5D3IB

Crystal structure of the ssl3-tlr2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
KYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 2
publication title Structural basis for inhibition of TLR2 by staphylococcal superantigen-like protein 3 (SSL3).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
B PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d3iB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5d3iB01
1KLUD 1FNVA 1RF2D 1S5BD 1RD9D 2AQ2B 1CHPD 1JCKB 1I4XA 1PZID 4RGTA 1STEA 1G8ZD 1V1OA 2RDGA 1LO5D 1MD2D 3R8BA 5I4DA 3DWPA 1RCVD 2XNAC 1BCPC 1SJHD 1BXTA 1PTOB 4TSSA 4OHJA 3SEBA 5FKAC 1S5ED 4RGOS 3MFGA 4K6LA 1BCPF 1LLRD 3KLSX 1TS2A 4RGMA 3GP7A 1FNWA 3EA6A 1AN8A 3W2DA 1EU3A 1TS4A 1TS3A 2J4XA 4O1NA 5ELCA 4BWGB 1S5FD 1TY2A 3R2IA 3URYA 4RCOA 1XTCD 1I4PA 2QILA 5ELFA 1ENFA 1LTID 1DYQA 1CHQD 2XRQD 1EU4A 5D3IB 3R2TA 5TSSA 1EWCA 5ELDA 2Z8LA 1SE4A 1V1PB 4RGNA 1SE3A 2O2LD 4Z9CB 1PRTB 3BZDB 1I4RA 1ET9A 4RH6A 1D5XC 2NTSA 1JWSD 1D5MC 1PTOC 1BCPD 2QEJC 2RDHA 4NZLB 3OWEB 1TY0A 1FGBD 2AQ1B 1PTOF 4DXGA 2XN9C 1KLGD 1EFID 1D5ZC 1YN4A 1LTBD 3BVZA 3O13A 5ELBA 3DWQA 4L63B 1PTOD 1XXGA 1CK1A 1KTKA 3BYYB 4L6TB 1DJRD 1PYWD 1LTGD 5ELEA 1SEBD 1JWMD 1I4GA 1LTSD 2SEBD 1L0YB 1LT3D 4ZYSA 3BVGA 2XRSD 3EFXD 3BVMA 1HXYD 4DXFA 1QILA 4UDUC 1LTTD 1ESFA 1RDPD 1LT6D 5FK9C 1LTAD 2G9HD 3TSSA 1B44D 1F77A 2TSSA 1EEFD 1FNUA 1HTLD 2IPKD 1I4HA 2CHBD 1SXTA 1D6EC 1S5DD 4C56C 1LT4D 2NTTA 1BCPB 1I4QA 1PZJD 1PRTC 4RFBA 1JWUD 2ICIA 1CQVA 1JR0D 1PRTF 1HA5A 3MC0B 1FD7D 1GOZA 1CT1D 1PTOH 3DWAA 1SBBB 1AW7A 1SJED 3CHBD 1M4VA 3BYTB 2WV6D 1PRTD 1T5XD 1TS5A 1JQYD 1SE2A 1LT5D 1EEID 1S5CD 1B1ZA 1UNSA 1L0XB 4RHSA 1PZKD 2IJ0A 5D3DA 1UUPA 3V05A 2R61A 1ET6A 4RHRA 1HQRD 1YN5A 1LTRD 2AQ3B 1V1PA 1YN3A
chains in the Genus database with same CATH superfamily
1TT5B 1HNZL 3AN1A 1SE8A 3RNUA 3C2PA 2GOWA 1VD2A 2CHXA 4GGQA 2XK5B 3NHEB 3ALBA 1IZ6A 1PH9A 5JPMC 2RSNA 4FO2A 3PGEA 1YEZA 2OXPA 3A8JE 2UXDQ 1S40A 1KDCA 3MVVA 1G6PA 1KLVA 5BYQA 1VZ7A 3DMUA 4B0MA 2GBMA 2NVQH 5M5XB 4MH0E 2EYOA 2EY1A 1VQ4A 1S5ED 4C3JB 4IUMB 3SHQA 4IUQA 1EL0A 4LK0M 3F2CA 3ECIA 1XEEA 2NZ1D 1D3ZA 3CQZH 3RD2A 3TMPB 5C0XJ 2INPE 3STBC 5LL6X 4BOSC 4FBJB 4LF6L 1IYJB 4DR6Q 1X54A 2INCC 5C4JH 2NR2A 3V62A 5IE8A 3HS0C 1JOOA 3JAMc 4K5XA 4XDXA 2KFJA 1KHIA 3D4RA 3WWVA 5IA7A 2PMZB 5EE1A 1EY5A 3J81j 4JL9A 4CYEA 2KLCA 1NR2A 1WWTA 3TP6A 1YNXA 2A69C 1CI3M 4K8IA 4BBRG 1GO3E 3TEXA 1E1TA 1KRTA 4FN2A 1QF6A 1EWYC 3FVQA 4B3SL 3K57A 4FJZA 4B0EA 4QGUA 3HP3A 1HNWQ 2IGHA 3PO0A 1C7YA 3K0XA 4HCEA 4RG1A 2DWQA 1SLJA 5LHY1 3TZDA 3CSFA 1E24A 1S3OA 4ZRZA 4C3IH 1I6HH 3VRAB 2Z0SA 1L1OC 3OWEB 3VXWA 2KVMA 2LZ6A 1V97A 3TRZA 1SDFA 4ANWA 2PEAA 1B9RA 1DGSA 1WTPA 3E0EA 2F03A 1VQBA 3U50C 1CK1A 3FKIB 1UEAB 2N78A 3KBGA 4BY7B 1HHVA 2DAJA 2L0TA 2L12A 3I4MB 4BBSH 2F4IA 3B2GA 1NBFC 5EE3A 3SHLA 3IG3A 1FCLA 2VZKD 1IBKQ 1O7IA 5HY6A 1N34Q 2IO0B 2MSED 2TSSA 4DHJD 2K33A 1VQHA 2HJ8A 4KGSA 2IPKD 1NMGA 1EF1A 3APFA 4MM3A 2CW0C 1S5DD 1KRSA 4PMWA 3I73A 1AZPA 1TKEA 3L4PA 4PT5A 3CCVA 1F9PA 1XMQL 4Y7NH 1EM7A 4KSLC 2OT2A 3CCLA 1JMCA 3B1LX 1F2MA 3ONSA 4TVAB 1BT0A 1OEYA 2UYZB 1VMPA 2BH2A 4NJ6A 4WJWA 2JK8A 3RR5A 4AYBG 1FRRA 1V9PA 1V81A 1LT5D 2NB0A 3BU2A 2BCOA 4I7AA 5JVG3 1STGA 2QCPX 3V05A 1WH3A 2EE1A 2R93B 3N30A 3R7RA 3H9DA 3BWUD 2DBYA 5IO9A 4RM8A 4IZ8A 1VCBA 4EKUA 1KAWA 4A3EB 4QY7A 1E6EB 1H9RA 4DUYL 4C80A 2KC1A 1B8AA 4LJZC 1I94Q 2L9HA 2Y5BB 2MO0A 4GOPC 5C44B 2M17A 2WX0A 5C2TB 1MD2D 2EYJA 4IFDH 3NBHB 4EQPA 4EX5A 4IOIE 3R3OA 4POGA 2CFMA 1JOKA 2PVOD 2A6HD 3AU5A 5DPTA 3RD4A 1ZGUB 2LGSA 2F3WA 2Q5WD 2ID0A 3I4NG 2CQOA 1FEHA 3Q6BA 1AZQA 2WXOA 4WWMA 3AE7B 4LK1C 3EVQA 3J81i 1XPRA 4JWSC 3IFTA 4RGMA 2BH8A 3I91A 2W3RA 4TMAB 2ZJRA 3AECB 2OQKA 3GOEA 2VL6A 3EA6A 1E3PA 1R9TB 4HRSA 4KJOA 1EU3A 3BIID 3ZJYC 1XNRQ 2BQQA 3C19A 3PHXB 5M3MB 4U673 1WMHA 3TEWA 5FJ8G 1Y1WB 3ND8A 2WXHA 4MJSB 3URYA 1X56A 4RCOA 3DM3A 4POFA 2MNAA 4P72A 3L2PA 1K51A 1PQSA 4FHKA 5AUKA 1I35A 1CFMA 3F2DA 2JUOA 1IUEA 3GDEA 5LXHA 1TWFH 3MA2B 1FMAD 4OO1G 3L08A 1WJJA 2F0UA 5AUIA 4AYBE 3T53B 4MGZE 1ZKHA 2J52A 5JXVA 1RTOA 3R2TA 5D3IB 3S14B 2RPQA 2FJ2A 4A3CG 4BXXH 2H5XA 4QIWB 1QZHA 2TMPA 1ICFB 2WB1B 3QA8A 2EJFC 4DV1L 1DOKA 3VYRA 1FCCC 1PRTB 3ZRCA 4RAUC 4B08A 1EYCA 3WA0A 2GRIA 1B3AA 4KIKB 3DHIC 2UUAL 5IT9L 4A3FG 1RODA 2X38A 3H3VI 3NUHB 1GUTA 1Q7YC 3NE5B 1T5EA 2PCFB 1BBXC 4UP9A 1X9NA 1JW9D 4ANUA 1K0RA 1YQBA 1D5ZC 1YN4A 3IKJA 4A3JB 3A5UA 3HOWG 2ZW1A 2B2UC 2N9KA 3UDXA 4E3CA 2KX3A 2CU1A 1I4GA 1OO9B 2F0SA 2XWJB 2MP2A 4JPSA 1Q12A 3KYDD 1IL8A 2Y0SG 3EFXD 1IBXA 3SVMA 3BVMA 4OZCA 2LMCB 4OWXB 3AH7A 1GHJA 3KFUA 3DBLI 4IUNA 3GTJB 2UUCQ 1OGWA 1T0QC 3AU7A 1YHAA 2WIIB 1J7CA 1LTAD 1S4ZA 4FXKC 3J9CA 4NW2A 4YWKA 2WAQG 3T3NA 1C0AA 1P0RA 2IGDA 1EQVA 3LWEA 4FADA 3HKSA 1VJKA 1V49A 4A3BG 4HDQA 1JWAD 2D5GA 4BBRH 5K36G 1WXVA 1PUTA 3RYTA 2BS3B 1IBML 3L16A 1WFYA 4A3GG 3M3YB 2VH1A 2UXCL 4WJPA 1GOZA 1MHXA 3AFPA 2CH4A 2K1FA 5BR8Q 4DR1L 1SJED 3CHBD 2E6XA 5J2RA 1FXIA 4CQNA 4IW0A 1WI0A 4XGAB 2SAKA 2JSVX 3MJWA 1W6JA 1N5WA 2FCNA 1QVCA 1ET6A 1WR1A 1X3FA 3NP8A 4GXBA 