1PYWD

Human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/protein binding/toxin
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Exploration of the P6/P7 region of the peptide-binding site of the human class II Major Histocompatability Complex Protein HLA-DR1
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pywD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pywD02
1V1PB 1D5MC 2IJ0A 1JWSD 1XXGA 1CHPD 1FGBD 1PZID 1EU3A 2TSSA 1HTLD 3BVGA 1LT4D 1ET9A 2G9HD 1KTKA 4DXFA 1HXYD 1BCPF 3BZDB 3DWQA 1PRTC 1PYWD 1SJHD 1PTOF 2O2LD 1LTRD 1JCKB 1ENFA 1LTID 3EFXD 1FNWA 1LT6D 1G8ZD 1LTGD 4ZYSA 1V1OA 1PTOH 1I4PA 1CHQD 1SXTA 1CT1D 2WV6D 1S5FD 1EEFD 1S5BD 3CHBD 3V05A 1LT5D 4O1NA 5FKAC 2XN9C 4RGOS 2ICIA 1PRTF 1PZJD 2SEBD 4DXGA 1RD9D 2NTTA 2AQ2B 1F77A 2QILA 3W2DA 1I4GA 3BYYB 1FNUA 1DJRD 1I4RA 4L6TB 1TY0A 3MFGA 5ELEA 1MD2D 5ELBA 2IPKD 5FK9C 1RCVD 1UNSA 1YN5A 1YN3A 1SJED 4RHRA 4RGNA 4RH6A 4BWGB 4NZLB 3MC0B 4UDUC 1BCPD 1QILA 1L0YB 2NTSA 1ESFA 5I4DA 1KLGD 1SE2A 3TSSA 1BCPB 1PTOD 3SEBA 1B44D 2CHBD 5ELCA 1PZKD 1STEA 1D5ZC 1PTOB 4K6LA 4RGMA 1LTAD 1HQRD 1AN8A 1LLRD 3OWEB 4Z9CB 1L0XB 3R8BA 2R61A 1TS2A 2RDHA 2AQ3B 1S5CD 1V1PA 5TSSA 4RGTA 1LO5D 1HA5A 2XRQD 3DWPA 1JQYD 1TS3A 2RDGA 1PRTD 1I4XA 2QEJC 1FNVA 1SE3A 1LTSD 1PRTB 1RDPD 2XRSD 1SE4A 1DYQA 3EA6A 1B1ZA 1EWCA 1JWMD 1LTTD 1XTCD 3KLSX 1JR0D 4OHJA 4RCOA 2J4XA 1CQVA 1FD7D 1S5ED 4C56C 3URYA 1LTBD 1CK1A 2XNAC 3R2IA 3R2TA 2AQ1B 1ET6A 3GP7A 3O13A 3BVMA 5ELDA 3DWAA 2Z8LA 1T5XD 1UUPA 3BYTB 1TS4A 5ELFA 1M4VA 4RHSA 1BXTA 1KLUD 1D5XC 1AW7A 3BVZA 1YN4A 5D3IB 1RF2D 1TS5A 1LT3D 1BCPC 1EFID 1S5DD 1GOZA 1SBBB 1I4QA 1SEBD 1EU4A 1I4HA 1TY2A 1D6EC 4RFBA 5D3DA 1PTOC 4TSSA 4L63B 1EEID 1JWUD
chains in the Genus database with same CATH superfamily
4MGZE 1SDFA 1B2TA 4A3MH 2MGSA 4XQJA 3CC2A 1L4ZB 4W9LA 3KF6A 1GHKA 2ZNVC 4NNJB 3PIPA 4YSYB 5BN5A 2BKFA 3DVGY 1HTLD 2WB1G 3I4MG 4NJCA 2NN6H 5C44H 5DM63 2OTJA 1KRTA 3S1RB 2K1FA 1E6EB 2HDEA 1NE3A 3CF6E 3AM9A 1V9PA 2FXQA 3N1ZC 3ITPA 1N36Q 5GQOA 2F4VL 3X3MA 3NY5A 3PRPB 4QAYA 5EBCA 2CH4W 1G8ZD 4EOYA 5E6JA 4WWOA 4B3SL 1E22A 1WYGA 4BZAA 4PS7A 1C9FA 3X3NA 1SNDA 3U58A 1VQ6A 3PRZA 3R3MA 3PIO3 5C3JB 3HZXA 1MI2A 3W1SC 4BY1B 2INCC 4DQOC 4DA2A 2NVXB 1KL9A 3HOVG 3U30A 5JVG3 2NVTH 1LXDA 4L5SA 1Q5WB 1ENCA 1FCCC 5FR6A 1SYEA 2ICIA 2JA7G 3GOEA 5AUIA 1SIJA 1VDZA 1EO6A 2CHWA 1F9SA 4BXXG 3GB1A 2E2DC 2DN8A 4EGVA 1YJ9A 4DHJB 3CXCA 4TRDA 2K39A 5LMNW 4HJ5A 2M2LA 4W9IA 1VZ6A 3ULLA 2JJQA 5ELBA 2KCNA 1EYCA 3P2BA 3P42A 1Q8IA 4A3JB 2CQAA 3HVZA 4TQUS 1I50H 3MXGA 4RHRA 2EELA 3AE8B 4DV4Q 3HFZB 1YBYA 4K5WA 4OO1H 2KVRA 5I6WA 1UELA 3BZKA 1ESFA 2K1BA 3H0GB 4L5RC 4DR5L 2DBYA 3A9KB 2NUCA 3Q23A 3T1YL 4C3HG 2JYEA 1HNXL 3QG1A 1IPGA 3ZTCA 1PTOB 1EL0A 3FHWA 2PLPA 1I42A 1DXMA 2J0MA 4DK6C 1XLNA 3QHTA 1TKEA 2AKWB 1MPEA 2KWDA 4MM3B 5CHFA 4NW2A 1GB4A 3I7FA 2JWUA 2WXMA 2Z4HA 1R9TH 2LZ6A 3KYCD 3NJTA 4QUFA 2ZNVB 4KX6B 2RDGA 4DV7L 2JA5G 2V4LA 4ASWC 4DNIA 1L5PA 4B3ML 4UP8A 4IPDA 5JJKA 4WURA 2YYZA 3KUZA 5FLXL 3M7NA 4GN5A 3J7A5 5C4JB 3K6OA 1KC8C 1XF5L 4MGIE 4P6VF 1SMYC 3R93A 3DVNV 3C2PA 3ZXRA 3MHZA 4GN1A 4AYBE 2UXBL 3DBLI 4XIGS 3RZDB 4FJYA 5DNFA 4MZ9A 3GV3A 2W55A 1DCZA 4WJPA 1P3QU 3R2IA 4MH8A 4IWPA 1C4QA 1XPRA 2JRHA 4AJWA 2A68C 3EJIA 1BR9A 1NUCA 2SNMA 4HSPA 4YWKA 3ZUNA 1WTXA 2KAJA 2H1EA 1UEAB 4RHSA 1PGBA 1KLUD 2IO0B 4JWUC 5KIXA 4PYUA 4GKJL 3D4WA 1EWYC 1WRDB 1TGZB 4QB4A 2LXCA 3IAM1 3K7UC 2UUAQ 3GDEA 2QW7A 1Y14B 3H91A 4AYBG 1NR2A 3OW7A 3OJ4B 1WXVA 2E3TA 3DEPA 1AFPA 3DM3A 1STHA 4IM2A 1X3PA 4LFCL 5HI1A 2MP1A 1IZ6A 4OW0A 5LXHA 3HP3A 5H1SE 2JU6X 1VZ7A 2E5LQ 3G48A 1WVLA 1EQRA 4FHJA 2AMCB 5C4XG 3A9KA 3U8ZA 4EEWA 1V5TA 3OMGA 1NI2A 2NCNA 1XT9B 3S1NB 2KN4A 2PJHA 1LTID 1FNWA 1P7FA 1KFYB 3R3OA 1KQSA 4JWSC 2MJEA 4FULA 4MM3A 3AEFB 3PT2B 5KHQA 1A6XA 2KX3A 1PFMA 1C79A 2NBWB 4BBRG 3QARA 1HTQA 2OOBB 2F0MA 4ID6A 4IUVA 4NXML 3DBLB 3PUYA 1MG8A 2I2YA 1AE3A 5KNDA 5EQ0A 2LGYA 3B2GA 4DXGA 1NYRA 1J6QA 2ASBA 4B3TL 4B9KA 4XWTA 4JBJA 4M1UB 4A4IA 2BS3B 1HNZQ 1A8VA 4P72A 4OZAA 2CJOA 1WY8A 3DBHI 3Q2AC 1QZGA 4A90A 1OO9B 1C0AA 4NPNA 3WAOA 4DV6L 3CSFA 3QC8B 2A6EC 4HVBA 3MTSA 3PUXA 5BYRA 2VXWA 1DGSA 2EYJA 2H4OA 2EVBA 4R4TA 4PK1A 1FO4A 4RH6A 4BWGB 1EIYB 2K8CA 4JI8Q 3S16B 2KOXA 3QIJA 3CRLC 2B2WC 4CJ1B 4ME3A 1KXLA 1OQYA 2KVMA 3ML8A 4IALA 3VVWB 3UQAA 2KA7A 3OHXC 3S1RH 3D32A 5ELCA 5C3XA 2CFMA 2WDVB 1CJEA 3MFYA 1UH6A 1LGRA 3SHQA 4PNYA 1TIID 2EY2A 2XIWA 2LVQA 1AN8A 1JOQA 1JMCA 1NCVA 3MXNB 4A3IB 1QF6A 3Q69A 1TS2A 4ZUJA 3HOZG 2WACA 2R2OA 4II2B 1E0ZA 1XX8A 4O0AA 4POGA 4ANWA 2VUMH 1SN8A 2Q8RE 3K80C 4BY1H 1NYQA 3ENEA 1QB5D 4LDTD 2NVXH 3ZJVA 3PSIA 1K83B 2PQEA 1AEXA 1GKHA 2R6GA 5ELNA 4I65A 3OMCA 2ZT9C 1JRPA 4US9A 2DYMA 4DV0Q 2PVOD 1VDVA 2N55A 5JVH3 2WAQB 3RZOH 2IBIB 3MWYW 5LMNQ 4LF4Q 1V2YA 3GO5A 2KDBA 4BBNC 1TYGB 4K0KQ 4R4IA 3CAMA 5IP7H 2CCZA 3T1HQ 2M17A 3EGRA 2D3BA 4A3JH 2VH2A 3GP7A 3BVMA 3UDXA 2MBQA 3L0OA 1B70B 4YCVA 1DOLA 3AEBB 1E5WA 3BYTB 3N20C 1UAPA 4KLKA 1VR9A 5L95C 1TXYA 3GTGH 4DUYQ 1E2VA 3K5NA 4YWMA 4ZYNA 1BCPC 2O5IC 2KO3A 3T3OA 5M5XB 1KOTA 4C3IG 1IYVA 