5D3IB

Crystal structure of the ssl3-tlr2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
KYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Toll-like receptor 2
publication title Structural basis for inhibition of TLR2 by staphylococcal superantigen-like protein 3 (SSL3).
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
B PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d3iB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5d3iB01
1LLRD 1PTOC 1PZKD 1TS3A 1D5MC 1RCVD 1PTOF 2WV6D 1GOZA 4DXFA 1JWSD 1QILA 1KLUD 1XXGA 1LTTD 1KTKA 1PZID 1SEBD 1PRTB 2NTTA 1JQYD 1T5XD 1BCPB 1LTRD 1JR0D 4RGNA 1V1OA 1PTOB 2ICIA 3OWEB 1STEA 3GP7A 3DWPA 1FNUA 3SEBA 1I4PA 4Z9CB 1AW7A 1SJHD 1YN5A 4RFBA 4UDUC 1RD9D 3DWAA 4ZYSA 2IJ0A 3CHBD 1TS5A 1ENFA 5ELCA 1HA5A 1JWMD 1ET9A 1S5CD 2XNAC 3URYA 4C56C 4K6LA 1B1ZA 1V1PA 4RGTA 5FK9C 1KLGD 4RGOS 1ET6A 1S5ED 1G8ZD 5D3IB 3BYTB 1HTLD 1ESFA 3EA6A 1XTCD 4BWGB 1JWUD 1BXTA 1CHPD 1LO5D 2AQ2B 1FGBD 1JCKB 1SXTA 3DWQA 4L6TB 3R8BA 1M4VA 3W2DA 3R2TA 1FD7D 2XRQD 5ELFA 1LTBD 5ELBA 2G9HD 1BCPD 1AN8A 2R61A 1CK1A 1L0XB 1SE2A 1F77A 2CHBD 1EEID 1LT6D 3V05A 1RDPD 4RCOA 1S5FD 1TS2A 1D6EC 5D3DA 1FNWA 1LTSD 2O2LD 1I4GA 1EU4A 3TSSA 1LTAD 1V1PB 1LTGD 1S5BD 1LT4D 4RHSA 1TS4A 2NTSA 4DXGA 2IPKD 1UNSA 3KLSX 3R2IA 1UUPA 1I4XA 1TY2A 5TSSA 3BVMA 1EFID 1CT1D 1PZJD 1YN4A 2QEJC 1FNVA 1S5DD 1SE3A 1BCPC 2J4XA 1PRTF 1I4HA 4TSSA 3BVGA 1PRTD 1PYWD 1BCPF 1HQRD 5FKAC 5ELEA 1D5ZC 1D5XC 2XN9C 1LT3D 4L63B 4O1NA 4RGMA 1HXYD 1PTOD 3BYYB 1PTOH 2TSSA 1B44D 1CQVA 1DJRD 2AQ3B 3BZDB 4RHRA 1SJED 1TY0A 2Z8LA 3O13A 5ELDA 3BVZA 1LT5D 1LTID 4NZLB 3MC0B 1SBBB 1CHQD 1L0YB 1I4RA 2XRSD 1MD2D 1RF2D 1SE4A 1DYQA 2RDHA 4OHJA 1EWCA 5I4DA 2SEBD 1PRTC 1YN3A 3EFXD 4RH6A 1EEFD 1EU3A 2AQ1B 2RDGA 2QILA 3MFGA 1I4QA
chains in the Genus database with same CATH superfamily
2H5XA 2DZKA 4BY7B 1BF4A 3DPDA 2PKOA 4HKZE 3NY5A 2R7ZB 2EPBA 2INPE 4N59A 3DEPA 3S1QH 4A3JG 1P8LA 2C5CA 4WAFA 4PNYA 5CV4A 3GOEA 2BDNA 3HFZB 2N88A 2Q2HA 4KZCA 4W9LA 4G50A 2EYLA 3RCZA 4YXDB 3HOVB 2EXZA 4GOPC 1SE9A 2KK8A 2K22A 1L1OB 1VQOA 4QF4A 4NXNQ 4XX5A 3DBRB 3OWEB 4CGYB 4PS3A 2L05A 1UE6A 3ERSX 3I4MG 4KKSA 4II3B 2Q8TA 4JI2Q 1U5KA 2K5DA 4A3IG 3ENEA 3PRZA 3TUOA 5EDSA 2JK8A 3HHMA 1X3GA 4ZOHC 1OTCA 2E5LL 4XXEA 3EFCA 2L11A 3ZJUA 1ENFA 1GUSA 3BG3A 1QVCA 1RWSA 2Z0DB 3LX0A 4NQKE 1HNWL 3T13A 3IL8A 3SE0A 5FK9C 1A0IA 1N33L 2DJFC 1C4AA 4JI6L 3RFZB 2N78A 3CXCA 2W82A 1M8AA 2XK5B 1HZ5A 2J7QB 2LMCB 3MXNA 2D3GA 1ZKHA 5BMGA 2GBKA 3EVQA 4DV6L 1XNQQ 3VHTC 5K36H 3IT6B 3P75A 1V1QA 1LO5D 1YHBA 2JY6A 4POGA 3QARA 1MBYA 4PS8A 1A6XA 2MHVA 3QC8B 4L6TB 3R8BA 1FD7D 1VQGA 3U7ZA 1L5PA 4X57B 3KDFA 3CD6A 2N1WA 2B2VC 1BUVT 3CC7A 1AN8A 5C3XA 2WAQE 2NVTH 5L95C 1QCBD 4XQNA 2CHBD 4NAMA 3K6OA 1YX5B 2K52A 1WWTA 3SXHA 5C4XH 1LM8B 2IYDB 3ZTDA 2WGSA 5EE1A 3TSSA 2O2LD 1EWHA 3G6EA 4JBWA 2VW9A 1LTGD 2NCNA 3K5LA 4RHSA 5JEAG 5G3LF 4DUYQ 2QC8A 1CI3M 2PZUA 2WFWA 2K03A 4V0BA 4CQNA 5JPMC 1KAWA 3SU8X 2G3QB 3M4OB 4LUVA 1ZUD2 2KVRA 1F2RC 3OLMD 1WFQA 2L0CA 1CSPA 3DHHC 1QF6A 2X6GA 2KKCA 4WQMA 1HQRD 2KFJA 2QF7A 3B6YA 3TIXA 4X3UA 2KLGA 3Q3MC 3OYYA 4X64L 3D3RA 2ID0A 2CH4W 1Y56A 4KHPL 4W9DA 4ZYNA 1NDDA 3IFWB 2IY0B 3U8ZA 2I5LX 3HK0A 1FO4A 4DV4Q 2HQLA 4IFDG 2DGYA 1UF0A 5T8IA 1SB3C 5EKKA 1RAXA 3CCEA 4IALA 1V5OA 3CPFA 3S1NH 4DR2Q 4KHVA 1WR6E 4MACA 1F9PA 4A3GG 2Y5CA 3M85A 1HFGA 1CTMA 1HJPA 3NZUA 4OVZA 4KMUC 1VQ9A 2BF8B 3I2ZA 4Y52H 2KTFA 4EOYA 3CF5A 3P42A 4RKLA 1OQYA 4J15A 2DLBA 3Q69A 4A3PA 1WYGA 1GUGA 1XLNA 1X3EA 3PIO3 1FXIA 2Y3AA 3N20C 2WV6D 4K81A 4WAAA 3SFEB 4XDCA 2Y0SB 3OW7A 2SOBA 4CKCA 1PH8A 4EZKA 4ME3A 4GMVA 4BBSH 4LDTB 2DYOA 4I7AA 3A33B 5K5PA 2B2UA 3QWNA 2JXTA 4OZBA 1ROEA 1ZEQX 1H8CA 2HD3A 4L8JA 2PZTA 1JW9D 1YJNA 2OJWA 2E5LQ 3CKIB 3QCAA 3UDXA 1FNUA 1I4PA 1KL9A 3H3VC 3J7ZC 1HNZL 4IM0A 2HQEA 3J9CA 4FN2A 1HNWQ 4K14A 1WGYA 4RFBA 1RD9D 1KIXA 2DUDA 1CJEA 2FHTA 2JA9A 3NK9A 1N33Q 3AE5B 5M3MB 4CJ2C 2PE6B 4JI6Q 3FEWX 1B8AA 3RLOA 3GB1A 2R92G 2H1EA 3OPOA 2IWHA 4K5WA 3JSVA 2NN6I 2NZOA 4RGTA 2KWUB 3A1QB 1KLGD 4YCUA 1Y1WH 3PO2H 3AU4A 4GDKA 2AWNA 3Q22A 4A3FB 2YYZA 4JPSA 5C3JB 2AKWB 1MJDA 2LFIA 1WTHA 4ZKBB 1UE7A 4CYEA 1JE4A 4YHHL 1NR2A 2BQQA 1VQDA 1HUMA 2WB1E 1A15A 2AQ2B 2FJ2A 5L37A 1JICA 5M5YH 1PH7A 1C77A 4M0WB 3HOWB 4EX5A 1EQVA 4LF5L 4OO1G 3Q14C 3PT2B 1YNJC 3DM1A 1VDZA 1ISNA 4HRSA 1ZKOA 2N9EB 3UI3A 2K9XA 1AZPA 1X65A 2KOXA 4H2AA 3VUYA 2KTRB 3KJOA 3DMUA 4RCOA 3WAPA 2PI2A 3NXWA 1NI3A 2L9HA 4A20A 5C44G 4A3EB 3A56A 4E6IA 3TDQA 5KEEA 1VRAB 3GTMB 4DXGA 2F1MA 3A9KB 2IPKD 2B2YA 1DOXA 3STBC 2VUMG 3BK2A 2L4NA 2RR9A 2L55A 4M8AA 2BS4B 2WXGA 1SNCA 3RZOB 1G91A 3A5ZB 4GKKL 3APCA 4A3KH 3I57A 2JVCA 4ZRJA 2PJHA 2CH4A 2NZHA 4DAYA 4X64Q 1HZCA 1D5XC 1GUWA 2ZCBA 1LT3D 1H9SB 4KHPQ 1JROA 2JPHA 2W54A 3J7A5 4L1BA 3OWFA 1Y14B 4R3DA 3GQBA 4JL9A 1V86A 1I50B 3GO5A 1PVOA 2KQ3A 1BQQT 1CKNA 4YCVA 3S15H 4OVUA 3X0WA 2JJQA 1XLQA 1BUIC 2N8NA 2JU6X 2LGIA 3NPPA 1HR0W 3Q8BA 1ICWA 2PNHA 4HIDA 4OZAA 3ZXRA 1SE4A 5I4DA 2NVXB 1NY4A 3TP7A 5IP9G 1SYDA 3G4SA 5C3EG 3JYUA 2F0SA 5IO9A 1L1OC 4JYAL 2ZNVC 1LFDA 3I4NH 2INCC 