1PYWD

Human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploration of the P6/P7 region of the peptide-binding site of the human class II Major Histocompatability Complex Protein HLA-DR1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/protein binding/toxin
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 69
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pywD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pywD02
1JCKB 2NTTA 1PTOH 1QILA 1TY2A 2R61A 4RGOS 1LTAD 4RGMA 4Z9CB 1EEFD 1M4VA 3BYYB 1T5XD 1PZJD 1B1ZA 1JR0D 1LTTD 3GP7A 2CHBD 2AQ2B 2J4XA 1YN5A 1F77A 1JWSD 1TS4A 1EFID 3BVGA 3DWAA 5I4DA 1LTID 1LTGD 5FK9C 5ELFA 1HXYD 1PTOD 1PRTD 1PTOB 3V05A 1SJHD 1HTLD 1TS2A 3MC0B 1FNVA 1S5CD 1TS3A 1AW7A 2RDHA 1RDPD 3BZDB 1CHPD 2QILA 1JWUD 1LTRD 1SXTA 2Z8LA 1V1OA 1PRTB 1I4GA 3EFXD 4NZLB 1UNSA 4OHJA 1V1PA 1EU3A 1UUPA 3BYTB 1KTKA 1EWCA 1EU4A 1D5XC 2SEBD 1TS5A 3R2IA 3BVMA 5ELCA 1CK1A 1SE4A 2TSSA 1FGBD 1PRTC 1PTOC 2AQ1B 1BCPB 1XXGA 1S5BD 1KLGD 2QEJC 1YN3A 1I4QA 1I4HA 2XN9C 1S5FD 4RHSA 2IPKD 2XRSD 1PRTF 1PZID 1JQYD 2ICIA 3EA6A 1G8ZD 1S5ED 2G9HD 5D3DA 1D5MC 1AN8A 1ET6A 1XTCD 4RFBA 1BCPF 1LT5D 1B44D 1SBBB 1DYQA 1SE2A 1TY0A 1EEID 4UDUC 1FNWA 1HQRD 1MD2D 3R8BA 1LT6D 2AQ3B 3TSSA 3DWQA 5ELBA 1V1PB 1BXTA 4K6LA 3SEBA 2XNAC 4DXFA 1PZKD 1SE3A 1JWMD 1RF2D 2XRQD 2NTSA 1HA5A 3OWEB 4L63B 1LT3D 1D5ZC 4RH6A 1I4PA 4RGNA 4BWGB 1SEBD 1CT1D 1LT4D 1FNUA 1PYWD 1S5DD 2O2LD 1LLRD 1CQVA 1FD7D 3DWPA 1LTBD 1ESFA 4RCOA 1I4XA 1L0YB 1I4RA 1RCVD 1STEA 1BCPC 1ENFA 1ET9A 1KLUD 1L0XB 3BVZA 5ELEA 2RDGA 2WV6D 1LTSD 4O1NA 1LO5D 1DJRD 1RD9D 5FKAC 1CHQD 4L6TB 3KLSX 3URYA 3W2DA 1GOZA 1PTOF 1BCPD 5D3IB 3CHBD 4TSSA 1SJED 4RHRA 3O13A 4C56C 3MFGA 4RGTA 3R2TA 1D6EC 2IJ0A 5TSSA 5ELDA 4ZYSA 1YN4A 4DXGA
chains in the Genus database with same CATH superfamily
1JICA 1YNXA 3ULJA 3QA8A 2D3BA 4JI8Q 1XMQQ 5JH5C 3NZUA 1V9PA 2HJ8A 5CV8A 4HVBA 2D62A 4KTAA 2K03A 1L1OC 2NVYH 1VQHA 1R4NI 3ZW3A 3J7YW 4BKSA 4LUVA 5L37A 2CU1A 4IUMB 4RM9A 3TP8A 3T3NA 3MXNB 1AE2A 4GOPB 2ZZPB 2B2WC 1TT2A 3ABVB 2J42A 4NB3A 3FC4A 2L4NA 4ZKBB 3I4NH 3R3MA 4A3MG 4A55A 2ZJPA 2QGQA 3AEDB 3HS0C 4LF5L 2BCOA 2K3UA 2JWZA 1SMXA 4A3GH 3SHQA 3W3AA 2JA7H 2K5WA 1F9JA 1PDQA 1RDPD 3HUIA 2N7DA 2MLBA 4HJ8A 3A56A 5EAYA 1FFUA 3U8ZA 3HHMA 4CDFC 3NPPA 2Z0DB 3M62B 4K3BA 2LRWA 1X32A 1H9MA 3OHXC 2F0IA 3IFTA 5JEAJ 3K5NA 2ZJQA 2L1BA 1VQFA 4DPGA 4X64Q 1QOGA 5KYLA 3R2IA 3ULPA 3JAML 1Z9FA 1XLQA 2LJIA 2E74C 3I55A 3QWZB 1DD2A 1XNQQ 3OJ3A 4HJAA 1YJNA 1ZE3D 3V61A 2KMAA 1D1KA 1WTWA 3P1MA 1E2ZA 1Y1WB 1QT9A 1V97A 1SROA 4K1RB 4BXXG 5HGQA 4AP4C 5E7NA 4X62L 4F8MA 4B3TL 4N9TA 1OFFA 1DGJA 2DLBA 3VTUA 2DJFC 1N60A 4BAXA 1MHXA 3DEPA 1G8ZD 1WX8A 2HD5B 3MXGA 2G1EA 2L5TA 3GS2A 4K7UA 3FPPA 4MJSB 2FBWB 4F8CB 1JOKA 1EEID 2F4IA 4HPLB 3BK1A 5IT9L 3MVVA 3TS0A 3NWTA 4DR1Q 2GBMA 5IE8A 3GOEA 3FMCA 3E9SA 5C4HA 5K5PA 4QUFA 2DYMA 2F52A 1BVSA 2AX5A 2M1MA 2NTSA 3D4RA 4KKIA 2E2HH 1WH3A 3HVZA 4X62Q 1SMYD 2JA9A 2F0TA 2YTVA 5IP4D 1Q12A 1ENCA 1N33Q 4DR7L 2ES2A 2B8FA 3ITPA 4CJ0B 2KHSA 1MJDA 1II3A 4DR5Q 2DUDA 1JALA 3K57A 3N1XC 3ALBA 3AU4A 4RG1A 4HR7B 3BDLA 1VDVA 2V4IB 3BWUD 1U4RA 4IG7B 3J80L 1IYVA 4FA6A 1G6PA 1FL0A 4POFA 2WXFA 2Z59B 1E7ZA 1NI2A 1O80A 2QW7A 2MQHA 2Y5CA 3TP7A 1FMAD 3S14B 1BCPD 1NJIC 2JA6G 4A75A 3CHBD 2JWUA 3Q8FA 1JMLA 4YHHL 1F2YA 1YQ3B 4NMZA 2N7EA 5EGTA 4JI3Q 1WJJA 1I35A 5IP7H 4CJ2C 2B8GA 1XO3A 3EROA 4JI7Q 2BYFA 3L17A 2B2UA 4PZ8A 3I91A 1QILA 2L76A 2R7ZH 1LTLA 1F9RA 1V86A 2M4NA 3PT2B 1VQCA 4DUZL 2XGTA 2DWQA 3MZ5A 3MTNB 2JA7B 4HXDA 2K50A 2ASBA 4JI1Q 3GTMB 4DAPA 1WJ4A 1I6VC 4HEDA 2VS1A 3F2UA 4JVZA 1X3PA 5I2YA 4X66Q 4MEMA 2OWOA 1XPUA 2JA7G 1GUGA 1LM8B 4HRSA 2QSDA 3SK5A 3A4SC 4NXNQ 5C0XG 4K5WA 2R93G 2K8CA 1K8RB 3APFA 2VQFL 3GZNI 4OVZA 1RLFA 3KDFA 1ROEA 4CKCA 2F0NA 2WQYB 4OO1G 1N5WA 4DWFA 1WMHB 2CR5A 4B0EA 3I56A 3AU5A 4HKZE 3AE5B 3EFCA 4LNNA 1WTVA 1IUEA 4DAYA 3CSTA 3M4QA 2KZRA 3DVGX 3NVYA 2Z8LA 2L3ZA 1HTPA 1VZ8A 5EDSA 3CD6A 1PRTB 2JA6H 4LFCL 1KM7A 1BMLC 1VQ6A 1BUIC 1V81A 1DGSA 5I6YA 4EE2A 4LF8L 1W3SA 1BQQT 3W1SC 3WIMA 2KVRA 4HEA1 5JXVA 1YX5B 3VA5A 4XDDA 1CK1A 1SNCA 1BUVT 2TSSA 3IHPC 4PS8A 3K0XA 2C7HA 2RDFA 1PTOC 1JC7A 3Q0AA 2RCNA 3NK9A 2WXJA 3HP3A 1PMRA 2WKCA 3BZKA 5HHDG 1PV4A 2LRUA 3FKYA 3I57A 2CVRA 1UGJA 4MSMB 4DUYQ 3RN2A 5KHQA 5D3DA 2GA4B 1IBXB 4PMWA 3S9WA 4YT0B 1HQRD 4LK1C 2OEOA 4EVOA 1JJGA 4LWCA 3UIOB 4ZAIA 2DHZA 1BXTA 3SEBA 5CYUA 4M8MA 3UIPB 1N63A 2K52A 2MNAA 1F9PA 4P72A 1HA6A 1RF2D 2RPVA 4JWUC 1CI3M 4YWGG 5H8YE 1XMQL 2LGXA 3RT3B 1A15A 1Z47A 2KUMA 3J80E 3RZDB 2MH7A 2LEKA 2JY6A 4LNKA 4RCOA 1I4XA 2VB3X 2KC2A 3NTKA 4MIUA 3PZ8A 1QF6A 1X65A 3VYUA 1HUNA 1MG8A 3QARA 2FIDA 2RDGA 4ZRPA 4LCDE 3VR4A 3AV8A 1S1QB 1A8VA 4BY1H 5LMUQ 2IO2B 3X3NA 4OIJA 2IGDA 3U4ZA 3GTOH 1WX7A 1ZKHA 2OHFA 2LJ5A 3NG0A 1WX9A 2PZTA 3ZXRA 1IL2A 1NAPA 4W9EA 2GOWA 2PW7A 4A3CG 1GC6A 1VQ4A 3RZFA 1FJGL 2NBUA 4OZAA 3F2DA 4A3BG 4GSWA 1WD1A 1WI5A 1EY7A 2D5GA 1QZHA 2ZW1A 1V5TA 1UBQA 3PGZA 3PV0A 2OTLA 5ELDA 1EY6A 4BXXH 4HTHA 3A8JE 1TBEA 3DMUA 2GBNA 4D2KA 2O4XA 3HKSA 3NZSA 4XWTA 2BDOA 3D4WA 4JYAL 