4ZHOA

The crystal structure of arabidopsis ferredoxin 2 with 2fe-2s cluster
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
97
structure length
97
Chain Sequence
ATYKVKFITPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEAIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin-2, chloroplastic
publication title Structure of the bacterial plant-ferredoxin receptor FusA.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 24
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zhoA00
2QIEB 4IDIA 3AB5A 4YTMB 5GXGB 2KMMA 1NVID 2MJEA 5EE1A 1DOXA 1PFDA 3EUB2 1TKGA 3AE4B 2CU3A 2W3RA 3AE7B 3P4RB 2Q5WD 3SR6A 1DOYA 2H88B 1SB3C 1NENB 2WLBA 1N60A 1TYGB 1YJJA 3AEEB 3AECB 2K9XA 3P4SB 4ITKA 1UWMA 4ZHPA 1L0VB 1GPXA 1QOBA 3BIID 2QJLA 1PUTA 4YSYB 5AUKA 1L6UA 1N63A 3AMZA 4JWSC 1L6VA 2WQYB 2W3SA 1KRHA 5EE0A 1N61A 2K5PA 3AEGB 2BS3B 3NS1A 1E7PB 1OQRA 1I7HA 1YJIA 1JWBD 2WU5B 1F0ZA 1YQ3B 3AE5B 2CJNA 2WP9B 2H89B 4US9A 1FRRA 1WYGA 1N5WA 2PVOD 3AE9B 4YSXB 5C3JB 3AE2B 4HROA 1J7BA 2MH7A 5H8YE 2KAJA 3ZYYX 3AE6B 3P63A 2WDQB 4KX6B 1GAQB 3AE3B 4YXDB 1SIJA 1YQ4B 1RYJA 1N5XA 1ZP0B 2DWQA 3AE1B 1XO3A 2CJOA 2PIAA 1J7CA 3DWMA 3ETRA 3AM9A 2E3TA 2ACZB 1VLBA 5G5GA 3W5VB 4C7ZA 4JX1C 3LXFA 1FFUA 5G5HA 1WXQA 2JQRB 1RM6C 1ZXIA 3SFDB 3W9CB 1IUEA 1CJEA 1QT9A 2MJ3A 2WDRB 3W5UB 2JX5A 2K22A 3HVZA 2OHFA 1VDVA 2N0SB 1QOFA 4N59A 1ZOYB 1V97A 1XLOA 4US8A 1TJEA 4YSZB 2Y5CA 3SFEB 4ZHOA 2DBYA 5EE9A 1R7SA 4A9AA 1TKYA 1JRPA 1NEKB 3NRZA 1WGKA 2BS2B 3CIRB 2MJDA 1T3QA 3AEFB 3B2GA 1FFVA 2WDVB 4HRSA 1NYRA 1TKEA 3AE8B 1SF0A 4LTUA 1JW9D 1E10A 4ZOHC 1WRIA 1QOGA 1N62A 1ZUD2 1QLBB 2G1EA 1E6EB 3VRAB 2HTME 4P6VF 3AEBB 2L83A 3AH7A 4WWMA 5MPOA 4N58A 1FXIA 3NVWA 1RFKA 1FMAD 3AEAB 2W54A 1PDXA 3B2FA 3LB8C 3P4PB 3P1MA 1V8CA 2M19A 4JWUC 5AUIA 3NVYA 1DGJA 3VRBB 2PVGC 1FIQA 1QOAA 5EE3A 4USAA 1RWSA 1JALA 1DOIA 1ROEA 3AV8A 3HUIA 1XLQA 1QF6A 3ABVB 1JQ4A 3HRDD 3CWIA 1FO4A 2WS3B 3AN1A 4C80A 1KFYB 1WWTA 1VJKA 3RPFC 3P4QB 4FXCA 1L5PA 4YTNB 1JWAD 3L4PA 3B9JA 1AYFA 3PO0A 4YTPB 1J7AA 3AEDB 2B76B 1CZPA 1E9MA 2EKIA 2L52A 2LEKA 2M56B 5H92C 1NI3A 1FXAA 1E0ZA 1KF6B 1OFFA 1B9RA 2WU2B 1XLPA 1NYQA 1FM0D 1EWYC 3DWGC 3FAHA 2PKOA 3KWLA 1A70A 2BS4B 3NVZA 4C7YA 4YT0B 3VR9B 2BT6A 1OQQA 3FC4A 3NVVA 4N6EB 5C2TB 2W55A 1FRDA 1AWDA 2FBWB 4WQMA 3VR8B 3WCQA 2AX5A 1XLNA 1JROA
chains in the Genus database with same CATH superfamily
4IDIA 2GBJA 2MJEA 5BMIA 4MACA 4K1RB 4MGZE 2H88B 1ZKHA 4HJKA 3B08A 1L0VB 1V86A 3PRPB 2ZW0A 5DPSA 2I1KA 2FCSA 2HJ8A 3AEGB 1I7HA 3AULA 2I38A 3Q8EA 3PHXB 4MM3B 3SU8X 3M63B 2IZVB 2WP9B 4WH4A 4DXGA 4HDQA 4A3PA 4YSXB 5C3JB 4HROA 2MH7A 5H8YE 1UH6A 4DHZE 4EOYA 3WA0A 3GE3C 5LXHA 2BBCA 2D3AA 3PREA 4NPNA 1WXQA 4EFOA 3L17A 3AU4A 1YD8U 1WJ6A 4IOIE 3R2TA 4FHJA 2UWQA 2V0GA 3BK1A 5JXVA 4ZHOA 1L2NA 1P9DU 1WGKA 3VH3B 2OJRA 1JW9D 1E10A 2JXTA 2LUEA 4ZOHC 3MJWA 5MPOA 1YN3A 3GZNB 4N58A 5DCNA 5L95C 4FADA 2GLSA 1XD3B 2HE7A 1DGJA 3NG0A 4USAA 4KZCA 1F77A 4ARIA 2BVCA 2KTRA 2C9WB 4JLCA 3V60A 3TBLD 3PO0A 3AEDB 2V4LA 2AQ3B 1E9MA 3ZO5B 3T9LA 2RR9A 3M95A 4HXDA 1TGZB 2LWPA 1L0YB 1L4ZB 1WE7A 2DX5B 3DVNV 2BTEA 1IP9A 3RUIB 1J8CA 2RD0A 2G4DB 5T8IA 1NVID 1UF0A 4I6PA 1OEYJ 2QC8A 2Q5WD 2K8BA 1Q1OA 3AECB 4KDIC 1UWMA 2G4SA 2M17A 1QOBA 3UQBA 4P1CC 5AUKA 4AWJA 1VCBA 5EE0A 4ZRKA 3VUWA 3C19A 1Y56A 4ZDVA 4XWWA 3H6NA 2K3UA 1WGYA 3RULA 1UELA 1NI2A 2GBRA 3GS2A 2V4IB 3ZIMA 1ZW7A 3AE6B 2DNFA 1PQSA 4GU2A 1WJUA 1N5XA 1ZGUB 2ACZB 4US8A 3NS8A 2OHFA 2KLGA 2WXMA 3VXWA 3J9CA 3IFWB 1BT0A 3IVFA 1TY2A 2DYOA 4O1NA 1TS4A 1I4HA 1ZUD2 3DBLB 2GRIA 3VVWB 1TIFA 3WAMA 2L0FA 1MHXA 3IG3A 1J0GA 1XQQA 2KTRB 3GE8C 1SBBB 2LXCA 3AV8A 1K50A 1UD7A 3BINA 1L7YA 3WAOA 5IO9A 3JW0X 4F7ZA 4BFRA 4RF1A 1R4NI 2JUOA 3CSTA 4GGQA 1N6ZA 4RM9A 1F2RC 2B76B 1WI0A 2M4NA 1P98A 1WXMA 3EECA 3RNEC 3IAM1 2WU2B 2YVCA 2LASA 4OZBA 2EMSA 1WH3A 1GOZA 3VR9B 4MH0E 1OQQA 2MBOA 1KOTA 2L7RA 2D07B 2KJ6A 4M00A 4W9FA 4NZLB 1GC7A 1C77A 2AWTA 1YOVB 4W9DA 2N7EA 1P3QU 3SR6A 2D3BA 1T0QC 2R61A 2QJLA 2CHWA 1KRHA 5JZEB 4KDLB 2DYBA 1OQRA 3UF8A 1Z5SB 4PT5A 1UGJA 5HFYA 4IWQA 2NVUI 2D11A 4NY0A 1CQVA 2WXKA 3VHTC 3PGEA 3W1YA 1FXTB 3AE1B 1ZP0B 3EGRA 2J0KA 3LYYA 4WQOB 1YMHE 3QK0A 4MEMA 1IBXA 2N0SB 5IAAC 5J2RA 4IWPA 3W2DA 4RFBA 1XEEA 2K8CA 4GDLA 3UINB 3BZDB 3R8BA 2D3GA 4A55A 3DBHB 4X57B 2PEAA 3ZJVA 4PS7A 2VZKD 2MW5A 1E8XA 3VUXA 1C4AA 2DHZA 1WWTA 4WAFA 2IO1B 3P4QB 1I35A 2LGYA 2ONQA 3KUDB 1TBEA 3DHIC 3MC9A 2ON8A 1CZPA 1WR1A 4XDCA 1PGBA 1BUIC 2L3ZA 2KXJA 4GB9A 2BT6A 5D94A 2IO3B 4L2YA 3KUCB 3MFGA 5HKHA 2UU7A 3DQVA 5GXGB 3R7QA 4LCDE 1DOXA 2JPHA 3EUB2 3AE4B 1ZDXA 5C23A 1WRDB 2REXA 3AEEB 3U52E 2BYTA 1LM8B 3ZNID 3BIID 2K5PA 1WFYA 3RNCC 1YJIA 2ZVNA 3PZ7A 2IO2B 2VH2A 2QCZA 1YJ1A 3RD2A 2INDC 3M3JA 1IBXB 4US9A 3RZWC 1T5XD 1XF5L 2KDBA 1TTNA 1GAQB 4GDLB 5BO4B 5G5HA 3PHWB 1RM6C 3GZNI 3U2SC 4KSLC 1WX9A 1FNVA 3QCAA 3T3OA 3SFEB 1UBQA 2BW2A 3OAWA 1T3QA 2JWZA 2EELA 1TKEA 1P0RA 4BAXA 4GN1A 4B0MA 4LNOA 2BGFA 1WIAA 3AEBB 3R7RA 1OTRB 3AH7A 4E3CA 1FMAD 4JIOU 3Q6BA 2LFIA 1V8CA 4CYEA 4JWUC 4DQOC 3NVYA 4FA6A 3V05A 2MBHA 1D6EC 3AU5A 1XLQA 1QF6A 2ZNVB 2WYQA 4HVBA 4C80A 1BMLC 3X23A 4IW0A 2BYVE 3W1SC 2IO0B 1SXTA 4ICUA 1SE3A 4HCNB 4KSKC 2N1VA 3V62A 2MEKA 3ZLZA 3TEWA 2RDGA 3DOWA 1S3SG 2PMVA 1I42A 1EWYC 4IM3A 4IUMB 3RZFA 1E8YA 2HTME 4HJGE 3VTUA 3ECIA 3TMPB 3TEYA 1HTQA 2N9EB 5KHQA 4JQWC 2G3QB 4ITKA 2FE8A 5IOIA 3U7ZA 1YN4A 3UQAA 3Q3JA 5IN7A 1E8WA 3MHSD 1UNSA 4G11A 1AN8A 1WYGA 4KVGB 2PVOD 3QA8A 3JYUA 1WM2A 2KMCA 3OWEB 5J18A 2LUMA 1YQ4B 4RGTA 1GC6A 2CJOA 3DBLI 4NJ7A 3NJTA 2L1AA 1ENFA 3W9CB 2AQ2B 4W9CA 4AS1A 5E6NA 3H9DA 3AEFB 3B2GA 2UYZB 3M62B 2CHXA 