2QEJC

Crystal structure of a staphylococcus aureus protein (ssl7) in complex with fc of human iga1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
191
structure length
191
Chain Sequence
YDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQNHQLFLLGEDKAKYKQGLQGQDVFVVKELIDPNGRLSTVGGVTKKNNQSSETNIHLLVNKLDGGNLDATNDSFLINKEEVSLKELDFKIRKQLVEKYGLYQGTSKYGKITIILNGGKKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG ALPHA-1 C REGION
publication title Structural basis for evasion of IgA immunity by Staphylococcus aureus revealed in the complex of SSL7 with Fc of human IgA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 191
sequence length 191
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qejC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qejC01
1RDPD 3DWQA 1HA5A 2TSSA 3R2IA 1RD9D 1LTGD 1S5BD 1V1PB 2AQ2B 1G8ZD 1M4VA 4RHRA 1LTID 1PZID 4UDUC 1DJRD 1DYQA 5ELCA 1B1ZA 4RH6A 2ICIA 1SE4A 5ELDA 1LT3D 1CQVA 4DXGA 4OHJA 3KLSX 1LLRD 5I4DA 3BVZA 2J4XA 1LTSD 1D5MC 1BCPC 5ELEA 1BCPD 1I4HA 1LTBD 1LT5D 3R2TA 1LO5D 4RGNA 1EEFD 1CHPD 1F77A 1BCPB 4RHSA 2SEBD 3BYYB 3URYA 1FGBD 1SEBD 3BVMA 1PZJD 1BCPF 1SJED 4RGOS 1JWSD 4RFBA 4ZYSA 1RCVD 1CK1A 1LTRD 1STEA 1SXTA 1V1OA 1T5XD 2IPKD 3OWEB 1XXGA 1AN8A 1EU4A 2IJ0A 1YN5A 1I4QA 1FNUA 1RF2D 1XTCD 1PTOC 2AQ1B 1BXTA 1PTOD 4DXFA 1YN3A 4L63B 1TS4A 1MD2D 2AQ3B 1S5CD 1I4PA 4L6TB 3EA6A 1PRTC 1PRTD 5ELBA 1SBBB 1LT4D 1KLUD 1JWMD 5FK9C 3MC0B 1PTOB 1ESFA 5TSSA 1D6EC 1YN4A 1SE2A 1JWUD 1PRTB 2G9HD 3O13A 2O2LD 1TY0A 1ET9A 1LTTD 4Z9CB 1UNSA 1L0YB 2Z8LA 1B44D 1L0XB 1HQRD 1TS3A 4C56C 1PTOF 3SEBA 1TS2A 2CHBD 3BYTB 5ELFA 1D5XC 4RGMA 1JQYD 1S5FD 1QILA 1TY2A 2R61A 1PRTF 3GP7A 1PYWD 1SE3A 1I4GA 5D3DA 2XRQD 1JCKB 1KLGD 1CHQD 1I4RA 1AW7A 1V1PA 3CHBD 3R8BA 1EEID 4K6LA 1D5ZC 4TSSA 3MFGA 2XN9C 2WV6D 4RGTA 1HTLD 2RDHA 3V05A 1FD7D 2QEJC 4RCOA 1HXYD 1UUPA 4BWGB 1JR0D 1LT6D 1TS5A 1FNWA 1S5ED 2XNAC 1EWCA 1SJHD 2XRSD 1ET6A 1ENFA 3W2DA 5D3IB 2NTTA 3DWPA 1S5DD 2NTSA 3DWAA 1I4XA 3BVGA 3BZDB 5FKAC 4NZLB 1CT1D 2RDGA 1LTAD 1EFID 1FNVA 1EU3A 1GOZA 2QILA 1PZKD 1KTKA 3TSSA 1PTOH 3EFXD 4O1NA
chains in the Genus database with same CATH superfamily
2VUMG 3E0EA 4HSVA 5DAUA 2Y5PA 2Y5BB 2DZIA 3NHEB 3L08A 4BFRA 3WWVA 5EE1A 1S5BD 2KLCA 2DAFA 3D8GA 1H9MA 4LF9L 5C0XI 2HD5B 2KJ6A 1HQMC 2F0DA 1YQBA 2D10A 5EE0A 5C4HA 3SHLA 1MJEA 3FAHA 2DY8A 2M19A 1FD6A 1XF5L 1LLRD 2KOXA 2I46A 3IG3A 3VH3B 4ZAIA 1VJKA 2J0KA 2WXMA 3E9SA 1VQCA 5L95C 1Q1BA 1OO9B 4K3CA 4E74A 4KN4C 3I91A 1L6UA 2W55A 4XWTA 3BU2A 5A2QE 1RHPA 2KFKB 4YHHQ 3RNFC 4JI5Q 2CJNA 2JF5A 2K14A 1EEFD 2NN6G 1YI2A 3GB1A 4DUYQ 1L2NA 3S15B 4XGAB 4YTMB 2DHZA 3PO3G 4TV3A 2UXBL 2PPBC 4BY1H 1M94A 3RD2A 4W9FA 2E2JB 1PZJD 4P7IA 3U7ZA 3HRDD 1VQGA 4JI3Q 3AI5A 4JI6L 1DOMA 5CGKA 1N6ZA 1WJJA 1FR3A 2Z6BA 2F0EA 3RMHA 1TKYA 4HJGE 5JJIA 4IUTA 2RDBC 4HRSA 1LACA 3RNCC 3OIPA 1RL2A 1I4QA 1YNJC 1KC8C 3MC9A 4DXFA 2JA6G 3GO5A 4EFOA 2NWGA 4Y7NB 1B3AA 1X32A 1Q8KA 2EYLA 4LF6Q 1R4PB 3H3VH 4FDBA 1JT8A 1WJUA 1YQ3B 3F8TA 2LSSA 2HCIA 2MFIA 2Z59B 3CWIA 1EFWA 3OW2A 1RAXA 4IW0A 3I4LA 4A3IG 2JVCA 4M8MA 4JBJA 2HHHL 2J0TD 3W1YA 5GROA 4IPGA 2I1JA 1T9HA 2KENA 1I50B 1PRTB 3L7ZC 4F8CB 1LTTD 1TKWB 2HQEA 2O6VA 2QDBA 1VMPA 4YWMA 3RCZA 3T53B 3DBLI 4HJ5A 3BYTB 3L0WB 1R4MI 4DV0L 2ZVNA 5FO8B 2ZM6L 4I6LB 1UWMA 2E5LL 1WGRA 3V60A 5CHFA 1SNPA 5D3DA 1HNZQ 4YSYB 2ACZB 2UUCL 3NZUA 5C3EG 5G5HA 1XMQL 1VZ6A 3Q2AC 3M85A 3T51B 4DNIA 1FJGL 2WV6D 2UUAL 4AUQC 2O4XA 3RZWC 2RQXA 5GQOA 3C1FA 2OT2A 5LMNL 3KF8B 4JWUC 3RYTA 5HY6A 3PF5A 1AARA 1Z9FA 2VS1A 3T1YL 1I7HA 3NRZA 3OWFA 3A55A 1YEZA 4DUZQ 1NYRA 4G57A 3HS0C 4KIKA 2KMMA 4XC2A 5GXGB 3AEVA 1TJEA 3KWVA 2NN6H 2QCPX 2M0AA 5KNDA 5CBAE 4I6PA 1R4NI 2ONQA 4W9GA 5ELOA 3FEWX 5C4ZA 4C1NI 2JA8H 3EFCA 5H92C 4DR2L 4ME5A 4XT3B 5BN4A 1EFID 3RN5A 2VNUD 1EU3A 3X0WA 4DHZB 1J7BA 4GSWA 2BKRB 3AMZA 4XQNA 3I55A 3IAYA 2I5HA 2Q2UA 5AJ3Q 1WE7A 2YVCA 3K9OB 3AFPA 4YIJA 1RLFA 5M5XB 2K5HA 1XMOQ 4DAVA 5DPSA 2ON8A 3K0YA 4BA2I 4S17A 2NR2A 5MPOA 1VCIA 5ELCA 1E8ZA 4JLCA 1L1OA 1Y1WB 4FF3A 4WJPA 4WFN3 4DR3L 2EYFA 4M1UB 2JA5H 2EXZA 3HOUB 2JP1A 4DHJD 3BZCA 2RMMA 1F9QA 1BT0A 3WIMA 1BCPC 3U9OA 4AWJA 2CW0D 3M4OB 2WXKA 3P2BA 2PE9A 1QOHA 2ZVOA 4FHKA 4HR7B 1S40A 3TREA 4B3ML 3QG1A 4MH8A 1CHPD 2MLBA 5JHAA 4PYUA 1U4PA 4UPAA 2DAJA 4LNIA 3P4QB 1IKLA 1HTPA 1WGYA 2X69A 3ZTDA 1CZGA 5JAVA 3D4DA 4IUMB 3HOWB 2JYOA 2SOBA 3IRBA 1KF6B 2JZZA 4K5VA 3KYHC 2HIXA 1V8CA 4P2CB 2EOTA 1SJED 5C3EH 1JWSD 2F0GA 2L76A 4BOSC 4JE3B 4F7ZA 1WXVA 3VR9B 1STEA 4DV4Q 3JSVB 2MBEA 4DK1A 2BYVE 2WB1E 1EOVA 3A74A 2R7ZB 2KZRA 2OJRA 2NVXB 4BBNF 1PTOD 5IA7A 2LVQA 1MHHE 1PYSB 2V4LA 3VR2A 3QK0A 1I4PA 5EE9A 3AQQA 3ZXVA 5FLXE 3EA6A 3I4MG 3G48A 1PMRA 5ELBA 1F2RC 2BOSA 2YEPB 4LK1C 1ZXHA 5NUCA 1EY9A 4MGZE 1FO4A 4P6VF 2B2YA 5IWAL 1JC7A 4Z9CB 2IX3A 4Q5VA 1YJIA 3W1SA 3B2FA 1TWCH 2Q2HA 1A8VA 5LL6X 2KDEB 4P75A 4GDKA 3AEAB 4RGMA 1PRTF 3RLOA 3Q23A 5GAHC 1EY8A 3CC7A 5GADC 4JBWA 1A70A 3CRLC 2UWQA 2WU2B 3UINB 3MAQA 1TT5B 5C3WA 2L3ZA 1D5ZC 1F2LA 4TSSA 1EOTA 3JAMc 3J9CA 1SYEA 1EF1A 4FADA 1TQOA 2CU3A 1K28A 1LT6D 1XNRQ 4RKLA 4C4VB 4HCEA 5KNBA 4HJKA 3FMCA 2LS01 