2FCSA

X-ray crystal structure of a chemically synthesized [l-gln35]ubiquitin with a cubic space group
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEQIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ubiquitin
publication title Dissecting the energetics of protein alpha-helix C-cap termination through chemical protein synthesis.
pubmed doi rcsb
total genus 21
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fcsA00
1H4RA 2BF8B 2G4DB 3U7DA 2KHWB 4WAAA 3B1LX 5DPWA 3QA8A 4GU2A 2JF5A 2MBHA 4NAWB 2IO0B 3ZNHB 5J17A 2FCSA 2A5UA 2KWUB 1RLFA 3PHWB 2LXAA 3BY4B 2KMAA 3IBEA 2LGDA 3MTNB 3PV1A 2EKEC 4K1RB 3ZKJC 4G3XB 1WMHA 4WJPA 3IVFA 1MG8A 2KX0A 4HWIB 3A4RA 2KDIA 2V4LA 2C7MB 2AWTA 4GDLB 3PS6A 1C1YB 2IZVB 4I6LB 2LRWA 4II3B 1G6JA 2MA9B 4MEMA 2ZJDA 3ALBA 3DBHI 3KW5B 3NOBA 4MGYE 1RFAA 1E7UA 2JRIB 2N1VA 3VTVA 1R4NI 4HK2A 1WXAA 3DCGA 1V6EA 3IFWB 4ZYNA 3ZRFA 4HCPB 5E6OA 4EOYA 3NZSA 4HVBA 1GG3A 3VFKA 5C23A 4OVUA 1IPGA 3ML9A 2JWZA 1M94A 1WJNA 2NS5A 3ZRCA 2NCNA 5LXIB 3CSFA 3SU8X 2L3ZA 4HPLB 1Z2MA 2R2OA 2LJ5A 4HXDA 2KWCA 2GBJA 3ZNID 4A3OA 1WMHB 5L95C 1EF1A 2RD0A 5IA7A 2DYBA 2KFKA 5IAAC 4M0WB 2C9WB 2KANA 3B08A 4G50A 4MGZE 3PLUA 4BOSC 2MBEA 2LZ6A 4ICVA 4XC2A 3VDZA 1NDDA 3ONSA 4HDQA 1WXSA 3PTFC 5LLIA 2MX2A 2PPHA 4ANVA 1WE6A 3M63B 4TQ1A 2MBOA 1BT0A 1GNUA 2MBBB 1Y8RC 2W9NA 4WWNA 2K1FA 2BGFA 2KFJA 1EF5A 2LRUA 3NS8A 1EO6A 2BWES 4IC7B 2A4ZA 3H9DA 5HKHA 4NJ6A 4RMAA 4CYEA 4PS8A 1WJUA 2AL3A 2MP2B 4N9F4 2G3QB 2L0FA 4URKA 2M4NA 3R3MA 1WGRA 2N1WA 1I42A 2ZNVB 1Q1OA 5D7GA 1J19A 3AXCA 4AUQC 1U4AA 3T8MA 3DPDA 3VTUA 3WAMA 4EZKA 2K39A 2DYMA 1A5RA 5E6NA 2KFKB 3L13A 3VHTC 2ZVNA 4FBJB 2FIFA 2KWVB 1D3ZA 4W9LA 2YVCA 4FLHA 4JL9A 2UYZB 2YLMA 3GZNI 3H7SA 3NZUA 1AARA 1V5TA 4EZJA 3DBSA 2GMIC 2J0MA 3W1SA 4EUTA 1P9DU 2DAFA 1HE8A 2V1YA 4BOZB 2MQJA 4KZCA 2KMCA 1V2YA 1WJ4A 4EZLA 4ASWC 3TJPA 5G55A 4DBGA 1V49A 2DENB 2Z59B 3QCAA 4W9HA 3PRZA 4ZRKA 1WJ6A 5CTRC 2IY0B 2BYVE 2NBUA 4GN1A 2UWQA 4DHZB 2KXJA 4GIVA 3ZNGC 2JXXA 3CF6E 1OEYJ 2RGFA 3H7PA 1WX9A 2MSED 4LCDE 1V9JA 1XD3B 4JGHB 3RZWC 3H6NA 3A4SC 1TBEA 2N9XA 4GMVA 2WYQA 4TUUA 1E8WA 2KJ6A 3JVZX 3N30A 1C3TA 4I6PA 1TGZB 1YIWA 2MCNB 3JSVA 4F1SA 4WWPA 3VAWA 4J6IA 1GJZA 3EFUA 2EMTA 4MGKE 3R7RA 3RUIB 4E71A 2JY6A 3PRMB 1R4MI 2K6QA 3DBRI 3L54A 4BBNC 2KJHB 4A20A 1XQQA 1Z5SB 3K9OB 3APCA 5DPRA 2DHZA 4GXBA 4RM9A 3KH0A 2WX0A 2FCNA 3APDA 4IW0A 2KTRB 1J8CA 2CHWA 4JLCA 3U8ZA 2L8JA 4GGQA 1LFDA 3DVNV 3EECA 4NJ7A 5CHFA 4WWOA 2GBMA 1ISNA 1LXDA 3H7PB 1ZW7A 5CX3A 3QJZA 2J0JA 2LUEA 5EDSA 3QWZB 3V62A 1WGHA 1P1AA 1LQBA 1YD8U 2KN5A 3DVGX 3GOEA 3KYDD 4NPNA 3SDLC 2ASQA 2KQSA 1WI0A 3I3TB 1CMXB 2ZPNA 3JSVB 3O65B 3CSTA 2N7EA 4IWPA 4W9IA 4DHZE 1UGMA 5TR5A 2GBRA 2KD0A 2L7RA 2ZCBA 4DHJB 4BKGA 2JT4B 2BYEA 2OOBB 2BKFA 3PRPB 4W9EA 4WJOA 3VH3B 4ZRJA 3UINB 3APFA 4W9DA 3VUWA 4HLEA 3PT2B 1GC6A 4HCNB 2WDTB 1WM3A 2D10A 3M62B 2IO1B 3MJWA 3WAPA 4AWJA 4DK5A 4G11A 2Y5BB 5JHAA 2DZMA 3IHPC 4K7UA 3TCAA 1V81A 2O2VA 3QARA 1KM7A 3QIJA 2FAZA 4IM3A 3KYCD 3WIMA 3RCZA 2KKCA 2EMSA 4FJVB 4E3CA 1YQBA 3L17A 2DZIA 5AZFA 3RT3B 1IYFA 2KK8A 3P2BA 5D2MB 3M3JA 2C7HA 4P7IA 2DZKA 2VRRB 3UF8A 1H8CA 2N7DA 4DHJD 3TMPB 2L76A 1WM2A 3UQBA 4ANUA 3QHTA 1IP9A 4WJQA 2KX3A 3NY5A 3RYTA 3VTWA 4FULA 4KSLC 3ZUNA 2K8CA 3PREA 4GDKA 1RRBA 2AEHA 2ZZPB 1T0YA 2O2VB 1P0RA 1KLVA 2CHZA 2K8HA 5JHBA 4JIOU 1E8XA 4M8NA 2NBVB 2N9EB 3EC8A 2KLGA 3TL5A 1ZKHA 1OEYA 2WWZA 4KZ0A 3LJ3A 5KHOA 2ZEQA 3VUYA 2XK5A 3ZIMA 4MSMB 1WF9A 3DDCB 1SIFA 2V3SA 3ZLZA 1S3SG 4IUMB 4OVVA 2CR5A 2LASA 4B95A 2M0XA 1JRUA 2NVUI 4MSQB 2KJRA 5CHWA 2LGYA 4LJPB 4HPMB 3ZTCA 2HTHA 3AULA 2AYOB 4XZ4A 2LVOA 3L16A 2BKRB 2OJRA 2O6VA 3M95A 2HD5B 3ML8A 4E74A 1WZ0A 2NBWB 1YJ1A 3DOWA 2ZNVC 4GDKB 4WQOB 3X23A 3L10B 1L2NA 3QAQA 2HJ8A 1YX5B 3QQ8B 4W9KA 4BKTA 3A1QA 2JUOA 3B0AA 2GBNA 4LJOB 2KNBA 3A33B 4LDTB 3V6CB 2DZJA 4DDGD 2JPHA 4F8CB 5GMVA 5J18A 1F9JA 1EUVB 1LM8B 4W9JA 3QK0A 2XK5B 4W9CA 3ZDMC 4BKSA 2C7NB 3DQVA 4CO7A 3N32A 3WA0A 3OJ4B 1TTNA 3DBLI 2D11A 1QZEA 2K6DB 1P3QU 2K25A 4K7WA 5E6PA 1WH3A 2C5LC 5KHQA 1S1QB 3W1YA 2LD9A 4EEWA 4ANWA 2O6VB 3PSEB 2D07B 3OLMD 3VQIA 4FADA 1WGDA 3R66C 2MWSB 3HM6X 3A9JA 2M1MA 4PS3A 4XX5A 2FCMA 3A1QB 2XBBC 3WAOA 4NY0A 4LDTD 1V80A 4ZRIA 1NBFC 3RD2A 3ZTDA 1UH6A 4KDIC 3LDZE 2NR2A 4X57B 4PYUA 2C60A 4TKNA 4B6WA 1UD7A 5G2NA 1WYWB 1PQSA 3W1SC 2FIDA 3L0WB 4PYZA 4AP4C 3D32A 2CHXA 2LVQA 1WR1A 2N4FA 3HHMA 4II2B 3Q3FA 4KSKC 3V61A 1X1MA 4NQKE 1RAXA 2BWFA 3KUDB 2JVCA 4MGIE 4NQLB 1Q5WB 2IBIB 3L08A 1GC7A 4IG7B 4KIKA 4HDOA 5C1ZA 3IG3A 4DDID 2L0TA 3A9KA 3OJ3A 3QX1A 3MHSD 2RR9A 4BVUC 4AJYB 3QC8B 5FR6A 3KUZA 3ZDTA 1WXVA 2O6VD 2G45B 5DPTA 1OQYA 2M8SA 4NNJB 2FNJB 3A9JB 3BINA 2LGXA 4JQWC 2KVRA 4MJSA 3T9LA 3V6EB 3N3KB 3KVFB 3VH4B 1WY8A 2D2QA 2G4SA 4W9GA 1E7VA 3RZFA 4ANXA 1WFYA 2HE7A 1NI2A 4RM8A 3PPAA 3AU5A 4KV2A 3EHVA 3Q3JA 3VXWA 4FJZA 5DCNA 1WGYA 2KQ7A 3WALA 1E5WA 1WXMA 3DVGY 4HJKA 1YX6B 3TIXA 2L05A 4BKSD 2I1JA 3K9PB 2L00B 2CS4A 1VCBA 5J2RA 2FCQA 2Z0EB 2PJHA 5JZEB 2MP2A 5DPSA 2ZVOA 4KIKB 1WX8A 3PLVA 1WX7A 2GBKA 3A9KB 4G0NB 4TQ0A 1WR6E 1SE9A 3U30A 2KDBA 2RSUA 3UIPB 3ZNZB 4BBNF 4FHJA 4MH0E 5AZGA 3UQAA 5BO4B 4F7ZA 3H1UA 4MJSB 2GOWA 2KO3A 4EFOA 1ZGUB 2CU1A 2RPQA 5LXHA 4WJNA 2D3GA 2B3AA 4DXAB 4ICUA 3ENEA 3SHQA 2KC1A 2AL6A 3ZO5B 4AJWA 3JYUA 3PZDA 3ECIA 1UBQA 2LXCA 3PVLA 4YL8A 1FXTB 1OGWA 2ZPYA 1V5OA 4IWQA 2JZZA 2DAJA 2KLCA 5L83A 4A3PA 1WRDB 2KOXA 4GOCA 3X0WA 1L7YA 4GB9A 1VD2A 2LVPA 3HIZA 2LI5A 4DWFA 2I1KA 4MDKE 1I35A 2KDFB 1J0GA 3ZW3A 1KJTA 4IM2A 1OTRB 3DVNU 1XT9B 2IYDB 4FHKA 4K7SA 1WE7A 2NPTA 1GUAB 3AI5A 3HK0A 2J7QB 4MELA 4AOFA 1UBIA 2IO3B 3KUCB 1E8YA 5AEKB 2REXA 2PEAA 4MM3A 2QHOA 4GSWA 4B9KA 2WX1A 1TZ1A 2KZRA 3OAWA 1V86A 3RULA 2IO2B 1SGHA 2BPSA 2MW5A 2PE9A 1WZ3A 4I6NB 4EKUA 2JZ3B 5JH5C 2K8BA 2JRHA 3TBLD 2KDEB 3CMMB 1UZXB 3C0RB 2DX5B 4BFRA 2MLBA 2N9PC 4FN2A 4NAWA 1WIAA 2IY1B 2J0KA 2MRPA 2M17A 4K81A 2MBQA 2R2QA 2KTRA 3UIOB 4FA6A 3JW0X 3VVWB 4CHKA 3NHEB 4KVGB 1E8ZA 2LWPA 1K8RB 1UELA 1Q0WB 3PGEA 4IWOA 3AU4A 5D94A 1P98A 2PE6B 2FUHB 2NPTB 5D6JB 3WANA 3V60A 4FJYA 5AZHA 5CHVC 4GDLA 3SD5A 4W9FA 4M8MA 1KOTA 1WGGA 4IM0A 3PHXB 1E90A 2XEWA 2BYFA 3R7QA 3S2AA 4PS7A 2DYOA 4KDLB 2KTFA 3VUXA 4ZDVA 4TV3A 2KC2A 2Z0DB 3UGBB 2ZCCA 3ZVVA 3HM3A 2CKHB
chains in the Genus database with same CATH superfamily
