2QEJC

Crystal structure of a staphylococcus aureus protein (ssl7) in complex with fc of human iga1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
191
structure length
191
Chain Sequence
YDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQNHQLFLLGEDKAKYKQGLQGQDVFVVKELIDPNGRLSTVGGVTKKNNQSSETNIHLLVNKLDGGNLDATNDSFLINKEEVSLKELDFKIRKQLVEKYGLYQGTSKYGKITIILNGGKKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for evasion of IgA immunity by Staphylococcus aureus revealed in the complex of SSL7 with Fc of human IgA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords IG ALPHA-1 C REGION
total genus 48
structure length 191
sequence length 191
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qejC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qejC01
2Z8LA 4C56C 4BWGB 1I4RA 1G8ZD 1EFID 1EWCA 1QILA 1HTLD 1I4PA 2NTSA 3BVZA 1HA5A 5D3DA 3R2IA 1DYQA 1LTAD 1AW7A 1L0YB 1SXTA 1B1ZA 4DXFA 1BXTA 1ENFA 1RD9D 1PTOF 1S5ED 1LTSD 1BCPD 1S5BD 2XRSD 4RCOA 4ZYSA 3BVGA 1D5ZC 1AN8A 1FD7D 1LLRD 1SE2A 1KTKA 1PRTC 2RDGA 3URYA 1KLGD 4RH6A 1V1OA 1LTGD 1ESFA 1V1PA 1F77A 2XNAC 2ICIA 1FNWA 1PZJD 5ELFA 1UUPA 1I4HA 1EU3A 1S5CD 2RDHA 3DWAA 1JCKB 1PYWD 1TS5A 1LT6D 2AQ2B 1CK1A 3O13A 4RFBA 1CQVA 2G9HD 1PTOB 2TSSA 4RHRA 4O1NA 1SBBB 1D5XC 2XN9C 1JR0D 2IJ0A 1RCVD 1D5MC 1JWUD 1S5DD 1FNUA 1SE4A 1B44D 2O2LD 5ELDA 1SJED 1UNSA 1JWMD 1XXGA 4L63B 4NZLB 1TS4A 1T5XD 1YN3A 1LTTD 4TSSA 1TY0A 3R8BA 1TY2A 1YN4A 1KLUD 1BCPF 1LO5D 4DXGA 1PTOH 3DWPA 1I4GA 1ET6A 3MC0B 4RGOS 3BYYB 3V05A 2AQ3B 1SJHD 1D6EC 3BVMA 1ET9A 1LTRD 5FKAC 4RHSA 1YN5A 1TS3A 1SEBD 1CHPD 1HXYD 5FK9C 2XRQD 5TSSA 1S5FD 2WV6D 2QILA 3BZDB 1HQRD 1CHQD 1FGBD 4OHJA 1MD2D 1LT4D 1RDPD 1BCPB 1LTID 1PRTB 5ELCA 3SEBA 3OWEB 5ELBA 1JQYD 4RGNA 3DWQA 1DJRD 1BCPC 1SE3A 2QEJC 1EEFD 4UDUC 1LT5D 4L6TB 2IPKD 1LT3D 1PRTD 4K6LA 3TSSA 1FNVA 1STEA 1EEID 1RF2D 2J4XA 2CHBD 5I4DA 1JWSD 1LTBD 2R61A 1EU4A 3CHBD 5D3IB 3W2DA 3R2TA 1PRTF 1PTOC 1V1PB 4RGMA 3KLSX 1PTOD 4Z9CB 1M4VA 3GP7A 1L0XB 1I4QA 1CT1D 3MFGA 3EFXD 1I4XA 1TS2A 2AQ1B 3EA6A 1GOZA 2NTTA 1PZID 1XTCD 2SEBD 5ELEA 1PZKD 3BYTB 4RGTA
chains in the Genus database with same CATH superfamily
2YEPB 2R2QA 3CC2A 3LJ3A 2MSED 2WXLA 2V4IB 1C9OA 2ENBA 4F8MA 1KAAA 1QILA 3QIAA 3TQYA 2B2WA 4FF2A 1KM7A 1MHHE 1D3ZA 1VQIA 3TS0A 4B0MA 3LGJA 5LL6X 1WR1A 5M3FB 1SNOA 4OWXB 2RHSB 3PF5A 3L9AX 1VQ8A 5JJLA 1XT9B 2EJFC 4RCOA 2X6LA 1VZ7A 3F2CA 4ANWA 4BY1H 2CS4A 3X3MA 5HY6A 2PO4A 2JYOA 3D4DA 3IAYA 2VH1A 1JOQA 5BYRA 3SR1A 2L15A 1IBLL 1IKMA 1ICFB 4LAAA 2NVXB 4KKJA 1JT8A 4NAWA 4OELB 5KYIA 3FKIG 3GE3C 4FHJA 1BUVT 4P75A 5JPMC 1SN8A 2I5LX 3K59A 4A3CG 5G5HA 4PK1A 1FNWA 2E74C 4D2KA 5J18A 1TKEA 2IDYA 2MFIA 5ELFA 2GBRA 2OTLA 4C00A 4C1NI 4DHZE 1QNUA 4C3IH 2BH8A 1F0ZA 2M56B 4LCDE 1JCKB 3T56B 3MEFA 4M1UB 2A5HA 5EDSA 4DFAA 3IKJA 3C19A 1QUQB 3ONSA 3H3VC 2N3SA 4P2CB 2E2IH 1WGDA 4WAFA 3OW7A 3AMZA 4GN1A 2EXZA 5JEAG 4BKSD 5BN3A 2B2VA 3K7AB 1JOKA 1H4RA 3AFPA 1Q90A 4A75A 2R7FA 3I73A 1A6XA 2G3QB 1IBML 1B44D 5GAEC 1N36L 4NZLB 1GHJA 4OZBA 2L55A 4YIJA 2CHXA 4C3HB 3V6CB 2K6AA 4IN3A 4IFDH 3F2BA 1LO5D 5C4JH 5AEKB 2WP8J 3AXCA 4BFRA 4RWSC 3HRDD 5LLIA 1ONLA 3DPDA 4IWOA 2WDTB 3A8JE 4DDID 3UGBB 2WS3B 1HUNA 1FPYA 2O6VA 2B3GA 4DV2Q 1U5KA 4QCLA 2JA5H 2KWVB 4WURA 3QR8A 3TEYA 1YNXA 5FK9C 3T51B 1GM5A 4ICVA 2NVTB 3N3KB 2I0QA 2LGYA 4IW0A 4LUVA 5GAGC 3OW2A 1WTXA 5C4XH 1JW9D 2WHIA 1MG8A 1PA6A 2L83A 3QA8A 3PGEA 4X66Q 2V1CC 1N63A 1E2VA 3I8ZA 1HNWQ 3OJ3A 4IWQA 3ZW3A 1KRSA 3ERSX 1PH4A 4DQOC 4G57A 4JOIA 3RLFA 3BWUD 1FXAA 3NVVA 3NVZA 4FLHA 3NHEB 4KZ0A 1V80A 1SRUA 2L32A 2SNSA 1NMFA 3GTMB 5J1ZA 1NI2A 4IDIA 1P1AA 1K28A 4RF1A 1KOTA 3VR2A 3Q2AC 5E4XA 2ONQA 1Q3LA 1EU4A 3CCEA 3CHBD 1Q8KA 1QVGA 1QVCA 3SDLC 4BY7B 2DX5B 1L1OA 3KF8B 1PTOD 2ZCCA 2RKSA 2EZVA 4A3EB 5CGKA 4DV5Q 1X1MA 1CT1D 4QB4A 1E10A 2MX2A 4W9EA 2XSCA 2INDC 3HOVG 2I5HA 4LFCQ 3U4ZA 2B8FA 5D94A 2L11A 4FJYA 4ZRZA 1EWCA 2EMSA 2QC8A 3HOVB 2RQXA 2F3IA 3S15H 1R4MB 3B1LX 3FPPA 3KJOA 4POGA 3GTQH 3BY4B 3Q8CA 5IP4D 2ZXRA 1IKLA 2MNAA 1DYQA 4KIKA 2KNBA 4X3TA 1I7HA 2QSDA 1RD9D 1PTOF 4X65L 4DV6L 1BCPD 4GOPC 4ZYSA 1A3VA 3BJUA 3RUIB 4NJ7A 4BY7H 4GLAC 1NNXA 1JRPA 1WSPA 3OJ4B 3SHQA 3AB9A 4KKSA 4HCSA 1IZ6A 1PFDA 4NAMA 2L12A 1I3QB 2WDRB 3EC8A 5M3MH 3ND8A 4X64L 3GTMH 1OXUA 1IW7D 2EJMA 5EPJA 5CV7A 3TBIB 4IUMB 1YMHE 4BXXG 2ZT9C 1YIJA 4MJSA 4IALA 4N9PA 1AWDA 1KJTA 2Y5BB 2YLMA 2F0MA 3HGBA 1N61A 2UXCQ 3T3NA 1TQOA 2K39A 2ZTDA 5D14A 2EJGC 5C4XB 3A8KE 1XEEA 3HS0C 4IO9A 3R3OA 1YJNA 1WJNA 1I94L 1J8IA 1RRBA 4W9FA 3ZDMC 5CR3A 2Z6BA 2LGDA 4H7BA 3EROA 3T1YL 4KV2A 2KDFB 4CDFC 4JI3L 4LK1C 1IYFA 4HAEA 4FF3A 2WXHA 3K81C 3T16A 3GOEA 3HKZB 5FO7B 4GOCA 3ECIA 4XT3B 1UGJA 5C4HA 1GUNA 4L8JA 4OIJA 2KMAA 1X65A 4HEDA 4IC7B 2ZM6Q 1WFYA 2L05A 3DEOA 4A3IG 4DAYB 2NVUI 5BN5A 4ZYNA 5GROA 4MGZE 4JI1Q 2JX5A 4C3HH 4IUUA 5JEAH 1Q86C 2KFKA 2CWPA 4JPSA 2LHEA 3PUVA 4OO1I 4JW0A 3KF6A 3I63C 3K7AH 3KBXA 2EYHA 1C4QA 5EQ0A 2BVCA 3MC8A 2W55A 2VZKB 4FADA 2FINB 2WXMA 3RYTA 1I94Q 2GI9A 1TT2A 1YZ6A 2F0PA 4RA8A 3P20A 4YWLA 3GTOB 1R4PB 1CQFA 3Q8DA 5EKIA 1WRIA 4JWSC 2F0DA 3IVFA 1RYJA 4CHTB 1FJGQ 3OPOA 