3TEHB 1FMAD 1IYUA 5CV4A 1YHBA 3OPOA 2QMTA 3PPAA 4LFAL 4NMZA 1EQRA 1ET6A 1GUTA 2F0SA 5CBEE 2EQSA 5C0XH 4DNTB 4C3JG 4HJ8A 4ITKA 4ARCA 1S5DD 4GOPA 3I4NG 1MSGA 2M1MA 4PZ6A 2K50A 5M5YH 1F52A 1CT1D 4KKIA 4BBRB 4KHVA 3QA8A 5G5GA 1AE2A 4QGUA 4QUCA 4B3RL 3NP8A 2K3UA 4TQ0A 2B2TC 1E8XA 3BY4B 5EGTA 2UU7A 2KOLA 2WINB 4LNNA 2DN8A 3VYUA 4NQLB 2N7EA 1OQYA 4FA6A 2J53A 3HOZB 3HOYH 1E24A 2D3GA 3VFKA 4NKLA 2K32A 3HG9A 1NMGA 1M4VA 4UP8A 3MTSA 3FILB 4JPBW 2WIIB 2KN4A 3ETRA 5M3MB 1UD7A 4KGSA 1IL2A 3DDCB 2AUJD 4C1NK 5BN3A 2GI9A 1B70B 5C3XA 4A3BB 2BTEA 4EE2A 2LRUA 2YTYA 3X3MA 1BNZA 2ZNVC 2PCFB 3S9WA 4JCVE 5JPNC 2KDFB 1OEYJ 3RNAC 1EYCA 1TXYA 2Z6KA 2GRIA 2F4VQ 3T3OA 3KQ4A 1NUCA 1TWAB 2E2IH 2SDFA 2AKWB 3PUZA 3FHWA 1BCPB 2MO0A 4M00A 4ZRJA 2JWZA 3KFUA 2L83A 5DPRA 1VQ9A 3NSWA 2CCZA 3QO2A 5JZEB 3HKSA 1KM7A 1OTRB 2LFIA 3N9YC 2C7MB 3ULPA 4HTHA 1WVLA 3ZUNA 4HKQA 5C4XG 3EBEA 3ML8A 4G0NB 4BY7B 4IDIA 4HJ9A 1QJOA 5M3FG 3B1LX 3I5JC 1L2FA 1MIUA 1XTCD 3KUDB 3RNBC 3GTGH 3TP7A 3K9PB 4L5TA 1VQ7A 4ZLTF 3BK1A 3SHQA 4RMFA 1FXIA 2A5HA 1PH5A 4B3TQ 1YJ9A 4KMUC 3HM6X 4RM8A 3C1EA 2BQQA 3HK0A 1WJ6A 2B2VC 1EZ8A 3Q8CA 4IFDJ 3HOVB 1S4ZA 4DV7L 1TWFH 2YEPF 2KWDA 1LTLA 3WCQA 1Y1VB 2QGQA 3VVWB 1TS3A 4YY3Q 4LCDE 4K5WA 5C3JB 4B08A 2DZJA 1HUMA 4RG1A 1YJ1A 1BF4A 4K3BA 3CU7A 1XNQL 2D11A 2WB1G 1K8AC 2K39A 5LL6S 1PYWD 3H6MA 4IM0A 4GDLA 4C3HH 1HNXL 5IT9E 1AW7A 1DGJA 3K5OA 3WAOA 3VTUA 3TS0A 1O7ZA 3H0GB 1PH7A 1K83B 4P72A 4BKSD 2B63B 1IW7D 2B2WC 1E7UA 1Q82C 2L55A 3PQIA 2RGFA 4DNRB 4H2AA 1JRPA 1OTCA 3VDYA 1QLBB 2BS2B 2G5DA 2PQAA 2D9UA 5KRUA 3RFZB 1BOSA 3C8YA 3PCOB 4R1JA 3E3XA 3LX0A 1Q46A 2E2HB 3J81E 4PMWA 1HR0W 2WDQB 4OZCA 2DZMA 2GBJA 3ZYYX 3I90A 3AEGB 4PYZA 4NJ7A 2KVMA 2ZXOA 2FIDA 4BKGA 3LWUA 2A6HC 3K6OA 1H95A 3N30A 2BYEA 4EVOA 2VUMB 2QKIC 1WR1A 4DAYA 3FKIG 3T1HL 1J19A 3AH7A 1Q12A 1O80A 4X3TA 3TZUA 1ZPSA 2RPQA 3DVNV 1SNOA 2HT1A 2EPBA 5C4XH 2LI5A 5EQ0A 2AWTA 1E2VA 1KJTA 2VQFL 1LFDA 1RDPD 1HA5A 2FFKB 2TSSA 3ERQA 2PI2A 1V1PB 1MVKA 1E2WA 3U4EG 1J7CA 3NUHB 4LF8Q 1JICA 2DWQA 5IYCG 3STBC 4DV2L 4RH6A 2UUBQ 3TEWA 5E1FA 4A75A 4GS3A 2JXTA 4I65A 3J80E 2UXCQ 3A4SC 3CCLA 4MEMA 1I5FA 1YHQA 4TKOB 3S2DH 1WYDA 4FXDA 3IVFA 4HMJA 3HOXH 4WORA 2NVUI 2RA4A 5ELEA 1F9RA 3BK2A 1QG7A 3GTPH 2JEAI 3ZTCA 4B9KA 1O7LA 2L8JA 2K6AA 1LO5D 3PO3B 1E3PA 4FJVB 3BJUA 2ZNVB 5IYDG 2R2OA 1KD1C 3UGBB 3U58A 3MEFA 1V6EA 2M56B 1KDCA 5I2XA 3DBRB 4LFBQ 4PZ7A 3W3AA 3AEEB 5LMUQ 2FHTA 2F0KA 3GTQH 4KVGB 4AOFA 3AULA 4AQYQ 2KLGA 2WX0A 2GBNA 1BCPF 2JA6B 1HZAA 1VLBA 4ICVA 5JVH3 2RVLA 3A1QB 3I72A 3K57A 3AE9B 4N58A 4FNFA 3MXPA 3OWEB 1ENCA 4IPCA 1WJ4A 5EAYA 1NAPA 1KDAA 2K1FA 1IGDA 4C3IB 1JOOA 2W3SA 1VR9A 2D3AA 4ZRIA 1GNUA 3A8JE 4A3IB 4HROA 3RULA 2A68D 1R4QB 1VQBA 3E5SA 5FO7B 3ICEA 3MXGA 3U7DA 5F2DA 4KX6B 4LTUA 1DOXA 1LM0A 5FK9C 2MJ8A 5H8YE 3MC0B 3S17B 4NPNA 2QF7A 4OIKA 3TEYA 5I9PA 5J1ZA 1IBLQ 1CI3M 1N33Q 4A20A 2Z0SA 1ET9A 3AE4B 3FKIH 1UNSA 4BXXG 3CCEA 2EJFC 5G55A 1J7AA 2ZTDA 5J18A 5DPWA 3O65B 2R92H 1NSNS 1TS2A 2B3GA 2K5NA 1F1HA 3CSFA 3A9KA 1JQYD 1WM2A 2KKCA 3IBEA 4MH0E 5HI1A 1TIID 4LF4Q 3S14B 3S16H 2INCC 3ZKJC 3M7GA 3WOEA 4ZK9B 4X62L 2NPTB 4GLAC 3DLLA 3NBHB 4NXNQ 3NVWA 3RZOH 3PGEA 2CH4A 3HM3A 4RGTA 3NS8A 2UYZB 4EQNA 2IL8A 3PREA 3CCMA 2PJHA 5AEKB 4XTCS 1A0IA 3BZKA 1EY6A 2CQOA 4CDEC 4DR1L 1MHXA 1QOBA 1TS5A 3JAML 4NAWA 1STNA 2AL6A 2IDYA 5T1IA 2RR9A 5EJWA 4GN5A 2HHHQ 4W9IA 4ALPA 5C0XJ 2C60A 5EE3A 1J8CA 4HCPB 4K2LA 3F2UA 3M62B 3A7LA 2ZZPB 5IYDH 1II3A 2BA1A 2PW5A 2WFWA 3DWAA 2KQ7A 3NPPA 5JJZA 4NZLB 4DR6L 4KV6A 1UBIA 4MGIE 1KAWA 1R9TH 2KEDA 1F2RI 1FNVA 2ZM6Q 4MT5A 1F2ZA 1IBML 4K8JA 2QSDA 4N9PA 4DPGA 4GNXA 1VQ5A 1UWXA 4MZ9A 2G1EA 3L13A 2A6ED 2B76B 1T0SC 1FFUA 2XK5B 5E6JA 4BBSG 1P1AA 3K0XA 4NXML 5M5WH 2F0NA 5J3BA 3SR6A 2R7DA 1TBEA 2WXPA 3T4AC 3DWGC 2OTJA 4HN7A 3K5MA 3T8MA 4OHJA 3P63A 4HCSA 1RKNA 1G2TA 1K3BC 3B9JA 3PZ7A 2H88B 1IZ6A 1I6HB 3KW5B 5JVG3 4AIMA 4BKSA 4RGNA 1E7VA 4BXXH 1IPGA 2ZJQA 1QKZA 4HXDA 1DOIA 2VZAA 4DV5L 4RHSA 2BS3B 2N1WA 1A3UA 3DEOA 4HPPA 1AEXA 3MTNB 2F0HA 2WHIA 2K5DA 2CKHB 3K7UC 2ES2A 4LUZA 1A2TA 3K8AA 2YU9H 3PIPA 1LTRD 4LFCL 3E9IA 3I4MB 1LUZA 1CSPA 2IPKD 3A0JA 4LWCA 2O6VD 2WXLA 3MA2B 1M90C 2A8VA 2E74C 5J2RA 2JPHA 1YN5A 3RN9C 5K5PA 4JOIA 1BUIC 4MACA 4X66Q 2Q8RE 4DK6C 3KYDD 4LJPB 1VQAA 3T9LA 4POFA 2UU9Q 1N63A 2E2IB 2EY2A 1W3SA 1LT4D 4HMIA 4KHZA 1VDZA 2NVYH 2JQOA 2VY3A 3WA0A 2F0WA 1P7FA 5D14A 3TUOA 1P16A 2K7VA 3I7FA 3ZQ4A 3GTLB 1OGWA 1NY4A 4OX9Q 1SLJA 3M63B 2KANA 5LXHA 3U4ZA 2FBWB 4I6NB 2CH4W 4RWSC 4Q2JA 3RT3B 2BH8A 4X64Q 1AZQA 1QVGA 2PQEA 1BDOA 1STAA 1JMCA 3NK9A 4K0KQ 1A6XA 2JZPA 2LWPA 1X3FA 2KBNA 1PH1A 3R66C 2R61A 3PUYA 1QOAA 3W5OA 2E8GA 5M9OA 2MJDA 5JXVA 3MFYA 1SROA 4BBSH 2CKZB 2L12A 4IUUA 1ROEA 3QAQA 1DM0B 1P0RA 2K9XA 3G71A 4HK2A 2HD3A 3DVGX 3OAWA 4URKA 4OZAA 1BVSA 1I3QB 4N9TA 1FD7D 1OXUA 1HXYD 3OSOA 2JYEA 3GE8C 3H9DA 3CMMB 3V61A 4ZHOA 3E0JA 1VQJA 4N8X1 2E2DC 2WAQE 2B2YC 4C3JB 4A3GB 1ICFB 1H9SB 1GB1A 3M4PA 3I4NB 2B29A 3K59A 5IIFA 1B53A 2ZPYA 4REZA 2H1EA 1P98A 5DLQE 3IKJA 3DM3A 2LGYA 2XRSD 3HKZE 4HJ7A 3GTOB 1FVIA 3V96A 3C2PA 1T0QC 1FRDA 2N7JA 2M8SA 2EYPA 4R4TA 4YWKA 1FRRA 3TBIB 