1H4RA 2NTSA 4JE3B 4O1NA 5DPWA 2UU7A 4GU2A 4PK1A 4MT5A 4YXDB 2KWUB 2LGDA 3N9YC 4G3XB 5BMIA 2HJ1A 2KX0A 3W2DA 1MHXA 2MH7A 2AWTA 3PS6A 4TSSA 2OHFA 3ALBA 1SF0A 3IXSA 2N1VA 1R4NI 4HK2A 4C80A 3TEWA 2W54A 5E6OA 3EA6A 1WYGA 3NZSA 1GG3A 1I4PA 3ZRCA 1SSNA 1FRRA 3P4SB 2GBJA 3ZNID 5L95C 2RD0A 4B0MA 2C9WB 5FK9C 3PLUA 4ICVA 4XC2A 3ONSA 1YMHE 4ANVA 1DOXA 4ZHPA 4DXGA 1EF5A 2LRUA 3I9V1 4YSXB 4IC7B 5HKHA 3N1ZC 4RMAA 1AWDA 3NVYA 4CYEA 4PS8A 1WJUA 2AL3A 4N9F4 4URKA 2K22A 3DPDA 1IGCA 1YN4A 2ZVNA 2KWVB 4FBJB 1D3ZA 3MC0B 4W9LA 1PUTA 1AARA 2MHJA 1UWMA 2BQQA 2GMIC 3RPFC 1UUPA 4RCOA 1I4GA 1PGAA 5H92C 3HRDD 4BOZB 1T5XD 2MJDA 3BVMA 4KGTA 4EZLA 5G55A 2DENB 3QCAA 4W9HA 3PRZA 1YNTE 1WJ6A 5CTRC 2BYVE 2UWQA 3RNEC 3BYTB 4GIVA 3ZNGC 1OEYJ 4R3DA 3H7PA 1WX9A 2MSED 1FXAA 2WGSA 1XD3B 1TBEA 1ZUD2 3W5VB 1E8WA 3U52E 4H2AA 4WWPA 3VAWA 1GJZA 2EMTA 1N5XA 3RUIB 1FNVA 2K6QA 2KJHB 4TMAB 4BZAA 3KH0A 1HZ5A 1D4BA 1L6UA 4C00A 4DQOC 2INCC 5CHFA 1AYFA 1K53A 3H7PB 3LB8C 1ZDVA 1NVID 3DVGX 2KN5A 2QEJC 2ASQA 3I3TB 4IWPA 2N7EA 4W9IA 1R4MB 4P6VF 5TR5A 2KD0A 2L7RA 2WDVB 3DBRB 2JT4B 2BYEA 4LNIA 4CQNA 2V4IB 3VH3B 4JWSC 3VUWA 3PT2B 1UF0A 3M62B 1F77A 1UGJA 2DZMA 3IHPC 3TCAA 2WNMA 3FC4A 3WIMA 2EMSA 2YEPF 2AQ2B 2WU2B 3RT3B 2KK8A 3P2BA 4WIPA 4ZRQA 2C7HA 1HZ6A 5FR3A 1ZDXA 4P7IA 1PGXA 3TMPB 1WM2A 3ZQ4A 3QHTA 1IP9A 3KQ4A 4IKGA 2FBWB 4HRSA 1P0RA 2WU5B 5G5HA 2EELA 2WWZA 2BS2B 5KHOA 4QAYA 4ZOHC 3VUYA 3ZIMA 4MSMB 1WF9A 3GB1A 5BYRA 4OVVA 3NJTA 1MG4A 2M0XA 2I38A 2LGYA 2HTHA 3AULA 1ZXIA 2AYOB 2GI9A 1L6VA 2QILA 2IDYA 3P42A 1WZ0A 4XWWA 4ZRPA 4NJCA 1R7SA 3CWIA 5BYQA 2LHEA 3AN1A 2JUOA 3B0AA 1JWAD 1TKGA 4LJOB 4LDTB 2DZJA 4DDGD 3Q8EA 1LM8B 1CQVA 3P4RB 4W9CA 3BYYB 2M0AA 5IOIA 2B76B 3AEGB 1QZEA 2C5LC 3W1YA 4EEWA 2N9KA 3VQIA 1JWUD 3R66C 3WAOA 2FCMA 1VZ7A 1UWXA 4LDTD 1UH6A 4X57B 2NR2A 1SE4A 1GB4A 2FIDA 2LVQA 3BVZA 3Q3FA 2RPVA 2JSVX 1KLUD 5HFYA 1K52A 2JVCA 4DDID 1XEEA 3A9KA 3AEAB 5D3DA 4AJYB 3QC8B 5FR6A 1UNSA 3KUZA 4B0EA 3V6EB 3KVFB 2D2QA 1N61A 2G4SA 1P7EA 2HE7A 3Q3OC 1YJIA 4FJZA 5DCNA 2KQ7A 1E5WA 1YX6B 1TIFA 2I1JA 2NMQA 2L00B 2CS4A 2PJHA 5JZEB 1ENFA 5DPSA 1WX7A 3A9KB 1B1ZA 1SE9A 1L0VB 4BBNF 5AZGA 3H1UA 3I63C 4WJNA 2D3GA 4DXAB 3AEEB 1I4HA 2AL6A 1UBQA 4XDDA 2G1EA 1MPEA 1WRDB 2KOXA 2LVPA 1SBBB 1FO4A 5E6JA 4IM2A 1OTRB 3DVNU 4K7SA 1WE7A 3OG5A 2Q5WD 1E8YA 1QOGA 4KKIA 5LNK1 4MM3A 2QHOA 4GSWA 4B9KA 3OAWA 1V86A 2IO2B 1SGHA 1FRDA 1WZ3A 4JWUC 4I6NB 4EKUA 2V9HA 2J52A 3AE6B 4BFRA 1IUEA 1NYRA 4C4VA 1F2RI 4FN2A 4P1BC 2J0KA 2MRPA 2R2QA 2KTRA 3UIOB 4FA6A 2BB6A 3JW0X 3VVWB 1FEHA 1JROA 2LWPA 1UELA 2WXNA 5D6JB 4YSZB 1SE2A 5AZHA 4M8MA 4RNAA 5BMHA 4MM3B 2BYFA 3S2AA 4KDLB 2KTFA 3VUXA 2DNFA 1I4QA 3UGBB 1L0XB 4IOIE 4YTPB 3ZVVA 2G4DB 3U7DA 2KHWB 3B1LX 2WXIA 3U4EG 4C4VB 3C19A 3IT4B 5MPOA 2IO0B 5J17A 2FCSA 3NVWA 1RLFA 2LXAA 3NVZA 4YTMB 2KMAA 3IBEA 3MTNB 3ZGZA 3ZKJC 2KT7A 4XDCA 4WURA 4WJPA 1MG8A 3A4RA 2KDIA 2V4LA 3NZ3A 3OWEB 1YOVB 4MEMA 3NOBA 1E7UA 1RFAA 1XLNA 2JRIB 3VTVA 3DCGA 1V6EA 3ZRFA 4C56C 4HCPB 4YT0B 3VFKA 3IT6B 2JWZA 5EE3A 3ZJUA 3SU8X 2L3ZA 2R2OA 2LJ5A 4HXDA 1EF1A 1V8CA 5IA7A 3SFEB 3R2IA 1RWSA 2ICIA 2KMMA 1TS5A 4S17A 4LNFA 1R4NB 5TSSA 1NDDA 4HDQA 1QOBA 3PTFC 5LLIA 1DYQA 1JRPA 4TQ1A 1D6EC 3C8YA 1Y8RC 1XCQL 4S0RA 4WWNA 2Y3AA 3NS8A 2FE8A 1GOZA 2MP2B 2G3QB 2SAKA 3R3MA 1V97A 1I42A 1T6BX 2W3SA 5D7GA 1J19A 3AXCA 2SEBD 5HG2A 2JYTA 2FIFA 4FLHA 2YLMA 3GZNI 3R2TA 1V5TA 3VR9B 3DBSA 3W1SA 2K0PA 4EUTA 2DAFA 1MFWA 1HE8A 2V1YA 2MQJA 4KZCA 1V2YA 1WJ4A 2LJIA 4HJGE 1V49A 4ZRKA 1ZPSA 5EE0A 1E6EB 2JWUA 3LYYA 4GN1A 3CIRB 4DHZB 3Q2AC 4HROA 3CF6E 4L23A 1EWCA 4JGHB 5IN7A 4GMVA 2N9XA 2WYQA 2BW2A 3JVZX 4L2YA 3N30A 1C3TA 1B9RA 4F1SA 4MGKE 3R7RA 1TS4A 4E71A 1FNUA 3PRMB 3DHIC 1VZ6A 3DWGC 4ZHOA 4A20A 1XQQA 1Z5SB 2JX5A 3APCA 2DHZA 4GXBA 4RM9A 2D3BA 4US8A 1DGJA 2WX0A 4IW0A 4RH6A 2AX5A 1J8CA 3U8ZA 2BVCA 4GGQA 1LFDA 4NJ7A 1J7BA 1LXDA 2QIEB 3QJZA 1WGHA 5H8YE 3GOEA 3KYDD 2KQSA 1CMXB 3CSTA 1UGMA 4BKGA 2L32A 3TEXA 2WXLA 3APFA 4HCNB 2WDTB 1WM3A 3AV8A 2IO1B 5C2TB 2O2VA 4IM3A 1KM7A 3QIJA 2LFIA 4FXCA 3RCZA 1YQBA 2DWQA 2DZIA 1IYFA 2KVZA 2DZKA 3V05A 2N7DA 4ANUA 3Q3MC 3NY5A 1LGRA 1SB3C 1SJHD 1XF5L 2WLBA 4XGAB 1VRAB 1N62A 2WS3B 2O2VB 2JU6X 3ABVB 1KLVA 1I7HA 2NBVB 3EC8A 3TL5A 1ZKHA 1OEYA 4WQMA 4KZ0A 3RNGC 5GXGB 2RMMA 2WXPA 2V3SA 1F0ZA 4IUMB 1IBXA 3AEFB 4B95A 2KJRA 4YSYB 4LLGM 2JXTA 4HPMB 2PKOA 4E74A 2NBWB 4JX1C 1L2NA 1YN3A 1YX5B 5G5GA 1TYGB 3V6CB 1L5PA 3ZXVA 1F9JA 3IAM1 4ITKA 3MHZA 3DQVA 4CO7A 3V3XA 1F1HA 1IBXB 3OJ4B 3DBLI 2D11A 1SEBD 5E6PA 1WH3A 4PT5A 4ANWA 2V0GA 2MWSB 4C7ZA 4XX5A 4PS3A 4M01A 4NY0A 4HPPA 3RD2A 3ZTDA 4KDIC 4PYUA 4B6WA 5G2NA 3W1SC 4M00A 3D32A 2CHXA 2N4FA 2PVGC 1XCTL 3HHMA 2EKIA 3P4PB 4NQKE 2BWFA 3KUDB 4MACA 3ZDTA 1D5MC 5DPTA 2FNJB 3NUHB 2KVRA 2D5GA 2XN9C 1WY8A 3VRAB 4W9GA 2M19A 4ANXA 3RMKC 1WFYA 4RM8A 4KV2A 3VXWA 1WGYA 1WXMA 3DVGY 1TS2A 3TIXA 4ARCA 3PZ8A 4HKQA 4OVZA 5HI1A 2FCQA 4MH8A 1FM0D 2W3RA 3PLVA 2GBKA 3U30A 2RSUA 3ZNZB 4FHJA 1NI3A 4EFOA 1ZGUB 2CU1A 2RPQA 2B3AA 3SHQA 3AEDB 3FILA 2LMCA 2PLPA 2QCZA 3PVLA 4OZBA 1FXTB 1OGWA 2ZPYA 1CJEA 2IJ0A 1L4ZB 4IWQA 1QKZA 5L83A 4A3PA 4GOCA 1HTOA 4J3OD 2J4XA 4GB9A 1VD2A 3AE9B 1TKYA 3HIZA 1KLGD 2I1KA 2V3NA 4RGTA 1XLQA 2GB1A 4RGOS 3O13A 1FD6A 2IYDB 2NPTA 4AOFA 2IO3B 3KUCB 3URYA 2DLBA 1WSPA 3FILB 1TZ1A 2KZRA 2PW9A 1L0YB 3RULA 2MW5A 2QC8A 5JH5C 2K8BA 2JRHA 3TBLD 2KDEB 1UZXB 1MHHE 2HTME 2D3CA 2ZW0A 2K9XA 4IWOA 3AU4A 5T8IA 1P98A 2NPTB 4K3CA 4W9FA 2Z8LA 1RYJA 3EUB2 1JCKB 2XEWA 4PS7A 3TEYA 1FFVA 4DXFA 4ZDVA 3NG0A 3SFDB 2ZCCA 2WXRA 4YWGG 1HEZE 3E9SA 1ZXHA 2BTEA 4WAAA 1D5ZC 2JF5A 2J53A 2KAJA 3PHWB 3BY4B 3BK2A 3PV1A 2EKEC 4K1RB 1FXIA 1WMHA 4HWIB 1OQRA 3N20C 2WXFA 4M0WA 2BS3B 1C1YB 3ETRA 4US9A 2LRWA 3P1MA 4II3B 2ZJDA 3KW5B 2BS4B 4MGYE 3MC8A 3IFWB 2INNE 4HVBA 1IPGA 3ML9A 1M94A 1WJNA 1SXTA 1EM7A 1Z2MA 5EE1A 2H88B 4A3OA 1WMHB 3U7ZA 2DYBA 2KFKA 5IAAC 4M0WB 4MGZE 4BOSC 2LZ6A 3KWVA 1E7PB 1BUIC 3N1XC 3AEBB 1WE6A 4A9AA 2W9NA 2K1FA 2KFJA 3Q8AA 3ZYYX 2BWES 2A4ZA 3H9DA 1C4PA 1WGRA 1Q1OA 4AUQC 1QLBB 1QF6A 1U4AA 2K39A 2PMVA 2KFKB 3VHTC 2IGGA 2UYZB 3H7SA 5AUIA 4A8XC 4EZJA 5BMGA 3Q14C 4RF0A 3L4PA 1P9DU 1I4RA 4P1CC 4D2KA 1D5XC 1Q10A 1BMLC 2IY0B 2BT6A 1QILA 3RN9C 2RGFA 1JWSD 3GZNB 1V9JA 3RZWC 3H6NA 3A4SC 4M02A 4TUUA 4I6PA 1TGZB 1YIWA 1AW7A 2MCNB 1TT5B 1VLBA 3SEBA 2KQ4X 1OQQA 2JY6A 4WWMA 4A55A 2Y5CA 3K9OB 2X8XX 5DPRA 2ONQA 1MI0A 3APDA 2KTRB 2CHWA 3AECB 2L8JA 2N9LA 3DVNV 2MJEA 1ZW7A 1HXYD 5CX3A 2J0JA 2LUEA 3UI3A 5EDSA 5IO9A 1KH0A 1LQBA 4NPNA 3VRBB 3SDLC 1KFYB 1NEKB 3O65B 1E0ZA 4DHZE 2N0SB 1F2RC 2GBRA 5HHDG 2ZCBA 2OOBB 3Q6BA 3PZ7A 2BKFA 3PRPB 1N5WA 4W9EA 4WJOA 3UINB 2G9HD 3AE3B 1DOYA 3I57A 4DK5A 1J7AA 4G11A 4K7UA 3Q8CA 3QARA 2KKCA 3L17A 2H89B 3M3JA 1XXGA 2TSSA 2QJLA 3FKYA 1KRHA 3AB5A 4KSLC 1QOAA 3HVZA 1RRBA 2AEHA 1TKEA 4JIOU 1E8XA 4M8NA 1VZ8A 3LJ3A 2ZEQA 2XK5A 1V1OA 1L4DB 1S3SG 3NVVA 1FNWA 3IAS1 3W5UB 2CR5A 1JRUA 4MSQB 3MJ5A 2INDC 3RFZB 2LVOA 2RDGA 2BKRB 2OJRA 2O6VA 1WXQA 2HD5B 3ML8A 2YEPB 3QAQA 5EE9A 3A1QA 1SE3A 2HDEA 2JPHA 4F8CB 5GMVA 5J18A 4UDUC 2LUMA 4W9JA 1KF6B 3QK0A 2XK5B 3ZDMC 2C7NB 2V3PA 3WA0A 1KTKA 1TTNA 3J9CA 1P3QU 1TY0A 3T3NA 4XWTA 1QT9A 3AE7B 1S1QB 2LD9A 2O6VB 1WGDA 3NS1A 3HM6X 4KGSA 4XYCA 2M1MA 3A1QB 2K3UA 4ZRIA 1PYWD 3KWLA 1YQ3B 1UD7A 1FIQA 1WYWB 4BAXA 4AP4C 3L0WB 2DBYA 4L1BA 4II2B 4KSKC 3DBLB 2FUG1 5I4DA 3N1YC 1RAXA 1N6ZA 3U2SC 4MGIE 4NQLB 1Q5WB 3L08A 4IG7B 4KIKA 4HDOA 2L0TA 3QX1A 4BVUC 3MHSD 4NZLB 1WXVA 2O6VD 2G45B 1OQYA 4NNJB 4JQWC 2LGXA 1C77A 2PIAA 4MJSA 3N3KB 1CZPA 3RZFA 1NI2A 1WRIA 3AE1B 4OZCA 3WALA 4HJKA 5JXVA 2L05A 2KDMA 4HEA1 1VCBA 3AE2B 5J2RA 3RNBC 2Z0EB 3KLSX 2ZVOA 4KIKB 4G0NB 2WXHA 4F7ZA 1YQ4B 3DBHB 4MJSB 3ZJVA 1WGKA 3ENEA 2CJOA 3ZO5B 3JYUA 3ECIA 2JZZA 1QQRA 2DAJA 2KLCA 2WQYB 1GPXA 2KDFB 4AQ7A 1J0GA 3ZW3A 2WHIA 1XT9B 3TSSA 3AI5A 3HK0A 1UBIA 5AEKB 2REXA 2PEAA 2AQ1B 2M56B 2MEKA 2E6XA 1VJKA 1I4XA 5C3JB 3C0RB 2MLBA 2WDRB 4NAWA 1EU3A 1WIAA 2MBQA 1E8ZA 1K8RB 2PVOD 5D94A 2PE6B 3WANA 2FUHB 2WDQB 3V60A 4FJYA 4GDLA 3SD5A 4IM0A 1E90A 3R7QA 3BVGA 4TV3A 3R8BA 3HM3A 2IPKD 2CKHB 4KGRA 2LGSA 2BF8B 3QA8A 4NAWB 3ZNHB 