5D3IB

Crystal structure of the ssl3-tlr2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
KYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of TLR2 by staphylococcal superantigen-like protein 3 (SSL3).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Toll-like receptor 2
total genus 46
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
B PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5d3iB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5d3iB01
1FGBD 1ET6A 1TS2A 1JWMD 2QEJC 2R61A 5ELBA 1YN3A 1CK1A 1D6EC 1PRTB 1I4QA 3BYYB 2CHBD 2SEBD 3TSSA 1LTBD 3R2IA 1BCPC 1RDPD 5ELFA 1LTAD 1KLUD 1PTOB 1DJRD 1PRTF 1LT4D 1PRTD 2RDHA 3R8BA 1YN5A 1PTOH 1G8ZD 4RGOS 1TY2A 1SBBB 4C56C 1SE4A 4K6LA 1UUPA 3MC0B 1I4HA 1QILA 1AN8A 1EU3A 1L0YB 1S5ED 1BXTA 4RCOA 1LTSD 2ICIA 1BCPD 1PTOF 2O2LD 3OWEB 4O1NA 4RFBA 1HA5A 1ET9A 3GP7A 1S5DD 1FD7D 3V05A 3W2DA 3DWQA 3MFGA 1CHPD 3EFXD 5FKAC 2AQ1B 1RD9D 2Z8LA 1LTRD 3DWAA 1FNUA 1HXYD 1S5CD 1BCPF 1SEBD 1PTOD 1LT6D 1RCVD 4ZYSA 1V1PA 2XRSD 2AQ2B 2RDGA 1T5XD 1B44D 1EWCA 3BVGA 1XTCD 4DXFA 2XNAC 2XN9C 3O13A 1I4PA 1CT1D 5ELEA 1LTGD 3BVMA 1SXTA 4BWGB 1JCKB 1UNSA 3EA6A 1JWUD 1CHQD 1TS3A 1HTLD 4Z9CB 5FK9C 1BCPB 3CHBD 1D5MC 1M4VA 1F77A 1PTOC 1SJED 1S5BD 1L0XB 1HQRD 2TSSA 3BYTB 1D5XC 3SEBA 1ESFA 1CQVA 1D5ZC 2WV6D 1EU4A 1LLRD 1TS5A 5ELDA 4UDUC 2G9HD 3R2TA 1RF2D 4OHJA 1LO5D 1DYQA 4L63B 1FNVA 1EFID 3KLSX 1I4XA 1LT3D 1EEID 4RGNA 3DWPA 1PRTC 1SE3A 4RH6A 5D3IB 1LTTD 1GOZA 1I4RA 1PYWD 1SJHD 5D3DA 1LTID 2J4XA 1I4GA 1PZJD 1LT5D 4DXGA 1ENFA 1KLGD 1PZKD 1XXGA 5I4DA 1TY0A 1JR0D 1YN4A 5TSSA 1FNWA 3URYA 1B1ZA 1JQYD 1SE2A 2IJ0A 4RGMA 1JWSD 1PZID 3BVZA 4RHRA 1MD2D 4RHSA 5ELCA 1STEA 4L6TB 4TSSA 1V1PB 2QILA 4RGTA 1TS4A 1KTKA 2NTSA 3BZDB 1EEFD 1S5FD 2XRQD 1AW7A 2IPKD 4NZLB 2AQ3B 1V1OA 2NTTA
chains in the Genus database with same CATH superfamily
3T1HL 1ZDVA 3Q6BA 4M00A 3AI5A 1QVGA 5CGKA 3MHBA 3HOYG 2EIFA 2VXWA 5JVH3 3PREA 1CZWA 3VTVA 2SEBD 2UUAL 4LJPB 4B0MA 3C3LA 1GUOA 4KJNA 3RN9C 2B2VC 3GTPB 3U52E 4HIMA 1PH3A 1NBFC 1LTAD 1X55A 4ALPA 3IKJA 5JHBA 2RQXA 1JQ4A 2KCMA 1JJGA 3D0FA 4C4VB 1QZEA 2QC8A 3APCA 3OIQA 3P4PB 1NR4A 3EHVA 2IL8A 4C3HG 3GTPH 1H9KA 4YWLA 4RF1A 1MHHE 4JBJA 1KFYB 4DU9A 1VQFA 1K51A 2FIDA 4LAAA 1HTOA 4AP4C 2IYDB 1EYCA 1GXDC 1MJEA 3AE7B 3DBHB 4USAA 1PTOF 1UD7A 3ZYYX 3H1UA 1XLQA 2L5TA 4BKSD 4KD3A 1BQQT 4JYAQ 1K53A 1IL8A 2R7ZG 4NB3A 5JZEB 2BCOA 1GG3A 5IYBG 3K5NA 2HE7A 1IYUA 3VHTC 2E2JB 2BKRB 1P16A 5EBDA 1BCPF 2MFIA 3PSIA 4A3LG 2NUCA 1RCVD 5KGUA 1K52A 4AWJA 1OXSC 3UE0A 1JMLA 4ZHPA 1FR3A 1L1OB 4DXFA 1MJCA 1X56A 3H15A 3CD6A 2M8SA 3H7PB 4DV0L 3H3VI 4DDID 1WE6A 1KF6B 2GI9A 1GD7A 1UEBA 3L9AX 3EA6A 4NKLA 4A3EH 3NBIA 5M5YB 4OVZA 4DAYB 3V60A 4YSYB 4IOCA 1QOHA 3FAHA 2F0NA 5FLMH 4DR3L 1R4NB 3DVNU 1P9DU 3PRMB 1CA5A 4WURA 2D9UA 1SJED 1ASZA 2AWTA 1K8AC 1FVIA 3VR4A 5JJLA 2F0GA 1L0WA 1V97A 4MM3A 2TSSA 2JF5A 3DPDA 2YYZA 1YNNC 1ICWA 1CQVA 3MZ5A 4WRDA 2AWNA 2ZJQA 4IDIA 4G57A 5IT9E 2C7NB 3AV8A 1BBWA 4L5SA 1WYWB 3I4LA 1N32L 1S1QB 2V3SA 4W9LA 4P2CB 5DM73 1WTXA 1LT3D 3CP0A 2IW3A 2ZXPA 1Y1WG 1PRTC 2VRRB 3V3XA 4NXNL 1FIQA 2IY1B 1LTTD 2UUBQ 1EWYC 3L16A 4CKCA 5EKLA 1JWBD 1PH1A 4K7WA 1Q86C 4XT3B 2A5HA 4DAYA 3IAM1 4LF9Q 2NBWB 4F1SA 3KFUA 5EKIA 1A3TA 3CPFA 5EBCA 4AYBB 1JR0D 1L0VB 3MJ5A 3VH3B 3W5UB 1RRBA 1WGHA 5BMGA 1JQYD 1BBXC 1DOIA 4GDLA 5HGTA 3W1BA 1YQBA 4NQLB 3TIXA 4CDCC 4RHRA 1SLJA 3F2BA 1FM0D 2RSOA 2J53A 2JA6H 3P1HA 2BS2B 5DPSA 2JA7G 1XMOQ 4OIKA 4OL7A 4C1NI 2DWQA 4J15A 1TWAB 1Z2MA 3KBGA 1OXXK 1EEFD 2EDGA 3W3AA 4TVAB 3RUZA 3S17H 3PO3B 3I70A 2MP2A 2RSUA 1Q5WB 1N33Q 5C0XH 3RI7C 2ZJDA 2I1JA 3RT3B 4K81A 2OWOA 5T1IA 1CK1A 2BH8A 5IOIA 4K8JA 2F0MA 2DAJA 2KENA 1E8WA 1HPCA 1YJNA 2JA8B 3Q3FA 3K5LA 1JRUA 3A0JA 2O5IC 1KRTA 2PZWA 2WNMA 4YY3Q 2KEDA 3A74A 2JPHA 5FLXL 4DA2A 1VR9A 1ZOYB 1K83B 2PZUA 4AH6A 1V9PA 5EPKA 3PV0A 1XPRA 3P75A 2EYOA 3CRLC 1VLBA 1WXAA 3DHIC 4I7ZC 4GOPC 2K5QA 1KL9A 2MPMA 3H6NA 4GGQA 2JRHA 2H1EA 5EPJA 4B3TQ 4B3SQ 2JZZA 3ECIA 2CH4W 1VDZA 1L0YB 1X9NA 4YWMA 4GKKQ 5IA7A 4CDEC 3ER0A 4RKLA 3DWGC 1N34Q 2DZMA 2A19A 3N52A 4OX9Q 2J0MA 2LI5A 2WXQA 3HUIA 4I6LB 5HG2A 3C8YA 4GB9A 1GC7A 3UQBA 1VQ4A 2M2LA 4B9WA 2E2HB 2KMMA 4WWNA 5IGBA 4OVUA 1XLPA 4QY7A 3Q8BA 2DHZA 1HUMA 3PUWA 2CCZA 3KLSA 1TWHH 3UGBB 3TBLD 1F52A 1WI5A 4I65A 3T16A 4ZYSA 1JJ2A 1OXVA 3S15H 2OJRA 4M0WA 1E7ZA 1JW9D 1JRPA 1UBQA 3S2AA 4N9TA 4OELB 1B44D 2UXCL 3APFA 1AZQA 1E9MA 1C48A 3D3RA 2KANA 1S3OA 1QKZA 5CBAE 2UUCQ 4RM8A 3WCQA 2KNBA 3PO3H 4FXKC 3RLOA 4WAFA 2NPTB 5L95C 1ZYRD 2L1AA 1W6KA 3IFTA 4C1NK 2WDVB 4DV5Q 3OLMD 4QAYA 5JEAJ 3DQVA 3WAMA 4KN4C 2PW9A 1EOVA 2RHSB 1KD1C 4OONA 1HA6A 3MTSA 3ALBA 2MP1A 1YNTE 3U2SC 3KWVA 4LDTD 4ZRZA 3H0GH 5KNBA 2WQYB 4JI0Q 2L12A 5HGQA 4E74A 5E6OA 1MVKA 2DNFA 2A5UA 4NXML 4XQJA 4ZOHC 3KLSX 3ZJUA 1L1OA 3M7GA 1E0BA 1KDAA 2CHXA 4OZBA 5KEEA 3ZTCA 2UXBL 1KDBA 3DCGA 2G9DA 2K3UA 4DV7Q 3LYYA 5AZFA 2KCTA 5AZHA 2FCNA 1DGJA 1B3AA 3HGBA 1XXGA 5K5PA 2IX3A 1Q0WB 1IP9A 4RM9A 2INDC 3I3TB 4M01A 2WXFA 1W3SA 2GBRA 4LW1A 4P75A 4IQZA 1HZ5A 4GN4B 4OXPA 2AL3A 2Z9HA 4KSLC 3HOUG 3Q69A 