2LGXA

Nmr structure for kindle-2 n-terminus
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
94
structure length
94
Chain Sequence
MALDGIRMPDGCYADGTWELSVHVTDVNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Fermitin family homolog 2
publication title Membrane Binding of the N-Terminal Ubiquitin-Like Domain of kindlin-2 Is Crucial for Its Regulation of Integrin Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18124 Kindlin_2_N Kindlin-2 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lgxA00
4TQ1A 4W9GA 3ZRCA 4DXAB 3PRMB 2D07B 5JH5C 2KX3A 2BYFA 2K6DB 3P2BA 4W9HA 2IO3B 4PS3A 3CSFA 2NS5A 2DZKA 2N9XA 5E6NA 2QHOA 2RSUA 4IM0A 5LXHA 4M0WB 3ZUNA 1WX7A 2LASA 2MBOA 2OJRA 2WWZA 2KFKA 3NZSA 2KMCA 1VCBA 3APCA 3VTUA 2UWQA 2NR2A 4BBNF 1R4MI 1WE6A 3VDZA 2LXCA 4ICUA 1TZ1A 1V2YA 2KLGA 2KXJA 3W1SA 2D11A 4CHKA 2FCNA 3ML8A 2ZVOA 4ANXA 4EZKA 4ZDVA 2KDBA 1C3TA 3PZDA 4ASWC 2KNBA 1WJ6A 1J0GA 1NBFC 1WM3A 3EHVA 2EMTA 3L54A 4FJVB 4K7SA 4J6IA 1UELA 3CMMB 1T0YA 1E8ZA 1WXVA 5AEKB 2MBEA 2MBHA 4HVBA 4FA6A 2RD0A 2RR9A 4WWOA 1CMXB 1WMHA 4BKTA 3PTFC 4BOSC 3VQIA 4AJWA 4W9EA 3HIZA 3RULA 3AI5A 3T9LA 4I6PA 2BYEA 1Q1OA 3ZLZA 4PYUA 2JT4B 4GIVA 5G2NA 1KOTA 1AARA 2KTRA 2K6QA 3JW0X 1P9DU 1C1YB 4ZYNA 2D2QA 3NY5A 3ECIA 4GB9A 3SU8X 4ANVA 2M0XA 1V80A 4JLCA 4W9FA 5D6JB 3DBSA 2LRWA 4B9KA 1S3SG 2HE7A 2LWPA 3H7PA 2IY0B 1H4RA 3KUZA 2BPSA 3RZFA 3WANA 3JSVB 2LGXA 2N4FA 4G3XB 4WJQA 3QA8A 4BKGA 1Z2MA 1R4NI 2M4NA 2PJHA 2BKRB 4NJ6A 1YX6B 3RD2A 3TIXA 3ENEA 2CR5A 3EC8A 3L10B 2C7HA 3U7DA 1UH6A 5C23A 3VFKA 5IA7A 4GDKB 1V49A 2L7RA 2N9EB 2Z59B 4GDLB 2G4SA 4KZCA 3UIOB 3M63B 3WAMA 4KIKB 3MJWA 3M3JA 4N9F4 2FIDA 4KSKC 2MA9B 2N7EA 4LJOB 4JIOU 5D2MB 3V6CB 5J2RA 3R3MA 3X0WA 2Y5BB 4KVGB 1P98A 4HWIB 1WX9A 3ZW3A 4DK5A 5IAAC 3HM6X 2K25A 2NBVB 3M95A 2CHZA 4WWPA 