2QEJC

Crystal structure of a staphylococcus aureus protein (ssl7) in complex with fc of human iga1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
191
structure length
191
Chain Sequence
b'YDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQNHQLFLLGEDKAKYKQGLQGQDVFVVKELIDPNGRLSTVGGVTKKNNQSSETNIHLLVNKLDGGNLDATNDSFLINKEEVSLKELDFKIRKQLVEKYGLYQGTSKYGKITIILNGGKKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG ALPHA-1 C REGION
publication title Structural basis for evasion of IgA immunity by Staphylococcus aureus revealed in the complex of SSL7 with Fc of human IgA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 191
sequence length 191
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qejC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qejC01
1EWCA 1SBBB 2SEBD 1S5DD 1LTGD 1EEID 1HA5A 1D6EC 1EFID 1KLUD 1ET6A 1LLRD 1PRTB 3DWQA 4L63B 4Z9CB 1PZJD 1PTOF 1S5ED 1SXTA 1TS3A 1S5FD 1BCPD 3EFXD 3BZDB 4O1NA 1JR0D 1JWSD 1CK1A 1BCPC 2WV6D 2AQ3B 3DWPA 4RGNA 1AW7A 2RDHA 5ELCA 2NTSA 1I4XA 1AN8A 1V1OA 1PTOB 1B44D 4RGTA 3KLSX 1RD9D 1L0XB 5FKAC 2XRSD 1CHPD 1JWMD 1PYWD 1LTRD 1S5CD 2AQ2B 1YN5A 1KTKA 1TY0A 1V1PB 3URYA 1RDPD 3R2TA 1PTOD 2XRQD 3TSSA 5ELBA 3R8BA 1PZKD 1DJRD 3BVMA 5FK9C 1PTOC 2J4XA 1JQYD 4RHSA 4TSSA 1F77A 1MD2D 1EU3A 1FGBD 1G8ZD 1LTAD 1RF2D 4RGOS 4C56C 4L6TB 1KLGD 2QEJC 1YN3A 1XXGA 5ELEA 1TS4A 5I4DA 2TSSA 1M4VA 1PRTD 2Z8LA 4NZLB 5ELFA 3CHBD 1PRTC 5ELDA 2XNAC 1XTCD 4RHRA 1LT3D 1LT5D 2IJ0A 1SJHD 1QILA 5D3IB 1LO5D 3SEBA 2CHBD 4RFBA 4DXFA 1LTBD 3BVZA 1STEA 1FNWA 1JCKB 1YN4A 1HQRD 1CHQD 1I4GA 1TY2A 1L0YB 1UNSA 2AQ1B 4RCOA 4RH6A 1I4QA 3MC0B 1I4HA 3GP7A 5D3DA 1SE2A 1FNUA 3MFGA 1SE3A 3DWAA 5TSSA 2RDGA 1V1PA 1I4RA 1I4PA 2NTTA 1TS5A 1JWUD 2IPKD 1ENFA 1SJED 1BXTA 2XN9C 3OWEB 1FD7D 1ESFA 2G9HD 1B1ZA 3O13A 1LTSD 1D5MC 1SEBD 3EA6A 1PTOH 1PZID 1LT4D 1HXYD 1S5BD 1ET9A 3V05A 4DXGA 3BYTB 4OHJA 1D5XC 1RCVD 4K6LA 1HTLD 4UDUC 1LT6D 3W2DA 4BWGB 1TS2A 1T5XD 1BCPF 3BYYB 3R2IA 2O2LD 1EEFD 3BVGA 2R61A 1SE4A 4RGMA 1LTTD 1UUPA 1CQVA 1EU4A 2QILA 1PRTF 1D5ZC 1DYQA 4ZYSA 1FNVA 1LTID 1BCPB 2ICIA 1GOZA 1CT1D
chains in the Genus database with same CATH superfamily
5KYLA 4DHZB 3HOVG 4IM2A 3BDOA 1UH6A 3U4EG 3M4OB 4K7SA 1YNNC 1E6EB 2GA4B 2KBNA 1P7FA 1WVLA 1P16A 4PV1C 3RLNA 1ASYA 1ZXTA 1BCPD 5IGEA 4DAVA 2L1AA 1KF6B 3DWPA 5CMDA 1GUOA 2Y5CA 1PA6A 2O6VD 2FMCA 2MJ8A 2DENB 3VUWA 4AP4C 2LXKA 4KIKA 3PQIA 1C76A 1B44D 1WGRA 1TWFB 5C6AA 3KFUA 2PMVA 1DCZA 2BB5A 1CHPD 1PYWD 1S3OA 4XIGS 1PDXA 2WU5B 2L76A 3PUYA 1QUQA 2L9HA 3CMAA 3CF6E 4S17A 2KQSA 4TQ0A 3VR4A 1RLFA 1YI2A 1TVXA 5I2XA 3VQIA 1BDOA 1IYUA 3NWTA 2J42A 1EIYB 1CKOA 1J6QA 1KIXA 5ELNA 4C2MB 4X62L 1UE6A 3AFPA 3VFKA 4BY1H 3SDLC 2C9WB 2XK5A 5CV4A 2ZPYA 1GO3E 1TIID 1KOTA 3NHHA 1XD3B 5I4DA 2PI2A 3H0GG 2JQRB 1VQAA 3A5ZB 4LDTB 4POGA 5KGUA 3P75A 5ELFA 4X66Q 1FL0A 4DV1Q 2WAQE 4MGIE 4WWPA 1OQYA 5CV8A 4IFDI 4QF4A 1EIHA 1BT0A 2EZVA 1SN8A 4DPGA 1MHHE 2JWUA 1Z9FA 2EJMA 4X3KA 2L00B 4A3OA 3GZNI 4OZBA 1NBWA 2NYZD 4YXDB 4OONA 4IM0A 4KKIA 1A5RA 3VAWA 5LMNW 3A8KE 3RN9C 2Q2TA 1F52A 1WCMH 4FXKC 4JLCA 1MJEA 3RZFA 3K57A 5KRUA 2A19A 1V9JA 3UQAA 5D2MB 4FF3A 5D3DA 1V5OA 2EELA 2LWPA 4HRSA 3DWAA 1WXAA 4NNJB 1MFWA 1K3RA 1TQOA 2R93B 1DZ1A 4R4CA 2KWCA 4WORA 2PI2E 2NTTA 3HOZB 1EY9A 1YEZA 4OZAA 1BXTA 1VQJA 5E6OA 3HOXG 2JRIB 4DFAA 1H9SB 2INNE 4K14A 2L0TA 3UQBA 5J18A 1VJKA 3Q3FA 3I2ZA 4C3JG 1P9DU 2DWQA 1KLVA 1PH3A 1CKMA 3WAMA 2CU1A 1J0GA 2WXHA 1TYGB 3HG9A 2K4KA 1K3BC 3V61A 4BKTA 4BOZB 4CYEA 1HXYD 1Y1WB 2BE5C 4ARCA 1E9MA 1A3TA 3EBEA 1V8QA 4KHPQ 1RRBA 1IKLA 5IWAQ 1QT9A 4J1MA 3PREA 3C1EA 3M4YA 4APVA 1AP0A 4EQ5A 2B3AA 3QARA 1W6JA 3Q69A 2I07B 1KRHA 4FXDA 1WR6E 2N7DA 1NJIC 5BMIA 2WXNA 2INPE 2MGSA 3TEXA 1WJJA 3SU8X 4A3FB 4U673 3WIMA 4P2CB 1Y8NB 4U68A 4DV7Q 1DYQA 2IY5B 4C3IB 1ZOYB 2C5CA 3Q8AA 1WWTA 2EXZA 2RSUA 1QOHA 2REXA 1F2MA 4PMCA 1JALA 2DUDA 1SSNA 2GRIA 1AWDA 1K50A 1KLUD 1PRTB 4B3MQ 1XNRL 4QGUA 4WJPA 2G4SA 4HJAA 3RNCC 1S5FD 3SD5A 5AZGA 1DM0B 1I3QB 4YT0B 4MZ9A 3HM3A 5IGBA 2K8BA 3IVFA 4BKSA 3EC8A 2KJHB 3LWUA 4B0EA 1AN8A 2K01A 3H94A 3GO5A 3PZ8A 1EZ8A 3GDEA 4TKOB 2L83A 3FMCA 1NE3A 4AIMA 1MG8A 2DZJA 1RD9D 4DV3Q 4TQ1A 3AE2B 2PJHA 3ERQA 3EJIA 2ZNVC 1K83H 1M90C 3KQ4A 1GUNA 3R8BA 3GTJB 3QQ8B 2EE1A 3V60A 1SMYD 5E6PA 1XYIA 1FRRA 4C4VB 4J3OD 2Z6KA 3RI7C 3RNEC 3K8AA 1ENAA 4IOAA 1RF2D 1R4NB 4JI6Q 1XLQA 2DGYA 3MXNB 3CPWA 3RFZB 4EEWA 3ZNID 1C4AA 2B8FA 1D3ZA 3ULJA 3PIO3 4KGSA 1ZE3D 1UEAB 3TP7A 1JROA 3AE6B 1CSQA 4HAEA 5IT9E 2RPVA 3M7NA 2PTLA 2AUKA 4P1BC 2SNMA 4P16A 3TQYA 3VR8B 4C3HB 3CCMA 1TWHH 4C1NK 2SOBA 4DV2Q 2IDYA 4C80A 4D2KA 3N6RA 4YCVA 2K5WA 3VA5A 4YY3L 3EN2A 3AYHB 4X66L 5JJZA 4DV1L 3RZDH 5C4ZA 4Y52H 2KWDA 3CCUA 4FN2A 2L8JA 2VY3A 1YNTE 5IO9A 4BA1I 5M3MG 4JX1C 2X8XX 3I91A 4AYBG 1EFWA 4PT5A 1EWYC 1B53A 5CR3A 4L5QA 4RH6A 1VQBA 1YNJD 3T3OA 3CSFA 4JPSA 1KJTA 1H4RA 1EWIA 5FLMG 1PXUA 5FO9B 4JI4Q 1AZPA 2JA6G 2IO3B 2NVYB 2M56B 2WXPA 2F0WA 4DDGD 5IYDG 1YNXA 1DGJA 4A20A 1TS5A 5HGTA 2L05A 3JAML 1WJUA 1BO0A 4HCEA 1FIQA 1PMRA 3M4PA 1P98A 1VQ5A 3J81c 3PIPA 4BY7H 4IKGA 2MQHA 2NUCA 2A8VA 5IP7G 3DHHC 3KF8A 1JB7A 