2JYEA

Human granulin a
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
72
structure length
72
Chain Sequence
AMDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQKLAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure dissection of human progranulin identifies well-folded granulin/epithelin modules with unique functional activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Granulin A
total genus 3
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00396 Granulin Granulin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.500 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jyeA01
2JYTA 2JYEA
chains in the Genus database with same CATH superfamily
2DYOA 3GE8C 4OVUA 4B0EA 4LNNA 3AE2B 1RFAA 4KDIC 1J19A 1XLQA 2V3NA 3B2GA 4MDKE 4YL8A 3PV1A 4GDKA 3TL5A 3HHMA 1P9DU 4YSZB 2I38A 1E10A 3ZDMC 2HJ1A 4GB9A 4YTMB 4PS8A 3QJZA 1GNUA 2G45B 2ZCBA 3M95A 2W55A 3TUOA 4PT5A 3NVVA 2J0MA 4WJOA 1ZW7A 3I9V1 2L0TA 3GZNB 1V1OA 1MI0A 1P3QU 2D07B 1SIJA 4GOCA 4K81A 4MGIE 1E7PB 1T5XD 4WAAA 1CJEA 2KC2A 2KDIA 1WJ6A 4W9JA 4HEA1 4JGHB 3PRZA 4FJZA 3IAS1 2INPE 4GDLA 1H8CA 1TT5B 2DZJA 2G9HD 4JE3B 3PZ7A 3DBLI 1ZUD2 2OJWA 4F8CB 1F77A 3NHEB 3ZUNA 2DX5B 1GJZA 4GIVA 3WALA 2MSED 4FLHA 3W5UB 1H4RA 1L0YB 3GP7A 2SEBD 2LVQA 1HEZE 4RH6A 4B9KA 4GDKB 3DVGX 1UGJA 1D3ZA 3BINA 4MT5A 5C1ZA 3RCZA 4X57B 4J6IA 4HVBA 2NCNA 1YN4A 2IBIB 2KO3A 3TBLD 2LXAA 3PZ8A 1ZP0B 3HM3A 3B08A 1QZEA 2PE6B 3LYYA 4MM3B 1RAXA 2K39A 1XLNA 5BO4B 3L54A 1JCKB 4JPSA 2KYWA 4ZYNA 2N0SB 1X1MA 1V5TA 1WMHB 4HPLB 4M02A 1HZ6A 3V61A 1AWDA 3TEWA 2QDFA 1WR1A 3ZNZB 2MCNB 1TIFA 3EECA 5MPOA 3GOEA 1FNVA 5J18A 2M19A 4FXCA 4ASWC 1VZ8A 4NAWB 3VTVA 4LJOB 2JU6X 2NPTB 1HXYD 5FK9C 4D2KA 3NS8A 4OZBA 1KH0A 1WJUA 1FRRA 2NTSA 2E6XA 4NJCA 4ZYSA 4XWTA 5EE0A 4EZLA 5D2MB 4RGTA 1F2RI 2GOWA 4E74A 1QOAA 1B1ZA 1AW7A 4HPMB 1UF0A 4WAFA 1QOFA 4GN1A 1FXAA 3R2IA 5BYRA 3NUHB 3T3NA 3Q6BA 1MJDA 5BYSA 1XO3A 4EOYA 1JWMD 2MBOA 1A70A 3LDZE 3DHHC 3APDA 4LDTD 4A6QA 1EWCA 1QF6A 3W1YA 5T8IA 3Q8FA 2KK8A 3ZRFA 4CYEA 4EFOA 3ML9A 3ZXVA 1WM2A 4EUTA 2MLBA 1CZPA 3VHTC 2CHWA 2AL3A 3P63A 4XX5A 2FAZA 4NAWA 3V05A 1UD7A 3IBEA 4K7WA 4DQOC 4B6WA 3ECIA 3ZQ4A 4P7IA 4JWUC 1JWAD 5IKCM 1SF0A 2HDEA 3FKYA 3DBSA 1EUVB 4RF1A 5C23A 4KX6B 5IAAC 3Q3NC 4DHJB 2KMMA 2RDHA 3R3MA 1N5XA 3ZNID 2X38A 1WWTA 2ZJDA 2KN5A 4REZA 1YNTE 4FJYA 3AMZA 4KIKB 2L0FA 4N6EB 2J4XA 3V3XA 4KKIA 1VDVA 2XEWA 2O2VA 1YQ4B 3MC0B 1OEYA 2ICIA 2Y3AA 2WQYB 2DYMA 3O13A 2BQQA 2WXMA 2ACZB 1MG4A 4I6PA 4K3BA 2BYFA 2N7EA 1UUPA 3VRAB 1VR9A 2VRRB 2QIEB 3R7QA 3AEDB 1S1QB 3B9JA 5AZHA 4AQ7A 1ET9A 1TYGB 3O65B 1PYWD 5H8YE 1OGWA 2QC8A 4M0WB 3GZNI 3A9KB 2JSVX 2DZIA 1V9JA 2AWTA 2GBKA 1VCBA 2V1YA 3P4SB 3CIRB 1ISNA 3BIID 4C7YA 1L6UA 1CQVA 2M0XA 1E8ZA 1C9FA 4K1RB 2KVRA 5AUKA 4EKUA 2KVZA 4YSYB 2WXQA 3U7ZA 3GE3C 3X23A 5IP4D 2K25A 2CR5A 1ZE3D 2W54A 3KWVA 2LWPA 4FHKA 2H89B 3W9CB 3ENEA 2BGFA 3N20C 1QOBA 1J7BA 3RUIB 3RPFC 2OJRA 3C19A 3TEZA 3UINB 2NBUA 3A4SC 2WU2B 1WX9A 5E6OA 1VLBA 3FILA 1XCTL 4B95A 1Q10A 3AEEB 3AV8A 2LGXA 1LFDA 1ZPSA 3JYUA 2IPKD 1SJED 4ZOHC 3NS1A 4IG7B 2IJ0A 2KTRA 1ACCA 2YEPF 4OW0A 3DDCB 3SEBA 2JF5A 4N9F4 2XK5A 2ZW1A 1WSPA 2JZ3B 2EKIA 2N9PC 4P1BC 2RPVA 3EC8A 3I63C 2V0GA 3DWGC 4BKSD 4HDOA 1E6EB 1JMLA 2PKOA 1PDXA 4OVZA 4LLGM 3Q3MC 2CS4A 4KV2A 1L4ZB 3JW0X 3ZTDA 3N1YC 2LGYA 4KDLB 5G55A 2BB6A 1KLGD 1F1HA 1E8WA 3MHZA 3BYYB 2RR9A 3ZLZA 1I4GA 2BF8B 3QIJA 1WX8A 2K8CA 3U30A 5H92C 2D10A 5HHDG 3NRZA 3KUCB 1KLVA 3VDZA 1QKZA 2N1VA 1I4XA 2JQRB 2ZZPB 1GB1A 2CJOA 2TSSA 3LB8C 3E9SA 2WXJA 2SAKA 1C4PA 3ALBA 3HVDA 2C7HA 4HROA 3TCAA 1PFDA 3EHVA 3PGEA 4RNAA 1LO5D 3SHQA 2FBWB 4P6VF 2L7RA 1VZ7A 1EO6A 1WYWB 1FRDA 1GG3A 3TJPA 1E9MA 3Q8AA 2C7MB 2BKRB 3MHSD 1YJ1A 3Q2AC 4WWNA 3GS2A 2I1JA 2LGSA 3ZGZA 1PGXA 1RM6C 3DVNV 2LUMA 2IGGA 5EE3A 2N9KA 2Z0EB 1NVID 4DXGA 3ONSA 1M94A 5HG2A 2KKCA 4AJWA 2YVCA 1JALA 5AZGA 1CMXB 1IBXA 2LJIA 5HI1A 1D6EC 4A8XC 1TS5A 2D5GA 3Q3JA 2XN9C 4RCOA 1N62A 3AE9B 3UGBB 2BTEA 3R8BA 1DOYA 1P0RA 2V3PA 2JVCA 1WJ4A 2KQ4X 3L10B 5EE9A 4US8A 1SXTA 2KQ7A 1I7HA 1BT0A 1SE9A 2L05A 4XDDA 2CJNA 2KWCA 3DPDA 2B3AA 1TKGA 4KSKC 3DBLB 2N9LA 2IY1B 5JXVA 1VRAB 2KLCA 3M62B 3DWMA 3A9JA 2AEHA 2ZPYA 3ZW3A 1UWMA 2MBHA 2GB1A 1YX6B 1P98A 3AN1A 1G6JA 2RPQA 4RM9A 1D4BA 4GU2A 1UWXA 4ZRQA 4LJPB 1E5WA 4GXBA 4CO7A 1V80A 3L08A 5DPSA 1BXTA 4HK2A 4IOIE 1S3SG 4JL9A 4XYCA 1T6BX 2KWUB 1MPEA 1XCQL 2LRWA 1RYJA 5G2NA 2K9XA 3URYA 4XWWA 3QARA 1DYQA 1ZOYB 2EMTA 1UZXB 3P42A 1FFVA 3RFZB 2W82A 4HRSA 4WJNA 2WX0A 2QSDA 4MH0E 1EU3A 2G4DB 4LK0M 4DDGD 2A5UA 4ZHPA 3KUZA 1WGRA 2BB5A 4PS7A 2NPTA 3NVZA 3P4PB 2KWVB 1XD3B 4JQWC 2IO1B 2KX0A 3T8MA 4NZLB 2PW9A 4A9AA 3RYTA 1CK1A 1RFKA 2ZCCA 3VTWA 3PREA 3AULA 1UGMA 4NPNA 3Q3FA 4L1BA 2MBBB 4DHZE 3VUXA 1L5PA 1WR6E 3NG0A 1V2YA 3VH3B 3FAHA 1WE7A 4LCDE 4S17A 3L13A 2LASA 1XLPA 1GPXA 4KGRA 4MM3A 2LXCA 3NZUA 3VXWA 3HVZA 5G5GA 4Q2JA 2RDBC 3Q14C 2GLSA 5IO9A 2OOBB 4IM3A 1LM8B 2R2QA 2JWUA 2GRIA 1XF5L 3H8HA 2IGHA 4KZ0A 4DK5A 4DBGA 1WI0A 2KDEB 4YXDB 1WGKA 3N32A 4NQLB 1NI3A 3B0AA 1V97A 2M8SA 1KLUD 3BVMA 3RNGC 3CF6E 