2QEJC

Crystal structure of a staphylococcus aureus protein (ssl7) in complex with fc of human iga1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
191
structure length
191
Chain Sequence
YDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQNHQLFLLGEDKAKYKQGLQGQDVFVVKELIDPNGRLSTVGGVTKKNNQSSETNIHLLVNKLDGGNLDATNDSFLINKEEVSLKELDFKIRKQLVEKYGLYQGTSKYGKITIILNGGKKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IG ALPHA-1 C REGION
publication title Structural basis for evasion of IgA immunity by Staphylococcus aureus revealed in the complex of SSL7 with Fc of human IgA1
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 191
sequence length 191
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qejC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qejC01
4RFBA 1PTOC 1CK1A 4Z9CB 4DXGA 2QEJC 1T5XD 5ELDA 1QILA 4UDUC 2ICIA 4RGOS 1BXTA 1EEID 2IPKD 1EU4A 1TS4A 1YN3A 4DXFA 4OHJA 1TS2A 1I4GA 2XNAC 3R2IA 1CHQD 1FNWA 2AQ1B 1SE3A 1D5MC 5D3DA 1D6EC 1S5FD 2NTTA 1FGBD 3R2TA 2R61A 1BCPF 1BCPD 3BYTB 1CT1D 1PRTC 3R8BA 1I4PA 1B44D 1XXGA 1BCPC 5TSSA 4NZLB 2O2LD 1I4QA 2XRQD 1CQVA 1PTOH 3BVMA 1JCKB 1LT5D 1ET9A 1S5DD 2SEBD 3EA6A 1L0XB 1STEA 1LTGD 1PZJD 1SEBD 1JWUD 1PZKD 2J4XA 2Z8LA 3MFGA 1EFID 5ELFA 2QILA 4C56C 1S5CD 2G9HD 1TS3A 3MC0B 1HQRD 1KTKA 5D3IB 1CHPD 1LTBD 1SE4A 1F77A 1UUPA 1I4XA 1KLUD 1I4RA 1LT4D 2RDHA 3CHBD 5FKAC 3KLSX 1SJHD 1JR0D 3DWAA 4RGMA 1SBBB 1PRTB 1DJRD 3V05A 1YN5A 4RH6A 1LTAD 1KLGD 1BCPB 1G8ZD 1PZID 1HXYD 1LTTD 1TY2A 1V1PA 4L63B 5ELBA 1EEFD 1EU3A 3URYA 1PTOB 3BVGA 3BYYB 4L6TB 1ESFA 1AN8A 1ET6A 2XN9C 1SXTA 5ELCA 1HA5A 1V1OA 2TSSA 2XRSD 2RDGA 3EFXD 4TSSA 5FK9C 4O1NA 1MD2D 5ELEA 1LLRD 1S5BD 1RD9D 1ENFA 5I4DA 1LT6D 1B1ZA 1LTID 1YN4A 1RF2D 2WV6D 2AQ2B 1FD7D 1DYQA 1AW7A 4K6LA 1JQYD 3TSSA 4BWGB 1LT3D 1GOZA 3BZDB 3BVZA 1S5ED 1D5XC 1LO5D 1UNSA 4RHSA 3OWEB 1SJED 2AQ3B 2IJ0A 4RCOA 4RHRA 4ZYSA 1XTCD 4RGNA 3SEBA 1RDPD 3DWQA 1JWMD 1PRTF 1RCVD 1EWCA 1PRTD 1FNUA 1TS5A 1SE2A 1TY0A 1LTSD 1PYWD 4RGTA 1L0YB 1HTLD 1FNVA 1LTRD 1I4HA 3W2DA 2NTSA 3GP7A 1PTOF 1PTOD 3O13A 1D5ZC 1M4VA 2CHBD 1V1PB 3DWPA 1JWSD
chains in the Genus database with same CATH superfamily
4GKKL 4G7OC 2N7DA 2G4DB 1AFPA 1T5XD 1VQ7A 4DWFA 2JK8A 3T8MA 4HPPA 5C3JB 4JI1Q 3TDQA 3K5OA 4JI4Q 2EIFA 3NVWA 2WP9B 3JAMi 4LFAQ 1I4GA 3FMCA 4C3JH 3DWMA 1IL2A 3S1MB 2NPTB 4ZRKA 3C1EA 4AYBB 2M4NA 1SF0A 3G6JB 4DR1Q 5E4XA 3S2HH 3DBRB 4ITKA 5CV4A 4MJSB 4DV5Q 2KOXA 1VQMA 2NVQB 1WZ0A 3QJYA 3P75A 2RSUA 4H02A 5G5GA 1HH2P 1SMXA 5GADC 4DR4Q 5EPJA 3QOLA 4POGA 3CCEA 4LTUA 3D32A 1CQVA 2QC8A 1WMHB 3HOVH 1WX9A 3L13A 3R66C 3B0AA 1PMRA 3PSEB 3VTUA 3IKJA 4EVOA 3MJWA 4ZDVA 3RNEC 2HTHA 2BKFA 1PZKD 2UXBQ 2XK5A 1JRUA 3VR3A 3G71A 1B9RA 3VYTA 4IOIE 2A6HD 2QIEB 4AYBG 3DUZA 1VQAA 4HEDA 1TIFA 4BOZB 3RN9C 2HIXA 4PV1C 4O42A 1UUPA 4O2DA 1TYGB 1S72A 4L5SA 3FKIH 2ALYB 5KYIA 1SJHD 1NEKB 2KWCA 5IT9E 3QA8A 3BDOA 2RHQB 1SDFA 4A8XC 3TP8A 1H9KA 1AE3A 4ASWC 1XEEA 2REXA 4B08A 1N60A 4LFCL 1R4NB 4L63B 1TWCB 1FRDA 2O6VD 1EOVA 2XVSA 2K75A 1RFKA 2LSSA 3HM6X 5EPLA 1R7SA 5FLMG 2K8HA 3RYTA 1SYBA 4MDKE 1I94L 1N63A 1SXTA 1WVLA 4M0WB 3KJPA 2I0QA 2M17A 4KDLB 2JXMB 3RT3B 4NPNA 1QLBB 3MXUA 3KOJA 1XMQQ 2EYOA 5JH5C 3CPWA 2RKSA 1BF4A 4CKBA 1G91A 3J80c 3J7YW 1EWYC 3PT2B 4DV2L 3DM3A 3F2UA 3M7NA 3S2DB 3ZJUA 2PPBC 4QUFA 2NZHA 2HTME 5GXGB 2C35B 1KDBA 1PGBA 3JYUA 3A5ZB 4TQ1A 3VR9B 4EZLA 3PIO3 4KJNA 1E3PA 2LXAA 3OWEB 4K5XA 5BR8L 3PLVA 5IKCM 4OIKA 2ZW1A 2ZNVC 3FHWA 2DBYA 1RCVD 1U5KA 4DV6L 4CHTB 5HHDG 5JEAG 4JGHB 5EKKA 3X23A 2B2WA 2KJRA 1XPUA 5C4HA 3HOXB 3MP9A 2QGQA 1HR0Q 1SIFA 2KX3A 3TBIB 4S3SA 3EVQA 5BN3A 3ZYYX 1VQIA 2MBBB 3S16B 1DZ1A 2K1BA 3P63A 2O2VB 3TEXA 4NKLA 3ECIA 5EE3A 4GDKB 2MPMA 2NR2A 1SIJA 2N55A 1LQBA 1TIID 4NY0A 4ZHOA 3T1YL 1P9DU 3K59A 2L7RA 4IM2A 4POFA 3GTJH 3I55A 1L6UA 2D5GA 2JVCA 1V6EA 1DOMA 3DQVA 3QCAA 4EQNA 1T5EA 3GTPB 2J7QB 1TR5A 4FXDA 4TMAB 2F0OA 3ERQA 1VQDA 3HOXG 3PZ7A 4JL9A 1DGSA 4N6EB 3RMKC 1BCPF 3DHQA 2Q2UA 2GVAA 3A5UA 3S15B 1WTWA 3K6OA 3AE7B 2DHZA 3DBSA 3Q8EA 2IT1A 3C8YA 1BO0A 2VUMH 3ITPA 2L3ZA 2NZOA 3OIQA 3T51B 1M8AA 2RGFA 3NS8A 4XTCS 4ANWA 3APDA 2Q2IA 2O2LD 1HRJA 1E2ZA 1R9TH 2D11A 3J81L 1C48A 1LT5D 1EY9A 1QCBD 2HHHL 5FO8B 4K14A 5CGKA 3I90A 1PFDA 4KD3A 2K9XA 1LTGD 2K5QA 3GDEA 1NE3A 1C79A 4GKJL 4HKZE 1H8CA 4GNXA 2Y3AA 3AU4A 3GO5A 4ZK9B 1KABA 2QMTA 1EL0A 3PCOB 3VA5A 1MJDA 1OQRA 4IC7B 3UQBA 3KYDD 2L0FA 2QW7A 3LJ3A 3O65B 2DZKA 2N8NA 3I2ZA 2WKCA 4ALPA 2V4LA 3TUOA 2D62A 3CHBD 4F7XA 4N8X1 2N0SB 2QHOA 2INDC 2K7VA 3K7AB 3WIMA 4ANUA 4A3BH 4QQBX 3MHZA 4ANVA 3KF6A 2L76A 5CTRC 1TWAH 3M4QA 5IGBA 2NVXB 1F1HA 4CBVA 1PH1A 3H3VH 3ZQ4A 3TEZA 3I4MG 3VRAB 1FD6A 1EU3A 4TRDA 2K8CA 2QCZA 1O7YA 3B6YA 2M2LA 4A3JB 4LF6Q 5IP9H 2PO4A 1A2TA 1FJGQ 1AEXA 2J0KA 3RD4A 3OOCA 1O7IA 4ABNA 2A6ED 4NMZA 1UE7A 4JI4L 3M4OB 2M0AA 2BWFA 3H15A 4H0LC 2G5DA 1K8GA 4LFAL 1J8IA 1F9JA 4WURA 3M3JA 3KK7A 1W2BA 2H89B 5I4DA 1NTGA 5C4JH 1JMLA 1B1ZA 1TXYA 1AWDA 1WOCA 1HEZE 1NCVA 5HGTA 3AFQA 4DV5L 2LGDA 3TN2A 1IBLQ 2KK8A 4R3DA 1P1AA 3AE2B 1F2LA 3E3XA 3GTMH 3SR6A 4BBNF 5E6OA 3BVZA 5NUCA 3UI2A 1YNTE 2NVYH 1JORA 4ZYSA 3J81i 