3Q3NC 3C0RB 1A3UA 4L5QA 5IOCA 5J39A 2KHSA 4P72A 3PPAA 1Q90A 4DV2L 3UIPB 1VQ9A 2N78A 3MC8A 1XCTL 4GU2A 3K5OA 3C1EA 3CMAA 1NVID 1E7PB 3NBHA 3TJPA 2WXLA 1EY5A 4TKNA 1TKWB 2KUMA 1HZ6A 2F0FA 1LV9A 1NYQA 1VQHA 1EY4A 2CHBD 2HHHQ 5JEAH 2KACA 2BOSA 3IL8A 2KN5A 5ELFA 1SIJA 1HTQA 2YVCA 3AU4A 5JPNC 3OTOL 1AH9A 4DR2L 1OQQA 3PGEA 4XYCA 3ZRCA 4A3GH 1Q10A 3NEMA 1SDFA 2D5DA 3ONAB 4K6LA 4ZDVA 2MH7A 4X62L 4FULA 3MXGA 4DR7L 4WQMA 3KF8A 2ZPNA 1C0AA 1SSNA 2PMVA 1JMCA 1K8MA 4LNOA 2LJIA 1HZBA 1NI3A 1OQRA 4D2KA 1A70A 1S5ED 4A3CH 5T1GA 3TMEA 1HFGA 1SN8A 4XQNA 1TBEA 1JJCB 2IHEA 3QOLA 3GTOB 2BYFA 3UDIA 3OW7A 4HK2A 2QF7A 4G7OC 3GTGB 3MWYW 1U4RA 1FD7D 4A3KH 3WOEA 4KN7C 3I56A 1OEYA 5BR8Q 3KUPA 2NBUA 2L0FA 2WXMA 2B63G 2XTIA 1I3QH 1VMCA 2HDMA 1G91A 1MG8A 1QB5D 2R2QA 4PS3A 2MX2A 1YZ6A 2EMSA 3NWTA 1S5CD 3RPFC 2RDFA 2BGFA 1PTOD 1C4PA 2INCC 1CKNA 5DNFA 2F0TA 2JA6B 2I07B 1EL0A 5IIFA 2B2UC 1QOBA 2GRIA 2FUG1 2KJHB 3PSEB 2UU9Q 2LGIA 5CV6A 5JJZA 2VQEQ 1X65A 2LVPA 3APDA 4A9AA 1CT1D 3V61A 3KJPA 1DOYA 2CJOA 1JWAD 1UNSA 3RUIB 2GOWA 1TS3A 4A3JH 4DK3C 3U58A 2YU9B 2QEXA 2CFMA 1MJDA 2Q2UA 4QUFA 2NVTH 2D07B 4DV4L 2YV5A 2HQLA 3EJIA 2NB0A 2Z0EB 4CDFC 2M4NA 3DXJC 4I7AA 4LJZC 4IUNA 3BK1A 1RHPA 2IGGA 2EOTA 4X66L 1C78A 3HFZB 2K8HA 1T3QA 5M5XB 4A3EB 1GUWA 2JRIB 1NY4A 1TU2B 4RA8A 2KX3A 3D6WA 4C7ZA 2I0QA 2LHEA 1IW7D 3DVGX 3NRZA 2F0VA 1HNZQ 4UP9A 5E6NA 4RH6A 3IAS1 1ZKOA 1OGWA 3Q3JA 2L55A 5CHFA 4LFCQ 1XO3A 2DY7A 1MI2A 2GA4B 1O80A 3GTQB 2RR9A 3B1LX 2A4ZA 3T4AC 1X6OA 2GVAA 2K39A 5I4DA 1TY0A 1R4MI 4IFDG 1XCQL 4KHZA 2N9XA 2Z0DB 3EFCA 1YMHE 4G7HC 4A55A 4A3DG 2WX1A 1FD6A 1CMXB 2WYQA 2LUEA 5CBEE 2CKZB 5GROA 1ZW7A 3AE1B 3CCEA 1LYLA 2E2IH 2KMCA 3U9SA 1C4AA 4R8IA 1TWHB 4DV1L 3AH7A 2KZRA 1EQRA 2K05A 4DGZA 2RCFA 1YHQA 4ZKBB 4DNRB 3E9HA 2IPKD 2AQ3B 1V1OA 1JORA 1V5OA 2RPVA 4KGRA 1IKMA 3ZVVA 4YWKA 2BBCA 1ET6A 1VQ5A 2AMCB 2VB3X 4Y7NH 4CYEA 4DK5A 4F8CB 2G45B 3I73A 1WSPA 1FFUA 1A62A 4IJHA 3W1GA 2KVRA 3R2IA 3AU5A 4CBVA 2LGYA 4LCDE 4ASWC 1LQBA 2EYMA 2RDHA 1QQRA 1SIFA 1G8ZD 1SBBB 2ICEC 1Z5SB 2DJGC 2F1MA 1QILA 5C6AA 3OYYA 2L15A 1AARA 2K32A 4ODGA 3TCAA 4KZ0A 2MBHA 5C44G 5CORA 1JOKA 3IFDA 3KW5B 2JXMB 3ZNHB 2VZKD 2H5XA 5EKKA 4LFCL 4MH8A 2BT6A 4CDDC 2JWUA 2E74C 5HI1A 3TL5A 1HNZL 1TWFB 2J0TD 2C5CA 1WVLA 4KGTA 5AEKB 1T0YA 1J8CA 4FXDA 3L4PA 1Q1OA 2XBBC 2A69D 2DX5B 2PNRC 3EFUA 1EQTA 1N60A 4KZCA 1PV4A 1Q8IA 1PDXA 4DR6Q 1OXUA 4X66Q 3CKIB 3PUVA 5DAUA 1Q8KA 3M4PA 4HDQA 1GUNA 1PFDA 4GNXA 4B9XA 3F8TA 4NW2A 3RN2A 1P0RA 1LTGD 4BZAA 3ZGZA 1TGZB 2WHIA 3S2HB 4PS8A 1VQAA 5IODA 2MNAA 3KLWA 2NVXB 3SHLA 2DLBA 1PGAA 3I5JC 2GVBA 1WFQA 4Z9CB 2IX1A 1RKNA 5C4JH 3J81c 4MH0E 4FADA 4MSQB 4BBSB 2HD3A 1VRAB 5A2QE 3W5VB 1NSNS 4PMWA 2LKVA 4MDKE 2Y5BB 3GE8C 4XZ4A 3BDOA 1H9SB 1WTHA 4DR1L 2M19A 3JAMi 2VUMB 2MBQA 3GTKB 2JXTA 1QF6A 4HEA1 5C3WA 5K36G 3QARA 4XE0A 2X6LA 1KM7A 3VDYA 2E75C 4KKIA 4H0LC 2E2HH 2XVSA 3ZQ4A 3KWLA 4KY6A 2BA1A 5BR8L 2PE6B 1XMQL 5LXIB 1WTQA 2ENBA 2JY6A 2ZCBA 1JICA 1JB7A 1I94Q 4JE3B 1HTPA 1HUNA 2TMPA 1KLGD 4U68A 3BZKA 2J7ZA 2FNJB 3EROA 5LHY1 4ZLTF 1RAXA 2E6XA 4LNFA 1XPUA 4H7BA 1TQOA 5IYDH 2JYOA 2N9KA 4GDLB 3RFZB 1YHBA 1K9MC 2JUOA 1WD1A 2WDRB 4DR7Q 4LLGM 1D4BA 4X62Q 2K5PA 3L10B 4PG3A 4LJOB 2V4DA 2X38A 4L6TB 2F4IA 2PYKA 3J7AF 1GJZA 3T8MA 3OIPA 4IURA 2PW5A 4DWFA 1TS4A 3DVNV 5IY0A 2BA0A 2LMCB 3OTOQ 4CQNA 4L2YA 2WB1B 4QQBX 2F0HA 2MA9B 3ND8A 1SSOA 2V9HA 2NTTA 1FGBD 2LSSA 3FRPB 2VQFL 3D8GA 4DK1A 1EUJA 1EO6A 4KHPQ 3J80i 3ZO5B 3BDCA 2KVZA 4MGKE 1BF4A 4KJOA 3S1QH 2CHZA 4TUUA 3KDFA 2LRUA 3T3NA 2KAJA 4J8QA 2IGHA 3BY4B 2DNCA 1AEXA 4DV2Q 3E9IA 1WGYA 1TJEA 2KKCA 3I4NH 2CS4A 2A69C 2KD0A 3I57A 3R66C 2NVYB 3ZW3A 2KQ7A 2NVYH 4BY7G 1JC7A 5CV5A 3HKZG 2EY2A 4S17A 4EZJA 3MXPA 2PIAA 4GXBA 2OQ0A 2EYJA 4M0WB 2BB6A 1X32A 1WD0A 3HKZB 1NYRA 3I4NB 4DHJD 4K14A 1V1QA 5NUCA 1PLFA 4PYZA 3OG5A 5DPWA 1FYCA 2ATWA 1WCMB 3GZNB 1GUAB 3NTIA 4XT1B 5DPTA 1LTLA 4EGVA 3HOVH 4ANUA 3D4RA 2RBMA 3OWEB 1STHA 4DV7L 1PGBA 4R3DA 1A15A 3HS0C 1KIXA 2UXBQ 3A7LA 3W2DA 3HOVG 3H3VH 1CJEA 3B6YA 1V5TA 2LXCA 3RN5A 1VQOA 4JWSC 4YL8A 4M1UB 4NXMQ 3S1NB 3E9SA 3CC4A 2Z8LA 1BUVT 1O78A 4EQ5A 2O5JC 2KDMA 2R92H 3DOWA 5IT9L 5CV8A 1NI2A 3DM3A 1AYFA 1GO3E 2N7JA 4EZKA 2F0IA 2Z6KA 1R9TB 3ZJVA 3GTLH 3CQZH 2C7HA 4URKA 3K7AB 1M90C 2ZVOA 3A33B 2CKHB 4DV5L 2I2YA 4HCSA 4A75A 3X3MA 2EY5A 4C80A 2IO1B 4KX6B 1YI2A 3BZCA 2HCIA 4ANVA 1WYGA 5M5WB 2WXKA 3PLUA 2B8GA 4KKTA 3CF5A 1MI0A 1P7EA 4FJVB 2UXCQ 5D65A 3L7ZC 3TP5A 2RMMA 2XIWA 4XC2A 2N55A 2C60A 1IUEA 1P8LA 5M5WH 4K3CA 1RF2D 1JOQA 4A93G 3VA5A 3AE9B 2N49A 5DM63 3HM6X 3PZ8A 3SD5A 4A3PA 3WAOA 4NDXA 3PUYA 1AP0A 1L1OC 4N58A 1HR0W 4JI7L 1ZXIA 4A20A 4WJNA 4DHZE 4UPAA 1VZ6A 3NQTA 4A3GG 4A3BB 3ZXRA 4FBJB 3D6CA 3AFPA 1GOZA 4B3RL 1HEZE 2XEWA 1N34L 3PLVA 3CU7A 3NTKA 3K7UC 1RTNA 4R1JA 4IPHA 1PZKD 3UDFA 4GKKL 2KOXA 3QCAA 5IYCG 4XWWA 2F3WA 2LXAA 1TVXA 2D3BA 1KLVA 3NZUA 2LGDA 1SE2A 2IJ0A 3NHEB 4CO7A 4TKOB 3BVZA 2VNUD 1O7LA 2FBWB 1E2WA 3VQIA 4RKBA 3U7ZA 1UE1A 2BE5C 5I9OA 1IYJB 1V1PB 4HAEA 3JAML 2WXHA 2CVRA 3VUXA 2L7RA 1ZXTA 4M02A 5AUIA 1HH2P 5EPLA 1L2FA 4EVOA 4YY3L 2IDYA 4I6PA 2XRQD 