2B39A 1FJGQ 1YN3A 1YNND 3M4OB 4J6IA 1S5BD 2MBBB 3DOWA 4JI1L 4JGHB 3RPFC 3A9JB 1I4XA 1VQ7A 5C23A 2GLSA 5FLXE 4X62L 1WTQA 2Z59B 4KN7C 5E6NA 3WCQA 1HZBA 1X1MA 3VYTA 2EYHA 1NE3A 2V3SA 3J7AF 2K4KA 2LJ5A 3W9CB 2EY5A 3DQVA 3U8ZA 2PPHA 1VQDA 5IGCA 2DGYA 3GV3A 1TKGA 4RNAA 3ZVVA 1SNMA 4ZLTF 4EFOA 1F1HA 3B6YA 1YNTE 1S1QB 2WAQE 1TS2A 2R3ZA 3HOUB 1BNZA 4DDGD 3CW2C 5EDSA 4HEA1 1YQ4B 3VH3B 2D0PA 4KN4C 3ZYYX 1TS4A 5C5MA 1S5FD 4FXDA 1HPCA 4WJOA 5AEKB 5D94A 3SFDB 1C79A 2Z4HA 1SIJA 3AMZA 4L1BA 1GXDC 3TEYA 2I5HA 5I2XA 2OHFA 1HNWL 3D0FA 2F0MA 3GS2A 4KKJA 1UWVA 4R4IA 1DYQA 1IXRA 3SDLC 4DV4Q 1FRDA 4YWGG 1WTRA 2QMTA 4IWQA 1Q86C 4OVUA 1NAPA 1Y8NB 2RPVA 1GNUA 2YEPF 1CMXB 2FCSA 3QWZB 4K6DA 1WM3A 4XT1B 2K6QA 4X57B 5E6OA 2Z8LA 2OEDA 3IHPC 1EY6A 4YHHQ 2B2YC 3F8TA 3KDFA 1KH0A 3WDNA 2V1YA 5CHFA 1H8CA 2NTSA 2VQEQ 1D5MC 3IBEA 4MTKA 3NY5A 1PTOC 1V1QA 3GO5A 4JI5Q 3HRZC 4JE3B 1SYDA 4NPNA 4DR3Q 1WX8A 4GOPA 1E9MA 3ER0A 4JVZA 4BY1G 2UU9Q 3H3VC 2A6ED 3ULJA 3P1HA 3PUVA 3I4NH 1Y8OB 3TP8A 1TT2A 1C4AA 1QNKA 4MT5A 2A68D 2D3GA 1IBKL 4S17A 3FKYA 1N34L 1JWMD 3DWMA 1PDQA 3Q69A 2I07B 2DHZA 1YD8U 4DR4Q 2GVAA 4JC0A 2JA7G 1A15A 4K14A 4CJ1B 5KNCA 1TZ1A 5FO8B 2J0JA 4M8NA 1B70B 4CDEC 5FJ8H 2JA6G 1FFVA 3N1ZC 2QF7A 5GAGC 1R4NI 1K3RA 2L55A 3AB5A 1FNUA 2KEDA 4XTCS 2QC8A 3QIJA 3VFKA 4A8XC 1WI5A 4ZKBB 4UY8C 3B9JA 4OO1H 3M4PA 1T0SC 4JI0Q 2F0DA 2LWPA 4L2YA 5IIFA 1A3UA 4A3CH 1CQVA 3MC0B 2YU9B 2HDMA 4NAWA 3J80L 1ZKOA 1QUQB 1LYLA 2F0GA 3H6MA 5H8YE 3RFZB 1WTWA 3PPAA 5CBEE 1WGRA 4WAFA 4AOFA 4R4CA 2L8JA 4AQYL 4CKEA 2JEAI 5LMNQ 2VUMB 1PA6A 4A3FH 2SNMA 3PZ8A 2XTIA 3PUWA 1J5EQ 1Q8KA 4KY5A 3CPWA 3RLFA 2KO3A 2C60A 1SIFA 4K3CA 2RMMA 1F2ZA 3HOWH 1H4RA 3OTOQ 3NBIA 2J7ZA 1HR0Q 4KKIA 2VQFL 1G8ZD 3FRPB 2E2JH 3K7UC 1O7ZA 2VZAA 1C3TA 1QKZA 3QOLA 2HE7A 2GBNA 2L4NA 1FYCA 4YTMB 2ZJPA 3BINA 2G45B 3K7AB 1VQJA 2ONQA 3RZDB 1XNRL 3PREA 3NHHA 4ZCKA 4Q2JA 1PDXA 4RGOS 2ZJDA 4WQMA 2MHJA 2N9XA 3T8MA 4G57A 4LW1A 3GTPH 3A4RA 4A3BH 5HHDG 2EDGA 3HK0A 4G4KA 3CQZB 5JH5C 5K36H 4B9WA 2E5LQ 1NYRA 4FA6A 2HUGA 1IP9A 3KUCB 3RT3B 4BWGB 3RZOH 5CC4A 5BN4A 4ZOHC 4A3GH 4BBNF 4AP4C 4W9DA 2IL8A 1CKOA 3EBEA 3VQIA 2KN4A 1I4PA 1GB1A 4X64Q 3H91A 2WWZA 3H15A 1JC7A 2GBRA 2XWBB 1I50H 4WQOB 4YXDB 4A3PA 3H8HA 3AEFB 1WTVA 3I90A 4LUOA 5CV7A 4X66L 3M9BA 1KAAA 5KGUA 3NJTA 4DU9A 3JC66 1QQRA 1M94A 4MGKE 3I57A 3WAPA 1SYBA 2F0HA 1XT9B 3PO3B 1ZW7A 4GNXA 2F0PA 1SFOH 5C4XG 1MVKA 4EUTA 2O2LD 2J42A 1ZYRC 4WRDA 3MWYW 3HKZB 5CORA 1I6HB 2JT4B 3CIRB 3TS0A 2R92G 1A70A 2BBCA 4RMFA 2KMCA 2BA0A 3ML8A 2A73B 2MJDA 2QJLA 2K5PA 2KBNA 4LF5L 2K28A 2P5ZX 4JK1C 5A35A 4XC2A 2UUCL 3AXCA 2Z6KA 1TWGH 3HOZG 1DJRD 3O65B 1WOCA 1L6UA 1U5KA 3RULA 1MG8A 3CCSA 1WGYA 4DK5A 1FXAA 3BVGA 1KQSA 4HLEA 1VQ9A 4DXFA 3G4SA 4GLXA 2N9LA 3P4QB 1F0ZA 2ZT9C 3NXWA 4R8NA 3S15H 2M00A 2NWGA 1LXDA 2RR9A 1N36L 1PH3A 1WYWB 2MP1A 2G5DA 4XYOA 2KTRA 2NVXB 3FHWA 2L76A 4IPDA 4B3SQ 3QX1A 2A5HA 1WJNA 1XQQA 5BR8L 2BS2B 5GROA 3V96A 3A55A 4I6LB 1OQQA 1E90A 2CHZA 1TWHH 3A8IE 3R66C 1P1AA 1C1YB 4YIJA 1V8CA 3J7YW 1VQMA 2MBEA 1RKNA 2YV5A 4GOCA 2RHQB 1G2TA 3VTUA 3IT4B 1TS5A 1SE2A 2B2YA 2D3BA 3VUXA 1CA5A 2ZPNA 4A93B 1B1ZA 2CU3A 3V6EB 3SR6A 1YOVB 3ZRFA 1YJIA 5M3FB 1FD6A 4BY1H 2PE6B 5H92C 1HQRD 1AFPA 4BA2I 3AE8B 3RZWC 3A74A 1V1PA 1T9HA 4XQNA 3J7ZC 2KKCA 3EFUA 2RDBC 4JCVE 3P4PB 4DK6C 3CRLC 2N1VA 2QEXA 4MIUA 1FFUA 3GB1A 4H7BA 2FCQA 3OOCA 3ZJTA 2XIWA 2NYZD 2KDEB 2JA7H 1V8QA 2M9VA 1BCPC 1MIUA 2JA6H 2JPHA 3AFQA 2VH2A 1K83H 3GTMH 1VQIA 1GUGA 2E76C 4DAYA 5IP9G 1J0GA 2EQSA 3J81E 3OG5A 1TR5A 2K5QA 1SGHA 3S2HH 1DOMA 2J0TD 1G91A 1YX5B 3OAWA 1TY2A 4ANVA 2KJ6A 3PV1A 1I3QB 2KEEA 4D2KA 4ZQ3A 1VF7A 3HOVG 2BPSA 2K50A 3I9V1 2AHOB 3NS8A 1F9JA 1TWFB 1BF4A 3KBXA 4YHHL 3V60A 3A1QA 2NPTA 4DUYQ 2SDFA 1EU4A 4JI5L 1ACCA 3BDCA 4YCVA 3I2ZA 3NWTA 1ZPSA 2LSSA 1QE6A 1SE4A 3T1YQ 1GJXA 3L0WB 2KACA 1VMCA 1EIFA 2R2OA 4M00A 4HSPA 3AE3B 4JX1C 3H1UA 4AUQC 3A0JA 1A8VA 1DOYA 1CKNB 4BKGA 1IYFA 3A9KA 5TR5A 1G2SA 2QEJC 2BA1A 1X55A 1MI0A 2FIFA 2XN9C 1SYGA 3T1HL 3ZTDA 5AFWA 4DR4L 2WP9B 2VB2X 2OF1A 2F52A 3PS6A 2ASQA 1WVLA 5JEAJ 1RIPA 4A3DB 1TKWB 4BKSA 5DEHA 5HI1A 1ML0D 2R7DA 5J22A 3RZFA 3BDLA 1VQAA 4N59A 1XPUA 3GE3C 5DPRA 4DDID 2INDC 3HM6X 1YVCA 1CZWA 1HA6A 2HHHL 3VR2A 4OZBA 1Z9FA 4PMBA 4AIMA 3PO2B 3UQAA 3PTFC 4P74A 1LT6D 2K5VA 4IQZA 4JI0L 1N60A 5FK9C 3EFCA 2O5JC 4N58A 4NJ7A 3NELA 4KKTA 2W55A 3I5JC 4H44C 3BZCA 1LFDA 1I4QA 5CV5A 1FM0D 4F1SA 2QHOA 4K2KA 1SMYC 2I0QA 3FC4A 3DXJC 4PZ6A 1VQKA 5L95C 3TP7A 2PW9A 3NSWA 4LUVA 4U68A 1X3QA 3B0AA 3QJZA 4A6QA 3TQYA 2UUAQ 2F0LA 2K14A 5C4XH 1C76A 4ACFA 1J5EL 3BY4B 2KCTA 5AZFA 5DAUA 3VR4A 4M0WA 1IYUA 4DPGA 5LMNW 2R92H 2QDFA 3A54A 2A74C 1V2YA 4LF9L 2QA4A 3PSEB 4MM3B 4EZLA 4K81A 3HM3A 5EPKA 3QK0A 2KQ3A 4JI2L 1PH1A 1Z47A 1J8CA 3W3AA 5AZGA 4L5RC 2JA8G 1FNVA 2JY6A 1RF2D 3S24A 3ENEA 3QQ8B 1HR0W 2FAZA 1CHPD 3HOZH 2KQ4X 1HQMC 1SNDA 2HDLA 3GV6A 4WIPA 4GN4B 2AYOB 3LB8C 3RCZA 1P7FA 2EJMA 3L3OC 4FJVB 3VHTC 3TL5A 4L8JA 1W6KA 3DWPA 2KDBA 1AARA 2WKCA 1TGZB 2PZUA 4X65L 2I2YA 2F3VA 1O80A 2E5LL 4QQBX 1XX8A 5E6JA 1K50A 3MXNA 3IAYA 2IZVB 3H3VH 2PTLA 