5AZHA

Crystal structure of lgg-2 fused with an eeeweel peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
127
structure length
127
Chain Sequence
EEWEELGSGIVPSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EEEWEEL peptide,Protein lgg-2
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
doi rcsb
source organism Synthetic construct
molecule tags Protein binding
total genus 33
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5azhA00
2IO1B 4NJ6A 4AJYB 3L08A 4CO7A 3UQBA 3L16A 2FCMA 4MGIE 4MH0E 2JZZA 4K81A 4YL8A 2C7NB 2PPHA 4KZCA 5D7GA 1WXSA 2KXJA 3ENEA 3UINB 4FJVB 3EECA 3VTUA 3QHTA 1V81A 2K25A 4BKSD 3UIOB 3KYDD 4KDLB 3W1SA 3K9PB 3R7RA 3A9JB 2N1VA 2LRUA 3UGBB 2J0KA 1G6JA 1GG3A 2HD5B 3KYCD 5AZFA 2KC1A 3KUDB 3L10B 3V6CB 2MCNB 4GDKB 3A9JA 2DX5B 2KJ6A 2ZPYA 2CHXA 4HPMB 3VTWA 4B95A 5IAAC 2ZEQA 4HPLB 1TGZB 4IG7B 2KX3A 3AXCA 2R2OA 4MELA 3OAWA 3CSTA 4CHKA 1E8WA 1J8CA 2B3AA 5L83A 3R66C 1ZGUB 4DHZB 3RUIB 4W9JA 2AYOB 1KOTA 4EZLA 3HHMA 3IHPC 1WXMA 2DZKA 2LVPA 4X57B 2A4ZA 4AUQC 5JH5C 4ZRIA 1E7VA 4CYEA 1TZ1A 4RMAA 3ZNZB 1WZ3A 1WJNA 1WY8A 2K1FA 3ZNHB 3SHQA 2N7EA 1H4RA 5HKHA 4NQKE 4W9HA 4GSWA 5KHOA 3IVFA 3VUWA 1P0RA 3ML8A 3ZVVA 3WIMA 4EEWA 1VCBA 2DENB 2KANA 3QCAA 5LXHA 3DVGY 1UGMA 2L3ZA 3MHSD 2WDTB 3N3KB 4HWIB 2KDBA 5JHAA 3DBLI 5DCNA 2REXA 2LZ6A 3H7SA 2PJHA 3LDZE 4DK5A 3DBHI 4I6PA 2KO3A 2Y5BB 4W9KA 3VXWA 4II3B 3ZDMC 2PEAA 3M95A 4JL9A 3U8ZA 2FUHB 3EFUA 1V80A 5GMVA 4ANVA 3OJ3A 3WAMA 1UELA 1V5TA 3NOBA 2WX1A 3A33B 1WXAA 5BO4B 1UBIA 4DDID 2EMTA 3BY4B 4ZRKA 1E90A 4GN1A 2KLGA 2LXAA 2FIDA 5LXIB 1EO6A 1MG8A 2HTHA 4PS7A 1RAXA 3GOEA 2AL6A 3X23A 3DQVA 4GGQA 1WJ6A 1WGYA 4BKTA 1GC6A 1U4AA 2L05A 2DYBA 2KTFA 3QWZB 4GXBA 4F8CB 1NDDA 4B6WA 4PS8A 4IM0A 3UIPB 4WAAA 2NPTA 4HXDA 2K6QA 3CSFA 3WAOA 4HLEA 2K8HA 3AULA 3AU4A 3RCZA 4J6IA 3V60A 1SE9A 2Z0EB 1YJ1A 3AU5A 3VUYA 4GB9A 3SU8X 2KD0A 1GUAB 3PZDA 1WJUA 1E8YA 3QIJA 2KFJA 2JY6A 4WJNA 5AZGA 3QJZA 1ZW7A 3VH3B 2KWVB 2D07B 1TBEA 4DXAB 2FNJB 3JVZX 3VHTC 3DVNV 1WH3A 2GBNA 2KDEB 4NJ7A 3I3TB 3PPAA 3PRZA 4P7IA 3ML9A 3DCGA 1P3QU 3DBSA 1WFYA 2FIFA 2OOBB 2W9NA 2L0TA 3PTFC 4ZYNA 2ZZPB 4MSMB 2DZMA 3V61A 4W9GA 2JRIB 5D2MB 3T9LA 2N4FA 4I6LB 2YLMA 3N30A 5CHVC 3KVFB 4E71A 4ICVA 2LXCA 2AWTA 2D3GA 3ZTCA 2RD0A 4ZRJA 3C0RB 1P9DU 2V4LA 4NPNA 3Q3FA 3PV1A 2ZNVC 3H7PB 4MJSB 3ZW3A 2WYQA 3RULA 2MW5A 2O6VD 3N32A 3V6EB 3WA0A 1WI0A 1KM7A 2BKFA 3H7PA 4MJSA 2N9PC 2KMAA 4ASWC 2C5LC 2DYMA 2DHZA 4BOZB 2D11A 3M3JA 5CTRC 3ZUNA 3A4RA 1IYFA 5FR6A 4GMVA 3PHWB 4K7SA 4PYZA 1WF9A 2JVCA 4KSLC 5CHFA 3APDA 2NBVB 2Z59B 1Z5SB 3DBRI 4JGHB 2KK8A 1H8CA 3QAQA 4TQ1A 1WIAA 1S1QB 3TIXA 4KSKC 2BKRB 3PHXB 3VQIA 4FHJA 2JRHA 4ICUA 5KHQA 2JWZA 1YD8U 4M8NA 2Z0DB 3B0AA 1WMHB 2KDIA 2MBHA 4GDKA 2CS4A 1WR6E 1V86A 4W9LA 1WGDA 4FA6A 4FULA 2J0MA 1PQSA 2KOXA 2UYZB 3ZIMA 4M8MA 4NY0A 3D32A 1QZEA 4DDGD 2BYVE 2FCNA 2KX0A 4M0WB 4HDQA 2GBJA 2ASQA 2BGFA 2ZVNA 2LVQA 2XK5B 4MDKE 1FXTB 4AWJA 5L95C 3PVLA 2KVRA 1HE8A 4EOYA 4W9CA 3P2BA 3W1YA 2MBOA 2D2QA 4GIVA 3V62A 1YQBA 4FJZA 3JYUA 1R4NI 2I1JA 1XT9B 2RSUA 4PS3A 5E6NA 3RZFA 4W9DA 2G45B 2N1WA 4LDTD 3R7QA 2ZCBA 3X0WA 2JUOA 3KH0A 2KZRA 3PGEA 2GBRA 3WALA 5AZHA 4AP4C 5J18A 3L54A 1WGHA 3B1LX 3ZNID 2RGFA 2C7HA 1GC7A 2FCQA 3EHVA 4FJYA 4AJWA 4G3XB 3GZNI 2MBQA 2BWFA 3CMMB 3HM3A 4FLHA 3ZNGC 5DPWA 4DBGA 2A5UA 3TCAA 4IC7B 4TUUA 3VH4B 4GOCA 4WJQA 1WJ4A 2CR5A 2K39A 4NNJB 2KKCA 4MEMA 4BBNC 2WWZA 1UBQA 2MX2A 4BFRA 1NI2A 2R2QA 2BF8B 4MM3A 2AL3A 4IWQA 1TTNA 2DZIA 1WYWB 3LJ3A 4XZ4A 1WX7A 4DWFA 4MGKE 2MWSB 3NHEB 1V6EA 2O6VB 5J2RA 2FAZA 4I6NB 1YIWA 2M1MA 3EC8A 2K6DB 4PYUA 2KQSA 5CX3A 4LJPB 1SGHA 2NBWB 2ZPNA 3DVGX 4KDIC 3QK0A 1Q5WB 4WQOB 1LFDA 5LLIA 2JXXA 1J19A 2LD9A 2NBUA 4KV2A 3VUXA 2BPSA 4IWPA 4DHZE 2ZVOA 5AEKB 4GDLB 2PE9A 4F1SA 1WGRA 4WWOA 4NQLB 2KFKB 2MRPA 2L7RA 2CU1A 4MGZE 1WM2A 2IO3B 2JZ3B 2NVUI 4BKSA 1WM3A 4HCPB 1E7UA 1LM8B 4HK2A 2KFKA 4RM9A 3ZO5B 4RM8A 3M62B 4W9EA 5E6PA 3A1QB 4KIKB 5DPTA 4K1RB 2N9XA 4FBJB 3O65B 2KQ7A 3A1QA 3A9KB 2MBBB 1S3SG 3ALBA 1UZXB 3HM6X 4G50A 1I42A 4ANUA 4KVGB 2C9WB 4B9KA 2XEWA 1BT0A 3A9KA 4IM3A 2PE6B 3VFKA 1WE7A 3QQ8B 3K9OB 4IUMB 5D6JB 3RZWC 1C1YB 3S2AA 2UWQA 2IO0B 2DAJA 4HDOA 4A3PA 3PRMB 1M94A 2IO2B 3QA8A 3U30A 1C3TA 1WGGA 2L8JA 1F9JA 4K7WA 2L00B 2L76A 1P1AA 1WXVA 3NY5A 3T8MA 4FADA 1WR1A 1UH6A 2IBIB 2NCNA 2EMSA 4BBNF 3JW0X 1EF1A 2M8SA 2KC2A 3PT2B 4WJOA 4ANXA 1X1MA 4KZ0A 5EDSA 2MQJA 1L2NA 4II2B 2C7MB 4JLCA 3VVWB 3DDCB 5G55A 2G4SA 3ZKJC 2ZNVB 1UD7A 1NBFC 4EKUA 1WX8A 4EZJA 2MP2B 3DPDA 2KJRA 1WE6A 4EUTA 1YX5B 2G4DB 2JPHA 3BINA 1OGWA 4OVUA 2MP2A 4DHJD 4A3OA 2IYDB 2V3SA 2D10A 2GBMA 3ZLZA 4G0NB 3TMPB 1WZ0A 3MTNB 4E74A 2KWCA 4EZKA 4FHKA 3WANA 1EUVB 1JRUA 2IY1B 2MSED 3RD2A 2AEHA 3W1SC 1ISNA 2M0XA 1Y8RC 3QX1A 1OQYA 3OLMD 5C1ZA 1R4MI 2BYEA 2JT4B 1OTRB 1I35A 1WMHA 3ZRFA 5TR5A 2EKEC 1LXDA 3A4SC 4WJPA 4MGYE 2HE7A 1P98A 2FCSA 2QHOA 3QARA 2RPQA 2M17A 1Q0WB 4BOSC 1V2YA 2CHZA 1YX6B 3ONSA 2KHWB 2LGDA 2DYOA 4BVUC 2MBEA 2LWPA 3KUZA 2XK5A 2L0FA 1V49A 3NZUA 4ANWA 1OEYJ 3H1UA 4W9IA 3CF6E 1RLFA 3AI5A 5JHBA 2JF5A 3APCA 1ZKHA 2WX0A 3TJPA 1V9JA 2BYFA 3RYTA 1XQQA 2LGYA 1XD3B 3Q3JA 2KNBA 2NS5A 3IBEA 1V5OA 5IA7A 4JQWC 1LQBA 3MJWA 3QC8B 3NZSA 2J7QB 2OJRA 2GMIC 2ZJDA 1K8RB 1WRDB 3DVNU 3OJ4B 5JZEB 1A5RA 3PLUA 2G3QB 4E3CA 3IFWB 3TL5A 2O2VB 4IM2A 1CMXB 1J0GA 2KLCA 3PSEB 2LVOA 3PLVA 2KJHB 4XC2A 4OVVA 4F7ZA 1AARA 3VAWA 2O2VA 3B08A 4HJKA 3TBLD 3HK0A 3ZTDA 5D94A 2BWES 3UF8A 3KUCB 1IP9A 3UQAA 1GJZA 2GOWA 4BKGA 5CHWA 4MSQB 2LUEA 1L7YA 2NR2A 2RR9A 2GBKA 2J0JA 1E8ZA 2HJ8A 2KMCA 4XX5A 4EFOA 1IPGA 1Z2MA 4HVBA 4LCDE 4URKA 2O6VA 1EF5A 3VTVA 3U7DA 4NAWB 2C60A 2ZCCA 3ZDTA 2N7DA 4TKNA 4DHJB 1KJTA 3L0WB 3L13A 2IY0B 2K8CA 2K8BA 3SD5A 2KDFB 2MLBA 1GNUA 4GDLA 5DPSA 1D3ZA 4NAWA 2M4NA 3M63B 1RFAA 3JSVB 3DOWA 4FN2A 4IWOA 3L17A 4GU2A 3R3MA 4WWNA 3ZRCA 1SIFA 2LASA 2NPTB 1WX9A 3JSVA 4KIKA 4K7UA 2V1YA 2LI5A 3NS8A 4TV3A 5J17A 2KN5A 4A20A 1T0YA 1VD2A 3PRPB 4IW0A 3ECIA 3H6NA 3KW5B 4AOFA 3H9DA 2KTRB 3PS6A 5E6OA 3PREA 1E5WA 4ZDVA 2I1KA 5DPRA 1E8XA 1Q1OA 2LRWA 2KTRA 2DAFA 2VRRB 2IZVB 4N9F4 3APFA 3HIZA 3IG3A 1OEYA 2MA9B 4TQ0A 4LDTB 1KLVA 3VDZA 1RRBA 2CHWA 2KWUB 4JIOU 2YVCA 4G11A 3RT3B 3SDLC 2DZJA 2LJ5A 4W9FA 4WWPA 2CKHB 2N9EB 2LGXA 4HCNB 4LJOB 3WAPA 5G2NA 2XBBC 5C23A
chains in the Genus database with same CATH superfamily