1ZGUB 5AJ3Q 1UWXA 4BBRB 3NSWA 3AU5A 1X3PA 2LS01 5J22A 1TKYA 2FUHB 2K9XA 3ECIA 4NAWB 3AE9B 5KNCA 1K52A 1LT4D 3ICEA 2DYBA 5EDSA 2BOSA 2EYOA 2VRRB 3I90A 1L2FA 4N9PA 5IY0A 3ERSX 3N32A 2JZ3B 2FFKB 4MIUA 3VR2A 1PH9A 1E8YA 1N61A 2GLSA 2ZXOA 4ZRQA 3F2CA 3J80c 2K7VA 5KYIA 4O2DA 2DY7A 2D3AA 3GB1A 3BVGA 5H8YE 4RGMA 1UUPA 4B3SQ 4PZ6A 2KHIA 2QF7A 3A54A 5IWAL 4KHPL 2KOXA 3N1ZC 1MIUA 4F88A 2BB6A 2KHWB 1E2VA 1LTID 1WTPA 3U7DA 2K8HA 1NCVA 1PFNA 1X9NA 1Z6HA 1J7AA 5JH5C 1EEID 4DV7L 4CJ1B 4FXCA 4A3LH 1KC8C 2A73B 1YJNA 1NBFC 1EYDA 3AE7B 2F52A 4BKGA 3GTLB 1F2LA 1XF5L 1T0YA 2K05A 2N9LA 1F2ZA 1HCZA 4FHKA 4PK1A 1L7YA 4N58A 1X3EA 2UXBL 2IGDA 4QL5A 3U8ZA 2AKWB 3OMCA 1RKNA 3S24A 5FR6A 2A68D 1GPXA 2GBKA 2DY8A 4JOIC 2HDLA 4KHVA 1ZEQX 3T9LA 4II3B 4LCDE 4LF8L 4IUUA 5KEEA 1FJGQ 2JXTA 3QG1A 1SFOH 3UF8A 1H8CA 2VQEQ 2MFIA 2N1WA 1S3SG 4DV3L 2QJLA 5FK9C 2R93G 4BVUC 3Q8BA 3PGEA 3RUIB 3M4QA 4IUNA 1FRDA 1JJ2A 3DHQA 1QOAA 2I2YA 1EQVA 3HOZG 4AYBE 2MHVA 5IN7A 4IFDJ 1SE8A 1T9HA 5C3EB 2RSOA 4X57B 1J19A 4EGVA 1NENB 2AWOA 3GD7A 1QOFA 2HE7A 4DHJB 4JI7Q 2KVZA 3ZRCA 2TSSA 1PRTD 4L5RC 4JI6L 3QCAA 4DHZE 4TKNA 1VQ6A 2NBUA 3U4ZA 1XPOA 3H6NA 4RHRA 1HZAA 4PYZA 1IGDA 3R3MA 1Y1WG 4FJYA 1Q8IA 4USAA 3FPPA 4J6IA 1DOMA 3J9CA 2NVUI 4DV2L 1QG7A 2EIFA 3O65B 4QUFA 3DBRB 3HRDD 2KDBA 5AEKB 1FD6A 1C9FA 1GB1A 1P1AA 1HNXQ 1HQRD 1I4GA 2AQ1B 3V62A 4A3FG 4M8AA 1Q81C 4C3IG 2LMCA 1N5XA 4RCNA 4CDCC 5EAYA 4DV0Q 2VNUD 3TS0A 4A93B 2J0JA 1PDQA 4AWJA 5I9PA 2AX5A 2KEDA 2DNEA 1AE3A 4B0MA 2WACA 2MBOA 2BF8B 4G57A 4LK1C 4EX5A 1WMHA 1SJED 4JI4L 5T8IA 3KJPA 5EKLA 4K5XA 4WJWA 3PO2H 2JN4A 3T3NA 3JSVB 1RODA 1CZGA 1JJCB 4ZRKA 1D8LA 1HR0Q 4X65Q 3KOJA 2F0GA 2JA9A 2PVOD 5AJ3L 3CC2A 2R7ZB 1FMAD 5EPLA 1Q3LA 5IKCM 4J8QA 2OQKA 4LFAQ 1O7YA 1Y8PB 2KZRA 3SK6A 3FHWA 2EY1A 3SXHA 3VR5A 1VQDA 2A6EC 2KCMA 2Z6BA 2D07B 4LUVA 1OGWA 4WFN3 3N9YC 2KXJA 3ZJUA 1L1OC 3AE5B 1HH2P 3I4NH 1ONLA 3QOJA 4H44C 3BJUA 4ZKBB 5K36H 2BCOA 1HFNA 1XT9B 2HIXA 1C78A 2IGHA 1GOZA 4A3JB 4MM3B 3TMPB 1VZ6A 4B3SL 1DOLA 3F8TA 3EQLC 2JP1A 2WKDA 4M1UB 3GV3A 4ZYNA 4B9KA 1N60A 3S16H 2WNMA 4CJ2C 1OQQA 2QA4A 3RYTA 5C3WA 2O5JC 1PZJD 4C3HG 5CHFA 4G7HC 3EFXD 3BZDB 2R92B 4DR3L 3PCOB 3D6WA 2K04A 1R4NI 1LTLA 3CCVA 5EE3A 4NJ6A 5J17A 4ZK9B 2BYEA 1OXSC 4MELA 3HZXA 2E76C 1XLPA 1WE6A 3W5UB 1XCTL 1S5CD 1B2TA 2NVXB 2W9NA 4ARIA 3RNUA 4WWMA 1AH9A 1PZKD 2UUAL 4ZRZA 3L0OA 2BVCA 4DK6C 1STHA 4IPDA 3V2TA 4NXNQ 1FJGL 4G7OC 2EKEC 1FFVA 2VQEL 1WGKA 4JBMA 4PZ7A 4JQWC 1JMCA 2E6XA 2EJGC 2HHHL 2G1EA 4HPLB 5CTRC 1OEYJ 3PF5A 5AZHA 3AB9A 4BBRG 4AJYB 2K5QA 1CZWA 2BA0A 4TQUS 3CF5A 2ZJRA 2D5GA 3NZ3A 3T1HQ 3M3YH 3CHBD 3FILB 2X6GA 1FPYA 3CCRA 5CBEE 4L23A 5C3JB 2XNAC 2VL6A 2K5DA 3RN2A 4JI7L 3OIQA 3NWSA 1MHXA 3OG5A 3CCQA 3TP5A 3N3KB 3QR8A 5FLXc 1E1OA 4OXPA 1EYCA 3ULPA 1X3GA 4ILWA 1XMQQ 4X6AH 2VUMB 2KNBA 4IG7B 2CQOA 3WALA 1S1QB 2LHDA 3UI2A 2BA1A 2RKSA 3HGBA 4CDDC 2BS4B 3ML9A 2XWJB 3C46A 4A3KH 1SSOA 1UNSA 1I35A 3HK0A 1G6JA 2RDBC 2CHXA 1SE2A 2YV5A 2EKIA 2K5PA 3TL5A 4BBSB 2Y5PA 2CCZA 3OW2A 1VDVA 1HNXL 3U4VA 1VQMA 4GKJL 1IPGA 2PO4A 4MJSB 5DPTA 3TEWA 1GB4A 2DAJA 5FR3A 2MEKA 4GLSC 1SNQA 2GVAA 4DV0L 2IPKD 3RUZA 1BUIC 2Y3AA 4KGTA 4LK0M 3S2HH 1YQ3B 2J52A 1KFYB 2QEXA 1S40A 2EY6A 3GTMH 2C60A 5FO8B 1LXDA 4DR1Q 3MC9A 4X3SA 1WF9A 2SNSA 1OQRA 2PW9A 2PIAA 5C4HA 1HZBA 3NVYA 2WXIA 1RL2A 4A3MB 1UD7A 2WDQB 3DVGY 2BYTA 2W3RA 2N8NA 1AEXA 3VXWA 1S5BD 4ZAIA 5IYCG 1VQEA 5EJWA 4KDLB 3Q24A 2BKRB 3BYTB 2EVBA 3HEJA 1HR0L 4X65L 1GKHA 2ZW1A 4I6PA 1HTLD 1IBKQ 2NBVB 3QWZB 2KQ7A 1TIFA 1U9RA 2ON8A 4NDXA 3L10B 3TN2A 1IYJB 1LTTD 4LFAL 1JB3A 1H9KA 1SLJA 3W1BA 3E9HA 1WGYA 2WKCA 1J5EQ 1J7BA 2HJ1A 2K0PA 5FJ8G 5H1SE 3SGIA 2FCNA 2FJ2A 3STBC 5C3EG 5E3FA 2WHIA 3A33B 1BCPB 3GZNB 3SR1A 2KHSA 3S2DH 3ZJYC 2AYOB 2L0CA 1OXVA 2L3ZA 4LLGM 1JRPA 3D4RA 4GXBA 5BMGA 4ANWA 1MKHA 1PH4A 2O6VB 3OLMD 3DWQA 1ZXHA 1Q12A 2WU2B 4HCNB 2DYOA 4A3DH 2HCIA 3Q0AA 1BCPC 2ZTDA 2EOTA 3SE0A 1GC7A 3ZW3A 2NVTH 2KDFB 1E0ZA 1JOOA 5J3BA 4X64Q 4OX9L 3S17H 4XTCS 2NTSA 4JW0A 4KTAA 5IGDA 2A69D 2X38A 2IHEA 3PPAA 1YHAA 1ML0D 4BOSC 3IFDA 4JOIA 2NN6H 5IT9L 3WOEA 2NBFA 4Y7NH 2ZJQA 3HKZB 4RF1A 2ZZPB 4KDIC 1YN5A 3FC4A 2RA4A 4HDOA 3J80i 1F1HA 4QY7A 2DZKA 2KLCA 1SB3C 4A93G 2KX3A 1IL8A 5C44H 3DVGX 3I57A 2NMQA 4UHVA 1RJTA 2K52A 2FBWB 1QVCA 2KENA 2RBMA 4IJLA 1EU3A 1FGBD 2OWOA 3J7A5 3DBRI 1HA6A 3PO3H 1SYDA 3Q8CA 3U30A 3MJ5A 2VW9A 1KLGD 1WYDA 4JV5Q 4NXNL 4KGRA 3G6EA 1XXGA 3OW7A 3RMHA 3VYUA 3J81j 2Z8LA 3AE3B 2K33A 3L08A 1F0ZA 4ACFA 1QZGA 1AE2A 1OFFA 2XTIA 2EPBA 2R7ZG 4BY1B 1LT3D 3CC7A 2KJ6A 2IJ0A 5CGKA 3RCZA 1EUVB 4W9GA 1J7CA 4KKSA 3V96A 3T1HL 2N9PC 1X3FA 1PFSA 3KDFB 2INCC 4TV3A 4LNKA 2N3SA 4RFBA 3WAPA 2DJGC 3P1MA 4POFA 3RT3B 5M5YB 1DOKA 1YN4A 2JX5A 1XMQL 3IAM1 1Q82C 2HD5B 4CO7A 4A3JG 3CCJA 2WXRA 4H2AA 4W9IA 1JOKA 3PUWA 3RZOH 4ZHPA 4CQNA 4MGYE 1V86A 4B08A 1C4PA 2WX1A 1VQCA 2F0HA 1SNCA 5EGTA 4UY8C 1MG4A 2JT4B 2KC2A 4MH0E 3IAS1 4FF1A 2R92G 1TZOA 1VQPA 3I63C 1FD7D 1G2SA 2RF4A 5EBCA 2D11A 2V9HA 3MXUA 1V8CA 3AE4B 1DOYA 2ZM6Q 2IHFA 1LTSD 1SEBD 5A35A 1AZQA 1WSPA 1WX8A 2A5HA 4A55A 5IA7A 1F9PA 2MRPA 2KVRA 4IWQA 5IP9H 4DR1L 2NN6I 2WB1B 1DD2A 2CH4W 3P20A 