2LGXA

Nmr structure for kindle-2 n-terminus
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
94
structure length
94
Chain Sequence
MALDGIRMPDGCYADGTWELSVHVTDVNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Membrane Binding of the N-Terminal Ubiquitin-Like Domain of kindlin-2 Is Crucial for Its Regulation of Integrin Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Fermitin family homolog 2
total genus 8
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18124 Kindlin_2_N Kindlin-2 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lgxA00
1LQBA 4NJ6A 2PPHA 3OLMD 1UBQA 1J19A 2KJRA 2AYOB 1BT0A 3VH4B 4II2B 1WRDB 5CHVC 1WFYA 3AULA 4E74A 2KX3A 1UBIA 1WGGA 2DZKA 4MJSB 2C5LC 2KMAA 3A4SC 1YJ1A 2XK5B 2KDFB 4IC7B 2KQSA 2DYBA 4FA6A 4JLCA 4PYZA 2HE7A 2FCSA 3O65B 1E8XA 3V6EB 3N32A 1WM2A 4GN1A 2MBOA 3ML9A 4ICVA 5IAAC 2DZIA 2NBUA 4GIVA 4I6NB 2DAJA 2KNBA 3JW0X 1RFAA 4HJKA 3VTUA 3ZRCA 2BYEA 5IA7A 2JVCA 2BWES 1V6EA 2EMTA 2PEAA 2MA9B 1I42A 4G11A 3UINB 4WWOA 1D3ZA 2D10A 2LXCA 3QC8B 2RD0A 2C9WB 4MGIE 3UGBB 5AZGA 3M62B 5D94A 4KDLB 4ANXA 2FUHB 2OJRA 2KTFA 2IZVB 3GOEA 3ZW3A 2MWSB 3KW5B 3PRPB 1WIAA 2KC1A 3EFUA 5AEKB 4K7UA 5LXHA 3H6NA 5L95C 2L05A 2K6DB 3RCZA 3KH0A 3V60A 1GC7A 2O6VB 3WA0A 1WE7A 2ZNVC 3OJ3A 3X0WA 4KDIC 3K9OB 4G0NB 5G2NA 4G3XB 2JZ3B 2KC2A 2BYVE 1KM7A 4XC2A 1V2YA 4JL9A 3RULA 3ZUNA 2N9XA 5JZEB 3HM3A 2K8CA 3W1SC 1ZW7A 3AU5A 4BKSD 2OOBB 3EECA 4HPLB 2JY6A 2EMSA 2MP2B 4M8MA 3UIOB 5DPWA 3A4RA 1AARA 1L2NA 3DOWA 4TQ1A 2ZCBA 2LASA 4EFOA 5D7GA 2KD0A 1YQBA 4N9F4 2G4DB 4KZCA 4AP4C 4FHJA 4FULA 3A1QB 2KOXA 3ZNID 3H7PA 3P2BA 3SHQA 2NBVB 3K9PB 2AL6A 5EDSA 1J0GA 2C60A 1CMXB 4DHZE 4NAWB 3VH3B 3RT3B 2KANA 4WJOA 1E5WA 2MBEA 1TTNA 2HJ8A 1OGWA 2K8HA 2LVQA 2LRWA 3UF8A 4ZYNA 4ANWA 2M4NA 3ZVVA 5CHFA 1V49A 4PS7A 2ZPNA 1WZ3A 3APFA 1WZ0A 2O2VA 4TKNA 2Y5BB 2KMCA 3Q3JA 4DBGA 3QWZB 4KSLC 4EUTA 1QZEA 2KHWB 4GSWA 2KFKA 2DHZA 2C7NB 3S2AA 5FR6A 4IUMB 4NJ7A 2L0TA 3V62A 2ZEQA 3QQ8B 4AUQC 1E7UA 3PRMB 3IHPC 3L08A 4MGYE 2DZMA 5LXIB 4JIOU 3B08A 4GOCA 4E71A 4CYEA 3PRZA 3VFKA 1KLVA 3UIPB 2LD9A 2UWQA 3DQVA 3M95A 4GDKA 4W9EA 3ZDMC 1HE8A 2MBBB 4W9KA 2HD5B 2C7HA 2LI5A 2WX0A 2IYDB 2IY1B 4ANUA 1Z5SB 2IO2B 2V3SA 3I3TB 3U7DA 2CU1A 3TBLD 5JHAA 2ZNVB 1R4NI 3R7QA 4EEWA 2N9EB 2KWVB 4WQOB 3RZFA 3VHTC 2DYOA 5CHWA 2GBMA 1RRBA 4DHJD 2EKEC 4K81A 3PTFC 4BFRA 2NR2A 1UH6A 2JWZA 3CF6E 3QJZA 4NQLB 2FNJB 1C1YB 5AZHA 2Z0EB 3R3MA 3RZWC 3VTWA 2IO0B 3PT2B 2MLBA 3MJWA 4IM0A 2AEHA 2CKHB 2RGFA 1P9DU 5D6JB 1YX6B 1OQYA 3BINA 4JGHB 3APCA 4LJOB 4HDQA 4GXBA 1ISNA 1XD3B 2KLCA 2L8JA 4TUUA 1M94A 1F9JA 1E8ZA 2MBQA 3IBEA 4K7WA 3W1SA 2D3GA 3IVFA 4IM3A 1WXMA 1L7YA 2GBKA 1WY8A 4HPMB 4GDLB 1Q1OA 2IO3B 4J6IA 3N3KB 3NZSA 5TR5A 3RYTA 3HM6X 4ZRJA 3T9LA 2MX2A 3H7PB 2JRHA 1TGZB 3SU8X 2VRRB 4FJYA 4BKTA 4MSMB 2N4FA 2Z59B 4B6WA 1C3TA 1NBFC 4NNJB 3A9JA 3VAWA 2ZZPB 1PQSA 4IWQA 2KTRB 3L10B 2GBJA 2CHWA 4KZ0A 2MP2A 4RM9A 1VD2A 3U8ZA 3PHXB 2RR9A 5C1ZA 1E8YA 3JVZX 1WJNA 2J0KA 3RD2A 2KWCA 1WR6E 1V9JA 2CHXA 2O2VB 3WALA 3L0WB 3QIJA 1GC6A 1V5OA 3VUXA 4RM8A 2G3QB 4MJSA 4X57B 4W9GA 3V61A 3VQIA 4BVUC 2WYQA 2PE6B 3DDCB 4KSKC 4MDKE 3OAWA 4HWIB 3ECIA 2PE9A 2MCNB 4DDID 3ENEA 1I35A 2KTRA 4GB9A 4EZKA 2N7EA 3IG3A 3ZDTA 3ZNZB 3PLUA 2B3AA 4K7SA 3VTVA 2W9NA 5KHOA 2I1KA 1XQQA 3N30A 4XX5A 2ZVNA 3QHTA 3KUCB 5HKHA 4II3B 1J8CA 1NDDA 3D32A 5G55A 2LZ6A 2M8SA 4IWPA 2KWUB 1WM3A 2WDTB 3KUZA 4HCPB 1ZKHA 1WMHA 2KXJA 4BKSA 3QX1A 3ZKJC 2AWTA 3LDZE 3PREA 3KVFB 1XT9B 2BPSA 1KOTA 3WIMA 1OEYA 3H9DA 4ICUA 4CO7A 1WX8A 2FCNA 2N7DA 3TCAA 4AJWA 2NCNA 4E3CA 4W9CA 1YX5B 3NHEB 4BBNF 2ASQA 3VDZA 2M17A 1WYWB 2CS4A 4WJNA 3TJPA 2J0MA 3PVLA 5DPRA 3ZNGC 4PS8A 4GDLA 1KJTA 2LGDA 4WAAA 4MH0E 1GJZA 2D11A 2LGXA 4NQKE 1R4MI 4HLEA 2JXXA 1VCBA 1WJ6A 4FJZA 1U4AA 3A9KB 1P3QU 2NVUI 4W9FA 1EUVB 2J0JA 2N1VA 4RMAA 2BYFA 4WJPA 2C7MB 2K25A 1WH3A 3KYDD 2D07B 4HXDA 4DDGD 1S3SG 1V81A 1TBEA 3AI5A 2R2QA 2DYMA 3DBLI 3A33B 1Y8RC 1P0RA 3SDLC 4AOFA 2DAFA 3HIZA 4BKGA 3WAPA 3WAOA 3PHWB 3NS8A 4HK2A 4A3OA 4EZLA 1WGYA 2K6QA 1GG3A 4MEMA 2KJ6A 4EOYA 3LJ3A 2MSED 3R7RA 3NY5A 2MQJA 2FIFA 2BKRB 3ZNHB 2M0XA 2XEWA 2RPQA 1E8WA 2DENB 1WE6A 4HVBA 3M63B 4LCDE 3PGEA 2GBRA 3DPDA 1WXVA 1IP9A 5C23A 3QCAA 1V5TA 1WXAA 2KDIA 2LXAA 4KVGB 2KO3A 2LVOA 1YIWA 2FAZA 2L00B 3GZNI 4MM3A 5GMVA 2G45B 4IW0A 2V4LA 3NZUA 4MGKE 4WWNA 2O6VA 2D2QA 4TV3A 3EHVA 3VXWA 3DVNU 4GU2A 5KHQA 3JYUA 3PSEB 4GMVA 3MTNB 4OVVA 5AZFA 3A9JB 4FLHA 2CHZA 4W9JA 2KLGA 3DCGA 2L0FA 2LVPA 2YVCA 4W9IA 5JH5C 2QHOA 3HHMA 4ANVA 3UQAA 3ZIMA 3AU4A 2IY0B 3H7SA 4HDOA 3ZO5B 2Z0DB 2FCQA 2FCMA 2L76A 2AL3A 2KFKB 2KVRA 2G4SA 3L13A 2KDBA 3PPAA 4FHKA 3ALBA 4B9KA 4B95A 4FBJB 3ZLZA 4K1RB 4GDKB 3TL5A 1EF1A 3X23A 3KYCD 4W9DA 3PLVA 2IO1B 2J7QB 3B0AA 1WGHA 1H8CA 2R2OA 2DZJA 3Q3FA 4DWFA 3OJ4B 3DBHI 1WJUA 1RAXA 4BOSC 2JPHA 1K8RB 2JUOA 1X1MA 2KKCA 4NAWA 1E90A 4KIKA 5D2MB 2JT4B 5JHBA 2KZRA 2A5UA 2ZCCA 1SGHA 3L16A 3TIXA 3WAMA 1ZGUB 3AXCA 4W9LA 4DHJB 4WWPA 2IBIB 2LWPA 3A1QA 4I6LB 4YL8A 4PS3A 3VUYA 2FIDA 3H1UA 3MHSD 4G50A 2M1MA 3DBSA 4HCNB 1V80A 3QA8A 4NY0A 3RUIB 4DK5A 2XBBC 1G6JA 5J17A 3ML8A 4M8NA 2GBNA 3SD5A 3B1LX 3DVGY 2KN5A 1GUAB 2BGFA 3JSVB 3V6CB 2L7RA 2BWFA 4AJYB 3DBRI 5E6PA 2JF5A 1EO6A 4CHKA 1WGDA 3PZDA 4F8CB 5L83A 3QAQA 3CSTA 2KX0A 2UYZB 1P1AA 5J18A 4MELA 4FN2A 3W1YA 1P98A 2NPTA 3CSFA 2PJHA 4DHZB 4ASWC 3UQBA 1EF5A 2A4ZA 2KDEB 4KV2A 3IFWB 2K39A 4IG7B 2BKFA 4BBNC 4LDTB 2NS5A 1GNUA 4I6PA 4KIKB 3U30A 4XZ4A 1RLFA 3ZTCA 2I1JA 3PS6A 3JSVA 1H4RA 1A5RA 4JQWC 2K8BA 2YLMA 2ZJDA 3ONSA 4IWOA 5DCNA 4F1SA 1YD8U 3CMMB 3L54A 4EKUA 4FJVB 2JZZA 4TQ0A 1IPGA 3C0RB 3KUDB 1WX7A 3ZRFA 1MG8A 1S1QB 4PYUA 4WJQA 2K1FA 3T8MA 2O6VD 3BY4B 1WF9A 4ZDVA 1WJ4A 1E7VA 4MSQB 4FADA 2RSUA 4IM2A 3APDA 4ZRKA 4MGZE 2HTHA 3A9KA 4AWJA 1T0YA 2KJHB 1WMHB 5CX3A 2WX1A 2BF8B 2L3ZA 2ZPYA 3HK0A 1Q0WB 4A3PA 1TZ1A 4URKA 2CR5A 2KFJA 2REXA 4A20A 3DVGX 1UELA 5E6NA 3VUWA 1FXTB 1WXSA 3QK0A 2ZVOA 3DVNV 3WANA 4LDTD 5DPSA 2LGYA 4OVUA 5LLIA 4M0WB 1WX9A 2NPTB 1WR1A 5E6OA 1Q5WB 2DX5B 3QARA 1WI0A 3EC8A 4DXAB 2WWZA 1UGMA 3VVWB 3R66C 4ZRIA 1UZXB 5J2RA 1Z2MA 4NPNA 5BO4B 5CTRC 2GMIC 2V1YA 2MRPA 2GOWA 4GGQA 1V86A 2LRUA 1LXDA 4W9HA 1IYFA 2N1WA 1OTRB 1NI2A 2MBHA 4F7ZA 3PV1A 4LJPB 1LFDA 1WGRA 2LJ5A 3L17A 3M3JA 4BOZB 2KK8A 2LUEA 2XK5A 1JRUA 2KQ7A 2JRIB 2NBWB 1SE9A 3NOBA 3TMPB 3ZTDA 5DPTA 1UD7A 2MW5A 1SIFA 4P7IA 4EZJA 1LM8B 2N9PC 1OEYJ
chains in the Genus database with same CATH superfamily