4GLXA 1PQSA 3EHVA 1XTCD 4RGNA 3DMUA 2Q8TA 1Z5SB 2AUJD 2UXBL 3CF5A 4C1NI 2I5HA 2C60A 1CZGA 2LFIA 2F0IA 4ZUIA 3U30A 1X3EA 1WX7A 4WJWA 5CV5A 1LXDA 3LDZE 1XWEA 2B39A 5M5WH 2KZRA 4I6NB 4LDTD 2K5PA 2NTSA 2IX1A 2JRHA 1CKNA 2L32A 4L5RC 2CS4A 4WWNA 3V61A 1X65A 1VQNA 4RM9A 4IO9A 3FILB 1B3AA 3PMFA 1K0RA 2R92B 3IAM1 1JWSD 2MBQA 2A74C 4JC0A 2JXXA 1QVFA 1WRDB 1VRAB 2RA4A 2JA6B 3VUXA 1Z7TA 2HIVA 3E9HA 4O0AA 4DGZA 1WTOA 5DM73 2PTLA 1IL8A 1SYDA 2BDOA 2H5XA 4W9JA 1Q8KA 2ZVOA 3OPOA 3ML8A 2A73B 5CORA 2X38A 2BVCA 4KN4C 4OXPA 2IL8A 2FMCA 2DYOA 4L5TA 4A76A 3C46A 2KJHB 1GVPA 1BBWA 3H7SA 1ICFB 1XLOA 3W1SA 3BYTB 2JEBI 1Y1VH 1WWTA 1PRTC 2KFJA 1E22A 5M5XH 2WXOA 2X6LA 4GZYC 1B50A 3TEWA 4IKGA 2D0PA 2JA8B 3FPPA 4C4VB 3D3RA 1U4AA 3PHWB 4MACA 4X3TA 2WDQB 2JA6G 1RHPA 5E6PA 2LY7A 2E2JB 1S5DD 2RVLA 1M90C 1FCLA 1WM2A 3V96A 1Z6HA 2KBNA 4IWQA 1GKHA 5EGTA 4H7BA 3NZ3A 3X3NA 4GIVA 2FAZA 2ZTEA 2F3IA 3DHGC 2KN5A 4CDDC 1WFQA 5CR3A 1FPYA 5KNBA 4ZQ3A 5MPOA 2JZ3B 3CMEA 2JJQA 2C9OA 3CQZH 2CQAA 1R4PB 3MEHA 1Z9FA 4F8MA 5C0XJ 2YU9H 4IWPA 2ASBA 1BNZA 4JBWA 3AE3B 2EKIA 1AE2A 3DWAA 2B63H 1GB1A 3WALA 4RMFA 2UXCQ 3L2PA 2O5IC 2JA8G 2VZKB 3KVFB 4RCNA 3CMAA 3VUYA 3KH0A 4HK2A 4K3BA 5IGFA 1HR0L 1BBXC 4L1BA 4GOPB 4RF1A 1RM6C 1NUCA 2WFWA 1FM0D 3CMMB 2AKWB 3L54A 1EEFD 2D9UA 2FFKB 2LMCB 3URYA 1C7YA 4FVMA 2RPQA 3DCGA 3U7DA 3MA2B 5I6YA 2L11A 1FYCA 4R8NA 4CYEA 4ZUJA 3OHXC 3PZ8A 4USAA 2DNEA 3U9OA 1QQRA 1PFSA 4NQLB 2G9DA 1D8LA 3CWIA 2LHDA 3K0YA 3PV0A 1EQTA 5JPMC 1XF5L 1IBMQ 4Y7NB 4CDCC 4BOSC 4JI6Q 3T16A 4XWTA 5GAHC 1OXTA 2B29A 2P5ZX 1WR6E 1X55A 5JPNC 4CQNA 5EDSA 2A5HA 2N9XA 2R7FA 3A8KE 4WIPA 2AQ2B 3B2GA 4PNYA 2ON8A 2F3VA 1KXLA 3F8TA 3BJUA 1K73C 4BA1I 5CMDA 4EQ5A 1EWIA 3K9PB 1DOYA 5LHY1 1YI2A 4QJFA 1A0IA 2B2TC 2FBWB 1X6OA 5ELOA 1FVIA 2IZVB 2KMCA 2F4VQ 3VDZA 5C5LA 4NJ7A 1MKHA 4W9LA 3NY5A 3E0JA 1WRIA 2LUMA 2R2OA 1EZ6A 4GN1A 4ICUA 5EE0A 4R4IA 3CSFA 2LFNA 2IGHA 4GN5A 1V9PA 2M56B 1H9JA 4KHPQ 2N7JA 1I3QH 1C0AA 3NHHA 4N9F4 3DM1A 1ZKHA 3ZRFA 3G4SA 2J42A 1P0RA 2XIWA 2A1AA 1UBQA 4HJGE 2L52A 2I1KA 2BDNA 1XNQQ 3A54A 1GUTA 2V0GA 4MM3A 1ENCA 1UF0A 5IYCH 2GBNA 4N58A 2LXCA 4ARIA 3MEFA 3ZNZB 2F0KA 1NSNS 2OT2A 3IT4B 4A3KB 1MJCA 4LF6L 1WYDA 2LRWA 1VQGA 4XGAB 5IOCA 4PMCA 3WAPA 1OXXK 3I4OA 1YNNC 5FLXL 1PH4A 1S5FD 3GTGB 1V5TA 2K5VA 4BS9A 1F9RA 2EYLA 2D2CC 3HOWH 4KDIC 3U2SC 3VH3B 4B3SQ 2EY1A 1EUJA 4IZ8A 1IYUA 4ZLTF 2BWES 3PO2B 3NVYA 4ANXA 2PCFB 1V80A 1STAA 4PZ8A 3A55A 5C3XA 1LM8B 3WCQA 2JA9A 3W3AA 2DYMA 1IBLL 1E6EB 5G3LF 2LGIA 3AE4B 3EA6A 4YCUA 4BKSA 2FUHB 2PQAB 1KM7A 3P4QB 2BTEA 1WJNA 2EYHA 4A3KG 3ZJTA 3X3MA 2LGSA 3F2CA 4OEMB 4EQOA 5H8YE 3OW7A 4V0BA 3SK4A 1SNOA 2FUG1 4GS3A 1PH7A 2OOBB 1I4XA 3RNCC 2FE8A 5BO4B 4XYOA 1L5PA 3HZXA 3CKIB 4XT3B 2SNSA 4A93B 1NJIC 1CSQA 1PVOA 1N9WA 3A0JA 3MFYA 1QOHA 3TZDA 4X65L 1PH2A 4DK0A 3GTLH 1C8CA 4FF2A 4FN2A 2RDBC 1VR9A 1LTTD 2L5TA 4LJZC 4NXNQ 4FXGC 1EYDA 3ZJVA 4D2KA 4LNIA 1QOGA 4L6TB 2ZPYA 2ZVNA 2KCCA 4K8JA 2LZ6A 4HDQA 2ZCBA 2JQOA 4NB3A 4OWTB 1FXTB 2E3TA 2WXIA 4YL8A 5CHFA 3TREA 4A6QA 3ONAB 2F0GA 3S14H 1ESRA 4YSXB 3HRZC 2KC1A 2F0LA 2PW5A 3UE0A 4K0KQ 1CM9A 4DAVA 3IBEA 2A6HC 1YZ6A 4FBJB 4A3DH 4H2AA 4A93G 3TEHB 1YN4A 1RF2D 1MHHE 2KTFA 2GVBA 2F0PA 3L0WB 4DUZL 1VQJA 2B2VC 1OXVA 4B3RQ 3L08A 5AZFA 4KKJA 1ZOYB 3I72A 2EMTA 1WIAA 2JQRB 5D94A 2F0SA 4JI0L 2XK5B 5JJKA 2KT7A 3FC4A 3L0OA 4RHSA 1Q86C 1IGDA 5ELNA 3S1MH 3RZOB 2JA5B 3U4VA 3HOUB 2KDBA 2Z0DB 2V4DA 4LNFA 1RDPD 1Q12A 2JE6I 1J0GA 2M9VA 2WDVB 3ENEA 4DR5Q 4FHKA 1EFWA 2FXQA 5IP7G 1VD2A 3U8ZA 2KC2A 1JC7A 3ETRA 2NVQH 1SNPA 3P7JA 4OELB 4DV7Q 2GI9A 5M3MB 4XX5A 2BYEA 4GOPC 3AM9A 3S2AA 5IE8A 1K9MC 1J7AA 3O13A 1M4VA 1SNCA 1KRSA 4K6DA 3DWPA 2YU9B 1WJ6A 5C3WA 4GU2A 2JUOA 2UXCL 4K5WA 1H9RA 2K22A 1EIFA 3LNNA 1CJEA 5FLMH 2I2YA 1STGA 1TU2B 4IUTA 4IUMB 2JA5G 3HOUG 4MEMA 2DNFA 3DBRI 3N1XC 4A3CH 1XMOQ 4RWSC 4DXFA 1TS2A 4K7SA 1K8AC 2FMMA 1JB3A 3KBXA 2XSCA 1I6HB 1UD7A 5E6JA 3GS2A 4EZKA 4DXAB 1MI2A 4BBRB 1D6EC 2XWJB 1KD1C 2NTTA 1VZ7A 2MHJA 2L1BA 5M3MG 2N9PC 4P1BC 4GN3B 1WYWB 2DY8A 4H44C 2PZTA 5CBEE 1IBML 2VNUD 1LABA 2BW2A 2CHXA 4HJ5A 3FAHA 4I65A 2Z1CA 1HR0W 4JI6L 4KZ0A 1TWCH 3L7ZC 3AI5A 3KWLA 3DVGY 4KKIA 2Z6KC 1FEHA 3SHLA 2WWZA 4PMWA 3D4WA 3RD2A 5JJLA 2WX1A 4HMJA 4L8JA 4AJYB 1I94Q 3NVZA 1CA6A 2C7NB 4ICVA 2AMCB 1E1OA 1IPGA 4OZAA 3VA7A 2KCNA 5JEAH 2ZTDA 3K81C 2BA1A 1WI0A 1X3PA 2G9HD 3MC0B 2LVQA 2NVUI 2F4VL 4BBRG 1SYFA 2CWPA 5K5PA 1G2SA 1JWAD 4W9FA 4KKTA 4DV2Q 3S2DH 1NDDA 1CA5A 1R4NI 1VDVA 2YEPF 2M19A 4II2B 3KUPA 4XDCA 2LD9A 2NB0A 3UQAA 2IHFA 4GLVB 1DCZA 3OMGA 3IHPC 5E6NA 5J17A 4HKQA 2KO3A 3V05A 3S1RB 1YN5A 4PS3A 2MFIA 3CCMA 4P71A 1T3QA 2HJ1A 4JI2Q 5IT9L 1G8ZD 4ILWA 1XNQL 3H3VC 2I46A 4AOFA 2QJLA 3UE1A 4HRSA 3MVVA 2W55A 2LKVA 5C44B 3LX0A 4DR6Q 3J7A5 3Q22A 1WJ4A 2R2QA 4DV0Q 2BYTA 4LK0M 1N33Q 1V1OA 2XRSD 1TWFB 3HOXH 2MP1A 2L8JA 3A33B 2FNJB 1EQRA 2MBHA 2DENB 5JJZA 1YJ9A 1XPRA 3Q3JA 3H6MA 3WOFA 4MH8A 2GBKA 3ZVVA 1ENFA 2E74C 3S16H 4G7HC 2KACA 3QO2A 4HIDA 1Y1WB 2O4XA 1OXUA 1BOSA 1D1KA 4B3SL 2DUDA 1SSNA 1D2BA 2IO3B 1YBYA 1AW7A 4K6LA 1IBXA 3OJ3A 4JLCA 1I7HA 5GMVA 4GNXB 3HIZA 3DEOA 5GAEC 1A63A 3RPFC 1LO5D 5C44G 2O5JC 