1IYFA

Solution structure of ubiquitin-like domain of human parkin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
76
structure length
76
Chain Sequence
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords parkin
publication title Parkin binds the Rpn10 subunit of 26S proteasomes through its ubiquitin-like domain
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 76
sequence length 76
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1iyfA00
1Z5SB 4G3XB 4AUQC 5KHOA 4KSKC 4MSQB 3O65B 3Q3JA 5CX3A 3N32A 3TMPB 4EEWA 2EMSA 3JYUA 2CU1A 2FCQA 4ANWA 3QWZB 4EUTA 3ALBA 4GIVA 1WJUA 4DDID 2M1MA 4URKA 2G4SA 4K7SA 3H7PB 1ZGUB 2KJ6A 3ZTCA 4TKNA 2KKCA 2FCNA 4EOYA 4NJ7A 1KOTA 2JPHA 1XD3B 1WYWB 2RD0A 3PS6A 1WJNA 3QIJA 4MGIE 2IO0B 4GDKA 3ZLZA 2ZJDA 5JHBA 3DBHI 2D11A 2EMTA 3ECIA 4K7UA 3NZUA 2BWES 2BYEA 2J0JA 2MW5A 3HHMA 2N1VA 2AWTA 1VCBA 4MELA 2O2VA 2KHWB 2IO2B 3QARA 1XQQA 2VRRB 1PQSA 1S1QB 3K9PB 3SU8X 3TJPA 3X0WA 3HM6X 1CMXB 1V49A 2KFKB 2NPTB 2O6VB 4NAWA 4W9CA 4K1RB 3NY5A 3VH4B 2R2QA 3ZO5B 4AJYB 2WDTB 2BPSA 2MBHA 2L0FA 3DCGA 1WGDA 4JGHB 4WWOA 1R4NI 3X23A 3JW0X 4B9KA 1G6JA 1JRUA 2N1WA 1AARA 1LXDA 3W1YA 4BKSA 1XT9B 1V2YA 3NHEB 1YD8U 3D32A 1WXSA 4WJPA 5CHFA 2MSED 2K39A 3DVGY 3IBEA 1SGHA 3L16A 4W9FA 2Z0DB 5E6PA 1C3TA 2FAZA 2Y5BB 5AEKB 4G50A 1C1YB 4KDLB 5DPTA 4PYZA 3M95A 1QZEA 4W9IA 2NBWB 3MJWA 4PS7A 2V3SA 3WALA 2DZIA 3UGBB 2MP2A 3DQVA 3T9LA 2ZCCA 4IW0A 2IO1B 4ANVA 2JZ3B 4HDQA 4K7WA 3WAOA 4HJKA 4MGZE 2GBMA 4FN2A 2JWZA 4XZ4A 1V81A 1GC6A 3IHPC 3PRPB 2O6VA 1WGHA 2N9XA 4W9KA 4YL8A 2G4DB 4BKGA 3APFA 4WWPA 3M3JA 4II3B 3PRZA 4E74A 1WR1A 2OOBB 1YQBA 4JQWC 3OJ4B 3ZDMC 3EECA 2K6DB 2I1JA 2LI5A 3Q3FA 3R66C 4DBGA 5JHAA 5JZEB 2KZRA 1KM7A 4MH0E 1WM3A 1E8WA 2DAFA 2EKEC 4MSMB 4HCPB 2NVUI 2IBIB 3QA8A 3ZNID 5DPSA 5D7GA 4IM0A 3QK0A 2KQSA 2D2QA 2LJ5A 1FXTB 3V62A 3ONSA 3A9JA 4FJZA 3BINA 3H6NA 1V80A 3KUZA 1Q5WB 2KQ7A 3R3MA 5AZGA 1J8CA 1E8YA 2GBNA 4DHZB 1HE8A 2KN5A 1E8ZA 3L08A 4E3CA 3N3KB 3ML9A 2ZPYA 4WJQA 3DVGX 3ENEA 3WA0A 2M17A 2KC2A 2Z59B 4HPLB 3OLMD 4A20A 1WMHA 2KLCA 4GU2A 4CO7A 1WGGA 4HK2A 1RAXA 4FJYA 1RLFA 3VVWB 3UIOB 2C7MB 1E8XA 2MA9B 4I6NB 4J6IA 3ZNGC 2KTFA 4ZDVA 4ZRIA 1H4RA 2D3GA 1NBFC 3MHSD 3DBSA 5D6JB 1WRDB 2N9EB 4HLEA 2A5UA 4GDKB 1D3ZA 4ANXA 3KUDB 2DYBA 3ZNZB 2MWSB 2FCMA 2XBBC 4I6PA 4EFOA 3PREA 5KHQA 1M94A 4I6LB 3PRMB 3ZUNA 3ZIMA 2O2VB 5L83A 3WAMA 4ICVA 5LXIB 1IYFA 1J0GA 1MG8A 4DWFA 3UIPB 2ZVOA 3L0WB 4NAWB 4WJOA 2WX1A 3EFUA 4A3PA 4HCNB 5TR5A 3P2BA 3TBLD 4B95A 1E5WA 3AU5A 4ICUA 4NQLB 2JY6A 5CTRC 5EDSA 5IA7A 2DX5B 3M62B 4LCDE 3L54A 3WIMA 2C7NB 2ASQA 2FIFA 2KANA 3KYDD 2V4LA 1ZKHA 5L95C 2KC1A 3KW5B 3OAWA 1EF1A 2JRHA 3DBLI 3U8ZA 1WX7A 3B0AA 1WGYA 3ZDTA 4FA6A 2DYOA 2KDIA 2MQJA 2FNJB 1IPGA 3VXWA 4DXAB 3LJ3A 2XEWA 3KYCD 3RZFA 3DOWA 3C0RB 3NS8A 4NNJB 5IAAC 2KX3A 3EC8A 1WIAA 2D10A 2MP2B 4MGYE 4W9LA 4HWIB 2LRWA 2WWZA 3B08A 3RT3B 4AWJA 4FLHA 2LUEA 4M8MA 1P98A 3QHTA 2NCNA 3ZVVA 2K8HA 2KDBA 2NBVB 3DVNU 3PV1A 2L05A 5C1ZA 4IC7B 2AEHA 5C23A 4NY0A 2AL6A 2GBRA 4AP4C 1WR6E 2JT4B 4FADA 4GSWA 4X57B 4RMAA 4BFRA 3PZDA 1WE6A 4XC2A 3BY4B 3WANA 2DHZA 2ZPNA 1KLVA 1S3SG 4F1SA 4N9F4 1L2NA 2B3AA 3A9JB 2G45B 2N4FA 3AI5A 1RRBA 2MBEA 3OJ3A 1WXAA 2KWUB 3RUIB 3APDA 2FIDA 4DDGD 3UF8A 2MRPA 3PT2B 4IWPA 3SD5A 1WX9A 3L13A 2LD9A 4IM3A 1WMHB 2KK8A 2BKRB 3B1LX 3AXCA 3EHVA 3ZRFA 1LM8B 2KLGA 2LWPA 1UBQA 1EF5A 3GOEA 3SHQA 1UH6A 1J19A 2L76A 2N7DA 5DPRA 5AZFA 1WY8A 2L7RA 2Z0EB 1RFAA 2UYZB 2LVOA 2D07B 2KD0A 3PHXB 4IWQA 3ZW3A 5G55A 2CHWA 3CMMB 1V86A 3GZNI 1KJTA 2LZ6A 3QQ8B 4TQ0A 3CSTA 5E6OA 3DBRI 3PLUA 4W9DA 5CHVC 2M8SA 2R2OA 1P3QU 3HM3A 2IZVB 2KJHB 4GGQA 2RGFA 3PVLA 2LRUA 2JRIB 2KWCA 4FHJA 3V6EB 4RM8A 4W9GA 3A33B 1A5RA 2KTRA 4MDKE 1L7YA 3PGEA 2V1YA 2C60A 2K8BA 2CHZA 3I3TB 5G2NA 2KWVB 4TUUA 3VTVA 3RD2A 1LFDA 4W9HA 4FULA 3TCAA 2DZMA 3IVFA 2MBOA 3PPAA 4KDIC 4BKSD 4DHJB 2LVQA 1UGMA 2MX2A 1NI2A 2RR9A 3A4RA 3V6CB 3VUYA 4KIKA 4HVBA 4MJSA 2ZNVB 3PSEB 3R7RA 4RM9A 2J7QB 5BO4B 5AZHA 2ZZPB 4ZRJA 2KOXA 3U7DA 4OVVA 3PLVA 1V6EA 2NBUA 2KJRA 1V9JA 3L17A 4BBNC 2CS4A 1TTNA 3DPDA 3QX1A 3H7SA 1UZXB 4PS3A 4OVUA 2IO3B 2ZNVC 3T8MA 2KDFB 2L3ZA 2REXA 1TGZB 3KH0A 4WJNA 3W1SA 1WJ6A 2O6VD 2WX0A 1NDDA 1YX6B 1K8RB 2JZZA 2HTHA 3A4SC 4JL9A 5FR6A 4MM3A 1YIWA 3U30A 5GMVA 4FHKA 3QCAA 5J2RA 3CF6E 2RSUA 1T0YA 3JVZX 3A1QA 4JIOU 2XK5A 2DZKA 1GJZA 3A9KA 3VUWA 3IG3A 3QAQA 2GBJA 2N7EA 4GOCA 4BBNF 1GNUA 1WI0A 3M63B 4IM2A 2KVRA 4ANUA 4LDTB 3JSVA 2IY1B 3RULA 3VQIA 2DENB 2GBKA 1WXVA 2KMCA 1GC7A 1P1AA 4BKTA 2IY0B 4IWOA 3UINB 2KFJA 2HJ8A 2M4NA 1IP9A 1I42A 4TQ1A 4GDLA 2JUOA 1U4AA 1WXMA 1E7VA 1R4MI 3KUCB 4GXBA 2ZVNA 1WE7A 4G11A 4E71A 1OQYA 2MBQA 1GG3A 4KZ0A 2IYDB 2JXXA 2PE9A 2BKFA 3RZWC 4ZRKA 3VAWA 4EZKA 2ZCBA 1EUVB 2N9PC 1WZ3A 4W9JA 2K8CA 2C7HA 4G0NB 1WM2A 4AOFA 2BYVE 2NR2A 2ZEQA 3H1UA 4EZLA 3NZSA 4LJPB 2LXAA 3ML8A 1WX8A 1Y8RC 1WZ0A 2BYFA 3PTFC 4MGKE 3L10B 4B6WA 2JF5A 4MEMA 2PPHA 2BF8B 1WFYA 3V60A 3ZKJC 4FJVB 1YJ1A 3VDZA 2BGFA 3PHWB 1WGRA 2KTRB 1ISNA 3R7QA 1Z2MA 3MTNB 1P0RA 3H7PA 2KMAA 4BVUC 3KVFB 3DDCB 4DK5A 1UBIA 4TV3A 2MBBB 4EZJA 1ZW7A 4FBJB 4F7ZA 2KO3A 5LXHA 4WAAA 3DVNV 4W9EA 5LLIA 1Q1OA 4WQOB 4DHZE 2KX0A 4DHJD 1E90A 2W9NA 2RPQA 3UQBA 4XX5A 5CHWA 2L8JA 3QC8B 4KIKB 2NS5A 4MJSB 2PE6B 1SE9A 1UD7A 1TBEA 3SDLC 3HK0A 3CSFA 3S2AA 4BOZB 1H8CA 1P9DU 2LASA 2C9WB 4ASWC 2KFKA 2NPTA 3RCZA 1X1MA 2KXJA 4CYEA 5JH5C 2FCSA 3H9DA 5J18A 3WAPA 4GMVA 2FUHB 2OJRA 2BWFA 4EKUA 2GOWA 3K9OB 3UQAA 2I1KA 2DAJA 4PS8A 2UWQA 4HDOA 1V5TA 1WJ4A 1LQBA 2J0KA 1UELA 1BT0A 2DZJA 3APCA 3N30A 4ZYNA 5DPWA 2YVCA 2CKHB 2C5LC 1VD2A 2QHOA 1V5OA 1Q0WB 2K1FA 2JVCA 2L00B 4IUMB 2G3QB 2CR5A 4PYUA 5HKHA 3IFWB 4WWNA 2YLMA 3VFKA 2AYOB 3A1QB 2XK5B 3W1SC 3A9KB 1EO6A 1TZ1A 1WF9A 4KVGB 4KSLC 4K81A 4NPNA 5DCNA 2CHXA 4GN1A 4II2B 4CHKA 3VHTC 2PJHA 4F8CB 2KDEB 2K25A 1E7UA 2LGDA 2M0XA 4NJ6A 3VH3B 4LDTD 3JSVB 5D2MB 3VUXA 2WYQA 3HIZA 4NQKE 2DYMA 1OEYA 1I35A 4KZCA 4P7IA 2LXCA 3NOBA 5J17A 2GMIC 2KNBA 3ZNHB 3AU4A 4GDLB 3RYTA 3TIXA 3ZTDA 2MLBA 1WH3A 2HD5B 2LVPA 5E6NA 4BOSC 4M8NA 1OGWA 2PEAA 1GUAB 2MCNB 1SIFA 4AJWA 2LGYA 3LDZE 3TL5A 3VTUA 4A3OA 3VTWA 2HE7A 1YX5B 4JLCA 4KV2A 5D94A 4HPMB 2J0MA 1F9JA 1OTRB 2AL3A 4GB9A 3ZRCA 2LGXA 4IG7B 4M0WB 2A4ZA 1OEYJ 2K6QA 3V61A 3QJZA 3AULA 4HXDA 4LJOB 2L0TA
chains in the Genus database with same CATH superfamily
