4W9IA

Pvhl:elob:eloc in complex with (2s,4r)-1-((2s,4r)-1-acetyl-4-hydroxypyrrolidine-2-carbonyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9iA00
2BYVE 4F7ZA 1ZW7A 2DENB 3M3JA 3KYDD 1UBIA 3JSVB 2NBVB 3IVFA 4GDKA 1WIAA 2PJHA 3PRPB 4J6IA 5JZEB 1C3TA 5DPTA 2G3QB 3ML9A 4KSKC 2Z59B 2BKFA 3ENEA 3WAPA 3IG3A 5J2RA 1YQBA 2DX5B 2G4SA 4IWQA 4W9GA 4RM8A 4ANWA 4HCNB 5G2NA 5L83A 2ZZPB 2CU1A 3H6NA 3KVFB 4TV3A 4PYUA 2ASQA 2WX1A 5D2MB 4A3OA 4BKSA 2C7MB 2YVCA 3ZRCA 1EUVB 2W9NA 4DHZB 3H7PA 2MP2B 4FHJA 2ZPYA 4N9F4 2BF8B 4AWJA 1MG8A 1LM8B 3ECIA 2L0TA 3VH4B 1I42A 1V80A 2Z0EB 3APDA 4II2B 4BFRA 2MBEA 3DVGX 2CHXA 2MBHA 2WX0A 3CF6E 1GC7A 3PREA 2NCNA 3MJWA 4HLEA 2C5LC 2I1JA 4TKNA 2NVUI 4ANVA 5EDSA 4IC7B 4MSQB 2J7QB 2M8SA 1KJTA 2KVRA 2LD9A 2LXCA 2PE6B 3L16A 3PHWB 1YD8U 1GUAB 1AARA 3KH0A 4HK2A 4OVVA 1P1AA 2EKEC 4NJ7A 3NS8A 1SE9A 3IHPC 1WGYA 2FIFA 1WXAA 2JZ3B 4NNJB 3PPAA 4OVUA 4PS3A 5E6NA 5J18A 2EMTA 1V49A 1Z5SB 2K39A 3DVNV 4FBJB 5CHVC 3VH3B 2G4DB 2OOBB 5CTRC 2I1KA 3A1QA 2KWCA 2KJRA 4NJ6A 2N7DA 4I6PA 2LVOA 4IM3A 4KDLB 4MJSB 3IFWB 5DPSA 4GDLB 4W9JA 2MCNB 1I35A 1LQBA 1NI2A 2N9PC 3QWZB 2KLGA 2ZNVC 4HDQA 4CO7A 1U4AA 2BPSA 2FUHB 3CSFA 2DZMA 4ZYNA 4G3XB 1WE6A 3JVZX 4LJOB 4EOYA 3Q3JA 2MX2A 3ZVVA 4M0WB 4MDKE 5G55A 2KTRA 3LJ3A 4GB9A 1GC6A 1WH3A 4AJYB 4W9EA 4E3CA 1E7VA 4BKTA 1WJNA 4AJWA 4URKA 2LXAA 4ICUA 1OGWA 2XK5B 3V62A 2KMCA 3P2BA 3DBRI 1FXTB 4FN2A 4DHJD 4FADA 1BT0A 1UD7A 4K81A 5CX3A 4GXBA 4TUUA 3SU8X 3V6CB 4KIKB 1EF1A 1P98A 1WX9A 2FAZA 3PGEA 3NZUA 2IY1B 3OAWA 3UQBA 1JRUA 2KJ6A 1V2YA 2MSED 1Q5WB 3RUIB 2KN5A 1UBQA 2KZRA 4GMVA 2MBQA 3ZDTA 1WF9A 4IWPA 1E8WA 2HJ8A 5DCNA 2O2VB 3UINB 2FCMA 3QIJA 1WI0A 1WM3A 2ZVNA 1NBFC 4WAAA 2DAJA 1PQSA 3N32A 2DHZA 2DYMA 3K9PB 3KW5B 2FCSA 2LWPA 4FHKA 2HD5B 2PE9A 1E8YA 3V61A 1CMXB 4X57B 2KFKB 2GBNA 3VVWB 4BBNC 2UYZB 1WX8A 2K6QA 3KYCD 5E6OA 3W1SA 3KUDB 1Z2MA 1WJUA 1UGMA 1J0GA 3QJZA 2GBRA 2QHOA 1YIWA 1HE8A 2MP2A 2ZEQA 3PZDA 2A5UA 2AL3A 3A9KB 4KV2A 1E7UA 2KC1A 2KOXA 2IBIB 1P3QU 2IO2B 4XX5A 2DAFA 3HM6X 1T0YA 4IG7B 4MM3A 4WQOB 1J8CA 3VUWA 3DVNU 3GZNI 4KZCA 4PS8A 3H7SA 2LVQA 2WYQA 3PSEB 2KX0A 4JL9A 5HKHA 4TQ0A 2NPTB 3AXCA 3ALBA 4MELA 3UGBB 2IO3B 2RD0A 3LDZE 2JVCA 4DBGA 3VAWA 4WJQA 4LDTD 4E74A 2DYOA 1WYWB 1UELA 3PT2B 3PHXB 3QAQA 1GJZA 1WMHB 4K7WA 2ZNVB 2KD0A 3M95A 1LFDA 4FJZA 4PS7A 5GMVA 4BOSC 1WXMA 2UWQA 5FR6A 4JGHB 3SHQA 1P9DU 4MGZE 3TL5A 4LJPB 1EF5A 2V1YA 2RPQA 2KHWB 4K7UA 4F1SA 4GGQA 3PS6A 3NY5A 3RT3B 3SD5A 3QHTA 2HE7A 3T9LA 3UIOB 2J0JA 3DDCB 4HPMB 1ZKHA 4DK5A 2R2OA 3U8ZA 2B3AA 2KXJA 1IP9A 2ZVOA 3DBHI 4WJPA 2DZKA 3WAOA 2ZPNA 3PRMB 1R4NI 4W9DA 4FA6A 1TTNA 2GBJA 3TJPA 1E8ZA 4KZ0A 1OEYJ 1WFYA 2A4ZA 1P0RA 5IAAC 3APCA 5AZHA 2BWES 3N3KB 3CMMB 1IYFA 2M1MA 2C60A 5KHQA 4HDOA 1OQYA 3B0AA 4HWIB 3TBLD 2WDTB 2V4LA 4MH0E 1VCBA 1XT9B 4FJVB 3R7QA 3SDLC 2O6VB 2REXA 2KQ7A 3H7PB 3MTNB 4EZKA 4HCPB 3WALA 2AEHA 2DZIA 2K8CA 4RMAA 3M62B 2KKCA 2OJRA 4ZRKA 3U7DA 1SGHA 1WXSA 3L0WB 2IO1B 2KTFA 4MGYE 4WWNA 2L00B 2WWZA 2CKHB 2M17A 4A20A 4HVBA 1R4MI 2L0FA 1G6JA 2ZJDA 4I6NB 1ISNA 3ZO5B 2JWZA 3W1SC 2FNJB 1H8CA 1WGRA 2GOWA 2KK8A 3TCAA 2CS4A 4K1RB 4PYZA 4EZLA 1M94A 3TIXA 1TBEA 1WGHA 3DOWA 4BBNF 2KQSA 4DWFA 4JLCA 3RYTA 4FJYA 3O65B 4CYEA 3IBEA 1KOTA 3M63B 2O6VD 3A1QB 4W9CA 1E8XA 3QARA 3A9KA 1Q1OA 5D7GA 2JXXA 2IO0B 3JSVA 2C7NB 3DCGA 4M8NA 1A5RA 1K8RB 5KHOA 1XD3B 4NQKE 2D10A 1WM2A 1V5TA 2N1VA 2RR9A 2IZVB 1QZEA 3WAMA 1WZ0A 2N9XA 3DQVA 3X0WA 4XC2A 4LCDE 4B6WA 3B1LX 2L76A 4ZDVA 4G50A 4NAWB 3H1UA 4EZJA 2LGXA 3EHVA 4YL8A 1KM7A 2BKRB 3PLUA 4EUTA 2L7RA 1UZXB 4BOZB 1C1YB 4NQLB 3UF8A 3JW0X 4W9KA 3R3MA 2MQJA 2KTRB 3VTUA 3EFUA 2LUEA 3QC8B 2D07B 3L13A 1WJ6A 4G0NB 3RULA 3CSTA 5C23A 2BGFA 3TMPB 1KLVA 2JPHA 2VRRB 2J0MA 1V86A 2RSUA 3AULA 3HHMA 1V5OA 3MHSD 4GSWA 4HPLB 5DPRA 3HK0A 4AOFA 1RLFA 3V60A 2D3GA 4MSMB 4GN1A 3ZLZA 2FCNA 3VTWA 2V3SA 2NBWB 3UIPB 2NR2A 3B08A 5DPWA 3ONSA 4WJOA 2LJ5A 3WA0A 2N4FA 2GBKA 2L8JA 5L95C 2AWTA 4ASWC 4JQWC 2GBMA 4W9LA 4W9FA 5CHWA 3ZTCA 3PV1A 4ANUA 2C9WB 3A9JB 2LRWA 3VUXA 5C1ZA 3APFA 2FIDA 5LLIA 5IA7A 2NBUA 5CHFA 4AUQC 2J0KA 1OTRB 2AL6A 2K25A 4TQ1A 1XQQA 2DYBA 5JHAA 2CHZA 4WJNA 5D6JB 2KMAA 2K8HA 1E90A 1X1MA 1V6EA 2BYEA 3ZUNA 4GU2A 1WY8A 4MJSA 2N7EA 2LI5A 4GDLA 4G11A 4GOCA 3VXWA 4ZRJA 4EKUA 3R7RA 2O6VA 3VHTC 3RD2A 2LASA 3QX1A 2NS5A 3QK0A 4WWOA 3VFKA 4I6LB 5AZFA 2JRHA 2KO3A 1SIFA 3A4SC 2YLMA 4DDGD 4NPNA 4EEWA 2KFJA 3GOEA 4GDKB 4KDIC 3N30A 3KUCB 3NHEB 3VUYA 4ANXA 3I3TB 3A4RA 4ZRIA 1RRBA 2KDBA 2M0XA 4FULA 2XK5A 2RGFA 2BYFA 2D2QA 1YJ1A 4GIVA 2KDIA 2K6DB 1Q0WB 2LGYA 4IM0A 4DDID 3ZNGC 5AEKB 3QA8A 3VDZA 3T8MA 3ZRFA 2ZCBA 2BWFA 3UQAA 5JH5C 3ZKJC 3HM3A 2LZ6A 4MGIE 2JY6A 3R66C 3PTFC 2JUOA 3EECA 2G45B 4M8MA 4KIKA 2Y5BB 3L54A 2MLBA 5AZGA 2KC2A 3ZIMA 3Q3FA 3ZW3A 4II3B 3X23A 4B95A 3OJ4B 2KWUB 4DHJB 1WX7A 3DPDA 1RFAA 2XBBC 4IW0A 1EO6A 2HTHA 3L10B 2JT4B 3ZNZB 2L05A 3PRZA 3QCAA 4KSLC 1WGGA 2JF5A 2KJHB 3D32A 3ZTDA 2O2VA 5J17A 1V81A 2LGDA 3RZFA 3RCZA 3S2AA 2L3ZA 2JZZA 4BVUC 1S1QB 2Z0DB 3KUZA 2KNBA 2KFKA 4KVGB 4NAWA 4A3PA 1H4RA 3DBSA 2KWVB 3WANA 3RZWC 3BINA 3VQIA 1WXVA 2FCQA 4RM9A 4AP4C 4W9IA 1RAXA 1WJ4A 1TZ1A 2EMSA 2JRIB 3AI5A 3OLMD 4FLHA 4MEMA 5BO4B 1OEYA 3H9DA 1WGDA 4B9KA 1GG3A 2C7HA 3BY4B 4BKSD 4EFOA 2LRUA 4E71A 2AYOB 2K1FA 2M4NA 5LXIB 2D11A 3NOBA 2DZJA 1WE7A 2CHWA 1LXDA 3NZSA 3L08A 5JHBA 1S3SG 5LXHA 1TGZB 1UH6A 1WR6E 3QQ8B 5TR5A 2MBOA 2ZCCA 2KLCA 3AU4A 1Y8RC 3JYUA 3EC8A 2CR5A 4MGKE 2NPTA 3K9OB 3V6EB 4NY0A 1L2NA 4IUMB 3ZNHB 3DBLI 3C0RB 2MRPA 4P7IA 1F9JA 1YX6B 3HIZA 2PPHA 4DXAB 2KX3A 4CHKA 1WMHA 1L7YA 1ZGUB 3AU5A 2KANA 2LVPA 2GMIC 2PEAA 2MW5A 2MWSB 4K7SA 5D94A 3A9JA 3WIMA 4F8CB 1GNUA 3ZNID 1D3ZA 1VD2A 1IPGA 3ZDMC 1J19A 1YX5B 2R2QA 3OJ3A 2KDFB 3ML8A 3PVLA 4LDTB 4HXDA 2K8BA 3A33B 2IY0B 3L17A 4ICVA 1WRDB 3DVGY 4IWOA 4JIOU 2MBBB 2N9EB 3PLVA 2MA9B 2KDEB 5E6PA 1V9JA 1E5WA 4W9HA 3VTVA 3W1YA 4BKGA 2XEWA 2IYDB 1WZ3A 4HJKA 4XZ4A 4IM2A 4DHZE 3U30A 1WR1A 2N1WA 1NDDA 4WWPA
chains in the Genus database with same CATH superfamily
5C2TB 3GE3C 3E56A 4F7ZA 4DXGA 2DENB 3KYDD 2BT6A 2NTTA 2V4IB 5JZEB 4J6IA 1VLBA 2G3QB 1JWMD 2Z59B 3IG3A 1YQBA 4IWQA 4W9GA 4RM8A 4HCNB 5G2NA 4OVZA 2ZZPB 3SR6A 4PYUA 1LO5D 2W9NA 1FM0D 5G5GA 3ECIA 3VH4B 2JSVX 1NYRA 1QILA 1GC7A 1I4PA 3MJWA 2PTLA 4HLEA 5BMGA 4TKNA 5EDSA 2KVRA 3W5VB 2LD9A 2J53A 1C79A 3L16A 4OVVA 5EE3A 1P1AA 2AQ3B 1FXIA 4NJ7A 1DGJA 4LNKA 2OJWA 5HHDG 2SAKA 2JXTA 4HJGE 2RDHA 3Q6BA 3PPAA 4NNJB 5E6NA 1JWSD 1YMHE 4FBJB 2G4DB 1HZ5A 4NJ6A 1RWSA 1NENB 4YSYB 2W55A 2JQRB 1CK1A 5DPSA 2LUMA 4M01A 1I35A 1UUPA 1LQBA 1NI2A 1JROA 2N9PC 1C77A 1KH0A 2ZNVC 2WHIA 1HTQA 2LEKA 3CSFA 2DZMA 2QEJC 3P4QB 2BS2B 5IO9A 3JVZX 4M0WB 1FXAA 3ZJTA 4ZHOA 4AJWA 2LXAA 1F52A 1XLPA 2KMCA 3DBRI 4FADA 1BT0A 1L4ZB 4K81A 2W82A 4WH4A 2FAZA 4N59A 1AW7A 3OAWA 1Q5WB 2KZRA 1ZDVA 2MBQA 3ZDTA 4IWPA 2FCMA 2V3PA 1WI0A 1NBFC 1MVKA 3N32A 4HRSA 2FCSA 1OFFA 1VDVA 3AH7A 2KFKB 4BBNC 1L0VB 1WX8A 5IN7A 3KYCD 1B9RA 1MI0A 2QHOA 1QOGA 2MP2A 2BQQA 1B1ZA 4LNIA 2AL3A 3A9KB 3DBHB 4KV2A 2KOXA 1VRAB 2IBIB 3P1MA 1T0YA 4IG7B 4MM3A 3GZNI 1XLNA 4KZCA 3H7SA 2KX0A 4JL9A 4NZLB 1DYQA 2TSSA 2NPTB 5C3JB 2IO3B 3Q69A 3LDZE 4E74A 3EGRA 3FKYA 3QAQA 