4ZHOA

The crystal structure of arabidopsis ferredoxin 2 with 2fe-2s cluster
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
97
structure length
97
Chain Sequence
ATYKVKFITPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEAIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-2, chloroplastic
publication title Structure of the bacterial plant-ferredoxin receptor FusA.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Electron transport
total genus 24
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zhoA00
2CJOA 3B2FA 3EUB2 3CIRB 3P1MA 1FFUA 1E10A 2PIAA 1WRIA 4YSYB 3VRAB 1FRRA 1NYRA 1FFVA 3L4PA 1SF0A 2Q5WD 1VDVA 5C2TB 3NVYA 5H92C 1FM0D 3AEEB 3FC4A 5AUIA 1TJEA 3DWGC 3AE1B 3AE8B 1YQ3B 4IDIA 1OQRA 1XO3A 1I7HA 1GPXA 2JX5A 3SR6A 4YTNB 2OHFA 3AE6B 3AE3B 2WLBA 1DOXA 1OFFA 3NVWA 1E7PB 1A70A 4C7ZA 1TKGA 2CU3A 1DOIA 5MPOA 4ZHPA 2QJLA 3AEGB 1EWYC 2PVOD 2H89B 3B2GA 5AUKA 2E3TA 1JW9D 4YT0B 3AN1A 2M19A 1ZOYB 2WU2B 1JROA 1KRHA 2PKOA 1N61A 3AMZA 4FXCA 2WDRB 1L6VA 4ZOHC 1J7BA 4YTPB 3P63A 1R7SA 3SFDB 4HRSA 4US8A 2L52A 1L5PA 1JALA 2W55A 1UWMA 1VLBA 3ETRA 2CJNA 5H8YE 3SFEB 2WS3B 1AYFA 1L0VB 3AE4B 3P4PB 4N6EB 3VR8B 2WP9B 3W9CB 5C3JB 1VJKA 2HTME 3AEBB 2M56B 1NI3A 1E6EB 1TYGB 2K5PA 2MH7A 1WXQA 3ZYYX 3AEFB 3B9JA 3NRZA 4USAA 2QIEB 1CJEA 4YSXB 3CWIA 4ZHOA 1N5WA 1ZP0B 3ABVB 3AECB 1SB3C 2MJEA 4N59A 1YJJA 2B76B 3FAHA 1DGJA 5G5GA 3AV8A 2FBWB 1TKYA 1V97A 1OQQA 2N0SB 2BS4B 2K9XA 1RWSA 3VRBB 3VR9B 2H88B 1FMAD 2BT6A 4C7YA 1B9RA 2WQYB 1F0ZA 1JWBD 1QF6A 1XLPA 2MJ3A 1E9MA 3AE5B 4JX1C 3P4QB 3AE2B 1E0ZA 1NVID 2JQRB 1JQ4A 1L6UA 2Y5CA 1FXIA 1PUTA 3P4SB 1QOGA 3W5VB 4KX6B 1RFKA 1ZXIA 2DWQA 2G1EA 3KWLA 4YSZB 1CZPA 4ITKA 1J7CA 1FO4A 1N63A 1QOBA 1IUEA 1QLBB 2BS3B 2MJDA 3BIID 1RYJA 1WGKA 3LB8C 5EE3A 5EE0A 4C80A 4YTMB 1T3QA 2BS2B 1GAQB 1ZUD2 2K22A 2L83A 2LEKA 2WDVB 4HROA 1DOYA 1NYQA 1FRDA 4US9A 2PVGC 4JWSC 3AE9B 3HUIA 1N5XA 1QT9A 2W3RA 1KF6B 1NENB 1PFDA 5G5HA 3NVVA 3DWMA 2DBYA 1XLOA 1JWAD 2WDQB 4JWUC 3NS1A 4LTUA 3W5UB 1QOFA 3AH7A 1ROEA 2AX5A 5EE9A 2WU5B 3HVZA 4YXDB 5EE1A 1J7AA 1WWTA 1SIJA 1YQ4B 4WWMA 4A9AA 1TKEA 1N60A 1XLNA 3AEDB 2W54A 1AWDA 1FXAA 1KFYB 1RM6C 3AEAB 1YJIA 3AM9A 3AE7B 3P4RB 1XLQA 3AB5A 2ACZB 1WYGA 3HRDD 5GXGB 1FIQA 2KMMA 1QOAA 2W3SA 3NVZA 3RPFC 4WQMA 2EKIA 3WCQA 1PDXA 1V8CA 3PO0A 4P6VF 1NEKB 4N58A 1JRPA 1N62A 2KAJA 3LXFA
chains in the Genus database with same CATH superfamily
3TEWA 2L7RA 1V2YA 4A90A 4JQWC 3A9KA 2N9LA 4J6IA 2FIFA 4C4VB 2Z0DB 1FFVA 3L4PA 1NDDA 1ZKHA 5LXHA 1D5ZC 1R4MB 4MEMA 3AE6B 3JYUA 2WLBA 4M02A 3DPDA 1WH3A 2IDYA 2CU3A 2BKRB 5MPOA 2JU6X 1LM8B 4JLCA 1R7SA 1GC7A 4KIKA 1VLBA 2IZVB 4NAWA 4GSWA 1WGDA 5C3JB 2BB5A 2KDBA 2IBIB 3ZXVA 1WXQA 3UQBA 4USAA 2O6VD 2V3NA 2GBMA 2KHWB 1SB3C 5GMVA 2C7MB 4OHJA 1DYQA 2NBWB 3A9JB 2M4NA 3WAPA 4EE2A 2WGSA 3AE5B 3QWZB 1UELA 1D3ZA 3DHHC 3P4SB 1QILA 3KWLA 4YSZB 1C77A 1FO4A 2DZMA 2CHWA 1RYJA 4YTMB 3UIPB 2ZPNA 2Y5PA 3GZNB 1FRDA 3FILB 4UDUC 1NENB 3KH0A 3NS1A 2RR9A 3WAOA 4TQ1A 2RMMA 2BYFA 3I9V1 1Q0WB 1I42A 3P4RB 2V3SA 3BVMA 4ZRPA 2WXHA 2BWFA 4MGYE 4KVGB 3RPFC 1FCLA 1H8CA 1MPEA 4ZRIA 4KGSA 3PGEA 4PT5A 2L1AA 2QEJC 1WZ3A 2KDMA 2A4ZA 3C8YA 1JRUA 1WXMA 2MW5A 2JXXA 4FN2A 1VDVA 1VRAB 2NCNA 2DAFA 4DK5A 5AUIA 3ZJUA 4IDIA 4MSMB 1XO3A 1YOVB 4B0EA 1TS5A 1YQBA 4JE3B 2V1YA 3DQVA 4NPNA 3B2GA 2AEHA 3Q3OC 1P3QU 2PKOA 3KLSX 4ZYNA 2FAZA 2WP9B 4KGTA 1BT0A 5BMGA 1SJHD 2KLCA 1CMXB 1HE8A 3BVGA 2M8SA 1SE4A 3HM3A 1Q1OA 3IHPC 4FJZA 3VTVA 3EECA 4WQOB 2NBVB 3MTNB 2EELA 3AE2B 1Y56A 4URKA 5C1ZA 2C60A 5BYRA 3NUHB 3W2DA 1ZXIA 3Q69A 2NR2A 1T5XD 5D3IB 3VXWA 2WXMA 1GAQB 1WYWB 5AEKB 1JMLA 1DOYA 2PVGC 1KF6B 4RH6A 4YWGG 2KWUB 2KVRA 2NBUA 3AXCA 4OW0A 1Z5SB 3HVZA 1ACCA 1SE3A 2GB1A 4HJKA 4WWMA 1OTRB 1WXAA 2GBJA 2D10A 4IKGA 1XEEA 4C00A 1FNWA 3BY4B 1FIQA 1ESFA 1P7EA 2FIDA 2KZRA 5JXVA 1TIFA 3N9YC 4F1SA 4XZ4A 4ACFA 2L32A 5IKCM 1WXSA 4LDTB 3DHIC 3JSVA 2IGGA 4W9IA 2DAJA 3L16A 2ZCBA 4E3CA 4W9KA 2KX3A 1WY8A 1DOXA 2LJIA 1YX6B 2N7JA 1A70A 4C7ZA 1CK1A 1ISNA 3WANA 3JW0X 2KOXA 1KH0A 1ZDVA 3AEGB 3Q8FA 4IWOA 2I1JA 2D2QA 4M0WA 1E8WA 2G45B 1ZXHA 1L5PA 2N9KA 2W55A 1UBQA 2SEBD 1OEYA 2LGSA 2XNAC 3B9JA 2RDGA 1JCKB 2ZPYA 4K3CA 2FBWB 4M8MA 3Q8CA 4NY0A 1FMAD 4LNKA 1I4XA 1VZ6A 1GJZA 4ANXA 3ZLZA 1XF5L 5G2NA 1WXVA 4DDID 3MP9A 2KFKB 3UI3A 1SJED 3KW5B 3MHZA 3V05A 3DCGA 2XBBC 2N4FA 2PEAA 1WE6A 2DBYA 1RAXA 2QCZA 2LUMA 2TSSA 2LWPA 2LXCA 1IGDA 2GBRA 3NS8A 3R2TA 5CTRC 3H7SA 5L95C 1WJNA 2JRHA 1K53A 3BVZA 3U2SC 1XXGA 3ONSA 5E6OA 2RDBC 1WYGA 1D6EC 3HRDD 4LJPB 5L83A 4DHZB 2LD9A 2M1MA 2JYEA 1C79A 1V8CA 2ZVOA 4EZJA 2IGDA 4DDGD 1I4RA 2AQ3B 3EUB2 2VH1A 3CIRB 3P1MA 3MJ5A 4IM0A 4GXBA 2C9WB 1UGJA 3PZ8A 4LDTD 1D5MC 3U7DA 1I4PA 3M3JA 4TQ0A 1V9JA 1U4AA 3RCZA 4ARIA 2YVCA 3PHXB 3EC8A 1JROA 1N61A 4NJ7A 3R66C 1Q10A 2QDFA 3AU5A 2HJ1A 1TYGB 2FCMA 4MELA 2FE8A 1K52A 1YJ1A 2RPVA 4HPMB 4HXDA 1IP9A 2SAKA 3DVNU 5IA7A 2N0SB 4JL9A 1KJTA 2BT6A 4FULA 4LNIA 4AJWA 3PRPB 2DLBA 2LRUA 2GRIA 4HKZE 2WXLA 2J7QB 3Q8EA 2LGXA 2NS5A 3LDZE 4G11A 2MJDA 4QAYA 1WGKA 3GS2A 4A20A 1GB1A 2XEWA 3CSTA 2ICIA 2K8HA 4JWSC 4GOCA 2G3QB 1PFDA 4RMAA 1EUVB 4LTUA 2CS4A 1E8XA 4W9LA 4A9AA 4PS7A 1AWDA 3AE7B 4L23A 2WYQA 5CX3A 3S2AA 2KMMA 4WQMA 1I4HA 2K3UA 3QA8A 2KAJA 2CJOA 3IXSA 1FNUA 1WRIA 3NG0A 2M0AA 4IWPA 5H92C 4B6WA 1YQ3B 3BINA 3PTFC 3RNFC 4LK0M 1WGRA 1TKGA 2JZPA 4ZHPA 3V60A 5IAAC 1G6JA 3ZRFA 3VVWB 1XD3B 3ETRA 3U52E 2JUOA 2LGDA 1L0VB 3AE4B 3RD2A 1V1PA 3A9KB 3KYDD 5E6JA 1MHXA 1TY2A 4XWTA 4ZHOA 2LRWA 2EMSA 4LJOB 2RDHA 4A3PA 1WR6E 2KO3A 3APDA 2GMIC 2KVZA 5C23A 4TKNA 4FLHA 4KZ0A 3VR9B 1TT5B 4A3OA 2KQSA 2LFIA 3P4QB 2K1FA 1VCBA 1PGXA 