1Z5SB 3NVWA 4AUQC 4KSKC 4MSQB 2OJWA 3Q3JA 2EMSA 2L1AA 4KX6B 4GIVA 4DDID 3RNGC 4URKA 1ZGUB 2KJ6A 4EOYA 2FCNA 1K53A 1SSNA 2JPHA 1XD3B 3PS6A 1WJNA 1WYGA 2IO0B 5IKCM 3I63C 2PTLA 2VRRB 1MHHE 1PDXA 1S1QB 3K9PB 1V49A 2L52A 3VH4B 1K52A 1N5XA 3P4QB 1CK1A 2BPSA 3JW0X 3AEEB 1AARA 1XT9B 1TS5A 1V2YA 1Y56A 2LGIA 3NUHB 3NHEB 1SGHA 2Z0DB 5E6PA 1C3TA 2FAZA 2Y5BB 5AEKB 4LNNA 2DZIA 3T9LA 2ZCCA 5BMGA 2IO1B 4BZAA 1JRPA 4HDQA 5FR3A 1F1HA 1C4PA 3Q3NC 4FN2A 2JWZA 3IT6B 1RM6C 3IHPC 3PRPB 4YTPB 2N9XA 4BKGA 2G4DB 4E74A 1WR1A 4WIPA 4AS1A 3EECA 3R66C 1ET6A 5JZEB 2KZRA 3BYTB 1E8WA 1OFFA 2FBWB 2EKEC 1DGJA 3ZXRA 1F2RC 1KF6B 1MHXA 2D2QA 1SIJA 3ZXVA 1J8CA 3BINA 1Q5WB 1V1OA 1FM0D 2ZPYA 4WJQA 3WA0A 2M17A 1WMHA 1N62A 1I4QA 1E8XA 3IAM1 2UU7A 1TYGB 5AUIA 1H4RA 5H8YE 1AW7A 1EWYC 3OG5A 4HLEA 4GDKB 2D3AA 4ANXA 3KUDB 3ZNZB 1EU4A 3NZ3A 5AUKA 2FCMA 4I6LB 3PRMB 2O2VB 3FILB 1J0GA 5EE0A 2ZVOA 1JMLA 4USAA 1B1ZA 5D3DA 4NQLB 2JY6A 5EDSA 5IA7A 3L54A 3KYDD 2RPVA 2V4LA 5L95C 2JRHA 3Q3OC 3TUOA 2MQJA 1IPGA 3VXWA 2PVOD 3BVGA 3VR9B 3RZFA 3NS8A 3ZJUA 4RFBA 1ET9A 2WXHA 3QHTA 3DVNU 5JXVA 2L05A 2VZKD 3IXSA 2AQ3B 2SEBD 4AP4C 1HXYD 2JT4B 1JCKB 4BFRA 1WE6A 1S3SG 3WCQA 3ZJVA 1WWTA 4L23A 3A9JB 1TS4A 1A70A 1I4XA 1FRRA 3OJ3A 3RUIB 3APDA 2J4XA 1E7PB 2MRPA 2WXQA 2LD9A 1V1PB 1UBQA 4C00A 1EF5A 1WRIA 2UYZB 4YSYB 2KD0A 3P4RB 3AN1A 3GZNI 1V86A 3ZYYX 5EE9A 3PLUA 1TY0A 2R2OA 3HM3A 2KJHB 1FO4A 3L4PA 2RGFA 3V6EB 4RM8A 2N9KA 3A33B 2KTRA 3PGEA 4JWSC 2K8BA 2CHZA 5G2NA 1ZE3D 4TUUA 4P6VF 4C4VB 2K22A 1JWBD 3IVFA 2LVQA 1TS2A 3V6CB 1D5MC 2ZNVB 2J7QB 2QDFA 3LXFA 4OVVA 2KYWA 1I4GA 2JSVX 1FCCC 2JU6X 1V9JA 1TTNA 4LLGM 3H7SA 2IO3B 3R2IA 1NENB 2KDFB 2L3ZA 2REXA 5BMIA 1WJ6A 1K8RB 2JZZA 2HTHA 4JL9A 4UDUC 2ON8A 2BB6A 1YIWA 5E6JA 2LMCA 5GMVA 1HTOA 3QCAA 5J2RA 2RSUA 1T0YA 2OEDA 4JIOU 1FNUA 3Q3MC 3QAQA 2WXRA 2WXLA 1B9RA 4IM2A 1TKYA 2DENB 3N20C 5C2TB 1YJIA 3I5JC 3KLSX 2HJ8A 2M4NA 2QCZA 4GDLA 2W3SA 2MBQA 3Q8CA 4KZ0A 2BKFA 4EZKA 1WZ3A 2K8CA 1FNVA 1FEHA 2C7HA 2NR2A 4EZLA 2LXAA 4OZBA 1WX8A 1Y8RC 4MT5A 2FE8A 1WZ0A 4MGKE 3L10B 1F52A 4B6WA 1YJ1A 3VDZA 2IJ0A 4DXFA 1XCQL 4WH4A 3R7QA 1Z2MA 3MTNB 4BVUC 3KVFB 3DDCB 4IOIE 1ZW7A 5LXHA 4ZYSA 1HZ6A 1I4HA 1Q1OA 3HVDA 5EE1A 5IP4D 4XX5A 4DXGA 2L8JA 4KIKB 2PE6B 1L0VB 1ZPSA 3SDLC 4ITKA 4BOZB 1SXTA 1P9DU 3ZQ4A 1TIFA 2ONQA 3RCZA 1MJDA 1X1MA 4L2YA 5JH5C 2FCSA 3MJ5A 2WLBA 2FUHB 2GOWA 2QEJC 2W55A 3APCA 3N30A 4ZYNA 2K5PA 2L00B 4IUMB 4ARIA 4PYUA 2MEKA 1ROEA 2H88B 2E3TA 1L4DB 2QSDA 5DCNA 4K81A 3EGRA 2K25A 1TY2A 5BYQA 3AE7B 1I35A 3CIRB 5HFYA 4M8NA 2RMMA 1SIFA 3LDZE 1UWMA 4RGTA 1KRHA 2J0MA 1C78A 1YN5A 1ZDXA 4IG7B 4M0WB 3T3OA 3V61A 2VH1A 4HXDA 4D2KA 1P7EA 4G3XB 4C7ZA 3TMPB 3DHHC 2WXGA 4ANWA 1SE3A 2CJNA 2RD0A 1WYWB 1WXQA 4N59A 4MGIE 4LNFA 3ZLZA 2D11A 2BYEA 2WXJA 2MW5A 2N1VA 3QARA 1XQQA 3TJPA 4ZOHC 4BAXA 2L32A 4AJYB 2J42A 3DCGA 4WWOA 1G6JA 2L83A 1XLPA 1Q10A 1YD8U 2K39A 2IDYA 4PK1A 1VZ6A 2MP2A 3RNBC 4ANVA 4ACFA 2JZ3B 1VDVA 3WAOA 4HJKA 1ZOYB 2GBMA 2IGGA 4KKIA 1WGHA 3M3JA 2VZKB 1YQBA 2K9XA 2K6DB 2I1JA 2LI5A 1KM7A 1SE4A 4MH0E 1WM3A 2LHDA 3BK2A 1E10A 4HCPB 1D4BA 5DPSA 4TSSA 1JQ4A 1FFVA 3V62A 4YT0B 3ONSA 1MVKA 4FJZA 3DBHB 3H6NA 2KQ7A 4N58A 2GBNA 4DHZB 2KN5A 1QQRA 3ML9A 3RN9C 5BYSA 4YSZB 3DVGX 4H2AA 3VR8B 3ENEA 2EKIA 4HEA1 3OLMD 3N1ZC 4CO7A 4N6EB 4HK2A 1N5WA 1RLFA 2C7MB 1FCLA 4I6NB 1L6VA 3ZNGC 3R2TA 4ZDVA 1PUTA 3AMZA 2G9HD 3DBSA 5D6JB 1QOFA 1WRDB 3VRBB 2MWSB 5KHQA 3PREA 1FPYA 2AX5A 1C9FA 3WAMA 1HA5A 1IYFA 1OQRA 1T3QA 3L0WB 2V4IB 4NAWB 3EFUA 4NJCA 4HCNB 5TR5A 3TBLD 1E5WA 3Q8BA 1P7FA 2FUG1 3EA6A 3WIMA 3AE4B 2FIFA 2KANA 1ZKHA 2KC1A 3KW5B 3OAWA 3DBLI 1NVID 1WX7A 3ZDTA 2KDIA 3I57A 1QOGA 4DXAB 2XEWA 4REZA 3V3XA 3DOWA 1XLOA 3C0RB 2LUMA 1JALA 2KX3A 1YJJA 4M8MA 3ZVVA 2NTTA 3DHGC 5C1ZA 2AEHA 5C23A 4NY0A 1IBXA 3VRAB 4EE2A 4FADA 2D3CA 4X57B 2Y3AA 4RMAA 3PZDA 4IKGA 3AEFB 3BY4B 4Q2JA 2J53A 4XDCA 1TS3A 4OVZA 2B3AA 3AI5A 2MBEA 4ZHOA 1CJEA 4IWPA 3ZJTA 4IM3A 4WQMA 1PYWD 3UI3A 3AXCA 1MG4A 1E9MA 5GXGB 3CWIA 1UH6A 1J19A 2L76A 2N7DA 2L7RA 2Z0EB 2W3RA 3PHXB 3QQ8B 1KJTA 3DBRI 2LFIA 1P3QU 2IZVB 4GGQA 3PVLA 5IN7A 2JRIB 4FHJA 1KTKA 5TSSA 4W9GA 2V1YA 2WP9B 3RD2A 1LFDA 4W9HA 4JWUC 4FULA 3TCAA 1DYQA 1GAQB 2DZMA 4KGTA 2AQ2B 2MBOA 3PPAA 4KDIC 1ZUD2 4GLSC 1L0XB 2RR9A 3A4RA 3VUYA 2GLSA 4HVBA 3TEYA 4ZRJA 2MJEA 3AH7A 3DPDA 3T8MA 3KH0A 5MPOA 1YX6B 5FR6A 4MM3A 1UNSA 5IOIA 1NEKB 4P16A 2XK5A 2DZKA 1GJZA 3A9KA 2BS3B 1C4AA 3IG3A 2N7EA 4GOCA 1WI0A 3RULA 3VQIA 2GBKA 1FD6A 3KQ4A 3LB8C 3I9V1 3UINB 1LGRA 2KDMA 1IP9A 4TQ1A 2JUOA 1U4AA 1E7VA 3KUCB 1OQYA 2JXXA 1J7AA 1RFKA 4ZRPA 4LK0M 4J3OD 2GRIA 2ZEQA 1FXIA 3ML8A 3ABVB 3DWGC 2BYFA 3PTFC 3R8BA 2KT7A 5LNK1 3ZKJC 4FJVB 2LGSA 3HRDD 3AV8A 4RNAA 2KMAA 2LHEA 1UBIA 1QILA 2MBBB 4FBJB 2KO3A 4WAAA 3DVNV 4W9EA 2WU5B 4OZAA 4DHZE 1ZXHA 2BTEA 4DHJD 1EU3A 3TEWA 4MJSB 3CSFA 4HRSA 3S2AA 3H8HA 3TEXA 3NVVA 4CYEA 1VZ8A 3WAPA 4GMVA 4EKUA 2BWFA 2H89B 4PS8A 2UWQA 1V5TA 1WJ4A 1LQBA 2DZJA 1R4MB 3EUB2 1VD2A 4HROA 2CR5A 5HKHA 2PW9A 4L1BA 3BWUD 3A1QB 4XE0A 1WSPA 1WF9A 4CHKA 3FC4A 2KDEB 2LGDA 2IGDA 4NJ6A 3LYYA 3JSVB 1DOXA 3VUXA 2QMTA 3P42A 2KACA 2LXCA 3ZNHB 3AU4A 3RYTA 3ZTDA 1WH3A 3PZ7A 2PEAA 1XF5L 1GUAB 2LGYA 2PVGC 1VRAB 5HG2A 3VTUA 3VTWA 2HE7A 4KV2A 5D94A 2BS2B 1OTRB 4A90A 2K6QA 1BUIC 4LJOB 2M56B 4NAMA 5KHOA 3O65B 5CX3A 3N32A 4EEWA 4RCOA 4S0RA 3QWZB 4EUTA 3ALBA 1WJUA 2M1MA 4PT5A 2G4SA 2NTSA 4K7SA 3H7PB 3E56A 4TKNA 4NJ7A 2KQ4X 2N0SB 4GDKA 5T8IA 5JHBA 4TMAB 4K7UA 4XYCA 2V0GA 2J0JA 3HHMA 4MELA 1VCBA 2O2VA 2KHWB 2IO2B 3FILA 1YOVB 3SU8X 1EWCA 2MHJA 3HM6X 1CMXB 2KFKB 2NPTB 2RDHA 4K1RB 2R2QA 3Q8AA 2WDTB 3J9CA 2MBHA 4JGHB 1L6UA 4B9KA 1LXDA 3W1YA 4BKSA 3NVZA 1VZ7A 2X38A 2ICIA 3MP9A 1WXSA 5CHFA 2MSED 3IBEA 3L16A 4CQNA 5DPTA 4PYZA 4W9IA 2DBYA 3MJWA 2V3SA 3UGBB 3DQVA 1ZP0B 4IW0A 3V05A 1STEA 1T0RC 4XZ4A 1GC6A 2O6VA 4W9KA 4YL8A 4WWPA 4II3B 3PRZA 1EM7A 4JQWC 3ZDMC 4DBGA 3Q3FA 2HJ1A 2K3UA 2INNE 5I4DA 2G1EA 4NZLB 4MSMB 1FMAD 4JX1C 1T6BX 3QA8A 2IBIB 5D7GA 2WXMA 3QK0A 1JWUD 2LJ5A 3A9JA 3KUZA 3R3MA 1YN4A 3P4SB 1E8YA 1K50A 3L08A 1D5ZC 3OWEB 2KC2A 1V1PA 1JWAD 4HPLB 4A20A 4GU2A 3U2SC 1UF0A 3VVWB 2MA9B 2KTFA 1JW9D 4M01A 3BVZA 4RF0A 2NMQA 1QF6A 2A5UA 1D3ZA 2DYBA 5G5GA 1XEEA 2XBBC 4EFOA 1M94A 3ZIMA 1I4RA 4ICVA 1MG8A 4DWFA 2RDBC 3UIPB 3N1YC 4US8A 2M0AA 2WX1A 4A3PA 4A8XC 5CTRC 4C4VA 4XGAB 2DX5B 3M62B 1YNTE 1L4ZB 2ASQA 3B0AA 4FA6A 1WGYA 2DYOA 4K3BA 3AM9A 4NNJB 5IAAC 4A55A 4MGYE 4A9AA 1PGXA 3B08A 4AWJA 4FLHA 1P98A 1JWMD 2KDBA 2NBVB 1FFUA 4ARCA 4K3CA 2AL6A 4QAYA 2GBRA 1WR6E 2KWDA 4GSWA 3WANA 2DHZA 1KLVA 2PMVA 4N9F4 1L5PA 2WS3B 2BB5A 4YTMB 1WXAA 2FIDA 4DDGD 1TKGA 3UF8A 3PT2B 4OW0A 3RNFC 3SD5A 1WX9A 1WMHB 3B1LX 2BKRB 1AWDA 3EHVA 3ZRFA 3BIID 2LWPA 1DOIA 3MC8A 4RGNA 1RFAA 4IWQA 3ZW3A 4YSXB 2CHWA 2INCC 2LZ6A 2Q5WD 2R61A 5HI1A 2N9LA 4ZHPA 2KWCA 2Y5CA 4OZCA 1YN3A 4MDKE 2C60A 3VTVA 3GP7A 1AN8A 1R4NB 2BQQA 2Y5PA 4DHJB 1UGMA 2MX2A 1NI2A 1PGAA 4KIKA 1D6EC 3R7RA 2WGSA 3P4PB 4RM9A 5BO4B 5AZHA 2ZZPB 4KGSA 3PLVA 1V6EA 2NBUA 3L17A 1E0ZA 4OVUA 1L0YB 3W1SA 3NRZA 2WX0A 4AQ7A 2WHIA 3NVYA 2DLBA 3CF6E 1QLBB 2JZPA 3JVZX 2GI9A 4B0EA 1ZXIA 2INDC 2Z8LA 1C4CA 4YTNB 4US9A 1GNUA 3M63B 3ZGZA 2V3PA 1HZ5A 1GC7A 1P1AA 4OHJA 4IWOA 1HTQA 1WXMA 4GXBA 4G11A 1WE7A 4E71A 2JWUA 1GG3A 3P1MA 1JROA 2PE9A 3C19A 4ZRKA 3HUIA 1EUVB 2WQYB 4W9JA 3RMKC 4G0NB 4AOFA 2BYVE 2WXFA 2PKOA 4M0WA 3NZSA 1GB1A 2JF5A 4MEMA 2BGFA 3PHWB 2CU3A 3MC9A 2I2YA 2KTRB 3BVMA 1ISNA 4WWMA 1P0RA 4WURA 3Q69A 4DK5A 4EZJA 2MJDA 1SB3C 3EFCA 2D3BA 4KKJA 4WQOB 3AEAB 2KX0A 2RPQA 3AB5A 3W5UB 1SE9A 1UD7A 3HK0A 3IAS1 1SJHD 2C9WB 3BYYB 1XLNA 2KXJA 1N60A 4C80A 5J18A 3UQAA 3K9OB 2I1KA 2DAJA 1FIQA 4HDOA 2J0KA 2V9HA 1UELA 2W54A 2YEPF 3U7ZA 1VLBA 1GB4A 2YVCA 2QHOA 1V5OA 1BMLC 2K1FA 2JVCA 4XWTA 2G3QB 3IFWB 4WWNA 3VFKA 4GN1A 4II2B 3C8YA 4F8CB 1E7UA 2M0XA 3VH3B 4LDTD 5D2MB 3Q2AC 2DWQA 1OEYA 1VJKA 4KZCA 2QJLA 5J17A 3KWLA 2BVCA 4GDLB 2QIEB 2LEKA 3TIXA 3RFZB 3O13A 3AE8B 5IO9A 2HD5B 2LVPA 5E6NA 2JXTA 4BOSC 1DOYA 2KMMA 3TL5A 4A3OA 1IGCA 4O1NA 1T5XD 1YX5B 4JLCA 4MH8A 4HKZE 2MH7A 4HPMB 3MHZA 2WXNA 4WAFA 3ZRCA 5D3IB 1OEYJ 