1PYWD

Human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
230
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Exploration of the P6/P7 region of the peptide-binding site of the human class II Major Histocompatability Complex Protein HLA-DR1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/protein binding/toxin
total genus 69
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pywD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pywD02
2AQ3B 4RHSA 1PRTC 1PTOD 3MFGA 1ENFA 2NTTA 1YN4A 4C56C 1HTLD 1SE4A 1QILA 1BCPC 1L0XB 1EEID 1BXTA 1EU4A 1KLUD 1PRTF 1LTID 1LTGD 1PTOC 1JWMD 3O13A 4TSSA 1ESFA 1I4XA 1EEFD 1F77A 1FGBD 2TSSA 1LTRD 4RH6A 1I4QA 3GP7A 4RGNA 1BCPB 1EU3A 3BYYB 4DXGA 4L6TB 1BCPD 3BVGA 3DWPA 2XRSD 1GOZA 1PTOF 4DXFA 1LTSD 1TS5A 3DWAA 1CT1D 4NZLB 1LLRD 1TY2A 1T5XD 5ELCA 4O1NA 2IJ0A 3TSSA 1M4VA 3V05A 5FKAC 1KTKA 1LO5D 3BYTB 4K6LA 4RFBA 1V1OA 3SEBA 4BWGB 2CHBD 1V1PA 2AQ2B 1G8ZD 4RHRA 1DJRD 1TS4A 1LTBD 1LTTD 2J4XA 3KLSX 2XNAC 1HA5A 1JQYD 5D3DA 1D5ZC 1PTOH 1B1ZA 1D5MC 3R2TA 2RDGA 1BCPF 1SJED 1SXTA 1S5FD 1FD7D 1SJHD 3EFXD 5ELEA 4RCOA 3URYA 3BVMA 1LT4D 3CHBD 1LT6D 1D5XC 1PYWD 2SEBD 5TSSA 1SE3A 3EA6A 2XN9C 1TS2A 1EWCA 1PZKD 1L0YB 3MC0B 1CQVA 4L63B 1B44D 2G9HD 4RGOS 1SEBD 2XRQD 1S5BD 4ZYSA 1FNUA 1I4HA 1STEA 2AQ1B 1LT5D 1UNSA 5ELBA 1D6EC 5D3IB 1ET9A 1ET6A 1JWUD 1LTAD 1SE2A 1S5DD 1XTCD 1RF2D 1HXYD 1TS3A 1EFID 2IPKD 2R61A 1PZJD 1S5CD 2RDHA 2NTSA 1I4GA 1JWSD 1KLGD 1RCVD 3OWEB 1TY0A 1MD2D 1RDPD 1AN8A 3DWQA 1JCKB 4RGMA 1FNWA 3W2DA 1RD9D 3R2IA 1YN3A 2Z8LA 3BVZA 5ELFA 1SBBB 1XXGA 5FK9C 1JR0D 5ELDA 1YN5A 1S5ED 1HQRD 1UUPA 1FNVA 1PRTB 2O2LD 2WV6D 1CK1A 1CHPD 1I4PA 1PRTD 2QEJC 3BZDB 5I4DA 4UDUC 1I4RA 4OHJA 1DYQA 1AW7A 1PZID 2QILA 3R8BA 1CHQD 1PTOB 1V1PB 4Z9CB 1LT3D 4RGTA 2ICIA
chains in the Genus database with same CATH superfamily
5AZGA 1NJIC 3EFCA 2G9DA 1EOVA 1KAWA 3LWUA 1R4QB 1EF5A 1T9HA 1T0SC 2W9NA 2F52A 2R93G 1K8AC 1EL0A 1HFNA 3TCAA 4YTMB 1SR3A 2KDEB 2R93H 1X1MA 4DR2L 5HKHA 2LGYA 4XWTA 3UDXA 4ARIA 3JSVA 1D7QA 1Y8RC 1E7VA 1UZXB 1EU4A 3PO0A 3GZNI 4DBGA 4YWMA 1R4MI 4H0LC 5IWAL 4C3IG 1OEYJ 2E2HH 2A1AA 2R92B 4C3IH 2JYEA 1EY7A 4RGNA 3OMGA 3VR3A 3VA5A 3GTJB 3I4NB 4KHPL 2GBNA 3A9KB 1YJJA 1DOXA 1VQNA 1QWYA 4ZRZA 1KNAA 5JJIA 1RRBA 3UINB 1PHJA 1TS5A 1IZ6A 4OXPA 4LF5L 1K8GA 1ISNA 1R4NI 4C3JG 1JB7A 5M5XH 5KRUA 1YNTE 4RWSC 4EQ5A 1KDBA 5FLXL 2I1JA 5LMNQ 3DBLB 5D2MB 2FINB 3K8AA 5HGQA 2X6LA 5FKAC 2IY1B 2LVQA 4RFBA 3H3VI 1LACA 1V43A 4X65Q 2ZPNA 4QUCA 3SHQA 3SR6A 4ZKBB 1FCLA 2Z6KA 2L0FA 1WMHA 1IW7D 2ZT9C 2HUGA 2BPSA 4XQJA 1VZ8A 2O6VD 1F52A 1U0LA 3RMKC 5C1ZA 1MHWC 2K5HA 4FBJB 4HLEA 1VF7A 4XWWA 5IYBG 5M3FH 2R7FA 1DOIA 1SXTA 1WTWA 1XX8A 5G3LD 4DNTB 4DR6Q 3RZDB 3CSFA 5JEAH 3PV1A 3OJ3A 3RCZA 1JT8A 4OZCA 1O7IA 4LTUA 5LLIA 3TP5A 3OG5A 2LS01 2HDMA 1VQMA 5D94A 2X69A 2JA5B 3ZTDA 2M2LA 4KD3A 3TZUA 2IYDB 1B9RA 3G7LA 1QCBD 1EY9A 5IODA 3CC7A 3J81L 2A5HA 3UDIA 2ONQA 2JSOA 3HP3A 2LY7A 3HIZA 3PV0A 3U7DA 3RNFC 2NPTA 4A3FH 5D65A 1NR4A 3Q3OC 1H9MA 2IGGA 2J7ZA 1N36Q 4P74A 3MXPA 2BE5C 2IT1A 2WIIB 2GLSA 2A73B 2VL6A 1JJCB 5D3IB 5MPOA 3NWSA 2PO4A 4LF8L 2UXCQ 3N32A 5D6JB 5CHFA 2JEBI 2PQAA 1JWSD 2DZJA 1I5FA 4ZOHC 3RZWC 2EJFC 3PSEB 4FNFA 4X3KA 1A62A 4ID6A 4DR5L 2H88B 3X23A 1WWTA 3W2DA 1YN3A 2LFIA 1NENB 4HDQA 4IPCA 1XLNA 3QQ8B 4CHKA 1LYLA 4TV3A 1GHJA 3J7AF 4IZ8A 4YIJA 2JA8G 4PMCA 2VUMH 4W9FA 1S5ED 3HOZG 1UE7A 1OFFA 1HQRD 2JA8H 3QX1A 3AN1A 1SAPA 3CCSA 3E9SA 4A3KH 1B53A 2EQSA 4W9KA 1G91A 5E6OA 3P2BA 2K8HA 2BYVE 3Q69A 2PCFB 2L0CA 3ERSX 4JYAL 2FIFA 2GOWA 1RTNA 5J22A 3U7ZA 1B4OA 4HVBA 4QGUA 3G6EA 1HEZE 3AEAB 3BU2A 3QR8A 4LLGM 4C56C 4QF4A 4NXNQ 3S1RB 2KFKA 2BH2A 2BH8A 3VR2A 4NQLB 3DM1A 3LXFA 3ALBA 1FD6A 2AKWB 2FE8A 3ULLA 3Q0AA 4DR1Q 3SK4A 2E8GA 2WX0A 2H1EA 3U52E 1I4XA 1WTQA 1OXTA 3NPPA 5CGKA 1I4QA 5HY6A 1HQMC 5DNFA 3CCUA 3K0XA 3GE3C 4K0KL 4M01A 2MBQA 2KCMA 2EYMA 1QVGA 2E2JH 3A1QA 1IYFA 3BVGA 1YOVB 4W9EA 3TL5A 2PPHA 1YD8U 1Q90A 1MJCA 4DGZA 4A3EB 1WX8A 2BDNA 4LFAQ 1TKYA 2KDFB 2HHHQ 4FHKA 1FRDA 4LK0M 3W1GA 3LWEA 4QMGA 4RKBA 1GHKA 1BT0A 5LXHA 3NUCA 1L0VB 4NAWB 3PO2B 1BVSA 2CHBD 5CTRC 4RHRA 1SDFA 2Z1CA 2JA7B 3S2HB 2ASQA 3CXCA 1J8CA 2KCTA 3V61A 2KHIA 5IT9c 3Q22A 2VB2X 1WD0A 3HRZC 2Z59B 1HA5A 1X3QA 1NAPA 2WP9B 4XIGS 4AYBG 4U673 2DYBA 5C0XG 1JORA 2PW9A 1XYIA 2PYKA 3CMMB 1RODA 3M7NA 1YI2A 1XCQL 5BR8Q 4FN2A 2UUBQ 2NB0A 2A68D 2KANA 3S16B 4NKLA 4C4VB 2WAQB 4AQ7A 2PI2E 3CIRB 1D5XC 5IAAC 4K14A 5KNDA 1GKHA 5TSSA 3SFEB 2KHJA 5CC4A 4X62Q 1XPUA 4L23A 1WCMB 3W1YA 1SYFA 4JV5L 1V6EA 1JMCA 3X0WA 2PW5A 3OMCA 4C2MB 1K52A 2JZ3B 2A8VA 4YSZB 2R92H 2MNAA 2EYPA 1WJ6A 4O2DA 1P9DU 3I4NG 4ZYSA 1SEBD 1GO3E 5GROA 4LW1A 3GTJH 4HK2A 3I4NH 1FNUA 1STEA 5HURA 3U58A 2R7ZG 4LAAA 1WR6E 1WGHA 4RNAA 3KLWA 4LF6Q 4LF9Q 2ZM6L 1KNEA 2MHJA 1BKBA 2RHQB 3PUWA 1GUWA 3IL8A 2OF1A 3CU7A 4H44C 4PZ6A 1QZHA 3FP9A 3NTKA 1JQ4A 4WORA 2ZW1A 3C0RB 2MBEA 3ZW3A 4DDGD 2KN4A 2FNJB 4ASWC 4KKUA 4ZLTF 2G4SA 3R2IA 5AZHA 2QHOA 3WDNA 3S17B 4MJSB 3KBGA 4NP5A 3D3RA 1YNXA 2V3PA 2SNSA 3AE9B 2LRWA 1GNUA 4TMAB 3T53B 3NS1A 4H7BA 3CSTA 3UE0A 