1GJZA 4ARIA 4YSXB 1SBBB 3C8YA 4BOSC 1J7AA 2RMMA 3BWUD 1TYGB 1K50A 2RPQA 2IJ0A 3PS6A 4GLSC 5EE1A 1ZOYB 1L4DB 3DDCB 4HPMB 1ZKHA 1EU3A 4DK5A 1YN3A 3ETRA 4WJPA 4L1BA 3LXFA 3CMMB 5AUIA 2C60A 5KHQA 2WDTB 4N58A 4MH0E 4ZRPA 2BB5A 3SDLC 2CJOA 1QT9A 2O6VB 2KQ7A 3MTNB 2CJNA 2DZIA 3M62B 3U7DA 3VRAB 1WXSA 4XWTA 2DWQA 2KTFA 2WLBA 2WWZA 4A20A 2BBCA 1G6JA 4I6NB 5BMHA 2UU7A 3W1SC 1YN5A 3TCAA 4K1RB 1PYWD 1JWAD 3AMZA 1QF6A 3TIXA 1EWYC 4BBNF 3AEEB 3TEZA 3AE2B 2NTSA 1T5XD 1Q1OA 2FE8A 3DCGA 2WXMA 2RR9A 2IZVB 2N9XA 4XC2A 4LCDE 4B6WA 3H1UA 4EZJA 2LGXA 4YL8A 1KM7A 2KN4A 2L7RA 1QQRA 3HVZA 1JMLA 3IAM1 3ZXVA 1WJ6A 3CSTA 3T3OA 2INPE 4YTMB 1KLVA 1FCCC 2JPHA 2YEPF 2J0MA 2ZW0A 3MHSD 3HK0A 1RLFA 2LGIA 4MSMB 3ZLZA 2V3SA 3L4PA 4MH8A 1V8CA 5L95C 3ZTCA 4ANUA 2C9WB 2WXOA 4BAXA 2FIDA 2EKIA 1OTRB 4ZRQA 3R2TA 1XQQA 3RNGC 5JHAA 5D6JB 2KMAA 1E90A 1X1MA 1V6EA 4GU2A 3LB8C 4MJSA 3VXWA 1YJJA 4EKUA 3VHTC 3AEFB 3QX1A 3I57A 3A4SC 2I38A 2YLMA 3RMKC 4NPNA 3ZYYX 2KFJA 1KFYB 3N30A 3AE9B 3I3TB 4ZRIA 5MPOA 2XK5A 2D2QA 2PKOA 2B76B 2LGYA 3HM3A 3PTFC 5AZGA 4KIKA 2INCC 3ZW3A 3DBLB 3Q3FA 3B2GA 4II3B 3X23A 1JW9D 2KWUB 1RFAA 3W5UB 2WDRB 1JALA 1T6BX 2JT4B 2R61A 2L05A 3PRZA 3QCAA 3N9YC 2O2VA 1FRDA 1S1QB 4HKQA 4NAWA 3DBSA 5I4DA 4AP4C 4W9IA 5BO4B 2EMSA 3AI5A 2E6XA 1WGDA 2C7HA 3BY4B 4HROA 2KMMA 2V9HA 2M4NA 5LXIB 2D11A 1ZP0B 2WDVB 3NOBA 1LXDA 1S3SG 3GZNB 5LXHA 4C4VA 3BK1A 1XLQA 1Y8RC 3EC8A 2CR5A 3V6EB 3K9OB 4C00A 3ZNHB 1ACCA 1YX6B 4CHKA 1WMHA 1ZGUB 2GMIC 2PEAA 5D94A 3WIMA 4F8CB 2BYTA 3ZDMC 2GI9A 2H89B 4LDTB 2WQYB 2DLBA 2K8BA 4IDIA 3L17A 4RGOS 2J42A 2MBBB 2N9EB 4MACA 1V9JA 3VTVA 3IT4B 2ONQA 2HTME 4LNOA 3U30A 1TT5B 3RULA 1NDDA 4A8XC 3P42A 2PVOD 3BYYB 3JSVB 1QOFA 4GDKA 1WIAA 2PJHA 1C3TA 3NVVA 3BVGA 3Q8AA 2BW2A 2BKFA 3WAPA 3B9JA 2ON8A 4DQOC 5L83A 3H6NA 2CU1A 4DHZB 2MH7A 1BXTA 2AX5A 4N9F4 4AWJA 1LM8B 3RNBC 1HA5A 1I7HA 2KWDA 4WQMA 2IGDA 4IC7B 2J7QB 3ZQ4A 2K5PA 2PE6B 1YD8U 2EKEC 3C19A 1SE9A 1WGYA 2MJEA 1WXAA 2JZ3B 2QJLA 2D3CA 1IGCA 3DVNV 3AEDB 2OOBB 2KWCA 5HI1A 3NG0A 5EE0A 4GDLB 3EUB2 2MCNB 4B0EA 3QWZB 1PDXA 2KLGA 1MPEA 2ICIA 1SSNA 1K51A 4G3XB 3Q3JA 3ZVVA 1F0ZA 4MDKE 5G55A 3GP7A 4GB9A 4AJYB 4W9EA 1E7VA 4ICUA 4JX1C 3V62A 2QDFA 1QKZA 4S0RA 2RDGA 5CX3A 3BVMA 3U7ZA 4GXBA 1SE3A 1SIJA 1WX9A 1P98A 3PGEA 2KJ6A 4GMVA 4M02A 3QIJA 2ZVNA 1FCLA 4RGMA 2M0AA 4XDDA 2DHZA 2DYMA 3K9PB 4FHKA 2HD5B 2PE9A 1E8YA 1CMXB 4X57B 2GBNA 1F2RI 1V97A 3KQ4A 3KUDB 1Z2MA 3RI7C 4RH6A 3RPFC 1GPXA 4YTNB 2ZEQA 2L52A 4XX5A 1P3QU 2Q5WD 1J8CA 3VUWA 1XF5L 2BB6A 5GXGB 1LGRA 3TSSA 5TSSA 1RFKA 3IXSA 4TQ0A 1DOXA 3AXCA 4MELA 3UGBB 3KWVA 4A55A 4DBGA 3VAWA 2DYOA 1SEBD 3M95A 2PIAA 1LFDA 4FJZA 4PS7A 1WXMA 3SHQA 3TL5A 4F1SA 2WU5B 4GGQA 1FNVA 2WP9B 1K53A 2INNE 3DHGC 3NY5A 3RFZB 1I4HA 3QHTA 4US9A 3NJTA 1FEHA 4RFBA 2EELA 2ZPNA 2IDYA 1R4NI 1TTNA 3TJPA 1JWBD 5IAAC 1P0RA 2BWES 5FK9C 3N3KB 1IYFA 2M1MA 4HDOA 3B0AA 3HUIA 2V4LA 1TS3A 3AEAB 4HCPB 3WALA 3RNEC 2K8CA 2KKCA 2OJRA 4ACFA 4C80A 1DOYA 1V1OA 1D5MC 2I2YA 2CKHB 1R4MI 3Q3NC 2ZJDA 1ISNA 1WGRA 2L83A 4XE0A 4PYZA 3BYTB 3NZ3A 4YTPB 1M94A 2JX5A 1TBEA 3TUOA 4DXFA 4DWFA 2L1AA 3V05A 3CWIA 2Y3AA 1KOTA 3M63B 3P63A 2O6VD 1E8XA 3A9KA 5D7GA 1WXQA 2J52A 3U2SC 1K8RB 4NQKE 1WM2A 1V5TA 1QZEA 3W9CB 3AE6B 1HEZE 2WS3B 3Q3MC 2L76A 4TSSA 3VRBB 2H88B 2JYTA 3EHVA 4RCOA 3PLUA 1C1YB 2MJDA 4NQLB 3UF8A 1D6EC 1IBXB 4A9AA 3AM9A 1C78A 2MEKA 2LUEA 2G1EA 2KACA 2D07B 4G0NB 2BVCA 2BGFA 1N63A 3FC4A 1V86A 4AOFA 2NR2A 3P4PB 3AN1A 1QOAA 2N4FA 5E6JA 1N61A 2WDQB 5C1ZA 3MJ5A 2AL6A 2K25A 2K8HA 2BYEA 2CU3A 2KAJA 3MHZA 2LI5A 3AV8A 4G11A 3GE8C 2IGHA 2O6VA 1TS5A 2LASA 3QK0A 4WWOA 3VFKA 3AE4B 2N9LA 4EE2A 2Y5PA 4DDGD 3VR8B 4MM3B 1FO4A 3GOEA 4KDIC 4YWGG 3KUCB 4ANXA 3OWEB 1RRBA 4FXCA 2BYFA 3MC0B 1Q0WB 2JYEA 4DDID 5AEKB 1WGKA 3VDZA 2M56B 3T8MA 2ZCBA 2LZ6A 2JUOA 4B95A 1WX7A 3ZNZB 4KSLC 2KJHB 3GB1A 1M4VA 3RZFA 4BVUC 2WXLA 4KVGB 1I4GA 4O1NA 1GB4A 2KWVB 3WANA 2WXFA 3VQIA 2FCQA 3OLMD 1OEYA 1VR9A 3IAS1 2LRUA 1ZUD2 4E71A 2K1FA 2QIEB 1WE7A 2CHWA 2ZW1A 1TGZB 1WR6E 2ZCCA 2KLCA 1FIQA 2OHFA 3U4EG 4NY0A 4IUMB 3NVZA 4P7IA 3EA6A 1HZ6A 1OQRA 1AN8A 1OQQA 4ZOHC 2KANA 3HRDD 4K7SA 5H92C 3ZNID 4C7YA 1D3ZA 1VD2A 2MHJA 1L6VA 3LYYA 3OJ3A 1N5XA 1K52A 4HXDA 3DVGY 1YQ3B 2G9HD 2KDEB 3RN9C 5E6PA 3I63C 1E5WA 4HJKA 1L6UA 3VR9B 3H8HA 2N1WA 1WYGA 1KF6B 2INDC 3ZGZA 3N20C 2NBVB 5IOIA 3PRPB 3ML9A 3SFEB 2DX5B 2G4SA 1ZDXA 3KVFB 5D2MB 4A3OA 1J7CA 2C7MB 2YVCA 3ZRCA 3H7PA 2BF8B 1SE2A 2WNMA 1V80A 4II2B 4BFRA 1E10A 2MBEA 3DVGX 2CHXA 2MBHA 3CF6E 1TY0A 3PREA 3RNAC 1EWCA 2C5LC 4ANVA 1ROEA 3AEGB 2LGSA 4MSQB 1KJTA 1V1PB 3PHWB 2LXCA 1YOVB 3KH0A 3DBRB 1VZ8A 3IHPC 1TKGA 3PO0A 2FIFA 4PS3A 1XCQL 5J18A 2EMTA 2OEDA 1V49A 1Z5SB 2K39A 2I1KA 3A1QA 2N7DA 4P6VF 4I6PA 2LVOA 4KDLB 3KWLA 4MJSB 2XN9C 4HPPA 4HDQA 4CO7A 1U4AA 2BPSA 4CQNA 4LNFA 2DNFA 4LJOB 2QMTA 4EOYA 1CJEA 2KTRA 3LJ3A 2K22A 1GC6A 1WH3A 1ZXIA 4KKIA 2LHEA 4E3CA 5FR3A 4R3DA 1OGWA 5LNK1 2XK5B 1I4RA 1I4QA 2K3UA 3MC8A 4DHJD 1UD7A 3V6CB 4KIKB 3NZUA 2IY1B 1JRUA 3RUIB 1UBQA 1XCTL 1NVID 2QCZA 1WF9A 2HJ8A 5DCNA 2LJIA 2O2VB 5D3IB 2WXNA 4WAAA 2DAJA 1PQSA 3KW5B 1C9FA 3V61A 4ITKA 3VVWB 2K6QA 5BYRA 3W1SA 1WJUA 4REZA 3QJZA 2GBRA 2A5UA 3E9SA 1E7UA 1TS2A 2KC1A 2IO2B 2DAFA 3DVNU 1XEEA 1UWMA 2LVQA 2WYQA 4C4VB 1FPYA 3CIRB 2IPKD 4USAA 1ZE3D 1MHXA 1CQVA 2RD0A 1JCKB 2HJ1A 3AEBB 1BUIC 1WYWB 1UELA 3PT2B 1FNWA 1WMHB 4K7WA 3DHHC 1MHHE 2KD0A 3TEYA 1FFUA 1EU4A 1D4BA 4OZAA 1PFDA 1ZPSA 5GMVA 3TEXA 5FR6A 2V0GA 4K3BA 2LFIA 4HEA1 1T0QC 4MGZE 4LJPB 4JE3B 1EF5A 2V1YA 4ZHPA 2WXIA 1P7FA 4P16A 1VZ7A 2D3BA 4XWWA 1MG4A 2HE7A 2J4XA 2R2OA 3SFDB 3U8ZA 2B3AA 2KXJA 3AE5B 3R2IA 3OG5A 1E6EB 1L0YB 3DBHI 1L5PA 2DZKA 2RPVA 3FILA 1E8ZA 1PGAA 5AZHA 4A6QA 4FJVB 2REXA 2WXQA 2PLPA 2AEHA 3Q8EA 4ZRKA 2JZPA 1YNTE 1N6ZA 1VZ6A 4MGYE 4WWNA 2L00B 2M17A 4HVBA 4LTUA 4WAFA 2JWZA 4K3CA 2FNJB 1JWUD 4JWUC 2RDBC 5JXVA 1FFVA 2X8XX 3DOWA 1PUTA 3O65B 4CYEA 2GLSA 2WXGA 4P1BC 3IBEA 1GB1A 2JXXA 2C7NB 2N1VA 3WAMA 1TIFA 3N1XC 2WXPA 5BYQA 3B1LX 4ZDVA 4G50A 2BKRB 4EUTA 1TY2A 2PVGC 5BYSA 3BVZA 3JW0X 3R3MA 2FUG1 3VTUA 4LNNA 1F77A 3TMPB 3HHMA 2RSUA 1A70A 1F2RC 4HPLB 5BMIA 4WWMA 2W3RA 3V60A 4GN1A 3VTWA 2NBWB 3UIPB 3FAHA 3B08A 3RNCC 2LJ5A 3WA0A 2L8JA 4XDCA 2AWTA 1AYFA 4ASWC 2GBMA 3PV1A 3A9JB 2LRWA 3VUXA 3KLSX 3APFA 4AUQC 3V3XA 1T0RC 3ZUNA 1WY8A 2N7EA 4GOCA 3AECB 3R7RA 3RD2A 1CZPA 1XO3A 2NS5A 1C76A 3Q3OC 1E9MA 4I6LB 5AZFA 2JRHA 2KO3A 4M0WA 1IGDA 3VUYA 2W3SA 2QILA 2KDBA 2M0XA 1SXTA 2RGFA 2VZKB 4GIVA 2KDIA 4IM0A 3ZNGC 4N6EB 3NVYA 3QA8A 1STEA 3ZKJC 3DWGC 4XZ4A 3R66C 3EECA 4RGNA 2Y5BB 2MLBA 5D3DA 2FBWB 3OJ4B 3DPDA 3P4RB 4BZAA 1QOBA 4IW0A 1EO6A 3L10B 2JF5A 3ZTDA 5J17A 3UI3A 3T3NA 1V81A 2LGDA 2BTEA 1YQ4B 3N1ZC 3B2FA 4J3OD 3ZXRA 2KNBA 2KFKA 3Q8FA 1H4RA 1TKYA 4L23A 3BINA 1WXVA 4RM9A 1WJ4A 1TZ1A 3Q8BA 1IBXA 4MEMA 4AS1A 4B9KA 4US8A 3NVWA 4BKSD 4EFOA 3AE8B 2AYOB 2DZJA 3NZSA 1YN4A 1NI3A 1UH6A 3QQ8B 2MBOA 3AU4A 2GB1A 4MGKE 2NPTA 3N1YC 4D2KA 3DBLI 4B0MA 1I4XA 3HIZA 2PPHA 2K0PA 2KX3A 5HFYA 2LVPA 2MW5A 1GNUA 4YT0B 3TEWA 1IPGA 4RF0A 1YX5B 2R2QA 2IY0B 3WCQA 4NAMA 1WRDB 4IWOA 4JIOU 3PLVA 1IUEA 4IOIE 1TKEA 4W9HA 3URYA 1MFWA 4BKGA 2XEWA 1WZ3A 5T8IA 4WWPA 2BYVE 1ZW7A 