2FCQA

X-ray crystal structure of a chemically synthesized ubiquitin with a cubic space group
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
73
Chain Sequence
LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ubiquitin
publication title Dissecting the energetics of protein alpha-helix C-cap termination through chemical protein synthesis.
pubmed doi rcsb
total genus 22
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2fcqA00
2N1WA 2G4DB 4HPLB 3NHEB 3L54A 1GNUA 3PZDA 4GB9A 2M17A 1V5OA 2ZPYA 3DOWA 3ZDMC 2UYZB 4W9GA 1FXTB 4FBJB 2DX5B 2DYMA 4MGKE 3UIOB 3ZNHB 4KSKC 5D7GA 2KLCA 2HTHA 4II2B 2AL3A 5KHOA 3CSTA 3MTNB 4ZRJA 5D6JB 4EZKA 3M95A 3RZWC 3A4RA 4ANXA 2L05A 2L0FA 1XT9B 1WM2A 4HDOA 4JGHB 4CYEA 2IBIB 2G4SA 3PVLA 4PS8A 2DZMA 5TR5A 1KLVA 2K8CA 4GDKB 3L13A 1NI2A 1V80A 3TJPA 2MP2B 2QHOA 4MSQB 2C7NB 4B6WA 1VCBA 3ZTCA 4WQOB 4G0NB 3NY5A 1SE9A 4ICVA 2KJ6A 4WWOA 4MELA 2L00B 3M62B 2L76A 1M94A 2MA9B 2WX1A 3KYDD 1OTRB 2RGFA 4G50A 4DDID 3EC8A 3PLVA 3KYCD 3U8ZA 1OGWA 2LVOA 1UELA 1E7UA 1Q0WB 3ML8A 1S1QB 1WY8A 3CSFA 3QIJA 3WALA 2KTRA 4EZLA 2GOWA 2BYEA 3H9DA 1R4MI 3OJ4B 2G45B 4GIVA 2CKHB 2ZNVC 3CF6E 3DBLI 4W9LA 4F7ZA 1I35A 2KFKA 3RULA 1WJUA 1Z5SB 3N3KB 3SHQA 4GDLA 5L95C 2IZVB 4MEMA 3TCAA 1K8RB 2CHXA 3AULA 4HDQA 1J0GA 3UINB 1KJTA 2DENB 2KTFA 4WWPA 1WJ6A 2IO2B 3QCAA 4IWPA 4NNJB 5GMVA 3UIPB 3W1SC 4DK5A 2R2QA 2DZIA 2M0XA 4KZ0A 3SU8X 3JYUA 1P0RA 2C5LC 3CMMB 5EDSA 1WR1A 3M3JA 2GBMA 3ZLZA 1V5TA 1UD7A 1T0YA 3VDZA 3VTVA 3N30A 1P1AA 4AJWA 3PS6A 2KWCA 3A9JA 4WJOA 2O6VD 3PRMB 2PE9A 3APDA 3U30A 2KANA 2JZ3B 3R3MA 2REXA 4PS3A 3RD2A 4EUTA 4PS7A 3PSEB 5IA7A 2KDEB 2C60A 3O65B 2M8SA 2BWFA 3PT2B 5AZFA 3ZRCA 3EFUA 3RT3B 2A4ZA 4TQ1A 2I1JA 2J0JA 4K7WA 3V6EB 1WFYA 2B3AA 3UGBB 1GG3A 3PTFC 4IM2A 3T9LA 2VRRB 4EKUA 3H6NA 3PLUA 1WX8A 2KD0A 2HE7A 5DPTA 2KJHB 2MX2A 2ZZPB 2MP2A 2KX0A 1U4AA 3QX1A 3NS8A 4JLCA 1V2YA 4M8MA 2GBKA 2IO3B 3T8MA 3X0WA 1WF9A 3A33B 2KTRB 4GGQA 2NVUI 3WANA 3IHPC 2EMTA 2LGDA 1IYFA 2KQ7A 2FNJB 2CR5A 2NPTA 4FA6A 1WJ4A 3VVWB 3WAOA 4BBNC 4IM3A 1L7YA 2KFKB 4OVVA 3TMPB 3HM3A 2BKRB 5CHFA 4K7UA 2D11A 3B08A 4JL9A 2KO3A 3PV1A 4FULA 1TZ1A 3DPDA 3HK0A 4GU2A 4M8NA 4W9EA 5AZGA 5LXIB 2HD5B 3QA8A 3ZRFA 4AP4C 3LJ3A 3PRZA 4XX5A 4MH0E 3ZNZB 4TV3A 1KOTA 3V6CB 2N7DA 1SIFA 1NBFC 2ZVNA 4WJQA 3ALBA 1E90A 1V9JA 3H7SA 2DYOA 1YIWA 1Q5WB 2KJRA 3GZNI 3VQIA 2AWTA 3UQAA 2PJHA 3A9JB 1WZ0A 2A5UA 5J2RA 1V49A 4EEWA 2KMAA 4J6IA 2LD9A 5AZHA 2I1KA 3WA0A 2RR9A 2WX0A 2LXCA 2FCMA 2N9PC 1D3ZA 1L2NA 4KIKA 3L17A 4LCDE 4N9F4 3N32A 3ZW3A 2O6VB 2J0MA 3PREA 4BKSD 3OAWA 1WJNA 1WXSA 3KUCB 3S2AA 1E8YA 3UF8A 1NDDA 2BPSA 5DPRA 3ZNGC 1H8CA 4HCPB 4RM8A 2JT4B 4BKSA 2NCNA 3Q3FA 2KC2A 5JHAA 2FAZA 2N1VA 4GOCA 2JY6A 4JQWC 4DHZE 3VTUA 1WGYA 2D3GA 4NPNA 1WGHA 4WAAA 4FHKA 2ZVOA 2NPTB 2BYVE 2V4LA 4A20A 2RPQA 2KC1A 3HHMA 3ZTDA 4G3XB 3KH0A 1HE8A 4KDLB 4P7IA 1EF5A 1YQBA 1S3SG 2D10A 3DBHI 1P3QU 2DZKA 3PRPB 4LJOB 5IAAC 3ONSA 3DCGA 3L08A 3VUWA 4BOZB 4FJVB 4TQ0A 4ZDVA 4OVUA 1G6JA 2PPHA 3L10B 2K25A 5DCNA 4BKTA 2KWUB 1WYWB 2GMIC 2DZJA 3V61A 4W9HA 2JVCA 5LLIA 1BT0A 3Q3JA 3VUYA 3ZDTA 2NR2A 1ZKHA 3VHTC 1C3TA 2CHZA 4II3B 2L0TA 3EHVA 1UGMA 4WJNA 5HKHA 2C7MB 3ZKJC 4B95A 2LRWA 3ENEA 4NY0A 2IYDB 3QC8B 3VTWA 4XC2A 2DAFA 3DVNV 4FJZA 2JF5A 4GSWA 3TIXA 5CHVC 1WRDB 4KIKB 4ASWC 5L83A 3QARA 4BFRA 2EKEC 2MBOA 1EO6A 1CMXB 1GC6A 4MSMB 1E8ZA 5E6NA 2LWPA 2UWQA 1E5WA 2C9WB 5JH5C 3AI5A 3ECIA 1KM7A 4NQLB 4MGYE 3W1YA 2LUEA 2MBQA 4PYUA 5D94A 1WH3A 4K81A 2OOBB 4KV2A 4W9KA 1P9DU 1JRUA 5CTRC 2O6VA 3RUIB 3LDZE 2WDTB 2ZJDA 5G2NA 4DDGD 3NOBA 2XBBC 3VFKA 1E8WA 2RD0A 4IW0A 1RLFA 2EMSA 2ASQA 5CHWA 1V81A 4BOSC 4HLEA 1AARA 4DHJD 2KZRA 4K1RB 3UQBA 3R7QA 4IWQA 3DVGY 4TKNA 2K1FA 3V62A 1WMHB 3PGEA 4NJ7A 4A3PA 4FJYA 3P2BA 1TTNA 2LZ6A 2HJ8A 4HK2A 2CHWA 5DPWA 1ZGUB 3APFA 2GBNA 2KN5A 3QHTA 3W1SA 4HCNB 2WWZA 2MBBB 1GJZA 1OEYJ 3RYTA 2BKFA 3IG3A 3AXCA 2BWES 1I42A 1WE6A 3DDCB 3PPAA 3D32A 2AEHA 1GUAB 3MJWA 2N4FA 4W9JA 1WGGA 3NZUA 4BVUC 2KFJA 3ZO5B 3EECA 1WM3A 3BINA 2C7HA 2AL6A 2LGYA 2PEAA 5E6PA 1IP9A 4DWFA 2JRHA 2BGFA 5CX3A 4MGZE 3K9OB 3R66C 2KDIA 2D2QA 3QWZB 4TUUA 2AYOB 4FN2A 1TGZB 2V1YA 4BKGA 3AU5A 3R7RA 2W9NA 3MHSD 1WE7A 3BY4B 2LVQA 3DBSA 3WIMA 2KKCA 1P98A 2K6QA 2N9XA 2MQJA 2MWSB 3DVNU 3H7PB 1WXAA 3PHWB 4NQKE 4W9FA 2LI5A 3VXWA 4AJYB 1Q1OA 2J0KA 4I6LB 2MRPA 2MBEA 4EOYA 4ZYNA 3VAWA 2L8JA 3V60A 3IBEA 2JZZA 1R4NI 3M63B 2M1MA 4A3OA 5AEKB 1YX5B 2KVRA 2KLGA 4E71A 1RFAA 4MM3A 4ANVA 2FIDA 4AUQC 3VH3B 2IO0B 2FCSA 2LASA 2KDFB 2ZNVB 1J19A 5LXHA 1WX9A 4GMVA 2KK8A 2K8BA 2MBHA 4MDKE 1LFDA 4RMAA 1E8XA 1WGDA 1F9JA 3QK0A 4GXBA 4DHJB 3APCA 1WXVA 5C1ZA 4HWIB 3HM6X 2V3SA 1UBQA 2D07B 3VH4B 2FCQA 4WWNA 4FLHA 4JIOU 4CHKA 2CS4A 3K9PB 4FHJA 1WMHA 3QQ8B 3OLMD 4MGIE 2JUOA 3L16A 1MG8A 2KQSA 2J7QB 3QJZA 2N7EA 4IM0A 1V6EA 5C23A 3B1LX 2KDBA 2KWVB 2ZEQA 3OJ3A 4M0WB 2DHZA 1PQSA 1LQBA 2MSED 2O2VB 2PE6B 1WR6E 2LGXA 4IC7B 1YD8U 3KW5B 3RCZA 1SGHA 3ZNID 4WJPA 1ISNA 4LDTD 1WI0A 4MJSA 5G55A 5DPSA 1ZW7A 2KOXA 4X57B 4I6PA 4NJ6A 2IO1B 4B9KA 3JSVA 2NBVB 2BF8B 2L7RA 2XK5A 3ML9A 4W9DA 2Z59B 3A9KA 1OEYA 4E3CA 4HPMB 4AWJA 1LM8B 1LXDA 4K7SA 2IY1B 1WIAA 2KX3A 2R2OA 4DBGA 2BYFA 3JVZX 3SDLC 2MCNB 4NAWB 2FIFA 1RRBA 2OJRA 2MW5A 3DQVA 4HJKA 2M4NA 4CO7A 3H7PA 1Z2MA 1EUVB 4LJPB 2ZCBA 3IFWB 5JZEB 2KMCA 2NBWB 5JHBA 1X1MA 2KXJA 3AU4A 2YVCA 4ICUA 2JWZA 3PHXB 3A1QA 3DBRI 4G11A 1GC7A 3ZUNA 4IUMB 3U7DA 2GBRA 2K39A 4W9CA 4KSLC 2RSUA 5D2MB 1IPGA 4EZJA 3WAPA 2LVPA 4ANWA 3C0RB 3GOEA 1WX7A 2JXXA 2Z0DB 4PYZA 2YLMA 2K8HA 3I3TB 4DHZB 2CU1A 4BBNF 3WAMA 4ANUA 1UBIA 1YX6B 4FADA 2FCNA 2ZCCA 3SD5A 5BO4B 3QAQA 4KZCA 3KVFB 4EFOA 2Y5BB 1YJ1A 3X23A 2LXAA 2WYQA 4W9IA 2LRUA 3H1UA 3TBLD 1XQQA 2K6DB 1WXMA 1E7VA 4MJSB 4DXAB 1A5RA 3NZSA 2KHWB 2GBJA 2Z0EB 3ZVVA 2NBUA 4KDIC 4KVGB 1QZEA 2XEWA 3JSVB 1XD3B 2LJ5A 1EF1A 1TBEA 2XK5B 2KNBA 2ZPNA 4HVBA 4LDTB 4ZRKA 4HXDA 4YL8A 4GDKA 3A9KB 1C1YB 2O2VA 4RM9A 4XZ4A 5KHQA 4F8CB 4E74A 4IWOA 1WZ3A 2JPHA 4I6NB 3VUXA 3ZIMA 2FUHB 5E6OA 4F1SA 2G3QB 1H4RA 1UZXB 1WGRA 3KUDB 2IY0B 4GDLB 4AOFA 2NS5A 2MLBA 1V86A 2DYBA 2N9EB 3DVGX 3B0AA 4GN1A 1RAXA 1UH6A 3JW0X 3RZFA 1VD2A 4URKA 4NAWA 1Y8RC 1OQYA 3A1QB 4IG7B 5FR6A 3L0WB 2DAJA 3HIZA 1J8CA 2JRIB 3A4SC 3TL5A 2L3ZA 3IVFA 5J18A 4ZRIA 5J17A 3KUZA
chains in the Genus database with same CATH superfamily
