5D3IB

Crystal structure of the ssl3-tlr2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
b'KYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 2
publication title Structural basis for inhibition of TLR2 by staphylococcal superantigen-like protein 3 (SSL3).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
B PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d3iB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5d3iB01
1S5FD 1TY2A 1KLGD 1L0XB 2IJ0A 1JWMD 1BCPD 4RHRA 4RGOS 1LT4D 3MFGA 4BWGB 1KTKA 4UDUC 1D5MC 1EU3A 1TY0A 4ZYSA 1EEID 1L0YB 5FK9C 1SE3A 1YN5A 1SE2A 3EFXD 2XRSD 1LTAD 5FKAC 3BVMA 1TS3A 3BVGA 3BYYB 4OHJA 1CK1A 1PRTF 1I4XA 4RFBA 1UUPA 3MC0B 1HQRD 1AN8A 2QEJC 5ELCA 1G8ZD 1I4GA 1SEBD 1LTTD 4RCOA 3GP7A 2NTSA 4DXGA 4RGNA 1TS5A 4RHSA 1FNWA 1DJRD 1XTCD 1LT3D 1PRTD 2IPKD 3BZDB 3O13A 1I4RA 1D6EC 1V1PA 4O1NA 2AQ2B 3R8BA 5ELBA 3BVZA 1JCKB 1S5ED 1I4HA 1LTRD 5D3IB 1M4VA 1JQYD 3TSSA 1CHPD 2TSSA 1FNVA 1BCPC 1I4QA 2SEBD 4TSSA 1S5CD 1LLRD 1GOZA 3DWAA 4DXFA 5D3DA 1YN3A 3W2DA 1SBBB 1RDPD 1SXTA 4K6LA 3DWPA 2NTTA 1ESFA 2ICIA 4L6TB 1CHQD 1PZID 4C56C 2J4XA 2XRQD 3URYA 5ELDA 1RCVD 1SE4A 3BYTB 5ELFA 2RDGA 1SJHD 1S5BD 1I4PA 1BCPB 1HTLD 1XXGA 1MD2D 2G9HD 5I4DA 1HXYD 1JWUD 1PTOF 1V1OA 1UNSA 3R2IA 1EFID 1LT5D 2AQ3B 3SEBA 1BXTA 1FD7D 3CHBD 1LTGD 3R2TA 1PRTC 1LTSD 1PTOH 1PTOD 3KLSX 1DYQA 1YN4A 2AQ1B 1CT1D 1JWSD 1EWCA 1ET6A 4NZLB 4RH6A 1LTID 1AW7A 4RGTA 1PRTB 2O2LD 1LT6D 1PTOC 3EA6A 1RD9D 2R61A 2XNAC 1D5XC 1PZKD 1KLUD 1LO5D 1STEA 1FNUA 1SJED 1EEFD 5ELEA 2XN9C 1EU4A 1T5XD 1CQVA 1ENFA 1FGBD 3OWEB 1PTOB 1HA5A 5TSSA 2CHBD 1PYWD 4RGMA 1QILA 3V05A 4L63B 1TS2A 1RF2D 1BCPF 1PZJD 1F77A 3DWQA 1JR0D 1ET9A 1LTBD 4Z9CB 2QILA 1S5DD 1V1PB 1TS4A 2Z8LA 1B1ZA 2WV6D 1B44D 1D5ZC 2RDHA
chains in the Genus database with same CATH superfamily
2N49A 4LF6Q 3HOWH 4DK6C 2KOLA 3DM3A 2WXMA 1TZOA 1YNND 4XDXA 4YCWA 1ZKHA 4IM0A 3W1SA 1ENCA 1BVSA 2CVRA 2BH8A 1SE3A 3ML9A 1EF5A 1XPUA 1XQQA 5EBDA 1SNCA 4OW0A 1X55A 4PG3A 1K83H 4B3SQ 1X3PA 1TS3A 2G9DA 3I8ZA 3DBHI 2WDQB 3RNEC 3MFYA 1UUPA 4M00A 1UBIA 1E2VA 4WWOA 1WX9A 5CGKA 2AHOB 3P1MA 1WGYA 2MH7A 2K52A 3I3CA 2WQYB 4HWIB 3GP7A 4G7ZC 1M8AA 2UXCL 1HQMC 2PMZE 3I56A 4FVMA 2GMIC 4W9KA 5FO9B 5DEHA 3ML8A 3T1HQ 2LKVA 5M3MH 2Z6KC 4OIKA 2IO3B 4DV3L 2V3SA 1O7IA 2V4IB 2K05A 1SSOA 2P5ZX 4FF2A 1VQKA 2NS5A 2HT1A 2KENA 4YY3L 4FJVB 4XDCA 1EO6A 2HUGA 1EOTA 3NTKA 4N8X1 4ZLTF 2NN6G 3PF4A 3HOUB 1NBFC 1PXUA 3RNUA 3IAYA 1M4VA 3SU8X 1YIJA 1ISNA 5DPTA 2YYZA 2VNUD 4U673 4DHZE 1QE6A 2Y5PA 2L4NA 4JOIC 5IP9G 3S1NB 3R7RA 2JA7B 2KN5A 2FIDA 1KC8C 4QJFA 2GOWA 5DLQE 2JWZA 4HCEA 3RZOH 3CF6E 2EY2A 4F8CB 2NTTA 2BDNA 2YTVA 3PVLA 1O7LA 1EF1A 3LWUA 3AMUA 3AE1B 3CPFA 1Y1VB 1IBLQ 4NJ7A 1MVKA 5DCNA 5IT9E 4IPGA 1P16A 4DV1L 1Y56A 3KQ4A 4DR7L 1T0YA 3P1HA 2PW5A 2GBMA 2EVBA 1KAWA 2K1BA 3TL5A 1PTOF 1MJEA 2CHXA 1CSPA 2ZT9C 3QR8A 3SFEB 3E6ZX 3SEBA 3SK6A 2F0JA 1QZGA 1KIXA 1SSNA 2J0KA 3PIO3 3I4NB 1DOIA 4DV4Q 2KVZA 1TWGH 3X23A 2CQAA 2JYEA 1IBKL 3M3YH 3PHWB 2F0DA 3MXGA 3DWMA 1A3VA 2VQEQ 2RGFA 2BB5A 4L5TA 2TMPA 1V5TA 1FGUA 4HMIA 5KNCA 3D4WA 4GKJQ 2NN6H 4CKEA 2KWCA 2ZW0A 1EFWA 2HJ1A 4HJKA 1EWCA 2BS4B 2MGSA 2HHHQ 1VQ4A 1K51A 2N9KA 5HFYA 3HRZC 1CUKA 4DNTB 2D3BA 2WHIA 5IP9H 2JA9A 1PH6A 2KWDA 3S1MB 1C76A 2HQEA 4EVOA 2DX5B 2B3AA 1K28A 3T16A 1KXLA 3WOEA 2B2UC 2CR5A 4K8IA 2JY6A 1TGZB 4DR6Q 1UBQA 1G91A 3NY5A 4MH8A 4NY0A 1XMQL 1EEFD 1TIFA 2XN9C 4JOIA 3J80E 2W3SA 4OONA 5E4WC 4MTNA 1K0RA 1QVFA 3RUIB 3ULLA 4XYQA 1OXUA 2INCC 4LJPB 2MHJA 1VZ6A 5TSSA 2R92B 2DHZA 2D0OA 5CV8A 5IKCM 1NEKB 1Z9FA 4DR2L 4WJOA 2NBVB 1R4NB 2JA5G 4KKJA 5C4JH 1AE2A 2JJQA 1WMHA 2CU1A 2BF8B 1TBEA 3NTIA 1TY2A 3GOEA 3PGZA 2UUCL 4KY7A 1DGSA 3IXSA 4RGOS 4LFAL 3VH3B 2ASBA 2WAQE 2UXDQ 1D5MC 3GDEA 4ZYSA 2RA4A 1CI3M 3T1YL 2I1JA 2E2DC 2QHOA 4DR1Q 3A1QB 5HHDG 4EE2A 1QB5D 2X6LA 3UE1A 2REXA 3W1GA 3Q14C 3RZWC 1L6VA 1MBYA 4W9LA 1B3AA 1B3QA 4N8FA 2KDMA 5LXHA 3H0GG 1CK1A 3OHXC 3NTHA 1MSGA 2KJRA 1JT8A 2WU2B 1GD7A 4DF7A 3FEWX 1TWFB 1G6ZA 1NNXA 1HRJA 2WAQB 2OCEA 4K1RB 3HFZB 2M19A 5G5GA 2B3GA 4DR3L 4HXDA 2RMMA 2PCFB 1S72A 4NW2A 5GADC 4KV6A 1K52A 1N32L 2YTYA 4HCSA 3SK8A 1KAAA 3O13A 3I3TB 2Q2IA 4MHEA 5M9OA 4C3HB 2XK5A 1QOGA 3GTGH 1K8AC 3J81i 3FILA 2A69D 5D94A 4TQUS 1XNRQ 2AQ2B 2PYKA 2JA5H 4W9GA 3KDFA 3ONAB 3OIQA 4LDTB 4JI7L 3L17A 4A4IA 5CBEE 2MPMA 4X3SA 1YBYA 4F7XA 4A9AA 2UUAQ 1A6XA 1RFKA 2F0KA 3PSEB 1WRDB 2D2CC 2ZJRA 1I94L 1N5XA 3SDLC 2KLGA 3TRZA 2MP2A 2RHSB 3S15H 5D2MB 3W2DA 1M94A 2DJGC 1XTDA 4UP7A 5E1FA 1PFBA 5C4ZA 1NI3A 2PQAA 1Q5WB 1RAXA 2FBWB 2KWUB 1AFPA 4YY3Q 4IWOA 1T0RC 2X8XX 3H0GH 3GZNB 1AE3A 1I4PA 4J8QA 2LGIA 2NBFA 3PCOB 4NXMQ 2JA8G 2RSUA 4W9IA 4PZ6A 5IE8A 1BF4A 3J81L 3VRBB 4A3IG 1HZAA 4EUTA 3ZGZA 1XCTL 1KJTA 2L8JA 3HG9A 4DV0L 1WM2A 4E6IA 4Y52H 3VFKA 1WMHB 5FLXL 1PTOD 3A9KA 3WAMA 4EX5A 2K3UA 3AULA 4LNOA 2C7MB 3PO0A 4DV1Q 1WTVA 2HIVA 1H9KA 3U9OA 5M5WH 4DR7Q 4FXDA 2V3PA 2NVXH 3X0WA 4C7ZA 3HOVB 1AW7A 1L6UA 1PQSA 3C1EA 1PMRA 1PH3A 4FDBA 4GN4B 4A8XC 3S17H 2ZXRA 5G5HA 4D2KA 4QUCA 3QG1A 3DBHB 5BMHA 1B9MA 2KDEB 2CKHB 2OF1A 2H88B 1XYIA 