3AEDB 4B0MA 4DR3Q 3QA8A 4C7YA 3ONSA 4OX9L 1E0BA 4KZCA 1B4OA 1UF0A 1WOCA 4A3CG 1JWUD 4Q5VA 4G7HC 3KUPA 3HOYG 3EN2A 4LNOA 2C35B 5IYDH 1G2TA 2RPQA 1K0SA 4NB3A 2H89B 3OJ3A 1J0GA 4JBKA 4RMFA 3FC4A 1Z9FA 2YTVA 3PCOB 2G1EA 2ZM6L 4WJ3M 2H5XA 2WQYB 4A9AA 4NXNQ 4A93G 1EYDA 1YJNA 3VR9B 4X62Q 4BKGA 3N30A 3Q8BA 2B2TC 2O4XA 4JC0A 3BK1A 1KRSA 1UE5A 5A2QL 4BY7G 2N88A 5LL6X 2O2LD 2ZEQA 1J8IA 4FXDA 3RZDH 1PXUA 4R4OA 4DAPA 2XBBC 1I94Q 3MXNA 2FMCA 3NPPA 2MWSB 2OJRA 4JBWA 2L15A 1CI3M 3CWIA 1V1OA 1F0ZA 2QIEB 3JAML 1WTQA 1WYDA 2LVOA 1CHQD 2ZW1A 3VQIA 4IUUA 2E2HH 3NRZA 1R7SA 1S5FD 2ZJRA 3RZFA 2ATWA 3ERSX 4B3RQ 4PT5A 2XN9C 3KLRA 2BA0A 2WX0A 2K25A 5JHBA 1SNMA 1Q82C 2RKSA 3D4RA 4JI5L 1Y1WG 2XWBB 3GS2A 1LTLA 3MFGA 3NUCA 4HKZE 1XWEA 2ZPYA 4S3SA 1D7QA 4KMUC 4DAVA 3I73A 5CHWA 1L2NA 1YN5A 2F4VQ 1C7YA 3J80i 2OQKA 1C4CA 1WJNA 3ZDMC 3TUOA 1B8AA 1F52A 4B3SQ 4BOZB 2PMZE 4AWJA 4C3JH 4F87A 3I3CA 4C1NK 2KEDA 3I4NH 3Q8EA 1ZDVA 1QOAA 3WAPA 5J2RA 1BCPB 1KIXA 1KABA 4KHVA 3WA0A 2RCNA 1PZKD 1WGYA 2PE9A 2CQOA 4YWGG 4IFDH 3S1NH 1LLRD 2D0OA 2KOLA 5KNCA 1VQ4A 4GZYC 4LF7L 2BQQA 4WJ4A 2JSOA 3MXPA 1WTOA 2DAJA 1D2BA 3P1HA 4RGTA 3SHLA 2WXJA 2EKIA 1O78A 4NMZA 4XZ4A 1MJCA 2GVAA 4FN2A 4HPLB 2JEBI 3MJ5A 5A35A 3GTJB 1O80A 2PIAA 2B2WA 5G5GA 2QEJC 1BUVT 1SE3A 2AWOA 2IO3B 3K9OB 1PDXA 1WD0A 3Q22A 1EY7A 3TBLD 2LWPA 1DYQA 3K0XA 3DBRI 2PE6B 1F2MA 4EQNA 1MG4A 1F2RC 3VH3B 2N7JA 4JW0A 5ELOA 5FOBB 4TQ1A 3ZYYX 4DR5Q 2ZJQA 4B9XA 3TP7A 3T1YQ 4YT0B 2IX1A 1F2RI 2LHDA 3I56A 1HNXQ 4DR4L 2KFJA 3NQTA 2R93B 2L00B 2HQLA 2QSDA 2J7QB 2MA9B 3I90A 4K7SA 2X69A 1IYJB 3DWAA 2JX5A 5JAVA 3KUDB 1LUZA 3BK2A 1ZXTA 2QCZA 1QOGA 3C8YA 3L4PA 1PV4A 4M0WB 4KGTA 1I6VC 5CV9A 2CS4A 5HURA 4XTCS 4J15A 2EXDA 3C46A 4E3CA 1Q3LA 4HJGE 3KJPA 4DV7Q 2K8HA 1RKNA 4B3MQ 3NE5B 1PH2A 3MC9A 1CTMA 2GRIA 1L0WA 2FCNA 3MVVA 1GJXA 2H88B 4A3BH 3KYHC 3NWSA 2K5QA 1WXAA 4GN4B 2UXBQ 1VRAB 3APCA 1PH3A 2F0NA 2A4ZA 4RAUC 3WWVA 2YLMA 2G9HD 3V62A 3S1QH 5M5WB 4KI0A 1KNAA 4HR7B 4WH4A 4IJLA 3M3YB 1KNEA 1VQPA 1E8YA 2JVCA 1JCKB 2MO1A 3AFQA 4IG7B 4DR7L 2K22A 2NYZD 1SYBA 4GKJQ 3PS6A 4PS3A 2L7RA 2D2CC 4HTHA 1UBQA 4YSZB 1ZEQX 4K5XA 2JA6B 1TR5A 1IW7C 2RSUA 2RCFA 1IGDA 3DBRB 5EPLA 1EEFD 4II3B 5JJIA 1DZ1A 1YJ1A 2A69D 2CU1A 5LLIA 1CZPA 2JF5A 1PRTF 2GVBA 2B2TA 3MC8A 3J81L 2F0HA 3BS1A 4LFCQ 4XC2A 1ML0D 1VQEA 2FHTA 2WKCA 5M3MH 5IT9E 4A3FG 1F77A 1YMHE 1ZE3D 2V4DA 2HD5B 1I4GA 3VRAB 2ZTDA 2RQXA 3KJOA 1ZUD2 2LUMA 1F2ZA 1MD2D 3A54A 2FMMA 3Q0AA 3TMPB 3FKIG 2F4IA 3OTOL 3C1FA 5CMDA 5MPOA 4IZ8A 3UDFA 1CZGA 5T1GA 3CMEA 4ZDVA 3ZDTA 3SDZA 1IBXB 4C80A 1NTGA 2B63G 5M3FG 4HIMA 3HRDD 1O7YA 5DPTA 4M0WA 3RNCC 4DK1A 4IURA 4NKLA 4POFA 2DZMA 2J0JA 1YQ3B 4IUPA 4RGMA 5M5YH 3AMZA 4NXMQ 1S72A 3AI5A 3NHEB 1KM7A 4YXDB 3OYYA 3OWEB 3L3OC 1RJTA 4B3TQ 1TVXA 1VQJA 2WNMA 4GIVA 5CC4A 1BMLC 4HCEA 2WXLA 3UIPB 4F8CB 2E76C 2PI2A 1YHAA 1E7UA 3E0EA 2R7DA 4DV6Q 2ON8A 3T9LA 2NWGA 4H13C 4JI4L 2XRSD 4CJ2C 3EIVA 3H3VH 5TR5A 3Q8FA 3TEYA 3BDCA 3JAMc 4R9WA 4AH6A 4DNTB 4DV2L 4LWCA 1FFVA 3U7ZA 3NVWA 5JJZA 3OG5A 1WJUA 2ZTCA 2GN5A 1ISNA 4YHHL 2R7ZH 2JZPA 4LF5L 2DAFA 2JWZA 3HVDA 1Z47A 3A5ZB 3UINB 3O13A 5DAUA 1XNQL 1LQBA 2INNE 3T13A 1BKBA 5FJ8G 4UAIA 1RTOA 2CKHB 2DY8A 1TS4A 4A3KG 2OWOA 5I6YA 2NS5A 2JA8B 3WIMA 3WANA 1SNPA 4M8AA 3AU4A 4OWWB 1E8WA 3QWZB 1O7IA 4KHZA 3HOWG 3GQBA 3EQLC 1V81A 1L6VA 4X3UA 2KLGA 1SLJA 2Y3AA 3H1UA 4WJNA 5AUKA 4X3SA 2N3SA 2KFKB 4IOIE 2Q2HA 4W9HA 2JXMB 3UE0A 3E5SA 2K3UA 4ZRKA 3VHTC 2NVUI 2I0QA 4KJOA 2YTXA 4WAFA 3A4RA 4R8NA 2HHHL 2WU5B 2C7HA 1DONA 1K8OA 1A3TA 1IBXA 5I2YA 1PYBA 2F0QA 1FYCA 3PO3H 4GXBA 3RR5A 1PYWD 1V1QA 1KDCA 3LNNA 4BKTA 3MAQA 2IW3A 4KY7A 4A20A 4G4KA 3PLUA 4L23A 4PMBA 4K7UA 2DNEA 2WLBA 3RNEC 3AE4B 1VQKA 3DWGC 3L9AX 3U9OA 3CPWA 4LJPB 4GB9A 5J18A 1HFNA 1SFOB 5C0XI 4LF6L 1P8LA 2WV6D 3V05A 3CHBD 4OX9Q 3J81j 2WB1B 4KY6A 3I4MB 4K3BA 1PLFA 5KNBA 5IYCH 4BVUC 2EQSA 5DM73 2SEBD 5IP9G 1K8GA 2D0PA 4K5VA 2X38A 4DHZB 3GTOB 4KSKC 2D62A 1G6JA 4CKEA 3ZTDA 3AXCA 4I6LB 4IC7B 2ZM6Q 2QILA 1J5EL 3W2DA 4UPAA 2WXIA 3CC4A 4WWNA 4K2KA 4LJOB 4LFBL 5C3WA 1PH7A 1NJIC 4A3PA 2Z0EB 3NVYA 1X56A 3GTPH 2XK5B 1OFFA 4USAA 3HOVB 1GVPA 3M85A 2Z4IA 2BE5D 2JA7B 3HUIA 3DHQA 2F03A 1WXQA 2WXHA 1SE2A 5EPJA 3TSSA 1GG3A 3GV6A 2F0IA 2EPBA 1L7YA 2CHBD 2E2IH 1HUNA 1L4DB 4NDXA 4A3DB 2D2QA 3W1SA 1K3BC 3CCMA 1NI3A 3CF5A 3BIID 3GTLH 1L0XB 2N8NA 3WALA 2KFKA 1XD3B 3JSVB 4G50A 5BO4B 3RCZA 1TJEA 2BYVE 2IYDB 2HTHA 4JI5Q 3TRZA 1V49A 1KDAA 1YEZA 3AE1B 2EY1A 3MTNB 4KKJA 4IKGA 3KBGA 4N8X1 3PZDA 4FBJB 1TTNA 1Q1BA 5C5LA 4C3HB 2JUOA 3KBXA 2KECA 5K5PA 4HJ7A 3K7AB 1Q7YC 4OHJA 5J39A 2K5PA 4W9EA 2M19A 1FD7D 3AE7B 5AZHA 4MJSB 5FR3A 1E2ZA 2F0WA 4KKTA 3IBEA 3TL5A 1WM2A 3QOJA 4ZLTF 4APVA 3A7LA 2AQ1B 4WIPA 2AL6A 4DWFA 3PO2H 3VR5A 5KRUA 3HKZE 5C3EG 4JG2A 4LF8L 2JA5B 2D3CA 4XE0A 4BFRA 3TP8A 2X6GA 5C4ZA 4LF7Q 4I6PA 4WQOB 2Q8IB 1BBXC 1ZPSA 1J8CA 4PZ8A 3A5UA 1I5FA 1OXUA 4TMAB 4OWTB 2IHFA 2Y0SG 2BA1A 1STNA 1I4QA 2N78A 1AARA 1XTDA 5H8YE 1IL8A 1Q46A 2DJGC 4XX5A 4L63B 4IDIA 3K5LA 3NG0A 5EPKA 3J7AF 3NXWA 1ZGUB 2HIXA 1YVCA 1C4AA 3Q8AA 3FEWX 2XK5A 2X6LA 2D3GA 