2JYEA

Human granulin a
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
72
structure length
72
Chain Sequence
AMDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQKLAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Granulin A
publication title Structure dissection of human progranulin identifies well-folded granulin/epithelin modules with unique functional activities.
pubmed doi rcsb
source organism Homo sapiens
total genus 3
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00396 Granulin Granulin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.500 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jyeA01
2JYTA 2JYEA
chains in the Genus database with same CATH superfamily
1VRAB 3RNFC 3JSVA 2QILA 3TMPB 4LK0M 1ZXHA 2OHFA 4II2B 3B1LX 3HRDD 3PO0A 2ZVOA 2JSVX 3ZXVA 4LNIA 2K8HA 4AP4C 1XLPA 3S2AA 1V8CA 4N58A 3RT3B 2DHZA 4JQWC 3URYA 1EF5A 5H8YE 1YJJA 2KN5A 3NVYA 3IFWB 3R2IA 3H1UA 1C4CA 2LRWA 2N9LA 1QQRA 2SEBD 3LXFA 1I4PA 3APCA 5EE1A 2TSSA 2K9XA 3GB1A 2BGFA 3Q8AA 1AWDA 1ZW7A 4KIKB 2BQQA 4GDLB 5IA7A 1L2NA 1RYJA 4KGTA 2LVQA 1SBBB 3RNBC 4G3XB 1D5ZC 3AEAB 4PYUA 3QC8B 2FUG1 4EOYA 3PTFC 1NVID 5J18A 1UNSA 4ZHPA 3P4PB 3KQ4A 1L0VB 1C79A 2NTTA 4HLEA 4A8XC 4JLCA 1F2RI 2NVUI 4HKQA 2BYFA 4C7ZA 1GB4A 4WJNA 1SEBD 2YEPF 4KVGB 4ZHOA 2N1WA 2RDGA 3BK2A 1ZUD2 4IWQA 3VVWB 4ANUA 2V4LA 4L1BA 4RGTA 2IY0B 2JX5A 1KF6B 2NBWB 3DWGC 2MP2A 3RCZA 1WMHA 1WGGA 2MH7A 3IHPC 3V62A 3AE1B 1WR6E 1B1ZA 1TS4A 3AEFB 1MI0A 4HEA1 4YL8A 2I1KA 1AN8A 3PPAA 2K39A 2B76B 5H92C 1KRHA 1LQBA 1A5RA 4OZBA 3GP7A 3KYCD 4L2YA 1TBEA 4M02A 3GE8C 1RWSA 2MQJA 1FNUA 4RGMA 3NVZA 1QZEA 2DX5B 1A70A 3AE9B 3RPFC 4LJPB 4KDLB 3CSTA 1X1MA 2W9NA 2KJHB 1N63A 3BYYB 1NBFC 3TBLD 1WX9A 3QCAA 3V3XA 5D3DA 1ET6A 3FC4A 4N9F4 3RZFA 2XK5B 4OHJA 1N61A 5J17A 3U4EG 3P1MA 1WX7A 3ZTDA 3P4SB 2KYWA 1QILA 3UGBB 3Q2AC 4GB9A 1TT5B 1ESFA 4ANWA 2IO2B 3QA8A 3NHEB 1SSNA 1YX5B 3AECB 4ZYSA 3AEDB 3WAOA 4WWMA 1L4ZB 2DYOA 3UINB 1PUTA 1D5MC 1R4NB 1WGKA 4DDGD 4EZLA 1WXSA 2DENB 4ZDVA 3I63C 1DOXA 3ONSA 5G55A 3U7DA 2CHXA 4XX5A 1UBQA 2G45B 5T8IA 1XLNA 2LASA 3BINA 4HCPB 1V81A 4US9A 3EC8A 1XLQA 3BVZA 2M0XA 3N3KB 2FCNA 3OWEB 5G5HA 2K0PA 2Y5PA 2X8XX 3OJ4B 4AWJA 2KDEB 3W5UB 2KTRB 1JWBD 3PV1A 4YTMB 4YXDB 1T6BX 1R4NI 4AJWA 4CYEA 3UI3A 2XBBC 3JW0X 4KV2A 4FBJB 4RF1A 2KQ4X 4DBGA 2BW2A 2D10A 1M94A 1E0ZA 2UU7A 3ALBA 2A4ZA 3DVGY 4A3PA 3N1ZC 3N1YC 4WWNA 2BF8B 3AU5A 2L3ZA 1YNTE 4P7IA 4NAMA 4C80A 1EM7A 3NZ3A 1EU3A 4ACFA 1ZP0B 1TS5A 4F1SA 4XC2A 1JRUA 2KQ7A 1Z5SB 2FCSA 4WAFA 1OQYA 4W9CA 2L32A 3W2DA 2Z0EB 4FULA 4XYCA 4REZA 2MA9B 2ZVNA 3H7PB 1L0YB 1SJHD 2PW9A 2BS3B 3NRZA 2L0TA 1XT9B 3U2SC 4HPLB 5FR3A 2PIAA 4DHJD 1GC7A 1ET9A 3TJPA 1JWSD 3A9KB 3MC9A 4AOFA 3JYUA 3N1XC 2WQYB 3QWZB 3L16A 2M1MA 4WAAA 3Q14C 3M62B 4RM9A 2LJIA 1N6ZA 1CJEA 1WYGA 2WXHA 3FILB 3AE4B 4LCDE 5CHVC 1QOFA 1YQBA 2N7DA 4HCNB 4MDKE 4RFBA 3QHTA 3VH4B 4ICUA 1QOBA 1SE2A 4Q2JA 4NAWB 2D3CA 1CMXB 1N5XA 2JY6A 3CIRB 3TEZA 3JVZX 2CU3A 5BMHA 3KUZA 3SHQA 2Y5BB 4GSWA 2DNFA 4FJYA 4YSZB 1SIJA 4BBNF 3Q69A 5FR6A 1D5XC 1EWYC 3ZRFA 3DVNU 3ZUNA 4TMAB 4XZ4A 3AEGB 4GIVA 2V0GA 1Q5WB 2DYMA 3BZDB 1DYQA 3DHIC 3P63A 5BMIA 4TUUA 5IKCM 2N9EB 4G0NB 2MRPA 2UYZB 3CMMB 1YN4A 2ASQA 2QIEB 5EE3A 3VUYA 3Q3JA 3UQAA 3X23A 4KKJA 3UQBA 3W9CB 2IY1B 2G1EA 2NCNA 4LNKA 5HKHA 1DOIA 2FCQA 2WDTB 5AZGA 1OFFA 1TS3A 2Z8LA 3A9JB 3TIXA 3PHXB 1FNWA 2WXFA 3ZIMA 1WIAA 2LEKA 1WMHB 3L13A 2PVOD 3PREA 2D3GA 1UF0A 3QK0A 1K52A 2BYEA 2MBEA 1V2YA 3TCAA 3PZDA 3PLVA 1JALA 1SGHA 1WGYA 1Q1OA 4I6LB 3R8BA 5DPWA 2WXKA 5CX3A 1FFVA 2E3TA 1SE4A 3RULA 3BYTB 2PVGC 5DCNA 2AEHA 2JRIB 2ZW0A 3WIMA 1S3SG 3AV8A 2KACA 5I4DA 2I1JA 5IP4D 1Q10A 2KDIA 1FXTB 2LFIA 1GJZA 1DOYA 1I7HA 4IM0A 2KMCA 3SD5A 3AE7B 1FM0D 3HVDA 3ZJTA 3H7SA 4HWIB 3WAMA 4FLHA 4DDID 1ZKHA 5C2TB 5C23A 1VDVA 1HA5A 3KYDD 4F7ZA 2PJHA 3N32A 4FA6A 1WRDB 2EELA 2WDVB 2BPSA 1E6EB 4C4VA 4DHZB 1YJ1A 1VZ7A 2WXJA 3B9JA 2FIFA 2PTLA 4K81A 2CU1A 5D6JB 2O2VA 1WJNA 4LDTB 1E8YA 4BVUC 1FRRA 3PVLA 2RGFA 3RYTA 5IN7A 1N5WA 1ZDVA 1WRIA 2L05A 4WURA 3ZDTA 2WGSA 3E56A 4W9EA 3M3JA 5E6OA 1WGRA 2WXLA 5LNK1 4OVUA 2NR2A 3T9LA 4UDUC 3VFKA 3SFEB 2RPVA 3NJTA 4DXAB 4XGAB 1TS2A 1TZ1A 3D32A 4BZAA 3ML9A 1H4RA 2Z0DB 3V6EB 2LVPA 4IC7B 1YN3A 4ARCA 3O65B 2KFKA 2K25A 3KH0A 4E74A 2QSDA 4M8NA 4M0WA 1C3TA 4S17A 4B0EA 1YOVB 1KH0A 3HUIA 1ACCA 3EUB2 4KDIC 1OGWA 2QDFA 3RUIB 1WZ3A 2LMCA 1AARA 1Y8RC 1BUIC 3T3OA 1V6EA 3AXCA 3H9DA 1XLOA 4W9HA 5AUKA 1V1PA 3CSFA 1V5TA 2ZPYA 4IG7B 2EMTA 1I4RA 3RNCC 2JVCA 1WJ4A 2KJRA 1LM8B 2JZZA 2IPKD 1XCTL 2ZPNA 1WY8A 2MHJA 5HI1A 2O6VB 2AL3A 3SU8X 3UIOB 4RH6A 2J52A 1C77A 1LXDA 3I5JC 2B3AA 1BXTA 4P1CC 3Q8CA 3NVWA 2NS5A 4MJSB 3KWLA 1OQQA 3A33B 1CK1A 2QEJC 1CQVA 2W54A 3QARA 3ZNHB 4PS3A 2GBMA 4LTUA 2K22A 1IGCA 1L0XB 3T8MA 3O13A 5AEKB 2LUMA 3VR8B 2W3SA 1QF6A 4JWSC 3VRAB 3GE3C 2ONQA 1NDDA 5LXIB 3K9OB 3V6CB 4MH8A 4GDKA 5BMGA 4HDQA 3U52E 4OZAA 2INDC 1WF9A 2GOWA 1KM7A 4K3BA 4LNNA 1JQ4A 2I38A 3SDLC 5HFYA 1I42A 4FXCA 1UGMA 1MG4A 1XO3A 1GUAB 4I6NB 3WAPA 2IGGA 3L4PA 1GOZA 2G3QB 1IYFA 2NMQA 5IO9A 4NQLB 5L95C 