5D3IB

Crystal structure of the ssl3-tlr2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
KYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of TLR2 by staphylococcal superantigen-like protein 3 (SSL3).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Toll-like receptor 2
total genus 46
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
B PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d3iB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5d3iB01
1HTLD 2AQ3B 1KTKA 1SJED 4RHRA 1CT1D 1ET9A 3W2DA 1S5DD 2QILA 3DWAA 2J4XA 1CQVA 1SEBD 1YN3A 2AQ2B 2QEJC 5FK9C 2NTSA 1BXTA 2ICIA 1LO5D 1BCPC 1PRTD 1JR0D 5ELCA 3BYYB 3MC0B 3R2IA 1JCKB 4DXFA 3BYTB 1DYQA 2RDGA 1S5BD 1HQRD 1PRTF 1RF2D 3OWEB 1LT5D 2NTTA 2XNAC 1PRTB 1UUPA 1S5ED 2XN9C 2RDHA 4RGTA 2WV6D 1I4GA 3BVMA 1TS4A 1HA5A 1ESFA 1AN8A 1EU3A 1F77A 1LTID 4C56C 1BCPD 1PRTC 1S5CD 2Z8LA 1XXGA 4RFBA 1CHPD 1PTOF 1RD9D 1I4RA 1STEA 3BZDB 3KLSX 1XTCD 4RHSA 1LTGD 1SE4A 1FNUA 1YN4A 1ENFA 2R61A 1SXTA 1BCPB 5TSSA 4L63B 1LTSD 4ZYSA 1HXYD 1FNWA 1EU4A 1SE3A 1V1PA 1SJHD 1DJRD 4RGMA 1EWCA 4UDUC 2TSSA 1PZKD 1LLRD 1I4HA 4NZLB 1TY2A 3V05A 4RGNA 1EEFD 4RGOS 3TSSA 1S5FD 1B44D 1JWMD 3CHBD 3DWPA 1YN5A 3DWQA 1B1ZA 1L0XB 1PZJD 2SEBD 5D3DA 1T5XD 4TSSA 3EA6A 1PZID 1EFID 1JWSD 1LTRD 5ELEA 4L6TB 2AQ1B 2XRSD 5ELBA 1D5XC 2G9HD 1CHQD 1I4PA 2IPKD 3R8BA 1M4VA 4OHJA 1LT3D 3URYA 1L0YB 3EFXD 4RCOA 1KLUD 1JWUD 1RDPD 3BVGA 3R2TA 1MD2D 1TS3A 2IJ0A 1D6EC 3O13A 1I4XA 3BVZA 4RH6A 1LT6D 1EEID 2XRQD 1V1OA 1D5MC 1PTOH 1PTOD 2O2LD 1V1PB 1D5ZC 1GOZA 4O1NA 1TS2A 1LTTD 5FKAC 4DXGA 5I4DA 1FNVA 3MFGA 1TS5A 3SEBA 1CK1A 1PTOC 3GP7A 5ELDA 1PTOB 1BCPF 5ELFA 4K6LA 1FGBD 1QILA 1LT4D 1LTAD 1UNSA 4BWGB 1TY0A 1ET6A 2CHBD 1I4QA 1RCVD 1LTBD 1G8ZD 1FD7D 1PYWD 1SBBB 1KLGD 5D3IB 4Z9CB 1AW7A 1JQYD 1SE2A
chains in the Genus database with same CATH superfamily
2UU9L 3AE6B 3PGZA 2A6EC 3RNFC 3AE1B 2MP2B 3RN2A 1BNZA 3T1YQ 2QILA 3W1YA 4KKIA 1DOKA 2L4NA 1EY6A 1U4MA 2ZXRA 1E7ZA 1PH7A 3QAQA 1PRTD 3OJ4B 2F0KA 1VQ9A 2LXKA 2WKDA 3BYYB 3S16B 3IHPC 3Q2AC 4UHVA 3SK5A 3JSVA 3CCVA 2F4IA 3APFA 2MA9B 1E22A 3R66C 1ZKOA 3WOFA 4MGKE 1S5BD 1H9RA 3TMPB 3HOUH 4GOPC 2F4VQ 1UE1A 2K25A 3L7ZC 5LL6X 2E6XA 3RZWC 1EZ8A 2ONQA 3PSIA 4WJ3M 3DHIC 4NKLA 2F0QA 4L8JA 4C3JG 3AV8A 3K9OB 4A3CH 2K8CA 1WGYA 1E90A 5F2DA 5C44G 2NZOA 2F1MA 2IWHA 3HEJA 2K0PA 2L52A 1UAPA 4N9F4 1H8CA 3JC66 3HOVB 3CCEA 2HJ8A 2WXIA 3GS2A 4IWOA 2IT1A 2V3PA 3OAWA 4LMQD 1KRSA 4QF4A 4A3MH 1VD2A 3AE5B 3ZRFA 1EU4A 3W5VB 1V1PA 4JK1C 4G11A 2M9VA 1V8QA 4OWXB 4A3IB 3S2DH 1G2TA 1NENB 3EFUA 3CQZH 4K5WA 1TKGA 3K5LA 3QOLA 1LGRA 4RGNA 3FPPA 2F0DA 2WNMA 1EO6A 3NWTA 1EYGA 4G4KA 5IGGA 4JYAQ 1WX7A 1Y1VH 3C1EA 3L08A 1KM7A 3QHTA 4AQ7A 3PRPB 3CHBD 1C3TA 4A3JB 3ZO5B 1QZGA 1YN5A 5AFWA 1K8GA 2YEPB 3OSOA 4DR2L 3L13A 4JI3L 5D7GA 3ZDMC 3NOBA 3U58A 3I4MH 1ZGUB 4A3DH 1CSPA 2HD5B 3Q3NC 1UWVA 3EA6A 3HP3A 1NI2A 3SFEB 3VTUA 3WCQA 3EBEA 1YNNC 5ELEA 4FJZA 3NP8A 2KQSA 1ISNA 3KF8A 3K80C 1LUZA 2RDBC 2O4XA 3A5UA 1JOOA 4YWKA 1JWAD 4RWSC 2K6DB 2F0OA 3D4WA 4GNXB 2LGXA 3D4DA 1P0RA 2N9LA 2PQEA 3A9JB 1L2FA 3KQ4A 3ML9A 3Q8AA 1L0YB 4MM3B 4KY7A 3HKZE 5FO8B 4RCOA 4KJNA 4HSPA 3GE8C 1PDQA 1RODA 3NHEB 2Z4HA 1PGXA 2IYDB 3RPFC 2K6QA 4MSMB 2I2YA 4C2MB 1WXVA 1T0SC 3AYHB 1YNJD 2AYOB 4A3OA 1V81A 4FO2A 1GC7A 4JL9A 3I4LA 2N78A 3DVNU 4BVUC 3DM3A 1WFYA 1PA6A 3UQAA 2PNHA 1VQKA 1XCQL 4CKEA 4ARCA 2Y5PA 4ME5A 1PTOB 3HG9A 3NPPA 4ZKCB 4B3TQ 1M8AA 2WDQB 5C23A 2K39A 4XYOA 1Q3LA 3PMFA 1BDOA 2E2JH 1RFAA 4KJOA 1WGDA 2ASBA 2IO1B 3S2AA 3RN9C 1A3TA 2NS5A 2UYZB 3NUHB 4GU2A 2QIEB 3CMMB 1EIYB 2Z6KC 1KNAA 1VCBA 5H92C 4GS3A 5D3IB 4DV6L 3H3VH 1N32L 3D31A 3H0GB 2EMSA 2WDRB 3P20A 2O5JC 4P71A 3M4YA 3L10B 4JWSC 4HPPA 4YL8A 1UGJA 1KTKA 1FIQA 2R92B 1PVOA 3VYUA 1OQYA 2O2VB 4BZAA 4CYEA 3NTIA 3DWAA 3J81L 2DN8A 4GNXC 1XNRL 4WJPA 1CMXB 3P4RB 2YEPF 4H2AA 4DK0A 2RPVA 5G3LF 4AIMA 3MC0B 3PV1A 5HURA 1IYVA 4WIPA 2SNMA 3S9WA 3TS2A 4WAFA 4GZYC 4WH4A 1V2YA 4HPLB 2NTTA 4JCVE 1S5ED 4OVVA 3KBXA 3ZXRA 2WV6D 4OELB 1L1OB 1ZW7A 4LAAA 1VQ7A 2LKVA 3ERSX 4EQPA 1E1OA 2LHDA 4IPCA 3BDOA 3OW7A 4IM3A 4IM2A 1W6KA 2AX5A 4IUNA 2QSDA 4MGYE 3C46A 2XK5A 3P42A 2K03A 4DKAC 1GVPA 1ZDVA 4A6QA 2MHJA 3CQZB 4QY7A 3M4PA 1XWEA 2G4DB 4DV7Q 1U9RA 2MFIA 5KHQA 4Q0FA 1N36Q 1CQFA 2N7DA 3LWEA 3KH0A 1C48A 2IBIB 1NE3A 3U52E 2KA7A 3CF5A 2LUEA 2TSSA 4HMJA 1I4HA 1PDXA 2SOBA 2A4ZA 1OTCA 2FNJB 3WALA 2AEHA 3AB5A 2NVYB 4X57B 3K59A 3RMHA 2N0SB 2LY7A 3L0WB 2JT4B 5L95C 3WAOA 3DWQA 4CKCA 2DWQA 2HE7A 2JVCA 4PQXA 4ZK9B 4OZCA 4HSVA 3Q6SA 4RA8A 4X65Q 3C0RB 2UU9Q 1I42A 1MGSA 3NS8A 4BA2I 2MBQA 4RM9A 2MJEA 2C9OA 3OWFA 2B2UC 3P7JA 4KD4A 1VQOA 1VQPA 4KHPQ 1ZDXA 4A3JG 2FAZA 2AQ1B 1V9JA 2MBHA 3ZLZA 5GROA 4L2YA 2LSSA 2XIWA 3AFPA 5CR3A 1CKNA 4I7AA 2WX1A 1KIXA 2RGFA 2UU7A 4CKBA 3DVGY 1OXXK 3Q6BA 4OWWB 2CJNA 4YY3Q 1F0ZA 3D6CA 1EF5A 1HR0L 2VQFQ 4W9IA 2B3GA 2DY8A 4XT3B 2R2OA 1GPXA 4BS9A 3NSWA 2E2HB 1SIFA 3N3KB 4BOSC 4DBGA 4R3DA 3UQBA 1LTTD 5C4XG 4KY5A 1HTOA 2GVAA 4MZ9A 4PV1C 2PIAA 2D0OA 2E2HH 2XEWA 4B08A 2GRIA 2ATWA 1R4NI 2WAQB 1JMCA 2BGFA 4HCNB 4ZOHC 2CHZA 1C0AA 1L0VB 