1LLRD 4H02A 4OX9L 3KF6A 4R4OA 3VR3A 4JYAQ 3U9SA 1WX7A 2GN5A 1VLBA 4TUUA 1FNWA 2UXCQ 1DOIA 1AN8A 2KD0A 4ZHOA 3HFZB 1LM0A 1EUVB 1VQ8A 4LF8Q 4MSQB 3ZXVA 1GD7A 1QLBB 5T8IA 2KMAA 3ERQA 1N32L 4JV5Q 4F8MA 4NJCA 3R2IA 2L5TA 4FF2A 1XTCD 2KFKA 2VS1A 3PF5A 1WCMG 4HJAA 3S1RH 4FXCA 3S1NH 1UGJA 2LRWA 2OWOA 2FCMA 2K25A 2WDQB 4DR2Q 5C4ZA 3QHTA 2N3SA 1SYEA 2LY7A 3CC4A 4MGYE 4JI1Q 1NTGA 2ZXOA 1UE7A 4TQ1A 4X62Q 4FP5D 4LWCA 5IAAC 2FUHB 3CCMA 1YJ9A 2BWES 1WMHB 3ZXRA 4LF4L 5FOBB 1Q3LA 2X6GA 1WTOA 4C4VB 2IGGA 1O78A 4A3IG 2EYPA 2L0FA 3Q8BA 1GHKA 4IUUA 4HIMA 2R7ZB 3M95A 2N7DA 2NN6G 1L0WA 1QT9A 1L6VA 5FR3A 4IFDJ 4YTPB 3S9WA 2F1MA 4I65A 3H7SA 2QDBA 1XPOA 1XF5L 1F2LA 2K7VA 3VRBB 4C7ZA 5IP9H 4G0NB 3HZXA 1LTSD 4FF3A 2HT1A 3GTQB 2KJXA 3CSTA 1EO6A 4AJYB 3TUOA 1QWYA 5LLIA 4UDUC 1GB4A 1M8AA 4X3TA 5EKLA 1IW7C 4JBKA 2FBWB 2KX0A 3EIVA 1B9NA 2Z0EB 3P4SB 4RF0A 5GXGB 4EOYA 3HOVH 3FILA 2L1BA 4F88A 3I72A 3ND9A 1GAQB 1EYDA 1FGUA 4GKKQ 1D6EC 3A56A 1MBYA 1XCQL 2KC2A 3PUZA 4RKLA 5EKKA 2EMSA 4HPLB 2ZTDA 2L11A 5LNK1 3KJPA 1N33L 1D4BA 1JWUD 2BVCA 3HEJA 3KW5B 4NB3A 2MP2B 2B63G 2LUEA 4C2MB 1PRTF 4XZ4A 3UIPB 1IBXB 4RWSC 2UXBQ 2JA5B 1M1KC 4LDTB 3DEPA 1NR4A 5IODA 3ETRA 4DF7A 3AYHB 2F0IA 3J81c 5A2QL 4R3DA 4DA2A 4F7XA 2D3AA 3AEAB 2K8BA 1NVID 2JRHA 4LCDE 3HOXB 4NXMQ 2WXPA 4XYCA 1KDBA 2H1EA 2M56B 3S17H 4MSMB 3HOWB 4K7UA 3KQ4A 5ISRA 3NVWA 2R2QA 4M01A 5EE0A 4LMQD 3K58A 1PGBA 3C46A 1LQBA 3AMUA 3GTKB 3R8BA 4J15A 3Q24A 2FINB 4GU2A 1PVOA 3F2UA 1RCVD 4LNIA 1Q10A 1OQYA 5ELOA 3CRKC 3SEBA 2FFKB 4WJQA 5GADC 5BMIA 1M90C 3TBIB 1TIFA 1L1OB 1QJOA 3HHMA 3TIXA 3GTLH 4W9IA 3GTPB 1KD1C 3N9YC 4HJ8A 3J7A5 2O6VA 2Z9HA 2LVPA 1PFNA 3P42A 4UHVA 2JZPA 1IKLA 1CQFA 1SR3A 2JZ3B 2RSUA 4TQUS 4WURA 2WKDA 3Q0AA 1R4MI 4A3OA 4A3GB 4DV5Q 4AQYQ 3F2BA 2C7NB 2B2WA 1BO0A 2K1BA 5H1SE 3L17A 3V6CB 1KXLA 3EJIA 1LTID 3T1YL 3JVZX 4FULA 1I50B 4C00A 5IGDA 2A1AA 4NXNQ 1Q5WB 2BE5D 1MKHA 2WFWA 1V80A 1NNXA 2H89B 3ITPA 4P1CC 3H0GB 2VQFQ 1GUAB 2ZZPB 2K3UA 2DLBA 3U4VA 5E7NA 4CHTB 2JA8H 1YMHE 5BN3A 3W1YA 5KEEA 4A20A 1IHZA 5C3XA 2EMTA 2AMCB 3U58A 2JF5A 1ET9A 2W82A 3FAHA 3ZQ4A 3LNNA 4PZ8A 4GDLA 5EPJA 4FYDA 1EY8A 2QW7A 3DVNU 3DDCB 2RDHA 1SYFA 3E9IA 3VDZA 1YNJD 4KJNA 1OEYJ 4HCSA 1E7UA 3T16A 3K59A 3V61A 2DYOA 2Z1CA 2FXQA 4HK2A 4Y52H 3KLWA 3X3NA 1PH8A 3U4EG 1PTOD 2BKFA 2L1AA 2XK5A 1TKYA 3GTGB 4HJKA 2UU7A 4XX5A 2BKRB 4IPGA 4ITKA 4GS3A 4MZ9A 1ZP0B 2MA9B 3NVZA 2HIXA 2L00B 2N7JA 3MHBA 2IY5B 4BVUC 2CR5A 4GOPB 2FE8A 3GZNI 3MC9A 3S1QB 2DYMA 2BTEA 1P3QU 4X66Q 1Q0WB 1IBLQ 1WCMH 1RLFA 1H9SA 4II2B 3JAML 1JOQA 4H2AA 2PQEA 1A6XA 1PZJD 5IOIA 2DZMA 5IYBG 3KLSA 2D07B 1HCZA 4KKSA 1EIYB 1S72A 3AE4B 3DHGC 3P1MA 2NVTB 2LGIA 2K32A 2AUKA 2KJHB 5KRUA 5IYDG 1TWHB 2L32A 4ZRKA 3L13A 4UP8A 1MPEA 4HR7B 3D3RA 4JPBW 1SBBB 4AJWA 4A76A 3UDGA 3C3LA 3FKIG 3K5LA 3M85A 4HIOA 3U30A 2PNRC 4BY7G 1S5CD 2KVZA 2LASA 1Y8PB 4A3IH 4LF5Q 4DK0A 1Q82C 3S1MH 2Y5PA 2ON8A 3IT6B 1UUPA 2PI2A 2EVBA 4PYZA 3DM1A 2NN6H 4BY1B 2ZW0A 2PLPA 4EE2A 5M5YB 4IKGA 1TWCB 1WD1A 3PRMB 2DZIA 3DHHC 5EAYA 4P1BC 3E5SA 3WANA 1QOFA 4YT0B 4WH4A 4N8X1 4R4QA 4XDDA 5CGKA 1A63A 5DCNA 2LXCA 1V1OA 2PMZE 4K0KL 1WGKA 2JEBI 5T1IA 1WYGA 2HDEA 1N36Q 4JYAL 4REZA 3H7PB 5G2NA 5CBAE 1YJWA 1FO4A 4DAPA 1WR6E 2AL6A 2JA6B 2K52A 1PFBA 3NENA 5FKAC 4LF8L 2PI2E 1Y69U 5KHOA 2HCCA 2RGFA 3ZIMA 3R93A 1AEXA 4JV5L 5IWAL 1PH4A 1TWAB 4HJ9A 3NG0A 3GP7A 1OQRA 1STNA 2I5MX 1RWSA 2E2HB 3APDA 4GNXC 3RNCC 4XQJA 1O7LA 3S2HB 4KI0A 3P75A 4NP5A 2C7HA 2HTHA 4DR2L 4K5WA 3PVLA 2B63H 5C3EG 1K28A 4A3EG 3A33B 4KZCA 2WXMA 1A3TA 2KWVB 4NQLB 3ZNGC 3A8KE 3CMMB 3Q3JA 1Z2MA 2MGSA 3U52E 3VR5A 4DFAA 4JI7Q 3I55A 1F52A 3RN5A 2XRQD 1F9QA 4XQQA 2I38A 3Q6SA 4XE0A 4CKBA 2Z6KC 2E75C 3L7ZC 2J0KA 4LFCL 2MBQA 4JIOU 1J19A 2AUJD 1ILPA 2MPMA 3PIP3 1SE3A 1E10A 3CU7A 5EQ0A 4RH6A 1K73C 3GTOH 5CYUA 1A2UA 3P4RB 1E8ZA 2ZM6L 3QJYA 1U4AA 2JRIB 5IGGA 3ZUNA 2Q2HA 1Q1EA 3QWNA 4J1MA 4DR5L 4W9LA 4CO7A 1CZPA 1ZYRD 4EZKA 3OSOA 1S3SG 3BVZA 3M7NA 1Y1WG 2ZXRA 1HFNA 2LS01 1JORA 1PGAA 4ZYNA 4DAMA 4LNKA 3PT2B 2B2VA 1EQQA 4HPPA 3PZ7A 4YY3Q 2NVYH 3NBHA 5BMHA 5I6WA 3HVDA 1VZ8A 2JQOA 4QUCA 4ALPA 3S2AA 3PUXA 3J80i 1WD0A 4GKKL 1XYIA 1HXYD 3RN2A 4HPMB 4N9TA 1N6ZA 1EF5A 2DUDA 1GJZA 1HNXQ 1IGCA 3CXCA 2JN4A 4DNIA 2ZTCA 4BKTA 2WB1G 1NEKB 1SRUA 5G3LD 1VDVA 3MTNB 2A6HC 2CHBD 5EBCA 2UXBL 4ODGA 4HJ7A 1XMOQ 2C35B 1P98A 3DVNV 4C3HB 2N49A 4OIJA 1FVIA 1U4MA 1C4PA 4IM3A 2FHTA 1JWBD 3PCOB 4MJSA 1STYA 3TS2A 2WU5B 2B3GA 2KHIA 2PNHA 2M4NA 1JR0D 5K5PA 1NSNS 1EIHA 5M5XH 1YQ3B 2O2VA 2V9HA 4L23A 3GD7A 5C4XB 3R7QA 4A3JG 1WXMA 2M2LA 2WU2B 4NXML 4EGVA 1WXQA 1MSGA 2AWOA 3T1HQ 2E2IB 1RRBA 2KTRB 3AE5B 3M3JA 4XXEA 2RF4A 1JROA 2IJ0A 5CHWA 3VDYA 4KY6A 4G50A 1YN5A 4QAYA 1PMRA 4HKQA 3KF8B 3U9OA 2WLBA 5E3FA 4W9GA 2K8HA 3NPPA 1JJCB 1NDDA 4XWTA 1RD9D 3H6NA 2PZWA 2HHHQ 4KIKA 4LUZA 2YLMA 3I4LA 2D10A 4DV7Q 1D1IA 3Q8FA 2DN8A 2K5DA 4XDCA 5FR6A 3NUCA 5T1GA 2QCZA 1NBWA 4KKUA 2KAJA 3OYYA 4C1NK 5I9PA 2NBFA 4O42A 2JSOA 2ALYB 1MJDA 1SROA 1PTOB 2K22A 1LGRA 1EFWA 1Q8IA 5KIXA 2MO1A 2K05A 3HOYB 1VZ6A 4K6LA 5M9OA 2MW5A 1FR3A 4QIWE 4W9KA 4DV5L 2WB1E 5C3JB 4G7HC 