1ZDXA 4M0WB 1VZ8A 1ET9A 3HOYH 4KV6A 1PUTA 1VQKA 2YYZA 3AECB 3LXFA 1D5XC 3OMGA 3JSVA 3H6MA 1IBLQ 1LYLA 2D62A 2WQYB 1CQFA 5LHY1 3ZDMC 4QJFA 4NMZA 4DR7L 2D3BA 2M8SA 1CM9A 2RSNA 1L1OA 2ZJPA 1IBKL 3SHQA 2OEOA 2BDNA 2F4IA 2Q2UA 1KAAA 1HJPA 3CRLC 2KDIA 1Q1EA 2D5DA 4IUTA 1O78A 2AL6A 2JZPA 4A90A 5IYBH 2OCEA 1N32Q 4GSWA 1WGHA 1LTGD 2L4NA 1J5EL 3A5UA 1BBXC 2BYFA 4P6VF 5CBAE 1WTQA 3IL8A 2MCNB 1GHJA 4K3CA 1IZ6A 2K1BA 2J0KA 3ZVVA 2MUYA 1NI3A 5IP4D 1ROEA 1A63A 4F1SA 5EKKA 4WH4A 3VH4B 2KUMA 3CMEA 4MM3A 1P0RA 2VUMG 2Y0SB 3BS1A 2FHTA 2Z59B 3ZTDA 5EPKA 1JICA 1WXQA 2NBWB 3K5OA 3DDCB 4NP5A 1KNAA 1L0XB 2ASQA 3PRZA 3HKSA 2VXWA 2F0NA 2NVQH 1XNRQ 1VQGA 2HJ8A 4BBSG 1DJRD 2CFMA 4ANUA 3RNBC 4KK7A 2N9EB 4YHHQ 4RHSA 1ZP0B 3MJWA 4K81A 4LNFA 5IOIA 4W9CA 4DR4Q 3U7ZA 3EFCA 2F3IA 4YTNB 1OTCA 2HDEA 2KFKA 4II2B 1K83B 3K58A 1QOGA 4IUMB 4HWIB 4NAMA 1F2RI 4A3GH 2QIEB 2F0DA 1UZXB 1RTOA 3S1QH 1YJJA 3KYCD 3MC8A 2FINB 5JJLA 1RFAA 1J9OA 4NJCA 1K28A 1PVOA 3BZKA 4JI5L 3L17A 1STAA 4QIWE 4JV5L 4A3MG 4DV5Q 4A4IA 4YTPB 1WR1A 2E8GA 2D9UA 2BT6A 5C4XH 2PNHA 2ZCBA 2BPSA 4R1JA 4GKKL 3KUPA 3SK5A 1PH2A 3SFEB 4DGZA 1EM7A 2PNRC 4LUZA 2B63H 4DQOC 1XNQQ 1GJXA 4NY0A 1X65A 4IUVA 5C5MA 2PZTA 1XLNA 2OT2A 2H4OA 4B95A 3BVZA 3DBHI 4IFDG 1FNWA 1D2BA 2FAZA 3B9JA 1JCKB 1TWHB 4QMGA 3PS6A 1TY2A 2JQOA 2Q2HA 4KJNA 1V6EA 2RMMA 3U2SC 1WTWA 1M94A 1YNJC 2WP8J 2OF1A 2KVMA 3K80C 5AFWA 3RZDB 4BBNC 5TSSA 1EY6A 4ZKCB 2F4VQ 2BS2B 4PS3A 1A62A 3VR9B 2F1MA 1H9RA 3D31A 4GN3B 4YY3Q 1JWUD 3G6JB 3C3LA 1SR3A 2ZCCA 2GBNA 2JWZA 3L3OC 3QWNA 2EJFC 1E22A 2VB2X 3OWEB 2ZVOA 3MWYW 1EQQA 3D0FA 1LM8B 3AV8A 3QB3A 2MWSB 3PHXB 2F0EA 2ENBA 4HIDA 3NE5B 1PTOH 3NBHA 3SK4A 4US8A 1VMPA 5LXIB 2DN8A 4LWCA 2A5UA 4IPCA 4ZCKA 3H7PB 2NZ1D 4IPGA 4ICUA 4P1CC 2EDGA 2CW0D 3KUCB 2ZM6L 1ZW7A 3HKZG 3LX0A 3JAMc 4BY7B 1TJEA 3Q3NC 4IURA 2G3QB 1HTPA 2B3GA 4N6EB 5J2RA 1BBWA 5HG2A 1NTGA 3R2IA 3FRPB 3LWEA 1X55A 2Q8IB 3C1FA 4KY5A 2DBYA 1D1IA 1XPUA 2DHZA 4M00A 1IBLL 1B8AA 3ZO5B 4BS9A 1WRIA 2R6GA 2VZKD 4MH8A 3A8IE 2D2CC 2JUOA 1XO3A 1F9RA 3A1QA 1PV4A 2IYDB 1ENCA 1TR5A 4ZQ3A 3KF6A 4HK2A 1EFID 4IUPA 3HFZB 4IW0A 1N32L 1FXTB 3K0XA 4BY1G 1YJIA 1CK1A 1KDBA 2F0TA 1R4MB 2QDLA 3DWGC 3OSOA 1AW7A 4K5WA 4OWTB 4FJVB 4XX5A 1G91A 1EQRA 5C1ZA 5C3XA 1C77A 1C48A 4H02A 4ODGA 3MHBA 2O6VA 1UE5A 2A68C 3NK9A 1QNUA 1I6HH 3IFWB 3PRMB 4K7UA 3M3JA 1LTRD 4FHJA 3A7AB 1EY8A 1GUWA 1GUTA 2DJFC 5IGFA 3PIP3 2CU3A 4KV2A 5G55A 2Z4HA 5DPSA 5G5HA 1WY8A 4GDLA 5DCNA 1RAXA 2WDRB 3RNFC 2P5ZX 3TBIB 3IXSA 4MDKE 2MNAA 1ZYRD 2Z0EB 2UXBQ 1WI0A 3NVVA 4E74A 3ALBA 4L6TB 2QGQA 1SFOB 1C3TA 3A7LA 1KAWA 4JWUC 5JPNC 4YHHL 4K5VA 1U5KA 3RN5A 4DR4L 3AQQA 1G6ZA 2L12A 2V0GA 4JVZA 4CKEA 4LF8Q 2YEPF 1LM0A 1SNPA 3ND8A 2UU7A 4IALA 2HTHA 3E9SA 1PRTC 1T0RC 2B2WC 3F2BA 5KNBA 3W5OA 4B6WA 2L5TA 2ES2A 1KM7A 3PLUA 3RNAC 3TZUA 4OW0A 2WB1G 3MTNB 1KD1C 2R2OA 1E8WA 3OPOA 1QILA 2KD0A 3CQZH 4DV5L 1LO5D 2BWES 1N34Q 2NZHA 2IY1B 5T1IA 3PZ7A 1FEHA 3T4AC 4W9FA 4ZRJA 5D6JB 2LSSA 1XNQL 3IKJA 2G5DA 3H7SA 2ACZB 2KLGA 1HZCA 4DWFA 1I4HA 2JA8H 1SMXA 3GTKB 4DNRB 3HKZE 5EBDA 1C4QA 3KDFA 4JWSC 1V1PA 3P4QB 2HT1A 1X54A 1U4LA 2JPHA 2PZUA 3X0WA 3V6EB 2C7HA 3CCLA 3CIRB 4NPSA 3PRPB 2F4VL 1L0WA 3PHWB 5IAAC 5D7GA 4BXXG 3L0WB 3Q3MC 4HSPA 1DOXA 1WTOA 1YIJA 4HIKA 1QQRA 2Y0SG 3UDXA 4REZA 1PZID 2OJRA 4P75A 3NS8A 2OQ0A 3Q6BA 2LFIA 2K25A 2IX3A 5EE1A 2K5HA 2E2IB 1V5TA 3PO2B 4DXGA 3GOEA 3PSIA 3NOBA 3I70A 1SIFA 1YMHE 2L15A 4DR5Q 4PG3A 5GQOA 3GTGH 4EQPA 2K5NA 1EEFD 5GAEC 1L5PA 1MPEA 3ZXVA 1KXLA 1Y69U 3VYSA 3A8JE 1Q86C 4AS1A 5HGQA 1Y8RC 2DAFA 3LB8C 3OWFA 3FEWX 2CHZA 3DOWA 4Q5VA 4Q2JA 3ONSA 2FXQA 4BAXA 1IBXA 4DV6L 4G50A 3M95A 1HA5A 4YCWA 4GGQA 4O1NA 3I4NB 1A0IA 1N6ZA 2JVCA 3AU7A 1T6BX 1F9QA 2GI9A 4KI0A 2KFJA 2LVQA 4W9HA 2WV6D 2GB1A 4RGNA 4FA6A 3S1MH 1B3QA 1MGSA 4PYUA 3V3XA 3DPDA 3H91A 3S16B 1ICFB 1U4MA 4HXDA 1Y8OB 3WOFA 4E6IA 4OVVA 2B2YC 3TEHB 5JJKA 4F87A 3UE0A 4NQLB 2J7QB 1DOIA 4HTHA 3S15H 2A6HC 4RMAA 4KVGB 1TWAH 4JI1Q 1TY0A 3LYYA 3RLOA 2WB1E 3K5MA 1B7YB 4LF4L 3GTPH 4GIVA 1WFYA 3EGRA 4TMAB 5BYSA 4A3BH 1EY7A 1NAPA 2Q2IA 3L9AX 4DR3Q 2KN5A 2JSVX 4GNXB 1WGGA 2L52A 3VRAB 4K0KQ 1VF5C 1D7QA 1FVIA 1LTAD 3KYDD 1MJCA 4DAMA 1YN3A 4EZKA 1JE4A 2G4DB 1TS4A 3BU2A 4DXAB 1UGJA 3ONAB 2NPTB 4FBJB 2I1KA 3GV6A 3CMMB 2O2VB 4AJWA 2MQJA 3A9KB 3HM6X 1EF1A 5JXVA 5DLQE 5C5LA 2IBIB 2UUAQ 2XBBC 3D6CA 4BY7G 3PMFA 3SR6A 2ASBA 1CKNB 4IJHA 2KYWA 1YOVB 2K50A 1ILQA 4A9AA 1PLFA 1UGMA 2LASA 2N7EA 3DVNV 3M3YB 2CHBD 2HHHQ 3ZKJC 1Y1VH 3SDZA 5CV9A 4AUQC 4FVMA 2F0MA 1A6XA 2NR2A 1N34L 3AEVA 3UINB 2PQAB 4HCPB 4JIOU 2J53A 3IG3A 4IO9A 4OO1H 1QZEA 3DM1A 2CJOA 4I7ZC 3MFGA 4MGKE 2KCTA 1V9PA 1XTDA 3RD4A 4ZLTF 5I6YA 4DV4Q 1T0SC 2I5LX 3C19A 1GAQB 1SGHA 4OIJA 1G6PA 5FO7B 5D94A 3AFQA 4A3KB 4BA2I 2LXAA 2BH8A 3K6OA 1T0QC 2CS4A 5L95C 2I5MX 1IKMA 2CKHB 2JJQA 2FCQA 4I7AA 1SYFA 3OIPA 2OOBB 1G291 3TS2A 1IHZA 3TMEA 3PUVA 3S1NH 2C7MB 3NUHB 3I72A 4XYCA 3S2HB 1K0SA 3Q8EA 4N9TA 4GKJQ 3U52E 3R93A 1WJ6A 3M9BA 3WDNA 1ZKHA 2HIVA 4KMUC 3GTJH 1TS2A 1HR0W 4B3RL 1QOBA 3BYYB 1R4MI 5M5XH 2ZPNA 3PV1A 1WYWB 4LNNA 4YWGG 2R61A 2KMAA 4OELB 1TU2B 1CTMA 4DR5L 1K8AC 4A3EH 3Q2AC 4JI0Q 1OXUA 