2ZPYA 3D4DA 4OZAA 2LXKA 1LV9A 3NJTA 3NVZA 4DR4L 4DV7L 4KVGB 1ZOYB 3RZDH 1ICFB 2WACA 3C8YA 3VXWA 3H7PA 5C5MA 3Q3NC 5K36H 3A54A 1K0RA 4UY8C 2B63B 3HOXG 2JA5G 2NUCA 1I6VC 2E2DC 2BBCA 1AW7A 1CA5A 2JA5H 1F9SA 4JI8Q 1C79A 1VQIA 2JP1A 2UU9L 3UI2A 1V1PB 1XPOA 1H9SB 4Y7NB 1E22A 1NUCA 3MFYA 4IFDJ 1Q0WB 1CKNA 1PRTC 1OXXK 4EFOA 4J8QA 2DENB 2IZVB 3TP6A 3H9DA 4KZCA 4DDID 4W9IA 1K28A 3I72A 2L52A 1IBXA 2ZTDA 2UUAL 1JWBD 1WIAA 2WHIA 1O7ZA 3MXNB 3CPWA 3AE1B 2MHVA 4BOZB 4NY0A 3SXHA 3GTQB 4JI2L 2V9HA 2BYFA 1YX5B 5IGCA 2H4OA 4OELB 4DV0L 2K5NA 1ACCA 1B70B 1EOTA 3DBSA 1YJ1A 1L5PA 3HRDD 4L6TB 5IGEA 3HOUB 2IGHA 2F0GA 1WXQA 2GVBA 3MA2B 4QCLA 4IUNA 2MJDA 3UF8A 3KFUA 3SFDB 3J81i 1TXYA 2A6EC 4IURA 1GUTA 1TJEA 2FAZA 4TQ0A 1N33L 2JQRB 5I2YA 1G8ZD 3ZXRA 1C9OA 1WYGA 1N34L 1SNQA 4GN3B 2Z0EB 2OXPA 4GU2A 2M0AA 3QWZB 5LL6S 1RWSA 4X3UA 4XC2A 2XEWA 1AZPA 1WF9A 3T56B 3SVMA 2K22A 5GXGB 4K6DA 2N78A 4I65A 1VCIA 1QLBB 2B2TC 4GZYC 5E1FA 4HTHA 2C5CA 3WIMA 3FKIB 4FF4A 4OIJA 1A70A 2UWQA 3APFA 2LUEA 4L8JA 3MP9A 4OWXB 1LABA 1WXMA 1PLFA 3S1RH 5E6PA 1UAPA 1C0AA 1IBML 5HFYA 2B76B 4EZLA 5M3MB 4CQNA 5IOCA 4DUZQ 1VMCA 4DK3C 1UE6A 3S14B 3H6MA 1QUQA 1FEHA 4MGKE 2O4XA 1EWCA 3SK6A 5IP9G 1VJKA 4QIWB 1Q8IA 1PVOA 2GBMA 2OOBB 2HDLA 2QMTA 2KOXA 2YYZA 1VQ4A 3S1MB 2JSVX 5C6AA 4KHVA 1AFPA 4HMJA 2YVCA 4DR7L 3NG0A 4IM2A 1T0RC 1DD2A 4IUQA 4JBJA 4A3EH 1S5DD 4MH8A 1H9KA 1EFID 4DAMA 3L54A 2FUHB 3RMHA 2J53A 3NXWA 2PMVA 4DR3Q 4BS9A 1HNWL 2JZZA 1NY4A 5C44B 2RMMA 4MEMA 3PO2G 1WGGA 4DHZB 3PO2H 1XNRL 1IL8A 1SLJA 4MHEA 3RLFA 4JI4L 2JA7H 3T1YQ 3S2HH 4FLHA 4MM3B 3EBEA 2LZ6A 3ZJUA 2Y0SE 4DV6Q 4GNXC 1RJTA 2FXQA 2DBYA 1TQOA 4K2LA 4RF1A 1HJPA 1HUMA 1CZGA 2A69D 2ASBA 2RGFA 3J81E 1B7YB 4WWPA 1U4LA 3B08A 1P7EA 4LUOA 2KECA 4DR2Q 2WAQG 1B3QA 1GUSA 3OIQA 4B3SL 3S16H 3PO3B 2LJIA 3I5JC 2PZUA 1SROA 3HKZE 2BDOA 5M9OA 2IX3A 4WWOA 4ZRQA 4KD4A 2XK5B 2F0MA 4HSPA 4A3CH 5EKIA 1WCMG 1PQSA 4B0MA 1A63A 1WCMH 3K58A 1VQLA 3VR4A 5EPJA 2PQEA 4J6HA 2RPQA 4C2MH 3S15B 2NZ1D 4NNJB 4RHSA 2I5MX 1FYCA 5CHVC 4IKGA 5DPTA 2LEKA 1X9NA 2WDRB 3RD2A 1NI3A 1D8LA 4MGYE 2NVQB 2D3CA 5JJLA 2DGYA 4KHZA 2KK8A 4IQZA 4GB9A 4BY1B 2XGTA 1MHXA 1L7YA 1HHVA 3FILB 3HGBA 2BB5A 1JWAD 4M8MA 3V6CB 4GN1A 5L83A 3Q8BA 4ARCA 2INDC 2E76C 4DK1A 1RKNA 2I5HA 1VQEA 1F2MA 3KUPA 1Q12A 4CKBA 2EYJA 5IGDA 1Y56A 5FR6A 1T5XD 3F2BA 4F87A 2BYEA 2KT7A 5G2NA 1XMOQ 3E0EA 5C0XJ 3KW5B 3SEBA 2CVRA 2KJ6A 3IFWB 2VQFL 1MVKA 5C4XG 2D11A 2NBFA 2LWPA 2RR9A 1KDCA 3PRMB 4XQQA 3CCJA 2K04A 2CCZA 1LTTD 2B63H 1OQRA 4LFCQ 2WDTB 5E3FA 3KLSX 3VR6A 4ZHOA 5J39A 4K8IA 1K83H 2IO3B 2Y5CA 5CHWA 4EVOA 3K5OA 2MX2A 2ON8A 1KHIA 4Y7NH 4NAMA 2EJMA 3A33B 1IXRA 4YHHQ 2AYOB 3J7ZC 1SMYD 4DN4M 3ABVB 2GMIC 1UWVA 3PSIA 3AM9A 1K8OA 1K9MC 4A6QA 3AE5B 2BWFA 4IWPA 3P20A 4XQNA 2ZXOA 5DM63 3C3LA 4LFBL 1FGUA 3A56A 1CSPA 3I3CA 3F2DA 3PIOA 4BA1I 4JW0A 5CV5A 1H95A 4YCWA 2ATWA 1MSHA 1NDDA 4B6WA 2OT2A 4MIUA 1STYA 4ZK9B 2QGQA 3GTQH 4C00A 3UIOB 3E3XA 4L63B 2NZOA 3RD4A 4AJYB 4ZUIA 1H4RA 1I4HA 3VYUA 1UF0A 4QUFA 2ICEC 1BF4A 3PIO3 3A4SC 3HOUH 5ELBA 2M00A 1BBUA 4AH6A 4GGQA 4OEMB 2PEAA 1JWUD 1W6JA 1O7LA 1VZ7A 4KGSA 3VH3B 1E8ZA 1O7YA 1H9RA 1VQGA 1MD2D 2VB3X 5D14A 1Y14B 2LSSA 2MO0A 3I70A 4OO1G 2ZVOA 4H02A 2Y3AA 1G2TA 2PVGC 3GDEA 4OO1H 3QA8A 3Q8EA 4JYAQ 2DLBA 4A3PA 1NI2A 5IP4D 5IE8A 5COYA 3OOCA 3HEJA 5GQOA 3Q3MC 1X3GA 1DONA 4PYZA 2R2OA 2CKHB 1PFBA 2CS4A 1F2LA 3FKIH 1FM0D 2I1KA 3BZDB 3WAOA 1D1IA 3BS1A 3A8JE 1IBLQ 3OWFA 5BN3A 2CW0D 5M3MH 1N32L 5M5YB 1TU2B 2B39A 3I56A 2FCSA 3S14H 3HS0C 4KMUC 5EPKA 1PTOB 4BA2I 1F9RA 2KA7A 1WR1A 1WM2A 4TUUA 3TUOA 2ICIA 5F2DA 1IGDA 4K0KQ 3UQBA 2AQ3B 2EPBA 3RN2A 4GOPB 4DV2L 1WMHB 2MA9B 4HJ7A 4GS3A 2NTTA 3MXGA 3S1MH 2K6DB 1XCTL 1QILA 1TZ1A 2HJ8A 5E6JA 3V6EB 4G7ZC 2Q2UA 1V1QA 3DLLA 5IYDG 3S2DB 1E7ZA 2X8XX 4C3JB 1F9QA 2JWZA 2K32A 3F2CA 5C44G 1JWMD 5C44H 1FJGL 3OIPA 4LJPB 3W5VB 1EYAA 2EIFA 1X6OA 4HKZE 2RSOA 1YIJA 3STBD 1WGDA 2ZJDA 2QW7A 3QWNA 2GI9A 1IW7C 2OEOA 1VQ5A 3HG9A 5DLQE 1WRIA 4Q5VA 2DAJA 4W9CA 4HSVA 1LLRD 1U4PA 4G11A 4JQWC 3ND8A 3V05A 3K80C 4I7ZC 3ULJA 1YQ4B 3M7GA 3KWLA 3BDOA 2LRUA 2PVOD 5J2RA 1LM8B 2LXAA 3DQVA 3PO3H 1TS4A 2R3ZA 3IFDA 1EIHA 5IY0A 3VDZA 1ZXTA 1ZXHA 4MTNA 3HZXA 3RLOA 2A5UA 2VH1A 2BCOA 1SB3C 3VYSA 1O80A 4K81A 4YSXB 3PUZA 5I2XA 3KJPA 1B9NA 3GTKB 2G1EA 1AP0A 3N3KB 4ANUA 3R2TA 3S15H 2LVOA 1SJED 3APCA 3NVWA 3IXSA 4R8IA 2CU3A 1QVFA 1WTHA 4DV3L 4WWMA 2EKIA 2D3AA 4ZRPA 1EO6A 1AE3A 1HTOA 3CF5A 2ZM6Q 3S1NB 2OQKA 4N9TA 2K6QA 2NVQH 2LXCA 4RM8A 1F2RI 2GRIA 4MSQB 4IG7B 5AEKB 5K5PA 3K57A 4WQMA 2YV5A 3EA6A 4BY1H 2UXDQ 1UD7A 1V81A 5EE1A 3MJWA 4K7SA 5D7GA 3U9OA 3EUB2 4II2B 2B2TA 1ZEQX 1HRJA 2AQ1B 2K5WA 4DV4Q 3M3JA 1WJ4A 2F0NA 4PNYA 4TKOB 2IY0B 3KDFB 4DR4Q 3HOZB 1ZKHA 1YQBA 1HFGA 3ECIA 4X66L 2IL8A 4DWFA 1I4GA 1L2FA 4OX9Q 3GTLB 4FDBA 2KFKB 2A74C 4TQ1A 3S9WA 1JCKB 4A76A 2N9KA 1A8VA 1U4RA 2CJOA 1RD9D 2FCNA 2UU9Q 3E9HA 2DNEA 2F0IA 3T8MA 3SK8A 4YTNB 4F7ZA 3FMCA 5ELDA 3HKZG 1YN5A 1E1OA 5CV8A 3A1QB 4YCVA 2CH4A 2F0QA 1Q8KA 4R8NA 4DXAB 4YWLA 1A2TA 1Q5WB 1PV4A 4K7UA 1GD7A 1DYQA 3TIXA 1NCVA 1VQBA 2NZHA 4N8X1 2L12A 1HNZL 4HXDA 