4ZHOA

The crystal structure of arabidopsis ferredoxin 2 with 2fe-2s cluster
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
97
structure length
97
Chain Sequence
ATYKVKFITPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEAIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the bacterial plant-ferredoxin receptor FusA.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Electron transport
molecule keywords Ferredoxin-2, chloroplastic
total genus 24
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zhoA00
2JQRB 3AEGB 3AE9B 1VDVA 2WDQB 2HTME 1NYQA 1N63A 3VRBB 3NVZA 1JW9D 4HRSA 2W3SA 1WGKA 1FXIA 2DWQA 4YXDB 1TJEA 2FBWB 1N61A 2BS3B 1XO3A 3P4QB 4ZHOA 2H88B 4YSYB 1RYJA 4IDIA 1PFDA 2Y5CA 3EUB2 5EE1A 1JQ4A 4US8A 1YQ3B 2MJEA 1E6EB 2BT6A 1TKGA 3P4PB 2B76B 3L4PA 2WLBA 1N5XA 3VR8B 5AUKA 4JX1C 2K9XA 1E10A 3NRZA 1EWYC 4C7YA 1KRHA 3AEEB 5H8YE 4C80A 1YJIA 4LTUA 2K22A 1NENB 1ZP0B 2L52A 1XLNA 2M19A 2N0SB 2KAJA 3NS1A 2ACZB 4YT0B 1DOYA 3WCQA 1F0ZA 3B2FA 4US9A 3W5UB 4ZHPA 1IUEA 1NVID 2OHFA 5EE0A 1JWBD 1FXAA 1QLBB 5MPOA 3AN1A 2WU2B 3HVZA 1NYRA 4ZOHC 3AB5A 3BIID 2AX5A 3ETRA 1PUTA 3DWMA 4YTPB 1FO4A 4C7ZA 2BS2B 1JWAD 1SIJA 1OQRA 1QT9A 5GXGB 3ABVB 1DOIA 1E0ZA 3B2GA 1N5WA 1TKEA 3AEAB 3HRDD 2PKOA 3AEBB 1XLOA 4YTMB 1L0VB 2CJOA 2LEKA 2WDRB 2WP9B 3AE5B 4FXCA 3HUIA 4WWMA 5G5HA 1FMAD 3B9JA 4WQMA 3AE4B 1ROEA 2L83A 3SFEB 3DWGC 1AWDA 1FFUA 1OFFA 2QJLA 1RWSA 1WWTA 3AEFB 4ITKA 3AECB 1FRDA 4N59A 1R7SA 1T3QA 1FFVA 3SFDB 3P4RB 1A70A 1L6VA 3RPFC 3CWIA 3AE2B 4JWUC 2K5PA 3KWLA 3AE1B 2WDVB 1QOGA 3PO0A 3VRAB 1QF6A 1GPXA 1QOAA 3AE6B 4YTNB 2CU3A 2EKIA 3AE8B 5C3JB 1I7HA 2H89B 5EE3A 2PIAA 2MJDA 1QOFA 1N62A 2CJNA 3P4SB 5EE9A 3FAHA 2PVOD 2KMMA 3AEDB 1E7PB 2WU5B 4P6VF 3ZYYX 3LB8C 1KFYB 3AMZA 3AV8A 1JROA 5H92C 2MJ3A 4HROA 1YQ4B 3NVYA 1FRRA 4KX6B 1J7AA 3AE3B 3P1MA 5AUIA 1JALA 1ZXIA 1J7BA 1WYGA 3W9CB 1J7CA 1SF0A 1WRIA 3FC4A 3NVVA 4N58A 3VR9B 1B9RA 2DBYA 3AH7A 1UWMA 1QOBA 1AYFA 2PVGC 1RM6C 2Q5WD 5G5GA 2QIEB 1PDXA 1ZOYB 4N6EB 1V8CA 2M56B 1TKYA 3W5VB 2WS3B 1L5PA 1XLPA 2BS4B 4YSXB 1CZPA 3NVWA 2WQYB 1SB3C 1VJKA 1NI3A 1TYGB 1YJJA 4JWSC 3LXFA 1CJEA 1XLQA 1E9MA 3CIRB 2JX5A 1JRPA 1ZUD2 2W54A 1FM0D 1FIQA 1OQQA 1RFKA 1V97A 3AE7B 3SR6A 1GAQB 3AM9A 1WXQA 1N60A 2E3TA 1KF6B 2MH7A 4USAA 4A9AA 2W55A 4YSZB 3P63A 1DGJA 2G1EA 1DOXA 2W3RA 1L6UA 1VLBA 5C2TB 1NEKB
chains in the Genus database with same CATH superfamily
2WDQB 3PHWB 1NYQA 1M94A 4G0NB 5DCNA 1TJEA 4MGIE 2JXTA 3I5JC 5T8IA 1WX9A 1IBXB 4FJYA 2Y5CA 3EUB2 1L0XB 1YQ3B 2RR9A 2FCMA 4HKQA 3I3TB 2NBUA 3A4RA 1UNSA 2AYOB 1Q10A 4JIOU 4EZLA 1HEZE 2PTLA 2LJ5A 3AB5A 2J7QB 4IWPA 1C76A 2V0GA 3OJ4B 1E0ZA 1JWMD 1HTOA 1XLOA 3QA8A 3NUHB 1HE8A 2BKRB 3WAMA 1QKZA 5BO4B 3CSFA 1FFUA 3PV1A 1WR1A 3AEFB 1FRDA 3CWIA 3KWLA 1QF6A 1UBQA 2WNMA 3FILB 3A9KB 4E74A 2N1VA 2BYTA 1KFYB 4IW0A 1KJTA 2J4XA 4NAMA 4MJSA 3O13A 4EE2A 3DBHI 5JXVA 2L00B 3AH7A 1UWMA 2EELA 1EF1A 4TQ1A 1P7EA 1L4DB 1Q5WB 3APCA 2JZ3B 2KFKB 4CYEA 3MC8A 4S17A 4MGZE 2LFIA 3DVGY 2N4FA 1I4GA 4IWQA 4EZKA 1PQSA 4NQKE 4TV3A 3C19A 2C9WB 4REZA 3RULA 1FM0D 3UQAA 2QSDA 1EWCA 2KJ6A 2E6XA 1MI0A 3HHMA 2JWZA 3DVNV 4WQOB 2JQRB 4FHJA 2L32A 2HTME 1WH3A 5IO9A 3Q69A 4AJYB 2FBWB 4W9HA 4OW0A 1I4RA 4US8A 5L95C 2OOBB 1KTKA 3H8HA 4MDKE 3KVFB 3A33B 1PYWD 1I4PA 2M19A 2C60A 4BOSC 4BKSA 2IGHA 1V1PB 3U8ZA 4RM9A 1FO4A 5TSSA 1SIJA 1DOIA 3ZRFA 3EC8A 1T0QC 3AEBB 3FKYA 4YTMB 4NAWA 3U4EG 3VQIA 4DXGA 3Q8FA 2K8HA 2NCNA 1QOGA 4IC7B 3ECIA 1SE4A 1MG4A 3Q8EA 1N62A 4MSMB 3LDZE 4ARCA 3OWEB 1YQ4B 4RGNA 2EMSA 3V3XA 1Y8RC 1WM3A 1WJUA 3NVVA 3MTNB 1QOBA 1T0RC 4W9JA 3M62B 1RM6C 3DHIC 2J42A 3ZTDA 2KJHB 2K8CA 3X0WA 3BVMA 4W9EA 2M56B 2N9XA 4DQOC 3VFKA 4DDID 1CZPA 4GN1A 1KLGD 4P1CC 1YJJA 4QAYA 3Q3NC 5IAAC 2BF8B 1JRPA 5CX3A 2IPKD 2XK5B 4GGQA 4TMAB 4MJSB 4EZJA 3T3OA 5LNK1 2W82A 1WXSA 5GMVA 4HVBA 2N1WA 2KTFA 1H4RA 2WGSA 4KSKC 1XCQL 1N61A 2WXOA 1ZXHA 2XNAC 3W2DA 4RFBA 2KT7A 4MH0E 5J2RA 4JX1C 3U52E 3L0WB 4NJ6A 1UGMA 1YQBA 5H8YE 1WGYA 2K22A 1MG8A 1MFWA 3WCQA 4BKTA 3H7PA 3GZNB 3IT6B 3PRPB 2G4DB 2RDHA 2O6VD 3ZXVA 3BIID 4DXAB 1JWAD 2D3CA 3VXWA 1V9JA 3T9LA 2KHWB 1PGBA 2D11A 1VRAB 4ANVA 1LQBA 3EFUA 3Q8AA 4MM3B 1JRUA 1SE3A 3SFDB 2LI5A 3N3KB 2XEWA 3P4RB 5CHWA 3E56A 3RN9C 2EKIA 5AZGA 2AEHA 1I7HA 4M0WA 1VZ8A 3M95A 2CJNA 4XGAB 5BMGA 2LRUA 4P6VF 4FN2A 3A9JA 2HTHA 2RD0A 2ZJDA 3L13A 2HJ8A 3PHXB 1B9RA 3KUCB 3W1SC 1B1ZA 4BZAA 3ZDMC 2IDYA 4RGTA 2JU6X 1WMHB 2A5UA 1V8CA 2DZIA 3QWZB 3NZSA 2PE6B 2IJ0A 3SU8X 3SDLC 1IGCA 4JGHB 3W1YA 3OLMD 2IZVB 1TS2A 2NPTB 1Z5SB 3AE7B 3NZUA 4IM3A 1IGDA 4LJPB 4BVUC 2PE9A 5BYSA 5C2TB 3PZDA 1VDVA 3RUIB 3QJZA 4XDDA 4HRSA 2VZKD 4LK0M 3ZGZA 3AULA 4M0WB 2LHEA 3KH0A 3ZJVA 3H9DA 2MCNB 1I35A 3SD5A 1XO3A 3T3NA 3EECA 2IO2B 3RNAC 4LDTB 1TS3A 1S3SG 1X1MA 3SHQA 1KRHA 3PTFC 1YJIA 2I1KA 2KAJA 3B2FA 3A1QA 3W5UB 2N7DA 3V61A 2D3GA 3AN1A 1NYRA 3QC8B 3HVDA 3A1QB 3VDZA 1XQQA 1ZKHA 3Q8CA 3TBLD 4HJGE 2CR5A 2KDMA 4WH4A 5L83A 4XDCA 2JUOA 5J17A 1YX5B 5BMIA 1UELA 3VRAB 1NDDA 1QOAA 4EOYA 1GNUA 3EA6A 1FD6A 1FXTB 2G4SA 4CHKA 1F2RI 3PZ8A 2MBOA 1JROA 5IKCM 3BVGA 3URYA 1JALA 2CS4A 3W9CB 1XD3B 3ZRCA 3FC4A 2RPQA 2PLPA 4KKJA 2Y3AA 2JYTA 2DAFA 2HDEA 4BAXA 1GG3A 4ZRKA 3SEBA 2WS3B 1J8CA 4MSQB 4RMAA 1OTRB 2FAZA 1VJKA 1LO5D 2MA9B 1CJEA 3AI5A 2LMCA 1SEBD 4KZCA 1GAQB 4F1SA 1KF6B 3H7SA 2C7MB 4BOZB 2G1EA 4G3XB 2LVOA 4J6IA 4OZCA 3M3JA 3R66C 2NBVB 3NVZA 4GMVA 1C3TA 3BYTB 1FXIA 1TBEA 3IT4B 3ZJUA 3B0AA 4GXBA 1I4XA 1YN4A 1GOZA 4DXFA 2LD9A 3ZW3A 4FJVB 1N5XA 2QC8A 1C4CA 2KTRA 4EUTA 2WXKA 3GZNI 3U2SC 5LXHA 3JSVA 4II2B 1FCLA 1IUEA 4I6NB 2KLGA 5MPOA 3DVGX 5GXGB 3JYUA 4GU2A 5LLIA 2KWUB 2KJRA 