2QEJC

Crystal structure of a staphylococcus aureus protein (ssl7) in complex with fc of human iga1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
191
structure length
191
Chain Sequence
YDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQNHQLFLLGEDKAKYKQGLQGQDVFVVKELIDPNGRLSTVGGVTKKNNQSSETNIHLLVNKLDGGNLDATNDSFLINKEEVSLKELDFKIRKQLVEKYGLYQGTSKYGKITIILNGGKKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for evasion of IgA immunity by Staphylococcus aureus revealed in the complex of SSL7 with Fc of human IgA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords IG ALPHA-1 C REGION
total genus 48
structure length 191
sequence length 191
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qejC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qejC01
1XXGA 3R8BA 1I4PA 1L0XB 1RDPD 1EWCA 1LT5D 3DWAA 4RHSA 1PZKD 4UDUC 3EA6A 1JR0D 2ICIA 2NTSA 1PRTD 4K6LA 4RHRA 1AW7A 1FNVA 1HTLD 1STEA 1PTOC 1HQRD 1FD7D 5ELFA 2IJ0A 1FGBD 1SEBD 4O1NA 1I4GA 1LTRD 3R2TA 1S5CD 4RGTA 4RH6A 4DXGA 1CK1A 4Z9CB 1SJHD 1JCKB 1PZJD 1B44D 1I4RA 1KTKA 4L6TB 2RDGA 5ELCA 1KLGD 1PRTF 1I4QA 1EFID 1JWMD 1JQYD 1ENFA 4RGOS 1LTSD 3SEBA 1XTCD 1I4HA 1SE3A 4BWGB 3CHBD 2RDHA 4NZLB 1CHPD 1HA5A 1YN4A 1LTGD 3BYTB 2SEBD 3TSSA 1F77A 1QILA 1UNSA 4OHJA 5ELEA 5TSSA 1LT6D 1PTOF 5D3DA 5I4DA 2Z8LA 2QILA 1LT3D 1PTOH 2CHBD 1SE2A 1CT1D 1SE4A 1SJED 1SXTA 2AQ3B 4TSSA 1YN5A 3BVGA 2G9HD 1HXYD 4RCOA 1TS2A 1JWUD 1LTAD 1BXTA 4L63B 1PYWD 1UUPA 1L0YB 1YN3A 4RFBA 3KLSX 2AQ2B 1TY0A 1G8ZD 1ESFA 1LTBD 4RGMA 1PZID 1TY2A 2IPKD 1LO5D 2XRSD 3BVMA 5FKAC 1V1OA 2AQ1B 1EEFD 1V1PB 1I4XA 3MFGA 1DYQA 1CQVA 4DXFA 2QEJC 4ZYSA 1S5ED 3O13A 1BCPB 1BCPF 1M4VA 5D3IB 3GP7A 1ET9A 1RD9D 1DJRD 1S5FD 2TSSA 3MC0B 1TS3A 2XNAC 1EEID 2XN9C 4RGNA 1LTTD 1RF2D 1LLRD 1S5BD 1BCPD 3OWEB 1D5MC 2WV6D 3R2IA 1KLUD 3EFXD 1EU4A 1PRTC 3URYA 1D5ZC 3BVZA 1LT4D 1S5DD 1D5XC 1T5XD 1EU3A 3DWQA 1GOZA 1TS4A 1MD2D 1JWSD 1FNUA 1CHQD 1PTOB 2R61A 1D6EC 1B1ZA 1BCPC 1V1PA 1AN8A 2O2LD 5FK9C 1LTID 4C56C 1SBBB 3BYYB 1ET6A 3DWPA 5ELBA 2XRQD 3V05A 1RCVD 3W2DA 5ELDA 2NTTA 1PTOD 3BZDB 1FNWA 2J4XA 1TS5A 1PRTB
chains in the Genus database with same CATH superfamily
4IUUA 1I4PA 1L0XB 1FGUA 1OXUA 2KENA 2WFWA 4DA2A 3PF5A 5E3FA 5IGFA 2NBVB 3J9CA 3EA6A 4JI6Q 2WXHA 4EZKA 2NTSA 2ENBA 5C4ZA 5CHFA 3CMAA 2A6ED 1S40A 1VLBA 3OIPA 4XE0A 1CUKA 4WAFA 1G6JA 4ZRZA 1SROA 4KIKB 1WTPA 1NBFC 4QL5A 3HOUG 1WYDA 4WIPA 4ZHPA 5C4XH 2JU6X 2ZPYA 4ARIA 1G91A 3QB3A 1T0QC 4D2KA 2JPHA 1VF5C 1FD6A 2CQOA 1BNZA 1CK1A 1G291 3IG3A 3KOJA 4OXPA 4MGZE 1I4RA 2E2JB 1N60A 4HJGE 1D1IA 2KWVB 1H9KA 2NVYB 3EN2A 2ZJDA 3P4QB 4RCNA 4IC7B 2ZCCA 2RA4A 5I6YA 3K7UC 5CYUA 4PMBA 3I4LA 4BBRG 1J5EQ 4TRDA 2K33A 4KY6A 2NYZD 5DM63 1N34Q 2JZZA 3HIZA 4DBGA 1FCLA 2R93B 4GLAC 2C9WB 1WGKA 2IY5B 3A7AB 4X62Q 3PRZA 3TP6A 1WGHA 1ZXTA 4UP9A 2N9EB 3MP9A 3TMPB 2PCFB 1K28A 4XQJA 3OAWA 2K7VA 4AYBB 5JAVA 1WGGA 1FYCA 4PYUA 2F0DA 1YI2A 5J3BA 2PQAB 2DNEA 3P1HA 4X3SA 1ZEQX 5CV7A 3VYTA 4AIMA 1JJGA 4MM3A 1JRPA 4LNKA 1TY0A 4H02A 3GTOB 3OTOQ 4A90A 4N8FA 3A9KB 3FILA 4KKTA 4RGMA 2AEHA 1SFOB 2BYVE 1WX9A 2FCQA 2D0OA 2LUEA 4YHHQ 2DAJA 2KAJA 3AB5A 1HTOA 1DYQA 4NPSA 4CHKA 3WA0A 2QSDA 2K05A 4POGA 1EZ8A 2D3CA 5JOBA 5D2MB 2QJLA 3TRZA 5JHBA 1T0YA 1P98A 2RBMA 2XN9C 3FKIH 4KLKA 2LASA 3TUOA 3ZRCA 1BCPD 4A3EH 1ZDVA 3K0XA 4K7UA 2DAFA 2M56B 2JY6A 1KDAA 1F2MA 2PZTA 4GKJQ 2CCZA 2ALYB 3F2CA 4FBJB 2OJWA 4ITKA 4JC0A 4A3FH 2KA7A 1H9JA 4IWPA 2A6HC 4DV4Q 2ZM6L 3HOWB 2JT4B 2KC2A 1F9SA 2M1MA 2F0KA 4EQNA 2R7ZB 2O2VA 4HVBA 2WAQB 2LWPA 4B3ML 4DV3Q 4YSYB 3MVVA 1CTMA 5IP9H 4MH0E 4MEMA 4ZCKA 4R4TA 4GKKL 3ABVB 5M3FG 2K6QA 1R4QB 3PIPA 2KO3A 2WXMA 3QAQA 4FJVB 4WAAA 2O5JC 1JB7A 4JLCA 2K6AA 4HEDA 4IURA 4GU2A 4RM9A 1K52A 1L1OC 5IODA 2J0KA 1EOVA 2RHSB 1JR0D 2K1FA 4UY8C 1C4QA 1EY6A 2OEOA 2L0CA 3F2DA 4DV6L 3OW2A 5JJZA 3PO2B 1C76A 4RKLA 4X6AH 1VZ8A 2V1CC 4JV5L 4NPNA 4E74A 4P75A 4KHPL 5ELFA 4Y7NB 2PI2A 2WNMA 3A1QA 5T1GA 1LTRD 3I73A 1BDOA 3LWEA 2ZXOA 2W3SA 2E2HH 3QK0A 1SSOA 2R7ZG 2RF4A 1VQKA 1WX7A 3SK6A 1HEZE 3M62B 3M4QA 3H1UA 4FULA 4LNIA 1FFVA 3S2HH 5KIXA 1TWCH 3WAMA 3T1HQ 3S2DH 1STGA 4XZ4A 3MAQA 5FR6A 4PNYA 1A70A 4BWGB 5M5WH 3AXCA 4ZOHC 1B3QA 3N6RA 4AJWA 1QNUA 1DD2A 4F7ZA 2OF1A 1YD8U 3AE3B 1RKNA 1IBKL 3L0OA 2MH7A 4WURA 4LUZA 1GUNA 3HS0C 4GDKA 1PYBA 1I50H 3AE8B 4RMAA 3TMEA 1PH6A 4EQ5A 2CU1A 1HQMC 2KMMA 1V1QA 2BDNA 3ULPA 4IPCA 4POFA 3NS1A 4GGQA 4LF4Q 1CT1D 2R93H 1D7QA 2KFJA 2AQ3B 4A3EG 4TMAB 2KBNA 4XQNA 2V4LA 2G4DB 4J6IA 1FO4A 4PT5A 2PPHA 3K58A 5M5WB 2VH1A 4GZYC 1YX5B 5CHWA 2AWOA 4GOPA 2IL8A 1QQRA 2LVOA 2SNSA 2UU9L 1SGHA 1A2TA 1RTOA 3PHWB 3I4MH 4W9DA 4RNAA 3DBLI 2F4IA 3VTVA 5BMGA 1SF0A 3X0WA 1E3PA 1NAPA 2KCMA 5JEAJ 4DV2L 3GTPB 1X32A 1LO5D 4LF6L 2DYMA 4XIGS 4P7IA 4L5QA 4DV7Q 4EUTA 2N9PC 5BN4A 4KZCA 4XYCA 5A2QE 4XWTA 4APVA 1T9HA 3K5LA 2ID0A 3P4SB 1GB4A 4L8JA 3ZTDA 1MG4A 4RG1A 1F2RI 5C44B 4II3B 2LY7A 3IAS1 3KYHC 1MVKA 1R7SA 1Z5SB 3ZIMA 2MJ3A 2MJEA 5IWAQ 4FJYA 4ZRQA 4LLGM 3APDA 1I7HA 2QHOA 1X3EA 5AUKA 4A3KH 1J0GA 3G7LA 2BYTA 4A93G 3HHMA 1QZGA 4XX5A 4BS9A 5L83A 1XLNA 3FPPA 2EXDA 3NSWA 2HTHA 1ENCA 1UD7A 3UQBA 4OZBA 