2JYEA

Human granulin a
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
72
structure length
72
Chain Sequence
AMDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQKLAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure dissection of human progranulin identifies well-folded granulin/epithelin modules with unique functional activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Granulin A
total genus 3
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00396 Granulin Granulin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.500 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jyeA01
2JYTA 2JYEA
chains in the Genus database with same CATH superfamily
2RDGA 1J7AA 4HK2A 3R7RA 3AM9A 3R2IA 1TS3A 2WYQA 3NVVA 2INPE 4F7ZA 1EUVB 1HA5A 2Z0EB 2JZ3B 5LXHA 3DHIC 4NAWB 1WJ4A 2O2VA 1NI2A 2G4SA 3C0RB 2IZVB 3DPDA 1FPYA 2RDBC 4KGSA 2LI5A 4PS3A 3ZDMC 2NBVB 1P0RA 2QIEB 2BYFA 3EFCA 1B9RA 3VRBB 4DHJB 2XNAC 2JXXA 2MJ3A 2C7MB 3EUB2 3CMMB 2CHXA 1GB4A 1OGWA 3RUIB 3HVDA 4KX6B 2BBCA 3W2DA 2D3AA 1T0YA 3BVMA 4RFBA 1KFYB 2WDTB 2QMTA 1SE4A 3WIMA 2OJRA 1L0XB 3BK2A 4MGIE 3H7PB 2JRIB 1FNWA 2WXOA 1A70A 3T8MA 4C00A 1F52A 3N20C 3I3TB 4FJVB 2L0TA 1JWSD 3QIJA 2Y5CA 2INNE 1C1YB 3KW5B 3AE7B 3NZ3A 4FBJB 1I4RA 1V8CA 1Y56A 5BYSA 4ICUA 2GLSA 4KZ0A 2KKCA 1QLBB 4TQ1A 1QQRA 2BTEA 4M0WA 2XN9C 3MJ5A 5TR5A 4WJPA 3OAWA 4BBNC 3N32A 5EE9A 1XLNA 4ICVA 1P7FA 5C2TB 3AE5B 4FHKA 5BMHA 1BUIC 1GNUA 2CU3A 4ZOHC 5E6NA 4M00A 1UELA 4M8NA 1XLPA 1I4QA 1L0VB 2KDEB 4NJ7A 2LUEA 4MM3A 1EU4A 4G50A 1CK1A 4BOSC 1MHHE 2MP2A 2MQJA 1WH3A 2Q5WD 2FBWB 1KJTA 2KXJA 4C7YA 3T3OA 2VRRB 4LCDE 4A8XC 2K8CA 3ZGZA 3PLVA 1J8CA 4BKSA 2NBUA 2BYVE 1TZOA 3SD5A 4J3OD 4DK5A 1F0ZA 2AQ1B 1S1QB 1TGZB 2D3CA 3T9LA 3NVYA 1FNVA 2Y3AA 5DPRA 2C60A 2N7DA 4RGTA 3Q8EA 2WXRA 4WQOB 2KNBA 1WY8A 4KV2A 3AN1A 2Y5BB 4FADA 2PE9A 4YSYB 1UBQA 3AE6B 2LFIA 1XO3A 1QOGA 1V5OA 4ANWA 1TT5B 4ACFA 3AB5A 2AL3A 2WHIA 1LO5D 1MJDA 2MH7A 1E7UA 2A5UA 3QJZA 5JHAA 3DVGY 4W9HA 1D4BA 4FULA 1KLUD 2PE6B 4HCNB 3KWVA 2IO1B 1PUTA 3AE4B 3B08A 3BVGA 4BKTA 2D11A 3JW0X 4REZA 2M56B 2K9XA 4OW0A 1KTKA 1XQQA 3GE8C 2K6DB 4MM3B 4H2AA 4JPSA 4CHKA 5D2MB 2PVOD 5JHBA 2VZKB 3IAM1 4NAMA 1PQSA 2MJDA 3Q8AA 2N9XA 5IKCM 2KDIA 4KSKC 3UF8A 4S0RA 2KN4A 1EWCA 2WWZA 4C4VA 1WSPA 3A9KB 4IDIA 3BIID 2ONQA 2LVOA 4B6WA 5CHVC 2BYEA 5G2NA 3DBSA 5CHFA 2RR9A 1FIQA 1KM7A 1PGBA 5C3JB 3W5VB 3DVNU 1YJ1A 3B9JA 5IP4D 1T0QC 1HXYD 3I57A 2J4XA 1ET6A 4L1BA 3P63A 2NMQA 4LNNA 4GDLA 4NPNA 5CX3A 3NY5A 3HRDD 1QILA 3VTUA 4DDGD 5EE1A 1FRDA 1FXTB 4NNJB 5G5GA 3ZQ4A 3EA6A 2FUHB 4X57B 1WGKA 1FM0D 4FHJA 2BWES 3TJPA 2ASQA 1GPXA 3WAOA 2BPSA 4ANVA 5LNK1 2INCC 1E5WA 1C78A 3CF6E 2W9NA 3RNGC 3AE9B 3WALA 3ZIMA 3AE1B 2L83A 2QCZA 2KMAA 2DX5B 3IFWB 2YVCA 3P2BA 3L16A 4WJQA 2GMIC 4MH8A 3Q3MC 2BW2A 3VR9B 3DWMA 3W1SA 4NAWA 3TCAA 4BZAA 1Q1OA 1L4ZB 1UBIA 1YD8U 1JRPA 3DDCB 1WJNA 3SR6A 2PLPA 3OLMD 4DXAB 1RLFA 4P7IA 3SDLC 3I5JC 4RM9A 4QAYA 2YEPF 1VD2A 4LK0M 1TS2A 2BB5A 2MBBB 1V80A 1E0ZA 2X8XX 2KQSA 1VZ6A 1XLQA 4GU2A 2GI9A 2K39A 3TEZA 2O6VA 3P42A 4J6IA 3V3XA 3VAWA 2AWTA 2DYMA 5IAAC 3FAHA 1WGHA 3ALBA 4C80A 3R2TA 3L0WB 2KANA 1AYFA 4GDKB 2QILA 2DZKA 4EEWA 1XEEA 3HVZA 4WJOA 3RMKC 2LZ6A 3W9CB 1K53A 3BYYB 4RH6A 4ZRPA 2LWPA 4ANUA 2G9HD 3CSTA 3QQ8B 2WQYB 1YQ4B 3VUXA 3RT3B 2IYDB 2L32A 4DXFA 2JY6A 2KTFA 1IGDA 4MDKE 1JALA 3LXFA 1MHXA 4HJGE 2JZZA 1K8RB 2WXGA 3Q69A 2KAJA 3AECB 1JWBD 4K3CA 2ZJDA 1P3QU 1KH0A 4RMAA 2L00B 1FXAA 3V6CB 2DYBA 2L7RA 2IGDA 2EELA 4AJYB 2DZMA 4MJSB 4RCOA 2DYOA 2NR2A 3A9KA 1TBEA 1L5PA 3KWLA 4E71A 3PLUA 4PYUA 1CZPA 1D6EC 1JWAD 1XCTL 1YN4A 3AE2B 4EFOA 1F1HA 2BYTA 4XZ4A 2ZNVB 5JH5C 3PPAA 4I6NB 1UZXB 3DBHB 4MGYE 2AEHA 4D2KA 3D32A 5GMVA 1UF0A 3LJ3A 1FNUA 1PGXA 2MBQA 4I6PA 1OQRA 4B0MA 2M8SA 4MGKE 2K3UA 1Z5SB 3R7QA 1L6UA 1EU3A 2CJOA 2R61A 1EF5A 4B9KA 1T0SC 4TV3A 2JSVX 1G6JA 2MEKA 4DHZB 2JYEA 2RSUA 2LXCA 3IVFA 2MLBA 2LVPA 1C3TA 2W55A 4RM8A 4BOZB 4II3B 3A33B 2R2OA 1L4DB 1NI3A 2LHEA 4XGAB 2BB6A 1JMLA 1E8XA 4OHJA 1N60A 2MBOA 1IPGA 1M94A 1E6EB 2WXMA 4PK1A 4LTUA 1ZDXA 1L6VA 4OZBA 3VDZA 4ZRJA 2LGYA 1NEKB 4FN2A 3ZJUA 2KOXA 2N1VA 3ZYYX 4A3PA 1YX6B 2CJNA 1WRIA 1TS5A 1NVID 2KJ6A 3AEGB 1V1PA 4HPLB 4M0WB 2XK5B 4MEMA 4JWSC 2FUG1 3DBLB 3BY4B 4GDLB 1WXSA 1SIFA 2D3GA 3RZFA 4ASWC 1L7YA 3QCAA 2X38A 3TEWA 2LMCA 2KFKA 1MG8A 4E3CA 4IM2A 1CQVA 2PMVA 2DENB 3S2AA 1I4GA 1QZEA 1BT0A 4O1NA 2M19A 2REXA 2N4FA 1OEYA 4GOCA 1Z2MA 3VUYA 3FILB 3KQ4A 1XF5L 3WA0A 4C4VB 3UQAA 2EKEC 2ZVNA 4C7ZA 4IOIE 3UI3A 3PV1A 1SSNA 3N1XC 3VVWB 2C7HA 1FEHA 2L76A 2IJ0A 4PS7A 1I42A 1STEA 1EM7A 4HPMB 3HK0A 3OG5A 2G4DB 3UIPB 5AZHA 1DYQA 2SEBD 5EE3A 4BBNF 3ZDTA 1SBBB 4WIPA 2DWQA 3O65B 3HUIA 3PO0A 4AS1A 3RCZA 2G45B 4A3OA 1PGAA 1ZW7A 3GB1A 4ZYSA 1GOZA 1NYQA 3APFA 3SEBA 2V3SA 1YNTE 3R8BA 3IBEA 4OVUA 2Z59B 1VJKA 2HDEA 2CHWA 1WMHB 2WXPA 2ZPNA 3V61A 1WF9A 3BZDB 3K9PB 4JWUC 2LXAA 3TEXA 3RD2A 1T3QA 1ZP0B 1SE9A 2J7QB 4M02A 4IM3A 3C19A 3IAS1 1E90A 2BS3B 3L4PA 4XC2A 2V1YA 4CQNA 3ZO5B 2KTRB 4ZYNA 1V2YA 3QWZB 3RPFC 1TY0A 2ZCBA 4K1RB 2MP2B 1SE2A 5I4DA 2KT7A 3ML9A 