1PYWD

Human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
230
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Exploration of the P6/P7 region of the peptide-binding site of the human class II Major Histocompatability Complex Protein HLA-DR1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/protein binding/toxin
total genus 69
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pywD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pywD02
1YN4A 1ESFA 3R2TA 1SE4A 1D5MC 1KTKA 1PRTC 4RHRA 1T5XD 3EA6A 1LO5D 1FNUA 4RGNA 1TS3A 5ELCA 3BVZA 1SBBB 1SJHD 5FK9C 3DWQA 1PTOC 1AW7A 1CT1D 1BCPC 3W2DA 3CHBD 1BXTA 4TSSA 4OHJA 1STEA 1LT3D 5D3IB 5ELEA 1PYWD 1RD9D 1V1OA 1I4GA 3MFGA 2QILA 1UUPA 2XNAC 1CHQD 3OWEB 1YN5A 1LTBD 2WV6D 1PZJD 3BYTB 1ET9A 1DYQA 1D5XC 1V1PB 1LTAD 2R61A 1FD7D 3SEBA 3R2IA 1S5FD 1RCVD 3KLSX 1PTOH 1LTSD 4UDUC 1TS5A 2ICIA 4RHSA 1RDPD 2AQ2B 4L63B 4BWGB 5ELFA 3BYYB 1LT4D 1PTOB 1BCPB 1D5ZC 1JQYD 1TY2A 1PZID 2O2LD 1I4HA 3GP7A 1PRTD 1JWMD 1I4QA 1LTGD 1B44D 1FNWA 5D3DA 1TS2A 1QILA 1EEID 1XXGA 1I4XA 3URYA 1PRTF 1L0YB 1LTTD 1HXYD 1PZKD 1EEFD 1EU4A 1LLRD 3TSSA 1B1ZA 1PTOD 2J4XA 1BCPD 2TSSA 1AN8A 1CK1A 1LTRD 1JWUD 2G9HD 1D6EC 1PTOF 1CHPD 3R8BA 4C56C 1S5ED 1BCPF 4Z9CB 1HA5A 1KLGD 2AQ3B 2IJ0A 4RGMA 2QEJC 5TSSA 4RCOA 1YN3A 1EFID 2SEBD 5ELDA 3BVMA 3DWAA 1EWCA 1UNSA 1JWSD 2AQ1B 2NTSA 2XN9C 3O13A 1XTCD 1TS4A 1MD2D 1S5CD 1SEBD 2NTTA 1LT6D 1EU3A 4RGOS 4RGTA 3MC0B 1RF2D 1G8ZD 2RDGA 1S5DD 1I4RA 1M4VA 1ET6A 2XRSD 2XRQD 1SJED 5ELBA 1FGBD 1FNVA 5I4DA 4L6TB 4O1NA 1I4PA 4DXGA 1JR0D 1CQVA 4RH6A 1GOZA 4DXFA 1ENFA 1SE2A 1L0XB 1TY0A 4NZLB 2Z8LA 1JCKB 2RDHA 1V1PA 2IPKD 5FKAC 1SE3A 1LT5D 1S5BD 3DWPA 2CHBD 3EFXD 1DJRD 3BVGA 1LTID 3BZDB 1HTLD 1F77A 1HQRD 4K6LA 4RFBA 1SXTA 1KLUD 3V05A 4ZYSA 1PRTB
chains in the Genus database with same CATH superfamily
5EE3A 3PRZA 2W82A 1A3VA 3TS0A 3HOZG 2JQOA 4HR7B 3W1BA 2V3SA 4ZAIA 1V43A 1E6EB 3K5OA 4W9HA 2HE7A 2LVQA 3FKIG 4YY3Q 2LUEA 3SDLC 3A74A 4C3HH 2IO2B 5C4XB 2B63B 3AULA 4LWCA 1LM0A 2CVRA 4AWJA 5JPMC 3PV0A 1UGJA 4J3OD 4TKOB 3TP5A 1A8VA 1LT3D 2JUOA 3KUCB 5T8IA 3AE7B 1X1MA 1L1OA 1Q1BA 1YQ4B 2XNAC 3ETRA 2K28A 3VUWA 2F0OA 1KOTA 3RZOH 4LAAA 2R7FA 3FC4A 4PNYA 4LLGM 1TIID 4QY7A 1ET9A 4OO1I 1EQVA 2KDEB 1QZGA 2JYTA 2F0GA 3ZTCA 3A8IE 1YBYA 4GDKB 1WX9A 3J80E 4J6IA 3KF8A 3VQIA 2FUG1 4A55A 4TRDA 3T1HL 1PGBA 2AQ2B 2LS01 1ACCA 1L1OC 2CKHB 3ALBA 3NUCA 1QWYA 2KUMA 1XWEA 2PVOD 4IKGA 4L8JA 1WTVA 3RMKC 1E2WA 3AV8A 1R4QB 3M3YB 4S0RA 1PHJA 3N20C 4FXKC 1QNKA 2H89B 1G51A 3MXNB 1PYSB 1SFOH 2F0MA 3QQ8B 3U4VA 3CF6E 4A93H 1PZKD 1N33L 1M1KC 4JG2A 5K36H 1J5EL 2JA8B 4TKNA 3PSIA 2L55A 2L15A 3EQLC 3K7UC 3S1RB 4ZRQA 1C9FA 5LLIA 1L7YA 1QVFA 1PH5A 4DR5L 4K7WA 2N49A 4A90A 4AOFA 4CHKA 4DK6C 3U9SA 1EO6A 2MPMA 1TKEA 4KK7A 2KVZA 3ZJVA 2QGQA 3CU7A 1N63A 5I2XA 2RPQA 5FJ8G 2WDQB 2BA0A 2A1AA 5M5XB 1N5WA 4UP8A 4A3JB 4UP7A 2UUAL 3IHPC 4KN7C 2XVSA 4RGOS 1Q7YC 1VF7A 2LI5A 3DDCB 1SNCA 4X65Q 1HEZE 1SYGA 1S5DD 1RTOA 2ZVNA 3S1RH 4DV4Q 3F1ZA 1SGHA 4FDBA 2Z59B 1FR3A 1Y1WG 4A3MB 3ZXRA 1PLFA 3IBEA 2K9XA 1IZ6A 4G50A 3M7NA 3C8YA 3QIJA 4ZHOA 3C0RB 3CC4A 2L12A 5IWAL 1KD1C 2YU9B 2M9VA 3CRKC 2MHJA 2M56B 2I2YA 4FYDA 1NSNS 5IYDH 4FNFA 2JSOA 1PQSA 2C5CA 4XC2A 5EKKA 1AEXA 4CKEA 2JZZA 2CHXA 3H6MA 1BF4A 2WXIA 2FINB 3Q8AA 1NCVA 2IT1A 3L7ZC 1YJ1A 1DOMA 2UU9L 3APDA 1K8MA 3MWYW 2N7EA 4A3FG 3R66C 2KC1A 2GA4B 1J19A 5C4JB 2NBFA 4MZ9A 1I7HA 3BG3A 3LJ3A 2IHFA 1Y69U 1MFWA 2NVQH 1T5EA 4KKSA 5KEEA 4BAXA 3P75A 2B39A 3CPFA 4C1NK 5KGUA 3JAMi 3CMAA 3S2DB 2EE1A 2TMPA 2JYEA 1N9WA 4C3JB 5AUIA 3TMEA 1CKMA 1H95A 3IXSA 2KECA 3CHBD 2CR5A 4KHPL 1QT9A 2L0FA 3ML9A 2J0TD 2HJ1A 3ABVB 2EOTA 4K7UA 4I65A 4UAIA 4ANXA 1XPOA 2QILA 1N34L 2R92B 3DHHC 1TKGA 4HMJA 4C3IG 3CQZB 5T1IA 1ZW7A 3M95A 1F9RA 1WCMB 2L52A 5C44G 4EEWA 1VQCA 2ICIA 5AZHA 1SYBA 2C7HA 3GTMB 1IPGA 4II3B 2EVBA 1JC7A 2LXCA 1XQQA 1PTOB 1PFMA 2PCFB 3V61A 3I90A 4A3BG 2F03A 4CJ1B 3ZUNA 1IBXA 1VDZA 2O2LD 1WGYA 1F9JA 3G7LA 1HZ5A 4DNTB 4JE3B 1BKBA 1CQFA 1LTGD 3CQZH 3HOUB 2KOXA 3B2GA 1NBWA 5C0XJ 1NEKB 1ZXHA 5JEAJ 1EEID 3K5NA 1GJZA 2L4NA 4MTKA 4IFDJ 4NQKE 3ZQ4A 3TP7A 1STNA 2KHWB 4WWMA 1WD1A 1JALA 2BQQA 3OIPA 3T1HQ 4DUZL 3IRBA 1TYGB 4C3HG 1A2UA 4UP9A 2X8XX 3PSEB 3P1MA 3WAMA 3T9LA 2IJ0A 1JRPA 2DY7A 3BDOA 2QEJC 5TSSA 3I5JC 1G6ZA 1JROA 4YSZB 2RHSB 1B70B 1HTPA 1NNXA 1TWHH 1H9RA 2SNMA 3PT2B 4LK0M 4A3PA 2Q8RE 1PH6A 2IX0A 1WI0A 3UINB 1IBLL 3EJIA 1GC6A 5A35A 2FMMA 4PYUA 3JVZX 1SR3A 2G4DB 3U50C 4IJHA 1N33Q 1SNOA 4RGTA 4WJ3M 1J5EQ 1G8ZD 2N78A 1E10A 3DM3A 4B0EA 2B63G 2JRIB 1G291 1WX7A 2A74C 2A6EC 4KY5A 3GTPB 2F0EA 2RCFA 1RRBA 4WWOA 1Q1OA 2GMIC 3HS0C 1XJVA 2IBIB 5IKCM 1WGRA 2RBMA 2UXBL 4DXFA 3PIO3 3G4SA 4DR5Q 2D5GA 1JWBD 1K53A 2K1FA 2KXJA 3I63C 3HHMA 5IGCA 5C0XG 3WIMA 4G0NB 2EKIA 5D7GA 5DAUA 1O7ZA 3TMPB 2QA4A 1E8XA 4IFDG 2DY8A 5COYA 5FO8B 4IN3A 1S5BD 5C5MA 1CA5A 2UUAQ 4K81A 4EX5A 2EKEC 3T56B 1OXVA 3BVGA 1NJIC 2DZKA 4LNOA 4A3GB 1PFDA 1TZOA 1J8CA 1SMXA 1VQPA 4MSQB 4JL9A 2KDBA 4OVZA 4ZYSA 2L5TA 3A0JA 5K36G 2BYFA 2Y5PA 3EUB2 4C00A 1PUTA 1MKHA 1QUQB 2JK8A 2K05A 