2MBHA 2A5UA 1TY2A 2D3AA 3ZXRA 3SR6A 1OFFA 3ZJTA 3BK1A 4WAFA 3IVFA 2XNAC 2BBCA 3AM9A 2C7MB 4GDLB 4I6LB 3LXFA 2IZVB 1G6JA 4OZAA 1QOFA 4LTUA 2MA9B 1JW9D 3DBHI 2ON8A 1ACCA 2R61A 3AE5B 3T3OA 1WXAA 1ESFA 1FMAD 1PGBA 4XE0A 4ZYNA 4EOYA 4RGMA 2IGHA 2JZPA 5C23A 4OVUA 2L83A 2NS5A 3B9JA 5LXIB 2NCNA 3CSFA 3RNCC 1T0RC 5FKAC 4HPLB 1NYQA 1C79A 4IDIA 2KWCA 2WXMA 1ZE3D 2WXGA 2RDBC 1A70A 4C7YA 2KANA 3B08A 4G50A 2MBEA 3VDZA 1WXSA 2QMTA 2GLSA 2MX2A 2PPHA 3M63B 2MBOA 1BT0A 1GNUA 2MBBB 2JQRB 2BGFA 3DHGC 1EO6A 3RI7C 4NJ6A 2L0FA 2M4NA 4OW0A 2N1WA 1C78A 2ZNVB 4RF1A 3T8MA 1A5RA 3VTUA 3WAMA 4EZKA 2DYMA 5E6NA 3L13A 4N6EB 3RNAC 1CK1A 4LNOA 2YVCA 4JL9A 4WH4A 2LEKA 3GE8C 3NZUA 1DOIA 2J0MA 4OHJA 1J7CA 1MVKA 1IGDA 4GLSC 1M4VA 2KMCA 4AS1A 4ASWC 3TJPA 4DBGA 2Z59B 1FFUA 1HQRD 4HKZE 2NBUA 2KXJA 3AE8B 1MJDA 2JXXA 3MC9A 1SIJA 4EE2A 4LCDE 4USAA 1TZOA 1V1PA 2KJ6A 3Q69A 3AMZA 1PDXA 3JSVA 4KKJA 4J6IA 3EFUA 3P4QB 1R4MI 3DBRI 3L54A 4BBNC 1JMLA 4RGNA 4ARIA 2FCNA 2VZKB 4YTNB 3H8HA 4JLCA 1C4CA 1GAQB 3EECA 1K50A 4WWOA 2GBMA 1ISNA 1T0QC 2L52A 3QWZB 3V62A 1P1AA 1TS3A 1V1PB 2OEDA 1YD8U 1FCLA 1WI0A 3JSVB 2ZPNA 5IKCM 4DHJB 3BWUD 4LNNA 4ZRJA 1Y56A 4W9DA 4HLEA 3DHHC 1GC6A 1P7FA 1ET6A 2D10A 2IGDA 2W55A 3MJWA 3WAPA 4AWJA 2Y5BB 2VZKD 5JHAA 1V81A 2FAZA 3KYCD 2K5PA 5AUKA 4FJVB 4E3CA 3FAHA 5AZFA 3EGRA 5D2MB 1HA5A 1C9FA 2L1AA 2LHDA 2VRRB 3UF8A 1H8CA 2WXKA 3W9CB 4DHJD 2L76A 4ZYSA 3UQBA 4WJQA 2KX3A 3BIID 3RYTA 3VTWA 4FULA 1T0SC 4K3BA 1E9MA 3ZUNA 1BXTA 2K8CA 3PREA 1VR9A 4GDKA 2ZZPB 1T0YA 3TUOA 2CHZA 2K8HA 5JHBA 1WWTA 3GP7A 3P63A 2N9EB 1E10A 2KLGA 4REZA 1JWBD 3HVDA 4NAMA 3TEZA 3DDCB 1RM6C 1SIFA 3ZLZA 2WXOA 2LASA 3PO0A 2NVUI 5CHWA 3NRZA 3GE3C 2W82A 4LJPB 1FPYA 3ZTCA 3Q3NC 3GS2A 4XZ4A 2VH1A 3L16A 3M95A 2WXQA 2PTLA 1YJ1A 3DOWA 2ZNVC 4GDKB 4WQOB 3X23A 3L10B 2HJ8A 3QQ8B 4BKTA 4W9KA 3HUIA 2GBNA 2KACA 2KNBA 3A33B 2GRIA 2AQ3B 2QDFA 1EUVB 3AH7A 1JALA 4BKSA 3Q8FA 3RNFC 2RDHA 3N32A 1ZOYB 4Q2JA 2WP9B 4N59A 2K6DB 4K7WA 2K25A 1N63A 1GB1A 5KHQA 1EWYC 3WCQA 4FADA 3PSEB 2D07B 3OLMD 3MP9A 3A9JA 4LNKA 4A6QA 2KN4A 2XBBC 1V80A 3EFCA 1FCCC 1NBFC 1ET9A 1XLPA 5BYSA 3LDZE 2OJWA 2C60A 4TKNA 1ZP0B 2CU3A 1PQSA 4PYZA 1WR1A 2QSDA 2X38A 3V61A 1X1MA 1RFKA 1YN5A 1STEA 2IBIB 2KYWA 1GC7A 5C1ZA 2INPE 1JWMD 2KWDA 3IG3A 2MJ3A 1C76A 3OJ3A 2RR9A 2Y5PA 2E3TA 2BYTA 2M8SA 3T9LA 3A9JB 3BINA 1SJED 3VH4B 2J42A 1E7VA 3PPAA 3AU5A 3EHVA 3Q3JA 4JPSA 1EU4A 4BKSD 3K9PB 4LK0M 1XLOA 2ACZB 2MP2A 1WX8A 3I5JC 4TQ0A 1WR6E 1K51A 2KDBA 3UIPB 4MH0E 3UQAA 5BO4B 1XO3A 3MFGA 1C4AA 1YJJA 3AE4B 2GOWA 2KO3A 4P16A 5LXHA 1HTQA 4ICUA 2KC1A 4AJWA 3PZDA 4ACFA 2LXCA 4YL8A 1V5OA 3X0WA 1AN8A 1L7YA 4RFBA 2LI5A 4DWFA 4MDKE 1I35A 1KJTA 4FHKA 1GUAB 3BZDB 2J7QB 4MELA 3DWMA 1NENB 2ZW1A 2WXJA 1PFDA 2WX1A 3E56A 2BPSA 2PE9A 3B2FA 1ROEA 4N58A 1VDVA 2JZ3B 3B2GA 3CMMB 2JYEA 1LO5D 5D3IB 2DX5B 1F52A 2N9PC 2IY1B 2M17A 4K81A 2LGIA 4CHKA 3NHEB 4KVGB 5IP4D 1Q0WB 3Q8BA 1T3QA 3PGEA 2NTTA 2VH2A 3VR8B 2BB5A 5CHVC 4KX6B 2I2YA 2N7JA 1KOTA 1WGGA 1JQ4A 1TJEA 3PHXB 4A90A 2DYOA 2KC2A 2Z0DB 2CJNA 1N60A
chains in the Genus database with same CATH topology
1H4RA 2BF8B 2G4DB 3U7DA 2KHWB 4WAAA 3B1LX 5DPWA 3QA8A 4GU2A 2JF5A 2MBHA 4NAWB 2IO0B 3ZNHB 5J17A 2FCSA 2A5UA 2KWUB 1RLFA 3PHWB 2LXAA 3BY4B 2KMAA 3IBEA 2LGDA 3MTNB 3PV1A 2EKEC 4K1RB 3ZKJC 4G3XB 1WMHA 4WJPA 3IVFA 1MG8A 2KX0A 4HWIB 3A4RA 2KDIA 2V4LA 2C7MB 2AWTA 4GDLB 3PS6A 1C1YB 2IZVB 4I6LB 2LRWA 4II3B 1G6JA 2MA9B 4MEMA 2ZJDA 3ALBA 3DBHI 3KW5B 3NOBA 4MGYE 1RFAA 1E7UA 2JRIB 2N1VA 3VTVA 1R4NI 4HK2A 1WXAA 3DCGA 1V6EA 3IFWB 4ZYNA 3ZRFA 4HCPB 5E6OA 4EOYA 3NZSA 4HVBA 1GG3A 3VFKA 5C23A 4OVUA 1IPGA 3ML9A 2JWZA 1M94A 1WJNA 2NS5A 3ZRCA 2NCNA 5LXIB 3CSFA 3SU8X 2L3ZA 4HPLB 1Z2MA 2R2OA 2LJ5A 4HXDA 2KWCA 2GBJA 3ZNID 4A3OA 1WMHB 5L95C 1EF1A 2RD0A 5IA7A 2DYBA 2KFKA 5IAAC 4M0WB 2C9WB 2KANA 3B08A 4G50A 4MGZE 3PLUA 4BOSC 2MBEA 2LZ6A 4ICVA 4XC2A 3VDZA 1NDDA 3ONSA 4HDQA 1WXSA 3PTFC 5LLIA 2MX2A 2PPHA 4ANVA 1WE6A 3M63B 4TQ1A 2MBOA 1BT0A 1GNUA 2MBBB 1Y8RC 2W9NA 4WWNA 2K1FA 2BGFA 2KFJA 1EF5A 2LRUA 3NS8A 1EO6A 2BWES 4IC7B 2A4ZA 3H9DA 5HKHA 4NJ6A 4RMAA 4CYEA 4PS8A 1WJUA 2AL3A 2MP2B 4N9F4 2G3QB 2L0FA 4URKA 2M4NA 3R3MA 1WGRA 2N1WA 1I42A 2ZNVB 1Q1OA 5D7GA 1J19A 3AXCA 4AUQC 1U4AA 3T8MA 3DPDA 3VTUA 3WAMA 4EZKA 2K39A 2DYMA 1A5RA 5E6NA 2KFKB 3L13A 3VHTC 2ZVNA 4FBJB 2FIFA 2KWVB 1D3ZA 4W9LA 2YVCA 4FLHA 4JL9A 2UYZB 2YLMA 3GZNI 3H7SA 3NZUA 1AARA 1V5TA 4EZJA 3DBSA 2GMIC 2J0MA 3W1SA 4EUTA 1P9DU 2DAFA 1HE8A 2V1YA 4BOZB 2MQJA 4KZCA 2KMCA 1V2YA 1WJ4A 4EZLA 4ASWC 3TJPA 5G55A 4DBGA 1V49A 2DENB 2Z59B 3QCAA 4W9HA 3PRZA 4ZRKA 1WJ6A 5CTRC 2IY0B 2BYVE 2NBUA 4GN1A 2UWQA 4DHZB 2KXJA 4GIVA 3ZNGC 2JXXA 3CF6E 1OEYJ 2RGFA 3H7PA 1WX9A 2MSED 4LCDE 1V9JA 1XD3B 4JGHB 3RZWC 3H6NA 3A4SC 1TBEA 2N9XA 4GMVA 2WYQA 4TUUA 1E8WA 2KJ6A 3JVZX 3N30A 1C3TA 4I6PA 1TGZB 1YIWA 2MCNB 3JSVA 4F1SA 4WWPA 3VAWA 4J6IA 1GJZA 3EFUA 2EMTA 4MGKE 3R7RA 3RUIB 4E71A 2JY6A 3PRMB 1R4MI 2K6QA 3DBRI 3L54A 4BBNC 2KJHB 4A20A 1XQQA 1Z5SB 3K9OB 3APCA 5DPRA 2DHZA 4GXBA 4RM9A 3KH0A 2WX0A 2FCNA 3APDA 4IW0A 2KTRB 1J8CA 2CHWA 4JLCA 3U8ZA 2L8JA 4GGQA 1LFDA 3DVNV 3EECA 4NJ7A 5CHFA 4WWOA 2GBMA 1ISNA 1LXDA 3H7PB 1ZW7A 5CX3A 3QJZA 2J0JA 2LUEA 5EDSA 3QWZB 3V62A 1WGHA 1P1AA 1LQBA 1YD8U 2KN5A 3DVGX 3GOEA 3KYDD 4NPNA 3SDLC 2ASQA 2KQSA 1WI0A 3I3TB 1CMXB 2ZPNA 3JSVB 3O65B 3CSTA 2N7EA 4IWPA 4W9IA 4DHZE 1UGMA 5TR5A 2GBRA 2KD0A 2L7RA 2ZCBA 4DHJB 4BKGA 2JT4B 2BYEA 2OOBB 2BKFA 3PRPB 4W9EA 4WJOA 3VH3B 4ZRJA 3UINB 3APFA 4W9DA 3VUWA 4HLEA 3PT2B 1GC6A 4HCNB 2WDTB 1WM3A 2D10A 3M62B 2IO1B 3MJWA 3WAPA 4AWJA 4DK5A 4G11A 2Y5BB 5JHAA 2DZMA 3IHPC 4K7UA 3TCAA 1V81A 2O2VA 3QARA 1KM7A 3QIJA 2FAZA 4IM3A 3KYCD 3WIMA 3RCZA 2KKCA 2EMSA 4FJVB 4E3CA 1YQBA 3L17A 2DZIA 5AZFA 3RT3B 1IYFA 2KK8A 3P2BA 5D2MB 3M3JA 2C7HA 4P7IA 2DZKA 2VRRB 3UF8A 1H8CA 2N7DA 4DHJD 3TMPB 2L76A 1WM2A 3UQBA 4ANUA 3QHTA 1IP9A 4WJQA 2KX3A 3NY5A 3RYTA 3VTWA 4FULA 4KSLC 3ZUNA 2K8CA 3PREA 4GDKA 1RRBA 2AEHA 2ZZPB 1T0YA 2O2VB 1P0RA 1KLVA 2CHZA 2K8HA 5JHBA 4JIOU 1E8XA 4M8NA 2NBVB 2N9EB 3EC8A 2KLGA 3TL5A 1ZKHA 1OEYA 2WWZA 4KZ0A 3LJ3A 5KHOA 2ZEQA 3VUYA 2XK5A 3ZIMA 4MSMB 1WF9A 3DDCB 1SIFA 2V3SA 3ZLZA 1S3SG 4IUMB 4OVVA 2CR5A 2LASA 4B95A 2M0XA 1JRUA 2NVUI 4MSQB 2KJRA 5CHWA 2LGYA 4LJPB 4HPMB 3ZTCA 2HTHA 3AULA 2AYOB 4XZ4A 2LVOA 3L16A 2BKRB 2OJRA 2O6VA 3M95A 2HD5B 3ML8A 4E74A 1WZ0A 2NBWB 1YJ1A 3DOWA 2ZNVC 4GDKB 4WQOB 3X23A 3L10B 1L2NA 3QAQA 2HJ8A 1YX5B 3QQ8B 4W9KA 4BKTA 3A1QA 2JUOA 3B0AA 2GBNA 4LJOB 2KNBA 3A33B 4LDTB 3V6CB 2DZJA 4DDGD 2JPHA 4F8CB 5GMVA 5J18A 1F9JA 1EUVB 1LM8B 4W9JA 3QK0A 2XK5B 4W9CA 3ZDMC 4BKSA 2C7NB 3DQVA 4CO7A 3N32A 3WA0A 3OJ4B 1TTNA 3DBLI 2D11A 1QZEA 2K6DB 1P3QU 2K25A 4K7WA 5E6PA 1WH3A 2C5LC 5KHQA 1S1QB 3W1YA 2LD9A 4EEWA 4ANWA 2O6VB 3PSEB 2D07B 3OLMD 3VQIA 4FADA 1WGDA 3R66C 2MWSB 3HM6X 3A9JA 2M1MA 4PS3A 4XX5A 2FCMA 3A1QB 2XBBC 3WAOA 4NY0A 4LDTD 1V80A 4ZRIA 1NBFC 3RD2A 3ZTDA 1UH6A 4KDIC 3LDZE 2NR2A 4X57B 4PYUA 2C60A 4TKNA 4B6WA 1UD7A 5G2NA 1WYWB 1PQSA 3W1SC 2FIDA 3L0WB 4PYZA 4AP4C 3D32A 2CHXA 2LVQA 1WR1A 2N4FA 3HHMA 4II2B 3Q3FA 4KSKC 3V61A 1X1MA 4NQKE 1RAXA 2BWFA 3KUDB 2JVCA 4MGIE 4NQLB 1Q5WB 2IBIB 3L08A 1GC7A 4IG7B 4KIKA 4HDOA 5C1ZA 3IG3A 4DDID 2L0TA 