1NYQA 2IO1B 5TSSA 3DBRB 4AJYB 2RPVA 3L16A 4MH0E 3RMKC 2ZW1A 2KMMA 3GE3C 1WXSA 4FJVB 1AYFA 3URYA 3QHTA 4BKSD 4KDLB 2M56B 2N1VA 3UGBB 4K3BA 2E6XA 1VZ7A 2HD5B 3KUDB 3L10B 3V6CB 4B95A 2CHXA 4HPMB 3AXCA 4KGTA 4MELA 1HA5A 2QILA 1E8WA 3EUB2 2B3AA 4W9JA 2D5GA 1WXMA 2LVPA 2Z8LA 5JH5C 1WY8A 4N6EB 2WU2B 1YQ3B 2JWUA 2PVOD 2WXMA 1XLOA 3AE8B 3FAHA 2L3ZA 1B9RA 2WDTB 3BYYB 5DCNA 2PJHA 4I6PA 2Y5BB 3ZDMC 3KWLA 3U8ZA 3EFUA 4ANVA 3TEYA 3IAM1 3NOBA 5AUIA 4GN1A 2KLGA 3EGRA 1SEBD 1V1PB 2LXAA 1MG8A 2HTHA 1RAXA 2AL6A 4BZAA 3X23A 3DQVA 3RPFC 3AE6B 2SEBD 2DYBA 4GXBA 4F8CB 2Q5WD 2NPTA 1N61A 4HXDA 4AQ7A 2K6QA 1YJJA 3AEBB 3CSFA 3WAOA 1SE9A 1YJ1A 1SE2A 1M4VA 2KD0A 1E8YA 4OZAA 2YEPF 1WRIA 3QIJA 2JY6A 2EELA 3VH3B 2PIAA 2XN9C 1TBEA 5FKAC 4DXAB 2FNJB 4NAMA 3DVNV 1WH3A 3PPAA 1FEHA 3DCGA 1ZXIA 1MJDA 4LTUA 2W9NA 4ZYNA 4W9GA 5CHVC 3KLSX 4ZRJA 2V4LA 4NPNA 2RDHA 3ZW3A 3B9JA 3RULA 4R3DA 2O6VD 1QLBB 4ARIA 2JXTA 3Q8CA 1KM7A 4MJSA 2DYMA 4BOZB 3M3JA 5CTRC 3SFEB 2ACZB 2BBCA 3P4PB 2BTEA 3PHWB 1SBBB 2N0SB 3APDA 3DBRI 1ET6A 4TQ1A 4C4VA 1WIAA 2BKRB 2JRHA 5HHDG 4GDKA 2CS4A 1WR6E 1WGDA 2UU7A 4YSZB 1PQSA 2KOXA 3D32A 4DDGD 3PO0A 2FCNA 4HDQA 2ZVNA 2LVQA 1TJEA 4AWJA 4FXCA 1YQBA 4C7YA 2I1JA 1XT9B 4W9DA 1P7EA 2LGIA 2JUOA 2GBRA 1WYGA 3L54A 3B1LX 1L0XB 3CMMB 3HM3A 1NVID 3DHIC 4HROA 4LNKA 2A5UA 4HKQA 1BUIC 4TUUA 1FMAD 4MEMA 2WXOA 1D5MC 4MM3A 2AL3A 4IWQA 2DZIA 2MWSB 5MPOA 5I4DA 2FAZA 2VH1A 1N60A 2M1MA 2ZW0A 4KDIC 3QK0A 4WQOB 2NBUA 2BPSA 5AEKB 1FXIA 1JWBD 4MACA 2MRPA 2CU1A 1LM8B 4RM9A 2AQ2B 3M62B 2WXLA 4RM8A 4HPPA 1PGBA 3Q8BA 4RGMA 4A8XC 5DPTA 3IT4B 4K1RB 1GB4A 4P1BC 3LXFA 1S3SG 2B76B 4G50A 1I42A 1AN8A 2XEWA 1FFVA 5BYRA 1CZPA 1KF6B 4H2AA 3AE3B 2JSVX 2UWQA 2IO0B 1M94A 2KQ4X 2BB5A 3AE5B 3NY5A 1WR1A 1UH6A 2NCNA 1EF1A 3PT2B 4ANXA 5EDSA 1L2NA 3MC0B 1XF5L 4JLCA 3I57A 3VVWB 5G55A 1F77A 4RGOS 2G4SA 4EKUA 4EZJA 1YX5B 1FCCC 3IAS1 2IYDB 1WZ0A 1QT9A 2IY1B 2MSED 1Y8RC 3QX1A 1HZ6A 3W2DA 3OLMD 1SB3C 2JT4B 1OTRB 3NZ3A 1TKGA 2WP9B 2WQYB 2M17A 1V2YA 2CHZA 3ONSA 4UDUC 2DYOA 2XK5A 3EFCA 3RNEC 4ANWA 5FK9C 1TS4A 2FBWB 1ACCA 1V9JA 2BYFA 1XQQA 1LQBA 3DBHB 3QC8B 3UI3A 1RYJA 2J7QB 2OJRA 2GMIC 2ZJDA 1WRDB 3OJ4B 4E3CA 3TL5A 1ZUD2 4IM2A 3Q3MC 2MJ3A 3PLVA 4XC2A 3VAWA 2Y3AA 3AE2B 3UQAA 5CHWA 1L7YA 4ZOHC 2KMCA 1Z2MA 4URKA 1UWXA 3N1ZC 4CQNA 2L52A 3U7DA 2K8BA 1GNUA 2HTME 4NAWA 2BYTA 2G1EA 1ZDXA 4IWOA 3L17A 3HUIA 3R3MA 3ZRCA 2NPTB 1WX9A 4KIKA 4TV3A 4IW0A 3KW5B 1IBXA 4XDCA 1T0SC 1K50A 1Q1OA 1EWCA 3DHGC 2KTRA 3AEDB 4XWTA 1FNWA 2NTSA 4KKJA 4ITKA 3IG3A 2QMTA 1OEYA 3VDZA 1RRBA 1KLGD 3ZXRA 2E3TA 2CHWA 2KWUB 3RT3B 3SDLC 4IKGA 2LJIA 3W9CB 2N9EB 2LGXA 3DWGC 4HCNB 1YQ4B 5C23A 3MJ5A 4US8A 3R2IA 4NJ6A 3UQBA 1L6VA 1QOGA 1D4BA 2C7NB 2PPHA 4ZRPA 2D3BA 5AUKA 2GRIA 2WDRB 1ET9A 3EECA 1QOAA 1V81A 3MHZA 3W1SA 5HFYA 1L4DB 4B0MA 1PYWD 2LRUA 3ZYYX 1R7SA 2KC1A 3VRBB 1V1OA 4GDKB 2OJWA 3A9JA 2ZPYA 3VTWA 5IAAC 1OFFA 4HPLB 1TGZB 4IG7B 2KX3A 2R2OA 1J8CA 3R66C 1KOTA 4EZLA 3HHMA 3IHPC 2DZKA 2KYWA 3RNBC 4ZRIA 4CYEA 3HVDA 1TZ1A 1CQVA 2K1FA 3ZNHB 4NQKE 1VLBA 4GSWA 3VUWA 2QCZA 3O13A 3KQ4A 2KANA 5LXHA 3DVGY 4OHJA 4B0EA 3N9YC 1HZ5A 2REXA 3P4SB 2IGGA 3H7SA 1HTOA 3DBHI 2WXNA 3VRAB 3M95A 4P6VF 1JMLA 1WWTA 3A33B 3GE8C 1UBIA 1E90A 1IGCA 2J42A 1EWYC 1D5ZC 3Q8EA 4S0RA 1WGYA 4B6WA 1XCTL 2D3AA 3ZGZA 1I4GA 4QAYA 4RH6A 2M19A 3VUYA 4GB9A 1NEKB 3RNGC 4HRSA 4WJNA 1ZW7A 1BXTA 2D07B 3ZJTA 3JVZX 3VHTC 1SF0A 5IN7A 4P7IA 3V3XA 1HTQA 2JRIB 2AQ3B 3KVFB 2AWTA 3AE1B 3C0RB 3PV1A 2MW5A 1TKEA 3H7PA 5BMGA 2N9PC 3AE9B 2DHZA 3ZUNA 4GMVA 3TIXA 4BVUC 4N58A 2NBVB 2Z59B 1Z5SB 2LEKA 1J7CA 3VQIA 4FHJA 2J53A 3AECB 1V86A 4P1CC 1AW7A 1Y56A 1BMLC 3AH7A 1I4RA 4EE2A 2GBJA 2ASQA 2BGFA 2XK5B 2KVRA 1HE8A 4M0WA 5C2TB 3FILA 4RGTA 3T3OA 5E6NA 3OWEB 3NS1A 2G45B 3X0WA 2W3RA 1E7PB 2KZRA 4WAFA 3WALA 5J18A 2LMCA 1WGHA 3DBLB 2FCQA 3EHVA 4OZBA 3AN1A 1XLQA 3ZNGC 4FLHA 1D5XC 1KTKA 1C4PA 3AEAB 3NUHB 4REZA 4GOCA 1UNSA 1L6UA 1WJ4A 2CR5A 2KKCA 4BBNC 2W3SA 4BFRA 2JQRB 2V9HA 1TTNA 2CJNA 4MGKE 1V6EA 4I6NB 1YIWA 5EE0A 2K6DB 3T3NA 5CX3A 1SGHA 2NBWB 2N9LA 5LLIA 2LD9A 2JYTA 4IWPA 3C19A 1I4HA 2PE9A 1WGRA 1SXTA 4NQLB 2KFKB 4MGZE 2JZ3B 4BKSA 2NVUI 2W55A 2PMVA 4NJCA 5E6PA 3A1QB 4KIKB 3BIID 2W82A 3TUOA 2MBBB 4HKZE 3RN9C 1UZXB 3TEWA 2J52A 1YJIA 1BT0A 3A9KA 3VFKA 3K9OB 1C1YB 3I5JC 2DAJA 3PRMB 2IO2B 3OG5A 3I9V1 2WXRA 4K7WA 2WLBA 2L76A 1WXVA 3WCQA 4FADA 5FR3A 1N5WA 3N20C 4BBNF 2M8SA 2KC2A 1X1MA 2MQJA 2C7MB 1UUPA 4C80A 2DWQA 1Q10A 4LNNA 3ZKJC 5C3JB 1JALA 1UD7A 4IOIE 1NBFC 1YN5A 3DPDA 2JPHA 3BINA 1SE3A 2MP2A 4A3OA 2QSDA 2FE8A 2GBMA 2VZKD 3ZLZA 1XLNA 4EZKA 1GPXA 1EUVB 1ISNA 5G5HA 5C1ZA 2BYEA 2GI9A 1T5XD 1LXDA 1GAQB 2HE7A 1T3QA 3QARA 2IPKD 1Q0WB 4BOSC 1YX6B 5LNK1 2KHWB 1V49A 3NZUA 4A6QA 2DNFA 1R4NB 5JHBA 3P63A 1ZKHA 1V8CA 3Q3JA 3TEXA 3MJWA 2WXKA 2LFIA 1SJED 4M02A 1GOZA 4BAXA 1T0QC 1YNTE 2Y5CA 1K8RB 3NVWA 2O2VB 1J0GA 1CMXB 3PZ8A 1A70A 2KJHB 3FC4A 4HJKA 3TBLD 5D94A 2BWES 3KUCB 1IP9A 1GJZA 1YN4A 3U7ZA 4BKGA 1OQQA 2WHIA 1E8ZA 2O6VA 3GP7A 3VTVA 1DOIA 3SFDB 2ZCCA 2N7DA 4TKNA 4WQMA 4DHJB 1KJTA 2IY0B 2KDFB 4XDDA 4GDLA 1D3ZA 1RFAA 3JSVB 1TY2A 2LASA 2V1YA 3NS8A 1HEZE 4A20A 1C9FA 1T0YA 3ECIA 3H6NA 2ON8A 1MFWA 1GB1A 3PS6A 3C8YA 5E6OA 3PREA 4ZDVA 5DPRA 3DHHC 2LRWA 2VRRB 2IZVB 3APFA 3HIZA 1ESFA 4LDTB 4YTNB 4C7ZA 3KWVA 5JXVA 1ZPSA 4JIOU 2DZJA 3VR8B 1F52A 5G2NA 1FM0D 1PGXA 4ARCA 1TY0A 2INNE 4CO7A 4MGIE 3AB5A 2JZZA 4K81A 1FD6A 1JWSD 1ZDVA 5D7GA 3P4RB 3ENEA 3UINB 2Y5PA 1R4MB 3VTUA 3SR6A 2K25A 3SEBA 1ROEA 1VJKA 3KYDD 3UIOB 3K9PB 1G6JA 1L0YB 1GG3A 2PW9A 3KYCD 2BW2A 2MCNB 2DX5B 4JPSA 2KJ6A 1ZOYB 2AQ1B 2ZEQA 2BVCA 3N1YC 2GLSA 4CHKA 3CSTA 2BT6A 5L83A 1ZGUB 4DHZB 5BYSA 1SE4A 2PKOA 1XO3A 2WS3B 3R8BA 3FILB 1VZ8A 1WZ3A 3GZNB 1WJNA 1C76A 1K52A 1H4RA 1ZXHA 2N7EA 5HKHA 5HG2A 4W9HA 4XWWA 3IVFA 1P0RA 3WIMA 2DENB 4LLGM 2QC8A 3QCAA 3ZJVA 1C77A 3N3KB 1MHXA 2J4XA 2KDBA 5JHAA 2LZ6A 2IGDA 2KO3A 3VXWA 2PEAA 1KFYB 4JL9A 1RFKA 2D3CA 2QIEB 3OJ3A 3WAMA 1UWMA 1WXAA 4DDID 2EMTA 3BY4B 4ZRKA 4LK0M 4JX1C 1J7BA 4C56C 1EO6A 3MP9A 1V1PA 1J7AA 2H88B 2L05A 2KTFA 3QWZB 1NDDA 4PS8A 4IM0A 3E56A 3Q3OC 4JWUC 1CK1A 2V3NA 3AMZA 3AULA 4YWGG 1DYQA 3SU8X 1WJUA 3CIRB 2KAJA 2KFJA 5AZGA 3QJZA 4D2KA 1PUTA 4NJ7A 3PRZA 3B2GA 3ML9A 1LO5D 1P3QU 2LHEA 3DBSA 1WFYA 2IDYA 5IKCM 2OOBB 2L0TA 3PTFC 4J3OD 1JROA 2VH2A 3N30A 4ICVA 4Q2JA 2LXCA 2RD0A 1P9DU 1SJHD 1FXAA 3Q3FA 2INDC 4KX6B 2ZNVC 4MJSB 2K22A 2K9XA 4MT5A 4YXDB 3V6EB 1DOYA 3WA0A 1WI0A 2BKFA 2KMAA 1XLPA 2C5LC 2IJ0A 4C4VB 2MEKA 1YOVB 5FR6A 5CHFA 2JVCA 2JU6X 4KSLC 4JGHB 1H8CA 3QAQA 1MVKA 1QILA 1S1QB 4KSKC 4ICUA 2JWZA 1YD8U 3B0AA 2WDQB 2KDIA 5T8IA 1RM6C 4FA6A 4FULA 2UYZB 3ZIMA 4NY0A 4ZHPA 1QZEA 3GS2A 3TEZA 2BYVE 3EA6A 4RNAA 2KX0A 1HXYD 1FXTB 5L95C 2KDMA 4EOYA 3P2BA 3W1YA 4FJZA 3JYUA 3AE4B 2K5PA 2RSUA 4M01A 3AEEB 2JZPA 4LDTD 2ZCBA 5G5GA 4AP4C 5AZHA 3ZNID 4JWSC 2C7HA 5EE9A 4AJWA 4G3XB 3BZDB 1L5PA 3GZNI 2MBQA 5DPWA 2SAKA 4DBGA 1F2RC 3VH4B 4MM3B 1TS2A 2K39A 2MHJA 1UBQA 1NYRA 3BVMA 1NI2A 2R2QA 1FNVA 1WYWB 4XZ4A 1JWAD 3NHEB 2O6VB 2AX5A 3EC8A 4PYUA 3DVGX 2JXXA 2NTTA 1WGKA 3BK2A 3VUXA 3ZXVA 2L32A 2BS4B 4DHZE 4GDLB 4RCOA 4WWOA 4MH8A 3RI7C 3AE7B 1XEEA 1RWSA 1WM2A 1QOFA 1E7UA 3ZO5B 4W9EA 1VR9A 3O65B 2KQ7A 2PTLA 2RMMA 4KVGB 3QQ8B 2QJLA 4IUMB 5D6JB 2IGHA 4WIPA 3S2AA 4A3PA 1JWMD 3QA8A 3U30A 1C3TA 1WGGA 2RDGA 2L8JA 1F9JA 4ACFA 4OW0A 3R2TA 3T8MA 2IBIB 4XE0A 1TIFA 1MHHE 4JE3B 2CJOA 1N6ZA 1FFUA 2ZNVB 4P16A 1PDXA 2G9HD 1FRDA 1L0VB 1WX8A 1K53A 2G4DB 3I63C 1C4AA 1OGWA 3Q8FA 2WXJA 5D3DA 4G0NB 3RNFC 3MTNB 4E74A 2KWCA 4FHKA 3WANA 1JRUA 3W1SC 4DXFA 3N1XC 1I35A 1WMHA 2QEJC 3ZRFA 4C00A 3GB1A 5TR5A 1FCLA 3A4SC 4WJPA 4MGYE 2WDVB 1F1HA 1ZP0B 1C79A 1QQRA 1E6EB 2HDEA 3ETRA 2MBEA 2LWPA 3KUZA 2JX5A 2L0FA 4W9IA 3CF6E 3AI5A 2JF5A 4HEA1 3TJPA 3RYTA 2LGYA 2NS5A 3IBEA 1I4PA 3L4PA 4JQWC 1STEA 1UF0A 2K3UA 3DVNU 1A5RA 5JZEB 5HI1A 2XNAC 3PSEB 5IOIA 4F7ZA 5IO9A 2WXPA 2N7JA 3ZTDA 1C4CA 4KGSA 3UF8A 2BS2B 1E10A 4YTMB 2LUEA 2RR9A 4XX5A 1IPGA 4LCDE 1QF6A 1EF5A 1FNUA 4NAWB 4YSXB 2C60A 3ZDTA 2WGSA 2MJEA 3LYYA 3L0WB 3L13A 3SD5A 2MLBA 1LGRA 1E0ZA 3FKYA 5H8YE 1HQRD 4WWNA 