2PPHA 2KQ4X 2KJRA 2AYOB 5CHVC 4HPPA 3AE5B 4E74A 1WGGA 1TS3A 1FPYA 2XK5B 3AE6B 2KQSA 3DBHB 4JLCA 4PYZA 3O65B 1E8XA 3N32A 1TYGB 2MBOA 3ML9A 4ICVA 5IAAC 4I6NB 2QDFA 2V3PA 2DWQA 2DAJA 5C3JB 4L2YA 1I42A 2EMTA 3UINB 1D3ZA 4A55A 1TJEA 2JX5A 3QC8B 5MPOA 3ZJVA 1C4CA 4ANXA 2FUHB 3T3NA 4QAYA 3ZW3A 3KW5B 2KC1A 3EFUA 1F52A 2K0PA 2K6DB 3RCZA 5FR3A 3KH0A 1T0QC 5GXGB 1GC7A 3WA0A 1EU4A 2KC2A 2BVCA 1VZ6A 5C2TB 2D3AA 3ZUNA 3W1SC 1ZW7A 1FXAA 2HJ1A 3EECA 2LHDA 4HPLB 2EMSA 4RFBA 3UIOB 5DPWA 1AARA 2KD0A 2WXQA 4AP4C 4FHJA 3A1QB 2KOXA 4DXFA 2PW9A 2C60A 4DHZE 3VH3B 3IT6B 2INNE 2MBEA 4RF1A 5HG2A 4C56C 1F77A 1OGWA 2K8HA 4OZCA 3ZGZA 5CHFA 1V49A 1WZ3A 1WZ0A 2KMCA 3Q3JA 2KHWB 3DWMA 4GSWA 1R4MB 1PYWD 4NJ7A 2CU3A 4HKZE 4JX1C 3V62A 4MGYE 4JIOU 3B08A 4GOCA 3Q3OC 2D5GA 2BS3B 4E71A 4CYEA 4ARCA 1P7FA 1FFUA 3N1XC 2KAJA 1WSPA 2B76B 2YEPB 3ZDMC 4W9KA 2C7HA 2L52A 2IYDB 2BYTA 4ANUA 1AWDA 2V4IB 1PFDA 2KWVB 1N63A 2VZKD 5JXVA 1Q10A 4RF0A 2V3NA 1HZ5A 2RDHA 3CF6E 1IBXA 1C1YB 5AZHA 3R3MA 4PT5A 1E7PB 3R2TA 4RGMA 3URYA 2GI9A 3MJWA 2LEKA 2R61A 2RGFA 2AQ1B 1YX6B 1QQRA 5E6JA 4LJOB 2BTEA 4JWUC 2IDYA 1XD3B 2KLCA 3TEZA 4K7WA 3AMZA 3IVFA 1FIQA 1WXMA 1WY8A 4K3BA 4KKIA 1ZXHA 4GDLB 5TR5A 3HM6X 1QT9A 2JXTA 4TMAB 3V05A 4MSMB 2N4FA 4B6WA 1FM0D 3E56A 1I7HA 1JW9D 3L10B 2GBJA 4RM9A 1ET6A 1VD2A 1QF6A 1JRPA 3R8BA 1DOXA 2O2VB 2BW2A 3L0WB 1KLGD 2NMQA 1GC6A 1L0YB 3VUXA 2G3QB 4MJSA 2WYQA 4MDKE 4HWIB 4YSYB 2MCNB 3FILA 3J9CA 3AM9A 2KTRA 1I4XA 3BVGA 1FD6A 2W9NA 2LHEA 1XXGA 3D32A 3HUIA 2LZ6A 1T0RC 1WM3A 2WDTB 4HCPB 3PREA 1WXQA 1SB3C 4ZOHC 4CO7A 4OW0A 1WX8A 5IO9A 4E3CA 1LO5D 1WYWB 4WJNA 5IP4D 3B9JA 4GDLA 1JWSD 4MH0E 2LGXA 4NQKE 1R4MI 4RH6A 5H8YE 3A9KB 4D2KA 4W9FA 4RMAA 3KYDD 3AI5A 2JU6X 3DBLI 3GS2A 4BKGA 1J7BA 3WAOA 2K6QA 4MEMA 2KJ6A 4XGAB 3R7RA 2MQJA 1HA5A 2BKRB 3ZNHB 5AUKA 2RPQA 2DENB 2QMTA 4HVBA 1DYQA 4LCDE 3PGEA 3DPDA 5C23A 1V8CA 1WXAA 2KDIA 1OFFA 2KO3A 2FAZA 2EELA 2G45B 4IW0A 3NZUA 3NVWA 1ZPSA 3AE8B 4TV3A 5EE1A 3BYTB 4GU2A 5KHQA 4OVVA 5AZFA 4JE3B 3DCGA 2L0FA 2LVPA 4W9IA 3HHMA 3AU4A 2IY0B 1YQ4B 2FCQA 2L76A 2KVRA 3W5VB 4K1RB 4GDKB 1EF1A 1R7SA 3IAS1 3X23A 3PLVA 2J7QB 2DZJA 1RAXA 2JPHA 1K8RB 1X1MA 1E90A 4KIKA 2JT4B 4OZBA 2A5UA 4REZA 4YTNB 5BYSA 1GAQB 1D5MC 2X8XX 2IJ0A 3A1QA 4HROA 4YL8A 2WDVB 3H1UA 1JMLA 3R2IA 1V80A 1IGDA 5T8IA 4JWSC 5J17A 4WURA 2TSSA 2GBNA 3DVGY 1GUAB 4LNFA 2L7RA 3P63A 2KX0A 2H89B 2UYZB 4R3DA 2NTSA 3RI7C 1JWAD 1UF0A 2PJHA 1F1HA 2KDMA 2NS5A 1SJED 4KIKB 3ZQ4A 4JQWC 2YLMA 3ONSA 3ZJTA 2JZZA 3KUDB 4WAFA 3PO0A 4A90A 2K1FA 3T8MA 2O6VD 1WF9A 4JPSA 3VRAB 2XN9C 3VR9B 1SXTA 2HTHA 2N7JA 3AECB 2J53A 1T0YA 5CX3A 4MACA 3HK0A 2ZPYA 3N1YC 3FC4A 5E6NA 1FXTB 3QK0A 2ZVOA 3WANA 2LGYA 1CK1A 1WX9A 3QARA 1QOAA 4ZRIA 5BO4B 2GMIC 2GOWA 4GLSC 3AE7B 4W9HA 2WXHA 3Q2AC 1NI2A 3PV1A 4LJPB 1LFDA 1R4NB 3L17A 3I9V1 1XLNA 2KK8A 2KQ7A 2NBWB 2GLSA 1SE9A 2HDEA 4Q2JA 3NOBA 1UD7A 2MW5A 1LQBA 3OLMD 3BZDB 2WU5B 1BT0A 3VH4B 3AULA 2KX3A 1Y56A 2DZKA 3A4SC 1XCTL 2W3SA 2KDFB 4IC7B 3RNGC 2HE7A 3V6EB 4GN1A 2DZIA 3N9YC 4GIVA 2BS2B 3JW0X 1L5PA 1HQRD 3IT4B 3ZRCA 3VTUA 2BYEA 5IA7A 2JVCA 2WNMA 2D10A 2LXCA 2RD0A 3RPFC 2C9WB 1F0ZA 1GB4A 4MGIE 3Q3NC 2OJRA 2KTFA 2IZVB 1K51A 2IGDA 2MWSB 2LUMA 3PRPB 5LXHA 2LGSA 4K7UA 2L05A 2O6VB 2ZW0A 2ZNVC 3OJ3A 3K9OB 4G0NB 5BMIA 2JZ3B 1NYQA 2BYVE 4HEA1 4JL9A 2KYWA 3Q8FA 2K8CA 4BKSD 2J42A 2OOBB 2MP2B 1BUIC 3A4RA 4TQ1A 5D7GA 2ACZB 1CZPA 2G4DB 1AW7A 2VZKB 3TSSA 5LNK1 1TS4A 3BK2A 4M00A 3ZNID 3P2BA 1NI3A 2AL6A 5EDSA 1J0GA 3DHIC 3IAM1 3RT3B 1GB1A 2KANA 2HJ8A 1V1PA 2K5PA 3UF8A 5EE3A 1PDXA 2M4NA 3BYYB 1CJEA 1TS5A 1STEA 3S2AA 5FR6A 4IUMB 4LK0M 1ZOYB 2KWDA 4AUQC 3PRMB 1KTKA 3PRZA 3UIPB 1N6ZA 3AEEB 1IBXB 2LD9A 1KF6B 4GDKA 3Q6BA 1HE8A 2I38A 2LI5A 2IY1B 2MJEA 1IUEA 4RGTA 3TBLD 1R4NI 2XNAC 3RZFA 1C4PA 4DHJD 5CHWA 2GBMA 2K22A 4K81A 3PTFC 1UH6A 4NQLB 2FNJB 2Z0EB 3RZWC 3VTWA 1MJDA 2MLBA 4IM0A 2AEHA 1UUPA 5D6JB 3BINA 2AQ2B 4GXBA 5AUIA 4TUUA 1M94A 1F9JA 2D3GA 3W5UB 2QC8A 2V0GA 4J6IA 4XYCA 1OQRA 4BKTA 4ZHPA 4NNJB 3AE1B 2INPE 2KTRB 1ROEA 2CHWA 2MP2A 3PHXB 1C78A 2RR9A 5BMHA 5C1ZA 1ET9A 3JVZX 2KWCA 2BB6A 3MC0B 4P16A 4M0WA 3RMKC 4X57B 5IOIA 3V61A 3VQIA 4IDIA 2PE6B 3OAWA 3Q3MC 4IOIE 3LB8C 4EZKA 3H8HA 2B3AA 3HRDD 3Q8BA 2I1KA 4XX5A 2ZVNA 5BMGA 3KUCB 1TS2A 4II3B 1NDDA 5G55A 2M8SA 4IWPA 3KUZA 1ZKHA 3QX1A 3ZJUA 1M4VA 1VRAB 1HZ6A 2NCNA 4ARIA 3NUHB 2M17A 3PVLA 1K53A 3ZNGC 2WXKA 1XO3A 4PS8A 4WAAA 1HEZE 1GOZA 1TZOA 1GJZA 1N62A 2D11A 2JXXA 1VCBA 1WJ6A 1U4AA 2NVUI 1EUVB 3RFZB 2Q5WD 2M19A 2WHIA 4NZLB 1S3SG 1V81A 1TBEA 2WGSA 2Y3AA 3A33B 3SDLC 1KH0A 4AOFA 3GP7A 1WYGA 1PGAA 3WAPA 4J3OD 3ZXVA 4HK2A 1BMLC 4KGTA 3LJ3A 2FIFA 3OG5A 2M0XA 2J4XA 1WE6A 1FCLA 3M63B 3IXSA 1FMAD 1V5TA 1E9MA 4XWWA 5GMVA 3AE9B 2WXFA 1K52A 4WWNA 3T3OA 4MH8A 2D2QA 1B1ZA 3VXWA 1TKGA 2ICIA 3KQ4A 1VR9A 3PSEB 4GMVA 3MTNB 3P1MA 2INDC 2CHZA 5JH5C 2YVCA 4ANVA 3UQAA 2RDBC 4HDOA 4S17A 4B95A 4M01A 3U2SC 4YSXB 5BYQA 3AE3B 1H8CA 1FRRA 2R2OA 4DWFA 2E3TA 1EWYC 2L32A 2FBWB 5JHBA 2ZCCA 2N9KA 3WAMA 3AXCA 4W9LA 4WWPA 1KLUD 2FIDA 3DBSA 3P4RB 1G6JA 3LYYA 3ML8A 3L4PA 4M8NA 4ZRQA 1JWMD 2BGFA 3GB1A 1TKEA 5L83A 1EO6A 4F8CB 1WGDA 2LMCA 3QAQA 3CSTA 4MELA 1P98A 3CSFA 1WRIA 3UQBA 1D6EC 1K50A 3KWVA 4L23A 3AEDB 3U30A 1RLFA 2I1JA 3PS6A 1H4RA 2K8BA 2WXOA 1YD8U 3L54A 4EKUA 2WXPA 3Q14C 3EA6A 1MG8A 4WJQA 3BY4B 4ZDVA 2JYEA 1E7VA 3V3XA 4FADA 2ZW1A 4MGZE 4US9A 4AWJA 4ITKA 2BF8B 2L3ZA 2REXA 3Q69A 1N60A 1BXTA 3DVGX 1ZE3D 3VUWA 3EFCA 3Q8EA 1LGRA 4LDTD 2Y5PA 4WH4A 5DPSA 5EE0A 4PK1A 3EC8A 2LGIA 3VVWB 3R66C 4C80A 5CTRC 4GGQA 1V86A 1LXDA 2N1WA 3GE8C 2MBHA 1WGRA 3M3JA 1L6VA 4BOZB 2MHJA 2LUEA 2XK5A 2JRIB 4TSSA 3NG0A 3DBRB 3TMPB 1SIFA 4EZJA 1LM8B 2N9PC 4NJ6A 4II2B 1WRDB 3HVZA 3Q8AA 1WFYA 2WDQB 1NEKB 1MHXA 1UBIA 3GZNB 2C5LC 2KMAA 4OVZA 3TEYA 1F2RI 4FA6A 3SFEB 2FCSA 4ZHOA 2NBUA 4A8XC 1KFYB 4MM3B 2Y5CA 2BWES 1V6EA 3NZ3A 4G11A 2UU7A 3UGBB 5D94A 4KDLB 2KMMA 1MHHE 4IKGA 5AEKB 2QIEB 2IPKD 1ZUD2 3B2GA 1NVID 1WE7A 2QCZA 3AEGB 1HTQA 5G2NA 2WQYB 4OHJA 3VR8B 1KM7A 4XC2A 1V2YA 3RULA 5JZEB 4A9AA 1L0XB 2N9LA 2BQQA 2JY6A 2BB5A 1B9RA 3AEBB 1L2NA 3DOWA 1C79A 1ZP0B 2ZCBA 1T6BX 4EFOA 1XF5L 1YQBA 1VDVA 4KZCA 1J7CA 4DXGA 2NBVB 3K9PB 3Q8CA 2FE8A 1CMXB 3KLSX 4NAWB 3N20C 1E10A 4WJOA 1E5WA 2IGHA 4RGNA 3DWGC 4ZYNA 3ZVVA 2WP9B 4PS7A 1J7AA 4TKNA 3APFA 3QWZB 4KSLC 1QZEA 2KFKA 1NYRA 2LJIA 1I4RA 2ZEQA 1E7UA 1VLBA 3L08A 2DZMA 5FK9C 2W82A 1JQ4A 1EU3A 1UNSA 2DBYA 1V1PB 1UGJA 3M95A 4W9EA 1YN4A 4YWGG 2HD5B 2WX0A 3OWEB 1JROA 1Z5SB 2IO2B 3U7DA 2JWUA 5JHAA 2ZNVB 3R7QA 4EEWA 2BBCA 2N9EB 4YTPB 1MFWA 2DYOA 2ON8A 4BFRA 4N6EB 2NR2A 2JWZA 3QJZA 4CQNA 2CKHB 4XE0A 1DGJA 1ZXIA 1OQYA 1PGBA 4JGHB 4HDQA 4YSZB 2Z8LA 2KVZA 1ISNA 3IBEA 1L7YA 1YN5A 3NZSA 3RYTA 2MX2A 3H7PB 2JRHA 5G5HA 1TGZB 2D3BA 5G5GA 2KACA 1C3TA 1NBFC 1VZ8A 3A9JA 2ZZPB 1PQSA 1ENFA 1ACCA 4USAA 2L1AA 1P7EA 3MC8A 1E8YA 3RD2A 2JQRB 1N61A 3WALA 2CHXA 4UDUC 4LNOA 2V9HA 3QIJA 4RM8A 4RGOS 3DBLB 3HVDA 4W9GA 4BVUC 3DDCB 3ECIA 2PE9A 5IKCM 3LXFA 1I35A 2DNFA 4GB9A 4MT5A 3IG3A 3PLUA 4K7SA 3VTVA 2PVOD 3NVZA 3AN1A 1J8CA 2MJDA 3WCQA 2KXJA 4BKSA 3ZKJC 3LDZE 3ZYYX 3SEBA 4WIPA 2WXIA 2BPSA 3WIMA 1OEYA 3AV8A 3PZ8A 3RNAC 1YX5B 2ASQA 1DOIA 2JZPA 2CS4A 3TJPA 2W3RA 5DPRA 3UI3A 2RDGA 1NENB 3P4QB 3FAHA 1SSNA 2N1VA 3CWIA 1XEEA 2BYFA 4WJPA 2C7MB 2K25A 4US8A 1WH3A 2D07B 1P0RA 1N5XA 3AE2B 2HTME 4A3OA 4EZLA 3BVZA 3NJTA 2MSED 3NY5A 1YMHE 2XEWA 1HTOA 1E8WA 2KN4A 1WXVA 3QCAA 2LXAA 2LVOA 3GZNI 2CJOA 2L00B 4MM3A 2V4LA 1I4QA 3AB5A 2H88B 2RPVA 3A9JB 4FLHA 2KLGA 1JALA 1SE4A 2QHOA 1EM7A 3ZIMA 3E9SA 3ZO5B 2Z0DB 4C4VB 4FHKA 3ALBA 4B9KA 4RCOA 3TL5A 4W9DA 1L4DB 3ABVB 2IGGA 1RFKA 3DBHI 3TEXA 1WJUA 4BOSC 2JUOA 3PZ7A 4NAWA 1SF0A 4XDCA 1C77A 3DHHC 3L16A 1RYJA 4DHJB 4KGSA 2LWPA 4I6LB 4PS3A 3VUYA 4G50A 4NY0A 4DK5A 2XBBC 2MH7A 4LNKA 2WXLA 1TY2A 2YEPF 3SD5A 3B1LX 2M56B 3V6CB 2BWFA 1MPEA 3DBRI 2N0SB 3PZDA 5J18A 4FN2A 3W1YA 1QKZA 4ASWC 1WWTA 1EF5A 2KDEB 1EWCA 4YXDB 2K39A 4BBNC 1QOFA 2BKFA 1GNUA 4XZ4A 4BAXA 3ZTCA 1A5RA 4F1SA 2ZJDA 4IWOA 3U7ZA 