3M3JA 1UBIA 4ARCA 3IVFA 1ENFA 5DPTA 1Y56A 4KX6B 4KSKC 3ENEA 5J2RA 4UDUC 4ANWA 4TV3A 4WIPA 4BKSA 2ASQA 2WX1A 2N9KA 1EUVB 2PW9A 2MP2B 4FHJA 2ZPYA 1MG8A 3Q2AC 2L0TA 1J7BA 1I42A 1RM6C 2Z0EB 3APDA 1SB3C 2KDMA 1TZOA 2WX0A 2NCNA 1D5XC 2I1JA 2NVUI 2M8SA 1UGJA 1GUAB 1AARA 4HK2A 1PGXA 3W2DA 1KLGD 2X38A 3DHIC 3NS8A 3P4SB 1YJIA 4PT5A 1FRRA 3U52E 4OVUA 2LMCA 4S17A 5CHVC 3VH3B 5CTRC 2KJRA 1RYJA 4QAYA 4IM3A 3IFWB 4KGTA 4W9JA 5IKCM 4NJCA 1VJKA 2BS4B 2FUHB 4ZYNA 1WE6A 1E0ZA 4OZCA 2MX2A 1SJHD 1L0XB 4BKTA 1WJNA 4URKA 1P7EA 4KKJA 1TS4A 2BS3B 3P2BA 1FXTB 4FN2A 3O13A 1PGBA 1WSPA 1KLUD 4TUUA 3SU8X 1EF1A 3UQBA 1FNUA 3IT6B 3NUHB 1V2YA 2MSED 2KN5A 4PK1A 3AE1B 4RNAA 1E8WA 4H2AA 3UINB 1WM3A 1GAQB 3AB5A 2LWPA 2NMQA 4L2YA 4RF1A 4Q2JA 2UYZB 5E6OA 2QSDA 1N5WA 1UGMA 3J9CA 1J0GA 1YIWA 1HE8A 3ZJUA 4M00A 3PZDA 1T0SC 1UF0A 3HM6X 1HXYD 1R4NB 2AQ1B 4WQOB 2JU6X 3ZJVA 4PS8A 5FKAC 3PSEB 1V1PA 1ET9A 3AE7B 5HKHA 3MP9A 1EM7A 3ALBA 2JVCA 4WJQA 4LDTD 2HDEA 3PHXB 2ZNVB 3MC9A 2UWQA 4JGHB 1R4MB 1N60A 1P9DU 2M19A 1JRPA 4A90A 4K7UA 2KHWB 3RT3B 3SD5A 1D5ZC 1NEKB 3T9LA 3UIOB 2J0JA 1F1HA 1IP9A 2ZVOA 3WAOA 3PRMB 4W9DA 4FA6A 2GBJA 1FMAD 4KZ0A 1OEYJ 1WFYA 1WWTA 2A4ZA 3APCA 1SE4A 3NS1A 4P1CC 4JPSA 1JQ4A 1OQYA 4HWIB 5H8YE 3TBLD 1VCBA 1XT9B 1SF0A 3HVDA 4OZBA 3RNFC 3R7QA 2GRIA 5G5HA 1AWDA 3H7PB 2N7JA 4EZKA 4RMAA 5EE9A 4YXDB 1SGHA 3L0WB 1HQRD 2IO1B 2MJ3A 1XXGA 3I9V1 2L32A 2L0FA 3ZO5B 4OW0A 1DOIA 1H8CA 2GOWA 2KK8A 2N0SB 2CS4A 1N62A 1MJDA 4EZLA 1WGHA 1C4AA 2KQSA 4JLCA 4C56C 3RYTA 4FJYA 3PZ7A 3A1QB 4W9CA 3QARA 3JSVA 2IO0B 1NYQA 4M8NA 1A5RA 5KHOA 1XD3B 2D10A 3PZ8A 1WZ0A 3DQVA 2YEPB 3X0WA 3AE3B 2Y5CA 4NAWB 1UZXB 4BOZB 1KRHA 4W9KA 2MQJA 1HTOA 2KTRB 1E7PB 3EFUA 3QC8B 2VH1A 3L13A 5C23A 3Q8CA 2VRRB 3AULA 1V5OA 4GSWA 2SEBD 5DPRA 4XGAB 5AUKA 4KGRA 2D3GA 4IKGA 2FCNA 5IP4D 5DPWA 1C4CA 1R7SA 3NRZA 3ONSA 4WJOA 3R8BA 3SEBA 2GBKA 4MT5A 4JQWC 4W9LA 4W9FA 5CHWA 3BZDB 2WGSA 5LLIA 5IA7A 2NBUA 5CHFA 2J0KA 4TQ1A 2DYBA 3I5JC 2CHZA 2Z8LA 2V3NA 4WJNA 2KVZA 4OHJA 2WXJA 1BMLC 4GDLA 4TMAB 4ZRJA 4YSZB 2WU2B 4JWSC 2ACZB 1SIFA 1SJED 3Q14C 4WURA 2QC8A 4EEWA 3ABVB 4GDKB 3NHEB 3A4RA 4FULA 1ZXHA 1YJ1A 4HKZE 2K6DB 2D5GA 3DWMA 1C4PA 3ZRFA 5HG2A 2BWFA 3UQAA 5JH5C 2XNAC 2AQ2B 2DBYA 2JY6A 4MGIE 4M8MA 5JHBA 2G45B 2WXRA 3BIID 3L54A 2KC2A 3ZIMA 2WXKA 4DHJB 2XBBC 2HTHA 1WGGA 3D32A 1UNSA 3RCZA 3S2AA 2L3ZA 2JZZA 2LHDA 2Z0DB 3KUZA 4A3PA 3RZWC 2VZKD 2VH2A 4ZYSA 2IGGA 1RAXA 3FILB 2JRIB 4FLHA 3H9DA 3EFCA 1GG3A 1ET6A 1GOZA 3L08A 2KYWA 5TR5A 2JWUA 3JYUA 3GS2A 1KTKA 4LK0M 1L2NA 1FD6A 3C0RB 1ESFA 2MRPA 1F9JA 1Q10A 1TJEA 2KQ4X 4C7ZA 4DXAB 1L7YA 3AU5A 3MFGA 3BK2A 2WXHA 2MWSB 2W54A 3A9JA 1QLBB 1J19A 2KT7A 4KGSA 4XYCA 2KDFB 3ML8A 3PVLA 3A33B 4ICVA 2E3TA 2K9XA 2MA9B 1XLOA 1T3QA 1UWXA 4AQ7A 3W1YA 2PMVA 1WRIA 2IYDB 4LLGM 4DHZE 4IM2A 4RGTA 1WR1A 2D3AA
chains in the Genus database with same CATH topology
2BYVE 4F7ZA 1ZW7A 2DENB 3M3JA 3KYDD 1UBIA 3JSVB 2NBVB 3IVFA 4GDKA 1WIAA 2PJHA 3PRPB 4J6IA 5JZEB 1C3TA 5DPTA 2G3QB 3ML9A 4KSKC 2Z59B 2BKFA 3ENEA 3WAPA 3IG3A 5J2RA 1YQBA 2DX5B 2G4SA 4IWQA 4W9GA 4RM8A 4ANWA 4HCNB 5G2NA 5L83A 2ZZPB 2CU1A 3H6NA 3KVFB 4TV3A 4PYUA 2ASQA 2WX1A 5D2MB 4A3OA 4BKSA 2C7MB 2YVCA 3ZRCA 1EUVB 2W9NA 4DHZB 3H7PA 2MP2B 4FHJA 2ZPYA 4N9F4 2BF8B 4AWJA 1MG8A 1LM8B 3ECIA 2L0TA 3VH4B 1I42A 1V80A 2Z0EB 3APDA 4II2B 4BFRA 2MBEA 3DVGX 2CHXA 2MBHA 2WX0A 3CF6E 1GC7A 3PREA 2NCNA 3MJWA 4HLEA 2C5LC 2I1JA 4TKNA 2NVUI 4ANVA 5EDSA 4IC7B 4MSQB 2J7QB 2M8SA 1KJTA 2KVRA 2LD9A 2LXCA 2PE6B 3L16A 3PHWB 1YD8U 1GUAB 1AARA 3KH0A 4HK2A 4OVVA 1P1AA 2EKEC 4NJ7A 3NS8A 1SE9A 3IHPC 1WGYA 2FIFA 1WXAA 2JZ3B 4NNJB 3PPAA 4OVUA 4PS3A 5E6NA 5J18A 2EMTA 1V49A 1Z5SB 2K39A 3DVNV 4FBJB 5CHVC 3VH3B 2G4DB 2OOBB 5CTRC 2I1KA 3A1QA 2KWCA 2KJRA 4NJ6A 2N7DA 4I6PA 2LVOA 4IM3A 4KDLB 4MJSB 3IFWB 5DPSA 4GDLB 4W9JA 2MCNB 1I35A 1LQBA 1NI2A 2N9PC 3QWZB 2KLGA 2ZNVC 4HDQA 4CO7A 1U4AA 2BPSA 2FUHB 3CSFA 2DZMA 4ZYNA 4G3XB 1WE6A 3JVZX 4LJOB 4EOYA 3Q3JA 2MX2A 3ZVVA 4M0WB 4MDKE 5G55A 2KTRA 3LJ3A 4GB9A 1GC6A 1WH3A 4AJYB 4W9EA 4E3CA 1E7VA 4BKTA 1WJNA 4AJWA 4URKA 2LXAA 4ICUA 1OGWA 2XK5B 3V62A 2KMCA 3P2BA 3DBRI 1FXTB 4FN2A 4DHJD 4FADA 1BT0A 1UD7A 4K81A 5CX3A 4GXBA 4TUUA 3SU8X 3V6CB 4KIKB 1EF1A 1P98A 1WX9A 2FAZA 3PGEA 3NZUA 2IY1B 3OAWA 3UQBA 1JRUA 2KJ6A 1V2YA 2MSED 1Q5WB 3RUIB 2KN5A 1UBQA 2KZRA 4GMVA 2MBQA 3ZDTA 1WF9A 4IWPA 1E8WA 2HJ8A 5DCNA 2O2VB 3UINB 2FCMA 3QIJA 1WI0A 1WM3A 2ZVNA 1NBFC 4WAAA 2DAJA 1PQSA 3N32A 2DHZA 2DYMA 3K9PB 3KW5B 2FCSA 2LWPA 4FHKA 2HD5B 2PE9A 1E8YA 3V61A 1CMXB 4X57B 2KFKB 2GBNA 3VVWB 4BBNC 2UYZB 1WX8A 2K6QA 3KYCD 5E6OA 3W1SA 3KUDB 1Z2MA 1WJUA 1UGMA 1J0GA 3QJZA 2GBRA 2QHOA 1YIWA 1HE8A 2MP2A 2ZEQA 3PZDA 2A5UA 2AL3A 3A9KB 4KV2A 1E7UA 2KC1A 2KOXA 2IBIB 1P3QU 2IO2B 4XX5A 2DAFA 3HM6X 1T0YA 4IG7B 4MM3A 4WQOB 1J8CA 3VUWA 3DVNU 3GZNI 4KZCA 4PS8A 3H7SA 2LVQA 2WYQA 3PSEB 2KX0A 4JL9A 5HKHA 4TQ0A 2NPTB 3AXCA 3ALBA 4MELA 3UGBB 2IO3B 2RD0A 3LDZE 2JVCA 4DBGA 3VAWA 4WJQA 4LDTD 4E74A 2DYOA 1WYWB 1UELA 3PT2B 3PHXB 3QAQA 1GJZA 1WMHB 4K7WA 2ZNVB 2KD0A 3M95A 1LFDA 4FJZA 4PS7A 5GMVA 4BOSC 1WXMA 2UWQA 5FR6A 4JGHB 3SHQA 1P9DU 4MGZE 3TL5A 4LJPB 1EF5A 2V1YA 2RPQA 2KHWB 4K7UA 4F1SA 4GGQA 3PS6A 3NY5A 3RT3B 3SD5A 3QHTA 2HE7A 3T9LA 3UIOB 2J0JA 3DDCB 4HPMB 1ZKHA 4DK5A 2R2OA 3U8ZA 2B3AA 2KXJA 1IP9A 2ZVOA 3DBHI 4WJPA 2DZKA 3WAOA 2ZPNA 3PRMB 1R4NI 4W9DA 4FA6A 1TTNA 2GBJA 3TJPA 1E8ZA 4KZ0A 1OEYJ 1WFYA 2A4ZA 1P0RA 5IAAC 3APCA 5AZHA 2BWES 3N3KB 3CMMB 1IYFA 2M1MA 2C60A 5KHQA 4HDOA 1OQYA 3B0AA 4HWIB 3TBLD 2WDTB 2V4LA 4MH0E 1VCBA 1XT9B 4FJVB 3R7QA 3SDLC 2O6VB 2REXA 2KQ7A 3H7PB 3MTNB 4EZKA 4HCPB 3WALA 2AEHA 2DZIA 2K8CA 4RMAA 3M62B 2KKCA 2OJRA 4ZRKA 3U7DA 1SGHA 1WXSA 3L0WB 2IO1B 2KTFA 4MGYE 4WWNA 2L00B 2WWZA 2CKHB 2M17A 4A20A 4HVBA 1R4MI 2L0FA 1G6JA 2ZJDA 4I6NB 1ISNA 3ZO5B 2JWZA 3W1SC 2FNJB 1H8CA 1WGRA 2GOWA 2KK8A 3TCAA 2CS4A 4K1RB 4PYZA 4EZLA 1M94A 3TIXA 1TBEA 1WGHA 3DOWA 4BBNF 2KQSA 4DWFA 4JLCA 3RYTA 4FJYA 3O65B 4CYEA 3IBEA 1KOTA 3M63B 2O6VD 3A1QB 4W9CA 1E8XA 3QARA 3A9KA 1Q1OA 5D7GA 2JXXA 2IO0B 3JSVA 2C7NB 3DCGA 4M8NA 1A5RA 1K8RB 5KHOA 1XD3B 4NQKE 2D10A 1WM2A 1V5TA 2N1VA 2RR9A 2IZVB 1QZEA 3WAMA 1WZ0A 2N9XA 3DQVA 3X0WA 4XC2A 4LCDE 4B6WA 3B1LX 2L76A 4ZDVA 4G50A 4NAWB 3H1UA 4EZJA 2LGXA 3EHVA 4YL8A 1KM7A 2BKRB 3PLUA 4EUTA 2L7RA 1UZXB 4BOZB 1C1YB 4NQLB 3UF8A 3JW0X 4W9KA 3R3MA 2MQJA 2KTRB 3VTUA 3EFUA 2LUEA 3QC8B 2D07B 3L13A 1WJ6A 4G0NB 3RULA 3CSTA 5C23A 2BGFA 3TMPB 1KLVA 2JPHA 2VRRB 2J0MA 1V86A 2RSUA 3AULA 3HHMA 1V5OA 3MHSD 4GSWA 4HPLB 5DPRA 3HK0A 4AOFA 1RLFA 3V60A 2D3GA 4MSMB 4GN1A 3ZLZA 2FCNA 3VTWA 2V3SA 2NBWB 3UIPB 2NR2A 3B08A 5DPWA 3ONSA 4WJOA 2LJ5A 3WA0A 2N4FA 2GBKA 2L8JA 5L95C 2AWTA 4ASWC 4JQWC 2GBMA 4W9LA 4W9FA 5CHWA 3ZTCA 3PV1A 4ANUA 2C9WB 3A9JB 2LRWA 3VUXA 5C1ZA 3APFA 2FIDA 5LLIA 5IA7A 2NBUA 5CHFA 4AUQC 2J0KA 1OTRB 2AL6A 2K25A 4TQ1A 1XQQA 2DYBA 5JHAA 2CHZA 4WJNA 5D6JB 2KMAA 2K8HA 1E90A 1X1MA 1V6EA 2BYEA 3ZUNA 4GU2A 1WY8A 4MJSA 2N7EA 2LI5A 4GDLA 4G11A 4GOCA 3VXWA 4ZRJA 4EKUA 3R7RA 2O6VA 3VHTC 3RD2A 2LASA 3QX1A 2NS5A 3QK0A 4WWOA 3VFKA 4I6LB 5AZFA 2JRHA 2KO3A 1SIFA 3A4SC 2YLMA 4DDGD 4NPNA 4EEWA 2KFJA 3GOEA 4GDKB 4KDIC 3N30A 3KUCB 