2LGXA

Nmr structure for kindle-2 n-terminus
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
94
structure length
94
Chain Sequence
MALDGIRMPDGCYADGTWELSVHVTDVNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Membrane Binding of the N-Terminal Ubiquitin-Like Domain of kindlin-2 Is Crucial for Its Regulation of Integrin Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Fermitin family homolog 2
total genus 8
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18124 Kindlin_2_N Kindlin-2 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lgxA00
1WJNA 3CF6E 2KQSA 3JVZX 4MGIE 4I6LB 1KOTA 3PLUA 2NR2A 3AU4A 3A4RA 4DHZB 2LGDA 4EZLA 5IA7A 3RZFA 4JL9A 2O6VB 4W9DA 4TV3A 3ZO5B 2JZZA 4HDQA 2KD0A 3JSVB 4JIOU 3U30A 2FUHB 1E8WA 1GNUA 3AXCA 4W9FA 1WGGA 2G4SA 2BKRB 4X57B 4B95A 2O6VA 4W9KA 4BVUC 2LASA 5CHVC 2PE6B 1IPGA 1V2YA 3M63B 4HJKA 4HVBA 2BYEA 3QK0A 2KDIA 2V3SA 1OEYJ 2N4FA 2A4ZA 4DHJD 4HXDA 1XQQA 4K7UA 5CHWA 4N9F4 4FBJB 3ZRCA 1GUAB 4HPMB 4MELA 3IFWB 4WWOA 1G6JA 3SU8X 4BKGA 4JQWC 5TR5A 2IO0B 3WAPA 1WGRA 3QAQA 2RSUA 3UIPB 4KSKC 1TTNA 1WX8A 4HCNB 2FNJB 3X0WA 3MJWA 3WAOA 2IYDB 5J18A 1LXDA 2N1VA 3OJ3A 4NQLB 4MGYE 4EUTA 5DPWA 3LDZE 1S3SG 3S2AA 3L54A 4NJ7A 2PPHA 5KHQA 2KTRA 2BKFA 3QWZB 2YVCA 1LM8B 2N7DA 2NS5A 2KWCA 5G55A 2M4NA 3R3MA 3QCAA 3K9OB 3V60A 4BOZB 3IG3A 2J0MA 2FIDA 4K1RB 2L8JA 3QIJA 2KN5A 3VTUA 2AYOB 2D2QA 3PSEB 2KHWB 3U7DA 1WXVA 4DWFA 4M8NA 1V86A 1UH6A 3DCGA 1NDDA 2D3GA 2IO3B 2D10A 2WWZA 2FCQA 3OAWA 3N30A 2KWUB 2KKCA 1KM7A 2NCNA 2KJ6A 3B08A 1E7VA 3H7PB 5CX3A 3A4SC 3RD2A 2KO3A 3DPDA 4WWNA 4TQ0A 3PS6A 4MSQB 1WMHA 1L2NA 3KVFB 2B3AA 3P2BA 3VH4B 2AEHA 3PLVA 1E8ZA 4GOCA 2ASQA 2KFKB 4GDKB 1OGWA 4ZRJA 4F1SA 2MLBA 3GZNI 1P1AA 1ZGUB 3ONSA 1M94A 3A9KB 3T8MA 4DK5A 2MA9B 4I6NB 1E5WA 2ZZPB 4A3OA 2LD9A 4K81A 2L3ZA 3W1YA 4LCDE 2NVUI 3ZTDA 4FJZA 2D07B 4ICUA 4KZ0A 4PYUA 4OVVA 5L95C 2M0XA 3A33B 2MQJA 2KTFA 2MBBB 2WDTB 3DVNU 4AP4C 4HLEA 5JHBA 2CKHB 2AL6A 2KX0A 5D6JB 2K6QA 2BF8B 3QARA 2REXA 2MBEA 3AU5A 2DZJA 2V4LA 4IW0A 3RULA 2MRPA 4FULA 3EFUA 4IUMB 2ZCBA 4GMVA 4DDID 4IM0A 3IBEA 2MBQA 5LXIB 2LUEA 3DVGX 2K8BA 2Y5BB 3PV1A 4YL8A 2LGYA 3HM3A 2LRUA 3WA0A 4FADA 1QZEA 2G3QB 1SGHA 1UD7A 5JH5C 1WR1A 1WZ0A 3TJPA 1TGZB 1P98A 1T0YA 2ZPNA 2CHWA 2JY6A 3L08A 3ZDTA 1E90A 4WJQA 1CMXB 4EZKA 4ZRIA 4FN2A 1Q5WB 3ZUNA 1NBFC 2BYFA 4HPLB 2HE7A 2KWVB 4HCPB 1I35A 4MJSB 1WIAA 2PEAA 3BY4B 4A20A 3L17A 2WX1A 5AEKB 3HIZA 1LFDA 4E3CA 3VUYA 3KYDD 2R2OA 3ZNGC 1YX5B 3O65B 5LXHA 2MWSB 5D94A 2KX3A 2N1WA 1UBIA 3PGEA 1U4AA 1TBEA 1GG3A 5DCNA 3CSTA 4ZDVA 1RLFA 1UBQA 4J6IA 3SHQA 1WRDB 2RD0A 3KUCB 4AWJA 2RR9A 2DENB 3NHEB 4KDLB 2C5LC 3T9LA 3L13A 2NBUA 5J17A 4II3B 1R4MI 2K8CA 3B0AA 3PHXB 4G0NB 3MHSD 4K7SA 5KHOA 3ZKJC 5C23A 4AJYB 2IY0B 4NNJB 3M95A 2V1YA 4OVUA 3EC8A 5DPRA 3RYTA 3ML9A 2XK5A 3DDCB 2JZ3B 3V62A 4IC7B 3H1UA 4WAAA 3QA8A 3VAWA 1P9DU 2FCSA 4FJVB 3ALBA 1E8XA 3ZVVA 2DZIA 4DBGA 3KW5B 2EKEC 2FCMA 2L05A 4W9IA 2JT4B 2ZEQA 5FR6A 4DHJB 1PQSA 1V5TA 1NI2A 4A3PA 3TCAA 2C7HA 3PRMB 1XD3B 2K1FA 3RUIB 2L7RA 3R66C 3OLMD 5D7GA 4F8CB 2I1KA 4HK2A 4G50A 4NAWB 1J8CA 2L76A 1V49A 4W9LA 1EO6A 4PS7A 1WJ6A 3ZDMC 2AWTA 1WX9A 2KVRA 3WIMA 2OOBB 3DBLI 3KUZA 3LJ3A 3ZW3A 5HKHA 3PZDA 3APDA 2IO1B 4F7ZA 2DYMA 2ZNVC 4ANXA 4K7WA 3NS8A 2DX5B 4M0WB 4NJ6A 2KJRA 2JRIB 1LQBA 4BBNC 5DPSA 3APFA 3PHWB 2ZNVB 4GGQA 3B1LX 4ASWC 4FHKA 3ENEA 4MGZE 3ZNZB 1FXTB 4AJWA 4BOSC 4KSLC 2MX2A 1UGMA 1RRBA 2KANA 1V6EA 2KDBA 2FIFA 2KTRB 2L0FA 3IHPC 4MDKE 2C7NB 1YJ1A 4EFOA 4URKA 3IVFA 1ZKHA 2PJHA 4XC2A 2FAZA 2EMTA 4IWQA 5G2NA 1Y8RC 3D32A 3CSFA 3L16A 1WGDA 1UELA 1WXAA 1X1MA 2GOWA 4PS8A 4KDIC 2HD5B 1EF1A 4B9KA 5AZHA 4IG7B 4IWOA 2BYVE 4KZCA 5CHFA 3V61A 3KYCD 1P3QU 4KIKB 3ML8A 4GDLB 4GDKA 1WR6E 3X23A 1V9JA 3A9KA 2K8HA 4IWPA 2LXAA 5JZEB 2AL3A 3Q3JA 4GU2A 3L0WB 3U8ZA 4TUUA 3H9DA 2R2QA 3A9JB 2M17A 3DVGY 3K9PB 2LZ6A 5E6PA 5LLIA 2IO2B 2BWES 2K39A 3VTVA 4HWIB 1WM3A 1WMHB 4GIVA 3HK0A 3UINB 4WJPA 3L10B 3AULA 4LDTD 3VQIA 3V6CB 2I1JA 4MGKE 2LWPA 3EECA 3N32A 3VUWA 2CHXA 4ZYNA 2Z0DB 3UIOB 2O2VA 2XK5B 3I3TB 3RZWC 2KZRA 4PYZA 2LXCA 2XBBC 4RMAA 2WYQA 3QJZA 2KFKA 3JYUA 2ZVNA 1P0RA 1KLVA 3HHMA 1H8CA 2CS4A 2G45B 3APCA 3SD5A 1HE8A 2JVCA 4W9CA 2J0KA 2KOXA 1F9JA 4GB9A 4KVGB 1YQBA 1I42A 3VFKA 4DDGD 2JWZA 4WWPA 1WH3A 3BINA 4EZJA 3H7PA 2O6VD 2JF5A 3VH3B 3ZIMA 1SE9A 4CHKA 4G11A 3W1SC 2KMCA 1V80A 3DOWA 1K8RB 3W1SA 4EOYA 1WJUA 3SDLC 1MG8A 3ZLZA 2KXJA 2PE9A 2GBMA 2KDFB 2LRWA 4MM3A 2LI5A 3ZRFA 3DVNV 1C1YB 1E7UA 1Z5SB 3AI5A 2KNBA 1WGYA 3MTNB 4MJSA 2NBVB 4BKTA 2L00B 3M62B 2EMSA 2IZVB 3A9JA 4W9JA 2MCNB 4EEWA 1Q0WB 4BKSD 2GBNA 2K6DB 2KMAA 2DHZA 3DBRI 1WXMA 1WF9A 2GBJA 3M3JA 2LVQA 2XEWA 2NPTA 2HJ8A 2DAJA 2C9WB 4BFRA 3KUDB 1EUVB 3TBLD 2DYBA 4IM3A 2GBRA 2ZVOA 1WFYA 1XT9B 2CR5A 3C0RB 2N9XA 3KH0A 3ZTCA 2CU1A 3ECIA 3H7SA 4WJOA 3N3KB 4DXAB 2NPTB 1GJZA 1AARA 2FCNA 3DQVA 1Q1OA 1C3TA 2N9EB 2DZKA 3PREA 4GXBA 4ZRKA 4CO7A 3VUXA 2D11A 4KV2A 2KQ7A 3ZNHB 1H4RA 1VCBA 4B6WA 1EF5A 2GMIC 2MBHA 2JPHA 3UF8A 2LVOA 4FLHA 3UQAA 1V5OA 4WJNA 1OEYA 2Z59B 3QX1A 2KLGA 2ZCCA 1YD8U 2MBOA 4LDTB 2N7EA 1ISNA 1WX7A 2J7QB 1WYWB 1D3ZA 4IM2A 3R7RA 1WM2A 2A5UA 3V6EB 1WE7A 3GOEA 1WZ3A 3TMPB 3VDZA 3QQ8B 4XZ4A 3NZSA 3CMMB 4ICVA 4W9GA 3NY5A 1J19A 3VTWA 1WI0A 4GDLA 2JRHA 4AUQC 4KIKA 4DHZE 4MH0E 4W9HA 1GC7A 3DBHI 2KC1A 1L7YA 4HDOA 2WX0A 1YX6B 3HM6X 4XX5A 2BPSA 4II2B 3WALA 2GBKA 3EHVA 2MP2B 2OJRA 3VVWB 5GMVA 1TZ1A 4TKNA 3Q3FA 5JHAA 4P7IA 3UGBB 4G3XB 3WAMA 5L83A 1KJTA 2M1MA 5BO4B 2NBWB 5E6OA 4EKUA 1GC6A 1IP9A 2K25A 3NOBA 2IBIB 2IY1B 2N9PC 3A1QB 1SIFA 4LJOB 4LJPB 4M8MA 4BBNF 4ANWA 4AOFA 1WXSA 5DPTA 4W9EA 4JLCA 4NAWA 2MP2A 1OQYA 5IAAC 5EDSA 4E71A 2HTHA 2ZJDA 4ANVA 3PPAA 1YIWA 2M8SA 1WE6A 4NPNA 3TIXA 4MEMA 2BWFA 4CYEA 3DBSA 3A1QA 2UWQA 2LGXA 3RCZA 3H6NA 3UQBA 1UZXB 2CHZA 1ZW7A 4FJYA 2KFJA 3PRPB 3ZNID 1BT0A 2C7MB 2QHOA 2ZPYA 5J2RA 2JXXA 1IYFA 4PS3A 2G4DB 3TL5A 3VXWA 4FA6A 3NZUA 2UYZB 3VHTC 2LVPA 4WQOB 2DAFA 3PVLA 3QHTA 5AZGA 2RPQA 4GSWA 3PTFC 1RFAA 4MSMB 4ANUA 4NY0A 1E8YA 1V81A 1WJ4A 4GN1A 5D2MB 4I6PA 2RGFA 2KJHB 2YLMA 1JRUA 3R7QA 3JW0X 2J0JA 1A5RA 2VRRB 5CTRC 2MSED 2KK8A 1WGHA 2BGFA 2W9NA 3PRZA 4JGHB 4TQ1A 2DZMA 1J0GA 2C60A 2KLCA 2LJ5A 4RM9A 3WANA 2O2VB 2KDEB 5AZFA 3PT2B 1VD2A 1RAXA 1Z2MA 2KC2A 3OJ4B 1R4NI 3QC8B 4E74A 1OTRB 1WY8A 1S1QB 2DYOA 5E6NA 3RT3B 3JSVA 4FHJA 5C1ZA 2MW5A 2Z0EB 2L0TA 4BKSA 4RM8A 4NQKE 2JUOA
chains in the Genus database with same CATH superfamily