1N9WA 2XWBB 3LXFA 1SMXA 3A8IE 3TEWA 2EXDA 4LNKA 4GKJL 4Y52H 2WDQB 5DCNA 2PQAB 3KH0A 1LTBD 3QJYA 3LX0A 3LWUA 1N33L 2MHJA 5C3XA 1F0ZA 2K5VA 2G1EA 3ZJYC 1RDPD 4HPLB 3RNGC 1LUZA 1SRUA 3I63C 5EJWA 1A5RA 1KHIA 2L8JA 4HCEA 2X6GA 2RCNA 4MTNA 5KNDA 5C4XG 1UUPA 2KK8A 1SGHA 1G2SA 3F2DA 2B8FA 3OHXC 4JOIC 4C3JH 2KT7A 2IO0B 5TR5A 1EU3A 2K5WA 4IG7B 1VF7A 1D1KA 4K5WA 3PRPB 4E71A 3LDZE 5J1ZA 2N9EB 5D6JB 5LMNQ 1L6VA 1IBXA 4FF2A 3NTHA 4DNTB 4K6DA 2HT1A 2LRWA 3Q8DA 1ZDXA 3OW2A 1FJGL 5D7GA 3AM9A 5CMDA 1IZ6A 3L3OC 2L76A 3MXNB 3RNUA 4A3BH 4MSMB 3PO2B 1F2MA 1I6HB 1GNUA 1NENB 3WALA 2ZXOA 1IBKL 1HFNA 2WLBA 2K1BA 3B0AA 3EIVA 2PCFB 3P7JA 5J18A 3UQAA 4JX1C 4PV1C 1ASYA 3KBXA 2K4KA 1SNQA 2E3TA 5BMIA 4FP5D 3I55A 2WU2B 1LM0A 2QW7A 4B08A 4JI6L 1LXDA 1OTRB 4GN1A 1CHQD 3B08A 1N61A 3LWEA 1M4VA 1G6JA 1WF9A 3CCQA 4IWOA 1EY6A 2Q8IB 2KCNA 2N4FA 4G11A 4R8NA 1E7VA 1D5ZC 3F1ZA 3RULA 5M5XH 1TS5A 2PNHA 3L13A 2UXDQ 4BBNC 2KXJA 2Z59B 4C2MB 3DDCB 2MBEA 1I4XA 3BWUD 3M9BA 4MACA 1WCMH 1CUKA 5C44B 2IO2B 2OXPA 4JYAL 2K8CA 4DR4L 2BWES 3W1SA 4PZ8A 4HMIA 3BJUA 5IGGA 2Y0SE 3J7AV 4FHKA 1RJTA 3NENA 4LF7L 2WXOA 2D2CC 2I5HA 1B9MA 2VB2X 3HOWH 2IY5B 3N1YC 1IBLL 5FJ8G 3E3XA 1Q81C 2ASBA 3PF4A 3KUDB 4W9HA 3RNEC 1FNWA 1QUQB 1ENCA 5M3MB 3QA8A 2CR5A 1K8RB 4LFAL 2MO0A 2G4SA 4CGYB 2I1KA 4RHSA 3L0WB 4EFOA 3WOFA 2LZ6A 1X3QA 2R92B 4DHJB 5C4XH 4WJQA 5HY6A 3VR3A 3GTMH 4UHVA 3S15B 2R7ZH 4ICVA 4E3CA 4A3KB 2KDBA 1ZYRC 3PF5A 3M4OB 3CQZB 1WWTA 2WB1E 4L23A 2UUAQ 1II3A 3PIP3 2QEJC 1KC8C 4QF4A 1J19A 4BOSC 5CHVC 4Y7NB 1VQLA 3UIOB 2PMZE 3T1HQ 2PKOA 1QLBB 1TWCB 3AFQA 2QCPX 2KDFB 3G6JB 4HIOA 2ZPYA 3A56A 1TIID 3MEHA 3R8BA 1QG7A 3MFYA 3VUYA 3LNNA 1B8AA 4DK6C 2L9HA 1CTMA 1EYGA 2M17A 2EYLA 3B2FA 4LFBQ 1WX8A 1C77A 2CJNA 4K5VA 1DXMA 3FP9A 3FKYA 3M95A 4JV5L 2EJGC 1YBYA 4CJ2C 1QOAA 3NXWA 3RNAC 3J81E 2LJ5A 1RFKA 4Q5VA 2W3RA 3V2TA 1J7CA 3KF6B 3EECA 4P73A 4X65Q 2Z0SA 3JC66 2E5LL 3I90A 5C3JB 3RD4A 5FOBB 3NPPA 2H88B 4JGHB 1Z9FA 3T53B 2JA8G 1OFFA 1B7YB 2D11A 5HHDG 1FXTB 1C76A 3K8AA 1GUTA 1HCZA 1CHPD 3DWQA 3I8ZA 3K81C 4BXXG 1K8OA 1B53A 1R7SA 5C4HA 3T56B 1ENAA 4IJLA 2GB1A 4G4KA 1J8IA 3P4SB 5IP7H 1SEBD 3JSVB 3K57A 3S1QB 1DZ1A 1GAQB 3MHSD 4A90A 1DOXA 2OEOA 4X3TA 2XRSD 5IP9H 2PO4A 5KNCA 4IM0A 1WH3A 4KVGB 3LGJA 4HJAA 1YNND 1BVSA 4PMBA 2H89B 4IOIE 4NY0A 4N59A 4A3LH 3O13A 2GBMA 4X64Q 1QUQA 4XTCS 2BWFA 1WJ4A 3CIRB 4NQKE 1F9PA 2B2WA 1UE5A 3GTJH 1Y8RC 4HIDA 2KWVB 3HHMA 1N5XA 1HR0L 4BFRA 2F0DA 1YEZA 4JPBW 2HIXA 1CA6A 1GHKA 4XDCA 3I7FA 4N8X1 5CC4A 4IPGA 4GLVB 3Q23A 1VQJA 3AE6B 1J9OA 3GE3C 1TT5B 3VH4B 3AEGB 2DZKA 3NBHB 1L0XB 2YTXA 3MXNA 4FF1A 2INPE 3A9JB 1ESFA 1M8AA 1SB3C 1WJJA 3ML9A 1T6BX 4NPSA 4LNQA 5IT9c 3UDGA 1VQBA 3N1ZC 4JI8Q 2NZOA 4F87A 3OAWA 2EVBA 4IWPA 5BN3A 4GSWA 3M3YH 2D0PA 3A8KE 1Y1VH 1PMRA 3CCJA 4NJCA 3GTQH 2KQ4X 1C1YB 2CU3A 1KQSA 1VQCA 2RDBC 1TWGH 2QGQA 1I4GA 4DXGA 4W9JA 1ENFA 3G7LA 1RWSA 2B2VA 2R92G 1VQEA 5GAHC 3VTWA 1C9OA 2HQEA 4JPSA 3AU7A 4LMQD 1B1ZA 3VYTA 3BU2A 4JBMA 2QJLA 4ANXA 1RFAA 3T1YL 3TRZA 2KVMA 4JBWA 3SE0A 4HWIB 3CCLA 2FMCA 3R7QA 3VA7A 2F0PA 4IFDJ 4MELA 4CHKA 2EY6A 2LHDA 1F2YA 3NHHA 2PQAA 5C4ZA 1J5EQ 3HOWG 3NVVA 2KWDA 2ZW1A 4BKSA 1TWFH 5IO9A 1Y56A 3U8ZA 4EQOA 3SHQA 3UI3A 4A3IH 2B63B 4RWSC 3A1QA 4ZYNA 1PRTB 3GTJB 5M3FG 2F4VL 1YNXA 5I6WA 1KABA 3ITPA 5BYRA 2DY8A 3ZUNA 4Q0FA 1P98A 2N7EA 4ZRKA 3GD7A 2GN5A 1VZ8A 3OMCA 5LMNW 2JQRB 3V62A 3S1MB 2HTHA 4YTNB 4RGOS 1EY7A 1WTRA 2CQOA 2PMZB 3K9PB 3EVQA 2W54A 1L4ZB 4P6VF 2Q8RE 2BW2A 4FF4A 3NE5B 3JVZX 5LNK1 2Y0SG 4JI1Q 3DHQA 2KCCA 2KJ6A 4IFDI 2CH4A 4ULLA 2B39A 4XYOA 5CV9A 4BY1H 4HR7B 1AN8A 3PRZA 4HJGE 1XNRL 4A3BG 3CPWA 5C0XJ 1I7HA 1BDOA 2HJ8A 4X3KA 3A9KB 5CX3A 3E6ZX 5LL6S 1UGMA 3HIZA 3ZDTA 1VQKA 2O4XA 2D10A 3J81j 3PT2B 4N6EB 4O1NA 1PH8A 2DZIA 2Z4HA 3SDZA 4BA1I 4ZKCB 4DV3Q 4A3MB 4QMGA 2MJ8A 2WAQE 3DHGC 2ZCCA 3GV3A 2GMIC 4YSXB 1E6EB 3AYHB 2VW9A 1N62A 4R4IA 2M0XA 1RD9D 4OGQC 2VH2A 4TRDA 1Y1VB 2A73B 4JC0A 1N36Q 3DMUA 2R93B 2OTJA 2EPBA 1T9HA 1GC6A 1AZPA 1T0SC 1SNCA 2Y0SB 4OW0A 2FMMA 2RDGA 4IN3A 3Q8CA 4KV6A 2N8NA 4IUVA 2B29A 5KIXA 1JB3A 5ISRA 4R4QA 1KDCA 2JEAI 3KVFB 4DR5L 4KGSA 2HUGA 2NVXH 5E1FA 3SR1A 1GM5A 2IZVB 3AB9A 4NP5A 4G50A 1EQQA 2J0KA 2PW7A 2PPBC 4W9KA 1AE2A 3KK7A 4J6IA 5FK9C 1DD2A 3OSOA 4KDLB 3T13A 4QCLA 1B9NA 1S5BD 3PUZA 4LF8L 1VQIA 3Q14C 2PVOD 3SEBA 2K5HA 4IC7B 4JBKA 1LLRD 3RLNA 1ZXHA 2WINB 3PV1A 2NVQH 2ALYB 3VR8B 2YLMA 5C0XG 3CCUA 3LJ3A 3RLFA 1SYFA 4BKGA 3J7A5 3JW0X 1XLOA 4O2DA 2K22A 2L4NA 4N9PA 1PFNA 4QUCA 2V4IB 2C35B 1WZ0A 2V3NA 5GXGB 4G3XB 2G5DA 1JE5A 1P1AA 1ROEA 1PYSB 3H7SA 1FXIA 4QJFA 5IWAQ 4G0NB 2BS4B 4GDKA 5BMHA 1WRIA 4BY7H 2V0GA 1OO9B 4WJPA 5L37A 1WX7A 4HVBA 2MJEA 3KLRA 1KRSA 3NSWA 1MG4A 3M63B 4P16A 3V6EB 4NPNA 3U7DA 2LY7A 1STEA 1ML0D 4JI2Q 1HNWL 1JE4A 4P7IA 4OVVA 1JROA 1UWXA 2HJ1A 2MQJA 3AXCA 4FYDA 2UWQA 5C0XI 3K9OB 4WJOA 4DV3L 2LVQA 1MIUA 1FMAD 3U50C 2EKIA 4NAWA 4A3OA 1V8CA 4KI0A 4ZRPA 3VR2A 5KHQA 1XNRQ 3ZKJC 1I35A 4ZUJA 4NJ6A 1GB1A 4DUYQ 4MIUA 1IBMQ 1FPYA 3IG3A 3TP6A 1QVCA 2EYHA 1FGUA 3SK5A 2PJHA 3CC7A 4GS3A 1G6PA 4TMAB 4BOZB 1WXMA 2K8BA 1SMYD 3AE2B 1H9SA 1V86A 