3NHEB 3VUYA 4ANXA 3I3TB 3A4RA 4ZRIA 1RRBA 2KDBA 2M0XA 4FULA 2XK5A 2RGFA 2BYFA 2D2QA 1YJ1A 4GIVA 2KDIA 2K6DB 1Q0WB 2LGYA 4IM0A 4DDID 3ZNGC 5AEKB 3QA8A 3VDZA 3T8MA 3ZRFA 2ZCBA 2BWFA 3UQAA 5JH5C 3ZKJC 3HM3A 2LZ6A 4MGIE 2JY6A 3R66C 3PTFC 2JUOA 3EECA 2G45B 4M8MA 4KIKA 2Y5BB 3L54A 2MLBA 5AZGA 2KC2A 3ZIMA 3Q3FA 3ZW3A 4II3B 3X23A 4B95A 3OJ4B 2KWUB 4DHJB 1WX7A 3DPDA 1RFAA 2XBBC 4IW0A 1EO6A 2HTHA 3L10B 2JT4B 3ZNZB 2L05A 3PRZA 3QCAA 4KSLC 1WGGA 2JF5A 2KJHB 3D32A 3ZTDA 2O2VA 5J17A 1V81A 2LGDA 3RZFA 3RCZA 3S2AA 2L3ZA 2JZZA 4BVUC 1S1QB 2Z0DB 3KUZA 2KNBA 2KFKA 4KVGB 4NAWA 4A3PA 1H4RA 3DBSA 2KWVB 3WANA 3RZWC 3BINA 3VQIA 1WXVA 2FCQA 4RM9A 4AP4C 4W9IA 1RAXA 1WJ4A 1TZ1A 2EMSA 2JRIB 3AI5A 3OLMD 4FLHA 4MEMA 5BO4B 1OEYA 3H9DA 1WGDA 4B9KA 1GG3A 2C7HA 3BY4B 4BKSD 4EFOA 2LRUA 4E71A 2AYOB 2K1FA 2M4NA 5LXIB 2D11A 3NOBA 2DZJA 1WE7A 2CHWA 1LXDA 3NZSA 3L08A 5JHBA 1S3SG 5LXHA 1TGZB 1UH6A 1WR6E 3QQ8B 5TR5A 2MBOA 2ZCCA 2KLCA 3AU4A 1Y8RC 3JYUA 3EC8A 2CR5A 4MGKE 2NPTA 3K9OB 3V6EB 4NY0A 1L2NA 4IUMB 3ZNHB 3DBLI 3C0RB 2MRPA 4P7IA 1F9JA 1YX6B 3HIZA 2PPHA 4DXAB 2KX3A 4CHKA 1WMHA 1L7YA 1ZGUB 3AU5A 2KANA 2LVPA 2GMIC 2PEAA 2MW5A 2MWSB 4K7SA 5D94A 3A9JA 3WIMA 4F8CB 1GNUA 3ZNID 1D3ZA 1VD2A 1IPGA 3ZDMC 1J19A 1YX5B 2R2QA 3OJ3A 2KDFB 3ML8A 3PVLA 4LDTB 4HXDA 2K8BA 3A33B 2IY0B 3L17A 4ICVA 1WRDB 3DVGY 4IWOA 4JIOU 2MBBB 2N9EB 3PLVA 2MA9B 2KDEB 5E6PA 1V9JA 1E5WA 4W9HA 3VTVA 3W1YA 4BKGA 2XEWA 2IYDB 1WZ3A 4HJKA 4XZ4A 4IM2A 4DHZE 3U30A 1WR1A 2N1WA 1NDDA 4WWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYV E;  4F7Z A;  1ZW7 A;  2DEN B;  3M3J A;  3KYD D;  1UBI A;  3JSV B;  2NBV B;  3IVF A;  4GDK A;  1WIA A;  2PJH A;  3PRP B;  4J6I A;  5JZE B;  1C3T A;  5DPT A;  2G3Q B;  3ML9 A;  4KSK C;  2Z59 B;  2BKF A;  3ENE A;  3WAP A;  3IG3 A;  5J2R A;  1YQB A;  2DX5 B;  2G4S A;  4IWQ A;  4W9G A;  4RM8 A;  4ANW A;  4HCN B;  5G2N A;  5L83 A;  2ZZP B;  2CU1 A;  3H6N A;  3KVF B;  4TV3 A;  4PYU A;  2ASQ A;  2WX1 A;  5D2M B;  4A3O A;  4BKS A;  2C7M B;  2YVC A;  3ZRC A;  1EUV B;  2W9N A;  4DHZ B;  3H7P A;  2MP2 B;  4FHJ A;  2ZPY A;  4N9F 4;  2BF8 B;  4AWJ A;  1MG8 A;  1LM8 B;  3ECI A;  2L0T A;  3VH4 B;  1I42 A;  1V80 A;  2Z0E B;  3APD A;  4II2 B;  4BFR A;  2MBE A;  3DVG X;  2CHX A;  2MBH A;  2WX0 A;  3CF6 E;  1GC7 A;  3PRE A;  2NCN A;  3MJW A;  4HLE A;  2C5L C;  2I1J A;  4TKN A;  2NVU I;  4ANV A;  5EDS A;  4IC7 B;  4MSQ B;  2J7Q B;  2M8S A;  1KJT A;  2KVR A;  2LD9 A;  2LXC A;  2PE6 B;  3L16 A;  3PHW B;  1YD8 U;  1GUA B;  1AAR A;  3KH0 A;  4HK2 A;  4OVV A;  1P1A A;  2EKE C;  4NJ7 A;  3NS8 A;  1SE9 A;  3IHP C;  1WGY A;  2FIF A;  1WXA A;  2JZ3 B;  4NNJ B;  3PPA A;  4OVU A;  4PS3 A;  5E6N A;  5J18 A;  2EMT A;  1V49 A;  1Z5S B;  2K39 A;  3DVN V;  4FBJ B;  5CHV C;  3VH3 B;  2G4D B;  2OOB B;  5CTR C;  2I1K A;  3A1Q A;  2KWC A;  2KJR A;  4NJ6 A;  2N7D A;  4I6P A;  2LVO A;  4IM3 A;  4KDL B;  4MJS B;  3IFW B;  5DPS A;  4GDL B;  4W9J A;  2MCN B;  1I35 A;  1LQB A;  1NI2 A;  2N9P C;  3QWZ B;  2KLG A;  2ZNV C;  4HDQ A;  4CO7 A;  1U4A A;  2BPS A;  2FUH B;  3CSF A;  2DZM A;  4ZYN A;  4G3X B;  1WE6 A;  3JVZ X;  4LJO B;  4EOY A;  3Q3J A;  2MX2 A;  3ZVV A;  4M0W B;  4MDK E;  5G55 A;  2KTR A;  3LJ3 A;  4GB9 A;  1GC6 A;  1WH3 A;  4AJY B;  4W9E A;  4E3C A;  1E7V A;  4BKT A;  1WJN A;  4AJW A;  4URK A;  2LXA A;  4ICU A;  1OGW A;  2XK5 B;  3V62 A;  2KMC A;  3P2B A;  3DBR I;  1FXT B;  4FN2 A;  4DHJ D;  4FAD A;  1BT0 A;  1UD7 A;  4K81 A;  5CX3 A;  4GXB A;  4TUU A;  3SU8 X;  3V6C B;  4KIK B;  1EF1 A;  1P98 A;  1WX9 A;  2FAZ A;  3PGE A;  3NZU A;  2IY1 B;  3OAW A;  3UQB A;  1JRU A;  2KJ6 A;  1V2Y A;  2MSE D;  1Q5W B;  3RUI B;  2KN5 A;  1UBQ A;  2KZR A;  4GMV A;  2MBQ A;  3ZDT A;  1WF9 A;  4IWP A;  1E8W A;  2HJ8 A;  5DCN A;  2O2V B;  3UIN B;  2FCM A;  3QIJ A;  1WI0 A;  1WM3 A;  2ZVN A;  1NBF C;  4WAA A;  2DAJ A;  1PQS A;  3N32 A;  2DHZ A;  2DYM A;  3K9P B;  3KW5 B;  2FCS A;  2LWP A;  4FHK A;  2HD5 B;  2PE9 A;  1E8Y A;  3V61 A;  1CMX B;  4X57 B;  2KFK B;  2GBN A;  3VVW B;  4BBN C;  2UYZ B;  1WX8 A;  2K6Q A;  3KYC D;  5E6O A;  3W1S A;  3KUD B;  1Z2M A;  1WJU A;  1UGM A;  1J0G A;  3QJZ A;  2GBR A;  2QHO A;  1YIW A;  1HE8 A;  2MP2 A;  2ZEQ A;  3PZD A;  2A5U A;  2AL3 A;  3A9K B;  4KV2 A;  1E7U A;  2KC1 A;  2KOX A;  2IBI B;  1P3Q U;  2IO2 B;  4XX5 A;  2DAF A;  3HM6 X;  1T0Y A;  4IG7 B;  4MM3 A;  4WQO B;  1J8C A;  3VUW A;  3DVN U;  3GZN I;  4KZC A;  4PS8 A;  3H7S A;  2LVQ A;  2WYQ A;  3PSE B;  2KX0 A;  4JL9 A;  5HKH A;  4TQ0 A;  2NPT B;  3AXC A;  3ALB A;  4MEL A;  3UGB B;  2IO3 B;  2RD0 A;  3LDZ E;  2JVC A;  4DBG A;  3VAW A;  4WJQ A;  4LDT D;  4E74 A;  2DYO A;  1WYW B;  1UEL A;  3PT2 B;  3PHX B;  3QAQ A;  1GJZ A;  1WMH B;  4K7W A;  2ZNV B;  2KD0 A;  3M95 A;  1LFD A;  4FJZ A;  4PS7 A;  5GMV A;  4BOS C;  1WXM A;  2UWQ A;  5FR6 A;  4JGH B;  3SHQ A;  1P9D U;  4MGZ E;  3TL5 A;  4LJP B;  1EF5 A;  2V1Y A;  2RPQ A;  2KHW B;  4K7U A;  4F1S A;  4GGQ A;  3PS6 A;  3NY5 A;  3RT3 B;  3SD5 A;  3QHT A;  2HE7 A;  3T9L A;  3UIO B;  2J0J A;  3DDC B;  4HPM B;  1ZKH A;  4DK5 A;  2R2O A;  3U8Z A;  2B3A A;  2KXJ A;  1IP9 A;  2ZVO A;  3DBH I;  4WJP A;  2DZK A;  3WAO A;  2ZPN A;  3PRM B;  1R4N I;  4W9D A;  4FA6 A;  1TTN A;  2GBJ A;  3TJP A;  1E8Z A;  4KZ0 A;  1OEY J;  1WFY A;  2A4Z A;  1P0R A;  5IAA C;  3APC A;  5AZH A;  2BWE S;  3N3K B;  3CMM B;  1IYF A;  2M1M A;  2C60 A;  5KHQ A;  4HDO A;  1OQY A;  3B0A A;  4HWI B;  3TBL D;  2WDT B;  2V4L A;  4MH0 E;  1VCB A;  1XT9 B;  4FJV B;  3R7Q A;  3SDL C;  2O6V B;  2REX A;  2KQ7 A;  3H7P B;  3MTN B;  4EZK A;  4HCP B;  3WAL A;  2AEH A;  2DZI A;  2K8C A;  4RMA A;  3M62 B;  2KKC A;  2OJR A;  4ZRK A;  3U7D A;  1SGH A;  1WXS A;  3L0W B;  2IO1 B;  2KTF A;  4MGY E;  4WWN A;  2L00 B;  2WWZ A;  2CKH B;  2M17 A;  4A20 A;  4HVB A;  1R4M I;  2L0F A;  1G6J A;  2ZJD A;  4I6N B;  1ISN A;  3ZO5 B;  2JWZ A;  3W1S C;  2FNJ B;  1H8C A;  1WGR A;  2GOW A;  2KK8 A;  3TCA A;  2CS4 A;  4K1R B;  4PYZ A;  4EZL A;  1M94 A;  3TIX A;  1TBE A;  1WGH A;  3DOW A;  4BBN F;  2KQS A;  4DWF A;  4JLC A;  3RYT A;  4FJY A;  3O65 B;  4CYE A;  3IBE A;  1KOT A;  3M63 B;  2O6V D;  3A1Q B;  4W9C A;  1E8X A;  3QAR A;  3A9K A;  1Q1O A;  5D7G A;  2JXX A;  2IO0 B;  3JSV A;  2C7N B;  3DCG A;  4M8N A;  1A5R A;  1K8R B;  5KHO A;  1XD3 B;  4NQK E;  2D10 A;  1WM2 A;  1V5T A;  2N1V A;  2RR9 A;  2IZV B;  1QZE A;  3WAM A;  1WZ0 A;  2N9X A;  3DQV A;  3X0W A;  4XC2 A;  4LCD E;  4B6W A;  3B1L X;  2L76 A;  4ZDV A;  4G50 A;  4NAW B;  3H1U A;  4EZJ A;  2LGX A;  3EHV A;  4YL8 A;  1KM7 A;  2BKR B;  3PLU A;  4EUT A;  2L7R A;  1UZX B;  4BOZ B;  1C1Y B;  4NQL B;  3UF8 A;  3JW0 X;  4W9K A;  3R3M A;  2MQJ A;  2KTR B;  3VTU A;  3EFU A;  2LUE A;  3QC8 B;  2D07 B;  3L13 A;  1WJ6 A;  4G0N B;  3RUL A;  3CST A;  5C23 A;  2BGF A;  3TMP B;  1KLV A;  2JPH A;  2VRR B;  2J0M A;  1V86 A;  2RSU A;  3AUL A;  3HHM A;  1V5O A;  3MHS D;  4GSW A;  4HPL B;  5DPR A;  3HK0 A;  4AOF A;  1RLF A;  3V60 A;  2D3G A;  4MSM B;  4GN1 A;  3ZLZ A;  2FCN A;  3VTW A;  2V3S A;  2NBW B;  3UIP B;  2NR2 A;  3B08 A;  5DPW A;  