4I6NB 4KIKB 5DPWA 4NAWB 2X38A 2J52A 3RT3B 3NJTA 2JT4B 2KQ7A 5BMHA 4D2KA 1GNUA 1IGCA 3RZFA 3QQ8B 2MP2A 4B95A 4GU2A 2HDEA 3DBLI 1TKEA 2JZZA 3QARA 5BYSA 2V4LA 4RF1A 3U8ZA 2D5GA 3L0WB 1ET6A 1TS2A 4KKJA 1F9JA 2R2OA 2IY1B 2I1KA 4JPSA 5FR3A 1YN3A 1P9DU 3TUOA 2GI9A 1TS3A 3BK2A 1SF0A 2KFJA 1KTKA 3X23A 2C7HA 3AE3B 5G55A 1UWXA 4WWOA 1E7PB 4WJOA 4BBNF 4NZLB 3GP7A 1WR1A 1VD2A 3R2IA 1E8YA 3URYA 4IM3A 4II2B 3NY5A 4BZAA 2RGFA 1ZOYB 2WU2B 3AMZA 1KRHA 1VZ7A 4ZOHC 3E9SA 4MT5A 4CO7A 3SFEB 4GIVA 2Y5BB 3MHSD 2D07B 2M56B 2MH7A 2G4SA 3I5JC 4MH8A 1GUAB 4WAAA 5KHOA 3LYYA 2BVCA 1P7FA 2WX1A 1QZEA 4RF0A 5D3DA 5G5GA 2KMAA 1RWSA 5EDSA 4OZBA 2AL6A 1V5OA 1JWBD 2MSED 3KUZA 3QIJA 4K7UA 1D4BA 3ZUNA 1FXIA 1P98A 2DHZA 3H9DA 3T8MA 1N63A 2BS3B 4BVUC 3IBEA 2R2QA 2B3AA 3IAS1 1KLVA 2BBCA 3N32A 4US9A 2AYOB 4A6QA 2PPHA 2IO1B 2C5LC 3N3KB 3K9PB 2LVOA 4JWUC 2JWZA 2PE9A 3VH3B 2KWCA 3W5UB 3L10B 1X1MA 1WIAA 4X57B 3Q3FA 1V86A 4DHZE 2IO2B 1E7UA 1B1ZA 1FXAA 4ANUA 3AEAB 3AM9A 1PQSA 2VZKD 3RMKC 3H1UA 2W3SA 4OZAA 2M17A 2EKIA 2N7DA 3MC8A 2YEPF 2BGFA 2D3CA 1BMLC 1V81A 5E6PA 2PIAA 4KV2A 3RZWC 3DHGC 3EFCA 2DZKA 3H7PA 3VRAB 2INPE 2Q5WD 5C2TB 1OEYJ 3Q3NC 3WIMA 3JVZX 2WHIA 1I4GA 3RNCC 3SEBA 3ZJVA 2HJ8A 3HK0A 3ZVVA 1XQQA 5AUKA 4YT0B 2KXJA 1RLFA 1S1QB 2M19A 1H4RA 1FPYA 1ZW7A 3PHWB 4BOZB 3GE8C 4MGKE 1EU4A 3EGRA 2WS3B 1AYFA 1VR9A 2D3BA 2K5PA 1C3TA 5LXIB 1FEHA 2FUHB 2K25A 1IBXA 3CWIA 1FNVA 1T0QC 4AP4C 1N5WA 4XWWA 2JZ3B 2V4IB 4REZA 1QKZA 1TKYA 2K9XA 1WRDB 3U7ZA 1I4QA 3Q14C 5AZFA 4XDDA 4M0WB 2JQRB 4NAMA 1QOGA 2QILA 3J9CA 2N9PC 5HHDG 3Q8AA 4RM9A 2WDVB 2K22A 4IG7B 1ZGUB 5G5HA 3DWMA 1V1OA 4OVUA 3VH4B 3IT4B 2WU5B 2DNFA 3A1QA 2N1WA 3APFA 1EF1A 1YIWA 3H6NA 3RN9C 3ZGZA 3TCAA 3MC0B 1K51A 2PTLA 2IO0B 4RGMA 4RFBA 3PV1A 2KJ6A 1NYRA 5JHBA 2KX0A 3RNEC 1XCTL 3HIZA 4CHKA 1C1YB 1JWUD 1HXYD 3ML9A 4CYEA 1V80A 4BKGA 4C56C 1UD7A 5CHWA 1PYWD 3PPAA 4N9F4 4HPPA 2PVOD 2BQQA 4JIOU 1QF6A 4WH4A 1J0GA 2L52A 2MRPA 2DYOA 3IAM1 3SU8X 2E6XA 2HTME 3B08A 4WJQA 3ZNGC 1WX9A 3QJZA 4IUMB 3RNGC 2KQ4X 4TUUA 3TEXA 4F8CB 4G3XB 4MJSA 1B9RA 4BFRA 3OWEB 4TSSA 1WSPA 3IVFA 5D6JB 3T3OA 3IFWB 3NZUA 4AUQC 3EFUA 5D7GA 5FKAC 2J0KA 1JQ4A 1L6UA 1WE7A 3W5VB 1PUTA 4FJVB 4FJYA 1RFKA 2CHXA 4DWFA 2V3PA 2Z0EB 2MHJA 3HUIA 2LZ6A 4M01A 3DVGY 1QT9A 2W3RA 2J4XA 1L4ZB 2LASA 2NPTA 2D3GA 5IOIA 2LI5A 1QOFA 4IOIE 4BAXA 1S3SG 1MJDA 3X0WA 1R4MI 1WX8A 4ANVA 3DBLB 1EU3A 4M8NA 5CHVC 1YJIA 1T6BX 3VDZA 2QC8A 1XLQA 5GXGB 4KKIA 3RNBC 4AWJA 2WDTB 4TMAB 2NTTA 1BUIC 1SBBB 3B2FA 3DBRI 4PYZA 4YSYB 5LLIA 3R7QA 2L76A 2JXTA 5FK9C 4B0MA 2OHFA 3OG5A 1KLUD 3EHVA 2J53A 3NVWA 1EM7A 2LGYA 3IG3A 2I38A 4BKTA 1PGBA 1WMHA 2QJLA 1K50A 2BYTA 4FHKA 2KTRB 2Z8LA 4JX1C 3TEZA 5JH5C 2NMQA 4MM3A 4YTPB 5T8IA 3VR8B 4L1BA 1E6EB 1C76A 2JY6A 2MBOA 2KNBA 4A55A 4BKSA 3PZ7A 2AQ2B 5BYQA 1YJJA 2WXNA 1LFDA 4BKSD 2DX5B 4OZCA 1NBFC 2DYBA 1FXTB 1LXDA 1C4CA 5J2RA 3KYCD 1YD8U 2G1EA 2WXRA 1QOBA 1UGMA 1T3QA 1V1PB 3TIXA 1GC6A 4HDQA 2HE7A 1T0SC 2ON8A 3I57A 3NVVA 3W1YA 4ZDVA 2REXA 1XLOA 4F7ZA 2LVPA 3ZNHB 4ZRQA 4MSQB 1XLNA 3AEDB 4MGZE 4OVZA 2DZIA 3TBLD 3SDLC 1GB4A 1OGWA 1P0RA 3I63C 5DCNA 3RI7C 1T0YA 3OLMD 1NEKB 4P1CC 5IN7A 4HLEA 1N6ZA 3AULA 3NOBA 3PZDA 4AOFA 3TEYA 2MP2B 3DWGC 1T0RC 4WURA 2ZVNA 3QK0A 2JX5A 5J18A 3C19A 2ZNVC 3PREA 1IPGA 5IO9A 5HG2A 3I3TB 4FA6A 2DYMA 4WAFA 2E3TA 2WDRB 3SFDB 4HRSA 3R8BA 3BYYB 3W9CB 2KLGA 3AEBB 4NNJB 4WJPA 1R4NI 2KWVB 2QIEB 5DPSA 5HI1A 4N59A 4DHJD 2L05A 1OQQA 1CQVA 2X8XX 3ZW3A 4W9DA 4EEWA 4KDLB 4HKQA 4PK1A 3M62B 1AARA 3EA6A 2MA9B 2Y5CA 1WJ6A 2NTSA 4R3DA 1CZPA 1J7CA 1V5TA 4C80A 2BS2B 1NYQA 3U4EG 5BO4B 1SE2A 2WXGA 4K3BA 4EOYA 3O13A 3ECIA 3SD5A 4FBJB 2WDQB 4RGNA 3V62A 1SEBD 2O2VA 4K7SA 4W9HA 2WXKA 1C9FA 2MBHA 2BTEA 4HPLB 3ZDTA 2UU7A 3AB5A 3Q8BA 1MFWA 2KMCA 1L0YB 2LVQA 2MLBA 2YLMA 2EMTA 1GOZA 3ZO5B 1UUPA 4GGQA 4W9CA 4EZKA 4LCDE 1ZE3D 3WA0A 3FC4A 2VZKB 2KDEB 4H2AA 2KN5A 4KDIC 1UZXB 3W1SC 2BF8B 3B1LX 3BYTB 4BBNC 3KVFB 1UH6A 2OEDA 2J42A 1EWYC 1F77A 1YN5A 4B9KA 1Q5WB 2A5UA 3PRZA 4E74A 2KDFB 4W9JA 1UBIA 1WJ4A 3ZNZB 2D3AA 3NZSA 2BYVE 4L2YA 4OVVA 3H7PB 4XC2A 4HVBA 1XT9B 4BOSC 1KM7A 2AL3A 3PS6A 2KK8A 5JHAA 2CHZA 1ZP0B 4W9FA 2B76B 1DGJA 3IT6B 1KOTA 3PLVA 1HQRD 3VRBB 2FCSA 2WQYB 5KHQA 4CQNA 1QQRA 4G50A 4IC7B 1NVID 3L13A 5LNK1 3VUYA 2Z59B 2DWQA 2W82A 4RGOS 3Q6BA 3Q3MC 5EE0A 3LJ3A 2Y3AA 1SSNA 3ENEA 4HROA 3M63B 3T9LA 3VTWA 1N5XA 4KSLC 4ARCA 1WF9A 4W9GA 2MBBB 4S0RA 2WX0A 2AX5A 3U30A 3QAQA 3VUXA 3ZTCA 2XK5A 2YEPB 1YQ4B 1N60A 3M95A 4O1NA 2K39A 1KFYB 1RM6C 4NQLB 2VH2A 2CU1A 1YN4A 3AI5A 3N1XC 3BZDB 3OJ3A 1FCCC 4HEA1 3PO0A 4XDCA 1Y8RC 3W1SA 2AQ1B 4WWPA 2FUG1 3DBRB 2O6VA 3TSSA 4DBGA 1E90A 3HHMA 1TY0A 3GE3C 1TJEA 4NJCA 2ZJDA 3QHTA 2IYDB 2LUEA 2ASQA 1L0XB 1P1AA 3A1QB 4HWIB 2BWES 4EFOA 1E8ZA 5E6NA 1L4DB 1MG4A 2LMCA 3RNAC 2K0PA 1WI0A 3DVNV 1JW9D 4NJ6A 2JYTA 4FXCA 1L6VA 1J7BA 4US8A 3P63A 3HM6X 4PS3A 1TBEA 1V6EA 1UWMA 4RNAA 1JWMD 1RRBA 4GDLA 1WM2A 3ZJTA 3BK1A 2INCC 3A4SC 2NVUI 2V0GA 3AEFB 1SIFA 4HK2A 3MJWA 2GBKA 2CR5A 4NQKE 4RCOA 2INNE 3UIOB 1D5XC 1M4VA 4DXGA 4XGAB 5J17A 4I6LB 5AZHA 4GDKA 2UYZB 3DBHI 1K8RB 2JF5A 1E10A 3LB8C 3JSVB 3UGBB 2J0JA 3OJ4B 3PRMB 2C7NB 3V61A 4TV3A 4C4VA 4GLSC 2QMTA 2L8JA 3AH7A 5EE1A 2MEKA 4HCPB 4LNOA 3KUDB 4MJSB 1UNSA 4GMVA 1NI2A 4HCNB 2MBEA 4EZLA 3N20C 1M94A 5D94A 3DOWA 2N9EB 2WXOA 2PMVA 4IW0A 4P6VF 1TGZB 4N58A 1JRPA 2IO3B 1N62A 4J3OD 2N9XA 1FFUA 5D2MB 2KT7A 3L17A 4KSKC 2IJ0A 2NPTB 3O65B 2OJWA 1STEA 4PS8A 3MC9A 3CSFA 3ZRCA 2W9NA 4XYCA 1GPXA 3DBSA 1SXTA 2RD0A 1AN8A 1C4PA 3A9JA 1KLGD 2ZW1A 2FCNA 1ET9A 2G4DB 3WAMA 3DVGX 3NZ3A 1XCQL 2L3ZA 2L00B 4FADA 4M00A 5H8YE 4N6EB 3TL5A 3KUCB 2J0MA 3FILA 