4BY1G 1VZ7A 4UP7A 3MWYW 1Q10A 2HE7A 2ZCCA 5CTRC 2FXQA 1RM6C 2EMSA 4P1BC 4B3SL 4G7HC 2MX2A 1PTOH 4A3FG 3C19A 4H0LC 4X57B 3QOLA 1Q3LA 1Z7TA 3RR5A 4ULLA 3R2IA 5CYUA 1RD9D 2V0GA 3ZJUA 4RKBA 5C2TB 4E3CA 4OIJA 4DV3L 4KDLB 1XWEA 3ZNGC 4JI8L 4DR4L 3A9JA 2RF4A 2KHJA 2BVCA 3NTHA 3PSIA 5KGUA 2ASQA 2L52A 4GU2A 4RF1A 2I2YA 1RJTA 3PGZA 2X38A 3KOJA 3HIZA 5EPKA 4JBKA 1JB3A 2JEBI 1IXRA 1T5EA 2MQHA 3CRKC 1N5WA 2ZT9C 1C8CA 3MHSD 2PMVA 4GOPC 5AZGA 3K81C 1B2TA 4YCWA 4IFDG 1F9PA 1KQSA 1PGAA 2IZVB 4LMQD 3CCUA 3EROA 2NYZD 2Z4IA 4AJYB 2INNE 4L23A 4W9HA 4HAEA 1VS0A 1ENAA 1F77A 5C4XB 2C9WB 3H94A 1X65A 4G7OC 2EKIA 1JOKA 2SEBD 4J6IA 5IGBA 2NZHA 3IFTA 1A3VA 4R4CA 5M3FB 4JI7Q 1C79A 1PXUA 4AQ7A 1WJNA 2WXNA 2A74C 2G9DA 4RFBA 4KSLC 3W5UB 1CK1A 3Q8BA 2Z4HA 4ZDVA 1TWGH 3DEPA 1GC6A 1HZ6A 1Z47A 2L7RA 3ALBA 3CKIB 1CKNB 3J80i 4WQMA 1TTNA 4R4OA 1CA6A 2JYTA 2Z6KC 2JWUA 1JWAD 3KYCD 1PRTD 5E4XA 1SBBB 3GTJH 2QDFA 2VB3X 1SE9A 4N8FA 5AZFA 3ZIMA 1JWMD 4L5RC 3NTKA 1WCMH 3CF6E 3AU7A 1QUQA 4IO9A 2JA8G 3ZRCA 2WB1B 3H8HA 1STGA 3ZGZA 4M0WA 1VMCA 3AB9A 2MEKA 2KK8A 2JJQA 1L0YB 3QX1A 4RMAA 4FJYA 1NR4A 1TU2B 3Q24A 3KLRA 3Q6BA 1QILA 5HFYA 4KKTA 1UWVA 4A3FH 2XBBC 5CV9A 1Z2MA 3WAMA 5E6NA 4J15A 3OTOL 1CSQA 4IOAA 5LHY1 2I38A 1XLNA 5DPTA 1KRHA 2Y3AA 2K03A 1UE1A 3SK6A 5LMNW 2JA5G 1EZ6A 4IG7B 1V5OA 2JT4B 3MP9A 3N1ZC 2CS4A 1T0YA 1Y8OB 3MVVA 3VR8B 1KFYB 3K80C 2QCZA 4FHJA 4EKUA 1SSNA 3H91A 2MO1A 4EQPA 2Z0DB 1SFOH 4JIOU 1G2SA 3GE3C 1AE3A 1UUPA 4GGQA 2Y0SB 3PZDA 3S1RB 4GMVA 1QB5D 5FLXc 5BN5A 2MSED 5C4JH 4JI2L 1J6QA 3AMUA 2M0XA 1GUNA 2QIEB 3CP0A 4CQNA 1A63A 1GPXA 4IFDH 3ZXRA 4YSXB 1JB7A 1U4LA 4FF1A 2E75C 3BZDB 1GXDC 1FM0D 3SDZA 4KD4A 1N34L 1LTAD 2MGSA 2BB6A 1UGMA 3WDNA 4JV5Q 3RLNA 4ABNA 2JSOA 4DV1L 3WOFA 3ULJA 2GVAA 2WAQG 2Q2TA 1NBFC 3EIVA 1MG8A 3DCGA 2L4NA 3KJPA 2K6QA 1PZID 3MJ5A 4DK5A 2D0OA 3HKZG 2HTHA 1SYBA 1IYJB 3VUWA 2ICIA 5ELDA 3GZNI 5J17A 3E56A 4A90A 4C7ZA 2UXDL 2ALYB 4EQOA 1R7SA 1TWHH 4KD3A 5BR8L 1E7PB 2NVTH 1P9DU 1IBKQ 1XLOA 1UE5A 4DN4M 3F2CA 2LEKA 3LYYA 4C2MB 2DNFA 1NR2A 2K5WA 2SAKA 4A55A 2GN5A 4A3MG 2BDNA 1L6VA 3PIP3 4GOPB 4JYAL 4Q0FA 2L1BA 5IY0A 1PH6A 3BYYB 4OONA 2O5IC 3MZ5A 5JOBA 2RHSB 1IYVA 1NNXA 1SYGA 3W1GA 3ZJYC 4LF5Q 4POGA 3MC8A 1RTOA 3I73A 3P4RB 4F8MA 4AYBE 1A3TA 4IWPA 1D8LA 3AEFB 1CZWA 4OO1I 2K05A 3FP9A 3SD5A 3HEJA 3TRZA 1YX6B 1EU4A 2A73B 4KK7A 1YNNC 2RHQB 1XYIA 1YNJD 3M3YB 1WH3A 1EIYB 2WX1A 1H8CA 1E8YA 3QWZB 1E6EB 4B6WA 2LXKA 4LF7Q 4V190 1HR0Q 3JW0X 3D6WA 5LLIA 4DK3C 4A3JB 1JROA 3PHXB 1X9NA 2N78A 3UE0A 3SVMA 4DWFA 5IAAC 2L5TA 5C0XG 3HHMA 4B9XA 4F1SA 2PVOD 2FUHB 3SE0A 3BS1A 1EQTA 4JI1L 1ONLA 1RFKA 4PS8A 4NQKE 3GTMH 3O13A 4DR7Q 1SYFA 2O2LD 2KFKA 1VQDA 4ZRZA 4OELB 3V3XA 3LB8C 2AEHA 4QIWE 2R93B 5A2QL 2V3NA 1STYA 3HOYG 2KX3A 1C4QA 4RAUC 4A3KG 4GZYC 2FCQA 3J7AV 1J5EL 2K6DB 3CW2C 2BBCA 4LNFA 1WGKA 2V1YA 2X6GA 1FPYA 5T1GA 3QARA 2MP2B 5HGTA 4LNOA 1WFQA 3S1QB 1S3OA 3ER0A 1PH2A 4J3OD 4LJOB 3MXUA 4XZ4A 5KHOA 1IBXB 3J7AF 3EUB2 1HCZA 1B4OA 1BBUA 5IGGA 2ZXPA 3BG3A 1IP9A 1FNWA 2XNAC 3VYRA 1HFGA 3CQZB 4GKKQ 1HE8A 2N9KA 3Q0AA 1YNTE 2D2QA 3JC66 1QZHA 3NZ3A 2EY1A 2PZWA 4A3MH 3H3VC 4RM9A 3P1MA 3D6CA 2PIAA 3EFUA 5BYRA 1ZYRC 2Q2IA 2RDGA 3QIAA 4WH4A 4ANUA 3T13A 4DHJB 2I0QA 4X6AH 2GA4B 3N1XC 4O42A 3G6EA 3F2DA 4F87A 1MG4A 4O1NA 2ZTCA 2KN5A 2JSVX 1F9JA 1IYFA 2KJXA 5IT9c 5D65A 3PO2G 2MBOA 1N36L 2BE5C 3AFQA 4XT1B 2JA7G 4GKJL 2N0SB 4ZOHC 4A3DG 3IFDA 4RHRA 1EYGA 3KUCB 3DHHC 4CJ0B 1DYQA 2KJRA 1HNWQ 3HVDA 1B1ZA 2YTVA 3PUXA 1LT3D 3AE2B 1CQVA 3DBHB 1JJGA 1TGZB 3NS1A 3KLSX 1ZEQX 4BA1I 1JMLA 3KF8A 4JC0A 2IW3A 1HZ5A 1BCPD 3J81c 1E90A 1LTBD 1X56A 3TQYA 3ZO5B 1C0AA 2EJGC 4IPDA 4KDIC 2LY7A 3CSTA 3MJWA 4XDCA 2IBIB 1AH9A 5C44G 2KHWB 1MGSA 4C3HG 4A3KH 1LABA 1FL0A 1WE6A 1PGBA 2WDVB 2EVBA 4DF7A 3M4YA 3VR3A 4GLXA 4DDGD 4R4QA 5CR3A 3EJIA 5KYLA 1YBYA 1NTGA 1B50A 2CHXA 1D1KA 4DKAC 2JU6X 4L5QA 2PO4A 1I94L 1CA5A 1TT2A 2EJMA 2IJ0A 4TVAB 1FNUA 3L9AX 4A3OA 1VQIA 1SMYC 5GAGC 3F2BA 1WZ3A 1X1MA 3AM9A 1OXTA 5EKKA 2K1BA 3J80c 1N32Q 4ZRQA 4X65Q 2K04A 1FGUA 3OMGA 4E6IA 4WJ4A 1I6VC 2OQKA 5FJ8H 4KKJA 1DGSA 1TYGB 3AEBB 2WYQA 3PT2B 1A5RA 3AEDB 4CKEA 5TSSA 4ZRKA 4KJNA 4DR5Q 3APFA 2PYKA 2RPVA 2OJWA 2A69C 4AYBG 1QWYA 3SEBA 1NYQA 5JJLA 1WTHA 4WJOA 1WZ0A 1HA6A 2EIFA 1TKGA 2FUG1 3P7JA 4YHHL 1Q7YC 1UAPA 4JI5L 3PS6A 2IGGA 3P1HA 3QJYA 3GTKH 3KDFB 3CIRB 3PUVA 5CV7A 2AL3A 1MKHA 1I4GA 1Q8IA 3DBSA 4DUYL 1CHQD 3PO2H 4K7WA 2JA7H 2EMTA 3NE5B 3R8BA 5EBCA 1UGJA 1I42A 4A3DH 3RZDH 5K36G 1JOQA 3DXJC 4PMCA 1XLQA 4E71A 4W9EA 2LGXA 3L17A 1HTLD 1QOFA 4EZJA 3Q8DA 4PMBA 2L11A 4CGYB 2D5GA 3JSVA 2CWPA 2EY5A 2D5DA 4JI3L 5IP7G 5FLMH 3HOXG 4CJ1B 3S2HH 1WGHA 4GB9A 1VQNA 2Y5CA 1WF9A 2VH1A 3QJZA 2O2VB 4NAMA 4IM2A 4FXKC 2MCNB 1SAPA 4BY1B 4XQQA 1FXAA 1CFMA 2HUGA 3KF6A 1SJHD 4WJ3M 4CJ2C 1PH3A 3VUYA 4M8AA 5TR5A 3GDEA 2NBUA 2WXOA 4LF6L 2JQRB 2WWZA 2OTLA 1VRAB 1JW9D 5C44H 2LXCA 2VXWA 2FINB 4LJZC 2AX5A 3ZJTA 4PG3A 1IKMA 4FF4A 4A3EH 1BBXC 2EY6A 2ZXRA 3V2TA 2GBMA 3UDIA 1SE3A 3NVZA 4C7YA 4KHPQ 2EELA 2XEWA 4A93H 4TRDA 3LDZE 1NE3A 1NENB 2EZVA 4LDTD 4RNAA 1GJZA 3S1NH 3SXHA 1DOKA 4DV6Q 3FPUB 1WTPA 2XTIA 4H13C 4IJLA 2INDC 3Q3OC 