4W9IA

Pvhl:elob:eloc in complex with (2s,4r)-1-((2s,4r)-1-acetyl-4-hydroxypyrrolidine-2-carbonyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9iA00
2LRWA 4NQLB 4FLHA 4ZRIA 3ZW3A 4IM0A 5AZHA 4AJYB 3PTFC 2NPTB 2CR5A 2KJ6A 2MA9B 5KHOA 3SDLC 2KLCA 4FBJB 2KFKB 2LXAA 3HIZA 3A9KA 2Y5BB 3A33B 4RM9A 1WX8A 1HE8A 2FCSA 1KLVA 3RCZA 1KM7A 4JL9A 3L16A 3ZNID 4MGKE 3TCAA 3IG3A 3A4RA 4EKUA 1ISNA 1UELA 3EHVA 3IFWB 3RUIB 4E74A 3A9JA 4ICUA 4XC2A 2RR9A 4HDQA 2KX0A 2DZIA 1C3TA 1SGHA 2MW5A 3ZTDA 1T0YA 1CMXB 2FUHB 1V49A 2L8JA 1YD8U 2D3GA 1YX5B 4GU2A 4B9KA 3KUDB 3PZDA 3D32A 1E8XA 1V86A 5DPSA 4ZRKA 3VUYA 4K1RB 1K8RB 2GMIC 2YLMA 2XK5B 4W9JA 2KDFB 2LVOA 2NBVB 3I3TB 4F7ZA 3TMPB 1BT0A 3WA0A 3MJWA 1WM3A 1M94A 2N1VA 4FJVB 3VVWB 4BBNC 2DX5B 4E3CA 1QZEA 1R4NI 2HJ8A 2KKCA 3PHWB 3DBHI 4GSWA 3VAWA 2KJRA 3VFKA 1E90A 2BYVE 4LCDE 2JF5A 5BO4B 2IZVB 3NY5A 2C60A 3TL5A 3RT3B 1E7UA 3ZTCA 5E6NA 2DAJA 5AZGA 4BKSD 4EUTA 2CS4A 4DDID 2MP2A 1YX6B 1UBQA 4HCPB 2UWQA 3M3JA 1OTRB 3AI5A 3L17A 4EZJA 4PS7A 2D11A 3P2BA 4G11A 4TKNA 1ZW7A 2XEWA 2LI5A 5D2MB 2MX2A 3OAWA 4HDOA 2FIDA 3GOEA 3ZLZA 2LD9A 4IM3A 1UBIA 1V5TA 4GB9A 5GMVA 3KVFB 4AWJA 3L54A 4A3OA 3KYDD 4JGHB 2JRHA 4WJQA 4MDKE 1WM2A 1ZGUB 3K9OB 3H6NA 4K7WA 2KMCA 1TBEA 4NAWB 3X23A 3H7PA 3DBLI 4ZYNA 1YJ1A 2EKEC 2N9PC 4KDLB 4WAAA 1EF1A 2PPHA 3O65B 4G0NB 4ANUA 1V81A 5JH5C 2KHWB 5JHBA 1Q0WB 2Z0EB 3IHPC 2BF8B 5CHFA 3VDZA 4GGQA 3QK0A 4KVGB 4FJZA 2KQSA 3PS6A 2DYMA 2KANA 1J8CA 3K9PB 1XT9B 1WJ6A 2K1FA 3V6EB 2KJHB 1WMHA 2KWCA 2MBQA 1S3SG 2LZ6A 3VTWA 2MBHA 4GOCA 2JWZA 3HM3A 4JQWC 3UIPB 2NPTA 1IP9A 4F1SA 2IY1B 1E5WA 3CSFA 3QJZA 4WJNA 2G4DB 3DVNV 2KFKA 4MM3A 3VHTC 4TQ1A 1WE6A 1Y8RC 4LJPB 4BFRA 3ONSA 3PRMB 3TIXA 2MRPA 2KDBA 4FULA 1P0RA 3DVNU 2ZJDA 2NR2A 3DOWA 3NS8A 2LWPA 3PPAA 4DHZB 2LRUA 4AP4C 3V6CB 3QIJA 4IWPA 4PYZA 4W9CA 3VTVA 1WXSA 3HM6X 2M8SA 3KYCD 3KUZA 4BVUC 2MSED 5LXHA 1I42A 1WYWB 4BKGA 3PREA 4MH0E 3R7RA 2L05A 4ICVA 4ANXA 4DWFA 2J0MA 4RM8A 2BYFA 2OOBB 3WAOA 2GOWA 5CTRC 3ALBA 2QHOA 3SHQA 4W9HA 3ZDMC 4M8NA 4MGYE 3JW0X 2LGDA 2PEAA 1GC6A 1V2YA 5D6JB 3U7DA 3OJ3A 4KSLC 3RYTA 2LXCA 3M95A 3PRZA 3DBRI 4I6NB 2N9EB 2LJ5A 3KH0A 2O2VB 4DHZE 1NDDA 1OGWA 1XQQA 3AU4A 4FN2A 2KK8A 3R3MA 3WAMA 1WGDA 2RSUA 3PV1A 2G45B 5J2RA 3JYUA 2XBBC 3VH3B 3L13A 1WR1A 2JZZA 2PE6B 3RZWC 4KDIC 5DPWA 5TR5A 4TUUA 5AEKB 2FNJB 1OQYA 2J0JA 2ZCCA 3B1LX 5C1ZA 3ZIMA 1JRUA 2KD0A 1G6JA 2D07B 1E8ZA 4K7SA 3N3KB 3RD2A 3AXCA 4NNJB 2WDTB 2BYEA 1GG3A 2BKFA 5CHWA 2KVRA 3SD5A 3QA8A 2DYOA 5LLIA 4W9EA 2A5UA 4JIOU 4LDTB 2GBMA 2ZCBA 1PQSA 4MGIE 2JRIB 3APCA 3DQVA 4WJOA 1D3ZA 1WXMA 4K7UA 2KDEB 2PE9A 4BKSA 2N7EA 3VXWA 2KN5A 2O6VD 3QQ8B 1WX9A 2CHXA 2N7DA 1UD7A 2VRRB 4GDKA 2KX3A 3PGEA 3IVFA 3V62A 4DHJD 2GBJA 2IYDB 2O6VB 2MLBA 4AOFA 2ASQA 3PT2B 1WR6E 4P7IA 4W9FA 3A1QA 2JY6A 3VH4B 3WAPA 2KTRA 4NQKE 2L7RA 3QCAA 2KLGA 5E6PA 3ZO5B 4DHJB 2FIFA 2KO3A 4I6PA 1WGGA 2DAFA 3ZNHB 3APDA 4BBNF 1NI2A 1OEYA 1KOTA 3UF8A 2ZEQA 1OEYJ 3AU5A 3L08A 2C5LC 4HK2A 4XZ4A 1VD2A 4HPLB 4II3B 2KQ7A 3T9LA 4MEMA 1GC7A 4TV3A 3A9KB 3VTUA 1R4MI 2A4ZA 4MJSA 1VCBA 4J6IA 3S2AA 2M4NA 2KZRA 4IUMB 2NCNA 1EO6A 4IC7B 2NBUA 3A9JB 2IO0B 5G55A 5J17A 2MBEA 5IA7A 1WE7A 2KWUB 4EEWA 3DCGA 3VUWA 3PHXB 4GDLA 1RLFA 2LVPA 2ZVOA 3H7SA 3APFA 5DPTA 3BINA 1WX7A 4A3PA 4ANWA 4W9KA 3PLUA 2C9WB 3NOBA 1IPGA 2FCQA 4NPNA 2GBRA 2J7QB 2EMTA 5G2NA 3H9DA 2B3AA 4IM2A 4ZRJA 4CO7A 1V6EA 4EZLA 3R66C 3U30A 2ZPNA 1GUAB 2FAZA 1RAXA 4WWOA 4DDGD 1P1AA 5KHQA 2K25A 1TZ1A 1LQBA 1F9JA 2DENB 3H1UA 3N32A 4GXBA 2O2VA 3QAQA 1UGMA 1RRBA 2PJHA 3CSTA 1A5RA 4B95A 1EF5A 2R2OA 3ZNZB 3ML9A 2MCNB 2YVCA 4IW0A 3ZVVA 5CX3A 2HD5B 4B6WA 2OJRA 2IO2B 2WYQA 5J18A 2L0TA 4MSMB 1WXVA 2CHWA 2BPSA 5AZFA 3UQAA 2CU1A 1WGRA 2MP2B 4M0WB 1WFYA 1YIWA 2KWVB 1P3QU 4KZ0A 2C7HA 1GNUA 4PS3A 1WY8A 1SE9A 5C23A 5D94A 1WGYA 2CKHB 4KSKC 1E8WA 2IO1B 3DPDA 2G3QB 1WGHA 2N1WA 3CF6E 3ENEA 3DVGX 2XK5A 2Z0DB 2D2QA 5IAAC 3JSVB 2AEHA 4GMVA 1KJTA 4N9F4 4IWQA 5D7GA 3H7PB 2V4LA 2J0KA 3DVGY 3L10B 3L0WB 4JLCA 4FADA 2DHZA 1Q5WB 2RD0A 3A4SC 2KXJA 3VUXA 1EUVB 4X57B 4ASWC 2V3SA 1TTNA 1P98A 2O6VA 3MHSD 3QARA 1V9JA 4MSQB 2I1KA 3IBEA 2LVQA 3PSEB 2C7NB 3X0WA 4KIKB 1WRDB 1WMHB 4IG7B 1WIAA 4LDTD 4W9LA 4W9IA 1U4AA 3M63B 4WWNA 4BOZB 5HKHA 3KW5B 4HCNB 1UZXB 2K8CA 2GBNA 3WANA 1J0GA 2HTHA 3NZSA 1X1MA 2WX1A 1RFAA 1H8CA 3BY4B 4TQ0A 1S1QB 1E8YA 3R7QA 2K6DB 4ANVA 2LGYA 2N9XA 3TJPA 2IO3B 3V61A 2CHZA 3NZUA 3VQIA 2MQJA 1NBFC 4GN1A 3T8MA 2RPQA 4LJOB 4W9DA 1WJUA 2MBOA 2N4FA 3ZRCA 2K8HA 2C7MB 5EDSA 2HE7A 1SIFA 1Z2MA 4MELA 2NVUI 1H4RA 3UGBB 5CHVC 4HXDA 3ZKJC 4NAWA 4XX5A 3ZDTA 4EZKA 2IBIB 3W1SA 4HVBA 2IY0B 2REXA 1Q1OA 3UQBA 1WF9A 1WZ0A 3KUCB 3W1SC 2L76A 4NJ6A 3Q3JA 4HJKA 4A20A 4IWOA 2DZMA 3Q3FA 4AJWA 2DZJA 3LJ3A 3W1YA 3QWZB 2FCMA 4OVVA 5L83A 2DYBA 3NHEB 3ZNGC 2K8BA 2M17A 2ZZPB 1V80A 2KNBA 2BGFA 3ECIA 2L00B 5FR6A 4ZDVA 4K81A 3EC8A 2JVCA 2L0FA 3C0RB 3GZNI 4AUQC 4HLEA 3N30A 2FCNA 2LGXA 3U8ZA 1LFDA 3RZFA 3B0AA 1J19A 2R2QA 4KZCA 4WQOB 5JHAA 2UYZB 4G3XB 3B08A 5DCNA 4FHKA 2DZKA 3DDCB 4NY0A 4CHKA 1FXTB 4HPMB 1WXAA 1GJZA 1L7YA 4E71A 2M0XA 1AARA 2G4SA 2M1MA 4OVUA 1L2NA 1WZ3A 2LUEA 2JUOA 4II2B 3QC8B 4GDKB 2D10A 2NS5A 3UIOB 1IYFA 4FJYA 2K6QA 3SU8X 2KMAA 2BWFA 2KC2A 3JSVA 4EOYA 2K39A 2ZNVC 5JZEB 2MBBB 1MG8A 3QX1A 4CYEA 3ML8A 3PLVA 2GBKA 4FHJA 2BWES 1Z5SB 3A1QB 2AWTA 2AYOB 2JPHA 3AULA 4I6LB 2Z59B 2AL6A 3ZUNA 3PVLA 2KTRB 4WJPA 3CMMB 5E6OA 3ZRFA 3LDZE 1ZKHA 3HHMA 2L3ZA 2KOXA 4GIVA 1WJ4A 4F8CB 1I35A 2WX0A 4KIKA 5DPRA 1WH3A 1V5OA 3UINB 1WI0A 1UH6A 3OJ4B 3WALA 5L95C 2JXXA 2BKRB 4RMAA 4KV2A 1YQBA 4DXAB 2W9NA 4MJSB 2RGFA 3OLMD 4PS8A 4NJ7A 5LXIB 2WWZA 1P9DU 4FA6A 1TGZB 2ZPYA 3WIMA 2KFJA 4PYUA 2KTFA 4W9GA 2JZ3B 3JVZX 2I1JA 4WWPA 2MWSB 3TBLD 1E7VA 2LASA 4URKA 3QHTA 2KC1A 2KDIA 3M62B 3PRPB 3DBSA 4GDLB 4HWIB 4EFOA 1LM8B 4G50A 3RULA 1XD3B 3HK0A 3EFUA 4YL8A 4DBGA 3EECA 4BOSC 2ZVNA 4BKTA 1WJNA 2AL3A 1LXDA 2V1YA 2NBWB 3MTNB 4M8MA 2JT4B 1C1YB 2EMSA 2ZNVB 4MGZE 4DK5A 3V60A
chains in the Genus database with same CATH superfamily
3EFCA 4ZRIA 4FLHA 3Q8EA 4IM0A 4FBJB 2LXAA 4MM3B 4QAYA 3HIZA 4RM9A 1HEZE 2FCSA 3RCZA 3ZNID 3TCAA 4EKUA 1UELA 2QC8A 3EHVA 4P1BC 1SGHA 2MW5A 3ZTDA 1T0YA 1YD8U 2W3RA 2D3GA 3D32A 1E8XA 1K8RB 2KACA 2YLMA 4W9JA 4R3DA 3AH7A 1DGJA 3TMPB 1ESFA 2JSVX 1FNVA 3SFDB 4OZBA 1YQ3B 4E3CA 1R4NI 2INCC 3DBHI 1J7BA 2M0AA 1E90A 5C2TB 2BYVE 2JF5A 1HTQA 3NY5A 3ZTCA 5E6NA 2DAJA 2CS4A 2WXIA 5FR3A 2PIAA 1YX6B 1MJDA 3P1MA 4HCPB 4M02A 3AI5A 3EGRA 3I9V1 1Q10A 1SEBD 5D2MB 2D5GA 3OAWA 4HDOA 3KVFB 4AWJA 4A3OA 1WM2A 4S17A 2ZW0A 2KMCA 4RH6A 4WURA 1ZOYB 2BS4B 4XYCA 3H7PA 3DBLI 1YJ1A 4KDLB 1XLOA 1EF1A 1NEKB 1Y56A 2PPHA 4ANUA 5JHBA 2KHWB 2Y3AA 1N60A 4OZCA 2Z0EB 5CHFA 4GGQA 4IDIA 4KVGB 3NG0A 2KANA 3BK1A 2KJHB 3B9JA 3P4RB 2MBQA 1RYJA 1S3SG 2LZ6A 1DOIA 1QILA 4KX6B 4JQWC 3UIPB 1FIQA 1IP9A 2BS3B 2G4DB 3DVNV 1Y8RC 4BFRA 3TIXA 4US8A 3V6CB 4IWPA 3HM6X 4BKGA 3R7RA 1E10A 1KH0A 2L05A 4ANXA 3TSSA 2QMTA 4RM8A 1IGCA 3KQ4A 4W9HA 4M8NA 1AW7A 3RYTA 3DBRI 4DHZE 1NDDA 3AU4A 1XQQA 4FN2A 3R3MA 2RSUA 1IGDA 3IXSA 1WR1A 3ZYYX 4KDIC 1HXYD 4DQOC 4PK1A 2J0JA 5C1ZA 1V8CA 1G6JA 2GRIA 1PGAA 4NNJB 1F52A 2V3NA 3BWUD 2DYOA 2JWUA 2FE8A 2ZCBA 3W5UB 