5AZHA

Crystal structure of lgg-2 fused with an eeeweel peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
127
structure length
127
Chain Sequence
EEWEELGSGIVPSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords EEEWEEL peptide,Protein lgg-2
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
doi rcsb
source organism Synthetic construct
total genus 33
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5azhA00
2IO3B 2XK5A 5AEKB 4ZRIA 2IYDB 1WJ4A 3UGBB 2HTHA 2RGFA 4TKNA 2ZPYA 3GZNI 1UELA 2LXAA 1E7UA 3P2BA 3CSTA 2LXCA 4KSKC 4GB9A 5KHOA 1M94A 1OGWA 2B3AA 2MA9B 3ZDTA 2FCQA 2M4NA 4W9JA 3APFA 3ZRCA 1I42A 1P3QU 3EECA 4FHKA 1RLFA 3BY4B 4AOFA 1C3TA 1ZW7A 4HPMB 1E8XA 2C7HA 2DZKA 2MSED 4WJQA 1V80A 2MBBB 3L08A 3X23A 4BKSD 4HLEA 4HWIB 4DHZB 1WJUA 1ISNA 2ZCCA 4G11A 3EHVA 2LGYA 4WQOB 3SDLC 4DWFA 2JT4B 5EDSA 3JW0X 3VH4B 2V4LA 4MELA 4IM2A 3HIZA 3MTNB 5JHBA 2CHWA 1WXVA 1C1YB 2JY6A 1MG8A 4X57B 5AZFA 1XT9B 3HHMA 4HCPB 2LGDA 4GDLB 1WE7A 2Y5BB 2AL6A 3QK0A 3OAWA 2D10A 2R2OA 2KC1A 2KOXA 2MBEA 3ZVVA 3JYUA 1EO6A 1UGMA 1YD8U 2KLCA 2MBQA 4XC2A 3IG3A 3QC8B 3QIJA 3VAWA 1P1AA 2V1YA 4IM0A 2J0KA 5CTRC 3WAPA 4EEWA 3R3MA 4W9GA 1XQQA 1WXSA 2WWZA 1CMXB 4F1SA 2ZNVC 4W9EA 2FCMA 3V6EB 2ZEQA 4M0WB 3ZNHB 4GDLA 4RM9A 4B6WA 4NJ7A 1E8YA 2LD9A 2N9PC 3R66C 1J0GA 5DPRA 4KDIC 3UIOB 4GDKA 2NR2A 2MQJA 3RUIB 3VTVA 1Q5WB 5J2RA 1E5WA 2KFKA 1JRUA 2N1VA 3BINA 2DYMA 2G4SA 1GG3A 3DBLI 2NVUI 2O6VD 4MGZE 2ZPNA 5C23A 3ZNZB 3ZRFA 4A20A 3UIPB 3TBLD 3KUDB 2G3QB 1H8CA 4URKA 3TCAA 3VHTC 2BF8B 1UD7A 4EZLA 2FAZA 1WI0A 2NBWB 1WIAA 1SIFA 3HK0A 1X1MA 4I6PA 4HDQA 5E6NA 2WYQA 4II3B 3WIMA 3DVGX 4WWPA 1V81A 2CR5A 3TL5A 2GMIC 1T0YA 1WX7A 4NPNA 1WM2A 4ZYNA 1WX9A 4W9KA 2N9EB 3RCZA 2M8SA 2KVRA 5D7GA 3A4RA 4E74A 3ZNID 5CX3A 2LWPA 4DHZE 4IWQA 3V61A 1WXMA 3ZW3A 1IPGA 2KMAA 2KQSA 4K81A 3AXCA 1UBQA 3H1UA 1VCBA 2MRPA 3RZFA 1K8RB 5G2NA 1E8ZA 5D6JB 3L16A 3H9DA 4DDID 2IBIB 1E8WA 3NY5A 3PRZA 2N9XA 3AI5A 2I1KA 1F9JA 2IY0B 4GXBA 2Z0DB 1OEYJ 2KWVB 2PJHA 1GC6A 3M62B 2KKCA 2CHXA 4ZDVA 2N7EA 3NZUA 4FJZA 4G3XB 1V9JA 2HE7A 2LVQA 3A33B 2MCNB 1ZGUB 1WZ3A 1KLVA 4JIOU 5IA7A 3UF8A 2Z59B 2KJ6A 1EF5A 3U7DA 4CYEA 5JH5C 2PE9A 2XK5B 4EKUA 3PGEA 3MJWA 4EFOA 2HJ8A 3QWZB 2C7NB 5BO4B 5TR5A 3VFKA 3OLMD 1V49A 2JF5A 1V2YA 3B1LX 1Z5SB 2L3ZA 3JSVB 2GBMA 3PVLA 1YIWA 3HM3A 3T9LA 3T8MA 2JRHA 5G55A 3M3JA 2LASA 2OOBB 4P7IA 4PYUA 4M8NA 4FULA 1WXAA 2JUOA 2KNBA 2K8BA 4LDTB 3B08A 4WJNA 2L00B 2C5LC 4A3PA 4JQWC 4HVBA 4II2B 3ZKJC 2GBRA 4M8MA 4GSWA 4FJVB 4ANWA 1IP9A 1SE9A 1BT0A 1WX8A 3VUWA 2DYBA 3DBRI 4BOSC 3JSVA 4FHJA 3SHQA 3APCA 2GBNA 2L7RA 1E7VA 1UZXB 2K6QA 4IG7B 3UINB 4B9KA 3H7SA 4IM3A 2UYZB 3RT3B 1E90A 3QX1A 4IUMB 2MWSB 2L0TA 2FCNA 4XX5A 3CMMB 4RMAA 4TQ1A 3ZIMA 2CHZA 2K1FA 4MGKE 2MBOA 2FUHB 4LJPB 3TIXA 2IO0B 1PQSA 3UQAA 2WDTB 3WAMA 3NS8A 2REXA 3N3KB 1WZ0A 1D3ZA 2J0JA 1FXTB 1V5OA 2MLBA 2OJRA 2KDEB 3ZNGC 3ZDMC 4ICVA 1WE6A 3CSFA 3I3TB 3M95A 3B0AA 4XZ4A 1KJTA 2BYEA 2ZVNA 2D07B 2DHZA 2KTFA 5D2MB 3QCAA 3PS6A 4TQ0A 1RRBA 1WGGA 3M63B 3ML9A 4ICUA 4W9DA 5DPTA 4A3OA 3KH0A 4AJYB 2XBBC 1WGHA 1WR6E 4EOYA 3DQVA 2HD5B 2KXJA 3PZDA 2JWZA 4GDKB 4TUUA 5J18A 2RD0A 4MJSA 3GOEA 5AZGA 4ASWC 2IY1B 2DZIA 2KFKB 2N4FA 1P98A 4MM3A 3DVNU 5LXIB 2KK8A 2L0FA 4KV2A 3A1QB 1V86A 2KX3A 1SGHA 1UBIA 4DHJB 2EKEC 3PRMB 4KIKA 3V6CB 4CHKA 2MP2B 5JZEB 2KO3A 3L13A 2QHOA 4MSMB 3AU4A 2KZRA 2AL3A 4DXAB 1WJNA 1WMHA 4KSLC 5C1ZA 2KC2A 1WGDA 2DYOA 3Q3FA 3JVZX 2DENB 3VXWA 3A1QA 4NJ6A 5FR6A 2JZ3B 3CF6E 2MP2A 1LM8B 4LJOB 4FADA 2KQ7A 4BBNC 3A9JA 1EUVB 3KYDD 2WX0A 3VH3B 4I6NB 4BKSA 5L95C 1WGRA 2DX5B 2PE6B 2R2QA 2LI5A 2KANA 1WFYA 1I35A 3WAOA 1V5TA 4EZKA 2KD0A 3EC8A 2KDBA 2J0MA 4GMVA 2BWFA 2LGXA 2Z0EB 1R4NI 1WGYA 2AYOB 3PREA 4NQKE 4BOZB 4FLHA 3SU8X 4ANVA 1KM7A 1P9DU 4IC7B 3U8ZA 1LXDA 2BKRB 2YVCA 3PLUA 2LVPA 2NBUA 2C60A 2JVCA 3KVFB 3A9KA 4KZCA 1GUAB 3VUXA 3PRPB 4N9F4 1LQBA 2BGFA 3H6NA 1YX6B 2ZZPB 3DDCB 3RZWC 3NOBA 1WJ6A 2M1MA 2IZVB 2IO1B 3NZSA 4HXDA 4WJOA 2BWES 2ZJDA 5L83A 4HJKA 4HPLB 4JL9A 1KOTA 4I6LB 2ZNVB 4LDTD 2L76A 3WALA 3PPAA 2FNJB 2K8HA 2G4DB 3LJ3A 1WRDB 4GOCA 2KTRA 1YQBA 2K25A 2KDFB 4HCNB 2D3GA 5LLIA 3KW5B 3ECIA 3PV1A 3QHTA 3DVNV 3N32A 4ZRJA 1QZEA 3ONSA 3VQIA 2KJHB 3QA8A 3C0RB 3EFUA 3OJ4B 2MW5A 3WANA 1J19A 4MH0E 2VRRB 2NBVB 4WJPA 3ZTCA 4BVUC 1WR1A 3VDZA 5D94A 3ZTDA 3Q3JA 3ZUNA 2G45B 1U4AA 4NAWB 3L0WB 4PS3A 2ZVOA 2NPTB 4NQLB 2BKFA 2DAFA 3OJ3A 4IWOA 1OTRB 3H7PA 2W9NA 2BPSA 4WWNA 3PLVA 3PSEB 1NDDA 4KVGB 1YX5B 5E6PA 2NCNA 3DVGY 3U30A 3IBEA 4B95A 4KDLB 4NAWA 3O65B 2M17A 2NPTA 3LDZE 3DOWA 4MJSB 4K1RB 4IWPA 3SD5A 3RD2A 4DK5A 4J6IA 3QAQA 3W1SC 2KJRA 4NNJB 2EMSA 1RFAA 1S1QB 2KWUB 3TMPB 3L54A 3MHSD 4GN1A 4MGIE 4DHJD 4DDGD 4KIKB 4BFRA 2GBKA 4YL8A 4HDOA 3V62A 3AULA 2JZZA 2N7DA 1GNUA 4JGHB 2K39A 4HK2A 5DCNA 1WMHB 2O2VB 2A4ZA 4PS7A 4OVUA 1YJ1A 2LZ6A 4K7UA 2C9WB 3HM6X 4PS8A 2JPHA 2CKHB 4CO7A 1ZKHA 2FIDA 1TTNA 5CHFA 2MX2A 1V6EA 5CHVC 1NBFC 3A9JB 1WH3A 2KDIA 5J17A 5JHAA 1GJZA 4ANUA 3K9OB 2A5UA 2LVOA 2L05A 1WYWB 2O2VA 1RAXA 2JXXA 3ZLZA 1A5RA 2L8JA 3K9PB 4MSQB 1OEYA 1XD3B 5LXHA 4W9IA 3D32A 2K6DB 2GBJA 2FCSA 3VUYA 2DAJA 4GU2A 3AU5A 3RYTA 4BBNF 2WX1A 3NHEB 1J8CA 3KYCD 4G50A 2LUEA 3VTWA 1P0RA 2DZJA 2DZMA 1Z2MA 3DCGA 3PHXB 3QARA 4FN2A 1Q1OA 1WY8A 4MGYE 4F8CB 3ENEA 2JRIB 3PHWB 4ZRKA 3S2AA 3UQBA 3VVWB 3A9KB 1GC7A 1LFDA 1AARA 3IHPC 4K7WA 2KWCA 4MEMA 3WA0A 3A4SC 4EUTA 3IVFA 2K8CA 1H4RA 1TGZB 4BKGA 2EMTA 1IYFA 2M0XA 5DPWA 3ALBA 2LJ5A 4W9FA 4AUQC 2D2QA 2KMCA 2PPHA 2V3SA 4AWJA 2AWTA 4ANXA 2CS4A 2LRUA 5IAAC 2D11A 1G6JA 1EF1A 2LRWA 1UH6A 1Q0WB 3PTFC 2KN5A 2KTRB 2XEWA 3X0WA 4G0NB 4WWOA 2KX0A 2O6VB 4FA6A 3TJPA 3R7QA 4RM8A 1L2NA 2BYVE 2PEAA 3KUCB 2CU1A 4MDKE 3DBSA 4K7SA 5KHQA 3DPDA 3V60A 4AJWA 1TBEA 2FIFA 2RPQA 3W1SA 3KUZA 4BKTA 4KZ0A 2N1WA 2BYFA 2RR9A 4OVVA 4E3CA 4PYZA 2ZCBA 3QQ8B 1WM3A 4FBJB 2J7QB 4F7ZA 4LCDE 3W1YA 4NY0A 2MBHA 2O6VA 2I1JA 2YLMA 3QJZA 2ASQA 3RULA 2UWQA 1S3SG 3N30A 3IFWB 1TZ1A 1HE8A 3L10B 2KLGA 2C7MB 4WAAA 5CHWA 1R4MI 3VTUA 3ZO5B 4EZJA 4JLCA 4GGQA 4E71A 5GMVA 2RSUA 3L17A 3H7PB 1WF9A 4DBGA 4GIVA 1VD2A 5DPSA 2AEHA 4FJYA 1L7YA 3R7RA 1OQYA 2NS5A 5HKHA 2KFJA 4W9HA 2GOWA 4IW0A 3ML8A 1Y8RC 3APDA 3DBHI 2IO2B 2KHWB 4TV3A 4AP4C 5AZHA 4W9LA 5E6OA 4W9CA 3PT2B 1NI2A
chains in the Genus database with same CATH superfamily