4GDKA 1Q5WB 2JXTA 1KOTA 4C3HB 4YIJA 4P75A 2A19A 4FN2A 4RG1A 4F8MA 3ML8A 2MP1A 2EYJA 2JZ3B 1JOKA 3GTJH 3Q24A 4WWNA 3ZNZB 4B0MA 3RN5A 1E2WA 2KHWB 2CQAA 3DHGC 1M1KC 3LB8C 1T0RC 5BMHA 2PYKA 3G6EA 2F03A 1MJDA 2L05A 4N58A 4WWPA 2HHHQ 2Q2UA 4JV5L 3NHHA 2VW9A 5AUKA 2Z6KA 4PS3A 2GN5A 1LACA 4OZBA 4XIGS 3DMUA 1SR3A 3A8KE 3TL5A 5BN4A 3T1HL 4OIJA 1Q7YC 4JI2L 4DQOC 5AZFA 2Q2HA 1ICWA 1PRTF 2E74C 1K52A 4E74A 5EKIA 1VDZA 4F8CB 5GAEC 1XLNA 4IKGA 5H8YE 4C80A 4B3MQ 1QUQA 2RF4A 2LEKA 2MH7A 3BVMA 5IODA 2DJFC 1V5TA 1CM9A 4ZRQA 4YSXB 4DNIA 1H9KA 4II2B 4K14A 1Z5SB 2CHWA 4PS8A 3TIXA 4G7OC 4IOCA 2EYFA 1I4RA 1RFKA 3OIPA 2KJRA 1LTGD 1SE4A 2A5HA 2HJ1A 3H0GG 1FNUA 4IFDJ 3HM3A 1VMCA 1T6BX 1V6EA 4A3GH 3BDLA 2TMPA 4DV5Q 4QQBX 3OHXC 2KJ6A 3I3TB 2RA4A 4RGMA 3S1NB 2PPHA 5GXGB 2FUG1 1HHVA 1SROA 4FXDA 3I7FA 2V3NA 4RKBA 2FINB 1SFOB 1AARA 1DOIA 3RD2A 2R7ZG 2BS2B 1HNZL 2MSED 3F1ZA 1FPYA 1CSQA 1JMLA 2R2QA 3NE5B 3OYYA 1WI5A 4FP5D 2Q8RE 2YV5A 3C2PA 3HHMA 1JWSD 5CORA 2D2QA 3ZKJC 2X8XX 4E3CA 4LUVA 1JROA 1TWAH 1WE7A 2LVOA 2PTLA 3MAQA 4KGRA 3ZXVA 5C5MA 2JA5G 2KCMA 2J0JA 2N9EB 3GQBA 1B3AA 3J9CA 3CU7A 4F7XA 2EYOA 4A76A 3C1FA 1KRTA 2RBMA 1LT3D 1AYFA 2YVCA 3APCA 2ACZB 4TQUS 3V6CB 4CJ1B 5IWAQ 1TS3A 1R9TH 1QWYA 2B2WA 2QDLA 2BWFA 1P7EA 3V62A 4PT5A 1M94A 5HG2A 3W1SC 3RZOH 4KY6A 1PTOH 1I94L 4GKJL 3IT6B 2O2LD 1YNND 3VDYA 4HIMA 2NZHA 3SGIA 4LF5Q 3B9JA 3VR8B 4MIUA 1B7YB 1VF7A 4NB3A 1ZXHA 4CDCC 3QIJA 3NVVA 4X6AH 4A8XC 4LUZA 1K8OA 5LL6S 3W5OA 2W82A 3OG5A 4HMIA 5LLIA 1YJNA 1WXQA 2R7ZB 2QCPX 3KLSA 2WB1B 2Z0SA 2AUKA 2OEOA 4XT1B 1VR9A 1FGUA 1QT9A 5LMNL 1JOQA 2N4FA 2BKRB 4DV1L 2GI9A 5E6OA 5LXIB 2V0GA 1Y1VG 4NJCA 4LNIA 4MHEA 3J80L 4DV5L 1ENAA 4HAEA 1CTMA 4B3SQ 3KF6A 2KWCA 3AXCA 3EHVA 5E6PA 1N9WA 5FOBB 1F2RC 2F0WA 3VA5A 5A35A 3HOWG 1C9OA 2WB1G 5IP7G 2JEBI 2ZJRA 1SIJA 2KMMA 2OCEA 2ALYB 1WTHA 2RDFA 3BG3A 3QO2A 5FO7B 3W1GA 4DFAA 1Y1WG 1E0ZA 1KABA 1NNXA 2QEJC 2WP8J 3PLVA 1A2TA 1BXTA 3ULPA 4HLEA 2M8SA 5IT9c 2PJHA 4DR4Q 1SMYD 3VR3A 3MXNA 1ZPSA 4XDXA 3U50C 4FF2A 1WYDA 2LRUA 4KIKA 5A2QE 1W2BA 4A3IH 2AWNA 1XTDA 1I5FA 2EVBA 1AZPA 3OLMD 2IHFA 1YJ1A 2MQJA 2V9HA 1IYUA 2FBWB 4DF7A 3K5OA 1FCLA 3Q0AA 2WYQA 1F2RI 1OXTA 3VDZA 2VL6A 3ZTCA 4TQ0A 3T9LA 2NBUA 2ZNVC 2KEEA 3KDFA 3TN2A 2ZPNA 3VVWB 3CC2A 1HFGA 2JUOA 3A1QA 2PMZE 4M02A 2UUBQ 4XE0A 2J0MA 1N33Q 3ZYYX 1PH2A 1J6QA 2NVXH 2JEAI 4HKZE 1F2LA 1UE6A 1ACCA 2NCNA 3ZUNA 4WORA 3PO2H 3IVFA 1DJRD 2BT6A 3HOUB 1TKYA 2DAJA 2CW0C 4DPGA 2GBKA 1ONLA 3S15H 1IW7C 1VS0A 3GTJB 3KW5B 4OL7A 4LNKA 1EEFD 1HFNA 2F0MA 1JICA 3K8AA 1I6HB 2WAQG 5FLXE 3JSVB 2JJQA 2C5LC 4IFDG 4NQLB 1B1ZA 2K5DA 3K7AB 3SHQA 4QJFA 5EPJA 1I50H 2V1CC 4EQNA 4X62Q 4ALPA 1FFVA 2NVTB 1LTRD 1RTNA 5EQ0A 1ML0D 4N8X1 1VCIA 3VYSA 4JI0Q 3GTMB 3DBRB 2IY1B 3IFWB 1F2MA 5M9OA 1E7VA 3PZ7A 2DYBA 2K22A 2DX5B 1AWDA 1NSNS 2F52A 4A93B 1L1OC 4OHJA 1QCBD 2OT2A 5E7NA 2JF5A 1WI0A 2O6VB 3QC8B 4YTNB 1WM3A 1MD2D 4NPSA 2RSNA 4FJVB 3BVZA 4RM8A 1YEZA 3TQYA 4NAWA 4GDKB 5IYCG 1TGZB 2CR5A 2EY5A 2DYMA 1PFDA 2PZUA 2O5IC 2N9XA 4DXGA 3H1UA 1KF6B 1HTPA 2I07B 3HOZB 4YWMA 2B2TA 2DGYA 3J80c 4WQOB 4KKJA 4HTHA 4DDID 2EJGC 1LTAD 4HDQA 1E5WA 5J17A 5I2YA 4A3FG 4DNTB 2PZWA 2R92G 3PVLA 3I72A 2KK8A 3I73A 3W5UB 3BY4B 2QEXA 1E8ZA 1FD7D 2IHEA 2F0SA 4XQQA 3P63A 3R7QA 4B6WA 3A7AB 1BO0A 4H0LC 1NTGA 1C4CA 3QA8A 4XYCA 3IRBA 2M0AA 4ZRKA 2CWAA 4P74A 1L6UA 3E9SA 1G51A 2P5ZX 3UDGA 1WXAA 4R8NA 4A3FB 2VB3X 2RKSA 1T5EA 3VYTA 4GN5A 1FJGL 3H94A 1B3QA 4ODGA 2PNRC 2W54A 5K36H 3ZNID 3VQIA 1P9DU 3VR6A 3K9PB 4WWOA 4C3JB 1BBXC 1DYQA 2RSOA 3SR1A 1Y14B 4DV0L 2RDGA 5G3LD 2BPSA 3K5NA 3E9HA 4K3BA 2XNAC 3GTQB 4LF8L 1R4MB 1IL2A 1EQRA 2XN9C 3MA2B 3SK4A 2AHOB 1RM6C 4BKSA 2RSUA 3HOVG 3ETRA 3K57A 4GN1A 3HKZG 4OGQC 2K50A 3NELA 4ME3A 4LW1A 4KKUA 1L6VA 3K81C 3JYUA 3OMGA 1WD0A 3OPOA 3HK0A 3TCAA 4LF7L 3TBIB 1VQJA 4LK1C 5C44B 1IBXB 1SYDA 4DV2Q 4L63B 2YTYA 5D94A 4XGAB 2CHXA 2WXGA 1KAWA 1IUEA 2Y0SE 4L5SA 2F3WA 3M4OH 1WF9A 2KLGA 2CVRA 2UXBQ 3DBLB 1DOYA 1G291 3RD4A 4OZAA 2HDMA 4WJOA 1PZKD 2CFMA 1LLRD 3K7AH 3IAYA 2BW2A 3QOJA 2J42A 3FKIB 5HFYA 3UE1A 4C1NK 1TWCH 5LMUQ 1N61A 2KJHB 1QOHA 4A9AA 5BMIA 2KFKB 2JYOA 3MEHA 4NP5A 1W6JA 4LF9L 2PW7A 5CV4A 1HPCA 4XDDA 3DM1A 2B3AA 1KDBA 4GXBA 4ANVA 4KI0A 2VUMB 4KHZA 1R4NB 1ASYA 1EFID 2ZTCA 1HEZE 4LF5L 5FLMG 1PFMA 5E1FA 1HZBA 4JI4Q 1UELA 3MFYA 4G0NB 2EPBA 4CDDC 2NVXB 4BKSD 4PMWA 2XRSD 2QGQA 1JORA 1WMHB 2RPQA 4MGZE 2IW3A 4JI7Q 2N9PC 1JJGA 2KC2A 3S24A 2AKWB 2MJ8A 2YLMA 4YWLA 4E6IA 3D4RA 3WOEA 3QK0A 2CKHB 1OEYJ 5JOBA 1DGSA 3MXPA 2PCFB 3RMKC 2F3IA 3AE3B 3GZNB 3Q69A 2IX1A 1HJPA 3J7YW 1QQRA 5I2XA 4B0EA 2LXCA 3BK1A 1MG4A 3PPAA 4IUVA 3HOUG 1FNVA 5FJ8G 2KWDA 5AUIA 1EOTA 3GTPB 4F88A 2BYVE 1X9NA 3PHWB 1J8IA 1LXDA 3RLOA 4A3CG 3AEGB 3VTWA 1LT4D 1A3VA 1K3BC 4DR3L 1HCZA 1JJCB 2MLBA 2MRPA 4HXDA 1R4PB 1Q1OA 4DR3Q 5E3FA 4JG2A 2K28A 3KLWA 3GTPH 4JOIA 1L0WA 3MWYW 1AZQA 4OX9L 2M2LA 2JA7H 3IFTA 3TEYA 1KLGD 5J2RA 1PH4A 3CW2C 2VY3A 3P1HA 3HOYH 4A3BB 5KNDA 2K33A 1XT9B 1QLBB 3UGBB 2A1AA 1IPGA 4KIKB 2OQ0A 1XMOL 4CJ2C 4ZKBB 3W3AA 1PV4A 2E2DC 4POFA 2E2IB 1K8RB 4GSWA 1DOLA 1WR6E 4IWPA 3I8ZA 4HDOA 