2FCSA

X-ray crystal structure of a chemically synthesized [l-gln35]ubiquitin with a cubic space group
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEQIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the energetics of protein alpha-helix C-cap termination through chemical protein synthesis.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Ubiquitin
total genus 21
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fcsA00
2BYFA 3A1QB 4G3XB 5E6OA 4DDGD 2LXCA 2MBEA 2JUOA 2MP2B 2M17A 2KTRA 2O2VA 4KSKC 2HD5B 3W1SC 5HKHA 2MBQA 4GU2A 4MM3A 2J0JA 1C3TA 2D10A 2K8HA 1K8RB 4GGQA 2KFKB 2NBUA 3M3JA 1WZ3A 2HTHA 3DCGA 3R66C 2GBNA 3APDA 2LVPA 2C5LC 1LQBA 2K6DB 4BOZB 1YX5B 3WAMA 3VAWA 4OVUA 5CTRC 1ZKHA 1R4NI 1WXAA 3KYCD 2KHWB 3TMPB 5CHFA 2PE6B 3A9KB 1UELA 3PRMB 4GOCA 3A9JB 4WJOA 2NBVB 3DBHI 5G2NA 2XBBC 1OEYA 1TBEA 4KDLB 3VXWA 2BWFA 3UIPB 3JSVB 3UF8A 1V5OA 3CMMB 3JSVA 3ZRCA 2KLGA 3HHMA 4FJVB 2R2QA 3WAPA 3ZTDA 2IO2B 3LDZE 4HWIB 2DENB 3KVFB 2HE7A 4IWQA 4BKTA 3PTFC 2NVUI 2XK5A 1X1MA 4NAWB 1J8CA 1H4RA 1WXVA 4XX5A 2KC1A 3B08A 3KUDB 4GDKA 4JL9A 1RRBA 4W9FA 3OAWA 2YVCA 2MBBB 4RMAA 3PSEB 3MTNB 4X57B 3RULA 4E3CA 2JRIB 4A3OA 2FCNA 5G55A 3H6NA 3Q3FA 3RZFA 2ZEQA 4II3B 4MSQB 3U30A 4PS3A 2NCNA 1WX7A 4EZLA 3SU8X 1L2NA 2HJ8A 2MBHA 1UBIA 2LUEA 5JH5C 4F8CB 4DHJB 4A3PA 4WJNA 1C1YB 3ZNHB 4NNJB 5LLIA 3DVGX 2ZCCA 4W9JA 1WGRA 4KZCA 1EO6A 2KZRA 3VUYA 1WZ0A 3ML9A 3EHVA 2DHZA 2JZZA 3VFKA 4WQOB 1VD2A 1WE6A 4W9DA 4NY0A 4ANWA 3SDLC 3ZRFA 3T8MA 2N9PC 1E8WA 4ZRIA 2CHZA 2LVQA 4CO7A 4EKUA 2Z0EB 2MCNB 5J17A 1NI2A 4B6WA 3B0AA 2L8JA 2KTFA 2RR9A 4RM8A 3R7QA 4OVVA 2K25A 3VDZA 4FADA 5D2MB 3BINA 2D2QA 5AZFA 3VH3B 2DZJA 4IM0A 5DPWA 1A5RA 2KDEB 1WR1A 4FN2A 4EZJA 3H9DA 4AP4C 3H1UA 3PPAA 2CKHB 3ZTCA 3QIJA 3M62B 3ZO5B 1V5TA 1YIWA 1SGHA 3NZSA 2GMIC 4G11A 4G50A 4W9GA 2ASQA 1GNUA 1EF5A 1AARA 4F1SA 4NJ7A 2LWPA 2O6VA 4WAAA 3N3KB 4FLHA 2MA9B 1GJZA 2DAFA 2DZMA 3L16A 1OQYA 2AWTA 4NPNA 3NHEB 1L7YA 1LXDA 2BPSA 2NR2A 1WGDA 4RM9A 3VUXA 2BYEA 3UQBA 3SHQA 3ENEA 2LASA 4DBGA 2DX5B 3Q3JA 2AL3A 1XQQA 4MGYE 1V86A 3A4SC 1BT0A 1T0YA 4GSWA 3PS6A 2KJRA 1PQSA 4W9EA 4EEWA 2GBKA 3U8ZA 4PYZA 4HJKA 4HVBA 2EMSA 2REXA 5IA7A 4IWPA 2KVRA 2C7HA 4FULA 4GXBA 3IBEA 3L17A 2RSUA 2WX1A 2D11A 5D94A 4GDLB 4CHKA 4ZDVA 2I1KA 2KDFB 4ICUA 2CHXA 1OGWA 1KJTA 4A20A 2KWVB 2L05A 1WX8A 3AULA 1UH6A 2L0TA 1WJ4A 1WR6E 2PPHA 4GDKB 4FA6A 3QA8A 1E90A 4GIVA 2DYBA 2MLBA 4ZYNA 3QC8B 1NDDA 3MHSD 3GZNI 1YX6B 3ZNZB 1Q1OA 2WWZA 5CHVC 1IP9A 5D7GA 2KWCA 3V61A 2ZPYA 3K9PB 5JHAA 4BBNF 3IHPC 3ZLZA 1TTNA 1RFAA 3CF6E 1WJ6A 2KKCA 3WANA 4K7WA 5BO4B 4TQ1A 2MW5A 2NBWB 4B95A 2KFKA 3RYTA 4EZKA 3L10B 4HCPB 4HK2A 1Z5SB 4NAWA 1P3QU 5C1ZA 3R7RA 4ANUA 3PREA 2KXJA 2IY1B 4BBNC 2LRUA 4PYUA 2FIFA 2A5UA 4KZ0A 4K7SA 3AXCA 3V62A 2M8SA 4I6PA 2IYDB 5E6NA 2FNJB 2L3ZA 2OOBB 2IY0B 2KWUB 2XEWA 3QJZA 2N9XA 2KJ6A 3EFUA 2MBOA 3H7PB 5DPRA 3A9JA 2MX2A 2L7RA 4CYEA 1EF1A 3PLVA 4LCDE 2LRWA 4TUUA 2RGFA 3M63B 3O65B 4I6LB 4AOFA 4AUQC 2QHOA 2NS5A 5J2RA 2KTRB 2O2VB 1G6JA 3OLMD 2LZ6A 4MH0E 3ZNID 2CU1A 2GBRA 3KW5B 4IUMB 3WIMA 1KOTA 4GN1A 3V60A 3VHTC 2L0FA 2IO1B 4W9LA 2V4LA 5L83A 2LGDA 1E5WA 1Y8RC 4B9KA 1WMHB 2KC2A 1WGHA 2KLCA 2Z0DB 1WMHA 3DVNU 3NZUA 1WM2A 3JYUA 2G3QB 2JF5A 1P0RA 1V6EA 2JRHA 4W9IA 3UQAA 4AWJA 3KH0A 3EECA 4MSMB 1UZXB 4XZ4A 5AZHA 3TJPA 4HDQA 3TIXA 2OJRA 1V80A 4IW0A 4ANVA 4HLEA 2I1JA 2N4FA 1OEYJ 4BVUC 2FCSA 2G45B 3IFWB 3JVZX 1SE9A 2KOXA 4W9KA 4BFRA 1D3ZA 1WF9A 3ALBA 2AYOB 2VRRB 5GMVA 2B3AA 4IWOA 1R4MI 1UGMA 3ZIMA 1VCBA 4GMVA 5L95C 3RCZA 4KSLC 2A4ZA 1WFYA 2WYQA 1WM3A 3L08A 4FJZA 2GBJA 1WI0A 4I6NB 4KDIC 2GOWA 1SIFA 1QZEA 1E8XA 3HM6X 4FBJB 3HIZA 3KUZA 5FR6A 1RLFA 1P9DU 2BGFA 2D07B 3W1YA 3ZKJC 3ZUNA 3T9LA 2DAJA 4TKNA 2ZNVB 2KQSA 2N9EB 1F9JA 4MGKE 4GDLA 3UINB 4E74A 2KFJA 2K6QA 1H8CA 1Q0WB 1J0GA 3PHXB 2C7NB 3PLUA 3PV1A 4FHKA 2BF8B 3X23A 2LXAA 2MSED 1Q5WB 2KMCA 3QCAA 3L13A 1E8YA 4LJOB 1WXSA 2IZVB 1WH3A 1WIAA 1U4AA 2WDTB 4G0NB 3ZNGC 2IO0B 2KO3A 3A1QA 2FIDA 1E7VA 3DQVA 2FCQA 4K81A 1WXMA 2RPQA 2K8BA 3QX1A 3PHWB 3N32A 2EKEC 2RD0A 2AEHA 2JXXA 2N7DA 2LI5A 2ZVOA 4MGIE 3C0RB 3VUWA 2K1FA 2KK8A 3ECIA 4MELA 3EC8A 1XT9B 2KNBA 1CMXB 4LDTB 4HPMB 2Z59B 3GOEA 3VTUA 3R3MA 3WAOA 3QARA 4EUTA 1HE8A 2JY6A 3LJ3A 4HXDA 2BKFA 4IC7B 3PVLA 3AU5A 2K39A 3A4RA 3DVGY 3A33B 3QHTA 1XD3B 1GC7A 2G4SA 3APFA 3TBLD 4JQWC 4DHJD 2LVOA 4WWNA 4JLCA 1YJ1A 3V6EB 5JHBA 2JVCA 2KX3A 2FUHB 3KUCB 2CS4A 2UYZB 4DK5A 2LGXA 4K7UA 2EMTA 3NY5A 4DHZE 1LFDA 3PRZA 4WJQA 3WA0A 3SD5A 1ISNA 4LJPB 4LDTD 1KLVA 4KIKA 2KQ7A 2ZCBA 1V81A 4TV3A 3RZWC 3S2AA 2J0KA 2N7EA 2CHWA 2M4NA 4E71A 4PS7A 4ASWC 2KDBA 2L76A 3OJ3A 4IM2A 2M0XA 1TZ1A 1GG3A 3DPDA 4NJ6A 1ZW7A 2C7MB 4JIOU 3D32A 4ICVA 3BY4B 4P7IA 5EDSA 3ZDMC 3PT2B 2FAZA 4M8NA 2KMAA 3QWZB 2DYOA 2GBMA 4WWOA 2ZJDA 2WX0A 2J7QB 3VQIA 3RT3B 2BKRB 3HM3A 1V9JA 3UGBB 4DHZB 2O6VD 2N1WA 2ZPNA 4XC2A 5JZEB 1S3SG 4N9F4 2KJHB 1GUAB 3ZVVA 4W9CA 5AEKB 2IBIB 5DCNA 3IG3A 1WGGA 2JWZA 3ML8A 2D3GA 1E8ZA 2LJ5A 3DOWA 5KHOA 1IPGA 4KVGB 1KM7A 2YLMA 2W9NA 4IG7B 4IM3A 2ZVNA 4AJWA 3QQ8B 3VTWA 4BKSD 2DYMA 2N1VA 3VTVA 1WX9A 3UIOB 4ANXA 1WY8A 1ZGUB 2FCMA 4FHJA 4TQ0A 2UWQA 3ZW3A 3PZDA 2V1YA 3H7PA 3PGEA 3K9OB 3P2BA 2KX0A 4MJSA 4EFOA 5DPSA 3DDCB 2JZ3B 4WWPA 3H7SA 3RD2A 4K1RB 5C23A 3I3TB 1M94A 4J6IA 1IYFA 1J19A 4KIKB 4HPLB 2C60A 1E7UA 3KYDD 2PJHA 3IVFA 1EUVB 5D6JB 3AI5A 2J0MA 3TCAA 3U7DA 2CR5A 3AU4A 1WGYA 4W9HA 4URKA 2BWES 3W1SA 2MRPA 2NPTA 1MG8A 2NPTB 4WJPA 4KV2A 3HK0A 5DPTA 2XK5B 3L0WB 2KN5A 1GC6A 3DBLI 1WE7A 1TGZB 2LD9A 3MJWA 4JGHB 4BKGA 5KHQA 3QAQA 5LXIB 1YD8U 2MQJA 5LXHA 5IAAC 1P1AA 5J18A 2KDIA 4EOYA 2IO3B 3PRPB 1WRDB 3QK0A 5AZGA 3APCA 2DZKA 2O6VB 1JRUA 2BYVE 4MJSB 2KANA 2Y5BB 3CSFA 1FXTB 4HDOA 1UD7A 2V3SA 4DWFA 4DXAB 2MWSB 3A9KA 3NS8A 3OJ4B 4M8MA 1V49A 3B1LX 2JPHA 1S1QB 4M0WB 3VH4B 4BOSC 4FJYA 3VVWB 1WJNA 3TL5A 1LM8B 2C9WB 2KD0A 2ZNVC 2LGYA 3N30A 4ZRJA 1YQBA 3ZDTA 3DBRI 3JW0X 4BKSA 2MP2A 2R2OA 5CX3A 1WYWB 3DBSA 1P98A 5CHWA 5E6PA 4II2B 1RAXA 2L00B 3L54A 4AJYB 3X0WA 2JT4B 3M95A 4GB9A 3CSTA 2M1MA 2AL6A 3ONSA 3V6CB 2ZZPB 3WALA 1OTRB 2K8CA 3NOBA 4MEMA 4DDID 4NQLB 4HCNB 4F7ZA 1I35A 5TR5A 2DZIA 1Z2MA 4NQKE 4ZRKA 1I42A 3DVNV 2G4DB 4PS8A 4MGZE 4MDKE 4YL8A 3RUIB 1NBFC 2PEAA 2PE9A 1UBQA 1V2YA 1WJUA
chains in the Genus database with same CATH superfamily
