1IYFA

Solution structure of ubiquitin-like domain of human parkin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
76
structure length
76
Chain Sequence
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords parkin
publication title Parkin binds the Rpn10 subunit of 26S proteasomes through its ubiquitin-like domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 76
sequence length 76
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1iyfA00
4GSWA 1WXSA 1WF9A 4K7WA 4TUUA 2DENB 4IM3A 2LGXA 5DPTA 3ZUNA 4FJZA 3VTVA 2EMTA 1OQYA 1UELA 2PJHA 2RPQA 2Z0EB 3QC8B 5C1ZA 2N1WA 3DVNU 3X23A 2G45B 2FCSA 3KYCD 3NY5A 4DDID 4E3CA 4MGYE 3H7PA 4F1SA 5EDSA 2ZZPB 1Y8RC 1BT0A 3V6EB 3CMMB 3QK0A 2DAJA 1WR1A 2BWES 4FHJA 4N9F4 4IC7B 3RT3B 2N1VA 2ZPYA 1J19A 4G11A 4JIOU 4NNJB 3VUXA 3W1YA 4M8MA 2CHXA 4MGZE 5LLIA 1XD3B 4NQKE 5L95C 1IP9A 4K7UA 2I1KA 4MSMB 3AXCA 3V6CB 3QHTA 4BOZB 4E71A 5CHFA 2KNBA 3ZVVA 2MLBA 2KANA 4ANWA 2XEWA 1Q0WB 1U4AA 1ZGUB 3UINB 2O6VB 1C1YB 1WM2A 2JZ3B 4G50A 2EKEC 4K7SA 1WFYA 3RULA 3ML9A 2AL3A 2LVQA 1WI0A 4W9LA 4CHKA 5L83A 4AJYB 4MM3A 1P1AA 2GBKA 1OTRB 2JRHA 3KH0A 4GDLA 2BYEA 4NQLB 3CSFA 2ZJDA 3WIMA 3DOWA 2LGDA 4EOYA 2ZVNA 2L3ZA 3M95A 5JH5C 3DDCB 3RUIB 2IY1B 3A1QA 4EFOA 2FIDA 5E6PA 2LVOA 3HM3A 5CX3A 4EEWA 1L2NA 3A33B 2GBMA 5KHOA 1LXDA 2Y5BB 3R7RA 5CHVC 3RZWC 2MBEA 3PHWB 1E90A 3NOBA 3P2BA 4FJVB 4II3B 5D6JB 3DBSA 3UIOB 4LCDE 3PTFC 4HXDA 4TQ0A 5D7GA 1TGZB 1WGRA 4J6IA 1V5OA 2D07B 3PT2B 4WQOB 1FXTB 5IA7A 2KQ7A 3Q3JA 1IYFA 3ALBA 3OLMD 3PRZA 2KZRA 1WJ4A 3SDLC 3EECA 3PPAA 2ZNVC 3VAWA 4MEMA 3H7SA 2D2QA 2G4DB 5JHBA 2O6VD 2N7EA 1WRDB 4FN2A 2V3SA 2DYOA 5J17A 3BINA 4W9KA 3T9LA 2K39A 2BWFA 2DYBA 2LRUA 4FHKA 3ZTCA 3R66C 4MGKE 2IYDB 4BFRA 2CKHB 2UYZB 3KVFB 3QAQA 2L0TA 4MJSA 3SU8X 4HCNB 2DZMA 1UH6A 4W9IA 1E8WA 3APFA 3SD5A 3QQ8B 3DBRI 2A4ZA 1GC6A 2DHZA 3M62B 2MWSB 3NHEB 4ZRKA 4KDLB 2KDFB 2W9NA 4GDKA 4DK5A 1HE8A 2ZVOA 5KHQA 1GJZA 5GMVA 4OVUA 1WJ6A 2IZVB 1EF1A 3A9KB 3C0RB 3DQVA 4GMVA 1E8YA 4AOFA 3IVFA 2J7QB 4OVVA 3VUYA 2RR9A 4HDQA 3JVZX 4XZ4A 2G3QB 1RLFA 2HD5B 3BY4B 3IG3A 4JQWC 2I1JA 1Q5WB 4WJOA 3T8MA 1J0GA 3DPDA 2KLGA 3JW0X 4HJKA 4BOSC 3R7QA 2IY0B 2KWVB 3L13A 3GZNI 2LXCA 2DZIA 1XT9B 2FCMA 1P3QU 2BYFA 4HPMB 2ZCBA 2KVRA 1A5RA 2UWQA 2M0XA 3EHVA 1EUVB 2D10A 1YX5B 3RD2A 3WAMA 2DAFA 2GBJA 3B1LX 3ZO5B 1V80A 4F8CB 1WY8A 3AU5A 1OEYA 2BYVE 3DBLI 4E74A 2YVCA 4I6NB 3KYDD 4ANUA 4XC2A 3ZIMA 2GBNA 3ONSA 2C7NB 4W9GA 2LZ6A 2L00B 2WWZA 4BBNF 4X57B 4CO7A 2KTFA 3H1UA 4AWJA 4FA6A 1YX6B 3KUCB 4IWQA 1P0RA 3U30A 2L7RA 3ZW3A 2M1MA 2MCNB 4PS7A 3ECIA 4W9CA 2LVPA 3R3MA 4WWOA 3L0WB 4TV3A 4HDOA 4IG7B 2N7DA 2JT4B 2M17A 2AEHA 1V86A 1ZKHA 2K8HA 2K6DB 3L16A 4M8NA 3RCZA 1WJUA 3V60A 2C60A 2KD0A 2O6VA 1V49A 3PZDA 4DBGA 1P9DU 2AL6A 3PS6A 1GC7A 5DPWA 2KTRB 2KX3A 2LJ5A 3CSTA 4AUQC 1AARA 3DVNV 4KIKB 5AZFA 1RAXA 2NBUA 2NS5A 1WGDA 1EO6A 2GBRA 4RM8A 5CHWA 2JWZA 4ANXA 2XK5B 4F7ZA 2M4NA 4NPNA 1TZ1A 3HHMA 3PGEA 2MRPA 1L7YA 4EUTA 4HWIB 4BKSD 1UBQA 4LJPB 3APCA 3O65B 2LUEA 2BGFA 3ZNZB 4WJNA 2OOBB 3D32A 4EZJA 2ZCCA 1WIAA 1E5WA 1UBIA 4AJWA 3KW5B 4HCPB 1I42A 2CU1A 3N3KB 4FULA 2J0MA 1WGYA 3PRMB 3WALA 2KMCA 3JYUA 4TKNA 1QZEA 4NAWB 5DPSA 1IPGA 1WXMA 3W1SA 4DHJB 2NCNA 2BKRB 1ZW7A 4IWOA 3RZFA 2GOWA 2L8JA 1KLVA 2JF5A 3TL5A 1KOTA 3VTUA 1LQBA 4HK2A 1LM8B 3MTNB 2JXXA 3TIXA 1WE7A 1WGHA 5DPRA 4GXBA 2ZPNA 2BPSA 4B95A 3W1SC 2DZJA 5BO4B 4A3PA 1WX7A 2N9XA 4I6PA 2MBOA 3NS8A 1WMHB 2CHZA 2KO3A 5D94A 1S3SG 1RFAA 1WX8A 5TR5A 4A20A 3ZRCA 2MQJA 3ZDMC 2KJHB 1E7UA 1MG8A 3Q3FA 2L05A 2WDTB 3UQBA 5AEKB 5C23A 2L76A 2FAZA 3GOEA 4W9EA 3KUZA 2IO1B 3N32A 3L54A 1TTNA 2NVUI 2CHWA 3A9KA 2N9PC 2FIFA 2KDBA 4MGIE 3TBLD 2JRIB 3WAPA 2DYMA 1WZ3A 2N4FA 1K8RB 2R2QA 4ASWC 2KFKB 5E6OA 4FBJB 1UZXB 4DHJD 4KSKC 2KC1A 4DWFA 1E7VA 2RD0A 5G55A 5J18A 4GU2A 2O2VB 2WX0A 2CR5A 3VFKA 2Z0DB 3UIPB 4MSQB 1GG3A 4JLCA 2C7HA 2MW5A 4XX5A 4MJSB 2V1YA 2K8CA 3IFWB 2REXA 4GN1A 5HKHA 3SHQA 2QHOA 4A3OA 3OJ3A 5AZGA 1NI2A 3V62A 4IUMB 5D2MB 3H6NA 4JGHB 3OJ4B 4DHZB 3KUDB 1NDDA 4ZDVA 2MBQA 1T0YA 5JHAA 2IO0B 4WJQA 3U7DA 4BBNC 3TJPA 2KMAA 2PE9A 3VDZA 1EF5A 3A9JA 4LJOB 4BKGA 1ISNA 4ZRIA 2C5LC 3AULA 3PVLA 2KJRA 2JY6A 1P98A 2KFJA 4PS8A 5IAAC 1TBEA 3IHPC 2PE6B 3ZTDA 4BKSA 3NZUA 1CMXB 3H9DA 4KDIC 1R4MI 2IO2B 3WAOA 2JPHA 1NBFC 2MA9B 3A4RA 2ASQA 3JSVB 2D3GA 3VQIA 2JVCA 5DCNA 2NPTB 3EFUA 4KZ0A 2WX1A 4EZKA 2JZZA 3L10B 4PYZA 3DVGY 1KM7A 3PV1A 3HK0A 3PRPB 2MP2B 3TMPB 2HE7A 3APDA 1V6EA 2IBIB 1YJ1A 2NR2A 3B08A 3ML8A 1D3ZA 1SIFA 1WX9A 3AI5A 3RYTA 4IM2A 4HPLB 3OAWA 2LGYA 2PPHA 1GUAB 3ZNID 1M94A 2KTRA 3K9PB 1H4RA 2Z59B 2BF8B 1YIWA 3ZDTA 2LXAA 4KIKA 3QX1A 3X0WA 4GB9A 2ZEQA 2XK5A 1KJTA 4KVGB 3TCAA 3WANA 2KK8A 5LXHA 1WYWB 1X1MA 3H7PB 5CTRC 1YQBA 4WAAA 2KN5A 4K1RB 3VH4B 4II2B 3MJWA 4GOCA 1OEYJ 3ZNHB 3IBEA 5AZHA 2FUHB 4KZCA 3PREA 3QWZB 3VH3B 3LJ3A 2R2OA 1GNUA 4DHZE 2FNJB 4WWNA 2YLMA 4KSLC 2RGFA 1V9JA 1I35A 1WZ0A 4NAWA 1Q1OA 2LWPA 4PS3A 4WJPA 3ZLZA 4P7IA 4CYEA 3CF6E 3VVWB 1PQSA 3I3TB 2FCQA 3ZNGC 4EKUA 2MSED 1XQQA 2N9EB 3EC8A 3WA0A 2MX2A 4NJ6A 2KDIA 1V81A 2D11A 2IO3B 2KLCA 2LRWA 3ENEA 4GDLB 3K9OB 3HM6X 5J2RA 3HIZA 4HVBA 1VCBA 4KV2A 4AP4C 1WMHA 3AU4A 3QJZA 1WGGA 3N30A 1WR6E 3UQAA 2NBVB 4W9DA 5JZEB 4ANVA 1WXAA 2AYOB 2B3AA 2L0FA 3A1QB 4TQ1A 2OJRA 4PYUA 2FCNA 4LDTB 4RM9A 3PLUA 1G6JA 1UD7A 2A5UA 2KWUB 2MBHA 2NBWB 2ZNVB 2KQSA 3M63B 3L08A 1WXVA 2DX5B 1UGMA 1C3TA 4FJYA 4M0WB 1SE9A 2HTHA 1VD2A 3B0AA 5E6NA 4B9KA 3NZSA 4ICUA 3MHSD 2KFKA 2J0KA 4EZLA 1V5TA 4IWPA 4JL9A 3UF8A 4G0NB 2KOXA 2O2VA 5FR6A 4WWPA 4YL8A 1R4NI 4MH0E 3U8ZA 3S2AA 2BKFA 1H8CA 2KJ6A 2KX0A 2KXJA 1WJNA 3V61A 2EMSA 4BVUC 1Z5SB 4GGQA 2C7MB 1E8ZA 2K6QA 2V4LA 4W9JA 2HJ8A 3ZKJC 2KHWB 3QIJA 2DZKA 4MELA 3VTWA 4NJ7A 4IW0A 2KKCA 4LDTD 2KWCA 4G3XB 4W9HA 2KC2A 4B6WA 1V2YA 1YD8U 4GDKB 3LDZE 3PHXB 2RSUA 4K81A 3QA8A 4IM0A 4ICVA 1F9JA 1JRUA 1WE6A 2LD9A 5LXIB 3VHTC 4ZYNA 4GIVA 4DXAB 4DDGD 1OGWA 2K1FA 4I6LB 2K8BA 1S1QB 3UGBB 2J0JA 3DCGA 3JSVA 2LASA 2LI5A 2VRRB 1WH3A 2NPTA 2GMIC 3DBHI 3QCAA 1SGHA 4HLEA 2JUOA 1WM3A 2XBBC 4FLHA 2CS4A 3L17A 2MP2A 3M3JA 2C9WB 3A4SC 1Z2MA 2G4SA 1RRBA 4W9FA 1E8XA 4RMAA 4ZRJA 4NY0A 2PEAA 3PLVA 3DVGX 4BKTA 2M8SA 4URKA 4FADA 2KDEB 2WYQA 3PSEB 4MDKE 3VUWA 3A9JB 2MBBB 3ZRFA 5G2NA 1J8CA 1LFDA 3VXWA 3QARA 2AWTA 2K25A
chains in the Genus database with same CATH superfamily