1XCTL 1SBBB 3QJZA 3AULA 1F2RI 2L0TA 1UWXA 4P1CC 1GPXA 4C56C 3B9JA 3ETRA 3JYUA 2CU1A 2FCQA 2IPKD 3AE2B 2WXOA 1N6ZA 2TSSA 3ZTCA 1KOTA 2KKCA 3QIJA 3AE5B 1N61A 2ZJDA 1D5XC 3DBHI 2EMTA 3ECIA 5HHDG 3NZUA 2BWES 2VH2A 2AWTA 1GOZA 1PQSA 3X0WA 2O6VB 4NAWA 4W9CA 3NY5A 3ZO5B 4YXDB 3P63A 5BMHA 1XLQA 2L0FA 1FRDA 1WGDA 3X23A 1R4NI 3RNCC 1JRUA 2D5GA 2N1WA 2BYTA 1QOBA 1RYJA 3D32A 4WJPA 3DVGY 1ACCA 3DWMA 4W9FA 3Q6BA 2KAJA 3SR6A 3KWVA 4G50A 1C1YB 2K0PA 4KDLB 3M95A 1QZEA 2NBWB 1FNWA 3N1XC 4PS7A 3WALA 1TT5B 1FXAA 4K7WA 1M4VA 4MGZE 3SFEB 1V81A 2HDEA 2QILA 2OHFA 2JQRB 3APFA 1XXGA 2OOBB 3OJ4B 5JHAA 1I4PA 2DAFA 1C76A 1MPEA 1KLGD 1J7BA 3URYA 2NVUI 3ZNID 3AE1B 4IM0A 2KQSA 1NI3A 2BW2A 1FXTB 3MC0B 2JYTA 3Q8FA 1V80A 5AZGA 3TSSA 2WXPA 4HJGE 5C3JB 1HE8A 1E8ZA 1QT9A 4E3CA 3N3KB 3B2FA 2Z59B 2KLCA 1MFWA 1WGGA 1R7SA 2BS4B 3GE8C 1RAXA 4FJYA 3UIOB 3FAHA 4J6IA 2RDGA 4ZRIA 2D3GA 1NBFC 3MHSD 1KLUD 3RNEC 2N9EB 1PGBA 1SEBD 3PZ8A 4I6PA 2WU2B 4LTUA 3ZUNA 5L83A 5LXIB 4LNOA 1KH0A 4WJOA 1TJEA 3P2BA 4B95A 4B0MA 3AU5A 4ICUA 1TKEA 3NJTA 4LCDE 4KGRA 3RNAC 1HQRD 2C7NB 1E6EB 1V8CA 1EF1A 1CQVA 4RGOS 3U8ZA 2BBCA 1C77A 2FNJB 3LJ3A 3KYCD 3EC8A 1WIAA 1XO3A 2D10A 2MP2B 1T0QC 5FK9C 4W9LA 4HWIB 2LRWA 1F0ZA 2WWZA 3RT3B 2GB1A 2LUEA 2NCNA 2K8HA 3IT4B 3PV1A 4M02A 4IC7B 2JYEA 2WNMA 3Q14C 3AEGB 4HKQA 1YMHE 4XC2A 2ZPNA 5G5HA 4F1SA 3TEZA 1L2NA 1ZDVA 2G45B 2N4FA 4RF1A 1RRBA 2CJOA 2KWUB 2WDVB 2DNFA 3SFDB 3GB1A 1I7HA 3L13A 2KK8A 2SAKA 1LM8B 2KLGA 4HPPA 3GOEA 3SHQA 4JPSA 5DPRA 5AZFA 1WY8A 2N7JA 3DBLB 2LVOA 2D07B 2KN4A 1ESFA 2WDRB 1ENFA 5G55A 3GE3C 4A6QA 3CMMB 4ZRQA 4TQ0A 3MFGA 3CSTA 5E6OA 4W9DA 5CHVC 2M8SA 4XDDA 2LRUA 2AQ1B 2ZW0A 1A5RA 3NS1A 1J7CA 1L7YA 1NYQA 3AE9B 3I3TB 2KWVB 5FKAC 2WXIA 1YQ4B 1QOAA 1HEZE 4IDIA 4JE3B 4BKSD 4MJSA 3PSEB 2KOXA 3U7DA 4R3DA 1BXTA 3AEDB 3T3NA 3Q8EA 2KJRA 3AECB 4BBNC 2CS4A 1C79A 3QX1A 2PLPA 1UZXB 4PS3A 2INPE 2WDQB 3RPFC 4LNKA 2ZNVC 1TGZB 1V97A 4WJNA 4RH6A 2O6VD 1NDDA 3A4SC 1JWSD 3U30A 1OQQA 1IBXB 4FHKA 3W2DA 3AE6B 3A1QA 1PFDA 2ZW1A 4M00A 3VUWA 2GBJA 4BBNF 4P1BC 1TZOA 4C7YA 2KVRA 4ANUA 4LDTB 3JSVA 2IY1B 3DBRB 1WXVA 2KMCA 3HVZA 2JX5A 4BKTA 2WXKA 4S17A 2IY0B 2KFJA 1I42A 3AE3B 1R4MI 2ZVNA 4MACA 2LJIA 1AYFA 2M19A 2IYDB 3BZDB 3RZWC 2BT6A 3VAWA 3GS2A 2ZCBA 1KFYB 2N9PC 5BYRA 4RGMA 1WM2A 2W82A 1IGDA 3H1UA 4LJPB 5H92C 1VR9A 2PPHA 2BF8B 1WFYA 3V60A 4XWWA 2YEPB 1N63A 3N9YC 2MJ3A 1WGRA 2ACZB 3E9SA 3H7PA 4DQOC 4TV3A 3AEBB 4F7ZA 1WGKA 2KVZA 1MI0A 5LLIA 4FXCA 1LO5D 1E90A 2W9NA 3UQBA 5CHWA 2EELA 3QC8B 2NS5A 5EE3A 3FKYA 1TBEA 2B76B 1H8CA 2PIAA 3W9CB 2LASA 3DHIC 2KFKA 2I38A 2NPTA 1CZPA 1UGJA 4ASWC 1YQ3B 1SF0A 3BK1A 3H9DA 2OJRA 1QKZA 2XNAC 2J52A 1F77A 2E6XA 2V3NA 1BT0A 4MM3B 3B2GA 5DPWA 1IUEA 2CKHB 2C5LC 1Q0WB 2YLMA 2AYOB 4YWGG 2XK5B 3W1SC 4LNIA 3A9KB 1EO6A 1UUPA 2HTME 1TZ1A 4KVGB 4NPNA 1T0SC 2IGHA 4KSLC 2CHXA 3SEBA 3VHTC 2PJHA 1K51A 2WYQA 3HIZA 4NQKE 2DYMA 2QC8A 1SE2A 4P7IA 3NOBA 1RWSA 2GMIC 2KNBA 2XN9C 1NYRA 2MLBA 1OGWA 2MCNB 4AJWA 3W5VB 3U52E 3PO0A 1F9JA 2AL3A 1SJED 4GB9A 2LGXA 2A4ZA 3RI7C 3U4EG 3NG0A 3GZNB 2X8XX
chains in the Genus database with same CATH topology
1Z5SB 4G3XB 4AUQC 5KHOA 4KSKC 4MSQB 3O65B 3Q3JA 5CX3A 3N32A 3TMPB 4EEWA 2EMSA 3JYUA 2CU1A 2FCQA 4ANWA 3QWZB 4EUTA 3ALBA 4GIVA 1WJUA 4DDID 2M1MA 4URKA 2G4SA 4K7SA 3H7PB 1ZGUB 2KJ6A 3ZTCA 4TKNA 2KKCA 2FCNA 4EOYA 4NJ7A 1KOTA 2JPHA 1XD3B 1WYWB 2RD0A 3PS6A 1WJNA 3QIJA 4MGIE 2IO0B 4GDKA 3ZLZA 2ZJDA 5JHBA 3DBHI 2D11A 2EMTA 3ECIA 4K7UA 3NZUA 2BWES 2BYEA 2J0JA 2MW5A 3HHMA 2N1VA 2AWTA 1VCBA 4MELA 2O2VA 2KHWB 2IO2B 3QARA 1XQQA 2VRRB 1PQSA 1S1QB 3K9PB 3SU8X 3TJPA 3X0WA 3HM6X 1CMXB 1V49A 2KFKB 2NPTB 2O6VB 4NAWA 4W9CA 4K1RB 3NY5A 3VH4B 2R2QA 3ZO5B 4AJYB 2WDTB 2BPSA 2MBHA 2L0FA 3DCGA 1WGDA 4JGHB 4WWOA 1R4NI 3X23A 3JW0X 4B9KA 1G6JA 1JRUA 2N1WA 1AARA 1LXDA 3W1YA 4BKSA 1XT9B 1V2YA 3NHEB 1YD8U 3D32A 1WXSA 4WJPA 5CHFA 2MSED 2K39A 3DVGY 3IBEA 1SGHA 3L16A 4W9FA 2Z0DB 5E6PA 1C3TA 2FAZA 2Y5BB 5AEKB 4G50A 1C1YB 4KDLB 5DPTA 4PYZA 3M95A 1QZEA 4W9IA 2NBWB 3MJWA 4PS7A 2V3SA 3WALA 2DZIA 3UGBB 2MP2A 3DQVA 3T9LA 2ZCCA 4IW0A 2IO1B 4ANVA 2JZ3B 4HDQA 4K7WA 3WAOA 4HJKA 4MGZE 2GBMA 4FN2A 2JWZA 4XZ4A 1V81A 1GC6A 3IHPC 3PRPB 2O6VA 1WGHA 2N9XA 4W9KA 4YL8A 2G4DB 4BKGA 3APFA 4WWPA 3M3JA 4II3B 3PRZA 4E74A 1WR1A 2OOBB 1YQBA 4JQWC 3OJ4B 3ZDMC 3EECA 2K6DB 2I1JA 2LI5A 3Q3FA 3R66C 4DBGA 5JHAA 5JZEB 2KZRA 1KM7A 4MH0E 1WM3A 1E8WA 2DAFA 2EKEC 4MSMB 4HCPB 2NVUI 2IBIB 3QA8A 3ZNID 5DPSA 5D7GA 4IM0A 3QK0A 2KQSA 2D2QA 2LJ5A 1FXTB 3V62A 3ONSA 3A9JA 4FJZA 3BINA 3H6NA 1V80A 3KUZA 1Q5WB 2KQ7A 3R3MA 5AZGA 1J8CA 1E8YA 2GBNA 4DHZB 1HE8A 2KN5A 1E8ZA 3L08A 4E3CA 3N3KB 3ML9A 2ZPYA 4WJQA 3DVGX 3ENEA 3WA0A 2M17A 2KC2A 2Z59B 4HPLB 3OLMD 4A20A 1WMHA 2KLCA 4GU2A 4CO7A 1WGGA 4HK2A 1RAXA 4FJYA 1RLFA 3VVWB 3UIOB 2C7MB 1E8XA 2MA9B 4I6NB 4J6IA 3ZNGC 2KTFA 4ZDVA 4ZRIA 1H4RA 2D3GA 1NBFC 3MHSD 3DBSA 5D6JB 1WRDB 2N9EB 4HLEA 2A5UA 4GDKB 1D3ZA 4ANXA 3KUDB 2DYBA 3ZNZB 2MWSB 2FCMA 2XBBC 4I6PA 4EFOA 3PREA 5KHQA 1M94A 4I6LB 3PRMB 3ZUNA 3ZIMA 2O2VB 5L83A 3WAMA 4ICVA 5LXIB 1IYFA 1J0GA 1MG8A 4DWFA 3UIPB 2ZVOA 3L0WB 4NAWB 4WJOA 2WX1A 3EFUA 4A3PA 4HCNB 5TR5A 3P2BA 3TBLD 4B95A 1E5WA 3AU5A 4ICUA 4NQLB 2JY6A 5CTRC 5EDSA 5IA7A 2DX5B 3M62B 4LCDE 3L54A 3WIMA 2C7NB 2ASQA 2FIFA 2KANA 3KYDD 2V4LA 1ZKHA 5L95C 2KC1A 3KW5B 3OAWA 1EF1A 2JRHA 3DBLI 3U8ZA 1WX7A 3B0AA 1WGYA 3ZDTA 4FA6A 2DYOA 2KDIA 2MQJA 2FNJB 1IPGA 3VXWA 4DXAB 3LJ3A 2XEWA 3KYCD 3RZFA 3DOWA 3C0RB 3NS8A 4NNJB 5IAAC 2KX3A 3EC8A 1WIAA 2D10A 2MP2B 4MGYE 4W9LA 4HWIB 2LRWA 2WWZA 3B08A 3RT3B 4AWJA 4FLHA 2LUEA 4M8MA 1P98A 3QHTA 2NCNA 3ZVVA 2K8HA 2KDBA 2NBVB 3DVNU 3PV1A 2L05A 5C1ZA 4IC7B 2AEHA 5C23A 4NY0A 2AL6A 2GBRA 4AP4C 1WR6E 2JT4B 4FADA 4GSWA 4X57B 4RMAA 4BFRA 3PZDA 1WE6A 4XC2A 3BY4B 3WANA 2DHZA 2ZPNA 1KLVA 1S3SG 4F1SA 4N9F4 1L2NA 2B3AA 3A9JB 2G45B 2N4FA 3AI5A 1RRBA 2MBEA 3OJ3A 1WXAA 2KWUB 3RUIB 3APDA 2FIDA 4DDGD 3UF8A 2MRPA 3PT2B 4IWPA 3SD5A 1WX9A 3L13A 2LD9A 4IM3A 1WMHB 2KK8A 2BKRB 3B1LX 3AXCA 3EHVA 3ZRFA 1LM8B 2KLGA 2LWPA 1UBQA 1EF5A 3GOEA 3SHQA 1UH6A 1J19A 2L76A 2N7DA 5DPRA 5AZFA 1WY8A 2L7RA 2Z0EB 1RFAA 2UYZB 2LVOA 2D07B 2KD0A 3PHXB 4IWQA 3ZW3A 5G55A 2CHWA 3CMMB 1V86A 3GZNI 1KJTA 2LZ6A 3QQ8B 4TQ0A 3CSTA 5E6OA 3DBRI 3PLUA 4W9DA 5CHVC 2M8SA 2R2OA 1P3QU 3HM3A 2IZVB 2KJHB 4GGQA 2RGFA 3PVLA 2LRUA 2JRIB 2KWCA 4FHJA 3V6EB 4RM8A 4W9GA 3A33B 1A5RA 2KTRA 4MDKE 1L7YA 3PGEA 2V1YA 2C60A 2K8BA 2CHZA 3I3TB 5G2NA 2KWVB 4TUUA 3VTVA 3RD2A 1LFDA 4W9HA 4FULA 3TCAA 2DZMA 3IVFA 2MBOA 3PPAA 4KDIC 4BKSD 4DHJB 2LVQA 1UGMA 2MX2A 1NI2A 2RR9A 3A4RA 3V6CB 3VUYA 4KIKA 4HVBA 4MJSA 2ZNVB 3PSEB 3R7RA 4RM9A 2J7QB 5BO4B 5AZHA 2ZZPB 4ZRJA 2KOXA 3U7DA 4OVVA 3PLVA 1V6EA 2NBUA 2KJRA 1V9JA 3L17A 4BBNC 2CS4A 1TTNA 3DPDA 3QX1A 3H7SA 1UZXB 4PS3A 4OVUA 2IO3B 2ZNVC 3T8MA 2KDFB 2L3ZA 2REXA 1TGZB 3KH0A 4WJNA 3W1SA 1WJ6A 2O6VD 2WX0A 1NDDA 1YX6B 1K8RB 2JZZA 2HTHA 3A4SC 4JL9A 5FR6A 4MM3A 1YIWA 3U30A 5GMVA 4FHKA 3QCAA 5J2RA 3CF6E 2RSUA 1T0YA 3JVZX 3A1QA 4JIOU 2XK5A 2DZKA 1GJZA 3A9KA 3VUWA 3IG3A 3QAQA 2GBJA 2N7EA 4GOCA 4BBNF 1GNUA 1WI0A 3M63B 4IM2A 2KVRA 4ANUA 4LDTB 3JSVA 2IY1B 3RULA 3VQIA 2DENB 2GBKA 1WXVA 2KMCA 1GC7A 1P1AA 4BKTA 2IY0B 4IWOA 3UINB 2KFJA 2HJ8A 