3ZXVA 3TP8A 1J19A 3KUDB 1U9RA 2KBNA 2JRHA 1PTOD 3VR8B 3FRPB 4HJ8A 1ENFA 4P2CB 4UP8A 2JY6A 2QJLA 2DX5B 3RLNA 5IT9L 2CJNA 4XGAB 2MBOA 3CWIA 3VTVA 4L2YA 2INPE 4GDKB 3S2AA 2GBKA 2MEKA 4BVUC 1LTID 4J15A 2NYZD 3DHHC 1HTPA 4TSSA 5FLMG 3T1HL 1N33Q 4IM3A 1JW9D 3SK5A 2KC1A 3I8ZA 1G6PA 2ES2A 4XDDA 1EU3A 5ELOA 1VQKA 4DXGA 1TR5A 3J7A5 2DWQA 3BIID 4AS1A 2EVBA 2NVYB 4DXFA 4LK1C 3TS2A 3NS8A 3E56A 4FULA 3SU8X 3DWAA 1JB3A 2JT4B 2RPVA 2K14A 4AYBB 4WJOA 3ERQA 2H5XA 2QSDA 2CFMA 2CKZB 2IJ0A 3TSSA 1N9WA 1NMGA 1RYJA 1I6HB 1LGRA 2BW2A 2KTRB 2A68C 4MNOA 4JI7Q 1MGSA 2W3SA 5DPSA 2A6HC 2AQ2B 2DY8A 1E8WA 5IGBA 2DN8A 1LTBD 3NTIA 2AWNA 4ABNA 4XX5A 2K5VA 2ALYB 1M1KC 4B9WA 2J4XA 4ODGA 5CYUA 2HQLA 5M5YH 3L2PA 4IFDG 4IM0A 3RI7C 4US8A 2ZTCA 4GKKQ 1OQQA 1PTOH 1WE6A 1HNXL 2ZZPB 2ZXRA 1NBWA 3G6JB 2D3GA 1UGJA 3QARA 4MT5A 1VZ6A 1HH2P 4B3MQ 3N30A 4JGHB 1NEKB 3NP8A 1QT9A 1XMQL 4RCNA 2D3BA 2MJ3A 5FO9B 1TWHH 2EE1A 2R7ZB 1A15A 5C3EG 4OGQC 3IAM1 1STAA 5G5HA 3T3NA 1MBYA 4UAIA 3SDZA 2K9XA 1LT6D 2GA4B 2IDYA 3S2DH 1J6QA 4LF4L 4C3JH 2CHXA 2LHDA 3H7PB 2N9LA 3CMAA 4ZCKA 2WYQA 2YEPB 1XNRQ 1FFVA 1L0YB 2M19A 2NVXB 5C3XA 5IA7A 1YZ6A 4RGOS 1V9JA 1NNXA 3ZKJC 2LVPA 4CDDC 4KDIC 1WTPA 1I7HA 2BF8B 4J6IA 5JJKA 5G3LF 2L4NA 1QB5D 1CKNB 1VQHA 2EY6A 1SE2A 1Q1OA 1XTCD 2KJHB 1X32A 1ONLA 2MFIA 3JYUA 4KV2A 4REZA 4JK1C 4KN4C 3A5UA 2PMZE 5IYBH 3VYRA 4BY7B 2FBWB 4B3SQ 3OTOL 3ZNID 2YU9B 1IBXB 2B2WC 3DWQA 3NK9A 1PH7A 4WJ3M 1VQOA 4QL5A 3VYTA 5FOBB 1VQPA 1GJZA 1QNKA 2JVCA 3HOXB 1N60A 1WI5A 3R66C 1XNQQ 1T0QC 2E75C 3O65B 5FO8B 2F03A 3M62B 3GTKH 4IOIE 4HCPB 3H1UA 2Q2TA 4W9JA 4ACFA 1GVPA 1FNVA 1K3BC 4DFAA 4HPLB 2WV6D 1SE9A 5G5GA 1PMRA 1G51A 5IIFA 4FF3A 2HTME 2QF7A 4GDLA 3H7SA 4HCEA 1CHPD 1SNOA 4BBSG 1EFWA 1DOLA 3S1NH 2OTJA 2XIWA 1FFUA 3JW0X 3I73A 2Q2HA 1FCCC 5FR3A 1ILPA 3R8BA 4DNIA 5C3WA 1Y1VG 1WX9A 1E0BA 1XWEA 1CKOA 1LT3D 2MQHA 4Z9CB 3CC4A 4A93G 3WCQA 4JX1C 4F1SA 3D4RA 3AH7A 3P42A 2RBMA 2LMCB 2J52A 1HPCA 1PFMA 3EECA 4H2AA 1EUVB 4CKCA 3I4OA 4K3CA 2K5PA 2NBWB 4IWQA 2OWOA 1I35A 2VH2A 4HJ9A 2QCPX 1J5EQ 2O2VB 4HROA 2MBHA 4JBMA 1HZ5A 4ULLA 3HOZH 3V3XA 1JROA 4D2KA 4JBKA 1SYBA 2VQFQ 3GTLH 3D4WA 1FGBD 1KC8C 3WA0A 1P8LA 4K2KA 4XTCS 2D5GA 2DNCA 1ZXIA 3K7AB 2I0QA 1QUQB 4TKNA 2WQYB 1VDVA 1TT2A 5AJ3L 1TY2A 1ZYRD 3TDQA 1D2BA 4ILWA 1GB4A 4UHVA 1JALA 4A8XC 3P75A 1C76A 3M85A 1M4VA 3QOJA 5J1ZA 1XF5L 1LO5D 2KHSA 2XSCA 3BYTB 2ACZB 4G50A 4KKJA 4DHJB 4DNRB 3U8ZA 2FUG1 5AUIA 1GUOA 2BWES 1HE8A 3TJPA 3VR5A 1QKZA 3DWGC 3DOWA 1U4MA 4W9HA 2KOLA 3U4ZA 5T1GA 2JUOA 5LMUQ 3P4PB 4PMBA 2BYTA 1W2BA 1K73C 2BGFA 4JWSC 5I6WA 3HOYB 3AI5A 1S5FD 3PZ8A 2KMMA 3P4QB 2KVZA 3TREA 4FA6A 5CR3A 4KN7C 3AMUA 3EVQA 1WGRA 2DYOA 3A9JB 3K5NA 4M0WB 3A7AB 5KIXA 4HRSA 2QEXA 2IW3A 1VQJA 4LUZA 4X64L 1FMAD 4AUQC 1HCZA 2AL3A 4I6LB 3PLVA 1EQQA 1X65A 4AQYL 4A3LG 2C5LC 4A3LH 2G9HD 1PDXA 4HN7A 3AV8A 4ZRJA 3TBLD 2K28A 3Q8FA 4CJ1B 1UNSA 2NVYH 3SE0A 3C46A 5EE3A 2MJ8A 1EQRA 3PGZA 4FF1A 5C0XH 3BK1A 3GQBA 5C4JB 4B95A 2MQJA 3ZGZA 5EGTA 3IFTA 3AMZA 1MI2A 1I6HH 3PHXB 1RTOA 3H94A 1XLOA 1R9TB 2KTFA 3EFUA 3NVYA 4LNIA 3ER0A 4IJLA 2F0DA 1M90C 4HIKA 1N32Q 2LUMA 4BBNC 2SNMA 4BAXA 2GBJA 3Q3FA 1PFSA 4XE0A 4AOFA 3AE6B 1C4QA 5FK9C 2ZJQA 2KDBA 2L32A 3ZTCA 3I55A 3CQZB 2XTIA 1GUAB 3DM3A 3AULA 1ZKOA 4QJFA 2UXBQ 2C9WB 2HDEA 4NXMQ 1V86A 4IDIA 1IBKQ 4FJVB 4JI0Q 2R7ZH 3DHQA 1I4RA 4CDFC 4C80A 3I57A 2WP8J 3TEWA 4L5RC 4IN3A 5KYLA 2V1CC 1GC7A 2A19A 2NVXH 1WI0A 1WTXA 3H6NA 4WH4A 4JI1Q 2QC8A 3I3TB 3HM3A 4FYDA 3KVFB 4I6NB 1SE4A 3BY4B 4BKGA 4UPAA 4LNKA 1DXMA 3Q2AC 1GUNA 1PFNA 1PA6A 3A4RA 1B3AA 2F1MA 2HTHA 2DJGC 2ENBA 2JYTA 2WB1E 4BY7G 3KJOA 5LL6X 1QE6A 5E4XA 5A2QE 3NE5B 4BY7H 4ZHPA 3E5SA 2YU9H 2J0MA 4PZ8A 1A6XA 5I9PA 2VW9A 5C4XB 4FJZA 2OJRA 1J0GA 4NW2A 4TRDA 2V3NA 1ENCA 2RCNA 1HZBA 2VQEL 3HOXH 3HM6X 1EY4A 4ANXA 3VRBB 3J80c 4IPGA 2K39A 3ML9A 3DMUA 1Y1WG 3K9PB 2BOSA 4EZJA 2L76A 5C0XI 1Z5SB 3KBXA 4KJNA 4R3DA 1Y8NB 4E6IA 1YHQA 1V8QA 1V1OA 1KIXA 3DPDA 2F0TA 1N63A 4KK7A 4DV1Q 5IT9E 4WFN3 3AE7B 3ETRA 4J3OD 4NPSA 4DHJD 1FXTB 2KQSA 1PXUA 4WURA 2DYMA 2EXDA 1NYRA 3N52A 4KY5A 2UUCL 2D2QA 5LHY1 2AX5A 3OW2A 5CBAE 2DZIA 1B1ZA 5L95C 3D6CA 1SYDA 4KLKA 4JCVE 4WWNA 3FEWX 4DUYQ 1I50B 1SJHD 3I91A 3PIPA 1T6BX 3RPFC 3RZOB 4A20A 3NQIA 1FO4A 2H89B 4C7YA 2KACA 4H13C 3UDGA 1HR0L 1E90A 1GJXA 5DEHA 3PHWB 3CHBD 3I4MB 1KOTA 2SEBD 2RD0A 4X66Q 4JI6L 3DBLI 3QOLA 3M4PA 1TS2A 4JI5L 4K5VA 1DM0B 1P1AA 2CH4W 1TTNA 1I42A 4BKSD 4B9XA 5ISRA 2JA9A 1GUGA 2F0WA 3K7AH 4YY3L 4YL8A 4HIMA 3ZO5B 2G5DA 2SDFA 4EE2A 4K5WA 1D6EC 4KX6B 5GMVA 3Q6BA 1PH9A 1KAAA 2X6GA 4CHTB 2R61A 1RFAA 3HUIA 4C1NI 2INCC 1HZ6A 3IVFA 1J7CA 3KQ4A 4PG3A 3TS0A 3ITPA 4P73A 4V190 1WJUA 1AN8A 1YHAA 4IW0A 5H1SE 3ZDTA 3J81j 1VD2A 1CMXB 1HUNA 3K9OB 4K3BA 3BJUA 2Z8LA 3VUWA 3LNNA 5KEEA 3QB3A 3P1MA 2VZAA 2CQAA 1JJ2A 2RA4A 4B9KA 1HNZQ 3LGJA 4JI3L 1JR0D 1XLPA 3B6YA 3HOYG 5IP9H 2ZW0A 5M5WB 1WM3A 1PRTB 3AE3B 2OQ0A 3HOYH 2M4NA 3IRBA 2JU6X 2Q5WD 4E3CA 4IUVA 3NBHA 2WXGA 3OSOA 2WXMA 2N88A 4QB4A 2B2WA 4A75A 1OGWA 3W1SC 3P63A 3ONAB 4CBVA 2NMQA 3J80E 4I7AA 3CMEA 2VRRB 3L13A 3L0WB 2DUDA 1YMHE 4ZAIA 1F9PA 