3AEBB 5MPOA 2DBYA 2N9KA 1YN3A 2ZPYA 1UELA 4LNOA 1E7UA 3P4PB 4KSKC 1FNVA 5KHOA 2B3AA 3ZDTA 1WXQA 2FCQA 2MEKA 3ZRCA 2YEPB 4AOFA 4RF1A 1ZW7A 2D3BA 4YTNB 3X23A 4BKSD 1JRPA 5C2TB 1TKEA 4HWIB 1WJUA 4WQOB 2LGYA 3SDLC 2JT4B 1WRIA 4J3OD 2WU5B 3KWVA 4GDLB 1FIQA 2Y5BB 2KLCA 3IG3A 3QC8B 5CTRC 3RPFC 3VRBB 4L23A 4F1SA 2ZNVC 2B76B 1NENB 1N5XA 3B2FA 2D3AA 4GDLA 2LD9A 1KRHA 1Q5WB 2KFKA 1C76A 2KT7A 2ZPNA 4A20A 1TY2A 3TBLD 2PVGC 3MJ5A 2BYTA 2G3QB 2GLSA 2IGDA 2WGSA 1UD7A 3GB1A 1WI0A 1WIAA 5E6NA 3TL5A 1T0YA 3V3XA 3N20C 2N9EB 5D7GA 3A4RA 4LK0M 4IWQA 3ZW3A 3H1UA 5G2NA 2KVZA 4YSYB 1FRRA 5IP4D 1QT9A 1XLPA 2N9XA 2I1KA 1B1ZA 4A8XC 2Z0DB 1OEYJ 3VR9B 1FXIA 2WLBA 2CHXA 4FJZA 2N9LA 1V9JA 2JQRB 2LVQA 3A33B 2MCNB 5IA7A 1EF5A 2PE9A 5H92C 4NJCA 2JF5A 1Z5SB 1GPXA 1YIWA 3T9LA 3M3JA 4C7ZA 1PGAA 1K53A 4AQ7A 4M8NA 4LDTB 2K8BA 3B08A 1I4PA 4JQWC 2DWQA 1SJED 1SE9A 1NEKB 4XDDA 2HDEA 5FKAC 2K6QA 4IG7B 2UYZB 1E90A 1Y56A 2WS3B 3N1ZC 3ZIMA 2MBOA 1D5MC 2ON8A 4WH4A 1D3ZA 4LNKA 3ZNGC 4ICVA 2VZKB 1MFWA 1QKZA 1FCCC 2DHZA 4M00A 5D2MB 3ML9A 2AQ3B 3KH0A 3DQVA 3GE3C 3GOEA 2KDMA 4ASWC 2DZIA 5C3JB 2KYWA 3EGRA 1VDVA 2L0FA 3A1QB 2M0AA 4JWSC 3PRMB 4MT5A 1UWMA 2QHOA 1YJIA 1TT5B 3MHZA 4DXAB 1WJNA 3NZ3A 2DENB 3A1QA 4NJ6A 3FILB 3CF6E 4FADA 2WX0A 3DBLB 1WGRA 1N60A 2KANA 1TY0A 1I35A 3WAOA 1V5TA 1J7CA 1HXYD 3Q8EA 2N7JA 2Z0EB 1WGYA 1OQRA 4BOZB 2LHDA 1FFVA 4ANVA 1KM7A 1QOGA 3DHHC 3U8ZA 5BMIA 1TIFA 3PLUA 2NBUA 4N59A 3A9KA 3VUXA 3ZQ4A 3RZWC 1GOZA 4HXDA 5L83A 4HKZE 2JWUA 1FPYA 1N61A 2BQQA 2ZNVB 2OEDA 3AE8B 5HHDG 3PPAA 2K8HA 4GOCA 3KW5B 1HTQA 4ZRJA 3QA8A 3BYYB 3LYYA 2MW5A 3WANA 2NBVB 3VDZA 5D94A 3ZTDA 1U4AA 2RDHA 3L0WB 2CJOA 2ZVOA 3AE3B 2LUMA 2WXHA 1OTRB 3H7PA 1K50A 5T8IA 3PSEB 2J53A 1FNUA 4YTMB 4XWWA 3LDZE 3DOWA 4IWPA 3MC0B 1JROA 3QAQA 4MM3B 2KWUB 2WXPA 2QCZA 3L54A 4GN1A 3TEWA 3TEYA 2Z8LA 3V62A 3V05A 4RGNA 2K39A 1TS2A 2J4XA 1WMHB 3AV8A 4JX1C 4ARCA 4PS7A 1YJ1A 2JPHA 4QAYA 4CO7A 1AYFA 1NBFC 3RNCC 4NZLB 5JHAA 4ANUA 4A9AA 2A5UA 4C00A 5FR3A 3AEGB 4L1BA 3AEEB 1A5RA 4MSQB 1XD3B 1SE2A 2QC8A 1MHHE 4BZAA 2WXJA 3RYTA 4LNFA 2WX1A 3NHEB 3ZJTA 2LUEA 1HTOA 1P0RA 4KGSA 4RGTA 1Z2MA 1DOYA 4F8CB 5BMHA 1WY8A 4MGYE 1VZ7A 4ZRKA 3S2AA 1ET6A 1GC7A 1XXGA 2SAKA 3IHPC 1JWMD 2KWCA 4EUTA 2K8CA 1H4RA 4M0WA 4BAXA 1MPEA 5DPWA 1T0RC 1TZOA 2NTSA 3FC4A 2MHJA 2LRUA 1Q0WB 3PTFC 4PK1A 2KN5A 4FA6A 2KX0A 3DHIC 2XN9C 1FO4A 3TJPA 3R7QA 3NJTA 4RM8A 2INDC 2PMVA 2PEAA 1TS5A 1TBEA 2FIFA 3W1SA 2N1WA 2RR9A 4E3CA 3QQ8B 2IPKD 1F2RI 3HVZA 2FE8A 2JX5A 3U7ZA 3N30A 4WAAA 4ZRQA 3ZO5B 3VTUA 1IGDA 4EZJA 4E71A 4GIVA 5DPSA 3R7RA 2NS5A 2KFJA 4W9HA 4HEA1 2NMQA 1N5WA 2QSDA 4ZRIA 1HZ5A 2LHEA 2HTHA 3GZNI 2LXAA 3P2BA 5D3IB 3LB8C 2K3UA 3I5JC 1OGWA 4HPPA 4NAMA 1E8XA 2MSED 3UI3A 3L08A 4DHZB 1VRAB 4REZA 3ZXVA 1PUTA 4ZOHC 3VH4B 4IM2A 3URYA 1C1YB 5AZFA 3IAM1 4HCPB 4TMAB 1WE7A 3OAWA 2KOXA 3ZVVA 2MBQA 3VRAB 1YD8U 3P42A 3QIJA 1IGCA 3VAWA 2V1YA 2J0KA 4EEWA 3WAPA 4YTPB 1XQQA 3NUHB 4W9EA 2FCMA 2RDGA 2ZEQA 3ETRA 4NJ7A 3R66C 2N9PC 3P4SB 1P7FA 1RM6C 4KDIC 2EELA 2PLPA 2QILA 4GDKA 5J2RA 4ZRPA 1JRUA 2DYMA 1GG3A 3DBLI 2O6VD 3ZRFA 1L6UA 3AEFB 3LXFA 3ZJUA 4JE3B 1M4VA 4RCOA 1ZPSA 2FAZA 3AEAB 1SXTA 2NBWB 3BYTB 1SIFA 4I6PA 1X1MA 3DVGX 1V81A 3P63A 2GMIC 4RFBA 2RPVA 2KVRA 4E74A 1MHXA 2W54A 5CX3A 3ZNID 1C4PA 4K81A 1UBQA 2MRPA 1K8RB 1T0QC 5D6JB 3H9DA 2E3TA 5HG2A 2NTTA 1D5XC 1F9JA 4XE0A 2Y5PA 2WXFA 2X38A 4G3XB 3P1MA 2OJWA 1JCKB 4JIOU 3UF8A 2KJ6A 3U7DA 4CYEA 1STEA 1R4MB 4EKUA 3MJWA 2HJ8A 3VFKA 2C7NB 2QEJC 3B1LX 2GBMA 1WYGA 3PVLA 1NVID 5G55A 4P7IA 4PYUA 1NI3A 4FULA 2KNBA 4A3PA 2L00B 2C5LC 3ZKJC 1QLBB 4YSXB 2WXMA 1IP9A 2BS2B 1WX8A 4S0RA 3VUWA 2DYBA 3DBRI 4BOSC 2FUG1 3APCA 2L7RA 1BMLC 1TYGB 4YXDB 4B9KA 3RT3B 4IUMB 2MH7A 2BB6A 1DYQA 2IDYA 2CHZA 2K1FA 4MGKE 2WXQA 3TIXA 3UQAA 1SJHD 3BVMA 5D3DA 3WAMA 2REXA 3N3KB 5G5GA 1WZ0A 2J0JA 2MLBA 2OJRA 1I4RA 1VLBA 2BYEA 2D07B 1SE4A 2KTFA 3PS6A 4DXFA 2PW9A 3O13A 2XBBC 1WGHA 2HD5B 4US8A 2RD0A 2KFKB 1I4XA 2MJ3A 2JU6X 3DVNU 1V86A 2HTME 4DHJB 4M01A 3V6CB 5JZEB 2W55A 1VJKA 3L13A 1KH0A 4MSMB 2E6XA 1NYQA 2KC2A 2DYOA 3JVZX 5FR6A 2JYTA 2LMCA 2JZ3B 1ZP0B 1BUIC 4BBNC 3A9JA 1EUVB 4BKSA 3Q2AC 3VH3B 5L95C 2JYEA 3IT6B 4USAA 1WFYA 3DWMA 4RGOS 3VR8B 4EZKA 2KD0A 3EC8A 2KDBA 2J0MA 4GMVA 5EE0A 2LGXA 1D4BA 4FLHA 3SU8X 2YVCA 3HVDA 2LVPA 2C60A 4PT5A 4KZCA 4N9F4 1LQBA 1R4NB 1ZDXA 2ZZPB 1XCTL 1E6EB 3BZDB 2IO1B 4M02A 4WJOA 1FM0D 4HPLB 1PYWD 4LDTD 2FNJB 3I57A 3I63C 2G4DB 1WWTA 2K25A 3FAHA 4HCNB 2D3GA 4XDCA 3ECIA 3PV1A 2K5PA 3QHTA 3DVNV 3N32A 1YJJA 1J7BA 5TSSA 1F0ZA 2BVCA 1J19A 3ZTCA 3GP7A 3RI7C 2DAFA 2VZKD 5EE9A 5EE1A 3PLVA 4KVGB 3U30A 4C7YA 3DVGY 2V0GA 1JWAD 4K1RB 4ITKA 3C8YA 3RMKC 4DK5A 1K51A 3W1SC 4NNJB 2EMSA 1MG4A 1S1QB 1TKYA 3R2TA 2BT6A 4HROA 1R7SA 2I38A 2QJLA 4BFRA 4HDOA 2ZW0A 2JZZA 3Q6BA 4HK2A 4KGTA 3L4PA 4ARIA 1BXTA 2A4ZA 2D3CA 3KWLA 4OVUA 2LZ6A 2C9WB 2WXKA 1ZKHA 1TTNA 2BB5A 3U4EG 1WH3A 2KDIA 3EFCA 1NYRA 1GJZA 3K9OB 2LVOA 1J7AA 2L05A 3AE2B 1RAXA 2JXXA 3BK2A 1L4DB 4IOIE 5LXHA 3H8HA 2K6DB 2GB1A 3AU5A 3AMZA 4A90A 3KYCD 4G50A 2DZJA 4FN2A 1C79A 3UQBA 2WXGA 3A9KB 1LFDA 4K7WA 4MEMA 3WA0A 1RFKA 1EU4A 3EUB2 1T5XD 1FNWA 3DWGC 2EMTA 2AQ2B 5BYRA 2D2QA 2PPHA 3HUIA 4ANXA 2CS4A 1EU3A 5IAAC 1EF1A 1ZUD2 4G0NB 3SR6A 4WWMA 2BYVE 2CU1A 2BYFA 1HQRD 2ZCBA 4FBJB 2J7QB 4F7ZA 4NY0A 2YLMA 3QJZA 2VH2A 4N58A 5IKCM 2LFIA 3IFWB 1HE8A 1TZ1A 4XYCA 1R4MI 1QF6A 3WCQA 4JLCA 2INCC 5GMVA 2RSUA 1IBXB 3H7PB 1WF9A 4DBGA 1L7YA 1C4CA 2V4IB 2ACZB 2LJIA 1TS3A 2GOWA 3AB5A 3APDA 2KHWB 4TV3A 2V9HA 2WNMA 1YQ3B 5AZHA 1IBXA 1JWSD 1Q10A 1V1OA 2M56B 3E9SA 1FMAD 2XK5A 3IAS1 5HI1A 4ZHOA 3KLSX 2RGFA 4RGMA 2LXCA 4OHJA 1TKGA 4GB9A 3SEBA 2MA9B 4W9JA 3APFA 1I42A 4FHKA 3BY4B 1C3TA 2C7HA 1V80A 2MBBB 3AE9B 2IGGA 1ISNA 4G11A 3EHVA 4DWFA 3R2IA 3JW0X 4K3CA 5JHBA 1WXVA 1PGBA 2JY6A 1MG8A 1XT9B 3HHMA 2WXOA 4KKIA 3W2DA 2AL6A 1FEHA 1SEBD 3U52E 3BVZA 2KC1A 2MBEA 1L4ZB 1C78A 2BW2A 3R3MA 1PGXA 1WXSA 2WWZA 1CMXB 3Q14C 5H8YE 3V6EB 4M0WB 3ZNHB 5AUKA 4B6WA 1E8YA 1J0GA 1XCQL 1F1HA 4WAFA 2NR2A 2MQJA 3VTVA 3BINA 4YSZB 4MGZE 5C23A 3ZNZB 3T3OA 3UIPB 1OQQA 2KWDA 2DLBA 3TCAA 2BF8B 4EZLA 3PZ7A 3HK0A 3WIMA 2WYQA 3W9CB 4NPNA 1WM2A 4YWGG 1WX9A 4W9KA 1TS4A 1JMLA 2LWPA 2KQ4X 1WXMA 1IPGA 2KQSA 1VCBA 3RZFA 1E8ZA 3Q8BA 3L16A 4DDID 2IBIB 1CJEA 4KGRA 3NY5A 3AI5A 2K0PA 4GXBA 3ABVB 2PJHA 2PIAA 4ZDVA 2N7EA 4LTUA 2J42A 2HE7A 4TSSA 1ZGUB 2SEBD 4EFOA 3QWZB 5BO4B 3RNFC 5TR5A 1V49A 1V2YA 1WGKA 3BWUD 3HM3A 4WURA 3T8MA 2M19A 2LASA 1SBBB 2HJ1A 2OOBB 1K52A 1WXAA 2JUOA 3DBHB 4WJNA 2L32A 4HVBA 3N1XC 4D2KA 2GBRA 4FJVB 5AUIA 4FHJA 2GBNA 1UZXB 4A6QA 3UINB 4IM3A 3QX1A 1IUEA 2MWSB 2L0TA 3E56A 4RMAA 3N1YC 4TQ1A 3Q3OC 4LJPB 2FUHB 1T0SC 2WDTB 1E10A 3NS8A 2G9HD 3NVVA 1FXTB 3ZDMC 3I3TB 3CSFA 3M95A 2INPE 1LO5D 3QCAA 4TQ0A 3N9YC 3M63B 2JXTA 5DPTA 4A3OA 5FK9C 4EOYA 4GDKB 2JWZA 4TUUA 4MJSA 5AZGA 3C19A 2MJDA 1KLGD 1L6VA 5LXIB 4KV2A 4RH6A 2KX3A 1UBIA 4DXGA 2EKEC 2CJNA 4KIKA 4CHKA 2PKOA 2KO3A 3Q8CA 1QILA 1KLUD 1JWBD 3IXSA 2AQ1B 3AU4A 2AL3A 3SFDB 5C1ZA 2QDFA 1WGDA 1V8CA 2WDQB 2KQ7A 4P1BC 4OZAA 4I6NB 2PE6B 2R2QA 2WXLA 2Q5WD 2LI5A 2BTEA 4LNIA 1FRDA 3J9CA 3AECB 1E0ZA 2BWFA 2AYOB 3PREA 3AE1B 1N63A 1ZE3D 2OHFA 1P9DU 1LXDA 2BKRB 4AS1A 2BS3B 2JVCA 4K3BA 3PRPB 3DDCB 1CQVA 2M1MA 4P1CC 4JPSA 3NZSA 2BWES 2ZJDA 4HJKA 3EA6A 3AE6B 4CQNA 4JL9A 1KOTA 3RN9C 4I6LB 3I9V1 3LJ3A 1KF6B 2KTRA 2QMTA 1YQBA 3W5UB 4C4VB 4RNAA 1V1PA 3VQIA 2KJHB 3EFUA 1ZXHA 2WDRB 4MH0E 3TEZA 2VRRB 2GRIA 4WJPA 1WR1A 2V3NA 4C4VA 1C9FA 1XO3A 3ZUNA 2G45B 4NAWB 4PS3A 2NPTB 4NQLB 3ZXRA 2BKFA 1UUPA 5E6JA 1OFFA 2W9NA 1B9RA 2BPSA 1FD6A 1NDDA 1YX5B 5E6PA 3IBEA 4WIPA 4KDLB 4NAWA 3KQ4A 2NPTA 3SD5A 3RD2A 2KMMA 2KJRA 3TMPB 3MHSD 1CK1A 4MGIE 1XEEA 4DHJD 1WSPA 2WDVB 2QIEB 3MP9A 1GNUA 4JGHB 4Q2JA 3ZGZA 1N6ZA 2D5GA 5DCNA 3ZJVA 2O2VB 4K7UA 4ZHPA 5CHFA 2MX2A 5CHVC 3A9JB 3FKYA 4L2YA 1SE3A 1WYWB 2O2VA 1KFYB 3ZLZA 2L8JA 3B2GA 3K9PB 1OEYA 3AN1A 4W9IA 1EWYC 3D32A 2DAJA 3PHXB 2KN4A 1Q1OA 3ENEA 2JRIB 2LEKA 3PHWB 4KX6B 3VVWB 1GB1A 3A4SC 1L5PA 1YN5A 3IVFA 1TGZB 2R61A 4HKQA 1IYFA 1UNSA 1ESFA 2WU2B 1JWUD 3ALBA 2LJ5A 1XLOA 2V3SA 1V97A 2AWTA 2D11A 4HJGE 