4W9IA

Pvhl:elob:eloc in complex with (2s,4r)-1-((2s,4r)-1-acetyl-4-hydroxypyrrolidine-2-carbonyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9iA00
1IPGA 4IC7B 4MGKE 4WJOA 4EZJA 1ZKHA 1YX5B 3PGEA 1NI2A 2QHOA 3DBHI 4M8NA 5E6NA 2REXA 1ISNA 2KDIA 2LASA 4F1SA 2KMAA 2KTRA 3PTFC 4HXDA 1WXVA 3CMMB 1J0GA 2G4DB 3B08A 1IP9A 2LXAA 3PS6A 4EZLA 1D3ZA 3QIJA 4PS7A 4KDLB 2PE6B 2KDBA 4MGZE 2KLCA 4NQLB 2JY6A 2GBRA 2KO3A 1E8YA 3M3JA 1S3SG 1VD2A 3ALBA 3V61A 2JVCA 2AL6A 1U4AA 1WMHA 3CSFA 4GDKB 3L10B 2BWFA 4ZRIA 3V6EB 2C7MB 3N3KB 5AEKB 4M0WB 5LXHA 4FA6A 1SGHA 1P9DU 2K8HA 4IUMB 4ANWA 1YJ1A 2CU1A 1OGWA 2RGFA 4W9LA 1WX8A 2IYDB 4LJPB 4NQKE 2DAFA 4G50A 1CMXB 1V6EA 1WI0A 3PZDA 3VTWA 1WGDA 4E74A 1WR1A 3DQVA 1XT9B 2BKRB 3A9KB 1WGGA 2KWUB 3IHPC 3BY4B 3TBLD 2ZNVC 4IW0A 4EKUA 4N9F4 1EF5A 4PYZA 2IO2B 4HCPB 4XX5A 2KN5A 4KZ0A 3ZVVA 2GBJA 2KWCA 2C7HA 2NBVB 4F8CB 4IWPA 2N7DA 2L76A 1WJ4A 4TV3A 5L83A 2N9EB 3A9JA 2MQJA 4NPNA 3DOWA 3L17A 2BWES 2KFJA 1Y8RC 1Q0WB 2JPHA 2FIDA 3PV1A 2B3AA 2KC1A 3JSVB 5KHQA 1I35A 3L13A 3WAMA 2O2VA 1V5OA 2FNJB 1P98A 3HHMA 2ZVOA 3ZKJC 2KQ7A 2PJHA 2JT4B 3VTUA 3L08A 3ML8A 4OVVA 2MLBA 2KTFA 2M4NA 2BKFA 3NZUA 5IAAC 2KOXA 1LQBA 1V86A 2V4LA 2KC2A 3ZIMA 1E8WA 2JF5A 3Q3JA 5GMVA 3H7PA 2DZKA 2Z59B 1GNUA 2FUHB 3S2AA 3DBLI 4DHZB 2Y5BB 1WZ0A 5E6PA 3R66C 4CHKA 2MP2A 3KUCB 3V6CB 2IBIB 1WXMA 2MSED 3OAWA 2KKCA 4FBJB 2LUEA 4PS3A 3UQAA 4MEMA 4ZYNA 4G3XB 1WFYA 4IM2A 1UZXB 3VTVA 5KHOA 1BT0A 1PQSA 3H6NA 4EFOA 1Z2MA 2IO1B 2V1YA 4M8MA 3VAWA 1RRBA 4HLEA 2I1JA 3N30A 4E3CA 3NZSA 4WJQA 4FADA 1LM8B 3PLVA 3ZLZA 1TBEA 3UQBA 2K25A 2WYQA 5E6OA 1SE9A 3PRZA 1C1YB 4ANUA 1V49A 1WXSA 4B95A 3TL5A 1E5WA 3PRPB 3DVNV 3KH0A 1X1MA 1WJNA 4AJWA 4MSQB 2HJ8A 4KVGB 3R3MA 4JL9A 2MP2B 4WWOA 3OJ3A 3PPAA 4TUUA 2WX0A 3VVWB 3UINB 4AUQC 2ZCBA 4TQ0A 5JHBA 1V5TA 3IFWB 3PLUA 1V9JA 4W9CA 2M17A 1P3QU 1WRDB 1GC7A 2LRWA 2NPTB 3PREA 4WAAA 4K7SA 4NNJB 4ZRJA 2RR9A 4IM3A 4BKSA 1OEYJ 3VUXA 3TCAA 5JZEB 2I1KA 3QWZB 4P7IA 2D11A 2KXJA 1WGHA 4DWFA 2CKHB 2JXXA 2GMIC 4HDQA 2CS4A 2DYBA 1H8CA 5AZHA 3P2BA 2LZ6A 2PEAA 3QHTA 2K1FA 1WR6E 1EUVB 2BYEA 3DVNU 3SDLC 2G3QB 4W9IA 3ENEA 3M95A 3N32A 3U7DA 1WY8A 5L95C 2DX5B 3JW0X 4NJ6A 2NBUA 4TKNA 2KX3A 1C3TA 2ZPYA 2FAZA 1MG8A 2KDFB 1FXTB 2LVOA 5EDSA 2IO0B 3EHVA 2A4ZA 2DZIA 1NBFC 2RPQA 3DBRI 3HM6X 4GB9A 2O6VB 1ZGUB 1EO6A 2K39A 2N9PC 3CSTA 1KM7A 3A4RA 4WJNA 2HD5B 5AZFA 4DXAB 4HPLB 3DPDA 4W9EA 3TJPA 2FCSA 4GMVA 3DVGY 5DPTA 3WALA 3BINA 1KLVA 3KYCD 3IVFA 1RFAA 4CO7A 3ZNHB 3GZNI 3DVGX 2N1WA 1UGMA 3RT3B 3T9LA 2J0MA 2MBOA 3AI5A 4GDKA 2CHWA 5CHWA 4FN2A 2KLGA 2M1MA 3PHXB 2IY1B 2BGFA 2KFKA 1V80A 3WIMA 1AARA 2EMTA 2D3GA 2C7NB 3ZTCA 2EKEC 4KSKC 1SIFA 2JRHA 1LFDA 3APCA 2O6VA 2EMSA 3NOBA 3MTNB 2AL3A 5D7GA 2KMCA 3H9DA 3ZDTA 4BFRA 5HKHA 2VRRB 3A9KA 1IYFA 2KQSA 4LJOB 5TR5A 4MGIE 5JH5C 2KNBA 5AZGA 1J19A 1OQYA 5DPSA 3VUWA 4MJSA 1A5RA 3ZNID 2ZCCA 2JZ3B 3JYUA 3TIXA 2HE7A 4PS8A 1WX9A 1WYWB 5DPRA 2IY0B 3RCZA 2MBHA 4BKTA 3DBSA 2K6DB 2CR5A 1GUAB 3Q3FA 4FHKA 3M62B 4K81A 4HK2A 3KW5B 3KYDD 2N1VA 2L00B 3A9JB 4KZCA 3UIPB 4A3OA 3B0AA 4JLCA 4LDTD 1YD8U 1KOTA 1WE7A 3ZNZB 3QARA 1UBQA 2L8JA 2K8BA 3AULA 4FULA 3JSVA 2LXCA 3RULA 2KVRA 2LWPA 4FHJA 4A3PA 3SHQA 1Q1OA 3VHTC 2MX2A 1NDDA 4ZDVA 1WGRA 3QAQA 5LXIB 5JHAA 4HJKA 4MJSB 2LGDA 1HE8A 3H1UA 2D10A 2ASQA 3K9PB 4IM0A 4HVBA 4GN1A 5IA7A 2R2OA 3V62A 2ZJDA 2FIFA 2DZMA 1Z5SB 3H7PB 3VDZA 2NS5A 2Z0EB 3U8ZA 3RYTA 2V3SA 3SD5A 2K8CA 3QA8A 3VQIA 2C5LC 4MELA 4FJZA 1L2NA 1E7UA 3V60A 2KZRA 3DCGA 3WAPA 2KDEB 1EF1A 3QC8B 1V81A 4JQWC 1P1AA 4XZ4A 1L7YA 3RD2A 5C1ZA 2LGYA 3ECIA 4DDGD 3CF6E 4EOYA 3B1LX 4CYEA 3KUZA 3ZRFA 3M63B 2JRIB 1TZ1A 2MBEA 4GOCA 2CHZA 3EFUA 4MDKE 1UD7A 4WJPA 4BBNF 1R4MI 2KJHB 4GDLB 3HM3A 1WIAA 2CHXA 2MWSB 4DK5A 3C0RB 4AOFA 5J18A 3DDCB 2W9NA 3I3TB 4WWPA 3PSEB 1S1QB 4MGYE 2JWZA 2LI5A 1WM3A 3K9OB 4ANVA 1YQBA 3NY5A 2M8SA 3U30A 2L3ZA 3MJWA 3VUYA 4DDID 2LGXA 2XBBC 3ZDMC 1LXDA 4OVUA 2Z0DB 3HK0A 2WX1A 3KVFB 3OJ4B 4ICVA 3PVLA 5D6JB 4URKA 4KV2A 3W1SC 3X0WA 2R2QA 2GBNA 3QX1A 3ZTDA 3A4SC 3ML9A 5G55A 2KJ6A 4ICUA 4B9KA 2J7QB 4HCNB 2ZVNA 2RSUA 2LD9A 4TQ1A 3OLMD 3EC8A 2L0TA 4GDLA 1M94A 4NY0A 5CTRC 4W9DA 2N4FA 4B6WA 1WH3A 2AEHA 4GSWA 2NBWB 2G4SA 4NAWB 3ZRCA 4A20A 4BOZB 4EZKA 4MSMB 3T8MA 2NVUI 5D2MB 3ZO5B 2AYOB 4WWNA 2KK8A 4II2B 1J8CA 2FCMA 4G0NB 2UYZB 3ZNGC 1QZEA 2OOBB 5CHFA 1TGZB 2BF8B 1OEYA 1WZ3A 2DYOA 3AXCA 3L0WB 4K1RB 4W9KA 2J0JA 2KD0A 4BKSD 1P0RA 3KUDB 3QK0A 4MM3A 3GOEA 4ZRKA 3ZUNA 3TMPB 2LVPA 1E8XA 2MBQA 2M0XA 2ZZPB 3SU8X 3R7QA 5G2NA 5J17A 2GOWA 1GG3A 3NS8A 2N7EA 4RMAA 5D94A 2BPSA 2O2VB 1WM2A 3JVZX 3LDZE 4ANXA 4DHJD 2FCQA 2NR2A 1Q5WB 3A33B 2MA9B 4G11A 1XQQA 4NAWA 4RM9A 4DHZE 4EUTA 2A5UA 5J2RA 5LLIA 1WF9A 3UF8A 3LJ3A 3MHSD 2G45B 4XC2A 1G6JA 1KJTA 4W9GA 1RAXA 1E7VA 4GXBA 1OTRB 4GU2A 4I6NB 1RLFA 2KFKB 3R7RA 4DHJB 4WQOB 2YLMA 2ZPNA 3L16A 4W9FA 4YL8A 5FR6A 3QCAA 2C9WB 5CHVC 2MCNB 2FCNA 4GIVA 2XEWA 5DPWA 5BO4B 1JRUA 3VXWA 2PE9A 2GBMA 5CX3A 3PRMB 2D2QA 1WJUA 4KDIC 1TTNA 2KWVB 2JUOA 4F7ZA 3UIOB 4K7UA 2DZJA 3AU5A 2D07B 4FJYA 3RZWC 2L7RA 1VCBA 4BVUC 4FJVB 2NCNA 3EECA 5C23A 4NJ7A 2GBKA 3WA0A 3W1SA 4W9HA 2O6VD 3A1QB 1E8ZA 2ZEQA 3H7SA 2BYFA 3PT2B 4E71A 2J0KA 1YX6B 3RZFA 2KANA 1E90A 1R4NI 2LJ5A 4KIKA 1WXAA 4PYUA 3W1YA 1WJ6A 2DENB 4AJYB 3NHEB 2IO3B 3O65B 4AWJA 4II3B 3L54A 3VH3B 2BYVE 2DYMA 2JZZA 2XK5A 2KHWB 2MBBB 3QJZA 4JGHB 4HPMB 3PHWB 4I6PA 2PPHA 4IWQA 4BBNC 3VFKA 2RD0A 2IZVB 2WDTB 3APDA 2NPTA 1XD3B 1UELA 2KX0A 4AP4C 2OJRA 4BOSC 1F9JA 4GGQA 2MW5A 4ASWC 1YIWA 4BKGA 4LCDE 1V2YA 2ZNVB 2KJRA 2HTHA 3IBEA 4K7WA 3X23A 1ZW7A 2WWZA 3D32A 3VH4B 1GJZA 2KTRB 2K6QA 2N9XA 4LDTB 2DAJA 1T0YA 2UWQA 3APFA 4IG7B 4MH0E 1H4RA 3A1QA 3AU4A 3WAOA 2C60A 4X57B 3ONSA 2MRPA 4IWOA 4KSLC 4FLHA 3ZW3A 3QQ8B 4KIKB 4I6LB 2LRUA 1K8RB 4DBGA 2YVCA 1WE6A 3UGBB 2LVQA 4J6IA 2L05A 1WGYA 1WX7A 1UH6A 1GC6A 4EEWA 4W9JA 2AWTA 4HDOA 4JIOU 2XK5B 1UBIA 1I42A 3HIZA 1WMHB 2L0FA 3IG3A 3RUIB 5DCNA 3WANA 4HWIB 2DHZA 4RM8A
chains in the Genus database with same CATH superfamily
1N63A 5HFYA 4IC7B 4AS1A 4IKGA 3BYTB 4M8NA 1SXTA 3PTFC 1NYQA 2IGDA 1I4QA 1MHHE 2PE6B 2KDBA 2KLCA 2JY6A 5GXGB 3BVMA 3ABVB 1QOBA 2KAJA 1M4VA 1U4AA 2B76B 3L10B 3V6EB 5LXHA 3NRZA 4FA6A 5JXVA 1BXTA 1P9DU 2K8HA 1J7CA 4ANWA 1F52A 2RGFA 1WX8A 2DAFA 4G50A 1WI0A 3PZDA 1CJEA 1WGGA 3TBLD 2ZNVC 4EKUA 4D2KA 1CK1A 4HCPB 3ZVVA 1EWYC 4IOIE 1QKZA 2KN4A 2KWCA 4F8CB 1YN3A 2GLSA 2OJWA 1Y8RC 2JPHA 4IDIA 3BYYB 2JYEA 3WCQA 1V5OA 4RFBA 4C00A 2INCC 1STEA 3ML8A 3Q8AA 2M4NA 2BKFA 3ZXRA 1MJDA 2KC2A 3ZIMA 2Z59B 2FUHB 3S2AA 1L6VA 1GPXA 3R66C 1I4HA 3KUCB 2IBIB 1WXMA 2MSED 1FRDA 3OAWA 2LUEA 4PS3A 4ZYNA 4HKQA 1BT0A 3H6NA 4EFOA 4HLEA 1FXAA 2I1JA 3NZSA 1HXYD 3ZLZA 3PLVA 1TBEA 2QC8A 5E6OA 3PRZA 1C1YB 1DYQA 3AN1A 3U4EG 1VR9A 3TL5A 1E5WA 5HG2A 3KH0A 1X1MA 4J3OD 2PTLA 3MC8A 2NTTA 2M17A 3N1YC 1GC7A 2RDHA 1SE2A 2RR9A 3VUXA 1R4NB 2I1KA 4P7IA 1RWSA 2D11A 1LGRA 2CKHB 2JXXA 4Q2JA 4HDQA 2CS4A 2DYBA 4C7YA 2KQ4X 2PEAA 3QHTA 1WR6E 1EU4A 3RNAC 1AW7A 3ENEA 1KF6B 3DBRB 2NBUA 2J42A 3N1ZC 5G5HA 1FXTB 3EHVA 3DBRI 2KACA 3HM6X 4GB9A 4K3BA 4WJNA 3DPDA 2JQRB 2FCSA 4GMVA 1KLVA 3IVFA 1FXIA 1RFAA 1ZXIA 4CO7A 2N1WA 5BYSA 2MHJA 2MBOA 4RH6A 