2FCSA

X-ray crystal structure of a chemically synthesized [l-gln35]ubiquitin with a cubic space group
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEQIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Dissecting the energetics of protein alpha-helix C-cap termination through chemical protein synthesis.
pubmed doi rcsb
molecule tags Structural protein
total genus 21
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fcsA00
2AWTA 4IUMB 4DDID 1ISNA 4GOCA 3WIMA 2DAFA 3PREA 1WJ6A 1QZEA 2KANA 3NY5A 4TUUA 1A5RA 5JHBA 3K9OB 1NI2A 1OEYA 4HWIB 1LQBA 4I6LB 4KV2A 5IAAC 2LI5A 3NS8A 3RD2A 5IA7A 2L8JA 4LCDE 2ZEQA 2M17A 1OGWA 4GXBA 3H1UA 3DBHI 3RULA 4BBNF 3ZW3A 5D2MB 1E8YA 3MTNB 2GBRA 3W1SC 1E8WA 2KMCA 3ZVVA 1V81A 2BKRB 5DCNA 1R4MI 1WE6A 4GIVA 5LXHA 4ICVA 4WWOA 3R7QA 3QC8B 2KO3A 1WF9A 1Z2MA 1R4NI 5LLIA 1P1AA 4A3PA 4KDLB 1WGDA 3TJPA 2NR2A 2MX2A 5JZEB 2Z59B 2RGFA 3PRPB 1PQSA 4FJVB 1VCBA 3PZDA 1U4AA 1VD2A 2KTRB 4TQ1A 3ZNHB 4DBGA 4HK2A 5HKHA 4HXDA 2KZRA 1WYWB 2R2OA 1CMXB 2Z0DB 3AI5A 3DDCB 3PHXB 4URKA 3KH0A 3KUZA 5BO4B 1F9JA 4FHKA 4BKGA 3QAQA 3L08A 3SU8X 2FCQA 1V5OA 1G6JA 2GBKA 2ZCCA 4XC2A 3V61A 2JZZA 3ALBA 4NQKE 2MBHA 3HHMA 4IM0A 4BKSA 5JH5C 3M62B 2DZJA 4IWPA 3JYUA 4WJOA 3PRMB 2L76A 1ZKHA 2FNJB 4BOSC 4MM3A 3QHTA 1Q1OA 3DVGY 4G0NB 1V9JA 4AP4C 1IP9A 5KHOA 2FCSA 2PEAA 1EO6A 3QIJA 5GMVA 2UWQA 3JSVA 1ZGUB 4W9IA 4P7IA 3PSEB 1YJ1A 3IHPC 5EDSA 3JW0X 3RCZA 3T9LA 3H7PA 3PRZA 3ZUNA 4FADA 1UGMA 2KWVB 1H8CA 1E8XA 2BF8B 1RAXA 4EEWA 1WE7A 3RZFA 3H7PB 1WJUA 3AU4A 3VTWA 3VH3B 2D2QA 2IO3B 2DYMA 4AWJA 2JXXA 3RT3B 2D11A 1LXDA 1XD3B 4XZ4A 4HPLB 2EKEC 1GC7A 3PLUA 3H9DA 1GNUA 4IM3A 3A4SC 2MP2A 1GJZA 2MWSB 2I1KA 3P2BA 3CSTA 2KXJA 4W9DA 2MBEA 3WAMA 3BY4B 2BGFA 2KDEB 2WWZA 4KSKC 1KLVA 1WXVA 2MP2B 4OVVA 2K8CA 2KFJA 2NVUI 2K6QA 1E5WA 4KSLC 3S2AA 4BBNC 4HDOA 2N1VA 2NPTA 1KM7A 2BKFA 4ZDVA 3ZNZB 3V6EB 4TQ0A 4LDTD 2WDTB 4FLHA 3IG3A 2O6VD 4KDIC 5FR6A 4N9F4 3ECIA 5AZHA 2ZZPB 3NHEB 3A33B 5J2RA 2GBMA 5AZFA 1J0GA 1YX6B 2KK8A 2KX3A 2XBBC 2DZMA 2Y5BB 4LJPB 1JRUA 2KC1A 3GOEA 1V2YA 2V1YA 2GMIC 2XK5A 4NY0A 4ANVA 3ZLZA 3V6CB 1LFDA 3ZRCA 3DOWA 3L0WB 3NZUA 1UBIA 4DDGD 2IYDB 3SD5A 1H4RA 3PHWB 2KFKB 2K6DB 3AULA 4XX5A 1RLFA 3KVFB 4B6WA 4EKUA 2MW5A 1UELA 2LD9A 2DYBA 5CX3A 2G4DB 2ZPNA 4B9KA 4NAWA 4WQOB 1YD8U 3Q3FA 3EECA 2FAZA 2IO0B 5DPSA 2EMSA 3RUIB 4NAWB 2NBVB 4ANXA 2LVQA 2NS5A 1Y8RC 3VXWA 4II2B 3HIZA 2DENB 3GZNI 2J0MA 2K8HA 2LGDA 2RD0A 3L17A 3TIXA 3V60A 1YQBA 2L3ZA 5L95C 1I35A 1Q0WB 3EFUA 2HTHA 3A1QA 3PS6A 2IY1B 4JLCA 3W1YA 3DBRI 2JZ3B 3A1QB 3U8ZA 4EUTA 1GG3A 4MJSA 1X1MA 3K9PB 1GUAB 2K1FA 4BOZB 4E3CA 2FIDA 3BINA 4K81A 2K39A 3A9JA 4MJSB 2L0TA 2MLBA 4J6IA 2CHXA 3QQ8B 2JRHA 4WJQA 3A9JB 2MRPA 2KLCA 2GOWA 5G55A 3A9KA 4ZRIA 2N4FA 1UZXB 2PE9A 2LXCA 3EC8A 1KOTA 1P9DU 4ASWC 2D3GA 1M94A 2BPSA 2O6VA 4M8MA 1L7YA 1P0RA 3ZDTA 3HM3A 3OJ4B 4JIOU 4LDTB 5J18A 3CMMB 1WX9A 3PV1A 2KMAA 4IWQA 3ZTCA 3UINB 3LDZE 4I6NB 3APFA 3KW5B 2GBNA 4BFRA 1OEYJ 3L13A 4EFOA 3B1LX 5C23A 2DAJA 1UH6A 4FA6A 2A4ZA 2BWES 5DPTA 2IZVB 4AJYB 1V86A 4II3B 3OJ3A 2IO2B 4MH0E 2LGYA 2LWPA 2DYOA 2LRWA 3DBLI 3M3JA 5CHFA 2MBOA 2O2VA 2LUEA 4M8NA 3VTUA 3X23A 5AEKB 4DHJD 3JSVB 2N7DA 3RZWC 1E7UA 2MSED 4BKTA 2D07B 2IY0B 2O2VB 2B3AA 5CHWA 3WALA 1GC6A 1WIAA 4DWFA 2KC2A 1WXSA 5E6OA 3VUXA 2KJ6A 2DHZA 2WX0A 4G11A 5AZGA 2BYEA 2NCNA 3DCGA 2HE7A 2C5LC 1YIWA 2ZCBA 4PS7A 2M0XA 1V6EA 3OAWA 4M0WB 4DHZE 3KUDB 4A20A 3UQAA 2FCNA 2V4LA 4AUQC 3SDLC 2ZPYA 2RSUA 4MGIE 1IPGA 4NJ6A 3VQIA 3VUWA 1E90A 2ZNVB 2LXAA 4PYZA 1K8RB 2KDIA 4MGZE 2A5UA 3HK0A 4GU2A 3VFKA 2IBIB 2PE6B 4GB9A 2JY6A 3MJWA 4FULA 3N32A 4ZRJA 2G3QB 2YLMA 2KNBA 3NZSA 4W9JA 4ANWA 4CYEA 4KIKA 4FBJB 2NBWB 4BVUC 5KHQA 1FXTB 3X0WA 2WX1A 3ENEA 2NPTB 3DQVA 2BYVE 4IW0A 4K7SA 4RM9A 3EHVA 1BT0A 2CKHB 2KKCA 3H7SA 4W9FA 1AARA 4F1SA 4E71A 3DVNV 2KJRA 2G4SA 3VVWB 1V5TA 2RPQA 3PTFC 2UYZB 3B08A 4GDKA 1I42A 3W1SA 4MGKE 4FHJA 3PLVA 1UD7A 4GDKB 2LVOA 3PPAA 3B0AA 2XK5B 2CU1A 2KWUB 4G3XB 1TZ1A 4K1RB 3APCA 1SE9A 1SGHA 2LZ6A 3UQBA 3ZRFA 1TTNA 2KX0A 5TR5A 2KVRA 1WZ3A 1SIFA 1WH3A 2C60A 2OJRA 5E6PA 5JHAA 2BWFA 1WRDB 2I1JA 3CF6E 2MQJA 5C1ZA 4W9EA 2RR9A 2N9PC 3T8MA 3AXCA 3ZNID 4W9CA 1P98A 2AL3A 4JL9A 3O65B 2L05A 2WYQA 1WX7A 2DX5B 1C1YB 3ONSA 4MSMB 2LGXA 3R7RA 3ZO5B 4KVGB 4WAAA 3JVZX 1WR1A 1WFYA 2C7HA 2VRRB 3WA0A 4AJWA 3DPDA 1WM3A 4GN1A 2MA9B 2GBJA 3PVLA 1LM8B 2KWCA 4W9KA 4DHJB 1WI0A 1XQQA 4MGYE 4K7UA 2ZNVC 5D7GA 1E8ZA 4TV3A 2JUOA 2KQSA 4EZJA 1T0YA 1UBQA 2KHWB 2M8SA 2LJ5A 4K7WA 5L83A 2EMTA 2KD0A 2ZVNA 4IG7B 3D32A 3U30A 3UIOB 3L54A 5DPRA 3WANA 1WGHA 3IFWB 2NBUA 1J19A 1TGZB 2QHOA 4GDLA 3TL5A 5CTRC 3UIPB 4DK5A 4HCNB 2KQ7A 4EZLA 2XEWA 1YX5B 4IC7B 4GDLB 4WWNA 1WM2A 4EOYA 1Q5WB 4F7ZA 3A9KB 4YL8A 3VAWA 4DHZB 2KLGA 2N1WA 4HLEA 4G50A 4OVUA 3WAPA 2Z0EB 3Q3JA 2R2QA 2O6VB 1WGGA 3HM6X 3KYDD 1E7VA 3TBLD 3CSFA 2JWZA 1WGYA 2HJ8A 4GMVA 4FN2A 2JF5A 1WJ4A 5CHVC 1NBFC 1C3TA 4X57B 2CHZA 2LVPA 4ICUA 2KTRA 3M95A 4JGHB 3IBEA 3ML9A 5G2NA 2L00B 4RMAA 3UF8A 3ZDMC 4EZKA 4IM2A 3PT2B 1RRBA 3TMPB 3UGBB 4FJZA 2HD5B 3QWZB 1V49A 2YVCA 4ZRKA 2KDFB 2FIFA 2PJHA 3QCAA 4HCPB 2LRUA 3L16A 4W9GA 2ZJDA 2N9EB 3VDZA 3WAOA 2FUHB 4ANUA 2MCNB 3QJZA 3QX1A 3SHQA 3TCAA 4WJNA 2JVCA 4NPNA 2REXA 3PGEA 4MEMA 3R66C 4PS8A 3VHTC 3C0RB 1WR6E 2OOBB 2V3SA 1RFAA 3APDA 3M63B 4HVBA 1WGRA 1V80A 2CHWA 3DVGX 3ML8A 2L7RA 4RM8A 3N30A 1OTRB 1XT9B 2MBQA 1P3QU 2D10A 3A4RA 4A3OA 2KDBA 2J0JA 4MDKE 2AYOB 3U7DA 5E6NA 2DZKA 2K8BA 3QA8A 2KJHB 2DZIA 5J17A 3VUYA 3KYCD 4WJPA 2JRIB 2CS4A 4I6PA 4B95A 1EUVB 2JPHA 4E74A 1S3SG 4KIKB 4CO7A 3NOBA 1WXAA 1WMHA 1OQYA 4KZ0A 4W9LA 1IYFA 4HPMB 1WMHB 2K25A 1L2NA 2ASQA 4GSWA 4F8CB 1HE8A 3DBSA 1S1QB 1KJTA 3H6NA 3QK0A 3I3TB 4KZCA 1WXMA 3ZIMA 4ZYNA 1D3ZA 2C7MB 1WZ0A 1WY8A 3OLMD 3V62A 3R3MA 2M1MA 2LASA 2AL6A 1TBEA 1MG8A 3MHSD 3N3KB 1Z5SB 3LJ3A 2W9NA 3ZKJC 2G45B 4CHKA 2C9WB 1ZW7A 4DXAB 2AEHA 1EF5A 2CR5A 3VH4B 1J8CA 2JT4B 5LXIB 2L0FA 4GGQA 5D6JB 2C7NB 2ZVOA 3AU5A 3QARA 4NQLB 4PS3A 5D94A 4BKSD 3ZTDA 2N9XA 2J0KA 2KFKA 2J7QB 4IWOA 2BYFA 5DPWA 3VTVA 4PYUA 4MELA 4NNJB 4HJKA 4TKNA 4JQWC 3L10B 4HDQA 4FJYA 2KOXA 3IVFA 3KUCB 1NDDA 2PPHA 2KN5A 1EF1A 1WJNA 4NJ7A 2FCMA 4AOFA 2IO1B 2N7EA 1WX8A 2MBBB 4LJOB 4WWPA 4W9HA 3DVNU 2KTFA 3ZNGC 3RYTA 4MSQB 2M4NA
chains in the Genus database with same CATH superfamily