1SIFA 3Q8AA 2LI5A 1IBXB 5J17A 1VD2A 3PRPB 1VZ6A 4AOFA 5BYQA 2KTRB 2WXFA 1EU3A 1E5WA 2I1KA 1E8XA 1FO4A 2KACA 4LNIA 2MJDA 3V05A 4DXGA 5GXGB 2JYEA 2MA9B 2KWDA 3BVGA 3ABVB 3RNCC 2YVCA 3HVZA 4G11A 4WWPA 4OZCA 2CKHB 2HJ1A 4WWMA 2R61A 1PFDA 3BWUD 3L08A 3J9CA 4YTPB 2FCMA 4XYCA 3P42A 2X38A 4YL8A 4A9AA 4KZCA 2KVZA 2KXJA 1P7FA 1AWDA 1JCKB 3R7RA 2N9KA 3A9JB 4M00A 2J0KA 2WXHA 5AZFA 3CWIA 1I4QA 3OAWA 3RUIB 2AYOB 3NVYA 3AEGB 3U52E 3Q14C 4X57B 2A4ZA 1QKZA 4AUQC 1E7VA 1XXGA 3RFZB 4RMAA 3ZNZB 1DGJA 3SHQA 3U4EG 1F0ZA 5KHOA 2PVGC 3ML8A 3ZVVA 1OQRA 1VCBA 4EEWA 2YEPB 3AV8A 1UGMA 1XCQL 3MHSD 4WH4A 4HWIB 3DBLI 3LDZE 4DK5A 3U2SC 4W9KA 4II3B 2FUHB 1V80A 5GMVA 1UELA 1V5TA 1D6EC 2WX1A 2WXQA 5BO4B 1F2RI 1E9MA 4K3CA 2I38A 2FIDA 5LXIB 3W5UB 4PS7A 3GOEA 1L4ZB 1T6BX 3H8HA 4GGQA 1WJ6A 3MFGA 2TSSA 4BKTA 1GC6A 1U4AA 3UIPB 2M0AA 1TZOA 4WAAA 1SSNA 1MI0A 4NZLB 2GB1A 2DBYA 4HLEA 2K8HA 2W54A 3AU4A 3RCZA 4J6IA 3V60A 2Z0EB 3AU5A 1GUAB 3PZDA 1KLUD 4A55A 4RFBA 3LB8C 3B2FA 2EKIA 2KWVB 3BVZA 4DQOC 1YMHE 5BMIA 1SIJA 1JQ4A 2GBNA 2KDEB 3I3TB 1ENFA 4A90A 3Q3NC 2LUMA 2FIFA 2OEDA 3V61A 2ZZPB 4MSMB 2CU3A 2DZMA 2BQQA 5D2MB 3T9LA 2N4FA 4I6LB 2YLMA 4E71A 3ZTCA 2D3GA 3H7PB 2WYQA 4LNOA 3N32A 3TSSA 4ASWC 3NVVA 1I7HA 2D11A 3AEFB 1TS5A 3A4RA 4LNFA 1IYFA 3V62A 4K7SA 4PYZA 1WF9A 2KK8A 3PHXB 5KHQA 4M8NA 2Z0DB 1WMHB 2WXIA 4RF1A 1N63A 2L1AA 2MBHA 3IXSA 4W9LA 2K0PA 2LGSA 2J0MA 4M8MA 1KRHA 4M0WB 5D3IB 1I4XA 4MDKE 2WXGA 4GLSC 3PVLA 4W9CA 1FPYA 2MBOA 2D2QA 4GIVA 4TSSA 1R4NI 4PS3A 1TT5B 3RZFA 2N1WA 3R7QA 3KH0A 3PGEA 1WXQA 4YSYB 2RGFA 1GC7A 4FJYA 2BS3B 2BWFA 3DWMA 3TCAA 4IC7B 4RF0A 2KT7A 4USAA 1JWUD 4WJQA 1K51A 1CJEA 4NNJB 2WWZA 1KH0A 2MX2A 2BF8B 1QOBA 4KGRA 3LJ3A 1WX7A 4DWFA 5J2RA 1MPEA 1N62A 2KQSA 4LJPB 5BMHA 2ZPNA 1Q5WB 1VRAB 1LFDA 2OHFA 1J19A 4KV2A 4L23A 2ZVOA 4F1SA 2L7RA 4WURA 1WSPA 2IO3B 4S17A 1WM3A 4HCPB 4HK2A 2KFKA 4HJGE 1EM7A 4ZRQA 1T0RC 4IDIA 4FBJB 2N9XA 3A1QA 3A9KB 3ALBA 3HM6X 4ANUA 4ZYSA 2C9WB 1FIQA 4B9KA 4IM3A 2PE6B 1JRPA 1WE7A 2L83A 3HRDD 3MC9A 3RZWC 1IUEA 3ZJUA 4HDOA 4RGNA 3P4QB 2INPE 2L00B 4KKIA 1P1AA 3AM9A 1DOXA 2EMSA 2INCC 3JW0X 4WJOA 2WNMA 4KZ0A 4II2B 4PK1A 2ONQA 3Q2AC 3DDCB 1JW9D 2V3PA 2MP2B 3ZQ4A 2KJRA 1WE6A 4EUTA 4YT0B 3PZ7A 4OVUA 4DHJD 2ICIA 2KN4A 2V4IB 2V3SA 2D10A 3TMPB 1UGJA 3RD2A 2AEHA 2M0XA 4ZHOA 2LHDA 4AS1A 1OQYA 1MG4A 1R4MI 4L2YA 5EE1A 4N59A 2EKEC 4L1BA 1C78A 1P98A 2FCSA 2QHOA 2RPQA 1TYGB 2FUG1 2LGDA 2DLBA 1OEYJ 2I2YA 3H1UA 3VR9B 1RLFA 3W5VB 3NJTA 3APCA 2WX0A 2QDFA 2WU5B 1XD3B 2X8XX 2BB6A 2KNBA 3NRZA 1V5OA 5IA7A 1FRRA 1N5XA 1VDVA 3NZSA 1TS3A 3PLUA 2G3QB 3IFWB 2KLCA 2LVOA 4OVVA 1AARA 2PLPA 1EU4A 2O2VA 3B08A 3HK0A 4OVZA 4XGAB 3NG0A 2GOWA 4MSQB 1B1ZA 2NR2A 1PGAA 2GBKA 2J0JA 2HJ8A 4HVBA 4EFOA 2V0GA 2MH7A 3Q6BA 5E6JA 2K8CA 2VZKB 5DPSA 2M4NA 3M63B 1IGDA 3MC8A 3P1MA 3DOWA 4FN2A 4GU2A 1TKYA 2NMQA 1YN3A 3JSVA 1V97A 4K7UA 1NENB 4PT5A 3BK1A 1ZE3D 2KN5A 3RNAC 2RDBC 3IT6B 5EE3A 5IP4D 2H89B 1NI3A 3H9DA 3Q69A 3NVZA 2DAFA 3BYTB 4N9F4 4TQ0A 1KLVA 4US9A 4TMAB 4O1NA 2LJ5A 4W9FA 3E9SA 4LJOB 3WAPA 2XBBC 5H92C
chains in the Genus database with same CATH topology
2IO1B 4NJ6A 4AJYB 3L08A 4CO7A 3UQBA 3L16A 2FCMA 4MGIE 4MH0E 2JZZA 4K81A 4YL8A 2C7NB 2PPHA 4KZCA 5D7GA 1WXSA 2KXJA 3ENEA 3UINB 4FJVB 3EECA 3VTUA 3QHTA 1V81A 2K25A 4BKSD 3UIOB 3KYDD 4KDLB 3W1SA 3K9PB 3R7RA 3A9JB 2N1VA 2LRUA 3UGBB 2J0KA 1G6JA 1GG3A 2HD5B 3KYCD 5AZFA 2KC1A 3KUDB 3L10B 3V6CB 2MCNB 4GDKB 3A9JA 2DX5B 2KJ6A 2ZPYA 2CHXA 4HPMB 3VTWA 4B95A 5IAAC 2ZEQA 4HPLB 1TGZB 4IG7B 2KX3A 3AXCA 2R2OA 4MELA 3OAWA 3CSTA 4CHKA 1E8WA 1J8CA 2B3AA 5L83A 3R66C 1ZGUB 4DHZB 3RUIB 4W9JA 2AYOB 1KOTA 4EZLA 3HHMA 3IHPC 1WXMA 2DZKA 2LVPA 4X57B 2A4ZA 4AUQC 5JH5C 4ZRIA 1E7VA 4CYEA 1TZ1A 4RMAA 3ZNZB 1WZ3A 1WJNA 1WY8A 2K1FA 3ZNHB 3SHQA 2N7EA 1H4RA 5HKHA 4NQKE 4W9HA 4GSWA 5KHOA 3IVFA 3VUWA 1P0RA 3ML8A 3ZVVA 3WIMA 4EEWA 1VCBA 2DENB 2KANA 3QCAA 5LXHA 3DVGY 1UGMA 2L3ZA 3MHSD 2WDTB 3N3KB 4HWIB 2KDBA 5JHAA 3DBLI 5DCNA 2REXA 2LZ6A 3H7SA 2PJHA 3LDZE 4DK5A 3DBHI 4I6PA 2KO3A 2Y5BB 4W9KA 3VXWA 4II3B 3ZDMC 2PEAA 3M95A 4JL9A 3U8ZA 2FUHB 3EFUA 1V80A 5GMVA 4ANVA 3OJ3A 3WAMA 1UELA 1V5TA 3NOBA 2WX1A 3A33B 1WXAA 5BO4B 1UBIA 4DDID 2EMTA 3BY4B 4ZRKA 1E90A 4GN1A 2KLGA 2LXAA 2FIDA 5LXIB 1EO6A 1MG8A 2HTHA 4PS7A 1RAXA 3GOEA 2AL6A 3X23A 3DQVA 4GGQA 1WJ6A 1WGYA 4BKTA 1GC6A 1U4AA 2L05A 2DYBA 2KTFA 3QWZB 4GXBA 4F8CB 1NDDA 4B6WA 4PS8A 4IM0A 3UIPB 4WAAA 2NPTA 4HXDA 2K6QA 3CSFA 3WAOA 4HLEA 2K8HA 3AULA 3AU4A 3RCZA 4J6IA 3V60A 1SE9A 2Z0EB 1YJ1A 3AU5A 3VUYA 4GB9A 3SU8X 2KD0A 1GUAB 3PZDA 1WJUA 1E8YA 3QIJA 2KFJA 2JY6A 4WJNA 5AZGA 3QJZA 1ZW7A 3VH3B 2KWVB 2D07B 1TBEA 4DXAB 2FNJB 3JVZX 3VHTC 3DVNV 1WH3A 2GBNA 2KDEB 4NJ7A 3I3TB 3PPAA 3PRZA 4P7IA 3ML9A 3DCGA 1P3QU 3DBSA 1WFYA 2FIFA 2OOBB 2W9NA 2L0TA 3PTFC 4ZYNA 2ZZPB 4MSMB 2DZMA 3V61A 4W9GA 2JRIB 5D2MB 3T9LA 2N4FA 4I6LB 2YLMA 3N30A 5CHVC 3KVFB 4E71A 4ICVA 2LXCA 2AWTA 2D3GA 3ZTCA 2RD0A 4ZRJA 3C0RB 1P9DU 2V4LA 4NPNA 3Q3FA 3PV1A 2ZNVC 3H7PB 4MJSB 3ZW3A 2WYQA 3RULA 2MW5A 2O6VD 3N32A 3V6EB 3WA0A 1WI0A 1KM7A 2BKFA 3H7PA 4MJSA 2N9PC 2KMAA 4ASWC 2C5LC 2DYMA 2DHZA 4BOZB 2D11A 3M3JA 5CTRC 3ZUNA 3A4RA 1IYFA 5FR6A 4GMVA 3PHWB 4K7SA 4PYZA 1WF9A 2JVCA 4KSLC 5CHFA 3APDA 2NBVB 2Z59B 1Z5SB 3DBRI 4JGHB 2KK8A 1H8CA 3QAQA 4TQ1A 1WIAA 1S1QB 3TIXA 4KSKC 2BKRB 3PHXB 3VQIA 4FHJA 2JRHA 4ICUA 5KHQA 2JWZA 1YD8U 4M8NA 2Z0DB 3B0AA 1WMHB 2KDIA 2MBHA 4GDKA 2CS4A 1WR6E 1V86A 4W9LA 1WGDA 4FA6A 4FULA 2J0MA 1PQSA 2KOXA 2UYZB 3ZIMA 4M8MA 4NY0A 3D32A 1QZEA 4DDGD 2BYVE 2FCNA 2KX0A 4M0WB 4HDQA 2GBJA 2ASQA 2BGFA 2ZVNA 2LVQA 2XK5B 4MDKE 1FXTB 4AWJA 5L95C 3PVLA 2KVRA 1HE8A 4EOYA 4W9CA 3P2BA 3W1YA 2MBOA 2D2QA 4GIVA 3V62A 1YQBA 4FJZA 3JYUA 1R4NI 2I1JA 1XT9B 2RSUA 4PS3A 5E6NA 3RZFA 4W9DA 2G45B 2N1WA 4LDTD 3R7QA 2ZCBA 3X0WA 2JUOA 3KH0A 2KZRA 3PGEA 2GBRA 3WALA 5AZHA 4AP4C 5J18A 3L54A 1WGHA 3B1LX 3ZNID 2RGFA 2C7HA 1GC7A 2FCQA 3EHVA 4FJYA 4AJWA 4G3XB 3GZNI 2MBQA 2BWFA 3CMMB 3HM3A 4FLHA 3ZNGC 5DPWA 4DBGA 2A5UA 3TCAA 4IC7B 4TUUA 3VH4B 4GOCA 4WJQA 1WJ4A 2CR5A 2K39A 4NNJB 2KKCA 4MEMA 4BBNC 2WWZA 1UBQA 2MX2A 4BFRA 1NI2A 2R2QA 2BF8B 4MM3A 2AL3A 4IWQA 1TTNA 2DZIA 1WYWB 3LJ3A 4XZ4A 1WX7A 4DWFA 4MGKE 2MWSB 3NHEB 1V6EA 2O6VB 5J2RA 2FAZA 4I6NB 1YIWA 2M1MA 3EC8A 2K6DB 4PYUA 2KQSA 5CX3A 4LJPB 1SGHA 2NBWB 2ZPNA 3DVGX 4KDIC 3QK0A 1Q5WB 4WQOB 1LFDA 5LLIA 2JXXA 1J19A 2LD9A 2NBUA 4KV2A 3VUXA 2BPSA 4IWPA 4DHZE 2ZVOA 5AEKB 4GDLB 2PE9A 4F1SA 1WGRA 4WWOA 4NQLB 2KFKB 2MRPA 2L7RA 2CU1A 4MGZE 1WM2A 2IO3B 2JZ3B 2NVUI 4BKSA 1WM3A 4HCPB 1E7UA 1LM8B 4HK2A 2KFKA 4RM9A 3ZO5B 4RM8A 3M62B 4W9EA 5E6PA 3A1QB 4KIKB 5DPTA 4K1RB 2N9XA 4FBJB 3O65B 2KQ7A 3A1QA 3A9KB 2MBBB 1S3SG 3ALBA 1UZXB 3HM6X 4G50A 1I42A 4ANUA 4KVGB 2C9WB 4B9KA 2XEWA 1BT0A 3A9KA 4IM3A 2PE6B 3VFKA 1WE7A 3QQ8B 3K9OB 4IUMB 5D6JB 3RZWC 1C1YB 3S2AA 2UWQA 2IO0B 2DAJA 4HDOA 4A3PA 3PRMB 1M94A 2IO2B 3QA8A 3U30A 1C3TA 1WGGA 2L8JA 1F9JA 4K7WA 2L00B 2L76A 1P1AA 1WXVA 3NY5A 3T8MA 4FADA 1WR1A 1UH6A 2IBIB 2NCNA 2EMSA 4BBNF 3JW0X 1EF1A 2M8SA 2KC2A 3PT2B 4WJOA 4ANXA 1X1MA 4KZ0A 5EDSA 2MQJA 1L2NA 4II2B 2C7MB 4JLCA 3VVWB 3DDCB 5G55A 2G4SA 3ZKJC 2ZNVB 1UD7A 1NBFC 4EKUA 1WX8A 4EZJA 2MP2B 3DPDA 2KJRA 1WE6A 4EUTA 1YX5B 2G4DB 2JPHA 