2VQEQ 3P20A 3CCJA 1HNZL 3RUIB 2CHWA 5ELNA 5H1SE 2MRPA 4FN2A 4JI0Q 3CF5A 1U4MA 1HJPA 2CQAA 5EKIA 4MJSB 4K1RB 4C4VA 3UIPB 2NUCA 2L15A 1XPRA 2IHFA 1EQQA 3RZFA 4MN3A 1P3QU 4B0EA 2R92G 1W6JA 5LXIB 4QQBX 1GC7A 4FLHA 4JW0A 2DZKA 4W9DA 3BDOA 3C3LA 4DUZL 4YSZB 2DBYA 2AYOB 4LAAA 4ODGA 4QL5A 1CKOA 3APCA 2KWUB 1NBWA 3UI2A 2B2UC 2F52A 3ULLA 4EUTA 2RKSA 2RSUA 2QJLA 1JJCB 4FF2A 2C5LC 1RIPA 4DA2A 5CV6A 1Q81C 2KUMA 5K36H 1V86A 4FYDA 3AE5B 3VRAB 3IXSA 1SXTA 4DR4Q 1C1YB 2JUOA 1ZE3D 4HDOA 1VQ6A 1C9FA 2ZPNA 3K58A 2IY0B 2IWHA 1KAAA 1RWSA 1RF2D 5IP7H 5J39A 1HZ9A 1VQHA 1K51A 5I9OA 2J42A 3FILA 2PZUA 1XMOL 2WLBA 2JA8B 3FKYA 4NY0A 3D4WA 2RCFA 4BKTA 1PHJA 1HUNA 3IT4B 2W3RA 5IGEA 2FAZA 3HVZA 4XX5A 1ZUD2 1E8WA 4IOCA 3AE7B 2QC8A 2PI2E 1WR6E 3DVNU 4A3CH 3PLUA 5J22A 3UDGA 1M1KC 4JI4Q 1YHAA 1TY0A 4DHZE 5FO9B 2M17A 3KLWA 2EXDA 1BO0A 2AUKA 2M9VA 3CCSA 1VQMA 4ACFA 4JK1C 1EYDA 4KGTA 1WD0A 3AN1A 4H44C 2Q8TA 4LF9Q 2JA5B 1D5XC 1QNUA 2BPSA 3DM1A 3PLVA 2VL6A 4OWWB 1E0BA 1L0VB 3CC4A 2GVBA 1Y8RC 2KD0A 3W1BA 1HZBA 1WGGA 2L0FA 1ZXTA 4MHEA 2HDEA 1KIXA 2BCOA 3S15H 2KXJA 3C0RB 4LNQA 2KA7A 2QEJC 1Y14B 1GUWA 2SNSA 4BWGB 5C5MA 1UE6A 4FXGC 2E2JH 2EYJA 4QUFA 4XYOA 4DV4L 2C9OA 4CDCC 4HWIB 3NVVA 4TQUS 4G3XB 4MTNA 1VCBA 4D2KA 1WTWA 1SB3C 2UXBQ 3TP8A 5C3EB 1MJCA 2ZW1A 3P4PB 2F1MA 3ZNHB 1Y8PB 3M9BA 2KTRA 4R9WA 2A6HD 2NTSA 3EVQA 1Y1WG 4JI6Q 3VRBB 4Y7NH 4MDKE 1GD7A 4FO2A 4ASWC 1NJIC 2WAQB 4YCVA 4R8IA 1U5KA 1PDXA 2K0PA 5DM63 2MBHA 3TEZA 2MH7A 1IL8A 3E9HA 3TSSA 3N1YC 3HKZB 1YNXA 1DOYA 1PFMA 5IP9H 1ESRA 4LLGM 1KLVA 1M8AA 2A19A 1SYDA 5E6OA 1I50H 3SK5A 3A4RA 3KUPA 4HIKA 1F2MA 1G8ZD 3MEHA 1WX7A 1LTID 1KOTA 2V3SA 1K3RA 1DJRD 4YXDB 5L83A 3M95A 5IT9L 1V2YA 1UZXB 1TWCB 4FXCA 4CDFC 5BMIA 5I4DA 3RI7C 3U4VA 1I4HA 1ICWA 2K25A 3Q69A 2ID0A 4NB3A 3TS2A 2HJ8A 1H9KA 2M00A 4DV0Q 1Q86C 4CKCA 2YTXA 1XNRL 3TJPA 2E5LQ 1WTXA 1Z5SB 1WTRA 2LKVA 3J81L 2FIFA 4WWMA 2ATWA 2UUCQ 3OJ4B 1S72A 2KMCA 3NG0A 4HVBA 1XMQQ 1K8MA 1GM5A 1YD8U 1FJGQ 2UUAQ 3J81j 1PH9A 2EDGA 5LMNQ 3HP3A 2KACA 4ZRPA 4IALA 4RGOS 2E6XA 3EECA 2D07B 5IGCA 5KIXA 2NBVB 3T1YQ 1SF0A 5JEAH 1T5XD 3N32A 1IGCA 2R3ZA 1V80A 2KO3A 1BQQT 3B08A 3SGIA 4OVZA 3QOJA 3CXCA 2J52A 3NUCA 4DDID 1S5CD 3X3NA 4GN3B 2B2TA 4YCUA 2EYHA 3LGJA 5M5YB 2ZCBA 2PNRC 1VF7A 1PV4A 2RDFA 2WP8J 1XTDA 1E0ZA 1MSHA 5M5XH 1V9PA 4DR2Q 2CJOA 4EZKA 4BVUC 3J80L 2FCSA 4CHKA 3HOYB 1VF5C 2N9XA 2XVSA 1YZ6A 2QEXA 1Y1WH 2JZ3B 3HUIA 2PMZE 4J6HA 4JYAQ 2REXA 1VQ8A 2Z8LA 3SFDB 1EQVA 1HQRD 2MNAA 4JGHB 3HOUH 1EIHA 1ZKHA 1VQLA 1J8IA 1L1OC 3ND8A 2DJFC 2F4VL 3OG5A 3RNEC 5ELFA 3NJTA 2BYFA 3QQ8B 3VUXA 2K5QA 5JPMC 4C00A 3M4OH 4S3SA 4DR3Q 2LGIA 3JYUA 1V8QA 5FR6A 1D3ZA 2LVOA 1WXAA 4K6LA 4MNOA 2NZOA 1GB4A 1Z6HA 1N62A 2F0JA 2PPHA 3AU4A 1MHWC 2RDHA 2KDIA 2WXFA 3A1QA 2NB0A 1AZPA 3HOWH 2R2QA 3IAS1 3RD4A 2LGDA 2NN6I 2JX5A 2WXRA 3DMUA 4B3MQ 2L1AA 3BDLA 4I7AA 5BO4B 3BINA 4IPHA 1WXQA 1WGDA 2N49A 3HOZG 1HRJA 3Q8FA 2KHSA 2OEDA 1KNAA 4JVZA 1WD1A 3GV3A 3Q6SA 1D7QA 1WWTA 2KECA 2F0LA 3NEMA 4P71A 4ZQ3A 3W2DA 2R7ZH 1C76A 2NVXH 1ZP0B 5IN7A 5M3MG 4R8NA 1X3GA 1V9JA 5IOCA 2WDTB 3DBRI 2MQJA 4B3TL 4WWPA 1Q90A 4WJQA 4DQOC 1GG3A 3A7AB 3A56A 3PO2B 1W6KA 3CPWA 3GTGB 2JA7B 5E4WC 2QILA 3DUZA 2XWJB 3VXWA 1PH8A 3DBLB 1PZKD 1KTKA 4GIVA 1QQRA 4DXAB 2NZ1D 4OGQC 5BYQA 2B2VA 1QE6A 4A8XC 4YY3L 3AE1B 3JVZX 3DQVA 4O2DA 1WYGA 1N9WA 3MXNA 1HPCA 3NVYA 1C3TA 2BWFA 2IO0B 4N6EB 4UDUC 2I5MX 2NPTA 4P1CC 3NBHA 1TWFB 2INPE 1H9RA 3ONSA 4PQXA 3W1SC 3Q22A 2IYDB 5HGQA 2FCMA 2ZTEA 1WCMG 2WKCA 3NQIA 5IWAQ 4WURA 1SDFA 4IWQA 5AZHA 3KBGA 1Q1OA 3H1UA 4OZBA 5C44B 5G3LF 1LGRA 4BY7G 3IL8A 2O6VB 4C3HB 1GUGA 5A35A 1VD2A 2B2WA 1U4AA 1ILQA 2VZKB 1KABA 5HHDG 3M3JA 2KHIA 1VZ8A 1ZGUB 5KEEA 4OEMB 3Q8EA 2ZJRA 3NBIA 4DAMA 3CPFA 1FCCC 3G6JB 2WXIA 1E2ZA 3Q3NC 1SEBD 4QF4A 2Z9HA 2IT1A 1SMXA 1YX5B 1QVFA 2DX5B 4G7ZC 1WTOA 1N36Q 1K52A 3N6RA 2BB5A 2RBMA 4MIUA 2P5ZX 1GAQB 2XK5A 3QR8A 1HTOA 4IC7B 3I8ZA 2D0PA 1G6JA 4L8JA 3BWUD 3B0AA 5I6WA 3A5ZB 4BBRH 4ARIA 3U8ZA 1BXTA 2F0UA 1QF6A 1YN3A 2OCEA 4L63B 4LFAQ 1MD2D 4A3LH 1BUVT 2N55A 3ECIA 3KK7A 3V62A 3VH4B 3D4RA 4KIKB 2LUMA 3TMPB 2SNMA 3HOZH 2F3VA 3I3CA 3VYSA 4AYBB 1H9JA 2PW9A 4YWLA 1EWHA 2UUBL 4ANWA 2NVQH 4B3RQ 1P8LA 2UXCL 1YN4A 4IUQA 5M3MH 1MI2A 2V1CC 4DFAA 1UE7A 1PH4A 4ANVA 4KZCA 2WS3B 4A3BH 1WTQA 4EOYA 4MSQB 3D31A 3VTWA 3KBXA 2KNBA 3GV6A 1D2BA 4R4IA 4YT0B 3QWNA 1B8AA 3AB5A 4EEWA 2JK8A 3CCVA 3S2DB 1CJEA 4NJ6A 1TWAH 3AE3B 3HOXB 4OL7A 4YWGG 4USAA 3GTPB 1L1OB 4LFBL 5LMUL 4CYEA 2XN9C 2LGSA 1ZW7A 3RMKC 2ASBA 4QIWB 4AQYL 2B8GA 5E6PA 3OMCA 3V05A 4RCOA 1AFPA 5EPLA 2BKFA 1WRIA 3DVGY 3GOEA 3ZDTA 2L05A 4ZCKA 5JHBA 1U0LA 1A62A 1X3QA 5AFWA 3GTQB 1SGHA 2K5PA 3PSEB 3NWTA 1VQKA 4BY7H 3H7PA 2NS5A 1LYLA 3GQBA 4X3UA 1CM9A 1J0GA 4EQ5A 2K33A 5HG2A 2H4OA 3DWPA 1HEZE 3VR4A 2BS4B 3AYHB 4EGVA 4J8QA 2G45B 1TZOA 1WYWB 3AE8B 4W9LA 2JA9A 2LUEA 5DCNA 1G91A 2YYZA 1FFVA 1IBLL 1N33L 1UELA 2TMPA 3EFXD 4FBJB 1QNKA 4EX5A 2MP1A 2K8HA 2FJ2A 1OQQA 1LTGD 3HOVH 5IP4D 1G6PA 2X6LA 1U4RA 1CTMA 1Y1VH 3BDCA 5C6AA 2N1VA 3CMAA 1MJDA 4MGKE 1ZOYB 4LF4L 3I56A 4LNKA 4CO7A 4QB4A 3FKIB 2K75A 2OXPA 3NELA 1FIQA 1WMHA 2R92B 3BVZA 2DYMA 3PO0A 2BYTA 