5JVH3 5H1SE 4YHHL 5KNBA 1D2BA 3N20C 4LNFA 5HGTA 1IGDA 2BT6A 3AECB 4CGYB 3BDOA 1E7ZA 3H15A 2O6VD 3L54A 4RKBA 3RLFA 2JA8H 4APVA 3LNNA 4C1NK 1UGJA 3B0AA 1ICFB 1UE5A 1OXXK 5FJ8G 4FF3A 1WYWB 2EY6A 2CU3A 4GU2A 4A3IH 2Y0SE 2XK5B 1KRSA 1HPCA 1UWVA 3WAOA 2AWOA 1B1ZA 4K0KQ 1F9PA 1CMXB 4A3KB 3HIZA 2KFJA 2DN8A 4JWSC 3I4MG 3ZTCA 3CQZB 3OLMD 4HEDA 3K81C 1FL0A 1JROA 4HRSA 1VR9A 4MN3A 1JRPA 2LD9A 3ZNZB 3MFGA 1N33Q 4X64L 1P7FA 4AQ7A 1C4QA 4BWGB 5BYSA 2RSOA 2Y0SB 4HSVA 2MP2B 3D4DA 2F3VA 1HTPA 2PVOD 4DR2Q 1KDAA 2KJHB 2PQAB 2D0PA 3U4EG 3PO3G 4OWWB 1SAPA 4REZA 1JWBD 1YZ6A 4M8AA 3B08A 2J0TD 2KANA 1J7AA 2BPSA 1G8ZD 1FXIA 4R1JA 4C1NI 2HQLA 4DXGA 1C4PA 2IYDB 3KBXA 3KUDB 1GB1A 2BWES 2D3AA 3T1YQ 2IPKD 3PO2B 4FYDA 5C0XG 2ZJPA 4IUTA 4DV6L 3M7GA 5FJ8H 4V0BA 1OQRA 1RLFA 3HOWB 1WGDA 2INPE 3VDZA 3A7AB 3CP0A 4LMQD 3GQBA 1CQFA 1NBWA 3A9KB 3FP9A 1HZ5A 4E3CA 2WP9B 3I4MH 2C5LC 2LVQA 1D4BA 1CSQA 1VQAA 3C19A 3NWSA 3MXNB 2FE8A 4BBSG 1K83B 3U52E 1SNOA 5LL6S 4TSSA 5FO8B 3NK9A 2WX0A 1J5EQ 3PHXB 1LLRD 2V0GA 4R8IA 4B3RL 2KCNA 4R4CA 1N32Q 4BAXA 3M95A 3AXCA 1LABA 3WOFA 4P2CB 4L6TB 3QX1A 1DD2A 3VR6A 1DXMA 4KD3A 1XLOA 3PO3H 2K5DA 4NPNA 1ZYRD 1B8AA 1S5BD 2KBNA 3VYSA 1CKNA 3GV6A 5M3MB 3T56B 1AEXA 1NY4A 2K7VA 2VQFL 1UNSA 3GD7A 3I4LA 1EY6A 1QOHA 3J80i 4XWTA 1Z7TA 1WTXA 1BXTA 3PRMB 3JAME 4WH4A 2A1AA 4JVZA 2PIAA 5C0XH 4IFDJ 2KKCA 4UPAA 4MDKE 4YWGG 4LFBL 2LVPA 4C7YA 3SDZA 3L9AX 3VR2A 4AUQC 2AQ1B 4ZHPA 1Z6HA 2MJ8A 3W3AA 1JWSD 2Q8RE 1HR0W 4EEWA 2FJ2A 5L37A 3WDNA 4RGTA 4BBSH 4TVAB 2C5CA 4DBGA 2B2VA 5FLMG 1NJIC 1UWXA 2O2LD 4DU9A 2NR2A 3BWUD 3IAM1 3PIPA 2NBWB 1JJCB 4B9KA 4JI8L 3J81j 4G7OC 1D7QA 4DV0Q 2IHEA 3QO2A 1SNMA 2UUBL 1VQIA 3ZRFA 4I65A 1QLBB 1G51A 2E75C 2MP1A 3TP7A 3ULJA 1CQVA 1TWGB 2DGYA 1PH2A 4A93G 4GN3B 3RNAC 2A5HA 3M3YB 3QB3A 2KACA 2MBBB 3OW7A 3IVFA 1DOXA 4HIOA 2JA6G 1W6JA 2Z0EB 3AFQA 2UWQA 2INDC 3OJ4B 4J1MA 1AARA 4LK1C 3X3MA 2CHWA 2EYOA 1BDOA 1E8XA 5F2DA 4B3MQ 1PVOA 1S5FD 2ZJQA 1EIHA 2DNFA 3D4RA 1GUGA 1JWMD 3KYHC 3TBIB 1B2TA 2LVOA 4A6QA 5C4XB 1I42A 1LT4D 2F0MA 3CD6A 2V1YA 4UDUC 1T9HA 1MPEA 5G3LF 1TKGA 3Q8FA 3KF6B 5D6JB 5T8IA 2LRWA 5FLMH 4LF9Q 3SVMA 3J7AV 1U4MA 2DBYA 3H9DA 4B6WA 4P1BC 1X3QA 1R4PB 5COYA 5AEKB 4OO1G 3NXWA 1KL9A 2B2YA 1D1KA 3A55A 4HJ9A 3C2PA 1L2NA 1TWHH 2LFNA 3M3JA 3NE5B 2F0SA 4ZCKA 1SEBD 4MM3A 1E22A 5C4JB 3NRZA 4A93H 5C0XI 4C3IG 4BS9A 2JA6H 1A63A 4KVGB 4IUMB 4FF1A 1YHBA 4EQPA 1XF5L 1CKOA 4YWLA 4DV5L 2O5JC 3PIP3 2WXIA 5G2NA 4MSQB 1WJJA 1TZ1A 3I57A 2C7NB 2I1KA 2UU9L 2YTXA 5BMGA 5IYCG 3TIXA 1L1OA 4WJNA 4JV5L 1U9RA 4HJ7A 2MSED 4FNFA 4ID6A 4GLSC 1BCPC 4JI0Q 4JI6L 5JEAJ 2JU6X 4K3CA 3VR9B 2E2IH 1ASZA 1ZDVA 3IFWB 1TVXA 1JOKA 2LRUA 3DEPA 3OAWA 3OSOA 4JYAQ 4NJCA 3ZJVA 2ICIA 1AP0A 1VQGA 1ZOYB 1SMYD 3AB9A 2V9HA 2E3TA 3F1ZA 5EKIA 1R9TH 4OO1H 4JPSA 2K01A 2Z59B 2R3ZA 1OEYA 1YNTE 1MSHA 2L00B 1HTLD 3GTGB 5KYIA 2XVSA 4LUVA 4B9WA 2JA5B 4BXXG 1XD3B 2MJ3A 2VZKD 2AQ3B 3Q22A 4CHTB 1YNJD 2Z0SA 3T8MA 4C3IH 3A8IE 2OEOA 1AWDA 2QJLA 1I50H 2I38A 1YX6B 1PRTC 4POFA 4ME3A 4IPDA 4PNYA 5DM63 1MJCA 4JI4L 1P0RA 2ZPNA 3P4PB 2OOBB 4PYZA 4F1SA 4M1UB 3JVZX 3K7UC 3Q8BA 4X65L 3S15B 4CYEA 4K2KA 5IYCH 2K1FA 1II3A 1JB7A 2EE1A 2F0QA 3K7AH 3RCZA 2DUDA 1NYRA 4HEA1 1JORA 2I46A 1O80A 2DJFC 3H0GB 1CJEA 4USAA 3T53B 1I3QB 3TCAA 3K8AA 4QCLA 2H5XA 3SGIA 1ILPA 4M0WB 1QF6A 3PT2B 2N9XA 4LFBQ 1AZPA 1E6EB 2AYOB 2WDVB 4X6AH 1Y8RC 5CBAE 4TKNA 1BQQT 3VAWA 3K80C 3EHVA 1ENFA 4G50A 2D3CA 2E2JB 4II3B 2LGXA 4BXXH 4WJPA 3ND9A 1TS2A 4C3HG 2UXBL 2D5GA 4K7WA 5A35A 4W9EA 3SHQA 1QJOA 1VQ7A 4Z9CB 5M5WB 2Z8LA 1TS4A 2NVXB 3RMKC 2F0LA 4ZQ3A 1J8IA 2EKIA 4KHZA 1VQMA 2OTJA 3UIOB 3S17B 1E90A 4JI2Q 2K8CA 1L1OB 1I35A 2A68C 2L76A 2YVCA 3TQYA 3CPWA 4DUYL 1WE6A 2WXLA 2KEDA 1EU3A 1BBWA 4H0LC 3DBLI 2QKIC 1A8VA 3KK7A 3HEJA 1AYFA 2GBJA 5FLXc 4OO1I 3DBSA 2JEAI 4ZYNA 1UE7A 1LUZA 3NBHB 2JA8B 4HPLB 4LNIA 4DQOC 3ITPA 2QDBA 5G3LD 3IFDA 3TS0A 4HCPB 2XTIA 1E10A 4A3IB 3C8YA 3PMFA 4RCOA 4IURA 2CHZA 4OWTB 1L4ZB 3D0FA 3H3VH 1FNWA 2KECA 4A3CG 4NNJB 5FR6A 1CZGA 4PQXA 4OVVA 2V3NA 1GVPA 1YHAA 4TMAB 4C3HH 1D6EC 4LNQA 5EPKA 1YX5B 3FHWA 2NUCA 5ELBA 3JAMi 3CF5A 3WANA 3QIAA 2PW7A 3NZSA 3HZXA 2MBQA 3BDLA 1PH4A 4JX1C 4IDIA 3AFPA 1KNAA 2F03A 2WXKA 2TSSA 3JSVA 3SR6A 5LHY1 1EYAA 4AIMA 4WJQA 3F2DA 3DWAA 1WXVA 3S24A 2DLBA 1VQPA 1SYDA 2XBBC 2ASQA 4DV5Q 1NAPA 3RT3B 1HNWL 2KXJA 1HEZE 3P7JA 2XRQD 4GOPA 3UDXA 3DLLA 2DY8A 3MEHA 2DNEA 2UU9Q 1SJHD 2IY5B 3U2SC 4H2AA 5DPRA 1BCPB 2VUMG 4JV5Q 1VQ8A 2EMTA 1XXGA 3V61A 4ANVA 2BH2A 3STBD 3DVGY 3CCSA 1VCIA 2ZZPB 2A6EC 4JI6Q 3P42A 3ETRA 1EUVB 1U5KA 3CC7A 4F7ZA 3I4MB 4A3CH 5I9PA 2ZTCA 3SE0A 3R2TA 5EAYA 3Q24A 4A55A 3ECIA 2B2WA 4C00A 4IWPA 1Y14B 4IUNA 5GAEC 3PV1A 2VW9A 2KMMA 1PH5A 1WFQA 1WD0A 3K0YA 3KWLA 4QGUA 3SFDB 1C3TA 2SNMA 5E4XA 2EYHA 2MCNB 3ZKJC 4YTMB 4P72A 3ULPA 1V49A 3IRBA 1H9JA 1PRTB 4OELB 3PO3B 3CRLC 1GJZA 4NXNQ 4IALA 1I6HB 1MHWC 4E74A 1KLUD 2KHIA 4NAWA 2KUMA 3OOCA 4LDTD 4JCVE 4F8MA 2D3GA 3UI3A 5I6WA 4MNOA 2JN4A 3H3VI 3AEBB 5BO4B 1IYFA 3NZUA 4X65Q 3BZKA 4BY1G 1S1QB 2WXHA 3RFZB 2VUMH 2LXKA 1HA5A 3B9JA 1HZCA 1E5WA 2L05A 1GUWA 4HROA 