1E1TA 2LUEA 4GOPC 3RNEC 1WI0A 3VUWA 1YQBA 3SK4A 4X64L 3R3OA 4A3FH 2FMMA 4DGZA 4L23A 4G11A 4B0MA 4AS1A 3OTOL 1FPYA 1WGDA 4B3SL 2EQSA 2JZPA 1T6BX 4C3JH 4DV4Q 2JA5H 2H89B 1Z7TA 4EQ5A 3W1YA 3V05A 1SJHD 3WOFA 5D14A 4L5RC 3J81E 1YOVB 3WCQA 2L1AA 4W9IA 4EUTA 4YCWA 2WXKA 4A3OA 3I8ZA 1TYGB 4GDLA 4FADA 1J9OA 2PQAA 2KQ4X 4QQBX 2KJHB 2H4OA 1LTRD 3T16A 4DR1L 2V4DA 4A3FG 1JB3A 2I1JA 3MHBA 5AZGA 3JSVA 3A54A 1I4GA 5LMNL 1U4MA 3CCMA 4FF2A 3FVQA 1GHKA 1GHJA 1IW7C 2DY8A 2MUYA 1EF5A 2A69D 3A0JA 1I6HB 2M8SA 3E56A 5E6JA 3UF8A 4LF4L 2UU9L 1Y8RC 1Q3LA 2JF5A 3E5SA 4MN3A 1MHWC 4A3KG 2X69A 1IBLL 4FF3A 1V8QA 2FCSA 4WJQA 5ELCA 2C9WB 1SE4A 3X0WA 2WYQA 4BOSC 1YI2A 2VUMH 2EYFA 3ND8A 2O6VA 2UWQA 5BMHA 4K8JA 2GMIC 2L55A 1X3QA 5A2QE 4LNIA 4LK0M 1GXDC 1XXGA 4LNFA 2JA8H 3BZCA 1R7SA 4DDGD 2VZKD 3QWNA 3CCUA 2NVTB 1A70A 1ZDVA 4JPSA 3B0AA 1ILQA 1EY5A 3GTGH 2RSUA 1ET6A 1AN8A 1LABA 4RFBA 1XD3B 2AEHA 3LGJA 4N9PA 3KYHC 3ONAB 5GROA 1VMPA 1IBLQ 3VRBB 4C7YA 2AWNA 1LT6D 4IPDA 2TMPA 1C48A 4KK7A 1R4MB 1KLVA 1PYBA 4FBJB 3PRMB 3HRZC 3J7ZC 2VL6A 1N8RC 2AL3A 4BBSH 4QUCA 2EKIA 1PZKD 1XYIA 2OOBB 4MGIE 5GAHC 2XSCA 3GTKH 4RH6A 2OJWA 2WXOA 2WDVB 3OPOA 4BWGB 3MWYW 1TZ1A 2LHEA 2MJ8A 4G4KA 4K5XA 3G6EA 3J81L 4JI6Q 4QAYA 3V6CB 2YEPB 3OW2A 2BDNA 1C3TA 2L83A 1GB1A 2DYBA 2K5PA 3Q3FA 4C3HH 1Z2MA 5DM63 1BT0A 4LFBQ 2K33A 2WV6D 2KWCA 4CHKA 1SN8A 1AFPA 2E5LL 2F0VA 1CQFA 5FJ8G 5HURA 2LASA 3M95A 5IYDH 3S15B 1KXLA 3E0JA 5KEEA 5M3MG 5C5MA 2MA9B 1I5FA 2MEKA 4LFAL 2I5MX 1CZGA 1UE6A 4CHTB 4KI0A 1MGSA 4IPGA 1GUOA 4ID6A 2RHSB 4TVAB 1VZ7A 2KHWB 4WRDA 4CDDC 4A3KB 1NNXA 3BS1A 1UBIA 4JI4L 1KC8C 4RGOS 3DLLA 4LLGM 3D31A 2F3VA 3WANA 4LF8Q 3CCLA 2I0QA 1JOQA 1TWAB 5JEAG 3IT4B 5J17A 2O2VB 3HOWH 2X8XX 1PZJD 5C4JB 1B1ZA 1GD7A 2CHBD 2LGYA 4WAFA 2N9LA 3HZXA 3RNAC 1JJ2A 5M3FG 1VQBA 5IYBG 1UEAB 3T56B 4KD4A 4DBGA 1TWGB 4F7XA 4IALA 4ZQ3A 3AE8B 2F0PA 1PH8A 3VXWA 3BDOA 4OZCA 2WB1G 2G45B 5CV4A 4NPSA 3PREA 2C5LC 1QZEA 3EIVA 3A9JB 3DHQA 3STBC 4DNTB 1E10A 1MHHE 3M9BA 1UGMA 1NBFC 3DVGY 3NRZA 5M9OA 2YV5A 2QILA 2Q8IB 1NCVA 5CMDA 2W3SA 2K32A 2KJXA 2VW9A 2HIVA 1MJEA 1EYGA 1J0GA 1GJXA 1YNTE 4NZLB 1WTQA 4YTMB 1WXSA 3VDYA 1Q90A 3V62A 1HCZA 3AN1A 2OCEA 1SYFA 3EFUA 1HEZE 3H9DA 2ZVOA 3TEZA 3RULA 3Q69A 2WAQB 1MJCA 5AJ3L 2UUAL 1SE9A 2AQ1B 1V43A 4JC0A 1X3GA 4HJ5A 4S3SA 4POGA 1JWAD 2L8JA 4M0WA 1S5BD 4I6LB 2J7QB 3D3RA 1QLBB 5LMUL 4DK0A 1E22A 3A1QB 1RHPA 3Q3JA 4A3PA 1OXSC 4EZKA 3UE1A 3DBRB 2MWSB 1JE5A 3GTPH 1SBBB 3I4OA 3VYSA 1SLJA 4DV3L 3GQBA 4HIKA 2N49A 3DWQA 1HNWQ 1V2YA 1FJGQ 2EKEC 2QDFA 2FAZA 2PLPA 4I65A 3RI7C 3QC8B 2D0OA 1HTOA 5GQOA 2UUAQ 3X23A 4URKA 4LF7Q 1QVGA 1LT3D 1SYCA 3PIO3 3BINA 3FHWA 4KGSA 4PK1A 5EKLA 3DBSA 1WE6A 1VF7A 4QMGA 1PLFA 3HOXG 1HFNA 2INDC 1L1OB 4M8NA 1Q86C 3H0GG 1S5DD 1V49A 1LLRD 1JROA 1STYA 2PQAB 4ABNA 1V5OA 4AH6A 4RA8A 1I4RA 1QWYA 3BVZA 3OTOQ 3K5MA 5DPSA 3N32A 2JU6X 1XLNA 2RKSA 1HZ9A 1ZEQX 2BE5D 4DV1L 4BBRG 2BYVE 2MRPA 4DR2Q 2FXQA 1GG3A 4EX5A 3UGBB 4Y7NB 3VRAB 4DK6C 5C6AA 1UZXB 2PJHA 2F0EA 2J7ZA 1EY9A 1CA6A 1VLBA 3RPFC 4L8JA 2JVCA 1O7LA 2UYZB 1KRSA 1J5EL 4DV2L 4HMJA 3T3OA 1AH9A 1EY8A 1WF9A 2V4LA 1AZQA 3DBLI 5CX3A 3H7PB 5LL6X 3OIPA 1D3ZA 1J7CA 1QE6A 5COYA 1E2WA 3TMEA 2QEXA 1HRJA 2K04A 2RD0A 4WH4A 3GTOB 1ZXIA 2EELA 3Q14C 4W9CA 2C60A 1K50A 1BKBA 4X6AH 2B76B 1FD6A 2F0FA 3PZDA 2R6GA 4X3KA 1QOBA 3K80C 2L00B 3I73A 2BYTA 2INCC 5H1SE 3J81i 1UWMA 2NVUI 4JBMA 3VH3B 1B4OA 1DOLA 3FKIG 4HSVA 4PG3A 2G4SA 2HHHL 1U4AA 4GN3B 1E7PB 2BB5A 4ACFA 5IGCA 1HR0W 2F0MA 3MP9A 2IX1A 2GBRA 5EKIA 2Y0SG 4EZJA 2IWHA 4OZBA 3W1GA 5M5WH 2JYEA 3GTJB 2CHWA 2WX0A 4KHZA 3GE8C 4HJGE 5CTRC 4ZOHC 1KJTA 4ANWA 3BZDB 5KHOA 3ZNHB 4AOFA 3SR1A 4K81A 2EY1A 1OQRA 5EKKA 1TVXA 3H8HA 2D2QA 1KF6B 3GB1A 1EO6A 4RAUC 2Q2TA 2IY5B 4AYBE 5IY0A 2IX0A 1R9TB 2A8VA 4NPNA 1CMXB 1A3UA 1R4QB 1O78A 4ARCA 2SEBD 2ZJRA 1TS5A 1SNMA 1AE3A 3I2ZA 2KMCA 3W1BA 2HDMA 3A5UA 3A7LA 3NJTA 4L5SA 3KF6B 5FLMG 2FCNA 4U673 2R7DA 3GO5A 4RKBA 4HMIA 3DWMA 4OWXB 3STBD 1JW9D 2KLGA 1PYSB 2LSSA 1GC7A 2JPHA 2SOBA 2I07B 1N32Q 3EBEA 1T0SC 3N1YC 1WCMB 2RBMA 3PTFC 2OT2A 2QEJC 3J80c 5JHAA 3C19A 3P1HA 3AE2B 4JI5Q 3DHIC 2FFKB 4A3IB 5JOBA 1I6HH 2G3QB 4G50A 1B44D 3U4VA 4R4IA 2HIXA 2IBIB 1TJEA 3I72A 2JQOA 1MD2D 4JL9A 4YTPB 4NAWA 3RYTA 5CR3A 4A3IG 3LDZE 3SR6A 1RTOA 4LFAQ 3SGIA 2DAFA 4BY1B 4CKEA 4GS3A 4GKKQ 1VR9A 2MP1A 2ENBA 2N1VA 4J6IA 1AP0A 3Q24A 2JA8B 4JIOU 4W9KA 5CV5A 1IXRA 1U9RA 4JI4Q 4ICUA 1SDFA 2IHEA 3ZUNA 1T9HA 1KIXA 3VAWA 3F1ZA 2MBBB 4UY8C 2YVCA 1WRIA 3HOYG 1F2RC 3CC2A 1NDDA 2EMSA 1L0XB 2M00A 4BY7B 1ZYRD 4FJYA 4M00A 2ZM6Q 1OQQA 2NWGA 1CKNA 1Q46A 4BA1I 1E6EB 2D0PA 1H9SB 4KV2A 2FIFA 5AZHA 1MBYA 2NVXH 3PUYA 4MHEA 4DV6L 2R92G 3JAMi 2SNSA 3HOUG 1UELA 1WZ3A 2DAJA 3VYRA 5D3IB 2PVOD 1EIGA 3DM1A 3MHZA 3NENA 2AWOA 2KKCA 2ALYB 3CMEA 4IFDI 4PT5A 1EWIA 3H0GB 2BT6A 4EQOA 1E8WA 3KW5B 4X65L 4NXML 4W9HA 4ZYSA 4R8NA 3C8YA 2L0CA 5CV6A 2ZM6L 2UU7A 1IKLA 2B2TC 2R61A 1ACCA 1L4ZB 1JRUA 1PH7A 2A73B 2NN6H 4PYUA 5HFYA 4IO9A 2MBOA 3DDCB 2KENA 5JJZA 2F03A 1RFAA 1I50H 1WTRA 2A5UA 4JPBW 5CC4A 1K8OA 4NJCA 3DCGA 3T8MA 3I4LA 2M17A 4I6PA 4BY7G 