2IY5B 3HOVB 2G45B 1LTLA 5JXVA 4B3TL 3OAWA 4XYCA 1QOBA 2Y5PA 2KWDA 2SAKA 4JG2A 4L5SA 4MELA 3M4YA 3N1ZC 2D5DA 1M8AA 1VS0A 4MN3A 1L0WA 4KY7A 2Q2IA 4B3RQ 3NZ3A 4A3BG 2LI5A 5E6NA 3QJZA 5C4JH 1Y69U 3MHZA 4BBNF 2WDVB 2Q8IB 2N49A 3NWTA 4PMWA 2VZKB 4US9A 2PPBC 5EAYA 3M4OB 3PREA 4L1BA 3F2UA 2RKSA 5JVH3 1R9TH 4BXXG 1UGMA 3D32A 3VDYA 4OVUA 3V60A 4P75A 1UH6A 1CUKA 2I38A 3DWPA 2WXJA 1KLVA 5IWAQ 1GOZA 1MSGA 4X65L 2CU1A 2IO2B 1LTSD 1CT1D 3AEGB 2PIAA 4ITKA 2NN6G 1YEZA 4QY7A 4LDTB 1WXVA 5J17A 1FXIA 2L05A 4R9WA 3CQZH 5KGUA 4KHPQ 2WXRA 4NJCA 5BYSA 1KTKA 2KCNA 4FXGC 4MACA 2WXOA 4XZ4A 5JPMC 1Z6HA 2C7NB 4LF5Q 2JA6G 1SNDA 1RHPA 2KQ4X 2N1VA 4J1MA 2XNAC 4NAWA 1JQYD 3LJ3A 2C35B 3DBHB 2M9VA 3GTGB 1IYUA 1QZEA 1SYCA 2PZWA 3E0JA 1UBIA 1YIWA 1FD7D 1YNNC 3EFXD 3H3VC 4WAFA 5A35A 4DAYB 3QIAA 1SIFA 1M94A 1PGAA 2F0FA 3MVVA 1BOSA 4RAUC 3S17H 2V4DA 1LT4D 1ZDVA 1ENAA 1X54A 4AWJA 1JRUA 2KC2A 4BOSC 1Y8OB 3U30A 1IKMA 2KD0A 2N7JA 1WGYA 1N36L 2N3SA 2Y0SB 1F0ZA 1A3TA 4ZYNA 2JE6I 1SIJA 1RM6C 2NR2A 2PLPA 3TP7A 3MZ5A 5C4XH 1AYFA 2EJGC 4JOIA 3TQYA 3ZJYC 4POGA 2EYLA 4GNXB 2RQXA 3N1XC 1TWGB 2JXMB 1WE7A 5IP7G 3M63B 1RF2D 2IPKD 3HKZB 5IP7H 3VA7A 4FJYA 3QAQA 4APVA 2D07B 5EE9A 2K05A 1SRUA 3PUVA 4A90A 1TY0A 1IP9A 5GAEC 1MG8A 3KF8A 3MAQA 2R7DA 1E5WA 3L10B 1E8XA 4DAVA 2V4IB 4WJQA 4LF8Q 3H8HA 4E71A 2B2VC 2KENA 3VUYA 1PGBA 3T51B 3P1HA 1JJGA 5E7NA 1WOCA 3GZNB 4DR5Q 1AZQA 2MCNB 4DQOC 4C7ZA 5T1IA 1UUPA 1WFQA 3AB5A 4KGRA 4JLCA 5BMIA 2YLMA 1I50H 2J0TD 1MJEA 3RZOH 2MP2A 1PRTD 1SYGA 1ML0D 4GOPC 1ILQA 2L0TA 3IAS1 4KSKC 1BO0A 2KWCA 3I4MG 5CORA 3UQAA 2F3VA 2MBBB 1UE1A 4DU9A 4A3GB 1F2ZA 3CAMA 4BBRG 1DOYA 1R4NB 3ZNHB 4XXEA 2DNFA 1YQ3B 1BBXC 2IHFA 1EUJA 3JSVB 2AEHA 3B1LX 1YVCA 5T8IA 4DR1L 4A55A 1Q1EA 4UP7A 3W5OA 1H9SA 2LGSA 5AJ3Q 2EMTA 3UDFA 3OJ4B 5IYCG 3GTOB 2RF4A 1R7SA 3QG1A 2BT6A 2HE7A 3MJ5A 3ML8A 2RSUA 3O13A 2WFWA 2L1AA 5KYIA 1EEFD 1F77A 2JK8A 1LUZA 2A6ED 3JAMc 3ZJVA 4LFAL 1EF1A 3MXNA 2HHHL 3ZLZA 1BCPB 2PNHA 2VZKD 3BYYB 3X3MA 1L1OC 2HT1A 2E2IB 3WAMA 1OTRB 3NENA 4ZRIA 2B3GA 4GOCA 4NPNA 3FDTA 5M5WH 4MGZE 1C4PA 3DVGX 1EZ6A 4LJOB 4R4IA 2WU5B 1PH5A 4LDTD 3OPOA 1OO9B 4BWGB 3NHHA 4DPGA 1KRHA 3ND9A 3HHMA 5C3EB 1X56A 3SGIA 4FXKC 2KAJA 3CC2A 3MHSD 5BR8L 2UUBL 3R3MA 1CJEA 4A3JG 1MHHE 5IYDH 3M95A 3QHTA 1ICWA 1EQVA 1WSPA 1ZGUB 3NY5A 3HOVG 2OJWA 1HZAA 3FAHA 4WJWA 3HOVH 3H09A 2HIXA 1HTQA 2BS4B 3ENEA 2JWUA 1EY0A 4X62L 3EROA 2PTLA 2FMMA 3WAPA 3CF6E 1CSQA 3TEYA 3CPFA 2IBIB 4B0EA 2WNMA 2KLGA 2NPTB 1A0IA 1WYWB 3NVVA 4LF6L 4LF9L 2WXIA 2EYOA 3S24A 3AEFB 1ASYA 4UP9A 3RR5A 3M4OH 4RKLA 4HKQA 1V49A 2XRQD 1Q81C 2DHZA 3AE4B 5I9OA 4OO1I 2PQAB 2V0GA 2K0PA 4WJPA 2Q8RE 4JV5Q 3CRLC 1Q46A 4ZKCB 2ZJPA 2KX3A 3D8GA 2AL6A 1ET9A 2XWBB 1YJ9A 4KJOA 1VQFA 3E9IA 4II3B 4EQPA 1IUEA 3E6ZX 4GLSC 1RCVD 1ZE3D 4HPPA 1E10A 3DHIC 5M3FB 4YCUA 4BBSB 4RGMA 1FNWA 1SMXA 1Y8PB 1WYDA 4W9GA 1STNA 3L9AX 3ICEA 1Z2MA 3PPAA 4F88A 4ICUA 4G57A 1Y1VB 2KEDA 3H91A 3ZJTA 1A5RA 2MRPA 4O42A 3GTGH 4L5QA 4A93B 2QIEB 4JC0A 5BYQA 1X3PA 2V1YA 3JAME 3LYYA 4XT3B 5KNBA 3VAWA 4JI8L 1AEXA 1S3OA 2Z6BA 5HHDG 3U4EG 1WY8A 2F4IA 3EJIA 3DXJC 4DKAC 1C1YB 2MLBA 4PS8A 1X3FA 4UDUC 4NQKE 4GN4B 2RDBC 1MI0A 4V0BA 2GN5A 5BMHA 3A74A 1LM0A 1KJTA 4RM9A 1DGSA 4DV7Q 2BS3B 3GTPB 2Y0SG 3AU4A 3L17A 3VTUA 3DEPA 4RGTA 2IX1A 5IO9A 4IUUA 1GM5A 4C1NK 4LJZC 3UI3A 3UGBB 1E2ZA 3WANA 5FJ8G 2LFNA 4K5XA 1F1HA 3PT2B 3VR9B 2EYFA 1YJWA 1WTRA 1HTLD 1S40A 5JHBA 2C60A 4JWUC 2FHTA 4S3SA 1TWGH 2WINB 1BXTA 3Q8DA 5A2QL 5GADC 3W9CB 3W1SA 3U2SC 2ZNVC 3F1ZA 1MFWA 1IGCA 4RH6A 1CKMA 2IX0A 2UUAQ 1UWXA 4MZ9A 2AHOB 3BDLA 4DK0A 3AEBB 2LHEA 3I9V1 4IALA 1Z9FA 1BCPD 4JI2Q 4USAA 1PTOF 4NB3A 2R2QA 4DV0Q 3FILA 3GD7A 2KVMA 1MKHA 1K51A 5JHAA 4KIKA 1JE5A 1XTDA 3Q6SA 1STGA 2MPMA 3IHPC 2EYHA 2L55A 2L83A 3RZFA 2J0JA 4JPSA 1STHA 3C19A 2EY2A 2CHZA 2CR5A 4HIOA 4A3GG 4OZBA 2FMCA 2WXNA 4P6VF 4A3GH 4NJ7A 1XJVA 3NTHA 1CQFA 3DBHI 3M9BA 1SNPA 5FLMH 2RDGA 4DUZL 1N34Q 4FXDA 1BBWA 4LWCA 2F3IA 3RN5A 1W6KA 4LNQA 3H0GG 2KJRA 4K1RB 3K5LA 4MTKA 3Q8AA 1TYGB 3QO2A 2BB6A 2OHFA 2EZVA 4Q2JA 4G0NB 2GVAA 1EY5A 3GTOH 4HJGE 4PK1A 1E2WA 3AXCA 1STBA 2N9EB 3FVQA 3R93A 3VTWA 2DAFA 1IBMQ 3PZ7A 5EJWA 4WJ4A 1S5BD 5EBCA 1G6ZA 2KXJA 3A8IE 4DR3L 1U4AA 2VY3A 2M56B 2WXFA 3GO5A 2WX1A 4XDXA 1QG7A 3PVLA 3HVZA 4IFDH 2AWTA 1NE3A 2E2IH 3NEMA 3T1YL 2EKEC 3AQQA 5DM73 4DV6L 1NBFC 3BK2A 1PH4A 4P72A 4DR7Q 1WX7A 2GB1A 2MW5A 2MWSB 5IOIA 3J9CA 3EHVA 5C3EH 4A9AA 1BR9A 4DV5L 2KEEA 1UWMA 1HNWQ 3PZDA 1KQSA 1K8RB 1V80A 2I2YA 5BN4A 1PFDA 4X3SA 3A8KE 3IBEA 3D6WA 1AE2A 4K7WA 4JI4Q 1JOQA 4CDEC 4B3TQ 3DVNU 3EC8A 2UU7A 5IN7A 3QIJA 2L15A 2C7MB 4MDKE 2PJHA 2K52A 2QEJC 1C8CA 3CCLA 5CBEE 4ANWA 3J80L 3ZNZB 4BFRA 4IJHA 4DF7A 4YXDB 2K75A 4OVVA 2BKRB 2K1FA 3W3AA 1LXDA 5TR5A 4IUMB 3B2GA 1V9PA 4FXCA 3KF6A 1A3UA 2B2VA 5CMDA 1DZ1A 2DY7A 4OVZA 2M0XA 3Q8CA 3R7QA 2RDFA 5KHQA 1EIFA 3AFQA 5EKKA 3R3OA 3K7UC 1NSNS 3MXUA 2PE9A 4U68A 1OTCA 4WJNA 5ELNA 2OCEA 1Q3LA 1L0XB 2WLBA 3A0JA 2KCCA 3DHGC 3T3OA 5C2TB 4GOPA 2K4KA 2ZEQA 5KNCA 4RG1A 1C7YA 1J8IA 3GE8C 2PW7A 1Y1WB 3GS2A 4ICVA 1JMLA 3C1EA 5M3FG 2K5DA 1LTRD 4I6PA 