1PQSA 2XK5A 2FNJB 2C7NB 4E3CA 3VVWB 4K1RB 2LUEA 3RYTA 1LM8B 4IM2A 2ZCCA 4W9KA 1YJ1A 4KDLB 5EDSA 1WM2A 2WYQA 2K8HA 4FJYA 1TTNA 2J0KA 2DX5B 1A5RA 5D7GA 2BGFA 4G11A 4BOZB 4BKSD 2O6VA 3DBRI 2ZPNA 2LJ5A 2UYZB 3BINA 2K8BA 3H9DA 4KV2A 4IWOA 3N32A 3Q3JA 4B6WA 2LD9A 3ALBA 1J19A 3R66C 2IBIB 3DBHI 3TCAA 1D3ZA 3RCZA 4RM8A 4WJPA 2KZRA 1P0RA 1LXDA 1WJ4A 4MM3A 3UIPB 3H6NA 3PRZA 4GSWA 4WAAA 5AZFA 4I6LB 1VD2A 5DPRA 1V5TA 4EEWA 3L0WB 2DENB 1TBEA 4W9LA 1WR6E 2JRHA 3DQVA 2EKEC 1ZGUB 3VUWA 1E5WA 3ZNGC 4EUTA 3HM3A 2C9WB 1E90A 3L16A 1WMHB 3APDA 2LVQA 4MGYE 4NJ7A 2RPQA 1V6EA 2Z0DB 3QCAA 3UINB 1KLVA 3PREA 2Z0EB 3O65B 2J0MA 3PGEA 1SIFA 2ZZPB 3GOEA 4NQKE 1WGGA 5G55A 3W1YA 4F1SA 2MX2A 2NPTA 2KTRB 3JVZX 2NVUI 2AYOB 4PS7A 2DZMA 1WGHA 1RAXA 3QHTA 2KJRA 4M8NA 2I1JA 2LVOA 3PVLA 4MDKE 2FAZA 1BT0A 3OAWA 2A4ZA 2JUOA 4FHJA 4MJSA 3B08A 3H7PB 2GMIC 4OVVA 3MHSD 5CHWA 2KN5A 1I35A 3RUIB 3V60A 4IWQA 2N9PC 2V1YA 4IM3A 3V62A 4EZJA 3RZWC 4BVUC 2KWCA 1YX5B 4IWPA 3ZDTA 2FCMA 2B3AA 3DVGX 3R7RA 2N1VA 4LJPB 2GOWA 3ZTDA 3V61A 3VH3B 2JY6A 2KC2A 4YL8A 1WYWB 3Q3FA 2DYMA 2LGDA 2JXXA 2PPHA 1EUVB 2C5LC 1WR1A 2KVRA 4NY0A 2JZ3B 2KQ7A 4A3PA 4AJYB 3D32A 2IYDB 4ZRKA 2YVCA 2LGYA 4HCNB 2CS4A 3OJ3A 4EFOA 2ZNVC 2VRRB 2XK5B 3TBLD 3L13A 4E71A 2LI5A 2PE9A 1WXSA 3WA0A 2K8CA 4K7WA 4II2B 1WFYA 4FN2A 4IC7B 3KH0A 5HKHA 3WIMA 4KSLC 4AWJA 1IYFA 2KK8A 4MEMA 3WAOA 5L95C 4ZRJA 1H8CA 2BYVE 1E8XA 5D94A 2R2OA 1XQQA 3KYDD 4A20A 4FLHA 2O6VB 2D3GA 2ZCBA 1E7VA 3ZNZB 3PRPB 4GXBA 2IO2B 2MBQA 2LRUA 4DBGA 1EF1A 5JHBA 2D10A 1Y8RC 3WALA 5BO4B 3DVNV 1KM7A 4NPNA 4BBNC 5KHQA 4ANUA 1J8CA 2ZJDA 4MH0E 2MLBA 2OOBB 2R2QA 3QK0A 4II3B 5LLIA 3PHXB 4HPLB 4K7UA 4PYZA 3DBLI 4W9JA 4EKUA 3KUCB 4NAWB 2C7MB 2FCSA 2DAJA 3BY4B 4K81A 3ZKJC 1SGHA 1YQBA 2O6VD 2ZEQA 2CU1A 3PSEB 3A9JA 1P1AA 1UZXB 1NDDA 3QQ8B 4HK2A 