4NDXA 3DLLA 5EQ0A 2F3IA 3KK7A 2G3QB 4RGNA 2LGXA 1WTOA 1KF6B 3MA2B 2ZTCA 5JVG3 1XLNA 4XDXA 5IWAQ 1UWMA 3P4RB 1A70A 4EQPA 2CWPA 3LYYA 1SJHD 4KTAA 5EGTA 1XEEA 4DR7L 2K14A 1HNXL 1IL8A 1BCPC 2HDLA 3BDLA 4OHJA 5D3IB 4RM8A 3PIP3 2MP1A 3ZXVA 1F2YA 3MFGA 1SF0A 4KKJA 5E3FA 2UU9Q 2JA8G 2G4SA 2ZVOA 4ZRKA 2JXMB 3P20A 3GTGB 2IYDB 5I6YA 1UGMA 3SD5A 3E0JA 4HCPB 3SHQA 3BYTB 1SMYD 4B3ML 2LVPA 1ZYRD 2Z6KA 2H4OA 1N32L 2WXRA 4PQXA 4TQ0A 2W54A 4DBGA 4OWWB 3GV6A 1QZEA 2V9HA 2KVRA 2RDBC 5IAAC 4AQ7A 5IYDG 4PYZA 2BA1A 2G5DA 2L7RA 3L17A 4A3JG 2PE6B 4QAYA 2KN5A 3TCAA 1EY7A 4KHPQ 1A3UA 3E5SA 2M0XA 4BZAA 1L5PA 2QKIC 2J53A 4DHZE 1VZ7A 1SNQA 1WE7A 3GP7A 1BR9A 1E2ZA 4U68A 1N34Q 4BY7B 1I4QA 4RNAA 3KF8B 1CSQA 1R4MI 5FR6A 5KYIA 1TS2A 3NENA 1WXQA 2BGFA 4YHHL 2Q2UA 2QCZA 1PRTF 4A3IB 1P7FA 2GRIA 1HXYD 4BY1H 4KSKC 5CBEE 3DOWA 4K2KA 1WM2A 5CHFA 1JW9D 2E74C 3NTHA 4L5QA 2MQHA 1OTRB 1AN8A 4P2CB 4M01A 1C78A 1H8CA 3KBXA 5M5WH 4DNRB 3GS2A 1ZKOA 4GMVA 5JAVA 4DGZA 4EZKA 2I5LX 1KLGD 5D2MB 3TUOA 4LF9L 1EWHA 4HJKA 4QMGA 1JE5A 1HR0W 1LV9A 1YN3A 2AUJD 1IBML 1PGAA 4YWKA 5G5GA 2HQEA 1ZKHA 1WD0A 4AJYB 3A7LA 5BN5A 2NTSA 3NPPA 3Q8CA 2XTIA 4X3TA 4OO1H 1K83H 1FD6A 5LMUL 2PI2A 3J81L 1S5CD 3MHSD 2YVCA 1YIJA 1XLPA 3WAOA 3VA5A 2AWOA 4CDCC 2EYJA 4B3SL 4F8MA 2D3AA 1OEYJ 1P0RA 1YD8U 4FULA 1JQ4A 4DUZQ 3F8TA 4C3JG 3HOWB 4DV3L 3S15H 2Q5WD 1KLVA 1DXMA 4K8IA 4A3CH 1LYLA 1HA6A 1GUOA 4AYBG 2N9PC 3GB1A 4MJSA 4BBSH 1I42A 3JSVB 3PHXB 3VYRA 1HTOA 2WU5B 3KF6B 3S1QB 3W3AA 1CTMA 1XX8A 2DN8A 2K3UA 3I57A 3T8MA 2ENBA 4EUTA 1H9SB 1Q86C 3ICEA 2SAKA 1SE3A 1IBLQ 2WYQA 4ICVA 1AARA 3Q3OC 2M2LA 1SN8A 3EFXD 3N1YC 4NQLB 2GBKA 3GZNI 3A8KE 4HIMA 4K6LA 3AECB 4PT5A 3WANA 4EZJA 5ELNA 4J6HA 2I38A 3PTFC 4IUMB 2FCSA 1PH7A 1YX6B 1TWFB 2B2UC 1VQOA 4J1MA 1LQBA 1RIPA 3M85A 3P2BA 2PYKA 2MP2B 2KWUB 1ZXTA 4R4IA 3GQBA 1UE7A 4LFCL 1E7PB 2UXBQ 3MHZA 1MJDA 2WXQA 2YEPF 3F2CA 2D11A 3IVFA 2NVYB 1FXAA 4IG7B 3ZGZA 5CV7A 4FN2A 2N9XA 5FK9C 2Z4HA 2A68C 4JI2L 1ZPSA 2CU3A 2Y3AA 3AN1A 4FJZA 2LSSA 2PMZE 3D8GA 4OONA 4WORA 2OHFA 5CTRC 2K50A 3S16B 4A3EH 3OJ4B 1CM9A 2MBHA 1TWFH 1U4RA 2FUHB 3QJZA 5CV9A 4E74A 2V3PA 4B9KA 1N5XA 4CJ2C 3C46A 1PH2A 3DVGY 1EUVB 1QF6A 1YZ6A 4GNXA 2FIDA 1D5XC 1FFUA 3TQYA 2R61A 4A20A 3NRZA 4HCSA 2AHOB 2KC2A 4LF5L 3HKZB 2FCMA 1J7AA 4OGQC 1WWTA 5GADC 3OMCA 4RHSA 1VZ8A 2K25A 3IL8A 2FNJB 3R7QA 1TKYA 5JZEB 3E3XA 4DR7Q 1HNXQ 4DF7A 3AEFB 1W2BA 4GKKQ 2BKFA 2VH1A 3DVGX 2JN4A 4XYOA 1F1HA 1YOVB 4GNXC 3IFWB 1L4ZB 1Y8RC 3GTOH 4HIDA 4DR4L 4DR6L 5IODA 1PH3A 2RGFA 3GTJB 4OIKA 3H91A 3CCLA 1FXIA 1TR5A 3BWUD 2PW7A 2KZRA 1DOIA 4P1BC 5C3EB 4B3MQ 3HM3A 3I8ZA 1L0YB 1YITA 4LTUA 4X3UA 1N32Q 1QNUA 4HEDA 2M4NA 4GDLA 1IBXB 3K7AB 1V9PA 3CW2C 4A4IA 4LJOB 1JE4A 4POGA 4RG1A 1L0VB 4S17A 2JYOA 4QQBX 5LHY1 1JWUD 1J9OA 1HZ9A 2GOWA 2KACA 3ZIMA 5CR3A 1A15A 1WJJA 1MJCA 4CKCA 1H4RA 3J7AF 2DYMA 1YQ3B 1Q8KA 2QDBA 1VCBA 2DAFA 4YXDB 3VR6A 2AQ1B 2Y0SE 4P73A 2GN5A 1IYJB 2GVBA 4JI8L 2JRHA 4YHHQ 3PO0A 4W9GA 1SE9A 4NW2A 3CMEA 3I56A 2DAJA 1UE1A 4PS3A 4KY7A 1EOTA 5FLMH 1JJCB 5JHBA 2W3SA 1RF2D 2WXFA 4IM3A 5G55A 2UWQA 1T0SC 2I1JA 2MJ3A 1FMAD 1OXXK 1MI2A 2L3ZA 2JZPA 4LF9Q 1TQOA 1CQVA 1WYGA 2FCNA 2HDEA 1Q8IA 4OL7A 5LXIB 4KV6A 5A2QL 1IBMQ 5KNBA 3I4MB 2J42A 3T3NA 1V1PA 4V0BA 4DAPA 1E2VA 3A7AB 4JBWA 4IM2A 4ODGA 2IDYA 3WAPA 2WB1E 2WKDA 3AU7A 5CORA 2QMTA 1YVCA 1L6VA 4NXMQ 1EWIA 1S4ZA 5LMUQ 4WWPA 4IWQA 2A69C 3B6YA 3BZDB 1JICA 1GC7A 1NAPA 1U4AA 2CJOA 2DHZA 2W3RA 4BY1G 4B3SQ 2KTFA 3CIRB 3CMMB 3QAQA 2BOSA 1FM0D 4GZYC 3AB9A 1UWVA 4OWXB 4DV3Q 1KTKA 4IUVA 3PLUA 4BA2I 4WJNA 1KNEA 2OXPA 4M8AA 3I4MH 1WE6A 4HJ9A 2NR2A 2XK5B 2EJGC 3A55A 3BVZA 3DQVA 4R8IA 2BH2A 5GQOA 3X3NA 2A19A 4BY7G 4PS7A 3DHGC 3LGJA 2A5HA 3VA7A 1E5WA 1QKZA 4DK5A 1PMRA 4HEA1 4I6PA 3EN2A 1QVCA 4OO1G 4Q2JA 3J81i 1EF1A 1VJKA 5J3BA 5KIXA 3HIZA 3ZW3A 1WTWA 2A6ED 1F2ZA 2B2TA 2YTXA 3FEWX 5HI1A 1NBFC 3D6CA 1LTBD 4DU9A 3G48A 4GOPA 4P6VF 1IUEA 4LNKA 1H9MA 4JQWC 3NQTA 2PEAA 1A62A 1Z5SB 4YCUA 5C4ZA 2LGIA 4LFCQ 3MEHA 4F7XA 3CF5A 4A3CG 3R2IA 1VQ4A 1RCVD 2QDLA 2LEKA 1OQRA 2N88A 1TS5A 4LF7Q 1EWYC 1OO9B 2KENA 2VS1A 4JI2Q 4DAYB 2B2TC 2ZXOA 4P72A 4DV2L 3AEDB 3L13A 3N1ZC 3QCAA 2EY2A 2B3AA 1HZCA 4AH6A 5DM73 4HIKA 4GOPC 3W9CB 2HHHL 1WFYA 4RCNA 1Y1WB 1VQBA 2LMCA 1ISNA 3KJPA 3ZNZB 4DQOC 1KFYB 1J7CA 4GN4B 2PZUA 3IAM1 4O2DA 4QF4A 3X0WA 2INPE 1EIYB 3AH7A 5LNK1 2EYOA 1TWAB 3OW2A 2JXXA 3MP9A 4JI3L 3I91A 4LF5Q 1WTPA 2HTME 2ZTDA 1BCPD 3DMUA 5BYSA 1N36L 4WJQA 2WX0A 4MH0E 3E9IA 5A2QE 1EYCA 2LVOA 4C2MH 1PTOF 4A3FB 2R93B 4HJ7A 5TR5A 3UDGA 1GPXA 3W5UB 3A5ZB 2UU7A 4C7ZA 5DM63 1OXTA 4A3EG 3S24A 3DUZA 4DR4Q 4DR6Q 4NAWA 1E8WA 1STAA 4CJ0B 3BVMA 1WZ0A 3I70A 1J0GA 3OW7A 1R4MB 3ZJTA 1MGSA 3HOVH 4QCLA 2HUGA 1XLOA 1W6JA 1WTXA 4M0WA 4B6WA 5AFWA 3SHLA 4FHKA 2DUDA 3FILA 5BN4A 2DYBA 4DHJB 1O80A 2XSCA 4A3DB 4R8NA 4LFBL 4QB4A 4G7OC 1G91A 2F0TA 1ZP0B 2E3TA 3UQBA 1WI5A 2AKWB 3FAHA 1JOQA 2V1CC 5HFYA 2QEXA 3J80c 1X3PA 2J0JA 3AE9B 1L2FA 4NKLA 3PO2B 3SK8A 4DPGA 1ICFB 1N8RC 3JAML 4MEMA 4BKSA 4JX1C 2NZHA 4CQNA 3S14B 4NJ7A 5FKAC 1O7YA 2O4XA 1ML0D 1VQGA 3PHWB 2AX5A 3GO5A 4WH4A 4HPPA 3WOEA 