4TUUA 3ZUNA 2Z0EB 2N9LA 4XDCA 1I4XA 1C9FA 3NY5A 5EDSA 4YTNB 1WR1A 1F2RI 1QILA 4FHJA 2ZPYA 1J19A 4JIOU 4NNJB 3W1YA 4M8MA 2CHXA 4NQKE 5L95C 1IP9A 3AXCA 4RGTA 1KFYB 2L1AA 2KNBA 3MC0B 4N59A 1U4AA 1C1YB 1WM2A 2JZ3B 3AE2B 2EKEC 1GPXA 3RULA 2WQYB 5L83A 4AJYB 3AV8A 4GDLA 4LTUA 4IDIA 5H92C 5FK9C 2LGDA 2LHEA 2L3ZA 2K9XA 3M95A 3RUIB 2L52A 5E6PA 1YN3A 3HM3A 1BXTA 1HZ6A 3R7RA 2W55A 5CHVC 2MBEA 3PHWB 2L32A 3PTFC 5D7GA 4WIPA 1ZP0B 4B0EA 3PT2B 2BTEA 2KQ7A 3C19A 3PRZA 3RN9C 1VZ6A 3PPAA 2JU6X 1B9RA 1HXYD 3P4PB 3U7ZA 4FN2A 1C76A 3Q69A 2DYOA 2PVGC 3NRZA 2K39A 2LRUA 4P1BC 4BFRA 2UYZB 5T8IA 4HCNB 1UH6A 1C79A 2YEPF 3M62B 2MWSB 3NHEB 1MVKA 2KDFB 2W9NA 4DK5A 4L1BA 2DNFA 3W9CB 2BQQA 2LMCA 5GMVA 1GJZA 1WJ6A 2IZVB 3A9KB 3MJ5A 4AOFA 2FUG1 2WXPA 5D3IB 4HDQA 2G3QB 3IG3A 1CJEA 4RNAA 1J0GA 3JW0X 3URYA 3GZNI 2LXCA 4LLGM 1N62A 1A5RA 1JWUD 2D10A 1YX5B 2QSDA 1WY8A 2BYVE 1L6UA 3N1ZC 3HUIA 4I6NB 4ANUA 3ZIMA 4WH4A 2RDBC 1ZXHA 4CO7A 2KTFA 4AWJA 2Y5PA 2J52A 3AE8B 4IWQA 3AE7B 4PS7A 4W9CA 2LVPA 4WWOA 3L0WB 4HDOA 3DHIC 2JT4B 2HTME 5H8YE 3L16A 4M8NA 1WJUA 3PZDA 2AL6A 2LFIA 1GC7A 3GZNB 2KX3A 1QLBB 3DVNV 5AZFA 2NBUA 2GBRA 3PGEA 5BMIA 4ZYSA 1DOYA 2BVCA 2FBWB 2K22A 2QDFA 2BGFA 2WDRB 1KH0A 1XLQA 3MC8A 1M4VA 4YSXB 1UBIA 4AJWA 4HCPB 2L83A 5DPSA 4DXGA 1WXMA 3DWMA 3NVWA 3RNGC 2BKRB 2L8JA 1MG4A 2ON8A 1TT5B 1QT9A 3VTUA 4HK2A 4C7YA 3TIXA 2BPSA 1YJJA 3LYYA 2DZJA 4ZHOA 1K52A 3PO0A 4I6PA 2MBOA 2CHZA 1EM7A 1C78A 3AECB 1E7UA 2R61A 2L76A 2IO1B 1SE3A 3A9KA 2N9PC 3TBLD 1D5ZC 4FBJB 2ICIA 2Z0DB 2PMVA 4JLCA 4RCOA 3WCQA 2V1YA 4A3OA 2KWDA 3OJ3A 3H6NA 3OJ4B 5EE3A 2IO0B 5EE0A 3A9JA 4LJOB 1YNTE 1ISNA 3AULA 1DYQA 3I5JC 4PS8A 2MJDA 5IAAC 1TBEA 3ZTDA 1YQ3B 3A4RA 1PFDA 2D3GA 1E0ZA 3EFUA 1FCLA 4EZKA 2JZZA 1F0ZA 1IGCA 1AYFA 3TMPB 3DWGC 2RDHA 3B08A 1P7FA 2E3TA 3R2TA 1M94A 3GE3C 2WXRA 1XLNA 3TCAA 2BS2B 3Q8AA 5IP4D 2BB5A 2W82A 1FNVA 4WAAA 4K1RB 3MJWA 4GOCA 3BZDB 5AZHA 3RMKC 1WYGA 2LGSA 4ARIA 2WXLA 3VH3B 4XGAB 2R2OA 3N9YC 1UWXA 1UGJA 1Q1OA 2LWPA 1FFVA 4WJPA 4P7IA 3SFDB 2FCQA 3ZNGC 4TMAB 4C56C 1MHXA 3WA0A 2MX2A 2INCC 2KLCA 3U4EG 3K9OB 5J2RA 1VCBA 4W9DA 2BB6A 2L0FA 2AYOB 2B3AA 2RPVA 4LDTB 1JALA 1TS2A 3B9JA 2KWUB 1ZUD2 1N61A 1L6VA 4FJYA 4C00A 2HTHA 1VD2A 2WU5B 4QAYA 2WNMA 3AEAB 1ESFA 4ICUA 3RFZB 1J7BA 1C77A 4IWPA 3KWVA 2E6XA 4WWPA 1R4NI 4MH0E 1SBBB 4WWMA 1TKYA 1QOAA 2KX0A 3AE5B 4GGQA 2C7MB 2KN4A 1E10A 1SJED 3QIJA 3ZYYX 4LDTD 3AM9A 2KC2A 4GDKB 1ENFA 1TZOA 3PHXB 1SXTA 2WS3B 1DOIA 4IM0A 2I2YA 3VHTC 4ZYNA 4DDGD 1S1QB 3UGBB 2VRRB 1XF5L 2LI5A 1V97A 1JQ4A 1FNUA 1WM3A 2EKIA 5C2TB 1FRRA 4EE2A 3L17A 2V9HA 1Z2MA 2G4SA 1SEBD 4ACFA 3NVZA 1E8XA 1YOVB 4NY0A 2JXTA 3VUWA 1J8CA 1LFDA 1R4NB 1KLUD 4GSWA 4KGSA 4IM3A 2LGXA 1LGRA 4FJZA 2PJHA 1TS3A 3FC4A 3X23A 2G45B 1F1HA 2FCSA 3KYCD 1BT0A 2WXFA 2DAJA 4N9F4 4G11A 3VUXA 4MGZE 5LLIA 1XD3B 4MSMB 2JX5A 1AN8A 5G5GA 5CHFA 4ZHPA 3ZVVA 2VH2A 2VZKB 1RWSA 2LVQA 1WI0A 4A6QA 2J53A 3AEFB 4MM3A 1P1AA 3GB1A 2BYEA 3WIMA 3E9SA 4EOYA 4KKIA 5JH5C 2WXHA 2IY1B 1JMLA 4EEWA 2INPE 2GBMA 5KHOA 2Y5BB 2BS4B 2KDMA 4LNFA 3NOBA 3DBSA 3UIOB 1WGRA 1XCTL 1RYJA 3SDLC 1SJHD 4OVZA 3I9V1 2VZKD 3T3OA 2D2QA 5JHBA 1WRDB 2V3SA 3ZTCA 1OQRA 2CKHB 4MJSA 2JYEA 2L0TA 3E56A 3SU8X 3QQ8B 3DBRI 4O1NA 2QMTA 2DHZA 4ZRKA 4KDLB 4P6VF 4GDKA 1HE8A 2ZVOA 5AUKA 1CZPA 1EF1A 3IVFA 2Z8LA 2NMQA 4XZ4A 1RLFA 3BY4B 2HD5B 2WDQB 4WJOA 2I1JA 5LNK1 2KLGA 4HJKA 1EWCA 3T3NA 2IY0B 2KWVB 4M01A 3SEBA 3VR9B 2FCMA 4HPMB 2ZCBA 2KVRA 4KGTA 2DAFA 2H89B 2HDEA 3ZO5B 3NJTA 3DBLI 1OEYA 1I4QA 3HRDD 2YVCA 4UDUC 1L4ZB 3NZ3A 4DXFA 2L00B 4X57B 3DBRB 3KUCB 3U30A 3ECIA 4TV3A 2QILA 3I63C 1N5XA 1VJKA 1ZKHA 3RCZA 2DLBA 1P9DU 3PS6A 3RNBC 2KTRB 2QIEB 2Y5CA 2PIAA 5IO9A 4S0RA 1VRAB 3N1XC 4ANXA 1EO6A 5CHWA 1YQ4B 2JWZA 4F7ZA 4NPNA 1B1ZA 2MRPA 5BYRA 4TSSA 4HROA 4BKSD 2QCZA 3APCA 3DBLB 4KKJA 3TEZA 5E6JA 3ZNZB 2OOBB 1N63A 1WIAA 3AN1A 1E5WA 1OFFA 4HKQA 3ETRA 4FULA 2V0GA 2J0MA 4IWOA 3RZFA 4XDDA 1NVID 1LQBA 1LM8B 1WGHA 4LNKA 4ZOHC 3W1SC 1WX7A 4OZBA 4MH8A 2KO3A 5TR5A 4HRSA 3ZDMC 1FRDA 3Q14C 5HI1A 1MG8A 2L05A 1FEHA 2WDTB 5AEKB 3Q8CA 2FAZA 2BT6A 3GOEA 3N32A 2NVUI 1XXGA 2FIFA 4IOIE 2KDBA 3WAPA 2JRIB 2SEBD 1K8RB 2R2QA 1UWMA 2KC1A 2WX0A 2CR5A 4JWUC 3VFKA 3UIPB 4MSQB 2C7HA 4YSZB 4XX5A 3IFWB 2REXA 5HKHA 3SHQA 3V62A 4DHZB 3KUDB 1T0YA 4WJQA 3TJPA 1T0SC 1EF5A 4J3OD 1I7HA 2KAJA 2C5LC 3PVLA 1P98A 3AE9B 3W2DA 2KFJA 4N6EB 4BKSA 2OEDA 2IO2B 2JPHA 2M56B 3W5UB 5DCNA 2UU7A 4NZLB 3L10B 3DVGY 3GS2A 1P7EA 3BK1A 3BYYB 3BVMA 2LGYA 1FXIA 1HTOA 4ARCA 2KTRA 1YIWA 4A9AA 1SB3C 3CWIA 1D6EC 3WANA 1JW9D 2KK8A 1PGAA 4A90A 1WYWB 5CTRC 4MT5A 1BUIC 1EWYC 3IAS1 4II2B 3DHHC 4BZAA 1R7SA 3KQ4A 4KZCA 3ZGZA 2WXMA 4DHZE 3R8BA 3P4QB 2RGFA 1WZ0A 4MACA 4CYEA 1PQSA 4EKUA 1GB1A 2Q5WD 2KDIA 1V81A 1T6BX 4IKGA 1TY0A 2D11A 2IO3B 2LRWA 3HIZA 4KV2A 4AP4C 3ZXVA 3QJZA 3V05A 3N30A 1WR6E 3OWEB 3A1QB 4GLSC 4PYUA 4RM9A 3VRBB 1F52A 2NBWB 2KQSA 2PLPA 4M0WB 1PGBA 3B0AA 5FR3A 3UI3A 3NZSA 2J0KA 3Q8EA 4EZLA 1V5TA 4JL9A 3UF8A 4G0NB 1N6ZA 1VDVA 2KOXA 3R2IA 4PT5A 4OZCA 1H8CA 2KJ6A 4B0MA 1J7AA 2EMSA 4BVUC 1E8ZA 1HQRD 2V4LA 2HJ8A 4LK0M 1QQRA 4MELA 2KWCA 4G3XB 4W9HA 3RNFC 4B6WA 2K3UA 1YD8U 2CJNA 2TSSA 2GI9A 2ACZB 5IKCM 1WE6A 2LD9A 5LXIB 4GIVA 4DXAB 2K8BA 2J0JA 2LASA 1WH3A 2GMIC 1XLPA 1FM0D 4HLEA 1L4DB 4PK1A 2IGHA 1XEEA 4ZRJA 2PEAA 4XWTA 3U52E 2WYQA 4MDKE 4H2AA 2MBBB 5G2NA 3UQAA 1WF9A 2DENB 3IT6B 5DPTA 1AW7A 3VTVA 2EMTA 1UELA 5C1ZA 3QC8B 2N1WA 3DVNU 1V1PB 4DDID 3GE8C 2QEJC 4E3CA 4F1SA 4OHJA 1Y8RC 2JSVX 3P4SB 1IBXB 2BWES 4ZRQA 2WXNA 1GOZA 4K3CA 1BMLC 1JROA 2JZPA 2PVOD 2I1KA 2CU3A 3V6CB 4BOZB 4C80A 2MLBA 2KANA 1Q0WB 3Q2AC 1ZGUB 3BK2A 2SAKA 3AB5A 5HHDG 4K7SA 5IN7A 4W9LA 2AL3A 2NTSA 2BS3B 2J42A 2BYTA 3DHGC 4NQLB 3ABVB 1XLOA 3DOWA 4HJGE 2ZVNA 4XWWA 3DDCB 3A1QA 3U2SC 4EFOA 2FIDA 3NVVA 2LVOA 5CX3A 1L2NA 1E90A 3VRAB 3P2BA 5D6JB 4LCDE 4JWSC 2D07B 1UUPA 3Q3JA 1IYFA 2WGSA 3ALBA 3OLMD 1WJ4A 2YEPB 2ZNVC 4MEMA 5D3DA 4M02A 4RGMA 2N7EA 3ZQ4A 4XYCA 1HZ5A 3BINA 4W9KA 4FHKA 2BWFA 3R66C 4MGKE 3RNCC 3KVFB 2KMMA 1E8WA 3APFA 1GC6A 3Q6BA 2IJ0A 3ZXRA 2GB1A 4OVUA 3DQVA 2N7JA 4GMVA 3AE1B 1E8YA 3AH7A 4OVVA 3VUYA 4JQWC 3T8MA 3DPDA 4BOSC 2AX5A 3NVYA 3R7QA 2WXGA 3W5VB 4LNIA 1KF6B 2W3SA 1STEA 4RFBA 2D5GA 2UWQA 2M0XA 3EHVA 1T3QA 3EFCA 3WAMA 1UF0A 2GBJA 1V80A 4F8CB 3AU5A 4OZAA 3KYDD 1FMAD 3ONSA 1DGJA 1V1PA 4BBNF 1GB4A 2DWQA 1PUTA 3H1UA 2DBYA 1QKZA 2PTLA 3AE6B 1TS4A 2NTTA 2L7RA 1IBXA 2GRIA 2M1MA 2V3PA 1ET9A 3TUOA 4JE3B 1Q10A 2Y3AA 1WWTA 2AEHA 1V86A 3RNEC 1OQQA 2K6DB 1FIQA 2C60A 2KD0A 1V49A 3EUB2 1Y56A 5DPWA 2WLBA 2LJ5A 2LEKA 3N20C 4AUQC 1AARA 1RAXA 3BWUD 4LNNA 1WGDA 1L7YA 4EUTA 4KX6B 1UBQA 2VH1A 4LJPB 4YTMB 1ACCA 3PZ7A 3Q3NC 2G1EA 3KW5B 5BYQA 3IXSA 2AQ1B 1QF6A 3PRMB 4TKNA 4NAWB 1L0VB 1KLVA 2JF5A 3TL5A 1KOTA 3MTNB 2JXXA 4GXBA 1RM6C 4JPSA 4B95A 2WDVB 1F2RC 1TY2A 3NS8A 1WMHB 2MHJA 5D94A 1S3SG 1FD6A 1RFAA 3ZRCA 4RH6A 3Q3FA 1FPYA 4WAFA 3UQBA 5C23A 1JWBD 1TYGB 5HG2A 2X38A 3OG5A 4OW0A 3L54A 3P1MA 2WU2B 3CIRB 2N4FA 3HVZA 5E6OA 5JXVA 4KGRA 1E7VA 5J18A 1TJEA 1C4PA 1JWAD 2XNAC 3AEDB 2BBCA 2M0AA 3Q8FA 2PKOA 1NI2A 1UNSA 4HPPA 4JGHB 5JHAA 1IGDA 4BBNC 1YN4A 2KMAA 3VDZA 3ZJTA 4C4VB 2D3BA 4ZRIA 1RFKA 2KJRA 2JY6A 2KT7A 4P16A 1E7PB 4C7ZA 5HFYA 3NZUA 3H9DA 2JWUA 4KDIC 1R4MI 3TEYA 2X8XX 1NBFC 1HTQA 3VQIA 3JSVB 2JVCA 2NPTB 4KZ0A 1PYWD 2WX1A 3H8HA 4PYZA 3P42A 1KM7A 3PV1A 3PRPB 3APDA 1V6EA 2D3AA 2W3RA 1WX9A 4IM2A 2WXJA 3ZNID 1H4RA 3SFEB 3ZDTA 3QX1A 5LXHA 3Q3MC 3H7PB 1YQBA 2ZW0A 1FO4A 2ZW1A 1OEYJ 3ZNHB 1XCQL 1YN5A 3QWZB 1E9MA 3LJ3A 1GNUA 1R4MB 2YLMA 4KSLC 1I35A 1V9JA 4HKZE 1A70A 4WURA 4NAWA 4PS3A 3CF6E 3I3TB 2N9EB 3EC8A 4NJ6A 3ENEA 3ZJUA 1WMHA 3VR8B 3LB8C 1NEKB 1WXAA 2OJRA 3PLUA 1G6JA 2A5UA 2MBHA 3BVGA 2OHFA 2V3NA 2WHIA 1ZDXA 1GAQB 1C3TA 1SE9A 3IAM1 3MHSD 5IOIA 2B76B 4ZRPA 2WP9B 4YL8A 3U8ZA 1C4AA 3S2AA 2LHDA 2KQ4X 1YJIA 2KXJA 3V61A 2IPKD 2WXQA 3TSSA 1Z5SB 2K6QA 3TEXA 3RI7C 2KHWB 1KRHA 4C4VA 4R3DA 4AQ7A 2RSUA 5GXGB 3QA8A 2QJLA 4ICVA 1MJDA 4DQOC 1SIJA 1OGWA 4I6LB 3DCGA 3JSVA 2LUMA 3AE4B 2NPTA 3DBHI 1SGHA 3IT4B 2CS4A 1CK1A 3B2GA 3EGRA 4LNOA 3M3JA 1T0RC 3A4SC 1N5WA 3AEGB 