4ZHOA

The crystal structure of arabidopsis ferredoxin 2 with 2fe-2s cluster
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
97
structure length
97
Chain Sequence
b'ATYKVKFITPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEAIML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-2, chloroplastic
publication title Structure of the bacterial plant-ferredoxin receptor FusA.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Electron transport
total genus 24
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zhoA00
4YXDB 4YTMB 1GAQB 1XLPA 2B76B 2LEKA 1RFKA 3P4QB 4IDIA 2W3RA 1DOIA 2BS4B 3DWMA 1DOXA 3SFDB 2CU3A 1FM0D 1TJEA 2WDRB 4ITKA 1VJKA 1E0ZA 4YT0B 1V8CA 1SF0A 2WLBA 3AE7B 2M56B 4YTPB 1WGKA 2WP9B 1A70A 1QOAA 1JWBD 1TYGB 1E7PB 1RWSA 1JALA 2JX5A 1TKEA 3HUIA 4JWUC 4P6VF 4N58A 1I7HA 5AUKA 1NYQA 3B2FA 2PKOA 1FXIA 3AE5B 1ZOYB 5EE1A 2MH7A 2KMMA 1WWTA 1PDXA 1FIQA 4HROA 4JX1C 4USAA 3W5UB 3WCQA 1N5XA 1WRIA 3P1MA 1JROA 2W3SA 1FO4A 1NENB 5EE9A 3P63A 1AWDA 1TKYA 5AUIA 1NYRA 3VRAB 5C2TB 3AEAB 3NVZA 4ZOHC 2WS3B 1YQ4B 3CWIA 1WYGA 3AN1A 2W55A 3AE4B 1E6EB 1E10A 1KFYB 1VLBA 2MJ3A 2EKIA 1QOBA 1YJJA 3AM9A 3FC4A 3B2GA 2L52A 3DWGC 2WU5B 2Y5CA 3PO0A 3B9JA 1SIJA 1N63A 3NVYA 1ROEA 2G1EA 3FAHA 3HRDD 4LTUA 5G5HA 1N62A 2QJLA 2WU2B 1N61A 3ETRA 1QOFA 1N5WA 2CJNA 4N6EB 4YTNB 2PVOD 3AMZA 1NEKB 3KWLA 3AV8A 1JWAD 1B9RA 2M19A 3AE1B 3AE3B 1PFDA 5GXGB 3VR9B 5MPOA 2MJEA 1PUTA 1DOYA 1QOGA 1RM6C 2L83A 2PIAA 1CJEA 1NI3A 2FBWB 1ZUD2 2K22A 5EE0A 2HTME 3W9CB 1NVID 2BS3B 1XO3A 2H88B 3SR6A 1QT9A 1DGJA 1QF6A 3AH7A 2WDQB 3NRZA 1E9MA 1KF6B 1L6UA 1XLQA 2W54A 1AYFA 3AE2B 3NVWA 4US9A 1FFUA 1OQQA 1J7BA 1WXQA 3VRBB 3HVZA 3ABVB 1GPXA 5EE3A 3AE8B 1V97A 2WDVB 3CIRB 3NS1A 3AEFB 3P4RB 3VR8B 2CJOA 1CZPA 1L6VA 2OHFA 2JQRB 3AEGB 4HRSA 3EUB2 3RPFC 5C3JB 1J7AA 4ZHOA 1JQ4A 4FXCA 5H92C 2K9XA 2WQYB 3P4SB 2N0SB 1JRPA 1ZXIA 1FRDA 1YJIA 2MJDA 3AEDB 3P4PB 1L0VB 3AE9B 3SFEB 4YSXB 2KAJA 4US8A 3L4PA 1SB3C 2ACZB 2BS2B 4ZHPA 1OQRA 4JWSC 4KX6B 2QIEB 3BIID 1N60A 4WQMA 1QLBB 1FXAA 1TKGA 1R7SA 1IUEA 1XLNA 4WWMA 3W5VB 1F0ZA 2H89B 2BT6A 5H8YE 3LB8C 1VDVA 2DBYA 2E3TA 2PVGC 4C7YA 1FRRA 3AECB 1T3QA 3AEEB 5G5GA 2K5PA 2AX5A 1EWYC 1KRHA 1J7CA 3AB5A 1RYJA 1L5PA 1OFFA 4YSZB 1XLOA 1UWMA 1ZP0B 1FMAD 4N59A 4A9AA 4C80A 3NVVA 1YQ3B 3LXFA 4YSYB 3ZYYX 3AEBB 4C7ZA 2Q5WD 1FFVA 3AE6B 2DWQA 1JW9D
chains in the Genus database with same CATH superfamily
4EFOA 2FCNA 2Y5BB 5JH5C 2DHZA 4URKA 3H6NA 2VH2A 1ZXHA 2KC2A 2PE6B 1R4MI 4IG7B 2LFIA 2WX0A 4NAWA 1R4NB 2LJ5A 1F77A 3IT4B 4JWUC 2IZVB 5DPRA 2HDEA 3EA6A 3L08A 2YEPB 5DPTA 3A1QA 2QMTA 4AJYB 4C00A 3Q8BA 3WCQA 4USAA 4A6QA 4BKSA 4NPNA 4ZOHC 5CX3A 4P16A 1WE7A 4RGTA 1WJ4A 3Q3JA 1MI0A 3B9JA 3HRDD 2M1MA 1ET6A 2GBNA 3FILA 5C23A 3L0WB 3RUIB 2WXMA 1RM6C 4S0RA 3OJ3A 4II3B 2O6VD 1PGXA 4KV2A 4DWFA 1HEZE 4HJGE 1QT9A 2E6XA 2ZW0A 3E56A 3QQ8B 2GMIC 4MELA 3RT3B 1HA5A 4IC7B 3HVZA 1GPXA 4B0MA 2WDVB 4KZ0A 5D6JB 4PYUA 3GOEA 1CK1A 3PSEB 1WXMA 2KACA 1ZXIA 3OAWA 4JIOU 2L8JA 4ZHPA 1IGCA 1OQRA 4ANXA 3N20C 1YN3A 2LI5A 2Z59B 2H89B 2OJRA 4I6NB 1ESFA 4KGSA 1XEEA 1FCLA 3QIJA 4NY0A 4ZYNA 2YVCA 4ZDVA 3CF6E 1SJED 2KZRA 4GDLB 4IWQA 5FK9C 2KFKA 5T8IA 5HHDG 1D5ZC 2BYEA 2ASQA 2IO1B 3PHXB 1HTQA 4L1BA 5KHOA 3NZUA 3GE8C 3UINB 4C56C 3B2FA 2L0TA 3HM3A 1UELA 4AWJA 2WXIA 2BB5A 3N32A 3APCA 3A9JA 2JU6X 3RNEC 1SGHA 4P1BC 5AUIA 1KFYB 4KKJA 2WXRA 4X57B 1UD7A 2EKIA 3AM9A 2Y5CA 4QAYA 2K8HA 2MLBA 1NDDA 2YLMA 3R2TA 3ETRA 1C4AA 3Q2AC 1B9RA 3VR9B 2O6VB 1WF9A 1OEYJ 3WAOA 3TMPB 4A3PA 3NG0A 1XO3A 2WX1A 4EUTA 5D94A 3TUOA 2DYBA 3KYDD 2WDQB 1Y56A 3PZDA 2PJHA 1LFDA 2NPTA 5HKHA 2MW5A 1V97A 2CJOA 4I6LB 4TV3A 4GB9A 2KN5A 2K6QA 3P4PB 3MHSD 2HD5B 1UWXA 1L4ZB 2QIEB 3QX1A 1E5WA 2DLBA 3MC0B 3ZRCA 2KMCA 3BINA 4GU2A 3C19A 2PLPA 4XZ4A 1OFFA 2C9WB 3GZNI 3AU4A 1S1QB 1YQBA 3IBEA 4N9F4 4E3CA 2XN9C 4HDQA 1Z2MA 4B6WA 4R3DA 5J2RA 2DWQA 3HHMA 2DYMA 4OVVA 1ZPSA 3U2SC 2DENB 4ITKA 1C4PA 4KGTA 4WURA 1HE8A 3PHWB 3VTUA 2BPSA 1V8CA 1I4QA 2ZVNA 4WIPA 4IWPA 4HKZE 4B9KA 5J17A 3Q3FA 2FAZA 2KC1A 2MA9B 2OEDA 3JVZX 2JZ3B 4IOIE 1LM8B 3FKYA 1F2RC 1MJDA 2W3SA 3TL5A 4WJQA 4RGMA 1VZ7A 4GDKA 4GDKB 1VLBA 1E8WA 2LGDA 2RPQA 3U8ZA 5G5HA 1I4XA 2WU2B 2EKEC 2A5UA 4YTNB 1EWCA 1STEA 3QJZA 4GOCA 2LMCA 2BS3B 1YX5B 3U7ZA 3AE2B 1L7YA 5HG2A 4D2KA 4MEMA 3AE8B 3CIRB 2J0JA 1Q10A 1SEBD 2LVOA 3AEGB 3B1LX 3U30A 4YSXB 3ZNHB 3QA8A 4WH4A 2D3BA 2JT4B 1FXAA 3WAMA 5H8YE 2AQ1B 4EZLA 2K5PA 4YSZB 2R2QA 1I4PA 2KD0A 5IN7A 4YSYB 2N9EB 1NBFC 2Q5WD 3NHEB 3U52E 2LASA 4GIVA 4YTMB 3SFDB 3SHQA 1IBXB 2NR2A 2PW9A 3T9LA 1VJKA 4XYCA 2DZIA 4G11A 1GOZA 3ZJTA 2PMVA 1TYGB 2W82A 4KKIA 1VCBA 1WJNA 4RGOS 1XQQA 4M00A 2JRIB 1SE4A 1V1OA 4ACFA 2PE9A 2J0MA 4FHKA 3BK2A 3DBLB 1HZ6A 1GG3A 2NMQA 3A9KA 3A9KB 3JSVA 1SJHD 1KM7A 4DDGD 3ML9A 1AW7A 4MJSB 4KSKC 2NBVB 2KWUB 3QK0A 2L83A 4P7IA 2D07B 1L2NA 2M0XA 2BB6A 2HTHA 1OGWA 2K22A 2KDFB 1FD6A 4MM3A 1V1PA 2KJHB 4MM3B 1TS4A 5AEKB 3Q69A 1J7BA 3VHTC 4DK5A 3PREA 5E6JA 2KXJA 1OEYA 3TEXA 3Q8FA 3B0AA 3P4SB 3AEDB 4C4VB 4BFRA 3DBRI 3KUCB 2KAJA 3W1YA 4GMVA 4YWGG 2MBOA 2JSVX 4HLEA 1XLNA 1WGDA 2O2VA 1VDVA 2DBYA 3PRPB 1WXVA 1D3ZA 2X38A 1FXTB 2NS5A 1L5PA 1UWMA 1ZP0B 1KOTA 3NVVA 3RNGC 4RM9A 4C7ZA 4K3CA 2KLGA 2ZZPB 1AARA 3M62B 2K0PA 1T5XD 1EUVB 1M94A 2ZVOA 4DXAB 1DOXA 1IGDA 2D2QA 4WQOB 2KMAA 2MWSB 4KDIC 3NS8A 4YT0B 5I4DA 1SF0A 4G3XB 1WGKA 2WP9B 3Q3MC 1QOAA 1KLVA 3CSTA 1WGYA 3QARA 5DPWA 2BYFA 4BAXA 1C3TA 4JX1C 3P1MA 2KWDA 2BTEA 3APFA 1ISNA 2LXAA 2WS3B 1WYGA 2BGFA 3P2BA 1YJJA 2I2YA 3R8BA 2QSDA 4UDUC 5JHBA 4DHZB 4LTUA 3C0RB 4RFBA 2XBBC 1I42A 1UUPA 2J0KA 3N30A 3AMZA 2FNJB 3AE3B 4LJOB 4HKQA 1XF5L 