1GUAB 4WIPA 2GBMA 1N62A 2KQ4X 2L83A 2AQ1B 2PW9A 2EKEC 3Q2AC 4A20A 4WAAA 3APCA 1FIQA 3Q8FA 1RWSA 2FUG1 3DPDA 2RSUA 4JGHB 2LHDA 3B9JA 4IM0A 2JY6A 1ET9A 2KDMA 4RGMA 3IT4B 3NY5A 1KLGD 1FXAA 1C4CA 2WXGA 4II3B 3VTWA 4C00A 2IBIB 3KWLA 1B1ZA 4LNIA 4A8XC 4H2AA 5E6JA 4TUUA 4S17A 3QHTA 3RYTA 4P1BC 4WWNA 2QIEB 3CSFA 4HEA1 1TS5A 4LK0M 2L00B 2CU3A 2QEJC 4TQ1A 2I1JA 2J7QB 4GSWA 2K9XA 1H4RA 3OJ3A 4G0NB 2Y5PA 5LNK1 1L0XB 1L6UA 2KACA 1WMHA 1F52A 4RF0A 2NS5A 3JVZX 5DPRA 2N4FA 4PS8A 3BYYB 4EZLA 4DDID 2H89B 3Q8CA 1J7BA 2WXHA 3DBHI 3ZW3A 4KX6B 5AEKB 1SIJA 4IM2A 3ZTDA 2G45B 2Y5BB 3KWVA 2XBBC 2WX1A 2J52A 3V6EB 1TJEA 1D5ZC 3ZDTA 1EF1A 1QKZA 4W9HA 2KFKA 3PVLA 2IY1B 4L23A 3ZJUA 3BWUD 1J19A 1FFVA 2JZPA 4LNKA 1Q5WB 2G1EA 1AARA 4NQLB 1E6EB 3RT3B 2V1YA 1RFKA 3UIOB 4BKTA 4M01A 1WE6A 5AUIA 3ZNHB 1E7UA 2NCNA 4G3XB 1I4PA 2QSDA 5AZHA 2V3NA 2X8XX 3BYTB 3I3TB 1T0SC 5E6PA 5D3DA 2A4ZA 3N30A 1YQBA 1ISNA 1VR9A 2NMQA 4PS3A 4YTPB 2ZNVC 2AYOB 2WGSA 4IC7B 5EDSA 1VD2A 2LGIA 1A70A 2PLPA 1C9FA 2WHIA 4R3DA 4NAWA 1FRDA 1TS2A 2A5UA 3BVGA 1WMHB 4C56C 1UZXB 2LGXA 4PK1A 1HTOA 3ZKJC 1YX5B 2YEPF 1V1PA 3ZNGC 2MBBB 1ZE3D 3AE7B 1DOYA 2KT7A 1NENB 4NNJB 4BOZB 3NZSA 2W3SA 4XGAB 1OQYA 2BS3B 1E7PB 2WU5B 4II2B 2C60A 2Y3AA 3WIMA 2IJ0A 2TSSA 2PPHA 3ML8A 5BYSA 3AE2B 2JWUA 3AE3B 1Z2MA 2KFKB 4DK5A 2KX3A 5JHAA 1CMXB 3W5UB 3N1ZC 4ZYSA 2DBYA 3O13A 3SEBA 1Y8RC 1SE4A 4HRSA 3H7SA 3KYDD 4HPLB 3BVZA 1QOGA 3Q3MC 1ESFA 2JU6X 2O6VD 1SIFA 4TMAB 4MH8A 1M4VA 3Q14C 2KJRA 2WXQA 4BOSC 4HKQA 2PJHA 2VZKB 3MC8A 3PLUA 2B3AA 4XDDA 3QWZB 1YX6B 2CU1A 2N9LA 1P7EA 2KDFB 1NBFC 3Q8AA 4NAWB 4W9IA 2AL3A 2DAFA 4KGSA 1V1PB 1XLPA 2HDEA 2GBKA 2KFJA 5C2TB 4FLHA 3GOEA 4DHJD 2PVGC 1ACCA 1C76A 4YTMB 2KJHB 3P4RB 4LNFA 3A1QA 1K52A 2WLBA 1N60A 4W9GA 1V5TA 5L83A 2D3CA 4YSYB 1N63A 1L6VA 1FPYA 3R66C 4HLEA 2LRWA 3MC0B 1C3TA 2GI9A 2BPSA 1FRRA 1XXGA 1LQBA 1K51A 2WDQB 3HHMA 5E6OA 3T3NA 1FCLA 3NUHB 2DWQA 3W5VB 2FUHB 1IUEA 1LXDA 1LO5D 2YLMA 2KC1A 3VH4B 1QOFA 2R2OA 4AUQC 2NTSA 4WWOA 2JZ3B 5CTRC 1UWXA 1HE8A 2V3SA 1ZDVA 3PS6A 4HCPB 3ZXRA 2PE9A 4P6VF 5AZFA 1LFDA 2W54A 1PDXA 2M0AA 2GBNA 1WF9A 3SHQA 4WJQA 2N9PC 1QOAA 5EE3A 1JALA 1ROEA 3EFUA 2BB6A 2Z0EB 1QILA 3EHVA 2KNBA 2R2QA 2DENB 2K6QA 3BVMA 2J0MA 1P1AA 3N32A 3AXCA 2J4XA 1WM3A 4B6WA 2INPE 2ZVOA 1OFFA 3A9KA 4OZAA 2W9NA 3NVZA 2BYFA 3A1QB 2KOXA 3ZVVA 4B95A 1IGDA 2FBWB 3RNAC 3AB5A 3UIPB 2M1MA 2W3RA 1VRAB 3Q3FA 3PLVA 2KDIA 4B0EA 3NZUA 3AMZA 2V9HA 3SDLC 4K3CA 1I4XA 2MHJA 1JWBD 1G6JA 3DHGC 1KLUD 2LJ5A 5HI1A 5LLIA 2OOBB 4OVVA 1E5WA 4FJZA 2MX2A 3X0WA 1R4MB 4RCOA 3QC8B 1VLBA 4DWFA 2KVZA 1WJNA 1CJEA 1OGWA 3PZ8A 1HZ5A 4GIVA 4N59A 1ZOYB 4FJVB 4MGYE 2NR2A 4A9AA 1NEKB 2WXOA 2BKRB 3K9OB 1NYRA 1WX8A 2KANA 4LTUA 2O2VA 4KIKA 4ZRJA 2LI5A 1FXIA 3NVWA 3ZRFA 1A5RA 2IPKD 1XT9B 3V3XA 1HA5A 1K8RB 5KHOA 1HXYD 2J53A 5IKCM 1S1QB 3KQ4A 3I63C 1K53A 2KTFA 2D10A 4BKGA 3A9KB 2N9KA 4CQNA 3TEXA 4FBJB 3Q3NC 4DHZB 1KH0A 2C7HA 4HK2A 1YIWA 2KWCA 1HQRD 2DZIA 3P2BA 2IGHA 3SD5A 1M94A 3FC4A 1YN5A 3PRZA 4AOFA 2BB5A 1U4AA 3EC8A 5BYQA 2Z59B 1VZ7A 1TT5B 4K7UA 4NQKE 1TKGA 1SB3C 2INNE 2L8JA 5FK9C 1EUVB 2JRIB 1MFWA 1PYWD 1SGHA 2KC2A 2VRRB 1FD6A 5LXIB 2C5LC 4TSSA 2DZJA 2DZKA 3QARA 1AW7A 4FN2A 4EZKA 5GMVA 3PV1A 1RYJA 1E7VA 1XO3A 1EU3A 2BQQA 4OHJA 5G5GA 2O2VB 4KIKB 2K22A 4MGIE 1GNUA 2LVQA 3PSEB 5DPWA 2W82A 2PTLA 2FIDA 1V5OA 3AE8B 4ARCA 4A3OA 4ANXA 2MBEA 4W9KA 4AJWA 5G55A 4MJSA 1JWMD 4QAYA 1VZ8A 3B2FA 3DVNU 3VRBB 1FCCC 2XNAC 3FKYA 2GOWA 4EE2A 1FO4A 3AN1A 3L10B 4M8NA 2DYMA 4WURA 1GG3A 1VJKA 3ML9A 2MA9B 1JWAD 1ZPSA 4HPPA 1T0YA 2Z8LA 4PYUA 2BKFA 4S0RA 3VUYA 4J3OD 1KF6B 1WGRA 3DHHC 2IGDA 2PKOA 4TKNA 2O6VA 1QQRA 4WJOA 3OLMD 1KLVA 3VR8B 1FEHA 1XLNA 4NAMA 1JROA 3DVGX 3TEZA 1T6BX 1PFDA 2WXNA 4K7WA 3Q3OC 1WXVA 3BY4B 1TYGB 2JRHA 1OEYA 3R3MA 3DVGY 2RGFA 1Q0WB 2KYWA 1JMLA 4EEWA 3DDCB 4MGKE 3VTVA 1V49A 2GMIC 3I9V1 1RAXA 1LGRA 3EA6A 2BYEA 3QX1A 2CR5A 4YXDB 3ZXVA 4C7ZA 3A4SC 2KQ7A 1E90A 1QT9A 3BK2A 1WJ4A 4FJYA 4MT5A 4MJSB 1WR6E 2N1WA 2LRUA 3DBRB 5HHDG 3CIRB 2MJDA 2NPTA 1V1OA 2WDVB 1EWCA 4I6LB 5G2NA 2MLBA 4M02A 1WYWB 4WWMA 4BKSA 1Q10A 4W9EA 1T0RC 1WGDA 3WANA 5I4DA 2QDFA 3VFKA 2LVPA 2DLBA 1C79A 2V3PA 4ANVA 3ABVB 1JQ4A 3HK0A 3NZ3A 2KZRA 3KVFB 4N9F4 2WXPA 2O6VB 4CHKA 2JVCA 4LJOB 1J7AA 2WXLA 3L16A 3Q69A 5CHVC 2LEKA 3R2IA 5H92C 1E0ZA 4HDOA 5BYRA 1PGXA 1NYQA 2KKCA 1FM0D 1V2YA 4RGOS 2BS4B 1V6EA 4YT0B 3H1UA 3A9JA 3LDZE 4N6EB 3TSSA 3RFZB 2MCNB 1SSNA 3KLSX 4IWOA 1MVKA 3ZJTA 3VAWA 2DAJA 4P7IA 5CHWA 4E74A 1TY0A 4CO7A 2ICIA 4ZRPA 2XN9C 1F9JA 1YJJA 4LDTB 2OJWA 3ZNZB 1R4MI 4DHJB 4UDUC 4KKJA 3L54A 1MG4A 1IPGA 4P16A 1TZ1A 2WXRA 4GOCA 1L4DB 2HD5B 1YQ3B 1KM7A 1NDDA 2FCQA 2JZZA 2FCMA 2KN5A 2DZMA 3APDA 3S2AA 2KAJA 4XC2A 2LVOA 3IAS1 1X1MA 2NPTB 2NBWB 2JQRB 2MJ3A 2KO3A 4EUTA 2JX5A 1C78A 2KWVB 3HVZA 1VDVA 2WXFA 3NOBA 1V80A 3URYA 4ASWC 5FR3A 3KH0A 3VQIA 4L1BA 1R7SA 1STEA 3ZTCA 5AZGA 2LD9A 4GDKA 2LJIA 2KDEB 3Q8BA 3UI3A 3W1SA 1QZEA 4RGNA 3P4PB 3TJPA 5IA7A 3UGBB 4K7SA 2PE6B 3DCGA 4ANUA 2KWDA 3L0WB 4OVUA 4WJPA 4ZRIA 2AEHA 4XYCA 4C4VA 3DBSA 4A6QA 2KWUB 3A9JB 3TCAA 2INCC 2L76A 5TR5A 3N3KB 2KHWB 2MRPA 1PGAA 3I57A 4E71A 4M0WA 3P42A 4TQ0A 1XCTL 2ZCCA 2AX5A 2MWSB 3IBEA 3N9YC 2BWFA 5EE1A 3QQ8B 4K3BA 4ICVA 4ZHPA 3T8MA 3CF6E 4JPSA 1GB1A 3PPAA 4OW0A 2KK8A 5CHFA 1F0ZA 3IT6B 2WX0A 4LDTD 3RNBC 3V61A 2CJNA 2HJ1A 1E8ZA 1FNUA 1V9JA 2CS4A 4AQ7A 4G50A 2L32A 2PIAA 1J7CA 2ZEQA 3APFA 2D2QA 2G9HD 1XCQL 1ZXIA 4GDKB 4KKIA 2LXAA 4ZYNA 1D5XC 1VZ6A 3D32A 4TV3A 3MJ5A 2IDYA 5D6JB 4F1SA 2BWES 2FIFA 3MHZA 3L13A 1UBIA 3MP9A 3N1YC 4FULA 4IG7B 1SF0A 4LNNA 3I5JC 2IY0B 3HVDA 1WRIA 4BKSD 2ZPNA 4LJPB 4MSQB 4C4VB 2I2YA 3E56A 