1TS3A 2MBOA 1YOVB 4JLCA 1D5MC 1B2TA 1HEZE 1Z7TA 3HOXG 4LNIA 1PYSB 3C1EA 2WACA 4OO1I 2XGTA 1PHJA 2ES2A 3H7PA 2WAQG 2GA4B 1EY7A 4RWSC 3HRZC 4BKSA 2D5GA 4K2KA 1NVID 2DY7A 3L0OA 1PV4A 4YL8A 2BTEA 2F52A 4C3JG 2WU5B 3ZDTA 4X3SA 1A2TA 1LTRD 3DBSA 1HNZQ 1WI5A 4IWPA 3W1SC 2BH2A 3A0JA 5FLXE 1TWGH 4A3CH 1GG3A 3GP7A 1EQQA 2ZW0A 3S1MB 1F1HA 2LUEA 3VYRA 1EL0A 4JWUC 2QHOA 2EYOA 4B3ML 4RG1A 3CRKC 1IBXA 4G7OC 1H9RA 1BBWA 4X3TA 1J7BA 3BINA 2YTVA 2GRIA 3DEOA 3L3OC 4IURA 4LF7L 4FYDA 3I4LA 3DQVA 4IW0A 3M4PA 1WTWA 2F3WA 2RVLA 4DHZE 3OSOA 2F3IA 4IUTA 3A4RA 1MHWC 3WALA 4YHHQ 4IZ8A 4DF7A 1U4RA 3RT3B 5KNCA 3I70A 5IOCA 2XSCA 5FLMG 2ZJPA 4LF5Q 3J81i 2KJ6A 4US9A 5AZFA 1BXTA 2BDOA 2VS1A 3MTSA 3NBHB 4UY8C 1RLFA 4FXCA 2CJNA 3HOUH 4ZQ3A 3OG5A 2KOLA 1RTNA 3X23A 4LUOA 3GTKB 5IGGA 1PDXA 2MA9B 3EQLC 5D7GA 5JEAH 2IO0B 2FCNA 4HPPA 3A7AB 3JAMc 4DR7L 1T0YA 1ZPSA 2GBJA 1VQIA 1D7QA 1OGWA 4LF8L 1YNNC 3GTPH 1F9SA 1I3QB 3D4DA 1YZ6A 3AE3B 4PV1C 4OZCA 3IHPC 2FCMA 1LTSD 3ZTCA 2MP2A 4B95A 4B9WA 5C0XG 4MGIE 2R7DA 2IZVB 2MSED 1KRSA 2ASQA 4GKKQ 5HURA 4JWSC 3NWTA 2XEWA 4LF4L 2B63G 1V9JA 1JMCA 1GNUA 4ZRIA 1EFID 3HOZG 2KMCA 3JAML 4N8X1 3S1QB 1SNPA 1S72A 2RD0A 4C80A 3PUVA 1FR3A 2A68D 1FL0A 2QEXA 5FKAC 1T6BX 1O7ZA 4IFDH 4A76A 1KDBA 4DN4M 3HOVH 1CA6A 1MHHE 2KC2A 3T9LA 2N9KA 2B2TA 3G48A 3NTHA 4FJZA 4A3GH 1FFVA 2BCOA 2R2OA 3PO3G 2OF1A 1KQSA 1SNQA 2E8GA 5A35A 3QB3A 4HCEA 3MHBA 3V96A 3HOYG 1N61A 5JH5C 2E75C 1F9RA 4IUVA 1SR3A 2A6EC 3G71A 4AP4C 2EIFA 2NR2A 5FJ8G 1ESRA 1L0YB 1EUVB 2Y5PA 5DPRA 4ALPA 1IYJB 1DYQA 4JYAQ 2WX1A 3VA5A 1S40A 2WB1G 1SSOA 4ILWA 3CU7A 4JVZA 5I6WA 2JRIB 3MXGA 4II2B 2UYZB 1U4MA 5IYBG 1V6EA 3N32A 3QJZA 4MH0E 5EBDA 2UXCL 4JV5L 3UF8A 5C5MA 1RFAA 4DXFA 2M4NA 1JB3A 2CKHB 4N9TA 4C3IB 3M63B 1SLJA 4PMWA 1KTKA 4FXKC 1VQHA 1SNDA 2IO3B 2QMTA 2MO1A 5IGBA 1PRTB 1WCMH 2RA4A 1T5XD 4J1MA 1R4MI 4KSLC 4DK6C 2PQAB 5DPTA 1NJIC 1NMGA 1U4PA 2EJFC 2NVTB 2V1YA 2ZCCA 3ZNID 1KOTA 2R92H 1FGUA 4B3MQ 2B76B 3GTJB 1E1TA 5C4XB 3N9YC 1E0ZA 3CCRA 4IUMB 1AW7A 4FO2A 4LF7Q 5C0XI 3VYSA 2JA7H 1JOOA 2B2WA 2C7NB 1YNJD 2JUOA 4JI4L 3CWIA 3UGBB 4MEMA 1RIPA 2VL6A 1NCVA 1PMRA 4K6LA 1KAAA 4TKNA 3B0AA 1KXLA 4OONA 2FMCA 2Z6KC 3M4OH 4HXDA 3TP5A 1MG8A 4A9AA 1E22A 1WTPA 1I7HA 3BYTB 4YWGG 3ZIMA 3QOLA 1WJ6A 2JSVX 1SAPA 4UAIA 3UI2A 2JA5G 5KGUA 1J7CA 4ANXA 2JQOA 5LMNL 4H13C 1FGBD 1AARA 2A6HC 2KN5A 4EZLA 1SXTA 2MJ8A 4YSZB 1GUOA 3GD7A 1XCTL 5I2XA 2EY6A 4DR7Q 2DBYA 1U0LA 2PW9A 3U7DA 3PIP3 2ZXRA 4LF8Q 3E0JA 4A3BG 4K3BA 4C2MB 3T8MA 3NELA 3L17A 1WTOA 1EQTA 1P7FA 1WXSA 1GAQB 4MGKE 4OWXB 1EYCA 5LNK1 1YQ4B 3PV0A 2AHOB 1AYFA 4R8NA 1VQPA 1EEID 1G291 4KKJA 4NNJB 3PUZA 2F0VA 5GROA 4H7BA 2A8VA 1GC7A 2A5HA 1R4NI 2CKZB 1C76A 1VR9A 4I6PA 2REXA 4EQ5A 4MJSA 4LF4Q 2I1KA 1LT4D 1OO9B 2BWES 1L6VA 4HCNB 3U4ZA 4WJQA 4WWPA 1P16A 1J8IA 4FJYA 2M0AA 1MFWA 4V190 1GUNA 3HKSA 4NKLA 2MQJA 2DN8A 3D0FA 5HHDG 1Q81C 1S5DD 1PRTF 1SE8A 1F9QA 2PCFB 3VR5A 1UGJA 1N8RC 5EPJA 5KHOA 3ZVVA 1STNA 4X6AH 5C5LA 1V43A 4MIUA 1IBLL 1YJJA 1MKHA 3TP8A 1C7YA 1J9OA 1M90C 3QO2A 1UEAB 4DR3L 3H6NA 1WGDA 3QIAA 3OHXC 4DHJB 1NAPA 2V1CC 1EYDA 5KNDA 2PMVA 3R66C 3LWEA 2ACZB 2K25A 4L2YA 2E2DC 1QUQB 2JYEA 4JPBW 1UD7A 3HKZB 1SYEA 2I07B 3MC0B 3C2PA 1JMLA 1QOBA 3HOXH 2JA6G 2XRSD 2JP1A 4A3DH 4HLEA 4DPGA 1H95A 2Z4HA 3AEAB 2G1EA 2N49A 4F88A 2UXCQ 4ID6A 4JV5Q 3OJ4B 1HTPA 3SGIA 2QKIC 2VY3A 4KY7A 2QILA 4CDCC 5IODA 4HJ8A 1MJEA 3PUXA 1DOLA 3PQIA 1NENB 5AZHA 2XVSA 3L0WB 3KFUA 5M5YB 4HMIA 4BY1B 3WDNA 1BNZA 3PLUA 3BU2A 1YQ3B 4JI1L 4OX9L 3HOWH 1JWSD 3MWYW 2M19A 1SF0A 3A4SC 3NOBA 3K9PB 2WXJA 3K5OA 2WXKA 4RM9A 3TJPA 5C4JB 4KKIA 2D9UA 1CSQA 2SDFA 3I56A 5D14A 3DBLI 1PTOB 1X3FA 1SDFA 1STEA 4JI4Q 1L4ZB 2D3BA 4E3CA 3UE0A 2VQFQ 1QOGA 2IL8A 4MN3A 2I5MX 2OHFA 4A3EH 2E74C 3E9HA 3LNNA 3MZ5A 4KD3A 4KI0A 5FLMH 4Q0FA 2EZVA 2G4SA 3ABVB 1FEHA 4LNNA 2IY5B 4WWMA 3URYA 2NVQH 1X54A 1DGJA 2D5DA 3AV8A 4PQXA 2RHQB 4DA2A 2QA4A 1Q86C 2KMMA 1YNND 5GAGC 5IP7H 1HZ9A 1ZYRD 1B7YB 4K8IA 4EQNA 3ZXVA 1ET6A 4UHVA 1G8ZD 4A3KB 3J80i 2YU9H 1ZDVA 3HM6X 5LMNQ 1UBQA 1TTNA 2LI5A 2NMQA 3JSVB 1ESFA 1K3RA 5CBEE 1TBEA 1UELA 2DHZA 2EY1A 4RCNA 3VH3B 2N9XA 3B08A 3AE8B 5A2QE 4BBNC 3NVYA 2JXXA 4RM8A 5JVG3 3UDIA 4NXML 1I50H 1VD2A 2XWBB 1H9JA 2LGDA 3N1ZC 4XYCA 5IT9E 1IPGA 3ND9A 5E3FA 1IYVA 2YVCA 3S16B 4H44C 3TN2A 1UAPA 2OTLA 5IYCH 5HGQA 4HJ5A 3MP9A 2LXJA 4EKUA 3WAMA 4C1NI 1B50A 5COYA 1KRTA 3OTOL 1XQQA 2ZVOA 3OAWA 2RDFA 2B63H 4MGYE 1LT6D 3KF8B 1C9FA 1S5FD 4HSPA 3TEHB 3HOZH 1FNWA 4A3JB 1TKEA 2KO3A 1KABA 1V1PB 3IAYA 1HZ6A 2GBRA 2PW5A 1P7EA 4DR1L 2MW5A 1EOVA 1LGRA 3PUWA 5I9OA 3T1YL 1KDAA 2UUBL 3I4NB 2MHJA 2NBFA 1BT0A 1Q8KA 3PF4A 2LSSA 3KLSX 4TRDA 1WH3A 2MBEA 2M8SA 2A6ED 1TY2A 1PH1A 3BVMA 2C60A 4GDLA 2BS2B 3I4MB 2EYMA 4A3IB 2OTJA 2BYFA 1IXRA 2CJOA 1IBLQ 2W55A 3DVNU 2BA1A 1EM7A 2CVRA 5LMUL 3PHWB 4W9CA 1Y8RC 1QZEA 1MI2A 2BA0A 5KNBA 2KQSA 2R7FA 3I9V1 2LVPA 1A2UA 3BYYB 1EWYC 3T3OA 4W9IA 1TWGB 3I3CA 4B3SL 2CU3A 3S1MH 1WZ0A 2FCSA 3I8ZA 1L2NA 1QQRA 3HUIA 3S9WA 1HE8A 3EJIA 1UH6A 3FKIG 1JJCB 1CKNB 4JBMA 4JCVE 3GS2A 5D6JB 2RQXA 3WOFA 1M1KC 3UDFA 4KN7C 2RDHA 2H88B 2KDMA 