5D3IB

Crystal structure of the ssl3-tlr2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
KYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 2
publication title Structural basis for inhibition of TLR2 by staphylococcal superantigen-like protein 3 (SSL3).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
B PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d3iB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5d3iB01
1ESFA 1JWUD 4L63B 3SEBA 1XTCD 1EEID 1PRTF 1UUPA 1TS2A 1B1ZA 5FK9C 1D5ZC 1D5MC 3DWPA 1JQYD 1I4PA 3W2DA 2QEJC 2J4XA 1LTTD 1LTRD 1FNVA 3MC0B 4L6TB 1JWSD 1V1PA 1RD9D 4ZYSA 1TS5A 1CHQD 1RCVD 3GP7A 1SBBB 4DXFA 5FKAC 1RF2D 1FD7D 1LLRD 3BVGA 1ET9A 3R2TA 1I4HA 1PTOB 1LT3D 2SEBD 1PRTB 1T5XD 1EU3A 2NTTA 1I4QA 2AQ2B 4RHSA 1SJHD 4RGMA 5ELCA 3BYTB 2IPKD 1BCPD 1D5XC 1HTLD 1EFID 3EA6A 5I4DA 1BXTA 2G9HD 4RGNA 1TY2A 1TS3A 1V1OA 2AQ3B 4O1NA 1BCPC 3BYYB 4RCOA 1MD2D 3OWEB 3KLSX 4TSSA 1S5CD 1JWMD 3R8BA 1S5DD 1LT4D 1YN4A 4NZLB 1QILA 1BCPF 4Z9CB 2XNAC 1G8ZD 1D6EC 1I4GA 1LTGD 1HA5A 2XRQD 1HQRD 1ENFA 3TSSA 2Z8LA 1LT5D 1XXGA 4K6LA 1JR0D 1LTBD 1AW7A 2AQ1B 1UNSA 2RDHA 2CHBD 3O13A 4RH6A 4RHRA 1V1PB 1I4RA 1L0YB 3MFGA 1CQVA 1LTID 1PZID 1I4XA 3DWAA 1LTAD 1SE3A 3URYA 5ELEA 1SJED 1LTSD 3EFXD 2QILA 1CHPD 1PTOD 2XRSD 1PZJD 2WV6D 1GOZA 1CK1A 1PTOC 1KTKA 5ELBA 1PRTC 1PZKD 1F77A 1EEFD 1ET6A 1S5BD 1HXYD 1FGBD 4OHJA 2R61A 2NTSA 1KLUD 3R2IA 2IJ0A 5ELFA 3CHBD 1RDPD 1SXTA 1AN8A 1STEA 1PYWD 2XN9C 3BVZA 5D3IB 1YN3A 1S5FD 4BWGB 1YN5A 1B44D 1DYQA 1KLGD 4C56C 1FNWA 1BCPB 1FNUA 1PTOH 3DWQA 1EU4A 3BVMA 4RGOS 1M4VA 2TSSA 4DXGA 1SE2A 5D3DA 1SE4A 2RDGA 3BZDB 1LO5D 2O2LD 4RFBA 1SEBD 1PRTD 1CT1D 4UDUC 1DJRD 3V05A 1JCKB 1LT6D 1S5ED 1EWCA 1TS4A 2ICIA 5ELDA 5TSSA 4RGTA 1L0XB 1TY0A 1PTOF
chains in the Genus database with same CATH superfamily
1MJEA 3CRLC 3IXSA 4KN7C 4WAFA 4CHTB 2VZAA 1SNCA 1YX5B 4IJHA 1B9MA 4IZ8A 4BAXA 4B08A 1K0RA 5JEAJ 1FRRA 1HZCA 1NBWA 1QUQB 3L0OA 2Z59B 3O65B 2LFNA 3M7GA 2FXQA 3HOUB 1N5XA 1A3TA 4JI2L 1SBBB 2B63B 5FKAC 1RF2D 1LLRD 4L2YA 3G7LA 1EQVA 4X66L 2OTJA 3VFKA 5AUKA 3DCGA 1K51A 1LT3D 2CH4W 1C4PA 1T5XD 1BKBA 2HIVA 2L4NA 1WGDA 4MSMB 1OEYA 4RNAA 3UGBB 1E0BA 3ZRCA 3DBLB 4QIWE 3FEWX 2WP9B 2RA4A 4U68A 1IXRA 1EY8A 1GD7A 1H9KA 4DGZA 1XNQQ 3VR3A 2EXZA 1FJGL 1BQQT 2VUMB 3U58A 4ILWA 3VYUA 2Y5CA 2LASA 4YXDB 2D3CA 4LNFA 1HNXL 1VQGA 3K5NA 2MBQA 1AEXA 2K8HA 2ZNVB 2BGFA 2EPBA 2WXQA 1B9RA 1B3AA 1QLBB 2X8XX 4LFBQ 3KJOA 1K52A 1I4GA 1KDBA 4BY7G 3H1UA 3W1YA 4DR1L 5C1ZA 2F0HA 4HMJA 3HGBA 3E5SA 1S40A 1K73C 2Q2TA 2YLMA 4HDOA 2RHSB 2J0KA 3TN2A 1B70B 4RG1A 4M00A 4JWSC 4P2CB 3QA8A 2K03A 3O13A 1VQMA 4BOSC 4YHHL 2IX0A 5G55A 4GNXC 2CKZB 4OO1H 4DNIA 2MJ8A 1NDDA 3NQIA 1ZXHA 3PIO3 2OF1A 4B3SL 2PZUA 2KENA 1L4ZB 2IYDB 1I4XA 2MJ3A 5DPWA 4GU2A 3DEPA 1VQ4A 1VQBA 4F8CB 1RRBA 4N9F4 4W9FA 1WYDA 4AYBG 3S1MH 3CCSA 1K53A 1XCQL 2MGSA 1R4PB 2JY6A 4BBSG 2L00B 2LHEA 3EJIA 2WWZA 2PQAB 3KQ4A 1XEEA 2KT7A 3R66C 4OHJA 3D4WA 3NBHB 4A3BB 5BN4A 4A4IA 3HRZC 2IO2B 1EL0A 3C8YA 2F0MA 3GQBA 5JJLA 4N58A 1TZ1A 2LGXA 1TVXA 2Z1CA 2F0DA 2I38A 5GXGB 2KVRA 2BA0A 2F0KA 2IDYA 3PUWA 4A3LG 5EKLA 1TU2B 1SE2A 4GN3B 3SVMA 4KDIC 1SMYD 2WAQG 2ICEC 5KYIA 3GTLB 3P4SB 3I63C 1LO5D 5G3LD 4DV2Q 2KX3A 5HFYA 4TRDA 1S5ED 2MO1A 2OT2A 3A5ZB 1U4AA 4HWIB 5JEAH 2K8CA 4JLCA 5IAAC 1SAPA 3RYTA 2QA4A 5CV6A 2EYOA 4QUCA 3VDZA 1HJPA 1XYIA 3LDZE 5BR8Q 2HIXA 2KJRA 2BH2A 1KRHA 1OQYA 3MJ5A 1YHQA 4MELA 4XDDA 1DD2A 3VUYA 3H0GB 1EEID 4YSYB 3SK5A 3SK6A 4OO1I 2EYMA 3KUPA 1VMCA 4XYQA 5C6AA 2NN6H 1FXAA 3S24A 3CCMA 3W5UB 5AEKB 1JQYD 4ZRPA 5D7GA 3OG5A 4MEMA 2BE5D 4DAYA 3NEMA 1I6VC 3T13A 3K5LA 3QJZA 4FA6A 3CW2C 2PE9A 4A3MH 1MG4A 4IWOA 4HR7B 4YCWA 3HOYG 4GN4B 1ZP0B 2HDMA 2KDBA 1FD6A 3N32A 1YNJC 1M90C 3R3OA 2L0TA 1H4RA 3VR4A 1HNWL 1S3OA 1E9MA 3E0JA 4FADA 3ZNZB 3NUCA 2NVQB 1L5PA 2D3GA 2NVUI 3SHQA 3ZGZA 3VRBB 3BYTB 3VYRA 4X65Q 2KYWA 1TKWB 1BCPD 1EIGA 3M7NA 2KNBA 2XK5A 1K8MA 4LFCL 4HLEA 1N34Q 3M4QA 4K5XA 4UP9A 2K75A 1HNZL 2IO3B 3QCAA 3Q8EA 2FINB 2DZKA 2WXJA 4KD4A 5CX3A 1J6QA 2VL6A 3ULLA 3A9JB 4M01A 4XWTA 1LT4D 4QJFA 3HOXH 4A3IH 3QWNA 1U4PA 1TWHB 4JC0A 2O6VA 5M5YH 1UH6A 4PYUA 1IW7C 1VR9A 1C78A 2M4NA 4QUFA 4R8IA 1EF5A 4KDLB 1HQRD 3A8IE 1HPCA 3VDYA 3S16B 1MHHE 4E6IA 4Q2JA 1HH2P 3DXJC 1A3UA 1B9NA 4WJWA 3U52E 2A19A 2JN4A 1GVPA 3RD2A 1XPOA 3DVNV 2IO1B 3CCUA 3J81L 4RMAA 3GTQH 3ZJVA 2LKVA 5E4WC 1TWAH 1UGMA 1SJED 3EFXD 2JPHA 4NPSA 2JU6X 2KDEB 3D6CA 2CR5A 3CSTA 5DPTA 1UEAB 2UXCQ 3NQTA 2H5XA 1WH3A 3TIXA 3KDFA 5JVG3 3KFUA 4BOZB 2R61A 3ZDMC 4HIKA 4LF6L 2PKOA 2F3IA 2LRUA 1IKLA 4LF4L 3R93A 1LFDA 2Z6KA 3F2DA 2LJIA 4BBRB 1S5FD 4X62L 2N4FA 4ZK9B 1KLGD 4WJNA 4X64L 1WJUA 3A7AB 1WCMH 1WJNA 4KKJA 4DHJD 1EY7A 1EUJA 1OO9B 4A3CG 3VUWA 3PO2G 2E2IB 2N9PC 3PGEA 4DF7A 1FGUA 4MNOA 4JI1L 2PMZB 2PEAA 1CT1D 1XMQQ 1VQEA 3HOVH 4N6EB 2DGYA 1JCKB 2ACZB 2OQ0A 2QGQA 1TWGB 1TKGA 3L13A 5L95C 1SYDA 2BTEA 5D14A 2F52A 1F9SA 2B2YA 4GOCA 2QW7A 4OWTB 2QDBA 3RMHA 4DV0Q 3RCZA 1HZ9A 1SYEA 1BO0A 2WINB 1VQCA 3UE0A 1QJOA 4Y7NB 2DY7A 1G91A 2KQ4X 1D5ZC 2J0JA 3Q23A 1OXUA 3Q6SA 4S3SA 5IYCG 3Q3OC 