2G4DB 4HPLB 1LGRA 2MJ3A 3PZDA 4OHJA 1L0YB 2UYZB 4W9GA 1FXTB 3CIRB 1VDVA 2DYMA 3AEFB 5D7GA 4YSZB 3MTNB 5D3IB 1YQ4B 1ZP0B 3RZWC 2IGHA 3A4RA 2Y5PA 1WM2A 4HDOA 2IBIB 2G4SA 3PVLA 4AS1A 4PS8A 1KLVA 1TY2A 4K3BA 4CQNA 3CWIA 4G0NB 4C4VA 3B9JA 1C79A 2MA9B 2WX1A 3KYDD 2Y5CA 4DDID 3FILA 1JWUD 3U8ZA 1OGWA 3ML8A 1E0ZA 5BMIA 3QIJA 1ZOYB 2GOWA 1R4MI 2CKHB 3CF6E 4N59A 4W9LA 4F7ZA 1I35A 2KFKA 2Y3AA 1EU3A 1K8RB 1J0GA 1N62A 1V1PA 2IO2B 3UIPB 4EE2A 4KZ0A 1ZE3D 3M3JA 2KWDA 4HRSA 3N30A 2KWCA 3A9JA 3KWVA 5IOIA 3DHHC 3BVMA 3MHZA 1QF6A 2C60A 3O65B 2M8SA 4LNIA 5AZFA 1FEHA 2J0JA 3EFCA 4K7WA 3UGBB 2B3AA 3RNBC 3HVDA 1ET9A 1F2RC 2HE7A 5DPTA 2KJHB 2K22A 2MP2A 1TS3A 1U4AA 1V2YA 2IO3B 1WF9A 4GGQA 2KTRB 1NEKB 3WANA 2EMTA 4L1BA 2FNJB 2CR5A 2NPTA 2PLPA 5IKCM 1STEA 3ZYYX 5CHFA 3PV1A 4FULA 4M8NA 4W9EA 3C8YA 1T0SC 1SEBD 3GP7A 3LJ3A 1E7PB 1K50A 2NTSA 1SIFA 4WJQA 2VZKD 2N9KA 1SIJA 1TS4A 2QMTA 1V49A 1VR9A 2H88B 2KMAA 3AE3B 4EEWA 4J6IA 4ARCA 2LD9A 5AZHA 2GLSA 2O6VB 3Q8FA 1WXSA 4DXGA 2ON8A 1E8YA 5DPRA 4YTMB 4WIPA 4QAYA 4RM8A 2JT4B 4WURA 2KC2A 2FAZA 2N1VA 1WGYA 2JSVX 4NPNA 3O13A 4FHKA 4A20A 1QILA 1WYGA 2KDMA 4WAFA 1S3SG 2D10A 3DBHI 5BMGA 3DCGA 2RMMA 4XWTA 1C4AA 2GMIC 1SE2A 3U2SC 3Q3JA 2NR2A 4YSXB 1C3TA 3GE8C 2L0TA 1T3QA 2C7MB 4NY0A 1C4CA 1QOGA 2WQYB 2IPKD 4ZOHC 4GSWA 1JCKB 2XN9C 3QARA 1FRRA 2EKEC 5AUIA 5E6NA 1E8ZA 4ZHPA 2C9WB 3AI5A 2WP9B 2KYWA 2LUEA 2MBQA 5D94A 4K81A 2OOBB 4KV2A 4ACFA 3LDZE 3ETRA 3Q69A 4DDGD 1E8WA 1GPXA 5EE0A 2EMSA 4ZRQA 1ZXHA 4DHJD 3UQBA 1GB4A 2K1FA 1FM0D 3PGEA 3V62A 4A3PA 4FJYA 2M0AA 2LZ6A 3APFA 1VLBA 2KAJA 2WWZA 5BYSA 2MBBB 1OEYJ 2BKFA 3IG3A 1WE6A 3DDCB 2Z8LA 4LNOA 2N4FA 4W9JA 4BVUC 3ZO5B 3EECA 2WXPA 2PEAA 2FBWB 5E6PA 2BGFA 2TSSA 2MJEA 2LMCA 2KDIA 2D2QA 1YOVB 2AYOB 4FN2A 1LO5D 3R7RA 1V1OA 3ZXRA 3DBSA 1P98A 1IBXB 3PHWB 3H7PB 1Q1OA 2WXGA 1I4RA 2MJDA 2IGGA 2MBEA 2FE8A 4ZYNA 2EKIA 4A8XC 2RDBC 2L8JA 3V60A 1R4NI 2KVRA 2PIAA 3VR9B 2LJIA 4AUQC 1J19A 1FRDA 4ZYSA 1E8XA 2K0PA 3APCA 3HM6X 1UBQA 2QILA 1FD6A 2BS2B 3QQ8B 4MGIE 2JUOA 3B1LX 2KWVB 1EWYC 4M0WB 3KW5B 1ISNA 2E3TA 3E9SA 4MJSA 1MFWA 2PTLA 4I6PA 3JSVA 3U7ZA 2I2YA 4A6QA 4W9DA 1RFKA 3FC4A 4E3CA 2D3AA 1NVID 1I4HA 2BYFA 2MCNB 4NAWB 2QJLA 2VH1A 3PO0A 3IAM1 1PYWD 4LJPB 2ZCBA 2V3NA 2KXJA 2YVCA 2JWZA 1GC7A 4GLSC 3Q8EA 2BW2A 2RSUA 5D2MB 4EZJA 3WAPA 2LVPA 4ANWA 4C56C 1SE4A 3GOEA 3BWUD 4JPSA 4ANUA 3WAMA 1UBIA 4AQ7A 4FADA 3LYYA 3SD5A 2G9HD 1SE3A 3X23A 4W9IA 2LRUA 4R3DA 3NZSA 4KDIC 2XEWA 1CQVA 3HUIA 1TBEA 2XK5B 4M02A 2ZPNA 3FILB 4ZRKA 4YL8A 4GDKA 2AQ3B 1IGDA 1A70A 1XCQL 1HTOA 3MJ5A 3VUXA 1DYQA 1FFUA 2WDVB 2FUHB 5E6OA 1H4RA 1AWDA 1UZXB 3URYA 2RDHA 1WGKA 2N9EB 2IJ0A 4GN1A 3P63A 1NI3A 3A1QB 1VZ6A 1C77A 2JRIB 1PGXA 3TCAA 2YEPF 1GNUA 1FCCC 2L52A 4ARIA 2HJ1A 3DOWA 2QDFA 4K3CA 4FBJB 5HFYA 2K3UA 4DXFA 2KLCA 2AL3A 1JMLA 4M01A 3M95A 4CYEA 3AN1A 4RF0A 3L13A 1V80A 2MP2B 2QHOA 2C7NB 3PZ8A 1NYQA 3NY5A 1SE9A 4ICVA 4LTUA 4WQMA 4WWOA 2L00B 3M62B 1OTRB 1KRHA 1UELA 4ITKA 2J52A 1D5ZC 1FMAD 3WALA 3AB5A 2QCZA 4EZLA 2G45B 4GIVA 3Q3MC 3NZ3A 3SHQA 4GDLA 2CHXA 3AULA 2W3RA 1KJTA 2DENB 3I63C 5I4DA 2WXFA 2DZIA 3JYUA 2C5LC 3CMMB 3MP9A 1PDXA 4OW0A 2R61A 4TMAB 2O6VD 1F52A 3AEGB 3R3MA 2REXA 3RD2A 2WXQA 4PS7A 3BYTB 4S17A 1F0ZA 2BWFA 1YQ3B 2I1JA 2SEBD 1ENFA 4UDUC 4EKUA 3PLUA 1BUIC 2INDC 5BYQA 2ZZPB 3X0WA 2INNE 4JLCA 3P4RB 3T8MA 2GBKA 1D6EC 1TKEA 1N5WA 2NVUI 1XLPA 2LGDA 3TMPB 1L7YA 2BKRB 1B9RA 4K7UA 2KO3A 1TZ1A 3DPDA 5AZGA 1FFVA 3V05A 3AEEB 1QKZA 3V6CB 2JWUA 1E90A 4RH6A 3H7SA 1N6ZA 1F77A 4REZA 2QIEB 3VQIA 1HA5A 5FKAC 2PJHA 2I1KA 3WA0A 5HG2A 1DOXA 1L0VB 2RR9A 2LXCA 2FCMA 1MHXA 1L6VA 3ZW3A 4N9F4 3PREA 3OAWA 2KVZA 1NDDA 1SXTA 4C00A 5MPOA 4D2KA 4N6EB 2JY6A 2H89B 1I4GA 3AE6B 2RPQA 3HHMA 3ZTDA 3BVGA 1HE8A 1YN5A 4KDLB 4P7IA 1EF5A 1YQBA 1P3QU 2DZKA 4LJOB 1E10A 1Q10A 4ZDVA 4OVUA 1G6JA 3L10B 5DCNA 1ESFA 3PZ7A 1PGBA 1YNTE 3BK1A 1DOIA 5LLIA 3VUYA 1AN8A 3ZDTA 1R7SA 3DHGC 3DWGC 3AECB 3NS1A 4WJNA 1K52A 4WH4A 4XC2A 2DAFA 2L83A 3T3NA 3TIXA 4KIKB 2KT7A 5L83A 3TEZA 2MBOA 1GC6A 4TSSA 1PFDA 4MT5A 4HJGE 4W9KA 1XXGA 3IXSA 5G2NA 3NOBA 4YTPB 2Q5WD 5LNK1 3VFKA 1VRAB 2RD0A 4HKQA 4BOSC 2ASQA 2BB6A 2HTME 4HROA 4TKNA 4NJ7A 1QLBB 4HK2A 5DPWA 1B1ZA 1ZGUB 2ONQA 2GBNA 1JRPA 3W1SA 1WRIA 3R8BA 2BWES 3PPAA 2AEHA 3Q6BA 3NZUA 1N5XA 1FXIA 3EA6A 2J42A 1IP9A 1MI0A 3QWZB 1TGZB 2V1YA 3ZXVA 2W9NA 3NRZA 3MHSD 2WNMA 1WE7A 3LXFA 3WIMA 1GOZA 2KKCA 2N9XA 3DVNU 4AJYB 3N1ZC 4EOYA 3AE9B 1TY0A 3N9YC 1Y56A 3IBEA 2JZZA 3M63B 4WWMA 2M1MA 4A3OA 1YX5B 1QOBA 2AX5A 2JXTA 5FK9C 2IO0B 2KDFB 2UU7A 1VZ7A 5LXHA 1WX9A 2K8BA 3AE5B 1LFDA 4RMAA 4KKJA 2HDEA 1F9JA 3AM9A 5IO9A 3QK0A 3VR8B 1R4MB 3VH4B 2V3SA 1NYRA 2V4IB 4FLHA 2CS4A 3K9PB 4FHJA 3ZJVA 2KQSA 2J7QB 3QJZA 2LGSA 4NAMA 1V6EA 3B2FA 2K9XA 2KDBA 4IOIE 1SBBB 1C4PA 2PE6B 1SGHA 3ZNID 4WJPA 5JXVA 2MEKA 5G55A 5DPSA 1C9FA 2X38A 3TEXA 2KOXA 3Q2AC 4NJ6A 1XLNA 2IO1B 4B9KA 3GE3C 2BF8B 3ML9A 2Z59B 3H8HA 3A9KA 1D4BA 2V3PA 1LM8B 1LXDA 4DBGA 2FIFA 4XWWA 2OJRA 4CO7A 1OQQA 1HZ5A 1CJEA 1Z2MA 1EUVB 3C19A 5JZEB 1X1MA 3AU4A 5TSSA 3RNCC 3PHXB 3DBRI 4G11A 4IUMB 3U7DA 1TYGB 2GBRA 1ZUD2 4KSLC 1NENB 3C0RB 3AEAB 2BYTA 1WX7A 1FIQA 2Z0DB 4P16A 1L6UA 2K8HA 2CU1A 1I4XA 2W3SA 2LUMA 5BO4B 1FO4A 4IDIA 4RF1A 1N63A 1YJ1A 4M00A 1F2RI 3TBLD 1XQQA 2K6DB 3Q8CA 1A5RA 4DXAB 1BMLC 2DBYA 2NMQA 2WXIA 4BAXA 4KVGB 1XD3B 1EF1A 1OQRA 1FXAA 1YJIA 2KNBA 2WXOA 3NVZA 4LDTB 1C1YB 2WHIA 5KHQA 4N58A 2B76B 4E74A 1WZ3A 3ZIMA 4F1SA 2G3QB 3KUDB 4GDLB 2MLBA 2DYBA 1RAXA 1VD2A 1JALA 4IG7B 2PVOD 3L0WB 2DAJA 3TUOA 1WSPA 3A4SC 3IVFA 1MHHE 4ZRIA 5J17A 3IT4B 2DWQA 2N1WA 5EE1A 2D3CA 2OEDA 5D3DA 3DBHB 2K5PA 2M17A 3BZDB 1V5OA 2ZPYA 2DX5B 2N9LA 2W55A 3UIOB 3ZNHB 4KSKC 2SAKA 2HTHA 4YXDB 4II2B 3CSTA 4ZRJA 2W82A 3AE2B 3OG5A 4PK1A 3OWEB 4ANXA 2L05A 1XT9B 4JGHB 2DZMA 2MH7A 1VCBA 4YTNB 3NJTA 4WQOB 2KJ6A 4MELA 2L76A 1M94A 4LK0M 3RMKC 4S0RA 2RGFA 4C80A 3AE8B 2LVOA 2D3BA 1E7UA 1Q0WB 4FXCA 3W2DA 3CSFA 2KTRA 4RFBA 3AMZA 2BYEA 3H9DA 1PGAA 5H92C 3OJ4B 3DBLI 3RULA 3I57A 1WJUA 1Z5SB 3N3KB 3BYYB 2IZVB 4MEMA 3UINB 2NTTA 1WJ6A 4IWPA 4NNJB 3Q8BA 3BVZA 1XLOA 1TT5B 1P0RA 2WDQB 3MC8A 3ZJTA 5HI1A 5AUKA 5EDSA 3RNEC 4L23A 1V5TA 3VTVA 1T0YA 3VDZA 3PS6A 2PE9A 2JZ3B 4EUTA 5IA7A 2KDEB 3ZQ4A 3GB1A 5E6JA 3PT2B 3ZRCA 3TSSA 2A4ZA 4C4VB 2E6XA 4B0MA 4IM2A 3T9LA 3H6NA 4KX6B 2L32A 2MX2A 4XGAB 3KLSX 2KX0A 3QX1A 3P4SB 3A33B 1R4NB 3IHPC 3HRDD 4FA6A 3KWLA 1D5MC 2RDGA 3VVWB 3WAOA 4OVVA 2KFKB 4ZHOA 2AQ2B 3P42A 1FPYA 4RGMA 3HK0A 4GU2A 1V1PB 5LXIB 2HD5B 3QA8A 1KFYB 4XX5A 3PRZA 4RGNA 3ZNZB 1KOTA 2N7DA 1NBFC 2DYOA 2ZW0A 5C2TB 1Q5WB 3GZNI 3NUHB 1YMHE 2AWTA 3A9JB 3UQAA 1DOYA 5J2RA 2CU3A 2N9PC 1L5PA 1L2NA 2J0MA 4BKSD 3S2AA 3UF8A 2QEJC 4HCPB 2NCNA 5JHAA 4GOCA 3VTUA 2D3GA 3EUB2 3AV8A 4WAAA 2ZVOA 2NPTB 3N1XC 5GXGB 2BBCA 3PRPB 4BOZB 4P1CC 2PPHA 2K25A 2KWUB 1CK1A 1WYWB 2WXLA 2DZJA 4YT0B 3V61A 4W9HA 2JVCA 1BT0A 2BQQA 1ZKHA 1SB3C 4B95A 3QC8B 4RNAA 3VTWA 2EELA 4FJZA 3Q14C 5CHVC 1WRDB 1GB1A 3U52E 4BFRA 3AEDB 1CMXB 2LWPA 2RPVA 2V9HA 1KM7A 3W1YA 3FAHA 2N0SB 1P9DU 1JRUA 5CTRC 2JYTA 2WDTB 4IW0A 1RLFA 4HLEA 1BXTA 1C76A 1AARA 1HQRD 2WXMA 3N20C 1HEZE 2KN5A 3QHTA 4LNFA 1GJZA 4P1BC 3B2GA 3RYTA 4Q2JA 3SFEB 1I42A 1E6EB 1UNSA 3MJWA 2CJNA 5HHDG 1J7CA 1WGGA 1DGJA 2KFJA 1ZXIA 2JRHA 4OZAA 4MGZE 3W5UB 4TUUA 4JWUC 3UI3A 3AU5A 3MC0B 3BY4B 1MJDA 2IDYA 1J7AA 4NQKE 3VXWA 2J0KA 2LEKA 4I6LB 2KMMA 1JROA 3RPFC 1PUTA 5AEKB 1TS5A 2KLGA 4E71A 4MM3A 4ANVA 3N1YC 4OVZA 3KQ4A 2PMVA 3VH3B 3RN9C 2FCSA 2LASA 3FKYA 2J53A 1FCLA 2QC8A 1TS2A 2MBHA 1JWBD 4MDKE 2OJWA 4KKIA 4HWIB 1T5XD 4WWNA 4CHKA 1WMHA 3OLMD 3L16A 5C23A 1TZOA 1N60A 3OJ3A 3WCQA 1PQSA 1LQBA 4IC7B 1YD8U 3RCZA 4LDTD 3SR6A 1EWCA 2NBVB 1IGCA 2L7RA 2XK5A 2ACZB 1XF5L 3T3OA 4AWJA 3NVWA 2AQ1B 1TKGA 1WIAA 1KTKA 2M19A 1RRBA 2MW5A 3DQVA 4HJKA 2M4NA 3RNGC 4HEA1 3AE7B 1XCTL 2GB1A 2NBWB 4H2AA 4J3OD 1SF0A 3A1QA 1K53A 4MACA 5IP4D 2K39A 1AYFA 4W9CA 2FUG1 3AE4B 1IPGA 3I9V1 5T8IA 4PYZA 2YLMA 4DHZB 2D5GA 3I3TB 3V3XA 2ZCCA 4IKGA 1J7BA 3KVFB 3LB8C 2Y5BB 2LXAA 2WYQA 2DNFA 3RNFC 1E7VA 4MJSB 3ZVVA 1HTQA 3JSVB 2LJ5A 1VJKA 4HVBA 1E9MA 2O2VA 2JYEA 3TEWA 2JPHA 4I6NB 