4W9FA 4BKTA 1NYQA 3DVGX 2M8SA 3AEEB 1TKEA 4FADA 3A9JB 4USAA 3ZRFA 2KYWA 1DOXA 1SE2A 2AWTA 2K25A 1ROEA 1WXSA 4K7WA 5BMHA 4YT0B 1OQYA 2RPQA 1KTKA 4MGYE 3H7PA 3L4PA 2ZZPB 3V6EB 3CMMB 3GP7A 1E6EB 3QK0A 2M19A 4IC7B 3RT3B 2N1VA 4YXDB 1MHHE 4K7UA 3QHTA 4E71A 1FXAA 1NENB 2FE8A 2J4XA 3DBHB 2XEWA 4ANWA 3UINB 2O6VB 1F77A 3C8YA 4G50A 1WFYA 3ML9A 2IDYA 3LXFA 4CHKA 1T5XD 3EA6A 2GBKA 1OTRB 1I4PA 2JRHA 3KH0A 2INDC 2AQ2B 3CSFA 2ZJDA 5EE1A 4L23A 4FXCA 3A33B 1LXDA 3RZWC 4FJVB 4II3B 4TQ0A 4HXDA 2ONQA 1TGZB 5IA7A 4J6IA 1V5OA 4WQOB 1FXTB 2KZRA 3EECA 3VAWA 3H7SA 3O13A 2G4DB 1JRPA 2O6VD 3MC9A 3PZ8A 5J17A 3T9LA 2DYBA 4P1CC 2IYDB 4S17A 3QAQA 2DZMA 4W9IA 3SD5A 2A4ZA 1XO3A 4NJCA 1WGKA 1C4CA 5KHQA 1MI0A 3C0RB 1FCCC 1ET6A 2J7QB 3TEWA 2RR9A 2EELA 2K0PA 1JWSD 1Q5WB 3L13A 3I57A 2DZIA 1XT9B 1P3QU 2BYFA 1SF0A 1EUVB 3RD2A 3B1LX 4E74A 2IGDA 1YMHE 4XE0A 4XC2A 2GBNA 3B2FA 1JCKB 2XN9C 2C7NB 4W9GA 2LZ6A 2WWZA 1AWDA 4FA6A 1YX6B 1P0RA 5FKAC 1TKGA 3ZW3A 2MCNB 3HVDA 3R3MA 4IG7B 1V1OA 2MJ3A 2N7DA 2M17A 2WXOA 1TIFA 2K8HA 2BW2A 1QOGA 3V60A 1ZDVA 2O6VA 4DBGA 2AQ3B 2PW9A 3CSTA 1L0YB 2IGGA 2OJWA 4KIKB 3V3XA 4L2YA 2NS5A 1V8CA 4RM8A 2XK5B 2M4NA 1TZ1A 3HHMA 3MFGA 4HWIB 2G9HD 3O65B 1I4HA 2LUEA 3RPFC 4WJNA 3D32A 4EZJA 3NUHB 2ZCCA 2W54A 1I42A 4RF0A 3Q8BA 2CU1A 3N3KB 1PDXA 1WGYA 3BIID 3WALA 2KMCA 3JYUA 1QZEA 1WSPA 4M0WA 1IPGA 3W1SA 4DHJB 1LO5D 2NCNA 1ZW7A 2GOWA 2QC8A 4A55A 4MM3B 1K50A 1WE7A 5DPRA 2ZPNA 5BO4B 4A3PA 1J7CA 2N9XA 4YWGG 4N58A 1WX8A 4A20A 2WXKA 2MQJA 1I4GA 2KJHB 1L5PA 4W9EA 5G5HA 3KUZA 2K5PA 1KLGD 1TTNA 2CHWA 1FNWA 4MGIE 1VZ8A 2DYMA 1WZ3A 3SR6A 4ASWC 2KFKB 3J9CA 2LGIA 4RF1A 1UZXB 4DHJD 4KSKC 5I4DA 3FILB 4RGNA 1N60A 4DWFA 2RD0A 5G55A 2MEKA 4GU2A 2O2VB 1ZXIA 4JX1C 1GG3A 2MW5A 4MJSB 2V4IB 2K8CA 3KLSX 1JWMD 4GN1A 2QHOA 5AZGA 4Q2JA 4IUMB 5D2MB 1NDDA 4ZDVA 2MBQA 3U7DA 4YSYB 1WXQA 1QOFA 4M00A 2LJIA 2PE9A 4BKGA 1SSNA 3NG0A 2JQRB 2RDGA 2WXIA 1D5MC 3IHPC 2PE6B 1CMXB 2GLSA 3WAOA 2MA9B 4US8A 1D4BA 1ZPSA 2ASQA 3ZJVA 4NAMA 3FAHA 3HK0A 5BMGA 2MP2B 2HE7A 2IBIB 2NR2A 1YJ1A 1D5XC 3ML8A 2H88B 1D3ZA 1SIFA 3AI5A 4CQNA 3RYTA 1T0QC 4AS1A 4HPLB 3OAWA 4WQMA 2PPHA 3AE3B 1GUAB 3K9PB 1K51A 2Z59B 2BF8B 4REZA 2LXAA 4KIKA 3X0WA 4D2KA 4GB9A 2ZEQA 2XK5A 1KJTA 1TS5A 4KVGB 3KWLA 2MH7A 1IUEA 3P4RB 3BYTB 1X1MA 1K53A 5MPOA 1QOBA 4YTPB 2KN5A 1NYRA 3VH4B 4A8XC 3IBEA 2FUHB 3N1YC 1L0XB 2CJOA 3PREA 2FNJB 4WWNA 2JYTA 5BYSA 3ZLZA 2HJ1A 2MJEA 3VVWB 2N9KA 2D3CA 2MSED 1XQQA 2I38A 4GDLB 3HM6X 1ZOYB 5C3JB 4HVBA 3AU4A 3AMZA 4ITKA 1WGGA 1VLBA 2NBVB 5JZEB 4HEA1 4ANVA 5AUIA 4TQ1A 5EE9A 5TSSA 2KVZA 2FCNA 1MFWA 2INNE 1UD7A 2ZNVB 3M63B 3L08A 1WXVA 1I4RA 2DX5B 1UGMA 3MHZA 3NS1A 1VZ7A 5E6NA 1MPEA 4K3BA 1HA5A 4B9KA 1FFUA 2KFKA 4US9A 1EU3A 3FILA 3MP9A 2O2VA 5FR6A 2BKFA 1SE4A 1WJNA 2RMMA 4W9JA 3ZKJC 2DZKA 3VTWA 4NJ7A 4IW0A 2KKCA 3BVZA 3AEBB 1V2YA 3LDZE 4K81A 1F9JA 1JRUA 2N0SB 3RNAC 2K1FA 1WRIA 1ZE3D 3P63A 1VR9A 1HEZE 3QCAA 2KACA 2JUOA 2XBBC 4FLHA 1EU4A 1PGXA 2MP2A 2C9WB 3FKYA 1RRBA 4RMAA 4URKA 1CQVA 3PLVA 4BAXA 2KDEB 1NI3A 3PSEB 3Q3OC 4RGOS 3VXWA 3QARA 3JVZX
chains in the Genus database with same CATH topology
4GSWA 1WXSA 1WF9A 4K7WA 4TUUA 2DENB 4IM3A 2LGXA 5DPTA 3ZUNA 4FJZA 3VTVA 2EMTA 1OQYA 1UELA 2PJHA 2RPQA 2Z0EB 3QC8B 5C1ZA 2N1WA 3DVNU 3X23A 2G45B 2FCSA 3KYCD 3NY5A 4DDID 4E3CA 4MGYE 3H7PA 4F1SA 5EDSA 2ZZPB 1Y8RC 1BT0A 3V6EB 3CMMB 3QK0A 2DAJA 1WR1A 2BWES 4FHJA 4N9F4 4IC7B 3RT3B 2N1VA 2ZPYA 1J19A 4G11A 4JIOU 4NNJB 3VUXA 3W1YA 4M8MA 2CHXA 4MGZE 5LLIA 1XD3B 4NQKE 5L95C 1IP9A 4K7UA 2I1KA 4MSMB 3AXCA 3V6CB 3QHTA 4BOZB 4E71A 5CHFA 2KNBA 3ZVVA 2MLBA 2KANA 4ANWA 2XEWA 1Q0WB 1U4AA 1ZGUB 3UINB 2O6VB 1C1YB 1WM2A 2JZ3B 4G50A 2EKEC 4K7SA 1WFYA 3RULA 3ML9A 2AL3A 2LVQA 1WI0A 4W9LA 4CHKA 5L83A 4AJYB 4MM3A 1P1AA 2GBKA 1OTRB 2JRHA 3KH0A 4GDLA 2BYEA 4NQLB 3CSFA 2ZJDA 3WIMA 3DOWA 2LGDA 4EOYA 2ZVNA 2L3ZA 3M95A 5JH5C 3DDCB 3RUIB 2IY1B 3A1QA 4EFOA 2FIDA 5E6PA 2LVOA 3HM3A 5CX3A 4EEWA 1L2NA 3A33B 2GBMA 5KHOA 1LXDA 2Y5BB 3R7RA 5CHVC 3RZWC 2MBEA 3PHWB 1E90A 3NOBA 3P2BA 4FJVB 4II3B 5D6JB 3DBSA 3UIOB 4LCDE 3PTFC 4HXDA 4TQ0A 5D7GA 1TGZB 1WGRA 4J6IA 1V5OA 2D07B 3PT2B 4WQOB 1FXTB 5IA7A 2KQ7A 3Q3JA 1IYFA 3ALBA 3OLMD 3PRZA 2KZRA 1WJ4A 3SDLC 3EECA 3PPAA 2ZNVC 3VAWA 4MEMA 3H7SA 2D2QA 2G4DB 5JHBA 2O6VD 2N7EA 1WRDB 4FN2A 2V3SA 2DYOA 5J17A 3BINA 4W9KA 3T9LA 2K39A 2BWFA 2DYBA 2LRUA 4FHKA 3ZTCA 3R66C 4MGKE 2IYDB 4BFRA 2CKHB 2UYZB 3KVFB 3QAQA 2L0TA 4MJSA 3SU8X 4HCNB 2DZMA 1UH6A 4W9IA 1E8WA 3APFA 3SD5A 3QQ8B 3DBRI 2A4ZA 1GC6A 2DHZA 3M62B 2MWSB 3NHEB 4ZRKA 4KDLB 2KDFB 2W9NA 4GDKA 4DK5A 1HE8A 2ZVOA 5KHQA 1GJZA 5GMVA 4OVUA 1WJ6A 2IZVB 1EF1A 3A9KB 3C0RB 3DQVA 4GMVA 1E8YA 4AOFA 3IVFA 2J7QB 4OVVA 3VUYA 2RR9A 4HDQA 3JVZX 4XZ4A 2G3QB 1RLFA 2HD5B 3BY4B 3IG3A 4JQWC 2I1JA 1Q5WB 4WJOA 3T8MA 1J0GA 3DPDA 2KLGA 3JW0X 4HJKA 4BOSC 3R7QA 2IY0B 2KWVB 3L13A 3GZNI 2LXCA 2DZIA 1XT9B 2FCMA 1P3QU 2BYFA 4HPMB 2ZCBA 2KVRA 1A5RA 2UWQA 2M0XA 3EHVA 1EUVB 2D10A 1YX5B 3RD2A 3WAMA 2DAFA 2GBJA 3B1LX 3ZO5B 1V80A 4F8CB 1WY8A 3AU5A 1OEYA 2BYVE 3DBLI 4E74A 2YVCA 4I6NB 3KYDD 4ANUA 4XC2A 3ZIMA 2GBNA 3ONSA 2C7NB 4W9GA 2LZ6A 2L00B 2WWZA 4BBNF 4X57B 4CO7A 2KTFA 3H1UA 4AWJA 4FA6A 1YX6B 3KUCB 4IWQA 1P0RA 3U30A 2L7RA 3ZW3A 2M1MA 2MCNB 4PS7A 3ECIA 4W9CA 2LVPA 3R3MA 4WWOA 3L0WB 4TV3A 4HDOA 4IG7B 2N7DA 2JT4B 2M17A 2AEHA 1V86A 1ZKHA 2K8HA 2K6DB 3L16A 4M8NA 3RCZA 1WJUA 3V60A 2C60A 2KD0A 2O6VA 1V49A 3PZDA 4DBGA 1P9DU 2AL6A 3PS6A 1GC7A 5DPWA 2KTRB 2KX3A 2LJ5A 3CSTA 4AUQC 1AARA 3DVNV 4KIKB 5AZFA 1RAXA 2NBUA 2NS5A 1WGDA 1EO6A 2GBRA 4RM8A 5CHWA 2JWZA 4ANXA 2XK5B 4F7ZA 2M4NA 4NPNA 1TZ1A 3HHMA 3PGEA 2MRPA 1L7YA 4EUTA 4HWIB 4BKSD 1UBQA 4LJPB 3APCA 3O65B 2LUEA 2BGFA 3ZNZB 4WJNA 2OOBB 3D32A 4EZJA 2ZCCA 1WIAA 1E5WA 1UBIA 4AJWA 3KW5B 4HCPB 1I42A 2CU1A 3N3KB 4FULA 2J0MA 1WGYA 3PRMB 3WALA 2KMCA 3JYUA 4TKNA 1QZEA 4NAWB 5DPSA 1IPGA 1WXMA 3W1SA 4DHJB 2NCNA 2BKRB 1ZW7A 4IWOA 3RZFA 2GOWA 2L8JA 1KLVA 2JF5A 3TL5A 1KOTA 3VTUA 1LQBA 4HK2A 1LM8B 3MTNB 2JXXA 3TIXA 1WE7A 1WGHA 5DPRA 4GXBA 2ZPNA 2BPSA 4B95A 3W1SC 2DZJA 5BO4B 4A3PA 1WX7A 2N9XA 4I6PA 2MBOA 3NS8A 1WMHB 2CHZA 2KO3A 5D94A 1S3SG 1RFAA 1WX8A 5TR5A 4A20A 3ZRCA 2MQJA 3ZDMC 2KJHB 1E7UA 1MG8A 3Q3FA 2L05A 2WDTB 3UQBA 5AEKB 5C23A 2L76A 2FAZA 3GOEA 4W9EA 3KUZA 2IO1B 3N32A 3L54A 1TTNA 2NVUI 2CHWA 3A9KA 2N9PC 2FIFA 2KDBA 4MGIE 3TBLD 2JRIB 3WAPA 2DYMA 1WZ3A 2N4FA 1K8RB 2R2QA 4ASWC 2KFKB 5E6OA 4FBJB 1UZXB 4DHJD 4KSKC 2KC1A 4DWFA 1E7VA 2RD0A 5G55A 5J18A 4GU2A 2O2VB 2WX0A 2CR5A 3VFKA 2Z0DB 3UIPB 4MSQB 1GG3A 4JLCA 2C7HA 2MW5A 4XX5A 4MJSB 2V1YA 2K8CA 3IFWB 2REXA 4GN1A 5HKHA 3SHQA 2QHOA 4A3OA 3OJ3A 5AZGA 1NI2A 3V62A 4IUMB 5D2MB 3H6NA 4JGHB 3OJ4B 4DHZB 3KUDB 1NDDA 4ZDVA 2MBQA 1T0YA 5JHAA 2IO0B 4WJQA 3U7DA 4BBNC 3TJPA 2KMAA 2PE9A 3VDZA 1EF5A 3A9JA 4LJOB 4BKGA 1ISNA 4ZRIA 2C5LC 3AULA 3PVLA 2KJRA 2JY6A 1P98A 2KFJA 4PS8A 5IAAC 1TBEA 3IHPC 2PE6B 3ZTDA 4BKSA 3NZUA 1CMXB 3H9DA 4KDIC 1R4MI 2IO2B 3WAOA 2JPHA 1NBFC 2MA9B 3A4RA 2ASQA 3JSVB 2D3GA 3VQIA 2JVCA 5DCNA 2NPTB 3EFUA 4KZ0A 2WX1A 4EZKA 2JZZA 3L10B 4PYZA 3DVGY 1KM7A 3PV1A 3HK0A 3PRPB 2MP2B 3TMPB 2HE7A 3APDA 1V6EA 2IBIB 1YJ1A 2NR2A 3B08A 3ML8A 1D3ZA 1SIFA 1WX9A 3AI5A 3RYTA 4IM2A 4HPLB 3OAWA 2LGYA 2PPHA 1GUAB 