3GE3C 4BAXA 4K7UA 4BKSA 3VXWA 2BTEA 2WXNA 1SE4A 2N7DA 3PGEA 3V62A 4C4VB 1CJEA 1JWUD 1YJJA 2LGSA 4YTPB 2KTRA 2KO3A 3APDA 1OEYA 1OEYJ 3AU5A 2N0SB 4HK2A 2KWDA 1VD2A 4XZ4A 4J6IA 2NTTA 2EKIA 1P7EA 1R4NB 5J17A 1RM6C 2KWUB 1JWSD 3DBHB 3IT6B 4EEWA 3AN1A 2ZVOA 3H7SA 3Q6BA 3APFA 3BINA 3MHZA 3NOBA 1NI3A 1T3QA 2FCQA 1V6EA 3AE9B 3DHIC 1SSNA 2K25A 3I63C 2BQQA 1FNUA 4GXBA 2O2VA 2PJHA 4B95A 3ZNZB 2BYTA 4IOIE 1WRIA 2YVCA 3ETRA 3ZVVA 5J18A 2L32A 1WXVA 2CHWA 2BPSA 5AZFA 2CU1A 4KKJA 2ACZB 2E6XA 2XN9C 1WFYA 1R7SA 1TYGB 2C7HA 4PS3A 1FEHA 5C23A 2HDEA 1WGYA 2MEKA 3AE3B 3ENEA 4TSSA 2XK5A 1TIFA 2D2QA 3H7PB 1SIJA 3L10B 3DVGY 3L0WB 2DHZA 4ITKA 1J7AA 4X57B 1P98A 2N9LA 2QSDA 1V9JA 2I1KA 3IBEA 2LVQA 3VR8B 4KIKB 4LDTD 1YOVB 1U4AA 4WWNA 3NVYA 4BOZB 3RNBC 1QOFA 2K8CA 1J0GA 2HTHA 3NZSA 1H8CA 4JX1C 4TQ0A 1E8YA 2N9XA 3TJPA 2IO3B 3V61A 2CHZA 3NZUA 3VQIA 3BVZA 2MQJA 3LYYA 3T8MA 5AUKA 4W9DA 1WJUA 5EDSA 1Z2MA 1PUTA 1H4RA 4HXDA 3ZDTA 4EZKA 2IBIB 2WDRB 1V1PA 4B0MA 3TEZA 4A20A 4HJKA 4K3CA 2WXFA 2E3TA 1XLPA 5IP4D 2BGFA 2L00B 1MVKA 4ZDVA 3ABVB 3T3NA 3RMKC 2NMQA 3N30A 2LHEA 3RZFA 2PVOD 2R2QA 4WQOB 5JHAA 2H88B 1STEA 1FPYA 4WIPA 4ZHOA 4M0WA 3DDCB 3U7ZA 3BVMA 1WXAA 1L7YA 2G4SA 3QC8B 1D5XC 4FJYA 1TS4A 2GLSA 2BWFA 3JSVA 4CQNA 1T0QC 5JZEB 1KF6B 4FHJA 3PLVA 2GBKA 2BWES 2AYOB 1WSPA 2Z59B 2JQRB 1TKYA 2KTRB 1F0ZA 1FNWA 3LDZE 3AE5B 3HHMA 1QF6A 2RPVA 2WS3B 1BXTA 3OJ4B 1UH6A 5L95C 4OW0A 2BKRB 4RMAA 4P1CC 1YQBA 1UGJA 2RGFA 1P9DU 4W9GA 2KTFA 3TBLD 4WWPA 3QHTA 2KDIA 1ZXIA 3UI3A 5IN7A 1LM8B 4G50A 4ARIA 3Q3NC 3HK0A 4YL8A 2KMMA 4WH4A 2ZVNA 3MTNB 2V1YA 4M8MA 2EMSA 4JPSA 4MGZE 4NQLB 4N6EB 3PTFC 2CR5A 5KHOA 1I4GA 3EA6A 3SDLC 2KLCA 3BVGA 2KFKB 2L83A 1KLGD 1C77A 1XLNA 1WX8A 3U52E 1KM7A 3L16A 2BB6A 2MJDA 1FFVA 5HFYA 1ISNA 4E74A 1F2RI 2V9HA 1JW9D 2KX0A 1C3TA 1V49A 4C7ZA 4GU2A 3KUDB 3PZDA 4ZRKA 1V86A 5DPSA 1OQRA 2JX5A 2XK5B 3I3TB 2WP9B 1BT0A 1HA5A 3Q69A 3WA0A 3MJWA 1WM3A 2N1VA 4FJVB 3VVWB 1QZEA 2HJ8A 3CWIA 3Q8FA 2DBYA 1P7FA 3RT3B 5AZGA 3L4PA 3RN9C 1MHXA 3B2GA 1ET9A 2J52A 2UWQA 3LXFA 4NJCA 3SR6A 4TKNA 2XEWA 3R8BA 4YTMB 2FIDA 3GOEA 2LD9A 4GB9A 3KYDD 4WJQA 4MDKE 1ZGUB 2WXOA 3K9OB 1JWBD 4ZYNA 2EKEC 4WAAA 1V1PB 1WWTA 1Q0WB 4FJZA 1TS3A 4XDCA 1C9FA 2DYMA 1JWAD 3U4EG 1WJ6A 1WMHA 3RNGC 2MJ3A 3MC9A 4MACA 4YT0B 4O1NA 3W2DA 2NPTA 4F1SA 1V97A 3QJZA 1DYQA 1VZ6A 2WQYB 1FM0D 3PZ7A 1FFUA 2KN4A 3RNCC 1XEEA 3PRMB 2MRPA 1P0RA 3DVNU 3PPAA 2LWPA 2I2YA 4AP4C 1WXSA 4BVUC 1ZUD2 1WYWB 3PREA 4XE0A 2PTLA 2BYFA 3WAOA 5CTRC 3ALBA 1N63A 2WXMA 4MGYE 3AECB 3JW0X 3U7DA 1V2YA 5D6JB 3M95A 1BMLC 2LGIA 2M19A 1F2RC 3RFZB 3KH0A 1ACCA 2Z8LA 3WAMA 2KK8A 1WGDA 1L4DB 3VH3B 2PE6B 3RZWC 5DPWA 2Y5PA 2B76B 1KFYB 2FNJB 1EU3A 3NVZA 3B1LX 2KD0A 1E8ZA 2QILA 3AXCA 2WDTB 1XCTL 2BKFA 2KVRA 1MHHE 1I4PA 2D3BA 1A70A 5LLIA 1I4HA 2A5UA 1D3ZA 1PQSA 3DQVA 2BVCA 3Q3MC 2KN5A 4ZYSA 1T0RC 1WX9A 2KX3A 1I4QA 5D3IB 4DHJD 3OWEB 3FAHA 4AOFA 4P7IA 2JY6A 3VH4B 2QEJC 3N1XC 4DHJB 2KLGA 1SF0A 5E6PA 4P6VF 4I6PA 3T3OA 1NI2A 3UF8A 4C56C 2C5LC 2L1AA 3T9LA 4MEMA 1RFKA 1R4MI 4XGAB 2OEDA 2M4NA 3ZXRA 4USAA 5G55A 2WGSA 4XWWA 5IA7A 4YXDB 4HRSA 3DCGA 3PHXB 1RLFA 2LVPA 2JZPA 3P4QB 4RFBA 2C9WB 1I4RA 3N9YC 4NPNA 5G2NA 4ZRJA 4CO7A 1HZ5A 5AUIA 2FAZA 1RAXA 4WWOA 4DDGD 1F9JA 3H1UA 3N32A 2SEBD 2MCNB 2HD5B 2WYQA 2L0TA 4L2YA 3UQAA 4ZOHC 3DHHC 4KZ0A 1PGXA 1TS5A 1WY8A 2CKHB 4KSKC 1E8WA 2IO1B 2G3QB 1WGHA 3CF6E 2Z0DB 2BW2A 5IAAC 4C00A 3DWGC 4GMVA 1ZE3D 4IWQA 5D7GA 1F77A 2J0KA 2RD0A 3FKYA 3VUXA 4ASWC 5FKAC 1NYRA 2O6VA 4MSQB 2PVGC 2W54A 1D5MC 2DWQA 3X0WA 4RGOS 1WMHB 1WIAA 4W9LA 4YWGG 4AQ7A 4W9IA 3M63B 5HKHA 4OVZA 4HCNB 2WXJA 4ARCA 1QOAA 1X1MA 2WX1A 4KKIA 3NS1A 4GN1A 4ZHPA 4M00A 5H92C 1N5XA 2MBOA 3URYA 2C7MB 2INDC 2NVUI 3UGBB 3ZKJC 4NAWA 3UQBA 1WF9A 4P16A 1WZ0A 3W1SC 1SXTA 1D4BA 3BZDB 3KWLA 5H8YE 2DZJA 4LK0M 3QWZB 2FCMA 2ZW1A 2K8BA 2LUMA 2M17A 1E9MA 1V80A 2KNBA 3PZ8A 4K81A 3EC8A 4HKZE 2CU3A 3GZNI 1CZPA 2FCNA 5T8IA 1LFDA 2INPE 1AWDA 5FK9C 4A9AA 5DCNA 1YJIA 5E6JA 1GOZA 2DZKA 1NVID 4NY0A 1FXTB 4HPMB 3NRZA 2WU2B 1QOBA 1AARA 1L2NA 1ZPSA 4N59A 1ZDXA 4LNKA 2JUOA 5LNK1 3GE8C 2D10A 1UWXA 3SU8X 4EOYA 2K39A 2MBBB 4CYEA 2GB1A 1WXQA 2KVZA 3I57A 2AWTA 4I6LB 2WXQA 4HPPA 4WJPA 2X8XX 3CMMB 3DBLB 2J42A 2KOXA 4GIVA 4F8CB 2WX0A 1UNSA 1WH3A 2WU5B 4ZRQA 3WALA 2BBCA 3RNAC 1N61A 4PS8A 2NTSA 5LXIB 1ZXHA 2OJWA 1KLUD 1TGZB 4WAFA 3JVZX 1C76A 4DXFA 3KLSX 1E7VA 4URKA 3PRPB 3DBSA 3C19A 4EFOA 3W9CB 4OZAA 1M4VA 1EWYC 4BKTA 2G1EA 2JT4B 4DK5A 2ON8A 3ZW3A 3ZQ4A 5AZHA 4AJYB 3H8HA 1IUEA 3A9KA 2Y5BB 3A33B 4NZLB 1HE8A 1KLVA 3DBRB 1C78A 1FXIA 3J9CA 3IG3A 3RUIB 1B1ZA 2JXTA 3IFWB 3R2TA 2RR9A 4HDQA 2YEPF 1XCQL 1WGKA 3Q8AA 5BMIA 2INNE 4B9KA 3VUYA 4K3BA 2KDFB 2NBVB 4F7ZA 1TZOA 2VZKD 4FXCA 1L0YB 1M94A 3P42A 1YMHE 1I7HA 1ZP0B 2G9HD 3HUIA 2VZKB 3VAWA 2KJRA 3VFKA 2W55A 1GPXA 1ENFA 2C60A 3GS2A 2H89B 3TL5A 4BKSD 4DDID 3M3JA 1OTRB 3DWMA 2D11A 4G11A 1ZW7A 2MX2A 4KGRA 1C4PA 5D3DA 3IT4B 4IM3A 1YQ4B 3VR9B 2XNAC 5IO9A 3L54A 4JGHB 5BMHA 3E9SA 3H6NA 1TBEA 3Q2AC 4NAWB 3X23A 3NJTA 3U2SC 3GZNB 3C8YA 3O65B 4G0NB 2CJOA 2KQ4X 5EE1A 3AEGB 3IHPC 2BF8B 2PW9A 5HHDG 2KQSA 3PS6A 2PMVA 2K1FA 3N1YC 2W82A 3N20C 2KWCA 3VTWA 2MBHA 2JWZA 3HM3A 4TMAB 2VH2A 2IY1B 4WJNA 4MM3A 3HRDD 3VHTC 2KDBA 4FULA 3NS8A 2NR2A 2LRUA 3QIJA 4W9CA 1L0VB 2M8SA 3KYCD 3KUZA 2VH1A 1I42A 5LXHA 4JWUC 5EE9A 1E7PB 3V3XA 1EM7A 1MFWA 2BB5A 2OOBB 1NYQA 2RDHA 2QHOA 3GP7A 1GC6A 4MH8A 3OJ3A 3AV8A 2UU7A 3PRZA 4PT5A 2LJ5A 2O2VB 1OGWA 3WCQA 5J2RA 2XBBC 4HEA1 3L13A 4C80A 2JZZA 1L6VA 2AQ2B 4TUUA 2DNFA 2ZCCA 3ZIMA 1JRUA 4MT5A 4K7SA 1FXAA 4US9A 2BYEA 1K53A 1MG4A 3AE6B 2EELA 3SD5A 4W9EA 3BIID 2GBMA 4MGIE 4WJOA 5TSSA 2J4XA 2JRIB 3APCA 2PE9A 5BYSA 2Y5CA 1K51A 1UD7A 2VRRB 1TKEA 1UUPA 2GBJA 1V1OA 2MLBA 3FC4A 2ASQA 1WR6E 2KYWA 3Q8CA 3AE1B 4NQKE 4Q2JA 3ZO5B 4RGNA 3ZNHB 1WGGA 2DAFA 2R61A 2BT6A 3L08A 1J7CA 4HPLB 2N7JA 2KQ7A 1CK1A 3A9KB 3VTUA 1SE3A 2A4ZA 4MJSA 1VCBA 1XO3A 4IUMB 1EO6A 4IC7B 4YSXB 2KDMA 2MBEA 1JCKB 4GDLA 1TY2A 1WX7A 4A3PA 4ANWA 5JXVA 1AYFA 1IPGA 5HI1A 2GBRA 4EZLA 3R66C 3OG5A 2ZPNA 1OFFA 1P1AA 1XF5L 3B2FA 3AE4B 5I4DA 1LQBA 3AEAB 3AE2B 3QAQA 3TEYA 3CSTA 1IBXA 1ET6A 2LEKA 1KTKA 3ML9A 1FD6A 2MHJA 5CX3A 4B6WA 1ROEA 2OJRA 3R2IA 2KAJA 2TSSA 4M0WB 1YIWA 4A8XC 5BYQA 3AEFB 5EE3A 4A6QA 1FCCC 3DPDA 3P4SB 3DVGX 4NAMA 3JSVB 1JALA 4JLCA 1DOXA 5MPOA 1Q5WB 3A4SC 3DHGC 2PLPA 1EUVB 1SE2A 3IAM1 3QARA 3ZJVA 3AE8B 1D5ZC 3NVWA 4IG7B 1TS2A 1MI0A 1UZXB 2AX5A 3AMZA 1LGRA 3BY4B 1S1QB 5BMGA 3ZJTA 3AEDB 2RPQA 2N4FA 2HE7A 1SIFA 4MELA 4HJGE 1VRAB 5CHVC 2RDBC 4XX5A 1LO5D 3MFGA 3W1SA 1SJHD 1B9RA 2J53A 4LNOA 3KUCB 2L76A 4IWOA 4AJWA 3LJ3A 5L83A 4OVVA 2DYBA 2Q5WD 3AEBB 3NHEB 3ZNGC 4YSYB 2IGGA 1L5PA 3P63A 4WQMA 3I5JC 3ZXVA 3ECIA 4RCOA 2JVCA 4ACFA 4AUQC 2QJLA 1FMAD 1T5XD 1J19A 3SFEB 2UYZB 2WXGA 3RNEC 1YNTE 4BZAA 1TT5B 3W5VB 2LFIA 4WWMA 2WHIA 2FUG1 2M0XA 2M1MA 4OVUA 1TJEA 1QT9A 4II2B 2NS5A 4XDDA 2K6QA 2KC2A 5EE0A 1MG8A 2GI9A 1Z5SB 3AULA 3PVLA 3BYTB 2QDFA 4LNIA 2N9KA 5E6OA 1ZKHA 2IJ0A 3MJ5A 2L3ZA 2LHDA 2M56B 5G5HA 1I35A 3AEEB 4KIKA 1V5OA 1WI0A 1OQQA 4MJSB 4RGTA 2WWZA 1K52A 2I38A 2ZPYA 2K3UA 2JZ3B 4RF0A 2I1JA 4D2KA 1FRDA 2KC1A 4GDLB 4HWIB 1FO4A 1RWSA 3FILA 