4ZRPA 4A3GG 1WM3A 3RNGC 3VTWA 3ZXVA 3G4SA 3GTMH 3VA7A 1HTPA 3HKZG 3W1BA 3J80E 4DR4Q 1FMAD 5J22A 1EIHA 1K51A 2NZ1D 4JK1C 3DWQA 1QNKA 5C6AA 1SNQA 1OXXK 3ER0A 4EQOA 1ZXIA 3PQIA 3DPDA 4W9DA 1JB3A 2GBKA 1EQVA 4A3MG 4FF3A 2K14A 4JYAL 4AYBB 1JW9D 4DK0A 3JSVA 1EY6A 2KWVB 3PUZA 3GTKB 4BBSH 4GNXC 3P4SB 2NN6G 1D8LA 2OF1A 5C44G 3DXJC 2NVQB 4PS8A 4S17A 1TWHB 3TMEA 1EYGA 2L1AA 2R92B 5IGDA 2JZ3B 2XVSA 4BKSD 5C4XB 1RAXA 5IP4D 1KD1C 4C4VB 4KKSA 3GE3C 2BYEA 2F52A 4HSVA 3KH0A 1BVSA 1U4PA 3BYYB 1VQHA 3SU8X 1N8RC 1RIPA 4MJSA 3LGJA 1WRIA 1AZPA 5KGUA 2FE8A 4MGYE 2A6HD 4BBRB 3LWEA 1QE6A 1SJED 1AE2A 4DR7Q 4I6NB 5LMUL 1SYGA 4OXPA 1TT2A 2K8BA 4HJ9A 1EF5A 2ZW0A 1E1TA 4ZHOA 2KQ3A 3STBD 3AEGB 4EKUA 5DCNA 2PPBC 3DLLA 1KAAA 1QVCA 3N6RA 1JT8A 2O2VA 3A4SC 4UP9A 4HLEA 1HEZE 2E2JB 4J8QA 3MP9A 3VTUA 3V96A 2R61A 3C1EA 2EYHA 4KTAA 4JI1L 3S1MH 4A3LH 1MHHE 1OTRB 4ZOHC 3H15A 3HOXH 2HCCA 3KLSA 1TU2B 1YQBA 1LACA 4OO1G 2NVYB 4FADA 1Y8NB 2MH7A 2NZOA 2Q2TA 2KQSA 1PFSA 2F3IA 2KDFB 4CDCC 2M56B 4LDTB 2KCMA 4GLXA 4DK3C 3OTOQ 2RR9A 1SE4A 1HRJA 3P63A 4AOFA 1HZBA 3M4OB 2PO4A 2N9LA 4QQBX 1WGKA 1EY9A 4A3EH 1EQQA 1PH4A 2JPHA 3AE9B 2VL6A 3HOZB 1Q10A 4JI6L 1IXRA 2OCEA 4BS9A 3NBIA 4GNXB 3URYA 3SK4A 1T0SC 3EVQA 3QOLA 4F8MA 5F2DA 1IYFA 3I4LA 4WAAA 3E9IA 3SXHA 2CW0D 5T8IA 3U52E 3NQIA 5M9OA 4KKUA 3EC8A 2K04A 3S2AA 5ELFA 1M4VA 2KDIA 2D11A 4HCPB 1J9OA 3BVZA 3SK6A 2V3SA 3NUHB 5J1ZA 1SNCA 1WTPA 4C4VA 4DUZL 1I3QB 4A3DH 4RCNA 4EZLA 2OTLA 2KHIA 1STGA 3D3RA 4ALPA 2MP2B 4YTPB 1I6HH 3VUXA 1S40A 3M7GA 5I9PA 2KANA 4JI4Q 4P71A 5FLMH 1GNUA 1TWCH 4DV2Q 2WXRA 1D5MC 3I3TB 1JWSD 3I70A 1EQTA 1CHPD 3QO2A 5IGFA 4KVGB 4YHHQ 1DOMA 1KDBA 1TWAH 4LF5Q 4AQ7A 1SB3C 4G11A 4GLSC 4XWWA 2NZHA 1XNQQ 1LV9A 3SR1A 2MUYA 4C3IB 1PTOF 3ZW3A 4ANUA 1VMCA 3K7AH 2KMCA 3UI3A 1YITA 1A5RA 2DGYA 4YTMB 4P2CB 5C0XH 1IL2A 4KIKB 4LCDE 4B0EA 3HOYB 3J81i 4F88A 3SD5A 3CPFA 3F1ZA 5AEKB 2JZZA 5D14A 3F2BA 1PH1A 2KMAA 5FLXE 3CQZB 5CYUA 1EY0A 1B7YB 2A74C 1SR3A 4WRDA 2HUGA 4A93B 1UZXB 2IGGA 3F8TA 2LJ5A 4LUOA 3M9BA 1K3RA 4BY7B 1EYAA 2HHHQ 4MT5A 3FPUB 1JJGA 4GN3B 1OEYJ 4OWXB 5CV6A 2WX1A 4M8MA 4MELA 5HFYA 2JYTA 2YV5A 5IN7A 1F9PA 3T16A 3RN9C 3ZJUA 5LNK1 3JYUA 2PCFB 1XPOA 1FGUA 3K9PB 3VDYA 2IPKD 5D6JB 1GB1A 4GNXA 2GB1A 5E6OA 2EYFA 3V3XA 3LX0A 3PTFC 4GLVB 4RGNA 4YCWA 4DV3L 2KTFA 1FXIA 2JEAI 3NWTA 4UHVA 1QWYA 5I4DA 5IOCA 3W1YA 4E74A 4EVOA 2IZVB 4FYDA 3SEBA 5LHY1 4LF6Q 2JQOA 1Y1WB 2L52A 1UE1A 4IQZA 4CQNA 1STEA 1CKOA 3GD7A 2BWFA 1NEKB 2MP2A 2HCIA 4MTKA 4GOPC 3R7RA 2BT6A 4HRSA 4KV6A 3OAWA 4G0NB 3KLWA 3SFEB 2K01A 5IOIA 1S5CD 1D4BA 2EY6A 3GTKH 1YJJA 1J5EQ 1E8ZA 3KDFB 2RDBC 4GKKL 2ES2A 5LXIB 5E4XA 1VMPA 4LFBQ 2KDMA 4MEMA 2MJ3A 4NAMA 2R92H 1QUQB 3S14B 1MVKA 4TQ0A 2A69C 3Q6SA 3EA6A 1T0RC 5G55A 4WQMA 1MSGA 4XYOA 4YY3L 2BCOA 1VQOA 3SR6A 1C1YB 2PZWA 1DGJA 2G4DB 1CQVA 3TP5A 2KKCA 4KD4A 2VUMG 4N6EB 1UE7A 4H44C 4KIKA 5DEHA 4BY1G 1TKGA 1WCMB 4HIOA 2M8SA 1PUTA 3F2CA 5E6NA 4ZAIA 2XNAC 2DZKA 2KXJA 1E2WA 1ET6A 3CSTA 2DNFA 2JN4A 2AUJD 5ELDA 2BH8A 2Z8LA 4ZK9B 3IXSA 3UQBA 4P1BC 2C5LC 1FVIA 2PMZB 4CDFC 1AW7A 3H8HA 2YU9B 3RUIB 3VR8B 1QZEA 2QF7A 1S5DD 3BDOA 1GD7A 1KHIA 1EIFA 2CWPA 5IP7G 1XLPA 2QDFA 1TY2A 1D6EC 4A6QA 1WGDA 2NBVB 1RYJA 4FA6A 4A3JG 2KQ7A 4EQPA 1A2UA 3NHHA 3AULA 4CJ0B 5GADC 2K7VA 3VR3A 3J7AV 3A55A 1V6EA 1A3VA 3OIPA 3AQQA 3WOFA 3AFPA 1QKZA 2B2VC 2Z59B 2FIDA 1ICFB 4F7XA 1L2FA 3NK9A 4MH0E 3Q24A 2Y5CA 2B3AA 1WTRA 1U4AA 4MHEA 4LF8Q 3B08A 4GOPB 5IYDG 3HM6X 1K0RA 1LT6D 3H0GH 4KJNA 1KJTA 2BTEA 1W6KA 2IT1A 2KYWA 4FXCA 1UGJA 2FJ2A 2PZTA 2D9UA 1PTOH 2JK8A 3TZUA 1WJ4A 3EBEA 3TEHB 4LUZA 3FKYA 3T53B 4KHPL 3KDFA 5AFWA 1JC7A 2GBJA 4L8JA 2DUDA 3Q3OC 2SDFA 2MLBA 3GZNI 4URKA 2DZIA 2AUKA 1K50A 1QUQA 1IUEA 2KJXA 4H02A 5D94A 3T3NA 4HKQA 1VQAA 3AH7A 2WWZA 2QMTA 1CA5A 4WJQA 2JXTA 3ZO5B 1UE6A 2J0KA 2LGXA 2IY0B 5IGBA 4AQYL 3V6EB 2WXGA 1ENAA 2MSED 5C4JH 1Y69U 3M62B 4ZRJA 4M01A 3X0WA 2EE1A 3AU5A 5CV4A 3RPFC 4XXEA 4S0RA 2BGFA 1FD6A 1YN3A 4ZCKA 2KWCA 4JYAQ 1GXDC 1IKLA 1T9HA 3PIOA 5FO9B 4DR6L 2JY6A 1QILA 1QOFA 5FO8B 4OIKA 1HTOA 4EX5A 1BBUA 1EWIA 5D7GA 1YJWA 4A3FB 3SFDB 1JICA 2L5TA 1OQQA 1GUGA 5JOBA 1VJKA 2NBFA 5EKKA 2RDFA 2M0AA 2QEXA 3FKIB 4DR2L 1E7ZA 4G7ZC 2KWUB 4BOSC 1JWAD 3D4DA 2WXQA 1EIGA 5EAYA 4E71A 1CFMA 3SVMA 4C3JG 2N0SB 3U2SC 3I4NG 2KJRA 3CQZH 1LO5D 3DWPA 1G91A 2F0KA 3Q3JA 2UXDL 1Q90A 2ZXOA 4JE3B 4IFDG 5IWAL 4JX1C 3IKJA 4K1RB 5CTRC 3APFA 3QIAA 5LMUQ 4GU2A 4DK5A 4FXKC 3D0FA 1L0VB 4GOPA 1FCLA 2I46A 4PG3A 3VXWA 3KUCB 3GZNB 5I9OA 3KF8B 4L1BA 4R4CA 2JA9A 1NR4A 2JXXA 4N9F4 4W9CA 2V1CC 3I8ZA 1X9NA 2I1JA 1UUPA 1ESRA 4KGRA 4JI1Q 4US8A 2KBNA 2A8VA 3HIZA 4DV5L 4K3CA 3S15B 2BE5C 1OXVA 1HPCA 3A7AB 4X64L 4CHTB 1ILQA 5K36H 4BBNF 2G9DA 5IE8A 2OEDA 1IYUA 4G57A 1K8RB 2C7MB 1B3QA 1FL0A 3MXUA 4X57B 3SK8A 3AE3B 2XSCA 1YIJA 1A63A 3HEJA 3OWFA 1RWSA 2AL3A 3VYTA 2BWES 3VDZA 1PDQA 4GS3A 4LFAL 2OHFA 3M63B 1EU3A 1HZAA 1CUKA 1SNOA 2VS1A 4JI6Q 1HA6A 2LGSA 4JPSA 3DM1A 3IRBA 4P74A 1BCPF 3S14H 5LL6S 2KDEB 3HOWB 3P7JA 3RMHA 1U4LA 2O6VD 1EY8A 1EFWA 1VQDA 1GC7A 1LTRD 2F3WA 3S16H 4A3BG 3AE2B 4EFOA 2V9HA 2L8JA 