2KJHB 1X32A 3GZNI 1W6KA 4RMAA 1PRTC 1YN3A 1SFOH 4RH6A 3IAM1 1BDOA 1YHAA 2DNEA 4JI1Q 2E6XA 1WTRA 1UGMA 3H8HA 1ICFB 1RFKA 2HT1A 3U50C 2K6QA 2KCMA 4XQJA 2AYOB 1EZ8A 2QJLA 2HUGA 2MEKA 2V4LA 5FLXc 2I0QA 4US8A 1UBIA 1SMYC 1WMHB 4ZRKA 4DQOC 1CZWA 4DU9A 3VUXA 3CQZB 3Q8EA 2NPTB 1EIHA 4K7WA 3GTPB 2K0PA 2FAZA 2O6VA 1VF7A 4M8MA 1OXSC 1I3QH 4Y7NH 2NVYB 3VA7A 1V97A 4ICVA 4NAWB 4B9KA 2EY2A 1JT8A 3SEBA 5C1ZA 4GNXA 5E6NA 3A9JB 1K50A 2G9DA 3BDLA 3QQ8B 3T3NA 4OWWB 3DBHI 1FYCA 4JOIA 2VZKD 5CHFA 1ONLA 4HJGE 5FLXL 5G5HA 1NBFC 4R4TA 4XGAB 4A3MH 5IY0A 1WM2A 4GLXA 4G7ZC 3ZDMC 2F0IA 1QNKA 3D6WA 4P72A 2PE9A 3N3KB 2HCIA 3A8IE 4DV0L 4I6NB 1NE3A 3F2UA 4QIWB 5D3IB 4DV5Q 4IDIA 3ERQA 3H0GG 4YTPB 1JQ4A 2L12A 3KUCB 1NYRA 1DOKA 2JEBI 3MHSD 4EGVA 3SK8A 1E7UA 2ZNVB 2D62A 3P4SB 1HFNA 2KWDA 4A3GB 1QE6A 1IUEA 5ELFA 3K59A 1R4QB 3OTOQ 4P73A 4IM2A 3ZW3A 3TEWA 3J7AF 1TKGA 1V81A 3F1ZA 3P20A 1QZHA 5J22A 2A5UA 3IAS1 3A8JE 1WX9A 2PLPA 2O2VA 1QWYA 1C1YB 2C9OA 3CSFA 3ZRFA 4DR1Q 2JZ3B 3T1YQ 1RRBA 4BBRG 1C4QA 4ZUIA 1N34L 4IOIE 2VB3X 2O5JC 1PFDA 1VQ5A 3ZRCA 5C23A 2MP2B 2LKVA 5E6PA 3TZDA 4A3LG 2MH7A 2M1MA 1X1MA 4WJNA 1YJWA 2RGFA 4KD4A 3Q0AA 3U52E 4ULLA 1PZJD 5LMUQ 4C3IH 4FXGC 3TQYA 1XLOA 4KGTA 3BY4B 4DFAA 1EYAA 4JBKA 4MZ9A 1PYWD 4HIOA 3WANA 1ML0D 1EZ6A 4LFCL 1LYLA 1WCMB 4B3SQ 2N1VA 3CPWA 1WY8A 4WJOA 3TS0A 1N5XA 5CORA 3B9JA 4MDKE 3RPFC 4FVMA 5EE0A 1WD1A 1F9JA 3APFA 4HDOA 1Y69U 2F0UA 2R92B 3K7UC 2KHJA 4C7YA 4A4IA 5I9PA 3GTJH 2EMSA 1CQVA 5J39A 2VB2X 4ZRQA 4RHRA 5JHBA 1PFMA 1TY0A 2JA7B 2KANA 2JT4B 4Q5VA 5AZGA 2K5QA 3VVWB 2E2HB 1FD6A 5JJKA 4W9JA 1LTID 5CV7A 3CMEA 4PMCA 4WJPA 2NYZD 1I4RA 2Z1CA 3AFQA 5J1ZA 3I91A 1UEBA 3AULA 2NN6G 1C78A 3RZDH 1RL2A 2FFKB 1XPOA 3H9DA 2X6LA 1IGDA 1Y8PB 4NJ6A 5ISRA 4GOPA 5IWAL 1XPRA 2B2UC 1PTOC 4WFN3 4XYOA 2ZTCA 1CA5A 3P4PB 4C4VA 1R4PB 1AP0A 2ZTEA 3AE1B 1K9MC 4NB3A 1DCZA 3T51B 3FDTA 1VQ4A 5HY6A 2WXOA 2CFMA 2FUG1 3WAOA 4ANVA 1LTTD 1JJ2A 1OXXK 5JJLA 1O7YA 2Z9HA 3P1HA 3WOEA 4F7ZA 1F0ZA 4C2MH 1LXDA 4ZK9B 3B2GA 2MUYA 2VUMB 4HN7A 5CHWA 4IUPA 5FR6A 5KYLA 2OQ0A 3PGEA 1E90A 2WXNA 1YNXA 1N32Q 2PQEA 2A68C 3H3VI 1YN5A 1TWAB 2LJ5A 5EAYA 3DWAA 1WRDB 2K32A 1PYBA 3CCSA 4DV0Q 2WDTB 3DLLA 2R7ZG 1DM0B 4DUZL 1B1ZA 4NPSA 1P98A 4AWJA 2K8BA 3NVZA 3FILB 2P5ZX 3AU7A 2W3RA 1Q5WB 4M8NA 2PNRC 2RSOA 4HJKA 3PSEB 1A62A 3VXWA 1GD7A 3FHWA 5FO7B 4BS9A 3KJPA 3Q2AC 5C2TB 4S0RA 3ETRA 4WURA 1CKOA 1TWHH 4PZ7A 2RSUA 1Q82C 4JI7L 3U9OA 2WX0A 4P7IA 3R2TA 3CCJA 1WI0A 5C3EB 1JB7A 2G9HD 1PH2A 3VTUA 3C3LA 1G6PA 1E8WA 1OFFA 1STYA 1VQBA 1N34Q 1F77A 1E2WA 3AECB 1J19A 3HOXB 4A3DB 2GBNA 1RYJA 2WP9B 1K83B 1X55A 2O6VD 2EYHA 2WAQB 3L2PA 3IG3A 3Q3OC 5H1SE 2L52A 4XWWA 5IN7A 1L2FA 3K81C 4KKTA 4DV6Q 3L4PA 2CHXA 1GXDC 5IGDA 3GE3C 1STHA 1TS4A 4C3JB 2FIDA 2KJRA 5DCNA 3TL5A 1JOQA 3QOJA 2K39A 5LHY1 1HQMC 3IFDA 3HVDA 4GIVA 2PPBC 1LM0A 3KUZA 2Q8IB 4BY1H 4J3OD 4LFCQ 2B29A 5FOBB 3D32A 3RNUA 1L0VB 1ZE3D 3SD5A 3KK7A 5JOBA 1PRTD 4KVGB 3FKIH 1KD1C 4TQ0A 5ELEA 4EQOA 3Q23A 3VR4A 5GAHC 5C4JH 1LQBA 4ODGA 4DV1L 1VF5C 2N7DA 1WXAA 4OVVA 1BVSA 1WE6A 1PTOH 3AFPA 1ILQA 3RUZA 4FJVB 4ASWC 1EY9A 2IHEA 4LFAL 3R7QA 1VQAA 4PK1A 1HTQA 1YNTE 5LL6X 3S1RB 2Q2TA 1SMYD 5I2YA 3SK6A 1FPYA 4LNQA 2VZKB 4DDGD 2CQAA 2NVQB 3QG1A 3DVGY 3Q6BA 4JIOU 1EUJA 4KX6B 5CV5A 2LVQA 2J0JA 2YV5A 5IWAQ 2E2JB 4BVUC 2MCNB 2AMCB 2YU9B 2AQ1B 2JWZA 2KCTA 2WDVB 4Q2JA 4DAVA 4J6HA 2YLMA 4KDLB 1K8AC 1V80A 3DBRI 1R4MB 3R93A 3CP0A 3I55A 2M2LA 2IGDA 4CDFC 2QDLA 3SVMA 1OEYJ 2KMAA 3PZ8A 3NSWA 1KLUD 4BA2I 5CX3A 1VQEA 2SNSA 5IIFA 4ZRPA 1L0WA 1WYDA 4IN3A 2ASBA 3S16H 2RSNA 3ZNHB 2K5NA 3LGJA 3K9OB 1KHIA 4HKQA 4RKBA 3V6CB 2HJ8A 3KBGA 3NS1A 1D3ZA 2X8XX 2B63B 3VR8B 2F0JA 3NTKA 2K1BA 3HOZB 2M00A 5E1FA 4R8IA 4A3JH 3L13A 3D4WA 3PCOB 4Z9CB 3E6ZX 4UDUC 3M9BA 1S4ZA 2OWOA 1WD0A 3CF6E 2IJ0A 2KDFB 2GB1A 3U4VA 4B0EA 1BOSA 2Y0SG 3BZCA 2GVBA 1GPXA 2KVMA 3RNEC 2GMIC 2F0GA 4EZJA 3I4MH 2V3NA 4L23A 4AJWA 3SHLA 1G2SA 1PFSA 3PMFA 1HTLD 3MAQA 4A3IH 4KSKC 4WQOB 1CFMA 4ANWA 3HOYB 5IT9c 3I3TB 3W1YA 4CBVA 4JI7Q 3A5UA 2J53A 1E8XA 1HA6A 2HE7A 2KX3A 4YT0B 5BMHA 2WB1B 3SDLC 4DHJD 1R4NB 1V2YA 2G5DA 3Q3FA 5ELBA 1UE1A 4MM3B 5M3MG 1SMXA 1L0XB 1G2TA 2INNE 5IYDG 5A2QL 4A3LH 3J7AV 3UE1A 1Z9FA 1DOIA 3TCAA 4IO9A 3L08A 3V05A 4OW0A 1SROA 5IT9L 4A3FG 4N8FA 2Z59B 2WP8J 1SFOB 3GTOB 4IWQA 2R3ZA 3VRAB 3PSIA 1STAA 2D0PA 3NZ3A 2LXKA 2RPVA 3VYUA 1Z2MA 1PFNA 2F0HA 4QL5A 2B2TC 4LMQD 1FXTB 1EIGA 5EPKA 3U9SA 4IOAA 2KX0A 1AZQA 2M17A 4HEA1 4W9GA 1BCPC 4DV1Q 2DAFA 2KACA 2Y5BB 4IKGA 4HJ7A 4GGQA 3HIZA 1EF1A 3KLRA 2JZPA 1WE7A 2D0OA 4WJ3M 3CQZH 1P1AA 4A75A 3BK1A 3PTFC 2R93G 1PTOD 4ZCKA 4LFAQ 4QY7A 4UPAA 1ZYRC 4HJ9A 1FVIA 2K4KA 4P71A 2TSSA 2NVYH 4Y7NB 4HIMA 2NN6H 1E7ZA 3EC8A 1DJRD 3K7AH 4OGQC 4HCSA 3NP8A 2KDEB 1EIFA 4DWFA 1L1OA 5JXVA 1E7PB 4HPLB 4YTNB 2F0QA 4NJCA 3UIPB 4LK0M 2JA5B 1SYGA 1YHQA 3ONSA 1LT5D 4FF2A 1LV9A 2F0KA 2O5IC 1HZAA 1KH0A 2UU7A 3H6MA 3MXUA 3MC9A 1MD2D 2PYKA 4NP5A 4C3HG 4A3MB 4NW2A 3WA0A 3EFXD 3M3JA 1EY4A 3PGZA 2DYMA 2DAJA 1VLBA 3KVFB 2KHSA 4A3BB 2J42A 3FP9A 2LHEA 2KHIA 4CDEC 4QCLA 2M56B 2IGHA 1S1QB 1P3QU 4M01A 2IX1A 1GUAB 1IL8A 