1DOYA 1XD3B 3EFUA 1VZ7A 4DBGA 4BOSC 1LXDA 1C1YB 3V60A 2LRWA 3Q3OC 2JYEA 1JMLA 2NPTB 1IBXB 2KJ6A 2MA9B 2HTME 5IOIA 1UWMA 1I4XA 4JL9A 4MGKE 2CJNA 3VRAB 3A4RA 5G5GA 3A9JA 4ICUA 4XC2A 2DZIA 1HQRD 4H2AA 1CMXB 1EU4A 2FUHB 2L8JA 1XLQA 1YX5B 3KWVA 4K1RB 3TEXA 2GMIC 3BYYB 2LVOA 3CIRB 3O13A 4BBNC 2DX5B 2KKCA 2WNMA 3PHWB 2JYTA 4GSWA 2MJEA 4LLGM 4LCDE 5BO4B 2IZVB 3Q14C 1E7UA 2WXKA 1K50A 4KGTA 4EUTA 2YEPB 2MP2A 1UBQA 3L17A 4EZJA 4PS7A 3P2BA 5HG2A 2WXLA 2LI5A 3BK2A 3ZLZA 4S0RA 1UBIA 1V5TA 5GMVA 3IAS1 2JRHA 2PKOA 1JWMD 4B0EA 4K7WA 1R4MB 2N9PC 1C4CA 5JH5C 2V3PA 1V81A 3VDZA 2QCZA 3QK0A 3AB5A 1J8CA 3K9PB 1XT9B 2L52A 3V6EB 1XXGA 4ZRPA 2WXRA 4LNNA 3ZGZA 1QQRA 2K0PA 4GOCA 2IPKD 5IKCM 2X38A 3LB8C 3NUHB 1E5WA 3CSFA 3V05A 2KFKA 4TQ1A 1WE6A 4LJPB 3ONSA 2ZJDA 3DOWA 4DHZB 1T6BX 2IGHA 4PYZA 3NZ3A 3VTVA 1D6EC 2MSED 3RI7C 4MH0E 2QIEB 4REZA 4ICVA 2MH7A 4DWFA 2J0MA 2GOWA 3SHQA 3ZDMC 4RF1A 4N58A 1L4ZB 2LGDA 2PEAA 4KSLC 2LXCA 4I6NB 2N9EB 4J3OD 3PV1A 2G45B 1N5WA 1KRHA 3JYUA 3NVVA 1VLBA 3PO0A 4JWSC 5TR5A 5AEKB 2BS2B 1OQYA 4L1BA 2FBWB 3E56A 1JRPA 2D07B 3GB1A 3RD2A 3N3KB 4UDUC 1GG3A 4OHJA 1NENB 5CHWA 4YSZB 3QA8A 1VJKA 2V0GA 4JIOU 4LDTB 1WXMA 2KDEB 4HROA 2N7EA 2O6VD 3QQ8B 1T0SC 2CHXA 3AM9A 4GDKA 3FILB 2IDYA 3IVFA 2IYDB 2O6VB 2K22A 3PT2B 4W9FA 3A1QA 2KT7A 3WAPA 1PFDA 2L7RA 3QCAA 2SAKA 1TY0A 1TKGA 2FIFA 4BBNF 1KOTA 2ZEQA 1JROA 2HJ1A 4II3B 1GC7A 2WXHA 4TV3A 4EE2A 3S2AA 2KZRA 2NCNA 1C79A 2LMCA 2NBUA 3A9JB 2IO0B 3RNFC 1L0XB 3TEWA 4KGSA 1WE7A 3VUWA 1PDXA 1SB3C 5DPTA 4W9KA 4L23A 3PLUA 3RPFC 1L6UA 2J7QB 2EMTA 2K5PA 2B3AA 3H9DA 4IM2A 3U30A 1GUAB 1AN8A 5KHQA 1TZ1A 2DENB 3VRBB 4GLSC 1UGMA 1RRBA 1A5RA 1EF5A 2R2OA 2WXPA 4IW0A 1E0ZA 2IO2B 1ZDVA 4JE3B 4MSMB 2MP2B 1WGRA 2KWVB 1P3QU 2W3SA 4C7YA 1GNUA 2ICIA 1QOGA 1SE9A 5D94A 3EUB2 2DLBA 2RMMA 4RNAA 2N1WA 2D3AA 2AEHA 1KJTA 4LTUA 4N9F4 1CQVA 2V4LA 4FADA 1GB1A 2KXJA 1BUIC 1YN4A 2JU6X 2V3SA 1TTNA 3MHSD 3PSEB 2C7NB 3HVZA 1WRDB 2K9XA 3HVDA 3MC0B 3KW5B 2GBNA 2LJIA 3WANA 4A55A 1HTOA 1RFAA 1N62A 3Q8BA 3R7QA 4ANVA 2K6DB 2LGYA 2WDVB 1NBFC 4LJOB 3ZRCA 2K8HA 4IKGA 1N6ZA 1PYWD 2WLBA 4HVBA 2IY0B 2REXA 1Q1OA 4NJ6A 3Q3JA 2DZMA 3Q3FA 5C3JB 3W1YA 2OHFA 1C4AA 4XWTA 1SBBB 1GB4A 2ZZPB 1FRRA 1HZ6A 5FR6A 2L0FA 3C0RB 4HLEA 2LGXA 3U8ZA 1PGBA 3B0AA 4KZCA 1JQ4A 4G3XB 3B08A 4YTNB 4FHKA 1VZ8A 3ZJUA 3N1ZC 1EWCA 2AQ1B 1VR9A 4CHKA 1FCLA 1GJZA 4E71A 1YN3A 1WZ3A 2LUEA 1WYGA 4GDKB 2ONQA 4HKQA 3UIOB 1IYFA 1QKZA 2KMAA 3SEBA 3MC8A 2V4IB 2ZNVC 3QX1A 3ML8A 2IGDA 4RGMA 3A1QB 2JPHA 2AL6A 3ZUNA 3AE7B 1F1HA 4M01A 3TUOA 1QLBB 4A90A 3ZRFA 1WJ4A 5DPRA 3UINB 2AQ3B 4DXGA 2JXXA 4KV2A 4DXAB 2W9NA 3OLMD 2RDGA 4NJ7A 4FA6A 3WIMA 2KFJA 4PYUA 2MWSB 2LASA 3P4PB 5GXGB 3M62B 5BYRA 4LNFA 3RULA 1YN5A 1VDVA 4C4VA 3EECA 4AS1A 1GAQB 3MP9A 1E6EB 1UF0A 1WJNA 2AL3A 2WDQB 2NBWB 1SJED 1MPEA 2ZNVB 2D3CA
chains in the Genus database with same CATH topology
2LRWA 4NQLB 4FLHA 4ZRIA 3ZW3A 4IM0A 5AZHA 4AJYB 3PTFC 2NPTB 2CR5A 2KJ6A 2MA9B 5KHOA 3SDLC 2KLCA 4FBJB 2KFKB 2LXAA 3HIZA 3A9KA 2Y5BB 3A33B 4RM9A 1WX8A 1HE8A 2FCSA 1KLVA 3RCZA 1KM7A 4JL9A 3L16A 3ZNID 4MGKE 3TCAA 3IG3A 3A4RA 4EKUA 1ISNA 1UELA 3EHVA 3IFWB 3RUIB 4E74A 3A9JA 4ICUA 4XC2A 2RR9A 4HDQA 2KX0A 2DZIA 1C3TA 1SGHA 2MW5A 3ZTDA 1T0YA 1CMXB 2FUHB 1V49A 2L8JA 1YD8U 2D3GA 1YX5B 4GU2A 4B9KA 3KUDB 3PZDA 3D32A 1E8XA 1V86A 5DPSA 4ZRKA 3VUYA 4K1RB 1K8RB 2GMIC 2YLMA 2XK5B 4W9JA 2KDFB 2LVOA 2NBVB 3I3TB 4F7ZA 3TMPB 1BT0A 3WA0A 3MJWA 1WM3A 1M94A 2N1VA 4FJVB 3VVWB 4BBNC 2DX5B 4E3CA 1QZEA 1R4NI 2HJ8A 2KKCA 3PHWB 3DBHI 4GSWA 3VAWA 2KJRA 3VFKA 1E90A 2BYVE 4LCDE 2JF5A 5BO4B 2IZVB 3NY5A 2C60A 3TL5A 3RT3B 1E7UA 3ZTCA 5E6NA 2DAJA 5AZGA 4BKSD 4EUTA 2CS4A 4DDID 2MP2A 1YX6B 1UBQA 4HCPB 2UWQA 3M3JA 1OTRB 3AI5A 3L17A 4EZJA 4PS7A 2D11A 3P2BA 4G11A 4TKNA 1ZW7A 2XEWA 2LI5A 5D2MB 2MX2A 3OAWA 4HDOA 2FIDA 3GOEA 3ZLZA 2LD9A 4IM3A 1UBIA 1V5TA 4GB9A 5GMVA 3KVFB 4AWJA 3L54A 4A3OA 3KYDD 4JGHB 2JRHA 4WJQA 4MDKE 1WM2A 1ZGUB 3K9OB 3H6NA 4K7WA 2KMCA 1TBEA 4NAWB 3X23A 3H7PA 3DBLI 4ZYNA 1YJ1A 2EKEC 2N9PC 4KDLB 4WAAA 1EF1A 2PPHA 3O65B 4G0NB 4ANUA 1V81A 5JH5C 2KHWB 5JHBA 1Q0WB 2Z0EB 3IHPC 2BF8B 5CHFA 3VDZA 4GGQA 3QK0A 4KVGB 4FJZA 2KQSA 3PS6A 2DYMA 2KANA 1J8CA 3K9PB 1XT9B 1WJ6A 2K1FA 3V6EB 2KJHB 1WMHA 2KWCA 2MBQA 1S3SG 2LZ6A 3VTWA 2MBHA 4GOCA 2JWZA 3HM3A 4JQWC 3UIPB 2NPTA 1IP9A 4F1SA 2IY1B 1E5WA 3CSFA 3QJZA 4WJNA 2G4DB 3DVNV 2KFKA 4MM3A 3VHTC 4TQ1A 1WE6A 1Y8RC 4LJPB 4BFRA 3ONSA 3PRMB 3TIXA 2MRPA 2KDBA 4FULA 1P0RA 3DVNU 2ZJDA 2NR2A 3DOWA 3NS8A 2LWPA 3PPAA 4DHZB 2LRUA 4AP4C 3V6CB 3QIJA 4IWPA 4PYZA 4W9CA 3VTVA 1WXSA 3HM6X 2M8SA 3KYCD 3KUZA 4BVUC 2MSED 5LXHA 1I42A 1WYWB 4BKGA 3PREA 4MH0E 3R7RA 2L05A 4ICVA 4ANXA 4DWFA 2J0MA 4RM8A 2BYFA 2OOBB 3WAOA 2GOWA 5CTRC 3ALBA 2QHOA 3SHQA 4W9HA 3ZDMC 4M8NA 4MGYE 3JW0X 2LGDA 2PEAA 1GC6A 1V2YA 5D6JB 3U7DA 3OJ3A 4KSLC 3RYTA 2LXCA 3M95A 3PRZA 3DBRI 4I6NB 2N9EB 2LJ5A 3KH0A 2O2VB 4DHZE 1NDDA 1OGWA 1XQQA 3AU4A 4FN2A 2KK8A 3R3MA 3WAMA 1WGDA 2RSUA 3PV1A 2G45B 5J2RA 3JYUA 2XBBC 3VH3B 3L13A 1WR1A 2JZZA 2PE6B 3RZWC 4KDIC 5DPWA 5TR5A 4TUUA 5AEKB 2FNJB 1OQYA 2J0JA 2ZCCA 3B1LX 5C1ZA 3ZIMA 1JRUA 2KD0A 1G6JA 2D07B 1E8ZA 4K7SA 3N3KB 3RD2A 3AXCA 4NNJB 2WDTB 2BYEA 1GG3A 2BKFA 5CHWA 2KVRA 3SD5A 3QA8A 2DYOA 5LLIA 4W9EA 2A5UA 4JIOU 4LDTB 2GBMA 2ZCBA 1PQSA 4MGIE 2JRIB 3APCA 3DQVA 4WJOA 1D3ZA 1WXMA 4K7UA 2KDEB 2PE9A 4BKSA 2N7EA 3VXWA 2KN5A 2O6VD 3QQ8B 1WX9A 2CHXA 2N7DA 1UD7A 2VRRB 4GDKA 2KX3A 3PGEA 3IVFA 3V62A 4DHJD 2GBJA 2IYDB 2O6VB 2MLBA 4AOFA 2ASQA 3PT2B 1WR6E 4P7IA 4W9FA 3A1QA 2JY6A 3VH4B 3WAPA 2KTRA 4NQKE 2L7RA 3QCAA 2KLGA 5E6PA 3ZO5B 4DHJB 2FIFA 2KO3A 4I6PA 1WGGA 2DAFA 3ZNHB 3APDA 4BBNF 1NI2A 1OEYA 1KOTA 3UF8A 2ZEQA 1OEYJ 3AU5A 3L08A 2C5LC 4HK2A 4XZ4A 1VD2A 4HPLB 4II3B 2KQ7A 3T9LA 4MEMA 1GC7A 4TV3A 3A9KB 3VTUA 1R4MI 2A4ZA 4MJSA 1VCBA 4J6IA 3S2AA 2M4NA 2KZRA 4IUMB 2NCNA 1EO6A 4IC7B 2NBUA 3A9JB 2IO0B 5G55A 5J17A 2MBEA 5IA7A 1WE7A 2KWUB 4EEWA 3DCGA 3VUWA 3PHXB 4GDLA 1RLFA 2LVPA 2ZVOA 3H7SA 3APFA 5DPTA 3BINA 1WX7A 4A3PA 4ANWA 4W9KA 3PLUA 2C9WB 3NOBA 1IPGA 2FCQA 4NPNA 2GBRA 2J7QB 2EMTA 5G2NA 3H9DA 2B3AA 4IM2A 4ZRJA 4CO7A 1V6EA 4EZLA 3R66C 3U30A 2ZPNA 1GUAB 2FAZA 1RAXA 4WWOA 4DDGD 1P1AA 5KHQA 2K25A 1TZ1A 1LQBA 1F9JA 2DENB 3H1UA 3N32A 4GXBA 2O2VA 3QAQA 1UGMA 1RRBA 2PJHA 3CSTA 1A5RA 4B95A 1EF5A 2R2OA 3ZNZB 3ML9A 2MCNB 2YVCA 4IW0A 3ZVVA 5CX3A 2HD5B 4B6WA 2OJRA 2IO2B 2WYQA 5J18A 2L0TA 4MSMB 1WXVA 2CHWA 2BPSA 5AZFA 3UQAA 2CU1A 1WGRA 2MP2B 4M0WB 1WFYA 1YIWA 2KWVB 1P3QU 4KZ0A 2C7HA 1GNUA 4PS3A 1WY8A 1SE9A 5C23A 5D94A 1WGYA 2CKHB 4KSKC 1E8WA 2IO1B 3DPDA 2G3QB 1WGHA 2N1WA 3CF6E 3ENEA 3DVGX 2XK5A 2Z0DB 2D2QA 5IAAC 3JSVB 2AEHA 4GMVA 1KJTA 4N9F4 4IWQA 5D7GA 3H7PB 2V4LA 2J0KA 3DVGY 3L10B 3L0WB 4JLCA 4FADA 2DHZA 1Q5WB 2RD0A 3A4SC 2KXJA 3VUXA 1EUVB 4X57B 4ASWC 2V3SA 1TTNA 1P98A 2O6VA 3MHSD 3QARA 1V9JA 4MSQB 2I1KA 3IBEA 2LVQA 3PSEB 2C7NB 3X0WA 4KIKB 1WRDB 1WMHB 4IG7B 1WIAA 4LDTD 4W9LA 4W9IA 1U4AA 3M63B 4WWNA 4BOZB 5HKHA 3KW5B 4HCNB 1UZXB 2K8CA 2GBNA 3WANA 1J0GA 2HTHA 3NZSA 1X1MA 2WX1A 1RFAA 1H8CA 3BY4B 4TQ0A 1S1QB 1E8YA 3R7QA 2K6DB 4ANVA 2LGYA 2N9XA 3TJPA 2IO3B 3V61A 2CHZA 3NZUA 3VQIA 2MQJA 1NBFC 4GN1A 3T8MA 