1ZKHA 5G55A 1FMAD 1WXQA 1UGMA 2MX2A 1WX8A 2PW9A 4LJPB 2NTTA 3AU4A 2HE7A 4RF0A 1A5RA 3ZNZB 3P4RB 2DHZA 3MHZA 3UINB 1DOXA 5G5HA 5DPTA 4XWTA 3ZRFA 2DAFA 5CHWA 3GZNI 4RNAA 3V05A 1TKEA 5J2RA 3TL5A 2BS4B 1N61A 3UGBB 2WDQB 1J19A 1QOFA 2LVQA 1WXVA 4MSQB 3HM6X 3RN9C 1RAXA 3PZ7A 2WP9B 4LDTD 4TMAB 3RI7C 3PSEB 3RULA 3ZNHB 1QOBA 2GB1A 2JWUA 1MPEA 2WXFA 4WJNA 1KLVA 3AEFB 2IPKD 3ZTCA 3X23A 2I38A 2JU6X 2K22A 4ARCA 1D5MC 3H8HA 2FIFA 2GRIA 1RWSA 1E8ZA 3N3KB 4HXDA 4EE2A 4II2B 3DHGC 4PS8A 2LGSA 2KD0A 1NENB 1WI0A 3EECA 4JQWC 2HTME 3AMZA 4BKGA 3AEBB 2JT4B 1Q10A 3TSSA 2N0SB 2W3RA 5J18A 2AL6A 5D7GA 5D3IB 2G1EA 2ACZB 4OZCA 3AE3B 3KUCB 4XDCA 1YN3A 4E74A 4WWMA 2GOWA 1IBXA 1F2RI 1YQBA 1V1OA 4W9CA 1MG4A 1K50A 3HM3A 1WJUA 4DBGA 2MCNB 3L54A 4NJCA 2N7JA 1V49A 3APCA 2KX0A 3B1LX 3KYCD 2VH1A 1ZUD2 3HHMA 2JF5A 3PHXB 3RYTA 4TQ0A 3DBLI 4DHJD 2VH2A 4M01A 3RNFC 2QDFA 2MW5A 2QHOA 4KDLB 2L05A 1LFDA 5JXVA 4MSMB 2RPQA 4K7WA 1YN5A 2WGSA 4P1CC 1JWMD 4MH0E 1N6ZA 3DWGC 2KVZA 2K1FA 1EO6A 4EOYA 1TTNA 3H9DA 4K3BA 3U52E 2QEJC 4ZDVA 3DVNV 4P16A 1CJEA 2ZPYA 1WE7A 2L52A 1HE8A 4AP4C 4RGMA 2KFJA 1N5XA 1UUPA 2EMSA 2NPTB 2N9LA 4MGZE 2ZVOA 2BGFA 3MC8A 4PYZA 1WZ3A 2DLBA 3QAQA 2E3TA 1QF6A 2RMMA 2ZCCA 5D94A 2L1AA 4I6LB 3LDZE 4IWQA 2INDC 3AEEB 3RZWC 4IWOA 1XT9B 5FKAC 3M63B 5AUKA 4KGRA 1EF1A 2LEKA 2ZNVC 4RGNA 1X1MA 1TIFA 3APDA 2N7EA 1HTOA 1WGDA 3VH3B 3WAMA 4IKGA 2FCSA 2GBMA 2PIAA 2R2QA 2DZIA 4P1BC 3MJWA 5KHOA 1JWUD 1SJED 2QJLA 3CWIA 5E6PA 2YLMA 3N1YC 2WXQA 2Z8LA 1GAQB 1XLOA 3PS6A 2WXJA 1WFYA 4BVUC 1TS4A 4JLCA 3IG3A 2FIDA 4WQMA 3L10B 4EZKA 2NTSA 1ET9A 2BQQA 3SHQA 3JSVB 1OQQA 2KDBA 2RGFA 3ABVB 3A1QA 3E56A 3VUWA 3Q14C 3IT6B 3L13A 4F1SA 5FR3A 4GSWA 1WYGA 1J7BA 2KLGA 3A9JB 3I9V1 1CMXB 4OVZA 4WWNA 1FRRA 3ONSA 4K7SA 3CSFA 2LGDA 1WR1A 4YT0B 2AQ3B 3NZUA 4GGQA 2KFKB 4FXCA 5IOIA 3A4RA 2JVCA 2RPVA 3ENEA 4W9EA 3PHWB 3TBLD 2H88B 3NJTA 1YJIA 1FO4A 4W9DA 1GUAB 4YXDB 5L95C 1T0RC 4KSLC 4BAXA 1VLBA 3V62A 4RF1A 3WANA 3X0WA 4KIKB 3J9CA 4USAA 4NQKE 2IO0B 3CIRB 3AULA 1RFAA 3ZJTA 3Q3FA 3HIZA 4LNFA 3OJ4B 4K81A 4F8CB 4LJOB 3VR8B 4ANXA 1LXDA 1F77A 2WDVB 4A20A 4JL9A 4FA6A 1L2NA 2WXKA 1J7CA 4WWOA 1WXAA 4YTPB 3ZUNA 5AUIA 1GC6A 1M4VA 1WE6A 2IDYA 1C4CA 2V4IB 3BINA 3MC0B 2DNFA 3FC4A 5D3DA 1ZE3D 5BO4B 4US9A 3EC8A 1ZXIA 2KVRA 2BT6A 3FKYA 4YTMB 1RM6C 3W1YA 3PZDA 4B95A 2FCNA 2D10A 2LGIA 2B76B 4JIOU 5HHDG 1B1ZA 3U30A 3K9OB 4G0NB 2MJEA 2AX5A 4AWJA 3DBRB 1KRHA 5DCNA 1HTQA 5HKHA 4DWFA 3PRPB 4ITKA 1I35A 3A9JA 4B0EA 2IY1B 3I63C 1SJHD 1WIAA 1AARA 2UWQA 3ZJVA 4KIKA 2KC1A 1JQ4A 2MSED 3URYA 2NS5A 3PRZA 1GG3A 3N1ZC 4AUQC 4AOFA 1T5XD 4ZRQA 1WWTA 3RNCC 1R4NI 4L2YA 3UQBA 3DOWA 1DGJA 2K8BA 3LYYA 1SEBD 4HLEA 1E7PB 4EKUA 2MA9B 1KLGD 3B2FA 1N62A 4WH4A 5HI1A 3H7SA 1K51A 3PGEA 2BF8B 1ENFA 2GBKA 1SB3C 3TUOA 1NDDA 2IGHA 4W9LA 3JSVA 1C76A 4URKA 1UNSA 2TSSA 3AI5A 1HEZE 4BKSD 3A4SC 2LRUA 5FK9C 4HDOA 1WXMA 4MACA 3VXWA 3SFDB 3PVLA 3DQVA 4LDTB 4AJWA 4HVBA 3VFKA 4GXBA 2G3QB 2K6QA 2MBEA 3T3NA 1V9JA 2K8HA 2WX1A 1UGJA 2NPTA 2BKFA 1VCBA 5FR6A 1HZ6A 4TSSA 2HJ8A 1TZ1A 4HCPB 4JE3B 2IBIB 2JQRB 1WGRA 2FNJB 2LHDA 5KHQA 1MVKA 2PEAA 1MI0A 3H6NA 3U8ZA 3VQIA 1UD7A 4HROA 2KDMA 2J42A 2L0FA 4LNIA 3MTNB 1PDXA 4RGOS 1FCCC 3OJ3A 2RD0A 3GP7A 3EGRA 2J0JA 1WJ6A 1PYWD 4HKZE 2V9HA 4A55A 1RFKA 2KX3A 2AYOB 1NBFC 1VR9A 4DHZE 4ZRIA 2DBYA 1MFWA 3MHSD 1AW7A 4GN1A 2N9PC 1UWXA 3ZXRA 5H92C 2KACA 3V6EB 2DZJA 5E6OA 4JGHB 4KGTA 2B3AA 3Q2AC 1IBXB 2JX5A 3TIXA 3U7ZA 3PTFC 4ZHPA 4HPPA 2CHZA 5HFYA 1WX7A 3ZW3A 3GE3C 3KUDB 3DVGX 1YQ3B 1ZOYB 2ZZPB 4G3XB 3NHEB 3NS1A 3RNEC 2V0GA 3QHTA 3RNAC 3ZXVA 2K25A 1VZ7A 3H1UA 4GIVA 2KN5A 4BFRA 2FE8A 3BK1A 1I7HA 1NYRA 2CKHB 2WLBA 2KMCA 2Z0DB 1I4HA 2V3PA 4KDIC 2I1JA 1KF6B 1XCQL 3ZRCA 3N30A 3W5UB 4YSXB 1OTRB 5H8YE 1ZXHA 1YIWA 4FLHA 2KQ7A 3PREA 2EMTA 4TKNA 2V4LA 3NZSA 5AEKB 1E8WA 1AN8A 1WGGA 2QC8A 2KWDA 2EKIA 4YTNB 1FD6A 4YWGG 1YX5B 2MRPA 5CTRC 1V86A 2M1MA 4N59A 4MT5A 4XWWA 4IW0A 2OOBB 2JPHA 2KWUB 1P98A 4W9IA 3Q3NC 3M95A 2LJ5A 1ZPSA 1V1PB 4LNKA 3VHTC 4EUTA 4WAAA 4P6VF 2CU1A 3KYDD 3ETRA 2UYZB 3ZKJC 4S17A 1N5WA 3QARA 2ICIA 3DBHI 5DPWA 1LM8B 2QSDA 4A90A 5C23A 1TY2A 2GBNA 3V60A 5LLIA 3WAPA 4OZAA 3QX1A 3Q8FA 3UIOB 3Q8BA 4DDID 2WXHA 2JRHA 3KVFB 3R66C 2UU7A 1WYWB 1E10A 5BYRA 2ZW1A 1T6BX 1AWDA 1OQYA 2PVGC 2BVCA 2HJ1A 2L8JA 4HDQA 2W3SA 3DCGA 3JYUA 2KJRA 3ECIA 1S3SG 3M62B 3P4SB 3OWEB 2YEPB 2W82A 3QK0A 4W9FA 4MELA 4A6QA 2K5PA 2FCQA 5D6JB 1KOTA 1F2RC 2OHFA 4N9F4 2O6VD 3JVZX 2J53A 2M0XA 1C4AA 4L23A 4W9KA 2Y5PA 2D5GA 3PT2B 1SE3A 4GB9A 2WU5B 1DOYA 3VTVA 2MHJA 4NZLB 3VRAB 1H4RA 2OEDA 2LJIA 3L08A 2PPHA 4HRSA 4W9GA 2I2YA 3NVWA 2W54A 4C56C 1C77A 1TKGA 4HEA1 1HQRD 2FAZA 3Q6BA 1P7EA 1LGRA 1V97A 2MBHA 3NRZA 2NCNA 2IY0B 3IHPC 3BVZA 1SGHA 4Q2JA 3M3JA 2IO2B 2L3ZA 4CYEA 3ZLZA 2E6XA 4G11A 2KQ4X 1YMHE 2HD5B 1R4MB 4WWPA 4DQOC 1UWMA 1BXTA 2K0PA 2KWVB 3L17A 2WNMA 2NBWB 3BYTB 1C4PA 2WXIA 2J0KA 4XYCA 1FCLA 5LXIB 3AU5A 1ISNA 3AEDB 1OFFA 2JYTA 2PJHA 4LLGM 4EZLA 1IUEA 1D5ZC 3PZ8A 1VRAB 3H7PA 3ZNID 2ZW0A 1H8CA 2GBRA 3SU8X 4IM0A 3U7DA 1I4XA 1LQBA 4US8A 1TJEA 1ROEA 1UH6A 2H89B 2JWZA 