1XD3B 1CJEA 1E7VA 5DCNA 2MBHA 4OHJA 1NVID 1YMHE 4WWOA 1SE3A 1DGJA 2B3AA 3NVWA 4IM2A 2J53A 2INCC 4FULA 1LQBA 3WIMA 3NS1A 2CKHB 4L23A 4HRSA 5LNK1 2ZPNA 4E71A 3IAS1 1WR6E 2KJ6A 4ZRJA 2L0FA 4ARCA 2N7EA 4AUQC 1K53A 2KANA 2HJ1A 1FRRA 2XNAC 4W9HA 1T3QA 2AYOB 1S3SG 3PS6A 2KQ4X 3UGBB 3DPDA 1P0RA 2GBKA 3ZYYX 2DZMA 4CHKA 1UNSA 3DOWA 4TUUA 1RRBA 1TJEA 2WXQA 5BYQA 1WZ3A 2MP2A 4YTPB 3ZDMC 2LZ6A 3GZNB 1RWSA 1JALA 1I7HA 5J18A 2GBJA 1WX8A 1FXIA 2CHWA 4HROA 3MP9A 2LGXA 2HE7A 2K8CA 2WNMA 1JROA 3PLUA 1TS5A 5JHAA 4GGQA 1GC7A 1A5RA 5L83A 1E6EB 2BVCA 5EDSA 1E90A 2BKRB 1TT5B 2FCQA 1HXYD 3D32A 2JF5A 2V4IB 1N63A 3NVYA 3T3NA 3FAHA 2ZPYA 3K9OB 1N61A 1WGHA 3MJWA 3VTVA 5TSSA 2JRHA 3ZXRA 2MEKA 3H8HA 3WALA 2QCZA 4H2AA 2WXKA 1L0XB 3BVGA 3I3TB 2H88B 5CHVC 3SD5A 3ZGZA 1N6ZA 1OQQA 2VRRB 3E9SA 3Q14C 4IWOA 5E6PA 3VR8B 1E8YA 1V6EA 2OHFA 2BBCA 1JRPA 1FRDA 2KN4A 1J19A 1SB3C 4ANWA 1TIFA 4XDCA 2J52A 4JQWC 1IUEA 1GUAB 1FCCC 4IW0A 3M3JA 1EWYC 1J7CA 4IUMB 2ONQA 3V3XA 2GBRA 1F2RI 1XLPA 4REZA 2W3RA 2DZKA 2L76A 2IBIB 4L2YA 1YNTE 2D10A 4FJVB 4P6VF 4BKTA 3UF8A 2V9HA 3ZLZA 1MG8A 1HQRD 1WWTA 1PDXA 4GDLA 3ZJUA 2CHZA 4OW0A 1X1MA 1SIFA 2LWPA 3DHGC 1YQ4B 3SEBA 3WANA 2LJIA 4EKUA 3DHIC 3V6CB 1TZ1A 2JY6A 2MJ3A 4P1CC 1EM7A 1YOVB 1WX7A 2HJ8A 2G1EA 5E6OA 3U4EG 4FA6A 5JZEB 2M19A 4W9EA 3DBHI 1NI3A 2REXA 3NJTA 3KWVA 1P3QU 4HCNB 2RDHA 1I4GA 4BZAA 4J6IA 1RFAA 4DHJD 2IGGA 2W54A 3VQIA 1T0SC 3DDCB 2WYQA 2N9XA 1I35A 1KLUD 3DVNU 4KGRA 1JWSD 3DQVA 3V05A 2ZNVB 4YL8A 3VUYA 1L0VB 2O6VA 3PZ7A 3L54A 2IPKD 2KVRA 3QAQA 4M0WB 4XWWA 2ZEQA 4AJWA 3H9DA 2JUOA 3VAWA 1V86A 1WJUA 1KRHA 1RYJA 2ZW1A 2WGSA 3ZTCA 5C1ZA 1VZ6A 4TQ1A 1WGRA 3DBRB 2K39A 1GB4A 1FFVA 4ZRPA 3OJ4B 3UIPB 1HTOA 2LEKA 4OZBA 1QILA 1XXGA 4FHJA 3DWMA 4E74A 2CU3A 3UQAA 1VRAB 3AU5A 2G45B 3APDA 3LYYA 2KQSA 2IO0B 2I38A 3VXWA 2V4LA 2L7RA 2NVUI 3N1ZC 2R2OA 3QCAA 1A70A 1Q0WB 3L10B 2C7MB 2V3PA 4RH6A 2JX5A 4BKGA 4TSSA 5DPSA 4G0NB 1V81A 4W9LA 1ZGUB 3W5UB 3ENEA 2KDIA 1UBQA 3H1UA 3U7DA 1V80A 1EU3A 1AWDA 2EMTA 3DBSA 3W2DA 3CWIA 2FUG1 4DHZE 4PT5A 3FC4A 3PZ8A 3DWGC 1Z5SB 5FR6A 2NCNA 1GC6A 1WYWB 1KH0A 3CSFA 4MH0E 2BYTA 1OQYA 1QOFA 4HXDA 1NEKB 5GXGB 3ZXVA 5G2NA 3NOBA 2LVPA 1RAXA 2FBWB 4J3OD 1V9JA 2HTME 2MBEA 2C7HA 4DHJB 4W9CA 3RMKC 2CU1A 3DCGA 4JGHB 1R4NI 1YX6B 2LD9A 1LO5D 4TKNA 3IVFA 3TEWA 3RPFC 2KK8A 4ICUA 3Q8AA 1J7AA 3ZJVA 2K9XA 4LCDE 3QWZB 4M01A 4NJ7A 3Q8CA 5CHWA 2UWQA 4US8A 1WIAA 4RGNA 2QEJC 5CHFA 5BMHA 1IPGA 1F0ZA 3SDLC 4KIKA 2LGYA 4KIKB 3C8YA 2KYWA 1XT9B 4OVUA 3PRZA 4FJZA 2KKCA 3PVLA 2BWES 5IAAC 4PS7A 2R61A 4NQKE 2WDRB 4NJCA 2WXFA 3I5JC 1WGGA 3RNCC 2KTFA 2MSED 3P42A 5IO9A 3PRMB 4W9GA 2DAFA 2M56B 4XE0A 4CQNA 1ENFA 1Q1OA 3VDZA 4B0EA 1C77A 2NTTA 3MHZA 1CQVA 2CS4A 4HPLB 2LHEA 3ZUNA 2OOBB 2PEAA 2C7NB 1WJ6A 1WY8A 1ZE3D 2QDFA 4BBNF 3OLMD 1FO4A 3I57A 4LNNA 5EE9A 3VRAB 4BBNC 1IBXA 2MCNB 4AOFA 3ONSA 5IOIA 5FR3A 5TR5A 1QOBA 1XCQL 2DZJA 3EHVA 3ZNID 5E6NA 4AQ7A 1P9DU 2WXOA 1YD8U 3ZO5B 5L95C 4DDID 4HWIB 2PIAA 3BYTB 2XK5A 2XK5B 1R4MB 3GB1A 1WZ0A 2LGSA 4RM8A 1SXTA 1SE2A 1E9MA 1WM2A 3S2AA 4HCPB 5EE3A 3RN9C 4MH8A 3WA0A 2L32A 3ZRFA 4MJSA 2JZPA 2QHOA 3O65B 4LDTD 1JQ4A 1UF0A 4NJ6A 2IGDA 5CTRC 4B95A 3M95A 1C76A 1QLBB 4ZYSA 1TKGA 2IO2B 3HVDA 2E3TA 1I4HA 4MGYE 2MX2A 2Z8LA 4IM3A 3ZNGC 3VUXA 2KJRA 1XLOA 1FMAD 1C9FA 1YQ3B 4JLCA 4NZLB 1JMLA 4JE3B 4C4VA 3AI5A 1YJ1A 4MT5A 4ZRQA 4YXDB 2PTLA 4II2B 2D3CA 5HI1A 3A4RA 2INNE 4K3BA 3ZNZB 4OVZA 3UI3A 1H4RA 4W9KA 1E0ZA 1AN8A 4MDKE 3WAPA 2G4SA 3PGEA 3EFUA 3MTNB 1C4CA 2JYEA 3RI7C 1Q5WB 3KUZA 2WXNA 3AE5B 3GP7A 5IA7A 4JPSA 2VZKD 3CMMB 2J7QB 5BYRA 4BVUC 3NVZA 1LXDA 3AN1A 3M63B 4WJNA 4M8MA 1WFYA 2K25A 2KHWB 3PV1A 4FJYA 2CJNA 1N5WA 3KQ4A 3KWLA 2JYTA 5MPOA 4WWNA 1Y8RC 3JW0X 1TBEA 2N9KA 3BVZA 3PPAA 3T8MA 1GJZA 2IJ0A 1AYFA 1FFUA 3VRBB 4K7WA 1T0QC 4KVGB 4LDTB 3I9V1 2L1AA 2MQJA 2N0SB 5BMIA 2EELA 5D7GA 5LXHA 1WMHB 2KDEB 4EOYA 1JRUA 3GE3C 2G4DB 2CHXA 3ML8A 2RGFA 5G5GA 1EO6A 4KDLB 2GB1A 4N59A 4A9AA 2GBMA 2BF8B 2MBQA 1F1HA 5AZHA 4CYEA 3IFWB 2ACZB 2GOWA 2ICIA 5IP4D 1L4DB 1P1AA 2FIFA 2JWUA 2RDBC 2WXPA 2C5LC 3B08A 4BKSD 3N1YC 3QHTA 2BW2A 1TKEA 2GI9A 3HUIA 1XCTL 1BXTA 1NYQA 1WX9A 2MBBB 2Z0DB 1WM3A 2VZKB 1UBIA 2KMMA 1B1ZA 1N5XA 3P63A 3OG5A 3AEAB 2DX5B 1HZ5A 2N4FA 4S17A 1T6BX 1SBBB 4RF1A 2INPE 1N62A 2KTRB 3IHPC 4LJPB 2PVOD 4AS1A 1BT0A 2WHIA 2ZNVC 1V5TA 1CMXB 1TY2A 4Q2JA 4F8CB 2KDBA 2KWCA 2MRPA 1E8ZA 2MHJA 3NRZA 1L6UA 1KF6B 1FNVA 3R7QA 1C78A 2KQ7A 3VTWA 1L6VA 2DNFA 1VD2A 2UYZB 3V61A 3AE9B 1H8CA 1D5MC 5BYSA 1D6EC 2KOXA 2LUEA 3Q6BA 1UZXB 2D3AA 1R7SA 3DBLI 4WJPA 2ON8A 4NAWB 3W5VB 3BVMA 2LHDA 2KT7A 5AZFA 1ZW7A 2D3GA 4MGIE 3IAM1 3NZ3A 3A1QB 3PLVA 4OZCA 5D3IB 2AQ3B 2M4NA 2IY0B 3BYYB 1D4BA 3X23A 1QQRA 1VR9A 3PT2B 1V49A 3NY5A 1L0YB 1WE6A 2JPHA 4DXGA 4N58A 3L13A 1G6JA 2PKOA 3FILB 2LVQA 3ZKJC 4F7ZA 3TIXA 1KTKA 1BMLC 1WSPA 4WAFA 1EF5A 4AP4C 1NENB 1GNUA 3MJ5A 2WXGA 1C1YB 3ZVVA 2JWZA 4LK0M 3B2GA 2K1FA 4A8XC 3RFZB 1WR1A 3BWUD 4EZJA 4FN2A 1MHHE 4LNOA 3DVGX 3AE1B 3KUDB 3L16A 2AL6A 4PS8A 1M4VA 1ZUD2 3RNAC 3N1XC 2L3ZA 5HFYA 2WDTB 1K51A 2NBWB 1PQSA 3JYUA 3BY4B 4ICVA 4M8NA 4KZCA 1K52A 4M02A 3RYTA 1ET9A 3VH3B 4ZHOA 1IYFA 5H92C 3SFEB 2KFKB 3V6EB 3L4PA 2DYOA 4A55A 2BS2B 2LRWA 4WQMA 3ZW3A 3DVGY 4ANUA 2QC8A 2VH1A 3LB8C 2M8SA 2RPVA 3AECB 2KX0A 3KW5B 4XWTA 2GLSA 2X8XX 1SSNA 4C80A 4A20A 3AEBB 1MHXA 3A9JB 2I1KA 2JXXA 1GAQB 1F52A 2CR5A 3ECIA 3P4QB 4IDIA 2IYDB 3Q3NC 4MGKE 2J4XA 4M0WA 3I63C 1WH3A 2QILA 3PTFC 2J42A 4HDOA 5AUKA 2SEBD 2M0AA 1TS3A 1PGAA 1FIQA 2GRIA 4XGAB 1MG4A 1SE9A 1WRIA 3MC9A 3N9YC 2V3NA 1TKYA 1WXSA 4MACA 2N9PC 3QC8B 2NPTB 3VUWA 3VH4B 3PO0A 1YN4A 1SIJA 1ZKHA 1RLFA 2QJLA 4N6EB 