1ZGUB 4E74A 4O2DA 4WJNA 5EE3A 1G91A 1LQBA 4C4VB 5EPLA 3WAPA 4A3LH 2CU3A 4L5TA 1LTID 1K73C 1Q0WB 4M1UB 2WNMA 2WXQA 5G55A 3OLMD 2NYZD 3ERQA 4ICVA 3Q8DA 1TZOA 4JCVE 2JXXA 3ZRCA 1NYQA 3RNFC 1K0RA 3ZNZB 5EBCA 3NTHA 1R4PB 3B2GA 3RN5A 4HK2A 5D94A 3BIID 4IUNA 1IW7D 5IO9A 2PQEA 4C80A 3NVZA 1J7BA 1NR2A 3KLWA 2MBQA 2A6HC 1A63A 3U30A 2GRIA 1EU4A 2MBHA 4JV5Q 1TWCH 1WGHA 2JRHA 5FO7B 1C76A 2KCMA 2A6ED 2YLMA 4BBSB 1WCMG 1PRTC 2KMMA 3QAQA 3PGEA 1RM6C 1MFWA 2L0FA 1KLGD 1L4DB 2XN9C 1XCTL 4HWIB 1H4RA 3QR8A 1RWSA 5DPTA 3ZQ4A 4DV1Q 5C3JB 2ICIA 1JQYD 3RLFA 5BR8L 1VQ5A 5M3FB 1BR9A 3L54A 4DHJB 1EZ8A 3TIXA 3VDZA 1VF5C 4W9DA 1TIFA 3AM9A 5IYCH 3KK7A 3R8BA 2ZNVC 5FLXc 4B3TQ 2WX1A 4GU2A 5L95C 3PO3B 2A19A 2RF4A 2KWDA 4MTKA 4QIWE 4IWPA 5DPRA 1SE3A 2LI5A 3KYDD 1F9QA 4RF1A 4HAEA 2VZAA 1HE8A 4ZDVA 2W3RA 3S14H 5IIFA 4P73A 4A76A 2QA4A 1X6OA 1CQVA 2W54A 1P7FA 4ZRQA 1XTDA 1K83B 1K3RA 4R4TA 3MA2B 4FXDA 1OGWA 2IGHA 4FLHA 4R4QA 2QDBA 5ELEA 4KMUC 3KJOA 2NMQA 3OIQA 1JMCA 4H2AA 1N33L 4A3DB 1YD8U 1IBKL 3KVFB 2HHHQ 1IYFA 2SDFA 1XPRA 3ICEA 1C77A 3DOWA 1ZYRC 3I63C 1LFDA 1TWAH 4P16A 4GN5A 1OTCA 3OSOA 4XT3B 2PW9A 4QB4A 3I90A 4ANVA 2CFMA 1HZAA 1SSNA 4KIKB 3OJ4B 4RHRA 4ZHPA 3S2HB 2RMMA 2M56B 1PFBA 4IURA 1FRDA 1WRDB 4IFDH 4YY3L 1A2TA 4AQYL 3RZOH 4H13C 5IGFA 1F1HA 1MVKA 2NS5A 4L1BA 3WOEA 2VXWA 1GB4A 1MI2A 3B9JA 4MH0E 2VRRB 2DN8A 3LYYA 1VJKA 2NZHA 1STAA 2LS01 2NVXB 3ZNGC 5BO4B 1EEFD 2NN6I 1M4VA 4A3JG 1HR0L 2J0MA 2LGIA 4BBRB 2RSNA 3V3XA 1LTTD 3GP7A 2KVMA 4NAWB 4H02A 3CMMB 4A3JB 4DUZQ 4KVGB 1C0AA 2KA7A 2PMZB 3BVGA 4IUTA 1N32L 1I94L 2H88B 3M3YB 2J0JA 2LVQA 3EUB2 3FILB 4JI1L 3IT6B 5E6NA 1NUCA 2FHTA 1S3SG 1XLOA 4K14A 1OXTA 5E6OA 1YNJD 3C1FA 2Q2HA 4IUPA 4AUQC 1XLPA 4XYOA 3HOXB 2F0LA 2VQEQ 1S5CD 2PIAA 2VUMB 1EIHA 1WGGA 2IZVB 2JYTA 1WXAA 2QIEB 5IT9E 2WGSA 3I4MH 5CHFA 3HM6X 1IYJB 1R4NB 5C4JH 2KN5A 1CZWA 2MP2B 5G3LF 1IKMA 3HOZH 4HJ9A 2WP8J 2MW5A 5M3MH 1TKYA 1E8ZA 2V3NA 3P4QB 4YL8A 2MSED 2K6AA 4DN4M 2V9HA 4GNXB 3M4PA 3Q8CA 3GTPB 3PO2G 3FAHA 4OX9L 1D1IA 2AL6A 1N36Q 3L08A 5F2DA 1EUVB 2MX2A 2M0AA 2CHZA 1A3TA 1EOVA 1HZCA 1XX8A 1NEKB 4J3OD 4IJLA 3PHXB 3V96A 4KN7C 4C1NI 2ASQA 2NR2A 3GE3C 4QIWB 4N6EB 3GTKB 4NKLA 2LGDA 1I4HA 1Y1VG 3NVWA 1PRTF 3EA6A 3NHEB 3Q23A 2BGFA 2MJ3A 2ZVNA 4GDLB 5M5YH 2QMTA 4OIKA 4DV6Q 2KD0A 2L12A 2K8BA 1BCPF 3OWFA 5LLIA 1ZPSA 1XMOL 5J18A 4OX9Q 3Q8BA 1N36L 3TP5A 4UAIA 1EIFA 4JI8L 5H92C 3ZLZA 1RFKA 3HOYB 3VTWA 3ETRA 4X65Q 2PZUA 4NXMQ 1HA5A 2JEBI 3P75A 2F3IA 3EGRA 3IXSA 5JZEB 2JEAI 1RL2A 1OEYA 4PMBA 1I4PA 3WA0A 3D8GA 2CS4A 1U5KA 2OQ0A 5I6WA 4TUUA 2AMCB 1CT1D 4P6VF 2BA0A 4IWOA 2JUOA 2DNFA 3QCAA 4HCNB 2LFNA 1I7HA 4R9WA 1FCLA 4KKSA 5I9PA 3A33B 3QO2A 2XK5B 3R7RA 4RNAA 4GLXA 4NW2A 1DOXA 3UQBA 1U4PA 1IHZA 1B53A 5T1IA 4USAA 4O1NA 5HGTA 3SVMA 4R1JA 5FKAC 3H3VH 1CHQD 3L2PA 5AZFA 4BOZB 3G7LA 5IWAL 3RNBC 3URYA 2ID0A 2AUJD 2QKIC 2KK8A 2KTFA 3MFYA 1G291 1ILPA 2RR9A 4RKLA 5JVG3 4OWWB 3I7FA 1GO3E 1HUMA 2WHIA 3VUYA 1LYLA 2KJRA 1X55A 3TMPB 4WJ4A 1C7YA 3IRBA 3T4AC 4HCSA 3DHGC 1UD7A 4KLKA 1YN4A 4XQNA 3AE3B 1IYUA 2LUMA 2Z0EB 3NP8A 4DHJD 3HOXH 5LXHA 3HOWG 4XDCA 2MQJA 1IGDA 1RKNA 4P2CB 4PV1C 1F2RI 1NYRA 3NQTA 1P98A 1KFYB 1S4ZA 1ZXTA 2EYHA 2AWTA 4HDQA 1PH4A 4NQKE 4LUOA 1VMCA 2YU9B 3VYTA 4EGVA 2VY3A 4G0NB 2PNRC 5I4DA 4WQOB 4L2YA 3SHLA 4F7ZA 4H7BA 4MT5A 1EQTA 2J52A 3W5UB 4V190 3E6ZX 5BR8Q 2EY5A 1FNVA 2WAQG 1SYGA 5DLQE 1FIQA 3NS1A 4ANUA 3H6NA 1ESRA 1GM5A 5BYRA 1CHPD 3FP9A 2KN4A 3PUZA 3K9PB 1JWUD 1HNZQ 4TMAB 3S1NB 1C4QA 1HPCA 1Z6HA 4A3MH 2HDEA 1NR4A 1MIUA 4JE3B 4DK1A 3M3JA 2EXDA 2NVQB 2JA5B 1NENB 3RD4A 4N59A 2BS3B 2J53A 3BK2A 1IBML 5DCNA 2C35B 2O6VD 3PZ7A 2KFKB 2WP9B 3J7AV 4LUZA 3TQYA 5C44H 1C78A 3DM3A 2PE9A 1EY4A 2WU5B 3W1SA 2WB1B 5JJLA 1E8XA 2Y3AA 3S1RB 1T0RC 2BBCA 3L4PA 3UI3A 2R93B 2WINB 1Y69U 4E3CA 3ZJTA 3VR6A 1WZ0A 1N34Q 1RODA 2PNHA 1SE2A 5CV7A 5C4ZA 4JI7L 4GZYC 3UDIA 2KTRA 4DXAB 3N52A 3A5ZB 2XK5A 2Y0SE 3H3VC 4KHPQ 1B50A 4NJ7A 1I42A 3HM3A 5IP9G 3DHHC 2WACA 3MC9A 1J8IA 2B2YA 2X6GA 4PQXA 3IAYA 1Q10A 2HTHA 3ML9A 4OVUA 3AYHB 3LJ3A 5J2RA 4FULA 3F2CA 4RMAA 3DBHB 3IFWB 3IG3A 1CKOA 2M2LA 2OXPA 2PVGC 2XTIA 4IJHA 2ZXRA 3K58A 4PS3A 4B3RL 2F0JA 1TXYA 2M0XA 1CTMA 2SNMA 2N1WA 4KGRA 4GKJQ 2QDLA 1ENFA 2FMCA 2K5HA 3R66C 3RLOA 1WOCA 3APDA 2R7FA 4K0KQ 3CF6E 2BA1A 2LXCA 1WY8A 1VQ8A 1JQ4A 5BN3A 1I94Q 2OEDA 5GAEC 1WYWB 2L05A 4IC7B 5GADC 2E2JH 5L83A 1WTHA 2E76C 2WIIB 1VQIA 5A35A 2Q8RE 5CBAE 3OMGA 3K59A 4A3FB 1E7UA 1RYJA 1Y8PB 3B2FA 1ZW7A 2WXNA 4A8XC 2C7MB 3CPFA 3MHSD 3AEVA 2L15A 4C3HG 1Y14B 4GN4B 4CBVA 4I7ZC 3V2TA 5C3EG 3VFKA 1WR1A 4BBSG 4MTNA 4IZ8A 4GKJL 4FO2A 1PGXA 3S17B 1CM9A 1KH0A 2NB0A 3B6YA 4C3HB 3M4YA 2BS2B 3KUCB 1J7AA 3AMUA 2ZPNA 2RA4A 4A3EH 2CCZA 1WGYA 3A4RA 3HKZE 5IP7G 2B3AA 3Q3OC 4MGZE 4W9JA 3PVLA 1E0ZA 3AEBB 3R7QA 4II2B 1WXQA 5C1ZA 3K7UC 1OXXK 3QK0A 2LD9A 1KAWA 3JSVB 1B70B 4G7OC 2EYJA 4O42A 2NPTA 2B39A 1JR0D 3K7AH 4N8FA 1SR3A 1CZPA 2D11A 3HOZB 1L5PA 4XDXA 2ZJDA 3K9OB 2KQSA 1BOSA 4GOCA 2I2YA 1Q1OA 1PRTD 1PTOB 3V6EB 4OL7A 4MJSA 2CKZB 5C5LA 3JC66 4BKGA 3HVDA 3S2AA 4OEMB 4XZ4A 4KY6A 4GNXA 3UDGA 4DV0Q 3GTQH 2A6HD 