1Q5WB 2DYBA 1JRUA 3AEFB 3AM9A 3KQ4A 4BKGA 5JZEB 4GDLB 2WDTB 2MWSB 1HQRD 4WURA 1IP9A 3B1LX 3UF8A 1P7EA 4DHZB 2DENB 3UQBA 4E71A 2DNFA 2WXHA 4OZCA 3VR9B 4WWMA 1TBEA 2VH2A 1HTOA 1KM7A 2ZPNA 4OHJA 4IM2A 1TY2A 1FO4A 1IUEA 4PYUA 3A33B 2WXRA 2WWZA 2BWES 1WE6A 1YOVB 5L83A 1R4NI 2ASQA 3PSEB 1R4NB 2LEKA 1YIWA 1Q1OA 4IWOA 4AOFA 3PHXB 1OEYJ 4CQNA 3SFDB 3PRPB 4IC7B 4W9FA 3K9PB 1IPGA 4WH4A 3DHIC 2KFJA 3W5VB 4AP4C 2I2YA 2G4SA 1I4RA 4W9CA 2FCMA 2WLBA 4IUMB 2MJDA 4HCPB 3QWZB 3OWEB 1T0SC 2MA9B 5EDSA 3ZJUA 1FCCC 2WXOA 1JWBD 1AARA 2D3AA 3K9OB 2WGSA 2KJRA 3X0WA 3AU4A 2GMIC 2JRHA 1N60A 4G50A 4EE2A 3DBHI 3N1XC 2NVUI 2WHIA 3AI5A 1NEKB 1WZ3A 3Q8EA 3EFUA 4RF0A 2JYTA 3RZWC 1P7FA 4AJYB 4BVUC 1AYFA 3AE4B 2MJEA 2KNBA 2BBCA 2K22A 1DOXA 1FCLA 3NVWA 1C77A 4ACFA 2D11A 1STEA 2LGDA 2KDMA 4JLCA 3UQAA 1IGCA 2ZNVC 3AH7A 3JSVB 2LI5A 4G0NB 1HE8A 4MELA 1YD8U 3N1ZC 1TS3A 2JUOA 3N30A 3U7DA 2MRPA 2JZZA 1N61A 4JIOU 1I4QA 3W1SC 2H88B 1NENB 2WXNA 3DOWA 4ZRKA 3WCQA 1WM3A 1C78A 3ABVB 4WJQA 4DXAB 4DWFA 1I4PA 4TUUA 2HE7A 4MACA 2NTTA 3AE5B 3E56A 2PE9A 2LVPA 1TKYA 3NZSA 2BKFA 4WWOA 4URKA 2INNE 1E7UA 5C3JB 1WFYA 4KVGB 3EUB2 2YEPB 4XZ4A 1ENFA 2CU3A 2UYZB 2Q5WD 1EM7A 4RGNA 1WXSA 3IG3A 3I57A 2O6VB 4WQOB 3H9DA 1U4AA 1SEBD 2WXPA 3TEXA 4G3XB 1N63A 1WJNA 1K50A 1MG8A 2WXIA 1TTNA 2JRIB 4MJSB 2BYEA 3ZJTA 1L6VA 2FUG1 2G1EA 5J2RA 5GXGB 3ZJVA 1WXQA 3IT4B 1FNUA 3KVFB 3ZTCA 1I42A 2J53A 1E0ZA 3RMKC 3MC9A 3SD5A 1IYFA 3VUWA 2XK5B 4ANWA 5HKHA 2UU7A 4ITKA 1K53A 1MHXA 2KXJA 4B0MA 3PS6A 2JY6A 1R4MB 2XNAC 2Y5PA 2YLMA 1TS4A 2M4NA 1N6ZA 4ZRJA 2K1FA 3AEGB 3Q8CA 2KDFB 4LNOA 3P1MA 4NQKE 4C4VA 4LNIA 4BBNC 1VD2A 4IWQA 2JT4B 3QA8A 3KYDD 3SDLC 5DPWA 3MJWA 5CHWA 4A20A 3PZDA 1I4HA 2C7NB 4ZHOA 3N3KB 5FR6A 4JWSC 4N59A 2AL6A 5J17A 4ZRPA 2UWQA 2MP2B 1YX5B 2JX5A 4PYZA 2M17A 4K7UA 3MJ5A 3CSFA 3RD2A 1C79A 2C60A 1RRBA 1T0RC 3U8ZA 3DVGY 1C4CA 1FIQA 5E6JA 4M8NA 2KTFA 3LXFA 4LDTB 3AB5A 3H6NA 2BS2B 3PHWB 1SE3A 2ON8A 4WIPA 4J3OD 4IKGA 3V6CB 3KYCD 3J9CA 4MEMA 1L7YA 5I4DA 3HUIA 4P16A 4C7ZA 1TGZB 3M3JA 4HJGE 2HTHA 3P2BA 1J0GA 1SJHD 3KLSX 2K8HA 4RMAA 3DVNU 2MJ3A 4KGTA 3IHPC 3PVLA 2QILA 2WYQA 3VUYA 3IXSA 4US9A 4C80A 3R7RA 5AEKB 1V6EA 2BW2A 1JQ4A 4DHJD 2J0JA 1D5ZC 3BZDB 1FMAD 4MH8A 3WANA 1TJEA 1XLOA 4WQMA 4GMVA 1KJTA 2GI9A 1NI2A 3ZIMA 4XGAB 3SU8X 1L4DB 4W9DA 2WXGA 1KTKA 2KZRA 4L2YA 1WRDB 4ZDVA 2L52A 4TQ1A 2DLBA 3MC8A 5GMVA 3NY5A 2BVCA 1D5XC 2I1KA 1M4VA 3QX1A 3KUDB 4YSXB 3A4RA 3IFWB 2OEDA 4A3PA 1Y8RC 1SSNA 2JXTA 3OG5A 2C5LC 2V3SA 5CHVC 4IDIA 1T3QA 2WXLA 5AZFA 3ML8A 1GC6A 2M1MA 4BOSC 1WZ0A 4AUQC 5LXHA 3BVZA 4HKQA 1KF6B 1YQBA 2AYOB 4ICUA 1FEHA 4M00A 1UBIA 2NS5A 3AE3B 2BPSA 4W9EA 3RT3B 1A5RA 1FPYA 3Q69A 4BKSA 1LXDA 2JYEA 2WXKA 2O2VB 1AN8A 4USAA 2PTLA 1TZOA 4FN2A 3C8YA 3S2AA 5HFYA 3A9JB 5EE1A 1GOZA 4HWIB 1WGGA 1WRIA 2M56B 1XQQA 2KT7A 3HM6X 3VRBB 2KN4A 2FCQA 3VAWA 1R4MI 2INDC 4F1SA 5D6JB 1OTRB 4I6LB 4N58A 1IGDA 1MFWA 3M63B 1V86A 1FXIA 2BWFA 2MBQA 1HA5A 2KANA 2L00B 3APFA 2BYTA 2DBYA 3AE1B 3C0RB 5E6NA 2KLGA 3A1QA 2WP9B 1HTQA 4MGYE 2PMVA 2MBEA 1WMHA 4BFRA 2IZVB 1FXTB 3PLVA 1SGHA 3H7PA 1IBXB 3NJTA 4TQ0A 1RLFA 3R2TA 5CX3A 1TY0A 3RNBC 4IW0A 4HXDA 4YTNB 1NYRA 3BVGA 5IA7A 4A90A 4C56C 2PVOD 4BAXA 3JSVA 5D7GA 3VR8B 4H2AA 4HJKA 1V1PB 4LNKA 1XT9B 1ESFA 2ZW0A 2GBNA 2L3ZA 4RGMA 3TMPB 3QC8B 4HPPA 4GSWA 1PGAA 5FR3A 4BZAA 1V5OA 4BBNF 4HLEA 2WDRB 4MSQB 3P4RB 1RWSA 1XEEA 4ANXA 2X8XX 2KAJA 3APCA 4AWJA 3WAMA 4XC2A 5KHOA 5D3DA 4RGOS 3WA0A 1YN5A 5C2TB 4XDCA 2REXA 2MP2A 2FIDA 1ET6A 2EMSA 3I5JC 4MSMB 1YJJA 4NAMA 3L16A 3JVZX 2BS4B 2BT6A 1ZXIA 5BYQA 3UI3A 2MEKA 3PTFC 5LLIA 2N9XA 4M01A 2KJHB 1Z5SB 2D3GA 4FBJB 2K6DB 1SE4A 2RDGA 3BY4B 3BK2A 4KSLC 3RULA 2JPHA 1WGDA 3DBRI 2LD9A 1SB3C 1F52A 1LQBA 1JWUD 4M0WA 4BKTA 3PO0A 4KGSA 1GC7A 2J42A 1F0ZA 4ARCA 5DPRA 1T0YA 5JH5C 1ZGUB 3VQIA 2J7QB 5G5HA 4LTUA 1WY8A 2HTME 4ANVA 2J0KA 2EELA 4NNJB 3AE8B 5LXIB 4P1CC 3KH0A 1E8XA 2ZVNA 2FNJB 2FUHB 3PPAA 4OZAA 1JRPA 4KIKA 3NVYA 2GBRA 2CHXA 2FIFA 5E6PA 4L23A 4DDID 3ZO5B 2MX2A 2KOXA 5BMIA 3ZNGC 2QEJC 2KMCA 4NY0A 2R61A 3U52E 1ZDVA 2MQJA 2WNMA 1WGYA 2DAJA 4PK1A 1WX7A 1SBBB 3GB1A 2RSUA 1FM0D 4MGKE 5JHBA 1ZDXA 2KJ6A 3BWUD 3H1UA 2JXXA 3B2FA 1EF1A 4IWPA 1C4AA 3RNFC 1OQYA 1D5MC 4TV3A 2KQSA 3ZKJC 2AX5A 3A9KA 1P1AA 3HK0A 4FHJA 3ZNHB 3HRDD 4K3CA 1JW9D 4LNFA 4TKNA 2RGFA 1T0QC 4GLSC 4R3DA 4M8MA 2VZKD 2W9NA 3H7SA 3SFEB 1YQ3B 3UIPB 1NBFC 2QJLA 3NZ3A 2Z8LA 4XE0A 1VZ6A 2W3SA 2G3QB 3AEAB 1B9RA 2L83A 3V62A 2IGDA 4ICVA 2Z59B 3Q8BA 1ZKHA 2K5PA 3VVWB 2PPHA 3A1QB 3LJ3A 3T9LA 4ARIA 4FULA 4EZJA 3TIXA 3AEBB 1KRHA 2K3UA 2LHEA 5CHFA 2LRUA 3AECB 1Y56A 1L0VB 2KWDA 1E7VA 3QAQA 4ZRIA 4TSSA 3AXCA 1C3TA 4NJ6A 1QILA 5D94A 2VH1A 2K0PA 5D3IB 1E90A 2RMMA 2ZVOA 3QCAA 1NDDA 3D32A 3DCGA 2Y5CA 1UNSA 1UELA 1DGJA 3TEYA 2L1AA 3L4PA 2FCNA 2DAFA 4OVVA 1FFUA 1I35A 2DHZA 3OJ4B 3T3OA 2FCSA 4FADA 3BYTB 1QQRA 3IT6B 1R7SA 3OAWA 3MP9A 2L32A 1MHHE 1V8CA 2A4ZA 1V49A 1PQSA 3EGRA 3CMMB 3QHTA 1QOGA 2LUEA 2M0AA 4YWGG 3AE7B 1K8RB 3CSTA 2VZKB 2AQ1B 2LVOA 1J8CA 1L0XB 3ZYYX 2LMCA 2WX1A 5TR5A 4ANUA 2CKHB 3U4EG 3DBRB 3R66C 4IM0A 4FJVB 