2QEJC 4DV6L 4H13C 1FNVA 1H9RA 1OQRA 1PA6A 2F3VA 1V1PA 2EE1A 1Y1WG 1N36Q 4OWWB 4R4QA 1D8LA 3I3TB 1E8WA 1FD7D 2NBUA 2WXIA 3L10B 3R2TA 1TZOA 5DCNA 4M8MA 2GMIC 4HAEA 1X3GA 1CM9A 1TIID 2SEBD 1GG3A 4JX1C 2OTLA 2GI9A 5D2MB 3T3OA 2A5HA 2L9HA 4CKBA 1WE7A 2B3GA 2EKIA 2DNCA 2Z0EB 3I9V1 2IGHA 1SNOA 5J1ZA 2UUCQ 4CYEA 5LHY1 1KAWA 5G3LF 1KM7A 4A3LH 1ZXIA 4C3JB 2EMTA 4FF1A 3EA6A 1FIQA 3GTMB 4K2LA 2MQJA 3KUCB 1KNAA 2LMCB 2HUGA 3OIPA 1H9SA 3ZKJC 3BYYB 2DJFC 1QZGA 3AE7B 3A54A 1SYCA 3HM6X 1GO3E 3IFWB 1NENB 2UUAL 2GA4B 1P1AA 2CS4A 3RLOA 2NYZD 1EOTA 2KTRB 3EFUA 3PZ8A 4XGAB 2WYQA 2OOBB 3T3NA 2FJ2A 4MN3A 3HIZA 1Y8NB 2BOSA 4FF4A 2EMSA 1FRDA 4ANXA 4HJAA 2C5LC 1UEBA 3ONSA 2KACA 1HUMA 1FPYA 5IKCM 2N3SA 4P73A 4WFN3 4KHVA 1C8CA 1EY9A 1V86A 3FKYA 3J7A5 1MPEA 3H7PA 4RF1A 3RMKC 4DXAB 3W9CB 4BY1H 3V6EB 1GXDC 4LF5Q 1T0SC 2MUYA 1B53A 4DN4M 1T3QA 4IC7B 1STYA 1K8AC 4I6PA 2J7ZA 3AI5A 5C3EB 3HKZB 1ENAA 4ZKCB 2JXMB 1RODA 3GS2A 2QSDA 3KWVA 1GOZA 4LUZA 5IY0A 4MH0E 1U5KA 2EYPA 5FO7B 3L54A 4GKJQ 2F0IA 1V80A 1X3PA 3M9BA 1L1OA 2JA8G 4M8AA 1ISNA 1MG8A 1WR6E 3P7JA 4LDTD 2PJHA 1Q86C 4K14A 3TREA 2G4SA 3S15B 5I2XA 1I5FA 5EDSA 5I6YA 4XQNA 1WJ6A 2HCCA 4BFRA 4EZLA 4CQNA 3LB8C 3MJWA 4L5QA 2K7VA 2WHIA 2VQEL 1DXMA 2B63H 1YQBA 1RAXA 1GM5A 3U4ZA 2RHQB 3RNGC 1NR4A 2F4IA 4REZA 2MJDA 5E6PA 5TR5A 1VD2A 2YEPF 3EROA 5DM73 4C4VB 2I07B 4B9KA 2WNMA 4FHKA 1WWTA 1QF6A 1HTQA 4KZCA 2PTLA 3X0WA 2VUMH 2K50A 5J3BA 1GC7A 1XO3A 2WX0A 3IHPC 2EOTA 2PPBC 3PO0A 2ZXOA 4JI0Q 1C9FA 1HZ5A 3SFDB 1TY0A 3SEBA 1OTCA 1N32Q 2K5VA 4JI7Q 4MGYE 2G9DA 3NTIA 4FXCA 1PRTF 1J8CA 1RHPA 5C3JB 4JOIA 2ONQA 5J2RA 1ASZA 2KDFB 1T0YA 4XT3B 5CV4A 2M0AA 3DHGC 2MW5A 4A3DG 4JIOU 1LTRD 4L6TB 3TEXA 1XLPA 2G1EA 1QVFA 4GLVB 4MGIE 4DUYQ 3MA2B 4A3EG 2ZW0A 1EY0A 3RN9C 3APDA 2QEXA 2KKCA 3W1SC 3DEOA 4KVGB 4ZRIA 4OZBA 1GHJA 1VJKA 1EQRA 2WDQB 3B2GA 1JOQA 4YSXB 3AV8A 4B0MA 3RFZB 5M3FG 4W9IA 2A8VA 4A3CH 4OVVA 2HJ1A 3KWLA 4DDGD 3A56A 1P16A 3WANA 3L0WB 3T51B 4ANVA 2E3TA 3TBLD 1WIAA 2M00A 4A9AA 5FJ8G 1XQQA 1X1MA 2D9UA 2G5DA 2DZJA 2CFMA 3NJTA 1IW7D 3PV0A 3HOWB 1A62A 2R92B 2K6DB 4NMZA 5ELOA 3DBLI 1UZXB 3AFPA 1QNUA 4A3BH 4UPAA 5C4XG 3H7SA 2NVTB 4KIKA 2VQFL 3I4NB 3P4PB 1T9HA 3U8ZA 4L5TA 2WXMA 4HPLB 4MACA 1Y14B 5KHOA 4HKZE 4Q5VA 1WTVA 3LJ3A 2B8FA 3KOJA 3J80i 1CFMA 3ZYYX 5E6NA 2MH7A 1HTPA 5KHQA 2INNE 3TEYA 3F2UA 1K28A 1E22A 4P72A 5IYDH 3NK9A 2MBOA 1CQFA 2DUDA 5D6JB 3VQIA 1YJWA 4C3JG 1WM2A 3KF6A 2K22A 2F0LA 3GTGB 3GTLH 1EYCA 1IHZA 1WMHA 2AHOB 2LZ6A 4DA2A 1X54A 2F0FA 3CCVA 1QG7A 1X6OA 2JX5A 2R3ZA 1VQLA 3HEJA 3DWAA 3MHSD 4YCUA 1JICA 3URYA 4XT1B 5AJ3L 1WOCA 4O2DA 1VQ6A 3Q24A 1JRPA 1F1HA 2MP2A 3CMMB 4K3CA 3H0GH 4WIPA 3A8JE 4P16A 1SSOA 3RNCC 5J18A 1STBA 1DOXA 1WTPA 1PH8A 1L0VB 1V81A 2MSED 2KEEA 3F2CA 4GOPC 5JPMC 2PIAA 2NTSA 1ZKHA 1HE8A 2PZTA 2BYVE 3Q3NC 4GMVA 2M17A 2FIDA 4YIJA 4HIMA 2C5CA 3PREA 1EFWA 4DHZE 3STBC 4J15A 4C56C 2XSCA 3H94A 1XT9B 3AEFB 1XLQA 3FKIG 4DV5Q 2L0CA 3CC7A 4RWSC 2GB1A 4OVUA 4JI5L 2WIIB 5C3EG 5LMUL 3Q8AA 3A9KB 3FPPA 4JI8Q 1KJTA 4PZ6A 2KAJA 2KJHB 2NVQH 1F2YA 1D7QA 2PO4A 2K5WA 2QJLA 2NR2A 3QB3A 1KOTA 1C7YA 4KHPQ 1L7YA 4C80A 2K4KA 1M8AA 2H4OA 2A4ZA 4DR6Q 4ZCKA 1QKZA 2QMTA 2KOXA 2YVCA 1NE3A 1WXAA 3DUZA 3ZNHB 3GE8C 2UXDQ 5TSSA 1E1TA 5J39A 2FCMA 4LNKA 4LUVA 5I6WA 2IWHA 2NUCA 4HJ9A 1C76A 2E2HB 1LABA 1LM8B 3PRZA 1GUGA 4L63B 5LLIA 3OOCA 2HHHL 4M0WA 2Y0SB 5E7NA 3K58A 1E2ZA 1JRUA 1TWHH 4ID6A 3QG1A 4MDKE 5A2QL 4WJPA 2WXKA 2RSOA 1WTOA 2L52A 3M85A 1I4PA 4IPDA 1LUZA 3BDOA 3W1GA 5IN7A 3S16H 2NPTA 3APFA 1AWDA 4KGRA 1AP0A 2JYOA 1GUTA 1DM0B 2D0OA 2K01A 2WKDA 1S72A 2AX5A 3RNFC 4H02A 2D11A 2LEKA 3BVGA 1UE6A 3DBHI 1E3PA 1QOGA 2GBNA 4DR4L 2KWVB 4JCVE 1K8OA 3AB5A 4FULA 3UIOB 4R4CA 1F52A 3PGZA 3ERSX 2RKSA 1IGCA 1N9WA 2K8BA 3D31A 1A2TA 3MAQA 3IAM1 4AYBE 4DR3L 3K0YA 1V97A 4AP4C 3CP0A 2N55A 2JA7B 1DGJA 3NS8A 3S14B 4LF8L 1HR0W 4IUVA 1C4AA 4A20A 2QCZA 4US8A 2MWSB 1TGZB 4IW0A 4RA8A 2J52A 5DLQE 2D2QA 2N1VA 1IBKL 4OO1G 1B7YB 2XNAC 3RZWC 3F8TA 1CSPA 4TQUS 4LW1A 1B4OA 4HK2A 1N8RC 2K5HA 3V96A 4IUTA 2E2DC 4W9DA 4BBRH 4K2KA 4YTNB 2L3ZA 4EOYA 2EJGC 2L7RA 3WCQA 4G0NB 3IRBA 4K6LA 4DAYB 5IIFA 2KWCA 5JHAA 2TMPA 1FEHA 4P7IA 2WAQE 2L8JA 4ARCA 4EQOA 2E2IH 2O6VD 1LYLA 2ZTCA 1CI3M 2W55A 4A93B 4ODGA 2K0PA 1V2YA 1AYFA 2M0XA 4WAAA 2KANA 1FFVA 3A4RA 4ARIA 3PMFA 4GKKQ 2L32A 2QDFA 5CHFA 2VW9A 4O0AA 3NBIA 4C2MB 1E1OA 2GBRA 1CZWA 1TWGH 4ASWC 1LTSD 4P74A 1AZPA 3GTPB 1KH0A 3I4NG 4P1CC 4GNXA 3VH3B 1PZJD 4JI3L 2X38A 4XX5A 1FR3A 4YCVA 3I4MB 2B2UC 4A6QA 1K8RB 4JVZA 2AUKA 4Y7NH 1PTOC 1TIFA 1VQ8A 2RPQA 4K5VA 1YVCA 1IPGA 1WM3A 1EEFD 3B6YA 3D8GA 2I0QA 3VAWA 1N33L 3ML9A 5IT9L 3AM9A 3R2IA 4KY7A 4BZAA 1I3QB 2R93B 2MLBA 1J5EL 1STEA 4P1BC 1LQBA 2O6VB 3TMEA 3KUDB 1A70A 3W5VB 3L08A 3I73A 3S9WA 1FNUA 1ASYA 4KSKC 4DK3C 1EQTA 1AARA 3HHMA 1ZW7A 3BVMA 1GUOA 4FJYA 4I6LB 2DWQA 2AL3A 4W9HA 5D3DA 3AEAB 1SE4A 2INPE 2NN6G 1EIFA 4FLHA 2RBMA 2KHIA 2PZWA 2CJNA 3BDCA 2KEDA 1E5WA 1D3ZA 4C3JH 1SIJA 2F0GA 1GC6A 4IO9A 3AU7A 4A3MG 4EEWA 1IBLL 1N60A 4HCSA 4JI2Q 3TBIB 1NY4A 1W6JA 2KXJA 3I5JC 1HQMC 4DV4L 2JWZA 4X66Q 4LNOA 3P2BA 