2Z0EB 4ARIA 2MJEA 2IO3B 1ZDXA 4HPMB 5G55A 2NBUA 4K7SA 1TZOA 4W9JA 3AH7A 5LXIB 2WXHA 1ZDVA 1J0GA 1MPEA 3P4RB 3RNBC 1FNUA 3EUB2 5JXVA 4FXCA 2G9HD 4LNIA 4NNJB 1YJIA 2TSSA 2D5GA 2FE8A 2G3QB 4F1SA 2RDGA 5AZGA 2XEWA 4NAMA 4K81A 2INDC 2BKFA 4MSMB 2N1VA 3EGRA 1PGBA 4RCOA 1P7FA 4JL9A 1TS2A 3ZIMA 3AE6B 3T3OA 4G50A 3VFKA 4RF0A 1I4RA 3MC8A 3R66C 2NTSA 2WLBA 2K8BA 2LRUA 3GS2A 4FADA 4CO7A 2KX3A 1NI2A 5GMVA 2ZCBA 2V0GA 3HM6X 2MH7A 2JVCA 1KJTA 1LGRA 3ZDTA 4GXBA 1EU4A 1NYRA 2V1YA 4XC2A 3AE4B 1E10A 3A4SC 3IXSA 2AQ2B 1UGMA 3L17A 3AULA 1FPYA 1PFDA 1DOYA 1PUTA 1QOGA 4HVBA 2WWZA 3BK1A 3DVNV 3TSSA 3TEZA 5KHQA 2RMMA 5D2MB 3SR6A 2RSUA 1XLQA 1YIWA 1WXQA 1DYQA 3Q8EA 3ABVB 4MGZE 1V5OA 3KYCD 2JQRB 3H7PA 4IKGA 3H7PB 5D3DA 4HJKA 2W9NA 3H7SA 2UU7A 3R2IA 1WI0A 1UH6A 4GLSC 1K8RB 1WRDB 4KX6B 1N60A 4PYZA 2BWFA 3RZWC 2IGHA 1P98A 3SU8X 3V62A 3ZQ4A 4C7YA 1VZ8A 1WXAA 1QZEA 3ALBA 2D11A 5BO4B 3TBLD 4ASWC 3KLSX 2B76B 3RZFA 4IM0A 1DOIA 2LGIA 2BS4B 3A33B 1TTNA 3AE7B 3EFCA 1JCKB 3JSVB 1FNWA 1JWBD 4A3OA 3DHHC 2Y5PA 3BZDB 2BYVE 3UQBA 2EMSA 1ZOYB 2SAKA 3AXCA 1QKZA 2N1WA 2WXJA 2A4ZA 1JWMD 1K50A 4ANVA 4HK2A 4DXFA 4ZRIA 1V1PB 1IP9A 3RULA 4DQOC 1YN5A 1TY0A 2L52A 3VVWB 2WU5B 3K9PB 4DBGA 1GB1A 3W1SC 2AEHA 2KWVB 5IKCM 1JWAD 1OTRB 2V3SA 2K6DB 2JZZA 1MFWA 3W9CB 4HPPA 2O2VB 1QF6A 3R7RA 3RNFC 2DAJA 4K1RB 1F9JA 4FLHA 4HEA1 5BMGA 4EZKA 2YEPF 2RD0A 2WQYB 4XX5A 3HK0A 3LDZE 3TCAA 4TMAB 3HIZA 2KVZA 4GSWA 3RD2A 2FUHB 2I1JA 4LNFA 2K3UA 3X0WA 4WWMA 2KO3A 2KLCA 1T0RC 2AWTA 3KH0A 3EECA 3LJ3A 3AB5A 1C79A 4OZAA 1FEHA 3R3MA 4BOZB 4FBJB 3UIOB 3N3KB 1EF1A 4W9FA 1E7UA 3OWEB 3DBHB 2C60A 4W9IA 1RFKA 1WMHA 2N7JA 1FM0D 2IDYA 2OJWA 2KNBA 3IT6B 1J8CA 2Y3AA 5LLIA 3Q3OC 1TGZB 2PPHA 4WAAA 4TQ0A 1E7PB 4O1NA 2KFJA 5EE1A 1E8XA 4EEWA 2FCMA 2L00B 1V2YA 4KSLC 5C2TB 4LLGM 2N7DA 2W55A 4RMAA 1MVKA 1UGJA 2N9LA 1D5XC 4NQLB 1U4AA 1ROEA 2FIDA 2IY1B 3NUHB 4PK1A 1ACCA 3URYA 2BQQA 3AV8A 1KLGD 3V60A 4ZRKA 2JXTA 3TJPA 2KDMA 3O13A 4MSQB 2LXCA 2WXLA 4RNAA 3J9CA 5EE0A 4A90A 2ZCCA 4K7UA 2M17A 4EE2A 2FCSA 4US9A 3EC8A 4XDDA 4LNKA 2RR9A 4W9DA 3AEFB 1CZPA 2AL3A 1JWUD 1P7EA 2LUMA 5C3JB 2KTRA 1BUIC 4I6PA 4WJOA 3ZTDA 3RCZA 2MJDA 4PS3A 4JWSC 2L05A 3BIID 1PYWD 3NZSA 3KVFB 3MFGA 2BT6A 2PVGC 5FKAC 3TEYA 2MP2B 2ZJDA 4WWPA 3AEEB 3W1SA 4GN1A 2AX5A 4BOSC 3IG3A 3LXFA 1T0YA 1JW9D
chains in the Genus database with same CATH topology
1GAQB 3P4QB 4IDIA 1ZXHA 1DOXA 2R61A 1IGDA 2WDRB 2J4XA 2WXFA 4NJCA 2LFIA 4M0WA 3P42A 4YT0B 5I4DA 1SF0A 1F77A 2M56B 1WGKA 2QILA 2WP9B 4XE0A 2J42A 1ENFA 4CQNA 1QOAA 3IT4B 4JWUC 4B0EA 1C77A 2NTTA 2SEBD 2HDEA 2M0AA 3EA6A 1CQVA 3MHZA 5AUKA 2YEPB 2QMTA 1TS3A 1PGAA 1FIQA 2LHEA 3Q8BA 4JX1C 2GRIA 4USAA 3WCQA 1WRIA 3P1MA 1ZE3D 3N9YC 2KWDA 2BTEA 2V3NA 1FO4A 4A6QA 3I57A 5EE9A 1TKYA 3VRAB 1IBXA 4ZOHC 2WS3B 1WYGA 5FR3A 4P16A 4RGTA 4MACA 1QOBA 1XCQL 1YJJA 2I2YA 1MI0A 3R8BA 2QSDA 4UDUC 3PO0A 3B9JA 1YN4A 1SIJA 4AQ7A 3HRDD 4LTUA 2QJLA 4RFBA 2WXOA 1UUPA 1ET6A 4N6EB 3AMZA 3FILA 3AE3B 4ARIA 2MJEA 4HKQA 2WXMA 1RM6C 1XF5L 2PIAA 1CJEA 3BYTB 1ZDXA 3GB1A 4OHJA 1NVID 1PGXA 1SXTA 1YMHE 1HEZE 4HJGE 1SE2A 1QT9A 2E6XA 1SE3A 1DGJA 1TZOA 2ZW0A 3E56A 3AH7A 3NVWA 1E9MA 2WXHA 1ZDVA 1HA5A 2J53A 3HVZA 1GPXA 5EE3A 4B0MA 1MPEA 3NS1A 2WDVB 3P4RB 4MH8A 4L23A 1FNUA 2L32A 1CK1A 4HRSA 3EUB2 2JZPA 5JXVA 5LNK1 2KACA 1JQ4A 4FXCA 2G9HD 1ZXIA 3IAS1 1YJIA 2TSSA 2D5GA 2FE8A 4ARCA 2IGDA 4ZHPA 1IGCA 1OQRA 2RDGA 1C76A 1QLBB 4ZYSA 1TKGA 1YN3A 1K53A 4NAMA 2H89B 3HVDA 2E3TA 1ESFA 4KGSA 1I4HA 1FRRA 2XNAC 1XEEA 1T3QA 2Z8LA 1FCLA 2KQ4X 3EGRA 1PGBA 4RCOA 1P7FA 1XLOA 1FMAD 1C9FA 1YQ3B 3ZYYX 1SJED 4NZLB 1TS2A 3AE6B 3T3OA 1JMLA 4JE3B 4GDLB 4RF0A 5FK9C 1I4RA 1UNSA 5T8IA 4MT5A 4ZRQA 4YXDB 2PTLA 5HHDG 5HI1A 1D5ZC 2NTSA 2INNE 1TJEA 2WXQA 5BYQA 4L1BA 4OVZA 3UI3A 1E0ZA 2WLBA 1AN8A 3GS2A 4YTPB 1C4CA 2JYEA 4C56C 1RWSA 1JALA 1I7HA 3B2FA 2WXNA 1FXIA 3AE5B 3GP7A 2V0GA 2WXIA 4JPSA 2BB5A 2MH7A 4HROA 3MP9A 2VZKD 2JU6X 2WNMA 1JROA 1EU4A 1TS5A 5AUIA 1NYRA 5BYRA 3NVZA 3AN1A 3AE4B 1E6EB 1E10A 1KFYB 4KKJA 2WXRA 2EKIA 3AM9A 3IXSA 1HXYD 2AQ2B 2Y5CA 2V4IB 1N63A 3NVYA 3T3NA 3FAHA 3R2TA 3ETRA 1N61A 2CJNA 1N5WA 3KQ4A 1C4AA 1B9RA 3KWLA 2JYTA 3VR9B 5MPOA 5TSSA 1PFDA 1DOYA 1PUTA 1QOGA 3BK1A 3TSSA 2MEKA 3TEZA 3H8HA 3BVZA 2N9KA 4H2AA 2WXKA 1L0XB 3BVGA 1XO3A 2H88B 2RMMA 3SR6A 3TUOA 2IJ0A 2WDQB 1Y56A 1XLQA 1AYFA 3ZGZA 1FFUA 1OQQA 1WXQA 3VRBB 1DYQA 3Q8EA 3E9SA 3ABVB 1V97A 3VR8B 2CJOA 3I9V1 2OHFA 2JQRB 2L1AA 4IKGA 2BBCA 5D3DA 2N0SB 1JRPA 1FRDA 3P4PB 2KN4A 5BMIA 2EELA 5D7GA 3R2IA 1SB3C 1UWXA 4GLSC 1L4ZB 4KX6B 2QIEB 1N60A 2IGHA 4XDCA 3ZQ4A 2J52A 1IUEA 2DLBA 1FCCC 3MC0B 4C7YA 5G5GA 2PLPA 1EWYC 1J7CA 1VZ8A 1OFFA 2GB1A 4N59A 4A9AA 2ONQA 3V3XA 2XN9C 4R3DA 1F2RI 2DWQA 2DYMA 2ACZB 2ICIA 3KLSX 1L4DB 1XLPA 2B76B 4REZA 2W3RA 1DOIA 2LGIA 2BS4B 2JWUA 1ZPSA 3U2SC 4ITKA 1C4PA 2WXPA 4KGTA 4WURA 1V8CA 3AE7B 4L2YA 1I4QA 1JCKB 1FNWA 1YNTE 4WIPA 1JWBD 2BW2A 2Y5PA 3BZDB 4HKZE 1TKEA 2GI9A 3HUIA 1XCTL 1BXTA 4P6VF 1NYQA 2VZKB 1ZOYB 1HQRD 2SAKA 2OEDA 3TEWA 2KMMA 1B1ZA 1PDXA 1WWTA 4IOIE 1QKZA 3ZJUA 1N5XA 4OW0A 2WXJA 1F2RC 1JWMD 1K50A 2W3SA 3P63A 3AEAB 4RGMA 1HZ5A 1YQ4B 3SEBA 4DXFA 1VZ7A 2LJIA 1V1PB 4GDKB 1VLBA 2MJ3A 1T6BX 1SBBB 4DQOC 4RF1A 1EM7A 1YN5A 1TY0A 2L52A 2WU5B 2INPE 1GB1A 2G1EA 3U4EG 5G5HA 1I4XA 1N62A 2WU2B 4YTNB 2PVOD 1JWAD 2M19A 1EWCA 4AS1A 1STEA 1NI3A 1TY2A 3KWVA 4Q2JA 2LMCA 2RDHA 1I4GA 3W9CB 2BS3B 3U7ZA 1QF6A 2IGGA 3NRZA 1L6UA 1KF6B 1FNVA 2W54A 1C78A 3AE2B 3VQIA 5HG2A 4D2KA 3AE8B 3CIRB 1KLUD 4HEA1 1Q10A 5BMGA 1L6VA 1SEBD 4KGRA 2YEPF 3AEGB 1JWSD 3V05A 2WQYB 4YSXB 1L0VB 3AE9B 1D5MC 3PZ7A 4TMAB 5BYSA 1D6EC 2IPKD 4WH4A 2K3UA 