2MJEA 3D4WA 2V4LA 2LMCA 1WRIA 5IYBH 1NMFA 2NZOA 4W9EA 3MHSD 3IAS1 4NXNL 1AYFA 3G6EA 5IYDH 1KF6B 4A3KG 2KWUB 2EJGC 4LF9Q 4HTHA 1QVFA 1WE7A 5AJ3Q 3FKIH 4JI2Q 3S1RB 3KUDB 3SD5A 3DBLB 3K5OA 3E6ZX 4BY7H 2EXDA 4ZK9B 3TJPA 3H94A 5IGFA 2AWNA 4LAAA 5CV8A 5TSSA 4LNQA 2NVQB 1WX9A 1EWCA 5FO7B 2ZEQA 5ELDA 2DENB 2K5NA 5G3LF 1DONA 1RTNA 4HIDA 1DZ1A 4ZUIA 2JWZA 4RMAA 2RD0A 4I6NB 4RA8A 4Z9CB 2EY2A 1WXSA 4CDCC 1I4RA 1Z6HA 4JG2A 1QZGA 4X65Q 4P16A 3VYUA 4WAAA 1VQCA 1EY9A 2K01A 5C4JB 1CJEA 2RHSB 4OX9Q 2PQAB 2ZVOA 3A1QB 5IP4D 1LTBD 3D32A 5ELBA 1NJIC 2NN6I 2DY7A 1RJTA 4JI6Q 4R4TA 3A9JA 1XXGA 2RSOA 4L6TB 4B9XA 4DK1A 1L4DB 3Q22A 2KXJA 1VQ5A 1WY8A 2SEBD 1YNNC 1N32Q 4ZRJA 4OL7A 3L9AX 1IBLL 5GAHC 3M63B 2FIDA 1C8CA 3V3XA 3VR8B 4HMIA 2XVSA 1D7QA 2C5LC 2YVCA 2X8XX 1QILA 4MTNA 1LTTD 2L83A 4HCNB 3D31A 2MCNB 3NS1A 5C3EH 3TCAA 4A3EH 3CKIB 4DNTB 1RYJA 1E7ZA 1WTXA 5C3WA 3KWVA 4DR7L 1HTLD 4C3IB 3W1SA 4PYUA 1K8AC 1WGDA 5D6JB 1WXAA 3N20C 2SNSA 3QO2A 5EBDA 1L7YA 2LHEA 4GIVA 4LF4Q 2DYBA 1QNUA 4CJ2C 4DHZB 1QOGA 4DV3L 3DBRI 2DJFC 4P2CB 1LTLA 4A4IA 3EGRA 3W5UB 2I46A 1UWXA 1AP0A 1VS0A 4KV6A 2JYOA 4BBSB 4TQ0A 5IOCA 1E2VA 4B3RQ 1L0XB 1WZ0A 5D3DA 2GI9A 1R9TH 3G48A 4FXGC 4F87A 3HUIA 1RAXA 4N6EB 3E56A 3UE0A 1BDOA 1XNQQ 3K5NA 3JSVA 3NVVA 1K53A 2XBBC 4PMCA 1Y1WH 2WP8J 5FLXc 1E2ZA 3S17B 3DBHI 2WXIA 1F9RA 5CR3A 4EZJA 4I6PA 1TVXA 2H4OA 4K5VA 4FNFA 1Q90A 4Y7NB 1FXTB 3BJUA 3P20A 3MP9A 4UP7A 4GLVB 2A8VA 3QR8A 1KNAA 1HRJA 4GB9A 3S14H 1NCVA 3Q3MC 5J1ZA 4F7ZA 3NOBA 5I6YA 1N33Q 4RKBA 4PS8A 3PLVA 1ZOYB 1T3QA 4G11A 4JW0A 2GVBA 3GTLB 2WACA 2M0XA 2B76B 2AEHA 2WXGA 1GUNA 1QZEA 3I3CA 2XSCA 2J4XA 4JI7L 3S16H 1JT8A 2EKEC 3UDFA 2MBOA 4BBNC 5JHAA 3QAQA 1FL0A 1V43A 2PO4A 4N8FA 2MQJA 4II3B 1EQTA 3AE6B 1HZAA 2WQYB 4A3JH 2WGSA 4GDKB 4ME5A 4MDKE 4CDFC 5IT9E 4G7OC 1UWMA 1PXUA 2BDOA 4FF1A 4CHKA 2WDTB 3MXNB 5DPWA 5HKHA 1CTMA 3AE2B 3UIOB 1R4NB 3UF8A 2RKSA 3IVFA 1DOXA 1STBA 5JEAG 3GTJH 5FLMG 2MRPA 1QUQA 3N32A 1VDZA 1GVPA 4N9PA 1HUMA 2UUBQ 1RFAA 5COYA 3KYHC 2ZJQA 4OWWB 2LJIA 2M0AA 5DM63 3ZTCA 3Q14C 3CMAA 3AE1B 4NZLB 2YYZA 1WTHA 4YY3L 2D9UA 1FPYA 5DLQE 4GN3B 3TN2A 1GUWA 4IUPA 2ATWA 1G51A 3O13A 4LDTD 1NYQA 3M3YH 2K39A 1NI3A 3STBD 3ZLZA 1BBUA 1ONLA 3MEHA 4OELB 5FO9B 3AV8A 1HNXL 3U7ZA 2DNEA 4LLGM 4M8AA 1OTCA 2GBKA 1UAPA 4H0LC 1KRHA 2A19A 2KN5A 1YJNA 1XMOL 2WXRA 3HRDD 5HG2A 2W9NA 4ZHPA 3AEVA 1DOLA 5HGQA 3VAWA 2REXA 4EEWA 2A69D 2G9HD 5IN7A 4DN4M 1PHJA 3PO3G 3VVWB 4A3KH 1B44D 1RL2A 3M4OH 2DNCA 3PF4A 1XLNA 4K3BA 4NAMA 2CWPA 4KD3A 3M7GA 3BZKA 4A3LG 2CKHB 3CF5A 3HKZG 1V5OA 1K3BC 1BCPB 2LFIA 3UGBB 2KENA 1IW7D 3N1YC 1P9DU 2I1KA 2ICIA 1P16A 4PK1A 3TREA 2ZNVC 1L2NA 2W54A 4FVMA 1YHQA 1UD7A 4X3UA 1CT1D 1LUZA 1PH6A 1PFDA 1WF9A 3I3TB 1JQ4A 3RLOA 3OHXC 1V86A 2DZKA 3BYTB 1WM2A 2PW7A 4Q0FA 1ROEA 2ZVNA 3CC2A 5G5GA 1B53A 1VCIA 4A3IB 4DXAB 1TJEA 1YZ6A 4DAVA 4RHRA 1ENCA 2RA4A 4DV7L 4L5QA 1FIQA 1AH9A 5E4WC 2F4VQ 2RQXA 3QARA 3QG1A 2KCNA 3U2SC 2KMMA 4OXPA 2KHSA 3DBSA 4P7IA 4BBRB 4W9HA 3IXSA 2O4XA 3VR9B 5EKIA 2IY1B 4O0AA 4XT3B 5I4DA 3Q23A 4DV0Q 4R9WA 1VRAB 3KUZA 2B2WC 3LXFA 2MFIA 4P75A 3P7JA 3SR1A 4LNNA 4JOIA 3LJ3A 2CW0D 4MEMA 2KK8A 4US8A 3MXUA 1BXTA 1I7HA 2I1JA 4S0RA 4OHJA 2NS5A 4ASWC 2LXAA 4E74A 1BKBA 3VTVA 3DEOA 4LNOA 1GM5A 3KLSX 1G6JA 4W9JA 3MXGA 3NQTA 2JZZA 3HVZA 4HDOA 4A93G 5AJ3L 4DWFA 3OPOA 1TS3A 3HKZE 2PW5A 3SK6A 3AEBB 3PRZA 1R4PB 5M3FG 2KCMA 1PLFA 1X3PA 1KOTA 2B63B 1BUVT 3HGBA 1WIAA 3M4YA 5KYIA 3DHQA 3F1ZA 3KWLA 4FJYA 1YBYA 5ELFA 1V9JA 3OWFA 5C0XG 1MSHA 5JJKA 2HTME 2CH4W 4AS1A 4IC7B 3NTHA 3Q8EA 2AL3A 4NKLA 3WAOA 1CHQD 1B9MA 3CCQA 2WINB 3E9HA 5M5WH 2BF8B 5J18A 1VF5C 2KA7A 1KJTA 3EQLC 5HGTA 4K0KQ 3N1XC 3IFDA 3AEGB 4NY0A 3SXHA 1XTDA 1MHWC 4IURA 1DM0B 4ZAIA 1PGXA 3OW2A 1EYAA 1QOAA 2RVLA 2IHFA 4LF7L 5G55A 4JI6L 3TEHB 3DLLA 1JJ2A 3FDTA 3T4AC 1A2TA 2CS4A 2E3TA 2PVGC 1MJCA 2K5HA 1TY0A 1HEZE 1K52A 4BZAA 3PHWB 5IWAQ 4KY7A 3G7LA 1EFID 4JWUC 5EJWA 1EY7A 4G3XB 4AQ7A 2CKZB 1HTQA 1OXXK 2YU9H 2KNBA 4C1NI 5KNDA 4B3TQ 5BYSA 3CF6E 2JJQA 4AYBB 1LTGD 4K1RB 4HEDA 4OIKA 4GMVA 3OMGA 3LYYA 3W5VB 4IG7B 5L37A 2BWFA 1A3VA 3NWSA 4KVGB 3TMEA 3OMCA 3HIZA 3N52A 3EECA 4OEMB 3J80E 3KYCD 5IGBA 2KTFA 3QOJA 3P2BA 1GUSA 2CWAA 1IPGA 2B8FA 4G7ZC 4APVA 4LFCQ 2NTTA 3DVGX 5HFYA 4M02A 3P63A 1HJPA 5IKCM 2GA4B 3K8AA 3IL8A 3I4NB 3E9SA 3LDZE 3UQBA 4B3RL 5JEAH 1HH2P 4ULLA 5FLMH 3K7AH 3VUWA 3K6OA 4OGQC 2F0JA 2ZM6Q 1ILQA 3RZDH 5JOBA 4A3DG 2QIEB 3OJ3A 3UINB 1M4VA 1XNQL 2JXMB 1ZXHA 4DR5Q 2IBIB 2L0CA 4A3MG 1EEID 4P73A 4GKJL 4KHPL 2XEWA 4OVZA 1YX6B 5JJLA 3MAQA 1H9SB 4WFN3 1UEBA 5MPOA 2HQEA 4IOCA 1C4QA 5KNBA 1WGHA 3ZJVA 2BB5A 3FEWX 3PO2G 2JA9A 3PGZA 1WRDB 1GC6A 2F0WA 1J7BA 5ELNA 5IT9c 1CKNA 2LXKA 4B95A 1JE5A 1O7YA 3QC8B 2RDGA 1X3EA 1E1OA 2BYVE 2R6GA 1TQOA 1Z5SB 4JI4Q 4KSKC 2HIVA 2F0EA 3QIAA 1KFYB 4IN3A 1YJJA 3PO3H 3RNAC 2BS4B 1EZ8A 2Y5CA 4HVBA 3ZNHB 2LEKA 4W9CA 2OCEA 4RF1A 3M4QA 4A3LH 3AE9B 2B2TA 1XLOA 4A3FB 3Q8AA 2VXWA 1D1KA 3S2DH 3T51B 4W9FA 1ZXTA 2EYLA 2N1WA 4N9F4 4O1NA 5GMVA 3UI3A 2Z0DB 4YSXB 1SSOA 2IT1A 3MFYA 4YL8A 2DJGC 2N4FA 2EIFA 2E2JB 3AI5A 4IM2A 1HZ9A 1Y1VG 1CKMA 