3ZNID 1M94A 2KTRA 3K9PB 1H4RA 2Z59B 2BF8B 1YIWA 3ZDTA 2LXAA 4KIKA 3QX1A 3X0WA 4GB9A 2ZEQA 2XK5A 1KJTA 4KVGB 3TCAA 3WANA 2KK8A 5LXHA 1WYWB 1X1MA 3H7PB 5CTRC 1YQBA 4WAAA 2KN5A 4K1RB 3VH4B 4II2B 3MJWA 4GOCA 1OEYJ 3ZNHB 3IBEA 5AZHA 2FUHB 4KZCA 3PREA 3QWZB 3VH3B 3LJ3A 2R2OA 1GNUA 4DHZE 2FNJB 4WWNA 2YLMA 4KSLC 2RGFA 1V9JA 1I35A 1WZ0A 4NAWA 1Q1OA 2LWPA 4PS3A 4WJPA 3ZLZA 4P7IA 4CYEA 3CF6E 3VVWB 1PQSA 3I3TB 2FCQA 3ZNGC 4EKUA 2MSED 1XQQA 2N9EB 3EC8A 3WA0A 2MX2A 4NJ6A 2KDIA 1V81A 2D11A 2IO3B 2KLCA 2LRWA 3ENEA 4GDLB 3K9OB 3HM6X 5J2RA 3HIZA 4HVBA 1VCBA 4KV2A 4AP4C 1WMHA 3AU4A 3QJZA 1WGGA 3N30A 1WR6E 3UQAA 2NBVB 4W9DA 5JZEB 4ANVA 1WXAA 2AYOB 2B3AA 2L0FA 3A1QB 4TQ1A 2OJRA 4PYUA 2FCNA 4LDTB 4RM9A 3PLUA 1G6JA 1UD7A 2A5UA 2KWUB 2MBHA 2NBWB 2ZNVB 2KQSA 3M63B 3L08A 1WXVA 2DX5B 1UGMA 1C3TA 4FJYA 4M0WB 1SE9A 2HTHA 1VD2A 3B0AA 5E6NA 4B9KA 3NZSA 4ICUA 3MHSD 2KFKA 2J0KA 4EZLA 1V5TA 4IWPA 4JL9A 3UF8A 4G0NB 2KOXA 2O2VA 5FR6A 4WWPA 4YL8A 1R4NI 4MH0E 3U8ZA 3S2AA 2BKFA 1H8CA 2KJ6A 2KX0A 2KXJA 1WJNA 3V61A 2EMSA 4BVUC 1Z5SB 4GGQA 2C7MB 1E8ZA 2K6QA 2V4LA 4W9JA 2HJ8A 3ZKJC 2KHWB 3QIJA 2DZKA 4MELA 3VTWA 4NJ7A 4IW0A 2KKCA 4LDTD 2KWCA 4G3XB 4W9HA 2KC2A 4B6WA 1V2YA 1YD8U 4GDKB 3LDZE 3PHXB 2RSUA 4K81A 3QA8A 4IM0A 4ICVA 1F9JA 1JRUA 1WE6A 2LD9A 5LXIB 3VHTC 4ZYNA 4GIVA 4DXAB 4DDGD 1OGWA 2K1FA 4I6LB 2K8BA 1S1QB 3UGBB 2J0JA 3DCGA 3JSVA 2LASA 2LI5A 2VRRB 1WH3A 2NPTA 2GMIC 3DBHI 3QCAA 1SGHA 4HLEA 2JUOA 1WM3A 2XBBC 4FLHA 2CS4A 3L17A 2MP2A 3M3JA 2C9WB 3A4SC 1Z2MA 2G4SA 1RRBA 4W9FA 1E8XA 4RMAA 4ZRJA 4NY0A 2PEAA 3PLVA 3DVGX 4BKTA 2M8SA 4URKA 4FADA 2KDEB 2WYQA 3PSEB 4MDKE 3VUWA 3A9JB 2MBBB 3ZRFA 5G2NA 1J8CA 1LFDA 3VXWA 3QARA 2AWTA 2K25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GSW A;  1WXS A;  1WF9 A;  4K7W A;  4TUU A;  2DEN B;  4IM3 A;  2LGX A;  5DPT A;  3ZUN A;  4FJZ A;  3VTV A;  2EMT A;  1OQY A;  1UEL A;  2PJH A;  2RPQ A;  2Z0E B;  3QC8 B;  5C1Z A;  2N1W A;  3DVN U;  3X23 A;  2G45 B;  2FCS A;  3KYC D;  3NY5 A;  4DDI D;  4E3C A;  4MGY E;  3H7P A;  4F1S A;  5EDS A;  2ZZP B;  1Y8R C;  1BT0 A;  3V6E B;  3CMM B;  3QK0 A;  2DAJ A;  1WR1 A;  2BWE S;  4FHJ A;  4N9F 4;  4IC7 B;  3RT3 B;  2N1V A;  2ZPY A;  1J19 A;  4G11 A;  4JIO U;  4NNJ B;  3VUX A;  3W1Y A;  4M8M A;  2CHX A;  4MGZ E;  5LLI A;  1XD3 B;  4NQK E;  5L95 C;  1IP9 A;  4K7U A;  2I1K A;  4MSM B;  3AXC A;  3V6C B;  3QHT A;  4BOZ B;  4E71 A;  5CHF A;  2KNB A;  3ZVV A;  2MLB A;  2KAN A;  4ANW A;  2XEW A;  1Q0W B;  1U4A A;  1ZGU B;  3UIN B;  2O6V B;  1C1Y B;  1WM2 A;  2JZ3 B;  4G50 A;  2EKE C;  4K7S A;  1WFY A;  3RUL A;  3ML9 A;  2AL3 A;  2LVQ A;  1WI0 A;  4W9L A;  4CHK A;  5L83 A;  4AJY B;  4MM3 A;  1P1A A;  2GBK A;  1OTR B;  2JRH A;  3KH0 A;  4GDL A;  2BYE A;  4NQL B;  3CSF A;  2ZJD A;  3WIM A;  3DOW A;  2LGD A;  4EOY A;  2ZVN A;  2L3Z A;  3M95 A;  5JH5 C;  3DDC B;  3RUI B;  2IY1 B;  3A1Q A;  4EFO A;  2FID A;  5E6P A;  2LVO A;  3HM3 A;  5CX3 A;  4EEW A;  1L2N A;  3A33 B;  2GBM A;  5KHO A;  1LXD A;  2Y5B B;  3R7R A;  5CHV C;  3RZW C;  2MBE A;  3PHW B;  1E90 A;  3NOB A;  3P2B A;  4FJV B;  4II3 B;  5D6J B;  3DBS A;  3UIO B;  4LCD E;  3PTF C;  4HXD A;  4TQ0 A;  5D7G A;  1TGZ B;  1WGR A;  4J6I A;  1V5O A;  2D07 B;  3PT2 B;  4WQO B;  1FXT B;  5IA7 A;  2KQ7 A;  3Q3J A;  1IYF A;  3ALB A;  3OLM D;  3PRZ A;  2KZR A;  1WJ4 A;  3SDL C;  3EEC A;  3PPA A;  2ZNV C;  3VAW A;  4MEM A;  3H7S A;  2D2Q A;  2G4D B;  5JHB A;  2O6V D;  2N7E A;  1WRD B;  4FN2 A;  2V3S A;  2DYO A;  5J17 A;  3BIN A;  4W9K A;  3T9L A;  2K39 A;  2BWF A;  2DYB A;  2LRU A;  4FHK A;  3ZTC A;  3R66 C;  4MGK E;  2IYD B;  4BFR A;  2CKH B;  2UYZ B;  3KVF B;  3QAQ A;  2L0T A;  4MJS A;  3SU8 X;  4HCN B;  2DZM A;  1UH6 A;  4W9I A;  1E8W A;  3APF A;  3SD5 A;  3QQ8 B;  3DBR I;  2A4Z A;  1GC6 A;  2DHZ A;  3M62 B;  2MWS B;  3NHE B;  4ZRK A;  4KDL B;  2KDF B;  2W9N A;  4GDK A;  4DK5 A;  1HE8 A;  2ZVO A;  5KHQ A;  1GJZ A;  5GMV A;  4OVU A;  1WJ6 A;  2IZV B;  1EF1 A;  3A9K B;  3C0R B;  3DQV A;  4GMV A;  1E8Y A;  4AOF A;  3IVF A;  2J7Q B;  4OVV A;  3VUY A;  2RR9 A;  4HDQ A;  3JVZ X;  4XZ4 A;  2G3Q B;  1RLF A;  2HD5 B;  3BY4 B;  3IG3 A;  4JQW C;  2I1J A;  1Q5W B;  4WJO A;  3T8M A;  1J0G A;  3DPD A;  2KLG A;  3JW0 X;  4HJK A;  4BOS C;  3R7Q A;  2IY0 B;  2KWV B;  3L13 A;  3GZN I;  2LXC A;  2DZI A;  1XT9 B;  2FCM A;  1P3Q U;  2BYF A;  4HPM B;  2ZCB A;  2KVR A;  1A5R A;  2UWQ A;  2M0X A;  3EHV A;  1EUV B;  2D10 A;  1YX5 B;  3RD2 A;  3WAM A;  2DAF A;  2GBJ A;  3B1L X;  3ZO5 B;  1V80 A;  4F8C B;  1WY8 A;  3AU5 A;  1OEY A;  2BYV E;  3DBL I;  4E74 A;  2YVC A;  4I6N B;  3KYD D;  4ANU A;  4XC2 A;  3ZIM A;  2GBN A;  3ONS A;  2C7N B;  4W9G A;  2LZ6 A;  2L00 B;  2WWZ A;  4BBN F;  4X57 B;  4CO7 A;  2KTF A;  3H1U A;  4AWJ A;  4FA6 A;  1YX6 B;  3KUC B;  4IWQ A;  1P0R A;  3U30 A;  2L7R A;  3ZW3 A;  2M1M A;  2MCN B;  4PS7 A;  3ECI A;  4W9C A;  2LVP A;  3R3M A;  4WWO A;  3L0W B;  4TV3 A;  4HDO A;  4IG7 B;  2N7D A;  2JT4 B;  2M17 A;  2AEH A;  1V86 A;  1ZKH A;  2K8H A;  2K6D B;  3L16 A;  4M8N A;  3RCZ A;  1WJU A;  3V60 A;  2C60 A;  2KD0 A;  2O6V A;  1V49 A;  3PZD A;  4DBG A;  1P9D U;  2AL6 A;  3PS6 A;  1GC7 A;  5DPW A;  2KTR B;  2KX3 A;  2LJ5 A;  3CST A;  4AUQ C;  1AAR A;  3DVN V;  4KIK B;  5AZF A;  1RAX A;  2NBU A;  2NS5 A;  1WGD A;  1EO6 A;  2GBR A;  4RM8 A;  5CHW A;  2JWZ A;  4ANX A;  2XK5 B;  4F7Z A;  2M4N A;  4NPN A;  1TZ1 A;  3HHM A;  3PGE A;  2MRP A;  1L7Y A;  4EUT A;  4HWI B;  4BKS D;  1UBQ A;  4LJP B;  3APC A;  3O65 B;  2LUE A;  2BGF A;  3ZNZ B;  4WJN A;  2OOB B;  3D32 A;  4EZJ A;  2ZCC A;  1WIA A;  1E5W A;  1UBI A;  4AJW A;  3KW5 B;  4HCP B;  1I42 A;  2CU1 A;  3N3K B;  4FUL A;  2J0M A;  1WGY A;  3PRM B;  3WAL A;  2KMC A;  3JYU A;  4TKN A;  1QZE A;  4NAW B;  5DPS A;  1IPG A;  1WXM A;  3W1S A;  4DHJ B;  2NCN A;  2BKR B;  1ZW7 A;  4IWO A;  3RZF A;  2GOW A;  2L8J A;  1KLV A;  2JF5 A;  3TL5 A;  1KOT A;  3VTU A;  1LQB A;  4HK2 A;  1LM8 B;  3MTN B;  2JXX A;  3TIX A;  1WE7 A;  1WGH A;  5DPR A;  4GXB A;  2ZPN A;  2BPS A;  4B95 A;  3W1S C;  2DZJ A;  5BO4 B;  4A3P A;  1WX7 A;  2N9X A;  4I6P A;  2MBO A;  3NS8 A;  1WMH B;  2CHZ A;  2KO3 A;  5D94 A;  1S3S G;  1RFA A;  1WX8 A;  5TR5 A;  4A20 A;  3ZRC A;  2MQJ A;  3ZDM C;  2KJH B;  1E7U A;  1MG8 A;  3Q3F A;  2L05 A;  2WDT B;  3UQB A;  5AEK B;  5C23 A;  2L76 A;  2FAZ A;  3GOE A;  4W9E A;  3KUZ A;  2IO1 B;  3N32 A;  3L54 A;  1TTN A;  2NVU I;  2CHW A;  3A9K A;  2N9P C;  2FIF A;  2KDB A;  4MGI E;  3TBL D;  2JRI B;  3WAP A;  2DYM A;  1WZ3 A;  2N4F A;  1K8R B;  2R2Q A;  4ASW C;  2KFK B;  5E6O A;  4FBJ B;  1UZX B;  4DHJ D;  4KSK C;  2KC1 A;  4DWF A;  1E7V A;  2RD0 A;  5G55 A;  5J18 A;  4GU2 A;  2O2V B;  2WX0 A;  2CR5 A;  3VFK A;  2Z0D B;  3UIP B;  4MSQ B;  1GG3 A;  4JLC A;  2C7H A;  2MW5 A;  4XX5 A;  4MJS B;  2V1Y A;  2K8C A;  3IFW B;  2REX A;  4GN1 A;  5HKH A;  3SHQ A;  2QHO A;  4A3O A;  3OJ3 A;  5AZG A;  1NI2 A;  3V62 A;  4IUM B;  5D2M B;  3H6N A;  4JGH B;  3OJ4 B;  4DHZ B;  3KUD B;  1NDD A;  4ZDV A;  2MBQ A;  1T0Y A;  5JHA A;  2IO0 B;  4WJQ A;  3U7D A;  4BBN C;  3TJP A;  2KMA A;  2PE9 A;  3VDZ A;  1EF5 