3CMMB 1FRDA 4KKJA 1IPGA 4PYUA 1JCKB 1AN8A 4MSQB 4L1BA 4C4VA 2RSUA 3APDA 1L6UA 3U52E 3A9KA 2KJHB 1WMHB 4ACFA 1Q0WB 2CR5A 1YJJA 1YOVB 2KFJA 1I4GA 4A20A 1ZDVA 5H92C 3DVNV 4OVUA 4M0WB 1VZ7A 2NPTB 5FKAC 1WR1A 5E6OA 1WI0A 4DXAB 2WWZA 1UGMA 1UZXB 5BYRA 5J2RA 4NPNA 3BVMA 2MRPA 2LRUA 1PGXA 1IYFA 2I2YA 4F7ZA 2ONQA 3B2FA 4AQ7A 2LJ5A 1XLOA 4C00A 3ZTDA 1UWMA 1OEYJ 1UBQA 1J19A 3NVYA 3MP9A 4ZRPA 2OJWA 2WS3B 4MJSB 1T0SC 1YJ1A 2DYBA 4A6QA 3RNCC 3MJ5A 1WM2A 4DQOC 3U4EG 2KNBA 1XCQL 1RFAA 4HJKA 3BWUD 1FCCC 4KX6B 2WXJA 2PEAA 2MA9B 2FUG1 2QILA 1FEHA 4WWOA 1OQQA 3C19A 1JWBD 5AZGA 3M62B 5IN7A 3GOEA 4LNNA 1WIAA 3H6NA 5L95C 1L0VB 3V60A 2J52A 5TSSA 1TKYA 2L83A 1E6EB 2M0AA 3X0WA 4KDIC 4G3XB 4N59A 2N9XA 3HM3A 1CQVA 3AU5A 1E0ZA 2OHFA 4M8MA 2LASA 2SEBD 4N9F4 1YJIA 2KT7A 4FULA 1SBBB 2BS4B 3H7PA 3SHQA 1ESFA 4NJCA 1C9FA 1YNTE 2BT6A 1TTNA 4ZYSA 1UWXA 2LVQA 2LRWA 3AH7A 4ANWA 3TEWA 2ZPNA 4DBGA 1GPXA 2O2VA 1SIJA 2Y5BB 4EUTA 2AX5A 2WU2B 3EUB2 3MFGA 2DHZA 1TT5B 2C7NB 1D5XC 2L0TA 3QQ8B 3IHPC 1SEBD 5LXIB 3ZXRA 1KLVA 3VFKA 3N1ZC 4XWTA 4LLGM 2QJLA 2UWQA 3DQVA 3I5JC 2MBBB 1QLBB 2PIAA 4C7ZA 1D5ZC 1AYFA 1T5XD 2V3SA 3I3TB 2CU1A 2G9HD 2CJNA 4WQOB 3VHTC 1RRBA 2PLPA 2EKEC 3ETRA 2IO0B 3PT2B 2WXNA 2PTLA 1P9DU 3O13A 4WQMA 3APCA 1F2RC 2L8JA 1E8ZA 2MBQA 3W1SA 1YN3A 3P4SB 1C76A 4IM3A 2GBKA 4HPMB 1Q1OA 2IO3B 3N3KB 2MEKA 4BZAA 4ZRJA 3T9LA 3SU8X 2VRRB 4FJYA 1C4AA 2G1EA 2Z59B 3FILB 1SE2A 3VAWA 4IWQA 2GRIA 2PVGC 1YQ3B 4KZ0A 1FO4A 3U8ZA 4FXCA 2QEJC 1WJNA 2J0KA 1V97A 1WR6E 1V9JA 2GB1A 1V5OA 3SFDB 4KSKC 1VJKA 2VH1A 4DDID 3ENEA 2N7EA 3ZNZB 3ZDTA 2JSVX 3KWLA 3P4PB 5D3IB 3CIRB 4B0EA 5KHOA 2JYTA 3W9CB 1XQQA 3N30A 3QHTA 5HKHA 3BK1A 3NS1A 4XDDA 2KWUB 3VRBB 4OZAA 1WMHA 3I57A 2AWTA 3KVFB 3MC9A 3NRZA 1XT9B 1KOTA 2K3UA 3H9DA 4ICUA 2FCNA 2N7DA 3TCAA 4AJWA 3RNFC 4LTUA 4W9CA 3NHEB 1MG4A 4BBNF 3RNEC 3VDZA 3RN9C 2J0MA 1FNWA 2RMMA 5EE9A 1KJTA 2LGDA 2WLBA 3W2DA 4HLEA 4FJZA 1P3QU 2J0JA 4HXDA 4DDGD 2DLBA 2R2QA 2DYMA 1T3QA 1FNVA 1SE3A 3AEAB 1Y8RC 2DAFA 3HIZA 4KGRA 3NS8A 5I4DA 1WGYA 1GG3A 2MJ3A 3MHZA 4EOYA 2INCC 2PMVA 3AE4B 2LFIA 2GBRA 2E6XA 1IP9A 2K9XA 4KVGB 1QILA 1YIWA 4MGKE 2O6VA 3EHVA 3NVVA 3TUOA 3DVNU 2WXMA 2OEDA 2PKOA 3JYUA 5HI1A 2VH2A 1FXIA 4W9JA 2NTTA 1FNUA 4N58A 2SAKA 4P1CC 1TY0A 3H7SA 4P6VF 2FCMA 2AL3A 2KFKB 3AEFB 2G4SA 3L13A 5D3DA 2KDBA 3PPAA 1D4BA 1MI0A 4FBJB 3ZLZA 3RNBC 3KYCD 1RWSA 2IO1B 3B0AA 1WGHA 3Q3FA 1SJHD 3OJ4B 4S0RA 1XLQA 2W54A 1JWUD 1MVKA 5HFYA 4B0MA 2KKCA 5D2MB 3I63C 2KZRA 3TIXA 1SGHA 1HXYD 1ZGUB 1I4HA 4HRSA 3SR6A 1TIFA 2IBIB 4EE2A 2AQ3B 3MHSD 4HCNB 4AS1A 2M1MA 4LNIA 3QA8A 3RUIB 2QSDA 2D3CA 3DHGC 1RM6C 2KN5A 4YT0B 5HHDG 3JSVB 4AJYB 5E6PA 4CHKA 2JF5A 1XLPA 2WDRB 3GE3C 1P1AA 2NPTA 3FKYA 1QOGA 4M02A 4DHZB 1V1OA 2A4ZA 4KV2A 3IFWB 4IG7B 4HKQA 4P1BC 4LDTB 2WXRA 4I6PA 1N5WA 3JSVA 4WWMA 5DCNA 4FJVB 4TQ0A 3C0RB 3ZRFA 1WX7A 1S1QB 1PUTA 1WGKA 4HJGE 1FFVA 1WJ4A 4IM2A 1I4PA 4ZRKA 2WXGA 1QOBA 1DOYA 2WX1A 4A3PA 1TZ1A 4URKA 4NAMA 2X38A 1UELA 1WXSA 5LLIA 1Q5WB 2DX5B 2EKIA 2W55A 4H2AA 3BIID 1Z2MA 3EGRA 1KRHA 2V1YA 1OTRB 3C8YA 1L4ZB 4YTMB 4RNAA 4O1NA 4C7YA 1ZDXA 1A70A 1JRUA 1IGCA 3P42A 5DPTA 4P7IA 3PHWB 4K3CA
chains in the Genus database with same CATH topology
1LQBA 4NJ6A 2PPHA 3OLMD 1UBQA 1J19A 2KJRA 2AYOB 1BT0A 3VH4B 4II2B 1WRDB 5CHVC 1WFYA 3AULA 4E74A 2KX3A 1UBIA 1WGGA 2DZKA 4MJSB 2C5LC 2KMAA 3A4SC 1YJ1A 2XK5B 2KDFB 4IC7B 2KQSA 2DYBA 4FA6A 4JLCA 4PYZA 2HE7A 2FCSA 3O65B 1E8XA 3V6EB 3N32A 1WM2A 4GN1A 2MBOA 3ML9A 4ICVA 5IAAC 2DZIA 2NBUA 4GIVA 4I6NB 2DAJA 2KNBA 3JW0X 1RFAA 4HJKA 3VTUA 3ZRCA 2BYEA 5IA7A 2JVCA 2BWES 1V6EA 2EMTA 2PEAA 2MA9B 1I42A 4G11A 3UINB 4WWOA 1D3ZA 2D10A 2LXCA 3QC8B 2RD0A 2C9WB 4MGIE 3UGBB 5AZGA 3M62B 5D94A 4KDLB 4ANXA 2FUHB 2OJRA 2KTFA 2IZVB 3GOEA 3ZW3A 2MWSB 3KW5B 3PRPB 1WIAA 2KC1A 3EFUA 5AEKB 4K7UA 5LXHA 3H6NA 5L95C 2L05A 2K6DB 3RCZA 3KH0A 3V60A 1GC7A 2O6VB 3WA0A 1WE7A 2ZNVC 3OJ3A 3X0WA 4KDIC 3K9OB 4G0NB 5G2NA 4G3XB 2JZ3B 2KC2A 2BYVE 1KM7A 4XC2A 1V2YA 4JL9A 3RULA 3ZUNA 2N9XA 5JZEB 3HM3A 2K8CA 3W1SC 1ZW7A 3AU5A 4BKSD 2OOBB 3EECA 4HPLB 2JY6A 2EMSA 2MP2B 4M8MA 3UIOB 5DPWA 3A4RA 1AARA 1L2NA 3DOWA 4TQ1A 2ZCBA 2LASA 4EFOA 5D7GA 2KD0A 1YQBA 4N9F4 2G4DB 4KZCA 4AP4C 4FHJA 4FULA 3A1QB 2KOXA 3ZNID 3H7PA 3P2BA 3SHQA 2NBVB 3K9PB 2AL6A 5EDSA 1J0GA 2C60A 1CMXB 4DHZE 4NAWB 3VH3B 3RT3B 2KANA 4WJOA 1E5WA 2MBEA 1TTNA 2HJ8A 1OGWA 2K8HA 2LVQA 2LRWA 3UF8A 4ZYNA 4ANWA 2M4NA 3ZVVA 5CHFA 1V49A 4PS7A 2ZPNA 1WZ3A 3APFA 1WZ0A 2O2VA 4TKNA 2Y5BB 2KMCA 3Q3JA 4DBGA 3QWZB 4KSLC 4EUTA 1QZEA 2KHWB 4GSWA 2KFKA 2DHZA 2C7NB 3S2AA 5FR6A 4IUMB 4NJ7A 2L0TA 3V62A 2ZEQA 3QQ8B 4AUQC 1E7UA 3PRMB 3IHPC 3L08A 4MGYE 2DZMA 5LXIB 4JIOU 3B08A 4GOCA 4E71A 4CYEA 3PRZA 3VFKA 1KLVA 3UIPB 2LD9A 2UWQA 3DQVA 3M95A 4GDKA 4W9EA 3ZDMC 1HE8A 2MBBB 4W9KA 2HD5B 2C7HA 2LI5A 2WX0A 2IYDB 2IY1B 4ANUA 1Z5SB 2IO2B 2V3SA 3I3TB 3U7DA 2CU1A 3TBLD 5JHAA 2ZNVB 1R4NI 3R7QA 4EEWA 2N9EB 2KWVB 4WQOB 3RZFA 3VHTC 2DYOA 5CHWA 2GBMA 1RRBA 4DHJD 2EKEC 4K81A 3PTFC 4BFRA 2NR2A 1UH6A 2JWZA 3CF6E 3QJZA 4NQLB 2FNJB 1C1YB 5AZHA 2Z0EB 3R3MA 3RZWC 3VTWA 2IO0B 3PT2B 2MLBA 3MJWA 4IM0A 2AEHA 2CKHB 2RGFA 1P9DU 5D6JB 1YX6B 1OQYA 3BINA 4JGHB 3APCA 4LJOB 4HDQA 4GXBA 1ISNA 1XD3B 2KLCA 2L8JA 4TUUA 1M94A 1F9JA 1E8ZA 2MBQA 3IBEA 4K7WA 3W1SA 2D3GA 3IVFA 4IM3A 1WXMA 1L7YA 2GBKA 1WY8A 4HPMB 4GDLB 1Q1OA 2IO3B 4J6IA 3N3KB 3NZSA 5TR5A 3RYTA 3HM6X 4ZRJA 3T9LA 2MX2A 3H7PB 2JRHA 1TGZB 3SU8X 2VRRB 4FJYA 4BKTA 4MSMB 2N4FA 2Z59B 4B6WA 1C3TA 1NBFC 4NNJB 3A9JA 3VAWA 2ZZPB 1PQSA 4IWQA 2KTRB 3L10B 2GBJA 2CHWA 4KZ0A 2MP2A 4RM9A 1VD2A 3U8ZA 3PHXB 2RR9A 5C1ZA 1E8YA 3JVZX 1WJNA 2J0KA 3RD2A 2KWCA 1WR6E 1V9JA 2CHXA 2O2VB 3WALA 3L0WB 3QIJA 1GC6A 1V5OA 3VUXA 4RM8A 2G3QB 4MJSA 4X57B 4W9GA 3V61A 3VQIA 4BVUC 2WYQA 2PE6B 3DDCB 4KSKC 4MDKE 3OAWA 4HWIB 3ECIA 2PE9A 2MCNB 4DDID 3ENEA 1I35A 2KTRA 4GB9A 4EZKA 2N7EA 3IG3A 3ZDTA 3ZNZB 3PLUA 2B3AA 4K7SA 3VTVA 2W9NA 5KHOA 2I1KA 1XQQA 3N30A 4XX5A 2ZVNA 3QHTA 3KUCB 5HKHA 4II3B 1J8CA 1NDDA 3D32A 5G55A 2LZ6A 2M8SA 4IWPA 2KWUB 1WM3A 2WDTB 3KUZA 4HCPB 1ZKHA 1WMHA 2KXJA 4BKSA 3QX1A 3ZKJC 2AWTA 3LDZE 3PREA 3KVFB 1XT9B 2BPSA 1KOTA 3WIMA 1OEYA 3H9DA 4ICUA 4CO7A 1WX8A 2FCNA 2N7DA 3TCAA 4AJWA 2NCNA 4E3CA 4W9CA 1YX5B 3NHEB 4BBNF 2ASQA 3VDZA 2M17A 1WYWB 2CS4A 4WJNA 3TJPA 2J0MA 3PVLA 5DPRA 3ZNGC 4PS8A 4GDLA 1KJTA 2LGDA 4WAAA 4MH0E 1GJZA 2D11A 2LGXA 4NQKE 1R4MI 4HLEA 2JXXA 1VCBA 1WJ6A 4FJZA 1U4AA 3A9KB 1P3QU 2NVUI 4W9FA 1EUVB 2J0JA 2N1VA 4RMAA 2BYFA 4WJPA 2C7MB 2K25A 1WH3A 3KYDD 2D07B 4HXDA 4DDGD 1S3SG 1V81A 1TBEA 3AI5A 2R2QA 2DYMA 3DBLI 3A33B 1Y8RC 1P0RA 3SDLC 4AOFA 2DAFA 3HIZA 4BKGA 3WAPA 3WAOA 3PHWB 3NS8A 4HK2A 4A3OA 4EZLA 1WGYA 2K6QA 1GG3A 4MEMA 2KJ6A 4EOYA 3LJ3A 2MSED 3R7RA 3NY5A 2MQJA 2FIFA 2BKRB 3ZNHB 2M0XA 2XEWA 2RPQA 1E8WA 2DENB 1WE6A 4HVBA 3M63B 4LCDE 3PGEA 2GBRA 3DPDA 1WXVA 1IP9A 5C23A 3QCAA 1V5TA 1WXAA 2KDIA 2LXAA 4KVGB 2KO3A 2LVOA 1YIWA 2FAZA 2L00B 3GZNI 4MM3A 5GMVA 2G45B 4IW0A 2V4LA 3NZUA 4MGKE 4WWNA 2O6VA 2D2QA 4TV3A 3EHVA 3VXWA 3DVNU 4GU2A 5KHQA 3JYUA 3PSEB 4GMVA 3MTNB 4OVVA 5AZFA 3A9JB 4FLHA 2CHZA 4W9JA 2KLGA 3DCGA 2L0FA 2LVPA 2YVCA 4W9IA 5JH5C 2QHOA 3HHMA 4ANVA 3UQAA 3ZIMA 3AU4A 2IY0B 3H7SA 4HDOA 3ZO5B 2Z0DB 2FCQA 2FCMA 2L76A 2AL3A 