4YL8A 1UF0A 3ZYYX 1R4NB 3ABVB 2L0FA 2ZCCA 2JRIB 3AV8A 4MGIE 3APCA 1F0ZA 1WMHB 1IYFA 1XLPA 2MX2A 2QSDA 3ALBA 2ZW0A 2IGHA 2DENB 4MDKE 1WM3A 4MM3B 2LGIA 1HTOA 4WJNA 1HTQA 4WWNA 2GBNA 1C4AA 5HKHA 1IUEA 4ICVA 1ZUD2 2FNJB 1JWAD 2ZEQA 1PGAA 3TJPA 2RPQA 3T3NA 4DXAB 2KN4A 5JZEB 1FD6A 4ZRKA 3VAWA 4MACA 1C78A 3Q2AC 1YMHE 1V49A 4HJGE 1WX7A 2RSUA 5AZGA 4AS1A 3ZXRA 2KC2A 3ZIMA 1OQRA 1ZPSA 2MQJA 3VHTC 1L2NA 3RFZB 2PE6B 3MFGA 2MWSB 2MCNB 2QHOA 3TMPB 3ZQ4A 4ICUA 3NHEB 2CJNA 2LJ5A 3P4PB 1TZOA 2UWQA 1EWCA 4P1BC 1L7YA 2KACA 4P7IA 2KTFA 3N30A 4YSXB 2M0XA 2MJEA 4DXFA 2KJHB 4A8XC 3FAHA 2KD0A 1AW7A 5CHFA 2G9HD 3VFKA 1F2RC 2K6QA 2PJHA 2KJRA 3GB1A 3H8HA 2OJRA 2WXFA 2WXPA 5TR5A 4K81A 4RGTA 3QX1A 3QC8B 1J8CA 3GZNI 3OAWA 1VZ8A 3CF6E 4DHJB 3AE9B 2BB6A 3VTUA 1HA5A 3BWUD 2KKCA 1WWTA 2W54A 1MI0A 1BXTA 2N1VA 1HEZE 4XE0A 1ENFA 3WCQA 1PDXA 1Z2MA 1F1HA 3N1YC 3RUIB 3E56A 4PYUA 4DQOC 1FRRA 3PLUA 1FM0D 2O2VB 2KWDA 3AE8B 2LHEA 3SR6A 2IY0B 1WJUA 1WZ0A 3N1ZC 1J19A 2MBQA 1DOIA 2I2YA 2GLSA 3P2BA 2D11A 2HTHA 3L08A 4K1RB 2R61A 3WALA 1E7VA 4S17A 2ZNVB 1F52A 1JALA 2BKFA 2IPKD 4LNFA 4EUTA 2KFKA 4G0NB 2ZZPB 1NI3A 1HZ6A 3KWVA 5TSSA 2XN9C 1A5RA 3SHQA 2FCQA 1WGHA 1TTNA 3HVDA 1MVKA 2LHDA 2WXQA 2BYEA 4KZCA 1V97A 2CKHB 3RYTA 2MJ3A 2JWUA 5DPTA 4EKUA 4KX6B 3VQIA 4LLGM 2DZJA 2EKEC 3R3MA 4ITKA 3DBHB 3A4RA 3R7RA 1QLBB 4E71A 3VUWA 2L83A 2KTRA 1YX5B 4P16A 2WWZA 2KYWA 3ZDMC 1MG8A 2JPHA 3V6CB 4AJYB 2KDIA 4KGRA 5DPRA 2AWTA 5EE9A 2LXAA 2KC1A 2ONQA 3DDCB 4YXDB 1J7AA 1SIJA 2K8CA 3RULA 1SE9A 5HFYA 4ZYSA 2ACZB 3L54A 3V3XA 2JSVX 1MHHE 2BW2A 2OOBB 2PW9A 2BPSA 1JWSD 1RFAA 2HD5B 1YNTE 3UINB 4I6PA 3AU4A 3NVYA 4K7WA 3AEEB 1E5WA 3AE1B 4ZRJA 3PT2B 1I7HA 2XK5B 4RM8A 4IWQA 4JGHB 4YTNB 3FKYA 1OFFA 1EF5A 3GOEA 1TS4A 3KQ4A 4ASWC 2V9HA 2H89B 3AN1A 3D32A 1OQYA 3UQAA 3ML8A 1WGYA 1WFYA 5IP4D 1VJKA 1LQBA 4LNNA 2O6VB 1HZ5A 1WGGA 3NRZA 4GB9A 1CJEA 3AECB 1LO5D 2KANA 2WXIA 4WIPA 3ZNID 3P42A 2BS4B 3Q3JA 4Q2JA 2H88B 3B0AA 4C7YA 2VRRB 4MH0E 1E9MA 1E0ZA 3CMMB 1GG3A 4AQ7A 2N7EA 2WNMA 5I4DA 1SGHA 1TZ1A 3QCAA 5EE3A 3BIID 2K6DB 1F2RI 4GDLB 2LEKA 4GN1A 1LGRA 4ANWA 2GOWA 3PVLA 1I35A 1EO6A 2JVCA 1ZDXA 3UF8A 2PLPA 1ROEA 3C0RB 4W9EA 3V6EB 3ZKJC 3K9OB 4FHJA 2K8BA 4XX5A 4GDKB 3PSEB 3ZTDA 1QOAA 4IM2A 3NVZA 2L0TA 4II3B 5FR6A 3A33B 4HDOA 5BMIA 1IBXB 2INDC 3LXFA 2WXJA
chains in the Genus database with same CATH topology
2CJOA 3TEWA 3B2FA 3IXSA 4A90A 1FFUA 1FNUA 1WRIA 4YSYB 2N9LA 2IJ0A 2M0AA 1FFVA 3L4PA 1STEA 2JXTA 5H92C 5FK9C 1D5ZC 1YQ3B 4B0MA 1GPXA 2OHFA 3AE6B 1SXTA 1KLUD 4LK0M 1AN8A 1C4PA 2WLBA 2J53A 3NVWA 1EM7A 1KLGD 2ZW1A 1TKGA 2CU3A 2IDYA 2I38A 1ET9A 2JZPA 5MPOA 2JU6X 4ZHPA 1PGBA 2QJLA 1K50A 3NZ3A 2BYTA 2Z8LA 1XCQL 4JX1C 3TEZA 2NMQA 4YTPB 1R7SA 1VLBA 5H8YE 3ETRA 3U52E 5T8IA 1L0VB 3AE4B 4N6EB 3VR8B 1V1PA 5C3JB 4L1BA 2BB5A 1E6EB 1C76A 3FILA 1WXQA 3ZYYX 4USAA 5E6JA 4A55A 1MHXA 1TY2A 4XWTA 2V3NA 3PZ7A 4ZHOA 3ABVB 2AQ2B 1SB3C 2RDHA 5BYQA 1YJJA 2WXNA 4OHJA 3AV8A 1DYQA 3VR9B 4EE2A 1F0ZA 1XLPA 2QSDA 3AE5B 2LFIA 3P4QB 4OZCA 2ZW0A 2IGHA 3P4SB 1C4CA 4MM3B 1QILA 2LGIA 2G1EA 2WXRA 1PGXA 1C77A 1C4AA 3KWLA 4YSZB 1QOBA 1FO4A 1IUEA 4NAWB 1RYJA 2X38A 4YTMB 1T3QA 1V1PB 1ZUD2 2Y5PA 1FRDA 2J52A 3FILB 4UDUC 2ON8A 1NENB 3I57A 3NVVA 5BMHA 4D2KA 1XLOA 1JWAD 3NS1A 1IGCA 1PGAA 4TQ1A 2HDEA 2RMMA 4ZRQA 1TKEA 1XLNA 3AEDB 3I9V1 3T3NA 2KN4A 4OVZA 3P4RB 1FD6A 3BVMA 4ZRPA 2WXHA 5BYSA 4RF1A 1GB4A 2D5GA 3RPFC 1ET6A 1FCLA 1TS2A 1MPEA 4KKJA 1NEKB 4KGSA 4MACA 4PT5A 2L1AA 2QEJC 2KDMA 4JPSA 5FR3A 1C78A 1YN3A 3C8YA 3TUOA 1YMHE 2GI9A 4HJGE 1TS3A 4AS1A 3BK2A 1SF0A 1VDVA 3TEYA 1VRAB 5AUIA 3DWGC 3ZJUA 1KTKA 4IDIA 4WURA 1OQRA 1XO3A 2JX5A 1ZPSA 4B0EA 3AE3B 1UWXA 1TS5A 4JE3B 3RFZB 1E7PB 4NZLB 5HG2A 3GP7A 3R2IA 3B2GA 2DYMA 4WAFA 3URYA 2E3TA 1ZOYB 2WU2B 2PKOA 1KRHA 3AMZA 3KLSX 3MFGA 2WDRB 1VZ7A 4ZOHC 3SFDB 3E9SA 4HRSA 3ZQ4A 4MT5A 3R8BA 2CJNA 3SFEB 3BYYB 3P4PB 1TZOA 3W9CB 2WP9B 1EWCA 4KGTA 3AEBB 2M56B 2MH7A 4MH8A 5BMGA 1SJHD 2KACA 2QIEB 3LYYA 4YSXB 1P7FA 4RF0A 2MJEA 5HI1A 4N59A 5D3DA 4DXFA 4A8XC 3FAHA 3BVGA 5G5GA 1AW7A 1SE4A 1OQQA 1CQVA 1RWSA 2G9HD 1F2RC 4OZBA 4HKQA 1JWBD 2EELA 3AE2B 3GB1A 1Y56A 3H8HA 1D4BA 3EA6A 2WXFA 2WXPA 2Y5CA 1FXIA 2NTSA 4R3DA 3NUHB 5BYRA 3W2DA 4RGTA 1ZXIA 3Q69A 1CZPA 1J7CA 1N63A 4C80A 2BS3B 1T5XD 5D3IB 3IAS1 2BS2B 2WXMA 1GAQB 1JMLA 1VZ8A 2BBCA 1DOYA 1NYQA 4US9A 3U4EG 4A6QA 2PVGC 1SE2A 2WXGA 3AE9B 2BB6A 1KF6B 3O13A 1HA5A 4RH6A 4YWGG 3BWUD 2WDQB 4JWUC 4OW0A 4RGNA 3W5UB 1SEBD 3HVZA 1ACCA 1SE3A 2GB1A 2WXKA 1WWTA 4WWMA 1B1ZA 2W54A 1C9FA 1MI0A 1FXAA 2BTEA 3AEAB 1BXTA 3AM9A 4IKGA 1XEEA 3AB5A 1HEZE 4XE0A 3Q8BA 1ENFA 1FNWA 2VZKD 1FIQA 1ESFA 2W3SA 4OZAA 1P7EA 2EKIA 3WCQA 1PDXA 1IBXB 5JXVA 1L0YB 2YEPF 3E56A 1BMLC 3N9YC 4DQOC 1GOZA 2PIAA 2L32A 3VRAB 1FRRA 1UUPA 2INPE 1ZE3D 2IGGA 2Q5WD 5C2TB 1FM0D 3FC4A 2KWDA 3AE8B 2LHEA 2VZKB 3SR6A 4H2AA 1I4GA 3SEBA 3BYTB 3ZJVA 1DOXA 2LJIA 2OEDA 2N7JA 1A70A 4C7ZA 1CK1A 1DOIA 2I2YA 2J42A 1KH0A 1ZDVA 3AEGB 1EWYC 1F77A 3Q8FA 5AUKA 1YN5A 2R61A 4YT0B 2M19A 4M0WA 1EU4A 3EGRA 1ZXHA 1L5PA 1JALA 2N9KA 2IPKD 2W55A 2WS3B 1AYFA 1VR9A 2SEBD 4L2YA 1NI3A 2K5PA 1HZ6A 2XNAC 3B9JA 1FEHA 3KWVA 5TSSA 2XN9C 1IBXA 3CWIA 1FNVA 1N5WA 1ZP0B 4XWWA 3HVDA 2RDGA 1MVKA 2B76B 1JCKB 1DGJA 2LHDA 2V4IB 2WXQA 3IT6B 4REZA 2FBWB 1QKZA 1TKYA 1V97A 3Q8CA 1HQRD 2K9XA 3VRBB 3U7ZA 1FMAD 2WQYB 4CQNA 1I4XA 1VZ6A 2MJ3A 2JWUA 1QQRA 1I4QA 4XDDA 1NVID 2JQRB 1XF5L 5LNK1 4NAMA 1QOGA 4KX6B 3VQIA 2QILA 4LLGM 2DWQA 2W82A 3J9CA 4RGOS 4ITKA 3MP9A 1QLBB 5EE0A 5HHDG 2Y3AA 1SSNA 3Q8AA 3UI3A 2WDVB 2K22A 1SJED 2L83A 4HROA 4P16A 3MHZA 3V05A 1N5XA 4ARCA 5G5HA 3DWMA 2DBYA 1V1OA 2LUMA 2TSSA 