2Z6KA 3CCQA 5FR3A 2W9NA 2BYEA 1S3SG 1YNND 2QEJC 3P1MA 4DV0Q 2HTHA 3W5OA 4BKSA 2JXXA 1I6HH 3Q22A 1HNZQ 2N9XA 2WDQB 3ZUNA 3KK7A 2EXDA 1XPRA 3AE9B 2NVXH 3H8HA 2N0SB 3AEGB 1LTLA 1ZKHA 4GDLB 4Y7NH 3OTOQ 1KD1C 3W2DA 3S17B 1PTOC 2K8CA 3UDFA 4UY8C 5EE0A 3SDZA 1ESRA 2HIVA 2A6HC 4K5XA 3R93A 1XMOQ 1N5WA 4MM3B 5BN4A 1ZXHA 3OYYA 1PFBA 2WLBA 3DCGA 2OQ0A 2PZTA 5DNFA 3PO2H 1HTOA 4APVA 3M7NA 2JZPA 5KYLA 1CFMA 3VXWA 1NTGA 4JBWA 1H9RA 3ZYYX 4K7UA 4RG1A 2D3GA 2LFIA 3A1QA 3C3LA 3M4OB 4DV0L 4JI2L 2IY0B 2RMMA 4LJPB 3RN2A 4GS3A 1E8WA 2FMMA 4DUZL 2F4IA 3GV6A 5I9PA 1ENFA 4XYQA 4W9GA 1KLVA 2K01A 3PHWB 1C76A 2XIWA 1M90C 4K5VA 5IGGA 1XD3B 3SD5A 5M3MG 5M3FG 1KTKA 2B29A 5KNDA 1NYQA 1YQ4B 3RCZA 3CU7A 2DY7A 4CQNA 4A3BB 3RPFC 3GE8C 4KGTA 4GKKQ 1F77A 3MTSA 4FJZA 1K3RA 3GTQB 3S15B 4NNJB 2RVLA 3FKIB 3KVFB 4RM9A 1WE6A 3J81j 2AL3A 2B2YA 1S40A 3TJPA 2V9HA 4I7ZC 4A3FG 2A8VA 1JALA 3PREA 2KHIA 5T1GA 2MQHA 2B63G 4K7SA 3NK9A 4OZCA 2NVQH 3NRZA 2RDFA 2PIAA 3ZXVA 2RPVA 3P75A 3MZ5A 1Q10A 3U8ZA 2AQ2B 1CK1A 1VQ4A 4A3FB 4DUZQ 1D7QA 1Z9FA 2B63B 4RMAA 2RF4A 3SK4A 4O1NA 2GRIA 3SHLA 1WI0A 4KX6B 1JICA 1TU2B 3SK5A 3MXGA 2K5WA 5C4ZA 1WWTA 5G2NA 1EQRA 1HUMA 4L1BA 1SJED 4IM2A 5JHBA 3BZKA 5L83A 1PH3A 4GKKL 3ABVB 2NWGA 3W1GA 2F0JA 3I91A 3TREA 4NQKE 2WAQE 2LVOA 5IE8A 4I6LB 1O7IA 1FFUA 1OEYA 2XK5A 4OO1G 3S14H 4A93H 1XCTL 1DOLA 3AQQA 5E1FA 1EM7A 3KUZA 1IYJB 2EE1A 5ISRA 1KFYB 1L2NA 3BVMA 4XQQA 2SAKA 3SFEB 3EJIA 4RMFA 2M4NA 4B9XA 1GNUA 2IGGA 5BMIA 3T1HQ 1V5TA 1SAPA 1YJ9A 2NVTH 2C7MB 3V6EB 5IGCA 3BZDB 4GU2A 1CHQD 1XNRQ 1YJJA 4RKLA 4JC0A 4DK6C 1BVSA 4C3JB 2X6GA 2DNEA 2WACA 2JA5B 1VD2A 1E90A 2Z0SA 1TKGA 2CW0D 5EKLA 1Q1BA 4CHKA 2KA7A 1Q7YC 3L3OC 3TBLD 4KTAA 3DWQA 1HFGA 2Z6KC 1VQKA 3NS1A 3ZVVA 1DOMA 5C4JB 1B9MA 1EUVB 3WCQA 1JMLA 1H9SB 1V43A 2J0MA 1VF7A 2R92H 4WWMA 5HHDG 1NY4A 1EEID 3N1YC 3TL5A 4C7ZA 2FCSA 2K3UA 5I4DA 1LTBD 2Z4IA 5BMGA 4KGRA 1JJ2A 3IFTA 2KWCA 3SE0A 1J7CA 2JF5A 4ANXA 4ZHPA 2KJHB 4DV1Q 3LDZE 4GLXA 1C0AA 2O2VB 3HZXA 3C1FA 3M85A 3QK0A 2Z0EB 4LW1A 4LF8Q 2AL6A 3MP9A 4K3BA 4F7ZA 1GUWA 5GADC 1VQDA 1FGUA 3I2ZA 4ZUJA 4JI8L 1UGMA 3AE3B 4K3CA 3QWZB 4A3EG 1DOKA 1ZKOA 3W3AA 2NZHA 3T13A 2EYOA 4JI6Q 1F2YA 2FAZA 3AI5A 2MBBB 2PPHA 1HZAA 3N52A 4WJPA 1HTLD 3CQZB 5A2QE 2AUKA 1XMQL 3MJWA 5DCNA 1CKMA 1CM9A 5D3DA 3J7YW 2L00B 2REXA 1RODA 3AU5A 5LXHA 1EY6A 4XYOA 3N9YC 5JVH3 1AW7A 3PIO3 2K8HA 1FO4A 4IUVA 2KKCA 2XWBB 2VL6A 5IIFA 4X6AH 1SYEA 1X32A 3A74A 2H88B 4HWIB 3M3YH 1SNQA 2B2TA 3DBSA 4BY1B 4TQUS 1NUCA 3GZNI 3BINA 3H15A 2L1AA 3K8AA 1DOXA 5M3FH 1ESFA 4BY1G 1V1QA 1YNJC 1PFMA 3CAMA 3LWUA 1DZ1A 2INNE 4WH4A 2KWUB 5MPOA 2ZW1A 4BAXA 4UP9A 2L76A 4N8X1 1YD8U 1OXSC 2INCC 2RDHA 3AEDB 3HIZA 3HVDA 1L7YA 3HOUG 1KRTA 3PZ7A 3VUXA 1QVFA 2VS1A 2VQEQ 4LWCA 1ROEA 1IBKQ 3Q8BA 2KVZA 2CH4W 4DV6Q 4NDXA 1QQRA 1NJIC 1R9TH 1QG7A 2D07B 1J5EQ 3F2DA 3PSEB 2A73B 1XLPA 2JA8G 1NBWA 1P98A 1GAQB 3H7PA 5KRUA 2Y0SB 3JVZX 3QQ8B 4DR5L 1L1OC 4YCVA 2K6DB 3PS6A 1GO3E 4HDOA 4XDDA 4TKNA 3QX1A 2XVSA 3A7LA 2H4OA 3CMAA 4WRDA 2K4KA 3U4EG 4GDKB 2JE6I 4M8AA 2UU9L 2PEAA 3I4MH 2E2JB 1VQLA 1NSNS 4BBRG 3QJZA 1WZ0A 1R9TB 2PYKA 3RN5A 1RKNA 3DVNV 3EUB2 2W3RA 3N32A 2DGYA 5G3LF 2MP2A 3UIOB 1ET6A 1Z47A 3I3CA 1C8CA 1Q1OA 2V4LA 3NVWA 4LF5L 1CKNA 1ZEQX 2F0EA 3BYYB 4EQ5A 1SROA 3KUDB 5FKAC 3AB5A 4AH6A 3K57A 5FOBB 2M0AA 1Y1VB 3M62B 3A4RA 1CHPD 2YTVA 4G0NB 1HJPA 4KY6A 5TSSA 3PIPA 3PO3H 3NQIA 4H02A 2LJ5A 3D4RA 2PE9A 4QUCA 1GUGA 2B2WC 5H1SE 2WKCA 4JI3Q 2D3BA 4ZK9B 1CZGA 4GNXB 1TIFA 2DWQA 2KCNA 3A9JA 1BKBA 2K6QA 1A15A 4K1RB 3HOZB 3CPWA 1V6EA 3CCVA 3SVMA 1A3UA 1DJRD 2J0KA 2MW5A 1RHPA 3FPUB 3GDEA 4OWTB 4DV3L 3GTGH 3I4OA 2MCNB 3I56A 2LXCA 4R4OA 1PRTD 1MHWC 1FNVA 2UWQA 4B3SL 4X3UA 4AYBE 1EY0A 1CA5A 3VA5A 1E24A 3AE8B 3GTPH 4LLGM 3S1RH 3VTUA 3EA6A 4A3DB 2GBMA 3A56A 2MQJA 3NBIA 1YQBA 2WX0A 5FLXL 2B39A 2NCNA 2WP9B 2L0TA 1K83H 4NMZA 1GPXA 5CC4A 4FXGC 1WOCA 1QKZA 5IT9c 3J80E 1E6EB 5E7NA 2M0XA 1RFAA 2F0OA 4PMBA 2DZJA 2NZOA 5EE1A 3NG0A 4C4VA 5M5WH 4CDEC 4HMJA 3WIMA 1OFFA 3M9BA 1KAWA 4JV5Q 2F0VA 1GUTA 2R92B 2NBWB 4DV2L 1YJWA 3UQBA 1LLRD 1BMLC 4K6DA 3QHTA 4YCWA 4M0WA 2C7NB 2MHVA 1K50A 1K9MC 2A1AA 3A1QB 3I90A 3TCAA 4HK2A 3NSWA 1TKWB 2CU1A 1E0BA 2VB2X 5IYBH 3ND9A 1SIFA 5IO9A 3VUYA 2MBEA 1TTNA 1SLJA 1HNZL 3C1EA 1PH8A 1QJOA 1ZXTA 2FNJB 1VMCA 4DN4M 1LACA 2WU2B 4ZRJA 4YHHQ 4XTCS 3TZDA 1C7YA 3PO3G 3N30A 2IY1B 4YT0B 2ZVNA 2B2TC 2KK8A 2Q2HA 3JYUA 2DENB 2E6XA 3PZDA 4R3DA 2E2HB 5K36H 2XTIA 4DU9A 4A3MH 2FXQA 1JR0D 2IJ0A 2SOBA 1SB3C 4EFOA 1JWUD 3KBGA 3I4MG 1XO3A 5I2XA 2LHDA 1KDBA 3AE2B 4JPBW 1HZBA 2C60A 3W1SC 1C9FA 4LF9L 1YVCA 2KX0A 4GKJL 3FHWA 1TY0A 3NZ3A 1C4CA 3BK1A 2VW9A 3L10B 4U673 4A3FH 5DPRA 4W9KA 4TRDA 4X3SA 3E9SA 1ICWA 4U68A 1ZYRD 2J7ZA 5IP7H 4RHSA 4PYZA 1TS3A 3VFKA 1SEBD 3S16B 1LGRA 3L2PA 2XRQD 5FLMH 5IA7A 3DHIC 1SMYD 4X62Q 3G71A 2MBOA 4ICUA 4OVZA 4XQNA 1B9RA 3TEHB 3K9OB 3TP5A 1PUTA 3ULLA 3I7FA 2CJOA 2EQSA 3MA2B 3NXWA 4MZ9A 4IWPA 3HG9A 4QF4A 1WXQA 1OQQA 4US9A 2L5TA 4OEMB 1IHZA 2ZXOA 1MBYA 3TS2A 2I2YA 2RPQA 2WXFA 1UWVA 1ZDXA 1UWXA 4NPNA 2PZWA 4WJ4A 1TXYA 1LT3D 3VTVA 4LNQA 2ALYB 4K6LA 3EFUA 1GJZA 4P73A 4XIGS 3T3OA 5EE9A 3EN2A 2QA4A 