3ONS A;  4WJO A;  2LJ5 A;  3WA0 A;  2N4F A;  2GBK A;  2L8J A;  5L95 C;  2AWT A;  4ASW C;  4JQW C;  2GBM A;  4W9L A;  4W9F A;  5CHW A;  3ZTC A;  3PV1 A;  4ANU A;  2C9W B;  3A9J B;  2LRW A;  3VUX A;  5C1Z A;  3APF A;  2FID A;  5LLI A;  5IA7 A;  2NBU A;  5CHF A;  4AUQ C;  2J0K A;  1OTR B;  2AL6 A;  2K25 A;  4TQ1 A;  1XQQ A;  2DYB A;  5JHA A;  2CHZ A;  4WJN A;  5D6J B;  2KMA A;  2K8H A;  1E90 A;  1X1M A;  1V6E A;  2BYE A;  3ZUN A;  4GU2 A;  1WY8 A;  4MJS A;  2N7E A;  2LI5 A;  4GDL A;  4G11 A;  4GOC A;  3VXW A;  4ZRJ A;  4EKU A;  3R7R A;  2O6V A;  3VHT C;  3RD2 A;  2LAS A;  3QX1 A;  2NS5 A;  3QK0 A;  4WWO A;  3VFK A;  4I6L B;  5AZF A;  2JRH A;  2KO3 A;  1SIF A;  3A4S C;  2YLM A;  4DDG D;  4NPN A;  4EEW A;  2KFJ A;  3GOE A;  4GDK B;  4KDI C;  3N30 A;  3KUC B;  3NHE B;  3VUY A;  4ANX A;  3I3T B;  3A4R A;  4ZRI A;  1RRB A;  2KDB A;  2M0X A;  4FUL A;  2XK5 A;  2RGF A;  2BYF A;  2D2Q A;  1YJ1 A;  4GIV A;  2KDI A;  2K6D B;  1Q0W B;  2LGY A;  4IM0 A;  4DDI D;  3ZNG C;  5AEK B;  3QA8 A;  3VDZ A;  3T8M A;  3ZRF A;  2ZCB A;  2BWF A;  3UQA A;  5JH5 C;  3ZKJ C;  3HM3 A;  2LZ6 A;  4MGI E;  2JY6 A;  3R66 C;  3PTF C;  2JUO A;  3EEC A;  2G45 B;  4M8M A;  4KIK A;  2Y5B B;  3L54 A;  2MLB A;  5AZG A;  2KC2 A;  3ZIM A;  3Q3F A;  3ZW3 A;  4II3 B;  3X23 A;  4B95 A;  3OJ4 B;  2KWU B;  4DHJ B;  1WX7 A;  3DPD A;  1RFA A;  2XBB C;  4IW0 A;  1EO6 A;  2HTH A;  3L10 B;  2JT4 B;  3ZNZ B;  2L05 A;  3PRZ A;  3QCA A;  4KSL C;  1WGG A;  2JF5 A;  2KJH B;  3D32 A;  3ZTD A;  2O2V A;  5J17 A;  1V81 A;  2LGD A;  3RZF A;  3RCZ A;  3S2A A;  2L3Z A;  2JZZ A;  4BVU C;  1S1Q B;  2Z0D B;  3KUZ A;  2KNB A;  2KFK A;  4KVG B;  4NAW A;  4A3P A;  1H4R A;  3DBS A;  2KWV B;  3WAN A;  3RZW C;  3BIN A;  3VQI A;  1WXV A;  2FCQ A;  4RM9 A;  4AP4 C;  4W9I A;  1RAX A;  1WJ4 A;  1TZ1 A;  2EMS A;  2JRI B;  3AI5 A;  3OLM D;  4FLH A;  4MEM A;  5BO4 B;  1OEY A;  3H9D A;  1WGD A;  4B9K A;  1GG3 A;  2C7H A;  3BY4 B;  4BKS D;  4EFO A;  2LRU A;  4E71 A;  2AYO B;  2K1F A;  2M4N A;  5LXI B;  2D11 A;  3NOB A;  2DZJ A;  1WE7 A;  2CHW A;  1LXD A;  3NZS A;  3L08 A;  5JHB A;  1S3S G;  5LXH A;  1TGZ B;  1UH6 A;  1WR6 E;  3QQ8 B;  5TR5 A;  2MBO A;  2ZCC A;  2KLC A;  3AU4 A;  1Y8R C;  3JYU A;  3EC8 A;  2CR5 A;  4MGK E;  2NPT A;  3K9O B;  3V6E B;  4NY0 A;  1L2N A;  4IUM B;  3ZNH B;  3DBL I;  3C0R B;  2MRP A;  4P7I A;  1F9J A;  1YX6 B;  3HIZ A;  2PPH A;  4DXA B;  2KX3 A;  4CHK A;  1WMH A;  1L7Y A;  1ZGU B;  3AU5 A;  2KAN A;  2LVP A;  2GMI C;  2PEA A;  2MW5 A;  2MWS B;  4K7S A;  5D94 A;  3A9J A;  3WIM A;  4F8C B;  1GNU A;  3ZNI D;  1D3Z A;  1VD2 A;  1IPG A;  3ZDM C;  1J19 A;  1YX5 B;  2R2Q A;  3OJ3 A;  2KDF B;  3ML8 A;  3PVL A;  4LDT B;  4HXD A;  2K8B A;  3A33 B;  2IY0 B;  3L17 A;  4ICV A;  1WRD B;  3DVG Y;  4IWO A;  4JIO U;  2MBB B;  2N9E B;  3PLV A;  2MA9 B;  2KDE B;  5E6P A;  1V9J A;  1E5W A;  4W9H A;  3VTV A;  3W1Y A;  4BKG A;  2XEW A;  2IYD B;  1WZ3 A;  4HJK A;  4XZ4 A;  4IM2 A;  4DHZ E;  3U30 A;  1WR1 A;  2N1W A;  1NDD A;  4WWP A; 
#chains in the Genus database with same CATH topology
 5C2T B;  3GE3 C;  3E56 A;  4F7Z A;  4DXG A;  2DEN B;  3KYD D;  2BT6 A;  2NTT A;  2V4I B;  5JZE B;  4J6I A;  1VLB A;  2G3Q B;  1JWM D;  2Z59 B;  3IG3 A;  1YQB A;  4IWQ A;  4W9G A;  4RM8 A;  4HCN B;  5G2N A;  4OVZ A;  2ZZP B;  3SR6 A;  4PYU A;  1LO5 D;  2W9N A;  1FM0 D;  5G5G A;  3ECI A;  3VH4 B;  2JSV X;  1NYR A;  1QIL A;  1GC7 A;  1I4P A;  3MJW A;  2PTL A;  4HLE A;  5BMG A;  4TKN A;  5EDS A;  2KVR A;  3W5V B;  2LD9 A;  2J53 A;  1C79 A;  3L16 A;  4OVV A;  5EE3 A;  1P1A A;  2AQ3 B;  1FXI A;  4NJ7 A;  1DGJ A;  4LNK A;  2OJW A;  5HHD G;  2SAK A;  2JXT A;  4HJG E;  2RDH A;  3Q6B A;  3PPA A;  4NNJ B;  5E6N A;  1JWS D;  1YMH E;  4FBJ B;  2G4D B;  1HZ5 A;  4NJ6 A;  1RWS A;  1NEN B;  4YSY B;  2W55 A;  2JQR B;  1CK1 A;  5DPS A;  2LUM A;  4M01 A;  1I35 A;  1UUP A;  1LQB A;  1NI2 A;  1JRO A;  2N9P C;  1C77 A;  1KH0 A;  2ZNV C;  2WHI A;  1HTQ A;  2LEK A;  3CSF A;  2DZM A;  2QEJ C;  3P4Q B;  2BS2 B;  5IO9 A;  3JVZ X;  4M0W B;  1FXA A;  3ZJT A;  4ZHO A;  4AJW A;  2LXA A;  1F52 A;  1XLP A;  2KMC A;  3DBR I;  4FAD A;  1BT0 A;  1L4Z B;  4K81 A;  2W82 A;  4WH4 A;  2FAZ A;  4N59 A;  1AW7 A;  3OAW A;  1Q5W B;  2KZR A;  1ZDV A;  2MBQ A;  3ZDT A;  4IWP A;  2FCM A;  2V3P A;  1WI0 A;  1NBF C;  1MVK A;  3N32 A;  4HRS A;  2FCS A;  1OFF A;  1VDV A;  3AH7 A;  2KFK B;  4BBN C;  1L0V B;  1WX8 A;  5IN7 A;  3KYC D;  1B9R A;  1MI0 A;  2QHO A;  1QOG A;  2MP2 A;  2BQQ A;  1B1Z A;  4LNI A;  2AL3 A;  3A9K B;  3DBH B;  4KV2 A;  2KOX A;  1VRA B;  2IBI B;  3P1M A;  1T0Y A;  4IG7 B;  4MM3 A;  3GZN I;  1XLN A;  4KZC A;  3H7S A;  2KX0 A;  4JL9 A;  4NZL B;  1DYQ A;  2TSS A;  2NPT B;  5C3J B;  2IO3 B;  3Q69 A;  3LDZ E;  4E74 A;  3EGR A;  3FKY A;  3QAQ A;  1GJZ A;  4ARI A;  4YSX B;  1SBB B;  3C8Y A;  4BOS C;  1J7A A;  2RMM A;  3BWU D;  1TYG B;  1K50 A;  2RPQ A;  2IJ0 A;  3PS6 A;  4GLS C;  5EE1 A;  1ZOY B;  1L4D B;  3DDC B;  4HPM B;  1ZKH A;  1EU3 A;  4DK5 A;  1YN3 A;  3ETR A;  4WJP A;  4L1B A;  3LXF A;  3CMM B;  5AUI A;  2C60 A;  5KHQ A;  2WDT B;  4N58 A;  4MH0 E;  4ZRP A;  2BB5 A;  3SDL C;  2CJO A;  1QT9 A;  2O6V B;  2KQ7 A;  3MTN B;  2CJN A;  2DZI A;  3M62 B;  3U7D A;  3VRA B;  1WXS A;  4XWT A;  2DWQ A;  2KTF A;  2WLB A;  2WWZ A;  4A20 A;  2BBC A;  1G6J A;  4I6N B;  5BMH A;  2UU7 A;  3W1S C;  1YN5 A;  3TCA A;  4K1R B;  1PYW D;  1JWA D;  3AMZ A;  1QF6 A;  3TIX A;  1EWY C;  4BBN F;  3AEE B;  3TEZ A;  3AE2 B;  2NTS A;  1T5X D;  1Q1O A;  2FE8 A;  3DCG A;  2WXM A;  2RR9 A;  2IZV B;  2N9X A;  4XC2 A;  4LCD E;  4B6W A;  3H1U A;  4EZJ A;  2LGX A;  4YL8 A;  1KM7 A;  2KN4 A;  2L7R A;  1QQR A;  3HVZ A;  1JML A;  3IAM 1;  3ZXV A;  1WJ6 A;  3CST A;  3T3O A;  2INP E;  4YTM B;  1KLV A;  1FCC C;  2JPH A;  2YEP F;  2J0M A;  2ZW0 A;  3MHS D;  3HK0 A;  1RLF A;  2LGI A;  4MSM B;  3ZLZ A;  2V3S A;  3L4P A;  4MH8 A;  1V8C A;  5L95 C;  3ZTC A;  4ANU A;  2C9W B;  2WXO A;  4BAX A;  2FID A;  2EKI A;  1OTR B;  4ZRQ A;  3R2T A;  1XQQ A;  3RNG C;  5JHA A;  5D6J B;  2KMA A;  1E90 A;  1X1M A;  1V6E A;  4GU2 A;  3LB8 C;  4MJS A;  3VXW A;  1YJJ A;  4EKU A;  3VHT C;  3AEF B;  3QX1 A;  3I57 A;  3A4S C;  2I38 A;  2YLM A;  3RMK C;  4NPN A;  3ZYY X;  2KFJ A;  1KFY B;  3N30 A;  3AE9 B;  3I3T B;  4ZRI A;  5MPO A;  2XK5 A;  2D2Q A;  2PKO A;  2B76 B;  2LGY A;  3HM3 A;  3PTF C;  5AZG A;  4KIK A;  2INC C;  3ZW3 A;  3DBL B;  3Q3F A;  3B2G A;  4II3 B;  3X23 A;  1JW9 D;  2KWU B;  1RFA A;  3W5U B;  2WDR B;  1JAL A;  1T6B X;  2JT4 B;  2R61 A;  2L05 A;  3PRZ A;  3QCA A;  3N9Y C;  2O2V A;  1FRD A;  1S1Q B;  4HKQ A;  4NAW A;  3DBS A;  5I4D A;  4AP4 C;  4W9I A;  5BO4 B;  2EMS A;  3AI5 A;  2E6X A;  1WGD A;  2C7H A;  3BY4 B;  4HRO A;  2KMM A;  2V9H A;  2M4N A;  5LXI B;  2D11 A;  1ZP0 B;  2WDV B;  3NOB A;  1LXD A;  1S3S G;  3GZN B;  5LXH A;  4C4V A;  3BK1 A;  1XLQ A;  1Y8R C;  3EC8 A;  2CR5 A;  3V6E B;  3K9O B;  4C00 A;  3ZNH B;  1ACC A;  1YX6 B;  4CHK A;  1WMH A;  1ZGU B;  2GMI C;  2PEA A;  5D94 A;  3WIM A;  4F8C B;  2BYT A;  