2E6XA 2KMAA 1EM7A 2M19A 3L08A 1BXTA 2CKHB 3U30A 1HZ6A 3GP7A 3HRDD 2MQJA 4RNAA 2QHOA 3ZDMC 4M0WB 3RMKC 1H8CA 4BBNF 2XK5A 2RDBC 2C7NB 3QIJA 1TZOA 4W9LA 2EKIA 2M56B 2FCNA 1RFAA 3U8ZA 3U4EG 4RH6A 1C4PA 4ACFA 3GB1A 2JSVX 4JE3B 4WQMA 3LJ3A 3RCZA 3PTFC 2KMMA 2RPQA 2CHZA 1WZ0A 2N7JA 1V81A 2FAZA 3RN9C 3PRMB 1GPXA 4W9JA 1JWUD 3FILA 1MHHE 1GB4A 4XZ4A 2BF8B 3JSVA 3NHEB 4B9KA 1F2RI 3DBRI 1UGMA 5JHBA 5IP4D 2KQSA 1WSPA 2JT4B 2C7MB 2NTTA 4JX1C 3SFDB 2MP2A 1WZ3A 1DYQA 4YSZB 2Y5CA 1I4GA 3QAQA 1TKYA 1JRPA 2K1FA 4ZRQA 1KTKA 1MG8A 2ZJDA 2K0PA 4OZCA 5BMGA 3VRAB 3ONSA 3AEAB 2XK5B 4BBNC 4GXBA 1DOIA 3HUIA 1TS3A 3CWIA 2WS3B 1RLFA 4GMVA 3RNGC 2LGDA 3MTNB 4DDGD 4EKUA 1SE2A 3H7PA 2L52A 1D3ZA 4KV2A 2ZZPB 2D5GA 3AI5A 1HEZE 3DWGC 2EMTA 4GLSC 2QMTA 3TIXA 4WJNA 2W55A 4HKZE 3WCQA 3FILB 3JSVB 2LGSA 5J17A 3WAPA 3N20C 1ZXHA 1SE9A 4JWSC 2IGGA 4RMAA 3V6CB 1N61A 2M8SA 3NS1A 3TUOA 3OG5A 3ZUNA 2KVRA 5TSSA 2RDHA 2MP2B 3EFCA 2WNMA 3AE9B 3H8HA 2K25A 4WWPA 3ZYYX 2WWZA 4DXAB 3DWMA 3ETRA 3AM9A 2RPVA 3LXFA 2MBQA 1EO6A 2WDRB 1V97A 1XLOA 2XEWA 2KD0A 4J6IA 5FKAC 1JRUA 1FNWA 5EE9A 1F1HA 4BVUC 4DBGA 3VDZA 2N9XA 2ZCBA 4NJCA 3PZDA 3ZQ4A 3C0RB 2L0TA 1WX7A 1ET6A 1QLBB 3TL5A 1MPEA 2J0JA 1D4BA 3CMMB 2JYTA 2JF5A 4HPMB 3P1MA 1WXAA 5D2MB 2WDTB 4D2KA 3H7PB 5D7GA 4F8CB 3RNFC 2JXXA 2MSED 2QILA 3E9SA 2NBVB 4KGRA 4FXCA 1L5PA 4YTNB 1GJZA 3ALBA 4XWTA 1I4RA 1JCKB 3IXSA 1WY8A 2AL6A 1SJHD 1NI3A 1B9RA 5BMHA 3FAHA 4MSMB 1C1YB 3ZGZA 5D3IB 1AWDA 1R4NB 2K6DB 3HM6X 1UUPA 4EZJA 1KJTA 2K8HA 2M0XA 2VH1A 4BZAA 2K39A 4XX5A 2L05A 4URKA 4LLGM 3PT2B 2RMMA 5JH5C 3P4SB 2N7DA 4I6NB 1PUTA 4YWGG 4JL9A 2WQYB 4MDKE 4KGTA 4KZ0A 5HG2A 2SEBD 1CK1A 2GB1A 3A4RA 3AE5B 2LHEA 4PYZA 3WALA 1MI0A 4Q2JA 5FR6A 1N5WA 2FNJB 2ZW1A 4OVZA 3HM3A 3KW5B 1RRBA 3P63A 2NBUA 4YL8A 1JWSD 2E3TA 2WXIA 2KLCA 1FFUA 3U7DA 3KYCD 4MM3A 3K9PB 2LZ6A 3KUZA 4REZA 2OEDA 5CX3A 4M8MA 5C1ZA 2JYEA 3B0AA 3A33B 1D5MC 3B1LX 3NRZA 2BS2B 4ANWA 1YNTE 3HIZA 2IYDB 4XE0A 2X38A 2YEPB 5DPTA 3N1XC 3RI7C 2SAKA 1EU4A 3OJ4B 4HWIB 4AP4C 1SJED 3IHPC 1WGHA 2WXJA 1IGCA 2Z0DB 2ZPYA 3LB8C 3ZRCA 2KX0A 2KN4A 4AJYB 4IKGA 1IYFA 1WGGA 4DXFA 4RM8A 1KFYB 2ASQA 3RPFC 3ENEA 1EF5A 4A90A 3L4PA 2LMCA 1AYFA 1SEBD 4FHKA 4NJ6A 1P7FA 2HTHA 4K81A 1WXSA 3C8YA 1I4QA 4C7YA 3O65B 3QJZA 3NVVA 2J42A 4MELA 1MJDA
chains in the Genus database with same CATH topology
4HJGE 4IDIA 3AB5A 3N9YC 2MJEA 5EE1A 5BMIA 4MACA 2W3RA 3TEYA 1VRAB 2H88B 4ITKA 4ZHPA 1L0VB 2FE8A 4B0EA 2ZW0A 3U7ZA 3AMZA 4JPSA 1YN4A 1GB1A 4OW0A 3AEGB 1I4XA 1F0ZA 3IT6B 1I7HA 1JWBD 2I38A 1UNSA 3Q8EA 1KLUD 5HI1A 4MM3B 2CJNA 1AN8A 4WH4A 2WP9B 4DXGA 1WYGA 2PVOD 1FNUA 4YSXB 5C3JB 4HROA 2MH7A 5H8YE 4AQ7A 3OWEB 2LUMA 1YQ4B 4RGTA 2L32A 2CJOA 2PIAA 1J7CA 2BBCA 4RCOA 1VLBA 2L1AA 2G9HD 1WXQA 1ENFA 1XCQL 1ZXIA 3W9CB 1CJEA 4GDKB 4KKIA 4IOIE 3PZ8A 1HZ5A 3R2TA 4N59A 1ZOYB 1D5XC 1VZ6A 2V0GA 3MJ5A 3BK1A 2IDYA 5JXVA 4ZHOA 2AQ2B 4AS1A 4A9AA 1NEKB 1WGKA 3MHZA 2WXOA 3AEFB 3B2GA 3MP9A 1NYRA 1SF0A 4LTUA 1JW9D 3HVDA 1E10A 2JXTA 4WIPA 4ZOHC 1WRIA 1N62A 2KQ4X 2L83A 5MPOA 1YN3A 4N58A 2AQ1B 1FXIA 3NVWA 2I2YA 2PW9A 3E56A 2E6XA 2IPKD 1EM7A 3V3XA 1HA5A 2M19A 1DGJA 1FIQA 2J53A 1HXYD 3Q8FA 4USAA 1RWSA 1BXTA 3KQ4A 1HZ6A 1K53A 3GP7A 2FUG1 3HRDD 4RNAA 1F77A 2LHDA 4ARIA 2N9KA 4CQNA 3TEXA 3B9JA 1ET9A 3PO0A 3AEDB 2KDMA 4RGMA 1TZOA 2AQ3B 3IT4B 1E9MA 2EKIA 2M56B 1KH0A 1KLGD 1FXAA 1C4CA 2WXGA 3KWLA 1B1ZA 1HQRD 3U4EG 4RH6A 4A8XC 4H2AA 1C4PA 5E6JA 3GB1A 1L0YB 1L4ZB 2IGHA 2JSVX 1YN5A 3FC4A 2BTEA 2BB5A 4JE3B 4WQMA 5BYQA 2QIEB 1VZ7A 5T8IA 4HEA1 1TS5A 2KMMA 1NVID 4LK0M 1TKGA 2CU3A 2QEJC 4TQ1A 2N7JA 2Q5WD 1SB3C 3AECB 2INNE 2K9XA 5FK9C 1UWMA 1GPXA 1QOBA 2Y5PA 5LNK1 5AUKA 1L0XB 1JWUD 1L6UA 1MHHE 1PYWD 2KACA 3FILA 1GB4A 4RF0A 5EE0A 1FD6A 1Y56A 4XWWA 4TSSA 2K3UA 3BYYB 1F2RI 2H89B 1AW7A 3GS2A 3Q8CA 2V4IB 1J7BA 1WSPA 2WXHA 3AE6B 4KX6B 1SIJA 1RYJA 1N5XA 1XO3A 2NTTA 1EU3A 2ACZB 4OHJA 5G5GA 4JX1C 3KWVA 3SFDB 4US8A 2K22A 2J52A 2OHFA 1DYQA 1TJEA 4YSZB 2Y5CA 2WXMA 1D5ZC 3J9CA 1I4GA 1QKZA 1TKYA 1JRPA 2W82A 4L23A 3ZJUA 4ZRQA 3BWUD 2PTLA 1TY2A 1FFVA 3AE8B 2JZPA 4ARCA 2DYOA 4O1NA 1TS4A 1I4HA 1ZUD2 1KTKA 2GRIA 2G1EA 2K0PA 1E6EB 4OZCA 5BMGA 3VRAB 1JWMD 1RFKA 1MHXA 3AEAB 1VZ8A 3B2FA 5AUIA 3VRBB 1FCCC 2XNAC 1I4PA 1SBBB 2QSDA 2V3NA 1DOIA 3AV8A 3HUIA 1K50A 3BYTB 1TS3A 4EE2A 3CWIA 1FO4A 2WS3B 3AN1A 2DYMA 5D3DA 4WURA 1VJKA 4RF1A 1JWAD 1VR9A 1ZPSA 2NMQA 1SE2A 2Z8LA 1F2RC 4YTPB 2B76B 2L52A 4J3OD 1KF6B 3IAM1 2D5GA 2WU2B 4OZBA 1HEZE 2IGDA 3DWGC 2PKOA 2LGIA 1A70A 4GLSC 2PLPA 1QQRA 1GOZA 2QMTA 3VR9B 1OQQA 1C9FA 2W55A 4HKZE 4R3DA 1FRDA 1TS2A 3BVGA 3VR8B 3FILB 1FEHA 3WCQA 4C56C 1XLNA 4NAMA 1JROA 2YEPF 3TEZA 1T6BX 1V1PA 4NZLB 1C77A 1PFDA 1ZE3D 2WXNA 3AE7B 1DOYA 3SR6A 1ZXHA 1NENB 1TYGB 2R61A 2QJLA 4JWSC 2IGGA 2W3SA 1KRHA 1N61A 1JMLA 2BS3B 3NS1A 1E7PB 1OQRA 2WU5B 4PT5A 3TUOA 1UGJA 2Y3AA 5HFYA 2IJ0A 5TSSA 2RDHA 2TSSA 2WNMA 1CQVA 2WXKA 5BYSA 3AE9B 3H8HA 3I9V1 3AE2B 3ZYYX 3EA6A 2JWUA 3AE3B 4YXDB 3AE1B 1ZP0B 3DWMA 3EGRA 3ETRA 4C7ZA 3AM9A 3LYYA 2RPVA 3LXFA 1YMHE 1QT9A 2WDRB 3BK2A 3W5UB 1IBXA 2N0SB 4MT5A 1V97A 1XLOA 3W2DA 5FKAC 4ZYSA 1FNWA 2DBYA 4RFBA 5EE9A 1XEEA 3O13A 5HHDG 3SEBA 3CIRB 2MJDA 3BZDB 3R8BA 1V1OA 1SE4A 4NJCA 4HRSA 2WDVB 3ZQ4A 4A55A 1EWCA 3BVZA 1QOGA 1ET6A 1QLBB 1MPEA 3ZJVA 1D4BA 1ESFA 4WWMA 2VZKD 2JYTA 2JU6X 1Q10A 3P1MA 5I4DA 4TMAB 4MH8A 4D2KA 1M4VA 5D7GA 2V3PA 2DLBA 1C79A 1C4AA 3ABVB 1JQ4A 2WXQA 3NZ3A 4HKQA 2QILA 2VZKB 1WWTA 4WAFA 3E9SA 3P4QB 2WXPA 4KGRA 4XDDA 4FXCA 1L5PA 2ONQA 4YTNB 4XWTA 1I4RA 1JCKB 3IXSA 2N9LA 1P7EA 3Q8AA 4NAWB 2ON8A 1J7AA 2WXLA 1CZPA 3Q69A 4XDCA 1PGBA 2LEKA 1SJHD 3R2IA 5H92C 1BUIC 