1RIPA 1JE5A 2A69C 3M63B 2OXPA 3RNUA 3AH7A 3AU4A 2PI2E 4GLSC 1IYUA 2OWOA 1ACCA 3B6YA 2C9WB 1MGSA 2H1EA 4IOAA 4REZA 5DAUA 4HJ8A 5C44B 2RA4A 1YQ3B 2A6EC 1JWBD 1CTMA 1RTNA 3T1HL 2UUCL 1H9SA 1K73C 4AQ7A 3PO2B 1PDXA 3F2UA 1R4MI 5C44G 2JA6B 4N9F4 2SEBD 4NXMQ 4ODGA 5CORA 4E3CA 5JXVA 2DAJA 1V2YA 3VR9B 4K8IA 5T8IA 4HCPB 2RCFA 1ZE3D 3APFA 4LF4L 1U4MA 2F0FA 2D5DA 3S17H 2F3VA 2MP1A 2ZEQA 4A3IB 4MTKA 2ATWA 4Y7NB 5C6AA 1F2ZA 3CC4A 4FJVB 4KY5A 4HKZE 3WA0A 4IM3A 3U30A 1WMHA 4S3SA 3UF8A 1BO0A 2EVBA 1I6HB 4F88A 4XYCA 2LD9A 2PLPA 4B3TQ 2MA9B 4DAYA 2BQQA 4GOPB 1PRTC 2D0OA 1Z7TA 2YV5A 3HK0A 4K8JA 1S1QB 1Y1VG 4XQJA 5C3EH 4XGAB 1J0GA 1VQEA 3TN2A 3DWMA 2RSOA 4PS7A 3RD4A 4IUPA 2PMZE 3CCSA 1VQBA 1UE6A 4WORA 3A8IE 1M1KC 2DZKA 2MH7A 4C7YA 1NR2A 2K03A 1FJGL 4JWUC 2ZJQA 2QCPX 4MEMA 1OXTA 1E8YA 2GN5A 3VR6A 2KOXA 1BNZA 1NEKB 1OEYJ 2LRWA 3G4SA 2DYMA 1Y1WB 2CHWA 5E6OA 4A8XC 3VTWA 3TRZA 1VCIA 1TWCH 1AP0A 1EF5A 3VYRA 3U50C 4KGSA 1HHVA 2A68C 2BKRB 2EMTA 2FJ2A 4ZLTF 1T6BX 2BT6A 4JI0L 3MWYW 2QIEB 4KDIC 5C3XA 1TWAB 1SBBB 2AKWB 3S2DH 4DR2Q 3OWFA 5KGUA 1GJXA 2UYZB 3A5ZB 2R7ZH 4ZOHC 1E2WA 1S5DD 3IBEA 2MJEA 1V9JA 2K5NA 2VUMB 4FULA 3QB3A 3J7ZC 4QIWB 4MGKE 1NVID 3FAHA 5IP9G 1ZUD2 4KVGB 3QG1A 3FILA 1YN3A 3KUPA 1Q8IA 1SYDA 1SFOH 1TY2A 4WFN3 2VUMG 1R4NI 3MVVA 4X3KA 3MAQA 4A3MG 3HFZB 1AE3A 2N88A 5D6JB 3NP8A 2WQYB 3KWVA 1EY7A 3V05A 4FN2A 1KDAA 2KC1A 1SJHD 2V3SA 2GVAA 2QW7A 1K8GA 2L7RA 3AE1B 2WINB 4JQWC 3PUWA 4A3LG 3LYYA 4JX1C 1SDFA 1WRDB 3RMKC 4UP8A 2BYVE 5E6PA 2LFNA 4A4IA 2QILA 5A35A 1Y69U 1SGHA 2ON8A 3HVZA 4II2B 2EOTA 3P4RB 1O80A 1VQJA 2V3NA 3WALA 1J5EL 3CKIB 1KC8C 2V4DA 2CHZA 1EZ6A 5M3MB 1AH9A 2MLBA 5IYBG 1NBFC 5EAYA 5BR8Q 3FMCA 2EELA 2DNCA 1UELA 3RI7C 1N34L 1V49A 3W1SA 4EE2A 4HMIA 5F2DA 3KLRA 3JAMc 1KQSA 1P9DU 2IW3A 5LMNW 2MRPA 3PF4A 4DWFA 3IG3A 3H9DA 4P74A 1V86A 3TSSA 5A2QL 2KQ7A 1GXDC 4WIPA 2Z9HA 1NR4A 4POFA 5C0XI 2BA0A 5EBDA 1K8AC 1UH6A 2JZ3B 5AUIA 5C0XG 3A9JB 4R4TA 3PRMB 1LV9A 3ERQA 2AWNA 1JORA 1STAA 3P42A 3HOVH 3PIOA 3VVWB 2LRUA 4M00A 4DR5Q 3AE5B 4FBJB 1L2FA 4KDLB 1HNXL 4CDCC 3BU2A 5ELOA 2LGXA 4ITKA 3W5UB 4PZ6A 4A9AA 1A0IA 2R6GA 2RHQB 3NHHA 3L0WB 2LEKA 2K33A 2KDIA 3NE5B 2FIFA 2HDLA 1SMYC 1CA6A 2LVQA 4JLCA 3CP0A 3H91A 1ZDVA 4E74A 4HSPA 2UXBL 3PTFC 4FHKA 2Y5CA 1IP9A 1SYGA 2WX1A 1MKHA 4LFAQ 5DM73 4DR7L 1GC7A 4N59A 1STGA 4K5WA 4ZRPA 4OWWB 1SXTA 4DF7A 3SU8X 1ZOYB 3DLLA 2F4VL 2AYOB 2BB6A 1DONA 4DK5A 2OTJA 2PQEA 1DOYA 4BOSC 1HTQA 3KLWA 1YI2A 4EQPA 4NB3A 2E2DC 3TP6A 4AQYL 1JB7A 3VRBB 4DHJD 1WTWA 2XK5B 2N55A 4AJWA 5K5PA 3E9HA 3F8TA 3A0JA 4MTNA 4BVUC 3VYTA 1V1PA 3G48A 3PLUA 4HPLB 2E75C 1UBQA 2A6ED 4NKLA 1TBEA 1EZ8A 4R8IA 4A76A 4TQ0A 4F7XA 1HZCA 2JEAI 3AEVA 2NVYH 4CKCA 3VA7A 3QOJA 1XNQQ 1WX7A 4M02A 2IHFA 1ML0D 2N49A 1IXRA 4PS8A 4F1SA 2OT2A 3FEWX 4DK0A 4EQNA 2WXPA 4LNKA 2NYZD 5C2TB 1WZ3A 2K25A 2M9VA 4LUZA 3A9KA 1UBIA 3KDFB 2W3SA 3L13A 1HZ5A 1I50B 4A3OA 4O0AA 4J1MA 4HJ7A 4EZKA 2D0PA 3B2GA 1EWHA 3R8BA 2F0LA 1QCBD 2E2IB 1Y8RC 5T1IA 5IYDG 2M8SA 1BCPF 2M19A 3DHGC 3EHVA 2F0IA 4C3IG 2CJNA 3H3VI 1XYIA 1WX9A 3J7AF 4AYBB 4ACFA 2O6VD 4JV5L 4I65A 3VR5A 2JT4B 4C3IB 5IYCG 1HRJA 3OIQA 2KHSA 3GTJB 3NJTA 1FCLA 3H94A 3IL8A 4UPAA 5KNBA 1K8RB 5CTRC 2ZNVC 1J8CA 3NEMA 4LNNA 5AUKA 2EPBA 4NXNL 2B76B 4JCVE 1PH5A 1VQPA 1MI2A 1JQYD 3Q8EA 2Q8RE 4KMUC 1IBMQ 5D65A 5FR6A 1ENCA 4JBMA 1QOFA 2EY1A 4UDUC 2D2QA 4IUTA 2IPKD 4A6QA 5HKHA 1WTOA 4CBVA 2QJLA 4XDCA 3N1XC 4BY7G 1TZOA 3L08A 4L23A 2JRIB 3RZFA 4C2MB 1EFWA 4ARCA 1B53A 3A54A 3SR6A 2B2UC 4MH0E 3LXFA 2OJWA 4IPHA 2N78A 4BBSB 2DZIA 4CKBA 1P7EA 3ULPA 1T0YA 2E8GA 2G1EA 4XC2A 3U9SA 5IT9L 1VZ8A 4GGQA 3RULA 3WOFA 4IFDJ 2RDGA 4NXNQ 4ANUA 4XZ4A 2HHHQ 1W6KA 3K7UC 2SDFA 3V60A 1JQ4A 2DYOA 4BBNF 1I4PA 4JI5Q 1HA5A 2KWDA 2HDMA 3PT2B 1EOTA 2MWSB 2EY5A 3QAQA 3X23A 4DK3C 1J6QA 2F52A 4O2DA 5AJ3L 3K5NA 4EQOA 2JRHA 2LWPA 2PJHA 4L5TA 3T8MA 4J3OD 3K80C 2J53A 3PV1A 1HR0L 1D5ZC 2WXOA 3A55A 1A70A 3PMFA 2K50A 1GUAB 1MSHA 4RH6A 3MFYA 2OJRA 1OQRA 4ZCKA 3ZKJC 4JI7L 5IOIA 1JMCA 3M3JA 1FEHA 1K51A 2JVCA 4P7IA 5D7GA 2VH2A 5KHQA 4IUNA 4JYAL 2OEDA 4O42A 1JB3A 1SYCA 2AMCB 3VAWA 1VQHA 3E5SA 2BS3B 2IYDB 4NXML 1P3QU 1WMHB 4H2AA 1VJKA 1E1TA 1PGXA 3TZUA 2DNFA 2B8GA 3AULA 1J7AA 3CW2C 3EVQA 3PCOB 1VMPA 2K8BA 3I57A 3KYHC 4EUTA 3NBHB 4DR3L 1SYBA 2DN8A 3D6WA 1HTPA 3DWAA 4N6EB 2Z59B 4GNXA 1VQ7A 1TYGB 3O13A 2F0QA 2N9KA 2TSSA 3VUWA 4HROA 2UUAL 2BA1A 2R3ZA 3M4YA 3VDYA 4E6IA 3KYDD 3HEJA 2M00A 1KDCA 1HA6A 2ZJRA 5IY0A 3TP8A 2JXTA 2QGQA 3PHXB 4BBSH 3TIXA 4NQLB 2QHOA 4EX5A 1Q0WB 2L4NA 4TSSA 3D32A 3J7A5 4A3DG 1KLUD 1RL2A 3Q14C 2KJRA 4YWGG 1Q1EA 1X9NA 4DHZB 2Y0SE 4F87A 2UXCL 4RGOS 4PV1C 2LJIA 1TWGB 3EFCA 1ILPA 1LTRD 3VDZA 4B3TL 2JYTA 5TR5A 1TVXA 4PMCA 1FRDA 3WOEA 4CKEA 1R4NB 1UEAB 2Z4HA 4LF6L 4IZ8A 1E3PA 2BE5D 4WWOA 3OMGA 2WV6D 3UI3A 4JI0Q 2YU9H 2HJ1A 4LNFA 1F9SA 3RFZB 4OHJA 3IT6B 1RDPD 4YWKA 1DOIA 1PRTB 3IFDA 3GZNB 4H0LC 3M95A 4KY7A 1DCZA 1JE4A 3KFUA 3RNGC 2I38A 2EY6A 3HOWH 1D1IA 1XTDA 2NZ1D 2QKIC 5IGDA 3I55A 2E76C 1RM6C 1T0SC 2X8XX 4AP4C 3AMUA 4J15A 4ZAIA 2GBJA 1GB1A 1UE1A 2VRRB 2KC2A 4GSWA 4R4CA 1YEZA 2BDOA 2R61A 2KACA 1Q46A 4ZQ3A 4HIOA 2PPBC 2R93G 2A5UA 