1MI0A 5I9OA 1MSHA 1JRUA 5EQ0A 1EWCA 3ZTCA 3NTHA 4YL8A 1S5DD 3VRBB 1C0AA 2Z0SA 4DU9A 2MBQA 3TBLD 4LJZC 2MP2B 1SXTA 3QAQA 4LF6L 1O7LA 1XX8A 2EY5A 3S1RH 2M0AA 1Y14B 2BTEA 3S2DB 3A9JB 2M00A 2V1CC 1QZHA 3AEGB 2WINB 1C9OA 1H9SA 4A3IH 1B50A 2PE9A 1I4XA 3G48A 3EIVA 1Z47A 2W55A 2A69C 3W5VB 1F9SA 1UBIA 4A3DB 3HHMA 3K0YA 5FKAC 1JWMD 3T53B 2O4XA 2NVTB 3QK0A 1EYGA 3R7QA 4OO1I 4WJ3M 1RDPD 3S17B 1XQQA 1QF6A 2XRQD 5T1GA 2V4DA 2Z0DB 3U9OA 2CH4A 5E6NA 4CBVA 2C35B 4XQNA 1JWAD 1K51A 3I4LA 4HKZE 1ESRA 1I94Q 4FO2A 1E7ZA 1WTHA 2CWPA 2EYFA 2MPMA 4JI1L 4GZYC 1WM3A 2B2VC 4WQMA 2Q8RE 3FDTA 2E2JH 4OX9Q 4C7ZA 2D0OA 2RR9A 1VQ8A 5IT9c 2V3NA 4ZRIA 4LF9L 5C4JH 1K8RB 1YQBA 2PEAA 2K1FA 1EO6A 3APCA 5C44B 1G2TA 2R7DA 4K0KL 5M9OA 3Q8DA 4NZLB 4DR6Q 1N33L 2FE8A 4KY6A 4BFRA 2KDEB 2JA5H 2B2WA 3PO3B 2D0PA 3FKIH 3HOUB 3PO2G 3J80L 4RG1A 5CV5A 2GMIC 5KHQA 1L2NA 2XGTA 3S14H 3SEBA 3ZGZA 1S72A 3Q3JA 3B1LX 1YIWA 3E5SA 3PUZA 2KTRB 3K7AH 1NVID 4JPBW 1HZ5A 3AEEB 3RZWC 3J7YW 4YIJA 3W1YA 1I4QA 3A4SC 2KJXA 3GTOH 4JI2Q 2ZTCA 1I4RA 1NDDA 3EROA 2ATWA 1B70B 2EYPA 1I4PA 3WCQA 5E7NA 3MAQA 2X69A 1E7PB 2N88A 4C4VA 5HURA 1TBEA 3I4NG 3IT4B 4DV4L 1N9WA 5K36G 4JL9A 5HKHA 3VDZA 3MXNA 2LXCA 3RZOB 2IWHA 2IO2B 5KHOA 1TKEA 2AWNA 2LUMA 3NVZA 3AEFB 3ZRFA 1E10A 2XIWA 1OXXK 1WZ3A 1E7VA 4JG2A 4DK0A 1CZPA 2Z4IA 2GN5A 1E2ZA 3W1GA 3HOWH 3OTOL 5K5PA 1TWGH 2LVOA 4WRDA 3APFA 1AYFA 3HIZA 1VDZA 1R7SA 1CQVA 1EU4A 5NUCA 4CGYB 1IYVA 1YX5B 4EOYA 4NPNA 1D5ZC 4TRDA 2JA7H 1B9NA 1F2RC 5C3EH 2ZJDA 4HJGE 2BKFA 3RULA 3ZJTA 4A3CH 2UU9L 3UGBB 2PW5A 3BVMA 3J7ZC 4MTNA 2Z1CA 1K8MA 3TUOA 2SEBD 3DBHB 1H9JA 4FADA 4JI0L 3K81C 4B9WA 1L4DB 1ET6A 2EYMA 1VF7A 3CU7A 3T16A 1BVSA 4IDIA 1S5ED 1PTOF 2F0LA 2DLBA 3AB5A 1GUAB 1WOCA 1CA5A 5JEAH 2GBRA 4HIMA 2AQ3B 2EY2A 1JWBD 4DR7Q 3MZ5A 2WS3B 3L54A 3I4MH 1EIFA 3P63A 1P8LA 3NG0A 3IAYA 5CX3A 1PHJA 1PQSA 3VHTC 4ALPA 1HE8A 4NAWA 4ZHOA 2B2YA 4OEMB 3ZYYX 1IBMQ 5L83A 3Q6SA 3N1XC 2AEHA 2FNJB 2VH1A 4W9JA 4A93H 1BKBA 2LGDA 4XE0A 1WGDA 4ME5A 4JI3Q 3T8MA 2B2UC 1O7ZA 1UE7A 4GN4B 4TSSA 3TP6A 3ER0A 4EVOA 2I5HA 4A3KG 1VQ4A 4KD4A 1WD0A 3CSTA 4HJ8A 3J81i 2LD9A 4XQQA 2NVQB 2V4IB 1GJZA 4HPPA 3IBEA 1I94L 2A74C 2EMSA 1GG3A 4M02A 3FKYA 3X3NA 3P4SB 2BYVE 2D2QA 2RGFA 3QIJA 3CRKC 1R9TH 3TIXA 1FM0D 4XT3B 2AL3A 4OVZA 4I6LB 3B2FA 3VTVA 1XTCD 3UDIA 4JBKA 4DR6L 1SJHD 1STYA 4A3GB 1NSNS 4DUZL 5HI1A 2K5VA 4P74A 3L16A 1LV9A 1GUGA 2KMCA 3K5LA 1BUVT 1SAPA 3AM9A 2QMTA 2MO1A 3UDGA 4GLXA 4V190 3VH3B 3WANA 1ZUD2 4YCUA 1XCQL 1VQ9A 4MSQB 5C4XB 1YD8U 2LFNA 2UYZB 1VS0A 4FLHA 5M3FH 4JI5Q 2B63B 1W6KA 1R4QB 3MXGA 1FNUA 2WDTB 1CKNA 5AZFA 1C79A 3KH0A 1STNA 2J7ZA 4GKKQ 2JY6A 4K7WA 3FPUB 2RVLA 1VD2A 2MBBB 3NENA 4XZ4A 4JI2L 4BZAA 2JU6X 1B4OA 4LNIA 3VTWA 1E5WA 3GE3C 1GD7A 3VVWB 2JYOA 1XMOQ 2ZTEA 2G9HD 1TZ1A 4LF7Q 2EXDA 2ZW0A 1B1ZA 1K53A 5E1FA 2KACA 5CC4A 4LUOA 2IT1A 3EA6A 4UP7A 5LL6X 3AMUA 3CD6A 1P3QU 2I1JA 5MPOA 2ALYB 2BGFA 1OTRB 3H9DA 3BY4B 3KUDB 3E0EA 2YTYA 2G9DA 4A3DG 1JW9D 3E3XA 5D14A 2CW0C 1WXMA 2PPHA 2PYKA 2XVSA 4O0AA 1SYGA 1PGAA 1LT6D 1FCCC 1E0BA 5HY6A 2VZKB 1JQ4A 3D32A 4MGZE 3AMZA 1QNKA 2BBCA 4W9EA 3N20C 4NB3A 1L4ZB 1WCMB 1Y56A 4HJ7A 2NN6G 5GROA 5COYA 2LGYA 3BG3A 5DM73 4A6QA 3T13A 3AE1B 5EKIA 4KKJA 3K9OB 3MEFA 1TTNA 1VQLA 3A0JA 2K6DB 1ZPSA 2UWQA 3JVZX 4XDCA 5C44G 2YU9H 3A56A 3QIAA 3NVWA 4WWNA 4RM8A 4WAFA 1TKWB 4Z9CB 4IUQA 3KLWA 3I8ZA 5FLXL 5C0XH 3PO3G 2LZ6A 4F8CB 4JI8Q 3HOUG 2K32A 5GMVA 4HKQA 5BN4A 4C7YA 2N0SB 3H3VH 4KZCA 1VQHA 4BBNF 2KTFA 4K8JA 3K7UC 1PFBA 4C1NI 4DKAC 1UAPA 2K6AA 2KX0A 2KWUB 3KLSX 1WXSA 4XGAB 1WE7A 3CXCA 1M8AA 1YZ6A 4NW2A 3TJPA 1C8CA 1KTKA 4GN5A 5IOCA 1MJDA 2N4FA 3NJTA 1PH8A 2DX5B 3HOVH 1IBML 3I4OA 2RPQA 3T56B 2V4LA 4PMWA 3NP8A 1EWHA 3CC4A 2JE6I 1N36Q 2IW3A 1I6HB 3AULA 4KHZA 4GDKB 1KNEA 2KJRA 4R3DA 1EY5A 4C56C 2WXFA 3ZNZB 2B2VA 1ZYRC 3KF8B 4JI3L 3BDCA 4LJOB 1QKZA 3OHXC 3A55A 1SE9A 5BMHA 1Q46A 1M4VA 4ID6A 1PH1A 4G11A 4OZCA 3UE1A 1HZ6A 2WWZA 1MBYA 4LF5Q 3GTQH 1CUKA 4S3SA 1TXYA 5CV6A 2K6QA 2WP9B 4ITKA 1UELA 2C9OA 2YTXA 2H1EA 4DR2Q 5JVG3 2KK8A 2INDC 1LTBD 1Q0WB 1SMYC 3CPFA 5G3LF 5IP9G 1ZDVA 1CHQD 3DUZA 2RQXA 2IX0A 1YQ4B 2K28A 1YJ9A 2PKOA 3K9PB 3LJ3A 1RWSA 2YVCA 2Y5BB 4OWXB 3DEPA 3EFUA 3CQZB 2EYJA 3UDFA 2KC1A 2NZOA 3H0GH 2JK8A 3B0AA 5IODA 2PMZB 4DAYB 1SF0A 2IO1B 1ILPA 1VMCA 3CWIA 4M01A 1V80A 2LUEA 2MJ3A 5C0XI 2QSDA 2K8CA 2JA8B 3DM3A 2QKIC 2L7RA 2E2HH 4CHKA 5IYBG 1EY4A 3R3OA 4X3TA 3KBXA 3H3VI 4HEA1 3J81E 1E2WA 4HCSA 4DK5A 3B08A 2KCCA 4IZ8A 4K2LA 1BF4A 2K3UA 3DBSA 1WXVA 4I65A 1TT5B 2CWAA 1XMOL 3DHIC 1Q7YC 1ICWA 4LF7L 3FILA 2HQLA 2H88B 3VUYA 4FF4A 3N30A 3V05A 1PH6A 3W2DA 1V1QA 2F0SA 3Q23A 2BDOA 2MH7A 1R4PB 4KSKC 4XDXA 4YWMA 4HDQA 1STBA 1SE4A 3J80E 1PRTF 4E3CA 1GUSA 3VR3A 1FNVA 3HOXH 1CT1D 3X3MA 4M8NA 2R7FA 1SBBB 4KN7C 1WIAA 2GBJA 4HMJA 5IGGA 3FP9A 3GTGB 1FR3A 3ABVB 1MVKA 4GS3A 4C3JH 1MHWC 4WJQA 4MJSA 1UWMA 2K14A 2KN4A 2E5LQ 4BKSD 1Q1OA 2CHWA 5J1ZA 4A3GG 1WI5A 1YBYA 4R4QA 2XWBB 4L2YA 1TWCH 2F0PA 1V1OA 1GNUA 2N9KA 4JI8L 3MHSD 4L5TA 4QQBX 4GLVB 4KY7A 4RAUC 4Q0FA 5M5YH 3WA0A 5C4XG 4CHTB 2XRSD 2Q5WD 2LMCB 3VA7A 1RTNA 4DV6Q 3S1MB 1ZXIA 2B63G 4PQXA 2YLMA 1VQOA 4E71A 1CFMA 