5KHQA 4L2YA 2NBFA 1XMOQ 1L1OB 5CORA 3AMUA 4OZCA 1SSNA 5HKHA 2IO3B 2BDOA 2JYEA 2ICEC 5IYBH 2R7ZH 4QB4A 5DCNA 4NAMA 3K5MA 1R4NB 1JWAD 1HNWL 2E3TA 2SDFA 3CCVA 5IN7A 2KDMA 1WTVA 2KC1A 2Q5WD 1E0BA 1CKOA 2C35B 5BR8L 4A3EB 2EZVA 3J81j 3ER0A 1YEZA 2W55A 1WZ3A 2LXAA 2WP9B 1KIXA 3R3OA 3UGBB 4LFBL 2K5QA 5M5YH 3CC7A 4C3JG 4DR1Q 2UU7A 2UUBQ 4HKQA 2WAQE 1PH1A 2JUOA 1VQ9A 2I2YA 4F7XA 2NN6I 1I6HH 1XMQL 1XTDA 4ZUIA 1ZYRD 3ZJUA 2EQSA 4RH6A 2MP2B 2CHZA 3CKIB 3GTMH 5DPSA 1PZJD 2EMSA 3AU4A 2A6EC 3SGIA 4NXNQ 1OGWA 3GS2A 1IBXB 2DY7A 1LYLA 4XYQA 5E7NA 1ENFA 4DR7L 2ZTCA 3M4OB 3N32A 3CQZB 3CMEA 2PW9A 4DR5L 3MHZA 4MJSA 4HMJA 2F0HA 1K73C 3HOVH 1VJKA 2JA5H 3M95A 5DM73 1EZ6A 2D9UA 4NDXA 3ONSA 2JSOA 1P7FA 3K81C 1KH0A 3QX1A 1TKWB 3IT4B 3KF8B 4K2KA 3U58A 3CAMA 1SE9A 4A3JB 1TZOA 2INPE 3CF6E 4QUFA 4PZ8A 4A55A 4KHZA 2IGDA 4BKGA 1YNND 5FJ8G 1I3QB 4DPGA 3MTSA 2YV5A 1CMXB 1MSGA 1MHWC 2KHWB 2JF5A 1HXYD 2K5PA 1M90C 1NBWA 4FDBA 3S16B 2KWCA 2HQEA 4IUQA 3VA5A 2YVCA 3PLVA 4W9LA 3Q6SA 3P63A 1L4ZB 1YNJD 1DGSA 4QJFA 5DLQE 2LFIA 3HZXA 1WXQA 2IYDB 2BWFA 1K83B 3VDYA 3HOZH 1OQRA 2X69A 2J53A 2JX5A 3DPDA 3H3VI 3C1EA 3VDZA 2XK5B 1EIYB 3I90A 2M2LA 2NVXB 2KANA 3QARA 5IE8A 2F0MA 1V1OA 2O2VB 5C0XG 1HNZQ 1CQVA 4OX9L 1N32Q 2L05A 4DV5L 2QC8A 2KN5A 1XX8A 1EUVB 1YHBA 3ZDMC 1SR3A 1CI3M 1RD9D 3HOUH 3NE5B 1ZUD2 3KQ4A 2K5NA 2R7FA 1UF0A 3AE4B 5EE9A 3T8MA 2GVBA 1SB3C 1A3VA 4V190 2QDLA 1WXMA 2GRIA 3HOZB 3R2IA 1ILPA 3NVWA 1R4NI 3U9OA 3I4NB 2KK8A 2HJ8A 4W9KA 1CSPA 1EF5A 1Z9FA 2DUDA 4GN5A 3SK8A 2Z0DB 1A15A 2LRWA 3V2TA 4RMFA 3PUVA 4K3CA 2Y5CA 1VCBA 2H88B 1YJ1A 4ME3A 2K32A 1D8LA 4E6IA 1EQRA 3DEPA 1X3FA 2M0AA 1WTOA 3AEDB 1LTID 4JI7L 1NJIC 2KVMA 5JJLA 1UAPA 3APCA 4HCPB 3IVFA 1N6ZA 3B2GA 4BKSD 5J18A 5ELBA 2AHOB 2PEAA 4YT0B 1C48A 5IT9L 5C3JB 1PTOD 2Z59B 1Q3LA 1Y56A 2I5LX 1IW7C 1BBWA 4BY7B 3AECB 3VTUA 2EYLA 4LNNA 1B2TA 1RDPD 5CV8A 1RFAA 5HY6A 1YOVB 5E6OA 2WXIA 3RMKC 3PF4A 5CX3A 2VQFQ 1EYCA 2HDMA 3BG3A 3HP3A 4IPDA 1TTNA 3AI5A 1AW7A 2M8SA 4OEMB 2L5TA 3QG1A 3BDCA 1ASYA 1E9MA 1CKMA 3MA2B 2ZTDA 2PO4A 1YVCA 3RN5A 3TN2A 4IOCA 1M1KC 4JI4L 2YTVA 3PSIA 2DYOA 2VQFL 2FMMA 3JSVA 5LMUQ 1IBLQ 4FJZA 4NQLB 4A93H 3RNGC 2K52A 4DR6Q 1WJUA 2A68C 4OWXB 4C3HH 3Q22A 1N5XA 1XNRQ 3AU7A 1ICWA 4Q2JA 1CHPD 1HA5A 4X66L 5C0XH 1E7ZA 2QDFA 2Z0SA 3QC8B 1RL2A 2XIWA 2YLMA 4WORA 3F2BA 5DPTA 4USAA 1EWYC 4LFAL 1VQNA 1B70B 2CWAA 4CDCC 3HOWH 2CHBD 4DF7A 5JEAG 5IP9G 1A63A 2DN8A 4O0AA 5IYCH 2I1JA 3DWMA 3PUYA 1T0RC 3J81L 2XBBC 1U4RA 5KGUA 1L5PA 5EKLA 2KLGA 1YN3A 3TDQA 2BH8A 1K50A 4WRDA 3T1YL 2B2TC 3S15H 2WXQA 1WE6A 4EVOA 1G2TA 4LUVA 3CCUA 5CV5A 5FLMG 1B9MA 4LF8Q 5IAAC 1WWTA 4TKNA 2LD9A 2WP8J 2Q8IB 2ZNVB 5IOIA 1MJEA 4GN4B 2JXXA 3AU5A 4YTNB 4JPBW 2F0UA 2F4VL 1S5ED 3KH0A 1QOFA 2K39A 4A76A 1YHQA 1EWHA 2B63G 4I7ZC 3WOFA 1N32L 2KDBA 3DVGX 4LCDE 2WB1G 3DXJC 3VVWB 4C7YA 3P4PB 1GUSA 5EE3A 4IALA 1KLUD 4GNXB 2W3RA 3K7AB 3U52E 2BA1A 4X3UA 1WGYA 3O65B 4H13C 4K2LA 2JWUA 4BXXG 3D6WA 3LNNA 4ID6A 3FILB 3U7ZA 2JEBI 1E24A 4MZ9A 2OWOA 3AFQA 3RNFC 1U4LA 2NVQB 3ZNID 4A3MG 1D3ZA 3KJOA 1YJJA 4C2MH 3T3NA 3OJ3A 4P73A 3KDFB 4AYBE 1XNQQ 3H7PB 1XWEA 1STYA 2Q2TA 2R2OA 4OVVA 1K3BC 3ERSX 2DWQA 3PUZA 3Q2AC 4R4CA 3DDCB 1ET6A 3I3TB 2IX1A 2JE6I 4ZQ3A 3ICEA 1K8OA 2CR5A 5C4JH 1DOMA 2F0GA 1HRJA 3GB1A 3ND8A 2W9NA 2Z0EB 5CBAE 4C3HG 4CHTB 4DR5Q 1PGAA 1QOAA 1WJ4A 4OWTB 3CCQA 3BJUA 4W9HA 2Z6KA 2QIEB 2MRPA 4X57B 3I4MG 1PQSA 2PMVA 3DWAA 2KD0A 1TT5B 4KN4C 1CJEA 4ABNA 4ILWA 3Q8EA 1GUWA 4M02A 3HOWG 3TCAA 3NVYA 2CH4A 3DEOA 4QIWB 2K9XA 4JWSC 1JW9D 3H6NA 3IBEA 5KYIA 1DOIA 1V9PA 1FCCC 2F0LA 2FNJB 3CCLA 1YNNC 4CDEC 3PZDA 4ZRKA 4X3TA 1E7VA 2DNCA 1OQQA 1T5EA 3Q23A 1KLVA 3UIOB 2KVRA 4DR4L 4QQBX 1UWMA 1F0ZA 3QIJA 4RGOS 3HOYB 4LJOB 1LTSD 4LW1A 1EL0A 5C44G 5D6JB 2DX5B 1JE4A 4X3KA 4PZ6A 3C8YA 3MJ5A 2AWTA 4IUPA 1N8RC 1EUJA 5LHY1 4NZLB 1ZDXA 2SNMA 4XT1B 3RLNA 5CGKA 3TSSA 2K8CA 2L83A 3HVDA 3KBGA 1Y1WH 2H4OA 5ELEA 3FRPB 3J80i 3AEVA 1P3QU 4IUMB 2MCNB 1H9RA 3EHVA 5G2NA 1NYRA 1JB3A 1LABA 3Q3FA 1EQTA 1SJED 4MM3B 3VXWA 1HUMA 2OQ0A 1NTGA 5AJ3Q 2K3UA 4LDTD 1WTQA 3ZJVA 1EY4A 2MO1A 1JWUD 1N33L 1TWAH 2JRIB 3G71A 4HIOA 3U4EG 2KXJA 1S3OA 2RCFA 5L95C 4H7BA 5DEHA 4KV6A 3QOJA 3S1MB 4CJ1B 5K36G 1WSPA 4DR4Q 2AQ2B 2OEDA 4G3XB 1WTWA 1EQQA 4DR6L 4C7ZA 4KHVA 1LM8B 1FXIA 4DK1A 1P7EA 3P2BA 4YWMA 3A4SC 1O7IA 1STAA 1TY2A 4F8MA 2XRSD 1WXAA 3P4RB 4P16A 5FO9B 3CW2C 3V6CB 2JQOA 3VUYA 2ZJQA 1PXUA 4MIUA 1PDQA 2G4SA 2F3VA 4LAAA 3Q24A 3T9LA 4CKCA 2N9LA 4W9JA 4EE2A 3R7RA 3OWFA 5IT9E 1EEID 4A3DB 2K50A 2R93G 2L32A 4WJNA 1RF2D 1IP9A 2V4IB 2IO0B 1HTPA 3E3XA 1VQ8A 1BF4A 4W9IA 3NK9A 2AL6A 1UBIA 3GE8C 2K8HA 3HRZC 1L2NA 1STBA 2DZJA 4KMUC 4S3SA 5HGQA 4OELB 2MX2A 1FRDA 4KSKC 2N78A 4FXKC 4WFN3 2VB2X 5M5XB 4JE3B 1BCPC 1SAPA 2B2YA 1XEEA 1GO3E 1V43A 1UWVA 4GOPB 2MO0A 2KNBA 5LNK1 3HOVG 4B3TL 1C4CA 1IW7D 4M00A 1RJTA 4BA1I 2KLCA 1PH5A 2C9OA 4FF3A 1WR1A 3Q8AA 3NRZA 2KWUB 2KKCA 4ACFA 4BOZB 2FJ2A 4KD3A 2W54A 4WJOA 2RHQB 1QUQA 2EY2A 3U50C 1FNWA 2J4XA 3KUPA 5EAYA 3I5JC 4HKZE 4OO1I 1YBYA 2HCCA 5IGDA 3QHTA 1E8ZA 3B9JA 3A9JA 2F0IA 3Q3MC 4A4IA 1EWCA 1JICA 1Y1WG 5C4XB 3HOZG 3KDFA 4WWPA 1L1OA 2GI9A 1EM7A 1TWGH 