3ZDTA 1QT9A 2KX3A 2D2QA 4HDQA 1YN3A 3DQVA 1KFYB 5AUIA 4YT0B 2ZEQA 2NR2A 2N9EB 2IO3B 3W1SA 2BS3B 3MFGA 2N1WA 1EU4A 2L76A 5JHAA 2LHDA 1XXGA 1YJIA 2N4FA 3OLMD 2NBVB 2RD0A 3V60A 1BMLC 2KHWB 4HKZE 3RNAC 3PT2B 3SR6A 1NYQA 4AS1A 1E8YA 2KFKB 3VTUA 2PLPA 4BOZB 1F2RC 3DBHB 3NOBA 3ZRCA 4A3OA 3Q3OC 1WF9A 3W2DA 3WAPA 2IY0B 3CWIA 1HZ5A 1EWYC 3P4QB 1OQQA 5CTRC 4G11A 1L2NA 3U2SC 5LNK1 2AQ2B 2INCC 5FKAC 3FC4A 2PVGC 2LZ6A 2LFIA 2CHZA 5BMHA 2O6VA 4RM8A 3MTNB 3HIZA 2KACA 1K51A 1J7AA 2K8BA 4CHKA 2C9WB 2FE8A 1K52A 3ZXRA 4EZKA 2XBBC 3QK0A 4C4VB 1JWSD 1C1YB 4WJPA 2CU1A 4YTPB 1GAQB 2IDYA 2HJ8A 3KWLA 2OHFA 1PGBA 1V81A 1OFFA 2BYVE 2KD0A 3N9YC 1MVKA 2WDQB 2QCZA 2KTRB 3RZFA 3BK1A 2W3RA 3PLUA 2KFKA 3TSSA 2EKEC 2WDVB 2PEAA 4NJ7A 2MHJA 3I3TB 4II2B 1FNWA 1UBQA 2IO0B 3IAM1 1KOTA 3FILB 4KKJA 3RNEC 2R2OA 3WIMA 4UDUC 2Y5BB 2IYDB 2HD5B 3AU5A 4MJSA 4K7SA 1WXVA 4E3CA 4W9GA 5IN7A 4KZCA 3V6EB 2DZKA 4F7ZA 4S0RA 2E3TA 2O6VD 1SIFA 2MW5A 2V4LA 4RFBA 4W9KA 1FD6A 2JZPA 3AE6B 1LGRA 1GUAB 4W9HA 4WWPA 3ZVVA 2GBJA 4I6NB 5KHQA 2JWZA 2WS3B 4GGQA 1WYGA 3PRMB 4JX1C 5IOIA 1WXMA 1ZXHA 1DOIA 1WGHA 2D3BA 1J7CA 1TKEA 3RN9C 2QHOA 3EFCA 2IO2B 1Z2MA 2PIAA 2GBMA 1UH6A 1V1PA 2DZMA 2ONQA 2WXFA 4HCNB 3QQ8B 2KDBA 3L17A 4O1NA 4DXFA 1EF5A 3RI7C 1QLBB 2MH7A 2PJHA 2QMTA 5DCNA 2N7DA 3L0WB 2J52A 5BMGA 1N5WA 2NBWB 1F9JA 1ROEA 3KW5B 2AQ3B 2ZNVB 3ETRA 5DPTA 4TMAB 2V4IB 1C76A 2DWQA 3H7PB 1YMHE 1VJKA 3EA6A 2K6QA 1WXAA 2KC1A 4W9IA 4C00A 4MGZE 2KMAA 1JROA 2Z0DB 1GB4A 4EEWA 2V9HA 2L8JA 5L95C 2WU5B 3RNCC 1SE2A 1WIAA 1TZ1A 2B76B 5TSSA 4II3B 3UIOB 3OJ3A 4W9LA 4QAYA 3IVFA 3WAOA 1OQRA 2LGIA 2N7JA 3VFKA 4A55A 2LJ5A 4FA6A 2NMQA 2D3CA 3DHGC 1BUIC 3VH4B 4PS3A 1PUTA 1WH3A 1Q0WB 1TS2A
chains in the Genus database with same CATH topology
2DYOA 1FRDA 3ZJTA 1L6VA 2FUG1 2G1EA 4B0EA 3HRDD 1E9MA 3AE2B 1JW9D 3Q8AA 5GXGB 3ZJVA 1WXQA 3IT4B 1FNUA 2J53A 1E0ZA 3GS2A 3ZGZA 1XLQA 1PGXA 4GLSC 1RM6C 4R3DA 2LUMA 2IGGA 2V3NA 5EE3A 2VZKD 3B2GA 2N9KA 4ITKA 1K53A 1MHXA 1NVID 4DXGA 3SFEB 1YQ3B 4B0MA 2XNAC 4YSZB 2I38A 2Y5PA 5HG2A 1TS4A 1JALA 2QJLA 1E10A 3AEGB 3NZ3A 1IBXA 2LJIA 2Z8LA 4XE0A 1D6EC 1VZ6A 5HI1A 4A8XC 1TS5A 3Q8CA 2D5GA 4YTMB 2W3SA 3P1MA 2XN9C 4RCOA 3AEAB 1B9RA 2L83A 2W55A 1N62A 2IGDA 3AE9B 2BTEA 3R8BA 3TUOA 4PT5A 1DOYA 3NVVA 3I9V1 3Q8BA 2V3PA 1V1OA 1MI0A 2KQ4X 5EE9A 4US8A 1SXTA 2K5PA 1I7HA 1SIJA 4ARIA 1E7PB 1T5XD 1CJEA 1I4HA 4XDDA 4HEA1 2CJNA 3AEBB 4ZHOA 1KRHA 2K3UA 2LHEA 3IAS1 4JWSC 4N59A 1TKGA 2INPE 4ZRPA 2N9LA 3AECB 1Y56A 1L0VB 2KWDA 5JXVA 2G9HD 1VRAB 4JE3B 3PZ7A 4TSSA 2JX5A 3DWMA 1ZUD2 1F77A 1UWMA 1QILA 2GB1A 3MJ5A 1C79A 2K0PA 5D3IB 2RMMA 3AN1A 1D4BA 1UWXA 4ZRQA 1C4CA 2Y5CA 1UNSA 1FIQA 5E6JA 3W5UB 1DGJA 3TEYA 1L0YB 3LXFA 2L1AA 3L4PA 3GP7A 2SEBD 3AB5A 1FFUA 2BS2B 1HEZE 1SE3A 2ON8A 4GDKB 4J3OD 1BXTA 4IOIE 4IKGA 1UGJA 4RH6A 4WIPA 3J9CA 1T6BX 4MT5A 3T3OA 3BYTB 5I4DA 3HUIA 4P16A 4C7ZA 1MPEA 1QQRA 1XCQL 1YN4A 4HJGE 3IT6B 1R7SA 1RYJA 2L32A 3MP9A 1MHHE 1V8CA 2K9XA 3URYA 4XWWA 1DYQA 1ZOYB 3EGRA 1SJHD 3PZ8A 1ZP0B 3KLSX 1QOGA 2MJ3A 2M0AA 4KGTA 3P42A 1FFVA 3AE7B 4YWGG 3RFZB 2QILA 2W82A 4HRSA 2VZKB 2QSDA 2AQ1B 3IXSA 3LYYA 4MM3B 4US9A 1EU3A 1XLNA 4C80A 1L0XB 4LK0M 3ZYYX 2LMCA 1JCKB 4JPSA 4ZHPA 2BW2A 1JQ4A 2N0SB 2BB5A 3U4EG 1D5ZC 3BZDB 3NVZA 3P4PB 1FMAD 1HZ6A 1AWDA 4MH8A 3TEWA 1TJEA 1XLOA 4NZLB 4WQMA 2PW9A 1QT9A 4A9AA 2GI9A 1CK1A 1RFKA 1L4DB 2WXGA 5MPOA 1KTKA 1YN3A 4L2YA 1KFYB 5AUIA 4L1BA 2L52A 1FNVA 4YT0B 2M19A 4FXCA 1VZ8A 1L5PA 4NAWB 4TQ1A 2DLBA 3FAHA 2JU6X 3W1SA 2BS3B 3MFGA 1D5XC 1HXYD 1EU4A 1M4VA 1XLPA 5FK9C 4D2KA 4YSXB 1GPXA 4OZBA 1KH0A 2OEDA 1FRRA 2LHDA 4KGRA 1SSNA 1XXGA 2JXTA 2NTSA 2E6XA 1YJIA 4IDIA 1T3QA 2WXLA 3HVZA 4NJCA 4ZYSA 5G5GA 4XWTA 4Q2JA 5EE0A 1BMLC 3BVZA 4HKZE 4RGTA 1F2RI 4HKQA 1KF6B 1QOAA 1B1ZA 1AW7A 1FEHA 3AE3B 2JWUA 3SR6A 4WAFA 1NYQA 1QOFA 1FXAA 3R2IA 4AS1A 2GRIA 5BYRA 1XF5L 3NUHB 3T3NA 3H8HA 3Q69A 2PLPA 5BYSA 1XO3A 2IGHA 2JYEA 1JWMD 1A70A 1F2RC 2WXKA 4YXDB 1AN8A 4USAA 2PTLA 1WGKA 4A6QA 1EWCA 1QF6A 1TZOA 1NI3A 3W2DA 3C8YA 5T8IA 1V97A 5HFYA 5EE1A 1KLUD 3BVMA 3CWIA 1GOZA 3Q8FA 1HZ5A 1EWYC 1WRIA 2M56B 3AEFB 3AM9A 3VRBB 2KN4A 3KQ4A 3P4QB 4GDLB 1OQQA 1HQRD 4WURA 1CZPA 3U2SC 1P7EA 2AQ2B 3P63A 5FKAC 3FC4A 2PVGC 5LNK1 4N58A 1IGDA 2LFIA 5BMHA 3V05A 1FXIA 2WXHA 4OZCA 3VR9B 4DQOC 3ZQ4A 1HA5A 4WWMA 2KACA 1K51A 4JWUC 1J7AA 1JWAD 1SF0A 2HDEA 2BYTA 2DBYA 4RF1A 3AE1B 4KX6B 2FE8A 1K52A 2KMMA 2RDHA 1N5XA 4OHJA 2WP9B 2PMVA 2X38A 1TY2A 1FO4A 1WWTA 1IUEA 1JWSD 1IBXB 4REZA 2WXRA 4YTPB 1GAQB 1YNTE 2IDYA 3AMZA 4N6EB 3KWLA 4TQ0A 2OHFA 1PGBA 2J4XA 3V3XA 4KKIA 1VDVA 3R2TA 1OFFA 3N9YC 3MC0B 1YQ4B 1TY0A 2ICIA 1MVKA 2Y3AA 2WQYB 4YTNB 1NYRA 2WDQB 2DYMA 3BVGA 3O13A 4A90A 2WXMA 3BK1A 2PVOD 2W3RA 4C56C 3TSSA 2ACZB 2LEKA 5D7GA 3VR8B 1UUPA 4H2AA 2WDVB 1V1PB 3VRAB 1VR9A 2QIEB 3AEDB 3B9JA 4AQ7A 1FNWA 1ESFA 1ET9A 2ZW0A 3IAM1 3FILB 4KKJA 4CQNA 3SFDB 4RGMA 1TYGB 5FR3A 1PGAA 4WH4A 2I2YA 1PYWD 4UDUC 5H8YE 2WDRB 3W5VB 1I4RA 2JSVX 3P4RB 2WLBA 1RWSA 1XEEA 2MJDA 2KAJA 3OWEB 3P4SB 3CIRB 3BIID 4C7YA 1CQVA 1L6UA 5D3DA 3ZJUA 1C9FA 1FCCC 2WXOA 4RGOS 