3R2TA 1O80A 1PTOD 2F0KA 5CV7A 1WH3A 4YSZB 1IXRA 1D1KA 1KABA 2F0VA 4B3TQ 3UIPB 3W1SC 4DUYQ 1WMHB 1LFDA 3KW5B 2B8GA 2B2UA 2DZMA 3NZSA 3S15B 2MSED 4MT5A 4RGOS 4J6HA 1TWAB 1LGRA 1KH0A 3HS0C 3GTPB 2H89B 1N36L 3HUIA 4LW1A 4JYAQ 4A3BB 1EQTA 3NELA 1K73C 2I46A 3LGJA 1SDFA 4JE3B 2KT7A 3I55A 2RHQB 5LMNQ 2PW7A 2MJDA 3DBLI 4LF4Q 3DEOA 4WJ4A 1VRAB 5G5GA 1TT2A 3ZIMA 2KDMA 1PH7A 4F7XA 5BR8Q 4LF5L 1IW7D 3DVNU 1NYQA 1WTVA 3DWMA 2A4ZA 2WYQA 5M5WH 1WCMG 1N62A 1SIJA 3B6YA 2EQSA 4DR2L 3GS2A 1L0YB 5E4XA 1H9MA 1DXMA 3TRZA 2DYMA 3RD2A 5JEAJ 2RCFA 4O42A 2OTJA 4F8MA 4XQJA 2K39A 1Q1BA 1Y1VB 2KECA 2KOLA 3A74A 1B9RA 1IYFA 1CMXB 5GAGC 1OO9B 1WX7A 2XN9C 3F1ZA 1L0VB 1I50H 4BXXH 2N7JA 5A2QL 2KO3A 3LDZE 1E1TA 1SYEA 4KD3A 1II3A 5L37A 1A70A 1FCLA 5KNDA 5BO4B 1J8CA 3ZXRA 4DA2A 1NEKB 1A2TA 2JF5A 5M3MH 1FFUA 1KDCA 3CAMA 4HJ9A 1FYCA 2SDFA 2RD0A 2UUBQ 1XEEA 2AMCB 1WYGA 2R2QA 4MN3A 2B39A 4IQZA 1PH5A 2OHFA 3RNGC 3VR6A 4R8IA 1JJGA 1TGZB 2ZNVB 2I38A 2W82A 1F2YA 1Z7TA 4KKUA 5FLMH 2IX1A 2JA6H 1C7YA 4IC7B 4KSLC 4DBGA 1T5XD 3S1NB 5IYDH 1IUEA 3M4OH 5LXHA 1NI2A 2QILA 2X6LA 1VLBA 2L55A 1QVFA 1EF5A 2Z9HA 4DNTB 4G4KA 5IP7H 1YNND 2VQFQ 2BS3B 5M5XB 3CKIB 4ZUIA 2LGSA 3M85A 2NWGA 1EIGA 2BWFA 1D6EC 4L63B 4ANXA 2PLPA 1SROA 1TWFH 2JXMB 3HP3A 4A3EB 3TP8A 3HRZC 4B3RQ 2ZXPA 3C8YA 2QDFA 4R4IA 4K2KA 1K0RA 2WFWA 3NS1A 3TREA 3GQBA 4UPAA 1FXIA 2M19A 2E5LL 3NRZA 4HJ5A 1EY0A 5JVH3 2C7NB 1NY4A 3S1RB 4NKLA 2WXGA 1U4RA 3U58A 1IL2A 1QLBB 1KRTA 2MA9B 2WXJA 3ZJVA 2AQ2B 4C2MH 3RPFC 1JE5A 1PGBA 2IO0B 4A3IB 3JW0X 4M0WA 3URYA 1Z5SB 5JPMC 2OXPA 4LF6Q 2L32A 3M62B 1A15A 4XT1B 3PTFC 5DM63 3Q14C 4AQYQ 4ANVA 4QUCA 3AEAB 1MD2D 4B3TL 4JBWA 5ELOA 2JA8G 1B9MA 1OEYA 4DUYL 3I9V1 3ZUNA 1LABA 1D4BA 4FNFA 2M9VA 4P73A 4CDFC 2N55A 4RNAA 3MTSA 2D3GA 1X1MA 4WQOB 2UXCQ 2F0JA 4LMQD 2LXJA 1VZ7A 3EUB2 4ZUJA 4OWWB 2E2JB 2ID0A 4OIKA 2AWTA 4GDKA 3SVMA 4DF7A 1NMFA 4JYAL 4PS7A 3Q8FA 5C4JB 3MP9A 4IN3A 2LRWA 4LDTD 3EVQA 1OXTA 3DMUA 1PFMA 3NTKA 1T5EA 1VQFA 4DAPA 5LMNL 2YEPB 4G0NB 4ZRPA 3FAHA 2V3SA 4LJPB 1YX6B 2R93H 4DXFA 5FLXE 4LF9Q 4PZ8A 5BR8L 4R4TA 2JA5B 3AU4A 4W9KA 1VR9A 3G7LA 2K75A 3FKIB 3HOZH 2WXKA 5JZEB 3AEBB 3OOCA 1N5WA 1N33Q 2MX2A 3MC0B 4JGHB 5C0XJ 3F2DA 4RA8A 3S14B 4WJOA 4CKBA 4P72A 3G71A 1K8GA 4G7ZC 5CHWA 3K7AB 4GNXC 1RHPA 2HDMA 3L13A 4EE2A 4F7ZA 3HVZA 4AOFA 1UEBA 1PYSB 1VCIA 2G45B 1X6OA 4YWKA 1Y1WH 5JAVA 1EUJA 3NBIA 4MTKA 5G3LD 3GTOB 3KLSA 1EZ6A 1V2YA 4LNQA 3P42A 1HEZE 2MW5A 1FXAA 4ICVA 1A3VA 3FVQA 3N1YC 1SYBA 3E6ZX 4WURA 5C2TB 2MLBA 4DAYA 3RMKC 4IPHA 2Y0SE 2BE5D 4AQ7A 3I5JC 1UF0A 3MHZA 3DCGA 4A3FH 4B3ML 3PIOA 4C3IH 3VTUA 1BR9A 4K6LA 2M17A 2LHEA 3JC66 4MNOA 1X3QA 1PGXA 2UUBL 2MBHA 3MEHA 1Z2MA 4XXEA 3AN1A 4RMFA 4QB4A 2UXDQ 2QDBA 3PVLA 1MSGA 2JEBI 1O7IA 1G51A 2JEAI 1V81A 4EFOA 1I3QH 1KHIA 4ZYSA 1V97A 1WTRA 1VCBA 2ZT9C 3HOWB 1FO4A 1TWGB 4A3BG 1HTQA 3L2PA 5EE0A 2MP1A 2F3VA 4OGQC 2KQ3A 4A3LG 4FXGC 1QVGA 2EYLA 2KQ4X 2WDVB 2JA7B 3KUZA 2VQFL 3OTOQ 2PMZE 1A2UA 1JWSD 5GXGB 4J15A 2DNCA 2GVBA 4IM3A 2C5LC 1PYBA 3DHGC 2RDHA 3GTMB 2E3TA 3S2AA 3I3CA 1AFPA 4N8FA 4DK3C 2N78A 3NEMA 4GU2A 1EYAA 4YSYB 5BYQA 2CQAA 3ZQ4A 5DEHA 2UU9Q 1KDAA 3MXPA 4PMBA 2RHSB 2M2LA 4KKTA 4LFBQ 5LMUQ 3H7PA 1XJVA 3MA2B 5BN5A 3SFDB 3NXWA 5J39A 3GTKH 3SK8A 2I0QA 3I4MB 4MEMA 4YWLA 3IHPC 3QJYA 4HROA 5CORA 2J4XA 2F0IA 3W1SA 3ITPA 1Y1VG 2ZXRA 1CJEA 1G8ZD 4C3HH 4NXMQ 5G2NA 5JHAA 3KWLA 2PVGC 4OO1G 4EQNA 2B76B 4AQYL 2B29A 2FCMA 2YTVA 5DPRA 3D3RA 4WWOA 3BIID 2LY7A 4RM9A 2RDFA 4TVAB 1NR4A 3TDQA 1HPCA 1HZ9A 3PF4A 1E7UA 2WXMA 4FJZA 4W9LA 3JAMi 3IFTA 1U4PA 4KJOA 2E2IH 2DNFA 4EZJA 4CDEC 1I5FA 2L1BA 3ULLA 2CR5A 2UXCL 3UI3A 4R8NA 1ASZA 4K1RB 5D3IB 4LNOA 1HTOA 3OAWA 4XDDA 2NVYH 5EE9A 1R9TB 3PUXA 3LNNA 1L1OB 4HN7A 3ETRA 3J81L 2F0OA 5E6JA 4Y7NB 4DK1A 1HNZQ 2LGXA 4X3UA 1JORA 4LAAA 2ZEQA 1SE3A 1HNWQ 3W9CB 3I7FA 4K3BA 4BBRH 2M4NA 4NQKE 1T3QA 4FF2A 1F9JA 4IOCA 4GOPB 1IGCA 1WX9A 4DUZQ 3AXCA 1ENFA 1FGUA 2E2DC 2PPBC 3P4RB 4A3EG 2IL8A 5M3FB 1QCBD 1WZ0A 2V1YA 3Q22A 4L5SA 1ESFA 4QIWB 3NQTA 5C23A 4OL7A 3J7AF 2KHJA 1BQQT 2AHOB 2B2TC 3G4SA 4GOPC 4JC0A 2IZVB 2E74C 4UP8A 3R7RA 1Q10A 4HSVA 4P71A 1P7EA 4RKLA 5KIXA 1ACCA 4FP5D 3ND9A 4A3IG 2HD3A 2FIDA 3PV0A 2HCCA 4UDUC 4L8JA 4BWGB 5JOBA 2UUCQ 1WM2A 1BCPF 1I6VC 2N9XA 2NS5A 2XEWA 1EL0A 3WAOA 1KRSA 1Q5WB 2A6HD 1WRDB 2KFKB 1HHVA 4A8XC 2MHJA 3GTLH 2GOWA 5TR5A 1RIPA 2FCSA 3MVVA 3NTIA 1IP9A 3JYUA 1Q90A 3A4RA 1LQBA 2UXDL 2DZIA 4KIKB 1E24A 2WAQB 3BDLA 3QO2A 1E90A 4KZ0A 4L1BA 2N49A 4ABNA 2F0UA 1QWYA 4EZLA 3QC8B 1JR0D 3U9SA 3BK1A 5E4WC 4ME3A 5IYCH 3KK7A 2BH2A 5GADC 2W3SA 2EMTA 3DQVA 3VUXA 1GM5A 1QUQB 2YU9B 4ZOHC 4S0RA 4A3PA 2MBEA 4IWPA 4RF0A 1C4CA 1CI3M 3TEZA 3D8GA 3H8HA 4RGTA 2JSOA 3M7GA 2JA5G 3OJ3A 5A2QE 3APDA 3FKIG 4HLEA 1E8ZA 2IY0B 2XK5B 5FJ8H 1VQIA 3HOYB 2LVPA 2EYHA 1WJ4A 3DLLA 3VDYA 3TSSA 3I3TB 1W3SA 4LFBL 5LMUL 4RKBA 3BWUD 5ISRA 2JRHA 2FIFA 2IGGA 3BZCA 2F3WA 2QW7A 3S9WA 2LRUA 5F2DA 4FYDA 2NB0A 2PE6B 4YSXB 4XYOA 3GE8C 3NQIA 3H3VC 1N8RC 3HOVB 1BOSA 2GBMA 4A76A 2HUGA 3NBHB 3ZNHB 2WXOA 1A3UA 4NXML 3H15A 1TKGA 2F0QA 1XLOA 3H1UA 5ELDA 3CCSA 1J8IA 3E9IA 3KYHC 4V0BA 1DONA 3C0RB 3T51B 4GOCA 1SRUA 2XSCA 2WGSA 