2KTRB 3V3XA 1YNNC 3B2FA 1U0LA 3ULJA 1UWMA 4BA1I 5IWAL 2KYWA 4I6NB 4LMQD 2DAFA 3Q8AA 3GP7A 5IGEA 4HLEA 1I4QA 1UF0A 5JVG3 3EFXD 1Y56A 1I4XA 2JA8H 2NPTB 4BBRB 4K2KA 1GOZA 3DXJC 3R7QA 2ASQA 1EUJA 2Z8LA 4C56C 4A3KB 1F52A 1SIJA 3RNBC 3HOUH 1EQQA 1RJTA 3E9IA 1QUQA 2PVGC 3B9JA 1YJ1A 2AX5A 2KCCA 1K8OA 2V1YA 4K81A 3R2IA 1TJEA 3ZRFA 3FDTA 4DV7L 1WVLA 2F0GA 2B3AA 4OX9L 2HTME 3ZXRA 1L0YB 4M8NA 2LXJA 1ZPSA 1YHAA 1E8XA 4ZRIA 3ENEA 5IOCA 1OTRB 4HIMA 2AEHA 1YITA 4KK7A 1AN8A 4A3BG 1SE2A 2D3AA 1QE6A 4B95A 3CF6E 1CKOA 2GOWA 3CSTA 2X38A 5CV4A 1RAXA 1AARA 4WJNA 1Q5WB 4GKJQ 5NUCA 1E8ZA 5IYCH 3RZWC 2Z1CA 1CI3M 3E56A 2L9HA 3APDA 3AEAB 3G7LA 4IQZA 1PZJD 3I70A 2FCNA 5J39A 2W54A 4URKA 2F0KA 5C0XJ 1TGZB 4K7WA 1DGJA 5KEEA 3I4LA 3D0FA 1IUEA 4DV7Q 1X55A 4CO7A 1Y14B 2E5LL 2YEPF 2NUCA 4A3GB 4PMWA 2W82A 1PTOB 2MJDA 1XMOL 4B08A 3S2HH 3IRBA 3TMPB 3NUHB 1EY9A 4OXPA 4P1CC 3D8GA 1RCVD 2WWZA 4P6VF 1YJIA 4WWNA 1EQVA 4AQYQ 1WTHA 2D5GA 4G3XB 3U52E 4DV4L 1XXGA 3Q6SA 3OMCA 4P71A 3K58A 1W3SA 3S1MB 2WXIA 3AV8A 3MC9A 5EBCA 2KD0A 1TWFH 4JI2Q 1E7PB 2MJ3A 2WB1E 3OOCA 4DXGA 2IGDA 4DHJB 1PGAA 5J2RA 4NAWB 5EPKA 2KEDA 4LF7L 2HIXA 3FVQA 3A9KB 1E7ZA 4F8CB 3AYHB 2BCOA 2RBMA 4UP7A 1D2BA 1HZ6A 3RZOB 5M5YB 3L0OA 3PRPB 3V61A 3EQLC 5LNK1 3ZNHB 3PRZA 3VQIA 4L2YA 3UIPB 2N9LA 5I2YA 4QY7A 3I4NH 2WXRA 2WXNA 1S5FD 1IBLQ 2ZPNA 1U4LA 4B9WA 5IAAC 3FRPB 4HJKA 5L37A 5LMUQ 2B2VC 1EIFA 1MD2D 3H0GH 3BDCA 1PHJA 4BXXH 2Z0DB 5J3BA 5EE3A 3CD6A 1V8CA 3STBC 4NW2A 2F0WA 4KLKA 4DPGA 4L5SA 4HKQA 1EEFD 2C35B 5EGTA 1Y8OB 4NPSA 4AS1A 3ZTDA 3J80c 2IX0A 5DPWA 2K1FA 4CGYB 1FL0A 2KDMA 3WWVA 3KH0A 1NI3A 4ZKCB 5D3IB 1B3QA 3TDQA 1Q12A 1SFOB 1OXVA 1WCMH 3KLSX 3FKYA 3ZJTA 4GIVA 3DUZA 4KHVA 2L1BA 3RZDB 2KTFA 2WU5B 5H8YE 3WANA 1B4OA 1TS2A 1EY8A 3CC7A 4JBJA 3ZJYC 5IP9H 3CF5A 1L0VB 1HR0W 2A19A 1PQSA 3R7RA 3ZJUA 2CW0C 3S2DB 2GBNA 1V8QA 3KQ4A 5M5XH 4DXAB 1VDZA 1FVIA 1WJUA 2HD5B 4JE3B 1IGDA 1S4ZA 1OQYA 2IX1A 1HCZA 1WF9A 4II3B 3D4WA 4OIKA 2NTSA 2ASBA 1FD6A 4YY3Q 2IO1B 1EL0A 3ZIMA 1BXTA 2F0UA 1F2RI 1SNPA 1Y1WH 3I5JC 2K52A 1WCMB 4G7OC 1V5OA 1XF5L 2IBIB 3AM9A 4KHPL 1XNRL 4YTPB 2WB1B 5IGFA 3RN9C 3M4PA 4FXKC 3U2SC 3NPPA 1KL9A 1A5RA 3ZLZA 5FLXc 1WTPA 2NBVB 3F1ZA 2D11A 2WB1G 1WTVA 3OLMD 4ANVA 5LMNQ 4M8MA 3CRLC 3K6OA 2KT7A 3HOXH 3CCRA 3GS2A 3ZNID 1VZ6A 1PYSB 5C3EG 4B3ML 2GBKA 2HE7A 5C23A 1LABA 4XXEA 4K0KQ 1UUPA 5DM63 1C4PA 1G6ZA 3MXNB 5I9OA 3DHQA 1MJDA 2CWAA 1K8MA 2BB5A 3LB8C 2NB0A 4V0BA 3VR4A 1WXMA 2MO1A 3ZDTA 4R4IA 3DMUA 4KN4C 3DHHC 3C2PA 1TZ1A 4LNOA 1SSOA 1PH1A 3TEZA 1C3TA 1WD0A 2BTEA 1HR0Q 2KFJA 4IFDI 2WYQA 1T3QA 1KHIA 4KIKB 2O5IC 4IFDG 3DBHB 4NP5A 3KOJA 1ENAA 1AZQA 2MHJA 4QQBX 4TMAB 2HHHL 5LXIB 3VRAB 1SMXA 3HM3A 4KI0A 4HJGE 5C44H 2LMCB 3PSIA 1TWFB 4TVAB 4FF4A 1LTTD 5LMNL 4RKBA 4JI5L 4A3PA 5C3WA 3Q3JA 2IX3A 4FYDA 1TWHH 3PVLA 4P72A 3JSVA 4YWMA 4LJOB 4DR6Q 1D6EC 1ET9A 2PQAA 4IURA 4MJSB 4LJZC 1N33L 3HM6X 3AFQA 3WAMA 2D10A 2PW7A 3KWLA 4TV3A 1EOVA 4LDTB 4A3GH 4JI7Q 1VDVA 2BWES 1LT4D 1KXLA 3BK2A 5D2MB 2KQ3A 1B8AA 3RD2A 1C77A 2J52A 4DUYL 2MP2B 3MHZA 3HP3A 2JK8A 3PV0A 4WJWA 2Q2IA 1CKNB 4B0EA 3BDLA 1TWHB 3CXCA 1T0RC 2Y5PA 1XLQA 3HOYG 1X3EA 3Q69A 2L0CA 3I72A 1GKHA 2R7DA 4OONA 2MPMA 1EY4A 4FA6A 4WJ3M 1PFNA 2R2OA 5FLMG 2G45B 2IO0B 3X0WA 1D1KA 2K5VA 3HOYB 4JI4L 5IP7G 2FE8A 2K7VA 1JC7A 3DQVA 4ASWC 4ARIA 4DAPA 1NMGA 4RGMA 4FF1A 2IGHA 2BE5C 2KVMA 2EYFA 1OO9B 3MHBA 1WGGA 1X56A 3PPAA 2B2YC 3AEFB 1E0ZA 3MFGA 4IPDA 2UU9Q 5HFYA 1VCBA 5CMDA 4CDDC 2JA7B 3E3XA 4A3MB 2KDEB 2E2HH 1EFID 1WTQA 2KTRA 3ZNZB 3J80i 4ZRQA 3NELA 4QJFA 1D8LA 4QL5A 3ETRA 1H9KA 2EYJA 2JJQA 2ZXPA 3D3RA 2ZVOA 3KDFA 2BS2B 2QDFA 2VZKD 1MVKA 2VY3A 1QLBB 1B1ZA 1S72A 3BS1A 1S5BD 4HPPA 4LF6Q 1N62A 4P16A 1Z5SB 4WWPA 1Y8NB 2D2CC 2K1BA 3E0EA 1LXDA 3URYA 2LASA 3A33B 4LFBL 3QARA 4IM0A 2KEEA 1FFVA 4AIMA 5FO9B 1NAPA 4GDLA 1ZW7A 3H6NA 2K5QA 1HEZE 1WGHA 2CH4A 2XNAC 2SNMA 4DV3Q 3TEXA 2NS5A 1QNKA 2OOBB 3RT3B 2M1MA 1XCQL 3DVGY 3P4SB 1HZ9A 2YVCA 1F1HA 5M5WB 1I4HA 5M5XB 4KD3A 1SNCA 1WJJA 1R4QB 1T0QC 4LNIA 1P0RA 5AZGA 1G51A 4WJOA 3RUZA 5JJZA 2QDLA 1IYVA 2C5LC 1I5FA 2ZTEA 2EIFA 1MJCA 4PS3A 1XQQA 2ICEC 1B3AA 2JWZA 3A7AB 2TMPA 1X3PA 1TWGH 2N7EA 2O6VB 2FUHB 2O5JC 1WYGA 5ELDA 4BBSG 3CMEA 1KNAA 4ZRKA 1EWIA 1ZYRC 2LSSA 3W1BA 1VQMA 3GTLB 2K04A 2R7ZG 1YN4A 4LUOA 1C4AA 3RNEC 2JP1A 3KJPA 5CX3A 2KQ4X 1I4GA 3QJYA 2BWFA 2KCMA 2WXKA 1YIWA 5CHFA 1PLFA 2L3ZA 1G291 1JJCB 3K0YA 1EIYB 2MBQA 5AJ3Q 4A3JG 1B7YB 2ZJDA 4C3JG 1HXYD 2JY6A 3DBRB 2PKOA 1K53A 4OW0A 3I4NB 4S17A 2LKVA 1FGBD 3HOZH 4A3JB 3B0AA 3I9V1 2A74C 4B3RL 2UXDL 2KCTA 4LFCL 1QB5D 5M5YH 2OEOA 3RZOH 3KYCD 5ELBA 1C48A 3LX0A 3B08A 2JA5G 2E3TA 3CRKC 4QMGA 3PO3B 4DV4Q 2H5XA 5EPLA 3RMHA 4LF9Q 4FP5D 4KJOA 1WJ4A 2KVRA 5KHOA 3GV3A 4OO1H 1N6ZA 3TUOA 1RF2D 3DM1A 3PUYA 1NDDA 2D62A 2CHBD 2QCZA 1IPGA 2LUMA 5CHVC 1JWSD 1STHA 5G55A 3P1HA 1NCVA 4AWJA 1F2MA 2KN4A 3SK6A 3PO2G 1C78A 4ILWA 1NYRA 3C8YA 2PNRC 3DBLI 1WY8A 3MHSD 4WQMA 3LWEA 2D9UA 2WGSA 5H92C 1EYGA 5LHY1 3BG3A 2UUAQ 2PVOD 4XT1B 3VYSA 3T4AC 1LFDA 5C1ZA 1PZID 2LXKA 4G4KA 1B50A 1ZGUB 4MNOA 2JWUA 1BR9A 2MBHA 4RGTA 4YXDB 4K2LA 1ZXIA 4IG7B 3HKSA 2K5HA 4LF7Q 1PXUA 4DR3Q 1GD7A 