2A6HD 4LLGM 4KX6B 5LNK1 1F9QA 3M62B 1ESFA 4KY6A 3CCJA 2O4XA 4JBJA 4B3RL 2PPHA 3CCEA 2CU3A 3KLSA 2B8GA 3S2DB 1D5MC 5GADC 4EUTA 3K8AA 3QIJA 3AYHB 1DOYA 2AYOB 3SDZA 3WDNA 3KDFB 2GOWA 1FJGQ 2L1AA 1YJJA 2CVRA 4QL5A 1PH3A 3NPPA 5IOCA 4DAVA 4BKGA 2K28A 1HNXQ 3K80C 1IBML 3I8ZA 4NJ7A 2NTTA 1YEZA 2EJMA 4KK7A 4DQOC 1HR0L 2PNHA 4OELB 1UELA 1MGSA 3UIPB 2PI2E 1I94L 1R7SA 2LS01 5CGKA 3ZVVA 3KK7A 5C3EH 4XDCA 4ZUJA 3TQYA 1N61A 1Z9FA 3EQLC 2B2WC 2VB3X 1TS3A 1WYWB 3PIPA 4DUZL 2GLSA 3M63B 2BS4B 2NMQA 1SLJA 2KWDA 3AMUA 1QE6A 2KC1A 3CIRB 3BK1A 1KD1C 1QOFA 3T9LA 1YI2A 4EGVA 4LNQA 3S15H 3DWGC 4B3SQ 1Q12A 1AE3A 1CJEA 2A6EC 4KV6A 1QNKA 3P1MA 3C1EA 3RUZA 5JJZA 2ZEQA 3U30A 4POGA 2LY7A 1IYUA 1AW7A 1XF5L 2HTME 1V1PB 1C4CA 1F0ZA 5GQOA 1HZ6A 3VRAB 1YMHE 4AQ7A 2INCC 3EECA 1ZEQX 2L55A 4X3TA 4MIUA 1UWXA 4LUOA 2A69C 4FVMA 4GDLA 3PSEB 2YTVA 2LGIA 3MC8A 4HDQA 4BKSD 1WCMG 1WFQA 3LXFA 5C23A 4OX9L 2EYFA 4MSQB 4LFAL 4CO7A 1MSHA 2K39A 1Q8IA 1H9SB 2KFJA 1F77A 2DNEA 1FGBD 2GRIA 3N52A 1KHIA 2FBWB 1VQ5A 3STBD 1BBUA 4B6WA 3HOVG 2A73B 1K0SA 1VZ6A 2KVZA 4R3DA 3TEWA 1EF1A 2DBYA 2EJFC 4OVZA 1WD1A 4RGOS 2BYTA 4ANUA 3BWUD 1Q1EA 3E6ZX 2WU2B 4RM9A 4Y52H 5IGBA 3C1FA 2VZKD 2V3PA 3J80L 4QAYA 3RZOB 1EYAA 1Y8RC 1RYJA 3VUXA 2DX5B 4AUQC 1FFUA 2NZ1D 3H7PB 3ZIMA 2WXLA 1EWCA 2BWFA 1L0WA 4K7UA 1Z5SB 3D32A 2C7HA 3U50C 3TDQA 5IGCA 4XDXA 2R92H 3HOWH 1HNWQ 4DV7L 1P7FA 1PUTA 1IBXA 2K9XA 4YTMB 4JG2A 2V3SA 1PV4A 4H2AA 2G45B 3PVLA 5C44B 2NVTH 4LJZC 5I2YA 3I4NH 1BUIC 1UBQA 1L1OB 2YU9B 4QF4A 4BS9A 1XD3B 2KD0A 3M4OB 4NW2A 2L83A 5LL6X 2UYZB 3L16A 4LFCQ 3RT3B 1RD9D 1V43A 1IYJB 3WOEA 1IL8A 1KFYB 1OQQA 4QIWB 1ENCA 1RM6C 2ZXRA 3ZXVA 1ET9A 4DFAA 3U2SC 1YD8U 1G6JA 3I2ZA 3GTGH 5M3MB 3NTKA 3EHVA 4MM3A 4JGHB 2E76C 2RMMA 1EIHA 1CKMA 3D0FA 2BKFA 3QC8B 2DLBA 4B9XA 3ER0A 2ZJDA 4D2KA 1SFOB 1OXSC 5HURA 1NMGA 4HJKA 4LF7L 2X69A 2G9HD 1SNQA 1SR3A 2F0UA 2B39A 2FFKB 1V1OA 2KCTA 3E3XA 3UDIA 1NUCA 2JZ3B 4RCOA 3JSVA 2JZPA 3ZNGC 1C0AA 5DAUA 2N9KA 4A3JB 3GD7A 4F8MA 1PLFA 3EFCA 3J9CA 5BN5A 4EE2A 2SOBA 1RFAA 1FM0D 4QCLA 4BY1G 4ZHOA 1OGWA 3A74A 3AU5A 3WAOA 3L3OC 4A3PA 4X6AH 1YOVB 4OEMB 2NBWB 4B3ML 2RDHA 4JW0A 3SHLA 2AQ1B 1UNSA 1WVLA 1EQQA 4L5RC 1GHKA 3M3JA 2DJGC 1VQHA 5IP7G 1HTOA 1TT5B 2QC8A 4KV2A 1VF7A 1QB5D 3UE1A 3MFGA 3DBRB 2KQ7A 4LF6Q 3AE9B 4F87A 2A1AA 2MFIA 1Q90A 5LXIB 5ELNA 3RUIB 2NWGA 1KDCA 4LF4Q 4EX5A 1Y8OB 2LFIA 3HZXA 4X62Q 5FO9B 2LRWA 4X57B 3HOUG 4W9CA 1YIJA 1QVGA 2QILA 1CHPD 1UWMA 2B63G 2LVPA 4X64Q 1PTOD 2E2HH 1CZGA 3R7QA 3CKIB 2Y5PA 2WXHA 1X3QA 5E6OA 4IQZA 3SE0A 3FILA 4E74A 4JI1Q 4OWXB 3NENA 1STNA 4G7ZC 2JK8A 1PFNA 1XNRL 1R9TB 3DBSA 1U4MA 5T1IA 2VUMG 2XGTA 1WRIA 1YN5A 1JB3A 4KIKB 4DR2L 4R8NA 1FNWA 1BCPB 1G2SA 4DV2L 4MJSB 4F7XA 2AEHA 2NN6I 2V1CC 2RF4A 2RSUA 4PZ8A 2WB1E 3GTKB 1PGXA 1XMOL 3BU2A 4GB9A 3G6EA 3CPFA 1B3QA 4GZYC 3KF6B 4XXEA 1PRTD 2I46A 3U9SA 4DV6Q 2EDGA 4UDUC 1WMHB 2JQRB 3UQBA 1TJEA 2QF7A 2JA7H 1SROA 3S14H 1MHXA 1A5RA 2KJ6A 2KQSA 4AIMA 4FJVB 1QOBA 1P9DU 3HM3A 1JWUD 3N20C 4KLKA 4WURA 4GDKA 2EY5A 5CBEE 1BT0A 2MP2B 4EZKA 4IFDJ 2KDIA 4IUPA 2YEPB 1GB1A 4K8JA 5L37A 3TS0A 4ZQ3A 3MC0B 3ULPA 2JA6B 4KKSA 4OXPA 4C3HB 3PTFC 3DMUA 1RCVD 4O42A 2V4IB 5E4XA 2X6GA 2FNJB 3VTVA 4A93H 1TR5A 5GAHC 3VXWA 1C3TA 5DEHA 1PRTB 3JAME 1KIXA 2OXPA 1EO6A 5IP9G 2UUAQ 4KHZA 3V3XA 1ILQA 2JZZA 3I3CA 1JOKA 1EY5A 1XX8A 4A3BG 1KL9A 2WS3B 1SJHD 3I4LA 3SDLC 1YJIA 5AUIA 4C2MH 3P63A 3W1SA 4J6IA 3QAQA 3GTPH 4JBWA 5EE3A 2A68C 3HVZA 1HFNA 1PGAA 3AXCA 3QARA 3I4MH 4B95A 1WZ3A 2BYEA 5IYDG 4L8JA 5L83A 1SNMA 3SK8A 1L6UA 3GZNB 4DHJB 4X3KA 2A6ED 3CD6A 2OWOA 1G6PA 4A55A 2NBFA 4PMBA 3S1NB 1I3QH 2R93H 1D1IA 2BT6A 2MHVA 1O7IA 2F0WA 4TVAB 1K3RA 2O2VB 1C48A 3C19A 3DLLA 1JE4A 2XRQD 1GUSA 2ZPNA 5BYRA 2M1MA 1SRUA 1Q5WB 5K36H 4LNNA 2KWUB 3FDTA 4DK6C 1JR0D 3AFQA 3T1YL 2NPTB 1ZDVA 4E3CA 4I6NB 4RHRA 1WGKA 1HFGA 3VR2A 3AECB 3H0GG 2WDVB 3R3MA 2WXPA 4NKLA 2KDMA 3ZJYC 1PYBA 4K6DA 1L6VA 2FE8A 4MTKA 4K7SA 4FP5D 1VLBA 2A69D 5FR6A 2BKRB 4HPMB 4HKQA 3JAMc 1Z47A 3MXPA 1NJIC 4A3JG 4C3IB 3OJ4B 4GN1A 1MBYA 2Q8TA 2HT1A 1LGRA 3WIMA 2VQEQ 4CJ1B 4DAMA 1W3SA 1IKMA 3TP7A 3BG3A 2ID0A 1K83B 4K5WA 2J0MA 1P3QU 3OMGA 3G6JB 3QR8A 5KNCA 3S2DH 5C5LA 3TEHB 1S5BD 2R2QA 4K1RB 2I2YA 3LGJA 3RLFA 3K59A 3HVDA 1KAAA 1QWYA 2PI2A 1E90A 5EJWA 1WXMA 3F2BA 3EN2A 1KRSA 2KMCA 4BKSA 4HSVA 4IG7B 2BCOA 2M56B 5EKKA 3KBXA 4GOPA 1GPXA 5ISRA 2WX1A 4NJ6A 4A3OA 1KF6B 1WJ4A 2TSSA 2LUMA 2F0EA 2CH4A 3ALBA 1R4MI 1NEKB 1VQ7A 3PHXB 2RDGA 3CC2A 4RKLA 1T0RC 4RFBA 2X6LA 2CWAA 1LACA 2CWPA 4IFDH 5NUCA 2CKHB 2D5GA 5EAYA 3C0RB 5MPOA 2KHWB 5IP7H 1IL2A 1XTDA 3V05A 1WX7A 3NG0A 1EIYB 5EE0A 1D1KA 2HDLA 1YNTE 3MTNB 1Y8PB 2N0SB 3N3KB 2MX2A 1VQOA 1PTOF 3Q3JA 4FXGC 5IP4D 4GNXB 4ULLA 1B1ZA 2C35B 3J7AF 1YNNC 2W3SA 3HOUH 2BPSA 4DR5L 2F4VL 3UDXA 3AE3B 2RD0A 2V4LA 1XCTL 1WXSA 1HA6A 5GAGC 1J7AA 4KI0A 4G7OC 1I6HB 4N9TA 1AE2A 2C9OA 1A63A 3CQZB 1NI3A 2JF5A 4FO2A 3AB9A 1L2FA 4GLSC 4J1MA 4RMFA 5C4ZA 1PMRA 1Q81C 2KVMA 1MJDA 1MI2A 3HOZB 2J7QB 3AEGB 4NPNA 3Q8DA 1EU3A 3IAS1 4W9EA 1ZYRC 1O7YA 4LDTB 2VQFQ 2L11A 4XIGS 4HJ7A 5H8YE 4MZ9A 2MP1A 3E9SA 4UP8A 2RQXA 