3VR9B 2CHWA 4FN2A 2KLGA 3R2TA 3PHXB 1QQRA 2WXJA 3N20C 1N5XA 3ZTCA 2EKEC 2EMSA 4KKJA 1L0YB 4PK1A 1EM7A 2M19A 3ZDTA 5EE9A 3W9CB 3A9KA 5FKAC 2E3TA 2KNBA 1OQYA 3VUWA 3JYUA 5DPRA 4ARCA 4DXFA 2CR5A 4FHKA 3KYDD 3A9JB 2LUMA 3B0AA 1P7FA 1XLNA 3DWGC 2QSDA 3QARA 3AULA 2K8BA 1ZPSA 2LXCA 3RULA 1Q1OA 3VHTC 2MX2A 1WGRA 1GB4A 2WDVB 4LNNA 2ZJDA 3U8ZA 2WXPA 3SD5A 1P7EA 3P4RB 1WRIA 1E7UA 3WAPA 2KDEB 2KMMA 1V81A 4WURA 3ZJVA 5EE0A 1SBBB 4DDGD 3Q8FA 3B1LX 1TKEA 5IP4D 2PVOD 1UD7A 4WJPA 4P16A 1R4MI 2KJHB 1VZ6A 1MPEA 4AOFA 5J18A 4P1BC 3I3TB 4WWPA 3PSEB 1WM3A 4OZAA 1LXDA 2Z0DB 1UWXA 3OJ4B 4URKA 5D6JB 3UI3A 3QX1A 1ZXHA 2LGIA 1C77A 3ML9A 4ICUA 1TJEA 2ZVNA 1NYRA 2OEDA 2L0TA 1M94A 4DXGA 4HPPA 2L83A 4GSWA 3ZRCA 4BOZB 3T8MA 2AYOB 2LFIA 1C9FA 3DWMA 2BF8B 4K1RB 3AXCA 3L0WB 3KWLA 4ZRKA 4MM3A 3GOEA 2TSSA 1IBXA 1L0VB 1E8XA 3R7QA 5J17A 2GOWA 1GG3A 3TEWA 3BK2A 1F77A 2WDQB 3KQ4A 2MA9B 4EUTA 4DHZE 2A5UA 4YSXB 3UF8A 2VZKB 3AMZA 3LXFA 5HI1A 3DHHC 1G6JA 1KH0A 2LJIA 2KFKB 2BW2A 1JALA 4YL8A 5FR6A 3ZJTA 5CHVC 4PT5A 2GBMA 3OWEB 3PRMB 2JUOA 4F7ZA 3UIOB 2D07B 1VCBA 1JWSD 2GBKA 4W9HA 2ZEQA 2J0KA 1YX6B 2WS3B 3RZFA 3W1YA 4KIKA 4PYUA 1WJ6A 2DENB 1YNTE 5HHDG 2IO3B 3O65B 2QCZA 3L54A 2BYVE 3VRAB 1QF6A 2MBBB 4OW0A 4HPMB 4I6PA 2G9HD 1ESFA 4B0EA 3VFKA 2RD0A 2WDTB 3APDA 2HDEA 1ROEA 2OJRA 4M02A 1Q10A 2DBYA 2ZNVB 2KJRA 4K7WA 2WWZA 2RDGA 1ZDVA 2K6QA 2N9XA 4LDTB 1T0YA 4IG7B 3APFA 1N61A 4KSLC 3ONSA 3QQ8B 2LRUA 1JQ4A 3Q8EA 2YVCA 1WX7A 4EEWA 3HIZA 2L0FA 3IG3A 3PGEA 4RGTA 1NI2A 3DBHI 1VLBA 2KDIA 3BWUD 2LASA 2KTRA 1WXVA 2G4DB 2HTME 1I4XA 4EZLA 4PS7A 2WGSA 1E7PB 4NQLB 2V0GA 1ZDXA 3B2FA 3U52E 3HVZA 3V61A 3CSFA 1WMHA 4YSZB 1YN5A 2C7MB 4M0WB 1IUEA 1DOIA 4A6QA 3ZGZA 1HZ6A 3NVVA 2CU1A 4W9LA 2WHIA 4LJPB 2IYDB 1T0QC 2SEBD 1V6EA 3IHPC 2BKRB 3A9KB 2KWUB 5BYQA 1HZ5A 1F2RI 4PYZA 2IO2B 2WXGA 4XX5A 2KN5A 4KZ0A 2MJ3A 1TKYA 4WIPA 2LMCA 2N7DA 1ET6A 2L76A 4TV3A 2N9EB 2PKOA 3A9JA 2V3NA 3DOWA 1AN8A 2WXIA 2BWES 3PV1A 2WQYB 1K50A 3JSVB 4XWTA 1I35A 1MI0A 1TS4A 1T5XD 3Q8BA 1JWAD 3HHMA 2JSVX 1KRHA 1OFFA 2KTFA 3BVGA 2KOXA 2V4LA 1E8WA 2JF5A 5GMVA 1LO5D 3BK1A 1GNUA 2Y5BB 2NMQA 3V6CB 1HTQA 3AE1B 3B2GA 3UQAA 4HKZE 3VTVA 5C3JB 1Z2MA 3VAWA 4R3DA 4YWGG 1V1OA 4ITKA 4WJQA 1FCLA 2WYQA 3RFZB 1WXSA 1PDXA 1WGKA 1FNVA 3DVNV 1BMLC 4AJWA 2HJ8A 4JL9A 2MP2B 4S17A 3OJ3A 3UINB 4AUQC 5JHBA 1JRPA 1V5TA 1V9JA 4W9CA 4LNOA 4NNJB 4WQMA 4ZRJA 4BKSA 1OEYJ 3TCAA 5JZEB 3QWZB 3P2BA 2LZ6A 3AEEB 2K1FA 1D5MC 2BYEA 4AQ7A 3SDLC 4LNFA 3N32A 1D6EC 1FFUA 4TKNA 1B1ZA 3EA6A 1T0SC 2BS3B 2A4ZA 2DZIA 3AE7B 2O6VB 1ZGUB 3PZ7A 4YTNB 2L1AA 2HD5B 2K5PA 5AZFA 1PYWD 3EUB2 5DPTA 3WALA 4WAFA 1F0ZA 4QAYA 3Q3NC 1B9RA 3GZNI 4JWSC 1UGMA 5TSSA 3T9LA 2J0MA 2VH2A 2CJOA 4GDKA 4XDDA 1GOZA 2M1MA 3GZNB 2KFKA 3WIMA 1AARA 1CQVA 3GB1A 3NOBA 3MTNB 4RF0A 1J7BA 4BFRA 2VRRB 3J9CA 1IYFA 5JH5C 5AZGA 3ZNID 2JZ3B 2XN9C 3TIXA 3RCZA 2K6DB 3Q3FA 4HK2A 4KZCA 3UIPB 4A3OA 1I7HA 2WXHA 3ZJUA 1KOTA 1WE7A 1UBQA 2WXMA 4N59A 2X8XX 4FHJA 2AQ1B 1IGDA 2WU5B 5FR3A 4ZDVA 4HJKA 2LGDA 2D10A 3NS1A 2WDRB 3K9PB 4IM0A 3HUIA 4HVBA 2ACZB 3H7PB 4REZA 2Z0EB 2K8CA 2C5LC 4MELA 1L2NA 3V60A 2KZRA 2BYTA 1OQQA 4JQWC 2DNFA 1L7YA 5FK9C 2H89B 2MJDA 3CF6E 4EOYA 4CYEA 1I4GA 5H8YE 4GOCA 2IJ0A 4N58A 4WWMA 4GDLB 1WIAA 2CHXA 2MWSB 4DK5A 4XWWA 3DDCB 2PLPA 2LI5A 1YQBA 1EWCA 2WLBA 4ZYSA 3NY5A 2L3ZA 3ZDMC 3SEBA 3R2IA 3HK0A 2WX1A 3C8YA 3KVFB 1E9MA 4ICVA 2YEPF 3P63A 3X0WA 1ACCA 3AEAB 4RCOA 3P4QB 1C4CA 5BMIA 4C56C 2RSUA 4TQ1A 3OLMD 2D3CA 3FC4A 1HTOA 5CTRC 4W9DA 3FAHA 2MJEA 2NBWB 4OZBA 3Q3MC 1VZ7A 1YOVB 3AM9A 2NVUI 5D2MB 4C4VA 4II2B 1J8CA 2BTEA 3P1MA 4G0NB 1QZEA 5CHFA 2DYOA 1WZ3A 4W9KA 2G1EA 3AE3B 3U7ZA 2BPSA 3JVZX 4ANXA 1YMHE 1N6ZA 1Q5WB 1TS5A 4G11A 1XQQA 4NAWA 5J2RA 1YQ3B 1WF9A 2EKIA 1YJJA 3MHSD 2JX5A 3L4PA 2BS4B 4L1BA 1E7VA 2DWQA 1SIJA 2BVCA 1MHXA 2YLMA 4W9FA 3QCAA 2C9WB 1TYGB 1JRUA 2WXQA 3VXWA 2D2QA 2LHDA 1TTNA 2DZJA 1PGBA 4BVUC 2NCNA 2CJNA 3IAM1 2FUG1 3H7SA 4E71A 1ZUD2 1E90A 1R4NI 2KANA 4JWUC 5IOIA 3SR6A 2RPVA 2SAKA 5T8IA 2X38A 2DYMA 1N62A 2JZZA 1SJED 1F2RC 1SSNA 5LNK1 2V4IB 1XD3B 1HQRD 2IPKD 4BOSC 4GGQA 1YIWA 3DBHB 4BKSD 2HTHA 5AUIA 5I4DA 2UWQA 2K3UA 1YJIA 3A1QA 1FEHA 4IWOA 4FLHA 3ZW3A 2L32A 3GE3C 1NVID 1K8RB 4NJCA 1SF0A 2JXTA 2LVQA 2L05A 1FIQA 4W9JA 2AWTA 1UBIA 5E6JA 1RM6C 3RUIB 1NEKB 2LEKA 4RM8A 4M0WA 4K3CA 5BMHA 1FNUA 4MACA 4WJOA 2QHOA 1QOAA 2KVZA 5MPOA 4YTMB 4HXDA 1J0GA 2INPE 3B08A 2ICIA 1JWUD 3PS6A 2INNE 3FILA 1PUTA 2GBRA 1IGCA 1E8YA 1QOFA 1VD2A 3B9JA 4XDCA 2AL6A 3I57A 4GDKB 4GLSC 2BWFA 4ZRIA 4RGMA 3NUHB 5AEKB 1YJ1A 2BBCA 1OGWA 4XE0A 3KLSX 3MC0B 4NQKE 1SB3C 1WR1A 1XT9B 1L4ZB 1EF5A 2C7HA 2W54A 4IWPA 3RPFC 5L83A 2NTSA 2MQJA 4NPNA 3L17A 2BQQA 2KFJA 3SFDB 1Q0WB 2FIDA 1FD6A 2B3AA 5G5GA 1JMLA 3ETRA 3L13A 2BB6A 2FNJB 1QT9A 1C76A 3ZKJC 3P4SB 2PJHA 2JT4B 4OVVA 2WU2B 3NG0A 1V1PB 3NZUA 5IAAC 2BT6A 1LQBA 1V86A 4NAMA 3U2SC 1MVKA 3Q3JA 4RF1A 3H7PA 2IGGA 3DBLI 1WZ0A 1KTKA 2ONQA 4CHKA 2MP2A 2PW9A 3MP9A 2KKCA 4DQOC 4KKIA 4FBJB 4MEMA 2J53A 1D5ZC 3RNCC 1WFYA 3E56A 4WH4A 1UZXB 5KHOA 1RYJA 3OG5A 2IO1B 3MC9A 3N30A 2KWDA 1T0RC 4FADA 1LM8B 1JW9D 2K25A 3AH7A 4ANUA 1V49A 3PRPB 4ZRPA 1WJNA 1E10A 1TS2A 4WWOA 2BB5A 3PPAA 2N9KA 2WX0A 2ZW1A 4TQ0A 2ZCBA 1HA5A 3ZYYX 3IFWB 2QDFA 4S0RA 2LHEA 2FBWB 3PREA 4K7SA 4WAAA 1DGJA 3Q3OC 2KXJA 1D5XC 1WGHA 4DWFA 1DOYA 2VZKD 1GAQB 1H8CA 5AZHA 1TY2A 1FO4A 1KLGD 5C2TB 4L23A 3Q69A 3U7DA 5L95C 2DX5B 3JW0X 4LNIA 4NJ6A 2KX3A 1OQRA 1C3TA 3IT6B 2GI9A 2FAZA 1MG8A 4HEA1 3NJTA 1ZP0B 3DHGC 5H92C 3DHIC 2IDYA 2K39A 1EO6A 3CSTA 3A4RA 2WXNA 1L6UA 4DXAB 1VDVA 3BZDB 2W3SA 3KYCD 4FXCA 2HJ1A 3ZNHB 3BVZA 1DOXA 4LTUA 4JX1C 4M01A 3RT3B 2L52A 1CZPA 4L2YA 5CHWA 2IY1B 1V80A 4US9A 1QOGA 2C7NB 4KSKC 1SIFA 3APCA 2O6VA 2AL3A 2KMCA 3H9DA 4KX6B 1SJHD 5TR5A 1I4PA 3RN9C 1J19A 5DPSA 4MJSA 2ZCCA 3LB8C 4LNKA 3NVZA 1WX9A 1WYWB 2IY0B 4BKTA 3DBSA 1GUAB 4K81A 3M62B 2N1VA 1JWBD 4LDTD 1UWMA 1YD8U 3ZXVA 3JSVA 2KVRA 2LWPA 4A3PA 1NDDA 3QAQA 5LXIB 3RNGC 5JHAA 1C4PA 1HE8A 4CQNA 4GN1A 5IA7A 3TEXA 3V62A 1K51A 3Q2AC 1AWDA 1Z5SB 3VDZA 3SFEB 2WXLA 3VQIA 4FJZA 1Y56A 1EF1A 1EU3A 1P1AA 4OVZA 4XZ4A 5C1ZA 5D3DA 3ECIA 2E6XA 3EFCA 4JPSA 4BZAA 3M63B 4LK0M 1TZ1A 3TEYA 2CHZA 3EFUA 4BBNF 4H2AA 3HM3A 3C0RB 4A9AA 1S1QB 2JWZA 3I63C 3K9OB 4TSSA 1N60A 5BYRA 3MJWA 3U30A 1L4DB 1SEBD 2LGXA 2XBBC 2N7JA 2V3PA 3NVYA 4NZLB 4KV2A 2R2QA 3ZTDA 3A4SC 3KWVA 3PZ8A 5G55A 4B9KA 2J7QB 1XCQL 1TY0A 4GDLA 1WSPA 1NENB 4NY0A 3AEDB 2R61A 1A70A 4A20A 4NAWB 3TEZA 4MSMB 3VRBB 1E6EB 3ZO5B 4A90A 3R8BA 4WWNA 1I4RA 1HEZE 3ZNGC 2QILA 2OOBB 1TGZB 1UGJA 2J0JA 2KD0A 1SE3A 1P0RA 3IXSA 2LVPA 2ZZPB 1VJKA 2M0XA 3SU8X 3NS8A 4RMAA 1NI3A 3LDZE 3GP7A 1TIFA 4A55A 4ACFA 4BAXA 2JU6X 1MG4A 2EELA 1FRRA 1UUPA 4XC2A 4W9GA 3Q8CA 4GXBA 1OTRB 4MH8A 4DHJB 4KGSA 4ZOHC 1TT5B 2ZPNA 2QMTA 3L16A 2GB1A 2FCNA 5DPWA 5BO4B 2MEKA 2PE9A 1WJUA 4KDIC 2CU3A 2KWVB 4K7UA 3AU5A 1XLOA 2L7RA 4FJVB 3EECA 4YT0B 4NJ7A 3A1QB 1E8ZA 2BYFA 1E0ZA 2AQ2B 1UF0A 1WXAA 4RGNA 1AYFA 4AJYB 4AWJA 4II3B 3VH3B 2XK5A 4JGHB 2PPHA 4BBNC 1T3QA 2W82A 4ZRQA 3ZQ4A 1UELA 2KX0A 4AP4C 1F9JA 4ASWC 1T6BX 3CIRB 3IBEA 3P4PB 3VH4B 2K22A 4MH0E 3WAOA 2Z8LA 4X57B 4C7ZA 4I6LB 4US8A 3UGBB 1UH6A 3AE9B 1GC6A 