4XWWA 1FXAA 4WWMA 1R7SA 3W5VB 2ON8A 4NAWB 3BVMA 5H8YE 2AQ1B 2LHDA 2K5PA 1KRHA 3AB5A 1RYJA 1C79A 2ZW1A 3IAM1 4YSZB 1VZ6A 4OZAA 1I4PA 1FEHA 3NZ3A 4TQ1A 4YSYB 1GB4A 2Q5WD 1FFVA 4ZRPA 3U52E 3OWEB 4OZCA 4YTMB 2LEKA 1RFKA 1QILA 4OZBA 1XXGA 5D3IB 3DWMA 2AQ3B 2N7JA 3SFDB 2CU3A 1FM0D 1VRAB 2IDYA 1IBXB 3BYYB 1D4BA 2PW9A 1VJKA 3IT6B 3LYYA 1QQRA 2I38A 1GOZA 1VR9A 2Y3AA 3ZJTA 1A70A 1L0YB 2PMVA 4TQ0A 2V3PA 4RH6A 1TYGB 1E7PB 2JX5A 4DXGA 4N58A 4O1NA 2W82A 4TSSA 2PKOA 5EE1A 4KKIA 3FILB 3W5UB 4RGOS 1KTKA 1BMLC 1SE4A 1WSPA 1V1OA 1EU3A 4WAFA 1NENB 1AWDA 3BK2A 3MJ5A 5C2TB 2WXGA 3W2DA 1HZ6A 3CWIA 4LLGM 2W55A 2NMQA 2FUG1 1MVKA 1UGJA 2N9LA 4LK0M 4PT5A 3FC4A 1D5XC 3PZ8A 3B2GA 3DWGC 4A8XC 3RFZB 1KH0A 1SJHD 1ROEA 3BWUD 2BYTA 1AW7A 3NUHB 1ACCA 1QOFA 3URYA 1MHHE 1NEKB 3AV8A 1KLGD 3AE1B 5GXGB 2JXTA 2KDMA 3O13A 2L83A 1M4VA 2BB6A 2FBWB 2WXLA 1ZUD2 4J3OD 2K22A 3J9CA 4RNAA 5EE0A 2HTME 4A90A 1FD6A 1V1PA 5HFYA 4MM3B 1K51A 4EE2A 1TS4A 3Q69A 4US9A 1LO5D 1J7BA 4XDDA 5E6JA 3AEFB 1K52A 1CZPA 1JWUD 1P7EA 3RPFC 2LUMA 3Q8FA 3TEXA 1ET9A 3Q8AA 1J7AA 4ZHOA 5C3JB 1BUIC 3ZJVA 5H92C 2K9XA 3P4SB 3AEDB 2MJDA 3SFEB 3Q8CA 2KAJA 4US8A 3L4PA 2DYOA 4A55A 2BS2B 4RGNA 4YWGG 4JWSC 2QEJC 2JSVX 3BIID 4WQMA 5BMHA 1PYWD 1XLNA 1F0ZA 3MFGA 2BT6A 3LB8C 1VDVA 2DBYA 2RPVA 2PVGC 5FKAC 3TEYA 3AECB 3AEEB 3C8YA 2X38A 3W1SA 2AX5A 4XWTA 1L5PA 1UWMA 1SSNA 1ZP0B 4C80A 3NVVA 3LXFA 4C7ZA 3AEBB 1MHXA 1JW9D 2K0PA 1T5XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXD B;  4YTM B;  1GAQ B;  1XLP A;  2B76 B;  2LEK A;  1RFK A;  3P4Q B;  4IDI A;  2W3R A;  1DOI A;  2BS4 B;  3DWM A;  1DOX A;  3SFD B;  2CU3 A;  1FM0 D;  1TJE A;  2WDR B;  4ITK A;  1VJK A;  1E0Z A;  4YT0 B;  1V8C A;  1SF0 A;  2WLB A;  3AE7 B;  2M56 B;  4YTP B;  1WGK A;  2WP9 B;  1A70 A;  1QOA A;  1JWB D;  1TYG B;  1E7P B;  1RWS A;  1JAL A;  2JX5 A;  1TKE A;  3HUI A;  4JWU C;  4P6V F;  4N58 A;  1I7H A;  5AUK A;  1NYQ A;  3B2F A;  2PKO A;  1FXI A;  3AE5 B;  1ZOY B;  5EE1 A;  2MH7 A;  2KMM A;  1WWT A;  1PDX A;  1FIQ A;  4HRO A;  4JX1 C;  4USA A;  3W5U B;  3WCQ A;  1N5X A;  1WRI A;  3P1M A;  1JRO A;  2W3S A;  1FO4 A;  1NEN B;  5EE9 A;  3P63 A;  1AWD A;  1TKY A;  5AUI A;  1NYR A;  3VRA B;  5C2T B;  3AEA B;  3NVZ A;  4ZOH C;  2WS3 B;  1YQ4 B;  3CWI A;  1WYG A;  3AN1 A;  2W55 A;  3AE4 B;  1E6E B;  1E10 A;  1KFY B;  1VLB A;  2MJ3 A;  2EKI A;  1QOB A;  1YJJ A;  3AM9 A;  3FC4 A;  3B2G A;  2L52 A;  3DWG C;  2WU5 B;  2Y5C A;  3PO0 A;  3B9J A;  1SIJ A;  1N63 A;  3NVY A;  1ROE A;  2G1E A;  3FAH A;  3HRD D;  4LTU A;  5G5H A;  1N62 A;  2QJL A;  2WU2 B;  1N61 A;  3ETR A;  1QOF A;  1N5W A;  2CJN A;  4N6E B;  4YTN B;  2PVO D;  3AMZ A;  1NEK B;  3KWL A;  3AV8 A;  1JWA D;  1B9R A;  2M19 A;  3AE1 B;  3AE3 B;  1PFD A;  5GXG B;  3VR9 B;  5MPO A;  2MJE A;  1PUT A;  1DOY A;  1QOG A;  1RM6 C;  2L83 A;  2PIA A;  1CJE A;  1NI3 A;  2FBW B;  1ZUD 2;  2K22 A;  5EE0 A;  2HTM E;  3W9C B;  1NVI D;  2BS3 B;  1XO3 A;  2H88 B;  3SR6 A;  1QT9 A;  1DGJ A;  1QF6 A;  3AH7 A;  2WDQ B;  3NRZ A;  1E9M A;  1KF6 B;  1L6U A;  1XLQ A;  2W54 A;  1AYF A;  3AE2 B;  3NVW A;  4US9 A;  1FFU A;  1OQQ A;  1J7B A;  1WXQ A;  3VRB B;  3HVZ A;  3ABV B;  1GPX A;  5EE3 A;  3AE8 B;  1V97 A;  2WDV B;  3CIR B;  3NS1 A;  3AEF B;  3P4R B;  3VR8 B;  2CJO A;  1CZP A;  1L6V A;  2OHF A;  2JQR B;  3AEG B;  4HRS A;  3EUB 2;  3RPF C;  5C3J B;  1J7A A;  4ZHO A;  1JQ4 A;  4FXC A;  5H92 C;  2K9X A;  2WQY B;  3P4S B;  2N0S B;  1JRP A;  1ZXI A;  1FRD A;  1YJI A;  2MJD A;  3AED B;  3P4P B;  1L0V B;  3AE9 B;  3SFE B;  4YSX B;  2KAJ A;  4US8 A;  3L4P A;  1SB3 C;  2ACZ B;  2BS2 B;  4ZHP A;  1OQR A;  4JWS C;  4KX6 B;  2QIE B;  3BII D;  1N60 A;  4WQM A;  1QLB B;  1FXA A;  1TKG A;  1R7S A;  1IUE A;  1XLN A;  4WWM A;  3W5V B;  1F0Z A;  2H89 B;  2BT6 A;  5H8Y E;  3LB8 C;  1VDV A;  2DBY A;  2E3T A;  2PVG C;  4C7Y A;  1FRR A;  3AEC B;  1T3Q A;  3AEE B;  5G5G A;  2K5P A;  2AX5 A;  1EWY C;  1KRH A;  1J7C A;  3AB5 A;  1RYJ A;  1L5P A;  1OFF A;  4YSZ B;  1XLO A;  1UWM A;  1ZP0 B;  1FMA D;  4N59 A;  4A9A A;  4C80 A;  3NVV A;  1YQ3 B;  3LXF A;  4YSY B;  3ZYY X;  3AEB B;  4C7Z A;  2Q5W D;  1FFV A;  3AE6 B;  2DWQ A;  1JW9 D; 
#chains in the Genus database with same CATH topology
 4EFO A;  2FCN A;  2Y5B B;  5JH5 C;  2DHZ A;  4URK A;  3H6N A;  2VH2 A;  1ZXH A;  2KC2 A;  2PE6 B;  1R4M I;  4IG7 B;  2LFI A;  2WX0 A;  4NAW A;  1R4N B;  2LJ5 A;  1F77 A;  3IT4 B;  4JWU C;  2IZV B;  5DPR A;  2HDE A;  3EA6 A;  3L08 A;  2YEP B;  5DPT A;  3A1Q A;  2QMT A;  4AJY B;  4C00 A;  3Q8B A;  3WCQ A;  4USA A;  4A6Q A;  4BKS A;  4NPN A;  4ZOH C;  5CX3 A;  4P16 A;  1WE7 A;  4RGT A;  1WJ4 A;  3Q3J A;  1MI0 A;  3B9J A;  3HRD D;  2M1M A;  1ET6 A;  2GBN A;  3FIL A;  5C23 A;  3L0W B;  3RUI B;  2WXM A;  1RM6 C;  4S0R A;  3OJ3 A;  4II3 B;  2O6V D;  1PGX A;  4KV2 A;  4DWF A;  1HEZ E;  4HJG E;  1QT9 A;  2E6X A;  2ZW0 A;  3E56 A;  3QQ8 B;  2GMI C;  4MEL A;  3RT3 B;  1HA5 A;  4IC7 B;  3HVZ A;  1GPX A;  4B0M A;  2WDV B;  4KZ0 A;  5D6J B;  4PYU A;  3GOE A;  1CK1 A;  3PSE B;  1WXM A;  2KAC A;  1ZXI A;  3OAW A;  4JIO U;  2L8J A;  4ZHP A;  1IGC A;  1OQR A;  4ANX A;  3N20 C;  1YN3 A;  2LI5 A;  2Z59 B;  2H89 B;  2OJR A;  4I6N B;  1ESF A;  4KGS A;  1XEE A;  1FCL A;  3QIJ A;  4NY0 A;  4ZYN A;  2YVC A;  4ZDV A;  3CF6 E;  1SJE D;  2KZR A;  4GDL B;  4IWQ A;  5FK9 C;  2KFK A;  5T8I A;  5HHD G;  1D5Z C;  2BYE A;  2ASQ A;  2IO1 B;  3PHX B;  1HTQ A;  4L1B A;  5KHO A;  3NZU A;  3GE8 C;  3UIN B;  4C56 C;  3B2F A;  2L0T A;  3HM3 A;  1UEL A;  4AWJ A;  2WXI A;  2BB5 A;  3N32 A;  3APC