3CCUA 3BIID 4DK3C 3SFDB 5H1SE 4MJSB 2MO1A 3ULJA 1SIFA 2HIXA 1T9HA 4PZ6A 1WH3A 3QHTA 3OYYA 4GS3A 3QB3A 2F0QA 2VRRB 1ESFA 1NTGA 1D5MC 1SE4A 2NYZD 1EF5A 2B2VA 2Z9HA 3VAWA 1X54A 2EPBA 3UIPB 3EA6A 3G6JB 3HRDD 2NN6I 1UE6A 5JJLA 3AE4B 4GB9A 3DBRI 3DEPA 2PW5A 1QOFA 2WAQE 2KJRA 1K51A 4TV3A 3HK0A 2R7DA 5C3EG 2KNBA 2K1BA 1EY8A 2KHSA 4DHJD 3H8HA 4C3HB 2B2VC 4FHJA 4N8FA 3ZYYX 3SK6A 4PMCA 4R9WA 5JPNC 2E2JH 4CYEA 5IYBH 4N6EB 2R3ZA 4B0MA 3RPFC 2MCNB 1Q82C 1P16A 1VD2A 2L0CA 2LWPA 3RZOB 1QVGA 1L6UA 3AE8B 4F1SA 1S5FD 5DPWA 3KLRA 3RYTA 3TZDA 1I50H 5C23A 2HCIA 4IPHA 4KD4A 2WXHA 3NVYA 3Q3JA 2F4VQ 4KVGB 3OWFA 5LL6S 1LT4D 1K50A 3VYTA 1EY5A 3J7A5 3NELA 2K0PA 2PTLA 1TY2A 3EVQA 4LNFA 1QOBA 2QIEB 2V4LA 1X9NA 2LGSA 2LHDA 3IAS1 1SNDA 1IGCA 4NAMA 1UH6A 2VQEL 2AEHA 2DYOA 1E8YA 2UXCL 1YJJA 1IKLA 3RFZB 5BO4B 2XWBB 3J7ZC 4MM3A 4WJWA 4AIMA 2A68D 1EY6A 4IUNA 1SFOB 3I4MG 4PMWA 4A93B 4DV2Q 1FRDA 3PUVA 1ASZA 1D2BA 3JAME 1C79A 3L4PA 1JMCA 4LW1A 2HHHQ 2GVAA 5EKLA 1UBQA 1O7LA 2B8FA 2K52A 4DK1A 3DBHI 3EROA 4CDEC 1NR4A 3RNCC 3P7JA 1C4PA 3I3TB 5CMDA 3TBLD 5JXVA 2O5JC 2F0PA 4H2AA 2BBCA 1Q46A 3BK2A 2IY1B 4R3DA 3U8ZA 4JC0A 1C76A 2OOBB 1RAXA 3A5UA 1NYQA 5HY6A 5K5PA 4MELA 2RDGA 2RA4A 2XRSD 3MZ5A 3DPDA 2BS3B 2LGYA 5G2NA 3E6ZX 2ZCCA 2RSUA 1RODA 1UEBA 2R6GA 4A8XC 4BBNF 4XXEA 3BY4B 2ONQA 1EQRA 2RSOA 4RH6A 2IL8A 1RFKA 1L0XB 2EDGA 4XQQA 1SRUA 5DEHA 1TT5B 2XWJB 4TVAB 5C5LA 2Q8IB 4JV5L 3HUIA 2KHJA 2ZPNA 2I1KA 3AU4A 2ZW0A 2XBBC 5G3LD 4EGVA 5BYRA 2EXDA 5I9OA 3DEOA 2QF7A 3P1HA 4KKTA 3M4YA 4RFBA 2BYVE 5IP7H 5CGKA 3D0FA 2K5DA 2G1EA 2WACA 3Q22A 1D3ZA 4LFBQ 1Z47A 3UF8A 2RSNA 5IT9L 1WVLA 5HKHA 4HMIA 3S2AA 2GI9A 2KTRB 4KDIC 4IPCA 3AE2B 2F0FA 4C4VA 2K8HA 2UUBL 1KDBA 4J15A 3GV3A 1SE8A 1NYRA 1T0YA 5J18A 1T0QC 3NBHB 4FO2A 1VQLA 4RA8A 1TT2A 3DVNU 1CI3M 1GHJA 3ITPA 4JI5L 1AW7A 3J7YW 2NVQB 3AU5A 2EIFA 4RF0A 2IX3A 2IY5B 5JJIA 1WJNA 2DBYA 3HOVG 2N9EB 3WCQA 2RKSA 1STEA 4K3BA 2F0WA 4EFOA 1I4GA 2ASBA 3RULA 2CHZA 1TWCB 1UUPA 3K9PB 1E3PA 2B29A 4HJ5A 4K0KQ 3NJTA 2M0AA 2IWHA 2ZJPA 1VMPA 4NMZA 2R93G 2GB1A 3ZJUA 4LDTD 4GGQA 4HN7A 2KOLA 3PIOA 4K5WA 1UEAB 1PGXA 2L05A 2OJWA 2EQSA 1YNXA 4Y7NH 2A69D 5ELFA 2KLCA 4KIKB 4ANWA 4NJ6A 1J7BA 4KD3A 2N1WA 1KM7A 2NPTB 1T3QA 3ZTDA 2OEDA 5IGEA 2KHIA 1Z6HA 4H02A 1TWCH 1CA6A 4KSLC 3KUPA 1E90A 5IN7A 4AYBB 2MRPA 1MSGA 1R9TH 4A3DG 5CHWA 1U9RA 2FIFA 1FVIA 2HCCA 4MNOA 4BOZB 1XXGA 1YNNC 1NI2A 4GLVB 5MPOA 5F2DA 4XDDA 3D4WA 3RI7C 1LLRD 3SGIA 1PV4A 2F0SA 1K73C 3PO2G 2DZIA 4WURA 1EFWA 1MHHE 1I5FA 4EE2A 1XPRA 1K52A 3VXWA 4E3CA 1WTRA 4X62L 3H7SA 1HNWL 3UE1A 1NVID 1QG7A 3NWSA 4Z9CB 1KRTA 1ZGUB 2R2OA 2KBNA 3PIPA 1PA6A 2VY3A 2O2VB 3DWMA 5CX3A 3ONSA 5C6AA 3MJWA 4W9KA 5IOCA 4LUOA 1AE3A 3Q8BA 1F2MA 2ZTEA 3GTLH 4FXCA 2KEEA 2X6LA 2UXCQ 2H88B 3A8JE 3U4EG 3A9KB 1WYDA 2C9WB 3IAYA 1TWHB 2LKVA 5IT9E 4RM9A 2NTTA 2BB5A 1TKWB 1CUKA 2R7ZB 2VNUD 2KFKA 3TDQA 3STBC 3NG0A 3NVZA 1FJGL 2WX1A 3VUYA 4PS8A 1AZQA 2BW2A 4NAWB 4NNJB 3L10B 2V1YA 4LF8L 3N1XC 1XMOL 2BDOA 3R93A 4F88A 3QO2A 1Z9FA 4L6TB 3SK5A 2K22A 4M0WB 1I4PA 4XTCS 1WGHA 1SE2A 1AWDA 2KANA 2O6VA 5E1FA 3MTNB 2F1MA 1VQJA 2VB3X 1JCKB 3QWNA 3K5LA 4C80A 2IGGA 4XQJA 1F0ZA 2Y5BB 3U7DA 2CHBD 3VR4A 2R7ZH 4Q5VA 1A0IA 1DGJA 3VR8B 4JK1C 5M3MH 3Q6SA 2PVGC 1JB3A 1SYCA 5EKIA 3M4PA 3S9WA 1PH9A 5DPSA 2HD5B 3R2TA 5CC4A 4XYCA 1SYDA 1GUGA 2WIIB 1KRHA 2MBQA 4ZRPA 1MBYA 2JQRB 1IYVA 3C1EA 5ELCA 2BDNA 4HKZE 3T13A 3ZDTA 2DLBA 4YTMB 4JV5Q 1VQEA 4MT5A 4KKIA 3MFYA 2PQAB 2CKZB 1XLQA 1CT1D 2FXQA 1FYCA 1RHPA 1HFGA 4FF1A 3NUHB 3UI2A 4OX9L 2I5HA 3RR5A 2KFJA 1K8AC 1S72A 4WJ4A 3H7PA 2FFKB 5EE1A 2GBJA 2N9KA 1CHQD 4F87A 4A3KH 4IUQA 4A93G 1LABA 1PZJD 3WALA 3V3XA 1DYQA 4B08A 3G6EA 4GXBA 1SLJA 1RKNA 1VCIA 4OW0A 5G5HA 3SEBA 2LRUA 4JW0A 3ZRCA 4MN3A 1O7IA 4KHZA 4Q0FA 2UUBQ 4QIWB 2JWUA 4H13C 4UDUC 3K9OB 2LASA 4HDQA 5C2TB 1SNMA 1B3QA 1RDPD 2WXMA 2GBMA 3ZNHB 3AQQA 2BWES 4JI5Q 1SIJA 3I4NH 2ICEC 1HUMA 1Y1VH 3L0OA 4OXPA 2HDMA 1E9MA 4ZKBB 1C4QA 3T1YL 4NPSA 2LFNA 4M8MA 2JX5A 4BKSD 1DZ1A 1VZ6A 2BH8A 3W1GA 4M00A 2WP8J 1WMHA 1WR1A 1WJUA 3WOFA 4BKTA 2L8JA 2JA6H 2J7ZA 4DV1L 1EEFD 5DLQE 2NN6H 3OJ3A 3W5VB 1IBKL 5CV6A 1X56A 1LM8B 4IUUA 2D10A 1GVPA 1WXVA 3BINA 4ZYNA 4DN4M 5EPLA 1ZDVA 1KL9A 4R4OA 4BY1B 4I6NB 1L1OB 4R4QA 3I2ZA 1I6VC 2KVMA 5NUCA 1XF5L 3OSOA 2W55A 2ZNVC 3S17H 5M5WB 4ACFA 3KLSA 1CSPA 2MHVA 4UY8C 2B8GA 3DWAA 1VLBA 2Z6KC 1K8OA 1LUZA 2ZXRA 1XTCD 2EY5A 1EYAA 3VDYA 4KZCA 3K0YA 1P98A 1YMHE 4XX5A 3BJUA 2K7VA 2MO0A 1EIHA 2C60A 5HGTA 3I7FA 2MBEA 5C3JB 1K83B 4JLCA 1I4RA 2KWCA 3RZDH 4X62Q 2WXPA 2K75A 1HNWQ 3VTVA 1UF0A 4FA6A 2KN4A 1FGBD 2CS4A 4P75A 3EFCA 2EJFC 1FFVA 4XE0A 4PMBA 1D1IA 2E2HH 1ENFA 1GO3E 4H7BA 4YWGG 1CKNA 3S15B 4I6LB 1A6XA 3VFKA 4BBSB 5AEKB 2F0IA 3BK1A 3J81c 2BYTA 3V2TA 3NHHA 2SNSA 4P71A 3U7ZA 3U58A 1IYFA 1HTLD 2J0KA 5EAYA 1FCLA 5EDSA 1FJGQ 2ZJDA 3TEWA 5JHAA 3D31A 4JPBW 2V0GA 4L5RC 1VS0A 3TEHB 4LF8Q 1X3GA 5ELOA 1X3QA 1XMOQ 2JA9A 1PRTC 1X3FA 3AEBB 1ILQA 4YCWA 5M9OA 3CC7A 2AWNA 4JI0L 4DHZB 2PNRC 3F2BA 3B1LX 4JI6L 2IZVB 3H94A 3H1UA 3I3CA 2D2QA 1ROEA 3EHVA 4KZ0A 2B76B 3B2FA 4KJOA 3PMFA 3V62A 4ZCKA 3RUZA 