1WVLA 4B3SL 4GOCA 4QY7A 5EPKA 3GTKB 3K80C 4A3IH 2F4VQ 4M01A 2KVZA 2L4NA 2NVXH 1X9NA 2CKZB 4J6HA 4O1NA 1OTCA 4JL9A 1V8CA 4TKOB 3RPFC 1Q10A 3QCAA 1I94Q 3TIXA 3L9AX 4FA6A 4Z9CB 4DV6Q 2FCMA 2HTME 2NMQA 4XQQA 2EOTA 1AZQA 2RDGA 5K36H 2NCNA 3L13A 3K59A 1EFID 3RYTA 3W1SA 1N62A 4ZRPA 1E5WA 4N9PA 1TWAB 1I3QH 1SE3A 2IZVB 4H2AA 3S2AA 2G9DA 2K03A 1EO6A 1AWDA 5E6NA 3KF6A 1Y8RC 4IFDG 4XDXA 1PFSA 2ATWA 4K0KQ 1Y8PB 1X1MA 2DENB 2BTEA 2OOBB 1LGRA 4IUNA 4HIMA 3U4ZA 3STBC 3ZTCA 4DAYB 4OZAA 1CFMA 5BYSA 5CMDA 3FVQA 4DFAA 1L7YA 2XVSA 2N49A 2NVQH 1XO3A 1LT3D 1XCQL 2GLSA 2A68D 1Q82C 2D62A 2WDVB 4C00A 5IGEA 5GAEC 1J7BA 2AWNA 1GM5A 2JJQA 3NOBA 4X66Q 5EBCA 2PKOA 4R9WA 3N1YC 3ZNGC 1MPEA 3B1LX 3A5ZB 2IGGA 4WJQA 1LTAD 3I4NH 4DK0A 3G6EA 2BPSA 2HIXA 4YWKA 3A5UA 4N58A 2VW9A 2DZMA 2X8XX 4DR7Q 1E8XA 2QF7A 4MDKE 1K3RA 2KHSA 2FUG1 4NXNL 1LTBD 1XQQA 1N61A 2LMCA 3IAM1 2XTIA 5AZHA 2AQ1B 1VCIA 4LF7L 1KRHA 4WWNA 2GOWA 2PZUA 3Q69A 2EY1A 2PE9A 5C4XG 3I7FA 2NN6G 5I6WA 4K7SA 1ML0D 3ERQA 1XMQQ 2LGIA 3N1XC 2JSVX 3VAWA 2E75C 3Q6BA 1F1HA 1WR6E 1V86A 4JGHB 2XNAC 4A3CG 5G3LF 4Q0FA 1S5BD 3Q3OC 4B95A 3EBEA 5IGBA 3T16A 3PO3H 3S24A 3S15B 2O6VD 4C3JB 2WV6D 4HCSA 3NVZA 3STBD 4HROA 3V61A 4DR1L 4K8IA 2GBKA 3GZNB 2YEPB 4LFBQ 2MUYA 1QLBB 1HZAA 2HQLA 2L1AA 4J3OD 3N9YC 1YJIA 3MTNB 1JWSD 1UE5A 1CHQD 5EJWA 3FMCA 3PGZA 2FE8A 2CVRA 1R4PB 1B1ZA 1E8WA 2WXGA 2MBBB 4W9GA 1VQPA 1HNWQ 1TKGA 1STHA 3CF5A 1WCMB 1JMCA 4C56C 3CRLC 2RSUA 4Y52H 1B3AA 3LWUA 3VR8B 1WM2A 4HLEA 2IW3A 4A3FB 1IPGA 3OLMD 4HTHA 4AQYQ 1RFKA 1HZ6A 4A3GB 1E6EB 1UEAB 2A74C 1U4AA 5JEAH 4K3BA 3WALA 1HFGA 4IPGA 1NY4A 3HM3A 4KGRA 5JVG3 3P1MA 3GTGB 4M8AA 1SRUA 1PH4A 2DYBA 4WWMA 4C3IH 5T8IA 2WWZA 3MC9A 3KUCB 1Q1OA 2LGXA 3NENA 2KOLA 1YX6B 1KXLA 2Y0SE 5MPOA 1OXSC 4QCLA 1FNVA 1UEBA 1STEA 3JAML 4ULLA 3C2PA 4DV5Q 4K8JA 3BU2A 4EZJA 2KJXA 1FGBD 1FXAA 2MLBA 4CO7A 3OPOA 3KWLA 5C23A 2N7JA 3M9BA 2KTRB 1H9SA 2F0FA 2WB1E 2QGQA 1SJHD 4FN2A 2BA0A 3HKSA 3GTOH 4MJSB 4A3LG 3AYHB 2LEKA 2R7DA 4PS3A 2JVCA 3ML9A 3HOXH 3TZDA 4A3FG 5LXIB 2JXMB 2GBRA 5AZFA 1A3UA 2YEPF 4ODGA 3L4PA 1I42A 4HIDA 5EPLA 1YN4A 1LTGD 1P16A 5KNBA 1NMGA 5C5LA 2CQAA 3A54A 4C1NK 4B3TQ 3S17H 2RR9A 4LK0M 1LT6D 1OXVA 1PTOF 5D3DA 3SE0A 3CC2A 1DONA 2UUAQ 4QGUA 2R92G 2IHEA 4A3CH 4HJ8A 5M3MH 4JQWC 2D2CC 4KK7A 3Q8CA 3UINB 5C2TB 3BVGA 4M1UB 2QA4A 1WTXA 3K9PB 4JBWA 3EFUA 4DHZB 2M9VA 1L0VB 2JA6G 1KDBA 3PGEA 4DHJB 3S1QH 3KF6B 1IHZA 4N9TA 1L6UA 3AFPA 3U9SA 1YZ6A 2V3NA 4P6VF 4CQNA 4HSVA 5L37A 3A9KA 1DZ1A 5FKAC 4A3IB 1BBUA 1W3SA 4US9A 5EE1A 4JI1L 4DXFA 2VUMH 1WOCA 1PA6A 2VZAA 2O6VB 2H1EA 3AH7A 1GKHA 4XWWA 4IFDI 3QR8A 3I56A 4LJPB 3N1ZC 5IP7G 2N4FA 2K5HA 1VQGA 2N7DA 5JJIA 2IY1B 4GB9A 4CDFC 4L1BA 1XLPA 1WTHA 2FUHB 4CBVA 1D5MC 1H8CA 4P2CB 1JALA 2MP2A 3AMZA 4WJ3M 2JYTA 3KLWA 4AQYL 2VQEQ 1LTLA 1YIJA 4W9EA 1JC7A 1TS4A 1MD2D 3S14B 3T53B 1EY9A 1B50A 4C4VA 5E1FA 4DV1Q 2NUCA 3I3CA 3H0GG 1I5FA 1Q46A 4LJZC 1B8AA 1GUGA 3J7AV 2M19A 2WU2B 1LM0A 2PQEA 2WXLA 3QWNA 2RSNA 1HH2P 2AUKA 4C2MB 5C4HA 1F2RC 1NI3A 4LNOA 5CV4A 1LFDA 4BY1H 1TR5A 1GAQB 2BB5A 1ZE3D 2BCOA 2YTYA 2KTRA 3MHSD 4J15A 1T0SC 2LMCB 1YIWA 2Q2UA 4PS7A 3RFZB 1F9QA 3G6JB 3M4OH 3BZDB 3I2ZA 2R3ZA 4K7WA 3E0EA 4HPMB 3MHBA 1TIID 2XGTA 3R8BA 1R9TB 1WRIA 1VDZA 5G3LD 2REXA 5BYRA 2K1BA 3C1FA 3MXNB 2ZJRA 2JA5G 4JI4Q 2F1MA 4BXXH 3TL5A 1TVXA 1JQ4A 2ICIA 1KF6B 3EGRA 1WMHA 1KM7A 3PT2B 5HI1A 3J81E 1XLQA 4LF7Q 4IDIA 2EYMA 4OGQC 5JPNC 3UI3A 2Z4HA 4KN7C 4HCEA 4DNTB 2D11A 2O5IC 4HN7A 1IYUA 1GG3A 1TGZB 2UWQA 3AEGB 3J80E 3UQAA 3C46A 2ZPNA 4G57A 1LUZA 4IJHA 4IKGA 5KRUA 2Z4IA 1QOGA 4BKSA 2BQQA 4DV0L 3H7PA 1J7AA 2YTXA 1JWMD 1PHJA 4HDOA 2CW0C 2ZCBA 4XYOA 4IG7B 2WKCA 4U673 1C7YA 1HR0Q 2UUAL 1E22A 2Y5BB 2ZNVC 1QT9A 4FHKA 4MTKA 2M0XA 1VQIA 2LXKA 4ANWA 2L12A 4ZLTF 1F77A 1WCMH 4P74A 1XNQL 2PQAA 1V5OA 4EKUA 3D4RA 2LXJA 4IN3A 2KECA 2C7MB 1NDDA 3FKYA 4US8A 4K0KL 3A8JE 2UUCL 3GTLH 1FEHA 4JI7Q 4A3MB 5AEKB 3AEBB 3IL8A 5TR5A 3HOVB 1OO9B 2BOSA 1ICFB 1PFNA 2EJFC 3S17B 2A5HA 1Y69U 1YN5A 4OVUA 1YJNA 1AYFA 4MNOA 3NWSA 5D14A 2HCIA 5COYA 2A1AA 3CQZH 1L4DB 1N5WA 1A8VA 4LWCA 1T6BX 2B3AA 1VQHA 1E2VA 1QNKA 3DM3A 2HJ1A 4ANUA 3AM9A 3H0GH 4OVZA 1JMLA 3NY5A 1PZID 2M4NA 3BVMA 2MWSB 1V1PB 4KHPQ 2KN4A 3DHHC 3OOCA 1PH8A 2I07B 4L23A 3EIVA 1SFOH 1PFMA 1M4VA 2ZVNA 1HNZL 3GP7A 1ET9A 3DVNU 3GZNI 5C3EH 1QVFA 4H0LC 2WXJA 4RGNA 4IM3A 3I4MB 1LLRD 4LNQA 3VYRA 2PJHA 1V80A 4NJ6A 5DPRA 3SHQA 4NB3A 4L5RC 3U8ZA 4KGTA 1EYDA 2MFIA 4JI6L 3TS2A 5IGGA 4A3GG 3GTGH 4A8XC 3ND9A 4LMQD 2WDRB 1BBXC 3S1NB 3OW7A 1GHKA 4ANVA 1ZKOA 3DUZA 4XXEA 3RT3B 2AUJD 3MEFA 4K5WA 3ULLA 3P42A 2RQXA 4FF4A 2O2LD 5A2QL 2N3SA 2BH2A 5HHDG 1TQOA 4HSPA 1JJ2A 1S72A 5ELOA 1B9NA 2D5DA 2KX3A 2HUGA 2MJ8A 1ZOYB 1U5KA 3K9OB 4A9AA 3HOYG 4DV0Q 1AE2A 1RODA 4DV4L 1Q5WB 1H4RA 3AULA 2B39A 4JI0L 3V05A 2BKRB 3ZGZA 3NBHB 5C6AA 3W2DA 4YTMB 1SMYC 4DNRB 4YWGG 1Y8OB 3A8KE 2BWES 3JW0X 2L52A 5J2RA 1P0RA 1SNDA 1GJZA 1JOQA 2NS5A 1LT5D 1IGDA 3DHIC 1PZKD 4DK5A 2HD5B 3W1YA 1VQLA 4MT5A 1TIFA 3N20C 1WD0A 4S17A 3HOUB 2EYPA 3H6MA 4QF4A 2PIAA 2F0NA 3W1SC 3TEWA 1CZPA 4JOIC 2EXZA 4KX6B 1C9OA 3P75A 4A6QA 1P8LA 2RSOA 1SEBD 4LDTB 1HCZA 2MSED 4FO2A 