2LRWA 2XEWA 4WWOA 5BYSA 4EE2A 2CU3A 1E9MA 3KUCB 3AE4B 4FXCA 3DPDA 3V60A 4AJWA 1AN8A 2RPQA 4BKTA 3KUZA 2KACA 4OW0A 4B0EA 1WM3A 4LCDE 1I7HA 2MBHA 4YT0B 2I1JA 3RULA 4P16A 4GGQA 4LNNA 3L17A 2TSSA 4A55A 1VD2A 4C80A 3MC9A 5HFYA 3RNGC 4ZYSA 1RYJA 3AEDB 2BBCA 4IW0A 1Y8RC 3DBHI 1SIJA 4AP4C 4W9CA 1SB3C 1SSNA 2IO3B 5AEKB 3DHGC 2IYDB 1WJ4A 3UGBB 4TKNA 1FFUA 2INNE 3CSTA 4WQMA 5BYQA 1E7PB 1M94A 1QOFA 2M4NA 1QOBA 1P3QU 3EECA 1CZPA 1RLFA 3GZNB 2V3PA 4HPMB 2DZKA 2ONQA 4WJQA 4HLEA 3TEXA 1MI0A 2ZCCA 2WXIA 3BIID 5EDSA 5EE3A 2RDBC 3CIRB 2V4LA 4MELA 3HIZA 3MTNB 5BMGA 2CHWA 1ZOYB 4X57B 2LGDA 3QK0A 2D10A 2PTLA 2R2OA 3JYUA 1EO6A 1UGMA 4XC2A 1T6BX 1P1AA 4IM0A 1JQ4A 3B9JA 4W9GA 2L83A 1P7EA 2JSVX 4US9A 5IO9A 1C4AA 4RM9A 3NVYA 1F52A 5DPRA 4LLGM 3UIOB 3SFEB 3PO0A 3RUIB 1E5WA 2N1VA 4N6EB 2G4SA 4OZCA 3RNBC 3NVWA 3T3NA 2NVUI 2IGHA 3KUDB 2LGIA 4S17A 4B0MA 1I4HA 1PFDA 1T3QA 4URKA 3NVZA 3VHTC 1YNTE 1H8CA 4H2AA 2H89B 4HDQA 1D6EC 4II3B 4WWPA 2CR5A 1WX7A 4ZYNA 1DOIA 2L52A 2W3SA 3RCZA 2YEPF 2M8SA 3FILA 1SF0A 4DHZE 3V61A 1ENFA 2WXNA 2KMAA 3AXCA 2ICIA 2FBWB 2JZPA 4P6VF 1E8WA 1HEZE 3PRZA 1MJDA 2IY0B 1ZDVA 2KWVB 1GC6A 3M62B 2KKCA 4HRSA 2L1AA 3NZUA 3U2SC 4MH8A 1WZ3A 1KLVA 2Z59B 5JH5C 2XK5B 3PGEA 2AX5A 3OLMD 5JXVA 3AE7B 2K22A 3TSSA 2L3ZA 3JSVB 3Q3NC 2JRHA 1TJEA 1HA5A 3W5VB 5LNK1 4II2B 4M8MA 3MFGA 4GSWA 4ANWA 1BT0A 3JSVA 4OZBA 3SHQA 1E7VA 2WXRA 4O1NA 1F77A 3H7SA 5I4DA 2W3RA 2FCNA 4XX5A 3DBRB 3CMMB 1N62A 1UGJA 2IO0B 1PQSA 1VR9A 2UU7A 1AWDA 3NS1A 3Q3MC 3ZYYX 1V5OA 1UF0A 2KDEB 4OVZA 1WE6A 1C77A 3B0AA 4XZ4A 1KJTA 2ZVNA 1I4QA 3AE5B 4DQOC 1RRBA 1WGGA 4ICUA 4W9DA 1XF5L 4AJYB 1WR6E 5J18A 2KXJA 3PZDA 2IY1B 2N4FA 1P98A 4MM3A 2KK8A 1SGHA 2MP2B 2WQYB 1I4GA 2KZRA 3AM9A 3R8BA 5GXGB 1WMHA 4KSLC 1FCLA 3OWEB 2GI9A 1FXAA 3Q3FA 3VXWA 4LJOB 2MP2A 1LM8B 3KYDD 1XLQA 2PVOD 2DX5B 3BVGA 3OG5A 3BK1A 1ROEA 4NQKE 1R4NI 5IN7A 4IC7B 5IOIA 3KVFB 1GUAB 2BGFA 3H6NA 1YX6B 2ZW1A 3NOBA 1ET9A 3Q69A 1WJ6A 1AW7A 2IZVB 2DNFA 2W82A 2L76A 3WALA 1EM7A 1WRDB 1UWXA 1YQ4B 4UDUC 2KDFB 4ACFA 2LGSA 5LLIA 5G5HA 2VH1A 1QZEA 3ONSA 3C0RB 2XNAC 4MACA 3OJ4B 3RNAC 3Q8AA 4KKJA 4BVUC 3HRDD 3Q3JA 2I2YA 2RMMA 1VZ8A 1RWSA 3OJ3A 4IWOA 1YOVB 3RNEC 4WWNA 1D5ZC 2Y5CA 2NCNA 4B95A 2J52A 3O65B 2M17A 1JALA 4MJSB 1L0VB 1KTKA 1JW9D 4R3DA 1L0XB 4J6IA 1RFAA 4IDIA 4DDGD 4KIKB 2GBKA 4YL8A 1PDXA 3AULA 1QOAA 2N7DA 1HZ6A 3MC8A 4PS8A 3HM6X 2H88B 2CKHB 4JWUC 2FIDA 2N0SB 1V6EA 1YMHE 4C56C 5J17A 2BS4B 3GE8C 2EKIA 2X8XX 1F2RC 2GBJA 2FCSA 3VUYA 1DGJA 4GU2A 4BBNF 1J8CA 3GS2A 3VTWA 2DZMA 2IJ0A 3DCGA 1L0YB 3QARA 3RFZB 1ACCA 1AARA 3P4QB 1EWCA 4BKGA 2M0XA 2KAJA 4W9FA 2G1EA 4GLSC 4AUQC 4AWJA 2KMCA 3P4RB 3NRZA 1G6JA 1UH6A 1VZ6A 1A70A 1YN4A 2KTRB 3X0WA 2MJEA 2O6VB 1L2NA 1GB4A 4MDKE 5KHQA 3DBSA 4K7SA 4IKGA 4XGAB 1QQRA 1V1PB 4KZ0A 4OVVA 4PYZA 3Q8FA 1LGRA 3AH7A 3W1YA 2K9XA 3CWIA 2O6VA 3PZ8A 1DOXA 2ASQA 2UWQA 1S3SG 1XLNA 3L10B 2KLGA 2C7MB 5CHWA 3NG0A 4XWTA 2WP9B 2WHIA 2AEHA 4FJYA 4RF0A 1MVKA 1OQYA 5HKHA 1ZXIA 1GAQB 3ML8A 2Y3AA 3IT4B 2IO2B 4W9LA 3TUOA 5E6OA 3PT2B 1NI2A
chains in the Genus database with same CATH topology
2IO3B 2XK5A 5AEKB 4ZRIA 2IYDB 1WJ4A 3UGBB 2HTHA 2RGFA 4TKNA 2ZPYA 3GZNI 1UELA 2LXAA 1E7UA 3P2BA 3CSTA 2LXCA 4KSKC 4GB9A 5KHOA 1M94A 1OGWA 2B3AA 2MA9B 3ZDTA 2FCQA 2M4NA 4W9JA 3APFA 3ZRCA 1I42A 1P3QU 3EECA 4FHKA 1RLFA 3BY4B 4AOFA 1C3TA 1ZW7A 4HPMB 1E8XA 2C7HA 2DZKA 2MSED 4WJQA 1V80A 2MBBB 3L08A 3X23A 4BKSD 4HLEA 4HWIB 4DHZB 1WJUA 1ISNA 2ZCCA 4G11A 3EHVA 2LGYA 4WQOB 3SDLC 4DWFA 2JT4B 5EDSA 3JW0X 3VH4B 2V4LA 4MELA 4IM2A 3HIZA 3MTNB 5JHBA 2CHWA 1WXVA 1C1YB 2JY6A 1MG8A 4X57B 5AZFA 1XT9B 3HHMA 4HCPB 2LGDA 4GDLB 1WE7A 2Y5BB 2AL6A 3QK0A 3OAWA 2D10A 2R2OA 2KC1A 2KOXA 2MBEA 3ZVVA 3JYUA 1EO6A 1UGMA 1YD8U 2KLCA 2MBQA 4XC2A 3IG3A 3QC8B 3QIJA 3VAWA 1P1AA 2V1YA 4IM0A 2J0KA 5CTRC 3WAPA 4EEWA 3R3MA 4W9GA 1XQQA 1WXSA 2WWZA 1CMXB 4F1SA 2ZNVC 4W9EA 2FCMA 3V6EB 2ZEQA 4M0WB 3ZNHB 4GDLA 4RM9A 4B6WA 4NJ7A 1E8YA 2LD9A 2N9PC 3R66C 1J0GA 5DPRA 4KDIC 3UIOB 4GDKA 2NR2A 2MQJA 3RUIB 3VTVA 1Q5WB 5J2RA 1E5WA 2KFKA 1JRUA 2N1VA 3BINA 2DYMA 2G4SA 1GG3A 3DBLI 2NVUI 2O6VD 4MGZE 2ZPNA 5C23A 3ZNZB 3ZRFA 4A20A 3UIPB 3TBLD 3KUDB 2G3QB 1H8CA 4URKA 3TCAA 3VHTC 2BF8B 1UD7A 4EZLA 2FAZA 1WI0A 2NBWB 1WIAA 1SIFA 3HK0A 1X1MA 4I6PA 4HDQA 5E6NA 2WYQA 4II3B 3WIMA 3DVGX 4WWPA 1V81A 2CR5A 3TL5A 2GMIC 1T0YA 1WX7A 4NPNA 1WM2A 4ZYNA 1WX9A 4W9KA 2N9EB 3RCZA 2M8SA 2KVRA 5D7GA 3A4RA 4E74A 3ZNID 5CX3A 2LWPA 4DHZE 4IWQA 3V61A 1WXMA 3ZW3A 1IPGA 2KMAA 2KQSA 4K81A 3AXCA 1UBQA 3H1UA 1VCBA 2MRPA 3RZFA 1K8RB 5G2NA 1E8ZA 5D6JB 3L16A 3H9DA 4DDID 2IBIB 1E8WA 3NY5A 3PRZA 2N9XA 3AI5A 2I1KA 1F9JA 2IY0B 4GXBA 2Z0DB 1OEYJ 2KWVB 2PJHA 1GC6A 3M62B 2KKCA 2CHXA 4ZDVA 2N7EA 3NZUA 4FJZA 4G3XB 1V9JA 2HE7A 2LVQA 3A33B 2MCNB 1ZGUB 1WZ3A 1KLVA 4JIOU 5IA7A 3UF8A 2Z59B 2KJ6A 1EF5A 3U7DA 4CYEA 5JH5C 2PE9A 2XK5B 4EKUA 3PGEA 3MJWA 4EFOA 2HJ8A 3QWZB 2C7NB 5BO4B 5TR5A 3VFKA 3OLMD 1V49A 2JF5A 1V2YA 3B1LX 1Z5SB 2L3ZA 3JSVB 2GBMA 3PVLA 1YIWA 3HM3A 3T9LA 3T8MA 2JRHA 5G55A 3M3JA 2LASA 2OOBB 4P7IA 4PYUA 4M8NA 4FULA 1WXAA 2JUOA 2KNBA 2K8BA 4LDTB 3B08A 4WJNA 2L00B 2C5LC 4A3PA 4JQWC 4HVBA 4II2B 3ZKJC 2GBRA 4M8MA 4GSWA 4FJVB 4ANWA 1IP9A 1SE9A 1BT0A 1WX8A 3VUWA 2DYBA 3DBRI 4BOSC 3JSVA 4FHJA 3SHQA 3APCA 2GBNA 2L7RA 1E7VA 1UZXB 2K6QA 4IG7B 3UINB 4B9KA 3H7SA 4IM3A 2UYZB 3RT3B 1E90A 3QX1A 4IUMB 2MWSB 2L0TA 2FCNA 4XX5A 3CMMB 4RMAA 4TQ1A 3ZIMA 2CHZA 2K1FA 4MGKE 2MBOA 2FUHB 4LJPB 3TIXA 2IO0B 1PQSA 3UQAA 2WDTB 3WAMA 3NS8A 2REXA 3N3KB 1WZ0A 1D3ZA 2J0JA 1FXTB 1V5OA 2MLBA 2OJRA 2KDEB 3ZNGC 3ZDMC 4ICVA 1WE6A 3CSFA 3I3TB 3M95A 3B0AA 4XZ4A 1KJTA 2BYEA 2ZVNA 2D07B 2DHZA 2KTFA 5D2MB 3QCAA 3PS6A 4TQ0A 1RRBA 1WGGA 3M63B 3ML9A 4ICUA 4W9DA 5DPTA 4A3OA 3KH0A 4AJYB 2XBBC 1WGHA 1WR6E 4EOYA 3DQVA 2HD5B 2KXJA 3PZDA 2JWZA 4GDKB 4TUUA 5J18A 2RD0A 4MJSA 3GOEA 5AZGA 4ASWC 2IY1B 2DZIA 2KFKB 2N4FA 1P98A 4MM3A 3DVNU 5LXIB 2KK8A 2L0FA 4KV2A 3A1QB 1V86A 2KX3A 1SGHA 1UBIA 4DHJB 2EKEC 3PRMB 4KIKA 3V6CB 4CHKA 2MP2B 5JZEB 2KO3A 3L13A 2QHOA 4MSMB 3AU4A 2KZRA 2AL3A 4DXAB 1WJNA 1WMHA 4KSLC 5C1ZA 2KC2A 1WGDA 2DYOA 3Q3FA 3JVZX 2DENB 3VXWA 3A1QA 4NJ6A 5FR6A 2JZ3B 3CF6E 2MP2A 1LM8B 4LJOB 4FADA 2KQ7A 4BBNC 3A9JA 1EUVB 3KYDD 2WX0A 3VH3B 4I6NB 4BKSA 5L95C 1WGRA 2DX5B 2PE6B 2R2QA 2LI5A 2KANA 1WFYA 1I35A 3WAOA 1V5TA 4EZKA 2KD0A 3EC8A 2KDBA 2J0MA 4GMVA 2BWFA 2LGXA 2Z0EB 1R4NI 1WGYA 2AYOB 3PREA 4NQKE 4BOZB 4FLHA 3SU8X 4ANVA 1KM7A 1P9DU 4IC7B 3U8ZA 1LXDA 2BKRB 2YVCA 3PLUA 2LVPA 2NBUA 2C60A 2JVCA 3KVFB 3A9KA 4KZCA 1GUAB 3VUXA 3PRPB 4N9F4 1LQBA 2BGFA 3H6NA 1YX6B 2ZZPB 3DDCB 3RZWC 3NOBA 1WJ6A 2M1MA 2IZVB 2IO1B 3NZSA 4HXDA 4WJOA 2BWES 2ZJDA 5L83A 4HJKA 4HPLB 4JL9A 1KOTA 4I6LB 2ZNVB 4LDTD 2L76A 3WALA 3PPAA 2FNJB 2K8HA 2G4DB 3LJ3A 1WRDB 4GOCA 2KTRA 1YQBA 2K25A 2KDFB 4HCNB 2D3GA 5LLIA 3KW5B 3ECIA 3PV1A 3QHTA 3DVNV 3N32A 4ZRJA 1QZEA 3ONSA 3VQIA 2KJHB 3QA8A 3C0RB 3EFUA 3OJ4B 2MW5A 3WANA 1J19A 4MH0E 2VRRB 2NBVB 4WJPA 3ZTCA 4BVUC 1WR1A 3VDZA 5D94A 3ZTDA 3Q3JA 3ZUNA 2G45B 1U4AA 4NAWB 3L0WB 4PS3A 2ZVOA 2NPTB 4NQLB 2BKFA 2DAFA 3OJ3A 4IWOA 1OTRB 3H7PA 2W9NA 2BPSA 4WWNA 3PLVA 3PSEB 1NDDA 4KVGB 1YX5B 5E6PA 2NCNA 3DVGY 3U30A 3IBEA 4B95A 4KDLB 4NAWA 3O65B 2M17A 2NPTA 