2M4NA 1IP9A 1I42A 4TQ1A 4GDLA 2JUOA 1U4AA 1WXMA 1E7VA 1R4MI 3KUCB 4GXBA 2ZVNA 1WE7A 4G11A 4E71A 1OQYA 2MBQA 1GG3A 4KZ0A 2IYDB 2JXXA 2PE9A 2BKFA 3RZWC 4ZRKA 3VAWA 4EZKA 2ZCBA 1EUVB 2N9PC 1WZ3A 4W9JA 2K8CA 2C7HA 4G0NB 1WM2A 4AOFA 2BYVE 2NR2A 2ZEQA 3H1UA 4EZLA 3NZSA 4LJPB 2LXAA 3ML8A 1WX8A 1Y8RC 1WZ0A 2BYFA 3PTFC 4MGKE 3L10B 4B6WA 2JF5A 4MEMA 2PPHA 2BF8B 1WFYA 3V60A 3ZKJC 4FJVB 1YJ1A 3VDZA 2BGFA 3PHWB 1WGRA 2KTRB 1ISNA 3R7QA 1Z2MA 3MTNB 1P0RA 3H7PA 2KMAA 4BVUC 3KVFB 3DDCB 4DK5A 1UBIA 4TV3A 2MBBB 4EZJA 1ZW7A 4FBJB 4F7ZA 2KO3A 5LXHA 4WAAA 3DVNV 4W9EA 5LLIA 1Q1OA 4WQOB 4DHZE 2KX0A 4DHJD 1E90A 2W9NA 2RPQA 3UQBA 4XX5A 5CHWA 2L8JA 3QC8B 4KIKB 2NS5A 4MJSB 2PE6B 1SE9A 1UD7A 1TBEA 3SDLC 3HK0A 3CSFA 3S2AA 4BOZB 1H8CA 1P9DU 2LASA 2C9WB 4ASWC 2KFKA 2NPTA 3RCZA 1X1MA 2KXJA 4CYEA 5JH5C 2FCSA 3H9DA 5J18A 3WAPA 4GMVA 2FUHB 2OJRA 2BWFA 4EKUA 2GOWA 3K9OB 3UQAA 2I1KA 2DAJA 4PS8A 2UWQA 4HDOA 1V5TA 1WJ4A 1LQBA 2J0KA 1UELA 1BT0A 2DZJA 3APCA 3N30A 4ZYNA 5DPWA 2YVCA 2CKHB 2C5LC 1VD2A 2QHOA 1V5OA 1Q0WB 2K1FA 2JVCA 2L00B 4IUMB 2G3QB 2CR5A 4PYUA 5HKHA 3IFWB 4WWNA 2YLMA 3VFKA 2AYOB 3A1QB 2XK5B 3W1SC 3A9KB 1EO6A 1TZ1A 1WF9A 4KVGB 4KSLC 4K81A 4NPNA 5DCNA 2CHXA 4GN1A 4II2B 4CHKA 3VHTC 2PJHA 4F8CB 2KDEB 2K25A 1E7UA 2LGDA 2M0XA 4NJ6A 3VH3B 4LDTD 3JSVB 5D2MB 3VUXA 2WYQA 3HIZA 4NQKE 2DYMA 1OEYA 1I35A 4KZCA 4P7IA 2LXCA 3NOBA 5J17A 2GMIC 2KNBA 3ZNHB 3AU4A 4GDLB 3RYTA 3TIXA 3ZTDA 2MLBA 1WH3A 2HD5B 2LVPA 5E6NA 4BOSC 4M8NA 1OGWA 2PEAA 1GUAB 2MCNB 1SIFA 4AJWA 2LGYA 3LDZE 3TL5A 3VTUA 4A3OA 3VTWA 2HE7A 1YX5B 4JLCA 4KV2A 5D94A 4HPMB 2J0MA 1F9JA 1OTRB 2AL3A 4GB9A 3ZRCA 2LGXA 4IG7B 4M0WB 2A4ZA 1OEYJ 2K6QA 3V61A 3QJZA 3AULA 4HXDA 4LJOB 2L0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5S B;  4G3X B;  4AUQ C;  5KHO A;  4KSK C;  4MSQ B;  3O65 B;  3Q3J A;  5CX3 A;  3N32 A;  3TMP B;  4EEW A;  2EMS A;  3JYU A;  2CU1 A;  2FCQ A;  4ANW A;  3QWZ B;  4EUT A;  3ALB A;  4GIV A;  1WJU A;  4DDI D;  2M1M A;  4URK A;  2G4S A;  4K7S A;  3H7P B;  1ZGU B;  2KJ6 A;  3ZTC A;  4TKN A;  2KKC A;  2FCN A;  4EOY A;  4NJ7 A;  1KOT A;  2JPH A;  1XD3 B;  1WYW B;  2RD0 A;  3PS6 A;  1WJN A;  3QIJ A;  4MGI E;  2IO0 B;  4GDK A;  3ZLZ A;  2ZJD A;  5JHB A;  3DBH I;  2D11 A;  2EMT A;  3ECI A;  4K7U A;  3NZU A;  2BWE S;  2BYE A;  2J0J A;  2MW5 A;  3HHM A;  2N1V A;  2AWT A;  1VCB A;  4MEL A;  2O2V A;  2KHW B;  2IO2 B;  3QAR A;  1XQQ A;  2VRR B;  1PQS A;  1S1Q B;  3K9P B;  3SU8 X;  3TJP A;  3X0W A;  3HM6 X;  1CMX B;  1V49 A;  2KFK B;  2NPT B;  2O6V B;  4NAW A;  4W9C A;  4K1R B;  3NY5 A;  3VH4 B;  2R2Q A;  3ZO5 B;  4AJY B;  2WDT B;  2BPS A;  2MBH A;  2L0F A;  3DCG A;  1WGD A;  4JGH B;  4WWO A;  1R4N I;  3X23 A;  3JW0 X;  4B9K A;  1G6J A;  1JRU A;  2N1W A;  1AAR A;  1LXD A;  3W1Y A;  4BKS A;  1XT9 B;  1V2Y A;  3NHE B;  1YD8 U;  3D32 A;  1WXS A;  4WJP A;  5CHF A;  2MSE D;  2K39 A;  3DVG Y;  3IBE A;  1SGH A;  3L16 A;  4W9F A;  2Z0D B;  5E6P A;  1C3T A;  2FAZ A;  2Y5B B;  5AEK B;  4G50 A;  1C1Y B;  4KDL B;  5DPT A;  4PYZ A;  3M95 A;  1QZE A;  4W9I A;  2NBW B;  3MJW A;  4PS7 A;  2V3S A;  3WAL A;  2DZI A;  3UGB B;  2MP2 A;  3DQV A;  3T9L A;  2ZCC A;  4IW0 A;  2IO1 B;  4ANV A;  2JZ3 B;  4HDQ A;  4K7W A;  3WAO A;  4HJK A;  4MGZ E;  2GBM A;  4FN2 A;  2JWZ A;  4XZ4 A;  1V81 A;  1GC6 A;  3IHP C;  3PRP B;  2O6V A;  1WGH A;  2N9X A;  4W9K A;  4YL8 A;  2G4D B;  4BKG A;  3APF A;  4WWP A;  3M3J A;  4II3 B;  3PRZ A;  4E74 A;  1WR1 A;  2OOB B;  1YQB A;  4JQW C;  3OJ4 B;  3ZDM C;  3EEC A;  2K6D B;  2I1J A;  2LI5 A;  3Q3F A;  3R66 C;  4DBG A;  5JHA A;  5JZE B;  2KZR A;  1KM7 A;  4MH0 E;  1WM3 A;  1E8W A;  2DAF A;  2EKE C;  4MSM B;  4HCP B;  2NVU I;  2IBI B;  3QA8 A;  3ZNI D;  5DPS A;  5D7G A;  4IM0 A;  3QK0 A;  2KQS A;  2D2Q A;  2LJ5 A;  1FXT B;  3V62 A;  3ONS A;  3A9J A;  4FJZ A;  3BIN A;  3H6N A;  1V80 A;  3KUZ A;  1Q5W B;  2KQ7 A;  3R3M A;  5AZG A;  1J8C A;  1E8Y A;  2GBN A;  4DHZ B;  1HE8 A;  2KN5 A;  1E8Z A;  3L08 A;  4E3C A;  3N3K B;  3ML9 A;  2ZPY A;  4WJQ A;  3DVG X;  3ENE A;  3WA0 A;  2M17 A;  2KC2 A;  2Z59 B;  4HPL B;  3OLM D;  4A20 A;  1WMH A;  2KLC A;  4GU2 A;  4CO7 A;  1WGG A;  4HK2 A;  1RAX A;  4FJY A;  1RLF A;  3VVW B;  3UIO B;  2C7M B;  1E8X A;  2MA9 B;  4I6N B;  4J6I A;  3ZNG C;  2KTF A;  4ZDV A;  4ZRI A;  1H4R A;  2D3G A;  1NBF C;  3MHS D;  3DBS A;  5D6J B;  1WRD B;  2N9E B;  4HLE A;  2A5U A;  4GDK B;  1D3Z A;  4ANX A;  3KUD B;  2DYB A;  3ZNZ B;  2MWS B;  2FCM A;  2XBB C;  4I6P A;  4EFO A;  3PRE A;  5KHQ A;  1M94 A;  4I6L B;  3PRM B;  3ZUN A;  3ZIM A;  2O2V B;  5L83 A;  3WAM A;  4ICV A;  5LXI B;  1IYF A;  1J0G A;  1MG8 A;  4DWF A;  3UIP B;  2ZVO A;  3L0W B;  4NAW B;  4WJO A;  2WX1 A;  3EFU A;  4A3P A;  4HCN B;  5TR5 A;  3P2B A;  3TBL D;  4B95 A;  1E5W A;  3AU5 A;  4ICU A;  4NQL B;  2JY6 A;  5CTR C;  5EDS A;  5IA7 A;  2DX5 B;  3M62 B;  4LCD E;  3L54 A;  3WIM A;  2C7N B;  2ASQ A;  2FIF A;  2KAN A;  3KYD D;  2V4L A;  1ZKH A;  5L95 C;  2KC1 A;  3KW5 B;  3OAW A;  1EF1 A;  2JRH A;  3DBL I;  3U8Z A;  1WX7 A;  3B0A A;  1WGY A;  3ZDT A;  4FA6 A;  2DYO A;  2KDI A;  2MQJ A;  2FNJ B;  1IPG A;  3VXW A;  4DXA B;  3LJ3 A;  2XEW A;  3KYC D;  3RZF A;  3DOW A;  3C0R B;  3NS8 A;  4NNJ B;  5IAA C;  2KX3 A;  3EC8 A;  1WIA A;  2D10 A;  2MP2 B;  4MGY E;  4W9L A;  4HWI B;  2LRW A;  2WWZ A;  3B08 A;  3RT3 B;  4AWJ A;  4FLH A;  2LUE A;  4M8M A;  1P98 A;  3QHT A;  2NCN A;  3ZVV A;  2K8H A;  2KDB A;  2NBV B;  3DVN U;  3PV1 A;  2L05 A;  5C1Z A;  4IC7 B;  2AEH A;  5C23 A;  4NY0 A;  2AL6 A;  2GBR A;  4AP4 C;  1WR6 E;  2JT4 B;  4FAD A;  4GSW A;  4X57 B;  4RMA A;  4BFR A;  3PZD A;  1WE6 A;  4XC2 A;  3BY4 B;  3WAN A;  2DHZ A;  2ZPN A;  1KLV A;  1S3S G;  4F1S A;  4N9F 4;  1L2N A;  2B3A A;  3A9J B;  2G45 B;  2N4F A;  3AI5 A;  1RRB A;  2MBE A;  3OJ3 A;  1WXA A;  2KWU B;  3RUI B;  3APD A;  2FID A;  4DDG D;  3UF8 A;  2MRP A;  3PT2 B;  4IWP A;  3SD5 A;  1WX9 A;  3L13 A;  2LD9 A;  4IM3 A;  1WMH B;  2KK8 A;  2BKR B;  3B1L X;  3AXC A;  3EHV A;  3ZRF A;  1LM8 B;  2KLG A;  2LWP A;  1UBQ A;  1EF5 A;  3GOE A;  3SHQ A;  1UH6 A;  1J19 A;  2L76 A;  2N7D A;  5DPR A;  5AZF A;  1WY8 A;  2L7R A;  2Z0E B;  1RFA A;  2UYZ B;  2LVO A;  2D07 B;  2KD0 A;  3PHX B;  4IWQ A;  3ZW3 A;  5G55 A;  2CHW A;  3CMM B;  1V86 A;  3GZN I;  1KJT A;  2LZ6 A;  3QQ8 B;  4TQ0 A;  3CST A;  5E6O A;  3DBR I;  3PLU A;  4W9D A;  5CHV C;  2M8S A;  2R2O A;  1P3Q U;  3HM3 A;  2IZV B;  2KJH B;  4GGQ A;  2RGF A;  3PVL A;  2LRU A;  2JRI B;  2KWC A;  4FHJ A;  3V6E B;  4RM8 A;  4W9G A;  3A33 B;  1A5R A;  2KTR A;  4MDK E;  1L7Y A;  3PGE A;  2V1Y A;  2C60 A;  2K8B A;  2CHZ A;  3I3T B;  5G2N A;  2KWV B;  4TUU A;  3VTV A;  3RD2 A;  1LFD A;  4W9H A;  4FUL A;  3TCA A;  2DZM A;  3IVF A;  2MBO A;  3PPA A;  4KDI C;  4BKS D;  4DHJ B;  2LVQ A;  1UGM A;  2MX2 A;  1NI2 A;  2RR9 A;  3A4R A;  3V6C B;  3VUY A;  4KIK A;  4HVB A;  4MJS A;  2ZNV B;  3PSE B;  3R7R A;  4RM9 A;  2J7Q B;  5BO4 B;  5AZH A;  2ZZP B;  4ZRJ A;  2KOX A;  3U7D A;  4OVV A;  3PLV A;  1V6E A;  2NBU A;  2KJR A;  1V9J A;  3L17 A;  4BBN C;  2CS4 A;  1TTN A;  3DPD A;  3QX1 A;  3H7S A;  1UZX B;  