2K5WA 2Y0SB 2UUBL 2A5UA 2VNUD 2KWDA 4B9KA 3OIQA 2K75A 4TV3A 3ZDTA 2L05A 2F0TA 4I7ZC 2B2VC 3MEFA 5D14A 1ASZA 1J8IA 4DK3C 1UF0A 2WAQB 4URKA 1SB3C 3U4ZA 2WXKA 1Y14B 4XIGS 4ICVA 4KZ0A 4GZYC 3C8YA 2HJ1A 2NVXH 4RCNA 4A3BB 1EWHA 2WXFA 2ES2A 1ZEQX 4NNJB 3G71A 2K8CA 1OXTA 3RMKC 2CJNA 3MJ5A 3HG9A 5AZHA 3ML9A 3VA7A 1C77A 3BS1A 3RZOB 2KCCA 3JAMi 5G5HA 3AEDB 1WSPA 3C0RB 1YIWA 3I4OA 5C1ZA 2PKOA 1C9OA 2PYKA 5CHVC 5CTRC 2YTXA 3NTKA 2YTYA 2DY8A 2BT6A 4CGYB 5JPNC 2F0VA 4ZYSA 4A93H 2RBMA 4IDIA 2CCZA 5CV6A 3I8ZA 2JYEA 1QOBA 5M3FH 2B8GA 1SFOB 1ZUD2 1N63A 5C3EB 1N61A 4C3JG 2Q8RE 3UI2A 1EEFD 4OWTB 3TBLD 1RFKA 4KGRA 3D4DA 5C0XH 4EQOA 2OJRA 1DCZA 4YSZB 1PH2A 4UPAA 3M62B 2IX0A 2LFNA 5D65A 5IP7G 2WS3B 2E2DC 1I6VC 4IPCA 1PRTC 2BOSA 2PMVA 4AWJA 2R7ZG 4WWPA 4ZRPA 2PJHA 4WWOA 2CHWA 4YSYB 2JXXA 1E22A 1FD7D 1Q1BA 2F0QA 2V4DA 5EE9A 1TWGB 1E0ZA 4NDXA 2V1CC 2X69A 3PSIA 3ZNID 2F4VL 3K5MA 1JQYD 2VW9A 3N6RA 3KDFB 2KJRA 1BR9A 4ILWA 3S15B 4ZRIA 4DV6Q 4JI8L 3KLRA 2HCIA 3RI7C 2OTJA 3RNGC 4DV0L 4JLCA 1I3QH 2ENBA 4IUVA 4GLSC 5GAEC 2NBWB 2CJOA 1YHBA 4Q5VA 2AQ2B 2MLBA 4C4VA 2IO1B 2O2VB 4RGTA 1SNCA 2ICEC 3UE1A 2WDVB 4P71A 4NPSA 1XLQA 1JRUA 3T56B 2BYTA 1ISNA 1EOTA 2F0KA 3CP0A 3AU4A 4DR7Q 1MHHE 2LHDA 2LGYA 3T9LA 1H9KA 1J9OA 2OEOA 2EOTA 4V0BA 2L52A 4B3MQ 1GKHA 2G9DA 5CV9A 4HN7A 1UELA 2J0MA 2MEKA 1U9RA 4E71A 4TSSA 1XD3B 1JALA 1STHA 2JA5G 3D8GA 4GN5A 2BDNA 1SE9A 1HZ5A 4LFBL 1OXSC 1GUOA 2ZCCA 2D2CC 3Q8CA 4DV3Q 3I4MG 1Z7TA 2G4SA 1SMXA 4KLKA 4EQNA 2WNMA 1U4RA 3PZDA 4LFAQ 4OVVA 2PPBC 1MGSA 4F8CB 3K9OB 5EGTA 1QCBD 4IALA 3S16B 2KWCA 3A7AB 1K9MC 1JB7A 1EY0A 3I63C 4IO9A 2MX2A 3OLMD 3HOXG 4KTAA 2AWTA 2K0PA 1K8OA 4LTUA 3ZGZA 4A3DH 4NAWB 3WALA 4P6VF 3VYSA 4A3MH 4J6HA 2EELA 3NZUA 1EIGA 1R4QB 2JA7B 1STAA 2Q2TA 3G6JB 3J81L 4ARCA 3J80c 2O5IC 5LXIB 3PO2H 3T13A 3JYUA 2L3ZA 1K83B 3VTWA 3GTMB 4BS9A 4B6WA 1H95A 1R7SA 2LVQA 1I5FA 2SOBA 3SK8A 3KJOA 3L10B 1YITA 1WJ4A 2M19A 2D62A 2MHVA 1Q81C 3RNFC 4BKSD 4B3TL 1UBQA 1MI2A 2R93G 1K8RB 3A7LA 1C4CA 3WAMA 4CDDC 1PTOF 2K04A 2EY6A 3CAMA 3W1SC 1HE8A 1UGMA 3DWQA 4L63B 3BYYB 1SYCA 4DUZQ 3R3MA 4HWIB 2WDRB 4A55A 2NBUA 3DWGC 2IW3A 3AQQA 5C44G 4BFRA 2J53A 1VQLA 2Z6BA 5JVH3 2RCFA 3MXPA 1J7AA 2FUG1 2LVOA 2MJ3A 1JICA 2ZTEA 3H0GG 1IKMA 2K6DB 1T6BX 3TSSA 3ULPA 2K03A 1L1OA 1C48A 4ID6A 3WOEA 4A3KB 2OQ0A 2L15A 5LMUQ 2UXDL 2ZCBA 4QF4A 3BG3A 3N3KB 1SAPA 4IWPA 1CM9A 1K8MA 1VQPA 4MELA 4IUTA 1Y1VH 1EYGA 4LJPB 5CMDA 3ZNZB 1TYGB 1L2FA 5M3MG 1UBIA 3SK5A 1CSPA 2Y0SE 4MACA 5C5LA 1Q46A 1VQOA 3LX0A 2LGDA 1E2WA 4ABNA 4GNXB 4HSVA 2Q2UA 4DR6L 1D2BA 1OXVA 2KDMA 4LJOB 4HJGE 1VR9A 4J8QA 1MFWA 2N9EB 1R4MB 3ICEA 5E4XA 3SE0A 4GSWA 4S3SA 5GQOA 2AQ3B 2VZKB 2N55A 4PV1C 4JI4L 4K2LA 2BE5C 2D11A 3PMFA 4DHJB 1JCKB 2N0SB 1OXUA 2N7EA 1HUNA 3SDZA 1SSNA 3Q2AC 4IPHA 1QOHA 2IHEA 3CCRA 1TIID 3OW7A 1P7EA 4J3OD 1PH5A 3CCUA 2V4IB 2G4DB 2C9WB 3FPPA 1SJHD 3BK1A 4DV2Q 2EYMA 1GC7A 4HKZE 1D8LA 4C3JH 1YNJC 5NUCA 3ZJUA 3ULLA 1UE5A 2JYTA 3JSVB 2EXZA 1E8WA 4PZ7A 2JWUA 5IGEA 2R92B 2F0OA 2NBVB 5IP7H 2IYDB 1UE6A 4QL5A 1AE3A 1WJ6A 2R7ZH 3K9PB 2IX1A 2DZJA 3Q3NC 3PQIA 2KDFB 4KDLB 4MGIE 2LI5A 3HOZB 1HTOA 1E7PB 3K81C 5IYCG 3ZDMC 4JI3Q 5D7GA 2KQ7A 3V2TA 1JJGA 1H9MA 3NEMA 1N9WA 2E8GA 5C0XI 3GTQH 3GZNB 3CCEA 4WJ3M 1UZXB 3X3MA 1W2BA 4A75A 3UDIA 5M5WB 1KL9A 3BDOA 3ONAB 2BGFA 3SFEB 2HQLA 2N8NA 1PFMA 2NUCA 4YWMA 4TKOB 1V1PB 2IWHA 4IFDI 2L7RA 1X6OA 5DM73 3B08A 3QCAA 5JAVA 1PYBA 3A4SC 1GG3A 3IAM1 1D5XC 2C9OA 4HMJA 1Q1OA 3I70A 2K6AA 5J17A 3TZUA 1BCPD 5E1FA 1IYVA 4JQWC 1RHPA 1SF0A 4KMUC 1ASYA 1NENB 2H88B 3RUIB 1TU2B 2AKWB 1SNQA 3L0OA 3NQIA 5CV4A 1JRPA 1ZDXA 2NMQA 3VA5A 4C7YA 2MJ8A 4C2MH 4O2DA 3MTSA 1HFGA 4XYQA 2JA5H 5JJZA 2B3AA 4HXDA 4DBGA 2D5DA 3S1NB 4FLHA 2DX5B 2KECA 3X0WA 1HZCA 3I4MH 1L0YB 4DAYB 4JBWA 3LGJA 3PIPA 3H7PA 1W3SA 1I94L 2Q8IB 1SN8A 3W5OA 3AEEB 3PLUA 1WE6A 2IO2B 4WJ4A 4BOZB 2ACZB 3MZ5A 3BK2A 4NMZA 3HOXH 2BYFA 3ABVB 3T3OA 3PV0A 3KVFB 4K7SA 3W1GA 4MHEA 5A2QE 1YI2A 3HOUG 5IY0A 2LKVA 4C56C 1I42A 1JMLA 2F0NA 3TP5A 1EUJA 2B2UA 1PV4A 1QG7A 3GTKH 4KV2A 1WZ3A 1U4LA 4ZRQA 1B4OA 1U4PA 2NPTB 1J6QA 4LF7Q 4JBMA 3MC8A 1A5RA 2PIAA 1DXMA 1ENAA 4L5SA 1KM7A 4DV6L 3JW0X 3DWAA 4ANXA 1AW7A 1EY4A 1AWDA 2EKIA 4M8MA 3I7FA 5HURA 2QKIC 2KANA 3LWUA 2OOBB 4JOIC 1PFSA 1UE1A 1PZKD 2D0OA 2R93H 3A9KB 2R61A 2FNJB 2LRUA 3ZKJC 4PQXA 1QB5D 4DNRB 3HOVB 2YEPB 4HAEA 1OTRB 2EYFA 4B3ML 4K8JA 1WJUA 4YCUA 5LL6S 1LABA 1PZID 3KK7A 2LGXA 5C44H 1LO5D 4IWOA 3GE8C 2DNFA 4C3HG 3Q3FA 1X65A 2IO3B 1TZOA 1LACA 3CD6A 1HNZQ 1E7VA 4WWNA 1WYDA 2O6VD 3FP9A 2KUMA 5DPSA 4LFAL 3H0GH 4ARIA 3KOJA 3FPUB 4EVOA 3RN9C 2X6LA 1KABA 1IL2A 4MNOA 4FDBA 1SMYD 2MUYA 2PZTA 3D6WA 4A90A 1BCPF 1BUIC 3C1FA 1V6EA 2GMIC 4CBVA 3U7DA 3W2DA 2M1MA 1OFFA 2VRRB 3ZW3A 3EROA 3AB9A 5KYLA 3S2DB 4ZUJA 2MBHA 5M3MH 2WYQA 5ELCA 5L83A 2WXLA 5BYRA 4GKJQ 1AE2A 4KHPQ 1LM8B 2WXJA 2JQRB 4KD4A 2CVRA 4IJHA 1VQNA 1YIJA 4KGTA 4LF6Q 3GTGH 3PUYA 4JBJA 4M0WB 1CZGA 1E5WA 4PG3A 1K0SA 3A5ZB 1EQRA 4OONA 4CKCA 1BVSA 2V0GA 3ERSX 2RCNA 1X3GA 4RM9A 2A6EC 2B29A 3S1QH 3HOYG 1Y56A 1C78A 2KHJA 4K7WA 1B3QA 4QJFA 1C9FA 3EC8A 1JWSD 3RNEC 