3LDZE 3DOWA 4MJSB 4K1RB 4IWPA 3SD5A 3RD2A 4DK5A 4J6IA 3QAQA 3W1SC 2KJRA 4NNJB 2EMSA 1RFAA 1S1QB 2KWUB 3TMPB 3L54A 3MHSD 4GN1A 4MGIE 4DHJD 4DDGD 4KIKB 4BFRA 2GBKA 4YL8A 4HDOA 3V62A 3AULA 2JZZA 2N7DA 1GNUA 4JGHB 2K39A 4HK2A 5DCNA 1WMHB 2O2VB 2A4ZA 4PS7A 4OVUA 1YJ1A 2LZ6A 4K7UA 2C9WB 3HM6X 4PS8A 2JPHA 2CKHB 4CO7A 1ZKHA 2FIDA 1TTNA 5CHFA 2MX2A 1V6EA 5CHVC 1NBFC 3A9JB 1WH3A 2KDIA 5J17A 5JHAA 1GJZA 4ANUA 3K9OB 2A5UA 2LVOA 2L05A 1WYWB 2O2VA 1RAXA 2JXXA 3ZLZA 1A5RA 2L8JA 3K9PB 4MSQB 1OEYA 1XD3B 5LXHA 4W9IA 3D32A 2K6DB 2GBJA 2FCSA 3VUYA 2DAJA 4GU2A 3AU5A 3RYTA 4BBNF 2WX1A 3NHEB 1J8CA 3KYCD 4G50A 2LUEA 3VTWA 1P0RA 2DZJA 2DZMA 1Z2MA 3DCGA 3PHXB 3QARA 4FN2A 1Q1OA 1WY8A 4MGYE 4F8CB 3ENEA 2JRIB 3PHWB 4ZRKA 3S2AA 3UQBA 3VVWB 3A9KB 1GC7A 1LFDA 1AARA 3IHPC 4K7WA 2KWCA 4MEMA 3WA0A 3A4SC 4EUTA 3IVFA 2K8CA 1H4RA 1TGZB 4BKGA 2EMTA 1IYFA 2M0XA 5DPWA 3ALBA 2LJ5A 4W9FA 4AUQC 2D2QA 2KMCA 2PPHA 2V3SA 4AWJA 2AWTA 4ANXA 2CS4A 2LRUA 5IAAC 2D11A 1G6JA 1EF1A 2LRWA 1UH6A 1Q0WB 3PTFC 2KN5A 2KTRB 2XEWA 3X0WA 4G0NB 4WWOA 2KX0A 2O6VB 4FA6A 3TJPA 3R7QA 4RM8A 1L2NA 2BYVE 2PEAA 3KUCB 2CU1A 4MDKE 3DBSA 4K7SA 5KHQA 3DPDA 3V60A 4AJWA 1TBEA 2FIFA 2RPQA 3W1SA 3KUZA 4BKTA 4KZ0A 2N1WA 2BYFA 2RR9A 4OVVA 4E3CA 4PYZA 2ZCBA 3QQ8B 1WM3A 4FBJB 2J7QB 4F7ZA 4LCDE 3W1YA 4NY0A 2MBHA 2O6VA 2I1JA 2YLMA 3QJZA 2ASQA 3RULA 2UWQA 1S3SG 3N30A 3IFWB 1TZ1A 1HE8A 3L10B 2KLGA 2C7MB 4WAAA 5CHWA 1R4MI 3VTUA 3ZO5B 4EZJA 4JLCA 4GGQA 4E71A 5GMVA 2RSUA 3L17A 3H7PB 1WF9A 4DBGA 4GIVA 1VD2A 5DPSA 2AEHA 4FJYA 1L7YA 3R7RA 1OQYA 2NS5A 5HKHA 2KFJA 4W9HA 2GOWA 4IW0A 3ML8A 1Y8RC 3APDA 3DBHI 2IO2B 2KHWB 4TV3A 4AP4C 5AZHA 4W9LA 5E6OA 4W9CA 3PT2B 1NI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO3 B;  2XK5 A;  5AEK B;  4ZRI A;  2IYD B;  1WJ4 A;  3UGB B;  2HTH A;  2RGF A;  4TKN A;  2ZPY A;  3GZN I;  1UEL A;  2LXA A;  1E7U A;  3P2B A;  3CST A;  2LXC A;  4KSK C;  4GB9 A;  5KHO A;  1M94 A;  1OGW A;  2B3A A;  2MA9 B;  3ZDT A;  2FCQ A;  2M4N A;  4W9J A;  3APF A;  3ZRC A;  1I42 A;  1P3Q U;  3EEC A;  4FHK A;  1RLF A;  3BY4 B;  4AOF A;  1C3T A;  1ZW7 A;  4HPM B;  1E8X A;  2C7H A;  2DZK A;  2MSE D;  4WJQ A;  1V80 A;  2MBB B;  3L08 A;  3X23 A;  4BKS D;  4HLE A;  4HWI B;  4DHZ B;  1WJU A;  1ISN A;  2ZCC A;  4G11 A;  3EHV A;  2LGY A;  4WQO B;  3SDL C;  4DWF A;  2JT4 B;  5EDS A;  3JW0 X;  3VH4 B;  2V4L A;  4MEL A;  4IM2 A;  3HIZ A;  3MTN B;  5JHB A;  2CHW A;  1WXV A;  1C1Y B;  2JY6 A;  1MG8 A;  4X57 B;  5AZF A;  1XT9 B;  3HHM A;  4HCP B;  2LGD A;  4GDL B;  1WE7 A;  2Y5B B;  2AL6 A;  3QK0 A;  3OAW A;  2D10 A;  2R2O A;  2KC1 A;  2KOX A;  2MBE A;  3ZVV A;  3JYU A;  1EO6 A;  1UGM A;  1YD8 U;  2KLC A;  2MBQ A;  4XC2 A;  3IG3 A;  3QC8 B;  3QIJ A;  3VAW A;  1P1A A;  2V1Y A;  4IM0 A;  2J0K A;  5CTR C;  3WAP A;  4EEW A;  3R3M A;  4W9G A;  1XQQ A;  1WXS A;  2WWZ A;  1CMX B;  4F1S A;  2ZNV C;  4W9E A;  2FCM A;  3V6E B;  2ZEQ A;  4M0W B;  3ZNH B;  4GDL A;  4RM9 A;  4B6W A;  4NJ7 A;  1E8Y A;  2LD9 A;  2N9P C;  3R66 C;  1J0G A;  5DPR A;  4KDI C;  3UIO B;  4GDK A;  2NR2 A;  2MQJ A;  3RUI B;  3VTV A;  1Q5W B;  5J2R A;  1E5W A;  2KFK A;  1JRU A;  2N1V A;  3BIN A;  2DYM A;  2G4S A;  1GG3 A;  3DBL I;  2NVU I;  2O6V D;  4MGZ E;  2ZPN A;  5C23 A;  3ZNZ B;  3ZRF A;  4A20 A;  3UIP B;  3TBL D;  3KUD B;  2G3Q B;  1H8C A;  4URK A;  3TCA A;  3VHT C;  2BF8 B;  1UD7 A;  4EZL A;  2FAZ A;  1WI0 A;  2NBW B;  1WIA A;  1SIF A;  3HK0 A;  1X1M A;  4I6P A;  4HDQ A;  5E6N A;  2WYQ A;  4II3 B;  3WIM A;  3DVG X;  4WWP A;  1V81 A;  2CR5 A;  3TL5 A;  2GMI C;  1T0Y A;  1WX7 A;  4NPN A;  1WM2 A;  4ZYN A;  1WX9 A;  4W9K A;  2N9E B;  3RCZ A;  2M8S A;  2KVR A;  5D7G A;  3A4R A;  4E74 A;  3ZNI D;  5CX3 A;  2LWP A;  4DHZ E;  4IWQ A;  3V61 A;  1WXM A;  3ZW3 A;  1IPG A;  2KMA A;  2KQS A;  4K81 A;  3AXC A;  1UBQ A;  3H1U A;  1VCB A;  2MRP A;  3RZF A;  1K8R B;  5G2N A;  1E8Z A;  5D6J B;  3L16 A;  3H9D A;  4DDI D;  2IBI B;  1E8W A;  3NY5 A;  3PRZ A;  2N9X A;  3AI5 A;  2I1K A;  1F9J A;  2IY0 B;  4GXB A;  2Z0D B;  1OEY J;  2KWV B;  2PJH A;  1GC6 A;  3M62 B;  2KKC A;  2CHX A;  4ZDV A;  2N7E A;  3NZU A;  4FJZ A;  4G3X B;  1V9J A;  2HE7 A;  2LVQ A;  3A33 B;  2MCN B;  1ZGU B;  1WZ3 A;  1KLV A;  4JIO U;  5IA7 A;  3UF8 A;  2Z59 B;  2KJ6 A;  1EF5 A;  3U7D A;  4CYE A;  5JH5 C;  2PE9 A;  2XK5 B;  4EKU A;  3PGE A;  3MJW A;  4EFO A;  2HJ8 A;  3QWZ B;  2C7N B;  5BO4 B;  5TR5 A;  3VFK A;  3OLM D;  1V49 A;  2JF5 A;  1V2Y A;  3B1L X;  1Z5S B;  2L3Z A;  3JSV B;  2GBM A;  3PVL A;  1YIW A;  3HM3 A;  3T9L A;  3T8M A;  2JRH A;  5G55 A;  3M3J A;  2LAS A;  2OOB B;  4P7I A;  4PYU A;  4M8N A;  4FUL A;  1WXA A;  2JUO A;  2KNB A;  2K8B A;  4LDT B;  3B08 A;  4WJN A;  2L00 B;  2C5L C;  4A3P A;  4JQW C;  4HVB A;  4II2 B;  3ZKJ C;  2GBR A;  4M8M A;  4GSW A;  4FJV B;  4ANW A;  1IP9 A;  1SE9 A;  1BT0 A;  1WX8 A;  3VUW A;  2DYB A;  3DBR I;  4BOS C;  3JSV A;  4FHJ A;  3SHQ A;  3APC A;  2GBN A;  2L7R A;  1E7V A;  1UZX B;  2K6Q A;  4IG7 B;  3UIN B;  4B9K A;  3H7S A;  4IM3 A;  2UYZ B;  3RT3 B;  1E90 A;  3QX1 A;  4IUM B;  2MWS B;  2L0T A;  2FCN A;  4XX5 A;  3CMM B;  4RMA A;  4TQ1 A;  3ZIM A;  2CHZ A;  2K1F A;  4MGK E;  2MBO A;  2FUH B;  4LJP B;  3TIX A;  2IO0 B;  1PQS A;  3UQA A;  2WDT B;  3WAM A;  3NS8 A;  2REX A;  3N3K B;  1WZ0 A;  1D3Z A;  2J0J A;  1FXT B;  1V5O A;  2MLB A;  2OJR A;  2KDE B;  3ZNG C;  3ZDM C;  4ICV A;  1WE6 A;  3CSF A;  3I3T B;  3M95 A;  3B0A A;  4XZ4 A;  1KJT A;  2BYE A;  2ZVN A;  2D07 B;  2DHZ A;  2KTF A;  5D2M B;  3QCA A;  3PS6 A;  4TQ0 A;  1RRB A;  1WGG A;  3M63 B;  3ML9 A;  4ICU A;  4W9D A;  5DPT A;  4A3O A;  3KH0 A;  4AJY B;  2XBB C;  1WGH A;  1WR6 E;  4EOY A;  3DQV A;  2HD5 B;  2KXJ A;  3PZD A;  2JWZ A;  4GDK B;  4TUU A;  5J18 A;  2RD0 A;  4MJS A;  3GOE A;  5AZG A;  4ASW C;  2IY1 B;  2DZI A;  2KFK B;  2N4F A;  1P98 A;  4MM3 A;  3DVN U;  5LXI B;  2KK8 A;  2L0F A;  4KV2 A;  3A1Q B;  1V86 A;  2KX3 A;  1SGH A;  1UBI A;  4DHJ B;  2EKE C;  3PRM B;  4KIK A;  3V6C B;  4CHK A;  2MP2 B;  5JZE B;  2KO3 A;  3L13 A;  2QHO A;  4MSM B;  3AU4 A;  2KZR A;  2AL3 A;  4DXA B;  1WJN A;  1WMH A;  4KSL C;  5C1Z A;  2KC2 A;  1WGD A;  2DYO A;  3Q3F A;  3JVZ X;  2DEN B;  3VXW A;  3A1Q A;  4NJ6 A;  5FR6 A;  2JZ3 B;  3CF6 E;  2MP2 A;  1LM8 B;  4LJO B;  4FAD A;  2KQ7 A;  4BBN C;  3A9J A;  1EUV B;  3KYD D;  2WX0 A;  3VH3 B;  4I6N B;  4BKS A;  5L95 C;  1WGR A;  2DX5 B;  2PE6 B;  2R2Q A;  2LI5 A;  2KAN A;  1WFY A;  1I35 A;  3WAO A;  1V5T A;  4EZK A;  2KD0 A;  3EC8 A;  2KDB A;  2J0M A;  4GMV A;  2BWF A;  2LGX A;  2Z0E B;  1R4N I;  1WGY A;  2AYO B;  3PRE A;  4NQK E;  4BOZ B;  4FLH A;  3SU8 X;  4ANV A;  1KM7 A;  1P9D U;  4IC7 B;  3U8Z A;  1LXD A;  2BKR B;  2YVC A;  3PLU A;  2LVP A;  2NBU A;  2C60 A;  2JVC A;  3KVF B;  3A9K A;  4KZC A;  1GUA B;  3VUX A;  3PRP B;  4N9F 4;  1LQB A;  2BGF A;  3H6N A;  1YX6 B;  2ZZP B;  3DDC B;  3RZW C;  3NOB A;  1WJ6 A;  2M1M A;  2IZV B;  2IO1 B;  3NZS A;  4HXD A;  4WJO A;  2BWE S;  2ZJD A;  5L83 A;  4HJK A;  4HPL B;  4JL9 A;  1KOT A;  4I6L B;  2ZNV B;  4LDT D;  2L76 A;  3WAL A;  3PPA A;  2FNJ B;  2K8H A;  2G4D B;  3LJ3 A;  