3MC8A 1EWYC 3Q8BA 2WXLA 3W1SC 2MBQA 4MM3B 2D10A 4GGQA 2KFKB 2NBUA 2HTHA 1N60A 3WAMA 4OVUA 5CTRC 3TMPB 1I4HA 3PRMB 1CJEA 4KDLB 4RNAA 2BWFA 1V5OA 4FJVB 1SF0A 3LDZE 1FNUA 4PT5A 2XK5A 4NAWB 1L0XB 3Q3NC 1H4RA 3LB8C 2N9KA 4W9FA 2BTEA 3OAWA 5IP4D 1IUEA 5G5HA 4A3OA 2FCNA 3H6NA 4K3CA 4II3B 4MSQB 4PS3A 3SU8X 1L2NA 2HJ8A 2MBHA 5HG2A 4C4VA 4DHJB 4WJNA 1JWUD 1ET9A 3DVGX 1E6EB 1D5XC 3VUYA 1WZ0A 2DHZA 2JZZA 4NY0A 3ZRFA 1SB3C 2N9PC 1E8WA 3BYYB 2LVQA 2PMVA 3AE8B 5HHDG 2L8JA 3I9V1 1UGJA 4H2AA 5D2MB 3PO0A 3VH3B 1WR1A 3Q8EA 4AP4C 3H1UA 1RWSA 1SSNA 1V5TA 1YIWA 3KWVA 4W9GA 1GNUA 2ACZB 1AARA 3PZ8A 3NG0A 4NJ7A 4F1SA 2ONQA 1OQYA 3NHEB 2BPSA 1E0ZA 1WGDA 2PVOD 1YMHE 1MFWA 4EE2A 3Q3JA 4MGYE 4US8A 1BUIC 5TSSA 2EMSA 5EE3A 1JALA 4FULA 3HVDA 2JWUA 2D11A 4A20A 1WJ4A 4RGNA 2LEKA 1HTOA 3AE2B 3NS1A 1FXIA 1QQRA 2WWZA 1GAQB 5CHVC 1HEZE 4BBNF 3DWMA 3AEDB 1FIQA 2WLBA 2ICIA 2KKCA 1F2RC 2MW5A 4B95A 3U52E 3WCQA 3W9CB 3L10B 2WXIA 4HK2A 1Z5SB 3VRBB 1P3QU 5C1ZA 2KXJA 2JZPA 4KZ0A 4K7SA 3IT4B 4B0EA 2IYDB 2OOBB 3AMZA 2KWUB 2XEWA 1L6VA 4NAMA 5DPRA 4L2YA 1XO3A 2BYTA 2W82A 4C7ZA 5J2RA 1L0VB 1G6JA 3OLMD 2LZ6A 4IOIE 4IUMB 1KOTA 4GN1A 2OJWA 3V60A 2L0FA 4W9LA 4KX6B 5L83A 1JRPA 2KC2A 4A6QA 1WMHA 5HI1A 4AWJA 2K5PA 4HDQA 1V80A 1ZPSA 4HLEA 2I1JA 1YQ4B 1OEYJ 3JVZX 1GOZA 1SE9A 2KOXA 1JWSD 4L23A 2AYOB 2VRRB 5GMVA 1R4MI 4ITKA 4GMVA 4YSYB 2A4ZA 3GP7A 2WS3B 1TT5B 4I6NB 2WXQA 3AEFB 3N9YC 3HIZA 2D3BA 1AYFA 3KUZA 1RLFA 1P9DU 2BGFA 4ZYSA 2W3RA 3T9LA 4TKNA 3ZUNA 3FILB 3N1XC 1F9JA 2KFJA 1Q10A 4WH4A 2C7NB 2BF8B 2MSED 2INNE 4A8XC 2KMCA 1WXSA 4G0NB 2IO0B 1WWTA 2KO3A 3DHGC 2FIDA 2QJLA 2D3AA 4PK1A 1F1HA 4K81A 3DHIC 2RPQA 2K8BA 3HVZA 2LI5A 3AH7A 2KK8A 4MELA 1XT9B 2KNBA 4LDTB 2Z59B 3GOEA 3VTUA 2G9HD 1R7SA 3ETRA 1HA5A 1OFFA 2PLPA 3ZGZA 5LXHA 3APFA 1GC7A 2G4SA 2FUHB 1IGCA 3GZNB 2LGXA 3NY5A 3WA0A 3IT6B 3RNCC 1KLVA 2KQ7A 2WXPA 3V05A 2M4NA 4PS7A 2K3UA 1IGDA 2FUG1 1VZ6A 1GG3A 3D32A 3AEBB 3VRAB 4HRSA 3ZDMC 4M8NA 2KMAA 5EE9A 2ZJDA 2DBYA 4DQOC 3U4EG 3AB5A 2BKRB 1V9JA 2O6VD 2WQYB 4RGOS 2N1WA 2J4XA 4YTPB 1GUAB 1WSPA 3ZVVA 3P1MA 1E8ZA 1TKEA 3AEEB 1KM7A 1UWXA 2W9NA 2IGGA 4IM3A 3MP9A 4YTMB 3BVZA 1KTKA 5EE1A 1JCKB 2UWQA 3PZDA 1I4QA 3H7PA 3PGEA 4MJSA 2K0PA 4EFOA 1C4CA 4RF1A 1NYQA 2JYTA 3RNAC 4BZAA 4J3OD 3H7SA 4WWPA 2G1EA 1M94A 1N6ZA 1IYFA 1FCCC 1J19A 4KIKB 3KYDD 5D6JB 4O1NA 3AU4A 1XLOA 4URKA 2BWES 2MRPA 2NPTA 4WIPA 3L0WB 1SE2A 1TGZB 1WE7A 5KHQA 2JU6X 3QAQA 2KAJA 1T6BX 3DBRB 2V0GA 5AZGA 1JRUA 1M4VA 2D3CA 1FXTB 1ZDXA 1C4PA 3T3OA 1UD7A 4DWFA 3A9KA 4M8MA 1V49A 3KLSX 1S1QB 4NJCA 4BOSC 2GI9A 2LGIA 3EGRA 1VZ8A 2K9XA 2KD0A 2ZNVC 1YQBA 3DBRI 3Q3OC 1WYWB 4AJYB 3P4QB 4II2B 3X0WA 2INCC 2AX5A 4LLGM 2MHJA 2K8CA 4DDID 3N20C 4NQLB 1I35A 4KGRA 3NVWA 5TR5A 4S0RA 3OG5A 4PS8A 4MGZE 4MDKE 4YL8A 3RMKC 3TEXA 2V9HA 1UBQA 2BYFA 1HTQA 3A1QB 1JROA 5E6OA 1UNSA 2YEPB 1EU4A 2LXCA 1L4ZB 2M17A 1ET6A 2KTRA 1PDXA 5BMIA 2HD5B 3RNGC 4GU2A 1C3TA 2K8HA 1SE4A 3TEWA 2M56B 2LVPA 1JWMD 1YX5B 1XLNA 2R61A 3KYCD 2Y3AA 5CHFA 3A9JB 4WJOA 2RPVA 3FKYA 3VXWA 1FD6A 1T5XD 3AV8A 3JSVA 3HHMA 2R2QA 4RGTA 3ZTDA 3AN1A 4IWQA 5FR3A 1X1MA 4XE0A 1WXVA 3RNEC 3KUDB 4GDKA 2YVCA 3BZDB 4AQ7A 3PSEB 2L52A 2LGSA 2JRIB 2NTSA 1SEBD 2ZEQA 2KT7A 3U30A 2NCNA 4FXCA 2LJIA 2MJDA 5JH5C 1P7EA 4NNJB 2DWQA 5LLIA 3ZXRA 2CJOA 1IBXA 1WXQA 2LHEA 5HFYA 1R4NB 2CHZA 2HDEA 3B0AA 2RR9A 5GXGB 4RM8A 3VDZA 4OZAA 1L4DB 3NZ3A 2D2QA 5AZFA 5EE0A 3BYTB 1A5RA 3Q6BA 4EZJA 4XWWA 2CKHB 3QIJA 2MEKA 4G11A 2ASQA 2O6VA 1R4MB 4FLHA 2MJ3A 4D2KA 1TKGA 2WDQB 3L16A 2AWTA 3IAS1 4TSSA 1LXDA 2PTLA 2BYEA 1MHXA 3SHQA 1T0QC 3B2FA 4A90A 1D5ZC 1XQQA 1I4PA 2BW2A 1BT0A 1ACCA 3A4SC 3R2TA 1PQSA 4YSXB 4PYZA 1YOVB 3AE9B 3AM9A 4S17A 4GXBA 3L17A 3TEZA 4OZBA 4GDLB 2KDFB 2CHXA 1OGWA 2SAKA 1A70A 2KWVB 3NUHB 2L05A 3Q2AC 1WR6E 2DYBA 2MLBA 4JWSC 3AE5B 1YX6B 4KKIA 5D7GA 2KWCA 1TZOA 3V61A 2ZPYA 3K9PB 5JHAA 1GB4A 1TTNA 1RFAA 3KQ4A 3E56A 1E9MA 4DXGA 1VRAB 2IJ0A 4HCPB 4NAWA 2IGHA 4ANUA 2IY1B 2LRUA 4N58A 4PYUA 2FIFA 3URYA 3AXCA 2KVZA 2JYEA 1C76A 2N9XA 3EFUA 2WXKA 2L7RA 3PLVA 4LCDE 4AOFA 2QHOA 2BS2B 2CU1A 3WIMA 3N1ZC 4ZOHC 1Y8RC 2PVGC 3W2DA 4B9KA 3DVNU 2Z0DB 1WM2A 2KMMA 3RFZB 2JRHA 1FCLA 2N9LA 3EECA 1YQ3B 5AZHA 3TJPA 1KLGD 3TIXA 4ANVA 2N4FA 3P4RB 1KF6B 1UWMA 3AECB 5T8IA 1D3ZA 1WF9A 3P4SB 4IWOA 1VCBA 3RCZA 1WFYA 2WYQA 4FJZA 4YXDB 4P1BC 1WI0A 4KDIC 1E8XA 3HM6X 2J42A 2WDRB 5FR6A 4M00A 3ZKJC 1FNVA 3AE4B 1QKZA 2DAJA 2ZNVB 1SXTA 2QCZA 4HJGE 1H8CA 2K6QA 5D3IB 1Q0WB 1VDVA 3OWEB 1Q5WB 3NVYA 3L13A 1E8YA 2WDTB 3ZNGC 3DWGC 1RM6C 5BYQA 2BT6A 4HKZE 1WXMA 2H88B 3N32A 2D5GA 2M0AA 2EKEC 2N7DA 4MGIE 2K1FA 3ECIA 3EC8A 1GB1A 1C78A 2HTME 3R3MA 4HXDA 2BKFA 3BVMA 1YN5A 3B9JA 3QHTA 4DHJD 3TBLD 3IAM1 4JQWC 4RH6A 1BMLC 4WWNA 4JLCA 2KX3A 1MG4A 2CS4A 1OQQA 2UYZB 4K7UA 4MACA 1ZXHA 3B2GA 4WJQA 4USAA 2GB1A 2CU3A 1OQRA 3H8HA 1LO5D 1V81A 2MH7A 2N7EA 2HJ1A 4ASWC 3NRZA 3EA6A 1Y56A 2RMMA 2XNAC 3DPDA 4NJ6A 1C79A 4ICVA 1TS2A 3MC9A 1I4RA 1WGKA 1PGXA 3PT2B 3VR9B 2DYOA 1NVID 2WX0A 2J7QB 2GRIA 4ZHOA 1CZPA 2V4IB 4LNOA 4HEA1 2ZPNA 5JZEB 4LNNA 4LNFA 4US9A 4W9CA 5AEKB 2IBIB 3IG3A 2JWZA 2LJ5A 1IPGA 3AEAB 4IG7B 2ZVNA 3QQ8B 2LFIA 3VTWA 4BKSD 2DNFA 3UIOB 1WY8A 2AQ2B 3K9OB 4RFBA 3IXSA 5AUIA 2JZ3B 2WNMA 5BYRA 1ENFA 1FFUA 4W9HA 3TEYA 4KV2A 3HK0A 5DPTA 2KN5A 1GC6A 1VJKA 3MJWA 2LD9A 5LXIB 2MQJA 2BS4B 5J18A 4EOYA 3PRPB 3NJTA 4MH8A 3RNFC 1PUTA 2DZKA 4XYCA 1RFKA 2KANA 2Y5BB 3CSFA 2V3SA 1CQVA 1QOGA 3HUIA 3EFCA 4DXAB 3AE3B 1AN8A 3VH4B 5I4DA 2C9WB 3N30A 2MP2A 2R2OA 1J7BA 3DBSA 4L1BA 5CHWA 1RAXA 3DBLB 4GB9A 3CSTA 3V6CB 1L5PA 4HPPA 3W5VB 1QLBB 3NOBA 4MEMA 4HCNB 2W3SA 3DBHB 1Z2MA 2VH1A 4ZRKA 1I42A 1JWBD 1NBFC 2PE9A 1WJUA 3AE6B 2MP2B 2O2VA 2B76B 4MM3A 2XN9C 2QDFA 1TYGB 3R66C 1ZDVA 2C5LC 1LQBA 2K6DB 4BOZB 1EU3A 3VAWA 1FNWA 1ZKHA 2WHIA 1WXAA 1UF0A 3A9KB 1UELA 3GB1A 1JWAD 4GOCA 2NBVB 5G2NA 2XBBC 1SE3A 1OEYA 2WXJA 1TBEA 2WXRA 3CMMB 2KLGA 3WAPA 1FRDA 4HWIB 3KVFB 2HE7A 4BKTA 4DXFA 2NVUI 2KC1A 3GE3C 1K51A 3B08A 2X8XX 1YJJA 4JL9A 1IBXB 1RRBA 3N1YC 1YNTE 2QEJC 4X57B 3RULA 1DOYA 5G55A 3AEGB 3L4PA 3BVGA 4P16A 1HZ6A 2LUEA 1D5MC 4BAXA 1LGRA 4A3PA 4C00A 4YWGG 1FO4A 4W9JA 1WGRA 1EO6A 2NMQA 1VR9A 3EHVA 2WXGA 3VFKA 4WQOB 1WE6A 4W9DA 3T8MA 4ZRIA 3W5UB 3Q14C 3I63C 4EKUA 4GLSC 5J17A 4B6WA 3O13A 2IDYA 2J53A 2K25A 1MHHE 4FADA 3BINA 1AWDA 1I4XA 2FBWB 3TSSA 4C4VB 5DPWA 2KDEB 4FN2A 2IPKD 2LUMA 1TS3A 2ZW1A 2GMIC 3UI3A 1QOFA 4XDDA 1EF5A 2YEPF 5H92C 2MA9B 2L83A 1GJZA 2DAFA 4NPNA 2NR2A 4RM9A 3VUXA 3PZ7A 3ENEA 1L0YB 2LASA 1TKYA 1XLPA 2AL3A 1XCQL 1V86A 3PS6A 4EEWA 4K3BA 4HJKA 4HVBA 2REXA 4IWPA 2KVRA 3R8BA 1KFYB 2RSUA 2WX1A 4ZDVA 2I1KA 4ICUA 3ZJTA 4GDKB 4FA6A 1UH6A 2L0TA 2PPHA 4ZRPA 5IO9A 1E90A 4GIVA 4ZYNA 3QC8B 3GZNI 3ZNZB 3ZXVA 1YJIA 1Q1OA 4M0WA 4IKGA 3ZJUA 2E6XA 3IHPC 1KH0A 1WJ6A 4QAYA 3WANA 2BQQA 4K7WA 1FFVA 2OHFA 5BO4B 2NBWB 3DHHC 2KFKA 3R7RA 3PREA 4BBNC 4RF0A 1CK1A 2A5UA 1TY2A 2SEBD 5E6NA 1I7HA 3NVVA 1JQ4A 1YN4A 3QJZA 2KJ6A 3H7PB 2MBOA 4CYEA 1EF1A 2LRWA 4TUUA 2KYWA 3M63B 4I6LB 2NS5A 2O2VB 4MH0E 2GBRA 1SBBB 3VHTC 3KWLA 4LK0M 2LGDA 3CWIA 1E5WA 1WMHB 2KLCA 3NZUA 1TS4A 2AQ3B 3JYUA 1ZUD2 3MHZA 1P0RA 4HKQA 3KH0A 2W54A 4XZ4A 3RN9C 2M19A 2FCSA 2G45B 3IFWB 4W9KA 4BFRA 4ARIA 3ZIMA 1UGMA 2JXTA 5L95C 3Q8FA 1WM3A 1WRIA 2WXHA 2WXNA 2GOWA 1MVKA 1QZEA 4C56C 4FBJB 1DYQA 3R2IA 3W1YA 2KQSA 4YTNB 4MGKE 3UINB 4GDLA 4E74A 1PYWD 1J0GA 1F0ZA 3PHXB 2J52A 3RI7C 2LXAA 1P7FA 1PFDA 4LJOB 1WH3A 2ON8A 4UDUC 3A1QA 3DQVA 1HQRD 2FCQA 2VH2A 4CQNA 2WGSA 4LTUA 1B1ZA 2AEHA 3C0RB 2TSSA 2PIAA 1CMXB 4HPMB 4HROA 3QARA 3LJ3A 4XWTA 2QMTA 3PVLA 3AU5A 3A4RA 3DVGY 2LVOA 5E6JA 2JX5A 2JVCA 4DHZE 1LFDA 5IOIA 2LHDA 1ISNA 4LDTD 2RDGA 2N0SB 2ZCBA 1QT9A 4TV3A 3RZWC 4E71A 5BYSA 2KDBA 2L76A 3OJ3A 3P63A 4TMAB 2M0XA 1V97A 1TZ1A 2PKOA 3GE8C 3P42A 1ZW7A 3Q8CA 1HZ5A 4P7IA 5EDSA 2FAZA 4JX1C 3QWZB 1ESFA 3UGBB 3ZJVA 3C19A 1C4AA 4XC2A 1WGGA 2D3GA 1I4GA 2WXMA 3Q8AA 3DOWA 4KVGB 3V3XA 3ZQ4A 2YLMA 2FE8A 1B9RA 2LMCA 5C3JB 3EUB2 2L1AA 4B0MA 3ABVB 4N6EB 3VTVA 2VZKB 2FCMA 4FHJA 4XGAB 1K52A 3P2BA 4WQMA 2BB6A 1MJDA 3GS2A 4YT0B 2KQ4X 3RD2A 4K1RB 5C23A 3I3TB 4J6IA 3T3NA 2C60A 1E7UA 