4OONA 5G2NA 2A69C 3QOLA 2N7JA 2WXGA 3NOBA 4KDLB 5I2XA 2WAQE 4X3TA 4ZUJA 1ONLA 2RHQB 1DXMA 2KXJA 3A9KB 4GMVA 4ZHOA 1OXVA 1EWCA 4DR3L 1PH6A 3DXJC 3NUCA 5HKHA 5FLXE 2NBVB 3S2DB 3QQ8B 1N6ZA 5E1FA 3OYYA 1QNUA 3PIOA 1C9OA 5IODA 1ZOYB 2JQRB 4TQ1A 4DV0L 4DR4Q 5IYBH 1MKHA 2H1EA 1SNDA 4YXDB 3TBIB 3SE0A 1FVIA 1YN3A 1YZ6A 3MXPA 4A3MB 3VR5A 3A74A 1HQMC 4XE0A 1NE3A 4XTCS 4WQMA 1R9TH 5AJ3Q 5IWAQ 3G4SA 3NHHA 2N78A 2IY1B 3EJIA 2JA5G 1VQLA 4RWSC 2PI2E 4XYQA 2AQ3B 2R7ZG 2D3AA 4W9GA 2JN4A 1GAQB 4R4CA 1UWVA 4WWMA 2XIWA 1VQOA 3KQ4A 5KNCA 2N9XA 1N9WA 5DEHA 3BG3A 4L63B 1JE4A 2KOLA 2OTJA 3TBLD 4LJOB 4RM8A 4CDCC 2A74C 2QC8A 2VZKB 4MACA 1DOYA 1FFVA 2NVTH 4LMQD 1ZXHA 4S17A 3WDNA 2O5IC 1SRUA 4DAYB 1U0LA 3DPDA 4KD3A 4YSYB 3P4PB 1EYAA 4II3B 4REZA 1ET9A 4GXBA 1WM3A 3HOVG 1PUTA 1UE1A 4A3KH 2KEEA 3HOYH 2X38A 4KGTA 4AJWA 4YSZB 3ZJUA 2LXJA 2KHJA 1Q8IA 4BS9A 5D7GA 2F3WA 4J15A 2L11A 2BKRB 2OQKA 2B2TA 3K5OA 4J1MA 1GOZA 1E3PA 5DAUA 3GTMH 3HOWB 1V6EA 2D10A 3DBRI 1SNOA 4JOIC 2RVLA 2WDRB 3KUPA 2CQAA 2K22A 4EZLA 1OQYA 1CSQA 1QVCA 1VQNA 4FJVB 3H09A 1TWHH 1GUAB 3PUWA 3PLUA 4FHKA 4FYDA 4DKAC 1B9NA 1E2VA 4C3JB 1STBA 1K3BC 2RPQA 4IUQA 1Y8NB 3AB9A 5IAAC 2NTTA 2LHDA 2E8GA 2KX3A 1S72A 1HNXL 4DDID 2JK8A 1M8AA 1IZ6A 4C7ZA 1RIPA 3RN9C 2F0WA 1STGA 2GVAA 2M9VA 4UHVA 3T13A 2Z6KC 4B3MQ 1TGZB 3DBHI 3CU7A 3VR9B 1G51A 1E0BA 3KUDB 4G3XB 3BYYB 4C3IG 1WWTA 1KAAA 2PPBC 1QOFA 3HEJA 1E1OA 5J22A 4EEWA 4A93B 3HOVB 3SU8X 4JWSC 1ML0D 2CH4W 1WXMA 1XF5L 3NBHA 1GNUA 3DBLB 1QOAA 4MGKE 3KLSA 3EHVA 4US8A 3CP0A 2WFWA 2J0KA 4B9KA 1GUWA 2FCMA 1VCIA 1PTOD 4Q5VA 1YNND 3FPUB 2VNUD 2JRIB 3U9OA 2RSOA 3X3MA 4W9FA 5K36G 2K39A 4LJZC 3TS2A 1AW7A 4JBWA 3J81j 4WJPA 2QHOA 1Y1WH 3FKIB 4ITKA 4N8X1 3G48A 2IT1A 4KHPL 2E2DC 1G2TA 1FXAA 1WFYA 1V1OA 4AQ7A 3ZTDA 3HG9A 3CAMA 2XWJB 1S40A 5CHWA 3A8KE 1KTKA 2DX5B 2J0TD 5J1ZA 4FF4A 4JI0L 2JJQA 2KQ3A 2B63H 4LDTD 3ND9A 3LXFA 3D0FA 5KNDA 3EVQA 3QB3A 1FGUA 1L0WA 3KYCD 3CCQA 1VQ7A 5FJ8H 2PI2A 5EPKA 1KQSA 2WU2B 4K0KL 2GBKA 3RMKC 1HTQA 4KV6A 5GMVA 1S5FD 1PH3A 5ISRA 3AEFB 3RZDH 1GVPA 4XT1B 3QJZA 1AZPA 1PH2A 2EJMA 2G9HD 1YITA 1LV9A 5DM73 1YJWA 2KOXA 3UE0A 1TY0A 4KJNA 2L7RA 2KCNA 1FNWA 1WYGA 3TSSA 2WS3B 4LF5Q 1DZ1A 4K6LA 3KF8A 2VH1A 4P74A 3RNCC 3L9AX 2JYOA 1WTXA 4YCUA 3OG5A 1EQRA 1JWMD 1ZDXA 2RDBC 3CF5A 1VQAA 4GN1A 3SXHA 5BMIA 1W2BA 4DA2A 1FYCA 2CWAA 2FCQA 4JLCA 1Q5WB 3AE7B 2L32A 2VB2X 1BBWA 4HPMB 3DWPA 2MBEA 3PO0A 3Q3NC 4JG2A 2ZCBA 2MPMA 3S2HH 4DAVA 3IFDA 3ENEA 4DK5A 3TRZA 2WDQB 1XT9B 1BCPC 2I46A 4X57B 4CDEC 3TEXA 4C4VA 2BE5C 3JW0X 1GUTA 1LO5D 4IOIE 3I5JC 2K4KA 4ZLTF 1GUNA 2MGSA 3AQQA 1KRHA 1GUSA 4DK3C 3Q6SA 1Q8KA 1SSOA 4TSSA 1K53A 2N88A 3ZJVA 1PVOA 2Q2IA 2PTLA 5IOCA 3IVFA 2N0SB 1EUJA 1SMYC 3VR2A 3HKZG 5IGGA 4Y52H 2KDBA 1OO9B 1P16A 2C5CA 2BPSA 2RGFA 4DXGA 1JCKB 3TCAA 1TY2A 2ZTDA 5EBDA 3KFUA 4L5QA 3D6CA 4A90A 3AEAB 3G6JB 5NUCA 3AFQA 1LTAD 3GTJH 1TT5B 4A93G 1YJJA 4P75A 3NSWA 5E3FA 3C46A 5BMGA 1NI3A 3U4EG 1ENAA 2KFJA 4DQOC 5E6PA 2O2VA 3GTQB 3PRPB 4DV7Q 2O6VB 5JAVA 2HUGA 4A3DG 1AEXA 2JE6I 1F77A 1TKWB 2Y5BB 4RCNA 2K25A 2ACZB 4DR4L 1FEHA 1N62A 2V3SA 4J8QA 2HQEA 3U58A 3RZOB 2ONQA 4KSLC 4WAAA 5ELFA 4ZCKA 1EYCA 3A7AB 4N58A 3NQIA 3K0YA 3J7A5 1OEYJ 2KCCA 1TS2A 3KBGA 3T1YQ 1Y1WG 5LHY1 3I4MG 1WIAA 2DENB 5FR6A 3M7GA 3EECA 1G6ZA 2RQXA 5JJKA 1K8MA 2I5LX 1WGRA 2OJRA 3ZRFA 2EY2A 2E2IH 2DJGC 5HY6A 2AHOB 4CGYB 1L0VB 3FDTA 3GV6A 3DVNV 3W5VB 3TJPA 3UINB 3H3VI 2KWVB 1A2UA 3AFPA 4IUUA 4JK1C 5KYIA 2A4ZA 3UDXA 2EY6A 1L6VA 3NZ3A 2M19A 3T1YL 2K14A 3DUZA 4DF7A 5M5WB 2DY7A 4MM3B 5EE0A 3QOJA 4IM3A 1K52A 3AI5A 3RZWC 2D5DA 1E8YA 2O5JC 1N61A 1BBUA 4EQPA 4G57A 4EQNA 5GXGB 2V1CC 1VQMA 1EY0A 2JA6B 1VD2A 4B6WA 2KBNA 4PMCA 2UUCL 3CCVA 3NE5B 4JW0A 2NVQH 4JQWC 1JWBD 2EVBA 2WXMA 3P2BA 3Q2AC 4EFOA 2VQFQ 1WGKA 3OAWA 2K05A 1TU2B 4J6HA 2ZXOA 3KF6A 4XGAB 3CRLC 3NEMA 4LAAA 1F2ZA 2FUG1 4US9A 3H91A 4DHZE 2FINB 4BVUC 1JJCB 2XNAC 1EM7A 1W6KA 4DXFA 3AE4B 2CW0D 3U9SA 1VQDA 2XRQD 1VRAB 1YMHE 3PSIA 3U52E 1D8LA 3I70A 4A4IA 5BN4A 4JBKA 2JP1A 5AEKB 1WE7A 2LMCB 2KC1A 4ZRZA 2KHIA 1WR6E 3ML8A 2LVOA 5IT9c 1Y8OB 4LFCQ 2R93H 4K7WA 2O2LD 5HG2A 2NBWB 1FD7D 1QKZA 5IN7A 3MXUA 1LTBD 4ILWA 1IGCA 2D3GA 3H6MA 2ATWA 2REXA 4MDKE 3S16B 1B3QA 1L0YB 4ASWC 2N55A 3ZIMA 2WDTB 5C4XH 3CRKC 3A1QA 2N3SA 4CO7A 1ISNA 2R7ZB 3C3LA 2WXIA 3HK0A 4GDKA 4MGYE 1RD9D 4B08A 4XQJA 2B2YC 1QZGA 4IM2A 5GAGC 2EZVA 2NVYB 2R3ZA 2NPTB 4TV3A 1D2BA 1SIFA 2IW3A 1YVCA 4BBRH 1LXDA 4O0AA 4IPCA 5IYCG 1H9JA 1IBKQ 2KT7A 4A93H 4M01A 3S1MH 2EYMA 4HDOA 2L52A 1TIID 1GPXA 3CCEA 2C9OA 3S1QB 1L6UA 3OMCA 3TL5A 1YBYA 5TSSA 4ANXA 2IGGA 4R3DA 5JPMC 3PO2H 3CW2C 4JOIA 1F2LA 3KDFB 3LB8C 2CWPA 2IDYA 3L3OC 3J81c 4NP5A 2PZWA 2NBFA 4HROA 2K6QA 1F0ZA 4JBJA 2DZKA 2EYLA 4JI0Q 1AARA 2K5NA 3M85A 2XVSA 4C1NK 2K28A 5DPWA 3FKIH 3OOCA 2Q5WD 3I3CA 1TKEA 3IKJA 1FXTB 1YN5A 3PF4A 3RUIB 3WWVA 2B2VA 2ICEC 3DWAA 4OWTB 2ZPYA 5FK9C 5LMNW 3AECB 1H9RA 3U7ZA 3GTLH 1PFNA 2BH8A 4C3JG 2ON8A 1O7ZA 1E9MA 3NXWA 4ME3A 5IKCM 5E4XA 4BKSD 2RDHA 4WIPA 4WWPA 3F8TA 2IO0B 2VH2A 2EXZA 3BY4B 1LACA 2P5ZX 3CIRB 3NELA 2DZIA 5EE1A 3VTVA 3A55A 2KQ7A 