4WWMA 1CM9A 1FXAA 4P75A 3R7QA 5EE1A 2KCTA 2LD9A 4CHKA 2OQ0A 3ND9A 2AWTA 2VB3X 4XT1B 1WCMH 2VQEL 4DUZQ 1GM5A 2W82A 3Q6BA 1JJCB 1WTHA 1EWHA 3DHGC 4RMAA 3CMAA 4A3IH 2WXFA 2B2VA 3ZGZA 2KHWB 3W9CB 2KTRB 1WFQA 2MHVA 1SSOA 3A74A 4A76A 2IHEA 4RNAA 4XDDA 1Y8OB 2CU3A 4A55A 2YU9H 2K6QA 2NTTA 2AQ2B 1PH8A 4IOAA 2YVCA 4UY8C 4ARCA 1BNZA 1K83H 1GUOA 1BF4A 1Q12A 3ZNID 1TWFB 1QT9A 3ZIMA 2NPTB 3AE5B 1LABA 1C3TA 1L1OC 1QLBB 3NTIA 4FHKA 4LNNA 3KF8A 1RL2A 4KGSA 5EE9A 1JOKA 5E1FA 1CKNB 4GLAC 4NZLB 5BR8L 3VA5A 3HOUB 3ECIA 2Z0SA 2G45B 5M3MG 3T8MA 3A56A 1CA6A 1C76A 1G291 3EFCA 4N59A 1WGHA 3IFTA 3W5UB 1ONLA 3PF5A 3VAWA 2M00A 1UWVA 5CORA 1IBLL 1NBWA 2QHOA 1LTAD 1PH6A 3DBSA 4QIWB 2INDC 1AZQA 4QCLA 1GJZA 1ZYRD 5M5XH 4RKLA 1BUIC 1T0QC 5TSSA 1IBML 4N9TA 4Y7NB 1SYCA 3QAQA 3OW2A 4LNFA 1I35A 5IYBH 1V43A 4NQLB 1A15A 3U7DA 1TWGB 1N61A 4RG1A 1N32L 3I4OA 2D07B 5KYLA 2QCPX 3B0AA 3Q3FA 2B8FA 3RD2A 1B1ZA 3AECB 1KLVA 3QJZA 1JWMD 3Q3NC 1SROA 4DV3Q 4RCOA 4YIJA 3RNFC 4IPGA 1K8AC 5IGEA 2N1VA 2MQHA 4HAEA 3H09A 1YNXA 1AYFA 2MBHA 3K57A 3PIP3 1CK1A 3R2TA 5EE3A 2PW9A 3SDLC 1STAA 3J81E 3HGBA 4RWSC 2K5VA 5IO9A 2RHSB 2IWHA 2F0EA 4DDID 3E9SA 2A6HC 3ND8A 3CCQA 3S2DB 2KTRA 4RM9A 4HJ8A 3V6CB 2NN6I 1MJEA 4O42A 2PKOA 1ZOYB 1D5XC 3L08A 2K9XA 3RYTA 1TS5A 4GKKQ 3VFKA 2XGTA 2MBOA 3QCAA 1Y1VG 1GOZA 2R7ZG 1MHWC 4JOIC 1EU4A 2FUHB 3K0YA 3STBC 4JBMA 2ZPNA 3F2DA 5CX3A 5G2NA 1L1OB 4IUQA 2NPTA 1QOHA 2V3NA 3MA2B 5BN4A 4HEDA 1C48A 4YY3Q 1E7VA 1CKNA 4W9JA 1MIUA 5CBEE 1RFKA 1HZ6A 2KJ6A 4JGHB 2LHEA 1EUVB 3QK0A 4XGAB 1LT4D 2LRWA 4HDQA 4L2YA 1XMOL 4DXFA 3IAS1 4K81A 1FEHA 2B3GA 2Y0SB 2FINB 1YNTE 1MKHA 2N9XA 4H0LC 3ZVVA 2Z0DB 4EZJA 1WJJA 2JRIB 3EFXD 2N4FA 2JP1A 4NPSA 1FRRA 1GUWA 2B39A 3VYUA 4IFDJ 1AWDA 3A0JA 4XQNA 1S3OA 1QNUA 2KVZA 3Q14C 3H7SA 1HZ9A 1JOOA 2RA4A 5G3LD 2ZJPA 3PO3G 4XDXA 1ILPA 2PYKA 4FNFA 2LMCB 2CW0C 3HKZB 3KOJA 2DZJA 4OO1I 1RLFA 4ITKA 3FILB 4O2DA 2BF8B 1C9OA 4B08A 4XDCA 1WZ0A 1P7EA 2N7EA 1JQ4A 3S2HB 2RGFA 1CSPA 3GTJH 1R4MI 4A3MB 1JJ2A 2K28A 2DNCA 1FNUA 1X54A 2P5ZX 4L6TB 1K9MC 2YEPB 2XWJB 4PZ6A 2CVRA 1H4RA 1E1OA 3N52A 4OVZA 5C44B 5IYCG 1PA6A 3DWMA 1WIAA 2ZXPA 4JPBW 1PH9A 1IKMA 4IM3A 2F3VA 2UXCL 2VZKD 3CC7A 1V8QA 2C7NB 1VQ7A 2R93H 2V1YA 1SYFA 4ILWA 3PGZA 1B44D 4KHPQ 2CWAA 3CCSA 1D5ZC 3I57A 2WXNA 3W5OA 1WSPA 2Y5BB 1L1OA 3R8BA 3LB8C 1N63A 4E6IA 3QQ8B 1VQLA 2NVTB 1WI5A 4DR1L 3OSOA 2IY5B 3P1MA 3AB9A 3NBHB 3FAHA 1MI0A 2ID0A 4AQYQ 2XRQD 2OEOA 2KMMA 3DOWA 2J7ZA 3CMMB 3VH4B 1PRTD 5CV7A 1WF9A 2K6DB 4Q2JA 1MGSA 5C4HA 2PQAB 2UUBL 2PZUA 1VQGA 3OPOA 4HN7A 4DAYB 1FJGL 4DR6Q 1FIQA 4M8NA 3LWUA 1ASYA 1NDDA 1I50B 5M5WH 1JB7A 2FAZA 2L0FA 3EECA 4HK2A 2PEAA 4M00A 3TEZA 3M3YH 2RSOA 1Z6HA 1TZOA 3RN2A 3D8GA 2HT1A 3VR2A 4QGUA 2Y5PA 3PV0A 1BQQT 4FJVB 4KSLC 1R4MB 1F9JA 1IBKL 1TKYA 4DR2Q 3HOUH 2JA6H 3Q3MC 2LMCA 2WDRB 3U9SA 3FILA 3T56B 3NENA 2NBUA 2HIVA 1EFID 2EYOA 2Z1CA 3MHBA 1X3EA 2W3SA 1SBBB 3QWNA 2A5UA 4KN7C 4QL5A 2UXDQ 2LJIA 5D2MB 1HNWL 1IHZA 1PFBA 1NSNS 5IWAQ 3PO2G 2D5GA 2Q8TA 2HDLA 1CZWA 3CU7A 4QUCA 1P9DU 3KW5B 3NELA 4CYEA 4DPGA 3VR6A 4ICVA 2PNRC 5JZEB 3E56A 5EJWA 1WH3A 3FVQA 4R4QA 2EYPA 2AYOB 1H9JA 4OL7A 3M3JA 1YHQA 1VD2A 2M9VA 1O7ZA 4JOIA 1TZ1A 1Q81C 1DD2A 1V8CA 2BVCA 4FVMA 3CW2C 4ZQ3A 1Z5SB 4DV5Q 2O2VB 2LGIA 4IUTA 4HJKA 4HROA 4ZYSA 4DGZA 3F2UA 1BBWA 1PVOA 4X64Q 3RULA 1P0RA 1I4PA 3D6CA 4AS1A 5BMHA 3NBHA 3TDQA 4OONA 1HUMA 4JQWC 1S5BD 3QB3A 3TN2A 1VCIA 2LS01 1BDOA 3J80L 3P4RB 4REZA 2EJMA 3CD6A 1LM8B 4LLGM 5AJ3L 1WI0A 2EY5A 4LFAQ 1N34L 4YTNB 4MDKE 3PZ8A 4NJ6A 2V0GA 2PQAA 1Q8KA 3VUWA 4DAYA 4BBSG 3JAMi 2NB0A 3N32A 4CBVA 3KQ4A 4JI0L 2A19A 4X3TA 4I7ZC 1FPYA 4F7ZA 4J6HA 3L54A 1E10A 4DKAC 3P4PB 5JEAH 2DY7A 4KKIA 2IGHA 1A2TA 1BOSA 1ICWA 2MQJA 2VQEQ 3C3LA 4AIMA 1XYIA 1JMLA 4IPHA 3MJWA 5EGTA 1W6JA 5ISRA 1SRUA 4HIDA 5E7NA 4PV1C 1UD7A 2C60A 3EUB2 4V0BA 3HRZC 1R4NI 2HE7A 2KT7A 3H9DA 1HQRD 2JA8H 5C1ZA 3K81C 5KHOA 3MEFA 3VTVA 1ZXHA 4DXAB 2FFKB 3Q8DA 3DVNU 4M02A 1F1HA 2L0CA 1GUNA 1PMRA 4OVUA 3ONAB 4JIOU 1SSNA 5C23A 1JQYD 3A1QB 3EROA 1WJ6A 1I4XA 1Q1EA 2DLBA 3ALBA 4KY5A 5BMIA 4ZRZA 4OEMB 2E75C 2XEWA 3I2ZA 1KRHA 4GMVA 2R7FA 4LF9L 1N6ZA 1EY4A 2KJHB 5DLQE 3OOCA 3IHPC 5BR8Q 4A3LG 1GUTA 1XTCD 4OVVA 2WDQB 2J0TD 3HOXG 3AV8A 3KWLA 1SE8A 4LW1A 3LJ3A 1JORA 4DF7A 3UDGA 3M95A 3NOBA 2KEEA 1HCZA 1IBLQ 2ZCCA 4OZBA 3BINA 1N33L 4WFN3 2JE6I 4MSQB 5GROA 1JROA 4LK1C 4A3EG 3OIQA 1HHVA 2UYZB 1SFOH 1IBMQ 2BS4B 2EIFA 1X32A 1NENB 3I4MH 3KVFB 1SEBD 2BYTA 4RFBA 3BG3A 2VUMB 1K53A 2UUCL 4X65L 2SNSA 1RM6C 1EEID 3GTOH 3HS0C 1G6PA 1N32Q 1C8CA 2I38A 2EJGC 5BN3A 2IGDA 1PFDA 5IGGA 1DOKA 3NZSA 3I63C 1VF5C 4ZUIA 4KK7A 2DENB 1R4NB 4MGKE 2I5MX 1FRDA 2EYMA 3RZOB 3BVGA 4A3DG 1HZCA 2GOWA 3DDCB 3PO0A 3PF4A 3PVLA 4QJFA 1XJVA 3AB5A 3HOVH 2O5JC 1CSQA 1X3QA 1W3SA 3ABVB 4P16A 5FLMG 2JA7H 3DVGX 1RODA 2ZVNA 4GDKB 2VB2X 1NY4A 4BXXH 3AU7A 2VNUD 1WX8A 5E4WC 4KDLB 2K5DA 1HZ5A 3GE8C 4J1MA 4HPPA 4V190 1SXTA 1X65A 3GTGB 1N5XA 3A8IE 2PNHA 3A1QA 5FKAC 1QVFA 3WAMA 5NUCA 4BAXA 4ME5A 2DHZA 1WR1A 1P98A 2J52A 5C0XG 2WIIB 2WKDA 3M4PA 3HK0A 2OT2A 3UIOB 1WWTA 3UGBB 1DOXA 2M4NA 2GBRA 