1O7YA 4UHVA 2JSVX 1VQFA 2LUEA 3CCLA 3H7PB 3CSFA 3T1YQ 2AHOB 2JQRB 2A69D 2XRSD 1IW7C 3KLSA 4A3CH 2HJ8A 2DUDA 5LMUL 1YBYA 4GDKA 1P7FA 3L54A 4JL9A 4J6HA 1WIAA 4IJLA 3WAPA 2N1VA 1E2ZA 1X54A 4C2MH 2G4DB 2QEXA 4R8NA 1V1OA 4RF0A 4B9KA 1LTGD 3S2AA 5C5MA 1FRRA 4G50A 2PMZB 1IBXA 2A68D 2ICIA 4ALPA 3IAM1 4PYUA 3M3YB 3IT4B 3ITPA 3DM3A 3S24A 3NWTA 2L8JA 1PH7A 2Q2TA 4L5RC 2JYEA 4DR4L 1B2TA 2F0SA 1D4BA 4JK1C 3P7JA 1BBUA 1X3FA 5CBEE 2KANA 3ML9A 4BBRH 1SNDA 2JA8B 1MPEA 3IXSA 1WYWB 2INPE 4RFBA 2KZRA 1N8RC 1MI0A 4GXBA 4RHRA 2JUOA 4LF8L 1D5XC 3EECA 2HQLA 3NTIA 4PZ7A 3BIID 2CQAA 4WQOB 1L4DB 1WGYA 2XEWA 3DOWA 4AUQC 4JOIC 2ZW0A 2O2LD 3BDOA 2NBUA 1H9MA 2Y0SG 1WX8A 4I6PA 3GQBA 2K5PA 2KLGA 4MN3A 2RGFA 4USAA 1EO6A 2UUBQ 3NENA 1OGWA 2BPSA 2IZVB 2AWOA 2K9XA 4XX5A 1I50H 1I42A 4GLVB 1QT9A 2G4SA 5KNCA 3HOWG 4IOIE 4IKGA 4KHPQ 3HOXG 1AYFA 1HE8A 1DGSA 2Q8IB 3UDGA 1A62A 1BT0A 1VS0A 2AUJD 2EDGA 4RAUC 3CCUA 1HQRD 2K5DA 3T53B 5DPSA 2NVYB 1BCPB 1LTID 1RWSA 2CKZB 3SEBA 3JSVB 3OWEB 1VQGA 1JROA 1VRAB 2RSUA 3SFDB 2CR5A 4K0KL 2HT1A 2PQAB 2AWTA 1YHQA 1XX8A 4MM3A 3HOZG 1WH3A 5HGTA 2GLSA 4AOFA 1XLNA 4CJ0B 2UUBL 4A20A 4QUFA 2VNUD 4HEA1 1H9JA 1WD1A 4HJ5A 2Q2UA 3S14B 4A93B 4HPMB 4DR6L 4TUUA 2C5CA 5AFWA 1BOSA 1X6OA 2VXWA 3KUCB 3G6JB 3J7AV 2E5LQ 2WDVB 4OGQC 3DWGC 4ZUIA 1VQ5A 3QC8B 4H44C 2CU3A 3LNNA 2PMVA 4W9LA 1G6JA 3H09A 3DDCB 2D3CA 2NN6I 1UE7A 1PFSA 2HUGA 3GD7A 1PZKD 3BYTB 4G7HC 2QDBA 1U4PA 3Q24A 4DNTB 4DUYQ 1JRUA 2JZZA 1PGBA 3TMEA 5FJ8H 2L52A 1FM0D 4YSXB 3VYUA 1F2RC 4Q2JA 4LF5Q 5HG2A 4TKOB 5K36G 2DZMA 2R92G 4CJ1B 2DLBA 3IHPC 1N33Q 1K0SA 3NOBA 2WKDA 1MG4A 3DBRI 3SXHA 1S5ED 4NJCA 2V3PA 1O78A 3BVGA 1ASZA 1NENB 1GVPA 1QOGA 4JI4Q 3OG5A 4FVMA 1G6PA 5HI1A 4DKAC 2V0GA 2GMIC 3PO0A 3OIPA 3PLVA 4X62L 1E1OA 3W9CB 3H0GG 4HXDA 1SSNA 4DNIA 1CSPA 1E22A 2EYLA 2DYBA 3L17A 5AZHA 3UE0A 1TT5B 2I46A 2HD3A 5EJWA 4A3JH 2H89B 3I3TB 1J9OA 2F0TA 4NY0A 1SYFA 1L6VA 1N5XA 2J7QB 2UXBQ 1ISNA 4MELA 1A2UA 5IT9E 3J9CA 4WJQA 4LK0M 3UINB 3J81E 4NJ6A 1PYWD 2IY5B 2EYMA 2VZAA 2VQFL 4GNXC 1H95A 1W2BA 1QZEA 1STNA 4KHZA 1WXAA 2PNHA 4MACA 2G9HD 1MHXA 1OTCA 4V190 1HNXQ 2KUMA 3UDIA 2CFMA 2DY8A 3JC66 3JAME 1N32L 2RD0A 1TR5A 4EGVA 3DBLB 4HCNB 4DV1L 1K0RA 1D5MC 3GTLH 1JJGA 4GMVA 4W9CA 1FNUA 4LFBQ 1H8CA 2LY7A 1XWEA 3S9WA 3NY5A 4JGHB 2C7HA 3RNCC 3QIJA 3K5OA 3MTNB 3VH3B 2PZUA 3J81L 3NVYA 2I07B 4KKUA 1L0WA 2UU7A 4AYBG 3ZQ4A 4DAMA 1DXMA 1XMQQ 3MC0B 4MIUA 3M7GA 2F4VQ 2R7ZB 1UZXB 2FBWB 4A90A 4IPCA 4EKUA 2LVPA 1EY5A 5C5LA 5IGBA 4C80A 1UAPA 2JEBI 1QOBA 4N9TA 4PG3A 1V9PA 2BH2A 3GTJH 1W6JA 4JI8Q 3Q0AA 4PQXA 5ELCA 2GB1A 2DJFC 2K05A 3I4NG 4Y52H 1YX6B 4P1BC 4GZYC 1CZPA 1GUSA 3EBEA 3GTOH 5BO4B 3P2BA 2K75A 4BA2I 3Q23A 4HCEA 4DA2A 1GC6A 2K28A 4QAYA 5E6NA 3N20C 1STEA 4EOYA 3J81c 2KDBA 2OHFA 3QOLA 3DEPA 5C3EB 4XWTA 3VR8B 4CYEA 5IYDH 1B9NA 4GN4B 3CCJA 5COYA 1KIXA 4BKTA 5FLXE 2N4FA 5DEHA 2XBBC 1WR6E 1PRTF 4CJ2C 4R9WA 4BKGA 4XDXA 2QMTA 5CV9A 4GN3B 2JA7H 1LUZA 4DR2L 2AQ1B 1HFNA 2LXAA 1E7UA 5G5GA 4A3IH 3MXNA 1T9HA 1KF6B 2KJXA 4X66L 3MXUA 4B3MQ 4G7ZC 3H6MA 1AE2A 1I4RA 1G8ZD 2CCZA 2IO2B 1Q81C 3C46A 2JA6G 2IO3B 3K0XA 1STYA 1EYDA 2F0HA 2OCEA 1VQOA 2EYPA 2ES2A 1LTAD 1RFKA 3HOYH 4J8QA 4MGYE 1MIUA 1C1YB 3NTHA 3X3NA 2MO0A 4JIOU 4TQ1A 3RNFC 2BYTA 2LMCA 1FD7D 2UXDQ 3OSOA 2ZPYA 1KLGD 3U7DA 5BMHA 2M17A 4PT5A 1I3QH 3FC4A 2PI2A 2BGFA 5FO8B 4IUQA 5CBAE 1VF5C 1PMRA 1KH0A 1L1OB 2LS01 3KF8A 3R3MA 1UD7A 2K22A 5BR8L 3U9OA 4RCNA 1UE5A 1U4AA 3DVNU 3FP9A 1WGKA 1A3TA 5CV6A 1BBXC 4LTUA 2A4ZA 1HH2P 3CWIA 3NWSA 4E71A 4YL8A 4W9DA 3Q3OC 1QWYA 2FMCA 1YX5B 2X69A 3V62A 2J0JA 4YTMB 4MT5A 2XN9C 1WJ6A 3EIVA 2NN6H 1QOHA 3UQAA 3ZJVA 3QWNA 4C1NK 1SE4A 1DM0B 2KQSA 3HUIA 1QOAA 5GXGB 3AE4B 4JVZA 3RLOA 4A3EH 2BKFA 1UNSA 1GG3A 5BYQA 4KV6A 2N7DA 1CJEA 3L4PA 1U9RA 4L5QA 5I6WA 4GOPA 2ZZPB 1FXIA 2N9PC 1P8LA 4HJ9A 4B3SQ 2KAJA 2Y3AA 5BYSA 2OQKA 2PCFB 3BZCA 1HQMC 1WCMG 2J0TD 5JOBA 1V81A 2KO3A 2Q5WD 4X65Q 1EIGA 4M01A 2DBYA 2BF8B 2AQ3B 3CPFA 2JPHA 2CVRA 2MGSA 4HRSA 4KKTA 1WXSA 1GHKA 4K14A 4FXDA 3P4QB 5CV8A 4DK1A 1GB4A 1OXXK 1STBA 1BQQT 1CUKA 3NZUA 4KKIA 4HIKA 3HOXB 2LGSA 1CZWA 4X64Q 2DHZA 4DDGD 1F2LA 3UDXA 1E5WA 3VH4B 3ZGZA 2KMMA 4OZAA 3SK8A 1F9PA 5JPNC 4A3LH 1AZPA 5GMVA 5E6JA 3ZNGC 2ZM6L 5DPTA 3OHXC 1F9RA 1LT5D 3T9LA 3VR3A 3N1ZC 3HKZE 3L7ZC 2NBFA 1EIHA 3PIP3 1RTOA 2VUMH 3FILB 3JW0X 2WAQG 2ZTCA 2YYZA 3HKZG 2KMCA 1XNQL 1SE9A 3R2TA 1M8AA 4HTHA 4KSKC 1X3GA 1V1PB 2KFKB 3CMMB 4A93G 1TWAH 3DBHI 1VR9A 3H3VH 2WAQB 2JA9A 2JXMB 3KF6B 5J22A 5CYUA 4C4VB 5FJ8G 3G6EA 4G11A 2KENA 3H7SA 2C9OA 5JEAJ 4HR7B 4ME3A 4JI1L 1XLOA 1TWCB 3MJ5A 2IWHA 4BWGB 3RZDH 2FFKB 4IPGA 4AJYB 1K83B 2I5MX 3JAMi 2ZNVB 4M0WB 4YHHL 2IT1A 5JAVA 3A5UA 5CHWA 1I35A 3BVZA 1PH2A 1KRHA 4QGUA 1JOOA 2ID0A 4ABNA 4BOZB 3K5LA 5IKCM 1FCCC 1MJEA 4DR1L 3S1RB 4JBKA 1LTSD 2NPTA 2BDNA 2PW9A 3APCA 5I6YA 3GTPB 4A55A 2KXJA 1SF0A 3UI2A 2ZCBA 1E9MA 3K5MA 3NTKA 1VQ6A 4US8A 5M9OA 4Q5VA 1VQAA 1N36Q 4W9IA 1ZP0B 4B6WA 2IL8A 2GA4B 1XPOA 1L5PA 3ML8A 1LQBA 1SE8A 3H0GB 2YTYA 1HNWL 1U4RA 3JAML 1A63A 2GVBA 2FCMA 1YNJD 1CSQA 1LM0A 4MGIE 3PGZA 5CV5A 4A3GG 1EYAA 1EU3A 2WXJA 2WXGA 2KECA 2HQEA 2B2UA 1UEBA 3OTOL 2JA6H 