3GTPH 1QOBA 4RCOA 3KF8A 5J39A 2A68D 1GUGA 1QVGA 1U9RA 4G4KA 1TKEA 3PO3G 3DHIC 1EWCA 4I7ZC 2JSVX 2MRPA 3S15H 1L7YA 1MFWA 4B95A 1UGMA 3H91A 5H92C 1F2RI 2C5CA 3RNBC 3KF6B 1Y1WG 2WKDA 3TP5A 2SAKA 3NELA 3TEYA 1YD8U 3HG9A 3MZ5A 4I6PA 1N32L 4XYCA 1PFNA 5F2DA 2KLGA 4C3IB 2F0QA 4GKJQ 4LNOA 4A3EB 1MJEA 4HAEA 4PQXA 4UDUC 1UAPA 1BR9A 3N52A 2BCOA 1PH8A 2CKHB 3HOZB 3Q8CA 3PVLA 4H13C 1QWYA 4ID6A 1CTMA 2PPHA 4LMQD 1CHQD 2LJ5A 4HSVA 4DV3Q 2XBBC 1M1KC 4OZBA 4DHZE 2L15A 2M00A 5J22A 1TKGA 1WX8A 4HSPA 4LUVA 2V1YA 3DBLI 1F9SA 5KHQA 1SE8A 3K7AH 1NVID 4P6VF 1LV9A 2HDMA 3MC9A 1CT1D 1XLPA 1K50A 2CCZA 2NVXH 4RMAA 5TSSA 5C6AA 1JWBD 4N8FA 4LNQA 1VQCA 1PYSB 3OMCA 4DA2A 4C3IG 4A3JH 3BVMA 4YTMB 2KHJA 4B3RL 4A3EG 4MT5A 3PRMB 3P4SB 2DZMA 1K3BC 1P8LA 2ICEC 2Q2HA 3M7GA 3HOZG 4II3B 3TZUA 2GN5A 5C23A 2WB1B 4A9AA 2WU2B 2Z8LA 3M4OH 4KK7A 1N36Q 3GZNI 3QR8A 1Q81C 1I50B 2QILA 4HJAA 5I9OA 1S5CD 2EY5A 4TQUS 3CCLA 4HROA 3TCAA 4GGQA 5IYDG 1CQFA 3OYYA 4JIOU 1L2FA 1U4LA 4P73A 4DR5L 2HT1A 2C7HA 1CKNB 4US8A 1WXMA 1E1TA 1ZXTA 1IBKQ 4HLEA 2Z59B 2W3RA 4JWSC 4KX6B 4DV7L 1SMYC 4C3HB 4NW2A 2DWQA 2KVRA 4EE2A 1W6KA 2BA0A 3L16A 3ML9A 4DNTB 2MLBA 5LMUQ 1K0SA 4JOIA 2K32A 1AZQA 4BVUC 1QUQA 5L83A 2KQ3A 3I7FA 4JYAQ 1VZ8A 5ELBA 2SNMA 2LXJA 2VB2X 2DYBA 2WB1G 2KD0A 2NMQA 4IJHA 4YWKA 2JU6X 1QKZA 3RUZA 1ET6A 1X56A 1VQEA 5ISRA 2KWDA 4NXMQ 1J8CA 4AWJA 1JOKA 2RSOA 4LF4Q 3OG5A 1EIHA 2IX0A 1WM3A 2BBCA 1XMOL 4LJOB 5D6JB 4DHJB 1TBEA 3QK0A 2W3SA 5C3EB 1WGKA 3ZXVA 3I70A 4LWCA 4C3HG 2R92H 1OQYA 1PH5A 3MHBA 3L17A 3TMPB 2DGYA 4R4QA 1LGRA 1VLBA 2JA6H 1T0RC 2F0VA 3H0GB 3MTSA 2D3CA 1DYQA 2GBJA 2WHIA 5CX3A 2DJFC 4WFN3 4XYQA 2R7ZB 1HHVA 5K36H 1PGAA 4BBSB 2D10A 4CJ1B 3BK2A 3KYCD 1QF6A 3AEDB 4FJVB 4Q0FA 2AL6A 2ACZB 1SFOB 4TKNA 4DAMA 2J53A 2KN4A 3DWQA 1SB3C 1VQ9A 4IPHA 2VZKD 2K5DA 3VTVA 2KA7A 1VS0A 2N78A 1I5FA 4DUYQ 5C3EG 2UU9Q 4OX9Q 3CCRA 2W82A 4GLAC 4DAPA 2CJNA 1P16A 2JA8H 1RFAA 1V1QA 5BMGA 3ZTDA 1TGZB 2J0TD 3H0GG 3T56B 3WDNA 2E2JH 2R7ZG 5CBAE 5T1IA 2ZCCA 4BBSG 4IFDJ 3PLUA 3CCUA 1G51A 1YVCA 3HUIA 2RCNA 1QILA 4Y52H 3ONSA 2BYVE 4JI2L 4FF3A 1UE1A 1BXTA 2BH8A 4RG1A 4KIKA 4PYUA 2K03A 4J8QA 1V5OA 2PNHA 3EUB2 2PEAA 3K80C 4DR6L 2K4KA 4DV0L 3VYRA 2VY3A 4LF9Q 4CHKA 4R1JA 4RKLA 1N33L 1E24A 4CJ2C 1E7UA 3UGBB 2JSOA 3PUXA 1DM0B 2ENBA 2FIFA 2PQEA 2RMMA 4ACFA 4DK1A 2IY1B 1T0QC 2KHWB 4G7ZC 4E3CA 1BCPC 3SDZA 3X0WA 1KNEA 1LUZA 4GNXC 1S40A 1VDZA 1G6PA 2UUCQ 1EY4A 1QJOA 3GE3C 3DPDA 1YHQA 3VFKA 4X57B 1K28A 3APCA 2Y0SE 3AECB 5D2MB 3KLSA 1O7ZA 1ZXIA 2INCC 3T1HQ 5AZHA 1EWHA 1PH3A 2K5NA 1UEAB 1SYEA 1E7ZA 4P74A 5HG2A 1IYFA 1DOIA 4Y7NH 3PF5A 1CHPD 4HIKA 2KQSA 3UDXA 3KUCB 4LF5Q 4ARCA 4NAMA 2K01A 1GB4A 2JWUA 2WDRB 3U58A 3FKYA 3QX1A 1N62A 1DJRD 3DDCB 3SFEB 4MM3B 3FEWX 4JBMA 1PFBA 4NAWA 3E9IA 4AJWA 1KLGD 1EZ8A 1WR1A 4HCNB 3RLFA 4DNRB 3DBLB 4J3OD 1HXYD 3M95A 4TKOB 1SYGA 2ZJRA 5JHAA 3I4MB 4IWOA 4K1RB 3BYYB 1RKNA 3M9BA 3U7ZA 3GOEA 4DK6C 3R3OA 5ELCA 2Y5PA 2RHSB 1CFMA 2EJFC 3AV8A 4ZRZA 1PHJA 4O1NA 1UZXB 1B8AA 3PV1A 2YTYA 2XEWA 3SHQA 4F88A 3WA0A 2KWUB 3R7QA 4DV3L 1P3QU 1HNZL 4B9WA 4DK3C 1U4PA 3GZNB 4LJPB 4YXDB 3RFZB 4EFOA 1J6QA 2SDFA 1E8WA 1A15A 1QZGA 4R9WA 1GJXA 1GOZA 5KNDA 1NBFC 2B2UC 1CSPA 1RJTA 1GUAB 1YNXA 4A3KH 2Y5CA 4BZAA 1SJED 4ZRPA 2G45B 1DD2A 4BBNC 4LW1A 3JW0X 3GTGH 1MG4A 2D0OA 4KHVA 3BK1A 4MSQB 3K5LA 4FLHA 1B9NA 3WWVA 1TVXA 1N36L 1Y8NB 2KEDA 4BY1B 1TY0A 2EE1A 4RGTA 1UGJA 1XO3A 3PO2H 2B2YC 1CKOA 1PH6A 4FF1A 2HCIA 4A3FB 3A4RA 3ZKJC 3W2DA 2WINB 1V2YA 3GP7A 3I4NB 1G6ZA 1JRPA 2WXPA 1ZKOA 2W9NA 1IBKL 1OFFA 3VR2A 2FJ2A 3GQBA 2EDGA 1GUSA 4YCWA 1CK1A 2OF1A 1RODA 2NUCA 4Z9CB 4IOAA 2LVOA 5LMUL 4RNAA 3TBLD 2GRIA 3U50C 4DN4M 2SOBA 4JYAL 1FGUA 5E3FA 1C76A 3SXHA 3D8GA 2CHZA 3KWVA 1IYVA 3QHTA 2EVBA 5FJ8G 4BY1G 1OEYJ 4NXML 2C5LC 4F7ZA 2XWBB 4LF4L 1ENAA 4A93H 1XCQL 3A8JE 1IKMA 1KJTA 2CU3A 2L05A 3OSOA 4A3FG 5GQOA 3JAMc 3RZWC 3I4NG 3WAMA 4X65Q 1WD1A 3TP7A 1TZOA 1ZE3D 4M8NA 2DLBA 5HURA 2INPE 1L2NA 4HIOA 2F0TA 3Q69A 2GOWA 4NJCA 2PMZB 4YHHQ 2F0EA 2IBIB 2LS01 1TWGB 4R8IA 2OTLA 5KYLA 5A2QL 3T9LA 4DDID 2ZJDA 1J7CA 1A62A 3RUIB 4DAYA 2NN6I 4A3IB 1OO9B 2KDMA 3B9JA 1JICA 2VL6A 4UP8A 3IG3A 5ELFA 5FR6A 3NTKA 1YITA 1WXVA 1Q0WB 5DAUA 2FCQA 3T53B 4GSWA 1SMYD 3V62A 1I4RA 4X66L 4DUZQ 2WXLA 3KLSX 3N30A 3NQIA 4RGMA 5IGGA 1Y8RC 4DUYL 2UU9L 4OX9L 2KUMA 4K81A 3AFPA 2VH1A 2I07B 2KVMA 3KLWA 3H6NA 4MHEA 4JI0Q 3K5NA 2R7DA 2UXDL 3PGEA 2QCPX 2JA7B 3CD6A 3ULPA 5BMIA 3RZOH 3CC4A 1V1PA 2JA5H 3HOUH 1Q1BA 1L1OA 3HEJA 3HOVG 4WJ4A 4A3IG 4MNOA 1Q90A 2K05A 4KD4A 4TV3A 2MA9B 1HUMA 2PI2E 2Z6BA 3RNAC 4IPCA 1Q1OA 4A3GB 2IDYA 3I63C 3IXSA 2PW7A 4ZAIA 1S1QB 3ER0A 1PFMA 1QE6A 5M3MH 5C1ZA 4TUUA 4GB9A 1EQQA 1ACCA 3NZUA 1O80A 4IM3A 3G48A 3ERSX 3EECA 4AYBE 3AB5A 1A5RA 4IALA 4LF9L 2FCSA 5CYUA 4C2MB 1GUWA 3GD7A 1EF5A 2M8SA 1F2RC 3D4DA 2KX0A 2V3PA 5AJ3L 3NK9A 5JAVA 2JA7G 1WXSA 3E0EA 5BN4A 3PZDA 1YIWA 4YWGG 3N32A 3LB8C 1D5XC 4QY7A 2IY0B 4FJZA 3RNFC 2UUCL 4HJ7A 3A7LA 1I6HH 4A3GG 3Q6SA 4ODGA 4JBKA 1F52A 2KQ7A 4KY7A 1B3QA 4QIWB 3SEBA 2K8BA 4BBRH 3I56A 1VMCA 1YNJC 2LI5A 4XQQA 3NJTA 1PRTF 1VF5C 4XC2A 1LTLA 1GC7A 3CC7A 1D4BA 1BUVT 3T1HL 1ILPA 5EBCA 2MO1A 