2E76C 4DV7Q 1D5MC 3FPPA 4NXNL 1K9MC 1XPUA 1K8OA 2CW0C 1QOGA 2C5CA 3I9V1 1NCVA 1PFNA 2H5XA 3U50C 1LM8B 3APDA 3S16B 3H0GH 3OLMD 1K83H 1H9SA 1XNQQ 4RA8A 2KJHB 4TMAB 3R7QA 2B63H 4HPMB 3ZNZB 4QMGA 1C4PA 5CMDA 4A9AA 1EUJA 3L3OC 3UQAA 4C3IG 4GDKB 1HNXQ 3RZOB 2IGHA 3UQBA 2F03A 2E2HH 4N9F4 1FXTB 2I1KA 2MW5A 1LV9A 4F88A 3BVMA 2LD9A 2PNHA 1GO3E 5EDSA 1XJVA 3H7SA 5JEAJ 1X55A 5L37A 4IM3A 1MI0A 3PTFC 1HZCA 5HURA 4NDXA 3PIO3 2VUMH 2N3SA 1CKMA 4P74A 2GBKA 1PTOC 5IGFA 2WDRB 1HH2P 2HQLA 1ZDXA 2PE6B 1EO6A 4HLEA 5AUIA 1R9TB 4ZUIA 3X23A 2X8XX 4PV1C 5CC4A 3T1HQ 1MBYA 4XDXA 4MM3A 1E10A 4K6DA 4BS9A 3ZRFA 1ESFA 1Q5WB 3W9CB 4BZAA 4P73A 1JWUD 3P42A 2KDMA 4KY5A 5M5WB 2JN4A 2VQFQ 1WIAA 3TIXA 3T16A 4C56C 5DEHA 1ZXIA 2N8NA 1E1OA 2KC2A 2CHBD 3GP7A 1V5TA 4XYCA 3PUWA 4DV2Q 4JWSC 4KY7A 2NMQA 2KCTA 3L10B 4LW1A 3PO3H 1F2YA 3P4SB 1I4RA 3E6ZX 3ND9A 1YJNA 3NZSA 5KNCA 2JXXA 2RSNA 2HIVA 3U30A 1CMXB 1WI0A 1Q1EA 4ZKBB 4NNJB 2MBQA 1DONA 1B9MA 4XDDA 2KAJA 1CKNA 2K8BA 3GD7A 2IO3B 3LJ3A 2JA6H 2K22A 3BIID 1EWCA 5CV5A 4X66L 3SU8X 3PHWB 4IKGA 2E3TA 2UU9L 4C3IH 4HEDA 3LNNA 2YU9B 3TL5A 3D32A 3V6EB 4A3IH 3DHIC 1WX9A 2NCNA 3A8KE 3FDTA 5D2MB 1JJ2A 2KVRA 1EUVB 2WNMA 3N3KB 1GHKA 2CR5A 4XQJA 5EBDA 5CV8A 4M8NA 2R7FA 2FE8A 3S17H 1JORA 2WXQA 4OX9L 1WM3A 4JX1C 2YV5A 3WALA 4GLSC 4EZLA 4X64L 1ILPA 1H4RA 3KH0A 2NVYB 3SDLC 2W82A 1N8RC 4K0KL 2AQ2B 3R93A 3J7ZC 1FEHA 1WI5A 1SNDA 3UE1A 1GUAB 3K5NA 1OQRA 2N9EB 3VR5A 3W5VB 3Q14C 1RYJA 4XYQA 5FJ8G 3S14H 4WWNA 4C80A 4KY6A 3OJ3A 4UAIA 4IURA 3Q3FA 1SNCA 1VQEA 1ML0D 2DGYA 4A76A 1SNQA 2LRWA 2ZJDA 1PVOA 4ANXA 2IY5B 5D7GA 3A33B 2LXAA 1SN8A 3R2TA 3C46A 1UF0A 4BBSB 3KF6B 2OWOA 1L7YA 2NBWB 2F0PA 4NP5A 2M2LA 3QIJA 2KTFA 1BBWA 1JE5A 3L54A 4X62Q 2F0FA 2RCNA 3OW7A 1YOVB 2FNJB 4GDLB 3OOCA 3ZJVA 3N52A 4IQZA 4WRDA 2C7HA 2LHDA 1E7ZA 4H02A 1KNEA 2F0IA 1NI3A 1STBA 2M4NA 1WTVA 2N88A 1EF5A 4DR1Q 2JRHA 1V1OA 5FLMG 1K8GA 2Y0SE 1TVXA 1RRBA 1X3PA 1XXGA 1AN8A 4GLVB 4J1MA 2PQAB 2IO2B 4YTPB 3TBLD 4OW0A 1YNND 1Y56A 2OOBB 1UEAB 4ME3A 1KHIA 2Z1CA 1TS4A 1MPEA 2V4IB 3RN2A 5C23A 1DXMA 2MJ3A 5BMGA 1I35A 1K0SA 2VH2A 3UDFA 1KLUD 4GNXC 4DR6Q 4WJWA 1PTOB 2D62A 1G51A 2BW2A 5IGDA 1IBMQ 3IFWB 4JG2A 3UIOB 4DAYB 1VQPA 5FR3A 4P16A 2KEEA 2LXJA 4A3EG 1B44D 5C1ZA 1V49A 4NXMQ 3UDXA 4A93G 2L0TA 4A6QA 2ZEQA 1IUEA 3EN2A 3T3NA 2MBBB 1KH0A 3GS2A 4IOIE 1S5FD 1TY2A 4A3GG 4WIPA 3MHZA 2KCMA 1GUOA 1I6HH 1C4CA 5D6JB 3IT6B 2OF1A 2XRQD 1EWIA 4ILWA 1XCTL 2PTLA 2LVPA 4X3KA 2ZW0A 1G291 2LASA 3PRZA 2KCCA 3K7AH 1WRDB 1IHZA 3TMEA 2XSCA 3TN2A 1DOLA 3MFGA 3Q8AA 4MELA 1QZEA 4RCNA 1IW7C 4W9JA 4BOZB 1NDDA 4KSKC 1K0RA 4JI7L 4BAXA 3QB3A 2XGTA 4WAAA 3V6CB 1JR0D 2NVQB 5ISRA 3S1MH 4GOCA 2YLMA 1UBQA 1JQ4A 2JY6A 2F0MA 1S5ED 4OO1G 4DV5Q 2LFNA 3I4MH 4II2B 4KJOA 1ENFA 5D3IB 4ICUA 3ABVB 2LMCA 4LUVA 2MPMA 5BYSA 3AE6B 1FCLA 2KCNA 1TWGB 5IYBG 2KDBA 2O5JC 2W54A 1PA6A 4GN4B 1ZYRD 4JOIC 5E7NA 4LFCQ 1N61A 3I2ZA 2CVRA 4K2KA 3L16A 2BDOA 2PEAA 1QT9A 2MWSB 3WANA 3GTJB 5T8IA 1WSPA 3GTLH 3IHPC 1SE8A 2GLSA 3TEXA 1WCMB 2BE5D 1O78A 1CZPA 1JALA 5JJKA 4WJNA 3PZ8A 1EY7A 1C78A 4PT5A 3UF8A 1N5XA 2KC1A 2NBFA 3RUZA 2F0QA 1EY4A 3A54A 1E9MA 1XO3A 2L9HA 4UP9A 2V9HA 4IUVA 5CORA 2GOWA 1PFBA 2MP2A 4A3CG 2VB2X 3TP6A 5FLXL 4KGRA 3EQLC 1IBXA 4A3FB 1EL0A 1CUKA 1V1QA 5GAEC 3B2GA 5EPJA 5IO9A 3CD6A 2GB1A 3TDQA 4K81A 1I3QH 3H15A 1K73C 2EKEC 2HDMA 3TP5A 3A9KB 2KTRB 2KWVB 3IAM1 2EYOA 2R6GA 2I07B 1HTQA 2K8CA 3NWSA 3HFZB 2HJ1A 1C9OA 4HCNB 4C3JH 4A3GH 1SFOB 1QZGA 3I4NH 2KT7A 1Y8NB 1FGBD 3VA7A 4FP5D 3GTOH 5C4JB 1JRUA 1ISNA 1D1IA 2IY1B 1PYBA 3JAME 1TKEA 1ZKOA 4XE0A 3OIQA 4JV5L 3AXCA 1AYFA 3TCAA 2BA0A 2AQ1B 1SMYD 3DPDA 2HCCA 4NAWB 2D3BA 2A68C 1KDBA 1E22A 4L6TB 2A4ZA 3PMFA 1B9NA 3LWEA 3RNGC 5CHWA 4OO1H 3KWLA 1JWBD 4WQOB 3VDZA 2QW7A 4IUNA 1PQSA 4B3SQ 4W9CA 4B95A 3MHBA 4US9A 4QJFA 4HPLB 2DENB 5KHQA 4K7UA 5IYBH 1RFAA 3Q3MC 3SK4A 4ID6A 1F0ZA 1PTOF 1X6OA 2A69D 3M4QA 4GNXB 2MHJA 4Y52H 2ENBA 2Y0SG 4DV3Q 5IP9G 4LK0M 1IBKL 4OWXB 1WXMA 1V43A 4JI8Q 3VHTC 3I3TB 3ZDMC 1OXSC 3Q3JA 1XX8A 1T0RC 4L2YA 1S3SG 5AUKA 4PS7A 3RPFC 2VW9A 1BMLC 4QAYA 1TWHB 1XD3B 5AJ3L 4PK1A 1EEID 2PMZB 2NVTB 1WXSA 1NMFA 2QDLA 3AV8A 3DBHI 4TQ1A 4CKBA 4LF5L 4KN7C 3I4OA 1QCBD 2WGSA 3AECB 5M3FH 3U9SA 2ICEC 1C7YA 1L4DB 2GBRA 1EIFA 3HGBA 4V0BA 5I2YA 1N60A 2K52A 4IZ8A 1A15A 1ASZA 1VQOA 2FCNA 4LDTB 4R3DA 2J0JA 1C48A 1YITA 4LF7L 1HR0L 3UI3A 4IWOA 4JPSA 4DAPA 1I4XA 3BVGA 3NXWA 2CU1A 3I70A 1SYCA 3B6YA 3L0OA 3P75A 2IX0A 3R3MA 3EC8A 4F7XA 3PF4A 2FMMA 3VQIA 2PVGC 4OXPA 3NY5A 4ZYNA 4DR7L 2A6EC 1K8RB 1ASYA 4MM3B 5JEAG 4OVVA 2F0TA 3CMEA 1S1QB 5G3LD 1E5WA 4HIMA 3G4SA 1NI2A 2G4SA 2WXJA 1NVID 3VAWA 3KDFA 3QC8B 2F3IA 2K01A 4WWOA 5D94A 1U9RA 1A2UA 2VRRB 2KFJA 3GTMB 1PFSA 2WKDA 1SE4A 1OEYA 5IE8A 1GHJA 3ZW3A 2J7ZA 1OFFA 2AWNA 3AU5A 2KQ3A 3TZDA 4MTKA 4MSMB 1T3QA 2I5LX 4B9WA 1L5PA 1RTNA 3ONAB 3ZNID 3ZVVA 1PGXA 3M7NA 1WY8A 3VTVA 2O2VA 2DY7A 1RODA 1GVPA 5E3FA 2MA9B 5COYA 3HOUG 4IUPA 4KI0A 3OTOQ 1J9OA 3D0FA 1WFYA 1PDQA 2FMCA 1YMHE 2MUYA 2J7QB 3KUZA 4G11A 1WOCA 1OXVA 3S1RH 5KYIA 4GKKL 1LQBA 2CHZA 4A3JG 3D3RA 3URYA 1XLPA 2DNCA 1DCZA 1BR9A 1DD2A 2V4DA 2EYMA 2N4FA 4W9KA 3ITPA 4PNYA 3ERSX 