2RDBC 1TS5A 1AFPA 4HSVA 1I6VC 3AU7A 1WFQA 1CQVA 4DR1Q 1IL2A 1WGRA 2CQOA 4HIDA 1L4ZB 4EZLA 4B3RQ 2G9DA 4PNYA 2F1MA 3PUXA 3QO2A 2JA7G 3S1MH 1M94A 4A3KG 4C3HG 2BYFA 2WNMA 3ZO5B 4ULLA 5G3LD 2LGIA 2G5DA 2F03A 4MH8A 1TIID 3Q3NC 3IAS1 1VQ9A 3OAWA 1JWMD 4FXCA 1AEXA 4HJAA 1T5XD 2E2JH 3I4MB 4KZCA 4DGZA 4EVOA 2DJGC 3S2HB 1KABA 1A8VA 1PTOH 3PUZA 4OX9Q 3ICEA 2N1WA 3AN1A 4LF4Q 1N9WA 1KNEA 4HDQA 1WYDA 2R93H 1F9QA 3GTKH 1YN5A 2KHWB 1VQNA 3STBD 3AE7B 3V96A 3NUCA 4PZ8A 4DV5L 1J7BA 2UUCQ 3Q8FA 2O4XA 3W1YA 2XWJB 4FDBA 1WXVA 3S1NH 3S16H 4RM8A 1N60A 4YSZB 2K0PA 4YSYB 3S1QB 3R66C 5E3FA 1Y8PB 1SNMA 4Q0FA 2KJ6A 3IFWB 2KBNA 1C79A 1WM3A 2MEKA 3ALBA 1PV4A 3W5VB 4QIWE 3J81i 3KW5B 2OF1A 1PH6A 3V2TA 3NS8A 2FCQA 3PQIA 1QF6A 3RNAC 1II3A 1K3BC 1T5EA 1QZGA 3TEWA 2BOSA 2HCIA 2I1KA 3O65B 5JHAA 2EY2A 1B70B 2JQOA 3M4QA 3QCAA 2VB3X 3VHTC 4W9JA 3U58A 2N9EB 1N32Q 2FUG1 2YTXA 1IBXB 3E6ZX 4Z9CB 2I1JA 1E7VA 1PH9A 3HOUB 1G2SA 4A3KH 4HN7A 4DNRB 4RNAA 2K32A 2FIDA 2JU6X 1Z2MA 4ID6A 4XWWA 4MHEA 1XTCD 4OL7A 3NBHA 3UE1A 5ELEA 4DBGA 3CQZH 5L95C 2FHTA 1IGCA 2RR9A 1A2TA 5C0XH 1J19A 2L0FA 4MDKE 1YOVB 3ONAB 4DR4Q 5IN7A 1HPCA 1MSGA 1PDQA 1WTRA 4LDTD 1Q82C 4EEWA 4FO2A 2KHJA 3H1UA 3PZ8A 4R4QA 5E4WC 4DXFA 1BBWA 2HDEA 1O7ZA 2LZ6A 3AEBB 1S3OA 2ZJPA 1G91A 5IODA 4HVBA 1MFWA 4WAAA 4ZHOA 2HCCA 2IHEA 5HGQA 1RLFA 3HOWB 1EWYC 5JJKA 1WI5A 5JH5C 5EKKA 5JJIA 2NMQA 3U4VA 4N58A 2RCNA 1FYCA 3MEHA 3AECB 5GQOA 4OVVA 2A6HD 3SGIA 2YU9B 1FXTB 2KX3A 2O2VA 1YHBA 2KLCA 4JI6L 1BUIC 3A4SC 3AE6B 1ILQA 2BS4B 4XE0A 4BBNC 3HHMA 1S5CD 5DLQE 4C3JH 2P5ZX 2WIIB 4A3DH 4DAVA 1NE3A 4YY3L 1Y1WG 1LT6D 4IJHA 1IL8A 4H13C 2F0NA 1PVOA 3P4PB 4W9HA 4KJNA 4IOCA 2NR2A 2MUYA 1XJVA 1FR3A 1QZHA 2J42A 2N7JA 4KSLC 5IWAQ 2LI5A 4YTNB 4R1JA 1ASYA 2WFWA 1CMXB 3Q3FA 3ER0A 1EF1A 1L6UA 3K9PB 2QF7A 3RLNA 1N34Q 5HURA 2Q8TA 2N8NA 1X3QA 2KN5A 3P63A 4L63B 3ZRCA 4N8FA 1TS4A 3NQTA 4I7AA 2JSOA 4GB9A 3GTGB 5GAHC 3NZSA 3ZTCA 3C0RB 2XGTA 1LYLA 4MSMB 3DWPA 1V97A 5LL6S 3E0JA 3WDNA 2CKHB 2RSNA 4FNFA 5ELNA 1TKYA 2PE6B 5C3JB 2JN4A 2B63H 2F3WA 2VQEL 3D31A 4MSQB 1IBKL 1FIQA 1PYBA 1O7LA 4J6IA 2KOLA 3RR5A 1Y1VH 3Q3MC 2K14A 2EKIA 3U7ZA 2ACZB 2NVQB 4JYAQ 4S0RA 1JWAD 3S1QH 4ME5A 5KIXA 3HRZC 5J17A 2PW5A 3S1NB 4JG2A 3CIRB 4RGNA 4ZKBB 1XPUA 1BDOA 1VQCA 4GN5A 3FKIH 1BCPC 2MJ8A 1SE3A 1SR3A 1R7SA 2EKEC 3MXPA 4L6TB 4LFAL 3GTKB 3J80L 1BF4A 4DR7Q 2R93B 5C4XG 3DVGX 1GUOA 3CCMA 4YCUA 1VLBA 1Z6HA 4A3BH 2J4XA 4UAIA 2BW2A 1DD2A 1WE7A 4ZDVA 4BZAA 1F9JA 1EYCA 3GB1A 4EZJA 2PTLA 3WAOA 2VQFQ 1M4VA 3D6CA 5AZFA 5JZEB 1EQTA 1L0XB 1P16A 2M2LA 1YNTE 4KD4A 2NN6G 3GO5A 1LM8B 2WXQA 2BBCA 3EGRA 3TP7A 3AEEB 3L16A 3Q6BA 1K52A 1G2TA 1FMAD 4OVUA 3N6RA 2NTTA 4BS9A 4X57B 3M4OH 1WM2A 4KN7C
chains in the Genus database with same CATH topology
2YEPB 2WXLA 2V4IB 2ENBA 4F8MA 1KAAA 1QILA 3QIAA 4FF2A 2B2WA 1MHHE 4B0MA 5LL6X 5M3FB 1SNOA 3L9AX 2EJFC 4RCOA 2X6LA 1VZ7A 3X3MA 2PO4A 2JYOA 3D4DA 3IAYA 5BYRA 1JOQA 3SR1A 1IKMA 4LAAA 2NVXB 4KKJA 5KYIA 5G5HA 1BUVT 5JPMC 3K59A 1FNWA 2E74C 4D2KA 1TKEA 2IDYA 5ELFA 4C1NI 1QNUA 1F0ZA 2M56B 1JCKB 3T56B 4M1UB 2A5HA 4DFAA 3IKJA 3H3VC 4P2CB 4WAFA 3OW7A 3AMZA 2EXZA 5JEAG 5BN3A 2B2VA 3K7AB 1JOKA 1Q90A 3I73A 1A6XA 1B44D 4NZLB 1GHJA 4OZBA 2L55A 4YIJA 4C3HB 2K6AA 4IN3A 4IFDH 1LO5D 2WP8J 4RWSC 3HRDD 1ONLA 3A8JE 2WS3B 1HUNA 4QCLA 4WURA 3TEYA 5FK9C 3T51B 2NVTB 1WTXA 1JW9D 2L83A 1N63A 1E2VA 3I8ZA 4DQOC 4G57A 3RLFA 3BWUD 3NVZA 1FXAA 3NVVA 2L32A 2SNSA 3GTMB 5J1ZA 4RF1A 3VR2A 5E4XA 2ONQA 1Q3LA 1EU4A 3CHBD 4BY7B 1PTOD 2RKSA 2EZVA 4A3EB 5CGKA 1CT1D 4QB4A 1E10A 2XSCA 2B8FA 2L11A 4ZRZA 1EWCA 3HOVB 2RQXA 3FPPA 3Q8CA 2ZXRA 1IKLA 1DYQA 4X3TA 1I7HA 2QSDA 1RD9D 1PTOF 1BCPD 4ZYSA 1A3VA 1JRPA 1WSPA 3AB9A 4KKSA 4HCSA 1PFDA 4NAMA 2L12A 1I3QB 2WDRB 3ND8A 1OXUA 1IW7D 2EJMA 5EPJA 5CV7A 3TBIB 1YMHE 2ZT9C 4IALA 4N9PA 1AWDA 2F0MA 3HGBA 1N61A 3T3NA 1TQOA 5D14A 2EJGC 5C4XB 3A8KE 1XEEA 3HS0C 3R3OA 1J8IA 5CR3A 4H7BA 3EROA 4LK1C 4HAEA 4FF3A 2WXHA 3T16A 3HKZB 5FO7B 4XT3B 1UGJA 5C4HA 1GUNA 4L8JA 4OIJA 4HEDA 3DEOA 5BN5A 2JX5A 4IUUA 5JEAH 4JPSA 2LHEA 3PUVA 4OO1I 3KBXA 2EYHA 1C4QA 5EQ0A 2W55A 2VZKB 2FINB 2WXMA 2GI9A 1TT2A 2F0PA 4RA8A 3P20A 3GTOB 1R4PB 1CQFA 5EKIA 1WRIA 4JWSC 2F0DA 1RYJA 4CHTB 3OPOA 5FR3A 1YNND 2QEJC 3P1MA 3Q22A 2WDQB 3KK7A 3AE9B 3H8HA 2N0SB 3AEGB 4GDLB 3W2DA 3S17B 1PTOC 5EE0A 3SDZA 1ESRA 3R93A 2A6HC 4K5XA 1N5WA 4MM3B 5BN4A 1ZXHA 1PFBA 2WLBA 5DNFA 2PZTA 2JZPA 3M7NA 5KYLA 1CFMA 4JBWA 1H9RA 3ZYYX 2LFIA 3C3LA 3M4OB 2RMMA 2FMMA 2F4IA 3GV6A 5I9PA 1ENFA 4XYQA 2K01A 1C76A 2XIWA 4K5VA 5IGGA 1KTKA 5KNDA 1NYQA 1YQ4B 3CU7A 2DY7A 4CQNA 4A3BB 3RPFC 4KGTA 1F77A 3MTSA 3GTQB 3S15B 2RVLA 3FKIB 2B2YA 4I7ZC 1JALA 3UI3A 5T1GA 3NK9A 3NRZA 2RDFA 2PIAA 2RPVA 3P75A 3MZ5A 1Q10A 2AQ2B 1CK1A 4A3FB 2B63B 3SK4A 4O1NA 2GRIA 3SHLA 4KX6B 1TU2B 1JICA 3SK5A 3MXGA 2K5WA 5C4ZA 1WWTA 1HUMA 4L1BA 1SJED 3ABVB 2NWGA 2F0JA 3I91A 1FFUA 4OO1G 1XCTL 1DOLA 1EM7A 5E1FA 2EE1A 5ISRA 1KFYB 3BVMA 4XQQA 2SAKA 3SFEB 3EJIA 4B9XA 2IGGA 5BMIA 1SAPA 5IGCA 3BZDB 1CHQD 1YJJA 4RKLA 2JA5B 4C3JB 2X6GA 2DNEA 2WACA 1TKGA 5EKLA 2CW0D 1Q1BA 2KA7A 3L3OC 4KTAA 3DWQA 1HFGA 3NS1A 1DOMA 5C4JB 1B9MA 3WCQA 