1J0GA 1VZ8A 2M4NA 2CR5A 2WS3B 2D3BA 5MPOA 4IWPA 2JZPA 3B0AA 5BMIA 3KLSX 1IP9A 3GOEA 2WU2B 1FFUA 3GS2A 3KH0A 1EWYC 2KC2A 3GZNB 4ARIA 1WM2A 2KO3A 5BYQA 1IYFA 2KMMA 1F9JA 2PTLA 1QKZA 4GMVA 4N58A 3AE8B 2WXNA 4KVGB 3EHVA 2C7NB 1ACCA 4GLSC 2LGXA 2LUMA 4HKQA 2XK5A 4KZCA 1D3ZA 5GXGB 1XXGA 2O6VB 1U4AA 4WAFA 5DPSA 4EZJA 3DBRI 1RRBA 2HTHA 3QC8B 4CO7A 3AXCA 3NOBA 1P1AA 3ZVVA 2M0AA 2IGGA 4KKJA 4A9AA 1IGCA 5EDSA 3MFGA 3P4PB 4YL8A 1V81A 2MWSB 1PFDA 1GC7A 2KTRA 5EE0A 2I1KA 2V3NA 3PRMB 3U4EG 4K7UA 4KKIA 1V5TA 2KLCA 3ML8A 4XX5A 2ZEQA 4HJKA 3W1SC 3AEAB 3AV8A 2AQ2B 4N6EB 5JZEB 5AZFA 1WGYA 5E6JA 3NS8A 3MC9A 3B2GA 2D2QA 3O13A 4HWIB 2LD9A 1YJJA 3P4QB 3IT4B 1R7SA 3KUZA 4XDDA 2PKOA 4MJSA 2VZKD 1Y8RC 1OEYJ 1HZ5A 1SF0A 2M17A 4FJZA 1D5XC 1ZDVA 2A4ZA 3C8YA 3A1QB 2GBJA 1WR6E 1QOAA 2DAJA 5AZGA 5BMGA 2LRWA 1FXIA 4ZHOA 1FFVA 2RDHA 3NUHB 3R3MA 3E9SA 1YOVB 1QT9A 5IN7A 3LB8C 1N63A 2JUOA 3WCQA 2JXTA 2BS2B 2OJWA 4UDUC 2BWFA 1DOIA 3FILA 2KWCA 1XD3B 3U2SC 2IO3B 5IA7A 1K52A 2KJHB 4WURA 4IG7B 1E7VA 3ZNGC 1I4PA 1WX9A 3SFEB 2KZRA 1R4NB 3BWUD 4GDKA 3QA8A 3N9YC 4NJ6A 2D07B 2WDRB 3TEYA 1JCKB 1ZGUB 2C9WB 5IO9A 2WX0A 1SIJA 3EFUA 2KHWB 2N1WA 4IC7B 1BMLC 3RFZB 2XBBC 1Q5WB 2O2VB 2LASA 4R3DA 1E9MA 1R4MI 1WRDB 3VTWA 3ZTDA 1C79A 5T8IA 4PT5A 2N9KA 1P9DU 1SXTA 2KDFB 3VH4B 2N9EB 1RYJA 3RNBC 4XE0A 3Q3JA 2KYWA 3NG0A 2WXLA 2XEWA 4AQ7A 1VDVA 3AH7A 2FCMA 1L0YB 4YSZB 1GB1A 3IXSA 2CS4A 1TKYA 3NVZA 1WZ0A 4M8MA 3P1MA 4NQLB 3Q8CA 4OVVA 2KK8A 4FJYA 4TUUA 2SAKA 1JROA 1TYGB 3DHHC 2BKRB 4JX1C 4IUMB 2NVUI 1JW9D 2J52A 1JRUA 5L83A 4W9JA 5C1ZA 4LNOA 2J0MA 5J17A 1Q0WB 3MP9A 1WMHA 2C5LC 1WM3A 1C9FA 1E8YA 5TSSA 3Q3OC 1V6EA 3TMPB 4ZRKA 1ESFA 1GJZA 4DXGA 5HG2A 2ON8A 4NY0A
chains in the Genus database with same CATH topology
3ETRA 2RDGA 3AE2B 1J7AA 1N5WA 3AM9A 2ICIA 3R2IA 1TS3A 2BYTA 2L1AA 3NVVA 2INPE 1HA5A 2QSDA 3AEEB 4A90A 4NAWB 4D2KA 1TY2A 5FKAC 1FNUA 4KGSA 5AUKA 4KGRA 2LEKA 4RGNA 2QIEB 1PGXA 1OQRA 4B0MA 4OZAA 1B9RA 3VRBB 3Q8FA 2XNAC 3Q8BA 2MJ3A 4IKGA 2WXHA 2K3UA 2PIAA 1E10A 1L6UA 1EU3A 2CJOA 2ZW1A 3EUB2 5BYRA 1T6BX 1AWDA 1JWUD 1SJED 2PVGC 2R61A 2QJLA 1GB4A 3CWIA 2W3SA 3HVDA 4KX6B 2BBCA 2JSVX 2WXQA 3BVMA 2MEKA 2Z8LA 4RFBA 3W2DA 1GAQB 1XLOA 2JYEA 1KFYB 2WXJA 1TS4A 2QMTA 1SE4A 3P4SB 3OWEB 2YEPB 2W82A 4WQMA 1L0XB 2W55A 2NTSA 1ET9A 3BK2A 4A6QA 1FNWA 2K5PA 2WXOA 1A70A 1OQQA 3ABVB 1F2RC 1L4DB 2OHFA 1NI3A 2LHEA 2J53A 2BB6A 1C4AA 1JMLA 3E56A 1JWSD 4L23A 3IT6B 2Y5CA 2INNE 2Y5PA 4OHJA 3AE7B 2D5GA 1N60A 5FR3A 1E6EB 1SE3A 1WYGA 3NZ3A 2WXMA 1I4RA 1J7BA 1V8CA 2E3TA 4LTUA 3I9V1 1Y56A 2WU5B 4OVZA 5BYSA 1DOYA 1ZDXA 1FRRA 4NZLB 4YT0B 2AQ3B 3VRAB 1QLBB 1L6VA 4TQ1A 1QQRA 4FXCA 4OZBA 2BTEA 4M0WA 1NEKB 2XN9C 2OEDA 2RPVA 3MJ5A 3ZJUA 2LJIA 2H88B 1YJIA 4HRSA 1FO4A 2I2YA 4YXDB 3NVWA 2W54A 3ZYYX 4C56C 5EE9A 1C77A 1XLNA 1TKGA 2CJNA 1P7FA 1WRIA 5C2TB 3AE5B 4HEA1 5BMHA 1VLBA 1HQRD 1BUIC 1TS5A 1NVID 2CU3A 4RF1A 4ZOHC 1P7EA 1XLPA 1V97A 1I4QA 1L0VB 3AEGB 1V1PA 3NRZA 3BVZA 3J9CA 4Q2JA 1EU4A 4JWSC 4USAA 2FUG1 1CK1A 4GDLB 1MHHE 2E6XA 3CIRB 2Q5WD 2X38A 3TEWA 3ZJTA 2FBWB 2KQ4X 1YMHE 2LMCA 4C7YA 3T3OA 4A8XC 4DQOC 1CQVA 2PMVA 3ZGZA 1UWMA 3VR8B 1BXTA 2K0PA 1F77A 2WDVB 2WNMA 1I4GA 3BYTB 1C4PA 1TZOA 2WXIA 4J3OD 1FCLA 4O1NA 2M19A 1F0ZA 3AEDB 2AQ1B 1OFFA 2JYTA 3NVYA 4LLGM 1FNVA 2Y3AA 3FILB 3KQ4A 2WXKA 1J7CA 1XF5L 4RGTA 1IUEA 4YTPB 3Q8EA 5AUIA 1M4VA 2IDYA 2WXRA 1D5ZC 1C4CA 4C7ZA 4IOIE 1VRAB 2V4IB 1SSNA 3PZ8A 3UI3A 2ZW0A 3MC0B 5HG2A 1I4XA 4US8A 3AN1A 1TJEA 1FEHA 3FC4A 1ROEA 2H89B 2IJ0A 1ZE3D 5D3DA 4US9A 1STEA 1EM7A 1ZXIA 1VZ8A 4YSYB 2BT6A 2WS3B 4YTMB 3AE6B 1RM6C 2LFIA 1XO3A 1QOGA 5MPOA 3AB5A 2JZPA 5BMIA 1LO5D 3KLSX 2LGIA 1DYQA 2B76B 2MH7A 2WU2B 1FFUA 5HHDG 2SEBD 1B1ZA 3GS2A 5EE3A 1EWYC 1SBBB 4ARIA 4WIPA 2DWQA 1D4BA 2MJEA 2AX5A 5BYQA 3HUIA 1KRHA 1KLUD 2KMMA 2PTLA 3PO0A 4AS1A 3KWVA 4ITKA 1PGAA 1PUTA 3AE4B 1QKZA 4B0EA 3GB1A 4N58A 1GOZA 3BVGA 4ZYSA 1SJHD 3AE8B 2WXNA 1ACCA 4REZA 4GLSC 1NYQA 2M56B 2K9XA 4OW0A 1KTKA 2LUMA 4MM3B 4HKQA 4H2AA 4JPSA 3ZJVA 2PVOD 3SEBA 1YNTE 3R8BA 5GXGB 2VZKB 1XXGA 3IAM1 1JQ4A 4NAMA 2MJDA 3URYA 3Q8AA 4WAFA 1VJKA 1T5XD 4ZRQA 1WWTA 2KN4A 2HDEA 1EWCA 1WSPA 2WXPA 4L2YA 2M0AA 4IDIA 1DGJA 3BIID 2IGGA 3LYYA 4KKJA 2ONQA 4A9AA 1SEBD 3BZDB 4JWUC 3TEXA 1IGCA 1E7PB 1T3QA 1ZP0B 3MFGA 3P4PB 3IAS1 2BS3B 3L4PA 1KLGD 1FIQA 1PFDA 1PGBA 5C3JB 3W5VB 3B2FA 4CQNA 3B9JA 1N62A 4WH4A 5HI1A 1QF6A 1HXYD 3RPFC 1TY0A 3I57A 1K51A 1ET6A 2J4XA 2V3NA 1ENFA 4L1BA 5EE0A 3U4EG 3P63A 1SB3C 2NMQA 1SE2A 4KKIA 5I4DA 3TUOA 2IGHA 3HRDD 1QILA 5EE1A 1C76A 1FRDA 3AEAB 3AV8A 1FMAD 2AQ2B 1UNSA 1WXQA 5G5GA 3ZQ4A 3EA6A 4N6EB 1WGKA 1FM0D 2TSSA 2PW9A 1HEZE 2NTTA 5FK9C 4MACA 1GPXA 3SFDB 4RF0A 3P4RB 5E6JA 3MHZA 1DOXA 5G5HA 3B2GA 4XWTA 5LNK1 3T3NA 3O13A 1C78A 1UGJA 1YJJA 3P4QB 3AE9B 3IT4B 4RNAA 1R7SA 2L83A 1HZ6A 3AE1B 4TSSA 4JE3B 3V05A 1TKEA 4XDDA 2JQRB 2PKOA 2BS4B 1N61A 2LHDA 1MVKA 1MI0A 2VZKD 2WDQB 3VQIA 1QOFA 4MH8A 4HROA 2KDMA 2BW2A 2J42A 1HZ5A 3DWMA 3VR9B 1SF0A 3W1SA 1D5XC 1ZDVA 3PZ7A 2WP9B 1PDXA 3C8YA 4RGOS 4TMAB 1L4ZB 1JRPA 1FCCC 3SR6A 2PLPA 1QOBA 1QOAA 