4B08A 2UUBL 1YJWA 4NW2A 4RGTA 3SFDB 4BFRA 1LACA 3DM1A 3QIAA 2YU9H 3ZJYC 4HIKA 4EX5A 4LF9L 1W6KA 1VRAB 1KTKA 3LJ3A 2K75A 1KNEA 1O7ZA 1NENB 1PRTF 3ZNHB 4HPPA 1XTCD 1I4HA 1WFQA 2M00A 1A6XA 1VQEA 5BYQA 4IOAA 2LKVA 4HMIA 4DXAB 5DAUA 5KEEA 4DDID 2V0GA 2KQSA 3UE1A 2IX0A 4DV1L 1MHHE 3DHGC 1WTRA 1MGSA 1V5TA 4W9FA 1E7PB 1QKZA 1V2YA 3A9JB 1SE2A 3RULA 5GAGC 2EKEC 1HZBA 4LK1C 5D94A 4MGIE 4OW0A 1W6JA 2BE5C 4KV2A 2L0TA 4A93B 4G7OC 4BVUC 3KWVA 1UWXA 1K8AC 1I94L 2Y0SG 3CC4A 2WGSA 4R3DA 2AKWB 1AARA 3S2DB 3SHLA 1TWCB 1UE1A 1ISNA 1VF7A 3NZ3A 2F3IA 1V6EA 5LLIA 4JI1Q 3QWZB 4B3SQ 2LVQA 3F8TA 1O78A 2IPKD 3NPPA 1M8AA 2D3GA 4DAVA 1SNOA 4Y7NH 4HCNB 3RZOB 1Z2MA 3T3OA 2B63B 1YHAA 3UDFA 1TT2A 4ZYSA 2NVTH 3K8AA 2LJ5A 4I6PA 4LUOA 2MBOA 2VB3X 3J7A5 1YNTE 3DOWA 4LF6Q 1SNCA 1SMXA 4DKAC 4CKBA 4BY7H 3A7LA 3CXCA 1VQDA 2INCC 2WXKA 4GIVA 4NAWA 2PE6B 3OJ4B 1AH9A 1F9JA 1B53A 1EU4A 2E2DC 5EGTA 1VQBA 2BS3B 3J81c 4BOSC 4A3BG 3VHTC 2EY6A 3HVZA 4JX1C 2BW2A 3NZUA 3PTFC 4PMWA 2F0JA 2WLBA 2NPTB 3E6ZX 4JI3L 3WAPA 4JIOU 5BMIA 4A3JG 2VS1A 3AE7B 1J8CA 4PG3A 1X3PA 2Y5PA 3TBLD 4AP4C 5FK9C 1GUOA 1IGCA 2BYFA 2WYQA 3EUB2 4XC2A 3MFYA 4JCVE 3BY4B 4G0NB 1Q90A 5HFYA 2RMMA 4IQZA 3VR3A 2G1EA 3OHXC 2NBWB 2RPQA 3LX0A 4PYZA 2HHHL 3RLOA 5M5XH 2WXPA 4JW0A 3DBHI 2QKIC 4YWLA 1F9RA 1HFNA 3U7DA 1VR9A 1RCVD 3F1ZA 4QIWE 2GBMA 5FR3A 4PK1A 2E2JH 2YU9B 3PO3G 1QZEA 4KKUA 1F52A 3PREA 1C78A 1MKHA 4QMGA 1TZ1A 3DWGC 3ZXRA 2LJIA 1XXGA 3PO3B 3OMGA 3R7QA 3L16A 1EFWA 3AE1B 4RWSC 2KCNA 2PNHA 2EYJA 4PV1C 3BK2A 2PVOD 1JWBD 2KQ7A 1GUTA 3TEZA 2EDGA 4PZ7A 3AE2B 2B63H 4ZRIA 1FD7D 3AB9A 4KSLC 3T13A 1Q1BA 4EFOA 4KKSA 5LL6X 4HXDA 4A3BB 3A1QB 3IFTA 5JHAA 1N33Q 3K5OA 4DN4M 2KJ6A 5KNDA 5CR3A 3S16H 1IYVA 3CD6A 1OFFA 2BS2B 1E2ZA 2ZXPA 4N59A 3ZQ4A 4IO9A 2KTFA 1II3A 4UPAA 4YCWA 4YSXB 3TP5A 1KFYB 3MXNA 2H89B 2F0TA 1GC6A 3MEHA 2D3BA 1EOTA 4ZUJA 3W5UB 3AE6B 1TWHB 2Z6KC 1L0WA 5GAHC 3L2PA 4HEA1 1RHPA 3KFUA 4WWOA 4B9XA 2F0PA 3PIO3 1C79A 5T1IA 1VMPA 2VXWA 4B3MQ 1QCBD 4ZKBB 1XPUA 5GQOA 4B9KA 1D1KA 3M7NA 4V0BA 3SXHA 3UF8A 1PH3A 4P1BC 1XLOA 5IWAL 3Q8FA 2L9HA 2D3AA 1WJ6A 4ALPA 2IO1B 2QMTA 1QJOA 4L63B 3KYCD 1PFDA 3R93A 1WXVA 4WJWA 2BYEA 4RFBA 1OTRB 1C4PA 1DOKA 5CV9A 2XWBB 3M85A 4B3RL 1STNA 1DGJA 1TKYA 2A6HD 1UZXB 2OCEA 1WJNA 3CRKC 3X3MA 4JBJA 3M63B 4FYDA 1PH9A 2LGSA 4IW0A 4M0WA 2G45B 3SK4A 2L15A 4TQ0A 1C77A 2MBEA 2PYKA 1IL8A 2KDFB 3KW5B 1XPRA 3PS6A 2G3QB 3VRBB 4FADA 1C0AA 5KHOA 5IT9c 4H44C 2MGSA 1KAAA 1WFYA 4NY0A 2X6GA 2V4DA 2KHIA 3MXPA 4B0MA 1S3SG 3RCZA 4DAYA 2WXRA 4NXMQ 2D2QA 3G4SA 1EU3A 3TREA 1IBXA 4AYBG 1NVID 2KCTA 3V60A 4J8QA 3D6CA 2JN4A 1K0SA 1ONLA 2IO2B 4BKTA 3VYUA 3KUDB 1V1PA 2WXOA 1SMYD 1HTQA 1F2ZA 2BF8B 1L6VA 5CV6A 1YQBA 4MHEA 1IBKQ 3ULJA 3CP0A 3MJWA 2A73B 1EY5A 4GSWA 3EJIA 1QZHA 3AE5B 4S0RA 3DWPA 2JZPA 2JA6B 4YXDB 3ZXVA 2K8BA 2ZTEA 4K6DA 3L08A 4X64Q 3PCOB 4N6EB 2HIVA 1GB1A 2XEWA 5E4WC 4R8NA 2HDEA 2MJDA 2A5UA 1PH2A 4G11A 5IP4D 1JOOA 4YY3L 1Q0WB 3RUIB 2R92B 1F2LA 3AEFB 2LUMA 1VQMA 5IYDG 4II2B 3OIQA 4LF8L 3NS8A 4HWIB 4P71A 3U30A 1I35A 1ROEA 3NP8A 5I2YA 4DUYL 2RDBC 1WI5A 1EY0A 3CPWA 2CWPA 2G5DA 4B6WA 1XJVA 3PV1A 2PMZE 3DMUA 1R4MB 2FIFA 3TP8A 4ZHOA 3RD2A 2X38A 2E2IH 2FCNA 4FVMA 2I5MX 3HUIA 3WIMA 1HNXQ 3PZ7A 3FEWX 3N3KB 2DJGC 4XDDA 3UDXA 4L6TB 1FL0A 2JA8G 2NZHA 3PUXA 4JI8Q 5GADC 3I72A 5M3FB 1HJPA 4LFAQ 1SNMA 2I46A 5J17A 1AEXA 2KDEB 2ASBA 1Q81C 1KOTA 1HZ9A 5IKCM 4KTAA 4MN3A 4ANXA 5TSSA 4DV3L 1C9FA 2A8VA 4BBRB 1IUEA 2JA7H 1C4AA 5C0XJ 1FJGQ 1XNRL 1TJEA 3BWUD 3DBLB 2DBYA 2LHEA 2EPBA 5AUIA 3PMFA 3S9WA 1SXTA 2EYHA 2KCCA 4EQPA 3NXWA 1MJDA 3HOYH 1MHXA 2J42A 5CHVC 4UAIA 4C1NI 2ACZB 1TS2A 4IWQA 3J7AF 2IDYA 1DM0B 4QAYA 4GS3A 3W1BA 4WJPA 1OXXK 3TP7A 3I9V1 4HAEA 1VQ4A 5BMHA 3KLSX 4GLSC 3ZVVA 3LGJA 1WE7A 3NZSA 1G8ZD 3KF8A 1O80A 3LB8C 2N8NA 2O4XA 2OT2A 2VH2A 2BE5D 4CGYB 1B9RA 1FVIA 5KNCA 2JA9A 3HM6X 4DR3L 5LMNW 1VQ7A 2RVLA 1H95A 1I4XA 2PI2E 4YCUA 1K8GA 1JT8A 3QO2A 4R1JA 4MSQB 4ARCA 4G7ZC 4F8CB 3T4AC 4C4VB 4HRSA 4CDDC 3IAYA 2NB0A 3MC0B 3RLFA 1TS3A 2JA8B 5FLXL 1FR3A 1GVPA 2YYZA 2CJNA 1WH3A 2P5ZX 5AFWA 2UXDL 2N0SB 5IYCG 5AJ3L 3OYYA 3DCGA 2PMZB 3GV6A 3TQYA 5IA7A 4DR2Q 4L5TA 5EPJA 3BVZA 1EIHA 3ALBA 1GPXA 3M3JA 5F2DA 1Z47A 1O7YA 1E90A 3UDIA 1XF5L 2A69D 2ZJPA 4YCVA 5GROA 1S4ZA 5FLXE 3VTWA 2R2QA 2WDTB 1WYWB 2WINB 3NUHB 1SYFA 1IYJB 1NI2A 3TEXA 5M3MB 1AN8A 4BBRH 2WACA 4X62L 2N9XA 1UH6A 4PMCA 2JA5B 3Q14C 4N9F4 1DOYA 2QEXA 2JA7B 5I2XA 2RD0A 1IXRA 2Q2HA 1TWHH 3BYYB 2K25A 3CCEA 3S1NH 2CJOA 1TWFH 4EGVA 2KJHB 4OIJA 3E56A 4ICUA 4M8NA 5BN5A 1A3TA 2MP1A 2QDBA 4EQOA 1GC7A 3NHEB 4KKJA 4GLXA 3L10B 1H9MA 2VY3A 4JOIA 2KX0A 3SVMA 2OQKA 3NWTA 1F9PA 5EQ0A 4ZK9B 1AFPA 1V81A 1XD3B 2NPTA 2E2IB 5BO4B 2Y0SB 2KOXA 1Y1VH 1E8YA 3TZUA 1SN8A 1NMFA 1ZGUB 5E6PA 4ZDVA 2D0PA 3GTKH 2NN6H 2V1YA 4DV7L 3ONAB 4R4IA 5H1SE 1HTLD 2E8GA 1I6VC 4URKA 3PO2H 1PTOC 1K8RB 2C7HA 1NEKB 3WAOA 3ZDTA 1SYEA 4EEWA 1A5RA 2XSCA 1IZ6A 4I65A 5FJ8H 4JYAQ 1GJXA 1UELA 2K6DB 2FMCA 2GA4B 3V96A 4LFCQ 1CQFA 1VZ6A 2J0JA 4DXGA 1VQCA 3ZO5B 3PIOA 2B2WA 4C3IB 3W9CB 2PVGC 3L3OC 2B2YC 4A3KG 4FXCA 2L11A 4ZAIA 1R4MI 2HT1A 1FM0D 5KYLA 1ESRA 2CU3A 2GVAA 3OG5A 3VH3B 5FOBB 