2KFKB 2KVRA 2G4SA 3L13A 2KDBA 3PPAA 4FHKA 3ALBA 4B9KA 4B95A 4FBJB 3ZLZA 4K1RB 4GDKB 3TL5A 1EF1A 3X23A 3KYCD 4W9DA 3PLVA 2IO1B 2J7QB 3B0AA 1WGHA 1H8CA 2R2OA 2DZJA 3Q3FA 4DWFA 3OJ4B 3DBHI 1WJUA 1RAXA 4BOSC 2JPHA 1K8RB 2JUOA 1X1MA 2KKCA 4NAWA 1E90A 4KIKA 5D2MB 2JT4B 5JHBA 2KZRA 2A5UA 2ZCCA 1SGHA 3L16A 3TIXA 3WAMA 1ZGUB 3AXCA 4W9LA 4DHJB 4WWPA 2IBIB 2LWPA 3A1QA 4I6LB 4YL8A 4PS3A 3VUYA 2FIDA 3H1UA 3MHSD 4G50A 2M1MA 3DBSA 4HCNB 1V80A 3QA8A 4NY0A 3RUIB 4DK5A 2XBBC 1G6JA 5J17A 3ML8A 4M8NA 2GBNA 3SD5A 3B1LX 3DVGY 2KN5A 1GUAB 2BGFA 3JSVB 3V6CB 2L7RA 2BWFA 4AJYB 3DBRI 5E6PA 2JF5A 1EO6A 4CHKA 1WGDA 3PZDA 4F8CB 5L83A 3QAQA 3CSTA 2KX0A 2UYZB 1P1AA 5J18A 4MELA 4FN2A 3W1YA 1P98A 2NPTA 3CSFA 2PJHA 4DHZB 4ASWC 3UQBA 1EF5A 2A4ZA 2KDEB 4KV2A 3IFWB 2K39A 4IG7B 2BKFA 4BBNC 4LDTB 2NS5A 1GNUA 4I6PA 4KIKB 3U30A 4XZ4A 1RLFA 3ZTCA 2I1JA 3PS6A 3JSVA 1H4RA 1A5RA 4JQWC 2K8BA 2YLMA 2ZJDA 3ONSA 4IWOA 5DCNA 4F1SA 1YD8U 3CMMB 3L54A 4EKUA 4FJVB 2JZZA 4TQ0A 1IPGA 3C0RB 3KUDB 1WX7A 3ZRFA 1MG8A 1S1QB 4PYUA 4WJQA 2K1FA 3T8MA 2O6VD 3BY4B 1WF9A 4ZDVA 1WJ4A 1E7VA 4MSQB 4FADA 2RSUA 4IM2A 3APDA 4ZRKA 4MGZE 2HTHA 3A9KA 4AWJA 1T0YA 2KJHB 1WMHB 5CX3A 2WX1A 2BF8B 2L3ZA 2ZPYA 3HK0A 1Q0WB 4A3PA 1TZ1A 4URKA 2CR5A 2KFJA 2REXA 4A20A 3DVGX 1UELA 5E6NA 3VUWA 1FXTB 1WXSA 3QK0A 2ZVOA 3DVNV 3WANA 4LDTD 5DPSA 2LGYA 4OVUA 5LLIA 4M0WB 1WX9A 2NPTB 1WR1A 5E6OA 1Q5WB 2DX5B 3QARA 1WI0A 3EC8A 4DXAB 2WWZA 1UGMA 3VVWB 3R66C 4ZRIA 1UZXB 5J2RA 1Z2MA 4NPNA 5BO4B 5CTRC 2GMIC 2V1YA 2MRPA 2GOWA 4GGQA 1V86A 2LRUA 1LXDA 4W9HA 1IYFA 2N1WA 1OTRB 1NI2A 2MBHA 4F7ZA 3PV1A 4LJPB 1LFDA 1WGRA 2LJ5A 3L17A 3M3JA 4BOZB 2KK8A 2LUEA 2XK5A 1JRUA 2KQ7A 2JRIB 2NBWB 1SE9A 3NOBA 3TMPB 3ZTDA 5DPTA 1UD7A 2MW5A 1SIFA 4P7IA 4EZJA 1LM8B 2N9PC 1OEYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQB A;  4NJ6 A;  2PPH A;  3OLM D;  1UBQ A;  1J19 A;  2KJR A;  2AYO B;  1BT0 A;  3VH4 B;  4II2 B;  1WRD B;  5CHV C;  1WFY A;  3AUL A;  4E74 A;  2KX3 A;  1UBI A;  1WGG A;  2DZK A;  4MJS B;  2C5L C;  2KMA A;  3A4S C;  1YJ1 A;  2XK5 B;  2KDF B;  4IC7 B;  2KQS A;  2DYB A;  4FA6 A;  4JLC A;  4PYZ A;  2HE7 A;  2FCS A;  3O65 B;  1E8X A;  3V6E B;  3N32 A;  1WM2 A;  4GN1 A;  2MBO A;  3ML9 A;  4ICV A;  5IAA C;  2DZI A;  2NBU A;  4GIV A;  4I6N B;  2DAJ A;  2KNB A;  3JW0 X;  1RFA A;  4HJK A;  3VTU A;  3ZRC A;  2BYE A;  5IA7 A;  2JVC A;  2BWE S;  1V6E A;  2EMT A;  2PEA A;  2MA9 B;  1I42 A;  4G11 A;  3UIN B;  4WWO A;  1D3Z A;  2D10 A;  2LXC A;  3QC8 B;  2RD0 A;  2C9W B;  4MGI E;  3UGB B;  5AZG A;  3M62 B;  5D94 A;  4KDL B;  4ANX A;  2FUH B;  2OJR A;  2KTF A;  2IZV B;  3GOE A;  3ZW3 A;  2MWS B;  3KW5 B;  3PRP B;  1WIA A;  2KC1 A;  3EFU A;  5AEK B;  4K7U A;  5LXH A;  3H6N A;  5L95 C;  2L05 A;  2K6D B;  3RCZ A;  3KH0 A;  3V60 A;  1GC7 A;  2O6V B;  3WA0 A;  1WE7 A;  2ZNV C;  3OJ3 A;  3X0W A;  4KDI C;  3K9O B;  4G0N B;  5G2N A;  4G3X B;  2JZ3 B;  2KC2 A;  2BYV E;  1KM7 A;  4XC2 A;  1V2Y A;  4JL9 A;  3RUL A;  3ZUN A;  2N9X A;  5JZE B;  3HM3 A;  2K8C A;  3W1S C;  1ZW7 A;  3AU5 A;  4BKS D;  2OOB B;  3EEC A;  4HPL B;  2JY6 A;  2EMS A;  2MP2 B;  4M8M A;  3UIO B;  5DPW A;  3A4R A;  1AAR A;  1L2N A;  3DOW A;  4TQ1 A;  2ZCB A;  2LAS A;  4EFO A;  5D7G A;  2KD0 A;  1YQB A;  4N9F 4;  2G4D B;  4KZC A;  4AP4 C;  4FHJ A;  4FUL A;  3A1Q B;  2KOX A;  3ZNI D;  3H7P A;  3P2B A;  3SHQ A;  2NBV B;  3K9P B;  2AL6 A;  5EDS A;  1J0G A;  2C60 A;  1CMX B;  4DHZ E;  4NAW B;  3VH3 B;  3RT3 B;  2KAN A;  4WJO A;  1E5W A;  2MBE A;  1TTN A;  2HJ8 A;  1OGW A;  2K8H A;  2LVQ A;  2LRW A;  3UF8 A;  4ZYN A;  4ANW A;  2M4N A;  3ZVV A;  5CHF A;  1V49 A;  4PS7 A;  2ZPN A;  1WZ3 A;  3APF A;  1WZ0 A;  2O2V A;  4TKN A;  2Y5B B;  2KMC A;  3Q3J A;  4DBG A;  3QWZ B;  4KSL C;  4EUT A;  1QZE A;  2KHW B;  4GSW A;  2KFK A;  2DHZ A;  2C7N B;  3S2A A;  5FR6 A;  4IUM B;  4NJ7 A;  2L0T A;  3V62 A;  2ZEQ A;  3QQ8 B;  4AUQ C;  1E7U A;  3PRM B;  3IHP C;  3L08 A;  4MGY E;  2DZM A;  5LXI B;  4JIO U;  3B08 A;  4GOC A;  4E71 A;  4CYE A;  3PRZ A;  3VFK A;  1KLV A;  3UIP B;  2LD9 A;  2UWQ A;  3DQV A;  3M95 A;  4GDK A;  4W9E A;  3ZDM C;  1HE8 A;  2MBB B;  4W9K A;  2HD5 B;  2C7H A;  2LI5 A;  2WX0 A;  2IYD B;  2IY1 B;  4ANU A;  1Z5S B;  2IO2 B;  2V3S A;  3I3T B;  3U7D A;  2CU1 A;  3TBL D;  5JHA A;  2ZNV B;  1R4N I;  3R7Q A;  4EEW A;  2N9E B;  2KWV B;  4WQO B;  3RZF A;  3VHT C;  2DYO A;  5CHW A;  2GBM A;  1RRB A;  4DHJ D;  2EKE C;  4K81 A;  3PTF C;  4BFR A;  2NR2 A;  1UH6 A;  2JWZ A;  3CF6 E;  3QJZ A;  4NQL B;  2FNJ B;  1C1Y B;  5AZH A;  2Z0E B;  3R3M A;  3RZW C;  3VTW A;  2IO0 B;  3PT2 B;  2MLB A;  3MJW A;  4IM0 A;  2AEH A;  2CKH B;  2RGF A;  1P9D U;  5D6J B;  1YX6 B;  1OQY A;  3BIN A;  4JGH B;  3APC A;  4LJO B;  4HDQ A;  4GXB A;  1ISN A;  1XD3 B;  2KLC A;  2L8J A;  4TUU A;  1M94 A;  1F9J A;  1E8Z A;  2MBQ A;  3IBE A;  4K7W A;  3W1S A;  2D3G A;  3IVF A;  4IM3 A;  1WXM A;  1L7Y A;  2GBK A;  1WY8 A;  4HPM B;  4GDL B;  1Q1O A;  2IO3 B;  4J6I A;  3N3K B;  3NZS A;  5TR5 A;  3RYT A;  3HM6 X;  4ZRJ A;  3T9L A;  2MX2 A;  3H7P B;  2JRH A;  1TGZ B;  3SU8 X;  2VRR B;  4FJY A;  4BKT A;  4MSM B;  2N4F A;  2Z59 B;  4B6W A;  1C3T A;  1NBF C;  4NNJ B;  3A9J A;  3VAW A;  2ZZP B;  1PQS A;  4IWQ A;  2KTR B;  3L10 B;  2GBJ A;  2CHW A;  4KZ0 A;  2MP2 A;  4RM9 A;  1VD2 A;  3U8Z A;  3PHX B;  2RR9 A;  5C1Z A;  1E8Y A;  3JVZ X;  1WJN A;  2J0K A;  3RD2 A;  2KWC A;  1WR6 E;  1V9J A;  2CHX A;  2O2V B;  3WAL A;  3L0W B;  3QIJ A;  1GC6 A;  1V5O A;  3VUX A;  4RM8 A;  2G3Q B;  4MJS A;  4X57 B;  4W9G A;  3V61 A;  3VQI A;  4BVU C;  2WYQ A;  2PE6 B;  3DDC B;  4KSK C;  4MDK E;  3OAW A;  4HWI B;  3ECI A;  2PE9 A;  2MCN B;  4DDI D;  3ENE A;  1I35 A;  2KTR A;  4GB9 A;  4EZK A;  2N7E A;  3IG3 A;  3ZDT A;  3ZNZ B;  3PLU A;  2B3A A;  4K7S A;  3VTV A;  2W9N A;  5KHO A;  2I1K A;  1XQQ A;  3N30 A;  4XX5 A;  2ZVN A;  3QHT A;  3KUC B;  5HKH A;  4II3 B;  1J8C A;  1NDD A;  3D32 A;  5G55 A;  2LZ6 A;  2M8S A;  4IWP A;  2KWU B;  1WM3 A;  2WDT B;  3KUZ A;  4HCP B;  1ZKH A;  1WMH A;  2KXJ A;  4BKS A;  3QX1 A;  3ZKJ C;  2AWT A;  3LDZ E;  3PRE A;  3KVF B;  1XT9 B;  2BPS A;  1KOT A;  3WIM A;  1OEY A;  3H9D A;  4ICU A;  4CO7 A;  1WX8 A;  2FCN A;  2N7D A;  3TCA A;  4AJW A;  2NCN A;  4E3C A;  4W9C A;  1YX5 B;  3NHE B;  4BBN F;  2ASQ A;  3VDZ A;  2M17 A;  1WYW B;  2CS4 A;  4WJN A;  3TJP A;  2J0M A;  3PVL A;  5DPR A;  3ZNG C;  4PS8 A;  4GDL A;  1KJT A;  2LGD A;  4WAA A;  4MH0 E;  1GJZ A;  2D11 A;  2LGX A;  4NQK E;  1R4M I;  4HLE A;  2JXX A;  1VCB A;  1WJ6 A;  4FJZ A;  1U4A A;  3A9K B;  1P3Q U;  2NVU I;  4W9F A;  1EUV B;  2J0J A;  2N1V A;  4RMA A;  2BYF A;  4WJP A;  2C7M B;  2K25 A;  1WH3 A;  3KYD D;  2D07 B;  4HXD A;  4DDG D;  1S3S G;  1V81 A;  1TBE A;  3AI5 A;  2R2Q A;  2DYM A;  3DBL I;  3A33 B;  1Y8R C;  1P0R A;  3SDL C;  4AOF A;  2DAF A;  3HIZ A;  4BKG A;  3WAP A;  3WAO A;  3PHW B;  3NS8 A;  4HK2 A;  4A3O A;  4EZL A;  1WGY A;  2K6Q A;  1GG3 A;  4MEM A;  2KJ6 A;  4EOY A;  3LJ3 A;  2MSE D;  3R7R A;  3NY5 A;  2MQJ A;  2FIF A;  2BKR B;  3ZNH B;  2M0X A;  2XEW A;  2RPQ A;  1E8W A;  2DEN B;  1WE6 A;  4HVB A;  3M63 B;  4LCD E;  3PGE