3DBLB 2Q8RE 1NBWA 2H4OA 5IGEA 4LW1A 2IO1B 2EELA 3RZWC 2Q5WD 1C0AA 2A1AA 4BXXG 1U4AA 3TBLD 5H92C 2NTTA 1TZOA 1T0QC 3HRDD 3EROA 1OEYA 3IXSA 3R3MA 1EWIA 2PMZE 2LVOA 3VUWA 1C79A 5TR5A 1F2ZA 3Q24A 2K7VA 2F0MA 2PTLA 4MTKA 1G6ZA 2ZPYA 2O6VB 4ZRZA 3L54A 3BS1A 3N1YC 3PIOA 4FHKA 1X9NA 1D8LA 1QVGA 1TIID 3MA2B 4ZYSA 4HK2A 2MBBB 3G6JB 3AEVA 2PVGC 3NG0A 3BDCA 2OXPA 3TMEA 4PG3A 2K05A 3NHHA 4OWTB 2C9WB 2ZW1A 1XPUA 4UP9A 3C1FA 3AB5A 3NBIA 1W6JA 3AYHB 5G2NA 1JWAD 4DHZB 1STGA 4BZAA 1VQFA 2RCFA 4R4QA 1OTRB 4GXBA 5JHAA 1H4RA 2WYQA 1JWUD 1V9PA 1JC7A 2MP1A 2K5PA 4ME5A 4FHJA 4YWKA 1T0RC 4BKTA 2JA6B 2EY5A 4BKGA 2JYTA 4KK7A 1WIAA 1GVPA 4JK1C 2BB6A 2V3PA 3CCMA 3EUB2 4LWCA 1V5TA 2OEDA 4OEMB 2R61A 2E2HH 1R7SA 3ULLA 3JAMi 4GS3A 3FVQA 2E2IB 2LEKA 2JX5A 1HRJA 1S3OA 4M02A 5C3WA 2L5TA 1SRUA 2O2VB 5EE9A 4OO1H 3ND8A 1CKMA 3ZNGC 1Y8NB 4PT5A 4XQQA 3RZDB 1S5BD 1K73C 2QDFA 3I5JC 2N9LA 3ZKJC 1N9WA 1VQ6A 2OOBB 1G6JA 1GJZA 4OXPA 2BE5D 2KZRA 3F8TA 2R6GA 1PGAA 5IGCA 1PLFA 2N3SA 1AWDA 1WJUA 4GN1A 5AUIA 4IPDA 3QA8A 3VQIA 4EE2A 3MXNB 2K1FA 5JVH3 3EFUA 5JZEB 1SGHA 4MHEA 2C7MB 2B3AA 4LTUA 3D31A 1AFPA 5E6JA 1GB4A 4KY5A 3FMCA 5C44H 3BVGA 2MWSB 4U673 1RTOA 4BKSD 3TREA 1CZPA 5CV9A 2C35B 1OQQA 1E5WA 5AEKB 3HGBA 2ON8A 5C4HA 4RGMA 1FJGL 3KDFB 3DCGA 1PDQA 2VUMH 3VTVA 1N62A 3ALBA 4GKJL 3OIQA 3RNCC 3GZNB 3L10B 2RBMA 3W5VB 5LXIB 1T9HA 1KNEA 5CV6A 3ZO5B 5M5XB 2KA7A 2NZ1D 1TWAH 4GOCA 1PH6A 1YJ1A 4MSQB 3O13A 3AMUA 5ELDA 2PPHA 5J2RA 4M1UB 4I6LB 2Z6BA 1K0RA 3ITPA 2KUMA 3KF6A 1WGGA 2TMPA 1FMAD 3CCUA 4LJOB 2BPSA 4DKAC 1EWCA 1IBKL 3RNGC 3CW2C 1VCBA 3C8YA 3CRLC 2BOSA 3SK4A 4WJ4A 2D3AA 2ZXOA 3ONAB 2L83A 3TP6A 2VXWA 4G4KA 2WXHA 2K28A 3RLFA 3F2CA 4PYUA 2K14A 1E1OA 2KFKA 4HR7B 5DNFA 4A6QA 3T56B 2RCNA 3FPPA 1WXMA 1E9MA 5KYIA 1ILPA 1MG4A 4K5VA 1OQRA 2WQYB 4C4VB 4K6DA 3EECA 3L16A 1TWHB 3W5OA 3BWUD 2KT7A 3J7YW 1HNXL 4ARCA 4YIJA 5IP9H 5C3EH 2BWFA 1VS0A 1JQYD 2QW7A 3DBHB 4M0WA 1Q90A 3I72A 3K57A 1V8QA 5CMDA 1QZGA 3JW0X 2N7EA 1TT2A 4CHTB 2IO2B 3OW2A 1C4CA 4LF9L 1QNUA 1V1OA 1MPEA 3GV6A 1UWXA 3E9IA 2ZVNA 2F3VA 1WXQA 3KUPA 1BR9A 1EOTA 1K83H 1QB5D 1RHPA 3W1GA 1UZXB 2H89B 5IKCM 2V9HA 1CQFA 3TEZA 2NS5A 3A54A 1SYBA 2F0PA 2KTRA 2L3ZA 2W3SA 4C3JH 5ELCA 3KYDD 5K36G 3PLVA 4DR5L 1JWMD 4UP7A 3U4EG 4C56C 1VQKA 1ASYA 2QSDA 2LGSA 1J5EL 3PV1A 4EVOA 3LWUA 4W9EA 3U58A 1CMXB 3A9KA 3DWMA 2LGYA 2HIVA 1F2LA 3GTGH 2KDBA 3FKIB 2L32A 1YX6B 4K7SA 3QX1A 2WKCA 5LLIA 5IYDH 4ZKCB 1FFUA 4XZ4A 5C4XG 2E76C 4K5XA 3KH0A 1KC8C 3RNAC 1JCKB 3K8AA 3Q3NC 3DWQA 3CSTA 1PH9A 3J81E 4IUQA 2AUJD 2WXFA 1A8VA 1NNXA 4XTCS 1BCPD 3E0EA 3AE4B 2LY7A 4URKA 2JRHA 3S1RH 1TT5B 2L0FA 2CWPA 2F0EA 3DHQA 1Q7YC 2NVUI 3MJWA 2NBVB 2HDEA 1D6EC 2CHWA 1LTLA 4AYBE 2E2JH 5HG2A 1E10A 4S3SA 2IBIB 2SAKA 4WWOA 5CV8A 2GLSA 1VQCA 3HP3A 1IW7C 2DY8A 4GDKB 4LUZA 2L1AA 3SK5A 1NEKB 1YD8U 3CMMB 4ACFA 2HDLA 3AI5A 1P0RA 3FRPB 3AXCA 4IJLA 1Q46A 1FJGQ 2V3SA 4PMBA 4ICUA 5C0XH 4QUFA 2GI9A 2MNAA 2B8GA 1YI2A 3ULJA 5DLQE 4FF3A 1V8CA 1SSNA 3NUCA 3ULPA 3S2HH 2MBHA 3PZ7A 4LNOA 2UWQA 5G5GA 2D2CC 4G0NB 3V61A 1AE3A 1IBKQ 4DK3C 3I90A 4LNFA 2JE6I 1VQ7A 2LRUA 2J7ZA 2LXAA 4XC2A 3M4QA 4BBSG 2HTHA 4DNIA 3PO3H 2QCZA 1EEFD 2KDIA 2DZJA 4DK1A 2EJGC 2JA8G 3NRZA 3HOYH 5NUCA 2RKSA 2A69C 4DR3Q 4DAYB 1HNXQ 1PTOF 5FJ8H 3NWSA 1TJEA 4J8QA 4HTHA 1WR1A 3EN2A 4L5QA 1NYQA 3AU5A 4BBRB 3LB8C 2A74C 4GNXC 2KENA 3SDZA 1KJTA 1PZID 4HMJA 1BBUA 3F2BA 1SEBD 2CW0C 3NBHA 4JOIC 4HROA 1B4OA 1HTOA 4DXAB 1PH5A 5IYBH 2EDGA 2BW2A 2JWUA 4IUNA 2XBBC 4N9PA 1JR0D 4J6IA 1WF9A 2AEHA 1EY8A 1Z6HA 3MVVA 5LL6S 3IBEA 4B08A 1Y1WG 1JWBD 3PO2G 3TEYA 2AL6A 1FCLA 2NB0A 3CIRB 4OIJA 4DR5Q 4DAPA 3N1XC 1STBA 4WH4A 3GTOH 2UUAL 3NEMA 3DVNV 2F0FA 3SHQA 1U9RA 1TIFA 4NJ7A 2IHFA 1J5EQ 5JAVA 5IP4D 4OX9Q 2C5LC 2E3TA 1D2BA 1SNOA 2AWTA 3ML9A 2MBQA 1PGXA 4AQ7A 5C6AA 2RPQA 4AOFA 5DPWA 1S5ED 3Q6SA 4MELA 3H7PB 3WIMA 1NSNS 2LFNA 3BZKA 1GJXA 1SYCA 2BYVE 2QCPX 4A90A 4K1RB 2L0TA 2WHIA 3X3NA 3ZQ4A 3K7AB 4G57A 2XRQD 1GC6A 1I42A 3ER0A 1QOHA 4HSVA 4K2LA 3RYTA 1EY5A 3BIID 2B3GA 4CKBA 2WDQB 1DGSA 3JVZX 4E71A 5DAUA 5FO9B 5M3FG 2JA5H 4WWNA 1NMFA 1IBXB 1QG7A 5ELOA 4HWIB 3U2SC 1RDPD 1XNRL 1DZ1A 2F0OA 1B3AA 1TQOA 2K75A 4A3KG 1RM6C 1DONA 3P2BA 3KW5B 1I4GA 3RI7C 4HJAA 3TBIB 2DYBA 1P9DU 1RODA 2WINB 4IQZA 2K6DB 1TGZB 3N6RA 4A3BH 2NTSA 4NY0A 4NXMQ 1Q8IA 1WSPA 2AWOA 1JOKA 1YEZA 2C7HA 3I4OA 3PIPA 3L7ZC 2KHWB 3EBEA 2VH1A 1FNVA 1Q0WB 4FBJB 3AB9A 5BO4B 2J4XA 3Q8AA 2LGXA 2F4VL 1BKBA 4YY3L 2M9VA 5F2DA 1MI0A 3HG9A 1F2YA 4H0LC 5EQ0A 3UIOB 3GE8C 5CC4A 4QGUA 2KD0A 4B9XA 1QOFA 1K53A 1WRIA 2G4DB 3BJUA 2FINB 2UUBQ 2PQAA 4EEWA 4LCDE 4MTNA 4RF1A 3PVLA 3I4NG 3QJYA 4GLAC 2Q2UA 2ONQA 3HVZA 5J18A 2WIIB 4YSXB 1N6ZA 1II3A 1EF5A 1QOAA 1IYFA 2DWQA 3KYCD 2MQHA 3H91A 4KJOA 5IA7A 5EPLA 4OHJA 4DR6L 2KC1A 3SFDB 4BAXA 3P7JA 2BB5A 1U4LA 1IHZA 4R1JA 3RMHA 4W9HA 5E6OA 4O2DA 1WGRA 2MJ3A 3AE6B 1F2RI 4LJZC 2KLCA 2M0XA 5G55A 3OJ3A 2RHSB 1EQRA 1ZXHA 2Y0SE 4F7XA 2SNMA 2GVAA 4LJPB 3RNFC 3E3XA 2EXDA 4XE0A 4A3CG 4GN4B 1GOZA 1I5FA 4LK1C 5I6YA 2UUCL 2JA6H 2KNBA 3AM9A 3GTQB 1S3SG 4CO7A 5L83A 3K80C 4WJWA 5GADC 3GTLB 2I46A 1X3QA 