2K0PA 3EROA 2KACA 1QUQB 3NHHA 2NVUI 4UP7A 2LZ6A 3MC8A 2GBJA 3GOEA 3JC66 2QILA 5I9PA 2N7EA 5LMNL 1UGMA 1VQ5A 3M4PA 4KGSA 3J81i 1CSQA 1BKBA 1KHIA 5D65A 1ASZA 4FF1A 3Q3JA 2UXBL 3M3YB 4RCOA 3H91A 1XCTL 4JVZA 5IIFA 1SIJA 3VRAB 4ME5A 3IFDA 3ZW3A 1UUPA 1G2SA 1FRRA 1UGJA 1AE3A 2OTLA 1WGRA 3UE0A 3JAME 3VR5A 2E74C 2RDFA 1Q7YC 4XT3B 1ESFA 2F3WA 3FKIB 1KABA 5JPMC 5JVH3 3W1GA 4JV5Q 3DHQA 1EEFD 1HA6A 3MFGA 4LTUA 3HGBA 1J6QA 5HG2A 3T1YQ 3Q3NC 1Z6HA 3VR9B 3O13A 2OTJA 1YITA 2F0WA 1B4OA 1BCPF 3BS1A 3HKZB 1RIPA 2QCZA 3NG0A 3VA7A 5BR8Q 1X65A 3U2SC 4NJCA 2L55A 4DDGD 3BZCA 2EELA 1LTTD 2K4KA 3E5SA 2KEDA 4DR3Q 4GNXA 3C3LA 3RI7C 3RN9C 1PRTC 3NTIA 5C3XA 3N52A 2ASQA 4AQ7A 2Q8TA 3RNBC 4I6LB 2NZ1D 2IBIB 4GKKQ 3DWQA 2HD3A 2LGYA 1A2UA 4KI0A 2LSSA 2J7QB 2F52A 3AE9B 3R3MA 1PTOB 1TWFB 2CHWA 4IJLA 4FXDA 1JRUA 3HKZG 2JA7G 3E9IA 2KUMA 3GTQH 1Q1EA 3MZ5A 3S1RB 3T56B 2JWZA 4YTPB 2EE1A 4OO1G 2JK8A 4B9WA 5M3MG 3UDGA 4GOPC 2PLPA 2L1BA 4HDQA 1IBLL 4KIKA 1MG8A 5LMUL 1FJGL 3FAHA 2KQ3A 3WOEA 2DGYA 1N63A 2E5LL 1D2BA 1YMHE 2SOBA 3JAMi 1WIAA 1OEYA 2LHDA 4M8MA 1B7YB 4KZ0A 2NZOA 5ELDA 2Q8RE 3CWIA 1X6OA 3HK0A 3DBRI 1OXTA 4HPLB 4F87A 4M0WB 4CYEA 3KLRA 3I4NG 1TS5A 1UNSA 1K51A 2UYZB 4HJ5A 1WY8A 2UXCL 3S2HB 4A3BH 4JI8L 2BBCA 1V97A 1CA6A 2HE7A 2MBQA 2FINB 3M4YA 3IRBA 2QW7A 4X65Q 1WCMG 2GN5A 5HGTA 2MPMA 3D32A 2EY5A 2AMCB 2CHXA 4DV2Q 1HNXL 3CCSA 1PRTD 3BIID 4QUCA 3HEJA 5BN3A 3QQ8B 2FAZA 2BGFA 1A0IA 4YHHL 1HQRD 3H8HA 4HJ9A 5IP7H 4IOIE 2SAKA 4DWFA 1TWGB 3H0GB 3I91A 1I4GA 2UU9Q 1EIGA 3R2TA 2JQRB 1S5CD 1WRDB 3QJYA 4DUYQ 3E0JA 4DK6C 5EKKA 1BT0A 2GBNA 4KY5A 1P1AA 3EECA 3W5VB 5ELCA 1KLGD 2PTLA 4LF4L 3H94A 4P72A 3DLLA 2K5WA 2MA9B 3SU8X 1PDXA 2AX5A 4RF1A 4FP5D 4GXBA 1ENAA 3SFEB 2RDHA 1BVSA 5FLMH 2Z1CA 5C4JB 3D31A 3H3VC 2KHJA 1LXDA 2EJGC 3BYTB 3H09A 2WU5B 1G6ZA 2RPVA 2VZKD 3NQTA 2NR2A 2UXBQ 1CZWA 3DBSA 1C3TA 3I55A 4ZYNA 1KRTA 1C1YB 4NMZA 5I4DA 4BY1G 3BINA 2KYWA 1NSNS 2Z8LA 2ZXRA 1PTOH 3NUCA 1J5EL 4A3IG 1JE5A 3E9SA 2KWDA 2CFMA 1ZYRC 1FXTB 3PSEB 2KDIA 5G5GA 3RD4A 2Z9HA 3GTJB 2KZRA 1YJ9A 1M94A 3HOXB 4TQ1A 3L54A 3L17A 3HRDD 2EMTA 3K7AH 2F0OA 3VR6A 5E4XA 4MGKE 3FHWA 3I4OA 4IPHA 2O6VA 4AJYB 1WXSA 3GTMB 1QWYA 2B8FA 2DHZA 2EYOA 4A75A 4KVGB 1JROA 4NXML 3WCQA 4OX9Q 4RF0A 2XK5A 4C3IG 3PQIA 3D3RA 3PV0A 3KJPA 5C3EB 1WI0A 3A4RA 3VFKA 5IYDH 4OO1H 4MELA 4ZRJA 3EFCA 3FPUB 3ZNZB 1XYIA 3DQVA 2L0FA 1EYAA 3IT6B 5JXVA 1JJCB 5M5YB 5D3IB 2LFNA 4JK1C 3RNEC 4EZLA 4JYAL 4E71A 5LXHA 1IBML 5C1ZA 2Q2IA 1DCZA 1K53A 2N1VA 1UE7A 3EVQA 4DQOC 1IYFA 2RKSA 4X65L 2B29A 1KJTA 1HHVA 1MSHA 2MNAA 2BKFA 4NQKE 5G5HA 2UXCQ 2FXQA 1YNJC 3M3YH 4F1SA 4OONA 2N55A 1S5DD 3I70A 1D5XC 4A3LH 2C60A 2OHFA 5C5MA 1BO0A 3CSFA 1J19A 4BY1B 1FNUA 4FXGC 4YL8A 2R61A 3QOLA 4AH6A 1IKMA 1QOBA 2FFKB 3DBRB 3N30A 2D07B 3JAMc 1KRSA 5AZGA 4JI2Q 1K0RA 2B2UC 4DUZL 2IGHA 1Y1WB 3GTLB 3VUWA 3RMHA 3BDLA 3PZ8A 4R8IA 4KJOA 4GKJL 2Y3AA 1EYGA 5K5PA 3A74A 3J80L 1WMHB 1PLFA 2WIIB 2K22A 1RM6C 1J9OA 3NBHA 4TV3A 2PNRC 5C44H 4MACA 4G7HC 1YQ3B 4UP8A 1PRTB 2GB1A 3LXFA 4I6NB 1Q8IA 3CMMB 3VR4A 1KDCA 5CBEE 4JG2A 1BQQT 4E3CA 4KY7A 3I8ZA 2K04A 4NP5A 2VUMB 4K6LA 4RHRA 3K0YA 1OEYJ 2ZW0A 1VDVA 3V3XA 4A3OA 2VRRB 3GTPH 5C3EG 2IJ0A 2VUMG 1X55A 4BBNF 4DAMA 2CKHB 3S1QB 5DPWA 3A8IE 1EF1A 5ELNA 2LXCA 3M7GA 4IM2A 4NKLA 3SD5A 1JCKB 1RLFA 1R9TH 1B44D 2FBWB 3NQIA 3S1MH 4MH8A 3FP9A 4Q5VA 3RNUA 4XGAB 2KMAA 4XDCA 1I4QA 5J39A 3IXSA 5FO7B 1X3QA 3CHBD 4L5SA 2INDC 5G55A 3SR6A 2R6GA 1XMOL 2I38A 3P20A 4BBNC 2V3SA 3UIPB 4OHJA 1I50B 2H5XA 2V9HA 5LMNQ 1DOXA 1LQBA 4GDLA 2ZEQA 2OJRA 2JRHA 1SNPA 1SE8A 2WHIA 3BK1A 3PUWA 2VL6A 1NUCA 1SIFA 1VS0A 1AZPA 2HHHQ 1FIQA 1NCVA 1SE4A 4G4KA 1ILQA 3PPAA 4GN1A 4FLHA 2ZW1A 2IT1A 4MGYE 3K5NA 4JI3Q 4LF5Q 3NELA 4R4OA 2FIDA 2B76B 1QVGA 3MXGA 2D10A 3AN1A 4B0EA 4DNIA 1LV9A 4CKEA 2JA8H 3KVFB 4BBSG 1TBEA 1PFBA 2L8JA 3RR5A 4BA2I 1Y14B 1P9DU 3NTHA 2ZVOA 1IBMQ 1MI2A 1WGDA 2A4ZA 1FMAD 2WXNA 1BOSA 1EIFA 2CH4W 4YIJA 2K5DA 3SDLC 1K9MC 2QEJC 2CW0D 3SDZA 3NVVA 4DU9A 1VQAA 3ENEA 3PO2G 1RYJA 2BVCA 4ASWC 4F88A 2K14A 3SK5A 2R92H 2TSSA 3GDEA 4R4QA 2XWJB 4K81A 3VUXA 2F0EA 5JJKA 1J8IA 3IKJA 3JSVB 1NR4A 3CCRA 5H92C 1WD1A 4LF5L 1EQVA 3EFXD 1VMCA 1D5ZC 1CM9A 1LT4D 4GDLB 1BR9A 1T5XD 2JA6H 1QF6A 5CTRC 3WDNA 3OSOA 3B08A 2I0QA 2PW5A 2PPBC 3ZUNA 1SYDA 1TKEA 2B2VC 1E10A 4CJ2C 4DAPA 1BUIC 2EJMA 2MBHA 2MQJA 4TQUS 3D4DA 1WYGA 1WJJA 2I1KA 3RNAC 3GD7A 3B2FA 3EC8A 3GTQB 2A19A 3PRPB 4CJ0B 3G48A 2NWGA 3T1HL 3RNCC 1SYBA 3E9HA 4P1CC 4DHZE 2TMPA 3H3VH 1E2WA 1QB5D 3I57A 4O2DA 2E76C 1HZ5A 1MJCA 3SR1A 3RZDB 2DZIA 4NNJB 2FHTA 2J52A 4DR2L 4A3DH 1WF9A 3PRMB 2B3GA 4TUUA 4RHSA 2UXDQ 4IZ8A 3RZFA 1SLJA 2IX3A 1VD2A 2HDLA 4XTCS 2KEEA 4LF9Q 1UE6A 1MFWA 4KDIC 4DK3C 2F0SA 1YQ4B 3KK7A 2NVTB 2WQYB 4ICVA 5ISRA 5J22A 4FNFA 2AL3A 2WX0A 5IO9A 3K57A 4AWJA 4HJKA 2LS01 1H9SB 1WZ0A 3GQBA 4JI5Q 1ZPSA 1PMRA 1QE6A 3CSTA 4GNXC 2ES2A 3RZDH 1Y1VB 3T51B 4BBSB 3LDZE 1IL2A 1J7CA 2B2UA 1CKNB 4NAWB 3RUZA 1NR2A 4U68A 4LNFA 1EY8A 1PYSB 3SEBA 2QCPX 1A62A 4B3RQ 4RAUC 2WDQB 4A3GH 2VZKB 1V49A 4KDLB 5JZEB 1QVCA 2Z6BA 2F03A 3PHXB 1NE3A 2B2VA 2J0TD 1PV4A 3AEAB 1QILA 3NTKA 2ZM6Q 5EE0A 4DHJD 4DUZQ 4JI2L 1PVOA 