4HDOA 1I42A 2WXRA 4JE3B 1XF5L 3WANA 3IT4B 5DCNA 1IPGA 3NVWA 4MGKE 4EZJA 1ZKHA 1YX5B 5E6NA 3H8HA 2REXA 1ISNA 2W3RA 4F1SA 2KMAA 2J4XA 2WXOA 3CMMB 2ON8A 3GE8C 1UNSA 1IP9A 2LXAA 1D3ZA 3AE5B 3QIJA 4KDLB 4MGZE 3T3NA 2KO3A 1TS3A 3M3JA 3FKYA 1S3SG 3ALBA 2JVCA 4M00A 3W5UB 3N3KB 3V05A 1SGHA 4IUMB 4UDUC 3RMKC 1TKGA 1CMXB 3VTWA 3I5JC 1WGDA 4E74A 3DQVA 3BY4B 4IW0A 4RNAA 4N9F4 3FILB 1R4MB 1V1PA 2GBJA 4C4VB 2NBVB 3P42A 1WJ4A 3DBLB 2PMVA 4C80A 3T3OA 2KC1A 5KHQA 1J7AA 4XYCA 2M0AA 3WAMA 2O2VA 1KLUD 1P98A 2ZVOA 2KQ7A 3PO0A 3VTUA 3L08A 2MLBA 2J52A 2DZKA 5IKCM 4DHZB 5E6PA 3Q6BA 2N0SB 4G3XB 1XXGA 2I38A 4IM2A 1TZOA 1XCTL 1PQSA 3I9V1 2V1YA 4M8MA 1RRBA 1JCKB 3EGRA 2I2YA 4E3CA 3UQBA 1SE9A 2RDBC 2M56B 3AE4B 2Y3AA 4B95A 2MH7A 3CWIA 4MSQB 1C79A 4KVGB 3R3MA 4KGTA 1RFKA 4TUUA 3VVWB 3PLUA 2NPTB 1P3QU 1WRDB 2LRWA 3N9YC 4IM3A 1XLQA 3IAS1 2GMIC 1YN4A 3URYA 2ZW0A 1FNWA 3AE6B 5EE1A 1EUVB 3DVNU 1KFYB 2G3QB 4W9IA 3M95A 4YTPB 1C78A 1WY8A 2RMMA 2ZPYA 1F1HA 2KDFB 2LVOA 5EDSA 2KYWA 2IO0B 1NBFC 1YQ4B 2RPQA 1IBXB 2N9PC 2WXFA 3V3XA 1KM7A 3AECB 3N1XC 2AX5A 2QEJC 3HVDA 5BMGA 4HPLB 4W9EA 3TJPA 4USAA 3DVGY 3BINA 1K52A 1D4BA 1V8CA 4OZCA 1VRAB 2D3AA 3DVGX 2IGHA 2WNMA 2LGSA 1XLPA 3AI5A 4KGRA 4ZHOA 2BGFA 4RGOS 2EMTA 2D3GA 3AV8A 3MJ5A 4P1CC 2JRHA 1LFDA 4HJGE 1N5WA 4EE2A 5D7GA 4ARIA 3E9SA 5HKHA 1ET9A 2KQSA 4LJOB 4O1NA 4MGIE 2QIEB 1A5RA 2HE7A 4PS8A 2MBHA 1QLBB 1WWTA 3KW5B 2L00B 4JLCA 4XGAB 1WYGA 2PVGC 2FE8A 3ZNZB 4FULA 2L8JA 2UU7A 3Q14C 2Y5CA 5D3IB 3SHQA 4MJSB 1ZOYB 3H1UA 2ASQA 4YSYB 2R2OA 2FIFA 2DZMA 2NS5A 3RYTA 2V3SA 1FPYA 3QA8A 1L5PA 3DCGA 3QC8B 4LLGM 3RD2A 2LGYA 3KUZA 3ZRFA 2JRIB 2MBEA 4MDKE 4P6VF 1BUIC 4B0MA 4A8XC 4ZHPA 2JZPA 2N9LA 2W9NA 2Q5WD 1L0XB 2JWUA 4MGYE 3AE2B 1XEEA 4ANVA 3VUYA 2M8SA 4DDID 5AUKA 1WXQA 4OVUA 1FM0D 3TSSA 3PVLA 3W1SC 1PFDA 3LYYA 2GBNA 3AEBB 4MM3B 1K53A 2KJ6A 2KDMA 4HCNB 2VH1A 2LD9A 1FCCC 3EC8A 2QJLA 2H88B 2OHFA 2N4FA 3AE8B 4B6WA 1WH3A 2AEHA 2INDC 2G4SA 2PIAA 4EZKA 2WXKA 2KK8A 2FCMA 2UYZB 2GRIA 1GB1A 1OEYA 3MFGA 3KUDB 3QK0A 2XNAC 3ZUNA 3TMPB 2MBQA 3O13A 3AB5A 1PGXA 5G2NA 2K9XA 2N7EA 4YXDB 5D94A 2O2VB 1WM2A 1V97A 4DHJD 2FCQA 2NR2A 3A33B 1VZ8A 5EE3A 3W2DA 3RNBC 4RM9A 5LLIA 1FMAD 2YEPB 3AEGB 3LJ3A 2G45B 1KJTA 1RAXA 2AQ3B 4I6NB 1ZE3D 4GU2A 1RLFA 3R7RA 4WQOB 2K0PA 1ENFA 4HROA 3W5VB 2MCNB 4OHJA 4GIVA 2XEWA 3C19A 2D3BA 4N6EB 3RI7C 5CX3A 4MT5A 1MFWA 4FJYA 3RZWC 1C4AA 3GS2A 2W55A 5C23A 3WA0A 3W1SA 2O6VD 3NZ3A 3PT2B 2LJ5A 2DLBA 3NHEB 2KHWB 3AEFB 3QJZA 3PHWB 4IWQA 2Y5PA 1JROA 2JYTA 2IZVB 2NPTA 5IN7A 2MW5A 4BKGA 4LCDE 1V2YA 3TUOA 3X23A 1ZW7A 1GJZA 2BS2B 3D32A 2KTRB 2V9HA 2DAJA 3MHZA 3VR8B 4HRSA 1H4RA 3AU4A 1FFVA 2D5GA 2C60A 2WP9B 3HRDD 3RNEC 2MRPA 1XO3A 3BIID 1JWMD 1SE4A 4TMAB 4KIKB 1R7SA 4DBGA 1WE6A 2KT7A 4J6IA 1WGYA 1PGAA 1QILA 4JIOU 2XK5B 5IO9A 1WMHB 4HWIB 2DHZA 3RNFC
chains in the Genus database with same CATH topology
1IPGA 4IC7B 4MGKE 4WJOA 4EZJA 1ZKHA 1YX5B 3PGEA 1NI2A 2QHOA 3DBHI 4M8NA 5E6NA 2REXA 1ISNA 2KDIA 2LASA 4F1SA 2KMAA 2KTRA 3PTFC 4HXDA 1WXVA 3CMMB 1J0GA 2G4DB 3B08A 1IP9A 2LXAA 3PS6A 4EZLA 1D3ZA 3QIJA 4PS7A 4KDLB 2PE6B 2KDBA 4MGZE 2KLCA 4NQLB 2JY6A 2GBRA 2KO3A 1E8YA 3M3JA 1S3SG 1VD2A 3ALBA 3V61A 2JVCA 2AL6A 1U4AA 1WMHA 3CSFA 4GDKB 3L10B 2BWFA 4ZRIA 3V6EB 2C7MB 3N3KB 5AEKB 4M0WB 5LXHA 4FA6A 1SGHA 1P9DU 2K8HA 4IUMB 4ANWA 1YJ1A 2CU1A 1OGWA 2RGFA 4W9LA 1WX8A 2IYDB 4LJPB 4NQKE 2DAFA 4G50A 1CMXB 1V6EA 1WI0A 3PZDA 3VTWA 1WGDA 4E74A 1WR1A 3DQVA 1XT9B 2BKRB 3A9KB 1WGGA 2KWUB 3IHPC 3BY4B 3TBLD 2ZNVC 4IW0A 4EKUA 4N9F4 1EF5A 4PYZA 2IO2B 4HCPB 4XX5A 2KN5A 4KZ0A 3ZVVA 2GBJA 2KWCA 2C7HA 2NBVB 4F8CB 4IWPA 2N7DA 2L76A 1WJ4A 4TV3A 5L83A 2N9EB 3A9JA 2MQJA 4NPNA 3DOWA 3L17A 2BWES 2KFJA 1Y8RC 1Q0WB 2JPHA 2FIDA 3PV1A 2B3AA 2KC1A 3JSVB 5KHQA 1I35A 3L13A 3WAMA 2O2VA 1V5OA 2FNJB 1P98A 3HHMA 2ZVOA 3ZKJC 2KQ7A 2PJHA 2JT4B 3VTUA 3L08A 3ML8A 4OVVA 2MLBA 2KTFA 2M4NA 2BKFA 3NZUA 5IAAC 2KOXA 1LQBA 1V86A 2V4LA 2KC2A 3ZIMA 1E8WA 2JF5A 3Q3JA 5GMVA 3H7PA 2DZKA 2Z59B 1GNUA 2FUHB 3S2AA 3DBLI 4DHZB 2Y5BB 1WZ0A 5E6PA 3R66C 4CHKA 2MP2A 3KUCB 3V6CB 2IBIB 1WXMA 2MSED 3OAWA 2KKCA 4FBJB 2LUEA 4PS3A 3UQAA 4MEMA 4ZYNA 4G3XB 1WFYA 4IM2A 1UZXB 3VTVA 5KHOA 1BT0A 1PQSA 3H6NA 4EFOA 1Z2MA 2IO1B 2V1YA 4M8MA 3VAWA 1RRBA 4HLEA 2I1JA 3N30A 4E3CA 3NZSA 4WJQA 4FADA 1LM8B 3PLVA 3ZLZA 1TBEA 3UQBA 2K25A 2WYQA 5E6OA 1SE9A 3PRZA 1C1YB 4ANUA 1V49A 1WXSA 4B95A 3TL5A 1E5WA 3PRPB 3DVNV 3KH0A 1X1MA 1WJNA 4AJWA 4MSQB 2HJ8A 4KVGB 3R3MA 4JL9A 2MP2B 4WWOA 3OJ3A 3PPAA 4TUUA 2WX0A 3VVWB 3UINB 4AUQC 2ZCBA 4TQ0A 5JHBA 1V5TA 3IFWB 3PLUA 1V9JA 4W9CA 2M17A 1P3QU 1WRDB 1GC7A 2LRWA 2NPTB 3PREA 4WAAA 4K7SA 4NNJB 4ZRJA 2RR9A 4IM3A 4BKSA 1OEYJ 3VUXA 3TCAA 5JZEB 2I1KA 3QWZB 4P7IA 2D11A 2KXJA 1WGHA 4DWFA 2CKHB 2JXXA 2GMIC 4HDQA 2CS4A 2DYBA 1H8CA 5AZHA 3P2BA 2LZ6A 2PEAA 3QHTA 2K1FA 1WR6E 1EUVB 2BYEA 3DVNU 3SDLC 2G3QB 4W9IA 3ENEA 3M95A 3N32A 3U7DA 1WY8A 5L95C 2DX5B 3JW0X 4NJ6A 2NBUA 4TKNA 2KX3A 1C3TA 2ZPYA 2FAZA 1MG8A 2KDFB 1FXTB 2LVOA 5EDSA 2IO0B 3EHVA 2A4ZA 2DZIA 1NBFC 2RPQA 3DBRI 3HM6X 4GB9A 2O6VB 1ZGUB 1EO6A 2K39A 2N9PC 3CSTA 1KM7A 3A4RA 4WJNA 2HD5B 5AZFA 4DXAB 4HPLB 3DPDA 4W9EA 3TJPA 2FCSA 4GMVA 3DVGY 5DPTA 3WALA 3BINA 1KLVA 3KYCD 3IVFA 1RFAA 4CO7A 3ZNHB 3GZNI 3DVGX 2N1WA 1UGMA 3RT3B 3T9LA 2J0MA 2MBOA 3AI5A 4GDKA 2CHWA 5CHWA 4FN2A 2KLGA 2M1MA 3PHXB 2IY1B 2BGFA 2KFKA 1V80A 3WIMA 1AARA 2EMTA 2D3GA 2C7NB 3ZTCA 2EKEC 4KSKC 1SIFA 2JRHA 1LFDA 3APCA 2O6VA 2EMSA 3NOBA 3MTNB 2AL3A 5D7GA 2KMCA 3H9DA 3ZDTA 4BFRA 5HKHA 2VRRB 3A9KA 1IYFA 2KQSA 4LJOB 5TR5A 4MGIE 5JH5C 2KNBA 5AZGA 1J19A 1OQYA 5DPSA 3VUWA 4MJSA 1A5RA 3ZNID 2ZCCA 2JZ3B 3JYUA 3TIXA 2HE7A 4PS8A 1WX9A 1WYWB 5DPRA 2IY0B 3RCZA 2MBHA 4BKTA 3DBSA 2K6DB 2CR5A 1GUAB 3Q3FA 4FHKA 3M62B 4K81A 4HK2A 3KW5B 3KYDD 2N1VA 2L00B 3A9JB 4KZCA 3UIPB 4A3OA 3B0AA 4JLCA 4LDTD 1YD8U 1KOTA 1WE7A 3ZNZB 3QARA 1UBQA 2L8JA 2K8BA 3AULA 4FULA 3JSVA 2LXCA 3RULA 2KVRA 2LWPA 4FHJA 4A3PA 3SHQA 1Q1OA 3VHTC 2MX2A 1NDDA 4ZDVA 1WGRA 3QAQA 5LXIB 5JHAA 4HJKA 4MJSB 2LGDA 1HE8A 3H1UA 2D10A 2ASQA 3K9PB 4IM0A 4HVBA 4GN1A 5IA7A 2R2OA 3V62A 2ZJDA 2FIFA 2DZMA 1Z5SB 3H7PB 3VDZA 2NS5A 2Z0EB 3U8ZA 3RYTA 2V3SA 3SD5A 2K8CA 3QA8A 3VQIA 2C5LC 4MELA 4FJZA 1L2NA 1E7UA 3V60A 2KZRA 3DCGA 3WAPA 2KDEB 1EF1A 3QC8B 1V81A 4JQWC 1P1AA 4XZ4A 1L7YA 3RD2A 5C1ZA 2LGYA 3ECIA 4DDGD 3CF6E 4EOYA 3B1LX 4CYEA 3KUZA 3ZRFA 3M63B 2JRIB 1TZ1A 2MBEA 4GOCA 2CHZA 3EFUA 4MDKE 1UD7A 4WJPA 4BBNF 1R4MI 2KJHB 4GDLB 3HM3A 1WIAA 2CHXA 2MWSB 4DK5A 3C0RB 4AOFA 5J18A 3DDCB 2W9NA 3I3TB 4WWPA 3PSEB 1S1QB 4MGYE 2JWZA 2LI5A 1WM3A 3K9OB 4ANVA 1YQBA 3NY5A 2M8SA 3U30A 2L3ZA 3MJWA 3VUYA 4DDID 2LGXA 2XBBC 3ZDMC 1LXDA 4OVUA 2Z0DB 3HK0A 2WX1A 3KVFB 3OJ4B 4ICVA 3PVLA 5D6JB 4URKA 4KV2A 3W1SC 3X0WA 2R2QA 2GBNA 3QX1A 3ZTDA 3A4SC 3ML9A 5G55A 2KJ6A 4ICUA 4B9KA 2J7QB 4HCNB 2ZVNA 2RSUA 2LD9A 4TQ1A 3OLMD 3EC8A 2L0TA 4GDLA 1M94A 4NY0A 5CTRC 4W9DA 2N4FA 4B6WA 1WH3A 2AEHA 4GSWA 2NBWB 2G4SA 4NAWB 3ZRCA 4A20A 4BOZB 4EZKA 4MSMB 3T8MA 2NVUI 5D2MB 3ZO5B 2AYOB 4WWNA 2KK8A 4II2B 1J8CA 2FCMA 4G0NB 2UYZB 3ZNGC 1QZEA 2OOBB 5CHFA 1TGZB 2BF8B 1OEYA 1WZ3A 2DYOA 3AXCA 3L0WB 4K1RB 4W9KA 2J0JA 2KD0A 4BKSD 1P0RA 3KUDB 3QK0A 