2WP8J 3FP9A 2GN5A 2XTIA 4BBRG 4EQ5A 5KYLA 4L5SA 3TMPB 4P71A 3Q22A 1JJCB 5I4DA 1NTGA 2UXBL 2ENBA 2Q2IA 2BS3B 4BXXH 4LTUA 1PH1A 3KLSX 1SGHA 1UGJA 4TSSA 3AEBB 1P98A 1S5CD 4GLXA 3RN2A 2KHSA 3BZCA 4YY3Q 1YNJD 2IBIB 3KUZA 2R7ZB 2DZIA 4IFDI 5JHBA 3NZUA 1HUNA 4J8QA 3GTOB 4NAWA 3D6WA 3CWIA 2DAJA 4RAUC 2CU1A 2I5HA 4JK1C 2BQQA 2E5LL 4CJ2C 5JJIA 2KLGA 2PVOD 4GSWA 5AJ3Q 1JROA 3RNAC 3D3RA 1D4BA 3NVVA 1I50B 2I5LX 3TRZA 1VQPA 4RM8A 3OSOA 2L12A 4U673 3IAYA 4DU9A 3AN1A 2MPMA 4KGSA 1PYSB 3FMCA 1BBXC 1JT8A 2A5UA 2K14A 1RFKA 1VQNA 2HCIA 3RZOH 1CKOA 4NXML 3N1ZC 5EQ0A 2QIEB 3AE1B 2LVQA 1N62A 1PFMA 1FXIA 5IP9H 1W2BA 2R7DA 2RPVA 3BINA 4C7YA 3EBEA 1SMXA 1PGBA 4IOIE 5LMUQ 4JI5Q 2JWUA 2WLBA 3QHTA 3DHHC 2JA9A 2B29A 2IX1A 5C44H 4UAIA 1SYBA 2YU9H 4W9LA 1MFWA 3M4OH 5IODA 1YHAA 1NSNS 1P8LA 2IZVB 3PUZA 4PS7A 1UAPA 3MFYA 2O5JC 1HHVA 2EYLA 2B2UA 1JB7A 1H9MA 2LI5A 1HEZE 4P6VF 1MJCA 1V1QA 1VS0A 1IYFA 4C3IG 1WR1A 2SNSA 4I7AA 3T4AC 5M3MH 2HHHQ 2ZNVC 2H1EA 2LXAA 2F0OA 4LJOB 1CKNA 4C1NI 1B8AA 3K7AB 2XBBC 4MGZE 1VQAA 1SFOH 2W54A 1ZDXA 2D0PA 4JI7L 1YNXA 2R2OA 3G4SA 1GUAB 1V9JA 4N59A 1WI0A 2B2VC 1VQ9A 1PFSA 1T6BX 1PH9A 4A3FB 2UU9L 3DVNU 2DHZA 3SD5A 4GDLB 2ZJQA 2ZXPA 1U4RA 4A3GB 5HHDG 4I7ZC 4A3JH 1FMAD 4DR4Q 2LGDA 3PO3B 4B0EA 1EWIA 4MHEA 4FF2A 2Q8IB 5D65A 1Y56A 2E8GA 1CSQA 1SE8A 5IGFA 5EE1A 1SF0A 4LF9Q 3LWEA 3L17A 1LTTD 1DONA 2WACA 3HKZG 1H8CA 4AH6A 4HROA 1BOSA 4YWGG 5JOBA 1K8GA 5C2TB 2D10A 3RI7C 3Q69A 1IBKQ 2CQOA 4UHVA 3KVFB 4KZ0A 2ON8A 3ZQ4A 5EE9A 1EY6A 2EVBA 2MQHA 4IN3A 4OONA 4ZRJA 1JWAD 4RHSA 5FLXE 4JI4L 3FHWA 1YQ3B 2PNRC 5ELCA 4POFA 5GMVA 3ZLZA 1SNDA 4RKBA 1E7ZA 3NY5A 1FL0A 1E7VA 3IT4B 3QOLA 1WSPA 2AQ3B 1A8VA 4R9WA 3I4OA 3IFTA 3MC9A 3ECIA 3PF4A 3UF8A 1Y1VB 3CPWA 3K5MA 2JA5B 5G2NA 4DV3L 1F2MA 3C46A 2MBBB 4TQ1A 4Q0FA 3KLWA 1G8ZD 1ZKOA 1R9TH 1ZOYB 4A76A 2K32A 3DWMA 4JL9A 1BBWA 2B2WA 3N6RA 4ZUIA 1IBXB 3CCRA 2IHEA 3TZDA 1LT5D 3HOXB 1WGYA 4G4KA 4AQYL 2Y5BB 5M5YB 3T16A 4JI3Q 2FUG1 1STHA 4XTCS 2PW9A 1RTOA 2BBCA 4NXNL 3GTKH 3A5UA 3J7YW 2MA9B 4WJOA 4RCNA 4ICUA 2FHTA 4A75A 3BS1A 2SAKA 1LTID 3M3YB 4DDID 4MM3B 4F88A 4PT5A 1PQSA 1TT2A 4IPHA 1QOHA 5FLXc 3K57A 5KIXA 5CC4A 2RR9A 4LK1C 3CCQA 3KF8A 2CW0C 2XRSD 4IM2A 4CJ0B 2F3WA 2WV6D 2F0JA 3T53B 3NHEB 2CJOA 4W9KA 3GOEA 2K6AA 2YYZA 4TKOB 1NBFC 4KKIA 3P20A 2DNFA 1NCVA 4ZOHC 4DHZB 3VTWA 1CMXB 3DBRI 3EGRA 4W9GA 1HXYD 3RNUA 1HRJA 2D3AA 1O7LA 2Z4IA 3JSVB 3ZO5B 3S1QB 3K5OA 3W3AA 4FBJB 2JA6H 2ZCCA 3SK4A 4C3HH 1VDVA 1AZQA 1IBLQ 2I5MX 3HKSA 1VQKA 2GBJA 5A35A 3AEDB 4TMAB 4YT0B 4DV4Q 2JVCA 3OPOA 3OYYA 4MTNA 4XQQA 3HG9A 4CDDC 3S2HB 4ZRZA 1M4VA 3NUHB 3HOWG 2R92G 4B3RQ 4BBNC 4JBMA 1Z2MA 2BE5C 2IY1B 3SR6A 1BDOA 4N8FA 4K0KL 2O2LD 1GKHA 1SNPA 1MIUA 4HTHA 4LAAA 3S17B 2JYEA 2OHFA 2ATWA 4BY7B 2KJXA 2XK5B 4QQBX 2ZT9C 4B3TQ 1LT6D 2CCZA 3GO5A 2NS5A 1S4ZA 4RGTA 1ZE3D 4LNIA 1X9NA 5CTRC 2B2TC 3HFZB 3SFEB 1WGRA 4W9JA 1E24A 2MBHA 4WWMA 2K05A 1TS2A 2Z0SA 4ACFA 2ZTDA 3S1NH 3DQVA 1HR0Q 2EYJA 1EM7A 3ABVB 3DWPA 2N1WA 3U7DA 3X3MA 3VR5A 3DM1A 3FILB 5AZFA 1RL2A 2N7DA 1WTQA 3AQQA 3IVFA 1B2TA 1JQ4A 5JVH3 5LMNW 1YJ1A 3AEVA 3Q8CA 4V190 1P0RA 3PQIA 3WA0A 4C1NK 3MXUA 4DUZQ 3JW0X 1WFYA 3OAWA 2V0GA 1I35A 3RULA 1I4HA 5HY6A 4AYBB 4JYAL 3S2AA 3QOJA 1X65A 2K33A 4BBSB 1GJXA 2KC2A 1E10A 1WRDB 3Q0AA 3GTMH 4A3GG 1FCCC 2HJ8A 5BYQA 4JE3B 5LL6S 2MNAA 2LXKA 4C3IH 2RSNA 2VY3A 2PW7A 5IGGA 3KYCD 1EZ6A 2KZRA 2ZM6L 4PYZA 4A3KB 2DYMA 1LV9A 4IM3A 3RR5A 3G48A 1V6EA 3SU8X 4O1NA 3AE6B 1ESRA 1II3A 1GAQB 3CMEA 3Q3FA 1J9OA 1F2ZA 2IL8A 2EZVA 2JEAI 4GXBA 4NZLB 3PIP3 2L1BA 4WORA 2KMAA 2WAQB 2E74C 3ZJTA 4DPGA 4GDKB 2LWPA 2PE6B 4APVA 3A4SC 4DAPA 1CTMA 3CF5A 3C2PA 4LCDE 4HJ5A 4YSZB 2N78A 2Z8LA 4IWPA 1FYCA 3ERQA 4N9PA 2B3AA 2L15A 2M8SA 1VF5C 4OX9Q 4DR1Q 4LFAQ 2XEWA 2Y0SG 3SGIA 3GZNI 1SN8A 2UUBL 2H89B 1YJNA 2QCPX 3L7ZC 1V5TA 2WXOA 3A1QA 3P75A 3KYDD 4HIOA 2K3UA 1JJ2A 1VCBA 3ITPA 3SXHA 3K0XA 5HG2A 2JUOA 1JOOA 5IWAL 4YHHQ 5J17A 3PLVA 2AWOA 1K50A 1K9MC 5CYUA 5JAVA 4J3OD 1WXVA 2F03A 2LGSA 4A8XC 4ITKA 4EQNA 1OEYJ 3AE2B 3TEZA 1OXTA 3HOYB 2GVBA 1PHJA 1KXLA 2ZJPA 4H7BA 3PT2B 2QKIC 5C3XA 1V5OA 3L4PA 3KH0A 4K3BA 4WH4A 3H9DA 1I6HH 1PYWD 1R4NB 5IYBH 2L5TA 1B44D 3CQZH 2JA7G 2C9WB 2ASQA 2K5DA 4UY8C 2Q2HA 3MXNA 3KJPA 3TP5A 3HOZH 2C7NB 1KABA 2KX0A 2F0VA 4DV7Q 5GROA 2JJQA 3VR6A 1GUWA 4JV5L 1SEBD 2KUMA 5M5XB 3ULJA 1QVCA 1SYGA 4II2B 4PS8A 1GNUA 1DZ1A 5EPKA 1MVKA 1QZEA 4FDBA 1NYQA 3V6CB 3EC8A 2RCNA 3ONAB 3T1HL 3AE4B 5J22A 3ZDTA 4A93G 5LMNL 1BMLC 5C5MA 2R7FA 1TYGB 4X3SA 2R7ZH 4JI6L 4V0BA 1MSGA 4WJ3M 1AFPA 2PCFB 3PUVA 5KEEA 3J81E 3P1HA 5E1FA 3GTOH 4DV1L 3QQ8B 4IALA 4II3B 4FXDA 3OTOL 3IFDA 4LF7Q 1RLFA 2JRIB 1I50H 3GP7A 2BYFA 4IUQA 3MXGA 2CHXA 3WAPA 1X32A 3I4MG 1IP9A 5E3FA 1VZ7A 2MEKA 3NVWA 4ABNA 2A74C 1BNZA 1FVIA 1J7CA 1WXQA 3QJYA 3CMAA 2XWJB 4GOPB 3A9KA 2R93G 1PH2A 3B1LX 1FCLA 2KCCA 4TQ0A 1RTNA 3JAMi 3E56A 3GTJB 3MWYW 5K36G 1C77A 4B3MQ 3PS6A 1J8IA 1UE1A 2XVSA 2D62A 2NVXB 1E8ZA 1YBYA 2N7EA 2ES2A 2Z4HA 3PO2B 4HPPA 2NZHA 1XPUA 1JWMD 3R8BA 4BA1I 4RF0A 1W6KA 4BA2I 3P42A 2JQOA 1BVSA 1HNZQ 1YQ4B 3QK0A 1GUNA 2CQAA 5M5WB 3OW2A 5C0XG 