2A68C 1B2TA 2KOLA 4DUZL 1WGGA 2VUMG 1E8XA 2NCNA 2WXNA 5E6PA 2AQ1B 3KF8A 2KZRA 1BQQT 1KLGD 2W3SA 1KC8C 4MN3A 4TRDA 3VUYA 1HTPA 2RDFA 2NVTH 1IGDA 2GB1A 1NI2A 1L5PA 1L4ZB 3JAME 1KTKA 2F3IA 1PYWD 5ELEA 3TDQA 4ME3A 1SNOA 1FJGL 5LMUL 1T0RC 1VQGA 1E0BA 1LT3D 3SGIA 2CQAA 3KF6B 2XRSD 4DGZA 4QMGA 1VQEA 3IRBA 5JZEB 1BOSA 4FHJA 3OIPA 2JA8B 2D3CA 4QB4A 3NTIA 5M5YH 1TWCH 2FMCA 3K0YA 3NK9A 1F77A 1F2RI 1TBEA 3SU8X 4USAA 1CSQA 2IX3A 4GN1A 1BBWA 5IYCH 1YJ1A 1I4HA 1K8GA 1DGJA 1SXTA 4V190 1L0VB 2KFKB 3DVGY 3KH0A 4HCPB 1MJEA 4PS7A 2KQSA 4UAIA 2Y3AA 3PIO3 2HD5B 1A62A 2IDYA 4XWWA 1NUCA 5DNFA 2AX5A 1KNEA 2NVUI 4IM0A 4X3KA 1V5TA 3Q3OC 4X3SA 3EN2A 3D6CA 3NRZA 1EZ6A 3ZO5B 3DCGA 1XMQQ 1T5XD 4HROA 4BAXA 3KUPA 4L5TA 4YCWA 4PNYA 3CCJA 3FMCA 2OJWA 4E6IA 3B2FA 1TWAH 1UNSA 2D2QA 3RUZA 4RHSA 3EUB2 3VR6A 1ZE3D 1A0IA 2EPBA 4M1UB 2E2HH 2BYEA 2KHWB 5JHBA 1PYSB 1LTRD 4ICUA 2Z4IA 4AH6A 1KLUD 4DV4L 3MHZA 3QB3A 1G291 2B2TC 1WCMB 2KLGA 2JE6I 3PRPB 2KVRA 4DV2L 2JX5A 1STEA 4C3IG 1N8RC 3DUZA 2GBJA 3CWIA 4KHZA 1XLPA 1LV9A 4MH8A 3NVYA 3CMEA 2C7MB 1JE4A 2PQAA 2J7QB 2MWSB 4OO1I 2VQEL 2YTVA 2IY0B 2JVCA 3AULA 2XNAC 1G6ZA 1HZ6A 1VQ6A 2EZVA 4DR3L 4PS3A 2E74C 2MQHA 2ZXPA 2DAFA 3MFGA 4OW0A 2UU9L 2C5CA 2MH7A 2M8SA 2Q2IA 3HOUH 3FILB 3NZ3A 1XWEA 2KT7A 3X23A 1XJVA 5J39A 3S1MB 1ZDVA 4BBSG 1QVGA 4JI3L 4IOAA 3WOFA 1B7YB 2JP1A 3NZSA 2F0FA 2R7FA 2XGTA 2VY3A 2I5LX 1E8YA 2WXQA 2INNE 5EPLA 5C6AA 2BB6A 2QILA 4YWLA 1ENFA 1ESRA 4JI8Q 2KDIA 3OJ4B 4A3MB 1N5XA 5I2YA 4KK7A 1GPXA 4HIKA 3CC7A 4KDIC 1TTNA 1XCTL 5F2DA 3J7AV 1DD2A 4A9AA 1BMLC 1XO3A 1CUKA 3GQBA 4EQ5A 4RGNA 2WHIA 3L54A 2UWQA 1SNPA 3RNBC 1ZXIA 1B50A 1RM6C 4YTNB 3BZDB 3VH4B 2FMMA 4DQOC 4LNFA 3E3XA 4KHVA 5FLXL 2ZNVB 2JU6X 4C3HH 3K80C 3DBRB 1ICWA 3CPFA 2N9PC 1FGBD 4NQKE 4DXGA 4DKAC 2ASBA 4DV1Q 3C1EA 4LFBQ 2QSDA 4US9A 1F2YA 1II3A 4X6AH 1KDAA 1UH6A 2JXTA 5BMGA 3SK4A 5LMNL 3APCA 4DHZE 2BW2A 2LUMA 4KX6B 4WORA 1SEBD 5C4HA 1T0YA 2KYWA 2E2IH 2A4ZA 2V3PA 1KIXA 4IFDG 4OZAA 5KHQA 3OTOL 2O6VB 1HR0L 5D2MB 1F9SA 2N88A 2OTLA 3DBHB 1ESFA 1RDPD 4R1JA 2HD3A 1EOVA 1VQFA 4ZKCB 3TEZA 4QUFA 2NZHA 2LD9A 3I56A 3W1BA 1F2RC 2G3QB 2VB3X 3PIOA 3GTOB 1P8LA 4WJNA 3RLNA 1WFQA 3DPDA 2ZPYA 4TKNA 1LT4D 3RMHA 1PH7A 1Y1VB 5BO4B 3H09A 4RFBA 4IJLA 5I9OA 1H9JA 1Y8RC 1HA5A 2V3NA 2K9XA 4GDKA 4R8IA 1MG4A 1PTOH 3E0JA 4ZDVA 1X32A 4H13C 5CX3A 3Q8DA 3HOYH 2WV6D 4FF4A 1PRTD 2NVYB 2QDLA 4HJ5A 2LXJA 2G1EA 5J3BA 2KOXA 2WX1A 3WIMA 3AM9A 1CA6A 1IBMQ 3IFWB 5BN5A 1TXYA 2QGQA 1JB3A 2VUMH 4GLAC 4BA1I 5JJIA 4GDLB 4X64L 3EHVA 2PE9A 1U0LA 4QCLA 1EWIA 4CJ0B 1NY4A 4BXXG 2Q8TA 4DR1Q 1N62A
chains in the Genus database with same CATH topology
3AN1A 3C2PA 5JPMC 2RSNA 4FO2A 2OXPA 3A8JE 1KDCA 3MVVA 5BYQA 1VZ7A 3DMUA 4B0MA 5M5XB 2EYOA 2EY1A 1S5ED 4C3JB 4IUQA 1EL0A 4LK0M 1XEEA 2NZ1D 5C0XJ 2INPE 5LL6X 3HS0C 1JOOA 4K5XA 4XDXA 3D4RA 2PMZB 5EE1A 1EY5A 1NR2A 1WWTA 3TP6A 2A69C 1CI3M 4K8IA 3TEXA 1QF6A 1EWYC 3FVQA 3K57A 4B0EA 3HP3A 3PO0A 2IGHA 4HCEA 2DWQA 5LHY1 3TZDA 4ZRZA 3VRAB 3OWEB 2KVMA 1V97A 1SDFA 1B9RA 2F03A 1WTPA 1CK1A 3FKIB 1UEAB 3KBGA 4BY7B 1HHVA 2L12A 3I4MB 2F4IA 3B2GA 5EE3A 3SHLA 1FCLA 2VZKD 2TSSA 2K33A 4KGSA 2IPKD 2CW0C 1S5DD 4PMWA 3I73A 1AZPA 1TKEA 3L4PA 4PT5A 1F9PA 1EM7A 2OT2A 1F2MA 1VMPA 4WJWA 1FRRA 1LT5D 2NB0A 2BCOA 5JVG3 1STGA 2QCPX 3V05A 2EE1A 2R93B 3BWUD 2DBYA 4IZ8A 4A3EB 1E6EB 1H9RA 4C80A 4LJZC 2L9HA 5C44B 5C2TB 1MD2D 2EYJA 4IFDH 4EQPA 4IOIE 3R3OA 2PVOD 1JOKA 2A6HD 3RD4A 2Q5WD 2F3WA 2ID0A 1FEHA 1AZQA 2WXOA 4WWMA 3AE7B 4LK1C 3EVQA 4JWSC 3IFTA 4RGMA 2W3RA 3I91A 4TMAB 3AECB 3EA6A 1R9TB 4HRSA 4KJOA 1EU3A 3BIID 5M3MB 4U673 3TEWA 1Y1WB 3ND8A 2WXHA 3URYA 4RCOA 1K51A 5AUKA 1CFMA 1IUEA 3MA2B 1FMAD 4OO1G 2F0UA 5AUIA 3T53B 2J52A 5JXVA 1RTOA 3R2TA 5D3IB 3S14B 2FJ2A 4QIWB 2TMPA 2WB1B 2EJFC 1DOKA 3VYRA 1FCCC 1PRTB 4RAUC 4B08A 1EYCA 2GRIA 1B3AA 5IT9L 1RODA 2X38A 3NUHB 1GUTA 3NE5B 1T5EA 2PCFB 1BBXC 1JW9D 1YN4A 1D5ZC 3IKJA 4A3JB 2ZW1A 2B2UC 2N9KA 1I4GA 1OO9B 2F0SA 2XWJB 4JPSA 1Q12A 1IL8A 3EFXD 1IBXA 3SVMA 3BVMA 4OZCA 2LMCB 3AH7A 1GHJA 4IUNA 3GTJB 3AU7A 2WIIB 1J7CA 3J9CA 1LTAD 1S4ZA 4FXKC 4NW2A 3T3NA 2IGDA 1EQVA 3LWEA 1VJKA 1JWAD 2D5GA 5K36G 1PUTA 2BS3B 3M3YB 1GOZA 1MHXA 1SJED 3CHBD 2E6XA 1FXIA 2SAKA 2JSVX 1W6JA 1N5WA 1ET6A 3NP8A 2B39A 1YN3A 1YNND 3M4OB 1S5BD 3RPFC 1I4XA 5FLXE 3WCQA 1WTQA 4KN7C 3VYTA 2EYHA 3J7AF 3W9CB 2EY5A 5IGCA 3GV3A 1TKGA 4RNAA 1SNMA 4ZLTF 1YNTE 1TS2A 2R3ZA 3HOUB 1BNZA 4HEA1 1YQ4B 4KN4C 3ZYYX 1TS4A 5C5MA 1S5FD 4FXDA 1HPCA 3SFDB 1C79A 2Z4HA 1SIJA 3AMZA 4L1BA 1GXDC 3TEYA 5I2XA 2OHFA 2F0MA 3GS2A 4KKJA 1DYQA 1FRDA 4YWGG 1WTRA 2QMTA 1NAPA 1Y8NB 2RPVA 2YEPF 4K6DA 4XT1B 2Z8LA 2OEDA 1EY6A 2B2YC 1KH0A 3WDNA 2NTSA 1D5MC 4JE3B 1PTOC 3GO5A 3HRZC 1SYDA 1E9MA 3H3VC 2A6ED 3P1HA 3PUVA 1Y8OB 3TP8A 1TT2A 1C4AA 1QNKA 4MT5A 2A68D 1JWMD 3DWMA 1PDQA 3Q69A 2I07B 1A15A 4K14A 4CJ1B 5KNCA 5FO8B 1FFVA 2QF7A 2L55A 3AB5A 1FNUA 2KEDA 4XTCS 4A8XC 4ZKBB 3B9JA 4OO1H 2F0DA 4L2YA 5IIFA 1A3UA 1CQVA 3MC0B 2YU9B 2HDMA 3J80L 1ZKOA 2F0GA 3H6MA 5H8YE 3RFZB 1WTWA 5CBEE 4WAFA 4CKEA 2JEAI 2VUMB 2SNMA 3PZ8A 3PUWA 4KY5A 3RLFA 2RMMA 1F2ZA 