1WRD B;  4GOC A;  2KTR A;  1YQB A;  2K25 A;  2KDF B;  4HCN B;  2D3G A;  5LLI A;  3KW5 B;  3ECI A;  3PV1 A;  3QHT A;  3DVN V;  3N32 A;  4ZRJ A;  1QZE A;  3ONS A;  3VQI A;  2KJH B;  3QA8 A;  3C0R B;  3EFU A;  3OJ4 B;  2MW5 A;  3WAN A;  1J19 A;  4MH0 E;  2VRR B;  2NBV B;  4WJP A;  3ZTC A;  4BVU C;  1WR1 A;  3VDZ A;  5D94 A;  3ZTD A;  3Q3J A;  3ZUN A;  2G45 B;  1U4A A;  4NAW B;  3L0W B;  4PS3 A;  2ZVO A;  2NPT B;  4NQL B;  2BKF A;  2DAF A;  3OJ3 A;  4IWO A;  1OTR B;  3H7P A;  2W9N A;  2BPS A;  4WWN A;  3PLV A;  3PSE B;  1NDD A;  4KVG B;  1YX5 B;  5E6P A;  2NCN A;  3DVG Y;  3U30 A;  3IBE A;  4B95 A;  4KDL B;  4NAW A;  3O65 B;  2M17 A;  2NPT A;  3LDZ E;  3DOW A;  4MJS B;  4K1R B;  4IWP A;  3SD5 A;  3RD2 A;  4DK5 A;  4J6I A;  3QAQ A;  3W1S C;  2KJR A;  4NNJ B;  2EMS A;  1RFA A;  1S1Q B;  2KWU B;  3TMP B;  3L54 A;  3MHS D;  4GN1 A;  4MGI E;  4DHJ D;  4DDG D;  4KIK B;  4BFR A;  2GBK A;  4YL8 A;  4HDO A;  3V62 A;  3AUL A;  2JZZ A;  2N7D A;  1GNU A;  4JGH B;  2K39 A;  4HK2 A;  5DCN A;  1WMH B;  2O2V B;  2A4Z A;  4PS7 A;  4OVU A;  1YJ1 A;  2LZ6 A;  4K7U A;  2C9W B;  3HM6 X;  4PS8 A;  2JPH A;  2CKH B;  4CO7 A;  1ZKH A;  2FID A;  1TTN A;  5CHF A;  2MX2 A;  1V6E A;  5CHV C;  1NBF C;  3A9J B;  1WH3 A;  2KDI A;  5J17 A;  5JHA A;  1GJZ A;  4ANU A;  3K9O B;  2A5U A;  2LVO A;  2L05 A;  1WYW B;  2O2V A;  1RAX A;  2JXX A;  3ZLZ A;  1A5R A;  2L8J A;  3K9P B;  4MSQ B;  1OEY A;  1XD3 B;  5LXH A;  4W9I A;  3D32 A;  2K6D B;  2GBJ A;  2FCS A;  3VUY A;  2DAJ A;  4GU2 A;  3AU5 A;  3RYT A;  4BBN F;  2WX1 A;  3NHE B;  1J8C A;  3KYC D;  4G50 A;  2LUE A;  3VTW A;  1P0R A;  2DZJ A;  2DZM A;  1Z2M A;  3DCG A;  3PHX B;  3QAR A;  4FN2 A;  1Q1O A;  1WY8 A;  4MGY E;  4F8C B;  3ENE A;  2JRI B;  3PHW B;  4ZRK A;  3S2A A;  3UQB A;  3VVW B;  3A9K B;  1GC7 A;  1LFD A;  1AAR A;  3IHP C;  4K7W A;  2KWC A;  4MEM A;  3WA0 A;  3A4S C;  4EUT A;  3IVF A;  2K8C A;  1H4R A;  1TGZ B;  4BKG A;  2EMT A;  1IYF A;  2M0X A;  5DPW A;  3ALB A;  2LJ5 A;  4W9F A;  4AUQ C;  2D2Q A;  2KMC A;  2PPH A;  2V3S A;  4AWJ A;  2AWT A;  4ANX A;  2CS4 A;  2LRU A;  5IAA C;  2D11 A;  1G6J A;  1EF1 A;  2LRW A;  1UH6 A;  1Q0W B;  3PTF C;  2KN5 A;  2KTR B;  2XEW A;  3X0W A;  4G0N B;  4WWO A;  2KX0 A;  2O6V B;  4FA6 A;  3TJP A;  3R7Q A;  4RM8 A;  1L2N A;  2BYV E;  2PEA A;  3KUC B;  2CU1 A;  4MDK E;  3DBS A;  4K7S A;  5KHQ A;  3DPD A;  3V60 A;  4AJW A;  1TBE A;  2FIF A;  2RPQ A;  3W1S A;  3KUZ A;  4BKT A;  4KZ0 A;  2N1W A;  2BYF A;  2RR9 A;  4OVV A;  4E3C A;  4PYZ A;  2ZCB A;  3QQ8 B;  1WM3 A;  4FBJ B;  2J7Q B;  4F7Z A;  4LCD E;  3W1Y A;  4NY0 A;  2MBH A;  2O6V A;  2I1J A;  2YLM A;  3QJZ A;  2ASQ A;  3RUL A;  2UWQ A;  1S3S G;  3N30 A;  3IFW B;  1TZ1 A;  1HE8 A;  3L10 B;  2KLG A;  2C7M B;  4WAA A;  5CHW A;  1R4M I;  3VTU A;  3ZO5 B;  4EZJ A;  4JLC A;  4GGQ A;  4E71 A;  5GMV A;  2RSU A;  3L17 A;  3H7P B;  1WF9 A;  4DBG A;  4GIV A;  1VD2 A;  5DPS A;  2AEH A;  4FJY A;  1L7Y A;  3R7R A;  1OQY A;  2NS5 A;  5HKH A;  2KFJ A;  4W9H A;  2GOW A;  4IW0 A;  3ML8 A;  1Y8R C;  3APD A;  3DBH I;  2IO2 B;  2KHW B;  4TV3 A;  4AP4 C;  5AZH A;  4W9L A;  5E6O A;  4W9C A;  3PT2 B;  1NI2 A; 
#chains in the Genus database with same CATH topology
 3AEB B;  5MPO A;  2DBY A;  2N9K A;  1YN3 A;  2ZPY A;  1UEL A;  4LNO A;  1E7U A;  3P4P B;  4KSK C;  1FNV A;  5KHO A;  2B3A A;  3ZDT A;  1WXQ A;  2FCQ A;  2MEK A;  3ZRC A;  2YEP B;  4AOF A;  4RF1 A;  1ZW7 A;  2D3B A;  4YTN B;  3X23 A;  4BKS D;  1JRP A;  5C2T B;  1TKE A;  4HWI B;  1WJU A;  4WQO B;  2LGY A;  3SDL C;  2JT4 B;  1WRI A;  4J3O D;  2WU5 B;  3KWV A;  4GDL B;  1FIQ A;  2Y5B B;  2KLC A;  3IG3 A;  3QC8 B;  5CTR C;  3RPF C;  3VRB B;  4L23 A;  4F1S A;  2ZNV C;  2B76 B;  1NEN B;  1N5X A;  3B2F A;  2D3A A;  4GDL A;  2LD9 A;  1KRH A;  1Q5W B;  2KFK A;  1C76 A;  2KT7 A;  2ZPN A;  4A20 A;  1TY2 A;  3TBL D;  2PVG C;  3MJ5 A;  2BYT A;  2G3Q B;  2GLS A;  2IGD A;  2WGS A;  1UD7 A;  3GB1 A;  1WI0 A;  1WIA A;  5E6N A;  3TL5 A;  1T0Y A;  3V3X A;  3N20 C;  2N9E B;  5D7G A;  3A4R A;  4LK0 M;  4IWQ A;  3ZW3 A;  3H1U A;  5G2N A;  2KVZ A;  4YSY B;  1FRR A;  5IP4 D;  1QT9 A;  1XLP A;  2N9X A;  2I1K A;  1B1Z A;  4A8X C;  2Z0D B;  1OEY J;  3VR9 B;  1FXI A;  2WLB A;  2CHX A;  4FJZ A;  2N9L A;  1V9J A;  2JQR B;  2LVQ A;  3A33 B;  2MCN B;  5IA7 A;  1EF5 A;  2PE9 A;  5H92 C;  4NJC A;  2JF5 A;  1Z5S B;  1GPX A;  1YIW A;  3T9L A;  3M3J A;  4C7Z A;  1PGA A;  1K53 A;  4AQ7 A;  4M8N A;  4LDT B;  2K8B A;  3B08 A;  1I4P A;  4JQW C;  2DWQ A;  1SJE D;  1SE9 A;  1NEK B;  4XDD A;  2HDE A;  5FKA C;  2K6Q A;  4IG7 B;  2UYZ B;  1E90 A;  1Y56 A;  2WS3 B;  3N1Z C;  3ZIM A;  2MBO A;  1D5M C;  2ON8 A;  4WH4 A;  1D3Z A;  4LNK A;  3ZNG C;  4ICV A;  2VZK B;  1MFW A;  1QKZ A;  1FCC C;  2DHZ A;  4M00 A;  5D2M B;  3ML9 A;  2AQ3 B;  3KH0 A;  3DQV A;  3GE3 C;  3GOE A;  2KDM A;  4ASW C;  2DZI A;  5C3J B;  2KYW A;  3EGR A;  1VDV A;  2L0F A;  3A1Q B;  2M0A A;  4JWS C;  3PRM B;  4MT5 A;  1UWM A;  2QHO A;  1YJI A;  1TT5 B;  3MHZ A;  4DXA B;  1WJN A;  3NZ3 A;  2DEN B;  3A1Q A;  4NJ6 A;  3FIL B;  3CF6 E;  4FAD A;  2WX0 A;  3DBL B;  1WGR A;  1N60 A;  2KAN A;  1TY0 A;  1I35 A;  3WAO A;  1V5T A;  1J7C A;  1HXY D;  3Q8E A;  2N7J A;  2Z0E B;  1WGY A;  1OQR A;  4BOZ B;  2LHD A;  1FFV A;  4ANV A;  1KM7 A;  1QOG A;  3DHH C;  3U8Z A;  5BMI A;  1TIF A;  3PLU A;  2NBU A;  4N59 A;  3A9K A;  3VUX A;  3ZQ4 A;  3RZW C;  1GOZ A;  4HXD A;  5L83 A;  4HKZ E;  2JWU A;  1FPY A;  1N61 A;  2BQQ A;  2ZNV B;  2OED A;  3AE8 B;  5HHD G;  3PPA A;  2K8H A;  4GOC A;  3KW5 B;  1HTQ A;  4ZRJ A;  3QA8 A;  3BYY B;  3LYY A;  2MW5 A;  3WAN A;  2NBV B;  3VDZ A;  5D94 A;  3ZTD A;  1U4A A;  2RDH A;  3L0W B;  2CJO A;  2ZVO A;  3AE3 B;  2LUM A;  2WXH A;  1OTR B;  3H7P A;  1K50 A;  5T8I A;  3PSE B;  2J53 A;  1FNU A;  4YTM B;  4XWW A;  3LDZ E;  3DOW A;  4IWP A;  3MC0 B;  1JRO A;  3QAQ A;  4MM3 B;  2KWU B;  2WXP A;  2QCZ A;  3L54 A;  4GN1 A;  3TEW A;  3TEY A;  2Z8L A;  3V62 A;  3V05 A;  4RGN A;  2K39 A;  1TS2 A;  2J4X A;  1WMH B;  3AV8 A;  4JX1 C;  4ARC A;  4PS7 A;  1YJ1 A;  2JPH A;  4QAY A;  4CO7 A;  1AYF A;  1NBF C;  3RNC C;  4NZL B;  5JHA A;  4ANU A;  4A9A A;  2A5U A;  4C00 A;  5FR3 A;  3AEG B;  4L1B A;  3AEE B;  1A5R A;  4MSQ B;  1XD3 B;  1SE2 A;  2QC8 A;  1MHH E;  4BZA A;  2WXJ A;  3RYT A;  4LNF A;  2WX1 A;  3NHE B;  3ZJT A;  2LUE A;  1HTO A;  1P0R A;  4KGS A;  4RGT A;  1Z2M A;  1DOY A;  4F8C B;  5BMH A;  1WY8 A;  4MGY E;  1VZ7 A;  4ZRK A;  3S2A A;  1ET6 A;  1GC7 A;  1XXG A;  2SAK A;  3IHP C;  1JWM D;  2KWC A;  4EUT A;  2K8C A;  1H4R A;  4M0W A;  4BAX A;  1MPE A;  5DPW A;  1T0R C;  1TZO A;  2NTS A;  3FC4 A;  2MHJ A;  2LRU A;  1Q0W B;  3PTF C;  4PK1 A;  2KN5 A;  4FA6 A;  2KX0 A;  3DHI C;  2XN9 C;  1FO4 A;  3TJP A;  3R7Q A;  3NJT A;  4RM8 A;  2IND C;  2PMV A;  2PEA A;  1TS5 A;  1TBE A;  2FIF A;  3W1S A;  2N1W A;  2RR9 A;  4E3C A;  3QQ8 B;  2IPK D;  1F2R I;  3HVZ A;  2FE8 A;  2JX5 A;  3U7Z A;  3N30 A;  4WAA A;  4ZRQ A;  3ZO5 B;  3VTU A;  1IGD A;  4EZJ A;  4E71 A;  4GIV A;  5DPS A;  3R7R A;  2NS5 A;  2KFJ A;  4W9H A;  4HEA 1;  