3ZDM C;  2GI9 A;  2H89 B;  4LDT B;  2WQY B;  2DLB A;  2K8B A;  4IDI A;  3L17 A;  4RGO S;  2J42 A;  2MBB B;  2N9E B;  4MAC A;  1V9J A;  3VTV A;  3IT4 B;  2ONQ A;  2HTM E;  4LNO A;  3U30 A;  1TT5 B;  3RUL A;  1NDD A;  4A8X C;  3P42 A;  2PVO D;  3BYY B;  3JSV B;  1QOF A;  4GDK A;  1WIA A;  2PJH A;  1C3T A;  3NVV A;  3BVG A;  3Q8A A;  2BW2 A;  2BKF A;  3WAP A;  3B9J A;  2ON8 A;  4DQO C;  5L83 A;  3H6N A;  2CU1 A;  4DHZ B;  2MH7 A;  1BXT A;  2AX5 A;  4N9F 4;  4AWJ A;  1LM8 B;  3RNB C;  1HA5 A;  1I7H A;  2KWD A;  4WQM A;  2IGD A;  4IC7 B;  2J7Q B;  3ZQ4 A;  2K5P A;  2PE6 B;  1YD8 U;  2EKE C;  3C19 A;  1SE9 A;  1WGY A;  2MJE A;  1WXA A;  2JZ3 B;  2QJL A;  2D3C A;  1IGC A;  3DVN V;  3AED B;  2OOB B;  2KWC A;  5HI1 A;  3NG0 A;  5EE0 A;  4GDL B;  3EUB 2;  2MCN B;  4B0E A;  3QWZ B;  1PDX A;  2KLG A;  1MPE A;  2ICI A;  1SSN A;  1K51 A;  4G3X B;  3Q3J A;  3ZVV A;  1F0Z A;  4MDK E;  5G55 A;  3GP7 A;  4GB9 A;  4AJY B;  4W9E A;  1E7V A;  4ICU A;  4JX1 C;  3V62 A;  2QDF A;  1QKZ A;  4S0R A;  2RDG A;  5CX3 A;  3BVM A;  3U7Z A;  4GXB A;  1SE3 A;  1SIJ A;  1WX9 A;  1P98 A;  3PGE A;  2KJ6 A;  4GMV A;  4M02 A;  3QIJ A;  2ZVN A;  1FCL A;  4RGM A;  2M0A A;  4XDD A;  2DHZ A;  2DYM A;  3K9P B;  4FHK A;  2HD5 B;  2PE9 A;  1E8Y A;  1CMX B;  4X57 B;  2GBN A;  1F2R I;  1V97 A;  3KQ4 A;  3KUD B;  1Z2M A;  3RI7 C;  4RH6 A;  3RPF C;  1GPX A;  4YTN B;  2ZEQ A;  2L52 A;  4XX5 A;  1P3Q U;  2Q5W D;  1J8C A;  3VUW A;  1XF5 L;  2BB6 A;  5GXG B;  1LGR A;  3TSS A;  5TSS A;  1RFK A;  3IXS A;  4TQ0 A;  1DOX A;  3AXC A;  4MEL A;  3UGB B;  3KWV A;  4A55 A;  4DBG A;  3VAW A;  2DYO A;  1SEB D;  3M95 A;  2PIA A;  1LFD A;  4FJZ A;  4PS7 A;  1WXM A;  3SHQ A;  3TL5 A;  4F1S A;  2WU5 B;  4GGQ A;  1FNV A;  2WP9 B;  1K53 A;  2INN E;  3DHG C;  3NY5 A;  3RFZ B;  1I4H A;  3QHT A;  4US9 A;  3NJT A;  1FEH A;  4RFB A;  2EEL A;  2ZPN A;  2IDY A;  1R4N I;  1TTN A;  3TJP A;  1JWB D;  5IAA C;  1P0R A;  2BWE S;  5FK9 C;  3N3K B;  1IYF A;  2M1M A;  4HDO A;  3B0A A;  3HUI A;  2V4L A;  1TS3 A;  3AEA B;  4HCP B;  3WAL A;  3RNE C;  2K8C A;  2KKC A;  2OJR A;  4ACF A;  4C80 A;  1DOY A;  1V1O A;  1D5M C;  2I2Y A;  2CKH B;  1R4M I;  3Q3N C;  2ZJD A;  1ISN A;  1WGR A;  2L83 A;  4XE0 A;  4PYZ A;  3BYT B;  3NZ3 A;  4YTP B;  1M94 A;  2JX5 A;  1TBE A;  3TUO A;  4DXF A;  4DWF A;  2L1A A;  3V05 A;  3CWI A;  2Y3A A;  1KOT A;  3M63 B;  3P63 A;  2O6V D;  1E8X A;  3A9K A;  5D7G A;  1WXQ A;  2J52 A;  3U2S C;  1K8R B;  4NQK E;  1WM2 A;  1V5T A;  1QZE A;  3W9C B;  3AE6 B;  1HEZ E;  2WS3 B;  3Q3M C;  2L76 A;  4TSS A;  3VRB B;  2H88 B;  2JYT A;  3EHV A;  4RCO A;  3PLU A;  1C1Y B;  2MJD A;  4NQL B;  3UF8 A;  1D6E C;  1IBX B;  4A9A A;  3AM9 A;  1C78 A;  2MEK A;  2LUE A;  2G1E A;  2KAC A;  2D07 B;  4G0N B;  2BVC A;  2BGF A;  1N63 A;  3FC4 A;  1V86 A;  4AOF A;  2NR2 A;  3P4P B;  3AN1 A;  1QOA A;  2N4F A;  5E6J A;  1N61 A;  2WDQ B;  5C1Z A;  3MJ5 A;  2AL6 A;  2K25 A;  2K8H A;  2BYE A;  2CU3 A;  2KAJ A;  3MHZ A;  2LI5 A;  3AV8 A;  4G11 A;  3GE8 C;  2IGH A;  2O6V A;  1TS5 A;  2LAS A;  3QK0 A;  4WWO A;  3VFK A;  3AE4 B;  2N9L A;  4EE2 A;  2Y5P A;  4DDG D;  3VR8 B;  4MM3 B;  1FO4 A;  3GOE A;  4KDI C;  4YWG G;  3KUC B;  4ANX A;  3OWE B;  1RRB A;  4FXC A;  2BYF A;  3MC0 B;  1Q0W B;  2JYE A;  4DDI D;  5AEK B;  1WGK A;  3VDZ A;  2M56 B;  3T8M A;  2ZCB A;  2LZ6 A;  2JUO A;  4B95 A;  1WX7 A;  3ZNZ B;  4KSL C;  2KJH B;  3GB1 A;  1M4V A;  3RZF A;  4BVU C;  2WXL A;  4KVG B;  1I4G A;  4O1N A;  1GB4 A;  2KWV B;  3WAN A;  2WXF A;  3VQI A;  2FCQ A;  3OLM D;  1OEY A;  1VR9 A;  3IAS 1;  2LRU A;  1ZUD 2;  4E71 A;  2K1F A;  2QIE B;  1WE7 A;  2CHW A;  2ZW1 A;  1TGZ B;  1WR6 E;  2ZCC A;  2KLC A;  1FIQ A;  2OHF A;  3U4E G;  4NY0 A;  4IUM B;  3NVZ A;  4P7I A;  3EA6 A;  1HZ6 A;  1OQR A;  1AN8 A;  1OQQ A;  4ZOH C;  2KAN A;  3HRD D;  4K7S A;  5H92 C;  3ZNI D;  4C7Y A;  1D3Z A;  1VD2 A;  2MHJ A;  1L6V A;  3LYY A;  3OJ3 A;  1N5X A;  1K52 A;  4HXD A;  3DVG Y;  1YQ3 B;  2G9H D;  2KDE B;  3RN9 C;  5E6P A;  3I63 C;  1E5W A;  4HJK A;  1L6U A;  3VR9 B;  3H8H A;  2N1W A;  1WYG A;  1KF6 B;  2IND C;  3ZGZ A;  3N20 C;  2NBV B;  5IOI A;  3PRP B;  3ML9 A;  3SFE B;  2DX5 B;  2G4S A;  1ZDX A;  3KVF B;  5D2M B;  4A3O A;  1J7C A;  2C7M B;  2YVC A;  3ZRC A;  3H7P A;  2BF8 B;  1SE2 A;  2WNM A;  1V80 A;  4II2 B;  4BFR A;  1E10 A;  2MBE A;  3DVG X;  2CHX A;  2MBH A;  3CF6 E;  1TY0 A;  3PRE A;  3RNA C;  1EWC A;  2C5L C;  4ANV A;  1ROE A;  3AEG B;  2LGS A;  4MSQ B;  1KJT A;  1V1P B;  3PHW B;  2LXC A;  1YOV B;  3KH0 A;  3DBR B;  1VZ8 A;  3IHP C;  1TKG A;  3PO0 A;  2FIF A;  4PS3 A;  1XCQ L;  5J18 A;  2EMT A;  2OED A;  1V49 A;  1Z5S B;  2K39 A;  2I1K A;  3A1Q A;  2N7D A;  4P6V F;  4I6P A;  2LVO A;  4KDL B;  3KWL A;  4MJS B;  2XN9 C;  4HPP A;  4HDQ A;  4CO7 A;  1U4A A;  2BPS A;  4CQN A;  4LNF A;  2DNF A;  4LJO B;  2QMT A;  4EOY A;  1CJE A;  2KTR A;  3LJ3 A;  2K22 A;  1GC6 A;  1WH3 A;  1ZXI A;  4KKI A;  2LHE A;  4E3C A;  5FR3 A;  4R3D A;  1OGW A;  5LNK 1;  2XK5 B;  1I4R A;  1I4Q A;  2K3U A;  3MC8 A;  4DHJ D;  1UD7 A;  3V6C B;  4KIK B;  3NZU A;  2IY1 B;  1JRU A;  3RUI B;  1UBQ A;  1XCT L;  1NVI D;  2QCZ A;  1WF9 A;  2HJ8 A;  5DCN A;  2LJI A;  2O2V B;  5D3I B;  2WXN A;  4WAA A;  2DAJ A;  1PQS A;  3KW5 B;  1C9F A;  3V61 A;  4ITK A;  3VVW B;  2K6Q A;  5BYR A;  3W1S A;  1WJU A;  4REZ A;  3QJZ A;  2GBR A;  2A5U A;  3E9S A;  1E7U A;  1TS2 A;  2KC1 A;  2IO2 B;  2DAF A;  3DVN U;  1XEE A;  1UWM A;  2LVQ A;  2WYQ A;  4C4V B;  1FPY A;  3CIR B;  2IPK D;  4USA A;  1ZE3 D;  1MHX A;  1CQV A;  2RD0 A;  1JCK B;  2HJ1 A;  3AEB B;  1BUI C;  1WYW B;  1UEL A;  3PT2 B;  1FNW A;  1WMH B;  4K7W A;  3DHH C;  1MHH E;  2KD0 A;  3TEY A;  1FFU A;  1EU4 A;  1D4B A;  4OZA A;  1PFD A;  1ZPS A;  5GMV A;  3TEX A;  5FR6 A;  2V0G A;  4K3B A;  2LFI A;  4HEA 1;  1T0Q C;  4MGZ E;  4LJP B;  4JE3 B;  1EF5 A;  2V1Y A;  4ZHP A;  2WXI A;  1P7F A;  4P16 A;  1VZ7 A;  2D3B A;  4XWW A;  1MG4 A;  2HE7 A;  2J4X A;  2R2O A;  3SFD B;  3U8Z A;  2B3A A;  2KXJ A;  3AE5 B;  3R2I A;  3OG5 A;  1E6E B;  1L0Y B;  3DBH I;  1L5P A;  2DZK A;  2RPV A;  3FIL A;  1E8Z A;  1PGA A;  5AZH A;  4A6Q A;  4FJV B;  2REX A;  2WXQ A;  2PLP A;  2AEH A;  3Q8E A;  4ZRK A;  2JZP A;  1YNT E;  1N6Z A;  1VZ6 A;  4MGY E;  4WWN A;  2L00 B;  2M17 A;  4HVB A;  4LTU A;  4WAF A;  2JWZ A;  4K3C A;  2FNJ B;  1JWU D;  4JWU C;  2RDB C;  5JXV A;  1FFV A;  2X8X X;  3DOW A;  1PUT A;  3O65 B;  4CYE A;  2GLS A;  2WXG A;  4P1B C;  3IBE A;  1GB1 A;  2JXX A;  2C7N B;  2N1V A;  3WAM A;  1TIF A;  3N1X C;  2WXP A;  5BYQ A;  3B1L X;  4ZDV A;  4G50 A;  2BKR B;  4EUT A;  1TY2 A;  2PVG C;  5BYS A;  3BVZ A;  3JW0 X;  3R3M A;  2FUG 1;  3VTU A;  4LNN A;  1F77 A;  3TMP B;  3HHM A;  2RSU A;  1A70 A;  1F2R C;  4HPL B;  5BMI A;  4WWM A;  2W3R A;  3V60 A;  4GN1 A;  3VTW A;  2NBW B;  3UIP B;  3FAH A;  3B08 A;  3RNC C;  2LJ5 A;  3WA0 A;  2L8J A;  4XDC A;  2AWT A;  1AYF A;  4ASW C;  2GBM A;  3PV1 A;  3A9J B;  2LRW A;  3VUX A;  3KLS X;  3APF A;  4AUQ C;  3V3X A;  1T0R C;  3ZUN A;  1WY8 A;  2N7E A;  4GOC