5CHVC 4C00A 1L6UA 3E0JA 1C1YB 4DHJD 2CVRA 2E75C 2PZWA 3H09A 1YHBA 1HUNA 2PQEA 2KAJA 3PO0A 1NUCA 4MACA 4MSMB 4P7IA 3VYTA 1I42A 3PZDA 1S4ZA 4MHEA 4XWTA 3GTQB 3CCEA 3SHLA 3E56A 1QE6A 3AEDB 4LTUA 1GXDC 1LUZA 2RCNA 1SNMA 5H92C 4FULA 3GP7A 1YJ1A 3A1QB 3W3AA 3HOWG 2KA7A 4R9WA 4XWWA 3KF6B 3OJ4B 3NY5A 1HFGA 2CKZB 2L0FA 5DAUA 1HNZL 3ML8A 4GMVA 3ZLZA 4HVBA 2SAKA 1JC7A 4GNXA 1HNWL 2JA7G 1E8XA 1JT8A 2R7ZH 3NPPA 3PLVA 4A3CG 4CKCA 3T1YQ 1SYCA 1H95A 4N59A 1I7HA 1XWEA 3S1QB 3H0GB 1M1KC 1GVPA 1D5MC 3BK2A 2QHOA 3KWVA 4GB9A 2NPTA 4PS8A 3V6CB 5CYUA 2VZAA 5LLIA 4G3XB 1UBQA 4B9XA 4HEDA 2O2VA 2QCPX 1EOTA 3F2UA 3QOLA 5JEAG 3A9KA 2VS1A 5EPJA 4DNIA 2LI5A 2M0XA 2E2HB 2H5XA 5DPWA 4OHJA 1RCVD 2A6ED 3CW2C 4A3JH 3I4MG 3JAME 2LJ5A 4GDLB 5D65A 5HFYA 2QCZA 4LFCQ 3DBLB 2KMMA 2BW2A 4AH6A 4KN4C 4UP9A 3J7AV 2W54A 2J0MA 4HPMB 2UUCL 1SNOA 1X56A 2LKVA 1X32A 2R92H 1L6VA 4XC2A 1QJOA 2LEKA 2D3CA 2ICIA 2PQAA 4ULLA 2PCFB 4XYQA 3K59A 5GAHC 2CJNA 2JYEA 3KBGA 2KANA 3KVFB 3P2BA 5AUKA 2JZZA 3BINA 1VQ7A 2R3ZA 1LLRD 4I6NB 2WLBA 2L11A 2K22A 1TS3A 4KLKA 1NNXA 2JXXA 3HOXB 3HOUH 1WFQA 1U4AA 3PT2B 2F0FA 2NVXH 3L4PA 1VQNA 3N52A 5ELCA 1K8OA 4C3JB 5BN3A 1YITA 3I56A 4WJNA 3HVDA 1PTOB 1B3AA 1XPRA 1DGSA 4HJKA 1QB5D 4M8MA 1MI2A 3WWVA 3K5NA 1JMLA 1BMLC 2JYTA 2MJEA 4OVUA 5LNK1 2VH2A 3DXJC 3IRBA 1V1PB 1YJWA 2OTLA 5ELBA 2O5IC 4KX6B 1TWCB 4X62Q 4K8IA 2D10A 1KL9A 1PTOC 2Z6KC 1JQYD 1YHQA 2NCNA 3RR5A 3KJOA 1AARA 2BQQA 2FMMA 4CJ0B 1F77A 1K9MC 3NZUA 2F03A 3ZNGC 1RFKA 5M3FG 4TUUA 5IIFA 3VYRA 1YVCA 2QEJC 4FDBA 3EHVA 2KEEA 5ELEA 2Q8TA 2ZVNA 4UAIA 3D4WA 1BNZA 2J0TD 2TMPA 1HRJA 3RLFA 2VUMH 2KCNA 4HIOA 1W2BA 4H0LC 4YTMB 2KWVB 2AUJD 3ENEA 2ICEC 4DN4M 1ISNA 5AUIA 2MP2A 3PGZA 3TCAA 1WD1A 1LT5D 5I6WA 4NJ7A 5FOBB 1GC6A 4GLAC 1JOQA 3NHEB 4IWOA 3A9JA 4BBSH 3I73A 4R4OA 4QAYA 5DNFA 2VB3X 1IW7C 1STEA 2FUG1 4IOIE 3IT6B 2ONQA 4RCOA 4HMIA 4JCVE 3PSEB 4EKUA 4HR7B 1UE1A 1HQMC 3M63B 1ZKOA 4JK1C 3R66C 4ZDVA 1IBXB 2RDGA 5HHDG 3KLRA 4H13C 2WX0A 4W9DA 1V43A 2WAQG 1HUMA 5LL6S 3QHTA 4WIPA 1RM6C 5IGCA 5M5WB 1CA6A 1N63A 1GHKA 3QA8A 4A3MH 5IE8A 3MFYA 5JJIA 2V3PA 1Q8KA 4WAAA 1WJNA 3QX1A 1SNDA 1NYRA 2WXLA 3L7ZC 3OYYA 1KQSA 3AI5A 4URKA 1BBUA 3U50C 2M1MA 1NMGA 3O13A 3Q3OC 5I2YA 2KKCA 2WIIB 1STGA 2HQEA 3D4DA 3T1YL 2LGIA 3AH7A 4EUTA 2B2TA 4IFDH 4GOPA 4DDID 4GN1A 4RWSC 1RYJA 1LACA 5C0XG 2LJIA 2OJWA 2QC8A 3P1HA 2A1AA 4N8X1 4US9A 1I50B 3P4PB 1PFDA 3TEYA 2HTME 3AE8B 3HOYG 3CP0A 4A75A 3NUCA 2N1VA 1NR2A 1U0LA 3B2GA 5JHBA 5BYRA 3X23A 5M3MB 1V49A 1E3PA 4JBJA 2O2LD 4AYBB 3C2PA 2WXQA 1CSPA 2OEDA 4EQOA 2MO0A 3QJZA 3ZDTA 1A8VA 4PNYA 4X64L 3TZDA 4H7BA 4QCLA 3UIOB 2KTRA 4ASWC 3STBD 3EECA 3P7JA 4K6DA 1EOVA 4LFCL 2K03A 4N9F4 1WTXA 1UWVA 2JA6B
chains in the Genus database with same CATH topology
5KYLA 3BDOA 3U4EG 3M4OB 1YNNC 1E6EB 2GA4B 1P7FA 1WVLA 4PV1C 1ZXTA 1BCPD 5IGEA 4DAVA 2L1AA 1KF6B 3DWPA 5CMDA 1GUOA 2Y5CA 2FMCA 2MJ8A 1C76A 1B44D 1TWFB 5C6AA 2PMVA 1DCZA 2BB5A 1CHPD 1PYWD 4XIGS 1PDXA 2WU5B 3PUYA 2L9HA 4TQ0A 3VR4A 1TVXA 5I2XA 3VQIA 1BDOA 1IYUA 3NWTA 2J42A 4C2MB 5CV4A 1TIID 3NHHA 2JQRB 5I4DA 5KGUA 3P75A 5ELFA 5CV8A 4IFDI 4QF4A 1EIHA 2EZVA 1MHHE 2JWUA 4X3KA 2EJMA 4OZBA 4YXDB 2NYZD 4KKIA 3A8KE 4FXKC 3K57A 5KRUA 4FF3A 5D3DA 2EELA 4HRSA 3DWAA 1TQOA 2R93B 1DZ1A 4WORA 2NTTA 3HOZB 1EY9A 4OZAA 1BXTA 4DFAA 1H9SB 2INNE 4K14A 1VJKA 4C3JG 2DWQA 2WXHA 1TYGB 3HG9A 1HXYD 1Y1WB 2BE5C 4ARCA 1E9MA 1A3TA 1V8QA 1IKLA 1QT9A 4J1MA 3C1EA 3M4YA 1AP0A 1W6JA 3Q69A 2I07B 1KRHA 4FXDA 5BMIA 2WXNA 2INPE 2MGSA 3TEXA 4A3FB 4U673 4P2CB 1Y8NB 4U68A 1DYQA 1ZOYB 4C3IB 2C5CA 3Q8AA 1WWTA 2EXZA 1QOHA 1F2MA 4PMCA 1JALA 1SSNA 2GRIA 1AWDA 1K50A 1KLUD 1PRTB 1S5FD 1DM0B 1I3QB 4YT0B 5IGBA 4B0EA 3LWUA 1AN8A 2K01A 3H94A 3GO5A 3PZ8A 1EZ8A 4TKOB 2L83A 3FMCA 1RD9D 4TQ1A 3AE2B 3ERQA 3EJIA 3KQ4A 1GUNA 3R8BA 3GTJB 2EE1A 1SMYD 1XYIA 1FRRA 4J3OD 1ENAA 1XLQA 1RF2D 3RFZB 1C4AA 2B8FA 3PIO3 4KGSA 1ZE3D 1UEAB 3TP7A 1JROA 3AE6B 4HAEA 5IT9E 2RPVA 3M7NA 2PTLA 2AUKA 2SNMA 4P16A 3VR8B 4C3HB 4C1NK 2SOBA 2IDYA 4C80A 4D2KA 3N6RA 2K5WA 3VA5A 5JJZA 5C4ZA 2KWDA 1YNTE 4BA1I 4JX1C 3I91A 4PT5A 1EWYC 1B53A 5CR3A 4RH6A 1YNJD 3T3OA 4JPSA 1PXUA 5FO9B 1AZPA 2NVYB 2M56B 2WXPA 2F0WA 1DGJA 1TS5A 5HGTA 3JAML 1BO0A 4HCEA 1FIQA 1PMRA 4IKGA 2NUCA 3KF8A 1UWXA 4BBRB 3NSWA 1X3PA 2LS01 5J22A 1TKYA 2K9XA 4NAWB 3AE9B 5KNCA 1K52A 1LT4D 2BOSA 2EYOA 3I90A 4N9PA 2FFKB 4MIUA 3VR2A 1N61A 2ZXOA 4ZRQA 2K7VA 5KYIA 2DY7A 3GB1A 3BVGA 5H8YE 4RGMA 1UUPA 2QF7A 3A54A 4F88A 2BB6A 1E2VA 1LTID 1WTPA 1NCVA 1PFNA 1J7AA 1Z6HA 1EEID 4CJ1B 4FXCA 3AE7B 2A73B 1EYDA 3GTLB 1F2LA 1XF5L 2N9LA 2K05A 1F2ZA 1HCZA 4N58A 2IGDA 3OMCA 1RKNA 2A68D 1GPXA 2DY8A 2HDLA 4KHVA 1ZEQX 4IUUA 5KEEA 2JXTA 3QG1A 2QJLA 5FK9C 3Q8BA 4IUNA 1FRDA 3DHQA 1QOAA 2I2YA 1EQVA 2MHVA 4IFDJ 5C3EB 2RSOA 4EGVA 1NENB 2AWOA 3GD7A 1QOFA 2TSSA 1PRTD 4RHRA 1IGDA 1Q8IA 4USAA 3FPPA 1DOMA 3J9CA 1QG7A 4QUFA 1GB1A 3HRDD 1FD6A 1C9FA 1HQRD 1I4GA 2AQ1B 4M8AA 4C3IG 2LMCA 1N5XA 4RCNA 2VNUD 4A93B 1PDQA 5I9PA 2AX5A 2KEDA 2DNEA 4B0MA 2WACA 4G57A 4LK1C 1SJED 5T8IA 5EKLA 4K5XA 4WJWA 3T3NA 1RODA 1CZGA 2F0GA 2PVOD 2R7ZB 1FMAD 5EPLA 1Q3LA 4J8QA 1O7YA 1Y8PB 3SK6A 