5C23A 3HUIA 1SJHD 3ZXRA 1WGDA 2WXGA 1L6VA 4ANUA 2DZKA 3HM6X 1ET6A 1EU3A 2CU3A 4IWOA 1ACCA 3QAQA 4W9CA 2KVZA 3P4SB 4HPMB 3DHGC 2PVOD 2AQ1B 1KLVA 2D3BA 2GBRA 2V4LA 4PYZA 3RZWC 4RH6A 2DX5B 5BYRA 1KH0A 2N7EA 2GMIC 4XX5A 2N9EB 2VRRB 1JWUD 4HLEA 4LLGM 3P2BA 4YSXB 4WJQA 4A90A 2GLSA 1I42A 3QCAA 4P7IA 4HPPA 5IA7A 3ZVVA 2G9HD 3CIRB 1K51A 1QILA 4M8NA 3RNCC 4ICUA 3APDA 5DPWA 4PK1A 3AE6B 1L6UA 2WYQA 1NEKB 2WXQA 3RT3B 2MBHA 3VRBB 2KNBA 1WR6E 2Z0EB 4II3B 2V3PA 2J0MA 1CK1A 2BS3B 4YSYB 3PVLA 3RCZA 5D94A 3MJ5A 3S2AA 2WXNA 1WYWB 3IG3A 3L4PA 3RYTA 3VH4B 3N20C 4YL8A 4ZRPA 3Q3JA 2NPTA 1F1HA 5FKAC 2KOXA 2WDTB 2OHFA 2L05A 4W9DA 4K3BA 2KDBA 3DPDA 2NTSA 1C77A 1EU4A 5AEKB 1TZ1A 2VH2A 2MBBB 2ZNVC 4K1RB 3GP7A 4PS7A 2K6DB 4OVUA 1BMLC 4C4VA 1WX8A 3APFA 4K7SA 3PREA 2DLBA 4MH8A 4GB9A 3K9OB 4JWUC 5TR5A 2WDVB 4DHZB 1GPXA 2WXIA 4YTNB 1NI2A 4PT5A 2JT4B 3AMZA 2C7HA 4DHJB 1FRRA 5AZFA 1J7AA 4WAFA 2VZKB 2OJRA 1P3QU 2N9PC 3W1SA 3V60A 4WWPA 2FNJB 4LJOB 2WX1A 1TKYA 1LGRA 1WZ3A 1ISNA 2IBIB 1L5PA 2V3NA 4HWIB 4JQWC 4L23A 4WJOA 1E5WA 1WX7A 1E9MA 1M4VA 1GUAB 4IG7B 4PS8A 4USAA 4KVGB 2ZZPB 2L7RA 1TS4A 4AS1A 1DOXA 2ZPYA 1DYQA 3NG0A 1RLFA 4FJZA 4YWGG 2L1AA 3P42A 2ICIA 4YXDB 3L54A 4BBNF 3U7DA 1ZPSA 3V62A 5AUKA 1KM7A 1E10A 4KIKB 4W9GA 1P1AA 2ON8A 1SIFA 2KWCA 1GJZA 2AL6A 2KN5A 2MHJA 3QARA 2NTTA 1FXAA 3BK2A 2BTEA 3PRZA 2AX5A 4PS3A 3UQBA 2BS2B 2LGYA 4MELA 2PMVA 2SEBD 1SGHA 4FADA 4FXCA 2CJOA 1MHXA 1FMAD 3ZKJC 4KIKA 4RGOS 1FFVA 2Y5BB 4AP4C 1T5XD 5J18A 4A8XC 2KO3A 1NBFC 2L3ZA 5JHAA 2WX0A 4OVVA 4W9LA 3DHHC 2MJDA 3TL5A 2INPE 3FAHA 2N7JA 3VUYA 1KOTA 5G2NA 4HDOA 2JY6A 5E6JA 3Q14C 1J7CA 3BK1A 2MP2A 3DOWA 3RZFA 4OZBA 1SSNA 2RPVA 2V3SA 1JMLA 5KHQA 1L7YA 2LHDA 2V4IB 3Q3MC 4TQ0A 1F52A 4S0RA 1ZDXA 3ALBA 1XLQA 4XYCA 3CF6E 1G6JA 2KYWA 1WFYA 2WXLA 3QQ8B 3HM3A 1N60A 3WALA 4MEMA 4HXDA 5DPTA 3N30A 3N1YC 4DHJD 2BT6A 2QHOA 2B76B 3AU4A 2WLBA 2REXA 3KQ4A 3AEEB 3ML8A 1V1OA 2FUHB 2MRPA 3VAWA 2KX3A 2NS5A 3AXCA 3GE3C 2LUEA 3EHVA 3NJTA 3ETRA 2WWZA 1V86A 1QT9A 5IN7A 2KX0A 3KYCD 1N5WA 3HRDD 1YJ1A 1L0VB 2KDEB 4GIVA 1EO6A 3BWUD 1WIAA 4WQMA 1MPEA 4RF0A 3HIZA 1GB4A 5HG2A 3L10B 4XZ4A 2IO3B 4ANWA 3VHTC 2KKCA 2D2QA 2CHXA 3FILA 4KGSA 3VH3B 2YVCA 1E7PB 1WRDB 1XXGA 3AV8A 5CHFA 2XK5A 1D5MC 4B6WA 2C5LC 4KX6B 4KKIA 3L08A 3NS8A 1ZXIA 3WA0A 4A55A 1E8ZA 5DPRA 2A4ZA 1LXDA 1YD8U 2WXHA 2QCZA 2GBNA 2K0PA 2BS4B 1XLPA 4ZRJA 2KMAA 4DK5A 1NI3A 2BGFA 2RDGA 3PS6A 4JWSC 4LNNA 1V97A 3SR6A 2JWUA 3RNFC 1V49A 4WIPA 4NY0A 1IBXA 3IAS1 3P4QB 4JPSA 3TSSA 5D6JB 4M02A 4TUUA 2BWES 4DBGA 2LVQA 4B9KA 1E6EB 2HJ1A 4JL9A 2KD0A 3I9V1 5EDSA 3CSTA 4N9F4 1I4HA 2QILA 1EWYC 3EFCA 3ZNGC 2K6QA 2UU7A 1PGAA 3NS1A 2L52A 4R3DA 4NJ7A 3WIMA 1EUVB 3RNEC 5FK9C 5BYQA 3OG5A 3Q3FA 2WXFA 1RAXA 2LGIA 2GBJA 3ZIMA 3UF8A 1WXMA 3Q2AC 2M1MA 3AE4B 2L83A 3NZ3A 1AWDA 1OFFA 2L8JA 2WXMA 3L16A 4ZDVA 5C3JB 2Z8LA 2KXJA 5JHBA 4B0EA 3TEWA 2WU5B 1P9DU 3ZJTA 1OEYA 4EEWA 3CMMB 3VTVA 4N58A 2FIFA 3B08A 3T8MA 4LNIA 4AQ7A 2D10A 3W5VB 1R4NB 1V1PA 1UH6A 3NVWA 3UINB 2NR2A 1WM2A 1YN3A 1C1YB 3DDCB 1N6ZA 1FIQA 2OJWA 4IM0A 2I38A 4KSLC 4YSZB 2ONQA 4NNJB 1C78A 4RNAA 4NJCA 3UIOB 3Q6BA 3A9KA 2BYVE 1V5TA 2KZRA 1WY8A 1E90A 1PFDA 2J52A 5IOIA 4NZLB 5HI1A 1VR9A 3TEYA 2K9XA 4J3OD 4GDLA 2M17A 1GB1A 2PPHA 1K50A 1R4MB 1V80A 3R2TA 1L2NA 4LTUA 4LNOA 2M4NA 2ACZB 2MSED 1NVID 1T0SC 2UYZB 3PRMB 3ABVB 2GBKA 1RFAA 2J0KA 4HPLB 2WDRB 1F9JA 3ZQ4A 5IP4D 5D3DA 1T6BX 1ROEA 3LJ3A 2I2YA 3DWGC 1RWSA 2IY1B 1TGZB 3M63B 3MJWA 4WJNA 4XWWA 2ASQA 3RPFC 1FCCC 3PO0A 3GB1A 1V6EA 4OVZA 4FHKA 4OHJA 5JZEB 3AE8B 2JYEA 5EE3A 2M8SA 3UI3A 5EE9A 4I6PA 1JWSD 5D7GA 2YEPB 4XC2A 4MACA 1K52A 2MJ3A 3GE8C 2Z59B 2B3AA 2JXXA 4ZRQA 1V81A 2FCSA 2O6VA 4KGRA 1SBBB 4IOIE 4RM8A 3IFWB 1WE6A 4GDKA 4L1BA 1ENFA 4AWJA 3QK0A 3R8BA 4ZYSA 2EMTA 2JX5A 3EGRA 2QMTA 2OEDA 5HHDG 2W55A 1E7UA 1XEEA 1LM8B 4ICVA 5HFYA 2LWPA 1WGKA 3KLSX 4HJKA 3TMPB 1TIFA 3ML9A 4FBJB 1RYJA 2R2QA 3GS2A 1D3ZA 1P7FA 3ZO5B 1YMHE 5LXIB 5C1ZA 4HKZE 4L2YA 1JWBD 1ZE3D 4GDKB 2WU2B 2V9HA 4WURA 1FPYA 2YEPF 3AEAB 1TKEA 2KWDA 2PKOA 2WP9B 3QHTA 5G5HA 1WSPA 2QDFA 3DBLI 3RD2A 1WWTA 4HCPB 2JSVX 3AECB 2KDIA 3H6NA 3MC0B 2IGGA 3AE1B 3C8YA 2H89B 1QOFA 1WF9A 3PPAA 4GLSC 1IP9A 4C56C 3QIJA 3ZYYX 1HZ6A 1WZ0A 2BB6A 4LNKA 4HROA 3D32A 2IY0B 1WGHA 3NVYA 4D2KA 3VUXA 2WHIA 4FLHA 1D5XC 2INNE 2KVRA 4PYUA 1SF0A 4ASWC 3ZNID 4W9IA 4B95A 2DZJA 1K8RB 2CHZA 5CTRC 3E9SA 1GC7A 4NQLB 3QX1A 3BY4B 4XWTA 4B0MA 3AM9A 2K3UA 2MWSB 4A9AA 3RNBC 3IBEA 2C7NB 1E7VA 1VLBA 1XT9B 1F77A 3AEGB 2LXAA 4ZRIA 3TJPA 2KC1A 2RMMA 4K3CA 3MHZA 3ENEA 3TIXA 1C4AA 1UUPA 1AW7A 1YIWA 1D6EC 2LZ6A 2MQJA 1TTNA 2BVCA 4MGKE 3R7QA 3MC9A 2D3AA 1BT0A 2LGSA 1UZXB 4TKNA 2KWVB 2N0SB 5BMHA 4OZAA 2AQ3B 4JLCA 3VUWA 2BW2A 1L0YB 4DHZE 2HE7A 2WXRA 3K9PB 2AQ2B 3KYDD 2IGDA 2L0FA 3RFZB 3PLUA 3ONSA 2UWQA 4HK2A 1V5OA 1A70A 1AN8A 1R4NI 1F2RC 3AE2B 4K81A 3VVWB 1TY2A 2ZVOA 1D5ZC 2JVCA 4M8MA 3ZNHB 2PIAA 4K7WA 3R7RA 1Z2MA 5H92C 4M00A 3P1MA 1C9FA 2NMQA 1J7BA 4MM3A 1HZ5A 3I57A 3PGEA 1TS5A 2Q5WD 5AZHA 2ZCBA 4NAWB 1Q1OA 2LGDA 1SE9A 3DQVA 2G45B 4G11A 5I4DA 3JW0X 2MW5A 3KW5B 1EF5A 1YX6B 1SB3C 4GSWA 2MP2B 1VD2A 3ZLZA 1RFKA 3H1UA 1T0YA 2MH7A 1IYFA 2ZPNA 1TZOA 4UDUC 1WGRA 1N63A 2FIDA 3PZ7A 4ARIA 2M0XA 3OAWA 1FNVA 2LVPA 4LDTD 1WXVA 4ZHOA 2PEAA 1JQ4A 1CMXB 2X8XX 2INCC 4K7UA 4C7YA 2W9NA 4IM2A 1QZEA 3IAM1 4C80A 1LFDA 1NENB 1ZP0B 4YT0B 1UGJA 2L76A 4US9A 4XE0A 1QLBB 4E71A 2BPSA 3HVZA 3JSVB 2CKHB 1OQRA 2LJIA 3H7PB 4KDIC 3B2GA 4BBNC 2KFKA 3Q8BA 1AARA 3UIPB 1UD7A 2INDC 1WE7A 3MP9A 4GDLB 1MJDA 2GOWA 2R61A 4ANXA 3NY5A 2JZZA 2N9LA 4W9FA 2BB5A 2FCQA 3WANA 2KMMA 2WXPA 4W9KA 3LB8C 5E6OA 4WWOA 1Y56A 3V6CB 