2RPQA 4LJOB 4W9DA 1WJUA 2MBOA 2N4FA 3ZRCA 2K8HA 2C7MB 5EDSA 2HE7A 1SIFA 1Z2MA 4MELA 2NVUI 1H4RA 3UGBB 5CHVC 4HXDA 3ZKJC 4NAWA 4XX5A 3ZDTA 4EZKA 2IBIB 3W1SA 4HVBA 2IY0B 2REXA 1Q1OA 3UQBA 1WF9A 1WZ0A 3KUCB 3W1SC 2L76A 4NJ6A 3Q3JA 4HJKA 4A20A 4IWOA 2DZMA 3Q3FA 4AJWA 2DZJA 3LJ3A 3W1YA 3QWZB 2FCMA 4OVVA 5L83A 2DYBA 3NHEB 3ZNGC 2K8BA 2M17A 2ZZPB 1V80A 2KNBA 2BGFA 3ECIA 2L00B 5FR6A 4ZDVA 4K81A 3EC8A 2JVCA 2L0FA 3C0RB 3GZNI 4AUQC 4HLEA 3N30A 2FCNA 2LGXA 3U8ZA 1LFDA 3RZFA 3B0AA 1J19A 2R2QA 4KZCA 4WQOB 5JHAA 2UYZB 4G3XB 3B08A 5DCNA 4FHKA 2DZKA 3DDCB 4NY0A 4CHKA 1FXTB 4HPMB 1WXAA 1GJZA 1L7YA 4E71A 2M0XA 1AARA 2G4SA 2M1MA 4OVUA 1L2NA 1WZ3A 2LUEA 2JUOA 4II2B 3QC8B 4GDKB 2D10A 2NS5A 3UIOB 1IYFA 4FJYA 2K6QA 3SU8X 2KMAA 2BWFA 2KC2A 3JSVA 4EOYA 2K39A 2ZNVC 5JZEB 2MBBB 1MG8A 3QX1A 4CYEA 3ML8A 3PLVA 2GBKA 4FHJA 2BWES 1Z5SB 3A1QB 2AWTA 2AYOB 2JPHA 3AULA 4I6LB 2Z59B 2AL6A 3ZUNA 3PVLA 2KTRB 4WJPA 3CMMB 5E6OA 3ZRFA 3LDZE 1ZKHA 3HHMA 2L3ZA 2KOXA 4GIVA 1WJ4A 4F8CB 1I35A 2WX0A 4KIKA 5DPRA 1WH3A 1V5OA 3UINB 1WI0A 1UH6A 3OJ4B 3WALA 5L95C 2JXXA 2BKRB 4RMAA 4KV2A 1YQBA 4DXAB 2W9NA 4MJSB 2RGFA 3OLMD 4PS8A 4NJ7A 5LXIB 2WWZA 1P9DU 4FA6A 1TGZB 2ZPYA 3WIMA 2KFJA 4PYUA 2KTFA 4W9GA 2JZ3B 3JVZX 2I1JA 4WWPA 2MWSB 3TBLD 1E7VA 2LASA 4URKA 3QHTA 2KC1A 2KDIA 3M62B 3PRPB 3DBSA 4GDLB 4HWIB 4EFOA 1LM8B 4G50A 3RULA 1XD3B 3HK0A 3EFUA 4YL8A 4DBGA 3EECA 4BOSC 2ZVNA 4BKTA 1WJNA 2AL3A 1LXDA 2V1YA 2NBWB 3MTNB 4M8MA 2JT4B 1C1YB 2EMSA 2ZNVB 4MGZE 4DK5A 3V60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRW A;  4NQL B;  4FLH A;  4ZRI A;  3ZW3 A;  4IM0 A;  5AZH A;  4AJY B;  3PTF C;  2NPT B;  2CR5 A;  2KJ6 A;  2MA9 B;  5KHO A;  3SDL C;  2KLC A;  4FBJ B;  2KFK B;  2LXA A;  3HIZ A;  3A9K A;  2Y5B B;  3A33 B;  4RM9 A;  1WX8 A;  1HE8 A;  2FCS A;  1KLV A;  3RCZ A;  1KM7 A;  4JL9 A;  3L16 A;  3ZNI D;  4MGK E;  3TCA A;  3IG3 A;  3A4R A;  4EKU A;  1ISN A;  1UEL A;  3EHV A;  3IFW B;  3RUI B;  4E74 A;  3A9J A;  4ICU A;  4XC2 A;  2RR9 A;  4HDQ A;  2KX0 A;  2DZI A;  1C3T A;  1SGH A;  2MW5 A;  3ZTD A;  1T0Y A;  1CMX B;  2FUH B;  1V49 A;  2L8J A;  1YD8 U;  2D3G A;  1YX5 B;  4GU2 A;  4B9K A;  3KUD B;  3PZD A;  3D32 A;  1E8X A;  1V86 A;  5DPS A;  4ZRK A;  3VUY A;  4K1R B;  1K8R B;  2GMI C;  2YLM A;  2XK5 B;  4W9J A;  2KDF B;  2LVO A;  2NBV B;  3I3T B;  4F7Z A;  3TMP B;  1BT0 A;  3WA0 A;  3MJW A;  1WM3 A;  1M94 A;  2N1V A;  4FJV B;  3VVW B;  4BBN C;  2DX5 B;  4E3C A;  1QZE A;  1R4N I;  2HJ8 A;  2KKC A;  3PHW B;  3DBH I;  4GSW A;  3VAW A;  2KJR A;  3VFK A;  1E90 A;  2BYV E;  4LCD E;  2JF5 A;  5BO4 B;  2IZV B;  3NY5 A;  2C60 A;  3TL5 A;  3RT3 B;  1E7U A;  3ZTC A;  5E6N A;  2DAJ A;  5AZG A;  4BKS D;  4EUT A;  2CS4 A;  4DDI D;  2MP2 A;  1YX6 B;  1UBQ A;  4HCP B;  2UWQ A;  3M3J A;  1OTR B;  3AI5 A;  3L17 A;  4EZJ A;  4PS7 A;  2D11 A;  3P2B A;  4G11 A;  4TKN A;  1ZW7 A;  2XEW A;  2LI5 A;  5D2M B;  2MX2 A;  3OAW A;  4HDO A;  2FID A;  3GOE A;  3ZLZ A;  2LD9 A;  4IM3 A;  1UBI A;  1V5T A;  4GB9 A;  5GMV A;  3KVF B;  4AWJ A;  3L54 A;  4A3O A;  3KYD D;  4JGH B;  2JRH A;  4WJQ A;  4MDK E;  1WM2 A;  1ZGU B;  3K9O B;  3H6N A;  4K7W A;  2KMC A;  1TBE A;  4NAW B;  3X23 A;  3H7P A;  3DBL I;  4ZYN A;  1YJ1 A;  2EKE C;  2N9P C;  4KDL B;  4WAA A;  1EF1 A;  2PPH A;  3O65 B;  4G0N B;  4ANU A;  1V81 A;  5JH5 C;  2KHW B;  5JHB A;  1Q0W B;  2Z0E B;  3IHP C;  2BF8 B;  5CHF A;  3VDZ A;  4GGQ A;  3QK0 A;  4KVG B;  4FJZ A;  2KQS A;  3PS6 A;  2DYM A;  2KAN A;  1J8C A;  3K9P B;  1XT9 B;  1WJ6 A;  2K1F A;  3V6E B;  2KJH B;  1WMH A;  2KWC A;  2MBQ A;  1S3S G;  2LZ6 A;  3VTW A;  2MBH A;  4GOC A;  2JWZ A;  3HM3 A;  4JQW C;  3UIP B;  2NPT A;  1IP9 A;  4F1S A;  2IY1 B;  1E5W A;  3CSF A;  3QJZ A;  4WJN A;  2G4D B;  3DVN V;  2KFK A;  4MM3 A;  3VHT C;  4TQ1 A;  1WE6 A;  1Y8R C;  4LJP B;  4BFR A;  3ONS A;  3PRM B;  3TIX A;  2MRP A;  2KDB A;  4FUL A;  1P0R A;  3DVN U;  2ZJD A;  2NR2 A;  3DOW A;  3NS8 A;  2LWP A;  3PPA A;  4DHZ B;  2LRU A;  4AP4 C;  3V6C B;  3QIJ A;  4IWP A;  4PYZ A;  4W9C A;  3VTV A;  1WXS A;  3HM6 X;  2M8S A;  3KYC D;  3KUZ A;  4BVU C;  2MSE D;  5LXH A;  1I42 A;  1WYW B;  4BKG A;  3PRE A;  4MH0 E;  3R7R A;  2L05 A;  4ICV A;  4ANX A;  4DWF A;  2J0M A;  4RM8 A;  2BYF A;  2OOB B;  3WAO A;  2GOW A;  5CTR C;  3ALB A;  2QHO A;  3SHQ A;  4W9H A;  3ZDM C;  4M8N A;  4MGY E;  3JW0 X;  2LGD A;  2PEA A;  1GC6 A;  1V2Y A;  5D6J B;  3U7D A;  3OJ3 A;  4KSL C;  3RYT A;  2LXC A;  3M95 A;  3PRZ A;  3DBR I;  4I6N B;  2N9E B;  2LJ5 A;  3KH0 A;  2O2V B;  4DHZ E;  1NDD A;  1OGW A;  1XQQ A;  3AU4 A;  4FN2 A;  2KK8 A;  3R3M A;  3WAM A;  1WGD A;  2RSU A;  3PV1 A;  2G45 B;  5J2R A;  3JYU A;  2XBB C;  3VH3 B;  3L13 A;  1WR1 A;  2JZZ A;  2PE6 B;  3RZW C;  4KDI C;  5DPW A;  5TR5 A;  4TUU A;  5AEK B;  2FNJ B;  1OQY A;  2J0J A;  2ZCC A;  3B1L X;  5C1Z A;  3ZIM A;  1JRU A;  2KD0 A;  1G6J A;  2D07 B;  1E8Z A;  4K7S A;  3N3K B;  3RD2 A;  3AXC A;  4NNJ B;  2WDT B;  2BYE A;  1GG3 A;  2BKF A;  5CHW A;  2KVR A;  3SD5 A;  3QA8 A;  2DYO A;  5LLI A;  4W9E A;  2A5U A;  4JIO U;  4LDT B;  2GBM A;  2ZCB A;  1PQS A;  4MGI E;  2JRI B;  3APC A;  3DQV A;  4WJO A;  1D3Z A;  1WXM A;  4K7U A;  2KDE B;  2PE9 A;  4BKS A;  2N7E A;  3VXW A;  2KN5 A;  2O6V D;  3QQ8 B;  1WX9 A;  2CHX A;  2N7D A;  1UD7 A;  2VRR B;  4GDK A;  2KX3 A;  3PGE A;  3IVF A;  3V62 A;  4DHJ D;  2GBJ A;  2IYD B;  2O6V B;  2MLB A;  4AOF A;  2ASQ A;  3PT2 B;  1WR6 E;  4P7I A;  4W9F A;  3A1Q A;  2JY6 A;  3VH4 B;  3WAP A;  2KTR A;  4NQK E;  2L7R A;  3QCA A;  2KLG A;  5E6P A;  3ZO5 B;  4DHJ B;  2FIF A;  2KO3 A;  4I6P A;  1WGG A;  2DAF A;  3ZNH B;  3APD A;  4BBN F;  1NI2 A;  1OEY A;  1KOT A;  3UF8 A;  2ZEQ A;  1OEY J;  3AU5 A;  3L08 A;  2C5L C;  4HK2 A;  4XZ4 A;  1VD2 A;  4HPL B;  4II3 B;  2KQ7 A;  3T9L A;  4MEM A;  1GC7 A;  4TV3 A;  3A9K B;  3VTU A;  1R4M I;  2A4Z A;  4MJS A;  1VCB A;  4J6I A;  3S2A A;  2M4N A;  2KZR A;  4IUM B;  2NCN A;  1EO6 A;  4IC7 B;  2NBU A;  3A9J B;  2IO0 B;  5G55 A;  5J17 A;  2MBE A;  5IA7 A;  1WE7 A;  2KWU B;  4EEW A;  3DCG A;  3VUW A;  3PHX B;  4GDL A;  1RLF A;  2LVP A;  2ZVO A;  3H7S A;  3APF A;  5DPT A;  3BIN A;  1WX7 A;  4A3P A;  4ANW A;  4W9K A;  3PLU A;  2C9W B;  3NOB A;  1IPG A;  2FCQ A;  4NPN A;  2GBR A;  2J7Q B;  2EMT A;  5G2N A;  3H9D A;  2B3A A;  4IM2 A;  4ZRJ A;  4CO7 A;  1V6E A;  4EZL A;  3R66 C;  3U30 A;  2ZPN A;  1GUA B;  2FAZ A;  1RAX A;  4WWO A;  4DDG D;  1P1A A;  5KHQ A;  2K25 A;  1TZ1 A;  1LQB A;  1F9J A;  2DEN B;  3H1U A;  3N32 A;  4GXB A;  2O2V A;  3QAQ A;  1UGM A;  1RRB A;  2PJH A;  3CST A;  1A5R A;  4B95 A;  1EF5 A;  2R2O A;  3ZNZ B;  3ML9 A;  2MCN B;  2YVC A;  4IW0 A;  3ZVV A;  5CX3 A;  2HD5 B;  4B6W A;  2OJR A;  2IO2 B;  2WYQ A;  5J18 A;  2L0T A;  4MSM B;  1WXV A;  2CHW A;  2BPS A;  5AZF A;  3UQA A;  2CU1 A;  1WGR A;  2MP2 B;  4M0W B;  1WFY A;  1YIW A;  2KWV B;  1P3Q U;  4KZ0 A;  2C7H A;  1GNU A;  4PS3 A;  1WY8 A;  1SE9 A;  5C23 A;  5D94 A;  1WGY A;  2CKH B;  4KSK C;  1E8W A;  2IO1 B;  3DPD A;  2G3Q B;  1WGH A;  2N1W A;  3CF6 E;  3ENE A;  3DVG X;  2XK5 A;  2Z0D B;  