2IDYA 2KVZA 1IBML 4AYBG 1XT9B 5CBAE 1BCPB 3RUIB 1BO0A 4A93G 3I63C 3HS0C 2E2IH 2LASA 4PZ8A 3IKJA 2UUAQ 1E2VA 3DWPA 4X66L 1IP9A 1EY0A 1TZ1A 2A4ZA 2JZZA 2FCQA 2N9PC 4R4CA 4H02A 1SJHD 1QT9A 2YTXA 3VDYA 4P1BC 2BBCA 3U30A 1CZGA 1I6HH 3RNBC 3AN1A 4O42A 5KHQA 1N63A 1ET9A 1VQNA 1UWMA 1M94A 3VH4B 3DWGC 4DV7L 1Y1VG 2DJGC 4KZ0A 3ZJVA 1ASZA 2EOTA 3HOUG 2F0DA 5M9OA 5IOIA 4FA6A 5E4XA 3TZUA 2BVCA 5C44B 4WORA 1K0SA 3K5NA 1VQLA 4TQUS 4IOCA 3DXJC 5HKHA 3CAMA 1IW7D 1QVFA 3J80E 4OELB 1FRDA 3V60A 1TVXA 2BYTA 1A3TA 4FF4A 2MO0A 1VZ6A 4XDDA 3IVFA 1QLBB 3C19A 4PYZA 3MC8A 5M5XH 1YITA 4CKEA 4W9KA 1C4PA 1XNRQ 4NQLB 4BY7G 1E7VA 2EYFA 4JI3L 3TMPB 4DV3L 1XLPA 3R7RA 2DZMA 2KQ7A 2ZEQA 1QUQA 1BBXC 4ZLTF 1I35A 1Z5SB 4B0MA 1QJOA 1JALA 4HEDA 2BKRB 1XWEA 2WNMA 2KQ4X 2WXLA 2B2VA 4IUUA 3S2AA 3HOVG 1IKMA 2D07B 4KTAA 4YWLA 3S14B 4NMZA 3VTWA 3ZLZA 2FMMA 1KRHA 3C0RB 4HDQA 4RMFA 2F4VQ 3RD4A 2CWAA 4YY3Q 2DZIA 2QEJC 4L5TA 1A3VA 1K8GA 3H15A 1I94L 1FCCC 3D6CA 4EFOA 4XT1B 3RN9C 1BCPF 5JEAJ 1KNAA 2LJIA 5AJ3L 1A3UA 3NUHB 4LLGM 4XDXA 4KV6A 2B2YC 1LABA 2ZJRA 3QWZB 4GN3B 5BR8L 1MHXA 3AE2B 4S17A 5FR3A 3DM3A 2A69D 1DD2A 2Z0EB 3KYHC 4JG2A 1B44D 1OXUA 1E2ZA 3FAHA 2DENB 2UU9L 5JPNC 3V62A 2K5WA 2Z8LA 3K58A 2XTIA 2JA8H 3KBXA 2EVBA 2D3CA 3W5UB 4DR6Q 2CHZA 3A55A 3BVZA 5HGTA 2CW0D 4CJ0B 1VZ8A 3C46A 4MJSB 3P4QB 1Z47A 4YWMA 3RZFA 4E74A 3KF6B 4W9FA 1GHKA 3PHXB 1T5EA 3A8KE 1WCMG 2OEOA 2L15A 3I73A 2UUCQ 3GTGB 1J6QA 1KDCA 4IFDJ 3A74A 1J0GA 2IW3A 3S24A 4KIKA 3AEEB 4DR4L 1HHVA 2GBMA 3CCLA 5EGTA 2KFKB 4PZ6A 1JJGA 5AFWA 1IBMQ 2LWPA 5HI1A 2F4IA 2K50A 1XCQL 4JX1C 2JA7G 2EMTA 3NJTA 5DEHA 2ZM6L 5GXGB 2BE5C 2MFIA 1L4DB 4X66Q 2WXRA 3QK0A 1PUTA 1ZOYB 5JJZA 2INDC 5J17A 1VMPA 1A63A 2N0SB 3B1LX 4K8JA 2CS4A 4LNKA 2HDMA 3M3YB 4NDXA 2V4DA 3WWVA 4F1SA 1ZP0B 1K28A 3NQTA 1TWCH 4KHZA 4DK0A 4IFDI 2N55A 3KF8A 4DV7Q 1N36L 2FXQA 3CHBD 2MLBA 1HA5A 3DHGC 3NVWA 3S17B 2R93B 4O0AA 3P63A 1V1PA 4TV3A 3W9CB 5ELNA 2Z4IA 3FKYA 3OMGA 2OT2A 2MPMA 4RGOS 4L5SA 1PFBA 3B2FA 4YTMB 2ZXPA 4JQWC 4F8CB 1VQ8A 1E8YA 3J81c 2I38A 2AL3A 4QQBX 4GLSC 5M3FH 1SN8A 2IT1A 2UXBL 3UDGA 1DOMA 4JW0A 3S2HB 1H9KA 4C3HB 2EKIA 1HH2P 3ZJTA 3IFTA 5KRUA 1RJTA 4TMAB 3W2DA 1YQBA 2J0MA 4MH8A 4IG7B 4BBNF 4GU2A 4JI3Q 2DNCA 3H0GH 4DUZQ 4DV3Q 2D10A 3RULA 1N60A 4TUUA 1VMCA 3TS2A 4P2CB 2CR5A 3P1MA 3M62B 4D2KA 2JF5A 5M5WH 1WGHA 3J81L 1JRPA 3ECIA 4USAA 1ZXIA 1EU4A 2J0TD 1YBYA 1LTAD 1XX8A 1TYGB 3PO3B 3VYTA 3CCQA 2I1JA 4U68A 4JI8L 1VQJA 1UNSA 3PS6A 4F87A 1JRUA 4JI5L 1I94Q 3RD2A 2EJMA 5CR3A 1EIYB 3MHZA 2BS3B 5GMVA 2K8HA 3ML8A 2JSOA 2XIWA 3L9AX 4WRDA 4APVA 3VR6A 5AJ3Q 1ENCA 1SE3A 4BBRH 2PVOD 3M95A 3V3XA 1IYUA 4AJYB 5BR8Q 3CC4A 3H3VH 5AUKA 1NTGA 3V2TA 1EO6A 3LJ3A 3QHTA 4A3DG 3SR6A 2UU9Q 3VFKA 1IL2A 1WMHA 4JI0L 4DNTB 2KCNA 4EQPA 1K8MA 3H1UA 2OJRA 2IGGA 5CHVC 3M4YA 2NPTA 5D65A 1IGCA 1K52A 1HZBA 5D94A 1VCIA 1TKWB 2BH8A 4YSYB 1Q3LA 4NAWA 2VH2A 4AQYL 4CJ1B 3D4RA 1ZGUB 3CC2A 3A9JA 3HOWG 2EE1A 1C9OA 2N4FA 5BMIA 5JJIA 1FRRA 3AEDB 1XTDA 4HAEA 4DR4Q 1HUNA 2QGQA 4B3TL 4ZAIA 4GDLB 1WJ4A 3NHEB 4NPNA 3TRZA 3GDEA 4A93H 3NVVA 2ZM6Q 4AUQC 3KLSA 2WXPA 3CCVA 1O7LA 4KGRA 4N9F4 1GUTA 4A3EG 4X62L 1VJKA 4MNOA 3KOJA 4ARIA 4JE3B 5LMNW 4P1CC 2RF4A 4IWOA 2LS01 1Q12A 2WWZA 1ACCA 2KJXA 3G7LA 2KAJA 1YJ9A 2PW7A 4RGNA 2J0KA 1J8CA 3VDZA 5IP7G 3KQ4A 4OIKA 1Y1VH 4FDBA 3NS8A 5MPOA 1N36Q 2KYWA 4N6EB 4ZDVA 2ZZPB 4N58A 1R9TH 1N5WA 3S2DB 5D2MB 1E6EB 4FP5D 4LFBL 2K01A 1V49A 3E5SA 1XMOL 4F8MA 5E4WC 2XNAC 3W1SA 1TWFB 2ENBA 4BOZB 3Q3JA 1GB1A 2JYOA 2G45B 2VQEL 2XK5A 3MTNB 1OXVA 2I5HA 2LMCA 1MIUA 2B8FA 2XWJB 2AUKA 2UXBQ 5EE3A 2B2WC 5IYCG 2J52A 3EA6A 4BY7H 1Y8OB 1YJIA 1CHPD 2DX5B 2RMMA 5C4ZA 1WOCA 5BN3A 2R7ZH 2IY1B 4MT5A 2K04A 2LZ6A 2B39A 1HR0L 4TQ1A 3AE7B 2GOWA 1GHJA 3GV3A 1LTBD 4QMGA 5BYQA 1B9NA 3ZJYC 1A5RA 4GNXB 2PO4A 1JE5A 3NZSA 5E7NA 3RLNA 3ZYYX 4KLKA 3RR5A 1K3BC 4JI8Q 2X69A 4M00A 2HCCA 4JI5Q 5DM73 3ZGZA 5EBCA 3PREA 4ANUA 1ZW7A 1XD3B 4FADA 5BN5A 4RA8A 1D1KA 5GAEC 1B9MA 3R2IA 2K5VA 1T0SC 3PUYA 4FXDA 2KN4A 3VR2A 1C8CA 1CT1D 5CGKA 3FPUB 3GTQH 3Q8CA 4JBJA 3MXPA 1XEEA 4LAAA 2VRRB 3DVGX 4IC7B 4B6WA 5C0XJ 1G51A 1TU2B 2L76A 1HPCA 3GTLH 3DOWA 4P16A 1D5ZC 1FM0D 1E24A 4JI0Q 4QAYA 1IZ6A 3P4RB 4DV2L 2D11A 3DDCB 2CQOA 4O1NA 4HIKA 5BYSA 1FIQA 2NUCA 3J81j 3AEGB 4GSWA 1MJCA 1XMQL 5BYRA 3NENA 3LYYA 3BZDB 1B70B 3HKZE 3H09A 3OMCA 2JQRB 4AQYQ 2A19A 2I2YA 3W1BA 4ZHPA 3F2DA 1I6HB 2VNUD 2HD5B 2MX2A 4P6VF 3PRMB 3KWVA 3AMZA 4K7UA 2KXJA 4XYQA 4GN5A 2VZAA 4AH6A 3TEXA 4QJFA 4B3TQ 2KWCA 1H9MA 2BYEA 1D4BA 5KIXA 1MGSA 4JGHB 2WXQA 2K33A 2BT6A 1CUKA 1N32L 4ZHOA 5DPSA 2MGSA 4P75A 2VQFL 2R2QA 2W9NA 2QIEB 1PZKD 1NR4A 3VRBB 2HTME 4X62Q 3FILA 3QAQA 3VR3A 2X38A 3V6EB 1QILA 2O4XA 1XXGA 4AIMA 3KLWA 4R4IA 2MJEA 3PRPB 1IKLA 2WKDA 4RF0A 4AS1A 1E3PA 3T53B 5FO8B 2FIFA 4K3CA 2MRPA 3E56A 2Q2IA 1WJJA 4A3MG 3STBD 5H8YE 1C3TA 2PMZB 4LFBQ 4TKOB 2HIXA 1XMOQ 4B3RL 1WX8A 3UINB 1SIJA 4GLVB 2VQEQ 1TS5A 1VZ7A 2LXCA 1GM5A 3A1QA 5LXHA 2QDBA 3S14H 4IPCA 3S1NB 1HCZA 4GOPB 4A3OA 3J80c 4WIPA 2LHDA 3VAWA 1AE2A 4GZYC 5CTRC 1OXTA 1WFYA 1B9RA 3CMAA 4FULA 3IT4B 1CM9A 1XTCD 5G3LD 1HR0Q 