4JI2L 1V97A 4MSMB 4AP4C 2VRRB 3HHMA 4IFDI 3TEXA 1R4QB 3CCLA 1XMOQ 4C3HH 4JV5L 1EF1A 1OTCA 4WORA 3RUZA 1XNRL 4WWPA 3VRBB 5IKCM 5C5MA 3E6ZX 4EZKA 4Q0FA 1PYSB 1E3PA 2G5DA 1Q86C 2LGDA 4BKSA 2CHXA 3AN1A 3PHXB 1N9WA 3PV1A 3MC0B 1X55A 3IG3A 3ZJYC 4UP7A 1TKWB 1A62A 1WGRA 3K5MA 3NTKA 2VQFL 2WHIA 3NZUA 1A70A 2EDGA 1ZKOA 2JA5H 1O7LA 1F9QA 2WU2B 3HG9A 3PZ7A 2KK8A 4ZRIA 4KD3A 1F2LA 4H7BA 4DV1L 3WDNA 1RHPA 2E2HB 2ICEC 4ICUA 1D3ZA 3ZLZA 3TBIB 5KYIA 2W9NA 3L13A 4CDDC 3ULPA 2F0DA 3FRPB 4HJAA 2BDNA 1WXMA 2J53A 4AUQC 4HCSA 2LEKA 3QR8A 1FNVA 3W3AA 4TVAB 5GAEC 4LJZC 1LTSD 4IJHA 2LUEA 5EKIA 5BMGA 5BYQA 3IT6B 2L4NA 1FFUA 4X66L 1V80A 1EWCA 2EZVA 2UXCQ 4GDKA 4DDGD 2C9WB 3WCQA 4EUTA 1VQ5A 3NS1A 4ZHPA 1P1AA 3J80c 4HEA1 4C3JB 3I4NB 5EKLA 2R92G 5JEAJ 3TP6A 1VQ9A 1Z2MA 1Z7TA 1WD1A 2LXAA 3N1YC 5GAHC 4MACA 2GA4B 3FMCA 4NQKE 3CP0A 1HE8A 2DX5B 2MNAA 4HMIA 1NBFC 4DR1Q 1SF0A 4N8FA 2CHZA 3PSEB 4FDBA 2NVQH 4DBGA 1YN4A 2KC1A 2LVPA 3K5OA 1TWHH 1YJIA 4A3OA 4EQ5A 3H7PB 2DJFC 5C4XH 5JHAA 3ULJA 4TKNA 2KC2A 3NP8A 1HFGA 1M8AA 2IX3A 2FIFA 1SIFA 4NAWB 1G51A 4HIKA 2UUBQ 2K5NA 2IJ0A 3S17B 1FJGQ 1L6UA 1MFWA 1VQFA 4LNIA 1FGBD 1ZYRC 2EOTA 2TSSA 3NTHA 5HHDG 5GMVA 2LY7A 1H95A 1WYWB 1UWXA 4R3DA 1KTKA 1OXTA 4WJWA 3V2TA 2L55A 4BBRH 1X6OA 3U50C 2WS3B 2WINB 5CHVC 3BU2A 5DPSA 4BA2I 4GGQA 4YL8A 3HM3A 1IBKQ 2O6VB 1ENFA 3NSWA 4QF4A 2VY3A 3L2PA 1PHJA 3RI7C 1V5OA 1V9JA 2F0LA 2EMSA 3PMFA 2HJ8A 4ULLA 2KUMA 3VYRA 1J7BA 2PMVA 4L5QA 2E2JH 1YNJD 3CCJA 2ZCBA 3NVVA 1HNWQ 1ASZA 4J3OD 1VCBA 4FF1A 1WX9A 4RM8A 2UU7A 1ZKHA 2QC8A 2AX5A 2NVYH 2MBBB 4ANVA 1GUAB 3IVFA 4DHJD 3H0GG 3IL8A 2SAKA 1S4ZA 4A3BB 2RPVA 4XQQA 3RZWC 4ANXA 2N49A 2KQ4X 5C2TB 1M1KC 1Y8RC 4CO7A 2KLCA 2HTME 3CCUA 3M4OH 1WFYA 1JRUA 5HG2A 1QCBD 2A5HA 3FDTA 3S1QB 1HR0L 1XQQA 2MEKA 1VQIA 3HOZH 1VS0A 4X3KA 4CGYB 3L16A 3H3VC 1N60A 4GSWA 1XEEA 2LSSA 1L0YB 2QGQA 2G3QB 1FR3A 2ZXRA 2FCQA 1PTOD 1YNND 1K8MA 4L5TA 3G7LA 3H3VI 1S1QB 2BKRB 4LUVA 4K2LA 3P20A 1B3AA 2L9HA 1VQMA 3RNUA 3H7PA 4DAMA 1DOIA 2MPMA 3RLFA 3IAYA 4HPMB 1CQFA 3ZKJC 1U4MA 3UE1A 4MIUA 2K6AA 2B2YC 5AJ3Q 1I3QH 1PFNA 2AQ3B 1N34Q 3M4YA 2CJNA 4OGQC 2DWQA 4NAWA 1XCTL 2NR2A 3DBHB 2WXPA 1OXSC 3DCGA 1TIFA 1JE4A 3N3KB 1SAPA 5M3MB 1LFDA 1M90C 4JI0Q 3CCVA 1NMGA 3PGEA 5DPWA 5BYSA 4MN3A 4HDOA 1RDPD 1C77A 2N9EB 2I1KA 3RMKC 5G5HA 4IM0A 4FXGC 2A73B 4JI7L 1LTTD 4XYQA 1EOTA 2O6VA 2B29A 2MBEA 4FF4A 1F2YA 1ZW7A 3IT4B 5CR3A 1YD8U 1X3GA 2W3RA 4C3IH 2WGSA 4IN3A 2MHJA 2GMIC 5C0XJ 3MEHA 2X8XX 1YI2A 1E90A 3RT3B 1H9RA 3FP9A 1VQCA 4A3CH 2UWQA 2RD0A 3A8KE 2FBWB 5CV5A 3HOYH 1T5XD 3G6JB 5M5YB 1QZHA 5IY0A 1XMQL 1BXTA 3BDLA 2RF4A 1I7HA 5A2QE 1TBEA 5D3IB 2BS2B 3LXFA 1MBYA 2MJ8A 2Z6BA 4XT3B 4A93H 2Q2UA 2B63B 3NVZA 5FLXc 2K05A 5M3FB 1I4HA 4NJ7A 1OQRA 4LMQD 4BY7H 4P1CC 3D31A 3UI2A 2Z6KC 4LF9Q 1LYLA 1V1PB 3NEMA 3PLVA 3ZJTA 2F0TA 4JI3L 3JAME 5D65A 1XXGA 2K5WA 1EZ8A 5KEEA 2K03A 1X1MA 2LFIA 2VZAA 5K36G 2JQRB 1K73C 2Z9HA 2PTLA 3ZRFA 3BZDB 3HKSA 1WZ3A 2DYOA 2WDTB 3N9YC 4IW0A 1PRTC 1Y1VB 2R7ZB 1N33Q 3DQVA 2BBCA 4OELB 3NZ3A 2INPE 2ZJDA 4CDEC 1W2BA 1QJOA 1Y1WH 2KD0A 2BW2A 1H9SB 3CCEA 2V4IB 3PUWA 2M0XA 3DHIC 3OLMD 3ZNZB 2UUCQ 3BJUA 4DFAA 1WTWA 4X65Q 1N5WA 4W9GA 2E74C 3RLOA 2LI5A 3AE6B 1GO3E 4HWIB 1GHJA 1LT5D 1SMYD 1E8XA 4RGOS 5COYA 2L3ZA 1GAQB 3ZQ4A 1PZJD 2D5DA 1VQNA 1B9RA 4RA8A 3BY4B 2G4SA 2WAQE 1RD9D 4KDIC 4A3KB 5FO7B 1EUJA 5JJLA 1KH0A 1HR0W 3FPPA 3H6MA 3U4ZA 1WCMG 3I9V1 3X23A 4TKOB 1AP0A 2IY1B 1U5KA 1TY0A 2D10A 2KHJA 3PUVA 4C2MB 4A3IG 2A68D 1RRBA 3RLNA 1T0YA 3L0WB 4ZRQA 3TQYA 4LNQA 2BB6A 2EKEC 3S17H 3PO3B 4PZ7A 2REXA 2BB5A 2IDYA 2WP8J 3MZ5A 2LXJA 2ENBA 4D2KA 3QJYA 4UDUC 1ROEA 1V86A 2GI9A 2KZRA 1X3FA 1KLGD 4G3XB 2VZKB 1S3SG 1B9MA 4ZKBB 3IFWB 4N58A 4PYZA 4W9FA 3W1GA 2NMQA 2C5CA 2EJFC 1SMXA 2VH1A 3P4QB 2WAQG 2PW7A 2F0GA 3J9CA 3SGIA 5IGCA 1EOVA 2VW9A 1VLBA 5G3LF 2UU9L 2IX0A 1Q1OA 2JT4B 1V1PA 3K8AA 4IUNA 4RF1A 4JI2Q 1BO0A 1MJDA 3V61A 2L32A 4JV5Q 1TS3A 1XNRQ 3PRMB 3CKIB 3LYYA 3JVZX 1P16A 1R4PB 4K14A 1VQBA 3BWUD 2K50A 1PRTB 1VQ8A 1T6BX 1B50A 1FXTB 3RD4A 3KLSX 2IO1B 2Q2IA 2K52A 3B2FA 5HGQA 1J19A 3GTPB 2VQFQ 3E0JA 5L37A 2IO2B 2B2YA 2Q5WD 3RNAC 4C56C 5IT9L 5JH5C 4HXDA 2HD3A 3ML9A 4J6IA 2BH2A 5IYBG 3TEWA 1H9SA 3TCAA 3G6EA 4X6AH 3ETRA 2HDMA 2QKIC 3VYSA 1NNXA 2R3ZA 1STYA 2RVLA 4DV1Q 2B8GA 1WTVA 1YQ4B 2E2IB 3EFUA 2EMTA 1HJPA 2L11A 4JLCA 1N36L 1Q0WB 1ACCA 2F0VA 4IO9A 2BPSA 5CGKA 3GTLB 1PH5A 3T4AC 5EE0A 1E24A 3E3XA 3AYHB 1G6ZA 4LNKA 5AZGA 1YX5B 3EHVA 2F0PA 2KNBA 2A6ED 1YX6B 2K75A 5GAGC 5JPNC 2MW5A 4W9KA 2K0PA 1QVGA 2F0SA 5JPMC 2WXOA 3LDZE 1J7AA 4X66Q 5HY6A 4R8IA 1KAWA 1YZ6A 1E7PB 1U9RA 2F0OA 2B2UC 1PZID 2KCCA 2EXZA 3ERQA 2MX2A 5EBDA 1ET9A 5IA7A 1HXYD 1IGCA 2QDLA 4JVZA 2K4KA 3SE0A 2C9OA 5E3FA 3DHHC 2PVGC 1B9NA 1U4RA 1MHXA 4P7IA 3ZNHB 1YIWA 3S24A 1LM0A 4DV4L 2Z6KA 2I5HA 2AHOB 3PO2B 2K5HA 1ZP0B 4YCUA 4A3FH 4OZCA 2BOSA 2RHQB 4LAAA 2D3AA 3N1XC 1XLOA 1WGGA 2GLSA 2BDOA 3CIRB 4IUMB 1CT1D 2LKVA 3DUZA 3FKIH 3WOEA 2ZVOA 5E6PA 1WR6E 1XPUA 5C3EB 4GDLB 4GOCA 3JW0X 3BZCA 4YWLA 2BYFA 2GBNA 1YHBA 4IOCA 2B63H 1WE6A 5M3FH 3KFUA 3A9JB 1I4RA 2OXPA 3AMUA 