1NI3A 1E0ZA 1B9RA 4KGSA 5BYRA 1V1PB 1PGXA 1NYQA 1XLPA 5BMHA 1FM0D 3FAHA 2HDEA 4RGOS 2BS4B 4YT0B 2BT6A 5C2TB 4N6EB 3TSSA 3RFZB 1SSNA 3ZGZA 5D3IB 3KLSX 1AWDA 1MVKA 4L2YA 2PVGC 1ACCA 3MFGA 1C76A 3ZJTA 1UUPA 1TY0A 4YTMB 5GXGB 1DOXA 3EUB2 3AE4B 3P4RB 2ICIA 1K52A 1ZDXA 2WLBA 3AEEB 2XN9C 4LLGM 1N60A 2RMMA 1YJJA 4ZRPA 3U52E 3P4SB 2BYTA 3BIID 4YSYB 1PUTA 4YWGG 1N63A 4UDUC 1L6VA 4KKJA 2WQYB 2K5PA 4KGTA 4P16A 2WXRA 3MC0B 1YJIA 3PZ7A 2GI9A 1L4DB 5HG2A 2SEBD 1CK1A 2GB1A 1YQ3B 3AE5B 2LHEA 1MI0A 4Q2JA 1IBXB 4US9A 1FRRA 1N5WA 2ZW1A 1T5XD 4OVZA 1XXGA 1XF5L 2KAJA 1K51A 3P63A 2WDQB 1FCLA 1GAQB 3T3NA 3NUHB 4GDLB 2DWQA 3IAS1 3W5VB 1JWSD 2E3TA 2WXIA 1FFUA 5G5HA 2JQRB 1RM6C 3U2SC 1IUEA 2MJ3A 2JX5A 1C78A 1LO5D 3HVZA 1VDVA 1QOFA 4REZA 1FNVA 2OEDA 2WXFA 2NTSA 3SFEB 3T3OA 3URYA 5FR3A 2JYEA 3VQIA 4L1BA 1R7SA 1D5MC 1STEA 3NRZA 2BS2B 2BW2A 1YNTE 1T3QA 4XE0A 1UWXA 2EELA 2X38A 2YEPB 1TKEA 1ZDVA 4B0MA 2SAKA 2LJIA 3Q8BA 3UI3A 1EU4A 3W1SA 4P6VF 3AEBB 1SJED 3AH7A 1FMAD 2WXJA 1IGCA 1PDXA 2W54A 3LB8C 3P4PB 2M0AA 4RGNA 2LFIA 1V8CA 2KN4A 4JWUC 4DQOC 3NVYA 4IKGA 3V05A 1QOAA 1D6EC 5EE3A 4DXFA 1JALA 2KWDA 1ROEA 1XLQA 1QF6A 2BB6A 4C80A 1BMLC 1KFYB 1QILA 3RPFC 4A6QA 4A90A 3BVMA 3L4PA 2LMCA 1AYFA 1SEBD 1SXTA 1SE3A 2J4XA 2INPE 1P7FA 2MEKA 3TEWA 2RDGA 1OFFA 2PMVA 3C8YA 1EWYC 4OZAA 1I4QA 1PGAA 3I57A 3NVZA 4C7YA 4M0WA 3P42A 3NVVA 4TQ0A 1XCTL 1IGDA 2FBWB 2J42A 2AX5A 2HTME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIE B;  4IDI A;  3AB5 A;  4YTM B;  5GXG B;  2KMM A;  1NVI D;  2MJE A;  5EE1 A;  1DOX A;  1PFD A;  3EUB 2;  1TKG A;  3AE4 B;  2CU3 A;  2W3R A;  3AE7 B;  3P4R B;  2Q5W D;  3SR6 A;  1DOY A;  2H88 B;  1SB3 C;  1NEN B;  2WLB A;  1N60 A;  1TYG B;  1YJJ A;  3AEE B;  3AEC B;  2K9X A;  3P4S B;  4ITK A;  1UWM A;  4ZHP A;  1L0V B;  1GPX A;  1QOB A;  3BII D;  2QJL A;  1PUT A;  4YSY B;  5AUK A;  1L6U A;  1N63 A;  3AMZ A;  4JWS C;  1L6V A;  2WQY B;  2W3S A;  1KRH A;  5EE0 A;  1N61 A;  2K5P A;  3AEG B;  2BS3 B;  3NS1 A;  1E7P B;  1OQR A;  1I7H A;  1YJI A;  1JWB D;  2WU5 B;  1F0Z A;  1YQ3 B;  3AE5 B;  2CJN A;  2WP9 B;  2H89 B;  4US9 A;  1FRR A;  1WYG A;  1N5W A;  2PVO D;  3AE9 B;  4YSX B;  5C3J B;  3AE2 B;  4HRO A;  1J7B A;  2MH7 A;  5H8Y E;  2KAJ A;  3ZYY X;  3AE6 B;  3P63 A;  2WDQ B;  4KX6 B;  1GAQ B;  3AE3 B;  4YXD B;  1SIJ A;  1YQ4 B;  1RYJ A;  1N5X A;  1ZP0 B;  2DWQ A;  3AE1 B;  1XO3 A;  2CJO A;  2PIA A;  1J7C A;  3DWM A;  3ETR A;  3AM9 A;  2E3T A;  2ACZ B;  1VLB A;  5G5G A;  3W5V B;  4C7Z A;  4JX1 C;  3LXF A;  1FFU A;  5G5H A;  1WXQ A;  2JQR B;  1RM6 C;  1ZXI A;  3SFD B;  3W9C B;  1IUE A;  1CJE A;  1QT9 A;  2MJ3 A;  2WDR B;  3W5U B;  2JX5 A;  2K22 A;  3HVZ A;  2OHF A;  1VDV A;  2N0S B;  1QOF A;  4N59 A;  1ZOY B;  1V97 A;  1XLO A;  4US8 A;  1TJE A;  4YSZ B;  2Y5C A;  3SFE B;  4ZHO A;  2DBY A;  5EE9 A;  1R7S A;  4A9A A;  1TKY A;  1JRP A;  1NEK B;  3NRZ A;  1WGK A;  2BS2 B;  3CIR B;  2MJD A;  1T3Q A;  3AEF B;  3B2G A;  1FFV A;  2WDV B;  4HRS A;  1NYR A;  1TKE A;  3AE8 B;  1SF0 A;  4LTU A;  1JW9 D;  1E10 A;  4ZOH C;  1WRI A;  1QOG A;  1N62 A;  1ZUD 2;  1QLB B;  2G1E A;  1E6E B;  3VRA B;  2HTM E;  4P6V F;  3AEB B;  2L83 A;  3AH7 A;  4WWM A;  5MPO A;  4N58 A;  1FXI A;  3NVW A;  1RFK A;  1FMA D;  3AEA B;  2W54 A;  1PDX A;  3B2F A;  3LB8 C;  3P4P B;  3P1M A;  1V8C A;  2M19 A;  4JWU C;  5AUI A;  3NVY A;  1DGJ A;  3VRB B;  2PVG C;  1FIQ A;  1QOA A;  5EE3 A;  4USA A;  1RWS A;  1JAL A;  1DOI A;  1ROE A;  3AV8 A;  3HUI A;  1XLQ A;  1QF6 A;  3ABV B;  1JQ4 A;  3HRD D;  3CWI A;  1FO4 A;  2WS3 B;  3AN1 A;  4C80 A;  1KFY B;  1WWT A;  1VJK A;  3RPF C;  3P4Q B;  4FXC A;  1L5P A;  4YTN B;  1JWA D;  3L4P A;  3B9J A;  1AYF A;  3PO0 A;  4YTP B;  1J7A A;  3AED B;  2B76 B;  1CZP A;  1E9M A;  2EKI A;  2L52 A;  2LEK A;  2M56 B;  5H92 C;  1NI3 A;  1FXA A;  1E0Z A;  1KF6 B;  1OFF A;  1B9R A;  2WU2 B;  1XLP A;  1NYQ A;  1FM0 D;  1EWY C;  3DWG C;  3FAH A;  2PKO A;  3KWL A;  1A70 A;  2BS4 B;  3NVZ A;  4C7Y A;  4YT0 B;  3VR9 B;  2BT6 A;  1OQQ A;  3FC4 A;  3NVV A;  4N6E B;  5C2T B;  2W55 A;  1FRD A;  1AWD A;  2FBW B;  4WQM A;  3VR8 B;  3WCQ A;  2AX5 A;  1XLN A;  1JRO A; 
#chains in the Genus database with same CATH topology
 4IDI A;  2GBJ A;  2MJE A;  5BMI A;  4MAC A;  4K1R B;  4MGZ E;  2H88 B;  1ZKH A;  4HJK A;  3B08 A;  1L0V B;  1V86 A;  3PRP B;  2ZW0 A;  5DPS A;  2I1K A;  2FCS A;  2HJ8 A;  3AEG B;  1I7H A;  3AUL A;  2I38 A;  3Q8E A;  3PHX B;  4MM3 B;  3SU8 X;  3M63 B;  2IZV B;  2WP9 B;  4WH4 A;  4DXG A;  4HDQ A;  4A3P A;  4YSX B;  5C3J B;  4HRO A;  2MH7 A;  5H8Y E;  1UH6 A;  4DHZ E;  4EOY A;  3WA0 A;  3GE3 C;  5LXH A;  2BBC A;  2D3A A;  3PRE A;  4NPN A;  1WXQ A;  4EFO A;  3L17 A;  3AU4 A;  1YD8 U;  1WJ6 A;  4IOI E;  3R2T A;  4FHJ A;  2UWQ A;  2V0G A;  3BK1 A;  5JXV A;  4ZHO A;  1L2N A;  1P9D U;  1WGK A;  3VH3 B;  2OJR A;  1JW9 D;  1E10 A;  2JXT A;  2LUE A;  4ZOH C;  3MJW A;  5MPO A;  1YN3 A;  3GZN B;  4N58 A;  5DCN A;  5L95 C;  4FAD A;  2GLS A;  1XD3 B;  2HE7 A;  1DGJ A;  3NG0 A;  4USA A;  4KZC A;  1F77 A;  4ARI A;  2BVC A;  2KTR A;  2C9W B;  4JLC A;  3V60 A;  3TBL D;  3PO0 A;  3AED B;  2V4L A;  2AQ3 B;  1E9M A;  3ZO5 B;  3T9L A;  2RR9 A;  3M95 A;  4HXD A;  1TGZ B;  2LWP A;  1L0Y B;  1L4Z B;  1WE7 A;  2DX5 B;  3DVN V;  2BTE A;  1IP9 A;  3RUI B;  1J8C A;  2RD0 A;  2G4D B;  5T8I A;  1NVI D;  1UF0 A;  4I6P A;  1OEY J;  2QC8 A;  2Q5W D;  2K8B A;  1Q1O A;  3AEC B;  4KDI C;  1UWM A;  2G4S A;  2M17 A;  1QOB A;  3UQB A;  4P1C C;  5AUK A;  4AWJ A;  1VCB A;  5EE0 A;  4ZRK A;  3VUW A;  3C19 A;  