3GP7A 5BMGA 2GB1A 3EGRA 2JWUA 1MPEA 2YEPF 2WXFA 1FXIA 4ZHOA 1FFVA 4LK0M 1PYWD 3AEFB 1TS2A 4HKZE 2BB5A 2IPKD 2RDHA 4A55A 1RFKA 3NUHB 3E9SA 2I38A 2JU6X 2K22A 1E0ZA 4ARCA 1QT9A 1D5MC 3H8HA 3LB8C 1N63A 2GRIA 1RWSA 3WCQA 2JXTA 1VR9A 2BS2B 1VZ6A 4UDUC 3FILA 1DOIA 2DBYA 4EE2A 1XLQA 3U2SC 1AW7A 1K52A 2GI9A 4WURA 3TEZA 1UWXA 1NENB 1I4PA 5H92C 2HTME 3AMZA 3SFEB 2KACA 3AEBB 3P42A 3BWUD 4KGTA 3N9YC 3V3XA 1IBXB 1Q10A 2JX5A 3TSSA 2DYMA 3U7ZA 2N0SB 2W3RA 3FAHA 2WDRB 4ZHPA 3TEYA 1JCKB 5D7GA 4C80A 3R2TA 5D3IB 2G1EA 2ACZB 4OZCA 5HFYA 1SIJA 3AE3B 4XDCA 1YN3A 4WWMA 1YQ3B 1BMLC 1ZOYB 1IBXA 3RFZB 1F2RI 1AYFA 4GDKB 1V1OA 3NS1A 2QILA 1K50A 2V0GA 4R3DA 1E9MA 1VZ7A 1XEEA 3HVZA 2N7JA 4NJCA 1C79A 3W9CB 1K53A 3BYYB 5T8IA 4PT5A 4RH6A 1ZUD2 2N9KA 1SXTA 4ZRPA 2FE8A 4TQ0A 3BK1A 1I7HA 1NYRA 1RYJA 2G9HD 4XE0A 2WLBA 2WXLA 4AQ7A 2WQYB 1YQ4B 1I4HA 1VDVA 3AH7A 2V3PA 2L32A 1KF6B 1L0YB 4DXFA 1XCQL 5JXVA 4YSZB 1GB1A 3IXSA 3W5UB 1TKYA 4YSXB 3NVZA 1IGDA 1YN5A 1JALA 3LXFA 1MHXA 5H8YE 3P1MA 1ZXHA 4HJGE 3Q8CA 1JWMD 2SAKA 1JROA 2WXGA 1TYGB 3Q69A 3DWGC 4JX1C 2KAJA 3AECB 1JW9D 1JWBD 2J52A 1KH0A 1AN8A 3U52E 2QEJC 1FXAA 2KWDA 4P16A 2IGDA 2EELA 2EKIA 1CJEA 4YTNB 2L52A 1FD6A 4YWGG 4RCOA 4RGMA 2DYOA 3MP9A 1N5XA 1C9FA 4N59A 4MT5A 4XWWA 1UUPA 1L5PA 3KWLA 5TSSA 2N9LA 1ZPSA 1V1PB 1CZPA 1ESFA 1D6EC 1JWAD 2DLBA 1XCTL 4DXGA 4P6VF 1YN4A 2ON8A 2RMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYT A;  2JYE A; 
#chains in the Genus database with same CATH topology
 2RDG A;  1J7A A;  4HK2 A;  3R7R A;  3AM9 A;  3R2I A;  1TS3 A;  2WYQ A;  3NVV A;  2INP E;  4F7Z A;  1EUV B;  1HA5 A;  2Z0E B;  2JZ3 B;  5LXH A;  3DHI C;  4NAW B;  1WJ4 A;  2O2V A;  1NI2 A;  2G4S A;  3C0R B;  2IZV B;  3DPD A;  1FPY A;  2RDB C;  4KGS A;  2LI5 A;  4PS3 A;  3ZDM C;  2NBV B;  1P0R A;  2QIE B;  2BYF A;  3EFC A;  1B9R A;  3VRB B;  4DHJ B;  2XNA C;  2JXX A;  2MJ3 A;  2C7M B;  3EUB 2;  3CMM B;  2CHX A;  1GB4 A;  1OGW A;  3RUI B;  3HVD A;  4KX6 B;  2BBC A;  3W2D A;  2D3A A;  1T0Y A;  3BVM A;  4RFB A;  1KFY B;  2WDT B;  2QMT A;  1SE4 A;  3WIM A;  2OJR A;  1L0X B;  3BK2 A;  4MGI E;  3H7P B;  2JRI B;  1FNW A;  2WXO A;  1A70 A;  3T8M A;  4C00 A;  1F52 A;  3N20 C;  3I3T B;  4FJV B;  2L0T A;  1JWS D;  3QIJ A;  2Y5C A;  2INN E;  1C1Y B;  3KW5 B;  3AE7 B;  3NZ3 A;  4FBJ B;  1I4R A;  1V8C A;  1Y56 A;  5BYS A;  4ICU A;  2GLS A;  4KZ0 A;  2KKC A;  1QLB B;  4TQ1 A;  1QQR A;  2BTE A;  4M0W A;  2XN9 C;  3MJ5 A;  5TR5 A;  4WJP A;  3OAW A;  4BBN C;  3N32 A;  5EE9 A;  1XLN A;  4ICV A;  1P7F A;  5C2T B;  3AE5 B;  4FHK A;  5BMH A;  1BUI C;  1GNU A;  2CU3 A;  4ZOH C;  5E6N A;  4M00 A;  1UEL A;  4M8N A;  1XLP A;  1I4Q A;  1L0V B;  2KDE B;  4NJ7 A;  2LUE A;  4MM3 A;  1EU4 A;  4G50 A;  1CK1 A;  4BOS C;  1MHH E;  2MP2 A;  2MQJ A;  1WH3 A;  2Q5W D;  2FBW B;  1KJT A;  2KXJ A;  4C7Y A;  3T3O A;  2VRR B;  4LCD E;  4A8X C;  2K8C A;  3ZGZ A;  3PLV A;  1J8C A;  4BKS A;  2NBU A;  2BYV E;  1TZO A;  3SD5 A;  4J3O D;  4DK5 A;  1F0Z A;  2AQ1 B;  1S1Q B;  1TGZ B;  2D3C A;  3T9L A;  3NVY A;  1FNV A;  2Y3A A;  5DPR A;  2C60 A;  2N7D A;  4RGT A;  3Q8E A;  2WXR A;  4WQO B;  2KNB A;  1WY8 A;  4KV2 A;  3AN1 A;  2Y5B B;  4FAD A;  2PE9 A;  4YSY B;  1UBQ A;  3AE6 B;  2LFI A;  1XO3 A;  1QOG A;  1V5O A;  4ANW A;  1TT5 B;  4ACF A;  3AB5 A;  2AL3 A;  2WHI A;  1LO5 D;  1MJD A;  2MH7 A;  1E7U A;  2A5U A;  3QJZ A;  5JHA A;  3DVG Y;  4W9H A;  1D4B A;  4FUL A;  1KLU D;  2PE6 B;  4HCN B;  3KWV A;  2IO1 B;  1PUT A;  3AE4 B;  3B08 A;  3BVG A;  4BKT A;  2D11 A;  3JW0 X;  4REZ A;  2M56 B;  2K9X A;  4OW0 A;  1KTK A;  1XQQ A;  3GE8 C;  2K6D B;  4MM3 B;  4H2A A;  4JPS A;  4CHK A;  5D2M B;  2PVO D;  5JHB A;  2VZK B;  3IAM 1;  4NAM A;  1PQS A;  2MJD A;  3Q8A A;  2N9X A;  5IKC M;  2KDI A;  4KSK C;  3UF8 A;  4S0R A;  2KN4 A;  1EWC A;  2WWZ A;  4C4V A;  1WSP A;  3A9K B;  4IDI A;  3BII D;  2ONQ A;  2LVO A;  4B6W A;  5CHV C;  2BYE A;  5G2N A;  3DBS A;  5CHF A;  2RR9 A;  1FIQ A;  1KM7 A;  1PGB A;  5C3J B;  3W5V B;  3DVN U;  1YJ1 A;  3B9J A;  5IP4 D;  1T0Q C;  1HXY D;  3I57 A;  2J4X A;  1ET6 A;  4L1B A;  3P63 A;  2NMQ A;  4LNN A;  4GDL A;  4NPN A;  5CX3 A;  3NY5 A;  3HRD D;  1QIL A;  3VTU A;  4DDG D;  5EE1 A;  1FRD A;  1FXT B;  4NNJ B;  5G5G A;  3ZQ4 A;  3EA6 A;  2FUH B;  4X57 B;  1WGK A;  1FM0 D;  4FHJ A;  2BWE S;  3TJP A;  2ASQ A;  1GPX A;  3WAO A;  2BPS A;  4ANV A;  5LNK 1;  2INC C;  1E5W A;  1C78 A;  3CF6 E;  2W9N A;  3RNG C;  3AE9 B;  3WAL A;  3ZIM A;  3AE1 B;  2L83 A;  2QCZ A;  2KMA A;  2DX5 B;  3IFW B;  2YVC A;  3P2B A;  3L16 A;  4WJQ A;  2GMI C;  4MH8 A;  3Q3M C;  2BW2 A;  3VR9 B;  3DWM A;  3W1S A;  4NAW A;  3TCA A;  4BZA A;  1Q1O A;  1L4Z B;  1UBI A;  1YD8 U;  1JRP A;  3DDC B;  1WJN A;  3SR6 A;  2PLP A;  3OLM D;  4DXA B;  1RLF A;  4P7I A;  3SDL C;  3I5J C;  4RM9 A;  4QAY A;  2YEP F;  1VD2 A;  4LK0 M;  1TS2 A;  2BB5 A;  2MBB B;  1V80 A;  1E0Z A;  2X8X X;  2KQS A;  1VZ6 A;  1XLQ A;  4GU2 A;  2GI9 A;  2K39 A;  3TEZ A;  2O6V A;  3P42 A;  4J6I A;  3V3X A;  3VAW