1JWBD 1YN5A 5C2TB 4XDCA 2E3TA 1ET6A 5AUKA 4YSYB 1N60A 2WXQA 4NAMA 1YJJA 4RFBA 3U7ZA 4EE2A 1FD6A 2BS4B 2BT6A 2JZPA 3AE6B 1ZXIA 5BYQA 3UI3A 1ZE3D 1NEKB 2W54A 3Q8EA 3KWVA 2H89B 2MEKA 4RF0A 3W9CB 2JYTA 1QOBA 1J7BA 1P7FA 3RPFC 1SE4A 1AYFA 2RDGA 3TEZA 2WS3B 3BK2A 3AE4B 2MJEA 1WYGA 2WU2B 2BBCA 2K22A 1DOXA 4JX1C 1FCLA 3NVWA 1ZXHA 1C77A 1DOIA 1VLBA 1J7CA 3FILA 1TKEA 1XCTL 1Q10A 1STEA 1SB3C 3AEEB 3AV8A 1JWUD 2PIAA 4M0WA 2KDMA 1V1PA 1IGCA 3PO0A 1ZPSA 3AH7A 4KGSA 2ONQA 2WXFA 2IPKD 1SJED 2J42A 4ZOHC 3NS1A 1F0ZA 2IJ0A 1ACCA 2YEPF 4OW0A 4ARCA 4O1NA 1TS3A 4DXFA 1QLBB 2MH7A 2QMTA 3SEBA 2J52A 3VQIA 5BMGA 2ZW1A 1WSPA 1N5WA 5G5HA 1ROEA 4LTUA 2AQ3B 2EKIA 1N61A 1I4QA 3ETRA 2RPVA 2H88B 1NENB 2WXNA 3WCQA 4TMAB 2V4IB 1C78A 1C76A 2DWQA 2HTME 3ABVB 3DWGC 2V0GA 2EELA 3AE8B 1E6EB 1JMLA 1YMHE 1VJKA 1I4PA 1PDXA 2PKOA 4OVZA 4LLGM 3EA6A 1L4ZB 4MACA 2BB6A 1JROA 4OZAA 1KLGD 2NTTA 1JRPA 3AE5B 3NVYA 3E56A 1GB4A 1TKYA 4L23A 3MHZA 3BYYB 5BMIA 1I4GA 2INNE 5H92C 5HHDG 2QEJC 3NRZA 5C3JB 2R61A 2WU5B 3U52E 1ZDVA 3EUB2 1QKZA 1SE2A 2WNMA 1I4XA 2YEPB 2B76B 2JQRB 1SBBB 5TSSA 2CJOA 1GB1A 2TSSA 3GB1A 3LB8C 3E9SA 2WXJA 1ENFA 2CU3A 2SAKA 1C4PA 2Q5WD 1EM7A 1FM0D 4RGNA 3HVDA 1OQRA 1ZDXA 2LGIA 2N7JA 3BWUD 4HROA 4A55A 3I57A 1PFDA 3B2FA 2NMQA 1C4AA 1SEBD 2WXPA 1LO5D 4RNAA 1D5MC 3TEXA 1BUIC 1N63A 2FBWB 1K50A 4P6VF 1PUTA 1TS2A 2WXIA 2AX5A 1VZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYT A;  2JYE A; 
#chains in the Genus database with same CATH topology
 2DYO A;  3GE8 C;  4OVU A;  4B0E A;  4LNN A;  3AE2 B;  1RFA A;  4KDI C;  1J19 A;  1XLQ A;  2V3N A;  3B2G A;  4MDK E;  4YL8 A;  3PV1 A;  4GDK A;  3TL5 A;  3HHM A;  1P9D U;  4YSZ B;  2I38 A;  1E10 A;  3ZDM C;  2HJ1 A;  4GB9 A;  4YTM B;  4PS8 A;  3QJZ A;  1GNU A;  2G45 B;  2ZCB A;  3M95 A;  2W55 A;  3TUO A;  4PT5 A;  3NVV A;  2J0M A;  4WJO A;  1ZW7 A;  3I9V 1;  2L0T A;  3GZN B;  1V1O A;  1MI0 A;  1P3Q U;  2D07 B;  1SIJ A;  4GOC A;  4K81 A;  4MGI E;  1E7P B;  1T5X D;  4WAA A;  1CJE A;  2KC2 A;  2KDI A;  1WJ6 A;  4W9J A;  4HEA 1;  4JGH B;  3PRZ A;  4FJZ A;  3IAS 1;  2INP E;  4GDL A;  1H8C A;  1TT5 B;  2DZJ A;  2G9H D;  4JE3 B;  3PZ7 A;  3DBL I;  1ZUD 2;  2OJW A;  4F8C B;  1F77 A;  3NHE B;  3ZUN A;  2DX5 B;  1GJZ A;  4GIV A;  3WAL A;  2MSE D;  4FLH A;  3W5U B;  1H4R A;  1L0Y B;  3GP7 A;  2SEB D;  2LVQ A;  1HEZ E;  4RH6 A;  4B9K A;  4GDK B;  3DVG X;  1UGJ A;  1D3Z A;  3BIN A;  4MT5 A;  5C1Z A;  3RCZ A;  4X57 B;  4J6I A;  4HVB A;  2NCN A;  1YN4 A;  2IBI B;  2KO3 A;  3TBL D;  2LXA A;  3PZ8 A;  1ZP0 B;  3HM3 A;  3B08 A;  1QZE A;  2PE6 B;  3LYY A;  4MM3 B;  1RAX A;  2K39 A;  1XLN A;  5BO4 B;  3L54 A;  1JCK B;  4JPS A;  2KYW A;  4ZYN A;  2N0S B;  1X1M A;  1V5T A;  1WMH B;  4HPL B;  4M02 A;  1HZ6 A;  3V61 A;  1AWD A;  3TEW A;  2QDF A;  1WR1 A;  3ZNZ B;  2MCN B;  1TIF A;  3EEC A;  5MPO A;  3GOE A;  1FNV A;  5J18 A;  2M19 A;  4FXC A;  4ASW C;  1VZ8 A;  4NAW B;  3VTV A;  4LJO B;  2JU6 X;  2NPT B;  1HXY D;  5FK9 C;  4D2K A;  3NS8 A;  4OZB A;  1KH0 A;  1WJU A;  1FRR A;  2NTS A;  2E6X A;  4NJC A;  4ZYS A;  4XWT A;  5EE0 A;  4EZL A;  5D2M B;  4RGT A;  1F2R I;  2GOW A;  4E74 A;  1QOA A;  1B1Z A;  1AW7 A;  4HPM B;  1UF0 A;  4WAF A;  1QOF A;  4GN1 A;  1FXA A;  3R2I A;  5BYR A;  3NUH B;  3T3N A;  3Q6B A;  1MJD A;  5BYS A;  1XO3 A;  4EOY A;  1JWM D;  2MBO A;  1A70 A;  3LDZ E;  3DHH C;  3APD A;  4LDT D;  4A6Q A;  1EWC A;  1QF6 A;  3W1Y A;  5T8I A;  3Q8F A;  2KK8 A;  3ZRF A;  4CYE A;  4EFO A;  3ML9 A;  3ZXV A;  1WM2 A;  4EUT A;  2MLB A;  1CZP A;  3VHT C;  2CHW A;  2AL3 A;  3P63 A;  4XX5 A;  2FAZ A;  4NAW A;  3V05 A;  1UD7 A;  3IBE A;  4K7W A;  4DQO C;  4B6W A;  3ECI A;  3ZQ4 A;  4P7I A;  4JWU C;  1JWA D;  5IKC M;  1SF0 A;  2HDE A;  3FKY A;  3DBS A;  1EUV B;  4RF1 A;  5C23 A;  4KX6 B;  5IAA C;  3Q3N C;  4DHJ B;  2KMM A;  2RDH A;  3R3M A;  1N5X A;  3ZNI D;  2X38 A;  1WWT A;  2ZJD A;  2KN5 A;  4REZ A;  1YNT E;  4FJY A;  3AMZ A;  4KIK B;  2L0F A;  4N6E B;  2J4X A;  3V3X A;  4KKI A;  1VDV A;  2XEW A;  2O2V A;  1YQ4 B;  3MC0 B;  1OEY A;  2ICI A;  2Y3A A;  2WQY B;  2DYM A;  3O13 A;  2BQQ A;  2WXM A;  2ACZ B;  1MG4 A;  4I6P A;  4K3B A;  2BYF A;  2N7E A;  1UUP A;  3VRA B;  1VR9 A;  2VRR B;  2QIE B;  3R7Q A;  3AED B;  1S1Q B;  3B9J A;  5AZH A;  4AQ7 A;  1ET9 A;  1TYG B;  3O65 B;  1PYW D;  5H8Y E;  1OGW A;  2QC8 A;  4M0W B;  3GZN I;  3A9K B;  2JSV X;  2DZI A;  1V9J A;  2AWT A;  2GBK A;  1VCB A;  2V1Y A;  3P4S B;  3CIR B;  1ISN A;  3BII D;  4C7Y A;  1L6U A;  1CQV A;  2M0X A;  1E8Z A;  1C9F A;  4K1R B;  2KVR A;  5AUK A;  4EKU A;  2KVZ A;  4YSY B;  2WXQ A;  3U7Z A;  3GE3 C;  3X23 A;  5IP4 D;  2K25 A;  2CR5 A;  1ZE3 D;  2W54 A;  3KWV A;  2LWP A;  4FHK A;  2H89 B;  3W9C B;  3ENE A;  2BGF A;  3N20 C;  1QOB A;  1J7B A;  3RUI B;  3RPF C;  2OJR A;  3C19 A;  3TEZ A;  3UIN B;  2NBU A;  3A4S C;  2WU2 B;  1WX9 A;  5E6O A;  1VLB A;  3FIL A;  1XCT L;  4B95 A;  1Q10 A;  3AEE B;  3AV8 A;  2LGX A;  1LFD A;  1ZPS A;  3JYU A;  2IPK D;  1SJE D;  4ZOH C;  3NS1 