4MM3A 3GOEA 4ZRKA 3ZUNA 3TMPB 2LVPA 1E8XA 2MBQA 2M0XA 2ZZPB 3SU8X 3R7QA 5G2NA 5J17A 2GOWA 1GG3A 3NS8A 2N7EA 4RMAA 5D94A 2BPSA 2O2VB 1WM2A 3JVZX 3LDZE 4ANXA 4DHJD 2FCQA 2NR2A 1Q5WB 3A33B 2MA9B 4G11A 1XQQA 4NAWA 4RM9A 4DHZE 4EUTA 2A5UA 5J2RA 5LLIA 1WF9A 3UF8A 3LJ3A 3MHSD 2G45B 4XC2A 1G6JA 1KJTA 4W9GA 1RAXA 1E7VA 4GXBA 1OTRB 4GU2A 4I6NB 1RLFA 2KFKB 3R7RA 4DHJB 4WQOB 2YLMA 2ZPNA 3L16A 4W9FA 4YL8A 5FR6A 3QCAA 2C9WB 5CHVC 2MCNB 2FCNA 4GIVA 2XEWA 5DPWA 5BO4B 1JRUA 3VXWA 2PE9A 2GBMA 5CX3A 3PRMB 2D2QA 1WJUA 4KDIC 1TTNA 2KWVB 2JUOA 4F7ZA 3UIOB 4K7UA 2DZJA 3AU5A 2D07B 4FJYA 3RZWC 2L7RA 1VCBA 4BVUC 4FJVB 2NCNA 3EECA 5C23A 4NJ7A 2GBKA 3WA0A 3W1SA 4W9HA 2O6VD 3A1QB 1E8ZA 2ZEQA 3H7SA 2BYFA 3PT2B 4E71A 2J0KA 1YX6B 3RZFA 2KANA 1E90A 1R4NI 2LJ5A 4KIKA 1WXAA 4PYUA 3W1YA 1WJ6A 2DENB 4AJYB 3NHEB 2IO3B 3O65B 4AWJA 4II3B 3L54A 3VH3B 2BYVE 2DYMA 2JZZA 2XK5A 2KHWB 2MBBB 3QJZA 4JGHB 4HPMB 3PHWB 4I6PA 2PPHA 4IWQA 4BBNC 3VFKA 2RD0A 2IZVB 2WDTB 3APDA 2NPTA 1XD3B 1UELA 2KX0A 4AP4C 2OJRA 4BOSC 1F9JA 4GGQA 2MW5A 4ASWC 1YIWA 4BKGA 4LCDE 1V2YA 2ZNVB 2KJRA 2HTHA 3IBEA 4K7WA 3X23A 1ZW7A 2WWZA 3D32A 3VH4B 1GJZA 2KTRB 2K6QA 2N9XA 4LDTB 2DAJA 1T0YA 2UWQA 3APFA 4IG7B 4MH0E 1H4RA 3A1QA 3AU4A 3WAOA 2C60A 4X57B 3ONSA 2MRPA 4IWOA 4KSLC 4FLHA 3ZW3A 3QQ8B 4KIKB 4I6LB 2LRUA 1K8RB 4DBGA 2YVCA 1WE6A 3UGBB 2LVQA 4J6IA 2L05A 1WGYA 1WX7A 1UH6A 1GC6A 4EEWA 4W9JA 2AWTA 4HDOA 4JIOU 2XK5B 1UBIA 1I42A 3HIZA 1WMHB 2L0FA 3IG3A 3RUIB 5DCNA 3WANA 4HWIB 2DHZA 4RM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IPG A;  4IC7 B;  4MGK E;  4WJO A;  4EZJ A;  1ZKH A;  1YX5 B;  3PGE A;  1NI2 A;  2QHO A;  3DBH I;  4M8N A;  5E6N A;  2REX A;  1ISN A;  2KDI A;  2LAS A;  4F1S A;  2KMA A;  2KTR A;  3PTF C;  4HXD A;  1WXV A;  3CMM B;  1J0G A;  2G4D B;  3B08 A;  1IP9 A;  2LXA A;  3PS6 A;  4EZL A;  1D3Z A;  3QIJ A;  4PS7 A;  4KDL B;  2PE6 B;  2KDB A;  4MGZ E;  2KLC A;  4NQL B;  2JY6 A;  2GBR A;  2KO3 A;  1E8Y A;  3M3J A;  1S3S G;  1VD2 A;  3ALB A;  3V61 A;  2JVC A;  2AL6 A;  1U4A A;  1WMH A;  3CSF A;  4GDK B;  3L10 B;  2BWF A;  4ZRI A;  3V6E B;  2C7M B;  3N3K B;  5AEK B;  4M0W B;  5LXH A;  4FA6 A;  1SGH A;  1P9D U;  2K8H A;  4IUM B;  4ANW A;  1YJ1 A;  2CU1 A;  1OGW A;  2RGF A;  4W9L A;  1WX8 A;  2IYD B;  4LJP B;  4NQK E;  2DAF A;  4G50 A;  1CMX B;  1V6E A;  1WI0 A;  3PZD A;  3VTW A;  1WGD A;  4E74 A;  1WR1 A;  3DQV A;  1XT9 B;  2BKR B;  3A9K B;  1WGG A;  2KWU B;  3IHP C;  3BY4 B;  3TBL D;  2ZNV C;  4IW0 A;  4EKU A;  4N9F 4;  1EF5 A;  4PYZ A;  2IO2 B;  4HCP B;  4XX5 A;  2KN5 A;  4KZ0 A;  3ZVV A;  2GBJ A;  2KWC A;  2C7H A;  2NBV B;  4F8C B;  4IWP A;  2N7D A;  2L76 A;  1WJ4 A;  4TV3 A;  5L83 A;  2N9E B;  3A9J A;  2MQJ A;  4NPN A;  3DOW A;  3L17 A;  2BWE S;  2KFJ A;  1Y8R C;  1Q0W B;  2JPH A;  2FID A;  3PV1 A;  2B3A A;  2KC1 A;  3JSV B;  5KHQ A;  1I35 A;  3L13 A;  3WAM A;  2O2V A;  1V5O A;  2FNJ B;  1P98 A;  3HHM A;  2ZVO A;  3ZKJ C;  2KQ7 A;  2PJH A;  2JT4 B;  3VTU A;  3L08 A;  3ML8 A;  4OVV A;  2MLB A;  2KTF A;  2M4N A;  2BKF A;  3NZU A;  5IAA C;  2KOX A;  1LQB A;  1V86 A;  2V4L A;  2KC2 A;  3ZIM A;  1E8W A;  2JF5 A;  3Q3J A;  5GMV A;  3H7P A;  2DZK A;  2Z59 B;  1GNU A;  2FUH B;  3S2A A;  3DBL I;  4DHZ B;  2Y5B B;  1WZ0 A;  5E6P A;  3R66 C;  4CHK A;  2MP2 A;  3KUC B;  3V6C B;  2IBI B;  1WXM A;  2MSE D;  3OAW A;  2KKC A;  4FBJ B;  2LUE A;  4PS3 A;  3UQA A;  4MEM A;  4ZYN A;  4G3X B;  1WFY A;  4IM2 A;  1UZX B;  3VTV A;  5KHO A;  1BT0 A;  1PQS A;  3H6N A;  4EFO A;  1Z2M A;  2IO1 B;  2V1Y A;  4M8M A;  3VAW A;  1RRB A;  4HLE A;  2I1J A;  3N30 A;  4E3C A;  3NZS A;  4WJQ A;  4FAD A;  1LM8 B;  3PLV A;  3ZLZ A;  1TBE A;  3UQB A;  2K25 A;  2WYQ A;  5E6O A;  1SE9 A;  3PRZ A;  1C1Y B;  4ANU A;  1V49 A;  1WXS A;  4B95 A;  3TL5 A;  1E5W A;  3PRP B;  3DVN V;  3KH0 A;  1X1M A;  1WJN A;  4AJW A;  4MSQ B;  2HJ8 A;  4KVG B;  3R3M A;  4JL9 A;  2MP2 B;  4WWO A;  3OJ3 A;  3PPA A;  4TUU A;  2WX0 A;  3VVW B;  3UIN B;  4AUQ C;  2ZCB A;  4TQ0 A;  5JHB A;  1V5T A;  3IFW B;  3PLU A;  1V9J A;  4W9C A;  2M17 A;  1P3Q U;  1WRD B;  1GC7 A;  2LRW A;  2NPT B;  3PRE A;  4WAA A;  4K7S A;  4NNJ B;  4ZRJ A;  2RR9 A;  4IM3 A;  4BKS A;  1OEY J;  3VUX A;  3TCA A;  5JZE B;  2I1K A;  3QWZ B;  4P7I A;  2D11 A;  2KXJ A;  1WGH A;  4DWF A;  2CKH B;  2JXX A;  2GMI C;  4HDQ A;  2CS4 A;  2DYB A;  1H8C A;  5AZH A;  3P2B A;  2LZ6 A;  2PEA A;  3QHT A;  2K1F A;  1WR6 E;  1EUV B;  2BYE A;  3DVN U;  3SDL C;  2G3Q B;  4W9I A;  3ENE A;  3M95 A;  3N32 A;  3U7D A;  1WY8 A;  5L95 C;  2DX5 B;  3JW0 X;  4NJ6 A;  2NBU A;  4TKN A;  2KX3 A;  1C3T A;  2ZPY A;  2FAZ A;  1MG8 A;  2KDF B;  1FXT B;  2LVO A;  5EDS A;  2IO0 B;  3EHV A;  2A4Z A;  2DZI A;  1NBF C;  2RPQ A;  3DBR I;  3HM6 X;  4GB9 A;  2O6V B;  1ZGU B;  1EO6 A;  2K39 A;  2N9P C;  3CST A;  1KM7 A;  3A4R A;  4WJN A;  2HD5 B;  5AZF A;  4DXA B;  4HPL B;  3DPD A;  4W9E A;  3TJP A;  2FCS A;  4GMV A;  3DVG Y;  5DPT A;  3WAL A;  3BIN A;  1KLV A;  3KYC D;  3IVF A;  1RFA A;  4CO7 A;  3ZNH B;  3GZN I;  3DVG X;  2N1W A;  1UGM A;  3RT3 B;  3T9L A;  2J0M A;  2MBO A;  3AI5 A;  4GDK A;  2CHW A;  5CHW A;  4FN2 A;  2KLG A;  2M1M A;  3PHX B;  2IY1 B;  2BGF A;  2KFK A;  1V80 A;  3WIM A;  1AAR A;  2EMT A;  2D3G A;  2C7N B;  3ZTC A;  2EKE C;  4KSK C;  1SIF A;  2JRH A;  1LFD A;  3APC A;  2O6V A;  2EMS A;  3NOB A;  3MTN B;  2AL3 A;  5D7G A;  2KMC A;  3H9D A;  3ZDT A;  4BFR A;  5HKH A;  2VRR B;  3A9K A;  1IYF A;  2KQS A;  4LJO B;  5TR5 A;  4MGI E;  5JH5 C;  2KNB A;  5AZG A;  1J19 A;  1OQY A;  5DPS A;  3VUW A;  4MJS A;  1A5R A;  3ZNI D;  2ZCC A;  2JZ3 B;  3JYU A;  3TIX A;  2HE7 A;  4PS8 A;  1WX9 A;  1WYW B;  5DPR A;  2IY0 B;  3RCZ A;  2MBH A;  4BKT A;  3DBS A;  2K6D B;  2CR5 A;  1GUA B;  3Q3F A;  4FHK A;  3M62 B;  4K81 A;  4HK2 A;  3KW5 B;  3KYD D;  2N1V A;  2L00 B;  3A9J B;  4KZC A;  3UIP B;  4A3O A;  3B0A A;  4JLC A;  4LDT D;  1YD8 U;  1KOT A;  1WE7 A;  3ZNZ B;  3QAR A;  1UBQ A;  2L8J A;  2K8B A;  3AUL A;  4FUL A;  3JSV A;  2LXC A;  3RUL A;  2KVR A;  2LWP A;  4FHJ A;  4A3P A;  3SHQ A;  1Q1O A;  3VHT C;  2MX2 A;  1NDD A;  4ZDV A;  1WGR A;  3QAQ A;  5LXI B;  5JHA A;  4HJK A;  4MJS B;  2LGD A;  1HE8 A;  3H1U A;  2D10 A;  2ASQ A;  3K9P B;  4IM0 A;  4HVB A;  4GN1 A;  5IA7 A;  2R2O A;  3V62 A;  2ZJD A;  2FIF A;  2DZM A;  1Z5S B;  3H7P B;  3VDZ A;  2NS5 A;  2Z0E B;  3U8Z A;  3RYT A;  2V3S A;  3SD5 A;  2K8C A;  3QA8 A;  3VQI A;  2C5L C;  4MEL A;  4FJZ A;  1L2N A;  1E7U A;  3V60 A;  2KZR A;  3DCG A;  3WAP A;  2KDE B;  1EF1 A;  3QC8 B;  1V81 A;  4JQW C;  1P1A A;  4XZ4 A;  1L7Y A;  3RD2 A;  5C1Z A;  2LGY A;  3ECI A;  4DDG D;  3CF6 E;  4EOY A;  3B1L X;  4CYE A;  3KUZ A;  3ZRF A;  3M63 B;  2JRI B;  1TZ1 A;  2MBE A;  4GOC A;  2CHZ A;  3EFU A;  4MDK E;  1UD7 A;  4WJP A;  4BBN F;  1R4M I;  2KJH B;  4GDL B;  3HM3 A;  1WIA A;  2CHX A;  2MWS B;  4DK5 A;  3C0R B;  4AOF A;  5J18 A;  3DDC B;  2W9N A;  3I3T B;  4WWP A;  3PSE B;  1S1Q B;  4MGY E;  2JWZ A;  2LI5 A;  1WM3 A;  3K9O B;  4ANV A;  1YQB A;  3NY5 A;  2M8S A;  3U30 A;  2L3Z A;  3MJW A;  3VUY A;  4DDI D;  