1VZ7A 2L00B 1X3GA 4A3MH 3HFZB 2ZZPB 4HK2A 2KQ4X 1U4MA 1E1OA 3B0AA 4AUQC 2LRUA 3QA8A 1MI0A 3WWVA 2JXTA 3HKZE 4JBKA 4A3PA 3J80c 2PW7A 1ZW7A 2KFKB 2W82A 1GXDC 2MQHA 1MBYA 4N8X1 5EBDA 1C8CA 3S14H 5D7GA 3ZJTA 4PQXA 5M9OA 3IHPC 4WH4A 1PYWD 1SNQA 1EWIA 1L0YB 3KYDD 4EOYA 1U0LA 2PZWA 1IKLA 4HJ7A 1QG7A 1OQYA 2RGFA 3I63C 2OXPA 3PLUA 3TEYA 4RA8A 3VYSA 3APFA 3H7SA 1YNXA 4WQOB 1RAXA 1G51A 1X56A 3V62A 2WS3B 2WX1A 3A55A 3J7YW 1BUVT 3L0WB 1N9WA 4UHVA 3TBIB 3OTOL 4K1RB 5IYBG 4KKIA 2KT7A 1TXYA 1MIUA 3ECIA 3AQQA 4C80A 1GHJA 1KAWA 1DJRD 1S5FD 2B8GA 5IY0A 3CCJA 2F0QA 1KL9A 5J1ZA 2KFKA 3C0RB 3Q8BA 1Q86C 3BZKA 5IOCA 5H8YE 5JH5C 1K83H 3MWYW 3ETRA 4YY3Q 5C0XI 3CCMA 4A3DG 2N88A 5GMVA 1V8QA 1CZGA 1JORA 1GOZA 3D0FA 3RN2A 4X64L 3TJPA 3AV8A 2JEAI 1E0ZA 1WM3A 2ONQA 3D8GA 1N34L 2IY0B 1Y8NB 1U4PA 2LGDA 2BT6A 2DNFA 1ZXHA 2K01A 1TU2B 3MXUA 1Z7TA 4HJAA 3S1RH 1SYCA 5E6JA 2L3ZA 4BAXA 2A69C 3A0JA 1D4BA 2UUCQ 3B6YA 5A35A 2N1WA 4W9CA 5I9OA 1NYQA 1V9JA 2MHVA 3HG9A 2EIFA 1E1TA 4IUVA 2C7NB 2NTTA 2INNE 2M17A 4GDKB 3DVNV 4OIKA 4BBSH 1SDFA 1VQOA 2RCNA 3P7JA 1HR0L 4OWWB 3KUZA 3WANA 2E2HB 4BZAA 4MTNA 3K6OA 2DY8A 3ZLZA 1F2YA 2C5LC 3PO0A 4YSZB 4UDUC 1RRBA 1KQSA 4LFCL 5CC4A 3FDTA 3RZOH 2WKDA 3Q8DA 4RM8A 2FCSA 2JZ3B 3DBHB 3GV3A 1FFUA 3PIP3 3OMCA 1KNAA 2B2WC 3RZWC 5LL6S 4AOFA 3C19A 4GN3B 3GE3C 4IM0A 3NBIA 4IFDJ 2MEKA 4IWOA 2AYOB 4I7AA 1GUAB 1S1QB 1ACCA 3AEEB 2X6LA 1CA5A 1HUNA 3W5OA 3CPFA 1PUTA 1XT9B 1JOKA 4K5XA 1BMLC 3FKIG 4A20A 2J7ZA 1HR0W 2BS4B 1VQ6A 1ZP0B 3FC4A 1K8MA 3VR2A 1JQYD 1O7LA 3U4VA 4OL7A 2E5LQ 4TVAB 1DXMA 4JPSA 4AS1A 3IFWB 3W3AA 1W2BA 2D5GA 4MSMB 4RKBA 1ZKHA 2K5VA 2E6XA 2ZT9C 2SEBD 5EDSA 1VQFA 1QOHA 2ON8A 3J7ZC 1T3QA 4A3JH 2I5HA 3H9DA 1X54A 2MW5A 1RWSA 4REZA 2JYOA 4FF2A 3Q0AA 1PGBA 3ML8A 1DOLA 4A3KB 4C3HB 4TSSA 3CU7A 1UBQA 2G9HD 2J0MA 4PS8A 2NVYH 2IWHA 3ZKJC 2IHFA 5M3FH 3TS0A 1PH7A 1BXTA 4JI5L 2LI5A 2CS4A 1U9RA 1TYGB 2GMIC 2VQEL 4IUTA 1NNXA 2EKIA 2KJRA 4JWUC 1EY7A 3JVZX 4C3JH 3V6EB 1VQJA 3NJTA 2L7RA 1N36Q 1ZXIA 3LYYA 2WAQG 3ITPA 1WX8A 2B2TA 3UI2A 1AP0A 3R66C 3X23A 1I6HB 3GO5A 5HURA 1N36L 2K28A 1CKNA 3F2UA 3EQLC 4JBMA 1FPYA 3D4WA 1L2FA 1SYGA 1BCPB 3JYUA 1G6PA 2JP1A 2EYFA 3NEMA 3KLSA 1KD1C 4ZKCB 3ZRFA 4O42A 3BDOA 4HR7B 3OWEB 2EVBA 1GD7A 4K14A 3DVGY 4J1MA 5C3WA 2L76A 3URYA 3HOXG 2DLBA 2DJFC 3VH4B 1RTNA 2WB1B 1E7UA 2BB6A 5IGCA 3H15A 4KD4A 2C5CA 3GTJH 1Y1VG 4K5VA 5DNFA 4G50A 3X3NA 3A33B 3VQIA 1D6EC 1PGXA 4WJ4A 5FO8B 2N9KA 1XPOA 1KC8C 1Q12A 2KMCA 4JI0Q 4IFDH 5NUCA 4WQMA 1SBBB 5EKIA 2V3PA 1Q8KA 3A56A 1HPCA 3TEHB 3PVLA 2MHJA 4FHJA 2NBUA 5GXGB 2XRQD 5FLXc 2WXFA 2VNUD 3ZYYX 1GNUA 3QJZA 1HE8A 2LVPA 4GMVA 4GLVB 4BY7G 3KBXA 3L7ZC 2F0VA 4NJ7A 2DZKA 4KJNA 1HZCA 4DGZA 3CIRB
chains in the Genus database with same CATH topology
4IUUA 1I4PA 1L0XB 1OXUA 4DA2A 5E3FA 5IGFA 3J9CA 3EA6A 2WXHA 2NTSA 2ENBA 5C4ZA 2A6ED 1VLBA 4WAFA 3OIPA 4XE0A 4ZRZA 1WTPA 4ZHPA 4WIPA 2JU6X 4ARIA 1G91A 3QB3A 4D2KA 1FD6A 1VF5C 1BNZA 1CK1A 1G291 1I4RA 2E2JB 1N60A 4HJGE 1D1IA 1H9KA 2NVYB 3P4QB 4RCNA 2RA4A 5I6YA 5CYUA 4PMBA 3I4LA 4TRDA 2K33A 4KY6A 2NYZD 5DM63 1FCLA 2R93B 1WGKA 3A7AB 3TP6A 1ZXTA 3MP9A 2PCFB 4XQJA 2K7VA 4AYBB 5JAVA 1FYCA 2F0DA 2DNEA 3P1HA 4X3SA 1ZEQX 5CV7A 3VYTA 1JRPA 1TY0A 3GTOB 4A90A 3FILA 4KKTA 4RGMA 1SFOB 3AB5A 2KAJA 1DYQA 2QSDA 2K05A 1EZ8A 5JOBA 2QJLA 2RBMA 2XN9C 3TUOA 1BCPD 1ZDVA 2M56B 1KDAA 1F2MA 2PZTA 4ITKA 2KA7A 1H9JA 2A6HC 3HOWB 1F9SA 2F0KA 4EQNA 2R7ZB 2WAQB 4YSYB 3MVVA 1CTMA 3ABVB 1R4QB 2WXMA 2O5JC 2K6AA 4HEDA 4IURA 1K52A 5IODA 1JR0D 1C4QA 1EY6A 2OEOA 2L0CA 3PO2B 1C76A 5JJZA 4RKLA 1VZ8A 5ELFA 4Y7NB 2WNMA 5T1GA 1LTRD 3I73A 1BDOA 3LWEA 2ZXOA 2W3SA 1SSOA 3SK6A 1HEZE 1FFVA 5KIXA 1STGA 3MAQA 4PNYA 1A70A 4BWGB 4ZOHC 3N6RA 1QNUA 1DD2A 2OF1A 3AE3B 1RKNA 2MH7A 4WURA 1GUNA 3HS0C 3AE8B 3TMEA 1HQMC 2KMMA 2BDNA 3NS1A 1CT1D 2AQ3B 4TMAB 4XQNA 1FO4A 4PT5A 3K58A 5M5WB 4GZYC 2AWOA 2IL8A 1QQRA 2SNSA 1A2TA 1RTOA 4RNAA 2F4IA 5BMGA 1SF0A 1NAPA 5JEAJ 3GTPB 1X32A 1LO5D 2DYMA 4XIGS 5BN4A 5A2QE 4XWTA 3K5LA 2ID0A 3P4SB 1GB4A 4L8JA 1F2RI 5C44B 2LY7A 3IAS1 1R7SA 1MVKA 2MJ3A 2MJEA 4ZRQA 4LLGM 1I7HA 5AUKA 3G7LA 2BYTA 4BS9A 1XLNA 3FPPA 3NSWA 1ENCA 4OZBA 4L2YA 2NBFA 5CORA 3AMUA 4OZCA 1SSNA 2BDOA 2JYEA 2ICEC 4QB4A 4NAMA 3K5MA 1JWAD 2E3TA 2SDFA 2KDMA 1WTVA 2Q5WD 1E0BA 4A3EB 2EZVA 2W55A 2WP9B 3R3OA 2K5QA 4C3JG 4HKQA 2I2YA 4F7XA 2NN6I 4ZUIA 1ZYRD 3ZJUA 4RH6A 3CKIB 1PZJD 2A6EC 3GS2A 1IBXB 2DY7A 4XYQA 1ENFA 3M4OB 3CQZB 2PW9A 3MHZA 4HMJA 2F0HA 1VJKA 5DM73 1EZ6A 2D9UA 4NDXA 2JSOA 1P7FA 1KH0A 1TKWB 3IT4B 4K2KA 4A3JB 1TZOA 2INPE 4QUFA 4A55A 4KHZA 2IGDA 1YNND 1I3QB 3MTSA 1MSGA 2K5PA 1HXYD 3S16B 2HQEA 4IUQA 3VA5A 3Q6SA 3P63A 1L4ZB 1YNJD 2LFIA 3HZXA 1WXQA 1K83B 1OQRA 2X69A 2J53A 2JX5A 3C1EA 3I90A 2M2LA 2NVXB 2F0MA 1V1OA 5C0XG 1CQVA 1XX8A 1CI3M 1RD9D 3NE5B 1ZUD2 3KQ4A 3AE4B 5EE9A 1SB3C 1A3VA 4V190 2GRIA 3NVWA 3HOZB 3R2IA 1ILPA 3U9OA 3I4NB 3SK8A 1A15A 3V2TA 3PUVA 2Y5CA 2H88B 2K32A 4E6IA 3DEPA 2M0AA 1WTOA 3AEDB 1LTID 2KVMA 1UAPA 3B2GA 5ELBA 4YT0B 1C48A 5IT9L 5C3JB 1PTOD 1Q3LA 1Y56A 1IW7C 4BY7B 3AECB 2EYLA 1B2TA 1RDPD 5CV8A 2WXIA 1EYCA 2HDMA 3BG3A 3HP3A 1AW7A 2L5TA 3QG1A 3BDCA 