3SK8A 3J7A5 3STBD 3I63C 1RCVD 3R7RA 3NQTA 4DK0A 3HOWG 1XCQL 1XQQA 4JI2Q 1V97A 2N9PC 1F9SA 4L1BA 1TZ1A 3MXNB 4A3MB 2C7NB 3VR6A 2R93G 1EIGA 1V81A 3VYTA 2IO1B 3WAPA 2HDLA 2F0OA 5IYCH 2MHVA 1P7EA 2KVZA 2MJEA 2F0VA 2WXGA 3F1ZA 1QVCA 1B9RA 3RLFA 2OQ0A 2R7ZG 1N34Q 1HNWL 4JQWC 3L2PA 2AWOA 5I6YA 3SR1A 1GJXA 2DLBA 4QCLA 1D6EC 4MJSA 3DHQA 3PRPB 1SE2A 4CDDC 2G9HD 4CBVA 3J7YW 3S2AA 3OHXC 5DM73 4DV1Q 2IHEA 1L0XB 1L0WA 1TIFA 4TUUA 4MGYE 2DYBA 1AP0A 3H3VI 5EKLA 4CHTB 2IX1A 4DGZA 4A4IA 2B8FA 1T6BX 2L00B 4KLKA 3RNUA 1YJWA 2A1AA 2A5UA 1XEEA 1V1PA 1G6ZA 1YVCA 4C2MH 2GMIC 1UH6A 2QHOA 4NJCA 1HFNA 3A9JB 1K50A 1XT9B 1XPOA 2KYWA 2Q5WD 3H6NA 2UXDQ 1E1TA 2RSOA 1DZ1A 2PW7A 4US8A 1SNMA 1JE4A 1KRSA 4K5XA 4IFDI 2BF8B 5BR8Q 3PVLA 1ACCA 4AS1A 3PIOA 5BMHA 2LHEA 2XWBB 4KZ0A 3CAMA 5G2NA 4IN3A 2OEOA 1YJJA 1TR5A 4NPSA 2L0CA 4B0MA 1Q0WB 1KRTA 4A3KB 2HTME 2K5VA 4KKSA 3PRMB 2H89B 3CCQA 4U68A 2KX0A 1SR3A 1FYCA 4KKUA 1W2BA 1EM7A 2DJGC 3M3YH 1N32L 1GUSA 4L5SA 4X65L 2WP9B 5FKAC 3ENEA 4LUOA 2WU5B 1O7IA 2AMCB 1YQ4B 4A3JH 4XWWA 3K5LA 2JXMB 3K7AB 4X3SA 2Z0EB 2G3QB 4FULA 3A5UA 4DR5L 2KQSA 3DWQA 4TKNA 4K7SA 2K28A 1EY5A 3R3OA 1X3EA 2OHFA 5IOIA 3LXFA 4BBRG 2D2CC 4A3LG 4KTAA 1Y69U 3S1MB 1C4AA 4HIDA 2LJIA 4K14A 2DUDA 3DWMA 1SSOA 2R93H 4PZ8A 4K8IA 1EWYC 4GN1A 4JI1Q 2XIWA 4DXGA 2B39A 2PZTA 2J4XA 2VZKD 1LTSD 1VDVA 5LNK1 3U52E 2JE6I 1QUQB 1SIJA 2LJ5A 3FC4A 1LT5D 3GTKB 1AWDA 4M0WB 4PS3A 4YTNB 2C35B 4A3BG 5DNFA 3H7PB 5CHVC 4FJZA 3S1QH 4BBNC 4A3DB 3RZDB 4ZHPA 3H09A 1J5EQ 1YIJA 1R4MB 5IODA 2LMCB 3KJOA 3KLSA 1PFDA 2JRIB 3DHGC 4G4KA 3S2HB 1KXLA 2DNEA 4JL9A 1LXDA 2K4KA 3CQZH 4QY7A 4AH6A 1PLFA 2J0MA 5FOBB 5IKCM 4APVA 3NOBA 4ZYSA 4II3B 4RF0A 2KQ4X 2CWAA 3T56B 4IJHA 2IGDA 3QCAA 1MFWA 3A8IE 4G50A 4WAFA 5GMVA 2AHOB 4KHPL 4I7ZC 5C5LA 4HIOA 2D3CA 2AQ3B 5CX3A 2KMAA 1O7YA 1X54A 1UEBA 3VA5A 1PRTC 3HRZC 1EYAA 2F4IA 2QA4A 1EY0A 4DV6L 1WMHB 3GZNB 1B3QA 3L4PA 2WACA 1B7YB 4A3EB 3ML9A 1GKHA 2RD0A 4XIGS 4NW2A 2VQEL 4HKZE 3PV0A 4HJAA 1L4ZB 1STHA 2Q8IB 4A93B 1R4NB 2KWCA 2L32A 3G7LA 4UY8C 4DBGA 4FVMA 4JI0L 3S1NB 2CFMA 2B3AA 4HSPA 1PUTA 4AJWA 3HZXA 1SRUA 1OXXK 4ZKCB 3QHTA 3U2SC 4GKJQ 3S24A 3EGRA 4OVUA 2PLPA 1SIFA 4JBMA 3FVQA 3HOVG 3I57A 3SFEB 4HDQA 4DU9A 1ZDVA 1WX8A 2DYOA 2PKOA 2V3PA 2WQYB 2W9NA 3KVFB 1Y1VG 1JCKB 1VQFA 1KLGD 1YIWA 3CHBD 3JAMi 3N20C 2BGFA 2N7DA 1C77A 2LZ6A 4H7BA 4GXBA 4HEA1 2BWES 2F3WA 1K53A 5HKHA 4LF8L 2B2UA 2BT6A 4YL8A 4M02A 3CC2A 1D4BA 1KL9A 3H0GG 3PV1A 3FRPB 2B63G 2ZJPA 4N59A 4S0RA 4AP4C 4U673 2EE1A 4O0AA 3ZLZA 3J81i 5JH5C 4OWTB 3EHVA 4UHVA 2G4DB 4A3PA 2NTTA 4ZUJA 2N9LA 2WXHA 4KV2A 3NTIA 3OYYA 3DOWA 4M01A 2BH2A 1NEKB 4XXEA 1VQ4A 1BKBA 1GOZA 1CQFA 3NHHA 1I94Q 3NENA 1HHVA 4JI4L 3CCRA
chains in the Genus database with same CATH topology
4HSVA 5DAUA 2Y5PA 5EE1A 1S5BD 3D8GA 1H9MA 5C0XI 1HQMC 2F0DA 5EE0A 5C4HA 3SHLA 3FAHA 2DY8A 2M19A 1FD6A 1XF5L 1LLRD 2I46A 4ZAIA 1VJKA 2WXMA 3E9SA 1Q1BA 1OO9B 4KN4C 3I91A 1L6UA 2W55A 4XWTA 5A2QE 1RHPA 2CJNA 1EEFD 2NN6G 3GB1A 3S15B 4YTMB 2PPBC 2E2JB 1PZJD 3U7ZA 3HRDD 1DOMA 5CGKA 1FR3A 3RMHA 2F0EA 1TKYA 4HJGE 4HRSA 4IUTA 1LACA 3OIPA 1YNJC 1I4QA 4DXFA 3GO5A 2NWGA 4Y7NB 1B3AA 1X32A 2EYLA 1YQ3B 2L1AA 1R4PB 2HCIA 3CWIA 3I4LA 2J0TD 1I50B 1PRTB 3L7ZC 1LTTD 1TKWB 2HQEA 2QDBA 1VMPA 3T53B 3BYTB 5FO8B 1UWMA 1SNPA 5D3DA 4YSYB 2ACZB 5G5HA 1VZ6A 3M85A 3T51B 2WV6D 2O4XA 2RQXA 3C1FA 2OT2A 4JWUC 1I7HA 3NRZA 3OWFA 3A55A 1NYRA 4G57A 3HS0C 2KMMA 5GXGB 1TJEA 3KWVA 2NN6H 2QCPX 2M0AA 5KNDA 5CBAE 2ONQA 3FEWX 5C4ZA 4C1NI 5H92C 4ME5A 4XT3B 5BN4A 1EFID 2VNUD 1EU3A 1J7BA 3AMZA 4XQNA 3IAYA 4YIJA 5M5XB 4DAVA 2ON8A 3K0YA 4BA2I 5MPOA 1VCIA 5ELCA 1Y1WB 4FF3A 4WFN3 2EYFA 4M1UB 2EXZA 3HOUB 2JP1A 2RMMA 1F9QA 1BCPC 3U9OA 2CW0D 3M4OB 2WXKA 1QOHA 4HR7B 3QG1A 4MH8A 1CHPD 1U4PA 3P4QB 1IKLA 1HTPA 2X69A 1CZGA 5JAVA 3D4DA 3HOWB 2JYOA 2SOBA 1KF6B 4K5VA 1V8CA 4P2CB 2EOTA 1SJED 1JWSD 2F0GA 4JE3B 3VR9B 1STEA 4DK1A 2R7ZB 2NVXB 1PTOD 1MHHE 3VR2A 1I4PA 5EE9A 5FLXE 3EA6A 1PMRA 5ELBA 1F2RC 2BOSA 2YEPB 4LK1C 1ZXHA 5NUCA 1EY9A 1FO4A 4P6VF 2B2YA 1JC7A 4Z9CB 2IX3A 4Q5VA 1YJIA 3W1SA 3B2FA 5LL6X 3AEAB 4RGMA 1PRTF 3Q23A 1EY8A 4JBWA 1A70A 3CRLC 2WU2B 3MAQA 5C3WA 1D5ZC 1F2LA 4TSSA 1EOTA 3J9CA 1SYEA 1TQOA 2CU3A 1LT6D 4RKLA 4HCEA 5KNBA 3FMCA 2LS01 1FMAD 1IYUA 5CV4A 3OPOA 2QMTA 4NMZA 1ET6A 1GUTA 2F0SA 5CBEE 5C0XH 4DNTB 4C3JG 4ITKA 4ARCA 1S5DD 1MSGA 4KKIA 1CT1D 4BBRB 4KHVA 5G5GA 4QUCA 3NP8A 2K3UA 4TQ0A 2B2TC 5EGTA 2KOLA 2WINB 2DN8A 3VYUA 2J53A 3HOZB 4NKLA 2K32A 3HG9A 1M4VA 3MTSA 3FILB 2WIIB 2KN4A 3ETRA 5M3MB 4KGSA 2AUJD 4C1NK 5BN3A 2GI9A 5C3XA 4A3BB 2BTEA 4EE2A 3X3MA 1BNZA 2PCFB 3S9WA 5JPNC 1EYCA 2GRIA 3T3OA 3KQ4A 1NUCA 1TWAB 2SDFA 3PUZA 1BCPB 2L83A 3NSWA 3QO2A 2LFIA 3N9YC 4HTHA 1WVLA 4BY7B 4IDIA 1QJOA 1XTCD 3TP7A 4ZLTF 3BK1A 1FXIA 2A5HA 4KMUC 3C1EA 2B2VC 1EZ8A 3Q8CA 4IFDJ 3HOVB 1S4ZA 2YEPF 2KWDA 3WCQA 1Y1VB 1TS3A 4K5WA 5C3JB 4B08A 1HUMA 1BF4A 3CU7A 5LL6S 1PYWD 3H6MA 5IT9E 1AW7A 1DGJA 3K5OA 1O7ZA 3H0GB 1K83B 2B63B 1IW7D 2B2WC 4H2AA 2L55A 4DNRB 1JRPA 1QLBB 2BS2B 2D9UA 5KRUA 3RFZB 1BOSA 3C8YA 3LX0A 2E2HB 3J81E 4PMWA 2WDQB 4OZCA 3ZYYX 3I90A 3AEGB 2KVMA 2ZXOA 3LWUA 2A6HC 