4PS3 A;  4OVU A;  2IO3 B;  2ZNV C;  3T8M A;  2KDF B;  2L3Z A;  2REX A;  1TGZ B;  3KH0 A;  4WJN A;  3W1S A;  1WJ6 A;  2O6V D;  2WX0 A;  1NDD A;  1YX6 B;  1K8R B;  2JZZ A;  2HTH A;  3A4S C;  4JL9 A;  5FR6 A;  4MM3 A;  1YIW A;  3U30 A;  5GMV A;  4FHK A;  3QCA A;  5J2R A;  3CF6 E;  2RSU A;  1T0Y A;  3JVZ X;  3A1Q A;  4JIO U;  2XK5 A;  2DZK A;  1GJZ A;  3A9K A;  3VUW A;  3IG3 A;  3QAQ A;  2GBJ A;  2N7E A;  4GOC A;  4BBN F;  1GNU A;  1WI0 A;  3M63 B;  4IM2 A;  2KVR A;  4ANU A;  4LDT B;  3JSV A;  2IY1 B;  3RUL A;  3VQI A;  2DEN B;  2GBK A;  1WXV A;  2KMC A;  1GC7 A;  1P1A A;  4BKT A;  2IY0 B;  4IWO A;  3UIN B;  2KFJ A;  2HJ8 A;  2M4N A;  1IP9 A;  1I42 A;  4TQ1 A;  4GDL A;  2JUO A;  1U4A A;  1WXM A;  1E7V A;  1R4M I;  3KUC B;  4GXB A;  2ZVN A;  1WE7 A;  4G11 A;  4E71 A;  1OQY A;  2MBQ A;  1GG3 A;  4KZ0 A;  2IYD B;  2JXX A;  2PE9 A;  2BKF A;  3RZW C;  4ZRK A;  3VAW A;  4EZK A;  2ZCB A;  1EUV B;  2N9P C;  1WZ3 A;  4W9J A;  2K8C A;  2C7H A;  4G0N B;  1WM2 A;  4AOF A;  2BYV E;  2NR2 A;  2ZEQ A;  3H1U A;  4EZL A;  3NZS A;  4LJP B;  2LXA A;  3ML8 A;  1WX8 A;  1Y8R C;  1WZ0 A;  2BYF A;  3PTF C;  4MGK E;  3L10 B;  4B6W A;  2JF5 A;  4MEM A;  2PPH A;  2BF8 B;  1WFY A;  3V60 A;  3ZKJ C;  4FJV B;  1YJ1 A;  3VDZ A;  2BGF A;  3PHW B;  1WGR A;  2KTR B;  1ISN A;  3R7Q A;  1Z2M A;  3MTN B;  1P0R A;  3H7P A;  2KMA A;  4BVU C;  3KVF B;  3DDC B;  4DK5 A;  1UBI A;  4TV3 A;  2MBB B;  4EZJ A;  1ZW7 A;  4FBJ B;  4F7Z A;  2KO3 A;  5LXH A;  4WAA A;  3DVN V;  4W9E A;  5LLI A;  1Q1O A;  4WQO B;  4DHZ E;  2KX0 A;  4DHJ D;  1E90 A;  2W9N A;  2RPQ A;  3UQB A;  4XX5 A;  5CHW A;  2L8J A;  3QC8 B;  4KIK B;  2NS5 A;  4MJS B;  2PE6 B;  1SE9 A;  1UD7 A;  1TBE A;  3SDL C;  3HK0 A;  3CSF A;  3S2A A;  4BOZ B;  1H8C A;  1P9D U;  2LAS A;  2C9W B;  4ASW C;  2KFK A;  2NPT A;  3RCZ A;  1X1M A;  2KXJ A;  4CYE A;  5JH5 C;  2FCS A;  3H9D A;  5J18 A;  3WAP A;  4GMV A;  2FUH B;  2OJR A;  2BWF A;  4EKU A;  2GOW A;  3K9O B;  3UQA A;  2I1K A;  2DAJ A;  4PS8 A;  2UWQ A;  4HDO A;  1V5T A;  1WJ4 A;  1LQB A;  2J0K A;  1UEL A;  1BT0 A;  2DZJ A;  3APC A;  3N30 A;  4ZYN A;  5DPW A;  2YVC A;  2CKH B;  2C5L C;  1VD2 A;  2QHO A;  1V5O A;  1Q0W B;  2K1F A;  2JVC A;  2L00 B;  4IUM B;  2G3Q B;  2CR5 A;  4PYU A;  5HKH A;  3IFW B;  4WWN A;  2YLM A;  3VFK A;  2AYO B;  3A1Q B;  2XK5 B;  3W1S C;  3A9K B;  1EO6 A;  1TZ1 A;  1WF9 A;  4KVG B;  4KSL C;  4K81 A;  4NPN A;  5DCN A;  2CHX A;  4GN1 A;  4II2 B;  4CHK A;  3VHT C;  2PJH A;  4F8C B;  2KDE B;  2K25 A;  1E7U A;  2LGD A;  2M0X A;  4NJ6 A;  3VH3 B;  4LDT D;  3JSV B;  5D2M B;  3VUX A;  2WYQ A;  3HIZ A;  4NQK E;  2DYM A;  1OEY A;  1I35 A;  4KZC A;  4P7I A;  2LXC A;  3NOB A;  5J17 A;  2GMI C;  2KNB A;  3ZNH B;  3AU4 A;  4GDL B;  3RYT A;  3TIX A;  3ZTD A;  2MLB A;  1WH3 A;  2HD5 B;  2LVP A;  5E6N A;  4BOS C;  4M8N A;  1OGW A;  2PEA A;  1GUA B;  2MCN B;  1SIF A;  4AJW A;  2LGY A;  3LDZ E;  3TL5 A;  3VTU A;  4A3O A;  3VTW A;  2HE7 A;  1YX5 B;  4JLC A;  4KV2 A;  5D94 A;  4HPM B;  2J0M A;  1F9J A;  1OTR B;  2AL3 A;  4GB9 A;  3ZRC A;  2LGX A;  4IG7 B;  4M0W B;  2A4Z A;  1OEY J;  2K6Q A;  3V61 A;  3QJZ A;  3AUL A;  4HXD A;  4LJO B;  2L0T A; 
#chains in the Genus database with same CATH topology
 1Z5S B;  3NVW A;  4AUQ C;  4KSK C;  4MSQ B;  2OJW A;  3Q3J A;  2EMS A;  2L1A A;  4KX6 B;  4GIV A;  4DDI D;  3RNG C;  4URK A;  1ZGU B;  2KJ6 A;  4EOY A;  2FCN A;  1K53 A;  1SSN A;  2JPH A;  1XD3 B;  3PS6 A;  1WJN A;  1WYG A;  2IO0 B;  5IKC M;  3I63 C;  2PTL A;  2VRR B;  1MHH E;  1PDX A;  1S1Q B;  3K9P B;  1V49 A;  2L52 A;  3VH4 B;  1K52 A;  1N5X A;  3P4Q B;  1CK1 A;  2BPS A;  3JW0 X;  3AEE B;  1AAR A;  1XT9 B;  1TS5 A;  1V2Y A;  1Y56 A;  2LGI A;  3NUH B;  3NHE B;  1SGH A;  2Z0D B;  5E6P A;  1C3T A;  2FAZ A;  2Y5B B;  5AEK B;  4LNN A;  2DZI A;  3T9L A;  2ZCC A;  5BMG A;  2IO1 B;  4BZA A;  1JRP A;  4HDQ A;  5FR3 A;  1F1H A;  1C4P A;  3Q3N C;  4FN2 A;  2JWZ A;  3IT6 B;  1RM6 C;  3IHP C;  3PRP B;  4YTP B;  2N9X A;  4BKG A;  2G4D B;  4E74 A;  1WR1 A;  4WIP A;  4AS1 A;  3EEC A;  3R66 C;  1ET6 A;  5JZE B;  2KZR A;  3BYT B;  1E8W A;  1OFF A;  2FBW B;  2EKE C;  1DGJ A;  3ZXR A;  1F2R C;  1KF6 B;  1MHX A;  2D2Q A;  1SIJ A;  3ZXV A;  1J8C A;  3BIN A;  1Q5W B;  1V1O A;  1FM0 D;  2ZPY A;  4WJQ A;  3WA0 A;  2M17 A;  1WMH A;  1N62 A;  1I4Q A;  1E8X A;  3IAM 1;  2UU7 A;  1TYG B;  5AUI A;  1H4R A;  5H8Y E;  1AW7 A;  1EWY C;  3OG5 A;  4HLE A;  4GDK B;  2D3A A;  4ANX A;  3KUD B;  3ZNZ B;  1EU4 A;  3NZ3 A;  5AUK A;  2FCM A;  4I6L B;  3PRM B;  2O2V B;  3FIL B;  1J0G A;  5EE0 A;  2ZVO A;  1JML A;  4USA A;  1B1Z A;  5D3D A;  4NQL B;  2JY6 A;  5EDS A;  5IA7 A;  3L54 A;  3KYD D;  2RPV A;  2V4L A;  5L95 C;  2JRH A;  3Q3O C;  3TUO A;  2MQJ A;  1IPG A;  3VXW A;  2PVO D;  3BVG A;  3VR9 B;  3RZF A;  3NS8 A;  3ZJU A;  4RFB A;  1ET9 A;  2WXH A;  3QHT A;  3DVN U;  5JXV A;  2L05 A;  2VZK D;  3IXS A;  2AQ3 B;  2SEB D;  4AP4 C;  1HXY D;  2JT4 B;  1JCK B;  4BFR A;  1WE6 A;  1S3S G;  3WCQ A;  3ZJV A;  1WWT A;  4L23 A;  3A9J B;  1TS4 A;  1A70 A;  1I4X A;  1FRR A;  3OJ3 A;  3RUI B;  3APD A;  2J4X A;  1E7P B;  2MRP A;  2WXQ A;  2LD9 A;  1V1P B;  1UBQ A;  4C00 A;  1EF5 A;  1WRI A;  2UYZ B;  4YSY B;  2KD0 A;  3P4R B;  3AN1 A;  3GZN I;  1V86 A;  3ZYY X;  5EE9 A;  3PLU A;  1TY0 A;  2R2O A;  3HM3 A;  2KJH B;  1FO4 A;  3L4P A;  2RGF A;  3V6E B;  4RM8 A;  2N9K A;  3A33 B;  2KTR A;  3PGE A;  4JWS C;  2K8B A;  2CHZ A;  5G2N A;  1ZE3 D;  4TUU A;  4P6V F;  4C4V B;  2K22 A;  1JWB D;  3IVF A;  2LVQ A;  1TS2 A;  3V6C B;  1D5M C;  2ZNV B;  2J7Q B;  2QDF A;  3LXF A;  4OVV A;  2KYW A;  1I4G A;  2JSV X;  1FCC C;  2JU6 X;  1V9J A;  1TTN A;  4LLG M;  3H7S A;  2IO3 B;  3R2I A;  1NEN B;  2KDF B;  2L3Z A;  2REX A;  5BMI A;  1WJ6 A;  1K8R B;  2JZZ A;  2HTH A;  4JL9 A;  4UDU C;  2ON8 A;  2BB6 A;  1YIW A;  5E6J A;  2LMC A;  5GMV A;  1HTO A;  3QCA A;  5J2R A;  2RSU A;  1T0Y A;  2OED A;  4JIO U;  1FNU A;  3Q3M C;  3QAQ A;  2WXR A;  2WXL A;  1B9R A;  4IM2 A;  1TKY A;  2DEN B;  3N20 C;  5C2T B;  1YJI A;  3I5J C;  3KLS X;  2HJ8 A;  2M4N A;  2QCZ A;  4GDL A;  2W3S A;  2MBQ A;  3Q8C A;  4KZ0 A;  2BKF A;  4EZK A;  1WZ3 A;  2K8C A;  1FNV A;  1FEH A;  2C7H A;  2NR2 A;  4EZL A;  2LXA A;  4OZB A;  1WX8 A;  1Y8R C;  4MT5 A;  2FE8 A;  1WZ0 A;  4MGK E;  3L10 B;  1F52 A;  4B6W A;  1YJ1 A;  3VDZ A;  2IJ0 A;  4DXF A;  1XCQ L;  4WH4 A;  3R7Q A;  1Z2M A;  3MTN B;  4BVU C;  3KVF B;  3DDC B;  4IOI E;  1ZW7 A;  5LXH A;  4ZYS A;  1HZ6 A;  1I4H A;  1Q1O A;  3HVD A;  5EE1 A;  5IP4 D;  4XX5 A;  4DXG A;  2L8J A;  4KIK B;  2PE6 B;  1L0V B;  1ZPS A;  3SDL C;  4ITK A;  4BOZ B;  1SXT A;  1P9D U;  3ZQ4 A;  1TIF A;  2ONQ A;  3RCZ A;  1MJD A;  1X1M A;  4L2Y A;  5JH5 C;  2FCS A;  3MJ5 A;  2WLB A;  2FUH B;  2GOW A;  2QEJ C;  2W55 A;  3APC A;  3N30 A;  4ZYN A;  2K5P A;  2L00 B;  4IUM B;  4ARI A;  4PYU A;  2MEK A;  1ROE A;  2H88 B;  2E3T A;  1L4D B;  2QSD A;  5DCN A;  4K81 A;  3EGR A;  2K25 A;  1TY2 A;  5BYQ A;  3AE7 B;  1I35 A;  3CIR B;  5HFY A;  4M8N A;  2RMM A;  1SIF A;  3LDZ E;  1UWM A;  4RGT A;  1KRH A;  2J0M A;  1C78 