1EYCA 1ZUD2 1JQ4A 5IT9c 1V9JA 2QILA 4KJOA 4DK0A 4A20A 3TP5A 4C2MH 1Q46A 4HIKA 1WTOA 2WV6D 5EBCA 4BBSB 2HD3A 4HPPA 1E24A 3PSIA 2KQSA 4FJZA 3OMCA 3CQZH 3ZLZA 2PPHA 2RBMA 5GROA 2RCNA 2M8SA 2O2VA 3GE8C 3M9BA 2BA0A 2L55A 3JSVB 1TY0A 3KWVA 1GC7A 4WORA 3QJYA 1KABA 1Q7YC 1IUEA 4LJZC 2ZXOA 1YIWA 4KY5A 1J6QA 2UXBQ 2B39A 1U4AA 3ABVB 4CBVA 1EWYC 1U4LA 2RCFA 2EIFA 2VZAA 2XRSD 4DHJB 1TYGB 3EN2A 1VDVA 4JC0A 4RFBA 4DDID 3E56A 4W9HA 3WA0A 2KVMA 3DXJC 3EJIA 4R4QA 3V2TA 5C4HA 4HIMA 4BY1H 4JE3B 1XT9B 4I6NB 1DJRD 3WALA 4Q5VA 2JXTA 3S2DB 3DCGA 5JJIA 1GHJA 1TQOA 5EPLA 1KH0A 2KQ7A 3P75A 2K14A 1LTLA 4CJ2C 4AYBB 5H92C 3J80c 3QWNA 2N8NA 1OQYA 1HR0Q 3T51B 1JCKB 2E5LL 2K8BA 3H1UA 4CJ0B 3VYUA 1N36L 1SE9A 2ZW1A 3H3VC 2HDEA 1ZXHA 1JMCA 1VD2A 1W2BA 1SYCA 1IW7C 5C3WA 2BKFA 1I4QA 1HA6A 1W3SA 2SEBD 2KCTA 1V5OA 1EY9A 1HNZQ 2L3ZA 1SYBA 2NVUI 3APCA 4W9CA 1R7SA 1TWHB 1YN3A 2I2YA 5IYDG 5CHVC 4K7UA 3TUOA 4G57A 3M63B 1WJ4A 4A93B 2A5UA 1MGSA 5HGQA 3ZDTA 3T3OA 2A4ZA 1I6VC 1GUAB 3EGRA 2ZVNA 2JA6B 1M1KC 2G45B 2VY3A 1CFMA 4IM3A 3C3LA 4MGZE 1NMGA 1WGHA 2MLBA 3CHBD 5IGFA 4BBRG 3HVZA 3ZJTA 1I7HA 2K4KA 1SNPA 4OVUA 1G2SA 2RVLA 3KLSX 4ZKCB 4L23A 1G2TA 3Q2AC 2E2IB 2PO4A 2B8FA 4M8NA 3F2BA 5C4XG 2DZMA 1V81A 3DBLB 5EE9A 4KHPQ 1FXTB 1AZQA 4JQWC 2L15A 2L11A 1R9TB 5CORA 3DHHC 1NCVA 5C5LA 4FJYA 1C77A 2Q2HA 5IYDH 3A9JB 3AU7A 4YWKA 2GBRA 2VB2X 3NJTA 1EIFA 3F8TA 3VHTC 4QY7A 3VR3A 3L2PA 3I2ZA 2ZTEA 5ELEA 1N61A 4C3IB 5M5YH 3NUCA 4GXBA 1I50B 5IN7A 4DK5A 2WDRB 2HIXA 1FGBD 4CDEC 1YJ1A 4AQYQ 4FP5D 1E8WA 4OGQC 2Z4HA 3V60A 3R93A 1R4MI 2MRPA 2F0EA 5IGEA 1WF9A 1DGJA 1GUNA 2IDYA 5C1ZA 3GTQH 4BBRH 2KFKA 1YQ3B 3K7AB 1QZEA 4O2DA 3HK0A 1N62A 1D5ZC 2CQOA 3G6EA 1IBML 1T0SC 1B70B 1Y1WG 2LGDA 3Q3MC 3KYCD 2K39A 1FM0D 2QEXA 5C4XH 3R7QA 2XIWA 4HDOA 4LJOB 4A90A 1EY5A 1PFMA 2FINB 4DR5L 1KD1C 2A19A 4QAYA 1TTNA 3PGEA 1RFAA 2Y5BB 1K8RB 2N9EB 1EY7A 3N1ZC 3QCAA 4RF0A 4YIJA 1EY4A 3BVGA 3QOJA 1EOVA 3L08A 3PLUA 4IPHA 2FHTA 1JRUA 3SR1A 1QQRA 2IHFA 1VS0A 2ZCCA 1TIID 3MVVA 3LWEA 4XQQA 2LMCA 2AUJD 1XLNA 2ACZB 1WXSA 3ZUNA 4X66L 3AN1A 3FKIG 4A3JH 4P16A 2RPVA 1RTOA 3I5JC 2N55A 4KLKA 1LFDA 5C3XA 1WGRA 3BJUA 5LMNL 4IUPA 1PGAA 5DNFA 1SF0A 1KFYB 2LGSA 3DQVA 1Y1WH 3NENA 4NMZA 4C3JG 2PTLA 2QF7A 4DV2L 2K5NA 2JF5A 5JPNC 1GUSA 2LEKA 5GAGC 1S5CD 1WOCA 4UP8A 4ZOHC 5AZFA 1IP9A 1GPXA 2KK8A 3PREA 4OL7A 1RDPD 2EJMA 1UWMA 3CMMB 3ENEA 4HPMB 1HJPA 2F52A 4NQLB 4KD4A 2QCPX 4RM8A 1PZID 4WQMA 2XEWA 4EZJA 1RCVD 3A4RA 4ZUIA 5FOBB 3EBEA 5IWAL 1N36Q 3APDA 1X9NA 1PFNA 5GAHC 4RM9A 2MQHA 1MD2D 1JB3A 2G9HD 4FF4A 3AM9A 2WX1A 2MWSB 5JJLA 4QMGA 2IGDA 4LLGM 4MH0E 1FYCA 4MACA 3CMAA 3VUWA 4EOYA 3S2HH 1LM8B 3QA8A 1ICWA 3NP8A 3DEOA 2SAKA 1PTOH 4KGRA 2KFKB 3FKIH 5GXGB 1IYJB 1T0QC 2M4NA 4M01A 1X32A 2KX0A 1YN4A 4DAYA 2UXCQ 2IZVB 4LCDE 1K9MC 4DV3Q 1S4ZA 4C3JH 2FCNA 3T9LA 2J7ZA 1SFOH 2FCMA 2F3WA 4G0NB 4IC7B 3IG3A 1I3QH 1WJUA 1PZKD 3KLWA 4ANUA 4CHKA 1K73C 2YV5A 4HJAA 2K8HA 5E6PA 3ZNGC 1RJTA 3U7ZA 2JT4B 3TJPA 1T5EA 1EQRA 2E2JH 1B9RA 3HOZB 1SYFA 4QIWB 4P73A 1BCPF 3LYYA 3DWQA 1WX7A 3KH0A 1ONLA 5C0XJ 2Z4IA 2HE7A 3IFTA 1ZE3D 3L0WB 2LZ6A 3MEFA 2HJ8A 3I91A 2PE6B 2GA4B 1RWSA 2RDHA 2UYZB 1SMXA 1KDCA 1VLBA 1SB3C 2BBCA 2GRIA 3JAMc 4PK1A 2NB0A 1IBKQ 1WD1A 3CKIB 5HI1A 2EYLA 4EQNA 3CC4A 2ZEQA 2W54A 2FCQA 3IKJA 3A8KE 3VR4A 5E6NA 4K5XA 1H9RA 5LL6X 5A2QE 4L5RC 2VUMB 2PE9A 1FD6A 2CW0C 1PRTF 2EYFA 3CCEA 4KKIA 1YQ4B 2DWQA 1P7EA 1UD7A 2YLMA 5EE1A 5JPMC 4KKSA 2PI2A 1VQLA 4RGNA 1ACCA 1FJGL 4C2MB 1KM7A 1YOVB 3FILB 3J9CA 1F9JA 5LLIA 3KDFB 1XTCD 1Z47A 3DHQA 1XMQQ 1E2ZA 4KSKC 4XGAB 4KMUC 2LUEA 4I7AA 4Y7NH 3UINB 1S3SG 1X6OA 2O4XA 4I7ZC 4DAYB 5NUCA 2F0UA 1EQVA 5D3IB 1J7BA 1P9DU 2JZ3B 2L1AA 4A3MG 2KLCA 1WFYA 2OQKA 4LW1A 1EL0A 1HUNA 2MUYA 2WU5B 4P7IA 2V4DA 4K5VA 1U4PA 3L3OC 2PEAA 4ARIA 4RMFA 1KF6B 5EKKA 2UUCQ 2KD0A 3NVYA 5CV4A 4X66Q 4N9TA 1QNUA 2OTLA 1XNQL 4LFAQ 3EFUA 4BY1B 2QSDA 1O7ZA 5JJZA 1MJDA 3OTOL 3WCQA 1SE4A 2RDGA 4HMJA 2KQ4X 4PS7A 3X3NA 3CCQA 2F0OA 2B2VC 2RD0A 4DV2Q 2M17A 3QARA 1R4MB 3R2IA 3U4VA 1RODA 2PJHA 4GN1A 3JYUA 4OWXB 4ZUJA 4HJ5A 3S9WA 3RN5A 2H89B 4N9F4 2GVAA 5IGGA 1N5WA 4DR3Q 1YI2A 1YMHE 1VMCA 3ND8A 1DYQA 2X38A 3CU7A 2KT7A 1ILQA 2E8GA 2K5VA 5IGDA 3L4PA 1EWHA 2M0AA 4RA8A 2C7HA 4A3MH 2ZTDA 4FHJA 4CO7A 5CMDA 2N7DA 1JJGA 1QUQA 2R7FA 4WWMA 2L1BA 5IT9L 1PTOC 4JI7Q 2MEKA 2R61A 4OZBA 4IKGA 1NMFA 1GC6A 4EKUA 5JHBA 3H91A 1UH6A 2LHDA 1Q0WB 2D62A 3CAMA 1I6HH 4WURA 2ALYB 4JBWA 3Q3NC 3H6MA 4MZ9A 1I94Q 4GDLA 4TUUA 4XT3B 4XTCS 5CV5A 1PHJA 2JZZA 2NPTA 5IA7A 3Q3FA 2E6XA 4KY6A 1V43A 3AV8A 3RR5A 4L5SA 3N6RA 1DOMA 4JLCA 3CSFA 4BKSD 3LB8C 4G3XB 3F2UA 1IBXA 2KHSA 2JSOA 4L63B 4HTHA 3AE9B 3O65B 4AYBG 2B2YC 3G7LA 3PF5A 3TMPB 2N88A 4Q2JA 1E2WA 4GLVB 4OEMB 1BR9A 4DGZA 2K5QA 1WI5A 1ZGUB 3NPPA 1P1AA 5EPJA 1UE6A 1BUIC 2JUOA 1P98A 2VS1A 4YTNB 4B0MA 1BCPD 3ZTDA 1TWAH 1QCBD 4MTKA 1XLPA 4A3OA 3DHGC 3LJ3A 2Q5WD 2BE5D 5J18A 5FK9C 3GB1A 5I2YA 3E9HA 1L0VB 3DDCB 5M5YB 3J80L 3WIMA 1WTRA 2M1MA 2R93G 1LTAD 1HZ9A 3MXPA 2DZIA 3BVMA 2WXRA 4WRDA 1IYUA 2LWPA 1L1OC 4POGA 4GSWA 3D6WA 4F88A 5ELCA 3SK4A 1DM0B 1WZ3A 4JG2A 3E0EA 