3A9KA 3OJ3A 3QX1A 3MHSD 2RR9A 4BVUC 4AJYB 3QC8B 5FR6A 3KUZA 3ZDTA 1WXVA 2O6VD 2G45B 5DPTA 1OQYA 2M8SA 4NNJB 2FNJB 3A9JB 3BINA 2LGXA 4JQWC 2KVRA 4MJSA 3T9LA 3V6EB 3N3KB 3KVFB 3VH4B 1WY8A 2D2QA 2G4SA 4W9GA 1E7VA 3RZFA 4ANXA 1WFYA 2HE7A 1NI2A 4RM8A 3PPAA 3AU5A 4KV2A 3EHVA 3Q3JA 3VXWA 4FJZA 5DCNA 1WGYA 2KQ7A 3WALA 1E5WA 1WXMA 3DVGY 4HJKA 1YX6B 3TIXA 2L05A 4BKSD 2I1JA 3K9PB 2L00B 2CS4A 1VCBA 5J2RA 2FCQA 2Z0EB 2PJHA 5JZEB 2MP2A 5DPSA 2ZVOA 4KIKB 1WX8A 3PLVA 1WX7A 2GBKA 3A9KB 4G0NB 4TQ0A 1WR6E 1SE9A 3U30A 2KDBA 2RSUA 3UIPB 3ZNZB 4BBNF 4FHJA 4MH0E 5AZGA 3UQAA 5BO4B 4F7ZA 3H1UA 4MJSB 2GOWA 2KO3A 4EFOA 1ZGUB 2CU1A 2RPQA 5LXHA 4WJNA 2D3GA 2B3AA 4DXAB 4ICUA 3ENEA 3SHQA 2KC1A 2AL6A 3ZO5B 4AJWA 3JYUA 3PZDA 3ECIA 1UBQA 2LXCA 3PVLA 4YL8A 1FXTB 1OGWA 2ZPYA 1V5OA 4IWQA 2JZZA 2DAJA 2KLCA 5L83A 4A3PA 1WRDB 2KOXA 4GOCA 3X0WA 1L7YA 4GB9A 1VD2A 2LVPA 3HIZA 2LI5A 4DWFA 2I1KA 4MDKE 1I35A 2KDFB 1J0GA 3ZW3A 1KJTA 4IM2A 1OTRB 3DVNU 1XT9B 2IYDB 4FHKA 4K7SA 1WE7A 2NPTA 1GUAB 3AI5A 3HK0A 2J7QB 4MELA 4AOFA 1UBIA 2IO3B 3KUCB 1E8YA 5AEKB 2REXA 2PEAA 4MM3A 2QHOA 4GSWA 4B9KA 2WX1A 1TZ1A 2KZRA 3OAWA 1V86A 3RULA 2IO2B 1SGHA 2BPSA 2MW5A 2PE9A 1WZ3A 4I6NB 4EKUA 2JZ3B 5JH5C 2K8BA 2JRHA 3TBLD 2KDEB 3CMMB 1UZXB 3C0RB 2DX5B 4BFRA 2MLBA 2N9PC 4FN2A 4NAWA 1WIAA 2IY1B 2J0KA 2MRPA 2M17A 4K81A 2MBQA 2R2QA 2KTRA 3UIOB 4FA6A 3JW0X 3VVWB 4CHKA 3NHEB 4KVGB 1E8ZA 2LWPA 1K8RB 1UELA 1Q0WB 3PGEA 4IWOA 3AU4A 5D94A 1P98A 2PE6B 2FUHB 2NPTB 5D6JB 3WANA 3V60A 4FJYA 5AZHA 5CHVC 4GDLA 3SD5A 4W9FA 4M8MA 1KOTA 1WGGA 4IM0A 3PHXB 1E90A 2XEWA 2BYFA 3R7QA 3S2AA 4PS7A 2DYOA 4KDLB 2KTFA 3VUXA 4ZDVA 4TV3A 2KC2A 2Z0DB 3UGBB 2ZCCA 3ZVVA 3HM3A 2CKHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4R A;  2BF8 B;  2G4D B;  3U7D A;  2KHW B;  4WAA A;  3B1L X;  5DPW A;  3QA8 A;  4GU2 A;  2JF5 A;  2MBH A;  4NAW B;  2IO0 B;  3ZNH B;  5J17 A;  2FCS A;  2A5U A;  2KWU B;  1RLF A;  3PHW B;  2LXA A;  3BY4 B;  2KMA A;  3IBE A;  2LGD A;  3MTN B;  3PV1 A;  2EKE C;  4K1R B;  3ZKJ C;  4G3X B;  1WMH A;  4WJP A;  3IVF A;  1MG8 A;  2KX0 A;  4HWI B;  3A4R A;  2KDI A;  2V4L A;  2C7M B;  2AWT A;  4GDL B;  3PS6 A;  1C1Y B;  2IZV B;  4I6L B;  2LRW A;  4II3 B;  1G6J A;  2MA9 B;  4MEM A;  2ZJD A;  3ALB A;  3DBH I;  3KW5 B;  3NOB A;  4MGY E;  1RFA A;  1E7U A;  2JRI B;  2N1V A;  3VTV A;  1R4N I;  4HK2 A;  1WXA A;  3DCG A;  1V6E A;  3IFW B;  4ZYN A;  3ZRF A;  4HCP B;  5E6O A;  4EOY A;  3NZS A;  4HVB A;  1GG3 A;  3VFK A;  5C23 A;  4OVU A;  1IPG A;  3ML9 A;  2JWZ A;  1M94 A;  1WJN A;  2NS5 A;  3ZRC A;  2NCN A;  5LXI B;  3CSF A;  3SU8 X;  2L3Z A;  4HPL B;  1Z2M A;  2R2O A;  2LJ5 A;  4HXD A;  2KWC A;  2GBJ A;  3ZNI D;  4A3O A;  1WMH B;  5L95 C;  1EF1 A;  2RD0 A;  5IA7 A;  2DYB A;  2KFK A;  5IAA C;  4M0W B;  2C9W B;  2KAN A;  3B08 A;  4G50 A;  4MGZ E;  3PLU A;  4BOS C;  2MBE A;  2LZ6 A;  4ICV A;  4XC2 A;  3VDZ A;  1NDD A;  3ONS A;  4HDQ A;  1WXS A;  3PTF C;  5LLI A;  2MX2 A;  2PPH A;  4ANV A;  1WE6 A;  3M63 B;  4TQ1 A;  2MBO A;  1BT0 A;  1GNU A;  2MBB B;  1Y8R C;  2W9N A;  4WWN A;  2K1F A;  2BGF A;  2KFJ A;  1EF5 A;  2LRU A;  3NS8 A;  1EO6 A;  2BWE S;  4IC7 B;  2A4Z A;  3H9D A;  5HKH A;  4NJ6 A;  4RMA A;  4CYE A;  4PS8 A;  1WJU A;  2AL3 A;  2MP2 B;  4N9F 4;  2G3Q B;  2L0F A;  4URK A;  2M4N A;  3R3M A;  1WGR A;  2N1W A;  1I42 A;  2ZNV B;  1Q1O A;  5D7G A;  1J19 A;  3AXC A;  4AUQ C;  1U4A A;  3T8M A;  3DPD A;  3VTU A;  3WAM A;  4EZK A;  2K39 A;  2DYM A;  1A5R A;  5E6N A;  2KFK B;  3L13 A;  3VHT C;  2ZVN A;  4FBJ B;  2FIF A;  2KWV B;  1D3Z A;  4W9L A;  2YVC A;  4FLH A;  4JL9 A;  2UYZ B;  2YLM A;  3GZN I;  3H7S A;  3NZU A;  1AAR A;  1V5T A;  4EZJ A;  3DBS A;  2GMI C;  2J0M A;  3W1S A;  4EUT A;  1P9D U;  2DAF A;  1HE8 A;  2V1Y A;  4BOZ B;  2MQJ A;  4KZC A;  2KMC A;  1V2Y A;  1WJ4 A;  4EZL A;  4ASW C;  3TJP A;  5G55 A;  4DBG A;  1V49 A;  2DEN B;  2Z59 B;  3QCA A;  4W9H A;  3PRZ A;  4ZRK A;  1WJ6 A;  5CTR C;  2IY0 B;  2BYV E;  2NBU A;  4GN1 A;  2UWQ A;  4DHZ B;  2KXJ A;  4GIV A;  3ZNG C;  2JXX A;  3CF6 E;  1OEY J;  2RGF A;  3H7P A;  1WX9 A;  2MSE D;  4LCD E;  1V9J A;  1XD3 B;  4JGH B;  3RZW C;  3H6N A;  3A4S C;  1TBE A;  2N9X A;  4GMV A;  2WYQ A;  4TUU A;  1E8W A;  2KJ6 A;  3JVZ X;  3N30 A;  1C3T A;  4I6P A;  1TGZ B;  1YIW A;  2MCN B;  3JSV A;  4F1S A;  4WWP A;  3VAW A;  4J6I A;  1GJZ A;  3EFU A;  2EMT A;  4MGK E;  3R7R A;  3RUI B;  4E71 A;  2JY6 A;  3PRM B;  1R4M I;  2K6Q A;  3DBR I;  3L54 A;  4BBN C;  2KJH B;  4A20 A;  1XQQ A;  1Z5S B;  3K9O B;  3APC A;  5DPR A;  2DHZ A;  4GXB A;  4RM9 A;  3KH0 A;  2WX0 A;  2FCN A;  3APD A;  4IW0 A;  2KTR B;  1J8C A;  2CHW A;  4JLC A;  3U8Z A;  2L8J A;  4GGQ A;  1LFD A;  3DVN V;  3EEC A;  4NJ7 A;  5CHF A;  4WWO A;  2GBM A;  1ISN A;  1LXD A;  3H7P B;  1ZW7 A;  5CX3 A;  3QJZ A;  2J0J A;  2LUE A;  5EDS A;  3QWZ B;  3V62 A;  1WGH A;  1P1A A;  1LQB A;  1YD8 U;  2KN5 A;  3DVG X;  3GOE A;  3KYD D;  4NPN A;  3SDL C;  2ASQ A;  2KQS A;  1WI0 A;  3I3T B;  1CMX B;  2ZPN A;  3JSV B;  3O65 B;  3CST A;  2N7E A;  4IWP A;  4W9I A;  4DHZ E;  1UGM A;  5TR5 A;  2GBR A;  2KD0 A;  2L7R A;  2ZCB A;  4DHJ B;  4BKG A;  2JT4 B;  2BYE A;  2OOB B;  2BKF A;  3PRP B;  4W9E A;  4WJO A;  3VH3 B;  4ZRJ A;  3UIN B;  3APF A;  4W9D A;  3VUW A;  4HLE A;  3PT2 B;  1GC6 A;  4HCN B;  2WDT B;  1WM3 A;  2D10 A;  3M62 B;  2IO1 B;  3MJW A;  3WAP A;  4AWJ A;  4DK5 A;  4G11 A;  2Y5B B;  5JHA A;  2DZM A;  3IHP C;  4K7U A;  3TCA A;  1V81 A;  2O2V A;  3QAR A;  1KM7 A;  3QIJ A;  2FAZ A;  4IM3 A;  3KYC D;  3WIM A;  3RCZ A;  2KKC A;  2EMS A;  4FJV B;  4E3C A;  1YQB A;  3L17 A;  2DZI A;  5AZF A;  3RT3 B;  1IYF A;  2KK8 A;  3P2B A;  5D2M B;  3M3J A;  2C7H A;  4P7I A;  2DZK A;  2VRR B;  3UF8 A;  1H8C A;  2N7D A;  4DHJ D;  3TMP B;  2L76 A;  1WM2 A;  3UQB A;  4ANU A;  3QHT A;  1IP9 A;  4WJQ A;  2KX3 A;  3NY5 A;  3RYT A;  3VTW A;  4FUL A;  4KSL C;  3ZUN A;  2K8C A;  3PRE A;  4GDK A;  1RRB A;  2AEH A;  2ZZP B;  1T0Y A;  2O2V B;  1P0R A;  1KLV A;  2CHZ A;  2K8H A;  5JHB A;  4JIO U;  1E8X A;  4M8N A;  2NBV B;  2N9E B;  3EC8 A;  2KLG A;  3TL5 A;  1ZKH A;  1OEY A;  2WWZ A;  4KZ0 A;  3LJ3 A;  5KHO A;  2ZEQ A;  3VUY A;  2XK5 A;  3ZIM A;  4MSM B;  1WF9 A;  3DDC B;  1SIF A;  2V3S A;  3ZLZ A;  1S3S G;  4IUM B;  4OVV A;  2CR5 A;  2LAS A;  4B95 A;  2M0X A;  1JRU A;  2NVU I;  4MSQ B;  2KJR A;  5CHW A;  2LGY A;  4LJP B;  4HPM B;  3ZTC A;  2HTH A;  3AUL A;  2AYO B;  4XZ4 A;  2LVO A;  3L16 A;  2BKR B;  2OJR A;  2O6V A;  3M95 A;  2HD5 B;  3ML8 A;  4E74 A;  1WZ0 A;  2NBW B;  1YJ1 A;  3DOW A;  2ZNV C;  4GDK B;  4WQO B;  3X23 A;  3L10 B;  1L2N A;  3QAQ A;  2HJ8 A;  1YX5 B;  3QQ8 B;  4W9K A;  4BKT A;  3A1Q A;  2JUO A;  3B0A A;  2GBN A;  4LJO B;  2KNB A;  3A33 B;  4LDT B;  3V6C B;  2DZJ A;  4DDG D;  2JPH A;  4F8C B;  5GMV A;  5J18 A;  1F9J A;  1EUV B;  1LM8 B;  4W9J A;  3QK0 A;  2XK5 B;  4W9C A;  3ZDM C;  4BKS A;  2C7N B;  3DQV A;  4CO7 A;  3N32 A;  3WA0 A;  3OJ4 B;  1TTN A;  3DBL I;  2D11 A;  1QZE A;  2K6D B;  1P3Q U;  2K25 A;  4K7W A;  5E6P A;  1WH3 A;  2C5L C;  5KHQ A;  1S1Q B;  3W1Y A;  2LD9 A;  4EEW A;  4ANW A;  2O6V