3SDZA 4BZAA 3KH0A 4KSKC 1RJTA 3CMAA 4QJFA 5IYDG 1XCQL 3AE1B 2A5HA 3QX1A 1UNSA 3H94A 2K5QA 1V1PA 1K0SA 1UUPA 5M5YB 4YIJA 2GBJA 1TWGH 3GZNB 3MTSA 2WXHA 1D5XC 5C3WA 4IKGA 1H95A 2DYOA 3Q8AA 3M63B 3W9CB 1BDOA 3EN2A 1CKMA 1EF1A 2EE1A 2Q8TA 3ZJYC 5ELOA 5EE9A 1PGAA 2WWZA 1Y56A 3N1ZC 5C3XA 4F87A 2NN6G 4MNOA 3JVZX 2UXCL 2I1KA 4Q0FA 3Q6BA 2R92H 1BCPB 1DOKA 1ASZA 3HOUH 2W82A 1PH1A 1I4QA 3ZXVA 1SNPA 3HFZB 1JOOA 3RLNA 5AFWA 2WXRA 2Z1CA 1S5ED 5LL6S 1D5MC 4IW0A 1Q82C 4A3LG 3I4NG 2AYOB 3ZDMC 2E6XA 4C3IB 1HHVA 1IBXA 2F0QA 1J19A 4X3SA 5CV9A 4BY7H 4NQLB 1Q81C 1W6JA 5C0XI 4LW1A 3M4OB 1VDZA 2AUKA 2OF1A 3D6WA 5BN5A 4DR7Q 2UXCQ 1FO4A 1K51A 3B08A 2AKWB 2HCIA 4DR5L 2DZJA 1VQEA 1JB7A 1Q1EA 4V0BA 2E2JB 4GLSC 3V60A 3RR5A 4R8IA 3EC8A 1GKHA 1YEZA 4APVA 1LT4D 3ZGZA 2MFIA 4FP5D 4K5VA 1BO0A 3RMHA 1KDCA 4HJKA 1VQJA 1Q1BA 4YWLA 4A3IH 3SK8A 1ZP0B 4KX6B 4K7SA 5IGEA 1XEEA 4XXEA 4DR6L 1NMGA 3CKIB 3S17H 1STEA 2UU9Q 4LF4Q 4WJ3M 2D3CA 2W55A 2I38A 3KWLA 3O65B 1LTSD 4ZRKA 3MXNA 1TKGA 2F0UA 2K9XA 4YHHQ 4CJ1B 4L6TB 1XJVA 4OXPA 3ER0A 3W2DA 1KL9A 4WFN3 1QQRA 3WAOA 3PPAA 4CYEA 1L2NA 5JPNC 3N3KB 3P7JA 1OTRB 1BNZA 4C56C 4DR6Q 2IJ0A 1O7IA 4QY7A 1M90C 3W5OA 3AE9B 4M02A 5C0XJ 4FHJA 1B9MA 4DNIA 2MP2A 4NXNL 2BB6A 2Z4IA 4RGMA 4LF6L 1SB3C 2NCNA 1I3QB 2PKOA 2K01A 3QG1A 2B63G 5I9OA 1YQ4B 2C7NB 2PMZE 3T51B 4G7HC 4QCLA 4PS7A 2NZ1D 3BDCA 1YJ9A 2PCFB 4FXKC 3H15A 1DONA 4FDBA 3DEOA 2J4XA 4F88A 1HFGA 4P1CC 3H0GH 5KIXA 3PHWB 2MCNB 4ZK9B 1JT8A 4JI6L 2ZTCA 1P0RA 3IAM1 5MPOA 1TWCB 2PO4A 3LX0A 1V9JA 1WSPA 2QF7A 1V8CA 4KN4C 4NY0A 4LF6Q 5C3EB 4LF9Q 4HPPA 1OXUA 1PXUA 2XWBB 2R92B 3PO3G 2XEWA 1LGRA 3RNGC 3HOVH 2IO1B 3L10B 3E0EA 5T1GA 4KY5A 2K8HA 4GB9A 5IP9H 4QL5A 2KLCA 1CUKA 1ICFB 2YTYA 4ME5A 4MH8A 2Z4HA 2DNCA 3QIAA 3TZDA 3E9HA 5J3BA 1XPOA 2BKFA 1WTOA 4M8AA 1ASYA 5A2QL 4BBNF 5E4WC 3KJPA 4LNQA 4C3IH 1NVID 1R4MI 3CQZB 3BVMA 5EPJA 1JORA 1KDAA 1BF4A 4UP8A 3JAMc 4GNXC 2EOTA 2KYWA 5C3EH 4EOYA 4DUYL 2A1AA 4BA2I 3SFDB 2B2UC 3UI2A 1L1OA 1KRTA 3AU7A 3HRDD 1IPGA 1DOMA 3RFZB 1KNAA 4HLEA 1E24A 2EYPA 4GGQA 4FJZA 4DNRB 3BJUA 1WJNA 1P3QU 3IL8A 4OO1H 1WVLA 1PZID 2B2WA 1EFWA 1KOTA 4HJ7A 3Q22A 5FO8B 3AXCA 3DVNU 5IGDA 5IOIA 4YY3Q 3Q8EA 4AQYQ 1DYQA 3K81C 4ODGA 1B9RA 2Y5PA 4ZYNA 5ELBA 1X54A 1VQ9A 2INNE 2DNEA 2LMCA 1J8CA 1HR0Q 2WLBA 2GVBA 1B7YB 1LUZA 1N34L 1C9FA 4C2MB 1A62A 4XX5A 3ZVVA 1E7VA 1WFQA 4IWQA 4WWOA 1HZ5A 4FNFA 1VS0A 1E5WA 4CQNA 2UUBL 2MJDA 2IL8A 5M3FH 4IQZA 3S1MB 4RMFA 3IAS1 1D4BA 1B8AA 4U68A 2N9PC 5K36H 4GDKB 1N5XA 2HDLA 5HI1A 2CQOA 1XQQA 3R93A 2KNBA 3Q3MC 2JT4B 3J80i 3CCSA 4A3BH 3T1HL 1WTPA 1AWDA 3VA7A 2KANA 2CW0C 2VQEL 2MHJA 3M4OH 3A9KA 1Z5SB 4B3RQ 3P4RB 1EOTA 3D4DA 1UAPA 1PFSA 3JAME 4KDIC 5IA7A 1I3QH 3AH7A 1WYDA 4GIVA 4XWWA 1UEBA 1SYDA 4XIGS 4ZKCB 3NUHB 2UUBQ 1AYFA 1YHQA 3WAMA 1O7YA 1Y1VB 2Z6BA 2ZW0A 4MSQB 4AJYB 3CCRA 3PMFA 1SGHA 2DBYA 2QCPX 2F0GA 4JYAQ 3CPWA 1P9DU 3AEGB 5G5HA 2K5DA 3ERSX 1P1AA 1QJOA 1PTOH 4DV3Q 1IL8A 1EYDA 1HNWL 4UP9A 4B3SQ 2LKVA 4HN7A 4B9XA 4R4OA 1WD0A 4M0WB 3TUOA 4DV4L 1X3FA 3PF5A 4A20A 4IUVA 2GI9A 1F52A 4G7ZC 2LY7A 2AQ2B 4HKQA 2E3TA 2FUHB 1KD1C 4X3UA 4S0RA 3PIPA 5DNFA 2KACA 1LTGD 2F0OA 4AYBB 1TQOA 4YWKA 1XMOQ 1PH5A 2IYDB 3FILA 3PV1A 3GD7A 3VR3A 3PSEB 2JSVX 3NBHB 4TQUS 4NDXA 1K8AC 4OGQC 4LTUA 3ZO5B 3ULLA 1NSNS 3MC0B 5LMNQ 4JX1C 2R2QA 1QUQB 1VCBA 4YWMA 4DR2L 2K6DB 5JEAH 3HOUB 3J7AF 1KDBA 1FCCC 2BWES 2Z0SA 2CH4A 3UDFA 5G5GA 4BFRA 1C4AA 4WWNA 1TR5A 2N4FA 2N9EB 3T9LA 1XWEA 2K1FA 4HIMA 3BYTB 1CFMA 3CC7A 5JJIA 1PQSA 2V3PA 2B2VC 4A3GG 2G4DB 3I3TB 3I9V1 4ZUIA 2KFKA 2BYEA 4WURA 2BQQA 1XNRQ 3H1UA 4KIKA 2BW2A 1L2FA 3UQAA 3U50C 4TRDA 1T0YA 1K9MC 2DZMA 2EDGA 3IBEA 1YHAA 5CBEE 4DR3Q 1SF0A 1UE5A 4RF0A 4AWJA 2F4VQ 4PYZA 3A8IE 2E75C 2GN5A 3LNNA 1X9NA 2UXBL 2ZNVB 5C23A 2JZZA 4JI2Q 3F2BA 4QGUA 3RNUA 5AUIA 4IPHA 2IPKD 1G6JA 4GLVB 2D2CC 1XTCD 4C00A 1LT5D 3NTIA 3VH4B 2KTRB 3S16H 4ARIA 1XNRL 3S2DH 2KWUB 2PW5A 5D65A 4NAMA 2IHFA 4A3DH 2KX0A 3PS6A 4PZ6A 5FOBB 2F4VL 1YHBA 2H5XA 2Z9HA 1PFMA 3EQLC 1T3QA 1D5ZC 2MO1A 1YNNC 1WCMH 4CKBA 4JI2L 4NJ6A 2HT1A 5TR5A 1E90A 1UE7A 3AEEB 4B95A 3NS8A 4YSXB 2FJ2A 3L7ZC 3N20C 1CSPA 3N6RA 2PYKA 3KUZA 4K3CA 4LFBL 1DOIA 1PYWD 2F0SA 1T5EA 3LWUA 4WORA 1KABA 4H44C 1M94A 3P20A 1ESFA 2LVPA 2JZ3B 2E5LQ 3KLRA 1STHA 5KNBA 1RCVD 2RCFA 3MEFA 3PO2B 1PDXA 5CORA 3AE6B 3MJ5A 1CKNB 1C1YB 2HCCA 1YIJA 1NMFA 3QJYA 3OW7A 2BH2A 1DJRD 2K0PA 2YEPF 4DU9A 3P42A 2E2HB 4C2MH 1LM0A 3KLSX 2KDIA 4ZRJA 1HNZL 4P71A 4HSPA 3K7AB 2L0TA 2F0HA 3A9JA 4UPAA 1D7QA 4LF9L 1SIJA 1SJED 1TWFB 1A5RA 2VUMG 4ZRIA 4RGTA 1D6EC 1WXVA 3NY5A 4A3EG 1IBMQ 5C4XB 1NY4A 4A3BB 2JA8G 3VR8B 3AMZA 3SDLC 5D2MB 4ULLA 4A3GB 2F0DA 4TQ0A 3RCZA 4Z9CB 2WXLA 2G9DA 1QUQA 4GKKL 2Q2UA 3U2SC 2IX3A 2LXKA 5C2TB 3E3XA 1HNXQ 1Y1VH 1S3OA 4FF1A 4IOAA 4B3ML 1UH6A 1C8CA 1JWSD 1EFID 2BVCA 1NBWA 2X6LA 4TKOB 4WJWA 2DGYA 5J39A 5C4XG 1A3VA 4A3EB 3S24A 3TEHB 1HTLD 1WM2A 5C44B 2ZXPA 3KOJA 3P63A 3M7NA 3DWGC 3WALA 2NZOA 4E71A 3TZUA 3VHTC 1I50B 2N9KA 4K2KA 4K2LA 1YNJC 1U4LA 4HIOA 4XYCA 1CA5A 1EZ6A 1X3EA 4OVVA 1PHJA 3P4SB 2F0KA 3EFXD 5LNK1 1SAPA 2ZCCA 5IGBA 1V80A 3L0OA 