1QQRA 1W3SA 3CCQA 2OF1A 3P63A 1RD9D 1LTLA 2E76C 2K4KA 2FCQA 4IOIE 3ND9A 5GAEC 3UDFA 1WGDA 4OEMB 5E6PA 4A3EB 3I9V1 1AZPA 2WV6D 3PZ7A 4HJGE 1E1OA 1EZ6A 1XNRL 1WXAA 3DCGA 3Q23A 3E56A 2F0NA 4WIPA 2YTVA 5LL6X 4YSXB 1K8RB 1RLFA 4B95A 1IKMA 2IGDA 1GHKA 5HHDG 1WYWB 1SAPA 3CKIB 5D94A 1QOHA 1K28A 1YQBA 3HKZE 4GSWA 2KYWA 3TBIB 3A9JA 2DGYA 4OX9Q 3M4OH 1DOLA 4RWSC 2HQLA 2R7ZG 1JORA 4M02A 4FXDA 3CP0A 1JWMD 5M3MG 2JJQA 2K5WA 3Q8DA 2PO4A 3RZWC 1R4NI 3GTKH 3URYA 1E24A 3GTOB 4ILWA 2K8CA 1TWGB 3DBLI 2D5DA 3OAWA 1IYUA 5GROA 4CHTB 2MJ8A 3AEEB 3PZ8A 4L2YA 2X38A 4ULLA 5J1ZA 1LTRD 4FF3A 2G9HD 3T4AC 5FO9B 4AJWA 3R8BA 1HH2P 2AMCB 1HA5A 4K2LA 4RGMA 3T1YQ 4RCOA 2F0VA 2HT1A 3Q69A 4H0LC 5AZGA 2BVCA 5JJKA 3J7AV 3LX0A 4PZ7A 4NP5A 2MNAA 1XCTL 2F0JA 1C9OA 1EYDA 4RKLA 3J81E 5IIFA 2SDFA 1PXUA 3RLOA 1QB5D 1TWGH 3HEJA 1P9DU 1V2YA 2DJFC 1WOCA 3AYHB 2EYFA 5G3LF 1VR9A 2BTEA 4DV1Q 1TBEA 2P5ZX 4F7ZA 2KJHB 3HOXH 3J9CA 5JOBA 1IBKQ 4LUZA 3VTUA 2K32A 4YT0B 1HJPA 4EQ5A 4FJYA 1DCZA 1P1AA 5ELBA 2K04A 1HFNA 3APFA 5IA7A 5BYQA 4IPDA 1JR0D 3K0XA 3I4NG 1GOZA 2WDTB 2PZWA 4HPLB 1M94A 3VUXA 1K9MC 5KHQA 1WGKA 3J81j 4LCDE 4ZHPA 3NBIA 1E0ZA 1YNND 3Q3NC 4CGYB 4DV6L 4BXXH 2ZXPA 4PK1A 5FLXL 4HDOA 3AEVA 4B3RL 1KAWA 5J39A 4GDKA 3S2HH 1WXMA 5CV8A 3KH0A 5CV4A 1KNAA 2K03A 1IGDA 3ZNID 1VQKA 3KJOA 1GJXA 4WJPA 5D6JB 1STYA 1KDAA 2K01A 4QJFA 2JA6G 1JWAD 2NN6G 1WTQA 3AFPA 4L5TA 4YTPB 5EPJA 2NB0A 1I3QH 4KJNA 3RN5A 3DWGC 4KDLB 4ZLTF 4FADA 3R3MA 3PCOB 4B9WA 4EOYA 1LO5D 1TTNA 2QJLA 3MXNA 4NXNL 4JI1L 4P1CC 3PRPB 4W9CA 1DONA 1H9JA 2EY1A 3CCRA 3UQAA 4US8A 1GG3A 4B3TL 3KWLA 4GIVA 3STBD 4HSPA 4AUQC 4XZ4A 1QOGA 3NWTA 1NE3A 3I72A 2KX0A 2L1BA 3LWEA 5EBDA 1BQQT 2NBUA 3H0GH 4ID6A 4A75A 3EBEA 3PGEA 4FBJB 3H9DA 3PO3B 3OWEB 4KKUA 1YN5A 1UD7A 4HJAA 1VRAB 1B9MA 4HSVA 1PH1A 3MJ5A 1LTAD 2D9UA 2DNFA 2R2QA 4YSYB 3AEGB 1ILPA 3D32A 3IFTA 4JI0Q 3HOZH 1C0AA 4JI6Q 1VDVA 2ATWA 1B9RA 4ZK9B 2VH2A 3QARA 3FKIH 2CQOA 1C4AA 3OPOA 3S1NH 1DGSA 2MGSA 1BCPB 2O6VD 1D5ZC 2WLBA 5C1ZA 1II3A 1PZID 2C35B 2INCC 2KK8A 1GM5A 3QG1A 1I4HA 5C3XA 4DDGD 3PO3H 4MTNA 3CPWA 2HIVA 3S1MH 3GDEA 1KJTA 1C3TA 4LNQA 1XNRQ 2N3SA 3QJYA 1BDOA 5J22A 2ACZB 1PFBA 1Q5WB 5IP9H 1MG8A 1OXSC 1WRDB 1EOVA 2LGDA 1KAAA 4DK0A 1DD2A 2WWZA 1YJWA 3C3LA 2WQYB 1JT8A 2WB1B 1IHZA 4BBSG 1WMHB 1EIGA 5FLXE 3WA0A 3H09A 1NI3A 2K5PA 1OFFA 1V6EA 4IC7B 2JA7H 4C2MB 3DXJC 1KDCA 4DDID 4LFAL 4UPAA 4II2B 3VTWA 2H5XA 3EC8A 2ZW1A 4PZ8A 3OLMD 1LXDA 1OQQA 3R3OA 2QHOA 4ABNA 5D65A 2Y5CA 3HOVB 3C1FA 4US9A 2N4FA 1GUSA 4DAMA 4XYQA 4XQNA 1HZBA 2FE8A 2WXOA 2ASQA 3OHXC 3ZO5B 4KHVA 1XT9B 2NUCA 3HGBA 2PE9A 1TY0A 2I46A 4K8JA 4LNIA 3BZKA 4FF2A 2LUMA 4N9F4 2RVLA 3CCEA 2BS2B 2E8GA 2FHTA 1BMLC 1Q10A 1DOKA 1SNPA 1DJRD 5FJ8H 1Q12A 3SK4A 2RHQB 1F77A 1GUNA 2CH4A 1CKNB 1V86A 2SOBA 3V05A 3PREA 2KJXA 1WGGA 4IWOA 3UGBB 1PRTB 3Q2AC 4NJCA 3MVVA 1HHVA 2F0KA 3VR2A 2MLBA 3F2DA 3NEMA 2NBWB 4OZBA 4YCVA 4HTHA 3FKYA 1Q90A 3AXCA 2CU1A 3JAMc 2GBNA 1SBBB 2HD3A 2C5LC 2YLMA 4DV6Q 2KJ6A 2PW9A 4L1BA 3X23A 5JVH3 4B3RQ 1PTOC 4GU2A 1GAQB 3U4ZA 2VUMH 2WU2B 1I94L 1G6JA 4HROA 3Q3MC 5E6NA 4FVMA 4TSSA 1VQ5A 4JI8Q 3ULLA 2WXLA 3H6NA 4FP5D 2G9DA 3HOXG 2D0PA 3PZDA 4W9IA 1I6HH 4A76A 4OVVA 5T1GA 1V8QA 2NBVB 2J0MA 4A6QA 3KUDB 1RYJA 1D4BA 2V4IB 5C4HA 1B3AA 1BBUA 2E2JB 4XT1B 5DPTA 4RMFA 1XYIA 3JC66 4JI1Q 4NXNQ 2E6XA 4GLSC 3RT3B 2JU6X 4BBRB 1SSNA 2NVUI 3Q6BA 4JGHB 4B3TQ 2F4IA 3IT4B 3Q8FA 4BXXG 3GE3C 1HR0L 2ZCBA 4EKUA 4YWLA 4DUYL 4CDDC 4REZA 2LHEA 1I50B 4OWTB 1F9QA 2BPSA 4G11A 4ZDVA 1G6PA 2JA5H 3H3VH 2E5LL 4ME3A 3V60A 1W6KA 3QC8B 1PRTD 4ZRZA 3KWVA 2FJ2A 2AL6A 2ZPYA 1QILA 3GZNB 1P8LA 4KLKA 4N9TA 4DNIA 5FLMG 4A9AA 5D14A 1RTNA 3AEAB 1LACA 1X6OA 3HOYB 4C3IH 1EU4A 4BBRH 4GLXA 1WM3A 5IOIA 4DV7L 2KQ7A 3ER0A 4JBMA 3ND8A 3GOEA 1GB4A 3NS8A 4KGTA 1D6EC 1NY4A 1TJEA 1S5ED 1AE2A 1YHBA 3E9HA 1ZYRC 2CJNA 3A56A 4JI7L 2NVTH 3SU8X 1C8CA 1EFID 4GNXB 1OXUA 2CW0C 4G4KA 4TQUS 4A3BH 4JYAL 2OEOA 1YX5B 3B0AA 4LF4L 3NVWA 3L08A 4ITKA 5KHOA 3O13A 1WZ3A 3EECA 4BOSC 2WXJA 1R4NB 2EYMA 5LMNL 3HOYH 4HWIB 2NVXH 1O78A 1MPEA 1NENB 2IO1B 4DR3L 1MI0A 3NTKA 3ONAB 2M1MA 3DBLB 1Z2MA 2O5IC 4WQOB 2F0UA 2MSED 4A3LH 2WAQB 2VXWA 1OQYA 3Q8EA 4XWTA 3TEZA 1ET6A 1XTDA 2BCOA 3D4DA 3I55A 3P4QB 1WTHA 3SVMA 2VW9A 4WAAA 1BVSA 1CZWA 4W9FA 2KDIA 4KGRA 2WFWA 1MG4A 3M9BA 2WNMA 1I35A 5GAGC 3DVNV 1S3SG 4NZLB 3L2PA 1IXRA 4LFAQ 5M5YH 4B9XA 5AJ3L 2PJHA 4GDLB 2IPKD 4ANUA 1SSOA 3PO3G 3RNFC 3DWPA 1EM7A 3U52E 2BYEA 3VR9B 3OIQA 3TEXA 1RL2A 2OT2A 1ZOYB 1FGUA 1QLBB 1ZUD2 4K1RB 1FL0A 5IP9G 1DM0B 1WIAA 2DNEA 3VR5A 2C7MB 2B3GA 2Y0SG 4QUCA 3VR3A 4JI3Q 4W9EA 2C9OA 4EQOA 4U673 1N36Q 4IW0A 3L3OC 4GLAC 5C4XH 2C7NB 1SDFA 3HKSA 1OTCA 4X3KA 2B63H 4NY0A 3RNEC 1KH0A 3FDTA 4IPGA 5IGBA 3QR8A 3EGRA 1VQIA 4LDTB 2JA7G 3N30A 3DWQA 1UAPA 1YI2A 1QJOA 4K5VA 4O42A 1KHIA 4WFN3 5C0XH 5JEAH 4CKBA 1PVOA 3JYUA 4FXGC 3VHTC 1V5OA 3N6RA 4IFDH 2ZT9C 4FLHA 1JB7A 3FHWA 2MBBB 1SYFA 1J8IA 1FXTB 1V80A 1F9SA 3Q24A 1Q1EA 2WB1G 4AP4C 1VQAA 5IT9c 4N59A 3I73A 2PKOA 3NVVA 1V1PB 2GLSA 2INDC 1Y56A 3FPPA 4YL8A 3V6CB 1KABA 4DFAA 3NS1A 4EVOA 4KGSA 1UBIA 2LXAA 4BS9A 