3AI5A 3U7DA 2CR5A 1WGYA 1MG8A 2NPTB 4WJPA 4Q2JA 2XK5B 3RPFC 1XEEA 1P1AA 5IAAC 2KDIA 2BBCA 1K50A 3QK0A 1TJEA 2O6VB 4MJSB 4AS1A 1TY0A 2MWSB 1FRRA 4RGMA 2KN4A 4WWMA 2AQ1B 2JPHA 3VVWB 4WURA 4LNKA 2LGYA 1K53A 4BKSA 3JW0X 5CX3A 2WP9B 1P98A 3L54A 2M1MA 2AL6A 2ZZPB 1OTRB 4M01A 3U2SC 2DZIA 3DVNV 1ZP0B 1JW9D 4P1CC 1N5WA 1V2YA 1PGBA 2QIEB 4G3XB 3AE7B 3BK2A 4DDGD 1FM0D 1ZE3D 2MBEA 2JUOA 1STEA 4KSKC 1NI3A 5HKHA 2J0JA 1T0SC 1K8RB 5H8YE 3M3JA 1WZ3A 3I5JC 3FILA 3DCGA 1PGAA 2GBNA 3APDA 2WXFA 2WU5B 3SFDB 1NEKB 3E9SA 4C80A 4MT5A 1WYGA 1R4NI 2KHWB 1SJED 2PE6B 1F2RI 2QSDA 1D6EC 4WAFA 3DBHI 4P6VF 3UIPB 3JSVB 3UF8A 3ZRCA 1DOXA 1V1PA 2IO2B 2DENB 3PTFC 1J8CA 3BK1A 4XX5A 2Y5CA 1C9FA 1XCTL 1FPYA 2MBBB 4RMAA 2K22A 4OW0A 3MTNB 2V3NA 4E3CA 2DLBA 2VZKD 1VLBA 3Q3FA 3RZFA 4EZLA 1WX7A 1UBIA 4F8CB 3Q69A 5JXVA 2UU7A 1C1YB 1TIFA 3ZNHB 1JMLA 2ZCCA 3C8YA 4KZCA 2KZRA 1L6UA 3ML9A 1VD2A 2PW9A 4ANWA 1HXYD 3SDLC 4KGSA 3I57A 2I2YA 4CO7A 4M02A 2W55A 2Z0EB 4N59A 3LYYA 2GLSA 2MCNB 1NI2A 3SR6A 2KTFA 3TUOA 3R7QA 4OVVA 2DZJA 4IM0A 1DGJA 1NYRA 1T3QA 3H9DA 5D3DA 1MPEA 3PPAA 3ZTCA 3M62B 3ZO5B 1SGHA 3NZSA 4G50A 1AW7A 2LWPA 4WAAA 3N3KB 3BIID 2DZMA 1L7YA 3UQBA 4XDCA 3HRDD 2V3PA 5FK9C 4DBGA 2DX5B 5C2TB 4NZLB 4GSWA 1T0YA 1KLUD 1SIJA 2KJRA 3FAHA 4W9EA 2GBKA 3U8ZA 5IA7A 5BMGA 2C7HA 3IBEA 5D94A 2L32A 4CHKA 1KJTA 1NENB 1WX8A 3AULA 3BWUD 3QA8A 3FC4A 1EM7A 3VR8B 1J7CA 1ZXIA 1F77A 1NDDA 3MHSD 1DOIA 4OHJA 1IP9A 2INDC 3CIRB 5MPOA 2MJEA 3P4PB 3ZLZA 3CF6E 3MFGA 1QOAA 4TQ1A 3U7ZA 4JE3B 3J9CA 5BMHA 3RYTA 4EZKA 2NTTA 4YSZB 2E3TA 3LXFA 4A55A 1N63A 3V62A 1J7AA 2M8SA 4I6PA 4REZA 2FNJB 2L3ZA 2IY0B 3A9JA 2MX2A 2RDHA 2RGFA 3O65B 4AUQC 2KTRB 1N62A 3ZNID 1E10A 5IKCM 3KW5B 1D4BA 2I38A 2IO1B 2V4LA 2QC8A 1V1PB 1WGHA 3Q3MC 4C7YA 2G3QB 2JF5A 1V6EA 4W9IA 3UQAA 1RYJA 3AE1B 4MSMB 1UZXB 2OJRA 4IW0A 4RCOA 4BVUC 2CJNA 3ALBA 2B3AA 1QOBA 4KSLC 2X38A 1GPXA 3L08A 2GBJA 1ROEA 2QILA 4LNIA 1QF6A 1SIFA 1N61A 2D07B 2N9EB 5LNK1 1FXAA 3PLUA 3PV1A 4FHKA 3X23A 1C77A 1E7PB 3QCAA 3MC0B 2IZVB 1WIAA 1U4AA 1E7VA 2KDMA 4R3DA 4KKJA 3QX1A 3PHWB 1QILA 2RD0A 2JXXA 2ZVOA 3VUWA 2IGDA 3WAOA 4EUTA 2KACA 1FEHA 1HE8A 2H89B 2JY6A 3ZYYX 4IC7B 2K39A 2BS3B 3A33B 1XD3B 5JHBA 3V6EB 1YJ1A 3KUCB 4DK5A 2EMTA 1BXTA 3PRZA 3SD5A 4LJPB 1XF5L 4KIKA 3RNBC 1KRHA 3S2AA 2J0KA 2CHWA 4ARCA 4IM2A 2N7JA 1V8CA 5IN7A 2EKIA 3MJ5A 4JIOU 2C7MB 2BB5A 1FMAD 3BY4B 2JSVX 2WDVB 2GBMA 4WWOA 2RDBC 4JPSA 3VQIA 3RT3B 4ZRQA 3HM3A 4DHZB 5G5GA 1VZ7A 1S3SG 4N9F4 2KJHB 2WU2B 1YN3A 5DCNA 3ML8A 4ACFA 2ZW0A 1EWCA 5KHOA 1MI0A 4AJWA 1SJHD 2DYMA 2N1VA 2OEDA 4OVZA 1WX9A 1ZOYB 4ANXA 1ZGUB 4TQ0A 2Q5WD 3ZW3A 2WXOA 2V1YA 1N5XA 4IDIA 2KX0A 1UUPA 5DPSA 3DDCB 1V1OA 1XXGA 4HPLB 2Y5PA 2PJHA 3IVFA 1EUVB 2J0MA 3TCAA 3W1SA 4A9AA 3NVZA 3DBLI 4BKGA 4JGHB 1YD8U 1TS5A 1T0RC 2IO3B 1WRDB 3APCA 2BYVE 4HDOA 5FKAC 4OZCA 2KWDA 3NS8A 3OJ4B 3B1LX 5AUKA 4M0WB 4FJYA 1WJNA 3TL5A 1LM8B 2INPE 4KGTA 4ZRJA 4ZHPA 3ZDTA 2Z8LA 4JWUC 5E6PA 2L00B 2JT4B 3M95A 3ONSA 3WALA 2JQRB 4F7ZA 3SFEB 3SEBA 2BVCA 4NQKE 1F52A 2G4DB 2EELA 3RUIB 2PEAA 1XLQA
chains in the Genus database with same CATH topology
2BYFA 3A1QB 4G3XB 5E6OA 4DDGD 2LXCA 2MBEA 2JUOA 2MP2B 2M17A 2KTRA 2O2VA 4KSKC 2HD5B 3W1SC 5HKHA 2MBQA 4GU2A 4MM3A 2J0JA 1C3TA 2D10A 2K8HA 1K8RB 4GGQA 2KFKB 2NBUA 3M3JA 1WZ3A 2HTHA 3DCGA 3R66C 2GBNA 3APDA 2LVPA 2C5LC 1LQBA 2K6DB 4BOZB 1YX5B 3WAMA 3VAWA 4OVUA 5CTRC 1ZKHA 1R4NI 1WXAA 3KYCD 2KHWB 3TMPB 5CHFA 2PE6B 3A9KB 1UELA 3PRMB 4GOCA 3A9JB 4WJOA 2NBVB 3DBHI 5G2NA 2XBBC 1OEYA 1TBEA 4KDLB 3VXWA 2BWFA 3UIPB 3JSVB 3UF8A 1V5OA 3CMMB 3JSVA 3ZRCA 2KLGA 3HHMA 4FJVB 2R2QA 3WAPA 3ZTDA 2IO2B 3LDZE 4HWIB 2DENB 3KVFB 2HE7A 4IWQA 4BKTA 3PTFC 2NVUI 2XK5A 1X1MA 4NAWB 1J8CA 1H4RA 1WXVA 4XX5A 2KC1A 3B08A 3KUDB 4GDKA 4JL9A 1RRBA 4W9FA 3OAWA 2YVCA 2MBBB 4RMAA 3PSEB 3MTNB 4X57B 3RULA 4E3CA 2JRIB 4A3OA 2FCNA 5G55A 3H6NA 3Q3FA 3RZFA 2ZEQA 4II3B 4MSQB 3U30A 4PS3A 2NCNA 1WX7A 4EZLA 3SU8X 1L2NA 2HJ8A 2MBHA 1UBIA 2LUEA 5JH5C 4F8CB 4DHJB 4A3PA 4WJNA 1C1YB 3ZNHB 4NNJB 5LLIA 3DVGX 2ZCCA 4W9JA 1WGRA 4KZCA 1EO6A 2KZRA 3VUYA 1WZ0A 3ML9A 3EHVA 2DHZA 2JZZA 3VFKA 4WQOB 1VD2A 1WE6A 4W9DA 4NY0A 4ANWA 3SDLC 3ZRFA 3T8MA 2N9PC 1E8WA 4ZRIA 2CHZA 2LVQA 4CO7A 4EKUA 2Z0EB 2MCNB 5J17A 1NI2A 4B6WA 3B0AA 2L8JA 2KTFA 2RR9A 4RM8A 3R7QA 4OVVA 2K25A 3VDZA 4FADA 5D2MB 3BINA 2D2QA 5AZFA 3VH3B 2DZJA 4IM0A 5DPWA 1A5RA 2KDEB 1WR1A 4FN2A 4EZJA 3H9DA 4AP4C 3H1UA 3PPAA 2CKHB 3ZTCA 3QIJA 3M62B 3ZO5B 1V5TA 1YIWA 1SGHA 3NZSA 2GMIC 4G11A 4G50A 4W9GA 2ASQA 1GNUA 1EF5A 1AARA 4F1SA 4NJ7A 2LWPA 2O6VA 4WAAA 3N3KB 4FLHA 2MA9B 1GJZA 2DAFA 2DZMA 3L16A 1OQYA 2AWTA 4NPNA 3NHEB 1L7YA 1LXDA 2BPSA 2NR2A 1WGDA 4RM9A 3VUXA 2BYEA 3UQBA 3SHQA 3ENEA 2LASA 4DBGA 2DX5B 3Q3JA 2AL3A 1XQQA 4MGYE 1V86A 3A4SC 1BT0A 1T0YA 4GSWA 3PS6A 2KJRA 1PQSA 4W9EA 4EEWA 2GBKA 3U8ZA 4PYZA 4HJKA 4HVBA 2EMSA 2REXA 5IA7A 4IWPA 2KVRA 2C7HA 4FULA 4GXBA 3IBEA 3L17A 2RSUA 2WX1A 2D11A 5D94A 4GDLB 4CHKA 4ZDVA 2I1KA 2KDFB 4ICUA 2CHXA 1OGWA 1KJTA 4A20A 2KWVB 2L05A 1WX8A 3AULA 1UH6A 2L0TA 1WJ4A 1WR6E 2PPHA 4GDKB 4FA6A 3QA8A 1E90A 4GIVA 2DYBA 2MLBA 4ZYNA 3QC8B 1NDDA 3MHSD 3GZNI 1YX6B 3ZNZB 1Q1OA 2WWZA 5CHVC 1IP9A 5D7GA 2KWCA 3V61A 2ZPYA 3K9PB 5JHAA 4BBNF 3IHPC 3ZLZA 1TTNA 1RFAA 3CF6E 1WJ6A 2KKCA 3WANA 4K7WA 5BO4B 4TQ1A 2MW5A 2NBWB 4B95A 2KFKA 3RYTA 4EZKA 3L10B 4HCPB 4HK2A 1Z5SB 4NAWA 1P3QU 5C1ZA 3R7RA 4ANUA 3PREA 2KXJA 2IY1B 4BBNC 2LRUA 4PYUA 2FIFA 2A5UA 4KZ0A 4K7SA 3AXCA 3V62A 2M8SA 4I6PA 2IYDB 5E6NA 2FNJB 2L3ZA 2OOBB 2IY0B 2KWUB 2XEWA 3QJZA 2N9XA 2KJ6A 3EFUA 2MBOA 3H7PB 5DPRA 3A9JA 2MX2A 2L7RA 4CYEA 1EF1A 3PLVA 4LCDE 2LRWA 4TUUA 2RGFA 3M63B 3O65B 4I6LB 4AOFA 4AUQC 2QHOA 2NS5A 5J2RA 2KTRB 2O2VB 1G6JA 3OLMD 2LZ6A 4MH0E 3ZNID 2CU1A 2GBRA 3KW5B 4IUMB 3WIMA 1KOTA 4GN1A 3V60A 3VHTC 2L0FA 2IO1B 4W9LA 2V4LA 5L83A 2LGDA 1E5WA 1Y8RC 4B9KA 1WMHB 2KC2A 1WGHA 2KLCA 2Z0DB 1WMHA 3DVNU 3NZUA 1WM2A 3JYUA 2G3QB 2JF5A 1P0RA 1V6EA 2JRHA 4W9IA 3UQAA 4AWJA 3KH0A 3EECA 4MSMB 1UZXB 4XZ4A 5AZHA 3TJPA 4HDQA 3TIXA 2OJRA 1V80A 4IW0A 4ANVA 4HLEA 2I1JA 2N4FA 1OEYJ 4BVUC 2FCSA 2G45B 3IFWB 3JVZX 1SE9A 2KOXA 4W9KA 4BFRA 1D3ZA 1WF9A 3ALBA 2AYOB 2VRRB 5GMVA 2B3AA 4IWOA 1R4MI 1UGMA 3ZIMA 1VCBA 4GMVA 5L95C 3RCZA 4KSLC 2A4ZA 1WFYA 2WYQA 1WM3A 3L08A 4FJZA 2GBJA 1WI0A 4I6NB 4KDIC 2GOWA 1SIFA 1QZEA 1E8XA 3HM6X 4FBJB 3HIZA 3KUZA 5FR6A 1RLFA 1P9DU 2BGFA 2D07B 3W1YA 3ZKJC 3ZUNA 3T9LA 2DAJA 4TKNA 2ZNVB 2KQSA 2N9EB 1F9JA 4MGKE 4GDLA 3UINB 4E74A 2KFJA 2K6QA 1H8CA 1Q0WB 1J0GA 3PHXB 2C7NB 3PLUA 3PV1A 4FHKA 2BF8B 3X23A 2LXAA 2MSED 1Q5WB 2KMCA 3QCAA 3L13A 1E8YA 4LJOB 1WXSA 2IZVB 1WH3A 1WIAA 1U4AA 2WDTB 4G0NB 3ZNGC 2IO0B 2KO3A 3A1QA 2FIDA 1E7VA 3DQVA 2FCQA 4K81A 1WXMA 2RPQA 2K8BA 3QX1A 3PHWB 3N32A 2EKEC 2RD0A 2AEHA 2JXXA 2N7DA 2LI5A 2ZVOA 4MGIE 3C0RB 3VUWA 2K1FA 2KK8A 3ECIA 4MELA 3EC8A 1XT9B 2KNBA 1CMXB 4LDTB 4HPMB 2Z59B 3GOEA 3VTUA 3R3MA 3WAOA 3QARA 4EUTA 1HE8A 2JY6A 3LJ3A 4HXDA 2BKFA 4IC7B 3PVLA 3AU5A 2K39A 3A4RA 3DVGY 3A33B 3QHTA 1XD3B 1GC7A 2G4SA 3APFA 3TBLD 4JQWC 4DHJD 2LVOA 4WWNA 4JLCA 1YJ1A 3V6EB 5JHBA 2JVCA 2KX3A 2FUHB 3KUCB 2CS4A 2UYZB 4DK5A 2LGXA 4K7UA 2EMTA 3NY5A 4DHZE 1LFDA 3PRZA 4WJQA 3WA0A 3SD5A 1ISNA 4LJPB 4LDTD 1KLVA 4KIKA 2KQ7A 