1Q10A 2SAKA 5G5HA 1TS2A 5GXGB 3K9OB 4HWIB 4I6LB 2LI5A 3NS8A 3RD2A 2ZEQA 3DBHB 3RMKC 2GBRA 3TUOA 2BBCA 3ZVVA 4WWOA 1B1ZA 1WF9A 3HVDA 2PMVA 5LLIA 5I4DA 5H8YE 1WGDA 5JZEB 2RGFA 4L23A 4FJVB 3P63A 3ZNHB 4TQ1A 2KWDA 2KZRA 1WYWB 2ZW1A 4LNIA 4URKA 5BO4B 3L08A 5EE0A 2QEJC 1TS4A 4ARIA 3BZDB 3FKYA 2ZCCA 4OZBA 2JSVX 1YJJA 5JH5C 4BKSA 5IO9A 1J7AA 1SE2A 2N7JA 2WP9B 1QLBB 4HJGE 4AP4C 1N6ZA 1AWDA 1ZGUB 1P7FA 1T0QC 1YJ1A 1VR9A 1FEHA 1L0VB 1ZOYB 1HXYD 3PRZA 3AN1A 2Y3AA 1E8XA 1RAXA 1JQ4A 1VJKA 1WJUA 4WH4A 2H89B 1YQ3B 2EKEC 3PLUA 3CSTA 2MBEA 3WAMA 3BY4B 3B2FA 1KLVA 2KFJA 1TKYA 3Q14C 1KM7A 1C4AA 2BKFA 3V6EB 2OJWA 4LDTD 3IAS1 2O6VD 2GRIA 4KDIC 3R2TA 1D4BA 3ECIA 5AZFA 1J0GA 1DOXA 2DWQA 1YX6B 1V2YA 4DDGD 4RGNA 3SD5A 3ETRA 4YTPB 2RMMA 4XX5A 1RLFA 4B6WA 1N5XA 2G1EA 3N9YC 2L83A 1TIFA 1KH0A 2K8HA 2RD0A 2Y5PA 3V60A 2INCC 5L95C 3IAM1 1Q0WB 2HTHA 3A1QA 3O13A 3PS6A 2WLBA 1ZXHA 2JZ3B 3BK1A 4ZOHC 4MJSA 1GUAB 2K1FA 4BOZB 4ZRPA 2HTME 2K39A 2L0TA 2MRPA 1QOGA 2M19A 3EC8A 1KOTA 1JWSD 1E0ZA 2WS3B 4ASWC 3BVZA 2O6VA 1L7YA 2KDMA 3OJ4B 4JIOU 3PV1A 3AEAB 4IWQA 4I6NB 2DNFA 3MP9A 5FK9C 1LGRA 3RNFC 5C23A 1SB3C 2W54A 2IZVB 4JWUC 4AJYB 4ARCA 4MH0E 2LGYA 2O2VA 1C4PA 4M8NA 3SEBA 3RNAC 4DHJD 1GC6A 2KC2A 5E6OA 2KJ6A 2NCNA 2N0SB 3SR6A 4PS7A 3KUDB 2FCNA 1WWTA 3SDLC 4MGIE 1E90A 1K8RB 2WU2B 4GU2A 4WIPA 3BWUD 4ZRJA 3N32A 2KNBA 4ANWA 4CYEA 4C7ZA 4BVUC 2ON8A 1KLUD 1BUIC 3X0WA 1YMHE 2BYVE 4K7SA 4A55A 3MHZA 2LGIA 1TKEA 4F1SA 1YOVB 3DVNV 2G4SA 2RPQA 1TS3A 4Q2JA 3W1SA 1WRIA 2N9KA 3NVWA 4USAA 3NVVA 4GDKB 3B0AA 4K1RB 4ZYSA 3UQBA 1WZ3A 1WH3A 4RF1A 1WRDB 1HTOA 4NZLB 3O65B 4LNFA 4MSMB 2LGXA 3MJ5A 4C4VA 1K52A 1WR1A 2VRRB 1E6EB 1I4RA 1JALA 4MGYE 4TV3A 2JUOA 5T8IA 2M8SA 4C80A 1VZ6A 4KKIA 2G9HD 4IG7B 1OFFA 3UIOB 3WANA 2MHJA 2WU5B 1TKGA 3TEYA 1XLPA 3TL5A 4DK5A 1FFVA 5CTRC 3U2SC 2QILA 2KQ7A 2WNMA 4IC7B 3NJTA 4EOYA 1Q5WB 4YL8A 2ICIA 2KLGA 4OVUA 3PO0A 2O6VB 1WGGA 1E7VA 3CSFA 1C4CA 4US8A 1JWUD 1WJ4A 4D2KA 2VZKD 4JGHB 5C2TB 4RMAA 3ZDMC 1RRBA 4YSZB 2JZPA 3IXSA 2KDFB 3QCAA 4HCPB 2LRUA 3Q2AC 2EELA 4PT5A 3ZQ4A 2MCNB 3QJZA 3QX1A 4IDIA 1HZ5A 4NPNA 3PGEA 3C0RB 3MFGA 1QF6A 3ZGZA 2KQ4X 4RGMA 3DVGX 3CIRB 1XT9B 1JW9D 2AYOB 5E6NA 2K8BA 3QA8A 2KJHB 3KYCD 4WJPA 4I6PA 1JWBD 4E74A 1WXAA 4KZ0A 4W9LA 2K25A 1TY0A 2D3BA 1HE8A 3Q8FA 4ZYNA 1WZ0A 1WY8A 1XLOA 3R3MA 4RGTA 1GPXA 1JCKB 2I2YA 1Z5SB 2W9NA 2G45B 4CHKA 2C9WB 2QDFA 1ZW7A 3MC9A 1J8CA 3LYYA 2JT4B 5LXIB 4KGTA 2JX5A 1BMLC 1F52A 4GGQA 5D6JB 2ZVOA 3BK2A 3QARA 2MJEA 4NQLB 4PS3A 4JWSC 2N9XA 2KFKA 4IWOA 5DPWA 3VTVA 4YWGG 4FJYA 1ZPSA 3W2DA 1FNVA 2KN5A 3AH7A 1WX8A 1HZ6A 1EWYC 3C8YA 5D3IB 4HEA1 1T6BX 2AWTA 4QAYA 3T3OA 3WIMA 4WWMA 1QZEA 2KANA 4TUUA 5JHBA 1NI2A 4XYCA 2QJLA 4KV2A 5IAAC 3P4PB 3DBHI 1KF6B 4BBNF 1R7SA 1E8WA 3W1SC 5DCNA 1R4MI 2J42A 4GIVA 2J53A 3R7QA 2QSDA 2FUG1 2KO3A 4RNAA 1Z2MA 3BYTB 1P1AA 4KDLB 3TJPA 4RCOA 1NYQA 2IPKD 1PQSA 3DHIC 1VCBA 2D3AA 3PZDA 4DBGA 1MPEA 4HK2A 5HKHA 1KTKA 2PVGC 2R2OA 1CMXB 4FHKA 2K3UA 4OZAA 1RM6C 2V3NA 1G6JA 2JZZA 3M62B 2DZJA 1B9RA 3JYUA 1SF0A 4N58A 4WJOA 3PRMB 4MM3A 3QHTA 4HKQA 1V1OA 4B0EA 1J7CA 2PEAA 2UWQA 4W9IA 3MC0B 1RWSA 3IHPC 3JW0X 1K53A 3ZUNA 1L0YB 1UGMA 1H8CA 1T5XD 4EEWA 4M0WA 3VH3B 2JXXA 2HDEA 1PGAA 1XD3B 1SE3A 1GC7A 5MPOA 3DWMA 1GNUA 3AECB 1GJZA 2MWSB 2I1KA 3EUB2 4DXFA 1RYJA 2MP2B 2K6QA 3ZJVA 4KSLC 2LJIA 4BBNC 2NPTA 4TQ0A 2WDTB 4FLHA 5AZHA 2ZZPB 3DHGC 4P16A 2GBMA 2KK8A 2Y5BB 1JROA 2GMIC 4NY0A 1PGBA 3ZLZA 1L5PA 1LFDA 3DOWA 3L0WB 1UBIA 3GP7A 3J9CA 3PHWB 2KFKB 3AULA 4JX1C 4ZHOA 1UELA 3BVMA 2FAZA 5DPSA 2INPE 4MACA 2OEDA 2LVQA 2NS5A 2LHEA 3KLSX 3HIZA 2L1AA 2J0MA 3AEGB 3L17A 3TIXA 5IN7A 4XE0A 3H8HA 4BZAA 3EFUA 5EE3A 1YNTE 1XF5L 3DBRB 4JE3B 1GG3A 3K9PB 1R4MB 3BINA 2WXPA 3I63C 2MLBA 3BYYB 4J6IA 3QQ8B 2JRHA 1I4XA 2WXLA 3A9JB 1PYWD 2GOWA 5G55A 1HEZE 4ZRIA 2WGSA 1P9DU 2HJ1A 1ESFA 3AV8A 3MC8A 2CJNA 3LDZE 3PZ7A 1FM0D 2GBNA 1OEYJ 1HTQA 1QOBA 3B1LX 3P42A 2DAJA 4R3DA 2A4ZA 5DPTA 4HPPA 2IO2B 4MM3B 2BQQA 5FR3A 4O1NA 2LRWA 3DBLB 1D5XC 3RZWC 3HVZA 4BKTA 2D07B 2V4IB 3WALA 2B3AA 1WIAA 1YN5A 1N61A 2WX0A 5AZGA 2HE7A 2C5LC 4M0WB 4KGSA 3UQAA 2SEBD 2ZPYA 3Q8BA 4NJ6A 2ZNVB 2LXAA 5H92C 3HK0A 3VFKA 2JY6A 3MJWA 3AE9B 4FULA 4W9JA 3NZ3A 3Q8CA 4H2AA 5KHQA 1FXTB 3B2GA 1VLBA 2NPTB 3EHVA 2CKHB 1F1HA 3H7SA 1DOIA 5C3JB 3PTFC 4GDKA 2MH7A 2CU1A 1JMLA 1C79A 1SE9A 4K3BA 1SIFA 2C60A 5E6PA 3N1YC 3CF6E 2MQJA 1ENFA 5C1ZA 3FC4A 2N9PC 3ZNID 3RN9C 4JL9A 2V9HA 1WX7A 1N62A 2DX5B 3ONSA 3R7RA 3HUIA 3KWLA 1WFYA 2C7HA 3WA0A 2NTSA 3GE3C 4GN1A 2MA9B 1UNSA 1CK1A 3PVLA 4W9KA 2ZNVC 1FNWA 3HRDD 1T0YA 1UBQA 1L6VA 4K7WA 2BB6A 2MEKA 1RFKA 3RNBC 2ZVNA 4FXCA 2WDRB 1FD6A 1J19A 4N6EB 4GDLB 2MJDA 4LNNA 3AE7B 1XLQA 2WXJA 1JWAD 1GOZA 2R2QA 3HM6X 1ZDXA 3P4QB 3EGRA 2JWZA 3ZYYX 4GMVA 2JF5A 1NBFC 2PIAA 3FILB 4ICUA 2WQYB 4IM2A 3PT2B 3UGBB 1MG4A 2YVCA 2FIFA 4AS1A 1V1PB 4W9GA 3I9V1 3Q8AA 3TCAA 4WJNA 3VRAB 4GLSC 3OWEB 3RI7C 2BYTA 2JVCA 3R66C 2OOBB 2JYTA 2V3SA 3APDA 4HVBA 2CHWA 4MT5A 3ML8A 1OTRB 4YSYB 2D10A 2KDBA 2J0JA 4MDKE 3DWGC 1FRDA 5BMHA 3ZJUA 3UI3A 1EUVB 1S3SG 4CO7A 2PKOA 3NOBA 1IYFA 1WMHB 2ASQA 2E3TA 3DBSA 1KJTA 2LMCA 3ZXVA 3I3TB 4KZCA 3ZIMA 2DLBA 3SFDB 2C7MB 1HQRD 1A70A 1SIJA 3V62A 2GLSA 3L4PA 3U52E 1AW7A 3RNEC 4ACFA 1MG8A 3LJ3A 4REZA 1V8CA 4HRSA 4HROA 2JYEA 1C78A 2L0FA 5D94A 2J7QB 4JQWC 3L10B 3NS1A 3KUCB 1NDDA 1WJNA 2IO1B 2N7EA 2MBBB 4W9HA 4YTNB 3DVNU 2KYWA 1K51A 2D3CA 4IUMB 2BB5A 4DDID 4GOCA 1SBBB 2DAFA 3URYA 1WGKA 3PREA 1WJ6A 3NY5A 1A5RA 2FBWB 1LQBA 3B9JA 2JQRB 3N20C 1VDVA 2L8JA 1WXQA 4GXBA 1I4GA 1OGWA 3H1UA 2KAJA 1FPYA 3U4EG 2KMCA 1UWMA 4M01A 1OQQA 1WE6A 5LXHA 3QC8B 5HHDG 1R4NB 2NTTA 4A3PA 4RF0A 2MX2A 2INDC 1VD2A 2IGGA 2WXKA 4HXDA 4LLGM 2Z0DB 3DDCB 5BMGA 3KUZA 4BKGA 4LNKA 2FCQA 1V5OA 3LB8C 3ALBA 2MBHA 3HHMA 3RPFC 3R2IA 4IWPA 2NMQA 1ZKHA 2FNJB 4BOSC 3DVGY 4G0NB 5KHOA 1PUTA 2FCSA 3JSVA 1SJHD 1N5WA 2J52A 3RCZA 2K22A 3SFEB 4C00A 2BF8B 3H7PB 3AU4A 2KN4A 4AWJA 1HA5A 2J4XA 4HPLB 4YSXB 3RFZB 2K5PA 4IM3A 2W3SA 3A4SC 2MP2A 1I7HA 2BGFA 2WWZA 4KSKC 2QIEB 1WXVA 3TSSA 4OVVA 1SJED 2WXFA 1E5WA 3S2AA 1QILA 1VRAB 2KMMA 1T0SC 4AQ7A 1M4VA 3ZNZB 3AE8B 3IG3A 5FR6A 4BAXA 4N9F4 1NI3A 3NHEB 1L6UA 3A33B 3PZ8A 4NJCA 3IT6B 2KX3A 1C77A 2DZMA 1JRUA 2BS2B 3GOEA 4ANVA 2XK5A 3ZRCA 1H4RA 3WCQA 4EKUA 2DYBA 5CX3A 2G4DB 4B9KA 1LO5D 2IO0B 2EMSA 3RUIB 4NAWB 2NBVB 4TSSA 3VXWA 1SXTA 3AB5A 2DENB 2LGDA 1YQBA 2Y5CA 2L3ZA 1I35A 3VR8B 4KKJA 3W1YA 2IY1B 1DOYA 3DBRI 3U8ZA 3GE8C 3U7ZA 4E3CA 2FIDA 5BYSA 1QOAA 3A9JA 1T0RC 2CHXA 4P1CC 3RNGC 1JRPA 3N1ZC 1SE4A 1XO3A 2N4FA 1UZXB 2PE9A 2LXCA 3T3NA 5BYQA 2XN9C 1STEA 1M94A 3IT4B 1P0RA 2KT7A 1F2RI 1WX9A 2KMAA 1CZPA 3ABVB 3UINB 2WHIA 3KW5B 4BFRA 2I38A 2FE8A 3L13A 1L0XB 1UH6A 2BWES 1L4ZB 1ZXIA 4HKZE 4II3B 5HFYA 2BS4B 1ET9A 3DBLI 3M3JA 3Q69A 5CHFA 2MBOA 4B0MA 3JSVB 3AEBB 2IY0B 1TZOA 2V0GA 4A9AA 4DWFA 1WXSA 2JXTA 3VUXA 2DHZA 2BYEA 3DCGA 4DHZE 3OAWA 2W3RA 4A20A 2V4LA 4AUQC 1FRRA 2RSUA 2KACA 2KDIA 1FNUA 4MGZE 1E10A 4GB9A 1XCQL 2UU7A 2G3QB 5LNK1 3GS2A 3NZSA 2NBWB 3P4SB 4YTMB 3DQVA 1EU4A 4J3OD 1UGJA 2BVCA 5TSSA 4E71A 2K9XA 2LEKA 1MVKA 1I42A 4MGKE 2ZW0A 4FHJA 2L52A 4DXGA 2XK5B 1TZ1A 3APCA 2PW9A 1SGHA 1XXGA 2LZ6A 1TTNA 2KX0A 2LGSA 2OJRA 3R8BA 2BWFA 2I1JA 3T8MA 2RR9A 2AQ1B 3AXCA 1P98A 1J7BA 1GB1A 2L05A 3ZO5B 2WXNA 1XEEA 4KVGB 2RDGA 3JVZX 3P4RB 3DPDA 2GI9A 3TEWA 3KQ4A 2GBJA 2M56B 2KWCA 1XCTL 1ZE3D 3VR9B 3AE5B 2QMTA 4ITKA 2ONQA 2LJ5A 1E7PB 2EMTA 3NRZA 1ZP0B 1SEBD 2CU3A 5DPRA 1WGHA 2PVOD 2NBUA 5HG2A 2QHOA 4GDLA 3UIPB 4EZLA 1D5MC 2XEWA 1WM2A 4F7ZA 3VAWA 4DHZB 2N1WA 1VZ7A 3WAPA 2Z0EB 3Q3JA 4ZHPA 4PK1A 1EM7A 3DHHC 3FILA 4P6VF 4FN2A 5CHVC 1C3TA 2OHFA 2LVPA 2KTRA 4YT0B 5G2NA 4EZKA 4FJZA 1V1PA 3QWZB 1V49A 4ZRKA 2PJHA 1IUEA 3Q3OC 1CJEA 2XNAC 3Q6BA 2INNE 4ANUA 1KFYB 3SHQA 1WSPA 5EE9A 4US9A 4WAFA 4MEMA 4PS8A 3VHTC 1NYRA 2LHDA 2VH1A 1GB4A 3NUHB 1RFAA 2RDBC 2L7RA 4RM8A 3W5UB 3N30A 4P1BC 1DYQA 1XLNA 1P3QU 3A4RA 4TMAB 4A3OA 5IP4D 2DZIA 3V3XA 2CS4A 4B95A 1I4HA 1F2RC 4RGOS 1WMHA 1OQYA 1FMAD 4HPMB 2JWUA 4S17A 1UWXA 3W5VB 4A8XC 1S1QB 1EU3A 5BMIA 4OHJA 3OLMD 2R61A 2LASA 2AL6A 1TBEA 3NG0A 5D3DA 1K50A 2Q5WD 3MHSD 