1Y56 A;  4ZDV A;  4XWW A;  3H6N A;  2K3U A;  1WGY A;  3RUL A;  1UEL A;  1NI2 A;  2GBR A;  3GS2 A;  2V4I B;  3ZIM A;  1ZW7 A;  3AE6 B;  2DNF A;  1PQS A;  4GU2 A;  1WJU A;  1N5X A;  1ZGU B;  2ACZ B;  4US8 A;  3NS8 A;  2OHF A;  2KLG A;  2WXM A;  3VXW A;  3J9C A;  3IFW B;  1BT0 A;  3IVF A;  1TY2 A;  2DYO A;  4O1N A;  1TS4 A;  1I4H A;  1ZUD 2;  3DBL B;  2GRI A;  3VVW B;  1TIF A;  3WAM A;  2L0F A;  1MHX A;  3IG3 A;  1J0G A;  1XQQ A;  2KTR B;  3GE8 C;  1SBB B;  2LXC A;  3AV8 A;  1K50 A;  1UD7 A;  3BIN A;  1L7Y A;  3WAO A;  5IO9 A;  3JW0 X;  4F7Z A;  4BFR A;  4RF1 A;  1R4N I;  2JUO A;  3CST A;  4GGQ A;  1N6Z A;  4RM9 A;  1F2R C;  2B76 B;  1WI0 A;  2M4N A;  1P98 A;  1WXM A;  3EEC A;  3RNE C;  3IAM 1;  2WU2 B;  2YVC A;  2LAS A;  4OZB A;  2EMS A;  1WH3 A;  1GOZ A;  3VR9 B;  4MH0 E;  1OQQ A;  2MBO A;  1KOT A;  2L7R A;  2D07 B;  2KJ6 A;  4M00 A;  4W9F A;  4NZL B;  1GC7 A;  1C77 A;  2AWT A;  1YOV B;  4W9D A;  2N7E A;  1P3Q U;  3SR6 A;  2D3B A;  1T0Q C;  2R61 A;  2QJL A;  2CHW A;  1KRH A;  5JZE B;  4KDL B;  2DYB A;  1OQR A;  3UF8 A;  1Z5S B;  4PT5 A;  1UGJ A;  5HFY A;  4IWQ A;  2NVU I;  2D11 A;  4NY0 A;  1CQV A;  2WXK A;  3VHT C;  3PGE A;  3W1Y A;  1FXT B;  3AE1 B;  1ZP0 B;  3EGR A;  2J0K A;  3LYY A;  4WQO B;  1YMH E;  3QK0 A;  4MEM A;  1IBX A;  2N0S B;  5IAA C;  5J2R A;  4IWP A;  3W2D A;  4RFB A;  1XEE A;  2K8C A;  4GDL A;  3UIN B;  3BZD B;  3R8B A;  2D3G A;  4A55 A;  3DBH B;  4X57 B;  2PEA A;  3ZJV A;  4PS7 A;  2VZK D;  2MW5 A;  1E8X A;  3VUX A;  1C4A A;  2DHZ A;  1WWT A;  4WAF A;  2IO1 B;  3P4Q B;  1I35 A;  2LGY A;  2ONQ A;  3KUD B;  1TBE A;  3DHI C;  3MC9 A;  2ON8 A;  1CZP A;  1WR1 A;  4XDC A;  1PGB A;  1BUI C;  2L3Z A;  2KXJ A;  4GB9 A;  2BT6 A;  5D94 A;  2IO3 B;  4L2Y A;  3KUC B;  3MFG A;  5HKH A;  2UU7 A;  3DQV A;  5GXG B;  3R7Q A;  4LCD E;  1DOX A;  2JPH A;  3EUB 2;  3AE4 B;  1ZDX A;  5C23 A;  1WRD B;  2REX A;  3AEE B;  3U52 E;  2BYT A;  1LM8 B;  3ZNI D;  3BII D;  2K5P A;  1WFY A;  3RNC C;  1YJI A;  2ZVN A;  3PZ7 A;  2IO2 B;  2VH2 A;  2QCZ A;  1YJ1 A;  3RD2 A;  2IND C;  3M3J A;  1IBX B;  4US9 A;  3RZW C;  1T5X D;  1XF5 L;  2KDB A;  1TTN A;  1GAQ B;  4GDL B;  5BO4 B;  5G5H A;  3PHW B;  1RM6 C;  3GZN I;  3U2S C;  4KSL C;  1WX9 A;  1FNV A;  3QCA A;  3T3O A;  3SFE B;  1UBQ A;  2BW2 A;  3OAW A;  1T3Q A;  2JWZ A;  2EEL A;  1TKE A;  1P0R A;  4BAX A;  4GN1 A;  4B0M A;  4LNO A;  2BGF A;  1WIA A;  3AEB B;  3R7R A;  1OTR B;  3AH7 A;  4E3C A;  1FMA D;  4JIO U;  3Q6B A;  2LFI A;  1V8C A;  4CYE A;  4JWU C;  4DQO C;  3NVY A;  4FA6 A;  3V05 A;  2MBH A;  1D6E C;  3AU5 A;  1XLQ A;  1QF6 A;  2ZNV B;  2WYQ A;  4HVB A;  4C80 A;  1BML C;  3X23 A;  4IW0 A;  2BYV E;  3W1S C;  2IO0 B;  1SXT A;  4ICU A;  1SE3 A;  4HCN B;  4KSK C;  2N1V A;  3V62 A;  2MEK A;  3ZLZ A;  3TEW A;  2RDG A;  3DOW A;  1S3S G;  2PMV A;  1I42 A;  1EWY C;  4IM3 A;  4IUM B;  3RZF A;  1E8Y A;  2HTM E;  4HJG E;  3VTU A;  3ECI A;  3TMP B;  3TEY A;  1HTQ A;  2N9E B;  5KHQ A;  4JQW C;  2G3Q B;  4ITK A;  2FE8 A;  5IOI A;  3U7Z A;  1YN4 A;  3UQA A;  3Q3J A;  5IN7 A;  1E8W A;  3MHS D;  1UNS A;  4G11 A;  1AN8 A;  1WYG A;  4KVG B;  2PVO D;  3QA8 A;  3JYU A;  1WM2 A;  2KMC A;  3OWE B;  5J18 A;  2LUM A;  1YQ4 B;  4RGT A;  1GC6 A;  2CJO A;  3DBL I;  4NJ7 A;  3NJT A;  2L1A A;  1ENF A;  3W9C B;  2AQ2 B;  4W9C A;  4AS1 A;  5E6N A;  3H9D A;  3AEF B;  3B2G A;  2UYZ B;  3M62 B;  2CHX A;  1GUA B;  4WIP A;  2GBM A;  1N62 A;  2KQ4 X;  2L83 A;  2AQ1 B;  2PW9 A;  2EKE C;  3Q2A C;  4A20 A;  4WAA A;  3APC A;  1FIQ A;  3Q8F A;  1RWS A;  2FUG 1;  3DPD A;  2RSU A;  4JGH B;  2LHD A;  3B9J A;  4IM0 A;  2JY6 A;  1ET9 A;  2KDM A;  4RGM A;  3IT4 B;  3NY5 A;  1KLG D;  1FXA A;  1C4C A;  2WXG A;  4II3 B;  3VTW A;  4C00 A;  2IBI B;  3KWL A;  1B1Z A;  4LNI A;  4A8X C;  4H2A A;  5E6J A;  4TUU A;  4S17 A;  3QHT A;  3RYT A;  4P1B C;  4WWN A;  2QIE B;  3CSF A;  4HEA 1;  1TS5 A;  4LK0 M;  2L00 B;  2CU3 A;  2QEJ C;  4TQ1 A;  2I1J A;  2J7Q B;  4GSW A;  2K9X A;  1H4R A;  3OJ3 A;  4G0N B;  2Y5P A;  5LNK 1;  1L0X B;  1L6U A;  2KAC A;  1WMH A;  1F52 A;  4RF0 A;  2NS5 A;  3JVZ X;  5DPR A;  2N4F A;  4PS8 A;  3BYY B;  4EZL A;  4DDI D;  2H89 B;  3Q8C A;  1J7B A;  2WXH A;  3DBH I;  3ZW3 A;  4KX6 B;  5AEK B;  1SIJ A;  4IM2 A;  3ZTD A;  2G45 B;  2Y5B B;  3KWV A;  2XBB C;  2WX1 A;  2J52 A;  3V6E B;  1TJE A;  1D5Z C;  3ZDT A;  1EF1 A;  1QKZ A;  4W9H A;  2KFK A;  3PVL A;  2IY1 B;  4L23 A;  3ZJU A;  3BWU D;  1J19 A;  1FFV A;  2JZP A;  4LNK A;  1Q5W B;  2G1E A;  1AAR A;  4NQL B;  1E6E B;  3RT3 B;  2V1Y A;  1RFK A;  3UIO B;  4BKT A;  4M01 A;  1WE6 A;  5AUI A;  3ZNH B;  1E7U A;  2NCN A;  4G3X B;  1I4P A;  2QSD A;  5AZH A;  2V3N A;  2X8X X;  3BYT B;  3I3T B;  1T0S C;  5E6P A;  5D3D A;  2A4Z A;  3N30 A;  1YQB A;  1ISN A;  1VR9 A;  2NMQ A;  4PS3 A;  4YTP B;  2ZNV C;  2AYO B;  2WGS A;  4IC7 B;  5EDS A;  1VD2 A;  2LGI A;  1A70 A;  2PLP A;  1C9F A;  2WHI A;  4R3D A;  4NAW A;  1FRD A;  1TS2 A;  2A5U A;  3BVG A;  1WMH B;  4C56 C;  1UZX B;  2LGX A;  4PK1 A;  1HTO A;  3ZKJ C;  1YX5 B;  2YEP F;  1V1P A;  3ZNG C;  2MBB B;  1ZE3 D;  3AE7 B;  1DOY A;  2KT7 A;  1NEN B;  4NNJ B;  4BOZ B;  3NZS A;  2W3S A;  4XGA B;  1OQY A;  2BS3 B;  1E7P B;  2WU5 B;  4II2 B;  2C60 A;  2Y3A A;  3WIM A;  2IJ0 A;  2TSS A;  2PPH A;  3ML8 A;  5BYS A;  3AE2 B;  2JWU A;  3AE3 B;  1Z2M A;  2KFK B;  4DK5 A;  2KX3 A;  5JHA A;  1CMX B;  3W5U B;  3N1Z C;  4ZYS A;  2DBY A;  3O13 A;  3SEB A;  1Y8R C;  1SE4 A;  4HRS A;  3H7S A;  3KYD D;  4HPL B;  3BVZ A;  1QOG A;  3Q3M C;  1ESF A;  2JU6 