A;  4IG7 B;  2IJ0 A;  2KTR A;  1ACC A;  2YEP F;  4OW0 A;  3DDC B;  3SEB A;  2JF5 A;  4N9F 4;  2XK5 A;  2ZW1 A;  1WSP A;  2JZ3 B;  2EKI A;  2N9P C;  4P1B C;  2RPV A;  3EC8 A;  3I63 C;  2V0G A;  3DWG C;  4BKS D;  4HDO A;  1E6E B;  1JML A;  2PKO A;  1PDX A;  4OVZ A;  4LLG M;  3Q3M C;  2CS4 A;  4KV2 A;  1L4Z B;  3JW0 X;  3ZTD A;  3N1Y C;  2LGY A;  4KDL B;  5G55 A;  2BB6 A;  1KLG D;  1F1H A;  1E8W A;  3MHZ A;  3BYY B;  2RR9 A;  3ZLZ A;  1I4G A;  2BF8 B;  3QIJ A;  1WX8 A;  2K8C A;  3U30 A;  5H92 C;  2D10 A;  5HHD G;  3NRZ A;  3KUC B;  1KLV A;  3VDZ A;  1QKZ A;  2N1V A;  1I4X A;  2JQR B;  2ZZP B;  1GB1 A;  2CJO A;  2TSS A;  3LB8 C;  3E9S A;  2WXJ A;  2SAK A;  1C4P A;  3ALB A;  3HVD A;  2C7H A;  4HRO A;  3TCA A;  1PFD A;  3EHV A;  3PGE A;  4RNA A;  1LO5 D;  3SHQ A;  2FBW B;  4P6V F;  2L7R A;  1VZ7 A;  1EO6 A;  1WYW B;  1FRD A;  1GG3 A;  3TJP A;  1E9M A;  3Q8A A;  2C7M B;  2BKR B;  3MHS D;  1YJ1 A;  3Q2A C;  4WWN A;  3GS2 A;  2I1J A;  2LGS A;  3ZGZ A;  1PGX A;  1RM6 C;  3DVN V;  2LUM A;  2IGG A;  5EE3 A;  2N9K A;  2Z0E B;  1NVI D;  4DXG A;  3ONS A;  1M94 A;  5HG2 A;  2KKC A;  4AJW A;  2YVC A;  1JAL A;  5AZG A;  1CMX B;  1IBX A;  2LJI A;  5HI1 A;  1D6E C;  4A8X C;  1TS5 A;  2D5G A;  3Q3J A;  2XN9 C;  4RCO A;  1N62 A;  3AE9 B;  3UGB B;  2BTE A;  3R8B A;  1DOY A;  1P0R A;  2V3P A;  2JVC A;  1WJ4 A;  2KQ4 X;  3L10 B;  5EE9 A;  4US8 A;  1SXT A;  2KQ7 A;  1I7H A;  1BT0 A;  1SE9 A;  2L05 A;  4XDD A;  2CJN A;  2KWC A;  3DPD A;  2B3A A;  1TKG A;  4KSK C;  3DBL B;  2N9L A;  2IY1 B;  5JXV A;  1VRA B;  2KLC A;  3M62 B;  3DWM A;  3A9J A;  2AEH A;  2ZPY A;  3ZW3 A;  1UWM A;  2MBH A;  2GB1 A;  1YX6 B;  1P98 A;  3AN1 A;  1G6J A;  2RPQ A;  4RM9 A;  1D4B A;  4GU2 A;  1UWX A;  4ZRQ A;  4LJP B;  1E5W A;  4GXB A;  4CO7 A;  1V80 A;  3L08 A;  5DPS A;  1BXT A;  4HK2 A;  4IOI E;  1S3S G;  4JL9 A;  4XYC A;  1T6B X;  2KWU B;  1MPE A;  1XCQ L;  2LRW A;  1RYJ A;  5G2N A;  2K9X A;  3URY A;  4XWW A;  3QAR A;  1DYQ A;  1ZOY B;  2EMT A;  1UZX B;  3P42 A;  1FFV A;  3RFZ B;  2W82 A;  4HRS A;  4WJN A;  2WX0 A;  2QSD A;  4MH0 E;  1EU3 A;  2G4D B;  4LK0 M;  4DDG D;  2A5U A;  4ZHP A;  3KUZ A;  1WGR A;  2BB5 A;  4PS7 A;  2NPT A;  3NVZ A;  3P4P B;  2KWV B;  1XD3 B;  4JQW C;  2IO1 B;  2KX0 A;  3T8M A;  4NZL B;  2PW9 A;  4A9A A;  3RYT A;  1CK1 A;  1RFK A;  2ZCC A;  3VTW A;  3PRE A;  3AUL A;  1UGM A;  4NPN A;  3Q3F A;  4L1B A;  2MBB B;  4DHZ E;  3VUX A;  1L5P A;  1WR6 E;  3NG0 A;  1V2Y A;  3VH3 B;  3FAH A;  1WE7 A;  4LCD E;  4S17 A;  3L13 A;  2LAS A;  1XLP A;  1GPX A;  4KGR A;  4MM3 A;  2LXC A;  3NZU A;  3VXW A;  3HVZ A;  5G5G A;  4Q2J A;  2RDB C;  3Q14 C;  2GLS A;  5IO9 A;  2OOB B;  4IM3 A;  1LM8 B;  2R2Q A;  2JWU A;  2GRI A;  1XF5 L;  3H8H A;  2IGH A;  4KZ0 A;  4DK5 A;  4DBG A;  1WI0 A;  2KDE B;  4YXD B;  1WGK A;  3N32 A;  4NQL B;  1NI3 A;  3B0A A;  1V97 A;  2M8S A;  1KLU D;  3BVM A;  3RNG C;  3CF6 E;  1Q5W B;  2DYB A;  1JRU A;  3AEF B;  3AM9 A;  3KQ4 A;  4BKG A;  5JZE B;  4GDL B;  2WDT B;  2MWS B;  1HQR D;  4WUR A;  1IP9 A;  3B1L X;  3UF8 A;  1P7E A;  4DHZ B;  2DEN B;  3UQB A;  4E71 A;  2DNF A;  2WXH A;  4OZC A;  3VR9 B;  4WWM A;  1TBE A;  2VH2 A;  1HTO A;  1KM7 A;  2ZPN A;  4OHJ A;  4IM2 A;  1TY2 A;  1FO4 A;  1IUE A;  4PYU A;  3A33 B;  2WXR A;  2WWZ A;  2BWE S;  1WE6 A;  1YOV B;  5L83 A;  1R4N I;  2ASQ A;  3PSE B;  1R4N B;  2LEK A;  1YIW A;  1Q1O A;  4IWO A;  4AOF A;  3PHX B;  1OEY J;  4CQN A;  3SFD B;  3PRP B;  4IC7 B;  4W9F A;  3K9P B;  1IPG A;  4WH4 A;  3DHI C;  2KFJ A;  3W5V B;  4AP4 C;  2I2Y A;  2G4S A;  1I4R A;  4W9C A;  2FCM A;  2WLB A;  4IUM B;  2MJD A;  4HCP B;  3QWZ B;  3OWE B;  1T0S C;  2MA9 B;  5EDS A;  3ZJU A;  1FCC C;  2WXO A;  1JWB D;  1AAR A;  2D3A A;  3K9O B;  2WGS A;  2KJR A;  3X0W A;  3AU4 A;  2GMI C;  2JRH A;  1N60 A;  4G50 A;  4EE2 A;  3DBH I;  3N1X C;  2NVU I;  2WHI A;  3AI5 A;  1NEK B;  1WZ3 A;  3Q8E A;  3EFU A;  4RF0 A;  2JYT A;  3RZW C;  1P7F A;  4AJY B;  4BVU C;  1AYF A;  3AE4 B;  2MJE A;  2KNB A;  2BBC A;  2K22 A;  1DOX A;  1FCL A;  3NVW A;  1C77 A;  4ACF A;  2D11 A;  1STE A;  2LGD A;  2KDM A;  4JLC A;  3UQA A;  1IGC A;  2ZNV C;  3AH7 A;  3JSV B;  2LI5 A;  4G0N B;  1HE8 A;  4MEL A;  1YD8 U;  3N1Z C;  1TS3 A;  2JUO A;  3N30 A;  3U7D A;  2MRP A;  2JZZ A;  1N61 A;  4JIO U;  1I4Q A;  3W1S C;  2H88 B;  1NEN B;  2WXN A;  3DOW A;  4ZRK A;  3WCQ A;  1WM3 A;  1C78 A;  3ABV B;  4WJQ A;  4DXA B;  4DWF A;  1I4P A;  4TUU A;  2HE7 A;  4MAC A;  2NTT A;  3AE5 B;  3E56 A;  2PE9 A;  2LVP A;  1TKY A;  3NZS A;  2BKF A;  4WWO A;  4URK A;  2INN E;  1E7U A;  5C3J B;  1WFY A;  4KVG B;  3EUB 2;  2YEP B;  4XZ4 A;  1ENF A;  2CU3 A;  2UYZ B;  2Q5W D;  1EM7 A;  4RGN A;  1WXS A;  3IG3 A;  3I57 A;  2O6V B;  4WQO B;  3H9D A;  1U4A A;  1SEB D;  2WXP A;  3TEX A;  4G3X B;  1N63 A;  1WJN A;  1K50 A;  1MG8 A;  2WXI A;  1TTN A;  2JRI B;  4MJS B;  2BYE A;  3ZJT A;  1L6V A;  2FUG 1;  2G1E A;  5J2R A;  5GXG B;  3ZJV A;  1WXQ A;  3IT4 B;  1FNU A;  3KVF B;  3ZTC A;  