A;  1YN5 A;  1ZDX A;  4IG7 B;  4M0W B;  3T3O A;  3V61 A;  2VH1 A;  4HXD A;  4D2K A;  1P7E A;  4G3X B;  4C7Z A;  3TMP B;  3DHH C;  2WXG A;  4ANW A;  1SE3 A;  2CJN A;  2RD0 A;  1WYW B;  1WXQ A;  4N59 A;  4MGI E;  4LNF A;  3ZLZ A;  2D11 A;  2BYE A;  2WXJ A;  2MW5 A;  2N1V A;  3QAR A;  1XQQ A;  3TJP A;  4ZOH C;  4BAX A;  2L32 A;  4AJY B;  2J42 A;  3DCG A;  4WWO A;  1G6J A;  2L83 A;  1XLP A;  1Q10 A;  1YD8 U;  2K39 A;  2IDY A;  4PK1 A;  1VZ6 A;  2MP2 A;  3RNB C;  4ANV A;  4ACF A;  2JZ3 B;  1VDV A;  3WAO A;  4HJK A;  1ZOY B;  2GBM A;  2IGG A;  4KKI A;  1WGH A;  3M3J A;  2VZK B;  1YQB A;  2K9X A;  2K6D B;  2I1J A;  2LI5 A;  1KM7 A;  1SE4 A;  4MH0 E;  1WM3 A;  2LHD A;  3BK2 A;  1E10 A;  4HCP B;  1D4B A;  5DPS A;  4TSS A;  1JQ4 A;  1FFV A;  3V62 A;  4YT0 B;  3ONS A;  1MVK A;  4FJZ A;  3DBH B;  3H6N A;  2KQ7 A;  4N58 A;  2GBN A;  4DHZ B;  2KN5 A;  1QQR A;  3ML9 A;  3RN9 C;  5BYS A;  4YSZ B;  3DVG X;  4H2A A;  3VR8 B;  3ENE A;  2EKI A;  4HEA 1;  3OLM D;  3N1Z C;  4CO7 A;  4N6E B;  4HK2 A;  1N5W A;  1RLF A;  2C7M B;  1FCL A;  4I6N B;  1L6V A;  3ZNG C;  3R2T A;  4ZDV A;  1PUT A;  3AMZ A;  2G9H D;  3DBS A;  5D6J B;  1QOF A;  1WRD B;  3VRB B;  2MWS B;  5KHQ A;  3PRE A;  1FPY A;  2AX5 A;  1C9F A;  3WAM A;  1HA5 A;  1IYF A;  1OQR A;  1T3Q A;  3L0W B;  2V4I B;  4NAW B;  3EFU A;  4NJC A;  4HCN B;  5TR5 A;  3TBL D;  1E5W A;  3Q8B A;  1P7F A;  2FUG 1;  3EA6 A;  3WIM A;  3AE4 B;  2FIF A;  2KAN A;  1ZKH A;  2KC1 A;  3KW5 B;  3OAW A;  3DBL I;  1NVI D;  1WX7 A;  3ZDT A;  2KDI A;  3I57 A;  1QOG A;  4DXA B;  2XEW A;  4REZ A;  3V3X A;  3DOW A;  1XLO A;  3C0R B;  2LUM A;  1JAL A;  2KX3 A;  1YJJ A;  4M8M A;  3ZVV A;  2NTT A;  3DHG C;  5C1Z A;  2AEH A;  5C23 A;  4NY0 A;  1IBX A;  3VRA B;  4EE2 A;  4FAD A;  2D3C A;  4X57 B;  2Y3A A;  4RMA A;  3PZD A;  4IKG A;  3AEF B;  3BY4 B;  4Q2J A;  2J53 A;  4XDC A;  1TS3 A;  4OVZ A;  2B3A A;  3AI5 A;  2MBE A;  4ZHO A;  1CJE A;  4IWP A;  3ZJT A;  4IM3 A;  4WQM A;  1PYW D;  3UI3 A;  3AXC A;  1MG4 A;  1E9M A;  5GXG B;  3CWI A;  1UH6 A;  1J19 A;  2L76 A;  2N7D A;  2L7R A;  2Z0E B;  2W3R A;  3PHX B;  3QQ8 B;  1KJT A;  3DBR I;  2LFI A;  1P3Q U;  2IZV B;  4GGQ A;  3PVL A;  5IN7 A;  2JRI B;  4FHJ A;  1KTK A;  5TSS A;  4W9G A;  2V1Y A;  2WP9 B;  3RD2 A;  1LFD A;  4W9H A;  4JWU C;  4FUL A;  3TCA A;  1DYQ A;  1GAQ B;  2DZM A;  4KGT A;  2AQ2 B;  2MBO A;  3PPA A;  4KDI C;  1ZUD 2;  4GLS C;  1L0X B;  2RR9 A;  3A4R A;  3VUY A;  2GLS A;  4HVB A;  3TEY A;  4ZRJ A;  2MJE A;  3AH7 A;  3DPD A;  3T8M A;  3KH0 A;  5MPO A;  1YX6 B;  5FR6 A;  4MM3 A;  1UNS A;  5IOI A;  1NEK B;  4P16 A;  2XK5 A;  2DZK A;  1GJZ A;  3A9K A;  2BS3 B;  1C4A A;  3IG3 A;  2N7E A;  4GOC A;  1WI0 A;  3RUL A;  3VQI A;  2GBK A;  1FD6 A;  3KQ4 A;  3LB8 C;  3I9V 1;  3UIN B;  1LGR A;  2KDM A;  1IP9 A;  4TQ1 A;  2JUO A;  1U4A A;  1E7V A;  3KUC B;  1OQY A;  2JXX A;  1J7A A;  1RFK A;  4ZRP A;  4LK0 M;  4J3O D;  2GRI A;  2ZEQ A;  1FXI A;  3ML8 A;  3ABV B;  3DWG C;  2BYF A;  3PTF C;  3R8B A;  2KT7 A;  5LNK 1;  3ZKJ C;  4FJV B;  2LGS A;  3HRD D;  3AV8 A;  4RNA A;  2KMA A;  2LHE A;  1UBI A;  1QIL A;  2MBB B;  4FBJ B;  2KO3 A;  4WAA A;  3DVN V;  4W9E A;  2WU5 B;  4OZA A;  4DHZ E;  1ZXH A;  2BTE A;  4DHJ D;  1EU3 A;  3TEW A;  4MJS B;  3CSF A;  4HRS A;  3S2A A;  3H8H A;  3TEX A;  3NVV A;  4CYE A;  1VZ8 A;  3WAP A;  4GMV A;  4EKU A;  2BWF A;  2H89 B;  4PS8 A;  2UWQ A;  1V5T A;  1WJ4 A;  1LQB A;  2DZJ A;  1R4M B;  3EUB 2;  1VD2 A;  4HRO A;  2CR5 A;  5HKH A;  2PW9 A;  4L1B A;  3BWU D;  3A1Q B;  4XE0 A;  1WSP A;  1WF9 A;  4CHK A;  3FC4 A;  2KDE B;  2LGD A;  2IGD A;  4NJ6 A;  3LYY A;  3JSV B;  1DOX A;  3VUX A;  2QMT A;  3P42 A;  2KAC A;  2LXC A;  3ZNH B;  3AU4 A;  3RYT A;  3ZTD A;  1WH3 A;  3PZ7 A;  2PEA A;  1XF5 L;  1GUA B;  2LGY A;  2PVG C;  1VRA B;  5HG2 A;  3VTU A;  3VTW A;  2HE7 A;  4KV2 A;  5D94 A;  2BS2 B;  1OTR B;  4A90 A;  2K6Q A;  1BUI C;  4LJO B;  2M56 B;  4NAM A;  5KHO A;  3O65 B;  5CX3 A;  3N32 A;  4EEW A;  4RCO A;  4S0R A;  3QWZ B;  4EUT A;  3ALB A;  1WJU A;  2M1M A;  4PT5 A;  2G4S A;  2NTS A;  4K7S A;  3H7P B;  3E56 A;  4TKN A;  4NJ7 A;  2KQ4 X;  2N0S B;  4GDK A;  5T8I A;  5JHB A;  4TMA B;  4K7U A;  4XYC A;  2V0G A;  2J0J A;  3HHM A;  4MEL A;  1VCB A;  2O2V A;  2KHW B;  2IO2 B;  3FIL A;  1YOV B;  3SU8 X;  1EWC A;  2MHJ A;  3HM6 X;  1CMX B;  2KFK B;  2NPT B;  2RDH A;  4K1R B;  2R2Q A;  3Q8A A;  2WDT B;  3J9C A;  2MBH A;  4JGH B;  1L6U A;  4B9K A;  1LXD A;  3W1Y A;  4BKS A;  3NVZ A;  1VZ7 A;  2X38 A;  2ICI A;  3MP9 A;  1WXS A;  5CHF A;  2MSE D;  3IBE A;  3L16 A;  4CQN A;  5DPT A;  4PYZ A;  4W9I A;  2DBY A;  3MJW A;  2V3S A;  3UGB B;  3DQV A;  1ZP0 B;  4IW0 A;  3V05 A;  1STE A;  1T0R C;  4XZ4 A;  1GC6 A;  2O6V A;  4W9K A;  4YL8 A;  4WWP A;  4II3 B;  3PRZ A;  1EM7 A;  4JQW C;  3ZDM C;  4DBG A;  3Q3F A;  2HJ1 A;  2K3U A;  2INN E;  5I4D A;  2G1E A;  4NZL B;  4MSM B;  1FMA D;  4JX1 C;  1T6B X;  3QA8 A;  2IBI B;  5D7G A;  2WXM A;  3QK0 A;  1JWU D;  2LJ5 A;  3A9J A;  3KUZ A;  3R3M A;  1YN4 A;  3P4S B;  1E8Y A;  1K50 A;  3L08 A;  1D5Z C;  3OWE B;  2KC2 A;  1V1P A;  1JWA D;  4HPL B;  4A20 A;  4GU2 A;  3U2S C;  1UF0 A;  3VVW B;  2MA9 B;  2KTF A;  1JW9 D;  4M01 A;  3BVZ A;  4RF0 A;  2NMQ A;  1QF6 A;  2A5U A;  1D3Z A;  2DYB A;  5G5G A;  1XEE A;  2XBB C;  4EFO A;  1M94 A;  3ZIM A;  1I4R A;  4ICV A;  1MG8 A;  4DWF A;  2RDB C;  3UIP B;  3N1Y C;  4US8 A;  2M0A A;  2WX1 A;  4A3P A;  4A8X C;  5CTR C;  4C4V A;  4XGA B;  2DX5 B;  3M62 B;  1YNT E;  1L4Z B;  2ASQ A;  3B0A A;  4FA6 A;  1WGY A;  2DYO A;  4K3B A;  3AM9 A;  4NNJ B;  5IAA C;  4A55 A;  4MGY E;  4A9A A;  1PGX A;  3B08 A;  4AWJ A;  4FLH A;  1P98 A;  1JWM D;  2KDB A;  2NBV B;  1FFU A;  4ARC A;  4K3C A;  2AL6 A;  4QAY A;  2GBR A;  1WR6 E;  2KWD A;  4GSW A;  3WAN A;  2DHZ A;  1KLV A;  2PMV A;  4N9F 4;  1L5P A;  2WS3 B;  2BB5 A;  4YTM B;  1WXA A;  2FID A;  4DDG D;  1TKG A;  3UF8 A;  3PT2 B;  4OW0 A;  3RNF C;  3SD5 A;  1WX9 A;  1WMH B;  3B1L X;  2BKR B;  1AWD A;  3EHV A;  3ZRF A;  3BII D;  2LWP A;  1DOI A;  3MC8 A;  4RGN A;  1RFA A;  4IWQ A;  3ZW3 A;  4YSX B;  2CHW A;  2INC C;  2LZ6 A;  2Q5W D;  2R61 A;  5HI1 A;  2N9L A;  4ZHP A;  2KWC A;  2Y5C A;  4OZC A;  1YN3 A;  4MDK E;  2C60 A;  3VTV A;  3GP7 A;  1AN8 A;  1R4N B;  2BQQ A;  2Y5P A;  4DHJ B;  1UGM A;  2MX2 A;  1NI2 A;  1PGA A;  4KIK A;  1D6E C;  3R7R A;  2WGS A;  3P4P B;  4RM9 A;  5BO4 B;  5AZH A;  2ZZP B;  4KGS A;  3PLV A;  1V6E A;  2NBU A;  3L17 A;  1E0Z A;  4OVU A;  1L0Y B;  3W1S A;  3NRZ A;  2WX0 A;  4AQ7 A;  2WHI A;  3NVY A;  2DLB A;  3CF6 E;  1QLB B;  2JZP A;  3JVZ X;  2GI9 A;  4B0E A;  1ZXI A;  2IND C;  2Z8L A;  1C4C A;  4YTN B;  4US9 A;  1GNU A;  3M63 B;  3ZGZ A;  2V3P A;  1HZ5 A;  1GC7 A;  1P1A A;  4OHJ A;  4IWO A;  1HTQ A;  1WXM A;  4GXB A;  4G11 A;  1WE7 A;  4E71 A;  2JWU A;  1GG3 A;  3P1M A;  1JRO A;  2PE9 A;  3C19 A;  4ZRK A;  3HUI A;  1EUV B;  2WQY B;  4W9J A;  3RMK C;  4G0N B;  4AOF A;  2BYV E;  2WXF A;  2PKO A;  4M0W A;  3NZS A;  1GB1 A;  2JF5 A;  4MEM A;  2BGF A;  3PHW B;  2CU3 A;  3MC9 A;  2I2Y A;  2KTR B;  3BVM A;  