4KGRA 3IT4B 5EE9A 1IGDA 2AX5A 2WU5B 4YXDB 2ONQA 3R2TA 1J7AA 1SIJA 2YEPB 1YQ4B 1N60A 4O1NA 1KFYB 1K53A 1RM6C 3BVZA 5HFYA 3U2SC 4ZYSA 1XXGA 2ACZB 1WYGA 1D6EC 3HRDD 1YN4A 3BZDB 2JSVX 2JYEA 1FCCC 4HEA1 3V3XA 1C79A 1V8CA 3ZGZA 3PO0A 4XDCA 1MHHE 2IGDA 2BW2A 3MC0B 2PW9A 1I4RA 1K51A 2PTLA 3W1SA 1JWSD 2AQ1B 2AQ3B 4RGMA 3EUB2 4RFBA 1YNTE 3CIRB 3P1MA 2FUG1 3MJ5A 1NYRA 3TSSA 3NVYA 1TY0A 1UGJA 1XCTL 3PZ8A 3AEEB 1TJEA 3AE1B 4NJCA 1D5MC 1JWUD 1HXYD 1I7HA 4YTNB 1L0XB 1I4PA 4TQ0A 4C56C 1OFFA 1L4DB 2LMCA 1TS4A 4ARIA 2K0PA 1PYWD 3KQ4A 2PVOD 2H89B 1JW9D 3AN1A 1QF6A 1JROA 2JYTA 1N61A 4FXCA 1L6VA 4WH4A 1J7BA 4US8A 3P63A 2L52A 1Q10A 2DYOA 1UWMA 4RNAA 3IAM1 1JWMD 1VJKA 2E6XA 2HTME 3ZJTA 3BK1A 1TYGB 1HZ5A 2V0GA 3AEFB 3NRZA 2FE8A 1K52A 1CJEA 2RPVA 2KQ4X 3AECB 1LO5D 2WXIA 4WIPA 3TEXA 4RCOA 2INNE 2SAKA 1D5XC 2N0SB 3P42A 2BS4B 1B9RA 4Q2JA 2H88B 3OWEB 1M4VA 1WSPA 2BT6A 4TSSA 4C7YA 4DXGA 3T3OA 2DLBA 1E9MA 2GRIA 4HKZE 5D7GA 2WXLA 1E0ZA 5FKAC 1JQ4A 1L6UA 3Q8EA 3W5VB 1PUTA 4AQ7A 1RFKA 2WNMA 5I4DA 1E10A 2MJDA 2V3PA 3LB8C 3BIID 5EE3A 1WGKA 1F2RI 3GS2A 4GDLB 2LEKA 1GB1A 2ICIA 4JWSC 3HUIA 1QT9A 2W3RA 1PFDA 2J4XA 1L4ZB 4GLSC 1ZDXA 2QMTA 4LTUA 1QOFA 2PLPA 3AH7A 1ROEA 4IOIE 5EE1A 2MEKA 4A9AA 1UNSA 1EU3A 1AWDA 1YJIA 1T6BX 3AE7B 1XLQA 4GDKB 5GXGB 4L23A 4KKIA 2KMMA 1QOAA 3NVZA 2WXOA 4WQMA 1I4HA 2PMVA 4TMAB 4P6VF 2K3UA 1BUIC 1JRPA 2NTTA 3LXFA 4N58A 1N62A 5BMIA 2KAJA 4J3OD 1SBBB 2WXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJO A;  3B2F A;  3EUB 2;  3CIR B;  3P1M A;  1FFU A;  1E10 A;  2PIA A;  1WRI A;  4YSY B;  3VRA B;  1FRR A;  1NYR A;  1FFV A;  3L4P A;  1SF0 A;  2Q5W D;  1VDV A;  5C2T B;  3NVY A;  5H92 C;  1FM0 D;  3AEE B;  3FC4 A;  5AUI A;  1TJE A;  3DWG C;  3AE1 B;  3AE8 B;  1YQ3 B;  4IDI A;  1OQR A;  1XO3 A;  1I7H A;  1GPX A;  2JX5 A;  3SR6 A;  4YTN B;  2OHF A;  3AE6 B;  3AE3 B;  2WLB A;  1DOX A;  1OFF A;  3NVW A;  1E7P B;  1A70 A;  4C7Z A;  1TKG A;  2CU3 A;  1DOI A;  5MPO A;  4ZHP A;  2QJL A;  3AEG B;  1EWY C;  2PVO D;  2H89 B;  3B2G A;  5AUK A;  2E3T A;  1JW9 D;  4YT0 B;  3AN1 A;  2M19 A;  1ZOY B;  2WU2 B;  1JRO A;  1KRH A;  2PKO A;  1N61 A;  3AMZ A;  4FXC A;  2WDR B;  1L6V A;  4ZOH C;  1J7B A;  4YTP B;  3P63 A;  1R7S A;  3SFD B;  4HRS A;  4US8 A;  2L52 A;  1L5P A;  1JAL A;  2W55 A;  1UWM A;  1VLB A;  3ETR A;  2CJN A;  5H8Y E;  3SFE B;  2WS3 B;  1AYF A;  1L0V B;  3AE4 B;  3P4P B;  4N6E B;  3VR8 B;  2WP9 B;  3W9C B;  5C3J B;  1VJK A;  2HTM E;  3AEB B;  2M56 B;  1NI3 A;  1E6E B;  1TYG B;  2K5P A;  2MH7 A;  1WXQ A;  3ZYY X;  3AEF B;  3B9J A;  3NRZ A;  4USA A;  2QIE B;  1CJE A;  4YSX B;  3CWI A;  4ZHO A;  1N5W A;  1ZP0 B;  3ABV B;  3AEC B;  1SB3 C;  2MJE A;  4N59 A;  1YJJ A;  2B76 B;  3FAH A;  1DGJ A;  5G5G A;  3AV8 A;  2FBW B;  1TKY A;  1V97 A;  1OQQ A;  2N0S B;  2BS4 B;  2K9X A;  1RWS A;  3VRB B;  3VR9 B;  2H88 B;  1FMA D;  2BT6 A;  4C7Y A;  1B9R A;  2WQY B;  1F0Z A;  1JWB D;  1QF6 A;  1XLP A;  2MJ3 A;  1E9M A;  3AE5 B;  4JX1 C;  3P4Q B;  3AE2 B;  1E0Z A;  1NVI D;  2JQR B;  1JQ4 A;  1L6U A;  2Y5C A;  1FXI A;  1PUT A;  3P4S B;  1QOG A;  3W5V B;  4KX6 B;  1RFK A;  1ZXI A;  2DWQ A;  2G1E A;  3KWL A;  4YSZ B;  1CZP A;  4ITK A;  1J7C A;  1FO4 A;  1N63 A;  1QOB A;  1IUE A;  1QLB B;  2BS3 B;  2MJD A;  3BII D;  1RYJ A;  1WGK A;  3LB8 C;  5EE3 A;  5EE0 A;  4C80 A;  4YTM B;  1T3Q A;  2BS2 B;  1GAQ B;  1ZUD 2;  2K22 A;  2L83 A;  2LEK A;  2WDV B;  4HRO A;  1DOY A;  1NYQ A;  1FRD A;  4US9 A;  2PVG C;  4JWS C;  3AE9 B;  3HUI A;  1N5X A;  1QT9 A;  2W3R A;  1KF6 B;  1NEN B;  1PFD A;  5G5H A;  3NVV A;  3DWM A;  2DBY A;  1XLO A;  1JWA D;  2WDQ B;  4JWU C;  3NS1 A;  4LTU A;  3W5U B;  1QOF A;  3AH7 A;  1ROE A;  2AX5 A;  5EE9 A;  2WU5 B;  3HVZ A;  4YXD B;  5EE1 A;  1J7A A;  1WWT A;  1SIJ A;  1YQ4 B;  4WWM A;  4A9A A;  1TKE A;  1N60 A;  1XLN A;  3AED B;  2W54 A;  1AWD A;  1FXA A;  1KFY B;  1RM6 C;  3AEA B;  1YJI A;  3AM9 A;  3AE7 B;  3P4R B;  1XLQ A;  3AB5 A;  2ACZ B;  1WYG A;  3HRD D;  5GXG B;  1FIQ A;  2KMM A;  1QOA A;  2W3S A;  3NVZ A;  3RPF C;  4WQM A;  2EKI A;  3WCQ A;  1PDX A;  1V8C A;  3PO0 A;  4P6V F;  1NEK B;  4N58 A;  1JRP A;  1N62 A;  2KAJ A;  3LXF A; 
#chains in the Genus database with same CATH topology
 3TEW A;  2L7R A;  1V2Y A;  4A90 A;  4JQW C;  3A9K A;  2N9L A;  4J6I A;  2FIF A;  4C4V B;  2Z0D B;  1FFV A;  3L4P A;  1NDD A;  1ZKH A;  5LXH A;  1D5Z C;  1R4M B;  4MEM A;  3AE6 B;  3JYU A;  2WLB A;  4M02 A;  3DPD A;  1WH3 A;  2IDY A;  2CU3 A;  2BKR B;  5MPO A;  2JU6 X;  1LM8 B;  4JLC A;  1R7S A;  1GC7 A;  4KIK A;  1VLB A;  2IZV B;  4NAW A;  4GSW A;  1WGD A;  5C3J B;  2BB5 A;  2KDB A;  2IBI B;  3ZXV A;  1WXQ A;  3UQB A;  4USA A;  2O6V D;  2V3N A;  2GBM A;  2KHW B;  1SB3 C;  5GMV A;  2C7M B;  4OHJ A;  1DYQ A;  2NBW B;  3A9J B;  2M4N A;  3WAP A;  4EE2 A;  2WGS A;  3AE5 B;  3QWZ B;  1UEL A;  1D3Z A;  3DHH C;  3P4S B;  1QIL A;  3KWL A;  4YSZ B;  1C77 A;  1FO4 A;  2DZM A;  2CHW A;  1RYJ A;  4YTM B;  3UIP B;  2ZPN A;  2Y5P A;  3GZN B;  1FRD A;  3FIL B;  4UDU C;  1NEN B;  3KH0 A;  3NS1 A;  2RR9 A;  3WAO A;  4TQ1 A;  2RMM A;  2BYF A;  3I9V 1;  1Q0W B;  1I42 A;  3P4R B;  2V3S A;  3BVM A;  4ZRP A;  2WXH A;  2BWF A;  4MGY E;  4KVG B;  3RPF C;  1FCL A;  1H8C A;  1MPE A;  4ZRI A;  4KGS A;  3PGE A;  4PT5 A;  2L1A A;  2QEJ C;  1WZ3 A;  2KDM A;  2A4Z A;  3C8Y A;  1JRU A;  1WXM A;  2MW5 A;  2JXX A;  4FN2 A;  1VDV A;  1VRA B;  2NCN A;  2DAF A;  4DK5 A;  5AUI A;  3ZJU A;  4IDI A;  4MSM B;  1XO3 A;  1YOV B;  4B0E A;  1TS5 A;  1YQB A;  4JE3 B;  2V1Y A;  3DQV A;  4NPN A;  3B2G