1JMLA 1H9SB 1V43A 1VF7A 4WWMA 5HHDG 1EEID 4C7ZA 2K3UA 5I4DA 1LTBD 2Z4IA 5BMGA 4KGRA 3IFTA 3SE0A 1J7CA 4ZHPA 3HZXA 3C1FA 3M85A 3MP9A 1GUWA 4ZUJA 3AE3B 1DOKA 1ZKOA 3W3AA 3T13A 2EYOA 1F2YA 3N52A 1HTLD 3CQZB 5A2QE 2AUKA 1CM9A 5D3DA 3J7YW 1RODA 1EY6A 4XYOA 3N9YC 5JVH3 1AW7A 3PIO3 1FO4A 4IUVA 2XWBB 5IIFA 1SYEA 1X32A 2H88B 1SNQA 2B2TA 4BY1B 4TQUS 1NUCA 2L1AA 1DOXA 1ESFA 1YNJC 1PFMA 3LWUA 1DZ1A 2INNE 4WH4A 5MPOA 2ZW1A 1OXSC 2RDHA 3AEDB 3HVDA 3PZ7A 3Q8BA 1ROEA 4NDXA 1QQRA 1QG7A 2A73B 1XLPA 1GAQB 5KRUA 2Y0SB 4OZCA 4XDDA 2XVSA 3A7LA 2H4OA 4WRDA 3U4EG 4GDKB 2JE6I 4M8AA 2E2JB 1NSNS 1R9TB 2PYKA 1RKNA 3EUB2 2W3RA 5G3LF 1ET6A 1Z47A 1C8CA 3I3CA 3NVWA 1ZEQX 3BYYB 2F0EA 5FKAC 3AB5A 3K57A 5FOBB 2M0AA 1Y1VB 1CHPD 4KY6A 5TSSA 3NQIA 3D4RA 4QUCA 1GUGA 2B2WC 2WKCA 4ZK9B 1CZGA 2DWQA 2KCNA 1A15A 3HOZB 3SVMA 1A3UA 1DJRD 1RHPA 3FPUB 1PRTD 1FNVA 4X3UA 1EY0A 1CA5A 3VA5A 3AE8B 4LLGM 3EA6A 4A3DB 3A56A 3NBIA 5FLXL 2B39A 2WP9B 4NMZA 1GPXA 5CC4A 4FXGC 1QKZA 3J80E 1E6EB 2F0OA 4PMBA 5EE1A 4HMJA 1OFFA 2F0VA 1GUTA 2R92B 1LLRD 1BMLC 4K6DA 4M0WA 2MHVA 1K50A 3I90A 3NSWA 1TKWB 1E0BA 2VB2X 3ND9A 3C1EA 1QJOA 1ZXTA 1VMCA 4DN4M 1LACA 2WU2B 4XTCS 3TZDA 4YT0B 2B2TC 2E6XA 4R3DA 2E2HB 5K36H 4DU9A 1JR0D 2IJ0A 2SOBA 1SB3C 1JWUD 3KBGA 1XO3A 5I2XA 2LHDA 1KDBA 3AE2B 1C9FA 1TY0A 3NZ3A 1C4CA 3BK1A 4U673 4TRDA 4X3SA 3E9SA 1ICWA 4U68A 1ZYRD 2J7ZA 4RHSA 1TS3A 1SEBD 3S16B 2XRQD 1SMYD 4OVZA 4XQNA 1B9RA 3TP5A 1PUTA 2CJOA 3MA2B 3NXWA 3HG9A 4QF4A 1WXQA 1OQQA 4US9A 2L5TA 1IHZA 2ZXOA 1MBYA 2I2YA 2WXFA 1ZDXA 1UWXA 2PZWA 1LT3D 4K6LA 4XIGS 3T3OA 5EE9A 2A69C 2OXPA 3AH7A 4GLSC 1IYUA 1ACCA 4REZA 1MGSA 2H1EA 5DAUA 5C44B 2RA4A 1YQ3B 2A6EC 1JWBD 1CTMA 1RTNA 1H9SA 4AQ7A 3PO2B 1PDXA 3F2UA 2JA6B 2SEBD 5JXVA 4ODGA 5CORA 3VR9B 4K8IA 5T8IA 1ZE3D 1U4MA 2F0FA 2D5DA 2F3VA 2MP1A 4A3IB 4Y7NB 5C6AA 1F2ZA 4KY5A 4HKZE 4S3SA 1BO0A 2EVBA 1I6HB 4F88A 2PLPA 4DAYA 1PRTC 1Z7TA 4K8JA 4XQJA 3TN2A 3DWMA 2RSOA 3RD4A 4IUPA 4WORA 3A8IE 2MH7A 4C7YA 1NR2A 2K03A 4JWUC 2QCPX 1OXTA 3VR6A 1BNZA 1NEKB 2DYMA 1Y1WB 4A8XC 1VCIA 1AP0A 3VYRA 4KGSA 1HHVA 2A68C 2FJ2A 4ZLTF 1T6BX 2BT6A 3MWYW 2QIEB 5C3XA 1TWAB 1SBBB 3OWFA 5KGUA 1GJXA 4ZOHC 1E2WA 1S5DD 2MJEA 2VUMB 3QB3A 4QIWB 1NVID 3FAHA 1ZUD2 3QG1A 3FILA 1YN3A 3KUPA 1Q8IA 1SYDA 1TY2A 4WFN3 3MVVA 4X3KA 3MAQA 2N88A 3NP8A 2WQYB 3KWVA 1EY7A 3V05A 1KDAA 1SJHD 3AE1B 2WINB 3PUWA 3LYYA 4JX1C 1SDFA 2LFNA 5A35A 2QILA 3HVZA 1Y69U 2ON8A 2EOTA 3P4RB 1O80A 2V3NA 3CKIB 2V4DA 1EZ6A 5M3MB 4IDIA 3TEWA 2EELA 3FMCA 2DNCA 3W1SA 4EE2A 4HMIA 5F2DA 3KLRA 2IW3A 3TSSA 5A2QL 1GXDC 4WIPA 1NR4A 5C0XI 2BA0A 5EBDA 5AUIA 5C0XG 1LV9A 3ERQA 2AWNA 1JORA 1STAA 3P42A 3AE5B 4ITKA 3W5UB 4A9AA 2R6GA 3NHHA 2LEKA 2K33A 3NE5B 2HDLA 1SMYC 1CA6A 3H91A 1ZDVA 4HSPA 2Y5CA 1SYGA 4N59A 5DM73 4ZRPA 1STGA 4K5WA 1SXTA 4DF7A 1ZOYB 2BB6A 1DONA 2PQEA 1DOYA 4EQPA 2E2DC 3TP6A 3VRBB 1WTWA 2N55A 5K5PA 3VYTA 1V1PA 2E75C 2A6ED 4NKLA 1EZ8A 4R8IA 4TQ0A 4F7XA 2JEAI 4CKCA 3VA7A 3QOJA 1ML0D 2OT2A 3FEWX 4DK0A 4EQNA 2WXPA 5C2TB 2NYZD 2M9VA 2W3SA 1HZ5A 1I50B 4J1MA 3B2GA 1EWHA 3R8BA 2F0LA 1QCBD 2E2IB 4HEA1 5T1IA 1BCPF 2M19A 2F0IA 4C3IG 2CJNA 1XYIA 3J7AF 4AYBB 4I65A 3VR5A 4C3IB 1HRJA 3OIQA 2KHSA 3GTJB 1FCLA 3H94A 3IL8A 5KNBA 5AUKA 2EPBA 2B76B 1MI2A 1JQYD 3Q8EA 2Q8RE 4KMUC 5D65A 1ENCA 1QOFA 2EY1A 4UDUC 4IUTA 2IPKD 4A6QA 1WTOA 4CBVA 2QJLA 4XDCA 1TZOA 4L23A 4C2MB 4ARCA 1B53A 3A54A 3SR6A 2B2UC 3LXFA 4BBSB 4CKBA 1P7EA 2G1EA 3U9SA 5IT9L 1VZ8A 3WOFA 4IFDJ 2RDGA 1W6KA 2SDFA 1JQ4A 2DYOA 1I4PA 1HA5A 2KWDA 2HDMA 1EOTA 2EY5A 3K5NA 4EQOA 4J3OD 2J53A 1D5ZC 2WXOA 3A55A 1A70A 3PMFA 1MSHA 4RH6A 3MFYA 1OQRA 1FEHA 1K51A 5D7GA 4IUNA 2OEDA 4O42A 1JB3A 1SYCA 3E5SA 2BS3B 4H2AA 1VJKA 1PGXA 3TZUA 2B8GA 1J7AA 3EVQA 3I57A 1VMPA 1SYBA 2DN8A 3D6WA 1HTPA 3DWAA 4N6EB 1TYGB 3O13A 2F0QA 2N9KA 2TSSA 4HROA 2BA1A 2R3ZA 3M4YA 4E6IA 3HEJA 2M00A 1KDCA 1HA6A 3TP8A 2JXTA 2L4NA 4TSSA 1KLUD 4YWGG 1Q1EA 4F87A 4RGOS 4PV1C 2LJIA 1TWGB 1ILPA 1LTRD 2JYTA 1TVXA 4PMCA 1FRDA 3WOEA 4CKEA 1UEAB 2Z4HA 2BE5D 4IZ8A 3OMGA 2WV6D 1F9SA 3RFZB 4OHJA 3IT6B 1RDPD 1DOIA 1PRTB 3IFDA 4H0LC 4KY7A 1DCZA 1JE4A 2I38A 2EY6A 1D1IA 5IGDA 2NZ1D 2QKIC 1RM6C 2E76C 3AMUA 4ZAIA 1GB1A 2BDOA 2R61A 2KACA 4ZQ3A 1FD6A 2PPBC 3V3XA 1YNNC 3B2FA 1UWMA 4BA1I 4LMQD 3Q8AA 3GP7A 5IGEA 1I4QA 5JVG3 3EFXD 1Y56A 1I4XA 4BBRB 4K2KA 1GOZA 3DXJC 2Z8LA 4C56C 4A3KB 1SIJA 1RJTA 2PVGC 3B9JA 2AX5A 2KCCA 1K8OA 3R2IA 1TJEA 3FDTA 1WVLA 2F0GA 2HTME 1L0YB 1ZPSA 5IOCA 4KK7A 1AN8A 1SE2A 1QE6A 2X38A 5CV4A 5NUCA 2Z1CA 1CI3M 3E56A 2L9HA 3AEAB 3G7LA 4IQZA 1PZJD 3I70A 2W54A 5J39A 2F0KA 5C0XJ 1DGJA 5KEEA 3I4LA 1IUEA 2YEPF 2NUCA 4A3GB 4PMWA 2W82A 1PTOB 2MJDA 4B08A 3NUHB 1EY9A 3D8GA 1RCVD 4P6VF 1YJIA 1EQVA 3U52E 2D5GA 1XXGA 3Q6SA 3OMCA 3K58A 3S1MB 2WXIA 3AV8A 5EBCA 1E7PB 2MJ3A 3OOCA 4DXGA 2IGDA 1PGAA 4NAWB 5EPKA 2KEDA 3FVQA 2BCOA 2RBMA 1D2BA 1HZ6A 3RZOB 5M5YB 3EQLC 5LNK1 3VQIA 4L2YA 2N9LA 5I2YA 2WXRA 2WXNA 1S5FD 1U4LA 4B9WA 3FRPB 2B2VC 1MD2D 3BDCA 5EE3A 1V8CA 4NW2A 2F0WA 4HKQA 1EEFD 5EGTA 1Y8OB 4AS1A 2IX0A 4CGYB 2KDMA 1NI3A 4ZKCB 5D3IB 3TDQA 1Q12A 1SFOB 1OXVA 3KLSX 3ZJTA 3DUZA 4KHVA 2L1BA 3RZDB 2WU5B 5H8YE 1B4OA 1TS2A 