X;  2O6V D;  1SIF A;  4TMA B;  4MH8 A;  1M4V A;  3Q14 C;  2KJR A;  2WXQ A;  4BOS C;  4HKQ A;  2PJH A;  2VZK B;  3MC8 A;  3PLU A;  2B3A A;  4XDD A;  3QWZ B;  1YX6 B;  2CU1 A;  2N9L A;  1P7E A;  2KDF B;  1NBF C;  3Q8A A;  4NAW B;  4W9I A;  2AL3 A;  2DAF A;  4KGS A;  1V1P B;  1XLP A;  2HDE A;  2GBK A;  2KFJ A;  5C2T B;  4FLH A;  3GOE A;  4DHJ D;  2PVG C;  1ACC A;  1C76 A;  4YTM B;  2KJH B;  3P4R B;  4LNF A;  3A1Q A;  1K52 A;  2WLB A;  1N60 A;  4W9G A;  1V5T A;  5L83 A;  2D3C A;  4YSY B;  1N63 A;  1L6V A;  1FPY A;  3R66 C;  4HLE A;  2LRW A;  3MC0 B;  1C3T A;  2GI9 A;  2BPS A;  1FRR A;  1XXG A;  1LQB A;  1K51 A;  2WDQ B;  3HHM A;  5E6O A;  3T3N A;  1FCL A;  3NUH B;  2DWQ A;  3W5V B;  2FUH B;  1IUE A;  1LXD A;  1LO5 D;  2YLM A;  2KC1 A;  3VH4 B;  1QOF A;  2R2O A;  4AUQ C;  2NTS A;  4WWO A;  2JZ3 B;  5CTR C;  1UWX A;  1HE8 A;  2V3S A;  1ZDV A;  3PS6 A;  4HCP B;  3ZXR A;  2PE9 A;  4P6V F;  5AZF A;  1LFD A;  2W54 A;  1PDX A;  2M0A A;  2GBN A;  1WF9 A;  3SHQ A;  4WJQ A;  2N9P C;  1QOA A;  5EE3 A;  1JAL A;  1ROE A;  3EFU A;  2BB6 A;  2Z0E B;  1QIL A;  3EHV A;  2KNB A;  2R2Q A;  2DEN B;  2K6Q A;  3BVM A;  2J0M A;  1P1A A;  3N32 A;  3AXC A;  2J4X A;  1WM3 A;  4B6W A;  2INP E;  2ZVO A;  1OFF A;  3A9K A;  4OZA A;  2W9N A;  3NVZ A;  2BYF A;  3A1Q B;  2KOX A;  3ZVV A;  4B95 A;  1IGD A;  2FBW B;  3RNA C;  3AB5 A;  3UIP B;  2M1M A;  2W3R A;  1VRA B;  3Q3F A;  3PLV A;  2KDI A;  4B0E A;  3NZU A;  3AMZ A;  2V9H A;  3SDL C;  4K3C A;  1I4X A;  2MHJ A;  1JWB D;  1G6J A;  3DHG C;  1KLU D;  2LJ5 A;  5HI1 A;  5LLI A;  2OOB B;  4OVV A;  1E5W A;  4FJZ A;  2MX2 A;  3X0W A;  1R4M B;  4RCO A;  3QC8 B;  1VLB A;  4DWF A;  2KVZ A;  1WJN A;  1CJE A;  1OGW A;  3PZ8 A;  1HZ5 A;  4GIV A;  4N59 A;  1ZOY B;  4FJV B;  4MGY E;  2NR2 A;  4A9A A;  1NEK B;  2WXO A;  2BKR B;  3K9O B;  1NYR A;  1WX8 A;  2KAN A;  4LTU A;  2O2V A;  4KIK A;  4ZRJ A;  2LI5 A;  1FXI A;  3NVW A;  3ZRF A;  1A5R A;  2IPK D;  1XT9 B;  3V3X A;  1HA5 A;  1K8R B;  5KHO A;  1HXY D;  2J53 A;  5IKC M;  1S1Q B;  3KQ4 A;  3I63 C;  1K53 A;  2KTF A;  2D10 A;  4BKG A;  3A9K B;  2N9K A;  4CQN A;  3TEX A;  4FBJ B;  3Q3N C;  4DHZ B;  1KH0 A;  2C7H A;  4HK2 A;  1YIW A;  2KWC A;  1HQR D;  2DZI A;  3P2B A;  2IGH A;  3SD5 A;  1M94 A;  3FC4 A;  1YN5 A;  3PRZ A;  4AOF A;  2BB5 A;  1U4A A;  3EC8 A;  5BYQ A;  2Z59 B;  1VZ7 A;  1TT5 B;  4K7U A;  4NQK E;  1TKG A;  1SB3 C;  2INN E;  2L8J A;  5FK9 C;  1EUV B;  2JRI B;  1MFW A;  1PYW D;  1SGH A;  2KC2 A;  2VRR B;  1FD6 A;  5LXI B;  2C5L C;  4TSS A;  2DZJ A;  2DZK A;  3QAR A;  1AW7 A;  4FN2 A;  4EZK A;  5GMV A;  3PV1 A;  1RYJ A;  1E7V A;  1XO3 A;  1EU3 A;  2BQQ A;  4OHJ A;  5G5G A;  2O2V B;  4KIK B;  2K22 A;  4MGI E;  1GNU A;  2LVQ A;  3PSE B;  5DPW A;  2W82 A;  2PTL A;  2FID A;  1V5O A;  3AE8 B;  4ARC A;  4A3O A;  4ANX A;  2MBE A;  4W9K A;  4AJW A;  5G55 A;  4MJS A;  1JWM D;  4QAY A;  1VZ8 A;  3B2F A;  3DVN U;  3VRB B;  1FCC C;  2XNA C;  3FKY A;  2GOW A;  4EE2 A;  1FO4 A;  3AN1 A;  3L10 B;  4M8N A;  2DYM A;  4WUR A;  1GG3 A;  1VJK A;  3ML9 A;  2MA9 B;  1JWA D;  1ZPS A;  4HPP A;  1T0Y A;  2Z8L A;  4PYU A;  2BKF A;  4S0R A;  3VUY A;  4J3O D;  1KF6 B;  1WGR A;  3DHH C;  2IGD A;  2PKO A;  4TKN A;  2O6V A;  1QQR A;  4WJO A;  3OLM D;  1KLV A;  3VR8 B;  1FEH A;  1XLN A;  4NAM A;  1JRO A;  3DVG X;  3TEZ A;  1T6B X;  1PFD A;  2WXN A;  4K7W A;  3Q3O C;  1WXV A;  3BY4 B;  1TYG B;  2JRH A;  1OEY A;  3R3M A;  3DVG Y;  2RGF A;  1Q0W B;  2KYW A;  1JML A;  4EEW A;  3DDC B;  4MGK E;  3VTV A;  1V49 A;  2GMI C;  3I9V 1;  1RAX A;  1LGR A;  3EA6 A;  2BYE A;  3QX1 A;  2CR5 A;  4YXD B;  3ZXV A;  4C7Z A;  3A4S C;  2KQ7 A;  1E90 A;  1QT9 A;  3BK2 A;  1WJ4 A;  4FJY A;  4MT5 A;  4MJS B;  1WR6 E;  2N1W A;  2LRU A;  3DBR B;  5HHD G;  3CIR B;  2MJD A;  2NPT A;  1V1O A;  2WDV B;  1EWC A;  4I6L B;  5G2N A;  2MLB A;  4M02 A;  1WYW B;  4WWM A;  4BKS A;  1Q10 A;  4W9E A;  1T0R C;  1WGD A;  3WAN A;  5I4D A;  2QDF A;  3VFK A;  2LVP A;  2DLB A;  1C79 A;  2V3P A;  4ANV A;  3ABV B;  1JQ4 A;  3HK0 A;  3NZ3 A;  2KZR A;  3KVF B;  4N9F 4;  2WXP A;  2O6V B;  4CHK A;  2JVC A;  4LJO B;  1J7A A;  2WXL A;  3L16 A;  3Q69 A;  5CHV C;  2LEK A;  3R2I A;  5H92 C;  1E0Z A;  4HDO A;  5BYR A;  1PGX A;  1NYQ A;  2KKC A;  1FM0 D;  1V2Y A;  4RGO S;  2BS4 B;  1V6E A;  4YT0 B;  3H1U A;  3A9J A;  3LDZ E;  4N6E B;  3TSS A;  3RFZ B;  2MCN B;  1SSN A;  3KLS X;  4IWO A;  1MVK A;  3ZJT A;  3VAW A;  2DAJ A;  4P7I A;  5CHW A;  4E74 A;  1TY0 A;  4CO7 A;  2ICI A;  4ZRP A;  2XN9 C;  1F9J A;  1YJJ A;  4LDT B;  2OJW A;  3ZNZ B;  1R4M I;  4DHJ B;  4UDU C;  4KKJ A;  3L54 A;  1MG4 A;  1IPG A;  4P16 A;  1TZ1 A;  2WXR A;  4GOC A;  1L4D B;  2HD5 B;  1YQ3 B;  1KM7 A;  1NDD A;  2FCQ A;  2JZZ A;  2FCM A;  2KN5 A;  2DZM A;  3APD A;  3S2A A;  2KAJ A;  4XC2 A;  2LVO A;  3IAS 1;  1X1M A;  2NPT B;  2NBW B;  2JQR B;  2MJ3 A;  2KO3 A;  4EUT A;  2JX5 A;  1C78 A;  2KWV B;  3HVZ A;  1VDV A;  2WXF A;  3NOB A;  1V80 A;  3URY A;  4ASW C;  5FR3 A;  3KH0 A;  3VQI A;  4L1B A;  1R7S A;  1STE A;  3ZTC A;  5AZG A;  2LD9 A;  4GDK A;  2LJI A;  2KDE B;  3Q8B A;  3UI3 A;  3W1S A;  1QZE A;  4RGN A;  3P4P B;  3TJP A;  5IA7 A;  3UGB B;  4K7S A;  2PE6 B;  3DCG A;  4ANU A;  2KWD A;  3L0W B;  4OVU A;  4WJP A;  4ZRI A;  2AEH A;  4XYC A;  4C4V A;  3DBS A;  4A6Q A;  2KWU B;  3A9J B;  3TCA A;  2INC C;  2L76 A;  5TR5 A;  3N3K B;  2KHW B;  2MRP A;  1PGA A;  3I57 A;  4E71 A;  4M0W A;  3P42 A;  4TQ0 A;  1XCT L;  2ZCC A;  2AX5 A;  2MWS B;  3IBE A;  3N9Y C;  2BWF A;  5EE1 A;  3QQ8 