A;  3A9J A;  4LJO B;  4BKG A;  1ISN A;  4ZRI A;  2C5L C;  3AUL A;  3PVL A;  2KJR A;  2JY6 A;  1P98 A;  2KFJ A;  4PS8 A;  5IAA C;  1TBE A;  3IHP C;  2PE6 B;  3ZTD A;  4BKS A;  3NZU A;  1CMX B;  3H9D A;  4KDI C;  1R4M I;  2IO2 B;  3WAO A;  2JPH A;  1NBF C;  2MA9 B;  3A4R A;  2ASQ A;  3JSV B;  2D3G A;  3VQI A;  2JVC A;  5DCN A;  2NPT B;  3EFU A;  4KZ0 A;  2WX1 A;  4EZK A;  2JZZ A;  3L10 B;  4PYZ A;  3DVG Y;  1KM7 A;  3PV1 A;  3HK0 A;  3PRP B;  2MP2 B;  3TMP B;  2HE7 A;  3APD A;  1V6E A;  2IBI B;  1YJ1 A;  2NR2 A;  3B08 A;  3ML8 A;  1D3Z A;  1SIF A;  1WX9 A;  3AI5 A;  3RYT A;  4IM2 A;  4HPL B;  3OAW A;  2LGY A;  2PPH A;  1GUA B;  3ZNI D;  1M94 A;  2KTR A;  3K9P B;  1H4R A;  2Z59 B;  2BF8 B;  1YIW A;  3ZDT A;  2LXA A;  4KIK A;  3QX1 A;  3X0W A;  4GB9 A;  2ZEQ A;  2XK5 A;  1KJT A;  4KVG B;  3TCA A;  3WAN A;  2KK8 A;  5LXH A;  1WYW B;  1X1M A;  3H7P B;  5CTR C;  1YQB A;  4WAA A;  2KN5 A;  4K1R B;  3VH4 B;  4II2 B;  3MJW A;  4GOC A;  1OEY J;  3ZNH B;  3IBE A;  5AZH A;  2FUH B;  4KZC A;  3PRE A;  3QWZ B;  3VH3 B;  3LJ3 A;  2R2O A;  1GNU A;  4DHZ E;  2FNJ B;  4WWN A;  2YLM A;  4KSL C;  2RGF A;  1V9J A;  1I35 A;  1WZ0 A;  4NAW A;  1Q1O A;  2LWP A;  4PS3 A;  4WJP A;  3ZLZ A;  4P7I A;  4CYE A;  3CF6 E;  3VVW B;  1PQS A;  3I3T B;  2FCQ A;  3ZNG C;  4EKU A;  2MSE D;  1XQQ A;  2N9E B;  3EC8 A;  3WA0 A;  2MX2 A;  4NJ6 A;  2KDI A;  1V81 A;  2D11 A;  2IO3 B;  2KLC A;  2LRW A;  3ENE A;  4GDL B;  3K9O B;  3HM6 X;  5J2R A;  3HIZ A;  4HVB A;  1VCB A;  4KV2 A;  4AP4 C;  1WMH A;  3AU4 A;  3QJZ A;  1WGG A;  3N30 A;  1WR6 E;  3UQA A;  2NBV B;  4W9D A;  5JZE B;  4ANV A;  1WXA A;  2AYO B;  2B3A A;  2L0F A;  3A1Q B;  4TQ1 A;  2OJR A;  4PYU A;  2FCN A;  4LDT B;  4RM9 A;  3PLU A;  1G6J A;  1UD7 A;  2A5U A;  2KWU B;  2MBH A;  2NBW B;  2ZNV B;  2KQS A;  3M63 B;  3L08 A;  1WXV A;  2DX5 B;  1UGM A;  1C3T A;  4FJY A;  4M0W B;  1SE9 A;  2HTH A;  1VD2 A;  3B0A A;  5E6N A;  4B9K A;  3NZS A;  4ICU A;  3MHS D;  2KFK A;  2J0K A;  4EZL A;  1V5T A;  4IWP A;  4JL9 A;  3UF8 A;  4G0N B;  2KOX A;  2O2V A;  5FR6 A;  4WWP A;  4YL8 A;  1R4N I;  4MH0 E;  3U8Z A;  3S2A A;  2BKF A;  1H8C A;  2KJ6 A;  2KX0 A;  2KXJ A;  1WJN A;  3V61 A;  2EMS A;  4BVU C;  1Z5S B;  4GGQ A;  2C7M B;  1E8Z A;  2K6Q A;  2V4L A;  4W9J A;  2HJ8 A;  3ZKJ C;  2KHW B;  3QIJ A;  2DZK A;  4MEL A;  3VTW A;  4NJ7 A;  4IW0 A;  2KKC A;  4LDT D;  2KWC A;  4G3X B;  4W9H A;  2KC2 A;  4B6W A;  1V2Y A;  1YD8 U;  4GDK B;  3LDZ E;  3PHX B;  2RSU A;  4K81 A;  3QA8 A;  4IM0 A;  4ICV A;  1F9J A;  1JRU A;  1WE6 A;  2LD9 A;  5LXI B;  3VHT C;  4ZYN A;  4GIV A;  4DXA B;  4DDG D;  1OGW A;  2K1F A;  4I6L B;  2K8B A;  1S1Q B;  3UGB B;  2J0J A;  3DCG A;  3JSV A;  2LAS A;  2LI5 A;  2VRR B;  1WH3 A;  2NPT A;  2GMI C;  3DBH I;  3QCA A;  1SGH A;  4HLE A;  2JUO A;  1WM3 A;  2XBB C;  4FLH A;  2CS4 A;  3L17 A;  2MP2 A;  3M3J A;  2C9W B;  3A4S C;  1Z2M A;  2G4S A;  1RRB A;  4W9F A;  1E8X A;  4RMA A;  4ZRJ A;  4NY0 A;  2PEA A;  3PLV A;  3DVG X;  4BKT A;  2M8S A;  4URK A;  4FAD A;  2KDE B;  2WYQ A;  3PSE B;  4MDK E;  3VUW A;  3A9J B;  2MBB B;  3ZRF A;  5G2N A;  1J8C A;  1LFD A;  3VXW A;  3QAR A;  2AWT A;  2K25 A; 
#chains in the Genus database with same CATH topology
 4TUU A;  3ZUN A;  2Z0E B;  2N9L A;  4XDC A;  1I4X A;  1C9F A;  3NY5 A;  5EDS A;  4YTN B;  1WR1 A;  1F2R I;  1QIL A;  4FHJ A;  2ZPY A;  1J19 A;  4JIO U;  4NNJ B;  3W1Y A;  4M8M A;  2CHX A;  4NQK E;  5L95 C;  1IP9 A;  3AXC A;  4RGT A;  1KFY B;  2L1A A;  2KNB A;  3MC0 B;  4N59 A;  1U4A A;  1C1Y B;  1WM2 A;  2JZ3 B;  3AE2 B;  2EKE C;  1GPX A;  3RUL A;  2WQY B;  5L83 A;  4AJY B;  3AV8 A;  4GDL A;  4LTU A;  4IDI A;  5H92 C;  5FK9 C;  2LGD A;  2LHE A;  2L3Z A;  2K9X A;  3M95 A;  3RUI B;  2L52 A;  5E6P A;  1YN3 A;  3HM3 A;  1BXT A;  1HZ6 A;  3R7R A;  2W55 A;  5CHV C;  2MBE A;  3PHW B;  2L32 A;  3PTF C;  5D7G A;  4WIP A;  1ZP0 B;  4B0E A;  3PT2 B;  2BTE A;  2KQ7 A;  3C19 A;  3PRZ A;  3RN9 C;  1VZ6 A;  3PPA A;  2JU6 X;  1B9R A;  1HXY D;  3P4P B;  3U7Z A;  4FN2 A;  1C76 A;  3Q69 A;  2DYO A;  2PVG C;  3NRZ A;  2K39 A;  2LRU A;  4P1B C;  4BFR A;  2UYZ B;  5T8I A;  4HCN B;  1UH6 A;  1C79 A;  2YEP F;  3M62 B;  2MWS B;  3NHE B;  1MVK A;  2KDF B;  2W9N A;  4DK5 A;  4L1B A;  2DNF A;  3W9C B;  2BQQ A;  2LMC A;  5GMV A;  1GJZ A;  1WJ6 A;  2IZV B;  3A9K B;  3MJ5 A;  4AOF A;  2FUG 1;  2WXP A;  5D3I B;  4HDQ A;  2G3Q B;  3IG3 A;  1CJE A;  4RNA A;  1J0G A;  3JW0 X;  3URY A;  3GZN I;  2LXC A;  4LLG M;  1N62 A;  1A5R A;  1JWU D;  2D10 A;  1YX5 B;  2QSD A;  1WY8 A;  2BYV E;  1L6U A;  3N1Z C;  3HUI A;  4I6N B;  4ANU A;  3ZIM A;  4WH4 A;  2RDB C;  1ZXH A;  4CO7 A;  2KTF A;  4AWJ A;  2Y5P A;  2J52 A;  3AE8 B;  4IWQ A;  3AE7 B;  4PS7 A;  4W9C A;  2LVP A;  4WWO A;  3L0W B;  4HDO A;  3DHI C;  2JT4 B;  2HTM E;  5H8Y E;  3L16 A;  4M8N A;  1WJU A;  3PZD A;  2AL6 A;  2LFI A;  1GC7 A;  3GZN B;  2KX3 A;  1QLB B;  3DVN V;  5AZF A;  2NBU A;  2GBR A;  3PGE A;  5BMI A;  4ZYS A;  1DOY A;  2BVC A;  2FBW B;  2K22 A;  2QDF A;  2BGF A;  2WDR B;  1KH0 A;  1XLQ A;  3MC8 A;  1M4V A;  4YSX B;  1UBI A;  4AJW A;  4HCP B;  2L83 A;  5DPS A;  4DXG A;  1WXM A;  3DWM A;  3NVW A;  3RNG C;  2BKR B;  2L8J A;  1MG4 A;  2ON8 A;  1TT5 B;  1QT9 A;  3VTU A;  4HK2 A;  4C7Y A;  3TIX A;  2BPS A;  1YJJ A;  3LYY A;  2DZJ A;  4ZHO A;  1K52 A;  3PO0 A;  4I6P A;  2MBO A;  2CHZ A;  1EM7 A;  1C78 A;  3AEC B;  1E7U A;  2R61 A;  2L76 A;  2IO1 B;  1SE3 A;  3A9K A;  2N9P C;  3TBL D;  1D5Z C;  4FBJ B;  2ICI A;  2Z0D B;  2PMV A;  4JLC A;  4RCO A;  3WCQ A;  2V1Y A;  4A3O A;  2KWD A;  3OJ3 A;  3H6N A;  3OJ4 B;  5EE3 A;  2IO0 B;  5EE0 A;  3A9J A;  4LJO B;  1YNT E;  1ISN A;  3AUL A;  1DYQ A;  3I5J C;  4PS8 A;  2MJD A;  5IAA C;  1TBE A;  3ZTD A;  1YQ3 B;  3A4R A;  1PFD A;  2D3G A;  1E0Z A;  3EFU A;  1FCL A;  4EZK A;  2JZZ A;  1F0Z A;  1IGC A;  1AYF A;  3TMP B;  3DWG C;  2RDH A;  3B08 A;  1P7F A;  2E3T A;  3R2T A;  1M94 A;  3GE3 C;  2WXR A;  1XLN A;  3TCA A;  2BS2 B;  3Q8A A;  5IP4 D;  2BB5 A;  2W82 A;  1FNV A;  4WAA A;  4K1R B;  3MJW A;  4GOC A;  3BZD B;  5AZH A;  3RMK C;  1WYG A;  2LGS A;  4ARI A;  2WXL A;  3VH3 B;  4XGA B;  2R2O A;  3N9Y C;  1UWX A;  1UGJ A;  1Q1O A;  2LWP A;  1FFV A;  4WJP A;  4P7I A;  3SFD B;  2FCQ A;  3ZNG C;  4TMA B;  4C56 C;  1MHX A;  3WA0 A;  2MX2 A;  2INC C;  2KLC A;  3U4E G;  3K9O B;  5J2R A;  1VCB A;  4W9D A;  2BB6 A;  2L0F A;  2AYO B;  2B3A A;  2RPV A;  4LDT B;  1JAL A;  1TS2 A;  3B9J A;  2KWU B;  1ZUD 2;  1N61 A;  1L6V A;  4FJY A;  4C00 A;  2HTH A;  1VD2 A;  2WU5 B;  4QAY A;  2WNM A;  3AEA B;  1ESF A;  4ICU A;  3RFZ B;  1J7B A;  1C77 A;  4IWP A;  3KWV A;  2E6X A;  4WWP A;  1R4N I;  4MH0 E;  1SBB B;  4WWM A;  1TKY A;  1QOA A;  2KX0 A;  3AE5 B;  4GGQ A;  2C7M B;  2KN4 A;  1E10 A;  1SJE D;  3QIJ A;  3ZYY X;  4LDT D;  3AM9 A;  2KC2 A;  4GDK B;  1ENF A;  1TZO A;  3PHX B;  1SXT A;  2WS3 B;  1DOI A;  4IM0 A;  2I2Y A;  3VHT C;  4ZYN A;  4DDG D;  1S1Q B;  3UGB B;  2VRR B;  1XF5 L;  2LI5 A;  1V97 A;  1JQ4 A;  1FNU A;  1WM3 A;  2EKI A;  5C2T B;  1FRR A;  4EE2 A;  3L17 A;  2V9H A;  1Z2M