4C4VB 3DBRI 3VR9B 4KV2A 1E8YA 1FNWA 3JVZX 1SE2A 4LNFA 2I1JA 1GC6A 2Z0DB 2WQYB 2HD5B 2O6VB 2MBQA 4BKSD 2RDBC 2W54A 2MEKA 4RGMA 1BXTA 2E3TA 4BFRA 3P63A 1JCKB 1DGJA 2BWFA 2W3RA 2KMCA 2KQ7A 3N32A 2YLMA 1UWXA 4DDGD 3WAPA 2DWQA 2L0TA 2D5GA 2DZMA 3RMKC 1PGXA 2PW9A 4IDIA 3R3MA 5EE1A 4E3CA 3BVZA 2JPHA 4I6LB 2MJEA 2IO1B 2DYBA 2V1YA 2J0JA 4LCDE 1SXTA 1E8WA 2LUMA 3IVFA 3IHPC 5E6NA 5JH5C 2D07B 2K39A 4F7ZA 4ZHPA 5EE0A 4A20A 1HQRD 1OQYA 2CHWA 4MT5A 2KANA 1UF0A 4ZOHC 2WXJA 5FR6A 4CO7A 4X57B 1KLUD 2K25A 2ZNVB 2K1FA 1WMHA 5DPSA 2GBMA 1UBIA 1C79A 3B9JA 3DBRB 2KTRB 1R7SA 4N59A 2BBCA 1WXAA 1ESFA 3NOBA 3AU5A 2KK8A 2JF5A 2RSUA 1HA5A 2GRIA 2KDFB 3OJ3A 2KACA 5D3IB 1V2YA 4NPNA 1CQVA 3MHSD 1EM7A 4KZ0A 4H2AA 4G50A 3AE3B 2JRHA 2KC2A 1WYGA 4A6QA 1WRIA 3NHEB 1AYFA 3TUOA 2PVGC 2KN4A 5KHOA 5G5GA 2QIEB 1ZOYB 4N6EB 2GB1A 3N9YC 4O1NA 3KUDB 4P1BC 2SAKA 1J19A 2MBEA 2KQ4X 4IUMB 2O2VA 1R4MI 1YN5A 4TSSA 4P16A 2NBWB 2M0AA 4KDLB 4FULA 3PLVA 4IKGA 3AE9B 1QQRA 2DNFA 4HCNB 1JW9D 3KUZA 3TCAA 2W3SA 2DENB 2LRWA 2CU1A 2NVUI 1WJ4A 2H88B 2ZW0A 1E8XA 2QEJC 2IYDB 2ZW1A 2KLCA 2LGXA 1TKGA 3P4PB 2R2OA 3A4SC 1ZW7A 3VR8B 4MGYE 1ZDVA 3NRZA 2ZCCA 2BYEA 1WJNA 3IXSA 1DOYA 1XCTL 2AL3A 3O65B 1C4PA 1F0ZA 3VTUA 2VH1A 1P0RA 3GOEA 3N1XC 2BKFA 1PUTA 2DYMA 4YTPB 1HXYD 1OGWA 4EFOA 3U7ZA 2G3QB 3AE5B 2LEKA 2LASA 5D2MB 3DVNU 3DBHB 4RF1A 2Y5PA 2QJLA 4ITKA 1OEYJ 1T3QA 1YOVB 1SJED 2K5PA 3HK0A 3A9JB 3TEXA 3RNGC 3ZNZB 4DWFA 1WJ6A 3X23A 4Q2JA 2KFJA 3AEDB 1BUIC 2AWTA 4A3PA 2BYFA 1RRBA 2EKEC 1TY0A 5AUIA 3TEZA 3PT2B 1VZ6A 2JZPA 3Q3OC 3ZUNA 4CQNA 3R2IA 1P98A 1XF5L 1U4AA 1YNTE 3DBLB 4ACFA 5G55A 1TYGB 2LXCA 4F8CB 3LXFA 1MVKA 1ZUD2 1OQQA 1VZ7A 2IO0B 2PJHA 2DHZA 2DYOA 1A5RA 4WAAA 1TT5B 2RGFA 3UGBB 4WJPA 1ZGUB 5HKHA 3PSEB 1ET9A 3DCGA 3L17A 1WI0A 4WWNA 1L4ZB 4RCOA 2GI9A 4ZYNA 4URKA 3J9CA 2ZEQA 3I63C 2BQQA 1J0GA 1XLNA 1K53A 4FA6A 2O2VB 4AJWA 2JRIB 3C0RB 2DAJA 3U30A 5FR3A 1MHHE 4M01A 3B1LX 3DWMA 4HEA1 1WGGA 3BYYB 4HDQA 4C7ZA 2ZVNA 1I4QA 1H8CA 3BINA 1HTQA 4WWMA 2KQSA 3KWVA 3SFEB 2MLBA 3MFGA 1D4BA 3V6EB 2MX2A 2FUG1 4AUQC 2XBBC 3N1ZC 2N9KA 2XN9C 3VTWA 4BKGA 1FNUA 1Q0WB 5E6PA 3V05A 3LYYA 2TSSA 3WAOA 1VCBA 2DBYA 1FEHA 2K8BA 4C00A 3ZDTA 4AOFA 1PDXA 4EKUA 2J53A 1S1QB 5CHVC 1STEA 2FCNA 4KGTA 2FE8A 4A3OA 3ZTCA 1IPGA 2X38A 1WXQA 3DBSA 4GOCA 3RI7C 3BZDB 4JE3B
chains in the Genus database with same CATH topology
4UDUC 2WDQB 1NYQA 4OZCA 1N63A 3PZ7A 3NVZA 4ARIA 3BYTB 1IBXA 1FXIA 3IT4B 1FNVA 3ZJUA 1TJEA 3IAS1 1I4XA 3P4QB 4ZHOA 1YN4A 4JPSA 3TSSA 2JXTA 1GOZA 5T8IA 4DXFA 1IBXB 2Y5CA 3EUB2 1JQ4A 1L0XB 1YQ3B 1E6EB 3I9V1 1N5XA 1I4HA 2QILA 1EWYC 4HKQA 4C7YA 1C4CA 1PGAA 3IAM1 4C80A 3NS1A 1NENB 1ZP0B 2L52A 2WXKA 4R3DA 4YT0B 3U2SC 1UNSA 1UGJA 1Q10A 4US9A 5FK9C 5BYQA 1IUEA 1FCLA 1HEZE 2PTLA 4XE0A 1QLBB 5MPOA 3HVZA 3AB5A 2WXFA 2LGIA 1C76A 2V0GA 1OQRA 5GXGB 2LJIA 1E0ZA 3B2GA 3Q8BA 1JWMD 1XLOA 3NUHB 3HUIA 1SJHD 3AE4B 2L83A 3NZ3A 1QKZA 1AWDA 1FFUA 1OFFA 3AEFB 1FRDA 2WXGA 3MP9A 4GDLB 1L6VA 3CWIA 2WXMA 3KWLA 2R61A 1QF6A 1ET6A 1EU3A 5C3JB 2Z8LA 2CU3A 2WNMA 3FILB 1ACCA 2N9LA 4B0EA 2BB5A 3P4SB 3TEWA 2PVOD 2KMMA 2BYTA 2WU5B 2WXPA 2AQ1B 3LB8C 1KFYB 2J4XA 4NAMA 3O13A 1Y56A 4EE2A 3ZJTA 4RH6A 5BYRA 5JXVA 4N58A 3VR9B 3AH7A 1UWMA 1KH0A 2EELA 4TQ1A 1P7EA 1L4DB 1FNWA 4AQ7A 2LFIA 1JWUD 1SE2A 1I4GA 3W5VB 4LLGM 4YSXB 4A90A 1V1PA 3NVWA 2WQYB 4REZA 1YN3A 2G9HD 3CIRB 1K51A 2W54A 1FM0D 1FIQA 2MEKA 1QILA 2QSDA 1EWCA 4RGMA 1BXTA 2E3TA 2E6XA 1MI0A 2I38A 4YSZB 2ONQA 1C78A 1JCKB 1DGJA 3P63A 2W3RA 3AE6B 1L6UA 4NJCA 4RNAA 1NEKB 2JQRB 2WXQA 2L32A 2HTME 3VRBB 1UWXA 3Q69A 2DWQA 2V3PA 2D5GA 2FBWB 1CK1A 2BS3B 4OW0A 1PGXA 2PW9A 4YSYB 4IDIA 1PFDA 2J52A 1I4RA 3BVZA 5EE1A 4NZLB 5HI1A 4US8A 2MJEA 3MJ5A 2WXNA 3L4PA 1VR9A 3TEYA 2K9XA 1KTKA 3H8HA 4J3OD 1GB1A 1PYWD 1K50A 1I4PA 3R2TA 4ZRPA 4LTUA 1SXTA 2M19A 2LUMA 5FKAC 2ACZB 4ZHPA 1NVID 2OHFA 5EE0A 2IGHA 1HQRD 1V1PB 4MT5A 4ZOHC 2WXJA 1FO4A 5TSSA 1SIJA 1C77A 2NTSA 1EU4A 1KLUD 3ABVB 1DOIA 3AEBB 4YTMB 2WDRB 1C79A 3GP7A 3ZQ4A 3B9JA 5D3DA 1T6BX 1BMLC 1ROEA 2I2YA 3DWGC 1RWSA 3U4EG 4N59A 1R7SA 3VQIA 2BBCA 2DLBA 3Q8FA 4MH8A 4DXGA 4XWWA 3RPFC 1FCCC 4JWUC 1ESFA 2WDVB 1QOGA 3GB1A 2WXIA 3PO0A 1GPXA 4OVZA 1HA5A 4OHJA 4YTNB 3AE8B 1SE4A 2GRIA 2JYEA 3Q8EA 4PT5A 2KACA 5EE3A 3UI3A 1N62A 5D3IB 5EE9A 1JWSD 5D7GA 1CQVA 4ARCA 2YEPB 1EM7A 3AMZA 4MACA 3OWEB 1K52A 2MJ3A 1YQ4B 4H2AA 4RGNA 1FRRA 4ZRQA 1J7AA 3AE3B 3V3XA 1WYGA 4A6QA 4WAFA 2VZKB 1WRIA 3NVVA 1AYFA 1QOBA 2PVGC 2KN4A 3TUOA 1RM6C 3W1SA 2J42A 5G5GA 2QIEB 1ZOYB 4KGRA 1SBBB 4IOIE 4N6EB 3BVMA 2GB1A 2M56B 1TKYA 4DQOC 1L5PA 2V3NA 3N9YC 4O1NA 1CZPA 1KLGD 4L1BA 4L23A 1ENFA 1YJJA 3R8BA 4ZYSA 2SAKA 1E9MA 2JX5A 2KQ4X 1JRPA 1M4VA 3EGRA 2QMTA 1YN5A 4TSSA 4P16A 2OEDA 4USAA 2IPKD 2M0AA 5HHDG 4TMAB 2W55A 3T3OA 1TS4A 4AS1A 5LNK1 1DOXA 1XEEA 4IKGA 2W82A 1DYQA 3AE9B 5HFYA 1QQRA 4YWGG 1JW9D 2L1AA 3P42A 2W3SA 1WGKA 2ICIA 4YXDB 1XCQL 3KLSX 1N61A 2WXOA 2H88B 1ZXHA 2ZW0A 1RYJA 2XNAC 2QEJC 3W2DA 2ZW1A 4RFBA 1ZPSA 1TKGA 3GS2A 3P4PB 3VR8B 5AUKA 4JX1C 3U52E 1E10A 1ZDVA 3NRZA 1P7FA 5H8YE 2ON8A 1YMHE 3IXSA 2K22A 4HKZE 1DOYA 1XCTL 3WCQA 1C4PA 1F0ZA 4L2YA 2NTTA 3IT6B 1JWBD 1FXAA 1ZE3D 3BK2A 4GDKB 2WU2B 2RDHA 2BTEA 4WURA 3BIID 2AX5A 1PUTA 2DYMA 4YTPB 2BS2B 1JWAD 1HXYD 2PMVA 2YEPF 1TKEA 3AEAB 2SEBD 3U7ZA 2KWDA 2PKOA 1PGBA 2WP9B 2CJOA 2LEKA 3AE5B 1MHXA 4FXCA 5G5HA 1VRAB 1WSPA 1FMAD 4MM3B 3Q8AA 4RF1A 2Y5PA 2QJLA 4ITKA 1WWTA 4RGOS 2JSVX 3AECB 1SE3A 1FFVA 1T3QA 3SFDB 3P4RB 3E56A 1T5XD 3MC0B 1SJED 2K5PA 2IGGA 3AE1B 3TEXA 4A8XC 2EKIA 3C8YA 4Q2JA 1I7HA 4M0WA 2H89B 1VZ8A 2MJDA 1QOFA 4GLSC 2CJNA 5BMGA 2INPE 3FAHA 2N7JA 3AEDB 4P6VF 1BUIC 