1CTMA 2QMTA 4A3FH 3LGJA 4RG1A 1WTQA 1X54A 4PS8A 3FRPB 3GTQB 2G1EA 4BBRB 4R9WA 4MGYE 2XGTA 1K8GA 1E7UA 5T1GA 3K59A 1PRTD 3VH4B 5C6AA 1IPGA 3S2DH 1SNQA 3HGBA 4YHHQ 2JZPA 1NR4A 4O42A 2JQOA 3R8BA 2M2LA 3TEHB 1WE7A 5AUKA 5K5PA 2N0SB 2L52A 2WXFA 3TMEA 2W82A 3VYTA 5CC4A 3CCLA 5KYLA 5JVG3 2Q8IB 1QUQB 4GNXC 5AUIA 4JI1L 3ZJYC 4DXFA 3HP3A 4A3BG 2O6VA 2IWHA 1CKNB 3P20A 1ESFA 2I5HA 3OIPA 4DV7L 1HTQA 1CHQD 5DM73 4H13C 2R93H 3I7FA 4X64Q 4XT1B 3T3NA 2MHVA 5FO7B 1F0ZA 2K9XA 4DDGD 3W5OA 2NPTB 2ZPYA 1LYLA 1FVIA 2BA1A 4R4TA 1XPOA 1WXAA 3D3RA 4JW0A 2LI5A 3NSWA 4A3JB 2J0JA 2R2OA 3HVDA 2VB3X 1N34L 2JYOA 3RD4A 5ELOA 4NJ6A 4QB4A 1IBXB 1XPRA 3AE6B 1EQQA 3QWZB 3PLVA 5BR8L 4Q0FA 1ZYRC 1FEHA 1Y1WB 2EELA 3W1YA 4DHJD 1XNQQ 4IFDG 1GUOA 4L5QA 3ICEA 1EM7A 2JXMB 2NCNA 2PKOA 2F0WA 2L0FA 4DV6Q 3MTNB 4DAVA 4NZLB 4DPGA 4LF4L 3AI5A 3SXHA 2K32A 1J7CA 2RHQB 2DZKA 4MIUA 1GO3E 2RF4A 3I73A 3EA6A 1DZ1A 2IO2B 4JBJA 4NQKE 3JC66 3FMCA 4C4VA 1FFUA 2PZUA 1GUTA 3CMEA 4A3BH 4KKUA 3ZW3A 5EQ0A 3UQBA 3FVQA 3HOYG 5CV9A 4B3RQ 3S2HB 1C4AA 4GNXA 4OXPA 2JRIB 2BYTA 4IOIE 3OWEB 1PTOB 1V97A 2F0PA 1TWCH 1PYWD 3FKIB 2XWJB 1QILA 2KCMA 3A7LA 4KJNA 1C4CA 3MA2B 4RKLA 2ATWA 1WJNA 3L10B 3PPAA 4RF1A 4WWNA 3I63C 2Q8TA 1WX8A 2BYEA 1S5DD 4W9JA 4NP5A 2VXWA 1RIPA 3KLSA 1ZDXA 3NWTA 4C3JB 4ALPA 3S1QH 1JMLA 2VQFQ 1SFOB 1C48A 4G7HC 4IFDH 2KTRA 1PH8A 4S0RA 1X1MA 1WH3A 3QIJA 2K5HA 3A74A 1L4DB 3BIID 4FN2A 4W9DA 5JXVA 4JI3L 4ANXA 2D07B 3HKSA 5C23A 1I5FA 4PT5A 2E74C 1A2TA 2WLBA 3Q8CA 1GXDC 3A0JA 1PUTA 2O6VB 1QVCA 4MM3B 3BU2A 3CCUA 3FPPA 3BYYB 2BYVE 2HTME 1VZ8A 1I4XA 4GDKA 4V190 2QEJC 4MT5A 4N59A 4MJSA 2A73B 4BOZB 4B08A 2A6ED 4B3TL 3HOYH 4JI8Q 2BWFA 1QKZA 1D8LA 2F0FA 3OPOA 4P74A 2UUBQ 1V80A 3M7NA 2EYPA 2KHJA 1HZBA 3E9IA 5ISRA 4A75A 4GOPC 1JALA 1EUJA 4LUOA 1BT0A 2KWVB 4MGIE 3ZO5B 2G4DB 1VF7A 2I5MX 3Q8EA 1W6KA 3PTFC 1YHQA 4LF8L 2M9VA 3APFA 1STGA 3K58A 3GV3A 4KK7A 2WB1B 2AL3A 1DOLA 2J0MA 4IUVA 5EDSA 1FNVA 4DUZL 1FXAA 2Q2TA 3UI2A 5LMUL 3AB5A 5CR3A 2B2WC 1Z5SB 3NS1A 2DY7A 1B53A 4JI5L 5JEAG 4BA1I 4C4VB 4RNAA 4EFOA 4A3EG 2JVCA 2J52A 3URYA 2UU7A 1FR3A 4NDXA 4EGVA 1SIJA 4KDLB 4GS3A 2H1EA 2K5WA 2WDTB 4GNXB 4ITKA 4HAEA 2ZXPA 2Z9HA 4Y7NB 2EZVA 2EY5A 3B1LX 4FA6A 3HOZG 4PMWA 2G3QB 4LF6L 4C80A 1A70A 2BS3B 5IYBG 2K0PA 4BVUC 3AU5A 4IFDI 2WXQA 4P75A 2LFIA 2OJRA 1E0ZA 4DV7Q 4A3GG 4MGKE 2VRRB 1OFFA 2IGHA 2KTRB 1WTHA 5BN4A 3A5UA 1VQ5A 3R3MA 4XE0A 1UEAB 1K8MA 3AH7A 4N6EB 3EIVA 1VQ9A 1FFVA 2N1VA 4B3SL 3ZXVA 1GAQB 4WAFA 1RM6C 1EQTA 1LTID 1TXYA 1N34Q 5K36G 2W9NA 4AOFA 2D9UA 1JE5A 5C3EG 3CCRA 5BR8Q 1HZ6A 2PW9A 2B2TC 2Y5CA 3NVZA 5JEAH 2F4VL 1K0SA 2CWPA 4A3EH 4G11A 3T1HL 4GDKB 4ZRIA 1RTNA 4DKAC 2WXJA 3JAML 1U0LA 4MJSB 4TQ1A 3PV0A 4URKA 2NVQH 1E7PB 2DYBA 1H8CA 3RULA 4L2YA 2K04A 1J19A 1CA6A 1Q90A 2CHBD 4XDDA 3HOZH 1WI0A 2LXCA 3EUB2 3SD5A 3ZQ4A 4B9XA 5IYBH 1WRIA 1KRTA 2HTHA 2CFMA 1WCMG 1LGRA 4A3MB 3AE5B 1B44D 4A3GH 3KF8A 1IW7D 3RNCC 4W9FA 2R6GA 4BY7G 4UAIA 2NZHA 4BBNC 4IPCA 1IBLL 1UZXB 2K25A 4JI4Q 2L12A 1HTOA 1UAPA 5K36H 1Q1OA 4FXGC 1YN5A 2B63G 3G4SA 2GBNA 2MX2A 2WNMA 1SE2A 3H7PA 5C3EH 3DVNV 4H02A 1QVGA 1VCBA 1Y69U 1C78A 3KYDD 4DV4L 5LMNW 1JICA 1AN8A 4K2LA 1OO9B 3HOXG 5KHOA 1PV4A 2L32A 3UGBB 1VRAB 2KDBA 2N4FA 2N7EA 4XXEA 1G6PA 2VH2A 2B2TA 1ZP0B 5D65A 5HURA 4WJ4A 1VQOA 2HHHL 2IBIB 2K33A 4YTPB 1NTGA 1TWAB 2PPBC 1EZ6A 3J81E 1E1TA 3EVQA 1WCMH 1AH9A 2ON8A 2DYMA 4GLAC 3W5VB 1I4HA 2NZOA 3F2CA 1PA6A 4GZYC 3HKZG 3TSSA 1F9QA 4BY7H 4DR6L 4LK0M 5FLXE 5J39A 3CXCA 2BDOA 1UF0A 2NBUA 4AYBE 1GOZA 1L2FA 5IOCA 4GOPB 1Y8PB 5AJ3L 3J7AF 5IY0A 1SBBB 1EWIA 1SXTA 4K6LA 3ZYYX 3BS1A 4A3FB 2B63H 1T3QA 1YQBA 2KX3A 3QK0A 4BZAA 4DUYQ 4ODGA 1Q12A 1SROA 3J7ZC 2EY1A 4FULA 3A4SC 1Q1EA 2D2QA 2FMCA 5ELFA 1TKWB 3QQ8B 1RYJA 4FLHA 1TR5A 4P1CC 5BN3A 4LF8Q 3GTLH 1IHZA 2QC8A 5I9OA 3HOXH 2FMMA 1OXVA 4J6HA 1WWTA 2AKWB 4KX6B 4MEMA 3U8ZA 3FDTA 3TEWA 5M5XH 1OGWA 2D11A 3PUWA 4NPSA 2KJXA 1WJ6A 4JI5Q 2UXDL 2PZWA 4FXKC 2F0IA 2F0HA 2KJ6A 3UDFA 2FCSA 2KDIA 4DR1L 2MBHA 4YSYB 3KF8B 1PH1A 3BINA 3UIPB 3RN2A 3M4QA 4ILWA 1X3GA 1A5RA 1PLFA 4GKKL 1ET6A 2KMAA 1RRBA 5E7NA 1Q86C 2I07B 3D31A 4II2B 4XYCA 2R93B 4NAWB 4FADA 4KN4C 1K3BC 1XX8A 2KNBA 1LT6D 1MKHA 3S2AA 3RNBC 4XIGS 2K5PA 2XNAC 3KLRA 5KRUA 2RDFA 2KTFA 4K5WA 1E7VA 2OXPA 3SK5A 2VZKB 3H7PB 5EGTA 3PIOA 3GTKH 3BY4B 1LO5D 3MP9A 3N1XC 3NVWA 1VQDA 4S17A 1C8CA 3H7SA 1IGCA 2NYZD 2AEHA 3PZDA 4HDQA 5HG2A 1XNRL 1NE3A 1PDXA 3U58A 2INNE 3NEMA 3IT4B 4YT0B 3VUYA 1WIAA 4AWJA 5L95C 3K5MA 1VJKA 1UE1A 3B2FA 4OZAA 1HNWQ 2IGGA 2QDFA 1STHA 4KIKA 2UUAL 4AJYB 1ET9A 1HFGA 1PFSA 5BN5A 2ZVOA 1F2YA 3LXFA 4US9A 3VTUA 2O2VB 4RWSC 2F4VQ 5KGUA 1FCLA 3PRPB 2WXNA 1X3EA 1SN8A 2F4IA 2NZ1D 5G55A 4J3OD 2SOBA 3TEXA 2HCCA 2IJ0A 4WFN3 1Q82C 3AE3B 2XWBB 4ZAIA 3WWVA 2MQJA 4A3BB 1EEID 3A5ZB 1KLVA 2R7ZG 4NXML 5KHQA 2KO3A 2ZNVC 3T13A 4HCNB 4ASWC 1L5PA 4OZCA 4HKZE 2PMZB 5LXIB 1F2RI 5IP4D 1E8ZA 4ZKBB 3TZDA 5J22A 2LGYA 3A1QA 1TWCB 4OVZA 2B8GA 3E3XA 3K6OA 4BKGA 4MELA 1PDQA 2MBOA 1BNZA 3FC4A 3ZRCA 2A6HC 1H9SA 2CH4A 4A3JG 1WGGA 3N30A 4OIJA 4UHVA 3B2GA 2KZRA 3HUIA 3ZNID 4QL5A 1WR6E 3K9PB 3S1QB 1LT3D 