B;  3PSE B;  2D07 B;  3OLM D;  3VQI A;  4FAD A;  1WGD A;  3R66 C;  2MWS B;  3HM6 X;  3A9J A;  2M1M A;  4PS3 A;  4XX5 A;  2FCM A;  3A1Q B;  2XBB C;  3WAO A;  4NY0 A;  4LDT D;  1V80 A;  4ZRI A;  1NBF C;  3RD2 A;  3ZTD A;  1UH6 A;  4KDI C;  3LDZ E;  2NR2 A;  4X57 B;  4PYU A;  2C60 A;  4TKN A;  4B6W A;  1UD7 A;  5G2N A;  1WYW B;  1PQS A;  3W1S C;  2FID A;  3L0W B;  4PYZ A;  4AP4 C;  3D32 A;  2CHX A;  2LVQ A;  1WR1 A;  2N4F A;  3HHM A;  4II2 B;  3Q3F A;  4KSK C;  3V61 A;  1X1M A;  4NQK E;  1RAX A;  2BWF A;  3KUD B;  2JVC A;  4MGI E;  4NQL B;  1Q5W B;  2IBI B;  3L08 A;  1GC7 A;  4IG7 B;  4KIK A;  4HDO A;  5C1Z A;  3IG3 A;  4DDI D;  2L0T A;  3A9K A;  3OJ3 A;  3QX1 A;  3MHS D;  2RR9 A;  4BVU C;  4AJY B;  3QC8 B;  5FR6 A;  3KUZ A;  3ZDT A;  1WXV A;  2O6V D;  2G45 B;  5DPT A;  1OQY A;  2M8S A;  4NNJ B;  2FNJ B;  3A9J B;  3BIN A;  2LGX A;  4JQW C;  2KVR A;  4MJS A;  3T9L A;  3V6E B;  3N3K B;  3KVF B;  3VH4 B;  1WY8 A;  2D2Q A;  2G4S A;  4W9G A;  1E7V A;  3RZF A;  4ANX A;  1WFY A;  2HE7 A;  1NI2 A;  4RM8 A;  3PPA A;  3AU5 A;  4KV2 A;  3EHV A;  3Q3J A;  3VXW A;  4FJZ A;  5DCN A;  1WGY A;  2KQ7 A;  3WAL A;  1E5W A;  1WXM A;  3DVG Y;  4HJK A;  1YX6 B;  3TIX A;  2L05 A;  4BKS D;  2I1J A;  3K9P B;  2L00 B;  2CS4 A;  1VCB A;  5J2R A;  2FCQ A;  2Z0E B;  2PJH A;  5JZE B;  2MP2 A;  5DPS A;  2ZVO A;  4KIK B;  1WX8 A;  3PLV A;  1WX7 A;  2GBK A;  3A9K B;  4G0N B;  4TQ0 A;  1WR6 E;  1SE9 A;  3U30 A;  2KDB A;  2RSU A;  3UIP B;  3ZNZ B;  4BBN F;  4FHJ A;  4MH0 E;  5AZG A;  3UQA A;  5BO4 B;  4F7Z A;  3H1U A;  4MJS B;  2GOW A;  2KO3 A;  4EFO A;  1ZGU B;  2CU1 A;  2RPQ A;  5LXH A;  4WJN A;  2D3G A;  2B3A A;  4DXA B;  4ICU A;  3ENE A;  3SHQ A;  2KC1 A;  2AL6 A;  3ZO5 B;  4AJW A;  3JYU A;  3PZD A;  3ECI A;  1UBQ A;  2LXC A;  3PVL A;  4YL8 A;  1FXT B;  1OGW A;  2ZPY A;  1V5O A;  4IWQ A;  2JZZ A;  2DAJ A;  2KLC A;  5L83 A;  4A3P A;  1WRD B;  2KOX A;  4GOC A;  3X0W A;  1L7Y A;  4GB9 A;  1VD2 A;  2LVP A;  3HIZ A;  2LI5 A;  4DWF A;  2I1K A;  4MDK E;  1I35 A;  2KDF B;  1J0G A;  3ZW3 A;  1KJT A;  4IM2 A;  1OTR B;  3DVN U;  1XT9 B;  2IYD B;  4FHK A;  4K7S A;  1WE7 A;  2NPT A;  1GUA B;  3AI5 A;  3HK0 A;  2J7Q B;  4MEL A;  4AOF A;  1UBI A;  2IO3 B;  3KUC B;  1E8Y A;  5AEK B;  2REX A;  2PEA A;  4MM3 A;  2QHO A;  4GSW A;  4B9K A;  2WX1 A;  1TZ1 A;  2KZR A;  3OAW A;  1V86 A;  3RUL A;  2IO2 B;  1SGH A;  2BPS A;  2MW5 A;  2PE9 A;  1WZ3 A;  4I6N B;  4EKU A;  2JZ3 B;  5JH5 C;  2K8B A;  2JRH A;  3TBL D;  2KDE B;  3CMM B;  1UZX B;  3C0R B;  2DX5 B;  4BFR A;  2MLB A;  2N9P C;  4FN2 A;  4NAW A;  1WIA A;  2IY1 B;  2J0K A;  2MRP A;  2M17 A;  4K81 A;  2MBQ A;  2R2Q A;  2KTR A;  3UIO B;  4FA6 A;  3JW0 X;  3VVW B;  4CHK A;  3NHE B;  4KVG B;  1E8Z A;  2LWP A;  1K8R B;  1UEL A;  1Q0W B;  3PGE A;  4IWO A;  3AU4 A;  5D94 A;  1P98 A;  2PE6 B;  2FUH B;  2NPT B;  5D6J B;  3WAN A;  3V60 A;  4FJY A;  5AZH A;  5CHV C;  4GDL A;  3SD5 A;  4W9F A;  4M8M A;  1KOT A;  1WGG A;  4IM0 A;  3PHX B;  1E90 A;  2XEW A;  2BYF A;  3R7Q A;  3S2A A;  4PS7 A;  2DYO A;  4KDL B;  2KTF A;  3VUX A;  4ZDV A;  4TV3 A;  2KC2 A;  2Z0D B;  3UGB B;  2ZCC A;  3ZVV A;  3HM3 A;  2CKH B; 
#chains in the Genus database with same CATH topology
 1H4R A;  2NTS A;  4JE3 B;  4O1N A;  5DPW A;  2UU7 A;  4GU2 A;  4PK1 A;  4MT5 A;  4YXD B;  2KWU B;  2LGD A;  3N9Y C;  4G3X B;  5BMI A;  2HJ1 A;  2KX0 A;  3W2D A;  1MHX A;  2MH7 A;  2AWT A;  3PS6 A;  4TSS A;  2OHF A;  3ALB A;  1SF0 A;  3IXS A;  2N1V A;  1R4N I;  4HK2 A;  4C80 A;  3TEW A;  2W54 A;  5E6O A;  3EA6 A;  1WYG A;  3NZS A;  1GG3 A;  1I4P A;  3ZRC A;  1SSN A;  1FRR A;  3P4S B;  2GBJ A;  3ZNI D;  5L95 C;  2RD0 A;  4B0M A;  2C9W B;  5FK9 C;  3PLU A;  4ICV A;  4XC2 A;  3ONS A;  1YMH E;  4ANV A;  1DOX A;  4ZHP A;  4DXG A;  1EF5 A;  2LRU A;  3I9V 1;  4YSX B;  4IC7 B;  5HKH A;  3N1Z C;  4RMA A;  1AWD A;  3NVY A;  4CYE A;  4PS8 A;  1WJU A;  2AL3 A;  4N9F 4;  4URK A;  2K22 A;  3DPD A;  1IGC A;  1YN4 A;  2ZVN A;  2KWV B;  4FBJ B;  1D3Z A;  3MC0 B;  4W9L A;  1PUT A;  1AAR A;  2MHJ A;  1UWM A;  2BQQ A;  2GMI C;  3RPF C;  1UUP A;  4RCO A;  1I4G A;  1PGA A;  5H92 C;  3HRD D;  4BOZ B;  1T5X D;  2MJD A;  3BVM A;  4KGT A;  4EZL A;  5G55 A;  2DEN B;  3QCA A;  4W9H A;  3PRZ A;  1YNT E;  1WJ6 A;  5CTR C;  2BYV E;  2UWQ A;  3RNE C;  3BYT B;  4GIV A;  3ZNG C;  1OEY J;  4R3D A;  3H7P A;  1WX9 A;  2MSE D;  1FXA A;  2WGS A;  1XD3 B;  1TBE A;  1ZUD 2;  3W5V B;  1E8W A;  3U52 E;  4H2A A;  4WWP A;  3VAW A;  1GJZ A;  2EMT A;  1N5X A;  3RUI B;  1FNV A;  2K6Q A;  2KJH B;  4TMA B;  4BZA A;  3KH0 A;  1HZ5 A;  1D4B A;  1L6U A;  4C00 A;  4DQO C;  2INC C;  5CHF A;  1AYF A;  1K53 A;  3H7P B;  3LB8 C;  1ZDV A;  1NVI D;  3DVG X;  2KN5 A;  2QEJ C;  2ASQ A;  3I3T B;  4IWP A;  2N7E A;  4W9I A;  1R4M B;  4P6V F;  5TR5 A;  2KD0 A;  2L7R A;  2WDV B;  3DBR B;  2JT4 B;  2BYE A;  4LNI A;  4CQN A;  2V4I B;  3VH3 B;  4JWS C;  3VUW A;  3PT2 B;  1UF0 A;  3M62 B;  1F77 A;  1UGJ A;  2DZM A;  3IHP C;  3TCA A;  2WNM A;  3FC4 A;  3WIM A;  2EMS A;  2YEP F;  2AQ2 B;  2WU2 B;  3RT3 B;  2KK8 A;  3P2B A;  4WIP A;  4ZRQ A;  2C7H A;  1HZ6 A;  5FR3 A;  1ZDX A;  4P7I A;  1PGX A;  3TMP B;  1WM2 A;  3ZQ4 A;  3QHT A;  1IP9 A;  3KQ4 A;  4IKG A;  2FBW B;  4HRS A;  1P0R A;  2WU5 B;  5G5H A;  2EEL A;  2WWZ A;  2BS2 B;  5KHO A;  4QAY A;  4ZOH C;  3VUY A;  3ZIM A;  4MSM B;  1WF9 A;  3GB1 A;  5BYR A;  4OVV A;  3NJT A;  1MG4 A;  2M0X A;  2I38 A;  2LGY A;  2HTH A;  3AUL A;  1ZXI A;  2AYO B;  2GI9 A;  1L6V A;  2QIL A;  2IDY A;  3P42 A;  1WZ0 A;  4XWW A;  4ZRP A;  4NJC A;  1R7S A;  3CWI A;  5BYQ A;  2LHE A;  3AN1 A;  2JUO A;  3B0A A;  1JWA D;  1TKG A;  4LJO B;  4LDT B;  2DZJ A;  4DDG D;  3Q8E A;  1LM8 B;  1CQV A;  3P4R B;  4W9C A;  3BYY B;  2M0A A;  5IOI A;  2B76 B;  3AEG B;  1QZE A;  2C5L C;  3W1Y A;  4EEW A;  2N9K A;  3VQI A;  1JWU D;  3R66 C;  3WAO A;  2FCM A;  1VZ7 A;  1UWX A;  4LDT D;  1UH6 A;  4X57 B;  2NR2 A;  1SE4 A;  1GB4 A;  2FID A;  2LVQ A;  3BVZ A;  3Q3F A;  2RPV A;  2JSV X;  1KLU D;  5HFY A;  1K52 A;  2JVC A;  4DDI D;  1XEE A;  3A9K A;  3AEA B;  5D3D A;  4AJY B;  3QC8 B;  5FR6 A;  1UNS A;  3KUZ A;  4B0E A;  3V6E B;  3KVF B;  2D2Q A;  1N61 A;  2G4S A;  1P7E A;  2HE7 A;  3Q3O C;  1YJI A;  4FJZ A;  5DCN A;  2KQ7 A;  1E5W A;  1YX6 B;  1TIF A;  2I1J A;  2NMQ A;  2L00 B;  2CS4 A;  2PJH A;  5JZE B;  1ENF A;  5DPS A;  1WX7 A;  3A9K B;  1B1Z A;  1SE9 A;  1L0V B;  4BBN F;  5AZG A;  3H1U A;  3I63 C;  4WJN A;  2D3G A;  4DXA B;  3AEE B;  1I4H A;  2AL6 A;  1UBQ A;  4XDD A;  2G1E A;  1MPE A;  1WRD B;  2KOX A;  2LVP A;  1SBB B;  1FO4 A;  5E6J A;  4IM2 A;  1OTR B;  3DVN U;  4K7S A;  1WE7 A;  3OG5 A;  2Q5W D;  1E8Y A;  1QOG A;  4KKI A;  5LNK 1;  4MM3 A;  2QHO A;  4GSW A;  4B9K A;  3OAW A;  1V86 A;  2IO2 B;  1SGH A;  1FRD A;  1WZ3 A;  4JWU C;  4I6N B;  4EKU A;  2V9H A;  2J52 A;  3AE6 B;  4BFR A;  1IUE A;  1NYR A;  4C4V A;  1F2R I;  4FN2 A;  4P1B C;  2J0K A;  2MRP A;  2R2Q A;  2KTR A;  3UIO B;  4FA6 A;  2BB6 A;  3JW0 X;  3VVW B;  1FEH A;  1JRO A;  2LWP A;  1UEL A;  2WXN A;  5D6J B;  4YSZ B;  1SE2 A;  5AZH