1I94Q 4C00A 1SNMA 1DM0B 4XQNA 2AQ2B 4NXMQ 2R7ZH 2ZCCA 2A6ED 1N5WA 1STHA 3CIRB 2KDIA 1PH6A 4TMAB 5BR8L 4NXNL 2MBOA 2MWSB 3IG3A 2LD9A 3PZDA 4AP4C 2W3SA 2HCIA 5AZGA 3T3OA 2G3QB 2K6AA 2AUJD 4JI2Q 2VUMH 2V4LA 4BKGA 3PUZA 2F0PA 3N52A 5C0XH 2XTIA 3L4PA 4B95A 1FCCC 2OJWA 3TEZA 5CV5A 1EUJA 1LTID 4CDEC 1SNDA 1BCPD 1HNWQ 1H9SB 4ULLA 4HIOA 5I9OA 3LGJA 4U68A 3I4MG 3BZDB 1FYCA 1WYGA 2K4KA 2N1VA 4A3KG 2DLBA 5KHOA 2QJLA 4GDLB 1Q10A 2M19A 3E56A 1SXTA 3MXUA 5TSSA 2LRWA 3NVWA 1H9MA 2L55A 4P16A 3P4SB 4GLXA 1XF5L 2ON8A 3M4QA 4QAYA 5AEKB 3OTOL 3UDFA 4DV2L 4K6DA 3V05A 1J7BA 1WTQA 2G5DA 3H09A 1WWTA 1HZCA 3ND9A 3Q3FA 4BBNF 1KQSA 2B39A 3MJ5A 2BH2A 2M4NA 3AB9A 3ONAB 1SFOH 1RKNA 3T8MA 4PK1A 3ZTDA 1SNOA 3PIO3 4X3KA 5LMUL 3P2BA 1U5KA 4W9FA 2F0HA 3WDNA 1NR4A 2XSCA 4NAWB 4K7UA 1QZHA 2KTRB 4H44C 4X3UA 3JAMc 4JI1Q 1YNJC 3STBD 1VQGA 3URYA 4LF7Q 1Y1WH 2FUHB 3VH4B 3A8IE 4IOAA 1CZGA 1M90C 2A68D 5C4XB 2UXCL 1WXSA 1D6EC 3O13A 4BBSH 4ILWA 5IIFA 3AE4B 4FDBA 3RLNA 1EEID 1DD2A 1V1OA 3PUXA 4RF1A 3NJTA 1YBYA 4LJZC 4A3FH 3RZDH 5E4XA 4A3GG 4PS7A 3VR9B 5J3BA 2JYTA 3HS0C 4N8FA 2NR2A 4RAUC 3G7LA 3DDCB 3QB3A 1CK1A 1KD1C 1GUGA 2KECA 1HR0W 2I38A 4HEA1 3ZNGC 1WSPA 3M85A 2FCNA 2SNSA 1N60A 3ONSA 2ZJDA 4P1BC 1FGBD 2BYTA 2NBWB 4BFRA 2BF8B 4C7YA 4IW0A 3W1BA 2UXDQ 1K0SA 1JQ4A 2JA6B 3HVDA 1IHZA 2KX0A 5ELOA 1T3QA 1Y1WB 1F9PA 2KO3A 5M5WH 4Y7NH 4ANUA 4OO1G 5FLMH 4I7ZC 2E76C 2Z0DB 1O7IA 1SE2A 2F0TA 4LNOA 3CRLC 5EJWA 1MJEA 1GC6A 1MHWC 1DGJA 3NVYA 2J53A 4C3HH 2L00B 2PQAA 1YN3A 2NN6G 4AWJA 5FK9C 4X3SA 2DHZA 4DR1L 2DZMA 4W9DA 1LO5D 2WX0A 2L11A 5JPNC 2BDOA 5C3XA 3GTLB 3KFUA 2IL8A 3ZNHB 2XWBB 4R4TA 3I4NH 3T56B 4FF1A 4K8JA 1F1HA 3C3LA 4APVA 1HQRD 2R7FA 5IYBH 2JE6I 3AE7B 2NMQA 4J3OD 2VZKB 3VUWA 4OIKA 3GOEA 2RDHA 2OXPA 4RGTA 3RT3B 5J22A 1AFPA 1VQCA 5IO9A 2HCCA 3VRBB 1VQ6A 3RUIB 4JI6L 1EU3A 4J8QA 5D65A 1P98A 3A9KA 4NXML 1FO4A 2UUAQ 1DCZA 4L5TA 4FF4A 3J81j 2EZVA 3CC4A 1BR9A 1VQHA 2RVLA 4A3LG 1PTOF 2PMVA 2QMTA 3I90A 2EE1A 2W9NA 3S15B 1OXVA 2NB0A 2EQSA 2R7DA 1D7QA 2BBCA 1Y8NB 2KFKA 2KQ7A 2IDYA 3VR2A 2R61A 4LF4Q 4ASWC 4QCLA 4US9A 1Q46A 3I4OA 1A62A 1QNUA 3VR4A 2MGSA 3TEHB 4CDFC 2W55A 3H7PB 5BR8Q 3IBEA 1X3QA 4P2CB 3S2HB 5EDSA 3KUZA 1TIFA 2A69C 2F0IA 4J1MA 3CCLA 3C19A 4A90A 4X3TA 1Y69U 1OXSC 4JE3B 1NI3A 1F9QA 5T1IA 1A3UA 5T1GA 2KHIA 4AS1A 3DXJC 3JAML 4WJNA 1Y8PB 4UP9A 1K9MC 2WXQA 4M01A 2NBVB 1TWFH 3J80E 4NJ6A 4DHZB 1EWIA 4DUZL 1WXMA 4YT0B 1RYJA 4LJOB 1Q12A 2EY1A 4B9WA 4RNAA 3PIPA 2YU9B 2RD0A 3AE2B 3GZNI 2ZJPA 1NAPA 3KLRA 1WJ6A 4WJWA 2JY6A 2J7QB 2B2YA 3SK8A 2VNUD 5D6JB 2PZTA 5BYQA 3V60A 1JT8A 5I6YA 5IP4D 3BWUD 1PH8A 1I3QH 2CKZB 2L0CA 3BVGA 2PKOA 4RMAA 1EWHA 1IYFA 5JEAJ 4A3KH 2ZT9C 4OO1H 4GMVA 1E8WA 1HTQA 2I5LX 2NPTB 5C4HA 3U4EG 2K5WA 1OO9B 3QJZA 1SMXA 5C3WA 4HJ7A 1C4PA 4JI4L 2KAJA 4A3PA 5KYIA 5H1SE 4KSKC 3R7RA 1YQ4B 3SK6A 1QG7A 1WGRA 3AM9A 5L37A 4OW0A 3T53B 3UI2A 4S17A 5AJ3L 4KMUC 4PNYA 1V5OA 3M95A 1SNQA 1E7PB 3NQIA 1PH1A 4NPNA 2I1JA 3H3VI 4MJSB 2WFWA 2MBEA 4JI5Q 1I4QA 2OWOA 5FJ8H 4JX1C 5KGUA 1E8XA 4LNFA 1K83B 2N8NA 3CP0A 3HZXA 3RNEC 4AQYQ 1EQVA 2G9DA 4M1UB 2JA8B 4MTNA 1FVIA 1GAQB 3SVMA 4KDIC 1V97A 2ZZPB 4EOYA 5MPOA 2ZTDA 3S1RH 1GUAB 3MJWA 3SXHA 4USAA 3B6YA 1ET9A 5G5HA 5D14A 3TUOA 1WIAA 3MTNB 1UEBA 4LLGM 1WR1A 4JI5L 1MJCA 3PO3G 3PO0A 5J1ZA 4YCUA 3NG0A 1UE5A 2M1MA 2VZKD 4LK0M 2KXJA 2ZXPA 4P73A 4DXFA 2INDC 3FKIH 2D62A 2I46A 3CAMA 3AMUA 2BCOA 1S40A 4JBMA 1H9SA 4YCWA 4B9KA 3MVVA 3CCSA 3M4OB 2L9HA 4KN4C 3U8ZA 2RCNA 5FLXc 4DV0Q 1JW9D 4RF0A 1K73C 2KD0A 1Q8IA 1GKHA 1UEAB 2KDMA 4F7ZA 4C2MH 3I2ZA 2B2VC 1X6OA 2H1EA 2UUAL 4ANXA 1IW7D 2JXMB 3TP8A 2ZM6L 2MW5A 3APDA 4IURA 2I0QA 2KQ4X 1V9PA 3RYTA 2BYEA 3W1SA 1XXGA 4PMBA 2K32A 1QJOA 4KN7C 5IGBA 1GD7A 1UWMA 5IYDH 3K58A 4KVGB 4NDXA 1A2UA 4DV4Q 2BA1A 2B8FA 4JI8Q 3RUZA 1BCPB 1HXYD 2JA8G 1FNWA 4A3GB 2L8JA 3CF6E 2BQQA 1K0RA 1WVLA 4IPHA 3I63C 1LM0A 5CV9A 3B1LX 4XYQA 5IYDG 4A3JH 1N5XA 4B3RL 2BOSA 2Z59B 1X3PA 1J19A 4G57A 1DOXA 1KDAA 3N32A 3ULLA 3S2DB 1WZ0A 1KLVA 1OQQA 2DBYA 3NZUA 1Z47A 2CCZA 1YIWA 1Z2MA 4GKKL 3KYDD 1HA6A 2QDBA 1TIID 1TBEA 1NJIC 5E6JA 2N9KA 4DR6Q 4M00A 3NK9A 4TQ1A 1EOVA 1RJTA 4A3EB 2EXDA 3HOVH 2X38A 3Q3MC 2GMIC 3AEAB 1Q1BA 2EXZA 2O6VD 4CHKA 2EY2A 2KDBA 4I65A 4IALA 3R2TA 2F0UA 1QVFA 4C1NI 4R4CA 4RH6A 4K7WA 2PE9A 1IBXA 2XRQD 1NYQA 2JP1A 3NTHA 2DUDA 4CQNA 3Q22A 1TWGB 1ZOYB 3JAME 3LYYA 3PHXB 1X3FA 3NBIA 1V1PB 4O2DA 2FCSA 4FHJA 4IC7B 4P1CC 1PFNA 4IUTA 3F2BA 1F52A 1TKEA 3HOWH 1YQBA 3P4PB 1WCMG 2CH4W 3J81E 4TV3A 2V4IB 2L7RA 3S16H 4QMGA 4R8IA 1J9OA 4K6LA 3T1HQ 4LTUA 5M5XH 4XDCA 3VAWA 4DHJD 1V86A 3U4ZA 4KSLC 1QVGA 4LFAQ 4TUUA 3Q8DA 3T4AC 1TY0A 1LQBA 2DY7A 4DR1Q 4IN3A 1WTXA 1KRHA 2VB2X 4JPBW 2AWTA 1NYRA 2CJOA 1PYWD 1AH9A 2HHHL 2Z4IA 3KBGA 5EKLA 2EMTA 4ZYNA 1T0QC 1MIUA 3GTOB 4ZUIA 1WE6A 3FRPB 2JZZA 4X62L 2ZXOA 3ULJA 1XJVA 3WAMA 1D1IA 4M8NA 3X3MA 1QOAA 2UUBL 2QKIC 3MHSD 1CT1D 1I50B 1LTLA 4K5VA 5K5PA 5BO4B 3KWLA 4KV2A 1CQVA 5KIXA 5C0XI 4W9CA 5JZEB 2V3SA 2EYHA 3AEBB 2SAKA 2JWUA 2F3VA 2WXHA 2KWVB 2EYMA 1I6HH 4WJ4A 1XD3B 1RIPA 3AE9B 2VQEQ 3DPDA 1EIFA 1WTPA 2BYFA 2KANA 2GBNA 1VLBA 