3EHVA 2ZT9C 3PZDA 2FUHB 5IAAC 2NBWB 4FNFA 4L5RC 2FBWB 4K0KL 3EIVA 2Z6KA 1M4VA 1WVLA 2ZJQA 4BFRA 4BBSB 2OQKA 5GQOA 3K0YA 1YMHE 2JA8B 1PH3A 3K5MA 1CK1A 1WX7A 2LRWA 2CU1A 4C1NK 3J80L 3RN5A 1SIFA 1UWVA 3JC66 3ZUNA 2PI2E 1W3SA 2YTYA 1WGKA 1TS2A 4C3IG 4POFA 2EQSA 3MEHA 4MSMB 2L8JA 2JEAI 4KDIC 2F0NA 3E9SA 3EGRA 1Q10A 3RN2A 1TR5A 5M3MH 1L6UA 3T1HL 3X3MA 1UUPA 1C48A 5TSSA 5EJWA 4PS7A 3KUDB 1Y1WB 4KN4C 3PO2B 2HHHL 1A70A 1YN4A 4A3FH 3AQQA 3NE5B 4KY6A 1I4HA 4TSSA 1H9SA 5DM63 4DV2Q 1PQSA 1NI2A 4KGSA 4I65A 4DBGA 3UQAA 2KEEA 4EUTA 1XMQQ 3PF5A 3H7SA 1HXYD 4IM3A 1K8OA 4HPMB 4MGZE 4JC0A 4QUCA 4ABNA 2BGFA 3N52A 3OIPA 1VDVA 4ZUJA 3FC4A 1F2MA 3M3YH 4KJNA 2KCCA 2KWVB 1X3PA 4TVAB 1KLVA 1SJED 2ZPNA 1TWCB 3BDOA 2MJDA 4CHKA 2WDRB 1AEXA 3HEJA 4P74A 4G7HC 5EKIA 2WXMA 1SBBB 4IPHA 1T3QA 4LF6L 3AE9B 2KECA 4C7ZA 2WU2B 3S17H 1NUCA 2R93H 1GKHA 1I6VC 2K5HA 5IE8A 1KF6B 2SEBD 2WS3B 1GO3E 1AH9A 1Q1OA 2KBNA 3R3OA 4G11A 1PGBA 1MSGA 1EU3A 2RDGA 3RMKC 2FNJB 2N7JA 3GTMH 4FF1A 2WXIA 4DDID 2D2QA 4HCPB 2PEAA 2OCEA 1LLRD 4GKJQ 2EKEC 3NQIA 5M3FB 2UXDL 1RCVD 2F0WA 4DGZA 4X65L 2RDBC 5T1GA 1O80A 4KIKB 1MSHA 3RZOH 4C3HH 4A8XC 3AEBB 3DHIC 4HVBA 1W2BA 1FXAA 1X6OA 1WYWB 1UE5A 1RKNA 2NWGA 4I7ZC 4C00A 1DOYA 3T16A 3ZNZB 1BMLC 3H0GB 1E8ZA 2JXMB 5BN4A 4RAUC 3MEFA 4DV5L 2LD9A 4RNAA 3SR1A 4A55A 3N30A 3LXFA 3Q8DA 2L00B 1F52A 3AEFB 4YCWA 4B3RQ 2ICIA 5M5WB 1YVCA 4DK5A 1TKYA 1MVKA 5IGFA 4ITKA 4MM3A 3S15B 4NXNL 2NBUA 1EY6A 3T4AC 2F03A 3AH7A 1SYFA 4XIGS 4IPGA 4BXXH 2A73B 1K51A 2AX5A 3VR9B 3KWLA 2DNFA 1LUZA 1WXVA 4JI2L 3PPAA 3O65B 2L7RA 1S5CD 3DUZA 1L7YA 4IJHA 5HFYA 2IX0A 4QIWE 2NVXH 2HJ1A 2FE8A 3OOCA 1KM7A 5T1IA 2YEPB 1WJNA 1SNMA 4LF9Q 2K3UA 4K0KQ 2ALYB 2EYJA 3HKZG 4BWGB 1WZ3A 1X56A 3A7LA 3I7FA 1PH4A 1O78A 1LACA 5EKLA 3HM3A 4BA1I 4DNRB 3LDZE 4R4OA 4UP8A 4GB9A 1J7AA 1B53A 1XNQL 2ZTDA 4LDTD 1ZDXA 2ICEC 1YIJA 1EYGA 4X3KA 3WCQA 2K8CA 4QB4A 1DXMA 2KEDA 2PZWA 2ATWA 1XJVA 1XYIA 1SE2A 1K8RB 4BY1G 2F0LA 4CDDC 1YIWA 3NTIA 3UQBA 5J3BA 5D3DA 3QIJA 4FLHA 1QKZA 5CYUA 2EYPA 3T1HQ 3JAME 4KKUA 1ZXTA 4AYBB 1Q1BA 3IRBA 2HHHQ 2V4IB 1B3QA 4A93B 1I4XA 4G3XB 4DUYL 2LUMA 3H94A 3HZXA 4DAMA 2CCZA 3D8GA 4REZA 3MFYA 2JN4A 4XT3B 4KV2A 1ENAA 2Z0SA 3W3AA 3M7NA 2XN9C 4BOSC 4L63B 2V0GA 3QR8A 2BKFA 1PA6A 2GN5A 1VQMA 1WTXA 4XWTA 1XF5L 3PO0A 3ICEA 1Y1VB 3M7GA 2F0TA 4OL7A 3HOUB 1KFYB 2AQ3B 1WTQA 1WM3A 2ZJDA 2PIAA 1R9TB 4LF6Q 3GTKH 3Q8FA 2K6AA 3S2DH 2L1BA 1PXUA 1TXYA 3APDA 1WTVA 1XO3A 4NZLB 1JORA 1CHQD 1RF2D 1TWFH 4DV4L 1E0BA 1O7IA 2A6HD 2WLBA 1EFWA 2YEPF 3MJ5A 2UXDQ 1Q1EA 2IX3A 4X65Q 4DR2L 4R9WA 3MFGA 1D1IA 1I4QA 3K0XA
chains in the Genus database with same CATH topology
4BY7B 1BF4A 2PKOA 4HKZE 2R7ZB 2EPBA 2INPE 4N59A 3DEPA 4WAFA 2C5CA 4PNYA 5CV4A 2BDNA 2N88A 2EYLA 4YXDB 3HOVB 2EXZA 2K22A 4QF4A 3OWEB 4CGYB 4KKSA 2Q8TA 2K5DA 3TUOA 4ZOHC 4XXEA 2L11A 3ZJUA 1ENFA 1GUSA 3BG3A 1RWSA 3LX0A 3T13A 3IL8A 3SE0A 5FK9C 1C4AA 3RFZB 2W82A 1M8AA 1HZ5A 2LMCB 3MXNA 5BMGA 3EVQA 5K36H 3IT6B 3P75A 1LO5D 1MBYA 1A6XA 2MHVA 4L6TB 3R8BA 1FD7D 3U7ZA 1L5PA 2B2VC 1BUVT 1AN8A 5C3XA 1QCBD 4XQNA 2CHBD 4NAMA 3K6OA 1WWTA 3SXHA 5EE1A 3TSSA 2O2LD 1EWHA 4JBWA 1LTGD 3K5LA 4RHSA 5JEAG 5G3LF 1CI3M 2PZUA 2K03A 4V0BA 4CQNA 5JPMC 3M4OB 1ZUD2 1F2RC 2L0CA 1QF6A 2X6GA 4WQMA 1HQRD 2QF7A 4X3UA 3D3RA 2ID0A 1Y56A 1FO4A 4IFDG 5T8IA 1SB3C 5EKKA 4IALA 4MACA 4KHVA 1F9PA 2Y5CA 3M85A 1HFGA 1CTMA 4OVZA 4KMUC 3P42A 4RKLA 2DLBA 3Q69A 1WYGA 1GUGA 1XLNA 3PIO3 1FXIA 2Y3AA 2WV6D 3SFEB 4XDCA 2Y0SB 3OW7A 2SOBA 4CKCA 2DYOA 5K5PA 2B2UA 3QWNA 2JXTA 4OZBA 1ROEA 1ZEQX 4L8JA 2PZTA 1JW9D 3CKIB 1FNUA 1I4PA 3H3VC 2HQEA 3J9CA 4K14A 4RFBA 1RD9D 1CJEA 2FHTA 3NK9A 3AE5B 5M3MB 4CJ2C 3FEWX 3GB1A 2H1EA 3OPOA 2IWHA 4K5WA 2NN6I 4RGTA 1KLGD 2AWNA 3Q22A 4A3FB 2YYZA 4JPSA 5C3JB 2LFIA 4ZKBB 1JE4A 1NR2A 1C9FA 1HUMA 1A15A 2AQ2B 2FJ2A 1C77A 1JICA 3HOWB 1EQVA 4OO1G 1YNJC 3DM1A 1VDZA 4HRSA 1ZKOA 3UI3A 2K9XA 1AZPA 4H2AA 3DMUA 4RCOA 3NXWA 1NI3A 2L9HA 4A3EB 3A56A 4E6IA 3TDQA 5KEEA 1VRAB 3GTMB 4DXGA 2F1MA 2IPKD 2B2YA 1DOXA 3BK2A 2L4NA 2L55A 4M8AA 2BS4B 2WXGA 1SNCA 3RZOB 1G91A 3I57A 4DAYA 1D5XC 1GUWA 1LT3D 1H9SB 1JROA 2W54A 4L1BA 3OWFA 4R3DA 3GQBA 1I50B 3GO5A 2KQ3A 1BQQT 1XLQA 1BUIC 2JU6X 2LGIA 3NPPA 3Q8BA 1ICWA 4OZAA 1SE4A 5I4DA 2NVXB 3TP7A 1SYDA 2F0SA 1TS3A 1D5MC 1B2TA 1HEZE 1Z7TA 3C1EA 2WACA 4OO1I 2GA4B 1EY7A 4RWSC 3HRZC 2D5GA 4K2KA 1NVID 2DY7A 2BTEA 4C3JG 2WU5B 4X3SA 1A2TA 1LTRD 5FLXE 3GP7A 2ZW0A 3S1MB 3VYRA 1EL0A 4JWUC 2EYOA 3CRKC 1IBXA 4G7OC 1H9RA 4X3TA 1J7BA 2GRIA 3DEOA 3L3OC 4IURA 4FYDA 3I4LA 1WTWA 2F3WA 2RVLA 3OSOA 4IUTA 4IZ8A 4DF7A 1U4RA 5KNCA 3I70A 5IOCA 2XSCA 4US9A 1BXTA 2BDOA 3MTSA 4FXCA 2CJNA 4ZQ3A 2KOLA 1RTNA 3GTKB 5IGGA 1PDXA 3EQLC 5D7GA 5JEAH 3A7AB 1ZPSA 1YNNC 1F9SA 1I3QB 3D4DA 3AE3B 4PV1C 4OZCA 1LTSD 4B9WA 5C0XG 5HURA 4JWSC 3NWTA 1EFID 3JAML 3S1QB 1SNPA 4C80A 3PUVA 1FR3A 2A68D 5FKAC 1T6BX 1O7ZA 4IFDH 1KDBA 4DN4M 1MHHE 1CA6A 2N9KA 2B2TA 3NTHA 1FFVA 2BCOA 2OF1A 1SNQA 5A35A 3QB3A 4HCEA 3MHBA 3V96A 1N61A 2E75C 1F9RA 4IUVA 2A6EC 1ESRA 1L0YB 2Y5PA 1DYQA 3VA5A 1SSOA 4ILWA 3CU7A 5I6WA 3MXGA 1U4MA 5EBDA 5C5MA 