A;  3AEC B;  3R7R A;  3RD2 A;  1CZP A;  1XO3 A;  2NS5 A;  1C76 A;  3Q3O C;  1E9M A;  4I6L B;  5AZF A;  2JRH A;  2KO3 A;  4M0W A;  1IGD A;  3VUY A;  2W3S A;  2QIL A;  2KDB A;  2M0X A;  1SXT A;  2RGF A;  2VZK B;  4GIV A;  2KDI A;  4IM0 A;  3ZNG C;  4N6E B;  3NVY A;  3QA8 A;  1STE A;  3ZKJ C;  3DWG C;  4XZ4 A;  3R66 C;  3EEC A;  4RGN A;  2Y5B B;  2MLB A;  5D3D A;  2FBW B;  3OJ4 B;  3DPD A;  3P4R B;  4BZA A;  1QOB A;  4IW0 A;  1EO6 A;  3L10 B;  2JF5 A;  3ZTD A;  5J17 A;  3UI3 A;  3T3N A;  1V81 A;  2LGD A;  2BTE A;  1YQ4 B;  3N1Z C;  3B2F A;  4J3O D;  3ZXR A;  2KNB A;  2KFK A;  3Q8F A;  1H4R A;  1TKY A;  4L23 A;  3BIN A;  1WXV A;  4RM9 A;  1WJ4 A;  1TZ1 A;  3Q8B A;  1IBX A;  4MEM A;  4AS1 A;  4B9K A;  4US8 A;  3NVW A;  4BKS D;  4EFO A;  3AE8 B;  2AYO B;  2DZJ A;  3NZS A;  1YN4 A;  1NI3 A;  1UH6 A;  3QQ8 B;  2MBO A;  3AU4 A;  2GB1 A;  4MGK E;  2NPT A;  3N1Y C;  4D2K A;  3DBL I;  4B0M A;  1I4X A;  3HIZ A;  2PPH A;  2K0P A;  2KX3 A;  5HFY A;  2LVP A;  2MW5 A;  1GNU A;  4YT0 B;  3TEW A;  1IPG A;  4RF0 A;  1YX5 B;  2R2Q A;  2IY0 B;  3WCQ A;  4NAM A;  1WRD B;  4IWO A;  4JIO U;  3PLV A;  1IUE A;  4IOI E;  1TKE A;  4W9H A;  3URY A;  1MFW A;  4BKG A;  2XEW A;  1WZ3 A;  5T8I A;  4WWP A;  2BYV E;  1ZW7 A;  3M3J A;  1UBI A;  4ARC A;  3IVF A;  1ENF A;  5DPT A;  1Y56 A;  4KX6 B;  4KSK C;  3ENE A;  5J2R A;  4UDU C;  4ANW A;  4TV3 A;  4WIP A;  4BKS A;  2ASQ A;  2WX1 A;  2N9K A;  1EUV B;  2PW9 A;  2MP2 B;  4FHJ A;  2ZPY A;  1MG8 A;  3Q2A C;  2L0T A;  1J7B A;  1I42 A;  1RM6 C;  2Z0E B;  3APD A;  1SB3 C;  2KDM A;  1TZO A;  2WX0 A;  2NCN A;  1D5X C;  2I1J A;  2NVU I;  2M8S A;  1UGJ A;  1GUA B;  1AAR A;  4HK2 A;  1PGX A;  3W2D A;  1KLG D;  2X38 A;  3DHI C;  3NS8 A;  3P4S B;  1YJI A;  4PT5 A;  1FRR A;  3U52 E;  4OVU A;  2LMC A;  4S17 A;  5CHV C;  3VH3 B;  5CTR C;  2KJR A;  1RYJ A;  4QAY A;  4IM3 A;  3IFW B;  4KGT A;  4W9J A;  5IKC M;  4NJC A;  1VJK A;  2BS4 B;  2FUH B;  4ZYN A;  1WE6 A;  1E0Z A;  4OZC A;  2MX2 A;  1SJH D;  1L0X B;  4BKT A;  1WJN A;  4URK A;  1P7E A;  4KKJ A;  1TS4 A;  2BS3 B;  3P2B A;  1FXT B;  4FN2 A;  3O13 A;  1PGB A;  1WSP A;  1KLU D;  4TUU A;  3SU8 X;  1EF1 A;  3UQB A;  1FNU A;  3IT6 B;  3NUH B;  1V2Y A;  2MSE D;  2KN5 A;  4PK1 A;  3AE1 B;  4RNA A;  1E8W A;  4H2A A;  3UIN B;  1WM3 A;  1GAQ B;  3AB5 A;  2LWP A;  2NMQ A;  4L2Y A;  4RF1 A;  4Q2J A;  2UYZ B;  5E6O A;  2QSD A;  1N5W A;  1UGM A;  3J9C A;  1J0G A;  1YIW A;  1HE8 A;  3ZJU A;  4M00 A;  3PZD A;  1T0S C;  1UF0 A;  3HM6 X;  1HXY D;  1R4N B;  2AQ1 B;  4WQO B;  2JU6 X;  3ZJV A;  4PS8 A;  5FKA C;  3PSE B;  1V1P A;  1ET9 A;  3AE7 B;  5HKH A;  3MP9 A;  1EM7 A;  3ALB A;  2JVC A;  4WJQ A;  4LDT D;  2HDE A;  3PHX B;  2ZNV B;  3MC9 A;  2UWQ A;  4JGH B;  1R4M B;  1N60 A;  1P9D U;  2M19 A;  1JRP A;  4A90 A;  4K7U A;  2KHW B;  3RT3 B;  3SD5 A;  1D5Z C;  1NEK B;  3T9L A;  3UIO B;  2J0J A;  1F1H A;  1IP9 A;  2ZVO A;  3WAO A;  3PRM B;  4W9D A;  4FA6 A;  2GBJ A;  1FMA D;  4KZ0 A;  1OEY J;  1WFY A;  1WWT A;  2A4Z A;  3APC A;  1SE4 A;  3NS1 A;  4P1C C;  4JPS A;  1JQ4 A;  1OQY A;  4HWI B;  5H8Y E;  3TBL D;  1VCB A;  1XT9 B;  1SF0 A;  3HVD A;  4OZB A;  3RNF C;  3R7Q A;  2GRI A;  5G5H A;  1AWD A;  3H7P B;  2N7J A;  4EZK A;  4RMA A;  5EE9 A;  4YXD B;  1SGH A;  3L0W B;  1HQR D;  2IO1 B;  2MJ3 A;  1XXG A;  3I9V 1;  2L32 A;  2L0F A;  3ZO5 B;  4OW0 A;  1DOI A;  1H8C A;  2GOW A;  2KK8 A;  2N0S B;  2CS4 A;  1N62 A;  1MJD A;  4EZL A;  1WGH A;  1C4A A;  2KQS A;  4JLC A;  4C56 C;  3RYT A;  4FJY A;  3PZ7 A;  3A1Q B;  4W9C A;  3QAR A;  3JSV A;  2IO0 B;  1NYQ A;  4M8N A;  1A5R A;  5KHO A;  1XD3 B;  2D10 A;  3PZ8 A;  1WZ0 A;  3DQV A;  2YEP B;  3X0W A;  3AE3 B;  2Y5C A;  4NAW B;  1UZX B;  4BOZ B;  1KRH A;  4W9K A;  2MQJ A;  1HTO A;  2KTR B;  1E7P B;  3EFU A;  3QC8 B;  2VH1 A;  3L13 A;  5C23 A;  3Q8C A;  2VRR B;  3AUL A;  1V5O A;  4GSW A;  2SEB D;  5DPR A;  4XGA B;  5AUK A;  4KGR A;  2D3G A;  4IKG A;  2FCN A;  5IP4 D;  5DPW A;  1C4C A;  1R7S A;  3NRZ A;  3ONS A;  4WJO A;  3R8B A;  3SEB A;  2GBK A;  4MT5 A;  4JQW C;  4W9L A;  4W9F A;  5CHW A;  3BZD B;  2WGS A;  5LLI A;  5IA7 A;  2NBU A;  5CHF A;  2J0K A;  4TQ1 A;  2DYB A;  3I5J C;  2CHZ A;  2Z8L A;  2V3N A;  4WJN A;  2KVZ A;  4OHJ A;  2WXJ A;  1BML C;  4GDL A;  4TMA B;  4ZRJ A;  4YSZ B;  2WU2 B;  4JWS C;  2ACZ B;  1SIF A;  1SJE D;  3Q14 C;  4WUR A;  2QC8 A;  4EEW A;  3ABV B;  4GDK B;  3NHE B;  3A4R A;  4FUL A;  1ZXH A;  1YJ1 A;  4HKZ E;  2K6D B;  2D5G A;  3DWM A;  1C4P A;  3ZRF A;  5HG2 A;  2BWF A;  3UQA A;  5JH5 C;  2XNA C;  2AQ2 B;  2DBY A;  2JY6 A;  4MGI E;  4M8M A;  5JHB A;  2G45 B;  2WXR A;  3BII D;  3L54 A;  2KC2 A;  3ZIM A;  2WXK A;  4DHJ B;  2XBB C;  2HTH A;  1WGG A;  3D32 A;  1UNS A;  3RCZ A;  3S2A A;  2L3Z A;  2JZZ A;  2LHD A;  2Z0D B;  3KUZ A;  4A3P A;  3RZW C;  2VZK D;  2VH2 A;  4ZYS A;  2IGG A;  1RAX A;  3FIL B;  2JRI B;  4FLH A;  3H9D A;  3EFC A;  1GG3 A;  1ET6 A;  1GOZ A;  3L08 A;  2KYW A;  5TR5 A;  2JWU A;  3JYU A;  3GS2 A;  1KTK A;  4LK0 M;  1L2N A;  1FD6 A;  3C0R B;  1ESF A;  2MRP A;  1F9J A;  1Q10 A;  1TJE A;  2KQ4 X;  4C7Z A;  4DXA B;  1L7Y A;  3AU5 A;  3MFG A;  3BK2 A;  2WXH A;  2MWS B;  2W54 A;  3A9J A;  1QLB B;  1J19 A;  2KT7 A;  4KGS A;  4XYC A;  2KDF B;  3ML8 A;  3PVL A;  3A33 B;  4ICV A;  2E3T A;  2K9X A;  2MA9 B;  1XLO A;  1T3Q A;  1UWX A;  4AQ7 A;  3W1Y A;  2PMV A;  1WRI A;  2IYD B;  4LLG M;  4DHZ E;  4IM2 A;  4RGT A;  1WR1 A;  2D3A A; 
#chains in the Genus database with same CATH homology
 2BYV E;  4F7Z A;  1ZW7 A;  2DEN B;  3M3J A;  3KYD D;  1UBI A;  3JSV B;  2NBV B;  3IVF A;  4GDK A;  1WIA A;  2PJH A;  3PRP B;  4J6I A;  5JZE B;  1C3T A;  5DPT A;  2G3Q B;  3ML9 A;  4KSK C;  2Z59 B;  2BKF A;  3ENE A;  3WAP A;  3IG3 A;  5J2R A;  1YQB A;  2DX5 B;  2G4S A;  4IWQ A;  4W9G A;  4RM8 A;  4ANW A;  4HCN B;  5G2N A;  5L83 A;  2ZZP B;  2CU1 A;  3H6N A;  3KVF B;  4TV3 A;  4PYU A;  2ASQ A;  2WX1 A;  5D2M B;  4A3O A;  4BKS A;  2C7M B;  2YVC A;  3ZRC A;  1EUV B;  2W9N A;  4DHZ B;  3H7P A;  2MP2 B;  4FHJ A;  2ZPY A;  4N9F 4;  2BF8 B;  4AWJ A;  1MG8 A;  1LM8 B;  3ECI A;  2L0T A;  3VH4 B;  1I42 A;  1V80 A;  2Z0E B;  3APD A;  4II2 B;  4BFR A;  2MBE A;  3DVG X;  2CHX A;  2MBH A;  2WX0 A;  3CF6 E;  1GC7 A;  3PRE A;  2NCN A;  3MJW A;  4HLE A;  2C5L C;  2I1J A;  4TKN A;  2NVU I;  4ANV A;  5EDS A;  4IC7 B;  4MSQ B;  2J7Q B;  2M8S A;  1KJT A;  2KVR A;  2LD9 A;  2LXC A;  2PE6 B;  3L16 A;  3PHW B;  1YD8 U;  1GUA B;  1AAR A;  3KH0 A;  4HK2 A;  4OVV A;  1P1A A;  2EKE C;  4NJ7 A;  3NS8 A;  1SE9 A;  3IHP C;  1WGY A;  2FIF A;  1WXA A;  2JZ3 B;  4NNJ B;  3PPA A;  4OVU A;  4PS3 A;  5E6N A;  5J18 A;  2EMT A;  1V49 A;  1Z5S B;  2K39 A;  3DVN V;  4FBJ B;  5CHV C;  3VH3 B;  2G4D B;  2OOB B;  5CTR C;  2I1K A;  3A1Q A;  2KWC A;  2KJR A;  4NJ6 A;  2N7D A;  4I6P A;  2LVO A;  4IM3 A;  4KDL B;  4MJS B;  3IFW B;  5DPS A;  4GDL B;  4W9J A;  2MCN B;  1I35 A;  1LQB A;  1NI2 A;  2N9P C;  3QWZ B;  2KLG A;  2ZNV C;  4HDQ A;  4CO7 A;  1U4A A;  2BPS A;  2FUH B;  3CSF A;  2DZM A;  4ZYN A;  4G3X