1PYWD

Human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Exploration of the P6/P7 region of the peptide-binding site of the human class II Major Histocompatability Complex Protein HLA-DR1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/protein binding/toxin
total genus 69
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pywD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pywD02
1B1ZA 5ELFA 2AQ1B 2O2LD 2IJ0A 3BVZA 3W2DA 1D5XC 1CHQD 1LO5D 1QILA 1S5FD 1I4GA 2SEBD 4ZYSA 1CK1A 1RCVD 2CHBD 1PTOD 3OWEB 3MC0B 1UUPA 1LTID 1FNWA 3BVMA 1PTOC 4L63B 1S5CD 4K6LA 1YN5A 1UNSA 1FD7D 1STEA 4RHSA 3BVGA 3TSSA 1S5ED 1SE2A 2RDHA 5FK9C 3DWQA 1M4VA 1LT4D 1CQVA 1JR0D 3DWAA 3EA6A 1EEFD 2NTSA 3O13A 3V05A 1PRTD 2XRQD 3KLSX 1L0YB 1PZID 1LLRD 1LTAD 1MD2D 1PRTC 1SJHD 2AQ3B 4L6TB 1LT3D 5FKAC 1LTRD 1FNVA 1G8ZD 3BYTB 1S5DD 1KLUD 1FGBD 1I4HA 1TY0A 3GP7A 1PTOF 3URYA 1EU4A 1JWMD 1F77A 1PZKD 1RDPD 1JCKB 1SJED 3R2TA 4RGOS 5ELCA 1RF2D 1LTBD 1B44D 3EFXD 4RGMA 3CHBD 2QEJC 1AW7A 4OHJA 1DYQA 1PTOB 3BZDB 2ICIA 1CT1D 4DXGA 1D6EC 1L0XB 5ELDA 3BYYB 1HXYD 5I4DA 4NZLB 1KLGD 1BCPD 1PRTF 1TS5A 2XRSD 4RH6A 4TSSA 1T5XD 1BCPC 1PYWD 1V1PB 1PTOH 1ET6A 1EFID 1TS3A 1RD9D 1SE4A 4O1NA 1PRTB 1JQYD 3R8BA 1LTTD 1LTSD 4DXFA 1D5ZC 4Z9CB 1TS4A 2XNAC 2J4XA 2IPKD 1LT6D 1SBBB 1I4XA 4C56C 1YN3A 3DWPA 1I4QA 1SEBD 1AN8A 1EEID 1YN4A 3R2IA 4RCOA 1GOZA 1HA5A 1ENFA 1I4RA 1KTKA 4UDUC 5D3IB 1XXGA 1I4PA 1TY2A 5TSSA 1BCPF 4RGNA 2XN9C 1LTGD 1JWUD 2G9HD 3SEBA 2NTTA 5ELEA 3MFGA 2TSSA 1LT5D 1V1PA 1ET9A 1FNUA 2RDGA 1JWSD 2WV6D 5ELBA 1HTLD 1BCPB 1BXTA 1D5MC 4RFBA 1SE3A 2R61A 1V1OA 1XTCD 4RHRA 1ESFA 1PZJD 1TS2A 1CHPD 2Z8LA 4BWGB 1S5BD 2AQ2B 1EU3A 1DJRD 2QILA 1HQRD 1EWCA 5D3DA 4RGTA 1SXTA
chains in the Genus database with same CATH superfamily
3ZRCA 3J7YW 1HR0W 1N63A 4XT3B 2UU9Q 2F3WA 5C5MA 2EPBA 1MSHA 4DV1L 2YEPB 3AEBB 5C4HA 3KBGA 4ANUA 2MO0A 4JE3B 1V8QA 4XYQA 4B3TQ 4GNXB 3S1NH 2LMCB 2BYEA 1UE6A 4K2LA 3CP0A 3ZLZA 1J9OA 4YWLA 3DOWA 4YTPB 1OXTA 2L1AA 3MC0B 2WDTB 1UUPA 2L55A 4K6LA 2CQAA 3KWLA 2NBVB 5C4XG 2DNCA 3Q6BA 2LVQA 2CHXA 1SE2A 2K39A 2WXJA 2KT7A 4B08A 4KSLC 4B3ML 4IFDH 1CQVA 1DOIA 3FVQA 1NI3A 4A90A 2WXQA 2OCEA 4XQJA 4LJOB 3TEYA 1X54A 1PZID 2E2JB 2PW7A 3RLFA 2VB3X 4GN5A 4MT5A 2KDIA 1LT3D 4OIJA 1F2YA 1GUSA 3E5SA 3EGRA 4DR2Q 2A6EC 1VQIA 1JMCA 1STBA 3JC66 2BYVE 2ZTCA 4DR5L 5T1IA 4O0AA 4UP9A 4WWPA 2GBKA 4C4VB 3AB5A 3LB8C 4P7IA 3ZJUA 2VB2X 4ZQ3A 5FLXL 2Z9HA 1Y1VG 3RLOA 3PO3H 5DCNA 2G4DB 1CKMA 1GD7A 3DBHI 1P9DU 3DEOA 1TXYA 5BR8Q 1WIAA 5EQ0A 1FRDA 4XE0A 3V2TA 3F2DA 3ONAB 3K5LA 1XJVA 2MNAA 4PS8A 4LF6L 1AZQA 3N1YC 3KK7A 3RR5A 1BR9A 4EFOA 1T3QA 1O7YA 1T6BX 4EE2A 1E3PA 2LI5A 2WS3B 5L95C 1JB7A 4IALA 4Y7NH 1L7YA 4OVVA 1HH2P 5BN4A 4GN1A 4N9F4 3T56B 4BOZB 5H1SE 4IUVA 4DV5L 1EWIA 3TP5A 1N5WA 1WWTA 1XMQQ 4H0LC 4AIMA 4GSWA 2NBWB 2C7MB 2WXHA 1I5FA 1IBML 3SHQA 2PI2A 2KX3A 3ZTDA 1KHIA 1RL2A 4HAEA 1G51A 2NVUI 2PYKA 4XZ4A 5KNCA 3N20C 2DLBA 4WWOA 2K8CA 1SNMA 4RMFA 4KKTA 1XQQA 1YOVB 3F1ZA 2I5LX 4K6DA 3TREA 3APFA 2VQFL 2LKVA 3NXWA 4HJAA 4CDFC 1SAPA 2Z1CA 4GDKB 3K9PB 2XN9C 4HJ7A 4K0KQ 3DQVA 3S2AA 2NTTA 4L1BA 3W1YA 4DNRB 2HIVA 3TP7A 2RPVA 3QAQA 4J3OD 1WCMH 2KDEB 2KQ3A 4TV3A 1QCBD 5L83A 5FLMG 3W5UB 1AEXA 4B9XA 4IW0A 4JK1C 3OIQA 1HZ9A 1H9RA 4PMCA 1XPRA 2IY5B 3KLSA 1B4OA 1S3OA 1TTNA 2CW0D 2RHSB 3N30A 4A3PA 4BXXG 3S15B 3VH4B 1K8AC 4HJ5A 1XLNA 4NJ6A 2ZW0A 4UAIA 4DGZA 4PT5A 1C4PA 2ZVOA 1X3QA 2L83A 3M3JA 1E10A 2VW9A 3VR2A 3HKSA 2KFKB 5M3FG 2CR5A 2UXBQ 2EYOA 3NBHB 2UYZB 3SFEB 2L1BA 3QHTA 3HOVH 3GTQB 1JE4A 4KD3A 2DWQA 2FIDA 4FF3A 3DBLB 3BVZA 1WR1A 2G1EA 1ZW7A 4GU2A 2LEKA 3PLVA 1S5FD 5IT9E 3L08A 1ZKHA 2QC8A 1VJKA 3FKIG 1U0LA 3GTGH 4LFAQ 3G48A 5J1ZA 3Q3FA 1EIGA 2K6AA 5EKKA 1P1AA 4ANWA 1EY0A 1PTOC 2Z0DB 3CRLC 4DPGA 2D3AA 2UUCQ 4EQ5A 4W9HA 2PNRC 3WAOA 1VQ4A 1QNUA 1K3BC 3PSIA 1JICA 1WH3A 4X62Q 1Y69U 4XWWA 2WB1E 1TBEA 2KOXA 1BUVT 2K25A 1YJJA 1OXSC 1ZP0B 2F0WA 4BZAA 3RZDB 1JJGA 4HXDA 3KWVA 4P1CC 1G6ZA 1ZPSA 4YIJA 2VZKD 1EYCA 5J39A 3TEZA 2A6ED 1M1KC 3ZXVA 2EYFA 2WAQG 3QR8A 2L15A 2J0KA 3MAQA 3K58A 1E8ZA 4GGQA 4A76A 2LMCA 2QDLA 1GC6A 3UDFA 4LNOA 3OTOQ 3R7RA 1GUAB 2B76B 2F0NA 1GJZA 2OT2A 2EXDA 5J2RA 3R7QA 1A3UA 2UU9L 2SDFA 1U4MA 1AP0A 1FXTB 3AN1A 3MFYA 2EJGC 3KLWA 1AW7A 2Z59B 4TRDA 4B3TL 2CH4A 5GMVA 4XDXA 1BO0A 4UP7A 3HP3A 3ONSA 3C1FA 2XRSD 3K5OA 3U50C 4DV2Q 2X6LA 3UE1A 3CQZB 3TJPA 2KOLA 4X3SA 4C2MB 1KRTA 4C3IG 1ENAA 2L76A 2R2QA 3T3NA 3D0FA 3H15A 2KK8A 4HK2A 1WM2A 2FJ2A 2IL8A 1HJPA 4Q0FA 4YHHL 4Z9CB 2ZEQA 4W9KA 5JAVA 4CYEA 4X64Q 4C4VA 4DXAB 2B2UA 4A3JB 4ABNA 2OQ0A 3H1UA 5EKIA 3C0RB 2M1MA 5JVH3 1WX7A 2KVZA 5C44B 3E56A 4S17A 4AWJA 4JBMA 4A3IB 1KTKA 3CPFA 1JT8A 1JALA 3I4MH 2K22A 5T8IA 3RPFC 2YV5A 1BDOA 1YJ1A 2I07B 2DY8A 3BS1A 1WD0A 2KTFA 2K05A 4EQOA 2WKCA 2RCNA 1FXAA 4C3JH 4FN2A 4ILWA 2B63H 1X55A 3PHWB 1PH4A 4QL5A 2W3SA 4JOIA 2JWZA 3EECA 1STHA 5CV6A 3HOYG 1PH8A 3A33B 2R93H 3HIZA 3HKZE 1PYBA 3QOJA 1KRSA 1PH6A 1KRHA 3OLMD 4M01A 1NBFC 2YEPF 4JI7Q 3C2PA 3ZXRA 1EWCA 2QEJC 1EF5A 4BKGA 2CKZB 2K28A 1RWSA 2MJ8A 5IIFA 4KX6B 2REXA 2JN4A 