A;  2GBR A;  3DPD A;  1WXV A;  1IP9 A;  5C23 A;  3QCA A;  1V5T A;  1WXA A;  2KDI A;  2LXA A;  4KVG B;  2KO3 A;  2LVO A;  1YIW A;  2FAZ A;  2L00 B;  3GZN I;  4MM3 A;  5GMV A;  2G45 B;  4IW0 A;  2V4L A;  3NZU A;  4MGK E;  4WWN A;  2O6V A;  2D2Q A;  4TV3 A;  3EHV A;  3VXW A;  3DVN U;  4GU2 A;  5KHQ A;  3JYU A;  3PSE B;  4GMV A;  3MTN B;  4OVV A;  5AZF A;  3A9J B;  4FLH A;  2CHZ A;  4W9J A;  2KLG A;  3DCG A;  2L0F A;  2LVP A;  2YVC A;  4W9I A;  5JH5 C;  2QHO A;  3HHM A;  4ANV A;  3UQA A;  3ZIM A;  3AU4 A;  2IY0 B;  3H7S A;  4HDO A;  3ZO5 B;  2Z0D B;  2FCQ A;  2FCM A;  2L76 A;  2AL3 A;  2KFK B;  2KVR A;  2G4S A;  3L13 A;  2KDB A;  3PPA A;  4FHK A;  3ALB A;  4B9K A;  4B95 A;  4FBJ B;  3ZLZ A;  4K1R B;  4GDK B;  3TL5 A;  1EF1 A;  3X23 A;  3KYC D;  4W9D A;  3PLV A;  2IO1 B;  2J7Q B;  3B0A A;  1WGH A;  1H8C A;  2R2O A;  2DZJ A;  3Q3F A;  4DWF A;  3OJ4 B;  3DBH I;  1WJU A;  1RAX A;  4BOS C;  2JPH A;  1K8R B;  2JUO A;  1X1M A;  2KKC A;  4NAW A;  1E90 A;  4KIK A;  5D2M B;  2JT4 B;  5JHB A;  2KZR A;  2A5U A;  2ZCC A;  1SGH A;  3L16 A;  3TIX A;  3WAM A;  1ZGU B;  3AXC A;  4W9L A;  4DHJ B;  4WWP A;  2IBI B;  2LWP A;  3A1Q A;  4I6L B;  4YL8 A;  4PS3 A;  3VUY A;  2FID A;  3H1U A;  3MHS D;  4G50 A;  2M1M A;  3DBS A;  4HCN B;  1V80 A;  3QA8 A;  4NY0 A;  3RUI B;  4DK5 A;  2XBB C;  1G6J A;  5J17 A;  3ML8 A;  4M8N A;  2GBN A;  3SD5 A;  3B1L X;  3DVG Y;  2KN5 A;  1GUA B;  2BGF A;  3JSV B;  3V6C B;  2L7R A;  2BWF A;  4AJY B;  3DBR I;  5E6P A;  2JF5 A;  1EO6 A;  4CHK A;  1WGD A;  3PZD A;  4F8C B;  5L83 A;  3QAQ A;  3CST A;  2KX0 A;  2UYZ B;  1P1A A;  5J18 A;  4MEL A;  4FN2 A;  3W1Y A;  1P98 A;  2NPT A;  3CSF A;  2PJH A;  4DHZ B;  4ASW C;  3UQB A;  1EF5 A;  2A4Z A;  2KDE B;  4KV2 A;  3IFW B;  2K39 A;  4IG7 B;  2BKF A;  4BBN C;  4LDT B;  2NS5 A;  1GNU A;  4I6P A;  4KIK B;  3U30 A;  4XZ4 A;  1RLF A;  3ZTC A;  2I1J A;  3PS6 A;  3JSV A;  1H4R A;  1A5R A;  4JQW C;  2K8B A;  2YLM A;  2ZJD A;  3ONS A;  4IWO A;  5DCN A;  4F1S A;  1YD8 U;  3CMM B;  3L54 A;  4EKU A;  4FJV B;  2JZZ A;  4TQ0 A;  1IPG A;  3C0R B;  3KUD B;  1WX7 A;  3ZRF A;  1MG8 A;  1S1Q B;  4PYU A;  4WJQ A;  2K1F A;  3T8M A;  2O6V D;  3BY4 B;  1WF9 A;  4ZDV A;  1WJ4 A;  1E7V A;  4MSQ B;  4FAD A;  2RSU A;  4IM2 A;  3APD A;  4ZRK A;  4MGZ E;  2HTH A;  3A9K A;  4AWJ A;  1T0Y A;  2KJH B;  1WMH B;  5CX3 A;  2WX1 A;  2BF8 B;  2L3Z A;  2ZPY A;  3HK0 A;  1Q0W B;  4A3P A;  1TZ1 A;  4URK A;  2CR5 A;  2KFJ A;  2REX A;  4A20 A;  3DVG X;  1UEL A;  5E6N A;  3VUW A;  1FXT B;  1WXS A;  3QK0 A;  2ZVO A;  3DVN V;  3WAN A;  4LDT D;  5DPS A;  2LGY A;  4OVU A;  5LLI A;  4M0W B;  1WX9 A;  2NPT B;  1WR1 A;  5E6O A;  1Q5W B;  2DX5 B;  3QAR A;  1WI0 A;  3EC8 A;  4DXA B;  2WWZ A;  1UGM A;  3VVW B;  3R66 C;  4ZRI A;  1UZX B;  5J2R A;  1Z2M A;  4NPN A;  5BO4 B;  5CTR C;  2GMI C;  2V1Y A;  2MRP A;  2GOW A;  4GGQ A;  1V86 A;  2LRU A;  1LXD A;  4W9H A;  1IYF A;  2N1W A;  1OTR B;  1NI2 A;  2MBH A;  4F7Z A;  3PV1 A;  4LJP B;  1LFD A;  1WGR A;  2LJ5 A;  3L17 A;  3M3J A;  4BOZ B;  2KK8 A;  2LUE A;  2XK5 A;  1JRU A;  2KQ7 A;  2JRI B;  2NBW B;  1SE9 A;  3NOB A;  3TMP B;  3ZTD A;  5DPT A;  1UD7 A;  2MW5 A;  1SIF A;  4P7I A;  4EZJ A;  1LM8 B;  2N9P C;  1OEY J; 
#chains in the Genus database with same CATH topology
 2PPH A;  2KQ4 X;  2KJR A;  2AYO B;  5CHV C;  4HPP A;  3AE5 B;  4E74 A;  1WGG A;  1TS3 A;  1FPY A;  2XK5 B;  3AE6 B;  2KQS A;  3DBH B;  4JLC A;  4PYZ A;  3O65 B;  1E8X A;  3N32 A;  1TYG B;  2MBO A;  3ML9 A;  4ICV A;  5IAA C;  4I6N B;  2QDF A;  2V3P A;  2DWQ A;  2DAJ A;  5C3J B;  4L2Y A;  1I42 A;  2EMT A;  3UIN B;  1D3Z A;  4A55 A;  1TJE A;  2JX5 A;  3QC8 B;  5MPO A;  3ZJV A;  1C4C A;  4ANX A;  2FUH B;  3T3N A;  4QAY A;  3ZW3 A;  3KW5 B;  2KC1 A;  3EFU A;  1F52 A;  2K0P A;  2K6D B;  3RCZ A;  5FR3 A;  3KH0 A;  1T0Q C;  5GXG B;  1GC7 A;  3WA0 A;  1EU4 A;  2KC2 A;  2BVC A;  1VZ6 A;  5C2T B;  2D3A A;  3ZUN A;  3W1S C;  1ZW7 A;  1FXA A;  2HJ1 A;  3EEC A;  2LHD A;  4HPL B;  2EMS A;  4RFB A;  3UIO B;  5DPW A;  1AAR A;  2KD0 A;  2WXQ A;  4AP4 C;  4FHJ A;  3A1Q B;  2KOX A;  4DXF A;  2PW9 A;  2C60 A;  4DHZ E;  3VH3 B;  3IT6 B;  2INN E;  2MBE A;  4RF1 A;  5HG2 A;  4C56 C;  1F77 A;  1OGW A;  2K8H A;  4OZC A;  3ZGZ A;  5CHF A;  1V49 A;  1WZ3 A;  1WZ0 A;  2KMC A;  3Q3J A;  2KHW B;  3DWM A;  4GSW A;  1R4M B;  1PYW D;  4NJ7 A;  2CU3 A;  4HKZ E;  4JX1 C;  3V62 A;  4MGY E;  4JIO U;  3B08 A;  4GOC A;  3Q3O C;  2D5G A;  2BS3 B;  4E71 A;  4CYE A;  4ARC A;  1P7F A;  1FFU A;  3N1X C;  2KAJ A;  1WSP A;  2B76 B;  2YEP B;  3ZDM C;  4W9K A;  2C7H A;  2L52 A;  2IYD B;  2BYT A;  4ANU A;  1AWD A;  2V4I B;  1PFD A;  2KWV B;  1N63 A;  2VZK D;  5JXV A;  1Q10 A;  4RF0 A;  2V3N A;  1HZ5 A;  2RDH A;  3CF6 E;  1IBX A;  1C1Y B;  5AZH A;  3R3M A;  4PT5 A;  1E7P B;  3R2T A;  4RGM A;  3URY A;  2GI9 A;  3MJW A;  2LEK A;  2R61 A;  2RGF A;  2AQ1 B;  1YX6 B;  1QQR A;  5E6J A;  4LJO B;  2BTE A;  4JWU C;  2IDY A;  1XD3 B;  2KLC A;  3TEZ A;  4K7W A;  3AMZ A;  3IVF A;  1FIQ A;  1WXM A;  1WY8 A;  4K3B A;  4KKI A;  1ZXH A;  4GDL B;  5TR5 A;  3HM6 X;  1QT9 A;  2JXT A;  4TMA B;  3V05 A;  4MSM B;  2N4F A;  4B6W A;  1FM0 D;  3E56 A;  1I7H A;  1JW9 D;  3L10 B;  2GBJ A;  4RM9 A;  1ET6 A;  1VD2 A;  1QF6 A;  1JRP A;  3R8B A;  1DOX A;  2O2V B;  2BW2 A;  3L0W B;  1KLG D;  2NMQ A;  1GC6 A;  1L0Y B;  3VUX A;  2G3Q B;  4MJS A;  2WYQ A;  4MDK E;  4HWI B;  4YSY B;  2MCN B;  3FIL A;  3J9C A;  3AM9 A;  2KTR A;  1I4X A;  3BVG A;  1FD6 A;  2W9N A;  2LHE A;  1XXG A;  3D32 A;  3HUI A;  2LZ6 A;  1T0R C;  1WM3 A;  2WDT B;  4HCP B;  3PRE A;  1WXQ A;  1SB3 C;  4ZOH C;  4CO7 A;  4OW0 A;  1WX8 A;  5IO9 A;  4E3C A;  1LO5 D;  1WYW B;  4WJN A;  5IP4 D;  3B9J A;  4GDL A;  1JWS D;  4MH0 E;  2LGX A;  4NQK E;  1R4M I;  4RH6 A;  5H8Y E;  3A9K B;  4D2K A;  4W9F A;  4RMA A;  3KYD D;  3AI5 A;  2JU6 X;  3DBL I;  3GS2 A;  4BKG A;  1J7B A;  3WAO A;  2K6Q A;  4MEM A;  2KJ6 A;  4XGA B;  3R7R A;  2MQJ A;  1HA5 A;  2BKR B;  3ZNH B;  5AUK A;  2RPQ A;  2DEN B;  2QMT A;  4HVB A;  1DYQ A;  4LCD E;  3PGE A;  3DPD A;  5C23 A;  1V8C A;  1WXA A;  2KDI A;  1OFF A;  2KO3 A;  2FAZ A;  2EEL A;  2G45 B;  4IW0 A;  3NZU A;  3NVW A;  1ZPS A;  3AE8 B;  4TV3 A;  5EE1 A;  3BYT B;  4GU2 A;  5KHQ A;  4OVV A;  5AZF A;  4JE3 B;  3DCG A;  2L0F A;  2LVP A;  4W9I A;  3HHM A;  3AU4 A;  2IY0 B;  1YQ4 B;  2FCQ A;  2L76 A;  2KVR A;  3W5V B;  4K1R B;  4GDK B;  1EF1 A;  1R7S A;  3IAS 1;  3X23 A;  3PLV A;  2J7Q B;  2DZJ A;  1RAX A;  2JPH A;  1K8R B;  1X1M A;  1E90 A;  4KIK A;  2JT4 B;  4OZB A;  2A5U A;  4REZ A;  4YTN B;  5BYS A;  1GAQ B;  1D5M C;  2X8X X;  2IJ0 A;  3A1Q A;  4HRO A;  4YL8 A;  2WDV B;  3H1U A;  1JML A;  3R2I A;  1V80 A;  1IGD A;  5T8I A;  4JWS C;  5J17 A;  4WUR A;  2TSS A;  2GBN A;  3DVG Y;  1GUA B;  4LNF A;  2L7R A;  3P63 A;  2KX0 A;  2H89 B;  2UYZ B;  4R3D A;  2NTS A;  3RI7 C;  1JWA D;  1UF0 A;  2PJH A;  1F1H A;  2KDM A;  2NS5 A;  1SJE D;  4KIK B;  3ZQ4 A;  4JQW C;  2YLM A;  3ONS A;  3ZJT A;  2JZZ A;  3KUD B;  4WAF A;  3PO0 A;  4A90 A;  2K1F A;  3T8M A;  2O6V D;  1WF9 A;  4JPS A;  3VRA B;  