1YHQA 2EYLA 5GMVA 1GNUA 3CPWA 1LT5D 1CFMA 2WB1E 3MC9A 4DAPA 3QWNA 3PF5A 4QUCA 5D2MB 5C1ZA 3B0AA 3NVZA 2KHJA 1FRRA 4HJ8A 2W3RA 2WXOA 1EM7A 1KHIA 4DR5Q 2DNCA 1ESFA 2AMCB 3MZ5A 1HR0Q 1NUCA 3IFDA 4UP8A 1BF4A 1N34L 4ID6A 3AFQA 2GOWA 4PYUA 1STEA 1W3SA 2G45B 1T9HA 4GOPA 3Q3JA 3FKIG 3PUVA 5GAGC 3OTOQ 1CA5A 4DV3Q 4ARIA 1P7FA 2FFKB 2OEDA 2KN4A 1FMAD 1IXRA 3AMZA 4UDUC 1G2SA 2JA7B 5JAVA 2K3UA 2K14A 2WIIB 5IOIA 2ASQA 4PZ6A 3NWSA 1O7LA 4RGOS 4QL5A 4WWMA 1I35A 3L17A 5G5GA 2H4OA 2A69D 4D2KA 3EUB2 3EQLC 1QE6A 2D5GA 4B3RQ 5IP9G 3H91A 5EE1A 4A3IG 2PE6B 2KNBA 4B3SL 3NY5A 4W9GA 1PZID 3UI3A 2FMMA 4KGTA 5DAUA 2B2VA 2I1KA 1TT5B 1Y56A 3PO3H 4JW0A 3H15A 2D07B 4ABNA 5IAAC 1D5XC 5LMNW 2WHIA 1I4PA 1B4OA 3I3CA 2JU6X 3LNNA 4JI8L 5M3FB 4DAYB 5I9PA 5IWAL 3M3YH 1BMLC 1A5RA 2XK5B 2A5UA 4RMFA 3CMAA 4BBRH 2NN6H 1XPRA 2BVCA 1TT2A 2Y3AA 4I6PA 3D8GA 3E0JA 1QVCA 4R4IA 1AEXA 1NR2A 2ZW0A 1LT6D 1PYSB 1C78A 3PSEB 4GDLA 1Y8RC 1XNRQ 4XQJA 1NBFC 4KD3A 1WJNA 1MG8A 1SDFA 2BE5C 3HKSA 2YYZA 4O42A 1F2YA 5EAYA 5JEAG 5FKAC 1IGDA 3I5JC 3VRAB 3ZQ4A 2BB6A 1LYLA 1XQQA 1TZ1A 2KDEB 4C3HG 3HFZB 4EGVA 3GV6A 1E8YA 4K0KQ 2K5NA 2KBNA 5ELDA 2D5DA 4YWGG 3EC8A 1BCPF 3CPFA 1HZAA 5JVH3 4DK1A 1E10A 2HUGA 5IT9L 1K50A 2JQOA 1R9TB 4TVAB 3VHTC 3H3VC 3M9BA 3SHLA 5DM73 4JI7L 1WZ3A 5JJLA 2LGYA 3WIMA 4MELA 3S1RB 3E9IA 4LNQA 3Q3OC 1K28A 3A54A 3PCOB 2DNFA 1TWAB 5FLXL 4QB4A 4GIVA 2LVQA 1L5PA 3MXNB 5KYLA 1BBWA 3DUZA 4P7IA 4PG3A 4DDGD 1WTOA 2EELA 4W9KA 1SJED 1IYJB 4OX9Q 5C44H 4AQYL 4MGIE 2K5VA 3GDEA 5CV8A 5M3FG 3CWIA 2RMMA 3DCGA 4ZAIA 4IQZA 4Q2JA 1BCPC 4CBVA 1VZ7A 4LDTD 4EUTA 2B2WC 2KJXA 4ZRZA 4DUYL 1SSOA 3OOCA 2J7ZA 3KDFB 4O0AA 4ZQ3A 1XPOA 4B3TL 1QNKA 2FHTA 4EX5A 3VXWA 1EY5A 1WOCA 2LVPA 1IP9A 3TRZA 2INCC 2IZVB 3ALBA 2IGHA 4DHZE 3I4MB 1UWXA 3KJOA 1SNCA 3DBHB 4A3KB 2J0KA 3DBLI 4TRDA 5C5LA 1N34Q 5M5YB 1O7YA 3JW0X 1OXUA 3EN2A 1TYGB 1WGHA 3RCZA 2L15A 4K8IA 4URKA 4CJ0B 4EZKA 4HCEA 4DR2Q 4FA6A 2OTLA 4KLKA 1QF6A 3CKIB 1EIHA 3PZ8A 2F0GA 3KLSX 2LZ6A 1LABA 2HD3A 3TREA 1ZKHA 3I57A 1CUKA 1GM5A 2YU9H 3I4NG 2HIXA 3NENA 4BBNC 1IL8A 2D3GA 3B2GA 4S0RA 3ZJYC 4JIOU 4CGYB 4XWWA 1VQDA 1G91A 3UIPB 3R93A 3Q8BA 4B9XA 4JBKA 2WDVB 4TKOB 2PO4A 2WINB 4XZ4A 2L76A 2LMCA 2Y5BB 4LFAL 1R4MI 5E6NA 1SYEA 3PF4A 3FAHA 4JV5Q 2F0JA 3HRZC 2WXKA 2V1YA 2KOLA 3DVGX 3QG1A 2QHOA 4DXAB 5D3DA 2QF7A 1O80A 1T5XD 1PXUA 1Q86C 3J7ZC 2PEAA 4KKSA 4OWTB 3RLFA 3NXWA 2DYOA 3GO5A 1A15A 1WJ4A 4IUUA 2WWZA 4FXCA 1MHHE 5EPLA 3T51B 1N63A 2B8GA 5EKKA 4LWCA 5IYCH 4LF8Q 5TR5A 2G9HD 1CHQD 1HZ5A 1T0YA 3FHWA 2JA9A 2ZTEA 2IY5B 1XLQA 1WX8A 3ZDTA 1EY4A 4WJQA 4XC2A 2KVRA 3A7LA 1JWUD 2FCQA 3HGBA 2VUMG 2KACA 1B9RA 4LUOA 4C4VB 1D1KA 2WAQE 4P6VF 4LCDE 4AYBB 1B9NA 4MH8A 2B63G 4MTKA 3Q8EA 1FJGQ 2R6GA 2HDEA 3H7PA 3SD5A 1N8RC 1GJXA 1EF1A 5I4DA 3EGRA 1IKMA 3U7DA 4KHVA 2NVTH 2JK8A 1D8LA 5CV6A 3GTLH 4YY3L 1UGMA 1TU2B 4PZ7A 1S3OA 2X6LA 1S72A 1LFDA 1UNSA 4BWGB 1F9RA 2JSOA 2B63B 2BS3B 4KZCA 1BQQT 5CHVC 5M5XB 3NZ3A 3HOXB 2WACA 3A4SC 3K6OA 3AI5A 1YZ6A 2R93H 2JSVX 1V80A 3GE3C 1WYWB 3KVFB 1K53A 1YOVB 4IUPA 3J80i 1YNXA 3L9AX 4Z9CB 2K52A 1N36L 1AW7A 1UE7A 1X54A 2HDLA 4X64Q 4IG7B 2K1FA 1PGAA 2B76B 4FJYA 2JA5H 1JE4A 5AZHA 3LJ3A 2C5CA 2HIVA 1GUOA 1YI2A 1CA6A 1FM0D 4ITKA 5HY6A 4LDTB 2WGSA 4MDKE 4NAMA 3CCUA 1WH3A 3S1QB 4IJHA 4QGUA 3N1ZC 5EPKA 4FXGC 2F0FA 2ICIA 1JJ2A 3PS6A 2NVYH 1MHXA 4V190 2MJDA 1ICFB 1CJEA 1JCKB 3LXFA 3NUCA 3AQQA 4A3EH 3UF8A 3AEDB 4EZJA 2LASA 2MP2A 3OWEB 2K9XA 4DV7L 2ZNVB 1RHPA 3VYRA 3CSFA 1KFYB 1X3EA 4W9JA 4WFN3 2F0NA 2D11A 2ID0A 4JPSA 4JI0L 1FXTB 4MEMA 3X23A 4LNNA 3DHQA 3WAPA 5C4XH 1SYFA 4II3B 1CKNB 4L23A 3CC7A 1HZ6A 4KTAA 4DK6C 1SYGA 1WRIA 1F2ZA 5KNBA 1F9JA 3GTKH 2KZRA 1YITA 2V4DA 1SGHA 4GGQA 4Y52H 4EZLA 3U4VA 2WXFA 2ZVNA 4JOIC 1VDVA 1SE3A 4DNRB 3G6JB 5BMGA 4HVBA 2GVBA 3L0OA 3AU7A 2ENBA 4QUFA 2RQXA 3PIOA 2JXXA 3QCAA 4NZLB 2A8VA 5IGEA 4JVZA 1YJWA 2BA0A 4ZRIA 5C3EG 4FULA 1S5FD 3G71A 2A6HD 1G6ZA 2PLPA 4KX6B 4DU9A 1JWMD 2D3CA 2EOTA 2L3ZA 2L32A 1VQBA 1X3GA 3A55A 1ROEA 5L83A 3OW2A 4EKUA 1ZYRC 2KCCA 1RLFA 2WQYB 5FR6A 4ZUJA 4KK7A 1SYCA 1HNXL 4REZA 2C7HA 1X55A 1MVKA 2FE8A 3STBC 3TZUA 1SSNA 1PMRA 4DV1Q 1DOMA 1Y8OB 3AEVA 1NMGA 3GV3A 4LF6Q 3IT4B 2X6GA 3R8BA 4TKNA 1V8CA 5JJZA 1EZ6A 2KMCA 4DUYQ 3S1MB 1Z6HA 4MT5A 1C77A 1SMYC 1OTRB 1X65A 2NBFA 1N6ZA 2CU1A 3RFZB 5DPRA 2JQRB 1Z7TA 3MC8A 1JRPA 2NN6I 2D2CC 4KV6A 1HNXQ 3M63B 1XLOA 4R4OA 3J7AV 2D0PA 1GO3E 4XXEA 1K83H 1O7ZA 3MTSA 2J0TD 4AYBG 4JI3Q 1PFBA 3S14B 4HROA 4IDIA 3V6EB 4F1SA 4IUQA 1BVSA 1QUQB 4IJLA 1QILA 4LFCQ 3H7SA 3RI7C 5C3EB 5BYSA 2MO0A 2JZPA 2WU2B 2KX3A 3ZGZA 1XLPA 2MUYA 3GD7A 3KYHC 3UDXA 3ENEA 3PO2G 1PH3A 2E2IH 1VQ8A 1FR3A 5M3FH 1WM2A 1KC8C 2NVQH 2JRIB 2KYWA 4A55A 5DEHA 5IE8A 1XNQL 4DUZQ 1J0GA 3S1NH 3PO3B 1SAPA 1TKWB 2JYEA 1VJKA 3HOXG 4EQOA 3T16A 4M0WB 4ZHOA 2ZCBA 1WCMH 1NMFA 5BN3A 4RHRA 4LFBL 4OONA 4KKTA 4MN3A 4UAIA 1P1AA 2C9WB 5EBCA 2IGGA 3GTKB 3PRMB 4A3LH 1HNZQ 3FPUB 3J7A5 2PI2E 4IWQA 4K5XA 1JRUA 1Y1VB 2WP9B 1WTWA 4I6NB 1MI0A 4C3IH 1IBKL 4PZ8A 1BT0A 3ZJTA 3BDCA 2K04A 2WKCA 1KJTA 4GB9A 3UIOB 4LJPB 3V3XA 3K5MA 4ICVA 3CCMA 2R93G 4K0KL 3DWMA 