4WRDA 1B9NA 5CBAE 2RMMA 3Q3NC 4IKGA 4JX1C 4C80A 4D2KA 3EHVA 3IBEA 1ISNA 2WB1B 1E24A 2JA7H 2OEDA 4A3MG 3TS2A 1OXUA 4HPPA 3DDCB 1I4GA 3HM3A 4HVBA 2BH2A 4GLVB 5CV8A 1ROEA 1PTOD 3T1YQ 1V43A 1Q1OA 1WE7A 5A35A 2K5DA 3E3XA 1SNDA 1OXVA 2OTJA 5FO9B 1K8MA 5KIXA 1KL9A 4HIDA 2PW5A 1RYJA 2HTME 4KGSA 1NYRA 2KQ4X 3T53B 2MQHA 1OQQA 2K01A 3R93A 1HE8A 3I3TB 3CCEA 3RYTA 3DWQA 2N0SB 4NXNQ 2FCQA 4W9GA 2Q2HA 4K0KL 1Q46A 1EEFD 3LNNA 1D2BA 2UWQA 3SK6A 4BBRG 3EFUA 5CV5A 3RNBC 3VXWA 1F2MA 3JSVB 4AJYB 4DV3L 2LXKA 3SGIA 3NBHA 1YJNA 2NVQB 1ZOYB 3Q23A 4M02A 2QEXA 3H9DA 1ICWA 3H3VI 5M3MH 4RM8A 2Q8IB 1A62A 1RAXA 2KC1A 3HKZG 3PO2B 2WX1A 4DV4Q 2UU7A 2JA8G 5E6PA 2CJOA 3MXUA 3R2TA 1PH3A 4HRSA 2F0HA 5AUKA 5JHAA 1WTOA 2UXBL 1KF6B 2PE6B 2H4OA 2E76C 2SAKA 4I6NB 1Q10A 3A56A 5IYBH 4A3MB 1XLOA 2QW7A 1PGXA 1DXMA 4EKUA 3TP6A 3M7NA 2XWJB 1VLBA 3NJTA 2E3TA 4LTUA 1KLGD 2A69C 3D4RA 3S17H 3VR4A 4LFAL 3S14H 3A7LA 3NTHA 3K6OA 1ET6A 4PNYA 3F2BA 2NVTH 3GO5A 1J8IA 1U4LA 4P1BC 3BU2A 1QUQB 4O1NA 2UUCL 2WDRB 3RZWC 3QG1A 2K5WA 1WX8A 3L3OC 2V1YA 3CRKC 4X62L 1LT6D 4A3KG 3J81E 2AL3A 2L0FA 4BBRB 4DF7A 2AWOA 3EQLC 3CF6E 3KF8A 2Z6KA 1FL0A 2JU6X 2NVYB 4QCLA 2R92B 2EY6A 1Y1WG 1Q5WB 3NOBA 5IP7G 3J80c 2IO0B 1XTDA 4B95A 4DV7L 4LJZC 1XXGA 1NBWA 3M4QA 3HKZB 4IM3A 4LJPB 1IPGA 1PH2A 2Z6KC 2VL6A 3BJUA 3HOXG 2KWVB 3DCGA 3I56A 1VQJA 3OTOL 1YQBA 2YVCA 1N32Q 3LYYA 1RFKA 3VQIA 1LT5D 5T1GA 3STBC 4DV0Q 1A3VA 3GTKH 1Q8KA 2F0IA 3GTJB 2DZIA 1JJCB 1NCVA 1DGSA 2A1AA 1L6UA 4JI4Q 2RA4A 4CDCC 1OTRB 3RD4A 2BH8A 4C3HH 4JI1Q 4GLAC 2PZUA 3U7DA 2M8SA 3KJPA 2V4LA 4FJYA 1HQRD 4LMQD 1WE6A 3TCAA 1TS3A 2UXDQ 1NSNS 2PNHA 4L5RC 1K8OA 3M62B 2IX0A 2O2LD 3OMCA 5EBCA 3GTLB 4A3KB 1WGYA 3ZDTA 1RKNA 1FCLA 2LUEA 1VQAA 4LCDE 3QWNA 1SYCA 4IWOA 1H9KA 1PFNA 4X64L 1Y1WB 3SR1A 2WU5B 4YTMB 2CHBD 2VNUD 4WWNA 3BVMA 1FNWA 4CJ2C 1E7ZA 1MHXA 3M9BA 2PVGC 1W3SA 1U4AA 4X66L 1S1QB 2QCPX 3I9V1 3CCSA 1IHZA 3HOXB 3CSTA 1SNPA 2MX2A 2RDHA 1Y56A 4LNKA 3PLUA 3FRPB 3OW2A 1GNUA 1WJ4A 3HOZG 1LV9A 2E75C 4A93G 1J7CA 1L5PA 1X32A 1F9SA 3WAMA 2DHZA 4KSKC 4XQQA 3IRBA 3NWSA 4BY7G 1C4AA 1FPYA 3DVNV 3PIO3 3Q8BA 4NJCA 3ZRFA 4A6QA 2N8NA 4A3EH 4A3DH 4DNTB 4GDLB 3ZQ4A 2HJ8A 3J7AF 4M8NA 1SIFA 4JI7L 3DVNU 4G3XB 4OXPA 3ZJYC 4G7ZC 1ZE3D 3AH7A 3PT2B 4WJQA 2CVRA 5FO8B 2M17A 3URYA 3CC2A 4KY5A 3ZW3A 4GOCA 2I38A 3MEFA 3VR6A 4HKZE 1YNJC 1B44D 2MFIA 2ZNVC 2ZW1A 3ULLA 3P42A 3TBLD 4OZCA 5HGQA 5C23A 1DYQA 1HCZA 3I55A 2A69D 5I2YA 4BBNC 3Q24A 3GTPB 1STNA 2J0TD 4ODGA 5AFWA 3JSVA 3OIPA 4DA2A 2JSVX 1U4RA 1YJ9A 1QOAA 1WJJA 3L0OA 3AXCA 1E2VA 2E5LQ 2TMPA 4HIKA 4NXNL 1JORA 1I4XA 3AB9A 2LXJA 2IWHA 4C56C 3HOZB 1OXXK 4A93B 3GB1A 3NG0A 4C1NK 2F3IA 2PKOA 2WDQB 2AWNA 4KKIA 4L8JA 4BY7B 1XNQQ 4OWTB 2K14A 4FF2A 2F0DA 1FEHA 2HQLA 3H91A 1I4RA 1R9TH 1WGGA 2VQEL 3HOUH 5BN3A 5IYDG 2IT1A 5I6WA 1VRAB 2ZJPA 1KJTA 1Q86C 3TS0A 4KTAA 3HRZC 1VQMA 4A3CH 5CV7A 4AUQC 3B2GA 3SEBA 4DNIA 4IFDI 3STBD 4JWUC 4EOYA 3LWUA 4LNIA 3FP9A 2KMAA 1ET9A 3I4NH 3MA2B 2WU2B 4TQUS 4DV1Q 3R66C 4WAAA 1IL2A 2OJWA 4UP8A 1EWYC 1DOXA 2MP1A 1ZGUB 3JAMi 1ESFA 4FHJA 1I7HA 1TS2A 5FLXE 2JVCA 3ECIA 1PQSA 4A3OA 2CS4A 2DAFA 1CKNB 3GE8C 4ZHOA 1S5BD 1EU3A 2CJNA 2O6VB 4LLGM 3OYYA 2BS3B 2RSOA 2KTRB 4BOSC 4ME5A 2N9KA 1A2UA 3FC4A 2E2HH 1STAA 5IP4D 1TU2B 1HA6A 1KM7A 2IO3B 1ZDVA 3A9KB 1VCIA 1UEBA 2PQEA 1WM3A 5I9PA 4KV2A 3X0WA 1CQFA 2ZJQA 2E8GA 1QG7A 2NN6I 3UDXA 4DK3C 4B3MQ 2LUMA 3DVGX 1QKZA 1ICFB 3HUIA 4ICVA 4MGZE 1FR3A 3QWZB 1MHHE 1WJ6A 2MBOA 2G3QB 2HCCA 4X57B 1R4NI 2BW2A 3GV3A 4AQYL 3FILB 1X1MA 4HCEA 2GA4B 5CGKA 3VDYA 2WXGA 4HR7B 1TWFH 1BOSA 4JI8Q 3VR3A 5A2QL 2B3GA 3CCVA 2OWOA 2LGDA 1S5CD 2JA6G 4TQ0A 1WRDB 3AMUA 4IUNA 3GOEA 5BMIA 4DR5Q 2QKIC 2NZOA 2BS2B 4KZCA 2KVRA 1DOYA 2F1MA 4LUOA 5BYQA 2MUYA 1DD2A 2J52A 1SE9A 3EA6A 3O13A 4XTCS 4DWFA 3UE0A 3H0GG 1O78A 4GIVA 2WXNA 1A15A 4NW2A 3CC4A 3FDTA 3RNFC 2HT1A 2KHJA 3TP8A 3M4OB 2GBNA 4HPMB 4G57A 4LAAA 3HOWH 2IO1B 4JI4L 1I6HH 3CU7A 3S1QB 3NVYA 4N58A 3BYTB 1MI2A 1H9JA 1XEEA 1B50A 3Q8DA 1K8GA 3RLNA 2FUHB 2LHDA 4JCVE 3PGEA 4QJFA 2C5LC 1IBLL 5JJIA 2UXDL 1TWCH 3I90A 2HTHA 4K3BA 1PH5A 1YNJD 1MFWA 1E22A 4KIKA 3RZOH 1L2FA 1XCTL 1UH6A 3FAHA 4CHKA 5M5YH 1LGRA 1T5EA 2DBYA 3BZDB 2ICIA 4DV5Q 1S3SG 2NBUA 4BKTA 1T5XD 1MG8A 1DOMA 3JW0X 2F0JA 2VS1A 1PTOH 3AFQA 4OL7A 5CV4A 2JP1A 3TQYA 3L17A 4IC7B 1RD9D 4YCWA 3IHPC 1EQTA 4YL8A 5CORA 2VQFQ 1PGAA 4GDLA 1S40A 4UHVA 1VQ8A 2JXTA 2KCCA 1IL8A 3H0GB 1II3A 4K14A 4A3LG 3K8AA 2G9DA 1YN3A 5FR3A 1Y8OB 5C3EG 3DHIC 3KW5B 2R7FA 2GBJA 2KMMA 1CJEA 2ZVNA 4IUUA 1S4ZA 1K51A 3W1GA 2ZM6Q 5AEKB 1L2NA 5HGTA 1YN4A 1E9MA 4W9IA 4ZRPA 3D4DA 1GB1A 2B29A 4XWTA 4ICUA 3ULJA 2L00B 3T9LA 3VR8B 4GMVA 5TSSA 1YIJA 5CV9A 1CZWA 2B39A 3R3OA 2HHHQ 2FCNA 4EZKA 4CGYB 5M5WH 1I50H 3CCLA 1N33Q 2R2OA 5LXIB 1Q90A 1CTMA 3A1QA 4ZRIA 3ZJVA 1HTLD 2XVSA 1BCPB 3OW7A 3NVWA 4OO1I 2MBEA 4NB3A 2KLGA 2ZXRA 1J7AA 3NHHA 1Z2MA 1QOHA 3I70A 1QVGA 3S9WA 1HRJA 4RAUC 2UXCL 4I6LB 3UIOB 2K7VA 3D31A 3DLLA 3K80C 4ULLA 1JJ2A 3AEVA 3K5NA 1PDXA 3NPPA 3QOLA 2C7NB 3DHHC 3B6YA 3LX0A 1SGHA 2CHWA 2KAJA 2EY1A 1BUIC 3GTMH 4V0BA 5ELFA 2PVOD 2AQ1B 3L0WB 