3RZWC 1IP9A 2PE9A 1EO6A 4K7UA 4A6QA 4JL9A 1V97A 1B9RA 1TJEA 3HIZA 3PS6A 1S1QB 4MH0E 2DWQA 4MM3B 3ENEA 1SE9A 2KC2A 3TEYA 2GI9A 1FRDA 2V1YA 5GMVA 1SB3C 2RR9A 2ZNVB 3N30A 4PS7A 1E7VA 5DPRA 5BYSA 1WZ0A 3E9SA 4IUMB 2DYBA 5TR5A 3WA0A 3AE5B 4NZLB 1HQRD 1VJKA 3KUCB 2WU2B 4PK1A 1FCLA 4JX1C 2L52A 1WX8A 2KVZA 2M0AA 2WXPA 1P7FA 1FPYA 1LGRA 3VHTC 2ZW1A 4IW0A 3BIID 3AE8B 3Q6BA 5AZHA 3U7ZA 1FFUA 2WWZA 2WXMA 4MGYE 3SFDB 1WYWB 2C7NB 1L5PA 4IOIE 2QC8A 1TYGB 4ZRPA 3C19A 2INNE 1KFYB 4C00A 2WXGA 5FK9C 2KAJA 4LNFA 2XN9C 4IKGA 2WU5B 5CTRC 3AI5A 1K8RB 2D07B 3R7RA 2LGDA 2WXOA 3VUXA 5HG2A 3W5VB 1C78A 2JWUA 2IYDB 2JXXA 2ICIA 2LXAA 2FUHB 3AE6B 2PLPA 2HTHA 1YN5A 2KTFA 1F2RC 3IT4B 2M56B 4WIPA 4HXDA 3UF8A 2V9HA 1C9FA 3VDZA 1K51A 2Z59B 3PRMB 1J19A 4N59A 1OEYJ 2WNMA 2DBYA 3OLMD 1L4DB 5D3IB 3ZDMC 3A1QB 2V3SA 2KMAA 3A4SC 4HKZE 1R4MB 2Y5CA 3AB5A 3NZSA 3RNGC 3VTUA 2N9KA 3IBEA 3MHSD 4P6VF 3LDZE 3PSEB 2GRIA 3V05A 4BKSD 1FO4A 2KQSA 1YMHE 2BT6A 2CJNA 3NZUA 2XNAC 4GGQA 3QX1A 2JWZA 2V4IB 3ZO5B 4ZRJA 4WWOA 1K50A 1KJTA 5JH5C 4ZYNA 1XQQA 4LNOA 4WJOA 1FXIA 2BYTA 3LYYA 2C7HA 1R4MI 4RM8A 3BVMA 4YSYB 1SIFA 3AN1A 1V1OA 3ZNZB 1V9JA 2KFJA 4GMVA 5IAAC 3EGRA 4KIKA 1NI2A 2MWSB 4GDLA 1HZ6A 2HD5B 3AH7A 5G5GA 2KX0A 1EU4A 3DOWA 2RDHA 2GBKA 4NNJB 3RD2A 1NI3A 4A90A 2W55A 3R3MA 3Q3NC 3EFUA 1I4GA 1VCBA 1I4HA 1FIQA 2KFKB 3DVNV 4QAYA 3VTWA 1KLGD 1GAQB 3AULA 3DHGC 3JSVB 4YT0B 3W1SC 2REXA 1GNUA 1SF0A 2N1VA 2Q5WD 3FAHA 3ABVB 1V80A 1YD8U 1PGBA 2WYQA 1FEHA 2VH1A 5L83A 5E6PA 1L7YA 3AMZA 2LGSA 3EFCA 4ARIA 2BVCA 2CHWA 2NBVB 5HHDG 4K3CA 3VUWA 1V1PB 2IO1B 3DBHB 4OVVA 5BYQA 4DHZE 1UELA 3P4RB 1OEYA 3IG3A 2C9WB 1KTKA 1ZPSA 2ZNVC 3P4QB 1K53A 1T0RC 4R3DA 4BOZB 1MFWA 5D7GA 2R2QA 3AE3B 1FXAA 2YLMA 2KDBA 3B2GA 4HVBA 5GXGB 1WGDA 4JPSA 2KDMA 2KO3A 3FKYA 4XE0A 4RF0A 3N9YC 3DBHI 3ZGZA 3VTVA 1L6VA 3ZRCA 3RNAC 3KLSX 3PLUA 1YIWA 1TKGA 2VH2A 3L08A 4W9GA 2L1AA 3WALA 3ZVVA 4B95A 1LFDA 1I4QA 1D4BA 2HJ8A 4W9JA 4GDKB 4FHKA 3HK0A 2LVOA 2PKOA 4FHJA 4HK2A 2MP2B 3LJ3A 2LUEA 1C4PA 5TSSA 4ZRKA 3MC0B 2BS4B 2W82A 4TV3A 2C60A 2JRHA 2YVCA 4K1RB 3P42A 1WM2A 3DVGX 2JZ3B 2A5UA 2R61A 2LI5A 4W9KA 4GOCA 1KLUD 4M01A 4LJOB 1PYWD 4ANVA 2KWCA 2L83A 5J2RA 4EUTA 2DAJA 4B0MA 1RM6C 4HJGE 5KHQA 1AW7A 2BB5A 4B9KA 4HDOA 3PT2B 2KHWB 4LDTD 2K6DB 2D11A 2DZKA 2WHIA 1MG8A 4KGSA 1JWUD 3PZ8A 2V3PA 2C7MB 4KKIA 2BS2B 4CQNA 1IBXA 3QAQA 2YEPB 3TUOA 4RMAA 1ZDXA 2KLCA 1ENFA 2HDEA 3P2BA 2MCNB 4AS1A 1VZ6A 1TY2A 1XXGA 4JIOU 2L00B 2EKIA 1JMLA 4FADA 4C7YA 2CHZA 5D2MB 4EZKA 1XF5L 2KN4A 3DBLB 1PDXA 4P16A 1HTOA 3L0WB 1WI0A 3APFA 2KTRA 2CJOA 4PYZA 3PRZA 2FBWB 2WX1A 4CO7A 3RFZB 2MBHA 2IGHA 4FJZA 2QCZA 3R2TA 2WX0A 2GBJA 1F1HA 2RSUA 2BWFA 5EE9A 4OVZA 3T3NA 2JYTA 3TEXA 1JWMD 3DBRI 2G4SA 3H8HA 1E10A 2ZEQA 3VH3B 1E8XA 4A9AA 3B2FA 3IAM1 2KWUB 2K6QA 2INPE 5LLIA 3AEEB 4DK5A 3DBLI 1HE8A 2N9PC 1QOAA 3M95A 2IDYA 4ITKA 4ICVA 1EWCA 1UWXA 5JHBA 1ZGUB 2W3RA 1MHXA 1NEKB 1QOGA 1STEA 1E7UA 4E71A 3TL5A 4K7SA 3IXSA 2J42A 3J9CA 3RI7C 2DZIA 1WE7A 2O6VD 2JUOA 3DPDA 3H7PA 4PS8A 4EEWA 1P9DU 2D3BA 3GOEA 2N4FA 3NS1A 4W9LA 4F8CB 2MLBA 3Q3MC 1J7AA 2JYEA 2WXIA 4AQ7A 4WWPA 4B6WA 1F9JA 3ZLZA 2ACZB 2KJ6A 3SEBA 3A9KA 3MP9A 1OQRA 2LWPA 4IM3A 1T0YA 4BKSA 4MGZE 1VR9A 2N7EA 1PQSA 4DXGA 3PZ7A 1T5XD 4NPNA 4GN1A 4CHKA 1VD2A 4BAXA 3VAWA 3NS8A 4FN2A 2EKEC 2LGIA 3FILA 2CS4A 1C1YB 2J0MA 3DWMA 4NQKE 1WWTA 3W1YA 1D3ZA 2JU6X 4PT5A 2FNJB 2JF5A 1HXYD 1H8CA 2AQ1B 2NPTA 3L54A 4W9IA 4M00A 3HVZA 4P1BC 4NAWA 2FAZA 2OJRA 1C4AA 1KOTA 2G4DB 3EA6A 1TGZB 5JZEB 1FNVA 5C1ZA 3ZYYX 1T3QA 5JHAA 4KX6B 3PHWB 2H88B 3I3TB 2FCMA 2WXRA 4YTPB 1WGHA 3ZQ4A 1G6JA 2M17A 5BYRA 2BKRB 4IWPA 1C76A 2MEKA 2JT4B 5MPOA 2WP9B 3IT6B 1RFAA 1IUEA 3Q8FA 2WXNA 3ML8A 2IZVB 4MSMB 1FD6A 1ISNA 2D3AA 3AEBB 2KD0A 1F0ZA 1P7EA 4D2KA 1GPXA 4YTNB 4NY0A 3TSSA 2SAKA 3A9JA 4DQOC 1ZXIA 5EDSA 1RFKA 2BKFA 2ZZPB 1Q0WB 2JXTA 2KDFB 3Q8EA 1JROA 2JZPA 2RD0A 1J7BA 1FMAD 3ZXRA 3NOBA 1UH6A 3GZNB 2XEWA 3U8ZA 4A3OA 4MSQB 2AX5A 2OOBB 2KNBA 3ETRA 1WE6A 4W9DA 4AUQC 4IDIA 2PEAA 4JGHB 1PFDA 1WSPA 2Y3AA 2KC1A 2KVRA 2IO3B 4MEMA 4C56C 1PGAA 1HEZE 2WXQA 1TIFA 3QQ8B 2KWVB 2J0JA 3PRPB 4DXFA 5KHOA 1JW9D 4ZOHC 2RMMA 4EE2A 3GZNI 1NYQA 3LB8C 1WXAA 2QJLA 2KMMA 2WDQB 4WQOB 5C3JB 3RMKC 1VZ8A 2RPQA 3BWUD 3DQVA 2N0SB 5FKAC 1FCCC 2K1FA 5AZFA 3I57A 2AWTA 3ZTCA 4URKA 2K8CA 2JPHA 1WXVA 3B0AA 3ZNGC 1WFYA 4YWGG 2MSED 3NY5A 5LXHA 2CR5A 2J53A 1YX6B 1D6EC 3NUHB 4J3OD 3MTNB 4US8A 2K5PA 4GLSC 2IJ0A 1U4AA 2DAFA 3PGEA 4AJYB 1DGJA 2HTME 2DZJA 1ZE3D 1UD7A 3X0WA 4G50A 3H6NA 4HROA 2C5LC 5E6JA 1AYFA 4IWOA 4JWUC 4NJCA 1UWMA 4USAA 1RLFA 4RGOS 1IBXB 1E9MA 4JE3B 2MBBB 2VZKD 1HZ5A 4I6PA 2LJ5A 2K8BA 1P98A 4EKUA 1T0SC 4KZCA 3Q8BA 4MACA 3KUDB 1QLBB 4MELA 3KW5B 2KOXA 4TQ0A 3M63B 4C4VB 5DPTA 1TKYA 4X57B 3VXWA 4ANXA 3RN9C 1BMLC 3UIPB 4MGKE 1N62A 4G11A 3OG5A 5IOIA 4XWWA 3SR6A 2MBOA 2O2VB 2J7QB 3AE2B 1HTQA 3I9V1 4M8MA 4EFOA 4NJ6A 1I4XA 3R7QA 3DHHC 3C8YA 4IM2A 3TEWA 1SXTA 5DPSA 1QKZA 3VQIA 3ZJVA 5E6NA 1YQ4B 5BO4B 2VZKB 1JCKB 1RRBA 3HHMA 3OAWA 2UWQA 4WJQA 1PGXA 4TKNA 3GS2A 1YJIA 2O6VA 4BOSC 2E6XA 1ROEA 1JWAD 3L17A 