2D2Q A;  5IAA C;  3JSV B;  2AEH A;  4GMV A;  1KJT A;  4N9F 4;  4IWQ A;  5D7G A;  3H7P B;  2V4L A;  2J0K A;  3DVG Y;  3L10 B;  3L0W B;  4JLC A;  4FAD A;  2DHZ A;  1Q5W B;  2RD0 A;  3A4S C;  2KXJ A;  3VUX A;  1EUV B;  4X57 B;  4ASW C;  2V3S A;  1TTN A;  1P98 A;  2O6V A;  3MHS D;  3QAR A;  1V9J A;  4MSQ B;  2I1K A;  3IBE A;  2LVQ A;  3PSE B;  2C7N B;  3X0W A;  4KIK B;  1WRD B;  1WMH B;  4IG7 B;  1WIA A;  4LDT D;  4W9L A;  4W9I A;  1U4A A;  3M63 B;  4WWN A;  4BOZ B;  5HKH A;  3KW5 B;  4HCN B;  1UZX B;  2K8C A;  2GBN A;  3WAN A;  1J0G A;  2HTH A;  3NZS A;  1X1M A;  2WX1 A;  1RFA A;  1H8C A;  3BY4 B;  4TQ0 A;  1S1Q B;  1E8Y A;  3R7Q A;  2K6D B;  4ANV A;  2LGY A;  2N9X A;  3TJP A;  2IO3 B;  3V61 A;  2CHZ A;  3NZU A;  3VQI A;  2MQJ A;  1NBF C;  4GN1 A;  3T8M A;  2RPQ A;  4LJO B;  4W9D A;  1WJU A;  2MBO A;  2N4F A;  3ZRC A;  2K8H A;  2C7M B;  5EDS A;  2HE7 A;  1SIF A;  1Z2M A;  4MEL A;  2NVU I;  1H4R A;  3UGB B;  5CHV C;  4HXD A;  3ZKJ C;  4NAW A;  4XX5 A;  3ZDT A;  4EZK A;  2IBI B;  3W1S A;  4HVB A;  2IY0 B;  2REX A;  1Q1O A;  3UQB A;  1WF9 A;  1WZ0 A;  3KUC B;  3W1S C;  2L76 A;  4NJ6 A;  3Q3J A;  4HJK A;  4A20 A;  4IWO A;  2DZM A;  3Q3F A;  4AJW A;  2DZJ A;  3LJ3 A;  3W1Y A;  3QWZ B;  2FCM A;  4OVV A;  5L83 A;  2DYB A;  3NHE B;  3ZNG C;  2K8B A;  2M17 A;  2ZZP B;  1V80 A;  2KNB A;  2BGF A;  3ECI A;  2L00 B;  5FR6 A;  4ZDV A;  4K81 A;  3EC8 A;  2JVC A;  2L0F A;  3C0R B;  3GZN I;  4AUQ C;  4HLE A;  3N30 A;  2FCN A;  2LGX A;  3U8Z A;  1LFD A;  3RZF A;  3B0A A;  1J19 A;  2R2Q A;  4KZC A;  4WQO B;  5JHA A;  2UYZ B;  4G3X B;  3B08 A;  5DCN A;  4FHK A;  2DZK A;  3DDC B;  4NY0 A;  4CHK A;  1FXT B;  4HPM B;  1WXA A;  1GJZ A;  1L7Y A;  4E71 A;  2M0X A;  1AAR A;  2G4S A;  2M1M A;  4OVU A;  1L2N A;  1WZ3 A;  2LUE A;  2JUO A;  4II2 B;  3QC8 B;  4GDK B;  2D10 A;  2NS5 A;  3UIO B;  1IYF A;  4FJY A;  2K6Q A;  3SU8 X;  2KMA A;  2BWF A;  2KC2 A;  3JSV A;  4EOY A;  2K39 A;  2ZNV C;  5JZE B;  2MBB B;  1MG8 A;  3QX1 A;  4CYE A;  3ML8 A;  3PLV A;  2GBK A;  4FHJ A;  2BWE S;  1Z5S B;  3A1Q B;  2AWT A;  2AYO B;  2JPH A;  3AUL A;  4I6L B;  2Z59 B;  2AL6 A;  3ZUN A;  3PVL A;  2KTR B;  4WJP A;  3CMM B;  5E6O A;  3ZRF A;  3LDZ E;  1ZKH A;  3HHM A;  2L3Z A;  2KOX A;  4GIV A;  1WJ4 A;  4F8C B;  1I35 A;  2WX0 A;  4KIK A;  5DPR A;  1WH3 A;  1V5O A;  3UIN B;  1WI0 A;  1UH6 A;  3OJ4 B;  3WAL A;  5L95 C;  2JXX A;  2BKR B;  4RMA A;  4KV2 A;  1YQB A;  4DXA B;  2W9N A;  4MJS B;  2RGF A;  3OLM D;  4PS8 A;  4NJ7 A;  5LXI B;  2WWZ A;  1P9D U;  4FA6 A;  1TGZ B;  2ZPY A;  3WIM A;  2KFJ A;  4PYU A;  2KTF A;  4W9G A;  2JZ3 B;  3JVZ X;  2I1J A;  4WWP A;  2MWS B;  3TBL D;  1E7V A;  2LAS A;  4URK A;  3QHT A;  2KC1 A;  2KDI A;  3M62 B;  3PRP B;  3DBS A;  4GDL B;  4HWI B;  4EFO A;  1LM8 B;  4G50 A;  3RUL A;  1XD3 B;  3HK0 A;  3EFU A;  4YL8 A;  4DBG A;  3EEC A;  4BOS C;  2ZVN A;  4BKT A;  1WJN A;  2AL3 A;  1LXD A;  2V1Y A;  2NBW B;  3MTN B;  4M8M A;  2JT4 B;  1C1Y B;  2EMS A;  2ZNV B;  4MGZ E;  4DK5 A;  3V60 A; 
#chains in the Genus database with same CATH topology
 3EFC A;  4ZRI A;  4FLH A;  3Q8E A;  4IM0 A;  4FBJ B;  2LXA A;  4MM3 B;  4QAY A;  3HIZ A;  4RM9 A;  1HEZ E;  2FCS A;  3RCZ A;  3ZNI D;  3TCA A;  4EKU A;  1UEL A;  2QC8 A;  3EHV A;  4P1B C;  1SGH A;  2MW5 A;  3ZTD A;  1T0Y A;  1YD8 U;  2W3R A;  2D3G A;  3D32 A;  1E8X A;  1K8R B;  2KAC A;  2YLM A;  4W9J A;  4R3D A;  3AH7 A;  1DGJ A;  3TMP B;  1ESF A;  2JSV X;  1FNV A;  3SFD B;  4OZB A;  1YQ3 B;  4E3C A;  1R4N I;  2INC C;  3DBH I;  1J7B A;  2M0A A;  1E90 A;  5C2T B;  2BYV E;  2JF5 A;  1HTQ A;  3NY5 A;  3ZTC A;  5E6N A;  2DAJ A;  2CS4 A;  2WXI A;  5FR3 A;  2PIA A;  1YX6 B;  1MJD A;  3P1M A;  4HCP B;  4M02 A;  3AI5 A;  3EGR A;  3I9V 1;  1Q10 A;  1SEB D;  5D2M B;  2D5G A;  3OAW A;  4HDO A;  3KVF B;  4AWJ A;  4A3O A;  1WM2 A;  4S17 A;  2ZW0 A;  2KMC A;  4RH6 A;  4WUR A;  1ZOY B;  2BS4 B;  4XYC A;  3H7P A;  3DBL I;  1YJ1 A;  4KDL B;  1XLO A;  1EF1 A;  1NEK B;  1Y56 A;  2PPH A;  4ANU A;  5JHB A;  2KHW B;  2Y3A A;  1N60 A;  4OZC A;  2Z0E B;  5CHF A;  4GGQ A;  4IDI A;  4KVG B;  3NG0 A;  2KAN A;  3BK1 A;  2KJH B;  3B9J A;  3P4R B;  2MBQ A;  1RYJ A;  1S3S G;  2LZ6 A;  1DOI A;  1QIL A;  4KX6 B;  4JQW C;  3UIP B;  1FIQ A;  1IP9 A;  2BS3 B;  2G4D B;  3DVN V;  1Y8R C;  4BFR A;  3TIX A;  4US8 A;  3V6C B;  4IWP A;  3HM6 X;  4BKG A;  3R7R A;  1E10 A;  1KH0 A;  2L05 A;  4ANX A;  3TSS A;  2QMT A;  4RM8 A;  1IGC A;  3KQ4 A;  4W9H A;  4M8N A;  1AW7 A;  3RYT A;  3DBR I;  4DHZ E;  1NDD A;  3AU4 A;  1XQQ A;  4FN2 A;  3R3M A;  2RSU A;  1IGD A;  3IXS A;  1WR1 A;  3ZYY X;  4KDI C;  1HXY D;  4DQO C;  4PK1 A;  2J0J A;  5C1Z A;  1V8C A;  1G6J A;  2GRI A;  1PGA A;  4NNJ B;  1F52 A;  2V3N A;  3BWU D;  2DYO A;  2JWU A;  2FE8 A;  2ZCB A;  3W5U B;  3GE3 C;  4BAX A;  4K7U A;  4BKS A;  3VXW A;  2BTE A;  2WXN A;  1SE4 A;  2N7D A;  3PGE A;  3V62 A;  4C4V B;  1CJE A;  1JWU D;  1YJJ A;  2LGS A;  4YTP B;  2KTR A;  2KO3 A;  3APD A;  1OEY A;  1OEY J;  3AU5 A;  2N0S B;  4HK2 A;  2KWD A;  1VD2 A;  4XZ4 A;  4J6I A;  2NTT A;  2EKI A;  1P7E A;  1R4N B;  5J17 A;  1RM6 C;  2KWU B;  1JWS D;  3DBH B;  3IT6 B;  4EEW A;  3AN1 A;  2ZVO A;  3H7S A;  3Q6B A;  3APF A;  3BIN A;  3MHZ A;  3NOB A;  1NI3 A;  1T3Q A;  2FCQ A;  1V6E A;  3AE9 B;  3DHI C;  1SSN A;  2K25 A;  3I63 C;  2BQQ A;  1FNU A;  4GXB A;  2O2V A;  2PJH A;  4B95 A;  3ZNZ B;  2BYT A;  4IOI E;  1WRI A;  2YVC A;  3ETR A;  3ZVV A;  5J18 A;  2L32 A;  1WXV A;  2CHW A;  2BPS A;  5AZF A;  2CU1 A;  4KKJ A;  2ACZ B;  2E6X A;  2XN9 C;  1WFY A;  1R7S A;  1TYG B;  2C7H A;  4PS3 A;  1FEH A;  5C23 A;  2HDE A;  1WGY A;  2MEK A;  3AE3 B;  3ENE A;  4TSS A;  2XK5 A;  1TIF A;  2D2Q A;  3H7P B;  1SIJ A;  3L10 B;  3DVG Y;  3L0W B;  2DHZ A;  4ITK A;  1J7A A;  4X57 B;  1P98 A;  2N9L A;  2QSD A;  1V9J A;  2I1K A;  3IBE A;  2LVQ A;  3VR8 B;  4KIK B;  4LDT D;  1YOV B;  1U4A A;  4WWN A;  3NVY A;  4BOZ B;  3RNB C;  1QOF A;  2K8C A;  1J0G A;  2HTH A;  3NZS A;  1H8C A;  4JX1 C;  4TQ0 A;  1E8Y A;  2N9X A;  3TJP A;  2IO3 B;  3V61 A;  2CHZ A;  3NZU A;  3VQI A;  3BVZ A;  2MQJ A;  3LYY A;  3T8M A;  5AUK A;  4W9D A;  1WJU A;  5EDS A;  1Z2M A;  1PUT A;  1H4R A;  4HXD A;  3ZDT A;  4EZK A;  2IBI B;  2WDR B;  1V1P A;  4B0M A;  3TEZ A;  4A20 A;  4HJK A;  4K3C A;  2WXF A;  2E3T A;  1XLP A;  5IP4 D;  2BGF A;  2L00 B;  1MVK A;  4ZDV A;  3ABV B;  3T3N A;  3RMK C;  2NMQ A;  3N30 A;  2LHE A;  3RZF A;  2PVO D;  2R2Q A;  4WQO B;  5JHA A;  2H88 B;  1STE A;  1FPY A;  4WIP A;  4ZHO A;  4M0W A;  3DDC B;  3U7Z A;  3BVM A;  1WXA A;  1L7Y A;  2G4S A;  3QC8 B;  1D5X C;  4FJY A;  1TS4 A;  2GLS A;  2BWF A;  3JSV A;  4CQN A;  1T0Q C;  5JZE B;  1KF6 B;  4FHJ A;  3PLV A;  2GBK A;  2BWE S;  2AYO B;  1WSP A;  2Z59 B;  2JQR B;  1TKY A;  2KTR B;  1F0Z A;  1FNW A;  3LDZ E;  3AE5 B;  3HHM A;  1QF6 A;  2RPV A;  2WS3 B;  1BXT A;  3OJ4 B;  1UH6 A;  5L95 C;  4OW0 A;  2BKR B;  4RMA A;  4P1C C;  1YQB A;  1UGJ A;  2RGF A;  1P9D U;  4W9G A;  2KTF A;  3TBL D;  4WWP A;  3QHT A;  2KDI A;  1ZXI A;  3UI3 A;  