A;  2AWT A;  2DYM A;  5IAA C;  3FAH A;  1WGH A;  3ALB A;  4C80 A;  3R2T A;  3L0W B;  2KAN A;  1AYF A;  4GDK B;  2QIL A;  2DZK A;  4EEW A;  1XEE A;  3HVZ A;  4WJO A;  3RMK C;  2LZ6 A;  3W9C B;  1K53 A;  3BYY B;  4RH6 A;  4ZRP A;  2LWP A;  4ANU A;  2G9H D;  3CST A;  3QQ8 B;  2WQY B;  1YQ4 B;  3VUX A;  3RT3 B;  2IYD B;  2L32 A;  4DXF A;  2JY6 A;  2KTF A;  1IGD A;  4MDK E;  1JAL A;  3LXF A;  1MHX A;  4HJG E;  2JZZ A;  1K8R B;  2WXG A;  3Q69 A;  2KAJ A;  3AEC B;  1JWB D;  4K3C A;  2ZJD A;  1P3Q U;  1KH0 A;  4RMA A;  2L00 B;  1FXA A;  3V6C B;  2DYB A;  2L7R A;  2IGD A;  2EEL A;  4AJY B;  2DZM A;  4MJS B;  4RCO A;  2DYO A;  2NR2 A;  3A9K A;  1TBE A;  1L5P A;  3KWL A;  4E71 A;  3PLU A;  4PYU A;  1CZP A;  1D6E C;  1JWA D;  1XCT L;  1YN4 A;  3AE2 B;  4EFO A;  1F1H A;  2BYT A;  4XZ4 A;  2ZNV B;  5JH5 C;  3PPA A;  4I6N B;  1UZX B;  3DBH B;  4MGY E;  2AEH A;  4D2K A;  3D32 A;  5GMV A;  1UF0 A;  3LJ3 A;  1FNU A;  1PGX A;  2MBQ A;  4I6P A;  1OQR A;  4B0M A;  2M8S A;  4MGK E;  2K3U A;  1Z5S B;  3R7Q A;  1L6U A;  1EU3 A;  2CJO A;  2R61 A;  1EF5 A;  4B9K A;  1T0S C;  4TV3 A;  2JSV X;  1G6J A;  2MEK A;  4DHZ B;  2JYE A;  2RSU A;  2LXC A;  3IVF A;  2MLB A;  2LVP A;  1C3T A;  2W55 A;  4RM8 A;  4BOZ B;  4II3 B;  3A33 B;  2R2O A;  1L4D B;  1NI3 A;  2LHE A;  4XGA B;  2BB6 A;  1JML A;  1E8X A;  4OHJ A;  1N60 A;  2MBO A;  1IPG A;  1M94 A;  1E6E B;  2WXM A;  4PK1 A;  4LTU A;  1ZDX A;  1L6V A;  4OZB A;  3VDZ A;  4ZRJ A;  2LGY A;  1NEK B;  4FN2 A;  3ZJU A;  2KOX A;  2N1V A;  3ZYY X;  4A3P A;  1YX6 B;  2CJN A;  1WRI A;  1TS5 A;  1NVI D;  2KJ6 A;  3AEG B;  1V1P A;  4HPL B;  4M0W B;  2XK5 B;  4MEM A;  4JWS C;  2FUG 1;  3DBL B;  3BY4 B;  4GDL B;  1WXS A;  1SIF A;  2D3G A;  3RZF A;  4ASW C;  1L7Y A;  3QCA A;  2X38 A;  3TEW A;  2LMC A;  2KFK A;  1MG8 A;  4E3C A;  4IM2 A;  1CQV A;  2PMV A;  2DEN B;  3S2A A;  1I4G A;  1QZE A;  1BT0 A;  4O1N A;  2M19 A;  2REX A;  2N4F A;  1OEY A;  4GOC A;  1Z2M A;  3VUY A;  3FIL B;  3KQ4 A;  1XF5 L;  3WA0 A;  4C4V B;  3UQA A;  2EKE C;  2ZVN A;  4C7Z A;  4IOI E;  3UI3 A;  3PV1 A;  1SSN A;  3N1X C;  3VVW B;  2C7H A;  1FEH A;  2L76 A;  2IJ0 A;  4PS7 A;  1I42 A;  1STE A;  1EM7 A;  4HPM B;  3HK0 A;  3OG5 A;  2G4D B;  3UIP B;  5AZH A;  1DYQ A;  2SEB D;  5EE3 A;  4BBN F;  3ZDT A;  1SBB B;  4WIP A;  2DWQ A;  3O65 B;  3HUI A;  3PO0 A;  4AS1 A;  3RCZ A;  2G45 B;  4A3O A;  1PGA A;  1ZW7 A;  3GB1 A;  4ZYS A;  1GOZ A;  1NYQ A;  3APF A;  3SEB A;  2V3S A;  1YNT E;  3R8B A;  3IBE A;  4OVU A;  2Z59 B;  1VJK A;  2HDE A;  2CHW A;  1WMH B;  2WXP A;  2ZPN A;  3V61 A;  1WF9 A;  3BZD B;  3K9P B;  4JWU C;  2LXA A;  3TEX A;  3RD2 A;  1T3Q A;  1ZP0 B;  1SE9 A;  2J7Q B;  4M02 A;  4IM3 A;  3C19 A;  3IAS 1;  1E90 A;  2BS3 B;  3L4P A;  4XC2 A;  2V1Y A;  4CQN A;  3ZO5 B;  2KTR B;  4ZYN A;  1V2Y A;  3QWZ B;  3RPF C;  1TY0 A;  2ZCB A;  4K1R B;  2MP2 B;  1SE2 A;  5I4D A;  2KT7 A;  3ML9 A;  1ZKH A;  5G55 A;  1FMA D;  1WXQ A;  1UGM A;  2MX2 A;  1WX8 A;  2PW9 A;  4LJP B;  2NTT A;  3AU4 A;  2HE7 A;  4RF0 A;  1A5R A;  3ZNZ B;  3P4R B;  2DHZ A;  3MHZ A;  3UIN B;  1DOX A;  5G5H A;  5DPT A;  4XWT A;  3ZRF A;  2DAF A;  5CHW A;  3GZN I;  4RNA A;  3V05 A;  1TKE A;  5J2R A;  3TL5 A;  2BS4 B;  1N61 A;  3UGB B;  2WDQ B;  1J19 A;  1QOF A;  2LVQ A;  1WXV A;  4MSQ B;  3HM6 X;  3RN9 C;  1RAX A;  3PZ7 A;  2WP9 B;  4LDT D;  4TMA B;  3RI7 C;  3PSE B;  3RUL A;  3ZNH B;  1QOB A;  2GB1 A;  2JWU A;  1MPE A;  2WXF A;  4WJN A;  1KLV A;  3AEF B;  2IPK D;  3ZTC A;  3X23 A;  2I38 A;  2JU6 X;  2K22 A;  4ARC A;  1D5M C;  3H8H A;  2FIF A;  2GRI A;  1RWS A;  1E8Z A;  3N3K B;  4HXD A;  4EE2 A;  4II2 B;  3DHG C;  4PS8 A;  2LGS A;  2KD0 A;  1NEN B;  1WI0 A;  3EEC A;  4JQW C;  2HTM E;  3AMZ A;  4BKG A;  3AEB B;  2JT4 B;  1Q10 A;  3TSS A;  2N0S B;  2W3R A;  5J18 A;  2AL6 A;  5D7G A;  5D3I B;  2G1E A;  2ACZ B;  4OZC A;  3AE3 B;  3KUC B;  4XDC A;  1YN3 A;  4E74 A;  4WWM A;  2GOW A;  1IBX A;  1F2R I;  1YQB A;  1V1O A;  4W9C A;  1MG4 A;  1K50 A;  3HM3 A;  1WJU A;  4DBG A;  2MCN B;  3L54 A;  4NJC A;  2N7J A;  1V49 A;  3APC A;  2KX0 A;  3B1L X;  3KYC D;  2VH1 A;  1ZUD 2;  3HHM A;  2JF5 A;  3PHX B;  3RYT A;  4TQ0 A;  3DBL I;  4DHJ D;  2VH2 A;  4M01 A;  3RNF C;  2QDF A;  2MW5 A;  2QHO A;  4KDL B;  2L05 A;  1LFD A;  5JXV A;  4MSM B;  2RPQ A;  4K7W A;  1YN5 A;  2WGS A;  4P1C C;  1JWM D;  4MH0 E;  1N6Z A;  3DWG C;  2KVZ A;  2K1F A;  1EO6 A;  4EOY A;  1TTN A;  3H9D A;  4K3B A;  3U52 E;  2QEJ C;  4ZDV A;  3DVN V;  4P16 A;  1CJE A;  2ZPY A;  1WE7 A;  2L52 A;  1HE8 A;  4AP4 C;  4RGM A;  2KFJ A;  1N5X A;  1UUP A;  2EMS A;  2NPT B;  2N9L A;  4MGZ E;  2ZVO A;  2BGF A;  3MC8 A;  4PYZ A;  1WZ3 A;  2DLB A;  3QAQ A;  2E3T A;  1QF6 A;  2RMM A;  2ZCC A;  5D94 A;  2L1A A;  4I6L B;  3LDZ E;  4IWQ A;  2IND C;  3AEE B;  3RZW C;  4IWO A;  1XT9 B;  5FKA C;  3M63 B;  5AUK A;  4KGR A;  1EF1 A;  2LEK A;  2ZNV C;  4RGN A;  1X1M A;  1TIF A;  3APD A;  2N7E A;  1HTO A;  1WGD A;  3VH3 B;  3WAM A;  4IKG A;  2FCS A;  