1EU3A 2WKDA 5EJWA 1FXIA 4H0LC 1DM0B 2K5VA 3I4NB 4P1BC 2EMTA 5ELNA 1X1MA 1MPEA 4YTNB 2Z6KA 1STNA 4Q2JA 2BTEA 1NTGA 1YJIA 2CJOA 2JSOA 3MC8A 1FGBD 1QG7A 2A6EC 5FLMH 5FO9B 3K5LA 3I4MB 1F9SA 5FLXL 3ZTCA 5CHVC 2K75A 2KDFB 2PMVA 3T1HQ 1RRBA 3APCA 4DHZB 1YX6B 4XC2A 3SFEB 4RHSA 5M3MB 2A68D 4BY1G 1EIYB 2PE6B 2R2OA 2XBBC 4OW0A 4JGHB 2HD3A 2GB1A 2PPHA 2CJNA 3PLVA 2V1YA 3TDQA 3PQIA 4LF7L 1HH2P 2KECA 2BF8B 3QIJA 4A3CH 2B63B 4GOPA 1KHIA 1SFOH 1P8LA 3E9IA 4AIMA 3AULA 3ECIA 1QCBD 3H7PA 4FVMA 4A6QA 4GLAC 4DFAA 2BOSA 1WJ6A 4RGNA 3G71A 3PIP3 1SEBD 3S1RH 1P7EA 3FEWX 3DQVA 4PZ7A 3CXCA 1FNUA 5M5XB 1BBXC 1TWFH 1XNQL 3PUVA 3B1LX 1QB5D 4FXCA 2G5DA 2WB1E 2FE8A 3TN2A 4JV5L 1EWYC 1KLUD 4KZ0A 1VZ6A 5D6JB 4F1SA 2K1BA 4LDTB 3L0WB 5G3LD 3VVWB 4MZ9A 2LFIA 3C0RB 5BYSA 2QJLA 1J5EQ 4DV2Q 2IY0B 4E6IA 3FRPB 1ICWA 2D9UA 5KGUA 1EQVA 2EYOA 4A3JH 1PFDA 4KKTA 2KAJA 1K83H 1MI0A 3U7DA 3CWIA 1VQKA 3QHTA 1SNQA 1UF0A 1ZKOA 2EJGC 2INPE 2CKHB 2KEDA 1QOHA 3KBXA 3HIZA 4KKJA 3GTLB 4AYBG 3PUXA 4IFDG 3VQIA 2JXTA 3GDEA 3K8AA 3CSFA 4ALPA 2KJ6A 1HZBA 1T5XD 2E2IB 3C2PA 1HZ6A 3PCOB 1H9SA 5C0XH 4IOCA 3S15H 3L16A 3RUZA 1VQPA 4EKUA 2MO0A 1F2MA 4NNJB 2NUCA 3TREA 2MJEA 1RAXA 1TS4A 1TWHB 2CHXA 3S1QH 2LZ6A 2UXBQ 1GJZA 2BWFA 1A0IA 2HE7A 3K6OA 1HXYD 5C44G 3HKZB 1VQGA 4DV7L 2HTME 3CQZH 4PNYA 4DV5Q 2IO3B 2Y0SB 3T53B 2ZT9C 2L9HA 3N9YC 5LXIB 2K7VA 5CGKA 1TS3A 4A9AA 1M1KC 3KWVA 4HCPB 4K8IA 3TEYA 4IFDJ 2KDMA 4JI3L 3J9CA 1DCZA 3JYUA 1SXTA 1QVFA 3BU2A 1YJ1A 3L13A 1L7YA 3MEHA 5T8IA 2FNJB 1SE8A 4OHJA 3TEWA 3ZYYX 3HGBA 2D07B 2QCZA 4MM3A 3GTGB 4WJOA 1ZUD2 2A68C 4KY7A 3D32A 3SK6A 1IP9A 4DV5L 2GLSA 1FRRA 5JHBA 3NWSA 4X66L 4I6NB 2YTXA 1TTNA 1RTNA 1C4PA 1K28A 1PH9A 4JI5L 2V0GA 3AB5A 2YYZA 4KKUA 2EJFC 2EPBA 4K6DA 3MAQA 1HJPA 1EL0A 3S1NH 1FR3A 1B3AA 2XRSD 3TP6A 1C4CA 3N30A 2ZEQA 2KCTA 1K8GA 1B2TA 1MSHA 4KHVA 2MHVA 2LXAA 5BYQA 5JVH3 1J6QA 1SYEA 2LWPA 2I5HA 4UDUC 4YCVA 4B9WA 4MELA 3LWEA 5AUKA 2KVZA 2W9NA 3H7SA 4BBNC 1V1PB 1G2SA 4DAMA 3CCJA 2UUCQ 4LNOA 2LGSA 1MSGA 2N8NA 1WJUA 1YIWA 1PA6A 4IM0A 4W9LA 2PEAA 4UP7A 3ZNID 3CC4A 3PRZA 3OWEB 1V1QA 4LJPB 3GV3A 4KZCA 4P7IA 2JX5A 4Y7NH 3ZDTA 2HQLA 4FXGC 5EQ0A 4TKNA 1CJEA 2UXDL 4IN3A 4HCEA 1A6XA 3ONSA 2F1MA 1EQQA 4BKTA 3NBIA 1JRPA 3ZKJC 3MJWA 2B3GA 1X56A 2WXPA 1H9KA 2B29A 1KNEA 3KF8B 1EWHA 1UWXA 1T0QC 2ZTEA 1MG4A 3SD5A 3PO3H 1SFOB 3HOZG 4XQQA 4I7AA 4OELB 4HIDA 1FM0D 2KDEB 4FN2A 3VUXA 1H8CA 2SAKA 1Q7YC 2HJ1A 2UXDQ 1PTOF 4IDIA 5FR3A 1PGBA 2EIFA 3NVVA 4N9F4 1SYBA 5M5XH 3RD2A 4KJOA 2YU9H 5KRUA 3O13A 1QNKA 3MFGA 4QF4A 1WMHA 3R2TA 2KO3A 3M3YH 2BS4B 1C79A 2JXMB 3C1EA 4OO1I
chains in the Genus database with same CATH topology
1JICA 5CV8A 2D62A 4KTAA 2K03A 3J7YW 3TP8A 3T3NA 2B2WC 1TT2A 3ABVB 2J42A 3FC4A 2L4NA 4ZKBB 4A55A 3AEDB 3HS0C 2K3UA 2BCOA 3W3AA 2K5WA 1PDQA 1RDPD 3HUIA 3A56A 1FFUA 3NPPA 1X32A 1H9MA 3OHXC 2F0IA 3IFTA 5JEAJ 3K5NA 1QOGA 2L1BA 5KYLA 3R2IA 3JAML 2LJIA 1XLQA 2E74C 1DD2A 1ZE3D 1D1KA 1WTWA 3P1MA 1E2ZA 1Y1WB 1QT9A 1V97A 4F8MA 4N9TA 1OFFA 1DGJA 2DLBA 1N60A 1MHXA 3DEPA 1G8ZD 3GS2A 3MXGA 2G1EA 2L5TA 3FPPA 2FBWB 1JOKA 1EEID 2F4IA 3BK1A 5IT9L 3MVVA 3NWTA 3FMCA 3E9SA 5C4HA 5K5PA 4QUFA 2DYMA 2AX5A 2NTSA 3D4RA 4KKIA 3HVZA 1SMYD 2F0TA 1Q12A 1ENCA 2B8FA 3ITPA 4CJ0B 2KHSA 1II3A 1JALA 3K57A 4HR7B 3BDLA 1VDVA 2V4IB 3BWUD 1U4RA 3J80L 1IYVA 2WXFA 1O80A 2Y5CA 3TP7A 1FMAD 3S14B 1BCPD 3CHBD 2JWUA 3Q8FA 1JMLA 1YQ3B 1F2YA 4NMZA 5EGTA 4CJ2C 2B8GA 1XO3A 3EROA 2B2UA 3I91A 1QILA 1F9RA 2DWQA 3MZ5A 2JA7B 3GTMB 4DAPA 1I6VC 4HEDA 3F2UA 1X3PA 5I2YA 1GUGA 4HRSA 2QSDA 3SK5A 5C0XG 4K5WA 4OVZA 1ROEA 4CKCA 2F0NA 2WQYB 4OO1G 1N5WA 4B0EA 4HKZE 3AE5B 1WTVA 1IUEA 4DAYA 3NVYA 2Z8LA 1HTPA 1VZ8A 1PRTB 1BMLC 1BUIC 5I6YA 4EE2A 1BQQT 4HEA1 5JXVA 3VA5A 4XDDA 1CK1A 1SNCA 1BUVT 2TSSA 2RDFA 1PTOC 1JC7A 3Q0AA 3NK9A 2WXJA 3HP3A 1PMRA 2WKCA 3I57A 2CVRA 1UGJA 5D3DA 2GA4B 1IBXB 4PMWA 3S9WA 4YT0B 1HQRD 4LK1C 2OEOA 4EVOA 4ZAIA 1BXTA 3SEBA 5CYUA 1N63A 1F9PA 2RPVA 1HA6A 1RF2D 4JWUC 1CI3M 4YWGG 5H8YE 1A15A 1Z47A 2KUMA 3J80E 3RZDB 2MH7A 2LEKA 4RCOA 1I4XA 2VB3X 3NTKA 4MIUA 3PZ8A 1QF6A 3VYUA 1HUNA 2RDGA 4ZRPA 3VR4A 3AV8A 3X3NA 4OIJA 2IGDA 2OHFA 2PZTA 1NAPA 2PW7A 4OZAA 1WD1A 1EY7A 2D5GA 2ZW1A 3PV0A 5ELDA 1EY6A 4HTHA 3A8JE 3DMUA 4D2KA 2O4XA 4XWTA 2BDOA 3D4WA 3SK4A 3R3OA 2FMMA 4DGZA 4L23A 4B0MA 4AS1A 2JZPA 1T6BX 2H89B 1Z7TA 3V05A 1SJHD 3WOFA 5D14A 3J81E 3WCQA 2L1AA 2WXKA 3I8ZA 1TYGB 1J9OA 2KQ4X 2H4OA 1LTRD 3T16A 2V4DA 1JB3A 3MHBA 3A54A 1I4GA 1U4MA 4FF2A 1GHKA 3FVQA 1GHJA 1IW7C 2DY8A 2MUYA 2A69D 1I6HB 5E6JA 3E56A 1Q3LA 3E5SA 4MN3A 4FF3A 2X69A 1V8QA 5ELCA 1SE4A 2EYFA 3ND8A 5BMHA 4K8JA 2L55A 1X3QA 5A2QE 4LK0M 1GXDC 1XXGA 1R7SA 2VZKD 3QWNA 2NVTB 1A70A 1ZDVA 4JPSA 1ILQA 1EY5A 1ET6A 1AN8A 1LABA 4RFBA 4N9PA 3ONAB 1VMPA 3VRBB 4C7YA 2AWNA 1LT6D 2TMPA 1C48A 4KK7A 3HRZC 2EKIA 4QUCA 1PZKD 1XYIA 2XSCA 4RH6A 2WXOA 2WDVB 3OPOA 4BWGB 3MWYW 2LHEA 2MJ8A 4G4KA 4K5XA 3J81L 2YEPB 2BDNA 2L83A 1GB1A 2K5PA 5DM63 2K33A 2WV6D 1AFPA 2F0VA 1CQFA 5HURA 3S15B 3E0JA 5KEEA 5C5MA 2MEKA 1CZGA 4CHTB 4KI0A 1MGSA 1GUOA 4ID6A 1VZ7A 4WRDA 4A3KB 3BS1A 4RGOS 4LLGM 