4R9WA 2LFIA 1WY8A 4LF4L 1GJZA 1A70A 5EE9A 2KCTA 4L5QA 1IBML 2KUMA 4A3MB 1TWFB 1BKBA 1MI2A 3N1XC 3AU5A 3F2DA 3AH7A 1YQ3B 3P75A 1SYBA 5DPWA 1Q0WB 3ER0A 4HJ9A 1Q90A 4GN4B 1DXMA 5JXVA 2DNEA 4RFBA 2MNAA 2D9UA 5T8IA 1RD9D 3PLUA 1VQMA 4A3DG 2LMCB 2DZIA 1XTCD 3BZKA 3S2HH 1C4AA 2OJRA 1GB4A 3ICEA 2BH8A 2L0FA 2EDGA 2KTFA 4ZYSA 2GLSA 3CSTA 4HPMB 1V49A 5IT9E 4YSYB 4N6EB 1SRUA 1EWCA 4H13C 2YTVA 1B70B 1TWHB 3BS1A 1KH0A 2N1WA 4BY7B 1FXAA 3DVNV 2KCNA 4M8MA 2K7VA 3CMEA 4HJ5A 5M3MB 5CBAE 1PH9A 2WXLA 4DK3C 2LGIA 2F0EA 3HOXH 4IO9A 1DZ1A 3LDZE 3RR5A 4NQKE 1PZJD 2C35B 4OVZA 2SEBD 3D3RA 4A3EG 2H89B 1S3SG 3DHHC 1E3PA 5DPSA 4DR5L 3P1MA 1Q81C 3F2UA 4C4VA 2Q2IA 3DLLA 1S1QB 2UXBL 4BKTA 4HCSA 5J18A 1FFUA 5GQOA 1XCTL 2WLBA 4DN4M 2F0VA 1TR5A 5ELBA 1WTVA 5CHWA 2OQKA 2EJFC 4G3XB 1M4VA 2MEKA 5IY0A 3FKYA 2D10A 3U9SA 3NTKA 4J6IA 3EFXD 2RCFA 4NY0A 4Q5VA 4P72A 3PIP3 2FXQA 1HH2P 3H9DA 2VQEL 1B9MA 4BY1H 1YHAA 2JWZA 2UWQA 4W9EA 5JPMC 3PRZA 4H02A 4POGA 4CHTB 3W9CB 1UBQA 2FIDA 3ZJUA 4UP7A 2N3SA 1KL9A 1GOZA 2WS3B 3U30A 4B3ML 1D4BA 3Q14C 1FEHA 4BAXA 3L2PA 2VXWA 3SEBA 3QJYA 4S3SA 2VQFL 4MACA 1TWGH 2K5HA 4BY1G 2ZW1A 1CI3M 3WANA 1BBUA 3HUIA 3I9V1 3CCJA 3RNCC 1E2VA 5C2TB 4J6HA 1OFFA 3FEWX 2RR9A 2CHBD 2PQAB 1B53A 1LTBD 1YD8U 1NBWA 4L5RC 5CMDA 1FXIA 2Q5WD 3DOWA 3VTVA 1C9FA 1C7YA 2HQEA 1U4LA 1NDDA 2WU5B 4IFDH 2N7EA 3IAS1 1VQ5A 2AQ3B 3BINA 3BK2A 2OHFA 4NJ7A 2MHVA 3E5SA 4JBWA 3ABVB 5CC4A 2KC1A 4ZCKA 1SEBD 1IBLQ 4ANWA 3U9OA 2CQOA 1CZWA 1R7SA 2M56B 1KNEA 5ELCA 5C4JH 4US8A 1H95A 1KDCA 2Y0SG 1YMHE 3SR6A 1HE8A 3ZW3A 2BWES 1XYIA 5M5YH 1ASZA 3N30A 1IBMQ 3MP9A 3RULA 2LWPA 4G50A 3X3NA 4HJAA 4NNJB 5EE0A 1WJJA 4DR6L 2XVSA 3KJPA 2REXA 4DAMA 2UUCL 4K7SA 4NXNQ 4OXPA 1BUVT 4GKKQ 5I6WA 4HIKA 4BY1B 4YHHQ 2Y0SB 2JA6G 1YHBA 4X66L 1QOGA 3MXGA 4GOCA 1JE5A 1EY9A 1P16A 3TZDA 3F2CA 3QIAA 4HRSA 5CTRC 4A93H 3RNGC 4I6LB 4RHSA 1XMOQ 2YTXA 1G6PA 1U4RA 1PH5A 1JB3A 3G48A 1C76A 1RRBA 2L1AA 2M00A 2PW9A 3QQ8B 2R92H 2DENB 3HOYG 4IUMB 2B2YC 5LHY1 5G55A 1HUMA 5BYRA 1GUSA 1PHJA 1SB3C 3KK7A 1IBKQ 4IOIE 4V0BA 2M17A 3HVZA 1TVXA 1IGCA 1A8VA 2JX5A 1HQMC 1X56A 2RHQB 2X69A 3IKJA 5M3MH 1OGWA 3NZSA 4RCNA 2E2JB 3UINB 1KAAA 2NWGA 1TWHH 1L4ZB 1YNTE 1D2BA 3FP9A 2A6HC 2ZM6Q 4HCPB 4CO7A 2CWPA 1XMQL 3PO2B 3ITPA 2QDFA 3TEXA 4DV6Q 1EQTA 4DR7L 1EL0A 2G4SA 3L3OC 3NBHA 3FILB 4MNOA 2GBRA 2JA8H 4K1RB 3C8YA 5EE3A 3A74A 4YTMB 5KNCA 3D6WA 2IPKD 4A4IA 4OO1I 2ZVOA 5FO9B 1TJEA 2E75C 4BOZB 1VF5C 2Q8IB 1TXYA 3J81i 1H9JA 2QCZA 4BBRB 4HJGE 4JWUC 3BZCA 1B50A 3TS0A 4LF6L 5CBEE 3M3YB 3A5ZB 2E3TA 3CCQA 2WXPA 3N6RA 4MJSA 1EYDA 3ECIA 4O1NA 3GTGB 3HOYB 5ELNA 4A3BH 3N1YC 5NUCA 3B2FA 3MFGA 4BY7G 4AJWA 1N32Q 2KOXA 3GP7A 2EYPA 5ELFA 4A3MG 3RZFA 1LV9A 2WXJA 3DEPA 4M0WA 3L54A 4L1BA 4DK5A 2XGTA 4GLVB 1WGGA 5JEAH 3N9YC 1E0BA 4JLCA 4AYBE 3IXSA 1RCVD 5A2QL 1G8ZD 1WCMB 3PV0A 3UDIA 1TQOA 2GA4B 2PI2A 4JQWC 4HK2A 5IGFA 3TMEA 3HIZA 2EKIA 2K5QA 3OJ3A 2KTRA 2B2TC 2E5LL 3DBSA 2BS4B 2K1BA 1UBIA 5HGQA 4LF9Q 3A0JA 3W2DA 1S5DD 3I70A 1JALA 1MFWA 2J4XA 3H6MA 4JYAL 3ZJVA 3VA7A 4ZLTF 5C3EH 3FVQA 4HEDA 4ZRJA 3FDTA 4K81A 3BU2A 3ND8A 5M3MG 5C0XJ 1X1MA 1Z9FA 3PUWA 3BYTB 4ZHPA 4UPAA 3T3NA 3M7NA 2Z0EB 3H6NA 3TBLD 1UD7A 5CV7A 4OEMB 2OOBB 3HOZG 4E71A 1UUPA 5GADC 1VQLA 3R3OA 5HI1A 4YSZB 2KDFB 2EY6A 1RWSA 3RZOB 1D3ZA 3SFDB 4DR7Q 2K8HA 2PW5A 3ZVVA 1GXDC 1F77A 4GNXA 3A9JA 1X32A 1OEYA 2H88B 1CHPD 2OF1A 5IP9H 3TEWA 5C3JB 2L1BA 4RKLA 5DNFA 2ES2A 1XPUA 3U2SC 4FADA 2B29A 2RHSB 1C79A 3B08A 1L2NA 2Q8TA 5IN7A 1YN4A 3EJIA 3RNUA 2MO1A 1CZPA 2F4VL 5JJIA 3DQVA 1MBYA 5JJKA 2LFNA 4A3BG 1FD6A 4YXDB 3KYCD 1TZOA 1WJUA 2VZAA 5G2NA 1IZ6A 3I4NB 5IOCA 3TSSA 3WWVA 4WQMA 4DWFA 4DAVA 1P3QU 3F8TA 3D0FA 1V43A 3DWPA 4AOFA 1L4DB 4AJYB 3I91A 4FF3A 1EY0A 1YIJA 1VRAB 1SN8A 2Z1CA 1PLFA 1XO3A 3IL8A 2IO0B 2IO2B 3D32A 4XWTA 1GUNA 4W9HA 3S17H 4KDLB 1K3RA 1VQAA 2MX2A 2FMCA 2VH1A 2JA7G 3ZRCA 2LXJA 2WXNA 1ZUD2 1MSHA 2JRHA 3HOWB 3PREA 3HKZB 2Q2TA 5CHFA 3A9KB 2BB5A 2D3BA 5C4JB 2O2VA 2G1EA 2I5MX 2PVOD 1KLUD 3PT2B 3EIVA 2AL6A 1QOBA 2IJ0A 2NUCA 1QZEA 3E6ZX 4JGHB 3Q23A 3TP6A 4X66Q 1ESRA 1JWBD 2KKCA 2CH4A 4AUQC 5ISRA 1VQEA 3NRZA 1D5MC 2KVMA 1YVCA 2KQ3A 4GLAC 1KXLA 2GB1A 4EEWA 4KGSA 2BTEA 1D5ZC 1YJJA 1VMPA 2F0LA 1TS2A 2O6VA 2N49A 2C7MB 2C60A 4WAAA 1PTOC 3LX0A 4X64L 3Q8CA 4HN7A 4FBJB 3NQTA 1E1TA 4HR7B 1P8LA 2HTME 2A74C 2K01A 4N9TA 3T13A 1C8CA 4BBSB 1SF0A 2K5PA 1MSGA 2LI5A 4M8AA 3HM6X 2GBMA 1ET6A 4R4QA 3WA0A 3J81c 1SNPA 1SBBB 3NEMA 3AEFB 1QKZA 2DAFA 5IGCA 4BA1I 3FC4A 3T1YL 3HOZH 4GLSC 3TP5A 3DWGC 3VUXA 4EFOA 1I7HA 2ICEC 1JQYD 1K8AC 1E6EB 2CW0D 1I6VC 4NMZA 1K8MA 1FRDA 4FHKA 5JH5C 1TTNA 3Q8FA 3FMCA 4DV4L 2R93B 3S17B 1ZP0B 1OQRA 4HJKA 5JHBA 4A75A 5HHDG 2EIFA 2QW7A 1GUTA 1WX9A 4R1JA 1WTRA 4WURA 1WGKA 2L0TA 1GHJA 2LS01 2NPTA 5LXHA 1NEKB 3R2IA 4N9PA 5KEEA 2HTHA 4XX5A 5IKCM 1VZ6A 1XX8A 1A63A 3M3JA 1II3A 3M62B 3GTMH 1U4AA 1N33L 2BDNA 2BE5D 3TP7A 2HT1A 2KLCA 3CRKC 1SE9A 3V61A 3PTFC 1ZYRD 2PVGC 1TS4A 4OVUA 3V2TA 3EECA 1ZEQX 1HA5A 1AN8A 4C56C 2JN4A 3O65B 1PYBA 4DA2A 1E24A 1PRTC 1ZE3D 3SDLC 1S5CD 2KENA 2Z8LA 1EY7A 2UXCQ 2PPBC 3E3XA 2IX0A 2MJ3A 3KUCB 