2GBM A;  2PIA A;  2R2Q A;  2DZI A;  4P1B C;  3MJW A;  5KHO A;  1JWU D;  1SJE D;  2QJL A;  3CWI A;  5E6P A;  2YLM A;  3N1Y C;  2WXQ A;  2Z8L A;  1GAQ B;  1XLO A;  3PS6 A;  2WXJ A;  1WFY A;  4BVU C;  1TS4 A;  4JLC A;  3IG3 A;  2FID A;  4WQM A;  3L10 B;  4EZK A;  2NTS A;  1ET9 A;  2BQQ A;  3SHQ A;  3JSV B;  1OQQ A;  2KDB A;  2RGF A;  3ABV B;  3A1Q A;  3E56 A;  3VUW A;  3Q14 C;  3IT6 B;  3L13 A;  4F1S A;  5FR3 A;  4GSW A;  1WYG A;  1J7B A;  2KLG A;  3A9J B;  3I9V 1;  1CMX B;  4OVZ A;  4WWN A;  1FRR A;  3ONS A;  4K7S A;  3CSF A;  2LGD A;  1WR1 A;  4YT0 B;  2AQ3 B;  3NZU A;  4GGQ A;  2KFK B;  4FXC A;  5IOI A;  3A4R A;  2JVC A;  2RPV A;  3ENE A;  4W9E A;  3PHW B;  3TBL D;  2H88 B;  3NJT A;  1YJI A;  1FO4 A;  4W9D A;  1GUA B;  4YXD B;  5L95 C;  1T0R C;  4KSL C;  4BAX A;  1VLB A;  3V62 A;  4RF1 A;  3WAN A;  3X0W A;  4KIK B;  3J9C A;  4USA A;  4NQK E;  2IO0 B;  3CIR B;  3AUL A;  1RFA A;  3ZJT A;  3Q3F A;  3HIZ A;  4LNF A;  3OJ4 B;  4K81 A;  4F8C B;  4LJO B;  3VR8 B;  4ANX A;  1LXD A;  1F77 A;  2WDV B;  4A20 A;  4JL9 A;  4FA6 A;  1L2N A;  2WXK A;  1J7C A;  4WWO A;  1WXA A;  4YTP B;  3ZUN A;  5AUI A;  1GC6 A;  1M4V A;  1WE6 A;  2IDY A;  1C4C A;  2V4I B;  3BIN A;  3MC0 B;  2DNF A;  3FC4 A;  5D3D A;  1ZE3 D;  5BO4 B;  4US9 A;  3EC8 A;  1ZXI A;  2KVR A;  2BT6 A;  3FKY A;  4YTM B;  1RM6 C;  3W1Y A;  3PZD A;  4B95 A;  2FCN A;  2D10 A;  2LGI A;  2B76 B;  4JIO U;  5HHD G;  1B1Z A;  3U30 A;  3K9O B;  4G0N B;  2MJE A;  2AX5 A;  4AWJ A;  3DBR B;  1KRH A;  5DCN A;  1HTQ A;  5HKH A;  4DWF A;  3PRP B;  4ITK A;  1I35 A;  3A9J A;  4B0E A;  2IY1 B;  3I63 C;  1SJH D;  1WIA A;  1AAR A;  2UWQ A;  3ZJV A;  4KIK A;  2KC1 A;  1JQ4 A;  2MSE D;  3URY A;  2NS5 A;  3PRZ A;  1GG3 A;  3N1Z C;  4AUQ C;  4AOF A;  1T5X D;  4ZRQ A;  1WWT A;  3RNC C;  1R4N I;  4L2Y A;  3UQB A;  3DOW A;  1DGJ A;  2K8B A;  3LYY A;  1SEB D;  4HLE A;  1E7P B;  4EKU A;  2MA9 B;  1KLG D;  3B2F A;  1N62 A;  4WH4 A;  5HI1 A;  3H7S A;  1K51 A;  3PGE A;  2BF8 B;  1ENF A;  2GBK A;  1SB3 C;  3TUO A;  1NDD A;  2IGH A;  4W9L A;  3JSV A;  1C76 A;  4URK A;  1UNS A;  2TSS A;  3AI5 A;  1HEZ E;  4BKS D;  3A4S C;  2LRU A;  5FK9 C;  4HDO A;  1WXM A;  4MAC A;  3VXW A;  3SFD B;  3PVL A;  3DQV A;  4LDT B;  4AJW A;  4HVB A;  3VFK A;  4GXB A;  2G3Q B;  2K6Q A;  2MBE A;  3T3N A;  1V9J A;  2K8H A;  2WX1 A;  1UGJ A;  2NPT A;  2BKF A;  1VCB A;  5FR6 A;  1HZ6 A;  4TSS A;  2HJ8 A;  1TZ1 A;  4HCP B;  4JE3 B;  2IBI B;  2JQR B;  1WGR A;  2FNJ B;  2LHD A;  5KHQ A;  1MVK A;  2PEA A;  1MI0 A;  3H6N A;  3U8Z A;  3VQI A;  1UD7 A;  4HRO A;  2KDM A;  2J42 A;  2L0F A;  4LNI A;  3MTN B;  1PDX A;  4RGO S;  1FCC C;  3OJ3 A;  2RD0 A;  3GP7 A;  3EGR A;  2J0J A;  1WJ6 A;  1PYW D;  4HKZ E;  2V9H A;  4A55 A;  1RFK A;  2KX3 A;  2AYO B;  1NBF C;  1VR9 A;  4DHZ E;  4ZRI A;  2DBY A;  1MFW A;  3MHS D;  1AW7 A;  4GN1 A;  2N9P C;  1UWX A;  3ZXR A;  5H92 C;  2KAC A;  3V6E B;  2DZJ A;  5E6O A;  4JGH B;  4KGT A;  2B3A A;  3Q2A C;  1IBX B;  2JX5 A;  3TIX A;  3U7Z A;  3PTF C;  4ZHP A;  4HPP A;  2CHZ A;  5HFY A;  1WX7 A;  3ZW3 A;  3GE3 C;  3KUD B;  3DVG X;  1YQ3 B;  1ZOY B;  2ZZP B;  4G3X B;  3NHE B;  3NS1 A;  3RNE C;  2V0G A;  3QHT A;  3RNA C;  3ZXV A;  2K25 A;  1VZ7 A;  3H1U A;  4GIV A;  2KN5 A;  4BFR A;  2FE8 A;  3BK1 A;  1I7H A;  1NYR A;  2CKH B;  2WLB A;  2KMC A;  2Z0D B;  1I4H A;  2V3P A;  4KDI C;  2I1J A;  1KF6 B;  1XCQ L;  3ZRC A;  3N30 A;  3W5U B;  4YSX B;  1OTR B;  5H8Y E;  1ZXH A;  1YIW A;  4FLH A;  2KQ7 A;  3PRE A;  2EMT A;  4TKN A;  2V4L A;  3NZS A;  5AEK B;  1E8W A;  1AN8 A;  1WGG A;  2QC8 A;  2KWD A;  2EKI A;  4YTN B;  1FD6 A;  4YWG G;  1YX5 B;  2MRP A;  5CTR C;  1V86 A;  2M1M A;  4N59 A;  4MT5 A;  4XWW A;  4IW0 A;  2OOB B;  2JPH A;  2KWU B;  1P98 A;  4W9I A;  3Q3N C;  3M95 A;  2LJ5 A;  1ZPS A;  1V1P B;  4LNK A;  3VHT C;  4EUT A;  4WAA A;  4P6V F;  2CU1 A;  3KYD D;  3ETR A;  2UYZ B;  3ZKJ C;  4S17 A;  1N5W A;  3QAR A;  2ICI A;  3DBH I;  5DPW A;  1LM8 B;  2QSD A;  4A90 A;  5C23 A;  1TY2 A;  2GBN A;  3V60 A;  5LLI A;  3WAP A;  4OZA A;  3QX1 A;  3Q8F A;  3UIO B;  3Q8B A;  4DDI D;  2WXH A;  2JRH A;  3KVF B;  3R66 C;  2UU7 A;  1WYW B;  1E10 A;  5BYR A;  2ZW1 A;  1T6B X;  1AWD A;  1OQY A;  2PVG C;  2BVC A;  2HJ1 A;  2L8J A;  4HDQ A;  2W3S A;  3DCG A;  3JYU A;  2KJR A;  3ECI A;  1S3S G;  3M62 B;  3P4S B;  3OWE B;  2YEP B;  2W82 A;  3QK0 A;  4W9F A;  4MEL A;  4A6Q A;  2K5P A;  2FCQ A;  5D6J B;  1KOT A;  1F2R C;  2OHF A;  4N9F 4;  2O6V D;  3JVZ X;  2J53 A;  2M0X A;  1C4A A;  4L23 A;  4W9K A;  2Y5P A;  2D5G A;  3PT2 B;  1SE3 A;  4GB9 A;  2WU5 B;  1DOY A;  3VTV A;  2MHJ A;  4NZL B;  3VRA B;  1H4R A;  2OED A;  2LJI A;  3L08 A;  2PPH A;  4HRS A;  4W9G A;  2I2Y A;  3NVW A;  2W54 A;  4C56 C;  1C77 A;  1TKG A;  4HEA 1;  1HQR D;  2FAZ A;  3Q6B A;  1P7E A;  1LGR A;  1V97 A;  2MBH A;  3NRZ A;  2NCN A;  2IY0 B;  3IHP C;  3BVZ A;  1SGH A;  4Q2J A;  3M3J A;  2IO2 B;  2L3Z A;  4CYE A;  3ZLZ A;  2E6X A;  4G11 A;  2KQ4 X;  1YMH E;  2HD5 