1PH4A 1CI3M 4XDXA 1PXUA 4FA6A 2F0JA 1RTOA 3DBSA 4R9WA 2INNE 2JSVX 5G5GA 4AOFA 1YD8U 3FKIH 1AFPA 2D3AA 4ARIA 1TIFA 2NS5A 1NNXA 3Q0AA 5E3FA 5FO9B 4KIKB 3SFEB 3RNCC 1BR9A 1K3RA 2EYPA 2ICIA 1XLNA 2KHIA 1C9FA 1MSGA 2ZNVB 2AEHA 1W2BA 3IT4B 1IBXB 2FIFA 2IGDA 3ND9A 1ILPA 3RNFC 3NVYA 4MT5A 1J5EL 1YVCA 3MA2B 3N9YC 3HKSA 2G4DB 3P63A 5FKAC 2C5LC 5J17A 2Q2TA 3TDQA 3S24A 4WWMA 3ULJA 4AYBE 1FNUA 5LLIA 2ZNVC 3T1YQ 1KXLA 1B3QA 1RL2A 2KLGA 4DAPA 1CZGA 1UE6A 3ML8A 3HRDD 4M8MA 1J7BA 2XK5B 2R7FA 3HM3A 4LUVA 4IKGA 1UE7A 1H9MA 3ZNZB 3I91A 2B2TA 3VDZA 1XTCD 3NUCA 4P71A 5CTRC 1HJPA 4C00A 3TP7A 3QWZB 5ELEA 2MSED 2KYWA 2NZHA 2ID0A 4YT0B 4TV3A 1LABA 5C2TB 1X54A 1JCKB 1PFBA 1EIFA 3BDLA 2B3GA 3NWSA 5KYIA 5C5LA 1EY0A 4F8MA 3U9OA 1F9SA 1A6XA 2K5DA 1RYJA 3IRBA 3NS1A 3A54A 4BBNF 1IYVA 2JVCA 4MZ9A 3QJZA 4JI8L 3RD2A 4F7XA 4ANWA 3X3NA 3JAME 1D5XC 4YHHQ 4FLHA 2Q5WD 1EU4A 1P7FA 1YJ9A 1D1IA 1WTOA 2QDBA 2YU9H 2KN4A 3OMGA 2EZVA 5G3LF 1GKHA 2ASQA 1H9JA 4JWUC 5IP7G 4B0EA 3A4RA 4HCPB 3HP3A 1KNAA 4MNOA 3U4ZA 3IXSA 1VQDA 1EFID 2GBKA 2WXIA 2D0OA 1EEID 2L1BA 5C44H 2KHWB 2W55A 4MM3B 3DWPA 1SE3A 1YNJD 3DEOA 1VQMA 1EF1A 4HJKA 1P3QU 1QWYA 4KSKC 3M4QA 4OWTB 1B70B 1YITA 3G48A 1PZJD 1I6VC 1LT5D 3NVZA 2NVUI 4OIJA 4K1RB 5JEAG 5E6JA 5BN4A 4YTPB 5G3LD 1F9JA 1VD2A 1STYA 4GN5A 1QVFA 1XEEA 1SAPA 2KO3A 1A2UA 2L11A 3OPOA 4DF7A 4PNYA 3M62B 3NG0A 1XNQQ 1G51A 1EWHA 5C3EH 1ESRA 2BYVE 2JA8H 4YCUA 2SOBA 1PUTA 3L0OA 2RPQA 1FXAA 4HPPA 3EBEA 4FDBA 2J7QB 3BINA 3ERSX 3TBIB 3LB8C 2WACA 4HTHA 4APVA 1D8LA 4HSPA 3AMUA 4HROA 3X0WA 3K0YA 4U673 2E5LQ 4A93B 2D2QA 4JL9A 1YIWA 3H9DA 4XYQA 2NYZD 2NMQA 4AQYL 4MGIE 1QCBD 3K7AH 5E4XA 1HNXL 1WMHA 5T8IA 4JV5Q 2KFKB 5I6YA 3VXWA 2BTEA 1PTOB 4A3DH 3RZDB 1LT4D 2AUKA 2MEKA 1H4RA 5DLQE 4K0KQ 1GPXA 1TXYA 5C5MA 4RAUC 2CU1A 3HZXA 1PH7A 2FE8A 3TEHB 3S1MH 2B2WC 3MHZA 2KTRA 2M1MA 4Q2JA 3NOBA 1ICFB 3EGRA 4RMAA 4DV6Q 1SNPA 1TKEA 3E5SA 1Y1VG 2Z6KC 4EZLA 1SNOA 2LGSA 4W9EA 4HSVA 2OEDA 1XTDA 3S9WA 4DAVA 4EQPA 5FLXE 1EIYB 1UAPA 2PQEA 3DBRB 2L3ZA 2WP8J 5HURA 1N63A 3DBRI 3ZJTA 4CKEA 2YTVA 2W9NA 4C2MH 4UP7A 3ERQA 4GLAC 2JA5G 3A9KA 1QE6A 4JVZA 1LTRD 2EJMA 2K5NA 3NP8A 5BN5A 1SYGA 4LFAQ 3BG3A 5FR6A 3RNBC 4A3MG 4HRSA 4C3HB 4A3FG 2ZZPB 5C4XB 1WJNA 3R7RA 1E1TA 4HEDA 2WXRA 1IBLQ 4F7ZA 1HE8A 4QB4A 1TYGB 2JK8A 1WCMG 3NY5A 3P4QB 1HZCA 1SYDA 5EGTA 4BY1G 5M3MH 1L4DB 4LF7Q 1EQVA 4BBRH 5IYDG 2ACZB 4DR4Q 4FVMA 3IFWB 2AWOA 1NE3A 2JA6G 2NVTB 2LVOA 3CXCA 2WXJA 4XDDA 5JJKA 4KHVA 5BO4B 4P1BC 3VVWB 2EKEC 1IHZA 3S2DB 3S14H 2G3QB 2I38A 1PTOC 3SGIA 4JI5Q 3PCOB 4POGA 3DHHC 2UXDL 3BYTB 4IO9A 2ZTDA 1XQQA 4A3KG 5ELDA 5C4JB 3KJOA 3HVDA 5IAAC 4JOIA 3AE3B 1DYQA 1FNVA 4KKUA 3FPUB 1TWCH 1BOSA 5EE1A 1WX9A 4GMVA 3AEBB 4MGYE 3QX1A 4LUZA 5M9OA 3JAMc 2KECA 1PA6A 4JI6Q 3M4YA 1U4MA 3S1NH 1WZ3A 1WXVA 3IVFA 1FL0A 5G5HA 1XF5L 4AYBG 3TN2A 1FCCC 3X23A 1SYCA 2WXNA 2BS3B 2HDLA 2KDIA 4S0RA 4E6IA 2Q2IA 2A1AA 1IBKQ 3URYA 1SE9A 2L52A 2EXZA 3GDEA 4K2KA 5EE3A 3D31A 3NJTA 1MD2D 1VZ7A 3W1SC 1VJKA 3J80L 3VR5A 1I5FA 1VQGA 5IGDA 5DEHA 2PEAA 4AIMA 1FJGQ 2FCQA 5LMUQ 4KIKA 1I3QB 2D62A 3SK6A 1QT9A 2IO3B 3EC8A 2O2VA 4IUMB 2K28A 4WH4A 5LMNL 4A3GB 1Y8OB 2QKIC 2DENB 3I4MB 2MJ3A 1ILQA 2B76B 4DUZQ 2R61A 1TS2A 2RD0A 3DVGY 1EY9A 5ELBA 1YN3A 3AB5A 5D2MB 5GAGC 1NBWA 1E0ZA 4A3JG 3DUZA 2L0CA 3SK8A 1V80A 2GBJA 2JWZA 3R3OA 3DBLB 1KNEA 1U5KA 4LF4L 1NDDA 1E2VA 4HLEA 1SE4A 3E56A 4DNIA 3H91A 2K6QA 3Q6SA 2PI2E 1TKGA 3A4SC 1I4HA 2ZM6L 1OEYJ 1WM2A 2LD9A 2MGSA 4JQWC 2CWPA 3S14B 3BIID 1K83H 1X1MA 4KMUC 1B4OA 4OO1G 1LTSD 1Z6HA 5IYCH 4GKJQ 5GMVA 1BCPD 1EZ6A 2J52A 4QIWE 1WRDB 1F2RI 1D2BA 2HCCA 4W9CA 3GV6A 1CKNB 1Q82C 4JI3Q 2VUMH 2JSOA 5FLMG 2MRPA 2RVLA 3MFGA 5AJ3L 2AKWB 2RF4A 3HOXH 3FEWX 1X3EA 4BA2I 2DUDA 3IBEA 3DWAA 4FO2A 1GUSA 2R6GA 1F2ZA 4LF6Q 5E7NA 1I50H 1B2TA 1WXQA 1TWGB 5K36H 3H94A 3AMZA 1R4QB 1DONA 2KJXA 1F2RC 2PE9A 2BKFA 3SR6A 3MVVA 2DAFA 2NPTA 4JI4Q 3M85A 4NNJB 4IW0A 2ZJRA 3N1XC 3AQQA 4B3RQ 4BWGB 1R4NI 1WE7A 2JE6I 4ID6A 1JWUD 2IT1A 3S2DH 4ICUA 4X57B 1HTLD 5IE8A 4OWWB 3IHPC 2MHVA 4WJWA 4JI7Q 1WR6E 3J9CA 5KHOA 4QL5A 2F3VA 4UP8A 3A5UA 3PS6A 1JT8A 3KYHC 1VCBA 1EOTA 3H09A 4JW0A 2MJDA 3NELA 2VY3A 4DK0A 3R3MA 5G2NA 2FFKB 1CSQA 1NMGA 3NQIA 3CSTA 5AZGA 4MJSA 4REZA 3SK4A 1TR5A 4C3IH 2ZEQA 4RGNA 3VUWA 4IWQA 2ES2A 1BKBA 1ZEQX 3VR6A 1HHVA 1PQSA 4DPGA 1E10A 2WB1G 3AE5B 2NVQB 5D3DA 4C3IG 4KTAA 1OTCA 1UF0A 3K5MA 4WJ3M 2QMTA 1LFDA 4C3IB 2DGYA 1L7YA 2F0QA 1A3VA 5FLXc 1PHJA 1FO4A 3UI2A 1N6ZA 1KRHA 3EQLC 3L2PA 1HZAA 2JQOA 5IYBH 4LF5Q 3PO2H 1I6HH 1T0QC 1KAWA 2IBIB 1TKYA 2ON8A 3J80c 2EY1A 4K2LA 3Q8FA 5ELCA 4K7UA 3W9CB 1C8CA 5JPMC 2XGTA 3H0GG 1Q1BA 4TSSA 4HMJA 2QHOA 3G4SA 1YIJA 3H3VC 2DYMA 4EE2A 1NMFA 4MTKA 1YJJA 3B2GA 3AEDB 3ETRA 3ONSA 4DDGD 3TEXA 1KTKA 1ISNA 5C23A 4GNXC 3MP9A 4A3IB 2B63H 2KDEB 1U9RA 3RR5A 4C4VA 4EQNA 1JWMD 1MHWC 4IPDA 2WDTB 2R2OA 3GS2A 1ZPSA 1EYDA 2LASA 2N0SB 3L54A 3DLLA 2K75A 1TTNA 2VUMG 4ACFA 3TS0A 3CW2C 1G2TA 1ONLA 1IXRA 1YHAA 2W3SA 4YTMB 1PRTF 1YN5A 3AEVA 1RODA 3FC4A 3QG1A 1F1HA 4PZ7A 1LACA 1WJUA 4C56C 2GLSA 2FJ2A 1A2TA 4PYUA 3FPPA 3HOYH 4LF5L 1KJTA 4XWTA 2R7DA 