4FHKA 3L9AX 5CMDA 3D6CA 4KJOA 2E5LL 4MACA 2M4NA 2D62A 3W2DA 3I8ZA 3V60A 2I2YA 2J7ZA 4CKEA 2DAJA 2KN5A 5KNBA 2HDMA 3RULA 1XNQL 3AE3B 4ITKA 3LJ3A 3A55A 3AU5A 4FJZA 3BZKA 2IO2B 1YN5A 4OZBA 2ZZPB 4C1NI 3I72A 2VRRB 4P16A 1G6JA 2BCOA 2L8JA 2BE5C 1I3QH 5LMUQ 3Q8EA 2IYDB 2B2WC 1FRRA 4R8IA 1NI2A 1VQBA 2O6VA 2VZAA 5G5GA 3W1SC 5MPOA 4DU9A 2C9WB 1MPEA 1LLRD 1FGUA 2I1JA 3ZGZA 1QVCA 4YWMA 2UUBQ 2QSDA 2JF5A 4I65A 1X3FA 5D7GA 3ZTCA 1WTXA 3SK8A 3NS8A 3AE4B 4A3BH 2NS5A 3B1LX 3SDZA 3WAPA 2CKHB 4R8NA 4U68A 5C4XH 1HZAA 1E5WA 1VCBA 1F2ZA 3H7PB 4QMGA 5C5LA 4K5WA 2B3AA 3X3MA 4FA6A 4L5TA 3PV0A 1V5TA 1VQ9A 1HFNA 2GI9A 4YHHQ 3VA5A 2L4NA 4APVA 3VTVA 1AARA 1HNXQ 3RZFA 3N3KB 2KECA 4IOCA 2FMMA 5F2DA 1D6EC 1PHJA 3R3MA 4REZA 3PS6A 3VUWA 2RVLA 2WWZA 4LNFA 3TEHB 4PS7A 5EE9A 3RD2A 4DHJB 4JI0Q 5C3JB 4JI8L 3W9CB 5GROA 5LL6X 5J22A 4MGYE 3M3YB 3R8BA 1LTTD 1A2TA 1Y1VH 5C6AA 1GPXA 1D5ZC 1F9RA 2K5NA 2M56B 4DR1L 4K7SA 2K1FA 2V3PA 2LY7A 3KQ4A 2HDEA 3ZDMC 3MJ5A 5BYSA 2RPQA 1C3TA 1NUCA 3WCQA 2JE6I 2Z4HA 2N88A 4JYAQ 1SNQA 2SNMA 4N8FA 3C19A 2ZXOA 1CKOA 3CXCA 1IXRA 5JJZA 4U673 4R9WA 2ALYB 3S15H 4XC2A 4DKAC 3AU7A 1TY2A 3UINB 2J53A 1EIHA 3J80L 4PZ8A 4A55A 4AP4C 1PFSA 2ZTDA 1STYA 2CFMA 4J8QA 4F8MA 3L54A 4W9DA 4UPAA 1MHWC 2SOBA 3AEEB 1SSOA 4IOIE 2G9HD 2DYBA 3ZNHB 4OWXB 4PK1A 1HTOA 5AZGA 2LGIA 3N1XC 1EYAA 1PLFA 1EF1A 2BKRB 3PTFC 4W9JA 1H8CA 1Q1BA 4IUQA 2KD0A 1A63A 2L32A 3WWVA 1L1OB 4MIUA 3SVMA 4RHRA 3SXHA 3MHBA 4GOPB 3EN2A 3I5JC 1FD6A 4TKNA 2NPTB 1N60A 2DZKA 2QILA 3CMEA 4IM0A 3G4SA 4NAMA 1QLBB 4KHVA 1E7PB 2NN6G 4K81A 3NZSA 1EY8A 4PMBA 4NAWB 3AE8B 3AEFB 3V61A 5JXVA 2K03A 1E8WA 4OONA 3SU8X 5FLMH 1VQ6A 3RZDH 1QILA 3KDFB 3BDCA 2FBWB 1S72A 1NMFA 4ANVA 2ZM6L 4RG1A 2N78A 2L0CA 4X3KA 2OXPA 4BXXH 1BBWA 3Q6SA 4DV3Q 3NY5A 4K3CA 4KN7C 1MG4A 3ZNZB 2XEWA 5LNK1 1N6ZA 3BIID 3RN2A 4IPDA 2BA0A 2BE5D 2GN5A 3DBSA 5M3FH 2LRUA 2C5CA 2FCSA 1NMGA 1X65A 1LXDA 1VQDA 2AL6A 2HHHL 3DWAA 1HUMA 2JRIB 3P75A 2E2IH 1V81A 1N33L 4WQMA 4DAMA 1YBYA 3J9CA 3A4SC 4MJSB 3UQAA 2IX3A 4WJPA 1WXAA 5FKAC 1F2RI 1EY6A 3FKIH 1LTRD 4LNQA 2GMIC 5D6JB 3HS0C 3J7AV 1D4BA 1TIFA 2JA9A 2DNFA 1LYLA 3LXFA 4LF7Q 3PO3B 1WXMA 2YTXA 4GN3B 3MVVA 1HZCA 3RNUA 4KDLB 4JI3Q 4K5VA 3GP7A 4CJ1B 3L2PA 1WYDA 1V5OA 1EU4A 2LASA 1F77A 1OGWA 1Y8RC 4NMZA 4O2DA 1R4NB 4WJNA 2LZ6A 3I3CA 3IT6B 4DDID 1FVIA 4IPCA 1FJGL 4PZ6A 2KUMA 1MGSA 1VQPA 1GM5A 1EO6A 3KYDD 1TS5A 4OIKA 4Y7NB 1SIJA 1LTLA 3PZ8A 4A3JG 1PYWD 3PZDA 2WKDA 3NEMA 2INDC 4L23A 3AE6B 1OTCA 1HZ5A 1JB3A 2PZTA 2EMTA 5C44G 2GLSA 4DV7Q 1SMYC 3A4RA 5IAAC 3V62A 1PFBA 2J42A 4HN7A 5FJ8G 1PRTB 5HKHA 1D3ZA 1EOVA 2XIWA 3OPOA 4A3IG 4GNXA 2D10A 2W54A 4CHTB 3QIJA 4DAPA 2XNAC 1CUKA 2MCNB 2IPKD 5LMUL 1Q1EA 2OOBB 2YU9H 2EYHA 2KENA 1GG3A 1SEBD 4ZRJA 4H7BA 3IG3A 1SYGA 4BY1G 1FMAD 2UUBL 3MJWA 3SR6A 4JLCA 4IG7B 4GNXC 4DK5A 1RJTA 3L4PA 1WCMB 4C3IH 2N7EA 2I5HA 4WJOA 1BCPF 4ARCA 4XX5A 3GE3C 4MH8A 2I5MX 2V4DA 4KLKA 4LDTB 4OO1G 5LMNQ 2N9XA 2HIXA 2F0KA 5CHFA 1BXTA 2K75A 3NQTA 4KHZA 5JH5C 4JI2L 1HNXL 4GB9A 1L4ZB 1KDCA 2MH7A 5CBEE 2WB1G 3IAS1 3MC9A 3HOVB 4MELA 2NYZD 2Z0EB 1JOQA 1M90C 4JI0L 2RBMA 2INCC 4JIOU 1R4MI 3PF5A 4X66Q 3PRMB 2JA5G 3KVFB 1MIUA 3JAMc 2L5TA 2IJ0A 2KHIA 1YQ3B 2B2UC 5IWAQ 3S1RH 2PMVA 5D65A 4LF5L 3ABVB 4HCPB 3PRZA 4C7YA 2EYLA 1IKLA 2RF4A 1C79A 1VQEA 4BY1B 1E0ZA 1QOGA 3HOYH 4NDXA 1E1TA 2SEBD 4JYAL 3VRBB 2B8FA 3F2CA 3DBRI 3M63B 3AMZA 2LSSA 3EFCA 1LTID 3P1HA 2PPHA 1A8VA 2Q2UA 3A9JB 4ANXA 1STEA 4E71A 5EGTA 3AEDB 1Z6HA 5DM63 1FFVA 2X69A 2FE8A 1ESRA 1M4VA 1P98A 2KJRA 3PV1A 3KUPA 3PO2G 5EBDA 4LF4L 1KXLA 4JOIC 3TUOA 1NDDA 5DPRA 3A5ZB 1B53A 3OOCA 1NR4A 4WJ4A 3RUIB 4L6TB 3Q14C 1GB4A 4NAWA 2GVBA 1T9HA 3P4RB 1SRUA 3GDEA 3U58A 1TYGB 5HFYA 1K28A 1WTVA 4GDKA 1GHJA 2WXRA 3KDFA 5GADC 4RF1A 1CZGA 4B3RL 2LFIA 1TWHH 2EVBA 5DLQE 1JRUA 2FHTA 4RGOS 2X6GA 4F87A 1JC7A 2N7JA 4L2YA 5EJWA 4DK0A 3S1MH 1PA6A 4HCNB 1VZ7A 4BBRH 1WI0A 3OJ4B 2HDLA 5CX3A 4N9TA 1GAQB 5IN7A 2F4VL 4E3CA 1Q7YC 2VUMG 2F0LA 2EYPA 2DYOA 3MWYW 5ELDA 1P7FA 1HXYD 4FVMA 1YD8U 2C7HA 4LF8L 3GV6A 4X65Q 4WWMA 2KFKA 2FNJB 2QA4A 1SNCA 3PUVA 1SMYD 2IW3A 1WD1A 1UE7A 4CDDC 2R92G 1CM9A 4OX9Q 4QAYA 3GS2A 4F1SA 2VQEQ 1VS0A 2R7DA 4YY3Q 2WP8J 4M8AA 2F0UA 2JA8H 1SYEA 4DXFA 5C4JH 1X6OA 2M00A 5IGBA 5BMHA 3QB3A 1SBBB 1V80A 1A70A 1RFAA 4K8IA 2N9PC 3DWPA 5A2QE 1WXVA 2FUG1 3I4MB 1BNZA 2NVXH 3Q22A 1I4QA 2O5IC 2JYEA 1LFDA 1EY7A 4DUYL 1Q0WB 2BS4B 1NYQA 2A4ZA 5C1ZA 4ZLTF 1PUTA 1TT5B 1I4PA 4LF7L 1XLQA 1B9MA 1J0GA 2JZPA 1YNNC 2B2YA 2D0PA 2YLMA 4JI3L 1MJDA 2DJGC 3MXNB 3U4VA 5I6YA 2KDBA 2R93B 1YNXA 1WXSA 1TQOA 2QIEB 1GJXA 2Y5PA 4LK0M 5K36G 3W1SA 2GBRA 1X9NA 2VUMB 2PQAB 1XYIA 2KEDA 3TDQA 5IP7H 4JI6L 1LM8B 3VA7A 3KUZA 2HD3A 4LK1C 3ER0A 4BWGB 3U4ZA 2ACZB 3HEJA 4AQYQ 4RCNA 4HEDA 4MHEA 5D3DA 4GS3A 1HUNA 2D07B 4R4OA 4GXBA 3GTOH 2OQKA 3CAMA 3K0YA 5IYBG 3HOXH 2MJ3A 1WR6E 1XNRQ 2Z0SA 4R4IA 1V49A 4DAYB 5IOCA 1H9SB 3KOJA 4LWCA 1PFDA 3SFDB 2LGSA 4M8MA 1QQRA 3VYSA 2JPHA 3K57A 2XSCA 1SYFA 2QJLA 3T1HQ 3E0JA 3OWEB 4DV6L 2RSNA 3W3AA 2EE1A 3VHTC 1LQBA 5C0XI 1QB5D 3WDNA 3AYHB 3U52E 2BQQA 4YSZB 4IJHA 1LT4D 2NWGA 2NTSA 