4MH8A 4O1NA 1WGRA 2ZW1A 3B0AA 1UH6A 2WXRA 4URKA 1TJEA 5FR6A 3HIZA 1J8CA 3TL5A 2L3ZA 1V97A 1UUPA 1ET6A 3NHEB 3L54A 4GB9A 5IN7A 3ZDMC 1SJED 4MGKE 4ZRPA 1MPEA 5KHOA 3VRBB 2GI9A 5D6JB 4EZKA 4LNKA 5G5HA 2L0FA 1JWSD 5TR5A 2K8CA 4GDKB 3W5VB 3TJPA 1NI2A 4MSQB 1YN3A 4B6WA 3ZTCA 4XE0A 3Q8AA 1SJHD 1HXYD 4NZLB 1WWTA 4G50A 4RGOS 2QSDA 3EC8A 3PLVA 3KYCD 4L2YA 1JW9D 1S1QB 1WY8A 1XEEA 1V8CA 2WDRB 1FNVA 2ZNVC 2BTEA 1KLUD 3IT6B 4HKZE 2J4XA 3SEBA 5L95C 3R2TA 4C7YA 4HDQA 2KTFA 4JWSC 1AW7A 1L4ZB 4WWPA 3QCAA 5GMVA 3W1SC 1CZPA 4DK5A 3VRAB 2R2QA 2M0XA 4NJCA 3SU8X 3AH7A 1WR1A 2PVGC 3AEBB 2GBMA 3ZLZA 2N7JA 1UD7A 1P1AA 4AJWA 1ACCA 4WJOA 1T0QC 3PRMB 2X8XX 3APDA 3U30A 2KANA 2LGIA 4PS3A 1KLGD 2JX5A 3PSEB 1ZPSA 3EFUA 3RT3B 4TQ1A 3V6EB 1WFYA 4OZCA 1GG3A 3PTFC 2VRRB 4USAA 1C78A 1WX8A 2KD0A 2M56B 1I4PA 3NS8A 3RFZB 4M8MA 3GS2A 1IYFA 3NG0A 2KQ7A 1WJ4A 4BBNC 4IM3A 1ZDVA 3HM3A 2D11A 3B08A 1KF6B 4JL9A 4KGSA 3ZRFA 4AP4C 4MH0E 4TV3A 2W54A 2ZVNA 3ALBA 1V9JA 2WXNA 2I38A 1YIWA 2KJRA 2GRIA 1WZ0A 2A5UA 5G5GA 1T0RC 2WX0A 1ROEA 1D3ZA 4KIKA 3L17A 4LCDE 3N32A 4XDDA 3E56A 1FNWA 1WJNA 3KUCB 1T6BX 4OZBA 4US8A 2BPSA 3Q3NC 1YJJA 3ZNGC 1H8CA 3J9CA 1I4QA 2LFIA 1RM6C 1OFFA 4BKSA 1P7EA 3Q3FA 4JQWC 4DHZE 1WGHA 1EU4A 2BYVE 2V4LA 2KC1A 4G3XB 3KH0A 1RYJA 1IUEA 2IGDA 5IAAC 3VUWA 3ONSA 3L08A 4JX1C 5JHBA 4FJVB 4TQ0A 1F1HA 2JU6X 1YN4A 2WXJA 3DBRB 3NVYA 4BKTA 4YWGG 1P7FA 3DWMA 3VHTC 1KH0A 2CHZA 4II3B 3EHVA 1UGMA 1XLQA 5HKHA 1TKYA 3ZKJC 2LRWA 3ENEA 2IYDB 2VZKB 1UGJA 3DVNV 2JF5A 1WXQA 3EGRA 4P6VF 4ASWC 2MHJA 2OHFA 2BB5A 1EO6A 4MM3B 4MSMB 2WS3B 2UWQA 1E5WA 5JH5C 3ECIA 4NQLB 3TEYA 2BS3B 4LLGM 4MGYE 2WU5B 4PYUA 1WH3A 1L4DB 3W9CB 2O6VA 2PKOA 3RUIB 2ZJDA 2WU2B 2XBBC 5CHWA 1V81A 2KZRA 4K1RB 3R7QA 4IWQA 3DVGY 1L0XB 1WMHB 3P2BA 1TTNA 4KGRA 2HJ8A 5BMHA 2CHWA 4LNNA 1JWMD 1M4VA 4HCNB 2V0GA 3P4PB 3P4QB 1VZ8A 1GAQB 5EE9A 3AXCA 3D32A 1GUAB 1UWXA 2ICIA 5BYRA 1WM3A 4JE3B 3BINA 2C7HA 2AL6A 2LGYA 1ZDXA 4DWFA 2WXHA 5CX3A 3K9OB 3R66C 4BKGA 3BK2A 3P1MA 2LVQA 2K6QA 1I7HA 2MQJA 2MWSB 2KACA 4W9FA 1WXAA 2YEPB 2LI5A 3HVZA 2L1AA 3NVVA 2MRPA 3VAWA 3DHIC 3MFGA 2WXKA 1RFAA 1HZ6A 2FIDA 2ZNVB 3I5JC 1UF0A 2INPE 4GMVA 2KK8A 1UWMA 2JZPA 3Q3OC 3BIID 1WGDA 3IAS1 4GXBA 4DHJB 1WXVA 3DBLB 5C1ZA 2D07B 2FCQA 2DLBA 4A90A 4JIOU 1QT9A 4RGTA 1MG8A 2N7EA 4IM0A 5H8YE 2ZEQA 2DHZA 2MSED 1N61A 2O2VB 1WR6E 2LGXA 4HPPA 1WI0A 4BZAA 4XDCA 1ZW7A 4X57B 1XO3A 3L4PA 1QQRA 2KQ4X 1OEYA 1D5XC 4HPMB 3AE1B 4YSYB 4K7SA 2IY1B 4DQOC 2KX3A 2R2OA 3JVZX 3SDLC 4US9A 1FNUA 1IBXA 3SFDB 3H7PA 2XNAC 3ZJUA 2WGSA 3IFWB 2KMCA 4RCOA 4ICUA 2BS4B 1TIFA 3ZUNA 1SSNA 2LHEA 2BVCA 1JWAD 2JXXA 4BBNF 1YX6B 1QOFA 2FCNA 1MVKA 3QAQA 4KZCA 4EFOA 4A9AA 4PT5A 4B0EA 3ABVB 4A55A 3H1UA 3MC9A 1WXMA 1RWSA 3RNAC 3ZGZA 2INCC 2CJOA 2KHWB 2GBJA 2Z0EB 2NBUA 3GZNB 1QZEA 3U4EG 2G1EA 4M0WA 4HXDA 3RI7C 5FR3A 3A9KB 1K51A 4XZ4A 4XYCA 4RM9A 2VH2A 4F8CB 2LHDA 4C7ZA 1MG4A 4IWOA 4KGTA 2JQRB 5C3JB 3R2IA 1JQ4A 1EM7A 2BT6A 4AOFA 2IY0B 2NS5A 1QOAA 1V86A 3DVGX 2WLBA 3JW0X 3RZFA 2PW9A 2KN4A 4NAWA 1Y8RC 1OQYA 5EE3A 5J18A 3KUZA
chains in the Genus database with same CATH topology
2N1WA 2G4DB 4HPLB 3NHEB 3L54A 1GNUA 3PZDA 4GB9A 2M17A 1V5OA 2ZPYA 3DOWA 3ZDMC 2UYZB 4W9GA 1FXTB 4FBJB 2DX5B 2DYMA 4MGKE 3UIOB 3ZNHB 4KSKC 5D7GA 2KLCA 2HTHA 4II2B 2AL3A 5KHOA 3CSTA 3MTNB 4ZRJA 5D6JB 4EZKA 3M95A 3RZWC 3A4RA 4ANXA 2L05A 2L0FA 1XT9B 1WM2A 4HDOA 4JGHB 4CYEA 2IBIB 2G4SA 3PVLA 4PS8A 2DZMA 5TR5A 1KLVA 2K8CA 4GDKB 3L13A 1NI2A 1V80A 3TJPA 2MP2B 2QHOA 4MSQB 2C7NB 4B6WA 1VCBA 3ZTCA 4WQOB 4G0NB 3NY5A 1SE9A 4ICVA 2KJ6A 4WWOA 4MELA 2L00B 3M62B 2L76A 1M94A 2MA9B 2WX1A 3KYDD 1OTRB 2RGFA 4G50A 4DDID 3EC8A 3PLVA 3KYCD 3U8ZA 1OGWA 2LVOA 1UELA 1E7UA 1Q0WB 3ML8A 1S1QB 1WY8A 3CSFA 3QIJA 3WALA 2KTRA 4EZLA 2GOWA 2BYEA 3H9DA 1R4MI 3OJ4B 2G45B 4GIVA 2CKHB 2ZNVC 3CF6E 3DBLI 4W9LA 4F7ZA 1I35A 2KFKA 3RULA 1WJUA 1Z5SB 3N3KB 3SHQA 4GDLA 5L95C 2IZVB 4MEMA 3TCAA 1K8RB 2CHXA 3AULA 4HDQA 1J0GA 3UINB 1KJTA 2DENB 2KTFA 4WWPA 1WJ6A 2IO2B 3QCAA 4IWPA 4NNJB 5GMVA 3UIPB 3W1SC 4DK5A 2R2QA 2DZIA 2M0XA 4KZ0A 3SU8X 3JYUA 1P0RA 2C5LC 3CMMB 5EDSA 1WR1A 3M3JA 2GBMA 3ZLZA 1V5TA 1UD7A 1T0YA 3VDZA 3VTVA 3N30A 1P1AA 4AJWA 3PS6A 2KWCA 3A9JA 4WJOA 2O6VD 3PRMB 2PE9A 3APDA 3U30A 2KANA 2JZ3B 3R3MA 2REXA 4PS3A 3RD2A 4EUTA 4PS7A 3PSEB 5IA7A 2KDEB 2C60A 3O65B 2M8SA 2BWFA 3PT2B 5AZFA 3ZRCA 3EFUA 3RT3B 2A4ZA 4TQ1A 2I1JA 2J0JA 4K7WA 3V6EB 1WFYA 2B3AA 3UGBB 1GG3A 3PTFC 4IM2A 3T9LA 2VRRB 4EKUA 3H6NA 3PLUA 1WX8A 2KD0A 2HE7A 5DPTA 2KJHB 2MX2A 2ZZPB 2MP2A 2KX0A 1U4AA 3QX1A 3NS8A 4JLCA 1V2YA 4M8MA 2GBKA 2IO3B 3T8MA 3X0WA 1WF9A 3A33B 2KTRB 4GGQA 2NVUI 3WANA 3IHPC 2EMTA 2LGDA 1IYFA 2KQ7A 2FNJB 2CR5A 2NPTA 4FA6A 1WJ4A 3VVWB 3WAOA 4BBNC 4IM3A 1L7YA 2KFKB 4OVVA 3TMPB 3HM3A 2BKRB 5CHFA 4K7UA 2D11A 3B08A 4JL9A 2KO3A 3PV1A 4FULA 1TZ1A 3DPDA 3HK0A 4GU2A 4M8NA 4W9EA 5AZGA 5LXIB 2HD5B 3QA8A 3ZRFA 4AP4C 3LJ3A 3PRZA 4XX5A 4MH0E 3ZNZB 4TV3A 1KOTA 3V6CB 2N7DA 1SIFA 1NBFC 2ZVNA 4WJQA 3ALBA 1E90A 1V9JA 3H7SA 2DYOA 1YIWA 1Q5WB 2KJRA 3GZNI 3VQIA 2AWTA 3UQAA 2PJHA 3A9JB 1WZ0A 2A5UA 5J2RA 1V49A 4EEWA 2KMAA 4J6IA 2LD9A 5AZHA 2I1KA 3WA0A 2RR9A 2WX0A 2LXCA 2FCMA 2N9PC 1D3ZA 1L2NA 4KIKA 3L17A 4LCDE 4N9F4 3N32A 3ZW3A 2O6VB 2J0MA 3PREA 4BKSD 3OAWA 1WJNA 1WXSA 3KUCB 3S2AA 1E8YA 3UF8A 1NDDA 2BPSA 5DPRA 3ZNGC 1H8CA 4HCPB 4RM8A 2JT4B 4BKSA 2NCNA 3Q3FA 2KC2A 5JHAA 2FAZA 2N1VA 4GOCA 2JY6A 4JQWC 4DHZE 3VTUA 1WGYA 2D3GA 4NPNA 1WGHA 4WAAA 4FHKA 2ZVOA 2NPTB 2BYVE 2V4LA 4A20A 2RPQA 2KC1A 3HHMA 3ZTDA 4G3XB 3KH0A 1HE8A 4KDLB 4P7IA 1EF5A 1YQBA 1S3SG 2D10A 3DBHI 1P3QU 2DZKA 3PRPB 4LJOB 5IAAC 3ONSA 3DCGA 3L08A 3VUWA 4BOZB 4FJVB 4TQ0A 4ZDVA 4OVUA 1G6JA 2PPHA 3L10B 2K25A 5DCNA 4BKTA 2KWUB 1WYWB 2GMIC 2DZJA 3V61A 4W9HA 2JVCA 5LLIA 1BT0A 3Q3JA 3VUYA 3ZDTA 2NR2A 1ZKHA 3VHTC 1C3TA 2CHZA 4II3B 2L0TA 3EHVA 1UGMA 4WJNA 5HKHA 2C7MB 3ZKJC 4B95A 2LRWA 3ENEA 4NY0A 2IYDB 3QC8B 3VTWA 4XC2A 2DAFA 3DVNV 4FJZA 2JF5A 4GSWA 3TIXA 5CHVC 1WRDB 4KIKB 4ASWC 5L83A 3QARA 4BFRA 2EKEC 2MBOA 1EO6A 1CMXB 1GC6A 4MSMB 1E8ZA 5E6NA 2LWPA 2UWQA 1E5WA 2C9WB 5JH5C 3AI5A 3ECIA 1KM7A 4NQLB 4MGYE 3W1YA 2LUEA 2MBQA 4PYUA 5D94A 1WH3A 4K81A 2OOBB 4KV2A 4W9KA 1P9DU 1JRUA 5CTRC 2O6VA 3RUIB 3LDZE 2WDTB 2ZJDA 5G2NA 4DDGD 3NOBA 2XBBC 3VFKA 1E8WA 2RD0A 4IW0A 1RLFA 2EMSA 2ASQA 5CHWA 1V81A 4BOSC 4HLEA 1AARA 4DHJD 2KZRA 4K1RB 3UQBA 3R7QA 4IWQA 3DVGY 4TKNA 2K1FA 3V62A 1WMHB 3PGEA 4NJ7A 4A3PA 4FJYA 3P2BA 1TTNA 2LZ6A 2HJ8A 4HK2A 2CHWA 5DPWA 1ZGUB 3APFA 2GBNA 2KN5A 3QHTA 3W1SA 4HCNB 2WWZA 2MBBB 1GJZA 1OEYJ 3RYTA 2BKFA 3IG3A 3AXCA 2BWES 1I42A 1WE6A 3DDCB 3PPAA 3D32A 2AEHA 1GUAB 3MJWA 2N4FA 4W9JA 1WGGA 3NZUA 4BVUC 2KFJA 3ZO5B 3EECA 1WM3A 3BINA 2C7HA 2AL6A 2LGYA 2PEAA 5E6PA 1IP9A 4DWFA 2JRHA 2BGFA 5CX3A 4MGZE 3K9OB 3R66C 2KDIA 2D2QA 3QWZB 4TUUA 2AYOB 4FN2A 1TGZB 2V1YA 4BKGA 3AU5A 3R7RA 2W9NA 3MHSD 1WE7A 3BY4B 2LVQA 3DBSA 3WIMA 2KKCA 1P98A 2K6QA 2N9XA 2MQJA 2MWSB 3DVNU 3H7PB 1WXAA 3PHWB 4NQKE 4W9FA 2LI5A 3VXWA 4AJYB 1Q1OA 2J0KA 4I6LB 2MRPA 2MBEA 4EOYA 4ZYNA 3VAWA 2L8JA 3V60A 3IBEA 2JZZA 1R4NI 3M63B 2M1MA 4A3OA 5AEKB 1YX5B 2KVRA 2KLGA 4E71A 1RFAA 4MM3A 4ANVA 2FIDA 4AUQC 3VH3B 2IO0B 2FCSA 2LASA 2KDFB 2ZNVB 1J19A 5LXHA 1WX9A 4GMVA 2KK8A 