1M94A 5EDSA 3B1LX 3UDIA 2FNJB 4QY7A 1OGWA 3VR4A 4LTUA 3KK7A 4K8JA 5FK9C 3GTMB 1B53A 3KWVA 1RCVD 1UNSA 5J3BA 1NAPA 3CRKC 5I2XA 3ZRCA 1C4PA 3TREA 1BCPD 1HQMC 1EZ6A 2F0JA 3ICEA 3APDA 3KYDD 5L83A 4YSXB 4IPCA 4A3GB 1CKMA 3U4VA 1Y1VH 1RTNA 5IAAC 3GTQB 2B76B 4K6LA 2ONQA 4I7AA 4BBSB 2CKZB 2L1BA 4B6WA 4B95A 2QJLA 1G2SA 3S15H 3DEOA 2PI2E 5CV8A 4CKBA 1ZDXA 2RSNA 2GBMA 4A75A 2KACA 3K59A 2R93G 2WYQA 2W54A 1D1KA 2QA4A 4XYCA 4F1SA 2UUAL 2L05A 2WXKA 3TIXA 3PHWB 1II3A 5FJ8H 1XCQL 1HR0Q 4ZKCB 4PMWA 4A3KH 1EM7A 1PGXA 2J4XA 1S5ED 4TUUA 3HOWH 3D6WA 4C2MH 2E5LL 2M1MA 4DU9A 4FP5D 2J42A 4A8XC 1LTBD 4PQXA 2L12A 2L76A 2RBMA 2LRUA 1QG7A 3QX1A 3RFZB 2HJ1A 4WJOA 1FM0D 1T5EA 3AEEB 4QIWE 1QQRA 1OEYA 1H9KA 4C7ZA 2L0TA 5J17A 1WXSA 1SYDA 3S1MB 4GDLA 1Y8PB 3IFDA 2F0FA 4FO2A 2KENA 4N9PA 1JWBD 1TQOA 2AEHA 2N9PC 3HOXB 4U673 2HQEA 2YEPF 4TSSA 1VF7A 5T1IA 1DM0B 3A9JA 2LFNA 2CR5A 3T51B 3SK5A 2RMMA 1CMXB 4C1NI 4Y52H 3HOUG 4JI7Q 4LK0M 3VUYA 2JA6G 2MCNB 1TWFH 1JALA 3L17A 4KZ0A 3ZNGC 3M4QA 1HNZL 4IWQA 4KV2A 3TZDA 4A3EB 1H9MA 3NS8A 3A33B 4JL9A 5IODA 4P73A 1WE7A 2CH4A 5AZFA 2XTIA 1SJHD 2I07B 4U68A 5IP9H 1C78A 4RF0A 1N62A 2ACZB 1STBA 1XMQQ 4IWOA 4ARIA 1LTGD 1UEBA 4JI8L 1WMHB 2ASQA 4H2AA 1JE5A 3W5VB 2FUG1 1GC6A 1PQSA 3AEAB 1R9TB 3L10B 2KN5A 3I55A 2A1AA 2B2UA 3B6YA 3I91A 3E9HA 1NVID 4FLHA 1H8CA 4CKCA 4O1NA 2FCSA 4TV3A 2K33A 4Y7NH 4JI3Q 1I6HB 4K6DA 4HCNB 3O65B 5IT9c 2ZZPB 1K28A 4DNRB 1D1IA 2SOBA 1DOYA 1TWCB 4DN4M 3Q8CA 1DJRD 1TWGH 5CBAE 1IP9A 5ELEA 1BT0A 4G7OC 4R1JA 4B9WA 1Y56A 3U4EG 2K32A 2F0UA 1TWAB 1RFAA 3B9JA 3CCRA 3TS2A 2Y0SE 2L83A 1SE9A 2F1MA 3KF6B 4DV0L 4K8IA 3JC66 3AEVA 1UBIA 2MO0A 2ZTEA 5LMNL 4LF4L 2JSVX 4EE2A 4NY0A 2NTSA 2EYLA 1QOBA 3V60A 4BA1I 2V3PA 4HMJA 4ODGA 4K0KL 3I72A 2JYOA 2PPHA 3T1HL 3TJPA 3UF8A 3J81c 3S2DH 3C0RB 2I5LX 2TMPA 2YTYA 3DMUA 3H94A 1UGMA 4Z9CB 1XLQA 2WP9B 5HKHA 3K58A 1PGAA 5DPRA 2N1WA 5JEAG 2MRPA 4ABNA 2RDHA 4QMGA 1YOVB 3P75A 3RN5A 5GXGB 5JXVA 1GPXA 1GUSA 4DUYL 4MNOA 1A3UA 4NP5A 3L7ZC 1TT5B 2PW5A 3S9WA 1HA5A 1F9RA 4DR3L 1AH9A 2LASA 1YNJC 2ALYB 3H6NA 3G71A 3A8JE 3PREA 5C3EH 2JA8G 3J7ZC 2AWNA 3I5JC 1EY5A 3C19A 1UWMA 1JR0D 2DYBA 1A0IA 2N7DA 2KHSA 3TS0A 1IW7D 4ACFA 1WMHA 2QDBA 4JCVE 4KN4C 4NXNL 2E8GA 1XO3A 2KX0A 2MJDA 2OJWA 2E6XA 4X62L 4MTNA 1E9MA 1WX7A 4RKBA 2WB1E 3RNBC 4PMCA 4OIJA 1MSHA 1T3QA 3MHSD 5IIFA 4AJYB 1J7CA 1KF6B 4K7WA 2UU9Q 2FCMA 2N9KA 4DHZE 1I94L 1K52A 3PPAA 5H92C 2LXKA 2R2QA 1VZ8A 4A3GH 2WFWA 1RF2D 1LT3D 3J7YW 1HH2P 3GTQH 2MFIA 2IL8A 5D3DA 1PTOC 1YNNC 4FJZA 1SGHA 5HGTA 4C00A 3R66C 1U0LA 1NMFA 4FF2A 4B3RL 3S2HH
chains in the Genus database with same CATH topology
1SDFA 1B2TA 2MGSA 4XQJA 1L4ZB 1GHKA 4YSYB 5BN5A 1HTLD 4NJCA 2NN6H 5DM63 3S1RB 1E6EB 2HDEA 3AM9A 3ITPA 3X3MA 5EBCA 1G8ZD 5E6JA 1WYGA 1C9FA 3X3NA 1SNDA 3PIO3 5C3JB 3HZXA 1MI2A 4BY1B 4DQOC 4DA2A 2NVXB 5JVG3 1ENCA 1FCCC 1SYEA 2ICIA 5AUIA 1SIJA 1VDZA 1F9SA 3GB1A 2E2DC 2DN8A 4EGVA 4TRDA 2M2LA 1VZ6A 5ELBA 2KCNA 1EYCA 3P42A 1Q8IA 4A3JB 2CQAA 3HVZA 4TQUS 3MXGA 4RHRA 2EELA 3AE8B 4K5WA 4OO1H 5I6WA 1ESFA 2K1BA 3H0GB 2DBYA 2NUCA 3Q23A 4C3HG 2JYEA 3QG1A 1PTOB 1EL0A 2PLPA 1DXMA 1XLNA 1TKEA 1MPEA 2KWDA 4MM3B 4NW2A 1GB4A 2JWUA 2WXMA 2Z4HA 4QUFA 4KX6B 2RDGA 1L5PA 4WURA 2YYZA 5FLXL 3M7NA 5C4JB 3K6OA 1XF5L 4P6VF 1SMYC 3R93A 3C2PA 3MHZA 4XIGS 3RZDB 5DNFA 3GV3A 2W55A 1DCZA 3R2IA 4MH8A 1C4QA 2A68C 3EJIA 1BR9A 1NUCA 2SNMA 4HSPA 1WTXA 2KAJA 2H1EA 1UEAB 4RHSA 1PGBA 1KLUD 4JWUC 5KIXA 3D4WA 1EWYC 4QB4A 3IAM1 3H91A 1NR2A 3OW7A 2E3TA 3DEPA 1AFPA 1STHA 1X3PA 5HI1A 2MP1A 4OW0A 3HP3A 2JU6X 1VZ7A 1WVLA 3OMGA 3S1NB 2KN4A 1LTID 1FNWA 1P7FA 1KFYB 3R3OA 4JWSC 2MJEA 3AEFB 1A6XA 1PFMA 1C79A 2F0MA 4ID6A 4IUVA 3PUYA 2I2YA 5KNDA 5EQ0A 3B2GA 4DXGA 1NYRA 4XWTA 4M1UB 2BS3B 4OZAA 2CJOA 4A90A 1OO9B 2A6EC 3MTSA 3PUXA 5BYRA 2VXWA 2EYJA 2H4OA 2EVBA 1FO4A 4RH6A 4BWGB 3S16B 3CRLC 2B2WC 4CJ1B 2KVMA 4IALA 2KA7A 3OHXC 5ELCA 5C3XA 2WDVB 1CJEA 3MFYA 4PNYA 1TIID 2EY2A 2XIWA 1AN8A 1JOQA 1NCVA 4A3IB 1QF6A 3Q69A 1TS2A 4ZUJA 2WACA 1E0ZA 1XX8A 2Q8RE 1NYQA 1QB5D 3ZJVA 1K83B 2PQEA 1AEXA 2R6GA 4I65A 3OMCA 2ZT9C 1JRPA 4US9A 2DYMA 2PVOD 1VDVA 2N55A 5JVH3 2WAQB 3MWYW 3GO5A 1TYGB 3EGRA 3GP7A 3BVMA 1DOLA 3AEBB 3BYTB 1UAPA 1VR9A 1E2VA 3K5NA 1BCPC 2O5IC 3T3OA 5M5XB 4C3IG 1IYVA 3AEDB 4B0MA 4C7YA 1E0BA 1B4OA 1JWUD 4Q5VA 4G7HC 3KUPA 1G2TA 2H89B 3FC4A 2G1EA 4A9AA 2WQYB 1EYDA 3VR9B 3Q8BA 2B2TC 2O4XA 3BK1A 5A2QL 2N88A 5LL6X 2O2LD 1J8IA 4FXDA 1PXUA 4DAPA 3MXNA 2FMCA 3NPPA 4JBWA 1CI3M 3CWIA 1V1OA 1F0ZA 2QIEB 3JAML 1WTQA 2ZW1A 3VQIA 1CHQD 4IUUA 3NRZA 1R7SA 1S5FD 4PT5A 2XN9C 3KLRA 2BA0A 1SNMA 2RKSA 3D4RA 2XWBB 3GS2A 3MFGA 3NUCA 4HKZE 1XWEA 4S3SA 4KMUC 4DAVA 3I73A 1YN5A 1C4CA 3TUOA 4F87A 3I3CA 4C1NK 2KEDA 3Q8EA 1ZDVA 1QOAA 1BCPB 1KABA 4KHVA 1PZKD 4YWGG 4IFDH 1LLRD 2KOLA 5KNCA 4GZYC 2JSOA 3MXPA 1WTOA 1D2BA 3P1HA 4RGTA 3SHLA 2WXJA 2EKIA 1O78A 4NMZA 2JEBI 3MJ5A 5A35A 3GTJB 1O80A 2PIAA 2B2WA 5G5GA 2QEJC 1BUVT 1SE3A 2AWOA 1PDXA 1WD0A 3Q22A 1EY7A 1DYQA 1F2MA 4EQNA 1F2RC 2N7JA 5FOBB 4TQ1A 3ZYYX 4B9XA 3TP7A 4YT0B 2IX1A 1F2RI 2LHDA 2QSDA 3NQTA 2R93B 3I90A 2X69A 