1A70A 3PLUA 3A4RA 2OJWA 3V3XA 5IA7A 3RZFA 3IAM1 4KGSA 3HVDA 4JIOU 3U30A 2QJLA 1E8WA 1GNUA 1R4MB 2DWQA 3AXCA 1DOYA 3URYA 4X57B 4BVUC 2LASA 1L6VA 1IPGA 1V2YA 3M63B 3ZJTA 3BVMA 1JWMD 2V3SA 3ETRA 1XQQA 1FFVA 4K7UA 5CHWA 4N9F4 3ZRCA 3IFWB 4WWOA 3SU8X 4BKGA 5TR5A 2Y3AA 3WAPA 4ITKA 1WGRA 1WWTA 3QAQA 1ET9A 3WAOA 2K22A 2IYDB 4M00A 1LXDA 4MM3B 3OJ3A 4NQLB 5TSSA 3NRZA 4EUTA 2PPHA 2KTRA 2WS3B 2BKFA 3QWZB 2N7DA 2NS5A 2M0AA 1Y56A 5G55A 1IGDA 2WQYB 3QCAA 3IG3A 2FIDA 2L8JA 2KN5A 2QDFA 1QQRA 1V86A 1T5XD 2FCQA 4USAA 3N30A 3ZXRA 4C00A 2BBCA 3I9V1 3L4PA 1PGXA 3H7PB 1ET6A 3AE5B 3PS6A 1E8ZA 4GOCA 4OW0A 4GDKB 1UWMA 4ZRJA 1P1AA 1ZGUB 1EM7A 3A9KB 5D3DA 4DK5A 4I6NB 1HQRD 1K50A 2ZZPB 2L3ZA 2AQ1B 3ZTDA 1AWDA 4FJZA 2D07B 1QKZA 1PDXA 4BAXA 4OVVA 2BS3B 3HRDD 3AE1B 4EE2A 2MQJA 5H92C 1C4PA 2WDTB 2OEDA 5JHBA 4YT0B 4WWMA 1FCLA 2KX0A 5D6JB 1MHHE 1JWUD 3QARA 2REXA 1YN3A 3AU5A 2V4LA 2MRPA 3RNEC 3ABVB 1F0ZA 1IBXA 2Y5BB 3PV1A 2LGYA 2LRUA 3MC9A 2ZPNA 4IOIE 2CHWA 4WJQA 3DHIC 4ZRIA 1NBFC 2KWVB 1SE3A 1WIAA 1VZ6A 2PEAA 3ZJVA 2MJEA 2MWSB 5D94A 3VRBB 2N1WA 1UBIA 1E9MA 3Q3OC 1SXTA 5DCNA 3AECB 4KDLB 3T9LA 5J17A 4K7SA 4OZAA 1XCTL 3M95A 5DPRA 1XCQL 2ZW1A 1HTQA 2DZIA 3KW5B 5EE0A 3T3NA 2JT4B 2ZEQA 1NI2A 2C7HA 1RWSA 3RNCC 2I1KA 3FILB 2JXTA 1J8CA 1V49A 4W9LA 3ZDMC 2KVRA 4RFBA 3PZDA 2J4XA 3DBHB 1JCKB 2DYMA 4ANXA 4WURA 1J7BA 4NJ6A 3PHWB 2ZNVB 4ASWC 4FHKA 2BQQA 4JWUC 3ZNZB 4AJWA 1N62A 1WXQA 1VR9A 1AW7A 4ZHPA 2HDEA 2KDBA 2KTRB 4EFOA 2EMTA 2WU5B 4IWQA 1YQ4B 1Y8RC 5HFYA 1JWAD 2GOWA 4PS8A 1PGAA 1EF1A 4IWOA 3ML8A 4GDLB 2HJ1A 2JWUA 2WXKA 3A9KA 4IWPA 2VZKB 2AL3A 3H9DA 3DVGY 3Q14C 3EGRA 2BWES 4GIVA 3TEZA 2LGSA 1MI0A 3V6CB 2LWPA 3EECA 3VUWA 2I38A 2CHXA 2Z0DB 2XK5B 2JQRB 3I3TB 2E6XA 2WYQA 2X38A 2KFKA 3JYUA 1H8CA 1YN4A 2JVCA 2KWDA 2J0KA 1F9JA 4GB9A 1TY2A 4KVGB 4DDGD 4WWPA 3BINA 3H7PA 3P1MA 2JF5A 1NYQA 1SE9A 2KMCA 3DOWA 3NVYA 4EOYA 3P42A 1WJUA 2KXJA 1VJKA 2PE9A 1SIJA 1FNWA 1C1YB 1WGYA 3MTNB 1L0VB 2LEKA 4BKTA 2L00B 3M62B 2EMSA 3A9JA 2MCNB 4C7ZA 2GBNA 2K6DB 2DHZA 3DBRI 1WF9A 3NVZA 2LVQA 3P4PB 2C9WB 4BFRA 1CJEA 2N9XA 3ZTCA 3H7SA 1C76A 4WJOA 1GJZA 3AMZA 1AARA 2FCNA 2PW9A 1Q1OA 3DQVA 3Q8BA 1MFWA 4US8A 4ZRKA 2G9HD 1H4RA 4B6WA 3NS1A 4N6EB 3SEBA 2Z59B 1QOBA 5EE1A 1KTKA 1TY0A 1D3ZA 1DOIA 3V6EB 2EELA 3QQ8B 1SE4A 2BW2A 4W9GA 1WI0A 1GB1A 4KIKA 4DHZE 1FO4A 1GC7A 3DBHI 3AN1A 4HDOA 1YX6B 3FKYA 1XXGA 1ACCA 3GS2A 2XN9C 4P7IA 5L83A 2RMMA 1KJTA 2NBWB 4EKUA 4TSSA 4M8MA 3A1QB 1SIFA 3DHHC 4AOFA 1OFFA 3RNBC 4DXGA 3FAHA 3NVVA 5IAAC 2BTEA 5BMIA 4E71A 2HTHA 4OZBA 4LNNA 2PVOD 4MEMA 2BWFA 2R61A 2ZW0A 3RN9C 5FR3A 1UZXB 3OWEB 4XE0A 4FJYA 2KFJA 5IOIA 1IYFA 5J2RA 3TL5A 3NZUA 2QSDA 2DAFA 5AZGA 2RPQA 4ANUA 1E8YA 4I6PA 2KJHB 4YSXB 1VLBA 1WGHA 3PRZA 4TQ1A 2DZMA 1J0GA 1SJHD 1Z2MA 3OJ4B 3Q8EA 1R4NI 3JSVA 3NZ3A 1V1OA 1SE2A 2Z0EB 3LXFA 2L0TA 4YTPB 1NENB 4MGIE 4I6LB 4EZLA 1DGJA 1ZPSA 4JL9A 2O6VB 3VR9B 4TV3A 3Q69A 2KD0A 4XWTA 4HRSA 1FD6A 4W9FA 1V8CA 3R8BA 2TSSA 3P63A 3SFDB 1C79A 2O6VA 1ZXIA 4W9KA 5CHVC 1D5MC 1ZOYB 3AM9A 1YJJA 3CIRB 1EU3A 1F1HA 4FBJB 4HPMB 2IO0B 1JROA 3UIPB 1WX8A 1ZDXA 4HCNB 2QC8A 3X0WA 3RNAC 5DPWA 2KQ4X 4JPSA 2H88B 2YVCA 1LM8B 1TJEA 4AS1A 3R3MA 2WXNA 3K9OB 4BOZB 1WYGA 5FK9C 1DOXA 1TKYA 2GI9A 2CU3A 2J0MA 3QIJA 5IO9A 3VTUA 2WXPA 3PSEB 2IGHA 1D4BA 1FEHA 2IO3B 2K0PA 2D10A 2WP9B 3OAWA 2KWUB 1SSNA 5CX3A 3B08A 2VH1A 4MSQB 1WMHA 3KVFB 4HKQA 2QILA 2BVCA 5IKCM 2INPE 4R3DA 2ASQA 3W5UB 2MLBA 1YN5A 3DBRB 5E6JA 3W9CB 1E5WA 1XEEA 3MJ5A 4A3OA 4LTUA 4QAYA 2NVUI 1C9FA 4ICUA 4KZ0A 1TIFA 3R2TA 2QIEB 1T0SC 3A33B 2KTFA 2MBBB 2WDVB 4HLEA 1C77A 2FBWB 4YTNB 1QT9A 2DLBA 4FULA 2ZCBA 4GMVA 4HEA1 3DVGX 4OHJA 2G1EA 1CQVA 1SGHA 2J42A 1WZ0A 4EZKA 2BYFA 2HE7A 4MJSB 2R2OA 3NVWA 3O65B 3MP9A 2OHFA 4PK1A 1ZXHA 3P4QB 1JWSD 3N1ZC 1UBQA 1UWXA 3B2FA 1GOZA 2NTTA 2RR9A 3NHEB 3TUOA 2GRIA 4II3B 1R4MI 5G5HA 2IY0B 2V1YA 3ZXVA 2KMMA 2JZ3B 3V62A 4IC7B 3H1UA 3VAWA 2FCSA 4FJVB 1E8XA 4KGRA 2L05A 1L0XB 2RDBC 1PQSA 1L5PA 3PRMB 1XD3B 1VDVA 1I4RA 2SAKA 2L76A 4PS7A 1WX9A 2OOBB 1SBBB 4M01A 4O1NA 3LJ3A 4DXFA 2JZPA 2IO1B 2ZNVC 4K7WA 2DX5B 4M0WB 2KJRA 3N1XC 1E6EB 2INNE 3B1LX 3C8YA 4C4VB 4MGZE 4C80A 3CWIA 4KSLC 2MX2A 4ACFA 2I2YA 2KANA 4M0WA 4RCOA 4S0RA 2BB6A 3GZNB 4XC2A 1UF0A 4RNAA 1MPEA 1ROEA 1WGDA 1WGKA 4IG7B 4KZCA 1IGCA 2BYVE 5CHFA 3V61A 3KYCD 4KIKB 1KH0A 1L0YB 1WR6E 2WDRB 1L4DB 1T0RC 2LXAA 4HKZE 5JZEB 2LZ6A 5LLIA 1MHXA 3HK0A 3UINB 3AULA 3EUB2 3AEAB 2W54A 4YWGG 3UIOB 1TT5B 1FNVA 3PO0A 4JE3B 4ZHOA 2LXCA 1UNSA 1KLVA 3HHMA 3AE4B 1BMLC 3SD5A 1HE8A 2WXQA 3IT4B 4LNFA 1J7CA 2KVZA 5I4DA 3VFKA 4A8XC 4S17A 2O6VD 3VH3B 3ZIMA 5C2TB 4CHKA 3RMKC 3W1SA 1FRDA 3SDLC 3ZLZA 5BMGA 2GBMA 2KDFB 2LRWA 3ZRFA 1GB4A 1E7UA 1Z5SB 4MJSA 4W9JA 2N0SB 1WXMA 4US9A 2INCC 4IM3A 2ZVOA 2CR5A 3RPFC 1PFDA 4DXAB 3AEEB 4CQNA 1GPXA 1WSPA 1TS3A 3PREA 4GXBA 4CO7A 3IXSA 2D11A 3ZNHB 1KF6B 1VCBA 1XLPA 1EF5A 3BK2A 2WXHA 3UF8A 3RFZB 4FLHA 1V5OA 4WJNA 4XDCA 1HZ5A 1JALA 1YD8U 3RI7C 2N7EA 1WX7A 1WYWB 2IPKD 3C19A 2A5UA 1FNUA 2DNFA 1WE7A 1RM6C 1ZP0B 3CMMB 4ICVA 2D3BA 2KYWA 1J19A 1NEKB 4GDLA 4MH0E 2W55A 4XX5A 4LNOA 2BPSA 3EHVA 1C4CA 2H89B 2KT7A 3VVWB 2WXLA 1N5WA 2BB5A 1TZ1A 2BT6A 2D5GA 4G3XB 1QOFA 3Q3MC 2M1MA 5BO4B 1IP9A 2UU7A 1GC6A 2JU6X 2K25A 3NOBA 2IBIB 2IY1B 4LJPB 4BBNF 4OVZA 1WXSA 5DPTA 2L83A 2MP2A 3AB5A 1OQYA 5LNK1 5EDSA 3ZJUA 4ANVA 3EFCA 1YIWA 2M8SA 1WE6A 2PVGC 1QOGA 4CYEA 4REZA 1KRHA 2LGXA 2K9XA 4Q2JA 2WXIA 3H6NA 1ZW7A 4J3OD 2QHOA 5HG2A 2Y5CA 4PS3A 2WXRA 4KKJA 5EE3A 2UYZB 2LVPA 4K3BA 2KDMA 1QOAA 3PVLA 3FILA 2WXFA 2RDHA 1F2RI 1MJDA 3V05A 1WJ4A 5D2MB 2L1AA 4MACA 2JYEA 3FC4A 4A9AA 3JW0X 1A5RA 2JYTA 5CTRC 1HXYD 2J53A 2W9NA 2BGFA 1QF6A 3BWUD 4BZAA 3ZQ4A 2KLCA 4RM9A 1K53A 3GB1A 1WRIA 5AZFA 1N60A 1RAXA 1JMLA 1NYRA 2PIAA 4NQKE 3P2BA 1FXAA 1WJNA 2KQSA 1KOTA 2NR2A 3AU4A 4ZRQA 4DHZB 3AE6B 3AE3B 4W9DA 2JZZA 4HDQA 1IBXB 3JSVB 3DWMA 1XLQA 2QEJC 3DWGC 4B95A 3PZ7A 2PE6B 4HJKA 5HHDG 3U4EG 1IUEA 3QK0A 2KDIA 4DHJD 4HXDA 4MH8A 1G6JA 4MT5A 4JQWC 2V3NA 2VH2A 2RSUA 4KSKC 1TTNA 2WLBA 4XWWA 1RFKA 5J18A 4MGYE 3LDZE 1S3SG 3S2AA 3L54A 4NJ7A 4C7YA 2KWCA 3VR8B 2M4NA 3V60A 1ZUD2 1N6ZA 1R4NB 4M02A 3U7DA 4DWFA 4M8NA 1UH6A 3ZGZA 3DCGA 2D3GA 2PTLA 1TS4A 5IP4D 2KKCA 2LGIA 2NCNA 1E7VA 3RD2A 3A4SC 2KO3A 1ZDVA 4WWNA 4TQ0A 2GLSA 1UGJA 1L2NA 1NVID 2B3AA 2PLPA 2AEHA 3PLVA 2KFKB 2MJDA 3GZNI 3B2GA 3ONSA 1M94A 1HEZE 4LNKA 1FMAD 2RPVA 3Q2AC 3Q3NC 2LD9A 4TMAB 4LCDE 2YEPF 1SEBD 4LLGM 3I63C 4PYUA 5L95C 2M0XA 2NMQA 3NG0A 4AP4C 2K3UA 2CKHB 3DBLB 1N5XA 2K6QA 2BF8B 3RNFC 2MBEA 2DZJA 4IW0A 3MC8A 4IUMB 3W2DA 4IM0A 3IBEA 2MBQA 2LUEA 3AEDB 3BVZA 4FADA 4YL8A 3HM3A 3WA0A 2YEPB 1QZEA 2WGSA 2V4IB 1UD7A 3TJPA 5MPOA 3IT6B 4N59A 3L08A 4HPLB 4HCPB 5AEKB 1L4ZB 1LFDA 4E3CA 1YX5B 2XNAC 2KX3A 3PGEA 3U52E 4NAMA 1U4AA 1GG3A 3CSTA 4ZDVA 1M4VA 1J7AA 1WRDB 2RD0A 4AWJA 2DENB 4C4VA 1SB3C 3L13A 2NBUA 3OG5A 4LK0M 1EWCA 3B0AA 2K8CA 3MHSD 3ZKJC 4AJYB 3N20C 1YJIA 2PMVA 3EC8A 1EWYC 1P7EA 3ML9A 1B9RA 2XK5A 3QA8A 4FXCA 1P9DU 4DBGA 3ALBA 3MC0B 4W9IA 1FIQA 5FR6A 1B1ZA 1V5TA 3TSSA 3TCAA 2K1FA 4ZYSA 3R66C 3OLMD 5D7GA 3H8HA 4HK2A 4G50A 2X8XX 1JQ4A 1D5XC 1WJ6A 3TEYA 2AWTA 3WIMA 5GXGB 1STEA 3ZW3A 5HKHA 3Q8FA 3NS8A 4P6VF 4JWSC 1LQBA 4BBNC 3APFA 4GGQA 2AQ2B 2D3CA 3ENEA 1E7PB 1YOVB 3J9CA 3P4RB 4BOSC 1TYGB 1RRBA 2PKOA 2FIFA 2L0FA 3IHPC 4MDKE 1K52A 2Q5WD 3IVFA 1I4PA 5G2NA 3UI3A 1I4HA 3N9YC 3L16A 5IN7A 1WXAA 4KDIC 4B9KA 2MH7A 5AZHA 2QCZA 1C78A 1P3QU 3GE3C 1F77A 3U8ZA 4TUUA 3A9JB 2B76B 2IO2B 3VTVA 4HWIB 1WM3A 1WMHB 5HI1A 5H8YE 3L10B 4MGKE 3N32A 4ZYNA 2O2VA 3RZWC 4PYZA 4RMAA 2FUG1 3QJZA 4ZOHC 3APCA 4W9CA 2BYTA 3SFEB 4NJCA 1YQBA 2LUMA 3BIID 1I42A 3BK1A 2Z8LA 2JWZA 2M19A 1WH3A 1QLBB 2BS4B 2INDC 4G11A 3W1SC 2IGGA 1MG8A 3NJTA 1AN8A 2LI5A 3W5VB 2KNBA 1F2RC 1PUTA 1HZ6A 2IZVB 1Q0WB 2KMAA 2ON8A 2ACZB 2NPTA 2DAJA 3KUDB 1EUVB 2GBRA 3LB8C 1AYFA 1D5ZC 1DYQA 3IAS1 3N3KB 2NPTB 5BYRA 2JX5A 2KQ7A 2GMIC 1TKEA 2MBHA 2LVOA 3UQAA 3QX1A 4LDTB 2ZCCA 2MBOA 1ISNA 1I4GA 4KKIA 4IM2A 3R7RA 2V3PA 3GOEA 3TMPB 1WZ3A 3VDZA 