3D4DA 2VZKB 2REXA 1XNQL 1ENFA 3QX1A 3TSSA 3J81c 1XXGA 2F1MA 1LXDA 3OLMD 1VQDA 3ZW3A 1JMCA 2E2JB 3VTUA 3T56B 3J7ZC 5DM63 1A6XA 4N8X1 1C79A 2EXDA 2WU5B 4A3KG 3HS0C 3PIOA 5JXVA 1L2NA 3LYYA 1VQJA 5JPNC 3K7AH 3KLRA 2I1JA 2Q8RE 4MH8A 3WWVA 1XNRQ 4LFBL 4KTAA 3ND9A 2OQKA 1EYGA 1NI2A 4IKGA 2CW0D 2VH2A 1H9JA 5BMGA 1ROEA 1YHBA 1SE3A 5IA7A 1DOLA 4A3FH 4DR2Q 1BR9A 1Y1WB 4FYDA 3UQAA 4A3GH 1U9RA 2EYHA 3ML8A 1WGHA 2IX3A 3PO3H 5T1GA 4YTPB 1KTKA 2EQSA 4IPGA 3I56A 4GGQA 3NS1A 1PZKD 1XMOQ 1EYDA 3VH4B 2JSOA 2ALYB 1WTHA 1G291 4GS3A 4IFDG 3DBHB 2JXXA 1YN3A 5CV5A 2L0FA 5IGDA 2WFWA 3M4PA 4IJLA 4NAWB 2ZVNA 4R4IA 3MHZA 3H6MA 2ZVOA 2LXJA 2FCQA 1S1QB 1ZPSA 4M8NA 1G6ZA 4KSLC 4UP7A 5CV7A 1A15A 4PNYA 2N9LA 1DJRD 2K5NA 2Y3AA 1WI5A 5CORA 3RNEC 3NSWA 3H91A 2OJWA 4M02A 5FO8B 3BIID 4EVOA 3PZDA 3MZ5A 2I1KA 4OIKA 4ICVA 2PMZE 5C0XJ 1Y1VH 2JA5H 2WXGA 1G51A 2AMCB 1UUPA 4WWNA 2KCNA 2IY0B 1N6ZA 4XYCA 5E6JA 1PDQA 1N63A 4IPCA 2PLPA 4DKAC 3Q8BA 2EIFA 2J4XA 1IYVA 2NVYB 1E7UA 3I90A 1EOVA 1WGGA 3IL8A 1WYGA 3FRPB 5LXHA 1GB4A 3BY4B 2KQ3A 4BKTA 4DBGA 5KGUA 2F0PA 5BR8L 4BXXG 3T8MA 1PTOB 1JW9D 3QWZB 1KDAA 4F1SA 2JA8B 2V4DA 3NWSA 2RVLA 3A7LA 3U9OA 1B50A 3IT6B 5IO9A 1I4QA 3M3YH 1WTXA 1Q8KA 3E0EA 3RZDB 4XZ4A 1CKNB 2K1BA 3AH7A 2MCNB 5CHVC 1AH9A 2MRPA 1XLNA 1BXTA 3T1YQ 4IOAA 3DM3A 3OJ3A 4F7ZA 5JH5C 3FAHA 3E9HA 1PH7A 2WDTB 2Z6BA 3I55A 3N30A 1S5DD 4US9A 2K5QA 2C60A 1DOMA 3G71A 3S1QH 1J19A 5AZGA 2F0NA 2WQYB 2D2CC 5EKIA 3ZXRA 3AE5B 3RD4A 1O80A 1NVID 1HA5A 4X65L 2R6GA 3KYHC 2RCFA 4P75A 3NELA 2ZZPB 4HXDA 1N34L 3DDCB 3S2HH 1TWCB 3FC4A 4ME3A 4JQWC 3V61A 2N88A 3GV3A 2WGSA 2IGDA 4LMQD 1OXXK 5C44G 5C4JB 3S17H 1PDXA 4BY7H 4A3DB 3DHQA 3RLNA 2E6XA 4M1UB 1LTAD 2KFKA 3FVQA 2SNMA 2Z9HA 2EY6A 2Q2UA 1EUVB 1I7HA 2BA1A 3NVZA 1PVOA 2K25A 3K9OB 1QQRA 4A3EB 3VR9B 1Q10A 1CK1A 3HP3A 4M0WB 5FR3A 1SB3C 3N1XC 4G57A 4PG3A 3CAMA 5M3MG 1UD7A 2M9VA 1HZAA 3CC4A 2K6QA 3H15A 2F0SA 4AJYB 4EZJA 3HKZE 4R1JA 1QUQA 1E8XA 2BF8B 3DVGY 5ELFA 3TZUA 5F2DA 5M3FB 3U4EG 1AN8A 4BVUC 5D3IB 2LJ5A 2WB1B 4HIDA 3N9YC 4BWGB 4OL7A 1QT9A 5DPSA 1C4QA 1DYQA 2J42A 1KQSA 4ZLTF 2KOLA 1T5EA 3LX0A 2OJRA 1EU4A 1SE9A 2KTFA 3I72A 4BBSH 2E75C 3LNNA 5C0XH 2XWBB 1XJVA 2UXCL 2BWES 3UDFA 4WRDA 4DXGA 4FHJA 4L1BA 3DPDA 4DR5Q 2F4VQ 4AWJA 4ZHPA 2PYKA 1LM0A 2EY2A 4ZRKA 1Q0WB 3K9PB 4R4OA 2RGFA 5C4XB 3TL5A 4TV3A 2GBMA 4K8IA 4A3KH 4KD3A 3PRMB 3RNBC 2NB0A 3H3VH 5ELDA 1F2LA 2YTYA 1WX9A 2DZMA 3B08A 4NQLB 4XC2A 1SYFA 3ZTDA 1U4LA 2MJEA 4DK1A 4OZCA 3ZNID 3KF8B 3PPAA 4USAA 1I42A 4S17A 2XIWA 1SIFA 1TWFB 4GIVA 3V60A 1RWSA 2B2VA 2DYBA 1CA5A 5IGEA 2D5DA 1DCZA 3TUOA 4DR7Q 3HK0A 1WY8A 4J6HA 1XMQL 2IY5B 2PQEA 2GBKA 3OIQA 5COYA 1JWSD 1TS5A 1KRTA 1MHWC 2UXBQ 4PMWA 1V8CA 4FJZA 4PS3A 1TBEA 1JMLA 3TCAA 3VR8B 3Q14C 4BBNF 3VHTC 4DV0L 1F2RI 3A55A 5CV8A 3PZ7A 1C1YB 1PFBA 4HMIA 1Q7YC 2K1FA 3PLUA 5BN3A 4RGMA 3UI3A 3S1RB 2IPKD 2RDFA 1D5XC 4YWMA 4XWWA 2WXFA 2E5LQ 5DPRA 1EFID 1F2RC 1N36L 2NBVB 3VYSA 5C4HA 1KLVA 2JYTA 2PQAA 2DAFA 3ENEA 3HOYH 1C9OA 2FCSA 2HD3A 3FKIB 3L9AX 3NBHA 2FCNA 4GN5A 5C0XI 2VNUD 2LUEA 4HN7A 1BCPF 2HE7A 3K7UC 3PF5A 4NXMQ 5AFWA 4CGYB 3Q2AC 4OIJA 1E8YA 1N5WA 2RDBC 4IUMB 2UUCL 1LTGD 3UDGA 3WOFA 3AULA 2KECA 2MBEA 3H3VI 1A2UA 1IUEA 3MVVA 3QO2A 4QB4A 4K81A 4RH6A 3X23A 4YL8A 2J0TD 2F0QA 3MTSA 4KN4C 1WTWA 1LTLA 2W9NA 1L0YB 4JPBW 1CQVA 3H3VC 1X56A 5A2QE 1U0LA 4CBVA 5M5XH 2KLCA 2BH8A 2KO3A 4B9WA 3BZKA 4DK0A 1OXVA 3RN5A 3A8KE 2JA6G 3B9JA 4C3HG 1A0IA 5ELEA 3U4VA 5JJKA 3NVYA 1Y69U 3VA5A 1STGA 1NR2A 3Q8FA 1UWVA 5I9OA 2WXRA 4XE0A 3IKJA 4C7ZA 1NNXA 4NB3A 1KC8C 1VZ8A 2Z6KC 2VXWA 3JAML 2L05A 1YZ6A 4HRSA 2K5PA 1XPRA 3MEFA 2AL6A 1ET6A 2YTXA 3BK2A 1F9PA 2HDEA 1RIPA 1ILPA 4AOFA 2EKEC 2XN9C 4LF5L 3BVZA 3CSFA 2A6HC 1D2BA 5FLMG 3OHXC 1VDZA 2BW2A 3AEEB 3ETRA 4JWUC 2UU9Q 4G50A 1ML0D 3VYTA 2G3QB 4DNTB 3H8HA 3OMCA 3DWQA 3J81j 2IHFA 2DYOA 3Q3MC 1JE5A 2VB2X 3I91A 4GKJL 2D3BA 3ZJUA 4GLAC 1E0ZA 3TP6A 1HCZA 4IWQA 3R7RA 2EY1A 2B2YC 2BDNA 3TJPA 1R4NI 2FAZA 3GTJH 1TKYA 2PVGC 3A1QB 1Q1BA 5CHWA 5BMHA 1JORA 2BB5A 2CHWA 2Q5WD 1ICWA 1IZ6A 3SR1A 1OFFA 3A9JA 3PRPB 2UU7A 3HRDD 3BDLA 4FXKC 2NVXH 4PK1A 1DGSA 3UI2A 2WB1G 2V1YA 1PFDA 3W5OA 3PO2H 3S1MB 2N9EB 3GE3C 2NCNA 1XTCD 3NXWA 3OWFA 4NNJB 5FK9C 1Q1OA 5EGTA 3E9IA 2V3NA 1YJ9A 4JI4Q 4L23A 5M5WH 1UE7A 2KMMA 3W2DA 3J7AV 3AE8B 4EFOA 2B2TA 3I7FA 1V9PA 1X55A 3EVQA 2W3RA 3ICEA 2E2JH 2Y0SE 1WD0A 4ZYSA 4G3XB 1CHQD 2PW5A 2VS1A 4JI0L 1EZ8A 3NZSA 3NTHA 4KJOA 1N32L 5DNFA 4MJSA 3M4YA 2L76A 4DV3Q 1STAA 4JPSA 2DENB 2LGYA 3MXNB 4OZAA 1QCBD 2FMMA 4ZKBB 1CA6A 2AUJD 5IYCH 1CZPA 5IT9E 1TTNA 2BS2B 2O5IC 3DOWA 1GJZA 2F0TA 4CDCC 5IOIA 3MHBA 4NAMA 3NRZA 3GV6A 2N9XA 3M95A 1HTLD 1Y1WH 4YY3L 4AQYQ 2YV5A 3APCA 5H92C 1JJGA 4RGNA 3C3LA 4R4TA 1TY2A 4DUYL 3VVWB 4PV1C 5H1SE 2ZCBA 4AJWA 3IBEA 1E2WA 1MD2D 2N49A 3NE5B 4NXNQ 4XQJA 2QHOA 4PZ7A 5FOBB 4DR3Q 4E71A 4KKUA 1YN4A 4HJ8A 1F9JA 1DOKA 4Z9CB 1VRAB 1D6EC 2WXNA 4LF8Q 4NQKE 5HGQA 1PH6A 4IOCA 4HJGE 2FIFA 2IT1A 5BO4B 3ZRFA 4A3MB 3NP8A 5KNBA 4ZYNA 3CXCA 2K04A 1EWYC 2A68D 1KNEA 2QDLA 1I4RA 2AKWB 4KJNA 3PSIA 3K81C 4IUUA 3JVZX 5HI1A 2JXTA 4LWCA 4WJ4A 