A;  2AEH A;  3Q3O C;  1P3Q U;  2PKO A;  3KLS X;  4ZYN A;  2FAZ A;  2WP9 B;  4KGT A;  1BT0 A;  5BMG A;  1SJH D;  2KLC A;  1CMX B;  1HE8 A;  3BVG A;  2M8S A;  1SE4 A;  3HM3 A;  1Q1O A;  3IHP C;  4FJZ A;  3VTV A;  3EEC A;  4WQO B;  2NBV B;  3MTN B;  2EEL A;  3AE2 B;  1Y56 A;  4URK A;  5C1Z A;  2C60 A;  5BYR A;  3NUH B;  3W2D A;  1ZXI A;  3Q69 A;  2NR2 A;  1T5X D;  5D3I B;  3VXW A;  2WXM A;  1GAQ B;  1WYW B;  5AEK B;  1JML A;  1DOY A;  2PVG C;  1KF6 B;  4RH6 A;  4YWG G;  2KWU B;  2KVR A;  2NBU A;  3AXC A;  4OW0 A;  1Z5S B;  3HVZ A;  1ACC A;  1SE3 A;  2GB1 A;  4HJK A;  4WWM A;  1OTR B;  1WXA A;  2GBJ A;  2D10 A;  4IKG A;  1XEE A;  4C00 A;  1FNW A;  3BY4 B;  1FIQ A;  1ESF A;  1P7E A;  2FID A;  2KZR A;  5JXV A;  1TIF A;  3N9Y C;  4F1S A;  4XZ4 A;  4ACF A;  2L32 A;  5IKC M;  1WXS A;  4LDT B;  3DHI C;  3JSV A;  2IGG A;  4W9I A;  2DAJ A;  3L16 A;  2ZCB A;  4E3C A;  4W9K A;  2KX3 A;  1WY8 A;  1DOX A;  2LJI A;  1YX6 B;  2N7J A;  1A70 A;  4C7Z A;  1CK1 A;  1ISN A;  3WAN A;  3JW0 X;  2KOX A;  1KH0 A;  1ZDV A;  3AEG B;  3Q8F A;  4IWO A;  2I1J A;  2D2Q A;  4M0W A;  1E8W A;  2G45 B;  1ZXH A;  1L5P A;  2N9K A;  2W55 A;  1UBQ A;  2SEB D;  1OEY A;  2LGS A;  2XNA C;  3B9J A;  2RDG A;  1JCK B;  2ZPY A;  4K3C A;  2FBW B;  4M8M A;  3Q8C A;  4NY0 A;  1FMA D;  4LNK A;  1I4X A;  1VZ6 A;  1GJZ A;  4ANX A;  3ZLZ A;  1XF5 L;  5G2N A;  1WXV A;  4DDI D;  3MP9 A;  2KFK B;  3UI3 A;  1SJE D;  3KW5 B;  3MHZ A;  3V05 A;  3DCG A;  2XBB C;  2N4F A;  2PEA A;  1WE6 A;  2DBY A;  1RAX A;  2QCZ A;  2LUM A;  2TSS A;  2LWP A;  2LXC A;  1IGD A;  2GBR A;  3NS8 A;  3R2T A;  5CTR C;  3H7S A;  5L95 C;  1WJN A;  2JRH A;  1K53 A;  3BVZ A;  3U2S C;  1XXG A;  3ONS A;  5E6O A;  2RDB C;  1WYG A;  1D6E C;  3HRD D;  4LJP B;  5L83 A;  4DHZ B;  2LD9 A;  2M1M A;  2JYE A;  1C79 A;  1V8C A;  2ZVO A;  4EZJ A;  2IGD A;  4DDG D;  1I4R A;  2AQ3 B;  3EUB 2;  2VH1 A;  3CIR B;  3P1M A;  3MJ5 A;  4IM0 A;  4GXB A;  2C9W B;  1UGJ A;  3PZ8 A;  4LDT D;  1D5M C;  3U7D A;  1I4P A;  3M3J A;  4TQ0 A;  1V9J A;  1U4A A;  3RCZ A;  4ARI A;  2YVC A;  3PHX B;  3EC8 A;  1JRO A;  1N61 A;  4NJ7 A;  3R66 C;  1Q10 A;  2QDF A;  3AU5 A;  2HJ1 A;  1TYG B;  2FCM A;  4MEL A;  2FE8 A;  1K52 A;  1YJ1 A;  2RPV A;  4HPM B;  4HXD A;  1IP9 A;  2SAK A;  3DVN U;  5IA7 A;  2N0S B;  4JL9 A;  1KJT A;  2BT6 A;  4FUL A;  4LNI A;  4AJW A;  3PRP B;  2DLB A;  2LRU A;  2GRI A;  4HKZ E;  2WXL A;  2J7Q B;  3Q8E A;  2LGX A;  2NS5 A;  3LDZ E;  4G11 A;  2MJD A;  4QAY A;  1WGK A;  3GS2 A;  4A20 A;  1GB1 A;  2XEW A;  3CST A;  2ICI A;  2K8H A;  4JWS C;  4GOC A;  2G3Q B;  1PFD A;  4RMA A;  1EUV B;  4LTU A;  2CS4 A;  1E8X A;  4W9L A;  4A9A A;  4PS7 A;  1AWD A;  3AE7 B;  4L23 A;  2WYQ A;  5CX3 A;  3S2A A;  2KMM A;  4WQM A;  1I4H A;  2K3U A;  3QA8 A;  2KAJ A;  2CJO A;  3IXS A;  1FNU A;  1WRI A;  3NG0 A;  2M0A A;  4IWP A;  5H92 C;  4B6W A;  1YQ3 B;  3BIN A;  3PTF C;  3RNF C;  4LK0 M;  1WGR A;  1TKG A;  2JZP A;  4ZHP A;  3V60 A;  5IAA C;  1G6J A;  3ZRF A;  3VVW B;  1XD3 B;  3ETR A;  3U52 E;  2JUO A;  2LGD A;  1L0V B;  3AE4 B;  3RD2 A;  1V1P A;  3A9K B;  3KYD D;  5E6J A;  1MHX A;  1TY2 A;  4XWT A;  4ZHO A;  2LRW A;  2EMS A;  4LJO B;  2RDH A;  4A3P A;  1WR6 E;  2KO3 A;  3APD A;  2GMI C;  2KVZ A;  5C23 A;  4TKN A;  4FLH A;  4KZ0 A;  3VR9 B;  1TT5 B;  4A3O A;  2KQS A;  2LFI A;  3P4Q B;  2K1F A;  1VCB A;  1PGX A;  4I6N B;  4KIK B;  5DPW A;  4NAW B;  2X38 A;  2J52 A;  3RT3 B;  3NJT A;  2JT4 B;  2KQ7 A;  5BMH A;  4D2K A;  1GNU A;  1IGC A;  3RZF A;  3QQ8 B;  2MP2 A;  4B95 A;  4GU2 A;  2HDE A;  3DBL I;  1TKE A;  2JZZ A;  3QAR A;  5BYS A;  2V4L A;  4RF1 A;  3U8Z A;  2D5G A;  3L0W B;  1ET6 A;  1TS2 A;  4KKJ A;  1F9J A;  2R2O A;  2IY1 B;  2I1K A;  4JPS A;  5FR3 A;  1YN3 A;  1P9D U;  3TUO A;  2GI9 A;  1TS3 A;  3BK2 A;  1SF0 A;  2KFJ A;  1KTK A;  3X23 A;  2C7H A;  3AE3 B;  5G55 A;  1UWX A;  4WWO A;  1E7P B;  4WJO A;  4BBN F;  4NZL B;  3GP7 A;  1WR1 A;  1VD2 A;  3R2I A;  1E8Y A;  3URY A;  4IM3 A;  4II2 B;  3NY5 A;  4BZA A;  2RGF A;  1ZOY B;  2WU2 B;  3AMZ A;  1KRH A;  1VZ7 A;  4ZOH C;  3E9S A;  4MT5 A;  4CO7 A;  3SFE B;  4GIV A;  2Y5B B;  3MHS D;  2D07 B;  2M56 B;  2MH7 A;  2G4S A;  3I5J C;  4MH8 A;  1GUA B;  4WAA A;  5KHO A;  3LYY A;  2BVC A;  1P7F A;  2WX1 A;  1QZE A;  4RF0 A;  5D3D A;  5G5G A;  2KMA A;  1RWS A;  5EDS A;  4OZB A;  2AL6 A;  1V5O A;  1JWB D;  2MSE D;  3KUZ A;  3QIJ A;  4K7U A;  1D4B A;  3ZUN A;  1FXI A;  1P98 A;  2DHZ A;  3H9D A;  3T8M A;  1N63 A;  2BS3 B;  4BVU C;  3IBE A;  2R2Q A;  2B3A A;  3IAS 1;  1KLV A;  2BBC A;  3N32 A;  4US9 A;  2AYO B;  4A6Q A;  2PPH A;  2IO1 B;  2C5L C;  3N3K B;  3K9P B;  2LVO A;  4JWU C;  2JWZ A;  2PE9 A;  3VH3 B;  2KWC A;  3W5U B;  3L10 B;  1X1M A;  1WIA A;  4X57 B;  3Q3F A;  1V86 A;  4DHZ E;  2IO2 B;  1E7U A;  1B1Z A;  1FXA A;  4ANU A;  3AEA B;  3AM9 A;  1PQS A;  2VZK D;  3RMK C;  3H1U A;  2W3S A;  4OZA A;  2M17 A;  2EKI A;  2N7D A;  3MC8 A;  2YEP F;  2BGF A;  2D3C A;  1BML C;  1V81 A;  5E6P A;  2PIA A;  4KV2 A;  3RZW C;  3DHG C;  3EFC A;  2DZK A;  3H7P A;  3VRA B;  2INP E;  2Q5W D;  5C2T B;  1OEY J;  3Q3N C;  3WIM A;  3JVZ X;  2WHI A;  1I4G A;  3RNC C;  3SEB A;  3ZJV A;  2HJ8 A;  3HK0 A;  3ZVV A;  1XQQ A;  5AUK A;  4YT0 B;  2KXJ A;  1RLF A;  1S1Q B;  2M19 A;  1H4R A;  1FPY A;  1ZW7 A;  3PHW B;  4BOZ B;  3GE8 C;  4MGK E;  1EU4 A;  3EGR A;  2WS3 B;  1AYF A;  1VR9 A;  2D3B A;  2K5P A;  1C3T A;  5LXI B;  1FEH A;  2FUH B;  2K25 A;  1IBX A;  3CWI A;  1FNV A;  1T0Q C;  4AP4 C;  1N5W A;  4XWW A;  2JZ3 B;  2V4I B;  