A;  3A9J A;  2JU6 X;  3RNE C;  1SGH A;  4P1B C;  5AUI A;  1KFY B;  4KKJ A;  2WXR A;  4X57 B;  1UD7 A;  2EKI A;  3AM9 A;  2Y5C A;  4QAY A;  2K8H A;  2MLB A;  1NDD A;  2YLM A;  3R2T A;  3ETR A;  1C4A A;  3Q2A C;  1B9R A;  3VR9 B;  2O6V B;  1WF9 A;  1OEY J;  3WAO A;  3TMP B;  4A3P A;  3NG0 A;  1XO3 A;  2WX1 A;  4EUT A;  5D94 A;  3TUO A;  2DYB A;  3KYD D;  2WDQ B;  1Y56 A;  3PZD A;  2PJH A;  1LFD A;  2NPT A;  5HKH A;  2MW5 A;  1V97 A;  2CJO A;  4I6L B;  4TV3 A;  4GB9 A;  2KN5 A;  2K6Q A;  3P4P B;  3MHS D;  2HD5 B;  1UWX A;  1L4Z B;  2QIE B;  3QX1 A;  1E5W A;  2DLB A;  3MC0 B;  3ZRC A;  2KMC A;  3BIN A;  4GU2 A;  3C19 A;  2PLP A;  4XZ4 A;  1OFF A;  2C9W B;  3GZN I;  3AU4 A;  1S1Q B;  1YQB A;  3IBE A;  4N9F 4;  4E3C A;  2XN9 C;  4HDQ A;  1Z2M A;  4B6W A;  4R3D A;  5J2R A;  2DWQ A;  3HHM A;  2DYM A;  4OVV A;  1ZPS A;  3U2S C;  2DEN B;  4ITK A;  1C4P A;  4KGT A;  4WUR A;  1HE8 A;  3PHW B;  3VTU A;  2BPS A;  1V8C A;  1I4Q A;  2ZVN A;  4WIP A;  4IWP A;  4HKZ E;  4B9K A;  5J17 A;  3Q3F A;  2FAZ A;  2KC1 A;  2MA9 B;  2OED A;  3JVZ X;  2JZ3 B;  4IOI E;  1LM8 B;  3FKY A;  1F2R C;  1MJD A;  2W3S A;  3TL5 A;  4WJQ A;  4RGM A;  1VZ7 A;  4GDK A;  4GDK B;  1VLB A;  1E8W A;  2LGD A;  2RPQ A;  3U8Z A;  5G5H A;  1I4X A;  2WU2 B;  2EKE C;  2A5U A;  4YTN B;  1EWC A;  1STE A;  3QJZ A;  4GOC A;  2LMC A;  2BS3 B;  1YX5 B;  3U7Z A;  3AE2 B;  1L7Y A;  5HG2 A;  4D2K A;  4MEM A;  3AE8 B;  3CIR B;  2J0J A;  1Q10 A;  1SEB D;  2LVO A;  3AEG B;  3B1L X;  3U30 A;  4YSX B;  3ZNH B;  3QA8 A;  4WH4 A;  2D3B A;  2JT4 B;  1FXA A;  3WAM A;  5H8Y E;  2AQ1 B;  4EZL A;  2K5P A;  4YSZ B;  2R2Q A;  1I4P A;  2KD0 A;  5IN7 A;  4YSY B;  2N9E B;  1NBF C;  2Q5W D;  3NHE B;  3U52 E;  2LAS A;  4GIV A;  4YTM B;  3SFD B;  3SHQ A;  1IBX B;  2NR2 A;  2PW9 A;  3T9L A;  1VJK A;  4XYC A;  2DZI A;  4G11 A;  1GOZ A;  3ZJT A;  2PMV A;  1TYG B;  2W82 A;  4KKI A;  1VCB A;  1WJN A;  4RGO S;  1XQQ A;  4M00 A;  2JRI B;  1SE4 A;  1V1O A;  4ACF A;  2PE9 A;  2J0M A;  4FHK A;  3BK2 A;  3DBL B;  1HZ6 A;  1GG3 A;  2NMQ A;  3A9K A;  3A9K B;  3JSV A;  1SJH D;  1KM7 A;  4DDG D;  3ML9 A;  1AW7 A;  4MJS B;  4KSK C;  2NBV B;  2KWU B;  3QK0 A;  2L83 A;  4P7I A;  2D07 B;  1L2N A;  2M0X A;  2BB6 A;  2HTH A;  1OGW A;  2K22 A;  2KDF B;  1FD6 A;  4MM3 A;  1V1P A;  2KJH B;  4MM3 B;  1TS4 A;  5AEK B;  3Q69 A;  1J7B A;  3VHT C;  4DK5 A;  3PRE A;  5E6J A;  2KXJ A;  1OEY A;  3TEX A;  3Q8F A;  3B0A A;  3P4S B;  3AED B;  4C4V B;  4BFR A;  3DBR I;  3KUC B;  2KAJ A;  3W1Y A;  4GMV A;  4YWG G;  2MBO A;  2JSV X;  4HLE A;  1XLN A;  1WGD A;  2O2V A;  1VDV A;  2DBY A;  3PRP B;  1WXV A;  1D3Z A;  2X38 A;  1FXT B;  2NS5 A;  1L5P A;  1UWM A;  1ZP0 B;  1KOT A;  3NVV A;  3RNG C;  4RM9 A;  4C7Z A;  4K3C A;  2KLG A;  2ZZP B;  1AAR A;  3M62 B;  2K0P A;  1T5X D;  1EUV B;  1M94 A;  2ZVO A;  4DXA B;  1DOX A;  1IGD A;  2D2Q A;  4WQO B;  2KMA A;  2MWS B;  4KDI C;  3NS8 A;  4YT0 B;  5I4D A;  1SF0 A;  4G3X B;  1WGK A;  2WP9 B;  3Q3M C;  1QOA A;  1KLV A;  3CST A;  1WGY A;  3QAR A;  5DPW A;  2BYF A;  4BAX A;  1C3T A;  4JX1 C;  3P1M A;  2KWD A;  2BTE A;  3APF A;  1ISN A;  2LXA A;  2WS3 B;  1WYG A;  2BGF A;  3P2B A;  1YJJ A;  2I2Y A;  3R8B A;  2QSD A;  4UDU C;  5JHB A;  4DHZ B;  4LTU A;  3C0R B;  4RFB A;  2XBB C;  1I42 A;  1UUP A;  2J0K A;  3N30 A;  3AMZ A;  2FNJ B;  3AE3 B;  4LJO B;  4HKQ A;  1XF5 L;  1XD3 B;  1CJE A;  1E7V A;  5DCN A;  2MBH A;  4OHJ A;  1NVI D;  1YMH E;  4WWO A;  1SE3 A;  1DGJ A;  2B3A A;  3NVW A;  4IM2 A;  2J53 A;  2INC C;  4FUL A;  1LQB A;  3WIM A;  3NS1 A;  2CKH B;  4L23 A;  4HRS A;  5LNK 1;  2ZPN A;  4E71 A;  3IAS 1;  1WR6 E;  2KJ6 A;  4ZRJ A;  2L0F A;  4ARC A;  2N7E A;  4AUQ C;  1K53 A;  2KAN A;  2HJ1 A;  1FRR A;  2XNA C;  4W9H A;  1T3Q A;  2AYO B;  1S3S G;  3PS6 A;  2KQ4 X;  3UGB B;  3DPD A;  1P0R A;  2GBK A;  3ZYY X;  2DZM A;  4CHK A;  1UNS A;  3DOW A;  4TUU A;  1RRB A;  1TJE A;  2WXQ A;  5BYQ A;  1WZ3 A;  2MP2 A;  4YTP B;  3ZDM C;  2LZ6 A;  3GZN B;  1RWS A;  1JAL A;  1I7H A;  5J18 A;  2GBJ A;  1WX8 A;  1FXI A;  2CHW A;  4HRO A;  3MP9 A;  2LGX A;  2HE7 A;  2K8C A;  2WNM A;  1JRO A;  3PLU A;  1TS5 A;  5JHA A;  4GGQ A;  1GC7 A;  1A5R A;  5L83 A;  1E6E B;  2BVC A;  5EDS A;  1E90 A;  2BKR B;  1TT5 B;  2FCQ A;  1HXY D;  3D32 A;  2JF5 A;  2V4I B;  1N63 A;  3NVY A;  3T3N A;  3FAH A;  2ZPY A;  3K9O B;  1N61 A;  1WGH A;  3MJW A;  3VTV A;  5TSS A;  2JRH A;  3ZXR A;  2MEK A;  3H8H A;  3WAL A;  2QCZ A;  4H2A A;  2WXK A;  1L0X B;  3BVG A;  3I3T B;  2H88 B;  5CHV C;  3SD5 A;  3ZGZ A;  1N6Z A;  1OQQ A;  2VRR B;  3E9S A;  3Q14 C;  4IWO A;  5E6P A;  3VR8 B;  1E8Y A;  1V6E A;  2OHF A;  2BBC A;  1JRP A;  1FRD A;  2KN4 A;  1J19 A;  1SB3 C;  4ANW A;  1TIF A;  4XDC A;  2J52 A;  4JQW C;  1IUE A;  1GUA B;  1FCC C;  4IW0 A;  3M3J A;  1EWY C;  1J7C A;  4IUM B;  2ONQ A;  3V3X A;  2GBR A;  1F2R I;  1XLP A;  4REZ A;  2W3R A;  2DZK A;  2L76 A;  2IBI B;  4L2Y A;  1YNT E;  2D10 A;  4FJV B;  4P6V F;  4BKT A;  3UF8 A;  2V9H A;  3ZLZ A;  1MG8 A;  1HQR D;  1WWT A;  1PDX A;  4GDL A;  3ZJU A;  2CHZ A;  4OW0 A;  1X1M A;  1SIF A;  2LWP A;  3DHG C;  1YQ4 B;  3SEB A;  3WAN A;  2LJI A;  4EKU A;  3DHI C;  3V6C B;  1TZ1 A;  2JY6 A;  2MJ3 A;  4P1C C;  1EM7 A;  1YOV B;  1WX7 A;  2HJ8 A;  2G1E A;  5E6O A;  3U4E G;  4FA6 A;  5JZE B;  2M19 A;  4W9E A;  3DBH I;  1NI3 A;  2REX A;  3NJT A;  3KWV A;  1P3Q U;  4HCN B;  2RDH A;  1I4G A;  4BZA A;  4J6I A;  1RFA A;  4DHJ D;  2IGG A;  2W54 A;  3VQI A;  1T0S C;  3DDC B;  2WYQ A;  2N9X A;  1I35 A;  1KLU D;  3DVN U;  