2NTSA 4XZ4A 3NZSA 3NY5A 1SJED 3VTWA 2JRHA 4P1BC 4GLSC 1L7YA 3HM6X 5T8IA 4II2B 2RDGA 2MP2B 2KN4A 2OJRA 2WDQB 3NUHB 3DHGC 5GMVA 2LHDA 4TKNA 3Q3FA 5JHAA 1N61A 3UGBB 1LO5D 3WAMA 5E6OA 2K5PA 2N9PC 3Q6BA 4PT5A 3AEGB 4W9EA 4NAWA 3GE8C 2ZJDA 3PPAA 2SEBD 4NPNA 3DBSA 3A1QA 4B0MA 2CHZA 4JX1C 2MJ3A 3PRPB 3ZNID 2C7MB 2ZPYA 3VXWA 1T6BX 1TS2A 4FA6A 3VHTC 4WQOB 1D6EC 3QHTA 4GSWA 4C56C 4MSMB 3TEWA 2RGFA 1E0ZA 4RF1A 2YLMA 3R7QA 2VRRB 2MSED 2D3AA 2C60A 4WH4A 2DBYA 2O2VB 4UDUC 1ZE3D 2KDEB 2WXOA 1T0QC 3KWLA 3BVGA 1OTRB 1WY8A 1S1QB 1SF0A 2DYOA 5E6NA 3RT3B 5C1ZA 2MW5A 4RM8A 5G5GA 4IKGA 3CF6E 3JVZX 2LGDA 3ZO5B 1RYJA 2WXMA 3E56A 2FUHB 4P16A 4OZCA 1WGGA 2V0GA 2G4SA 2BKRB 4XGAB 4HVBA 4DQOC 2BYEA 4YTMB 1OEYJ 2N4FA 2A4ZA 1GUAB 1VZ7A 4MELA 1PYWD 5BYQA 2QMTA 1YNTE 2FNJB 3MJWA 2LHEA 2N1VA 2WXGA 4ZRPA 5KHQA 4N58A 2EKIA 2IGDA 4HROA 1HTOA 1Q10A 2JSVX 3RNGC 1N63A 4K1RB 1F52A 2WHIA 1V97A 2AYOB 2D2QA 2KHWB 1WXVA 4A90A 1NDDA 2WWZA 3AEFB 1KFYB 1JRPA 3GP7A 1KM7A 2KJ6A 4RGNA 3DPDA 4H2AA 1CZPA 3KWVA 3VH4B 1FPYA 1I4XA 1ESFA 1K51A 1T3QA 1OGWA 2WXJA 4F1SA 2VZKD 1V1PA 3T8MA 2MA9B 1FCCC 4B0EA 1GAQB 4K81A 3W1YA 3SR6A 2IDYA 1JWBD 4RH6A 4A6QA 1VRAB 3DVNU 2AL6A 3VRAB 2W3RA 5JXVA 4HJGE 3AE8B 3Q8AA 1XLOA 1CK1A 3RULA 3EFUA 4DDID 5LXIB 1XF5L 3BYYB 2K8BA 2G3QB 4L2YA 5JH5C 1WR1A 1TGZB 1P98A 1T0YA 1V1PB 2JY6A 3ZDTA 1E90A 1CMXB 4FN2A 1Q5WB 3ZUNA 1I35A 2LMCA 3BY4B 4A20A 3L17A 2WX1A 3HIZA 3P4SB 3VUYA 3KYDD 3ZNGC 5LXHA 3EA6A 5AUKA 3I5JC 2GB1A 1TBEA 2WU2B 1RLFA 4J6IA 4D2KA 3SHQA 2IJ0A 2CJNA 4LNIA 3KUCB 5BYSA 4YSYB 2C5LC 3WCQA 3HVZA 5KHOA 3B9JA 3PHXB 4G0NB 3AH7A 1VZ8A 5C23A 3U2SC 4NNJB 4OVUA 2N7JA 3RYTA 3KLSX 3DDCB 4WAAA 3AV8A 2W82A 3ZVVA 2EKEC 2FCMA 4DHJB 3LYYA 4A3PA 4A55A 3RUIB 2L7RA 4F8CB 4NAWB 1E10A 3U7ZA 2AX5A 1EO6A 2MHJA 3DBLI 3KUZA 4YXDB 1C4AA 2N9KA 3APDA 4F7ZA 2W3SA 3AE2B 1L6UA 2JRIB 5DPSA 1OQQA 1KLUD 1HA5A 4RF0A 1FXTB 4WAFA 1FXIA 1UGMA 1V6EA 4WIPA 1TZOA 4URKA 2C7NB 1YJ1A 3I57A 1TS5A 1ZKHA 2PJHA 2FAZA 5EE9A 3D32A 2ONQA 3CSFA 1UELA 1X1MA 2WNMA 4XDDA 1MG4A 3TEXA 2HD5B 2LJIA 3R2IA 2BS2B 3N1YC 4GDKA 4XYCA 3X23A 1V9JA 1OQRA 2K8HA 3Q3JA 4GU2A 5D3IB 3L0WB 2R2QA 1ENFA 2M17A 3O13A 3K9PB 5E6PA 1PGBA 2K39A 4YSZB 1EU4A 4WJPA 4LDTD 3VQIA 2I1JA 3T3OA 1UUPA 2KZRA 2XBBC 3E9SA 1XO3A 3HUIA 1R7SA 2ZVNA 1P0RA 2V9HA 2CS4A 2G45B 2J52A 2KOXA 4RGTA 2E3TA 3AE7B 2M56B 4P1CC 4WQMA 4EZJA 1JW9D 1V80A 1K8RB 3Q8CA 3BYTB 1LGRA 4MM3A 2AQ3B 3DVNV 2CJOA 3AI5A 5AUIA 3AEBB 2NBVB 4KX6B 3BZDB 4EEWA 1QILA 4BKSD 1BXTA 1P7FA 5C3JB 2GBJA 3M3JA 2XEWA 2HJ8A 1I7HA 2L32A 4KGTA 3TBLD 2DYBA 1WFYA 1XT9B 3C0RB 3KH0A 2CU1A 3ECIA 1TKGA 4AQ7A 1C3TA 3ZYYX 2N9EB 2DZKA 3MHZA 3VUXA 2L52A 4KV2A 1BUIC 2JPHA 1OEYA 4RGMA 2KLGA 2FE8A 2J7QB 1WM2A 4IDIA 4NZLB 4ARIA 2N9LA 4AUQC 4W9HA 3AE9B 2KC1A 2WX0A 1FRRA 3WALA 2GBKA 2MEKA 4K3CA 1FM0D 4LJOB 4ANWA 4JLCA 2KACA 1KLGD 2ICIA 2LFIA 5FKAC 4L1BA 3TIXA 1MVKA 2UWQA 3MFGA 3RCZA 3UQBA 1XLNA 4ARCA 1BT0A 2JXXA 2G4DB 3KQ4A 3PTFC 1RFAA 2Y5PA 5BMHA 1FFUA 1I4QA 4NY0A 1V81A 4GN1A 3PZ8A 1YQ3B 1JRUA 2J0JA 2KAJA 2KK8A 4JGHB 4L23A 2LJ5A 3WANA 4RGOS 3PT2B 1VD2A 2KC2A 1NI3A 3QC8B 4E74A 4FHJA 2HTME 4HPPA 1YMHE 4BKSA 2JUOA
chains in the Genus database with same CATH topology
1WJNA 3CF6E 2KQSA 3JVZX 4MGIE 4I6LB 1KOTA 3PLUA 2NR2A 3AU4A 3A4RA 4DHZB 2LGDA 4EZLA 5IA7A 3RZFA 4JL9A 2O6VB 4W9DA 4TV3A 3ZO5B 2JZZA 4HDQA 2KD0A 3JSVB 4JIOU 3U30A 2FUHB 1E8WA 1GNUA 3AXCA 4W9FA 1WGGA 2G4SA 2BKRB 4X57B 4B95A 2O6VA 4W9KA 4BVUC 2LASA 5CHVC 2PE6B 1IPGA 1V2YA 3M63B 4HJKA 4HVBA 2BYEA 3QK0A 2KDIA 2V3SA 1OEYJ 2N4FA 2A4ZA 4DHJD 4HXDA 1XQQA 4K7UA 5CHWA 4N9F4 4FBJB 3ZRCA 1GUAB 4HPMB 4MELA 3IFWB 4WWOA 1G6JA 3SU8X 4BKGA 4JQWC 5TR5A 2IO0B 3WAPA 1WGRA 3QAQA 2RSUA 3UIPB 4KSKC 1TTNA 1WX8A 4HCNB 2FNJB 3X0WA 3MJWA 3WAOA 2IYDB 5J18A 1LXDA 2N1VA 3OJ3A 4NQLB 4MGYE 4EUTA 5DPWA 3LDZE 1S3SG 3S2AA 3L54A 4NJ7A 2PPHA 5KHQA 2KTRA 2BKFA 3QWZB 2YVCA 1LM8B 2N7DA 2NS5A 2KWCA 5G55A 2M4NA 3R3MA 3QCAA 3K9OB 3V60A 4BOZB 3IG3A 2J0MA 2FIDA 4K1RB 2L8JA 3QIJA 2KN5A 3VTUA 2AYOB 2D2QA 3PSEB 2KHWB 3U7DA 1WXVA 4DWFA 4M8NA 1V86A 1UH6A 3DCGA 1NDDA 2D3GA 2IO3B 2D10A 2WWZA 2FCQA 3OAWA 3N30A 2KWUB 2KKCA 1KM7A 2NCNA 2KJ6A 3B08A 1E7VA 3H7PB 5CX3A 3A4SC 3RD2A 2KO3A 3DPDA 4WWNA 4TQ0A 3PS6A 4MSQB 1WMHA 1L2NA 3KVFB 2B3AA 3P2BA 3VH4B 2AEHA 3PLVA 1E8ZA 4GOCA 2ASQA 2KFKB 4GDKB 1OGWA 4ZRJA 4F1SA 2MLBA 3GZNI 1P1AA 1ZGUB 3ONSA 1M94A 3A9KB 3T8MA 4DK5A 2MA9B 4I6NB 1E5WA 2ZZPB 4A3OA 2LD9A 4K81A 2L3ZA 3W1YA 4LCDE 2NVUI 3ZTDA 4FJZA 2D07B 4ICUA 4KZ0A 4PYUA 4OVVA 5L95C 2M0XA 3A33B 2MQJA 2KTFA 2MBBB 2WDTB 3DVNU 4AP4C 4HLEA 5JHBA 2CKHB 2AL6A 2KX0A 5D6JB 2K6QA 2BF8B 3QARA 2REXA 2MBEA 3AU5A 2DZJA 2V4LA 4IW0A 3RULA 2MRPA 4FULA 3EFUA 4IUMB 2ZCBA 4GMVA 4DDID 4IM0A 3IBEA 2MBQA 5LXIB 2LUEA 3DVGX 2K8BA 2Y5BB 3PV1A 4YL8A 2LGYA 3HM3A 2LRUA 3WA0A 4FADA 1QZEA 2G3QB 1SGHA 1UD7A 5JH5C 1WR1A 1WZ0A 3TJPA 1TGZB 1P98A 1T0YA 2ZPNA 2CHWA 2JY6A 3L08A 3ZDTA 1E90A 4WJQA 1CMXB 4EZKA 4ZRIA 4FN2A 1Q5WB 3ZUNA 1NBFC 2BYFA 4HPLB 2HE7A 2KWVB 4HCPB 1I35A 4MJSB 1WIAA 2PEAA 3BY4B 4A20A 3L17A 2WX1A 5AEKB 3HIZA 1LFDA 4E3CA 3VUYA 3KYDD 2R2OA 3ZNGC 1YX5B 3O65B 5LXHA 2MWSB 5D94A 2KX3A 2N1WA 1UBIA 3PGEA 1U4AA 1TBEA 1GG3A 5DCNA 3CSTA 4ZDVA 1RLFA 1UBQA 4J6IA 3SHQA 1WRDB 2RD0A 3KUCB 4AWJA 2RR9A 2DENB 3NHEB 4KDLB 2C5LC 3T9LA 3L13A 2NBUA 5J17A 4II3B 1R4MI 2K8CA 3B0AA 3PHXB 4G0NB 3MHSD 4K7SA 5KHOA 3ZKJC 5C23A 4AJYB 2IY0B 4NNJB 3M95A 2V1YA 4OVUA 3EC8A 5DPRA 3RYTA 3ML9A 2XK5A 3DDCB 2JZ3B 3V62A 4IC7B 3H1UA 4WAAA 3QA8A 3VAWA 1P9DU 2FCSA 4FJVB 3ALBA 1E8XA 3ZVVA 2DZIA 4DBGA 3KW5B 2EKEC 2FCMA 2L05A 4W9IA 2JT4B 2ZEQA 5FR6A 4DHJB 1PQSA 1V5TA 1NI2A 4A3PA 3TCAA 2C7HA 3PRMB 1XD3B 2K1FA 3RUIB 2L7RA 3R66C 3OLMD 5D7GA 4F8CB 2I1KA 4HK2A 4G50A 4NAWB 1J8CA 2L76A 1V49A 4W9LA 1EO6A 4PS7A 1WJ6A 3ZDMC 2AWTA 1WX9A 2KVRA 3WIMA 2OOBB 3DBLI 3KUZA 3LJ3A 3ZW3A 5HKHA 3PZDA 3APDA 2IO1B 4F7ZA 2DYMA 2ZNVC 4ANXA 4K7WA 3NS8A 2DX5B 4M0WB 4NJ6A 2KJRA 2JRIB 1LQBA 4BBNC 5DPSA 3APFA 3PHWB 2ZNVB 4GGQA 3B1LX 4ASWC 4FHKA 3ENEA 4MGZE 3ZNZB 1FXTB 4AJWA 4BOSC 4KSLC 2MX2A 1UGMA 1RRBA 2KANA 1V6EA 2KDBA 2FIFA 2KTRB 2L0FA 3IHPC 4MDKE 2C7NB 1YJ1A 4EFOA 4URKA 3IVFA 1ZKHA 2PJHA 4XC2A 2FAZA 2EMTA 4IWQA 5G2NA 1Y8RC 3D32A 3CSFA 3L16A 1WGDA 1UELA 1WXAA 1X1MA 2GOWA 4PS8A 4KDIC 2HD5B 1EF1A 4B9KA 5AZHA 4IG7B 4IWOA 2BYVE 4KZCA 5CHFA 3V61A 3KYCD 1P3QU 4KIKB 3ML8A 4GDLB 4GDKA 1WR6E 3X23A 1V9JA 3A9KA 2K8HA 4IWPA 2LXAA 5JZEB 2AL3A 3Q3JA 4GU2A 3L0WB 3U8ZA 4TUUA 3H9DA 2R2QA 3A9JB 2M17A 3DVGY 3K9PB 2LZ6A 5E6PA 5LLIA 2IO2B 2BWES 2K39A 3VTVA 4HWIB 1WM3A 1WMHB 4GIVA 3HK0A 3UINB 4WJPA 3L10B 3AULA 4LDTD 3VQIA 3V6CB 2I1JA 4MGKE 2LWPA 3EECA 3N32A 3VUWA 2CHXA 4ZYNA 2Z0DB 3UIOB 2O2VA 2XK5B 3I3TB 3RZWC 2KZRA 4PYZA 2LXCA 2XBBC 4RMAA 2WYQA 3QJZA 2KFKA 3JYUA 2ZVNA 1P0RA 1KLVA 3HHMA 1H8CA 2CS4A 2G45B 3APCA 3SD5A 1HE8A 2JVCA 4W9CA 2J0KA 2KOXA 1F9JA 4GB9A 4KVGB 1YQBA 1I42A 3VFKA 4DDGD 2JWZA 4WWPA 1WH3A 3BINA 4EZJA 3H7PA 2O6VD 2JF5A 3VH3B 3ZIMA 1SE9A 4CHKA 4G11A 3W1SC 2KMCA 1V80A 3DOWA 1K8RB 3W1SA 4EOYA 1WJUA 3SDLC 1MG8A 3ZLZA 2KXJA 2PE9A 2GBMA 2KDFB 2LRWA 4MM3A 2LI5A 3ZRFA 3DVNV 1C1YB 1E7UA 1Z5SB 3AI5A 2KNBA 1WGYA 3MTNB 4MJSA 2NBVB 4BKTA 2L00B 3M62B 2EMSA 2IZVB 3A9JA 4W9JA 2MCNB 4EEWA 1Q0WB 