2LGX A;  2XBB C;  3ZDM C;  1LXD A;  4OVU A;  2Z0D B;  3HK0 A;  2WX1 A;  3KVF B;  3OJ4 B;  4ICV A;  3PVL A;  5D6J B;  4URK A;  4KV2 A;  3W1S C;  3X0W A;  2R2Q A;  2GBN A;  3QX1 A;  3ZTD A;  3A4S C;  3ML9 A;  5G55 A;  2KJ6 A;  4ICU A;  4B9K A;  2J7Q B;  4HCN B;  2ZVN A;  2RSU A;  2LD9 A;  4TQ1 A;  3OLM D;  3EC8 A;  2L0T A;  4GDL A;  1M94 A;  4NY0 A;  5CTR C;  4W9D A;  2N4F A;  4B6W A;  1WH3 A;  2AEH A;  4GSW A;  2NBW B;  2G4S A;  4NAW B;  3ZRC A;  4A20 A;  4BOZ B;  4EZK A;  4MSM B;  3T8M A;  2NVU I;  5D2M B;  3ZO5 B;  2AYO B;  4WWN A;  2KK8 A;  4II2 B;  1J8C A;  2FCM A;  4G0N B;  2UYZ B;  3ZNG C;  1QZE A;  2OOB B;  5CHF A;  1TGZ B;  2BF8 B;  1OEY A;  1WZ3 A;  2DYO A;  3AXC A;  3L0W B;  4K1R B;  4W9K A;  2J0J A;  2KD0 A;  4BKS D;  1P0R A;  3KUD B;  3QK0 A;  4MM3 A;  3GOE A;  4ZRK A;  3ZUN A;  3TMP B;  2LVP A;  1E8X A;  2MBQ A;  2M0X A;  2ZZP B;  3SU8 X;  3R7Q A;  5G2N A;  5J17 A;  2GOW A;  1GG3 A;  3NS8 A;  2N7E A;  4RMA A;  5D94 A;  2BPS A;  2O2V B;  1WM2 A;  3JVZ X;  3LDZ E;  4ANX A;  4DHJ D;  2FCQ A;  2NR2 A;  1Q5W B;  3A33 B;  2MA9 B;  4G11 A;  1XQQ A;  4NAW A;  4RM9 A;  4DHZ E;  4EUT A;  2A5U A;  5J2R A;  5LLI A;  1WF9 A;  3UF8 A;  3LJ3 A;  3MHS D;  2G45 B;  4XC2 A;  1G6J A;  1KJT A;  4W9G A;  1RAX A;  1E7V A;  4GXB A;  1OTR B;  4GU2 A;  4I6N B;  1RLF A;  2KFK B;  3R7R A;  4DHJ B;  4WQO B;  2YLM A;  2ZPN A;  3L16 A;  4W9F A;  4YL8 A;  5FR6 A;  3QCA A;  2C9W B;  5CHV C;  2MCN B;  2FCN A;  4GIV A;  2XEW A;  5DPW A;  5BO4 B;  1JRU A;  3VXW A;  2PE9 A;  2GBM A;  5CX3 A;  3PRM B;  2D2Q A;  1WJU A;  4KDI C;  1TTN A;  2KWV B;  2JUO A;  4F7Z A;  3UIO B;  4K7U A;  2DZJ A;  3AU5 A;  2D07 B;  4FJY A;  3RZW C;  2L7R A;  1VCB A;  4BVU C;  4FJV B;  2NCN A;  3EEC A;  5C23 A;  4NJ7 A;  2GBK A;  3WA0 A;  3W1S A;  4W9H A;  2O6V D;  3A1Q B;  1E8Z A;  2ZEQ A;  3H7S A;  2BYF A;  3PT2 B;  4E71 A;  2J0K A;  1YX6 B;  3RZF A;  2KAN A;  1E90 A;  1R4N I;  2LJ5 A;  4KIK A;  1WXA A;  4PYU A;  3W1Y A;  1WJ6 A;  2DEN B;  4AJY B;  3NHE B;  2IO3 B;  3O65 B;  4AWJ A;  4II3 B;  3L54 A;  3VH3 B;  2BYV E;  2DYM A;  2JZZ A;  2XK5 A;  2KHW B;  2MBB B;  3QJZ A;  4JGH B;  4HPM B;  3PHW B;  4I6P A;  2PPH A;  4IWQ A;  4BBN C;  3VFK A;  2RD0 A;  2IZV B;  2WDT B;  3APD A;  2NPT A;  1XD3 B;  1UEL A;  2KX0 A;  4AP4 C;  2OJR A;  4BOS C;  1F9J A;  4GGQ A;  2MW5 A;  4ASW C;  1YIW A;  4BKG A;  4LCD E;  1V2Y A;  2ZNV B;  2KJR A;  2HTH A;  3IBE A;  4K7W A;  3X23 A;  1ZW7 A;  2WWZ A;  3D32 A;  3VH4 B;  1GJZ A;  2KTR B;  2K6Q A;  2N9X A;  4LDT B;  2DAJ A;  1T0Y A;  2UWQ A;  3APF A;  4IG7 B;  4MH0 E;  1H4R A;  3A1Q A;  3AU4 A;  3WAO A;  2C60 A;  4X57 B;  3ONS A;  2MRP A;  4IWO A;  4KSL C;  4FLH A;  3ZW3 A;  3QQ8 B;  4KIK B;  4I6L B;  2LRU A;  1K8R B;  4DBG A;  2YVC A;  1WE6 A;  3UGB B;  2LVQ A;  4J6I A;  2L05 A;  1WGY A;  1WX7 A;  1UH6 A;  1GC6 A;  4EEW A;  4W9J A;  2AWT A;  4HDO A;  4JIO U;  2XK5 B;  1UBI A;  1I42 A;  3HIZ A;  1WMH B;  2L0F A;  3IG3 A;  3RUI B;  5DCN A;  3WAN A;  4HWI B;  2DHZ A;  4RM8 A; 
#chains in the Genus database with same CATH topology
 1N63 A;  5HFY A;  4IC7 B;  4AS1 A;  4IKG A;  3BYT B;  4M8N A;  1SXT A;  3PTF C;  1NYQ A;  2IGD A;  1I4Q A;  1MHH E;  2PE6 B;  2KDB A;  2KLC A;  2JY6 A;  5GXG B;  3BVM A;  3ABV B;  1QOB A;  2KAJ A;  1M4V A;  1U4A A;  2B76 B;  3L10 B;  3V6E B;  5LXH A;  3NRZ A;  4FA6 A;  5JXV A;  1BXT A;  1P9D U;  2K8H A;  1J7C A;  4ANW A;  1F52 A;  2RGF A;  1WX8 A;  2DAF A;  4G50 A;  1WI0 A;  3PZD A;  1CJE A;  1WGG A;  3TBL D;  2ZNV C;  4EKU A;  4D2K A;  1CK1 A;  4HCP B;  3ZVV A;  1EWY C;  4IOI E;  1QKZ A;  2KN4 A;  2KWC A;  4F8C B;  1YN3 A;  2GLS A;  2OJW A;  1Y8R C;  2JPH A;  4IDI A;  3BYY B;  2JYE A;  3WCQ A;  1V5O A;  4RFB A;  4C00 A;  2INC C;  1STE A;  3ML8 A;  3Q8A A;  2M4N A;  2BKF A;  3ZXR A;  1MJD A;  2KC2 A;  3ZIM A;  2Z59 B;  2FUH B;  3S2A A;  1L6V A;  1GPX A;  3R66 C;  1I4H A;  3KUC B;  2IBI B;  1WXM A;  2MSE D;  1FRD A;  3OAW A;  2LUE A;  4PS3 A;  4ZYN A;  4HKQ A;  1BT0 A;  3H6N A;  4EFO A;  4HLE A;  1FXA A;  2I1J A;  3NZS A;  1HXY D;  3ZLZ A;  3PLV A;  1TBE A;  2QC8 A;  5E6O A;  3PRZ A;  1C1Y B;  1DYQ A;  3AN1 A;  3U4E G;  1VR9 A;  3TL5 A;  1E5W A;  5HG2 A;  3KH0 A;  1X1M A;  4J3O D;  2PTL A;  3MC8 A;  2NTT A;  2M17 A;  3N1Y C;  1GC7 A;  2RDH A;  1SE2 A;  2RR9 A;  3VUX A;  1R4N B;  2I1K A;  4P7I A;  1RWS A;  2D11 A;  1LGR A;  2CKH B;  2JXX A;  4Q2J A;  4HDQ A;  2CS4 A;  2DYB A;  4C7Y A;  2KQ4 X;  2PEA A;  3QHT A;  1WR6 E;  1EU4 A;  3RNA C;  1AW7 A;  3ENE A;  1KF6 B;  3DBR B;  2NBU A;  2J42 A;  3N1Z C;  5G5H A;  1FXT B;  3EHV A;  3DBR I;  2KAC A;  3HM6 X;  4GB9 A;  4K3B A;  4WJN A;  3DPD A;  2JQR B;  2FCS A;  4GMV A;  1KLV A;  3IVF A;  1FXI A;  1RFA A;  1ZXI A;  4CO7 A;  2N1W A;  5BYS A;  2MHJ A;  2MBO A;  4RH6 A;  3VR9 B;  2CHW A;  4FN2 A;  2KLG A;  3R2T A;  3PHX B;  1QQR A;  2WXJ A;  3N20 C;  1N5X A;  3ZTC A;  2EKE C;  2EMS A;  4KKJ A;  1L0Y B;  4PK1 A;  1EM7 A;  2M19 A;  3ZDT A;  5EE9 A;  3W9C B;  3A9K A;  5FKA C;  2E3T A;  2KNB A;  1OQY A;  3VUW A;  3JYU A;  5DPR A;  4ARC A;  4DXF A;  2CR5 A;  4FHK A;  3KYD D;  3A9J B;  2LUM A;  3B0A A;  1P7F A;  1XLN A;  3DWG C;  2QSD A;  3QAR A;  3AUL A;  2K8B A;  1ZPS A;  2LXC A;  3RUL A;  1Q1O A;  3VHT C;  2MX2 A;  1WGR A;  1GB4 A;  2WDV B;  4LNN A;  2ZJD A;  3U8Z A;  2WXP A;  3SD5 A;  1P7E A;  3P4R B;  1WRI A;  1E7U A;  3WAP A;  2KDE B;  2KMM A;  1V81 A;  4WUR A;  3ZJV A;  5EE0 A;  1SBB B;  4DDG D;  3Q8F A;  3B1L X;  1TKE A;  5IP4 D;  2PVO D;  1UD7 A;  4WJP A;  4P16 A;  1R4M I;  2KJH B;  1VZ6 A;  1MPE A;  4AOF A;  5J18 A;  4P1B C;  3I3T B;  4WWP A;  3PSE B;  1WM3 A;  4OZA A;  1LXD A;  2Z0D B;  1UWX A;  3OJ4 B;  4URK A;  5D6J B;  3UI3 A;  3QX1 A;  1ZXH A;  2LGI A;  1C77 A;  3ML9 A;  4ICU A;  1TJE A;  2ZVN A;  1NYR A;  2OED A;  2L0T A;  1M94 A;  4DXG A;  4HPP A;  2L83 A;  4GSW A;  3ZRC A;  4BOZ B;  3T8M A;  2AYO B;  2LFI A;  1C9F A;  3DWM A;  2BF8 B;  4K1R B;  3AXC A;  3L0W B;  3KWL A;  4ZRK A;  4MM3 A;  3GOE A;  2TSS A;  1IBX A;  1L0V B;  1E8X A;  3R7Q A;  5J17 A;  2GOW A;  1GG3 A;  3TEW A;  3BK2 A;  1F77 A;  2WDQ B;  3KQ4 A;  2MA9 B;  4EUT A;  4DHZ E;  2A5U A;  4YSX B;  3UF8 A;  2VZK B;  3AMZ A;  3LXF A;  5HI1 A;  3DHH C;  1G6J A;  1KH0 A;  2LJI A;  2KFK B;  2BW2 A;  1JAL A;  4YL8 A;  5FR6 A;  3ZJT A;  5CHV C;  4PT5 A;  2GBM A;  3OWE B;  3PRM B;  2JUO A;  4F7Z A;  3UIO B;  2D07 B;  1VCB A;  1JWS D;  2GBK A;  4W9H A;  2ZEQ A;  2J0K A;  1YX6 B;  2WS3 B;  3RZF A;  3W1Y A;  4KIK A;  4PYU A;  1WJ6 A;  2DEN B;  1YNT E;  5HHD G;  2IO3 B;  3O65 B;  2QCZ A;  3L54 A;  2BYV E;  3VRA B;  1QF6 A;  2MBB B;  4OW0 A;  4HPM B;  4I6P A;  2G9H D;  1ESF A;  4B0E A;  3VFK A;  2RD0 A;  2WDT B;  3APD A;  2HDE A;  1ROE A;  2OJR A;  4M02 A;  1Q10 A;  2DBY A;  2ZNV B;  2KJR A;  4K7W A;  2WWZ A;  2RDG A;  1ZDV A;  2K6Q A;  2N9X A;  4LDT B;  1T0Y A;  4IG7 B;  3APF A;  1N61 A;  4KSL C;  3ONS A;  3QQ8 B;  2LRU A;  1JQ4 A;  3Q8E A;  2YVC A;  1WX7 A;  4EEW A;  3HIZ A;  2L0F A;  3IG3 A;  3PGE A;  4RGT A;  1NI2 A;  3DBH I;  