4FJVB 3A4RA 1EF1A 2NBUA 4KZ0A 3IVFA 4HPMB 2INCC 2LGYA 4ASWC 4MJSA 2RDBC 1BT0A 4M0WB 2FE8A 4KSKC 4ZRIA 2WS3B 1MHHE 1UGJA 1J8CA 3ZKJC 1VLBA 2MJ3A 1E8WA 2H89B 1E7PB 4LLGM 2GB1A 1WXQA 4BKGA 2IO0B 1Z2MA 4OW0A 2QHOA 4MT5A 4E3CA 2VRRB 3ZNID 4OZCA 4H2AA 1IGDA 2EMSA 3B08A 4N6EB 2X38A 3NVVA 4MGIE 1YQ3B 1T0QC 3DCGA 5EE0A 2LZ6A 2AQ3B 3U30A 4BKTA 3NG0A 1WR1A 4HPPA 2I2YA 1MPEA 2NPTB 3OJ3A 1IPGA 2LXCA 2WDRB 2AL6A 2AQ2B 4O1NA 3MC8A 2L0FA 3HM6X 1QT9A 3Q3OC 2BTEA 3W1SA 1TTNA 3CF6E 1E90A 2G9HD 2KWDA 1OTRB 2L8JA 3N20C 1MJDA 4DHJB 1JRPA 2HJ1A 2GLSA 4HRSA 3VR9B 4MM3A 1SE3A 1I35A 4HJKA 3BY4B 4NJ7A 3MHZA 1J7CA 3KVFB 4WQMA 2LHDA 2LGXA 2XK5A 2HE7A 1L6UA 3MFGA 5D94A 4XWTA 1XD3B 2MW5A 4DWFA 5JXVA 4BBNC 3MJWA 3MJ5A 3ECIA 2KX3A 2M4NA 1RAXA 5CHFA 2PPHA 3WCQA 3VRBB 3CWIA 2R2OA 3HM3A 4WH4A 2KT7A 3RNEC 4XDCA 1WH3A 2L76A 1WJUA 1Y56A 1WXMA 2D5GA 2ZCBA 2MBQA 2ZCCA 3AU4A 4II3B 4S0RA 4BFRA 1V86A 4L23A 3EECA 2LD9A 3Q3FA 2KKCA 2LHEA 2AYOB 2GBRA 1UZXB 2KXJA 2GBNA 1J0GA 1TZOA 1KLVA 2D2QA 2M19A 2BB6A 2BYVE 1XEEA 3APDA 1CZPA 3DBRB 3BVGA 3V61A 1E8ZA 4RNAA 2IBIB 4TSSA 2L7RA 3BK1A 4K7WA 1MVKA 4XDDA 1TKEA 1F77A 2GMIC 2KANA 2ON8A 3ZJUA 4RCOA 5AUIA 1P3QU 2CKHB 2M8SA 3ZW3A 1ZOYB 3K9PB 1UBIA 1F52A 2V3NA 3A1QA 3KWVA 4KGRA 4A20A 1NENB 5G2NA 1EUVB 2J4XA 2ZJDA 3L10B 4GXBA 2MJDA 2BBCA 1E5WA 3QJZA 3WANA 2MX2A 2FIDA 4J6IA 4RGNA 2KK8A 1N60A 2PE6B 2OEDA 1M4VA 5CHWA 4KSLC 1GG3A 3AM9A 3DBSA 4WJPA 2K3UA 2JQRB 1UUPA 3R66C 1WJ6A 4TQ1A 2KZRA 1SJED 1P1AA 2KLGA 2LRUA 3C0RB 2PMVA 2N7JA 1LO5D 2BWES 2J0KA 2IGDA 2OJWA 1V49A 4EZJA 3EHVA 3IAS1 1NYRA 4YSXB 3V60A 1TY0A 2N9XA 3QIJA 1WM3A 4GU2A 2MJEA 2WLBA 1GB1A 2QMTA 2DZMA 1R7SA 1XCQL 4W9FA 1P0RA 3DDCB 2NTSA 4ZRQA 1V5OA 2DLBA 1GC6A 4A55A
chains in the Genus database with same CATH topology
1VRAB 1FXIA 2BYTA 2QILA 3LYYA 4DXFA 4LK0M 1ZXHA 2OHFA 1K52A 1JW9D 3BVMA 4ZOHC 4YSYB 3AN1A 2RMMA 1V1OA 3HRDD 4EE2A 3PO0A 1JALA 3EGRA 2JSVX 1NYQA 3R8BA 1HZ6A 1XLPA 2WXKA 1V8CA 3AH7A 3LB8C 1FFVA 2E3TA 2QJLA 1SE4A 5G5GA 2KMMA 1EU4A 2WDQB 4N58A 2RDHA 3BYTB 2PVGC 5C3JB 3URYA 1VZ8A 1NI3A 4A90A 2W55A 2ZW0A 3BWUD 5H8YE 3AV8A 2KACA 1YJJA 1I4GA 3NVYA 1I4HA 2N0SB 5FKAC 3R2IA 1FIQA 5I4DA 1C4CA 1FCCC 2N9LA 1QQRA 2SEBD 1Q10A 3LXFA 1KLGD 1GAQB 3I57A 1I4PA 4YT0B 5EE1A 2TSSA 2LFIA 2K9XA 3GB1A 1DOYA 1I7HA 3Q8AA 1AWDA 1SF0A 2Q5WD 3FAHA 3ABVB 3AE7B 4GDLB 4YWGG 1FM0D 3HVDA 1PGBA 1RYJA 3ZJTA 1FEHA 4KGTA 1SBBB 3AMZA 1D5ZC 3AEAB 4ARIA 5C2TB 5HHDG 2J53A 2FUG1 1NVID 1HA5A 1VDVA 1D6EC 3NUHB 4J3OD 1UNSA 4ZHPA 3P4PB 3KQ4A 1L0VB 4US8A 2K5PA 1C79A 1V1PB 2IJ0A 4GLSC 1DGJA 5BYQA 2EELA 2HTME 2NTTA 2WDVB 1ZE3D 4A8XC 1F2RI 3P4RB 4HROA 4HKQA 1E6EB 1KTKA 1ZPSA 4C7ZA 3P4QB 1GB4A 5E6JA 1AYFA 4JWUC 1SEBD 2YEPF 1K53A 4NJCA 4ZHOA 1UWMA 2RDGA 3BK2A 4R3DA 1ZUD2 4USAA 4RGOS 1VZ7A 2WXJA 3B9JA 1IBXB 1E9MA 4JE3B 2PTLA 5D7GA 4L1BA 2VZKD 3AE3B 1HZ5A 1FXAA 4RGTA 2JX5A 1KF6B 3B2GA 3DWGC 3Q8BA 1FRRA 5GXGB 4JPSA 4MACA 2KDMA 2MH7A 4XE0A 4RF0A 1QLBB 3N9YC 1N5WA 1ZDVA 3AE1B 4TQ0A 1WRIA 3ZGZA 1L6VA 4WURA 1B1ZA 1TKYA 1TS4A 3AEFB 3E56A 1MI0A 3KLSX 4HEA1 1TKGA 2WXLA 1AN8A 5LNK1 1BMLC 2B76B 5H92C 1KRHA 1N62A 2L1AA 4UDUC 4OZBA 3GP7A 3SFEB 4XWWA 2RPVA 3SR6A 4L2YA 1I4QA 1D4BA 3AE2B 1RWSA 3I9V1 4GDKB 1TS2A 1FNUA 1I4XA 2PKOA 4RGMA 3NVZA 3C8YA 1A70A 3TEWA 1C4PA 1SXTA 5TSSA 3AE9B 1YN3A 3RPFC 4ARCA 3MC0B 1QKZA 3VQIA 2BS4B 2QSDA 2W82A 3ZJVA 4M0WA 1YQ4B 1N63A 2VZKB 1JCKB 3BYYB 3P42A 4B0EA 2R61A 1PGXA 3V3XA 5D3DA 1ET6A 1KH0A 1YJIA 3GS2A 3HUIA 1ACCA 3EUB2 3FC4A 1KLUD 2E6XA 1N61A 2LMCA 4OHJA 1PYWD 1ROEA 1JWAD 3U4EG 3P1MA 1BUIC 2L83A 3P4SB 3T3OA 4B0MA 1RM6C 1XLOA 5AUKA 1V1PA 4HJGE 1QILA 1AW7A 2BB5A 1I4RA 2FE8A 1ESFA 4KGSA 1JWUD 2WS3B 1MHHE 3PZ8A 1UGJA 2IPKD 1XCTL 2V3PA 4KKIA 1VLBA 2MJ3A 2H89B 1E7PB 2BS2B 4LLGM 4CQNA 5HI1A 1SSNA 2GB1A 1IBXA 1WXQA 2YEPB 3TUOA 1ZDXA 1ENFA 2HDEA 3AECB 4AS1A 4OW0A 4MT5A 4ZYSA 1VZ6A 1TY2A 1XXGA 3AEDB 4RH6A 4OZCA 2J52A 1C77A 4H2AA 1IGDA 4WWMA 1L4ZB 2DYOA 2EKIA 4N6EB 1JMLA 1BXTA 2X38A 3NVVA 1YQ3B 4C7YA 5EE0A 3Q8CA 2AQ3B 3NVWA 1XF5L 2KN4A 4P16A 1PDXA 1PUTA 1D5MC 3KWLA 1OQQA 1CK1A 2QEJC 1WGKA 1CQVA 2W54A 2CJOA 4LTUA 2K22A 2FBWB 1IGCA 1L0XB 2I2YA 3O13A 1MPEA 2LUMA 3VR8B 1DOXA 2W3SA 2WDRB 1QF6A 3RFZB 2IGHA 2AQ2B 4JWSC 4O1NA 3VRAB 3R2TA 2ONQA 1QT9A 5T8IA 1XLNA 4MH8A 2BTEA 5BMGA 5EE9A 4OVZA 3W1SA 3T3NA 2JYTA 3TEXA 1JWMD 4US9A 3U52E 2G9HD 4OZAA 1XLQA 2KWDA 3BVZA 3H8HA 3OWEB 1E10A 5G5HA 2K0PA 1JRPA 2Y5PA 4A9AA 3B2FA 1JQ4A 3IAM1 4HRSA 2I38A 3VR9B 3W5UB 5HFYA 1SE3A 2INPE 1JWBD 3AEEB 4YTMB 4FXCA 1XO3A 4YXDB 1QOAA 1T6BX 3MHZA 2IDYA 4ITKA 3UI3A 1J7CA 2IGGA 1EWCA 1UWXA 3L4PA 1GOZA 4WQMA 2LHDA 2W3RA 1MHXA 1NEKB 1QOGA 4RF1A 1STEA 2KQ4X 2NMQA 2BW2A 1L6UA 3MFGA 1E0ZA 3IXSA 2J42A 4XWTA 3J9CA 4A6QA 1V97A 5JXVA 1B9RA 1TJEA 3MJ5A 1YNTE 3NS1A 4NAMA 4C80A 1EM7A 1J7AA 2JYEA 2DWQA 2WXIA 3NZ3A 4MM3B 1EU3A 4AQ7A 1ZP0B 3WCQA 2ACZB 3VRBB 3CWIA 1TS5A 3TEYA 4WH4A 2GI9A 4WAFA 3SEBA 1FRDA 3MP9A 1OQRA 2L32A 4XDCA 3W2DA 1SB3C 1VR9A 1Y56A 4REZA 2D5GA 4DXGA 3PZ7A 5BYSA 1T5XD 3E9SA 1L0YB 1SJHD 2PW9A 3AE5B 4NZLB 1HQRD 2BS3B 2LGIA 3FILA 