5IN7 A;  1LM8 B;  4G50 A;  4ARI A;  3Q3N C;  3HK0 A;  4YL8 A;  2KMM A;  4WH4 A;  2ZVN A;  3MTN B;  2V1Y A;  4M8M A;  2EMS A;  4JPS A;  4MGZ E;  4NQL B;  4N6E B;  3PTF C;  2CR5 A;  5KHO A;  1I4G A;  3EA6 A;  3SDL C;  2KLC A;  3BVG A;  2KFK B;  2L83 A;  1KLG D;  1C77 A;  1XLN A;  1WX8 A;  3U52 E;  1KM7 A;  3L16 A;  2BB6 A;  2MJD A;  1FFV A;  5HFY A;  1ISN A;  4E74 A;  1F2R I;  2V9H A;  1JW9 D;  2KX0 A;  1C3T A;  1V49 A;  4C7Z A;  4GU2 A;  3KUD B;  3PZD A;  4ZRK A;  1V86 A;  5DPS A;  1OQR A;  2JX5 A;  2XK5 B;  3I3T B;  2WP9 B;  1BT0 A;  1HA5 A;  3Q69 A;  3WA0 A;  3MJW A;  1WM3 A;  2N1V A;  4FJV B;  3VVW B;  1QZE A;  2HJ8 A;  3CWI A;  3Q8F A;  2DBY A;  1P7F A;  3RT3 B;  5AZG A;  3L4P A;  3RN9 C;  1MHX A;  3B2G A;  1ET9 A;  2J52 A;  2UWQ A;  3LXF A;  4NJC A;  3SR6 A;  4TKN A;  2XEW A;  3R8B A;  4YTM B;  2FID A;  3GOE A;  2LD9 A;  4GB9 A;  3KYD D;  4WJQ A;  4MDK E;  1ZGU B;  2WXO A;  3K9O B;  1JWB D;  4ZYN A;  2EKE C;  4WAA A;  1V1P B;  1WWT A;  1Q0W B;  4FJZ A;  1TS3 A;  4XDC A;  1C9F A;  2DYM A;  1JWA D;  3U4E G;  1WJ6 A;  1WMH A;  3RNG C;  2MJ3 A;  3MC9 A;  4MAC A;  4YT0 B;  4O1N A;  3W2D A;  2NPT A;  4F1S A;  1V97 A;  3QJZ A;  1DYQ A;  1VZ6 A;  2WQY B;  1FM0 D;  3PZ7 A;  1FFU A;  2KN4 A;  3RNC C;  1XEE A;  3PRM B;  2MRP A;  1P0R A;  3DVN U;  3PPA A;  2LWP A;  2I2Y A;  4AP4 C;  1WXS A;  4BVU C;  1ZUD 2;  1WYW B;  3PRE A;  4XE0 A;  2PTL A;  2BYF A;  3WAO A;  5CTR C;  3ALB A;  1N63 A;  2WXM A;  4MGY E;  3AEC B;  3JW0 X;  3U7D A;  1V2Y A;  5D6J B;  3M95 A;  1BML C;  2LGI A;  2M19 A;  1F2R C;  3RFZ B;  3KH0 A;  1ACC A;  2Z8L A;  3WAM A;  2KK8 A;  1WGD A;  1L4D B;  3VH3 B;  2PE6 B;  3RZW C;  5DPW A;  2Y5P A;  2B76 B;  1KFY B;  2FNJ B;  1EU3 A;  3NVZ A;  3B1L X;  2KD0 A;  1E8Z A;  2QIL A;  3AXC A;  2WDT B;  1XCT L;  2BKF A;  2KVR A;  1MHH E;  1I4P A;  2D3B A;  1A70 A;  5LLI A;  1I4H A;  2A5U A;  1D3Z A;  1PQS A;  3DQV A;  2BVC A;  3Q3M C;  2KN5 A;  4ZYS A;  1T0R C;  1WX9 A;  2KX3 A;  1I4Q A;  5D3I B;  4DHJ D;  3OWE B;  3FAH A;  4AOF A;  4P7I A;  2JY6 A;  3VH4 B;  2QEJ C;  3N1X C;  4DHJ B;  2KLG A;  1SF0 A;  5E6P A;  4P6V F;  4I6P A;  3T3O A;  1NI2 A;  3UF8 A;  4C56 C;  2C5L C;  2L1A A;  3T9L A;  4MEM A;  1RFK A;  1R4M I;  4XGA B;  2OED A;  2M4N A;  3ZXR A;  4USA A;  5G55 A;  2WGS A;  4XWW A;  5IA7 A;  4YXD B;  4HRS A;  3DCG A;  3PHX B;  1RLF A;  2LVP A;  2JZP A;  3P4Q B;  4RFB A;  2C9W B;  1I4R A;  3N9Y C;  4NPN A;  5G2N A;  4ZRJ A;  4CO7 A;  1HZ5 A;  5AUI A;  2FAZ A;  1RAX A;  4WWO A;  4DDG D;  1F9J A;  3H1U A;  3N32 A;  2SEB D;  2MCN B;  2HD5 B;  2WYQ A;  2L0T A;  4L2Y A;  3UQA A;  4ZOH C;  3DHH C;  4KZ0 A;  1PGX A;  1TS5 A;  1WY8 A;  2CKH B;  4KSK C;  1E8W A;  2IO1 B;  2G3Q B;  1WGH A;  3CF6 E;  2Z0D B;  2BW2 A;  5IAA C;  4C00 A;  3DWG C;  4GMV A;  1ZE3 D;  4IWQ A;  5D7G A;  1F77 A;  2J0K A;  2RD0 A;  3FKY A;  3VUX A;  4ASW C;  5FKA C;  1NYR A;  2O6V A;  4MSQ B;  2PVG C;  2W54 A;  1D5M C;  2DWQ A;  3X0W A;  4RGO S;  1WMH B;  1WIA A;  4W9L A;  4YWG G;  4AQ7 A;  4W9I A;  3M63 B;  5HKH A;  4OVZ A;  4HCN B;  2WXJ A;  4ARC A;  1QOA A;  1X1M A;  2WX1 A;  4KKI A;  3NS1 A;  4GN1 A;  4ZHP A;  4M00 A;  5H92 C;  1N5X A;  2MBO A;  3URY A;  2C7M B;  2IND C;  2NVU I;  3UGB B;  3ZKJ C;  4NAW A;  3UQB A;  1WF9 A;  4P16 A;  1WZ0 A;  3W1S C;  1SXT A;  1D4B A;  3BZD B;  3KWL A;  5H8Y E;  2DZJ A;  4LK0 M;  3QWZ B;  2FCM A;  2ZW1 A;  2K8B A;  2LUM A;  2M17 A;  1E9M A;  1V80 A;  2KNB A;  3PZ8 A;  4K81 A;  3EC8 A;  4HKZ E;  2CU3 A;  3GZN I;  1CZP A;  2FCN A;  5T8I A;  1LFD A;  2INP E;  1AWD A;  5FK9 C;  4A9A A;  5DCN A;  1YJI A;  5E6J A;  1GOZ A;  2DZK A;  1NVI D;  4NY0 A;  1FXT B;  4HPM B;  3NRZ A;  2WU2 B;  1QOB A;  1AAR A;  1L2N A;  1ZPS A;  4N59 A;  1ZDX A;  4LNK A;  2JUO A;  5LNK 1;  3GE8 C;  2D10 A;  1UWX A;  3SU8 X;  4EOY A;  2K39 A;  2MBB B;  4CYE A;  2GB1 A;  1WXQ A;  2KVZ A;  3I57 A;  2AWT A;  4I6L B;  2WXQ A;  4HPP A;  4WJP A;  2X8X X;  3CMM B;  3DBL B;  2J42 A;  2KOX A;  4GIV A;  4F8C B;  2WX0 A;  1UNS A;  1WH3 A;  2WU5 B;  4ZRQ A;  3WAL A;  2BBC A;  3RNA C;  1N61 A;  4PS8 A;  2NTS A;  5LXI B;  1ZXH A;  2OJW A;  1KLU D;  1TGZ B;  4WAF A;  3JVZ X;  1C76 A;  4DXF A;  3KLS X;  1E7V A;  4URK A;  3PRP B;  3DBS A;  3C19 A;  4EFO A;  3W9C B;  4OZA A;  1M4V A;  1EWY C;  4BKT A;  2G1E A;  2JT4 B;  4DK5 A;  2ON8 A;  3ZW3 A;  3ZQ4 A;  5AZH A;  4AJY B;  3H8H A;  1IUE A;  3A9K A;  2Y5B B;  3A33 B;  4NZL B;  1HE8 A;  1KLV A;  3DBR B;  1C78 A;  1FXI A;  3J9C A;  3IG3 A;  3RUI B;  1B1Z A;  2JXT A;  3IFW B;  3R2T A;  2RR9 A;  4HDQ A;  2YEP F;  1XCQ L;  1WGK A;  3Q8A A;  5BMI A;  2INN E;  4B9K A;  3VUY A;  4K3B A;  2KDF B;  2NBV B;  4F7Z A;  1TZO A;  2VZK D;  4FXC A;  1L0Y B;  1M94 A;  3P42 A;  1YMH E;  1I7H A;  1ZP0 B;  2G9H D;  3HUI A;  2VZK B;  3VAW A;  2KJR A;  3VFK A;  2W55 A;  1GPX A;  1ENF A;  2C60 A;  3GS2 A;  2H89 B;  3TL5 A;  4BKS D;  4DDI D;  3M3J A;  1OTR B;  3DWM A;  2D11 A;  4G11 A;  1ZW7 A;  2MX2 A;  4KGR A;  1C4P A;  5D3D A;  3IT4 B;  4IM3 A;  1YQ4 B;  3VR9 B;  2XNA C;  5IO9 A;  3L54 A;  4JGH B;  5BMH A;  3E9S A;  3H6N A;  1TBE A;  3Q2A C;  4NAW B;  3X23 A;  3NJT A;  3U2S C;  3GZN B;  3C8Y A;  3O65 B;  4G0N B;  2CJO A;  2KQ4 X;  5EE1 A;  3AEG B;  3IHP C;  2BF8 B;  2PW9 A;  5HHD G;  2KQS A;  3PS6 A;  2PMV A;  2K1F A;  3N1Y C;  2W82 A;  3N20 C;  2KWC A;  3VTW A;  2MBH A;  2JWZ A;  3HM3 A;  4TMA B;  2VH2 A;  2IY1 B;  4WJN A;  4MM3 A;  3HRD D;  3VHT C;  2KDB A;  4FUL A;  3NS8 A;  2NR2 A;  2LRU A;  3QIJ A;  4W9C A;  1L0V B;  2M8S A;  3KYC D;  3KUZ A;  2VH1 A;  1I42 A;  5LXH A;  4JWU C;  5EE9 A;  1E7P B;  3V3X A;  1EM7 A;  1MFW A;  2BB5 A;  2OOB B;  1NYQ A;  2RDH A;  2QHO A;  3GP7 A;  1GC6 A;  4MH8 A;  3OJ3 A;  3AV8 A;  2UU7 A;  3PRZ A;  4PT5 A;  2LJ5 A;  2O2V B;  1OGW A;  3WCQ A;  5J2R A;  2XBB C;  4HEA 1;  3L13 A;  4C80 A;  2JZZ A;  1L6V A;  2AQ2 B;  4TUU A;  2DNF A;  2ZCC A;  3ZIM A;  1JRU A;  4MT5 A;  4K7S A;  1FXA A;  4US9 A;  2BYE A;  1K53 A;  1MG4 A;  3AE6 B;  2EEL A;  3SD5 A;  4W9E A;  3BII D;  2GBM A;  4MGI E;  4WJO A;  5TSS A;  2J4X A;  2JRI B;  3APC A;  2PE9 A;  5BYS A;  2Y5C A;  1K51 A;  1UD7 A;  2VRR B;  1TKE A;  1UUP A;  2GBJ A;  1V1O A;  2MLB A;  3FC4 A;  2ASQ A;  1WR6 E;  2KYW A;  3Q8C A;  3AE1 B;  4NQK E;  4Q2J A;  3ZO5 B;  4RGN A;  3ZNH B;  1WGG A;  2DAF A;  2R61 A;  2BT6 A;  3L08 A;  1J7C A;  4HPL B;  2N7J A;  2KQ7 A;  1CK1 A;  3A9K B;  3VTU A;  1SE3 A;  2A4Z A;  4MJS A;  1VCB A;  1XO3 A;  4IUM B;  1EO6 A;  4IC7 B;  4YSX B;  2KDM A;  2MBE A;  1JCK B;  4GDL A;  1TY2 A;  1WX7 A;  4A3P A;  4ANW A;  5JXV A;  1AYF A;  1IPG A;  5HI1 A;  2GBR A;  4EZL A;  3R66 C;  3OG5 A;  2ZPN A;  1OFF A;  1P1A A;  1XF5 L;  3B2F A;  3AE4 B;  5I4D A;  1LQB A;  3AEA B;  3AE2 B;  3QAQ A;  3TEY A;  3CST A;  1IBX A;  1ET6 A;  2LEK A;  1KTK A;  3ML9 A;  1FD6 A;  2MHJ A;  5CX3 A;  4B6W A;  1ROE A;  2OJR A;  3R2I A;  2KAJ A;  2TSS A;  4M0W B;  1YIW A;  4A8X C;  5BYQ A;  3AEF B;  5EE3 A;  4A6Q A;  1FCC C;  3DPD A;  3P4S B;  3DVG X;  4NAM A;  3JSV B;  1JAL A;  4JLC A;  1DOX