A;  4M8M A;  4RNA A;  5BMH A;  4MM3 B;  2BYF A;  3S2A A;  4KDL B;  2KTF A;  3VUX A;  2DNF A;  1I4Q A;  3UGB B;  1L0X B;  4IOI E;  4YTP B;  3ZVV A;  2G4D B;  3U7D A;  2KHW B;  3B1L X;  2WXI A;  3U4E G;  4C4V B;  3C19 A;  3IT4 B;  5MPO A;  2IO0 B;  5J17 A;  2FCS A;  3NVW A;  1RLF A;  2LXA A;  3NVZ A;  4YTM B;  2KMA A;  3IBE A;  3MTN B;  3ZGZ A;  3ZKJ C;  2KT7 A;  4XDC A;  4WUR A;  4WJP A;  1MG8 A;  3A4R A;  2KDI A;  2V4L A;  3NZ3 A;  3OWE B;  1YOV B;  4MEM A;  3NOB A;  1E7U A;  1RFA A;  1XLN A;  2JRI B;  3VTV A;  3DCG A;  1V6E A;  3ZRF A;  4C56 C;  4HCP B;  4YT0 B;  3VFK A;  3IT6 B;  2JWZ A;  5EE3 A;  3ZJU A;  3SU8 X;  2L3Z A;  2R2O A;  2LJ5 A;  4HXD A;  1EF1 A;  1V8C A;  5IA7 A;  3SFE B;  3R2I A;  1RWS A;  2ICI A;  2KMM A;  1TS5 A;  4S17 A;  4LNF A;  1R4N B;  5TSS A;  1NDD A;  4HDQ A;  1QOB A;  3PTF C;  5LLI A;  1DYQ A;  1JRP A;  4TQ1 A;  1D6E C;  3C8Y A;  1Y8R C;  1XCQ L;  4S0R A;  4WWN A;  2Y3A A;  3NS8 A;  2FE8 A;  1GOZ A;  2MP2 B;  2G3Q B;  2SAK A;  3R3M A;  1V97 A;  1I42 A;  1T6B X;  2W3S A;  5D7G A;  1J19 A;  3AXC A;  2SEB D;  5HG2 A;  2JYT A;  2FIF A;  4FLH A;  2YLM A;  3GZN I;  3R2T A;  1V5T A;  3VR9 B;  3DBS A;  3W1S A;  2K0P A;  4EUT A;  2DAF A;  1MFW A;  1HE8 A;  2V1Y A;  2MQJ A;  4KZC A;  1V2Y A;  1WJ4 A;  2LJI A;  4HJG E;  1V49 A;  4ZRK A;  1ZPS A;  5EE0 A;  1E6E B;  2JWU A;  3LYY A;  4GN1 A;  3CIR B;  4DHZ B;  3Q2A C;  4HRO A;  3CF6 E;  4L23 A;  1EWC A;  4JGH B;  5IN7 A;  4GMV A;  2N9X A;  2WYQ A;  2BW2 A;  3JVZ X;  4L2Y A;  3N30 A;  1C3T A;  1B9R A;  4F1S A;  4MGK E;  3R7R A;  1TS4 A;  4E71 A;  1FNU A;  3PRM B;  3DHI C;  1VZ6 A;  3DWG C;  4ZHO A;  4A20 A;  1XQQ A;  1Z5S B;  2JX5 A;  3APC A;  2DHZ A;  4GXB A;  4RM9 A;  2D3B A;  4US8 A;  1DGJ A;  2WX0 A;  4IW0 A;  4RH6 A;  2AX5 A;  1J8C A;  3U8Z A;  2BVC A;  4GGQ A;  1LFD A;  4NJ7 A;  1J7B A;  1LXD A;  2QIE B;  3QJZ A;  1WGH A;  5H8Y E;  3GOE A;  3KYD D;  2KQS A;  1CMX B;  3CST A;  1UGM A;  4BKG A;  2L32 A;  3TEX A;  2WXL A;  3APF A;  4HCN B;  2WDT B;  1WM3 A;  3AV8 A;  2IO1 B;  5C2T B;  2O2V A;  4IM3 A;  1KM7 A;  3QIJ A;  2LFI A;  4FXC A;  3RCZ A;  1YQB A;  2DWQ A;  2DZI A;  1IYF A;  2KVZ A;  2DZK A;  3V05 A;  2N7D A;  4ANU A;  3Q3M C;  3NY5 A;  1LGR A;  1SB3 C;  1SJH D;  1XF5 L;  2WLB A;  4XGA B;  1VRA B;  1N62 A;  2WS3 B;  2O2V B;  2JU6 X;  3ABV B;  1KLV A;  1I7H A;  2NBV B;  3EC8 A;  3TL5 A;  1ZKH A;  1OEY A;  4WQM A;  4KZ0 A;  3RNG C;  5GXG B;  2RMM A;  2WXP A;  2V3S A;  1F0Z A;  4IUM B;  1IBX A;  3AEF B;  4B95 A;  2KJR A;  4YSY B;  4LLG M;  2JXT A;  4HPM B;  2PKO A;  4E74 A;  2NBW B;  4JX1 C;  1L2N A;  1YN3 A;  1YX5 B;  5G5G A;  1TYG B;  3V6C B;  1L5P A;  3ZXV A;  1F9J A;  3IAM 1;  4ITK A;  3MHZ A;  3DQV A;  4CO7 A;  3V3X A;  1F1H A;  1IBX B;  3OJ4 B;  3DBL I;  2D11 A;  1SEB D;  5E6P A;  1WH3 A;  4PT5 A;  4ANW A;  2V0G A;  2MWS B;  4C7Z A;  4XX5 A;  4PS3 A;  4M01 A;  4NY0 A;  4HPP A;  3RD2 A;  3ZTD A;  4KDI C;  4PYU A;  4B6W A;  5G2N A;  3W1S C;  4M00 A;  3D32 A;  2CHX A;  2N4F A;  2PVG C;  1XCT L;  3HHM A;  2EKI A;  3P4P B;  4NQK E;  2BWF A;  3KUD B;  4MAC A;  3ZDT A;  1D5M C;  5DPT A;  2FNJ B;  3NUH B;  2KVR A;  2D5G A;  2XN9 C;  1WY8 A;  3VRA B;  4W9G A;  2M19 A;  4ANX A;  3RMK C;  1WFY A;  4RM8 A;  4KV2 A;  3VXW A;  1WGY A;  1WXM A;  3DVG Y;  1TS2 A;  3TIX A;  4ARC A;  3PZ8 A;  4HKQ A;  4OVZ A;  5HI1 A;  2FCQ A;  4MH8 A;  1FM0 D;  2W3R A;  3PLV A;  2GBK A;  3U30 A;  2RSU A;  3ZNZ B;  4FHJ A;  1NI3 A;  4EFO A;  1ZGU B;  2CU1 A;  2RPQ A;  2B3A A;  3SHQ A;  3AED B;  3FIL A;  2LMC A;  2PLP A;  2QCZ A;  3PVL A;  4OZB A;  1FXT B;  1OGW A;  2ZPY A;  1CJE A;  2IJ0 A;  1L4Z B;  4IWQ A;  1QKZ A;  5L83 A;  4A3P A;  4GOC A;  1HTO A;  4J3O D;  2J4X A;  4GB9 A;  1VD2 A;  3AE9 B;  1TKY A;  3HIZ A;  1KLG D;  2I1K A;  2V3N A;  4RGT A;  1XLQ A;  2GB1 A;  4RGO S;  3O13 A;  1FD6 A;  2IYD B;  2NPT A;  4AOF A;  2IO3 B;  3KUC B;  3URY A;  2DLB A;  1WSP A;  3FIL B;  1TZ1 A;  2KZR A;  2PW9 A;  1L0Y B;  3RUL A;  2MW5 A;  2QC8 A;  5JH5 C;  2K8B A;  2JRH A;  3TBL D;  2KDE B;  1UZX B;  1MHH E;  2HTM E;  2D3C A;  2ZW0 A;  2K9X A;  4IWO A;  3AU4 A;  5T8I A;  1P98 A;  2NPT B;  4K3C A;  4W9F A;  2Z8L A;  1RYJ A;  3EUB 2;  1JCK B;  2XEW A;  4PS7 A;  3TEY A;  1FFV A;  4DXF A;  4ZDV A;  3NG0 A;  3SFD B;  2ZCC A;  2WXR A;  4YWG G;  1HEZ E;  3E9S A;  1ZXH A;  2BTE A;  4WAA A;  1D5Z C;  2JF5 A;  2J53 A;  2KAJ A;  3PHW B;  3BY4 B;  3BK2 A;  3PV1 A;  2EKE C;  4K1R B;  1FXI A;  1WMH A;  4HWI B;  1OQR A;  3N20 C;  2WXF A;  4M0W A;  2BS3 B;  1C1Y B;  3ETR A;  4US9 A;  2LRW A;  3P1M A;  4II3 B;  2ZJD A;  3KW5 B;  2BS4 B;  4MGY E;  3MC8 A;  3IFW B;  2INN E;  4HVB A;  1IPG A;  3ML9 A;  1M94 A;  1WJN A;  1SXT A;  1EM7 A;  1Z2M A;  5EE1 A;  2H88 B;  4A3O A;  1WMH B;  3U7Z A;  2DYB A;  2KFK A;  5IAA C;  4M0W B;  4MGZ E;  4BOS C;  2LZ6 A;  3KWV A;  1E7P B;  1BUI C;  3N1X C;  3AEB B;  1WE6 A;  4A9A A;  2W9N A;  2K1F A;  2KFJ A;  3Q8A A;  3ZYY X;  2BWE S;  2A4Z A;  3H9D A;  1C4P A;  1WGR A;  1Q1O A;  4AUQ C;  1QLB B;  1QF6 A;  1U4A A;  2K39 A;  2PMV A;  2KFK B;  3VHT C;  2IGG A;  2UYZ B;  3H7S A;  5AUI A;  4A8X C;  4EZJ A;  5BMG A;  3Q14 C;  4RF0 A;  3L4P A;  1P9D U;  1I4R A;  4P1C C;  4D2K A;  1D5X C;  1Q10 A;  1BML C;  2IY0 B;  2BT6 A;  1QIL A;  3RN9 C;  2RGF A;  1JWS D;  3GZN B;  1V9J A;  3RZW C;  3H6N A;  3A4S C;  4M02 A;  4TUU A;  4I6P A;  1TGZ B;  1YIW A;  1AW7 A;  2MCN B;  1TT5 B;  1VLB A;  3SEB A;  2KQ4 X;  1OQQ A;  2JY6 A;  4WWM A;  4A55 A;  2Y5C A;  3K9O B;  2X8X X;  5DPR A;  2ONQ A;  1MI0 A;  3APD A;  2KTR B;  2CHW A;  3AEC B;  2L8J A;  2N9L A;  3DVN V;  2MJE A;  1ZW7 A;  1HXY D;  5CX3 A;  2J0J A;  2LUE A;  3UI3 A;  5EDS A;  5IO9 A;  1KH0 A;  1LQB A;  4NPN A;  3VRB B;  3SDL C;  1KFY B;  1NEK B;  3O65 B;  1E0Z A;  4DHZ E;  2N0S B;  1F2R C;  2GBR A;  5HHD G;  2ZCB A;  2OOB B;  3Q6B A;  3PZ7 A;  2BKF A;  3PRP B;  1N5W A;  4W9E A;  4WJO A;  3UIN B;  2G9H D;  3AE3 B;  1DOY A;  3I57 A;  4DK5 A;  1J7A A;  4G11 A;  4K7U A;  3Q8C A;  3QAR A;  2KKC A;  3L17 A;  2H89 B;  3M3J A;  1XXG A;  2TSS A;  2QJL A;  3FKY A;  1KRH A;  3AB5 A;  4KSL C;  1QOA A;  3HVZ A;  1RRB A;  2AEH A;  1TKE A;  4JIO U;  1E8X A;  4M8N A;  1VZ8 A;  3LJ3 A;  2ZEQ A;  2XK5 A;  1V1O A;  1L4D B;  1S3S G;  3NVV A;  1FNW A;  3IAS 1;  3W5U B;  2CR5 A;  1JRU A;  4MSQ B;  3MJ5 A;  2IND C;  3RFZ B;  2LVO A;  2RDG A;  2BKR B;  2OJR A;  2O6V A;  1WXQ A;  2HD5 B;  3ML8 A;  2YEP B;  3QAQ A;  5EE9 A;  3A1Q A;  1SE3 A;  2HDE A;  2JPH A;  4F8C B;  5GMV A;  5J18 A;  4UDU C;  2LUM A;  4W9J A;  1KF6 B;  3QK0 A;  2XK5 B;  3ZDM C;  2C7N B;  2V3P A;  3WA0 A;  1KTK A;  1TTN A;  3J9C A;  1P3Q U;  1TY0 A;  3T3N A;  4XWT A;  1QT9 A;  3AE7 B;  1S1Q B;  2LD9 A;  2O6V B;  1WGD A;  3NS1 A;  3HM6 X;  4KGS A;  4XYC A;  2M1M A;  3A1Q B;  2K3U A;  4ZRI A;  1PYW D;  3KWL A;  1YQ3 B;  1UD7 A;  1FIQ A;  1WYW B;  4BAX A;  4AP4 C;  3L0W B;  2DBY A;  4L1B A;  4II2 B;  4KSK C;  3DBL B;  2FUG 1;  5I4D A;  3N1Y C;  1RAX A;  1N6Z A;  3U2S C;  4MGI E;  4NQL B;  1Q5W B;  3L08 A;  4IG7 B;  4KIK A;  4HDO A;  2L0T A;  3QX1 