4DXFA 1JB3A 4N9TA 4C3IB 4PMWA 1KTKA 4FXKC 1SNDA 2QMTA 5IGBA 1PRTB 2RA4A 1T5XD 4J1MA 2EJFC 1U4PA 2NVTB 2B76B 3GTJB 5C4XB 3N9YC 1E0ZA 1AW7A 4FO2A 5C0XI 3VYSA 1JOOA 2B2WA 1YNJD 3CWIA 1NCVA 1PMRA 4K6LA 1KAAA 2FMCA 3TP5A 4A9AA 1WTPA 1I7HA 3BYTB 4YWGG 3QOLA 2JSVX 1SAPA 4UAIA 3UI2A 5KGUA 1J7CA 4H13C 1FGBD 2A6HC 1SXTA 2MJ8A 4YSZB 1GUOA 3GD7A 1XCTL 5I2XA 2EY6A 2DBYA 2PW9A 3PIP3 2ZXRA 3E0JA 4C2MB 1WTOA 1EQTA 1P7FA 1GAQB 1EYCA 5LNK1 1YQ4B 3PV0A 1AYFA 4R8NA 1EEID 1G291 4KKJA 3PUZA 2F0VA 4H7BA 2A5HA 1C76A 1VR9A 1LT4D 1OO9B 1L6VA 1J8IA 2M0AA 4V190 1GUNA 4NKLA 2DN8A 5HHDG 1S5DD 1PRTF 3VR5A 1F9QA 2PCFB 1UGJA 5EPJA 1STNA 5C5LA 1V43A 4MIUA 1YJJA 3TP8A 1J9OA 3QO2A 1UEAB 3QIAA 3OHXC 1NAPA 5KNDA 1EYDA 2PMVA 3LWEA 2ACZB 4L2YA 2E2DC 2JYEA 3HKZB 1SYEA 2I07B 3MC0B 3C2PA 1JMLA 1QOBA 2XRSD 2JP1A 2Z4HA 3AEAB 2G1EA 4F88A 4ID6A 1HTPA 2QKIC 4KY7A 5IODA 2QILA 3PUXA 1DOLA 1NENB 2XVSA 5M5YB 4HMIA 4BY1B 3WDNA 1BNZA 1YQ3B 1JWSD 3MWYW 2M19A 1SF0A 2WXJA 3K5OA 2WXKA 5C4JB 4KKIA 2D9UA 2SDFA 5D14A 1PTOB 1SDFA 1STEA 1L4ZB 1QOGA 2IL8A 4MN3A 2OHFA 2E74C 3LNNA 4KD3A 3MZ5A 2EZVA 4KI0A 3ABVB 4Q0FA 4WWMA 1FEHA 3URYA 1DGJA 2D5DA 3AV8A 4PQXA 4DA2A 2KMMA 1YNND 1ZYRD 4EQNA 4K8IA 1ET6A 4A3KB 1G8ZD 1ZDVA 2NMQA 1ESFA 5CBEE 2EY1A 4RCNA 3AE8B 5A2QE 3NVYA 5JVG3 2XWBB 1H9JA 5IT9E 3ND9A 5E3FA 1IYVA 3S16B 4H44C 3TN2A 1UAPA 3MP9A 4C1NI 1B50A 5COYA 2RDFA 1LT6D 1S5FD 4HSPA 1FNWA 4A3JB 1TKEA 1KABA 1V1PB 3IAYA 1HZ6A 2PW5A 1P7EA 3PUWA 5I9OA 1KDAA 3I4NB 2NBFA 3KLSX 4TRDA 2A6ED 1TY2A 3BVMA 2BS2B 3I4MB 2EYMA 4A3IB 2CJOA 2W55A 2BA1A 1EM7A 2CVRA 1MI2A 2BA0A 5KNBA 3I9V1 1A2UA 3BYYB 1EWYC 3T3OA 1TWGB 3I3CA 2CU3A 3I8ZA 1QQRA 3HUIA 3S9WA 3EJIA 3GS2A 2RQXA 3WOFA 4KN7C 2RDHA 2H88B 2KDMA 1X32A 1W6KA 1PRTC 1YN3A 4RH6A 3IAM1 1BDOA 2DNEA 2E6XA 1WTRA 3H8HA 1RFKA 4XQJA 1EZ8A 2QJLA 2HUGA 2MEKA 4US8A 1SMYC 4DQOC 1CZWA 4DU9A 3CQZB 3Q8EA 1EIHA 3GTPB 2K0PA 1VF7A 1OXSC 2NVYB 3VA7A 1V97A 4NAWB 2EY2A 3SEBA 1K50A 2G9DA 3BDLA 3T3NA 1FYCA 2VZKD 1ONLA 4HJGE 5FLXL 5G5HA 4G7ZC 2F0IA 1QNKA 3D6WA 2HCIA 3A8IE 3F2UA 4QIWB 5D3IB 4IDIA 4YTPB 3ERQA 1JQ4A 2L12A 1NYRA 1DOKA 2JEBI 4EGVA 3SK8A 3P4SB 2D62A 1HFNA 2KWDA 4A3GB 1QE6A 1IUEA 5ELFA 3K59A 1R4QB 3TEWA 3J7AF 1TKGA 3P20A 3IAS1 5J22A 3A8JE 2PLPA 1QWYA 2C9OA 4IOIE 1C4QA 4ZUIA 2VB3X 2O5JC 1PFDA 2LKVA 3TZDA 2MH7A 4KD4A 3Q0AA 3U52E 4ULLA 1PZJD 4FXGC 1XLOA 4KGTA 4DFAA 1EYAA 1PYWD 1ML0D 1EZ6A 1WCMB 1N5XA 3RPFC 5CORA 3B9JA 4FVMA 5EE0A 1WD1A 1Y69U 2F0UA 2R92B 4C7YA 5I9PA 1CQVA 5J39A 2VB2X 4ZRQA 4RHRA 1PFMA 1TY0A 2JA7B 4Q5VA 2K5QA 2E2HB 1FD6A 1LTID 5CV7A 4PMCA 2NYZD 1I4RA 2Z1CA 5J1ZA 3I91A 2NN6G 1C78A 2FFKB 2X6LA 1IGDA 1Y8PB 5ISRA 2B2UC 1PTOC 4WFN3 4XYOA 1CA5A 3P4PB 1R4PB 1AP0A 3AE1B 1DCZA 3T51B 3FDTA 2WXOA 2FUG1 1LTTD 1OXXK 1O7YA 3P1HA 3WOEA 1F0ZA 4ZK9B 3B2GA 2MUYA 2VUMB 4HN7A 4IUPA 5KYLA 2WXNA 2PQEA 2A68C 1YN5A 1TWAB 3DWAA 2K32A 1DM0B 1B1ZA 3NVZA 3FILB 3AU7A 2W3RA 2PNRC 2RSOA 5FO7B 4BS9A 5C2TB 3ETRA 4WURA 3U9OA 3R2TA 5C3EB 2G9HD 3C3LA 1OFFA 1STYA 1F77A 1E2WA 3AECB 3HOXB 4A3DB 1RYJA 2WP9B 1K83B 2EYHA 2WAQB 4XWWA 2L52A 4KKTA 3L4PA 1GXDC 5IGDA 1STHA 1TS4A 4C3JB 1JOQA 3QOJA 5LHY1 1HQMC 3IFDA 3HVDA 2PPBC 4J3OD 2Q8IB 5FOBB 1L0VB 1ZE3D 3KK7A 5JOBA 1PRTD 4TQ0A 5ELEA 4EQOA 3Q23A 3VR4A 4ODGA 1VF5C 1PTOH 1ILQA 3RUZA 1EY9A 1YNTE 5LL6X 3S1RB 1SMYD 5I2YA 3SK6A 2VZKB 2CQAA 2NVQB 3QG1A 4KX6B 5CV5A 2E2JB 2YU9B 2AQ1B 2WDVB 4Q2JA 4DAVA 4J6HA 3R93A 2M2LA 2IGDA 3PZ8A 3SVMA 3NSWA 1KLUD 4BA2I 5IIFA 2SNSA 4ZRPA 4IN3A 2RSNA 4HKQA 4RKBA 3KBGA 3NS1A 2B63B 3VR8B 2F0JA 3NTKA 2K1BA 3HOZB 2M00A 5E1FA 4R8IA 4Z9CB 3D4WA 3E6ZX 4UDUC 1S4ZA 1WD0A 2IJ0A 2GB1A 4B0EA 1BOSA 1GPXA 2KVMA 2F0GA 2V3NA 4L23A 3SHLA 1G2SA 3PMFA 1HTLD 3MAQA 1CFMA 3HOYB 4CBVA 2J53A 1HA6A 4YT0B 5BMHA 2WB1B 5ELBA 4MM3B 1L0XB 1G2TA 2INNE 5A2QL 3J7AV 1DOIA 3V05A 4OW0A 5IT9L 2WP8J 1SFOB 3GTOB 2R3ZA 3VRAB 1STAA 3NZ3A 2RPVA 3VYUA 1PFNA 2F0HA 2B2TC 4LMQD 1EIGA 5EPKA 3U9SA 1AZQA 4HEA1 1BCPC 4IKGA 2KACA 3KLRA 2JZPA 3BK1A 1PTOD 1ZYRC 4Y7NB 2TSSA 2NN6H 1DJRD 4OGQC 4HCSA 3NP8A 5JXVA 1E7PB 4YTNB 2F0QA 4NJCA 4LK0M 2JA5B 1SYGA 1LT5D 4FF2A 1LV9A 2F0KA 2O5IC 1KH0A 3H6MA 3MXUA 1MD2D 2PYKA 4NP5A 4C3HG 4A3MB 4NW2A 3EFXD 1EY4A 2DYMA 1VLBA 2KHSA 4A3BB 2J42A 2LHEA 4QCLA 2M56B 2IGHA 2IX1A 1IL8A 2Q8RE 2H4OA 5IGEA 2EELA 2Q5WD 5H92C 2NTTA 1TZOA 3HRDD 3EROA 3IXSA 1C79A 1F2ZA 3Q24A 2K7VA 2F0MA 2PTLA 1G6ZA 4ZRZA 3BS1A 1TIID 3MA2B 4ZYSA 3G6JB 2PVGC 3BDCA 2OXPA 3TMEA 2ZW1A 2K05A 3NHHA 3C1FA 3AB5A 3NBIA 1W6JA 1JWAD 1STGA 1JWUD 1JC7A 2MP1A 2K5PA 4ME5A 2JA6B 2EY5A 2JYTA 3MFGA 4JK1C 2BB6A 2V3PA 3EUB2 2OEDA 2R61A 1R7SA 2LEKA 3FVQA 2E2IB 2JX5A 1HRJA 5C3WA 2L5TA 5EE9A 4OO1H 3ND8A 1Y8NB 4PT5A 4XQQA 3RZDB 1S5BD 2N9LA 2BE5D 1PGAA 2R6GA 5IGCA 1PLFA 1AWDA 3VQIA 5AUIA 4EE2A 5JVH3 4MHEA 5E6JA 1GB4A 4LTUA 3D31A 1AFPA 4KY5A 3FMCA 3BVGA 4U673 1RTOA 1CZPA 5CV9A 1OQQA 3HGBA 2ON8A 5C4HA 4RGMA 1PDQA 1N62A 3OIQA 2RBMA 3W5VB 1KNEA 5CV6A 5M5XB 2KA7A 2NZ1D 3O13A 3AMUA 5ELDA 4M1UB 3ITPA 2KUMA 2TMPA 1FMAD 1EWCA 3C8YA 3CRLC 2BOSA 3SK4A 2L83A 2ZXOA 3ONAB 3TP6A 2VXWA 4G4KA 2WXHA 2K28A 3RLFA 4HR7B 5DNFA 4A6QA 