1EY8A 1L0VB 3ZJUA 2CW0C 3S2DB 1V8QA 3KQ4A 1VDZA 4JE3B 1IGDA 1S4ZA 2IX1A 1HCZA 3D4WA 4OIKA 2NTSA 1EL0A 1BXTA 2F0UA 1F2RI 1SNPA 1WCMB 4G7OC 1XF5L 3AM9A 4YTPB 2WB1B 5IGFA 4FXKC 3U2SC 3NPPA 1WTPA 1WTVA 3CRLC 3K6OA 3GS2A 1VZ6A 1LABA 4XXEA 1UUPA 5DM63 1C4PA 1G6ZA 5I9OA 3DHQA 1K8MA 2BB5A 3LB8C 2NB0A 4V0BA 3VR4A 3DMUA 4KN4C 3C2PA 3TEZA 1SSOA 1WD0A 2BTEA 4IFDI 1T3QA 2O5IC 4IFDG 4NP5A 1ENAA 1AZQA 4TMAB 3VRAB 4KI0A 4HJGE 2LMCB 1TWFB 4FF4A 1LTTD 4RKBA 5C3WA 2IX3A 4FYDA 1D6EC 1ET9A 4IURA 4LJZC 2PW7A 3KWLA 1VDVA 1LT4D 3BK2A 2KQ3A 1C77A 2J52A 3MHZA 3HP3A 4WJWA 3PV0A 4B0EA 3BDLA 1TWHB 2Y5PA 1XLQA 3Q69A 2L0CA 3I72A 2MPMA 1EY4A 1PFNA 1D1KA 3HOYB 2FE8A 2K7VA 1JC7A 4ARIA 4DAPA 4RGMA 4FF1A 2IGHA 2BE5C 2KVMA 2EYFA 1OO9B 3MHBA 2B2YC 3AEFB 1E0ZA 3MFGA 5HFYA 5CMDA 2JA7B 4A3MB 1EFID 1WTQA 4ZRQA 3ETRA 1H9KA 2EYJA 2ZXPA 3D3RA 2BS2B 2VZKD 1MVKA 1QLBB 1B1ZA 3BS1A 1S5BD 1N62A 4P16A 1Y8NB 2D2CC 2K1BA 3URYA 2KEEA 1FFVA 5FO9B 1NAPA 2K5QA 1HEZE 2XNAC 2SNMA 3TEXA 1QNKA 1XCQL 3P4SB 5M5WB 1I4HA 5M5XB 4KD3A 1SNCA 1R4QB 3RUZA 5JJZA 1IYVA 2ICEC 1B3AA 3A7AB 2TMPA 1X3PA 2O5JC 1WYGA 5ELDA 1KNAA 1ZYRC 3GTLB 2K04A 1YN4A 1C4AA 2JP1A 2KQ4X 1I4GA 3QJYA 2WXKA 1PLFA 1G291 3K0YA 4C3JG 1HXYD 2PKOA 1K53A 4OW0A 3I4NB 2LKVA 1FGBD 4A3JB 3I9V1 2A74C 1QB5D 2OEOA 5ELBA 1C48A 3LX0A 2E3TA 3CRKC 4QMGA 3PO3B 5EPLA 3RMHA 4FP5D 4KJOA 3GV3A 4OO1H 3TUOA 1RF2D 3DM1A 3PUYA 2D62A 2CHBD 2LUMA 1JWSD 1STHA 3P1HA 1NCVA 1F2MA 2KN4A 3SK6A 1C78A 4ILWA 1NYRA 3C8YA 2PNRC 4WQMA 3LWEA 2D9UA 5H92C 5LHY1 3BG3A 2PVOD 4XT1B 3VYSA 3T4AC 1PZID 1B50A 4G4KA 2JWUA 1BR9A 4RGTA 4YXDB 4K2LA 1ZXIA 1PXUA 1O7YA 2JSVX 2JQRB 2A69D 2XRSD 1IW7C 3KLSA 1P7FA 4J6HA 1E2ZA 4R8NA 1V1OA 4RF0A 1LTGD 5C5MA 1FRRA 2PMZB 1IBXA 2A68D 2ICIA 3IAM1 3M3YB 3IT4B 3ITPA 3NWTA 2JYEA 1B2TA 2F0SA 1D4BA 4JK1C 3P7JA 5CBEE 1SNDA 2JA8B 1MPEA 3IXSA 2INPE 4RFBA 1MI0A 4RHRA 1D5XC 3NTIA 3BIID 2CQAA 1L4DB 2ZW0A 2O2LD 3BDOA 1H9MA 4USAA 3GQBA 2K5PA 4MN3A 2AWOA 2K9XA 1QT9A 5KNCA 4IOIE 4IKGA 1AYFA 2Q8IB 2AUJD 2EDGA 4RAUC 1HQRD 2K5DA 3T53B 2NVYB 1BCPB 1LTID 1RWSA 3SEBA 3OWEB 1JROA 1VRAB 3SFDB 1XX8A 5HGTA 1XLNA 4CJ0B 4QUFA 2VNUD 1H9JA 1WD1A 3S14B 4A93B 2C5CA 5AFWA 1BOSA 2VXWA 3G6JB 3J7AV 2WDVB 4OGQC 3DWGC 4ZUIA 4H44C 2CU3A 3LNNA 2PMVA 3H09A 2NN6I 2HUGA 3GD7A 1PZKD 3BYTB 4G7HC 3Q24A 2QDBA 1U4PA 4DNTB 1PGBA 3TMEA 2L52A 1FM0D 4YSXB 3VYUA 1F2RC 4Q2JA 5HG2A 4TKOB 5K36G 4CJ1B 2DLBA 2WKDA 3SXHA 1S5ED 4NJCA 2V3PA 1O78A 3BVGA 1NENB 1QOGA 4FVMA 5HI1A 2V0GA 3PO0A 3W9CB 3OIPA 1SSNA 2EYLA 2I46A 5EJWA 2H89B 1J9OA 2F0TA 1SYFA 1L6VA 1N5XA 1A2UA 5IT9E 3J9CA 4LK0M 3J81E 1PYWD 2EYMA 4MACA 1STNA 4KHZA 2G9HD 1MHXA 4V190 2KUMA 2DY8A 3JAME 1TR5A 4EGVA 1D5MC 1FNUA 2LY7A 1XWEA 3S9WA 3K5OA 2PZUA 3J81L 3NVYA 2I07B 4KKUA 3ZQ4A 1DXMA 3MC0B 4MIUA 3M7GA 2R7ZB 4A90A 2FBWB 1EY5A 5C5LA 5IGBA 4C80A 1UAPA 2JEBI 1QOBA 4N9TA 1W6JA 3Q0AA 4PQXA 5ELCA 2GB1A 2K05A 4GZYC 1CZPA 1GUSA 4BA2I 3Q23A 4HCEA 4DA2A 2K28A 1STEA 2OHFA 3QOLA 3DEPA 5C3EB 4XWTA 3VR8B 1B9NA 5COYA 5FLXE 5DEHA 1PRTF 4CJ2C 4R9WA 4XDXA 2QMTA 5CV9A 2AQ1B 1HFNA 5G5GA 3MXNA 1KF6B 2KJXA 3MXUA 4G7ZC 3H6MA 1I4RA 1G8ZD 3C46A 1STYA 1EYDA 2F0HA 2EYPA 1LTAD 1RFKA 4J8QA 3NTHA 3X3NA 4TQ1A 2BYTA 2LMCA 1FD7D 3OSOA 1KLGD 5BMHA 4PT5A 3FC4A 5FO8B 4IUQA 5CBAE 1VF5C 1PMRA 1KH0A 3KF8A 2LS01 2K22A 3U9OA 4RCNA 1WGKA 1A3TA 5CV6A 1BBXC 4LTUA 3CWIA 3NWSA 1QWYA 2FMCA 2X69A 4YTMB 4MT5A 2XN9C 2NN6H 1QOHA 3ZJVA 3QWNA 4C1NK 1SE4A 1DM0B 3HUIA 5GXGB 1QOAA 3AE4B 5BYQA 1UNSA 4KV6A 3L4PA 1CJEA 1U9RA 5I6WA 1FXIA 2KAJA 2Y3AA 5BYSA 2PCFB 5JOBA 1HQMC 2J0TD 2Q5WD 1EIGA 2DBYA 2AQ3B 2CVRA 2MGSA 4HRSA 4KKTA 1GHKA 4K14A 4FXDA 3P4QB 5CV8A 4DK1A 1GB4A 1OXXK 1STBA 1BQQT 4KKIA 3HOXB 1CZWA 1F2LA 3ZGZA 2KMMA 4OZAA 3SK8A 1F9PA 5JPNC 1AZPA 5E6JA 3OHXC 1F9RA 1LT5D 3VR3A 3L7ZC 2NBFA 1EIHA 3PIP3 1RTOA 3FILB 2YYZA 3R2TA 1M8AA 4HTHA 1V1PB 1VR9A 2WAQB 2JXMB 5J22A 5CYUA 2C9OA 5JEAJ 4HR7B 1XLOA 3MJ5A 1TWCB 2IWHA 4BWGB 2FFKB 1K83B 2IT1A 5JAVA 3BVZA 1KRHA 1JOOA 2ID0A 4ABNA 3K5LA 1FCCC 3S1RB 1LTSD 2BDNA 2PW9A 5I6YA 3GTPB 4A55A 1SF0A 3UI2A 1E9MA 3K5MA 3NTKA 4US8A 5M9OA 4Q5VA 1ZP0B 2IL8A 2GA4B 1L5PA 3H0GB 1U4RA 3JAML 1YNJD 5CV5A 1EYAA 1EU3A 2WXJA 2WXGA 2KECA 2HQEA 2B2UA 1TS5A 1AFPA 4HSVA 1I6VC 3AU7A 1CQVA 1L4ZB 2G9DA 4PNYA 2F1MA 3PUXA 3QO2A 4C3HG 2WNMA 4ULLA 5G3LD 2LGIA 2F03A 4MH8A 1TIID 3IAS1 1JWMD 4FXCA 1AEXA 1T5XD 3I4MB 4DGZA 4EVOA 3S2HB 1KABA 1PTOH 3PUZA 3AN1A 1KNEA 1F9QA 1YN5A 3AE7B 3V96A 3NUCA 1J7BA 3Q8FA 2O4XA 2XWJB 1N60A 4YSZB 2K0PA 4YSYB 3S1QB 5E3FA 1Y8PB 1SNMA 4Q0FA 1C79A 2MEKA 3W5VB 2OF1A 3V2TA 1QF6A 1II3A 1T5EA 2BOSA 2HCIA 2EY2A 2VB3X 2FUG1 1IBXB 3E6ZX 4Z9CB 3HOUB 1G2SA 4HN7A 4DNRB 4RNAA 2K32A 2JU6X 4ID6A 4XWWA 4MHEA 1XTCD 4OL7A 3NBHA 5ELEA 2FHTA 1IGCA 1A2TA 5C0XH 3ONAB 1HPCA 1MSGA 1PDQA 1WTRA 4FO2A 3PZ8A 5E4WC 4DXFA 2HDEA 1O7ZA 3AEBB 1G91A 5IODA 4ZHOA 2HCCA 3HOWB 1EWYC 5EKKA 2NMQA 4N58A 1FYCA 3MEHA 3AECB 2A6HD 2YU9B 1BUIC 3AE6B 1ILQA 2BS4B 4XE0A 1S5CD 2WIIB 4DAVA 1LT6D 1IL8A 4H13C 2F0NA 3P4PB 4KJNA 2MUYA 1FR3A 2J42A 2N7JA 4YTNB 1L6UA 2QF7A 5HURA 2Q8TA 1X3QA 3P63A 4L63B 1TS4A 3NQTA 2JSOA 3GTGB 3DWPA 1V97A 5LL6S 3E0JA 3WDNA 2RSNA