1VLB A;  2KDI A;  3BWU D;  2LAS A;  2KTR A;  1WXV A;  2G4D B;  2HTM E;  1I4X A;  4EZL A;  4PS7 A;  2WGS A;  1E7P B;  4NQL B;  2V0G A;  1ZDX A;  3B2F A;  3U52 E;  3HVZ A;  3V61 A;  3CSF A;  1WMH A;  4YSZ B;  1YN5 A;  2C7M B;  4M0W B;  1IUE A;  1DOI A;  4A6Q A;  3ZGZ A;  1HZ6 A;  3NVV A;  2CU1 A;  4W9L A;  2WHI A;  4LJP B;  2IYD B;  1T0Q C;  2SEB D;  1V6E A;  3IHP C;  2BKR B;  3A9K B;  2KWU B;  5BYQ A;  1HZ5 A;  1F2R I;  4PYZ A;  2IO2 B;  2WXG A;  4XX5 A;  2KN5 A;  4KZ0 A;  2MJ3 A;  1TKY A;  4WIP A;  2LMC A;  2N7D A;  1ET6 A;  2L76 A;  4TV3 A;  2N9E B;  2PKO A;  3A9J A;  2V3N A;  3DOW A;  1AN8 A;  2WXI A;  2BWE S;  3PV1 A;  2WQY B;  1K50 A;  3JSV B;  4XWT A;  1I35 A;  1MI0 A;  1TS4 A;  1T5X D;  3Q8B A;  1JWA D;  3HHM A;  2JSV X;  1KRH A;  1OFF A;  2KTF A;  3BVG A;  2KOX A;  2V4L A;  1E8W A;  2JF5 A;  5GMV A;  1LO5 D;  3BK1 A;  1GNU A;  2Y5B B;  2NMQ A;  3V6C B;  1HTQ A;  3AE1 B;  3B2G A;  3UQA A;  4HKZ E;  3VTV A;  5C3J B;  1Z2M A;  3VAW A;  4R3D A;  4YWG G;  1V1O A;  4ITK A;  4WJQ A;  1FCL A;  2WYQ A;  3RFZ B;  1WXS A;  1PDX A;  1WGK A;  1FNV A;  3DVN V;  1BML C;  4AJW A;  2HJ8 A;  4JL9 A;  2MP2 B;  4S17 A;  3OJ3 A;  3UIN B;  4AUQ C;  5JHB A;  1JRP A;  1V5T A;  1V9J A;  4W9C A;  4LNO A;  4NNJ B;  4WQM A;  4ZRJ A;  4BKS A;  1OEY J;  3TCA A;  5JZE B;  3QWZ B;  3P2B A;  2LZ6 A;  3AEE B;  2K1F A;  1D5M C;  2BYE A;  4AQ7 A;  3SDL C;  4LNF A;  3N32 A;  1D6E C;  1FFU A;  4TKN A;  1B1Z A;  3EA6 A;  1T0S C;  2BS3 B;  2A4Z A;  2DZI A;  3AE7 B;  2O6V B;  1ZGU B;  3PZ7 A;  4YTN B;  2L1A A;  2HD5 B;  2K5P A;  5AZF A;  1PYW D;  3EUB 2;  5DPT A;  3WAL A;  4WAF A;  1F0Z A;  4QAY A;  3Q3N C;  1B9R A;  3GZN I;  4JWS C;  1UGM A;  5TSS A;  3T9L A;  2J0M A;  2VH2 A;  2CJO A;  4GDK A;  4XDD A;  1GOZ A;  2M1M A;  3GZN B;  2KFK A;  3WIM A;  1AAR A;  1CQV A;  3GB1 A;  3NOB A;  3MTN B;  4RF0 A;  1J7B A;  4BFR A;  2VRR B;  3J9C A;  1IYF A;  5JH5 C;  5AZG A;  3ZNI D;  2JZ3 B;  2XN9 C;  3TIX A;  3RCZ A;  2K6D B;  3Q3F A;  4HK2 A;  4KZC A;  3UIP B;  4A3O A;  1I7H A;  2WXH A;  3ZJU A;  1KOT A;  1WE7 A;  1UBQ A;  2WXM A;  4N59 A;  2X8X X;  4FHJ A;  2AQ1 B;  1IGD A;  2WU5 B;  5FR3 A;  4ZDV A;  4HJK A;  2LGD A;  2D10 A;  3NS1 A;  2WDR B;  3K9P B;  4IM0 A;  3HUI A;  4HVB A;  2ACZ B;  3H7P B;  4REZ A;  2Z0E B;  2K8C A;  2C5L C;  4MEL A;  1L2N A;  3V60 A;  2KZR A;  2BYT A;  1OQQ A;  4JQW C;  2DNF A;  1L7Y A;  5FK9 C;  2H89 B;  2MJD A;  3CF6 E;  4EOY A;  4CYE A;  1I4G A;  5H8Y E;  4GOC A;  2IJ0 A;  4N58 A;  4WWM A;  4GDL B;  1WIA A;  2CHX A;  2MWS B;  4DK5 A;  4XWW A;  3DDC B;  2PLP A;  2LI5 A;  1YQB A;  1EWC A;  2WLB A;  4ZYS A;  3NY5 A;  2L3Z A;  3ZDM C;  3SEB A;  3R2I A;  3HK0 A;  2WX1 A;  3C8Y A;  3KVF B;  1E9M A;  4ICV A;  2YEP F;  3P63 A;  3X0W A;  1ACC A;  3AEA B;  4RCO A;  3P4Q B;  1C4C A;  5BMI A;  4C56 C;  2RSU A;  4TQ1 A;  3OLM D;  2D3C A;  3FC4 A;  1HTO A;  5CTR C;  4W9D A;  3FAH A;  2MJE A;  2NBW B;  4OZB A;  3Q3M C;  1VZ7 A;  1YOV B;  3AM9 A;  2NVU I;  5D2M B;  4C4V A;  4II2 B;  1J8C A;  2BTE A;  3P1M A;  4G0N B;  1QZE A;  5CHF A;  2DYO A;  1WZ3 A;  4W9K A;  2G1E A;  3AE3 B;  3U7Z A;  2BPS A;  3JVZ X;  4ANX A;  1YMH E;  1N6Z A;  1Q5W B;  1TS5 A;  4G11 A;  1XQQ A;  4NAW A;  5J2R A;  1YQ3 B;  1WF9 A;  2EKI A;  1YJJ A;  3MHS D;  2JX5 A;  3L4P A;  2BS4 B;  4L1B A;  1E7V A;  2DWQ A;  1SIJ A;  2BVC A;  1MHX A;  2YLM A;  4W9F A;  3QCA A;  2C9W B;  1TYG B;  1JRU A;  2WXQ A;  3VXW A;  2D2Q A;  2LHD A;  1TTN A;  2DZJ A;  1PGB A;  4BVU C;  2NCN A;  2CJN A;  3IAM 1;  2FUG 1;  3H7S A;  4E71 A;  1ZUD 2;  1E90 A;  1R4N I;  2KAN A;  4JWU C;  5IOI A;  3SR6 A;  2RPV A;  2SAK A;  5T8I A;  2X38 A;  2DYM A;  1N62 A;  2JZZ A;  1SJE D;  1F2R C;  1SSN A;  5LNK 1;  2V4I B;  1XD3 B;  1HQR D;  2IPK D;  4BOS C;  4GGQ A;  1YIW A;  3DBH B;  4BKS D;  2HTH A;  5AUI A;  5I4D A;  2UWQ A;  2K3U A;  1YJI A;  3A1Q A;  1FEH A;  4IWO A;  4FLH A;  3ZW3 A;  2L32 A;  3GE3 C;  1NVI D;  1K8R B;  4NJC A;  1SF0 A;  2JXT A;  2LVQ A;  2L05 A;  1FIQ A;  4W9J A;  2AWT A;  1UBI A;  5E6J A;  1RM6 C;  3RUI B;  1NEK B;  2LEK A;  4RM8 A;  4M0W A;  4K3C A;  5BMH A;  1FNU A;  4MAC A;  4WJO A;  2QHO A;  1QOA A;  2KVZ A;  5MPO A;  4YTM B;  4HXD A;  1J0G A;  2INP E;  3B08 A;  2ICI A;  1JWU D;  3PS6 A;  2INN E;  3FIL A;  1PUT A;  2GBR A;  1IGC A;  1E8Y A;  1QOF A;  1VD2 A;  3B9J A;  4XDC A;  2AL6 A;  3I57 A;  4GDK B;  4GLS C;  2BWF A;  4ZRI A;  4RGM A;  3NUH B;  5AEK B;  1YJ1 A;  2BBC A;  1OGW A;  4XE0 A;  3KLS X;  3MC0 B;  4NQK E;  1SB3 C;  1WR1 A;  1XT9 B;  1L4Z B;  1EF5 A;  2C7H A;  2W54 A;  4IWP A;  3RPF C;  5L83 A;  2NTS A;  2MQJ A;  4NPN A;  3L17 A;  2BQQ A;  2KFJ A;  3SFD B;  1Q0W B;  2FID A;  1FD6 A;  2B3A A;  5G5G A;  1JML A;  3ETR A;  3L13 A;  2BB6 A;  2FNJ B;  1QT9 A;  1C76 A;  3ZKJ C;  3P4S B;  2PJH A;  2JT4 B;  4OVV A;  2WU2 B;  3NG0 A;  1V1P B;  3NZU A;  5IAA C;  2BT6 A;  1LQB A;  1V86 A;  4NAM A;  3U2S C;  1MVK A;  3Q3J A;  4RF1 A;  3H7P A;  2IGG A;  3DBL I;  1WZ0 A;  1KTK A;  2ONQ A;  4CHK A;  2MP2 A;  2PW9 A;  3MP9 A;  2KKC A;  4DQO C;  4KKI A;  4FBJ B;  4MEM A;  2J53 A;  1D5Z C;  3RNC C;  1WFY A;  3E56 A;  4WH4 A;  1UZX B;  5KHO A;  1RYJ A;  3OG5 A;  2IO1 B;  3MC9 A;  3N30 A;  2KWD A;  1T0R C;  4FAD A;  1LM8 B;  1JW9 D;  2K25 A;  3AH7 A;  4ANU A;  1V49 A;  3PRP B;  4ZRP A;  1WJN A;  1E10 A;  1TS2 A;  4WWO A;  2BB5 A;  3PPA A;  2N9K A;  2WX0 A;  2ZW1 A;  4TQ0 A;  2ZCB A;  1HA5 A;  3ZYY X;  3IFW B;  2QDF A;  4S0R A;  2LHE A;  2FBW B;  3PRE A;  4K7S A;  4WAA A;  1DGJ A;  3Q3O C;  2KXJ A;  1D5X C;  1WGH A;  4DWF A;  1DOY A;  2VZK D;  1GAQ B;  1H8C A;  5AZH A;  1TY2 A;  1FO4 A;  1KLG D;  5C2T B;  4L23 A;  3Q69 A;  3U7D A;  5L95 C;  2DX5 B;  3JW0 X;  4LNI A;  4NJ6 A;  2KX3 A;  1OQR A;  1C3T A;  3IT6 B;  2GI9 A;  2FAZ A;  1MG8 A;  4HEA 1;  3NJT A;  1ZP0 B;  3DHG C;  5H92 C;  3DHI C;  2IDY A;  2K39 A;  1EO6 A;  3CST A;  3A4R A;  2WXN A;  1L6U A;  4DXA B;  1VDV A;  3BZD B;  2W3S A;  3KYC D;  4FXC A;  2HJ1 A;  3ZNH B;  3BVZ A;  1DOX A;  4LTU A;  4JX1 C;  4M01 A;  3RT3 B;  2L52 A;  1CZP A;  4L2Y A;  5CHW A;  2IY1 B;  1V80 A;  4US9 A;  1QOG A;  2C7N B;  4KSK C;  1SIF A;  3APC A;  2O6V A;  2AL3 A;  2KMC A;  3H9D A;  4KX6 B;  1SJH D;  5TR5 A;  1I4P A;  3RN9 C;  1J19 A;  5DPS A;  4MJS A;  2ZCC A;  3LB8 C;  4LNK A;  3NVZ A;  1WX9 A;  1WYW B;  2IY0 B;  4BKT A;  3DBS A;  1GUA B;  4K81 A;  3M62 B;  2N1V A;  1JWB D;  4LDT D;  1UWM A;  1YD8 U;  3ZXV A;  3JSV A;  2KVR A;  2LWP A;  4A3P A;  1NDD A;  3QAQ A;  5LXI B;  3RNG C;  5JHA A;  1C4P A;  1HE8 A;  4CQN A;  4GN1 A;  5IA7 A;  3TEX A;  3V62 A;  1K51 A;  3Q2A C;  1AWD A;  1Z5S B;  3VDZ A;  3SFE B;  2WXL A;  3VQI A;  4FJZ A;  1Y56 A;  1EF1 A;  1EU3 A;  1P1A A;  4OVZ A;  4XZ4 A;  5C1Z A;  5D3D A;  3ECI A;  2E6X A;  3EFC A;  4JPS A;  4BZA A;  3M63 B;  4LK0 M;  1TZ1 A;  3TEY A;  2CHZ A;  3EFU A;  4BBN F;  4H2A A;  3HM3 A;  3C0R B;  4A9A A;  1S1Q B;  2JWZ A;  3I63 C;  3K9O B;  4TSS A;  1N60 A;  5BYR A;  3MJW A;  3U30 A;  1L4D B;  1SEB D;  2LGX A;  2XBB C;  2N7J A;  2V3P A;  3NVY