3BINA 1OGWA 4OVUA 2MP2A 4DHJD 4A3OA 2IYDB 2V3SA 2D10A 2GBMA 3ZLZA 4G0NB 3TMPB 1WZ0A 3MTNB 4E74A 2KWCA 4EZKA 4FHKA 3WANA 1EUVB 1JRUA 2IY1B 2MSED 3RD2A 2AEHA 3W1SC 1ISNA 2M0XA 1Y8RC 3QX1A 1OQYA 3OLMD 5C1ZA 1R4MI 2BYEA 2JT4B 1OTRB 1I35A 1WMHA 3ZRFA 5TR5A 2EKEC 1LXDA 3A4SC 4WJPA 4MGYE 2HE7A 1P98A 2FCSA 2QHOA 3QARA 2RPQA 2M17A 1Q0WB 4BOSC 1V2YA 2CHZA 1YX6B 3ONSA 2KHWB 2LGDA 2DYOA 4BVUC 2MBEA 2LWPA 3KUZA 2XK5A 2L0FA 1V49A 3NZUA 4ANWA 1OEYJ 3H1UA 4W9IA 3CF6E 1RLFA 3AI5A 5JHBA 2JF5A 3APCA 1ZKHA 2WX0A 3TJPA 1V9JA 2BYFA 3RYTA 1XQQA 2LGYA 1XD3B 3Q3JA 2KNBA 2NS5A 3IBEA 1V5OA 5IA7A 4JQWC 1LQBA 3MJWA 3QC8B 3NZSA 2J7QB 2OJRA 2GMIC 2ZJDA 1K8RB 1WRDB 3DVNU 3OJ4B 5JZEB 1A5RA 3PLUA 2G3QB 4E3CA 3IFWB 3TL5A 2O2VB 4IM2A 1CMXB 1J0GA 2KLCA 3PSEB 2LVOA 3PLVA 2KJHB 4XC2A 4OVVA 4F7ZA 1AARA 3VAWA 2O2VA 3B08A 4HJKA 3TBLD 3HK0A 3ZTDA 5D94A 2BWES 3UF8A 3KUCB 1IP9A 3UQAA 1GJZA 2GOWA 4BKGA 5CHWA 4MSQB 2LUEA 1L7YA 2NR2A 2RR9A 2GBKA 2J0JA 1E8ZA 2HJ8A 2KMCA 4XX5A 4EFOA 1IPGA 1Z2MA 4HVBA 4LCDE 4URKA 2O6VA 1EF5A 3VTVA 3U7DA 4NAWB 2C60A 2ZCCA 3ZDTA 2N7DA 4TKNA 4DHJB 1KJTA 3L0WB 3L13A 2IY0B 2K8CA 2K8BA 3SD5A 2KDFB 2MLBA 1GNUA 4GDLA 5DPSA 1D3ZA 4NAWA 2M4NA 3M63B 1RFAA 3JSVB 3DOWA 4FN2A 4IWOA 3L17A 4GU2A 3R3MA 4WWNA 3ZRCA 1SIFA 2LASA 2NPTB 1WX9A 3JSVA 4KIKA 4K7UA 2V1YA 2LI5A 3NS8A 4TV3A 5J17A 2KN5A 4A20A 1T0YA 1VD2A 3PRPB 4IW0A 3ECIA 3H6NA 3KW5B 4AOFA 3H9DA 2KTRB 3PS6A 5E6OA 3PREA 1E5WA 4ZDVA 2I1KA 5DPRA 1E8XA 1Q1OA 2LRWA 2KTRA 2DAFA 2VRRB 2IZVB 4N9F4 3APFA 3HIZA 3IG3A 1OEYA 2MA9B 4TQ0A 4LDTB 1KLVA 3VDZA 1RRBA 2CHWA 2KWUB 4JIOU 2YVCA 4G11A 3RT3B 3SDLC 2DZJA 2LJ5A 4W9FA 4WWPA 2CKHB 2N9EB 2LGXA 4HCNB 4LJOB 3WAPA 5G2NA 2XBBC 5C23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO1 B;  4NJ6 A;  4AJY B;  3L08 A;  4CO7 A;  3UQB A;  3L16 A;  2FCM A;  4MGI E;  4MH0 E;  2JZZ A;  4K81 A;  4YL8 A;  2C7N B;  2PPH A;  4KZC A;  5D7G A;  1WXS A;  2KXJ A;  3ENE A;  3UIN B;  4FJV B;  3EEC A;  3VTU A;  3QHT A;  1V81 A;  2K25 A;  4BKS D;  3UIO B;  3KYD D;  4KDL B;  3W1S A;  3K9P B;  3R7R A;  3A9J B;  2N1V A;  2LRU A;  3UGB B;  2J0K A;  1G6J A;  1GG3 A;  2HD5 B;  3KYC D;  5AZF A;  2KC1 A;  3KUD B;  3L10 B;  3V6C B;  2MCN B;  4GDK B;  3A9J A;  2DX5 B;  2KJ6 A;  2ZPY A;  2CHX A;  4HPM B;  3VTW A;  4B95 A;  5IAA C;  2ZEQ A;  4HPL B;  1TGZ B;  4IG7 B;  2KX3 A;  3AXC A;  2R2O A;  4MEL A;  3OAW A;  3CST A;  4CHK A;  1E8W A;  1J8C A;  2B3A A;  5L83 A;  3R66 C;  1ZGU B;  4DHZ B;  3RUI B;  4W9J A;  2AYO B;  1KOT A;  4EZL A;  3HHM A;  3IHP C;  1WXM A;  2DZK A;  2LVP A;  4X57 B;  2A4Z A;  4AUQ C;  5JH5 C;  4ZRI A;  1E7V A;  4CYE A;  1TZ1 A;  4RMA A;  3ZNZ B;  1WZ3 A;  1WJN A;  1WY8 A;  2K1F A;  3ZNH B;  3SHQ A;  2N7E A;  1H4R A;  5HKH A;  4NQK E;  4W9H A;  4GSW A;  5KHO A;  3IVF A;  3VUW A;  1P0R A;  3ML8 A;  3ZVV A;  3WIM A;  4EEW A;  1VCB A;  2DEN B;  2KAN A;  3QCA A;  5LXH A;  3DVG Y;  1UGM A;  2L3Z A;  3MHS D;  2WDT B;  3N3K B;  4HWI B;  2KDB A;  5JHA A;  3DBL I;  5DCN A;  2REX A;  2LZ6 A;  3H7S A;  2PJH A;  3LDZ E;  4DK5 A;  3DBH I;  4I6P A;  2KO3 A;  2Y5B B;  4W9K A;  3VXW A;  4II3 B;  3ZDM C;  2PEA A;  3M95 A;  4JL9 A;  3U8Z A;  2FUH B;  3EFU A;  1V80 A;  5GMV A;  4ANV A;  3OJ3 A;  3WAM A;  1UEL A;  1V5T A;  3NOB A;  2WX1 A;  3A33 B;  1WXA A;  5BO4 B;  1UBI A;  4DDI D;  2EMT A;  3BY4 B;  4ZRK A;  1E90 A;  4GN1 A;  2KLG A;  2LXA A;  2FID A;  5LXI B;  1EO6 A;  1MG8 A;  2HTH A;  4PS7 A;  1RAX A;  3GOE A;  2AL6 A;  3X23 A;  3DQV A;  4GGQ A;  1WJ6 A;  1WGY A;  4BKT A;  1GC6 A;  1U4A A;  2L05 A;  2DYB A;  2KTF A;  3QWZ B;  4GXB A;  4F8C B;  1NDD A;  4B6W A;  4PS8 A;  4IM0 A;  3UIP B;  4WAA A;  2NPT A;  4HXD A;  2K6Q A;  3CSF A;  3WAO A;  4HLE A;  2K8H A;  3AUL A;  3AU4 A;  3RCZ A;  4J6I A;  3V60 A;  1SE9 A;  2Z0E B;  1YJ1 A;  3AU5 A;  3VUY A;  4GB9 A;  3SU8 X;  2KD0 A;  1GUA B;  3PZD A;  1WJU A;  1E8Y A;  3QIJ A;  2KFJ A;  2JY6 A;  4WJN A;  5AZG A;  3QJZ A;  1ZW7 A;  3VH3 B;  2KWV B;  2D07 B;  1TBE A;  4DXA B;  2FNJ B;  3JVZ X;  3VHT C;  3DVN V;  1WH3 A;  2GBN A;  2KDE B;  4NJ7 A;  3I3T B;  3PPA A;  3PRZ A;  4P7I A;  3ML9 A;  3DCG A;  1P3Q U;  3DBS A;  1WFY A;  2FIF A;  2OOB B;  2W9N A;  2L0T A;  3PTF C;  4ZYN A;  2ZZP B;  4MSM B;  2DZM A;  3V61 A;  4W9G A;  2JRI B;  5D2M B;  3T9L A;  2N4F A;  4I6L B;  2YLM A;  3N30 A;  5CHV C;  3KVF B;  4E71 A;  4ICV A;  2LXC A;  2AWT A;  2D3G A;  3ZTC A;  2RD0 A;  4ZRJ A;  3C0R B;  1P9D U;  2V4L A;  4NPN A;  3Q3F A;  3PV1 A;  2ZNV C;  3H7P B;  4MJS B;  3ZW3 A;  2WYQ A;  3RUL A;  2MW5 A;  2O6V D;  3N32 A;  3V6E B;  3WA0 A;  1WI0 A;  1KM7 A;  2BKF A;  3H7P A;  4MJS A;  2N9P C;  2KMA A;  4ASW C;  2C5L C;  2DYM A;  2DHZ A;  4BOZ B;  2D11 A;  3M3J A;  5CTR C;  3ZUN A;  3A4R A;  1IYF A;  5FR6 A;  4GMV A;  3PHW B;  4K7S A;  4PYZ A;  1WF9 A;  2JVC A;  4KSL C;  5CHF A;  3APD A;  2NBV B;  2Z59 B;  1Z5S B;  3DBR I;  4JGH B;  2KK8 A;  1H8C A;  3QAQ A;  4TQ1 A;  1WIA A;  1S1Q B;  3TIX A;  4KSK C;  2BKR B;  3PHX B;  3VQI A;  4FHJ A;  2JRH A;  4ICU A;  5KHQ A;  2JWZ A;  1YD8 U;  4M8N A;  2Z0D B;  3B0A A;  1WMH B;  2KDI A;  2MBH A;  4GDK A;  2CS4 A;  1WR6 E;  1V86 A;  4W9L A;  1WGD A;  4FA6 A;  4FUL A;  2J0M A;  1PQS A;  2KOX A;  2UYZ B;  3ZIM A;  4M8M A;  4NY0 A;  3D32 A;  1QZE A;  4DDG D;  2BYV E;  2FCN A;  2KX0 A;  4M0W B;  4HDQ A;  2GBJ A;  2ASQ A;  2BGF A;  2ZVN A;  2LVQ A;  2XK5 B;  4MDK E;  1FXT B;  4AWJ A;  5L95 C;  3PVL A;  2KVR A;  1HE8 A;  4EOY A;  4W9C A;  3P2B A;  3W1Y A;  2MBO A;  2D2Q A;  4GIV A;  3V62 A;  1YQB A;  4FJZ A;  3JYU A;  1R4N I;  2I1J A;  1XT9 B;  2RSU A;  4PS3 A;  5E6N A;  3RZF A;  4W9D A;  2G45 B;  2N1W A;  4LDT D;  3R7Q A;  2ZCB A;  3X0W A;  2JUO A;  3KH0 A;  2KZR A;  3PGE A;  2GBR A;  3WAL A;  5AZH A;  4AP4 C;  5J18 A;  3L54 A;  1WGH A;  3B1L X;  3ZNI D;  2RGF A;  2C7H A;  1GC7 A;  2FCQ A;  3EHV A;  4FJY A;  4AJW A;  4G3X B;  3GZN I;  2MBQ A;  2BWF A;  3CMM B;  3HM3 A;  4FLH A;  3ZNG C;  5DPW A;  4DBG A;  2A5U A;  3TCA A;  4IC7 B;  4TUU A;  3VH4 B;  4GOC A;  4WJQ A;  1WJ4 A;  2CR5 A;  2K39 A;  4NNJ B;  2KKC A;  4MEM A;  4BBN C;  2WWZ A;  1UBQ A;  2MX2 A;  4BFR A;  1NI2 A;  2R2Q A;  2BF8 B;  4MM3 A;  2AL3 A;  4IWQ A;  1TTN A;  2DZI A;  1WYW B;  3LJ3 A;  4XZ4 A;  1WX7 A;  4DWF A;  4MGK E;  2MWS B;  3NHE B;  1V6E A;  2O6V B;  5J2R A;  2FAZ A;  4I6N B;  1YIW A;  2M1M A;  3EC8 A;  2K6D B;  4PYU A;  2KQS A;  5CX3 A;  4LJP B;  1SGH A;  2NBW B;  2ZPN A;  3DVG X;  4KDI C;  3QK0 A;  1Q5W B;  4WQO B;  1LFD A;  5LLI A;  2JXX A;  1J19 A;  2LD9 A;  2NBU A;  4KV2 A;  3VUX A;  2BPS A;  4IWP A;  4DHZ E;  2ZVO A;  5AEK B;  4GDL B;  2PE9 A;  4F1S A;  1WGR A;  4WWO A;  4NQL B;  2KFK B;  2MRP A;  2L7R A;  2CU1 A;  4MGZ E;  1WM2 A;  2IO3 B;  2JZ3 B;  2NVU I;  4BKS A;  1WM3 A;  4HCP B;  1E7U A;  1LM8 B;  4HK2 A;  2KFK A;  4RM9 A;  3ZO5 B;  4RM8 A;  3M62 B;  4W9E A;  5E6P A;  3A1Q B;  4KIK B;  5DPT A;  4K1R B;  2N9X A;  4FBJ B;  3O65 B;  2KQ7 A;  3A1Q A;  3A9K B;  2MBB B;  1S3S G;  3ALB A;  1UZX B;  3HM6 X;  4G50 A;  1I42 A;  4ANU A;  4KVG B;  2C9W B;  4B9K A;  2XEW A;  1BT0 A;  3A9K A;  4IM3 A;  2PE6 B;  3VFK