4IWOA 4JBWA 2L1BA 1YNJD 2QDFA 3KYDD 4BBSH 5JEAG 1WJNA 2AWOA 1QF6A 3L4PA 1XMOL 4F8MA 1N6ZA 5FO7B 4ANVA 1CFMA 2HD3A 1P7FA 1MIUA 2XRSD 2EY1A 1H8CA 1RFKA 1Y1VH 4IFDI 1XT9B 4A93H 4CJ0B 4LMQD 4YSYB 4EOYA 4LFCL 3P4RB 1YHBA 2IO0B 2F0EA 3WWVA 3H15A 3TRZA 2EOTA 4YHHL 3ZNGC 3CCVA 4A3FG 1EY6A 1VQ9A 4XYOA 4Q0FA 3TMPB 1YITA 3NZUA 3U9SA 2W55A 4KZ0A 4AJWA 2JYOA 3A5ZB 3DBRB 3GTPH 4ZQ3A 4HJAA 1QOFA 1L1OA 2LJ5A 1RIPA 4EZKA 3DEOA 2E6XA 1CM9A 2WXKA 2N55A 1EYDA 3VFKA 1YX6B 1CZPA 2F0VA 3KLSA 2PMZB 4GKJL 3QC8B 4HAEA 4TQUS 2Q8TA 3PUXA 5JAVA 1TIFA 1T0YA 1PH2A 1QOAA 1S72A 4MSMB 1GPXA 3NBHB 3W5UB 5CV6A 3LDZE 2K8BA 2VUMG 1KRSA 4X6AH 3QJYA 4LFBQ 4W9LA 4A3KG 1J7AA 2KNBA 2AUJD 1Z7TA 2PKOA 2K01A 5CV9A 4EEWA 2L3ZA 3DVNV 2YTVA 1LTAD 2MP1A 2LD9A 5AFWA 3RT3B 4K8JA 4JOIC 4M00A 2O6VA 5IKCM 1PZJD 3PLUA 3L7ZC 3OYYA 2N9XA 2WAQE 2BA1A 5H92C 1KABA 1HA6A 2RSNA 3B2FA 1RAXA 3L0OA 1JE4A 1XQQA 3SD5A 3KDFA 5DCNA 1UEBA 3NELA 2CWAA 3CRKC 2BQQA 2YEPF 1C9FA 3BZKA 1MJDA 3D0FA 1IBLL 2KX0A 3I7FA 2O2LD 2NBVB 1E6EB 2KMCA 2F0UA 2NVTB 1OXSC 4A3IB 4P71A 4G4KA 3OLMD 3ZUNA 4LNFA 1IKLA 3KOJA 4OWTB 2KN5A 2D0PA 4FHJA 1EIYB 1TT5B 3OHXC 1CHQD 2A69C 3P7JA 4A3BB 1C3TA 2O5IC 3AYHB 2NVUI 2EDGA 1EIGA 2F4VL 2JXXA 1Q86C 4YWGG 1L4DB 1ZUD2 1N8RC 3L08A 5JPNC 4KSLC 1C77A 2ZJRA 2XBBC 1FRRA 1O78A 4RMFA 4GLVB 4DV2Q 3IAYA 4GN5A 4DK5A 2HCIA 3SDLC 3W1BA 2F0PA 1TVXA 3RN9C 4PZ7A 1K3RA 2B2UC 5DPRA 1A2UA 2Z9HA 3MEFA 3I2ZA 2JEAI 1PGXA 2W54A 2WXQA 4GDKA 2MSED 3DWMA 3P4SB 2KWUB 1VR9A 4Y52H 2B2YC 2JA6B 2A6HD 3B9JA 3UE1A 2LGIA 1Q1BA 2OTLA 1FJGQ 3FPUB 3ZIMA 5JOBA 1U5KA 3IT4B 2WWZA 4HEA1 4HWIB 3HOWB 2R92G 3TBIB 4OIKA 3BDCA 5HG2A 4OL7A 5I6YA 3T9LA 4ZDVA 2EELA 4GXBA 1HZCA 2KZRA 5JH5C 3SR1A 2KYWA 4YTPB 4C3HB 4HR7B 2KTRA 3MC8A 2G4DB 2Y5BB 3KF8B 5D3DA 1D5ZC 1EWYC 3K81C 3FKYA 3RNBC 1BUIC 1TBEA 1PH6A 2RVLA 1I94L 5EE0A 2IHEA 2UXDL 4NDXA 4LNNA 2V4LA 3URYA 1V5TA 1S1QB 1WFYA 1RL2A 3GB1A 1PYWD 1IYVA 2Z4HA 1DOKA 3D31A 4DV3Q 3A9KA 2F0KA 1Y1WH 2MP2B 4DV4L 3VH4B 1SMYC 3AU7A 5BYRA 4N9F4 3T16A 1G291 4HIDA 3RFZB 5FLXc 2JQOA 2MGSA 5C3JB 2HCCA 3J80i 5K36G 1P3QU 4OX9L 1LQBA 4JVZA 1PYSB 2LGDA 2N8NA 3FPPA 2QA4A 2DJFC 4N8FA 1F2RC 3VQIA 1D1KA 1PDQA 3S1QB 3PGEA 3BINA 4XDCA 1K83B 2RDHA 3DDCB 2ID0A 4XYQA 4DA2A 3KUCB 1X55A 4G3XB 3GTMB 2F0SA 4GIVA 1SFOB 1QQRA 4OONA 1GG3A 4N59A 1SNCA 1UELA 1KH0A 1A3VA 2N1WA 1PH8A 2NWGA 1KRTA 3CCMA 3KYCD 2BE5D 2GBRA 4QIWE 1ZP0B 5BN5A 1KFYB 2IGDA 4BBRB 2Z0DB 4WIPA 2L7RA 3JAML 3NSWA 4M8NA 1XEEA 1NMFA 5AUKA 1ASZA 1N62A 3PIP3 2KUMA 4JIOU 1CI3M 5AZFA 4KKSA 2I5LX 3AEVA 2WB1B 1IL2A 2K8CA 3J81c 1I3QB 2D9UA 3EN2A 2K50A 1TWCB 4KDLB 3VRAB 2E5LL 1II3A 3CCEA 4DHZE 1PZID 2YTYA 4W9DA 3JC66 1ROEA 4GMVA 3C2PA 2N7DA 3MFGA 4IC7B 3TEZA 4HEDA 1WD1A 2K1BA 2MUYA 3MEHA 4WQOB 3OW7A 1YN4A 2CW0C 5JEAJ 4IO9A 4KGTA 1OQYA 3AE8B 3Q3JA 2L00B 5JZEB 2MH7A 1JOKA 1PH3A 2LMCA 3Q24A 1XPRA 4YT0B 4LF7L 2FCQA 3GV3A 1ESFA 5J3BA 3AEEB 4HDOA 2O2VA 2MJEA 1FL0A 4PV1C 3TN2A 2WXHA 1QZGA 1SF0A 3ULPA 1WTVA 2KWVB 4JI7L 4A3JB 3T1HQ 2N7EA 2NCNA 1GC6A 2EXZA 4NZLB 5ELCA 1VQ7A 2W3RA 5C4ZA 4O1NA 3VHTC 4URKA 3G71A 5FLXE 3A55A 4K6LA 3STBC 1FVIA 4ALPA 4A3IG 2NVTH 1E1TA 4GKKL 2C9OA 1WGKA 1WXAA 1G2SA 4A3IH 3N9YC 3KWVA 3ZRCA 4PS7A 3G4SA 2CQOA 4B3ML 2WU2B 1N5XA 1V2YA 2L8JA 3RUIB 1SE8A 4R1JA 4JL9A 2J0KA 2BVCA 3RNGC 2D2CC 5HI1A 4A3EG 2D0OA 4A3BH 2N0SB 3DBRI 5H8YE 1D3ZA 1EWIA 5CV7A 2LGXA 1D5MC 2LXJA 2SOBA 2ZVNA 1FPYA 1Q10A 3L16A 1TZOA 3TZDA 5LMNL 3EIVA 1WVLA 4BXXH 3GV6A 2D62A 3PF4A 2JA7G 2AMCB 3PTFC 1HNXQ 2F0HA 1QOGA 1BMLC 2E74C 3AFPA 1XMQQ 2NN6H 2KQ7A 4KTAA 2ZXPA 1SE3A 3U4VA 3KH0A 4JE3B 3A9JA 1PZKD 4GLXA 4LUVA 3M3YB 5J18A 4CO7A 3T4AC 1CQVA 3RUZA 4M0WA 5CV4A 1BQQT 2M1MA 1SSNA 4DV5Q 2KLCA 3PS6A 5E4WC 1E3PA 3R7RA 1OXUA 4LF4Q 2JA6H 2M8SA 4DR6L 1L6VA 2OEDA 1Q82C 1BUVT 3EGRA 4BKSA 1C78A 4R4TA 4A3MB 4IOAA 1RLFA 1ZPSA 4CKEA 2BS2B 5DPWA 2WKDA 4A3CG 3G48A 2QDLA 4EGVA 1HXYD 1Q7YC 3VUXA 3QCAA 3Q14C 1S5CD 3LX0A 3HOWG 3BZCA 1VF5C 1TKWB 2NTSA 3HOWH 2MO1A 3OWEB 1XNQL 1AWDA 1FIQA 3I4LA 1RDPD 4PQXA 2C7HA 1P98A 3KUZA 3WOFA 4P7IA 2B8FA 1JC7A 1E0ZA 2F0JA 2AUKA 4HJ5A 3BVZA 5EBDA 3EQLC 4C3HG 3ONSA 4KY6A 5ELFA 4C3HH 1TKEA 3OTOQ 1TWFB 4FADA 4C4VA 3JVZX 1T5EA 2J7QB 1VQ6A 2QKIC 5IGGA 3K6OA 2UXCL 1VCBA 4MGIE 4FF2A 3Q23A 1C48A 4BZAA 3WALA 3HKSA 3U50C 3V96A 1WZ3A 2E3TA 4EUTA 2K03A 3MWYW 3ZQ4A 4KIKB 4OHJA 4KI0A 5BO4B 4P1CC 1PYBA 3PRPB 4R4CA 3HVDA 2DZMA 3BG3A 2KMAA 3BWUD 2QCZA 2A4ZA 1J5EL 1YJNA 3PQIA 4LCDE 1ESRA 3RNAC 1K8MA 4FO2A 4G7HC 2YTXA 4IUTA 1FXAA 3I63C 1GB1A 3V62A 3DCGA 1BCPC 2B63G 1EM7A 1X3EA 1V8CA 5GAGC 1F9JA 4OW0A 2VXWA 1EEID 1JICA 2V3SA 1VQAA 4EX5A 1PRTF 4QQBX 1R4MB 5C4HA 2L9HA 3S1QH 2NN6I 1SNMA 3WOEA 1LTGD 1PTOC 1QNUA 5JJZA 2ZCCA 4MJSA 1NVID 2KKCA 4HMIA 2FFKB 5GAHC 2Z6KC 3GP7A 3GTMH 4RF0A 1SFOH 5HGTA 1C4CA 2EMSA 2WXLA 4KKTA 4A3DB 1OXVA 3HFZB 1L6UA 3F8TA 5C23A 3I4MH 1WRDB 4PYUA 5LXIB 4NXNL 4BBRH 3V2TA 2INNE 5DAUA 3PUYA 4N58A 2PZTA 3J7YW 1K50A 2WB1G 1XD3B 4GKJQ 4S17A 3ZRFA 5LMUL 3H0GB 1V1PA 1I3QH 2B2UA 3ZYYX 1TWAB 4RA8A 5LNK1 1TWCH 3MTNB 2PI2A 3NUHB 1TIID 4FP5D 1J9OA 3HOUG 2B2YA 5IYCH 2BA0A 1NYQA 2K7VA 