A;  4NZL B;  4KV2 A;  2R2Q A;  3ZTD A;  3A4S C;  3KWV A;  3PZ8 A;  5G55 A;  4B9K A;  2J7Q B;  1XCQ L;  1TY0 A;  4GDL A;  1WSP A;  1NEN B;  4NY0 A;  3AED B;  2R61 A;  1A70 A;  4A20 A;  4NAW B;  3TEZ A;  4MSM B;  3VRB B;  1E6E B;  3ZO5 B;  4A90 A;  3R8B A;  4WWN A;  1I4R A;  1HEZ E;  3ZNG C;  2QIL A;  2OOB B;  1TGZ B;  1UGJ A;  2J0J A;  2KD0 A;  1SE3 A;  1P0R A;  3IXS A;  2LVP A;  2ZZP B;  1VJK A;  2M0X A;  3SU8 X;  3NS8 A;  4RMA A;  1NI3 A;  3LDZ E;  3GP7 A;  1TIF A;  4A55 A;  4ACF A;  4BAX A;  2JU6 X;  1MG4 A;  2EEL A;  1FRR A;  1UUP A;  4XC2 A;  4W9G A;  3Q8C A;  4GXB A;  1OTR B;  4MH8 A;  4DHJ B;  4KGS A;  4ZOH C;  1TT5 B;  2ZPN A;  2QMT A;  3L16 A;  2GB1 A;  2FCN A;  5DPW A;  5BO4 B;  2MEK A;  2PE9 A;  1WJU A;  4KDI C;  2CU3 A;  2KWV B;  4K7U A;  3AU5 A;  1XLO A;  2L7R A;  4FJV B;  3EEC A;  4YT0 B;  4NJ7 A;  3A1Q B;  1E8Z A;  2BYF A;  1E0Z A;  2AQ2 B;  1UF0 A;  1WXA A;  4RGN A;  1AYF A;  4AJY B;  4AWJ A;  4II3 B;  3VH3 B;  2XK5 A;  4JGH B;  2PPH A;  4BBN C;  1T3Q A;  2W82 A;  4ZRQ A;  3ZQ4 A;  1UEL A;  2KX0 A;  4AP4 C;  1F9J A;  4ASW C;  1T6B X;  3CIR B;  3IBE A;  3P4P B;  3VH4 B;  2K22 A;  4MH0 E;  3WAO A;  2Z8L A;  4X57 B;  4C7Z A;  4I6L B;  4US8 A;  3UGB B;  1UH6 A;  3AE9 B;  1GC6 A;  4HDO A;  1I42 A;  2WXR A;  4JE3 B;  1XF5 L;  3WAN A;  3IT4 B;  5DCN A;  1IPG A;  3NVW A;  4MGK E;  4EZJ A;  1ZKH A;  1YX5 B;  5E6N A;  3H8H A;  2REX A;  1ISN A;  2W3R A;  4F1S A;  2KMA A;  2J4X A;  2WXO A;  3CMM B;  2ON8 A;  3GE8 C;  1UNS A;  1IP9 A;  2LXA A;  1D3Z A;  3AE5 B;  3QIJ A;  4KDL B;  4MGZ E;  3T3N A;  2KO3 A;  1TS3 A;  3M3J A;  3FKY A;  1S3S G;  3ALB A;  2JVC A;  4M00 A;  3W5U B;  3N3K B;  3V05 A;  1SGH A;  4IUM B;  4UDU C;  3RMK C;  1TKG A;  1CMX B;  3VTW A;  3I5J C;  1WGD A;  4E74 A;  3DQV A;  3BY4 B;  4IW0 A;  4RNA A;  4N9F 4;  3FIL B;  1R4M B;  1V1P A;  2GBJ A;  4C4V B;  2NBV B;  3P42 A;  1WJ4 A;  3DBL B;  2PMV A;  4C80 A;  3T3O A;  2KC1 A;  5KHQ A;  1J7A A;  4XYC A;  2M0A A;  3WAM A;  2O2V A;  1KLU D;  1P98 A;  2ZVO A;  2KQ7 A;  3PO0 A;  3VTU A;  3L08 A;  2MLB A;  2J52 A;  2DZK A;  5IKC M;  4DHZ B;  5E6P A;  3Q6B A;  2N0S B;  4G3X B;  1XXG A;  2I38 A;  4IM2 A;  1TZO A;  1XCT L;  1PQS A;  3I9V 1;  2V1Y A;  4M8M A;  1RRB A;  1JCK B;  3EGR A;  2I2Y A;  4E3C A;  3UQB A;  1SE9 A;  2RDB C;  2M56 B;  3AE4 B;  2Y3A A;  4B95 A;  2MH7 A;  3CWI A;  4MSQ B;  1C79 A;  4KVG B;  3R3M A;  4KGT A;  1RFK A;  4TUU A;  3VVW B;  3PLU A;  2NPT B;  1P3Q U;  1WRD B;  2LRW A;  3N9Y C;  4IM3 A;  1XLQ A;  3IAS 1;  2GMI C;  1YN4 A;  3URY A;  2ZW0 A;  1FNW A;  3AE6 B;  5EE1 A;  1EUV B;  3DVN U;  1KFY B;  2G3Q B;  4W9I A;  3M95 A;  4YTP B;  1C78 A;  1WY8 A;  2RMM A;  2ZPY A;  1F1H A;  2KDF B;  2LVO A;  5EDS A;  2KYW A;  2IO0 B;  1NBF C;  1YQ4 B;  2RPQ A;  1IBX B;  2N9P C;  2WXF A;  3V3X A;  1KM7 A;  3AEC B;  3N1X C;  2AX5 A;  2QEJ C;  3HVD A;  5BMG A;  4HPL B;  4W9E A;  3TJP A;  4USA A;  3DVG Y;  3BIN A;  1K52 A;  1D4B A;  1V8C A;  4OZC A;  1VRA B;  2D3A A;  3DVG X;  2IGH A;  2WNM A;  2LGS A;  1XLP A;  3AI5 A;  4KGR A;  4ZHO A;  2BGF A;  4RGO S;  2EMT A;  2D3G A;  3AV8 A;  3MJ5 A;  4P1C C;  2JRH A;  1LFD A;  4HJG E;  1N5W A;  4EE2 A;  5D7G A;  4ARI A;  3E9S A;  5HKH A;  1ET9 A;  2KQS A;  4LJO B;  4O1N A;  4MGI E;  2QIE B;  1A5R A;  2HE7 A;  4PS8 A;  2MBH A;  1QLB B;  1WWT A;  3KW5 B;  2L00 B;  4JLC A;  4XGA B;  1WYG A;  2PVG C;  2FE8 A;  3ZNZ B;  4FUL A;  2L8J A;  2UU7 A;  3Q14 C;  2Y5C A;  5D3I B;  3SHQ A;  4MJS B;  1ZOY B;  3H1U A;  2ASQ A;  4YSY B;  2R2O A;  2FIF A;  2DZM A;  2NS5 A;  3RYT A;  2V3S A;  1FPY A;  3QA8 A;  1L5P A;  3DCG A;  3QC8 B;  4LLG M;  3RD2 A;  2LGY A;  3KUZ A;  3ZRF A;  2JRI B;  2MBE A;  4MDK E;  4P6V F;  1BUI C;  4B0M A;  4A8X C;  4ZHP A;  2JZP A;  2N9L A;  2W9N A;  2Q5W D;  1L0X B;  2JWU A;  4MGY E;  3AE2 B;  1XEE A;  4ANV A;  3VUY A;  2M8S A;  4DDI D;  5AUK A;  1WXQ A;  4OVU A;  1FM0 D;  3TSS A;  3PVL A;  3W1S C;  1PFD A;  3LYY A;  2GBN A;  3AEB B;  4MM3 B;  1K53 A;  2KJ6 A;  2KDM A;  4HCN B;  2VH1 A;  2LD9 A;  1FCC C;  3EC8 A;  2QJL A;  2H88 B;  2OHF A;  2N4F A;  3AE8 B;  4B6W A;  1WH3 A;  2AEH A;  2IND C;  2G4S A;  2PIA A;  4EZK A;  2WXK A;  2KK8 A;  2FCM A;  2UYZ B;  2GRI A;  1GB1 A;  1OEY A;  3MFG A;  3KUD B;  3QK0 A;  2XNA C;  3ZUN A;  3TMP B;  2MBQ A;  3O13 A;  3AB5 A;  1PGX A;  5G2N A;  2K9X A;  2N7E A;  4YXD B;  5D94 A;  2O2V B;  1WM2 A;  1V97 A;  4DHJ D;  2FCQ A;  2NR2 A;  3A33 B;  1VZ8 A;  5EE3 A;  3W2D A;  3RNB C;  4RM9 A;  5LLI A;  1FMA D;  2YEP B;  3AEG B;  3LJ3 A;  2G45 B;  1KJT A;  1RAX A;  2AQ3 B;  4I6N B;  1ZE3 D;  4GU2 A;  1RLF A;  3R7R A;  4WQO B;  2K0P A;  1ENF A;  4HRO A;  3W5V B;  2MCN B;  4OHJ A;  4GIV A;  2XEW A;  3C19 A;  2D3B A;  4N6E B;  3RI7 C;  5CX3 A;  4MT5 A;  1MFW A;  4FJY A;  3RZW C;  1C4A A;  3GS2 A;  2W55 A;  5C23 A;  3WA0 A;  3W1S A;  2O6V D;  3NZ3 A;  3PT2 B;  2LJ5 A;  2DLB A;  3NHE B;  2KHW B;  3AEF B;  3QJZ A;  3PHW B;  4IWQ A;  2Y5P A;  1JRO A;  2JYT A;  2IZV B;  2NPT A;  5IN7 A;  2MW5 A;  4BKG A;  4LCD E;  1V2Y A;  3TUO A;  3X23 A;  1ZW7 A;  1GJZ A;  2BS2 B;  3D32 A;  2KTR B;  2V9H A;  2DAJ A;  3MHZ A;  3VR8 B;  4HRS A;  1H4R A;  3AU4 A;  1FFV A;  2D5G A;  2C60 A;  2WP9 B;  3HRD D;  3RNE C;  2MRP A;  1XO3 A;  3BII D;  1JWM D;  1SE4 A;  4TMA B;  4KIK B;  1R7S A;  4DBG A;  1WE6 A;  2KT7 A;  4J6I A;  1WGY A;  1PGA A;  1QIL A;  4JIO U;  2XK5 B;  5IO9 A;  1WMH B;  4HWI B;  2DHZ A;  3RNF C; 
#chains in the Genus database with same CATH homology
 1IPG A;  4IC7 B;  4MGK E;  4WJO A;  4EZJ A;  1ZKH A;  1YX5 B;  3PGE A;  1NI2 A;  2QHO A;  3DBH I;  4M8N A;  5E6N A;  2REX A;  1ISN A;  2KDI A;  2LAS A;  4F1S A;  2KMA A;  2KTR A;  3PTF C;  4HXD A;  1WXV A;  3CMM B;  1J0G A;  2G4D B;  3B08 A;  1IP9 A;  2LXA A;  3PS6 A;  4EZL A;  1D3Z A;  3QIJ A;  4PS7 A;  4KDL B;  2PE6 B;  2KDB A;  4MGZ E;  2KLC A;  4NQL B;  2JY6 A;  2GBR A;  2KO3 A;  1E8Y A;  3M3J A;  1S3S G;  1VD2 A;  3ALB A;  3V61 A;  2JVC A;  2AL6 A;  1U4A A;  1WMH A;  3CSF A;  4GDK B;  3L10 B;  2BWF A;  4ZRI A;  3V6E B;  2C7M B;  3N3K B;  5AEK B;  4M0W B;  5LXH A;  4FA6 A;  1SGH A;  1P9D U;  2K8H A;  4IUM B;  4ANW A;  1YJ1 A;  2CU1 A;  1OGW A;  2RGF A;  4W9L A;  1WX8 A;  2IYD B;  4LJP B;  4NQK E;  2DAF A;  4G50 A;  1CMX B;  1V6E A;  1WI0 A;  3PZD A;  3VTW A;  1WGD A;  4E74 A;  1WR1 A;  3DQV A;  1XT9 B;  2BKR B;  3A9K B;  1WGG A;  2KWU B;  3IHP C;  3BY4 B;  3TBL D;  2ZNV C;  4IW0 A;  4EKU A;  4N9F 4;  1EF5 A;  4PYZ A;  2IO2 B;  4HCP B;  4XX5 A;  2KN5 A;  4KZ0 A;  3ZVV A;  2GBJ A;  2KWC A;  2C7H A;  2NBV B;  4F8C B;  4IWP A;  2N7D A;  2L76 A;  1WJ4 A;  4TV3 A;  5L83 A;  2N9E B;  3A9J A;  2MQJ A;  4NPN A;  3DOW A;  3L17 A;  2BWE S;  2KFJ A;  1Y8R C;  1Q0W B;  2JPH A;  2FID A;  3PV1 A;  2B3A A;  2KC1 A;  3JSV B;  5KHQ A;  1I35 A;  3L13 A;  3WAM A;  2O2V A;  1V5O A;  2FNJ B;  1P98 A;  3HHM A;  2ZVO A;  3ZKJ C;  2KQ7 A;  2PJH A;  2JT4 B;  3VTU A;  3L08 A;  3ML8 A;  4OVV A;  2MLB A;  2KTF A;  2M4N A;  2BKF A;  3NZU A;  5IAA C;  2KOX A;  1LQB A;  1V86 A;  2V4L