3DWAA 2JX5A 5JAVA 3BK2A 1ZXTA 1QOGA 3C8YA 3L4PA 4KGTA 1I6VC 5CV9A 5HURA 4XTCS 3C46A 1Q3LA 4HJGE 1RKNA 3NE5B 1CTMA 2GRIA 3MVVA 1GJXA 2H88B 3NWSA 2K5QA 1VRAB 2F0NA 4RAUC 2G9HD 5M5WB 4KI0A 1KNAA 4HR7B 4WH4A 3M3YB 1KNEA 1JCKB 2K22A 2NYZD 1SYBA 2D2CC 4HTHA 4YSZB 1ZEQX 4K5XA 2JA6B 1TR5A 1IW7C 1IGDA 5EPLA 1EEFD 1DZ1A 2A69D 1CZPA 1PRTF 2B2TA 3J81L 2F0HA 3BS1A 1ML0D 2FHTA 2WKCA 5IT9E 1YMHE 1F77A 1ZE3D 2V4DA 1I4GA 3VRAB 2RQXA 1ZUD2 2LUMA 1F2ZA 1MD2D 3A54A 2FMMA 3Q0AA 2F4IA 3C1FA 5CMDA 5MPOA 4IZ8A 1CZGA 5T1GA 1IBXB 3SDZA 4C80A 3HRDD 1O7YA 4M0WA 4DK1A 4IURA 4NKLA 1YQ3B 4IUPA 4RGMA 3AMZA 4YXDB 3OWEB 3L3OC 1RJTA 1TVXA 2WNMA 5CC4A 1BMLC 4HCEA 2WXLA 2E76C 2ON8A 2NWGA 4H13C 3TEYA 2XRSD 4CJ2C 3Q8FA 3BDCA 4R9WA 4DNTB 1FFVA 3U7ZA 3NVWA 5JJZA 2JZPA 3HVDA 1Z47A 3O13A 5DAUA 2INNE 3T13A 4UAIA 1RTOA 2DY8A 1TS4A 5I6YA 2JA8B 1SNPA 4M8AA 4KHZA 3GQBA 3EQLC 1L6VA 4X3UA 2Y3AA 5AUKA 4X3SA 4IOIE 2JXMB 3E5SA 2K3UA 4KJOA 4WAFA 4R8NA 2WU5B 1DONA 1K8OA 1A3TA 1IBXA 5I2YA 2F0QA 1FYCA 1PYWD 1KDCA 3LNNA 3MAQA 2IW3A 4KY7A 4G4KA 4L23A 4PMBA 2DNEA 2WLBA 3AE4B 3DWGC 3L9AX 3U9OA 1HFNA 1SFOB 5C0XI 2WV6D 3V05A 3CHBD 2WB1B 4KY6A 3I4MB 1PLFA 5KNBA 5DM73 2SEBD 2X38A 4K5VA 3GTOB 2D62A 4CKEA 2QILA 3W2DA 2WXIA 4K2KA 5C3WA 3NVYA 1OFFA 4USAA 3HOVB 3M85A 2Z4IA 2BE5D 2JA7B 3HUIA 3DHQA 2F03A 1WXQA 2WXHA 1SE2A 5EPJA 3TSSA 3GV6A 2F0IA 2EPBA 2CHBD 3W1SA 1HUNA 1L4DB 4NDXA 4A3DB 1NI3A 3BIID 1L0XB 1TJEA 1KDAA 3AE1B 2EY1A 4KKJA 4IKGA 3KBGA 1Q1BA 5C5LA 4C3HB 3KBXA 2KECA 5K5PA 3K7AB 4OHJA 5J39A 2K5PA 2M19A 1FD7D 3AE7B 5FR3A 1E2ZA 2F0WA 4KKTA 3QOJA 4ZLTF 3A7LA 2AQ1B 4WIPA 3VR5A 5KRUA 2JA5B 4XE0A 3TP8A 2X6GA 5C4ZA 2Q8IB 1BBXC 1ZPSA 1OXUA 4TMAB 2BA1A 1STNA 1I4QA 5H8YE 1IL8A 4L63B 4IDIA 3K5LA 5EPKA 3J7AF 3NXWA 1C4AA 3Q8AA 3FEWX 2X6LA 4ZRPA 3VA7A 1HTPA 3J80E 1FMAD 5J22A 1EIHA 1K51A 2NZ1D 4JK1C 3DWQA 1QNKA 5C6AA 1SNQA 1OXXK 4EQOA 1ZXIA 1JB3A 1EQVA 4FF3A 4AYBB 1JW9D 4DK0A 1EY6A 3PUZA 3GTKB 3P4SB 2NN6G 2OF1A 3DXJC 2NVQB 1TWHB 3TMEA 2L1AA 2R92B 5IGDA 2XVSA 5C4XB 4KKSA 4HSVA 1U4PA 3BYYB 1WRIA 1AZPA 5KGUA 2FE8A 2A6HD 4BBRB 3LWEA 1QE6A 1SJED 1SYGA 1TT2A 2ZW0A 4ZHOA 2KQ3A 3AEGB 2PPBC 1KAAA 3N6RA 1HEZE 2E2JB 4J8QA 3MP9A 3V96A 2R61A 3C1EA 2EYHA 4KTAA 1MHHE 4ZOHC 2HCCA 3KLSA 1TU2B 1LACA 4OO1G 2NVYB 1Y8NB 2MH7A 2M56B 1SE4A 1HRJA 3P63A 3M4OB 2N9LA 2PO4A 1WGKA 1EY9A 3AE9B 3HOZB 1Q10A 4BS9A 3NBIA 3URYA 3SK4A 3EVQA 3QOLA 4F8MA 5F2DA 3I4LA 3SXHA 2CW0D 5T8IA 3U52E 3NQIA 5M9OA 4KKUA 2K04A 5ELFA 1M4VA 1J9OA 3BVZA 3SK6A 3NUHB 5J1ZA 1SNCA 1WTPA 1I3QB 4RCNA 1STGA 3D3RA 4YTPB 3M7GA 5I9PA 2WXRA 1D5MC 1JWSD 3I70A 1EQTA 1CHPD 3QO2A 5IGFA 1DOMA 1KDBA 4AQ7A 1SB3C 4GLSC 4XWWA 3SR1A 1LV9A 2MUYA 4C3IB 1PTOF 1VMCA 3UI3A 4YTMB 4P2CB 5C0XH 4B0EA 3HOYB 4F88A 5D14A 5FLXE 3CQZB 5CYUA 1EY0A 2A74C 4WRDA 4A93B 2HUGA 2IGGA 4BY7B 1EYAA 4MT5A 3FPUB 5CV6A 5HFYA 2JYTA 1F9PA 3T16A 3ZJUA 5LNK1 2PCFB 2IPKD 1GB1A 2GB1A 2EYFA 3V3XA 3LX0A 4RGNA 1FXIA 2JEAI 3NWTA 1QWYA 5I4DA 5IOCA 4EVOA 4FYDA 3SEBA 5LHY1 1Y1WB 2L52A 4IQZA 4CQNA 1STEA 3GD7A 1NEKB 2HCIA 2BT6A 4HRSA 4KV6A 3SFEB 1D4BA 2K01A 1S5CD 2EY6A 1YJJA 5E4XA 1VMPA 2KDMA 2MJ3A 4NAMA 3S14B 1MVKA 4TQ0A 2A69C 3Q6SA 3EA6A 4WQMA 1MSGA 4XYOA 2BCOA 3SR6A 1DGJA 2PZWA 1CQVA 3TP5A 4KD4A 4N6EB 4H44C 5DEHA 1TKGA 1WCMB 1PUTA 4ZAIA 2XNAC 1E2WA 1ET6A 2AUJD 5ELDA 2Z8LA 4ZK9B 3IXSA 2PMZB 3H8HA 1AW7A 2YU9B 3VR8B 2QF7A 1S5DD 3BDOA 1DOYA 4A6QA 1XLPA 1TY2A 1D6EC 1RYJA 4EQPA 1A2UA 3NHHA 4CJ0B 2K7VA 3VR3A 3J7AV 3A55A 1A3VA 3OIPA 3WOFA 1QKZA 2B2VC 4F7XA 3NK9A 3Q24A 1WTRA 4MHEA 1LT6D 4KJNA 2BTEA 1W6KA 2IT1A 4FXCA 1UGJA 2FJ2A 2PZTA 2D9UA 1PTOH 3TZUA 3T53B 5AFWA 1JC7A 4L8JA 2SDFA 2AUKA 1K50A 1IUEA 2KJXA 4HKQA 3T3NA 3AH7A 2QMTA 1CA5A 2JXTA 5IGBA 2WXGA 1ENAA 1Y69U 2EE1A 5CV4A 3RPFC 4XXEA 1FD6A 1YN3A 1GXDC 1IKLA 5FO9B 1QILA 1QOFA 5FO8B 4OIKA 5D7GA 4A3FB 3SFDB 1JICA 2L5TA 1OQQA 1GUGA 5JOBA 1VJKA 2NBFA 5EKKA 2RDFA 2M0AA 4G7ZC 3FKIB 1JWAD 3D4DA 2WXQA 1EIGA 1CFMA 3SVMA 4C3JG 2N0SB 3U2SC 1LO5D 3DWPA 1G91A 2F0KA 1Q90A 2ZXOA 4JE3B 4IFDG 4JX1C 3IKJA 3QIAA 4FXKC 1L0VB 1FCLA 2I46A 5I9OA 4L1BA 1NR4A 3I8ZA 1UUPA 1ESRA 4KGRA 4US8A 3S15B 2BE5C 1OXVA 1HPCA 3A7AB 4CHTB 1ILQA 5K36H 2G9DA 2OEDA 1IYUA 4G57A 3MXUA 3SK8A 3AE3B 2XSCA 1RWSA 3HEJA 3OWFA 3VYTA 1PDQA 2OHFA 1EU3A 1SNOA 1HA6A 4JPSA 3DM1A 1BCPF 5LL6S 3HOWB 3P7JA 3RMHA 1U4LA 1EY8A 1LTRD 2F3WA 3AE2B 4WWMA 1CM9A 1FXAA 5EE1A 3ND9A 2VB3X 4XT1B 2W82A 1EWHA 2WXFA 2B2VA 3ZGZA 3W9CB 2MHVA 1SSOA 4XDDA 4RNAA 1Y8OB 2CU3A 4A55A 2NTTA 2AQ2B 4ARCA 1BNZA 1GUOA 1BF4A 1Q12A 1TWFB 1QT9A 3AE5B 1LABA 1QLBB 3NTIA 3KF8A 4KGSA 5EE9A 1JOKA 5E1FA 4NZLB 3VA5A 3HOUB 3A56A 1CA6A 1C76A 1G291 4N59A 3IFTA 3W5UB 1ONLA 2M00A 5CORA 1LTAD 4QIWB 1AZQA 4QCLA 1ZYRD 4RKLA 1BUIC 5TSSA 4N9TA 4Y7NB 1SYCA 1V43A 1A15A 1TWGB 1N61A 5KYLA 2QCPX 2B8FA 1B1ZA 3AECB 1JWMD 4RCOA 4YIJA 5IGEA 4HAEA 3H09A 1AYFA 3K57A 3PIP3 1CK1A 3R2TA 5EE3A 2PW9A 1STAA 3J81E 3HGBA 4RWSC 2IWHA 2F0EA 3E9SA 2A6HC 3ND8A 3S2DB 2NN6I 2PKOA 4O42A 1ZOYB 1D5XC 2K9XA 1TS5A 1GOZA 1EU4A 3K0YA 4IUQA 1QOHA 2V3NA 3MA2B 5BN4A 4HEDA 1C48A 5CBEE 1RFKA 1HZ6A 2LHEA 