1IBLQ 3KFUA 2XRQD 2AEHA 1K0SA 5LMNL 3H8HA 5M3MB 5HG2A 4OGQC 4WQOB 2AQ3B 2EIFA 1DOLA 1UWXA 1K0RA 2A68C 3NVVA 4P2CB 4RWSC 4ACFA 2JA5B 5EE0A 4JGHB 1E7VA 5KHOA 3VUXA 2K04A 4BAXA 3U9SA 1K53A 4CBVA 1I6VC 2Q2IA 1N61A 1XCQL 5CHVC 4ASWC 5JOBA 2HD5B 3WA0A 1WF9A 1P8LA 3ERQA 3OMGA 3JYUA 2DYMA 1CA5A 1TJEA 1ML0D 2N49A 4IZ8A 4PQXA 4HIMA 2WXOA 4XYCA 1MKHA 4E6IA 3BZCA 1TKEA 1UAPA 3PUWA 1YNTE 3TMPB 3HOZH 1WMHB 3I73A 3VAWA 3S17B 3E0EA 5IWAL 4V190 1RM6C 2VXWA 1EY9A 4DXGA 2NVTB 1R7SA 1L0XB 4P6VF 4BY7H 2XK5B 4NZLB 3W5VB 1PRTF 5J17A 1JQ4A 3HRDD 3K7AH 2ATWA 4TVAB 2KCMA 1FFUA 4WFN3 4HKQA 1IBKQ 3OAWA 3MEHA 2KANA 3AE5B 4IPHA 2EZVA 3S16H 2HJ1A 5E4WC 2HUGA 1FO4A 3CW2C 4CQNA 2A73B 3QC8B 4FO2A 1EYGA 3P7JA 1E1OA 2IGGA 4PS3A 2KWDA 3U30A 4KHPQ 4C00A 5M5XH 1ENCA 3C8YA 3EBEA 1YHBA 2Y0SE 3NRZA 2O2VB 1SF0A 3TIXA 2L9HA 5IE8A 1IUEA 5JHBA 1FCCC 3FMCA 4XIGS 4A75A 1SSNA 5J3BA 5IYCG 3ICEA 2K6DB 2UXCQ 3IL8A 1YNND 4IURA 3F2UA 3NQIA 3GTKB 4WJ3M 2BYFA 2K4KA 1PH9A 4RGNA 2A74C 4N9PA 2MLBA 3B08A 3IT4B 2KWUB 4MM3B 1V8CA 4G50A 5LL6S 5FO7B 5G3LF 2K6QA 4WH4A 3T13A 4BS9A 1WSPA 4POFA 5EPKA 4NXMQ 2EKEC 3KBXA 2QGQA 3CWIA 1TVXA 1XTCD 3UDIA 3MHZA 3PIP3 1C1YB 2PCFB 2Q8TA 4BBSH 3ZUNA 5E4XA 2Z8LA 3DXJC 3OG5A 2ZCCA 3J81i 4X65L 2IDYA 5IYDH 3IAYA 2MBBB 5FR6A 2INPE 5C4ZA 1WZ0A 4MTKA 1Q81C 1B1ZA 4OX9L 4G0NB 4A3FG 5C2TB 4YY3L 2L3ZA 1OQYA 3I91A 1ILPA 1DM0B 3CCJA 1CFMA 1F9JA 2KXJA 2I0QA 3B9JA 5DNFA 1UF0A 3PVLA 4MSMB 4LNNA 5ELNA 3A8KE 1EY4A 2WFWA 1AFPA 3MXNA 4F8CB 1CK1A 3F8TA 1EZ6A 1G6PA 1QF6A 4FLHA 2F0TA 1QUQA 5K5PA 2BGFA 4WAFA 1TGZB 4H13C 1K8RB 1FD7D 1VQLA 2PQAA 5I9OA 1QT9A 1QZGA 2EMSA 2MPMA 1KNEA 2AX5A 1WOCA 1I42A 1L0YB 4OW0A 3L7ZC 1MD2D 3OHXC 1CMXB 1TZ1A 1EYDA 3J80E 3HOUG 3RN9C 4RMAA 2A68D 4JC0A 3K81C 4DAYA 4NY0A 1GUTA 3T16A 1R4MB 1WGRA 2W3RA 2JA6H 2R7ZG 1KLUD 1EZ8A 2MEKA 2AUJD 2ENBA 1Z47A 4A3FB 4KJNA 4PV1C 2AWTA 5ELCA 1LTBD 1EQQA 3H0GH 1AZPA 1XNRL 1PVOA 2G4SA 1K83H 4RGMA 3PF4A 3DBRB 4DR1Q 4OHJA 1IBXB 1B8AA 3C1EA 1X3EA 3K7UC 3I2ZA 2EELA 4P72A 1YHAA 5I4DA 1MSGA 4RNAA 2K50A 4XYOA 1PV4A 3VFKA 4P73A 2AKWB 3T1HL 4NNJB 2BTEA 1F9QA 4HDOA 5AZHA 1SE4A 5JEAG 3MHSD 1O80A 3P1MA 1GC7A 1VDZA 2LXCA 2QDFA 4KY7A 3N32A 1KLVA 2DN8A 3L16A 3RNEC 2C60A 3IFDA 4A3GH 1STGA 2VZKB 1EWHA 1L6VA 2EJMA 1F52A 1A0IA 1W6JA 3A5UA 1R9TB 4Y52H 3CMAA 2ES2A 1WGDA 1E8YA 4ZKBB 5IGDA 1HNZL 3HOUB 1HR0Q 2DZJA 3QO2A 3UQBA 4DAVA 3QQ8B 1SFOH 2GOWA 2L12A 5EKLA 4DR3Q 2R7ZB 2XTIA 4XT1B 2H89B 2H1EA 3BWUD 2XK5A 1UGMA 2R6GA 3CC7A 2I1KA 1UBIA 2IGHA 1XX8A 3I57A 5IKCM 1TWGH 1FNUA 3DEPA 2N55A 4A3LH 3KYCD 3AU4A 3SE0A 5C3EH 3DHGC 4MH0E 1I35A 1GHKA 2MP2B 2D2CC 2V9HA 3DVGY 3EROA 1X56A 1SE3A 3CCMA 3S2HH 3S2DB 2O4XA 2F0EA 4ZUIA 4KZ0A 3AE2B 1SMXA 2RCFA 3CCRA 2NZHA 2LFNA 4KK7A 1DJRD 1EIYB 4JQWC 2KDFB 1BQQT 2F03A 4XDDA 4B6WA 1IBKL 1WRIA 4P75A 2RKSA 4LFBL 4TMAB 4X6AH 4ZRQA 3NK9A 4B9KA 1YQ4B 4H02A 2WNMA 2LD9A 3PUXA 4OVUA 1TWFB 4B0EA 2PLPA 3ND9A 1QZHA 1DONA 3JAML 1H4RA 1PMRA 1ZYRC 2IHFA 1KD1C 1G2TA 4ME3A 4ZYSA 5C0XG 2PPBC 4KHPL 2IY1B 2B2TA 1LACA 1QZEA 3UF8A 1VQHA 2BWFA 2JXMB 4KVGB 4EUTA 5EE1A 1VQ5A 2V4IB 3DHQA 3U8ZA 3ZJTA 2IHEA 4USAA 1S5ED 1Y14B 3H09A 1L4DB 2MA9B 2CCZA 3HOWB 1NE3A 3ENEA 1DCZA 1JR0D 4HLEA 4HJ8A 2B2TC 1I6HB 1H9MA 3NENA 4JPSA 2K52A 5IP9G 1SJHD 2XWBB 3UI2A 4NXML 3H6MA 1JOKA 2FMCA 5KEEA 2FFKB 2JYOA 5AZFA 5J18A 1FJGQ 3J80i 4JBJA 1ZXHA 5E1FA 1TWCB 2E2JH 1TWAB 3DUZA 1FM0D 4KV6A 4JV5L 3TN2A 5M5YB 1I4HA 3M3YH 2ICEC 2AHOB 1PZKD 4A4IA 2EOTA 1ZKOA 4BA2I 3VTWA 5CTRC 5KGUA 2KHSA 3CHBD 4HJ9A 3RN5A 1BF4A 1RLFA 1VDVA 4WURA 4F7ZA 1PTOB 2EJFC 3CF5A 1CKNA 3I7FA 1NEKB 3WALA 3KF6B 4EGVA 3BYYB 1T0YA 5IT9c 1HTQA 2KTRA 1J7BA 4EZJA 1SYDA 1GUWA 1C9FA 1V1PB 3RI7C 1Z7TA 3A9KA 1VF7A 3JVZX 2QF7A 5AJ3L 4FF1A 1EQRA 2K32A 2F0VA 1UBQA 1VR9A 1LTSD 3A8IE 2N1VA 3N1ZC 4LUVA 1EL0A 1NENB 5D14A 2WINB 1TIID 1IZ6A 1X3PA 3FILA 3P4PB 3U9OA 3VDZA 4HTHA 1C4CA 4POGA 3TL5A 2EYMA 2RD0A 3AFPA 3ZKJC 4JI2Q 3HFZB 2HCIA 1QJOA 1I50B 5M5WB 1VQNA 5D3IB 1O7IA 3QA8A 5GXGB 4LF9L 1JRPA 4H44C 1IBXA 4OWWB 2F0PA 3CCUA 3NZ3A 2XBBC 5CC4A 3PUYA 2KX0A 1LTGD 3I4OA 2OJRA 2BPSA 1UE1A 3DM1A 5ELEA 4LFCL 1RTNA 2IZVB 2KJ6A 3KH0A 2G5DA 1W6KA 3GZNI 3ML9A 2C9OA 4IWQA 3OWFA 1YHQA 4K5XA 3TRZA 2JT4B 3W1BA 1YX5B 4YT0B 2RR9A 1SYBA 1YIWA 2N1WA 4RFBA 2WXPA 4YXDB 2FXQA 3T4AC 4A3BG 4LF5Q 3ITPA 5IGFA 4YWGG 1PZJD 4KD4A 1CHPD 1ZDXA 4AYBE 3GTMB 2N9EB 1RODA 1ONLA 1T0SC 3X23A 2IX1A 1N62A 1ZXIA 1C8CA 2NCNA 4EEWA 1D7QA 3UI3A 1U4PA 2WXKA 2ZCBA 4KDIC 4DBGA 2MWSB 4F7XA 4ZDVA 1J19A 4IFDG 2KYWA 4RKBA 2L7RA 1P7EA 3B2FA 2YTYA 1UEAB 1HZBA 2Z4IA 1B70B 4KKSA 4KN4C 1KQSA 1WZ3A 1CZPA 1ZYRD 1L0WA 2D3BA 4GLSC 3NUHB 4E74A 5JEAJ 3NE5B 4LF4Q 2MJDA 2D9UA 3AEAB 3GTQH 1UD7A 1HR0L 3NSWA 1EM7A 2JYTA 4PZ7A 1RHPA 2PIAA 1I3QB 3RNCC 2JXXA 4XDCA 3EIVA 3QX1A 2KQSA 2MP2A 1B3QA 4DR3L 4RHSA 4A9AA 1TR5A 3RT3B 1Q8IA 3BVGA 4J6IA 2YYZA 2NN6H 3T3OA 3I4LA 3PQIA 3PO3G 4B3RQ 2CWAA 2PMZE 1N8RC 1LTAD 3S1NB 3M4PA 3CD6A 4JWSC 5G2NA 3UGBB 5CYUA 2JQRB 4A3BB 3Q69A 2MSED 1J6QA 3BY4B 2K5HA 4ZKCB 3Q8AA 2Q5WD 5C4XB 1E90A 2BDNA 5IODA 3QJYA 2F4VQ 1IW7C 3H3VC 1SROA 4AH6A 1K9MC 