2ZCBA 1V81A 4TV3A 3RZWC 3S2AA 2J0KA 2N7EA 2CHWA 2M4NA 4E71A 4PS7A 4ASWC 2KDBA 2L76A 3OJ3A 4IM2A 2M0XA 1TZ1A 1GG3A 3DPDA 4NJ6A 1ZW7A 2C7MB 4JIOU 3D32A 4ICVA 3BY4B 4P7IA 5EDSA 3ZDMC 3PT2B 2FAZA 4M8NA 2KMAA 3QWZB 2DYOA 2GBMA 4WWOA 2ZJDA 2WX0A 2J7QB 3VQIA 3RT3B 2BKRB 3HM3A 1V9JA 3UGBB 4DHZB 2O6VD 2N1WA 2ZPNA 4XC2A 5JZEB 1S3SG 4N9F4 2KJHB 1GUAB 3ZVVA 4W9CA 5AEKB 2IBIB 5DCNA 3IG3A 1WGGA 2JWZA 3ML8A 2D3GA 1E8ZA 2LJ5A 3DOWA 5KHOA 1IPGA 4KVGB 1KM7A 2YLMA 2W9NA 4IG7B 4IM3A 2ZVNA 4AJWA 3QQ8B 3VTWA 4BKSD 2DYMA 2N1VA 3VTVA 1WX9A 3UIOB 4ANXA 1WY8A 1ZGUB 2FCMA 4FHJA 4TQ0A 2UWQA 3ZW3A 3PZDA 2V1YA 3H7PA 3PGEA 3K9OB 3P2BA 2KX0A 4MJSA 4EFOA 5DPSA 3DDCB 2JZ3B 4WWPA 3H7SA 3RD2A 4K1RB 5C23A 3I3TB 1M94A 4J6IA 1IYFA 1J19A 4KIKB 4HPLB 2C60A 1E7UA 3KYDD 2PJHA 3IVFA 1EUVB 5D6JB 3AI5A 2J0MA 3TCAA 3U7DA 2CR5A 3AU4A 1WGYA 4W9HA 4URKA 2BWES 3W1SA 2MRPA 2NPTA 1MG8A 2NPTB 4WJPA 4KV2A 3HK0A 5DPTA 2XK5B 3L0WB 2KN5A 1GC6A 3DBLI 1WE7A 1TGZB 2LD9A 3MJWA 4JGHB 4BKGA 5KHQA 3QAQA 5LXIB 1YD8U 2MQJA 5LXHA 5IAAC 1P1AA 5J18A 2KDIA 4EOYA 2IO3B 3PRPB 1WRDB 3QK0A 5AZGA 3APCA 2DZKA 2O6VB 1JRUA 2BYVE 4MJSB 2KANA 2Y5BB 3CSFA 1FXTB 4HDOA 1UD7A 2V3SA 4DWFA 4DXAB 2MWSB 3A9KA 3NS8A 3OJ4B 4M8MA 1V49A 3B1LX 2JPHA 1S1QB 4M0WB 3VH4B 4BOSC 4FJYA 3VVWB 1WJNA 3TL5A 1LM8B 2C9WB 2KD0A 2ZNVC 2LGYA 3N30A 4ZRJA 1YQBA 3ZDTA 3DBRI 3JW0X 4BKSA 2MP2A 2R2OA 5CX3A 1WYWB 3DBSA 1P98A 5CHWA 5E6PA 4II2B 1RAXA 2L00B 3L54A 4AJYB 3X0WA 2JT4B 3M95A 4GB9A 3CSTA 2M1MA 2AL6A 3ONSA 3V6CB 2ZZPB 3WALA 1OTRB 2K8CA 3NOBA 4MEMA 4DDID 4NQLB 4HCNB 4F7ZA 1I35A 5TR5A 2DZIA 1Z2MA 4NQKE 4ZRKA 1I42A 3DVNV 2G4DB 4PS8A 4MGZE 4MDKE 4YL8A 3RUIB 1NBFC 2PEAA 2PE9A 1UBQA 1V2YA 1WJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYF A;  3A1Q B;  4G3X B;  5E6O A;  4DDG D;  2LXC A;  2MBE A;  2JUO A;  2MP2 B;  2M17 A;  2KTR A;  2O2V A;  4KSK C;  2HD5 B;  3W1S C;  5HKH A;  2MBQ A;  4GU2 A;  4MM3 A;  2J0J A;  1C3T A;  2D10 A;  2K8H A;  1K8R B;  4GGQ A;  2KFK B;  2NBU A;  3M3J A;  1WZ3 A;  2HTH A;  3DCG A;  3R66 C;  2GBN A;  3APD A;  2LVP A;  2C5L C;  1LQB A;  2K6D B;  4BOZ B;  1YX5 B;  3WAM A;  3VAW A;  4OVU A;  5CTR C;  1ZKH A;  1R4N I;  1WXA A;  3KYC D;  2KHW B;  3TMP B;  5CHF A;  2PE6 B;  3A9K B;  1UEL A;  3PRM B;  4GOC A;  3A9J B;  4WJO A;  2NBV B;  3DBH I;  5G2N A;  2XBB C;  1OEY A;  1TBE A;  4KDL B;  3VXW A;  2BWF A;  3UIP B;  3JSV B;  3UF8 A;  1V5O A;  3CMM B;  3JSV A;  3ZRC A;  2KLG A;  3HHM A;  4FJV B;  2R2Q A;  3WAP A;  3ZTD A;  2IO2 B;  3LDZ E;  4HWI B;  2DEN B;  3KVF B;  2HE7 A;  4IWQ A;  4BKT A;  3PTF C;  2NVU I;  2XK5 A;  1X1M A;  4NAW B;  1J8C A;  1H4R A;  1WXV A;  4XX5 A;  2KC1 A;  3B08 A;  3KUD B;  4GDK A;  4JL9 A;  1RRB A;  4W9F A;  3OAW A;  2YVC A;  2MBB B;  4RMA A;  3PSE B;  3MTN B;  4X57 B;  3RUL A;  4E3C A;  2JRI B;  4A3O A;  2FCN A;  5G55 A;  3H6N A;  3Q3F A;  3RZF A;  2ZEQ A;  4II3 B;  4MSQ B;  3U30 A;  4PS3 A;  2NCN A;  1WX7 A;  4EZL A;  3SU8 X;  1L2N A;  2HJ8 A;  2MBH A;  1UBI A;  2LUE A;  5JH5 C;  4F8C B;  4DHJ B;  4A3P A;  4WJN A;  1C1Y B;  3ZNH B;  4NNJ B;  5LLI A;  3DVG X;  2ZCC A;  4W9J A;  1WGR A;  4KZC A;  1EO6 A;  2KZR A;  3VUY A;  1WZ0 A;  3ML9 A;  3EHV A;  2DHZ A;  2JZZ A;  3VFK A;  4WQO B;  1VD2 A;  1WE6 A;  4W9D A;  4NY0 A;  4ANW A;  3SDL C;  3ZRF A;  3T8M A;  2N9P C;  1E8W A;  4ZRI A;  2CHZ A;  2LVQ A;  4CO7 A;  4EKU A;  2Z0E B;  2MCN B;  5J17 A;  1NI2 A;  4B6W A;  3B0A A;  2L8J A;  2KTF A;  2RR9 A;  4RM8 A;  3R7Q A;  4OVV A;  2K25 A;  3VDZ A;  4FAD A;  5D2M B;  3BIN A;  2D2Q A;  5AZF A;  3VH3 B;  2DZJ A;  4IM0 A;  5DPW A;  1A5R A;  2KDE B;  1WR1 A;  4FN2 A;  4EZJ A;  3H9D A;  4AP4 C;  3H1U A;  3PPA A;  2CKH B;  3ZTC A;  3QIJ A;  3M62 B;  3ZO5 B;  1V5T A;  1YIW A;  1SGH A;  3NZS A;  2GMI C;  4G11 A;  4G50 A;  4W9G A;  2ASQ A;  1GNU A;  1EF5 A;  1AAR A;  4F1S A;  4NJ7 A;  2LWP A;  2O6V A;  4WAA A;  3N3K B;  4FLH A;  2MA9 B;  1GJZ A;  2DAF A;  2DZM A;  3L16 A;  1OQY A;  2AWT A;  4NPN A;  3NHE B;  1L7Y A;  1LXD A;  2BPS A;  2NR2 A;  1WGD A;  4RM9 A;  3VUX A;  2BYE A;  3UQB A;  3SHQ A;  3ENE A;  2LAS A;  4DBG A;  2DX5 B;  3Q3J A;  2AL3 A;  1XQQ A;  4MGY E;  1V86 A;  3A4S C;  1BT0 A;  1T0Y A;  4GSW A;  3PS6 A;  2KJR A;  1PQS A;  4W9E A;  4EEW A;  2GBK A;  3U8Z A;  4PYZ A;  4HJK A;  4HVB A;  2EMS A;  2REX A;  5IA7 A;  4IWP A;  2KVR A;  2C7H A;  4FUL A;  4GXB A;  3IBE A;  3L17 A;  2RSU A;  2WX1 A;  2D11 A;  5D94 A;  4GDL B;  4CHK A;  4ZDV A;  2I1K A;  2KDF B;  4ICU A;  2CHX A;  1OGW A;  1KJT A;  4A20 A;  2KWV B;  2L05 A;  1WX8 A;  3AUL A;  1UH6 A;  2L0T A;  1WJ4 A;  1WR6 E;  2PPH A;  4GDK B;  4FA6 A;  3QA8 A;  1E90 A;  4GIV A;  2DYB A;  2MLB A;  4ZYN A;  3QC8 B;  1NDD A;  3MHS D;  3GZN I;  1YX6 B;  3ZNZ B;  1Q1O A;  2WWZ A;  5CHV C;  1IP9 A;  5D7G A;  2KWC A;  3V61 A;  2ZPY A;  3K9P B;  5JHA A;  4BBN F;  3IHP C;  3ZLZ A;  1TTN A;  1RFA A;  3CF6 E;  1WJ6 A;  2KKC A;  3WAN A;  4K7W A;  5BO4 B;  4TQ1 A;  2MW5 A;  2NBW B;  4B95 A;  2KFK A;  3RYT A;  4EZK A;  3L10 B;  4HCP B;  4HK2 A;  1Z5S B;  4NAW A;  1P3Q U;  5C1Z A;  3R7R A;  4ANU A;  3PRE A;  2KXJ A;  2IY1 B;  4BBN C;  2LRU A;  4PYU A;  2FIF A;  2A5U A;  4KZ0 A;  4K7S A;  3AXC A;  3V62 A;  2M8S A;  4I6P A;  2IYD B;  5E6N A;  2FNJ B;  2L3Z A;  2OOB B;  2IY0 B;  2KWU B;  2XEW A;  3QJZ A;  2N9X A;  2KJ6 A;  3EFU A;  2MBO A;  3H7P B;  5DPR A;  3A9J A;  2MX2 A;  2L7R A;  4CYE A;  1EF1 A;  3PLV A;  4LCD E;  2LRW A;  4TUU A;  2RGF A;  3M63 B;  3O65 B;  4I6L B;  4AOF A;  4AUQ C;  2QHO A;  2NS5 A;  5J2R A;  2KTR B;  2O2V B;  1G6J A;  3OLM D;  2LZ6 A;  4MH0 E;  3ZNI D;  2CU1 A;  2GBR A;  3KW5 B;  4IUM B;  3WIM A;  1KOT A;  4GN1 A;  3V60 A;  3VHT C;  2L0F A;  2IO1 B;  4W9L A;  2V4L A;  5L83 A;  2LGD A;  1E5W A;  1Y8R C;  4B9K A;  1WMH B;  2KC2 A;  1WGH A;  2KLC A;  2Z0D B;  1WMH A;  3DVN U;  3NZU A;  1WM2 A;  3JYU A;  2G3Q B;  2JF5 A;  1P0R A;  1V6E A;  2JRH A;  4W9I A;  3UQA A;  4AWJ A;  3KH0 A;  3EEC A;  4MSM B;  1UZX B;  4XZ4 A;  5AZH A;  3TJP A;  4HDQ A;  3TIX A;  2OJR A;  1V80 A;  4IW0 A;  4ANV A;  4HLE A;  2I1J A;  2N4F A;  1OEY J;  4BVU C;  2FCS A;  2G45 B;  3IFW B;  3JVZ X;  1SE9 A;  2KOX A;  4W9K A;  4BFR A;  1D3Z A;  1WF9 A;  3ALB A;  2AYO B;  2VRR B;  5GMV A;  2B3A A;  4IWO A;  1R4M I;  1UGM A;  3ZIM A;  1VCB A;  4GMV A;  5L95 C;  3RCZ A;  4KSL C;  2A4Z A;  1WFY A;  2WYQ A;  1WM3 A;  3L08 A;  4FJZ A;  2GBJ A;  1WI0 A;  4I6N B;  4KDI C;  2GOW A;  1SIF A;  1QZE A;  1E8X A;  3HM6 X;  4FBJ B;  3HIZ A;  3KUZ A;  5FR6 A;  1RLF A;  1P9D U;  2BGF A;  2D07 B;  3W1Y A;  3ZKJ C;  3ZUN A;  3T9L A;  2DAJ A;  4TKN A;  2ZNV B;  2KQS A;  2N9E B;  1F9J A;  4MGK E;  4GDL A;  3UIN B;  4E74 A;  2KFJ A;  2K6Q A;  1H8C A;  1Q0W B;  1J0G A;  3PHX B;  2C7N B;  3PLU A;  3PV1 A;  4FHK A;  2BF8 B;  3X23 A;  2LXA A;  2MSE D;  1Q5W B;  2KMC A;  3QCA A;  3L13 A;  1E8Y A;  4LJO B;  1WXS A;  2IZV B;  1WH3 A;  1WIA A;  1U4A A;  2WDT B;  4G0N B;  3ZNG C;  2IO0 B;  2KO3 A;  3A1Q A;  2FID A;  1E7V A;  3DQV A;  2FCQ A;  4K81 A;  1WXM A;  2RPQ A;  2K8B A;  3QX1 A;  3PHW B;  3N32 A;  2EKE C;  2RD0 A;  2AEH A;  2JXX A;  2N7D A;  2LI5 