B;  4K3B A;  4ICV A;  4ZHP A;  3T8M A;  3CF6 E;  4JPS A;  1GB1 A;  3PPA A;  4OW0 A;  2KK8 A;  5CHF A;  1F0Z A;  3IT6 B;  2WX0 A;  4LDT D;  3RNB C;  3V61 A;  2CJN A;  2HJ1 A;  1E8Z A;  1FNU A;  1V9J A;  2CS4 A;  4AQ7 A;  4G50 A;  2L32 A;  2PIA A;  1J7C A;  2ZEQ A;  3APF A;  2D2Q A;  2G9H D;  1XCQ L;  1ZXI A;  4GDK B;  4KKI A;  2LXA A;  4ZYN A;  1D5X C;  1VZ6 A;  3D32 A;  4TV3 A;  3MJ5 A;  2IDY A;  5D6J B;  4F1S A;  2BWE S;  2FIF A;  3MHZ A;  3L13 A;  1UBI A;  3MP9 A;  3N1Y C;  4FUL A;  4IG7 B;  1SF0 A;  4LNN A;  3I5J C;  2IY0 B;  3HVD A;  1WRI A;  4BKS D;  2ZPN A;  4LJP B;  4MSQ B;  4C4V B;  2I2Y A;  3E56 A;  2E6X A;  2KMA A;  1EM7 A;  2M19 A;  3L08 A;  1BXT A;  2CKH B;  3U30 A;  1HZ6 A;  3GP7 A;  3HRD D;  2MQJ A;  4RNA A;  2QHO A;  3ZDM C;  4M0W B;  3RMK C;  1H8C A;  4BBN F;  2XK5 A;  2RDB C;  2C7N B;  3QIJ A;  1TZO A;  4W9L A;  2EKI A;  2M56 B;  2FCN A;  1RFA A;  3U8Z A;  3U4E G;  4RH6 A;  1C4P A;  4ACF A;  3GB1 A;  2JSV X;  4JE3 B;  4WQM A;  3LJ3 A;  3RCZ A;  3PTF C;  2KMM A;  2RPQ A;  2CHZ A;  1WZ0 A;  2N7J A;  1V81 A;  2FAZ A;  3RN9 C;  3PRM B;  1GPX A;  4W9J A;  1JWU D;  3FIL A;  1MHH E;  1GB4 A;  4XZ4 A;  2BF8 B;  3JSV A;  3NHE B;  4B9K A;  1F2R I;  3DBR I;  1UGM A;  5JHB A;  5IP4 D;  2KQS A;  1WSP A;  2JT4 B;  2C7M B;  2NTT A;  4JX1 C;  3SFD B;  2MP2 A;  1WZ3 A;  1DYQ A;  4YSZ B;  2Y5C A;  1I4G A;  3QAQ A;  1TKY A;  1JRP A;  2K1F A;  4ZRQ A;  1KTK A;  1MG8 A;  2ZJD A;  2K0P A;  4OZC A;  5BMG A;  3VRA B;  3ONS A;  3AEA B;  2XK5 B;  4BBN C;  4GXB A;  1DOI A;  3HUI A;  1TS3 A;  3CWI A;  2WS3 B;  1RLF A;  4GMV A;  3RNG C;  2LGD A;  3MTN B;  4DDG D;  4EKU A;  1SE2 A;  3H7P A;  2L52 A;  1D3Z A;  4KV2 A;  2ZZP B;  2D5G A;  3AI5 A;  1HEZ E;  3DWG C;  2EMT A;  4GLS C;  2QMT A;  3TIX A;  4WJN A;  2W55 A;  4HKZ E;  3WCQ A;  3FIL B;  3JSV B;  2LGS A;  5J17 A;  3WAP A;  3N20 C;  1ZXH A;  1SE9 A;  4JWS C;  2IGG A;  4RMA A;  3V6C B;  1N61 A;  2M8S A;  3NS1 A;  3TUO A;  3OG5 A;  3ZUN A;  2KVR A;  5TSS A;  2RDH A;  2MP2 B;  3EFC A;  2WNM A;  3AE9 B;  3H8H A;  2K25 A;  4WWP A;  3ZYY X;  2WWZ A;  4DXA B;  3DWM A;  3ETR A;  3AM9 A;  2RPV A;  3LXF A;  2MBQ A;  1EO6 A;  2WDR B;  1V97 A;  1XLO A;  2XEW A;  2KD0 A;  4J6I A;  5FKA C;  1JRU A;  1FNW A;  5EE9 A;  1F1H A;  4BVU C;  4DBG A;  3VDZ A;  2N9X A;  2ZCB A;  4NJC A;  3PZD A;  3ZQ4 A;  3C0R B;  2L0T A;  1WX7 A;  1ET6 A;  1QLB B;  3TL5 A;  1MPE A;  2J0J A;  1D4B A;  3CMM B;  2JYT A;  2JF5 A;  4HPM B;  3P1M A;  1WXA A;  5D2M B;  2WDT B;  4D2K A;  3H7P B;  5D7G A;  4F8C B;  3RNF C;  2JXX A;  2MSE D;  2QIL A;  3E9S A;  2NBV B;  4KGR A;  4FXC A;  1L5P A;  4YTN B;  1GJZ A;  3ALB A;  4XWT A;  1I4R A;  1JCK B;  3IXS A;  1WY8 A;  2AL6 A;  1SJH D;  1NI3 A;  1B9R A;  5BMH A;  3FAH A;  4MSM B;  1C1Y B;  3ZGZ A;  5D3I B;  1AWD A;  1R4N B;  2K6D B;  3HM6 X;  1UUP A;  4EZJ A;  1KJT A;  2K8H A;  2M0X A;  2VH1 A;  4BZA A;  2K39 A;  4XX5 A;  2L05 A;  4URK A;  4LLG M;  3PT2 B;  2RMM A;  5JH5 C;  3P4S B;  2N7D A;  4I6N B;  1PUT A;  4YWG G;  4JL9 A;  2WQY B;  4MDK E;  4KGT A;  4KZ0 A;  5HG2 A;  2SEB D;  1CK1 A;  2GB1 A;  3A4R A;  3AE5 B;  2LHE A;  4PYZ A;  3WAL A;  1MI0 A;  4Q2J A;  5FR6 A;  1N5W A;  2FNJ B;  2ZW1 A;  4OVZ A;  3HM3 A;  3KW5 B;  1RRB A;  3P63 A;  2NBU A;  4YL8 A;  1JWS D;  2E3T A;  2WXI A;  2KLC A;  1FFU A;  3U7D A;  3KYC D;  4MM3 A;  3K9P B;  2LZ6 A;  3KUZ A;  4REZ A;  2OED A;  5CX3 A;  4M8M A;  5C1Z A;  2JYE A;  3B0A A;  3A33 B;  1D5M C;  3B1L X;  3NRZ A;  2BS2 B;  4ANW A;  1YNT E;  3HIZ A;  2IYD B;  4XE0 A;  2X38 A;  2YEP B;  5DPT A;  3N1X C;  3RI7 C;  2SAK A;  1EU4 A;  3OJ4 B;  4HWI B;  4AP4 C;  1SJE D;  3IHP C;  1WGH A;  2WXJ A;  1IGC A;  2Z0D B;  2ZPY A;  3LB8 C;  3ZRC A;  2KX0 A;  2KN4 A;  4AJY B;  4IKG A;  1IYF A;  1WGG A;  4DXF A;  4RM8 A;  1KFY B;  2ASQ A;  3RPF C;  3ENE A;  1EF5 A;  4A90 A;  3L4P A;  2LMC A;  1AYF A;  1SEB D;  4FHK A;  4NJ6 A;  1P7F A;  2HTH A;  4K81 A;  1WXS A;  3C8Y A;  1I4Q A;  4C7Y A;  3O65 B;  3QJZ A;  3NVV A;  2J42 A;  4MEL A;  1MJD A; 
#chains in the Genus database with same CATH homology
 4HJG E;  4IDI A;  3AB5 A;  3N9Y C;  2MJE A;  5EE1 A;  5BMI A;  4MAC A;  2W3R A;  3TEY A;  1VRA B;  2H88 B;  4ITK A;  4ZHP A;  1L0V B;  2FE8 A;  4B0E A;  2ZW0 A;  3U7Z A;  3AMZ A;  4JPS A;  1YN4 A;  1GB1 A;  4OW0 A;  3AEG B;  1I4X A;  1F0Z A;  3IT6 B;  1I7H A;  1JWB D;  2I38 A;  1UNS A;  3Q8E A;  1KLU D;  5HI1 A;  4MM3 B;  2CJN A;  1AN8 A;  4WH4 A;  2WP9 B;  4DXG A;  1WYG A;  2PVO D;  1FNU A;  4YSX B;  5C3J B;  4HRO A;  2MH7 A;  5H8Y E;  4AQ7 A;  3OWE B;  2LUM A;  1YQ4 B;  4RGT A;  2L32 A;  2CJO A;  2PIA A;  1J7C A;  2BBC A;  4RCO A;  1VLB A;  2L1A A;  2G9H D;  1WXQ A;  1ENF A;  1XCQ L;  1ZXI A;  3W9C B;  1CJE A;  4GDK B;  4KKI A;  4IOI E;  3PZ8 A;  1HZ5 A;  3R2T A;  4N59 A;  1ZOY B;  1D5X C;  1VZ6 A;  2V0G A;  3MJ5 A;  3BK1 A;  2IDY A;  5JXV A;  4ZHO A;  2AQ2 B;  4AS1 A;  4A9A A;  1NEK B;  1WGK A;  3MHZ A;  2WXO A;  3AEF B;  3B2G A;  3MP9 A;  1NYR A;  1SF0 A;  4LTU A;  1JW9 D;  3HVD A;  1E10 A;  2JXT A;  4WIP A;  4ZOH C;  1WRI A;  1N62 A;  2KQ4 X;  2L83 A;  5MPO A;  1YN3 A;  4N58 A;  2AQ1 B;  1FXI A;  3NVW A;  2I2Y A;  2PW9 A;  3E56 A;  2E6X A;  2IPK D;  1EM7 A;  3V3X A;  1HA5 A;  2M19 A;  1DGJ A;  1FIQ A;  2J53 A;  1HXY D;  3Q8F A;  4USA A;  1RWS A;  1BXT A;  3KQ4 A;  1HZ6 A;  1K53 A;  3GP7 A;  2FUG 1;  3HRD D;  4RNA A;  1F77 A;  2LHD A;  4ARI A;  2N9K A;  4CQN A;  3TEX A;  3B9J A;  1ET9 A;  3PO0 A;  3AED B;  2KDM A;  4RGM A;  1TZO A;  2AQ3 B;  3IT4 B;  1E9M