2R6GA 1N5WA 4F7XA 3PRZA 3K59A 2O5JC 3NOBA 1JRPA 1BDOA 3L3OC 4WAAA 5ELEA 2JJQA 1OEYA 4RMAA 2M17A 3GOEA 1VRAB 3AEDB 2VNUD 4WRDA 1KDAA 3JAMi 5EPLA 1QVCA 1SGHA 2JZPA 2ZCBA 3TEXA 3UIPB 2XN9C 5NUCA 2TMPA 1NR2A 4M1UB 4O0AA 4HCSA 2G3QB 1XO3A 4QAYA 2QDBA 4YWKA 1SSOA 1B50A 1B44D 1JOOA 2K3UA 2KQ3A 4BKTA 1S4ZA 1UEAB 3FKIG 3KF6B 4X64Q 1MG4A 3QK0A 1HR0W 2R93B 1B2TA 4N6EB 3MHBA 2RCFA 5L37A 4A3JH 1CA6A 1K53A 2EY5A 4FVMA 2B8GA 5M3MG 1ET6A 4AQYQ 1KF6B 1K0SA 1E9MA 1TS3A 4PS3A 4ME3A 1E2VA 2K33A 4XT1B 1AH9A 5KHOA 3AECB 2E2HB 1KLGD 2JXTA 4C3IB 1R4PB 1E7PB 3ZVVA 2Z0SA 3NQTA 1B9MA 2KDIA 1TWHB 1VMPA 2UXBL 1W3SA 4ZUJA 1PH1A 4NXML 1G6JA 1T3QA 1IBKL 2WGSA 1F2YA 4JI0L 1SBBB 4GDLB 4PT5A 5JVG3 1XXGA 3TMEA 4CJ2C 2HIVA 4A4IA 1KD1C 4IUPA 5M5XB 2F4VQ 1UBQA 3SHLA 2KVRA 3KK7A 1DOMA 3N6RA 1E8YA 4E74A 3AE2B 1N61A 4F8CB 1KM7A 1CK1A 3A7LA 1WXSA 1C4AA 3RNEC 4AP4C 2HJ1A 1S3SG 1VLBA 1VQDA 3PCOB 5I4DA 4KKIA 1YJIA 1EWHA 4JI1L 3MC9A 4B08A 4GSWA 1D4BA 2LASA 3RNUA 4M02A 4N9PA 2XVSA 3CD6A 4HJKA 2F0OA 3CKIB 3M3YH 2B3AA 2I07B 1SYEA 1UE5A 3KYHC 1YNJC 4IOCA 2JPHA 2RHSB 4R4OA 3X3NA 1BNZA 3PO3G 3RULA 3C1FA 4A3MG 1EYCA 1L1OB 4TVAB 4A3MH 1L2NA 1WH3A 5EDSA 4DAPA 1GXDC 1KLUD 3N20C 4X57B 4MM3A 1IHZA 4A3OA 2I46A 2TSSA 4EKUA 2KO3A 4A3FB 3VVWB 2D10A 4HPMB 3MTSA 1TWFH 3I90A 4DV1L 2X38A 1V5OA 1L4ZB 2CWPA 4BY1G 1I94Q 2XWJB 1J7BA 1ZW7A 2W82A 2XK5A 4LNOA 2VQEQ 3CCRA 5FJ8H 5LMNW 2WDQB 4HCNB 2BTEA 1P16A 1DJRD 1KL9A 1YNND 2CHWA 4POFA 2J42A 2O6VB 2JF5A 2KHWB 5BMGA 4DUYL 3IKJA 1VQ8A 2IWHA 5G55A 4ME5A 4M8AA 1ZYRC 2N9PC 4EQOA 3J7AV 1XLQA 2IO1B 5CX3A 1MPEA 3N1YC 2L5TA 2VUMB 3LB8C 1P0RA 2FCMA 2JA8B 1TKGA 1BCPF 3DUZA 4L5TA 3APDA 2WKCA 1EY8A 4A3KB 2BKFA 1WTOA 4RCOA 3DVGY 1YBYA 5IGFA 2KJXA 5EKLA 4AYBE 2UUCQ 3FC4A 3BVMA 2N4FA 1CTMA 5EQ0A 1WZ0A 4MH0E 3IG3A 1H9JA 1AARA 4OWWB 2ZTEA 4ZRKA 4DAYA 3CW2C 2FJ2A 2WS3B 2PNRC 4S0RA 2F0LA 3TEHB 1LFDA 3MC0B 1HR0Q 1EYGA 2KFJA 1QOHA 2HQEA 4A3DG 4P16A 2PE6B 4X3TA 3CP0A 4A3DH 3NZSA 4JI6Q 3CCQA 3KLRA 1VDZA 3T13A 1LT5D 3B0AA 1B8AA 2LKVA 3PF5A 1EZ8A 4JI5Q 1Z47A 4IPHA 2JRIB 4GLAC 1VQCA 3NHEB 1V97A 2L11A 3IT6B 2KDMA 2WXPA 1WJJA 4CGYB 1KXLA 2NBUA 4YY3Q 2NS5A 3RYTA 3H3VH 5C5LA 1IPGA 1E7UA 4GNXA 3K0YA 2F3WA 1CZWA 4IPDA 3H0GH 2JX5A 1SN8A 4KV6A 2E2JB 1TWAH 2E5LQ 3AU5A 2UYZB 1ZDXA 1NTGA 3K5MA 1IYJB 3ZDMC 3NBIA 2Z4IA 4CYEA 4DK6C 3NRZA 3M4QA 4JPBW 4CDCC 3PMFA 2HD5B 3RNCC 3HK0A 1DGJA 1QJOA 1DCZA 1I4PA 1HZ9A 2K6AA 1TGZB 4JI3Q 1FR3A 1PUTA 2FIDA 2REXA 2P5ZX 4NMZA 4R4QA 4G7OC 2DZKA 4EQNA 2QILA 2B29A 4LF7Q 1GAQB 4NJ6A 4AIMA 2K5QA 2ZNVB 4P1BC 3FHWA 1E24A 1EQTA 2VS1A 2K25A 4B3RL 2JN4A 3AB9A
chains in the Genus database with same CATH topology
2G9DA 3LWUA 5E6JA 1R4QB 1HFNA 1EL0A 4YTMB 4XWTA 4ARIA 3PO0A 1EU4A 4H0LC 4C3IG 2R92B 2JYEA 1EY7A 4RGNA 3OMGA 3VR3A 3VA5A 3GTJB 3I4NB 1YJJA 1DOXA 1QWYA 4ZRZA 1KNAA 1TS5A 4C3JG 1YNTE 5KRUA 4RWSC 5FLXL 1KDBA 2FINB 2X6LA 5FKAC 4RFBA 1LACA 1V43A 3SR6A 4QUCA 1FCLA 4ZKBB 1IW7D 2ZT9C 2HUGA 4XQJA 1VZ8A 4XWWA 1DOIA 1SXTA 1WTWA 1XX8A 5G3LD 4DNTB 3RZDB 5JEAH 4OZCA 4LTUA 3TP5A 2LS01 2HDMA 2X69A 2JA5B 2M2LA 4KD3A 3TZUA 1B9RA 3G7LA 1QCBD 1EY9A 5IODA 3J81L 2A5HA 2ONQA 2JSOA 3HP3A 2LY7A 3PV0A 5D65A 1NR4A 1H9MA 2IGGA 2J7ZA 3MXPA 2BE5C 2IT1A 2WIIB 2A73B 5D3IB 5MPOA 3NWSA 2PO4A 2JEBI 1JWSD 4ZOHC 2EJFC 4FNFA 4X3KA 4ID6A 2H88B 1WWTA 3W2DA 1YN3A 2LFIA 1NENB 1XLNA 1GHJA 3J7AF 4IZ8A 4YIJA 4PMCA 1S5ED 1OFFA 1HQRD 3AN1A 1SAPA 3E9SA 1B53A 1G91A 3Q69A 2PCFB 2L0CA 3U7ZA 1RTNA 5J22A 1B4OA 1HEZE 3AEAB 4LLGM 4C56C 4QF4A 3S1RB 3VR2A 3DM1A 3LXFA 1FD6A 2FE8A 3Q0AA 3SK4A 3U52E 2H1EA 1I4XA 1WTQA 1OXTA 3NPPA 5CGKA 1I4QA 1HQMC 5DNFA 2EYMA 3BVGA 1Q90A 4DGZA 4A3EB 5H92C 2BDNA 1TKYA 1FRDA 4LK0M 3LWEA 4QMGA 4RKBA 1GHKA 3NUCA 1L0VB 4NAWB 3PO2B 2CHBD 4RHRA 1SDFA 2Z1CA 2JA7B 3S2HB 3Q22A 2VB2X 1WD0A 3HRZC 1HA5A 1X3QA 1NAPA 2WP9B 4XIGS 4U673 5C0XG 1JORA 2PW9A 1XYIA 2PYKA 1RODA 3M7NA 1XCQL 2NB0A 2A68D 3S16B 4NKLA 2WAQB 4AQ7A 3CIRB 1D5XC 4K14A 5KNDA 3SFEB 5TSSA 5CC4A 4L23A 1WCMB 1SYFA 2PW5A 3OMCA 4C2MB 1K52A 4YSZB 2EYPA 4ZYSA 1SEBD 4WQMA 1FNUA 1STEA 5HURA 4LAAA 4RNAA 1KNEA 3PUWA 1GUWA 3IL8A 2OF1A 3CU7A 4H44C 3NTKA 1JQ4A 4WORA 2ZW1A 2KN4A 4KKUA 4ZLTF 3R2IA 3WDNA 3S17B 3KBGA 4NP5A 3D3RA 2V3PA 2SNSA 3AE9B 4TMAB 3T53B 3NS1A 4H7BA 3D4DA 4OZAA 1LV9A 3NVZA 1ZOYB 3C8YA 2WACA 5C5MA 5K36H 3A54A 2B63B 2BBCA 2NUCA 1I6VC 2E2DC 1AW7A 1CA5A 1F9SA 1C79A 2JP1A 3UI2A 1V1PB 1H9SB 4Y7NB 1NUCA 3MFYA 4IFDJ 1PRTC 1OXXK 4J8QA 3TP6A 3I72A 2L52A 1IBXA 1JWBD 1O7ZA 3AE1B 2MHVA 3SXHA 3GTQB 5IGCA 2H4OA 1ACCA 1EOTA 1L5PA 3HRDD 4L6TB 5IGEA 3HOUB 2IGHA 2F0GA 1WXQA 3MA2B 4QCLA 4IUNA 2MJDA 3SFDB 2A6EC 4IURA 1GUTA 1TJEA 4TQ0A 2JQRB 5I2YA 1G8ZD 1WYGA 1SNQA 2OXPA 2M0AA 5LL6S 1RWSA 4X3UA 1AZPA 5GXGB 3T56B 3SVMA 2K22A 4K6DA 4I65A 1VCIA 1QLBB 2B2TC 4GZYC 5E1FA 4HTHA 2C5CA 3FKIB 4FF4A 4OIJA 1A70A 3MP9A 4L8JA 1LABA 5HFYA 1PLFA 1UAPA 2B76B 4CQNA 5M3MB 5IOCA 1VMCA 3S14B 3H6MA 1FEHA 5BMIA 2O4XA 1EWCA 3SK6A 1VJKA 2QMTA 4QIWB 1Q8IA 2HDLA 2YYZA 3S1MB 2JSVX 5C6AA 4KHVA 1AFPA 4HMJA 1DD2A 4IUQA 1S5DD 4MH8A 1H9KA 1EFID 3RMHA 2J53A 3NXWA 2PMVA 4BS9A 2RMMA 