A;  2ZVO A;  4MGI E;  3C0R B;  3VUW A;  2K1F A;  2KK8 A;  3ECI A;  4MEL A;  3EC8 A;  1XT9 B;  2KNB A;  1CMX B;  4LDT B;  4HPM B;  2Z59 B;  3GOE A;  3VTU A;  3R3M A;  3WAO A;  3QAR A;  4EUT A;  1HE8 A;  2JY6 A;  3LJ3 A;  4HXD A;  2BKF A;  4IC7 B;  3PVL A;  3AU5 A;  2K39 A;  3A4R A;  3DVG Y;  3A33 B;  3QHT A;  1XD3 B;  1GC7 A;  2G4S A;  3APF A;  3TBL D;  4JQW C;  4DHJ D;  2LVO A;  4WWN A;  4JLC A;  1YJ1 A;  3V6E B;  5JHB A;  2JVC A;  2KX3 A;  2FUH B;  3KUC B;  2CS4 A;  2UYZ B;  4DK5 A;  2LGX A;  4K7U A;  2EMT A;  3NY5 A;  4DHZ E;  1LFD A;  3PRZ A;  4WJQ A;  3WA0 A;  3SD5 A;  1ISN A;  4LJP B;  4LDT D;  1KLV A;  4KIK A;  2KQ7 A;  2ZCB A;  1V81 A;  4TV3 A;  3RZW C;  3S2A A;  2J0K A;  2N7E A;  2CHW A;  2M4N A;  4E71 A;  4PS7 A;  4ASW C;  2KDB A;  2L76 A;  3OJ3 A;  4IM2 A;  2M0X A;  1TZ1 A;  1GG3 A;  3DPD A;  4NJ6 A;  1ZW7 A;  2C7M B;  4JIO U;  3D32 A;  4ICV A;  3BY4 B;  4P7I A;  5EDS A;  3ZDM C;  3PT2 B;  2FAZ A;  4M8N A;  2KMA A;  3QWZ B;  2DYO A;  2GBM A;  4WWO A;  2ZJD A;  2WX0 A;  2J7Q B;  3VQI A;  3RT3 B;  2BKR B;  3HM3 A;  1V9J A;  3UGB B;  4DHZ B;  2O6V D;  2N1W A;  2ZPN A;  4XC2 A;  5JZE B;  1S3S G;  4N9F 4;  2KJH B;  1GUA B;  3ZVV A;  4W9C A;  5AEK B;  2IBI B;  5DCN A;  3IG3 A;  1WGG A;  2JWZ A;  3ML8 A;  2D3G A;  1E8Z A;  2LJ5 A;  3DOW A;  5KHO A;  1IPG A;  4KVG B;  1KM7 A;  2YLM A;  2W9N A;  4IG7 B;  4IM3 A;  2ZVN A;  4AJW A;  3QQ8 B;  3VTW A;  4BKS D;  2DYM A;  2N1V A;  3VTV A;  1WX9 A;  3UIO B;  4ANX A;  1WY8 A;  1ZGU B;  2FCM A;  4FHJ A;  4TQ0 A;  2UWQ A;  3ZW3 A;  3PZD A;  2V1Y A;  3H7P A;  3PGE A;  3K9O B;  3P2B A;  2KX0 A;  4MJS A;  4EFO A;  5DPS A;  3DDC B;  2JZ3 B;  4WWP A;  3H7S A;  3RD2 A;  4K1R B;  5C23 A;  3I3T B;  1M94 A;  4J6I A;  1IYF A;  1J19 A;  4KIK B;  4HPL B;  2C60 A;  1E7U A;  3KYD D;  2PJH A;  3IVF A;  1EUV B;  5D6J B;  3AI5 A;  2J0M A;  3TCA A;  3U7D A;  2CR5 A;  3AU4 A;  1WGY A;  4W9H A;  4URK A;  2BWE S;  3W1S A;  2MRP A;  2NPT A;  1MG8 A;  2NPT B;  4WJP A;  4KV2 A;  3HK0 A;  5DPT A;  2XK5 B;  3L0W B;  2KN5 A;  1GC6 A;  3DBL I;  1WE7 A;  1TGZ B;  2LD9 A;  3MJW A;  4JGH B;  4BKG A;  5KHQ A;  3QAQ A;  5LXI B;  1YD8 U;  2MQJ A;  5LXH A;  5IAA C;  1P1A A;  5J18 A;  2KDI A;  4EOY A;  2IO3 B;  3PRP B;  1WRD B;  3QK0 A;  5AZG A;  3APC A;  2DZK A;  2O6V B;  1JRU A;  2BYV E;  4MJS B;  2KAN A;  2Y5B B;  3CSF A;  1FXT B;  4HDO A;  1UD7 A;  2V3S A;  4DWF A;  4DXA B;  2MWS B;  3A9K A;  3NS8 A;  3OJ4 B;  4M8M A;  1V49 A;  3B1L X;  2JPH A;  1S1Q B;  4M0W B;  3VH4 B;  4BOS C;  4FJY A;  3VVW B;  1WJN A;  3TL5 A;  1LM8 B;  2C9W B;  2KD0 A;  2ZNV C;  2LGY A;  3N30 A;  4ZRJ A;  1YQB A;  3ZDT A;  3DBR I;  3JW0 X;  4BKS A;  2MP2 A;  2R2O A;  5CX3 A;  1WYW B;  3DBS A;  1P98 A;  5CHW A;  5E6P A;  4II2 B;  1RAX A;  2L00 B;  3L54 A;  4AJY B;  3X0W A;  2JT4 B;  3M95 A;  4GB9 A;  3CST A;  2M1M A;  2AL6 A;  3ONS A;  3V6C B;  2ZZP B;  3WAL A;  1OTR B;  2K8C A;  3NOB A;  4MEM A;  4DDI D;  4NQL B;  4HCN B;  4F7Z A;  1I35 A;  5TR5 A;  2DZI A;  1Z2M A;  4NQK E;  4ZRK A;  1I42 A;  3DVN V;  2G4D B;  4PS8 A;  4MGZ E;  4MDK E;  4YL8 A;  3RUI B;  1NBF C;  2PEA A;  2PE9 A;  1UBQ A;  1V2Y A;  1WJU A; 
#chains in the Genus database with same CATH topology
 3MC8 A;  1EWY C;  3Q8B A;  2WXL A;  3W1S C;  2MBQ A;  4MM3 B;  2D10 A;  4GGQ A;  2KFK B;  2NBU A;  2HTH A;  1N60 A;  3WAM A;  4OVU A;  5CTR C;  3TMP B;  1I4H A;  3PRM B;  1CJE A;  4KDL B;  4RNA A;  2BWF A;  1V5O A;  4FJV B;  1SF0 A;  3LDZ E;  1FNU A;  4PT5 A;  2XK5 A;  4NAW B;  1L0X B;  3Q3N C;  1H4R A;  3LB8 C;  2N9K A;  4W9F A;  2BTE A;  3OAW A;  5IP4 D;  1IUE A;  5G5H A;  4A3O A;  2FCN A;  3H6N A;  4K3C A;  4II3 B;  4MSQ B;  4PS3 A;  3SU8 X;  1L2N A;  2HJ8 A;  2MBH A;  5HG2 A;  4C4V A;  4DHJ B;  4WJN A;  1JWU D;  1ET9 A;  3DVG X;  1E6E B;  1D5X C;  3VUY A;  1WZ0 A;  2DHZ A;  2JZZ A;  4NY0 A;  3ZRF A;  1SB3 C;  2N9P C;  1E8W A;  3BYY B;  2LVQ A;  2PMV A;  3AE8 B;  5HHD G;  2L8J A;  3I9V 1;  1UGJ A;  4H2A A;  5D2M B;  3PO0 A;  3VH3 B;  1WR1 A;  3Q8E A;  4AP4 C;  3H1U A;  1RWS A;  1SSN A;  1V5T A;  1YIW A;  3KWV A;  4W9G A;  1GNU A;  2ACZ B;  1AAR A;  3PZ8 A;  3NG0 A;  4NJ7 A;  4F1S A;  2ONQ A;  1OQY A;  3NHE B;  2BPS A;  1E0Z A;  1WGD A;  2PVO D;  1YMH E;  1MFW A;  4EE2 A;  3Q3J A;  4MGY E;  4US8 A;  1BUI C;  5TSS A;  2EMS A;  5EE3 A;  1JAL A;  4FUL A;  3HVD A;  2JWU A;  2D11 A;  4A20 A;  1WJ4 A;  4RGN A;  2LEK A;  1HTO A;  3AE2 B;  3NS1 A;  1FXI A;  1QQR A;  2WWZ A;  1GAQ B;  5CHV C;  1HEZ E;  4BBN F;  3DWM A;  3AED B;  1FIQ A;  2WLB A;  2ICI A;  2KKC A;  1F2R C;  2MW5 A;  4B95 A;  3U52 E;  3WCQ A;  3W9C B;  3L10 B;  2WXI A;  4HK2 A;  1Z5S B;  3VRB B;  1P3Q U;  5C1Z A;  2KXJ A;  2JZP A;  4KZ0 A;  4K7S A;  3IT4 B;  4B0E A;  2IYD B;  2OOB B;  3AMZ A;  2KWU B;  2XEW A;  1L6V A;  4NAM A;  5DPR A;  4L2Y A;  1XO3 A;  2BYT A;  2W82 A;  4C7Z A;  5J2R A;  1L0V B;  1G6J A;  3OLM D;  2LZ6 A;  4IOI E;  4IUM B;  1KOT A;  4GN1 A;  2OJW A;  3V60 A;  2L0F A;  4W9L A;  4KX6 B;  5L83 A;  1JRP A;  2KC2 A;  4A6Q A;  1WMH A;  5HI1 A;  4AWJ A;  2K5P A;  4HDQ A;  1V80 A;  1ZPS A;  4HLE A;  2I1J A;  1YQ4 B;  1OEY J;  3JVZ X;  1GOZ A;  1SE9 A;  2KOX A;  1JWS D;  4L23 A;  2AYO B;  2VRR B;  5GMV A;  1R4M I;  4ITK A;  4GMV A;  4YSY B;  2A4Z A;  3GP7 A;  2WS3 B;  1TT5 B;  4I6N B;  2WXQ A;  3AEF B;  3N9Y C;  3HIZ A;  2D3B A;  1AYF A;  3KUZ A;  1RLF A;  1P9D U;  2BGF A;  4ZYS A;  2W3R A;  3T9L A;  4TKN A;  3ZUN A;  3FIL B;  3N1X C;  1F9J A;  2KFJ A;  1Q10 A;  4WH4 A;  2C7N B;  2BF8 B;  2MSE D;  2INN E;  4A8X C;  2KMC A;  1WXS A;  4G0N B;  2IO0 B;  1WWT A;  2KO3 A;  3DHG C;  2FID A;  2QJL A;  2D3A A;  4PK1 A;  1F1H A;  4K81 A;  3DHI C;  2RPQ A;  2K8B A;  3HVZ A;  2LI5 A;  3AH7 A;  2KK8 A;  4MEL A;  1XT9 B;  2KNB A;  4LDT B;  2Z59 B;  3GOE A;  3VTU A;  2G9H D;  1R7S A;  3ETR A;  1HA5 A;  1OFF A;  2PLP A;  3ZGZ A;  5LXH A;  3APF A;  1GC7 A;  2G4S A;  2FUH B;  1IGC A;  3GZN B;  2LGX A;  3NY5 A;  3WA0 A;  3IT6 B;  3RNC C;  1KLV A;  2KQ7 A;  2WXP A;  3V05 A;  2M4N A;  4PS7 A;  2K3U A;  1IGD A;  2FUG 1;  1VZ6 A;  1GG3 A;  3D32 A;  3AEB B;  3VRA B;  4HRS A;  3ZDM C;  4M8N A;  2KMA A;  5EE9 A;  2ZJD A;  2DBY A;  4DQO C;  3U4E G;  3AB5 A;  2BKR B;  1V9J A;  2O6V D;  2WQY B;  4RGO S;  2N1W A;  2J4X A;  4YTP B;  1GUA B;  1WSP A;  3ZVV A;  3P1M A;  1E8Z A;  1TKE A;  3AEE B;  1KM7 A;  1UWX A;  2W9N A;  2IGG A;  4IM3 A;  3MP9 A;  4YTM B;  3BVZ A;  1KTK A;  5EE1 A;  1JCK B;  2UWQ A;  3PZD A;  1I4Q A;  3H7P A;  3PGE A;  4MJS A;  2K0P A;  4EFO A;  1C4C A;  4RF1 A;  1NYQ A;  2JYT A;  3RNA C;  4BZA A;  4J3O D;  3H7S A;  4WWP A;  2G1E A;  1M94 A;  1N6Z A;  1IYF A;  1FCC C;  1J19 A;  4KIK B;  3KYD D;  5D6J B;  4O1N A;  3AU4 A;  1XLO A;  4URK A;  2BWE S;  2MRP A;  2NPT A;  4WIP A;  3L0W B;  1SE2 A;  1TGZ B;  1WE7 A;  5KHQ A;  2JU6 X;  3QAQ A;  2KAJ A;  1T6B X;  3DBR B;  2V0G A;  5AZG A;  1JRU A;  1M4V A;  2D3C A;  1FXT B;  1ZDX A;  1C4P A;  3T3O A;  1UD7 A;  4DWF A;  3A9K A;  4M8M A;  1V49 A;  3KLS X;  1S1Q B;  4NJC A;  4BOS C;  2GI9 A;  2LGI A;  3EGR A;  1VZ8 A;  2K9X A;  2KD0 