3ZYYX 4C56C 1HZ6A 2BB6A 4HROA 3NVYA 4D2KA 1TY0A 5E6JA 5AUIA 3TEZA 1D5XC 2INNE 1B9RA 1J7CA 1SF0A 1VZ6A 1B1ZA 3BK1A 2JZPA 2IDYA 4OZBA 4RGTA 2JU6X 1SSNA 4CQNA 2RPVA 1V8CA 3R2IA 1JMLA 1XF5L 2LHDA 2V4IB 2IJ0A 1IGCA 1YNTE 3E9SA 4TQ0A 1TYGB 1ZDXA 3LXFA 1XLQA 1TS2A 1MVKA 1ZUD2 2WXLA 1OQQA 4XWTA 1VZ7A 3AE7B 4B0MA 3AM9A 2K3UA 1N60A 1IGDA 4A9AA 5BYSA 2DYOA 1VLBA 5C2TB 1F77A 3AEGB 1VDVA 4XDDA 4HRSA 2VZKD 2RMMA 4LK0M 3ZGZA 2LHEA 3MHZA 3ZJVA 1XO3A 3T3NA 1C4AA 1UUPA 1AW7A 1ET9A 1D6EC 2BT6A 1L4ZB 4RCOA 2B76B 2GI9A 2WLBA 1TS3A 3KQ4A 3J9CA 1KRHA 3AEEB 4WIPA 1YJIA 1XLNA 2N0SB 1K53A 1V1OA 2KAJA 5BMHA 4OZAA 2AQ3B 3B2FA 3W5UB 2BW2A 1L0YB 3AN1A 5FR3A 1NYRA 2WXRA 1MHHE 3HVDA 2AQ2B 3ETRA 3DWMA 4HEA1 3BYYB 4C7ZA 1QT9A 1I4QA 1N5WA 3Q8CA 3HRDD 2IGDA 1L0VB 4WWMA 4HJGE 3BWUD 3KWVA 2KDMA 4WQMA 1MPEA 3RFZB 4RF0A 4WH4A 3SFEB 1GB4A 3MFGA 4XDCA 5HG2A 1D4BA 1A70A 1AN8A 2FUG1 1F2RC 3AE2B 5BMIA 1TY2A 3VRAB 1QOAA 1D5ZC 3EA6A 3FILA 2N9KA 2XN9C 1FD6A 4KGSA 2PIAA 1FNUA 3V05A 1E7PB 1F2RI 3LYYA 1XXGA 3PZ8A 3AV8A 1JROA 2TSSA 5H92C 3BVGA 1D5MC 4KX6B 4KKIA 3P1MA 3URYA 1C9FA 1JALA 1ZXIA 1J7BA 2NMQA 3W9CB 3FC4A 4A55A 2PLPA 4KKJA 2DBYA 1FEHA 1HZ5A 3I57A 1TS5A 2Q5WD 4NAWB 2Y3AA 2JYTA 1PDXA 2HDEA 2J53A 3SEBA 1STEA 2WXHA 5I4DA 4KGTA 2FE8A 2WS3B 2K0PA 2BS4B 1XLPA 1SB3C 1VJKA 1NI3A 2RDGA 1LO5D 4JWSC 1CJEA 2LMCA 1SEBD 1V97A 2X38A 1RFKA 3SR6A 1GAQB 1WXQA 2JWUA 1KF6B 2MH7A 3BZDB 2G1EA 4JE3B 1TZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQR B;  3AEG B;  3AE9 B;  1VDV A;  2WDQ B;  2HTM E;  1NYQ A;  1N63 A;  3VRB B;  3NVZ A;  1JW9 D;  4HRS A;  2W3S A;  1WGK A;  1FXI A;  2DWQ A;  4YXD B;  1TJE A;  2FBW B;  1N61 A;  2BS3 B;  1XO3 A;  3P4Q B;  4ZHO A;  2H88 B;  4YSY B;  1RYJ A;  4IDI A;  1PFD A;  2Y5C A;  3EUB 2;  5EE1 A;  1JQ4 A;  4US8 A;  1YQ3 B;  2MJE A;  1E6E B;  2BT6 A;  1TKG A;  3P4P B;  2B76 B;  3L4P A;  2WLB A;  1N5X A;  3VR8 B;  5AUK A;  4JX1 C;  2K9X A;  1E10 A;  3NRZ A;  1EWY C;  4C7Y A;  1KRH A;  3AEE B;  5H8Y E;  4C80 A;  1YJI A;  4LTU A;  2K22 A;  1NEN B;  1ZP0 B;  2L52 A;  1XLN A;  2M19 A;  2N0S B;  2KAJ A;  3NS1 A;  2ACZ B;  4YT0 B;  1DOY A;  3WCQ A;  1F0Z A;  3B2F A;  4US9 A;  3W5U B;  4ZHP A;  1IUE A;  1NVI D;  2OHF A;  5EE0 A;  1JWB D;  1FXA A;  1QLB B;  5MPO A;  3AN1 A;  2WU2 B;  3HVZ A;  1NYR A;  4ZOH C;  3AB5 A;  3BII D;  2AX5 A;  3ETR A;  1PUT A;  3DWM A;  4YTP B;  1FO4 A;  4C7Z A;  2BS2 B;  1JWA D;  1SIJ A;  1OQR A;  1QT9 A;  5GXG B;  3ABV B;  1DOI A;  1E0Z A;  3B2G A;  1N5W A;  1TKE A;  3AEA B;  3HRD D;  2PKO A;  3AEB B;  1XLO A;  4YTM B;  1L0V B;  2CJO A;  2LEK A;  2WDR B;  2WP9 B;  3AE5 B;  4FXC A;  3HUI A;  4WWM A;  5G5H A;  1FMA D;  3B9J A;  4WQM A;  3AE4 B;  1ROE A;  2L83 A;  3SFE B;  3DWG C;  1AWD A;  1FFU A;  1OFF A;  2QJL A;  1RWS A;  1WWT A;  3AEF B;  4ITK A;  3AEC B;  1FRD A;  4N59 A;  1R7S A;  1T3Q A;  1FFV A;  3SFD B;  3P4R B;  1A70 A;  1L6V A;  3RPF C;  3CWI A;  3AE2 B;  4JWU C;  2K5P A;  3KWL A;  3AE1 B;  2WDV B;  1QOG A;  3PO0 A;  3VRA B;  1QF6 A;  1GPX A;  1QOA A;  3AE6 B;  4YTN B;  2CU3 A;  2EKI A;  3AE8 B;  5C3J B;  1I7H A;  2H89 B;  5EE3 A;  2PIA A;  2MJD A;  1QOF A;  1N62 A;  2CJN A;  3P4S B;  5EE9 A;  3FAH A;  2PVO D;  2KMM A;  3AED B;  1E7P B;  2WU5 B;  4P6V F;  3ZYY X;  3LB8 C;  1KFY B;  3AMZ A;  3AV8 A;  1JRO A;  5H92 C;  2MJ3 A;  4HRO A;  1YQ4 B;  3NVY A;  1FRR A;  4KX6 B;  1J7A A;  3AE3 B;  3P1M A;  5AUI A;  1JAL A;  1ZXI A;  1J7B A;  1WYG A;  3W9C B;  1J7C A;  1SF0 A;  1WRI A;  3FC4 A;  3NVV A;  4N58 A;  3VR9 B;  1B9R A;  2DBY A;  3AH7 A;  1UWM A;  1QOB A;  1AYF A;  2PVG C;  1RM6 C;  2Q5W D;  5G5G A;  2QIE B;  1PDX A;  1ZOY B;  4N6E B;  1V8C A;  2M56 B;  1TKY A;  3W5V B;  2WS3 B;  1L5P A;  1XLP A;  2BS4 B;  4YSX B;  1CZP A;  3NVW A;  2WQY B;  1SB3 C;  1VJK A;  1NI3 A;  1TYG B;  1YJJ A;  4JWS C;  3LXF A;  1CJE A;  1XLQ A;  1E9M A;  3CIR B;  2JX5 A;  1JRP A;  1ZUD 2;  2W54 A;  1FM0 D;  1FIQ A;  1OQQ A;  1RFK A;  1V97 A;  3AE7 B;  3SR6 A;  1GAQ B;  3AM9 A;  1WXQ A;  1N60 A;  2E3T A;  1KF6 B;  2MH7 A;  4USA A;  4A9A A;  2W55 A;  4YSZ B;  3P63 A;  1DGJ A;  2G1E A;  1DOX A;  2W3R A;  1L6U A;  1VLB A;  5C2T B;  1NEK B; 
#chains in the Genus database with same CATH topology
 2WDQ B;  3PHW B;  1NYQ A;  1M94 A;  4G0N B;  5DCN A;  1TJE A;  4MGI E;  2JXT A;  3I5J C;  5T8I A;  1WX9 A;  1IBX B;  4FJY A;  2Y5C A;  3EUB 2;  1L0X B;  1YQ3 B;  2RR9 A;  2FCM A;  4HKQ A;  3I3T B;  2NBU A;  3A4R A;  1UNS A;  2AYO B;  1Q10 A;  4JIO U;  4EZL A;  1HEZ E;  2PTL A;  2LJ5 A;  3AB5 A;  2J7Q B;  4IWP A;  1C76 A;  2V0G A;  3OJ4 B;  1E0Z A;  1JWM D;  1HTO A;  1XLO A;  3QA8 A;  3NUH B;  1HE8 A;  2BKR B;  3WAM A;  1QKZ A;  5BO4 B;  3CSF A;  1FFU A;  3PV1 A;  1WR1 A;  3AEF B;  1FRD A;  3CWI A;  3KWL A;  1QF6 A;  1UBQ A;  2WNM A;  3FIL B;  3A9K B;  4E74 A;  2N1V A;  2BYT A;  1KFY B;  4IW0 A;  1KJT A;  2J4X A;  4NAM A;  4MJS A;  3O13 A;  4EE2 A;  3DBH I;  5JXV A;  2L00 B;  3AH7 A;  1UWM A;  2EEL A;  1EF1 A;  4TQ1 A;  1P7E A;  1L4D B;  1Q5W B;  3APC A;  2JZ3 B;  2KFK B;  4CYE A;  3MC8 A;  4S17 A;  4MGZ E;  2LFI A;  3DVG Y;  2N4F A;  1I4G A;  4IWQ A;  4EZK A;  1PQS A;  4NQK E;  4TV3 A;  3C19 A;  2C9W B;  4REZ A;  3RUL A;  1FM0 D;  3UQA A;  2QSD A;  1EWC A;  2KJ6 A;  2E6X A;  1MI0 A;  3HHM A;  2JWZ A;  3DVN V;  4WQO B;  2JQR B;  4FHJ A;  2L32 A;  2HTM E;  1WH3 A;  5IO9 A;  3Q69 A;  4AJY B;  2FBW B;  4W9H A;  4OW0 A;  1I4R A;  4US8 A;  5L95 C;  2OOB B;  1KTK A;  3H8H A;  4MDK E;  3KVF B;  3A33 B;  1PYW D;  1I4P A;  2M19 A;  2C60 A;  4BOS C;  4BKS A;  2IGH A;  