5I2YA 3V96A 2L0TA 4KV2A 3RD2A 4L63B 4USAA 2F3VA 3DHQA 2KT7A 3AM9A 4BBNC 4I7ZC 3M3YH 1I94Q 2PMVA 3BYYB 2L83A 4JI4L 4IWPA 2UYZB 4Y7NB 2MJDA 4ALPA 1VQMA 2MQJA 4QUFA 2EYHA 2K39A 5E4WC 1X65A 3DM1A 2Q8TA 1PFNA 5E4XA 2JA8H 3JSVA 1ENAA 3KF6A 2A8VA 3CSFA 4WAFA 4DXAB 3GTQB 2FAZA 2YYZA 1R9TB 1H9SA 4LF6L 4AYBE 3TSSA 2KMAA 4D2KA 4WWNA 4AS1A 4N9PA 1K8GA 1CK1A 2RQXA 1K3RA 5BMGA 1R4PB 4MSMB 1HR0Q 4C56C 1B53A 1MVKA 3CWIA 4DUYQ 3CSTA 1MSHA 2VUMG 2IW3A 2Q2HA 1F52A 5M5XH 3NP8A 1WRIA 4GOPB 2E5LQ 3BZCA 4A3JH 3MXPA 2K8BA 4N8X1 2MP2A 2CCZA 4HCEA 1VQ7A 1JWSD 3ERSX 4MACA 1NMFA 2IO3B 3GTQH 3IT6B 2A6HC 4G7ZC 3PGZA 2DZJA 3TEYA 4ZRJA 4XT3B 3ZDMC 3GTLB 1RJTA 1UE5A 3MC0B 1EY0A 2K6DB 4A3MH 5AUKA 2Z0EB 5IP4D 2D0OA 4DV7Q 1N6ZA 1TXYA 3TIXA 3KBGA 3UDIA 2MBOA 2MEKA 1SJED 1IW7C 2LMCB 3NK9A 2AL3A 2YU9H 3HVDA 3M62B 3L54A 3J80i 3ERQA 2OQKA 4JI7Q 3G71A 4DAVA 1D1KA 2ZZPB 2JA5G 4JYAQ 2RDHA 3W5OA 1MHXA 4YTNB 5J17A 1J6QA 1KXLA 4LF4Q 1LT5D 3GD7A 2RD0A 5LMNQ 2VQEQ 2QSDA 1BOSA 2EMSA 5C4JH 3QIAA 4DR3Q 2KX3A 3ML8A 2PPHA 5IYBG 4ICUA 2JEAI 1IP9A 1TIFA 1GNUA 4BBRG 1EQQA 2A5UA 2LXJA 1V49A 1YN4A 1PFSA 3S2DH 5M3MB 3RZFA 4JOIA 4HJ8A 1NR2A 2WDVB 2KDFB 1C1YB 2JEBI 4C3JH 1FNUA 2WGSA 1GUTA 4WQMA 2Q2IA 2DENB 3KYCD 3I4LA 4JCVE 2I5MX 2ZM6L 2JXTA 4F8CB 5AJ3Q 4ARIA 4G7HC 3W1YA 3FILB 4PV1C 4P7IA 5DCNA 2JE6I 3AE5B 3W2DA 2R92H 3RLNA 1HZ6A 1VQHA 3EIVA 4JOIC 5ELEA 3HOYG 3TS2A 2RMMA 2KDMA 1V1OA 3NZ3A 3IKJA 2Q2TA 1WCMH 2BT6A 1VQ8A 4A3LG 2IHEA 4BFRA 1CJEA 1BT0A 1EY9A 3QA8A 3TRZA 3GTMH 2N1VA 4XGAB 3KFUA 2MFIA 4A3KB 4H44C 4IO9A 4EZLA 1PTOH 5EPKA 1LTSD 4LK1C 1B9NA 3TN2A 2I07B 4S3SA 2G45B 4XIGS 1EL0A 4V190 2K5VA 3OTOL 1S1QB 5H8YE 2L1AA 3KDFA 1B4OA 3HOUH 4QIWE 2JF5A 5JJZA 1JQYD 4AQYL 3KUZA 3I4NB 4Y52H 2WAQG 2Z0DB 1Y1VB 4BKGA 2CHWA 5BR8L 3QK0A 5EJWA 1WFQA 1KIXA 3QOJA 4TUUA 2WHIA 3RNGC 1C77A 2MUYA 5FO7B 5JH5C 1EQTA 5C4XG 1PTOD 1B50A 2J4XA 3A33B 2TSSA 3LWUA 4OELB 5C3WA 2XEWA 5HGQA 5EBCA 3MC9A 2JA6B 3ENEA 2MJEA 1FCCC 1F2RI 1PYBA 1CHPD 1EY4A 1VQNA 2INNE 1BCPF 2KA7A 3DBRB 5L95C 4JI4Q 5JEAG 2F3WA 2K6AA 5M3FB 3UE0A 2UUCL 1U5KA 1HQMC 1LGRA 5FOBB 1NUCA 1XNQL 3IG3A 4RMAA 4W9DA 3N3KB 2PIAA 2RPVA 2XK5A 3S17B 2NCNA 5IP7G 3RNBC 3HM6X 4DWFA 2MWSB 1MD2D 3WWVA 3ZRFA 4LF6Q 4BA1I 4MGZE 3GTPH 2X6GA 1DOYA 3N52A 4MHEA 4KMUC 3PUYA 1M4VA 3LDZE 1L0WA 4K3CA 4HK2A 1S3OA 3K59A 3FMCA 3T51B 5ISRA 5DNFA 1L2NA 4MGIE 2PNHA 5M3FH 3U9OA 5HURA 4DR1L 4IALA 4DR2L 1F2RC 1NDDA 3RZDB 3ZNGC 3RUIB 3ZJYC 2D3CA 1Q0WB 4GKKL 4A3GH 2MH7A 4MM3B 3ZVVA 3E0EA 1TU2B 3L9AX 1X55A 3PF4A 2E2HB 4GOCA 5E6OA 3LNNA 4IUTA 2MW5A 3P42A 4LNNA 3CCVA 2IX1A 2FBWB 1X32A 1CFMA 1UWXA 4DAYA 1MIUA 1MJEA 1WX8A 1VQ9A 4URKA 2J7QB 1UZXB 1L4DB 1ENCA 1VQFA 1V5TA 1KLUD 2LRWA 3KW5B 3Q0AA 2YTYA 1YEZA 2EYPA 2NZ1D 4K14A 3RMHA 1WSPA 3OMGA 2OJRA 3APCA 5IGGA 2CW0D 4KY6A 2BE5C 2K6QA 2OCEA 4CBVA 4L23A 4JWSC 1JJGA 2JWZA 2KMMA 4W9JA 2E2IB 2F0DA 4MIUA 2JVCA 2KWDA 4OZAA 3VDZA 4NB3A 5IYCH 1JOKA 1U4PA 3SXHA 4HAEA 3DBHB 4ZQ3A 1HCZA 4DA2A 1BXTA 2B2WA 5KNDA 3GTGH 1YNJC 2NMQA 3AB5A 2L9HA 4X57B 1PYWD 3AE3B 2DZMA 1G2SA 3NZUA 2KD0A 2K5QA 2NWGA 1ONLA 4A3MG 2V3NA 3H3VI 4RF1A 3D3RA 3KYHC 3HG9A 4WJOA 1Y14B 3M63B 2BWFA 2PPBC 1K0RA 5KYLA 2BS4B 3Q3FA 3VYUA 3C2PA 1N61A 4C7YA 5GAHC 2JP1A 4X64L 2B2WC 1VF5C 4WRDA 2E2IH 3KLSX 2FMCA 4LUVA 4RKBA 4E71A 3TP8A 2ZM6Q 4BWGB 1HNZL 1FO4A 3CAMA 1ZXIA 2HJ8A 1A2TA 1N62A 5L83A 4ASWC 1SROA 2ALYB 1C48A 4PG3A 4BY7H 3A1QA 3T3OA 1HPCA 5EE9A 1CKOA 3VRAB 4TQ1A 1PDQA 3K80C 2NZOA 1E0BA 4A3IH 4JPSA 2D62A 4NXML 2DNCA 1F9PA 2OTLA 2Z0SA 4C4VB 3K81C 5D3DA 4DV0L 5LXHA 2KO3A 3M4OB 1I4XA 1B7YB 3OG5A 2UXDL 2LXKA 1K3BC 2WKCA 3H3VC 4MDKE 4N58A 2N55A 3NE5B 1D7QA 3UI3A 1E7UA 2LJIA 3DBSA 2BF8B 3PVLA 4BVUC 2M17A 4IM0A 3GTKB 4E6IA 1YJNA 2VQFL 1K0SA 2ID0A 4QGUA 3OTOQ 3AFQA 2B2UA 2EY6A 1XCQL 3U30A 3SE0A 5GMVA 2ZEQA 1KRSA 2N7JA 2R92G 2KCMA 3RN2A 2QW7A 1U4LA 1EZ8A 4DV5L 1HZAA 4AQYQ 2D3BA 2DWQA 2RR9A 1GD7A 4HLEA 1UNSA 5BR8Q 2KQSA 2QDFA 4CO7A 1WCMG 1YHQA 1WXSA 3NY5A 5LMNW 1V8CA 2Z1CA 1SEBD 2EMTA 4NPNA 3O65B 3SR6A 4GN5A 3N9YC 3HOWH 1EU3A 2JPHA 2AYOB 1N60A 3KOJA 2A73B 4L5SA 1PH8A 1JOOA 3HOXB 3S1QH 5BMHA 5CYUA 3FRPB 2EXZA 4GN1A 1A3TA 4LF7L 3PUZA 4LJZC 2XGTA 3RLFA 1V9JA 1BUVT 2JY6A 4HCNB 2UUCQ 3HOUG 3HFZB 3RCZA 1XO3A 1EYGA 4KN4C 2ZJQA 3CCJA 2D2CC 2EYLA 1HRJA 2REXA 2RF4A 4G57A 1XNQQ 1V97A 2YV5A 3BU2A 3M7GA 2N9LA 3NOBA 5DPRA 1B2TA 4W9LA 4M1UB 3IFDA 2J52A 1B8AA 1EIFA 5C0XI 3PLVA 1HQRD 2K5HA 5BMIA 4A3KG 1ZE3D 3PQIA 3S2HB 4IFDI 1YNTE 3NQIA 5EE0A 2F52A 1TGZB 3AMZA 2CH4W 2NS5A 5IGFA 5L37A 1JJ2A 2CQAA 3LB8C 4ME5A 5HG2A 2LFIA 2WP9B 2OTJA 2NVYH 3DHIC 4RHRA 1RWSA 2PMZB 4DR1Q 4DR2Q 1JRUA 3PV1A 1TS3A 1GUWA 5IO9A 1VMCA 2KLGA 3S16H 1I3QB 3UDXA 2I0QA 2RDFA 1Y1VG 2A6HD 3U2SC 2LZ6A 4JWUC 5FLXc 2VL6A 2KFKB 4I7AA 4HRSA 4M8NA 1OGWA 2QCPX 4APVA 3NZSA 2JSVX 2CFMA 2KAJA 1HTQA 1FPYA 1IW7D 2KWVB 3SDZA 1GB1A 2QC8A 4JBJA 3HRZC 4GN3B 4LMQD 3CC2A 4HIOA 1VQDA 2L00B 2L32A 3VVWB 2O6VB 3HZXA 4FF4A 2HTHA 3H0GB 1FD7D 5I9PA 3ULPA 2PQEA 5KNCA 3MAQA 3EFUA 2KCNA 5M3FG 3FP9A 1RFAA 1TVXA 5E6JA 3WDNA 2WS3B 1QCBD 3L0WB 5CV5A 1T0RC 1WJ4A 3W1SA 3K58A 2N8NA 