4BKSD 2GBNA 2K6DB 2KMAA 2DHZA 3DBRI 1WXMA 1WF9A 2GBJA 3M3JA 2LVQA 2XEWA 2NPTA 2HJ8A 2DAJA 2C9WB 4BFRA 3KUDB 1EUVB 3TBLD 2DYBA 4IM3A 2GBRA 2ZVOA 1WFYA 1XT9B 2CR5A 3C0RB 2N9XA 3KH0A 3ZTCA 2CU1A 3ECIA 3H7SA 4WJOA 3N3KB 4DXAB 2NPTB 1GJZA 1AARA 2FCNA 3DQVA 1Q1OA 1C3TA 2N9EB 2DZKA 3PREA 4GXBA 4ZRKA 4CO7A 3VUXA 2D11A 4KV2A 2KQ7A 3ZNHB 1H4RA 1VCBA 4B6WA 1EF5A 2GMIC 2MBHA 2JPHA 3UF8A 2LVOA 4FLHA 3UQAA 1V5OA 4WJNA 1OEYA 2Z59B 3QX1A 2KLGA 2ZCCA 1YD8U 2MBOA 4LDTB 2N7EA 1ISNA 1WX7A 2J7QB 1WYWB 1D3ZA 4IM2A 3R7RA 1WM2A 2A5UA 3V6EB 1WE7A 3GOEA 1WZ3A 3TMPB 3VDZA 3QQ8B 4XZ4A 3NZSA 3CMMB 4ICVA 4W9GA 3NY5A 1J19A 3VTWA 1WI0A 4GDLA 2JRHA 4AUQC 4KIKA 4DHZE 4MH0E 4W9HA 1GC7A 3DBHI 2KC1A 1L7YA 4HDOA 2WX0A 1YX6B 3HM6X 4XX5A 2BPSA 4II2B 3WALA 2GBKA 3EHVA 2MP2B 2OJRA 3VVWB 5GMVA 1TZ1A 4TKNA 3Q3FA 5JHAA 4P7IA 3UGBB 4G3XB 3WAMA 5L83A 1KJTA 2M1MA 5BO4B 2NBWB 5E6OA 4EKUA 1GC6A 1IP9A 2K25A 3NOBA 2IBIB 2IY1B 2N9PC 3A1QB 1SIFA 4LJOB 4LJPB 4M8MA 4BBNF 4ANWA 4AOFA 1WXSA 5DPTA 4W9EA 4JLCA 4NAWA 2MP2A 1OQYA 5IAAC 5EDSA 4E71A 2HTHA 2ZJDA 4ANVA 3PPAA 1YIWA 2M8SA 1WE6A 4NPNA 3TIXA 4MEMA 2BWFA 4CYEA 3DBSA 3A1QA 2UWQA 2LGXA 3RCZA 3H6NA 3UQBA 1UZXB 2CHZA 1ZW7A 4FJYA 2KFJA 3PRPB 3ZNID 1BT0A 2C7MB 2QHOA 2ZPYA 5J2RA 2JXXA 1IYFA 4PS3A 2G4DB 3TL5A 3VXWA 4FA6A 3NZUA 2UYZB 3VHTC 2LVPA 4WQOB 2DAFA 3PVLA 3QHTA 5AZGA 2RPQA 4GSWA 3PTFC 1RFAA 4MSMB 4ANUA 4NY0A 1E8YA 1V81A 1WJ4A 4GN1A 5D2MB 4I6PA 2RGFA 2KJHB 2YLMA 1JRUA 3R7QA 3JW0X 2J0JA 1A5RA 2VRRB 5CTRC 2MSED 2KK8A 1WGHA 2BGFA 2W9NA 3PRZA 4JGHB 4TQ1A 2DZMA 1J0GA 2C60A 2KLCA 2LJ5A 4RM9A 3WANA 2O2VB 2KDEB 5AZFA 3PT2B 1VD2A 1RAXA 1Z2MA 2KC2A 3OJ4B 1R4NI 3QC8B 4E74A 1OTRB 1WY8A 1S1QB 2DYOA 5E6NA 3RT3B 3JSVA 4FHJA 5C1ZA 2MW5A 2Z0EB 2L0TA 4BKSA 4RM8A 4NQKE 2JUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJN A;  3CF6 E;  2KQS A;  3JVZ X;  4MGI E;  4I6L B;  1KOT A;  3PLU A;  2NR2 A;  3AU4 A;  3A4R A;  4DHZ B;  2LGD A;  4EZL A;  5IA7 A;  3RZF A;  4JL9 A;  2O6V B;  4W9D A;  4TV3 A;  3ZO5 B;  2JZZ A;  4HDQ A;  2KD0 A;  3JSV B;  4JIO U;  3U30 A;  2FUH B;  1E8W A;  1GNU A;  3AXC A;  4W9F A;  1WGG A;  2G4S A;  2BKR B;  4X57 B;  4B95 A;  2O6V A;  4W9K A;  4BVU C;  2LAS A;  5CHV C;  2PE6 B;  1IPG A;  1V2Y A;  3M63 B;  4HJK A;  4HVB A;  2BYE A;  3QK0 A;  2KDI A;  2V3S A;  1OEY J;  2N4F A;  2A4Z A;  4DHJ D;  4HXD A;  1XQQ A;  4K7U A;  5CHW A;  4N9F 4;  4FBJ B;  3ZRC A;  1GUA B;  4HPM B;  4MEL A;  3IFW B;  4WWO A;  1G6J A;  3SU8 X;  4BKG A;  4JQW C;  5TR5 A;  2IO0 B;  3WAP A;  1WGR A;  3QAQ A;  2RSU A;  3UIP B;  4KSK C;  1TTN A;  1WX8 A;  4HCN B;  2FNJ B;  3X0W A;  3MJW A;  3WAO A;  2IYD B;  5J18 A;  1LXD A;  2N1V A;  3OJ3 A;  4NQL B;  4MGY E;  4EUT A;  5DPW A;  3LDZ E;  1S3S G;  3S2A A;  3L54 A;  4NJ7 A;  2PPH A;  5KHQ A;  2KTR A;  2BKF A;  3QWZ B;  2YVC A;  1LM8 B;  2N7D A;  2NS5 A;  2KWC A;  5G55 A;  2M4N A;  3R3M A;  3QCA A;  3K9O B;  3V60 A;  4BOZ B;  3IG3 A;  2J0M A;  2FID A;  4K1R B;  2L8J A;  3QIJ A;  2KN5 A;  3VTU A;  2AYO B;  2D2Q A;  3PSE B;  2KHW B;  3U7D A;  1WXV A;  4DWF A;  4M8N A;  1V86 A;  1UH6 A;  3DCG A;  1NDD A;  2D3G A;  2IO3 B;  2D10 A;  2WWZ A;  2FCQ A;  3OAW A;  3N30 A;  2KWU B;  2KKC A;  1KM7 A;  2NCN A;  2KJ6 A;  3B08 A;  1E7V A;  3H7P B;  5CX3 A;  3A4S C;  3RD2 A;  2KO3 A;  3DPD A;  4WWN A;  4TQ0 A;  3PS6 A;  4MSQ B;  1WMH A;  1L2N A;  3KVF B;  2B3A A;  3P2B A;  3VH4 B;  2AEH A;  3PLV A;  1E8Z A;  4GOC A;  2ASQ A;  2KFK B;  4GDK B;  1OGW A;  4ZRJ A;  4F1S A;  2MLB A;  3GZN I;  1P1A A;  1ZGU B;  3ONS A;  1M94 A;  3A9K B;  3T8M A;  4DK5 A;  2MA9 B;  4I6N B;  1E5W A;  2ZZP B;  4A3O A;  2LD9 A;  4K81 A;  2L3Z A;  3W1Y A;  4LCD E;  2NVU I;  3ZTD A;  4FJZ A;  2D07 B;  4ICU A;  4KZ0 A;  4PYU A;  4OVV A;  5L95 C;  2M0X A;  3A33 B;  2MQJ A;  2KTF A;  2MBB B;  2WDT B;  3DVN U;  4AP4 C;  4HLE A;  5JHB A;  2CKH B;  2AL6 A;  2KX0 A;  5D6J B;  2K6Q A;  2BF8 B;  3QAR A;  2REX A;  2MBE A;  3AU5 A;  2DZJ A;  2V4L A;  4IW0 A;  3RUL A;  2MRP A;  4FUL A;  3EFU A;  4IUM B;  2ZCB A;  4GMV A;  4DDI D;  4IM0 A;  3IBE A;  2MBQ A;  5LXI B;  2LUE A;  3DVG X;  2K8B A;  2Y5B B;  3PV1 A;  4YL8 A;  2LGY A;  3HM3 A;  2LRU A;  3WA0 A;  4FAD A;  1QZE A;  2G3Q B;  1SGH A;  1UD7 A;  5JH5 C;  1WR1 A;  1WZ0 A;  3TJP A;  1TGZ B;  1P98 A;  1T0Y A;  2ZPN A;  2CHW A;  2JY6 A;  3L08 A;  3ZDT A;  1E90 A;  4WJQ A;  1CMX B;  4EZK A;  4ZRI A;  4FN2 A;  1Q5W B;  3ZUN A;  1NBF C;  2BYF A;  4HPL B;  2HE7 A;  2KWV B;  4HCP B;  1I35 A;  4MJS B;  1WIA A;  2PEA A;  3BY4 B;  4A20 A;  3L17 A;  2WX1 A;  5AEK B;  3HIZ A;  1LFD A;  4E3C A;  3VUY A;  3KYD D;  2R2O A;  3ZNG C;  1YX5 B;  3O65 B;  5LXH A;  2MWS B;  5D94 A;  2KX3 A;  2N1W A;  1UBI A;  3PGE A;  1U4A A;  1TBE A;  1GG3 A;  5DCN A;  3CST A;  4ZDV A;  1RLF A;  1UBQ A;  4J6I A;  3SHQ A;  1WRD B;  2RD0 A;  3KUC B;  4AWJ A;  2RR9 A;  2DEN B;  3NHE B;  4KDL B;  2C5L C;  3T9L A;  3L13 A;  2NBU A;  5J17 A;  4II3 B;  1R4M I;  2K8C A;  3B0A A;  3PHX B;  4G0N B;  3MHS D;  4K7S A;  5KHO A;  3ZKJ C;  5C23 A;  4AJY B;  2IY0 B;  4NNJ B;  3M95 A;  2V1Y A;  4OVU A;  3EC8 A;  5DPR A;  3RYT A;  3ML9 A;  2XK5 A;  3DDC B;  2JZ3 B;  3V62 A;  4IC7 B;  3H1U A;  4WAA A;  3QA8 A;  3VAW A;  1P9D U;  2FCS A;  4FJV B;  3ALB A;  1E8X A;  3ZVV A;  2DZI A;  4DBG A;  3KW5 B;  2EKE C;  2FCM A;  2L05 A;  4W9I A;  2JT4 B;  2ZEQ A;  5FR6 A;  4DHJ B;  1PQS A;  1V5T A;  1NI2 A;  4A3P A;  3TCA A;  2C7H A;  3PRM B;  1XD3 B;  2K1F A;  3RUI B;  2L7R A;  3R66 C;  3OLM D;  5D7G A;  4F8C B;  2I1K A;  4HK2 A;  4G50 A;  4NAW B;  1J8C A;  2L76 A;  1V49 A;  4W9L A;  1EO6 A;  4PS7 A;  1WJ6 A;  3ZDM C;  2AWT A;  1WX9 A;  2KVR A;  3WIM A;  2OOB B;  3DBL I;  3KUZ A;  3LJ3 A;  3ZW3 A;  5HKH A;  3PZD A;  3APD A;  2IO1 B;  4F7Z A;  2DYM A;  2ZNV C;  4ANX A;  4K7W A;  3NS8 A;  2DX5 B;  4M0W B;  4NJ6 A;  2KJR A;  2JRI B;  1LQB A;  4BBN C;  5DPS A;  3APF A;  3PHW B;  2ZNV B;  4GGQ A;  3B1L X;  4ASW C;  4FHK A;  3ENE A;  4MGZ E;  3ZNZ B;  1FXT B;  4AJW A;  4BOS C;  4KSL C;  2MX2 A;  1UGM A;  1RRB A;  2KAN A;  1V6E A;  2KDB A;  2FIF A;  2KTR B;  2L0F A;  3IHP C;  4MDK E;  2C7N B;  1YJ1 A;  4EFO A;  4URK A;  3IVF A;  1ZKH A;  2PJH A;  4XC2 A;  2FAZ A;  2EMT A;  4IWQ A;  5G2N A;  1Y8R C;  3D32 A;  3CSF A;  3L16 A;  1WGD A;  1UEL A;  1WXA A;  1X1M A;  2GOW A;  4PS8 A;  4KDI C;  2HD5 B;  1EF1 A;  4B9K A;  5AZH A;  4IG7 B;  4IWO A;  2BYV E;  4KZC A;  5CHF A;  3V61 A;  3KYC D;  1P3Q U;  4KIK B;  3ML8 A;  4GDL B;  4GDK A;  1WR6 E;  3X23 A;  1V9J A;  3A9K A;  2K8H A;  4IWP A;  2LXA A;  5JZE B;  2AL3 A;  3Q3J A;  4GU2 A;  3L0W B;  3U8Z A;  4TUU A;  3H9D A;  2R2Q A;  3A9J B;  2M17 A;  3DVG Y;  3K9P B;  2LZ6 A;  5E6P A;  5LLI A;  2IO2 B;  2BWE S;  2K39 A;  3VTV A;  4HWI B;  1WM3 A;  1WMH B;  4GIV A;  3HK0 A;  3UIN B;  4WJP A;  3L10 B;  3AUL A;  4LDT D;  3VQI A;  3V6C B;  2I1J A;  4MGK E;  2LWP A;  3EEC A;  3N32 A;  3VUW A;  2CHX A;  4ZYN A;  2Z0D B;  3UIO B;  2O2V A;  2XK5 B;  3I3T B;  3RZW C;  2KZR A;  4PYZ A;  2LXC A;  2XBB C;  4RMA A;  2WYQ A;  3QJZ A;  2KFK A;  3JYU A;  2ZVN A;  1P0R A;  1KLV A;  3HHM A;  1H8C A;  2CS4 A;  2G45 B;  3APC