1ZUD2 4WQMA 4HCEA 2B76B 4K7WA 1L1OC 1PZID 4NY0A 5M9OA 4EQPA 3V62A 5KRUA 5IYBG 1H95A 2MO0A 2KBNA 5IT9c 3JYUA 2HTHA 4ANWA 3ZUNA 3D4RA 2G4DB 5GAEC 2DY8A 3TS2A 4QMGA 5G5GA 3HOZG 2HQLA 2VH1A 1V49A 5ELBA 3EUB2 2P5ZX 1L4DB 4A3IB 4S0RA 4YWKA 4YWLA 2GVAA 1Q82C 1KLUD 4K0KQ 2IJ0A 4AS1A 2OCEA 3CHBD 1BUVT 2NVYH 1T0QC 1RDPD 1SXTA 3PUYA 1ACCA 2BB6A 2O2VA 4DWFA 1SDFA 4ZAIA 3LWUA 1G2TA 2K52A 1UF0A 1MKHA 2ZPYA 3TP8A 1JALA 1N33Q 1TKEA 3PV1A 1PTOH 5BMIA 1O7ZA 5EBCA 3CRKC 1HZBA 1J5EQ 2JA8H 5CV9A 3N1YC 4LJPB 4IURA 1Q3LA 2C7MB 1E2VA 3A0JA 5CBAE 4MGKE 5CR3A 2KN4A 2OEDA 2R7ZG 2D07B 3CU7A 1CUKA 1ICFB 3RZDH 3GTQB 3OW7A 3K6OA 5KNDA 1SMYC 4JOIC 2LMCA 2AWNA 2Z0DB 4FN2A 2KA7A 2MHJA 4OGQC 1TS4A 1TWAB 2ICIA 2WDRB 1E6EB 2LXCA 5EPLA 1L0XB 4LF9L 2KK8A 3AMZA 5C3WA 4DV5L 2JRHA 1EY4A 4JYAQ 3NHHA 2HQEA 4DR7L 3HUIA 3B2FA 5AZHA 1YX6B 1J7BA 2KTRA 3NWTA 4JI8L 1XWEA 2IW3A 4JBKA 1K3BC 3L2PA 3I57A 1M1KC 3PHWB 4QY7A 2V9HA 3P4RB 1F9RA 1TQOA 2WKCA 4KHPL 4CHKA 4H0LC 5I9PA 3Q6BA 2ZM6Q 4DR6L 2LHDA 1WTRA 4CDFC 1FXTB 2M19A 1R4QB 1E7PB 1TWCH 2DN8A 3FPUB 3J81i 3WALA 4DXFA 2UXDL 3ND8A 1A3VA 2KCMA 2OEOA 2EELA 2M2LA 4NP5A 4PQXA 3KW5B 4TKNA 4ZDVA 1WCMB 1S3SG 2N8NA 4HCPB 1J0GA 4KMUC 1O78A 2LVOA 3MP9A 5C4JH 4MT5A 4DNRB 5FLMH 2LSSA 1DOIA 2AWTA 2AQ2B 4KY5A 4A3DH 3I70A 2BVCA 1BF4A 3UINB 3A33B 4CKCA 4HEA1 1YNND 4HSPA 3BJUA 3EIVA 4ME5A 1IBMQ 3HOVB 2J53A 4H44C 4URKA 3GDEA 1X3EA 5D94A 4A3EH 2IGGA 1BCPC 1P7EA 5BYSA 1ONLA 3OWEB 3KBGA 5IE8A 1I94Q 2KN5A 3DVGX 2UUBQ 4C00A 1OTRB 1QILA 1VCIA 3RPFC 4IDIA 4I65A 4G7HC 4CKEA 5EBDA 3J80E 5M3FH 1EWHA 5IWAQ 1ZYRD 1RKNA 4FNFA 3W1BA 1MI0A 1R4MB 2ZW1A 1Q46A 4A3FG 1XLOA 1UBIA 3DHIC 4ALPA 4A90A 1SSNA 3B0AA 1TXYA 1PH5A 1YIWA 1LTBD 5T8IA 4HVBA 2CHBD 4NDXA 5FJ8H 4WWOA 4WWPA 5K5PA 3PO3G 4EKUA 1FO4A 4C4VA 4DK5A 5EPJA 3CCLA 5JEAG 3GB1A 3V2TA 2INDC 4OW0A 5HKHA 2W82A 5C4XH 3WAMA 4HCNB 1PXUA 1VMPA 2JEBI 1K83H 4KGTA 4WQOB 2JE6I 2UWQA 1WF9A 4QGUA 2JP1A 1VQFA 2LD9A 5JZEB 3P4QB 4TUUA 1V8QA 1WE6A 2PMVA 3RZFA 1ZXTA 1JC7A 5HGTA 2FUHB 2BDOA 3IG3A 3F1ZA 3NOBA 4KKTA 1TWFH 2HD5B 4ZRQA 5CMDA 4X3UA 1PRTC 1NAPA 4IUNA 1ZGUB 4G11A 2SDFA 1Z6HA 5FLXL 4JV5Q 4NJCA 4IM0A 4GKKL 5G5HA 3QIAA 4XYOA 2ASBA 1QOAA 1Z7TA 4CDEC 2FMCA 1JWBD 4FF3A 3J80c 2H88B 1WJJA 1VQIA 3H6NA 1NMFA 3PUXA 3ZTCA 3T1HQ 3NZ3A 4HEDA 1IGDA 1Y1VG 2JSVX 2JA5G 5LMNQ 3PCOB 4B3TL 1NYRA 4PMCA 3JC66 4WJQA 2KHJA 1QZHA 4JI6Q 3BZDB 2JT4B 3U7ZA 1RJTA 2ZTEA 3H09A 3S1RH 2NZOA 3X3NA 2IO0B 4DV1Q 1UE5A 1PH4A 4BY1B 3CF6E 3OTOQ 4A3IG 3HOXG 3MEHA 2N7JA 2VRRB 1YITA 1WZ0A 3AU4A 1X3FA 1WX8A 2CHZA 4LK0M 3FKIH 2ZJRA 3VA7A 2KFKB 1M94A
chains in the Genus database with same CATH topology
3IXSA 3CRLC 4KN7C 4WAFA 4CHTB 1SNCA 1B9MA 4IZ8A 4B08A 1FRRA 5JEAJ 2LFNA 3M7GA 3HOUB 1N5XA 1A3TA 1SBBB 2B63B 5FKAC 1RF2D 1LLRD 4L2YA 3G7LA 1EQVA 5AUKA 1K51A 1LT3D 1C4PA 1T5XD 2L4NA 4RNAA 1E0BA 3FEWX 2WP9B 2RA4A 4U68A 1EY8A 4DGZA 1H9KA 3VR3A 2EXZA 2VUMB 1BQQT 4ILWA 3VYUA 2Y5CA 4YXDB 3K5NA 1AEXA 2EPBA 2WXQA 1B9RA 1B3AA 1QLBB 1K52A 1I4GA 1KDBA 2F0HA 4HMJA 3HGBA 3E5SA 3TN2A 4JWSC 4P2CB 2K03A 3O13A 2IX0A 4OO1H 2MJ8A 3NQIA 1ZXHA 3PIO3 2OF1A 2PZUA 1L4ZB 1I4XA 2MJ3A 3DEPA 1K53A 1XCQL 2MGSA 1R4PB 2LHEA 3EJIA 3KQ4A 1XEEA 4OHJA 3D4WA 4A3BB 5BN4A 3HRZC 3C8YA 1EL0A 4N58A 2F0MA 3GQBA 1TVXA 2Z1CA 2F0DA 2I38A 5GXGB 2BA0A 2F0KA 2IDYA 3PUWA 5EKLA 1TU2B 1SE2A 3SVMA 1SMYD 3GTLB 2ICEC 5KYIA 3P4SB 1LO5D 5G3LD 5HFYA 4TRDA 1S5ED 2OT2A 5JEAH 1SAPA 5CV6A 2EYOA 4QUCA 1XYIA 3MJ5A 1KRHA 4XDDA 1DD2A 3H0GB 1EEID 4YSYB 3SK5A 3SK6A 4OO1I 2EYMA 3KUPA 1VMCA 4XYQA 5C6AA 2NN6H 1FXAA 3W5UB 1JQYD 4ZRPA 5D7GA 2BE5D 4DAYA 1I6VC 3T13A 3K5LA 4HR7B 1ZP0B 2HDMA 1FD6A 1YNJC 3R3OA 3VR4A 1E9MA 3E0JA 3NUCA 2NVQB 1L5PA 3ZGZA 3VRBB 3BYTB 3VYRA 1TKWB 1BCPD 1EIGA 3M7NA 1K8MA 4K5XA 3Q8EA 2FINB 2WXJA 4KD4A 4XWTA 1LT4D 3QWNA 1U4PA 1TWHB 1IW7C 1VR9A 1C78A 4QUFA 4R8IA 1HQRD 3A8IE 1HPCA 3S16B 1MHHE 4E6IA 4Q2JA 3DXJC 1A3UA 1B9NA 4WJWA 3U52E 3J81L 3ZJVA 2LKVA 5E4WC 1SJED 3EFXD 2JU6X 3D6CA 1UEAB 3NQTA 5JVG3 2R61A 2PKOA 1IKLA 3R93A 2LJIA 4BBRB 1S5FD 4ZK9B 1KLGD 3A7AB 4KKJA 1EY7A 1OO9B 2E2IB 4DF7A 2PMZB 1CT1D 4N6EB 1JCKB 2ACZB 1TWGB 1TKGA 1SYDA 2BTEA 5D14A 1F9SA 2B2YA 3RMHA 3TEXA 2QDBA 1SYEA 2WINB 1BO0A 1G91A 4Y7NB 1QJOA 2DY7A 2KQ4X 1D5ZC 3Q23A 1OXUA 3Q6SA 4S3SA 2QEJC 4H13C 1FNVA 1H9RA 1OQRA 2F3VA 1V1PA 2EE1A 2WXIA 1FD7D 3R2TA 1TZOA 4HAEA 1CM9A 1TIID 2SEBD 4JX1C 2GI9A 3T3OA 2A5HA 2L9HA 4CKBA 2EKIA 2DNCA 3I9V1 2IGHA 1SNOA 5J1ZA 5LHY1 5G3LF 1ZXIA 4C3JB 4FF1A 3EA6A 1FIQA 3GTMB 4K2LA 1KNAA 2LMCB 2HUGA 3OIPA 1H9SA 3BYYB 3AE7B 3A54A 1SYCA 1NENB 2GA4B 2NYZD 1EOTA 3PZ8A 3T3NA 2FJ2A 4MN3A 1Y8NB 2BOSA 4FF4A 1FRDA 2KACA 1HUMA 4WFN3 4KHVA 1C8CA 1EY9A 1MPEA 4RF1A 3W9CB 1GXDC 2MUYA 1B53A 4DN4M 1T3QA 1STYA 2J7ZA 5C3EB 3HKZB 1ENAA 4ZKCB 2JXMB 1RODA 3GS2A 2QSDA 3KWVA 1GOZA 2EYPA 5FO7B 2ZW1A 2F0IA 1X3PA 4M8AA 3P7JA 4K14A 3S15B 5I2XA 5I6YA 4XQNA 2HCCA 4CQNA 3LB8C 2K7VA 1DXMA 1NR4A 2F4IA 4REZA 2MJDA 2YEPF 3EROA 5DM73 2I07B 2WNMA 1WWTA 1QF6A 2PTLA 1XO3A 2EOTA 2PPBC 3PO0A 2ZXOA 1C9FA 1HZ5A 3SFDB 1TY0A 3SEBA 2G9DA 3NTIA 4FXCA 1PRTF 1RHPA 5C3JB 2ONQA 