1V1P B;  3U8Z A;  4RM9 A;  1FO4 A;  5TSS A;  1SIJ A;  1DOI A;  3ZRF A;  3EC8 A;  1T0Q C;  3AEB B;  3FKY A;  4YTM B;  4NAW A;  3U4E G;  3VQI A;  4DXG A;  3Q8F A;  2K8H A;  2NCN A;  1QOG A;  4IC7 B;  3ECI A;  1SE4 A;  1MG4 A;  3Q8E A;  1N62 A;  4MSM B;  3LDZ E;  4ARC A;  3OWE B;  1YQ4 B;  4RGN A;  2EMS A;  3V3X A;  1Y8R C;  1WM3 A;  1WJU A;  3NVV A;  3MTN B;  1QOB A;  1T0R C;  4W9J A;  3M62 B;  1RM6 C;  3DHI C;  2J42 A;  3ZTD A;  2KJH B;  2K8C A;  3X0W A;  3BVM A;  4W9E A;  2M56 B;  2N9X A;  4DQO C;  3VFK A;  4DDI D;  1CZP A;  4GN1 A;  1KLG D;  4P1C C;  1YJJ A;  4QAY A;  3Q3N C;  5IAA C;  2BF8 B;  1JRP A;  5CX3 A;  2IPK D;  2XK5 B;  4GGQ A;  4TMA B;  4MJS B;  4EZJ A;  3T3O A;  5LNK 1;  2W82 A;  1WXS A;  5GMV A;  4HVB A;  2N1W A;  2KTF A;  1H4R A;  2WGS A;  4KSK C;  1XCQ L;  1N61 A;  2WXO A;  1ZXH A;  2XNA C;  3W2D A;  4RFB A;  2KT7 A;  4MH0 E;  5J2R A;  4JX1 C;  3U52 E;  3L0W B;  4NJ6 A;  1UGM A;  1YQB A;  5H8Y E;  1WGY A;  2K22 A;  1MG8 A;  1MFW A;  3WCQ A;  4BKT A;  3H7P A;  3GZN B;  3IT6 B;  3PRP B;  2G4D B;  2RDH A;  2O6V D;  3ZXV A;  3BII D;  4DXA B;  1JWA D;  2D3C A;  3VXW A;  1V9J A;  3T9L A;  2KHW B;  1PGB A;  2D11 A;  1VRA B;  4ANV A;  1LQB A;  3EFU A;  3Q8A A;  4MM3 B;  1JRU A;  1SE3 A;  3SFD B;  2LI5 A;  3N3K B;  2XEW A;  3P4R B;  5CHW A;  3E56 A;  3RN9 C;  2EKI A;  5AZG A;  2AEH A;  1I7H A;  4M0W A;  1VZ8 A;  3M95 A;  2CJN A;  4XGA B;  5BMG A;  2LRU A;  4P6V F;  4FN2 A;  3A9J A;  2HTH A;  2RD0 A;  2ZJD A;  3L13 A;  2HJ8 A;  3PHX B;  1B9R A;  3KUC B;  3W1S C;  1B1Z A;  4BZA A;  3ZDM C;  2IDY A;  4RGT A;  2JU6 X;  1WMH B;  2A5U A;  1V8C A;  2DZI A;  3QWZ B;  3NZS A;  2PE6 B;  2IJ0 A;  3SU8 X;  3SDL C;  1IGC A;  4JGH B;  3W1Y A;  3OLM D;  2IZV B;  1TS2 A;  2NPT B;  1Z5S B;  3AE7 B;  3NZU A;  4IM3 A;  1IGD A;  4LJP B;  4BVU C;  2PE9 A;  5BYS A;  5C2T B;  3PZD A;  1VDV A;  3RUI B;  3QJZ A;  4XDD A;  4HRS A;  2VZK D;  4LK0 M;  3ZGZ A;  3AUL A;  4M0W B;  2LHE A;  3KH0 A;  3ZJV A;  3H9D A;  2MCN B;  1I35 A;  3SD5 A;  1XO3 A;  3T3N A;  3EEC A;  2IO2 B;  3RNA C;  4LDT B;  1TS3 A;  1S3S G;  1X1M A;  3SHQ A;  1KRH A;  3PTF C;  1YJI A;  2I1K A;  2KAJ A;  3B2F A;  3A1Q A;  3W5U B;  2N7D A;  3V61 A;  2D3G A;  3AN1 A;  1NYR A;  3QC8 B;  3HVD A;  3A1Q B;  3VDZ A;  1XQQ A;  1ZKH A;  3Q8C A;  3TBL D;  4HJG E;  2CR5 A;  2KDM A;  4WH4 A;  5L83 A;  4XDC A;  2JUO A;  5J17 A;  1YX5 B;  5BMI A;  1UEL A;  3VRA B;  1NDD A;  1QOA A;  4EOY A;  1GNU A;  3EA6 A;  1FD6 A;  1FXT B;  2G4S A;  4CHK A;  1F2R I;  3PZ8 A;  2MBO A;  1JRO A;  5IKC M;  3BVG A;  3URY A;  1JAL A;  2CS4 A;  3W9C B;  1XD3 B;  3ZRC A;  3FC4 A;  2RPQ A;  2PLP A;  4KKJ A;  2Y3A A;  2JYT A;  2DAF A;  2HDE A;  4BAX A;  1GG3 A;  4ZRK A;  3SEB A;  2WS3 B;  1J8C A;  4MSQ B;  4RMA A;  1OTR B;  2FAZ A;  1VJK A;  1LO5 D;  2MA9 B;  1CJE A;  3AI5 A;  2LMC A;  1SEB D;  4KZC A;  1GAQ B;  4F1S A;  1KF6 B;  3H7S A;  2C7M B;  4BOZ B;  2G1E A;  4G3X B;  2LVO A;  4J6I A;  4OZC A;  3M3J A;  3R66 C;  2NBV B;  3NVZ A;  4GMV A;  1C3T A;  3BYT B;  1FXI A;  1TBE A;  3IT4 B;  3ZJU A;  3B0A A;  4GXB A;  1I4X A;  1YN4 A;  1GOZ A;  4DXF A;  2LD9 A;  3ZW3 A;  4FJV B;  1N5X A;  2QC8 A;  1C4C A;  2KTR A;  4EUT A;  2WXK A;  3GZN I;  3U2S C;  5LXH A;  3JSV A;  4II2 B;  1FCL A;  1IUE A;  4I6N B;  2KLG A;  5MPO A;  3DVG X;  5GXG B;  3JYU A;  4GU2 A;  5LLI A;  2KWU B;  2KJR A;  5C23 A;  3HUI A;  1SJH D;  3ZXR A;  1WGD A;  2WXG A;  1L6V A;  4ANU A;  2DZK A;  3HM6 X;  1ET6 A;  1EU3 A;  2CU3 A;  4IWO A;  1ACC A;  3QAQ A;  4W9C A;  2KVZ A;  3P4S B;  4HPM B;  3DHG C;  2PVO D;  2AQ1 B;  1KLV A;  2D3B A;  2GBR A;  2V4L A;  4PYZ A;  3RZW C;  4RH6 A;  2DX5 B;  5BYR A;  1KH0 A;  2N7E A;  2GMI C;  4XX5 A;  2N9E B;  2VRR B;  1JWU D;  4HLE A;  4LLG M;  3P2B A;  4YSX B;  4WJQ A;  4A90 A;  2GLS A;  1I42 A;  3QCA A;  4P7I A;  4HPP A;  5IA7 A;  3ZVV A;  2G9H D;  3CIR B;  1K51 A;  1QIL A;  4M8N A;  3RNC C;  4ICU A;  3APD A;  5DPW A;  4PK1 A;  3AE6 B;  1L6U A;  2WYQ A;  1NEK B;  2WXQ A;  3RT3 B;  2MBH A;  3VRB B;  2KNB A;  1WR6 E;  2Z0E B;  4II3 B;  2V3P A;  2J0M A;  1CK1 A;  2BS3 B;  4YSY B;  3PVL A;  3RCZ A;  5D94 A;  3MJ5 A;  3S2A A;  2WXN A;  1WYW B;  3IG3 A;  3L4P A;  3RYT A;  3VH4 B;  3N20 C;  4YL8 A;  4ZRP A;  3Q3J A;  2NPT A;  1F1H A;  5FKA C;  2KOX A;  2WDT B;  2OHF A;  2L05 A;  4W9D A;  4K3B A;  2KDB A;  3DPD A;  2NTS A;  1C77 A;  1EU4 A;  5AEK B;  1TZ1 A;  2VH2 A;  2MBB B;  2ZNV C;  4K1R B;  3GP7 A;  4PS7 A;  2K6D B;  4OVU A;  1BML C;  4C4V A;  1WX8 A;  3APF A;  4K7S A;  3PRE A;  2DLB A;  4MH8 A;  4GB9 A;  3K9O B;  4JWU C;  5TR5 A;  2WDV B;  4DHZ B;  1GPX A;  2WXI A;  4YTN B;  1NI2 A;  4PT5 A;  2JT4 B;  3AMZ A;  2C7H A;  4DHJ B;  1FRR A;  5AZF A;  1J7A A;  4WAF A;  2VZK B;  2OJR A;  1P3Q U;  2N9P C;  3W1S A;  3V60 A;  4WWP A;  2FNJ B;  4LJO B;  2WX1 A;  1TKY A;  1LGR A;  1WZ3 A;  1ISN A;  2IBI B;  1L5P A;  2V3N A;  4HWI B;  4JQW C;  4L23 A;  4WJO A;  1E5W A;  1WX7 A;  1E9M A;  1M4V A;  1GUA B;  4IG7 B;  4PS8 A;  4USA A;  4KVG B;  2ZZP B;  2L7R A;  1TS4 A;  4AS1 A;  1DOX A;  2ZPY A;  1DYQ A;  3NG0 A;  1RLF A;  4FJZ A;  4YWG G;  2L1A A;  3P42 A;  2ICI A;  4YXD B;  3L54 A;  4BBN F;  3U7D A;  1ZPS A;  3V62 A;  5AUK A;  1KM7 A;  1E10 A;  4KIK B;  4W9G A;  1P1A A;  2ON8 A;  1SIF A;  2KWC A;  1GJZ A;  2AL6 A;  2KN5 A;  2MHJ A;  3QAR A;  2NTT A;  1FXA A;  3BK2 A;  2BTE A;  3PRZ A;  2AX5 A;  4PS3 A;  3UQB A;  2BS2 B;  2LGY A;  4MEL A;  2PMV A;  2SEB D;  1SGH A;  4FAD A;  4FXC A;  2CJO A;  1MHX A;  1FMA D;  3ZKJ C;  4KIK