3ZKJC 4DXAB 2AEHA 1MJDA 3VH4B 2C7NB 2IDYA 2QC8A 2LFIA 2J0KA 2BYFA 4C7YA 4PYUA 4MELA 4TKNA 4HJKA 3Q8EA 2KOXA 2PPHA 4NJ7A 2FCMA 4L1BA 3NVYA 2WXOA 4LJOB 1ACCA 3FAHA 3ZNGC 3RYTA 3E9SA 1L4DB 1ISNA 1OEYA 2WXRA 2X8XX 4NAMA 5IA7A 4LCDE 2M17A 3RULA 5E6JA 3ZW3A 5D2MB 1E8YA 3MTNB 1V81A 4A6QA 2BKRB 4XDCA 4XWWA 4ICVA 1R4NI 4RFBA 2QCZA 2NR2A 3RNCC 2Z59B 3PRPB 1PDXA 1U4AA 2KTRB 3V05A 1YJIA 4S0RA 3AI5A 3NVZA 3PHXB 3KH0A 1F9JA 2W82A 3QAQA 3SU8X 3BIID 2GBKA 3Q3NC 4XC2A 3AE4B 3V61A 2BTEA 4NQKE 1FFUA 3EA6A 4IM0A 2LUMA 4M00A 2L76A 2WXMA 5AUKA 1Q1OA 1TT5B 1V9JA 1EWCA 1IP9A 1EO6A 3QIJA 1D5ZC 5GMVA 4P7IA 3PSEB 5EDSA 2N9LA 3T9LA 3H7PA 4FADA 2KWVB 1WE7A 3RZFA 2MJ3A 3VTWA 2D2QA 1OQRA 2DYMA 2IO3B 3I57A 3RT3B 2D11A 1LXDA 4XZ4A 4LTUA 3H9DA 1FCLA 3P2BA 2KXJA 4W9DA 2KDEB 3AEFB 2K8CA 2NVUI 2IGHA 4HDOA 2N1VA 2JU6X 4ZDVA 2AQ2B 1V97A 1PGXA 2IGDA 4ZRQA 1FXAA 5J2RA 2XBBC 4LJPB 2KC1A 2V1YA 2WXQA 3V6CB 3NZUA 1YN4A 4KGRA 2IYDB 1BXTA 3TEZA 2K6DB 3KVFB 2MW5A 4LK0M 2X38A 4RH6A 2LD9A 2ZPNA 2YEPF 4JPSA 4NAWA 4WQOB 1YD8U 3Q3FA 3AE6B 3EECA 1QT9A 1FO4A 1IBXA 4N59A 4ANXA 4YXDB 1Y8RC 4II2B 1QKZA 3VRBB 3GZNI 4OW0A 2Z8LA 1NVID 5BYRA 4JLCA 4C56C 2YEPB 3ZXRA 3A1QB 4EUTA 1X1MA 1DGJA 1QOFA 4K81A 4MJSB 2WDVB 4WJQA 2KLCA 1KRHA 2K0PA 3A9KA 3Q3MC 1FIQA 3ZJTA 2D3GA 2BPSA 4M8MA 3ZDTA 3HM3A 5J18A 4LDTB 2KVZA 3CMMB 3AE3B 3ZTCA 5AUIA 3APFA 1N63A 4EFOA 4FA6A 2WXGA 1V86A 2DBYA 3OJ3A 2LWPA 2DYOA 4K3CA 2AQ3B 2BW2A 4A90A 2LUEA 3VTUA 3KWVA 3X23A 4XWTA 5AEKB 2N7DA 1E7UA 2MSED 3AE1B 4M02A 5CHWA 2O2VB 1PFDA 2TSSA 4OZCA 5G5GA 4G11A 1YIWA 2ZCBA 2M0XA 1V6EA 3AEDB 2BT6A 1WYGA 1IPGA 3AEEB 3VQIA 3VUWA 4PYZA 2D5GA 2A5UA 3GB1A 2IBIB 2PE6B 1KLGD 1C76A 1ROEA 2YLMA 4FBJB 4KIKA 1SSNA 2WX1A 3ENEA 1IGDA 2EKIA 4RM9A 4IW0A 1BT0A 2KKCA 4W9FA 2L32A 1AARA 2KJRA 3VVWB 2ACZB 1V5TA 1TS5A 5EE1A 1F0ZA 1FCCC 2UYZB 3B08A 4DQOC 1ZUD2 1MI0A 3PLVA 1UD7A 2B76B 2LVOA 3PPAA 2KWUB 4WURA 4G3XB 1AYFA 2CJOA 3ZRFA 5TR5A 2KVRA 1GAQB 5JHAA 4W9EA 4EE2A 1IGCA 4W9CA 2AL3A 2WYQA 3W9CB 2AX5A 1C1YB 4WAAA 1VZ8A 1QQRA 4AJWA 1IBXB 3GZNB 4C4VB 1WM3A 4XDDA 1I4PA 3TEXA 1LM8B 4DHJB 1Y56A 1D6EC 1MHHE 1WI0A 1XQQA 2WXHA 4K7UA 5D7GA 1E8ZA 2KQSA 3CWIA 4EZJA 3BVGA 2KHWB 1N60A 5L83A 2KD0A 3D32A 1TYGB 3U30A 3L54A 3IFWB 1TGZB 1F77A 4HCNB 1TY2A 1YX5B 4WWNA 1NEKB 2WXIA 3A9KB 2VH2A 1ET6A 5HI1A 4HLEA 4G50A 3E56A 3KYDD 3TBLD 4MH8A 1UUPA 1WGYA 2HJ8A 1CQVA 4LNOA 1MFWA 4X57B 2CHZA 4L2YA 3M95A 2WDQB 1YQ4B 2H88B 3IBEA 3ML9A 2L00B 1MHXA 3UF8A 1YN3A 3TMPB 2V3PA 2HD5B 1I4QA 2BS3B 3L16A 2ZJDA 2N9EB 3VDZA 1AN8A 3WAOA 1E9MA 2FUHB 2E6XA 3AMZA 4OVZA 1TJEA 2REXA 3I5JC 4IKGA 1WR6E 3M63B 1WGRA 5IKCM 1V80A 1P7EA 1JWMD 2MBQA 3EFCA 3U7DA 2DZKA 5JXVA 2W55A 5J17A 2PTLA 3VUYA 2JRIB 2JPHA 4KIKB 3P1MA 2M0AA 3C19A 1L2NA 3LXFA 4GSWA 4F8CB 3H6NA 3QK0A 1WXMA 1D3ZA 3N1XC 1ZDVA 2M1MA 3N3KB 1C9FA 1T3QA 2VZKB 1EF5A 2CR5A 2RDHA 4CQNA 3OG5A 2IJ0A 2GB1A 1UF0A 4KX6B 3AU5A 4XGAB 1FXIA 4UDUC 4BKSD 3ZTDA 2PLPA 2RPVA 1NENB 3AM9A 4NNJB 3AE2B 4HDQA 4WQMA 3IVFA 4IOIE 1EF1A 5IOIA 4AOFA 5FKAC 4WWPA 2KTFA 4MSQB 2M4NA
chains in the Genus database with same CATH topology
2AWTA 4IUMB 4DDID 1ISNA 4GOCA 3WIMA 2DAFA 3PREA 1WJ6A 1QZEA 2KANA 3NY5A 4TUUA 1A5RA 5JHBA 3K9OB 1NI2A 1OEYA 4HWIB 1LQBA 4I6LB 4KV2A 5IAAC 2LI5A 3NS8A 3RD2A 5IA7A 2L8JA 4LCDE 2ZEQA 2M17A 1OGWA 4GXBA 3H1UA 3DBHI 3RULA 4BBNF 3ZW3A 5D2MB 1E8YA 3MTNB 2GBRA 3W1SC 1E8WA 2KMCA 3ZVVA 1V81A 2BKRB 5DCNA 1R4MI 1WE6A 4GIVA 5LXHA 4ICVA 4WWOA 3R7QA 3QC8B 2KO3A 1WF9A 1Z2MA 1R4NI 5LLIA 1P1AA 4A3PA 4KDLB 1WGDA 3TJPA 2NR2A 2MX2A 5JZEB 2Z59B 2RGFA 3PRPB 1PQSA 4FJVB 1VCBA 3PZDA 1U4AA 1VD2A 2KTRB 4TQ1A 3ZNHB 4DBGA 4HK2A 5HKHA 4HXDA 2KZRA 1WYWB 2R2OA 1CMXB 2Z0DB 3AI5A 3DDCB 3PHXB 4URKA 3KH0A 3KUZA 5BO4B 1F9JA 4FHKA 4BKGA 3QAQA 3L08A 3SU8X 2FCQA 1V5OA 1G6JA 2GBKA 2ZCCA 4XC2A 3V61A 2JZZA 3ALBA 4NQKE 2MBHA 3HHMA 4IM0A 4BKSA 5JH5C 3M62B 2DZJA 4IWPA 3JYUA 4WJOA 3PRMB 2L76A 1ZKHA 2FNJB 4BOSC 4MM3A 3QHTA 1Q1OA 3DVGY 4G0NB 1V9JA 4AP4C 1IP9A 5KHOA 2FCSA 2PEAA 1EO6A 3QIJA 5GMVA 2UWQA 3JSVA 1ZGUB 4W9IA 4P7IA 3PSEB 1YJ1A 3IHPC 5EDSA 3JW0X 3RCZA 3T9LA 3H7PA 3PRZA 3ZUNA 4FADA 1UGMA 2KWVB 1H8CA 1E8XA 2BF8B 1RAXA 4EEWA 1WE7A 3RZFA 3H7PB 1WJUA 3AU4A 3VTWA 3VH3B 2D2QA 2IO3B 2DYMA 4AWJA 2JXXA 3RT3B 2D11A 1LXDA 1XD3B 4XZ4A 4HPLB 2EKEC 1GC7A 3PLUA 3H9DA 1GNUA 4IM3A 3A4SC 2MP2A 1GJZA 2MWSB 2I1KA 3P2BA 3CSTA 2KXJA 4W9DA 2MBEA 3WAMA 3BY4B 2BGFA 2KDEB 2WWZA 4KSKC 1KLVA 1WXVA 2MP2B 4OVVA 2K8CA 2KFJA 2NVUI 2K6QA 1E5WA 4KSLC 3S2AA 4BBNC 4HDOA 2N1VA 2NPTA 1KM7A 2BKFA 4ZDVA 3ZNZB 3V6EB 4TQ0A 4LDTD 2WDTB 4FLHA 3IG3A 2O6VD 4KDIC 5FR6A 4N9F4 3ECIA 5AZHA 2ZZPB 3NHEB 3A33B 5J2RA 2GBMA 5AZFA 1J0GA 1YX6B 2KK8A 2KX3A 2XBBC 2DZMA 2Y5BB 4LJPB 1JRUA 2KC1A 3GOEA 1V2YA 2V1YA 2GMIC 2XK5A 4NY0A 4ANVA 3ZLZA 3V6CB 1LFDA 3ZRCA 3DOWA 3L0WB 3NZUA 1UBIA 4DDGD 2IYDB 3SD5A 1H4RA 3PHWB 2KFKB 2K6DB 3AULA 4XX5A 1RLFA 3KVFB 4B6WA 4EKUA 2MW5A 1UELA 2LD9A 2DYBA 5CX3A 2G4DB 2ZPNA 4B9KA 4NAWA 4WQOB 1YD8U 3Q3FA 3EECA 2FAZA 2IO0B 5DPSA 2EMSA 3RUIB 4NAWB 2NBVB 4ANXA 2LVQA 2NS5A 1Y8RC 3VXWA 4II2B 3HIZA 2DENB 3GZNI 2J0MA 2K8HA 2LGDA 2RD0A 3L17A 3TIXA 3V60A 1YQBA 2L3ZA 5L95C 1I35A 1Q0WB 3EFUA 2HTHA 3A1QA 3PS6A 2IY1B 4JLCA 3W1YA 3DBRI 2JZ3B 3A1QB 3U8ZA 4EUTA 1GG3A 4MJSA 1X1MA 3K9PB 1GUAB 2K1FA 4BOZB 4E3CA 2FIDA 3BINA 4K81A 2K39A 3A9JA 4MJSB 2L0TA 2MLBA 4J6IA 2CHXA 3QQ8B 2JRHA 4WJQA 3A9JB 2MRPA 2KLCA 2GOWA 5G55A 3A9KA 4ZRIA 2N4FA 1UZXB 2PE9A 2LXCA 3EC8A 1KOTA 1P9DU 4ASWC 2D3GA 1M94A 2BPSA 2O6VA 4M8MA 1L7YA 1P0RA 3ZDTA 3HM3A 3OJ4B 4JIOU 4LDTB 5J18A 3CMMB 1WX9A 3PV1A 2KMAA 4IWQA 3ZTCA 3UINB 3LDZE 4I6NB 3APFA 3KW5B 2GBNA 4BFRA 1OEYJ 3L13A 4EFOA 3B1LX 5C23A 2DAJA 1UH6A 4FA6A 2A4ZA 2BWES 5DPTA 2IZVB 4AJYB 1V86A 4II3B 3OJ3A 2IO2B 4MH0E 2LGYA 2LWPA 2DYOA 2LRWA 3DBLI 3M3JA 5CHFA 2MBOA 2O2VA 2LUEA 4M8NA 3VTUA 3X23A 5AEKB 4DHJD 3JSVB 2N7DA 3RZWC 1E7UA 2MSED 4BKTA 2D07B 2IY0B 2O2VB 2B3AA 5CHWA 3WALA 1GC6A 1WIAA 4DWFA 2KC2A 1WXSA 5E6OA 3VUXA 2KJ6A 2DHZA 2WX0A 4G11A 5AZGA 2BYEA 2NCNA 3DCGA 2HE7A 2C5LC 1YIWA 2ZCBA 4PS7A 2M0XA 1V6EA 3OAWA 4M0WB 4DHZE 3KUDB 4A20A 3UQAA 2FCNA 2V4LA 4AUQC 3SDLC 2ZPYA 2RSUA 4MGIE 1IPGA 4NJ6A 3VQIA 3VUWA 1E90A 2ZNVB 2LXAA 4PYZA 1K8RB 2KDIA 4MGZE 2A5UA 3HK0A 4GU2A 3VFKA 2IBIB 2PE6B 4GB9A 2JY6A 3MJWA 4FULA 3N32A 4ZRJA 2G3QB 2YLMA 2KNBA 3NZSA 4W9JA 4ANWA 4CYEA 4KIKA 4FBJB 2NBWB 4BVUC 5KHQA 1FXTB 3X0WA 2WX1A 3ENEA 2NPTB 3DQVA 2BYVE 4IW0A 4K7SA 4RM9A 3EHVA 1BT0A 2CKHB 2KKCA 3H7SA 4W9FA 1AARA 4F1SA 4E71A 3DVNV 2KJRA 2G4SA 3VVWB 1V5TA 2RPQA 3PTFC 2UYZB 3B08A 4GDKA 1I42A 3W1SA 4MGKE 4FHJA 3PLVA 1UD7A 4GDKB 2LVOA 3PPAA 3B0AA 2XK5B 2CU1A 2KWUB 4G3XB 1TZ1A 4K1RB 3APCA 1SE9A 1SGHA 2LZ6A 3UQBA 3ZRFA 1TTNA 2KX0A 5TR5A 2KVRA 1WZ3A 1SIFA 1WH3A 2C60A 2OJRA 5E6PA 5JHAA 2BWFA 1WRDB 2I1JA 3CF6E 2MQJA 5C1ZA 4W9EA 2RR9A 2N9PC 3T8MA 3AXCA 3ZNID 4W9CA 1P98A 2AL3A 4JL9A 3O65B 2L05A 2WYQA 1WX7A 2DX5B 1C1YB 3ONSA 4MSMB 2LGXA 3R7RA 3ZO5B 4KVGB 4WAAA 3JVZX 1WR1A 1WFYA 2C7HA 2VRRB 3WA0A 4AJWA 3DPDA 1WM3A 4GN1A 2MA9B 2GBJA 3PVLA 1LM8B 2KWCA 4W9KA 4DHJB 1WI0A 1XQQA 4MGYE 4K7UA 2ZNVC 5D7GA 1E8ZA 4TV3A 2JUOA 2KQSA 4EZJA 1T0YA 1UBQA 2KHWB 2M8SA 2LJ5A 4K7WA 5L83A 2EMTA 2KD0A 2ZVNA 4IG7B 3D32A 3U30A 