3N3KB 4W9IA 4EOYA 1SE9A 1P3QU 2KJHB 3VHTC 3X23A 2BWFA 4GOCA 1IPGA 3VUXA 4HLEA 3DVNU 2KKCA 2LVPA 3DOWA 4KDIC 3ZIMA 5C1ZA 5AZGA 2KO3A 1WZ3A 1F9JA 2KFKB 1TGZB 2M17A 4E74A 3PV1A 2IO1B 4TV3A 1WZ0A 2MBBB 3EFUA 3LDZE 1Z5SB 2L05A 4JGHB 5LXIB 1ZKHA 3KYCD 3R7QA 4MGKE 2XBBC 4OVUA 2AWTA 2NBWB 3APFA 2KJ6A 4G0NB 3LJ3A 1V86A 2RGFA 2LXAA 3K9OB 2DZIA 4CO7A 4F8CB 1X1MA 2BWES 5DPTA 4FULA 4MJSB 4URKA 1XD3B 2MP2A 1L7YA 1WJUA 2L3ZA 2BKFA 3MTNB 4M8MA 3ZTCA 3IHPC 1UBQA 4TUUA 1WE7A 2ZPYA 2REXA 4IUMB 3ML9A 2N7DA 4W9DA 3VH4B 4DWFA 2KC1A 3U30A 4HDOA 1GUAB 2GBJA 2NCNA 1U4AA 3NOBA 1WY8A 1JRUA 3I3TB 3A9KA 2JWZA 3M62B 4X57B 3SDLC 2KFJA 2AEHA 2AL6A 4HDQA 2MW5A 3HHMA 3IBEA 4A3OA 4DDGD 2CHXA 2KX0A 3S2AA 1S1QB 1GJZA 2O2VA 4I6NB 1OGWA 4HJKA 2CKHB 3VTWA 2M1MA 3PT2B 4P7IA 1V9JA 3PS6A 4JL9A 3WAPA 4WWNA 2J0JA 4HXDA 2CHWA 2K1FA 4RM9A 3V6EB 5L83A 3JYUA 1OTRB 2KWVB 4MGIE 3B1LX 2K39A 1RLFA 3CSTA 2KDEB 2KDIA 3A1QA 2KANA 3PLUA 2IZVB 3AU5A 1GC7A 2V3SA 3QAQA 4TKNA 1RFAA 3ZNHB 2KQSA 4AUQC 3KW5B 2HJ8A 3RT3B 1EF5A 3CF6E 4PS8A 2KDFB 3H7SA 1M94A 2G3QB 1V81A 1WRDB 3IFWB 3OLMD 2JRIB 1OQYA 4HPMB 2WX1A 2IO0B 3A4RA 3DPDA 3UF8A 3QX1A 4HCPB 3TL5A 3VTVA 3TJPA 4EZLA 1G6JA 2WDTB 3ZDMC 1OEYJ 2KLCA 3AULA 1FXTB 1E8YA 5GMVA 4IW0A 3ZO5B 1YIWA 1ZW7A 2DHZA 2W9NA 4LDTB 3KVFB 1UBIA 3UGBB 2IY1B 5TR5A 2N1WA 2KOXA 4GMVA 5FR6A 1WI0A 4BFRA 2KHWB 4CYEA 1I42A 5CTRC 3A9JB 3GZNI 2MQJA 2PE6B 4DHJB 2LZ6A 1L2NA 2YLMA 3ZNID 4DDID 2HTHA 5AZHA 1EO6A 1WGDA 2GBMA 3EECA 2JVCA 5JHAA 2G45B 2NBUA 2MWSB 2DZJA 5DCNA 2A5UA 4LDTD 1V5OA 2DYOA 2GBNA 3ZRFA 3IG3A 2KD0A 4B95A 2L00B 2DYBA 1WH3A 2MCNB 4DHZB 2ASQA 4XC2A 1E7UA 1WX8A 3HK0A 3VXWA 4LCDE 2JZZA 1IP9A 3UQAA 5CX3A 2J7QB 4DHJD 3T8MA 3KUDB 4ZRIA 3IVFA 3SD5A 3ONSA 3SHQA 1Q5WB 1WF9A 4W9CA 4FJZA 3ZVVA 2MP2B 4KZ0A 3QC8B 2KTFA 2V4LA 1GNUA 1XT9B 4WJOA 