2F0HA 1KQSA 4ZUIA 4ANVA 1BO0A 3KLWA 3HOZB 4A3GG 3GTJH 1ICWA 2K33A 2LY7A 3MEFA 3QOLA 1T6BX 4O0AA 3FKIB 1D8LA 3TREA 5C3EH 1WJ6A 4X66L 2EZVA 2KQ4X 3PRMB 3VH4B 3S1NB 2M19A 1B44D 1FNWA 3K7AH 3AE1B 3W1SC 4HVBA 3NTIA 2DX5B 3KDFB 4HXDA 1P7EA 3K57A 4IURA 3S1MB 4A3OA 2RCNA 1B1ZA 4X64Q 1EUJA 3ZKJC 1QE6A 4OIJA 4IJLA 1S40A 1QZHA 1HUNA 1Y8OB 1HNZQ 3V6EB 2M00A 4GKJL 3H7PB 2Y0SB 5IYCG 2MA9B 1E8ZA 2IGHA 2OQ0A 1DOXA 2IY0B 1TZ1A 2ON8A 4HPMB 2EJMA 1GKHA 5GXGB 3A54A 4ZRIA 3D6WA 4IQZA 3HP3A 3D4RA 5ELDA 1ZDXA 2KTRA 2N0SB 4OZCA 1ASYA 3P4PB 1EWCA 2XN9C 3PF5A 3KYDD 4DV0Q 1SYEA 2KEDA 1ZEQX 1XMQL 3BS1A 5I6WA 1TS4A 2VB2X 3FPUB 2UXDQ 2JA7B 4JBKA 1WF9A 1FEHA 4ZOHC 3I4OA 3NBHA 3VRBB 3PS6A 1LT6D 2ES2A 4POFA 4HKQA 2K5NA 2VQFQ 4XWWA 3M4QA 4DKAC 1FNVA 2BKRB 2Z6BA 2V4DA 1Y8PB 2XIWA 4O1NA 1STBA 4DXGA 1YIWA 5FR3A 2AWTA 1GXDC 4YWMA 1STGA 2VZKB 4DV5Q 4YY3L 2F4VL 1BNZA 1BBWA 2WXKA 2GBRA 4X3SA 2ZNVB 1GUAB 1A5RA 1XD3B 3RN9C 4A3IG 2LD9A 1RM6C 3PUXA 2D3GA 4LJPB 1AFPA 3PUWA 1XPUA 4K6DA 1YJ9A 3X3MA 5KRUA 3K5MA 1UELA 2WXNA 4CDFC 4IOAA 4MGYE 4KIKA 1CZGA 3MTSA 4RAUC 3NXWA 1VQ6A 2NPTA 3VYSA 1AH9A 4UHVA 1BBXC 3N32A 1Q3LA 1T5XD 3MXUA 3UIOB 2IO0B 3CD6A 5E7NA 1X3EA 2Z4IA 2VZAA 3NHEB 3AMUA 5J2RA 3TL5A 1ESRA 5AZFA 1F2LA 3K8AA 3OOCA 1LFDA 2LJ5A 5CHVC 2D07B 3E9SA 2PI2E 3FVQA 2E75C 1CMXB 1U4MA 4ZKCB 3KQ4A 1M8AA 2VUMB 1PH4A 3HOWG 3K6OA 4MH8A 1YJIA 2WDRB 1U0LA 2O2VA 3AI5A 3GE8C 3PPAA 1STHA 1E1TA 2CWAA 2JZ3B 3M3JA 4IZ8A 2OWOA 2VZKD 5IY0A 3MC8A 3SFEB 2L11A 5IGDA 1I6HB 4X6AH 1Z7TA 1IL2A 3QX1A 1BUIC 3B9JA 3A9KA 4QL5A 1A63A 2JT4B 1Y1WH 2WINB 4J8QA 4MGKE 3TP6A 3LXFA 1OEYA 2F0LA 1AP0A 1E22A 2ZJRA 2W9NA 4FJVB 1TWAH 3KVFB 1C7YA 2WXGA 2BE5D 3A4SC 2JA5B 1WY8A 4IDIA 3T53B 2X69A 4IOCA 3SR1A 5BN3A 1P3QU 1PDXA 3Q14C 3A1QB 3RD4A 3R7RA 1LTTD 3CRLC 1H9KA 4ARCA 1YHAA 5CBAE 1Y8NB 4A3FH 2R93H 2KQ3A 2E2DC 3MHBA 4X65L 3C19A 1E7VA 5IE8A 2KCCA 4IUPA 1R7SA 4DV4L 1YNJD 4C3IB 2H1EA 4P74A 4K7SA 3CCMA 3TZUA 2AQ3B 3J80L 1V1QA 3H15A 5C44B 4JIOU 3TJPA 3BDCA 3A4RA 2SEBD 1FRRA 4X66Q 1CZPA 3CXCA 2EELA 3B08A 3ECIA 3HVZA 2L76A 4ZUJA 1Q81C 1G2TA 4C1NI 2NVTB 4OVUA 3L16A 4A3DH 3HKZG 4A3BB 4KX6B 2KKCA 2PLPA 4R4TA 2MX2A 1NMGA 4K0KL 1AYFA 2BB6A 2PQAA 1JMLA 2B2YA 3NSWA 2NVXB 1FIQA 3A9JB 4EQNA 2XRQD 4YIJA 3PO2H 4G3XB 1QOAA 3RNAC 4GKJQ 4JVZA 3QWZB 3T16A 5C44H 5I4DA 1WR6E 2M8SA 3MXGA 3S14H 4XDCA 1C4CA 1E7ZA 1SMYC 1KC8C 4TMAB 2Z8LA 2YEPB 1HE8A 2KCTA 4P16A 4KI0A 1V81A 2AUKA 3RNUA 1SB3C 3P4SB 4R1JA 2B2YC 1QUQA 2KMCA 1XMQQ 5H92C 2PZTA 2A4ZA 4K5XA 3AE6B 3H0GG 1MHWC 1LTID 5M5YB 4R4CA 1M90C 2DJGC 3JW0X 3VH3B 1SXTA 2N7DA 3ZLZA 3F2UA 3CCSA
chains in the Genus database with same CATH topology
5EE3A 2W82A 1A3VA 4HR7B 4ZAIA 1V43A 1E6EB 3K5OA 5C4XB 2B63B 2CVRA 5JPMC 3PV0A 1UGJA 4J3OD 4TKOB 3TP5A 1LT3D 5T8IA 3AE7B 1Q1BA 1YQ4B 3ETRA 2XNAC 2K28A 2F0OA 4LAAA 3FC4A 4PNYA 4LLGM 1TIID 1ET9A 4OO1I 1EQVA 2JYTA 2F0GA 3A8IE 4GDKB 3J80E 3KF8A 3VQIA 2FUG1 4A55A 4TRDA 1PGBA 2AQ2B 2LS01 1ACCA 3NUCA 1QWYA 2KUMA 1XWEA 2PVOD 4IKGA 4L8JA 1WTVA 1E2WA 3AV8A 1R4QB 3M3YB 4FXKC 1QNKA 2H89B 2F0MA 1PZKD 5K36H 2JA8B 2L55A 3EQLC 3S1RB 4ZRQA 1C9FA 4A90A 3U9SA 2MPMA 1TKEA 4KK7A 3ZJVA 3CU7A 1N63A 5I2XA 2WDQB 2BA0A 5M5XB 1N5WA 4A3JB 4KN7C 2XVSA 4RGOS 1VF7A 1SNCA 1HEZE 1SYGA 1S5DD 1RTOA 1FR3A 4A3MB 1PLFA 2K9XA 3M7NA 3C8YA 4ZHOA 2L12A 2YU9B 2M9VA 3CRKC 2M56B 2I2YA 4FYDA 1NSNS 4FNFA 2JSOA 2C5CA 5EKKA 1AEXA 4CKEA 3H6MA 1BF4A 2WXIA 2FINB 3Q8AA 1NCVA 2IT1A 3L7ZC 1DOMA 1K8MA 3MWYW 2GA4B 5C4JB 2NBFA 1I7HA 3BG3A 1Y69U 1T5EA 4KKSA 5KEEA 3P75A 2B39A 4C1NK 5KGUA 3S2DB 2EE1A 2TMPA 2JYEA 4C3JB 5AUIA 3TMEA 3IXSA 2KECA 3CHBD 1QT9A 2J0TD 3ABVB 2EOTA 4I65A 4UAIA 2QILA 2R92B 1TKGA 4HMJA 4C3IG 3CQZB 5T1IA 1F9RA 1WCMB 2L52A 2ICIA 1SYBA 3GTMB 2EVBA 1JC7A 1PTOB 1PFMA 2PCFB 3I90A 2F03A 4CJ1B 1IBXA 1VDZA 2O2LD 3G7LA 1HZ5A 4DNTB 4JE3B 1CQFA 1LTGD 3B2GA 3SR6A 3HOUB 5C0XJ 1NEKB 1ZXHA 5JEAJ 1EEID 3K5NA 2L4NA 4IFDJ 3ZQ4A 3TP7A 1STNA 1WD1A 1JALA 3OIPA 1TYGB 4C3HG 1A2UA 3P1MA 2IJ0A 1JRPA 2DY7A 3BDOA 2QEJC 5TSSA 1G6ZA 1JROA 1HTPA 1H9RA 2SNMA 4LK0M 2Q8RE 2IX0A 3EJIA 5A35A 2FMMA 1SNOA 4RGTA 1G8ZD 1E10A 4B0EA 1G291 2A74C 2A6EC 4KY5A 3GTPB 2F0EA 3HS0C 2RBMA 4DXFA 3PIO3 2D5GA 1JWBD 1K53A 5IGCA 5C0XG 2EKIA 5D7GA 5DAUA 1O7ZA 4IFDG 2DY8A 5COYA 5FO8B 4IN3A 1S5BD 5C5MA 1CA5A 3T56B 1OXVA 3BVGA 4A3GB 1PFDA 1TZOA 4OVZA 4ZYSA 2L5TA 5K36G 2Y5PA 3EUB2 1PUTA 2K05A 4NDXA 5EQ0A 3KK7A 4RGNA 1WTOA 1KF6B 3MA2B 5JVG3 1XLNA 3P4RB 4XDXA 1UWMA 1A70A 4EQPA 3LYYA 1SJHD 4KTAA 5EGTA 1XEEA 1IL8A 1BCPC 2HDLA 3BDLA 4OHJA 5D3IB 3PIP3 2MP1A 1F2YA 3MFGA 1SF0A 4KKJA 5E3FA 2JXMB 3P20A 3GTGB 5I6YA 3E0JA 3BYTB 1SMYD 1ZYRD 2H4OA 2WXRA 4PQXA 2W54A 3GV6A 4AQ7A 2BA1A 1EY7A 1A3UA 3E5SA 1L5PA 2QKIC 2J53A 1VZ7A 1SNQA 3GP7A 1BR9A 1E2ZA 4U68A 4BY7B 1I4QA 4RNAA 5KYIA 1TS2A 1WXQA 1PRTF 4A3IB 1P7FA 2GRIA 1HXYD 5CBEE 4K2KA 1JW9D 2E74C 3NTHA 1AN8A 4P2CB 1C78A 3KBXA 4DNRB 3GS2A 1ZKOA 5JAVA 4DGZA 1KLGD 3TUOA 1EWHA 4QMGA 1YN3A 1LV9A 2AUJD 1PGAA 5G5GA 2HQEA 1WD0A 3A7LA 5BN5A 2NTSA 3NPPA 3Q8CA 4X3TA 4OO1H 1FD6A 3J81L 1S5CD 1XLPA 3VA5A 2AWOA 2EYJA 4F8MA 1JQ4A 4C3JG 