3D31A 2F3VA 1JOQA 1TWAB 5JEAG 3IT4B 1PZJD 5C4JB 1B1ZA 2CHBD 4WAFA 2N9LA 3HZXA 1UEAB 3T56B 4KD4A 1TWGB 4F7XA 4IALA 4ZQ3A 3AE8B 2F0PA 3BDOA 4OZCA 5CV4A 3DHQA 4DNTB 1E10A 1MHHE 3NRZA 5M9OA 5CMDA 2QILA 2Q8IB 1NCVA 2W3SA 2K32A 2KJXA 1GJXA 1YNTE 4NZLB 1WTQA 4YTMB 1Q90A 1HCZA 3AN1A 1SYFA 1HEZE 3TEZA 3Q69A 2WAQB 2AQ1B 1V43A 4S3SA 1JWAD 4M0WA 1S5BD 3D3RA 1QLBB 4DK0A 1RHPA 1OXSC 1SBBB 3VYSA 3GQBA 3DWQA 2PLPA 4I65A 1LT3D 1SYCA 3PIO3 4KGSA 5EKLA 1VF7A 4QMGA 1PLFA 1HFNA 1S5DD 1LLRD 1JROA 1STYA 4ABNA 4RA8A 1I4RA 1QWYA 3BVZA 3K5MA 2JU6X 1XLNA 2RKSA 1ZEQX 2BE5D 4Y7NB 3VRAB 5C6AA 2F0EA 2J7ZA 1EY9A 1CA6A 1VLBA 3RPFC 4L8JA 1O7LA 4HMJA 3T3OA 1EY8A 1AZQA 5LL6X 3OIPA 1J7CA 1QE6A 5COYA 1E2WA 3TMEA 1HRJA 2K04A 4WH4A 3GTOB 1ZXIA 2EELA 1K50A 2B76B 1FD6A 2F0FA 2R6GA 4X3KA 1QOBA 3I73A 2BYTA 1UWMA 1B4OA 1DOLA 4HSVA 1E7PB 2BB5A 5IGCA 2F0MA 3MP9A 2IX1A 5EKIA 2IWHA 4OZBA 2JYEA 3GTJB 4KHZA 4HJGE 4ZOHC 3BZDB 3SR1A 2EY1A 1OQRA 5EKKA 1TVXA 3H8HA 1KF6B 3GB1A 4RAUC 2IX0A 1R9TB 1A3UA 1R4QB 1O78A 4ARCA 2SEBD 1TS5A 1SNMA 2HDMA 3A7LA 4U673 3GO5A 4RKBA 4HMIA 3DWMA 1JW9D 2SOBA 2I07B 1WCMB 2RBMA 2OT2A 2QEJC 3P1HA 3AE2B 2FFKB 4A3IB 5JOBA 1B44D 1TJEA 3I72A 4YTPB 1MD2D 5CR3A 3SR6A 1RTOA 4BY1B 4CKEA 1VR9A 2MP1A 2ENBA 1AP0A 3Q24A 2JA8B 5CV5A 1U9RA 1SDFA 1WRIA 1F2RC 1L0XB 2M00A 4BY7B 1ZYRD 1OQQA 2NWGA 1E6EB 4BA1I 1H9SB 1MBYA 3PUYA 4MHEA 2SNSA 3VYRA 5D3IB 2PVOD 1EIGA 3DM1A 3MHZA 2AWOA 4PT5A 4IFDI 3H0GB 2BT6A 4EQOA 4ZYSA 4R8NA 3C8YA 2L0CA 5CV6A 1IKLA 2B2TC 2R61A 1ACCA 1L4ZB 2A73B 2NN6H 5HFYA 5JJZA 2F03A 1WTRA 1K8OA 5CC4A 4NJCA 3I4LA 5EE3A 1G91A 5EPLA 2CU3A 1LTID 4M1UB 2WNMA 2WXQA 2NYZD 3ERQA 1TZOA 1NYQA 5EBCA 3NTHA 1R4PB 3B2GA 3BIID 4IUNA 1IW7D 2PQEA 4C80A 3NVZA 1J7BA 1NR2A 2A6HC 2GRIA 1EU4A 5FO7B 1C76A 2A6ED 4BBSB 1PRTC 2KMMA 1RM6C 1KLGD 1L4DB 2XN9C 1XCTL 3ZQ4A 1RWSA 5C3JB 2ICIA 1JQYD 3RLFA 5M3FB 1BR9A 1EZ8A 1VF5C 3AM9A 3KK7A 3R8BA 3PO3B 2KWDA 1SE3A 1F9QA 4RF1A 4HAEA 2W3RA 5IIFA 1CQVA 2W54A 1P7FA 4ZRQA 1K83B 4FXDA 3MA2B 2IGHA 2QDBA 5ELEA 4KMUC 2NMQA 4H2AA 3OIQA 4A3DB 2SDFA 1C77A 1ZYRC 4P16A 3OSOA 4XT3B 2PW9A 4QB4A 3I90A 1SSNA 4RHRA 4ZHPA 3S2HB 2RMMA 2M56B 1PFBA 4IURA 1FRDA 4IFDH 1A2TA 4H13C 5IGFA 1MVKA 4L1BA 3WOEA 2VXWA 1GB4A 1MI2A 3B9JA 3LYYA 2DN8A 1VJKA 1STAA 2LS01 2NVXB 1EEFD 2NN6I 1M4VA 2LGIA 4BBRB 2RSNA 3V3XA 1LTTD 3GP7A 2KVMA 4NAWB 4A3JB 2H88B 2KA7A 2PMZB 3BVGA 4IUTA 3EUB2 3M3YB 3FILB 3IT6B 1NUCA 2FHTA 1XLOA 4K14A 1OXTA 1YNJD 3C1FA 4IUPA 1XLPA 4XYOA 3HOXB 2F0LA 1S5CD 2PIAA 2VUMB 1EIHA 2JYTA 2QIEB 5IT9E 1CZWA 5G3LF 1IKMA 3P4QB 2WP8J 1TKYA 2V3NA 2K6AA 4DN4M 3Q8CA 3GTPB 3FAHA 1D1IA 5F2DA 2M0AA 1A3TA 1XX8A 1NEKB 4J3OD 3V96A 4KN7C 4C1NI 4QIWB 4N6EB 3GTKB 4NKLA 1I4HA 3NVWA 1PRTF 3EA6A 4GDLB 3Q23A 2MJ3A 2QMTA 4OIKA 2L12A 1BCPF 3OWFA 1ZPSA 3Q8BA 3TP5A 4UAIA 5H92C 1RFKA 3HOYB 3ETRA 2PZUA 1HA5A 2JEBI 3P75A 3IXSA 3EGRA 2JEAI 4PMBA 1I4PA 3D8GA 5I6WA 1CT1D 4P6VF 2BA0A 2LFNA 1I7HA 4R9WA 1FCLA 4KKSA 5I9PA 3QO2A 4RNAA 4NW2A 1DOXA 1U4PA 1IHZA 1B53A 5T1IA 4USAA 4O1NA 5HGTA 3SVMA 5FKAC 1CHQD 3G7LA 3URYA 2ID0A 2AUJD 2QKIC 3MFYA 1G291 1ILPA 4RKLA 5JVG3 1HUMA 3T4AC 4HCSA 1YN4A 4XQNA 3AE3B 1IYUA 2LUMA 3NP8A 4XDCA 1IGDA 1RKNA 4P2CB 4PV1C 1F2RI 1NYRA 3NQTA 1KFYB 1S4ZA 1ZXTA 2EYHA 1VMCA 2YU9B 3VYTA 4EGVA 2PNRC 5I4DA 4L2YA 3SHLA 4H7BA 4MT5A 1EQTA 2J52A 3W5UB 4V190 3E6ZX 2EY5A 1FNVA 1FIQA 1SYGA 3NS1A 1ESRA 5BYRA 1CHPD 2KN4A 3PUZA 1JWUD 4TMAB 3S1NB 1C4QA 1HPCA 1Z6HA 2HDEA 1NR4A 4JE3B 4DK1A 2NVQB 2JA5B 1NENB 3RD4A 4N59A 2BS3B 2J53A 3BK2A 3PZ7A 2WP9B 3J7AV 1C78A 1EY4A 2WU5B 3W1SA 2WB1B 2Y3AA 3S1RB 2BBCA 3L4PA 3UI3A 2R93B 2WINB 1Y69U 3ZJTA 3VR6A 1RODA 5CV7A 1SE2A 5C4ZA 4GZYC 3N52A 3H3VC 1B50A 2WACA 1J8IA 2B2YA 2X6GA 4PQXA 3IAYA 1Q10A 2M2LA 2OXPA 2PVGC 2ZXRA 3K58A 2F0JA 1CTMA 2SNMA 4KGRA 1ENFA 2FMCA 2BA1A 5BN3A 2OEDA 2E76C 4A3FB 2WIIB 5A35A 2Q8RE 5CBAE 3OMGA 3K59A 1RYJA 3B2FA 4A8XC 1Y8PB 2WXNA 4C3HG 4CBVA 4I7ZC 3V2TA 4IZ8A 4FO2A 1PGXA 3S17B 1CM9A 1KH0A 2NB0A 4C3HB 3M4YA 2BS2B 1J7AA 3AMUA 2RA4A 1JQ4A 1E0ZA 3AEBB 1WXQA 1OXXK 4G7OC 2EYJA 4O42A 2B39A 1JR0D 1CZPA 3HOZB 1L5PA 4XDXA 1BOSA 2I2YA 1PRTD 1PTOB 4OL7A 5C5LA 3HVDA 4KY6A 2A6HD 2A69C 3QOLA 2N7JA 2WXGA 5I2XA 4X3TA 4ZUJA 1ONLA 1DXMA 4ZHOA 1OXVA 1EWCA 3DXJC 3NUCA 5FLXE 3S2DB 5E1FA 1QNUA 5IODA 1ZOYB 2JQRB 4TQ1A 2H1EA 1SNDA 4YXDB 3TBIB 3SE0A 1YN3A 3MXPA 4A3MB 3VR5A 1HQMC 4XE0A 4XTCS 4WQMA 3NHHA 3EJIA 4RWSC 4XYQA 2AQ3B 1GAQB 4WWMA 2XIWA 3KQ4A 5KNCA 5DEHA 3BG3A 4L63B 1JE4A 2KOLA 1DOYA 2A74C 2VZKB 4MACA 1FFVA 4LMQD 1ZXHA 3WDNA 2O5IC 4KD3A 4YSYB 3P4PB 1EYAA 4REZA 1ET9A 1PUTA 2KEEA 2X38A 4KGTA 4YSZB 3ZJUA 4BS9A 1Q8IA 5D7GA 2F3WA 2L11A 2B2TA 3K5OA 4J1MA 1GOZA 5DAUA 3HOWB 1SNOA 2RVLA 2WDRB 3KUPA 2CQAA 2K22A 3H09A 3PUWA 4FYDA 1B9NA 1E2VA 4C3JB 1STBA 4IUQA 1Y8NB 3AB9A 2NTTA 2LHDA 1M8AA 4C7ZA 2F0WA 1STGA 2M9VA 3T13A 3CU7A 3VR9B 1E0BA 3BYYB 4C3IG 1WWTA 1KAAA 2PPBC 1QOFA 3HEJA 5J22A 4A93B 3HOVB 4JWSC 1ML0D 1XF5L 3NBHA 1QOAA 3KLSA 4US8A 1GUWA 1VCIA 1PTOD 4Q5VA 1YNND 3FPUB 2VNUD 3U9OA 2RSOA 3X3MA 5K36G 4LJZC 1AW7A 4JBWA 3FKIB 4ITKA 2IT1A 1G2TA 2E2DC 4AQ7A 1FXAA 1V1OA 