5C44B 1IL8A 3RLFA 4MHEA 4MM3B 3ZJUA 1RJTA 2DBYA 1TQOA 4K2LA 4RF1A 1HUMA 1CZGA 2A69D 3J81E 1U4LA 1P7EA 2KECA 1GUSA 2LJIA 3OIQA 3PO3B 2PZUA 5M9OA 2BDOA 2IX3A 4ZRQA 4KD4A 2F0MA 4HSPA 5EKIA 4B0MA 3K58A 3VR4A 5EPJA 2PQEA 4J6HA 3S15B 2NZ1D 4RHSA 1FYCA 4IKGA 2LEKA 2WDRB 1NI3A 2NVQB 4KHZA 4IQZA 4BY1B 1MHXA 1HHVA 3FILB 3HGBA 2BB5A 1JWAD 3Q8BA 4ARCA 2E76C 4DK1A 1RKNA 1F2MA 3KUPA 1Q12A 4CKBA 2EYJA 5IGDA 1Y56A 1T5XD 4F87A 5C0XJ 3SEBA 2CVRA 1MVKA 2NBFA 1KDCA 4XQQA 2K04A 1LTTD 1OQRA 5E3FA 3KLSX 3VR6A 4ZHOA 5J39A 4K8IA 2Y5CA 4EVOA 3K5OA 2ON8A 4NAMA 2EJMA 1SMYD 4DN4M 3ABVB 3AM9A 4A6QA 1K8OA 3AE5B 3P20A 4XQNA 2ZXOA 5DM63 3C3LA 3A56A 3I3CA 4BA1I 5CV5A 1MSHA 2OT2A 4MIUA 1STYA 4ZK9B 4L63B 3RD4A 4ZUIA 1I4HA 3VYUA 4QUFA 2ICEC 1BF4A 3PIO3 5ELBA 2M00A 1JWUD 1W6JA 1O7LA 1VZ7A 4KGSA 1O7YA 1H9RA 1MD2D 2VB3X 5D14A 3I70A 4OO1G 2Y3AA 1G2TA 2PVGC 3Q8EA 4OO1H 2DLBA 5COYA 3OOCA 3HEJA 1DONA 1PFBA 1F2LA 1FM0D 3BZDB 1D1IA 3BS1A 3A8JE 3OWFA 5BN3A 2CW0D 5M5YB 1TU2B 2B39A 2KMMA 3HS0C 4KMUC 5EPKA 1PTOB 4BA2I 1F9RA 2KA7A 5F2DA 2ICIA 1IGDA 2AQ3B 2EPBA 2NTTA 3MXGA 1XCTL 1QILA 4G7ZC 3S2DB 4C3JB 1F9QA 2K32A 1JWMD 3OIPA 3W5VB 1EYAA 4HKZE 2RSOA 3QWNA 2GI9A 1IW7C 2OEOA 3HG9A 1WRIA 4Q5VA 4HSVA 1LLRD 1U4PA 3ND8A 3V05A 4I7ZC 1YQ4B 3M7GA 3KWLA 3BDOA 2PVOD 1EIHA 1TS4A 2R3ZA 3IFDA 1ZXTA 1ZXHA 3HZXA 2BCOA 1SB3C 3VYSA 1O80A 4YSXB 3PUZA 5I2XA 1B9NA 3GTKB 2G1EA 1AP0A 3R2TA 3NVWA 1SJED 3IXSA 4R8IA 2CU3A 4WWMA 2EKIA 4ZRPA 3S1NB 4N9TA 1F2RI 2GRIA 5K5PA 3K57A 3EA6A 5EE1A 5D7GA 3U9OA 3EUB2 2B2TA 1ZEQX 1HRJA 2AQ1B 2K5WA 2F0NA 4PNYA 4TKOB 3HOZB 1HFGA 2IL8A 1I4GA 3GTLB 2A74C 4TQ1A 3S9WA 1JCKB 2N9KA 1U4RA 2CJOA 1RD9D 2DNEA 2F0IA 3SK8A 4YTNB 3FMCA 5ELDA 1YN5A 5CV8A 2F0QA 4R8NA 1A2TA 1DYQA 1NCVA 2L12A 3TP8A 3VR8B 1U9RA 1PTOD 3FRPB 1ENFA 4P2CB 2QJLA 5IT9L 2CJNA 3CWIA 4L2YA 2INPE 4GDKB 2MEKA 1LTID 2NYZD 1HTPA 4TSSA 1JW9D 3SK5A 3I8ZA 4XDDA 1EU3A 4DXGA 1TR5A 2DWQA 3BIID 4AS1A 2EVBA 2NVYB 4DXFA 4LK1C 3E56A 3DWAA 1JB3A 2RPVA 4AYBB 3ERQA 2QSDA 2IJ0A 3TSSA 1RYJA 1I6HB 2BW2A 2A68C 2W3SA 1MGSA 2A6HC 2AQ2B 2DY8A 5IGBA 2DN8A 1LTBD 3NTIA 2AWNA 4ABNA 4B9WA 2J4XA 4ODGA 5CYUA 4IFDG 4US8A 1OQQA 1PTOH 4MT5A 2ZXRA 3G6JB 1UGJA 1VZ6A 1NEKB 3NP8A 1QT9A 2MJ3A 4RCNA 5FO9B 2EE1A 2R7ZB 1A15A 4OGQC 3IAM1 1STAA 5G5HA 3T3NA 1MBYA 4UAIA 3SDZA 2K9XA 1LT6D 2GA4B 2IDYA 2LHDA 2N9LA 2YEPB 1FFVA 1L0YB 2M19A 2NVXB 5C3XA 4RGOS 1WTPA 1I7HA 5G3LF 2L4NA 1QB5D 2EY6A 1SE2A 1XTCD 1X32A 1ONLA 4REZA 4JK1C 4KN4C 3VYRA 4BY7B 2FBWB 1IBXB 2YU9B 2B2WC 3DWQA 3NK9A 3VYTA 5FOBB 1QNKA 3HOXB 1N60A 2E75C 5FO8B 2F03A 4IOIE 1FNVA 4DFAA 5G5GA 2WV6D 1PMRA 5IIFA 2HTME 4FF3A 2QF7A 4HCEA 1CHPD 1SNOA 1DOLA 2XIWA 1FFUA 3I73A 1FCCC 5FR3A 1ILPA 3R8BA 5C3WA 1E0BA 1XWEA 4Z9CB 1LT3D 3WCQA 4JX1C 3D4RA 3AH7A 3P42A 2RBMA 2LMCB 2J52A 1HPCA 1PFMA 4H2AA 4CKCA 2K5PA 2QCPX 4HROA 1HZ5A 4ULLA 3V3XA 1JROA 4D2KA 1SYBA 3D4WA 1FGBD 4K2KA 4XTCS 2D5GA 2DNCA 1ZXIA 3K7AB 2WQYB 1VDVA 1TT2A 1TY2A 1ZYRD 3TDQA 1D2BA 4ILWA 1GB4A 1JALA 4A8XC 3P75A 1C76A 3M85A 1M4VA 3QOJA 5J1ZA 1XF5L 1LO5D 2KHSA 2XSCA 3BYTB 2ACZB 4KKJA 4DNRB 2FUG1 5AUIA 1GUOA 3VR5A 1QKZA 3DWGC 1U4MA 2KOLA 5T1GA 3P4PB 4PMBA 2BYTA 4JWSC 5I6WA 3HOYB 1S5FD 3PZ8A 5CR3A 4KN7C 3AMUA 3EVQA 2DYOA 3K5NA 3A7AB 5KIXA 4HRSA 2IW3A 1FMAD 1HCZA 2G9HD 1PDXA 4HN7A 3AV8A 2K28A 3Q8FA 4CJ1B 1UNSA 3SE0A 3C46A 5EE3A 2MJ8A 4FF1A 5C0XH 3BK1A 3GQBA 5C4JB 3ZGZA 5EGTA 3IFTA 3AMZA 1MI2A 1RTOA 3H94A 1XLOA 1R9TB 3NVYA 2F0DA 2LUMA 2SNMA 4XE0A 3AE6B 1C4QA 5FK9C 2L32A 3CQZB 1ZKOA 2HDEA 4IDIA 3DHQA 1I4RA 4C80A 3I57A 2WP8J 3TEWA 4IN3A 5KYLA 1WTXA 4WH4A 4FYDA 1SE4A 1DXMA 1GUNA 1PFNA 1B3AA 2F1MA 2JYTA 2ENBA 5LL6X 1QE6A 5E4XA 5A2QE 3NE5B 4ZHPA 3E5SA 1A6XA 5I9PA 5C4XB 4NW2A 4TRDA 2V3NA 1ENCA 1EY4A 3VRBB 3DMUA 2BOSA 5C0XI 3KBXA 4KJNA 4R3DA 1Y8NB 4E6IA 1V8QA 1V1OA 2F0TA 1N63A 4KK7A 5IT9E 3AE7B 4WFN3 3ETRA 4J3OD 1PXUA 4WURA 2DYMA 1NYRA 3N52A 4KY5A 5LHY1 2AX5A 5CBAE 1B1ZA 3D6CA 1SYDA 3FEWX 1I50B 1SJHD 3I91A 1T6BX 3RPFC 3RZOB 3NQIA 1FO4A 2H89B 4C7YA 2KACA 4H13C 1GJXA 5DEHA 3CHBD 3I4MB 2SEBD 3QOLA 1TS2A 4K5VA 1DM0B 4B9XA 5ISRA 1GUGA 2F0WA 2SDFA 4EE2A 4K5WA 1D6EC 4KX6B 1KAAA 2X6GA 4CHTB 2R61A 3HUIA 4C1NI 1HZ6A 1J7CA 3KQ4A 3ITPA 4V190 1AN8A 1HUNA 2Z8LA 3LNNA 5KEEA 3QB3A 3P1MA 2CQAA 2RA4A 1JR0D 1XLPA 2ZW0A 5M5WB 1PRTB 3AE3B 2Q5WD 2JU6X 4IUVA 3NBHA 2WXGA 3OSOA 2WXMA 2N88A 4QB4A 2B2WA 3P63A 3ONAB 4CBVA 2NMQA 3J80E 1YMHE 4ZAIA 1F9PA 3HOVB 5JXVA 1QOBA 2Y5PA 2KWDA 2SAKA 3M4YA 2D5DA 1M8AA 4MN3A 4KY7A 3NZ3A 1Y69U 3MHZA 2WDVB 2Q8IB 3NWTA 4PMWA 2VZKB 4US9A 2PPBC 3M4OB 4L1BA 3F2UA 2RKSA 5JVH3 2I38A 3DWPA 2WXJA 1GOZA 1MSGA 1LTSD 1CT1D 3AEGB 2PIAA 4ITKA 2NN6G 1FXIA 4R9WA 5KGUA 2WXRA 4NJCA 5BYSA 1KTKA 2KCNA 4FXGC 4MACA 2WXOA 5JPMC 1Z6HA 1SNDA 1RHPA 2KQ4X 4J1MA 2XNAC 1JQYD 2M9VA 3GTGB 1IYUA 1SYCA 2PZWA 3E0JA 1FD7D 1YNNC 3EFXD 3H3VC 4WAFA 5A35A 3QIAA 1PGAA 2F0FA 3MVVA 1BOSA 4RAUC 2V4DA 1LT4D 1ZDVA 1ENAA 1Y8OB 1IKMA 2N7JA 2Y0SB 1F0ZA 1A3TA 2JE6I 1SIJA 1RM6C 2PLPA 3TP7A 3MZ5A 1AYFA 2EJGC 2EYLA 2RQXA 1TWGB 2JXMB 1RF2D 2IPKD 3HKZB 3VA7A 5EE9A 2K05A 4A90A 3PUVA 1TY0A 3KF8A 3MAQA 