1XCTL 2EMSA 2UU7A 4LF5L 3HKZB 2ATWA 1PTOF 3MAQA 4IG7B 4A3PA 2PMVA 1GUNA 3B2FA 2F52A 5M9OA 4RFBA 2Q2TA 4FNFA 2YEPB 4JI3Q 4IJLA 4WJ3M 4JQWC 4OVVA 4N9TA 2MNAA 4LCDE 1N34Q 2ICIA 1YIJA 2F03A 1E0ZA 1H9MA 2UWQA 1WI5A 3PUYA 4OHJA 1ZXHA 3M4PA 4XQJA 1P7FA 1H95A 4S0RA 5T8IA 5HY6A 1BT0A 2K28A 1HNWQ 5DM63 1J5EQ 2A68C 1WTRA 3R2TA 4ME5A 1RRBA 4FJYA 2K5WA 4DF7A 3S1RH 1BCPD 2PW9A 3FVQA 2RQXA 3HKZG 1T0SC 3NXWA 1IBXB 2ZZPB 2H4OA 5H1SE 1TT5B 4X3UA 1V9JA 3OW2A 3CW2C 2DAJA 2KMAA 3U4EG 5M3FB 5M5YB 3BZCA 3HVDA 5C44H 2E75C 1JCKB 2KJ6A 4KLKA 4R4OA 1XYIA 3KF8B 2AUKA 4WQOB 2PE6B 5GAGC 5C0XG 2DZIA 1TWFH 2F4IA 1IHZA 2OEOA 2KCMA 2WAQB 5KEEA 3TL5A 1TS3A 4QB4A 4PK1A 2RD0A 1YQBA 5JJIA 4GMVA 3L4PA 3VDYA 1CKMA 1YHBA 3CU7A 1Y1WH 1KLUD 3ZXRA 2MGSA 4W9KA 2OQKA 3RNUA 1JR0D 3Q6BA 2R3ZA 5HGQA 1V97A 5E7NA 2VZAA 5LXHA 4OIJA 5CV7A 5A2QE 5M3FG 3PSIA 1LFDA 2BS2B 1JMCA 2E5LQ 2L00B 2NCNA 2PIAA 2EYMA 3RZDB 3M63B 1ROEA 4NPSA 1WE7A 1YEZA 2HDEA 3F2DA 3V60A 2WXGA 1MI0A 2IO1B 2B3GA 2WAQG 5LXIB 4NNJB 4P75A 1OXSC 3PIOA 3N3KB 1C3TA 3UDGA 3KFUA 2B2TA 2MJDA 4OVZA 2AWNA 3J9CA 1EM7A 3EFUA 2VW9A 1OTRB 2F0UA 3OJ4B 5IAAC 4P72A 4REZA 3TS0A 2IX3A 1HNXQ 1XTDA 4IUQA 1VCBA 1N32Q 1HFGA 4BFRA 2J0MA 3EBEA 2MQHA 4C3IH 4AQ7A 2B8FA 1EIGA 4LUOA 4A3EH 2CHWA 3Q3NC 3C19A 4QCLA 3HOZH 2WXFA 3UF8A 4GDLA 2JX5A 4XE0A 3ZIMA 4YHHL 1C78A 2AQ3B 1B2TA 3H1UA 3M4YA 3PF4A 4UP9A 2WYQA 3F1ZA 1VQ4A 5IYDH 1RLFA 2AYOB 1WTQA 4HJKA 4R4TA 3NBIA 4LF7Q 1MHXA 1LTSD 3J81c 1C4AA 2NN6G 3R93A 2ZM6Q 3AXCA 2N7EA 2DNCA 3B1LX 2RDFA 2MW5A 4OWXB 4FYDA 1YOVB 1QUQB 3FDTA 4FHJA 3E6ZX 1D5ZC 3NTIA 3VR6A 2DY7A 5C4ZA 1VQOA 2KMMA 1H9SA 1IGCA 3PUWA 1R4MI 2AEHA 5FO7B 1WZ3A 1XX8A 3J80L 2KWVB 1I50H 3AEBB 2JP1A 4IUUA 4DHJD 1VQ8A 3CP0A 1W3SA 1TS4A 3CCVA 1VQBA 1KDCA 4LNKA 2LVPA 2XNAC 3A9JA 3I3TB 1KFYB 2Q5WD 2EQSA 2AQ1B 3HS0C 1JE4A 3OIPA 3KLRA 4TVAB 2GMIC 1WGHA 1QB5D 4X6AH 3I9V1 3UIPB 1D1IA 3D6WA 1QZHA 4C3HH 5BMHA 3R8BA 1VQFA 2ZJQA 2FCMA 2QEXA 1JW9D 4Q2JA 3LYYA 1PDXA 3S9WA 2FHTA 4A4IA 2K6AA 4FULA 2EOTA 1TT2A 3MTNB 2QA4A 1HZ6A 4MIUA 2K6DB 2LXKA 3HKSA 4LDTB 4MH0E 2I38A 2SEBD 1ZEQX 5LMNW 1L0XB 1Y56A 3BS1A 3AQQA 4UAIA 2GBMA 5CHWA 1UEBA 3MFGA 2MQJA 2CU1A 2WS3B 5KGUA 1G291 3NG0A 5C4XB 3STBC 2MJEA 2N88A 3VQIA 5C3EH 4ULLA 3VYSA 3VAWA 2V1CC 3HRDD 3IAS1 3SFDB 4YSZB 5I9PA 2M1MA 2EYFA 1NYRA 4HCEA 1F2YA 2D07B 1X9NA 3H0GH 2LGYA 4A3OA 4JV5L 3VXWA 2R7ZH 1FCCC 2ID0A 2VQEQ 2K50A 4BBSH 4B6WA 2BKRB 4DNIA 2OJWA 2N3SA 2NBFA 4KIKB 1SFOH 4G50A 1XD3B 1DXMA 3TS2A 2B2VA 3CXCA 3A1QA 4DQOC 3SD5A 4JI3L 4B3MQ 3P20A 1TJEA 3CRLC 1ZDVA 3J80i 1VQKA 3J7AV 5C4XG 1EOTA 1EY8A 4QAYA 1N34L 2RDGA 1MIUA 1O78A 2CW0C 1JROA 1PUTA 1MD2D 4MTNA 1NY4A 4EQPA 5EE9A 2O6VA 3A9KA 1GPXA 4WQMA 1HNWL 3QOJA 1J5EL 3I4LA 1X54A 4XDDA 2LEKA 1P98A 1YJIA 4AQYQ 3ZO5B 2V4IB 4WH4A 4K2LA 3WAOA 1FD7D 2D5DA 1TZ1A 2LGXA 4XIGS 1JQYD 2J0JA 1E8ZA 3DXJC 1WTXA 3SK8A 1YNJD 2HCCA 3V6CB 2PKOA 4X3KA 2IJ0A 1VF7A 1OTCA 1HZBA 4WWMA 5J1ZA 5EPKA 1PH9A 5LNK1 3PHXB 5IOIA 4GN4B 4WJQA 1SE2A 1FXIA 4KV6A 3PO3B 4ZHPA 2DZJA 2IO2B 5G55A 3HK0A 4IW0A 3SE0A 4BY7B 1CMXB 2MH7A 3ZNID 3SGIA 5EJWA 3ZLZA 4M01A 4B3TQ 4NAWB 4KY5A 1ZW7A 2NVTB 1WF9A 3RZFA 2EZVA 1Q8IA 3PIPA 2H88B 1WGRA 1XLNA 2JRIB 3T13A 4HEA1 4P1CC 4FA6A 4P2CB 2QEJC 1V8CA 2OCEA 1VZ6A 4HPLB 3QG1A 1LACA 3AMZA 2E5LL 4HCSA 1H4RA 1EEID 3EN2A 3KBGA 1EU4A 1I6VC 2Z6KA 3HGBA 1A3UA 3D6CA 4X64L 2QF7A 4RAUC 2D3AA 2K1FA 1F9PA 3L3OC 1FFVA 3B08A 3R2IA 4LAAA 3GV3A 3N1ZC 1JE5A 1FNWA 4QIWE 1SE3A 1VQ5A 1L0VB 1SGHA 2ZNVB 3JVZX 2A19A 4KKUA 4BY7G 4W9DA 1FGBD 4BKSD 5KHOA 1KF6B 4JW0A 4RA8A 2CH4W 5EBDA 3CAMA 1QOAA 4DBGA 2F0FA 4RF0A 4PG3A 2DN8A 2VRRB 1C4PA 3GB1A 2C7MB 3CF6E 1XXGA 2HD3A 3ZNHB 5CHVC 5I6WA 5CV9A 5DPTA 4NZLB 4I7AA 1HNXL 1XPOA 3J80E 4PS7A 3I4MH 3ULJA 1A70A 4IFDI 5IYCG 4XT1B 5CC4A 5G3LD 3ICEA 4ZRQA 2EPBA 1KHIA 4DPGA 5JZEB 3UINB 5EE1A 1STBA 1I42A 1S3OA 2JZZA 1ICWA 4C56C 4IQZA 1B4OA 3VR5A 4JPSA 1GG3A 2JYEA 3EGRA 4DR2Q 1HNZQ 3M3YB 1K83B 1R4MB 4IDIA 2I5LX 1GC6A 1Q10A 4G57A 3RLNA 2VS1A 4HJ8A 4LF7L 1J9OA 5DNFA 1WCMB 1XQQA 1WE6A 2ZM6L 4BXXG 2D2QA 1IP9A 1JJCB 2L55A 2L12A 4OZCA 4WRDA 1KRTA 1ASYA 4WWPA 3HOYB 3AN1A 5DCNA 5JOBA 4ZYNA 4CGYB 1DGJA 1A2UA 1TY2A 3P1HA 3SVMA 3QAQA 2G1EA 3Q8DA 2GB1A 3BVGA 1ILQA 1SRUA 4B9KA 2BPSA 2JT4B 2NS5A 5FJ8H 2MSED 4BY1H 3W9CB 3NP8A 3GTOB 4DR7Q 4TSSA 5FK9C 1EQVA 4KGRA 2EYJA 4HDOA 3GTKB 4A3FH 1M94A 3I4NH 4JX1C 4X3SA 1WCMG 3LWUA 1HTQA 1HZ5A 3QC8B 5C5MA 2MEKA 3NUCA 3Q2AC 3RCZA 3EROA 4MGKE 3HOYG 2GBRA 4ZRIA 1IYJB 4KSKC 4K7WA 4DAYB 1EY5A 5FLXc 3S17B 1C9FA 3RR5A 5BYSA 1UELA 3TIXA 4CO7A 3P1MA 3KQ4A 2KCTA 4XWWA 2KTRA 2F0WA 3AE8B 3RLOA 1WGGA 1VMPA 4LUZA 2ZW0A 4M00A 1D3ZA 2WXRA 3R7RA 4DU9A 5I2YA 4OW0A 2RCFA 1K53A 3ZRCA 5BYRA 1RAXA 4BA2I 2I5MX 3VYUA 4CDEC 4G3XB 4WAAA 1AARA 2JEAI 4EEWA 4A75A 1X32A 4A3DG 2Z9HA 1PGXA 1V81A 3MXNA 2K33A 3A7AB 3QWNA 4YCVA 1TWGH 1ONLA 2KJXA 1V1PB 2R93B 1J7BA 3EC8A 5JEAJ 1L1OB 4CJ0B 2VQEL 4KKSA 2YTVA 4DXGA 4A3IH 1G2TA 3FRPB 3GTQB 4DV4Q 1CI3M 3Q8FA 1DOKA 3QB3A 4B0MA 2B76B 1Q46A 1SN8A 2QDLA 4OO1G 4J15A 3AU5A 1S4ZA 2B2WC 2EJMA 1XNRL 2WXMA 3ALBA 3KW5B 4HJ9A 4M8MA 3H7PA 2K52A 3PO0A 4B3ML 4X66Q 3DVNV 1PDQA 4DKAC 2E2HB 