B;  1R4M B;  4WWP A;  4DQO C;  1UWM A;  1BXT A;  2K0P A;  2KWV B;  3L17 A;  2WNM A;  2NBW B;  3BYT B;  1C4P A;  2WXI A;  2J0K A;  4XYC A;  1FCL A;  5LXI B;  3AU5 A;  1ISN A;  3AED B;  1OFF A;  2JYT A;  2PJH A;  4LLG M;  4EZL A;  1IUE A;  1D5Z C;  3PZ8 A;  1VRA B;  3H7P A;  3ZNI D;  2ZW0 A;  1H8C A;  2GBR A;  3SU8 X;  4IM0 A;  3U7D A;  1I4X A;  1LQB A;  4US8 A;  1TJE A;  1ROE A;  1UH6 A;  2H89 B;  2JWZ A;  1J0G A;  1VZ8 A;  2M4N A;  2CR5 A;  2WS3 B;  2D3B A;  5MPO A;  4IWP A;  2JZP A;  3B0A A;  5BMI A;  3KLS X;  1IP9 A;  3GOE A;  2WU2 B;  1FFU A;  3GS2 A;  3KH0 A;  1EWY C;  2KC2 A;  3GZN B;  4ARI A;  1WM2 A;  2KO3 A;  5BYQ A;  1IYF A;  2KMM A;  1F9J A;  2PTL A;  1QKZ A;  4GMV A;  4N58 A;  3AE8 B;  2WXN A;  4KVG B;  3EHV A;  2C7N B;  1ACC A;  4GLS C;  2LGX A;  2LUM A;  4HKQ A;  2XK5 A;  4KZC A;  1D3Z A;  5GXG B;  1XXG A;  2O6V B;  1U4A A;  4WAF A;  5DPS A;  4EZJ A;  3DBR I;  1RRB A;  2HTH A;  3QC8 B;  4CO7 A;  3AXC A;  3NOB A;  1P1A A;  3ZVV A;  2M0A A;  2IGG A;  4KKJ A;  4A9A A;  1IGC A;  5EDS A;  3MFG A;  3P4P B;  4YL8 A;  1V81 A;  2MWS B;  1PFD A;  1GC7 A;  2KTR A;  5EE0 A;  2I1K A;  2V3N A;  3PRM B;  3U4E G;  4K7U A;  4KKI A;  1V5T A;  2KLC A;  3ML8 A;  4XX5 A;  2ZEQ A;  4HJK A;  3W1S C;  3AEA B;  3AV8 A;  2AQ2 B;  4N6E B;  5JZE B;  5AZF A;  1WGY A;  5E6J A;  3NS8 A;  3MC9 A;  3B2G A;  2D2Q A;  3O13 A;  4HWI B;  2LD9 A;  1YJJ A;  3P4Q B;  3IT4 B;  1R7S A;  3KUZ A;  4XDD A;  2PKO A;  4MJS A;  2VZK D;  1Y8R C;  1OEY J;  1HZ5 A;  1SF0 A;  2M17 A;  4FJZ A;  1D5X C;  1ZDV A;  2A4Z A;  3C8Y A;  3A1Q B;  2GBJ A;  1WR6 E;  1QOA A;  2DAJ A;  5AZG A;  5BMG A;  2LRW A;  1FXI A;  4ZHO A;  1FFV A;  2RDH A;  3NUH B;  3R3M A;  3E9S A;  1YOV B;  1QT9 A;  5IN7 A;  3LB8 C;  1N63 A;  2JUO A;  3WCQ A;  2JXT A;  2BS2 B;  2OJW A;  4UDU C;  2BWF A;  1DOI A;  3FIL A;  2KWC A;  1XD3 B;  3U2S C;  2IO3 B;  5IA7 A;  1K52 A;  2KJH B;  4WUR A;  4IG7 B;  1E7V A;  3ZNG C;  1I4P A;  1WX9 A;  3SFE B;  2KZR A;  1R4N B;  3BWU D;  4GDK A;  3QA8 A;  3N9Y C;  4NJ6 A;  2D07 B;  2WDR B;  3TEY A;  1JCK B;  1ZGU B;  2C9W B;  5IO9 A;  2WX0 A;  1SIJ A;  3EFU A;  2KHW B;  2N1W A;  4IC7 B;  1BML C;  3RFZ B;  2XBB C;  1Q5W B;  2O2V B;  2LAS A;  4R3D A;  1E9M A;  1R4M I;  1WRD B;  3VTW A;  3ZTD A;  1C79 A;  5T8I A;  4PT5 A;  2N9K A;  1P9D U;  1SXT A;  2KDF B;  3VH4 B;  2N9E B;  1RYJ A;  3RNB C;  4XE0 A;  3Q3J A;  2KYW A;  3NG0 A;  2WXL A;  2XEW A;  4AQ7 A;  1VDV A;  3AH7 A;  2FCM A;  1L0Y B;  4YSZ B;  1GB1 A;  3IXS A;  2CS4 A;  1TKY A;  3NVZ A;  1WZ0 A;  4M8M A;  3P1M A;  4NQL B;  3Q8C A;  4OVV A;  2KK8 A;  4FJY A;  4TUU A;  2SAK A;  1JRO A;  1TYG B;  3DHH C;  2BKR B;  4JX1 C;  4IUM B;  2NVU I;  1JW9 D;  2J52 A;  1JRU A;  5L83 A;  4W9J A;  5C1Z A;  4LNO A;  2J0M A;  5J17 A;  1Q0W B;  3MP9 A;  1WMH A;  2C5L C;  1WM3 A;  1C9F A;  1E8Y A;  5TSS A;  3Q3O C;  1V6E A;  3TMP B;  4ZRK A;  1ESF A;  1GJZ A;  4DXG A;  5HG2 A;  2ON8 A;  4NY0 A; 
#chains in the Genus database with same CATH homology
 3ETR A;  2RDG A;  3AE2 B;  1J7A A;  1N5W A;  3AM9 A;  2ICI A;  3R2I A;  1TS3 A;  2BYT A;  2L1A A;  3NVV A;  2INP E;  1HA5 A;  2QSD A;  3AEE B;  4A90 A;  4NAW B;  4D2K A;  1TY2 A;  5FKA C;  1FNU A;  4KGS A;  5AUK A;  4KGR A;  2LEK A;  4RGN A;  2QIE B;  1PGX A;  1OQR A;  4B0M A;  4OZA A;  1B9R A;  3VRB B;  3Q8F A;  2XNA C;  3Q8B A;  2MJ3 A;  4IKG A;  2WXH A;  2K3U A;  2PIA A;  1E10 A;  1L6U A;  1EU3 A;  2CJO A;  2ZW1 A;  3EUB 2;  5BYR A;  1T6B X;  1AWD A;  1JWU D;  1SJE D;  2PVG C;  2R61 A;  2QJL A;  1GB4 A;  3CWI A;  2W3S A;  3HVD A;  4KX6 B;  2BBC A;  2JSV X;  2WXQ A;  3BVM A;  2MEK A;  2Z8L A;  4RFB A;  3W2D A;  1GAQ B;  1XLO A;  2JYE A;  1KFY B;  2WXJ A;  1TS4 A;  2QMT A;  1SE4 A;  3P4S B;  3OWE B;  2YEP B;  2W82 A;  4WQM A;  1L0X B;  2W55 A;  2NTS A;  1ET9 A;  3BK2 A;  4A6Q A;  1FNW A;  2K5P A;  2WXO A;  1A70 A;  1OQQ A;  3ABV B;  1F2R C;  1L4D B;  2OHF A;  1NI3 A;  2LHE A;  2J53 A;  2BB6 A;  1C4A A;  1JML A;  3E56 A;  1JWS D;  4L23 A;  3IT6 B;  2Y5C A;  2INN E;  2Y5P A;  4OHJ A;  3AE7 B;  2D5G A;  1N60 A;  5FR3 A;  1E6E B;  1SE3 A;  1WYG A;  3NZ3 A;  2WXM A;  1I4R A;  1J7B A;  1V8C A;  2E3T A;  4LTU A;  3I9V 1;  1Y56 A;  2WU5 B;  4OVZ A;  5BYS A;  1DOY A;  1ZDX A;  1FRR A;  4NZL B;  4YT0 B;  2AQ3 B;  3VRA B;  1QLB B;  1L6V A;  4TQ1 A;  1QQR A;  4FXC A;  4OZB A;  2BTE A;  4M0W A;  1NEK B;  2XN9 C;  2OED A;  2RPV A;  3MJ5 A;  3ZJU A;  2LJI A;  2H88 B;  1YJI A;  4HRS A;  1FO4 A;  2I2Y A;  4YXD B;  3NVW A;  2W54 A;  3ZYY X;  4C56 C;  5EE9 A;  1C77 A;  1XLN A;  1TKG A;  2CJN A;  1P7F A;  1WRI A;  5C2T B;  3AE5 B;  4HEA 1;  5BMH A;  1VLB A;  1HQR D;  1BUI C;  1TS5 A;  1NVI D;  2CU3 A;  4RF1 A;  4ZOH C;  1P7E A;  1XLP A;  1V97 A;  1I4Q A;  1L0V B;  3AEG B;  1V1P A;  3NRZ A;  3BVZ A;  3J9C A;  4Q2J A;  1EU4 A;  4JWS C;  4USA A;  2FUG 1;  1CK1 A;  4GDL B;  1MHH E;  2E6X A;  3CIR B;  2Q5W D;  2X38 A;  3TEW A;  3ZJT A;  2FBW B;  2KQ4 X;  1YMH E;  2LMC A;  4C7Y A;  3T3O A;  