A;  2ZNV C;  1YQB A;  3DBR I;  3Q3O C;  1WYW B;  4AJY B;  3P4Q B;  4II2 B;  3X0W A;  2INC C;  2AX5 A;  4LLG M;  2MHJ A;  2K8C A;  4DDI D;  3N20 C;  4NQL B;  1I35 A;  4KGR A;  3NVW A;  5TR5 A;  4S0R A;  3OG5 A;  4PS8 A;  4MGZ E;  4MDK E;  4YL8 A;  3RMK C;  3TEX A;  2V9H A;  1UBQ A;  2BYF A;  1HTQ A;  3A1Q B;  1JRO A;  5E6O A;  1UNS A;  2YEP B;  1EU4 A;  2LXC A;  1L4Z B;  2M17 A;  1ET6 A;  2KTR A;  1PDX A;  5BMI A;  2HD5 B;  3RNG C;  4GU2 A;  1C3T A;  2K8H A;  1SE4 A;  3TEW A;  2M56 B;  2LVP A;  1JWM D;  1YX5 B;  1XLN A;  2R61 A;  3KYC D;  2Y3A A;  5CHF A;  3A9J B;  4WJO A;  2RPV A;  3FKY A;  3VXW A;  1FD6 A;  1T5X D;  3AV8 A;  3JSV A;  3HHM A;  2R2Q A;  4RGT A;  3ZTD A;  3AN1 A;  4IWQ A;  5FR3 A;  1X1M A;  4XE0 A;  1WXV A;  3RNE C;  3KUD B;  4GDK A;  2YVC A;  3BZD B;  4AQ7 A;  3PSE B;  2L52 A;  2LGS A;  2JRI B;  2NTS A;  1SEB D;  2ZEQ A;  2KT7 A;  3U30 A;  2NCN A;  4FXC A;  2LJI A;  2MJD A;  5JH5 C;  1P7E A;  4NNJ B;  2DWQ A;  5LLI A;  3ZXR A;  2CJO A;  1IBX A;  1WXQ A;  2LHE A;  5HFY A;  1R4N B;  2CHZ A;  2HDE A;  3B0A A;  2RR9 A;  5GXG B;  4RM8 A;  3VDZ A;  4OZA A;  1L4D B;  3NZ3 A;  2D2Q A;  5AZF A;  5EE0 A;  3BYT B;  1A5R A;  3Q6B A;  4EZJ A;  4XWW A;  2CKH B;  3QIJ A;  2MEK A;  4G11 A;  2ASQ A;  2O6V A;  1R4M B;  4FLH A;  2MJ3 A;  4D2K A;  1TKG A;  2WDQ B;  3L16 A;  2AWT A;  3IAS 1;  4TSS A;  1LXD A;  2PTL A;  2BYE A;  1MHX A;  3SHQ A;  1T0Q C;  3B2F A;  4A90 A;  1D5Z C;  1XQQ A;  1I4P A;  2BW2 A;  1BT0 A;  1ACC A;  3A4S C;  3R2T A;  1PQS A;  4YSX B;  4PYZ A;  1YOV B;  3AE9 B;  3AM9 A;  4S17 A;  4GXB A;  3L17 A;  3TEZ A;  4OZB A;  4GDL B;  2KDF B;  2CHX A;  1OGW A;  2SAK A;  1A70 A;  2KWV B;  3NUH B;  2L05 A;  3Q2A C;  1WR6 E;  2DYB A;  2MLB A;  4JWS C;  3AE5 B;  1YX6 B;  4KKI A;  5D7G A;  2KWC A;  1TZO A;  3V61 A;  2ZPY A;  3K9P B;  5JHA A;  1GB4 A;  1TTN A;  1RFA A;  3KQ4 A;  3E56 A;  1E9M A;  4DXG A;  1VRA B;  2IJ0 A;  4HCP B;  4NAW A;  2IGH A;  4ANU A;  2IY1 B;  2LRU A;  4N58 A;  4PYU A;  2FIF A;  3URY A;  3AXC A;  2KVZ A;  2JYE A;  1C76 A;  2N9X A;  3EFU A;  2WXK A;  2L7R A;  3PLV A;  4LCD E;  4AOF A;  2QHO A;  2BS2 B;  2CU1 A;  3WIM A;  3N1Z C;  4ZOH C;  1Y8R C;  2PVG C;  3W2D A;  4B9K A;  3DVN U;  2Z0D B;  1WM2 A;  2KMM A;  3RFZ B;  2JRH A;  1FCL A;  2N9L A;  3EEC A;  1YQ3 B;  5AZH A;  3TJP A;  1KLG D;  3TIX A;  4ANV A;  2N4F A;  3P4R B;  1KF6 B;  1UWM A;  3AEC B;  5T8I A;  1D3Z A;  1WF9 A;  3P4S B;  4IWO A;  1VCB A;  3RCZ A;  1WFY A;  2WYQ A;  4FJZ A;  4YXD B;  4P1B C;  1WI0 A;  4KDI C;  1E8X A;  3HM6 X;  2J42 A;  2WDR B;  5FR6 A;  4M00 A;  3ZKJ C;  1FNV A;  3AE4 B;  1QKZ A;  2DAJ A;  2ZNV B;  1SXT A;  2QCZ A;  4HJG E;  1H8C A;  2K6Q A;  5D3I B;  1Q0W B;  1VDV A;  3OWE B;  1Q5W B;  3NVY A;  3L13 A;  1E8Y A;  2WDT B;  3ZNG C;  3DWG C;  1RM6 C;  5BYQ A;  2BT6 A;  4HKZ E;  1WXM A;  2H88 B;  3N32 A;  2D5G A;  2M0A A;  2EKE C;  2N7D A;  4MGI E;  2K1F A;  3ECI A;  3EC8 A;  1GB1 A;  1C78 A;  2HTM E;  3R3M A;  4HXD A;  2BKF A;  3BVM A;  1YN5 A;  3B9J A;  3QHT A;  4DHJ D;  3TBL D;  3IAM 1;  4JQW C;  4RH6 A;  1BML C;  4WWN A;  4JLC A;  2KX3 A;  1MG4 A;  2CS4 A;  1OQQ A;  2UYZ B;  4K7U A;  4MAC A;  1ZXH A;  3B2G A;  4WJQ A;  4USA A;  2GB1 A;  2CU3 A;  1OQR A;  3H8H A;  1LO5 D;  1V81 A;  2MH7 A;  2N7E A;  2HJ1 A;  4ASW C;  3NRZ A;  3EA6 A;  1Y56 A;  2RMM A;  2XNA C;  3DPD A;  4NJ6 A;  1C79 A;  4ICV A;  1TS2 A;  3MC9 A;  1I4R A;  1WGK A;  1PGX A;  3PT2 B;  3VR9 B;  2DYO A;  1NVI D;  2WX0 A;  2J7Q B;  2GRI A;  4ZHO A;  1CZP A;  2V4I B;  4LNO A;  4HEA 1;  2ZPN A;  5JZE B;  4LNN A;  4LNF A;  4US9 A;  4W9C A;  5AEK B;  2IBI B;  3IG3 A;  2JWZ A;  2LJ5 A;  1IPG A;  3AEA B;  4IG7 B;  2ZVN A;  3QQ8 B;  2LFI A;  3VTW A;  4BKS D;  2DNF A;  3UIO B;  1WY8 A;  2AQ2 B;  3K9O B;  4RFB A;  3IXS A;  5AUI A;  2JZ3 B;  2WNM A;  5BYR A;  1ENF A;  1FFU A;  4W9H A;  3TEY A;  4KV2 A;  3HK0 A;  5DPT A;  2KN5 A;  1GC6 A;  1VJK A;  3MJW A;  2LD9 A;  5LXI B;  2MQJ A;  2BS4 B;  5J18 A;  4EOY A;  3PRP B;  3NJT A;  4MH8 A;  3RNF C;  1PUT A;  2DZK A;  4XYC A;  1RFK A;  2KAN A;  2Y5B B;  3CSF A;  2V3S A;  1CQV A;  1QOG A;  3HUI A;  3EFC A;  4DXA B;  3AE3 B;  1AN8 A;  3VH4 B;  5I4D A;  2C9W B;  3N30 A;  2MP2 A;  2R2O A;  1J7B A;  3DBS A;  4L1B A;  5CHW A;  1RAX A;  3DBL B;  4GB9 A;  3CST A;  3V6C B;  1L5P A;  4HPP A;  3W5V B;  1QLB B;  3NOB A;  4MEM A;  4HCN B;  2W3S A;  3DBH B;  1Z2M A;  2VH1 A;  4ZRK A;  1I42 A;  1JWB D;  1NBF C;  2PE9 A;  1WJU A;  3AE6 B;  2MP2 B;  2O2V A;  2B76 B;  4MM3 A;  2XN9 C;  2QDF A;  1TYG B;  3R66 C;  1ZDV A;  2C5L C;  1LQB A;  2K6D B;  4BOZ B;  1EU3 A;  3VAW A;  1FNW A;  1ZKH A;  2WHI A;  1WXA A;  1UF0 A;  3A9K B;  1UEL A;  3GB1 A;  1JWA D;  4GOC A;  2NBV B;  5G2N A;  2XBB C;  1SE3 A;  1OEY A;  2WXJ A;  1TBE A;  2WXR A;  3CMM B;  2KLG A;  3WAP A;  1FRD A;  4HWI B;  3KVF B;  2HE7 A;  4BKT A;  4DXF A;  2NVU I;  2KC1 A;  3GE3 C;  1K51 A;  3B08 A;  2X8X X;  1YJJ A;  4JL9 A;  1IBX B;  1RRB A;  3N1Y C;  1YNT E;  2QEJ C;  4X57 B;  3RUL A;  1DOY A;  5G55 A;  3AEG B;  3L4P A;  3BVG A;  4P16 A;  1HZ6 A;  2LUE A;  1D5M C;  4BAX A;  1LGR A;  4A3P A;  4C00 A;  4YWG G;  1FO4 A;  4W9J A;  1WGR A;  1EO6 A;  2NMQ A;  1VR9 A;  3EHV A;  2WXG A;  3VFK A;  4WQO B;  1WE6 A;  4W9D A;  3T8M A;  4ZRI A;  3W5U B;  3Q14 C;  3I63 C;  4EKU A;  4GLS C;  5J17 A;  4B6W A;  3O13 A;  2IDY A;  2J53 A;  2K25 A;  1MHH E;  4FAD A;  3BIN A;  1AWD A;  1I4X A;  2FBW B;  3TSS A;  4C4V B;  5DPW A;  2KDE B;  4FN2 A;  2IPK D;  2LUM A;  1TS3 A;  2ZW1 A;  2GMI C;  3UI3 A;  1QOF A;  4XDD A;  1EF5 A;  2YEP F;  5H92 C;  2MA9 B;  2L83 A;  1GJZ A;  2DAF A;  4NPN A;  2NR2 A;  4RM9 A;  3VUX A;  3PZ7 A;  3ENE A;  1L0Y B;  2LAS A;  1TKY A;  1XLP A;  2AL3 A;  1XCQ L;  1V86 A;  3PS6 A;  4EEW A;  4K3B A;  4HJK A;  4HVB A;  2REX A;  4IWP A;  2KVR A;  3R8B A;  1KFY B;  2RSU A;  2WX1 A;  4ZDV A;  2I1K A;  4ICU A;  3ZJT A;  4GDK B;  4FA6 A;  1UH6 A;  2L0T A;  2PPH A;  4ZRP A;  5IO9 A;  1E90 A;  4GIV A;  4ZYN A;  3QC8 B;  3GZN I;  3ZNZ B;  3ZXV A;  1YJI A;  1Q1O A;  4M0W A;  4IKG A;  3ZJU A;  2E6X A;  3IHP C;  1KH0 A;  1WJ6 A;  4QAY A;  3WAN A;  2BQQ A;  4K7W A;  1FFV A;  2OHF A;  5BO4 B;  2NBW B;  3DHH C;  2KFK A;  3R7R A;  3PRE A;  4BBN C;  4RF0 A;  1CK1 A;  2A5U A;  1TY2 A;  2SEB D;  5E6N A;  1I7H A;  3NVV A;  1JQ4 A;  1YN4 A;  3QJZ A;  2KJ6 A;  3H7P B;  2MBO A;  4CYE A;  1EF1 A;  2LRW A;  4TUU A;  2KYW A;  3M63 B;  4I6L B;  2NS5 A;  2O2V B;  4MH0 E;  2GBR A;  1SBB B;  3VHT C;  3KWL A;  4LK0 M;  2LGD A;  3CWI A;  1E5W A;  1WMH B;  2KLC A;  3NZU A;  1TS4 A;  2AQ3 B;  3JYU A;  1ZUD 2;  3MHZ A;  1P0R A;  4HKQ A;  3KH0 A;  2W54 A;  4XZ4 A;  3RN9 C;  2M19 A;  2FCS A;  2G45 B;  3IFW B;  4W9K A;  4BFR A;  4ARI A;  3ZIM A;  1UGM A;  2JXT A;  5L95 C;  3Q8F A;  1WM3 A;  1WRI A;  2WXH A;  2WXN A;  2GOW A;  1MVK A;  1QZE A;  4C56 C;  4FBJ B;  1DYQ A;  3R2I A;  3W1Y A;  2KQS A;  4YTN B;  4MGK E;  3UIN B;  4GDL A;  4E74 A;  1PYW D;  1J0G A;  1F0Z A;  3PHX B;  2J52 A;  3RI7 C;  2LXA A;  1P7F A;  1PFD A;  4LJO B;  1WH3 A;  2ON8 A;  4UDU C;  3A1Q