3L9AX 3KDFA 1IZ6A 1U4RA 1K8OA 3BWUD 1F2ZA 1B44D 4LF8Q 2F0MA 2JA7H 3A74A 4KTAA 2R93G 2UXDQ 3PUZA 3P42A 5G2NA 2RSNA 4PZ6A 4AQYL 5LMNQ 1ET9A 3S1QB 4A3GH 2OWOA 3AYHB 4GLSC 4W9IA 1S3SG 1U4MA 3STBD 1QNKA 1FXAA 3I91A 5C2TB 2ZXOA 2E76C 1K52A 2KHIA 1MBYA 4A3CG 4B0EA 2J52A 5L95C 4IUPA 1KTKA 4K8IA 5IYBG 4MZ9A 5E1FA 1YQ3B 2N9KA 4KSLC 2OXPA 1BUIC 2KDIA 2FCNA 4NQKE 4JCVE 5JHBA 2MBOA 4C2MH 2IHEA 5FKAC 4B9XA 3RN5A 3VHTC 4U68A 1MSHA 3I5JC 3VTWA 1TWHB 1PRTB 5AJ3Q 4WJPA 2PJHA 4PZ7A 2XTIA 4XXEA 4EX5A 4B3TL 4A3LG 3JAME 5D7GA 3J7AF 3C3LA 3NE5B 3ZDMC 2WIIB 1L4DB 5AUKA 1NMGA 1PTOB 2B3AA 3G6EA 3MWYW 2E2IH 3EQLC 5DLQE 1AN8A 2CW0D 3CC2A 1FRRA 4APVA 3I3CA 4LNNA 2CFMA 4PYZA 2TSSA 4IM0A 1GM5A 1DOLA 3EFXD 3UDFA 2JWZA 1SNMA 2KFKA 1GHJA 1O7LA 3CSTA 4XZ4A 3WANA 2AX5A 2KNBA 5E4WC 3EFCA 2F3WA 1MGSA 3IT6B 1RD9D 3RULA 2ZXRA 1LT6D 1LTID 3GE8C 2MP2A 3AB9A 4ZCKA 5LL6X 4DFAA 1HTPA 3EJIA 3S1NB 3W5VB 3RI7C 3BIID 4BWGB 4MGIE 2ASQA 1CZPA 3JSVA 1NI2A 5C0XH 2E8GA 3EIVA 1FIQA 2F0DA 2WNMA 2WXNA 4YTNB 1GJZA 1JQ4A 1II3A 1JOQA 1YJJA 1Y8PB 1WXQA 2KKCA 3DWGC 5FR3A 1X3QA 1DONA 3SK5A 3BG3A 4ZOHC 1HE8A 2AHOB 2YTXA 1T0YA 2RPVA 5LLIA 4IFDG 4M8AA 1GXDC 2KAJA 2PYKA 4JI8Q 1E2WA 4A3MB 4HVBA 1L0YB 1G6JA 1P7EA 4AP4C 3NWSA 4FP5D 4DR2L 4FDBA 1D7QA 2FINB 1N6ZA 4FADA 2KLCA 2F0HA 3W1BA 5M3FH 5M5YH 1HTOA 2MJ3A 3ABVB 3IFWB 2EY2A 5C0XI 2MWSB 2CHBD 2BH2A 1Y8OB 2F0NA 2MCNB 1V43A 4LFBQ 1RIPA 4KY6A 3OAWA 1F0ZA 1NAPA 3AEGB 3ZTCA 5J18A 1JJ2A 2EY6A 3LXFA 5DPSA 2IPKD 3DEPA 4YY3Q 2DAFA 4NJ6A 1BQQT 1HZCA 2ZEQA 4EGVA 3ND9A 3A4SC 1KL9A 1FR3A 4GOCA 2H1EA 5IT9c 4A3MG 1N5WA 1NI3A 2F1MA 4DR7L 2NBWB 3ZUNA 2L0CA 2IWHA 3QARA 4F87A 2Z4HA 3V2TA 4HMIA 2PLPA 2A4ZA 3R3MA 1EUVB 1EY0A 4J1MA 2WU5B 3NSWA 3C0RB 3CPFA 3WOEA 3RZDH 4A55A 2A5UA 2N4FA 4GDLB 5A35A 4BKTA 1EYCA 1V8QA 2WACA 2G4SA 5DPRA 4EKUA 2N9LA 2QKIC 1K8MA 1PZJD 1JJGA 2R6GA 1MSGA 1F2MA 3Q3MC 4IOCA 2K5HA 3QWZB 4JI1L 4WJOA 1GO3E 5GROA 2INNE 4MGZE 3W1SC 3MHSD 1B9MA 1HQRD 3IFDA 3S24A 5KRUA 2NN6H 2EXZA 4C3JB 3K7UC 5KIXA 3M85A 2YV5A 1KNAA 2BS3B 3H3VI 4OVUA 3NBHA 4PMBA 1ZYRC 1E8XA 4C7ZA 4YIJA 4DR1L 1A8VA 1L1OC 3AMUA 1H9SB 3S2HB 1ZPSA 4JI5Q 2KHSA 1KAAA 1JB7A 4FF4A 2MUYA 1WTVA 1XJVA 5IN7A 4IN3A 4HPMB 3TJPA 3A56A 4DR4L 4NP5A 4A3JG 1B7YB 2CWAA 2ZTCA 5D65A 1ZGUB 5D14A 4MTKA 1SLJA 3DBHI 3IAYA 3A9JB 4G11A 1B70B 2PI2A 3NTHA 3HOVB 1MVKA 4DV4L 1WXAA 3P2BA 5IA7A 2B2UA 2X6GA 4JBJA 2I1JA 1VQPA 4US9A 3KYHC 3RNGC 5IP7H 4WAFA 3HVZA 1E0BA 4DK5A 4C3JG 2NZ1D 3APFA 1WD0A 1YX6B 2GLSA 3Q8BA 4C00A 5CV8A 4TQ0A 2NPTA 1KOTA 2K14A 1JT8A 4AS1A 1U0LA 1NR4A 2BB5A 1RYJA 1KDAA 2LASA 2LUEA 3BU2A 1RTNA 3OTOQ 1OGWA 4MJSA 4K7UA 3FKIB 2B2YA 3H09A 1NMFA 3L10B 4PS8A 4LF8L 1HUNA 2WXQA 1GHKA 3C1FA 1UNSA 2WP8J 1T9HA 1WMHA 5LMNL 1X3GA 1SYCA 3PRPB 2WB1E 3BZKA 1TS5A 2JYTA 1SNDA 1Q5WB 3PIP3 1SNQA 1ML0D 1GD7A 3LGJA 2PVGC 2NBUA 3PS6A 1Q3LA 1Q1EA 3NWTA 1VQ6A 3T3NA 1XMQL 1VQLA 2TMPA 1FNVA 3OWFA 4MELA 3FKIG 1KQSA 2R92G 2ZJPA 2ES2A 5FO9B 1C4CA 4W9GA 3A8IE 3PGZA 1HZAA 3NENA 3PPAA 1FMAD 4MN3A 4P7IA 3A1QB 4JVZA 1L4ZB 1PTOC 2JF5A 3Q14C 2PZWA 5K36G 1NENB 2L0TA 1PXUA 2Q8RE 1SSOA 4W9HA 4W9EA 5C4XH 1HJPA 1W6JA 2N1VA 2J7ZA 3H8HA 4YTPB 2NBVB 3PQIA 2O6VB 3A9KB 2E2IB 2X8XX 1PA6A 1D5MC 2E6XA 4M0WA 3U9SA 4M02A 4CKEA 2IY5B 2WXHA 1HCZA 4KN7C 4ZRJA 1L6VA 2N49A 4JV5Q 4F8CB 2WGSA 4XQNA 3K5MA 2K0PA 1I4PA 1IW7C 2JPHA 2VXWA 3J81E 2UUBQ 1TQOA 1E7VA 1BVSA 1SR3A 5T1GA 2FIDA 3IVFA 1NBWA 3IL8A 1WTPA 2AL3A 4C80A 3U52E 1JWUD 1C1YB 4WWOA 4AUQC 1EY6A 1R4QB 1IKLA 3GV6A 4M1UB 1YJWA 3GTJB 2QDBA 2HDLA 3HHMA 2K39A 4QL5A 1N61A 2N9EB 1LTBD 1QVCA 2KDFB 4YT0B 1WH3A 3V6EB 1ZP0B 3H94A 3CCQA 4IURA 4CKCA 5AUIA 2V9HA 1NR2A 2IGDA 4JI8L 2ZT9C 5LL6S 4J6IA 4RH6A 3E5SA 1WFYA 1WJUA 4JE3B 5DPWA 5HFYA 2OJRA 5IWAQ 2VUMB 2CVRA 1Q82C 5BYQA 2WX0A 1PZID 5I2XA 2WLBA 2OQ0A 2O2VA 3AE9B 1OQQA 3I57A 3I8ZA 1R9TB 3UI3A 2KEEA 2L1AA 5EQ0A 2UUAQ 4LFBL 1K8RB 1HQMC 2W54A 3NVVA 3OLMD 2CJOA 4GDKA 4DHZB 1EF1A 1TKYA 2YVCA 3PO3H 3U4ZA 1BBUA 4YY3L 4BY7H 2UYZB 3E9SA 3MC8A 3AULA 2A69C 2IO0B 2V3NA 5ELEA 3PUVA 1E9MA 1LLRD 3HP3A 5L37A 2NVTH 4PT5A 3BY4B 3H9DA 2VB3X 1E10A 3MXPA 3NUHB 1C4QA 2Z0SA 4DR3Q 1ZDXA 3Q8AA 1IUEA 4DDGD 1FFUA 2VUMG 2KVZA 1JOOA 3TSSA 1Z2MA 1LT3D 4A3BB 3AE5B 2KOLA 3BZDB 1YQ4B 1TWAB 1LM0A 4X62Q 1KRHA 3CRKC 4X64Q 1E7PB 1WGYA 5AEKB 4K3CA 1FJGL 4JWUC 3T3OA 4KI0A 2ZPNA 3VH4B 3I73A 2HJ8A 1I35A 1UWXA 4NDXA 3Q3OC 5IY0A 3C2PA 5G5HA 4EOYA 2Z4IA 3N1YC 2MO0A 4J6HA 3KJOA 4HTHA 4WORA 3DBHB 1HTLD 2LJIA 1KIXA 4BXXH 1A3VA 2CR5A 1LTRD 1I4HA 3DLLA 3PREA 4FXKC 3ZW3A 2ONQA 1SROA 1A3TA 2BE5C 5C4JB 2BB6A 1HZ9A 3SDLC 1KC8C 4E74A 1NNXA 4A3BG 1A6XA 1BDOA 2IW3A 4IPDA 4L2YA 4JI5L 3FP9A 4L5QA 2BYFA 1C77A 2KECA 2B8GA 1JALA 1WTHA 3GTMB 4RGOS 2MHVA 2K25A 4LK1C 2PE9A 1XT9B 4URKA 1YN3A 3K58A 2ZXPA 4G0NB 5IP9G 1EYAA 2NVYB 3M3YH 1K83H 1L0WA 4S17A 2LRUA 1STNA 3T4AC 3FPUB 2CQOA 3CCSA 2XGTA 1LYLA 1EY7A 3TP6A 4U673 1E5WA 1BKBA 5HKHA 1GUOA 1WCMH 2R61A 4DV1Q 1K51A 4HCPB 3PO2G 1KLVA 2GA4B 4XDXA 2VQFQ 4K2KA 3HOYH 1KAWA 5M5WB 3N20C 4BKGA 3IFTA 3TRZA 3ZJYC 3RN2A 2N1WA 4KGTA 4KV2A 3DHHC 3OTOL 3J81j 4KGSA 3NPPA 4MSMB 4A20A 2KTRB 2PVOD 3CIRB 4F1SA 4YSYB 3VVWB 4W9CA 2D3BA 