A;  3SD5 A;  1HE8 A;  2JVC A;  4W9C A;  2J0K A;  2KOX A;  1F9J A;  4GB9 A;  4KVG B;  1YQB A;  1I42 A;  3VFK A;  4DDG D;  2JWZ A;  4WWP A;  1WH3 A;  3BIN A;  4EZJ A;  3H7P A;  2O6V D;  2JF5 A;  3VH3 B;  3ZIM A;  1SE9 A;  4CHK A;  4G11 A;  3W1S C;  2KMC A;  1V80 A;  3DOW A;  1K8R B;  3W1S A;  4EOY A;  1WJU A;  3SDL C;  1MG8 A;  3ZLZ A;  2KXJ A;  2PE9 A;  2GBM A;  2KDF B;  2LRW A;  4MM3 A;  2LI5 A;  3ZRF A;  3DVN V;  1C1Y B;  1E7U A;  1Z5S B;  3AI5 A;  2KNB A;  1WGY A;  3MTN B;  4MJS A;  2NBV B;  4BKT A;  2L00 B;  3M62 B;  2EMS A;  2IZV B;  3A9J A;  4W9J A;  2MCN B;  4EEW A;  1Q0W B;  4BKS D;  2GBN A;  2K6D B;  2KMA A;  2DHZ A;  3DBR I;  1WXM A;  1WF9 A;  2GBJ A;  3M3J A;  2LVQ A;  2XEW A;  2NPT A;  2HJ8 A;  2DAJ A;  2C9W B;  4BFR A;  3KUD B;  1EUV B;  3TBL D;  2DYB A;  4IM3 A;  2GBR A;  2ZVO A;  1WFY A;  1XT9 B;  2CR5 A;  3C0R B;  2N9X A;  3KH0 A;  3ZTC A;  2CU1 A;  3ECI A;  3H7S A;  4WJO A;  3N3K B;  4DXA B;  2NPT B;  1GJZ A;  1AAR A;  2FCN A;  3DQV A;  1Q1O A;  1C3T A;  2N9E B;  2DZK A;  3PRE A;  4GXB A;  4ZRK A;  4CO7 A;  3VUX A;  2D11 A;  4KV2 A;  2KQ7 A;  3ZNH B;  1H4R A;  1VCB A;  4B6W A;  1EF5 A;  2GMI C;  2MBH A;  2JPH A;  3UF8 A;  2LVO A;  4FLH A;  3UQA A;  1V5O A;  4WJN A;  1OEY A;  2Z59 B;  3QX1 A;  2KLG A;  2ZCC A;  1YD8 U;  2MBO A;  4LDT B;  2N7E A;  1ISN A;  1WX7 A;  2J7Q B;  1WYW B;  1D3Z A;  4IM2 A;  3R7R A;  1WM2 A;  2A5U A;  3V6E B;  1WE7 A;  3GOE A;  1WZ3 A;  3TMP B;  3VDZ A;  3QQ8 B;  4XZ4 A;  3NZS A;  3CMM B;  4ICV A;  4W9G A;  3NY5 A;  1J19 A;  3VTW A;  1WI0 A;  4GDL A;  2JRH A;  4AUQ C;  4KIK A;  4DHZ E;  4MH0 E;  4W9H A;  1GC7 A;  3DBH I;  2KC1 A;  1L7Y A;  4HDO A;  2WX0 A;  1YX6 B;  3HM6 X;  4XX5 A;  2BPS A;  4II2 B;  3WAL A;  2GBK A;  3EHV A;  2MP2 B;  2OJR A;  3VVW B;  5GMV A;  1TZ1 A;  4TKN A;  3Q3F A;  5JHA A;  4P7I A;  3UGB B;  4G3X B;  3WAM A;  5L83 A;  1KJT A;  2M1M A;  5BO4 B;  2NBW B;  5E6O A;  4EKU A;  1GC6 A;  1IP9 A;  2K25 A;  3NOB A;  2IBI B;  2IY1 B;  2N9P C;  3A1Q B;  1SIF A;  4LJO B;  4LJP B;  4M8M A;  4BBN F;  4ANW A;  4AOF A;  1WXS A;  5DPT A;  4W9E A;  4JLC A;  4NAW A;  2MP2 A;  1OQY A;  5IAA C;  5EDS A;  4E71 A;  2HTH A;  2ZJD A;  4ANV A;  3PPA A;  1YIW A;  2M8S A;  1WE6 A;  4NPN A;  3TIX A;  4MEM A;  2BWF A;  4CYE A;  3DBS A;  3A1Q A;  2UWQ A;  2LGX A;  3RCZ A;  3H6N A;  3UQB A;  1UZX B;  2CHZ A;  1ZW7 A;  4FJY A;  2KFJ A;  3PRP B;  3ZNI D;  1BT0 A;  2C7M B;  2QHO A;  2ZPY A;  5J2R A;  2JXX A;  1IYF A;  4PS3 A;  2G4D B;  3TL5 A;  3VXW A;  4FA6 A;  3NZU A;  2UYZ B;  3VHT C;  2LVP A;  4WQO B;  2DAF A;  3PVL A;  3QHT A;  5AZG A;  2RPQ A;  4GSW A;  3PTF C;  1RFA A;  4MSM B;  4ANU A;  4NY0 A;  1E8Y A;  1V81 A;  1WJ4 A;  4GN1 A;  5D2M B;  4I6P A;  2RGF A;  2KJH B;  2YLM A;  1JRU A;  3R7Q A;  3JW0 X;  2J0J A;  1A5R A;  2VRR B;  5CTR C;  2MSE D;  2KK8 A;  1WGH A;  2BGF A;  2W9N A;  3PRZ A;  4JGH B;  4TQ1 A;  2DZM A;  1J0G A;  2C60 A;  2KLC A;  2LJ5 A;  4RM9 A;  3WAN A;  2O2V B;  2KDE B;  5AZF A;  3PT2 B;  1VD2 A;  1RAX A;  1Z2M A;  2KC2 A;  3OJ4 B;  1R4N I;  3QC8 B;  4E74 A;  1OTR B;  1WY8 A;  1S1Q B;  2DYO A;  5E6N A;  3RT3 B;  3JSV A;  4FHJ A;  5C1Z A;  2MW5 A;  2Z0E B;  2L0T A;  4BKS A;  4RM8 A;  4NQK E;  2JUO A; 
#chains in the Genus database with same CATH topology
 1A70 A;  3PLU A;  3A4R A;  2OJW A;  3V3X A;  5IA7 A;  3RZF A;  3IAM 1;  4KGS A;  3HVD A;  4JIO U;  3U30 A;  2QJL A;  1E8W A;  1GNU A;  1R4M B;  2DWQ A;  3AXC A;  1DOY A;  3URY A;  4X57 B;  4BVU C;  2LAS A;  1L6V A;  1IPG A;  1V2Y A;  3M63 B;  3ZJT A;  3BVM A;  1JWM D;  2V3S A;  3ETR A;  1XQQ A;  1FFV A;  4K7U A;  5CHW A;  4N9F 4;  3ZRC A;  3IFW B;  4WWO A;  3SU8 X;  4BKG A;  5TR5 A;  2Y3A A;  3WAP A;  4ITK A;  1WGR A;  1WWT A;  3QAQ A;  1ET9 A;  3WAO A;  2K22 A;  2IYD B;  4M00 A;  1LXD A;  4MM3 B;  3OJ3 A;  4NQL B;  5TSS A;  3NRZ A;  4EUT A;  2PPH A;  2KTR A;  2WS3 B;  2BKF A;  3QWZ B;  2N7D A;  2NS5 A;  2M0A A;  1Y56 A;  5G55 A;  1IGD A;  2WQY B;  3QCA A;  3IG3 A;  2FID A;  2L8J A;  2KN5 A;  2QDF A;  1QQR A;  1V86 A;  1T5X D;  2FCQ A;  4USA A;  3N30 A;  3ZXR A;  4C00 A;  2BBC A;  3I9V 1;  3L4P A;  1PGX A;  3H7P B;  1ET6 A;  3AE5 B;  3PS6 A;  1E8Z A;  4GOC A;  4OW0 A;  4GDK B;  1UWM A;  4ZRJ A;  1P1A A;  1ZGU B;  1EM7 A;  3A9K B;  5D3D A;  4DK5 A;  4I6N B;  1HQR D;  1K50 A;  2ZZP B;  2L3Z A;  2AQ1 B;  3ZTD A;  1AWD A;  4FJZ A;  2D07 B;  1QKZ A;  1PDX A;  4BAX A;  4OVV A;  2BS3 B;  3HRD D;  3AE1 B;  4EE2 A;  2MQJ A;  5H92 C;  1C4P A;  2WDT B;  2OED A;  5JHB A;  4YT0 B;  4WWM A;  1FCL A;  2KX0 A;  5D6J B;  1MHH E;  1JWU D;  3QAR A;  2REX A;  1YN3 A;  3AU5 A;  2V4L A;  2MRP A;  3RNE C;  3ABV B;  1F0Z A;  1IBX A;  2Y5B B;  3PV1 A;  2LGY A;  2LRU A;  3MC9 A;  2ZPN A;  4IOI E;  2CHW A;  4WJQ A;  3DHI C;  4ZRI A;  1NBF C;  2KWV B;  1SE3 A;  1WIA A;  1VZ6 A;  2PEA A;  3ZJV A;  2MJE A;  2MWS B;  5D94 A;  3VRB B;  2N1W A;  1UBI A;  1E9M A;  3Q3O C;  1SXT A;  5DCN A;  3AEC B;  4KDL B;  3T9L A;  5J17 A;  4K7S A;  4OZA A;  1XCT L;  3M95 A;  5DPR A;  1XCQ L;  2ZW1 A;  1HTQ A;  2DZI A;  3KW5 B;  5EE0 A;  3T3N A;  2JT4 B;  2ZEQ A;  1NI2 A;  2C7H A;  1RWS A;  3RNC C;  2I1K A;  3FIL B;  2JXT A;  1J8C A;  1V49 A;  4W9L A;  3ZDM C;  2KVR A;  4RFB A;  3PZD A;  2J4X A;  3DBH B;  1JCK B;  2DYM A;  4ANX A;  4WUR A;  1J7B A;  4NJ6 A;  3PHW B;  2ZNV B;  4ASW C;  4FHK A;  2BQQ A;  4JWU C;  3ZNZ B;  4AJW A;  1N62 A;  1WXQ A;  1VR9 A;  1AW7 A;  4ZHP A;  2HDE A;  2KDB A;  2KTR B;  4EFO A;  2EMT A;  2WU5 B;  4IWQ A;  1YQ4 B;  1Y8R C;  5HFY A;  1JWA D;  2GOW A;  4PS8 A;  1PGA A;  1EF1 A;  4IWO A;  3ML8 A;  4GDL B;  2HJ1 A;  2JWU A;  2WXK A;  3A9K A;  4IWP A;  2VZK B;  2AL3 A;  3H9D A;  3DVG Y;  3Q14 C;  3EGR A;  2BWE S;  4GIV A;  3TEZ A;  2LGS A;  1MI0 A;  3V6C B;  2LWP A;  3EEC A;  3VUW A;  2I38 A;  2CHX A;  2Z0D B;  2XK5 B;  2JQR B;  3I3T B;  2E6X A;  2WYQ A;  2X38 A;  2KFK A;  3JYU A;  1H8C A;  1YN4 A;  2JVC A;  2KWD A;  2J0K A;  1F9J A;  4GB9 A;  1TY2 A;  4KVG B;  4DDG D;  4WWP A;  3BIN A;  3H7P A;  3P1M A;  2JF5 A;  1NYQ A;  1SE9 A;  2KMC A;  3DOW A;  3NVY A;  4EOY A;  3P42 A;  1WJU A;  2KXJ A;  1VJK A;  2PE9 A;  1SIJ A;  1FNW A;  1C1Y B;  1WGY A;  3MTN B;  1L0V B;  2LEK A;  4BKT A;  2L00 B;  3M62 B;  2EMS A;  3A9J A;  2MCN B;  4C7Z A;  2GBN A;  2K6D B;  2DHZ A;  3DBR I;  1WF9 A;  3NVZ A;  2LVQ A;  3P4P B;  2C9W B;  4BFR A;  1CJE A;  2N9X A;  3ZTC A;  3H7S A;  1C76 A;  4WJO A;  1GJZ A;  3AMZ A;  1AAR A;  2FCN A;  2PW9 A;  1Q1O A;  3DQV A;  3Q8B A;  1MFW A;  4US8 A;  4ZRK A;  2G9H D;  1H4R A;  4B6W A;  3NS1 A;  4N6E B;  3SEB A;  2Z59 B;  1QOB A;  5EE1 A;  1KTK A;  1TY0 A;  1D3Z A;  1DOI A;  3V6E B;  2EEL A;  3QQ8 B;  1SE4 A;  2BW2 A;  4W9G A;  1WI0 A;  1GB1 A;  4KIK A;  4DHZ E;  1FO4 A;  1GC7 A;  3DBH I;  3AN1 A;  4HDO A;  1YX6 B;  3FKY A;  1XXG A;  1ACC A;  3GS2 A;  2XN9 C;  4P7I A;  5L83 A;  2RMM A;  1KJT A;  2NBW B;  4EKU A;  4TSS A;  4M8M A;  3A1Q B;  1SIF A;  3DHH C;  4AOF A;  1OFF A;  3RNB C;  4DXG A;  3FAH A;  3NVV A;  5IAA C;  2BTE A;  5BMI A;  4E71 A;  2HTH A;  4OZB A;  4LNN A;  2PVO D;  4MEM A;  