3HG9A 2XWJB 3A8KE 1KTKA 2J0TD 5J1ZA 4FF4A 2KQ3A 3ND9A 3LXFA 5KNDA 3EVQA 3QB3A 5EPKA 2WU2B 4KV6A 1S5FD 5ISRA 3AEFB 4XT1B 1AZPA 2EJMA 2G9HD 1LV9A 5DM73 1TY0A 4KJNA 2KCNA 1FNWA 1WYGA 3TSSA 2WS3B 1DZ1A 4K6LA 3KF8A 3L9AX 2JYOA 1WTXA 1ZDXA 1JWMD 3SXHA 5BMIA 4DA2A 1FYCA 3AE7B 2L32A 2VB2X 3DWPA 3PO0A 2MPMA 4DAVA 3IFDA 2WDQB 1BCPC 2I46A 3TEXA 2BE5C 1GUTA 1LO5D 4IOIE 4ZLTF 1GUNA 2MGSA 1KRHA 1GUSA 3Q6SA 1SSOA 4TSSA 1K53A 2N88A 3ZJVA 2PTLA 5IOCA 2N0SB 1SMYC 3VR2A 5IGGA 1OO9B 2C5CA 4DXGA 1JCKB 1TY2A 5EBDA 3D6CA 4A90A 3AEAB 3G6JB 5NUCA 1LTAD 1YJJA 5E3FA 3NSWA 5BMGA 3C46A 1NI3A 3U4EG 1ENAA 4DQOC 3GTQB 5JAVA 2HUGA 1AEXA 2JE6I 1F77A 1TKWB 4RCNA 2ACZB 1FEHA 1N62A 4J8QA 2HQEA 2ONQA 3RZOB 5ELFA 1EYCA 3A7AB 4N58A 3NQIA 3K0YA 2KCCA 1TS2A 3KBGA 5LHY1 3M7GA 1G6ZA 2RQXA 1K8MA 2EY2A 4CGYB 1L0VB 3FDTA 3GV6A 3W5VB 1A2UA 4IUUA 4JK1C 5KYIA 2EY6A 1L6VA 3NZ3A 2M19A 3DUZA 4DF7A 5M5WB 2DY7A 4MM3B 5EE0A 3QOJA 1K52A 2D5DA 2O5JC 1N61A 4EQPA 4G57A 4EQNA 5GXGB 1EY0A 2JA6B 4PMCA 3NE5B 1JWBD 2EVBA 2WXMA 1WGKA 2K05A 1TU2B 4J6HA 2ZXOA 3CRLC 4LAAA 1F2ZA 2FUG1 4US9A 3H91A 2FINB 2XNAC 1EM7A 1W6KA 4DXFA 3AE4B 2CW0D 3U9SA 2XRQD 1VRAB 1YMHE 3U52E 3I70A 5BN4A 2JP1A 2LMCB 4ZRZA 1Y8OB 2O2LD 5HG2A 1FD7D 1QKZA 3MXUA 1LTBD 4ILWA 1IGCA 3H6MA 3S16B 1L0YB 2N55A 3CRKC 2R7ZB 3C3LA 2WXIA 1RD9D 4B08A 4XQJA 2B2YC 2EZVA 2NVYB 2R3ZA 1D2BA 2IW3A 1H9JA 2EYMA 2L52A 1TIID 1GPXA 2C9OA 3S1QB 1L6UA 3OMCA 5TSSA 2IGGA 4R3DA 5JPMC 1F2LA 3LB8C 2IDYA 3L3OC 4NP5A 2PZWA 2NBFA 4HROA 1F0ZA 2EYLA 3M85A 2XVSA 4C1NK 2K28A 2Q5WD 3OOCA 3I3CA 1TKEA 3IKJA 1YN5A 2B2VA 2ICEC 3DWAA 5FK9C 3AECB 1H9RA 3U7ZA 1PFNA 4C3JG 2ON8A 1O7ZA 1E9MA 3NXWA 5E4XA 2RDHA 4WIPA 2EXZA 1LACA 3CIRB 5EE1A 3A55A 3SDZA 1RJTA 1XCQL 3AE1B 2A5HA 1UNSA 3H94A 2K5QA 1V1PA 1UUPA 5M5YB 4YIJA 3MTSA 2WXHA 1D5XC 5C3WA 4IKGA 3Q8AA 2DYOA 3W9CB 1BDOA 2EE1A 2Q8TA 5EE9A 1PGAA 1Y56A 5C3XA 4F87A 2NN6G 4Q0FA 1BCPB 1DOKA 2W82A 1I4QA 1SNPA 1JOOA 5AFWA 2WXRA 2Z1CA 1S5ED 5LL6S 1D5MC 2E6XA 4C3IB 1HHVA 1IBXA 2F0QA 4X3SA 5CV9A 1W6JA 5C0XI 3M4OB 1VDZA 2AUKA 2OF1A 3D6WA 5BN5A 1FO4A 1K51A 2HCIA 2E2JB 1Q1EA 4V0BA 4GLSC 4R8IA 1LT4D 3ZGZA 4FP5D 4K5VA 1BO0A 3RMHA 1KDCA 4KX6B 1Q1BA 1ZP0B 3SK8A 5IGEA 1XEEA 4XXEA 3CKIB 1STEA 2W55A 2I38A 3KWLA 1LTSD 3MXNA 1TKGA 2F0UA 2K9XA 4CJ1B 4L6TB 3W2DA 4WFN3 1QQRA 5JPNC 3P7JA 1BNZA 4C56C 2IJ0A 3AE9B 5C0XJ 1B9MA 2BB6A 2Z4IA 4RGMA 1SB3C 1I3QB 2PKOA 2K01A 3QG1A 1YQ4B 5I9OA 3T51B 4QCLA 4G7HC 2NZ1D 3BDCA 2PCFB 4FXKC 1DONA 3DEOA 2J4XA 4F88A 1HFGA 5KIXA 4ZK9B 3IAM1 5MPOA 1TWCB 2PO4A 3LX0A 1WSPA 2QF7A 1V8CA 4KN4C 5C3EB 1OXUA 1PXUA 2XWBB 2R92B 5T1GA 4KY5A 4ME5A 4MH8A 2Z4HA 2DNCA 3QIAA 3TZDA 1WTOA 4M8AA 5A2QL 5E4WC 1NVID 3CQZB 3BVMA 5EPJA 1JORA 1KDAA 1BF4A 2EOTA 4BA2I 3SFDB 2B2UC 3UI2A 3AU7A 3HRDD 1DOMA 3RFZB 1KNAA 2EYPA 4DNRB 3IL8A 4OO1H 1WVLA 1PZID 2B2WA 3Q22A 5FO8B 5IGDA 3Q8EA 1DYQA 4ODGA 1B9RA 2Y5PA 5ELBA 2INNE 2DNEA 2LMCA 2WLBA 1C9FA 4C2MB 1HZ5A 4FNFA 4CQNA 2MJDA 2IL8A 3S1MB 4IQZA 3IAS1 1D4BA 4GDKB 4U68A 5K36H 1N5XA 2HDLA 5HI1A 3R93A 1WTPA 1AWDA 3VA7A 2CW0C 3P4RB 1EOTA 3D4DA 1UAPA 3JAME 3AH7A 4XWWA 1SYDA 4XIGS 4ZKCB 3NUHB 1AYFA 1O7YA 1Y1VB 2ZW0A 3PMFA 2DBYA 2QCPX 2F0GA 3AEGB 5G5HA 2K5DA 1QJOA 1PTOH 1IL8A 1EYDA 2LKVA 4HN7A 4B9XA 1WD0A 3TUOA 4IUVA 2GI9A 4G7ZC 2LY7A 2AQ2B 4HKQA 2E3TA 4X3UA 2KACA 5DNFA 1LTGD 2F0OA 4AYBB 1TQOA 3FILA 3GD7A 3VR3A 2JSVX 4TQUS 4NDXA 4OGQC 4LTUA 1NSNS 3MC0B 4JX1C 5JEAH 3HOUB 3J7AF 1KDBA 1FCCC 5G5GA 1C4AA 1TR5A 1XWEA 3BYTB 1CFMA 3I9V1 2V3PA 2B2VC 4ZUIA 4WURA 2BW2A 4TRDA 2EDGA 5CBEE 1SF0A 4RF0A 3A8IE 2E75C 3LNNA 5AUIA 2IPKD 2D2CC 1XTCD 1LT5D 3NTIA 4ARIA 2PW5A 5D65A 4NAMA 5FOBB 1T3QA 1PFMA 3EQLC 1D5ZC 4CKBA 1YNNC 3AEEB 4YSXB 2FJ2A 3L7ZC 5HHDG 3N6RA 2PYKA 1DOIA 1PYWD 2F0SA 1T5EA 3LWUA 4WORA 1KABA 4H44C 3P20A 1ESFA 3KLRA 1STHA 5KNBA 1RCVD 3PO2B 1PDXA 5CORA 3AE6B 3MJ5A 2HCCA 3QJYA 3OW7A 1DJRD 2K0PA 2YEPF 4DU9A 3P42A 2E2HB 3KLSX 4HSPA 3K7AB 2F0HA 1SIJA 1SJED 1TWFB 4RGTA 1D6EC 5C4XB 4A3BB 3VR8B 3AMZA 4ULLA 4A3GB 2F0DA 4TQ0A 4Z9CB 2WXLA 2G9DA 3U2SC 2IX3A 5C2TB 4FF1A 1C8CA 1JWSD 1EFID 2X6LA 4TKOB 4WJWA 5J39A 1A3VA 4A3EB 1HTLD 5C44B 2ZXPA 3P63A 3M7NA 3DWGC 3TZUA 1I50B 2N9KA 4K2KA 4K2LA 1YNJC 1U4LA 1CA5A 1EZ6A 3P4SB 2F0KA 3EFXD 5LNK1 1SAPA 5IGBA 1FXIA 1EU3A 2WKDA 5EJWA 4H0LC 1DM0B 3I4NB 1MPEA 4YTNB 1STNA 4Q2JA 2BTEA 1YJIA 2CJOA 2JSOA 3K5LA 1FGBD 3I4MB 1QG7A 2A6EC 5FO9B 1F9SA 5FLXL 2PMVA 3SFEB 4RHSA 5M3MB 2A68D 4OW0A 2GB1A 2CJNA 3TDQA 2KECA 2B63B 1QCBD 4FVMA 4A6QA 4DFAA 2BOSA 4RGNA 3PIP3 1SEBD 1P7EA 3FEWX 5M5XB 1FNUA 1BBXC 3PUVA 1QB5D 4FXCA 2FE8A 3TN2A 1EWYC 1KLUD 1VZ6A 2K1BA 5G3LD 2LFIA 5BYSA 2QJLA 4E6IA 3FRPB 1ICWA 2D9UA 5KGUA 1EQVA 2EYOA 1PFDA 4KKTA 2KAJA 1MI0A 3CWIA 1SNQA 1ZKOA 2EJGC 2INPE 4KKJA 2KEDA 1QOHA 3KBXA 3GTLB 3PUXA 4IFDG 3VQIA 2JXTA 1T5XD 2E2IB 3C2PA 1HZ6A 5C0XH 1H9SA 3RUZA 1F2MA 2NUCA 2MJEA 1TS4A 1TWHB 3K6OA 1HXYD 3HKZB 2HTME 4PNYA 3T53B 2Y0SB 2ZT9C 2L9HA 3N9YC 2K7VA 5CGKA 1TS3A 4A9AA 3KWVA 4K8IA 3TEYA 4IFDJ 2KDMA 3J9CA 1DCZA 1SXTA 3MEHA 5T8IA 4OHJA 3TEWA 3ZYYX 3HGBA 3GTGB 1ZUD2 2A68C 4KY7A 3SK6A 1FRRA 3NWSA