1I42 A;  2J53 A;  1E0Z A;  3RMK C;  3MC9 A;  3SD5 A;  1IYF A;  3VUW A;  2XK5 B;  4ANW A;  5HKH A;  2UU7 A;  4ITK A;  1K53 A;  1MHX A;  2KXJ A;  4B0M A;  3PS6 A;  2JY6 A;  1R4M B;  2XNA C;  2Y5P A;  2YLM A;  1TS4 A;  2M4N A;  1N6Z A;  4ZRJ A;  2K1F A;  3AEG B;  3Q8C A;  2KDF B;  4LNO A;  3P1M A;  4NQK E;  4C4V A;  4LNI A;  4BBN C;  1VD2 A;  4IWQ A;  2JT4 B;  3QA8 A;  3KYD D;  3SDL C;  5DPW A;  3MJW A;  5CHW A;  4A20 A;  3PZD A;  1I4H A;  2C7N B;  4ZHO A;  3N3K B;  5FR6 A;  4JWS C;  4N59 A;  2AL6 A;  5J17 A;  4ZRP A;  2UWQ A;  2MP2 B;  1YX5 B;  2JX5 A;  4PYZ A;  2M17 A;  4K7U A;  3MJ5 A;  3CSF A;  3RD2 A;  1C79 A;  2C60 A;  1RRB A;  1T0R C;  3U8Z A;  3DVG Y;  1C4C A;  1FIQ A;  5E6J A;  4M8N A;  2KTF A;  3LXF A;  4LDT B;  3AB5 A;  3H6N A;  2BS2 B;  3PHW B;  1SE3 A;  2ON8 A;  4WIP A;  4J3O D;  4IKG A;  3V6C B;  3KYC D;  3J9C A;  4MEM A;  1L7Y A;  5I4D A;  3HUI A;  4P16 A;  4C7Z A;  1TGZ B;  3M3J A;  4HJG E;  2HTH A;  3P2B A;  1J0G A;  1SJH D;  3KLS X;  2K8H A;  4RMA A;  3DVN U;  2MJ3 A;  4KGT A;  3IHP C;  3PVL A;  2QIL A;  2WYQ A;  3VUY A;  3IXS A;  4US9 A;  4C80 A;  3R7R A;  5AEK B;  1V6E A;  2BW2 A;  1JQ4 A;  4DHJ D;  2J0J A;  1D5Z C;  3BZD B;  1FMA D;  4MH8 A;  3WAN A;  1TJE A;  1XLO A;  4WQM A;  4GMV A;  1KJT A;  2GI9 A;  1NI2 A;  3ZIM A;  4XGA B;  3SU8 X;  1L4D B;  4W9D A;  2WXG A;  1KTK A;  2KZR A;  4L2Y A;  1WRD B;  4ZDV A;  2L52 A;  4TQ1 A;  2DLB A;  3MC8 A;  5GMV A;  3NY5 A;  2BVC A;  1D5X C;  2I1K A;  1M4V A;  3QX1 A;  3KUD B;  4YSX B;  3A4R A;  3IFW B;  2OED A;  4A3P A;  1Y8R C;  1SSN A;  2JXT A;  3OG5 A;  2C5L C;  2V3S A;  5CHV C;  4IDI A;  1T3Q A;  2WXL A;  5AZF A;  3ML8 A;  1GC6 A;  2M1M A;  4BOS C;  1WZ0 A;  4AUQ C;  5LXH A;  3BVZ A;  4HKQ A;  1KF6 B;  1YQB A;  2AYO B;  4ICU A;  1FEH A;  4M00 A;  1UBI A;  2NS5 A;  3AE3 B;  2BPS A;  4W9E A;  3RT3 B;  1A5R A;  1FPY A;  3Q69 A;  4BKS A;  1LXD A;  2JYE A;  2WXK A;  2O2V B;  1AN8 A;  4USA A;  2PTL A;  1TZO A;  4FN2 A;  3C8Y A;  3S2A A;  5HFY A;  3A9J B;  5EE1 A;  1GOZ A;  4HWI B;  1WGG A;  1WRI A;  2M56 B;  1XQQ A;  2KT7 A;  3HM6 X;  3VRB B;  2KN4 A;  2FCQ A;  3VAW A;  1R4M I;  2IND C;  4F1S A;  5D6J B;  1OTR B;  4I6L B;  4N58 A;  1IGD A;  1MFW A;  3M63 B;  1V86 A;  1FXI A;  2BWF A;  2MBQ A;  1HA5 A;  2KAN A;  2L00 B;  3APF A;  2BYT A;  2DBY A;  3AE1 B;  3C0R B;  5E6N A;  2KLG A;  3A1Q A;  2WP9 B;  1HTQ A;  4MGY E;  2PMV A;  2MBE A;  1WMH A;  4BFR A;  2IZV B;  1FXT B;  3PLV A;  1SGH A;  3H7P A;  1IBX B;  3NJT A;  4TQ0 A;  1RLF A;  3R2T A;  5CX3 A;  1TY0 A;  3RNB C;  4IW0 A;  4HXD A;  4YTN B;  1NYR A;  3BVG A;  5IA7 A;  4A90 A;  4C56 C;  2PVO D;  4BAX A;  3JSV A;  5D7G A;  3VR8 B;  4H2A A;  4HJK A;  1V1P B;  4LNK A;  1XT9 B;  1ESF A;  2ZW0 A;  2GBN A;  2L3Z A;  4RGM A;  3TMP B;  3QC8 B;  4HPP A;  4GSW A;  1PGA A;  5FR3 A;  4BZA A;  1V5O A;  4BBN F;  4HLE A;  2WDR B;  4MSQ B;  3P4R B;  1RWS A;  1XEE A;  4ANX A;  2X8X X;  2KAJ A;  3APC A;  4AWJ A;  3WAM A;  4XC2 A;  5KHO A;  5D3D A;  4RGO S;  3WA0 A;  1YN5 A;  5C2T B;  4XDC A;  2REX A;  2MP2 A;  2FID A;  1ET6 A;  2EMS A;  3I5J C;  4MSM B;  1YJJ A;  4NAM A;  3L16 A;  3JVZ X;  2BS4 B;  2BT6 A;  1ZXI A;  5BYQ A;  3UI3 A;  2MEK A;  3PTF C;  5LLI A;  2N9X A;  4M01 A;  2KJH B;  1Z5S B;  2D3G A;  4FBJ B;  2K6D B;  1SE4 A;  2RDG A;  3BY4 B;  3BK2 A;  4KSL C;  3RUL A;  2JPH A;  1WGD A;  3DBR I;  2LD9 A;  1SB3 C;  1F52 A;  1LQB A;  1JWU D;  4M0W A;  4BKT A;  3PO0 A;  4KGS A;  1GC7 A;  2J42 A;  1F0Z A;  4ARC A;  5DPR A;  1T0Y A;  5JH5 C;  1ZGU B;  3VQI A;  2J7Q B;  5G5H A;  4LTU A;  1WY8 A;  2HTM E;  4ANV A;  2J0K A;  2EEL A;  4NNJ B;  3AE8 B;  5LXI B;  4P1C C;  3KH0 A;  1E8X A;  2ZVN A;  2FNJ B;  2FUH B;  3PPA A;  4OZA A;  1JRP A;  4KIK A;  3NVY A;  2GBR A;  2CHX A;  2FIF A;  5E6P A;  4L23 A;  4DDI D;  3ZO5 B;  2MX2 A;  2KOX A;  5BMI A;  3ZNG C;  2QEJ C;  2KMC A;  4NY0 A;  2R61 A;  3U52 E;  1ZDV A;  2MQJ A;  2WNM A;  1WGY A;  2DAJ A;  4PK1 A;  1WX7 A;  1SBB B;  3GB1 A;  2RSU A;  1FM0 D;  4MGK E;  5JHB A;  1ZDX A;  2KJ6 A;  3BWU D;  3H1U A;  2JXX A;  3B2F A;  1EF1 A;  4IWP A;  1C4A A;  3RNF C;  1OQY A;  1D5M C;  4TV3 A;  2KQS A;  3ZKJ C;  2AX5 A;  3A9K A;  1P1A A;  3HK0 A;  4FHJ A;  3ZNH B;  3HRD D;  4K3C A;  1JW9 D;  4LNF A;  4TKN A;  2RGF A;  1T0Q C;  4GLS C;  4R3D A;  4M8M A;  2VZK D;  2W9N A;  3H7S A;  3SFE B;  1YQ3 B;  3UIP B;  1NBF C;  2QJL A;  3NZ3 A;  2Z8L A;  4XE0 A;  1VZ6 A;  2W3S A;  2G3Q B;  3AEA B;  1B9R A;  2L83 A;  3V62 A;  2IGD A;  4ICV A;  2Z59 B;  3Q8B A;  1ZKH A;  2K5P A;  3VVW B;  2PPH A;  3A1Q B;  3LJ3 A;  3T9L A;  4ARI A;  4FUL A;  4EZJ A;  3TIX A;  3AEB B;  1KRH A;  2K3U A;  2LHE A;  5CHF A;  2LRU A;  3AEC B;  1Y56 A;  1L0V B;  2KWD A;  1E7V A;  3QAQ A;  4ZRI A;  4TSS A;  3AXC A;  1C3T A;  4NJ6 A;  1QIL A;  5D94 A;  2VH1 A;  2K0P A;  5D3I B;  1E90 A;  2RMM A;  2ZVO A;  3QCA A;  1NDD A;  3D32 A;  3DCG A;  2Y5C A;  1UNS A;  1UEL A;  1DGJ A;  3TEY A;  2L1A A;  3L4P A;  2FCN A;  2DAF A;  4OVV