A;  2KC2 A;  3ZIM A;  1E8W A;  2JF5 A;  3Q3J A;  5GMV A;  3H7P A;  2DZK A;  2Z59 B;  1GNU A;  2FUH B;  3S2A A;  3DBL I;  4DHZ B;  2Y5B B;  1WZ0 A;  5E6P A;  3R66 C;  4CHK A;  2MP2 A;  3KUC B;  3V6C B;  2IBI B;  1WXM A;  2MSE D;  3OAW A;  2KKC A;  4FBJ B;  2LUE A;  4PS3 A;  3UQA A;  4MEM A;  4ZYN A;  4G3X B;  1WFY A;  4IM2 A;  1UZX B;  3VTV A;  5KHO A;  1BT0 A;  1PQS A;  3H6N A;  4EFO A;  1Z2M A;  2IO1 B;  2V1Y A;  4M8M A;  3VAW A;  1RRB A;  4HLE A;  2I1J A;  3N30 A;  4E3C A;  3NZS A;  4WJQ A;  4FAD A;  1LM8 B;  3PLV A;  3ZLZ A;  1TBE A;  3UQB A;  2K25 A;  2WYQ A;  5E6O A;  1SE9 A;  3PRZ A;  1C1Y B;  4ANU A;  1V49 A;  1WXS A;  4B95 A;  3TL5 A;  1E5W A;  3PRP B;  3DVN V;  3KH0 A;  1X1M A;  1WJN A;  4AJW A;  4MSQ B;  2HJ8 A;  4KVG B;  3R3M A;  4JL9 A;  2MP2 B;  4WWO A;  3OJ3 A;  3PPA A;  4TUU A;  2WX0 A;  3VVW B;  3UIN B;  4AUQ C;  2ZCB A;  4TQ0 A;  5JHB A;  1V5T A;  3IFW B;  3PLU A;  1V9J A;  4W9C A;  2M17 A;  1P3Q U;  1WRD B;  1GC7 A;  2LRW A;  2NPT B;  3PRE A;  4WAA A;  4K7S A;  4NNJ B;  4ZRJ A;  2RR9 A;  4IM3 A;  4BKS A;  1OEY J;  3VUX A;  3TCA A;  5JZE B;  2I1K A;  3QWZ B;  4P7I A;  2D11 A;  2KXJ A;  1WGH A;  4DWF A;  2CKH B;  2JXX A;  2GMI C;  4HDQ A;  2CS4 A;  2DYB A;  1H8C A;  5AZH A;  3P2B A;  2LZ6 A;  2PEA A;  3QHT A;  2K1F A;  1WR6 E;  1EUV B;  2BYE A;  3DVN U;  3SDL C;  2G3Q B;  4W9I A;  3ENE A;  3M95 A;  3N32 A;  3U7D A;  1WY8 A;  5L95 C;  2DX5 B;  3JW0 X;  4NJ6 A;  2NBU A;  4TKN A;  2KX3 A;  1C3T A;  2ZPY A;  2FAZ A;  1MG8 A;  2KDF B;  1FXT B;  2LVO A;  5EDS A;  2IO0 B;  3EHV A;  2A4Z A;  2DZI A;  1NBF C;  2RPQ A;  3DBR I;  3HM6 X;  4GB9 A;  2O6V B;  1ZGU B;  1EO6 A;  2K39 A;  2N9P C;  3CST A;  1KM7 A;  3A4R A;  4WJN A;  2HD5 B;  5AZF A;  4DXA B;  4HPL B;  3DPD A;  4W9E A;  3TJP A;  2FCS A;  4GMV A;  3DVG Y;  5DPT A;  3WAL A;  3BIN A;  1KLV A;  3KYC D;  3IVF A;  1RFA A;  4CO7 A;  3ZNH B;  3GZN I;  3DVG X;  2N1W A;  1UGM A;  3RT3 B;  3T9L A;  2J0M A;  2MBO A;  3AI5 A;  4GDK A;  2CHW A;  5CHW A;  4FN2 A;  2KLG A;  2M1M A;  3PHX B;  2IY1 B;  2BGF A;  2KFK A;  1V80 A;  3WIM A;  1AAR A;  2EMT A;  2D3G A;  2C7N B;  3ZTC A;  2EKE C;  4KSK C;  1SIF A;  2JRH A;  1LFD A;  3APC A;  2O6V A;  2EMS A;  3NOB A;  3MTN B;  2AL3 A;  5D7G A;  2KMC A;  3H9D A;  3ZDT A;  4BFR A;  5HKH A;  2VRR B;  3A9K A;  1IYF A;  2KQS A;  4LJO B;  5TR5 A;  4MGI E;  5JH5 C;  2KNB A;  5AZG A;  1J19 A;  1OQY A;  5DPS A;  3VUW A;  4MJS A;  1A5R A;  3ZNI D;  2ZCC A;  2JZ3 B;  3JYU A;  3TIX A;  2HE7 A;  4PS8 A;  1WX9 A;  1WYW B;  5DPR A;  2IY0 B;  3RCZ A;  2MBH A;  4BKT A;  3DBS A;  2K6D B;  2CR5 A;  1GUA B;  3Q3F A;  4FHK A;  3M62 B;  4K81 A;  4HK2 A;  3KW5 B;  3KYD D;  2N1V A;  2L00 B;  3A9J B;  4KZC A;  3UIP B;  4A3O A;  3B0A A;  4JLC A;  4LDT D;  1YD8 U;  1KOT A;  1WE7 A;  3ZNZ B;  3QAR A;  1UBQ A;  2L8J A;  2K8B A;  3AUL A;  4FUL A;  3JSV A;  2LXC A;  3RUL A;  2KVR A;  2LWP A;  4FHJ A;  4A3P A;  3SHQ A;  1Q1O A;  3VHT C;  2MX2 A;  1NDD A;  4ZDV A;  1WGR A;  3QAQ A;  5LXI B;  5JHA A;  4HJK A;  4MJS B;  2LGD A;  1HE8 A;  3H1U A;  2D10 A;  2ASQ A;  3K9P B;  4IM0 A;  4HVB A;  4GN1 A;  5IA7 A;  2R2O A;  3V62 A;  2ZJD A;  2FIF A;  2DZM A;  1Z5S B;  3H7P B;  3VDZ A;  2NS5 A;  2Z0E B;  3U8Z A;  3RYT A;  2V3S A;  3SD5 A;  2K8C A;  3QA8 A;  3VQI A;  2C5L C;  4MEL A;  4FJZ A;  1L2N A;  1E7U A;  3V60 A;  2KZR A;  3DCG A;  3WAP A;  2KDE B;  1EF1 A;  3QC8 B;  1V81 A;  4JQW C;  1P1A A;  4XZ4 A;  1L7Y A;  3RD2 A;  5C1Z A;  2LGY A;  3ECI A;  4DDG D;  3CF6 E;  4EOY A;  3B1L X;  4CYE A;  3KUZ A;  3ZRF A;  3M63 B;  2JRI B;  1TZ1 A;  2MBE A;  4GOC A;  2CHZ A;  3EFU A;  4MDK E;  1UD7 A;  4WJP A;  4BBN F;  1R4M I;  2KJH B;  4GDL B;  3HM3 A;  1WIA A;  2CHX A;  2MWS B;  4DK5 A;  3C0R B;  4AOF A;  5J18 A;  3DDC B;  2W9N A;  3I3T B;  4WWP A;  3PSE B;  1S1Q B;  4MGY E;  2JWZ A;  2LI5 A;  1WM3 A;  3K9O B;  4ANV A;  1YQB A;  3NY5 A;  2M8S A;  3U30 A;  2L3Z A;  3MJW A;  3VUY A;  4DDI D;  2LGX A;  2XBB C;  3ZDM C;  1LXD A;  4OVU A;  2Z0D B;  3HK0 A;  2WX1 A;  3KVF B;  3OJ4 B;  4ICV A;  3PVL A;  5D6J B;  4URK A;  4KV2 A;  3W1S C;  3X0W A;  2R2Q A;  2GBN A;  3QX1 A;  3ZTD A;  3A4S C;  3ML9 A;  5G55 A;  2KJ6 A;  4ICU A;  4B9K A;  2J7Q B;  4HCN B;  2ZVN A;  2RSU A;  2LD9 A;  4TQ1 A;  3OLM D;  3EC8 A;  2L0T A;  4GDL A;  1M94 A;  4NY0 A;  5CTR C;  4W9D A;  2N4F A;  4B6W A;  1WH3 A;  2AEH A;  4GSW A;  2NBW B;  2G4S A;  4NAW B;  3ZRC A;  4A20 A;  4BOZ B;  4EZK A;  4MSM B;  3T8M A;  2NVU I;  5D2M B;  3ZO5 B;  2AYO B;  4WWN A;  2KK8 A;  4II2 B;  1J8C A;  2FCM A;  4G0N B;  2UYZ B;  3ZNG C;  1QZE A;  2OOB B;  5CHF A;  1TGZ B;  2BF8 B;  1OEY A;  1WZ3 A;  2DYO A;  3AXC A;  3L0W B;  4K1R B;  4W9K A;  2J0J A;  2KD0 A;  4BKS D;  1P0R A;  3KUD B;  3QK0 A;  4MM3 A;  3GOE A;  4ZRK A;  3ZUN A;  3TMP B;  2LVP A;  1E8X A;  2MBQ A;  2M0X A;  2ZZP B;  3SU8 X;  3R7Q A;  5G2N A;  5J17 A;  2GOW A;  1GG3 A;  3NS8 A;  2N7E A;  4RMA A;  5D94 A;  2BPS A;  2O2V B;  1WM2 A;  3JVZ X;  3LDZ E;  4ANX A;  4DHJ D;  2FCQ A;  2NR2 A;  1Q5W B;  3A33 B;  2MA9 B;  4G11 A;  1XQQ A;  4NAW A;  4RM9 A;  4DHZ E;  4EUT A;  2A5U A;  5J2R A;  5LLI A;  1WF9 A;  3UF8 A;  3LJ3 A;  3MHS D;  2G45 B;  4XC2 A;  1G6J A;  1KJT A;  4W9G A;  1RAX A;  1E7V A;  4GXB A;  1OTR B;  4GU2 A;  4I6N B;  1RLF A;  2KFK B;  3R7R A;  4DHJ B;  4WQO B;  2YLM A;  2ZPN A;  3L16 A;  4W9F A;  4YL8 A;  5FR6 A;  3QCA A;  2C9W B;  5CHV C;  2MCN B;  2FCN A;  4GIV A;  2XEW A;  5DPW A;  5BO4 B;  1JRU A;  3VXW A;  2PE9 A;  2GBM A;  5CX3 A;  3PRM B;  2D2Q A;  1WJU A;  4KDI C;  1TTN A;  2KWV B;  2JUO A;  4F7Z A;  3UIO B;  4K7U A;  2DZJ A;  3AU5 A;  2D07 B;  4FJY A;  3RZW C;  2L7R A;  1VCB A;  4BVU C;  4FJV B;  2NCN A;  3EEC A;  5C23 A;  4NJ7 A;  2GBK A;  3WA0 A;  3W1S A;  4W9H A;  2O6V D;  3A1Q B;  1E8Z A;  2ZEQ A;  3H7S A;  2BYF A;  3PT2 B;  4E71 A;  2J0K A;  1YX6 B;  3RZF A;  2KAN A;  1E90 A;  1R4N I;  2LJ5 A;  4KIK A;  1WXA A;  4PYU A;  3W1Y A;  1WJ6 A;  2DEN B;  4AJY B;  3NHE B;  2IO3 B;  3O65 B;  4AWJ A;  4II3 B;  3L54 A;  3VH3 B;  2BYV E;  2DYM A;  2JZZ A;  2XK5 A;  2KHW B;  2MBB B;  3QJZ A;  4JGH B;  4HPM B;  3PHW B;  4I6P A;  2PPH A;  4IWQ A;  4BBN C;  3VFK A;  2RD0 A;  2IZV B;  2WDT B;  3APD A;  2NPT A;  1XD3 B;  1UEL A;  2KX0 A;  4AP4 C;  2OJR A;  4BOS C;  1F9J A;  4GGQ A;  2MW5 A;  4ASW C;  1YIW A;  4BKG A;  4LCD E;  1V2Y A;  2ZNV B;  2KJR A;  2HTH A;  3IBE A;  4K7W A;  3X23 A;  1ZW7 A;  2WWZ A;  3D32 A;  3VH4 B;  1GJZ A;  2KTR B;  2K6Q A;  2N9X A;  4LDT B;  2DAJ A;  1T0Y A;  2UWQ A;  3APF A;  4IG7 B;  4MH0 E;  1H4R A;  3A1Q A;  3AU4 A;  3WAO A;  2C60 A;  4X57 B;  3ONS A;  2MRP A;  4IWO A;  4KSL C;  4FLH A;  3ZW3 A;  3QQ8 B;  4KIK B;  4I6L B;  2LRU A;  1K8R B;  4DBG A;  2YVC A;  1WE6 A;  3UGB B;  2LVQ A;  4J6I A;  2L05 A;  1WGY A;  1WX7 A;  1UH6 A;  1GC6 A;  4EEW A;  4W9J A;  2AWT A;  4HDO A;  4JIO U;  2XK5 B;  1UBI A;  1I42 A;  3HIZ A;  1WMH B;  2L0F A;  3IG3 A;  3RUI B;  5DCN A;  3WAN A;  4HWI B;  2DHZ A;  4RM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...