3K6OA 4EVOA 2VUMB 2QKIC 4DAYA 3AH7A 1Q12A 1O80A 4X3TA 3TZUA 1ZPSA 1SNOA 2EPBA 5EQ0A 1E2VA 1RDPD 1HA5A 2FFKB 2TSSA 3ERQA 1V1PB 1MVKA 1E2WA 3U4EG 1J7CA 3NUHB 1JICA 2DWQA 4RH6A 3TEWA 5E1FA 2JXTA 4I65A 3J80E 4TKOB 4FXDA 4HMJA 4WORA 2RA4A 5ELEA 1F9RA 3BK2A 1QG7A 2JEAI 1O7LA 2K6AA 1LO5D 3PO3B 2M56B 1KDCA 5I2XA 3W3AA 3AEEB 2FHTA 2F0KA 1BCPF 2JA6B 1VLBA 5JVH3 2RVLA 3I72A 3K57A 3AE9B 4N58A 4FNFA 3MXPA 3OWEB 1ENCA 1NAPA 1KDAA 2W3SA 1IGDA 4C3IB 1JOOA 1VR9A 3A8JE 4A3IB 4HROA 2A68D 1R4QB 3E5SA 5FO7B 3MXGA 5F2DA 4KX6B 4LTUA 1DOXA 5FK9C 2MJ8A 5H8YE 3MC0B 3S17B 2QF7A 4OIKA 3TEYA 5I9PA 5J1ZA 1CI3M 1ET9A 3AE4B 1UNSA 2EJFC 1J7AA 1NSNS 1TS2A 1JQYD 5HI1A 1TIID 3S14B 3M7GA 3WOEA 4ZK9B 3NVWA 4RGTA 4EQNA 2IL8A 4XTCS 1EY6A 1MHXA 1QOBA 1TS5A 3JAML 1STNA 2IDYA 5T1IA 5EJWA 5C0XJ 5EE3A 4K2LA 3F2UA 3A7LA 1II3A 2BA1A 2PW5A 3DWAA 3NPPA 5JJZA 4NZLB 4KV6A 2KEDA 1F2RI 1FNVA 4MT5A 1F2ZA 4K8JA 2QSDA 4N9PA 1UWXA 2G1EA 2A6ED 2B76B 1FFUA 5E6JA 2F0NA 3SR6A 2WXPA 3T4AC 3DWGC 4HN7A 3K5MA 4OHJA 3P63A 4HCSA 1RKNA 1G2TA 3B9JA 3PZ7A 2H88B 1I6HB 5JVG3 4RGNA 1QKZA 1DOIA 4RHSA 2BS3B 1A3UA 3DEOA 1AEXA 2F0HA 2K5DA 1A2TA 1LTRD 3I4MB 2IPKD 2WXLA 3MA2B 2E74C 1YN5A 5K5PA 1BUIC 4MACA 2Q8RE 1N63A 2E2IB 2EY2A 1LT4D 4HMIA 4KHZA 1VDZA 2F0WA 1P7FA 5D14A 3TUOA 2K7VA 3ZQ4A 3GTLB 2FBWB 4Q2JA 4RWSC 1AZQA 2PQEA 1BDOA 1STAA 1A6XA 3NK9A 2JZPA 4J3OD 2R61A 3PUYA 1QOAA 5JXVA 5M9OA 2MJDA 3MFYA 2L12A 4IUUA 1ROEA 1DM0B 2K9XA 4OZAA 1I3QB 4N9TA 1FD7D 1OXUA 1HXYD 3OSOA 2JYEA 4ZHOA 3E0JA 2E2DC 2B2YC 4C3JB 4A3GB 1GB1A 1H9SB 3I4NB 4REZA 3K59A 5IIFA 1B53A 2H1EA 3IKJA 2XRSD 3GTOB 3V96A 3C2PA 1FRDA 2N7JA 2EYPA 1FRRA 3TBIB 1VZ7A 3MWYW 1Q10A 1RM6C 4G7HC 1PTOH 4H0LC 3QOLA 1Q3LA 1Z7TA 4ULLA 3R2IA 5CYUA 1RD9D 2V0GA 3ZJUA 4RKBA 5C2TB 4OIJA 1XWEA 2I2YA 3NTHA 2L52A 5KGUA 4RF1A 1RJTA 2X38A 5EPKA 1JB3A 2JEBI 1T5EA 1N5WA 3CRKC 2ZT9C 1C8CA 2PMVA 1B2TA 4IFDG 1F9PA 1PGAA 4LMQD 3EROA 2NYZD 2Z4IA 2INNE 4L23A 4HAEA 1ENAA 1F77A 5C4XB 3H94A 4G7OC 2EKIA 1JOKA 2SEBD 5IGBA 3IFTA 1A3VA 1C79A 5M3FB 1PXUA 4AQ7A 2WXNA 2A74C 2G9DA 4RFBA 3W5UB 1CK1A 3Q8BA 2Z4HA 3DEPA 1HZ6A 1Z47A 3CKIB 4WQMA 1CA6A 2JYTA 2JWUA 1JWAD 1PRTD 5E4XA 1SBBB 2VB3X 1JWMD 3NTKA 3AU7A 2WB1B 3H8HA 1STGA 3ZGZA 4M0WA 1VMCA 3AB9A 2MEKA 1L0YB 1NR4A 1TU2B 3Q24A 3KLRA 1QILA 5HFYA 4KKTA 5CV9A 5LHY1 2I38A 1XLNA 1KRHA 2Y3AA 2K03A 3SK6A 1EZ6A 3MP9A 1Y8OB 3MVVA 3VR8B 1KFYB 1SSNA 3H91A 4EQPA 1G2SA 1UUPA 2Y0SB 3S1RB 1QB5D 5BN5A 3AMUA 4CQNA 1GUNA 2QIEB 1GPXA 4IFDH 4YSXB 1U4LA 4FF1A 2E75C 3BZDB 1GXDC 1FM0D 3SDZA 4KD4A 1LTAD 2MGSA 2BB6A 3WDNA 4ABNA 2JSOA 3WOFA 2L4NA 1PZID 3MJ5A 1SYBA 2ICIA 5ELDA 3E56A 4A90A 4C7ZA 4EQOA 1R7SA 4KD3A 1E7PB 1XLOA 4DN4M 2LEKA 3LYYA 4C2MB 1NR2A 2K5WA 2SAKA 2BDNA 1L6VA 3PIP3 4Q0FA 2L1BA 3BYYB 2O5IC 3MZ5A 5JOBA 1IYVA 1SYGA 1RTOA 3I73A 3P4RB 4F8MA 1A3TA 1CZWA 4OO1I 2K05A 3HEJA 1EU4A 2A73B 4KK7A 1YNNC 1XYIA 3M3YB 1YNJD 1E6EB 4V190 3D6WA 4A3JB 1JROA 3SVMA 2L5TA 5C0XG 4B9XA 2PVOD 3SE0A 3BS1A 1EQTA 1ONLA 1RFKA 3O13A 1SYFA 2O2LD 3V3XA 4ZRZA 3LB8C 2R93B 5A2QL 2V3NA 1STYA 1C4QA 4RAUC 4GZYC 3J7AV 2BBCA 1WGKA 2X6GA 5T1GA 5HGTA 3S1QB 3MXUA 1IBXB 3J7AF 3EUB2 1HCZA 1B4OA 5IGGA 2ZXPA 3BG3A 1FNWA 2XNAC 3VYRA 1HFGA 3CQZB 2N9KA 3Q0AA 1YNTE 3NZ3A 2EY1A 2PZWA 3H3VC 3P1MA 3D6CA 2PIAA 5BYRA 1ZYRC 2RDGA 3QIAA 4WH4A 3T13A 2GA4B 4O42A 4F87A 4O1NA 2JSVX 2KJXA 3AEFB 5D65A 2N0SB 2BE5C 4XT1B 4ZOHC 3IFDA 4RHRA 4CJ0B 1DYQA 3HVDA 1B1ZA 3PUXA 1LT3D 3AE2B 1CQVA 3NS1A 3KLSX 1ZEQX 4BA1I 1JMLA 3KF8A 2IW3A 1HZ5A 1BCPD 1LTBD 2EJGC 2LY7A 4XDCA 1MGSA 4C3HG 1LABA 2WDVB 1PGBA 2EVBA 4DF7A 3M4YA 3VR3A 5CR3A 3EJIA 5KYLA 1B50A 1D1KA 2JU6X 2PO4A 1CA5A 1TT2A 2EJMA 2IJ0A 1FNUA 3L9AX 1SMYC 3AM9A 1OXTA 5EKKA 2K1BA 4ZRQA 2K04A 3OMGA 4E6IA 1I6VC 4KKJA 1TYGB 3AEBB 3AEDB 4CKEA 5TSSA 4KJNA 2PYKA 2RPVA 2A69C 1QWYA 3SEBA 1NYQA 1HA6A 1TKGA 2FUG1 3P7JA 1UAPA 2IGGA 3P1HA 3QJYA 3CIRB 3PUVA 5CV7A 1I4GA 1Q8IA 1CHQD 3NE5B 3R8BA 5EBCA 1UGJA 1XLQA 5K36G 1JOQA 3DXJC 4PMCA 1HTLD 1QOFA 4CGYB 4PMBA 2L11A 2D5GA 2EY5A 2D5DA 4CJ1B 2Y5CA 4NAMA 4FXKC 1SAPA 4BY1B 4XQQA 1FXAA 1CFMA 2HUGA 1SJHD 4CJ2C 4M8AA 2WXOA 2JQRB 1VRAB 1JW9D 2VXWA 2FINB 4LJZC 2AX5A 3ZJTA 1IKMA 4FF4A 3NVZA 1BBXC 2EY6A 2ZXRA 3V2TA 4C7YA 1SE3A 2EELA 4TRDA 1NENB 2EZVA 4RNAA 3SXHA 1DOKA 3FPUB 1WTPA 4H13C 3P20A 1U4MA 2CQAA 5EKIA 2NUCA 4B0EA 4MN3A 1W6JA 3BDOA 3C3LA 4YSZB 2DBYA 4LAAA 4ODGA 3UI2A 2B2UC 2RKSA 2QJLA 4FF2A 4DA2A 5CV6A 5K36H 2KUMA 3AE5B 3VRAB 4FYDA 3IXSA 1SXTA 1C9FA 1ZE3D 3K58A 2IWHA 1KAAA 1RWSA 1RF2D 5J39A 1K51A 5I9OA 2J42A 3FILA 2PZUA 2WLBA 2JA8B 3D4WA 1HUNA 3IT4B 2W3RA 5IGEA 3HVZA 1ZUD2 3AE7B 5J22A 1TY0A 5FO9B 1BO0A 2AUKA 2M9VA 4JK1C 1EYDA 4KGTA 1WD0A 3AN1A 4H44C 2Q8TA 2JA5B 1D5XC 1QNUA 3DM1A 1E0BA 1L0VB 1ZXTA 4MHEA 2HDEA 2BCOA 2KA7A 2QEJC 1GUWA 2SNSA 4BWGB 5C5MA 4FXGC 2EYJA 4QUFA 4XYOA 2C9OA 3NVVA 4TQUS 4D2KA 1WTWA 1SB3C 3TP8A 5C3EB 3P4PB 2ZW1A 2F1MA 1Y8PB 4R9WA 2A6HD 2NTSA 3EVQA 3VRBB 4FO2A 2WAQB 4R8IA 1PDXA 2K0PA 5DM63 3TEZA 2MH7A 1IL8A 3TSSA 3HKZB 1DOYA 1PFMA 4LLGM 1ESRA 1M8AA 1SYDA 3SK5A 3KUPA 1F2MA 1G8ZD 3MEHA 1LTID 1DJRD 4YXDB 5IT9L 1TWCB 4FXCA 5BMIA 5I4DA 1I4HA 1ICWA 3Q69A 2ID0A 1H9KA 