2EJFC 4DHZB 2ICEC 2GVBA 5E6JA 1I4RA 4DNRB 2WP8J 2M0XA 1WY8A 2MJDA 4DXAB 1H95A 1FO4A 3MC9A 2C35B 2LY7A 4X62L 1GM5A 3NBIA 3H6NA 1YJ9A 1BOSA 1PYSB 3Q3OC 3PUYA 1C7YA 2BW2A 4XQJA 1NENB 1P8LA 5IP7G 2LUMA 2A8VA 1QOBA 4LFCL 1STBA 3AEEB 4ZRQA 4QQBX 2WS3B 4IN3A 4KKTA 3RZFA 1YNNC 2K50A 1UGMA 4XWWA 2B29A 2R7ZH 4WQOB 5JOBA 4S3SA 3RLOA 3HOYB 2KN4A 1MIUA 3V3XA 1B7YB 2Z6KA 1HFNA 4NB3A 1ZXIA 4CKBA 2VL6A 2X69A 3ZXRA 1U4RA 2OQ0A 5ELDA 3TBLD 3K57A 1JJ2A 4AP4C 5D14A 2IO1B 2D5DA 1STNA 3H8HA 1OEYJ 1EIGA 5EE3A 4K0KL 2GBKA 1WXMA 2WXPA 1V1OA 3PUZA 1OTRB 4YL8A 4RCNA 3AE2B 4KIKB 3S1RH 5AJ3Q 1QWYA 1N33L 2JRHA 3Q3JA 2EQSA 4X3KA 1LTSD 1BUVT 2KDFB 1F2RC 1PYBA 2JK8A 3NHHA 2N9LA 3VXWA 4DWFA 2D10A 2AUKA 2IY0B 1DOKA 3S16B 5JZEB 1J9OA 1A0IA 4DAPA 4IUQA 2K22A 1B50A 1WSPA 4YSZB 4K3BA 1F9SA 1V8QA 3A54A 4RH6A 1KQSA 1PFDA 4ZDVA 5IP7H 4B95A 2KHWB 1BBUA 3MZ5A 5IGCA 3AEDB 4KTAA 2E5LQ 5J17A 3EFCA 3CRKC 2CW0D 2IX0A 1JC7A 1SYGA 2GLSA 1LM0A 1FPYA 1JOQA 3AEGB 3K5NA 4R8NA 2PVGC 1F1HA 1A3UA 1XJVA 3IBEA 3DMUA 4ICUA 2FIFA 4PZ8A 3P4QB 1XWEA 2G5DA 1H9SB 5J1ZA 3I55A 3S14H 4GKKQ 2QW7A 5I6YA 3QHTA 4M8MA 1K53A 1RHPA 3G6JB 1RF2D 1PZJD 2HDMA 4R4IA 1F77A 4UY8C 1PH7A 4IQZA 1LTBD 3DPDA 2WXGA 4ZRKA 1J5EL 4TV3A 2BCOA 5M3FG 1N63A 3BK2A 1NR2A 3JW0X 2KCCA 2B2UA 4NKLA 5HY6A 5CV7A 1SRUA 1HNXL 4ZRJA 3MTSA 5DPSA 3W5UB 1KOTA 5C44G 2WB1G 3TDQA 1A2UA 3HM6X 4QIWE 2MA9B 2NN6I 1FCCC 2DAFA 3WAPA 2KMCA 1KTKA 2FUHB 2CH4W 2AWNA 3KJOA 4IWQA 4A3EB 1L0YB 4B0EA 3ZJUA 4N9PA 1E9MA 1J0GA 2QA4A 3IT6B 3E5SA 1B9NA 2WACA 1ZEQX 2WKDA 2Y3AA 1V9PA 2ID0A 1IXRA 3EFXD 2NVQB 4FXCA 5CHWA 4A3LG 3UDIA 4OHJA 1JOOA 3EROA 1SNDA 4LWCA 2IL8A 1V86A 5E6OA 2LMCB 5E3FA 3TP6A 1I4GA 3N32A 5DPWA 2A74C 2K75A 2ZNVB 2JE6I 4KI0A 1WR1A 1XMOL 4A3GB 1FRRA 3DBRI 4UP9A 3ZNHB 4H44C 2ENBA 4EZLA 1EY0A 1STAA 4PMCA 3AEAB 3I70A 1L0WA 1CA5A 3RI7C 4X57B 4YWMA 3BVZA 1Z2MA 2EYJA 4ACFA 5M3FH 2PNHA 5J3BA 1DCZA 2IW3A 2IX3A 2NVTH 5C44H 3M4OH 3L0OA 2AMCB 4WJ3M 3OWFA 5C3EB 5KNDA 3HM3A 1V1QA 2JQRB 5T1IA 2EOTA 3NQIA 4K8JA 1YD8U 2ZJDA 1TU2B 1ZW7A 2F0NA 1BBXC 3M4PA 2PNRC 3MXNA 1IBMQ 1XO3A 2MFIA 3B6YA 3E0JA 4GLXA 1BMLC 2ONQA 2J4XA 1VZ7A 4TRDA 4X62Q 4A3LH 3VTWA 3MWYW 3ERQA 3Q8AA 4LNKA 1F2ZA 4DR5Q 1SGHA 3W1BA 1HH2P 1IKLA 2YU9H 1A62A 3D8GA 3CC2A 4LFCQ 4B3ML 2KAJA 3RYTA 3NVVA 1WCMB 2WKCA 2R2QA 2RDBC 1MI2A 3H94A 4JGHB 2BYFA 2O5IC 2AWTA 1EY8A 1KDBA 2OJWA 1HCZA 3NHEB 4BY7B 2V4LA 2KVRA 3AQQA 4XC2A 3NOBA 1M90C 4AJWA 2A69C 2BB6A 4LF9L 2YEPB 2C9OA 4RMAA 1SLJA 2WYQA 2BTEA 1WM3A 4XQNA 2Q2UA 1MG4A 1ESRA 5CTRC 2EPBA 2B63B 1ENAA 4XX5A 2LASA 1K8OA 1PGBA 3GE3C 3NS8A 1IZ6A 2DZJA 3GTLB 5KIXA 5LMNQ 3I9V1 3PS6A 1EYGA 3TEYA 3HOXB 2DNCA 1QNKA 1MI0A 3FKYA 1O7YA 2NVYH 2DYOA 4A3DG 3DWGC 3K5OA 5GMVA 3HKZE 5M5XB 5IO9A 2FAZA 2MO1A 1HHVA 2N78A 3U7DA 1MHHE 1E3PA 2K28A 4YCVA 3UQAA 4AS1A 3MHSD 1VDZA 3BDCA 3T4AC 4RGMA 1P3QU 3CIRB 3V05A 5D7GA 4JL9A 4JK1C 3AE7B 4A76A 1EYDA 4DK1A 5IWAQ 4DR4L 3LDZE 3AYHB 4JI0L 2WGSA 3HKZB 3KUCB 2AL6A 2F1MA 2KOXA 2PI2E 4HSPA 4LF5L 3GTPH 4JYAL 1SR3A 3P2BA 4BKTA 1VQEA 4K14A 4DFAA 4IG7B 4WIPA 3VDYA 3GTKB 4GN5A 1IYVA 2KYWA 4JIOU 3D6CA 4KHVA 4HVBA 3C0RB 1Q81C 2BVCA 4A3FG 1V8CA 1OTCA 2CS4A 1X3FA 3EC8A 2IO0B 2BGFA 1O78A 3KF6A 1Q8KA 5DAUA 1QOFA 1HNXQ 3LX0A 1WYGA 4A3DH 4I6PA 1YJWA 2MNAA 1UELA 2LJIA 5JHAA 2OEDA 2HDLA 2NTSA 5C2TB 4R4OA 1WTWA 4J6IA 3AE4B 3BZDB 4TKOB 4HLEA 3C1FA 1TT2A 1GB4A 3RZDH 1CZPA 1F2LA 1V1PA 3MJ5A 4DAMA 2OT2A 1E8YA 3NG0A 4IW0A 2LHEA 2OHFA 1G6JA 2F0GA 1OXTA 4GB9A 3MJWA 1A3TA 4HN7A 2FNJB 2EYMA 1LTRD 1S3OA 1SYEA 1T6BX 1Y8OB 3DVNU 1CHPD 3GTJH 3CCJA 4KZ0A 1QZHA 5BYQA 3RN9C 3IAS1 2E2HH 2Z0DB 3OW2A 4JBKA 1PGXA 3NZ3A 2RSNA 1XMOQ 4DK3C 4KZCA 5EKLA 3GTMH 3NUHB 1LACA 3RZOB 3RPFC 3DWPA 1NI2A 3TP8A 4L1BA 4TQ0A 3D32A 1CKMA 5CV6A 5EJWA 1G291 1C1YB 1E0BA 1EIYB 2KC1A 4K81A 1VQCA 1HUMA 4US8A 1Q10A 3UE0A 1VQHA 3IL8A 1EFID 1PH9A 3ONSA 4JI2L 4BBNF 3I90A 3CCMA 2PLPA 1XEEA 1FD7D 3FPUB 5KEEA 3KVFB 1LTGD 4K7SA 1YJJA 3QAQA 3N3KB 1F9RA 3UF8A 3CCVA 4ZRZA 2KC2A 1K50A 1FJGQ 4U68A 3A33B 3P4RB 1CT1D 3V96A 2N9PC 2QIEB 2R7ZB 5LNK1 2M56B 3VA5A 2LS01 3GTOH 3HOUG 2KQ3A 3KJPA 4OX9L 2WFWA 1YVCA 4LUZA 4GDLB 4WWPA 3ERSX 1N9WA 5CHFA 1WYDA 4IO9A 1DOYA 3KUZA 2JA7G 3DOWA 4ANWA 2KEEA 1STEA 2CJOA 1FNUA 1UEBA 3VQIA 2N3SA 3A8JE 2JWUA 1NDDA 2LXJA 3S1RB 1EU4A 1T5XD 4M0WA 1FMAD 3EQLC 1Y1VG 4J15A 3TN2A 2IY1B 3CW2C 4DA2A 4GIVA 2MW5A 3HRDD 5CX3A 4ZK9B 3VR8B 5JJKA 1F52A 2CCZA 3DBRB 3P63A 1VQBA 2A68D 4IJLA 3QOLA 2JP1A 3OTOQ 4IZ8A 4CJ1B 5JH5C 1JR0D 1Q1BA 3EECA 1V1PB 2FXQA 1YEZA 4DN4M 4EQ5A 4XZ4A 2W3RA 3L13A 3I4NG 1A15A 3U9SA 2WWZA 1KLGD 1L0XB 4GOCA 4P6VF 1QT9A 2J7QB 1B4OA 2ES2A 2K03A 1CZWA 5FR3A 3SHLA 4HR7B 1QG7A 2F0VA 4BA2I 4GGQA 3HOUH 1VQFA 2EXZA 2CKZB 3RNFC 4NAMA 3VVWB 1NSNS 1Q8IA 1TT5B 1VMPA 3TS2A 4IUUA 4DR4Q 3S14B 4KDIC 4ABNA 5FKAC 3S1NH 3NELA 1GG3A 3PZ7A 2JA7H 4F87A 3UDGA 2DENB 3NQTA 1HQRD 1FRDA 2MO0A 4LF5Q 2SNSA 2BE5C 2SDFA 4YCUA 4JBMA 3P4SB 4I6LB 2ZM6L 1LTTD 2HCIA 3NBHA 1SIFA 2L7RA 1Y1VH 1KNEA 2EMSA 2QCZA 4ME5A 5AZGA 3R66C 2LSSA 3G71A 3J7YW 4WJWA 5IAAC 2R92G 3H09A 1SE8A 2L5TA 2WXOA 3AEVA 4KGSA 3BG3A 3Q0AA 