4KKIA 3NBIA 2J7ZA 1G8ZD 3FRPB 1O7ZA 1QKZA 3QOLA 2L4NA 1FYCA 4YTMB 3K7AB 2ONQA 3RZDB 3NHHA 4Q2JA 1PDXA 4RGOS 4WQMA 4G57A 5HHDG 2EDGA 4G4KA 3CQZB 5K36H 4B9WA 1NYRA 2HUGA 4BWGB 5CC4A 5BN4A 4ZOHC 2IL8A 3VQIA 2KN4A 1I4PA 1GB1A 3H91A 1JC7A 2XWBB 4YXDB 3H8HA 3AEFB 1WTVA 3I90A 5CV7A 5KGUA 1KAAA 4DU9A 1QQRA 3I57A 1SYBA 2F0HA 3PO3B 1MVKA 2F0PA 2O2LD 2J42A 1ZYRC 4WRDA 3MWYW 3HKZB 5CORA 1I6HB 3CIRB 1A70A 2BBCA 2BA0A 2A73B 2MJDA 2QJLA 2K5PA 2K28A 4JK1C 5A35A 1DJRD 1L6UA 1FXAA 3BVGA 4DXFA 2N9LA 1F0ZA 3P4QB 2ZT9C 3NXWA 4R8NA 2M00A 2NWGA 2MP1A 4XYOA 2NVXB 2A5HA 2BS2B 3V96A 3A55A 1OQQA 3A8IE 1V8CA 4YIJA 3J7YW 1RKNA 1G2TA 3IT4B 1TS5A 1SE2A 2B2YA 1CA5A 4A93B 1B1ZA 2CU3A 3SR6A 1YJIA 5M3FB 1FD6A 5H92C 1HQRD 1AFPA 4BA2I 3AE8B 1V1PA 4XQNA 3P4PB 3CRLC 4MIUA 1FFUA 3GB1A 4H7BA 3ZJTA 3OOCA 2XIWA 2NYZD 1V8QA 2M9VA 1BCPC 1GUGA 2E76C 4DAYA 3J81E 1TR5A 2K5QA 1DOMA 2J0TD 1G91A 1TY2A 1I3QB 2KEEA 4D2KA 4ZQ3A 1VF7A 3I9V1 1TWFB 1BF4A 3KBXA 2SDFA 1EU4A 1ACCA 3BDCA 3NWTA 1ZPSA 1QE6A 1SE4A 1GJXA 2KACA 1VMCA 4HSPA 3AE3B 4JX1C 1DOYA 1G2SA 2QEJC 2BA1A 1MI0A 2XN9C 1SYGA 5AFWA 2WP9B 2VB2X 2OF1A 1WVLA 5JEAJ 4A3DB 1TKWB 5DEHA 5HI1A 1ML0D 5J22A 3BDLA 4N59A 1CZWA 1HA6A 3VR2A 4OZBA 4PMBA 3PO2B 1LT6D 4IQZA 1N60A 5FK9C 4N58A 2O5JC 4KKTA 2W55A 4H44C 1I4QA 5CV5A 1FM0D 4K2KA 1SMYC 3FC4A 3DXJC 3TP7A 2PW9A 3NSWA 4U68A 4A6QA 1X3QA 2F0LA 1C76A 5DAUA 3VR4A 4M0WA 1IYUA 3A54A 2A74C 4MM3B 5EPKA 2KQ3A 1Z47A 3W3AA 1FNVA 1RF2D 1CHPD 2KQ4X 1HQMC 1SNDA 2HDLA 3GV6A 4WIPA 3LB8C 1P7FA 2EJMA 3L3OC 4L8JA 1W6KA 3DWPA 2WKCA 2PZUA 2I2YA 2F3VA 1O80A 1XX8A 5E6JA 1K50A 3MXNA 3IAYA 2PTLA 1LLRD 1VLBA 3VR3A 3U9SA 1FNWA 1DOIA 4ZHOA 1AN8A 1QLBB 5T8IA 3ERQA 4F8MA 4NJCA 3R2IA 2L5TA 4FF2A 1XTCD 4FXCA 1UGJA 2WDQB 5C4ZA 1SYEA 2LY7A 2ZXOA 4TQ1A 4FP5D 5FOBB 1Q3LA 2X6GA 1WTOA 2IGGA 1O78A 2EYPA 3Q8BA 1GHKA 4IUUA 2R7ZB 2NN6G 1QT9A 1L6VA 5FR3A 4IFDJ 4YTPB 3S9WA 2F1MA 4I65A 2QDBA 1XF5L 1F2LA 2K7VA 3VRBB 4C7ZA 3HZXA 1LTSD 4FF3A 3GTQB 2KJXA 1QWYA 4UDUC 1GB4A 1M8AA 4X3TA 5EKLA 1IW7C 2FBWB 3P4SB 1B9NA 4RF0A 5GXGB 3FILA 2L1BA 4F88A 3I72A 3ND9A 1GAQB 1EYDA 1D6EC 3A56A 1MBYA 1XCQL 3PUZA 4RKLA 5EKKA 2L11A 5LNK1 1D4BA 1JWUD 3HEJA 4C2MB 1PRTF 1IBXB 4RWSC 2JA5B 3DEPA 1NR4A 5IODA 3ETRA 4DF7A 2F0IA 5A2QL 4R3DA 4DA2A 4F7XA 3AEAB 1NVID 3HOXB 2WXPA 1KDBA 2H1EA 2M56B 3HOWB 3KQ4A 5ISRA 3NVWA 5EE0A 4LMQD 3K58A 1PGBA 3C46A 3AMUA 3GTKB 3R8BA 3Q24A 2FINB 3F2UA 1RCVD 1Q10A 3CRKC 3SEBA 2FFKB 5BMIA 3TBIB 1QJOA 3GTPB 3N9YC 1PFNA 3P42A 2JZPA 1IKLA 1CQFA 4TQUS 4WURA 2WKDA 3Q0AA 4A3GB 2B2WA 1BO0A 2K1BA 3EJIA 1LTID 1I50B 5IGDA 2BE5D 2H89B 3ITPA 3H0GB 2K3UA 2DLBA 4CHTB 1YMHE 5BN3A 5KEEA 1IHZA 5C3XA 3FAHA 1ET9A 2W82A 3ZQ4A 3LNNA 5EPJA 4FYDA 1EY8A 2RDHA 1SYFA 1YNJD 4KJNA 4HCSA 3T16A 3K59A 2DYOA 2Z1CA 3X3NA 3U4EG 1PTOD 2L1AA 1TKYA 3GTGB 4ITKA 1ZP0B 3NVZA 2N7JA 3MHBA 2FE8A 3S1QB 2DYMA 2BTEA 1H9SA 3JAML 1JOQA 4H2AA 2PQEA 1A6XA 1PZJD 3KLSA 1HCZA 4KKSA 3AE4B 3P1MA 2NVTB 2LGIA 2K32A 2AUKA 5KRUA 1TWHB 2L32A 1MPEA 4HR7B 3D3RA 1SBBB 3C3LA 3K5LA 3M85A 2PNRC 1S5CD 1Y8PB 4DK0A 2Y5PA 2ON8A 3IT6B 1UUPA 2EVBA 3DM1A 2NN6H 4BY1B 2ZW0A 2PLPA 4EE2A 5M5YB 4IKGA 1TWCB 1WD1A 3E5SA 1QOFA 4YT0B 4WH4A 4XDDA 5CGKA 1V1OA 1WGKA 1WYGA 2JEBI 5T1IA 2HDEA 4REZA 5CBAE 1FO4A 4DAPA 2JA6B 1PFBA 5FKAC 1Y69U 2HCCA 3R93A 1AEXA 1TWAB 3GP7A 1OQRA 1STNA 1RWSA 2E2HB 4XQJA 1O7LA 3S2HB 4KI0A 3P75A 4NP5A 4K5WA 2WXMA 1A3TA 3A8KE 2MGSA 3U52E 3VR5A 4DFAA 2XRQD 1F9QA 4XQQA 2I38A 3Q6SA 4XE0A 4CKBA 2E75C 3L7ZC 2AUJD 1ILPA 2MPMA 3PIP3 1SE3A 1E10A 3CU7A 5EQ0A 4RH6A 5CYUA 1A2UA 3P4RB 3QJYA 5IGGA 1Q1EA 3QWNA 4J1MA 1CZPA 1ZYRD 3OSOA 3BVZA 3M7NA 1HFNA 2ZXRA 2LS01 1JORA 1PGAA 2B2VA 3PZ7A 5BMHA 3NBHA 5I6WA 3HVDA 1VZ8A 4QUCA 3PUXA 1WD0A 1XYIA 1HXYD 4N9TA 1IGCA 1NEKB 5G3LD 1VDVA 2A6HC 2CHBD 5EBCA 4ODGA 4C3HB 4OIJA 1U4MA 1C4PA 2FHTA 1JWBD 1STYA 2WU5B 1JR0D 5K5PA 1NSNS 1EIHA 1YQ3B 4L23A 3GD7A 5C4XB 2M2LA 2WU2B 4EGVA 1WXQA 1MSGA 2AWOA 2E2IB 3AE5B 4XXEA 1JROA 2IJ0A 4KY6A 1YN5A 1PMRA 4HKQA 3U9OA 2WLBA 5E3FA 3NPPA 4XWTA 1RD9D 2PZWA 3I4LA 1D1IA 3Q8FA 2DN8A 2K5DA 4XDCA 3NUCA 5T1GA 4KKUA 2KAJA 4C1NK 5I9PA 2NBFA 4O42A 2JSOA 1PTOB 2K22A 1Q8IA 5KIXA 3HOYB 2K05A 1VZ6A 4K6LA 5M9OA 1FR3A 5C3JB 4G7HC 2MJEA 3D4WA 2LMCA 1WRIA 3IAS1 1AYFA 1KF6B 2EJGC 4HTHA 3S1RB 3K5OA 3E6ZX 4ZK9B 3H94A 5IGFA 2AWNA 4LAAA 5CV8A 5TSSA 2NVQB 1EWCA 5FO7B 5ELDA 5G3LF 1DONA 1RTNA 4CQNA 1DZ1A 4ZUIA 4RA8A 4Z9CB 2EY2A 1I4RA 1Z6HA 4P16A 3VYUA 1EY9A 2K01A 5C4JB 1CJEA 1LTBD 5ELBA 2NN6I 2DY7A 1RJTA 1XXGA 2RSOA 4L6TB 4B9XA 4DK1A 1L4DB 3Q22A 2SEBD 1YNNC 4OL7A 3L9AX 3V3XA 3VR8B 1C8CA 4HMIA 2XVSA 1QILA 1LTTD 2L83A 3D31A 3NS1A 3CKIB 4DNTB 1RYJA 1WTXA 5C3WA 3KWVA 1HTLD 4C3IB 3W1SA 2SNSA 3QO2A 5EBDA 2LHEA 1QNUA 4CJ2C 1QOGA 4P2CB 3EGRA 3W5UB 2I46A 1UWXA 1AP0A 4KV6A 2JYOA 4BBSB 4TQ0A 5IOCA 1E2VA 1L0XB 5D3DA 2GI9A 4FXGC 4F87A 3HUIA 4N6EB 3E56A 1BDOA 3K5NA 3NVVA 1K53A 4PMCA 2WP8J 1E2ZA 3S17B 2WXIA 1F9RA 5CR3A 1TVXA 2H4OA 4K5VA 4FNFA 1Q90A 4Y7NB 3MP9A 3P20A 1HRJA 1KNAA 1NCVA 5J1ZA 5I6YA 4RKBA 1ZOYB 1T3QA 3GTLB 2WACA 2B76B 2WXGA 1GUNA 3I3CA 2XSCA 2J4XA 1V43A 2PO4A 