3UIOB 3L54A 5DPRA 3WANA 1WGHA 3IFWB 2NBUA 1J19A 1TGZB 2QHOA 4GDLA 3TL5A 5CTRC 3UIPB 4DK5A 4HCNB 2KQ7A 4EZLA 2XEWA 1YX5B 4IC7B 4GDLB 4WWNA 1WM2A 4EOYA 1Q5WB 4F7ZA 3A9KB 4YL8A 3VAWA 4DHZB 2KLGA 2N1WA 4HLEA 4G50A 4OVUA 3WAPA 2Z0EB 3Q3JA 2R2QA 2O6VB 1WGGA 3HM6X 3KYDD 1E7VA 3TBLD 3CSFA 2JWZA 1WGYA 2HJ8A 4GMVA 4FN2A 2JF5A 1WJ4A 5CHVC 1NBFC 1C3TA 4X57B 2CHZA 2LVPA 4ICUA 2KTRA 3M95A 4JGHB 3IBEA 3ML9A 5G2NA 2L00B 4RMAA 3UF8A 3ZDMC 4EZKA 4IM2A 3PT2B 1RRBA 3TMPB 3UGBB 4FJZA 2HD5B 3QWZB 1V49A 2YVCA 4ZRKA 2KDFB 2FIFA 2PJHA 3QCAA 4HCPB 2LRUA 3L16A 4W9GA 2ZJDA 2N9EB 3VDZA 3WAOA 2FUHB 4ANUA 2MCNB 3QJZA 3QX1A 3SHQA 3TCAA 4WJNA 2JVCA 4NPNA 2REXA 3PGEA 4MEMA 3R66C 4PS8A 3VHTC 3C0RB 1WR6E 2OOBB 2V3SA 1RFAA 3APDA 3M63B 4HVBA 1WGRA 1V80A 2CHWA 3DVGX 3ML8A 2L7RA 4RM8A 3N30A 1OTRB 1XT9B 2MBQA 1P3QU 2D10A 3A4RA 4A3OA 2KDBA 2J0JA 4MDKE 2AYOB 3U7DA 5E6NA 2DZKA 2K8BA 3QA8A 2KJHB 2DZIA 5J17A 3VUYA 3KYCD 4WJPA 2JRIB 2CS4A 4I6PA 4B95A 1EUVB 2JPHA 4E74A 1S3SG 4KIKB 4CO7A 3NOBA 1WXAA 1WMHA 1OQYA 4KZ0A 4W9LA 1IYFA 4HPMB 1WMHB 2K25A 1L2NA 2ASQA 4GSWA 4F8CB 1HE8A 3DBSA 1S1QB 1KJTA 3H6NA 3QK0A 3I3TB 4KZCA 1WXMA 3ZIMA 4ZYNA 1D3ZA 2C7MB 1WZ0A 1WY8A 3OLMD 3V62A 3R3MA 2M1MA 2LASA 2AL6A 1TBEA 1MG8A 3MHSD 3N3KB 1Z5SB 3LJ3A 2W9NA 3ZKJC 2G45B 4CHKA 2C9WB 1ZW7A 4DXAB 2AEHA 1EF5A 2CR5A 3VH4B 1J8CA 2JT4B 5LXIB 2L0FA 4GGQA 5D6JB 2C7NB 2ZVOA 3AU5A 3QARA 4NQLB 4PS3A 5D94A 4BKSD 3ZTDA 2N9XA 2J0KA 2KFKA 2J7QB 4IWOA 2BYFA 5DPWA 3VTVA 4PYUA 4MELA 4NNJB 4HJKA 4TKNA 4JQWC 3L10B 4HDQA 4FJYA 2KOXA 3IVFA 3KUCB 1NDDA 2PPHA 2KN5A 1EF1A 1WJNA 4NJ7A 2FCMA 4AOFA 2IO1B 2N7EA 1WX8A 2MBBB 4LJOB 4WWPA 4W9HA 3DVNU 2KTFA 3ZNGC 3RYTA 4MSQB 2M4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWT A;  4IUM B;  4DDI D;  1ISN A;  4GOC A;  3WIM A;  2DAF A;  3PRE A;  1WJ6 A;  1QZE A;  2KAN A;  3NY5 A;  4TUU A;  1A5R A;  5JHB A;  3K9O B;  1NI2 A;  1OEY A;  4HWI B;  1LQB A;  4I6L B;  4KV2 A;  5IAA C;  2LI5 A;  3NS8 A;  3RD2 A;  5IA7 A;  2L8J A;  4LCD E;  2ZEQ A;  2M17 A;  1OGW A;  4GXB A;  3H1U A;  3DBH I;  3RUL A;  4BBN F;  3ZW3 A;  5D2M B;  1E8Y A;  3MTN B;  2GBR A;  3W1S C;  1E8W A;  2KMC A;  3ZVV A;  1V81 A;  2BKR B;  5DCN A;  1R4M I;  1WE6 A;  4GIV A;  5LXH A;  4ICV A;  4WWO A;  3R7Q A;  3QC8 B;  2KO3 A;  1WF9 A;  1Z2M A;  1R4N I;  5LLI A;  1P1A A;  4A3P A;  4KDL B;  1WGD A;  3TJP A;  2NR2 A;  2MX2 A;  5JZE B;  2Z59 B;  2RGF A;  3PRP B;  1PQS A;  4FJV B;  1VCB A;  3PZD A;  1U4A A;  1VD2 A;  2KTR B;  4TQ1 A;  3ZNH B;  4DBG A;  4HK2 A;  5HKH A;  4HXD A;  2KZR A;  1WYW B;  2R2O A;  1CMX B;  2Z0D B;  3AI5 A;  3DDC B;  3PHX B;  4URK A;  3KH0 A;  3KUZ A;  5BO4 B;  1F9J A;  4FHK A;  4BKG A;  3QAQ A;  3L08 A;  3SU8 X;  2FCQ A;  1V5O A;  1G6J A;  2GBK A;  2ZCC A;  4XC2 A;  3V61 A;  2JZZ A;  3ALB A;  4NQK E;  2MBH A;  3HHM A;  4IM0 A;  4BKS A;  5JH5 C;  3M62 B;  2DZJ A;  4IWP A;  3JYU A;  4WJO A;  3PRM B;  2L76 A;  1ZKH A;  2FNJ B;  4BOS C;  4MM3 A;  3QHT A;  1Q1O A;  3DVG Y;  4G0N B;  1V9J A;  4AP4 C;  1IP9 A;  5KHO A;  2FCS A;  2PEA A;  1EO6 A;  3QIJ A;  5GMV A;  2UWQ A;  3JSV A;  1ZGU B;  4W9I A;  4P7I A;  3PSE B;  1YJ1 A;  3IHP C;  5EDS A;  3JW0 X;  3RCZ A;  3T9L A;  3H7P A;  3PRZ A;  3ZUN A;  4FAD A;  1UGM A;  2KWV B;  1H8C A;  1E8X A;  2BF8 B;  1RAX A;  4EEW A;  1WE7 A;  3RZF A;  3H7P B;  1WJU A;  3AU4 A;  3VTW A;  3VH3 B;  2D2Q A;  2IO3 B;  2DYM A;  4AWJ A;  2JXX A;  3RT3 B;  2D11 A;  1LXD A;  1XD3 B;  4XZ4 A;  4HPL B;  2EKE C;  1GC7 A;  3PLU A;  3H9D A;  1GNU A;  4IM3 A;  3A4S C;  2MP2 A;  1GJZ A;  2MWS B;  2I1K A;  3P2B A;  3CST A;  2KXJ A;  4W9D A;  2MBE A;  3WAM A;  3BY4 B;  2BGF A;  2KDE B;  2WWZ A;  4KSK C;  1KLV A;  1WXV A;  2MP2 B;  4OVV A;  2K8C A;  2KFJ A;  2NVU I;  2K6Q A;  1E5W A;  4KSL C;  3S2A A;  4BBN C;  4HDO A;  2N1V A;  2NPT A;  1KM7 A;  2BKF A;  4ZDV A;  3ZNZ B;  3V6E B;  4TQ0 A;  4LDT D;  2WDT B;  4FLH A;  3IG3 A;  2O6V D;  4KDI C;  5FR6 A;  4N9F 4;  3ECI A;  5AZH A;  2ZZP B;  3NHE B;  3A33 B;  5J2R A;  2GBM A;  5AZF A;  1J0G A;  1YX6 B;  2KK8 A;  2KX3 A;  2XBB C;  2DZM A;  2Y5B B;  4LJP B;  1JRU A;  2KC1 A;  3GOE A;  1V2Y A;  2V1Y A;  2GMI C;  2XK5 A;  4NY0 A;  4ANV A;  3ZLZ A;  3V6C B;  1LFD A;  3ZRC A;  3DOW A;  3L0W B;  3NZU A;  1UBI A;  4DDG D;  2IYD B;  3SD5 A;  1H4R A;  3PHW B;  2KFK B;  2K6D B;  3AUL A;  4XX5 A;  1RLF A;  3KVF B;  4B6W A;  4EKU A;  2MW5 A;  1UEL A;  2LD9 A;  2DYB A;  5CX3 A;  2G4D B;  2ZPN A;  4B9K A;  4NAW A;  4WQO B;  1YD8 U;  3Q3F A;  3EEC A;  2FAZ A;  2IO0 B;  5DPS A;  2EMS A;  3RUI B;  4NAW B;  2NBV B;  4ANX A;  2LVQ A;  2NS5 A;  1Y8R C;  3VXW A;  4II2 B;  3HIZ A;  2DEN B;  3GZN I;  2J0M A;  2K8H A;  2LGD A;  2RD0 A;  3L17 A;  3TIX A;  3V60 A;  1YQB A;  2L3Z A;  5L95 C;  1I35 A;  1Q0W B;  3EFU A;  2HTH A;  3A1Q A;  3PS6 A;  2IY1 B;  4JLC A;  3W1Y A;  3DBR I;  2JZ3 B;  3A1Q B;  3U8Z A;  4EUT A;  1GG3 A;  4MJS A;  1X1M A;  3K9P B;  1GUA B;  2K1F A;  4BOZ B;  4E3C A;  2FID A;  3BIN A;  4K81 A;  2K39 A;  3A9J A;  4MJS B;  2L0T A;  2MLB A;  4J6I A;  2CHX A;  3QQ8 B;  2JRH A;  4WJQ A;  3A9J B;  2MRP A;  2KLC A;  2GOW A;  5G55 A;  3A9K A;  4ZRI A;  2N4F A;  1UZX B;  2PE9 A;  2LXC A;  3EC8 A;  1KOT A;  1P9D U;  4ASW C;  2D3G A;  1M94 A;  2BPS A;  2O6V A;  4M8M A;  1L7Y A;  1P0R A;  3ZDT A;  3HM3 A;  3OJ4 B;  4JIO U;  4LDT B;  5J18 A;  3CMM B;  1WX9 A;  3PV1 A;  2KMA A;  4IWQ A;  3ZTC A;  3UIN B;  3LDZ E;  4I6N B;  3APF A;  3KW5 B;  2GBN A;  4BFR A;  1OEY J;  3L13 A;  4EFO A;  3B1L X;  5C23 A;  2DAJ A;  1UH6 A;  4FA6 A;  2A4Z A;  2BWE S;  5DPT A;  2IZV B;  4AJY B;  1V86 A;  4II3 B;  3OJ3 A;  2IO2 B;  4MH0 E;  2LGY A;  2LWP A;  2DYO A;  2LRW A;  3DBL I;  3M3J A;  5CHF A;  2MBO A;  2O2V A;  2LUE A;  4M8N A;  3VTU A;  3X23 A;  5AEK B;  4DHJ D;  3JSV B;  2N7D A;  3RZW C;  1E7U A;  2MSE D;  4BKT A;  2D07 B;  2IY0 B;  2O2V B;  2B3A A;  5CHW A;  3WAL A;  1GC6 A;  1WIA A;  4DWF A;  2KC2 A;  1WXS A;  5E6O A;  3VUX A;  2KJ6 A;  2DHZ A;  2WX0 A;  4G11 A;  5AZG A;  2BYE A;  2NCN A;  3DCG A;  2HE7 A;  2C5L C;  1YIW A;  2ZCB A;  4PS7 A;  2M0X A;  1V6E A;  3OAW A;  4M0W B;  4DHZ E;  3KUD B;  4A20 A;  3UQA A;  2FCN A;  2V4L A;  4AUQ C;  3SDL C;  2ZPY A;  2RSU A;  4MGI E;  1IPG A;  4NJ6 A;  3VQI A;  3VUW A;  1E90 A;  2ZNV B;  2LXA A;  4PYZ A;  1K8R B;  2KDI A;  4MGZ E;  2A5U A;  3HK0 A;  4GU2 A;  3VFK A;  2IBI B;  2PE6 B;  4GB9 A;  2JY6 A;  3MJW A;  4FUL A;  3N32 A;  4ZRJ A;  2G3Q B;  2YLM A;  2KNB A;  3NZS A;  4W9J A;  4ANW A;  4CYE A;  4KIK A;  4FBJ B;  2NBW B;  4BVU C;  5KHQ A;  1FXT B;  3X0W A;  2WX1 A;  3ENE A;  2NPT B;  3DQV A;  2BYV E;  4IW0 A;  4K7S A;  4RM9 A;  3EHV A;  1BT0 A;  2CKH B;  2KKC A;  3H7S A;  4W9F A;  1AAR A;  4F1S A;  4E71 A;  3DVN V;  2KJR A;  2G4S A;  3VVW B;  1V5T A;  2RPQ A;  3PTF C;  2UYZ B;  3B08 A;  4GDK A;  1I42 A;  3W1S A;  4MGK E;  4FHJ A;  3PLV A;  1UD7 A;  4GDK B;  2LVO A;  3PPA A;  3B0A A;  2XK5 B;  2CU1 A;  2KWU B;  4G3X B;  1TZ1 A;  4K1R B;  3APC A;  1SE9 A;  1SGH A;  2LZ6 A;  3UQB A;  3ZRF A;  1TTN A;  2KX0 A;  5TR5 A;  2KVR A;  1WZ3 A;  1SIF A;  1WH3 A;  2C60 A;  2OJR A;  5E6P