2BWF A;  2R61 A;  2ZW0 A;  3RN9 C;  5FR3 A;  1UZX B;  3OWE B;  4XE0 A;  4FJY A;  2KFJ A;  5IOI A;  1IYF A;  5J2R A;  3TL5 A;  3NZU A;  2QSD A;  2DAF A;  5AZG A;  2RPQ A;  4ANU A;  1E8Y A;  4I6P A;  2KJH B;  4YSX B;  1VLB A;  1WGH A;  3PRZ A;  4TQ1 A;  2DZM A;  1J0G A;  1SJH D;  1Z2M A;  3OJ4 B;  3Q8E A;  1R4N I;  3JSV A;  3NZ3 A;  1V1O A;  1SE2 A;  2Z0E B;  3LXF A;  2L0T A;  4YTP B;  1NEN B;  4MGI E;  4I6L B;  4EZL A;  1DGJ A;  1ZPS A;  4JL9 A;  2O6V B;  3VR9 B;  4TV3 A;  3Q69 A;  2KD0 A;  4XWT A;  4HRS A;  1FD6 A;  4W9F A;  1V8C A;  3R8B A;  2TSS A;  3P63 A;  3SFD B;  1C79 A;  2O6V A;  1ZXI A;  4W9K A;  5CHV C;  1D5M C;  1ZOY B;  3AM9 A;  1YJJ A;  3CIR B;  1EU3 A;  1F1H A;  4FBJ B;  4HPM B;  2IO0 B;  1JRO A;  3UIP B;  1WX8 A;  1ZDX A;  4HCN B;  2QC8 A;  3X0W A;  3RNA C;  5DPW A;  2KQ4 X;  4JPS A;  2H88 B;  2YVC A;  1LM8 B;  1TJE A;  4AS1 A;  3R3M A;  2WXN A;  3K9O B;  4BOZ B;  1WYG A;  5FK9 C;  1DOX A;  1TKY A;  2GI9 A;  2CU3 A;  2J0M A;  3QIJ A;  5IO9 A;  3VTU A;  2WXP A;  3PSE B;  2IGH A;  1D4B A;  1FEH A;  2IO3 B;  2K0P A;  2D10 A;  2WP9 B;  3OAW A;  2KWU B;  1SSN A;  5CX3 A;  3B08 A;  2VH1 A;  4MSQ B;  1WMH A;  3KVF B;  4HKQ A;  2QIL A;  2BVC A;  5IKC M;  2INP E;  4R3D A;  2ASQ A;  3W5U B;  2MLB A;  1YN5 A;  3DBR B;  5E6J A;  3W9C B;  1E5W A;  1XEE A;  3MJ5 A;  4A3O A;  4LTU A;  4QAY A;  2NVU I;  1C9F A;  4ICU A;  4KZ0 A;  1TIF A;  3R2T A;  2QIE B;  1T0S C;  3A33 B;  2KTF A;  2MBB B;  2WDV B;  4HLE A;  1C77 A;  2FBW B;  4YTN B;  1QT9 A;  2DLB A;  4FUL A;  2ZCB A;  4GMV A;  4HEA 1;  3DVG X;  4OHJ A;  2G1E A;  1CQV A;  1SGH A;  2J42 A;  1WZ0 A;  4EZK A;  2BYF A;  2HE7 A;  4MJS B;  2R2O A;  3NVW A;  3O65 B;  3MP9 A;  2OHF A;  4PK1 A;  1ZXH A;  3P4Q B;  1JWS D;  3N1Z C;  1UBQ A;  1UWX A;  3B2F A;  1GOZ A;  2NTT A;  2RR9 A;  3NHE B;  3TUO A;  2GRI A;  4II3 B;  1R4M I;  5G5H A;  2IY0 B;  2V1Y A;  3ZXV A;  2KMM A;  2JZ3 B;  3V62 A;  4IC7 B;  3H1U A;  3VAW A;  2FCS A;  4FJV B;  1E8X A;  4KGR A;  2L05 A;  1L0X B;  2RDB C;  1PQS A;  1L5P A;  3PRM B;  1XD3 B;  1VDV A;  1I4R A;  2SAK A;  2L76 A;  4PS7 A;  1WX9 A;  2OOB B;  1SBB B;  4M01 A;  4O1N A;  3LJ3 A;  4DXF A;  2JZP A;  2IO1 B;  2ZNV C;  4K7W A;  2DX5 B;  4M0W B;  2KJR A;  3N1X C;  1E6E B;  2INN E;  3B1L X;  3C8Y A;  4C4V B;  4MGZ E;  4C80 A;  3CWI A;  4KSL C;  2MX2 A;  4ACF A;  2I2Y A;  2KAN A;  4M0W A;  4RCO A;  4S0R A;  2BB6 A;  3GZN B;  4XC2 A;  1UF0 A;  4RNA A;  1MPE A;  1ROE A;  1WGD A;  1WGK A;  4IG7 B;  4KZC A;  1IGC A;  2BYV E;  5CHF A;  3V61 A;  3KYC D;  4KIK B;  1KH0 A;  1L0Y B;  1WR6 E;  2WDR B;  1L4D B;  1T0R C;  2LXA A;  4HKZ E;  5JZE B;  2LZ6 A;  5LLI A;  1MHX A;  3HK0 A;  3UIN B;  3AUL A;  3EUB 2;  3AEA B;  2W54 A;  4YWG G;  3UIO B;  1TT5 B;  1FNV A;  3PO0 A;  4JE3 B;  4ZHO A;  2LXC A;  1UNS A;  1KLV A;  3HHM A;  3AE4 B;  1BML C;  3SD5 A;  1HE8 A;  2WXQ A;  3IT4 B;  4LNF A;  1J7C A;  2KVZ A;  5I4D A;  3VFK A;  4A8X C;  4S17 A;  2O6V D;  3VH3 B;  3ZIM A;  5C2T B;  4CHK A;  3RMK C;  3W1S A;  1FRD A;  3SDL C;  3ZLZ A;  5BMG A;  2GBM A;  2KDF B;  2LRW A;  3ZRF A;  1GB4 A;  1E7U A;  1Z5S B;  4MJS A;  4W9J A;  2N0S B;  1WXM A;  4US9 A;  2INC C;  4IM3 A;  2ZVO A;  2CR5 A;  3RPF C;  1PFD A;  4DXA B;  3AEE B;  4CQN A;  1GPX A;  1WSP A;  1TS3 A;  3PRE A;  4GXB A;  4CO7 A;  3IXS A;  2D11 A;  3ZNH B;  1KF6 B;  1VCB A;  1XLP A;  1EF5 A;  3BK2 A;  2WXH A;  3UF8 A;  3RFZ B;  4FLH A;  1V5O A;  4WJN A;  4XDC A;  1HZ5 A;  1JAL A;  1YD8 U;  3RI7 C;  2N7E A;  1WX7 A;  1WYW B;  2IPK D;  3C19 A;  2A5U A;  1FNU A;  2DNF A;  1WE7 A;  1RM6 C;  1ZP0 B;  3CMM B;  4ICV A;  2D3B A;  2KYW A;  1J19 A;  1NEK B;  4GDL A;  4MH0 E;  2W55 A;  4XX5 A;  4LNO A;  2BPS A;  3EHV A;  1C4C A;  2H89 B;  2KT7 A;  3VVW B;  2WXL A;  1N5W A;  2BB5 A;  1TZ1 A;  2BT6 A;  2D5G A;  4G3X B;  1QOF A;  3Q3M C;  2M1M A;  5BO4 B;  1IP9 A;  2UU7 A;  1GC6 A;  2JU6 X;  2K25 A;  3NOB A;  2IBI B;  2IY1 B;  4LJP B;  4BBN F;  4OVZ A;  1WXS A;  5DPT A;  2L83 A;  2MP2 A;  3AB5 A;  1OQY A;  5LNK 1;  5EDS A;  3ZJU A;  4ANV A;  3EFC A;  1YIW A;  2M8S A;  1WE6 A;  2PVG C;  1QOG A;  4CYE A;  4REZ A;  1KRH A;  2LGX A;  2K9X A;  4Q2J A;  2WXI A;  3H6N A;  1ZW7 A;  4J3O D;  2QHO A;  5HG2 A;  2Y5C A;  4PS3 A;  2WXR A;  4KKJ A;  5EE3 A;  2UYZ B;  2LVP A;  4K3B A;  2KDM A;  1QOA A;  3PVL A;  3FIL A;  2WXF A;  2RDH A;  1F2R I;  1MJD A;  3V05 A;  1WJ4 A;  5D2M B;  2L1A A;  4MAC A;  2JYE A;  3FC4 A;  4A9A A;  3JW0 X;  1A5R A;  2JYT A;  5CTR C;  1HXY D;  2J53 A;  2W9N A;  2BGF A;  1QF6 A;  3BWU D;  4BZA A;  3ZQ4 A;  2KLC A;  4RM9 A;  1K53 A;  3GB1 A;  1WRI A;  5AZF A;  1N60 A;  1RAX A;  1JML A;  1NYR A;  2PIA A;  4NQK E;  3P2B A;  1FXA A;  1WJN A;  2KQS A;  1KOT A;  2NR2 A;  3AU4 A;  4ZRQ A;  4DHZ B;  3AE6 B;  3AE3 B;  4W9D A;  2JZZ A;  4HDQ A;  1IBX B;  3JSV B;  3DWM A;  1XLQ A;  2QEJ C;  3DWG C;  4B95 A;  3PZ7 A;  2PE6 B;  4HJK A;  5HHD G;  3U4E G;  1IUE A;  3QK0 A;  2KDI A;  4DHJ D;  4HXD A;  4MH8 A;  1G6J A;  4MT5 A;  4JQW C;  2V3N A;  2VH2 A;  2RSU A;  4KSK C;  1TTN A;  2WLB A;  4XWW A;  1RFK A;  5J18 A;  4MGY E;  3LDZ E;  1S3S G;  3S2A A;  3L54 A;  4NJ7 A;  4C7Y A;  2KWC A;  3VR8 B;  2M4N A;  3V60 A;  1ZUD 2;  1N6Z A;  1R4N B;  4M02 A;  3U7D A;  4DWF A;  4M8N A;  1UH6 A;  3ZGZ A;  3DCG A;  2D3G A;  2PTL A;  1TS4 A;  5IP4 D;  2KKC A;  2LGI A;  2NCN A;  1E7V A;  3RD2 A;  3A4S C;  2KO3 A;  1ZDV A;  4WWN A;  4TQ0 A;  2GLS A;  1UGJ A;  1L2N A;  1NVI D;  2B3A A;  2PLP A;  2AEH A;  3PLV A;  2KFK B;  2MJD A;  3GZN I;  3B2G A;  3ONS A;  1M94 A;  1HEZ E;  4LNK A;  1FMA D;  2RPV A;  3Q2A C;  3Q3N C;  2LD9 A;  4TMA B;  4LCD E;  2YEP F;  1SEB D;  4LLG M;  3I63 C;  4PYU A;  5L95 C;  2M0X A;  2NMQ A;  3NG0 A;  4AP4 C;  2K3U A;  2CKH B;  3DBL B;  1N5X A;  2K6Q A;  2BF8 B;  3RNF C;  2MBE A;  2DZJ A;  4IW0 A;  3MC8 A;  4IUM B;  3W2D A;  4IM0 A;  3IBE A;  2MBQ A;  2LUE A;  3AED B;  3BVZ A;  4FAD A;  4YL8 A;  3HM3 A;  3WA0 A;  2YEP B;  1QZE A;  2WGS A;  2V4I B;  1UD7 A;  3TJP A;  5MPO A;  3IT6 B;  4N59 A;  3L08 A;  4HPL B;  4HCP B;  5AEK B;  1L4Z B;  1LFD A;  4E3C A;  1YX5 B;  2XNA C;  2KX3 A;  3PGE A;  3U52 E;  4NAM A;  1U4A A;  1GG3 A;  3CST A;  4ZDV A;  1M4V A;  1J7A A;  1WRD B;  2RD0 A;  4AWJ A;  2DEN B;  4C4V A;  1SB3 C;  3L13 A;  2NBU A;  3OG5 A;  4LK0 M;  1EWC A;  3B0A A;  2K8C A;  3MHS D;  3ZKJ C;  4AJY B;  3N20 C;  1YJI A;  2PMV A;  3EC8 A;  1EWY C;  1P7E A;  3ML9 A;  1B9R A;  2XK5 A;  3QA8 A;  4FXC A;  1P9D U;  4DBG A;  3ALB A;  3MC0 B;  4W9I A;  1FIQ A;  5FR6 A;  1B1Z A;  1V5T A;  3TSS A;  3TCA A;  2K1F A;  4ZYS A;  3R66 C;  3OLM D;  5D7G A;  3H8H A;  4HK2 A;  4G50 A;  2X8X X;  1JQ4 A;  1D5X C;  1WJ6 A;  3TEY A;  2AWT A;  3WIM A;  5GXG B;  1STE A;  3ZW3 A;  5HKH A;  3Q8F A;  3NS8 A;  4P6V F;  4JWS C;  1LQB A;  4BBN C;  3APF A;  4GGQ A;  2AQ2 B;  2D3C A;  3ENE A;  1E7P B;  1YOV B;  3J9C A;  3P4R B;  4BOS C;  1TYG B;  1RRB A;  2PKO A;  2FIF A;  2L0F A;  3IHP C;  4MDK E;  1K52 A;  2Q5W D;  3IVF A;  1I4P A;  5G2N A;  3UI3 A;  1I4H A;  3N9Y C;  3L16 A;  5IN7 A;  1WXA A;  4KDI C;  4B9K A;  2MH7 A;  5AZH A;  