2C35B 5GQOA 4LF8Q 3KYHC 2AMCB 2BBCA 5E3FA 4AYBG 2KACA 3BDOA 5BMGA 3N52A 4R4QA 1XWEA 1J5EL 1T0QC 2LVPA 2QDBA 4AOFA 2FAZA 4FF4A 3A74A 1FXIA 2XGTA 3M95A 3PSEB 2CH4W 2DJFC 4ZUJA 2QHOA 4S3SA 3S24A 4Q5VA 3NUCA 3CMMB 4FADA 3Q3MC 4TSSA 2KBNA 4HROA 1B3AA 3E6ZX 1Y1VB 1BCPC 4PG3A 4W9EA 2NMQA 3LWEA 4DUYQ 1E2WA 4M1UB 2PO4A 5C3WA 3U2SC 2KVMA 3TBIB 4I7AA 2V0GA 4ZYNA 1Q12A 3TZDA 3NWTA 5LHY1 1K73C 3AULA 3Q0AA 3G7LA 2O6VD 4HPLB 5IGGA 3A54A 4FBJB 2WAQE 3CQZH 3CSFA 5C0XJ 4C2MH 5E6OA 1BBXC 4IQZA 1WCMG 3ZO5B 4DDGD 4ID6A 3D4WA 1XT9B 1E2ZA 1M94A 2B2VA 4J1MA 5FOBB 2PEAA 2V3NA 4DUZQ 4AJWA 2KA7A 1YZ6A 3R2IA 1YITA 1HEZE 1KOTA 1ENFA 3VTUA 4A3JH 1IGCA 4R4TA 2FINB 1P16A 4JI6Q 3PREA 1PDQA 3VYRA 1CSPA 4AYBB 2B2VC 3KF6A 5C44H 4RKLA 1N34L 2BB6A 2DZMA 2JY6A 5FJ8H 4A3IH 3IKJA 4MZ9A 1WX9A 1HPCA 2KMCA 1V1PA 3HOVG 2W9NA 3RCZA 2IGDA 3AE9B 2JEAI 5IO9A 2QCZA 2A5HA 3V3XA 1N36Q 1D5MC 1LABA 4QB4A 1KC8C 4EZLA 2KN4A 4CKCA 4BY1H 1YJWA 4RF0A 2ZPYA 2N7DA 1NR2A 2JX5A 1O7ZA 3NTKA 3V6CB 4DQOC 1GUNA 3H7PA 1A6XA 4QUCA 1CI3M 3N9YC 4OVZA 4W9CA 3VYUA 3A0JA 3J7A5 4DV6Q 4RGTA 1XF5L 2IY0B 1PH7A 1NJIC 3RUZA 2Q8RE 2KDMA 2MO1A 4GKJQ 3T51B 1HNWQ 3VUYA 4IUPA 2NR2A 4OO1H 3AE7B 1C0AA 4I7ZC 1K52A 4JI5Q 1WJNA 1D5XC 1WY8A 2BT6A 2LGXA 1GXDC 3EVQA 2MRPA 4TUUA 4CO7A 3J81c 3ERSX 1FIQA 2PMZB 3X3NA 4HSPA 3AV8A 2E2DC 2A5UA 4DFAA 1RCVD 3KF8B 5E7NA 5M3FB 2K5PA 3IVFA 2CWPA 4FJVB 4N6EB 4KGTA 2DGYA 2E2IB 1IGDA 1UWMA 2D0OA 4BFRA 4RA8A 1VQGA 3TSSA 4JBKA 2WDVB 1UWVA 4IUTA 5FK9C 1HHVA 2JA5H 4J6HA 4X3UA 1EOTA 3FKIB 3O65B 1HZ6A 1CA6A 1JOOA 1V1QA 3KLSX 1T0RC 2CU1A 4ARIA 1WTHA 1LUZA 4ALPA 2K3UA 3GTGB 1IW7D 1R4PB 4DR7Q 2SNSA 4G11A 2F0MA 2LVOA 3HVZA 4ZAIA 3HVDA 2KZRA 2JJQA 4XGAB 1S5DD 5D2MB 1KAAA 2NVQH 4FNFA 2ID0A 4K2KA 1PTOF 1EUJA 2KJHB 1YVCA 1IYFA 1Z9FA 2LJIA 2NB0A 1RF2D 2K8BA 1VF5C 3PO2H 1L1OA 3EC8A 4B3SQ 3EFXD 2WAQB 2G45B 4B0MA 1SN8A 5EPLA 1PH1A 4GOPA 2ZT9C 5JVG3 4DR2L 5DPWA 1HQMC 2NPTA 2F4IA 3HZXA 1BCPD 1F9PA 1EFWA 1C7YA 3MTSA 4MSQB 4IFDJ 4A3MH 1TKWB 3CPWA 3I4MG 5G55A 1GO3E 3AECB 1L1OC 1IKMA 2F0OA 2YU9B 2WIIB 1E7UA 3WOFA 4GOPC 4QF4A 4Q2JA 3AE1B 3IXSA 3MP9A 4IUMB 4C3JG 4X3TA 4BVUC 2J4XA 2B63G 5BR8L 1G2SA 2NUCA 5DPTA 2E6XA 2JZ3B 4LW1A 3FPUB 2Y3AA 2ZJDA 1UE5A 1WTRA 1PGBA 1VMPA 1B9RA 3CKIB 4JVZA 4C3IB 2VUMH 1XLPA 3WOEA 4AS1A 2R93G 4RCOA 1GOZA 1DOKA 1UGJA 2ASQA 2W82A 1QOFA 2WXFA 1SDFA 2NVYH 3RNAC 4MGKE 2R92H 1WGKA 1E6EB 3P2BA 4US9A 2ZNVB 4GZYC 3IAM1 4MJSA 1F2LA 2Z6BA 1XMQL 2OHFA 5EDSA 1QNKA 1JWSD 2JK8A 2N4FA 3ZNGC 2JA7G 2WP9B 4M0WB 4NP5A 2J0MA 2ZPNA 2PW9A 4BA1I 1BVSA 2BB5A 1EQVA 3LGJA 4US8A 4HJKA 4QY7A 1EY5A 3GTJH 2AQ2B 1KDAA 2JRHA 2JWUA 1SNOA 2KC2A 3DPDA 3UIPB 2VH2A 3S1RB 2DENB 1AH9A 2WX0A 5JPNC 3NS1A 3KUCB 2OEOA 4C3JB 1M8AA 2IBIB 3H94A 2LRWA 3WANA 2B63B 3HOYB 2INNE 3BK2A 1Z5SB 3APDA 2K0PA 3MXGA 2BDOA 3HGBA 2WXMA 4IN3A 1YMHE 1WTPA 1LO5D 2PTLA 5K36H 4BKSA 4DUZL 3GTLH 3K0XA 3OSOA 4A3KH 4JW0A 1WTQA 3MTNB 1FYCA 4GLXA 1BBUA 3AI5A 5LMNW 5M3MG 3K5MA 2VY3A 1QWYA 4LUZA 1W2BA 3DWGC 2X38A 1Y1WH 4P71A 3GZNB 2GB1A 2D5DA 4L5SA 1H95A 2KWCA 4YSYB 2KO3A 2B2YC 3GD7A 5JPMC 4FXCA 4R3DA 4DHJD 1KFYB 4EVOA 4KKUA 1OQRA 4WJWA 1RIPA 5NUCA 3D32A 1GUOA 3VR5A 4ZK9B 3FEWX 3NBIA 2JA7B 1ACCA 3C46A 1WJUA 2UUAQ 1PRTC 3QCAA 4NPNA 2K5VA 2VH1A 3K59A 3SK5A 1N36L 2K9XA 1C48A 4P74A 2D2QA 3ZNID 2A19A 2JEBI 2MHJA 4IJLA 2RHQB 4FXDA 1TWHB 4PYUA 2CU3A 2D3CA 1XMOQ 1RTOA 4WORA 5FLXc 2WACA 3D6WA 3S1MB 1A3TA 3ZYYX 2KQ7A 4QUFA 1XD3B 1TY0A 1C78A 4NKLA 1V2YA 1JWMD 1RDPD 1O7LA 1JCKB 3HHMA 4DK1A 1JWAD 4GKJL 4JL9A 2V1CC 1OO9B 4TKOB 2O5JC 1V6EA 1HNWL 3PIOA 4JI5L 4YTNB 2N9LA 4W9LA 1CT1D 3D8GA 3U7ZA 2F0FA 4CJ0B 1J8CA 3W5OA 1U5KA 1HNZQ 2JA8B 4XQNA 3DBHB 1QE6A 3EUB2 3U4EG 4JBWA 3NELA 5C4JB 3H6NA 4DR6Q 5M9OA 4HSVA 1EFID 1VZ6A 2D11A 1ASZA 5IT9L 2W55A 1IP9A 1ZXTA 3EJIA 3NTIA 3V96A 5IA7A 2E74C 3JAME 5KYIA 2NVXB 3TEXA 4IDIA 1V86A 3WIMA 1MJEA 3GTPH 3E9SA 4GKKQ 2I46A 5COYA 3KJOA 5KHQA 3E9IA 1UELA 4KY6A 3ALBA 2KCNA 1V9JA 1AN8A 2GVAA 4DV2L 2WQYB 2B8GA 2MBQA 3TMEA 4C3HG 3PGZA 1I94Q 5HURA 5ISRA 3A9JA 3G6JB 1HA5A 4A93H 3S14B 1B2TA 3BG3A 2WHIA 3DWMA 4R4CA 4UDUC 4DR7L 3NZUA 3ZIMA 5HY6A 1GUGA 3PIPA 3QIAA 1C4QA 2P5ZX 4ZRZA 3V6EB 1YEZA 1B7YB 1KIXA 5BYRA 4B9WA 4HJGE 4LFBQ 2M0AA 5H8YE 2R3ZA 5BO4B 1D8LA 3RMKC 3M7GA 4EQNA 5D94A 4B3SL 4DHZE 3PMFA 4KIKB 1A5RA 2R61A 2D3GA 2KCTA 1XPUA 4KKJA 3GTOB 3AM9A 2EQSA 1JWBD 3IFTA 1IYVA 4HCSA 1EIFA 5EPJA 1C77A 1WXQA 5IYCH 2WV6D 1V97A 3MC8A 4PYZA 1SXTA 3M4YA 3VH3B 2BF8B 1YJIA 1EUVB 5H92C 4NQKE 2EY2A 2LXAA 5GAGC 3ML8A 3NVZA 3T8MA 5HI1A 5I2XA 3OJ3A 3APCA 3PCOB 1CHQD 4OZAA 4FYDA 2MW5A 1G291 5C3XA 4C3HB 4EX5A 2ONQA 2L11A 1ASYA 1TZOA 1D1IA 3D3RA 4A3EG 4A3DG 4WIPA 4HMJA 4L63B 1WFYA 4KGRA 4M0WA 1SLJA 3NHEB 4A8XC 3SHLA 4BKSD 2X8XX 2LS01 2F52A 1OEYJ 3IFWB 4JV5Q 4A3FH 1SE8A 4MTNA 3A7AB 1NAPA 3SD5A 2KJXA 1VMCA 2NZ1D 4PMWA 1UZXB 4YSXB 2BYTA 3Q3JA 1PRTD 2K5QA 2BOSA 1NVID 4IPGA 4MGIE 1KH0A 2MJEA 4L5QA 3DMUA 3T1YL 1Q82C 3A1QB 3P4SB 3TEWA 4K7WA 4J15A 2PJHA 1FNVA 2EKIA 2J0JA 4R1JA 1TT2A 5IGCA 4IWPA 3CCQA 3M4OH 4IO9A 1OEYA 2KEEA 3LDZE 2M9VA 5KRUA 3QK0A 4RM9A 1FGBD 