2I0QA 1QOAA 3I4NH 2JPHA 2GB1A 3OJ3A 1K3RA 4NXNL 3RNGC 3ZIMA 2E76C 3PRZA 4A3PA 4BOSC 5JAVA 4LTUA 1NVID 4ICVA 2N1WA 5A2QL 4YSXB 1WVLA 4M02A 2JEBI 5L83A 2MBEA 1JWAD 1OXSC 5D3DA 1C0AA 1LV9A 2BKRB 4X3UA 4YXDB 1NYQA 2C60A 2BS2B 4FO2A 2G4SA 2LJ5A 4BKSA 3OG5A 3K5LA 4R3DA 4C56C 2VH1A 3L7ZC 1C9FA 2WB1E 4LF7L 3S1MH 1BO0A 1X56A 1OQQA 4JWUC 5I4DA 1HXYD 1JWUD 3U30A 3CWIA 1LT5D 1TKYA 2RQXA 5AFWA 2WAQG 2L9HA 5M3FB 3QC8B 2B76B 5C3JB 4AH6A 2BQQA 3OYYA 1DONA 2F0TA 3M4OB 1VQNA 5C44B 2NVTB 2DAJA 2K6DB 4PS3A 2R92H 1ZPSA 2L0CA 3R3OA 2JSVX 4X3TA 3VUXA 2FFKB 3K9OB 5BMIA 2XSCA 1STYA 3Q23A 4CDCC 3S16H 3KBGA 4HKQA 5ELNA 3ZDMC 2L83A 3L16A 3M4YA 2QDLA 2N7JA 2RR9A 3J81c 3OMGA 3E9SA 2WINB 1D3ZA 1ZXTA 1WXQA 2CWAA 3GO5A 3VR5A 2YU9B 4CQNA 1MG8A 1SJED 1GKHA 1SMYC 1VF5C 1CM9A 3KUPA 4JI1Q 2GI9A 3TREA 3Q6SA 3MAQA 3MHZA 4EZKA 1HR0L 3MC8A 3FAHA 2RKSA 3TEZA 5I2XA 4OX9Q 1RL2A 1GNUA 3Q8DA 3N9YC 1TWFH 1YNJC 3ER0A 5IIFA 4P71A 4CKCA 3DHIC 1HNZL 1WTPA 3TZUA 2K6AA 1H4RA 3MHBA 1RKNA 2OWOA 4IJHA 2H4OA 4HIDA 1IKMA 4RHRA 4FBJB 3RLNA 2EXDA 4IOCA 3VTVA 1Q3LA 1N60A 1C9OA 3N52A 3Q69A 4CDFC 3U4ZA 2YEPF 2NVYB 4PZ7A 2J42A 2HD5B 3DM1A 3G48A 1HE8A 1IL8A 2W55A 4KV2A 2K6QA 5H8YE 3HOVG 4N58A 4ZHOA 3KFUA 3VYRA 3M85A 3ZVVA 4JPBW 4G4KA 1NUCA 4LF4Q 3BK1A 5TR5A 3MC0B 3V6CB 4KGTA 1TJEA 1BKBA 1V2YA 3RUZA 4LNNA 1YITA 2V1CC 1WZ0A 4KN7C 2AX5A 2FUG1 3PZ8A 1ZKOA 4ULLA 4PV1C 2IX1A 1FIQA 3PUXA 1TS5A 1MHXA 4K6DA 4RHSA 2NMQA 1X65A 4CDDC 1Y8NB 4IOAA 3GTPB 3AE8B 5AZHA 3HHMA 3RD2A 4L8JA 1VQ6A 3V62A 5MPOA 1E1OA 4KHPL 2J53A 4XYOA 1GHKA 4ZRPA 3KOJA 2JX5A 4O1NA 2Z6BA 1GJXA 1R4NI 3N1YC 3J7A5 3U50C 3W9CB 2PQEA 1S5ED 1F2MA 4FHKA 4RAUC 3RMHA 5IODA 2C9WB 2EKEC 1XLQA 4KSLC 1JQYD 3GS2A 4A3KG 2KA7A 1V6EA 2ZM6Q 3VA7A 2JXXA 5C5MA 5J2RA 1R4QB 2M00A 1TKEA 2RPQA 3MXUA 4HK2A 2QGQA 2IT1A 5HKHA 3BZCA 4A3DB 3M62B 2MJEA 4AQYL 3DVGX 2X6GA 2Y0SG 3HOVH 2VQEL 4JI3Q 2GN5A 1YJNA 3VRAB 3BYTB 2EDGA 1JE4A 4GKJL 1D1IA 1H9MA 1VQJA 2ZCBA 1ASYA 3CSTA 4HJGE 4MSMB 5EE0A 3RZDB 2EJGC 1J8CA 3ALBA 4BFRA 3A56A 4H7BA 1SDFA 3AU4A 5IOIA 2BOSA 1S40A 2R7DA 3AMZA 3W1SC 4EQOA 1EZ8A 2JYTA 5IGBA 3DUZA 3PUVA 3GTJB 3PO2G 4B3TQ 1L7YA 3I72A 2LXAA 2E2HB 4PMBA 3HOWG 4LF7Q 2PZTA 2WIIB 3GTMB 3HS0C 4PYUA 4WAAA 4QUFA 3AEFB 1IL2A 2F3IA 4A3KH 4DNIA 1ROEA 2PMVA 2NWGA 3KW5B 1JW9D 1ML0D 1RD9D 1LXDA 3QJZA 1N6ZA 1N8RC 1D5XC 1YNXA 2Z1CA 1YJIA 1LQBA 1XCQL 5GQOA 3PQIA 4ARCA 4GMVA 2A6HD 1WGKA 4DUZQ 5LMUQ 3K0XA 1C79A 3A9JA 1MFWA 3GZNI 4LAAA 2L0TA 4IM2A 1KRHA 4QF4A 3C46A 2CJNA 5M3MG 3STBC 3V6EB 4O0AA 3IHPC 4E71A 3Q6BA 3I4OA 1KHIA 3GTOB 4HJ8A 5BYRA 5CYUA 2I5LX 3PO2H
chains in the Genus database with same CATH topology
2KOLA 2WXMA 1TZOA 1YNND 4XDXA 3W1SA 1ENCA 2CVRA 1SE3A 5EBDA 1SNCA 4OW0A 1X3PA 1TS3A 2G9DA 3I8ZA 2WDQB 3MFYA 1UUPA 1E2VA 5CGKA 3P1MA 2MH7A 2WQYB 3I3CA 3GP7A 4G7ZC 1M8AA 1HQMC 4FVMA 5FO9B 5DEHA 2LKVA 2V4IB 4OIKA 2K05A 1SSOA 4FF2A 4XDCA 2HUGA 1EOTA 3NTKA 4ZLTF 3HOUB 2NN6G 1PXUA 3IAYA 1M4VA 2YYZA 2VNUD 4U673 1QE6A 2Y5PA 2L4NA 3S1NB 2JA7B 4HCEA 2EY2A 2NTTA 2BDNA 1O7LA 3LWUA 3AMUA 3AE1B 1Y1VB 1MVKA 5IT9E 1Y56A 3KQ4A 3P1HA 2PW5A 2EVBA 2K1BA 1PTOF 2ZT9C 3SFEB 3E6ZX 3SEBA 3SK6A 2F0JA 1SSNA 3PIO3 3I4NB 1DOIA 2CQAA 2JYEA 2F0DA 3MXGA 3DWMA 1A3VA 2BB5A 2TMPA 4HMIA 5KNCA 3D4WA 2NN6H 4CKEA 2ZW0A 1EWCA 2BS4B 2MGSA 1K51A 2N9KA 5HFYA 3HRZC 4DNTB 2KWDA 3S1MB 1C76A 2HQEA 4EVOA 3T16A 3WOEA 2B2UC 4K8IA 1G91A 4MH8A 1EEFD 2XN9C 3J80E 2W3SA 5E4WC 4XYQA 1OXUA 1VZ6A 5TSSA 2R92B 5CV8A 1NEKB 4KKJA 3NTIA 1TY2A 4KY7A 3IXSA 4RGOS 1D5MC 4ZYSA 2RA4A 1CI3M 2E2DC 5HHDG 4EE2A 1QB5D 2X6LA 1L6VA 1MBYA 1B3AA 2KDMA 1CK1A 3OHXC 3NTHA 1MSGA 2WU2B 4DF7A 3FEWX 1TWFB 1G6ZA 1HRJA 5G5GA 2WAQB 2M19A 2RMMA 2PCFB 4NW2A 4KV6A 1K52A 4HCSA 3SK8A 1KAAA 3O13A 4MHEA 5M9OA 4C3HB 1QOGA 3FILA 2A69D 4TQUS 2AQ2B 2PYKA 3ONAB 3OIQA 5CBEE 2MPMA 4X3SA 4F7XA 4A9AA 1A6XA 1RFKA 2F0KA 2D2CC 1N5XA 3W2DA 5C4ZA 5E1FA 1PFBA 1NI3A 2FBWB 1AFPA 1I4PA 4J8QA 2LGIA 2NBFA 1BF4A 3J81L 3VRBB 3ZGZA 1XCTL 3HG9A 4E6IA 5FLXL 1PTOD 2K3UA 3PO0A 1WTVA 3U9OA 1H9KA 2V3PA 4FXDA 4C7ZA 3HOVB 1AW7A 1L6UA 3C1EA 1PMRA 4A8XC 5G5HA 2ZXRA 4D2KA 4QUCA 3QG1A 5BMHA 1B9MA 2OF1A 2H88B 1XYIA 5JVH3 1D2BA 5KNBA 5HGTA 1IGDA 2BT6A 3AECB 4CGYB 3BDOA 4RKBA 3RLFA 4C1NK 3LNNA 1UGJA 4FF3A 1OXXK 2CU3A 2EY6A 1HPCA 2AWOA 1B1ZA 4JWSC 1F9PA 4A3KB 2DN8A 3CQZB 4HEDA 1JROA 4HRSA 1VR9A 4MN3A 1JRPA 4AQ7A 3MFGA 1P7FA 1C4QA 4BWGB 5BYSA 2RSOA 2Y0SB 4HSVA 3D4DA 2F3VA 1HTPA 2PVOD 1KDAA 3U4EG 1SAPA 4REZA 1JWBD 4M8AA 2J0TD 1J7AA 1G8ZD 1FXIA 4C1NI 4DXGA 1C4PA 1GB1A 3KBXA 2IPKD 3PO2B 4FYDA 5C0XG 4IUTA 3M7GA 4V0BA 1OQRA 3HOWB 2INPE 3A7AB 4LMQD 3GQBA 1CQFA 1HZ5A 2WP9B 1D4BA 3NWSA 2FE8A 1K83B 3U52E 1SNOA 5LL6S 4TSSA 5FO8B 3NK9A 2V0GA 1LLRD 4R8IA 2KCNA 1LABA 3WOFA 4P2CB 4L6TB 1DD2A 3VR6A 1DXMA 4KD3A 1XLOA 2K5DA 1ZYRD 1S5BD 3VYSA 3GV6A 5M3MB 3T56B 1AEXA 2K7VA 1UNSA 3GD7A 3I4LA 1EY6A 1QOHA 4XWTA 1Z7TA 1WTXA 1BXTA 4WH4A 3JAME 2PIAA 5C0XH 4IFDJ 4YWGG 4C7YA 3SDZA 3L9AX 3VR2A 2AQ1B 4ZHPA 1Z6HA 2MJ8A 3W3AA 1JWSD 2Q8RE 2FJ2A 3WDNA 4RGTA 2C5CA 2B2VA 1UWXA 2O2LD 4DU9A 3BWUD 3IAM1 4G7OC 3QO2A 1SNMA 4I65A 1QLBB 