4REZ A;  1QKZ A;  1TKY A;  2K9X A;  1WRD B;  3U7Z A;  1I4Q A;  3Q14 C;  5AZF A;  4XDD A;  4M0W B;  2JQR B;  4NAM A;  1QOG A;  2QIL A;  3J9C A;  2N9P C;  5HHD G;  3Q8A A;  4RM9 A;  2WDV B;  2K22 A;  4IG7 B;  1ZGU B;  5G5H A;  3DWM A;  1V1O A;  4OVU A;  3VH4 B;  3IT4 B;  2WU5 B;  2DNF A;  3A1Q A;  2N1W A;  3APF A;  1EF1 A;  1YIW A;  3H6N A;  3RN9 C;  3ZGZ A;  3TCA A;  3MC0 B;  1K51 A;  2PTL A;  2IO0 B;  4RGM A;  4RFB A;  3PV1 A;  2KJ6 A;  1NYR A;  5JHB A;  2KX0 A;  3RNE C;  1XCT L;  3HIZ A;  4CHK A;  1C1Y B;  1JWU D;  1HXY D;  3ML9 A;  4CYE A;  1V80 A;  4BKG A;  4C56 C;  1UD7 A;  5CHW A;  1PYW D;  3PPA A;  4N9F 4;  4HPP A;  2PVO D;  2BQQ A;  4JIO U;  1QF6 A;  4WH4 A;  1J0G A;  2L52 A;  2MRP A;  2DYO A;  3IAM 1;  3SU8 X;  2E6X A;  2HTM E;  3B08 A;  4WJQ A;  3ZNG C;  1WX9 A;  3QJZ A;  4IUM B;  3RNG C;  2KQ4 X;  4TUU A;  3TEX A;  4F8C B;  4G3X B;  4MJS A;  1B9R A;  4BFR A;  3OWE B;  4TSS A;  1WSP A;  3IVF A;  5D6J B;  3T3O A;  3IFW B;  3NZU A;  4AUQ C;  3EFU A;  5D7G A;  5FKA C;  2J0K A;  1JQ4 A;  1L6U A;  1WE7 A;  3W5V B;  1PUT A;  4FJV B;  4FJY A;  1RFK A;  2CHX A;  4DWF A;  2V3P A;  2Z0E B;  2MHJ A;  3HUI A;  2LZ6 A;  4M01 A;  3DVG Y;  1QT9 A;  2W3R A;  2J4X A;  1L4Z B;  2LAS A;  2NPT A;  2D3G A;  5IOI A;  2LI5 A;  1QOF A;  4IOI E;  4BAX A;  1S3S G;  1MJD A;  3X0W A;  1R4M I;  1WX8 A;  4ANV A;  3DBL B;  1EU3 A;  4M8N A;  5CHV C;  1YJI A;  1T6B X;  3VDZ A;  2QC8 A;  1XLQ A;  5GXG B;  4KKI A;  3RNB C;  4AWJ A;  2WDT B;  4TMA B;  2NTT A;  1BUI C;  1SBB B;  3B2F A;  3DBR I;  4PYZ A;  4YSY B;  5LLI A;  3R7Q A;  2L76 A;  2JXT A;  5FK9 C;  4B0M A;  2OHF A;  3OG5 A;  1KLU D;  3EHV A;  2J53 A;  3NVW A;  1EM7 A;  2LGY A;  3IG3 A;  2I38 A;  4BKT A;  1PGB A;  1WMH A;  2QJL A;  1K50 A;  2BYT A;  4FHK A;  2KTR B;  2Z8L A;  4JX1 C;  3TEZ A;  5JH5 C;  2NMQ A;  4MM3 A;  4YTP B;  5T8I A;  3VR8 B;  4L1B A;  1E6E B;  1C76 A;  2JY6 A;  2MBO A;  2KNB A;  4A55 A;  4BKS A;  3PZ7 A;  2AQ2 B;  5BYQ A;  1YJJ A;  2WXN A;  1LFD A;  4BKS D;  2DX5 B;  4OZC A;  1NBF C;  2DYB A;  1FXT B;  1LXD A;  1C4C A;  5J2R A;  3KYC D;  1YD8 U;  2G1E A;  2WXR A;  1QOB A;  1UGM A;  1T3Q A;  1V1P B;  3TIX A;  1GC6 A;  4HDQ A;  2HE7 A;  1T0S C;  2ON8 A;  3I57 A;  3NVV A;  3W1Y A;  4ZDV A;  2REX A;  1XLO A;  4F7Z A;  2LVP A;  3ZNH B;  4ZRQ A;  4MSQ B;  1XLN A;  3AED B;  4MGZ E;  4OVZ A;  2DZI A;  3TBL D;  3SDL C;  1GB4 A;  1OGW A;  1P0R A;  3I63 C;  5DCN A;  3RI7 C;  1T0Y A;  3OLM D;  1NEK B;  4P1C C;  5IN7 A;  4HLE A;  1N6Z A;  3AUL A;  3NOB A;  3PZD A;  4AOF A;  3TEY A;  2MP2 B;  3DWG C;  1T0R C;  4WUR A;  2ZVN A;  3QK0 A;  2JX5 A;  5J18 A;  3C19 A;  2ZNV C;  3PRE A;  1IPG A;  5IO9 A;  5HG2 A;  3I3T B;  4FA6 A;  2DYM A;  4WAF A;  2E3T A;  2WDR B;  3SFD B;  4HRS A;  3R8B A;  3BYY B;  3W9C B;  2KLG A;  3AEB B;  4NNJ B;  4WJP A;  1R4N I;  2KWV B;  2QIE B;  5DPS A;  5HI1 A;  4N59 A;  4DHJ D;  2L05 A;  1OQQ A;  1CQV A;  2X8X X;  3ZW3 A;  4W9D A;  4EEW A;  4KDL B;  4HKQ A;  4PK1 A;  3M62 B;  1AAR A;  3EA6 A;  2MA9 B;  2Y5C A;  1WJ6 A;  2NTS A;  4R3D A;  1CZP A;  1J7C A;  1V5T A;  4C80 A;  2BS2 B;  1NYQ A;  3U4E G;  5BO4 B;  1SE2 A;  2WXG A;  4K3B A;  4EOY A;  3O13 A;  3ECI A;  3SD5 A;  4FBJ B;  2WDQ B;  4RGN A;  3V62 A;  1SEB D;  2O2V A;  4K7S A;  4W9H A;  2WXK A;  1C9F A;  2MBH A;  2BTE A;  4HPL B;  3ZDT A;  2UU7 A;  3AB5 A;  3Q8B A;  1MFW A;  2KMC A;  1L0Y B;  2LVQ A;  2MLB A;  2YLM A;  2EMT A;  1GOZ A;  3ZO5 B;  1UUP A;  4GGQ A;  4W9C A;  4EZK A;  4LCD E;  1ZE3 D;  3WA0 A;  3FC4 A;  2VZK B;  2KDE B;  4H2A A;  2KN5 A;  4KDI C;  1UZX B;  3W1S C;  2BF8 B;  3B1L X;  3BYT B;  4BBN C;  3KVF B;  1UH6 A;  2OED A;  2J42 A;  1EWY C;  1F77 A;  1YN5 A;  4B9K A;  1Q5W B;  2A5U A;  3PRZ A;  4E74 A;  2KDF B;  4W9J A;  1UBI A;  1WJ4 A;  3ZNZ B;  2D3A A;  3NZS A;  2BYV E;  4L2Y A;  4OVV A;  3H7P B;  4XC2 A;  4HVB A;  1XT9 B;  4BOS C;  1KM7 A;  2AL3 A;  3PS6 A;  2KK8 A;  5JHA A;  2CHZ A;  1ZP0 B;  4W9F A;  2B76 B;  1DGJ A;  3IT6 B;  1KOT A;  3PLV A;  1HQR D;  3VRB B;  2FCS A;  2WQY B;  5KHQ A;  4CQN A;  1QQR A;  4G50 A;  4IC7 B;  1NVI D;  3L13 A;  5LNK 1;  3VUY A;  2Z59 B;  2DWQ A;  2W82 A;  4RGO S;  3Q6B A;  3Q3M C;  5EE0 A;  3LJ3 A;  2Y3A A;  1SSN A;  3ENE A;  4HRO A;  3M63 B;  3T9L A;  3VTW A;  1N5X A;  4KSL C;  4ARC A;  1WF9 A;  4W9G A;  2MBB B;  4S0R A;  2WX0 A;  2AX5 A;  3U30 A;  3QAQ A;  3VUX A;  3ZTC A;  2XK5 A;  2YEP B;  1YQ4 B;  1N60 A;  3M95 A;  4O1N A;  2K39 A;  1KFY B;  1RM6 C;  4NQL B;  2VH2 A;  2CU1 A;  1YN4 A;  3AI5 A;  3N1X C;  3BZD B;  3OJ3 A;  1FCC C;  4HEA 1;  3PO0 A;  4XDC A;  1Y8R C;  3W1S A;  2AQ1 B;  4WWP A;  2FUG 1;  3DBR B;  2O6V A;  3TSS A;  4DBG A;  1E90 A;  3HHM A;  1TY0 A;  3GE3 C;  1TJE A;  4NJC A;  2ZJD A;  3QHT A;  2IYD B;  2LUE A;  2ASQ A;  1L0X B;  1P1A A;  3A1Q B;  4HWI B;  2BWE S;  4EFO A;  1E8Z A;  5E6N A;  1L4D B;  1MG4 A;  2LMC A;  3RNA C;  2K0P A;  1WI0 A;  3DVN V;  1JW9 D;  4NJ6 A;  2JYT A;  4FXC A;  1L6V A;  1J7B A;  4US8 A;  3P63 A;  3HM6 X;  4PS3 A;  1TBE A;  1V6E A;  1UWM A;  4RNA A;  1JWM D;  1RRB A;  4GDL A;  1WM2 A;  3ZJT A;  3BK1 A;  2INC C;  3A4S C;  2NVU I;  2V0G A;  3AEF B;  1SIF A;  4HK2 A;  3MJW A;  2GBK A;  2CR5 A;  4NQK E;  4RCO A;  2INN E;  3UIO B;  1D5X C;  1M4V A;  4DXG A;  4XGA B;  5J17 A;  4I6L B;  5AZH A;  4GDK A;  2UYZ B;  3DBH I;  1K8R B;  2JF5 A;  1E10 A;  3LB8 C;  3JSV B;  3UGB B;  2J0J A;  3OJ4 B;  3PRM B;  2C7N B;  3V61 A;  4TV3 A;  4C4V A;  4GLS C;  2QMT A;  2L8J A;  3AH7 A;  5EE1 A;  2MEK A;  4HCP B;  4LNO A;  3KUD