3NRZA 3DWMA 4L23A 1VJKA 2WU2B 1WWTA 2LHEA 1FCLA 2JU6X 4JX1C 2L52A 4PT5A 3U2SC 1HXYD 2M0AA 2WXPA 1P7FA 5FR3A 2PIAA 1TZOA 1ET9A 2AQ1B 1JWSD 2M19A 2BB6A 2ZW1A 3BIID 1XEEA 1CZPA 3AE8B 2WQYB 3HVZA 3BVGA 4RNAA 3U7ZA 1FFUA 2WXMA 1C4AA 3SFDB 2LJIA 4TSSA 1L5PA 3BK1A 1MVKA 3EA6A 1CJEA 4XDDA 1WYGA 4IOIE 1FNVA 1TKEA 1F77A 1TYGB 4ZRPA 2INNE 3ZYYX 1T3QA 1KFYB 2WXHA 3FILB 2ON8A 3ZJUA 3AE4B 2WXGA 5FK9C 4RCOA 1QOFA 4KX6B 5AUIA 2KAJA 2H88B 4RFBA 2XN9C 2WXRA 4IKGA 4YTPB 2WU5B 3ZQ4A 5BYRA 1QOBA 1ZOYB 2WXOA 2V3NA 1C76A 2MEKA 3KWVA 5HG2A 1SE2A 5MPOA 2WP9B 4Q2JA 3W5VB 4NAWB 4KGRA 3IT6B 1N5XA 1IUEA 3CIRB 2WXNA 1C78A 2JWUA 1NENB 3Q8FA 3TEZA 2J4XA 2ICIA 2CU3A 5BMHA 1FD6A 2MJDA 2BBCA 3AEBB 3AE6B 1F0ZA 2PLPA 1P7EA 1YN5A 4D2KA 1GPXA 1F2RC 4RGNA 4YSZB 4YTNB 1SIJA 3IT4B 2M56B 4WIPA 3TSSA 1N60A 1C9FA 3Q69A 2OEDA 1D5XC 1M4VA 1EWYC 2SAKA 4DQOC 1ZXIA 4TMAB 1K51A 3AEGB 1RFKA 3AM9A 2DYMA 2V0GA 3BZDB 4N59A 1DYQA 3P63A 2WNMA 2K3UA 2JQRB 1UUPA 5BMIA 2DBYA 2JXTA 4TQ1A 1L4DB 5D3IB 3Q8EA 1SJED 1JROA 1YN4A 2JZPA 4HKZE 2QIEB 5EE3A 1J7BA 2Y5CA 1FMAD 3AB5A 2PMVA 2N7JA 1LO5D 2N9KA 4KKJA 2IGDA 4P6VF 3W9CB 2AX5A 2GRIA 3V05A 2G1EA 3IAS1 3ETRA 1NYRA 1FO4A 4YSXB 1DOIA 1TY0A 1YMHE 4IDIA 1OFFA 1TS3A 2BT6A 2Z8LA 1PFDA 2CJNA 1WSPA 2MJEA 2WLBA 1FNWA 2WXFA 1GB1A 2XNAC 2QMTA 2Y3AA 1R7SA 1XCQL 2V4IB 4C56C 2LEKA 2NTSA 1PGAA 1HEZE 2WXQA 4ZRQA 2PVOD 1K50A 2DLBA 4A55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYT A;  2JYE A; 
#chains in the Genus database with same CATH topology
 1VRA B;  3RNF C;  3JSV A;  2QIL A;  3TMP B;  4LK0 M;  1ZXH A;  2OHF A;  4II2 B;  3B1L X;  3HRD D;  3PO0 A;  2ZVO A;  2JSV X;  3ZXV A;  4LNI A;  2K8H A;  4AP4 C;  1XLP A;  3S2A A;  1V8C A;  4N58 A;  3RT3 B;  2DHZ A;  4JQW C;  3URY A;  1EF5 A;  5H8Y E;  1YJJ A;  2KN5 A;  3NVY A;  3IFW B;  3R2I A;  3H1U A;  1C4C A;  2LRW A;  2N9L A;  1QQR A;  2SEB D;  3LXF A;  1I4P A;  3APC A;  5EE1 A;  2TSS A;  2K9X A;  3GB1 A;  2BGF A;  3Q8A A;  1AWD A;  1ZW7 A;  4KIK B;  2BQQ A;  4GDL B;  5IA7 A;  1L2N A;  1RYJ A;  4KGT A;  2LVQ A;  1SBB B;  3RNB C;  4G3X B;  1D5Z C;  3AEA B;  4PYU A;  3QC8 B;  2FUG 1;  4EOY A;  3PTF C;  1NVI D;  5J18 A;  1UNS A;  4ZHP A;  3P4P B;  3KQ4 A;  1L0V B;  1C79 A;  2NTT A;  4HLE A;  4A8X C;  4JLC A;  1F2R I;  2NVU I;  4HKQ A;  2BYF A;  4C7Z A;  1GB4 A;  4WJN A;  1SEB D;  2YEP F;  4KVG B;  4ZHO A;  2N1W A;  2RDG A;  3BK2 A;  1ZUD 2;  4IWQ A;  3VVW B;  4ANU A;  2V4L A;  4L1B A;  4RGT A;  2IY0 B;  2JX5 A;  1KF6 B;  2NBW B;  3DWG C;  2MP2 A;  3RCZ A;  1WMH A;  1WGG A;  2MH7 A;  3IHP C;  3V62 A;  3AE1 B;  1WR6 E;  1B1Z A;  1TS4 A;  3AEF B;  1MI0 A;  4HEA 1;  4YL8 A;  2I1K A;  1AN8 A;  3PPA A;  2K39 A;  2B76 B;  5H92 C;  1KRH A;  1LQB A;  1A5R A;  4OZB A;  3GP7 A;  3KYC D;  4L2Y A;  1TBE A;  4M02 A;  3GE8 C;  1RWS A;  2MQJ A;  1FNU A;  4RGM A;  3NVZ A;  1QZE A;  2DX5 B;  1A70 A;  3AE9 B;  3RPF C;  4LJP B;  4KDL B;  3CST A;  1X1M A;  2W9N A;  2KJH B;  1N63 A;  3BYY B;  1NBF C;  3TBL D;  1WX9 A;  3QCA A;  3V3X A;  5D3D A;  1ET6 A;  3FC4 A;  4N9F 4;  3RZF A;  2XK5 B;  4OHJ A;  1N61 A;  5J17 A;  3U4E G;  3P1M A;  1WX7 A;  3ZTD A;  3P4S B;  2KYW A;  1QIL A;  3UGB B;  3Q2A C;  4GB9 A;  1TT5 B;  1ESF A;  4ANW A;  2IO2 B;  3QA8 A;  3NHE B;  1SSN A;  1YX5 B;  3AEC B;  4ZYS A;  3AED B;  3WAO A;  4WWM A;  1L4Z B;  2DYO A;  3UIN B;  1PUT A;  1D5M C;  1R4N B;  1WGK A;  4DDG D;  4EZL A;  1WXS A;  2DEN B;  4ZDV A;  3I63 C;  1DOX A;  3ONS A;  5G55 A;  3U7D A;  2CHX A;  4XX5 A;  1UBQ A;  2G45 B;  5T8I A;  1XLN A;  2LAS A;  3BIN A;  4HCP B;  1V81 A;  4US9 A;  3EC8 A;  1XLQ A;  3BVZ A;  2M0X A;  3N3K B;  2FCN A;  3OWE B;  5G5H A;  2K0P A;  2Y5P A;  2X8X X;  3OJ4 B;  4AWJ A;  2KDE B;  3W5U B;  2KTR B;  1JWB D;  3PV1 A;  4YTM B;  4YXD B;  1T6B X;  1R4N I;  4AJW A;  4CYE A;  3UI3 A;  2XBB C;  3JW0 X;  4KV2 A;  4FBJ B;  4RF1 A;  2KQ4 X;  4DBG A;  2BW2 A;  2D10 A;  1M94 A;  1E0Z A;  2UU7 A;  3ALB A;  2A4Z A;  3DVG Y;  4A3P A;  3N1Z C;  3N1Y C;  4WWN A;  2BF8 B;  3AU5 A;  2L3Z A;  1YNT E;  4P7I A;  4NAM A;  4C80 A;  1EM7 A;  3NZ3 A;  1EU3 A;  4ACF A;  1ZP0 B;  1TS5 A;  4F1S A;  4XC2 A;  1JRU A;  2KQ7 A;  1Z5S B;  2FCS A;  4WAF A;  1OQY A;  4W9C A;  2L32 A;  3W2D A;  2Z0E B;  4FUL A;  4XYC A;  4REZ A;  2MA9 B;  2ZVN A;  3H7P B;  1L0Y B;  1SJH D;  2PW9 A;  2BS3 B;  3NRZ A;  2L0T A;  1XT9 B;  3U2S C;  4HPL B;  5FR3 A;  2PIA A;  4DHJ D;  1GC7 A;  1ET9 A;  3TJP A;  1JWS D;  3A9K B;  3MC9 A;  4AOF A;  3JYU A;  3N1X C;  2WQY B;  3QWZ B;  3L16 A;  2M1M A;  4WAA A;  3Q14 C;  3M62 B;  4RM9 A;  2LJI A;  1N6Z A;  1CJE A;  1WYG A;  2WXH A;  3FIL B;  3AE4 B;  4LCD E;  5CHV C;  1QOF A;  1YQB A;  2N7D A;  4HCN B;  4MDK E;  4RFB A;  3QHT A;  3VH4 B;  4ICU A;  1QOB A;  1SE2 A;  4Q2J A;  4NAW B;  2D3C A;  1CMX B;  1N5X A;  2JY6 A;  3CIR B;  3TEZ A;  3JVZ X;  2CU3 A;  5BMH A;  3KUZ A;  3SHQ A;  2Y5B B;  4GSW A;  2DNF A;  4FJY A;  4YSZ B;  1SIJ A;  4BBN F;  3Q69 A;  5FR6 A;  1D5X C;  1EWY C;  3ZRF A;  3DVN U;  3ZUN A;  4TMA B;  