A;  2G4S A;  1SEB D;  4ACF A;  3NVZ A;  1E8X A;  1YOV B;  4NY0 A;  2JXT A;  3VUW A;  1J8C A;  1LFD A;  1R4N B;  1KLU D;  4GSW A;  4KGS A;  4IM3 A;  2LGX A;  1LGR A;  4FJZ A;  2PJH A;  1TS3 A;  3FC4 A;  3X23 A;  2G45 B;  1F1H A;  2FCS A;  3KYC D;  1BT0 A;  2WXF A;  2DAJ A;  4N9F 4;  4G11 A;  3VUX A;  4MGZ E;  5LLI A;  1XD3 B;  4MSM B;  2JX5 A;  1AN8 A;  5G5G A;  5CHF A;  4ZHP A;  3ZVV A;  2VH2 A;  2VZK B;  1RWS A;  2LVQ A;  1WI0 A;  4A6Q A;  2J53 A;  3AEF B;  4MM3 A;  1P1A A;  3GB1 A;  2BYE A;  3WIM A;  3E9S A;  4EOY A;  4KKI A;  5JH5 C;  2WXH A;  2IY1 B;  1JML A;  4EEW A;  2INP E;  2GBM A;  5KHO A;  2Y5B B;  2BS4 B;  2KDM A;  4LNF A;  3NOB A;  3DBS A;  3UIO B;  1WGR A;  1XCT L;  1RYJ A;  3SDL C;  1SJH D;  4OVZ A;  3I9V 1;  2VZK D;  3T3O A;  2D2Q A;  5JHB A;  1WRD B;  2V3S A;  3ZTC A;  1OQR A;  2CKH B;  4MJS A;  2JYE A;  2L0T A;  3E56 A;  3SU8 X;  3QQ8 B;  3DBR I;  4O1N A;  2QMT A;  2DHZ A;  4ZRK A;  4KDL B;  4P6V F;  4GDK A;  1HE8 A;  2ZVO A;  5AUK A;  1CZP A;  1EF1 A;  3IVF A;  2Z8L A;  2NMQ A;  4XZ4 A;  1RLF A;  3BY4 B;  2HD5 B;  2WDQ B;  4WJO A;  2I1J A;  5LNK 1;  2KLG A;  4HJK A;  1EWC A;  3T3N A;  2IY0 B;  2KWV B;  4M01 A;  3SEB A;  3VR9 B;  2FCM A;  4HPM B;  2ZCB A;  2KVR A;  4KGT A;  2DAF A;  2H89 B;  2HDE A;  3ZO5 B;  3NJT A;  3DBL I;  1OEY A;  1I4Q A;  3HRD D;  2YVC A;  4UDU C;  1L4Z B;  3NZ3 A;  4DXF A;  2L00 B;  4X57 B;  3DBR B;  3KUC B;  3U30 A;  3ECI A;  4TV3 A;  2QIL A;  3I63 C;  1N5X A;  1VJK A;  1ZKH A;  3RCZ A;  2DLB A;  1P9D U;  3PS6 A;  3RNB C;  2KTR B;  2QIE B;  2Y5C A;  2PIA A;  5IO9 A;  4S0R A;  1VRA B;  3N1X C;  4ANX A;  1EO6 A;  5CHW A;  1YQ4 B;  2JWZ A;  4F7Z A;  4NPN A;  1B1Z A;  2MRP A;  5BYR A;  4TSS A;  4HRO A;  4BKS D;  2QCZ A;  3APC A;  3DBL B;  4KKJ A;  3TEZ A;  5E6J A;  3ZNZ B;  2OOB B;  1N63 A;  1WIA A;  3AN1 A;  1E5W A;  1OFF A;  4HKQ A;  3ETR A;  4FUL A;  2V0G A;  2J0M A;  4IWO A;  3RZF A;  4XDD A;  1NVI D;  1LQB A;  1LM8 B;  1WGH A;  4LNK A;  4ZOH C;  3W1S C;  1WX7 A;  4OZB A;  4MH8 A;  2KO3 A;  5TR5 A;  4HRS A;  3ZDM C;  1FRD A;  3Q14 C;  5HI1 A;  1MG8 A;  2L05 A;  1FEH A;  2WDT B;  5AEK B;  3Q8C A;  2FAZ A;  2BT6 A;  3GOE A;  3N32 A;  2NVU I;  1XXG A;  2FIF A;  4IOI E;  2KDB A;  3WAP A;  2JRI B;  2SEB D;  1K8R B;  2R2Q A;  1UWM A;  2KC1 A;  2WX0 A;  2CR5 A;  4JWU C;  3VFK A;  3UIP B;  4MSQ B;  2C7H A;  4YSZ B;  4XX5 A;  3IFW B;  2REX A;  5HKH A;  3SHQ A;  3V62 A;  4DHZ B;  3KUD B;  1T0Y A;  4WJQ A;  3TJP A;  1T0S C;  1EF5 A;  4J3O D;  1I7H A;  2KAJ A;  2C5L C;  3PVL A;  1P98 A;  3AE9 B;  3W2D A;  2KFJ A;  4N6E B;  4BKS A;  2OED A;  2IO2 B;  2JPH A;  2M56 B;  3W5U B;  5DCN A;  2UU7 A;  4NZL B;  3L10 B;  3DVG Y;  3GS2 A;  1P7E A;  3BK1 A;  3BYY B;  3BVM A;  2LGY A;  1FXI A;  1HTO A;  4ARC A;  2KTR A;  1YIW A;  4A9A A;  1SB3 C;  3CWI A;  1D6E C;  3WAN A;  1JW9 D;  2KK8 A;  1PGA A;  4A90 A;  1WYW B;  5CTR C;  4MT5 A;  1BUI C;  1EWY C;  3IAS 1;  4II2 B;  3DHH C;  4BZA A;  1R7S A;  3KQ4 A;  4KZC A;  3ZGZ A;  2WXM A;  4DHZ E;  3R8B A;  3P4Q B;  2RGF A;  1WZ0 A;  4MAC A;  4CYE A;  1PQS A;  4EKU A;  1GB1 A;  2Q5W D;  2KDI A;  1V81 A;  1T6B X;  4IKG A;  1TY0 A;  2D11 A;  2IO3 B;  2LRW A;  3HIZ A;  4KV2 A;  4AP4 C;  3ZXV A;  3QJZ A;  3V05 A;  3N30 A;  1WR6 E;  3OWE B;  3A1Q B;  4GLS C;  4PYU A;  4RM9 A;  3VRB B;  1F52 A;  2NBW B;  2KQS A;  2PLP A;  4M0W B;  1PGB A;  3B0A A;  5FR3 A;  3UI3 A;  3NZS A;  2J0K A;  3Q8E A;  4EZL A;  1V5T A;  4JL9 A;  3UF8 A;  4G0N B;  1N6Z A;  1VDV A;  2KOX A;  3R2I A;  4PT5 A;  4OZC A;  1H8C A;  2KJ6 A;  4B0M A;  1J7A A;  2EMS A;  4BVU C;  1E8Z A;  1HQR D;  2V4L A;  2HJ8 A;  4LK0 M;  1QQR A;  4MEL A;  2KWC A;  4G3X B;  4W9H A;  3RNF C;  4B6W A;  2K3U A;  1YD8 U;  2CJN A;  2TSS A;  2GI9 A;  2ACZ B;  5IKC M;  1WE6 A;  2LD9 A;  5LXI B;  4GIV A;  4DXA B;  2K8B A;  2J0J A;  2LAS A;  1WH3 A;  2GMI C;  1XLP A;  1FM0 D;  4HLE A;  1L4D B;  4PK1 A;  2IGH A;  1XEE A;  4ZRJ A;  2PEA A;  4XWT A;  3U52 E;  2WYQ A;  4MDK E;  4H2A A;  2MBB B;  5G2N A;  3UQA A;  1WF9 A;  2DEN B;  3IT6 B;  5DPT A;  1AW7 A;  3VTV A;  2EMT A;  1UEL A;  5C1Z A;  3QC8 B;  2N1W A;  3DVN U;  1V1P B;  4DDI D;  3GE8 C;  2QEJ C;  4E3C A;  4F1S A;  4OHJ A;  1Y8R C;  2JSV X;  3P4S B;  1IBX B;  2BWE S;  4ZRQ A;  2WXN A;  1GOZ A;  4K3C A;  1BML C;  1JRO A;  2JZP A;  2PVO D;  2I1K A;  2CU3 A;  3V6C B;  4BOZ B;  4C80 A;  2MLB A;  2KAN A;  1Q0W B;  3Q2A C;  1ZGU B;  3BK2 A;  2SAK A;  3AB5 A;  5HHD G;  4K7S A;  5IN7 A;  4W9L A;  2AL3 A;  2NTS A;  2BS3 B;  2J42 A;  2BYT A;  3DHG C;  4NQL B;  3ABV B;  1XLO A;  3DOW A;  4HJG E;  2ZVN A;  4XWW A;  3DDC B;  3A1Q A;  3U2S C;  4EFO A;  2FID A;  3NVV A;  2LVO A;  5CX3 A;  1L2N A;  1E90 A;  3VRA B;  3P2B A;  5D6J B;  4LCD E;  4JWS C;  2D07 B;  1UUP A;  3Q3J A;  1IYF A;  2WGS A;  3ALB A;  3OLM D;  1WJ4 A;  2YEP B;  2ZNV C;  4MEM A;  5D3D A;  4M02 A;  4RGM A;  2N7E A;  3ZQ4 A;  4XYC A;  1HZ5 A;  3BIN A;  4W9K A;  4FHK A;  2BWF A;  3R66 C;  4MGK E;  3RNC C;  3KVF B;  2KMM A;  1E8W A;  3APF A;  1GC6 A;  3Q6B A;  2IJ0 A;  3ZXR A;  2GB1 A;  4OVU A;  3DQV A;  2N7J A;  4GMV A;  3AE1 B;  1E8Y A;  3AH7 A;  4OVV A;  3VUY A;  4JQW C;  3T8M A;  3DPD A;  4BOS C;  2AX5 A;  3NVY A;  3R7Q A;  2WXG A;  3W5V B;  4LNI A;  1KF6 B;  2W3S A;  1STE A;  4RFB A;  2D5G A;  2UWQ A;  2M0X A;  3EHV A;  1T3Q A;  3EFC A;  3WAM A;  1UF0 A;  2GBJ A;  1V80 A;  4F8C B;  3AU5 A;  4OZA A;  3KYD D;  1FMA D;  3ONS A;  1DGJ A;  1V1P A;  4BBN F;  1GB4 A;  2DWQ A;  1PUT A;  3H1U A;  2DBY A;  1QKZ A;  2PTL A;  3AE6 B;  1TS4 A;  2NTT A;  2L7R A;  1IBX A;  2GRI A;  2M1M A;  2V3P A;  1ET9 A;  3TUO A;  4JE3 B;  1Q10 A;  2Y3A A;  1WWT A;  2AEH A;  1V86 A;  3RNE C;  1OQQ A;  2K6D B;  1FIQ A;  2C60 A;  2KD0 A;  1V49 A;  3EUB 2;  1Y56 A;  5DPW A;  2WLB A;  2LJ5 A;  2LEK A;  3N20 C;  4AUQ C;  1AAR A;  1RAX A;  3BWU D;  4LNN A;  1WGD A;  1L7Y A;  4EUT A;  4KX6 B;  1UBQ A;  2VH1 A;  4LJP B;  4YTM B;  1ACC A;  3PZ7 A;  3Q3N C;  2G1E A;  3KW5 B;  5BYQ A;  3IXS A;  2AQ1 B;  1QF6 A;  3PRM B;  4TKN A;  4NAW B;  1L0V B;  1KLV A;  2JF5 A;  3TL5 A;  1KOT A;  3MTN B;  2JXX A;  4GXB A;  1RM6 C;  4JPS A;  4B95 A;  2WDV B;  1F2R C;  1TY2 A;  3NS8 A;  1WMH B;  2MHJ A;  5D94 A;  1S3S G;  1FD6 A;  1RFA A;  3ZRC A;  4RH6 A;  3Q3F A;  1FPY A;  4WAF A;  3UQB A;  5C23 A;  1JWB D;  1TYG B;  5HG2 A;  2X38 A;  3OG5 A;  4OW0 A;  3L54 A;  3P1M A;  2WU2 B;  3CIR B;  2N4F A;  3HVZ A;  5E6O A;  5JXV A;  4KGR A;  1E7V A;  5J18 A;  1TJE A;  1C4P A;  1JWA D;  2XNA C;  3AED B;  2BBC A;  2M0A A;  3Q8F A;  2PKO A;  1NI2 A;  1UNS A;  4HPP A;  4JGH B;  5JHA A;  1IGD A;  4BBN C;  1YN4 A;  2KMA A;  3VDZ A;  3ZJT A;  4C4V B;  2D3B A;  4ZRI A;  1RFK A;  2KJR A;  2JY6 A;  2KT7 A;  4P16 A;  1E7P B;  4C7Z A;  5HFY A;  3NZU A;  3H9D A;  2JWU A;  4KDI C;  1R4M I;  3TEY A;  2X8X X;  1NBF C;  1HTQ A;  3VQI A;  3JSV B;  2JVC A;  2NPT B;  4KZ0 A;  1PYW D;  2WX1 A;  3H8H A;  4PYZ A;  3P42 A;  1KM7 A;  3PV1 A;  3PRP B;  3APD A;  1V6E A;  2D3A A;  2W3R A;  1WX9 A;  4IM2 A;  2WXJ A;  3ZNI D;  1H4R A;  3SFE B;  3ZDT A;  3QX1 A;  