1STGA 4A20A 4BY7H 3AE8B 4JI1L 3G4SA 1RAXA 3NS1A 2E5LQ 4MH0E 1PQSA 3VFKA 2ZJQA 3CD6A 1VZ8A 2WXMA 4EVOA 4KHPL 3UE0A 3SDZA 1N62A 3KWVA 4PYZA 1J5EQ 2EKEC 5HKHA 2CU3A 4DR4L 2LXAA 1BOSA 1TY2A 3TJPA 2N88A 1GG3A 2M0XA 3NBHB 4X65L 3EVQA 2NYZD 2IO3B 3TDQA 2N7JA 3FILA 4H7BA 4K2LA 2AL3A 1B44D 2K8BA 2WDTB 3A33B 5DCNA 2LUMA 1L7YA 4C3IG 1UZXB 1ZXIA 4DAYA 1L0XB 2ZEQA 5AJ3Q 3KUPA 1ZXTA 4XTCS 4TSSA 1EYCA 2DZJA 2L5TA 4HIDA 4ICUA 4IPDA 1LM8B 2AWOA 5JHAA 1YJIA 1F9SA 1NY4A 1Q8KA 2L12A 5C6AA 3V96A 2LGDA 3K0YA 4HWIB 2WXRA 5LMNQ 4IZ8A 4C3IB 1ENCA 3A4RA 3CXCA 2L83A 4FXKC 4UY8C 1RDPD 4ZDVA 1GUWA 4JBJA 2FCMA 1QOFA 1I3QB 1UF0A 1I4XA 1U0LA 1HNWL 2KMAA 1EFWA 1R4QB 4IPGA 4N59A 1AE3A 3KF8B 2KVZA 1WMHA 1PTOD 5C0XG 1C1YB 2A68C 5C4ZA 3J7AF 4U673 1DONA 1UH6A 4MM3A 1WRDB 3SU8X 4GKJQ 3GTGH 3HRDD 2NVUI 1A0IA 4IFDI 4KZ0A 4K2KA 1EWYC 5CX3A 4EE2A 1EYAA 3VR5A 2NVQB 3VH3B 5LNK1 3MEFA 5DM63 1E2ZA 2PMZB 3DEOA 1FL0A 4DHJB 5GAHC 1J8CA 4F87A 1HRJA 5COYA 5HGTA 3VUYA 5IP7H 1EUVB 1U4PA 3QWZB 3ZIMA 1MPEA 1ILPA 1EIGA 4DGZA 5JVG3 2D3AA 2IY0B 1VQNA 3AECB 3U7ZA 3AEEB 1STBA 1K51A 3S14H 1ILQA 2FJ2A 4LFCL 1XEEA 5DPTA 1CKOA 2DJGC 1AE2A 2GBJA 3H0GH 4G7HC 4LFBQ 3PUYA 1E7UA 3K0XA 2KHSA 1XMQQ 1HUNA 3QARA 1HTLD 4WRDA 2VH2A 2EJMA 2C7NB 1XNQQ 1V1QA 1Q82C 2FIFA 1GB1A 5EGTA 1J7CA 4BXXH 3OIQA 2OTJA 2NTSA 3IAM1 2KFJA 2XWJB 4GN3B 4JI6Q 1YX6B 3S1MH 1JR0D 3AN1A 3P4QB 1TWCB 3BIID 4YCVA 1O78A 3EROA 1SLJA 1WD1A 4J15A 2N55A 2UUCQ 1JC7A 1RF2D 5FR3A 3PGEA 2QA4A 2HQLA 3MHZA 1PRTB 1MKHA 1NVID 1A6XA 3DBRI 2QC8A 3N20C 4EQ5A 1B8AA 4YTPB 1I4GA 4BBSG 1RL2A 4ACFA 2Z9HA 2B2UA 2SDFA 1VQ4A 1PUTA 3E0EA 5DLQE 4YHHL 2VRRB 1B2TA 4BBRG 3A56A 3SE0A 5K36G 3KUDB 2Z6BA 1H4RA 1PGBA 2A73B 3PQIA 5E4WC 1ENFA 2MPMA 1J7AA 1LTSD 1IKLA 1L1OA 1JB7A 1J5EL 4IM0A 3MHBA 4PMCA 3QR8A 3GTQH 3K7UC 2BKFA 1SJHD 2INPE 1SE8A 4A3DB 4AH6A 4HKQA 3R3MA 4DV3L 5CYUA 1E9MA 2KEDA 3A8JE 3GB1A 4ZRPA 2MBBB 2DZKA 4C3JH 2LJ5A 4Y7NB 5M5WB 2UXDL 1GHKA 1IBLL 3AU4A 3KOJA 4FNFA 2JA6H 2INNE 1YJ9A 3DBHI 3JAMi 1PFSA 5IA7A 4A93G 1S4ZA 1BUIC 5J39A 3I56A 3BJUA 1YX5B 4L6TB 3H8HA 4MSQB 2K75A 2MCNB 1STNA 4FVMA 1C4QA 2XBBC 3KF6B 2VS1A 3RZDB 2KWUB 2NZ1D 1Q1EA 3RNBC 5KRUA 1STAA 2ZPYA 4K3CA 1CKMA 5IYBG 3ERQA 2K05A 3S1QH 4G7ZC 1G6JA 4QIWE 4GOPB 3JVZX 1EY8A 2R3ZA 2IGDA 5CGKA 1AP0A 2JPHA 2LGSA 1WFQA 2JA5B 5EBDA 1QB5D 2KT7A 4FLHA 3RNAC 1TS5A 2I5HA 3M7GA 4NW2A 4W9LA 2CS4A 1EQQA 1VQFA 3CCRA 4BXXG 4QIWB 5IGDA 1RTOA 2B63H 2LJIA 3AULA 1HZ9A 5BN5A 2LHEA 2J52A 2Y5CA 4FYDA 2KN5A 2IX3A 2E8GA 3LWUA 3EFCA 1NCVA 2MQHA 3OMCA 3A1QB 2H5XA 3X0WA 3QX1A 1STYA 3I55A 3L16A 3GTOH 1VQIA 4C7ZA 4JC0A
chains in the Genus database with same CATH topology
3AE6B 2A6EC 3AE1B 1BNZA 2QILA 4KKIA 1DOKA 2L4NA 1EY6A 1U4MA 2ZXRA 1PRTD 2F0KA 2WKDA 3BYYB 3S16B 3SK5A 2F4IA 1ZKOA 3WOFA 1S5BD 1H9RA 3L7ZC 5LL6X 2E6XA 1EZ8A 2ONQA 4NKLA 2F0QA 4L8JA 4C3JG 3AV8A 5F2DA 2F1MA 2IWHA 3HEJA 2K0PA 2L52A 1UAPA 3HOVB 2WXIA 3GS2A 2IT1A 2V3PA 4LMQD 4QF4A 3AE5B 1EU4A 3W5VB 1V1PA 4JK1C 2M9VA 1V8QA 4A3IB 1G2TA 1NENB 4K5WA 1TKGA 3K5LA 3QOLA 4RGNA 3FPPA 2F0DA 2WNMA 3NWTA 4G4KA 5IGGA 3C1EA 4AQ7A 3CHBD 4A3JB 1YN5A 5AFWA 2YEPB 3OSOA 5D7GA 3EA6A 3HP3A 3SFEB 3WCQA 1YNNC 5ELEA 3NP8A 3KF8A 2O4XA 1JOOA 1JWAD 4RWSC 3MP9A 2F0OA 3D4WA 2N9LA 3D4DA 2PQEA 3KQ4A 4MM3B 3Q8AA 1L0YB 4KY7A 5FO8B 4RCOA 4KJNA 4HSPA 1PDQA 1RODA 2Z4HA 1PGXA 3RPFC 2I2YA 4C2MB 1YNJD 4FO2A 3I4LA 1XCQL 4CKEA 4ARCA 2Y5PA 4ME5A 1PTOB 3HG9A 3NPPA 4ZKCB 2WDQB 1M8AA 4XYOA 1Q3LA 3PMFA 1BDOA 4KJOA 1A3TA 3NUHB 2QIEB 1KNAA 5H92C 5D3IB 3D31A 3H0GB 2WDRB 3P20A 2O5JC 4JWSC 3M4YA 1UGJA 1KTKA 1FIQA 2R92B 3VYUA 3NTIA 3DWAA 3J81L 2DN8A 3P4RB 2YEPF 4H2AA 4DK0A 2RPVA 5G3LF 3MC0B 5HURA 1IYVA 4WIPA 2SNMA 3S9WA 4WAFA 4GZYC 4WH4A 2NTTA 1S5ED 3KBXA 2WV6D 4LAAA 2LKVA 4EQPA 2LHDA 3BDOA 3OW7A 1W6KA 2AX5A 4IUNA 2QSDA 3C46A 3P42A 2K03A 4A6QA 1ZDVA 3CQZB 1XWEA 1U9RA 4Q0FA 1CQFA 3LWEA 1C48A 2KA7A 2TSSA 4HMJA 1I4HA 1PDXA 2SOBA 3AB5A 2NVYB 3K59A 3RMHA 2N0SB 2LY7A 3DWQA 4CKCA 2DWQA 4OZCA 4ZK9B 4PQXA 4HSVA 3Q6SA 4RA8A 1MGSA 4BA2I 2MJEA 2C9OA 3OWFA 2B2UC 3P7JA 4KD4A 1ZDXA 3U52E 2AQ1B 4L2YA 2XIWA 5CR3A 4CKBA 1OXXK 2CJNA 1F0ZA 3D6CA 2DY8A 4XT3B 1GPXA 4BS9A 3NSWA 2E2HB 4R3DA 1LTTD 4KY5A 2PIAA 4PV1C 4B08A 2GRIA 2WAQB 4ZOHC 1L0VB 2JXTA 4C3HB 4YIJA 4F8MA 2MP1A 2EYJA 1JOKA 3Q24A 4B0MA 1E2WA 2CQAA 3LB8C 5BMHA 2PYKA 2F03A 4N58A 3NHHA 5AUKA 1LACA 4OZBA 4XIGS 3DMUA 3A8KE 5BN4A 4OIJA 4DQOC 1ICWA 1PRTF 2E74C 1K52A 5EKIA 1VDZA 1XLNA 5H8YE 4IKGA 2MH7A 2LEKA 3BVMA 5IODA 1CM9A 4ZRQA 4YSXB 1H9KA 4K14A 4G7OC 2EYFA 1I4RA 1RFKA 3OIPA 1LTGD 1SE4A 2A5HA 1FNUA 4IFDJ 1VMCA 1T6BX 3BDLA 2TMPA 3OHXC 2RA4A 4RGMA 3S1NB 5GXGB 2FUG1 1HHVA 4FXDA 2V3NA 4RKBA 2FINB 1SFOB 1DOIA 2BS2B 1JMLA 3NE5B 4FP5D 2Q8RE 3C2PA 1JWSD 5CORA 1JROA 2PTLA 4KGRA 3MAQA 5C5MA 3GQBA 1B3AA 3J9CA 3CU7A 4F7XA 2EYOA 3C1FA 2RBMA 1LT3D 1AYFA 2ACZB 4TQUS 4CJ1B 1TS3A 1QWYA 2B2WA 1P7EA 4PT5A 5HG2A 4KY6A 1PTOH 3IT6B 2O2LD 1YNND 3B9JA 3VR8B 4MIUA 1ZXHA 1VF7A 3NVVA 4A8XC 1K8OA 5LL6S 2W82A 4HMIA 1WXQA 2R7ZB 2QCPX 3KLSA 2WB1B 2AUKA 2OEOA 4XT1B 1VR9A 1QT9A 1JOQA 2GI9A 2V0GA 4NJCA 4MHEA 3J80L 