A;  1WE7 A;  3QQ8 B;  3K9O B;  4IUM B;  5D6J B;  3RZW C;  1C1Y B;  3S2A A;  2UWQ A;  2IO0 B;  2DAJ A;  4HDO A;  4A3P A;  3PRM B;  1M94 A;  2IO2 B;  3QA8 A;  3U30 A;  1C3T A;  1WGG A;  2L8J A;  1F9J A;  4K7W A;  2L00 B;  2L76 A;  1P1A A;  1WXV A;  3NY5 A;  3T8M A;  4FAD A;  1WR1 A;  1UH6 A;  2IBI B;  2NCN A;  2EMS A;  4BBN F;  3JW0 X;  1EF1 A;  2M8S A;  2KC2 A;  3PT2 B;  4WJO A;  4ANX A;  1X1M A;  4KZ0 A;  5EDS A;  2MQJ A;  1L2N A;  4II2 B;  2C7M B;  4JLC A;  3VVW B;  3DDC B;  5G55 A;  2G4S A;  3ZKJ C;  2ZNV B;  1UD7 A;  1NBF C;  4EKU A;  1WX8 A;  4EZJ A;  2MP2 B;  3DPD A;  2KJR A;  1WE6 A;  4EUT A;  1YX5 B;  2G4D B;  2JPH A;  3BIN A;  1OGW A;  4OVU A;  2MP2 A;  4DHJ D;  4A3O A;  2IYD B;  2V3S A;  2D10 A;  2GBM A;  3ZLZ A;  4G0N B;  3TMP B;  1WZ0 A;  3MTN B;  4E74 A;  2KWC A;  4EZK A;  4FHK A;  3WAN A;  1EUV B;  1JRU A;  2IY1 B;  2MSE D;  3RD2 A;  2AEH A;  3W1S C;  1ISN A;  2M0X A;  1Y8R C;  3QX1 A;  1OQY A;  3OLM D;  5C1Z A;  1R4M I;  2BYE A;  2JT4 B;  1OTR B;  1I35 A;  1WMH A;  3ZRF A;  5TR5 A;  2EKE C;  1LXD A;  3A4S C;  4WJP A;  4MGY E;  2HE7 A;  1P98 A;  2FCS A;  2QHO A;  3QAR A;  2RPQ A;  2M17 A;  1Q0W B;  4BOS C;  1V2Y A;  2CHZ A;  1YX6 B;  3ONS A;  2KHW B;  2LGD A;  2DYO A;  4BVU C;  2MBE A;  2LWP A;  3KUZ A;  2XK5 A;  2L0F A;  1V49 A;  3NZU A;  4ANW A;  1OEY J;  3H1U A;  4W9I A;  3CF6 E;  1RLF A;  3AI5 A;  5JHB A;  2JF5 A;  3APC A;  1ZKH A;  2WX0 A;  3TJP A;  1V9J A;  2BYF A;  3RYT A;  1XQQ A;  2LGY A;  1XD3 B;  3Q3J A;  2KNB A;  2NS5 A;  3IBE A;  1V5O A;  5IA7 A;  4JQW C;  1LQB A;  3MJW A;  3QC8 B;  3NZS A;  2J7Q B;  2OJR A;  2GMI C;  2ZJD A;  1K8R B;  1WRD B;  3DVN U;  3OJ4 B;  5JZE B;  1A5R A;  3PLU A;  2G3Q B;  4E3C A;  3IFW B;  3TL5 A;  2O2V B;  4IM2 A;  1CMX B;  1J0G A;  2KLC A;  3PSE B;  2LVO A;  3PLV A;  2KJH B;  4XC2 A;  4OVV A;  4F7Z A;  1AAR A;  3VAW A;  2O2V A;  3B08 A;  4HJK A;  3TBL D;  3HK0 A;  3ZTD A;  5D94 A;  2BWE S;  3UF8 A;  3KUC B;  1IP9 A;  3UQA A;  1GJZ A;  2GOW A;  4BKG A;  5CHW A;  4MSQ B;  2LUE A;  1L7Y A;  2NR2 A;  2RR9 A;  2GBK A;  2J0J A;  1E8Z A;  2HJ8 A;  2KMC A;  4XX5 A;  4EFO A;  1IPG A;  1Z2M A;  4HVB A;  4LCD E;  4URK A;  2O6V A;  1EF5 A;  3VTV A;  3U7D A;  4NAW B;  2C60 A;  2ZCC A;  3ZDT A;  2N7D A;  4TKN A;  4DHJ B;  1KJT A;  3L0W B;  3L13 A;  2IY0 B;  2K8C A;  2K8B A;  3SD5 A;  2KDF B;  2MLB A;  1GNU A;  4GDL A;  5DPS A;  1D3Z A;  4NAW A;  2M4N A;  3M63 B;  1RFA A;  3JSV B;  3DOW A;  4FN2 A;  4IWO A;  3L17 A;  4GU2 A;  3R3M A;  4WWN A;  3ZRC A;  1SIF A;  2LAS A;  2NPT B;  1WX9 A;  3JSV A;  4KIK A;  4K7U A;  2V1Y A;  2LI5 A;  3NS8 A;  4TV3 A;  5J17 A;  2KN5 A;  4A20 A;  1T0Y A;  1VD2 A;  3PRP B;  4IW0 A;  3ECI A;  3H6N A;  3KW5 B;  4AOF A;  3H9D A;  2KTR B;  3PS6 A;  5E6O A;  3PRE A;  1E5W A;  4ZDV A;  2I1K A;  5DPR A;  1E8X A;  1Q1O A;  2LRW A;  2KTR A;  2DAF A;  2VRR B;  2IZV B;  4N9F 4;  3APF A;  3HIZ A;  3IG3 A;  1OEY A;  2MA9 B;  4TQ0 A;  4LDT B;  1KLV A;  3VDZ A;  1RRB A;  2CHW A;  2KWU B;  4JIO U;  2YVC A;  4G11 A;  3RT3 B;  3SDL C;  2DZJ A;  2LJ5 A;  4W9F A;  4WWP A;  2CKH B;  2N9E B;  2LGX A;  4HCN B;  4LJO B;  3WAP A;  5G2N A;  2XBB C;  5C23 A; 
#chains in the Genus database with same CATH topology
 1NYQ A;  2IO1 B;  5TSS A;  3DBR B;  4AJY B;  2RPV A;  3L16 A;  4MH0 E;  3RMK C;  2ZW1 A;  2KMM A;  3GE3 C;  1WXS A;  4FJV B;  1AYF A;  3URY A;  3QHT A;  4BKS D;  4KDL B;  2M56 B;  2N1V A;  3UGB B;  4K3B A;  2E6X A;  1VZ7 A;  2HD5 B;  3KUD B;  3L10 B;  3V6C B;  4B95 A;  2CHX A;  4HPM B;  3AXC A;  4KGT A;  4MEL A;  1HA5 A;  2QIL A;  1E8W A;  3EUB 2;  2B3A A;  4W9J A;  2D5G A;  1WXM A;  2LVP A;  2Z8L A;  5JH5 C;  1WY8 A;  4N6E B;  2WU2 B;  1YQ3 B;  2JWU A;  2PVO D;  2WXM A;  1XLO A;  3AE8 B;  3FAH A;  2L3Z A;  1B9R A;  2WDT B;  3BYY B;  5DCN A;  2PJH A;  4I6P A;  2Y5B B;  3ZDM C;  3KWL A;  3U8Z A;  3EFU A;  4ANV A;  3TEY A;  3IAM 1;  3NOB A;  5AUI A;  4GN1 A;  2KLG A;  3EGR A;  1SEB D;  1V1P B;  2LXA A;  1MG8 A;  2HTH A;  1RAX A;  2AL6 A;  4BZA A;  3X23 A;  3DQV A;  3RPF C;  3AE6 B;  2SEB D;  2DYB A;  4GXB A;  4F8C B;  2Q5W D;  2NPT A;  1N61 A;  4HXD A;  4AQ7 A;  2K6Q A;  1YJJ A;  3AEB B;  3CSF A;  3WAO A;  1SE9 A;  1YJ1 A;  1SE2 A;  1M4V A;  2KD0 A;  1E8Y A;  4OZA A;  2YEP F;  1WRI A;  3QIJ A;  2JY6 A;  2EEL A;  3VH3 B;  2PIA A;  2XN9 C;  1TBE A;  5FKA C;  4DXA B;  2FNJ B;  4NAM A;  3DVN V;  1WH3 A;  3PPA A;  1FEH A;  3DCG A;  1ZXI A;  1MJD A;  4LTU A;  2W9N A;  4ZYN A;  4W9G A;  5CHV C;  3KLS X;  4ZRJ A;  2V4L A;  4NPN A;  2RDH A;  3ZW3 A;  3B9J A;  3RUL A;  4R3D A;  2O6V D;  1QLB B;  4ARI A;  2JXT A;  3Q8C A;  1KM7 A;  4MJS A;  2DYM A;  4BOZ B;  3M3J A;  5CTR C;  3SFE B;  2ACZ B;  2BBC A;  3P4P B;  2BTE A;  3PHW B;  1SBB B;  2N0S B;  3APD A;  3DBR I;  1ET6 A;  4TQ1 A;  4C4V A;  1WIA A;  2BKR B;  2JRH A;  5HHD G;  4GDK A;  2CS4 A;  1WR6 E;  1WGD A;  2UU7 A;  4YSZ B;  1PQS A;  2KOX A;  3D32 A;  4DDG D;  3PO0 A;  2FCN A;  4HDQ A;  2ZVN A;  2LVQ A;  1TJE A;  4AWJ A;  4FXC A;  1YQB A;  4C7Y A;  2I1J A;  1XT9 B;  4W9D A;  1P7E A;  2LGI A;  2JUO A;  2GBR A;  1WYG A;  3L54 A;  3B1L X;  1L0X B;  3CMM B;  3HM3 A;  1NVI D;  3DHI C;  4HRO A;  4LNK A;  2A5U A;  4HKQ A;  1BUI C;  4TUU A;  1FMA D;  4MEM A;  2WXO A;  1D5M C;  4MM3 A;  2AL3 A;  4IWQ A;  2DZI A;  2MWS B;  5MPO A;  5I4D A;  2FAZ A;  2VH1 A;  1N60 A;  2M1M A;  2ZW0 A;  4KDI C;  3QK0 A;  4WQO B;  2NBU A;  2BPS A;  5AEK B;  1FXI A;  1JWB D;  4MAC A;  2MRP A;  2CU1 A;  1LM8 B;  4RM9 A;  2AQ2 B;  3M62 B;  2WXL A;  4RM8 A;  4HPP A;  1PGB A;  3Q8B A;  4RGM A;  4A8X C;  5DPT A;  3IT4 B;  4K1R B;  1GB4 A;  4P1B C;  3LXF A;  1S3S G;  2B76 B;  4G50 A;  1I42 A;  1AN8 A;  2XEW A;  1FFV A;  5BYR A;  1CZP A;  1KF6 B;  4H2A A;  3AE3 B;  2JSV X;  2UWQ A;  2IO0 B;  1M94 A;  2KQ4 X;  2BB5 A;  3AE5 B;  3NY5 A;  1WR1 A;  1UH6 A;  2NCN A;  1EF1 A;  3PT2 B;  4ANX A;  5EDS A;  1L2N A;  3MC0 B;  1XF5 L;  4JLC A;  3I57 A;  3VVW B;  5G55 A;  1F77 A;  4RGO S;  2G4S A;  4EKU A;  4EZJ A;  1YX5 B;  1FCC C;  3IAS 1;  2IYD B;  1WZ0 A;  1QT9 A;  2IY1 B;  2MSE D;  1Y8R C;  3QX1 A;  1HZ6 A;  3W2D A;  3OLM D;  1SB3 C;  2JT4 B;  1OTR B;  3NZ3 A;  1TKG A;  2WP9 B;  2WQY B;  2M17 A;  1V2Y A;  2CHZ A;  3ONS A;  4UDU C;  2DYO A;  2XK5 A;  3EFC A;  3RNE C;  4ANW A;  5FK9 C;  1TS4 A;  2FBW B;  1ACC A;  1V9J A;  2BYF A;  1XQQ A;  1LQB A;  3DBH B;  3QC8 B;  3UI3 A;  1RYJ A;  2J7Q B;  2OJR A;  2GMI C;  2ZJD A;  1WRD B;  3OJ4 B;  4E3C A;  3TL5 A;  1ZUD 2;  4IM2 A;  3Q3M C;  2MJ3 A;  3PLV A;  4XC2 A;  3VAW A;  2Y3A A;  3AE2 B;  3UQA A;  5CHW A;  1L7Y A;  4ZOH C;  2KMC A;  1Z2M A;  4URK A;  1UWX A;  3N1Z C;  4CQN A;  2L52 A;  3U7D A;  2K8B A;  1GNU A;  2HTM E;  4NAW A;  2BYT A;  2G1E A;  1ZDX A;  4IWO A;  3L17 A;  3HUI A;  3R3M A;  3ZRC A;  2NPT B;  1WX9 A;  4KIK A;  4TV3 A;  4IW0 A;  3KW5 B;  1IBX A;  4XDC A;  1T0S C;  1K50 A;  1Q1O A;  1EWC A;  3DHG C;  2KTR A;  3AED B;  4XWT A;  1FNW A;  2NTS A;  4KKJ A;  4ITK A;  3IG3 A;  2QMT A;  1OEY A;  3VDZ A;  1RRB A;  1KLG D;  3ZXR A;  2E3T A;  2CHW A;  2KWU B;  3RT3 B;  3SDL C;  