4A8X C;  4DQO C;  1CQV A;  2PMV A;  3ZGZ A;  1UWM A;  3VR8 B;  1BXT A;  2K0P A;  1F77 A;  2WDV B;  2WNM A;  1I4G A;  3BYT B;  1C4P A;  1TZO A;  2WXI A;  4J3O D;  1FCL A;  4O1N A;  2M19 A;  1F0Z A;  3AED B;  2AQ1 B;  1OFF A;  2JYT A;  3NVY A;  4LLG M;  1FNV A;  2Y3A A;  3FIL B;  3KQ4 A;  2WXK A;  1J7C A;  1XF5 L;  4RGT A;  1IUE A;  4YTP B;  3Q8E A;  5AUI A;  1M4V A;  2IDY A;  2WXR A;  1D5Z C;  1C4C A;  4C7Z A;  4IOI E;  1VRA B;  2V4I B;  1SSN A;  3PZ8 A;  3UI3 A;  2ZW0 A;  3MC0 B;  5HG2 A;  1I4X A;  4US8 A;  3AN1 A;  1TJE A;  1FEH A;  3FC4 A;  1ROE A;  2H89 B;  2IJ0 A;  1ZE3 D;  5D3D A;  4US9 A;  1STE A;  1EM7 A;  1ZXI A;  1VZ8 A;  4YSY B;  2BT6 A;  2WS3 B;  4YTM B;  3AE6 B;  1RM6 C;  2LFI A;  1XO3 A;  1QOG A;  5MPO A;  3AB5 A;  2JZP A;  5BMI A;  1LO5 D;  3KLS X;  2LGI A;  1DYQ A;  2B76 B;  2MH7 A;  2WU2 B;  1FFU A;  5HHD G;  2SEB D;  1B1Z A;  3GS2 A;  5EE3 A;  1EWY C;  1SBB B;  4ARI A;  4WIP A;  2DWQ A;  1D4B A;  2MJE A;  2AX5 A;  5BYQ A;  3HUI A;  1KRH A;  1KLU D;  2KMM A;  2PTL A;  3PO0 A;  4AS1 A;  3KWV A;  4ITK A;  1PGA A;  1PUT A;  3AE4 B;  1QKZ A;  4B0E A;  3GB1 A;  4N58 A;  1GOZ A;  3BVG A;  4ZYS A;  1SJH D;  3AE8 B;  2WXN A;  1ACC A;  4REZ A;  4GLS C;  1NYQ A;  2M56 B;  2K9X A;  4OW0 A;  1KTK A;  2LUM A;  4MM3 B;  4HKQ A;  4H2A A;  4JPS A;  3ZJV A;  2PVO D;  3SEB A;  1YNT E;  3R8B A;  5GXG B;  2VZK B;  1XXG A;  3IAM 1;  1JQ4 A;  4NAM A;  2MJD A;  3URY A;  3Q8A A;  4WAF A;  1VJK A;  1T5X D;  4ZRQ A;  1WWT A;  2KN4 A;  2HDE A;  1EWC A;  1WSP A;  2WXP A;  4L2Y A;  2M0A A;  4IDI A;  1DGJ A;  3BII D;  2IGG A;  3LYY A;  4KKJ A;  2ONQ A;  4A9A A;  1SEB D;  3BZD B;  4JWU C;  3TEX A;  1IGC A;  1E7P B;  1T3Q A;  1ZP0 B;  3MFG A;  3P4P B;  3IAS 1;  2BS3 B;  3L4P A;  1KLG D;  1FIQ A;  1PFD A;  1PGB A;  5C3J B;  3W5V B;  3B2F A;  4CQN A;  3B9J A;  1N62 A;  4WH4 A;  5HI1 A;  1QF6 A;  1HXY D;  3RPF C;  1TY0 A;  3I57 A;  1K51 A;  1ET6 A;  2J4X A;  2V3N A;  1ENF A;  4L1B A;  5EE0 A;  3U4E G;  3P63 A;  1SB3 C;  2NMQ A;  1SE2 A;  4KKI A;  5I4D A;  3TUO A;  2IGH A;  3HRD D;  1QIL A;  5EE1 A;  1C76 A;  1FRD A;  3AEA B;  3AV8 A;  1FMA D;  2AQ2 B;  1UNS A;  1WXQ A;  5G5G A;  3ZQ4 A;  3EA6 A;  4N6E B;  1WGK A;  1FM0 D;  2TSS A;  2PW9 A;  1HEZ E;  2NTT A;  5FK9 C;  4MAC A;  1GPX A;  3SFD B;  4RF0 A;  3P4R B;  5E6J A;  3MHZ A;  1DOX A;  5G5H A;  3B2G A;  4XWT A;  5LNK 1;  3T3N A;  3O13 A;  1C78 A;  1UGJ A;  1YJJ A;  3P4Q B;  3AE9 B;  3IT4 B;  4RNA A;  1R7S A;  2L83 A;  1HZ6 A;  3AE1 B;  4TSS A;  4JE3 B;  3V05 A;  1TKE A;  4XDD A;  2JQR B;  2PKO A;  2BS4 B;  1N61 A;  2LHD A;  1MVK A;  1MI0 A;  2VZK D;  2WDQ B;  3VQI A;  1QOF A;  4MH8 A;  4HRO A;  2KDM A;  2BW2 A;  2J42 A;  1HZ5 A;  3DWM A;  3VR9 B;  1SF0 A;  3W1S A;  1D5X C;  1ZDV A;  3PZ7 A;  2WP9 B;  1PDX A;  3C8Y A;  4RGO S;  4TMA B;  1L4Z B;  1JRP A;  1FCC C;  3SR6 A;  2PLP A;  1QOB A;  1QOA A;  3GP7 A;  5BMG A;  2GB1 A;  3EGR A;  2JWU A;  1MPE A;  2YEP F;  2WXF A;  1FXI A;  4ZHO A;  1FFV A;  4LK0 M;  1PYW D;  3AEF B;  1TS2 A;  4HKZ E;  2BB5 A;  2IPK D;  2RDH A;  4A55 A;  1RFK A;  3NUH B;  3E9S A;  2I38 A;  2JU6 X;  2K22 A;  1E0Z A;  4ARC A;  1QT9 A;  1D5M C;  3H8H A;  3LB8 C;  1N63 A;  2GRI A;  1RWS A;  3WCQ A;  2JXT A;  1VR9 A;  2BS2 B;  1VZ6 A;  4UDU C;  3FIL A;  1DOI A;  2DBY A;  4EE2 A;  1XLQ A;  3U2S C;  1AW7 A;  1K52 A;  2GI9 A;  4WUR A;  3TEZ A;  1UWX A;  1NEN B;  1I4P A;  5H92 C;  2HTM E;  3AMZ A;  3SFE B;  2KAC A;  3AEB B;  3P42 A;  3BWU D;  4KGT A;  3N9Y C;  3V3X A;  1IBX B;  1Q10 A;  2JX5 A;  3TSS A;  2DYM A;  3U7Z A;  2N0S B;  2W3R A;  3FAH A;  2WDR B;  4ZHP A;  3TEY A;  1JCK B;  5D7G A;  4C80 A;  3R2T A;  5D3I B;  2G1E A;  2ACZ B;  4OZC A;  5HFY A;  1SIJ A;  3AE3 B;  4XDC A;  1YN3 A;  4WWM A;  1YQ3 B;  1BML C;  1ZOY B;  1IBX A;  3RFZ B;  1F2R I;  1AYF A;  4GDK B;  1V1O A;  3NS1 A;  2QIL A;  1K50 A;  2V0G A;  4R3D A;  1E9M A;  1VZ7 A;  1XEE A;  3HVZ A;  2N7J A;  4NJC A;  1C79 A;  3W9C B;  1K53 A;  3BYY B;  5T8I A;  4PT5 A;  4RH6 A;  1ZUD 2;  2N9K A;  1SXT A;  4ZRP A;  2FE8 A;  4TQ0 A;  3BK1 A;  1I7H A;  1NYR A;  1RYJ A;  2G9H D;  4XE0 A;  2WLB A;  2WXL A;  4AQ7 A;  2WQY B;  1YQ4 B;  1I4H A;  1VDV A;  3AH7 A;  2V3P A;  2L32 A;  1KF6 B;  1L0Y B;  4DXF A;  1XCQ L;  5JXV A;  4YSZ B;  1GB1 A;  3IXS A;  3W5U B;  1TKY A;  4YSX B;  3NVZ A;  1IGD A;  1YN5 A;  1JAL A;  3LXF A;  1MHX A;  5H8Y E;  3P1M A;  1ZXH A;  4HJG E;  3Q8C A;  1JWM D;  2SAK A;  1JRO A;  2WXG A;  1TYG B;  3Q69 A;  3DWG C;  4JX1 C;  2KAJ A;  3AEC B;  1JW9 D;  1JWB D;  2J52 A;  1KH0 A;  1AN8 A;  3U52 E;  2QEJ C;  1FXA A;  2KWD A;  4P16 A;  2IGD A;  2EEL A;  2EKI A;  1CJE A;  4YTN B;  2L52 A;  1FD6 A;  4YWG G;  4RCO A;  4RGM A;  2DYO A;  3MP9 A;  1N5X A;  1C9F A;  4N59 A;  4MT5 A;  4XWW A;  1UUP A;  1L5P A;  3KWL A;  5TSS A;  2N9L A;  1ZPS A;  1V1P B;  1CZP A;  1ESF A;  1D6E C;  1JWA D;  2DLB A;  1XCT L;  4DXG A;  4P6V F;  1YN4 A;  2ON8 A;  2RMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...