1ENAA 4HAEA 1CTMA 5FOBB 1F2RC 2F0WA 3VA5A 5A35A 1SIJA 4C80A 2KMMA 2JEBI 4DFAA 2RDFA 3BG3A 3QO2A 5FO7B 1E0ZA 1KABA 2QEJC 2WP8J 1A2TA 1BXTA 1SMYD 3VR3A 3MXNA 1ZPSA 4XDXA 4FF2A 5A2QE 2AWNA 2EVBA 1AZPA 1IYUA 2FBWB 4DF7A 3K5OA 1FCLA 3Q0AA 1F2RI 1OXTA 4TQ0A 2KEEA 3TN2A 1HFGA 4XE0A 3ZYYX 2JEAI 4HKZE 1F2LA 1ACCA 4WORA 1DJRD 2BT6A 3HOUB 1TKYA 2CW0C 1ONLA 1IW7C 3GTJB 4OL7A 1EEFD 1HFNA 2F0MA 1JICA 1I6HB 5FLXE 4IFDG 1B1ZA 2K5DA 3K7AB 5EPJA 4EQNA 1FFVA 2NVTB 1LTRD 1RTNA 5EQ0A 1ML0D 3GTMB 1VCIA 3VYSA 1F2MA 5M9OA 3PZ7A 2K22A 1AWDA 1NSNS 4A93B 4OHJA 1QCBD 2OT2A 4YTNB 1MD2D 2RSNA 3BVZA 4GDKB 2EY5A 2DYMA 1PFDA 2PZUA 2O5IC 4DXGA 1KF6B 1HTPA 2I07B 3HOZB 2B2TA 4KKJA 4HTHA 2EJGC 1LTAD 5I2YA 4DNTB 2PZWA 3I72A 3I73A 3W5UB 3P63A 1FD7D 4XQQA 2F0SA 3A7AB 1BO0A 4H0LC 1C4CA 2M0AA 1L6UA 3E9SA 4R8NA 4A3FB 2VB3X 2RKSA 1T5EA 3VYTA 3H94A 4ODGA 2PNRC 2W54A 5K36H 3VQIA 3VR6A 4C3JB 1BBXC 1DYQA 2RSOA 3SR1A 2RDGA 5G3LD 3K5NA 2XNAC 3GTQB 3MA2B 2XN9C 3SK4A 1RM6C 3ETRA 3K57A 4OGQC 4KKUA 1L6VA 3OMGA 1WD0A 3OPOA 3TBIB 4LK1C 5C44B 1IBXB 1SYDA 4L63B 2WXGA 1IUEA 2F3WA 2CVRA 1DOYA 1G291 3RD4A 4OZAA 2HDMA 1PZKD 2BW2A 1LLRD 3IAYA 2J42A 3QOJA 3FKIB 5HFYA 4C1NK 1N61A 4A9AA 1QOHA 5BMIA 2JYOA 3MEHA 4NP5A 1W6JA 2PW7A 5CV4A 1HPCA 4XDDA 3DM1A 1KDBA 4KI0A 2VUMB 4KHZA 1EFID 1HEZE 1ZXIA 1PFMA 5E1FA 3MFYA 2EPBA 2NVXB 4PMWA 2XRSD 1JORA 2IW3A 2MJ8A 4E6IA 3D4RA 3WOEA 5JOBA 3MXPA 2PCFB 3AE3B 3Q69A 2IX1A 1QQRA 3J7YW 5I2XA 4B0EA 3BK1A 4IUVA 1FNVA 2KWDA 5AUIA 1EOTA 3GTPB 4F88A 1J8IA 3AEGB 1LT4D 1A3VA 1HCZA 1R4PB 5E3FA 2K28A 3MWYW 1AZQA 2M2LA 3IFTA 3TEYA 1KLGD 4A3BB 3P1HA 5KNDA 2K33A 1QLBB 4CJ2C 4ZKBB 3W3AA 2E2DC 2E2IB 1DOLA 3I8ZA 1SNMA 1DM0B 4XQNA 2AQ2B 2A6ED 1N5WA 1STHA 3CIRB 4TMAB 2W3SA 2HCIA 3T3OA 2K6AA 2AUJD 3PUZA 2F0PA 3N52A 5C0XH 3L4PA 1FCCC 3TEZA 5CV5A 1LTID 1SNDA 1BCPD 1H9SB 4ULLA 5I9OA 4U68A 1WYGA 3BZDB 1FYCA 2DLBA 2QJLA 4GDLB 1Q10A 2M19A 3E56A 1SXTA 3MXUA 5TSSA 3NVWA 1H9MA 2L55A 4P16A 3P4SB 1XF5L 2ON8A 4K6DA 3V05A 1J7BA 1WTQA 3H09A 1WWTA 3ND9A 2B39A 3MJ5A 3AB9A 3ONAB 1RKNA 1SNOA 3PIO3 4X3KA 2F0HA 3WDNA 1NR4A 2XSCA 4NAWB 4H44C 4X3UA 3URYA 1YNJC 3A8IE 1CZGA 5C4XB 2A68D 1D6EC 3O13A 4ILWA 5IIFA 3AE4B 1EEID 1DD2A 1V1OA 3PUXA 4RF1A 4LJZC 5E4XA 3VR9B 2JYTA 3HS0C 4RAUC 3G7LA 3QB3A 1CK1A 1GUGA 2KECA 4HEA1 2I38A 1WSPA 3M85A 2BYTA 2SNSA 1N60A 1FGBD 4C7YA 1JQ4A 2JA6B 3HVDA 1IHZA 1T3QA 1Y1WB 1F9PA 4OO1G 4I7ZC 2E76C 1SE2A 2F0TA 3CRLC 5EJWA 1DGJA 3NVYA 2J53A 1YN3A 2NN6G 5FK9C 4X3SA 1LO5D 2L11A 5JPNC 2BDOA 5C3XA 3GTLB 2IL8A 2XWBB 3T56B 4FF1A 4K8JA 3C3LA 1HQRD 3AE7B 4J3OD 2JE6I 2NMQA 2VZKB 4OIKA 2RDHA 2OXPA 4RGTA 5J22A 1AFPA 2HCCA 3VRBB 1EU3A 4J8QA 5D65A 1FO4A 1DCZA 4FF4A 2EZVA 1BR9A 2PMVA 2RVLA 2QMTA 1PTOF 3I90A 2EE1A 3S15B 1OXVA 2NB0A 2BBCA 1Y8NB 2IDYA 3VR2A 2R61A 4QCLA 4US9A 1QNUA 3VR4A 2MGSA 2W55A 1X3QA 4P2CB 3S2HB 2A69C 2F0IA 4J1MA 4A90A 4X3TA 1Y69U 1OXSC 4JE3B 1NI3A 1F9QA 5T1IA 1A3UA 5T1GA 4AS1A 3DXJC 3JAML 1Y8PB 3J80E 4YT0B 1RYJA 1Q12A 2EY1A 4B9WA 4RNAA 2YU9B 3AE2B 1NAPA 3KLRA 4WJWA 2B2YA 3SK8A 2VNUD 5BYQA 2PZTA 5I6YA 3BWUD 2L0CA 3BVGA 2PKOA 1EWHA 5JEAJ 2ZT9C 4OO1H 5C4HA 3U4EG 2K5WA 1OO9B 5C3WA 1C4PA 2KAJA 5KYIA 1YQ4B 3SK6A 1QG7A 3AM9A 4OW0A 3T53B 3UI2A 4KMUC 4PNYA 1SNQA 1E7PB 3NQIA 1I4QA 4JX1C 5KGUA 1K83B 3HZXA 1EQVA 2G9DA 4M1UB 2JA8B 1GAQB 3SVMA 1V97A 5MPOA 3SXHA 4USAA 5G5HA 1ET9A 3TUOA 5D14A 4LLGM 3PO0A 5J1ZA 2VZKD 4LK0M 2ZXPA 4DXFA 2D62A 2I46A 3AMUA 2BCOA 1H9SA 3MVVA 3M4OB 2L9HA 4KN4C 1JW9D 4RF0A 1Q8IA 2KDMA 1UEAB 2B2VC 2H1EA 1IW7D 2JXMB 3TP8A 4IURA 2KQ4X 3W1SA 1XXGA 4PMBA 2K32A 1QJOA 4KN7C 5IGBA 1UWMA 3K58A 4NDXA 1A2UA 2BA1A 2B8FA 3RUZA 1BCPB 1HXYD 1FNWA 4A3GB 1WVLA 5CV9A 4XYQA 1N5XA 2BOSA 1X3PA 4G57A 1DOXA 1KDAA 3S2DB 1OQQA 2DBYA 1Z47A 1HA6A 2QDBA 1TIID 5E6JA 2N9KA 3NK9A 4TQ1A 1RJTA 4A3EB 2X38A 3AEAB 1Q1BA 2EXZA 2EY2A 4I65A 4IALA 3R2TA 2F0UA 4C1NI 4RH6A 1IBXA 2XRQD 1NYQA 2JP1A 3NTHA 4CQNA 3Q22A 1TWGB 1ZOYB 3JAME 3LYYA 3NBIA 1V1PB 1PFNA 4IUTA 1TKEA 3P4PB 3J81E 2V4IB 4QMGA 4R8IA 1J9OA 4K6LA 4XDCA 4LTUA 3T4AC 1TY0A 2DY7A 4IN3A 1WTXA 1KRHA 2VB2X 2CJOA 1NYRA 1PYWD 2Z4IA 3KBGA 5EKLA 3GTOB 4ZUIA 3FRPB 2ZXOA 1D1IA 3X3MA 1QOAA 2QKIC 1CT1D 1I50B 4K5VA 5K5PA 3KWLA 1CQVA 5KIXA 5C0XI 2EYHA 3AEBB 2SAKA 2JWUA 2F3VA 2WXHA 2EYMA 3AE9B 1WTPA 1VLBA 2EYLA 1LT5D 1CFMA 4DAPA 3QWNA 4QUCA 3NVZA 1FRRA 2W3RA 2WXOA 1EM7A 2DNCA 1ESFA 3MZ5A 1NUCA 3IFDA 1BF4A 4ID6A 1STEA 3PUVA 1CA5A 4ARIA 1P7FA 2FFKB 2OEDA 2KN4A 1FMAD 3AMZA 4UDUC 1G2SA 2JA7B 5JAVA 2K3UA 2WIIB 3NWSA 1O7LA 4RGOS 4WWMA 5G5GA 2H4OA 2A69D 4D2KA 3EUB2 3EQLC 1QE6A 2D5GA 3H91A 5EE1A 3UI3A 1PZID 2FMMA 4KGTA 5DAUA 2B2VA 1Y56A 4ABNA 1D5XC 1I4PA 1B4OA 3I3CA 2JU6X 3LNNA 5M3FB 5I9PA 1BMLC 2NN6H 1TT2A 2Y3AA 3D8GA 3E0JA 1AEXA 1NR2A 2ZW0A 1LT6D 1C78A 4XQJA 4KD3A 1SDFA 2BE5C 4O42A 2YYZA 5JEAG 1F2YA 3VRAB 1IGDA 5FKAC 3ZQ4A 2BB6A 4C3HG 4EGVA 3GV6A 5ELDA 4YWGG 2D5DA 1BCPF 5JVH3 4DK1A 1E10A 2HUGA 5IT9L 1K50A 1R9TB 3H3VC 3SHLA 5DM73 3S1RB 3A54A 1TWAB 5FLXL 4QB4A 1L5PA 5KYLA 3DUZA 1WTOA 2EELA 1SJED 5CV8A 3CWIA 2RMMA 4ZAIA 4IQZA 4Q2JA 1BCPC 4CBVA 1VZ7A 2B2WC 2KJXA 4ZRZA 