4AOFA 1WXMA 1Q0WB 1K8RB 1KJTA 2FIFA 3QWZB 1WXAA 3N30A 1WJNA 4TQ0A 1LFDA 2JF5A 3QARA 3W1SC 4IG7B 3DDCB 4AP4C 1HE8A 3QIJA 1UD7A 1GC6A 3A4SC 1NI2A 2BF8B 5KHOA 3A9KB 5E6OA 2KWUB 5CHVC 1QZEA 2ZNVB 3NS8A 1YD8U 4FHKA 5CHFA 1OEYA 2L76A 1GG3A 3TMPB 1E8WA 1WGRA 1WGYA 4MSMB 5J18A 1RRBA 4FADA 3PPAA 2L0TA 4JQWC 3DVGY 2HD5B 2O2VB 3DCGA 3NZUA 2NPTB 4ICVA 4XX5A 3L17A 4NQLB 3C0RB 2XEWA 3L08A 3B0AA 4F7ZA 3A33B 4GGQA 2C60A 1WIAA 3NHEB 5J17A 2EMSA 4NNJB 3JSVA 3QJZA 4GN1A 4MSQB 2DAFA 2JPHA 1MG8A 4ANWA 4GU2A 5JZEB 3A1QB 2L8JA 4XZ4A 4RMAA 1LQBA 4DHZE 4GDKA 2PEAA 1UGMA 4GDLA 2GBRA 2AL3A 3PHWB 2FUHB 4KIKA 4MELA 2WX0A 2FCQA 3VAWA 4G50A 5DPWA 5DPSA 2M8SA 3PLVA 4WJNA 3UQBA 2L0FA 3K9PB 5E6PA 2I1KA 4WQOB 3AU4A 3U8ZA 1ISNA 3H1UA 4FBJB 2G4DB 3OJ4B 4NAWA 3AXCA 4BKSA 2GBKA 2KMAA 3VUYA 2MSED 2ZVNA 4MGZE 2MRPA
chains in the Genus database with same CATH superfamily
1FMAD 4TQ1A 4DXAB 1NVID 1OQQA 2D07B 2SEBD 5JH5C 2KX3A 4MT5A 4IM0A 2LASA 3DBLB 4TSSA 2WQYB 2KMCA 3NZSA 1L6VA 3APCA 3VTUA 2NR2A 4BBNF 1SB3C 2KMMA 1R4MI 2WXJA 3N1XC 1HEZE 1TZ1A 2KLGA 2KXJA 2D11A 4ZDVA 2ZVOA 1C3TA 1TS4A 1V97A 1NBFC 1WM3A 2MJ3A 4US8A 4J6IA 1T0QC 1UELA 4NAMA 3KWVA 2RR9A 4O1NA 4BKTA 2OEDA 1EM7A 1L0XB 1HTOA 4BOSC 1DYQA 3VQIA 4HROA 4W9EA 1ENFA 3AI5A 3RULA 2K9XA 1Q1OA 5G2NA 1TYGB 2LHEA 3JW0X 1P9DU 2IJ0A 3SU8X 1V80A 2LRWA 4B9KA 4BAXA 2I2YA 2WHIA 3EFCA 1FXIA 3H7PA 2LGXA 3NUHB 2IGGA 4G3XB 1R4NI 4NJ6A 3Q8AA 4P1CC 1AN8A 3RNFC 3AEFB 2C7HA 1UH6A 2QSDA 1QKZA 4GDKB 2Z59B 4GDLB 4KZCA 4Q2JA 1SSNA 2G4SA 4KGRA 5J2RA 1A70A 5D2MB 4JIOU 3SFDB 3Q2AC 1WX9A 4ZOHC 4C7ZA 3HM6X 2CJNA 2LUMA 3H8HA 1IBXA 1N6ZA 3M95A 2INDC 1PQSA 2FNJB 2C7NB 4E3CA 3MHZA 1LM8B 1LGRA 1YJ1A 3BVGA 2K8HA 4LNKA 2BGFA 4BOZB 2O6VA 4KV2A 2IBIB 3DBHI 2KZRA 1XLOA 3TEZA 1FCLA 3UIPB 4MM3A 5BYRA 3H6NA 3AECB 4WAAA 3BYYB 1RYJA 