A;  1FFU A;  1I35 A;  2DHZ A;  3OJ4 B;  3T3O A;  2FCS A;  4FAD A;  3BYT B;  1QQR A;  3IT6 B;  1R7S A;  3OAW A;  3MP9 A;  2L32 A;  1MHH E;  1V8C A;  2A4Z A;  1V49 A;  1PQS A;  3EGR A;  3CMM B;  3QHT A;  1QOG A;  2LUE A;  2M0A A;  4YWG G;  3AE7 B;  1K8R B;  3CST A;  2VZK B;  2AQ1 B;  2LVO A;  1J8C A;  1L0X B;  3ZYY X;  2LMC A;  2WX1 A;  5TR5 A;  4ANU A;  2CKH B;  3U4E G;  3DBR B;  3R66 C;  4IM0 A;  4FJV B;  3ZDT A;  1QT9 A;  2KX3 A;  2D2Q A;  4HDQ A;  1YN3 A;  3DQV A;  1KFY B;  5AUI A;  4YT0 B;  2ZEQ A;  2NR2 A;  2N9E B;  2IO3 B;  3W1S A;  2BS3 B;  3MFG A;  2N1W A;  1EU4 A;  2L76 A;  5JHA A;  2LHD A;  1XXG A;  1YJI A;  2N4F A;  3OLM D;  2NBV B;  2RD0 A;  3V60 A;  1BML C;  2KHW B;  4HKZ E;  3RNA C;  3PT2 B;  3SR6 A;  1NYQ A;  4AS1 A;  1E8Y A;  2KFK B;  3VTU A;  2PLP A;  4BOZ B;  1F2R C;  3DBH B;  3NOB A;  3ZRC A;  4A3O A;  3Q3O C;  1WF9 A;  3W2D A;  3WAP A;  2IY0 B;  3CWI A;  1HZ5 A;  1EWY C;  3P4Q B;  1OQQ A;  5CTR C;  4G11 A;  1L2N A;  3U2S C;  5LNK 1;  2AQ2 B;  2INC C;  5FKA C;  3FC4 A;  2PVG C;  2LZ6 A;  2LFI A;  2CHZ A;  5BMH A;  2O6V A;  4RM8 A;  3MTN B;  3HIZ A;  2KAC A;  1K51 A;  1J7A A;  2K8B A;  4CHK A;  2C9W B;  2FE8 A;  1K52 A;  3ZXR A;  4EZK A;  2XBB C;  3QK0 A;  4C4V B;  1JWS D;  1C1Y B;  4WJP A;  2CU1 A;  4YTP B;  1GAQ B;  2IDY A;  2HJ8 A;  3KWL A;  2OHF A;  1PGB A;  1V81 A;  1OFF A;  2BYV E;  2KD0 A;  3N9Y C;  1MVK A;  2WDQ B;  2QCZ A;  2KTR B;  3RZF A;  3BK1 A;  2W3R A;  3PLU A;  2KFK A;  3TSS A;  2EKE C;  2WDV B;  2PEA A;  4NJ7 A;  2MHJ A;  3I3T B;  4II2 B;  1FNW A;  1UBQ A;  2IO0 B;  3IAM 1;  1KOT A;  3FIL B;  4KKJ A;  3RNE C;  2R2O A;  3WIM A;  4UDU C;  2Y5B B;  2IYD B;  2HD5 B;  3AU5 A;  4MJS A;  4K7S A;  1WXV A;  4E3C A;  4W9G A;  5IN7 A;  4KZC A;  3V6E B;  2DZK A;  4F7Z A;  4S0R A;  2E3T A;  2O6V D;  1SIF A;  2MW5 A;  2V4L A;  4RFB A;  4W9K A;  1FD6 A;  2JZP A;  3AE6 B;  1LGR A;  1GUA B;  4W9H A;  4WWP A;  3ZVV A;  2GBJ A;  4I6N B;  5KHQ A;  2JWZ A;  2WS3 B;  4GGQ A;  1WYG A;  3PRM B;  4JX1 C;  5IOI A;  1WXM A;  1ZXH A;  1DOI A;  1WGH A;  2D3B A;  1J7C A;  1TKE A;  3RN9 C;  2QHO A;  3EFC A;  2IO2 B;  1Z2M A;  2PIA A;  2GBM A;  1UH6 A;  1V1P A;  2DZM A;  2ONQ A;  2WXF A;  4HCN B;  3QQ8 B;  2KDB A;  3L17 A;  4O1N A;  4DXF A;  1EF5 A;  3RI7 C;  1QLB B;  2MH7 A;  2PJH A;  2QMT A;  5DCN A;  2N7D A;  3L0W B;  2J52 A;  5BMG A;  1N5W A;  2NBW B;  1F9J A;  1ROE A;  3KW5 B;  2AQ3 B;  2ZNV B;  3ETR A;  5DPT A;  4TMA B;  2V4I B;  1C76 A;  2DWQ A;  3H7P B;  1YMH E;  1VJK A;  3EA6 A;  2K6Q A;  1WXA A;  2KC1 A;  4W9I A;  4C00 A;  4MGZ E;  2KMA A;  1JRO A;  2Z0D B;  1GB4 A;  4EEW A;  2V9H A;  2L8J A;  5L95 C;  2WU5 B;  3RNC C;  1SE2 A;  1WIA A;  1TZ1 A;  2B76 B;  5TSS A;  4II3 B;  3UIO B;  3OJ3 A;  4W9L A;  4QAY A;  3IVF A;  3WAO A;  1OQR A;  2LGI A;  2N7J A;  3VFK A;  4A55 A;  2LJ5 A;  4FA6 A;  2NMQ A;  2D3C A;  3DHG C;  1BUI C;  3VH4 B;  4PS3 A;  1PUT A;  1WH3 A;  1Q0W B;  1TS2 A; 
#chains in the Genus database with same CATH homology
 2DYO A;  1FRD A;  3ZJT A;  1L6V A;  2FUG 1;  2G1E A;  4B0E A;  3HRD D;  1E9M A;  3AE2 B;  1JW9 D;  3Q8A A;  5GXG B;  3ZJV A;  1WXQ A;  3IT4 B;  1FNU A;  2J53 A;  1E0Z A;  3GS2 A;  3ZGZ A;  1XLQ A;  1PGX A;  4GLS C;  1RM6 C;  4R3D A;  2LUM A;  2IGG A;  2V3N A;  5EE3 A;  2VZK D;  3B2G A;  2N9K A;  4ITK A;  1K53 A;  1MHX A;  1NVI D;  4DXG A;  3SFE B;  1YQ3 B;  4B0M A;  2XNA C;  4YSZ B;  2I38 A;  2Y5P A;  5HG2 A;  1TS4 A;  1JAL A;  2QJL A;  1E10 A;  3AEG B;  3NZ3 A;  1IBX A;  2LJI A;  2Z8L A;  4XE0 A;  1D6E C;  1VZ6 A;  5HI1 A;  4A8X C;  1TS5 A;  3Q8C A;  2D5G A;  4YTM B;  2W3S A;  3P1M A;  2XN9 C;  4RCO A;  3AEA B;  1B9R A;  2L83 A;  2W55 A;  1N62 A;  2IGD A;  3AE9 B;  2BTE A;  3R8B A;  3TUO A;  4PT5 A;  1DOY A;  3NVV A;  3I9V 1;  3Q8B A;  2V3P A;  1V1O A;  1MI0 A;  2KQ4 X;  5EE9 A;  4US8 A;  1SXT A;  2K5P A;  1I7H A;  1SIJ A;  4ARI A;  1E7P B;  1T5X D;  1CJE A;  1I4H A;  4XDD A;  4HEA 1;  2CJN A;  3AEB B;  4ZHO A;  1KRH A;  2K3U A;  2LHE A;  3IAS 1;  4JWS C;  4N59 A;  1TKG A;  2INP E;  4ZRP A;  2N9L A;  3AEC B;  1Y56 A;  1L0V B;  2KWD A;  5JXV A;  2G9H D;  1VRA B;  4JE3 B;  3PZ7 A;  4TSS A;  2JX5 A;  3DWM A;  1ZUD 2;  1F77 A;  1UWM A;  1QIL A;  2GB1 A;  3MJ5 A;  1C79 A;  2K0P A;  5D3I B;  2RMM A;  3AN1 A;  1D4B A;  1UWX A;  4ZRQ A;  1C4C A;  2Y5C A;  1UNS A;  1FIQ A;  5E6J A;  3W5U B;  1DGJ A;  3TEY A;  1L0Y B;  3LXF A;  2L1A A;  3L4P A;  3GP7 A;  2SEB D;  3AB5 A;  1FFU A;  2BS2 B;  1HEZ E;  1SE3 A;  2ON8 A;  4GDK B;  4J3O D;  1BXT A;  4IOI E;  4IKG A;  1UGJ A;  4RH6 A;  4WIP A;  3J9C A;  1T6B X;  4MT5 A;  3T3O A;  3BYT B;  5I4D A;  3HUI A;  4P16 A;  4C7Z A;  1MPE A;  1QQR A;  1XCQ L;  1YN4 A;  4HJG E;  3IT6 B;  1R7S A;  1RYJ A;  2L32 A;  3MP9 A;  1MHH E;  1V8C A;  2K9X A;  3URY A;  4XWW A;  1DYQ A;  1ZOY B;  3EGR A;  1SJH D;  3PZ8 A;  1ZP0 B;  3KLS X;  1QOG A;  2MJ3 A;  2M0A A;  4KGT A;  3P42 A;  1FFV A;  3AE7 B;  4YWG G;  3RFZ B;  2QIL A;  2W82 A;  4HRS A;  2VZK B;  