4XT3B 5CV4A 2M0AA 1LTRD 4L6TB 1XLPA 2G1EA 3MA2B 2ZW0A 1EY0A 3DEOA 1GHJA 1VJKA 2WDQB 3B2GA 1JOQA 4YSXB 3AV8A 4B0MA 3RFZB 3KWLA 3A56A 3T51B 2E3TA 2M00A 4A9AA 2D9UA 1IW7D 3PV0A 3HOWB 2R92B 4NMZA 1QNUA 2NVTB 3I4NB 3P4PB 2WXMA 4MACA 4HKZE 4Q5VA 1WTVA 2B8FA 1CFMA 3ZYYX 2MH7A 1HTPA 2INNE 3TEYA 3F2UA 3NK9A 1CQFA 3VQIA 4C3JG 2K22A 2F0LA 3GTGB 1EYCA 1IHZA 4DA2A 2F0FA 1QG7A 2JX5A 2R3ZA 3HEJA 3DWAA 1JICA 3URYA 4XT1B 3Q24A 1JRPA 4WIPA 3A8JE 4P16A 1SSOA 1DOXA 1STBA 1WTPA 1L0VB 2KEEA 2PIAA 5JPMC 2NTSA 2PZTA 4YIJA 2C5CA 4C56C 2XSCA 3H94A 3AEFB 1XLQA 2L0CA 4RWSC 2GB1A 3Q8AA 2WIIB 3FPPA 2KAJA 1F2YA 2PO4A 2K5WA 2QJLA 3QB3A 4C80A 1M8AA 2H4OA 1QKZA 2QMTA 3DUZA 5TSSA 5J39A 5I6WA 2IWHA 2NUCA 1C76A 2E2HB 1LABA 1GUGA 4L63B 3OOCA 4M0WA 2Y0SB 3K58A 1E2ZA 4ID6A 3QG1A 5A2QL 2WXKA 2RSOA 1WTOA 2L52A 3M85A 1I4PA 3BDOA 1AWDA 4KGRA 1AP0A 2JYOA 1GUTA 1DM0B 2K01A 2WKDA 2AX5A 2LEKA 3BVGA 1QOGA 1K8OA 3AB5A 2RKSA 1IGCA 3D31A 1A2TA 3MAQA 3IAM1 3K0YA 1V97A 2N55A 2JA7B 1DGJA 3S14B 1C4AA 4IUVA 4US8A 4RA8A 2J52A 4OO1G 2XNAC 4TQUS 1B4OA 3V96A 4IUTA 2E2DC 4K2KA 4YTNB 2EJGC 3WCQA 4K6LA 5IIFA 2TMPA 1FEHA 4ARCA 4EQOA 1CI3M 2W55A 4A93B 4ODGA 2K0PA 1AYFA 1FFVA 4ARIA 3PMFA 2L32A 3NBIA 4C2MB 1CZWA 1LTSD 1AZPA 3GTPB 1KH0A 1PZJD 2X38A 1FR3A 3I4MB 2B2UC 4A6QA 2AUKA 1PTOC 4K5VA 1EEFD 3D8GA 5IT9L 3AM9A 3R2IA 4KY7A 1I3QB 2R93B 1STEA 3TMEA 1A70A 3W5VB 3I73A 3S9WA 1FNUA 1EQTA 3BVMA 1GUOA 2DWQA 5D3DA 3AEAB 1SE4A 2INPE 2NN6G 2RBMA 2PZWA 2CJNA 3BDCA 2KEDA 1SIJA 2F0GA 3AU7A 1N60A 4HCSA 3TBIB 1W6JA 1HQMC 4LLGM 2A6HD 5LNK1 4KX6B 1F9QA 1ESFA 4KY6A 2O4XA 2CU3A 3KLSA 2B8GA 3S2DB 1D5MC 1DOYA 3SDZA 3WDNA 2L1AA 1YJJA 2CVRA 3NPPA 5IOCA 4DAVA 2K28A 3I8ZA 2NTTA 2EJMA 4KK7A 4DQOC 1MGSA 1R7SA 2LS01 5CGKA 3KK7A 4XDCA 4ZUJA 1N61A 3EQLC 2B2WC 2VB3X 1TS3A 2BS4B 2NMQA 2KWDA 3AMUA 1QE6A 3CIRB 3BK1A 1QOFA 4EGVA 3DWGC 1Q12A 1CJEA 2A6EC 4KV6A 1QNKA 3P1MA 3C1EA 3RUZA 5JJZA 2LY7A 1IYUA 1AW7A 1XF5L 2HTME 1V1PB 1C4CA 1F0ZA 1HZ6A 3VRAB 1YMHE 4AQ7A 1ZEQX 2L55A 4X3TA 4MIUA 1UWXA 2A69C 4FVMA 2LGIA 3LXFA 2EYFA 1MSHA 1Q8IA 1H9SB 1F77A 2DNEA 1FGBD 2GRIA 3N52A 2FBWB 2A73B 1VZ6A 4R3DA 3TEWA 2DBYA 2EJFC 4OVZA 1WD1A 4RGOS 2BYTA 3BWUD 1Q1EA 3E6ZX 2WU2B 5IGBA 3C1FA 2VZKD 2V3PA 3J80L 3RZOB 1EYAA 1RYJA 1FFUA 2NZ1D 2WXLA 1EWCA 3TDQA 5IGCA 4XDXA 1PUTA 1P7FA 1IBXA 2K9XA 4YTMB 4H2AA 4N59A 5C44B 4LJZC 5I2YA 1BUIC 2YU9B 4QF4A 4BS9A 3M4OB 4NW2A 2L83A 5LL6X 1RD9D 1V43A 3WOEA 1IL8A 1KFYB 1OQQA 4QIWB 1ENCA 1RM6C 2ZXRA 1ET9A 4DFAA 3U2SC 5M3MB 3NTKA 2E76C 2RMMA 1EIHA 2DLBA 4B9XA 4D2KA 1SFOB 1OXSC 5HURA 2X69A 2G9HD 1SNQA 2F0UA 2B39A 2FFKB 1V1OA 1NUCA 4RCOA 2JZPA 5DAUA 2N9KA 4A3JB 3GD7A 4F8MA 1PLFA 3J9CA 5BN5A 4EE2A 2SOBA 1FM0D 4QCLA 4ZHOA 3L3OC 2RDHA 3SHLA 2AQ1B 1UNSA 1WVLA 1GHKA 1VF7A 1QB5D 3MFGA 3AE9B 4F87A 1Q90A 2NWGA 1KDCA 1Y8OB 2LFIA 3HZXA 5FO9B 2QILA 1CHPD 1UWMA 1PTOD 1CZGA 3CKIB 2Y5PA 2WXHA 1X3QA 4IQZA 3SE0A 3FILA 1STNA 4G7ZC 1PFNA 1R9TB 1U4MA 5T1IA 1WRIA 1YN5A 1JB3A 4R8NA 1FNWA 1BCPB 1G2SA 4F7XA 2NN6I 3GTKB 1PGXA 4GZYC 4XXEA 1PRTD 2I46A 3U9SA 2JQRB 2EDGA 4UDUC 1TJEA 2QF7A 1MHXA 1QOBA 1JWUD 4WURA 2EY5A 5CBEE 4IFDJ 4IUPA 2YEPB 1GB1A 4K8JA 4ZQ3A 3MC0B 2JA6B 4KKSA 4C3HB 3DMUA 1RCVD 4O42A 2V4IB 5E4XA 2X6GA 1TR5A 5DEHA 1PRTB 3JAME 2OXPA 3V3XA 4KHZA 1ILQA 3I3CA 1JOKA 1EY5A 1XX8A 2WS3B 1SJHD 3I4LA 1YJIA 5AUIA 3P63A 3W1SA 4JBWA 5EE3A 2A68C 3HVZA 1HFNA 1PGAA 4L8JA 1SNMA 3SK8A 1L6UA 4X3KA 2A6ED 4A55A 2NBFA 4PMBA 3S1NB 1D1IA 2BT6A 2MHVA 2F0WA 1C48A 5BYRA 1JE4A 2XRQD 1GUSA 5K36H 3FDTA 1JR0D 1ZDVA 4RHRA 1WGKA 1HFGA 3VR2A 3AECB 2WDVB 2WXPA 4NKLA 2KDMA 4K6DA 1L6VA 2FE8A 4FP5D 1VLBA 2A69D 4HKQA 1Z47A 3MXPA 4C3IB 1MBYA 2Q8TA 4CJ1B 1IKMA 3TP7A 3BG3A 2ID0A 1K83B 4K5WA 3OMGA 3G6JB 5KNCA 5C5LA 1S5BD 2I2YA 3RLFA 3K59A 3HVDA 1KAAA 1QWYA 5EJWA 4HSVA 2BCOA 2M56B 5EKKA 3KBXA 1GPXA 5ISRA 1KF6B 2LUMA 2TSSA 2F0EA 1NEKB 2RDGA 4RKLA 4RFBA 2X6LA 2D5GA 1LACA 4IFDH 5NUCA 5MPOA 3V05A 5EE0A 1D1KA 2HDLA 1YNTE 1Y8PB 2N0SB 1PTOF 4FXGC 4ULLA 1B1ZA 3J7AF 2W3SA 1YNNC 3AE3B 1XCTL 1HA6A 1J7AA 4KI0A 4G7OC 1I6HB 4N9TA 2C9OA 1NI3A 3CQZB 4FO2A 3AB9A 4GLSC 4J1MA 5C4ZA 1PMRA 3AEGB 2KVMA 1MI2A 3HOZB 1EU3A 3IAS1 1ZYRC 1O7YA 2L11A 4XIGS 5H8YE 2MP1A 3E9SA 2RQXA 2WP8J 5KYLA 3Q22A 5I4DA 2ENBA 2BS3B 4LTUA 3KLSX 1UGJA 4TSSA 3AEBB 1S5CD 2KHSA 1YNJD 2R7ZB 4IFDI 1HUNA 4J8QA 3GTOB 3D6WA 3CWIA 4RAUC 4JK1C 4CJ2C 2PVOD 1JROA 3D3RA 1D4BA 3NVVA 1I50B 3OSOA 2L12A 4U673 3IAYA 4DU9A 3AN1A 2MPMA 4KGSA 3FMCA 1BBXC 1RFKA 2HCIA 5EQ0A 2QIEB 3AE1B 1N62A 1PFMA 1FXIA 2RPVA 4C7YA 1PGBA 4IOIE 2JWUA 2WLBA 2IX1A 4UAIA 1SYBA 5IODA 1NSNS 3PUZA 1UAPA 3MFYA 2O5JC 1HHVA 2EYLA 2B2UA 1H9MA 1HEZE 4P6VF 4C3IG 2SNSA 3T4AC 2H1EA 2F0OA 4C1NI 3K7AB 2W54A 1ZDXA 2B2VC 1T6BX 4A3FB 4GDLB 2ZXPA 1U4RA 4A3GB 5HHDG 4I7ZC 1FMAD 3PO3B 4B0EA 4MHEA 4FF2A 2Q8IB 5D65A 1Y56A 5IGFA 5EE1A 1SF0A 3LWEA 1LTTD 1DONA 2WACA 4HROA 1BOSA 4YWGG 5JOBA 5C2TB 3Q69A 2ON8A 3ZQ4A 5EE9A 1EY6A 2EVBA 4IN3A 1JWAD 4RHSA 5FLXE 1YQ3B 2PNRC 5ELCA 1SNDA 4RKBA 3IT4B 3QOLA 1WSPA 2AQ3B 4R9WA 3IFTA 1Y1VB 3K5MA 2JA5B 1F2MA 3C46A 4TQ1A 4Q0FA 1G8ZD 1ZKOA 1ZOYB 2K32A 