4DAVA 2V4IB 3H8HA 2B2VC 1PGBA 3T51B 3P1HA 4DQOC 1AZQA 4C7ZA 5T1IA 1UUPA 4KGRA 3AB5A 2J0TD 1PRTD 1SYGA 1ML0D 1ILQA 3IAS1 1BO0A 5CORA 2F3VA 4DU9A 4A3GB 1F2ZA 1DOYA 4XXEA 1YQ3B 1BBXC 5T8IA 4A55A 1Q1EA 1H9SA 3GTOB 1R7SA 3MJ5A 3QG1A 2BT6A 3O13A 2L1AA 5KYIA 1EEFD 1F77A 3ZJVA 2A6ED 3MXNA 1BCPB 2VZKD 3BYYB 3X3MA 2E2IB 3FDTA 1C4PA 1EZ6A 2WU5B 3OPOA 1OO9B 4BWGB 3NHHA 1KRHA 3ND9A 5C3EB 4FXKC 2KAJA 1CJEA 1MHHE 1ICWA 1EQVA 1WSPA 3FAHA 4WJWA 3H09A 2BS4B 2JWUA 1EY0A 3EROA 2PTLA 2FMMA 3TEYA 4B0EA 2WNMA 3NVVA 2WXIA 2EYOA 3AEFB 4RKLA 4HKQA 2XRQD 3AE4B 5I9OA 4OO1I 2V0GA 2K0PA 2Q8RE 3CRLC 4ZKCB 3D8GA 1ET9A 2XWBB 4KJOA 4EQPA 1IUEA 3E6ZX 4GLSC 1RCVD 1ZE3D 1E10A 5M3FB 4BBSB 4RGMA 1FNWA 1Y8PB 1STNA 3L9AX 4F88A 4G57A 1Y1VB 2KEDA 3H91A 3ZJTA 5BYQA 4O42A 4A93B 2QIEB 1X3PA 3JAME 3LYYA 4XT3B 5KNBA 1AEXA 5HHDG 3U4EG 2F4IA 3EJIA 3DXJC 4UDUC 1MI0A 4V0BA 5BMHA 2BS3B 3GTPB 3DEPA 4RGTA 2IX1A 4IUUA 4C1NK 4LJZC 3UI3A 1E2ZA 2LFNA 4K5XA 3VR9B 2EYFA 1WTRA 1HTLD 4JWUC 2FHTA 4S3SA 2WINB 1BXTA 5A2QL 3W9CB 3W1SA 3U2SC 1IGCA 4RH6A 2IX0A 1UWXA 3BDLA 4DK0A 3AEBB 2LHEA 3I9V1 4IALA 1BCPD 4USAA 1PTOF 3FILA 3GD7A 2KVMA 1K51A 3Q6SA 1STGA 2MPMA 2EYHA 2L55A 2L83A 4JPSA 1STHA 2EY2A 4OZBA 2FMCA 2WXNA 4P6VF 3NTHA 1CQFA 1SNPA 2RDGA 4FXDA 1W6KA 3K5LA 3Q8AA 1TYGB 3QO2A 2BB6A 2OHFA 2EZVA 4Q2JA 1EY5A 4HJGE 1E2WA 1STBA 3FVQA 3R93A 3PZ7A 5EJWA 1S5BD 5EBCA 1G6ZA 3A8IE 2M56B 2WXFA 3GO5A 4XDXA 1QG7A 3HVZA 4IFDH 5DM73 3BK2A 2GB1A 3J9CA 4A9AA 1BR9A 2KEEA 1UWMA 2I2YA 5BN4A 1PFDA 4X3SA 3A8KE 3D6WA 1JOQA 2QEJC 1C8CA 5CBEE 3J80L 4DF7A 3W3AA 3B2GA 4FXCA 1A3UA 2B2VA 5CMDA 1DZ1A 2DY7A 4OVZA 3Q8CA 2RDFA 5EKKA 3R3OA 1NSNS 3MXUA 4U68A 1Q3LA 1L0XB 2WLBA 2KCCA 3T3OA 5C2TB 5KNCA 1J8IA 2PW7A 1Y1WB 3GS2A 1JMLA 3C1EA 2K5DA 1LTRD 4JBWA 2L1BA 1YNJD 5JEAG 2AWOA 1QF6A 3L4PA 4F8MA 5FO7B 1CFMA 1P7FA 2XRSD 2EY1A 1RFKA 4IFDI 4CJ0B 4LMQD 4YSYB 3P4RB 2F0EA 2EOTA 1EY6A 4XYOA 4Q0FA 3U9SA 2W55A 2JYOA 4ZQ3A 1QOFA 3DEOA 2E6XA 1CM9A 2WXKA 2N55A 1EYDA 1CZPA 2F0VA 3KLSA 2PMZB 4HAEA 4TQUS 2Q8TA 3PUXA 5JAVA 1QOAA 1GPXA 3W5UB 5CV6A 3QJYA 1J7AA 2AUJD 1Z7TA 2PKOA 2K01A 5CV9A 1LTAD 2MP1A 5AFWA 4K8JA 1PZJD 3L7ZC 2BA1A 1KABA 1HA6A 2RSNA 3B2FA 1JE4A 3CRKC 2YEPF 1C9FA 2O2LD 1E6EB 2F0UA 2NVTB 1OXSC 4A3IB 4G4KA 1IKLA 3OHXC 1CHQD 2A69C 3P7JA 4A3BB 2O5IC 2EDGA 1EIGA 4YWGG 1L4DB 1ZUD2 5JPNC 1C77A 1FRRA 1O78A 3IAYA 2HCIA 2F0PA 1TVXA 2B2UC 1A2UA 2JEAI 1PGXA 2WXQA 2W54A 3DWMA 3P4SB 1VR9A 2B2YC 2JA6B 2A6HD 3B9JA 2LGIA 1Q1BA 3FPUB 5JOBA 4HEA1 3IT4B 3HOWB 3TBIB 4OIKA 3BDCA 5HG2A 4OL7A 5I6YA 2EELA 3SR1A 4YTPB 4C3HB 4HR7B 1EWYC 5D3DA 1D5ZC 1BUIC 2RVLA 5EE0A 4NDXA 3URYA 3GB1A 1PYWD 1IYVA 2Z4HA 1DOKA 3D31A 2F0KA 1SMYC 3AU7A 5BYRA 3T16A 1G291 3RFZB 2MGSA 5C3JB 2HCCA 5K36G 3FPPA 1F2RC 3VQIA 1D1KA 1PDQA 3S1QB 4XDCA 1K83B 2RDHA 2ID0A 4XYQA 4DA2A 3GTMB 2F0SA 1SFOB 1QQRA 4N59A 1SNCA 1KH0A 1A3VA 2NWGA 2BE5D 1ZP0B 5BN5A 1KFYB 2IGDA 4BBRB 4WIPA 3JAML 3NSWA 1XEEA 5AUKA 1N62A 3PIP3 2KUMA 1CI3M 4KKSA 2WB1B 1I3QB 2D9UA 1TWCB 3VRAB 1II3A 1PZID 1ROEA 3C2PA 3MFGA 3TEZA 4HEDA 1WD1A 2K1BA 2MUYA 3MEHA 3OW7A 1YN4A 2CW0C 5JEAJ 4KGTA 3AE8B 2MH7A 1JOKA 2LMCA 3Q24A 4YT0B 3GV3A 1ESFA 3AEEB 2MJEA 4PV1C 3TN2A 2WXHA 1SF0A 1WTVA 4A3JB 2EXZA 4NZLB 5ELCA 2W3RA 5C4ZA 4O1NA 5FLXE 3A55A 4K6LA 4YXDB 3P4QB 3N9YC 1WGKA 2C9OA 1G2SA 3KWVA 2WU2B 1N5XA 2D2CC 5HI1A 2N0SB 5H8YE 5CV7A 1D5MC 2SOBA 1Q10A 1TZOA 3TZDA 1WVLA 3GV6A 2D62A 2F0HA 1QOGA 1BMLC 2E74C 2NN6H 4KTAA 2ZXPA 1SE3A 4JE3B 1PZKD 3M3YB 3T4AC 1CQVA 3RUZA 4M0WA 5CV4A 1BQQT 1SSNA 5E4WC 1OXUA 3EGRA 2OEDA 1L6VA 1BUVT 1C78A 4A3MB 1ZPSA 4CKEA 2BS2B 2WKDA 4EGVA 1HXYD 1S5CD 3LX0A 1VF5C 1TKWB 2NTSA 3OWEB 1AWDA 1FIQA 3I4LA 1RDPD 4PQXA 3WOFA 2B8FA 1JC7A 1E0ZA 2F0JA 2AUKA 3BVZA 5EBDA 3EQLC 4C3HG 4KY6A 5ELFA 1TKEA 1TWFB 1T5EA 2QKIC 5IGGA 3K6OA 4FF2A 3Q23A 1C48A 3V96A 2E3TA 2K03A 3MWYW 3ZQ4A 4OHJA 4KI0A 3HVDA 3BG3A 3BWUD 1ESRA 1K8MA 4FO2A 4G7HC 4IUTA 1FXAA 1GB1A 1BCPC 1EM7A 1V8CA 4OW0A 2VXWA 1EEID 1JICA 1PRTF 5C4HA 2L9HA 2NN6I 1SNMA 3WOEA 1LTGD 1PTOC 1QNUA 5JJZA 1NVID 4HMIA 2FFKB 4RF0A 3GP7A 1C4CA 5HGTA 2WXLA 4KKTA 4A3DB 1OXVA 1L6UA 3V2TA 2INNE 5DAUA 3PUYA 4N58A 2PZTA 3J7YW 1K50A 3H0GB 1V1PA 2B2UA 3ZYYX 1TWAB 4RA8A 5LNK1 3NUHB 1TIID 4FP5D 1J9OA 2B2YA 2BA0A 1NYQA 2K7VA 2R6GA 1N5WA 4F7XA 3K59A 2O5JC 1JRPA 1BDOA 3L3OC 5ELEA 1VRAB 3AEDB 2VNUD 4WRDA 1KDAA 5EPLA 3TEXA 2JZPA 2XN9C 5NUCA 2TMPA 1NR2A 4M1UB 4HCSA 1XO3A 2QDBA 1SSOA 1B50A 1B44D 1JOOA 2K3UA 2KQ3A 1S4ZA 1UEAB 2R93B 1B2TA 4N6EB 3MHBA 1CA6A 1K53A 2EY5A 4FVMA 2B8GA 1ET6A 1KF6B 1E9MA 1TS3A 1E2VA 2K33A 4XT1B 3AECB 2E2HB 1KLGD 2JXTA 4C3IB 1R4PB 1E7PB 3NQTA 1B9MA 1TWHB 1VMPA 4ZUJA 1T3QA 4GDLB 4PT5A 1F2YA 3TUOA 1SBBB 5JVG3 1XXGA 3TMEA 4CJ2C 4IUPA 5M5XB 3SHLA 3KK7A 1DOMA 3N6RA 3AE2B 1N61A 1CK1A 3A7LA 1C4AA 1VLBA 5I4DA 4KKIA 1YJIA 1EWHA 4B08A 1D4BA 4N9PA 2XVSA 2F0OA 3CKIB 2I07B 1SYEA 1YNJC 3X3NA 1BNZA 3C1FA 1EYCA 4DAPA 1GXDC 1KLUD 1IHZA 2I46A 2TSSA 4A3FB 3MTSA 3I90A 2X38A 1L4ZB 2W82A 1J7BA 2XWJB 2WDQB 2BTEA 1YNND 1DJRD 2J42A 5BMGA 3IKJA 2IWHA 4ME5A 4M8AA 1ZYRC 4EQOA 3J7AV 1XLQA 1MPEA 2L5TA 2VUMB 3LB8C