4IKG A;  2LJI A;  3W9C B;  2N9E B;  2LGX A;  3DWG C;  4HCN B;  1YQ4 B;  5C23 A;  3MJ5 A;  4US8 A;  3R2I A;  4NJ6 A;  3UQB A;  1L6V A;  1QOG A;  1D4B A;  2C7N B;  2PPH A;  4ZRP A;  2D3B A;  5AUK A;  2GRI A;  2WDR B;  1ET9 A;  3EEC A;  1QOA A;  1V81 A;  3MHZ A;  3W1S A;  5HFY A;  1L4D B;  4B0M A;  1PYW D;  2LRU A;  3ZYY X;  1R7S A;  2KC1 A;  3VRB B;  1V1O A;  4GDK B;  2OJW A;  3A9J A;  2ZPY A;  3VTW A;  5IAA C;  1OFF A;  4HPL B;  1TGZ B;  4IG7 B;  2KX3 A;  2R2O A;  1J8C A;  3R66 C;  1KOT A;  4EZL A;  3HHM A;  3IHP C;  2DZK A;  2KYW A;  3RNB C;  4ZRI A;  4CYE A;  3HVD A;  1TZ1 A;  1CQV A;  2K1F A;  3ZNH B;  4NQK E;  1VLB A;  4GSW A;  3VUW A;  2QCZ A;  3O13 A;  3KQ4 A;  2KAN A;  5LXH A;  3DVG Y;  4OHJ A;  4B0E A;  3N9Y C;  1HZ5 A;  2REX A;  3P4S B;  2IGG A;  3H7S A;  1HTO A;  3DBH I;  2WXN A;  3VRA B;  3M95 A;  4P6V F;  1JML A;  1WWT A;  3A33 B;  3GE8 C;  1UBI A;  1E90 A;  1IGC A;  2J42 A;  1EWY C;  1D5Z C;  3Q8E A;  4S0R A;  1WGY A;  4B6W A;  1XCT L;  2D3A A;  3ZGZ A;  1I4G A;  4QAY A;  4RH6 A;  2M19 A;  3VUY A;  4GB9 A;  1NEK B;  3RNG C;  4HRS A;  4WJN A;  1ZW7 A;  1BXT A;  2D07 B;  3ZJT A;  3JVZ X;  3VHT C;  1SF0 A;  5IN7 A;  4P7I A;  3V3X A;  1HTQ A;  2JRI B;  2AQ3 B;  3KVF B;  2AWT A;  3AE1 B;  3C0R B;  3PV1 A;  2MW5 A;  1TKE A;  3H7P A;  5BMG A;  2N9P C;  3AE9 B;  2DHZ A;  3ZUN A;  4GMV A;  3TIX A;  4BVU C;  4N58 A;  2NBV B;  2Z59 B;  1Z5S B;  2LEK A;  1J7C A;  3VQI A;  4FHJ A;  2J53 A;  3AEC B;  1V86 A;  4P1C C;  1AW7 A;  1Y56 A;  1BML C;  3AH7 A;  1I4R A;  4EE2 A;  2GBJ A;  2ASQ A;  2BGF A;  2XK5 B;  2KVR A;  1HE8 A;  4M0W A;  5C2T B;  3FIL A;  4RGT A;  3T3O A;  5E6N A;  3OWE B;  3NS1 A;  2G45 B;  3X0W A;  2W3R A;  1E7P B;  2KZR A;  4WAF A;  3WAL A;  5J18 A;  2LMC A;  1WGH A;  3DBL B;  2FCQ A;  3EHV A;  4OZB A;  3AN1 A;  1XLQ A;  3ZNG C;  4FLH A;  1D5X C;  1KTK A;  1C4P A;  3AEA B;  3NUH B;  4REZ A;  4GOC A;  1UNS A;  1L6U A;  1WJ4 A;  2CR5 A;  2KKC A;  4BBN C;  2W3S A;  4BFR A;  2JQR B;  2V9H A;  1TTN A;  2CJN A;  4MGK E;  1V6E A;  4I6N B;  1YIW A;  5EE0 A;  2K6D B;  3T3N A;  5CX3 A;  1SGH A;  2NBW B;  2N9L A;  5LLI A;  2LD9 A;  2JYT A;  4IWP A;  3C19 A;  1I4H A;  2PE9 A;  1WGR A;  1SXT A;  4NQL B;  2KFK B;  4MGZ E;  2JZ3 B;  4BKS A;  2NVU I;  2W55 A;  2PMV A;  4NJC A;  5E6P A;  3A1Q B;  4KIK B;  3BII D;  2W82 A;  3TUO A;  2MBB B;  4HKZ E;  3RN9 C;  1UZX B;  3TEW A;  2J52 A;  1YJI A;  1BT0 A;  3A9K A;  3VFK A;  3K9O B;  1C1Y B;  3I5J C;  2DAJ A;  3PRM B;  2IO2 B;  3OG5 A;  3I9V 1;  2WXR A;  4K7W A;  2WLB A;  2L76 A;  1WXV A;  3WCQ A;  4FAD A;  5FR3 A;  1N5W A;  3N20 C;  4BBN F;  2M8S A;  2KC2 A;  1X1M A;  2MQJ A;  2C7M B;  1UUP A;  4C80 A;  2DWQ A;  1Q10 A;  4LNN A;  3ZKJ C;  5C3J B;  1JAL A;  1UD7 A;  4IOI E;  1NBF C;  1YN5 A;  3DPD A;  2JPH A;  3BIN A;  1SE3 A;  2MP2 A;  4A3O A;  2QSD A;  2FE8 A;  2GBM A;  2VZK D;  3ZLZ A;  1XLN A;  4EZK A;  1GPX A;  1EUV B;  1ISN A;  5G5H A;  5C1Z A;  2BYE A;  2GI9 A;  1T5X D;  1LXD A;  1GAQ B;  2HE7 A;  1T3Q A;  3QAR A;  2IPK D;  1Q0W B;  4BOS C;  1YX6 B;  5LNK 1;  2KHW B;  1V49 A;  3NZU A;  4A6Q A;  2DNF A;  1R4N B;  5JHB A;  3P63 A;  1ZKH A;  1V8C A;  3Q3J A;  3TEX A;  3MJW A;  2WXK A;  2LFI A;  1SJE D;  4M02 A;  1GOZ A;  4BAX A;  1T0Q C;  1YNT E;  2Y5C A;  1K8R B;  3NVW A;  2O2V B;  1J0G A;  1CMX B;  3PZ8 A;  1A70 A;  2KJH B;  3FC4 A;  4HJK A;  3TBL D;  5D94 A;  2BWE S;  3KUC B;  1IP9 A;  1GJZ A;  1YN4 A;  3U7Z A;  4BKG A;  1OQQ A;  2WHI A;  1E8Z A;  2O6V A;  3GP7 A;  3VTV A;  1DOI A;  3SFD B;  2ZCC A;  2N7D A;  4TKN A;  4WQM A;  4DHJ B;  1KJT A;  2IY0 B;  2KDF B;  4XDD A;  4GDL A;  1D3Z A;  1RFA A;  3JSV B;  1TY2 A;  2LAS A;  2V1Y A;  3NS8 A;  1HEZ E;  4A20 A;  1C9F A;  1T0Y A;  3ECI A;  3H6N A;  2ON8 A;  1MFW A;  1GB1 A;  3PS6 A;  3C8Y A;  5E6O A;  3PRE A;  4ZDV A;  5DPR A;  3DHH C;  2LRW A;  2VRR B;  2IZV B;  3APF A;  3HIZ A;  1ESF A;  4LDT B;  4YTN B;  4C7Z A;  3KWV A;  5JXV A;  1ZPS A;  4JIO U;  2DZJ A;  3VR8 B;  1F52 A;  5G2N A;  1FM0 D;  1PGX A;  4ARC A;  1TY0 A;  2INN E;  4CO7 A;  4MGI E;  3AB5 A;  2JZZ A;  4K81 A;  1FD6 A;  1JWS D;  1ZDV A;  5D7G A;  3P4R B;  3ENE A;  3UIN B;  2Y5P A;  1R4M B;  3VTU A;  3SR6 A;  2K25 A;  3SEB A;  1ROE A;  1VJK A;  3KYD D;  3UIO B;  3K9P B;  1G6J A;  1L0Y B;  1GG3 A;  2PW9 A;  3KYC D;  2BW2 A;  2MCN B;  2DX5 B;  4JPS A;  2KJ6 A;  1ZOY B;  2AQ1 B;  2ZEQ A;  2BVC A;  3N1Y C;  2GLS A;  4CHK A;  3CST A;  2BT6 A;  5L83 A;  1ZGU B;  4DHZ B;  5BYS A;  1SE4 A;  2PKO A;  1XO3 A;  2WS3 B;  3R8B A;  3FIL B;  1VZ8 A;  1WZ3 A;  3GZN B;  1WJN A;  1C76 A;  1K52 A;  1H4R A;  1ZXH A;  2N7E A;  5HKH A;  5HG2 A;  4W9H A;  4XWW A;  3IVF A;  1P0R A;  3WIM A;  2DEN B;  4LLG M;  2QC8 A;  3QCA A;  3ZJV A;  1C77 A;  3N3K B;  1MHX A;  2J4X A;  2KDB A;  5JHA A;  2LZ6 A;  2IGD A;  2KO3 A;  3VXW A;  2PEA A;  1KFY B;  4JL9 A;  1RFK A;  2D3C A;  2QIE B;  3OJ3 A;  3WAM A;  1UWM A;  1WXA A;  4DDI D;  2EMT A;  3BY4 B;  4ZRK A;  4LK0 M;  4JX1 C;  1J7B A;  4C56 C;  1EO6 A;  3MP9 A;  1V1P A;  1J7A A;  2H88 B;  2L05 A;  2KTF A;  3QWZ B;  1NDD A;  4PS8 A;  4IM0 A;  3E56 A;  3Q3O C;  4JWU C;  1CK1 A;  2V3N A;  3AMZ A;  3AUL A;  4YWG G;  1DYQ A;  3SU8 X;  1WJU A;  3CIR B;  2KAJ A;  2KFJ A;  5AZG A;  3QJZ A;  4D2K A;  1PUT A;  4NJ7 A;  3PRZ A;  3B2G A;  3ML9 A;  1LO5 D;  1P3Q U;  2LHE A;  3DBS A;  1WFY A;  2IDY A;  5IKC M;  2OOB B;  2L0T A;  3PTF C;  4J3O D;  1JRO A;  2VH2 A;  3N30 A;  4ICV A;  4Q2J A;  2LXC A;  2RD0 A;  1P9D U;  1SJH D;  1FXA A;  3Q3F A;  2IND C;  4KX6 B;  2ZNV C;  4MJS B;  2K22 A;  2K9X A;  4MT5 A;  4YXD B;  3V6E B;  1DOY A;  3WA0 A;  1WI0 A;  2BKF A;  2KMA A;  1XLP A;  2C5L C;  2IJ0 A;  4C4V B;  2MEK A;  1YOV B;  5FR6 A;  5CHF A;  2JVC A;  2JU6 X;  4KSL C;  4JGH B;  1H8C A;  3QAQ A;  1MVK A;  1QIL A;  1S1Q B;  4KSK C;  4ICU A;  2JWZ A;  1YD8 U;  3B0A A;  2WDQ B;  2KDI A;  5T8I A;  1RM6 C;  4FA6 A;  4FUL A;  2UYZ B;  3ZIM A;  4NY0 A;  4ZHP A;  1QZE A;  3GS2 A;  3TEZ A;  2BYV E;  3EA6 A;  4RNA A;  2KX0 A;  1HXY D;  1FXT B;  5L95 C;  2KDM A;  4EOY A;  3P2B A;  3W1Y A;  4FJZ A;  3JYU A;  3AE4 B;  2K5P A;  2RSU A;  4M01 A;  3AEE B;  2JZP A;  4LDT D;  2ZCB A;  5G5G A;  4AP4 C;  5AZH A;  3ZNI D;  4JWS C;  2C7H A;  5EE9 A;  4AJW A;  4G3X B;  3BZD B;  1L5P A;  3GZN I;  2MBQ A;  5DPW A;  2SAK A;  4DBG A;  1F2R C;  3VH4 B;  4MM3 B;  1TS2 A;  2K39 A;  2MHJ A;  1UBQ A;  1NYR A;  3BVM A;  1NI2 A;  2R2Q A;  1FNV A;  1WYW B;  4XZ4 A;  1JWA D;  3NHE B;  2O6V B;  2AX5 A;  3EC8 A;  4PYU A;  3DVG X;  2JXX A;  2NTT A;  1WGK A;  3BK2 A;  3VUX A;  3ZXV A;  2L32 A;  2BS4 B;  4DHZ E;  4GDL B;  4RCO A;  4WWO A;  4MH8 A;  3RI7 C;  3AE7 B;  1XEE A;  1RWS A;  1WM2 A;  1QOF A;  1E7U A;  3ZO5 B;  4W9E A;  1VR9 A;  3O65 B;  2KQ7 A;  2PTL A;  2RMM A;  4KVG B;  3QQ8 B;  2QJL A;  4IUM B;  5D6J B;  2IGH A;  4WIP A;  3S2A A;  4A3P A;  1JWM D;  3QA8 A;  3U30 A;  1C3T A;  1WGG A;  2RDG A;  2L8J A;  1F9J A;  4ACF A;  4OW0 A;  3R2T A;  3T8M A;  2IBI B;  4XE0 A;  1TIF A;  1MHH E;  4JE3 B;  2CJO A;  1N6Z A;  1FFU A;  2ZNV B;  4P16 A;  1PDX A;  