A;  5MPO A;  1Q5W B;  3A4S C;  3DHG C;  2PLP A;  1EUV B;  1SE2 A;  3IAM 1;  3QAR A;  3ZJV A;  3AE8 B;  1D5Z C;  3NVW A;  4IG7 B;  1TS2 A;  1MI0 A;  1UZX B;  2AX5 A;  3AMZ A;  1LGR A;  3BY4 B;  1S1Q B;  5BMG A;  3ZJT A;  3AED B;  2RPQ A;  2N4F A;  2HE7 A;  1SIF A;  4MEL A;  4HJG E;  1VRA B;  5CHV C;  2RDB C;  4XX5 A;  1LO5 D;  3MFG A;  3W1S A;  1SJH D;  1B9R A;  2J53 A;  4LNO A;  3KUC B;  2L76 A;  4IWO A;  4AJW A;  3LJ3 A;  5L83 A;  4OVV A;  2DYB A;  2Q5W D;  3AEB B;  3NHE B;  3ZNG C;  4YSY B;  2IGG A;  1L5P A;  3P63 A;  4WQM A;  3I5J C;  3ZXV A;  3ECI A;  4RCO A;  2JVC A;  4ACF A;  4AUQ C;  2QJL A;  1FMA D;  1T5X D;  1J19 A;  3SFE B;  2UYZ B;  2WXG A;  3RNE C;  1YNT E;  4BZA A;  1TT5 B;  3W5V B;  2LFI A;  4WWM A;  2WHI A;  2FUG 1;  2M0X A;  2M1M A;  4OVU A;  1TJE A;  1QT9 A;  4II2 B;  2NS5 A;  4XDD A;  2K6Q A;  2KC2 A;  5EE0 A;  1MG8 A;  2GI9 A;  1Z5S B;  3AUL A;  3PVL A;  3BYT B;  2QDF A;  4LNI A;  2N9K A;  5E6O A;  1ZKH A;  2IJ0 A;  3MJ5 A;  2L3Z A;  2LHD A;  2M56 B;  5G5H A;  1I35 A;  3AEE B;  4KIK A;  1V5O A;  1WI0 A;  1OQQ A;  4MJS B;  4RGT A;  2WWZ A;  1K52 A;  2I38 A;  2ZPY A;  2K3U A;  2JZ3 B;  4RF0 A;  2I1J A;  4D2K A;  1FRD A;  2KC1 A;  4GDL B;  4HWI B;  1FO4 A;  1RWS A;  3FIL A;  1DOY A;  1XD3 B;  3EFU A;  1VZ7 A;  4DBG A;  4BOS C;  1LXD A;  1C1Y B;  3V60 A;  2LRW A;  3Q3O C;  2JYE A;  1JML A;  2NPT B;  1IBX B;  2KJ6 A;  2MA9 B;  2HTM E;  5IOI A;  1UWM A;  1I4X A;  4JL9 A;  4MGK E;  2CJN A;  3VRA B;  3A4R A;  5G5G A;  3A9J A;  4ICU A;  4XC2 A;  2DZI A;  1HQR D;  4H2A A;  1CMX B;  1EU4 A;  2FUH B;  2L8J A;  1XLQ A;  1YX5 B;  3KWV A;  4K1R B;  3TEX A;  2GMI C;  3BYY B;  2LVO A;  3CIR B;  3O13 A;  4BBN C;  2DX5 B;  2KKC A;  2WNM A;  3PHW B;  2JYT A;  4GSW A;  2MJE A;  4LLG M;  4LCD E;  5BO4 B;  2IZV B;  3Q14 C;  1E7U A;  2WXK A;  1K50 A;  4KGT A;  4EUT A;  2YEP B;  2MP2 A;  1UBQ A;  3L17 A;  4EZJ A;  4PS7 A;  3P2B A;  5HG2 A;  2WXL A;  2LI5 A;  3BK2 A;  3ZLZ A;  4S0R A;  1UBI A;  1V5T A;  5GMV A;  3IAS 1;  2JRH A;  2PKO A;  1JWM D;  4B0E A;  4K7W A;  1R4M B;  2N9P C;  1C4C A;  5JH5 C;  2V3P A;  1V81 A;  3VDZ A;  2QCZ A;  3QK0 A;  3AB5 A;  1J8C A;  3K9P B;  1XT9 B;  2L52 A;  3V6E B;  1XXG A;  4ZRP A;  2WXR A;  4LNN A;  3ZGZ A;  1QQR A;  2K0P A;  4GOC A;  2IPK D;  5IKC M;  2X38 A;  3LB8 C;  3NUH B;  1E5W A;  3CSF A;  3V05 A;  2KFK A;  4TQ1 A;  1WE6 A;  4LJP B;  3ONS A;  2ZJD A;  3DOW A;  4DHZ B;  1T6B X;  2IGH A;  4PYZ A;  3NZ3 A;  3VTV A;  1D6E C;  2MSE D;  3RI7 C;  4MH0 E;  2QIE B;  4REZ A;  4ICV A;  2MH7 A;  4DWF A;  2J0M A;  2GOW A;  3SHQ A;  3ZDM C;  4RF1 A;  4N58 A;  1L4Z B;  2LGD A;  2PEA A;  4KSL C;  2LXC A;  4I6N B;  2N9E B;  4J3O D;  3PV1 A;  2G45 B;  1N5W A;  1KRH A;  3JYU A;  3NVV A;  1VLB A;  3PO0 A;  4JWS C;  5TR5 A;  5AEK B;  2BS2 B;  1OQY A;  4L1B A;  2FBW B;  3E56 A;  1JRP A;  2D07 B;  3GB1 A;  3RD2 A;  3N3K B;  4UDU C;  1GG3 A;  4OHJ A;  1NEN B;  5CHW A;  4YSZ B;  3QA8 A;  1VJK A;  2V0G A;  4JIO U;  4LDT B;  1WXM A;  2KDE B;  4HRO A;  2N7E A;  2O6V D;  3QQ8 B;  1T0S C;  2CHX A;  3AM9 A;  4GDK A;  3FIL B;  2IDY A;  3IVF A;  2IYD B;  2O6V B;  2K22 A;  3PT2 B;  4W9F A;  3A1Q A;  2KT7 A;  3WAP A;  1PFD A;  2L7R A;  3QCA A;  2SAK A;  1TY0 A;  1TKG A;  2FIF A;  4BBN F;  1KOT A;  2ZEQ A;  1JRO A;  2HJ1 A;  4II3 B;  1GC7 A;  2WXH A;  4TV3 A;  4EE2 A;  3S2A A;  2KZR A;  2NCN A;  1C79 A;  2LMC A;  2NBU A;  3A9J B;  2IO0 B;  3RNF C;  1L0X B;  3TEW A;  4KGS A;  1WE7 A;  3VUW A;  1PDX A;  1SB3 C;  5DPT A;  4W9K A;  4L23 A;  3PLU A;  3RPF C;  1L6U A;  2J7Q B;  2EMT A;  2K5P A;  2B3A A;  3H9D A;  4IM2 A;  3U30 A;  1GUA B;  1AN8 A;  5KHQ A;  1TZ1 A;  2DEN B;  3VRB B;  4GLS C;  1UGM A;  1RRB A;  1A5R A;  1EF5 A;  2R2O A;  2WXP A;  4IW0 A;  1E0Z A;  2IO2 B;  1ZDV A;  4JE3 B;  4MSM B;  2MP2 B;  1WGR A;  2KWV B;  1P3Q U;  2W3S A;  4C7Y A;  1GNU A;  2ICI A;  1QOG A;  1SE9 A;  5D94 A;  3EUB 2;  2DLB A;  2RMM A;  4RNA A;  2N1W A;  2D3A A;  2AEH A;  1KJT A;  4LTU A;  4N9F 4;  1CQV A;  2V4L A;  4FAD A;  1GB1 A;  2KXJ A;  1BUI C;  1YN4 A;  2JU6 X;  2V3S A;  1TTN A;  3MHS D;  3PSE B;  2C7N B;  3HVZ A;  1WRD B;  2K9X A;  3HVD A;  3MC0 B;  3KW5 B;  2GBN A;  2LJI A;  3WAN A;  4A55 A;  1HTO A;  1RFA A;  1N62 A;  3Q8B A;  3R7Q A;  4ANV A;  2K6D B;  2LGY A;  2WDV B;  1NBF C;  4LJO B;  3ZRC A;  2K8H A;  4IKG A;  1N6Z A;  1PYW D;  2WLB A;  4HVB A;  2IY0 B;  2REX A;  1Q1O A;  4NJ6 A;  3Q3J A;  2DZM A;  3Q3F A;  5C3J B;  3W1Y A;  2OHF A;  1C4A A;  4XWT A;  1SBB B;  1GB4 A;  2ZZP B;  1FRR A;  1HZ6 A;  5FR6 A;  2L0F A;  3C0R B;  4HLE A;  2LGX A;  3U8Z A;  1PGB A;  3B0A A;  4KZC A;  1JQ4 A;  4G3X B;  3B08 A;  4YTN B;  4FHK A;  1VZ8 A;  3ZJU A;  3N1Z C;  1EWC A;  2AQ1 B;  1VR9 A;  4CHK A;  1FCL A;  1GJZ A;  4E71 A;  1YN3 A;  1WZ3 A;  2LUE A;  1WYG A;  4GDK B;  2ONQ A;  4HKQ A;  3UIO B;  1IYF A;  1QKZ A;  2KMA A;  3SEB A;  3MC8 A;  2V4I B;  2ZNV C;  3QX1 A;  3ML8 A;  2IGD A;  4RGM A;  3A1Q B;  2JPH A;  2AL6 A;  3ZUN A;  3AE7 B;  1F1H A;  4M01 A;  3TUO A;  1QLB B;  4A90 A;  3ZRF A;  1WJ4 A;  5DPR A;  3UIN B;  2AQ3 B;  4DXG A;  2JXX A;  4KV2 A;  4DXA B;  2W9N A;  3OLM D;  2RDG A;  4NJ7 A;  4FA6 A;  3WIM A;  2KFJ A;  4PYU A;  2MWS B;  2LAS A;  3P4P B;  5GXG B;  3M62 B;  5BYR A;  4LNF A;  3RUL A;  1YN5 A;  1VDV A;  4C4V A;  3EEC A;  4AS1 A;  1GAQ B;  3MP9 A;  1E6E B;  1UF0 A;  1WJN A;  2AL3 A;  2WDQ B;  2NBW B;  1SJE D;  1MPE A;  2ZNV B;  2D3C A; 
#chains in the Genus database with same CATH homology
 2LRW A;  4NQL B;  4FLH A;  4ZRI A;  3ZW3 A;  4IM0 A;  5AZH A;  4AJY B;  3PTF C;  2NPT B;  2CR5 A;  2KJ6 A;  2MA9 B;  5KHO A;  3SDL C;  2KLC A;  4FBJ B;  2KFK B;  2LXA A;  3HIZ A;  3A9K A;  2Y5B B;  3A33 B;  4RM9 A;  1WX8 A;  1HE8 A;  2FCS A;  1KLV A;  3RCZ A;  1KM7 A;  4JL9 A;  3L16 A;  3ZNI D;  4MGK E;  3TCA A;  3IG3 A;  3A4R A;  4EKU A;  1ISN A;  1UEL A;  3EHV A;  3IFW B;  3RUI B;  4E74 A;  3A9J A;  4ICU A;  4XC2 A;  2RR9 A;  4HDQ A;  2KX0 A;  2DZI A;  1C3T A;  1SGH A;  2MW5 A;  3ZTD A;  1T0Y A;  1CMX B;  2FUH B;  1V49 A;  2L8J A;  1YD8 U;  2D3G A;  1YX5 B;  4GU2 A;  4B9K A;  3KUD B;  3PZD A;  3D32 A;  1E8X A;  1V86 A;  5DPS A;  4ZRK A;  3VUY A;  4K1R B;  1K8R B;  2GMI C;  2YLM A;  2XK5 B;  4W9J A;  2KDF B;  2LVO A;  2NBV B;  3I3T B;  4F7Z A;  3TMP B;  1BT0 A;  3WA0 A;  3MJW A;  1WM3 A;  1M94 A;  2N1V A;  4FJV B;  3VVW B;  4BBN C;  2DX5 B;  4E3C A;  1QZE A;  1R4N I;  2HJ8 A;  2KKC A;  3PHW B;  3DBH I;  4GSW A;  3VAW A;  2KJR A;  3VFK A;  1E90 A;  2BYV E;  4LCD E;  2JF5 A;  5BO4 B;  2IZV B;  3NY5 A;  2C60 A;  3TL5 A;  3RT3 B;  1E7U A;  3ZTC A;  5E6N A;  2DAJ A;  5AZG A;  4BKS D;  4EUT A;  2CS4 A;  4DDI D;  2MP2 A;  1YX6 B;  1UBQ A;  4HCP B;  2UWQ A;  3M3J A;  1OTR B;  3AI5 A;  3L17 A;  4EZJ A;  4PS7 A;  2D11 A;  3P2B A;  4G11 A;  4TKN A;  1ZW7 A;  2XEW A;  2LI5 A;  5D2M B;  2MX2 A;  3OAW A;  4HDO A;  2FID A;  3GOE A;  3ZLZ A;  2LD9 A;  4IM3 A;  1UBI A;  1V5T A;  4GB9 A;  5GMV A;  3KVF B;  4AWJ A;  3L54 A;  4A3O A;  3KYD D;  4JGH B;  2JRH A;  4WJQ A;  4MDK