A;  3DQV A;  1HQR D;  2FCQ A;  2VH2 A;  4CQN A;  2WGS A;  4LTU A;  1B1Z A;  2AEH A;  3C0R B;  2TSS A;  2PIA A;  1CMX B;  4HPM B;  4HRO A;  3QAR A;  3LJ3 A;  4XWT A;  2QMT A;  3PVL A;  3AU5 A;  3A4R A;  3DVG Y;  2LVO A;  5E6J A;  2JX5 A;  2JVC A;  4DHZ E;  1LFD A;  5IOI A;  2LHD A;  1ISN A;  4LDT D;  2RDG A;  2N0S B;  2ZCB A;  1QT9 A;  4TV3 A;  3RZW C;  4E71 A;  5BYS A;  2KDB A;  2L76 A;  3OJ3 A;  3P63 A;  4TMA B;  2M0X A;  1V97 A;  1TZ1 A;  2PKO A;  3GE8 C;  3P42 A;  1ZW7 A;  3Q8C A;  1HZ5 A;  4P7I A;  5EDS A;  2FAZ A;  4JX1 C;  3QWZ B;  1ESF A;  3UGB B;  3ZJV A;  3C19 A;  1C4A A;  4XC2 A;  1WGG A;  2D3G A;  1I4G A;  2WXM A;  3Q8A A;  3DOW A;  4KVG B;  3V3X A;  3ZQ4 A;  2YLM A;  2FE8 A;  1B9R A;  2LMC A;  5C3J B;  3EUB 2;  2L1A A;  4B0M A;  3ABV B;  4N6E B;  3VTV A;  2VZK B;  2FCM A;  4FHJ A;  4XGA B;  1K52 A;  3P2B A;  4WQM A;  2BB6 A;  1MJD A;  3GS2 A;  4YT0 B;  2KQ4 X;  3RD2 A;  4K1R B;  5C23 A;  3I3T B;  4J6I A;  3T3N A;  2C60 A;  1E7U A;  3AI5 A;  3U7D A;  2CR5 A;  1WGY A;  1MG8 A;  2NPT B;  4WJP A;  4Q2J A;  2XK5 B;  3RPF C;  1XEE A;  1P1A A;  5IAA C;  2KDI A;  2BBC A;  1K50 A;  3QK0 A;  1TJE A;  2O6V B;  4MJS B;  4AS1 A;  1TY0 A;  2MWS B;  1FRR A;  4RGM A;  2KN4 A;  4WWM A;  2AQ1 B;  2JPH A;  3VVW B;  4WUR A;  4LNK A;  2LGY A;  1K53 A;  4BKS A;  3JW0 X;  5CX3 A;  2WP9 B;  1P98 A;  3L54 A;  2M1M A;  2AL6 A;  2ZZP B;  1OTR B;  4M01 A;  3U2S C;  2DZI A;  3DVN V;  1ZP0 B;  1JW9 D;  4P1C C;  1N5W A;  1V2Y A;  1PGB A;  2QIE B;  4G3X B;  3AE7 B;  3BK2 A;  4DDG D;  1FM0 D;  1ZE3 D;  2MBE A;  2JUO A;  1STE A;  4KSK C;  1NI3 A;  5HKH A;  2J0J A;  1T0S C;  1K8R B;  5H8Y E;  3M3J A;  1WZ3 A;  3I5J C;  3FIL A;  3DCG A;  1PGA A;  2GBN A;  3APD A;  2WXF A;  2WU5 B;  3SFD B;  1NEK B;  3E9S A;  4C80 A;  4MT5 A;  1WYG A;  1R4N I;  2KHW B;  1SJE D;  2PE6 B;  1F2R I;  2QSD A;  1D6E C;  4WAF A;  3DBH I;  4P6V F;  3UIP B;  3JSV B;  3UF8 A;  3ZRC A;  1DOX A;  1V1P A;  2IO2 B;  2DEN B;  3PTF C;  1J8C A;  3BK1 A;  4XX5 A;  2Y5C A;  1C9F A;  1XCT L;  1FPY A;  2MBB B;  4RMA A;  2K22 A;  4OW0 A;  3MTN B;  2V3N A;  4E3C A;  2DLB A;  2VZK D;  1VLB A;  3Q3F A;  3RZF A;  4EZL A;  1WX7 A;  1UBI A;  4F8C B;  3Q69 A;  5JXV A;  2UU7 A;  1C1Y B;  1TIF A;  3ZNH B;  1JML A;  2ZCC A;  3C8Y A;  4KZC A;  2KZR A;  1L6U A;  3ML9 A;  1VD2 A;  2PW9 A;  4ANW A;  1HXY D;  3SDL C;  4KGS A;  3I57 A;  2I2Y A;  4CO7 A;  4M02 A;  2W55 A;  2Z0E B;  4N59 A;  3LYY A;  2GLS A;  2MCN B;  1NI2 A;  3SR6 A;  2KTF A;  3TUO A;  3R7Q A;  4OVV A;  2DZJ A;  4IM0 A;  1DGJ A;  1NYR A;  1T3Q A;  3H9D A;  5D3D A;  1MPE A;  3PPA A;  3ZTC A;  3M62 B;  3ZO5 B;  1SGH A;  3NZS A;  4G50 A;  1AW7 A;  2LWP A;  4WAA A;  3N3K B;  3BII D;  2DZM A;  1L7Y A;  3UQB A;  4XDC A;  3HRD D;  2V3P A;  5FK9 C;  4DBG A;  2DX5 B;  5C2T B;  4NZL B;  4GSW A;  1T0Y A;  1KLU D;  1SIJ A;  2KJR A;  3FAH A;  4W9E A;  2GBK A;  3U8Z A;  5IA7 A;  5BMG A;  2C7H A;  3IBE A;  5D94 A;  2L32 A;  4CHK A;  1KJT A;  1NEN B;  1WX8 A;  3AUL A;  3BWU D;  3QA8 A;  3FC4 A;  1EM7 A;  3VR8 B;  1J7C A;  1ZXI A;  1F77 A;  1NDD A;  3MHS D;  1DOI A;  4OHJ A;  1IP9 A;  2IND C;  3CIR B;  5MPO A;  2MJE A;  3P4P B;  3ZLZ A;  3CF6 E;  3MFG A;  1QOA A;  4TQ1 A;  3U7Z A;  4JE3 B;  3J9C A;  5BMH A;  3RYT A;  4EZK A;  2NTT A;  4YSZ B;  2E3T A;  3LXF A;  4A55 A;  1N63 A;  3V62 A;  1J7A A;  2M8S A;  4I6P A;  4REZ A;  2FNJ B;  2L3Z A;  2IY0 B;  3A9J A;  2MX2 A;  2RDH A;  2RGF A;  3O65 B;  4AUQ C;  2KTR B;  1N62 A;  3ZNI D;  1E10 A;  5IKC M;  3KW5 B;  1D4B A;  2I38 A;  2IO1 B;  2V4L A;  2QC8 A;  1V1P B;  1WGH A;  3Q3M C;  4C7Y A;  2G3Q B;  2JF5 A;  1V6E A;  4W9I A;  3UQA A;  1RYJ A;  3AE1 B;  4MSM B;  1UZX B;  2OJR A;  4IW0 A;  4RCO A;  4BVU C;  2CJN A;  3ALB A;  2B3A A;  1QOB A;  4KSL C;  2X38 A;  1GPX A;  3L08 A;  2GBJ A;  1ROE A;  2QIL A;  4LNI A;  1QF6 A;  1SIF A;  1N61 A;  2D07 B;  2N9E B;  5LNK 1;  1FXA A;  3PLU A;  3PV1 A;  4FHK A;  3X23 A;  1C77 A;  1E7P B;  3QCA A;  3MC0 B;  2IZV B;  1WIA A;  1U4A A;  1E7V A;  2KDM A;  4R3D A;  4KKJ A;  3QX1 A;  3PHW B;  1QIL A;  2RD0 A;  2JXX A;  2ZVO A;  3VUW A;  2IGD A;  3WAO A;  4EUT A;  2KAC A;  1FEH A;  1HE8 A;  2H89 B;  2JY6 A;  3ZYY X;  4IC7 B;  2K39 A;  2BS3 B;  3A33 B;  1XD3 B;  5JHB A;  3V6E B;  1YJ1 A;  3KUC B;  4DK5 A;  2EMT A;  1BXT A;  3PRZ A;  3SD5 A;  4LJP B;  1XF5 L;  4KIK A;  3RNB C;  1KRH A;  3S2A A;  2J0K A;  2CHW A;  4ARC A;  4IM2 A;  2N7J A;  1V8C A;  5IN7 A;  2EKI A;  3MJ5 A;  4JIO U;  2C7M B;  2BB5 A;  1FMA D;  3BY4 B;  2JSV X;  2WDV B;  2GBM A;  4WWO A;  2RDB C;  4JPS A;  3VQI A;  3RT3 B;  4ZRQ A;  3HM3 A;  4DHZ B;  5G5G A;  1VZ7 A;  1S3S G;  4N9F 4;  2KJH B;  2WU2 B;  1YN3 A;  5DCN A;  3ML8 A;  4ACF A;  2ZW0 A;  1EWC A;  5KHO A;  1MI0 A;  4AJW A;  1SJH D;  2DYM A;  2N1V A;  2OED A;  4OVZ A;  1WX9 A;  1ZOY B;  4ANX A;  1ZGU B;  4TQ0 A;  2Q5W D;  3ZW3 A;  2WXO A;  2V1Y A;  1N5X A;  4IDI A;  2KX0 A;  1UUP A;  5DPS A;  3DDC B;  1V1O A;  1XXG A;  4HPL B;  2Y5P A;  2PJH A;  3IVF A;  1EUV B;  2J0M A;  3TCA A;  3W1S A;  4A9A A;  3NVZ A;  3DBL I;  4BKG A;  4JGH B;  1YD8 U;  1TS5 A;  1T0R C;  2IO3 B;  1WRD B;  3APC A;  2BYV E;  4HDO A;  5FKA C;  4OZC A;  2KWD A;  3NS8 A;  3OJ4 B;  3B1L X;  5AUK A;  4M0W B;  4FJY A;  1WJN A;  3TL5 A;  1LM8 B;  2INP E;  4KGT A;  4ZRJ A;  4ZHP A;  3ZDT A;  2Z8L A;  4JWU C;  5E6P A;  2L00 B;  2JT4 B;  3M95 A;  3ONS A;  3WAL A;  2JQR B;  4F7Z A;  3SFE B;  3SEB A;  2BVC A;  4NQK E;  1F52 A;  2G4D B;  2EEL A;  3RUI B;  2PEA A;  1XLQ A; 
#chains in the Genus database with same CATH homology
 2BYF A;  3A1Q B;  4G3X B;  5E6O A;  4DDG D;  2LXC A;  2MBE A;  2JUO A;  2MP2 B;  2M17 A;  2KTR A;  2O2V A;  4KSK C;  2HD5 B;  3W1S C;  5HKH A;  2MBQ A;  4GU2 A;  4MM3 A;  2J0J A;  1C3T A;  2D10 A;  2K8H A;  1K8R B;  4GGQ A;  2KFK B;  2NBU A;  3M3J A;  1WZ3 A;  2HTH A;  3DCG A;  3R66 C;  2GBN A;  3APD A;  2LVP A;  2C5L C;  1LQB A;  2K6D B;  4BOZ B;  1YX5 B;  3WAM A;  3VAW A;  4OVU A;  5CTR C;  1ZKH A;  1R4N I;  1WXA A;  3KYC D;  2KHW B;  3TMP B;  5CHF A;  2PE6 B;  3A9K B;  1UEL A;  3PRM B;  4GOC A;  3A9J B;  4WJO A;  2NBV B;  3DBH I;  5G2N A;  2XBB C;  1OEY A;  1TBE A;  4KDL B;  3VXW A;  2BWF A;  3UIP B;  3JSV B;  3UF8 A;  1V5O A;  3CMM B;  3JSV A;  3ZRC A;  2KLG A;  3HHM A;  4FJV B;  2R2Q A;  3WAP A;  3ZTD A;  2IO2 B;  3LDZ E;  4HWI B;  2DEN B;  3KVF B;  2HE7 A;  4IWQ A;  4BKT A;  3PTF C;  2NVU I;  2XK5 A;  1X1M A;  4NAW B;  1J8C A;  1H4R A;  1WXV A;  4XX5 A;  2KC1 A;  3B08 A;  3KUD B;  4GDK A;  4JL9 A;  1RRB A;  4W9F A;  3OAW A;  2YVC A;  2MBB B;  4RMA A;  3PSE B;  3MTN B;  4X57 B;  3RUL A;  4E3C A;  2JRI B;  4A3O A;  2FCN A;  5G55 A;  3H6N A;  3Q3F A;  3RZF A;  2ZEQ A;  4II3 B;  4MSQ B;  3U30 A;  4PS3 A;  2NCN A;  1WX7 A;  4EZL A;  3SU8 X;  1L2N A;  2HJ8 A;  2MBH A;  1UBI A;  2LUE A;  5JH5 C;  4F8C B;  4DHJ B;  4A3P A;  4WJN A;  1C1Y B;  3ZNH B;  4NNJ B;  5LLI A;  3DVG X;  2ZCC A;  4W9J A;  1WGR A;  4KZC A;  1EO6 A;  2KZR A;  3VUY A;  1WZ0 A;  3ML9 A;  3EHV A;  2DHZ A;  2JZZ A;  3VFK A;  4WQO B;  1VD2 A;  1WE6 A;  4W9D