2K8BA 2MBHA 4MDKE 1LFDA 4RMAA 1E8XA 1WGDA 1F9JA 3QK0A 4GXBA 4DHJB 3APCA 1WXVA 5C1ZA 4HWIB 3HM6X 2V3SA 1UBQA 2D07B 3VH4B 2FCQA 4WWNA 4FLHA 4JIOU 4CHKA 2CS4A 3K9PB 4FHJA 1WMHA 3QQ8B 3OLMD 4MGIE 2JUOA 3L16A 1MG8A 2KQSA 2J7QB 3QJZA 2N7EA 4IM0A 1V6EA 5C23A 3B1LX 2KDBA 2KWVB 2ZEQA 3OJ3A 4M0WB 2DHZA 1PQSA 1LQBA 2MSED 2O2VB 2PE6B 1WR6E 2LGXA 4IC7B 1YD8U 3KW5B 3RCZA 1SGHA 3ZNID 4WJPA 1ISNA 4LDTD 1WI0A 4MJSA 5G55A 5DPSA 1ZW7A 2KOXA 4X57B 4I6PA 4NJ6A 2IO1B 4B9KA 3JSVA 2NBVB 2BF8B 2L7RA 2XK5A 3ML9A 4W9DA 2Z59B 3A9KA 1OEYA 4E3CA 4HPMB 4AWJA 1LM8B 1LXDA 4K7SA 2IY1B 1WIAA 2KX3A 2R2OA 4DBGA 2BYFA 3JVZX 3SDLC 2MCNB 4NAWB 2FIFA 1RRBA 2OJRA 2MW5A 3DQVA 4HJKA 2M4NA 4CO7A 3H7PA 1Z2MA 1EUVB 4LJPB 2ZCBA 3IFWB 5JZEB 2KMCA 2NBWB 5JHBA 1X1MA 2KXJA 3AU4A 2YVCA 4ICUA 2JWZA 3PHXB 3A1QA 3DBRI 4G11A 1GC7A 3ZUNA 4IUMB 3U7DA 2GBRA 2K39A 4W9CA 4KSLC 2RSUA 5D2MB 1IPGA 4EZJA 3WAPA 2LVPA 4ANWA 3C0RB 3GOEA 1WX7A 2JXXA 2Z0DB 4PYZA 2YLMA 2K8HA 3I3TB 4DHZB 2CU1A 4BBNF 3WAMA 4ANUA 1UBIA 1YX6B 4FADA 2FCNA 2ZCCA 3SD5A 5BO4B 3QAQA 4KZCA 3KVFB 4EFOA 2Y5BB 1YJ1A 3X23A 2LXAA 2WYQA 4W9IA 2LRUA 3H1UA 3TBLD 1XQQA 2K6DB 1WXMA 1E7VA 4MJSB 4DXAB 1A5RA 3NZSA 2KHWB 2GBJA 2Z0EB 3ZVVA 2NBUA 4KDIC 4KVGB 1QZEA 2XEWA 3JSVB 1XD3B 2LJ5A 1EF1A 1TBEA 2XK5B 2KNBA 2ZPNA 4HVBA 4LDTB 4ZRKA 4HXDA 4YL8A 4GDKA 3A9KB 1C1YB 2O2VA 4RM9A 4XZ4A 5KHQA 4F8CB 4E74A 4IWOA 1WZ3A 2JPHA 4I6NB 3VUXA 3ZIMA 2FUHB 5E6OA 4F1SA 2G3QB 1H4RA 1UZXB 1WGRA 3KUDB 2IY0B 4GDLB 4AOFA 2NS5A 2MLBA 1V86A 2DYBA 2N9EB 3DVGX 3B0AA 4GN1A 1RAXA 1UH6A 3JW0X 3RZFA 1VD2A 4URKA 4NAWA 1Y8RC 1OQYA 3A1QB 4IG7B 5FR6A 3L0WB 2DAJA 3HIZA 1J8CA 2JRIB 3A4SC 3TL5A 2L3ZA 3IVFA 5J18A 4ZRIA 5J17A 3KUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1W A;  2G4D B;  4HPL B;  3NHE B;  3L54 A;  1GNU A;  3PZD A;  4GB9 A;  2M17 A;  1V5O A;  2ZPY A;  3DOW A;  3ZDM C;  2UYZ B;  4W9G A;  1FXT B;  4FBJ B;  2DX5 B;  2DYM A;  4MGK E;  3UIO B;  3ZNH B;  4KSK C;  5D7G A;  2KLC A;  2HTH A;  4II2 B;  2AL3 A;  5KHO A;  3CST A;  3MTN B;  4ZRJ A;  5D6J B;  4EZK A;  3M95 A;  3RZW C;  3A4R A;  4ANX A;  2L05 A;  2L0F A;  1XT9 B;  1WM2 A;  4HDO A;  4JGH B;  4CYE A;  2IBI B;  2G4S A;  3PVL A;  4PS8 A;  2DZM A;  5TR5 A;  1KLV A;  2K8C A;  4GDK B;  3L13 A;  1NI2 A;  1V80 A;  3TJP A;  2MP2 B;  2QHO A;  4MSQ B;  2C7N B;  4B6W A;  1VCB A;  3ZTC A;  4WQO B;  4G0N B;  3NY5 A;  1SE9 A;  4ICV A;  2KJ6 A;  4WWO A;  4MEL A;  2L00 B;  3M62 B;  2L76 A;  1M94 A;  2MA9 B;  2WX1 A;  3KYD D;  1OTR B;  2RGF A;  4G50 A;  4DDI D;  3EC8 A;  3PLV A;  3KYC D;  3U8Z A;  1OGW A;  2LVO A;  1UEL A;  1E7U A;  1Q0W B;  3ML8 A;  1S1Q B;  1WY8 A;  3CSF A;  3QIJ A;  3WAL A;  2KTR A;  4EZL A;  2GOW A;  2BYE A;  3H9D A;  1R4M I;  3OJ4 B;  2G45 B;  4GIV A;  2CKH B;  2ZNV C;  3CF6 E;  3DBL I;  4W9L A;  4F7Z A;  1I35 A;  2KFK A;  3RUL A;  1WJU A;  1Z5S B;  3N3K B;  3SHQ A;  4GDL A;  5L95 C;  2IZV B;  4MEM A;  3TCA A;  1K8R B;  2CHX A;  3AUL A;  4HDQ A;  1J0G A;  3UIN B;  1KJT A;  2DEN B;  2KTF A;  4WWP A;  1WJ6 A;  2IO2 B;  3QCA A;  4IWP A;  4NNJ B;  5GMV A;  3UIP B;  3W1S C;  4DK5 A;  2R2Q A;  2DZI A;  2M0X A;  4KZ0 A;  3SU8 X;  3JYU A;  1P0R A;  2C5L C;  3CMM B;  5EDS A;  1WR1 A;  3M3J A;  2GBM A;  3ZLZ A;  1V5T A;  1UD7 A;  1T0Y A;  3VDZ A;  3VTV A;  3N30 A;  1P1A A;  4AJW A;  3PS6 A;  2KWC A;  3A9J A;  4WJO A;  2O6V D;  3PRM B;  2PE9 A;  3APD A;  3U30 A;  2KAN A;  2JZ3 B;  3R3M A;  2REX A;  4PS3 A;  3RD2 A;  4EUT A;  4PS7 A;  3PSE B;  5IA7 A;  2KDE B;  2C60 A;  3O65 B;  2M8S A;  2BWF A;  3PT2 B;  5AZF A;  3ZRC A;  3EFU A;  3RT3 B;  2A4Z A;  4TQ1 A;  2I1J A;  2J0J A;  4K7W A;  3V6E B;  1WFY A;  2B3A A;  3UGB B;  1GG3 A;  3PTF C;  4IM2 A;  3T9L A;  2VRR B;  4EKU A;  3H6N A;  3PLU A;  1WX8 A;  2KD0 A;  2HE7 A;  5DPT A;  2KJH B;  2MX2 A;  2ZZP B;  2MP2 A;  2KX0 A;  1U4A A;  3QX1 A;  3NS8 A;  4JLC A;  1V2Y A;  4M8M A;  2GBK A;  2IO3 B;  3T8M A;  3X0W A;  1WF9 A;  3A33 B;  2KTR B;  4GGQ A;  2NVU I;  3WAN A;  3IHP C;  2EMT A;  2LGD A;  1IYF A;  2KQ7 A;  2FNJ B;  2CR5 A;  2NPT A;  4FA6 A;  1WJ4 A;  3VVW B;  3WAO A;  4BBN C;  4IM3 A;  1L7Y A;  2KFK B;  4OVV A;  3TMP B;  3HM3 A;  2BKR B;  5CHF A;  4K7U A;  2D11 A;  3B08 A;  4JL9 A;  2KO3 A;  3PV1 A;  4FUL A;  1TZ1 A;  3DPD A;  3HK0 A;  4GU2 A;  4M8N A;  4W9E A;  5AZG A;  5LXI B;  2HD5 B;  3QA8 A;  3ZRF A;  4AP4 C;  3LJ3 A;  3PRZ A;  4XX5 A;  4MH0 E;  3ZNZ B;  4TV3 A;  1KOT A;  3V6C B;  2N7D A;  1SIF A;  1NBF C;  2ZVN A;  4WJQ A;  3ALB A;  1E90 A;  1V9J A;  3H7S A;  2DYO A;  1YIW A;  1Q5W B;  2KJR A;  3GZN I;  3VQI A;  2AWT A;  3UQA A;  2PJH A;  3A9J B;  1WZ0 A;  2A5U A;  5J2R A;  1V49 A;  4EEW A;  2KMA A;  4J6I A;  2LD9 A;  5AZH A;  2I1K A;  3WA0 A;  2RR9 A;  2WX0 A;  2LXC A;  2FCM A;  2N9P C;  1D3Z A;  1L2N A;  4KIK A;  3L17 A;  4LCD E;  4N9F 4;  3N32 A;  3ZW3 A;  2O6V B;  2J0M A;  3PRE A;  4BKS D;  3OAW A;  1WJN A;  1WXS A;  3KUC B;  3S2A A;  1E8Y A;  3UF8 A;  1NDD A;  2BPS A;  5DPR A;  3ZNG C;  1H8C A;  4HCP B;  4RM8 A;  2JT4 B;  4BKS A;  2NCN A;  3Q3F A;  2KC2 A;  5JHA A;  2FAZ A;  2N1V A;  4GOC A;  2JY6 A;  4JQW C;  4DHZ E;  3VTU A;  1WGY A;  2D3G A;  4NPN A;  1WGH A;  4WAA A;  4FHK A;  2ZVO A;  2NPT B;  2BYV E;  2V4L A;  4A20 A;  2RPQ A;  2KC1 A;  3HHM A;  3ZTD A;  4G3X B;  3KH0 A;  1HE8 A;  4KDL B;  4P7I A;  1EF5 A;  1YQB A;  1S3S G;  2D10 A;  3DBH I;  1P3Q U;  2DZK A;  3PRP B;  4LJO B;  5IAA C;  3ONS A;  3DCG A;  3L08 A;  3VUW A;  4BOZ B;  4FJV B;  4TQ0 A;  4ZDV A;  4OVU A;  1G6J A;  2PPH A;  3L10 B;  2K25 A;  5DCN A;  4BKT A;  2KWU B;  1WYW B;  2GMI C;  2DZJ A;  3V61 A;  4W9H A;  2JVC A;  5LLI A;  1BT0 A;  3Q3J A;  3VUY A;  3ZDT A;  2NR2 A;  1ZKH A;  3VHT C;  1C3T A;  2CHZ A;  4II3 B;  2L0T A;  3EHV A;  1UGM A;  4WJN A;  5HKH A;  2C7M B;  3ZKJ C;  4B95 A;  2LRW A;  3ENE A;  4NY0 A;  2IYD B;  3QC8 B;  3VTW A;  4XC2 A;  2DAF A;  3DVN V;  4FJZ A;  2JF5 A;  4GSW A;  3TIX A;  5CHV C;  1WRD B;  4KIK B;  4ASW C;  5L83 A;  3QAR A;  4BFR A;  2EKE C;  2MBO A;  1EO6 A;  1CMX B;  1GC6 A;  4MSM B;  1E8Z A;  5E6N A;  2LWP A;  2UWQ A;  1E5W A;  2C9W B;  5JH5 C;  3AI5 A;  3ECI A;  1KM7 A;  4NQL B;  4MGY E;  3W1Y A;  2LUE A;  2MBQ A;  4PYU A;  5D94 A;  1WH3 A;  4K81 A;  2OOB B;  4KV2 A;  4W9K A;  1P9D U;  1JRU A;  5CTR C;  2O6V A;  3RUI B;  3LDZ E;  2WDT B;  2ZJD A;  5G2N A;  4DDG D;  3NOB A;  2XBB C;  3VFK A;  1E8W A;  2RD0 A;  4IW0 A;  1RLF A;  2EMS A;  2ASQ A;  5CHW A;  1V81 A;  4BOS C;  4HLE A;  1AAR A;  4DHJ D;  2KZR A;  4K1R B;  3UQB A;  3R7Q A;  4IWQ A;  3DVG Y;  4TKN A;  2K1F A;  3V62 A;  1WMH B;  3PGE A;  4NJ7 A;  4A3P A;  4FJY A;  3P2B A;  1TTN A;  2LZ6 A;  2HJ8 A;  4HK2 A;  2CHW A;  5DPW A;  1ZGU B;  3APF A;  2GBN A;  2KN5 A;  3QHT A;  3W1S A;  4HCN B;  2WWZ A;  2MBB B;  1GJZ A;  1OEY J;  3RYT A;  2BKF A;  3IG3 A;  3AXC A;  2BWE S;  1I42 A;  1WE6 A;  3DDC B;  3PPA A;  3D32 A;  2AEH A;  1GUA B;  3MJW A;  2N4F A;  4W9J A;  1WGG A;  3NZU A;  4BVU C;  2KFJ A;  3ZO5 B;  3EEC A;  1WM3 A;  3BIN A;  2C7H A;  2AL6 A;  2LGY A;  2PEA A;  5E6P A;  1IP9 A;  4DWF A;  2JRH A;  2BGF A;  5CX3 A;  4MGZ E;  3K9O B;  