2EY1A 3SXHA 3VR5A 2A6EC 3N9YC 4WFN3 3ZJUA 3AE5B 1ONLA 3QOJA 4H44C 4ZKBB 5K36H 1HFNA 2BCOA 1C78A 2IGHA 4MM3B 1GOZA 4A3JB 1VZ6A 1DOLA 3EQLC 2JP1A 2WKDA 4M1UB 3GV3A 1N60A 2WNMA 4CJ2C 1OQQA 5C3WA 2O5JC 1PZJD 4C3HG 4G7HC 3EFXD 3BZDB 2R92B 3D6WA 2K04A 5EE3A 4ZK9B 1OXSC 3HZXA 2E76C 1XLPA 3W5UB 1XCTL 1S5CD 1B2TA 2NVXB 4ARIA 4WWMA 1PZKD 4ZRZA 1STHA 3V2TA 4G7OC 1FFVA 1WGKA 2E6XA 2EJGC 2G1EA 3AB9A 2K5QA 1CZWA 2BA0A 4TQUS 2D5GA 3NZ3A 3CHBD 3FILB 2X6GA 4L23A 5CBEE 5C3JB 2K03A 2XNAC 2K5DA 3OIQA 3NWSA 1MHXA 3TP5A 1EYCA 4ILWA 2VUMB 2LHDA 3UI2A 2BA1A 2RKSA 3HGBA 2BS4B 2XWJB 3C46A 1SSOA 1UNSA 1SE2A 2EKIA 2K5PA 4BBSB 2Y5PA 1VDVA 3TEWA 1GB4A 2PO4A 5FR3A 2MEKA 4GLSC 1SNQA 2Y3AA 1BUIC 2IPKD 3RUZA 4KGTA 4LK0M 1YQ3B 2J52A 1KFYB 2EY6A 5FO8B 4X3SA 2SNSA 1OQRA 2PW9A 2PIAA 5C4HA 3NVYA 2WXIA 4A3MB 2WDQB 2BYTA 2W3RA 1AEXA 1S5BD 4ZAIA 5EJWA 3Q24A 3BYTB 2EVBA 3HEJA 2ZW1A 1HTLD 1U9RA 2ON8A 4NDXA 3TN2A 1LTTD 1JB3A 1H9KA 2K0PA 2WKCA 1J7BA 2FJ2A 5E3FA 1BCPB 3SR1A 2KHSA 5BMGA 2L0CA 1OXVA 4LLGM 1JRPA 3D4RA 3DWQA 1ZXHA 1Q12A 2WU2B 2DYOA 2HCIA 3Q0AA 1BCPC 2EOTA 3SE0A 1E0ZA 1JOOA 4XTCS 2NTSA 4KTAA 5IGDA 2A69D 2X38A 1ML0D 3IFDA 2NN6H 5IT9L 3WOEA 2NBFA 3HKZB 4RF1A 1YN5A 3FC4A 2RA4A 1SB3C 1IL8A 3I57A 2NMQA 1RJTA 2FBWB 2RBMA 1EU3A 1FGBD 1HA6A 1SYDA 3Q8CA 3MJ5A 1KLGD 4KGRA 1XXGA 3OW7A 3RMHA 3VYUA 2Z8LA 3AE3B 2K33A 1F0ZA 1OFFA 2EPBA 4BY1B 1LT3D 2IJ0A 5CGKA 1J7CA 4KKSA 3V96A 4RFBA 3P1MA 5M5YB 1DOKA 1YN4A 2JX5A 3IAM1 2WXRA 4H2AA 1JOKA 3PUWA 4ZHPA 4CQNA 4B08A 1C4PA 2F0HA 1SNCA 5EGTA 3IAS1 4FF1A 1TZOA 1FD7D 1G2SA 5EBCA 3AE4B 3MXUA 1V8CA 1DOYA 1LTSD 1SEBD 5A35A 1AZQA 1WSPA 4A55A 2A5HA 1F9PA 2NN6I 2WB1B 1DD2A 3P20A 1ZDXA 1VZ8A 1ET9A 4KV6A 1PUTA 3LXFA 2YYZA 3AECB 1D5XC 3OMGA 3H6MA 2D62A 2WQYB 1CQFA 5LHY1 4NMZA 1CM9A 2RSNA 2BDNA 2F4IA 2OEOA 1KAAA 3CRLC 1Q1EA 2D5DA 4IUTA 1O78A 2JZPA 4A90A 1LTGD 2L4NA 1BBXC 4P6VF 5CBAE 1WTQA 3IL8A 1GHJA 2K1BA 2MUYA 1NI3A 1ROEA 5EKKA 4WH4A 2KUMA 2Y0SB 3BS1A 2FHTA 5EPKA 1JICA 1WXQA 3K5OA 4NP5A 1KNAA 1L0XB 2VXWA 2F0NA 1DJRD 4KK7A 4RHSA 1ZP0B 3U7ZA 4YTNB 2HDEA 1K83B 3K58A 1QOGA 4NAMA 1F2RI 2QIEB 2F0DA 1RTOA 1YJJA 2FINB 4NJCA 1J9OA 1STAA 4YTPB 2D9UA 2BT6A 3KUPA 3SK5A 3SFEB 4DGZA 1EM7A 2PNRC 4DQOC 1GJXA 5C5MA 4IUVA 2PZTA 1XLNA 2OT2A 2H4OA 3BVZA 4IFDG 1FNWA 1D2BA 3B9JA 1JCKB 1TWHB 4QMGA 1TY2A 4KJNA 2RMMA 3U2SC 1WTWA 1YNJC 2WP8J 2OF1A 2KVMA 5AFWA 3RZDB 5TSSA 1EY6A 4ZKCB 2BS2B 3VR9B 2F1MA 1H9RA 3D31A 1JWUD 3G6JB 3C3LA 3L3OC 3QWNA 2EJFC 3OWEB 2VB2X 3MWYW 3AV8A 3QB3A 2F0EA 2ENBA 3NE5B 1PTOH 3NBHA 3SK4A 4US8A 1VMPA 2DN8A 2NZ1D 2EDGA 2CW0D 3LX0A 4BY7B 1TJEA 4IURA 1HTPA 4N6EB 5HG2A 3R2IA 3FRPB 3LWEA 2Q8IB 3C1FA 4KY5A 2DBYA 1D1IA 4BS9A 1WRIA 2R6GA 2VZKD 4MH8A 3A8IE 2D2CC 1XO3A 1F9RA 1ENCA 1TR5A 4ZQ3A 1EFID 4IUPA 1YJIA 1CK1A 1KDBA 2F0TA 3DWGC 3OSOA 1AW7A 4K5WA 1G91A 5C3XA 1C77A 1C48A 4ODGA 3MHBA 3NK9A 2A68C 1QNUA 1LTRD 3A7AB 1EY8A 1GUWA 1GUTA 3PIP3 5IGFA 2CU3A 2Z4HA 5G5HA 2WDRB 3TBIB 3IXSA 1ZYRD 3NVVA 4L6TB 1SFOB 3A7LA 4JWUC 5JPNC 4K5VA 1G6ZA 2L12A 2V0GA 4CKEA 2YEPF 1SNPA 3ND8A 3E9SA 4IALA 1PRTC 2B2WC 5KNBA 2L5TA 3TZUA 4OW0A 3OPOA 1QILA 1LO5D 5T1IA 3PZ7A 1FEHA 3T4AC 3IKJA 2ACZB 1I4HA 3GTKB 4DNRB 5EBDA 1C4QA 4JWSC 1V1PA 3P4QB 1U4LA 2PZUA 3CIRB 5D7GA 4HSPA 1DOXA 1WTOA 1QQRA 4REZA 1PZID 2LFIA 2IX3A 5EE1A 2E2IB 3PO2B 4DXGA 3I70A 1YMHE 4EQPA 1EEFD 1L5PA 1MPEA 1Y69U 3VYSA 3A8JE 4AS1A 3LB8C 3OWFA 3FEWX 4Q5VA 4Q2JA 1IBXA 1HA5A 4O1NA 3I4NB 3AU7A 1T6BX 1F9QA 2GI9A 4KI0A 2WV6D 2GB1A 4RGNA 1MGSA 3V3XA 3H91A 3S16B 1U4MA 1Y8OB 3WOFA 4E6IA 2B2YC 4F87A 1DOIA 4HTHA 2A6HC 3LYYA 1TY0A 3K5MA 3EGRA 4TMAB 5BYSA 1EY7A 1NAPA 3L9AX 2JSVX 2L52A 3VRAB 1VF5C 1LTAD 1YN3A 1JE4A 1TS4A 1UGJA 3ONAB 3GV6A 5JXVA 5C5LA 3D6CA 3PMFA 3SR6A 1ILQA 4A9AA 1PLFA 3M3YB 2CHBD 3SDZA 5CV9A 4FVMA 2F0MA 1A6XA 2J53A 4OO1H 3DM1A 2CJOA 4I7ZC 3MFGA 5I6YA 3RD4A 4ZLTF 1GAQB 4OIJA 5FO7B 4A3KB 4BA2I 3K6OA 1IKMA 1SYFA 3OIPA 1G291 1IHZA 3TMEA 3PUVA 3NUHB 3I72A 3S2HB 3Q8EA 4N9TA 3U52E 3R93A 3WDNA 4KMUC 1TS2A 1QOBA 3BYYB 4YWGG 2R61A 1TU2B 1CTMA 1OXUA 1MI0A 5I9OA 1MSHA 5EQ0A 1EWCA 3NTHA 1S5DD 3VRBB 4DU9A 4LJZC 1SXTA 1O7LA 1XX8A 2EY5A 2M0AA 2BTEA 3S2DB 2M00A 3AEGB 2WINB 1H9SA 1B50A 1I4XA 1Z47A 2W55A 2A69C 3W5VB 1F9SA 4A3DB 3K0YA 5FKAC 1JWMD 3T53B 2O4XA 2NVTB 4OO1I 1RDPD 3S17B 1QF6A 2XRQD 5T1GA 2V4DA 3U9OA 4CBVA 1JWAD 4XQNA 1K51A 3I4LA 4HKZE 1ESRA 4FO2A 4GZYC 2EYFA 2MPMA 4WQMA 2B2VC 2Q8RE 3FDTA 4C7ZA 2V3NA 5C44B 1G2TA 5M9OA 4NZLB 2FE8A 4KY6A 2B2WA 3PO3B 3HOUB 3J80L 5CV5A 3SEBA 3ZGZA 3E5SA 3PUZA 1NVID 3AEEB 1HZ5A 3J7YW 4YIJA 1I4QA 2KJXA 1I4RA 3EROA 2EYPA 1I4PA 3WCQA 3MAQA 2X69A 1E7PB 2N88A 5HURA 3IT4B 5K36G 3MXNA 3RZOB 2IWHA 1TKEA 2AWNA 2LUMA 3NVZA 3AEFB 1E10A 2XIWA 1OXXK 4DK0A 1CZPA 2Z4IA 1E2ZA 5K5PA 4WRDA 1AYFA 1VDZA 1R7SA 1CQVA 1EU4A 5NUCA 4CGYB 1IYVA 1D5ZC 4TRDA 1F2RC 1B9NA 4HJGE 3ZJTA 2PW5A 3BVMA 2Z1CA 1K8MA 3TUOA 2SEBD 1H9JA 1L4DB 4B9WA 1ET6A 2EYMA 1VF7A 3CU7A 3T16A 4IDIA 1S5ED 1PTOF 2F0LA 2DLBA 3AB5A 1CA5A 5JEAH 2AQ3B 2EY2A 1JWBD 3MZ5A 2WS3B 3P63A 3IAYA 4ZHOA 2B2YA 3ZYYX 3Q6SA 4XE0A 4ME5A 2B2UC 1O7ZA 3TP6A 4TSSA 4EVOA 1WD0A 4KD4A 4XQQA 2NVQB 2V4IB 2A74C 3X3NA 