A;  4RGO S;  1FFV A;  2Y5B B;  4AP4 C;  1T5X D;  5J18 A;  4A8X C;  2KO3 A;  1NBF C;  2L3Z A;  5JHA A;  2WX0 A;  4OVV A;  4W9L A;  3DHH C;  2MJD A;  3TL5 A;  2INP E;  3FAH A;  2N7J A;  3VUY A;  1KOT A;  5G2N A;  4HDO A;  2JY6 A;  5E6J A;  3Q14 C;  1J7C A;  3BK1 A;  2MP2 A;  3DOW A;  3RZF A;  4OZB A;  1SSN A;  2RPV A;  2V3S A;  1JML A;  5KHQ A;  1L7Y A;  2LHD A;  2V4I B;  3Q3M C;  4TQ0 A;  1F52 A;  4S0R A;  1ZDX A;  3ALB A;  1XLQ A;  4XYC A;  3CF6 E;  1G6J A;  2KYW A;  1WFY A;  2WXL A;  3QQ8 B;  3HM3 A;  1N60 A;  3WAL A;  4MEM A;  4HXD A;  5DPT A;  3N30 A;  3N1Y C;  4DHJ D;  2BT6 A;  2QHO A;  2B76 B;  3AU4 A;  2WLB A;  2REX A;  3KQ4 A;  3AEE B;  3ML8 A;  1V1O A;  2FUH B;  2MRP A;  3VAW A;  2KX3 A;  2NS5 A;  3AXC A;  3GE3 C;  2LUE A;  3EHV A;  3NJT A;  3ETR A;  2WWZ A;  1V86 A;  1QT9 A;  5IN7 A;  2KX0 A;  3KYC D;  1N5W A;  3HRD D;  1YJ1 A;  1L0V B;  2KDE B;  4GIV A;  1EO6 A;  3BWU D;  1WIA A;  4WQM A;  1MPE A;  4RF0 A;  3HIZ A;  1GB4 A;  5HG2 A;  3L10 B;  4XZ4 A;  2IO3 B;  4ANW A;  3VHT C;  2KKC A;  2D2Q A;  2CHX A;  3FIL A;  4KGS A;  3VH3 B;  2YVC A;  1E7P B;  1WRD B;  1XXG A;  3AV8 A;  5CHF A;  2XK5 A;  1D5M C;  4B6W A;  2C5L C;  4KX6 B;  4KKI A;  3L08 A;  3NS8 A;  1ZXI A;  3WA0 A;  4A55 A;  1E8Z A;  5DPR A;  2A4Z A;  1LXD A;  1YD8 U;  2WXH A;  2QCZ A;  2GBN A;  2K0P A;  2BS4 B;  1XLP A;  4ZRJ A;  2KMA A;  4DK5 A;  1NI3 A;  2BGF A;  2RDG A;  3PS6 A;  4JWS C;  4LNN A;  1V97 A;  3SR6 A;  2JWU A;  3RNF C;  1V49 A;  4WIP A;  4NY0 A;  1IBX A;  3IAS 1;  3P4Q B;  4JPS A;  3TSS A;  5D6J B;  4M02 A;  4TUU A;  2BWE S;  4DBG A;  2LVQ A;  4B9K A;  1E6E B;  2HJ1 A;  4JL9 A;  2KD0 A;  3I9V 1;  5EDS A;  3CST A;  4N9F 4;  1I4H A;  2QIL A;  1EWY C;  3EFC A;  3ZNG C;  2K6Q A;  2UU7 A;  1PGA A;  3NS1 A;  2L52 A;  4R3D A;  4NJ7 A;  3WIM A;  1EUV B;  3RNE C;  5FK9 C;  5BYQ A;  3OG5 A;  3Q3F A;  2WXF A;  1RAX A;  2LGI A;  2GBJ A;  3ZIM A;  3UF8 A;  1WXM A;  3Q2A C;  2M1M A;  3AE4 B;  2L83 A;  3NZ3 A;  1AWD A;  1OFF A;  2L8J A;  2WXM A;  3L16 A;  4ZDV A;  5C3J B;  2Z8L A;  2KXJ A;  5JHB A;  4B0E A;  3TEW A;  2WU5 B;  1P9D U;  3ZJT A;  1OEY A;  4EEW A;  3CMM B;  3VTV A;  4N58 A;  2FIF A;  3B08 A;  3T8M A;  4LNI A;  4AQ7 A;  2D10 A;  3W5V B;  1R4N B;  1V1P A;  1UH6 A;  3NVW A;  3UIN B;  2NR2 A;  1WM2 A;  1YN3 A;  1C1Y B;  3DDC B;  1N6Z A;  1FIQ A;  2OJW A;  4IM0 A;  2I38 A;  4KSL C;  4YSZ B;  2ONQ A;  4NNJ B;  1C78 A;  4RNA A;  4NJC A;  3UIO B;  3Q6B A;  3A9K A;  2BYV E;  1V5T A;  2KZR A;  1WY8 A;  1E90 A;  1PFD A;  2J52 A;  5IOI A;  4NZL B;  5HI1 A;  1VR9 A;  3TEY A;  2K9X A;  4J3O D;  4GDL A;  2M17 A;  1GB1 A;  2PPH A;  1K50 A;  1R4M B;  1V80 A;  3R2T A;  1L2N A;  4LTU A;  4LNO A;  2M4N A;  2ACZ B;  2MSE D;  1NVI D;  1T0S C;  2UYZ B;  3PRM B;  3ABV B;  2GBK A;  1RFA A;  2J0K A;  4HPL B;  2WDR B;  1F9J A;  3ZQ4 A;  5IP4 D;  5D3D A;  1T6B X;  1ROE A;  3LJ3 A;  2I2Y A;  3DWG C;  1RWS A;  2IY1 B;  1TGZ B;  3M63 B;  3MJW A;  4WJN A;  4XWW A;  2ASQ A;  3RPF C;  1FCC C;  3PO0 A;  3GB1 A;  1V6E A;  4OVZ A;  4FHK A;  4OHJ A;  5JZE B;  3AE8 B;  2JYE A;  5EE3 A;  2M8S A;  3UI3 A;  5EE9 A;  4I6P A;  1JWS D;  5D7G A;  2YEP B;  4XC2 A;  4MAC A;  1K52 A;  2MJ3 A;  3GE8 C;  2Z59 B;  2B3A A;  2JXX A;  4ZRQ A;  1V81 A;  2FCS A;  2O6V A;  4KGR A;  1SBB B;  4IOI E;  4RM8 A;  3IFW B;  1WE6 A;  4GDK A;  4L1B A;  1ENF A;  4AWJ A;  3QK0 A;  3R8B A;  4ZYS A;  2EMT A;  2JX5 A;  3EGR A;  2QMT A;  2OED A;  5HHD G;  2W55 A;  1E7U A;  1XEE A;  1LM8 B;  4ICV A;  5HFY A;  2LWP A;  1WGK A;  3KLS X;  4HJK A;  3TMP B;  1TIF A;  3ML9 A;  4FBJ B;  1RYJ A;  2R2Q A;  3GS2 A;  1D3Z A;  1P7F A;  3ZO5 B;  1YMH E;  5LXI B;  5C1Z A;  4HKZ E;  4L2Y A;  1JWB D;  1ZE3 D;  4GDK B;  2WU2 B;  2V9H A;  4WUR A;  1FPY A;  2YEP F;  3AEA B;  1TKE A;  2KWD A;  2PKO A;  2WP9 B;  3QHT A;  5G5H A;  1WSP A;  2QDF A;  3DBL I;  3RD2 A;  1WWT A;  4HCP B;  2JSV X;  3AEC B;  2KDI A;  3H6N A;  3MC0 B;  2IGG A;  3AE1 B;  3C8Y A;  2H89 B;  1QOF A;  1WF9 A;  3PPA A;  4GLS C;  1IP9 A;  4C56 C;  3QIJ A;  3ZYY X;  1HZ6 A;  1WZ0 A;  2BB6 A;  4LNK A;  4HRO A;  3D32 A;  2IY0 B;  1WGH A;  3NVY A;  4D2K A;  3VUX A;  2WHI A;  4FLH A;  1D5X C;  2INN E;  2KVR A;  4PYU A;  1SF0 A;  4ASW C;  3ZNI D;  4W9I A;  4B95 A;  2DZJ A;  1K8R B;  2CHZ A;  5CTR C;  3E9S A;  1GC7 A;  4NQL B;  3QX1 A;  3BY4 B;  4XWT A;  4B0M A;  3AM9 A;  2K3U A;  2MWS B;  4A9A A;  3RNB C;  3IBE A;  2C7N B;  1E7V A;  1VLB A;  1XT9 B;  1F77 A;  3AEG B;  2LXA A;  4ZRI A;  3TJP A;  2KC1 A;  2RMM A;  4K3C A;  3MHZ A;  3ENE A;  3TIX A;  1C4A A;  1UUP A;  1AW7 A;  1YIW A;  1D6E C;  2LZ6 A;  2MQJ A;  1TTN A;  2BVC A;  4MGK E;  3R7Q A;  3MC9 A;  2D3A A;  1BT0 A;  2LGS A;  1UZX B;  4TKN A;  2KWV B;  2N0S B;  5BMH A;  4OZA A;  2AQ3 B;  4JLC A;  3VUW A;  2BW2 A;  1L0Y B;  4DHZ E;  2HE7 A;  2WXR A;  3K9P B;  2AQ2 B;  3KYD D;  2IGD A;  2L0F A;  3RFZ B;  3PLU A;  3ONS A;  2UWQ A;  4HK2 A;  1V5O A;  1A70 A;  1AN8 A;  1R4N I;  1F2R C;  3AE2 B;  4K81 A;  3VVW B;  1TY2 A;  2ZVO A;  1D5Z C;  2JVC A;  4M8M A;  3ZNH B;  2PIA A;  4K7W A;  3R7R A;  1Z2M A;  5H92 C;  4M00 A;  3P1M A;  1C9F A;  2NMQ A;  1J7B A;  4MM3 A;  1HZ5 A;  3I57 A;  3PGE A;  1TS5 A;  2Q5W D;  5AZH A;  2ZCB A;  4NAW B;  1Q1O A;  2LGD A;  1SE9 A;  3DQV A;  2G45 B;  4G11 A;  5I4D A;  3JW0 X;  2MW5 A;  3KW5 B;  1EF5 A;  1YX6 B;  1SB3 C;  4GSW A;  2MP2 B;  1VD2 A;  3ZLZ A;  1RFK A;  3H1U A;  1T0Y A;  2MH7 A;  1IYF A;  2ZPN A;  1TZO A;  4UDU C;  1WGR A;  1N63 A;  2FID A;  3PZ7 A;  4ARI A;  2M0X A;  3OAW