2XN9 C;  3VR9 B;  1SXT A;  2HTH A;  2N7J A;  3AEC B;  2J53 A;  1T0Y A;  5CX3 A;  4MAC A;  3HK0 A;  2ZPY A;  3N1Y C;  3FC4 A;  5E6N A;  1FXT B;  3QK0 A;  2ZVO A;  3WAN A;  2LGY A;  1CK1 A;  1WX9 A;  3QAR A;  1QOA A;  4ZRI A;  5BO4 B;  2GMI C;  2GOW A;  4GLS C;  3AE7 B;  4W9H A;  2WXH A;  3Q2A C;  1NI2 A;  3PV1 A;  4LJP B;  1LFD A;  1R4N B;  3L17 A;  3I9V 1;  1XLN A;  2KK8 A;  2KQ7 A;  2NBW B;  2GLS A;  1SE9 A;  2HDE A;  4Q2J A;  3NOB A;  1UD7 A;  2MW5 A;  1LQB A;  3OLM D;  3BZD B;  2WU5 B;  1BT0 A;  3VH4 B;  3AUL A;  2KX3 A;  1Y56 A;  2DZK A;  3A4S C;  1XCT L;  2W3S A;  2KDF B;  4IC7 B;  3RNG C;  2HE7 A;  3V6E B;  4GN1 A;  2DZI A;  3N9Y C;  4GIV A;  2BS2 B;  3JW0 X;  1L5P A;  1HQR D;  3IT4 B;  3ZRC A;  3VTU A;  2BYE A;  5IA7 A;  2JVC A;  2WNM A;  2D10 A;  2LXC A;  2RD0 A;  3RPF C;  2C9W B;  1F0Z A;  1GB4 A;  4MGI E;  3Q3N C;  2OJR A;  2KTF A;  2IZV B;  1K51 A;  2IGD A;  2MWS B;  2LUM A;  3PRP B;  5LXH A;  2LGS A;  4K7U A;  2L05 A;  2O6V B;  2ZW0 A;  2ZNV C;  3OJ3 A;  3K9O B;  4G0N B;  5BMI A;  2JZ3 B;  1NYQ A;  2BYV E;  4HEA 1;  4JL9 A;  2KYW A;  3Q8F A;  2K8C A;  4BKS D;  2J42 A;  2OOB B;  2MP2 B;  1BUI C;  3A4R A;  4TQ1 A;  5D7G A;  2ACZ B;  1CZP A;  2G4D B;  1AW7 A;  2VZK B;  3TSS A;  5LNK 1;  1TS4 A;  3BK2 A;  4M00 A;  3ZNI D;  3P2B A;  1NI3 A;  2AL6 A;  5EDS A;  1J0G A;  3DHI C;  3IAM 1;  3RT3 B;  1GB1 A;  2KAN A;  2HJ8 A;  1V1P A;  2K5P A;  3UF8 A;  5EE3 A;  1PDX A;  2M4N A;  3BYY B;  1CJE A;  1TS5 A;  1STE A;  3S2A A;  5FR6 A;  4IUM B;  4LK0 M;  1ZOY B;  2KWD A;  4AUQ C;  3PRM B;  1KTK A;  3PRZ A;  3UIP B;  1N6Z A;  3AEE B;  1IBX B;  2LD9 A;  1KF6 B;  4GDK A;  3Q6B A;  1HE8 A;  2I38 A;  2LI5 A;  2IY1 B;  2MJE A;  1IUE A;  4RGT A;  3TBL D;  1R4N I;  2XNA C;  3RZF A;  1C4P A;  4DHJ D;  5CHW A;  2GBM A;  2K22 A;  4K81 A;  3PTF C;  1UH6 A;  4NQL B;  2FNJ B;  2Z0E B;  3RZW C;  3VTW A;  1MJD A;  2MLB A;  4IM0 A;  2AEH A;  1UUP A;  5D6J B;  3BIN A;  2AQ2 B;  4GXB A;  5AUI A;  4TUU A;  1M94 A;  1F9J A;  2D3G A;  3W5U B;  2QC8 A;  2V0G A;  4J6I A;  4XYC A;  1OQR A;  4BKT A;  4ZHP A;  4NNJ B;  3AE1 B;  2INP E;  2KTR B;  1ROE A;  2CHW A;  2MP2 A;  3PHX B;  1C78 A;  2RR9 A;  5BMH A;  5C1Z A;  1ET9 A;  3JVZ X;  2KWC A;  2BB6 A;  3MC0 B;  4P16 A;  4M0W A;  3RMK C;  4X57 B;  5IOI A;  3V61 A;  3VQI A;  4IDI A;  2PE6 B;  3OAW A;  3Q3M C;  4IOI E;  3LB8 C;  4EZK A;  3H8H A;  2B3A A;  3HRD D;  3Q8B A;  2I1K A;  4XX5 A;  2ZVN A;  5BMG A;  3KUC B;  1TS2 A;  4II3 B;  1NDD A;  5G55 A;  2M8S A;  4IWP A;  3KUZ A;  1ZKH A;  3QX1 A;  3ZJU A;  1M4V A;  1VRA B;  1HZ6 A;  2NCN A;  4ARI A;  3NUH B;  2M17 A;  3PVL A;  1K53 A;  3ZNG C;  2WXK A;  1XO3 A;  4PS8 A;  4WAA A;  1HEZ E;  1GOZ A;  1TZO A;  1GJZ A;  1N62 A;  2D11 A;  2JXX A;  1VCB A;  1WJ6 A;  1U4A A;  2NVU I;  1EUV B;  3RFZ B;  2Q5W D;  2M19 A;  2WHI A;  4NZL B;  1S3S G;  1V81 A;  1TBE A;  2WGS A;  2Y3A A;  3A33 B;  3SDL C;  1KH0 A;  4AOF A;  3GP7 A;  1WYG A;  1PGA A;  3WAP A;  4J3O D;  3ZXV A;  4HK2 A;  1BML C;  4KGT A;  3LJ3 A;  2FIF A;  3OG5 A;  2M0X A;  2J4X A;  1WE6 A;  1FCL A;  3M63 B;  3IXS A;  1FMA D;  1V5T A;  1E9M A;  4XWW A;  5GMV A;  3AE9 B;  2WXF A;  1K52 A;  4WWN A;  3T3O A;  4MH8 A;  2D2Q A;  1B1Z A;  3VXW A;  1TKG A;  2ICI A;  3KQ4 A;  1VR9 A;  3PSE B;  4GMV A;  3MTN B;  3P1M A;  2IND C;  2CHZ A;  5JH5 C;  2YVC A;  4ANV A;  3UQA A;  2RDB C;  4HDO A;  4S17 A;  4B95 A;  4M01 A;  3U2S C;  4YSX B;  5BYQ A;  3AE3 B;  1H8C A;  1FRR A;  2R2O A;  4DWF A;  2E3T A;  1EWY C;  2L32 A;  2FBW B;  5JHB A;  2ZCC A;  2N9K A;  3WAM A;  3AXC A;  4W9L A;  4WWP A;  1KLU D;  2FID A;  3DBS A;  3P4R B;  1G6J A;  3LYY A;  3ML8 A;  3L4P A;  4M8N A;  4ZRQ A;  1JWM D;  2BGF A;  3GB1 A;  1TKE A;  5L83 A;  1EO6 A;  4F8C B;  1WGD A;  2LMC A;  3QAQ A;  3CST A;  4MEL A;  1P98 A;  3CSF A;  1WRI A;  3UQB A;  1D6E C;  1K50 A;  3KWV A;  4L23 A;  3AED B;  3U30 A;  1RLF A;  2I1J A;  3PS6 A;  1H4R A;  2K8B A;  2WXO A;  1YD8 U;  3L54 A;  4EKU A;  2WXP A;  3Q14 C;  3EA6 A;  1MG8 A;  4WJQ A;  3BY4 B;  4ZDV A;  2JYE A;  1E7V A;  3V3X A;  4FAD A;  2ZW1 A;  4MGZ E;  4US9 A;  4AWJ A;  4ITK A;  2BF8 B;  2L3Z A;  2REX A;  3Q69 A;  1N60 A;  1BXT A;  3DVG X;  1ZE3 D;  3VUW A;  3EFC A;  3Q8E A;  1LGR A;  4LDT D;  2Y5P A;  4WH4 A;  5DPS A;  5EE0 A;  4PK1 A;  3EC8 A;  2LGI A;  3VVW B;  3R66 C;  4C80 A;  5CTR C;  4GGQ A;  1V86 A;  1LXD A;  2N1W A;  3GE8 C;  2MBH A;  1WGR A;  3M3J A;  1L6V A;  4BOZ B;  2MHJ A;  2LUE A;  2XK5 A;  2JRI B;  4TSS A;  3NG0 A;  3DBR B;  3TMP B;  1SIF A;  4EZJ A;  1LM8 B;  2N9P C;  4NJ6 A;  4II2 B;  1WRD B;  3HVZ A;  3Q8A A;  1WFY A;  2WDQ B;  1NEK B;  1MHX A;  1UBI A;  3GZN B;  2C5L C;  2KMA A;  4OVZ A;  3TEY A;  1F2R I;  4FA6 A;  3SFE B;  2FCS A;  4ZHO A;  2NBU A;  4A8X C;  1KFY B;  4MM3 B;  2Y5C A;  2BWE S;  1V6E A;  3NZ3 A;  4G11 A;  2UU7 A;  3UGB B;  5D94 A;  4KDL B;  2KMM A;  1MHH E;  4IKG A;  5AEK B;  2QIE B;  2IPK D;  1ZUD 2;  3B2G A;  1NVI D;  1WE7 A;  2QCZ A;  3AEG B;  1HTQ A;  5G2N A;  2WQY B;  4OHJ A;  3VR8 B;  1KM7 A;  4XC2 A;  1V2Y A;  3RUL A;  5JZE B;  4A9A A;  1L0X B;  2N9L A;  2BQQ A;  2JY6 A;  2BB5 A;  1B9R A;  3AEB B;  1L2N A;  3DOW A;  1C79 A;  1ZP0 B;  2ZCB A;  1T6B X;  4EFO A;  1XF5 L;  1YQB A;  1VDV A;  4KZC A;  1J7C A;  4DXG A;  2NBV B;  3K9P B;  3Q8C A;  2FE8 A;  1CMX B;  3KLS X;  4NAW B;  3N20 C;  1E10 A;  4WJO A;  1E5W A;  2IGH A;  4RGN A;  3DWG C;  4ZYN A;  3ZVV A;  2WP9 B;  4PS7 A;  1J7A A;  4TKN A;  3APF A;  3QWZ B;  4KSL C;  1QZE A;  2KFK A;  1NYR A;  2LJI A;  1I4R A;  2ZEQ A;  1E7U A;  1VLB A;  3L08 A;  2DZM A;  5FK9 C;  2W82 A;  1JQ4 A;  1EU3 A;  1UNS A;  2DBY A;  1V1P B;  1UGJ A;  3M95 A;  4W9E A;  1YN4 A;  4YWG G;  2HD5 B;  2WX0 A;  3OWE B;  1JRO A;  1Z5S B;  2IO2 B;  3U7D A;  2JWU A;  5JHA A;  2ZNV B;  3R7Q A;  4EEW A;  2BBC A;  2N9E B;  4YTP B;  1MFW A;  2DYO A;  2ON8 A;  4BFR A;  4N6E B;  2NR2 A;  2JWZ A;  3QJZ A;  4CQN A;  2CKH B;  4XE0 A;  1DGJ A;  1ZXI A;  1OQY A;  1PGB A;  4JGH B;  4HDQ A;  4YSZ B;  2Z8L A;  2KVZ A;  1ISN A;  3IBE A;  1L7Y A;  1YN5 A;  3NZS A;  3RYT A;  2MX2 A;  3H7P B;  2JRH A;  5G5H A;  1TGZ B;  2D3B A;  5G5G A;  2KAC A;  1C3T A;  1NBF C;  1VZ8 A;  3A9J A;  2ZZP B;  1PQS A;  1ENF A;  1ACC A;  4USA A;  2L1A A;  1P7E A;  3MC8 A;  1E8Y A;  3RD2 A;  2JQR B;  1N61 A;  3WAL A;  2CHX A;  4UDU C;  4LNO A;  2V9H A;  3QIJ A;  4RM8 A;  4RGO S;  3DBL B;  3HVD A;  4W9G A;  4BVU C;  3DDC B;  3ECI A;  2PE9 A;  5IKC M;  3LXF A;  1I35 A;  2DNF A;  4GB9 A;  4MT5 A;  3IG3 A;  3PLU A;  4K7S A;  3VTV A;  2PVO D;  3NVZ A;  3AN1 A;  1J8C A;  2MJD A;  3WCQ A;  2KXJ A;  4BKS A;  3ZKJ C;  3LDZ E;  3ZYY X;  3SEB A;  4WIP A;  2WXI A;  2BPS A;  3WIM A;  1OEY A;  3AV8 A;  3PZ8 A;  3RNA C;  1YX5 B;  2ASQ A;  1DOI A;  2JZP A;  2CS4 A;  3TJP A;  2W3R A;  5DPR A;  3UI3 A;  2RDG A;  1NEN B;  3P4Q B;  3FAH A;  1SSN A;  2N1V A;  3CWI A;  1XEE A;  2BYF A;  4WJP A;  2C7M B;  2K25 A;  4US8 A;  1WH3 A;  2D07 B;  1P0R A;  1N5X A;  3AE2 B;  2HTM E;  4A3O A;  4EZL A;  3BVZ A;  3NJT A;  2MSE D;  3NY5 A;  1YMH E;  2XEW A;  1HTO A;  1E8W A;  2KN4 A;  