2QSD A;  2AQ1 B;  3IXS A;  3LYY A;  4MM3 B;  4US9 A;  1EU3 A;  1XLN A;  4C80 A;  1L0X B;  4LK0 M;  3ZYY X;  2LMC A;  1JCK B;  4JPS A;  4ZHP A;  2BW2 A;  1JQ4 A;  2N0S B;  2BB5 A;  3U4E G;  1D5Z C;  3BZD B;  3NVZ A;  3P4P B;  1FMA D;  1HZ6 A;  1AWD A;  4MH8 A;  3TEW A;  1TJE A;  1XLO A;  4NZL B;  4WQM A;  2PW9 A;  1QT9 A;  4A9A A;  2GI9 A;  1CK1 A;  1RFK A;  1L4D B;  2WXG A;  5MPO A;  1KTK A;  1YN3 A;  4L2Y A;  1KFY B;  5AUI A;  4L1B A;  2L52 A;  1FNV A;  4YT0 B;  2M19 A;  4FXC A;  1VZ8 A;  1L5P A;  4NAW B;  4TQ1 A;  2DLB A;  3FAH A;  2JU6 X;  3W1S A;  2BS3 B;  3MFG A;  1D5X C;  1HXY D;  1EU4 A;  1M4V A;  1XLP A;  5FK9 C;  4D2K A;  4YSX B;  1GPX A;  4OZB A;  1KH0 A;  2OED A;  1FRR A;  2LHD A;  4KGR A;  1SSN A;  1XXG A;  2JXT A;  2NTS A;  2E6X A;  1YJI A;  4IDI A;  1T3Q A;  2WXL A;  3HVZ A;  4NJC A;  4ZYS A;  5G5G A;  4XWT A;  4Q2J A;  5EE0 A;  1BML C;  3BVZ A;  4HKZ E;  4RGT A;  1F2R I;  4HKQ A;  1KF6 B;  1QOA A;  1B1Z A;  1AW7 A;  1FEH A;  3AE3 B;  2JWU A;  3SR6 A;  4WAF A;  1NYQ A;  1QOF A;  1FXA A;  3R2I A;  4AS1 A;  2GRI A;  5BYR A;  1XF5 L;  3NUH B;  3T3N A;  3H8H A;  3Q69 A;  2PLP A;  5BYS A;  1XO3 A;  2IGH A;  2JYE A;  1JWM D;  1A70 A;  1F2R C;  2WXK A;  4YXD B;  1AN8 A;  4USA A;  2PTL A;  1WGK A;  4A6Q A;  1EWC A;  1QF6 A;  1TZO A;  1NI3 A;  3W2D A;  3C8Y A;  5T8I A;  1V97 A;  5HFY A;  5EE1 A;  1KLU D;  3BVM A;  3CWI A;  1GOZ A;  3Q8F A;  1HZ5 A;  1EWY C;  1WRI A;  2M56 B;  3AEF B;  3AM9 A;  3VRB B;  2KN4 A;  3KQ4 A;  3P4Q B;  4GDL B;  1OQQ A;  1HQR D;  4WUR A;  1CZP A;  3U2S C;  1P7E A;  2AQ2 B;  3P63 A;  5FKA C;  3FC4 A;  2PVG C;  5LNK 1;  4N58 A;  1IGD A;  2LFI A;  5BMH A;  3V05 A;  1FXI A;  2WXH A;  4OZC A;  3VR9 B;  4DQO C;  3ZQ4 A;  1HA5 A;  4WWM A;  2KAC A;  1K51 A;  4JWU C;  1J7A A;  1JWA D;  1SF0 A;  2HDE A;  2BYT A;  2DBY A;  4RF1 A;  3AE1 B;  4KX6 B;  2FE8 A;  1K52 A;  2KMM A;  2RDH A;  1N5X A;  4OHJ A;  2WP9 B;  2PMV A;  2X38 A;  1TY2 A;  1FO4 A;  1WWT A;  1IUE A;  1JWS D;  1IBX B;  4REZ A;  2WXR A;  4YTP B;  1GAQ B;  1YNT E;  2IDY A;  3AMZ A;  4N6E B;  3KWL A;  4TQ0 A;  2OHF A;  1PGB A;  2J4X A;  3V3X A;  4KKI A;  1VDV A;  3R2T A;  1OFF A;  3N9Y C;  3MC0 B;  1YQ4 B;  1TY0 A;  2ICI A;  1MVK A;  2Y3A A;  2WQY B;  4YTN B;  1NYR A;  2WDQ B;  2DYM A;  3BVG A;  3O13 A;  4A90 A;  2WXM A;  3BK1 A;  2PVO D;  2W3R A;  4C56 C;  3TSS A;  2ACZ B;  2LEK A;  5D7G A;  3VR8 B;  1UUP A;  4H2A A;  2WDV B;  1V1P B;  3VRA B;  1VR9 A;  2QIE B;  3AED B;  3B9J A;  4AQ7 A;  1FNW A;  1ESF A;  1ET9 A;  2ZW0 A;  3IAM 1;  3FIL B;  4KKJ A;  4CQN A;  3SFD B;  4RGM A;  1TYG B;  5FR3 A;  1PGA A;  4WH4 A;  2I2Y A;  1PYW D;  4UDU C;  5H8Y E;  2WDR B;  3W5V B;  1I4R A;  2JSV X;  3P4R B;  2WLB A;  1RWS A;  1XEE A;  2MJD A;  2KAJ A;  3OWE B;  3P4S B;  3CIR B;  3BII D;  4C7Y A;  1CQV A;  1L6U A;  5D3D A;  3ZJU A;  1C9F A;  1FCC C;  2WXO A;  4RGO S;  1JWB D;  1YN5 A;  5C2T B;  4XDC A;  2E3T A;  1ET6 A;  5AUK A;  4YSY B;  1N60 A;  2WXQ A;  4NAM A;  1YJJ A;  4RFB A;  3U7Z A;  4EE2 A;  1FD6 A;  2BS4 B;  2BT6 A;  2JZP A;  3AE6 B;  1ZXI A;  5BYQ A;  3UI3 A;  1ZE3 D;  1NEK B;  2W54 A;  3Q8E A;  3KWV A;  2H89 B;  2MEK A;  4RF0 A;  3W9C B;  2JYT A;  1QOB A;  1J7B A;  1P7F A;  3RPF C;  1SE4 A;  1AYF A;  2RDG A;  3TEZ A;  2WS3 B;  3BK2 A;  3AE4 B;  2MJE A;  1WYG A;  2WU2 B;  2BBC A;  2K22 A;  1DOX A;  4JX1 C;  1FCL A;  3NVW A;  1ZXH A;  1C77 A;  1DOI A;  1VLB A;  1J7C A;  3FIL A;  1TKE A;  1XCT L;  1Q10 A;  1STE A;  1SB3 C;  3AEE B;  3AV8 A;  1JWU D;  2PIA A;  4M0W A;  2KDM A;  1V1P A;  1IGC A;  3PO0 A;  1ZPS A;  3AH7 A;  4KGS A;  2ONQ A;  2WXF A;  2IPK D;  1SJE D;  2J42 A;  4ZOH C;  3NS1 A;  1F0Z A;  2IJ0 A;  1ACC A;  2YEP F;  4OW0 A;  4ARC A;  4O1N A;  1TS3 A;  4DXF A;  1QLB B;  2MH7 A;  2QMT A;  3SEB A;  2J52 A;  3VQI A;  5BMG A;  2ZW1 A;  1WSP A;  1N5W A;  5G5H A;  1ROE A;  4LTU A;  2AQ3 B;  2EKI A;  1N61 A;  1I4Q A;  3ETR A;  2RPV A;  2H88 B;  1NEN B;  2WXN A;  3WCQ A;  4TMA B;  2V4I B;  1C78 A;  1C76 A;  2DWQ A;  2HTM E;  3ABV B;  3DWG C;  2V0G A;  2EEL A;  3AE8 B;  1E6E B;  1JML A;  1YMH E;  1VJK A;  1I4P A;  1PDX A;  2PKO A;  4OVZ A;  4LLG M;  3EA6 A;  1L4Z B;  4MAC A;  2BB6 A;  1JRO A;  4OZA A;  1KLG D;  2NTT A;  1JRP A;  3AE5 B;  3NVY A;  3E56 A;  1GB4 A;  1TKY A;  4L23 A;  3MHZ A;  3BYY B;  5BMI A;  1I4G A;  2INN E;  5H92 C;  5HHD G;  2QEJ C;  3NRZ A;  5C3J B;  2R61 A;  2WU5 B;  3U52 E;  1ZDV A;  3EUB 2;  1QKZ A;  1SE2 A;  2WNM A;  1I4X A;  2YEP B;  2B76 B;  2JQR B;  1SBB B;  5TSS A;  2CJO A;  1GB1 A;  2TSS A;  3GB1 A;  3LB8 C;  3E9S A;  2WXJ A;  1ENF A;  2CU3 A;  2SAK A;  1C4P A;  2Q5W D;  1EM7 A;  1FM0 D;  4RGN A;  3HVD A;  1OQR A;  1ZDX A;  2LGI A;  2N7J A;  3BWU D;  4HRO A;  4A55 A;  3I57 A;  1PFD A;  3B2F A;  2NMQ A;  1C4A A;  1SEB D;  2WXP A;  1LO5 D;  4RNA A;  1D5M C;  3TEX A;  1BUI C;  1N63 A;  2FBW B;  1K50 A;  4P6V F;  1PUT A;  1TS2 A;  2WXI A;  2AX5 A;  1VZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...