A;  5JHA A;  2BWF A;  1WRD B;  2I1J A;  3CF6 E;  2MQJ A;  5C1Z A;  4W9E A;  2RR9 A;  2N9P C;  3T8M A;  3AXC A;  3ZNI D;  4W9C A;  1P98 A;  2AL3 A;  4JL9 A;  3O65 B;  2L05 A;  2WYQ A;  1WX7 A;  2DX5 B;  1C1Y B;  3ONS A;  4MSM B;  2LGX A;  3R7R A;  3ZO5 B;  4KVG B;  4WAA A;  3JVZ X;  1WR1 A;  1WFY A;  2C7H A;  2VRR B;  3WA0 A;  4AJW A;  3DPD A;  1WM3 A;  4GN1 A;  2MA9 B;  2GBJ A;  3PVL A;  1LM8 B;  2KWC A;  4W9K A;  4DHJ B;  1WI0 A;  1XQQ A;  4MGY E;  4K7U A;  2ZNV C;  5D7G A;  1E8Z A;  4TV3 A;  2JUO A;  2KQS A;  4EZJ A;  1T0Y A;  1UBQ A;  2KHW B;  2M8S A;  2LJ5 A;  4K7W A;  5L83 A;  2EMT A;  2KD0 A;  2ZVN A;  4IG7 B;  3D32 A;  3U30 A;  3UIO B;  3L54 A;  5DPR A;  3WAN A;  1WGH A;  3IFW B;  2NBU A;  1J19 A;  1TGZ B;  2QHO A;  4GDL A;  3TL5 A;  5CTR C;  3UIP B;  4DK5 A;  4HCN B;  2KQ7 A;  4EZL A;  2XEW A;  1YX5 B;  4IC7 B;  4GDL B;  4WWN A;  1WM2 A;  4EOY A;  1Q5W B;  4F7Z A;  3A9K B;  4YL8 A;  3VAW A;  4DHZ B;  2KLG A;  2N1W A;  4HLE A;  4G50 A;  4OVU A;  3WAP A;  2Z0E B;  3Q3J A;  2R2Q A;  2O6V B;  1WGG A;  3HM6 X;  3KYD D;  1E7V A;  3TBL D;  3CSF A;  2JWZ A;  1WGY A;  2HJ8 A;  4GMV A;  4FN2 A;  2JF5 A;  1WJ4 A;  5CHV C;  1NBF C;  1C3T A;  4X57 B;  2CHZ A;  2LVP A;  4ICU A;  2KTR A;  3M95 A;  4JGH B;  3IBE A;  3ML9 A;  5G2N A;  2L00 B;  4RMA A;  3UF8 A;  3ZDM C;  4EZK A;  4IM2 A;  3PT2 B;  1RRB A;  3TMP B;  3UGB B;  4FJZ A;  2HD5 B;  3QWZ B;  1V49 A;  2YVC A;  4ZRK A;  2KDF B;  2FIF A;  2PJH A;  3QCA A;  4HCP B;  2LRU A;  3L16 A;  4W9G A;  2ZJD A;  2N9E B;  3VDZ A;  3WAO A;  2FUH B;  4ANU A;  2MCN B;  3QJZ A;  3QX1 A;  3SHQ A;  3TCA A;  4WJN A;  2JVC A;  4NPN A;  2REX A;  3PGE A;  4MEM A;  3R66 C;  4PS8 A;  3VHT C;  3C0R B;  1WR6 E;  2OOB B;  2V3S A;  1RFA A;  3APD A;  3M63 B;  4HVB A;  1WGR A;  1V80 A;  2CHW A;  3DVG X;  3ML8 A;  2L7R A;  4RM8 A;  3N30 A;  1OTR B;  1XT9 B;  2MBQ A;  1P3Q U;  2D10 A;  3A4R A;  4A3O A;  2KDB A;  2J0J A;  4MDK E;  2AYO B;  3U7D A;  5E6N A;  2DZK A;  2K8B A;  3QA8 A;  2KJH B;  2DZI A;  5J17 A;  3VUY A;  3KYC D;  4WJP A;  2JRI B;  2CS4 A;  4I6P A;  4B95 A;  1EUV B;  2JPH A;  4E74 A;  1S3S G;  4KIK B;  4CO7 A;  3NOB A;  1WXA A;  1WMH A;  1OQY A;  4KZ0 A;  4W9L A;  1IYF A;  4HPM B;  1WMH B;  2K25 A;  1L2N A;  2ASQ A;  4GSW A;  4F8C B;  1HE8 A;  3DBS A;  1S1Q B;  1KJT A;  3H6N A;  3QK0 A;  3I3T B;  4KZC A;  1WXM A;  3ZIM A;  4ZYN A;  1D3Z A;  2C7M B;  1WZ0 A;  1WY8 A;  3OLM D;  3V62 A;  3R3M A;  2M1M A;  2LAS A;  2AL6 A;  1TBE A;  1MG8 A;  3MHS D;  3N3K B;  1Z5S B;  3LJ3 A;  2W9N A;  3ZKJ C;  2G45 B;  4CHK A;  2C9W B;  1ZW7 A;  4DXA B;  2AEH A;  1EF5 A;  2CR5 A;  3VH4 B;  1J8C A;  2JT4 B;  5LXI B;  2L0F A;  4GGQ A;  5D6J B;  2C7N B;  2ZVO A;  3AU5 A;  3QAR A;  4NQL B;  4PS3 A;  5D94 A;  4BKS D;  3ZTD A;  2N9X A;  2J0K A;  2KFK A;  2J7Q B;  4IWO A;  2BYF A;  5DPW A;  3VTV A;  4PYU A;  4MEL A;  4NNJ B;  4HJK A;  4TKN A;  4JQW C;  3L10 B;  4HDQ A;  4FJY A;  2KOX A;  3IVF A;  3KUC B;  1NDD A;  2PPH A;  2KN5 A;  1EF1 A;  1WJN A;  4NJ7 A;  2FCM A;  4AOF A;  2IO1 B;  2N7E A;  1WX8 A;  2MBB B;  4LJO B;  4WWP A;  4W9H A;  3DVN U;  2KTF A;  3ZNG C;  3RYT A;  4MSQ B;  2M4N A; 
#chains in the Genus database with same CATH topology
 1Q10 A;  2SAK A;  5G5H A;  1TS2 A;  5GXG B;  3K9O B;  4HWI B;  4I6L B;  2LI5 A;  3NS8 A;  3RD2 A;  2ZEQ A;  3DBH B;  3RMK C;  2GBR A;  3TUO A;  2BBC A;  3ZVV A;  4WWO A;  1B1Z A;  1WF9 A;  3HVD A;  2PMV A;  5LLI A;  5I4D A;  5H8Y E;  1WGD A;  5JZE B;  2RGF A;  4L23 A;  4FJV B;  3P63 A;  3ZNH B;  4TQ1 A;  2KWD A;  2KZR A;  1WYW B;  2ZW1 A;  4LNI A;  4URK A;  5BO4 B;  3L08 A;  5EE0 A;  2QEJ C;  1TS4 A;  4ARI A;  3BZD B;  3FKY A;  2ZCC A;  4OZB A;  2JSV X;  1YJJ A;  5JH5 C;  4BKS A;  5IO9 A;  1J7A A;  1SE2 A;  2N7J A;  2WP9 B;  1QLB B;  4HJG E;  4AP4 C;  1N6Z A;  1AWD A;  1ZGU B;  1P7F A;  1T0Q C;  1YJ1 A;  1VR9 A;  1FEH A;  1L0V B;  1ZOY B;  1HXY D;  3PRZ A;  3AN1 A;  2Y3A A;  1E8X A;  1RAX A;  1JQ4 A;  1VJK A;  1WJU A;  4WH4 A;  2H89 B;  1YQ3 B;  2EKE C;  3PLU A;  3CST A;  2MBE A;  3WAM A;  3BY4 B;  3B2F A;  1KLV A;  2KFJ A;  1TKY A;  3Q14 C;  1KM7 A;  1C4A A;  2BKF A;  3V6E B;  2OJW A;  4LDT D;  3IAS 1;  2O6V D;  2GRI A;  4KDI C;  3R2T A;  1D4B A;  3ECI A;  5AZF A;  1J0G A;  1DOX A;  2DWQ A;  1YX6 B;  1V2Y A;  4DDG D;  4RGN A;  3SD5 A;  3ETR A;  4YTP B;  2RMM A;  4XX5 A;  1RLF A;  4B6W A;  1N5X A;  2G1E A;  3N9Y C;  2L83 A;  1TIF A;  1KH0 A;  2K8H A;  2RD0 A;  2Y5P A;  3V60 A;  2INC C;  5L95 C;  3IAM 1;  1Q0W B;  2HTH A;  3A1Q A;  3O13 A;  3PS6 A;  2WLB A;  1ZXH A;  2JZ3 B;  3BK1 A;  4ZOH C;  4MJS A;  1GUA B;  2K1F A;  4BOZ B;  4ZRP A;  2HTM E;  2K39 A;  2L0T A;  2MRP A;  1QOG A;  2M19 A;  3EC8 A;  1KOT A;  1JWS D;  1E0Z A;  2WS3 B;  4ASW C;  3BVZ A;  2O6V A;  1L7Y A;  2KDM A;  3OJ4 B;  4JIO U;  3PV1 A;  3AEA B;  4IWQ A;  4I6N B;  2DNF A;  3MP9 A;  5FK9 C;  1LGR A;  3RNF C;  5C23 A;  1SB3 C;  2W54 A;  2IZV B;  4JWU C;  4AJY B;  4ARC A;  4MH0 E;  2LGY A;  2O2V A;  1C4P A;  4M8N A;  3SEB A;  3RNA C;  4DHJ D;  1GC6 A;  2KC2 A;  5E6O A;  2KJ6 A;  2NCN A;  2N0S B;  3SR6 A;  4PS7 A;  3KUD B;  2FCN A;  1WWT A;  3SDL C;  4MGI E;  1E90 A;  1K8R B;  2WU2 B;  4GU2 A;  4WIP A;  3BWU D;  4ZRJ A;  3N32 A;  2KNB A;  4ANW A;  4CYE A;  4C7Z A;  4BVU C;  2ON8 A;  1KLU D;  1BUI C;  3X0W A;  1YMH E;  2BYV E;  4K7S A;  4A55 A;  3MHZ A;  2LGI A;  1TKE A;  4F1S A;  1YOV B;  3DVN V;  2G4S A;  2RPQ A;  1TS3 A;  4Q2J A;  3W1S A;  1WRI A;  2N9K A;  3NVW A;  4USA A;  3NVV A;  4GDK B;  3B0A A;  4K1R B;  4ZYS A;  3UQB A;  1WZ3 A;  1WH3 A;  4RF1 A;  1WRD B;  1HTO A;  4NZL B;  3O65 B;  4LNF A;  4MSM B;  2LGX A;  3MJ5 A;  4C4V A;  1K52 A;  1WR1 A;  2VRR B;  1E6E B;  1I4R A;  1JAL A;  4MGY E;  4TV3 A;  2JUO A;  5T8I A;  2M8S A;  4C80 A;  1VZ6 A;  4KKI A;  2G9H D;  4IG7 B;  1OFF A;  3UIO B;  3WAN A;  2MHJ A;  2WU5 B;  1TKG A;  3TEY A;  1XLP A;  3TL5 A;  4DK5 A;  1FFV A;  5CTR C;  3U2S C;  2QIL A;  2KQ7 A;  2WNM A;  4IC7 B;  3NJT A;  4EOY A;  1Q5W B;  4YL8 A;  2ICI A;  2KLG A;  4OVU A;  3PO0 A;  2O6V B;  1WGG A;  1E7V A;  3CSF A;  1C4C A;  4US8 A;  1JWU D;  1WJ4 A;  4D2K A;  2VZK D;  4JGH B;  5C2T B;  4RMA A;  3ZDM C;  1RRB A;  4YSZ B;  2JZP A;  3IXS A;  2KDF B;  3QCA A;  4HCP B;  2LRU A;  3Q2A C;  2EEL A;  4PT5 A;  3ZQ4 A;  2MCN B;  3QJZ A;  3QX1 A;  4IDI A;  1HZ5 A;  4NPN A;  3PGE A;  3C0R B;  3MFG A;  1QF6 A;  3ZGZ A;  2KQ4 X;  4RGM A;  3DVG X;  3CIR B;  1XT9 B;  1JW9 D;  2AYO B;  5E6N A;  2K8B A;  3QA8 A;  2KJH B;  3KYC D;  4WJP A;  4I6P A;  1JWB D;  4E74 A;  1WXA A;  4KZ0 A;  4W9L A;  2K25 A;  1TY0 A;  2D3B A;  1HE8 A;  3Q8F A;  4ZYN A;  1WZ0 A;  1WY8 A;  1XLO A;  3R3M A;  4RGT A;  1GPX A;  1JCK B;  2I2Y A;  1Z5S B;  2W9N A;  2G45 B;  4CHK A;  2C9W B;  2QDF A;  1ZW7 A;  3MC9 A;  1J8C A;  3LYY A;  2JT4 B;  5LXI B;  4KGT A;  2JX5 A;  1BML C;  1F52 A;  4GGQ A;  5D6J B;  2ZVO A;  3BK2 A;  3QAR A;  2MJE A;  4NQL B;  4PS3 A;  4JWS C;  2N9X A;  2KFK A;  4IWO A;  5DPW A;  3VTV A;  4YWG G;  4FJY A;  1ZPS A;  3W2D A;  1FNV A;  2KN5 A;  3AH7 A;  1WX8 A;  1HZ6 A;  1EWY