4KMUC 4DR4Q 1SB3C 5E6NA 3S1QH 5BN5A 1XPOA 4II2B 4H2AA 1IYUA 4QGUA 2H5XA 5AJ3Q 2Y0SG 2KLCA 1IYJB 2JQOA 2PZWA 3K7AB 3RFZB 4BBSG 3PPAA 4LDTD 3J7ZC 1BMLC 4OELB 1ZUD2 2ZJRA 3N6RA 4G4KA 1MVKA 3ND8A 4II3B 4A3EB 2OF1A 4RH6A 3S16B 4A3DB 1WGHA 1PYSB 4DV4L 1KABA 1MBYA 2HQEA 1MJCA 5G3LD 2OTLA 2R7ZH 2PI2E 3ETRA 4JG2A 2GBMA 4NJ7A 2NBFA 4A3CG 1H9SA 4G7OC 4LF9Q 1JQYD 2CQOA 4ZCKA 4I6PA 3BK1A 5M5XB 3NP8A 1TS4A 2F0QA 2KHWB 3PHXB 3I4NG 3PUZA 2WYQA 4LFCQ 1LM0A 5HHDG 3Q3OC 3VR9B 2EXZA 3ULPA 1N5XA 1TKGA 2UUAL 1C9OA 1JMLA 3DBLI 1SR3A 3S2DH 1R4QB 1KDBA 3HG9A 3PZ7A 2A8VA 4DHZB 2KFJA 3H3VH 3HK0A 4FXGC 4BBNF 4FXKC 1K3RA 4M00A 2AUKA 1U9RA 1XMOL 5TR5A 5JEAH 5DEHA 5IOIA 4FDBA 3C3LA 2QMTA 1VQCA 2CHZA 2LWPA 4FP5D 1GKHA 3K9OB 2Y0SB 1N9WA 1BKBA 1ZEQX 2DNEA 2F0SA 2H88B 2TSSA 3AQQA 3DM3A 3H7SA 5ELBA 4BBSB 4MNOA 4O42A 5CR3A 3P4QB 1OFFA 3QJZA 5LXHA 2FCMA 1V1OA 3A8JE 1NNXA 1AE3A 1VQFA 4S0RA 2A6HC 2LHEA 2BVCA 2K1BA 4FULA 1DZ1A 4MDKE 3P20A 2FIFA 3BDLA 4CKBA 1BT0A 4HMIA 3GQBA 1WYWB 4DR6L 4YCUA 1N32L 1D1KA 3BINA 3ZVVA 1TKYA 4HIOA 2ASBA 2RGFA 1WVLA 4CDEC 1WMHA 4DV0L 1QVFA 1VQKA 4QIWE 1GVPA 4F88A 5L37A 2D5GA 3I4NB 2YTVA 1F1HA 2JUOA 3Q2AC 4GKKL 4DN4M 5IY0A 4UY8C 2F0GA 3KUDB 4JI1L 1ILQA 2L52A 4KI0A 2RSUA 1JROA 2Q2TA 3HOWG 3MXPA 1VQ7A 4LF6Q 2BKFA 1WYGA 3J81L 1I94L 1E8XA 1NTGA 1JW9D 1TWAH 4NQLB 1UNSA 2M0XA 4A3GG 1PXUA 4NPSA 3G71A 4G7HC 1Y8NB 4EQPA 1RRBA 2E2HB 2BA1A 2RQXA 3HM6X 1YI2A 4N8X1 2AYOB 2L0TA 3Q8FA 3V05A 4IOAA 2WXIA 2GRIA 2KNBA 1J5EQ 2O2VA 2DX5B 2ZTEA 3MZ5A 3VYTA 1IBMQ 1DGJA 2JA6B 2M2LA 2LJ5A 1F2RC 5EAYA 5C0XH 2LGYA 1HFGA 3PO0A 1VQOA 2L05A 4DK6C 1G8ZD 4YWKA 4A20A 4MM3A 1P0RA 4K8JA 2DUDA 1E0BA 4K7UA 2ON8A 5JJLA 1K83B 1WI5A 4TQ1A 5CHWA 2N3SA 4MEMA 5JZEB 1SJED 1VZ8A 2KKCA 4N59A 5ELOA 4AQ7A 2K33A 4YCVA 5GAEC 1Y8PB 4MN3A 2Y5CA 3VRAB 5IP9H 4K1RB 1YX6B 1C76A 3PRPB 2EDGA 3CIRB 1KNAA 3P63A 3SDLC 3I63C 2ZXPA 1P3QU 1CSQA 3E9HA 2MBHA 1VD2A 4A3GB 5E6JA 4GN4B 2JSOA 4XXEA 2PE9A 3L13A 2BWES 3TZUA 5DPSA 4HWIB 1N34Q 3FHWA 5DM73 5LLIA 4JPBW 1QOBA 3RZOB 1HTPA 1F0ZA 3RMHA 2WLBA 4C7ZA 3FPPA 2EY5A 1SFOB 1Q3LA 2RDFA 1AYFA 2WGSA 3SK4A 4W9FA 1EEID 4ZOHC 2HE7A 3FKYA 1AE2A 5G5HA 2DY7A 3RNGC 2K8HA 5AUIA 3J81j 4IM2A 1TWGB 2WXLA 4HEA1 3B0AA 1WFQA 5C3EB 1WTWA 1K50A 3L10B 1JWUD 4DR4L 5KNDA 1G91A 3QARA 3MFGA 3S2HB 4URKA 4QQBX 5IGEA 2B2WA 2RDGA 4ZHPA 2V3SA 1MI0A 1AWDA 4QIWB 2Y5BB 2RDBC 2J7QB 2A6HD 2MHVA 3AEGB 5JJKA 3UDGA 1L0VB 1X3GA 1PFMA 5GAHC 1V9PA 2CW0C 2EYJA 5KYLA 3G6EA 3Q8CA 2MQJA 2JZZA 2F3VA 1XO3A 4HDQA 2M19A 1KAWA 2MGSA 3VVWB 1JE5A 1NY4A 3KLRA 4ZRKA 4OEMB 3M85A 5DAUA 5EE3A
chains in the Genus database with same CATH topology
3J7YW 1N63A 4XT3B 2F3WA 5C5MA 2EPBA 1MSHA 2YEPB 3AEBB 5C4HA 3KBGA 4JE3B 1V8QA 4XYQA 2LMCB 4K2LA 1J9OA 4YTPB 1OXTA 2L1AA 3MC0B 1UUPA 2L55A 4K6LA 2CQAA 3KWLA 2DNCA 1SE2A 2WXJA 4B08A 1DOIA 4IFDH 1CQVA 3FVQA 1NI3A 4A90A 2WXQA 4XQJA 3TEYA 1PZID 2E2JB 2PW7A 3RLFA 2VB3X 4MT5A 1LT3D 4OIJA 1F2YA 1GUSA 3E5SA 3EGRA 2A6EC 1STBA 5T1IA 3AB5A 3LB8C 3ZJUA 2VB2X 4ZQ3A 5FLXL 3DEOA 5EQ0A 1FRDA 4XE0A 3V2TA 3ONAB 3K5LA 1AZQA 3KK7A 4EE2A 1BR9A 1T3QA 1O7YA 1T6BX 2WS3B 4IALA 5BN4A 3T56B 4IUVA 1WWTA 3TP5A 1N5WA 4H0LC 2WXHA 4HAEA 2PYKA 5KNCA 2DLBA 1SNMA 4KKTA 4K6DA 2LKVA 3NXWA 1SAPA 2Z1CA 4GDKB 2XN9C 2NTTA 4L1BA 4DNRB 3TP7A 2RPVA 4J3OD 2KQ3A 1QCBD 3W5UB 1AEXA 4B9XA 4JK1C 3OIQA 1H9RA 4PMCA 3KLSA 1B4OA 2CW0D 3S15B 1XLNA 2ZW0A 4UAIA 4DGZA 4PT5A 1C4PA 1X3QA 2L83A 1E10A 3VR2A 2EYOA 3SFEB 2L1BA 2DWQA 3GTQB 1JE4A 4KD3A 4FF3A 3BVZA 2G1EA 2LEKA 1S5FD 5IT9E 1VJKA 5J1ZA 1EIGA 2K6AA 5EKKA 1EY0A 1PTOC 3CRLC 2PNRC 1QNUA 1JICA 1Y69U 4XWWA 1BUVT 1YJJA 1OXSC 1ZP0B 2F0WA 3RZDB 3KWVA 1G6ZA 1ZPSA 4YIJA 2VZKD 1EYCA 5J39A 3TEZA 2A6ED 2EYFA 3MAQA 3K58A 2LMCA 2B76B 2F0NA 2OT2A 1A3UA 2SDFA 1U4MA 1AP0A 3AN1A 3MFYA 2EJGC 1AW7A 4TRDA 4XDXA 1BO0A 3HP3A 3C1FA 2XRSD 3K5OA 2X6LA 3CQZB 2KOLA 4X3SA 4C2MB 4C3IG 1ENAA 3T3NA 2FJ2A 2IL8A 4Q0FA 4Z9CB 5JAVA 2B2UA 4A3JB 4ABNA 5EKIA 5JVH3 5C44B 3E56A 4A3IB 1KTKA 1JALA 2K22A 3RPFC 5T8IA 1BDOA 2I07B 2DY8A 3BS1A 1WD0A 2K05A 4EQOA 2WKCA 1FXAA 4ILWA 2W3SA 1STHA 5CV6A 3QOJA 1KRHA 2YEPF 3C2PA 1EWCA 2QEJC 2K28A 1RWSA 2MJ8A 5IIFA 4KX6B 4WRDA 1B9NA 5CBAE 2RMMA 4IKGA 4JX1C 4C80A 4D2KA 2WB1B 2OEDA 1OXUA 1I4GA 5CV8A 1ROEA 1PTOD 1V43A 5A35A 2K5DA 2JA5B 1SNDA 1OXVA 5FO9B 1K8MA 5KIXA 2PW5A 1RYJA 2HTME 4KGSA 1NYRA 2KQ4X 3T53B 1OQQA 2K01A 3R93A 3DWQA 2N0SB 1EEFD 3LNNA 1D2BA 3SK6A 5CV5A 1F2MA 3NBHA 2NVQB 1ZOYB 3Q23A 1ICWA 2Q8IB 3PO2B 2CJOA 3MXUA 3R2TA 4HRSA 2F0HA 5AUKA 1WTOA 1KF6B 2H4OA 2E76C 2SAKA 1Q10A 3A56A 4A3MB 1XLOA 1PGXA 1DXMA 3TP6A 3M7NA 2XWJB 1VLBA 2E3TA 4LTUA 1KLGD 2A69C 3D4RA 3VR4A 3A7LA 3NTHA 3K6OA 1ET6A 4PNYA 3GO5A 1J8IA 1U4LA 4O1NA 2WDRB 3QG1A 2K5WA 3L3OC 3CRKC 1LT6D 3J81E 4BBRB 4DF7A 2AWOA 3EQLC 3KF8A 2JU6X 2NVYB 4QCLA 2R92B 2EY6A 4LJZC 1XXGA 3HKZB 1QF6A 3LYYA 1RFKA 3VQIA 1LT5D 5T1GA 1A3VA 2F0IA 3GTJB 1NCVA 1L6UA 2RA4A 3RD4A 2PZUA 1HQRD 4LMQD 1TS3A 1NSNS 1K8OA 2IX0A 2O2LD 3OMCA 5EBCA 3GTLB 4A3KB 1RKNA 1FCLA 3QWNA 1SYCA 1H9KA 1PFNA 1Y1WB 3SR1A 2WU5B 4YTMB 2CHBD 2VNUD 3BVMA 1FNWA 4CJ2C 