2NMQ A;  1N5W A;  2QSD A;  4ZRI A;  1HZ5 A;  2LHE A;  2HTH A;  3GZN I;  2LXA A;  3P2B A;  5D3I B;  3LB8 C;  2K3U A;  3I5J C;  1OGW A;  4HPP A;  4NAM A;  1E8X A;  2MSE D;  3UI3 A;  3L08 A;  4DHZ B;  1VRA B;  4REZ A;  3ZXV A;  1PUT A;  4ZOH C;  3VH4 B;  4IM2 A;  3URY A;  1C1Y B;  5AZF A;  3IAM 1;  4HCP B;  4TMA B;  1WE7 A;  3OAW A;  2KOX A;  3ZVV A;  2MBQ A;  3VRA B;  1YD8 U;  3P42 A;  3QIJ A;  1IGC A;  3VAW A;  2V1Y A;  2J0K A;  4EEW A;  3WAP A;  4YTP B;  1XQQ A;  3NUH B;  4W9E A;  2FCM A;  2RDG A;  2ZEQ A;  3ETR A;  4NJ7 A;  3R66 C;  2N9P C;  3P4S B;  1P7F A;  1RM6 C;  4KDI C;  2EEL A;  2PLP A;  2QIL A;  4GDK A;  5J2R A;  4ZRP A;  1JRU A;  2DYM A;  1GG3 A;  3DBL I;  2O6V D;  3ZRF A;  1L6U A;  3AEF B;  3LXF A;  3ZJU A;  4JE3 B;  1M4V A;  4RCO A;  1ZPS A;  2FAZ A;  3AEA B;  1SXT A;  2NBW B;  3BYT B;  1SIF A;  4I6P A;  1X1M A;  3DVG X;  1V81 A;  3P63 A;  2GMI C;  4RFB A;  2RPV A;  2KVR A;  4E74 A;  1MHX A;  2W54 A;  5CX3 A;  3ZNI D;  1C4P A;  4K81 A;  1UBQ A;  2MRP A;  1K8R B;  1T0Q C;  5D6J B;  3H9D A;  2E3T A;  5HG2 A;  2NTT A;  1D5X C;  1F9J A;  4XE0 A;  2Y5P A;  2WXF A;  2X38 A;  4G3X B;  3P1M A;  2OJW A;  1JCK B;  4JIO U;  3UF8 A;  2KJ6 A;  3U7D A;  4CYE A;  1STE A;  1R4M B;  4EKU A;  3MJW A;  2HJ8 A;  3VFK A;  2C7N B;  2QEJ C;  3B1L X;  2GBM A;  1WYG A;  3PVL A;  1NVI D;  5G55 A;  4P7I A;  4PYU A;  1NI3 A;  4FUL A;  2KNB A;  4A3P A;  2L00 B;  2C5L C;  3ZKJ C;  1QLB B;  4YSX B;  2WXM A;  1IP9 A;  2BS2 B;  1WX8 A;  4S0R A;  3VUW A;  2DYB A;  3DBR I;  4BOS C;  2FUG 1;  3APC A;  2L7R A;  1BML C;  1TYG B;  4YXD B;  4B9K A;  3RT3 B;  4IUM B;  2MH7 A;  2BB6 A;  1DYQ A;  2IDY A;  2CHZ A;  2K1F A;  4MGK E;  2WXQ A;  3TIX A;  3UQA A;  1SJH D;  3BVM A;  5D3D A;  3WAM A;  2REX A;  3N3K B;  5G5G A;  1WZ0 A;  2J0J A;  2MLB A;  2OJR A;  1I4R A;  1VLB A;  2BYE A;  2D07 B;  1SE4 A;  2KTF A;  3PS6 A;  4DXF A;  2PW9 A;  3O13 A;  2XBB C;  1WGH A;  2HD5 B;  4US8 A;  2RD0 A;  2KFK B;  1I4X A;  2MJ3 A;  2JU6 X;  3DVN U;  1V86 A;  2HTM E;  4DHJ B;  4M01 A;  3V6C B;  5JZE B;  2W55 A;  1VJK A;  3L13 A;  1KH0 A;  4MSM B;  2E6X A;  1NYQ A;  2KC2 A;  2DYO A;  3JVZ X;  5FR6 A;  2JYT A;  2LMC A;  2JZ3 B;  1ZP0 B;  1BUI C;  4BBN C;  3A9J A;  1EUV B;  4BKS A;  3Q2A C;  3VH3 B;  5L95 C;  2JYE A;  3IT6 B;  4USA A;  1WFY A;  3DWM A;  4RGO S;  3VR8 B;  4EZK A;  2KD0 A;  3EC8 A;  2KDB A;  2J0M A;  4GMV A;  5EE0 A;  2LGX A;  1D4B A;  4FLH A;  3SU8 X;  2YVC A;  3HVD A;  2LVP A;  2C60 A;  4PT5 A;  4KZC A;  4N9F 4;  1LQB A;  1R4N B;  1ZDX A;  2ZZP B;  1XCT L;  1E6E B;  3BZD B;  2IO1 B;  4M02 A;  4WJO A;  1FM0 D;  4HPL B;  1PYW D;  4LDT D;  2FNJ B;  3I57 A;  3I63 C;  2G4D B;  1WWT A;  2K25 A;  3FAH A;  4HCN B;  2D3G A;  4XDC A;  3ECI A;  3PV1 A;  2K5P A;  3QHT A;  3DVN V;  3N32 A;  1YJJ A;  1J7B A;  5TSS A;  1F0Z A;  2BVC A;  1J19 A;  3ZTC A;  3GP7 A;  3RI7 C;  2DAF A;  2VZK D;  5EE9 A;  5EE1 A;  3PLV A;  4KVG B;  3U30 A;  4C7Y A;  3DVG Y;  2V0G A;  1JWA D;  4K1R B;  4ITK A;  3C8Y A;  3RMK C;  4DK5 A;  1K51 A;  3W1S C;  4NNJ B;  2EMS A;  1MG4 A;  1S1Q B;  1TKY A;  3R2T A;  2BT6 A;  4HRO A;  1R7S A;  2I38 A;  2QJL A;  4BFR A;  4HDO A;  2ZW0 A;  2JZZ A;  3Q6B A;  4HK2 A;  4KGT A;  3L4P A;  4ARI A;  1BXT A;  2A4Z A;  2D3C A;  3KWL A;  4OVU A;  2LZ6 A;  2C9W B;  2WXK A;  1ZKH A;  1TTN A;  2BB5 A;  3U4E G;  1WH3 A;  2KDI A;  3EFC A;  1NYR A;  1GJZ A;  3K9O B;  2LVO A;  1J7A A;  2L05 A;  3AE2 B;  1RAX A;  2JXX A;  3BK2 A;  1L4D B;  4IOI E;  5LXH A;  3H8H A;  2K6D B;  2GB1 A;  3AU5 A;  3AMZ A;  4A90 A;  3KYC D;  4G50 A;  2DZJ A;  4FN2 A;  1C79 A;  3UQB A;  2WXG A;  3A9K B;  1LFD A;  4K7W A;  4MEM A;  3WA0 A;  1RFK A;  1EU4 A;  3EUB 2;  1T5X D;  1FNW A;  3DWG C;  2EMT A;  2AQ2 B;  5BYR A;  2D2Q A;  2PPH A;  3HUI A;  4ANX A;  2CS4 A;  1EU3 A;  5IAA C;  1EF1 A;  1ZUD 2;  4G0N B;  3SR6 A;  4WWM A;  2BYV E;  2CU1 A;  2BYF A;  1HQR D;  2ZCB A;  4FBJ B;  2J7Q B;  4F7Z A;  4NY0 A;  2YLM A;  3QJZ A;  2VH2 A;  4N58 A;  5IKC M;  2LFI A;  3IFW B;  1HE8 A;  1TZ1 A;  4XYC A;  1R4M I;  1QF6 A;  3WCQ A;  4JLC A;  2INC C;  5GMV A;  2RSU A;  1IBX B;  3H7P B;  1WF9 A;  4DBG A;  1L7Y A;  1C4C A;  2V4I B;  2ACZ B;  2LJI A;  1TS3 A;  2GOW A;  3AB5 A;  3APD A;  2KHW B;  4TV3 A;  2V9H A;  2WNM A;  1YQ3 B;  5AZH A;  1IBX A;  1JWS D;  1Q10 A;  1V1O A;  2M56 B;  3E9S A;  1FMA D;  2XK5 A;  3IAS 1;  5HI1 A;  4ZHO A;  3KLS X;  2RGF A;  4RGM A;  2LXC A;  4OHJ A;  1TKG A;  4GB9 A;  3SEB A;  2MA9 B;  4W9J A;  3APF A;  1I42 A;  4FHK A;  3BY4 B;  1C3T A;  2C7H A;  1V80 A;  2MBB B;  3AE9 B;  2IGG A;  1ISN A;  4G11 A;  3EHV A;  4DWF A;  3R2I A;  3JW0 X;  4K3C A;  5JHB A;  1WXV A;  1PGB A;  2JY6 A;  1MG8 A;  1XT9 B;  3HHM A;  2WXO A;  4KKI A;  3W2D A;  2AL6 A;  1FEH A;  1SEB D;  3U52 E;  3BVZ A;  2KC1 A;  2MBE A;  1L4Z B;  1C78 A;  2BW2 A;  3R3M A;  1PGX A;  1WXS A;  2WWZ A;  1CMX B;  3Q14 C;  5H8Y E;  3V6E B;  4M0W B;  3ZNH B;  5AUK A;  4B6W A;  1E8Y A;  1J0G A;  1XCQ L;  1F1H A;  4WAF A;  2NR2 A;  2MQJ A;  3VTV A;  3BIN A;  4YSZ B;  4MGZ E;  5C23 A;  3ZNZ B;  3T3O A;  3UIP B;  1OQQ A;  2KWD A;  2DLB A;  3TCA A;  2BF8 B;  4EZL A;  3PZ7 A;  3HK0 A;  3WIM A;  2WYQ A;  3W9C B;  4NPN A;  1WM2 A;  4YWG G;  1WX9 A;  4W9K A;  1TS4 A;  1JML A;  2LWP A;  2KQ4 X;  1WXM A;  1IPG A;  2KQS A;  1VCB A;  3RZF A;  1E8Z A;  3Q8B A;  3L16 A;  4DDI D;  2IBI B;  1CJE A;  4KGR A;  3NY5 A;  3AI5 A;  2K0P A;  4GXB A;  3ABV B;  2PJH A;  2PIA A;  4ZDV A;  2N7E A;  4LTU A;  2J42 A;  2HE7 A;  4TSS A;  1ZGU B;  2SEB D;  4EFO A;  3QWZ B;  5BO4 B;  3RNF C;  5TR5 A;  1V49 A;  1V2Y A;  1WGK A;  3BWU D;  3HM3 A;  4WUR A;  3T8M A;  2M19 A;  2LAS A;  1SBB B;  2HJ1 A;  2OOB B;  1K52 A;  1WXA A;  2JUO A;  3DBH B;  4WJN A;  2L32 A;  4HVB A;  3N1X C;  4D2K A;  2GBR A;  4FJV B;  5AUI A;  4FHJ A;  2GBN A;  1UZX B;  4A6Q A;  3UIN B;  4IM3 A;  3QX1 A;  1IUE A;  2MWS B;  2L0T A;  3E56 A;  4RMA A;  3N1Y C;  4TQ1 A;  3Q3O C;  4LJP B;  2FUH B;  1T0S C;  2WDT B;  1E10 A;  3NS8 A;  2G9H D;  3NVV A;  1FXT B;  3ZDM C;  3I3T B;  3CSF A;  3M95 A;  2INP E;  1LO5 D;  3QCA A;  4TQ0 A;  3N9Y C;  3M63 B;  2JXT A;  5DPT A;  4A3O A;  5FK9 C;  4EOY A;  4GDK B;  2JWZ A;  4TUU A;  4MJS A;  5AZG A;  3C19 A;  2MJD A;  1KLG D;  1L6V A;  5LXI B;  4KV2 A;  4RH6 A;  2KX3 A;  1UBI A;  4DXG A;  2EKE C;  2CJN A;  4KIK A;  4CHK A;  2PKO A;  2KO3 A;  3Q8C A;  1QIL A;  1KLU D;  1JWB D;  3IXS A;  2AQ1 B;  3AU4 A;  2AL3 A;  3SFD B;  5C1Z A;  2QDF A;  1WGD A;  1V8C A;  2WDQ B;  2KQ7 A;  4P1B C;  4OZA A;  4I6N B;  2PE6 B;  2R2Q A;  2WXL A;  2Q5W D;  2LI5 A;  2BTE A;  4LNI A;  1FRD A;  3J9C A;  3AEC B;  1E0Z A;  2BWF A;  2AYO B;  3PRE A;  3AE1 B;  1N63 A;  1ZE3 D;  2OHF A;  1P9D U;  1LXD A;  2BKR B;  4AS1 A;  2BS3 B;  2JVC A;  4K3B A;  3PRP B;  3DDC B;  1CQV A;  2M1M A;  4P1C C;  4JPS A;  3NZS A;  2BWE S;  2ZJD A;  4HJK A;  3EA6 A;  3AE6 B;  4CQN A;  4JL9 A;  1KOT A;  3RN9 C;  4I6L B;  3I9V 1;  3LJ3 A;  1KF6 B;  2KTR A;  2QMT A;  1YQB A;  3W5U B;  4C4V B;  4RNA A;  1V1P A;  3VQI A;  2KJH B;  3EFU A;  1ZXH A;  2WDR B;  4MH0 E;  