5LXH A;  3Q3M C;  3H7P B;  1YQB A;  2ZW0 A;  1FO4 A;  2ZW1 A;  1OEY J;  3ZNH B;  1XCQ L;  1YN5 A;  3QWZ B;  1E9M A;  3LJ3 A;  1GNU A;  1R4M B;  2YLM A;  4KSL C;  1I35 A;  1V9J A;  4HKZ E;  1A70 A;  4WUR A;  4NAW A;  4PS3 A;  3CF6 E;  3I3T B;  2N9E B;  3EC8 A;  4NJ6 A;  3ENE A;  3ZJU A;  1WMH A;  3VR8 B;  3LB8 C;  1NEK B;  1WXA A;  2OJR A;  3PLU A;  1G6J A;  2A5U A;  2MBH A;  3BVG A;  2OHF A;  2V3N A;  2WHI A;  1ZDX A;  1GAQ B;  1C3T A;  1SE9 A;  3IAM 1;  3MHS D;  5IOI A;  2B76 B;  4ZRP A;  2WP9 B;  4YL8 A;  3U8Z A;  1C4A A;  3S2A A;  2LHD A;  2KQ4 X;  1YJI A;  2KXJ A;  3V61 A;  2IPK D;  2WXQ A;  3TSS A;  1Z5S B;  2K6Q A;  3TEX A;  3RI7 C;  2KHW B;  1KRH A;  4C4V A;  4R3D A;  4AQ7 A;  2RSU A;  5GXG B;  3QA8 A;  2QJL A;  4ICV A;  1MJD A;  4DQO C;  1SIJ A;  1OGW A;  4I6L B;  3DCG A;  3JSV A;  2LUM A;  3AE4 B;  2NPT A;  3DBH I;  1SGH A;  3IT4 B;  2CS4 A;  1CK1 A;  3B2G A;  3EGR A;  4LNO A;  3M3J A;  1T0R C;  3A4S C;  1N5W A;  3AEG B;  4W9F A;  4BKT A;  1NYQ A;  3DVG X;  2M8S A;  3AEE B;  1TKE A;  4FAD A;  3A9J B;  4USA A;  3ZRF A;  2KYW A;  1DOX A;  1SE2 A;  2AWT A;  2K25 A;  1ROE A;  1WXS A;  4K7W A;  5BMH A;  4YT0 B;  1OQY A;  2RPQ A;  1KTK A;  4MGY E;  3H7P A;  3L4P A;  2ZZP B;  3V6E B;  3CMM B;  3GP7 A;  1E6E B;  3QK0 A;  2M19 A;  4IC7 B;  3RT3 B;  2N1V A;  4YXD B;  1MHH E;  4K7U A;  3QHT A;  4E71 A;  1FXA A;  1NEN B;  2FE8 A;  2J4X A;  3DBH B;  2XEW A;  4ANW A;  3UIN B;  2O6V B;  1F77 A;  3C8Y A;  4G50 A;  1WFY A;  3ML9 A;  2IDY A;  3LXF A;  4CHK A;  1T5X D;  3EA6 A;  2GBK A;  1OTR B;  1I4P A;  2JRH A;  3KH0 A;  2IND C;  2AQ2 B;  3CSF A;  2ZJD A;  5EE1 A;  4L23 A;  4FXC A;  3A33 B;  1LXD A;  3RZW C;  4FJV B;  4II3 B;  4TQ0 A;  4HXD A;  2ONQ A;  1TGZ B;  5IA7 A;  4J6I A;  1V5O A;  4WQO B;  1FXT B;  2KZR A;  3EEC A;  3VAW A;  3H7S A;  3O13 A;  2G4D B;  1JRP A;  2O6V D;  3MC9 A;  3PZ8 A;  5J17 A;  3T9L A;  2DYB A;  4P1C C;  2IYD B;  4S17 A;  3QAQ A;  2DZM A;  4W9I A;  3SD5 A;  2A4Z A;  1XO3 A;  4NJC A;  1WGK A;  1C4C A;  5KHQ A;  1MI0 A;  3C0R B;  1FCC C;  1ET6 A;  2J7Q B;  3TEW A;  2RR9 A;  2EEL A;  2K0P A;  1JWS D;  1Q5W B;  3L13 A;  3I57 A;  2DZI A;  1XT9 B;  1P3Q U;  2BYF A;  1SF0 A;  1EUV B;  3RD2 A;  3B1L X;  4E74 A;  2IGD A;  1YMH E;  4XE0 A;  4XC2 A;  2GBN A;  3B2F A;  1JCK B;  2XN9 C;  2C7N B;  4W9G A;  2LZ6 A;  2WWZ A;  1AWD A;  4FA6 A;  1YX6 B;  1P0R A;  5FKA C;  1TKG A;  3ZW3 A;  2MCN B;  3HVD A;  3R3M A;  4IG7 B;  1V1O A;  2MJ3 A;  2N7D A;  2M17 A;  2WXO A;  1TIF A;  2K8H A;  2BW2 A;  1QOG A;  3V60 A;  1ZDV A;  2O6V A;  4DBG A;  2AQ3 B;  2PW9 A;  3CST A;  1L0Y B;  2IGG A;  2OJW A;  4KIK B;  3V3X A;  4L2Y A;  2NS5 A;  1V8C A;  4RM8 A;  2XK5 B;  2M4N A;  1TZ1 A;  3HHM A;  3MFG A;  4HWI B;  2G9H D;  3O65 B;  1I4H A;  2LUE A;  3RPF C;  4WJN A;  3D32 A;  4EZJ A;  3NUH B;  2ZCC A;  2W54 A;  1I42 A;  4RF0 A;  3Q8B A;  2CU1 A;  3N3K B;  1PDX A;  1WGY A;  3BII D;  3WAL A;  2KMC A;  3JYU A;  1QZE A;  1WSP A;  4M0W A;  1IPG A;  3W1S A;  4DHJ B;  1LO5 D;  2NCN A;  1ZW7 A;  2GOW A;  2QC8 A;  4A55 A;  4MM3 B;  1K50 A;  1WE7 A;  5DPR A;  2ZPN A;  5BO4 B;  4A3P A;  1J7C A;  2N9X A;  4YWG G;  4N58 A;  1WX8 A;  4A20 A;  2WXK A;  2MQJ A;  1I4G A;  2KJH B;  1L5P A;  4W9E A;  5G5H A;  3KUZ A;  2K5P A;  1KLG D;  1TTN A;  2CHW A;  1FNW A;  4MGI E;  1VZ8 A;  2DYM A;  1WZ3 A;  3SR6 A;  4ASW C;  2KFK B;  3J9C A;  2LGI A;  4RF1 A;  1UZX B;  4DHJ D;  4KSK C;  5I4D A;  3FIL B;  4RGN A;  1N60 A;  4DWF A;  2RD0 A;  5G55 A;  2MEK A;  4GU2 A;  2O2V B;  1ZXI A;  4JX1 C;  1GG3 A;  2MW5 A;  4MJS B;  2V4I B;  2K8C A;  3KLS X;  1JWM D;  4GN1 A;  2QHO A;  5AZG A;  4Q2J A;  4IUM B;  5D2M B;  1NDD A;  4ZDV A;  2MBQ A;  3U7D A;  4YSY B;  1WXQ A;  1QOF A;  4M00 A;  2LJI A;  2PE9 A;  4BKG A;  1SSN A;  3NG0 A;  2JQR B;  2RDG A;  2WXI A;  1D5M C;  3IHP C;  2PE6 B;  1CMX B;  2GLS A;  3WAO A;  2MA9 B;  4US8 A;  1D4B A;  1ZPS A;  2ASQ A;  3ZJV A;  4NAM A;  3FAH A;  3HK0 A;  5BMG A;  2MP2 B;  2HE7 A;  2IBI B;  2NR2 A;  1YJ1 A;  1D5X C;  3ML8 A;  2H88 B;  1D3Z A;  1SIF A;  3AI5 A;  4CQN A;  3RYT A;  1T0Q C;  4AS1 A;  4HPL B;  3OAW A;  4WQM A;  2PPH A;  3AE3 B;  1GUA B;  3K9P B;  1K51 A;  2Z59 B;  2BF8 B;  4REZ A;  2LXA A;  4KIK A;  3X0W A;  4D2K A;  4GB9 A;  2ZEQ A;  2XK5 A;  1KJT A;  1TS5 A;  4KVG B;  3KWL A;  2MH7 A;  1IUE A;  3P4R B;  3BYT B;  1X1M A;  1K53 A;  5MPO A;  1QOB A;  4YTP B;  2KN5 A;  1NYR A;  3VH4 B;  4A8X C;  3IBE A;  2FUH B;  3N1Y C;  1L0X B;  2CJO A;  3PRE A;  2FNJ B;  4WWN A;  2JYT A;  5BYS A;  3ZLZ A;  2HJ1 A;  2MJE A;  3VVW B;  2N9K A;  2D3C A;  2MSE D;  1XQQ A;  2I38 A;  4GDL B;  3HM6 X;  1ZOY B;  5C3J B;  4HVB A;  3AU4 A;  3AMZ A;  4ITK A;  1WGG A;  1VLB A;  2NBV B;  5JZE B;  4HEA 1;  4ANV A;  5AUI A;  4TQ1 A;  5EE9 A;  5TSS A;  2KVZ A;  2FCN A;  1MFW A;  2INN E;  1UD7 A;  2ZNV B;  3M63 B;  3L08 A;  1WXV A;  1I4R A;  2DX5 B;  1UGM A;  3MHZ A;  3NS1 A;  1VZ7 A;  5E6N A;  1MPE A;  4K3B A;  1HA5 A;  4B9K A;  1FFU A;  2KFK A;  4US9 A;  1EU3 A;  3FIL A;  3MP9 A;  2O2V A;  5FR6 A;  2BKF A;  1SE4 A;  1WJN A;  2RMM A;  4W9J A;  3ZKJ C;  2DZK A;  3VTW A;  4NJ7 A;  4IW0 A;  2KKC A;  3BVZ A;  3AEB B;  1V2Y A;  3LDZ E;  4K81 A;  1F9J A;  1JRU A;  2N0S B;  3RNA C;  2K1F A;  1WRI A;  1ZE3 D;  3P63 A;  1VR9 A;  1HEZ E;  3QCA A;  2KAC A;  2JUO A;  2XBB C;  4FLH A;  1EU4 A;  1PGX A;  2MP2 A;  2C9W B;  3FKY A;  1RRB A;  4RMA A;  4URK A;  1CQV A;  3PLV A;  4BAX A;  2KDE B;  1NI3 A;  3PSE B;  3Q3O C;  4RGO S;  3VXW A;  3QAR A;  3JVZ X; 
#chains in the Genus database with same CATH homology
 4GSW A;  1WXS A;  1WF9 A;  4K7W A;  4TUU A;  2DEN B;  4IM3 A;  2LGX A;  5DPT A;  3ZUN A;  4FJZ A;  3VTV A;  2EMT A;  1OQY A;  1UEL A;  2PJH A;  2RPQ A;  2Z0E B;  3QC8 B;  5C1Z A;  2N1W A;  3DVN U;  3X23 A;  2G45 B;  2FCS A;  3KYC D;  3NY5 A;  4DDI D;  4E3C A;  4MGY E;  3H7P A;  4F1S A;  5EDS A;  2ZZP B;  1Y8R C;  1BT0 A;  3V6E B;  3CMM B;  3QK0 A;  2DAJ A;  1WR1 A;  2BWE S;  4FHJ A;  4N9F 4;  4IC7 B;  3RT3 B;  2N1V A;  2ZPY A;  1J19 A;  4G11 A;  4JIO U;  4NNJ B;  3VUX A;  3W1Y A;  4M8M A;  2CHX A;  4MGZ E;  5LLI A;  1XD3 B;  4NQK E;  5L95 C;  1IP9 A;  4K7U A;  2I1K A;  4MSM B;  3AXC A;  3V6C B;  3QHT A;  4BOZ B;  4E71 A;  5CHF A;  2KNB A;  3ZVV A;  2MLB A;  2KAN A;  4ANW A;  2XEW A;  1Q0W B;  1U4A A;  1ZGU B;  3UIN B;  2O6V B;  1C1Y B;  1WM2 A;  2JZ3 B;  4G50 A;  2EKE C;  4K7S A;  1WFY A;  3RUL A;  3ML9 A;  2AL3 A;  2LVQ A;  1WI0 A;  4W9L A;  4CHK A;  5L83 A;  4AJY B;  4MM3 A;  1P1A A;  2GBK A;  1OTR B;  2JRH A;  3KH0 A;  4GDL A;  2BYE A;  4NQL B;  3CSF A;  2ZJD A;  3WIM A;  3DOW A;  2LGD A;  4EOY A;  2ZVN A;  2L3Z A;  3M95 A;  5JH5 C;  3DDC B;  3RUI B;  2IY1 B;  3A1Q A;  4EFO A;  2FID A;  5E6P A;  2LVO A;  3HM3 A;  5CX3 A;  4EEW A;  1L2N A;  3A33 B;  2GBM A;  5KHO A;  1LXD A;  2Y5B B;  3R7R A;  5CHV C;  3RZW C;  2MBE A;  3PHW B;  1E90 A;  3NOB A;  3P2B A;  4FJV B;  4II3 B;  5D6J B;  3DBS A;  3UIO B;  4LCD E;  3PTF C;  4HXD A;  4TQ0 A;  5D7G A;  1TGZ B;  1WGR A;  4J6I A;  1V5O A;  2D07 B;  3PT2 B;  4WQO B;  1FXT B;  