1SSOA 3OOCA 2J7ZA 4ZQ3A 1QNKA 2FHTA 1EY5A 2IGHA 3I4MB 1UWXA 1SNCA 4A3KB 4TRDA 5C5LA 5M5YB 1O7YA 1OXUA 1TYGB 4K8IA 4CJ0B 4HCEA 1QF6A 3CKIB 1EIHA 3PZ8A 2F0GA 3KLSX 1LABA 3I57A 1IL8A 3B2GA 4XWWA 4CGYB 1G91A 3R93A 3Q8BA 4B9XA 2WDVB 4TKOB 2PO4A 2WINB 2LMCA 1SYEA 3FAHA 2F0JA 3HRZC 2WXKA 2KOLA 3QG1A 5D3DA 2QF7A 1O80A 1T5XD 1PXUA 4KKSA 3RLFA 2DYOA 3NXWA 3GO5A 1A15A 4IUUA 4FXCA 1MHHE 5EPLA 3T51B 1N63A 2B8GA 5EKKA 2G9HD 1CHQD 1HZ5A 1XLQA 1EY4A 3A7LA 1JWUD 3HGBA 2KACA 1B9RA 1D1KA 4P6VF 4AYBB 1B9NA 4MH8A 3Q8EA 2R6GA 2HDEA 1GJXA 5I4DA 3EGRA 1IKMA 4KHVA 5CV6A 1TU2B 2X6LA 1UNSA 4BWGB 1F9RA 2JSOA 2B63B 2BS3B 1BQQT 5M5XB 3NZ3A 3HOXB 2WACA 3K6OA 2JSVX 1K53A 4IUPA 3L9AX 4Z9CB 1AW7A 2HDLA 1PGAA 2B76B 1JE4A 2C5CA 1GUOA 1CA6A 4ITKA 1FM0D 4NAMA 3S1QB 5EPKA 4FXGC 2F0FA 2ICIA 1MHXA 4V190 2MJDA 1CJEA 1JCKB 3LXFA 3NUCA 3AEDB 3OWEB 2K9XA 1RHPA 3VYRA 1KFYB 4WFN3 2F0NA 2ID0A 4JPSA 3DHQA 1SYFA 4L23A 1HZ6A 4KTAA 1SYGA 1WRIA 1F2ZA 5KNBA 2V4DA 2WXFA 1VDVA 1SE3A 4DNRB 3G6JB 5BMGA 3AU7A 2ENBA 4QUFA 2RQXA 4NZLB 5IGEA 2BA0A 4KX6B 1S5FD 1G6ZA 2A6HD 2PLPA 4DU9A 1JWMD 2L32A 2EOTA 3A55A 1ROEA 1ZYRC 2KCCA 2WQYB 4ZUJA 4KK7A 1SYCA 4REZA 1MVKA 2FE8A 3TZUA 1SSNA 1PMRA 1DOMA 1Y8OB 3GV3A 3IT4B 2X6GA 3R8BA 1V8CA 5JJZA 1EZ6A 3S1MB 4MT5A 1Z6HA 1C77A 1SMYC 2NBFA 3RFZB 2JQRB 1Z7TA 1JRPA 2NN6I 2D2CC 4KV6A 1XLOA 3J7AV 4XXEA 1O7ZA 3MTSA 2J0TD 4IDIA 3S14B 1PFBA 4HROA 4IUQA 1QILA 5C3EB 5BYSA 2WU2B 2JZPA 3ZGZA 1XLPA 2MUYA 3GD7A 1FR3A 4A55A 5DEHA 3PO3B 1SAPA 1TKWB 2JYEA 1VJKA 4EQOA 3T16A 4ZHOA 5BN3A 4RHRA 4KKTA 4MN3A 4UAIA 5EBCA 2IGGA 3GTKB 3FPUB 4K5XA 1Y1VB 2WP9B 1WTWA 1MI0A 3ZJTA 3BDCA 2K04A 2WKCA 3V3XA 3K5MA 3DWMA 4R9WA 2LFIA 1A70A 5EE9A 2KUMA 4A3MB 1TWFB 1MI2A 3AH7A 1YQ3B 3P75A 1SYBA 1Q90A 1DXMA 5JXVA 2DNEA 4RFBA 2D9UA 5T8IA 1RD9D 2LMCB 1XTCD 1C4AA 1GB4A 2EDGA 4ZYSA 5IT9E 4YSYB 4N6EB 1EWCA 4H13C 1TWHB 3BS1A 1KH0A 4BY7B 1FXAA 2KCNA 2K7VA 5M3MB 5CBAE 2WXLA 2LGIA 2F0EA 1DZ1A 1PZJD 4OVZA 2SEBD 3D3RA 2H89B 3P1MA 3F2UA 4HCSA 1FFUA 1XCTL 2WLBA 4DN4M 2F0VA 1TR5A 5ELBA 1WTVA 2EJFC 1M4VA 2MEKA 3U9SA 3NTKA 3EFXD 4Q5VA 3PIP3 1B9MA 5JPMC 4CHTB 3W9CB 3ZJUA 1GOZA 2WS3B 1D4BA 1FEHA 2VXWA 3SEBA 3QJYA 4S3SA 4MACA 2ZW1A 1CI3M 3HUIA 3I9V1 1E2VA 5C2TB 4J6HA 1OFFA 3FEWX 2CHBD 1B53A 1LTBD 5CMDA 1FXIA 2Q5WD 1C9FA 2HQEA 1U4LA 2WU5B 4IFDH 3IAS1 2AQ3B 3BK2A 2OHFA 2MHVA 3E5SA 4JBWA 3ABVB 5CC4A 1SEBD 3U9OA 1CZWA 1R7SA 2M56B 1KNEA 5ELCA 4US8A 1KDCA 1YMHE 3SR6A 1XYIA 3X3NA 5EE0A 2XVSA 1BUVT 5I6WA 4BY1B 2Y0SB 1QOGA 3MXGA 1EY9A 3TZDA 3QIAA 4HRSA 4RHSA 1C76A 2L1AA 1U4RA 1JB3A 2M00A 2PW9A 2B2YC 5LHY1 1HUMA 5BYRA 1GUSA 1SB3C 3KK7A 4IOIE 4V0BA 3HVZA 1TVXA 2JX5A 1HQMC 2X69A 3IKJA 4RCNA 2E2JB 1KAAA 2NWGA 1L4ZB 1YNTE 1D2BA 2A6HC 3PO2B 3TEXA 3ITPA 1EL0A 1EQTA 3L3OC 3NBHA 3FILB 3C8YA 5EE3A 4YTMB 5KNCA 3D6WA 2IPKD 4OO1I 5FO9B 1TJEA 2E75C 1VF5C 2Q8IB 1H9JA 4HJGE 4BBRB 4JWUC 1B50A 5CBEE 3M3YB 2E3TA 2WXPA 3N6RA 1EYDA 4O1NA 3GTGB 3HOYB 5NUCA 3B2FA 3MFGA 3GP7A 2EYPA 5ELFA 1LV9A 2WXJA 3DEPA 4M0WA 4L1BA 5JEAH 3N9YC 1E0BA 3IXSA 1RCVD 5A2QL 1G8ZD 1WCMB 3PV0A 1TQOA 2GA4B 5IGFA 3TMEA 2EKIA 2K5QA 2B2TC 2BS4B 2K1BA 3W2DA 1S5DD 3I70A 1JALA 2J4XA 3H6MA 3ZJVA 3VA7A 4ZLTF 3FVQA 4HEDA 3FDTA 3ND8A 5C0XJ 3PUWA 3BYTB 4ZHPA 3T3NA 3M7NA 5CV7A 1UUPA 3R3OA 5HI1A 4YSZB 2EY6A 1RWSA 3RZOB 3SFDB 2PW5A 1GXDC 1F77A 1X32A 2H88B 1CHPD 2OF1A 3TEWA 5C3JB 2L1BA 4RKLA 5DNFA 3U2SC 1C79A 2Q8TA 1YN4A 3EJIA 1CZPA 1MBYA 2LFNA 1FD6A 4YXDB 1TZOA 3I4NB 5IOCA 3TSSA 4WQMA 4DAVA 1V43A 3DWPA 1L4DB 3I91A 4FF3A 1EY0A 1VRAB 2WXQA 2Z1CA 1XO3A 1PLFA 4XWTA 3IL8A 1GUNA 2FMCA 2WXNA 1ZUD2 1MSHA 3HOWB 3HKZB 2BB5A 5C4JB 2G1EA 2PVOD 1KLUD 1QOBA 2IJ0A 2NUCA 3E6ZX 3Q23A 3TP6A 1JWBD 1ESRA 5ISRA 3NRZA 1D5MC 2KVMA 2GB1A 2KQ3A 2BTEA 4KGSA 1D5ZC 1YJJA 1VMPA 2F0LA 1TS2A 1PTOC 3LX0A 3Q8CA 4HN7A 3NQTA 4HR7B 2HTME 2A74C 2K01A 4N9TA 3T13A 1C8CA 4BBSB 1SF0A 2K5PA 1MSGA 4M8AA 1ET6A 1SNPA 1SBBB 3AEFB 1QKZA 5IGCA 4BA1I 3FC4A 4GLSC 3TP5A 3DWGC 1I7HA 2ICEC 1JQYD 1E6EB 2CW0D 1I6VC 4NMZA 1K8MA 1FRDA 3Q8FA 3FMCA 2R93B 1ZP0B 3S17B 1OQRA 5HHDG 1GUTA 1WTRA 4WURA 1WGKA 1GHJA 2LS01 1NEKB 3R2IA 4N9PA 5KEEA 1VZ6A 1XX8A 1II3A 2BDNA 2BE5D 3TP7A 3CRKC 1ZYRD 2PVGC 1TS4A 3V2TA 1ZEQX 1HA5A 1AN8A 4C56C 4DA2A 1PRTC 1ZE3D 1S5CD 2Z8LA 1EY7A 2PPBC 2IX0A 2MJ3A 1STGA 3AE8B 3NS1A 1VZ8A 2WXMA 4EVOA 1N62A 3SDZA 3KWVA 2CU3A 1BOSA 1TY2A 2N88A 3FILA 3EVQA 2NYZD 2N7JA 3TDQA 4H7BA 4K2LA 1B44D 2LUMA 4C3IG 4DAYA 1L0XB 3KUPA 1ZXTA 4XTCS 4TSSA 1EYCA 2L5TA 2AWOA 1YJIA 1F9SA 2L12A 5C6AA 3V96A 3K0YA 2WXRA 4IZ8A 4C3IB 1ENCA 2L83A 4FXKC 1RDPD 1GUWA 1QOFA 1I3QB 1I4XA 1R4QB 4N59A 1PTOD 5C0XG 2A68C 5C4ZA 3J7AF 4U673 1DONA 3HRDD 4IFDI 4K2KA 1EWYC 4EE2A 1EYAA 3VR5A 2NVQB 5LNK1 5DM63 1E2ZA 2PMZB 3DEOA 4F87A 1HRJA 5COYA 5HGTA 1U4PA 1MPEA 1ILPA 1EIGA 4DGZA 5JVG3 3AECB 3U7ZA 3AEEB 1STBA 1K51A 1ILQA 2FJ2A 1XEEA 4G7HC 3PUYA 2KHSA 1HUNA 1HTLD 4WRDA 2EJMA 1GB1A 5EGTA 1J7CA 3OIQA 2NTSA 3IAM1 2XWJB 1JR0D 3AN1A 3P4QB 1TWCB 3BIID 1WD1A 1O78A 3EROA 2N55A 1JC7A 1RF2D 5FR3A 3MHZA 1PRTB 1NVID 1A6XA 4YTPB 1I4GA 2B2UA 2SDFA 1PUTA 1B2TA 3A56A 3SE0A 5K36G 1PGBA