A;  1FNV A;  2LVP A;  4LDT D;  1WXV A;  4ZHO A;  2PEA A;  1JQ4 A;  1CMX B;  2X8X X;  2INC C;  4K7U A;  4C7Y A;  2W9N A;  4IM2 A;  1QZE A;  3IAM 1;  4C80 A;  1LFD A;  1NEN B;  1ZP0 B;  4YT0 B;  1UGJ A;  2L76 A;  4US9 A;  4XE0 A;  1QLB B;  4E71 A;  2BPS A;  3HVZ A;  3JSV B;  2CKH B;  1OQR A;  2LJI A;  3H7P B;  4KDI C;  3B2G A;  4BBN C;  2KFK A;  3Q8B A;  1AAR A;  3UIP B;  1UD7 A;  2IND C;  1WE7 A;  3MP9 A;  4GDL B;  1MJD A;  2GOW A;  2R61 A;  4ANX A;  3NY5 A;  2JZZ A;  2N9L A;  4W9F A;  2BB5 A;  2FCQ A;  3WAN A;  2KMM A;  2WXP A;  4W9K A;  3LB8 C;  5E6O A;  4WWO A;  1Y56 A;  3V6C B;  4C4V B;  3DBR I;  3VR9 B;  4KV2 A;  1E8Y A;  1FNW A;  3JVZ X;  1SE2 A;  4LNF A;  2I1J A;  1GC6 A;  2Z0D B;  2WQY B;  2HD5 B;  2O6V B;  2MBQ A;  4BKS D;  2RDB C;  2W54 A;  2MEK A;  4RGM A;  1BXT A;  2E3T A;  4BFR A;  3P63 A;  1JCK B;  1DGJ A;  2BWF A;  2W3R A;  2KMC A;  2KQ7 A;  3N32 A;  2YLM A;  1UWX A;  4DDG D;  3WAP A;  2DWQ A;  2L0T A;  2D5G A;  2DZM A;  3RMK C;  1PGX A;  2PW9 A;  4IDI A;  3R3M A;  5EE1 A;  4E3C A;  3BVZ A;  2JPH A;  4I6L B;  2MJE A;  2IO1 B;  2DYB A;  2V1Y A;  2J0J A;  4LCD E;  1SXT A;  1E8W A;  2LUM A;  3IVF A;  3IHP C;  5E6N A;  5JH5 C;  2D07 B;  2K39 A;  4F7Z A;  4ZHP A;  5EE0 A;  4A20 A;  1HQR D;  1OQY A;  2CHW A;  4MT5 A;  2KAN A;  1UF0 A;  4ZOH C;  2WXJ A;  5FR6 A;  4CO7 A;  4X57 B;  1KLU D;  2K25 A;  2ZNV B;  2K1F A;  1WMH A;  5DPS A;  2GBM A;  1UBI A;  1C79 A;  3B9J A;  3DBR B;  2KTR B;  1R7S A;  4N59 A;  2BBC A;  1WXA A;  1ESF A;  3NOB A;  3AU5 A;  2KK8 A;  2JF5 A;  2RSU A;  1HA5 A;  2GRI A;  2KDF B;  3OJ3 A;  2KAC A;  5D3I B;  1V2Y A;  4NPN A;  1CQV A;  3MHS D;  1EM7 A;  4KZ0 A;  4H2A A;  4G50 A;  3AE3 B;  2JRH A;  2KC2 A;  1WYG A;  4A6Q A;  1WRI A;  3NHE B;  1AYF A;  3TUO A;  2PVG C;  2KN4 A;  5KHO A;  5G5G A;  2QIE B;  1ZOY B;  4N6E B;  2GB1 A;  3N9Y C;  4O1N A;  3KUD B;  4P1B C;  2SAK A;  1J19 A;  2MBE A;  2KQ4 X;  4IUM B;  2O2V A;  1R4M I;  1YN5 A;  4TSS A;  4P16 A;  2NBW B;  2M0A A;  4KDL B;  4FUL A;  3PLV A;  4IKG A;  3AE9 B;  1QQR A;  2DNF A;  4HCN B;  1JW9 D;  3KUZ A;  3TCA A;  2W3S A;  2DEN B;  2LRW A;  2CU1 A;  2NVU I;  1WJ4 A;  2H88 B;  2ZW0 A;  1E8X A;  2QEJ C;  2IYD B;  2ZW1 A;  2KLC A;  2LGX A;  1TKG A;  3P4P B;  2R2O A;  3A4S C;  1ZW7 A;  3VR8 B;  4MGY E;  1ZDV A;  3NRZ A;  2ZCC A;  2BYE A;  1WJN A;  3IXS A;  1DOY A;  1XCT L;  2AL3 A;  3O65 B;  1C4P A;  1F0Z A;  3VTU A;  2VH1 A;  1P0R A;  3GOE A;  3N1X C;  2BKF A;  1PUT A;  2DYM A;  4YTP B;  1HXY D;  1OGW A;  4EFO A;  3U7Z A;  2G3Q B;  3AE5 B;  2LEK A;  2LAS A;  5D2M B;  3DVN U;  3DBH B;  4RF1 A;  2Y5P A;  2QJL A;  4ITK A;  1OEY J;  1T3Q A;  1YOV B;  1SJE D;  2K5P A;  3HK0 A;  3A9J B;  3TEX A;  3RNG C;  3ZNZ B;  4DWF A;  1WJ6 A;  3X23 A;  4Q2J A;  2KFJ A;  3AED B;  1BUI C;  2AWT A;  4A3P A;  2BYF A;  1RRB A;  2EKE C;  1TY0 A;  5AUI A;  3TEZ A;  3PT2 B;  1VZ6 A;  2JZP A;  3Q3O C;  3ZUN A;  4CQN A;  3R2I A;  1P98 A;  1XF5 L;  1U4A A;  1YNT E;  3DBL B;  4ACF A;  5G55 A;  1TYG B;  2LXC A;  4F8C B;  3LXF A;  1MVK A;  1ZUD 2;  1OQQ A;  1VZ7 A;  2IO0 B;  2PJH A;  2DHZ A;  2DYO A;  1A5R A;  4WAA A;  1TT5 B;  2RGF A;  3UGB B;  4WJP A;  1ZGU B;  5HKH A;  3PSE B;  1ET9 A;  3DCG A;  3L17 A;  1WI0 A;  4WWN A;  1L4Z B;  4RCO A;  2GI9 A;  4ZYN A;  4URK A;  3J9C A;  2ZEQ A;  3I63 C;  2BQQ A;  1J0G A;  1XLN A;  1K53 A;  4FA6 A;  2O2V B;  4AJW A;  2JRI B;  3C0R B;  2DAJ A;  3U30 A;  5FR3 A;  1MHH E;  4M01 A;  3B1L X;  3DWM A;  4HEA 1;  1WGG A;  3BYY B;  4HDQ A;  4C7Z A;  2ZVN A;  1I4Q A;  1H8C A;  3BIN A;  1HTQ A;  4WWM A;  2KQS A;  3KWV A;  3SFE B;  2MLB A;  3MFG A;  1D4B A;  3V6E B;  2MX2 A;  2FUG 1;  4AUQ C;  2XBB C;  3N1Z C;  2N9K A;  2XN9 C;  3VTW A;  4BKG A;  1FNU A;  1Q0W B;  5E6P A;  3V05 A;  3LYY A;  2TSS A;  3WAO A;  1VCB A;  2DBY A;  1FEH A;  2K8B A;  4C00 A;  3ZDT A;  4AOF A;  1PDX A;  4EKU A;  2J53 A;  1S1Q B;  5CHV C;  1STE A;  2FCN A;  4KGT A;  2FE8 A;  4A3O A;  3ZTC A;  1IPG A;  2X38 A;  1WXQ A;  3DBS A;  4GOC A;  3RI7 C;  3BZD B;  4JE3 B; 
#chains in the Genus database with same CATH homology
 4UDU C;  2WDQ B;  1NYQ A;  4OZC A;  1N63 A;  3PZ7 A;  3NVZ A;  4ARI A;  3BYT B;  1IBX A;  1FXI A;  3IT4 B;  1FNV A;  3ZJU A;  1TJE A;  3IAS 1;  1I4X A;  3P4Q B;  4ZHO A;  1YN4 A;  4JPS A;  3TSS A;  2JXT A;  1GOZ A;  5T8I A;  4DXF A;  1IBX B;  2Y5C A;  3EUB 2;  1JQ4 A;  1L0X B;  1YQ3 B;  1E6E B;  3I9V 1;  1N5X A;  1I4H A;  2QIL A;  1EWY C;  4HKQ A;  4C7Y A;  1C4C A;  1PGA A;  3IAM 1;  4C80 A;  3NS1 A;  1NEN B;  1ZP0 B;  2L52 A;  2WXK A;  4R3D A;  4YT0 B;  3U2S C;  1UNS A;  1UGJ A;  1Q10 A;  4US9 A;  5FK9 C;  5BYQ A;  1IUE A;  1FCL A;  1HEZ E;  2PTL A;  4XE0 A;  1QLB B;  5MPO A;  3HVZ A;  3AB5 A;  2WXF A;  2LGI A;  1C76 A;  2V0G A;  1OQR A;  5GXG B;  2LJI A;  1E0Z A;  3B2G A;  3Q8B A;  1JWM D;  1XLO A;  3NUH B;  3HUI A;  1SJH D;  3AE4 B;  2L83 A;  3NZ3 A;  1QKZ A;  1AWD A;  1FFU A;  1OFF A;  3AEF B;  1FRD A;  2WXG A;  3MP9 A;  4GDL B;  1L6V A;  3CWI A;  2WXM A;  3KWL A;  2R61 A;  1QF6 A;  1ET6 A;  1EU3 A;  5C3J B;  2Z8L A;  2CU3 A;  2WNM A;  3FIL B;  1ACC A;  2N9L A;  4B0E A;  2BB5 A;  3P4S B;  3TEW A;  2PVO D;  2KMM A;  2BYT A;  2WU5 B;  2WXP A;  2AQ1 B;  3LB8 C;  1KFY B;  2J4X A;  4NAM A;  3O13 A;  1Y56 A;  4EE2 A;  3ZJT A;  4RH6 A;  5BYR A;  5JXV A;  4N58 A;  3VR9 B;  3AH7 A;  1UWM A;  1KH0 A;  2EEL A;  4TQ1 A;  1P7E A;  1L4D B;  1FNW A;  4AQ7 A;  2LFI A;  1JWU D;  1SE2 A;  1I4G A;  3W5V B;  4LLG M;  4YSX B;  4A90 A;  1V1P A;  3NVW A;  2WQY B;  4REZ A;  