3DWMA 2B2WA 3N6RA 4ZUIA 1IBXB 3TZDA 1LT5D 3HOXB 4G4KA 5M5YB 3T16A 2FUG1 1STHA 4XTCS 2PW9A 1RTOA 2BBCA 3J7YW 4RCNA 2FHTA 3BS1A 2SAKA 1LTID 3M3YB 4MM3B 4F88A 4PT5A 1TT2A 1QOHA 3K57A 5KIXA 5CC4A 4LK1C 3KF8A 2CW0C 2XRSD 4CJ0B 2F3WA 2WV6D 2F0JA 3T53B 2CJOA 2K6AA 2YYZA 4TKOB 4KKIA 4ZOHC 3P20A 1NCVA 3EGRA 1HXYD 1HRJA 1O7LA 2Z4IA 3S1QB 3K5OA 3W3AA 3SK4A 1VDVA 1AZQA 4TMAB 3AEDB 5A35A 4YT0B 3OPOA 4XQQA 3HG9A 3S2HB 4ZRZA 1M4VA 3NUHB 2BE5C 3SR6A 1BDOA 2O2LD 1SNPA 4HTHA 4LAAA 3S17B 2JYEA 2OHFA 4BY7B 2KJXA 2ZT9C 1LT6D 3GO5A 1S4ZA 4RGTA 1ZE3D 2B2TC 3SFEB 4WWMA 2K05A 1TS2A 2EYJA 1EM7A 3ABVB 3DWPA 3X3MA 3VR5A 3DM1A 3FILB 1WTQA 1B2TA 1JQ4A 5JVH3 3Q8CA 4V190 4C1NK 3MXUA 2V0GA 1I4HA 4AYBB 3QOJA 2K33A 4BBSB 1GJXA 1E10A 3Q0AA 1FCCC 5BYQA 4JE3B 5LL6S 2RSNA 2PW7A 5IGGA 1EZ6A 4A3KB 2DYMA 1LV9A 4O1NA 3AE6B 1ESRA 1II3A 1GAQB 1J9OA 1F2ZA 2IL8A 2EZVA 2JEAI 4NZLB 3PIP3 2L1BA 4WORA 2WAQB 2E74C 3ZJTA 4GDKB 4DAPA 1CTMA 3C2PA 4YSZB 2Z8LA 1FYCA 3ERQA 4N9PA 1VF5C 2H89B 2QCPX 3L7ZC 2WXOA 3P75A 2K3UA 3ITPA 3SXHA 5HG2A 1JOOA 2AWOA 1K50A 5CYUA 5JAVA 4J3OD 2F03A 4A8XC 4ITKA 4EQNA 3AE2B 3TEZA 1OXTA 3HOYB 4H7BA 2QKIC 5C3XA 3L4PA 4WH4A 1PYWD 2L5TA 1B44D 2K5DA 3MXNA 3TP5A 1KABA 2F0VA 3VR6A 1GUWA 1SEBD 2KUMA 5M5XB 1SYGA 1DZ1A 5EPKA 1MVKA 1NYQA 3ONAB 3AE4B 5J22A 1BMLC 5C5MA 1TYGB 4X3SA 4V0BA 1MSGA 1AFPA 2PCFB 3PUVA 5KEEA 3J81E 3P1HA 5E1FA 4IALA 4FXDA 3IFDA 3GP7A 4IUQA 3MXGA 1X32A 5E3FA 1VZ7A 2MEKA 3NVWA 4ABNA 2A74C 1BNZA 1J7CA 1WXQA 3QJYA 2XWJB 1FCLA 2KCCA 4TQ0A 1RTNA 3E56A 3GTJB 3MWYW 5K36G 1C77A 1J8IA 2XVSA 2D62A 2NVXB 2Z4HA 3PO2B 1JWMD 3R8BA 4BA1I 4RF0A 1W6KA 4BA2I 3P42A 1YQ4B 1GUNA 2CQAA 5M5WB 2VZKB 5C0XG 3D4DA 1ENFA 3TSSA 1XXGA 2F1MA 2E2JB 3T56B 5DM63 1A6XA 1C79A 2WU5B 3HS0C 5JXVA 3LYYA 5JPNC 3KLRA 2Q8RE 4MH8A 4KTAA 3ND9A 4IKGA 2CW0D 1H9JA 5BMGA 1ROEA 1SE3A 1DOLA 1BR9A 1Y1WB 4FYDA 1U9RA 2EYHA 2IX3A 5T1GA 4YTPB 1KTKA 3NS1A 1PZKD 1EYDA 2JSOA 1G291 4IFDG 1YN3A 5CV5A 5IGDA 4NAWB 3MHZA 3H6MA 1ZPSA 1G6ZA 5CV7A 1A15A 4PNYA 2N9LA 1DJRD 2Y3AA 5CORA 3NSWA 3H91A 5FO8B 3BIID 4EVOA 3MZ5A 4OIKA 5C0XJ 2WXGA 1UUPA 2KCNA 5E6JA 1PDQA 1N63A 2PLPA 3Q8BA 2J4XA 1IYVA 2NVYB 3I90A 3IL8A 1WYGA 3FRPB 1GB4A 2KQ3A 5KGUA 2F0PA 1PTOB 1JW9D 1KDAA 2JA8B 2V4DA 3NWSA 2RVLA 3A7LA 3U9OA 1B50A 3IT6B 1I4QA 1WTXA 3RZDB 2K1BA 3AH7A 1XLNA 1BXTA 3FAHA 1S5DD 4US9A 2K5QA 1DOMA 2F0NA 2WQYB 2D2CC 5EKIA 3AE5B 3RD4A 1O80A 1NVID 1HA5A 2R6GA 1TWCB 3FC4A 2N88A 3GV3A 2IGDA 4LMQD 1OXXK 5C4JB 1PDXA 4A3DB 3DHQA 2E6XA 4M1UB 1LTAD 3FVQA 2SNMA 2EY6A 1I7HA 2BA1A 3NVZA 5FR3A 1QQRA 4A3EB 3VR9B 1Q10A 1CK1A 3HP3A 1SB3C 4G57A 2M9VA 2F0SA 5ELFA 3TZUA 5F2DA 5M3FB 3U4EG 1AN8A 5D3IB 2WB1B 3N9YC 4BWGB 4OL7A 1QT9A 1C4QA 1DYQA 2J42A 4ZLTF 2KOLA 1T5EA 3LX0A 1EU4A 3I72A 2E75C 3LNNA 5C0XH 2XWBB 4L1BA 4DXGA 4WRDA 4ZHPA 2PYKA 2EY2A 5C4XB 4K8IA 4KD3A 2NB0A 5ELDA 1F2LA 1SYFA 1U4LA 2MJEA 4DK1A 4OZCA 4USAA 2XIWA 1TWFB 1RWSA 2B2VA 1CA5A 5IGEA 2D5DA 1DCZA 3TUOA 4J6HA 2PQEA 3OIQA 5COYA 1JWSD 1TS5A 4PMWA 1V8CA 1JMLA 3VR8B 1F2RI 3A55A 5CV8A 3PZ7A 1PFBA 4HMIA 5BN3A 4RGMA 3UI3A 3S1RB 2IPKD 2RDFA 1D5XC 4XWWA 2WXFA 1EFID 1F2RC 3VYSA 5C4HA 2JYTA 3FKIB 3L9AX 3NBHA 2VNUD 5C0XI 4HN7A 1BCPF 5AFWA 4CGYB 4OIJA 1N5WA 1LTGD 3WOFA 2KECA 1A2UA 1IUEA 3MVVA 3QO2A 4QB4A 4RH6A 2J0TD 2F0QA 3MTSA 4KN4C 1WTWA 1L0YB 1CQVA 3H3VC 5A2QE 4CBVA 4B9WA 4DK0A 1OXVA 3A8KE 3B9JA 4C3HG 5ELEA 3NVYA 1Y69U 3VA5A 1STGA 1NR2A 3Q8FA 2WXRA 5I9OA 4XE0A 3IKJA 4C7ZA 1VZ8A 2VXWA 3JAML 4HRSA 2K5PA 1ET6A 3BK2A 1F9PA 2HDEA 1ILPA 2XN9C 3BVZA 2A6HC 1D2BA 3ETRA 3OHXC 1VDZA 2BW2A 3AEEB 4JWUC 1ML0D 3VYTA 3H8HA 4DNTB 3OMCA 3DWQA 2DYOA 2VB2X 3I91A 3ZJUA 1E0ZA 3TP6A 1HCZA 2EY1A 2B2YC 2BDNA 1TKYA 2PVGC 1Q1BA 5BMHA 1JORA 2BB5A 2Q5WD 1ICWA 1OFFA 3SR1A 3HRDD 3BDLA 4FXKC 3UI2A 1PFDA 3S1MB 1XTCD 3NXWA 3OWFA 5FK9C 5EGTA 2V3NA 4L23A 2KMMA 3W2DA 3J7AV 3AE8B 2B2TA 2W3RA 3EVQA 1WD0A 4ZYSA 1CHQD 2PW5A 1EZ8A 3NTHA 4KJOA 5DNFA 3M4YA 1STAA 4JPSA 4OZAA 1QCBD 2FMMA 4ZKBB 1CA6A 2AUJD 1CZPA 5IT9E 2BS2B 2O5IC 2F0TA 3MHBA 4NAMA 3NRZA 3GV6A 1HTLD 5H92C 4RGNA 3C3LA 1TY2A 4PV1C 1E2WA 1MD2D 3NE5B 4XQJA 5FOBB 4KKUA 1YN4A 1DOKA 4Z9CB 1VRAB 1D6EC 2WXNA 4HJGE 2IT1A 4A3MB 3NP8A 5KNBA 2K04A 1EWYC 2A68D 1KNEA 1I4RA 4KJNA 4IUUA 5HI1A 2JXTA 1ZUD2 4WQMA 4HCEA 2B76B 1PZID 5M9OA 4EQPA 5KRUA 3D4RA 2DY8A 4QMGA 5G5GA 5ELBA 3EUB2 1L4DB 4A3IB 4AS1A 1KLUD 2IJ0A 3CHBD 1BUVT 1RDPD 1SXTA 3PUYA 1ACCA 2BB6A 1SDFA 4ZAIA 3LWUA 1G2TA 3TP8A 1JALA 1TKEA 1PTOH 5BMIA 1O7ZA 5EBCA 3CRKC 5CV9A 4IURA 1Q3LA 1E2VA 5CBAE 5CR3A 2KN4A 2OEDA 3CU7A 3GTQB 3OW7A 3K6OA 5KNDA 1SMYC 2LMCA 2AWNA 2KA7A 4OGQC 1TS4A 1TWAB 2ICIA 2WDRB 1E6EB 5EPLA 1L0XB 3AMZA 5C3WA 1EY4A 3NHHA 2HQEA 3HUIA 3B2FA 1J7BA 3NWTA 1XWEA 2IW3A 3I57A 3P4RB 1F9RA 1TQOA 2WKCA 4H0LC 5I9PA 2LHDA 1WTRA 2M19A 1R4QB 1E7PB 2DN8A 3FPUB 4DXFA 1A3VA 2OEOA 3ND8A 2EELA 2M2LA 4NP5A 4PQXA 1WCMB 4KMUC 1O78A 3MP9A 4MT5A 4DNRB 1DOIA 2AQ2B 4KY5A 3I70A 1BF4A 4CKCA 4HEA1 1YNND 4HSPA 4ME5A 3HOVB 2J53A 4H44C 2IGGA 1BCPC 1P7EA 5BYSA 1ONLA 3OWEB 3KBGA 1QILA 1VCIA 3RPFC 4IDIA 4I65A 4G7HC 4CKEA 5EBDA 3J80E 1EWHA 1ZYRD 1RKNA 4FNFA