3TEZ A;  2VRR B;  2GRI A;  4WJP A;  1WR1 A;  2V3N A;  4C4V A;  1C9F A;  1XO3 A;  3ZUN A;  2G45 B;  4NAW B;  4PS3 A;  2NPT B;  4NQL B;  3ZXR A;  2BKF A;  1UUP A;  5E6J A;  1OFF A;  2W9N A;  1B9R A;  2BPS A;  1FD6 A;  1NDD A;  1YX5 B;  5E6P A;  3IBE A;  4WIP A;  4KDL B;  4NAW A;  3KQ4 A;  2NPT A;  3SD5 A;  3RD2 A;  2KMM A;  2KJR A;  3TMP B;  3MHS D;  1CK1 A;  4MGI E;  1XEE A;  4DHJ D;  1WSP A;  2WDV B;  2QIE B;  3MP9 A;  1GNU A;  4JGH B;  4Q2J A;  3ZGZ A;  1N6Z A;  2D5G A;  5DCN A;  3ZJV A;  2O2V B;  4K7U A;  4ZHP A;  5CHF A;  2MX2 A;  5CHV C;  3A9J B;  3FKY A;  4L2Y A;  1SE3 A;  1WYW B;  2O2V A;  1KFY B;  3ZLZ A;  2L8J A;  3B2G A;  3K9P B;  1OEY A;  3AN1 A;  4W9I A;  1EWY C;  3D32 A;  2DAJ A;  3PHX B;  2KN4 A;  1Q1O A;  3ENE A;  2JRI B;  2LEK A;  3PHW B;  4KX6 B;  3VVW B;  1GB1 A;  3A4S C;  1L5P A;  1YN5 A;  3IVF A;  1TGZ B;  2R61 A;  4HKQ A;  1IYF A;  1UNS A;  1ESF A;  2WU2 B;  1JWU D;  3ALB A;  2LJ5 A;  1XLO A;  2V3S A;  1V97 A;  2AWT A;  2D11 A;  4HJG E;  2LRW A;  2XEW A;  4WWO A;  5BYS A;  4EE2 A;  2CU3 A;  1E9M A;  3KUC B;  3AE4 B;  4FXC A;  3DPD A;  3V60 A;  4AJW A;  1AN8 A;  2RPQ A;  4BKT A;  3KUZ A;  2KAC A;  4OW0 A;  4B0E A;  1WM3 A;  4LCD E;  1I7H A;  2MBH A;  4YT0 B;  2I1J A;  3RUL A;  4P16 A;  4GGQ A;  4LNN A;  3L17 A;  2TSS A;  4A55 A;  1VD2 A;  4C80 A;  3MC9 A;  5HFY A;  3RNG C;  4ZYS A;  1RYJ A;  3AED B;  2BBC A;  4IW0 A;  1Y8R C;  3DBH I;  1SIJ A;  4AP4 C;  4W9C A;  1SB3 C;  1SSN A;  2IO3 B;  5AEK B;  3DHG C;  2IYD B;  1WJ4 A;  3UGB B;  4TKN A;  1FFU A;  2INN E;  3CST A;  4WQM A;  5BYQ A;  1E7P B;  1M94 A;  1QOF A;  2M4N A;  1QOB A;  1P3Q U;  3EEC A;  1CZP A;  1RLF A;  3GZN B;  2V3P A;  4HPM B;  2DZK A;  2ONQ A;  4WJQ A;  4HLE A;  3TEX A;  1MI0 A;  2ZCC A;  2WXI A;  3BII D;  5EDS A;  5EE3 A;  2RDB C;  3CIR B;  2V4L A;  4MEL A;  3HIZ A;  3MTN B;  5BMG A;  2CHW A;  1ZOY B;  4X57 B;  2LGD A;  3QK0 A;  2D10 A;  2PTL A;  2R2O A;  3JYU A;  1EO6 A;  1UGM A;  4XC2 A;  1T6B X;  1P1A A;  4IM0 A;  1JQ4 A;  3B9J A;  4W9G A;  2L83 A;  1P7E A;  2JSV X;  4US9 A;  5IO9 A;  1C4A A;  4RM9 A;  3NVY A;  1F52 A;  5DPR A;  4LLG M;  3UIO B;  3SFE B;  3PO0 A;  3RUI B;  1E5W A;  2N1V A;  4N6E B;  2G4S A;  4OZC A;  3RNB C;  3NVW A;  3T3N A;  2NVU I;  2IGH A;  3KUD B;  2LGI A;  4S17 A;  4B0M A;  1I4H A;  1PFD A;  1T3Q A;  4URK A;  3NVZ A;  3VHT C;  1YNT E;  1H8C A;  4H2A A;  2H89 B;  4HDQ A;  1D6E C;  4II3 B;  4WWP A;  2CR5 A;  1WX7 A;  4ZYN A;  1DOI A;  2L52 A;  2W3S A;  3RCZ A;  2YEP F;  2M8S A;  3FIL A;  1SF0 A;  4DHZ E;  3V61 A;  1ENF A;  2WXN A;  2KMA A;  3AXC A;  2ICI A;  2FBW B;  2JZP A;  4P6V F;  1E8W A;  1HEZ E;  3PRZ A;  1MJD A;  2IY0 B;  1ZDV A;  2KWV B;  1GC6 A;  3M62 B;  2KKC A;  4HRS A;  2L1A A;  3NZU A;  3U2S C;  4MH8 A;  1WZ3 A;  1KLV A;  2Z59 B;  5JH5 C;  2XK5 B;  3PGE A;  2AX5 A;  3OLM D;  5JXV A;  3AE7 B;  2K22 A;  3TSS A;  2L3Z A;  3JSV B;  3Q3N C;  2JRH A;  1TJE A;  1HA5 A;  3W5V B;  5LNK 1;  4II2 B;  4M8M A;  3MFG A;  4GSW A;  4ANW A;  1BT0 A;  3JSV A;  4OZB A;  3SHQ A;  1E7V A;  2WXR A;  4O1N A;  1F77 A;  3H7S A;  5I4D A;  2W3R A;  2FCN A;  4XX5 A;  3DBR B;  3CMM B;  1N62 A;  1UGJ A;  2IO0 B;  1PQS A;  1VR9 A;  2UU7 A;  1AWD A;  3NS1 A;  3Q3M C;  3ZYY X;  1V5O A;  1UF0 A;  2KDE B;  4OVZ A;  1WE6 A;  1C77 A;  3B0A A;  4XZ4 A;  1KJT A;  2ZVN A;  1I4Q A;  3AE5 B;  4DQO C;  1RRB A;  1WGG A;  4ICU A;  4W9D A;  1XF5 L;  4AJY B;  1WR6 E;  5J18 A;  2KXJ A;  3PZD A;  2IY1 B;  2N4F A;  1P98 A;  4MM3 A;  2KK8 A;  1SGH A;  2MP2 B;  2WQY B;  1I4G A;  2KZR A;  3AM9 A;  3R8B A;  5GXG B;  1WMH A;  4KSL C;  1FCL A;  3OWE B;  2GI9 A;  1FXA A;  3Q3F A;  3VXW A;  4LJO B;  2MP2 A;  1LM8 B;  3KYD D;  1XLQ A;  2PVO D;  2DX5 B;  3BVG A;  3OG5 A;  3BK1 A;  1ROE A;  4NQK E;  1R4N I;  5IN7 A;  4IC7 B;  5IOI A;  3KVF B;  1GUA B;  2BGF A;  3H6N A;  1YX6 B;  2ZW1 A;  3NOB A;  1ET9 A;  3Q69 A;  1WJ6 A;  1AW7 A;  2IZV B;  2DNF A;  2W82 A;  2L76 A;  3WAL A;  1EM7 A;  1WRD B;  1UWX A;  1YQ4 B;  4UDU C;  2KDF B;  4ACF A;  2LGS A;  5LLI A;  5G5H A;  2VH1 A;  1QZE A;  3ONS A;  3C0R B;  2XNA C;  4MAC A;  3OJ4 B;  3RNA C;  3Q8A A;  4KKJ A;  4BVU C;  3HRD D;  3Q3J A;  2I2Y A;  2RMM A;  1VZ8 A;  1RWS A;  3OJ3 A;  4IWO A;  1YOV B;  3RNE C;  4WWN A;  1D5Z C;  2Y5C A;  2NCN A;  4B95 A;  2J52 A;  3O65 B;  2M17 A;  1JAL A;  4MJS B;  1L0V B;  1KTK A;  1JW9 D;  4R3D A;  1L0X B;  4J6I A;  1RFA A;  4IDI A;  4DDG D;  4KIK B;  2GBK A;  4YL8 A;  1PDX A;  3AUL A;  1QOA A;  2N7D A;  1HZ6 A;  3MC8 A;  4PS8 A;  3HM6 X;  2H88 B;  2CKH B;  4JWU C;  2FID A;  2N0S B;  1V6E A;  1YMH E;  4C56 C;  5J17 A;  2BS4 B;  3GE8 C;  2EKI A;  2X8X X;  1F2R C;  2GBJ A;  2FCS A;  3VUY A;  1DGJ A;  4GU2 A;  4BBN F;  1J8C A;  3GS2 A;  3VTW A;  2DZM A;  2IJ0 A;  3DCG A;  1L0Y B;  3QAR A;  3RFZ B;  1ACC A;  1AAR A;  3P4Q B;  1EWC A;  4BKG A;  2M0X A;  2KAJ A;  4W9F A;  2G1E A;  4GLS C;  4AUQ C;  4AWJ A;  2KMC A;  3P4R B;  3NRZ A;  1G6J A;  1UH6 A;  1VZ6 A;  1A70 A;  1YN4 A;  2KTR B;  3X0W A;  2MJE A;  2O6V B;  1L2N A;  1GB4 A;  4MDK E;  5KHQ A;  3DBS A;  4K7S A;  4IKG A;  4XGA B;  1QQR A;  1V1P B;  4KZ0 A;  4OVV A;  4PYZ A;  3Q8F A;  1LGR A;  3AH7 A;  3W1Y A;  2K9X A;  3CWI A;  2O6V A;  3PZ8 A;  1DOX A;  2ASQ A;  2UWQ A;  1S3S G;  1XLN A;  3L10 B;  2KLG A;  2C7M B;  5CHW A;  3NG0 A;  4XWT A;  2WP9 B;  2WHI A;  2AEH A;  4FJY A;  4RF0 A;  1MVK A;  1OQY A;  5HKH A;  1ZXI A;  1GAQ B;  3ML8 A;  2Y3A A;  3IT4 B;  2IO2 B;  4W9L A;  3TUO A;  5E6O A;  3PT2 B;  1NI2 A; 
#chains in the Genus database with same CATH homology
 2IO3 B;  2XK5 A;  5AEK B;  4ZRI A;  2IYD B;  1WJ4 A;  3UGB B;  2HTH A;  2RGF A;  4TKN A;  2ZPY A;  3GZN I;  1UEL A;  2LXA A;  1E7U A;  3P2B A;  3CST A;  2LXC A;  4KSK C;  4GB9 A;  5KHO A;  1M94 A;  1OGW A;  2B3A A;  2MA9 B;  3ZDT A;  2FCQ A;  2M4N A;  4W9J A;  3APF A;  3ZRC A;  1I42 A;  1P3Q U;  3EEC A;  4FHK A;  1RLF A;  3BY4 B;  4AOF A;  1C3T A;  1ZW7 A;  4HPM B;  1E8X A;  2C7H A;  2DZK A;  2MSE D;  4WJQ A;  1V80 A;  2MBB B;  3L08 A;  3X23 A;  4BKS D;  4HLE A;  4HWI B;  4DHZ B;  1WJU A;  1ISN A;  2ZCC A;  4G11 A;  3EHV A;  2LGY A;  4WQO B;  3SDL C;  4DWF A;  2JT4 B;  5EDS A;  3JW0 X;  3VH4 B;  2V4L A;  4MEL A;  4IM2 A;  3HIZ A;  3MTN B;  5JHB A;  2CHW A;  1WXV A;  1C1Y B;  2JY6 A;  1MG8 A;  4X57 B;  5AZF A;  1XT9 B;  3HHM A;  4HCP B;  2LGD A;  4GDL B;  1WE7 A;  2Y5B B;  2AL6 A;  3QK0 A;  3OAW A;  2D10 A;  2R2O A;  2KC1 A;  2KOX A;  2MBE A;  3ZVV A;  3JYU A;  1EO6 A;  1UGM A;  1YD8 U;  2KLC A;  2MBQ A;  4XC2 A;  3IG3 A;  3QC8 B;  3QIJ A;  3VAW A;  1P1A A;  2V1Y A;  4IM0 A;  2J0K A;  5CTR C;  3WAP A;  4EEW A;  3R3M A;  4W9G A;  1XQQ A;  1WXS A;  2WWZ A;  1CMX B;  4F1S A;  2ZNV C;  4W9E A;  2FCM A;  3V6E B;  2ZEQ A;  4M0W B;  3ZNH B;  4GDL A;  4RM9 A;  4B6W A;  4NJ7 A;  1E8Y A;  2LD9 A;  2N9P C;  3R66 C;  1J0G A;  5DPR A;  4KDI C;  3UIO B;  4GDK A;  2NR2 A;  2MQJ A;  3RUI B;  3VTV A;  1Q5W B;  5J2R A;  1E5W A;  2KFK A;  1JRU A;  2N1V A;  3BIN A;  2DYM A;  2G4S A;  1GG3 A;  3DBL I;  2NVU I;  2O6V D;  4MGZ E;  2ZPN A;  5C23 