3T56B 3FPPA 1E9MA 5KYIA 1ILPA 1OQRA 4K5VA 2WQYB 4K6DA 1TWHB 3BWUD 3J7YW 4ARCA 4YIJA 1JQYD 4M0WA 1Q90A 3I72A 3K57A 1V8QA 5CMDA 1TT2A 4CHTB 1C4CA 1UWXA 1QNUA 1V1OA 1MPEA 3GV6A 2F3VA 1WXQA 3KUPA 1BR9A 1EOTA 1QB5D 1RHPA 2H89B 3TEZA 1CQFA 3A54A 1SYBA 2F0PA 2W3SA 5ELCA 5K36G 1JWMD 3U4EG 4C56C 2QSDA 4EVOA 3LWUA 3DWMA 1F2LA 3FKIB 2L32A 2WKCA 4ZKCB 1FFUA 2E76C 4K5XA 1JCKB 3DWQA 3J81E 4IUQA 2AUJD 2WXFA 4XTCS 1BCPD 3AE4B 2LY7A 2F0EA 3DHQA 2HDEA 1D6EC 5HG2A 1E10A 4S3SA 2SAKA 5CV8A 3HP3A 1IW7C 2DY8A 4GDKB 2L1AA 3SK5A 1NEKB 2HDLA 3FRPB 4PMBA 5C0XH 4QUFA 2GI9A 2B8GA 4FF3A 1V8CA 1SSNA 3NUCA 3PZ7A 5G5GA 2D2CC 3I90A 2JE6I 2J7ZA 1EEFD 4DK1A 2EJGC 3NRZA 5NUCA 2RKSA 2A69C 1PTOF 3NWSA 1TJEA 4J8QA 4HTHA 1NYQA 4BBRB 3LB8C 2A74C 3SDZA 1PZID 4HMJA 1SEBD 2CW0C 3NBHA 4HROA 1B4OA 2EDGA 2BW2A 2JWUA 4IUNA 4N9PA 1JR0D 1EY8A 1Z6HA 3MVVA 5LL6S 4B08A 1JWBD 3TEYA 1FCLA 2NB0A 3CIRB 4OIJA 4DAPA 4WH4A 1STBA 2F0FA 1U9RA 5JAVA 2E3TA 1D2BA 1SNOA 1PGXA 4AQ7A 5C6AA 1S5ED 3Q6SA 1NSNS 2LFNA 1GJXA 1SYCA 2QCPX 4A90A 3X3NA 3ZQ4A 3K7AB 4G57A 2XRQD 4HSVA 1QOHA 4K2LA 1EY5A 3BIID 4CKBA 2WDQB 5DAUA 5FO9B 1IBXB 1QG7A 3U2SC 1RDPD 1DZ1A 2F0OA 1B3AA 1TQOA 1RM6C 1DONA 1I4GA 3TBIB 1RODA 2WINB 4IQZA 3N6RA 2NTSA 1Q8IA 1WSPA 2AWOA 1JOKA 3L7ZC 1FNVA 3AB9A 2J4XA 3Q8AA 1MI0A 2M9VA 5F2DA 3HG9A 1F2YA 4H0LC 5EQ0A 5CC4A 4B9XA 1QOFA 1K53A 1WRIA 2FINB 4RF1A 3QJYA 2ONQA 3HVZA 2WIIB 4YSXB 1II3A 1QOAA 2DWQA 4KJOA 3H91A 5EPLA 4OHJA 3SFDB 3P7JA 2BB5A 1U4LA 1IHZA 3RMHA 2MJ3A 3AE6B 1F2RI 4LJZC 1ZXHA 4F7XA 2SNMA 4XE0A 4LK1C 1GOZA 5I6YA 3AM9A 3GTQB 4WJWA 3GTLB 2I46A 1X3QA 2IDYA 5CBAE 1BCPB 1BO0A 3HS0C 3IKJA 1E2VA 3DWPA 1EY0A 1SJHD 1QT9A 2BBCA 1CZGA 3AN1A 4O42A 1N63A 1ET9A 1UWMA 3DWGC 3ZJVA 2EOTA 2F0DA 5M9OA 5E4XA 3TZUA 5C44B 4WORA 3K5NA 4TQUS 3DXJC 1IW7D 3J80E 1FRDA 1TVXA 2BYTA 1A3TA 4FF4A 1VZ6A 4XDDA 1QLBB 4CKEA 1C4PA 2EYFA 1XLPA 1BBXC 4ZLTF 4B0MA 1QJOA 1JALA 4HEDA 2WXLA 1XWEA 2WNMA 2KQ4X 2B2VA 4IUUA 1IKMA 4KTAA 3S14B 4NMZA 2FMMA 1KRHA 3RD4A 2QEJC 1A3VA 1FCCC 3D6CA 4XT1B 1BCPF 5JEAJ 1KNAA 2LJIA 1A3UA 3NUHB 4LLGM 4XDXA 4KV6A 2B2YC 1LABA 5FR3A 1MHXA 3AE2B 2A69D 1DD2A 1B44D 1OXUA 1E2ZA 3FAHA 5JPNC 2K5WA 2Z8LA 3K58A 3W5UB 3KBXA 2EVBA 3A55A 5HGTA 3BVZA 2CW0D 4CJ0B 1VZ8A 3C46A 3P4QB 1Z47A 1GHKA 1T5EA 3A8KE 2OEOA 3I73A 3GTGB 1KDCA 4IFDJ 2IW3A 3AEEB 1HHVA 5EGTA 5AFWA 5HI1A 2F4IA 1XCQL 4JX1C 5DEHA 5GXGB 2BE5C 1L4DB 2WXRA 1PUTA 1ZOYB 5JJZA 1VMPA 2N0SB 4K8JA 2HDMA 3M3YB 4NDXA 2V4DA 1ZP0B 3NQTA 4KHZA 4DK0A 4IFDI 2N55A 3KF8A 3CHBD 1HA5A 3NVWA 3S17B 2R93B 3P63A 1V1PA 3W9CB 2Z4IA 3OMGA 2OT2A 2MPMA 4RGOS 4YTMB 1PFBA 3B2FA 2ZXPA 2I38A 4GLSC 2IT1A 1DOMA 3S2HB 1H9KA 4C3HB 2EKIA 3ZJTA 3IFTA 5KRUA 1RJTA 4TMAB 3W2DA 4MH8A 2DNCA 1N60A 1VMCA 4P2CB 3P1MA 4D2KA 3J81L 1JRPA 4USAA 1ZXIA 1EU4A 2J0TD 1LTAD 1XX8A 1TYGB 3PO3B 3VYTA 4U68A 1UNSA 4F87A 2EJMA 5CR3A 3MHZA 2BS3B 2JSOA 2XIWA 3L9AX 4WRDA 3VR6A 1ENCA 1SE3A 2PVOD 3V3XA 1IYUA 5AUKA 3V2TA 3SR6A 4DNTB 2KCNA 4EQPA 1K8MA 2IGGA 3M4YA 5D65A 1IGCA 1K52A 1VCIA 1TKWB 4YSYB 1Q3LA 4CJ1B 3D4RA 2EE1A 5BMIA 1FRRA 3AEDB 4HAEA 1HUNA 4ZAIA 4GDLB 3NVVA 3KLSA 2WXPA 1O7LA 4KGRA 1GUTA 1VJKA 4ARIA 4JE3B 2LS01 1Q12A 1ACCA 2KJXA 3G7LA 2KAJA 2PW7A 4RGNA 3KQ4A 4OIKA 5MPOA 4N6EB 4N58A 1N5WA 3S2DB 1E6EB 4FP5D 2K01A 3E5SA 4F8MA 5E4WC 2XNAC 3W1SA 1TWFB 2ENBA 1GB1A 2JYOA 1OXVA 2LMCA 2B8FA 2XWJB 2AUKA 5EE3A 2B2WC 2J52A 3EA6A 1Y8OB 1YJIA 1CHPD 2RMMA 5C4ZA 5BN3A 4MT5A 2K04A 2B39A 4TQ1A 3AE7B 1GHJA 3GV3A 1LTBD 4QMGA 5BYQA 1B9NA 2PO4A 3ZYYX 2X69A 2HCCA 5DM73 3ZGZA 5EBCA 5BN5A 4RA8A 1D1KA 1B9MA 3R2IA 3PUYA 4FXDA 2KN4A 3VR2A 1C8CA 1CT1D 5CGKA 3FPUB 3Q8CA 3MXPA 1XEEA 4LAAA 5C0XJ 1TU2B 1HPCA 4P16A 1D5ZC 1FM0D 3P4RB 4O1NA 5BYSA 1FIQA 2NUCA 3AEGB 5BYRA 3LYYA 3BZDB 3OMCA 3H09A 2JQRB 2I2YA 4ZHPA 1I6HB 2VNUD 4P6VF 3KWVA 3AMZA 4XYQA 3TEXA 1H9MA 1D4BA 5KIXA 1MGSA 2WXQA 2K33A 2BT6A 4ZHOA 2MGSA 2QIEB 1PZKD 1NR4A 3VRBB 2HTME 3FILA 3VR3A 2X38A 1QILA 2O4XA 1XXGA 2MJEA 4RF0A 4AS1A 1IKLA 2WKDA 3T53B 5FO8B 3E56A 5H8YE 2PMZB 4TKOB 1SIJA 1TS5A 1VZ7A 2QDBA 3S1NB 1HCZA 4WIPA 2LHDA 4GZYC 1OXTA 1B9RA 3IT4B 1CM9A 1XTCD 5G3LD 2ZT9C 4FNFA 2FBWB 1M4VA 1WVLA 4BBSB 3K0YA 1YMHE 2JA8B 3K5MA 1CK1A 4C1NK 3J80L 1WGKA 1TS2A 4C3IG 3MEHA 2JEAI 2F0NA 3E9SA 3EGRA 1Q10A 1TR5A 1L6UA 3X3MA 1UUPA 1C48A 5TSSA 5EJWA 1Y1WB 4KN4C 3PO2B 1A70A 1YN4A 3NE5B 4KY6A 1I4HA 4TSSA 1H9SA 5DM63 4KGSA 4I65A 2KEEA 1HXYD 1K8OA 4ABNA 4QUCA 1VDVA 3FC4A 3N52A 3OIPA 4ZUJA 1F2MA 4KJNA 2KCCA 1X3PA 1SJED 1TWCB 3BDOA 2MJDA 2WDRB 1AEXA 3HEJA 4G7HC 5EKIA 2WXMA 1SBBB 1T3QA 3AE9B 4C7ZA 2KECA 2WU2B 1NUCA 1I6VC 1KF6B 2WS3B 2SEBD 3R3OA 1PGBA 1MSGA 1EU3A 2RDGA 2N7JA 4FF1A 2WXIA 1LLRD 3NQIA 5M3FB 1RCVD 2F0WA 4DGZA 5T1GA 1O80A 1MSHA 4A8XC 3AEBB 1FXAA 4I7ZC 1RKNA 2NWGA 1DOYA 3T16A 1BMLC 3H0GB 2JXMB 5BN4A 4RAUC 4A55A 4RNAA 3SR1A 3LXFA 3AEFB 2ICIA 5M5WB 1TKYA 1MVKA 5IGFA 4ITKA 3S15B 3T4AC 1EY6A 2F03A 3AH7A 1SYFA 4XIGS 1K51A 2AX5A 2A73B 3VR9B 3KWLA 1S5CD 3DUZA 5HFYA 2IX0A 2FE8A 3OOCA 5T1IA 2YEPB 1SNMA 2K3UA 2EYJA 4BWGB 3A7LA 1O78A 1LACA 5EKLA 4BA1I 4DNRB 1J7AA 1B53A 1ZDXA 2ICEC 4X3KA 3WCQA 4QB4A