3QO2A 3VYRA 2B2UA 4FN2A 4WJ4A 3CC2A 3M3YB 2KFKA 4KHPL 4L5RC 1WTPA 2VQFQ 2WGSA 2MCNB 4AJYB 4RMFA 4H44C 1E8YA 4HXDA 1TZ1A 3V05A 1K8GA 2CWAA 2EMTA 3T3OA 1D3ZA 3Q24A 1A63A 1EUVB 2MQHA 1K73C 2Q2HA 1Z47A 4ZK9B 5L83A 2OJWA 2N88A 3OWFA 5I9PA 3H8HA 1O7ZA 2OTLA 4DHZB 2KTFA 1TT2A 5M3FH 5JOBA 1E90A 3J7YW 3U30A 1T5XD 4BBSH 2A68D 4GOCA 3OJ3A 3MC9A 2B2YA 2XNAC 3CSFA 1CKMA 3FHWA 2REXA 1WGDA 4PS7A 5COYA 1I94L 4UAIA 1WXSA 2JP1A 3VFKA 2MBBB 3GTKH 1XMQQ 1Y8PB 4R4CA 4DQOC 1E1OA 4RCNA 4CJ1B 2X69A 4JI4L 3ZDMC 3I9V1 5IN7A 5JVG3 2HD5B 5FR3A 1CQFA 2N9PC 4BAXA 2ZW0A 1O7YA 1HQRD 2PTLA 2KLCA 4DR1Q 2WV6D 1FEHA 1XJVA 4LF6L 3PIOA 4K7SA 3WAPA 3R2TA 2OCEA 2J0JA 3QHTA 4KDIC 3GOEA 2EE1A 5AJ3Q 4KK7A 1GVPA 1BMLC 3UE1A 4JI3L 1C3TA 3P2BA 5J22A 1WY8A 2C7MB 4GN3B 1LTID 3A5ZB 4R4OA 2NN6I 4IUUA 4C3HH 1V8QA 3JSVA 1DGSA 3I4OA 3RMHA 2KWCA 3N3KB 1ZE3D 4H2AA 1KAAA 4MJSB 1GJXA 1PYBA 3S1RH 4RGMA 2ZM6Q 4DR6L 5J3BA 1SFOB 2I46A 1Y1WH 1PVOA 3RZOH 3TEYA 4A3MH 1F9QA 1SFOH 4A3JB 2KX0A 1IKLA 2F03A 4LF4Q 5JXVA 4FF3A 2IHFA 2PLPA 3HKZE 2KJRA 4LWCA 1SMYC 1VQNA 2JN4A 5EDSA 1PDQA 3FILB 2NWGA 5IGCA 2WKCA 4LK1C 3PZDA 2JA5H 2RA4A 1Q7YC 1AW7A 4FJYA 3U4EG 4BBRG 3QC8B 1R4PB 1VQPA 2KFJA 1SNDA 2DJFC 3PO3G 3PVLA 2BF8B 4A93H 1K0SA 2R7ZB 1I4QA 1Y8NB 3WDNA 2NN6G 4DUZL 3NS8A 1X3GA 2KMAA 1DM0B 3U4VA 4KLKA 3EUB2 3QIJA 4IPCA 3J80E 4J6HA 3PIPA 5LMUL 1IGCA 2WP9B 1CKOA 1PTOH 5LL6X 4A3DB 3NZSA 2N7DA 4EUTA 1XD3B 3I4MH 1TY2A 1S72A 1YQ3B 4C3JG 2Z6BA 2WKDA 1EFWA 2K52A 1C4CA 3CMEA 2B2YC 4B95A 3PO2G 1MPEA 2X8XX 4BKTA 5JHAA 1E2ZA 4R4TA 1W6JA 2QDLA 1FCLA 3H7PA 4I6NB 1AE3A 1Q3LA 3PMFA 1WYDA 4H02A 2DYOA 2Y3AA 4M8NA 1UH6A 1J0GA 2XK5A 2ZJPA 1K0RA 1Z7TA 3C46A 2C9OA 4NAWB 3Q3OC 4ITKA 2KBNA 2OOBB 5IKCM 3RCZA 2QSDA 4M8AA 1G291 3EFXD 4P74A 3WWVA 4DV1Q 2AYOB 2UYZB 3FMCA 4KKSA 3AE8B 2L05A 1HXYD 2RKSA 3BS1A 2D5GA 3N32A 1EIGA 1V1PA 1ACCA 2BYEA 2SAKA 2PZTA 3WIMA 5H1SE 2Y5CA 2MUYA 4YCWA 1E24A 1EWCA 4BY7B 1OXTA 1XPOA 4JI5L 2FINB 1H95A 5C3EG 2XN9C 1U4AA 2ZXRA 3M3JA 4KKJA 3VR9B 1M94A 1I4PA 4GOPA 3BVMA 1SXTA 2WS3B 3R93A 3Q2AC 4YIJA 3A9JA 4HKZE 3H6MA 1WOCA 4JCVE 3KDFB 5JH5C 2JA7H 3CCSA 1S40A 2O2VB 3TZUA 2NN6H 1F77A 4YWGG 1E5WA 1SE8A 4XXEA 2M0AA 3KYCD 3VRAB 2JX5A 4BBRB 2BDOA 1L6UA 2MLBA 4XGAB 4LNNA 4X6AH 1LGRA 2JA7B 4QGUA 2CW0C 1STNA 2K6AA 2N1VA 4MHEA 1VQ7A 1LO5D 3PZ7A 4DV4Q 2YEPB 5FO8B 4EEWA 1PGXA 1V2YA 1BNZA 2WXPA 3T51B 3KUZA 3V6CB 4WWOA 2L83A 2R3ZA 4AUQC 1I4RA 1PYWD 1SR3A 4II2B 4DXAB 1C79A 5KYLA 2NBFA 1KH0A 4ZRJA 1DOKA 3HK0A 2SNSA 2Z1CA 2WX0A 3PO0A 2FXQA 2VQEL 1WFYA 4B9KA 2UU9L 4MN3A 4X3UA 3CCMA 1UGJA 3P1MA 5TSSA 4CKBA 1K28A 3HOZH 4DV6L 2R93H 4A4IA 4KD4A 4HCNB 1MFWA 5E6PA 1V43A 4OEMB 3TEZA 3GTGH 1RIPA 1XWEA 4KY5A 4HPMB 4L5TA 1EYAA 2AUJD 2BDNA 3K6OA 1SNMA 5G55A 2QILA 1B50A 4K0KL 4OZCA 3L08A 3G6EA 3DBLI 4FXCA 1HNXQ 2K1FA 1PH9A 2A8VA 5CHWA 4NZLB 4AQYQ 1X3FA 3OOCA 3S17B 5M5YH 2V4LA 3A8JE 2P5ZX 1M1KC 2F0EA 3KYDD 3E0EA 1NTGA 3CMMB 5CV4A 3DM1A 1KOTA 2LXKA 1YX6B 3ENEA 1DJRD 2I5LX 1PRTD 1GB4A 3B9JA 2YTYA 1MSHA 5I2XA 1U4LA 3TREA 1WGGA 3AN1A 3ZLZA 1UEAB 2A6HD 3PHWB 2N9LA 3ZNID 1XNQL 2D3CA 4DR2Q 2I5MX 4IFDH 4WAAA 3I72A 4CHTB 2MP2B 3DEPA 3GB1A 2FUHB 3N6RA 3GQBA 1GHJA 2B2TC 1NJIC 2HHHL 3PTFC 2BH2A 2EQSA 2M00A 1YX5B 4V0BA 4UY8C 3STBC 3RZFA 2WIIB 3HRZC 3HOVB 1WGRA 1ET9A 1S4ZA 3QIAA 3GP7A 3SXHA 2IY0B 2JT4B 4A76A 4GLXA 1JALA 3NUHB 5DPRA 2JU6X 5GADC 4POFA 1DOMA 1EIHA 3RMKC 3FKIB 4ZQ3A 2KOLA 3SFDB 2F0WA 1A0IA 4HN7A 4LUOA 1E3PA 1STGA 1V49A 4IALA 4FHJA 1FRDA 4IUQA 5AUKA 2F0SA 3E0JA 3I4NG 1N8RC 3HOWB 1FFVA 5A2QL 1IGDA 3UF8A 3ZIMA 2RHQB 1SROA 3PUXA 4YHHL 2E2IB 1YJ1A 3KQ4A 3S16B 2AQ2B 3ZTDA 4KV2A 4ZHOA 2IX0A 3OJ4B 3BVGA 2EELA 1C7YA 1PFMA 4IZ8A 4II3B 2C9WB 3Q3MC 2FCSA 2PPHA 1B9RA 3A7AB 3KUCB 2ONQA 3RZWC 3MTNB 3IAYA 5E4WC 2EYFA 2L00B 2OQKA 3AEFB 1K50A 4AS1A 3GO5A 3J7ZC 2N3SA 3P4RB 4JI0L 3VAWA 2E2DC 4WORA 4DKAC 4ZRQA 1BT0A 1VS0A 5IGFA 2KTRB 4FNFA 5ELNA 1VQ8A 1QJOA 2F0OA 4RF0A 1MHXA 4P1CC 3MAQA 1H9RA 1Q1EA 1WTWA 1QNUA 3HG9A 4O42A 4UDUC 4OHJA 4ME3A 4BXXH 3H0GB 3CWIA 2A6HC 1WMHB 1Y69U 4PT5A 4G7ZC 4WIPA 2Y5PA 5D3IB 3QWNA 3BK2A 4A3IG 2KC1A 3SDLC 2VS1A 3P42A 3QK0A 4A3FH 4RNAA 1VF5C 3WA0A 2KEEA 5GQOA 3ABVB 2J4XA 2UUCL 1VDVA 1T5EA 2NZ1D 4PK1A 4US8A 1HQMC 3CF6E 2QIEB 2HIVA 2B3AA 5IGEA 2PVGC 5LXHA 4KY7A 4IM2A 4BY1B 5JJIA 2OHFA 2A6EC 4BS9A 1JWSD 4J1MA 1NEKB 1Y14B 2K01A 2WAQB 1XYIA 5ELOA 1WGKA 2QDFA 2A68C 1QNKA 5D94A 1CFMA 4LK0M 3TMPB 1Q46A 1STAA 3NK9A 1V6EA 3T9LA 4RGTA 2L0TA 4ARCA 1CSPA 1QZGA 3Q8EA 2V3PA 3CCRA 4OX9L 4N9F4 3I4MG 4WQOB 2O6VD 3DBHI 1IBML 4YCVA 4DUYL 2JA5B 5C1ZA 3HOZG 4GLSC 2SNMA 3ICEA 1UBIA 4XIGS 2DN8A 3S2HH 1RLFA 4YSZB 1S3SG 3TSSA 4B3SL 1SF0A 2WXGA 5FO7B 2VL6A 4B3TL 3UDXA 5BYQA 3ZNGC 4O0AA 2K14A 1HRJA 1N5WA 1KLUD 4HJ7A 5AFWA 3IT6B 1YJIA 3KF6A 4JI2L 3M4OH 1HNWQ 4BVUC 1UZXB 3CAMA 3VTUA 4K8IA 4IM3A 3D4WA 2ZT9C 1IL2A 4F88A 2JYTA 3MC0B 1J7AA 2R93G 4DFAA 5IWAL 4TQ1A 4AQ7A 1BBUA 4X3SA 2QA4A 1E7UA 1ZUD2 3VYSA 1Y1WB 2L32A 3RZDH 4RG1A 2GBNA 2F0KA 3MEFA 3FKIG 3JYUA 4W9IA 4TQUS 3A55A 4RFBA 2O6VB 1HA5A 4DBGA 1S5DD 4GDKB 3VYUA 2J42A 3AEAB 1XMOL 3GTMB 1AWDA 3HOZB 2UU7A 