A;  2EKI A;  2M56 B;  1KH0 A;  1KLG D;  1FXA A;  1C4C A;  2WXG A;  3KWL A;  1B1Z A;  1HQR D;  3U4E G;  4RH6 A;  4A8X C;  4H2A A;  1C4P A;  5E6J A;  3GB1 A;  1L0Y B;  1L4Z B;  2IGH A;  2JSV X;  1YN5 A;  3FC4 A;  2BTE A;  2BB5 A;  4JE3 B;  4WQM A;  5BYQ A;  2QIE B;  1VZ7 A;  5T8I A;  4HEA 1;  1TS5 A;  2KMM A;  1NVI D;  4LK0 M;  1TKG A;  2CU3 A;  2QEJ C;  4TQ1 A;  2N7J A;  2Q5W D;  1SB3 C;  3AEC B;  2INN E;  2K9X A;  5FK9 C;  1UWM A;  1GPX A;  1QOB A;  2Y5P A;  5LNK 1;  5AUK A;  1L0X B;  1JWU D;  1L6U A;  1MHH E;  1PYW D;  2KAC A;  3FIL A;  1GB4 A;  4RF0 A;  5EE0 A;  1FD6 A;  1Y56 A;  4XWW A;  4TSS A;  2K3U A;  3BYY B;  1F2R I;  2H89 B;  1AW7 A;  3GS2 A;  3Q8C A;  2V4I B;  1J7B A;  1WSP A;  2WXH A;  3AE6 B;  4KX6 B;  1SIJ A;  1RYJ A;  1N5X A;  1XO3 A;  2NTT A;  1EU3 A;  2ACZ B;  4OHJ A;  5G5G A;  4JX1 C;  3KWV A;  3SFD B;  4US8 A;  2K22 A;  2J52 A;  2OHF A;  1DYQ A;  1TJE A;  4YSZ B;  2Y5C A;  2WXM A;  1D5Z C;  3J9C A;  1I4G A;  1QKZ A;  1TKY A;  1JRP A;  2W82 A;  4L23 A;  3ZJU A;  4ZRQ A;  3BWU D;  2PTL A;  1TY2 A;  1FFV A;  3AE8 B;  2JZP A;  4ARC A;  2DYO A;  4O1N A;  1TS4 A;  1I4H A;  1ZUD 2;  1KTK A;  2GRI A;  2G1E A;  2K0P A;  1E6E B;  4OZC A;  5BMG A;  3VRA B;  1JWM D;  1RFK A;  1MHX A;  3AEA B;  1VZ8 A;  3B2F A;  5AUI A;  3VRB B;  1FCC C;  2XNA C;  1I4P A;  1SBB B;  2QSD A;  2V3N A;  1DOI A;  3AV8 A;  3HUI A;  1K50 A;  3BYT B;  1TS3 A;  4EE2 A;  3CWI A;  1FO4 A;  2WS3 B;  3AN1 A;  2DYM A;  5D3D A;  4WUR A;  1VJK A;  4RF1 A;  1JWA D;  1VR9 A;  1ZPS A;  2NMQ A;  1SE2 A;  2Z8L A;  1F2R C;  4YTP B;  2B76 B;  2L52 A;  4J3O D;  1KF6 B;  3IAM 1;  2D5G A;  2WU2 B;  4OZB A;  1HEZ E;  2IGD A;  3DWG C;  2PKO A;  2LGI A;  1A70 A;  4GLS C;  2PLP A;  1QQR A;  1GOZ A;  2QMT A;  3VR9 B;  1OQQ A;  1C9F A;  2W55 A;  4HKZ E;  4R3D A;  1FRD A;  1TS2 A;  3BVG A;  3VR8 B;  3FIL B;  1FEH A;  3WCQ A;  4C56 C;  1XLN A;  4NAM A;  1JRO A;  2YEP F;  3TEZ A;  1T6B X;  1V1P A;  4NZL B;  1C77 A;  1PFD A;  1ZE3 D;  2WXN A;  3AE7 B;  1DOY A;  3SR6 A;  1ZXH A;  1NEN B;  1TYG B;  2R61 A;  2QJL A;  4JWS C;  2IGG A;  2W3S A;  1KRH A;  1N61 A;  1JML A;  2BS3 B;  3NS1 A;  1E7P B;  1OQR A;  2WU5 B;  4PT5 A;  3TUO A;  1UGJ A;  2Y3A A;  5HFY A;  2IJ0 A;  5TSS A;  2RDH A;  2TSS A;  2WNM A;  1CQV A;  2WXK A;  5BYS A;  3AE9 B;  3H8H A;  3I9V 1;  3AE2 B;  3ZYY X;  3EA6 A;  2JWU A;  3AE3 B;  4YXD B;  3AE1 B;  1ZP0 B;  3DWM A;  3EGR A;  3ETR A;  4C7Z A;  3AM9 A;  3LYY A;  2RPV A;  3LXF A;  1YMH E;  1QT9 A;  2WDR B;  3BK2 A;  3W5U B;  1IBX A;  2N0S B;  4MT5 A;  1V97 A;  1XLO A;  3W2D A;  5FKA C;  4ZYS A;  1FNW A;  2DBY A;  4RFB A;  5EE9 A;  1XEE A;  3O13 A;  5HHD G;  3SEB A;  3CIR B;  2MJD A;  3BZD B;  3R8B A;  1V1O A;  1SE4 A;  4NJC A;  4HRS A;  2WDV B;  3ZQ4 A;  4A55 A;  1EWC A;  3BVZ A;  1QOG A;  1ET6 A;  1QLB B;  1MPE A;  3ZJV A;  1D4B A;  1ESF A;  4WWM A;  2VZK D;  2JYT A;  2JU6 X;  1Q10 A;  3P1M A;  5I4D A;  4TMA B;  4MH8 A;  4D2K A;  1M4V A;  5D7G A;  2V3P A;  2DLB A;  1C79 A;  1C4A A;  3ABV B;  1JQ4 A;  2WXQ A;  3NZ3 A;  4HKQ A;  2QIL A;  2VZK B;  1WWT A;  4WAF A;  3E9S A;  3P4Q B;  2WXP A;  4KGR A;  4XDD A;  4FXC A;  1L5P A;  2ONQ A;  4YTN B;  4XWT A;  1I4R A;  1JCK B;  3IXS A;  2N9L A;  1P7E A;  3Q8A A;  4NAW B;  2ON8 A;  1J7A A;  2WXL A;  1CZP A;  3Q69 A;  4XDC A;  1PGB A;  2LEK A;  1SJH D;  3R2I A;  5H92 C;  1BUI C;  1NI3 A;  1E0Z A;  1B9R A;  4KGS A;  5BYR A;  1V1P B;  1PGX A;  1NYQ A;  1XLP A;  5BMH A;  1FM0 D;  3FAH A;  2HDE A;  4RGO S;  2BS4 B;  4YT0 B;  2BT6 A;  5C2T B;  4N6E B;  3TSS A;  3RFZ B;  1SSN A;  3ZGZ A;  5D3I B;  3KLS X;  1AWD A;  1MVK A;  4L2Y A;  2PVG C;  1ACC A;  3MFG A;  1C76 A;  3ZJT A;  1UUP A;  1TY0 A;  4YTM B;  5GXG B;  1DOX A;  3EUB 2;  3AE4 B;  3P4R B;  2ICI A;  1K52 A;  1ZDX A;  2WLB A;  3AEE B;  2XN9 C;  4LLG M;  1N60 A;  2RMM A;  1YJJ A;  4ZRP A;  3U52 E;  3P4S B;  2BYT A;  3BII D;  4YSY B;  1PUT A;  4YWG G;  1N63 A;  4UDU C;  1L6V A;  4KKJ A;  2WQY B;  2K5P A;  4KGT A;  4P16 A;  2WXR A;  3MC0 B;  1YJI A;  3PZ7 A;  2GI9 A;  1L4D B;  5HG2 A;  2SEB D;  1CK1 A;  2GB1 A;  1YQ3 B;  3AE5 B;  2LHE A;  1MI0 A;  4Q2J A;  1IBX B;  4US9 A;  1FRR A;  1N5W A;  2ZW1 A;  1T5X D;  4OVZ A;  1XXG A;  1XF5 L;  2KAJ A;  1K51 A;  3P63 A;  2WDQ B;  1FCL A;  1GAQ B;  3T3N A;  3NUH B;  4GDL B;  2DWQ A;  3IAS 1;  3W5V B;  1JWS D;  2E3T A;  2WXI A;  1FFU A;  5G5H A;  2JQR B;  1RM6 C;  3U2S C;  1IUE A;  2MJ3 A;  2JX5 A;  1C78 A;  1LO5 D;  3HVZ A;  1VDV A;  1QOF A;  4REZ A;  1FNV A;  2OED A;  2WXF A;  2NTS A;  3SFE B;  3T3O A;  3URY A;  5FR3 A;  2JYE A;  3VQI A;  4L1B A;  1R7S A;  1D5M C;  1STE A;  3NRZ A;  2BS2 B;  2BW2 A;  1YNT E;  1T3Q A;  4XE0 A;  1UWX A;  2EEL A;  2X38 A;  2YEP B;  1TKE A;  1ZDV A;  4B0M A;  2SAK A;  2LJI A;  3Q8B A;  3UI3 A;  1EU4 A;  3W1S A;  4P6V F;  3AEB B;  1SJE D;  3AH7 A;  1FMA D;  2WXJ A;  1IGC A;  1PDX A;  2W54 A;  3LB8 C;  3P4P B;  2M0A A;  4RGN A;  2LFI A;  1V8C A;  2KN4 A;  4JWU C;  4DQO C;  3NVY A;  4IKG A;  3V05 A;  1QOA A;  1D6E C;  5EE3 A;  4DXF A;  1JAL A;  2KWD A;  1ROE A;  1XLQ A;  1QF6 A;  2BB6 A;  4C80 A;  1BML C;  1KFY B;  1QIL A;  3RPF C;  4A6Q A;  4A90 A;  3BVM A;  3L4P A;  2LMC A;  1AYF A;  1SEB D;  1SXT A;  1SE3 A;  2J4X A;  2INP E;  1P7F A;  2MEK A;  3TEW A;  2RDG A;  1OFF A;  2PMV A;  3C8Y A;  1EWY C;  4OZA A;  1I4Q A;  1PGA A;  3I57 A;  3NVZ A;  4C7Y A;  4M0W A;  3P42 A;  3NVV A;  4TQ0 A;  1XCT L;  1IGD A;  2FBW B;  2J42 A;  2AX5 A;  2HTM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...