B;  1WE6 A;  3JVZ X;  4LJO B;  4EOY A;  3Q3J A;  2MX2 A;  3ZVV A;  4M0W B;  4MDK E;  5G55 A;  2KTR A;  3LJ3 A;  4GB9 A;  1GC6 A;  1WH3 A;  4AJY B;  4W9E A;  4E3C A;  1E7V A;  4BKT A;  1WJN A;  4AJW A;  4URK A;  2LXA A;  4ICU A;  1OGW A;  2XK5 B;  3V62 A;  2KMC A;  3P2B A;  3DBR I;  1FXT B;  4FN2 A;  4DHJ D;  4FAD A;  1BT0 A;  1UD7 A;  4K81 A;  5CX3 A;  4GXB A;  4TUU A;  3SU8 X;  3V6C B;  4KIK B;  1EF1 A;  1P98 A;  1WX9 A;  2FAZ A;  3PGE A;  3NZU A;  2IY1 B;  3OAW A;  3UQB A;  1JRU A;  2KJ6 A;  1V2Y A;  2MSE D;  1Q5W B;  3RUI B;  2KN5 A;  1UBQ A;  2KZR A;  4GMV A;  2MBQ A;  3ZDT A;  1WF9 A;  4IWP A;  1E8W A;  2HJ8 A;  5DCN A;  2O2V B;  3UIN B;  2FCM A;  3QIJ A;  1WI0 A;  1WM3 A;  2ZVN A;  1NBF C;  4WAA A;  2DAJ A;  1PQS A;  3N32 A;  2DHZ A;  2DYM A;  3K9P B;  3KW5 B;  2FCS A;  2LWP A;  4FHK A;  2HD5 B;  2PE9 A;  1E8Y A;  3V61 A;  1CMX B;  4X57 B;  2KFK B;  2GBN A;  3VVW B;  4BBN C;  2UYZ B;  1WX8 A;  2K6Q A;  3KYC D;  5E6O A;  3W1S A;  3KUD B;  1Z2M A;  1WJU A;  1UGM A;  1J0G A;  3QJZ A;  2GBR A;  2QHO A;  1YIW A;  1HE8 A;  2MP2 A;  2ZEQ A;  3PZD A;  2A5U A;  2AL3 A;  3A9K B;  4KV2 A;  1E7U A;  2KC1 A;  2KOX A;  2IBI B;  1P3Q U;  2IO2 B;  4XX5 A;  2DAF A;  3HM6 X;  1T0Y A;  4IG7 B;  4MM3 A;  4WQO B;  1J8C A;  3VUW A;  3DVN U;  3GZN I;  4KZC A;  4PS8 A;  3H7S A;  2LVQ A;  2WYQ A;  3PSE B;  2KX0 A;  4JL9 A;  5HKH A;  4TQ0 A;  2NPT B;  3AXC A;  3ALB A;  4MEL A;  3UGB B;  2IO3 B;  2RD0 A;  3LDZ E;  2JVC A;  4DBG A;  3VAW A;  4WJQ A;  4LDT D;  4E74 A;  2DYO A;  1WYW B;  1UEL A;  3PT2 B;  3PHX B;  3QAQ A;  1GJZ A;  1WMH B;  4K7W A;  2ZNV B;  2KD0 A;  3M95 A;  1LFD A;  4FJZ A;  4PS7 A;  5GMV A;  4BOS C;  1WXM A;  2UWQ A;  5FR6 A;  4JGH B;  3SHQ A;  1P9D U;  4MGZ E;  3TL5 A;  4LJP B;  1EF5 A;  2V1Y A;  2RPQ A;  2KHW B;  4K7U A;  4F1S A;  4GGQ A;  3PS6 A;  3NY5 A;  3RT3 B;  3SD5 A;  3QHT A;  2HE7 A;  3T9L A;  3UIO B;  2J0J A;  3DDC B;  4HPM B;  1ZKH A;  4DK5 A;  2R2O A;  3U8Z A;  2B3A A;  2KXJ A;  1IP9 A;  2ZVO A;  3DBH I;  4WJP A;  2DZK A;  3WAO A;  2ZPN A;  3PRM B;  1R4N I;  4W9D A;  4FA6 A;  1TTN A;  2GBJ A;  3TJP A;  1E8Z A;  4KZ0 A;  1OEY J;  1WFY A;  2A4Z A;  1P0R A;  5IAA C;  3APC A;  5AZH A;  2BWE S;  3N3K B;  3CMM B;  1IYF A;  2M1M A;  2C60 A;  5KHQ A;  4HDO A;  1OQY A;  3B0A A;  4HWI B;  3TBL D;  2WDT B;  2V4L A;  4MH0 E;  1VCB A;  1XT9 B;  4FJV B;  3R7Q A;  3SDL C;  2O6V B;  2REX A;  2KQ7 A;  3H7P B;  3MTN B;  4EZK A;  4HCP B;  3WAL A;  2AEH A;  2DZI A;  2K8C A;  4RMA A;  3M62 B;  2KKC A;  2OJR A;  4ZRK A;  3U7D A;  1SGH A;  1WXS A;  3L0W B;  2IO1 B;  2KTF A;  4MGY E;  4WWN A;  2L00 B;  2WWZ A;  2CKH B;  2M17 A;  4A20 A;  4HVB A;  1R4M I;  2L0F A;  1G6J A;  2ZJD A;  4I6N B;  1ISN A;  3ZO5 B;  2JWZ A;  3W1S C;  2FNJ B;  1H8C A;  1WGR A;  2GOW A;  2KK8 A;  3TCA A;  2CS4 A;  4K1R B;  4PYZ A;  4EZL A;  1M94 A;  3TIX A;  1TBE A;  1WGH A;  3DOW A;  4BBN F;  2KQS A;  4DWF A;  4JLC A;  3RYT A;  4FJY A;  3O65 B;  4CYE A;  3IBE A;  1KOT A;  3M63 B;  2O6V D;  3A1Q B;  4W9C A;  1E8X A;  3QAR A;  3A9K A;  1Q1O A;  5D7G A;  2JXX A;  2IO0 B;  3JSV A;  2C7N B;  3DCG A;  4M8N A;  1A5R A;  1K8R B;  5KHO A;  1XD3 B;  4NQK E;  2D10 A;  1WM2 A;  1V5T A;  2N1V A;  2RR9 A;  2IZV B;  1QZE A;  3WAM A;  1WZ0 A;  2N9X A;  3DQV A;  3X0W A;  4XC2 A;  4LCD E;  4B6W A;  3B1L X;  2L76 A;  4ZDV A;  4G50 A;  4NAW B;  3H1U A;  4EZJ A;  2LGX A;  3EHV A;  4YL8 A;  1KM7 A;  2BKR B;  3PLU A;  4EUT A;  2L7R A;  1UZX B;  4BOZ B;  1C1Y B;  4NQL B;  3UF8 A;  3JW0 X;  4W9K A;  3R3M A;  2MQJ A;  2KTR B;  3VTU A;  3EFU A;  2LUE A;  3QC8 B;  2D07 B;  3L13 A;  1WJ6 A;  4G0N B;  3RUL A;  3CST A;  5C23 A;  2BGF A;  3TMP B;  1KLV A;  2JPH A;  2VRR B;  2J0M A;  1V86 A;  2RSU A;  3AUL A;  3HHM A;  1V5O A;  3MHS D;  4GSW A;  4HPL B;  5DPR A;  3HK0 A;  4AOF A;  1RLF A;  3V60 A;  2D3G A;  4MSM B;  4GN1 A;  3ZLZ A;  2FCN A;  3VTW A;  2V3S A;  2NBW B;  3UIP B;  2NR2 A;  3B08 A;  5DPW A;  3ONS A;  4WJO A;  2LJ5 A;  3WA0 A;  2N4F A;  2GBK A;  2L8J A;  5L95 C;  2AWT A;  4ASW C;  4JQW C;  2GBM A;  4W9L A;  4W9F A;  5CHW A;  3ZTC A;  3PV1 A;  4ANU A;  2C9W B;  3A9J B;  2LRW A;  3VUX A;  5C1Z A;  3APF A;  2FID A;  5LLI A;  5IA7 A;  2NBU A;  5CHF A;  4AUQ C;  2J0K A;  1OTR B;  2AL6 A;  2K25 A;  4TQ1 A;  1XQQ A;  2DYB A;  5JHA A;  2CHZ A;  4WJN A;  5D6J B;  2KMA A;  2K8H A;  1E90 A;  1X1M A;  1V6E A;  2BYE A;  3ZUN A;  4GU2 A;  1WY8 A;  4MJS A;  2N7E A;  2LI5 A;  4GDL A;  4G11 A;  4GOC A;  3VXW A;  4ZRJ A;  4EKU A;  3R7R A;  2O6V A;  3VHT C;  3RD2 A;  2LAS A;  3QX1 A;  2NS5 A;  3QK0 A;  4WWO A;  3VFK A;  4I6L B;  5AZF A;  2JRH A;  2KO3 A;  1SIF A;  3A4S C;  2YLM A;  4DDG D;  4NPN A;  4EEW A;  2KFJ A;  3GOE A;  4GDK B;  4KDI C;  3N30 A;  3KUC B;  3NHE B;  3VUY A;  4ANX A;  3I3T B;  3A4R A;  4ZRI A;  1RRB A;  2KDB A;  2M0X A;  4FUL A;  2XK5 A;  2RGF A;  2BYF A;  2D2Q A;  1YJ1 A;  4GIV A;  2KDI A;  2K6D B;  1Q0W B;  2LGY A;  4IM0 A;  4DDI D;  3ZNG C;  5AEK B;  3QA8 A;  3VDZ A;  3T8M A;  3ZRF A;  2ZCB A;  2BWF A;  3UQA A;  5JH5 C;  3ZKJ C;  3HM3 A;  2LZ6 A;  4MGI E;  2JY6 A;  3R66 C;  3PTF C;  2JUO A;  3EEC A;  2G45 B;  4M8M A;  4KIK A;  2Y5B B;  3L54 A;  2MLB A;  5AZG A;  2KC2 A;  3ZIM A;  3Q3F A;  3ZW3 A;  4II3 B;  3X23 A;  4B95 A;  3OJ4 B;  2KWU B;  4DHJ B;  1WX7 A;  3DPD A;  1RFA A;  2XBB C;  4IW0 A;  1EO6 A;  2HTH A;  3L10 B;  2JT4 B;  3ZNZ B;  2L05 A;  3PRZ A;  3QCA A;  4KSL C;  1WGG A;  2JF5 A;  2KJH B;  3D32 A;  3ZTD A;  2O2V A;  5J17 A;  1V81 A;  2LGD A;  3RZF A;  3RCZ A;  3S2A A;  2L3Z A;  2JZZ A;  4BVU C;  1S1Q B;  2Z0D B;  3KUZ A;  2KNB A;  2KFK A;  4KVG B;  4NAW A;  4A3P A;  1H4R A;  3DBS A;  2KWV B;  3WAN A;  3RZW C;  3BIN A;  3VQI A;  1WXV A;  2FCQ A;  4RM9 A;  4AP4 C;  4W9I A;  1RAX A;  1WJ4 A;  1TZ1 A;  2EMS A;  2JRI B;  3AI5 A;  3OLM D;  4FLH A;  4MEM A;  5BO4 B;  1OEY A;  3H9D A;  1WGD A;  4B9K A;  1GG3 A;  2C7H A;  3BY4 B;  4BKS D;  4EFO A;  2LRU A;  4E71 A;  2AYO B;  2K1F A;  2M4N A;  5LXI B;  2D11 A;  3NOB A;  2DZJ A;  1WE7 A;  2CHW A;  1LXD A;  3NZS A;  3L08 A;  5JHB A;  1S3S G;  5LXH A;  1TGZ B;  1UH6 A;  1WR6 E;  3QQ8 B;  5TR5 A;  2MBO A;  2ZCC A;  2KLC A;  3AU4 A;  1Y8R C;  3JYU A;  3EC8 A;  2CR5 A;  4MGK E;  2NPT A;  3K9O B;  3V6E B;  4NY0 A;  1L2N A;  4IUM B;  3ZNH B;  3DBL I;  3C0R B;  2MRP A;  4P7I A;  1F9J A;  1YX6 B;  3HIZ A;  2PPH A;  4DXA B;  2KX3 A;  4CHK A;  1WMH A;  1L7Y A;  1ZGU B;  3AU5 A;  2KAN A;  2LVP A;  2GMI C;  2PEA A;  2MW5 A;  2MWS B;  4K7S A;  5D94 A;  3A9J A;  3WIM A;  4F8C B;  1GNU A;  3ZNI D;  1D3Z A;  1VD2 A;  1IPG A;  3ZDM C;  1J19 A;  1YX5 B;  2R2Q A;  3OJ3 A;  2KDF B;  3ML8 A;  3PVL A;  4LDT B;  4HXD A;  2K8B A;  3A33 B;  2IY0 B;  3L17 A;  4ICV A;  1WRD B;  3DVG Y;  4IWO A;  4JIO U;  2MBB B;  2N9E B;  3PLV A;  2MA9 B;  2KDE B;  5E6P A;  1V9J A;  1E5W A;  4W9H A;  3VTV A;  3W1Y A;  4BKG A;  2XEW A;  2IYD B;  1WZ3 A;  4HJK A;  4XZ4 A;  4IM2 A;  4DHZ E;  3U30 A;  1WR1 A;  2N1W A;  1NDD A;  4WWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...