1MHXA 2PVGC 3I9V1 2QCPX 1IHZA 3HOXB 1SNPA 2RDHA 1Y56A 3FRPB 1LV9A 2E75C 1J7CA 1L5PA 1X32A 1F9SA 4XQQA 3NWSA 1C4AA 4NJCA 3Q8BA 3PIO3 4A6QA 4GDLB 4DNTB 3ZQ4A 3J7AF 1ZE3D 3AH7A 4G7ZC 2CVRA 5FO8B 3URYA 4KY5A 2I38A 3VR6A 4HKZE 1YNJC 1B44D 2ZW1A 3P42A 4OZCA 1DYQA 1HCZA 2A69D 5I2YA 3Q24A 3GTPB 1STNA 2J0TD 4ODGA 5AFWA 3OIPA 4DA2A 2JSVX 1U4RA 1QOAA 1E2VA 2TMPA 1JORA 1I4XA 3AB9A 2IWHA 4C56C 3HOZB 3GB1A 1OXXK 4A93B 4C1NK 2PKOA 2WDQB 2AWNA 4KKIA 4L8JA 4BY7B 4FF2A 2F0DA 1FEHA 3H91A 1I4RA 5BN3A 2IT1A 5I6WA 1VRAB 4KTAA 3HRZC 5CV7A 3B2GA 3SEBA 4IFDI 4JWUC 3LWUA 1ET9A 3MA2B 2WU2B 4TQUS 1EWYC 1DOXA 2MP1A 1ESFA 1I7HA 1TS2A 5FLXE 1S5BD 1EU3A 2CJNA 4LLGM 2BS3B 2RSOA 4ME5A 2N9KA 1A2UA 3FC4A 1STAA 1TU2B 1HA6A 1ZDVA 1VCIA 2PQEA 5I9PA 1CQFA 1QG7A 2NN6I 2LUMA 3HUIA 1QKZA 1FR3A 1MHHE 2HCCA 2BW2A 3GV3A 3FILB 4HCEA 2GA4B 5CGKA 2WXGA 4HR7B 3VR3A 1BOSA 4LK0M 5A2QL 4TQ0A 1S5CD 3AMUA 4IUNA 5BMIA 2QKIC 2BS2B 1DOYA 2F1MA 5BYQA 2MUYA 1DD2A 2J52A 3EA6A 3O13A 4XTCS 1O78A 2WXNA 1A15A 4NW2A 3FDTA 3M4OB 3TP8A 4G57A 4LAAA 3CU7A 3S1QB 3NVYA 4N58A 3BYTB 1MI2A 1H9JA 1XEEA 1B50A 2LHDA 3I90A 1YNJD 1XCTL 3FAHA 1T5EA 2DBYA 3BZDB 2ICIA 1T5XD 1DOMA 2F0JA 4OL7A 1PTOH 5CV4A 2JP1A 1RD9D 1EQTA 5CORA 1PGAA 2JXTA 2KCCA 1IL8A 3H0GB 1II3A 4K14A 2G9DA 1YN3A 5FR3A 1Y8OB 2KMMA 1CJEA 4IUUA 1S4ZA 1K51A 5HGTA 1YN4A 1E9MA 4ZRPA 3D4DA 1GB1A 4XWTA 3VR8B 5TSSA 5CV9A 1CZWA 2B39A 3R3OA 4CGYB 1Q90A 1CTMA 3ZJVA 1HTLD 2XVSA 1BCPB 3OW7A 3NVWA 4OO1I 2ZXRA 1J7AA 3NHHA 1QOHA 3I70A 3S9WA 1HRJA 4RAUC 2K7VA 3D31A 1PDXA 4ULLA 3K5NA 3NPPA 3QOLA 3LX0A 2KAJA 2EY1A 1BUIC 4V0BA 5ELFA 2PVOD 2AQ1B 3L9AX 5CMDA 3D6CA 4KJOA 4MACA 2D62A 3W2DA 3I8ZA 2I2YA 2J7ZA 4CKEA 5KNBA 2HDMA 3AE3B 4ITKA 3A55A 1YN5A 4OZBA 4C1NI 3I72A 4P16A 2BCOA 2BE5C 3Q8EA 2B2WC 1FRRA 4R8IA 5MPOA 4DU9A 1MPEA 1LLRD 3ZGZA 2QSDA 4I65A 5D7GA 1WTXA 3SK8A 3AE4B 3SDZA 4R8NA 4U68A 1F2ZA 4QMGA 5C5LA 4K5WA 3X3MA 3PV0A 1HFNA 2GI9A 3VA5A 2L4NA 2KECA 2FMMA 5F2DA 1D6EC 4REZA 2RVLA 5EE9A 5C3JB 3W9CB 5LL6X 5J22A 3M3YB 3R8BA 1LTTD 1A2TA 5C6AA 1GPXA 1D5ZC 1F9RA 2M56B 3KQ4A 2V3PA 2LY7A 2HDEA 3MJ5A 5BYSA 1NUCA 3WCQA 2JE6I 2Z4HA 2N88A 1SNQA 2SNMA 2ZXOA 5JJZA 4U673 4R9WA 3AU7A 1TY2A 2J53A 1EIHA 3J80L 4A55A 4J8QA 1STYA 4F8MA 2SOBA 3AEEB 1SSOA 4IOIE 2G9HD 2LGIA 1EYAA 1PLFA 1Q1BA 4IUQA 2L32A 4MIUA 3SVMA 4RHRA 3SXHA 3MHBA 1FD6A 1N60A 2QILA 4NAMA 1QLBB 4KHVA 1E7PB 2NN6G 1EY8A 4PMBA 4NAWB 3AE8B 3AEFB 5JXVA 2K03A 1QILA 3BDCA 2FBWB 2L0CA 4X3KA 2OXPA 3Q6SA 4KN7C 5LNK1 3BIID 2BA0A 2BE5D 2C5CA 4WQMA 3DWAA 1HUMA 3P75A 3J9CA 2IX3A 5FKAC 1F2RI 1EY6A 1LTRD 3HS0C 3J7AV 1D4BA 3LXFA 3PO3B 3MVVA 4K5VA 3GP7A 4CJ1B 1EU4A 1F77A 4NMZA 3I3CA 3IT6B 2KUMA 1MGSA 1TS5A 4OIKA 4Y7NB 1SIJA 3PZ8A 1PYWD 2WKDA 4L23A 3AE6B 1HZ5A 1JB3A 2PZTA 1SMYC 1PFBA 2J42A 4HN7A 1PRTB 2XIWA 3OPOA 2W54A 4CHTB 4DAPA 2XNAC 2IPKD 1Q1EA 2EYHA 1SEBD 4H7BA 1SYGA 1FMAD 3SR6A 1RJTA 3L4PA 1WCMB 1BCPF 4ARCA 4MH8A 2V4DA 4OO1G 2F0KA 1BXTA 3NQTA 4KHZA 1L4ZB 1KDCA 2MH7A 5CBEE 3IAS1 3HOVB 2NYZD 1JOQA 2RBMA 1YQ3B 2L5TA 2IJ0A 2B2UC 3ABVB 2PMVA 5D65A 4C7YA 2EYLA 1IKLA 1C79A 1E0ZA 4BY1B 1QOGA 4NDXA 2SEBD 3VRBB 2B8FA 3AMZA 1LTID 3P1HA 1STEA 5EGTA 3AEDB 1Z6HA 5DM63 1FFVA 2X69A 2FE8A 1ESRA 1M4VA 3KUPA 5EBDA 3TUOA 1B53A 3OOCA 1NR4A 4L6TB 1GB4A 3P4RB 1TYGB 5HFYA 1WTVA 1GHJA 2WXRA 4RF1A 1CZGA 2LFIA 2EVBA 2FHTA 4RGOS 2X6GA 4F87A 1JC7A 2N7JA 5EJWA 4DK0A 1VZ7A 2HDLA 4N9TA 1GAQB 2DYOA 2F0LA 2EYPA 3MWYW 5ELDA 1P7FA 1HXYD 4FVMA 3GV6A 4WWMA 1SNCA 3PUVA 1SMYD 2IW3A 1WD1A 1CM9A 3GS2A 2WP8J 4M8AA 2F0UA 1SYEA 4DXFA 5IGBA 2M00A 5BMHA 1SBBB 3QB3A 1A70A 4K8IA 3DWPA 5A2QE 2FUG1 3I4MB 1BNZA 3Q22A 1I4QA 2O5IC 2JYEA 1EY7A 2BS4B 1NYQA 4ZLTF 1PUTA 1I4PA 1XLQA 1B9MA 2JZPA 1YNNC 2B2YA 5I6YA 2R93B 1TQOA 2QIEB 1GJXA 2Y5PA 5K36G 3W1SA 2VUMB 1XYIA 2KEDA 3TDQA 3VA7A 4LK1C 4BWGB 2ACZB 3HEJA 4RCNA 4HEDA 5D3DA 4MHEA 1HUNA 3K0YA 2MJ3A 5IOCA 1H9SB 1PFDA 3SFDB 1QQRA 3VYSA 3K57A 2XSCA 1SYFA 2QJLA 3E0JA 3OWEB 2RSNA 3W3AA 2EE1A 5C0XI 1QB5D 3WDNA 3U52E 4YSZB 1LT4D 2NWGA 2NTSA 2XRQD 3H8HA 5M3MB 5HG2A 4OGQC 2AQ3B 1DOLA 1UWXA 2A68C 3NVVA 4P2CB 4RWSC 5EE0A 2K04A 3U9SA 1K53A 4CBVA 1I6VC 1N61A 1XCQL 5JOBA 3ERQA 3OMGA 2DYMA 1CA5A 1TJEA 1ML0D 4IZ8A 4PQXA 2WXOA 4E6IA 1TKEA 1UAPA 3PUWA 1YNTE 3I73A 3S17B 4V190 1RM6C 2VXWA 1EY9A 4DXGA 2NVTB 1R7SA 1L0XB 4P6VF 1JQ4A 4NZLB 3W5VB 1PRTF 3HRDD 1FFUA 4WFN3 4HKQA 3MEHA 3AE5B 2EZVA 5E4WC 2HUGA 1FO4A 4CQNA 2A73B 4FO2A 3P7JA 2IGGA 2KWDA 1ENCA 3C8YA 3NRZA 1SF0A 2L9HA 1IUEA 1FCCC 3FMCA 4XIGS 1SSNA 3IL8A 1YNND 4IURA 3F2UA 3NQIA 3GTKB 4RGNA 2A74C 4N9PA 3IT4B 4MM3B 1V8CA 5LL6S 5FO7B 5G3LF 4WH4A 3T13A 4BS9A 1WSPA 5EPKA 3KBXA 3CWIA 1TVXA 1XTCD 3MHZA 3PIP3 2PCFB 2Q8TA 5E4XA 2Z8LA 3DXJC 2IDYA 3IAYA 2INPE 5C4ZA 1B1ZA 5C2TB 3I91A 1ILPA 1DM0B 3B9JA 1CFMA 5DNFA 3A8KE 1EY4A 1AFPA 3MXNA 1CK1A 1EZ6A 2F0TA 5K5PA 4WAFA 4H13C 1FD7D 5I9OA 1QT9A 2MPMA 1KNEA 2AX5A 1L0YB 4OW0A 3L7ZC 1MD2D 3OHXC 1EYDA 3J80E 2A68D 4DAYA 1GUTA 3T16A 2W3RA 1KLUD 1EZ8A 2MEKA 2AUJD 2ENBA 1Z47A 4A3FB 4KJNA 4PV1C 5ELCA 1LTBD 1AZPA 4RGMA 4OHJA 1IBXB 3C1EA 2EELA 5I4DA 1MSGA 4RNAA 4XYOA 