1ISN A;  4WWM A;  1P0R A;  4WUR A;  3Q69 A;  4DK5 A;  4EZJ A;  2MJD A;  1SB3 C;  3EFC A;  2D3B A;  4KKJ A;  4WQO B;  3AEA B;  2KX0 A;  2RPQ A;  3AB5 A;  3W5U B;  1SE9 A;  1UD7 A;  3HK0 A;  3IAS 1;  1SJH D;  2C9W B;  3BYY B;  1XLN A;  2KXJ A;  1N60 A;  4C80 A;  5J18 A;  3UQA A;  3K9O B;  2I1K A;  2DAJ A;  1FIQ A;  4HDO A;  2J0K A;  2V9H A;  1UEL A;  2W54 A;  2YEP F;  3U7Z A;  1VLB A;  1GB4 A;  2YVC A;  2QHO A;  1V5O A;  1BML C;  2K1F A;  2JVC A;  4XWT A;  2G3Q B;  3IFW B;  4WWN A;  3VFK A;  4GN1 A;  4II2 B;  3C8Y A;  4F8C B;  1E7U A;  2M0X A;  3VH3 B;  4LDT D;  5D2M B;  3Q2A C;  2DWQ A;  1OEY A;  1VJK A;  4KZC A;  2QJL A;  5J17 A;  3KWL A;  2BVC A;  4GDL B;  2QIE B;  2LEK A;  3TIX A;  3RFZ B;  3O13 A;  3AE8 B;  5IO9 A;  2HD5 B;  2LVP A;  5E6N A;  2JXT A;  4BOS C;  1DOY A;  2KMM A;  3TL5 A;  4A3O A;  1IGC A;  4O1N A;  1T5X D;  1YX5 B;  4JLC A;  4MH8 A;  4HKZ E;  2MH7 A;  4HPM B;  3MHZ A;  2WXN A;  4WAF A;  3ZRC A;  5D3I B;  1OEY J;  1XCT L;  1SBB B;  3QJZ A;  3AUL A;  1F2R I;  2L0T A;  1UWX A;  4P1C C;  1GPX A;  4C56 C;  3B9J A;  3ETR A;  3JYU A;  2CU1 A;  2FCQ A;  2IPK D;  3AE2 B;  2WXO A;  1N6Z A;  2TSS A;  3ZTC A;  1KOT A;  2KKC A;  3QIJ A;  3AE5 B;  1N61 A;  2ZJD A;  1D5X C;  3DBH I;  2EMT A;  3ECI A;  5HHD G;  3NZU A;  2BWE S;  2VH2 A;  2AWT A;  1GOZ A;  1PQS A;  3X0W A;  2O6V B;  4NAW A;  4W9C A;  3NY5 A;  3ZO5 B;  4YXD B;  3P63 A;  5BMH A;  1XLQ A;  2L0F A;  1FRD A;  1WGD A;  3X23 A;  1R4N I;  3RNC C;  1JRU A;  2D5G A;  2N1W A;  2BYT A;  1QOB A;  1RYJ A;  3D32 A;  4WJP A;  3DVG Y;  1ACC A;  3DWM A;  4W9F A;  3Q6B A;  2KAJ A;  3SR6 A;  3KWV A;  4G50 A;  1C1Y B;  2K0P A;  4KDL B;  3M95 A;  1QZE A;  2NBW B;  1FNW A;  3N1X C;  4PS7 A;  3WAL A;  1TT5 B;  1FXA A;  4K7W A;  1M4V A;  4MGZ E;  3SFE B;  1V81 A;  2HDE A;  2QIL A;  2OHF A;  2JQR B;  3APF A;  1XXG A;  2OOB B;  3OJ4 B;  5JHA A;  1I4P A;  2DAF A;  1C76 A;  1MPE A;  1KLG D;  1J7B A;  3URY A;  2NVU I;  3ZNI D;  3AE1 B;  4IM0 A;  2KQS A;  1NI3 A;  2BW2 A;  1FXT B;  3MC0 B;  2JYT A;  3Q8F A;  1V80 A;  5AZG A;  3TSS A;  2WXP A;  4HJG E;  5C3J B;  1HE8 A;  1E8Z A;  1QT9 A;  4E3C A;  3N3K B;  3B2F A;  2Z59 B;  2KLC A;  1MFW A;  1WGG A;  1R7S A;  2BS4 B;  3GE8 C;  1RAX A;  4FJY A;  3UIO B;  3FAH A;  4J6I A;  2RDG A;  4ZRI A;  2D3G A;  1NBF C;  3MHS D;  1KLU D;  3RNE C;  2N9E B;  1PGB A;  1SEB D;  3PZ8 A;  4I6P A;  2WU2 B;  4LTU A;  3ZUN A;  5L83 A;  5LXI B;  4LNO A;  1KH0 A;  4WJO A;  1TJE A;  3P2B A;  4B95 A;  4B0M A;  3AU5 A;  4ICU A;  1TKE A;  3NJT A;  4LCD E;  4KGR A;  3RNA C;  1HQR D;  2C7N B;  1E6E B;  1V8C A;  1EF1 A;  1CQV A;  4RGO S;  3U8Z A;  2BBC A;  1C77 A;  2FNJ B;  3LJ3 A;  3KYC D;  3EC8 A;  1WIA A;  1XO3 A;  2D10 A;  2MP2 B;  1T0Q C;  5FK9 C;  4W9L A;  4HWI B;  2LRW A;  1F0Z A;  2WWZ A;  3RT3 B;  2GB1 A;  2LUE A;  2NCN A;  2K8H A;  3IT4 B;  3PV1 A;  4M02 A;  4IC7 B;  2JYE A;  2WNM A;  3Q14 C;  3AEG B;  4HKQ A;  1YMH E;  4XC2 A;  2ZPN A;  5G5H A;  4F1S A;  3TEZ A;  1L2N A;  1ZDV A;  2G45 B;  2N4F A;  4RF1 A;  1RRB A;  2CJO A;  2KWU B;  2WDV B;  2DNF A;  3SFD B;  3GB1 A;  1I7H A;  3L13 A;  2KK8 A;  2SAK A;  1LM8 B;  2KLG A;  4HPP A;  3GOE A;  3SHQ A;  4JPS A;  5DPR A;  5AZF A;  1WY8 A;  2N7J A;  3DBL B;  2LVO A;  2D07 B;  2KN4 A;  1ESF A;  2WDR B;  1ENF A;  5G55 A;  3GE3 C;  4A6Q A;  3CMM B;  4ZRQ A;  4TQ0 A;  3MFG A;  3CST A;  5E6O A;  4W9D A;  5CHV C;  2M8S A;  4XDD A;  2LRU A;  2AQ1 B;  2ZW0 A;  1A5R A;  3NS1 A;  1J7C A;  1L7Y A;  1NYQ A;  3AE9 B;  3I3T B;  2KWV B;  5FKA C;  2WXI A;  1YQ4 B;  1QOA A;  1HEZ E;  4IDI A;  4JE3 B;  4BKS D;  4MJS A;  3PSE B;  2KOX A;  3U7D A;  4R3D A;  1BXT A;  3AED B;  3T3N A;  3Q8E A;  2KJR A;  3AEC B;  4BBN C;  2CS4 A;  1C79 A;  3QX1 A;  2PLP A;  1UZX B;  4PS3 A;  2INP E;  2WDQ B;  3RPF C;  4LNK A;  2ZNV C;  1TGZ B;  1V97 A;  4WJN A;  4RH6 A;  2O6V D;  1NDD A;  3A4S C;  1JWS D;  3U30 A;  1OQQ A;  1IBX B;  4FHK A;  3W2D A;  3AE6 B;  3A1Q A;  1PFD A;  2ZW1 A;  4M00 A;  3VUW A;  2GBJ A;  4BBN F;  4P1B C;  1TZO A;  4C7Y A;  2KVR A;  4ANU A;  4LDT B;  3JSV A;  2IY1 B;  3DBR B;  1WXV A;  2KMC A;  3HVZ A;  2JX5 A;  4BKT A;  2WXK A;  4S17 A;  2IY0 B;  2KFJ A;  1I42 A;  3AE3 B;  1R4M I;  2ZVN A;  4MAC A;  2LJI A;  1AYF A;  2M19 A;  2IYD B;  3BZD B;  3RZW C;  2BT6 A;  3VAW A;  3GS2 A;  2ZCB A;  1KFY B;  2N9P C;  5BYR A;  4RGM A;  1WM2 A;  2W82 A;  1IGD A;  3H1U A;  4LJP B;  5H92 C;  1VR9 A;  2PPH A;  2BF8 B;  1WFY A;  3V60 A;  4XWW A;  2YEP B;  1N63 A;  3N9Y C;  2MJ3 A;  1WGR A;  2ACZ B;  3E9S A;  3H7P A;  4DQO C;  4TV3 A;  3AEB B;  4F7Z A;  1WGK A;  2KVZ A;  1MI0 A;  5LLI A;  4FXC A;  1LO5 D;  1E90 A;  2W9N A;  3UQB A;  5CHW A;  2EEL A;  3QC8 B;  2NS5 A;  5EE3 A;  3FKY A;  1TBE A;  2B76 B;  1H8C A;  2PIA A;  3W9C B;  2LAS A;  3DHI C;  2KFK A;  2I38 A;  2NPT A;  1CZP A;  1UGJ A;  4ASW C;  1YQ3 B;  1SF0 A;  3BK1 A;  3H9D A;  2OJR A;  1QKZ A;  2XNA C;  2J52 A;  1F77 A;  2E6X A;  2V3N A;  1BT0 A;  4MM3 B;  3B2G A;  5DPW A;  1IUE A;  2CKH B;  2C5L C;  1Q0W B;  2YLM A;  2AYO B;  4YWG G;  2XK5 B;  3W1S C;  4LNI A;  3A9K B;  1EO6 A;  1UUP A;  2HTM E;  1TZ1 A;  4KVG B;  4NPN A;  1T0S C;  2IGH A;  4KSL C;  2CHX A;  3SEB A;  3VHT C;  2PJH A;  1K51 A;  2WYQ A;  3HIZ A;  4NQK E;  2DYM A;  2QC8 A;  1SE2 A;  4P7I A;  3NOB A;  1RWS A;  2GMI C;  2KNB A;  2XN9 C;  1NYR A;  2MLB A;  1OGW A;  2MCN B;  4AJW A;  3W5V B;  3U52 E;  3PO0 A;  1F9J A;  2AL3 A;  1SJE D;  4GB9 A;  2LGX A;  2A4Z A;  3RI7 C;  3U4E G;  3NG0 A;  3GZN B;  2X8X X; 
#chains in the Genus database with same CATH homology
 1Z5S B;  4G3X B;  4AUQ C;  5KHO A;  4KSK C;  4MSQ B;  3O65 B;  3Q3J A;  5CX3 A;  3N32 A;  3TMP B;  4EEW A;  2EMS A;  3JYU A;  2CU1 A;  2FCQ A;  4ANW A;  3QWZ B;  4EUT A;  3ALB A;  4GIV A;  1WJU A;  4DDI D;  2M1M A;  4URK A;  2G4S A;  4K7S A;  3H7P B;  1ZGU B;  2KJ6 A;  3ZTC A;  4TKN A;  2KKC A;  2FCN A;  4EOY A;  4NJ7 A;  1KOT A;  2JPH A;  1XD3 B;  1WYW B;  2RD0 A;  3PS6 A;  1WJN A;  3QIJ A;  4MGI E;  2IO0 B;  4GDK A;  3ZLZ A;  2ZJD A;  5JHB A;  3DBH I;  2D11 A;  2EMT A;  3ECI A;  4K7U A;  3NZU A;  2BWE S;  2BYE A;  2J0J A;  2MW5 A;  3HHM A;  2N1V A;  2AWT A;  1VCB A;  4MEL A;  2O2V A;  2KHW B;  2IO2 B;  3QAR A;  1XQQ A;  2VRR B;  1PQS A;  1S1Q B;  3K9P B;  3SU8 X;  3TJP A;  3X0W A;  3HM6 X;  1CMX B;  1V49 A;  2KFK B;  2NPT B;  2O6V B;  4NAW A;  4W9C A;  4K1R B;  3NY5 A;  3VH4 B;  2R2Q A;  3ZO5 B;  4AJY B;  2WDT B;  2BPS A;  2MBH A;  2L0F A;  3DCG A;  1WGD A;  4JGH B;  4WWO A;  1R4N I;  3X23 A;  3JW0 X;  4B9K A;  1G6J A;  1JRU A;  2N1W A;  1AAR A;  1LXD A;  3W1Y A;  4BKS A;  1XT9 B;  1V2Y A;  3NHE B;  1YD8 U;  3D32 A;  1WXS A;  4WJP A;  5CHF A;  2MSE D;  2K39 A;  3DVG Y;  3IBE A;  1SGH A;  3L16 A;  4W9F A;  2Z0D B;  5E6P A;  1C3T A;  2FAZ A;  2Y5B B;  5AEK B;  4G50 A;  1C1Y B;  4KDL B;  5DPT A;  4PYZ A;  3M95 A;  1QZE A;  4W9I A;  2NBW B;  3MJW A;  4PS7 A;  2V3S A;  3WAL A;  2DZI A;  3UGB B;  2MP2 A;  3DQV A;  3T9L A;  2ZCC A;  4IW0 A;  2IO1 B;  4ANV A;  2JZ3 B;  4HDQ A;  4K7W A;  3WAO A;  4HJK A;  4MGZ E;  2GBM A;  