1LT4D 4L2YA 4DXFA 3IAS1 1FEHA 2Y0SB 2FINB 1YNTE 4H0LC 3EFXD 2JP1A 1FRRA 1GUWA 2B39A 3VYUA 4IFDJ 1AWDA 4XQNA 1QNUA 1JOOA 2RA4A 5G3LD 4XDXA 1ILPA 2PYKA 4FNFA 2LMCB 2CW0C 3HKZB 4OO1I 4ITKA 3FILB 4B08A 4XDCA 1P7EA 1JQ4A 3S2HB 4A3MB 2K28A 2DNCA 1FNUA 4L6TB 2YEPB 2XWJB 2CVRA 3N52A 4OVZA 5C44B 3DWMA 2ZXPA 1IKMA 2F3VA 2VZKD 1V8QA 1SYFA 4ILWA 1B44D 1D5ZC 3I57A 2WXNA 1WSPA 3R8BA 3LB8C 1N63A 4E6IA 2NVTB 3OSOA 3P1MA 3AB9A 3FAHA 1MI0A 2ID0A 2XRQD 2OEOA 2KMMA 2J7ZA 1PRTD 5CV7A 4Q2JA 1MGSA 5C4HA 2PZUA 3OPOA 4HN7A 1FIQA 3LWUA 1I50B 3TEZA 2RSOA 1Z6HA 1TZOA 3D8GA 3VR2A 2Y5PA 3PV0A 1BQQT 1TKYA 2LMCA 2WDRB 3U9SA 3FILA 3T56B 2W3SA 1EFID 2EYOA 2Z1CA 3MHBA 1SBBB 3QWNA 4KN7C 2LJIA 1IHZA 1PFBA 1NSNS 2D5GA 2Q8TA 2HDLA 1CZWA 3CU7A 4QUCA 3VR6A 2PNRC 3E56A 5EJWA 3FVQA 2EYPA 1H9JA 4OL7A 2M9VA 1O7ZA 1DD2A 1V8CA 4FVMA 4ZQ3A 2LGIA 4IUTA 4HROA 4ZYSA 4DGZA 3F2UA 1I4PA 3D6CA 4AS1A 5BMHA 3NBHA 3TDQA 1HUMA 1S5BD 3QB3A 3TN2A 1VCIA 2LS01 1BDOA 3J80L 3P4RB 4REZA 2EJMA 4LLGM 2EY5A 4YTNB 2V0GA 3PZ8A 4DAYA 2NB0A 4CBVA 3KQ4A 4X3TA 4I7ZC 4J6HA 1E10A 3P4PB 5JEAH 2DY7A 4KKIA 2IGHA 1A2TA 1BOSA 1ICWA 3C3LA 1XYIA 1JMLA 5EGTA 1W6JA 5ISRA 4PV1C 3EUB2 4V0BA 3HRZC 1HQRD 1ZXHA 2FFKB 2L0CA 1GUNA 1PMRA 3ONAB 1SSNA 1JQYD 3EROA 1I4XA 1Q1EA 2DLBA 5BMIA 4KY5A 4ZRZA 2E75C 1KRHA 1EY4A 3OOCA 1GUTA 1XTCD 2WDQB 2J0TD 3AV8A 3KWLA 1JORA 4DF7A 2KEEA 1HCZA 4OZBA 4WFN3 2JE6I 1JROA 4LK1C 1HHVA 3OIQA 2BS4B 1X32A 1NENB 2BYTA 1SEBD 4RFBA 3BG3A 2VUMB 1K53A 1RM6C 2SNSA 1EEID 3HS0C 2I38A 1C8CA 2EJGC 5BN3A 2IGDA 1PFDA 5IGGA 1DOKA 1VF5C 4ZUIA 4KK7A 1FRDA 2EYMA 3RZOB 3BVGA 3PO0A 3AB5A 2O5JC 1X3QA 3ABVB 4P16A 1RODA 4GDKB 2VB2X 3AU7A 2VNUD 5E4WC 2K5DA 1HZ5A 4J1MA 4V190 1SXTA 1N5XA 3GTGB 3A8IE 5FKAC 5NUCA 4ME5A 2J52A 5C0XG 2WIIB 2WKDA 1DOXA 2OT2A 1WWTA 1V97A 4IFDI 3TEXA 1R4QB 3VRBB 4WORA 3RUZA 5C5MA 3E6ZX 4Q0FA 3AN1A 3MC0B 1TKWB 3K5MA 3NTKA 1A70A 2EDGA 1ZKOA 3PZ7A 1O7LA 1F9QA 2WU2B 3HG9A 4KD3A 1F2LA 4H7BA 3WDNA 1RHPA 2E2HB 2ICEC 3TBIB 5KYIA 2F0DA 3FRPB 2BDNA 2J53A 4HCSA 2LEKA 1FNVA 3W3AA 4LJZC 1LTSD 5EKIA 5BMGA 5BYQA 3IT6B 2L4NA 1FFUA 1EWCA 2EZVA 3WCQA 3NS1A 4ZHPA 4HEA1 4C3JB 3I4NB 5EKLA 5JEAJ 3TP6A 1Z7TA 1WD1A 4MACA 2GA4B 3FMCA 4HMIA 1SF0A 1YN4A 3K5OA 1YJIA 1HFGA 1M8AA 3NP8A 2IX3A 4NAWB 2IJ0A 3S17B 1L6UA 1FGBD 1ZYRC 2EOTA 2TSSA 3NTHA 5HHDG 2LY7A 1UWXA 4R3DA 1KTKA 1OXTA 4WJWA 3V2TA 2L55A 2WS3B 2WINB 4BA2I 1ENFA 3NSWA 4QF4A 2F0LA 3PMFA 4ULLA 2KUMA 3VYRA 1J7BA 2PMVA 1YNJD 3NVVA 4J3OD 4FF1A 2AX5A 3IL8A 2SAKA 1S4ZA 4A3BB 2RPVA 4XQQA 5C2TB 2KQ4X 2HTME 5HG2A 1QCBD 2A5HA 3FDTA 3S1QB 2MEKA 4X3KA 4CGYB 3H3VC 1N60A 1XEEA 1L0YB 1FR3A 2ZXRA 1PTOD 1YNND 1K8MA 3G7LA 4K2LA 3P20A 1B3AA 2L9HA 1DOIA 2MPMA 3RLFA 3IAYA 1CQFA 1U4MA 4MIUA 2K6AA 2B2YC 1PFNA 2AQ3B 2CJNA 3M4YA 4OGQC 2DWQA 1XCTL 2WXPA 1OXSC 1JE4A 1SAPA 5M3MB 5BYSA 4MN3A 1RDPD 1C77A 5G5HA 4FXGC 2A73B 1LTTD 4XYQA 1EOTA 4FF4A 1F2YA 3IT4B 5CR3A 2W3RA 4IN3A 5C0XJ 3MEHA 1H9RA 3A8KE 2FBWB 5CV5A 1T5XD 3G6JB 5M5YB 1BXTA 3BDLA 1I7HA 5A2QE 5D3IB 2BS2B 3LXFA 1MBYA 2MJ8A 4XT3B 3NVZA 2B63B 2K05A 5M3FB 1I4HA 1OQRA 4LMQD 3D31A 3UI2A 1V1PB 3ZJTA 2F0TA 3JAME 5D65A 1XXGA 2K5WA 1EZ8A 5KEEA 2K03A 2LFIA 5K36G 2JQRB 2PTLA 3BZDB 2DYOA 3N9YC 1PRTC 1Y1VB 2R7ZB 2BBCA 3NZ3A 2INPE 1QJOA 2BW2A 1H9SB 2V4IB 3PUWA 4DFAA 1WTWA 1N5WA 2E74C 3AE6B 1GHJA 1LT5D 1SMYD 4RGOS 5COYA 1GAQB 3ZQ4A 1PZJD 2D5DA 1B9RA 4RA8A 1RD9D 4A3KB 5FO7B 1KH0A 3FPPA 3H6MA 3I9V1 4TKOB 1AP0A 1TY0A 3PUVA 4C2MB 2A68D 4ZRQA 2BB6A 3PO3B 2BB5A 2IDYA 2WP8J 3MZ5A 4D2KA 2ENBA 3QJYA 4UDUC 1ROEA 2GI9A 1KLGD 2VZKB 1B9MA 4ZKBB 4N58A 2NMQA 2C5CA 2EJFC 3P4QB 2PW7A 2F0GA 3J9CA 5IGCA 1VLBA 5G3LF 2IX0A 1V1PA 4IUNA 4RF1A 1BO0A 2L32A 1TS3A 3CKIB 3LYYA 1R4PB 4K14A 3BWUD 1PRTB 1T6BX 1B50A 3RD4A 3KLSX 3B2FA 3GTPB 3E0JA 2B2YA 2Q5WD 4C56C 5IT9L 3TEWA 1H9SA 3ETRA 2HDMA 2QKIC 3VYSA 2R3ZA 1STYA 2RVLA 2B8GA 1WTVA 1YQ4B 2E2IB 2L11A 1ACCA 2F0VA 5CGKA 3GTLB 3T4AC 5EE0A 1G6ZA 2F0PA 2A6ED 5JPNC 2K0PA 2F0SA 5JPMC 2WXOA 1J7AA 4R8IA 1E7PB 1U9RA 2F0OA 2B2UC 1PZID 2KCCA 2EXZA 3ERQA 5EBDA 1ET9A 1HXYD 1IGCA 3SE0A 2C9OA 5E3FA 2PVGC 1B9NA 1U4RA 1MHXA 3PO2B 1ZP0B 4OZCA 2BOSA 4LAAA 1XLOA 2BDOA 3CIRB 1CT1D 2LKVA 3DUZA 3WOEA 5C3EB 4GDLB 1I4RA 2OXPA 3AMUA 3VR4A 4LTUA 3KK7A 4K8JA 5FK9C 3GTMB 1B53A 3KWVA 1RCVD 1UNSA 1NAPA 3CRKC 5I2XA 1C4PA 1BCPD 1HQMC 1EZ6A 2F0JA 4YSXB 4A3GB 1RTNA 3GTQB 2B76B 4K6LA 2ONQA 4BBSB 2L1BA 2QJLA 1G2SA 3DEOA 5CV8A 4CKBA 1ZDXA 2RSNA 2KACA 3K59A 2W54A 1D1KA 2WXKA 1II3A 1XCQL 4ZKCB 4PMWA 1EM7A 1PGXA 2J4XA 1S5ED 3D6WA 4DU9A 4FP5D 2J42A 4A8XC 1LTBD 4PQXA 2L12A 2RBMA 1QG7A 3RFZB 1FM0D 1T5EA 3AEEB 1QQRA 1H9KA 4C7ZA 1SYDA 3S1MB 1Y8PB 3IFDA 2F0FA 4FO2A 4N9PA 1JWBD 1TQOA 3HOXB 4U673 2HQEA 2YEPF 4TSSA 1VF7A 5T1IA 1DM0B 2LFNA 3T51B 3SK5A 2RMMA 4C1NI 4LK0M 1JALA 3TZDA 4A3EB 1H9MA 5IODA 1SJHD 2I07B 4U68A 4RF0A 1C78A 1N62A 2ACZB 1STBA 4ARIA 1LTGD 4H2AA 3W5VB 2FUG1 3AEAB 1R9TB 2B2UA 3I91A 1NVID 4CKCA 4O1NA 2K33A 1I6HB 4K6DA 4DNRB 1D1IA 2SOBA 1TWCB 4DN4M 3Q8CA 1DJRD 5CBAE 5ELEA 4G7OC 4B9WA 1Y56A 3U4EG 2K32A 2F0UA 1TWAB 3B9JA 2L83A 2F1MA 4K8IA 4EE2A 2JSVX