4KGR A;  1JWS D;  3DQV A;  3V05 A;  2ZNV B;  4YL8 A;  3VUY A;  1L0V B;  2O6V A;  3PZ7 A;  3L54 A;  2IPK D;  2KVR A;  3QAQ A;  4M0W B;  4XWW A;  2ZEQ A;  4AJW A;  3H9D A;  2JUO A;  3VAW A;  1V86 A;  1WJU A;  1KRH A;  1RYJ A;  2ZW1 A;  2WGS A;  3ZTC A;  5C1Z A;  1VZ6 A;  4TQ1 A;  1WGR A;  3DBR B;  2K39 A;  1GB4 A;  1FFV A;  4ZRP A;  3OJ4 B;  3UIP B;  1HTO A;  2LEK A;  4OZB A;  1QIL A;  1XXG A;  4FHJ A;  3DWM A;  4E74 A;  2CU3 A;  3UQA A;  1VRA B;  3AU5 A;  2G45 B;  3APD A;  3LYY A;  2KQS A;  2IO0 B;  2I38 A;  3VXW A;  2V4L A;  2L7R A;  2NVU I;  3N1Z C;  2R2O A;  3QCA A;  1A70 A;  1Q0W B;  3L10 B;  2C7M B;  2V3P A;  4RH6 A;  2JX5 A;  4BKG A;  4TSS A;  5DPS A;  4G0N B;  1V81 A;  4W9L A;  1ZGU B;  3W5U B;  3ENE A;  2KDI A;  1UBQ A;  3H1U A;  3U7D A;  1V80 A;  1EU3 A;  1AWD A;  2EMT A;  3DBS A;  3W2D A;  3CWI A;  2FUG 1;  4DHZ E;  4PT5 A;  3FC4 A;  3PZ8 A;  3DWG C;  1Z5S B;  5FR6 A;  2NCN A;  1GC6 A;  1WYW B;  1KH0 A;  3CSF A;  4MH0 E;  2BYT A;  1OQY A;  1QOF A;  4HXD A;  1NEK B;  5GXG B;  3ZXV A;  5G2N A;  3NOB A;  2LVP A;  1RAX A;  2FBW B;  4J3O D;  1V9J A;  2HTM E;  2MBE A;  2C7H A;  4DHJ B;  4W9C A;  3RMK C;  2CU1 A;  3DCG A;  4JGH B;  1R4N I;  1YX6 B;  2LD9 A;  1LO5 D;  4TKN A;  3IVF A;  3TEW A;  3RPF C;  2KK8 A;  4ICU A;  3Q8A A;  1J7A A;  3ZJV A;  2K9X A;  4LCD E;  3QWZ B;  4M01 A;  4NJ7 A;  3Q8C A;  5CHW A;  2UWQ A;  4US8 A;  1WIA A;  4RGN A;  2QEJ C;  5CHF A;  5BMH A;  1IPG A;  1F0Z A;  3SDL C;  4KIK A;  2LGY A;  4KIK B;  3C8Y A;  2KYW A;  1XT9 B;  4OVU A;  3PRZ A;  4FJZ A;  2KKC A;  3PVL A;  2BWE S;  5IAA C;  4PS7 A;  2R61 A;  4NQK E;  2WDR B;  4NJC A;  2WXF A;  3I5J C;  1WGG A;  3RNC C;  2KTF A;  2MSE D;  3P42 A;  5IO9 A;  3PRM B;  4W9G A;  2DAF A;  2M56 B;  4XE0 A;  4CQN A;  1ENF A;  1Q1O A;  3VDZ A;  4B0E A;  1C77 A;  2NTT A;  3MHZ A;  1CQV A;  2CS4 A;  4HPL B;  2LHE A;  3ZUN A;  2OOB B;  2PEA A;  2C7N B;  1WJ6 A;  1WY8 A;  1ZE3 D;  2QDF A;  4BBN F;  3OLM D;  1FO4 A;  3I57 A;  4LNN A;  5EE9 A;  3VRA B;  4BBN C;  1IBX A;  2MCN B;  4AOF A;  3ONS A;  5IOI A;  5FR3 A;  5TR5 A;  1QOB A;  1XCQ L;  2DZJ A;  3EHV A;  3ZNI D;  5E6N A;  4AQ7 A;  1P9D U;  2WXO A;  1YD8 U;  3ZO5 B;  5L95 C;  4DDI D;  4HWI B;  2PIA A;  3BYT B;  2XK5 A;  2XK5 B;  1R4M B;  3GB1 A;  1WZ0 A;  2LGS A;  4RM8 A;  1SXT A;  1SE2 A;  1E9M A;  1WM2 A;  3S2A A;  4HCP B;  5EE3 A;  3RN9 C;  4MH8 A;  3WA0 A;  2L32 A;  3ZRF A;  4MJS A;  2JZP A;  2QHO A;  3O65 B;  4LDT D;  1JQ4 A;  1UF0 A;  4NJ6 A;  2IGD A;  5CTR C;  4B95 A;  3M95 A;  1C76 A;  1QLB B;  4ZYS A;  1TKG A;  2IO2 B;  3HVD A;  2E3T A;  1I4H A;  4MGY E;  2MX2 A;  2Z8L A;  4IM3 A;  3ZNG C;  3VUX A;  2KJR A;  1XLO A;  1FMA D;  1C9F A;  1YQ3 B;  4JLC A;  4NZL B;  1JML A;  4JE3 B;  4C4V A;  3AI5 A;  1YJ1 A;  4MT5 A;  4ZRQ A;  4YXD B;  2PTL A;  4II2 B;  2D3C A;  5HI1 A;  3A4R A;  2INN E;  4K3B A;  3ZNZ B;  4OVZ A;  3UI3 A;  1H4R A;  4W9K A;  1E0Z A;  1AN8 A;  4MDK E;  3WAP A;  2G4S A;  3PGE A;  3EFU A;  3MTN B;  1C4C A;  2JYE A;  3RI7 C;  1Q5W B;  3KUZ A;  2WXN A;  3AE5 B;  3GP7 A;  5IA7 A;  4JPS A;  2VZK D;  3CMM B;  2J7Q B;  5BYR A;  4BVU C;  3NVZ A;  1LXD A;  3AN1 A;  3M63 B;  4WJN A;  4M8M A;  1WFY A;  2K25 A;  2KHW B;  3PV1 A;  4FJY A;  2CJN A;  1N5W A;  3KQ4 A;  3KWL A;  2JYT A;  5MPO A;  4WWN A;  1Y8R C;  3JW0 X;  1TBE A;  2N9K A;  3BVZ A;  3PPA A;  3T8M A;  1GJZ A;  2IJ0 A;  1AYF A;  1FFU A;  3VRB B;  4K7W A;  1T0Q C;  4KVG B;  4LDT B;  3I9V 1;  2L1A A;  2MQJ A;  2N0S B;  5BMI A;  2EEL A;  5D7G A;  5LXH A;  1WMH B;  2KDE B;  4EOY A;  1JRU A;  3GE3 C;  2G4D B;  2CHX A;  3ML8 A;  2RGF A;  5G5G A;  1EO6 A;  4KDL B;  2GB1 A;  4N59 A;  4A9A A;  2GBM A;  2BF8 B;  2MBQ A;  1F1H A;  5AZH A;  4CYE A;  3IFW B;  2ACZ B;  2GOW A;  2ICI A;  5IP4 D;  1L4D B;  1P1A A;  2FIF A;  2JWU A;  2RDB C;  2WXP A;  2C5L C;  3B08 A;  4BKS D;  3N1Y C;  3QHT A;  2BW2 A;  1TKE A;  2GI9 A;  3HUI A;  1XCT L;  1BXT A;  1NYQ A;  1WX9 A;  2MBB B;  2Z0D B;  1WM3 A;  2VZK B;  1UBI A;  2KMM A;  1B1Z A;  1N5X A;  3P63 A;  3OG5 A;  3AEA B;  2DX5 B;  1HZ5 A;  2N4F A;  4S17 A;  1T6B X;  1SBB B;  4RF1 A;  2INP E;  1N62 A;  2KTR B;  3IHP C;  4LJP B;  2PVO D;  4AS1 A;  1BT0 A;  2WHI A;  2ZNV C;  1V5T A;  1CMX B;  1TY2 A;  4Q2J A;  4F8C B;  2KDB A;  2KWC A;  2MRP A;  1E8Z A;  2MHJ A;  3NRZ A;  1L6U A;  1KF6 B;  1FNV A;  3R7Q A;  1C78 A;  2KQ7 A;  3VTW A;  1L6V A;  2DNF A;  1VD2 A;  2UYZ B;  3V61 A;  3AE9 B;  1H8C A;  1D5M C;  5BYS A;  1D6E C;  2KOX A;  2LUE A;  3Q6B A;  1UZX B;  2D3A A;  1R7S A;  3DBL I;  4WJP A;  2ON8 A;  4NAW B;  3W5V B;  3BVM A;  2LHD A;  2KT7 A;  5AZF A;  1ZW7 A;  2D3G A;  4MGI E;  3IAM 1;  3NZ3 A;  3A1Q B;  3PLV A;  4OZC A;  5D3I B;  2AQ3 B;  2M4N A;  2IY0 B;  3BYY B;  1D4B A;  3X23 A;  1QQR A;  1VR9 A;  3PT2 B;  1V49 A;  3NY5 A;  1L0Y B;  1WE6 A;  2JPH A;  4DXG A;  4N58 A;  3L13 A;  1G6J A;  2PKO A;  3FIL B;  2LVQ A;  3ZKJ C;  4F7Z A;  3TIX A;  1KTK A;  1BML C;  1WSP A;  4WAF A;  1EF5 A;  4AP4 C;  1NEN B;  1GNU A;  3MJ5 A;  2WXG A;  1C1Y B;  3ZVV A;  2JWZ A;  4LK0 M;  3B2G A;  2K1F A;  4A8X C;  3RFZ B;  1WR1 A;  3BWU D;  4EZJ A;  4FN2 A;  1MHH E;  4LNO A;  3DVG X;  3AE1 B;  3KUD B;  3L16 A;  2AL6 A;  4PS8 A;  1M4V A;  1ZUD 2;  3RNA C;  3N1X C;  2L3Z A;  5HFY A;  2WDT B;  1K51 A;  2NBW B;  1PQS A;  3JYU A;  3BY4 B;  4ICV A;  4M8N A;  4KZC A;  1K52 A;  4M02 A;  3RYT A;  1ET9 A;  3VH3 B;  4ZHO A;  1IYF A;  5H92 C;  3SFE B;  2KFK B;  3V6E B;  3L4P A;  2DYO A;  4A55 A;  2BS2 B;  2LRW A;  4WQM A;  3ZW3 A;  3DVG Y;  4ANU