2E75C 2MP1A 3TP7A 1CQVA 1TWGB 2A5HA 3M3YB 3QB3A 2KACA 1DOXA 3OW7A 1W6JA 4J1MA 4LK1C 3X3MA 2EYOA 1BDOA 5F2DA 1S5FD 1EIHA 3D4RA 1GUGA 1JWMD 3TBIB 1B2TA 4A6QA 5C4XB 1LT4D 2F0MA 4UDUC 1MPEA 5G3LF 1TKGA 3Q8FA 5T8IA 3J7AV 3SVMA 2DBYA 1U4MA 1X3QA 1R4PB 5COYA 4OO1G 3NXWA 2B2YA 1D1KA 3A55A 3C2PA 2LFNA 3NE5B 2F0SA 1SEBD 5C4JB 3NRZA 5C0XI 4C3IG 4BS9A 4FF1A 1XF5L 4EQPA 2O5JC 3PIP3 2WXIA 3I57A 5BMGA 1U9RA 4FNFA 4ID6A 4GLSC 1BCPC 2JU6X 3VR9B 5JEAJ 1ZDVA 1TVXA 1JOKA 4NJCA 3DEPA 3ZJVA 3OSOA 2ICIA 1AP0A 1ZOYB 1SMYD 3AB9A 2E3TA 5EKIA 4OO1H 4JPSA 2K01A 2R3ZA 1YNTE 1MSHA 1HTLD 3GTGB 5KYIA 2XVSA 4B9WA 2JA5B 2MJ3A 2VZKD 2AQ3B 3Q22A 4CHTB 1YNJD 3A8IE 2OEOA 1AWDA 2QJLA 2I38A 1PRTC 4PNYA 5DM63 3P4PB 4M1UB 3Q8BA 3S15B 4K2KA 1II3A 2EE1A 2F0QA 4HEA1 1NYRA 1JORA 2I46A 1O80A 3H0GB 4USAA 1CJEA 3T53B 1I3QB 4QCLA 1ILPA 1QF6A 1AZPA 1E6EB 2WDVB 5CBAE 1BQQT 1ENFA 2E2JB 3ND9A 1TS2A 4C3HG 2D5GA 5A35A 1QJOA 4Z9CB 5M5WB 2Z8LA 1TS4A 2NVXB 2F0LA 4ZQ3A 1J8IA 2EKIA 4KHZA 3S17B 2A68C 2WXLA 2KEDA 1EU3A 4H0LC 2QKIC 3KK7A 3HEJA 1AYFA 4OO1I 2JEAI 2JA8B 4DQOC 3ITPA 2QDBA 5G3LD 3IFDA 1E10A 4A3IB 3C8YA 3PMFA 4RCOA 4IURA 1L4ZB 1FNWA 2KECA 1CZGA 4PQXA 2V3NA 4TMAB 1D6EC 5EPKA 2NUCA 5ELBA 3QIAA 2PW7A 3HZXA 3BDLA 4JX1C 4IDIA 1KNAA 2F03A 2WXKA 2TSSA 3SR6A 5LHY1 1EYAA 3DWAA 2DLBA 1SYDA 1NAPA 1HEZE 3P7JA 2XRQD 2DY8A 3MEHA 2DNEA 1SJHD 3U2SC 4H2AA 1BCPB 1XXGA 1VCIA 2A6EC 3P42A 3ETRA 3I4MB 5I9PA 3SE0A 3R2TA 3Q24A 4A55A 2B2WA 4IUNA 2KMMA 1WD0A 3K0YA 3KWLA 3SFDB 2SNMA 5E4XA 2EYHA 4YTMB 1H9JA 1PRTB 3PO3B 3CRLC 1I6HB 4IALA 1KLUD 2KUMA 3OOCA 4F8MA 3UI3A 5I6WA 3AEBB 3RFZB 2WXHA 1HA5A 3B9JA 1GUWA 4HROA 1EYCA 1ZUD2 1JQ4A 2QILA 4KJOA 4DK0A 3TP5A 1WTOA 2WV6D 5EBCA 4BBSB 3OMCA 2RBMA 2BA0A 2L55A 1TY0A 3KWVA 4WORA 3QJYA 1KABA 1IUEA 4LJZC 2ZXOA 4KY5A 2B39A 3ABVB 4CBVA 1EWYC 1U4LA 2XRSD 1TYGB 1VDVA 4RFBA 3E56A 2KVMA 3DXJC 3EJIA 3V2TA 5C4HA 4JE3B 1DJRD 4Q5VA 2JXTA 3S2DB 1GHJA 1TQOA 5EPLA 1KH0A 3P75A 4CJ2C 4AYBB 5H92C 3QWNA 3T51B 1JCKB 4CJ0B 3VYUA 2ZW1A 3H3VC 2HDEA 1ZXHA 1SYCA 1IW7C 5C3WA 1I4QA 1HA6A 2SEBD 1EY9A 1SYBA 1R7SA 1TWHB 1YN3A 2I2YA 3TUOA 4G57A 4A93B 3T3OA 1MGSA 1I6VC 3EGRA 2JA6B 1CFMA 3C3LA 3CHBD 5IGFA 3HVZA 3ZJTA 1I7HA 1SNPA 1G2SA 2RVLA 3KLSX 4ZKCB 4L23A 1G2TA 2E2IB 2PO4A 2B8FA 5EE9A 1AZQA 2L11A 1R9TB 5CORA 1NCVA 5C5LA 1C77A 3AU7A 2VB2X 3VR3A 5ELEA 1N61A 4C3IB 3NUCA 1I50B 2WDRB 1FGBD 4FP5D 4OGQC 2Z4HA 3R93A 2F0EA 5IGEA 1DGJA 1GUNA 2IDYA 1YQ3B 3K7AB 1N62A 1D5ZC 1FM0D 2XIWA 4A90A 1EY5A 1PFMA 2FINB 1EY7A 4RF0A 4YIJA 1EY4A 3BVGA 3QOJA 2FHTA 3SR1A 1QQRA 1TIID 3MVVA 3LWEA 4XQQA 2LMCA 2AUJD 1XLNA 2ACZB 3AN1A 4P16A 2RPVA 1RTOA 2N55A 5C3XA 4IUPA 1PGAA 5DNFA 1SF0A 1KFYB 2PTLA 4NMZA 4C3JG 2QF7A 5JPNC 1GUSA 2LEKA 4ZOHC 1S5CD 1GPXA 4OL7A 1RDPD 2EJMA 1UWMA 4KD4A 2QCPX 1PZID 4WQMA 1RCVD 5FOBB 4ZUIA 1PFNA 1MD2D 1JB3A 2G9HD 4FF4A 3AM9A 2IGDA 4QMGA 4LLGM 1FYCA 4MACA 1ICWA 3NP8A 3DEOA 2SAKA 1PTOH 4KGRA 5GXGB 1X32A 1YN4A 4DAYA 1S4ZA 2J7ZA 2F3WA 1PZKD 1RJTA 3U7ZA 1T5EA 1B9RA 3HOZB 1SYFA 4QIWB 1BCPF 3LYYA 3DWQA 1ONLA 5C0XJ 2Z4IA 3IFTA 1ZE3D 3I91A 2GA4B 1RWSA 2RDHA 1KDCA 1VLBA 1SB3C 2BBCA 2GRIA 2NB0A 5HI1A 1WD1A 3CKIB 2EYLA 4EQNA 2W54A 3IKJA 3A8KE 3VR4A 4K5XA 1H9RA 5LL6X 5A2QE 2VUMB 1FD6A 2CW0C 1PRTF 2EYFA 4KKIA 1YQ4B 2DWQA 1P7EA 5EE1A 5JPMC 4KKSA 3FILB 4RGNA 1ACCA 4C2MB 3J9CA 1XTCD 1Z47A 3DHQA 1E2ZA 4KMUC 2O4XA 4I7ZC 5NUCA 2F0UA 1EQVA 5D3IB 1J7BA 2L1AA 1EL0A 1HUNA 2MUYA 2WU5B 2V4DA 4K5VA 1U4PA 3L3OC 4ARIA 1KF6B 5EKKA 3NVYA 5CV4A 4N9TA 1QNUA 4BY1B 2QSDA 5JJZA 1O7ZA 3WCQA 1SE4A 2RDGA 4HMJA 2KQ4X 3X3NA 2F0OA 2B2VC 3R2IA 1RODA 4ZUJA 3S9WA 2H89B 5IGGA 1N5WA 1YMHE 1VMCA 3ND8A 1DYQA 2X38A 3CU7A 1ILQA 5IGDA 3L4PA 1EWHA 2M0AA 4RA8A 5CMDA 4WWMA 2L1BA 5IT9L 1PTOC 2MEKA 4OZBA 2R61A 4IKGA 3H91A 2LHDA 2D62A 4WURA 4JBWA 3H6MA 4XT3B 4XTCS 5CV5A 2E6XA 4KY6A 1V43A 3AV8A 3N6RA 1DOMA 3LB8C 3F2UA 1IBXA 2KHSA 2JSOA 4L63B 4HTHA 3AE9B 2B2YC 3G7LA 2N88A 4Q2JA 1E2WA 4DGZA 1BR9A 2K5QA 3NPPA 5EPJA 1BUIC 4YTNB 4B0MA 1BCPD 1QCBD 1XLPA 2Q5WD 2BE5D 5FK9C 3GB1A 5I2YA 1L0VB 5M5YB 3J80L 1WTRA 1LTAD 3MXPA 3BVMA 2WXRA 4WRDA 1IYUA 3D6WA 4F88A 5ELCA 3SK4A 1DM0B 2QMTA 1CTMA 1WTQA 3FRPB 3GTQB 2G1EA 4BBRB 4R9WA 5T1GA 3K59A 1PRTD 5C6AA 1SNQA 3HGBA 2JZPA 1NR4A 4O42A 3R8BA 2M2LA 5AUKA 5K5PA 2N0SB 2L52A 2WXFA 3TMEA 2W82A 3VYTA 5CC4A 5KYLA 5JVG3 2Q8IB 5AUIA 4DXFA 3HP3A 2IWHA 3P20A 1ESFA 3OIPA 1CHQD 5DM73 4H13C 3T3NA 4XT1B 2MHVA 5FO7B 1F0ZA 2K9XA 2BA1A 3D3RA 3NSWA 4A3JB 3HVDA 2VB3X 2JYOA 3RD4A 4QB4A 1IBXB 3AE6B 4Q0FA 1ZYRC 1FEHA 1Y1WB 2EELA 4IFDG 1GUOA 1EM7A 2JXMB 2PKOA 2F0WA 4DAVA 4NZLB 3SXHA 2K32A 1J7CA 4MIUA 3I73A 3EA6A 1DZ1A 3FMCA 1FFUA 2PZUA 1GUTA 4KKUA 5EQ0A 3FVQA 3S2HB 5CV9A 1C4AA 2BYTA 4IOIE 3OWEB 1PTOB 1V97A 2F0PA 3FKIB 1PYWD 2XWJB 1QILA 3A7LA 4KJNA 1C4CA 3MA2B 4RKLA 4RF1A 2Q8TA 1S5DD 4NP5A 2VXWA 3KLSA 1ZDXA 3NWTA 4C3JB 1JMLA 1SFOB 1C48A 4G7HC 4IFDH 3BIID 1L4DB 5JXVA 4PT5A 2E74C 1A2TA 2WLBA 3Q8CA 1GXDC 1PUTA 4MM3B 3FPPA 3BYYB 2HTME 1VZ8A 1I4XA 4V190 2QEJC 4MT5A 4N59A 2A73B 4B08A 2A6ED 1QKZA 2F0FA 3OPOA 3M7NA 2EYPA 5ISRA 1JALA 1VF7A 3Q8EA 1W6KA 