4JG2A 4ME5A 4LDTB 4JK1C 2OF1A 4WFN3 4JIOU 4TQ0A 4L8JA 4DN4M 4EX5A 2N1WA 2LWPA 4W9GA 1V81A 2AL6A 4ILWA 2AX5A 2Z4IA 3I3CA 3P20A 3K80C 4ZCKA 2JEBI 1OQYA 3ZRFA 2KQSA 2JZ3B 2KA7A 4LF8Q 1U4PA 3NZ3A 4US9A 3SU8X 4OZAA 1JOOA 2KHJA 2LGXA 4FXGC 4PQXA 2A6ED 4LF9L 2K0PA 1WM3A 2RGFA 4GIVA 1R4MB 2LFNA 2PI2A 2UUBL 4A3CG 2JXXA 2JYEA 4NXNQ 1IW7C 2M56B 1K3BC 3FDTA 3ULLA 2V1YA 4MGZE 1QOGA 5EAYA 4C7YA 1EWIA 3TS2A 3O65B 4ZUIA 1Q12A 3CHBD 1D5MC 4DR5Q 1YOVB 4C3JB 2CHWA 2EJFC 3J81L 1MGSA 3TQYA 5JAVA 4LTUA 1N32Q 1WR1A 3DWMA 5EQ0A 1TZOA 3AEEB 4W9DA 2K7VA 5HKHA 4W9FA 1N36L 3V96A 2LUMA 1WJ6A 1XX8A 4A3EG 2HDEA 3FVQA 1FRRA 1O7IA 3W5OA 5BYSA 4L63B 1V9JA 4JLCA 3F2UA 1YJWA 4N8FA 4DR3Q 1VQ6A 3HVZA 2BVCA 1YNJC 1SYBA 3GTOH 1ZGUB 1J6QA 1HZ9A 3AECB 2IWHA 1T0RC 3M7NA 4A6QA 3C19A 2BB5A 4EOYA 1A8VA 2K03A 4DV0Q 3C2PA 4J3OD 4S3SA 4GZYC 3WANA 4ZAIA 3HOUB 2FHTA 3K0XA 1YN4A 3G71A 4PMCA 2E2JH 1MBYA 3AE4B 1ZP0B 2K50A 4JI1L 5FJ8H 5C3EB 4OO1I 2FAZA 2DYBA 4HDOA 2M9VA 2DNEA 1EM7A 2F0UA 1UELA 5CV7A 1QZHA 1PH2A 4CJ0B 3PQIA 1WIAA 2BYTA 3QOJA 2NTSA 2SDFA 2K33A 3CRKC 3BZDB 3RYTA 3AULA 1MKHA 1EF5A 5I2YA 2AHOB 3RZOB 4ABNA 1E8ZA 1NCVA 1H8CA 2F4VQ 1DCZA 4BBSG 4OWXB 2BPSA 2MW5A 1VMPA 3EN2A 1D6EC 3BYYB 4MEMA 3Q22A 1GUGA 1NR2A 1PH5A 3Q8AA 2QCZA 4IOAA 3STBD 1L5PA 4OO1H 1BCPC 2Q8TA 3QAQA 2K25A 5IP4D 2KWUB 4NAMA 5M3MG 1BO0A 2W82A 3A1QB 3I2ZA 3TP8A 5H92C 3QQ8B 4L1BA 2LEKA 1NUCA 3VRBB 3KF8B 2BE5D 3HOXG 1IYFA 3L17A 3K59A 2DZJA 2LS01 2E76C 1BUIC 2F0LA 3UINB 2F3IA 4RCOA 1BXTA 5KRUA 4NJ7A 2FCMA 1E22A 2YEPF 2WWZA 4DAMA 4HJ8A 3TUOA 2O2LD 4FJZA 2OT2A 2XWJB 3QB3A 4A3FB 3MXUA 4A8XC 2O6VA 3GTLB 4XX5A 5EE9A 1F9RA 5EE0A 1TWAH 2AQ1B 5CR3A 4IUPA 3SVMA 1STBA 4HJ5A 2MBOA 4ZRIA 1IPGA 2LFIA 1LT6D 4B3ML 4K5XA 1SYEA 2F52A 1DOLA 2CQAA 3F2CA 1NAPA 3HOUH 2A74C 1G6ZA 1ZKHA 3NVWA 4H13C 4B6WA 4GOPB 3S1RB 4IUTA 2JZPA 3CCVA 1LM8B 1HR0Q 1F2LA 4HJ9A 2JA9A 2ZTCA 1QOFA 1X3PA 2DBYA 4AJWA 1L2NA 1I50B 4V190 1BCPB 2VZAA 3PGZA 5H8YE 4HKQA 4X64L 1CZPA 2K04A 4K3BA 2XSCA 2VZKB 5A35A 2K9XA 4NMZA 3N20C 1U0LA 1D7QA 1VCIA 4HIKA 1EZ8A 2BQQA 3K58A 2WU5B 1UWVA 3W1YA 5D14A 2D3GA 4QIWB 2G9HD 2CW0D 2H4OA 4GNXB 1CM9A 2NBVB 2NCNA 3HOYB 2VH1A 5IP9G 5GAEC 4XQQA 1E8XA 3QR8A 2WAQG 1UWMA 2KC2A 2RSNA 5F2DA 4LNIA 3GZNI 1RM6C 2E8GA 1XT9B 3KOJA 1SJHD 2HTME 2KQ3A 2WFWA 2ZTEA 4PZ6A 3S16H 1I42A 3D32A 3HOXB 1WTVA 3ZXVA 1EY8A 3C1FA 3TZDA 2NR2A 4X65L 3MJWA 3FILA 2K6DB 2MWSB 3PIO3 2LMCA 2V1CC 3J81i 1R9TH 2MO1A 1PFSA 3D4DA 4B3MQ 4EKUA 5HFYA 1WI0A 1C4QA 1PZID 3HEJA 4LFBL 3PHXB 4WWPA 5CYUA 4YXDB 5MPOA 5M3FB 3ULPA 1YQ4B 1PH6A 2ZVNA 3N30A 1S5FD 5J2RA 2JJQA 2LXJA
chains in the Genus database with same CATH topology
1ZDVA 5CGKA 3MHBA 2VXWA 5JVH3 1CZWA 2SEBD 4B0MA 3C3LA 1GUOA 4KJNA 2B2VC 3GTPB 3U52E 1LTAD 3IKJA 2RQXA 1JQ4A 3P4PB 3OIQA 1NR4A 2IL8A 4C3HG 1H9KA 4RF1A 1MHHE 1KFYB 4DU9A 1K51A 4LAAA 1EYCA 1GXDC 3AE7B 4USAA 1PTOF 3ZYYX 1XLQA 2L5TA 4KD3A 1BQQT 1K53A 1IL8A 2BCOA 3K5NA 1IYUA 2E2JB 5EBDA 1BCPF 2NUCA 1RCVD 5KGUA 1K52A 1OXSC 1JMLA 4ZHPA 1FR3A 4DXFA 1KF6B 2GI9A 3L9AX 3EA6A 4NKLA 3NBIA 5M5YB 4OVZA 4YSYB 1QOHA 3FAHA 2F0NA 4WURA 1CA5A 2D9UA 1SJED 3VR4A 2F0GA 1V97A 2TSSA 2YYZA 1YNNC 1ICWA 1CQVA 3MZ5A 4WRDA 2AWNA 4IDIA 4G57A 5IT9E 3AV8A 3I4LA 4P2CB 5DM73 1WTXA 1LT3D 2IW3A 2ZXPA 1PRTC 3V3XA 1FIQA 1LTTD 1EWYC 4CKCA 5EKLA 1JWBD 4XT3B 2A5HA 4DAYA 3IAM1 5EKIA 1A3TA 5EBCA 4AYBB 1JR0D 1L0VB 3MJ5A 3W5UB 5BMGA 1JQYD 1BBXC 1DOIA 5HGTA 4RHRA 1FM0D 2RSOA 2J53A 3P1HA 2BS2B 4OIKA 4OL7A 4C1NI 2DWQA 1TWAB 3KBGA 1OXXK 1EEFD 2EDGA 3W3AA 3RUZA 3PO3B 3I70A 5C0XH 5T1IA 1CK1A 4K8JA 2F0MA 1HPCA 2JA8B 3K5LA 2O5IC 2PZWA 2WNMA 2KEDA 5FLXL 4DA2A 1VR9A 1ZOYB 1K83B 2PZUA 5EPKA 3PV0A 3P75A 2EYOA 3CRLC 1VLBA 4I7ZC 2K5QA 2MPMA 2H1EA 5EPJA 1VDZA 1L0YB 4RKLA 3DWGC 3N52A 3HUIA 2WXQA 5HG2A 3C8YA 2KMMA 2M2LA 4B9WA 2E2HB 5IGBA 1XLPA 3Q8BA 1HUMA 3PUWA 3KLSA 4I65A 3T16A 4ZYSA 1OXVA 4M0WA 1JW9D 1JRPA 4N9TA 1B44D 1AZQA 1E9MA 1C48A 3D3RA 1QKZA 5CBAE 3WCQA 4FXKC 4WAFA 1ZYRD 2L1AA 1W6KA 3IFTA 4C1NK 2WDVB 5JEAJ 4KN4C 2PW9A 1HA6A 3MTSA 2MP1A 1YNTE 3U2SC 3KWVA 4ZRZA 5KNBA 2WQYB 2L12A 1MVKA 4XQJA 4ZOHC 3KLSX 3ZJUA 3M7GA 1E0BA 1KDAA 4OZBA 5KEEA 1KDBA 2G9DA 2K3UA 3LYYA 1DGJA 1B3AA 3HGBA 1XXGA 5K5PA 2IX3A 2WXFA 4IQZA 1HZ5A 3Q69A 1A3UA 5IOCA 5J39A 2KHSA 1Q90A 1XCTL 3K5OA 3C1EA 1NVID 1E7PB 3NBHA 2WXLA 1EY5A 1TKWB 2KUMA 1HZ6A 2F0FA 1LV9A 1NYQA 2CHBD 1EY4A 5JEAH 2KACA 2BOSA 3IL8A 5ELFA 1SIJA 5JPNC 1OQQA 1Q10A 1SDFA 2D5DA 3ONAB 4K6LA 2MH7A 3MXGA 4WQMA 3KF8A 1SSNA 2PMVA 1K8MA 2LJIA 1NI3A 1OQRA 4D2KA 1A70A 1S5ED 5T1GA 3TMEA 1HFGA 4XQNA 3QOLA 3GTOB 3OW7A 2QF7A 4G7OC 3GTGB 3MWYW 1U4RA 1FD7D 3WOEA 4KN7C 3KUPA 2WXMA 1VMCA 1G91A 2HDMA 1QB5D 3NWTA 1S5CD 3RPFC 2RDFA 1PTOD 1C4PA 5DNFA 2F0TA 2JA6B 2I07B 1EL0A 5IIFA 2B2UC 1QOBA 2GRIA 2FUG1 2LGIA 5CV6A 5JJZA 4A9AA 1CT1D 1DOYA 2CJOA 1JWAD 1UNSA 1TS3A 2YU9B 4QUFA 3EJIA 2NB0A 3DXJC 4LJZC 4IUNA 3BK1A 1RHPA 2IGGA 2EOTA 1C78A 1T3QA 5M5XB 4A3EB 1GUWA 1TU2B 4RA8A 3D6WA 4C7ZA 2LHEA 1IW7D 3NRZA 2F0VA 4RH6A 3IAS1 1ZKOA 2L55A 1XO3A 2DY7A 1MI2A 2GA4B 3GTQB 1O80A 3T4AC 5I4DA 1TY0A 4IFDG 1XCQL 4KHZA 