1WXV A;  3QCA A;  2LXA A;  2LVO A;  3GZN I;  2CJO A;  2L00 B;  4MM3 A;  2V4L A;  1I4Q A;  3AB5 A;  2H88 B;  2RPV A;  3A9J B;  4FLH A;  2KLG A;  1JAL A;  1SE4 A;  2QHO A;  1EM7 A;  3ZIM A;  3E9S A;  3ZO5 B;  2Z0D B;  4C4V B;  4FHK A;  3ALB A;  4B9K A;  4RCO A;  3TL5 A;  4W9D A;  1L4D B;  3ABV B;  2IGG A;  1RFK A;  3DBH I;  3TEX A;  1WJU A;  4BOS C;  2JUO A;  3PZ7 A;  4NAW A;  1SF0 A;  4XDC A;  1C77 A;  3DHH C;  3L16 A;  1RYJ A;  4DHJ B;  4KGS A;  2LWP A;  4I6L B;  4PS3 A;  3VUY A;  4G50 A;  4NY0 A;  4DK5 A;  2XBB C;  2MH7 A;  4LNK A;  2WXL A;  1TY2 A;  2YEP F;  3SD5 A;  3B1L X;  2M56 B;  3V6C B;  2BWF A;  1MPE A;  3DBR I;  2N0S B;  3PZD A;  5J18 A;  4FN2 A;  3W1Y A;  1QKZ A;  4ASW C;  1WWT A;  1EF5 A;  2KDE B;  1EWC A;  4YXD B;  2K39 A;  4BBN C;  1QOF A;  2BKF A;  1GNU A;  4XZ4 A;  4BAX A;  3ZTC A;  1A5R A;  4F1S A;  2ZJD A;  4IWO A;  3U7Z A;  3CMM B;  1FRD A;  4KKJ A;  1IPG A;  4PYU A;  1JCK B;  1AN8 A;  4MSQ B;  4L1B A;  4C4V A;  2RSU A;  3APD A;  1L6U A;  3U52 E;  3A9K A;  2KJH B;  1WMH B;  4ACF A;  1Q0W B;  2CR5 A;  1YJJ A;  1YOV B;  2KFJ A;  1I4G A;  4A20 A;  1ZDV A;  5H92 C;  3DVN V;  4OVU A;  4M0W B;  1VZ7 A;  2NPT B;  5FKA C;  1WR1 A;  5E6O A;  1WI0 A;  4DXA B;  2WWZ A;  1UGM A;  1UZX B;  5BYR A;  5J2R A;  4NPN A;  3BVM A;  2MRP A;  2LRU A;  1PGX A;  1IYF A;  2I2Y A;  4F7Z A;  2ONQ A;  3B2F A;  4AQ7 A;  2LJ5 A;  1XLO A;  4C00 A;  3ZTD A;  1UWM A;  1OEY J;  1UBQ A;  1J19 A;  3NVY A;  3MP9 A;  4ZRP A;  2OJW A;  2WS3 B;  4MJS B;  1T0S C;  1YJ1 A;  2DYB A;  4A6Q A;  3RNC C;  3MJ5 A;  1WM2 A;  4DQO C;  3U4E G;  2KNB A;  1XCQ L;  1RFA A;  4HJK A;  3BWU D;  1FCC C;  4KX6 B;  2WXJ A;  2PEA A;  2MA9 B;  2FUG 1;  2QIL A;  1FEH A;  4WWO A;  1OQQ A;  3C19 A;  1JWB D;  5AZG A;  3M62 B;  5IN7 A;  3GOE A;  4LNN A;  1WIA A;  3H6N A;  5L95 C;  1L0V B;  3V60 A;  2J52 A;  5TSS A;  1TKY A;  2L83 A;  1E6E B;  2M0A A;  3X0W A;  4KDI C;  4G3X B;  4N59 A;  2N9X A;  3HM3 A;  1CQV A;  3AU5 A;  1E0Z A;  2OHF A;  4M8M A;  2LAS A;  2SEB D;  4N9F 4;  1YJI A;  2KT7 A;  4FUL A;  1SBB B;  2BS4 B;  3H7P A;  3SHQ A;  1ESF A;  4NJC A;  1C9F A;  1YNT E;  2BT6 A;  1TTN A;  4ZYS A;  1UWX A;  2LVQ A;  2LRW A;  3AH7 A;  4ANW A;  3TEW A;  2ZPN A;  4DBG A;  1GPX A;  2O2V A;  1SIJ A;  2Y5B B;  4EUT A;  2AX5 A;  2WU2 B;  3EUB 2;  3MFG A;  2DHZ A;  1TT5 B;  2C7N B;  1D5X C;  2L0T A;  3QQ8 B;  3IHP C;  1SEB D;  5LXI B;  3ZXR A;  1KLV A;  3VFK A;  3N1Z C;  4XWT A;  4LLG M;  2QJL A;  2UWQ A;  3DQV A;  3I5J C;  2MBB B;  1QLB B;  2PIA A;  4C7Z A;  1D5Z C;  1AYF A;  1T5X D;  2V3S A;  3I3T B;  2CU1 A;  2G9H D;  2CJN A;  4WQO B;  3VHT C;  1RRB A;  2PLP A;  2EKE C;  3ETR A;  2IO0 B;  3PT2 B;  2WXN A;  2PTL A;  1P9D U;  3O13 A;  4WQM A;  3APC A;  1F2R C;  2L8J A;  1E8Z A;  2MBQ A;  3W1S A;  1YN3 A;  3P4S B;  1C76 A;  4IM3 A;  2GBK A;  4HPM B;  1Q1O A;  2IO3 B;  3N3K B;  2MEK A;  4BZA A;  4ZRJ A;  3T9L A;  3SU8 X;  2VRR B;  4FJY A;  1C4A A;  2G1E A;  2Z59 B;  3FIL B;  1SE2 A;  3VAW A;  4IWQ A;  2GRI A;  2PVG C;  1YQ3 B;  4KZ0 A;  1FO4 A;  3U8Z A;  4FXC A;  2QEJ C;  1WJN A;  2J0K A;  1V97 A;  1WR6 E;  1V9J A;  2GB1 A;  1V5O A;  3SFD B;  4KSK C;  1VJK A;  2VH1 A;  4DDI D;  3ENE A;  2N7E A;  3ZNZ B;  3ZDT A;  2JSV X;  3KWL A;  3P4P B;  5D3I B;  3CIR B;  4B0E A;  5KHO A;  2JYT A;  3W9C B;  1XQQ A;  3N30 A;  3QHT A;  5HKH A;  3BK1 A;  3NS1 A;  4XDD A;  2KWU B;  3VRB B;  4OZA A;  1WMH A;  3I57 A;  2AWT A;  3KVF B;  3MC9 A;  3NRZ A;  1XT9 B;  1KOT A;  2K3U A;  3H9D A;  4ICU A;  2FCN A;  2N7D A;  3TCA A;  4AJW A;  3RNF C;  4LTU A;  4W9C A;  3NHE B;  1MG4 A;  4BBN F;  3RNE C;  3VDZ A;  3RN9 C;  2J0M A;  1FNW A;  2RMM A;  5EE9 A;  1KJT A;  2LGD A;  2WLB A;  3W2D A;  4HLE A;  4FJZ A;  1P3Q U;  2J0J A;  4HXD A;  4DDG D;  2DLB A;  2R2Q A;  2DYM A;  1T3Q A;  1FNV A;  1SE3 A;  3AEA B;  1Y8R C;  2DAF A;  3HIZ A;  4KGR A;  3NS8 A;  5I4D A;  1WGY A;  1GG3 A;  2MJ3 A;  3MHZ A;  4EOY A;  2INC C;  2PMV A;  3AE4 B;  2LFI A;  2GBR A;  2E6X A;  1IP9 A;  2K9X A;  4KVG B;  1QIL A;  1YIW A;  4MGK E;  2O6V A;  3EHV A;  3NVV A;  3TUO A;  3DVN U;  2WXM A;  2OED A;  2PKO A;  3JYU A;  5HI1 A;  2VH2 A;  1FXI A;  4W9J A;  2NTT A;  1FNU A;  4N58 A;  2SAK A;  4P1C C;  1TY0 A;  3H7S A;  4P6V F;  2FCM A;  2AL3 A;  2KFK B;  3AEF B;  2G4S A;  3L13 A;  5D3D A;  2KDB A;  3PPA A;  1D4B A;  1MI0 A;  4FBJ B;  3ZLZ A;  3RNB C;  3KYC D;  1RWS A;  2IO1 B;  3B0A A;  1WGH A;  3Q3F A;  1SJH D;  3OJ4 B;  4S0R A;  1XLQ A;  2W54 A;  1JWU D;  1MVK A;  5HFY A;  4B0M A;  2KKC A;  5D2M B;  3I63 C;  2KZR A;  3TIX A;  1SGH A;  1HXY D;  1ZGU B;  1I4H A;  4HRS A;  3SR6 A;  1TIF A;  2IBI B;  4EE2 A;  2AQ3 B;  3MHS D;  4HCN B;  4AS1 A;  2M1M A;  4LNI A;  3QA8 A;  3RUI B;  2QSD A;  2D3C A;  3DHG C;  1RM6 C;  2KN5 A;  4YT0 B;  5HHD G;  3JSV B;  4AJY B;  5E6P A;  4CHK A;  2JF5 A;  1XLP A;  2WDR B;  3GE3 C;  1P1A A;  2NPT A;  3FKY A;  1QOG A;  4M02 A;  4DHZ B;  1V1O A;  2A4Z A;  4KV2 A;  3IFW B;  4IG7 B;  4HKQ A;  4P1B C;  4LDT B;  2WXR A;  4I6P A;  1N5W A;  3JSV A;  4WWM A;  5DCN A;  4FJV B;  4TQ0 A;  3C0R B;  3ZRF A;  1WX7 A;  1S1Q B;  1PUT A;  1WGK A;  4HJG E;  1FFV A;  1WJ4 A;  4IM2 A;  1I4P A;  4ZRK A;  2WXG A;  1QOB A;  1DOY A;  2WX1 A;  4A3P A;  1TZ1 A;  4URK A;  4NAM A;  2X38 A;  1UEL A;  1WXS A;  5LLI A;  1Q5W B;  2DX5 B;  2EKI A;  2W55 A;  4H2A A;  3BII D;  1Z2M A;  3EGR A;  1KRH A;  2V1Y A;  1OTR B;  3C8Y A;  1L4Z B;  4YTM B;  4RNA A;  4O1N A;  4C7Y A;  1ZDX A;  1A70 A;  1JRU A;  1IGC A;  3P42 A;  5DPT A;  4P7I A;  3PHW B;  4K3C A; 
#chains in the Genus database with same CATH homology
 1LQB A;  4NJ6 A;  2PPH A;  3OLM D;  1UBQ A;  1J19 A;  2KJR A;  2AYO B;  1BT0 A;  3VH4 B;  4II2 B;  1WRD B;  5CHV C;  1WFY A;  3AUL A;  4E74 A;  2KX3 A;  1UBI A;  1WGG A;  2DZK A;  4MJS B;  2C5L C;  2KMA A;  3A4S C;  1YJ1 A;  2XK5 B;  2KDF B;  4IC7 B;  2KQS A;  2DYB A;  4FA6 A;  4JLC A;  4PYZ A;  2HE7 A;  2FCS A;  3O65 B;  1E8X A;  3V6E B;  3N32 A;  1WM2 A;  4GN1 A;  2MBO A;  3ML9 A;  4ICV A;  5IAA C;  2DZI A;  2NBU A;  4GIV A;  4I6N B;  2DAJ A;  2KNB A;  3JW0 X;  1RFA A;  4HJK A;  3VTU A;  3ZRC A;  2BYE A;  5IA7 A;  2JVC A;  2BWE S;  1V6E A;  2EMT A;  2PEA A;  2MA9 B;  1I42 A;  4G11 A;  3UIN B;  4WWO A;  1D3Z A;  2D10 A;  2LXC A;  3QC8 B;  2RD0 A;  2C9W B;  4MGI E;  3UGB B;  5AZG A;  3M62 B;  5D94 A;  4KDL B;  4ANX A;  2FUH B;  2OJR A;  2KTF A;  2IZV B;  3GOE A;  3ZW3 A;  2MWS B;  3KW5 B;  3PRP B;  1WIA A;  2KC1 A;  3EFU A;  5AEK B;  4K7U A;  5LXH A;  3H6N A;  5L95 C;  2L05 A;  2K6D B;  3RCZ A;  3KH0 A;  3V60 A;  1GC7 A;  2O6V B;  3WA0 A;  1WE7 A;  2ZNV C;  3OJ3 A;  3X0W A;  4KDI C;  3K9O B;  4G0N B;  5G2N A;  4G3X B;  2JZ3 B;  2KC2 A;  2BYV E;  1KM7 A;  4XC2 A;  1V2Y A;  4JL9 A;  3RUL A;  3ZUN A;  2N9X A;  5JZE B;  3HM3 A;  2K8C A;  3W1S C;  1ZW7 A;  3AU5 A;  4BKS D;  2OOB B;  3EEC A;  4HPL B;  2JY6 A;  2EMS A;  2MP2 B;  4M8M A;  3UIO B;  5DPW A;  3A4R A;  1AAR A;  1L2N A;  3DOW A;  4TQ1 A;  2ZCB A;  2LAS A;  4EFO A;  5D7G A;  2KD0 A;  1YQB A;  4N9F 4;  2G4D B;  4KZC A;  4AP4 C;  4FHJ A;  4FUL A;  3A1Q B;  