2G9H D;  1FRD A;  1L0V B;  1WX8 A;  1K53 A;  2G4D B;  3I63 C;  1C4A A;  1OGW A;  3Q8F A;  2WXJ A;  5D3D A;  4G0N B;  3RNF C;  3MTN B;  4E74 A;  2KWC A;  4FHK A;  3WAN A;  1JRU A;  3W1S C;  4DXF A;  3N1X C;  1I35 A;  1WMH A;  2QEJ C;  3ZRF A;  4C00 A;  3GB1 A;  5TR5 A;  1FCL A;  3A4S C;  4WJP A;  4MGY E;  2WDV B;  1F1H A;  1ZP0 B;  1C79 A;  1QQR A;  1E6E B;  2HDE A;  3ETR A;  2MBE A;  2LWP A;  3KUZ A;  2JX5 A;  2L0F A;  4W9I A;  3CF6 E;  3AI5 A;  2JF5 A;  4HEA 1;  3TJP A;  3RYT A;  2LGY A;  2NS5 A;  3IBE A;  1I4P A;  3L4P A;  4JQW C;  1STE A;  1UF0 A;  2K3U A;  3DVN U;  1A5R A;  5JZE B;  5HI1 A;  2XNA C;  3PSE B;  5IOI A;  4F7Z A;  5IO9 A;  2WXP A;  2N7J A;  3ZTD A;  1C4C A;  4KGS A;  3UF8 A;  2BS2 B;  1E10 A;  4YTM B;  2LUE A;  2RR9 A;  4XX5 A;  1IPG A;  4LCD E;  1QF6 A;  1EF5 A;  1FNU A;  4NAW B;  4YSX B;  2C60 A;  3ZDT A;  2WGS A;  2MJE A;  3LYY A;  3L0W B;  3L13 A;  3SD5 A;  2MLB A;  1LGR A;  1E0Z A;  3FKY A;  5H8Y E;  1HQR D;  4WWN A;  1SIF A;  3Q8A A;  2LI5 A;  1IBX B;  5J17 A;  1VD2 A;  3PRP B;  1VZ6 A;  4AOF A;  5BYQ A;  2KTR B;  2WXF A;  1EU3 A;  1E5W A;  2I1K A;  1E8X A;  1FO4 A;  2KAC A;  4LNI A;  2MJD A;  3V05 A;  4DXG A;  5GXG B;  2JYE A;  2MA9 B;  2KWD A;  3BVG A;  3ABV B;  3RNC C;  2YVC A;  3HVZ A;  4G11 A;  4WWP A;  4OZC A;  2CKH B;  2HJ1 A;  4WWM A;  2R61 A;  1PFD A;  3BWU D;  3L08 A;  3J9C A;  4YTP B;  2FCM A;  4XYC A;  3P42 A;  2X38 A;  4YL8 A;  4A9A A;  4KZC A;  2KVZ A;  2KXJ A;  1P7F A;  1AWD A;  1JCK B;  3R7R A;  2N9K A;  3A9J B;  4M00 A;  2J0K A;  2WXH A;  5AZF A;  3CWI A;  1I4Q A;  3OAW A;  3RUI B;  2AYO B;  3NVY A;  3AEG B;  3U52 E;  3Q14 C;  4X57 B;  2A4Z A;  1QKZ A;  4AUQ C;  1E7V A;  1XXG A;  3RFZ B;  4RMA A;  3ZNZ B;  1DGJ A;  3SHQ A;  3U4E G;  1F0Z A;  5KHO A;  2PVG C;  3ML8 A;  3ZVV A;  1OQR A;  1VCB A;  4EEW A;  2YEP B;  3AV8 A;  1UGM A;  1XCQ L;  3MHS D;  4WH4 A;  4HWI B;  3DBL I;  3LDZ E;  4DK5 A;  3U2S C;  4W9K A;  4II3 B;  2FUH B;  1V80 A;  5GMV A;  1UEL A;  1V5T A;  1D6E C;  2WX1 A;  2WXQ A;  5BO4 B;  1F2R I;  1E9M A;  4K3C A;  2I38 A;  2FID A;  5LXI B;  3W5U B;  4PS7 A;  3GOE A;  1L4Z B;  1T6B X;  3H8H A;  4GGQ A;  1WJ6 A;  3MFG A;  2TSS A;  4BKT A;  1GC6 A;  1U4A A;  3UIP B;  2M0A A;  1TZO A;  4WAA A;  1SSN A;  1MI0 A;  4NZL B;  2GB1 A;  2DBY A;  4HLE A;  2K8H A;  2W54 A;  3AU4 A;  3RCZ A;  4J6I A;  3V60 A;  2Z0E B;  3AU5 A;  1GUA B;  3PZD A;  1KLU D;  4A55 A;  4RFB A;  3LB8 C;  3B2F A;  2EKI A;  2KWV B;  3BVZ A;  4DQO C;  1YMH E;  5BMI A;  1SIJ A;  1JQ4 A;  2GBN A;  2KDE B;  3I3T B;  1ENF A;  4A90 A;  3Q3N C;  2LUM A;  2FIF A;  2OED A;  3V61 A;  2ZZP B;  4MSM B;  2CU3 A;  2DZM A;  2BQQ A;  5D2M B;  3T9L A;  2N4F A;  4I6L B;  2YLM A;  4E71 A;  3ZTC A;  2D3G A;  3H7P B;  2WYQ A;  4LNO A;  3N32 A;  3TSS A;  4ASW C;  3NVV A;  1I7H A;  2D11 A;  3AEF B;  1TS5 A;  3A4R A;  4LNF A;  1IYF A;  3V62 A;  4K7S A;  4PYZ A;  1WF9 A;  2KK8 A;  3PHX B;  5KHQ A;  4M8N A;  2Z0D B;  1WMH B;  2WXI A;  4RF1 A;  1N63 A;  2L1A A;  2MBH A;  3IXS A;  4W9L A;  2K0P A;  2LGS A;  2J0M A;  4M8M A;  1KRH A;  4M0W B;  5D3I B;  1I4X A;  4MDK E;  2WXG A;  4GLS C;  3PVL A;  4W9C A;  1FPY A;  2MBO A;  2D2Q A;  4GIV A;  4TSS A;  1R4N I;  4PS3 A;  1TT5 B;  3RZF A;  2N1W A;  3R7Q A;  3KH0 A;  3PGE A;  1WXQ A;  4YSY B;  2RGF A;  1GC7 A;  4FJY A;  2BS3 B;  2BWF A;  3DWM A;  3TCA A;  4IC7 B;  4RF0 A;  2KT7 A;  4USA A;  1JWU D;  4WJQ A;  1K51 A;  1CJE A;  4NNJ B;  2WWZ A;  1KH0 A;  2MX2 A;  2BF8 B;  1QOB A;  4KGR A;  3LJ3 A;  1WX7 A;  4DWF A;  5J2R A;  1MPE A;  1N62 A;  2KQS A;  4LJP B;  5BMH A;  2ZPN A;  1Q5W B;  1VRA B;  1LFD A;  2OHF A;  1J19 A;  4KV2 A;  4L23 A;  2ZVO A;  4F1S A;  2L7R A;  4WUR A;  1WSP A;  2IO3 B;  4S17 A;  1WM3 A;  4HCP B;  4HK2 A;  2KFK A;  4HJG E;  1EM7 A;  4ZRQ A;  1T0R C;  4IDI A;  4FBJ B;  2N9X A;  3A1Q A;  3A9K B;  3ALB A;  3HM6 X;  4ANU A;  4ZYS A;  2C9W B;  1FIQ A;  4B9K A;  4IM3 A;  2PE6 B;  1JRP A;  1WE7 A;  2L83 A;  3HRD D;  3MC9 A;  3RZW C;  1IUE A;  3ZJU A;  4HDO A;  4RGN A;  3P4Q B;  2INP E;  2L00 B;  4KKI A;  1P1A A;  3AM9 A;  1DOX A;  2EMS A;  2INC C;  3JW0 X;  4WJO A;  2WNM A;  4KZ0 A;  4II2 B;  4PK1 A;  2ONQ A;  3Q2A C;  3DDC B;  1JW9 D;  2V3P A;  2MP2 B;  3ZQ4 A;  2KJR A;  1WE6 A;  4EUT A;  4YT0 B;  3PZ7 A;  4OVU A;  4DHJ D;  2ICI A;  2KN4 A;  2V4I B;  2V3S A;  2D10 A;  3TMP B;  1UGJ A;  3RD2 A;  2AEH A;  2M0X A;  4ZHO A;  2LHD A;  4AS1 A;  1OQY A;  1MG4 A;  1R4M I;  4L2Y A;  5EE1 A;  4N59 A;  2EKE C;  4L1B A;  1C78 A;  1P98 A;  2FCS A;  2QHO A;  2RPQ A;  1TYG B;  2FUG 1;  2LGD A;  2DLB A;  1OEY J;  2I2Y A;  3H1U A;  3VR9 B;  1RLF A;  3W5V B;  3NJT A;  3APC A;  2WX0 A;  2QDF A;  2WU5 B;  1XD3 B;  2X8X X;  2BB6 A;  2KNB A;  3NRZ A;  1V5O A;  5IA7 A;  1FRR A;  1N5X A;  1VDV A;  3NZS A;  1TS3 A;  3PLU A;  2G3Q B;  3IFW B;  2KLC A;  2LVO A;  4OVV A;  1AAR A;  2PLP A;  1EU4 A;  2O2V A;  3B08 A;  3HK0 A;  4OVZ A;  4XGA B;  3NG0 A;  2GOW A;  4MSQ B;  1B1Z A;  2NR2 A;  1PGA A;  2GBK A;  2J0J A;  2HJ8 A;  4HVB A;  4EFO A;  2V0G A;  2MH7 A;  3Q6B A;  5E6J A;  2K8C A;  2VZK B;  5DPS A;  2M4N A;  3M63 B;  1IGD A;  3MC8 A;  3P1M A;  3DOW A;  4FN2 A;  4GU2 A;  1TKY A;  2NMQ A;  1YN3 A;  3JSV A;  1V97 A;  4K7U A;  1NEN B;  4PT5 A;  3BK1 A;  1ZE3 D;  2KN5 A;  3RNA C;  2RDB C;  3IT6 B;  5EE3 A;  5IP4 D;  2H89 B;  1NI3 A;  3H9D A;  3Q69 A;  3NVZ A;  2DAF A;  3BYT B;  4N9F 4;  4TQ0 A;  1KLV A;  4US9 A;  4TMA B;  4O1N A;  2LJ5 A;  4W9F A;  3E9S A;  4LJO B;  3WAP A;  2XBB C;  5H92 C; 
#chains in the Genus database with same CATH homology
 2IO1 B;  4NJ6 A;  4AJY B;  3L08 A;  4CO7 A;  3UQB A;  3L16 A;  2FCM A;  4MGI E;  4MH0 E;  2JZZ A;  4K81 A;  4YL8 A;  2C7N B;  2PPH A;  4KZC A;  5D7G A;  1WXS A;  2KXJ A;  3ENE A;  3UIN B;  4FJV B;  3EEC A;  3VTU A;  3QHT A;  1V81 A;  2K25 A;  4BKS D;  3UIO B;  3KYD D;  4KDL B;  3W1S A;  3K9P B;  3R7R A;  3A9J B;  2N1V A;  2LRU A;  3UGB B;  2J0K A;  1G6J A;  1GG3 A;  2HD5 B;  3KYC D;  5AZF A;  2KC1 A;  3KUD B;  3L10 B;  3V6C B;  2MCN B;  4GDK B;  3A9J A;  2DX5 B;  2KJ6 A;  2ZPY A;  2CHX A;  4HPM B;  3VTW A;  4B95 A;  5IAA C;  2ZEQ A;  4HPL B;  1TGZ B;  4IG7 B;  2KX3 A;  3AXC A;  2R2O A;  4MEL A;  3OAW A;  3CST A;  4CHK A;  1E8W A;  1J8C A;  2B3A A;  5L83 A;  3R66 C;  1ZGU B;  4DHZ B;  3RUI B;  4W9J A;  2AYO B;  1KOT A;  4EZL A;  3HHM A;  3IHP C;  1WXM A;  2DZK A;  2LVP A;  4X57 B;  2A4Z A;  4AUQ C;  5JH5 C;  4ZRI A;  1E7V A;  4CYE A;  1TZ1 A;  4RMA A;  3ZNZ B;  1WZ3 A;  1WJN A;  1WY8 A;  2K1F A;  3ZNH B;  3SHQ A;  2N7E A;  1H4R A;  5HKH A;  4NQK E;  4W9H A;  4GSW A;  5KHO A;  3IVF A;  3VUW A;  1P0R A;  3ML8 A;  3ZVV A;  3WIM A;  4EEW A;  1VCB A;  2DEN B;  2KAN A;  3QCA A;  5LXH A;  3DVG Y;  1UGM A;  2L3Z A;  3MHS D;  2WDT B;  3N3K B;  4HWI B;  2KDB A;  5JHA A;  3DBL I;  5DCN A;  2REX A;  2LZ6 A;  3H7S A;  2PJH A;  3LDZ E;  4DK5 A;  3DBH I;  4I6P A;  2KO3 A;  2Y5B B;  4W9K A;  3VXW A;  4II3 B;  3ZDM C;  2PEA A;  3M95 A;  4JL9 A;  3U8Z A;  2FUH B;  3EFU A;  1V80 A;  5GMV A;  4ANV A;  3OJ3 A;  3WAM A;  1UEL A;  1V5T A;  3NOB