WU2 B;  4YWG G;  4WQM A;  2Y5C A;  3W5V B;  1L4Z B;  4NJC A;  3HRD D;  2J4X A;  4JWU C;  1K51 A;  1L0Y B;  2WXP A;  4RFB A;  1XF5 L;  2WXM A;  2ACZ B;  3ZGZ A;  1V1O A;  1T6B X;  2DYO A;  1C76 A;  2SAK A;  3FAH A;  3Q8E A;  1FCL A;  1MVK A;  2W82 A;  3AEE B;  3FIL B;  4KGT A;  1LO5 D;  2L52 A;  2MJD A;  1KLU D;  3VR8 B;  3ZYY X;  3ABV B;  1PFD A;  5BYQ A;  2WQY B;  3R2T A;  2WDV B;  1HEZ E;  1ZOY B;  3TEY A;  1SBB B;  3I57 A;  4XWT A;  2J52 A;  3AN1 A;  2KAJ A;  2RPV A;  1TKG A;  2ZW1 A;  2KAC A;  5D3D A;  3AE5 B;  2N9K A;  3NUH B;  1EM7 A;  3AE3 B;  1QT9 A;  3BII D;  4J3O D;  2PVG C;  3FIL A;  2DWQ A;  5HG2 A;  1PDX A;  1TJE A;  1WWT A;  2WLB A;  1XLP A;  1MHX A;  2NTT A;  1I4P A;  3GP7 A;  4REZ A;  1QOA A;  1BUI C;  2V3P A;  2W55 A;  3HVD A;  3W1S A;  4IOI E;  5T8I A;  1FIQ A;  3R2I A;  5D7G A;  4KKJ A;  2I2Y A;  1I4R A;  1L0V B;  2WXI A;  4M0W A;  4A8X C;  3MP9 A;  3NS1 A;  5LNK 1;  2WXQ A;  4UDU C;  1ZDV A;  2BBC A;  5BMH A;  2WXJ A;  3NRZ A;  1V8C A;  1SE3 A;  2SEB D;  3KLS X;  1TYG B;  1WRI A;  1CK1 A;  1SSN A;  3VQI A;  4XE0 A;  2KWD A;  2MJ3 A;  1JWU D;  1FMA D;  1Y56 A;  5AUK A;  1ET6 A;  2J53 A;  1OQR A;  2OED A;  4JPS A;  2XN9 C;  5HFY A;  4HKQ A;  1QF6 A;  5D3I B;  2JYE A;  4OZC A;  1UNS A;  4A9A A;  2FUG 1;  2XNA C;  1XO3 A;  2W54 A;  1JAL A;  4DXG A;  2BS2 B;  5EE9 A;  1EWY C;  2IGD A;  4ARI A;  1SIJ A;  1EU4 A;  3NZ3 A;  1ACC A;  1I4X A;  2PIA A;  1D4B A;  1KFY B;  5C3J B;  1L0X B;  1GAQ B;  1VR9 A;  1XCT L;  3AEG B;  5MPO A;  1L6U A;  5BYR A;  3AE9 B;  3TEW A;  1CJE A;  2INN E;  2KQ4 X;  1YN5 A;  1V97 A;  1RWS A;  2PMV A;  2JQR B;  2WP9 B;  3AE2 B;  1XLO A;  2IPK D;  1YJI A;  1SB3 C;  4KKI A;  2KMM A;  3LXF A;  1ENF A;  4H2A A;  1SE2 A;  1KRH A;  1XLN A;  2FE8 A;  3H8H A;  2AQ3 B;  1E9M A;  5EE0 A;  3E56 A;  4L1B A;  4US8 A;  3BZD B;  2ICI A;  1PYW D;  1TKE A;  1B9R A;  4WIP A;  3KWV A;  2CU3 A;  5GXG B;  4YXD B;  4RNA A;  1D6E C;  1V1P B;  1NEK B;  1C79 A;  1C77 A;  2N9L A;  3AH7 A;  2QJL A;  1ZE3 D;  2E6X A;  2QIL A;  4OZB A;  3C8Y A;  5G5G A;  1FO4 A;  2EKI A;  3P4R B;  3AE6 B;  3BVG A;  1VLB A;  1ZUD 2;  1JWS D;  1HZ6 A;  4RGM A;  2WDR B;  3SEB A;  1FXA A;  4A55 A;  1D5Z C;  1V1P A;  2WXG A;  3BVM A;  3P63 A;  4GDL B;  4HRO A;  1YQ3 B;  1F2R C;  1FEH A;  1KF6 B;  4MH8 A;  4WUR A;  1TZO A;  1NI3 A;  5C2T B;  3LYY A;  1RYJ A;  3ZJT A;  4RGT A;  1SJE D;  4N59 A;  4USA A;  4ZRP A;  1J7B A;  3P4S B;  3NVZ A;  1GB1 A;  1C9F A;  2JZP A;  1I4H A;  1SJH D;  2GRI A;  5H92 C;  4C56 C;  1FFV A;  2OHF A;  2LFI A;  2LHD A;  2X38 A;  2VZK D;  3AM9 A;  3IT4 B;  4WAF A;  3BK2 A;  1AYF A;  4HJG E;  1FFU A;  1TS4 A;  1ZP0 B;  2QEJ C;  3HVZ A;  5BMI A;  2IJ0 A;  4AQ7 A;  2GB1 A;  3U2S C;  2K5P A;  2GI9 A;  3RFZ B;  1JW9 D;  1IUE A;  1C4P A;  1EU3 A;  3ETR A;  1HQR D;  4RGO S;  1FCC C;  1C4A A;  3TSS A;  1ZXH A;  4TSS A;  4ZYS A;  1AWD A;  3SFD B;  5HHD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...