4XZ4 A;  3AEG B;  4GIV A;  2V0G A;  1Q5W B;  2DYM A;  3BZD B;  1DYQ A;  3DHI C;  3P63 A;  5BMI A;  4TUU A;  5IKC M;  2N9E B;  4G0N B;  2MRP A;  2UYZ B;  3CMM B;  1YN4 A;  2ASQ A;  2QIE B;  5EE3 A;  3VUY A;  3Q3J A;  3UQA A;  3X23 A;  4KKJ A;  3UQB A;  3W9C B;  2IY1 B;  2G1E A;  2NCN A;  4LNK A;  5HKH A;  1DOI A;  2FCQ A;  2WDT B;  5AZG A;  1OFF A;  1TS3 A;  2Z8L A;  3A9J B;  3TIX A;  3PHX B;  1FNW A;  2WXF A;  3ZIM A;  1WIA A;  2LEK A;  1WMH B;  3L13 A;  2PVO D;  3PRE A;  2D3G A;  1UF0 A;  3QK0 A;  1K52 A;  2BYE A;  2MBE A;  1V2Y A;  3TCA A;  3PZD A;  3PLV A;  1JAL A;  1SGH A;  1WGY A;  1Q1O A;  4I6L B;  3R8B A;  5DPW A;  2WXK A;  5CX3 A;  1FFV A;  2E3T A;  1SE4 A;  3RUL A;  3BYT B;  2PVG C;  5DCN A;  2AEH A;  2JRI B;  2ZW0 A;  3WIM A;  1S3S G;  3AV8 A;  2KAC A;  5I4D A;  2I1J A;  5IP4 D;  1Q10 A;  2KDI A;  1FXT B;  2LFI A;  1GJZ A;  1DOY A;  1I7H A;  4IM0 A;  2KMC A;  3SD5 A;  3AE7 B;  1FM0 D;  3HVD A;  3ZJT A;  3H7S A;  4HWI B;  3WAM A;  4FLH A;  4DDI D;  1ZKH A;  5C2T B;  5C23 A;  1VDV A;  1HA5 A;  3KYD D;  4F7Z A;  2PJH A;  3N32 A;  4FA6 A;  1WRD B;  2EEL A;  2WDV B;  2BPS A;  1E6E B;  4C4V A;  4DHZ B;  1YJ1 A;  1VZ7 A;  2WXJ A;  3B9J A;  2FIF A;  2PTL A;  4K81 A;  2CU1 A;  5D6J B;  2O2V A;  1WJN A;  4LDT B;  1E8Y A;  4BVU C;  1FRR A;  3PVL A;  2RGF A;  3RYT A;  5IN7 A;  1N5W A;  1ZDV A;  1WRI A;  2L05 A;  4WUR A;  3ZDT A;  2WGS A;  3E56 A;  4W9E A;  3M3J A;  5E6O A;  1WGR A;  2WXL A;  5LNK 1;  4OVU A;  2NR2 A;  3T9L A;  4UDU C;  3VFK A;  3SFE B;  2RPV A;  3NJT A;  4DXA B;  4XGA B;  1TS2 A;  1TZ1 A;  3D32 A;  4BZA A;  3ML9 A;  1H4R A;  2Z0D B;  3V6E B;  2LVP A;  4IC7 B;  1YN3 A;  4ARC A;  3O65 B;  2KFK A;  2K25 A;  3KH0 A;  4E74 A;  2QSD A;  4M8N A;  4M0W A;  1C3T A;  4S17 A;  4B0E A;  1YOV B;  1KH0 A;  3HUI A;  1ACC A;  3EUB 2;  4KDI C;  1OGW A;  2QDF A;  3RUI B;  1WZ3 A;  2LMC A;  1AAR A;  1Y8R C;  1BUI C;  3T3O A;  1V6E A;  3AXC A;  3H9D A;  1XLO A;  4W9H A;  5AUK A;  1V1P A;  3CSF A;  1V5T A;  2ZPY A;  4IG7 B;  2EMT A;  1I4R A;  3RNC C;  2JVC A;  1WJ4 A;  2KJR A;  1LM8 B;  2JZZ A;  2IPK D;  1XCT L;  2ZPN A;  1WY8 A;  2MHJ A;  5HI1 A;  2O6V B;  2AL3 A;  3SU8 X;  3UIO B;  4RH6 A;  2J52 A;  1C77 A;  1LXD A;  3I5J C;  2B3A A;  1BXT A;  4P1C C;  3Q8C A;  3NVW A;  2NS5 A;  4MJS B;  3KWL A;  1OQQ A;  3A33 B;  1CK1 A;  2QEJ C;  1CQV A;  2W54 A;  3QAR A;  3ZNH B;  4PS3 A;  2GBM A;  4LTU A;  2K22 A;  1IGC A;  1L0X B;  3T8M A;  3O13 A;  5AEK B;  2LUM A;  3VR8 B;  2W3S A;  1QF6 A;  4JWS C;  3VRA B;  3GE3 C;  2ONQ A;  1NDD A;  5LXI B;  3K9O B;  3V6C B;  4MH8 A;  4GDK A;  5BMG A;  4HDQ A;  3U52 E;  4OZA A;  2IND C;  1WF9 A;  2GOW A;  1KM7 A;  4K3B A;  4LNN A;  1JQ4 A;  2I38 A;  3SDL C;  5HFY A;  1I42 A;  4FXC A;  1UGM A;  1MG4 A;  1XO3 A;  1GUA B;  4I6N B;  3WAP A;  2IGG A;  3L4P A;  1GOZ A;  2G3Q B;  1IYF A;  2NMQ A;  5IO9 A;  4NQL B;  5L95 C;  3RZW C;  1IP9 A;  2PE9 A;  1EO6 A;  4K7U A;  4A6Q A;  4JL9 A;  1V97 A;  1B9R A;  1TJE A;  3HIZ A;  3PS6 A;  1S1Q B;  4MH0 E;  2DWQ A;  4MM3 B;  3ENE A;  1SE9 A;  2KC2 A;  3TEY A;  2GI9 A;  1FRD A;  2V1Y A;  5GMV A;  1SB3 C;  2RR9 A;  2ZNV B;  3N30 A;  4PS7 A;  1E7V A;  5DPR A;  5BYS A;  1WZ0 A;  3E9S A;  4IUM B;  2DYB A;  5TR5 A;  3WA0 A;  3AE5 B;  4NZL B;  1HQR D;  1VJK A;  3KUC B;  2WU2 B;  4PK1 A;  1FCL A;  4JX1 C;  2L52 A;  1WX8 A;  2KVZ A;  2M0A A;  2WXP A;  1P7F A;  1FPY A;  1LGR A;  3VHT C;  2ZW1 A;  4IW0 A;  3BII D;  3AE8 B;  3Q6B A;  5AZH A;  3U7Z A;  1FFU A;  2WWZ A;  2WXM A;  4MGY E;  3SFD B;  1WYW B;  2C7N B;  1L5P A;  4IOI E;  2QC8 A;  1TYG B;  4ZRP A;  3C19 A;  2INN E;  1KFY B;  4C00 A;  2WXG A;  5FK9 C;  2KAJ A;  4LNF A;  2XN9 C;  4IKG A;  2WU5 B;  5CTR C;  3AI5 A;  1K8R B;  2D07 B;  3R7R A;  2LGD A;  2WXO A;  3VUX A;  5HG2 A;  3W5V B;  1C78 A;  2JWU A;  2IYD B;  2JXX A;  2ICI A;  2LXA A;  2FUH B;  3AE6 B;  2PLP A;  2HTH A;  1YN5 A;  2KTF A;  1F2R C;  3IT4 B;  2M56 B;  4WIP A;  4HXD A;  3UF8 A;  2V9H A;  1C9F A;  3VDZ A;  1K51 A;  2Z59 B;  3PRM B;  1J19 A;  4N59 A;  1OEY J;  2WNM A;  2DBY A;  3OLM D;  1L4D B;  5D3I B;  3ZDM C;  3A1Q B;  2V3S A;  2KMA A;  3A4S C;  4HKZ E;  1R4M B;  2Y5C A;  3AB5 A;  3NZS A;  3RNG C;  3VTU A;  2N9K A;  3IBE A;  3MHS D;  4P6V F;  3LDZ E;  3PSE B;  2GRI A;  3V05 A;  4BKS D;  1FO4 A;  2KQS A;  1YMH E;  2BT6 A;  2CJN A;  3NZU A;  2XNA C;  4GGQ A;  3QX1 A;  2JWZ A;  2V4I B;  3ZO5 B;  4ZRJ A;  4WWO A;  1K50 A;  1KJT A;  5JH5 C;  4ZYN A;  1XQQ A;  4LNO A;  4WJO A;  1FXI A;  2BYT A;  3LYY A;  2C7H A;  1R4M I;  4RM8 A;  3BVM A;  4YSY B;  1SIF A;  3AN1 A;  1V1O A;  3ZNZ B;  1V9J A;  2KFJ A;  4GMV A;  5IAA C;  3EGR A;  4KIK A;  1NI2 A;  2MWS B;  4GDL A;  1HZ6 A;  2HD5 B;  3AH7 A;  5G5G A;  2KX0 A;  1EU4 A;  3DOW A;  2RDH A;  2GBK A;  4NNJ B;  3RD2 A;  1NI3 A;  4A90 A;  2W55 A;  3R3M A;  3Q3N C;  3EFU A;  1I4G A;  1VCB A;  1I4H A;  1FIQ A;  2KFK B;  3DVN V;  4QAY A;  3VTW A;  1KLG D;  1GAQ B;  3AUL A;  3DHG C;  3JSV B;  4YT0 B;  3W1S C;  