A;  2QC8 A;  2VH1 A;  3LB8 C;  2M8S A;  2RPV A;  3AEC B;  2KX0 A;  3KW5 B;  4XWT A;  2GLS A;  2X8X X;  1SSN A;  4C80 A;  4A20 A;  3AEB B;  1MHX A;  3A9J B;  2I1K A;  2JXX A;  1GAQ B;  1F52 A;  2CR5 A;  3ECI A;  3P4Q B;  4IDI A;  2IYD B;  3Q3N C;  4MGK E;  2J4X A;  4M0W A;  3I63 C;  1WH3 A;  2QIL A;  3PTF C;  2J42 A;  4HDO A;  5AUK A;  2SEB D;  2M0A A;  1TS3 A;  1PGA A;  1FIQ A;  2GRI A;  4XGA B;  1MG4 A;  1SE9 A;  1WRI A;  3MC9 A;  3N9Y C;  2V3N A;  1TKY A;  1WXS A;  4MAC A;  2N9P C;  3QC8 B;  2NPT B;  3VUW A;  3VH4 B;  3PO0 A;  1YN4 A;  1SIJ A;  1ZKH A;  1RLF A;  2QJL A;  4N6E B;  2Z0E B;  4ARI A;  2MJE A;  2IO3 B;  1ZDX A;  4HPM B;  5G55 A;  2NBU A;  4K7S A;  1TZO A;  4W9J A;  3AH7 A;  5LXI B;  2WXH A;  1ZDV A;  1J0G A;  1MPE A;  3P4R B;  3RNB C;  1FNU A;  3EUB 2;  5JXV A;  4FXC A;  2G9H D;  4LNI A;  4NNJ B;  1YJI A;  2TSS A;  2D5G A;  2FE8 A;  2G3Q B;  4F1S A;  2RDG A;  5AZG A;  2XEW A;  4NAM A;  4K81 A;  2IND C;  2BKF A;  4MSM B;  2N1V A;  3EGR A;  1PGB A;  4RCO A;  1P7F A;  4JL9 A;  1TS2 A;  3ZIM A;  3AE6 B;  3T3O A;  4G50 A;  3VFK A;  4RF0 A;  1I4R A;  3MC8 A;  3R66 C;  2NTS A;  2WLB A;  2K8B A;  2LRU A;  3GS2 A;  4FAD A;  4CO7 A;  2KX3 A;  1NI2 A;  5GMV A;  2ZCB A;  2V0G A;  3HM6 X;  2MH7 A;  2JVC A;  1KJT A;  1LGR A;  3ZDT A;  4GXB A;  1EU4 A;  1NYR A;  2V1Y A;  4XC2 A;  3AE4 B;  1E10 A;  3A4S C;  3IXS A;  2AQ2 B;  1UGM A;  3L17 A;  3AUL A;  1FPY A;  1PFD A;  1DOY A;  1PUT A;  1QOG A;  4HVB A;  2WWZ A;  3BK1 A;  3DVN V;  3TSS A;  3TEZ A;  5KHQ A;  2RMM A;  5D2M B;  3SR6 A;  2RSU A;  1XLQ A;  1YIW A;  1WXQ A;  1DYQ A;  3Q8E A;  3ABV B;  4MGZ E;  1V5O A;  3KYC D;  2JQR B;  3H7P A;  4IKG A;  3H7P B;  5D3D A;  4HJK A;  2W9N A;  3H7S A;  2UU7 A;  3R2I A;  1WI0 A;  1UH6 A;  4GLS C;  1K8R B;  1WRD B;  4KX6 B;  1N60 A;  4PYZ A;  2BWF A;  3RZW C;  2IGH A;  1P98 A;  3SU8 X;  3V62 A;  3ZQ4 A;  4C7Y A;  1VZ8 A;  1WXA A;  1QZE A;  3ALB A;  2D11 A;  5BO4 B;  3TBL D;  4ASW C;  3KLS X;  2B76 B;  3RZF A;  4IM0 A;  1DOI A;  2LGI A;  2BS4 B;  3A33 B;  1TTN A;  3AE7 B;  3EFC A;  1JCK B;  3JSV B;  1FNW A;  1JWB D;  4A3O A;  3DHH C;  2Y5P A;  3BZD B;  2BYV E;  3UQB A;  2EMS A;  1ZOY B;  2SAK A;  3AXC A;  1QKZ A;  2N1W A;  2WXJ A;  2A4Z A;  1JWM D;  1K50 A;  4ANV A;  4HK2 A;  4DXF A;  4ZRI A;  1V1P B;  1IP9 A;  3RUL A;  4DQO C;  1YN5 A;  1TY0 A;  2L52 A;  3VVW B;  2WU5 B;  3K9P B;  4DBG A;  1GB1 A;  3W1S C;  2AEH A;  2KWV B;  5IKC M;  1JWA D;  1OTR B;  2V3S A;  2K6D B;  2JZZ A;  1MFW A;  3W9C B;  4HPP A;  2O2V B;  1QF6 A;  3R7R A;  3RNF C;  2DAJ A;  4K1R B;  1F9J A;  4FLH A;  4HEA 1;  5BMG A;  4EZK A;  2YEP F;  2RD0 A;  2WQY B;  4XX5 A;  3HK0 A;  3LDZ E;  3TCA A;  4TMA B;  3HIZ A;  2KVZ A;  4GSW A;  3RD2 A;  2FUH B;  2I1J A;  4LNF A;  2K3U A;  3X0W A;  4WWM A;  2KO3 A;  2KLC A;  1T0R C;  2AWT A;  3KH0 A;  3EEC A;  3LJ3 A;  3AB5 A;  1C79 A;  4OZA A;  1FEH A;  3R3M A;  4BOZ B;  4FBJ B;  3UIO B;  3N3K B;  1EF1 A;  4W9F A;  1E7U A;  3OWE B;  3DBH B;  2C60 A;  4W9I A;  1RFK A;  1WMH A;  2N7J A;  1FM0 D;  2IDY A;  2OJW A;  2KNB A;  3IT6 B;  1J8C A;  2Y3A A;  5LLI A;  3Q3O C;  1TGZ B;  2PPH A;  4WAA A;  4TQ0 A;  1E7P B;  4O1N A;  2KFJ A;  5EE1 A;  1E8X A;  4EEW A;  2FCM A;  2L00 B;  1V2Y A;  4KSL C;  5C2T B;  4LLG M;  2N7D A;  2W55 A;  4RMA A;  1MVK A;  1UGJ A;  2N9L A;  1D5X C;  4NQL B;  1U4A A;  1ROE A;  2FID A;  2IY1 B;  3NUH B;  4PK1 A;  1ACC A;  3URY A;  2BQQ A;  3AV8 A;  1KLG D;  3V60 A;  4ZRK A;  2JXT A;  3TJP A;  2KDM A;  3O13 A;  4MSQ B;  2LXC A;  2WXL A;  4RNA A;  3J9C A;  5EE0 A;  4A90 A;  2ZCC A;  4K7U A;  2M17 A;  4EE2 A;  2FCS A;  4US9 A;  3EC8 A;  4XDD A;  4LNK A;  2RR9 A;  4W9D A;  3AEF B;  1CZP A;  2AL3 A;  1JWU D;  1P7E A;  2LUM A;  5C3J B;  2KTR A;  1BUI C;  4I6P A;  4WJO A;  3ZTD A;  3RCZ A;  2MJD A;  4PS3 A;  4JWS C;  2L05 A;  3BII D;  1PYW D;  3NZS A;  3KVF B;  3MFG A;  2BT6 A;  2PVG C;  5FKA C;  3TEY A;  2MP2 B;  2ZJD A;  4WWP A;  3AEE B;  3W1S A;  4GN1 A;  2AX5 A;  4BOS C;  3IG3 A;  3LXF A;  1T0Y A;  1JW9 D; 
#chains in the Genus database with same CATH homology
 1GAQ B;  3P4Q B;  4IDI A;  1ZXH A;  1DOX A;  2R61 A;  1IGD A;  2WDR B;  2J4X A;  2WXF A;  4NJC A;  2LFI A;  4M0W A;  3P42 A;  4YT0 B;  5I4D A;  1SF0 A;  1F77 A;  2M56 B;  1WGK A;  2QIL A;  2WP9 B;  4XE0 A;  2J42 A;  1ENF A;  4CQN A;  1QOA A;  3IT4 B;  4JWU C;  4B0E A;  1C77 A;  2NTT A;  2SEB D;  2HDE A;  2M0A A;  3EA6 A;  1CQV A;  3MHZ A;  5AUK A;  2YEP B;  2QMT A;  1TS3 A;  1PGA A;  1FIQ A;  2LHE A;  3Q8B A;  4JX1 C;  2GRI A;  4USA A;  3WCQ A;  1WRI A;  3P1M A;  1ZE3 D;  3N9Y C;  2KWD A;  2BTE A;  2V3N A;  1FO4 A;  4A6Q A;  3I57 A;  5EE9 A;  1TKY A;  3VRA B;  1IBX A;  4ZOH C;  2WS3 B;  1WYG A;  5FR3 A;  4P16 A;  4RGT A;  4MAC A;  1QOB A;  1XCQ L;  1YJJ A;  2I2Y A;  1MI0 A;  3R8B A;  2QSD A;  4UDU C;  3PO0 A;  3B9J A;  1YN4 A;  1SIJ A;  4AQ7 A;  3HRD D;  4LTU A;  2QJL A;  4RFB A;  2WXO A;  1UUP A;  1ET6 A;  4N6E B;  3AMZ A;  3FIL A;  3AE3 B;  4ARI A;  2MJE A;  4HKQ A;  2WXM A;  1RM6 C;  1XF5 L;  2PIA A;  1CJE A;  3BYT B;  1ZDX A;  3GB1 A;  4OHJ A;  1NVI D;  1PGX A;  1SXT A;  1YMH E;  1HEZ E;  4HJG E;  1SE2 A;  1QT9 A;  2E6X A;  1SE3 A;  1DGJ A;  1TZO A;  2ZW0 A;  3E56 A;  3AH7 A;  3NVW A;  1E9M A;  2WXH A;  1ZDV A;  1HA5 A;  2J53 A;  3HVZ A;  1GPX A;  5EE3 A;  4B0M A;  1MPE A;  3NS1 A;  2WDV B;  3P4R B;  4MH8 A;  4L23 A;  1FNU A;  2L32 A;  1CK1 A;  4HRS A;  3EUB 2;  2JZP A;  5JXV A;  5LNK 1;  2KAC A;  1JQ4 A;  4FXC A;  2G9H D;  1ZXI A;  3IAS 1;  1YJI A;  