2DX5B 3GTOH 1EO6A 2CKZB 3GTKH 2OHFA 5D3IB 1AZPA 3AEEB 1STHA 4BAXA 1ZYRD 1F77A 1CUKA 2LHEA 3D4RA 3MXNB 2NWGA 3F2BA 4JI7Q 1LT4D 2RDHA 5AZGA 3VRBB 5HI1A 3PTFC 1SBBB 2L4NA 3NOBA 1TTNA 4GKKQ 2Z0EB 1PYBA 4RM8A 5IO9A 4N59A 1Y1VB 3QIJA 2C9WB 5M5XB 3S17H 4MGYE 1SE9A 1VQHA 1YJ1A 3AEFB 4KJOA 4OO1H 3FILA 5EAYA 5IGDA 1EYGA 2KQ4X 4E6IA 1HPCA 3H7PB 1X3FA 3LWEA 1STYA 4ZKCB 3DOWA 2PNRC 2XN9C 1OEYA 4A90A 3VR4A 2RBMA 4HXDA 3QIAA 4HN7A 2CH4A 3KDFB 1AYFA 1N5XA 3MXGA 4V190 3G7LA 2E2DC 2M0XA 2IYDB 3W5OA 4QUCA 3UIOB 2JY6A 4GXBA 2R93H 5CV6A 3BINA 3CQZB 3K57A 1Y1VG 2WV6D 3D31A 4OO1I 3DVNU 4CDFC 3GTQH 5IIFA 2B63B 3P4PB 2UUBL 4WJNA 3CCJA 5JVH3 2Y0SB 3RMHA 1NYQA 2OTJA 2X69A 2HE7A 5EKLA 2JZPA 2KANA 1S5ED 4JG2A 4C4VA 3HM3A 1VCIA 4P16A 2PMZE 3HFZB 4QMGA 3K8AA 1XNRQ 2BT6A 4N9PA 3NEMA 4RHRA 2DJGC 4C7YA 1N8RC 3AEAB 5IYBH 3JC66 2WQYB 2EYPA 1PRTD 1PLFA 2E2HH 1RL2A 4RKBA 5IGCA 2QSDA 3D0FA 2V3SA 4KZCA 3KUDB 1HFNA 1WJJA 4AH6A 2WXKA 4E71A 4OWWB 1E90A 2RR9A 1QNUA 4JPBW 3TMEA 2WXJA 4A3LH 2HUGA 4YWLA 3NQTA 3N6RA 2EELA 4LFCQ 3P4RB 2MJ8A 1PTOD 2EJGC 2B63G 1HA6A 1C9OA 2AWOA 2WDTB 3S1QH 2Y0SG 2RF4A 2MBEA 1UBIA 2YLMA 2YYZA 5FOBB 2BOSA 3BDCA 4GOPA 4OGQC 5ELDA 5IWAL 2K6QA 3QQ8B 1SAPA 2NYZD 1WGDA 2IGGA 1E2VA 1F9QA 1IXRA 5FLXE 5J2RA 2D3GA 2LMCA 2KFKB 2KXJA 2UUAL 4IPGA 1VJKA 4Q5VA 4R4CA 4C1NK 4KMUC 5D3DA 1IW7D 5IGEA 1YJNA 2MP2B 2MX2A 3AE1B 5JXVA 1TWHH 1Q7YC 1QT9A 1GAQB 1MG8A 2HQLA 2L9HA 3ZGZA 3ND8A 4I6LB 3SU8X 4KHPL 1K3RA 1AH9A 4UP7A 4EZJA 1UWVA 2PZUA 1I3QB 2EKEC 1UWMA 1XLQA 5IODA 1YX5B 3JSVB 4FO2A 3Q23A 1EIYB 2LWPA 4DR3L 4AIMA 1I4QA 2XRQD 1PV4A 3SR1A 1PTOH 5BR8Q 3KUZA 3IRBA 2A8VA 4L23A 2JN4A 1STEA 3BDLA 4UHVA 1SEBD 4DV6Q 2J4XA 4OL7A 1EFID 3W1GA 3W5UB 2KENA 4X62L 2Q8IB 2VH2A 3ULLA 4IFDH 3AU7A 3MJ5A 1RTOA 1RWSA 2JYOA 1SE4A 3J7ZC 5DEHA 3K9OB 1UE5A 1UH6A 2KYWA 1YHAA 3NHEB 3PRZA 3W1YA 1ISNA 3S1NH 1WSPA 1Z47A 1CZWA 2HD5B 2KDEB 3NZSA 1FO4A 2AWTA 1YMHE 3HOWB 1AP0A 3QJZA 1UE6A 1LTAD 3T1YQ 1QZEA 3HKZE 1BCPB 2L83A 3DVGX 4FXCA 2BS4B 3SK6A 3NS1A 2Y5BB 4OONA 2BF8B 3M62B 3JAML 1ESFA 3V3XA 5BN5A 2A69D 1GNUA 5TR5A 1HA5A 3VR8B 4IUVA 1WY8A 4A3MH 2F0JA 1Y69U 5JVG3 2HQEA 1B53A 4HWIB 2JXTA 1S5BD 2A6EC 4JOIC 2EXDA 4QGUA 3HOWG 3N9YC 4DV1L 1J19A 4UPAA 3VUWA 2HHHQ 4YWMA 4UY8C 5AFWA 2BGFA 1WYGA 5J3BA 2VQFL 2QDFA 3Q0AA 1E8YA 3GTLB 1KH0A 1ASZA 5IP4D 4NXNL 1MPEA 3Q24A 3AEVA 1YNND 3NRZA 1BMLC 2K3UA 4EUTA 3ZNGC 1TKWB 2PQAA 4IUNA 1QOFA 3UDIA 3Q3FA 1X1MA 1JWMD 5EKIA 1FNUA 4KHZA 1MHWC 2WAQE 4ME3A 3NBHB 3E56A 1PYWD 1Y14B 1FL0A 2G3QB 5COYA 4HIMA 4ZKBB 3S14B 3AH7A 4KVGB 1ZUD2 2BE5D 1T6BX 3AE6B 1QG7A 4K0KL 4JK1C 5KNCA 1V86A 4LLGM 2OEDA 4QF4A 3TQYA 4JI7L 3K0XA 4HR7B 4A3DB 2BQQA 1DOXA 3ZDTA 4K5VA 1V49A 2K04A
chains in the Genus database with same CATH topology
4G7OC 1AFPA 1T5XD 5C3JB 3TDQA 3K5OA 3NVWA 2WP9B 1I4GA 3FMCA 3DWMA 3S1MB 3C1EA 4AYBB 1SF0A 3G6JB 4ITKA 5E4XA 5CV4A 2NVQB 3QJYA 3P75A 5G5GA 5EPJA 3QOLA 4LTUA 1CQVA 1PMRA 3IKJA 4EVOA 1PZKD 3VR3A 1B9RA 3VYTA 4IOIE 2A6HD 2QIEB 3DUZA 4HEDA 4PV1C 4O42A 1UUPA 1TYGB 5KYIA 1NEKB 1SJHD 5IT9E 3BDOA 1SDFA 4A8XC 3TP8A 1H9KA 1XEEA 4B08A 1N60A 4L63B 1TWCB 1FRDA 2XVSA 1RFKA 5EPLA 1R7SA 1SYBA 1N63A 1SXTA 1WVLA 2JXMB 1QLBB 3MXUA 2EYOA 2RKSA 1BF4A 4CKBA 1G91A 3J7YW 1EWYC 3F2UA 3M7NA 3S2DB 3ZJUA 2PPBC 4QUFA 2HTME 5GXGB 1KDBA 1PGBA 4TQ1A 3VR9B 3PIO3 4KJNA 3OWEB 4K5XA 4OIKA 2ZW1A 2DBYA 1RCVD 4CHTB 5HHDG 5JEAG 5EKKA 2B2WA 5C4HA 3HOXB 3MP9A 3TBIB 4S3SA 3EVQA 5BN3A 3ZYYX 3P63A 3S16B 1DZ1A 2K1BA 3TEXA 4NKLA 5EE3A 4GDKB 2MPMA 1SIJA 2N55A 4ZHOA 1TIID 3K59A 1L6UA 2D5GA 1DOMA 4EQNA 1T5EA 3GTPB 1TR5A 4FXDA 4TMAB 2F0OA 3ERQA 4N6EB 3PZ7A 1BCPF 3DHQA 3S15B 1WTWA 3K6OA 3AE7B 3Q8EA 2IT1A 3C8YA 1BO0A 3ITPA 3OIQA 3T51B 1M8AA 4XTCS 1HRJA 2O2LD 1E2ZA 3J81L 1C48A 1LT5D 1EY9A 1QCBD 5FO8B 4K14A 5CGKA 3I90A 1PFDA 4KD3A 2K9XA 1LTGD 2K5QA 1C79A 4HKZE 2Y3AA 3GO5A 4ZK9B 1KABA 2QMTA 1EL0A 3VA5A 1OQRA 2WKCA 3TUOA 2D62A 3CHBD 4F7XA 2N0SB 2K7VA 3K7AB 3MHZA 2NVXB 5IGBA 4CBVA 3ZQ4A 3TEZA 3VRAB 1FD6A 1EU3A 4TRDA 1O7YA 4A3JB 2M2LA 2PO4A 1A2TA 1AEXA 3RD4A 3OOCA 4ABNA 2A6ED 4NMZA 2M0AA 3M4OB 4H0LC 4WURA 1J8IA 3KK7A 2H89B 5I4DA 1JMLA 1B1ZA 1AWDA 1HEZE 1NCVA 5HGTA 3TN2A 4R3DA 3AE2B 1F2LA 3SR6A 3BVZA 5NUCA 3UI2A 1YNTE 1JORA 4ZYSA 1XTCD 4RGNA 3DMUA 2Q8TA 2AUJD 4C1NI 1CZGA 2LFIA 2F0IA 4ZUIA 4WJWA 5CV5A 1XWEA 2B39A 2K5PA 2NTSA 2IX1A 2L32A 3FILB 1B3AA 3PMFA 2R92B 3IAM1 1JWSD 2A74C 1VRAB 2RA4A 2JA6B 1Z7TA 4DGZA 1WTOA 5DM73 2PTLA 1IL8A 1SYDA 2BDOA 3OPOA 2A73B 5CORA 2X38A 4KN4C 2IL8A 2FMCA 2DYOA 3C46A 1XLOA 3W1SA 3BYTB 2JEBI 1WWTA 1PRTC 2WXOA 2X6LA 4GZYC 1B50A 3TEWA 4IKGA 2JA8B 3FPPA 3D3RA 4MACA 4X3TA 2WDQB 1RHPA 2LY7A 2E2JB 1S5DD 2RVLA 1FCLA 3V96A 1Z6HA 5EGTA 4H7BA 3NZ3A 3X3NA 5CR3A 5KNBA 4ZQ3A 5MPOA 2C9OA 2CQAA 1R4PB 3MEHA 4F8MA 5C0XJ 1BNZA 4JBWA 3AE3B 2EKIA 3DWAA 1GB1A 2VZKB 2O5IC 4RCNA 5IGFA 4L1BA 1BBXC 4RF1A 1RM6C 1NUCA 1FM0D 1EEFD 2D9UA 2FFKB 2LMCB 3URYA 4FVMA 3MA2B 5I6YA 2L11A 1FYCA 4R8NA 4ZUJA 3OHXC 3PZ8A 4USAA 3U9OA 2DNEA 1QQRA 2G9DA 3CWIA 2LHDA 3K0YA 3PV0A 1EQTA 5JPMC 1XF5L 4Y7NB 3T16A 4XWTA 1OXTA 5JPNC 4CQNA 2A5HA 3A8KE 4WIPA 2AQ2B 3B2GA 4PNYA 2ON8A 2F3VA 