2REX A;  1GNU A;  1SF0 A;  2N1V A;  2Q5W D;  3FAH A;  3ABV B;  1V80 A;  1YD8 U;  1PGB A;  2WYQ A;  1FEH A;  2VH1 A;  5L83 A;  5E6P A;  1L7Y A;  3AMZ A;  2LGS A;  3EFC A;  4ARI A;  2BVC A;  2CHW A;  2NBV B;  5HHD G;  4K3C A;  3VUW A;  1V1P B;  2IO1 B;  3DBH B;  4OVV A;  5BYQ A;  4DHZ E;  1UEL A;  3P4R B;  1OEY A;  3IG3 A;  2C9W B;  1KTK A;  1ZPS A;  2ZNV C;  3P4Q B;  1K53 A;  1T0R C;  4R3D A;  4BOZ B;  1MFW A;  5D7G A;  2R2Q A;  3AE3 B;  1FXA A;  2YLM A;  2KDB A;  3B2G A;  4HVB A;  5GXG B;  1WGD A;  4JPS A;  2KDM A;  2KO3 A;  3FKY A;  4XE0 A;  4RF0 A;  3N9Y C;  3DBH I;  3ZGZ A;  3VTV A;  1L6V A;  3ZRC A;  3RNA C;  3KLS X;  3PLU A;  1YIW A;  1TKG A;  2VH2 A;  3L08 A;  4W9G A;  2L1A A;  3WAL A;  3ZVV A;  4B95 A;  1LFD A;  1I4Q A;  1D4B A;  2HJ8 A;  4W9J A;  4GDK B;  4FHK A;  3HK0 A;  2LVO A;  2PKO A;  4FHJ A;  4HK2 A;  2MP2 B;  3LJ3 A;  2LUE A;  1C4P A;  5TSS A;  4ZRK A;  3MC0 B;  2BS4 B;  2W82 A;  4TV3 A;  2C60 A;  2JRH A;  2YVC A;  4K1R B;  3P42 A;  1WM2 A;  3DVG X;  2JZ3 B;  2A5U A;  2R61 A;  2LI5 A;  4W9K A;  4GOC A;  1KLU D;  4M01 A;  4LJO B;  1PYW D;  4ANV A;  2KWC A;  2L83 A;  5J2R A;  4EUT A;  2DAJ A;  4B0M A;  1RM6 C;  4HJG E;  5KHQ A;  1AW7 A;  2BB5 A;  4B9K A;  4HDO A;  3PT2 B;  2KHW B;  4LDT D;  2K6D B;  2D11 A;  2DZK A;  2WHI A;  1MG8 A;  4KGS A;  1JWU D;  3PZ8 A;  2V3P A;  2C7M B;  4KKI A;  2BS2 B;  4CQN A;  1IBX A;  3QAQ A;  2YEP B;  3TUO A;  4RMA A;  1ZDX A;  2KLC A;  1ENF A;  2HDE A;  3P2B A;  2MCN B;  4AS1 A;  1VZ6 A;  1TY2 A;  1XXG A;  4JIO U;  2L00 B;  2EKI A;  1JML A;  4FAD A;  4C7Y A;  2CHZ A;  5D2M B;  4EZK A;  1XF5 L;  2KN4 A;  3DBL B;  1PDX A;  4P16 A;  1HTO A;  3L0W B;  1WI0 A;  3APF A;  2KTR A;  2CJO A;  4PYZ A;  3PRZ A;  2FBW B;  2WX1 A;  4CO7 A;  3RFZ B;  2MBH A;  2IGH A;  4FJZ A;  2QCZ A;  3R2T A;  2WX0 A;  2GBJ A;  1F1H A;  2RSU A;  2BWF A;  5EE9 A;  4OVZ A;  3T3N A;  2JYT A;  3TEX A;  1JWM D;  3DBR I;  2G4S A;  3H8H A;  1E10 A;  2ZEQ A;  3VH3 B;  1E8X A;  4A9A A;  3B2F A;  3IAM 1;  2KWU B;  2K6Q A;  2INP E;  5LLI A;  3AEE B;  4DK5 A;  3DBL I;  1HE8 A;  2N9P C;  1QOA A;  3M95 A;  2IDY A;  4ITK A;  4ICV A;  1EWC A;  1UWX A;  5JHB A;  1ZGU B;  2W3R A;  1MHX A;  1NEK B;  1QOG A;  1STE A;  1E7U A;  4E71 A;  3TL5 A;  4K7S A;  3IXS A;  2J42 A;  3J9C A;  3RI7 C;  2DZI A;  1WE7 A;  2O6V D;  2JUO A;  3DPD A;  3H7P A;  4PS8 A;  4EEW A;  1P9D U;  2D3B A;  3GOE A;  2N4F A;  3NS1 A;  4W9L A;  4F8C B;  2MLB A;  3Q3M C;  1J7A A;  2JYE A;  2WXI A;  4AQ7 A;  4WWP A;  4B6W A;  1F9J A;  3ZLZ A;  2ACZ B;  2KJ6 A;  3SEB A;  3A9K A;  3MP9 A;  1OQR A;  2LWP A;  4IM3 A;  1T0Y A;  4BKS A;  4MGZ E;  1VR9 A;  2N7E A;  1PQS A;  4DXG A;  3PZ7 A;  1T5X D;  4NPN A;  4GN1 A;  4CHK A;  1VD2 A;  4BAX A;  3VAW A;  3NS8 A;  4FN2 A;  2EKE C;  2LGI A;  3FIL A;  2CS4 A;  1C1Y B;  2J0M A;  3DWM A;  4NQK E;  1WWT A;  3W1Y A;  1D3Z A;  2JU6 X;  4PT5 A;  2FNJ B;  2JF5 A;  1HXY D;  1H8C A;  2AQ1 B;  2NPT A;  3L54 A;  4W9I A;  4M00 A;  3HVZ A;  4P1B C;  4NAW A;  2FAZ A;  2OJR A;  1C4A A;  1KOT A;  2G4D B;  3EA6 A;  1TGZ B;  5JZE B;  1FNV A;  5C1Z A;  3ZYY X;  1T3Q A;  5JHA A;  4KX6 B;  3PHW B;  2H88 B;  3I3T B;  2FCM A;  2WXR A;  4YTP B;  1WGH A;  3ZQ4 A;  1G6J A;  2M17 A;  5BYR A;  2BKR B;  4IWP A;  1C76 A;  2MEK A;  2JT4 B;  5MPO A;  2WP9 B;  3IT6 B;  1RFA A;  1IUE A;  3Q8F A;  2WXN A;  3ML8 A;  2IZV B;  4MSM B;  1FD6 A;  1ISN A;  2D3A A;  3AEB B;  2KD0 A;  1F0Z A;  1P7E A;  4D2K A;  1GPX A;  4YTN B;  4NY0 A;  3TSS A;  2SAK A;  3A9J A;  4DQO C;  1ZXI A;  5EDS A;  1RFK A;  2BKF A;  2ZZP B;  1Q0W B;  2JXT A;  2KDF B;  3Q8E A;  1JRO A;  2JZP A;  2RD0 A;  1J7B A;  1FMA D;  3ZXR A;  3NOB A;  1UH6 A;  3GZN B;  2XEW A;  3U8Z A;  4A3O A;  4MSQ B;  2AX5 A;  2OOB B;  2KNB A;  3ETR A;  1WE6 A;  4W9D A;  4AUQ C;  4IDI A;  2PEA A;  4JGH B;  1PFD A;  1WSP A;  2Y3A A;  2KC1 A;  2KVR A;  2IO3 B;  4MEM A;  4C56 C;  1PGA A;  1HEZ E;  2WXQ A;  1TIF A;  3QQ8 B;  2KWV B;  2J0J A;  3PRP B;  4DXF A;  5KHO A;  1JW9 D;  4ZOH C;  2RMM A;  4EE2 A;  3GZN I;  1NYQ A;  3LB8 C;  1WXA A;  2QJL A;  2KMM A;  2WDQ B;  4WQO B;  5C3J B;  3RMK C;  1VZ8 A;  2RPQ A;  3BWU D;  3DQV A;  2N0S B;  5FKA C;  1FCC C;  2K1F A;  5AZF A;  3I57 A;  2AWT A;  3ZTC A;  4URK A;  2K8C A;  2JPH A;  1WXV A;  3B0A A;  3ZNG C;  1WFY A;  4YWG G;  2MSE D;  3NY5 A;  5LXH A;  2CR5 A;  2J53 A;  1YX6 B;  1D6E C;  3NUH B;  4J3O D;  3MTN B;  4US8 A;  2K5P A;  4GLS C;  2IJ0 A;  1U4A A;  2DAF A;  3PGE A;  4AJY B;  1DGJ A;  2HTM E;  2DZJ A;  1ZE3 D;  1UD7 A;  3X0W A;  4G50 A;  3H6N A;  4HRO A;  2C5L C;  5E6J A;  1AYF A;  4IWO A;  4JWU C;  4NJC A;  1UWM A;  4USA A;  1RLF A;  4RGO S;  1IBX B;  1E9M A;  4JE3 B;  2MBB B;  2VZK D;  1HZ5 A;  4I6P A;  2LJ5 A;  2K8B A;  1P98 A;  4EKU A;  1T0S C;  4KZC A;  3Q8B A;  4MAC A;  3KUD B;  1QLB B;  4MEL A;  3KW5 B;  2KOX A;  4TQ0 A;  3M63 B;  4C4V B;  5DPT A;  1TKY A;  4X57 B;  3VXW A;  4ANX A;  3RN9 C;  1BML C;  3UIP B;  4MGK E;  1N62 A;  4G11 A;  3OG5 A;  