C;  3C8Y A;  5D3I B;  4HEA 1;  1T6B X;  2AWT A;  4QAY A;  3T3O A;  3WIM A;  4WWM A;  1QZE A;  2KAN A;  4TUU A;  5JHB A;  1NI2 A;  4XYC A;  2QJL A;  4KV2 A;  5IAA C;  3P4P B;  3DBH I;  1KF6 B;  4BBN F;  1R7S A;  1E8W A;  3W1S C;  5DCN A;  1R4M I;  2J42 A;  4GIV A;  2J53 A;  3R7Q A;  2QSD A;  2FUG 1;  2KO3 A;  4RNA A;  1Z2M A;  3BYT B;  1P1A A;  4KDL B;  3TJP A;  4RCO A;  1NYQ A;  2IPK D;  1PQS A;  3DHI C;  1VCB A;  2D3A A;  3PZD A;  4DBG A;  1MPE A;  4HK2 A;  5HKH A;  1KTK A;  2PVG C;  2R2O A;  1CMX B;  4FHK A;  2K3U A;  4OZA A;  1RM6 C;  2V3N A;  1G6J A;  2JZZ A;  3M62 B;  2DZJ A;  1B9R A;  3JYU A;  1SF0 A;  4N58 A;  4WJO A;  3PRM B;  4MM3 A;  3QHT A;  4HKQ A;  1V1O A;  4B0E A;  1J7C A;  2PEA A;  2UWQ A;  4W9I A;  3MC0 B;  1RWS A;  3IHP C;  3JW0 X;  1K53 A;  3ZUN A;  1L0Y B;  1UGM A;  1H8C A;  1T5X D;  4EEW A;  4M0W A;  3VH3 B;  2JXX A;  2HDE A;  1PGA A;  1XD3 B;  1SE3 A;  1GC7 A;  5MPO A;  3DWM A;  1GNU A;  3AEC B;  1GJZ A;  2MWS B;  2I1K A;  3EUB 2;  4DXF A;  1RYJ A;  2MP2 B;  2K6Q A;  3ZJV A;  4KSL C;  2LJI A;  4BBN C;  2NPT A;  4TQ0 A;  2WDT B;  4FLH A;  5AZH A;  2ZZP B;  3DHG C;  4P16 A;  2GBM A;  2KK8 A;  2Y5B B;  1JRO A;  2GMI C;  4NY0 A;  1PGB A;  3ZLZ A;  1L5P A;  1LFD A;  3DOW A;  3L0W B;  1UBI A;  3GP7 A;  3J9C A;  3PHW B;  2KFK B;  3AUL A;  4JX1 C;  4ZHO A;  1UEL A;  3BVM A;  2FAZ A;  5DPS A;  2INP E;  4MAC A;  2OED A;  2LVQ A;  2NS5 A;  2LHE A;  3KLS X;  3HIZ A;  2L1A A;  2J0M A;  3AEG B;  3L17 A;  3TIX A;  5IN7 A;  4XE0 A;  3H8H A;  4BZA A;  3EFU A;  5EE3 A;  1YNT E;  1XF5 L;  3DBR B;  4JE3 B;  1GG3 A;  3K9P B;  1R4M B;  3BIN A;  2WXP A;  3I63 C;  2MLB A;  3BYY B;  4J6I A;  3QQ8 B;  2JRH A;  1I4X A;  2WXL A;  3A9J B;  1PYW D;  2GOW A;  5G55 A;  1HEZ E;  4ZRI A;  2WGS A;  1P9D U;  2HJ1 A;  1ESF A;  3AV8 A;  3MC8 A;  2CJN A;  3LDZ E;  3PZ7 A;  1FM0 D;  2GBN A;  1OEY J;  1HTQ A;  1QOB A;  3B1L X;  3P42 A;  2DAJ A;  4R3D A;  2A4Z A;  5DPT A;  4HPP A;  2IO2 B;  4MM3 B;  2BQQ A;  5FR3 A;  4O1N A;  2LRW A;  3DBL B;  1D5X C;  3RZW C;  3HVZ A;  4BKT A;  2D07 B;  2V4I B;  3WAL A;  2B3A A;  1WIA A;  1YN5 A;  1N61 A;  2WX0 A;  5AZG A;  2HE7 A;  2C5L C;  4M0W B;  4KGS A;  3UQA A;  2SEB D;  2ZPY A;  3Q8B A;  4NJ6 A;  2ZNV B;  2LXA A;  5H92 C;  3HK0 A;  3VFK A;  2JY6 A;  3MJW A;  3AE9 B;  4FUL A;  4W9J A;  3NZ3 A;  3Q8C A;  4H2A A;  5KHQ A;  1FXT B;  3B2G A;  1VLB A;  2NPT B;  3EHV A;  2CKH B;  1F1H A;  3H7S A;  1DOI A;  5C3J B;  3PTF C;  4GDK A;  2MH7 A;  2CU1 A;  1JML A;  1C79 A;  1SE9 A;  4K3B A;  1SIF A;  2C60 A;  5E6P A;  3N1Y C;  3CF6 E;  2MQJ A;  1ENF A;  5C1Z A;  3FC4 A;  2N9P C;  3ZNI D;  3RN9 C;  4JL9 A;  2V9H A;  1WX7 A;  1N62 A;  2DX5 B;  3ONS A;  3R7R A;  3HUI A;  3KWL A;  1WFY A;  2C7H A;  3WA0 A;  2NTS A;  3GE3 C;  4GN1 A;  2MA9 B;  1UNS A;  1CK1 A;  3PVL A;  4W9K A;  2ZNV C;  1FNW A;  3HRD D;  1T0Y A;  1UBQ A;  1L6V A;  4K7W A;  2BB6 A;  2MEK A;  1RFK A;  3RNB C;  2ZVN A;  4FXC A;  2WDR B;  1FD6 A;  1J19 A;  4N6E B;  4GDL B;  2MJD A;  4LNN A;  3AE7 B;  1XLQ A;  2WXJ A;  1JWA D;  1GOZ A;  2R2Q A;  3HM6 X;  1ZDX A;  3P4Q B;  3EGR A;  2JWZ A;  3ZYY X;  4GMV A;  2JF5 A;  1NBF C;  2PIA A;  3FIL B;  4ICU A;  2WQY B;  4IM2 A;  3PT2 B;  3UGB B;  1MG4 A;  2YVC A;  2FIF A;  4AS1 A;  1V1P B;  4W9G A;  3I9V 1;  3Q8A A;  3TCA A;  4WJN A;  3VRA B;  4GLS C;  3OWE B;  3RI7 C;  2BYT A;  2JVC A;  3R66 C;  2OOB B;  2JYT A;  2V3S A;  3APD A;  4HVB A;  2CHW A;  4MT5 A;  3ML8 A;  1OTR B;  4YSY B;  2D10 A;  2KDB A;  2J0J A;  4MDK E;  3DWG C;  1FRD A;  5BMH A;  3ZJU A;  3UI3 A;  1EUV B;  1S3S G;  4CO7 A;  2PKO A;  3NOB A;  1IYF A;  1WMH B;  2ASQ A;  2E3T A;  3DBS A;  1KJT A;  2LMC A;  3ZXV A;  3I3T B;  4KZC A;  3ZIM A;  2DLB A;  3SFD B;  2C7M B;  1HQR D;  1A70 A;  1SIJ A;  3V62 A;  2GLS A;  3L4P A;  3U52 E;  1AW7 A;  3RNE C;  4ACF A;  1MG8 A;  3LJ3 A;  4REZ A;  1V8C A;  4HRS A;  4HRO A;  2JYE A;  1C78 A;  2L0F A;  5D94 A;  2J7Q B;  4JQW C;  3L10 B;  3NS1 A;  3KUC B;  1NDD A;  1WJN A;  2IO1 B;  2N7E A;  2MBB B;  4W9H A;  4YTN B;  3DVN U;  2KYW A;  1K51 A;  2D3C A;  4IUM B;  2BB5 A;  4DDI D;  4GOC A;  1SBB B;  2DAF A;  3URY A;  1WGK A;  3PRE A;  1WJ6 A;  3NY5 A;  1A5R A;  2FBW B;  1LQB A;  3B9J A;  2JQR B;  3N20 C;  1VDV A;  2L8J A;  1WXQ A;  4GXB A;  1I4G A;  1OGW A;  3H1U A;  2KAJ A;  1FPY A;  3U4E G;  2KMC A;  1UWM A;  4M01 A;  1OQQ A;  1WE6 A;  5LXH A;  3QC8 B;  5HHD G;  1R4N B;  2NTT A;  4A3P A;  4RF0 A;  2MX2 A;  2IND C;  1VD2 A;  2IGG A;  2WXK A;  4HXD A;  4LLG M;  2Z0D B;  3DDC B;  5BMG A;  3KUZ A;  4BKG A;  4LNK A;  2FCQ A;  1V5O A;  3LB8 C;  3ALB A;  2MBH A;  3HHM A;  3RPF C;  3R2I A;  4IWP A;  2NMQ A;  1ZKH A;  2FNJ B;  4BOS C;  3DVG Y;  4G0N B;  5KHO A;  1PUT A;  2FCS A;  3JSV A;  1SJH D;  1N5W A;  2J52 A;  3RCZ A;  2K22 A;  3SFE B;  4C00 A;  2BF8 B;  3H7P B;  3AU4 A;  2KN4 A;  4AWJ A;  1HA5 A;  2J4X A;  4HPL B;  4YSX B;  3RFZ B;  2K5P A;  4IM3 A;  2W3S A;  3A4S C;  2MP2 A;  1I7H A;  2BGF A;  2WWZ A;  4KSK C;  2QIE B;  1WXV A;  3TSS A;  4OVV A;  1SJE D;  2WXF A;  1E5W A;  3S2A A;  1QIL A;  1VRA B;  2KMM A;  1T0S C;  4AQ7 A;  1M4V A;  3ZNZ B;  3AE8 B;  3IG3 A;  5FR6 A;  4BAX A;  4N9F 4;  1NI3 A;  3NHE B;  1L6U A;  3A33 B;  3PZ8 A;  4NJC A;  3IT6 B;  2KX3 A;  1C77 A;  2DZM A;  1JRU A;  2BS2 B;  3GOE A;  4ANV A;  2XK5 A;  3ZRC A;  1H4R A;  3WCQ A;  4EKU A;  2DYB A;  5CX3 A;  2G4D B;  4B9K A;  1LO5 D;  2IO0 B;  2EMS A;  3RUI B;  4NAW B;  2NBV B;  4TSS A;  3VXW A;  1SXT A;  3AB5 A;  2DEN B;  2LGD A;  1YQB A;  2Y5C A;  2L3Z A;  1I35 A;  3VR8 B;  4KKJ A;  3W1Y A;  2IY1 B;  1DOY A;  3DBR I;  3U8Z A;  3GE8 C;  3U7Z A;  4E3C A;  2FID A;  5BYS A;  1QOA A;  3A9J A;  1T0R C;  2CHX A;  4P1C C;  3RNG C;  1JRP A;  3N1Z C;  1SE4 A;  1XO3 A;  2N4F A;  1UZX B;  2PE9 A;  2LXC A;  3T3N A;  5BYQ A;  2XN9 C;  1STE A;  1M94 A;  3IT4 B;  1P0R A;  2KT7 A;  1F2R I;  1WX9 A;  2KMA A;  1CZP A;  3ABV B;  3UIN B;  2WHI A;  3KW5 B;  4BFR A;  2I38 A;  2FE8 A;  3L13 A;  1L0X B;  1UH6 A;  2BWE S;  1L4Z B;  1ZXI A;  4HKZ E;  4II3 B;  5HFY A;  2BS4 B;  1ET9 A;  3DBL I;  3M3J A;  3Q69 A;  5CHF A;  2MBO A;  4B0M A;  3JSV B;  3AEB B;  2IY0 B;  1TZO A;  2V0G A;  4A9A A;  4DWF A;  1WXS A;  2JXT A;  3VUX A;  2DHZ A;  2BYE A;  3DCG A;  4DHZ E;  3OAW A;  2W3R A;  4A20 A;  2V4L A;  4AUQ C;  1FRR A;  2RSU A;  2KAC A;  2KDI A;  1FNU A;  4MGZ E;  1E10 A;  4GB9 A;  1XCQ L;  2UU7 A;  2G3Q B;  5LNK 1;  3GS2 A;  3NZS A;  2NBW B;  3P4S B;  4YTM B;  3DQV A;  1EU4 A;  4J3O D;  1UGJ A;  2BVC A;  5TSS A;  4E71 A;  2K9X A;  2LEK A;  1MVK A;  1I42 A;  4MGK E;  2ZW0 A;  4FHJ A;  2L52 A;  4DXG A;  2XK5 B;  1TZ1 A;  3APC A;  2PW9 A;  1SGH A;  1XXG A;  2LZ6 A;  1TTN A;  2KX0 A;  2LGS A;  2OJR A;  3R8B A;  2BWF A;  2I1J A;  3T8M A;  2RR9 A;  2AQ1 B;  3AXC A;  1P98 A;  1J7B A;  1GB1 A;  2L05 A;  3ZO5 B;  2WXN A;  1XEE A;  4KVG B;  2RDG A;  3JVZ X;  3P4R B;  3DPD A;  2GI9 A;  3TEW A;  3KQ4 A;  2GBJ A;  2M56 B;  2KWC A;  1XCT L;  1ZE3 D;  3VR9 B;  3AE5 B;  2QMT A;  4ITK A;  2ONQ A;  2LJ5 A;  1E7P B;  2EMT A;  3NRZ A;  1ZP0 B;  1SEB