3P4SB 3CRKC 1FM0D 4XT3B 4OVZA 3B2FA 1XTCD 1SJHD 1STYA 4A3GB 1NSNS 5HI1A 1LV9A 1GUGA 3K5LA 1BUVT 1SAPA 3AM9A 2QMTA 4V190 1ZUD2 1XCQL 5C4XB 2LFNA 2B63B 1W6KA 1R4QB 3MXGA 1FNUA 1C79A 1STNA 2J7ZA 3FPUB 2RVLA 2JU6X 1B4OA 2JYOA 2G9HD 2ZW0A 1B1ZA 1K53A 5E1FA 2KACA 5CC4A 2IT1A 3EA6A 5LL6X 3AMUA 5MPOA 2G9DA 1JW9D 5D14A 2CW0C 2PYKA 2XVSA 1PGAA 1SYGA 1LT6D 1FCCC 1E0BA 2VZKB 1JQ4A 3AMZA 1QNKA 2BBCA 1L4ZB 1WCMB 1Y56A 2NN6G 5COYA 3BG3A 5DM73 4A6QA 3T13A 3AE1B 5EKIA 4KKJA 1ZPSA 4XDCA 3A56A 3QIAA 3NVWA 4WAFA 1TKWB 4Z9CB 4IUQA 3I8ZA 5FLXL 5C0XH 2K32A 4HKQA 5BN4A 4C7YA 2N0SB 4K8JA 1PFBA 4C1NI 1UAPA 2K6AA 3KLSX 1M8AA 4NW2A 1C8CA 1KTKA 5IOCA 3T56B 4PMWA 3NP8A 1EWHA 2JE6I 2IW3A 1I6HB 4GDKB 4KHZA 4R3DA 1KNEA 1EY5A 4C56C 2WXFA 2B2VA 1ZYRC 3BDCA 1QKZA 3OHXC 3A55A 5BMHA 1M4VA 4ID6A 4OZCA 1HZ6A 1MBYA 4S3SA 5CV6A 2WP9B 4ITKA 2C9OA 2H1EA 5JVG3 1LTBD 1SMYC 5G3LF 1ZDVA 1CHQD 3DUZA 2RQXA 2IX0A 1YQ4B 2K28A 2PKOA 1RWSA 3DEPA 3CQZB 2EYJA 5IODA 2PMZB 1SF0A 1ILPA 1VMCA 3CWIA 2MJ3A 5C0XI 2QSDA 2JA8B 2QKIC 1EY4A 3R3OA 4X3TA 3KBXA 4HEA1 3J81E 1E2WA 4HCSA 2KCCA 4IZ8A 4K2LA 1BF4A 2K3UA 4I65A 1ICWA 3FILA 2H88B 4FF4A 3V05A 3W2DA 2F0SA 3Q23A 2BDOA 2MH7A 1R4PB 4XDXA 1STBA 1SE4A 3J80E 1PRTF 1GUSA 3VR3A 1FNVA 1CT1D 3X3MA 4KN7C 1SBBB 4HMJA 5IGGA 3GTGB 1FR3A 3ABVB 1MVKA 1UWMA 2KN4A 5J1ZA 2XWBB 4L2YA 2F0PA 1V1OA 2N9KA 4KY7A 4RAUC 4Q0FA 4CHTB 2XRSD 2Q5WD 2LMCB 3VA7A 1RTNA 1ZXIA 3S1MB 4PQXA 1CFMA 3R2TA 1O80A 1PTOD 2F0KA 5CV7A 4YSZB 1D1KA 1KABA 2F0VA 2B8GA 2B2UA 3S15B 4MT5A 4RGOS 4J6HA 1TWAB 1KH0A 3HS0C 3GTPB 2H89B 3HUIA 4A3BB 1EQTA 2I46A 1SDFA 4JE3B 2MJDA 2PW7A 3DEOA 1VRAB 5G5GA 1TT2A 2KDMA 4F7XA 1IW7D 1NYQA 1WTVA 3DWMA 1N62A 1SIJA 3GS2A 1L0YB 5E4XA 1H9MA 1DXMA 2DYMA 5JEAJ 4O42A 4F8MA 4XQJA 1Q1BA 1Y1VB 2KECA 2KOLA 1B9RA 1OO9B 2XN9C 1L0VB 2N7JA 5A2QL 4KD3A 1SYEA 1II3A 1A70A 1FCLA 5KNDA 4DA2A 1NEKB 1A2TA 1FFUA 1KDCA 1FYCA 2SDFA 1XEEA 1WYGA 4MN3A 2B39A 4IQZA 2OHFA 3VR6A 4R8IA 2I38A 2W82A 1F2YA 1Z7TA 4KKUA 2IX1A 1T5XD 3S1NB 1IUEA 2QILA 2X6LA 1VLBA 2L55A 4DNTB 4G4KA 1YNND 2BS3B 5M5XB 3CKIB 4ZUIA 3M85A 2NWGA 1EIGA 1D6EC 4L63B 2PLPA 2JXMB 3HP3A 4A3EB 3TP8A 3HRZC 2ZXPA 3C8YA 4K2KA 3NS1A 3GQBA 1FXIA 2M19A 3NRZA 1EY0A 5JVH3 3S1RB 4NKLA 2WXGA 1U4RA 1QLBB 2WXJA 3ZJVA 2AQ2B 3RPFC 1PGBA 4A3IB 4M0WA 3URYA 5JPMC 2OXPA 2L32A 1A15A 4XT1B 5DM63 4QUCA 3AEAB 1MD2D 4JBWA 3I9V1 1B9MA 1D4BA 1LABA 4FNFA 2M9VA 2N55A 4RNAA 3MTSA 2F0JA 4LMQD 1VZ7A 3EUB2 4ZUJA 2E2JB 2ID0A 4OIKA 3SVMA 4DF7A 3Q8FA 5C4JB 3MP9A 4IN3A 3EVQA 1OXTA 3DMUA 1PFMA 3NTKA 1T5EA 4DAPA 2YEPB 4ZRPA 3FAHA 4DXFA 5FLXE 2JA5B 1VR9A 3G7LA 3FKIB 2WXKA 3AEBB 3OOCA 1N5WA 3MC0B 5C0XJ 4RA8A 3S14B 4CKBA 4G7ZC 3K7AB 1RHPA 2HDMA 4EE2A 3HVZA 1VCIA 5JAVA 3GTOB 3NBIA 5G3LD 3KLSA 1EZ6A 3P42A 1HEZE 1FXAA 1A3VA 3FVQA 1SYBA 3E6ZX 4WURA 5C2TB 4DAYA 2BE5D 4AQ7A 3MHZA 1BR9A 4K6LA 2LHEA 1PGXA 1X3QA 3MEHA 4XXEA 3AN1A 4QB4A 2QDBA 1MSGA 2JEBI 2JEAI 1V97A 4ZYSA 1WTRA 2ZT9C 3HOWB 1FO4A 1TWGB 5EE0A 2MP1A 2F3VA 4OGQC 2KQ3A 2KQ4X 4FXGC 2WDVB 2EYLA 2JA7B 1A2UA 1JWSD 5GXGB 2DNCA 2RDHA 3GTMB 2E3TA 3I3CA 1AFPA 1EYAA 4YSYB 5BYQA 2CQAA 3ZQ4A 5DEHA 4PMBA 1KDAA 3MXPA 2M2LA 4KKTA 3MA2B 5BN5A 3SFDB 3NXWA 5J39A 3SK8A 3I4MB 3QJYA 4HROA 5CORA 2J4XA 2F0IA 3W1SA 3ITPA 2ZXRA 1CJEA 1G8ZD 3KWLA 2PVGC 4OO1G 4EQNA 2B76B 3D3RA 3BIID 2LY7A 2RDFA 3TDQA 1NR4A 1HPCA 2WXMA 3IFTA 1U4PA 4KJOA 2L1BA 3UI3A 4R8NA 5D3IB 4XDDA 5EE9A 1R9TB 3PUXA 3LNNA 4HN7A 3ETRA 3J81L 2F0OA 5E6JA 4Y7NB 4DK1A 4X3UA 1JORA 4LAAA 1SE3A 3W9CB 1T3QA 4FF2A 1IGCA 1ENFA 2E2DC 2PPBC 3P4RB 2IL8A 5M3FB 1QCBD 3Q22A 1ESFA 4QIWB 3NQTA 4OL7A 3J7AF 1BQQT 2B2TC 2E74C 1Q10A 4HSVA 1P7EA 4RKLA 5KIXA 1ACCA 4FP5D 3ND9A 3PV0A 2HCCA 4UDUC 4L8JA 4BWGB 5JOBA 1BCPF 1I6VC 1EL0A 2A6HD 1HHVA 4A8XC 3MVVA 3NTIA 1Q90A 2WAQB 3BDLA 3QO2A 4L1BA 4ABNA 2F0UA 1QWYA 1JR0D 3U9SA 3BK1A 5E4WC 3KK7A 2W3SA 4ZOHC 2YU9B 4RF0A 1C4CA 1CI3M 3TEZA 3D8GA 3H8HA 4RGTA 2JSOA 3M7GA 5A2QE 3HOYB 2EYHA 3TSSA 4RKBA 3BWUD 5ISRA 2IGGA 2F3WA 3S9WA 5F2DA 4FYDA 2NB0A 4YSXB 4XYOA 3NQIA 3H3VC 3HOVB 1BOSA 2HUGA 2WXOA 1A3UA 1TKGA 2F0QA 1XLOA 5ELDA 1J8IA 1DONA 4V0BA 3T51B 2XSCA 1L6UA 3E0JA 2CVRA 2E75C 2PZWA 3H09A 1HUNA 2PQEA 2KAJA 3PO0A 1NUCA 4MACA 3VYTA 1S4ZA 4MHEA 4XWTA 3GTQB 3SHLA 3E56A 1QE6A 3AEDB 4LTUA 1GXDC 1SNMA 5H92C 3GP7A 3W3AA 2KA7A 4R9WA 4XWWA 1HFGA 5DAUA 2SAKA 1JC7A 3NPPA 4CKCA 1SYCA 4N59A 1I7HA 1XWEA 3S1QB 3H0GB 1D5MC 3BK2A 3KWVA 5CYUA 4B9XA 4HEDA 2QCPX 1EOTA 3F2UA 3QOLA 5JEAG 5EPJA 2E2HB 4OHJA 1RCVD 2A6ED 3JAME 4GDLB 5D65A 5HFYA 2KMMA 2BW2A 4KN4C 3J7AV 2W54A 1SNOA 2LKVA 1X32A 1L6VA 1QJOA 2LEKA 2ICIA 4ULLA 4XYQA 2PCFB 3K59A 2CJNA 2JYEA 3KBGA 5AUKA 2R3ZA 1LLRD 2WLBA 2L11A 2K22A 1TS3A 3HOXB 2F0FA 3L4PA 3N52A 5ELCA 1K8OA 4C3JB 5BN3A 3HVDA 1PTOB 1B3AA 1QB5D 1MI2A 3K5NA 1JMLA 1BMLC 2JYTA 2MJEA 5LNK1 3DXJC 1V1PB 5ELBA 2O5IC 4KX6B 1TWCB 4K8IA 1PTOC 1JQYD 2FMMA 4CJ0B 1F77A 2F03A 1RFKA 5IIFA 3VYRA 2QEJC 2KEEA 5ELEA 2Q8TA 4UAIA 3D4WA 1BNZA 2J0TD 2TMPA 1HRJA 3RLFA 2KCNA 4YTMB 4H0LC 2AUJD 2ICEC 4DN4M 5AUIA 1WD1A 1LT5D 5I6WA 5FOBB 1JOQA 3I73A 5DNFA 2VB3X 1IW7C 1STEA 2FUG1 4IOIE 3IT6B 2ONQA 4RCOA 4HMIA 4HR7B 1HQMC 1ZKOA 4JK1C