5IOI A;  4XWW A;  3SR6 A;  2MBO A;  2O2V B;  2J7Q B;  3AE2 B;  1HTQ A;  3I9V 1;  4M8M A;  4EFO A;  4NJ6 A;  1I4X A;  3R7Q A;  3DHH C;  3C8Y A;  4IM2 A;  3TEW A;  1SXT A;  5DPS A;  1QKZ A;  3VQI A;  3ZJV A;  5E6N A;  1YQ4 B;  5BO4 B;  2VZK B;  1JCK B;  1RRB A;  3HHM A;  3OAW A;  2UWQ A;  4WJQ A;  1PGX A;  4TKN A;  3GS2 A;  1YJI A;  2O6V A;  4BOS C;  2E6X A;  1ROE A;  1JWA D;  3L17 A;  4FJV B;  3A4R A;  1EF1 A;  2NBU A;  4KZ0 A;  3IVF A;  4HPM B;  2INC C;  2LGY A;  4ASW C;  4MJS A;  2RDB C;  1BT0 A;  4M0W B;  2FE8 A;  4KSK C;  4ZRI A;  2WS3 B;  1MHH E;  1UGJ A;  1J8C A;  3ZKJ C;  1VLB A;  2MJ3 A;  1E8W A;  2H89 B;  1E7P B;  4LLG M;  2GB1 A;  1WXQ A;  4BKG A;  2IO0 B;  1Z2M A;  4OW0 A;  2QHO A;  4MT5 A;  4E3C A;  2VRR B;  3ZNI D;  4OZC A;  4H2A A;  1IGD A;  2EMS A;  3B08 A;  4N6E B;  2X38 A;  3NVV A;  4MGI E;  1YQ3 B;  1T0Q C;  3DCG A;  5EE0 A;  2LZ6 A;  2AQ3 B;  3U30 A;  4BKT A;  3NG0 A;  1WR1 A;  4HPP A;  2I2Y A;  1MPE A;  2NPT B;  3OJ3 A;  1IPG A;  2LXC A;  2WDR B;  2AL6 A;  2AQ2 B;  4O1N A;  3MC8 A;  2L0F A;  3HM6 X;  1QT9 A;  3Q3O C;  2BTE A;  3W1S A;  1TTN A;  3CF6 E;  1E90 A;  2G9H D;  2KWD A;  1OTR B;  2L8J A;  3N20 C;  1MJD A;  4DHJ B;  1JRP A;  2HJ1 A;  2GLS A;  4HRS A;  3VR9 B;  4MM3 A;  1SE3 A;  1I35 A;  4HJK A;  3BY4 B;  4NJ7 A;  3MHZ A;  1J7C A;  3KVF B;  4WQM A;  2LHD A;  2LGX A;  2XK5 A;  2HE7 A;  1L6U A;  3MFG A;  5D94 A;  4XWT A;  1XD3 B;  2MW5 A;  4DWF A;  5JXV A;  4BBN C;  3MJW A;  3MJ5 A;  3ECI A;  2KX3 A;  2M4N A;  1RAX A;  5CHF A;  2PPH A;  3WCQ A;  3VRB B;  3CWI A;  2R2O A;  3HM3 A;  4WH4 A;  2KT7 A;  3RNE C;  4XDC A;  1WH3 A;  2L76 A;  1WJU A;  1Y56 A;  1WXM A;  2D5G A;  2ZCB A;  2MBQ A;  2ZCC A;  3AU4 A;  4II3 B;  4S0R A;  4BFR A;  1V86 A;  4L23 A;  3EEC A;  2LD9 A;  3Q3F A;  2KKC A;  2LHE A;  2AYO B;  2GBR A;  1UZX B;  2KXJ A;  2GBN A;  1J0G A;  1TZO A;  1KLV A;  2D2Q A;  2M19 A;  2BB6 A;  2BYV E;  1XEE A;  3APD A;  1CZP A;  3DBR B;  3BVG A;  3V61 A;  1E8Z A;  4RNA A;  2IBI B;  4TSS A;  2L7R A;  3BK1 A;  4K7W A;  1MVK A;  4XDD A;  1TKE A;  1F77 A;  2GMI C;  2KAN A;  2ON8 A;  3ZJU A;  4RCO A;  5AUI A;  1P3Q U;  2CKH B;  2M8S A;  3ZW3 A;  1ZOY B;  3K9P B;  1UBI A;  1F52 A;  2V3N A;  3A1Q A;  3KWV A;  4KGR A;  4A20 A;  1NEN B;  5G2N A;  1EUV B;  2J4X A;  2ZJD A;  3L10 B;  4GXB A;  2MJD A;  2BBC A;  1E5W A;  3QJZ A;  3WAN A;  2MX2 A;  2FID A;  4J6I A;  4RGN A;  2KK8 A;  1N60 A;  2PE6 B;  2OED A;  1M4V A;  5CHW A;  4KSL C;  1GG3 A;  3AM9 A;  3DBS A;  4WJP A;  2K3U A;  2JQR B;  1UUP A;  3R66 C;  1WJ6 A;  4TQ1 A;  2KZR A;  1SJE D;  1P1A A;  2KLG A;  2LRU A;  3C0R B;  2PMV A;  2N7J A;  1LO5 D;  2BWE S;  2J0K A;  2IGD A;  2OJW A;  1V49 A;  4EZJ A;  3EHV A;  3IAS 1;  1NYR A;  4YSX B;  3V60 A;  1TY0 A;  2N9X A;  3QIJ A;  1WM3 A;  4GU2 A;  2MJE A;  2WLB A;  1GB1 A;  2QMT A;  2DZM A;  1R7S A;  1XCQ L;  4W9F A;  1P0R A;  3DDC B;  2NTS A;  4ZRQ A;  1V5O A;  2DLB A;  1GC6 A;  4A55 A; 
#chains in the Genus database with same CATH homology
 1VRA B;  1FXI A;  2BYT A;  2QIL A;  3LYY A;  4DXF A;  4LK0 M;  1ZXH A;  2OHF A;  1K52 A;  1JW9 D;  3BVM A;  4ZOH C;  4YSY B;  3AN1 A;  2RMM A;  1V1O A;  3HRD D;  4EE2 A;  3PO0 A;  1JAL A;  3EGR A;  2JSV X;  1NYQ A;  3R8B A;  1HZ6 A;  1XLP A;  2WXK A;  1V8C A;  3AH7 A;  3LB8 C;  1FFV A;  2E3T A;  2QJL A;  1SE4 A;  5G5G A;  2KMM A;  1EU4 A;  2WDQ B;  4N58 A;  2RDH A;  3BYT B;  2PVG C;  5C3J B;  3URY A;  1VZ8 A;  1NI3 A;  4A90 A;  2W55 A;  2ZW0 A;  3BWU D;  5H8Y E;  3AV8 A;  2KAC A;  1YJJ A;  1I4G A;  3NVY A;  1I4H A;  2N0S B;  5FKA C;  3R2I A;  1FIQ A;  5I4D A;  1C4C A;  1FCC C;  2N9L A;  1QQR A;  2SEB D;  1Q10 A;  3LXF A;  1KLG D;  1GAQ B;  3I57 A;  1I4P A;  4YT0 B;  5EE1 A;  2TSS A;  2LFI A;  2K9X A;  3GB1 A;  1DOY A;  1I7H A;  3Q8A A;  1AWD A;  1SF0 A;  2Q5W D;  3FAH A;  3ABV B;  3AE7 B;  4GDL B;  4YWG G;  1FM0 D;  3HVD A;  1PGB A;  1RYJ A;  3ZJT A;  1FEH A;  4KGT A;  1SBB B;  3AMZ A;  1D5Z C;  3AEA B;  4ARI A;  5C2T B;  5HHD G;  2J53 A;  2FUG 1;  1NVI D;  1HA5 A;  1VDV A;  1D6E C;  3NUH B;  4J3O D;  1UNS A;  4ZHP A;  3P4P B;  3KQ4 A;  1L0V B;  4US8 A;  2K5P A;  1C79 A;  1V1P B;  2IJ0 A;  4GLS C;  1DGJ A;  5BYQ A;  2EEL A;  2HTM E;  2NTT A;  2WDV B;  1ZE3 D;  4A8X C;  1F2R I;  3P4R B;  4HRO A;  4HKQ A;  1E6E B;  1KTK A;  1ZPS A;  4C7Z A;  3P4Q B;  1GB4 A;  5E6J A;  1AYF A;  4JWU C;  1SEB D;  2YEP F;  1K53 A;  4NJC A;  4ZHO A;  1UWM A;  2RDG A;  3BK2 A;  4R3D A;  1ZUD 2;  4USA A;  4RGO S;  1VZ7 A;  2WXJ A;  3B9J A;  1IBX B;  1E9M A;  4JE3 B;  2PTL A;  5D7G A;  4L1B A;  2VZK D;  3AE3 B;  1HZ5 A;  1FXA A;  4RGT A;  2JX5 A;  1KF6 B;  3B2G A;  3DWG C;  3Q8B A;  1FRR A;  5GXG B;  4JPS A;  4MAC A;  2KDM A;  2MH7 A;  4XE0 A;  4RF0 A;  1QLB B;  3N9Y C;  1N5W A;  1ZDV A;  3AE1 B;  4TQ0 A;  1WRI A;  3ZGZ A;  1L6V A;  4WUR A;  1B1Z A;  1TKY A;  1TS4 A;  3AEF B;  3E56 A;  1MI0 A;  3KLS X;  4HEA 1;  1TKG A;  2WXL A;  1AN8 A;  5LNK 1;  1BML C;  2B76 B;  5H92 C;  1KRH A;  1N62 A;  