2M9VA 1STGA 3K58A 3GV3A 4KK7A 2WB1B 1DOLA 4IUVA 1FNVA 1FXAA 3UI2A 3AB5A 5CR3A 2B2WC 3NS1A 2DY7A 1B53A 5JEAG 4BA1I 4RNAA 2J52A 3URYA 1FR3A 4NDXA 4EGVA 1SIJA 2H1EA 2K5WA 4ITKA 4HAEA 2ZXPA 4Y7NB 2EZVA 2EY5A 4C80A 4PMWA 1A70A 2BS3B 2K0PA 4IFDI 2WXQA 2LFIA 1E0ZA 1OFFA 2IGHA 5BN4A 4XE0A 1UEAB 1K8MA 3AH7A 4N6EB 1FFVA 1GAQB 4WAFA 1RM6C 1EQTA 1LTID 5K36G 2D9UA 2PW9A 3NVZA 1HZ6A 2Y5CA 2B2TC 5JEAH 4GDKB 1RTNA 2WXJA 3JAML 4TQ1A 3PV0A 1E7PB 4L2YA 2K04A 1CA6A 1Q90A 2CHBD 4XDDA 3EUB2 3ZQ4A 4B9XA 1WRIA 3AE5B 4A3MB 1B44D 3KF8A 1IW7D 2R6GA 4UAIA 2L12A 1UAPA 5K36H 4FXGC 1YN5A 2WNMA 1SE2A 1Y69U 1C78A 1JICA 1AN8A 4K2LA 1OO9B 2L32A 1VRAB 4XXEA 2B2TA 1ZP0B 5D65A 5HURA 4YTPB 2K33A 1TWAB 2PPBC 1EZ6A 3J81E 3EVQA 2ON8A 2DYMA 3W5VB 1I4HA 4GZYC 3TSSA 1F9QA 4LK0M 5FLXE 5J39A 2BDOA 5IOCA 1GOZA 3J7AF 1Y8PB 1SBBB 1SXTA 4K6LA 3ZYYX 3BS1A 4A3FB 1T3QA 4ODGA 1Q12A 2EY1A 1Q1EA 2FMCA 5ELFA 1TKWB 1RYJA 1TR5A 5BN3A 1IHZA 5I9OA 4J6HA 1OXVA 2FMMA 1WWTA 4KX6B 3FDTA 3TEWA 3PUWA 2KJXA 2PZWA 4FXKC 2F0IA 2F0HA 4YSYB 4ILWA 1PLFA 1ET6A 2I07B 3D31A 2R93B 4NAWB 4KN4C 1XX8A 1LT6D 4XIGS 2K5PA 2XNAC 3KLRA 5KRUA 2RDFA 4K5WA 2OXPA 3SK5A 2VZKB 5EGTA 3NVWA 1LO5D 3MP9A 1C8CA 1IGCA 2NYZD 5HG2A 1PDXA 2INNE 3IT4B 4YT0B 3K5MA 1VJKA 4OZAA 3B2FA 2IGGA 1STHA 1ET9A 1HFGA 5BN5A 1F2YA 3LXFA 4US9A 4RWSC 5KGUA 1FCLA 2WXNA 2F4IA 2NZ1D 4J3OD 2SOBA 3TEXA 2HCCA 2IJ0A 4WFN3 3AE3B 2XWBB 4ZAIA 4A3BB 1EEID 3T13A 1L5PA 4OZCA 4HKZE 2PMZB 1F2RI 4ZKBB 3TZDA 5J22A 1TWCB 4OVZA 2B8GA 3K6OA 1PDQA 1BNZA 3FC4A 2A6HC 1H9SA 4OIJA 3B2GA 3HUIA 3S1QB 1LT3D 2EJFC 2ICEC 5E6JA 1I4RA 4DNRB 2WP8J 2MJDA 1FO4A 2LY7A 3NBIA 1BOSA 3PUYA 2BW2A 4XQJA 1NENB 2LUMA 1QOBA 4ZRQA 1STBA 3AEEB 2WS3B 4IN3A 4KKTA 1YNNC 4XWWA 5JOBA 4S3SA 3HOYB 2KN4A 3V3XA 1HFNA 1ZXIA 4CKBA 2X69A 1U4RA 5ELDA 3K57A 5D14A 2D5DA 1STNA 3H8HA 5EE3A 1EIGA 2WXPA 1V1OA 3PUZA 4RCNA 3AE2B 1QWYA 4X3KA 1LTSD 1BUVT 1F2RC 3NHHA 2N9LA 2AUKA 1DOKA 3S16B 1J9OA 4DAPA 4IUQA 2K22A 1B50A 1WSPA 4YSZB 1F9SA 1V8QA 3A54A 4RH6A 1PFDA 3MZ5A 5IGCA 3AEDB 4KTAA 3CRKC 2CW0D 2IX0A 1JC7A 1SYGA 1JOQA 3AEGB 3K5NA 4R8NA 2PVGC 1A3UA 3DMUA 3P4QB 1XWEA 5J1ZA 1H9SB 5I6YA 1K53A 1RHPA 3G6JB 1RF2D 1PZJD 2HDMA 1F77A 4IQZA 1LTBD 2WXGA 2BCOA 1N63A 3BK2A 1NR2A 4NKLA 2KCCA 2B2UA 5CV7A 3MTSA 3W5UB 3TDQA 1A2UA 2NN6I 1FCCC 1KTKA 2AWNA 3ZJUA 4B0EA 4A3EB 1L0YB 4N9PA 1E9MA 3IT6B 3E5SA 1B9NA 2WACA 1ZEQX 2WKDA 2Y3AA 2ID0A 3EFXD 2NVQB 4FXCA 4OHJA 1JOOA 3EROA 1SNDA 2IL8A 2LMCB 5E3FA 3TP6A 1I4GA 2A74C 2JE6I 4KI0A 4A3GB 1FRRA 4H44C 2ENBA 1EY0A 1STAA 4PMCA 3AEAB 3I70A 1CA5A 3BVZA 2EYJA 1DCZA 2IW3A 2IX3A 3OWFA 5C3EB 5KNDA 2JQRB 5T1IA 2EOTA 3NQIA 4K8JA 1TU2B 2F0NA 1BBXC 3MXNA 2PNRC 1XO3A 3E0JA 1BMLC 2ONQA 2J4XA 1VZ7A 4TRDA 3MWYW 3ERQA 3Q8AA 1F2ZA 1IKLA 3D8GA 2KAJA 3NVVA 1WCMB 2WKCA 1MI2A 3H94A 2O5IC 1EY8A 1KDBA 1HCZA 4BY7B 2A69C 2BB6A 2YEPB 2C9OA 2BTEA 4XQNA 1ESRA 2EPBA 2B63B 1ENAA 1K8OA 1PGBA 3GTLB 5KIXA 3I9V1 3TEYA 3HOXB 2DNCA 1QNKA 1MI0A 1O7YA 2DYOA 3DWGC 3K5OA 5M5XB 1HHVA 1MHHE 2K28A 4AS1A 1VDZA 3BDCA 3T4AC 4RGMA 3CIRB 3V05A 5D7GA 4JK1C 3AE7B 1EYDA 4DK1A 3HKZB 2F1MA 4HSPA 4K14A 4DFAA 4WIPA 3GTKB 1IYVA 3D6CA 4KHVA 1V8CA 1O78A 5DAUA 1QOFA 3LX0A 1WYGA 2LJIA 2OEDA 2HDLA 2NTSA 5C2TB 1WTWA 3AE4B 3BZDB 4TKOB 3C1FA 1TT2A 1GB4A 1CZPA 1F2LA 1V1PA 3MJ5A 2OT2A 2LHEA 2OHFA 2F0GA 1OXTA 1A3TA 4HN7A 2EYMA 1LTRD 1SYEA 1T6BX 1Y8OB 1CHPD 5BYQA 3IAS1 1PGXA 3NZ3A 2RSNA 5EKLA 3NUHB 1LACA 3RZOB 3RPFC 3DWPA 3TP8A 4L1BA 4TQ0A 5CV6A 5EJWA 1G291 1E0BA 1HUMA 4US8A 1Q10A 3IL8A 1EFID 3I90A 2PLPA 1XEEA 1FD7D 3FPUB 5KEEA 1LTGD 1YJJA 1F9RA 4ZRZA 1K50A 4U68A 3P4RB 1CT1D 3V96A 2QIEB 2R7ZB 5LNK1 2M56B 3VA5A 2LS01 2KQ3A 4GDLB 1DOYA 2KEEA 1STEA 2CJOA 1FNUA 3VQIA 3A8JE 2JWUA 3S1RB 1EU4A 1T5XD 4M0WA 1FMAD 3EQLC 3TN2A 4DA2A 3HRDD 4ZK9B 3VR8B 3P63A 2A68D 3QOLA 2JP1A 4IZ8A 4CJ1B 1JR0D 1Q1BA 1V1PB 4DN4M 2W3RA 1A15A 3U9SA 1KLGD 1L0XB 4P6VF 1QT9A 1B4OA 2K03A 1CZWA 5FR3A 3SHLA 4HR7B 1QG7A 2F0VA 4BA2I 2EXZA 4NAMA 1NSNS 1Q8IA 1VMPA 4IUUA 3S14B 4ABNA 5FKAC 3PZ7A 4F87A 3NQTA 1HQRD 1FRDA 2SNSA 2BE5C 2SDFA 3P4SB 1LTTD 2HCIA 3NBHA 1KNEA 4ME5A 3J7YW 4WJWA 3H09A 2L5TA 2WXOA 4KGSA 3BG3A 3Q0AA 1QOAA 2GB1A 2E76C 5JAVA 4LTUA 1NVID 5A2QL 4YSXB 1WVLA 2JEBI 1JWAD 1OXSC 5D3DA 1LV9A 4X3UA 4YXDB 1NYQA 2BS2B 4FO2A 3K5LA 4R3DA 4C56C 3L7ZC 1C9FA 1BO0A 1OQQA 4JWUC 5I4DA 1HXYD 1JWUD 3CWIA 1LT5D 1TKYA 2RQXA 5AFWA 2L9HA 5M3FB 2B76B 5C3JB 1DONA 2F0TA 3M4OB 2NVTB 5C44B 1ZPSA 2L0CA 3R3OA 2JSVX 4X3TA 5BMIA 2FFKB 2XSCA 1STYA 3Q23A 3KBGA 4HKQA 2L83A 3M4YA 2N7JA 3OMGA 3E9SA 2WINB 1ZXTA 1WXQA 4CQNA 3GO5A 3VR5A 2YU9B 1SJED 1SMYC 1VF5C 1CM9A 3KUPA 2GI9A 3MAQA 3Q6SA 3MHZA 3FAHA 2RKSA 3TEZA 5I2XA 3N9YC 1YNJC 5IIFA 4CKCA 1WTPA 3TZUA 2K6AA 3MHBA 1RKNA 2H4OA 1IKMA 4RHRA 1Q3LA 1N60A 3N52A 3Q69A 2YEPF 2NVYB 2J42A 3DM1A 2W55A 5H8YE 1IL8A 4N58A 4ZHOA 3VYRA 3M85A 1NUCA 4G4KA 3BK1A 3MC0B 4KGTA 1TJEA 3RUZA 3PZ8A 4KN7C 2AX5A 2FUG1 1ZKOA 4ULLA 4PV1C 2IX1A 1FIQA 3PUXA 1TS5A 1MHXA 4K6DA 4RHSA 2NMQA 1Y8NB 3GTPB 3AE8B 5MPOA 4L8JA 2J53A 4XYOA 1GHKA 4ZRPA 2JX5A 4O1NA 1GJXA 3W9CB 2PQEA 1S5ED 1F2MA 4RAUC 3RMHA 5IODA