3HOWB 2Q5WD 1DXMA 4K8IA 1HA6A 3GB1A 4YSZB 1GUOA 3VYRA 2WU5B 3S1QB 1CTMA 1XX8A 3W3AA 2DN8A 2K3UA 3I57A 2ENBA 1H9SB 2SAKA 1SE3A 2M2LA 3EFXD 3A8KE 4K6LA 3AECB 4PT5A 4J6HA 2I38A 1TWFB 2B2UC 4J1MA 3M85A 2PYKA 1ZXTA 3GQBA 1E7PB 3MHZA 2WXQA 2YEPF 2NVYB 1FXAA 3ZGZA 5CV7A 2Y3AA 5FK9C 2Z4HA 2A68C 1ZPSA 2CU3A 3AN1A 3D8GA 4WORA 2OHFA 3S16B 1CM9A 1U4RA 5CV9A 2V3PA 1N5XA 4CJ2C 3C46A 1QF6A 1D5XC 1FFUA 2R61A 3NRZA 4HCSA 3HKZB 1J7AA 4OGQC 1WWTA 1VZ8A 3OMCA 4RHSA 3IL8A 1TKYA 4DF7A 3AEFB 4XYOA 1L4ZB 5IODA 3GTJB 4OIKA 3H91A 1FXIA 1TR5A 3BWUD 2PW7A 1DOIA 5C3EB 3I8ZA 1L0YB 4LTUA 4X3UA 1QNUA 4HEDA 1IBXB 3K7AB 1JE4A 1L0VB 2JYOA 5LHY1 1JWUD 1J9OA 2KACA 5CR3A 1A15A 4CKCA 3J7AF 2DYMA 1YQ3B 2QDBA 4YXDB 3VR6A 2AQ1B 3PO0A 4NW2A 4KY7A 1EOTA 2W3SA 1RF2D 2WXFA 2MJ3A 1FMAD 1OXXK 1MI2A 2JZPA 1TQOA 1CQVA 1WYGA 2HDEA 1Q8IA 4OL7A 4KV6A 5A2QL 2J42A 5KNBA 3I4MB 3T3NA 1V1PA 4V0BA 4DAPA 1E2VA 3A7AB 4JBWA 4ODGA 2IDYA 2WKDA 3AU7A 5CORA 2QMTA 1L6VA 1S4ZA 2A69C 3BZDB 1JICA 2CJOA 1NAPA 2W3RA 3CIRB 2BOSA 1FM0D 4GZYC 3AB9A 1KTKA 4IUVA 4BA2I 1KNEA 2OXPA 4M8AA 2EJGC 3A55A 3BVZA 4R8IA 3X3NA 2A5HA 3VA7A 1QKZA 1PMRA 4HEA1 4Q2JA 4OO1G 1VJKA 5KIXA 1WTWA 2A6ED 1F2ZA 2B2TA 3FEWX 5HI1A 3D6CA 1LTBD 4DU9A 4P6VF 1IUEA 1H9MA 3NQTA 2LGIA 5C4ZA 3MEHA 4F7XA 3R2IA 1RCVD 2LEKA 1OQRA 2N88A 1TS5A 1EWYC 1OO9B 3AEDB 2B2TC 2ZXOA 2EY2A 5DM73 3W9CB 4RCNA 1Y1WB 2LMCA 4DQOC 1KFYB 1J7CA 2PZUA 3IAM1 4QF4A 2INPE 3AH7A 5LNK1 2EYOA 1TWAB 3MP9A 3I91A 1WTPA 2HTME 3DMUA 1BCPD 5BYSA 5A2QE 1EYCA 1PTOF 4A3FB 2R93B 1GPXA 3W5UB 4C7ZA 5DM63 1OXTA 3DUZA 1STAA 4CJ0B 3BVMA 3I70A 3OW7A 3ZJTA 1MGSA 4QCLA 2HUGA 1XLOA 1W6JA 1WTXA 4M0WA 5AFWA 3SHLA 3FILA 5BN4A 1O80A 2XSCA 4A3DB 4R8NA 4G7OC 4QB4A 1G91A 2F0TA 1ZP0B 2E3TA 3FAHA 1JOQA 5HFYA 1X3PA 3AE9B 4NKLA 3PO2B 3SK8A 3JAML 4JX1C 4CQNA 3S14B 5FKAC 1O7YA 2O4XA 1ML0D 4WH4A 2AX5A 3GO5A 3WOEA 3BIID 3SFDB 3QB3A 2F0QA 1ESFA 1SE4A 1D5MC 2NYZD 2B2VA 2EPBA 3EA6A 3G6JB 3HRDD 2NN6I 3AE4B 3DEPA 2PW5A 1QOFA 1K51A 2K1BA 1EY8A 2KHSA 3H8HA 4C3HB 2B2VC 3ZYYX 3SK6A 4PMCA 4R9WA 5JPNC 4N6EB 2R3ZA 4B0MA 3RPFC 2L0CA 3RZOB 1L6UA 3AE8B 1S5FD 3KLRA 3TZDA 2HCIA 4KD4A 2WXHA 3NVYA 3OWFA 5LL6S 1LT4D 1K50A 3VYTA 1EY5A 2K0PA 2PTLA 1TY2A 3EVQA 1QOBA 2QIEB 2LHDA 3IAS1 1SNDA 1IGCA 4NAMA 2DYOA 1YJJA 1IKLA 3RFZB 2XWBB 4WJWA 2A68D 1EY6A 4IUNA 1SFOB 4PMWA 4A93B 1FRDA 3PUVA 1C79A 1D2BA 3JAME 3L4PA 5EKLA 1O7LA 2B8FA 4DK1A 3EROA 1NR4A 3P7JA 1C4PA 5JXVA 5CMDA 2O5JC 2F0PA 4H2AA 2BBCA 3BK2A 4R3DA 1C76A 1NYQA 5K5PA 2RDGA 2RA4A 2XRSD 3MZ5A 2BS3B 3E6ZX 1RODA 2R6GA 4A8XC 4XXEA 2ONQA 2RSOA 4RH6A 2IL8A 1RFKA 1L0XB 2EDGA 4XQQA 5DEHA 2XWJB 5C5LA 2Q8IB 3HUIA 2ZW0A 5G3LD 4EGVA 5BYRA 5I9OA 3DEOA 2QF7A 3P1HA 4KKTA 3M4YA 4RFBA 5CGKA 2K5DA 2G1EA 2WACA 3Q22A 1Z47A 2RSNA 5IT9L 1WVLA 4HMIA 2GI9A 3AE2B 2F0FA 1KDBA 3GV3A 1NYRA 4FO2A 4RA8A 1TT2A 1CI3M 1GHJA 3ITPA 3J7YW 1AW7A 2NVQB 4RF0A 2IX3A 2DBYA 3WCQA 2RKSA 1STEA 2F0WA 1I4GA 1TWCB 1UUPA 2M0AA 2IWHA 1VMPA 4NMZA 2GB1A 3ZJUA 4HN7A 2KOLA 4K5WA 1UEAB 1PGXA 2A69D 5ELFA 1J7BA 4KD3A 1T3QA 2OEDA 5IGEA 1Z6HA 1CA6A 3KUPA 4AYBB 1MSGA 1U9RA 2HCCA 1XXGA 1YNNC 5MPOA 5F2DA 4XDDA 3D4WA 1LLRD 2F0SA 4WURA 1MHHE 4EE2A 1K52A 1WTRA 1NVID 1QG7A 3NWSA 4Z9CB 3DWMA 5C6AA 5IOCA 3Q8BA 1F2MA 4FXCA 2KEEA 2X6LA 3U4EG 2H88B 3A8JE 3IAYA 1TWHB 2LKVA 5IT9E 2NTTA 2BB5A 1TKWB 2R7ZB 2VNUD 3TDQA 3NVZA 1AZQA 2BW2A 4NAWB 2BDOA 3R93A 4F88A 3QO2A 3SK5A 4L6TB 2K22A 1I4PA 4XTCS 1SE2A 1AWDA 5E1FA 2F1MA 2VB3X 3QWNA 1JCKB 3K5LA 4C80A 2IGGA 4XQJA 1F0ZA 2CHBD 3VR4A 4Q5VA 1DGJA 3VR8B 4JK1C 2PVGC 3Q6SA 1JB3A 1SYCA 5EKIA 3S9WA 3R2TA 5CC4A 1SYDA 1GUGA 2WIIB 1KRHA 4ZRPA 1MBYA 2JQRB 1IYVA 3C1EA 5ELCA 2BDNA 4HKZE 3T13A 2DLBA 4YTMB 4MT5A 4KKIA 3MFYA 1XLQA 1CT1D 1FYCA 1RHPA 1HFGA 4FF1A 3NUHB 3UI2A 5EE1A 2FFKB 2N9KA 1CHQD 4F87A 4IUQA 1LABA 1PZJD 3V3XA 1DYQA 4B08A 1VCIA 1RKNA 4OW0A 5G5HA 3SEBA 4MN3A 4KHZA 4Q0FA 2JWUA 4QIWB 5C2TB 4H13C 4UDUC 1SNMA 1RDPD 2WXMA 1SIJA 2ICEC 1HUMA 2HDMA 1E9MA 4ZKBB 1C4QA 2LFNA 2JX5A 1DZ1A 1VZ6A 2WP8J 3WOFA 2J7ZA 1EEFD 3W5VB 2NN6H 5CV6A 4IUUA 4DN4M 5EPLA 1ZDVA 4BY1B 1I6VC 2KVMA 5NUCA 1XF5L 3OSOA 2W55A 5M5WB 3KLSA 2MHVA 2B8GA 3DWAA 1VLBA 1K8OA 2ZXRA 1XTCD 2EY5A 1EYAA 3K0YA 1YMHE 2K7VA 1EIHA 5C3JB 5HGTA 1K83B 1I4RA 2WXPA 2KN4A 1FGBD 2EJFC 1FFVA 4XE0A 4PMBA 1D1IA 1ENFA 4H7BA 4YWGG 3S15B 1A6XA 4BBSB 2F0IA 3BK1A 2BYTA 3V2TA 2SNSA 3NHHA 3U7ZA 1HTLD 1FCLA 3TEWA 3D31A 2V0GA 3AEBB 1X3QA 1PRTC 1ILQA 5M9OA 2AWNA 2PNRC 3H94A 3I3CA 1ROEA 2B76B 3B2FA 4KJOA 3PMFA 3RUZA 1QQRA 2OF1A 3P63A 1RD9D 4IOIE 2E76C 3ND9A 4A3EB 3I9V1 1AZPA 2WV6D 3PZ7A 4HJGE 1EZ6A 3E56A 3Q23A 2F0NA 4WIPA 5LL6X 4YSXB 1IKMA 2IGDA 1GHKA 5HHDG 1SAPA 3CKIB 1QOHA 3TBIB 1DOLA 4RWSC 1JORA 4FXDA 1JWMD 2K5WA 2PO4A 3URYA 3GTOB 4ILWA 1TWGB 2D5DA 1IYUA 4CHTB 2MJ8A 3AEEB 3PZ8A 4L2YA 2X38A 4ULLA 5J1ZA 1LTRD 4FF3A 2G9HD 3T4AC 5FO9B 3R8BA 1HA5A 4K2LA 4RGMA 4RCOA 2F0VA 3Q69A 4H0LC 3J7AV 3LX0A 4NP5A 1XCTL 2F0JA 1EYDA 4RKLA 3J81E 5IIFA 2SDFA 1PXUA 1QB5D 3HEJA 2BTEA 1VR9A 2EYFA 5G3LF 3J9CA 5JOBA 2K32A 4YT0B 1DCZA 5ELBA 2K04A 1HFNA 5BYQA 1JR0D 1GOZA 2PZWA 1WGKA 4ZHPA 3NBIA 