2TSS A;  2D5G A;  2FE8 A;  4ARC A;  2IGD A;  4ZHP A;  1IGC A;  1OQR A;  2RDG A;  1C76 A;  1QLB B;  4ZYS A;  1TKG A;  1YN3 A;  1K53 A;  4NAM A;  2H89 B;  3HVD A;  2E3T A;  1ESF A;  4KGS A;  1I4H A;  1FRR A;  2XNA C;  1XEE A;  1T3Q A;  2Z8L A;  1FCL A;  2KQ4 X;  3EGR A;  1PGB A;  4RCO A;  1P7F A;  1XLO A;  1FMA D;  1C9F A;  1YQ3 B;  3ZYY X;  1SJE D;  4NZL B;  1TS2 A;  3AE6 B;  3T3O A;  1JML A;  4JE3 B;  4GDL B;  4RF0 A;  5FK9 C;  1I4R A;  1UNS A;  5T8I A;  4MT5 A;  4ZRQ A;  4YXD B;  2PTL A;  5HHD G;  5HI1 A;  1D5Z C;  2NTS A;  2INN E;  1TJE A;  2WXQ A;  5BYQ A;  4L1B A;  4OVZ A;  3UI3 A;  1E0Z A;  2WLB A;  1AN8 A;  3GS2 A;  4YTP B;  1C4C A;  2JYE A;  4C56 C;  1RWS A;  1JAL A;  1I7H A;  3B2F A;  2WXN A;  1FXI A;  3AE5 B;  3GP7 A;  2V0G A;  2WXI A;  4JPS A;  2BB5 A;  2MH7 A;  4HRO A;  3MP9 A;  2VZK D;  2JU6 X;  2WNM A;  1JRO A;  1EU4 A;  1TS5 A;  5AUI A;  1NYR A;  5BYR A;  3NVZ A;  3AN1 A;  3AE4 B;  1E6E B;  1E10 A;  1KFY B;  4KKJ A;  2WXR A;  2EKI A;  3AM9 A;  3IXS A;  1HXY D;  2AQ2 B;  2Y5C A;  2V4I B;  1N63 A;  3NVY A;  3T3N A;  3FAH A;  3R2T A;  3ETR A;  1N61 A;  2CJN A;  1N5W A;  3KQ4 A;  1C4A A;  1B9R A;  3KWL A;  2JYT A;  3VR9 B;  5MPO A;  5TSS A;  1PFD A;  1DOY A;  1PUT A;  1QOG A;  3BK1 A;  3TSS A;  2MEK A;  3TEZ A;  3H8H A;  3BVZ A;  2N9K A;  4H2A A;  2WXK A;  1L0X B;  3BVG A;  1XO3 A;  2H88 B;  2RMM A;  3SR6 A;  3TUO A;  2IJ0 A;  2WDQ B;  1Y56 A;  1XLQ A;  1AYF A;  3ZGZ A;  1FFU A;  1OQQ A;  1WXQ A;  3VRB B;  1DYQ A;  3Q8E A;  3E9S A;  3ABV B;  1V97 A;  3VR8 B;  2CJO A;  3I9V 1;  2OHF A;  2JQR B;  2L1A A;  4IKG A;  2BBC A;  5D3D A;  2N0S B;  1JRP A;  1FRD A;  3P4P B;  2KN4 A;  5BMI A;  2EEL A;  5D7G A;  3R2I A;  1SB3 C;  1UWX A;  4GLS C;  1L4Z B;  4KX6 B;  2QIE B;  1N60 A;  2IGH A;  4XDC A;  3ZQ4 A;  2J52 A;  1IUE A;  2DLB A;  1FCC C;  3MC0 B;  4C7Y A;  5G5G A;  2PLP A;  1EWY C;  1J7C A;  1VZ8 A;  1OFF A;  2GB1 A;  4N59 A;  4A9A A;  2ONQ A;  3V3X A;  2XN9 C;  4R3D A;  1F2R I;  2DWQ A;  2DYM A;  2ACZ B;  2ICI A;  3KLS X;  1L4D B;  1XLP A;  2B76 B;  4REZ A;  2W3R A;  1DOI A;  2LGI A;  2BS4 B;  2JWU A;  1ZPS A;  3U2S C;  4ITK A;  1C4P A;  2WXP A;  4KGT A;  4WUR A;  1V8C A;  3AE7 B;  4L2Y A;  1I4Q A;  1JCK B;  1FNW A;  1YNT E;  4WIP A;  1JWB D;  2BW2 A;  2Y5P A;  3BZD B;  4HKZ E;  1TKE A;  2GI9 A;  3HUI A;  1XCT L;  1BXT A;  4P6V F;  1NYQ A;  2VZK B;  1ZOY B;  1HQR D;  2SAK A;  2OED A;  3TEW A;  2KMM A;  1B1Z A;  1PDX A;  1WWT A;  4IOI E;  1QKZ A;  3ZJU A;  1N5X A;  4OW0 A;  2WXJ A;  1F2R C;  1JWM D;  1K50 A;  2W3S A;  3P63 A;  3AEA B;  4RGM A;  1HZ5 A;  1YQ4 B;  3SEB A;  4DXF A;  1VZ7 A;  2LJI A;  1V1P B;  4GDK B;  1VLB A;  2MJ3 A;  1T6B X;  1SBB B;  4DQO C;  4RF1 A;  1EM7 A;  1YN5 A;  1TY0 A;  2L52 A;  2WU5 B;  2INP E;  1GB1 A;  2G1E A;  3U4E G;  5G5H A;  1I4X A;  1N62 A;  2WU2 B;  4YTN B;  2PVO D;  1JWA D;  2M19 A;  1EWC A;  4AS1 A;  1STE A;  1NI3 A;  1TY2 A;  3KWV A;  4Q2J A;  2LMC A;  2RDH A;  1I4G A;  3W9C B;  2BS3 B;  3U7Z A;  1QF6 A;  2IGG A;  3NRZ A;  1L6U A;  1KF6 B;  1FNV A;  2W54 A;  1C78 A;  3AE2 B;  3VQI A;  5HG2 A;  4D2K A;  3AE8 B;  3CIR B;  1KLU D;  4HEA 1;  1Q10 A;  5BMG A;  1L6V A;  1SEB D;  4KGR A;  2YEP F;  3AEG B;  1JWS D;  3V05 A;  2WQY B;  4YSX B;  1L0V B;  3AE9 B;  1D5M C;  3PZ7 A;  4TMA B;  5BYS A;  1D6E C;  2IPK D;  4WH4 A;  2K3U A;  4XWW A;  1FXA A;  4WWM A;  1R7S A;  3W5V B;  2ON8 A;  4NAW B;  3BVM A;  5H8Y E;  2AQ1 B;  2LHD A;  2K5P A;  1KRH A;  3AB5 A;  1RYJ A;  1C79 A;  2ZW1 A;  3IAM 1;  4YSZ B;  1VZ6 A;  4OZA A;  1I4P A;  1FEH A;  3NZ3 A;  4TQ1 A;  4YSY B;  1GB4 A;  2Q5W D;  1FFV A;  4ZRP A;  3U52 E;  3OWE B;  4OZC A;  4YTM B;  2LEK A;  1RFK A;  1QIL A;  4OZB A;  1XXG A;  5D3I B;  3DWM A;  2AQ3 B;  2N7J A;  3SFD B;  2CU3 A;  1FM0 D;  1VRA B;  2IDY A;  1IBX B;  3BYY B;  1D4B A;  2PW9 A;  1VJK A;  3IT6 B;  3LYY A;  1QQR A;  2I38 A;  1GOZ A;  1VR9 A;  2Y3A A;  3ZJT A;  1A70 A;  1L0Y B;  2PMV A;  4TQ0 A;  2V3P A;  4RH6 A;  1TYG B;  1E7P B;  2JX5 A;  4DXG A;  4N58 A;  4O1N A;  2W82 A;  4TSS A;  2PKO A;  5EE1 A;  4KKI A;  3FIL B;  3W5U B;  4RGO S;  1KTK A;  1BML C;  1SE4 A;  1WSP A;  1V1O A;  1EU3 A;  4WAF A;  1NEN B;  1AWD A;  3BK2 A;  3MJ5 A;  5C2T B;  2WXG A;  3W2D A;  1HZ6 A;  3CWI A;  4LLG M;  2W55 A;  2NMQ A;  2FUG 1;  1MVK A;  1UGJ A;  2N9L A;  4LK0 M;  4PT5 A;  3FC4 A;  1D5X C;  3PZ8 A;  3B2G A;  3DWG C;  4A8X C;  3RFZ B;  1KH0 A;  1SJH D;  1ROE A;  3BWU D;  2BYT A;  1AW7 A;  3NUH B;  1ACC A;  1QOF A;  3URY A;  1MHH E;  1NEK B;  3AV8 A;  1KLG D;  3AE1 B;  5GXG B;  2JXT A;  2KDM A;  3O13 A;  2L83 A;  1M4V A;  2BB6 A;  2FBW B;  2WXL A;  1ZUD 2;  4J3O D;  2K22 A;  3J9C A;  4RNA A;  5EE0 A;  2HTM E;  4A90 A;  1FD6 A;  1V1P A;  5HFY A;  4MM3 B;  1K51 A;  4EE2 A;  1TS4 A;  3Q69 A;  4US9 A;  1LO5 D;  1J7B A;  4XDD A;  5E6J A;  3AEF B;  1K52 A;  1CZP A;  1JWU D;  1P7E A;  3RPF C;  2LUM A;  3Q8F A;  3TEX A;  1ET9 A;  3Q8A A;  1J7A A;  4ZHO A;  5C3J B;  1BUI C;  3ZJV A;  5H92 C;  2K9X A;  3P4S B;  3AED B;  2MJD A;  3SFE B;  3Q8C A;  2KAJ A;  4US8 A;  3L4P A;  2DYO A;  4A55 A;  2BS2 B;  4RGN A;  4YWG G;  4JWS C;  2QEJ C;  2JSV X;  3BII D;  4WQM A;  5BMH A;  1PYW D;  1XLN A;  1F0Z A;  3MFG A;  2BT6 A;  3LB8 C;  1VDV A;  2DBY A;  2RPV A;  2PVG C;  5FKA C;  3TEY A;  3AEC B;  3AEE B;  3C8Y A;  2X38 A;  3W1S A;  2AX5 A;  4XWT A;  1L5P A;  1UWM A;  1SSN A;  1ZP0 B;  4C80 A;  3NVV A;  3LXF A;  4C7Z A;  3AEB B;  1MHX A;  1JW9 D;  2K0P A;  1T5X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...