B;  4MJS B;  1UNS A;  4GMV A;  1NI2 A;  4HCN B;  2MBE A;  4EZL A;  3N20 C;  1M94 A;  5D94 A;  3DOW A;  2N9E B;  2WXO A;  2PMV A;  4IW0 A;  4P6V F;  1TGZ B;  4N58 A;  1JRP A;  2IO3 B;  1N62 A;  4J3O D;  2N9X A;  1FFU A;  5D2M B;  2KT7 A;  3L17 A;  4KSK C;  2IJ0 A;  2NPT B;  3O65 B;  2OJW A;  1STE A;  4PS8 A;  3MC9 A;  3CSF A;  3ZRC A;  2W9N A;  4XYC A;  1GPX A;  3DBS A;  1SXT A;  2RD0 A;  1AN8 A;  1C4P A;  3A9J A;  1KLG D;  2ZW1 A;  2FCN A;  1ET9 A;  2G4D B;  3WAM A;  3DVG X;  3NZ3 A;  1XCQ L;  2L3Z A;  2L00 B;  4FAD A;  4M00 A;  5H8Y E;  4N6E B;  3TL5 A;  3KUC B;  2J0M A;  3FIL A;  4YL8 A;  1UF0 A;  3ZYY X;  1R4N B;  3ABV B;  2L0F A;  2ZCC A;  2JRI B;  3AV8 A;  4MGI E;  3APC A;  1F0Z A;  1WMH B;  1IYF A;  1XLP A;  2MX2 A;  2QSD A;  3ALB A;  2ZW0 A;  2IGH A;  2DEN B;  4MDK E;  1WM3 A;  4MM3 B;  2LGI A;  1HTO A;  4WJN A;  1HTQ A;  4WWN A;  2GBN A;  1C4A A;  5HKH A;  1IUE A;  4ICV A;  1ZUD 2;  2FNJ B;  1JWA D;  2ZEQ A;  1PGA A;  3TJP A;  2RPQ A;  3T3N A;  4DXA B;  2KN4 A;  5JZE B;  1FD6 A;  4ZRK A;  3VAW A;  4MAC A;  1C78 A;  3Q2A C;  1YMH E;  1V49 A;  4HJG E;  1WX7 A;  2RSU A;  5AZG A;  4AS1 A;  3ZXR A;  2KC2 A;  3ZIM A;  1OQR A;  1ZPS A;  2MQJ A;  3VHT C;  1L2N A;  3RFZ B;  2PE6 B;  3MFG A;  2MWS B;  2MCN B;  2QHO A;  3TMP B;  3ZQ4 A;  4ICU A;  3NHE B;  2CJN A;  2LJ5 A;  3P4P B;  1TZO A;  2UWQ A;  1EWC A;  4P1B C;  1L7Y A;  2KAC A;  4P7I A;  2KTF A;  3N30 A;  4YSX B;  2M0X A;  2MJE A;  4DXF A;  2KJH B;  4A8X C;  3FAH A;  2KD0 A;  1AW7 A;  5CHF A;  2G9H D;  3VFK A;  1F2R C;  2K6Q A;  2PJH A;  2KJR A;  3GB1 A;  3H8H A;  2OJR A;  2WXF A;  2WXP A;  5TR5 A;  4K81 A;  4RGT A;  3QX1 A;  3QC8 B;  1J8C A;  3GZN I;  3OAW A;  1VZ8 A;  3CF6 E;  4DHJ B;  3AE9 B;  2BB6 A;  3VTU A;  1HA5 A;  3BWU D;  2KKC A;  1WWT A;  2W54 A;  1MI0 A;  1BXT A;  2N1V A;  1HEZ E;  4XE0 A;  1ENF A;  3WCQ A;  1PDX A;  1Z2M A;  1F1H A;  3N1Y C;  3RUI B;  3E56 A;  4PYU A;  4DQO C;  1FRR A;  3PLU A;  1FM0 D;  2O2V B;  2KWD A;  3AE8 B;  2LHE A;  3SR6 A;  2IY0 B;  1WJU A;  1WZ0 A;  3N1Z C;  1J19 A;  2MBQ A;  1DOI A;  2I2Y A;  2GLS A;  3P2B A;  2D11 A;  2HTH A;  3L08 A;  4K1R B;  2R61 A;  3WAL A;  1E7V A;  4S17 A;  2ZNV B;  1F52 A;  1JAL A;  2BKF A;  2IPK D;  4LNF A;  4EUT A;  2KFK A;  4G0N B;  2ZZP B;  1NI3 A;  1HZ6 A;  3KWV A;  5TSS A;  2XN9 C;  1A5R A;  3SHQ A;  2FCQ A;  1WGH A;  1TTN A;  3HVD A;  1MVK A;  2LHD A;  2WXQ A;  2BYE A;  4KZC A;  1V97 A;  2CKH B;  3RYT A;  2MJ3 A;  2JWU A;  5DPT A;  4EKU A;  4KX6 B;  3VQI A;  4LLG M;  2DZJ A;  2EKE C;  3R3M A;  4ITK A;  3DBH B;  3A4R A;  3R7R A;  1QLB B;  4E71 A;  3VUW A;  2L83 A;  2KTR A;  1YX5 B;  4P16 A;  2WWZ A;  2KYW A;  3ZDM C;  1MG8 A;  2JPH A;  3V6C B;  4AJY B;  2KDI A;  4KGR A;  5DPR A;  2AWT A;  5EE9 A;  2LXA A;  2KC1 A;  2ONQ A;  3DDC B;  4YXD B;  1J7A A;  1SIJ A;  2K8C A;  3RUL A;  1SE9 A;  5HFY A;  4ZYS A;  2ACZ B;  3L54 A;  3V3X A;  2JSV X;  1MHH E;  2BW2 A;  2OOB B;  2PW9 A;  2BPS A;  1JWS D;  1RFA A;  2HD5 B;  1YNT E;  3UIN B;  4I6P A;  3AU4 A;  3NVY A;  4K7W A;  3AEE B;  1E5W A;  3AE1 B;  4ZRJ A;  3PT2 B;  1I7H A;  2XK5 B;  4RM8 A;  4IWQ A;  4JGH B;  4YTN B;  3FKY A;  1OFF A;  1EF5 A;  3GOE A;  1TS4 A;  3KQ4 A;  4ASW C;  2V9H A;  2H89 B;  3AN1 A;  3D32 A;  1OQY A;  3UQA A;  3ML8 A;  1WGY A;  1WFY A;  5IP4 D;  1VJK A;  1LQB A;  4LNN A;  2O6V B;  1HZ5 A;  1WGG A;  3NRZ A;  4GB9 A;  1CJE A;  3AEC B;  1LO5 D;  2KAN A;  2WXI A;  4WIP A;  3ZNI D;  3P42 A;  2BS4 B;  3Q3J A;  4Q2J A;  2H88 B;  3B0A A;  4C7Y A;  2VRR B;  4MH0 E;  1E9M A;  1E0Z A;  3CMM B;  1GG3 A;  4AQ7 A;  2N7E A;  2WNM A;  5I4D A;  1SGH A;  1TZ1 A;  3QCA A;  5EE3 A;  3BII D;  2K6D B;  1F2R I;  4GDL B;  2LEK A;  4GN1 A;  1LGR A;  4ANW A;  2GOW A;  3PVL A;  1I35 A;  1EO6 A;  2JVC A;  1ZDX A;  3UF8 A;  2PLP A;  1ROE A;  3C0R B;  4W9E A;  3V6E B;  3ZKJ C;  3K9O B;  4FHJ A;  2K8B A;  4XX5 A;  4GDK B;  3PSE B;  3ZTD A;  1QOA A;  4IM2 A;  3NVZ A;  2L0T A;  4II3 B;  5FR6 A;  3A33 B;  4HDO A;  5BMI A;  1IBX B;  2IND C;  3LXF A;  2WXJ A; 
#chains in the Genus database with same CATH homology
 2CJO A;  3TEW A;  3B2F A;  3IXS A;  4A90 A;  1FFU A;  1FNU A;  1WRI A;  4YSY B;  2N9L A;  2IJ0 A;  2M0A A;  1FFV A;  3L4P A;  1STE A;  2JXT A;  5H92 C;  5FK9 C;  1D5Z C;  1YQ3 B;  4B0M A;  1GPX A;  2OHF A;  3AE6 B;  1SXT A;  1KLU D;  4LK0 M;  1AN8 A;  1C4P A;  2WLB A;  2J53 A;  3NVW A;  1EM7 A;  1KLG D;  2ZW1 A;  1TKG A;  2CU3 A;  2IDY A;  2I38 A;  1ET9 A;  2JZP A;  5MPO A;  2JU6 X;  4ZHP A;  1PGB A;  2QJL A;  1K50 A;  3NZ3 A;  2BYT A;  2Z8L A;  1XCQ L;  4JX1 C;  3TEZ A;  2NMQ A;  4YTP B;  1R7S A;  1VLB A;  5H8Y E;  3ETR A;  3U52 E;  5T8I A;  1L0V B;  3AE4 B;  4N6E B;  3VR8 B;  1V1P A;  5C3J B;  4L1B A;  2BB5 A;  1E6E B;  1C76 A;  3FIL A;  1WXQ A;  3ZYY X;  4USA A;  5E6J A;  4A55 A;  1MHX A;  1TY2 A;  4XWT A;  2V3N A;  3PZ7 A;  4ZHO A;  3ABV B;  2AQ2 B;  1SB3 C;  2RDH A;  5BYQ A;  1YJJ A;  2WXN A;  4OHJ A;  3AV8 A;  1DYQ A;  3VR9 B;  4EE2 A;  1F0Z A;  1XLP A;  2QSD A;  3AE5 B;  2LFI A;  3P4Q B;  4OZC A;  2ZW0 A;  2IGH A;  3P4S B;  1C4C A;  4MM3 B;  1QIL A;  2LGI A;  2G1E A;  2WXR A;  1PGX A;  1C77 A;  1C4A A;  3KWL A;  4YSZ B;  1QOB A;  1FO4 A;  1IUE A;  4NAW B;  1RYJ A;  2X38 A;  4YTM B;  1T3Q A;  1V1P B;  1ZUD 2;  2Y5P A;  1FRD A;  2J52 A;  3FIL B;  4UDU C;  2ON8 A;  1NEN B;  3I57 A;  3NVV A;  5BMH A;  4D2K A;  1XLO A;  1JWA D;  3NS1 A;  1IGC A;  1PGA A;  4TQ1 A;  2HDE A;  2RMM A;  4ZRQ A;  1TKE A;  1XLN A;  3AED B;  3I9V 1;  3T3N A;  2KN4 A;  4OVZ A;  