1E0ZA 1YNND 4CGYB 2ZXPA 5FLXL 5J39A 5CV8A 5CV4A 1KNAA 2K03A 1IGDA 1GJXA 1STYA 1KDAA 2K01A 1JWAD 2NN6G 1WTQA 4YTPB 5EPJA 2NB0A 4KJNA 3DWGC 4ZLTF 4B9WA 1LO5D 2QJLA 3MXNA 1DONA 1H9JA 2EY1A 4US8A 3KWLA 4HSPA 1QOGA 3NWTA 3I72A 2L1BA 3LWEA 5EBDA 1BQQT 4ID6A 3PO3B 3OWEB 4KKUA 1YN5A 1VRAB 1B9MA 4HSVA 3MJ5A 1LTAD 2D9UA 4YSYB 3AEGB 1ILPA 3IFTA 1VDVA 1B9RA 4ZK9B 1C4AA 3OPOA 2MGSA 1BCPB 1D5ZC 2WLBA 1II3A 1PZID 3QG1A 1I4HA 5C3XA 3QJYA 1BDOA 5J22A 1PFBA 1OXSC 1KAAA 4DK0A 1DD2A 3C3LA 2WQYB 2WB1B 1IHZA 1EIGA 5FLXE 3H09A 1NI3A 2K5PA 1OFFA 4C2MB 1KDCA 3DXJC 2ZW1A 1OQQA 3R3OA 4ABNA 5D65A 2Y5CA 3HOVB 3C1FA 4US9A 1GUSA 4XYQA 4XQNA 2FE8A 2WXOA 3OHXC 4KHVA 2NUCA 3HGBA 1TY0A 2I46A 4K8JA 4FF2A 2LUMA 2RVLA 2BS2B 2FHTA 1BMLC 1Q10A 1DOKA 1SNPA 1DJRD 1Q12A 3SK4A 1F77A 1GUNA 2SOBA 3V05A 2KJXA 1PRTB 4NJCA 3MVVA 1HHVA 2F0KA 3VR2A 4OZBA 4HTHA 1Q90A 1SBBB 2PW9A 4L1BA 5JVH3 1PTOC 1GAQB 2WU2B 4HROA 4FVMA 4TSSA 2WXLA 4FP5D 2G9DA 4A6QA 5T1GA 1V8QA 1D4BA 1RYJA 2V4IB 5C4HA 1B3AA 2E2JB 4XT1B 1XYIA 2E6XA 4GLSC 2JU6X 4BBRB 1SSNA 2F4IA 3IT4B 3Q8FA 4REZA 2LHEA 1I50B 1F9QA 1W6KA 1PRTD 4ZRZA 3KWVA 2FJ2A 1QILA 4N9TA 4A9AA 5D14A 1RTNA 3AEAB 1LACA 3HOYB 1EU4A 3ND8A 1GB4A 4KGTA 1D6EC 1TJEA 1S5ED 1ZYRC 2CJNA 3A56A 1C8CA 1EFID 1OXUA 2CW0C 4G4KA 4TQUS 2OEOA 3NVWA 4ITKA 3O13A 2WXJA 2EYMA 1O78A 1MPEA 1NENB 1MI0A 3NTKA 3ONAB 2O5IC 2F0UA 2WAQB 2VXWA 3Q8EA 4XWTA 3TEZA 1ET6A 3D4DA 2BCOA 3P4QB 3SVMA 1CZWA 4KGRA 2WNMA 4NZLB 4B9XA 4GDLB 2IPKD 1SSOA 3DWPA 1EM7A 3U52E 3VR9B 3OIQA 3TEXA 2OT2A 1ZOYB 1QLBB 1ZUD2 1DM0B 2DNEA 3VR5A 3VR3A 4QUCA 2C9OA 4EQOA 4U673 3L3OC 4WWMA 1SDFA 4X3KA 1KH0A 3FDTA 5IGBA 3EGRA 3DWQA 1UAPA 1QJOA 4K5VA 4O42A 4WFN3 5C0XH 5JEAH 4CKBA 4FXGC 3N6RA 4IFDH 2ZT9C 1SYFA 1J8IA 1F9SA 3Q24A 1Q1EA 4N59A 3I73A 2PKOA 3NVVA 1V1PB 1Y56A 3FPPA 1KABA 4DFAA 3NS1A 4EVOA 4KGSA 4BS9A 5I2YA 3V96A 4L63B 4USAA 2F3VA 3DHQA 3AM9A 4I7ZC 2PMVA 3BYYB 2L83A 4Y7NB 2MJDA 4QUFA 2EYHA 5E4WC 3DM1A 2Q8TA 1PFNA 5E4XA 1ENAA 4WAFA 3GTQB 2YYZA 1R9TB 1H9SA 3TSSA 4D2KA 4AS1A 4N9PA 1CK1A 2RQXA 5BMGA 1R4PB 4C56C 1B53A 1MVKA 3CWIA 1MSHA 2IW3A 3NP8A 1WRIA 3MXPA 4HCEA 1JWSD 4MACA 3IT6B 2A6HC 4G7ZC 3TEYA 4XT3B 3GTLB 1RJTA 3MC0B 1EY0A 5AUKA 3KBGA 2MEKA 1SJED 1IW7C 2LMCB 3NK9A 3HVDA 3ERQA 4DAVA 1D1KA 4YTNB 2RDHA 1MHXA 1LT5D 3GD7A 2QSDA 1BOSA 3QIAA 2JEAI 1YN4A 5M3MB 1NR2A 2WDVB 2JEBI 1FNUA 4WQMA 1GUTA 3I4LA 2JXTA 4ARIA 4G7HC 3FILB 4PV1C 2JE6I 3AE5B 3W2DA 1HZ6A 5ELEA 2RMMA 2KDMA 1V1OA 3NZ3A 3IKJA 2BT6A 1CJEA 1EY9A 4A3KB 4H44C 1PTOH 5EPKA 1LTSD 4LK1C 1B9NA 3TN2A 2I07B 4S3SA 4XIGS 1EL0A 4V190 5H8YE 2L1AA 1B4OA 5JJZA 1JQYD 3I4NB 1Y1VB 5EJWA 3QOJA 1C77A 2MUYA 5FO7B 1EQTA 1PTOD 1B50A 2J4XA 2TSSA 3LWUA 5C3WA 5EBCA 2JA6B 2MJEA 1FCCC 1F2RI 1CHPD 1EY4A 2INNE 1BCPF 2KA7A 5JEAG 2F3WA 2K6AA 5M3FB 1HQMC 5FOBB 1NUCA 2PIAA 2RPVA 3S17B 1MD2D 4BA1I 1DOYA 2X6GA 3N52A 4MHEA 4KMUC 3PUYA 1M4VA 3K59A 3FMCA 3T51B 5ISRA 5DNFA 3U9OA 5HURA 4IALA 1F2RC 3RZDB 4MM3B 4TQ0A 2MH7A 1TU2B 3L9AX 2E2HB 3LNNA 4IUTA 3P42A 2IX1A 2FBWB 1X32A 1CFMA 1UWXA 4DAYA 1L4DB 1ENCA 1KLUD 3Q0AA 2EYPA 2NZ1D 4K14A 3RMHA 1WSPA 3OMGA 5IGGA 2CW0D 4KY6A 2BE5C 4L23A 4CBVA 4JWSC 2KMMA 2E2IB 2F0DA 4MIUA 2KWDA 4OZAA 1JOKA 1U4PA 3SXHA 4HAEA 4ZQ3A 1HCZA 4DA2A 1BXTA 2B2WA 5KNDA 1YNJC 2NMQA 3AB5A 2L9HA 1PYWD 3AE3B 1G2SA 2K5QA 2NWGA 1ONLA 2V3NA 4RF1A 3D3RA 3HG9A 2PPBC 5KYLA 2BS4B 3VYUA 3C2PA 1N61A 4C7YA 2JP1A 2B2WC 1VF5C 4WRDA 3KLSX 2FMCA 4RKBA 3TP8A 4BWGB 1FO4A 1ZXIA 1A2TA 1N62A 1C48A 3T3OA 1HPCA 5EE9A 3VRAB 4TQ1A 1PDQA 1E0BA 4JPSA 2D62A 2DNCA 1F9PA 5D3DA 3M4OB 1I4XA 2WKCA 3H3VC 4N58A 2N55A 3NE5B 3UI3A 2LJIA 3GTKB 4E6IA 2ID0A 2B2UA 2EY6A 1XCQL 3SE0A 2N7JA 1U4LA 1EZ8A 2DWQA 1UNSA 1V8CA 2Z1CA 1SEBD 3N9YC 1EU3A 1N60A 2A73B 1JOOA 3HOXB 5BMHA 5CYUA 3FRPB 2EXZA 1A3TA 3PUZA 4LJZC 3RLFA 1BUVT 1XO3A 4KN4C 2D2CC 2EYLA 1HRJA 4G57A 1V97A 3M7GA 2N9LA 1B2TA 4M1UB 3IFDA 2J52A 5C0XI 5BMIA 1HQRD 1ZE3D 1YNTE 3S2HB 4IFDI 5EE0A 3NQIA 3AMZA 5IGFA 3LB8C 2CQAA 4ME5A 5HG2A 2LFIA 2WP9B 4RHRA 1RWSA 2PMZB 1TS3A 1GUWA 1VMCA 1I3QB 2RDFA 2A6HD 3U2SC 4JWUC 4HRSA 2QCPX 2JSVX 2KAJA 1IW7D 3SDZA 1GB1A 3HRZC 4LMQD 2L32A 3HZXA 4FF4A 3H0GB 1FD7D 5I9PA 2PQEA 5KNCA 3MAQA 2KCNA 1TVXA 5E6JA 3WDNA 2WS3B 1QCBD 3W1SA 5CV5A 3K58A 2F0HA 4ZUIA 1BO0A 3HOZB 1ICWA 2K33A 2LY7A 3QOLA 1T6BX 2KQ4X 3FKIB 2EZVA 3S1NB 2M19A 1B44D 1FNWA 3AE1B 3NTIA 1P7EA 3K57A 4IURA 3S1MB 1B1ZA 1QE6A 4OIJA 1HUNA 1Y8OB 2M00A 2Y0SB 2IGHA 1DOXA 2ON8A 2EJMA 5GXGB 3A54A 3D6WA 4IQZA 3HP3A 3D4RA 5ELDA 1ZDXA 2N0SB 4OZCA 3P4PB 1EWCA 2XN9C 1SYEA 2KEDA 1ZEQX 3BS1A 5I6WA 1TS4A 2VB2X 3FPUB 2JA7B 4ZOHC 3VRBB 1FEHA 3NBHA 1LT6D 4HKQA 4XWWA 1FNVA 2V4DA 1Y8PB 2XIWA 4O1NA 1STBA 4DXGA 5FR3A 1GXDC 1STGA 2VZKB 1BNZA 2WXKA 4X3SA 1RM6C 3PUXA 1AFPA 3PUWA 4K6DA 3X3MA 5KRUA 3K5MA 2WXNA 1CZGA 3MTSA 4RAUC 3NXWA 3VYSA 1BBXC 1Q3LA 1T5XD 3MXUA 2Z4IA 3AMUA 1ESRA 1F2LA 3OOCA 3E9SA 3FVQA 2E75C 1U4MA 4ZKCB 3KQ4A 1M8AA 2VUMB 4MH8A 3K6OA 1YJIA 2WDRB 1STHA 4IZ8A 2VZKD 3SFEB 2L11A 5IGDA 1I6HB 1Z7TA 1BUIC 3B9JA 2WINB 4J8QA 3TP6A 3LXFA 2F0LA 1AP0A 2WXGA 2BE5D 4IDIA 2JA5B 3T53B 2X69A 1PDXA 3SR1A