D;  2CU3 A;  5DPR A;  1WGH A;  2PVO D;  2NBU A;  5HG2 A;  2QHO A;  4GDL A;  3UIP B;  4EZL A;  1D5M C;  2XEW A;  1WM2 A;  4F7Z A;  3VAW A;  4DHZ B;  2N1W A;  1VZ7 A;  3WAP A;  2Z0E B;  3Q3J A;  4ZHP A;  4PK1 A;  1EM7 A;  3DHH C;  3FIL A;  4P6V F;  4FN2 A;  5CHV C;  1C3T A;  2OHF A;  2LVP A;  2KTR A;  4YT0 B;  5G2N A;  4EZK A;  4FJZ A;  1V1P A;  3QWZ B;  1V49 A;  4ZRK A;  2PJH A;  1IUE A;  3Q3O C;  1CJE A;  2XNA C;  3Q6B A;  2INN E;  4ANU A;  1KFY B;  3SHQ A;  1WSP A;  5EE9 A;  4US9 A;  4WAF A;  4MEM A;  4PS8 A;  3VHT C;  1NYR A;  2LHD A;  2VH1 A;  1GB4 A;  3NUH B;  1RFA A;  2RDB C;  2L7R A;  4RM8 A;  3W5U B;  3N30 A;  4P1B C;  1DYQ A;  1XLN A;  1P3Q U;  3A4R A;  4TMA B;  4A3O A;  5IP4 D;  2DZI A;  3V3X A;  2CS4 A;  4B95 A;  1I4H A;  1F2R C;  4RGO S;  1WMH A;  1OQY A;  1FMA D;  4HPM B;  2JWU A;  4S17 A;  1UWX A;  3W5V B;  4A8X C;  1S1Q B;  1EU3 A;  5BMI A;  4OHJ A;  3OLM D;  2R61 A;  2LAS A;  2AL6 A;  1TBE A;  3NG0 A;  5D3D A;  1K50 A;  2Q5W D;  3MHS D;  3ZKJ C;  4DXA B;  2AEH A;  1MJD A;  3VH4 B;  2C7N B;  2IDY A;  2QC8 A;  2LFI A;  2J0K A;  2BYF A;  4C7Y A;  4PYU A;  4MEL A;  4TKN A;  4HJK A;  3Q8E A;  2KOX A;  2PPH A;  4NJ7 A;  2FCM A;  4L1B A;  3NVY A;  2WXO A;  4LJO B;  1ACC A;  3FAH A;  3ZNG C;  3RYT A;  3E9S A;  1L4D B;  1ISN A;  1OEY A;  2WXR A;  2X8X X;  4NAM A;  5IA7 A;  4LCD E;  2M17 A;  3RUL A;  5E6J A;  3ZW3 A;  5D2M B;  1E8Y A;  3MTN B;  1V81 A;  4A6Q A;  2BKR B;  4XDC A;  4XWW A;  4ICV A;  1R4N I;  4RFB A;  2QCZ A;  2NR2 A;  3RNC C;  2Z59 B;  3PRP B;  1PDX A;  1U4A A;  2KTR B;  3V05 A;  1YJI A;  4S0R A;  3AI5 A;  3NVZ A;  3PHX B;  3KH0 A;  1F9J A;  2W82 A;  3QAQ A;  3SU8 X;  3BII D;  2GBK A;  3Q3N C;  4XC2 A;  3AE4 B;  3V61 A;  2BTE A;  4NQK E;  1FFU A;  3EA6 A;  4IM0 A;  2LUM A;  4M00 A;  2L76 A;  2WXM A;  5AUK A;  1Q1O A;  1TT5 B;  1V9J A;  1EWC A;  1IP9 A;  1EO6 A;  3QIJ A;  1D5Z C;  5GMV A;  4P7I A;  3PSE B;  5EDS A;  2N9L A;  3T9L A;  3H7P A;  4FAD A;  2KWV B;  1WE7 A;  3RZF A;  2MJ3 A;  3VTW A;  2D2Q A;  1OQR A;  2DYM A;  2IO3 B;  3I57 A;  3RT3 B;  2D11 A;  1LXD A;  4XZ4 A;  4LTU A;  3H9D A;  1FCL A;  3P2B A;  2KXJ A;  4W9D A;  2KDE B;  3AEF B;  2K8C A;  2NVU I;  2IGH A;  4HDO A;  2N1V A;  2JU6 X;  4ZDV A;  2AQ2 B;  1V97 A;  1PGX A;  2IGD A;  4ZRQ A;  1FXA A;  5J2R A;  2XBB C;  4LJP B;  2KC1 A;  2V1Y A;  2WXQ A;  3V6C B;  3NZU A;  1YN4 A;  4KGR A;  2IYD B;  1BXT A;  3TEZ A;  2K6D B;  3KVF B;  2MW5 A;  4LK0 M;  2X38 A;  4RH6 A;  2LD9 A;  2ZPN A;  2YEP F;  4JPS A;  4NAW A;  4WQO B;  1YD8 U;  3Q3F A;  3AE6 B;  3EEC A;  1QT9 A;  1FO4 A;  1IBX A;  4N59 A;  4ANX A;  4YXD B;  1Y8R C;  4II2 B;  1QKZ A;  3VRB B;  3GZN I;  4OW0 A;  2Z8L A;  1NVI D;  5BYR A;  4JLC A;  4C56 C;  2YEP B;  3ZXR A;  3A1Q B;  4EUT A;  1X1M A;  1DGJ A;  1QOF A;  4K81 A;  4MJS B;  2WDV B;  4WJQ A;  2KLC A;  1KRH A;  2K0P A;  3A9K A;  3Q3M C;  1FIQ A;  3ZJT A;  2D3G A;  2BPS A;  4M8M A;  3ZDT A;  3HM3 A;  5J18 A;  4LDT B;  2KVZ A;  3CMM B;  3AE3 B;  3ZTC A;  5AUI A;  3APF A;  1N63 A;  4EFO A;  4FA6 A;  2WXG A;  1V86 A;  2DBY A;  3OJ3 A;  2LWP A;  2DYO A;  4K3C A;  2AQ3 B;  2BW2 A;  4A90 A;  2LUE A;  3VTU A;  3KWV A;  3X23 A;  4XWT A;  5AEK B;  2N7D A;  1E7U A;  2MSE D;  3AE1 B;  4M02 A;  5CHW A;  2O2V B;  1PFD A;  2TSS A;  4OZC A;  5G5G A;  4G11 A;  1YIW A;  2ZCB A;  2M0X A;  1V6E A;  3AED B;  2BT6 A;  1WYG A;  1IPG A;  3AEE B;  3VQI A;  3VUW A;  4PYZ A;  2D5G A;  2A5U A;  3GB1 A;  2IBI B;  2PE6 B;  1KLG D;  1C76 A;  1ROE A;  2YLM A;  4FBJ B;  4KIK A;  1SSN A;  2WX1 A;  3ENE A;  1IGD A;  2EKI A;  4RM9 A;  4IW0 A;  1BT0 A;  2KKC A;  4W9F A;  2L32 A;  1AAR A;  2KJR A;  3VVW B;  2ACZ B;  1V5T A;  1TS5 A;  5EE1 A;  1F0Z A;  1FCC C;  2UYZ B;  3B08 A;  4DQO C;  1ZUD 2;  1MI0 A;  3PLV A;  1UD7 A;  2B76 B;  2LVO A;  3PPA A;  2KWU B;  4WUR A;  4G3X B;  1AYF A;  2CJO A;  3ZRF A;  5TR5 A;  2KVR A;  1GAQ B;  5JHA A;  4W9E A;  4EE2 A;  1IGC A;  4W9C A;  2AL3 A;  2WYQ A;  3W9C B;  2AX5 A;  1C1Y B;  4WAA A;  1VZ8 A;  1QQR A;  4AJW A;  1IBX B;  3GZN B;  4C4V B;  1WM3 A;  4XDD A;  1I4P A;  3TEX A;  1LM8 B;  4DHJ B;  1Y56 A;  1D6E C;  1MHH E;  1WI0 A;  1XQQ A;  2WXH A;  4K7U A;  5D7G A;  1E8Z A;  2KQS A;  3CWI A;  4EZJ A;  3BVG A;  2KHW B;  1N60 A;  5L83 A;  2KD0 A;  3D32 A;  1TYG B;  3U30 A;  3L54 A;  3IFW B;  1TGZ B;  1F77 A;  4HCN B;  1TY2 A;  1YX5 B;  4WWN A;  1NEK B;  2WXI A;  3A9K B;  2VH2 A;  1ET6 A;  5HI1 A;  4HLE A;  4G50 A;  3E56 A;  3KYD D;  3TBL D;  4MH8 A;  1UUP A;  1WGY A;  2HJ8 A;  1CQV A;  4LNO A;  1MFW A;  4X57 B;  2CHZ A;  4L2Y A;  3M95 A;  2WDQ B;  1YQ4 B;  2H88 B;  3IBE A;  3ML9 A;  2L00 B;  1MHX A;  3UF8 A;  1YN3 A;  3TMP B;  2V3P A;  2HD5 B;  1I4Q A;  2BS3 B;  3L16 A;  2ZJD A;  2N9E B;  3VDZ A;  1AN8 A;  3WAO A;  1E9M A;  2FUH B;  2E6X A;  3AMZ A;  4OVZ A;  1TJE A;  2REX A;  3I5J C;  4IKG A;  1WR6 E;  3M63 B;  1WGR A;  5IKC M;  1V80 A;  1P7E A;  1JWM D;  2MBQ A;  3EFC A;  3U7D A;  2DZK A;  5JXV A;  2W55 A;  5J17 A;  2PTL A;  3VUY A;  2JRI B;  2JPH A;  4KIK B;  3P1M A;  2M0A A;  3C19 A;  1L2N A;  3LXF A;  4GSW A;  4F8C B;  3H6N A;  3QK0 A;  1WXM A;  1D3Z A;  3N1X C;  1ZDV A;  2M1M A;  3N3K B;  1C9F A;  1T3Q A;  2VZK B;  1EF5 A;  2CR5 A;  2RDH A;  4CQN A;  3OG5 A;  2IJ0 A;  2GB1 A;  1UF0 A;  4KX6 B;  3AU5 A;  4XGA B;  1FXI A;  4UDU C;  4BKS D;  3ZTD A;  2PLP A;  2RPV A;  1NEN B;  3AM9 A;  4NNJ B;  3AE2 B;  4HDQ A;  4WQM A;  3IVF A;  4IOI E;  1EF1 A;  5IOI A;  4AOF A;  5FKA C;  4WWP A;  2KTF A;  4MSQ B;  2M4N A; 
#chains in the Genus database with same CATH homology
 2AWT A;  4IUM B;  4DDI D;  1ISN A;  4GOC A;  3WIM A;  2DAF A;  3PRE A;  1WJ6 A;  1QZE A;  2KAN A;  3NY5 A;  4TUU A;  1A5R A;  5JHB A;  3K9O B;  1NI2 A;  1OEY A;  4HWI B;  1LQB A;  4I6L B;  4KV2 A;  5IAA C;  2LI5 A;  3NS8 A;  3RD2 A;  5IA7 A;  2L8J A;  4LCD E;  2ZEQ A;  2M17 A;  1OGW A;  4GXB A;  3H1U A;  3DBH I;  3RUL A;  4BBN F;  3ZW3 A;  5D2M B;  1E8Y A;  3MTN B;  2GBR A;  3W1S C;  1E8W A;  2KMC A;  3ZVV A;  1V81 A;  2BKR B;  5DCN A;  1R4M I;  1WE6 A;  4GIV A;  5LXH A;  4ICV A;  4WWO A;  3R7Q A;  3QC8 B;  2KO3 A;  1WF9 A;  1Z2M A;  1R4N I;  5LLI A;  1P1A A;  4A3P A;  4KDL B;  1WGD A;  3TJP A;  2NR2 A;  2MX2 A;  5JZE B;  2Z59 B;  2RGF A;  3PRP B;  1PQS A;  4FJV B;  1VCB A;  3PZD A;  1U4A A;  1VD2 A;  2KTR B;  4TQ1 A;  3ZNH B;  4DBG A;  4HK2 A;  5HKH A;  4HXD A;  2KZR A;  1WYW B;  2R2O A;  1CMX B;  2Z0D B;  3AI5 A;  3DDC B;  3PHX B;  4URK A;  3KH0 A;  3KUZ A;  5BO4 B;  1F9J A;  4FHK A;  4BKG A;  3QAQ A;  3L08 A;  3SU8 X;  2FCQ A;  1V5O A;  1G6J A;  2GBK A;  2ZCC A;  4XC2 A;  3V61 A;  2JZZ A;  3ALB A;  4NQK E;  2MBH A;  3HHM A;  4IM0 A;  4BKS A;  5JH5 C;  3M62 B;  2DZJ A;  4IWP A;  3JYU A;  4WJO A;  3PRM B;  2L76 A;  1ZKH A;  2FNJ B;  4BOS C;  4MM3 A;  3QHT A;  1Q1O A;  3DVG Y;  4G0N B;  1V9J A;  4AP4 C;  1IP9 A;  5KHO A;  2FCS A;  2PEA A;  1EO6 A;  3QIJ A;  5GMV A;  2UWQ A;  3JSV A;  1ZGU B;  4W9I A;  4P7I A;  3PSE B;  1YJ1 A;  3IHP C;  5EDS A;  3JW0 X;  3RCZ A;  3T9L A;  3H7P A;  3PRZ A;  3ZUN A;  4FAD A;  1UGM A;  2KWV