3R66 C;  2KDI A;  2D2Q A;  3QWZ B;  4TUU A;  2AYO B;  4FN2 A;  1TGZ B;  2V1Y A;  4BKG A;  3AU5 A;  3R7R A;  2W9N A;  3MHS D;  1WE7 A;  3BY4 B;  2LVQ A;  3DBS A;  3WIM A;  2KKC A;  1P98 A;  2K6Q A;  2N9X A;  2MQJ A;  2MWS B;  3DVN U;  3H7P B;  1WXA A;  3PHW B;  4NQK E;  4W9F A;  2LI5 A;  3VXW A;  4AJY B;  1Q1O A;  2J0K A;  4I6L B;  2MRP A;  2MBE A;  4EOY A;  4ZYN A;  3VAW A;  2L8J A;  3V60 A;  3IBE A;  2JZZ A;  1R4N I;  3M63 B;  2M1M A;  4A3O A;  5AEK B;  1YX5 B;  2KVR A;  2KLG A;  4E71 A;  1RFA A;  4MM3 A;  4ANV A;  2FID A;  4AUQ C;  3VH3 B;  2IO0 B;  2FCS A;  2LAS A;  2KDF B;  2ZNV B;  1J19 A;  5LXH A;  1WX9 A;  4GMV A;  2KK8 A;  2K8B A;  2MBH A;  4MDK E;  1LFD A;  4RMA A;  1E8X A;  1WGD A;  1F9J A;  3QK0 A;  4GXB A;  4DHJ B;  3APC A;  1WXV A;  5C1Z A;  4HWI B;  3HM6 X;  2V3S A;  1UBQ A;  2D07 B;  3VH4 B;  2FCQ A;  4WWN A;  4FLH A;  4JIO U;  4CHK A;  2CS4 A;  3K9P B;  4FHJ A;  1WMH A;  3QQ8 B;  3OLM D;  4MGI E;  2JUO A;  3L16 A;  1MG8 A;  2KQS A;  2J7Q B;  3QJZ A;  2N7E A;  4IM0 A;  1V6E A;  5C23 A;  3B1L X;  2KDB A;  2KWV B;  2ZEQ A;  3OJ3 A;  4M0W B;  2DHZ A;  1PQS A;  1LQB A;  2MSE D;  2O2V B;  2PE6 B;  1WR6 E;  2LGX A;  4IC7 B;  1YD8 U;  3KW5 B;  3RCZ A;  1SGH A;  3ZNI D;  4WJP A;  1ISN A;  4LDT D;  1WI0 A;  4MJS A;  5G55 A;  5DPS A;  1ZW7 A;  2KOX A;  4X57 B;  4I6P A;  4NJ6 A;  2IO1 B;  4B9K A;  3JSV A;  2NBV B;  2BF8 B;  2L7R A;  2XK5 A;  3ML9 A;  4W9D A;  2Z59 B;  3A9K A;  1OEY A;  4E3C A;  4HPM B;  4AWJ A;  1LM8 B;  1LXD A;  4K7S A;  2IY1 B;  1WIA A;  2KX3 A;  2R2O A;  4DBG A;  2BYF A;  3JVZ X;  3SDL C;  2MCN B;  4NAW B;  2FIF A;  1RRB A;  2OJR A;  2MW5 A;  3DQV A;  4HJK A;  2M4N A;  4CO7 A;  3H7P A;  1Z2M A;  1EUV B;  4LJP B;  2ZCB A;  3IFW B;  5JZE B;  2KMC A;  2NBW B;  5JHB A;  1X1M A;  2KXJ A;  3AU4 A;  2YVC A;  4ICU A;  2JWZ A;  3PHX B;  3A1Q A;  3DBR I;  4G11 A;  1GC7 A;  3ZUN A;  4IUM B;  3U7D A;  2GBR A;  2K39 A;  4W9C A;  4KSL C;  2RSU A;  5D2M B;  1IPG A;  4EZJ A;  3WAP A;  2LVP A;  4ANW A;  3C0R B;  3GOE A;  1WX7 A;  2JXX A;  2Z0D B;  4PYZ A;  2YLM A;  2K8H A;  3I3T B;  4DHZ B;  2CU1 A;  4BBN F;  3WAM A;  4ANU A;  1UBI A;  1YX6 B;  4FAD A;  2FCN A;  2ZCC A;  3SD5 A;  5BO4 B;  3QAQ A;  4KZC A;  3KVF B;  4EFO A;  2Y5B B;  1YJ1 A;  3X23 A;  2LXA A;  2WYQ A;  4W9I A;  2LRU A;  3H1U A;  3TBL D;  1XQQ A;  2K6D B;  1WXM A;  1E7V A;  4MJS B;  4DXA B;  1A5R A;  3NZS A;  2KHW B;  2GBJ A;  2Z0E B;  3ZVV A;  2NBU A;  4KDI C;  4KVG B;  1QZE A;  2XEW A;  3JSV B;  1XD3 B;  2LJ5 A;  1EF1 A;  1TBE A;  2XK5 B;  2KNB A;  2ZPN A;  4HVB A;  4LDT B;  4ZRK A;  4HXD A;  4YL8 A;  4GDK A;  3A9K B;  1C1Y B;  2O2V A;  4RM9 A;  4XZ4 A;  5KHQ A;  4F8C B;  4E74 A;  4IWO A;  1WZ3 A;  2JPH A;  4I6N B;  3VUX A;  3ZIM A;  2FUH B;  5E6O A;  4F1S A;  2G3Q B;  1H4R A;  1UZX B;  1WGR A;  3KUD B;  2IY0 B;  4GDL B;  4AOF A;  2NS5 A;  2MLB A;  1V86 A;  2DYB A;  2N9E B;  3DVG X;  3B0A A;  4GN1 A;  1RAX A;  1UH6 A;  3JW0 X;  3RZF A;  1VD2 A;  4URK A;  4NAW A;  1Y8R C;  1OQY A;  3A1Q B;  4IG7 B;  5FR6 A;  3L0W B;  2DAJ A;  3HIZ A;  1J8C A;  2JRI B;  3A4S C;  3TL5 A;  2L3Z A;  3IVF A;  5J18 A;  4ZRI A;  5J17 A;  3KUZ A; 
#chains in the Genus database with same CATH topology
 2G4D B;  4HPL B;  1LGR A;  2MJ3 A;  3PZD A;  4OHJ A;  1L0Y B;  2UYZ B;  4W9G A;  1FXT B;  3CIR B;  1VDV A;  2DYM A;  3AEF B;  5D7G A;  4YSZ B;  3MTN B;  5D3I B;  1YQ4 B;  1ZP0 B;  3RZW C;  2IGH A;  3A4R A;  2Y5P A;  1WM2 A;  4HDO A;  2IBI B;  2G4S A;  3PVL A;  4AS1 A;  4PS8 A;  1KLV A;  1TY2 A;  4K3B A;  4CQN A;  3CWI A;  4G0N B;  4C4V A;  3B9J A;  1C79 A;  2MA9 B;  2WX1 A;  3KYD D;  2Y5C A;  4DDI D;  3FIL A;  1JWU D;  3U8Z A;  1OGW A;  3ML8 A;  1E0Z A;  5BMI A;  3QIJ A;  1ZOY B;  2GOW A;  1R4M I;  2CKH B;  3CF6 E;  4N59 A;  4W9L A;  4F7Z A;  1I35 A;  2KFK A;  2Y3A A;  1EU3 A;  1K8R B;  1J0G A;  1N62 A;  1V1P A;  2IO2 B;  3UIP B;  4EE2 A;  4KZ0 A;  1ZE3 D;  3M3J A;  2KWD A;  4HRS A;  3N30 A;  2KWC A;  3A9J A;  3KWV A;  5IOI A;  3DHH C;  3BVM A;  3MHZ A;  1QF6 A;  2C60 A;  3O65 B;  2M8S A;  4LNI A;  5AZF A;  1FEH A;  2J0J A;  3EFC A;  4K7W A;  3UGB B;  2B3A A;  3RNB C;  3HVD A;  1ET9 A;  1F2R C;  2HE7 A;  5DPT A;  2KJH B;  2K22 A;  2MP2 A;  1TS3 A;  1U4A A;  1V2Y A;  2IO3 B;  1WF9 A;  4GGQ A;  2KTR B;  1NEK B;  3WAN A;  2EMT A;  4L1B A;  2FNJ B;  2CR5 A;  2NPT A;  2PLP A;  5IKC M;  1STE A;  3ZYY X;  5CHF A;  3PV1 A;  4FUL A;  4M8N A;  4W9E A;  3C8Y A;  1T0S C;  1SEB D;  3GP7 A;  3LJ3 A;  1E7P B;  1K50 A;  2NTS A;  1SIF A;  4WJQ A;  2VZK D;  2N9K A;  1SIJ A;  1TS4 A;  2QMT A;  1V49 A;  1VR9 A;  2H88 B;  2KMA A;  3AE3 B;  4EEW A;  4J6I A;  4ARC A;  2LD9 A;  5AZH A;  2GLS A;  2O6V B;  3Q8F A;  1WXS A;  4DXG A;  2ON8 A;  1E8Y A;  5DPR A;  4YTM B;  4WIP A;  4QAY A;  4RM8 A;  2JT4 B;  4WUR A;  2KC2 A;  2FAZ A;  2N1V A;  1WGY A;  2JSV X;  4NPN A;  3O13 A;  4FHK A;  4A20 A;  1QIL A;  1WYG A;  2KDM A;  4WAF A;  1S3S G;  2D10 A;  3DBH I;  5BMG A;  3DCG A;  2RMM A;  4XWT A;  1C4A A;  2GMI C;  1SE2 A;  3U2S C;  3Q3J A;  2NR2 A;  4YSX B;  1C3T A;  3GE8 C;  2L0T A;  1T3Q A;  2C7M B;  4NY0 A;  1C4C A;  1QOG A;  2WQY B;  2IPK D;  4ZOH C;  4GSW A;  1JCK B;  2XN9 C;  3QAR A;  1FRR A;  2EKE C;  5AUI A;  5E6N A;  1E8Z A;  4ZHP A;  2C9W B;  3AI5 A;  2WP9 B;  2KYW A;  2LUE A;  2MBQ A;  5D94 A;  4K81 A;  2OOB B;  4KV2 A;  4ACF A;  3LDZ E;  3ETR A;  3Q69 A;  4DDG D;  1E8W A;  1GPX A;  5EE0 A;  2EMS A;  4ZRQ A;  1ZXH A;  4DHJ D;  3UQB A;  1GB4 A;  2K1F A;  1FM0 D;  3PGE A;  3V62 A;  4A3P A;  4FJY A;  2M0A A;  2LZ6 A;  3APF A;  1VLB A;  2KAJ A;  2WWZ A;  5BYS A;  2MBB B;  1OEY J;  2BKF A;  3IG3 A;  1WE6 A;  3DDC B;  2Z8L A;  4LNO A;  2N4F A;  4W9J A;  4BVU C;  3ZO5 B;  3EEC A;  2WXP A;  2PEA A;  2FBW B;  5E6P A;  2BGF A;  2TSS A;  2MJE A;  2LMC A;  2KDI A;  2D2Q A;  1YOV B;  2AYO B;  4FN2 A;  1LO5 D;  3R7R A;  1V1O A;  3ZXR A;  3DBS A;  1P98 A;  1IBX B;  3PHW B;  3H7P B;  1Q1O A;  2WXG A;  1I4R A;  2MJD A;  2IGG A;  2MBE A;  2FE8 A;  4ZYN A;  2EKI A;  4A8X C;  2RDB C;  2L8J A;  3V60 A;  1R4N I;  2KVR A;  2PIA A;  3VR9 B;  2LJI A;  4AUQ C;  1J19 A;  1FRD A;  4ZYS A;  1E8X A;  2K0P A;  3APC A;  3HM6 X;  1UBQ A;  2QIL A;  1FD6 A;  2BS2 B;  3QQ8 B;  4MGI E;  2JUO A;  3B1L X;  2KWV B;  1EWY C;  4M0W B;  3KW5 B;  1ISN A;  2E3T A;  3E9S A;  4MJS A;  1MFW A;  2PTL A;  4I6P A;  3JSV A;  3U7Z A;  2I2Y A;  4A6Q A;  4W9D A;  1RFK A;  3FC4 A;  4E3C A;  2D3A A;  1NVI D;  1I4H A;  2BYF A;  2MCN B;  4NAW B;  2QJL A;  2VH1 A;  3PO0 A;  3IAM 1;  1PYW D;  4LJP B;  2ZCB A;  2V3N A;  2KXJ A;  2YVC A;  2JWZ A;  1GC7 A;  4GLS C;  3Q8E A;  2BW2 A;  2RSU A;  5D2M B;  4EZJ A;  3WAP A;  2LVP A;  4ANW A;  4C56 C;  1SE4 A;  3GOE A;  3BWU D;  4JPS A;  4ANU A;  3WAM A;  1UBI A;  4AQ7 A;  4FAD A;  3LYY A;  3SD5 A;  2G9H D;  1SE3 A;  3X23 A;  4W9I A;  2LRU A;  4R3D A;  3NZS A;  4KDI C;  2XEW A;  1CQV A;  3HUI A;  1TBE A;  2XK5 B;  4M02 A;  2ZPN A;  3FIL B;  4ZRK A;  4YL8 A;  4GDK A;  2AQ3 B;  1IGD A;  1A70 A;  1XCQ L;  1HTO A;  3MJ5 A;  3VUX A;  1DYQ A;  1FFU A;  2WDV B;  2FUH B;  