2QCZ A;  1C78 A;  1P3Q U;  3GE3 C;  1F77 A;  3U8Z A;  4TUU A;  3A9J B;  2B76 B;  2IO2 B;  3VTV A;  4HWI B;  1WM3 A;  1WMH B;  5HI1 A;  5H8Y E;  3L10 B;  4MGK E;  3N32 A;  4ZYN A;  2O2V A;  3RZW C;  4PYZ A;  4RMA A;  2FUG 1;  3QJZ A;  4ZOH C;  3APC A;  4W9C A;  2BYT A;  3SFE B;  4NJC A;  1YQB A;  2LUM A;  3BII D;  1I42 A;  3BK1 A;  2Z8L A;  2JWZ A;  2M19 A;  1WH3 A;  1QLB B;  2BS4 B;  2IND C;  4G11 A;  3W1S C;  2IGG A;  1MG8 A;  3NJT A;  1AN8 A;  2LI5 A;  3W5V B;  2KNB A;  1F2R C;  1PUT A;  1HZ6 A;  2IZV B;  1Q0W B;  2KMA A;  2ON8 A;  2ACZ B;  2NPT A;  2DAJ A;  3KUD B;  1EUV B;  2GBR A;  3LB8 C;  1AYF A;  1D5Z C;  1DYQ A;  3IAS 1;  3N3K B;  2NPT B;  5BYR A;  2JX5 A;  2KQ7 A;  2GMI C;  1TKE A;  2MBH A;  2LVO A;  3UQA A;  3QX1 A;  4LDT B;  2ZCC A;  2MBO A;  1ISN A;  1I4G A;  4KKI A;  4IM2 A;  3R7R A;  2V3P A;  3GOE A;  3TMP B;  1WZ3 A;  3VDZ A;  2NTS A;  4XZ4 A;  3NZS A;  3NY5 A;  1SJE D;  3VTW A;  2JRH A;  4P1B C;  4GLS C;  1L7Y A;  3HM6 X;  5T8I A;  4II2 B;  2RDG A;  2MP2 B;  2KN4 A;  2OJR A;  2WDQ B;  3NUH B;  3DHG C;  5GMV A;  2LHD A;  4TKN A;  3Q3F A;  5JHA A;  1N61 A;  3UGB B;  1LO5 D;  3WAM A;  5E6O A;  2K5P A;  2N9P C;  3Q6B A;  4PT5 A;  3AEG B;  4W9E A;  4NAW A;  3GE8 C;  2ZJD A;  3PPA A;  2SEB D;  4NPN A;  3DBS A;  3A1Q A;  4B0M A;  2CHZ A;  4JX1 C;  2MJ3 A;  3PRP B;  3ZNI D;  2C7M B;  2ZPY A;  3VXW A;  1T6B X;  1TS2 A;  4FA6 A;  3VHT C;  4WQO B;  1D6E C;  3QHT A;  4GSW A;  4C56 C;  4MSM B;  3TEW A;  2RGF A;  1E0Z A;  4RF1 A;  2YLM A;  3R7Q A;  2VRR B;  2MSE D;  2D3A A;  2C60 A;  4WH4 A;  2DBY A;  2O2V B;  4UDU C;  1ZE3 D;  2KDE B;  2WXO A;  1T0Q C;  3KWL A;  3BVG A;  1OTR B;  1WY8 A;  1S1Q B;  1SF0 A;  2DYO A;  5E6N A;  3RT3 B;  5C1Z A;  2MW5 A;  4RM8 A;  5G5G A;  4IKG A;  3CF6 E;  3JVZ X;  2LGD A;  3ZO5 B;  1RYJ A;  2WXM A;  3E56 A;  2FUH B;  4P16 A;  4OZC A;  1WGG A;  2V0G A;  2G4S A;  2BKR B;  4XGA B;  4HVB A;  4DQO C;  2BYE A;  4YTM B;  1OEY J;  2N4F A;  2A4Z A;  1GUA B;  1VZ7 A;  4MEL A;  1PYW D;  5BYQ A;  2QMT A;  1YNT E;  2FNJ B;  3MJW A;  2LHE A;  2N1V A;  2WXG A;  4ZRP A;  5KHQ A;  4N58 A;  2EKI A;  2IGD A;  4HRO A;  1HTO A;  1Q10 A;  2JSV X;  3RNG C;  1N63 A;  4K1R B;  1F52 A;  2WHI A;  1V97 A;  2AYO B;  2D2Q A;  2KHW B;  1WXV A;  4A90 A;  1NDD A;  2WWZ A;  3AEF B;  1KFY B;  1JRP A;  3GP7 A;  1KM7 A;  2KJ6 A;  4RGN A;  3DPD A;  4H2A A;  1CZP A;  3KWV A;  3VH4 B;  1FPY A;  1I4X A;  1ESF A;  1K51 A;  1T3Q A;  1OGW A;  2WXJ A;  4F1S A;  2VZK D;  1V1P A;  3T8M A;  2MA9 B;  1FCC C;  4B0E A;  1GAQ B;  4K81 A;  3W1Y A;  3SR6 A;  2IDY A;  1JWB D;  4RH6 A;  4A6Q A;  1VRA B;  3DVN U;  2AL6 A;  3VRA B;  2W3R A;  5JXV A;  4HJG E;  3AE8 B;  3Q8A A;  1XLO A;  1CK1 A;  3RUL A;  3EFU A;  4DDI D;  5LXI B;  1XF5 L;  3BYY B;  2K8B A;  2G3Q B;  4L2Y A;  5JH5 C;  1WR1 A;  1TGZ B;  1P98 A;  1T0Y A;  1V1P B;  2JY6 A;  3ZDT A;  1E90 A;  1CMX B;  4FN2 A;  1Q5W B;  3ZUN A;  1I35 A;  2LMC A;  3BY4 B;  4A20 A;  3L17 A;  2WX1 A;  3HIZ A;  3P4S B;  3VUY A;  3KYD D;  3ZNG C;  5LXH A;  3EA6 A;  5AUK A;  3I5J C;  2GB1 A;  1TBE A;  2WU2 B;  1RLF A;  4J6I A;  4D2K A;  3SHQ A;  2IJ0 A;  2CJN A;  4LNI A;  3KUC B;  5BYS A;  4YSY B;  2C5L C;  3WCQ A;  3HVZ A;  5KHO A;  3B9J A;  3PHX B;  4G0N B;  3AH7 A;  1VZ8 A;  5C23 A;  3U2S C;  4NNJ B;  4OVU A;  2N7J A;  3RYT A;  3KLS X;  3DDC B;  4WAA A;  3AV8 A;  2W82 A;  3ZVV A;  2EKE C;  2FCM A;  4DHJ B;  3LYY A;  4A3P A;  4A55 A;  3RUI B;  2L7R A;  4F8C B;  4NAW B;  1E10 A;  3U7Z A;  2AX5 A;  1EO6 A;  2MHJ A;  3DBL I;  3KUZ A;  4YXD B;  1C4A A;  2N9K A;  3APD A;  4F7Z A;  2W3S A;  3AE2 B;  1L6U A;  2JRI B;  5DPS A;  1OQQ A;  1KLU D;  1HA5 A;  4RF0 A;  1FXT B;  4WAF A;  1FXI A;  1UGM A;  1V6E A;  4WIP A;  1TZO A;  4URK A;  2C7N B;  1YJ1 A;  3I57 A;  1TS5 A;  1ZKH A;  2PJH A;  2FAZ A;  5EE9 A;  3D32 A;  2ONQ A;  3CSF A;  1UEL A;  1X1M A;  2WNM A;  4XDD A;  1MG4 A;  3TEX A;  2HD5 B;  2LJI A;  3R2I A;  2BS2 B;  3N1Y C;  4GDK A;  4XYC A;  3X23 A;  1V9J A;  1OQR A;  2K8H A;  3Q3J A;  4GU2 A;  5D3I B;  3L0W B;  2R2Q A;  1ENF A;  2M17 A;  3O13 A;  3K9P B;  5E6P A;  1PGB A;  2K39 A;  4YSZ B;  1EU4 A;  4WJP A;  4LDT D;  3VQI A;  2I1J A;  3T3O A;  1UUP A;  2KZR A;  2XBB C;  3E9S A;  1XO3 A;  3HUI A;  1R7S A;  2ZVN A;  1P0R A;  2V9H A;  2CS4 A;  2G45 B;  2J52 A;  2KOX A;  4RGT A;  2E3T A;  3AE7 B;  2M56 B;  4P1C C;  4WQM A;  4EZJ A;  1JW9 D;  1V80 A;  1K8R B;  3Q8C A;  3BYT B;  1LGR A;  4MM3 A;  2AQ3 B;  3DVN V;  2CJO A;  3AI5 A;  5AUI A;  3AEB B;  2NBV B;  4KX6 B;  3BZD B;  4EEW A;  1QIL A;  4BKS D;  1BXT A;  1P7F A;  5C3J B;  2GBJ A;  3M3J A;  2XEW A;  2HJ8 A;  1I7H A;  2L32 A;  4KGT A;  3TBL D;  2DYB A;  1WFY A;  1XT9 B;  3C0R B;  3KH0 A;  2CU1 A;  3ECI A;  1TKG A;  4AQ7 A;  1C3T A;  3ZYY X;  2N9E B;  2DZK A;  3MHZ A;  3VUX A;  2L52 A;  4KV2 A;  1BUI C;  2JPH A;  1OEY A;  4RGM A;  2KLG A;  2FE8 A;  2J7Q B;  1WM2 A;  4IDI A;  4NZL B;  4ARI A;  2N9L A;  4AUQ C;  4W9H A;  3AE9 B;  2KC1 A;  2WX0 A;  1FRR A;  3WAL A;  2GBK A;  2MEK A;  4K3C A;  1FM0 D;  4LJO B;  4ANW A;  4JLC A;  2KAC A;  1KLG D;  2ICI A;  2LFI A;  5FKA C;  4L1B A;  3TIX A;  1MVK A;  2UWQ A;  3MFG A;  3RCZ A;  3UQB A;  1XLN A;  4ARC A;  1BT0 A;  2JXX A;  2G4D B;  3KQ4 A;  3PTF C;  1RFA A;  2Y5P A;  5BMH A;  1FFU A;  1I4Q A;  4NY0 A;  1V81 A;  4GN1 A;  3PZ8 A;  1YQ3 B;  1JRU A;  2J0J A;  2KAJ A;  2KK8 A;  4JGH B;  4L23 A;  2LJ5 A;  3WAN A;  4RGO S;  3PT2 B;  1VD2 A;  2KC2 A;  1NI3 A;  3QC8 B;  4E74 A;  4FHJ A;  2HTM E;  4HPP A;  1YMH E;  4BKS A;  2JUO A; 
#chains in the Genus database with same CATH homology
 1WJN A;  3CF6 E;  2KQS A;  3JVZ X;  4MGI E;  4I6L B;  1KOT A;  3PLU A;  2NR2 A;  3AU4 A;  3A4R A;  4DHZ B;  2LGD A;  4EZL A;  5IA7 A;  3RZF A;  4JL9 A;  2O6V B;  4W9D A;  4TV3 A;  3ZO5 B;  2JZZ A;  4HDQ A;  2KD0 A;  3JSV B;  4JIO U;  3U30 A;  2FUH B;  1E8W A;  1GNU A;  3AXC A;  4W9F A;  1WGG A;  2G4S A;  2BKR B;  4X57 B;  4B95 A;  2O6V A;  4W9K A;  4BVU C;  2LAS A;  5CHV C;  2PE6 B;  1IPG A;  1V2Y A;  3M63 B;  4HJK A;  4HVB A;  2BYE A;  3QK0 A;  2KDI A;  2V3S A;  1OEY J;  2N4F A;  2A4Z A;  4DHJ D;  4HXD A;  1XQQ A;  4K7U A;  5CHW A;  4N9F 4;  4FBJ B;  3ZRC A;  1GUA B;  4HPM B;  4MEL A;  3IFW B;  4WWO A;  1G6J A;  3SU8 X;  4BKG A;  4JQW C;  5TR5 A;  2IO0 B;  3WAP A;  1WGR A;  3QAQ A;  2RSU A;  3UIP B;  4KSK C;  1TTN A;  1WX8 A;  4HCN B;  2FNJ B;  3X0W A;  3MJW A;  3WAO A;  2IYD B;  5J18 A;  1LXD A;  2N1V A;  3OJ3 A;  4NQL B;  4MGY E;  4EUT A;  5DPW A;  3LDZ E;  1S3S G;  3S2A A;  3L54 A;  4NJ7 A;  2PPH A;  5KHQ A;  2KTR A;  2BKF A;  3QWZ B;  2YVC A;  1LM8 B;  2N7D A;  2NS5 A;  2KWC A;  5G55 A;  2M4N A;  3R3M A;  3QCA A;  3K9O B;  3V60 A;  4BOZ B;  3IG3 A;  2J0M A;  2FID A;  4K1R B;  2L8J A;  3QIJ A;  2KN5 A;  3VTU A;  2AYO B;  2D2Q A;  3PSE B;  2KHW B;  3U7D A;  1WXV A;  4DWF A;  4M8N A;  1V86 A;  1UH6 A;  3DCG A;  1NDD A;  2D3G A;  2IO3 B;  2D10 A;  2WWZ A;  2FCQ A;  3OAW A;  3N30 A;  2KWU B;  2KKC A;  1KM7 A;  2NCN A;  2KJ6 A;  3B08 A;  1E7V A;  3H7P B;  5CX3 A;  3A4S C;  3RD2 A;  2KO3 A;  3DPD A;  4WWN A;  4TQ0 A;  3PS6 A;  4MSQ B;  1WMH A;  1L2N A;  3KVF B;  2B3A A;  3P2B A;  3VH4 B;  2AEH A;  3PLV A;  1E8Z A;  4GOC A;  2ASQ A;  2KFK B;  4GDK B;  1OGW A;  4ZRJ A;  4F1S A;  2MLB A;  3GZN I;  1P1A A;  1ZGU B;  3ONS A;  1M94 A;  3A9K B;  3T8M A;  4DK5 A;  2MA9 B;  4I6N B;  1E5W A;  2ZZP B;  4A3O A;  2LD9 A;  4K81 A;  2L3Z A;  3W1Y A;  4LCD E;  2NVU I;  3ZTD A;  4FJZ A;  2D07 B;  4ICU A;  4KZ0 A;  4PYU A;  4OVV A;  5L95 C;  2M0X A;  3A33 B;  2MQJ A;  2KTF A;  2MBB B;  2WDT B;  3DVN U;  4AP4 C;  4HLE A;  5JHB A;  2CKH B;  2AL6 A;  2KX0 A;  5D6J B;  2K6Q A;  2BF8 B;  3QAR A;  2REX A;  2MBE A;  3AU5 A;  2DZJ A;  2V4L A;  4IW0 A;  3RUL A;  2MRP A;  4FUL A;  3EFU A;  4IUM B;  2ZCB A;  4GMV A;  4DDI D;  4IM0 A;  3IBE A;  2MBQ A;  5LXI B;  2LUE A;  3DVG X;  2K8B A;  2Y5B B;  3PV1 A;  4YL8 A;  2LGY A;  3HM3 A;  2LRU A;  3WA0 A;  4FAD A;  1QZE A;  2G3Q B;  1SGH A;  1UD7 A;  5JH5 C;  1WR1 A;  1WZ0 A;  3TJP A;  1TGZ B;  1P98 A;  1T0Y A;  2ZPN A;  2CHW A;  2JY6 A;  3L08 A;  3ZDT A;  1E90 A;  4WJQ A;  1CMX B;  4EZK A;  4ZRI A;  4FN2 A;  1Q5W B;  3ZUN A;  1NBF C;  2BYF A;  4HPL B;  2HE7 A;  2KWV B;  4HCP B;  1I35 A;  4MJS B;  1WIA A;  2PEA A;  3BY4 B;  4A20 A;  3L17 A;  2WX1 A;  5AEK B;  3HIZ A;  1LFD A;  4E3C A;  3VUY A;  3KYD D;  2R2O A;  3ZNG C;  1YX5 B;  3O65 B;  5LXH A;  2MWS B;  5D94 A;  2KX3 A;  2N1W A;  1UBI A;  3PGE A;  1U4A A;  1TBE A;  1GG3 A;  5DCN A;  3CST A;  4ZDV A;  1RLF A;  1UBQ A;  4J6I A;  3SHQ A;  1WRD B;  2RD0 A;  3KUC B;  4AWJ A;  2RR9 A;  2DEN B;  3NHE B;  4KDL B;  2C5L C;  3T9L A;  3L13 A;  2NBU A;  5J17 A;  4II3 B;  1R4M I;  2K8C A;  3B0A A;  3PHX B;  4G0N B;  3MHS D;  4K7S A;  5KHO A;  3ZKJ C;  5C23 A;  4AJY B;  2IY0 B;  4NNJ B;  3M95 A;  2V1Y A;  4OVU A;  3EC8 A;  5DPR A;  3RYT A;  3ML9 A;  2XK5 A;  3DDC B;  2JZ3 B;  3V62 A;  4IC7 B;  3H1U A;  4WAA A;  3QA8 A;  3VAW A;  1P9D U;  2FCS A;  4FJV B;  3ALB A;  1E8X A;  3ZVV A;  2DZI A;  4DBG A;  3KW5 B;  2EKE C;  2FCM A;  2L05 A;  4W9I A;  2JT4 B;  2ZEQ A;  5FR6 A;  4DHJ B;  1PQS A;  1V5T A;  1NI2 A;  4A3P A;  3TCA A;  2C7H A;  3PRM B;  1XD3 B;  2K1F A;  3RUI B;  2L7R A;  3R66 C;  3OLM D;  5D7G A;  4F8C B;  2I1K A;  4HK2 A;  4G50 A;  4NAW B;  1J8C A;  2L76 A;  1V49 A;  4W9L A;  1EO6 A;  4PS7 A;  1WJ6 A;  3ZDM C;  2AWT A;  1WX9 A;  2KVR A;  3WIM A;  2OOB B;  3DBL I;  3KUZ A;  3LJ3 A;  3ZW3 A;  5HKH A;  3PZD A;  3APD A;  2IO1 B;  4F7Z A;  2DYM A;  2ZNV C;  4ANX A;  4K7W A;  3NS8 A;  2DX5 B;  4M0W B;  4NJ6 A;  2KJR A;  2JRI B;  1LQB A;  4BBN C;  5DPS A;  3APF A;  3PHW B;  2ZNV B;  4GGQ A;  3B1L X;  4ASW C;  4FHK A;  3ENE A;  4MGZ E;  3ZNZ B;  1FXT B;  4AJW A;  4BOS C;  4KSL C;  2MX2 A;  1UGM A;  1RRB A;  2KAN A;  1V6E A;  2KDB A;  2FIF A;  2KTR B;  2L0F A;  3IHP C;  4MDK E;  2C7N B;  1YJ1 A;  4EFO A;  4URK A;  3IVF A;  1ZKH A;  2PJH A;  4XC2 A;  2FAZ A;  2EMT A;  4IWQ A;  5G2N A;  1Y8R C;  3D32 A;  3CSF A;  3L16 A;  1WGD A;  1UEL A;  1WXA A;  1X1M A;  2GOW A;  4PS8 A;  4KDI C;  2HD5 B;  1EF1 A;  4B9K A;  5AZH A;  4IG7 B;  4IWO A;  2BYV E;  4KZC A;  5CHF A;  3V61 A;  3KYC D;  1P3Q U;  4KIK B;  3ML8 A;  4GDL B;  4GDK A;  1WR6 E;  3X23 A;  1V9J A;  3A9K A;  2K8H A;  4IWP A;  2LXA A;  5JZE B;  2AL3 A;  3Q3J A;  4GU2 A;  3L0W B;  3U8Z A;  4TUU A;  3H9D A;  2R2Q A;  3A9J B;  2M17 A;  3DVG Y;  3K9P B;  2LZ6 A;  5E6P A;  5LLI A;  2IO2 B;  2BWE S;  2K39 A;  3VTV A;  4HWI B;  1WM3 A;  1WMH B;  4GIV A;  3HK0 A;  3UIN B;  4WJP A;  3L10 B;  3AUL A;  4LDT D;  3VQI A;  3V6C B;  2I1J A;  4MGK E;  2LWP A;  3EEC A;  3N32 A;  3VUW A;  2CHX A;  4ZYN A;  2Z0D B;  3UIO B;  2O2V A;  2XK5 B;  3I3T B;  3RZW C;  2KZR A;  4PYZ A;  2LXC A;  2XBB C;  4RMA A;  2WYQ A;  3QJZ A;  2KFK A;  3JYU A;  2ZVN A;  1P0R A;  1KLV A;  3HHM A;  1H8C A;  2CS4 A;  2G45 B;  3APC A;  3SD5 A;  1HE8 A;  2JVC A;  4W9C A;  2J0K A;  2KOX A;  1F9J A;  4GB9 A;  4KVG B;  1YQB A;  1I42 A;  3VFK A;  4DDG D;  2JWZ A;  4WWP A;  1WH3 A;  3BIN A;  4EZJ A;  3H7P A;  2O6V D;  2JF5 A;  3VH3 B;  3ZIM A;  1SE9 A;  4CHK A;  4G11 A;  3W1S C;  2KMC A;  1V80 A;  3DOW A;  1K8R B;  3W1S A;  4EOY A;  1WJU A;  3SDL C;  1MG8 A;  3ZLZ A;  2KXJ A;  2PE9 A;  2GBM A;  2KDF B;  2LRW A;  4MM3 A;  2LI5 A;  3ZRF A;  3DVN V;  1C1Y B;  1E7U A;  1Z5S B;  3AI5 A;  2KNB A;  1WGY A;  3MTN B;  4MJS A;  2NBV B;  4BKT A;  2L00 B;  3M62 B;  2EMS A;  2IZV B;  3A9J A;  4W9J A;  2MCN B;  4EEW A;  1Q0W B;  4BKS D;  2GBN A;  2K6D B;  2KMA A;  2DHZ A;  3DBR I;  1WXM A;  1WF9 A;  2GBJ A;  3M3J A;  2LVQ A;  2XEW A;  2NPT A;  2HJ8 A;  2DAJ A;  2C9W B;  4BFR A;  3KUD B;  1EUV B;  3TBL D;  2DYB A;  4IM3 A;  2GBR A;  2ZVO A;  1WFY A;  1XT9 B;  2CR5 A;  3C0R B;  2N9X A;  3KH0 A;  3ZTC A;  2CU1 A;  3ECI A;  3H7S A;  4WJO A;  3N3K B;  4DXA B;  2NPT B;  1GJZ A;  1AAR A;  2FCN A;  3DQV A;  1Q1O A;  1C3T A;  2N9E B;  2DZK A;  3PRE A;  4GXB A;  4ZRK A;  4CO7 A;  3VUX A;  2D11 A;  4KV2 A;  2KQ7 A;  3ZNH B;  1H4R A;  1VCB A;  4B6W A;  1EF5 A;  2GMI C;  2MBH A;  2JPH A;  3UF8 A;  2LVO A;  4FLH A;  3UQA A;  1V5O A;  4WJN A;  1OEY A;  2Z59 B;  3QX1 A;  2KLG A;  2ZCC A;  1YD8 U;  2MBO A;  4LDT B;  2N7E A;  1ISN A;  1WX7 A;  2J7Q B;  1WYW B;  1D3Z A;  4IM2 A;  3R7R A;  1WM2 A;  2A5U A;  3V6E B;  1WE7 A;  3GOE A;  1WZ3 A;  3TMP B;  3VDZ A;  3QQ8 B;  4XZ4 A;  3NZS A;  3CMM B;  4ICV A;  4W9G A;  3NY5 A;  1J19 A;  3VTW A;  1WI0 A;  4GDL A;  2JRH A;  4AUQ C;  4KIK A;  4DHZ E;  4MH0 E;  4W9H A;  1GC7 A;  3DBH I;  2KC1 A;  1L7Y A;  4HDO A;  2WX0 A;  1YX6 B;  3HM6 X;  4XX5 A;  2BPS A;  4II2 B;  3WAL A;  2GBK A;  3EHV A;  2MP2 B;  2OJR A;  3VVW B;  5GMV A;  1TZ1 A;  4TKN A;  3Q3F A;  5JHA A;  4P7I A;  3UGB B;  4G3X B;  3WAM A;  5L83 A;  1KJT A;  2M1M A;  5BO4 B;  2NBW B;  5E6O A;  4EKU A;  1GC6 A;  1IP9 A;  2K25 A;  3NOB A;  2IBI B;  2IY1 B;  2N9P C;  3A1Q B;  1SIF A;  4LJO B;  4LJP B;  4M8M A;  4BBN F;  4ANW A;  4AOF A;  1WXS A;  5DPT A;  4W9E A;  4JLC A;  4NAW A;  2MP2 A;  1OQY A;  5IAA C;  5EDS A;  4E71 A;  2HTH A;  2ZJD A;  4ANV A;  3PPA A;  1YIW A;  2M8S A;  1WE6 A;  4NPN A;  3TIX A;  4MEM A;  2BWF A;  4CYE A;  3DBS A;  3A1Q A;  2UWQ A;  2LGX A;  3RCZ A;  3H6N A;  3UQB A;  1UZX B;  2CHZ A;  1ZW7 A;  4FJY A;  2KFJ A;  3PRP B;  3ZNI D;  1BT0 A;  2C7M B;  2QHO A;  2ZPY A;  5J2R A;  2JXX A;  1IYF A;  4PS3 A;  2G4D B;  3TL5 A;  3VXW A;  4FA6 A;  3NZU A;  2UYZ B;  3VHT C;  2LVP A;  4WQO B;  2DAF A;  3PVL A;  3QHT A;  5AZG A;  2RPQ A;  4GSW A;  3PTF C;  1RFA A;  4MSM B;  4ANU A;  4NY0 A;  1E8Y A;  1V81 A;  1WJ4 A;  4GN1 A;  5D2M B;  4I6P A;  2RGF A;  2KJH B;  2YLM A;  1JRU A;  3R7Q A;  3JW0 X;  2J0J A;  1A5R A;  2VRR B;  5CTR C;  2MSE D;  2KK8 A;  1WGH A;  2BGF A;  2W9N A;  3PRZ A;  4JGH B;  4TQ1 A;  2DZM A;  1J0G A;  2C60 A;  2KLC A;  2LJ5 A;  4RM9 A;  3WAN A;  2O2V B;  2KDE B;  5AZF A;  3PT2 B;  1VD2 A;  1RAX A;  1Z2M A;  2KC2 A;  3OJ4 B;  1R4N I;  3QC8 B;  4E74 A;  1OTR B;  1WY8 A;  1S1Q B;  2DYO A;  5E6N A;  3RT3 B;  3JSV A;  4FHJ A;  5C1Z A;  2MW5 A;  2Z0E B;  2L0T A;  4BKS A;  4RM8 A;  4NQK E;  2JUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...