B;  1H8C A;  1E8X A;  2BF8 B;  1RAX A;  4EEW A;  1WE7 A;  3RZF A;  3H7P B;  1WJU A;  3AU4 A;  3VTW A;  3VH3 B;  2D2Q A;  2IO3 B;  2DYM A;  4AWJ A;  2JXX A;  3RT3 B;  2D11 A;  1LXD A;  1XD3 B;  4XZ4 A;  4HPL B;  2EKE C;  1GC7 A;  3PLU A;  3H9D A;  1GNU A;  4IM3 A;  3A4S C;  2MP2 A;  1GJZ A;  2MWS B;  2I1K A;  3P2B A;  3CST A;  2KXJ A;  4W9D A;  2MBE A;  3WAM A;  3BY4 B;  2BGF A;  2KDE B;  2WWZ A;  4KSK C;  1KLV A;  1WXV A;  2MP2 B;  4OVV A;  2K8C A;  2KFJ A;  2NVU I;  2K6Q A;  1E5W A;  4KSL C;  3S2A A;  4BBN C;  4HDO A;  2N1V A;  2NPT A;  1KM7 A;  2BKF A;  4ZDV A;  3ZNZ B;  3V6E B;  4TQ0 A;  4LDT D;  2WDT B;  4FLH A;  3IG3 A;  2O6V D;  4KDI C;  5FR6 A;  4N9F 4;  3ECI A;  5AZH A;  2ZZP B;  3NHE B;  3A33 B;  5J2R A;  2GBM A;  5AZF A;  1J0G A;  1YX6 B;  2KK8 A;  2KX3 A;  2XBB C;  2DZM A;  2Y5B B;  4LJP B;  1JRU A;  2KC1 A;  3GOE A;  1V2Y A;  2V1Y A;  2GMI C;  2XK5 A;  4NY0 A;  4ANV A;  3ZLZ A;  3V6C B;  1LFD A;  3ZRC A;  3DOW A;  3L0W B;  3NZU A;  1UBI A;  4DDG D;  2IYD B;  3SD5 A;  1H4R A;  3PHW B;  2KFK B;  2K6D B;  3AUL A;  4XX5 A;  1RLF A;  3KVF B;  4B6W A;  4EKU A;  2MW5 A;  1UEL A;  2LD9 A;  2DYB A;  5CX3 A;  2G4D B;  2ZPN A;  4B9K A;  4NAW A;  4WQO B;  1YD8 U;  3Q3F A;  3EEC A;  2FAZ A;  2IO0 B;  5DPS A;  2EMS A;  3RUI B;  4NAW B;  2NBV B;  4ANX A;  2LVQ A;  2NS5 A;  1Y8R C;  3VXW A;  4II2 B;  3HIZ A;  2DEN B;  3GZN I;  2J0M A;  2K8H A;  2LGD A;  2RD0 A;  3L17 A;  3TIX A;  3V60 A;  1YQB A;  2L3Z A;  5L95 C;  1I35 A;  1Q0W B;  3EFU A;  2HTH A;  3A1Q A;  3PS6 A;  2IY1 B;  4JLC A;  3W1Y A;  3DBR I;  2JZ3 B;  3A1Q B;  3U8Z A;  4EUT A;  1GG3 A;  4MJS A;  1X1M A;  3K9P B;  1GUA B;  2K1F A;  4BOZ B;  4E3C A;  2FID A;  3BIN A;  4K81 A;  2K39 A;  3A9J A;  4MJS B;  2L0T A;  2MLB A;  4J6I A;  2CHX A;  3QQ8 B;  2JRH A;  4WJQ A;  3A9J B;  2MRP A;  2KLC A;  2GOW A;  5G55 A;  3A9K A;  4ZRI A;  2N4F A;  1UZX B;  2PE9 A;  2LXC A;  3EC8 A;  1KOT A;  1P9D U;  4ASW C;  2D3G A;  1M94 A;  2BPS A;  2O6V A;  4M8M A;  1L7Y A;  1P0R A;  3ZDT A;  3HM3 A;  3OJ4 B;  4JIO U;  4LDT B;  5J18 A;  3CMM B;  1WX9 A;  3PV1 A;  2KMA A;  4IWQ A;  3ZTC A;  3UIN B;  3LDZ E;  4I6N B;  3APF A;  3KW5 B;  2GBN A;  4BFR A;  1OEY J;  3L13 A;  4EFO A;  3B1L X;  5C23 A;  2DAJ A;  1UH6 A;  4FA6 A;  2A4Z A;  2BWE S;  5DPT A;  2IZV B;  4AJY B;  1V86 A;  4II3 B;  3OJ3 A;  2IO2 B;  4MH0 E;  2LGY A;  2LWP A;  2DYO A;  2LRW A;  3DBL I;  3M3J A;  5CHF A;  2MBO A;  2O2V A;  2LUE A;  4M8N A;  3VTU A;  3X23 A;  5AEK B;  4DHJ D;  3JSV B;  2N7D A;  3RZW C;  1E7U A;  2MSE D;  4BKT A;  2D07 B;  2IY0 B;  2O2V B;  2B3A A;  5CHW A;  3WAL A;  1GC6 A;  1WIA A;  4DWF A;  2KC2 A;  1WXS A;  5E6O A;  3VUX A;  2KJ6 A;  2DHZ A;  2WX0 A;  4G11 A;  5AZG A;  2BYE A;  2NCN A;  3DCG A;  2HE7 A;  2C5L C;  1YIW A;  2ZCB A;  4PS7 A;  2M0X A;  1V6E A;  3OAW A;  4M0W B;  4DHZ E;  3KUD B;  4A20 A;  3UQA A;  2FCN A;  2V4L A;  4AUQ C;  3SDL C;  2ZPY A;  2RSU A;  4MGI E;  1IPG A;  4NJ6 A;  3VQI A;  3VUW A;  1E90 A;  2ZNV B;  2LXA A;  4PYZ A;  1K8R B;  2KDI A;  4MGZ E;  2A5U A;  3HK0 A;  4GU2 A;  3VFK A;  2IBI B;  2PE6 B;  4GB9 A;  2JY6 A;  3MJW A;  4FUL A;  3N32 A;  4ZRJ A;  2G3Q B;  2YLM A;  2KNB A;  3NZS A;  4W9J A;  4ANW A;  4CYE A;  4KIK A;  4FBJ B;  2NBW B;  4BVU C;  5KHQ A;  1FXT B;  3X0W A;  2WX1 A;  3ENE A;  2NPT B;  3DQV A;  2BYV E;  4IW0 A;  4K7S A;  4RM9 A;  3EHV A;  1BT0 A;  2CKH B;  2KKC A;  3H7S A;  4W9F A;  1AAR A;  4F1S A;  4E71 A;  3DVN V;  2KJR A;  2G4S A;  3VVW B;  1V5T A;  2RPQ A;  3PTF C;  2UYZ B;  3B08 A;  4GDK A;  1I42 A;  3W1S A;  4MGK E;  4FHJ A;  3PLV A;  1UD7 A;  4GDK B;  2LVO A;  3PPA A;  3B0A A;  2XK5 B;  2CU1 A;  2KWU B;  4G3X B;  1TZ1 A;  4K1R B;  3APC A;  1SE9 A;  1SGH A;  2LZ6 A;  3UQB A;  3ZRF A;  1TTN A;  2KX0 A;  5TR5 A;  2KVR A;  1WZ3 A;  1SIF A;  1WH3 A;  2C60 A;  2OJR A;  5E6P A;  5JHA A;  2BWF A;  1WRD B;  2I1J A;  3CF6 E;  2MQJ A;  5C1Z A;  4W9E A;  2RR9 A;  2N9P C;  3T8M A;  3AXC A;  3ZNI D;  4W9C A;  1P98 A;  2AL3 A;  4JL9 A;  3O65 B;  2L05 A;  2WYQ A;  1WX7 A;  2DX5 B;  1C1Y B;  3ONS A;  4MSM B;  2LGX A;  3R7R A;  3ZO5 B;  4KVG B;  4WAA A;  3JVZ X;  1WR1 A;  1WFY A;  2C7H A;  2VRR B;  3WA0 A;  4AJW A;  3DPD A;  1WM3 A;  4GN1 A;  2MA9 B;  2GBJ A;  3PVL A;  1LM8 B;  2KWC A;  4W9K A;  4DHJ B;  1WI0 A;  1XQQ A;  4MGY E;  4K7U A;  2ZNV C;  5D7G A;  1E8Z A;  4TV3 A;  2JUO A;  2KQS A;  4EZJ A;  1T0Y A;  1UBQ A;  2KHW B;  2M8S A;  2LJ5 A;  4K7W A;  5L83 A;  2EMT A;  2KD0 A;  2ZVN A;  4IG7 B;  3D32 A;  3U30 A;  3UIO B;  3L54 A;  5DPR A;  3WAN A;  1WGH A;  3IFW B;  2NBU A;  1J19 A;  1TGZ B;  2QHO A;  4GDL A;  3TL5 A;  5CTR C;  3UIP B;  4DK5 A;  4HCN B;  2KQ7 A;  4EZL A;  2XEW A;  1YX5 B;  4IC7 B;  4GDL B;  4WWN A;  1WM2 A;  4EOY A;  1Q5W B;  4F7Z A;  3A9K B;  4YL8 A;  3VAW A;  4DHZ B;  2KLG A;  2N1W A;  4HLE A;  4G50 A;  4OVU A;  3WAP A;  2Z0E B;  3Q3J A;  2R2Q A;  2O6V B;  1WGG A;  3HM6 X;  3KYD D;  1E7V A;  3TBL D;  3CSF A;  2JWZ A;  1WGY A;  2HJ8 A;  4GMV A;  4FN2 A;  2JF5 A;  1WJ4 A;  5CHV C;  1NBF C;  1C3T A;  4X57 B;  2CHZ A;  2LVP A;  4ICU A;  2KTR A;  3M95 A;  4JGH B;  3IBE A;  3ML9 A;  5G2N A;  2L00 B;  4RMA A;  3UF8 A;  3ZDM C;  4EZK A;  4IM2 A;  3PT2 B;  1RRB A;  3TMP B;  3UGB B;  4FJZ A;  2HD5 B;  3QWZ B;  1V49 A;  2YVC A;  4ZRK A;  2KDF B;  2FIF A;  2PJH A;  3QCA A;  4HCP B;  2LRU A;  3L16 A;  4W9G A;  2ZJD A;  2N9E B;  3VDZ A;  3WAO A;  2FUH B;  4ANU A;  2MCN B;  3QJZ A;  3QX1 A;  3SHQ A;  3TCA A;  4WJN A;  2JVC A;  4NPN A;  2REX A;  3PGE A;  4MEM A;  3R66 C;  4PS8 A;  3VHT C;  3C0R B;  1WR6 E;  2OOB B;  2V3S A;  1RFA A;  3APD A;  3M63 B;  4HVB A;  1WGR A;  1V80 A;  2CHW A;  3DVG X;  3ML8 A;  2L7R A;  4RM8 A;  3N30 A;  1OTR B;  1XT9 B;  2MBQ A;  1P3Q U;  2D10 A;  3A4R A;  4A3O A;  2KDB A;  2J0J A;  4MDK E;  2AYO B;  3U7D A;  5E6N A;  2DZK A;  2K8B A;  3QA8 A;  2KJH B;  2DZI A;  5J17 A;  3VUY A;  3KYC D;  4WJP A;  2JRI B;  2CS4 A;  4I6P A;  4B95 A;  1EUV B;  2JPH A;  4E74 A;  1S3S G;  4KIK B;  4CO7 A;  3NOB A;  1WXA A;  1WMH A;  1OQY A;  4KZ0 A;  4W9L A;  1IYF A;  4HPM B;  1WMH B;  2K25 A;  1L2N A;  2ASQ A;  4GSW A;  4F8C B;  1HE8 A;  3DBS A;  1S1Q B;  1KJT A;  3H6N A;  3QK0 A;  3I3T B;  4KZC A;  1WXM A;  3ZIM A;  4ZYN A;  1D3Z A;  2C7M B;  1WZ0 A;  1WY8 A;  3OLM D;  3V62 A;  3R3M A;  2M1M A;  2LAS A;  2AL6 A;  1TBE A;  1MG8 A;  3MHS D;  3N3K B;  1Z5S B;  3LJ3 A;  2W9N A;  3ZKJ C;  2G45 B;  4CHK A;  2C9W B;  1ZW7 A;  4DXA B;  2AEH A;  1EF5 A;  2CR5 A;  3VH4 B;  1J8C A;  2JT4 B;  5LXI B;  2L0F A;  4GGQ A;  5D6J B;  2C7N B;  2ZVO A;  3AU5 A;  3QAR A;  4NQL B;  4PS3 A;  5D94 A;  4BKS D;  3ZTD A;  2N9X A;  2J0K A;  2KFK A;  2J7Q B;  4IWO A;  2BYF A;  5DPW A;  3VTV A;  4PYU A;  4MEL A;  4NNJ B;  4HJK A;  4TKN A;  4JQW C;  3L10 B;  4HDQ A;  4FJY A;  2KOX A;  3IVF A;  3KUC B;  1NDD A;  2PPH A;  2KN5 A;  1EF1 A;  1WJN A;  4NJ7 A;  2FCM A;  4AOF A;  2IO1 B;  2N7E A;  1WX8 A;  2MBB B;  4LJO B;  4WWP A;  4W9H A;  3DVN U;  2KTF A;  3ZNG C;  3RYT A;  4MSQ B;  2M4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...