1YMHE 4G7HC 4A55A 1FD6A 5CBEE 3AE1B 3U9SA 1C4AA 4R8IA 1TWHB 3AH7A 2K05A 4DGZA 4ZKBB 4DNRB 2IPKD 2AQ3B 1V1OA 1JORA 4KGRA 2RPVA 1IKMA 2BBCA 1ET6A 2VB3X 3I73A 1WSPA 1FFUA 3R2IA 4CBVA 2EYMA 2RDHA 1QQRA 1G8ZD 1SBBB 2ICEC 2F1MA 1QILA 5C6AA 2K32A 4ODGA 5CORA 1JOKA 3IFDA 2JXMB 2VZKD 5EKKA 4MH8A 2BT6A 2JWUA 2E74C 5HI1A 1TWFB 2J0TD 2C5CA 1WVLA 4KGTA 4FXDA 3L4PA 2A69D 2PNRC 1EQTA 1N60A 1Q8IA 1PDXA 1OXUA 3CKIB 3PUVA 5DAUA 1GUNA 1PFDA 4B9XA 4NW2A 1LTGD 3ZGZA 3S2HB 5IODA 2NVXB 3SHLA 2DLBA 1PGAA 2IX1A 4Z9CB 1RKNA 4BBSB 1VRAB 5A2QE 3W5VB 1NSNS 4PMWA 2LKVA 3BDOA 1H9SB 2M19A 2VUMB 1QF6A 3GTKB 2JXTA 4HEA1 5C3WA 5K36G 4XE0A 2X6LA 4KKIA 2E75C 4H0LC 2XVSA 3ZQ4A 3KWLA 4KY6A 2BA1A 1WTQA 2ENBA 1JICA 4JE3B 1HTPA 1HUNA 2TMPA 1KLGD 4U68A 2J7ZA 3EROA 5LHY1 4ZLTF 2E6XA 4H7BA 1TQOA 2N9KA 2JYOA 4GDLB 3RFZB 1WD1A 2WDRB 4LLGM 1D4BA 2K5PA 2V4DA 2X38A 4L6TB 2F4IA 2PYKA 3J7AF 3OIPA 4IURA 2PW5A 1TS4A 2BA0A 2LMCB 4CQNA 4L2YA 2WB1B 2F0HA 3ND8A 1SSOA 2NTTA 1FGBD 3FRPB 3D8GA 4DK1A 3BDCA 1BF4A 4KJOA 3T3NA 2KAJA 4J8QA 2IGHA 2DNCA 1AEXA 1TJEA 2A69C 3I57A 2NVYB 1JC7A 5CV5A 2EY2A 3MXPA 2PIAA 2EYJA 2BB6A 1X32A 1WD0A 3HKZB 1NYRA 3I4NB 4K14A 5NUCA 1PLFA 1FYCA 1WCMB 3NTIA 4XT1B 4EGVA 3D4RA 2RBMA 3OWEB 1STHA 1PGBA 4R3DA 1A15A 3HS0C 3A7LA 3W2DA 1CJEA 4JWSC 4M1UB 3E9SA 3S1NB 2Z8LA 1BUVT 1O78A 2O5JC 2KDMA 5IT9L 5CV8A 1AYFA 2N7JA 2F0IA 1R9TB 3ZJVA 3K7AB 2I2YA 4HCSA 3X3MA 2EY5A 4C80A 4KX6B 2HCIA 1WYGA 5M5WB 2WXKA 2B8GA 4KKTA 1MI0A 1P7EA 2RMMA 5D65A 3L7ZC 3TP5A 2XIWA 2N55A 1IUEA 1RF2D 1JOQA 3VA5A 3AE9B 3PZ8A 5DM63 4NDXA 3PUYA 1AP0A 4N58A 1ZXIA 1VZ6A 3NQTA 4A3BB 3D6CA 1GOZA 1HEZE 3CU7A 3NTKA 1RTNA 4XWWA 1PZKD 2F3WA 1TVXA 1SE2A 2IJ0A 4TKOB 3BVZA 2VNUD 1O7LA 2FBWB 1E2WA 3VQIA 4RKBA 3U7ZA 2BE5C 5I9OA 1V1PB 4HAEA 3JAML 2WXHA 2CVRA 1ZXTA 5AUIA 4EVOA 5EPLA 2IDYA 2XRQD 2XWBB 3LXFA 3A8IE 3TEWA 2WDQB 1LTBD 3QJYA 3LX0A 3LWUA 1F0ZA 5C3XA 2G1EA 1RDPD 5EJWA 4HCEA 2X6GA 5KNDA 1UUPA 1G2SA 2B8FA 3OHXC 1EU3A 2K5WA 1VF7A 1D1KA 4K5WA 5J1ZA 1L6VA 1IBXA 4FF2A 3NTHA 4DNTB 4K6DA 1ZDXA 5D7GA 3AM9A 5CMDA 3L3OC 3PO2B 1F2MA 1I6HB 1NENB 2ZXOA 1HFNA 2WLBA 2K1BA 2PCFB 3P7JA 4JX1C 4PV1C 3KBXA 2E3TA 1SNQA 5BMIA 4FP5D 2WU2B 4B08A 1CHQD 1N61A 3LWEA 1M4VA 1EY6A 2Q8IB 2KCNA 4R8NA 1D5ZC 1TS5A 4C2MB 1I4XA 3BWUD 4MACA 5C44B 2OXPA 3W1SA 4HMIA 5IGGA 3J7AV 1RJTA 2WXOA 2D2CC 2VB2X 1B9MA 1FNWA 1ENCA 5M3MB 4CGYB 4RHSA 3WOFA 1X3QA 2R92B 3VR3A 3S15B 4A3KB 1ZYRC 3M4OB 3CQZB 1WWTA 4L23A 1II3A 3PIP3 2QEJC 4QF4A 4Y7NB 2PKOA 1QLBB 1TWCB 2QCPX 3G6JB 3A56A 1TIID 3MEHA 3R8BA 1QG7A 3MFYA 3LNNA 2L9HA 1CTMA 3B2FA 2EYLA 2CJNA 1C77A 4K5VA 1DXMA 2EJGC 4CJ2C 1QOAA 3NXWA 3J81E 1RFKA 4Q5VA 2W3RA 3V2TA 1J7CA 3I90A 5C3JB 3RD4A 5FOBB 3NPPA 2H88B 3T53B 1OFFA 5HHDG 1C76A 1GUTA 1HCZA 1CHPD 3DWQA 3I8ZA 1K8OA 1B53A 1R7SA 5C4HA 3T56B 1ENAA 2GB1A 4G4KA 1J8IA 3P4SB 1SEBD 3K57A 3S1QB 1DZ1A 1GAQB 4A90A 1DOXA 2OEOA 4X3TA 2XRSD 2PO4A 5KNCA 1YNND 4PMBA 2H89B 4IOIE 4N59A 3O13A 4XTCS 3CIRB 1F9PA 2B2WA 1N5XA 2F0DA 1CA6A 1GHKA 4XDCA 5CC4A 3Q23A 3AE6B 1J9OA 3AEGB 1L0XB 3MXNA 4FF1A 2INPE 1ESFA 1M8AA 1SB3C 1T6BX 4F87A 2EVBA 5BN3A 3A8KE 1PMRA 4NJCA 2KQ4X 2CU3A 1I4GA 4DXGA 1ENFA 3G7LA 1RWSA 2B2VA 2HQEA 4JPSA 3AU7A 4LMQD 1B1ZA 3VYTA 2QJLA 2KVMA 4JBWA 3SE0A 2FMCA 3VA7A 2F0PA 4IFDJ 2EY6A 2LHDA 1F2YA 3NHHA 5C4ZA 3NVVA 2KWDA 2ZW1A 1Y56A 4EQOA 3UI3A 2B63B 4RWSC 1PRTB 3GTJB 5I6WA 1KABA 3ITPA 5BYRA 2DY8A 4Q0FA 3GD7A 1VZ8A 3OMCA 2JQRB 3S1MB 4YTNB 4RGOS 1EY7A 1WTRA 2PMZB 3EVQA 2W54A 1L4ZB 4P6VF 2Q8RE 2BW2A 4FF4A 3NE5B 5LNK1 3DHQA 2KCCA 4IFDI 4ULLA 2B39A 4XYOA 5CV9A 4HR7B 1AN8A 4HJGE 1I7HA 5C0XJ 1BDOA 4X3KA 3E6ZX 5LL6S 2O4XA 4N6EB 4O1NA 2Z4HA 3SDZA 4BA1I 4ZKCB 4A3MB 4QMGA 2MJ8A 3GV3A 4YSXB 1E6EB 1N62A 1RD9D 4OGQC 4TRDA 1Y1VB 2A73B 3DMUA 2R93B 2EPBA 1AZPA 1SNCA 2Y0SB 4OW0A 2FMMA 2RDGA 4IN3A 3Q8CA 4KV6A 4IUVA 5KIXA 1JB3A 5ISRA 1KDCA 2JEAI 4KGSA 2HUGA 5E1FA 3SR1A 3AB9A 4NP5A 2PW7A 2PPBC 3KK7A 5FK9C 1DD2A 3OSOA 3T13A 4QCLA 1B9NA 1S5BD 3PUZA 2PVOD 3SEBA 1LLRD 1ZXHA 2WINB 3VR8B 5C0XG 3RLFA 1SYFA 1XLOA 2K22A 2L4NA 1PFNA 4N9PA 4QUCA 2V4IB 2V3NA 5GXGB 1ROEA 1FXIA 2BS4B 5BMHA 1WRIA 2V0GA 1OO9B 2MJEA 3KLRA 3NSWA 4P16A 2LY7A 1STEA 1ML0D 1JE4A 1JROA 1UWXA 4FYDA 5C0XI 1FMAD 2EKIA 1V8CA 4KI0A 4ZRPA 3VR2A 4ZUJA 1GB1A 4MIUA 3TP6A 2EYHA 3SK5A 4TMAB 1SMYD 3AE2B 1H9SA 1CI3M 4XDXA 1PXUA 2F0JA 1RTOA 4R9WA 2INNE 2JSVX 5G5GA 1AFPA 4ARIA 3Q0AA 5E3FA 5FO9B 3SFEB 1BR9A 2EYPA 2ICIA 1XLNA 1C9FA 1MSGA 3IT4B 1IBXB 2IGDA 3ND9A 1ILPA 3NVYA 4MT5A 3MA2B 3N9YC 3P63A 5FKAC 3TDQA 4WWMA 1FNUA 4DAPA 1CZGA 3HRDD 1J7BA 4IKGA 1H9MA 3I91A 2B2TA 1XTCD 3NUCA 3TP7A 5ELEA 4YT0B 2ID0A 1LABA 5C2TB 1JCKB 1PFBA 3BDLA 5KYIA 3NWSA 5C5LA 1EY0A 4F8MA 3U9OA 1F9SA 1A6XA 2K5DA 1RYJA 3NS1A 3A54A 1IYVA 4F7XA 3X3NA 3JAME 1D5XC 2Q5WD 1EU4A 1P7FA 1WTOA 1D1IA 2QDBA 2KN4A 3OMGA 2EZVA 5G3LF 1H9JA 4JWUC 4B0EA 3HP3A 1KNAA 3IXSA 1EFID 2WXIA 1EEID 2L1BA 2W55A 4MM3B 3DWPA 1SE3A 1YNJD 3DEOA 1QWYA 1PZJD 1I6VC 1LT5D 3NVZA 4OIJA 5E6JA 5JEAG 5BN4A 4YTPB 5G3LD 1STYA 1XEEA 1SAPA 1A2UA 2L11A 3OPOA 4DF7A 4PNYA 1EWHA 1ESRA 2SOBA 1PUTA 1FXAA 3TBIB 3LB8C 2WACA 4HTHA 