2M00A 4CKCA 1WTXA 1WTRA 2LKVA 3J81L 4WWMA 1K8MA 2EDGA 3HP3A 2KACA 4ZRPA 4IALA 4RGOS 2E6XA 5IGCA 5KIXA 1SF0A 5JEAH 1T5XD 1IGCA 2R3ZA 1BQQT 4OVZA 3QOJA 2J52A 3NUCA 1S5CD 3X3NA 2B2TA 2EYHA 5M5YB 2PNRC 1VF7A 2RDFA 2WP8J 1E0ZA 1MSHA 2CJOA 3J80L 3HOYB 1VF5C 2XVSA 3HUIA 4J6HA 2Z8LA 3SFDB 1EQVA 1HQRD 1EIHA 1J8IA 3ND8A 5ELFA 2K5QA 5JPMC 4S3SA 2LGIA 1V8QA 4K6LA 1GB4A 1Z6HA 1N62A 2F0JA 2RDHA 2WXFA 2NB0A 1AZPA 3IAS1 3RD4A 2NN6I 2JX5A 2WXRA 3DMUA 3BDLA 1WXQA 1HRJA 3Q8FA 2KHSA 2OEDA 1KNAA 1WD1A 3GV3A 3Q6SA 1WWTA 2KECA 2F0LA 4ZQ3A 3W2DA 1C76A 1ZP0B 4R8NA 5IOCA 1Q90A 4DQOC 3A7AB 3A56A 3PO2B 1W6KA 3GTGB 2JA7B 5E4WC 2QILA 3DUZA 2XWJB 1PZKD 1KTKA 1QQRA 2NZ1D 4OGQC 5BYQA 2B2VA 1QE6A 4A8XC 3AE1B 1WYGA 3MXNA 1HPCA 3NVYA 4N6EB 4UDUC 3NBHA 1TWFB 2INPE 1H9RA 4PQXA 3Q22A 2WKCA 3NQIA 4WURA 1SDFA 3KBGA 4OZBA 5C44B 5G3LF 3IL8A 4C3HB 1GUGA 5A35A 2B2WA 1ILQA 2VZKB 1KABA 5HHDG 1VZ8A 5KEEA 3Q8EA 3NBIA 1FCCC 3G6JB 2WXIA 1E2ZA 1SEBD 4QF4A 2IT1A 4G7ZC 1WTOA 1K52A 3N6RA 2BB5A 2RBMA 4MIUA 1GAQB 3I8ZA 4L8JA 3BWUD 5I6WA 4ARIA 1QF6A 1BXTA 2F0UA 1YN3A 4L63B 1MD2D 1BUVT 2N55A 3KK7A 3D4RA 2LUMA 2SNMA 2F3VA 3I3CA 3VYSA 4AYBB 1H9JA 2PW9A 1EWHA 1YN4A 4IUQA 1MI2A 4DFAA 2WS3B 1WTQA 3D31A 3KBXA 3GV6A 1D2BA 4YT0B 3QWNA 3AB5A 3S2DB 1CJEA 3AE3B 3HOXB 4OL7A 4YWGG 4USAA 3GTPB 2XN9C 4QIWB 2B8GA 3OMCA 3V05A 4RCOA 1AFPA 5EPLA 1WRIA 1X3QA 5AFWA 3GTQB 2K5PA 3NWTA 3GQBA 4X3UA 1CM9A 2K33A 5HG2A 2H4OA 3DWPA 1HEZE 3VR4A 2BS4B 4EGVA 2LMCA 4J8QA 3AE8B 1TZOA 1G91A 2YYZA 1FFVA 2TMPA 3EFXD 1QNKA 2MP1A 2FJ2A 1OQQA 1LTGD 2X6LA 1U4RA 1CTMA 3BDCA 5C6AA 1ZOYB 4QB4A 3FKIB 1FIQA 2OXPA 2R92B 3BVZA 2DYMA 3PO0A 2BYTA 2E76C 1D5MC 3FPPA 1K8OA 2CW0C 1QOGA 2C5CA 3I9V1 1NCVA 1PFNA 3S16B 4HKQA 1H9SA 4RA8A 4TMAB 4A9AA 4QMGA 1C4PA 5CMDA 3L3OC 4C3IG 4GDKB 3RZOB 2IGHA 2F03A 1LV9A 4F88A 3BVMA 5JEAJ 1MI0A 5HURA 4NDXA 3PIO3 1PTOC 5IGFA 2WDRB 1ZDXA 5AUIA 1R9TB 4ZUIA 4PV1C 5CC4A 1MBYA 4XDXA 1E10A 4K6DA 4BS9A 1ESFA 3W9CB 1JWUD 3P42A 2KDMA 4KY5A 5M5WB 3T16A 4C56C 5DEHA 1ZXIA 2CHBD 3GP7A 3PUWA 4JWSC 4KY7A 2NMQA 1F2YA 3P4SB 1I4RA 3E6ZX 3ND9A 5KNCA 2RSNA 1Q1EA 4ZKBB 1DONA 1B9MA 4XDDA 2KAJA 3GD7A 2K22A 3BIID 1EWCA 5CV5A 4IKGA 2E3TA 4HEDA 3LNNA 2YU9B 3A8KE 3FDTA 2WNMA 1GHKA 4XQJA 5EBDA 5CV8A 2FE8A 1JORA 2WXQA 4JX1C 4GLSC 1ILPA 2NVYB 2W82A 2AQ2B 3R93A 1FEHA 1SNDA 3K5NA 1OQRA 3VR5A 3W5VB 1RYJA 4XYQA 4C80A 4KY6A 4UAIA 4IURA 1SNCA 1ML0D 1SNQA 5D7GA 3R2TA 3C46A 4BBSB 2F0PA 4NP5A 2M2LA 2F0FA 3OW7A 4GDLB 3OOCA 3ZJVA 3N52A 4IQZA 4WRDA 2LHDA 1KNEA 2F0IA 1NI3A 1STBA 1WTVA 2N88A 1V1OA 1TVXA 1X3PA 1XXGA 1AN8A 4YTPB 4J1MA 4OW0A 1YNND 1Y56A 1UEAB 2V4IB 2Z1CA 1MPEA 1TS4A 1DXMA 2MJ3A 5BMGA 1KLUD 4WJWA 1PTOB 2D62A 2BW2A 5IGDA 5FR3A 4P16A 2KEEA 1B44D 4A6QA 1IUEA 3T3NA 3GS2A 1KH0A 4IOIE 1S5FD 1TY2A 4WIPA 3MHZA 1GUOA 1C4CA 3IT6B 2OF1A 2XRQD 4ILWA 1XCTL 2PTLA 4X3KA 2ZW0A 1G291 2KCCA 1IHZA 3TMEA 2XSCA 3TN2A 1DOLA 3MFGA 3Q8AA 4RCNA 1IW7C 3QB3A 1JR0D 2NVQB 5ISRA 1JQ4A 2F0MA 1S5ED 4OO1G 2LFNA 4KJOA 1ENFA 5D3IB 3ABVB 2MPMA 5BYSA 3AE6B 1FCLA 2KCNA 1TWGB 2W54A 2O5JC 1ZYRD 1N61A 2CVRA 4K2KA 2BDOA 1QT9A 3GTJB 5T8IA 1WSPA 3TEXA 1WCMB 2BE5D 1O78A 1CZPA 1JALA 3PZ8A 1EY7A 1C78A 4PT5A 1N5XA 2NBFA 3RUZA 2F0QA 1EY4A 3A54A 1E9MA 1XO3A 2L9HA 4IUVA 5CORA 1PFBA 2VB2X 3TP6A 5FLXL 4KGRA 3EQLC 1IBXA 4A3FB 1EL0A 3B2GA 5EPJA 2GB1A 3TDQA 2HDMA 3TP5A 3IAM1 2EYOA 2R6GA 2I07B 3NWSA 1SFOB 1Y8NB 1FGBD 3VA7A 4FP5D 5C4JB 1D1IA 1TKEA 3JAME 4XE0A 1ZKOA 3OIQA 1AYFA 2BA0A 2AQ1B 1SMYD 2HCCA 4NAWB 2A68C 1KDBA 4L6TB 3PMFA 1B9NA 3LWEA 4OO1H 3KWLA 1JWBD 4IUNA 3MHBA 4US9A 3SK4A 4ID6A 1F0ZA 1PTOF 2A69D 4LK0M 2ENBA 1V43A 1OXSC 1XX8A 4L2YA 5AUKA 3RPFC 1BMLC 1TWHB 1EEID 2PMZB 2NVTB 3AV8A 4TQ1A 4CKBA 4KN7C 1QCBD 3AECB 3U9SA 2ICEC 1L4DB 3HGBA 4V0BA 5I2YA 1N60A 4IZ8A 1A15A 4R3DA 1C48A 3UI3A 4JPSA 4DAPA 1I4XA 3BVGA 3NXWA 3I70A 1SYCA 3P75A 2IX0A 4F7XA 2FMMA 3VQIA 2PVGC 2A6EC 4MM3B 5JEAG 2F0TA 5G3LD 2WXJA 1NVID 2K01A 1U9RA 1A2UA 3GTMB 2WKDA 1SE4A 1GHJA 2J7ZA 1OFFA 2AWNA 2KQ3A 3TZDA 1T3QA 4B9WA 1L5PA 1RTNA 3ONAB 1PGXA 3M7NA 2DY7A 1RODA 5E3FA 5COYA 4IUPA 4KI0A 1J9OA 4A55A 1PDQA 2FMCA 1YMHE 2MUYA 1OXVA 5KYIA 3D3RA 3URYA 1XLPA 2DNCA 1DCZA 1BR9A 1DD2A 2V4DA 2EYMA 3ITPA 4PNYA 3SK8A 1RCVD 3NQTA 4DK0A 1XCQL 1V97A 1F9SA 4L1BA 4A3MB 3VR6A 1EIGA 3VYTA 2HDLA 2F0OA 2MHVA 1P7EA 2MJEA 2F0VA 1B9RA 3RLFA 2AWOA 5I6YA 3SR1A 1GJXA 2DLBA 4QCLA 1D6EC 3DHQA 1SE2A 3J7YW 2G9HD 4CBVA 3OHXC 5DM73 1L0XB 1AP0A 5EKLA 4CHTB 2IX1A 4DGZA 2B8FA 1T6BX 1XEEA 1V1PA 1G6ZA 4NJCA 1HFNA 1K50A 2Q5WD 2RSOA 1DZ1A 2PW7A 4US8A 1SNMA 1JE4A 4K5XA 4IFDI 4AS1A 1ACCA 5BMHA 2LHEA 2XWBB 4IN3A 2OEOA 1YJJA 1TR5A 2L0CA 4B0MA 4A3KB 2HTME 4KKSA 2H89B 4U68A 1FYCA 4KKUA 1EM7A 1GUSA 2WP9B 5FKAC 2WU5B 1YQ4B 4XWWA 3K5LA 2JXMB 3K7AB 4X3SA 3DWQA 2K28A 1EY5A 3R3OA 2OHFA 3LXFA 2D2CC 4KTAA 1Y69U 3S1MB 1C4AA 2LJIA 3DWMA 4K14A 1SSOA 4K8IA 1EWYC 2XIWA 4DXGA 2B39A 2PZTA 2J4XA 2VZKD 1LTSD 1VDVA 5LNK1 3U52E 2JE6I 1SIJA 3FC4A 1LT5D 3GTKB 1AWDA 4YTNB 5DNFA 4A3DB 3RZDB 4ZHPA 3H09A 5IODA 2LMCB 3KLSA 1PFDA 4G4KA 3S2HB 2DNEA 1PLFA 5FOBB 4ZYSA 4RF0A 2KQ4X 3T56B 2IGDA 3A8IE 4WAFA 4I7ZC 5C5LA 2AQ3B 1O7YA 3VA5A 1PRTC