5IA7 A;  2KQ7 A;  3Q3J A;  1IYF A;  3ALB A;  3OLM D;  3PRZ A;  2KZR A;  1WJ4 A;  3SDL C;  3EEC A;  3PPA A;  2ZNV C;  3VAW A;  4MEM A;  3H7S A;  2D2Q A;  2G4D B;  5JHB A;  2O6V D;  2N7E A;  1WRD B;  4FN2 A;  2V3S A;  2DYO A;  5J17 A;  3BIN A;  4W9K A;  3T9L A;  2K39 A;  2BWF A;  2DYB A;  2LRU A;  4FHK A;  3ZTC A;  3R66 C;  4MGK E;  2IYD B;  4BFR A;  2CKH B;  2UYZ B;  3KVF B;  3QAQ A;  2L0T A;  4MJS A;  3SU8 X;  4HCN B;  2DZM A;  1UH6 A;  4W9I A;  1E8W A;  3APF A;  3SD5 A;  3QQ8 B;  3DBR I;  2A4Z A;  1GC6 A;  2DHZ A;  3M62 B;  2MWS B;  3NHE B;  4ZRK A;  4KDL B;  2KDF B;  2W9N A;  4GDK A;  4DK5 A;  1HE8 A;  2ZVO A;  5KHQ A;  1GJZ A;  5GMV A;  4OVU A;  1WJ6 A;  2IZV B;  1EF1 A;  3A9K B;  3C0R B;  3DQV A;  4GMV A;  1E8Y A;  4AOF A;  3IVF A;  2J7Q B;  4OVV A;  3VUY A;  2RR9 A;  4HDQ A;  3JVZ X;  4XZ4 A;  2G3Q B;  1RLF A;  2HD5 B;  3BY4 B;  3IG3 A;  4JQW C;  2I1J A;  1Q5W B;  4WJO A;  3T8M A;  1J0G A;  3DPD A;  2KLG A;  3JW0 X;  4HJK A;  4BOS C;  3R7Q A;  2IY0 B;  2KWV B;  3L13 A;  3GZN I;  2LXC A;  2DZI A;  1XT9 B;  2FCM A;  1P3Q U;  2BYF A;  4HPM B;  2ZCB A;  2KVR A;  1A5R A;  2UWQ A;  2M0X A;  3EHV A;  1EUV B;  2D10 A;  1YX5 B;  3RD2 A;  3WAM A;  2DAF A;  2GBJ A;  3B1L X;  3ZO5 B;  1V80 A;  4F8C B;  1WY8 A;  3AU5 A;  1OEY A;  2BYV E;  3DBL I;  4E74 A;  2YVC A;  4I6N B;  3KYD D;  4ANU A;  4XC2 A;  3ZIM A;  2GBN A;  3ONS A;  2C7N B;  4W9G A;  2LZ6 A;  2L00 B;  2WWZ A;  4BBN F;  4X57 B;  4CO7 A;  2KTF A;  3H1U A;  4AWJ A;  4FA6 A;  1YX6 B;  3KUC B;  4IWQ A;  1P0R A;  3U30 A;  2L7R A;  3ZW3 A;  2M1M A;  2MCN B;  4PS7 A;  3ECI A;  4W9C A;  2LVP A;  3R3M A;  4WWO A;  3L0W B;  4TV3 A;  4HDO A;  4IG7 B;  2N7D A;  2JT4 B;  2M17 A;  2AEH A;  1V86 A;  1ZKH A;  2K8H A;  2K6D B;  3L16 A;  4M8N A;  3RCZ A;  1WJU A;  3V60 A;  2C60 A;  2KD0 A;  2O6V A;  1V49 A;  3PZD A;  4DBG A;  1P9D U;  2AL6 A;  3PS6 A;  1GC7 A;  5DPW A;  2KTR B;  2KX3 A;  2LJ5 A;  3CST A;  4AUQ C;  1AAR A;  3DVN V;  4KIK B;  5AZF A;  1RAX A;  2NBU A;  2NS5 A;  1WGD A;  1EO6 A;  2GBR A;  4RM8 A;  5CHW A;  2JWZ A;  4ANX A;  2XK5 B;  4F7Z A;  2M4N A;  4NPN A;  1TZ1 A;  3HHM A;  3PGE A;  2MRP A;  1L7Y A;  4EUT A;  4HWI B;  4BKS D;  1UBQ A;  4LJP B;  3APC A;  3O65 B;  2LUE A;  2BGF A;  3ZNZ B;  4WJN A;  2OOB B;  3D32 A;  4EZJ A;  2ZCC A;  1WIA A;  1E5W A;  1UBI A;  4AJW A;  3KW5 B;  4HCP B;  1I42 A;  2CU1 A;  3N3K B;  4FUL A;  2J0M A;  1WGY A;  3PRM B;  3WAL A;  2KMC A;  3JYU A;  4TKN A;  1QZE A;  4NAW B;  5DPS A;  1IPG A;  1WXM A;  3W1S A;  4DHJ B;  2NCN A;  2BKR B;  1ZW7 A;  4IWO A;  3RZF A;  2GOW A;  2L8J A;  1KLV A;  2JF5 A;  3TL5 A;  1KOT A;  3VTU A;  1LQB A;  4HK2 A;  1LM8 B;  3MTN B;  2JXX A;  3TIX A;  1WE7 A;  1WGH A;  5DPR A;  4GXB A;  2ZPN A;  2BPS A;  4B95 A;  3W1S C;  2DZJ A;  5BO4 B;  4A3P A;  1WX7 A;  2N9X A;  4I6P A;  2MBO A;  3NS8 A;  1WMH B;  2CHZ A;  2KO3 A;  5D94 A;  1S3S G;  1RFA A;  1WX8 A;  5TR5 A;  4A20 A;  3ZRC A;  2MQJ A;  3ZDM C;  2KJH B;  1E7U A;  1MG8 A;  3Q3F A;  2L05 A;  2WDT B;  3UQB A;  5AEK B;  5C23 A;  2L76 A;  2FAZ A;  3GOE A;  4W9E A;  3KUZ A;  2IO1 B;  3N32 A;  3L54 A;  1TTN A;  2NVU I;  2CHW A;  3A9K A;  2N9P C;  2FIF A;  2KDB A;  4MGI E;  3TBL D;  2JRI B;  3WAP A;  2DYM A;  1WZ3 A;  2N4F A;  1K8R B;  2R2Q A;  4ASW C;  2KFK B;  5E6O A;  4FBJ B;  1UZX B;  4DHJ D;  4KSK C;  2KC1 A;  4DWF A;  1E7V A;  2RD0 A;  5G55 A;  5J18 A;  4GU2 A;  2O2V B;  2WX0 A;  2CR5 A;  3VFK A;  2Z0D B;  3UIP B;  4MSQ B;  1GG3 A;  4JLC A;  2C7H A;  2MW5 A;  4XX5 A;  4MJS B;  2V1Y A;  2K8C A;  3IFW B;  2REX A;  4GN1 A;  5HKH A;  3SHQ A;  2QHO A;  4A3O A;  3OJ3 A;  5AZG A;  1NI2 A;  3V62 A;  4IUM B;  5D2M B;  3H6N A;  4JGH B;  3OJ4 B;  4DHZ B;  3KUD B;  1NDD A;  4ZDV A;  2MBQ A;  1T0Y A;  5JHA A;  2IO0 B;  4WJQ A;  3U7D A;  4BBN C;  3TJP A;  2KMA A;  2PE9 A;  3VDZ A;  1EF5 A;  3A9J A;  4LJO B;  4BKG A;  1ISN A;  4ZRI A;  2C5L C;  3AUL A;  3PVL A;  2KJR A;  2JY6 A;  1P98 A;  2KFJ A;  4PS8 A;  5IAA C;  1TBE A;  3IHP C;  2PE6 B;  3ZTD A;  4BKS A;  3NZU A;  1CMX B;  3H9D A;  4KDI C;  1R4M I;  2IO2 B;  3WAO A;  2JPH A;  1NBF C;  2MA9 B;  3A4R A;  2ASQ A;  3JSV B;  2D3G A;  3VQI A;  2JVC A;  5DCN A;  2NPT B;  3EFU A;  4KZ0 A;  2WX1 A;  4EZK A;  2JZZ A;  3L10 B;  4PYZ A;  3DVG Y;  1KM7 A;  3PV1 A;  3HK0 A;  3PRP B;  2MP2 B;  3TMP B;  2HE7 A;  3APD A;  1V6E A;  2IBI B;  1YJ1 A;  2NR2 A;  3B08 A;  3ML8 A;  1D3Z A;  1SIF A;  1WX9 A;  3AI5 A;  3RYT A;  4IM2 A;  4HPL B;  3OAW A;  2LGY A;  2PPH A;  1GUA B;  3ZNI D;  1M94 A;  2KTR A;  3K9P B;  1H4R A;  2Z59 B;  2BF8 B;  1YIW A;  3ZDT A;  2LXA A;  4KIK A;  3QX1 A;  3X0W A;  4GB9 A;  2ZEQ A;  2XK5 A;  1KJT A;  4KVG B;  3TCA A;  3WAN A;  2KK8 A;  5LXH A;  1WYW B;  1X1M A;  3H7P B;  5CTR C;  1YQB A;  4WAA A;  2KN5 A;  4K1R B;  3VH4 B;  4II2 B;  3MJW A;  4GOC A;  1OEY J;  3ZNH B;  3IBE A;  5AZH A;  2FUH B;  4KZC A;  3PRE A;  3QWZ B;  3VH3 B;  3LJ3 A;  2R2O A;  1GNU A;  4DHZ E;  2FNJ B;  4WWN A;  2YLM A;  4KSL C;  2RGF A;  1V9J A;  1I35 A;  1WZ0 A;  4NAW A;  1Q1O A;  2LWP A;  4PS3 A;  4WJP A;  3ZLZ A;  4P7I A;  4CYE A;  3CF6 E;  3VVW B;  1PQS A;  3I3T B;  2FCQ A;  3ZNG C;  4EKU A;  2MSE D;  1XQQ A;  2N9E B;  3EC8 A;  3WA0 A;  2MX2 A;  4NJ6 A;  2KDI A;  1V81 A;  2D11 A;  2IO3 B;  2KLC A;  2LRW A;  3ENE A;  4GDL B;  3K9O B;  3HM6 X;  5J2R A;  3HIZ A;  4HVB A;  1VCB A;  4KV2 A;  4AP4 C;  1WMH A;  3AU4 A;  3QJZ A;  1WGG A;  3N30 A;  1WR6 E;  3UQA A;  2NBV B;  4W9D A;  5JZE B;  4ANV A;  1WXA A;  2AYO B;  2B3A A;  2L0F A;  3A1Q B;  4TQ1 A;  2OJR A;  4PYU A;  2FCN A;  4LDT B;  4RM9 A;  3PLU A;  1G6J A;  1UD7 A;  2A5U A;  2KWU B;  2MBH A;  2NBW B;  2ZNV B;  2KQS A;  3M63 B;  3L08 A;  1WXV A;  2DX5 B;  1UGM A;  1C3T A;  4FJY A;  4M0W B;  1SE9 A;  2HTH A;  1VD2 A;  3B0A A;  5E6N A;  4B9K A;  3NZS A;  4ICU A;  3MHS D;  2KFK A;  2J0K A;  4EZL A;  1V5T A;  4IWP A;  4JL9 A;  3UF8 A;  4G0N B;  2KOX A;  2O2V A;  5FR6 A;  4WWP A;  4YL8 A;  1R4N I;  4MH0 E;  3U8Z A;  3S2A A;  2BKF A;  1H8C A;  2KJ6 A;  2KX0 A;  2KXJ A;  1WJN A;  3V61 A;  2EMS A;  4BVU C;  1Z5S B;  4GGQ A;  2C7M B;  1E8Z A;  2K6Q A;  2V4L A;  4W9J A;  2HJ8 A;  3ZKJ C;  2KHW B;  3QIJ A;  2DZK A;  4MEL A;  3VTW A;  4NJ7 A;  4IW0 A;  2KKC A;  4LDT D;  2KWC A;  4G3X B;  4W9H A;  2KC2 A;  4B6W A;  1V2Y A;  1YD8 U;  4GDK B;  3LDZ E;  3PHX B;  2RSU A;  4K81 A;  3QA8 A;  4IM0 A;  4ICV A;  1F9J A;  1JRU A;  1WE6 A;  2LD9 A;  5LXI B;  3VHT C;  4ZYN A;  4GIV A;  4DXA B;  4DDG D;  1OGW A;  2K1F A;  4I6L B;  2K8B A;  1S1Q B;  3UGB B;  2J0J A;  3DCG A;  3JSV A;  2LAS A;  2LI5 A;  2VRR B;  1WH3 A;  2NPT A;  2GMI C;  3DBH I;  3QCA A;  1SGH A;  4HLE A;  2JUO A;  1WM3 A;  2XBB C;  4FLH A;  2CS4 A;  3L17 A;  2MP2 A;  3M3J A;  2C9W B;  3A4S C;  1Z2M A;  2G4S A;  1RRB A;  4W9F A;  1E8X A;  4RMA A;  4ZRJ A;  4NY0 A;  2PEA A;  3PLV A;  3DVG X;  4BKT A;  2M8S A;  4URK A;  4FAD A;  2KDE B;  2WYQ A;  3PSE B;  4MDK E;  3VUW A;  3A9J B;  2MBB B;  3ZRF A;  5G2N A;  1J8C A;  1LFD A;  3VXW A;  3QAR A;  2AWT A;  2K25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...