E;  1WM2 A;  1ZGU B;  3K9O B;  3H6N A;  4K7W A;  2KMC A;  1TBE A;  4NAW B;  3X23 A;  3H7P A;  3DBL I;  4ZYN A;  1YJ1 A;  2EKE C;  2N9P C;  4KDL B;  4WAA A;  1EF1 A;  2PPH A;  3O65 B;  4G0N B;  4ANU A;  1V81 A;  5JH5 C;  2KHW B;  5JHB A;  1Q0W B;  2Z0E B;  3IHP C;  2BF8 B;  5CHF A;  3VDZ A;  4GGQ A;  3QK0 A;  4KVG B;  4FJZ A;  2KQS A;  3PS6 A;  2DYM A;  2KAN A;  1J8C A;  3K9P B;  1XT9 B;  1WJ6 A;  2K1F A;  3V6E B;  2KJH B;  1WMH A;  2KWC A;  2MBQ A;  1S3S G;  2LZ6 A;  3VTW A;  2MBH A;  4GOC A;  2JWZ A;  3HM3 A;  4JQW C;  3UIP B;  2NPT A;  1IP9 A;  4F1S A;  2IY1 B;  1E5W A;  3CSF A;  3QJZ A;  4WJN A;  2G4D B;  3DVN V;  2KFK A;  4MM3 A;  3VHT C;  4TQ1 A;  1WE6 A;  1Y8R C;  4LJP B;  4BFR A;  3ONS A;  3PRM B;  3TIX A;  2MRP A;  2KDB A;  4FUL A;  1P0R A;  3DVN U;  2ZJD A;  2NR2 A;  3DOW A;  3NS8 A;  2LWP A;  3PPA A;  4DHZ B;  2LRU A;  4AP4 C;  3V6C B;  3QIJ A;  4IWP A;  4PYZ A;  4W9C A;  3VTV A;  1WXS A;  3HM6 X;  2M8S A;  3KYC D;  3KUZ A;  4BVU C;  2MSE D;  5LXH A;  1I42 A;  1WYW B;  4BKG A;  3PRE A;  4MH0 E;  3R7R A;  2L05 A;  4ICV A;  4ANX A;  4DWF A;  2J0M A;  4RM8 A;  2BYF A;  2OOB B;  3WAO A;  2GOW A;  5CTR C;  3ALB A;  2QHO A;  3SHQ A;  4W9H A;  3ZDM C;  4M8N A;  4MGY E;  3JW0 X;  2LGD A;  2PEA A;  1GC6 A;  1V2Y A;  5D6J B;  3U7D A;  3OJ3 A;  4KSL C;  3RYT A;  2LXC A;  3M95 A;  3PRZ A;  3DBR I;  4I6N B;  2N9E B;  2LJ5 A;  3KH0 A;  2O2V B;  4DHZ E;  1NDD A;  1OGW A;  1XQQ A;  3AU4 A;  4FN2 A;  2KK8 A;  3R3M A;  3WAM A;  1WGD A;  2RSU A;  3PV1 A;  2G45 B;  5J2R A;  3JYU A;  2XBB C;  3VH3 B;  3L13 A;  1WR1 A;  2JZZ A;  2PE6 B;  3RZW C;  4KDI C;  5DPW A;  5TR5 A;  4TUU A;  5AEK B;  2FNJ B;  1OQY A;  2J0J A;  2ZCC A;  3B1L X;  5C1Z A;  3ZIM A;  1JRU A;  2KD0 A;  1G6J A;  2D07 B;  1E8Z A;  4K7S A;  3N3K B;  3RD2 A;  3AXC A;  4NNJ B;  2WDT B;  2BYE A;  1GG3 A;  2BKF A;  5CHW A;  2KVR A;  3SD5 A;  3QA8 A;  2DYO A;  5LLI A;  4W9E A;  2A5U A;  4JIO U;  4LDT B;  2GBM A;  2ZCB A;  1PQS A;  4MGI E;  2JRI B;  3APC A;  3DQV A;  4WJO A;  1D3Z A;  1WXM A;  4K7U A;  2KDE B;  2PE9 A;  4BKS A;  2N7E A;  3VXW A;  2KN5 A;  2O6V D;  3QQ8 B;  1WX9 A;  2CHX A;  2N7D A;  1UD7 A;  2VRR B;  4GDK A;  2KX3 A;  3PGE A;  3IVF A;  3V62 A;  4DHJ D;  2GBJ A;  2IYD B;  2O6V B;  2MLB A;  4AOF A;  2ASQ A;  3PT2 B;  1WR6 E;  4P7I A;  4W9F A;  3A1Q A;  2JY6 A;  3VH4 B;  3WAP A;  2KTR A;  4NQK E;  2L7R A;  3QCA A;  2KLG A;  5E6P A;  3ZO5 B;  4DHJ B;  2FIF A;  2KO3 A;  4I6P A;  1WGG A;  2DAF A;  3ZNH B;  3APD A;  4BBN F;  1NI2 A;  1OEY A;  1KOT A;  3UF8 A;  2ZEQ A;  1OEY J;  3AU5 A;  3L08 A;  2C5L C;  4HK2 A;  4XZ4 A;  1VD2 A;  4HPL B;  4II3 B;  2KQ7 A;  3T9L A;  4MEM A;  1GC7 A;  4TV3 A;  3A9K B;  3VTU A;  1R4M I;  2A4Z A;  4MJS A;  1VCB A;  4J6I A;  3S2A A;  2M4N A;  2KZR A;  4IUM B;  2NCN A;  1EO6 A;  4IC7 B;  2NBU A;  3A9J B;  2IO0 B;  5G55 A;  5J17 A;  2MBE A;  5IA7 A;  1WE7 A;  2KWU B;  4EEW A;  3DCG A;  3VUW A;  3PHX B;  4GDL A;  1RLF A;  2LVP A;  2ZVO A;  3H7S A;  3APF A;  5DPT A;  3BIN A;  1WX7 A;  4A3P A;  4ANW A;  4W9K A;  3PLU A;  2C9W B;  3NOB A;  1IPG A;  2FCQ A;  4NPN A;  2GBR A;  2J7Q B;  2EMT A;  5G2N A;  3H9D A;  2B3A A;  4IM2 A;  4ZRJ A;  4CO7 A;  1V6E A;  4EZL A;  3R66 C;  3U30 A;  2ZPN A;  1GUA B;  2FAZ A;  1RAX A;  4WWO A;  4DDG D;  1P1A A;  5KHQ A;  2K25 A;  1TZ1 A;  1LQB A;  1F9J A;  2DEN B;  3H1U A;  3N32 A;  4GXB A;  2O2V A;  3QAQ A;  1UGM A;  1RRB A;  2PJH A;  3CST A;  1A5R A;  4B95 A;  1EF5 A;  2R2O A;  3ZNZ B;  3ML9 A;  2MCN B;  2YVC A;  4IW0 A;  3ZVV A;  5CX3 A;  2HD5 B;  4B6W A;  2OJR A;  2IO2 B;  2WYQ A;  5J18 A;  2L0T A;  4MSM B;  1WXV A;  2CHW A;  2BPS A;  5AZF A;  3UQA A;  2CU1 A;  1WGR A;  2MP2 B;  4M0W B;  1WFY A;  1YIW A;  2KWV B;  1P3Q U;  4KZ0 A;  2C7H A;  1GNU A;  4PS3 A;  1WY8 A;  1SE9 A;  5C23 A;  5D94 A;  1WGY A;  2CKH B;  4KSK C;  1E8W A;  2IO1 B;  3DPD A;  2G3Q B;  1WGH A;  2N1W A;  3CF6 E;  3ENE A;  3DVG X;  2XK5 A;  2Z0D B;  2D2Q A;  5IAA C;  3JSV B;  2AEH A;  4GMV A;  1KJT A;  4N9F 4;  4IWQ A;  5D7G A;  3H7P B;  2V4L A;  2J0K A;  3DVG Y;  3L10 B;  3L0W B;  4JLC A;  4FAD A;  2DHZ A;  1Q5W B;  2RD0 A;  3A4S C;  2KXJ A;  3VUX A;  1EUV B;  4X57 B;  4ASW C;  2V3S A;  1TTN A;  1P98 A;  2O6V A;  3MHS D;  3QAR A;  1V9J A;  4MSQ B;  2I1K A;  3IBE A;  2LVQ A;  3PSE B;  2C7N B;  3X0W A;  4KIK B;  1WRD B;  1WMH B;  4IG7 B;  1WIA A;  4LDT D;  4W9L A;  4W9I A;  1U4A A;  3M63 B;  4WWN A;  4BOZ B;  5HKH A;  3KW5 B;  4HCN B;  1UZX B;  2K8C A;  2GBN A;  3WAN A;  1J0G A;  2HTH A;  3NZS A;  1X1M A;  2WX1 A;  1RFA A;  1H8C A;  3BY4 B;  4TQ0 A;  1S1Q B;  1E8Y A;  3R7Q A;  2K6D B;  4ANV A;  2LGY A;  2N9X A;  3TJP A;  2IO3 B;  3V61 A;  2CHZ A;  3NZU A;  3VQI A;  2MQJ A;  1NBF C;  4GN1 A;  3T8M A;  2RPQ A;  4LJO B;  4W9D A;  1WJU A;  2MBO A;  2N4F A;  3ZRC A;  2K8H A;  2C7M B;  5EDS A;  2HE7 A;  1SIF A;  1Z2M A;  4MEL A;  2NVU I;  1H4R A;  3UGB B;  5CHV C;  4HXD A;  3ZKJ C;  4NAW A;  4XX5 A;  3ZDT A;  4EZK A;  2IBI B;  3W1S A;  4HVB A;  2IY0 B;  2REX A;  1Q1O A;  3UQB A;  1WF9 A;  1WZ0 A;  3KUC B;  3W1S C;  2L76 A;  4NJ6 A;  3Q3J A;  4HJK A;  4A20 A;  4IWO A;  2DZM A;  3Q3F A;  4AJW A;  2DZJ A;  3LJ3 A;  3W1Y A;  3QWZ B;  2FCM A;  4OVV A;  5L83 A;  2DYB A;  3NHE B;  3ZNG C;  2K8B A;  2M17 A;  2ZZP B;  1V80 A;  2KNB A;  2BGF A;  3ECI A;  2L00 B;  5FR6 A;  4ZDV A;  4K81 A;  3EC8 A;  2JVC A;  2L0F A;  3C0R B;  3GZN I;  4AUQ C;  4HLE A;  3N30 A;  2FCN A;  2LGX A;  3U8Z A;  1LFD A;  3RZF A;  3B0A A;  1J19 A;  2R2Q A;  4KZC A;  4WQO B;  5JHA A;  2UYZ B;  4G3X B;  3B08 A;  5DCN A;  4FHK A;  2DZK A;  3DDC B;  4NY0 A;  4CHK A;  1FXT B;  4HPM B;  1WXA A;  1GJZ A;  1L7Y A;  4E71 A;  2M0X A;  1AAR A;  2G4S A;  2M1M A;  4OVU A;  1L2N A;  1WZ3 A;  2LUE A;  2JUO A;  4II2 B;  3QC8 B;  4GDK B;  2D10 A;  2NS5 A;  3UIO B;  1IYF A;  4FJY A;  2K6Q A;  3SU8 X;  2KMA A;  2BWF A;  2KC2 A;  3JSV A;  4EOY A;  2K39 A;  2ZNV C;  5JZE B;  2MBB B;  1MG8 A;  3QX1 A;  4CYE A;  3ML8 A;  3PLV A;  2GBK A;  4FHJ A;  2BWE S;  1Z5S B;  3A1Q B;  2AWT A;  2AYO B;  2JPH A;  3AUL A;  4I6L B;  2Z59 B;  2AL6 A;  3ZUN A;  3PVL A;  2KTR B;  4WJP A;  3CMM B;  5E6O A;  3ZRF A;  3LDZ E;  1ZKH A;  3HHM A;  2L3Z A;  2KOX A;  4GIV A;  1WJ4 A;  4F8C B;  1I35 A;  2WX0 A;  4KIK A;  5DPR A;  1WH3 A;  1V5O A;  3UIN B;  1WI0 A;  1UH6 A;  3OJ4 B;  3WAL A;  5L95 C;  2JXX A;  2BKR B;  4RMA A;  4KV2 A;  1YQB A;  4DXA B;  2W9N A;  4MJS B;  2RGF A;  3OLM D;  4PS8 A;  4NJ7 A;  5LXI B;  2WWZ A;  1P9D U;  4FA6 A;  1TGZ B;  2ZPY A;  3WIM A;  2KFJ A;  4PYU A;  2KTF A;  4W9G A;  2JZ3 B;  3JVZ X;  2I1J A;  4WWP A;  2MWS B;  3TBL D;  1E7V A;  2LAS A;  4URK A;  3QHT A;  2KC1 A;  2KDI A;  3M62 B;  3PRP B;  3DBS A;  4GDL B;  4HWI B;  4EFO A;  1LM8 B;  4G50 A;  3RUL A;  1XD3 B;  3HK0 A;  3EFU A;  4YL8 A;  4DBG A;  3EEC A;  4BOS C;  2ZVN A;  4BKT A;  1WJN A;  2AL3 A;  1LXD A;  2V1Y A;  2NBW B;  3MTN B;  4M8M A;  2JT4 B;  1C1Y B;  2EMS A;  2ZNV B;  4MGZ E;  4DK5 A;  3V60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...