4FN2 A;  2JWZ A;  4XZ4 A;  1V81 A;  1GC6 A;  3IHP C;  3PRP B;  2O6V A;  1WGH A;  2N9X A;  4W9K A;  4YL8 A;  2G4D B;  4BKG A;  3APF A;  4WWP A;  3M3J A;  4II3 B;  3PRZ A;  4E74 A;  1WR1 A;  2OOB B;  1YQB A;  4JQW C;  3OJ4 B;  3ZDM C;  3EEC A;  2K6D B;  2I1J A;  2LI5 A;  3Q3F A;  3R66 C;  4DBG A;  5JHA A;  5JZE B;  2KZR A;  1KM7 A;  4MH0 E;  1WM3 A;  1E8W A;  2DAF A;  2EKE C;  4MSM B;  4HCP B;  2NVU I;  2IBI B;  3QA8 A;  3ZNI D;  5DPS A;  5D7G A;  4IM0 A;  3QK0 A;  2KQS A;  2D2Q A;  2LJ5 A;  1FXT B;  3V62 A;  3ONS A;  3A9J A;  4FJZ A;  3BIN A;  3H6N A;  1V80 A;  3KUZ A;  1Q5W B;  2KQ7 A;  3R3M A;  5AZG A;  1J8C A;  1E8Y A;  2GBN A;  4DHZ B;  1HE8 A;  2KN5 A;  1E8Z A;  3L08 A;  4E3C A;  3N3K B;  3ML9 A;  2ZPY A;  4WJQ A;  3DVG X;  3ENE A;  3WA0 A;  2M17 A;  2KC2 A;  2Z59 B;  4HPL B;  3OLM D;  4A20 A;  1WMH A;  2KLC A;  4GU2 A;  4CO7 A;  1WGG A;  4HK2 A;  1RAX A;  4FJY A;  1RLF A;  3VVW B;  3UIO B;  2C7M B;  1E8X A;  2MA9 B;  4I6N B;  4J6I A;  3ZNG C;  2KTF A;  4ZDV A;  4ZRI A;  1H4R A;  2D3G A;  1NBF C;  3MHS D;  3DBS A;  5D6J B;  1WRD B;  2N9E B;  4HLE A;  2A5U A;  4GDK B;  1D3Z A;  4ANX A;  3KUD B;  2DYB A;  3ZNZ B;  2MWS B;  2FCM A;  2XBB C;  4I6P A;  4EFO A;  3PRE A;  5KHQ A;  1M94 A;  4I6L B;  3PRM B;  3ZUN A;  3ZIM A;  2O2V B;  5L83 A;  3WAM A;  4ICV A;  5LXI B;  1IYF A;  1J0G A;  1MG8 A;  4DWF A;  3UIP B;  2ZVO A;  3L0W B;  4NAW B;  4WJO A;  2WX1 A;  3EFU A;  4A3P A;  4HCN B;  5TR5 A;  3P2B A;  3TBL D;  4B95 A;  1E5W A;  3AU5 A;  4ICU A;  4NQL B;  2JY6 A;  5CTR C;  5EDS A;  5IA7 A;  2DX5 B;  3M62 B;  4LCD E;  3L54 A;  3WIM A;  2C7N B;  2ASQ A;  2FIF A;  2KAN A;  3KYD D;  2V4L A;  1ZKH A;  5L95 C;  2KC1 A;  3KW5 B;  3OAW A;  1EF1 A;  2JRH A;  3DBL I;  3U8Z A;  1WX7 A;  3B0A A;  1WGY A;  3ZDT A;  4FA6 A;  2DYO A;  2KDI A;  2MQJ A;  2FNJ B;  1IPG A;  3VXW A;  4DXA B;  3LJ3 A;  2XEW A;  3KYC D;  3RZF A;  3DOW A;  3C0R B;  3NS8 A;  4NNJ B;  5IAA C;  2KX3 A;  3EC8 A;  1WIA A;  2D10 A;  2MP2 B;  4MGY E;  4W9L A;  4HWI B;  2LRW A;  2WWZ A;  3B08 A;  3RT3 B;  4AWJ A;  4FLH A;  2LUE A;  4M8M A;  1P98 A;  3QHT A;  2NCN A;  3ZVV A;  2K8H A;  2KDB A;  2NBV B;  3DVN U;  3PV1 A;  2L05 A;  5C1Z A;  4IC7 B;  2AEH A;  5C23 A;  4NY0 A;  2AL6 A;  2GBR A;  4AP4 C;  1WR6 E;  2JT4 B;  4FAD A;  4GSW A;  4X57 B;  4RMA A;  4BFR A;  3PZD A;  1WE6 A;  4XC2 A;  3BY4 B;  3WAN A;  2DHZ A;  2ZPN A;  1KLV A;  1S3S G;  4F1S A;  4N9F 4;  1L2N A;  2B3A A;  3A9J B;  2G45 B;  2N4F A;  3AI5 A;  1RRB A;  2MBE A;  3OJ3 A;  1WXA A;  2KWU B;  3RUI B;  3APD A;  2FID A;  4DDG D;  3UF8 A;  2MRP A;  3PT2 B;  4IWP A;  3SD5 A;  1WX9 A;  3L13 A;  2LD9 A;  4IM3 A;  1WMH B;  2KK8 A;  2BKR B;  3B1L X;  3AXC A;  3EHV A;  3ZRF A;  1LM8 B;  2KLG A;  2LWP A;  1UBQ A;  1EF5 A;  3GOE A;  3SHQ A;  1UH6 A;  1J19 A;  2L76 A;  2N7D A;  5DPR A;  5AZF A;  1WY8 A;  2L7R A;  2Z0E B;  1RFA A;  2UYZ B;  2LVO A;  2D07 B;  2KD0 A;  3PHX B;  4IWQ A;  3ZW3 A;  5G55 A;  2CHW A;  3CMM B;  1V86 A;  3GZN I;  1KJT A;  2LZ6 A;  3QQ8 B;  4TQ0 A;  3CST A;  5E6O A;  3DBR I;  3PLU A;  4W9D A;  5CHV C;  2M8S A;  2R2O A;  1P3Q U;  3HM3 A;  2IZV B;  2KJH B;  4GGQ A;  2RGF A;  3PVL A;  2LRU A;  2JRI B;  2KWC A;  4FHJ A;  3V6E B;  4RM8 A;  4W9G A;  3A33 B;  1A5R A;  2KTR A;  4MDK E;  1L7Y A;  3PGE A;  2V1Y A;  2C60 A;  2K8B A;  2CHZ A;  3I3T B;  5G2N A;  2KWV B;  4TUU A;  3VTV A;  3RD2 A;  1LFD A;  4W9H A;  4FUL A;  3TCA A;  2DZM A;  3IVF A;  2MBO A;  3PPA A;  4KDI C;  4BKS D;  4DHJ B;  2LVQ A;  1UGM A;  2MX2 A;  1NI2 A;  2RR9 A;  3A4R A;  3V6C B;  3VUY A;  4KIK A;  4HVB A;  4MJS A;  2ZNV B;  3PSE B;  3R7R A;  4RM9 A;  2J7Q B;  5BO4 B;  5AZH A;  2ZZP B;  4ZRJ A;  2KOX A;  3U7D A;  4OVV A;  3PLV A;  1V6E A;  2NBU A;  2KJR A;  1V9J A;  3L17 A;  4BBN C;  2CS4 A;  1TTN A;  3DPD A;  3QX1 A;  3H7S A;  1UZX B;  4PS3 A;  4OVU A;  2IO3 B;  2ZNV C;  3T8M A;  2KDF B;  2L3Z A;  2REX A;  1TGZ B;  3KH0 A;  4WJN A;  3W1S A;  1WJ6 A;  2O6V D;  2WX0 A;  1NDD A;  1YX6 B;  1K8R B;  2JZZ A;  2HTH A;  3A4S C;  4JL9 A;  5FR6 A;  4MM3 A;  1YIW A;  3U30 A;  5GMV A;  4FHK A;  3QCA A;  5J2R A;  3CF6 E;  2RSU A;  1T0Y A;  3JVZ X;  3A1Q A;  4JIO U;  2XK5 A;  2DZK A;  1GJZ A;  3A9K A;  3VUW A;  3IG3 A;  3QAQ A;  2GBJ A;  2N7E A;  4GOC A;  4BBN F;  1GNU A;  1WI0 A;  3M63 B;  4IM2 A;  2KVR A;  4ANU A;  4LDT B;  3JSV A;  2IY1 B;  3RUL A;  3VQI A;  2DEN B;  2GBK A;  1WXV A;  2KMC A;  1GC7 A;  1P1A A;  4BKT A;  2IY0 B;  4IWO A;  3UIN B;  2KFJ A;  2HJ8 A;  2M4N A;  1IP9 A;  1I42 A;  4TQ1 A;  4GDL A;  2JUO A;  1U4A A;  1WXM A;  1E7V A;  1R4M I;  3KUC B;  4GXB A;  2ZVN A;  1WE7 A;  4G11 A;  4E71 A;  1OQY A;  2MBQ A;  1GG3 A;  4KZ0 A;  2IYD B;  2JXX A;  2PE9 A;  2BKF A;  3RZW C;  4ZRK A;  3VAW A;  4EZK A;  2ZCB A;  1EUV B;  2N9P C;  1WZ3 A;  4W9J A;  2K8C A;  2C7H A;  4G0N B;  1WM2 A;  4AOF A;  2BYV E;  2NR2 A;  2ZEQ A;  3H1U A;  4EZL A;  3NZS A;  4LJP B;  2LXA A;  3ML8 A;  1WX8 A;  1Y8R C;  1WZ0 A;  2BYF A;  3PTF C;  4MGK E;  3L10 B;  4B6W A;  2JF5 A;  4MEM A;  2PPH A;  2BF8 B;  1WFY A;  3V60 A;  3ZKJ C;  4FJV B;  1YJ1 A;  3VDZ A;  2BGF A;  3PHW B;  1WGR A;  2KTR B;  1ISN A;  3R7Q A;  1Z2M A;  3MTN B;  1P0R A;  3H7P A;  2KMA A;  4BVU C;  3KVF B;  3DDC B;  4DK5 A;  1UBI A;  4TV3 A;  2MBB B;  4EZJ A;  1ZW7 A;  4FBJ B;  4F7Z A;  2KO3 A;  5LXH A;  4WAA A;  3DVN V;  4W9E A;  5LLI A;  1Q1O A;  4WQO B;  4DHZ E;  2KX0 A;  4DHJ D;  1E90 A;  2W9N A;  2RPQ A;  3UQB A;  4XX5 A;  5CHW A;  2L8J A;  3QC8 B;  4KIK B;  2NS5 A;  4MJS B;  2PE6 B;  1SE9 A;  1UD7 A;  1TBE A;  3SDL C;  3HK0 A;  3CSF A;  3S2A A;  4BOZ B;  1H8C A;  1P9D U;  2LAS A;  2C9W B;  4ASW C;  2KFK A;  2NPT A;  3RCZ A;  1X1M A;  2KXJ A;  4CYE A;  5JH5 C;  2FCS A;  3H9D A;  5J18 A;  3WAP A;  4GMV A;  2FUH B;  2OJR A;  2BWF A;  4EKU A;  2GOW A;  3K9O B;  3UQA A;  2I1K A;  2DAJ A;  4PS8 A;  2UWQ A;  4HDO A;  1V5T A;  1WJ4 A;  1LQB A;  2J0K A;  1UEL A;  1BT0 A;  2DZJ A;  3APC A;  3N30 A;  4ZYN A;  5DPW A;  2YVC A;  2CKH B;  2C5L C;  1VD2 A;  2QHO A;  1V5O A;  1Q0W B;  2K1F A;  2JVC A;  2L00 B;  4IUM B;  2G3Q B;  2CR5 A;  4PYU A;  5HKH A;  3IFW B;  4WWN A;  2YLM A;  3VFK A;  2AYO B;  3A1Q B;  2XK5 B;  3W1S C;  3A9K B;  1EO6 A;  1TZ1 A;  1WF9 A;  4KVG B;  4KSL C;  4K81 A;  4NPN A;  5DCN A;  2CHX A;  4GN1 A;  4II2 B;  4CHK A;  3VHT C;  2PJH A;  4F8C B;  2KDE B;  2K25 A;  1E7U A;  2LGD A;  2M0X A;  4NJ6 A;  3VH3 B;  4LDT D;  3JSV B;  5D2M B;  3VUX A;  2WYQ A;  3HIZ A;  4NQK E;  2DYM A;  1OEY A;  1I35 A;  4KZC A;  4P7I A;  2LXC A;  3NOB A;  5J17 A;  2GMI C;  2KNB A;  3ZNH B;  3AU4 A;  4GDL B;  3RYT A;  3TIX A;  3ZTD A;  2MLB A;  1WH3 A;  2HD5 B;  2LVP A;  5E6N A;  4BOS C;  4M8N A;  1OGW A;  2PEA A;  1GUA B;  2MCN B;  1SIF A;  4AJW A;  2LGY A;  3LDZ E;  3TL5 A;  3VTU A;  4A3O A;  3VTW A;  2HE7 A;  1YX5 B;  4JLC A;  4KV2 A;  5D94 A;  4HPM B;  2J0M A;  1F9J A;  1OTR B;  2AL3 A;  4GB9 A;  3ZRC A;  2LGX A;  4IG7 B;  4M0W B;  2A4Z A;  1OEY J;  2K6Q A;  3V61 A;  3QJZ A;  3AUL A;  4HXD A;  4LJO B;  2L0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...