A;  2WX1 A;  3A33 B;  1WXA A;  5BO4 B;  1UBI A;  4DDI D;  2EMT A;  3BY4 B;  4ZRK A;  1E90 A;  4GN1 A;  2KLG A;  2LXA A;  2FID A;  5LXI B;  1EO6 A;  1MG8 A;  2HTH A;  4PS7 A;  1RAX A;  3GOE A;  2AL6 A;  3X23 A;  3DQV A;  4GGQ A;  1WJ6 A;  1WGY A;  4BKT A;  1GC6 A;  1U4A A;  2L05 A;  2DYB A;  2KTF A;  3QWZ B;  4GXB A;  4F8C B;  1NDD A;  4B6W A;  4PS8 A;  4IM0 A;  3UIP B;  4WAA A;  2NPT A;  4HXD A;  2K6Q A;  3CSF A;  3WAO A;  4HLE A;  2K8H A;  3AUL A;  3AU4 A;  3RCZ A;  4J6I A;  3V60 A;  1SE9 A;  2Z0E B;  1YJ1 A;  3AU5 A;  3VUY A;  4GB9 A;  3SU8 X;  2KD0 A;  1GUA B;  3PZD A;  1WJU A;  1E8Y A;  3QIJ A;  2KFJ A;  2JY6 A;  4WJN A;  5AZG A;  3QJZ A;  1ZW7 A;  3VH3 B;  2KWV B;  2D07 B;  1TBE A;  4DXA B;  2FNJ B;  3JVZ X;  3VHT C;  3DVN V;  1WH3 A;  2GBN A;  2KDE B;  4NJ7 A;  3I3T B;  3PPA A;  3PRZ A;  4P7I A;  3ML9 A;  3DCG A;  1P3Q U;  3DBS A;  1WFY A;  2FIF A;  2OOB B;  2W9N A;  2L0T A;  3PTF C;  4ZYN A;  2ZZP B;  4MSM B;  2DZM A;  3V61 A;  4W9G A;  2JRI B;  5D2M B;  3T9L A;  2N4F A;  4I6L B;  2YLM A;  3N30 A;  5CHV C;  3KVF B;  4E71 A;  4ICV A;  2LXC A;  2AWT A;  2D3G A;  3ZTC A;  2RD0 A;  4ZRJ A;  3C0R B;  1P9D U;  2V4L A;  4NPN A;  3Q3F A;  3PV1 A;  2ZNV C;  3H7P B;  4MJS B;  3ZW3 A;  2WYQ A;  3RUL A;  2MW5 A;  2O6V D;  3N32 A;  3V6E B;  3WA0 A;  1WI0 A;  1KM7 A;  2BKF A;  3H7P A;  4MJS A;  2N9P C;  2KMA A;  4ASW C;  2C5L C;  2DYM A;  2DHZ A;  4BOZ B;  2D11 A;  3M3J A;  5CTR C;  3ZUN A;  3A4R A;  1IYF A;  5FR6 A;  4GMV A;  3PHW B;  4K7S A;  4PYZ A;  1WF9 A;  2JVC A;  4KSL C;  5CHF A;  3APD A;  2NBV B;  2Z59 B;  1Z5S B;  3DBR I;  4JGH B;  2KK8 A;  1H8C A;  3QAQ A;  4TQ1 A;  1WIA A;  1S1Q B;  3TIX A;  4KSK C;  2BKR B;  3PHX B;  3VQI A;  4FHJ A;  2JRH A;  4ICU A;  5KHQ A;  2JWZ A;  1YD8 U;  4M8N A;  2Z0D B;  3B0A A;  1WMH B;  2KDI A;  2MBH A;  4GDK A;  2CS4 A;  1WR6 E;  1V86 A;  4W9L A;  1WGD A;  4FA6 A;  4FUL A;  2J0M A;  1PQS A;  2KOX A;  2UYZ B;  3ZIM A;  4M8M A;  4NY0 A;  3D32 A;  1QZE A;  4DDG D;  2BYV E;  2FCN A;  2KX0 A;  4M0W B;  4HDQ A;  2GBJ A;  2ASQ A;  2BGF A;  2ZVN A;  2LVQ A;  2XK5 B;  4MDK E;  1FXT B;  4AWJ A;  5L95 C;  3PVL A;  2KVR A;  1HE8 A;  4EOY A;  4W9C A;  3P2B A;  3W1Y A;  2MBO A;  2D2Q A;  4GIV A;  3V62 A;  1YQB A;  4FJZ A;  3JYU A;  1R4N I;  2I1J A;  1XT9 B;  2RSU A;  4PS3 A;  5E6N A;  3RZF A;  4W9D A;  2G45 B;  2N1W A;  4LDT D;  3R7Q A;  2ZCB A;  3X0W A;  2JUO A;  3KH0 A;  2KZR A;  3PGE A;  2GBR A;  3WAL A;  5AZH A;  4AP4 C;  5J18 A;  3L54 A;  1WGH A;  3B1L X;  3ZNI D;  2RGF A;  2C7H A;  1GC7 A;  2FCQ A;  3EHV A;  4FJY A;  4AJW A;  4G3X B;  3GZN I;  2MBQ A;  2BWF A;  3CMM B;  3HM3 A;  4FLH A;  3ZNG C;  5DPW A;  4DBG A;  2A5U A;  3TCA A;  4IC7 B;  4TUU A;  3VH4 B;  4GOC A;  4WJQ A;  1WJ4 A;  2CR5 A;  2K39 A;  4NNJ B;  2KKC A;  4MEM A;  4BBN C;  2WWZ A;  1UBQ A;  2MX2 A;  4BFR A;  1NI2 A;  2R2Q A;  2BF8 B;  4MM3 A;  2AL3 A;  4IWQ A;  1TTN A;  2DZI A;  1WYW B;  3LJ3 A;  4XZ4 A;  1WX7 A;  4DWF A;  4MGK E;  2MWS B;  3NHE B;  1V6E A;  2O6V B;  5J2R A;  2FAZ A;  4I6N B;  1YIW A;  2M1M A;  3EC8 A;  2K6D B;  4PYU A;  2KQS A;  5CX3 A;  4LJP B;  1SGH A;  2NBW B;  2ZPN A;  3DVG X;  4KDI C;  3QK0 A;  1Q5W B;  4WQO B;  1LFD A;  5LLI A;  2JXX A;  1J19 A;  2LD9 A;  2NBU A;  4KV2 A;  3VUX A;  2BPS A;  4IWP A;  4DHZ E;  2ZVO A;  5AEK B;  4GDL B;  2PE9 A;  4F1S A;  1WGR A;  4WWO A;  4NQL B;  2KFK B;  2MRP A;  2L7R A;  2CU1 A;  4MGZ E;  1WM2 A;  2IO3 B;  2JZ3 B;  2NVU I;  4BKS A;  1WM3 A;  4HCP B;  1E7U A;  1LM8 B;  4HK2 A;  2KFK A;  4RM9 A;  3ZO5 B;  4RM8 A;  3M62 B;  4W9E A;  5E6P A;  3A1Q B;  4KIK B;  5DPT A;  4K1R B;  2N9X A;  4FBJ B;  3O65 B;  2KQ7 A;  3A1Q A;  3A9K B;  2MBB B;  1S3S G;  3ALB A;  1UZX B;  3HM6 X;  4G50 A;  1I42 A;  4ANU A;  4KVG B;  2C9W B;  4B9K A;  2XEW A;  1BT0 A;  3A9K A;  4IM3 A;  2PE6 B;  3VFK A;  1WE7 A;  3QQ8 B;  3K9O B;  4IUM B;  5D6J B;  3RZW C;  1C1Y B;  3S2A A;  2UWQ A;  2IO0 B;  2DAJ A;  4HDO A;  4A3P A;  3PRM B;  1M94 A;  2IO2 B;  3QA8 A;  3U30 A;  1C3T A;  1WGG A;  2L8J A;  1F9J A;  4K7W A;  2L00 B;  2L76 A;  1P1A A;  1WXV A;  3NY5 A;  3T8M A;  4FAD A;  1WR1 A;  1UH6 A;  2IBI B;  2NCN A;  2EMS A;  4BBN F;  3JW0 X;  1EF1 A;  2M8S A;  2KC2 A;  3PT2 B;  4WJO A;  4ANX A;  1X1M A;  4KZ0 A;  5EDS A;  2MQJ A;  1L2N A;  4II2 B;  2C7M B;  4JLC A;  3VVW B;  3DDC B;  5G55 A;  2G4S A;  3ZKJ C;  2ZNV B;  1UD7 A;  1NBF C;  4EKU A;  1WX8 A;  4EZJ A;  2MP2 B;  3DPD A;  2KJR A;  1WE6 A;  4EUT A;  1YX5 B;  2G4D B;  2JPH A;  3BIN A;  1OGW A;  4OVU A;  2MP2 A;  4DHJ D;  4A3O A;  2IYD B;  2V3S A;  2D10 A;  2GBM A;  3ZLZ A;  4G0N B;  3TMP B;  1WZ0 A;  3MTN B;  4E74 A;  2KWC A;  4EZK A;  4FHK A;  3WAN A;  1EUV B;  1JRU A;  2IY1 B;  2MSE D;  3RD2 A;  2AEH A;  3W1S C;  1ISN A;  2M0X A;  1Y8R C;  3QX1 A;  1OQY A;  3OLM D;  5C1Z A;  1R4M I;  2BYE A;  2JT4 B;  1OTR B;  1I35 A;  1WMH A;  3ZRF A;  5TR5 A;  2EKE C;  1LXD A;  3A4S C;  4WJP A;  4MGY E;  2HE7 A;  1P98 A;  2FCS A;  2QHO A;  3QAR A;  2RPQ A;  2M17 A;  1Q0W B;  4BOS C;  1V2Y A;  2CHZ A;  1YX6 B;  3ONS A;  2KHW B;  2LGD A;  2DYO A;  4BVU C;  2MBE A;  2LWP A;  3KUZ A;  2XK5 A;  2L0F A;  1V49 A;  3NZU A;  4ANW A;  1OEY J;  3H1U A;  4W9I A;  3CF6 E;  1RLF A;  3AI5 A;  5JHB A;  2JF5 A;  3APC A;  1ZKH A;  2WX0 A;  3TJP A;  1V9J A;  2BYF A;  3RYT A;  1XQQ A;  2LGY A;  1XD3 B;  3Q3J A;  2KNB A;  2NS5 A;  3IBE A;  1V5O A;  5IA7 A;  4JQW C;  1LQB A;  3MJW A;  3QC8 B;  3NZS A;  2J7Q B;  2OJR A;  2GMI C;  2ZJD A;  1K8R B;  1WRD B;  3DVN U;  3OJ4 B;  5JZE B;  1A5R A;  3PLU A;  2G3Q B;  4E3C A;  3IFW B;  3TL5 A;  2O2V B;  4IM2 A;  1CMX B;  1J0G A;  2KLC A;  3PSE B;  2LVO A;  3PLV A;  2KJH B;  4XC2 A;  4OVV A;  4F7Z A;  1AAR A;  3VAW A;  2O2V A;  3B08 A;  4HJK A;  3TBL D;  3HK0 A;  3ZTD A;  5D94 A;  2BWE S;  3UF8 A;  3KUC B;  1IP9 A;  3UQA A;  1GJZ A;  2GOW A;  4BKG A;  5CHW A;  4MSQ B;  2LUE A;  1L7Y A;  2NR2 A;  2RR9 A;  2GBK A;  2J0J A;  1E8Z A;  2HJ8 A;  2KMC A;  4XX5 A;  4EFO A;  1IPG A;  1Z2M A;  4HVB A;  4LCD E;  4URK A;  2O6V A;  1EF5 A;  3VTV A;  3U7D A;  4NAW B;  2C60 A;  2ZCC A;  3ZDT A;  2N7D A;  4TKN A;  4DHJ B;  1KJT A;  3L0W B;  3L13 A;  2IY0 B;  2K8C A;  2K8B A;  3SD5 A;  2KDF B;  2MLB A;  1GNU A;  4GDL A;  5DPS A;  1D3Z A;  4NAW A;  2M4N A;  3M63 B;  1RFA A;  3JSV B;  3DOW A;  4FN2 A;  4IWO A;  3L17 A;  4GU2 A;  3R3M A;  4WWN A;  3ZRC A;  1SIF A;  2LAS A;  2NPT B;  1WX9 A;  3JSV A;  4KIK A;  4K7U A;  2V1Y A;  2LI5 A;  3NS8 A;  4TV3 A;  5J17 A;  2KN5 A;  4A20 A;  1T0Y A;  1VD2 A;  3PRP B;  4IW0 A;  3ECI A;  3H6N A;  3KW5 B;  4AOF A;  3H9D A;  2KTR B;  3PS6 A;  5E6O A;  3PRE A;  1E5W A;  4ZDV A;  2I1K A;  5DPR A;  1E8X A;  1Q1O A;  2LRW A;  2KTR A;  2DAF A;  2VRR B;  2IZV B;  4N9F 4;  3APF A;  3HIZ A;  3IG3 A;  1OEY A;  2MA9 B;  4TQ0 A;  4LDT B;  1KLV A;  3VDZ A;  1RRB A;  2CHW A;  2KWU B;  4JIO U;  2YVC A;  4G11 A;  3RT3 B;  3SDL C;  2DZJ A;  2LJ5 A;  4W9F A;  4WWP A;  2CKH B;  2N9E B;  2LGX A;  4HCN B;  4LJO B;  3WAP A;  5G2N A;  2XBB C;  5C23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...