A;  4BVU C;  3MHS D;  4NZL B;  1WXV A;  2O6V D;  2G45 B;  1OQY A;  4NNJ B;  4JQW C;  2LGX A;  1C77 A;  2PIA A;  4MJS A;  3N3K B;  1CZP A;  3RZF A;  1NI2 A;  1WRI A;  3AE1 B;  4OZC A;  3WAL A;  4HJK A;  5JXV A;  2L05 A;  2KDM A;  4HEA 1;  1VCB A;  3AE2 B;  5J2R A;  3RNB C;  2Z0E B;  3KLS X;  2ZVO A;  4KIK B;  4G0N B;  2WXH A;  4F7Z A;  1YQ4 B;  3DBH B;  4MJS B;  3ZJV A;  1WGK A;  3ENE A;  2CJO A;  3ZO5 B;  3JYU A;  3ECI A;  2JZZ A;  1QQR A;  2DAJ A;  2KLC A;  2WQY B;  1GPX A;  2KDF B;  4AQ7 A;  1J0G A;  3ZW3 A;  2WHI A;  1XT9 B;  3TSS A;  3AI5 A;  3HK0 A;  1UBI A;  5AEK B;  2REX A;  2PEA A;  2AQ1 B;  2M56 B;  2MEK A;  2E6X A;  1VJK A;  1I4X A;  5C3J B;  3C0R B;  2MLB A;  2WDR B;  4NAW A;  1EU3 A;  1WIA A;  2MBQ A;  1E8Z A;  1K8R B;  2PVO D;  5D94 A;  2PE6 B;  3WAN A;  2FUH B;  2WDQ B;  3V60 A;  4FJY A;  4GDL A;  3SD5 A;  4IM0 A;  1E90 A;  3R7Q A;  3BVG A;  4TV3 A;  3R8B A;  3HM3 A;  2IPK D;  2CKH B;  4KGR A;  2LGS A;  2BF8 B;  3QA8 A;  4NAW B;  3ZNH B;  2MBH A;  2A5U A;  1TY2 A;  2D3A A;  3ZXR A;  3SR6 A;  1OFF A;  3ZJT A;  3BK1 A;  4WAF A;  3IVF A;  2XNA C;  2BBC A;  3AM9 A;  2C7M B;  4GDL B;  4I6L B;  3LXF A;  2IZV B;  1G6J A;  4OZA A;  1QOF A;  4LTU A;  2MA9 B;  1JW9 D;  3DBH I;  2ON8 A;  1ACC A;  2R61 A;  3AE5 B;  3T3O A;  1WXA A;  1ESF A;  1FMA D;  1PGB A;  4XE0 A;  4ZYN A;  4EOY A;  4RGM A;  2IGH A;  2JZP A;  5C23 A;  4OVU A;  2L83 A;  2NS5 A;  3B9J A;  5LXI B;  2NCN A;  3CSF A;  3RNC C;  1T0R C;  5FKA C;  4HPL B;  1NYQ A;  1C79 A;  4IDI A;  2KWC A;  2WXM A;  1ZE3 D;  2WXG A;  2RDB C;  1A70 A;  4C7Y A;  2KAN A;  3B08 A;  4G50 A;  2MBE A;  3VDZ A;  1WXS A;  2QMT A;  2GLS A;  2MX2 A;  2PPH A;  3M63 B;  2MBO A;  1BT0 A;  1GNU A;  2MBB B;  2JQR B;  2BGF A;  3DHG C;  1EO6 A;  3RI7 C;  4NJ6 A;  2L0F A;  2M4N A;  4OW0 A;  2N1W A;  1C78 A;  2ZNV B;  4RF1 A;  3T8M A;  1A5R A;  3VTU A;  3WAM A;  4EZK A;  2DYM A;  5E6N A;  3L13 A;  4N6E B;  3RNA C;  1CK1 A;  4LNO A;  2YVC A;  4JL9 A;  4WH4 A;  2LEK A;  3GE8 C;  3NZU A;  1DOI A;  2J0M A;  4OHJ A;  1J7C A;  1MVK A;  1IGD A;  4GLS C;  1M4V A;  2KMC A;  4AS1 A;  4ASW C;  3TJP A;  4DBG A;  2Z59 B;  1FFU A;  1HQR D;  4HKZ E;  2NBU A;  2KXJ A;  3AE8 B;  1MJD A;  2JXX A;  3MC9 A;  1SIJ A;  4EE2 A;  4LCD E;  4USA A;  1TZO A;  1V1P A;  2KJ6 A;  3Q69 A;  3AMZ A;  1PDX A;  3JSV A;  4KKJ A;  4J6I A;  3EFU A;  3P4Q B;  1R4M I;  3DBR I;  3L54 A;  4BBN C;  1JML A;  4RGN A;  4ARI A;  2FCN A;  2VZK B;  4YTN B;  3H8H A;  4JLC A;  1C4C A;  1GAQ B;  3EEC A;  1K50 A;  4WWO A;  2GBM A;  1ISN A;  1T0Q C;  2L52 A;  3QWZ B;  3V62 A;  1P1A A;  1TS3 A;  1V1P B;  2OED A;  1YD8 U;  1FCL A;  1WI0 A;  3JSV B;  2ZPN A;  5IKC M;  4DHJ B;  3BWU D;  4LNN A;  4ZRJ A;  1Y56 A;  4W9D A;  4HLE A;  3DHH C;  1GC6 A;  1P7F A;  1ET6 A;  2D10 A;  2IGD A;  2W55 A;  3MJW A;  3WAP A;  4AWJ A;  2Y5B B;  2VZK D;  5JHA A;  1V81 A;  2FAZ A;  3KYC D;  2K5P A;  5AUK A;  4FJV B;  4E3C A;  3FAH A;  5AZF A;  3EGR A;  5D2M B;  1HA5 A;  1C9F A;  2L1A A;  2LHD A;  2VRR B;  3UF8 A;  1H8C A;  2WXK A;  3W9C B;  4DHJ D;  2L76 A;  4ZYS A;  3UQB A;  4WJQ A;  2KX3 A;  3BII D;  3RYT A;  3VTW A;  4FUL A;  1T0S C;  4K3B A;  1E9M A;  3ZUN A;  1BXT A;  2K8C A;  3PRE A;  1VR9 A;  4GDK A;  2ZZP B;  1T0Y A;  3TUO A;  2CHZ A;  2K8H A;  5JHB A;  1WWT A;  3GP7 A;  3P63 A;  2N9E B;  1E10 A;  2KLG A;  4REZ A;  1JWB D;  3HVD A;  4NAM A;  3TEZ A;  3DDC B;  1RM6 C;  1SIF A;  3ZLZ A;  2WXO A;  2LAS A;  3PO0 A;  2NVU I;  5CHW A;  3NRZ A;  3GE3 C;  2W82 A;  4LJP B;  1FPY A;  3ZTC A;  3Q3N C;  3GS2 A;  4XZ4 A;  2VH1 A;  3L16 A;  3M95 A;  2WXQ A;  2PTL A;  1YJ1 A;  3DOW A;  2ZNV C;  4GDK B;  4WQO B;  3X23 A;  3L10 B;  2HJ8 A;  3QQ8 B;  4BKT A;  4W9K A;  3HUI A;  2GBN A;  2KAC A;  2KNB A;  3A33 B;  2GRI A;  2AQ3 B;  2QDF A;  1EUV B;  3AH7 A;  1JAL A;  4BKS A;  3Q8F A;  3RNF C;  2RDH A;  3N32 A;  1ZOY B;  4Q2J A;  2WP9 B;  4N59 A;  2K6D B;  4K7W A;  2K25 A;  1N63 A;  1GB1 A;  5KHQ A;  1EWY C;  3WCQ A;  4FAD A;  3PSE B;  2D07 B;  3OLM D;  3MP9 A;  3A9J A;  4LNK A;  4A6Q A;  2KN4 A;  2XBB C;  1V80 A;  3EFC A;  1FCC C;  1NBF C;  1ET9 A;  1XLP A;  5BYS A;  3LDZ E;  2OJW A;  2C60 A;  4TKN A;  1ZP0 B;  2CU3 A;  1PQS A;  4PYZ A;  1WR1 A;  2QSD A;  2X38 A;  3V61 A;  1X1M A;  1RFK A;  1YN5 A;  1STE A;  2IBI B;  2KYW A;  1GC7 A;  5C1Z A;  2INP E;  1JWM D;  2KWD A;  3IG3 A;  2MJ3 A;  1C76 A;  3OJ3 A;  2RR9 A;  2Y5P A;  2E3T A;  2BYT A;  2M8S A;  3T9L A;  3A9J B;  3BIN A;  1SJE D;  3VH4 B;  2J42 A;  1E7V A;  3PPA A;  3AU5 A;  3EHV A;  3Q3J A;  4JPS A;  1EU4 A;  4BKS D;  3K9P B;  4LK0 M;  1XLO A;  2ACZ B;  2MP2 A;  1WX8 A;  3I5J C;  4TQ0 A;  1WR6 E;  1K51 A;  2KDB A;  3UIP B;  4MH0 E;  3UQA A;  5BO4 B;  1XO3 A;  3MFG A;  1C4A A;  1YJJ A;  3AE4 B;  2GOW A;  2KO3 A;  4P16 A;  5LXH A;  1HTQ A;  4ICU A;  2KC1 A;  4AJW A;  3PZD A;  4ACF A;  2LXC A;  4YL8 A;  1V5O A;  3X0W A;  1AN8 A;  1L7Y A;  4RFB A;  2LI5 A;  4DWF A;  4MDK E;  1I35 A;  1KJT A;  4FHK A;  1GUA B;  3BZD B;  2J7Q B;  4MEL A;  3DWM A;  1NEN B;  2ZW1 A;  2WXJ A;  1PFD A;  2WX1 A;  3E56 A;  2BPS A;  2PE9 A;  3B2F A;  1ROE A;  4N58 A;  1VDV A;  2JZ3 B;  3B2G A;  3CMM B;  2JYE A;  1LO5 D;  5D3I B;  2DX5 B;  1F52 A;  2N9P C;  2IY1 B;  2M17 A;  4K81 A;  2LGI A;  4CHK A;  3NHE B;  4KVG B;  5IP4 D;  1Q0W B;  3Q8B A;  1T3Q A;  3PGE A;  2NTT A;  2VH2 A;  3VR8 B;  2BB5 A;  5CHV C;  4KX6 B;  2I2Y A;  2N7J A;  1KOT A;  1WGG A;  1JQ4 A;  1TJE A;  3PHX B;  4A90 A;  2DYO A;  2KC2 A;  2Z0D B;  2CJN A;  1N60 A; 
#chains in the Genus database with same CATH homology
 1H4R A;  2BF8 B;  2G4D B;  3U7D A;  2KHW B;  4WAA A;  3B1L X;  5DPW A;  3QA8 A;  4GU2 A;  2JF5 A;  2MBH A;  4NAW B;  2IO0 B;  3ZNH B;  5J17 A;  2FCS A;  2A5U A;  2KWU B;  1RLF A;  3PHW B;  2LXA A;  3BY4 B;  2KMA A;  3IBE A;  2LGD A;  3MTN B;  3PV1 A;  2EKE C;  4K1R B;  3ZKJ C;  4G3X B;  1WMH A;  4WJP A;  3IVF A;  1MG8 A;  2KX0 A;  4HWI B;  3A4R A;  2KDI A;  2V4L A;  2C7M B;  2AWT A;  4GDL B;  3PS6 A;  1C1Y B;  2IZV B;  4I6L B;  2LRW A;  4II3 B;  1G6J A;  2MA9 B;  4MEM A;  2ZJD A;  3ALB A;  3DBH I;  3KW5 B;  3NOB A;  4MGY E;  1RFA A;  1E7U A;  2JRI B;  2N1V A;  3VTV A;  1R4N I;  4HK2 A;  1WXA A;  3DCG A;  1V6E A;  3IFW B;  4ZYN A;  3ZRF A;  4HCP B;  5E6O A;  4EOY A;  3NZS A;  4HVB A;  1GG3 A;  3VFK A;  5C23 A;  4OVU A;  1IPG A;  3ML9 A;  2JWZ A;  1M94 A;  1WJN A;  2NS5 A;  3ZRC A;  2NCN A;  5LXI B;  3CSF A;  3SU8 X;  2L3Z A;  4HPL B;  1Z2M A;  2R2O A;  2LJ5 A;  4HXD A;  2KWC A;  2GBJ A;  3ZNI D;  4A3O A;  1WMH B;  5L95 C;  1EF1 A;  2RD0 A;  5IA7 A;  2DYB A;  2KFK A;  5IAA C;  4M0W B;  2C9W B;  2KAN A;  3B08 A;  4G50 A;  4MGZ E;  3PLU A;  4BOS C;  2MBE A;  2LZ6 A;  4ICV A;  4XC2 A;  3VDZ A;  1NDD A;  3ONS A;  4HDQ A;  1WXS A;  3PTF C;  5LLI A;  2MX2 A;  2PPH A;  4ANV A;  1WE6 A;  3M63 B;  4TQ1 A;  2MBO A;  1BT0 A;  1GNU A;  2MBB B;  1Y8R C;  2W9N A;  4WWN A;  2K1F A;  2BGF A;  2KFJ A;  1EF5 A;  2LRU A;  3NS8 A;  1EO6 A;  2BWE S;  4IC7 B;  2A4Z A;  3H9D A;  5HKH A;  4NJ6 A;  4RMA A;  4CYE A;  4PS8 A;  1WJU A;  2AL3 A;  2MP2 