1E9MA 3MA2B 2PO4A 3TN2A 2DYOA 2FMMA 2A68C 3Q22A 1N5XA 3AU7A 1ICWA 4Q2JA 1CHPD 1HA5A 5C0XH 2XIWA 4WORA 4USAA 1EWYC 2CHBD 4DF7A 5JEAG 2DN8A 3DWMA 3PUYA 3J81L 1U4RA 5KGUA 1L5PA 5EKLA 1YN3A 3TDQA 1K50A 4WRDA 2B2TC 2WXQA 4EVOA 1G2TA 5CV5A 1B9MA 1WWTA 2WP8J 2Q8IB 4YTNB 2F0UA 1S5ED 1QOFA 1EWHA 4I7ZC 3WOFA 3DXJC 4C7YA 1GUSA 5EE3A 4IALA 1KLUD 2W3RA 3K7AB 3U52E 2BA1A 4X3UA 4H13C 4K2LA 2JWUA 3D6WA 3LNNA 4ID6A 3FILB 3U7ZA 2JEBI 1U4LA 2NVQB 1YJJA 3T3NA 1XWEA 1STYA 2DWQA 3PUZA 1ET6A 2IX1A 2JE6I 4ZQ3A 1K8OA 1DOMA 2F0GA 1HRJA 3GB1A 3ND8A 5CBAE 4C3HG 4CHTB 1PGAA 1QOAA 2QIEB 2PMVA 3DWAA 4KN4C 1CJEA 4ABNA 4ILWA 3Q8EA 1GUWA 3NVYA 3DEOA 4QIWB 2K9XA 4JWSC 1JW9D 5KYIA 1DOIA 1FCCC 2F0LA 1YNNC 4X3TA 1OQQA 2DNCA 1T5EA 3Q23A 1UWMA 1F0ZA 4RGOS 3HOYB 1LTSD 1EL0A 1JE4A 4X3KA 3C8YA 3MJ5A 4IUPA 5LHY1 4NZLB 1ZDXA 2SNMA 4XT1B 5CGKA 3TSSA 2L83A 3HVDA 3KBGA 2H4OA 5ELEA 3FRPB 1H9RA 1NYRA 1JB3A 1LABA 1EQTA 1SJED 4MM3B 1HUMA 2K3UA 1WTQA 3ZJVA 1EY4A 1JWUD 3U4EG 4H7BA 5DEHA 4KV6A 3QOJA 3S1MB 4CJ1B 5K36G 1WSPA 2OEDA 2AQ2B 1WTWA 4C7ZA 4KHVA 1FXIA 4DK1A 1P7EA 1STAA 1TY2A 4F8MA 3P4RB 2XRSD 4P16A 5FO9B 1PXUA 4MIUA 1PDQA 2F3VA 4LAAA 3Q24A 4CKCA 2N9LA 4EE2A 3OWFA 5IT9E 1EEID 4A3DB 2L32A 1RF2D 2V4IB 1HTPA 1BF4A 3NK9A 3HRZC 1STBA 4KMUC 4S3SA 1FRDA 4FXKC 4WFN3 2VB2X 5M5XB 4JE3B 1BCPC 1SAPA 2B2YA 1XEEA 1V43A 5LNK1 1C4CA 1IW7D 1RJTA 4BA1I 2C9OA 4FF3A 3Q8AA 3NRZA 2FJ2A 4KD3A 2W54A 2EY2A 1FNWA 2J4XA 3KUPA 4HKZE 4OO1I 2HCCA 5IGDA 3B9JA 2F0IA 1EWCA 1JICA 5C4XB 2GI9A 1EM7A 1WVLA 5EPKA 3GTKB 2L4NA 4O1NA 4J6HA 3RPFC 1V8CA 4TKOB 1Q10A 3L9AX 4Z9CB 2NMQA 2HTME 4XQQA 2EOTA 1AZQA 2RDGA 5K36H 3K59A 1EFID 3W1SA 1N62A 4ZRPA 4N9PA 1TWAB 1SE3A 4H2AA 2G9DA 2K03A 1AWDA 4IFDG 4XDXA 2BTEA 1Y8PB 4IUNA 4OZAA 1CFMA 5BYSA 5CMDA 3FVQA 4DFAA 2XVSA 1XO3A 1LT3D 1XCQL 2WDVB 2A68D 2D62A 5IGEA 1J7BA 2AWNA 5EBCA 2PKOA 4R9WA 1MPEA 2IGGA 1LTAD 4DK0A 4N58A 2QF7A 2KHSA 2FUG1 1LTBD 2LMCA 1N61A 3IAM1 2AQ1B 1VCIA 1KRHA 3Q69A 2PZUA 2EY1A 2NN6G 5I6WA 1ML0D 3ERQA 2LGIA 2JSVX 2E75C 2XNAC 5G3LF 4Q0FA 1S5BD 5IGBA 3S15B 3T16A 3NVZA 4HROA 4C3JB 2WV6D 4HCSA 4K8IA 2YEPB 2MUYA 1QLBB 2L1AA 4J3OD 3N9YC 1YJIA 1JWSD 1CHQD 5EJWA 3FMCA 2FE8A 2CVRA 1R4PB 1B1ZA 2WXGA 1TKGA 1STHA 1WCMB 4C56C 3CRLC 1B3AA 3LWUA 3VR8B 2IW3A 4A3FB 4HTHA 1RFKA 1HZ6A 4A3GB 1E6EB 1UEAB 2A74C 5JEAH 1HFGA 4KGRA 5JVG3 3P1MA 3GTGB 4M8AA 4WWMA 5T8IA 2KOLA 5MPOA 1OXSC 4QCLA 1FNVA 3JAML 1STEA 4ULLA 3C2PA 4K8JA 2KJXA 1FGBD 1FXAA 3OPOA 3KWLA 2N7JA 1H9SA 2F0FA 1SJHD 2BA0A 2LEKA 3TZDA 2JXMB 1A3UA 2YEPF 4ODGA 3L4PA 5EPLA 1YN4A 1LTGD 5KNBA 5C5LA 4C1NK 2CQAA 3A54A 4LK0M 1LT6D 1OXVA 1PTOF 5D3DA 3SE0A 1DONA 2D2CC 4KK7A 3Q8CA 5C2TB 3BVGA 4M1UB 1WTXA 4JBWA 2M9VA 1L0VB 1KDBA 1IHZA 4N9TA 1L6UA 3U9SA 2V3NA 4CQNA 4P6VF 4HSVA 1DZ1A 5FKAC 4A3IB 4US9A 5EE1A 4DXFA 2H1EA 3AH7A 4XWWA 4IFDI 4L1BA 1XLPA 4CBVA 1D5MC 4P2CB 1JALA 3AMZA 2JYTA 1TS4A 1JC7A 1MD2D 3S14B 3T53B 1EY9A 1B50A 5E1FA 2NUCA 3I3CA 4LJZC 1GUGA 3J7AV 2M19A 2WU2B 2PQEA 2WXLA 3QWNA 2RSNA 2AUKA 4C2MB 5C4HA 1F2RC 1NI3A 5CV4A 1TR5A 1GAQB 2BB5A 1ZE3D 2BCOA 2LMCB 3RFZB 1F9QA 3G6JB 3BZDB 2R3ZA 3MHBA 1TIID 3R8BA 1R9TB 5BYRA 1WRIA 1VDZA 5G3LD 2K1BA 3C1FA 1JQ4A 2F1MA 1TVXA 2ICIA 1KF6B 3EGRA 5HI1A 3J81E 1XLQA 4IDIA 5JPNC 2EYMA 4OGQC 3UI3A 2Z4HA 4KN7C 4HCEA 4DNTB 2O5IC 4HN7A 1IYUA 3AEGB 3J80E 3C46A 4G57A 4IKGA 5KRUA 2Z4IA 1QOGA 1J7AA 1JWMD 2CW0C 4XYOA 2WKCA 4U673 1QT9A 2L12A 4ZLTF 1F77A 3D4RA 4IN3A 2KECA 4US8A 3A8JE 1FEHA 4A3MB 3AEBB 3IL8A 3HOVB 1OO9B 2BOSA 1PFNA 2EJFC 3S17B 2A5HA 1Y69U 1YN5A 1AYFA 3NWSA 5D14A 2HCIA 5COYA 1L4DB 1N5WA 1T6BX 1E2VA 1QNKA 3AM9A 4OVZA 1JMLA 1PZID 3BVMA 1V1PB 2KN4A 3OOCA 2I07B 4L23A 1PFMA 1M4VA 3GP7A 1ET9A 4H0LC 2WXJA 4RGNA 3I4MB 1LLRD 3VYRA 4KGTA 1EYDA 5IGGA 4A8XC 3ND9A 4LMQD 2WDRB 1BBXC 3S1NB 3OW7A 1GHKA 1ZKOA 3DUZA 4XXEA 2AUJD 4K5WA 3P42A 2RQXA 4FF4A 2O2LD 5A2QL 5HHDG 1TQOA 4HSPA 1B9NA 2D5DA 2HUGA 2MJ8A 1ZOYB 4A9AA 1RODA 2B39A 3V05A 3ZGZA 5C6AA 3W2DA 4YTMB 1SMYC 4DNRB 4YWGG 1Y8OB 3A8KE 2L52A 1SNDA 1JOQA 1LT5D 1IGDA 1PZKD 4MT5A 1WD0A 3HOUB 2EYPA 3H6MA 4QF4A 2PIAA 2F0NA 3TEWA 1CZPA 2EXZA 4KX6B 3P75A 4A6QA 2RSOA 1SEBD 1HCZA 4FO2A 4B08A 4NW2A 4RGTA 3SFDB 1LACA 3DM1A 3QIAA 1W6KA 1VRAB 1KTKA 1KNEA 1O7ZA 1NENB 1PRTF 1XTCD 1I4HA 2M00A 1A6XA 5BYQA 2LKVA 4HMIA 5DAUA 5KEEA 2V0GA 2IX0A 1MHHE 1WTRA 1MGSA 1E7PB 1QKZA 1SE2A 4LK1C 4OW0A 1W6JA 2BE5C 4A93B 4G7OC 3KWVA 1UWXA 4R3DA 3S2DB 3SHLA 1TWCB 1VF7A 3NZ3A 1O78A 2IPKD 3NPPA 1M8AA 4DAVA 1SNOA 3T3OA 3RZOB 2B63B 4ZYSA 1TT2A 2VB3X 1YNTE 1SNCA 4CKBA 3A7LA 2WXKA 1B53A 1EU4A 2E2DC 5EGTA 2BS3B 2EY6A 3HVZA 4JX1C 2BW2A 4PMWA 2F0JA 2WLBA 3E6ZX 5BMIA 3AE7B 2Y5PA 1X3PA 5FK9C 1GUOA 1IGCA 3EUB2 3MFYA 1Q90A 5HFYA 2RMMA 4IQZA 3VR3A 2G1EA 3OHXC 3LX0A 2WXPA 2QKIC 1F9RA 1HFNA 1VR9A 1RCVD 5FR3A 2YU9B 4KKUA 1C78A 4QMGA 3DWGC 2LJIA 1XXGA 3PO3B 3OMGA 3AE1B 4RWSC 2KCNA 2EYJA 4PV1C 3BK2A 2PVOD 1JWBD 1GUTA 3TEZA 2EDGA 3AE2B 1FD7D 3AB9A 3T13A 1Q1BA 4KKSA 5LL6X 4A3BB 3IFTA 3K5OA 4DN4M 5KNDA 5CR3A 3ZQ4A 1IYVA 1OFFA 2BS2B 1E2ZA 2ZXPA 4N59A 4YSXB 1II3A 3TP5A 1KFYB 3MXNA 2H89B 2F0TA 3MEHA 1EOTA 4ZUJA 3W5UB 3AE6B 1TWHB 4HEA1 1RHPA 4B9XA 2F0PA 