4HSPA 3AMUA 4HROA 3K0YA 4U673 4A93B 4XYQA 2NYZD 2NMQA 1QCBD 5E4XA 5T8IA 2BTEA 5I6YA 1PTOB 3RZDB 1LT4D 2AUKA 2MEKA 1GPXA 5C5MA 4RAUC 3HZXA 2FE8A 2B2WC 3MHZA 4Q2JA 3EGRA 1SNPA 1TKEA 3E5SA 1SNOA 4HSVA 2OEDA 3S9WA 4DAVA 4EQPA 5FLXE 1UAPA 2PQEA 3ZJTA 2WP8J 5HURA 1N63A 4CKEA 3ERQA 1QE6A 1LTRD 2EJMA 3NP8A 5BN5A 1SYGA 3BG3A 4HRSA 4C3HB 5C4XB 2WXRA 4HEDA 4QB4A 1TYGB 3P4QB 1SYDA 5EGTA 1L4DB 1EQVA 2ACZB 4FVMA 2AWOA 2NVTB 2WXJA 4XDDA 4KHVA 1IHZA 3S2DB 2I38A 1PTOC 3BYTB 5ELDA 5C4JB 3HVDA 3AE3B 1DYQA 1FNVA 4KKUA 3FPUB 1BOSA 5EE1A 3AEBB 5M9OA 2KECA 3M4YA 1U4MA 5G5HA 1XF5L 3TN2A 1FCCC 1SYCA 2WXNA 2BS3B 2HDLA 4E6IA 3URYA 2L52A 5EE3A 2EXZA 4K2KA 3D31A 1MD2D 1VZ7A 1VJKA 3J80L 3VR5A 5IGDA 5DEHA 1I3QB 2D62A 3SK6A 1QT9A 2K28A 4WH4A 4A3GB 1Y8OB 2QKIC 3I4MB 2MJ3A 1ILQA 2B76B 2R61A 1TS2A 1EY9A 5ELBA 1YN3A 3AB5A 1E0ZA 3DUZA 2L0CA 3SK8A 3R3OA 1KNEA 1E2VA 1SE4A 3E56A 3H91A 3Q6SA 1TKGA 1I4HA 2MGSA 3S14B 3BIID 4KMUC 1B4OA 4OO1G 1LTSD 1Z6HA 1BCPD 1EZ6A 2J52A 1F2RI 1D2BA 2HCCA 3GV6A 2JSOA 2RVLA 3MFGA 3FEWX 4BA2I 3DWAA 4FO2A 1GUSA 2R6GA 1F2ZA 1B2TA 1WXQA 1TWGB 5K36H 3H94A 3AMZA 1R4QB 1DONA 2KJXA 1F2RC 3SR6A 3MVVA 3M85A 4BWGB 2JE6I 4ID6A 1JWUD 2IT1A 1HTLD 3J9CA 2MHVA 4WJWA 2F3VA 1EOTA 3H09A 2MJDA 4DK0A 2FFKB 3NQIA 4REZA 3SK4A 1TR5A 4RGNA 1ZEQX 3VR6A 1HHVA 1E10A 3AE5B 2NVQB 5D3DA 4C3IG 4KTAA 3K5MA 2QMTA 4C3IB 2F0QA 1A3VA 1FO4A 3UI2A 1KRHA 3EQLC 2ON8A 1TKYA 3Q8FA 2EY1A 4K2LA 3W9CB 5ELCA 1C8CA 5JPMC 4TSSA 1Q1BA 4HMJA 3H3VC 2DYMA 4EE2A 1YJJA 3B2GA 3AEDB 3ETRA 3TEXA 1KTKA 3MP9A 4A3IB 1U9RA 4EQNA 1JWMD 3GS2A 1ZPSA 1EYDA 2N0SB 1G2TA 1ONLA 2W3SA 4YTMB 1PRTF 1YN5A 1RODA 3FC4A 3QG1A 1LACA 4C56C 2FJ2A 1A2TA 3FPPA 4XWTA 3QO2A 3VYRA 2B2UA 3M3YB 1WTPA 4H44C 3V05A 3T3OA 3Q24A 1Z47A 4ZK9B 2N88A 3OWFA 5I9PA 3H8HA 1O7ZA 1TT2A 5JOBA 3J7YW 1T5XD 2A68D 2B2YA 2XNAC 5COYA 4UAIA 2JP1A 1Y8PB 4DQOC 4RCNA 4CJ1B 2X69A 3I9V1 5JVG3 5FR3A 1CQFA 2ZW0A 1O7YA 1HQRD 2PTLA 2WV6D 1FEHA 3R2TA 2EE1A 4KK7A 1BMLC 5J22A 1LTID 2NN6I 4IUUA 1V8QA 3RMHA 1ZE3D 4H2AA 1KAAA 1GJXA 4RGMA 1SFOB 2I46A 3TEYA 1F9QA 4A3JB 1IKLA 2F03A 5JXVA 4FF3A 2PLPA 1SMYC 1PDQA 3FILB 2NWGA 5IGCA 2WKCA 4LK1C 2RA4A 1AW7A 3U4EG 1R4PB 1SNDA 2R7ZB 1I4QA 1Y8NB 3WDNA 2NN6G 1DM0B 3EUB2 3J80E 4J6HA 1IGCA 2WP9B 1PTOH 4A3DB 5LL6X 1TY2A 1YQ3B 4C3JG 2WKDA 1C4CA 2B2YC 1MPEA 1E2ZA 1W6JA 1FCLA 1Q3LA 3PMFA 2Y3AA 2DYOA 1Z7TA 3C46A 2C9OA 4NAWB 4ITKA 2QSDA 4M8AA 1G291 3EFXD 3FMCA 4KKSA 3AE8B 1HXYD 2RKSA 3BS1A 2D5GA 1EIGA 1V1PA 1ACCA 2SAKA 2PZTA 2Y5CA 2MUYA 1MHXA 1EWCA 4BY7B 1OXTA 2FINB 4KKJA 2XN9C 2ZXRA 3VR9B 1I4PA 3BVMA 1SXTA 2WS3B 3R93A 4YIJA 4HKZE 3H6MA 3TZUA 2NN6H 1F77A 4YWGG 4XXEA 2M0AA 3VRAB 2JX5A 4BBRB 2BDOA 1L6UA 2JA7B 2CW0C 1STNA 2K6AA 4MHEA 1LO5D 3PZ7A 2YEPB 5FO8B 1PGXA 1BNZA 2WXPA 3T51B 2L83A 2R3ZA 1I4RA 1PYWD 1C79A 5KYLA 2NBFA 1KH0A 1DOKA 3PO0A 2SNSA 2Z1CA 4MN3A 4X3UA 3P1MA 1UGJA 5TSSA 4CKBA 4KD4A 1V43A 3TEZA 1XWEA 4KY5A 1EYAA 2BDNA 2AUJD 3K6OA 1SNMA 2QILA 1B50A 4OZCA 4FXCA 4NZLB 3OOCA 3S17B 3A8JE 2F0EA 5CV4A 3DM1A 1DJRD 1PRTD 1GB4A 3B9JA 1MSHA 5I2XA 1U4LA 3AN1A 1UEAB 2A6HD 2N9LA 4IFDH 3I72A 4CHTB 3DEPA 3GB1A 3N6RA 3GQBA 1GHJA 2B2TC 2M00A 4V0BA 2WIIB 3HRZC 3HOVB 1ET9A 1S4ZA 3QIAA 3GP7A 3SXHA 3NUHB 1JALA 2JU6X 1EIHA 1DOMA 3SFDB 3FKIB 4ZQ3A 2KOLA 2F0WA 4HN7A 1STGA 4IALA 1FRDA 4IUQA 5AUKA 2F0SA 3E0JA 1FFVA 3HOWB 5A2QL 1IGDA 3PUXA 2E2IB 3KQ4A 3S16B 2AQ2B 4ZHOA 2IX0A 3BVGA 2EELA 1PFMA 4IZ8A 1B9RA 3A7AB 2ONQA 3IAYA 5E4WC 2EYFA 3AEFB 1K50A 4AS1A 3GO5A 3P4RB 2E2DC 4WORA 4ZRQA 5IGFA 4FNFA 1QJOA 2F0OA 4RF0A 3MAQA 1H9RA 1Q1EA 1WTWA 1QNUA 3HG9A 4O42A 4UDUC 4OHJA 3H0GB 3CWIA 2A6HC 1Y69U 4PT5A 4G7ZC 4WIPA 2Y5PA 5D3IB 3QWNA 3BK2A 3P42A 4RNAA 1VF5C 2KEEA 3ABVB 2J4XA 1VDVA 1T5EA 2NZ1D 4US8A 1HQMC 2QIEB 5IGEA 2PVGC 4KY7A 4BY1B 2OHFA 2A6EC 4BS9A 1JWSD 4J1MA 1NEKB 2K01A 2WAQB 1XYIA 1WGKA 2A68C 1QNKA 1CFMA 4LK0M 1STAA 3NK9A 4RGTA 4ARCA 3Q8EA 2V3PA 2JA5B 4GLSC 2SNMA 4XIGS 2DN8A 4YSZB 3TSSA 1SF0A 2WXGA 5FO7B 5BYQA 1HRJA 1N5WA 1KLUD 5AFWA 3IT6B 1YJIA 4K8IA 3D4WA 2ZT9C 4F88A 2JYTA 3MC0B 1J7AA 4DFAA 4TQ1A 4AQ7A 4X3SA 1ZUD2 2L32A 3VYSA 1Y1WB 2F0KA 4TQUS 3A55A 4RFBA 1HA5A 1S5DD 4GDKB 3VYUA 2J42A 3AEAB 3GTMB 1AWDA 3HOZB 4ME5A 4TQ0A 2OF1A 4JK1C 4WFN3 4L8JA 4DN4M 4ILWA 2AX5A 2Z4IA 3I3CA 3P20A 2JEBI 3NZ3A 2KA7A 1U4PA 4US9A 4OZAA 1JOOA 4FXGC 4PQXA 2A6ED 2K0PA 2LFNA 2JYEA 2M56B 4HKQA 1IW7C 3FDTA 4C7YA 1QOGA 4ZUIA 1Q12A 3CHBD 1D5MC 4C3JB 2EJFC 3J81L 1MGSA 5JAVA 4LTUA 3DWMA 5EQ0A 1TZOA 3AEEB 2K7VA 3V96A 2LUMA 1XX8A 2HDEA 3FVQA 1FRRA 5BYSA 4L63B 3F2UA 3HVZA 1YNJC 1SYBA 3AECB 2IWHA 3M7NA 4A6QA 2BB5A 2K03A 3C2PA 4J3OD 4S3SA 4GZYC 4ZAIA 3HOUB 2FHTA 1YN4A 4PMCA 1MBYA 3AE4B 1ZP0B 5C3EB 4OO1I 2M9VA 2DNEA 1EM7A 2F0UA 5CV7A 4CJ0B 2BYTA 3QOJA 2NTSA 2SDFA 2K33A 3CRKC 3BZDB 5I2YA 3RZOB 4ABNA 1NCVA 1DCZA 1VMPA 1D6EC 3BYYB 3Q22A 1GUGA 1NR2A 3Q8AA 1L5PA 4OO1H 1BCPC 2Q8TA 4NAMA 1BO0A 2W82A 5H92C 3TP8A 4L1BA 2LEKA 1NUCA 3VRBB 2BE5D 3K59A 2LS01 2E76C 1BUIC 2F0LA 4RCOA 1BXTA 5KRUA 2YEPF 3TUOA 2O2LD 2OT2A 2XWJB 3QB3A 4A3FB 3MXUA 4A8XC 3GTLB 5EE9A 1F9RA 5EE0A 3SVMA 2AQ1B 5CR3A 4IUPA 1STBA