4BA1I 5CMDA 1DOYA 5LHY1 2B2TC 2FBWB 5C5LA 3E0JA 1WRIA 2LUMA 1EZ6A 5EE0A 2LFNA 2IGHA 2M56B 1H9JA 2N7JA 3NHHA 3DM1A 2J42A 2XIWA 4HJGE 2L52A 2BDNA 3A54A 1GUTA 2V0GA 1ENCA 4N58A 4ARIA 2F0KA 1NSNS 2OT2A 3IT4B 4A3KB 5IOCA 4PMCA 1OXXK 1YNNC 5FLXL 3GTGB 1S5FD 3U2SC 4BS9A 1F9RA 2EYLA 2D2CC 2EY1A 4IZ8A 1IYUA 4ZLTF 3NVYA 3PO2B 2PCFB 1STAA 3A55A 5C3XA 3WCQA 3W3AA 2DYMA 1E6EB 3AE4B 5G3LF 2LGIA 3EA6A 3P4QB 2BTEA 2EYHA 3ZJTA 3X3MA 4EQOA 5H8YE 3OW7A 4V0BA 3SK4A 1SNOA 2FUG1 1I4XA 2FE8A 4XYOA 1L5PA 3HZXA 3CKIB 4XT3B 2SNSA 4A93B 3MFYA 1QOHA 3TZDA 4DK0A 1C8CA 4FF2A 1VR9A 1LTTD 2L5TA 4LJZC 4FXGC 1EYDA 3ZJVA 4D2KA 1QOGA 4L6TB 2KCCA 4K8JA 2E3TA 2WXIA 4A6QA 3ONAB 2F0GA 1ESRA 4YSXB 3HRZC 2F0LA 2PW5A 1CM9A 4DAVA 2A6HC 4H2AA 1YN4A 1RF2D 1MHHE 2F0PA 2B2VC 1OXVA 4KKJA 1ZOYB 3I72A 2JQRB 2F0SA 3FC4A 4RHSA 1IGDA 3RZOB 2JA5B 3HOUB 2V4DA 1RDPD 1Q12A 2JE6I 2M9VA 2WDVB 1JC7A 3ETRA 1SNPA 3P7JA 2GI9A 5M3MB 3AM9A 1J7AA 3O13A 1M4VA 1SNCA 4K6DA 2YU9B 3DWPA 5C3WA 4K5WA 1H9RA 2K22A 3LNNA 1CJEA 2I2YA 1STGA 1TU2B 4IUTA 4RWSC 4DXFA 1TS2A 2FMMA 1JB3A 3KBXA 2XSCA 1I6HB 5E6JA 3GS2A 1MI2A 4BBRB 1D6EC 2XWJB 1VZ7A 2NTTA 2L1BA 2DY8A 4H44C 2PZTA 5CBEE 2VNUD 1LABA 2BW2A 3FAHA 4I65A 2Z1CA 3L7ZC 3KWLA 4KKIA 1FEHA 3SHLA 4PMWA 3D4WA 4HMJA 4L8JA 3NVZA 1CA6A 4OZAA 3VA7A 2KCNA 5JEAH 2BA1A 1X3PA 2G9HD 3MC0B 5K5PA 1SYFA 1G2SA 1JWAD 4KKTA 1VDVA 1CA5A 4XDCA 2YEPF 2M19A 3KUPA 2NB0A 1DCZA 3OMGA 4HKQA 3V05A 3S1RB 1YN5A 1T3QA 5IT9L 1G8ZD 4ILWA 3H3VC 2I46A 2QJLA 4HRSA 3MVVA 2W55A 2LKVA 5C44B 3LX0A 3Q22A 2BYTA 4LK0M 1V1OA 2XRSD 1TWFB 2MP1A 5JJZA 4MH8A 3H6MA 3WOFA 1ENFA 2E74C 4G7HC 2KACA 3QO2A 1Y1WB 2O4XA 1OXUA 1BOSA 1D1KA 1SSNA 1D2BA 1AW7A 4K6LA 1IBXA 1I7HA 3DEOA 3RPFC 1LO5D 2O5JC 1QOBA 4RCOA 3KF8A 5J39A 2A68D 1GUGA 1U9RA 4G4KA 1TKEA 1EWCA 4I7ZC 2JSVX 3H91A 5H92C 1F2RI 2C5CA 2WKDA 3TP5A 2SAKA 3TEYA 3HG9A 3MZ5A 1PFNA 5F2DA 4C3IB 2F0QA 4A3EB 4HAEA 4PQXA 4UDUC 1UAPA 1BR9A 3N52A 2BCOA 3Q8CA 3HOZB 4H13C 1QWYA 4ID6A 1CTMA 4LMQD 1CHQD 4HSVA 4OZBA 2M00A 5J22A 1TKGA 4HSPA 1F9SA 1NVID 4P6VF 1LV9A 2HDMA 1CT1D 1XLPA 1K50A 5TSSA 5C6AA 1JWBD 4DA2A 3OMCA 4C3IG 3BVMA 4YTMB 4MT5A 3P4SB 2ICEC 3M7GA 3TZUA 2WB1B 4A9AA 2WU2B 2Z8LA 4KK7A 1I50B 2QILA 5I9OA 1S5CD 2EY5A 4TQUS 4HROA 1CQFA 1U4LA 4US8A 1ZXTA 2W3RA 4JWSC 4KX6B 1SMYC 4C3HB 4NW2A 2DWQA 4EE2A 1W6KA 2BA0A 4DNTB 2K32A 1AZQA 2KQ3A 1VZ8A 5ELBA 2SNMA 2VB2X 2NMQA 2JU6X 1QKZA 3RUZA 1ET6A 5ISRA 2KWDA 1JOKA 2RSOA 1EIHA 2IX0A 2BBCA 2W3SA 5C3EB 1WGKA 3I70A 4C3HG 3MHBA 1VLBA 2F0VA 3H0GB 3MTSA 1DYQA 4ARCA 4WFN3 2R7ZB 4XYQA 1HHVA 1PGAA 5K36H 4BBSB 3BK2A 4CJ1B 1QF6A 3AEDB 4Q0FA 2ACZB 1SFOB 2J53A 2KN4A 3DWQA 1SB3C 2VZKD 2K5DA 2KA7A 2W82A 4DAPA 2CJNA 5BMGA 2J0TD 3T56B 3WDNA 5CBAE 5T1IA 4IFDJ 3HUIA 1QILA 4FF3A 1BXTA 2K03A 4J8QA 3EUB2 3VYRA 4RKLA 4CJ2C 2JSOA 1DM0B 2ENBA 3PUXA 2PQEA 2RMMA 4DK1A 4G7ZC 1BCPC 3SDZA 1KNEA 1VDZA 1EY4A 1QJOA 3AECB 3KLSA 1O7ZA 1ZXIA 1EWHA 1UEAB 1SYEA 5HG2A 1DOIA 1CHPD 4NAMA 2K01A 1GB4A 2JWUA 2WDRB 1N62A 1DJRD 3SFEB 4MM3B 3FEWX 1PFBA 1KLGD 1EZ8A 3RLFA 4DNRB 4J3OD 1HXYD 4TKOB 1SYGA 3I4MB 3BYYB 1RKNA 3U7ZA 3R3OA 5ELCA 2Y5PA 1CFMA 2EJFC 3AV8A 4ZRZA 4O1NA 4F88A 4B9WA 1U4PA 4YXDB 3RFZB 2SDFA 1A15A 4R9WA 1GJXA 1GOZA 5KNDA 2B2UC 1RJTA 2Y5CA 1SJED 4ZRPA 1DD2A 3BK1A 4KHVA 3K5LA 1B9NA 1TVXA 1Y8NB 2KEDA 4BY1B 1TY0A 2EE1A 4RGTA 1UGJA 1XO3A 2B2YC 4FF1A 2HCIA 4A3FB 3W2DA 2WINB 3GP7A 3I4NB 1G6ZA 1JRPA 2WXPA 1ZKOA 1OFFA 3VR2A 2FJ2A 3GQBA 2EDGA 1GUSA 4Z9CB 1CK1A 1RODA 2NUCA 2OF1A 4RNAA 2GRIA 4DN4M 2SOBA 5E3FA 1C76A 3SXHA 3D8GA 3KWVA 1IYVA 2EVBA 2XWBB 1ENAA 1XCQL 3A8JE 1IKMA 2CU3A 3OSOA 1WD1A 3TP7A 1TZOA 1ZE3D 2DLBA 5HURA 2INPE 2F0TA 3Q69A 4NJCA 2PMZB 2F0EA 2LS01 1TWGB 4R8IA 5KYLA 5A2QL 1J7CA 4DAYA 2NN6I 4A3IB 1OO9B 2KDMA 3B9JA 1JICA 5ELFA 3NTKA 5DAUA 3T53B 1SMYD 1I4RA 2WXLA 3KLSX 3NQIA 4RGMA 5IGGA 2KUMA 2I07B 2KVMA 4MHEA 3K5NA 2QCPX 2JA7B 5BMIA 1V1PA 1Q1BA 3HEJA 1Q90A 2K05A 4KD4A 1HUMA 2IDYA 3IXSA 4A3GB 2PW7A 4ZAIA 1PFMA 1QE6A 1ACCA 1O80A 3AB5A 4IALA 5CYUA 4C2MB 1GUWA 3GD7A 1F2RC 3D4DA 2V3PA 3NK9A 5JAVA 5BN4A 4YWGG 3LB8C 1D5XC 3A7LA 3Q6SA 4ODGA 4KY7A 3SEBA 4QIWB 1VMCA 1YNJC 4XQQA 1PRTF 1VF5C 1D4BA 1BUVT 1ILPA 5EBCA 1XCTL 3HKZB 1PTOF 3MAQA 2PMVA 1GUNA 3B2FA 5M9OA 4RFBA 4FNFA 2YEPB 4N9TA 2ICIA 2F03A 1E0ZA 1H9MA 3PUYA 4OHJA 1ZXHA 4XQJA 1P7FA 5T8IA 2K28A 5DM63 2A68C 1WTRA 3R2TA 4ME5A 2K5WA 4DF7A 1BCPD 2PW9A 3FVQA 2RQXA 3NXWA 1IBXB 2H4OA 4X3UA 3U4EG 5M3FB 5M5YB 3HVDA 2E75C 1JCKB 1XYIA 2AUKA 5C0XG 2F4IA 1IHZA 2OEOA 2WAQB 5KEEA 1TS3A 4QB4A 3L4PA 3CU7A 1KLUD 2MGSA 1JR0D 2R3ZA 1V97A 4OIJA 5CV7A 5A2QE 2BS2B 2PIAA 2EYMA 3RZDB 1ROEA 2HDEA 2WXGA 1MI0A 1OXSC 2B2TA 2MJDA 4OVZA 2AWNA 3J9CA 1EM7A 2F0UA 4REZA 2IX3A 4IUQA 1HFGA 4AQ7A 2B8FA 1EIGA 4QCLA 2WXFA 2JX5A 4XE0A 1C78A 2AQ3B 1B2TA 3M4YA 1WTQA 3NBIA 1MHXA 1LTSD 1C4AA 2NN6G 3R93A 2DNCA 2RDFA 4FYDA 3FDTA 3E6ZX 1D5ZC 3NTIA 3VR6A 2DY7A 5C4ZA 2KMMA 1H9SA 1IGCA 3PUWA 5FO7B 1XX8A 3J80L 3AEBB 2JP1A 4IUUA 1TS4A 1KDCA 2XNAC 1KFYB 2Q5WD 2AQ1B 3HS0C 1JE4A 3OIPA 3KLRA 3I9V1 1QB5D 1D1IA 3D6WA 5BMHA 3R8BA 1JW9D 4Q2JA 3LYYA 1PDXA 3S9WA 2FHTA 2K6AA 2EOTA 1TT2A 1HZ6A 4MIUA 2I38A 2SEBD 1ZEQX 