3PIO3 1C79A 5T1IA 1VMPA 2VXWA 1QCBD 4ZKBB 1D1KA 3M7NA 4V0BA 3SXHA 1XLOA 3Q8FA 2L9HA 2QMTA 1QJOA 4L63B 1PFDA 3R93A 4WJWA 4RFBA 1C4PA 1DOKA 5CV9A 2XWBB 3M85A 1STNA 1DGJA 1TKYA 2A6HD 3CRKC 3X3MA 4FYDA 4M0WA 3SK4A 4TQ0A 1C77A 2PYKA 1IL8A 3VRBB 4H44C 2MGSA 1KAAA 2X6GA 2V4DA 3MXPA 4B0MA 4DAYA 2WXRA 1EU3A 1IBXA 1NVID 4J8QA 3D6CA 1ONLA 3VYUA 1V1PA 2WXOA 1SMYD 1F2ZA 1L6VA 5CV6A 4MHEA 2A73B 1EY5A 3EJIA 3AE5B 3DWPA 2JZPA 2JA6B 4YXDB 4K6DA 1GB1A 4N6EB 5E4WC 4R8NA 2HDEA 2MJDA 1JOOA 2R92B 1F2LA 3AEFB 2LUMA 3OIQA 1ROEA 3NP8A 5I2YA 1EY0A 3DMUA 3TP8A 4ZHOA 2X38A 4FVMA 3HUIA 3PZ7A 3FEWX 4XDDA 4L6TB 3PUXA 3I72A 5M3FB 1SNMA 2I46A 1AEXA 4KTAA 4MN3A 1C9FA 5TSSA 4BBRB 1IUEA 1C4AA 5C0XJ 1TJEA 3BWUD 2DBYA 2LHEA 2EPBA 5AUIA 3PMFA 3S9WA 1SXTA 2EYHA 2KCCA 4EQPA 3NXWA 1MHXA 2J42A 4UAIA 4C1NI 2ACZB 1TS2A 3J7AF 2IDYA 1DM0B 1OXXK 3TP7A 3I9V1 4HAEA 5BMHA 3KLSX 4GLSC 1G8ZD 3KF8A 1O80A 3LB8C 2O4XA 2OT2A 2BE5D 4CGYB 1B9RA 5KNCA 3P4PB 2RVLA 4ARCA 1I4XA 3QO2A 4G7ZC 3T4AC 4HRSA 3IAYA 2NB0A 3MC0B 3RLFA 1TS3A 2JA8B 5FLXL 1FR3A 2YYZA 2CJNA 5AFWA 2N0SB 2PMZB 3GV6A 5EPJA 3BVZA 1EIHA 1GPXA 5F2DA 1Z47A 1O7YA 1XF5L 2A69D 1S4ZA 5FLXE 3NUHB 2WINB 1SYFA 3TEXA 5M3MB 1AN8A 2WACA 4PMCA 2JA5B 1DOYA 2JA7B 5I2XA 3BYYB 2CJOA 4EGVA 4OIJA 3E56A 5BN5A 1A3TA 2MP1A 2QDBA 4EQOA 4KKJA 1H9MA 3SVMA 3NWTA 1F9PA 5EQ0A 4ZK9B 1AFPA 2E2IB 2Y0SB 3TZUA 2NN6H 3ONAB 1HTLD 1I6VC 1PTOC 1NEKB 1SYEA 2XSCA 4I65A 1GJXA 2FMCA 2GA4B 3V96A 1CQFA 1VZ6A 4DXGA 2B2WA 4C3IB 3W9CB 2PVGC 3L3OC 2B2YC 4FXCA 2L11A 4ZAIA 1FM0D 5KYLA 1ESRA 2CU3A 5FOBB 2K0PA 3EROA 2KACA 3NHHA 2QILA 5I9PA 4KGSA 4FF1A 5D65A 3M3YB 4RCOA 3H91A 1XCTL 5IIFA 1SIJA 3VRAB 4ME5A 3IFDA 1UUPA 1G2SA 1FRRA 1UGJA 3JAME 3VR5A 2E74C 2RDFA 4XT3B 1ESFA 2F3WA 3FKIB 1KABA 5JPMC 5JVH3 3DHQA 1EEFD 1HA6A 3MFGA 4LTUA 3HGBA 5HG2A 1Z6HA 3VR9B 3O13A 3BS1A 1B4OA 1BCPF 2F0WA 3HKZB 3VA7A 3U2SC 4NJCA 2L55A 2EELA 1LTTD 3C3LA 3E5SA 2KEDA 1PRTC 3NTIA 5C3XA 3N52A 4AQ7A 2Q8TA 2NZ1D 3DWQA 1A2UA 4KI0A 3AE9B 1PTOB 1TWFB 4FXDA 2KUMA 1Q1EA 3MZ5A 3S1RB 3T56B 4YTPB 2EE1A 4OO1G 4B9WA 2PLPA 2L1BA 3FAHA 2KQ3A 3WOEA 1N63A 1D2BA 1YMHE 2SOBA 2LHDA 5ELDA 2Q8RE 3CWIA 1OXTA 4F87A 3KLRA 1TS5A 1UNSA 1K51A 2BBCA 3S2HB 1V97A 1D4BA 1CA6A 2FINB 3M4YA 5HGTA 2MPMA 2EY5A 1PRTD 3BIID 4QUCA 3HEJA 5BN3A 1HQRD 3H8HA 4IOIE 2SAKA 1TWGB 3H0GB 3I91A 1I4GA 1EIGA 3R2TA 2JQRB 1S5CD 3QJYA 3E0JA 5EKKA 4KY5A 3W5VB 5ELCA 1KLGD 2PTLA 3H94A 2K5WA 1PDXA 2AX5A 4RF1A 4FP5D 1ENAA 3SFEB 2RDHA 5C4JB 2Z1CA 3D31A 3H3VC 2EJGC 3BYTB 3H09A 2WU5B 1G6ZA 2RPVA 2VZKD 3NQTA 1CZWA 4NMZA 5I4DA 1NSNS 2Z8LA 2ZXRA 1PTOH 3NUCA 3E9SA 2KWDA 1ZYRC 5G5GA 3RD4A 3GTJB 4TQ1A 3HOXB 3HRDD 2F0OA 3VR6A 5E4XA 3GTMB 1QWYA 2B8FA 2EYOA 1JROA 3WCQA 4RF0A 4C3IG 3D3RA 3PV0A 5C3EB 4OO1H 3FPUB 1XYIA 3IT6B 1EYAA 5JXVA 5M5YB 5D3IB 2LFNA 4JK1C 1DCZA 1K53A 3EVQA 4DQOC 2RKSA 5G5HA 1HHVA 1MSHA 1YNJC 2N55A 1S5DD 3I70A 1D5XC 2OHFA 5C5MA 1BO0A 4BY1B 1FNUA 4FXGC 2R61A 3QOLA 1IKMA 1QOBA 2FFKB 2IGHA 2B2UC 1Y1WB 3GTLB 3RMHA 3BDLA 3PZ8A 4R8IA 4KJOA 2Y3AA 5K5PA 3J80L 1PLFA 2WIIB 2K22A 1RM6C 1J9OA 3NBHA 2PNRC 4MACA 4G7HC 1YQ3B 1PRTB 2GB1A 3LXFA 1Q8IA 3VR4A 1KDCA 5CBEE 1BQQT 4KY7A 3I8ZA 2K04A 4NP5A 2VUMB 4K6LA 4RHRA 3K0YA 2ZW0A 1VDVA 3V3XA 2IJ0A 3S1QB 3A8IE 3M7GA 4NKLA 1JCKB 1B44D 2FBWB 3NQIA 4MH8A 4Q5VA 4XDCA 1I4QA 5J39A 3IXSA 5FO7B 1X3QA 3CHBD 3SR6A 2R6GA 2I38A 3P20A 4OHJA 1I50B 1DOXA 1SNPA 3BK1A 3PUWA 1NUCA 1AZPA 1FIQA 1NCVA 1SE4A 4G4KA 1ILQA 2ZW1A 2IT1A 3K5NA 2B76B 3MXGA 3AN1A 4B0EA 1LV9A 4CKEA 1PFBA 4BA2I 3NTHA 1MI2A 1FMAD 2WXNA 1BOSA 4YIJA 2K5DA 2QEJC 2CW0D 3SDZA 3NVVA 4DU9A 1RYJA 4F88A 3SK5A 2TSSA 2XWJB 2F0EA 1J8IA 5H92C 3IKJA 1NR4A 1WD1A 1EQVA 3EFXD 1VMCA 1D5ZC 1CM9A 1LT4D 4GDLB 1BR9A 1T5XD 1QF6A 3WDNA 3OSOA 2PW5A 2PPBC 1SYDA 1TKEA 2B2VC 1E10A 4CJ2C 4DAPA 1BUIC 2EJMA 4TQUS 3D4DA 1WYGA 3GD7A 3B2FA 3GTQB 4CJ0B 2NWGA 1SYBA 2TMPA 1E2WA 1QB5D 3I57A 2E76C 1HZ5A 3SR1A 3RZDB 2FHTA 2J52A 4RHSA 4IZ8A 2IX3A 2HDLA 4XTCS 2KEEA 2F0SA 1YQ4B 3KK7A 2NVTB 2WQYB 5ISRA 5J22A 4FNFA 3K57A 2LS01 1H9SB 3GQBA 1ZPSA 1PMRA 1QE6A 1Y1VB 3T51B 4BBSB 1J7CA 2B2UA 4NAWB 3RUZA 1NR2A 4U68A 1EY8A 3SEBA 2QCPX 4RAUC 2WDQB 2VZKB 2F03A 2B2VA 2J0TD 3AEAB 1QILA 3NTKA 5EE0A 1VZ7A 2KQ4X 1U4MA 1MI0A 2JXTA 2PW7A 2W82A 1GXDC 1C8CA 1MBYA 5EBDA 5D7GA 3ZJTA 4PQXA 5M9OA 4WH4A 1PYWD 1SNQA 1L0YB 2PZWA 1IKLA 1QG7A 2OXPA 3TEYA 4RA8A 3VYSA 2WS3B 3A55A 3J7YW 1BUVT 3TBIB 4KKIA 4C80A 1GHJA 1DJRD 1S5FD 2B8GA 2F0QA 5J1ZA 3Q8BA 5IOCA 5H8YE 3MWYW 3ETRA 5C0XI 2N88A 1V8QA 1CZGA 1JORA 1GOZA 3AV8A 2JEAI 1E0ZA 2ONQA 3D8GA 1Y8NB 1U4PA 2BT6A 1ZXHA 2K01A 1TU2B 3MXUA 1Z7TA 5E6JA 1SYCA 2A69C 5A35A 5I9OA 1NYQA 2MHVA 3HG9A 4IUVA 2INNE 2NTTA 4GDKB 4OIKA 1SDFA 3P7JA 2E2HB 3K6OA 2DY8A 4YSZB 1F2YA 3PO0A 4UDUC 5CC4A 3FDTA 2WKDA 3GV3A 1FFUA 3PIP3 3OMCA 1KNAA 2B2WC 5LL6S 3NBIA 4IFDJ 2MEKA 1ACCA 3AEEB 2X6LA 1CA5A 1HUNA 1PUTA 1JOKA 4K5XA 1BMLC 2J7ZA 2BS4B 1ZP0B 3FC4A 1K8MA 3VR2A 1JQYD 1O7LA 4OL7A 1DXMA 4JPSA 4AS1A 3W3AA 2D5GA 4RKBA 2E6XA 2ZT9C 2SEBD 2ON8A 1QOHA 1T3QA 1RWSA 4REZA 2JYOA 4FF2A 3Q0AA 1PGBA 1DOLA 4A3KB 4C3HB 4TSSA 3CU7A 2G9HD 2IWHA 1BXTA 1U9RA 1TYGB 4IUTA 2EKIA 4JWUC 1EY7A