1YN3 A;  2G9H D;  3CIR B;  1K51 A;  2W54 A;  1FM0 D;  1FIQ A;  2MEK A;  1QIL A;  2QSD A;  1EWC A;  4RGM A;  1BXT A;  2E3T A;  2E6X A;  1MI0 A;  2I38 A;  4YSZ B;  2ONQ A;  1C78 A;  1JCK B;  1DGJ A;  3P63 A;  2W3R A;  3AE6 B;  1L6U A;  4NJC A;  4RNA A;  1NEK B;  2JQR B;  2WXQ A;  2L32 A;  2HTM E;  3VRB B;  1UWX A;  3Q69 A;  2DWQ A;  2V3P A;  2D5G A;  2FBW B;  1CK1 A;  2BS3 B;  4OW0 A;  1PGX A;  2PW9 A;  4YSY B;  4IDI A;  1PFD A;  2J52 A;  1I4R A;  3BVZ A;  5EE1 A;  4NZL B;  5HI1 A;  4US8 A;  2MJE A;  3MJ5 A;  2WXN A;  3L4P A;  1VR9 A;  3TEY A;  2K9X A;  1KTK A;  3H8H A;  4J3O D;  1GB1 A;  1PYW D;  1K50 A;  1I4P A;  3R2T A;  4ZRP A;  4LTU A;  1SXT A;  2M19 A;  2LUM A;  5FKA C;  2ACZ B;  4ZHP A;  1NVI D;  2OHF A;  5EE0 A;  2IGH A;  1HQR D;  1V1P B;  4MT5 A;  4ZOH C;  2WXJ A;  1FO4 A;  5TSS A;  1SIJ A;  1C77 A;  2NTS A;  1EU4 A;  1KLU D;  3ABV B;  1DOI A;  3AEB B;  4YTM B;  2WDR B;  1C79 A;  3GP7 A;  3ZQ4 A;  3B9J A;  5D3D A;  1T6B X;  1BML C;  1ROE A;  2I2Y A;  3DWG C;  1RWS A;  3U4E G;  4N59 A;  1R7S A;  3VQI A;  2BBC A;  2DLB A;  3Q8F A;  4MH8 A;  4DXG A;  4XWW A;  3RPF C;  1FCC C;  4JWU C;  1ESF A;  2WDV B;  1QOG A;  3GB1 A;  2WXI A;  3PO0 A;  1GPX A;  4OVZ A;  1HA5 A;  4OHJ A;  4YTN B;  3AE8 B;  1SE4 A;  2GRI A;  2JYE A;  3Q8E A;  4PT5 A;  2KAC A;  5EE3 A;  3UI3 A;  1N62 A;  5D3I B;  5EE9 A;  1JWS D;  5D7G A;  1CQV A;  4ARC A;  2YEP B;  1EM7 A;  3AMZ A;  4MAC A;  3OWE B;  1K52 A;  2MJ3 A;  1YQ4 B;  4H2A A;  4RGN A;  1FRR A;  4ZRQ A;  1J7A A;  3AE3 B;  3V3X A;  1WYG A;  4A6Q A;  4WAF A;  2VZK B;  1WRI A;  3NVV A;  1AYF A;  1QOB A;  2PVG C;  2KN4 A;  3TUO A;  1RM6 C;  3W1S A;  2J42 A;  5G5G A;  2QIE B;  1ZOY B;  4KGR A;  1SBB B;  4IOI E;  4N6E B;  3BVM A;  2GB1 A;  2M56 B;  1TKY A;  4DQO C;  1L5P A;  2V3N A;  3N9Y C;  4O1N A;  1CZP A;  1KLG D;  4L1B A;  4L23 A;  1ENF A;  1YJJ A;  3R8B A;  4ZYS A;  2SAK A;  1E9M A;  2JX5 A;  2KQ4 X;  1JRP A;  1M4V A;  3EGR A;  2QMT A;  1YN5 A;  4TSS A;  4P16 A;  2OED A;  4USA A;  2IPK D;  2M0A A;  5HHD G;  4TMA B;  2W55 A;  3T3O A;  1TS4 A;  4AS1 A;  5LNK 1;  1DOX A;  1XEE A;  4IKG A;  2W82 A;  1DYQ A;  3AE9 B;  5HFY A;  1QQR A;  4YWG G;  1JW9 D;  2L1A A;  3P42 A;  2W3S A;  1WGK A;  2ICI A;  4YXD B;  1XCQ L;  3KLS X;  1N61 A;  2WXO A;  2H88 B;  1ZXH A;  2ZW0 A;  1RYJ A;  2XNA C;  2QEJ C;  3W2D A;  2ZW1 A;  4RFB A;  1ZPS A;  1TKG A;  3GS2 A;  3P4P B;  3VR8 B;  5AUK A;  4JX1 C;  3U52 E;  1E10 A;  1ZDV A;  3NRZ A;  1P7F A;  5H8Y E;  2ON8 A;  1YMH E;  3IXS A;  2K22 A;  4HKZ E;  1DOY A;  1XCT L;  3WCQ A;  1C4P A;  1F0Z A;  4L2Y A;  2NTT A;  3IT6 B;  1JWB D;  1FXA A;  1ZE3 D;  3BK2 A;  4GDK B;  2WU2 B;  2RDH A;  2BTE A;  4WUR A;  3BII D;  2AX5 A;  1PUT A;  2DYM A;  4YTP B;  2BS2 B;  1JWA D;  1HXY D;  2PMV A;  2YEP F;  1TKE A;  3AEA B;  2SEB D;  3U7Z A;  2KWD A;  2PKO A;  1PGB A;  2WP9 B;  2CJO A;  2LEK A;  3AE5 B;  1MHX A;  4FXC A;  5G5H A;  1VRA B;  1WSP A;  1FMA D;  4MM3 B;  3Q8A A;  4RF1 A;  2Y5P A;  2QJL A;  4ITK A;  1WWT A;  4RGO S;  2JSV X;  3AEC B;  1SE3 A;  1FFV A;  1T3Q A;  3SFD B;  3P4R B;  3E56 A;  1T5X D;  3MC0 B;  1SJE D;  2K5P A;  2IGG A;  3AE1 B;  3TEX A;  4A8X C;  2EKI A;  3C8Y A;  4Q2J A;  1I7H A;  4M0W A;  2H89 B;  1VZ8 A;  2MJD A;  1QOF A;  4GLS C;  2CJN A;  5BMG A;  2INP E;  3FAH A;  2N7J A;  3AED B;  4P6V F;  1BUI C;  3ZYY X;  4C56 C;  1HZ6 A;  2BB6 A;  4HRO A;  3NVY A;  4D2K A;  1TY0 A;  5E6J A;  5AUI A;  3TEZ A;  1D5X C;  2INN E;  1B9R A;  1J7C A;  1SF0 A;  1VZ6 A;  1B1Z A;  3BK1 A;  2JZP A;  2IDY A;  4OZB A;  4RGT A;  2JU6 X;  1SSN A;  4CQN A;  2RPV A;  1V8C A;  3R2I A;  1JML A;  1XF5 L;  2LHD A;  2V4I B;  2IJ0 A;  1IGC A;  1YNT E;  3E9S A;  4TQ0 A;  1TYG B;  1ZDX A;  3LXF A;  1XLQ A;  1TS2 A;  1MVK A;  1ZUD 2;  2WXL A;  1OQQ A;  4XWT A;  1VZ7 A;  3AE7 B;  4B0M A;  3AM9 A;  2K3U A;  1N60 A;  1IGD A;  4A9A A;  5BYS A;  2DYO A;  1VLB A;  5C2T B;  1F77 A;  3AEG B;  1VDV A;  4XDD A;  4HRS A;  2VZK D;  2RMM A;  4LK0 M;  3ZGZ A;  2LHE A;  3MHZ A;  3ZJV A;  1XO3 A;  3T3N A;  1C4A A;  1UUP A;  1AW7 A;  1ET9 A;  1D6E C;  2BT6 A;  1L4Z B;  4RCO A;  2B76 B;  2GI9 A;  2WLB A;  1TS3 A;  3KQ4 A;  3J9C A;  1KRH A;  3AEE B;  4WIP A;  1YJI A;  1XLN A;  2N0S B;  1K53 A;  1V1O A;  2KAJ A;  5BMH A;  4OZA A;  2AQ3 B;  3B2F A;  3W5U B;  2BW2 A;  1L0Y B;  3AN1 A;  5FR3 A;  1NYR A;  2WXR A;  1MHH E;  3HVD A;  2AQ2 B;  3ETR A;  3DWM A;  4HEA 1;  3BYY B;  4C7Z A;  1QT9 A;  1I4Q A;  1N5W A;  3Q8C A;  3HRD D;  2IGD A;  1L0V B;  4WWM A;  4HJG E;  3BWU D;  3KWV A;  2KDM A;  4WQM A;  1MPE A;  3RFZ B;  4RF0 A;  4WH4 A;  3SFE B;  1GB4 A;  3MFG A;  4XDC A;  5HG2 A;  1D4B A;  1A70 A;  1AN8 A;  2FUG 1;  1F2R C;  3AE2 B;  5BMI A;  1TY2 A;  3VRA B;  1QOA A;  1D5Z C;  3EA6 A;  3FIL A;  2N9K A;  2XN9 C;  1FD6 A;  4KGS A;  2PIA A;  1FNU A;  3V05 A;  1E7P B;  1F2R I;  3LYY A;  1XXG A;  3PZ8 A;  3AV8 A;  1JRO A;  2TSS A;  5H92 C;  3BVG A;  1D5M C;  4KX6 B;  4KKI A;  3P1M A;  3URY A;  1C9F A;  1JAL A;  1ZXI A;  1J7B A;  2NMQ A;  3W9C B;  3FC4 A;  4A55 A;  2PLP A;  4KKJ A;  2DBY A;  1FEH A;  1HZ5 A;  3I57 A;  1TS5 A;  2Q5W D;  4NAW B;  2Y3A A;  2JYT A;  1PDX A;  2HDE A;  2J53 A;  3SEB A;  1STE A;  2WXH A;  5I4D A;  4KGT A;  2FE8 A;  2WS3 B;  2K0P A;  2BS4 B;  1XLP A;  1SB3 C;  1VJK A;  1NI3 A;  2RDG A;  1LO5 D;  4JWS C;  1CJE A;  2LMC A;  1SEB D;  1V97 A;  2X38 A;  1RFK A;  3SR6 A;  1GAQ B;  1WXQ A;  2JWU A;  1KF6 B;  2MH7 A;  3BZD B;  2G1E A;  4JE3 B;  1TZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...