B;  4N9F 4;  2G3Q B;  2L0F A;  4URK A;  2M4N A;  3R3M A;  1WGR A;  2N1W A;  1I42 A;  2ZNV B;  1Q1O A;  5D7G A;  1J19 A;  3AXC A;  4AUQ C;  1U4A A;  3T8M A;  3DPD A;  3VTU A;  3WAM A;  4EZK A;  2K39 A;  2DYM A;  1A5R A;  5E6N A;  2KFK B;  3L13 A;  3VHT C;  2ZVN A;  4FBJ B;  2FIF A;  2KWV B;  1D3Z A;  4W9L A;  2YVC A;  4FLH A;  4JL9 A;  2UYZ B;  2YLM A;  3GZN I;  3H7S A;  3NZU A;  1AAR A;  1V5T A;  4EZJ A;  3DBS A;  2GMI C;  2J0M A;  3W1S A;  4EUT A;  1P9D U;  2DAF A;  1HE8 A;  2V1Y A;  4BOZ B;  2MQJ A;  4KZC A;  2KMC A;  1V2Y A;  1WJ4 A;  4EZL A;  4ASW C;  3TJP A;  5G55 A;  4DBG A;  1V49 A;  2DEN B;  2Z59 B;  3QCA A;  4W9H A;  3PRZ A;  4ZRK A;  1WJ6 A;  5CTR C;  2IY0 B;  2BYV E;  2NBU A;  4GN1 A;  2UWQ A;  4DHZ B;  2KXJ A;  4GIV A;  3ZNG C;  2JXX A;  3CF6 E;  1OEY J;  2RGF A;  3H7P A;  1WX9 A;  2MSE D;  4LCD E;  1V9J A;  1XD3 B;  4JGH B;  3RZW C;  3H6N A;  3A4S C;  1TBE A;  2N9X A;  4GMV A;  2WYQ A;  4TUU A;  1E8W A;  2KJ6 A;  3JVZ X;  3N30 A;  1C3T A;  4I6P A;  1TGZ B;  1YIW A;  2MCN B;  3JSV A;  4F1S A;  4WWP A;  3VAW A;  4J6I A;  1GJZ A;  3EFU A;  2EMT A;  4MGK E;  3R7R A;  3RUI B;  4E71 A;  2JY6 A;  3PRM B;  1R4M I;  2K6Q A;  3DBR I;  3L54 A;  4BBN C;  2KJH B;  4A20 A;  1XQQ A;  1Z5S B;  3K9O B;  3APC A;  5DPR A;  2DHZ A;  4GXB A;  4RM9 A;  3KH0 A;  2WX0 A;  2FCN A;  3APD A;  4IW0 A;  2KTR B;  1J8C A;  2CHW A;  4JLC A;  3U8Z A;  2L8J A;  4GGQ A;  1LFD A;  3DVN V;  3EEC A;  4NJ7 A;  5CHF A;  4WWO A;  2GBM A;  1ISN A;  1LXD A;  3H7P B;  1ZW7 A;  5CX3 A;  3QJZ A;  2J0J A;  2LUE A;  5EDS A;  3QWZ B;  3V62 A;  1WGH A;  1P1A A;  1LQB A;  1YD8 U;  2KN5 A;  3DVG X;  3GOE A;  3KYD D;  4NPN A;  3SDL C;  2ASQ A;  2KQS A;  1WI0 A;  3I3T B;  1CMX B;  2ZPN A;  3JSV B;  3O65 B;  3CST A;  2N7E A;  4IWP A;  4W9I A;  4DHZ E;  1UGM A;  5TR5 A;  2GBR A;  2KD0 A;  2L7R A;  2ZCB A;  4DHJ B;  4BKG A;  2JT4 B;  2BYE A;  2OOB B;  2BKF A;  3PRP B;  4W9E A;  4WJO A;  3VH3 B;  4ZRJ A;  3UIN B;  3APF A;  4W9D A;  3VUW A;  4HLE A;  3PT2 B;  1GC6 A;  4HCN B;  2WDT B;  1WM3 A;  2D10 A;  3M62 B;  2IO1 B;  3MJW A;  3WAP A;  4AWJ A;  4DK5 A;  4G11 A;  2Y5B B;  5JHA A;  2DZM A;  3IHP C;  4K7U A;  3TCA A;  1V81 A;  2O2V A;  3QAR A;  1KM7 A;  3QIJ A;  2FAZ A;  4IM3 A;  3KYC D;  3WIM A;  3RCZ A;  2KKC A;  2EMS A;  4FJV B;  4E3C A;  1YQB A;  3L17 A;  2DZI A;  5AZF A;  3RT3 B;  1IYF A;  2KK8 A;  3P2B A;  5D2M B;  3M3J A;  2C7H A;  4P7I A;  2DZK A;  2VRR B;  3UF8 A;  1H8C A;  2N7D A;  4DHJ D;  3TMP B;  2L76 A;  1WM2 A;  3UQB A;  4ANU A;  3QHT A;  1IP9 A;  4WJQ A;  2KX3 A;  3NY5 A;  3RYT A;  3VTW A;  4FUL A;  4KSL C;  3ZUN A;  2K8C A;  3PRE A;  4GDK A;  1RRB A;  2AEH A;  2ZZP B;  1T0Y A;  2O2V B;  1P0R A;  1KLV A;  2CHZ A;  2K8H A;  5JHB A;  4JIO U;  1E8X A;  4M8N A;  2NBV B;  2N9E B;  3EC8 A;  2KLG A;  3TL5 A;  1ZKH A;  1OEY A;  2WWZ A;  4KZ0 A;  3LJ3 A;  5KHO A;  2ZEQ A;  3VUY A;  2XK5 A;  3ZIM A;  4MSM B;  1WF9 A;  3DDC B;  1SIF A;  2V3S A;  3ZLZ A;  1S3S G;  4IUM B;  4OVV A;  2CR5 A;  2LAS A;  4B95 A;  2M0X A;  1JRU A;  2NVU I;  4MSQ B;  2KJR A;  5CHW A;  2LGY A;  4LJP B;  4HPM B;  3ZTC A;  2HTH A;  3AUL A;  2AYO B;  4XZ4 A;  2LVO A;  3L16 A;  2BKR B;  2OJR A;  2O6V A;  3M95 A;  2HD5 B;  3ML8 A;  4E74 A;  1WZ0 A;  2NBW B;  1YJ1 A;  3DOW A;  2ZNV C;  4GDK B;  4WQO B;  3X23 A;  3L10 B;  1L2N A;  3QAQ A;  2HJ8 A;  1YX5 B;  3QQ8 B;  4W9K A;  4BKT A;  3A1Q A;  2JUO A;  3B0A A;  2GBN A;  4LJO B;  2KNB A;  3A33 B;  4LDT B;  3V6C B;  2DZJ A;  4DDG D;  2JPH A;  4F8C B;  5GMV A;  5J18 A;  1F9J A;  1EUV B;  1LM8 B;  4W9J A;  3QK0 A;  2XK5 B;  4W9C A;  3ZDM C;  4BKS A;  2C7N B;  3DQV A;  4CO7 A;  3N32 A;  3WA0 A;  3OJ4 B;  1TTN A;  3DBL I;  2D11 A;  1QZE A;  2K6D B;  1P3Q U;  2K25 A;  4K7W A;  5E6P A;  1WH3 A;  2C5L C;  5KHQ A;  1S1Q B;  3W1Y A;  2LD9 A;  4EEW A;  4ANW A;  2O6V B;  3PSE B;  2D07 B;  3OLM D;  3VQI A;  4FAD A;  1WGD A;  3R66 C;  2MWS B;  3HM6 X;  3A9J A;  2M1M A;  4PS3 A;  4XX5 A;  2FCM A;  3A1Q B;  2XBB C;  3WAO A;  4NY0 A;  4LDT D;  1V80 A;  4ZRI A;  1NBF C;  3RD2 A;  3ZTD A;  1UH6 A;  4KDI C;  3LDZ E;  2NR2 A;  4X57 B;  4PYU A;  2C60 A;  4TKN A;  4B6W A;  1UD7 A;  5G2N A;  1WYW B;  1PQS A;  3W1S C;  2FID A;  3L0W B;  4PYZ A;  4AP4 C;  3D32 A;  2CHX A;  2LVQ A;  1WR1 A;  2N4F A;  3HHM A;  4II2 B;  3Q3F A;  4KSK C;  3V61 A;  1X1M A;  4NQK E;  1RAX A;  2BWF A;  3KUD B;  2JVC A;  4MGI E;  4NQL B;  1Q5W B;  2IBI B;  3L08 A;  1GC7 A;  4IG7 B;  4KIK A;  4HDO A;  5C1Z A;  3IG3 A;  4DDI D;  2L0T A;  3A9K A;  3OJ3 A;  3QX1 A;  3MHS D;  2RR9 A;  4BVU C;  4AJY B;  3QC8 B;  5FR6 A;  3KUZ A;  3ZDT A;  1WXV A;  2O6V D;  2G45 B;  5DPT A;  1OQY A;  2M8S A;  4NNJ B;  2FNJ B;  3A9J B;  3BIN A;  2LGX A;  4JQW C;  2KVR A;  4MJS A;  3T9L A;  3V6E B;  3N3K B;  3KVF B;  3VH4 B;  1WY8 A;  2D2Q A;  2G4S A;  4W9G A;  1E7V A;  3RZF A;  4ANX A;  1WFY A;  2HE7 A;  1NI2 A;  4RM8 A;  3PPA A;  3AU5 A;  4KV2 A;  3EHV A;  3Q3J A;  3VXW A;  4FJZ A;  5DCN A;  1WGY A;  2KQ7 A;  3WAL A;  1E5W A;  1WXM A;  3DVG Y;  4HJK A;  1YX6 B;  3TIX A;  2L05 A;  4BKS D;  2I1J A;  3K9P B;  2L00 B;  2CS4 A;  1VCB A;  5J2R A;  2FCQ A;  2Z0E B;  2PJH A;  5JZE B;  2MP2 A;  5DPS A;  2ZVO A;  4KIK B;  1WX8 A;  3PLV A;  1WX7 A;  2GBK A;  3A9K B;  4G0N B;  4TQ0 A;  1WR6 E;  1SE9 A;  3U30 A;  2KDB A;  2RSU A;  3UIP B;  3ZNZ B;  4BBN F;  4FHJ A;  4MH0 E;  5AZG A;  3UQA A;  5BO4 B;  4F7Z A;  3H1U A;  4MJS B;  2GOW A;  2KO3 A;  4EFO A;  1ZGU B;  2CU1 A;  2RPQ A;  5LXH A;  4WJN A;  2D3G A;  2B3A A;  4DXA B;  4ICU A;  3ENE A;  3SHQ A;  2KC1 A;  2AL6 A;  3ZO5 B;  4AJW A;  3JYU A;  3PZD A;  3ECI A;  1UBQ A;  2LXC A;  3PVL A;  4YL8 A;  1FXT B;  1OGW A;  2ZPY A;  1V5O A;  4IWQ A;  2JZZ A;  2DAJ A;  2KLC A;  5L83 A;  4A3P A;  1WRD B;  2KOX A;  4GOC A;  3X0W A;  1L7Y A;  4GB9 A;  1VD2 A;  2LVP A;  3HIZ A;  2LI5 A;  4DWF A;  2I1K A;  4MDK E;  1I35 A;  2KDF B;  1J0G A;  3ZW3 A;  1KJT A;  4IM2 A;  1OTR B;  3DVN U;  1XT9 B;  2IYD B;  4FHK A;  4K7S A;  1WE7 A;  2NPT A;  1GUA B;  3AI5 A;  3HK0 A;  2J7Q B;  4MEL A;  4AOF A;  1UBI A;  2IO3 B;  3KUC B;  1E8Y A;  5AEK B;  2REX A;  2PEA A;  4MM3 A;  2QHO A;  4GSW A;  4B9K A;  2WX1 A;  1TZ1 A;  2KZR A;  3OAW A;  1V86 A;  3RUL A;  2IO2 B;  1SGH A;  2BPS A;  2MW5 A;  2PE9 A;  1WZ3 A;  4I6N B;  4EKU A;  2JZ3 B;  5JH5 C;  2K8B A;  2JRH A;  3TBL D;  2KDE B;  3CMM B;  1UZX B;  3C0R B;  2DX5 B;  4BFR A;  2MLB A;  2N9P C;  4FN2 A;  4NAW A;  1WIA A;  2IY1 B;  2J0K A;  2MRP A;  2M17 A;  4K81 A;  2MBQ A;  2R2Q A;  2KTR A;  3UIO B;  4FA6 A;  3JW0 X;  3VVW B;  4CHK A;  3NHE B;  4KVG B;  1E8Z A;  2LWP A;  1K8R B;  1UEL A;  1Q0W B;  3PGE A;  4IWO A;  3AU4 A;  5D94 A;  1P98 A;  2PE6 B;  2FUH B;  2NPT B;  5D6J B;  3WAN A;  3V60 A;  4FJY A;  5AZH A;  5CHV C;  4GDL A;  3SD5 A;  4W9F A;  4M8M A;  1KOT A;  1WGG A;  4IM0 A;  3PHX B;  1E90 A;  2XEW A;  2BYF A;  3R7Q A;  3S2A A;  4PS7 A;  2DYO A;  4KDL B;  2KTF A;  3VUX A;  4ZDV A;  4TV3 A;  2KC2 A;  2Z0D B;  3UGB B;  2ZCC A;  3ZVV A;  3HM3 A;  2CKH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...