2KOX A;  3ZNI D;  3H7P A;  3P2B A;  3SHQ A;  2NBV B;  3K9P B;  2AL6 A;  5EDS A;  1J0G A;  2C60 A;  1CMX B;  4DHZ E;  4NAW B;  3VH3 B;  3RT3 B;  2KAN A;  4WJO A;  1E5W A;  2MBE A;  1TTN A;  2HJ8 A;  1OGW A;  2K8H A;  2LVQ A;  2LRW A;  3UF8 A;  4ZYN A;  4ANW A;  2M4N A;  3ZVV A;  5CHF A;  1V49 A;  4PS7 A;  2ZPN A;  1WZ3 A;  3APF A;  1WZ0 A;  2O2V A;  4TKN A;  2Y5B B;  2KMC A;  3Q3J A;  4DBG A;  3QWZ B;  4KSL C;  4EUT A;  1QZE A;  2KHW B;  4GSW A;  2KFK A;  2DHZ A;  2C7N B;  3S2A A;  5FR6 A;  4IUM B;  4NJ7 A;  2L0T A;  3V62 A;  2ZEQ A;  3QQ8 B;  4AUQ C;  1E7U A;  3PRM B;  3IHP C;  3L08 A;  4MGY E;  2DZM A;  5LXI B;  4JIO U;  3B08 A;  4GOC A;  4E71 A;  4CYE A;  3PRZ A;  3VFK A;  1KLV A;  3UIP B;  2LD9 A;  2UWQ A;  3DQV A;  3M95 A;  4GDK A;  4W9E A;  3ZDM C;  1HE8 A;  2MBB B;  4W9K A;  2HD5 B;  2C7H A;  2LI5 A;  2WX0 A;  2IYD B;  2IY1 B;  4ANU A;  1Z5S B;  2IO2 B;  2V3S A;  3I3T B;  3U7D A;  2CU1 A;  3TBL D;  5JHA A;  2ZNV B;  1R4N I;  3R7Q A;  4EEW A;  2N9E B;  2KWV B;  4WQO B;  3RZF A;  3VHT C;  2DYO A;  5CHW A;  2GBM A;  1RRB A;  4DHJ D;  2EKE C;  4K81 A;  3PTF C;  4BFR A;  2NR2 A;  1UH6 A;  2JWZ A;  3CF6 E;  3QJZ A;  4NQL B;  2FNJ B;  1C1Y B;  5AZH A;  2Z0E B;  3R3M A;  3RZW C;  3VTW A;  2IO0 B;  3PT2 B;  2MLB A;  3MJW A;  4IM0 A;  2AEH A;  2CKH B;  2RGF A;  1P9D U;  5D6J B;  1YX6 B;  1OQY A;  3BIN A;  4JGH B;  3APC A;  4LJO B;  4HDQ A;  4GXB A;  1ISN A;  1XD3 B;  2KLC A;  2L8J A;  4TUU A;  1M94 A;  1F9J A;  1E8Z A;  2MBQ A;  3IBE A;  4K7W A;  3W1S A;  2D3G A;  3IVF A;  4IM3 A;  1WXM A;  1L7Y A;  2GBK A;  1WY8 A;  4HPM B;  4GDL B;  1Q1O A;  2IO3 B;  4J6I A;  3N3K B;  3NZS A;  5TR5 A;  3RYT A;  3HM6 X;  4ZRJ A;  3T9L A;  2MX2 A;  3H7P B;  2JRH A;  1TGZ B;  3SU8 X;  2VRR B;  4FJY A;  4BKT A;  4MSM B;  2N4F A;  2Z59 B;  4B6W A;  1C3T A;  1NBF C;  4NNJ B;  3A9J A;  3VAW A;  2ZZP B;  1PQS A;  4IWQ A;  2KTR B;  3L10 B;  2GBJ A;  2CHW A;  4KZ0 A;  2MP2 A;  4RM9 A;  1VD2 A;  3U8Z A;  3PHX B;  2RR9 A;  5C1Z A;  1E8Y A;  3JVZ X;  1WJN A;  2J0K A;  3RD2 A;  2KWC A;  1WR6 E;  1V9J A;  2CHX A;  2O2V B;  3WAL A;  3L0W B;  3QIJ A;  1GC6 A;  1V5O A;  3VUX A;  4RM8 A;  2G3Q B;  4MJS A;  4X57 B;  4W9G A;  3V61 A;  3VQI A;  4BVU C;  2WYQ A;  2PE6 B;  3DDC B;  4KSK C;  4MDK E;  3OAW A;  4HWI B;  3ECI A;  2PE9 A;  2MCN B;  4DDI D;  3ENE A;  1I35 A;  2KTR A;  4GB9 A;  4EZK A;  2N7E A;  3IG3 A;  3ZDT A;  3ZNZ B;  3PLU A;  2B3A A;  4K7S A;  3VTV A;  2W9N A;  5KHO A;  2I1K A;  1XQQ A;  3N30 A;  4XX5 A;  2ZVN A;  3QHT A;  3KUC B;  5HKH A;  4II3 B;  1J8C A;  1NDD A;  3D32 A;  5G55 A;  2LZ6 A;  2M8S A;  4IWP A;  2KWU B;  1WM3 A;  2WDT B;  3KUZ A;  4HCP B;  1ZKH A;  1WMH A;  2KXJ A;  4BKS A;  3QX1 A;  3ZKJ C;  2AWT A;  3LDZ E;  3PRE A;  3KVF B;  1XT9 B;  2BPS A;  1KOT A;  3WIM A;  1OEY A;  3H9D A;  4ICU A;  4CO7 A;  1WX8 A;  2FCN A;  2N7D A;  3TCA A;  4AJW A;  2NCN A;  4E3C A;  4W9C A;  1YX5 B;  3NHE B;  4BBN F;  2ASQ A;  3VDZ A;  2M17 A;  1WYW B;  2CS4 A;  4WJN A;  3TJP A;  2J0M A;  3PVL A;  5DPR A;  3ZNG C;  4PS8 A;  4GDL A;  1KJT A;  2LGD A;  4WAA A;  4MH0 E;  1GJZ A;  2D11 A;  2LGX A;  4NQK E;  1R4M I;  4HLE A;  2JXX A;  1VCB A;  1WJ6 A;  4FJZ A;  1U4A A;  3A9K B;  1P3Q U;  2NVU I;  4W9F A;  1EUV B;  2J0J A;  2N1V A;  4RMA A;  2BYF A;  4WJP A;  2C7M B;  2K25 A;  1WH3 A;  3KYD D;  2D07 B;  4HXD A;  4DDG D;  1S3S G;  1V81 A;  1TBE A;  3AI5 A;  2R2Q A;  2DYM A;  3DBL I;  3A33 B;  1Y8R C;  1P0R A;  3SDL C;  4AOF A;  2DAF A;  3HIZ A;  4BKG A;  3WAP A;  3WAO A;  3PHW B;  3NS8 A;  4HK2 A;  4A3O A;  4EZL A;  1WGY A;  2K6Q A;  1GG3 A;  4MEM A;  2KJ6 A;  4EOY A;  3LJ3 A;  2MSE D;  3R7R A;  3NY5 A;  2MQJ A;  2FIF A;  2BKR B;  3ZNH B;  2M0X A;  2XEW A;  2RPQ A;  1E8W A;  2DEN B;  1WE6 A;  4HVB A;  3M63 B;  4LCD E;  3PGE A;  2GBR A;  3DPD A;  1WXV A;  1IP9 A;  5C23 A;  3QCA A;  1V5T A;  1WXA A;  2KDI A;  2LXA A;  4KVG B;  2KO3 A;  2LVO A;  1YIW A;  2FAZ A;  2L00 B;  3GZN I;  4MM3 A;  5GMV A;  2G45 B;  4IW0 A;  2V4L A;  3NZU A;  4MGK E;  4WWN A;  2O6V A;  2D2Q A;  4TV3 A;  3EHV A;  3VXW A;  3DVN U;  4GU2 A;  5KHQ A;  3JYU A;  3PSE B;  4GMV A;  3MTN B;  4OVV A;  5AZF A;  3A9J B;  4FLH A;  2CHZ A;  4W9J A;  2KLG A;  3DCG A;  2L0F A;  2LVP A;  2YVC A;  4W9I A;  5JH5 C;  2QHO A;  3HHM A;  4ANV A;  3UQA A;  3ZIM A;  3AU4 A;  2IY0 B;  3H7S A;  4HDO A;  3ZO5 B;  2Z0D B;  2FCQ A;  2FCM A;  2L76 A;  2AL3 A;  2KFK B;  2KVR A;  2G4S A;  3L13 A;  2KDB A;  3PPA A;  4FHK A;  3ALB A;  4B9K A;  4B95 A;  4FBJ B;  3ZLZ A;  4K1R B;  4GDK B;  3TL5 A;  1EF1 A;  3X23 A;  3KYC D;  4W9D A;  3PLV A;  2IO1 B;  2J7Q B;  3B0A A;  1WGH A;  1H8C A;  2R2O A;  2DZJ A;  3Q3F A;  4DWF A;  3OJ4 B;  3DBH I;  1WJU A;  1RAX A;  4BOS C;  2JPH A;  1K8R B;  2JUO A;  1X1M A;  2KKC A;  4NAW A;  1E90 A;  4KIK A;  5D2M B;  2JT4 B;  5JHB A;  2KZR A;  2A5U A;  2ZCC A;  1SGH A;  3L16 A;  3TIX A;  3WAM A;  1ZGU B;  3AXC A;  4W9L A;  4DHJ B;  4WWP A;  2IBI B;  2LWP A;  3A1Q A;  4I6L B;  4YL8 A;  4PS3 A;  3VUY A;  2FID A;  3H1U A;  3MHS D;  4G50 A;  2M1M A;  3DBS A;  4HCN B;  1V80 A;  3QA8 A;  4NY0 A;  3RUI B;  4DK5 A;  2XBB C;  1G6J A;  5J17 A;  3ML8 A;  4M8N A;  2GBN A;  3SD5 A;  3B1L X;  3DVG Y;  2KN5 A;  1GUA B;  2BGF A;  3JSV B;  3V6C B;  2L7R A;  2BWF A;  4AJY B;  3DBR I;  5E6P A;  2JF5 A;  1EO6 A;  4CHK A;  1WGD A;  3PZD A;  4F8C B;  5L83 A;  3QAQ A;  3CST A;  2KX0 A;  2UYZ B;  1P1A A;  5J18 A;  4MEL A;  4FN2 A;  3W1Y A;  1P98 A;  2NPT A;  3CSF A;  2PJH A;  4DHZ B;  4ASW C;  3UQB A;  1EF5 A;  2A4Z A;  2KDE B;  4KV2 A;  3IFW B;  2K39 A;  4IG7 B;  2BKF A;  4BBN C;  4LDT B;  2NS5 A;  1GNU A;  4I6P A;  4KIK B;  3U30 A;  4XZ4 A;  1RLF A;  3ZTC A;  2I1J A;  3PS6 A;  3JSV A;  1H4R A;  1A5R A;  4JQW C;  2K8B A;  2YLM A;  2ZJD A;  3ONS A;  4IWO A;  5DCN A;  4F1S A;  1YD8 U;  3CMM B;  3L54 A;  4EKU A;  4FJV B;  2JZZ A;  4TQ0 A;  1IPG A;  3C0R B;  3KUD B;  1WX7 A;  3ZRF A;  1MG8 A;  1S1Q B;  4PYU A;  4WJQ A;  2K1F A;  3T8M A;  2O6V D;  3BY4 B;  1WF9 A;  4ZDV A;  1WJ4 A;  1E7V A;  4MSQ B;  4FAD A;  2RSU A;  4IM2 A;  3APD A;  4ZRK A;  4MGZ E;  2HTH A;  3A9K A;  4AWJ A;  1T0Y A;  2KJH B;  1WMH B;  5CX3 A;  2WX1 A;  2BF8 B;  2L3Z A;  2ZPY A;  3HK0 A;  1Q0W B;  4A3P A;  1TZ1 A;  4URK A;  2CR5 A;  2KFJ A;  2REX A;  4A20 A;  3DVG X;  1UEL A;  5E6N A;  3VUW A;  1FXT B;  1WXS A;  3QK0 A;  2ZVO A;  3DVN V;  3WAN A;  4LDT D;  5DPS A;  2LGY A;  4OVU A;  5LLI A;  4M0W B;  1WX9 A;  2NPT B;  1WR1 A;  5E6O A;  1Q5W B;  2DX5 B;  3QAR A;  1WI0 A;  3EC8 A;  4DXA B;  2WWZ A;  1UGM A;  3VVW B;  3R66 C;  4ZRI A;  1UZX B;  5J2R A;  1Z2M A;  4NPN A;  5BO4 B;  5CTR C;  2GMI C;  2V1Y A;  2MRP A;  2GOW A;  4GGQ A;  1V86 A;  2LRU A;  1LXD A;  4W9H A;  1IYF A;  2N1W A;  1OTR B;  1NI2 A;  2MBH A;  4F7Z A;  3PV1 A;  4LJP B;  1LFD A;  1WGR A;  2LJ5 A;  3L17 A;  3M3J A;  4BOZ B;  2KK8 A;  2LUE A;  2XK5 A;  1JRU A;  2KQ7 A;  2JRI B;  2NBW B;  1SE9 A;  3NOB A;  3TMP B;  3ZTD A;  5DPT A;  1UD7 A;  2MW5 A;  1SIF A;  4P7I A;  4EZJ A;  1LM8 B;  2N9P C;  1OEY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...