5E6O A;  1H4R A;  1AWD A;  1UZX B;  3URY A;  2RDH A;  1WGK A;  2N9E B;  2IJ0 A;  4GN1 A;  3P63 A;  1NI3 A;  3A1Q B;  1VZ6 A;  1C77 A;  2JRI B;  1PGX A;  3TCA A;  2YEP F;  1GNU A;  1FCC C;  2L52 A;  4ARI A;  2HJ1 A;  3DOW A;  2QDF A;  4K3C A;  4FBJ B;  5HFY A;  2K3U A;  4DXF A;  2KLC A;  2AL3 A;  1JML A;  4M01 A;  3M95 A;  4CYE A;  3AN1 A;  4RF0 A;  3L13 A;  1V80 A;  2MP2 B;  2QHO A;  2C7N B;  3PZ8 A;  1NYQ A;  3NY5 A;  1SE9 A;  4ICV A;  4LTU A;  4WQM A;  4WWO A;  2L00 B;  3M62 B;  1OTR B;  1KRH A;  1UEL A;  4ITK A;  2J52 A;  1D5Z C;  1FMA D;  3WAL A;  3AB5 A;  2QCZ A;  4EZL A;  2G45 B;  4GIV A;  3Q3M C;  3NZ3 A;  3SHQ A;  4GDL A;  2CHX A;  3AUL A;  2W3R A;  1KJT A;  2DEN B;  3I63 C;  5I4D A;  2WXF A;  2DZI A;  3JYU A;  2C5L C;  3CMM B;  3MP9 A;  1PDX A;  4OW0 A;  2R61 A;  4TMA B;  2O6V D;  1F52 A;  3AEG B;  3R3M A;  2REX A;  3RD2 A;  2WXQ A;  4PS7 A;  3BYT B;  4S17 A;  1F0Z A;  2BWF A;  1YQ3 B;  2I1J A;  2SEB D;  1ENF A;  4UDU C;  4EKU A;  3PLU A;  1BUI C;  2IND C;  5BYQ A;  2ZZP B;  3X0W A;  2INN E;  4JLC A;  3P4R B;  3T8M A;  2GBK A;  1D6E C;  1TKE A;  1N5W A;  2NVU I;  1XLP A;  2LGD A;  3TMP B;  1L7Y A;  2BKR B;  1B9R A;  4K7U A;  2KO3 A;  1TZ1 A;  3DPD A;  5AZG A;  1FFV A;  3V05 A;  3AEE B;  1QKZ A;  3V6C B;  2JWU A;  1E90 A;  4RH6 A;  3H7S A;  1N6Z A;  1F77 A;  4REZ A;  2QIE B;  3VQI A;  1HA5 A;  5FKA C;  2PJH A;  2I1K A;  3WA0 A;  5HG2 A;  1DOX A;  1L0V B;  2RR9 A;  2LXC A;  2FCM A;  1MHX A;  1L6V A;  3ZW3 A;  4N9F 4;  3PRE A;  3OAW A;  2KVZ A;  1NDD A;  1SXT A;  4C00 A;  5MPO A;  4D2K A;  4N6E B;  2JY6 A;  2H89 B;  1I4G A;  3AE6 B;  2RPQ A;  3HHM A;  3ZTD A;  3BVG A;  1HE8 A;  1YN5 A;  4KDL B;  4P7I A;  1EF5 A;  1YQB A;  1P3Q U;  2DZK A;  4LJO B;  1E10 A;  1Q10 A;  4ZDV A;  4OVU A;  1G6J A;  3L10 B;  5DCN A;  1ESF A;  3PZ7 A;  1PGB A;  1YNT E;  3BK1 A;  1DOI A;  5LLI A;  3VUY A;  1AN8 A;  3ZDT A;  1R7S A;  3DHG C;  3DWG C;  3AEC B;  3NS1 A;  4WJN A;  1K52 A;  4WH4 A;  4XC2 A;  2DAF A;  2L83 A;  3T3N A;  3TIX A;  4KIK B;  2KT7 A;  5L83 A;  3TEZ A;  2MBO A;  1GC6 A;  4TSS A;  1PFD A;  4MT5 A;  4HJG E;  4W9K A;  1XXG A;  3IXS A;  5G2N A;  3NOB A;  4YTP B;  2Q5W D;  5LNK 1;  3VFK A;  1VRA B;  2RD0 A;  4HKQ A;  4BOS C;  2ASQ A;  2BB6 A;  2HTM E;  4HRO A;  4TKN A;  4NJ7 A;  1QLB B;  4HK2 A;  5DPW A;  1B1Z A;  1ZGU B;  2ONQ A;  2GBN A;  1JRP A;  3W1S A;  1WRI A;  3R8B A;  2BWE S;  3PPA A;  2AEH A;  3Q6B A;  3NZU A;  1N5X A;  1FXI A;  3EA6 A;  2J42 A;  1IP9 A;  1MI0 A;  3QWZ B;  1TGZ B;  2V1Y A;  3ZXV A;  2W9N A;  3NRZ A;  3MHS D;  2WNM A;  1WE7 A;  3LXF A;  3WIM A;  1GOZ A;  2KKC A;  2N9X A;  3DVN U;  4AJY B;  3N1Z C;  4EOY A;  3AE9 B;  1TY0 A;  3N9Y C;  1Y56 A;  3IBE A;  2JZZ A;  3M63 B;  4WWM A;  2M1M A;  4A3O A;  1YX5 B;  1QOB A;  2AX5 A;  2JXT A;  5FK9 C;  2IO0 B;  2KDF B;  2UU7 A;  1VZ7 A;  5LXH A;  1WX9 A;  2K8B A;  3AE5 B;  1LFD A;  4RMA A;  4KKJ A;  2HDE A;  1F9J A;  3AM9 A;  5IO9 A;  3QK0 A;  3VR8 B;  1R4M B;  3VH4 B;  2V3S A;  1NYR A;  2V4I B;  4FLH A;  2CS4 A;  3K9P B;  4FHJ A;  3ZJV A;  2KQS A;  2J7Q B;  3QJZ A;  2LGS A;  4NAM A;  1V6E A;  3B2F A;  2K9X A;  2KDB A;  4IOI E;  1SBB B;  1C4P A;  2PE6 B;  1SGH A;  3ZNI D;  4WJP A;  5JXV A;  2MEK A;  5G55 A;  5DPS A;  1C9F A;  2X38 A;  3TEX A;  2KOX A;  3Q2A C;  4NJ6 A;  1XLN A;  2IO1 B;  4B9K A;  3GE3 C;  2BF8 B;  3ML9 A;  2Z59 B;  3H8H A;  3A9K A;  1D4B A;  2V3P A;  1LM8 B;  1LXD A;  4DBG A;  2FIF A;  4XWW A;  2OJR A;  4CO7 A;  1OQQ A;  1HZ5 A;  1CJE A;  1Z2M A;  1EUV B;  3C19 A;  5JZE B;  1X1M A;  3AU4 A;  5TSS A;  3RNC C;  3PHX B;  3DBR I;  4G11 A;  4IUM B;  3U7D A;  1TYG B;  2GBR A;  1ZUD 2;  4KSL C;  1NEN B;  3C0R B;  3AEA B;  2BYT A;  1WX7 A;  1FIQ A;  2Z0D B;  4P16 A;  1L6U A;  2K8H A;  2CU1 A;  1I4X A;  2W3S A;  2LUM A;  5BO4 B;  1FO4 A;  4IDI A;  4RF1 A;  1N63 A;  1YJ1 A;  4M00 A;  1F2R I;  3TBL D;  1XQQ A;  2K6D B;  3Q8C A;  1A5R A;  4DXA B;  1BML C;  2DBY A;  2NMQ A;  2WXI A;  4BAX A;  4KVG B;  1XD3 B;  1EF1 A;  1OQR A;  1FXA A;  1YJI A;  2KNB A;  2WXO A;  3NVZ A;  4LDT B;  1C1Y B;  2WHI A;  5KHQ A;  4N58 A;  2B76 B;  4E74 A;  1WZ3 A;  3ZIM A;  4F1S A;  2G3Q B;  3KUD B;  4GDL B;  2MLB A;  2DYB A;  1RAX A;  1VD2 A;  1JAL A;  4IG7 B;  2PVO D;  3L0W B;  2DAJ A;  3TUO A;  1WSP A;  3A4S C;  3IVF A;  1MHH E;  4ZRI A;  5J17 A;  3IT4 B;  2DWQ A;  2N1W A;  5EE1 A;  2D3C A;  2OED A;  5D3D A;  3DBH B;  2K5P A;  2M17 A;  3BZD B;  1V5O A;  2ZPY A;  2DX5 B;  2N9L A;  2W55 A;  3UIO B;  3ZNH B;  4KSK C;  2SAK A;  2HTH A;  4YXD B;  4II2 B;  3CST A;  4ZRJ A;  2W82 A;  3AE2 B;  3OG5 A;  4PK1 A;  3OWE B;  4ANX A;  2L05 A;  1XT9 B;  4JGH B;  2DZM A;  2MH7 A;  1VCB A;  4YTN B;  3NJT A;  4WQO B;  2KJ6 A;  4MEL A;  2L76 A;  1M94 A;  4LK0 M;  3RMK C;  4S0R A;  2RGF A;  4C80 A;  3AE8 B;  2LVO A;  2D3B A;  1E7U A;  1Q0W B;  4FXC A;  3W2D A;  3CSF A;  2KTR A;  4RFB A;  3AMZ A;  2BYE A;  3H9D A;  1PGA A;  5H92 C;  3OJ4 B;  3DBL I;  3RUL A;  3I57 A;  1WJU A;  1Z5S B;  3N3K B;  3BYY B;  2IZV B;  4MEM A;  3UIN B;  2NTT A;  1WJ6 A;  4IWP A;  4NNJ B;  3Q8B A;  3BVZ A;  1XLO A;  1TT5 B;  1P0R A;  2WDQ B;  3MC8 A;  3ZJT A;  5HI1 A;  5AUK A;  5EDS A;  3RNE C;  4L23 A;  1V5T A;  3VTV A;  1T0Y A;  3VDZ A;  3PS6 A;  2PE9 A;  2JZ3 B;  4EUT A;  5IA7 A;  2KDE B;  3ZQ4 A;  3GB1 A;  5E6J A;  3PT2 B;  3ZRC A;  3TSS A;  2A4Z A;  4C4V B;  2E6X A;  4B0M A;  4IM2 A;  3T9L A;  3H6N A;  4KX6 B;  2L32 A;  2MX2 A;  4XGA B;  3KLS X;  2KX0 A;  3QX1 A;  3P4S B;  3A33 B;  1R4N B;  3IHP C;  3HRD D;  4FA6 A;  3KWL A;  1D5M C;  2RDG A;  3VVW B;  3WAO A;  4OVV A;  2KFK B;  4ZHO A;  2AQ2 B;  3P42 A;  1FPY A;  4RGM A;  3HK0 A;  4GU2 A;  1V1P B;  5LXI B;  2HD5 B;  3QA8 A;  1KFY B;  4XX5 A;  3PRZ A;  4RGN A;  3ZNZ B;  1KOT A;  2N7D A;  1NBF C;  2DYO A;  2ZW0 A;  5C2T B;  1Q5W B;  3GZN I;  3NUH B;  1YMH E;  2AWT A;  3A9J B;  3UQA A;  1DOY A;  5J2R A;  2CU3 A;  2N9P C;  1L5P A;  1L2N A;  2J0M A;  4BKS D;  3S2A A;  3UF8 A;  2QEJ C;  4HCP B;  2NCN A;  5JHA A;  4GOC A;  3VTU A;  2D3G A;  3EUB 2;  3AV8 A;  4WAA A;  2ZVO A;  2NPT B;  3N1X C;  5GXG B;  2BBC A;  3PRP B;  4BOZ B;  4P1C C;  2PPH A;  2K25 A;  2KWU B;  1CK1 A;  1WYW B;  2WXL A;  2DZJ A;  4YT0 B;  3V61 A;  4W9H A;  2JVC A;  1BT0 A;  2BQQ A;  1ZKH A;  1SB3 C;  4B95 A;  3QC8 B;  4RNA A;  3VTW A;  2EEL A;  4FJZ A;  3Q14 C;  5CHV C;  1WRD B;  1GB1 A;  3U52 E;  4BFR A;  3AED B;  1CMX B;  2LWP A;  2RPV A;  2V9H A;  1KM7 A;  3W1Y A;  3FAH A;  2N0S B;  1P9D U;  1JRU A;  5CTR C;  2JYT A;  2WDT B;  4IW0 A;  1RLF A;  4HLE A;  1BXT A;  1C76 A;  1AAR A;  1HQR D;  2WXM A;  3N20 C;  1HEZ E;  2KN5 A;  3QHT A;  4LNF A;  1GJZ A;  4P1B C;  3B2G A;  3RYT A;  4Q2J A;  3SFE B;  1I42 A;  1E6E B;  1UNS A;  3MJW A;  2CJN A;  5HHD G;  1J7C A;  1WGG A;  1DGJ A;  2KFJ A;  1ZXI A;  2JRH A;  4OZA A;  4MGZ E;  3W5U B;  4TUU A;  4JWU C;  3UI3 A;  3AU5 A;  3MC0 B;  3BY4 B;  1MJD A;  2IDY A;  1J7A A;  4NQK E;  3VXW A;  2J0K A;  2LEK A;  4I6L B;  2KMM A;  1JRO A;  3RPF C;  1PUT A;  5AEK B;  1TS5 A;  2KLG A;  4E71 A;  4MM3 A;  4ANV A;  3N1Y C;  4OVZ A;  3KQ4 A;  2PMV A;  3VH3 B;  3RN9 C;  2FCS A;  2LAS A;  3FKY A;  2J53 A;  1FCL A;  2QC8 A;  1TS2 A;  2MBH A;  1JWB D;  4MDK E;  2OJW A;  4KKI A;  4HWI B;  1T5X D;  4WWN A;  4CHK A;  1WMH A;  3OLM D;  3L16 A;  5C23 A;  1TZO A;  1N60 A;  3OJ3 A;  3WCQ A;  1PQS A;  1LQB A;  4IC7 B;  1YD8 U;  3RCZ A;  4LDT D;  3SR6 A;  1EWC A;  2NBV B;  1IGC A;  2L7R A;  2XK5 A;  2ACZ B;  1XF5 L;  3T3O A;  4AWJ A;  3NVW A;  2AQ1 B;  1TKG A;  1WIA A;  1KTK A;  2M19 A;  1RRB A;  2MW5 A;  3DQV A;  4HJK A;  2M4N A;  3RNG C;  4HEA 1;  3AE7 B;  1XCT L;  2GB1 A;  2NBW B;  4H2A A;  4J3O D;  1SF0 A;  3A1Q A;  1K53 A;  4MAC A;  5IP4 D;  2K39 A;  1AYF A;  4W9C A;  2FUG 1;  3AE4 B;  1IPG A;  3I9V 1;  5T8I A;  4PYZ A;  2YLM A;  4DHZ B;  2D5G A;  3I3T B;  3V3X A;  2ZCC A;  4IKG A;  1J7B A;  3KVF B;  3LB8 C;  2Y5B B;  2LXA A;  2WYQ A;  2DNF A;  3RNF C;  1E7V A;  4MJS B;  3ZVV A;  1HTQ A;  3JSV B;  2LJ5 A;  1VJK A;  4HVB A;  1E9M A;  2O2V A;  2JYE A;  3TEW A;  2JPH A;  4I6N B;  4MH8 A;  4O1N A;  1WGR A;  2ZW1 A;  3B0A A;  1UH6 A;  2WXR A;  4URK A;  1TJE A;  5FR6 A;  3HIZ A;  1J8C A;  3TL5 A;  2L3Z A;  1V97 A;  1UUP A;  1ET6 A;  3NHE B;  3L54 A;  4GB9 A;  5IN7 A;  3ZDM C;  1SJE D;  4MGK E;  4ZRP A;  1MPE A;  5KHO A;  3VRB B;  2GI9 A;  5D6J B;  4EZK A;  4LNK A;  5G5H A;  2L0F A;  1JWS D;  5TR5 A;  2K8C A;  4GDK B;  3W5V B;  3TJP A;  1NI2 A;  4MSQ B;  1YN3 A;  4B6W A;  3ZTC A;  4XE0 A;  3Q8A A;  1SJH D;  1HXY D;  4NZL B;  1WWT A;  4G50 A;  4RGO S;  2QSD A;  3EC8 A;  3PLV A;  3KYC D;  4L2Y A;  1JW9 D;  1S1Q B;  1WY8 A;  1XEE A;  1V8C A;  2WDR B;  1FNV A;  2ZNV C;  2BTE A;  1KLU D;  3IT6 B;  4HKZ E;  2J4X A;  3SEB A;  5L95 C;  3R2T A;  4C7Y A;  4HDQ A;  2KTF A;  4JWS C;  1AW7 A;  1L4Z B;  4WWP A;  3QCA A;  5GMV A;  3W1S C;  1CZP A;  4DK5 A;  3VRA B;  2R2Q A;  2M0X A;  4NJC A;  3SU8 X;  3AH7 A;  1WR1 A;  2PVG C;  3AEB B;  2GBM A;  3ZLZ A;  2N7J A;  1UD7 A;  1P1A A;  4AJW A;  1ACC A;  4WJO A;  1T0Q C;  3PRM B;  2X8X X;  3APD A;  3U30 A;  2KAN A;  2LGI A;  4PS3 A;  1KLG D;  2JX5 A;  3PSE B;  1ZPS A;  3EFU A;  3RT3 B;  4TQ1 A;  3V6E B;  1WFY A;  4OZC A;  1GG3 A;  3PTF C;  2VRR B;  4USA A;  1C78 A;  1WX8 A;  2KD0 A;  2M56 B;  1I4P A;  3NS8 A;  3RFZ B;  4M8M A;  3GS2 A;  1IYF A;  3NG0 A;  2KQ7 A;  1WJ4 A;  4BBN C;  4IM3 A;  1ZDV A;  3HM3 A;  2D11 A;  3B08 A;  1KF6 B;  4JL9 A;  4KGS A;  3ZRF A;  4AP4 C;  4MH0 E;  4TV3 A;  2W54 A;  2ZVN A;  3ALB A;  1V9J A;  2WXN A;  2I38 A;  1YIW A;  2KJR A;  2GRI A;  1WZ0 A;  2A5U A;  5G5G A;  1T0R C;  2WX0 A;  1ROE A;  1D3Z A;  4KIK A;  3L17 A;  4LCD E;  3N32 A;  4XDD A;  3E56 A;  1FNW A;  1WJN A;  3KUC B;  1T6B X;  4OZB A;  4US8 A;  2BPS A;  3Q3N C;  1YJJ A;  3ZNG C;  1H8C A;  3J9C A;  1I4Q A;  2LFI A;  1RM6 C;  1OFF A;  4BKS A;  1P7E A;  3Q3F A;  4JQW C;  4DHZ E;  1WGH A;  1EU4 A;  2BYV E;  2V4L A;  2KC1 A;  4G3X B;  3KH0 A;  1RYJ A;  1IUE A;  2IGD A;  5IAA C;  3VUW A;  3ONS A;  3L08 A;  4JX1 C;  5JHB A;  4FJV B;  4TQ0 A;  1F1H A;  2JU6 X;  1YN4 A;  2WXJ A;  3DBR B;  3NVY A;  4BKT A;  4YWG G;  1P7F A;  3DWM A;  3VHT C;  1KH0 A;  2CHZ A;  4II3 B;  3EHV A;  1UGM A;  1XLQ A;  5HKH A;  1TKY A;  3ZKJ C;  2LRW A;  3ENE A;  2IYD B;  2VZK B;  1UGJ A;  3DVN V;  2JF5 A;  1WXQ A;  3EGR A;  4P6V F;  4ASW C;  2MHJ A;  2OHF A;  2BB5 A;  1EO6 A;  4MM3 B;  4MSM B;  2WS3 B;  2UWQ A;  1E5W A;  5JH5 C;  3ECI A;  4NQL B;  3TEY A;  2BS3 B;  4LLG M;  4MGY E;  2WU5 B;  4PYU A;  1WH3 A;  1L4D B;  3W9C B;  2O6V A;  2PKO A;  3RUI B;  2ZJD A;  2WU2 B;  2XBB C;  5CHW A;  1V81 A;  2KZR A;  4K1R B;  3R7Q A;  4IWQ A;  3DVG Y;  1L0X B;  1WMH B;  3P2B A;  1TTN A;  4KGR A;  2HJ8 A;  5BMH A;  2CHW A;  4LNN A;  1JWM D;  1M4V A;  4HCN B;  2V0G A;  3P4P B;  3P4Q B;  1VZ8 A;  1GAQ B;  5EE9 A;  3AXC A;  3D32 A;  1GUA B;  1UWX A;  2ICI A;  5BYR A;  1WM3 A;  4JE3 B;  3BIN A;  2C7H A;  2AL6 A;  2LGY A;  1ZDX A;  4DWF A;  2WXH A;  5CX3 A;  3K9O B;  3R66 C;  4BKG A;  3BK2 A;  3P1M A;  2LVQ A;  2K6Q A;  1I7H A;  2MQJ A;  2MWS B;  2KAC A;  4W9F A;  1WXA A;  2YEP B;  2LI5 A;  3HVZ A;  2L1A A;  3NVV A;  2MRP A;  3VAW A;  3DHI C;  3MFG A;  2WXK A;  1RFA A;  1HZ6 A;  2FID A;  2ZNV B;  3I5J C;  1UF0 A;  2INP E;  4GMV A;  2KK8 A;  1UWM A;  2JZP A;  3Q3O C;  3BII D;  1WGD A;  3IAS 1;  4GXB A;  4DHJ B;  1WXV A;  3DBL B;  5C1Z A;  2D07 B;  2FCQ A;  2DLB A;  4A90 A;  4JIO U;  1QT9 A;  4RGT A;  1MG8 A;  2N7E A;  4IM0 A;  5H8Y E;  2ZEQ A;  2DHZ A;  2MSE D;  1N61 A;  2O2V B;  1WR6 E;  2LGX A;  4HPP A;  1WI0 A;  4BZA A;  4XDC A;  1ZW7 A;  4X57 B;  1XO3 A;  3L4P A;  1QQR A;  2KQ4 X;  1OEY A;  1D5X C;  4HPM B;  3AE1 B;  4YSY B;  4K7S A;  2IY1 B;  4DQO C;  2KX3 A;  2R2O A;  3JVZ X;  3SDL C;  4US9 A;  1FNU A;  1IBX A;  3SFD B;  3H7P A;  2XNA C;  3ZJU A;  2WGS A;  3IFW B;  2KMC A;  4RCO A;  4ICU A;  2BS4 B;  1TIF A;  3ZUN A;  1SSN A;  2LHE A;  2BVC A;  1JWA D;  2JXX A;  4BBN F;  1YX6 B;  1QOF A;  2FCN A;  1MVK A;  3QAQ A;  4KZC A;  4EFO A;  4A9A A;  4PT5 A;  4B0E A;  3ABV B;  4A55 A;  3H1U A;  3MC9 A;  1WXM A;  1RWS A;  3RNA C;  3ZGZ A;  2INC C;  2CJO A;  2KHW B;  2GBJ A;  2Z0E B;  2NBU A;  3GZN B;  1QZE A;  3U4E G;  2G1E A;  4M0W A;  4HXD A;  3RI7 C;  5FR3 A;  3A9K B;  1K51 A;  4XZ4 A;  4XYC A;  4RM9 A;  2VH2 A;  4F8C B;  2LHD A;  4C7Z A;  1MG4 A;  4IWO A;  4KGT A;  2JQR B;  5C3J B;  3R2I A;  1JQ4 A;  1EM7 A;  2BT6 A;  4AOF A;  2IY0 B;  2NS5 A;  1QOA A;  1V86 A;  3DVG X;  2WLB A;  3JW0 X;  3RZF A;  2PW9 A;  2KN4 A;  4NAW A;  1Y8R C;  1OQY A;  5EE3 A;  5J18 A;  3KUZ A; 
#chains in the Genus database with same CATH homology
 2N1W A;  2G4D B;  4HPL B;  3NHE B;  3L54 A;  1GNU A;  3PZD A;  4GB9 A;  2M17 A;  1V5O A;  2ZPY A;  3DOW A;  3ZDM C;  2UYZ B;  4W9G A;  1FXT B;  4FBJ B;  2DX5 B;  2DYM A;  4MGK E;  3UIO B;  3ZNH B;  4KSK C;  5D7G A;  2KLC A;  2HTH A;  4II2 B;  2AL3 A;  5KHO A;  3CST A;  3MTN B;  4ZRJ A;  5D6J B;  4EZK A;  3M95 A;  3RZW C;  3A4R A;  4ANX A;  2L05 A;  2L0F A;  1XT9 B;  1WM2 A;  4HDO A;  4JGH B;  4CYE A;  2IBI B;  2G4S A;  3PVL A;  4PS8 A;  2DZM A;  5TR5 A;  1KLV A;  2K8C A;  4GDK B;  3L13 A;  1NI2 A;  1V80 A;  3TJP A;  2MP2 B;  2QHO A;  4MSQ B;  2C7N B;  4B6W A;  1VCB A;  3ZTC A;  4WQO B;  4G0N B;  3NY5 A;  1SE9 A;  4ICV A;  2KJ6 A;  4WWO A;  4MEL A;  2L00 B;  3M62 B;  2L76 A;  1M94 A;  2MA9 B;  2WX1 A;  3KYD D;  1OTR B;  2RGF A;  4G50 A;  4DDI D;  3EC8 A;  3PLV A;  3KYC D;  3U8Z A;  1OGW A;  2LVO A;  1UEL A;  1E7U A;  1Q0W B;  3ML8 A;  1S1Q B;  1WY8 A;  3CSF A;  3QIJ A;  3WAL A;  2KTR A;  4EZL A;  2GOW A;  2BYE A;  3H9D A;  1R4M I;  3OJ4 B;  2G45 B;  4GIV A;  2CKH B;  2ZNV C;  3CF6 E;  3DBL I;  4W9L A;  4F7Z A;  1I35 A;  2KFK A;  3RUL A;  1WJU A;  1Z5S B;  3N3K B;  3SHQ A;  4GDL A;  5L95 C;  2IZV B;  4MEM A;  3TCA A;  1K8R B;  2CHX A;  3AUL A;  4HDQ A;  1J0G A;  3UIN B;  1KJT A;  2DEN B;  2KTF A;  4WWP A;  1WJ6 A;  2IO2 B;  3QCA A;  4IWP A;  4NNJ B;  5GMV A;  3UIP B;  3W1S C;  4DK5 A;  2R2Q A;  2DZI A;  2M0X A;  4KZ0 A;  3SU8 X;  3JYU A;  1P0R A;  2C5L C;  3CMM B;  5EDS A;  1WR1 A;  3M3J A;  2GBM A;  3ZLZ A;  1V5T A;  1UD7 