1Y56A 1L0XB 3BS1A 4UAIA 3MFGA 2WS3B 5KGUA 1G291 5C4XB 2MJEA 2N88A 3VQIA 4ULLA 3VYSA 3HRDD 3IAS1 3SFDB 4YSZB 5I9PA 2EYFA 1NYRA 4HCEA 1F2YA 1FCCC 2ID0A 2NBFA 1DXMA 2B2VA 4DQOC 1TJEA 3P20A 3CRLC 1ZDVA 3J7AV 1EOTA 1EY8A 2RDGA 1O78A 2CW0C 1JROA 1PUTA 1MD2D 4EQPA 5EE9A 1GPXA 4WQMA 3QOJA 3I4LA 4XDDA 2LEKA 1YJIA 2V4IB 4WH4A 4K2LA 1FD7D 2D5DA 4XIGS 1JQYD 3DXJC 1WTXA 3SK8A 1YNJD 2HCCA 2PKOA 4X3KA 2IJ0A 1VF7A 4WWMA 5J1ZA 5EPKA 5LNK1 1SE2A 1FXIA 4KV6A 3PO3B 4ZHPA 3SE0A 4BY7B 2MH7A 5EJWA 4NAWB 4KY5A 2NVTB 2EZVA 1Q8IA 2H88B 1XLNA 3T13A 4HEA1 4P2CB 2QEJC 1V8CA 1VZ6A 3QG1A 1LACA 3AMZA 4HCSA 1EEID 3HGBA 3KBGA 1EU4A 1I6VC 1A3UA 3D6CA 2QF7A 4RAUC 1F9PA 3L3OC 1FFVA 3R2IA 4LAAA 3GV3A 1FNWA 1SE3A 1L0VB 4KKUA 1FGBD 1KF6B 4RA8A 5EBDA 1QOAA 2F0FA 4RF0A 2DN8A 1C4PA 3GB1A 1XXGA 5I6WA 5CV9A 4NZLB 3J80E 1A70A 4IFDI 4XT1B 5CC4A 5G3LD 4ZRQA 2EPBA 5EE1A 1STBA 1ICWA 4C56C 4IQZA 1B4OA 3VR5A 4JPSA 2JYEA 3EGRA 3M3YB 1K83B 4IDIA 1Q10A 4G57A 1J9OA 5DNFA 1WCMB 2L55A 2L12A 4OZCA 4WRDA 3HOYB 3AN1A 5JOBA 4CGYB 1DGJA 1A2UA 1TY2A 3P1HA 3SVMA 2G1EA 2GB1A 3BVGA 1ILQA 3W9CB 3NP8A 3GTOB 4TSSA 5FK9C 1EQVA 4KGRA 2EYJA 3GTKB 4JX1C 4X3SA 3LWUA 1HZ5A 5C5MA 2MEKA 3NUCA 3EROA 1EY5A 3S17B 1C9FA 5BYSA 3P1MA 3KQ4A 4XWWA 2F0WA 3AE8B 1VMPA 2ZW0A 2WXRA 4DU9A 5I2YA 4OW0A 1K53A 5BYRA 4BA2I 3VYUA 2JEAI 1X32A 1PGXA 3MXNA 2K33A 3A7AB 3QWNA 1ONLA 2KJXA 1V1PB 2R93B 1J7BA 5JEAJ 4CJ0B 4KKSA 4DXGA 1G2TA 3FRPB 3GTQB 3Q8FA 1CI3M 4B0MA 1DOKA 3QB3A 2B76B 4OO1G 1S4ZA 2B2WC 2EJMA 2WXMA 3PO0A 1PDQA 2E2HB 3L9AX 1K8OA 1U4RA 3BWUD 1F2ZA 1B44D 2F0MA 4KTAA 3P42A 3PUZA 2RSNA 1ET9A 3S1QB 4GLSC 1U4MA 1QNKA 1FXAA 3I91A 5C2TB 2ZXOA 2E76C 1K52A 1MBYA 4B0EA 2J52A 4IUPA 1KTKA 4K8IA 1YQ3B 2N9KA 5E1FA 2OXPA 1BUIC 4B9XA 5FKAC 4U68A 1MSHA 1TWHB 1PRTB 4XXEA 3JAME 5D7GA 3J7AF 3C3LA 3NE5B 2WIIB 1L4DB 5AUKA 1PTOB 1FRRA 3MWYW 3EQLC 1AN8A 2CW0D 3I3CA 2TSSA 1DOLA 3EFXD 1SNMA 1GHJA 1O7LA 2AX5A 5E4WC 2F3WA 1MGSA 3IT6B 1RD9D 2ZXRA 1LT6D 1LTID 3AB9A 5LL6X 4DFAA 1HTPA 3EJIA 3S1NB 3W5VB 3BIID 4BWGB 1CZPA 5C0XH 1FIQA 2F0DA 2WNMA 2WXNA 4YTNB 1JQ4A 1II3A 1JOQA 1YJJA 1Y8PB 1WXQA 3DWGC 5FR3A 1X3QA 1DONA 3SK5A 3BG3A 4ZOHC 2RPVA 4IFDG 4M8AA 1GXDC 2KAJA 2PYKA 1E2WA 4A3MB 1L0YB 1P7EA 3NWSA 4FP5D 2FINB 2F0HA 2MJ3A 3ABVB 2EY2A 5C0XI 2CHBD 1Y8OB 2F0NA 1V43A 4KY6A 1F0ZA 1NAPA 3AEGB 2EY6A 3LXFA 2IPKD 3DEPA 1BQQT 4EGVA 3ND9A 1FR3A 2H1EA 1N5WA 1NI3A 2F1MA 2L0CA 2IWHA 4F87A 2Z4HA 3V2TA 4HMIA 2PLPA 1EY0A 4J1MA 2WU5B 3NSWA 3WOEA 4A55A 4GDLB 5A35A 1EYCA 1V8QA 2WACA 2N9LA 2QKIC 1K8MA 1PZJD 2R6GA 1MSGA 1F2MA 2INNE 1B9MA 1HQRD 3IFDA 5KRUA 2NN6H 2EXZA 4C3JB 5KIXA 3M85A 1KNAA 2BS3B 3NBHA 4PMBA 1ZYRC 4C7ZA 4YIJA 3AMUA 3S2HB 1H9SB 1ZPSA 2KHSA 1KAAA 4FF4A 2MUYA 1WTVA 4IN3A 3A56A 4NP5A 5D65A 5D14A 3IAYA 3NTHA 3HOVB 1MVKA 2B2UA 2X6GA 4US9A 4WAFA 3HVZA 1E0BA 4C3JG 2NZ1D 1WD0A 3Q8BA 4TQ0A 5CV8A 4AS1A 1NR4A 2BB5A 1RYJA 1KDAA 1RTNA 3FKIB 2B2YA 3H09A 1HUNA 2WXQA 1GHKA 3C1FA 1UNSA 2WP8J 1SYCA 1TS5A 2JYTA 1SNDA 3PIP3 1SNQA 1ML0D 2PVGC 3T3NA 1Q3LA 1Q1EA 3NWTA 2TMPA 1FNVA 3OWFA 1C4CA 5FO9B 3A8IE 1FMAD 4MN3A 1L4ZB 1PTOC 2PZWA 5K36G 1NENB 1PXUA 2Q8RE 1SSOA 1W6JA 2J7ZA 3H8HA 4YTPB 2E2IB 1D5MC 2E6XA 4M0WA 3U9SA 4CKEA 2WXHA 1HCZA 4KN7C 1L6VA 4XQNA 3K5MA 2K0PA 1I4PA 1IW7C 2VXWA 3J81E 1TQOA 5T1GA 3IL8A 1WTPA 4C80A 3U52E 1JWUD 1EY6A 1R4QB 1IKLA 3GV6A 4M1UB 3GTJB 2QDBA 2HDLA 1N61A 1LTBD 4YT0B 1ZP0B 3H94A 5AUIA 4IURA 4CKCA 1NR2A 2IGDA 2ZT9C 5LL6S 4RH6A 3E5SA 4JE3B 5HFYA 2VUMB 2CVRA 5BYQA 1PZID 5I2XA 2WLBA 3AE9B 3I57A 1OQQA 3I8ZA 1R9TB 3UI3A 2KEEA 2L1AA 5EQ0A 2W54A 3NVVA 1HQMC 2CJOA 1TKYA 3E9SA 2A69C 2V3NA 5ELEA 3PUVA 1E9MA 1LLRD 3HP3A 4PT5A 2VB3X 1E10A 3MXPA 3NUHB 1C4QA 1ZDXA 3Q8AA 1IUEA 1FFUA 1JOOA 3TSSA 1LT3D 4A3BB 3AE5B 2KOLA 3BZDB 1YQ4B 1TWAB 1KRHA 3CRKC 1E7PB 4JWUC 3T3OA 4KI0A 3I73A 1UWXA 4NDXA 5G5HA 3C2PA 2Z4IA 4J6HA 4HTHA 4WORA 1HTLD 2LJIA 1A3VA 1LTRD 1I4HA 4FXKC 2ONQA 5C4JB 1A3TA 2BE5C 2BB6A 1A6XA 1BDOA 2IW3A 4L2YA 1C77A 2KECA 2B8GA 1JALA 3GTMB 4RGOS 2MHVA 4LK1C 1YN3A 3K58A 2ZXPA 1EYAA 2NVYB 1STNA 3T4AC 3FPUB 1EY7A 3TP6A 4U673 1GUOA 2R61A 1K51A 2GA4B 4XDXA 4K2KA 5M5WB 3IFTA 4KGTA 4KGSA 3NPPA 2PVOD 3CIRB 4YSYB 2OHFA 5D3IB 1AZPA 3AEEB 1STHA 1ZYRD 1F77A 2LHEA 3D4RA 2NWGA 3VRBB 1LT4D 2RDHA 5HI1A 1SBBB 2L4NA 4N59A 1Y1VB 5M5XB 3AEFB 4KJOA 4OO1H 3FILA 5IGDA 2KQ4X 4E6IA 1HPCA 3LWEA 1STYA 4ZKCB 2PNRC 2XN9C 4A90A 3VR4A 2RBMA 3QIAA 4HN7A 1AYFA 1N5XA 3MXGA 4V190 3G7LA 2E2DC 4QUCA 5CV6A 3CQZB 3K57A 2WV6D 3D31A 4OO1I 5IIFA 2B63B 3P4PB 5JVH3 1NYQA 2Y0SB 3RMHA 2JZPA 2X69A 5EKLA 1S5ED 1VCIA 4P16A 4QMGA 2BT6A 4N9PA 4RHRA 4C7YA 3AEAB 2WQYB 2EYPA 1PRTD 1PLFA 4RKBA 5IGCA 2QSDA 1HFNA 2WXKA 1QNUA 3TMEA 2WXJA 2HUGA 3NQTA 3N6RA 2EELA 3P4RB 2MJ8A 1PTOD 2EJGC 1HA6A 2AWOA 2YYZA 5FOBB 2BOSA 3BDCA 4OGQC 5ELDA 1SAPA 2NYZD 2IGGA 1E2VA 1F9QA 5FLXE 2LMCA 1VJKA 4Q5VA 4C1NK 4KMUC 5D3DA 1IW7D 5IGEA 3AE1B 5JXVA 1QT9A 1GAQB 2L9HA 3ZGZA 3ND8A 2PZUA 1I3QB 1UWMA 1XLQA 5IODA 4FO2A 3Q23A 1I4QA 2XRQD 3SR1A 1PTOH 4L23A 1STEA 3BDLA 1SEBD 2J4XA 4OL7A 1EFID 3W5UB 2Q8IB 4IFDH 3AU7A 3MJ5A 1RTOA 1RWSA 2JYOA 1SE4A 5DEHA 1WSPA 1Z47A 1CZWA 1FO4A 1YMHE 3HOWB 1AP0A <