A;  3ZNZ B;  3ZRF A;  4A20 A;  3UIP B;  3TBL D;  3KUD B;  2G3Q B;  1H8C A;  4URK A;  3TCA A;  3VHT C;  2BF8 B;  1UD7 A;  4EZL A;  2FAZ A;  1WI0 A;  2NBW B;  1WIA A;  1SIF A;  3HK0 A;  1X1M A;  4I6P A;  4HDQ A;  5E6N A;  2WYQ A;  4II3 B;  3WIM A;  3DVG X;  4WWP A;  1V81 A;  2CR5 A;  3TL5 A;  2GMI C;  1T0Y A;  1WX7 A;  4NPN A;  1WM2 A;  4ZYN A;  1WX9 A;  4W9K A;  2N9E B;  3RCZ A;  2M8S A;  2KVR A;  5D7G A;  3A4R A;  4E74 A;  3ZNI D;  5CX3 A;  2LWP A;  4DHZ E;  4IWQ A;  3V61 A;  1WXM A;  3ZW3 A;  1IPG A;  2KMA A;  2KQS A;  4K81 A;  3AXC A;  1UBQ A;  3H1U A;  1VCB A;  2MRP A;  3RZF A;  1K8R B;  5G2N A;  1E8Z A;  5D6J B;  3L16 A;  3H9D A;  4DDI D;  2IBI B;  1E8W A;  3NY5 A;  3PRZ A;  2N9X A;  3AI5 A;  2I1K A;  1F9J A;  2IY0 B;  4GXB A;  2Z0D B;  1OEY J;  2KWV B;  2PJH A;  1GC6 A;  3M62 B;  2KKC A;  2CHX A;  4ZDV A;  2N7E A;  3NZU A;  4FJZ A;  4G3X B;  1V9J A;  2HE7 A;  2LVQ A;  3A33 B;  2MCN B;  1ZGU B;  1WZ3 A;  1KLV A;  4JIO U;  5IA7 A;  3UF8 A;  2Z59 B;  2KJ6 A;  1EF5 A;  3U7D A;  4CYE A;  5JH5 C;  2PE9 A;  2XK5 B;  4EKU A;  3PGE A;  3MJW A;  4EFO A;  2HJ8 A;  3QWZ B;  2C7N B;  5BO4 B;  5TR5 A;  3VFK A;  3OLM D;  1V49 A;  2JF5 A;  1V2Y A;  3B1L X;  1Z5S B;  2L3Z A;  3JSV B;  2GBM A;  3PVL A;  1YIW A;  3HM3 A;  3T9L A;  3T8M A;  2JRH A;  5G55 A;  3M3J A;  2LAS A;  2OOB B;  4P7I A;  4PYU A;  4M8N A;  4FUL A;  1WXA A;  2JUO A;  2KNB A;  2K8B A;  4LDT B;  3B08 A;  4WJN A;  2L00 B;  2C5L C;  4A3P A;  4JQW C;  4HVB A;  4II2 B;  3ZKJ C;  2GBR A;  4M8M A;  4GSW A;  4FJV B;  4ANW A;  1IP9 A;  1SE9 A;  1BT0 A;  1WX8 A;  3VUW A;  2DYB A;  3DBR I;  4BOS C;  3JSV A;  4FHJ A;  3SHQ A;  3APC A;  2GBN A;  2L7R A;  1E7V A;  1UZX B;  2K6Q A;  4IG7 B;  3UIN B;  4B9K A;  3H7S A;  4IM3 A;  2UYZ B;  3RT3 B;  1E90 A;  3QX1 A;  4IUM B;  2MWS B;  2L0T A;  2FCN A;  4XX5 A;  3CMM B;  4RMA A;  4TQ1 A;  3ZIM A;  2CHZ A;  2K1F A;  4MGK E;  2MBO A;  2FUH B;  4LJP B;  3TIX A;  2IO0 B;  1PQS A;  3UQA A;  2WDT B;  3WAM A;  3NS8 A;  2REX A;  3N3K B;  1WZ0 A;  1D3Z A;  2J0J A;  1FXT B;  1V5O A;  2MLB A;  2OJR A;  2KDE B;  3ZNG C;  3ZDM C;  4ICV A;  1WE6 A;  3CSF A;  3I3T B;  3M95 A;  3B0A A;  4XZ4 A;  1KJT A;  2BYE A;  2ZVN A;  2D07 B;  2DHZ A;  2KTF A;  5D2M B;  3QCA A;  3PS6 A;  4TQ0 A;  1RRB A;  1WGG A;  3M63 B;  3ML9 A;  4ICU A;  4W9D A;  5DPT A;  4A3O A;  3KH0 A;  4AJY B;  2XBB C;  1WGH A;  1WR6 E;  4EOY A;  3DQV A;  2HD5 B;  2KXJ A;  3PZD A;  2JWZ A;  4GDK B;  4TUU A;  5J18 A;  2RD0 A;  4MJS A;  3GOE A;  5AZG A;  4ASW C;  2IY1 B;  2DZI A;  2KFK B;  2N4F A;  1P98 A;  4MM3 A;  3DVN U;  5LXI B;  2KK8 A;  2L0F A;  4KV2 A;  3A1Q B;  1V86 A;  2KX3 A;  1SGH A;  1UBI A;  4DHJ B;  2EKE C;  3PRM B;  4KIK A;  3V6C B;  4CHK A;  2MP2 B;  5JZE B;  2KO3 A;  3L13 A;  2QHO A;  4MSM B;  3AU4 A;  2KZR A;  2AL3 A;  4DXA B;  1WJN A;  1WMH A;  4KSL C;  5C1Z A;  2KC2 A;  1WGD A;  2DYO A;  3Q3F A;  3JVZ X;  2DEN B;  3VXW A;  3A1Q A;  4NJ6 A;  5FR6 A;  2JZ3 B;  3CF6 E;  2MP2 A;  1LM8 B;  4LJO B;  4FAD A;  2KQ7 A;  4BBN C;  3A9J A;  1EUV B;  3KYD D;  2WX0 A;  3VH3 B;  4I6N B;  4BKS A;  5L95 C;  1WGR A;  2DX5 B;  2PE6 B;  2R2Q A;  2LI5 A;  2KAN A;  1WFY A;  1I35 A;  3WAO A;  1V5T A;  4EZK A;  2KD0 A;  3EC8 A;  2KDB A;  2J0M A;  4GMV A;  2BWF A;  2LGX A;  2Z0E B;  1R4N I;  1WGY A;  2AYO B;  3PRE A;  4NQK E;  4BOZ B;  4FLH A;  3SU8 X;  4ANV A;  1KM7 A;  1P9D U;  4IC7 B;  3U8Z A;  1LXD A;  2BKR B;  2YVC A;  3PLU A;  2LVP A;  2NBU A;  2C60 A;  2JVC A;  3KVF B;  3A9K A;  4KZC A;  1GUA B;  3VUX A;  3PRP B;  4N9F 4;  1LQB A;  2BGF A;  3H6N A;  1YX6 B;  2ZZP B;  3DDC B;  3RZW C;  3NOB A;  1WJ6 A;  2M1M A;  2IZV B;  2IO1 B;  3NZS A;  4HXD A;  4WJO A;  2BWE S;  2ZJD A;  5L83 A;  4HJK A;  4HPL B;  4JL9 A;  1KOT A;  4I6L B;  2ZNV B;  4LDT D;  2L76 A;  3WAL A;  3PPA A;  2FNJ B;  2K8H A;  2G4D B;  3LJ3 A;  1WRD B;  4GOC A;  2KTR A;  1YQB A;  2K25 A;  2KDF B;  4HCN B;  2D3G A;  5LLI A;  3KW5 B;  3ECI A;  3PV1 A;  3QHT A;  3DVN V;  3N32 A;  4ZRJ A;  1QZE A;  3ONS A;  3VQI A;  2KJH B;  3QA8 A;  3C0R B;  3EFU A;  3OJ4 B;  2MW5 A;  3WAN A;  1J19 A;  4MH0 E;  2VRR B;  2NBV B;  4WJP A;  3ZTC A;  4BVU C;  1WR1 A;  3VDZ A;  5D94 A;  3ZTD A;  3Q3J A;  3ZUN A;  2G45 B;  1U4A A;  4NAW B;  3L0W B;  4PS3 A;  2ZVO A;  2NPT B;  4NQL B;  2BKF A;  2DAF A;  3OJ3 A;  4IWO A;  1OTR B;  3H7P A;  2W9N A;  2BPS A;  4WWN A;  3PLV A;  3PSE B;  1NDD A;  4KVG B;  1YX5 B;  5E6P A;  2NCN A;  3DVG Y;  3U30 A;  3IBE A;  4B95 A;  4KDL B;  4NAW A;  3O65 B;  2M17 A;  2NPT A;  3LDZ E;  3DOW A;  4MJS B;  4K1R B;  4IWP A;  3SD5 A;  3RD2 A;  4DK5 A;  4J6I A;  3QAQ A;  3W1S C;  2KJR A;  4NNJ B;  2EMS A;  1RFA A;  1S1Q B;  2KWU B;  3TMP B;  3L54 A;  3MHS D;  4GN1 A;  4MGI E;  4DHJ D;  4DDG D;  4KIK B;  4BFR A;  2GBK A;  4YL8 A;  4HDO A;  3V62 A;  3AUL A;  2JZZ A;  2N7D A;  1GNU A;  4JGH B;  2K39 A;  4HK2 A;  5DCN A;  1WMH B;  2O2V B;  2A4Z A;  4PS7 A;  4OVU A;  1YJ1 A;  2LZ6 A;  4K7U A;  2C9W B;  3HM6 X;  4PS8 A;  2JPH A;  2CKH B;  4CO7 A;  1ZKH A;  2FID A;  1TTN A;  5CHF A;  2MX2 A;  1V6E A;  5CHV C;  1NBF C;  3A9J B;  1WH3 A;  2KDI A;  5J17 A;  5JHA A;  1GJZ A;  4ANU A;  3K9O B;  2A5U A;  2LVO A;  2L05 A;  1WYW B;  2O2V A;  1RAX A;  2JXX A;  3ZLZ A;  1A5R A;  2L8J A;  3K9P B;  4MSQ B;  1OEY A;  1XD3 B;  5LXH A;  4W9I A;  3D32 A;  2K6D B;  2GBJ A;  2FCS A;  3VUY A;  2DAJ A;  4GU2 A;  3AU5 A;  3RYT A;  4BBN F;  2WX1 A;  3NHE B;  1J8C A;  3KYC D;  4G50 A;  2LUE A;  3VTW A;  1P0R A;  2DZJ A;  2DZM A;  1Z2M A;  3DCG A;  3PHX B;  3QAR A;  4FN2 A;  1Q1O A;  1WY8 A;  4MGY E;  4F8C B;  3ENE A;  2JRI B;  3PHW B;  4ZRK A;  3S2A A;  3UQB A;  3VVW B;  3A9K B;  1GC7 A;  1LFD A;  1AAR A;  3IHP C;  4K7W A;  2KWC A;  4MEM A;  3WA0 A;  3A4S C;  4EUT A;  3IVF A;  2K8C A;  1H4R A;  1TGZ B;  4BKG A;  2EMT A;  1IYF A;  2M0X A;  5DPW A;  3ALB A;  2LJ5 A;  4W9F A;  4AUQ C;  2D2Q A;  2KMC A;  2PPH A;  2V3S A;  4AWJ A;  2AWT A;  4ANX A;  2CS4 A;  2LRU A;  5IAA C;  2D11 A;  1G6J A;  1EF1 A;  2LRW A;  1UH6 A;  1Q0W B;  3PTF C;  2KN5 A;  2KTR B;  2XEW A;  3X0W A;  4G0N B;  4WWO A;  2KX0 A;  2O6V B;  4FA6 A;  3TJP A;  3R7Q A;  4RM8 A;  1L2N A;  2BYV E;  2PEA A;  3KUC B;  2CU1 A;  4MDK E;  3DBS A;  4K7S A;  5KHQ A;  3DPD A;  3V60 A;  4AJW A;  1TBE A;  2FIF A;  2RPQ A;  3W1S A;  3KUZ A;  4BKT A;  4KZ0 A;  2N1W A;  2BYF A;  2RR9 A;  4OVV A;  4E3C A;  4PYZ A;  2ZCB A;  3QQ8 B;  1WM3 A;  4FBJ B;  2J7Q B;  4F7Z A;  4LCD E;  3W1Y A;  4NY0 A;  2MBH A;  2O6V A;  2I1J A;  2YLM A;  3QJZ A;  2ASQ A;  3RUL A;  2UWQ A;  1S3S G;  3N30 A;  3IFW B;  1TZ1 A;  1HE8 A;  3L10 B;  2KLG A;  2C7M B;  4WAA A;  5CHW A;  1R4M I;  3VTU A;  3ZO5 B;  4EZJ A;  4JLC A;  4GGQ A;  4E71 A;  5GMV A;  2RSU A;  3L17 A;  3H7P B;  1WF9 A;  4DBG A;  4GIV A;  1VD2 A;  5DPS A;  2AEH A;  4FJY A;  1L7Y A;  3R7R A;  1OQY A;  2NS5 A;  5HKH A;  2KFJ A;  4W9H A;  2GOW A;  4IW0 A;  3ML8 A;  1Y8R C;  3APD A;  3DBH I;  2IO2 B;  2KHW B;  4TV3 A;  4AP4 C;  5AZH A;  4W9L A;  5E6O A;  4W9C A;  3PT2 B;  1NI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...