1EQTA 3AE6B 2WQYB 4GDKB 4ME5A 5IT9E 4G7OC 1UWMA 1PXUA 2BDOA 4FF1A 1CTMA 3AE2B 2RKSA 1DOXA 1STBA 5JEAG 1VDZA 4N9PA 1HUMA 5COYA 2LJIA 2M0AA 5DM63 3AE1B 4NZLB 2YYZA 2D9UA 3TN2A 1GUWA 4IUPA 3O13A 1NYQA 1NI3A 3MEHA 1ONLA 5FO9B 3AV8A 3U7ZA 2DNEA 4LLGM 4M8AA 1UAPA 4H0LC 1KRHA 2WXRA 3HRDD 5HG2A 4ZHPA 1DOLA 2A69D 2G9HD 4DN4M 1B44D 2DNCA 1XLNA 4NAMA 4KD3A 3M7GA 2LFIA 1BCPB 1IW7D 2ICIA 2W54A 4FVMA 4X3UA 1CT1D 1PFDA 1JQ4A 3OHXC 3BYTB 2PW7A 4Q0FA 1ROEA 5G5GA 1B53A 1VCIA 4A3IB 1TJEA 4DAVA 4RHRA 1ENCA 2RA4A 1FIQA 5E4WC 2RQXA 3QG1A 2KCNA 3U2SC 2KMMA 2KHSA 4BBRB 3IXSA 2O4XA 3VR9B 5EKIA 4XT3B 5I4DA 3Q23A 4R9WA 1VRAB 3LXFA 2B2WC 3P7JA 3SR1A 2CW0D 4US8A 3MXUA 1BXTA 1I7HA 4OHJA 3DEOA 3KLSX 3MXGA 3NQTA 3HVZA 3OPOA 1TS3A 3AEBB 2PW5A 3SK6A 1R4PB 1PLFA 1X3PA 2B63B 1BUVT 3HGBA 3M4YA 5KYIA 3DHQA 3KWLA 5ELFA 3OWFA 5C0XG 1MSHA 2HTME 4AS1A 3NTHA 3Q8EA 4NKLA 1CHQD 1B9MA 2WINB 1VF5C 2KA7A 3EQLC 5HGTA 3IFDA 3AEGB 3SXHA 4IURA 1DM0B 4ZAIA 1PGXA 1EYAA 1QOAA 2RVLA 3FDTA 3T4AC 1A2TA 2E3TA 2PVGC 1HEZE 1TY0A 1K52A 4JWUC 4KY7A 3G7LA 1EFID 5EJWA 1EY7A 4AQ7A 1OXXK 4C1NI 5KNDA 5BYSA 4AYBB 1LTGD 4HEDA 4OIKA 3OMGA 3LYYA 3W5VB 1A3VA 3NWSA 3TMEA 3OMCA 3N52A 3J80E 5IGBA 3QOJA 1GUSA 2B8FA 4G7ZC 2NTTA 5HFYA 3P63A 2GA4B 3IL8A 3I4NB 3E9SA 5JEAH 4ULLA 3K6OA 4OGQC 2F0JA 2QIEB 1ILQA 5JOBA 1M4VA 2JXMB 1ZXHA 2L0CA 1EEID 4OVZA 3MAQA 1H9SB 4WFN3 5MPOA 2HQEA 3ZJVA 1C4QA 5KNBA 2BB5A 3FEWX 2F0WA 1J7BA 1O7YA 2RDGA 2R6GA 1TQOA 2F0EA 3QIAA 1KFYB 4IN3A 1YJJA 2BS4B 1EZ8A 2Y5CA 2LEKA 4RF1A 3AE9B 2B2TA 1XLOA 4A3FB 3Q8AA 2VXWA 1D1KA 3T51B 1ZXTA 2EYLA 4O1NA 3UI3A 4YSXB 1SSOA 2IT1A 3MFYA 2E2JB 2K5WA 2Y0SB 2VNUD 2KWDA 3OIQA 2F0TA 4I7ZC 2B2VC 5D14A 1J8IA 2WAQB 1SB3C 2WXKA 4XIGS 4GZYC 3C8YA 4RCNA 4A3BB 1EWHA 2WXFA 1ZEQX 1OXTA 2CJNA 3MJ5A 3HG9A 3VA7A 1C77A 3BS1A 3RZOB 2KCCA 5G5HA 3AEDB 1WSPA 2PKOA 2PYKA 3NTKA 2DY8A 2BT6A 4CGYB 5JPNC 2F0VA 4ZYSA 4IDIA 2RBMA 5CV6A 3I8ZA 2JYEA 1QOBA 2B8GA 1SFOB 1ZUD2 1N63A 5C3EB 1N61A 4C3JG 2Q8RE 3UI2A 1EEFD 1RFKA 4KGRA 3D4DA 5C0XH 4EQOA 1DCZA 4YSZB 2IX0A 2LFNA 5D65A 2WS3B 2E2DC 1I6VC 1PRTC 2BOSA 2PMVA 4ZRPA 4YSYB 1FD7D 1Q1BA 2F0QA 2V4DA 5EE9A 1TWGB 1E0ZA 4NDXA 2X69A 3K5MA 1JQYD 3N6RA 1BR9A 4ILWA 3S15B 3KLRA 2HCIA 2ENBA 4IUVA 4GLSC 2CJOA 4Q5VA 2AQ2B 4RGTA 1SNCA 2ICEC 2WDVB 1XLQA 3T56B 2BYTA 1EOTA 2F0KA 1MHHE 2LHDA 1H9KA 1J9OA 2OEOA 2EOTA 4V0BA 2L52A 5CV9A 2G9DA 2MEKA 4HN7A 1U9RA 4TSSA 1JALA 1STHA 3D8GA 2BDNA 1HZ5A 1OXSC 1GUOA 2D2CC 3Q8CA 1Z7TA 2WNMA 4EQNA 1U4RA 2PPBC 1MGSA 5EGTA 1QCBD 4IALA 3S16B 3A7AB 1EY0A 4KTAA 2K0PA 1K8OA 4LTUA 3ZGZA 4NAWB 4P6VF 3VYSA 4J6HA 2EELA 1EIGA 1R4QB 2JA7B 1STAA 3G6JB 3J81L 4ARCA 2O5IC 3T13A 1K83B 3GTMB 4BS9A 1R7SA 2SOBA 3SK8A 2M19A 2D62A 2MHVA 1MI2A 3A7LA 1C4CA 1PTOF 2K04A 2EY6A 3DWQA 4L63B 3BYYB 1SYCA 2WDRB 4A55A 3DWGC 2IW3A 2J53A 5JVH3 3MXPA 1J7AA 2FUG1 2MJ3A 1JICA 1IKMA 1T6BX 3TSSA 2K03A 1C48A 4ID6A 3WOEA 4A3KB 4QF4A 3BG3A 1SAPA 1CM9A 1K8MA 4IUTA 5CMDA 1TYGB 3SK5A 4MACA 5C5LA 3LX0A 1E2WA 4ABNA 4HSVA 1D2BA 2KDMA 1OXVA 4HJGE 1VR9A 4J8QA 5E4XA 3SE0A 4S3SA 2AQ3B 2VZKB 2N55A 4PV1C 4K2LA 2BE5C 3PMFA 1JCKB 2N0SB 1OXUA 1HUNA 3SDZA 1SSNA 1QOHA 1TIID 3OW7A 1P7EA 4J3OD 2V4IB 3FPPA 1SJHD 3BK1A 2EYMA 4HKZE 1YNJC 5NUCA 3ZJUA 2JYTA 2EXZA 2JWUA 5IGEA 2R92B 2F0OA 2IX1A 3HOZB 1E7PB 5D7GA 3V2TA 1H9MA 5C0XI 3X3MA 5M5WB 3BDOA 3ONAB 3SFEB 4IFDI 1PFMA 2NUCA 2IWHA 4TKOB 1V1PB 5DM73 5JAVA 3IAM1 1D5XC 2C9OA 4HMJA 3I70A 2K6AA 3TZUA 1BCPD 5E1FA 1IYVA 1RHPA 1SF0A 4KMUC 1NENB 2H88B 1TU2B 3NQIA 1SNQA 5CV4A 1JRPA 2NMQA 1ZDXA 3VA5A 2MJ8A 3MTSA 1HFGA 4XYQA 5JJZA 2D5DA 3S1NB 2KECA 1L0YB 4JBWA 2Q8IB 3AEEB 2ACZB 3MZ5A 3BK2A 4NMZA 3ABVB 3T3OA 3PV0A 5A2QE 4MHEA 2LKVA 4C56C 1JMLA 2F0NA 3TP5A 2B2UA 1QG7A 1U4LA 4ZRQA 1B4OA 1U4PA 2PIAA 1DXMA 1ENAA 3DWAA 1AW7A 1EY4A 1AWDA 2EKIA 5HURA 2QKIC 3LWUA 1PZKD 2R61A 4PQXA 1QB5D 4DNRB 3HOVB 2YEPB 4HAEA 2EYFA 4K8JA 5LL6S 1LABA 1PZID 3KK7A 1LO5D 4C3HG 1TZOA 1LACA 2KUMA 4ARIA 3FPUB 4EVOA 2X6LA 1KABA 4A90A 1SMYD 2MUYA 2PZTA 3D6WA 1BCPF 1BUIC 3C1FA 4CBVA 3W2DA 1OFFA 3EROA 3AB9A 5KYLA 3S2DB 4ZUJA 5ELCA 2WXLA 5BYRA 2WXJA 2JQRB 4KD4A 2CVRA 4KGTA 3PUYA 1CZGA 4CKCA 2V0GA 2A6EC 1Y56A 1C78A 1C9FA 1JWSD 2A68C 1B2TA 2KOLA 2WXNA 2AQ1B 3KF8A 1BQQT 1KLGD 2W3SA 4MN3A 4TRDA 1HTPA 2RDFA 1IGDA 2GB1A 1L5PA 1L4ZB 3JAME 1KTKA 1PYWD 5ELEA 3TDQA 1SNOA 1E0BA 1LT3D 2CQAA 2XRSD 4DGZA 4QMGA 1BOSA 3OIPA 2JA8B 4QB4A 3NTIA 1F2RI 3K0YA 2FMCA 3NK9A 4C7YA 1F77A 4USAA 2IX3A 1I4HA 1DGJA 1SXTA 4V190 1L0VB 4UAIA 2Y3AA 3PIO3 2IDYA 4XWWA 1NUCA 5DNFA 2AX5A 1KNEA 4X3KA 4X3SA 3D6CA 3NRZA 1EZ6A 4HROA 1T5XD 3KUPA 4PNYA 3FMCA 3B2FA 4E6IA 1UNSA 3RUZA 4RHSA 3EUB2 3VR6A 1ZE3D 2EPBA 4M1UB 1LTRD 2Z4IA 1KLUD 3MHZA 3QB3A 1G291 2B2TC 1WCMB 2JE6I 2JX5A 1STEA 4C3IG 3DUZA 3CWIA 4KHZA 1XLPA 1LV9A 4MH8A 3NVYA 1JE4A 4OO1I 2XNAC 1G6ZA 1HZ6A 2EZVA 2E74C 2ZXPA 4OW0A 3MFGA 2C5CA 2MH7A 3FILB 3NZ3A 1XWEA 5J39A 3S1MB 1ZDVA 3WOFA 2JP1A 2F0FA 2WXQA 2INNE 5EPLA 5C6AA 2BB6A 2QILA 1ENFA 1ESRA 4A3MB 1N5XA 5I2YA 4KK7A 1GPXA 1XCTL 5F2DA 3J7AV 1DD2A 4A9AA 1BMLC 1XO3A 3TUOA 3GQBA 4RGNA 1SNPA 1ZXIA 1B50A 1RM6C 4YTNB