2BTEA 1F9QA 1SE4A 5JEAG 1O80A 3P1MA 1VDZA 4KY7A 2DN8A 3IFDA 1STGA 2VZKB 1EWHA 1L6VA 2EJMA 1W6JA 1R9TB 4ZKBB 5IGDA 3HOUB 3QO2A 4DAVA 2L12A 5EKLA 2R7ZB 4XT1B 2H89B 2H1EA 3BWUD 2R6GA 2IGHA 3I57A 1XX8A 1FNUA 3DEPA 2N55A 3SE0A 1GHKA 2D2CC 3EROA 1SE3A 3S2DB 2O4XA 2F0EA 4ZUIA 3AE2B 2LFNA 4KK7A 1DJRD 1BQQT 2F03A 4XDDA 1WRIA 2RKSA 4TMAB 4ZRQA 3NK9A 1YQ4B 2WNMA 3PUXA 1TWFB 4B0EA 2PLPA 3ND9A 1DONA 3JAML 1PMRA 1ZYRC 1G2TA 2PPBC 4ZYSA 5C0XG 2B2TA 1LACA 2JXMB 5EE1A 2V4IB 3DHQA 3ZJTA 4USAA 1S5ED 3H09A 1L4DB 3HOWB 1DCZA 1JR0D 2B2TC 1I6HB 1H9MA 4JPSA 1SJHD 2XWBB 3UI2A 3H6MA 1JOKA 2FMCA 5KEEA 2FFKB 2JYOA 1ZXHA 5E1FA 1TWCB 1TWAB 3DUZA 1FM0D 4KV6A 3TN2A 5M5YB 1I4HA 2ICEC 1PZKD 2EOTA 1ZKOA 4BA2I 5KGUA 2KHSA 3CHBD 1BF4A 1VDVA 4WURA 1PTOB 2EJFC 1NEKB 4EGVA 3BYYB 1J7BA 1SYDA 1GUWA 1C9FA 1V1PB 1Z7TA 1VF7A 2QF7A 4FF1A 2K32A 2F0VA 1VR9A 1LTSD 3A8IE 1EL0A 1NENB 5D14A 2WINB 1TIID 1X3PA 3FILA 3P4PB 3U9OA 4HTHA 1C4CA 2EYMA 2HCIA 1QJOA 1I50B 5M5WB 5D3IB 5GXGB 1JRPA 1IBXA 4H44C 2F0PA 3NZ3A 5CC4A 3PUYA 1LTGD 4L2YA 4ZHOA 3DM1A 5ELEA 1RTNA 1W6KA 2C9OA 3OWFA 4K5XA 4YT0B 1SYBA 4YXDB 2WXPA 4RFBA 3T4AC 3ITPA 5IGFA 4YWGG 1PZJD 4KD4A 1CHPD 1ZDXA 3GTMB 1RODA 1ONLA 2IX1A 1N62A 1ZXIA 1C8CA 3UI3A 1U4PA 2WXKA 4F7XA 4IFDG 4RKBA 1P7EA 3B2FA 1UEAB 2Z4IA 4KKSA 4KN4C 1CZPA 1ZYRD 4GLSC 3NUHB 5JEAJ 3NE5B 2MJDA 2D9UA 3AEAB 2JYTA 3NSWA 1EM7A 1RHPA 2PIAA 1I3QB 4XDCA 4RHSA 4A9AA 1TR5A 1Q8IA 3BVGA 2YYZA 2NN6H 3T3OA 3I4LA 1LTAD 3S1NB 4JWSC 5CYUA 2JQRB 4A3BB 3Q69A 4ZKCB 3Q8AA 2Q5WD 5C4XB 2BDNA 5IODA 3QJYA 1IW7C 3H3VC 2BBCA 5E3FA 2KACA 3BDOA 5BMGA 3N52A 1XWEA 2QDBA 4FF4A 1FXIA 4ZUJA 4S3SA 4Q5VA 3NUCA 4TSSA 4HROA 1B3AA 3E6ZX 1Y1VB 1BCPC 2NMQA 3LWEA 1E2WA 4M1UB 2PO4A 5C3WA 3U2SC 3TBIB 2KVMA 2V0GA 1Q12A 3TZDA 3NWTA 5LHY1 3Q0AA 3G7LA 5IGGA 3A54A 5C0XJ 1BBXC 4IQZA 4ID6A 3D4WA 2V3NA 1E2ZA 2B2VA 4J1MA 5FOBB 2KA7A 3R2IA 1HEZE 1ENFA 1IGCA 2FINB 1PDQA 3VYRA 4AYBB 2B2VC 2BB6A 4RKLA 3IKJA 1HPCA 1V1PA 2IGDA 3AE9B 2JEAI 2A5HA 3V3XA 1D5MC 1LABA 4QB4A 2KN4A 4CKCA 4RF0A 1NR2A 2JX5A 1O7ZA 3NTKA 4DQOC 1GUNA 1A6XA 4QUCA 1CI3M 3N9YC 4OVZA 3VYUA 1XF5L 4RGTA 3RUZA 2Q8RE 2KDMA 3T51B 4IUPA 4OO1H 3AE7B 1K52A 4I7ZC 2BT6A 1D5XC 1GXDC 3EVQA 1FIQA 2PMZB 3X3NA 4HSPA 3AV8A 2E2DC 4DFAA 1RCVD 5M3FB 2K5PA 4N6EB 4KGTA 2E2IB 1IGDA 1UWMA 4RA8A 3TSSA 2WDVB 4IUTA 5FK9C 1HHVA 4J6HA 4X3UA 1EOTA 3FKIB 1HZ6A 1CA6A 1JOOA 4ARIA 3KLSX 2K3UA 3GTGB 1IW7D 1R4PB 2SNSA 2F0MA 3HVZA 4ZAIA 3HVDA 1S5DD 1KAAA 4FNFA 2ID0A 4K2KA 1PTOF 2LJIA 2NB0A 1RF2D 1VF5C 3EFXD 2WAQB 4B0MA 5EPLA 2ZT9C 5JVG3 1HQMC 2F4IA 3HZXA 1BCPD 1F9PA 3MTSA 4IFDJ 1TKWB 3AECB 1IKMA 2F0OA 2YU9B 2WIIB 4Q2JA 3WOFA 4QF4A 3AE1B 3IXSA 3MP9A 4C3JG 4X3TA 2J4XA 1G2SA 2NUCA 2E6XA 2Y3AA 3FPUB 1WTRA 1PGBA 1VMPA 1B9RA 3CKIB 4C3IB 1XLPA 4AS1A 3WOEA 4RCOA 1GOZA 1DOKA 1UGJA 2W82A 1QOFA 2WXFA 1SDFA 1WGKA 1E6EB 4US9A 4GZYC 3IAM1 1F2LA 2OHFA 1QNKA 1JWSD 2WP9B 4NP5A 2PW9A 4BA1I 2BB5A 1EQVA 4US8A 1EY5A 2AQ2B 1KDAA 2JWUA 1SNOA 3S1RB 5JPNC 3NS1A 2OEOA 4C3JB 1M8AA 3H94A 2B63B 3HOYB 2INNE 3BK2A 2K0PA 3MXGA 2BDOA 3HGBA 2WXMA 4IN3A 1YMHE 1WTPA 1LO5D 2PTLA 5K36H 3OSOA 1WTQA 1FYCA 3K5MA 1QWYA 3DWGC 2X38A 2GB1A 2D5DA 4YSYB 4FXCA 2B2YC 3GD7A 5JPMC 4R3DA 1KFYB 4EVOA 4KKUA 1OQRA 4WJWA 5NUCA 1GUOA 3VR5A 4ZK9B 3FEWX 3NBIA 2JA7B 1ACCA 3C46A 5G5GA 1PRTC 3K59A 3SK5A 2K9XA 1C48A 2JEBI 4FXDA 1TWHB 2CU3A 1RTOA 4WORA 2WACA 3D6WA 3S1MB 1A3TA 3ZYYX 4QUFA 1TY0A 1C78A 4NKLA 1JWMD 1RDPD 1O7LA 1JCKB 4DK1A 1JWAD 2O5JC 1OO9B 4TKOB 4YTNB 2N9LA 1CT1D 3D8GA 3U7ZA 2F0FA 4CJ0B 2JA8B 3EUB2 4XQNA 1QE6A 3U4EG 4JBWA 5C4JB 5M9OA 4HSVA 1EFID 1VZ6A 5IT9L 2W55A 1ZXTA 3EJIA 3NTIA 3V96A 2E74C 3JAME 5KYIA 2NVXB 3TEXA 4IDIA 3E9SA 2I46A 5COYA 4KY6A 2KCNA 1AN8A 2WQYB 2B8GA 3TMEA 4C3HG 5HURA 5ISRA 3G6JB 1HA5A 3S14B 1B2TA 3BG3A 3DWMA 4UDUC 1GUGA 3QIAA 1C4QA 4ZRZA 5BYRA 4B9WA 4HJGE 2M0AA 5H8YE 2R3ZA 3M7GA 4EQNA 3PMFA 2R61A 4KKJA 3GTOB 3AM9A 1JWBD 3IFTA 1IYVA 4HCSA 5EPJA 1C77A 1WXQA 2WV6D 1V97A 1SXTA 3M4YA 1YJIA 5H92C 2EY2A 3NVZA 5HI1A 5I2XA 1CHQD 4OZAA 4FYDA 2ONQA 1G291 5C3XA 4C3HB 2L11A 1TZOA 1D1IA 3D3RA 4WIPA 4HMJA 4L63B 4KGRA 4M0WA 4A8XC 3SHLA 2LS01 3A7AB 1NAPA 2KJXA 1VMCA 2NZ1D 4PMWA 4YSXB 2BYTA 1PRTD 2K5QA 2BOSA 1NVID 1KH0A 2MJEA 3DMUA 3TEWA 3P4SB 1FNVA 2EKIA 1TT2A 5IGCA 2KEEA 2M9VA 5KRUA 1FGBD 4KMUC 1SB3C 5BN5A 4H2AA 1IYUA 2PZWA 3K7AB 3RFZB 1BMLC 1ZUD2 1MVKA 3N6RA 4G4KA 3ND8A 4A3EB 2OF1A 4RH6A 3S16B 4A3DB 1KABA 1MBYA 2HQEA 5G3LD 3ETRA 2NBFA 4G7OC 1H9SA 1JQYD 3BK1A 5M5XB 3NP8A 1TS4A 2F0QA 3PUZA 5HHDG 3VR9B 2EXZA 1N5XA 1TKGA 1JMLA 1R4QB 1KDBA 3HG9A 3PZ7A 4FXGC 4FXKC 2AUKA 1U9RA 5JEAH 5DEHA 3C3LA 2QMTA 4FP5D 2Y0SB 1ZEQX 2DNEA 2F0SA 2H88B 2TSSA 5ELBA 4BBSB 4O42A 5CR3A 3P4QB 1OFFA 1V1OA 3A8JE 2A6HC 2LHEA 2K1BA 1DZ1A 3P20A 3BDLA 4CKBA 4HMIA 3GQBA 1D1KA 1TKYA 1WVLA 2D5GA 4F88A 3I4NB 4DN4M 2F0GA 1ILQA 2L52A 4KI0A 1JROA 3MXPA 1WYGA 3J81L 1JW9D 1UNSA 1PXUA 4G7HC 1Y8NB 4EQPA 2E2HB 2BA1A 2RQXA 3Q8FA 3V05A 2WXIA 2GRIA 3MZ5A 3VYTA 1DGJA 2JA6B 2M2LA 1F2RC 5C0XH 1HFGA 3PO0A 1G8ZD 4K8JA 1E0BA 2ON8A 1K83B 4TQ1A 1SJED 1VZ8A 4N59A 4AQ7A 2K33A 1Y8PB