3P4R B;  1FD6 A;  3BVM A;  4ZRP A;  2WXH A;  5BYS A;  4RF1 A;  1GB4 A;  2D5G A;  3RPF C;  1ET6 A;  1FCL A;  1TS2 A;  1MPE A;  4KKJ A;  1NEK B;  4KGS A;  4MAC A;  4PT5 A;  2L1A A;  2QEJ C;  2KDM A;  4JPS A;  5FR3 A;  1C78 A;  1YN3 A;  3C8Y A;  3TUO A;  1YMH E;  2GI9 A;  4HJG E;  1TS3 A;  4AS1 A;  3BK2 A;  1SF0 A;  1VDV A;  3TEY A;  1VRA B;  5AUI A;  3DWG C;  3ZJU A;  1KTK A;  4IDI A;  4WUR A;  1OQR A;  1XO3 A;  2JX5 A;  1ZPS A;  4B0E A;  3AE3 B;  1UWX A;  1TS5 A;  4JE3 B;  3RFZ B;  1E7P B;  4NZL B;  5HG2 A;  3GP7 A;  3R2I A;  3B2G A;  2DYM A;  4WAF A;  3URY A;  2E3T A;  1ZOY B;  2WU2 B;  2PKO A;  1KRH A;  3AMZ A;  3KLS X;  3MFG A;  2WDR B;  1VZ7 A;  4ZOH C;  3SFD B;  3E9S A;  4HRS A;  3ZQ4 A;  4MT5 A;  3R8B A;  2CJN A;  3SFE B;  3BYY B;  3P4P B;  1TZO A;  3W9C B;  2WP9 B;  1EWC A;  4KGT A;  3AEB B;  2M56 B;  2MH7 A;  4MH8 A;  5BMG A;  1SJH D;  2KAC A;  2QIE B;  3LYY A;  4YSX B;  1P7F A;  4RF0 A;  2MJE A;  5HI1 A;  4N59 A;  5D3D A;  4DXF A;  4A8X C;  3FAH A;  3BVG A;  5G5G A;  1AW7 A;  1SE4 A;  1OQQ A;  1CQV A;  1RWS A;  2G9H D;  1F2R C;  4OZB A;  4HKQ A;  1JWB D;  2EEL A;  3AE2 B;  3GB1 A;  1Y56 A;  3H8H A;  1D4B A;  3EA6 A;  2WXF A;  2WXP A;  2Y5C A;  1FXI A;  2NTS A;  4R3D A;  3NUH B;  5BYR A;  3W2D A;  4RGT A;  1ZXI A;  3Q69 A;  1CZP A;  1J7C A;  1N63 A;  4C80 A;  2BS3 B;  1T5X D;  5D3I B;  3IAS 1;  2BS2 B;  2WXM A;  1GAQ B;  1JML A;  1VZ8 A;  2BBC A;  1DOY A;  1NYQ A;  4US9 A;  3U4E G;  4A6Q A;  2PVG C;  1SE2 A;  2WXG A;  3AE9 B;  2BB6 A;  1KF6 B;  3O13 A;  1HA5 A;  4RH6 A;  4YWG G;  3BWU D;  2WDQ B;  4JWU C;  4OW0 A;  4RGN A;  3W5U B;  1SEB D;  3HVZ A;  1ACC A;  1SE3 A;  2GB1 A;  2WXK A;  1WWT A;  4WWM A;  1B1Z A;  2W54 A;  1C9F A;  1MI0 A;  1FXA A;  2BTE A;  3AEA B;  1BXT A;  3AM9 A;  4IKG A;  1XEE A;  3AB5 A;  1HEZ E;  4XE0 A;  3Q8B A;  1ENF A;  1FNW A;  2VZK D;  1FIQ A;  1ESF A;  2W3S A;  4OZA A;  1P7E A;  2EKI A;  3WCQ A;  1PDX A;  1IBX B;  5JXV A;  1L0Y B;  2YEP F;  3E56 A;  1BML C;  3N9Y C;  4DQO C;  1GOZ A;  2PIA A;  2L32 A;  3VRA B;  1FRR A;  1UUP A;  2INP E;  1ZE3 D;  2IGG A;  2Q5W D;  5C2T B;  1FM0 D;  3FC4 A;  2KWD A;  3AE8 B;  2LHE A;  2VZK B;  3SR6 A;  4H2A A;  1I4G A;  3SEB A;  3BYT B;  3ZJV A;  1DOX A;  2LJI A;  2OED A;  2N7J A;  1A70 A;  4C7Z A;  1CK1 A;  1DOI A;  2I2Y A;  2J42 A;  1KH0 A;  1ZDV A;  3AEG B;  1EWY C;  1F77 A;  3Q8F A;  5AUK A;  1YN5 A;  2R61 A;  4YT0 B;  2M19 A;  4M0W A;  1EU4 A;  3EGR A;  1ZXH A;  1L5P A;  1JAL A;  2N9K A;  2IPK D;  2W55 A;  2WS3 B;  1AYF A;  1VR9 A;  2SEB D;  4L2Y A;  1NI3 A;  2K5P A;  1HZ6 A;  2XNA C;  3B9J A;  1FEH A;  3KWV A;  5TSS A;  2XN9 C;  1IBX A;  3CWI A;  1FNV A;  1N5W A;  1ZP0 B;  4XWW A;  3HVD A;  2RDG A;  1MVK A;  2B76 B;  1JCK B;  1DGJ A;  2LHD A;  2V4I B;  2WXQ A;  3IT6 B;  4REZ A;  2FBW B;  1QKZ A;  1TKY A;  1V97 A;  3Q8C A;  1HQR D;  2K9X A;  3VRB B;  3U7Z A;  1FMA D;  2WQY B;  4CQN A;  1I4X A;  1VZ6 A;  2MJ3 A;  2JWU A;  1QQR A;  1I4Q A;  4XDD A;  1NVI D;  2JQR B;  1XF5 L;  5LNK 1;  4NAM A;  1QOG A;  4KX6 B;  3VQI A;  2QIL A;  4LLG M;  2DWQ A;  2W82 A;  3J9C A;  4RGO S;  4ITK A;  3MP9 A;  1QLB B;  5EE0 A;  5HHD G;  2Y3A A;  1SSN A;  3Q8A A;  3UI3 A;  2WDV B;  2K22 A;  1SJE D;  2L83 A;  4HRO A;  4P16 A;  3MHZ A;  3V05 A;  1N5X A;  4ARC A;  5G5H A;  3DWM A;  2DBY A;  1V1O A;  2LUM A;  2TSS A;  4KGR A;  3IT4 B;  5EE9 A;  1IGD A;  2AX5 A;  2WU5 B;  4YXD B;  2ONQ A;  3R2T A;  1J7A A;  1SIJ A;  2YEP B;  1YQ4 B;  1N60 A;  4O1N A;  1KFY B;  1K53 A;  1RM6 C;  3BVZ A;  5HFY A;  3U2S C;  4ZYS A;  1XXG A;  2ACZ B;  1WYG A;  1D6E C;  3HRD D;  1YN4 A;  3BZD B;  2JSV X;  2JYE A;  1FCC C;  4HEA 1;  3V3X A;  1C79 A;  1V8C A;  3ZGZ A;  3PO0 A;  4XDC A;  1MHH E;  2IGD A;  2BW2 A;  3MC0 B;  2PW9 A;  1I4R A;  1K51 A;  2PTL A;  3W1S A;  1JWS D;  2AQ1 B;  2AQ3 B;  4RGM A;  3EUB 2;  4RFB A;  1YNT E;  3CIR B;  3P1M A;  2FUG 1;  3MJ5 A;  1NYR A;  3TSS A;  3NVY A;  1TY0 A;  1UGJ A;  1XCT L;  3PZ8 A;  3AEE B;  1TJE A;  3AE1 B;  4NJC A;  1D5M C;  1JWU D;  1HXY D;  1I7H A;  4YTN B;  1L0X B;  1I4P A;  4TQ0 A;  4C56 C;  1OFF A;  1L4D B;  2LMC A;  1TS4 A;  4ARI A;  2K0P A;  1PYW D;  3KQ4 A;  2PVO D;  2H89 B;  1JW9 D;  3AN1 A;  1QF6 A;  1JRO A;  2JYT A;  1N61 A;  4FXC A;  1L6V A;  4WH4 A;  1J7B A;  4US8 A;  3P63 A;  2L52 A;  1Q10 A;  2DYO A;  1UWM A;  4RNA A;  3IAM 1;  1JWM D;  1VJK A;  2E6X A;  2HTM E;  3ZJT A;  3BK1 A;  1TYG B;  1HZ5 A;  2V0G A;  3AEF B;  3NRZ A;  2FE8 A;  1K52 A;  1CJE A;  2RPV A;  2KQ4 X;  3AEC B;  1LO5 D;  2WXI A;  4WIP A;  3TEX A;  4RCO A;  2INN E;  2SAK A;  1D5X C;  2N0S B;  3P42 A;  2BS4 B;  1B9R A;  4Q2J A;  2H88 B;  3OWE B;  1M4V A;  1WSP A;  2BT6 A;  4TSS A;  4C7Y A;  4DXG A;  3T3O A;  2DLB A;  1E9M A;  2GRI A;  4HKZ E;  5D7G A;  2WXL A;  1E0Z A;  5FKA C;  1JQ4 A;  1L6U A;  3Q8E A;  3W5V B;  1PUT A;  4AQ7 A;  1RFK A;  2WNM A;  5I4D A;  1E10 A;  2MJD A;  2V3P A;  3LB8 C;  3BII D;  5EE3 A;  1WGK A;  1F2R I;  3GS2 A;  4GDL B;  2LEK A;  1GB1 A;  2ICI A;  4JWS C;  3HUI A;  1QT9 A;  2W3R A;  1PFD A;  2J4X A;  1L4Z B;  4GLS C;  1ZDX A;  2QMT A;  4LTU A;  1QOF A;  2PLP A;  3AH7 A;  1ROE A;  4IOI E;  5EE1 A;  2MEK A;  4A9A A;  1UNS A;  1EU3 A;  1AWD A;  1YJI A;  1T6B X;  3AE7 B;  1XLQ A;  4GDK B;  5GXG B;  4L23 A;  4KKI A;  2KMM A;  1QOA A;  3NVZ A;  2WXO A;  4WQM A;  1I4H A;  2PMV A;  4TMA B;  4P6V F;  2K3U A;  1BUI C;  1JRP A;  2NTT A;  3LXF A;  4N58 A;  1N62 A;  5BMI A;  2KAJ A;  4J3O D;  1SBB B;  2WXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...