A;  4NY0 A;  4ANW A;  3SDL C;  3ZRF A;  3T8M A;  2N9P C;  1E8W A;  4ZRI A;  2CHZ A;  2LVQ A;  4CO7 A;  4EKU A;  2Z0E B;  2MCN B;  5J17 A;  1NI2 A;  4B6W A;  3B0A A;  2L8J A;  2KTF A;  2RR9 A;  4RM8 A;  3R7Q A;  4OVV A;  2K25 A;  3VDZ A;  4FAD A;  5D2M B;  3BIN A;  2D2Q A;  5AZF A;  3VH3 B;  2DZJ A;  4IM0 A;  5DPW A;  1A5R A;  2KDE B;  1WR1 A;  4FN2 A;  4EZJ A;  3H9D A;  4AP4 C;  3H1U A;  3PPA A;  2CKH B;  3ZTC A;  3QIJ A;  3M62 B;  3ZO5 B;  1V5T A;  1YIW A;  1SGH A;  3NZS A;  2GMI C;  4G11 A;  4G50 A;  4W9G A;  2ASQ A;  1GNU A;  1EF5 A;  1AAR A;  4F1S A;  4NJ7 A;  2LWP A;  2O6V A;  4WAA A;  3N3K B;  4FLH A;  2MA9 B;  1GJZ A;  2DAF A;  2DZM A;  3L16 A;  1OQY A;  2AWT A;  4NPN A;  3NHE B;  1L7Y A;  1LXD A;  2BPS A;  2NR2 A;  1WGD A;  4RM9 A;  3VUX A;  2BYE A;  3UQB A;  3SHQ A;  3ENE A;  2LAS A;  4DBG A;  2DX5 B;  3Q3J A;  2AL3 A;  1XQQ A;  4MGY E;  1V86 A;  3A4S C;  1BT0 A;  1T0Y A;  4GSW A;  3PS6 A;  2KJR A;  1PQS A;  4W9E A;  4EEW A;  2GBK A;  3U8Z A;  4PYZ A;  4HJK A;  4HVB A;  2EMS A;  2REX A;  5IA7 A;  4IWP A;  2KVR A;  2C7H A;  4FUL A;  4GXB A;  3IBE A;  3L17 A;  2RSU A;  2WX1 A;  2D11 A;  5D94 A;  4GDL B;  4CHK A;  4ZDV A;  2I1K A;  2KDF B;  4ICU A;  2CHX A;  1OGW A;  1KJT A;  4A20 A;  2KWV B;  2L05 A;  1WX8 A;  3AUL A;  1UH6 A;  2L0T A;  1WJ4 A;  1WR6 E;  2PPH A;  4GDK B;  4FA6 A;  3QA8 A;  1E90 A;  4GIV A;  2DYB A;  2MLB A;  4ZYN A;  3QC8 B;  1NDD A;  3MHS D;  3GZN I;  1YX6 B;  3ZNZ B;  1Q1O A;  2WWZ A;  5CHV C;  1IP9 A;  5D7G A;  2KWC A;  3V61 A;  2ZPY A;  3K9P B;  5JHA A;  4BBN F;  3IHP C;  3ZLZ A;  1TTN A;  1RFA A;  3CF6 E;  1WJ6 A;  2KKC A;  3WAN A;  4K7W A;  5BO4 B;  4TQ1 A;  2MW5 A;  2NBW B;  4B95 A;  2KFK A;  3RYT A;  4EZK A;  3L10 B;  4HCP B;  4HK2 A;  1Z5S B;  4NAW A;  1P3Q U;  5C1Z A;  3R7R A;  4ANU A;  3PRE A;  2KXJ A;  2IY1 B;  4BBN C;  2LRU A;  4PYU A;  2FIF A;  2A5U A;  4KZ0 A;  4K7S A;  3AXC A;  3V62 A;  2M8S A;  4I6P A;  2IYD B;  5E6N A;  2FNJ B;  2L3Z A;  2OOB B;  2IY0 B;  2KWU B;  2XEW A;  3QJZ A;  2N9X A;  2KJ6 A;  3EFU A;  2MBO A;  3H7P B;  5DPR A;  3A9J A;  2MX2 A;  2L7R A;  4CYE A;  1EF1 A;  3PLV A;  4LCD E;  2LRW A;  4TUU A;  2RGF A;  3M63 B;  3O65 B;  4I6L B;  4AOF A;  4AUQ C;  2QHO A;  2NS5 A;  5J2R A;  2KTR B;  2O2V B;  1G6J A;  3OLM D;  2LZ6 A;  4MH0 E;  3ZNI D;  2CU1 A;  2GBR A;  3KW5 B;  4IUM B;  3WIM A;  1KOT A;  4GN1 A;  3V60 A;  3VHT C;  2L0F A;  2IO1 B;  4W9L A;  2V4L A;  5L83 A;  2LGD A;  1E5W A;  1Y8R C;  4B9K A;  1WMH B;  2KC2 A;  1WGH A;  2KLC A;  2Z0D B;  1WMH A;  3DVN U;  3NZU A;  1WM2 A;  3JYU A;  2G3Q B;  2JF5 A;  1P0R A;  1V6E A;  2JRH A;  4W9I A;  3UQA A;  4AWJ A;  3KH0 A;  3EEC A;  4MSM B;  1UZX B;  4XZ4 A;  5AZH A;  3TJP A;  4HDQ A;  3TIX A;  2OJR A;  1V80 A;  4IW0 A;  4ANV A;  4HLE A;  2I1J A;  2N4F A;  1OEY J;  4BVU C;  2FCS A;  2G45 B;  3IFW B;  3JVZ X;  1SE9 A;  2KOX A;  4W9K A;  4BFR A;  1D3Z A;  1WF9 A;  3ALB A;  2AYO B;  2VRR B;  5GMV A;  2B3A A;  4IWO A;  1R4M I;  1UGM A;  3ZIM A;  1VCB A;  4GMV A;  5L95 C;  3RCZ A;  4KSL C;  2A4Z A;  1WFY A;  2WYQ A;  1WM3 A;  3L08 A;  4FJZ A;  2GBJ A;  1WI0 A;  4I6N B;  4KDI C;  2GOW A;  1SIF A;  1QZE A;  1E8X A;  3HM6 X;  4FBJ B;  3HIZ A;  3KUZ A;  5FR6 A;  1RLF A;  1P9D U;  2BGF A;  2D07 B;  3W1Y A;  3ZKJ C;  3ZUN A;  3T9L A;  2DAJ A;  4TKN A;  2ZNV B;  2KQS A;  2N9E B;  1F9J A;  4MGK E;  4GDL A;  3UIN B;  4E74 A;  2KFJ A;  2K6Q A;  1H8C A;  1Q0W B;  1J0G A;  3PHX B;  2C7N B;  3PLU A;  3PV1 A;  4FHK A;  2BF8 B;  3X23 A;  2LXA A;  2MSE D;  1Q5W B;  2KMC A;  3QCA A;  3L13 A;  1E8Y A;  4LJO B;  1WXS A;  2IZV B;  1WH3 A;  1WIA A;  1U4A A;  2WDT B;  4G0N B;  3ZNG C;  2IO0 B;  2KO3 A;  3A1Q A;  2FID A;  1E7V A;  3DQV A;  2FCQ A;  4K81 A;  1WXM A;  2RPQ A;  2K8B A;  3QX1 A;  3PHW B;  3N32 A;  2EKE C;  2RD0 A;  2AEH A;  2JXX A;  2N7D A;  2LI5 A;  2ZVO A;  4MGI E;  3C0R B;  3VUW A;  2K1F A;  2KK8 A;  3ECI A;  4MEL A;  3EC8 A;  1XT9 B;  2KNB A;  1CMX B;  4LDT B;  4HPM B;  2Z59 B;  3GOE A;  3VTU A;  3R3M A;  3WAO A;  3QAR A;  4EUT A;  1HE8 A;  2JY6 A;  3LJ3 A;  4HXD A;  2BKF A;  4IC7 B;  3PVL A;  3AU5 A;  2K39 A;  3A4R A;  3DVG Y;  3A33 B;  3QHT A;  1XD3 B;  1GC7 A;  2G4S A;  3APF A;  3TBL D;  4JQW C;  4DHJ D;  2LVO A;  4WWN A;  4JLC A;  1YJ1 A;  3V6E B;  5JHB A;  2JVC A;  2KX3 A;  2FUH B;  3KUC B;  2CS4 A;  2UYZ B;  4DK5 A;  2LGX A;  4K7U A;  2EMT A;  3NY5 A;  4DHZ E;  1LFD A;  3PRZ A;  4WJQ A;  3WA0 A;  3SD5 A;  1ISN A;  4LJP B;  4LDT D;  1KLV A;  4KIK A;  2KQ7 A;  2ZCB A;  1V81 A;  4TV3 A;  3RZW C;  3S2A A;  2J0K A;  2N7E A;  2CHW A;  2M4N A;  4E71 A;  4PS7 A;  4ASW C;  2KDB A;  2L76 A;  3OJ3 A;  4IM2 A;  2M0X A;  1TZ1 A;  1GG3 A;  3DPD A;  4NJ6 A;  1ZW7 A;  2C7M B;  4JIO U;  3D32 A;  4ICV A;  3BY4 B;  4P7I A;  5EDS A;  3ZDM C;  3PT2 B;  2FAZ A;  4M8N A;  2KMA A;  3QWZ B;  2DYO A;  2GBM A;  4WWO A;  2ZJD A;  2WX0 A;  2J7Q B;  3VQI A;  3RT3 B;  2BKR B;  3HM3 A;  1V9J A;  3UGB B;  4DHZ B;  2O6V D;  2N1W A;  2ZPN A;  4XC2 A;  5JZE B;  1S3S G;  4N9F 4;  2KJH B;  1GUA B;  3ZVV A;  4W9C A;  5AEK B;  2IBI B;  5DCN A;  3IG3 A;  1WGG A;  2JWZ A;  3ML8 A;  2D3G A;  1E8Z A;  2LJ5 A;  3DOW A;  5KHO A;  1IPG A;  4KVG B;  1KM7 A;  2YLM A;  2W9N A;  4IG7 B;  4IM3 A;  2ZVN A;  4AJW A;  3QQ8 B;  3VTW A;  4BKS D;  2DYM A;  2N1V A;  3VTV A;  1WX9 A;  3UIO B;  4ANX A;  1WY8 A;  1ZGU B;  2FCM A;  4FHJ A;  4TQ0 A;  2UWQ A;  3ZW3 A;  3PZD A;  2V1Y A;  3H7P A;  3PGE A;  3K9O B;  3P2B A;  2KX0 A;  4MJS A;  4EFO A;  5DPS A;  3DDC B;  2JZ3 B;  4WWP A;  3H7S A;  3RD2 A;  4K1R B;  5C23 A;  3I3T B;  1M94 A;  4J6I A;  1IYF A;  1J19 A;  4KIK B;  4HPL B;  2C60 A;  1E7U A;  3KYD D;  2PJH A;  3IVF A;  1EUV B;  5D6J B;  3AI5 A;  2J0M A;  3TCA A;  3U7D A;  2CR5 A;  3AU4 A;  1WGY A;  4W9H A;  4URK A;  2BWE S;  3W1S A;  2MRP A;  2NPT A;  1MG8 A;  2NPT B;  4WJP A;  4KV2 A;  3HK0 A;  5DPT A;  2XK5 B;  3L0W B;  2KN5 A;  1GC6 A;  3DBL I;  1WE7 A;  1TGZ B;  2LD9 A;  3MJW A;  4JGH B;  4BKG A;  5KHQ A;  3QAQ A;  5LXI B;  1YD8 U;  2MQJ A;  5LXH A;  5IAA C;  1P1A A;  5J18 A;  2KDI A;  4EOY A;  2IO3 B;  3PRP B;  1WRD B;  3QK0 A;  5AZG A;  3APC A;  2DZK A;  2O6V B;  1JRU A;  2BYV E;  4MJS B;  2KAN A;  2Y5B B;  3CSF A;  1FXT B;  4HDO A;  1UD7 A;  2V3S A;  4DWF A;  4DXA B;  2MWS B;  3A9K A;  3NS8 A;  3OJ4 B;  4M8M A;  1V49 A;  3B1L X;  2JPH A;  1S1Q B;  4M0W B;  3VH4 B;  4BOS C;  4FJY A;  3VVW B;  1WJN A;  3TL5 A;  1LM8 B;  2C9W B;  2KD0 A;  2ZNV C;  2LGY A;  3N30 A;  4ZRJ A;  1YQB A;  3ZDT A;  3DBR I;  3JW0 X;  4BKS A;  2MP2 A;  2R2O A;  5CX3 A;  1WYW B;  3DBS A;  1P98 A;  5CHW A;  5E6P A;  4II2 B;  1RAX A;  2L00 B;  3L54 A;  4AJY B;  3X0W A;  2JT4 B;  3M95 A;  4GB9 A;  3CST A;  2M1M A;  2AL6 A;  3ONS A;  3V6C B;  2ZZP B;  3WAL A;  1OTR B;  2K8C A;  3NOB A;  4MEM A;  4DDI D;  4NQL B;  4HCN B;  4F7Z A;  1I35 A;  5TR5 A;  2DZI A;  1Z2M A;  4NQK E;  4ZRK A;  1I42 A;  3DVN V;  2G4D B;  4PS8 A;  4MGZ E;  4MDK E;  4YL8 A;  3RUI B;  1NBF C;  2PEA A;  2PE9 A;  1UBQ A;  1V2Y A;  1WJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...