A;  1T0Y A;  3VDZ A;  3VTV A;  3N30 A;  1P1A A;  4AJW A;  3PS6 A;  2KWC A;  3A9J A;  4WJO A;  2O6V D;  3PRM B;  2PE9 A;  3APD A;  3U30 A;  2KAN A;  2JZ3 B;  3R3M A;  2REX A;  4PS3 A;  3RD2 A;  4EUT A;  4PS7 A;  3PSE B;  5IA7 A;  2KDE B;  2C60 A;  3O65 B;  2M8S A;  2BWF A;  3PT2 B;  5AZF A;  3ZRC A;  3EFU A;  3RT3 B;  2A4Z A;  4TQ1 A;  2I1J A;  2J0J A;  4K7W A;  3V6E B;  1WFY A;  2B3A A;  3UGB B;  1GG3 A;  3PTF C;  4IM2 A;  3T9L A;  2VRR B;  4EKU A;  3H6N A;  3PLU A;  1WX8 A;  2KD0 A;  2HE7 A;  5DPT A;  2KJH B;  2MX2 A;  2ZZP B;  2MP2 A;  2KX0 A;  1U4A A;  3QX1 A;  3NS8 A;  4JLC A;  1V2Y A;  4M8M A;  2GBK A;  2IO3 B;  3T8M A;  3X0W A;  1WF9 A;  3A33 B;  2KTR B;  4GGQ A;  2NVU I;  3WAN A;  3IHP C;  2EMT A;  2LGD A;  1IYF A;  2KQ7 A;  2FNJ B;  2CR5 A;  2NPT A;  4FA6 A;  1WJ4 A;  3VVW B;  3WAO A;  4BBN C;  4IM3 A;  1L7Y A;  2KFK B;  4OVV A;  3TMP B;  3HM3 A;  2BKR B;  5CHF A;  4K7U A;  2D11 A;  3B08 A;  4JL9 A;  2KO3 A;  3PV1 A;  4FUL A;  1TZ1 A;  3DPD A;  3HK0 A;  4GU2 A;  4M8N A;  4W9E A;  5AZG A;  5LXI B;  2HD5 B;  3QA8 A;  3ZRF A;  4AP4 C;  3LJ3 A;  3PRZ A;  4XX5 A;  4MH0 E;  3ZNZ B;  4TV3 A;  1KOT A;  3V6C B;  2N7D A;  1SIF A;  1NBF C;  2ZVN A;  4WJQ A;  3ALB A;  1E90 A;  1V9J A;  3H7S A;  2DYO A;  1YIW A;  1Q5W B;  2KJR A;  3GZN I;  3VQI A;  2AWT A;  3UQA A;  2PJH A;  3A9J B;  1WZ0 A;  2A5U A;  5J2R A;  1V49 A;  4EEW A;  2KMA A;  4J6I A;  2LD9 A;  5AZH A;  2I1K A;  3WA0 A;  2RR9 A;  2WX0 A;  2LXC A;  2FCM A;  2N9P C;  1D3Z A;  1L2N A;  4KIK A;  3L17 A;  4LCD E;  4N9F 4;  3N32 A;  3ZW3 A;  2O6V B;  2J0M A;  3PRE A;  4BKS D;  3OAW A;  1WJN A;  1WXS A;  3KUC B;  3S2A A;  1E8Y A;  3UF8 A;  1NDD A;  2BPS A;  5DPR A;  3ZNG C;  1H8C A;  4HCP B;  4RM8 A;  2JT4 B;  4BKS A;  2NCN A;  3Q3F A;  2KC2 A;  5JHA A;  2FAZ A;  2N1V A;  4GOC A;  2JY6 A;  4JQW C;  4DHZ E;  3VTU A;  1WGY A;  2D3G A;  4NPN A;  1WGH A;  4WAA A;  4FHK A;  2ZVO A;  2NPT B;  2BYV E;  2V4L A;  4A20 A;  2RPQ A;  2KC1 A;  3HHM A;  3ZTD A;  4G3X B;  3KH0 A;  1HE8 A;  4KDL B;  4P7I A;  1EF5 A;  1YQB A;  1S3S G;  2D10 A;  3DBH I;  1P3Q U;  2DZK A;  3PRP B;  4LJO B;  5IAA C;  3ONS A;  3DCG A;  3L08 A;  3VUW A;  4BOZ B;  4FJV B;  4TQ0 A;  4ZDV A;  4OVU A;  1G6J A;  2PPH A;  3L10 B;  2K25 A;  5DCN A;  4BKT A;  2KWU B;  1WYW B;  2GMI C;  2DZJ A;  3V61 A;  4W9H A;  2JVC A;  5LLI A;  1BT0 A;  3Q3J A;  3VUY A;  3ZDT A;  2NR2 A;  1ZKH A;  3VHT C;  1C3T A;  2CHZ A;  4II3 B;  2L0T A;  3EHV A;  1UGM A;  4WJN A;  5HKH A;  2C7M B;  3ZKJ C;  4B95 A;  2LRW A;  3ENE A;  4NY0 A;  2IYD B;  3QC8 B;  3VTW A;  4XC2 A;  2DAF A;  3DVN V;  4FJZ A;  2JF5 A;  4GSW A;  3TIX A;  5CHV C;  1WRD B;  4KIK B;  4ASW C;  5L83 A;  3QAR A;  4BFR A;  2EKE C;  2MBO A;  1EO6 A;  1CMX B;  1GC6 A;  4MSM B;  1E8Z A;  5E6N A;  2LWP A;  2UWQ A;  1E5W A;  2C9W B;  5JH5 C;  3AI5 A;  3ECI A;  1KM7 A;  4NQL B;  4MGY E;  3W1Y A;  2LUE A;  2MBQ A;  4PYU A;  5D94 A;  1WH3 A;  4K81 A;  2OOB B;  4KV2 A;  4W9K A;  1P9D U;  1JRU A;  5CTR C;  2O6V A;  3RUI B;  3LDZ E;  2WDT B;  2ZJD A;  5G2N A;  4DDG D;  3NOB A;  2XBB C;  3VFK A;  1E8W A;  2RD0 A;  4IW0 A;  1RLF A;  2EMS A;  2ASQ A;  5CHW A;  1V81 A;  4BOS C;  4HLE A;  1AAR A;  4DHJ D;  2KZR A;  4K1R B;  3UQB A;  3R7Q A;  4IWQ A;  3DVG Y;  4TKN A;  2K1F A;  3V62 A;  1WMH B;  3PGE A;  4NJ7 A;  4A3P A;  4FJY A;  3P2B A;  1TTN A;  2LZ6 A;  2HJ8 A;  4HK2 A;  2CHW A;  5DPW A;  1ZGU B;  3APF A;  2GBN A;  2KN5 A;  3QHT A;  3W1S A;  4HCN B;  2WWZ A;  2MBB B;  1GJZ A;  1OEY J;  3RYT A;  2BKF A;  3IG3 A;  3AXC A;  2BWE S;  1I42 A;  1WE6 A;  3DDC B;  3PPA A;  3D32 A;  2AEH A;  1GUA B;  3MJW A;  2N4F A;  4W9J A;  1WGG A;  3NZU A;  4BVU C;  2KFJ A;  3ZO5 B;  3EEC A;  1WM3 A;  3BIN A;  2C7H A;  2AL6 A;  2LGY A;  2PEA A;  5E6P A;  1IP9 A;  4DWF A;  2JRH A;  2BGF A;  5CX3 A;  4MGZ E;  3K9O B;  3R66 C;  2KDI A;  2D2Q A;  3QWZ B;  4TUU A;  2AYO B;  4FN2 A;  1TGZ B;  2V1Y A;  4BKG A;  3AU5 A;  3R7R A;  2W9N A;  3MHS D;  1WE7 A;  3BY4 B;  2LVQ A;  3DBS A;  3WIM A;  2KKC A;  1P98 A;  2K6Q A;  2N9X A;  2MQJ A;  2MWS B;  3DVN U;  3H7P B;  1WXA A;  3PHW B;  4NQK E;  4W9F A;  2LI5 A;  3VXW A;  4AJY B;  1Q1O A;  2J0K A;  4I6L B;  2MRP A;  2MBE A;  4EOY A;  4ZYN A;  3VAW A;  2L8J A;  3V60 A;  3IBE A;  2JZZ A;  1R4N I;  3M63 B;  2M1M A;  4A3O A;  5AEK B;  1YX5 B;  2KVR A;  2KLG A;  4E71 A;  1RFA A;  4MM3 A;  4ANV A;  2FID A;  4AUQ C;  3VH3 B;  2IO0 B;  2FCS A;  2LAS A;  2KDF B;  2ZNV B;  1J19 A;  5LXH A;  1WX9 A;  4GMV A;  2KK8 A;  2K8B A;  2MBH A;  4MDK E;  1LFD A;  4RMA A;  1E8X A;  1WGD A;  1F9J A;  3QK0 A;  4GXB A;  4DHJ B;  3APC A;  1WXV A;  5C1Z A;  4HWI B;  3HM6 X;  2V3S A;  1UBQ A;  2D07 B;  3VH4 B;  2FCQ A;  4WWN A;  4FLH A;  4JIO U;  4CHK A;  2CS4 A;  3K9P B;  4FHJ A;  1WMH A;  3QQ8 B;  3OLM D;  4MGI E;  2JUO A;  3L16 A;  1MG8 A;  2KQS A;  2J7Q B;  3QJZ A;  2N7E A;  4IM0 A;  1V6E A;  5C23 A;  3B1L X;  2KDB A;  2KWV B;  2ZEQ A;  3OJ3 A;  4M0W B;  2DHZ A;  1PQS A;  1LQB A;  2MSE D;  2O2V B;  2PE6 B;  1WR6 E;  2LGX A;  4IC7 B;  1YD8 U;  3KW5 B;  3RCZ A;  1SGH A;  3ZNI D;  4WJP A;  1ISN A;  4LDT D;  1WI0 A;  4MJS A;  5G55 A;  5DPS A;  1ZW7 A;  2KOX A;  4X57 B;  4I6P A;  4NJ6 A;  2IO1 B;  4B9K A;  3JSV A;  2NBV B;  2BF8 B;  2L7R A;  2XK5 A;  3ML9 A;  4W9D A;  2Z59 B;  3A9K A;  1OEY A;  4E3C A;  4HPM B;  4AWJ A;  1LM8 B;  1LXD A;  4K7S A;  2IY1 B;  1WIA A;  2KX3 A;  2R2O A;  4DBG A;  2BYF A;  3JVZ X;  3SDL C;  2MCN B;  4NAW B;  2FIF A;  1RRB A;  2OJR A;  2MW5 A;  3DQV A;  4HJK A;  2M4N A;  4CO7 A;  3H7P A;  1Z2M A;  1EUV B;  4LJP B;  2ZCB A;  3IFW B;  5JZE B;  2KMC A;  2NBW B;  5JHB A;  1X1M A;  2KXJ A;  3AU4 A;  2YVC A;  4ICU A;  2JWZ A;  3PHX B;  3A1Q A;  3DBR I;  4G11 A;  1GC7 A;  3ZUN A;  4IUM B;  3U7D A;  2GBR A;  2K39 A;  4W9C A;  4KSL C;  2RSU A;  5D2M B;  1IPG A;  4EZJ A;  3WAP A;  2LVP A;  4ANW A;  3C0R B;  3GOE A;  1WX7 A;  2JXX A;  2Z0D B;  4PYZ A;  2YLM A;  2K8H A;  3I3T B;  4DHZ B;  2CU1 A;  4BBN F;  3WAM A;  4ANU A;  1UBI A;  1YX6 B;  4FAD A;  2FCN A;  2ZCC A;  3SD5 A;  5BO4 B;  3QAQ A;  4KZC A;  3KVF B;  4EFO A;  2Y5B B;  1YJ1 A;  3X23 A;  2LXA A;  2WYQ A;  4W9I A;  2LRU A;  3H1U A;  3TBL D;  1XQQ A;  2K6D B;  1WXM A;  1E7V A;  4MJS B;  4DXA B;  1A5R A;  3NZS A;  2KHW B;  2GBJ A;  2Z0E B;  3ZVV A;  2NBU A;  4KDI C;  4KVG B;  1QZE A;  2XEW A;  3JSV B;  1XD3 B;  2LJ5 A;  1EF1 A;  1TBE A;  2XK5 B;  2KNB A;  2ZPN A;  4HVB A;  4LDT B;  4ZRK A;  4HXD A;  4YL8 A;  4GDK A;  3A9K B;  1C1Y B;  2O2V A;  4RM9 A;  4XZ4 A;  5KHQ A;  4F8C B;  4E74 A;  4IWO A;  1WZ3 A;  2JPH A;  4I6N B;  3VUX A;  3ZIM A;  2FUH B;  5E6O A;  4F1S A;  2G3Q B;  1H4R A;  1UZX B;  1WGR A;  3KUD B;  2IY0 B;  4GDL B;  4AOF A;  2NS5 A;  2MLB A;  1V86 A;  2DYB A;  2N9E B;  3DVG X;  3B0A A;  4GN1 A;  1RAX A;  1UH6 A;  3JW0 X;  3RZF A;  1VD2 A;  4URK A;  4NAW A;  1Y8R C;  1OQY A;  3A1Q B;  4IG7 B;  5FR6 A;  3L0W B;  2DAJ A;  3HIZ A;  1J8C A;  2JRI B;  3A4S C;  3TL5 A;  2L3Z A;  3IVF A;  5J18 A;  4ZRI A;  5J17 A;  3KUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...