2L1A A;  4UDU C;  4OZB A;  3GP7 A;  3SFE B;  4XWW A;  2RPV A;  3SR6 A;  4L2Y A;  1I4Q A;  1D4B A;  3AE2 B;  1RWS A;  3I9V 1;  4GDK B;  1TS2 A;  1FNU A;  1I4X A;  2PKO A;  4RGM A;  3NVZ A;  3C8Y A;  1A70 A;  3TEW A;  1C4P A;  1SXT A;  5TSS A;  3AE9 B;  1YN3 A;  3RPF C;  4ARC A;  3MC0 B;  1QKZ A;  3VQI A;  2BS4 B;  2QSD A;  2W82 A;  3ZJV A;  4M0W A;  1YQ4 B;  1N63 A;  2VZK B;  1JCK B;  3BYY B;  3P42 A;  4B0E A;  2R61 A;  1PGX A;  3V3X A;  5D3D A;  1ET6 A;  1KH0 A;  1YJI A;  3GS2 A;  3HUI A;  1ACC A;  3EUB 2;  3FC4 A;  1KLU D;  2E6X A;  1N61 A;  2LMC A;  4OHJ A;  1PYW D;  1ROE A;  1JWA D;  3U4E G;  3P1M A;  1BUI C;  2L83 A;  3P4S B;  3T3O A;  4B0M A;  1RM6 C;  1XLO A;  5AUK A;  1V1P A;  4HJG E;  1QIL A;  1AW7 A;  2BB5 A;  1I4R A;  2FE8 A;  1ESF A;  4KGS A;  1JWU D;  2WS3 B;  1MHH E;  3PZ8 A;  1UGJ A;  2IPK D;  1XCT L;  2V3P A;  4KKI A;  1VLB A;  2MJ3 A;  2H89 B;  1E7P B;  2BS2 B;  4LLG M;  4CQN A;  5HI1 A;  1SSN A;  2GB1 A;  1IBX A;  1WXQ A;  2YEP B;  3TUO A;  1ZDX A;  1ENF A;  2HDE A;  3AEC B;  4AS1 A;  4OW0 A;  4MT5 A;  4ZYS A;  1VZ6 A;  1TY2 A;  1XXG A;  3AED B;  4RH6 A;  4OZC A;  2J52 A;  1C77 A;  4H2A A;  1IGD A;  4WWM A;  1L4Z B;  2DYO A;  2EKI A;  4N6E B;  1JML A;  1BXT A;  2X38 A;  3NVV A;  1YQ3 B;  4C7Y A;  5EE0 A;  3Q8C A;  2AQ3 B;  3NVW A;  1XF5 L;  2KN4 A;  4P16 A;  1PDX A;  1PUT A;  1D5M C;  3KWL A;  1OQQ A;  1CK1 A;  2QEJ C;  1WGK A;  1CQV A;  2W54 A;  2CJO A;  4LTU A;  2K22 A;  2FBW B;  1IGC A;  1L0X B;  2I2Y A;  3O13 A;  1MPE A;  2LUM A;  3VR8 B;  1DOX A;  2W3S A;  2WDR B;  1QF6 A;  3RFZ B;  2IGH A;  2AQ2 B;  4JWS C;  4O1N A;  3VRA B;  3R2T A;  2ONQ A;  1QT9 A;  5T8I A;  1XLN A;  4MH8 A;  2BTE A;  5BMG A;  5EE9 A;  4OVZ A;  3W1S A;  3T3N A;  2JYT A;  3TEX A;  1JWM D;  4US9 A;  3U52 E;  2G9H D;  4OZA A;  1XLQ A;  2KWD A;  3BVZ A;  3H8H A;  3OWE B;  1E10 A;  5G5H A;  2K0P A;  1JRP A;  2Y5P A;  4A9A A;  3B2F A;  1JQ4 A;  3IAM 1;  4HRS A;  2I38 A;  3VR9 B;  3W5U B;  5HFY A;  1SE3 A;  2INP E;  1JWB D;  3AEE B;  4YTM B;  4FXC A;  1XO3 A;  4YXD B;  1QOA A;  1T6B X;  3MHZ A;  2IDY A;  4ITK A;  3UI3 A;  1J7C A;  2IGG A;  1EWC A;  1UWX A;  3L4P A;  1GOZ A;  4WQM A;  2LHD A;  2W3R A;  1MHX A;  1NEK B;  1QOG A;  4RF1 A;  1STE A;  2KQ4 X;  2NMQ A;  2BW2 A;  1L6U A;  3MFG A;  1E0Z A;  3IXS A;  2J42 A;  4XWT A;  3J9C A;  4A6Q A;  1V97 A;  5JXV A;  1B9R A;  1TJE A;  3MJ5 A;  1YNT E;  3NS1 A;  4NAM A;  4C80 A;  1EM7 A;  1J7A A;  2JYE A;  2DWQ A;  2WXI A;  3NZ3 A;  4MM3 B;  1EU3 A;  4AQ7 A;  1ZP0 B;  3WCQ A;  2ACZ B;  3VRB B;  3CWI A;  1TS5 A;  3TEY A;  4WH4 A;  2GI9 A;  4WAF A;  3SEB A;  1FRD A;  3MP9 A;  1OQR A;  2L32 A;  4XDC A;  3W2D A;  1SB3 C;  1VR9 A;  1Y56 A;  4REZ A;  2D5G A;  4DXG A;  3PZ7 A;  5BYS A;  1T5X D;  3E9S A;  1L0Y B;  1SJH D;  2PW9 A;  3AE5 B;  4NZL B;  1HQR D;  2BS3 B;  2LGI A;  3FIL A;  3NRZ A;  3DWM A;  4L23 A;  1VJK A;  2WU2 B;  1WWT A;  2LHE A;  1FCL A;  2JU6 X;  4JX1 C;  2L52 A;  4PT5 A;  3U2S C;  1HXY D;  2M0A A;  2WXP A;  1P7F A;  5FR3 A;  2PIA A;  1TZO A;  1ET9 A;  2AQ1 B;  1JWS D;  2M19 A;  2BB6 A;  2ZW1 A;  3BII D;  1XEE A;  1CZP A;  3AE8 B;  2WQY B;  3HVZ A;  3BVG A;  4RNA A;  3U7Z A;  1FFU A;  2WXM A;  1C4A A;  3SFD B;  2LJI A;  4TSS A;  1L5P A;  3BK1 A;  1MVK A;  3EA6 A;  1CJE A;  4XDD A;  1WYG A;  4IOI E;  1FNV A;  1TKE A;  1F77 A;  1TYG B;  4ZRP A;  2INN E;  3ZYY X;  1T3Q A;  1KFY B;  2WXH A;  3FIL B;  2ON8 A;  3ZJU A;  3AE4 B;  2WXG A;  5FK9 C;  4RCO A;  1QOF A;  4KX6 B;  5AUI A;  2KAJ A;  2H88 B;  4RFB A;  2XN9 C;  2WXR A;  4IKG A;  4YTP B;  2WU5 B;  3ZQ4 A;  5BYR A;  1QOB A;  1ZOY B;  2WXO A;  2V3N A;  1C76 A;  2MEK A;  3KWV A;  5HG2 A;  1SE2 A;  5MPO A;  2WP9 B;  4Q2J A;  3W5V B;  4NAW B;  4KGR A;  3IT6 B;  1N5X A;  1IUE A;  3CIR B;  2WXN A;  1C78 A;  2JWU A;  1NEN B;  3Q8F A;  3TEZ A;  2J4X A;  2ICI A;  2CU3 A;  5BMH A;  1FD6 A;  2MJD A;  2BBC A;  3AEB B;  3AE6 B;  1F0Z A;  2PLP A;  1P7E A;  1YN5 A;  4D2K A;  1GPX A;  1F2R C;  4RGN A;  4YSZ B;  4YTN B;  1SIJ A;  3IT4 B;  2M56 B;  4WIP A;  3TSS A;  1N60 A;  1C9F A;  3Q69 A;  2OED A;  1D5X C;  1M4V A;  1EWY C;  2SAK A;  4DQO C;  1ZXI A;  4TMA B;  1K51 A;  3AEG B;  1RFK A;  3AM9 A;  2DYM A;  2V0G A;  3BZD B;  4N59 A;  1DYQ A;  3P63 A;  2WNM A;  2K3U A;  2JQR B;  1UUP A;  5BMI A;  2DBY A;  2JXT A;  4TQ1 A;  1L4D B;  5D3I B;  3Q8E A;  1SJE D;  1JRO A;  1YN4 A;  2JZP A;  4HKZ E;  2QIE B;  5EE3 A;  1J7B A;  2Y5C A;  1FMA D;  3AB5 A;  2PMV A;  2N7J A;  1LO5 D;  2N9K A;  4KKJ A;  2IGD A;  4P6V F;  3W9C B;  2AX5 A;  2GRI A;  3V05 A;  2G1E A;  3IAS 1;  3ETR A;  1NYR A;  1FO4 A;  4YSX B;  1DOI A;  1TY0 A;  1YMH E;  4IDI A;  1OFF A;  1TS3 A;  2BT6 A;  2Z8L A;  1PFD A;  2CJN A;  1WSP A;  2MJE A;  2WLB A;  1FNW A;  2WXF A;  1GB1 A;  2XNA C;  2QMT A;  2Y3A A;  1R7S A;  1XCQ L;  2V4I B;  4C56 C;  2LEK A;  2NTS A;  1PGA A;  1HEZ E;  2WXQ A;  4ZRQ A;  2PVO D;  1K50 A;  2DLB A;  4A55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...