3L0WB 2DENB 1IGDA 4W9LA 1MPEA 2JRHA 3DQVA 1MJDA 3HM3A 3APDA 4MGYE 4NJ7A 1V6EA 2Z0DB 1D5ZC 3UINB 4YTNB 1FPYA 3PREA 2J0MA 2QJLA 2H88B 1Q10A 2MX2A 2NPTA 3JVZX 1MI0A 2NVUI 4KGSA 1ZDVA 1WGHA 3U2SC 4M8NA 2LVOA 3ABVB 4MDKE 4MJSA 2GMIC 2V4IB 3MHSD 3B2FA 2TSSA 4R3DA 1C4CA 3AB5A 3ZDTA 3R7RA 2N1VA 1JW9D 1SXTA 4NZLB 3ZJTA 3AE4B 1TY2A 2B76B 2NMQA 3RI7C 3AMZA 2PVOD 2ZNVC 2NTSA 3Q8FA 4N58A 2LI5A 3W2DA 5HKHA 3OWEB 1IYFA 4ZRJA 2BYVE 1E8XA 1N62A 2WXQA 2R2OA 3AN1A 2INPE 3P4PB 1K50A 2LGIA 2ZCBA 1B9RA 1QOBA 3DVNV 4NPNA 1J8CA 4MH0E 4YXDB 2MLBA 2JX5A 2C7MB 2BYTA 3AE5B 1SGHA 2CU1A 3PSEB 1I4HA 1P1AA 4HK2A 2ACZB 4EOYA 3LXFA 2KJHB 3KQ4A 2JQRB 2KO3A 2M17A 1TGZB 3PV1A 3EFUA 4EE2A 3PZ8A 2N7JA 2XBBC 3AH7A 1CK1A 2WXIA 3Q6BA 2DLBA 2LXAA 3C8YA 4LTUA 4CO7A 4F8CB 2BWES 5DPTA 4FULA 4URKA 1WJUA 1F1HA 3RFZB 2YEPB 4YSZB 2REXA 3ML9A 2N7DA 3B9JA 3PZ7A 2KC1A 1FM0D 3U30A 4XWWA 1FIQA 1D6EC 1WY8A 4X57B 2KFJA 1F2RI 3IT4B 1S1QB 1GJZA 2O2VA 3PT2B 1TJEA 1V1OA 1OQRA 2LJIA 4RM9A 4DXGA 5L83A 1NENB 2KWVB 3B1LX 4JWUC 1RLFA 3PLUA 1MFWA 3AU5A 3QAQA 2KQSA 4AUQC 1DOYA 3N1ZC 3ZQ4A 4PS8A 3MP9A 1QOGA 1V81A 3OLMD 3P42A 2YEPF 2KWDA 4HPMB 5GXGB 1FNWA 3UF8A 3DHGC 4EZLA 2K5PA 2PIAA 2WDTB 3KLSX 2WXOA 5GMVA 3ZO5B 3GE8C 4A9AA 1TKYA 1SJHD 3DBRB 3UGBB 1C79A 2SAKA 1WI0A 2D5GA 2M56B 5CTRC 2V3PA 3A9JB 5H8YE 3GZNI 1I4QA 1SBBB 4DHJB 3ZNID 5AZHA 1EO6A 3U52E 2GBMA 5JHAA 2JVCA 2A5UA 1GPXA 2ONQA 2L00B 2KT7A 2MCNB 4DHZB 4IOIE 2DWQA 4LCDE 1YN3A 4GLSC 1TT5B 4ITKA 4DHJD 5I4DA 1QILA 3SHQA 1E7PB 3RNEC 2LEKA 3QWZB 1Q0WB 1K8RB 1KJTA 2Z8LA 3N30A 1LFDA 1JWAD 4IG7B 1GC6A 3A4SC 2N0SB 5KHOA 3A9KB 1QZEA 2ZNVB 4FHKA 2KN4A 5CHFA 2L76A 3AEEB 1E8WA 1RRBA 4LLGM 3PPAA 3NZUA 3L17A 2XEWA 4HPPA 4F7ZA 4GGQA 4P1BC 2BS4B 3QJZA 4MSQB 4ANWA 3HVZA 1PGXA 1VZ7A 3TEXA 1WGKA 1V1PA 1D5MC 4OVZA 2AL3A 3AM9A 4MELA 5DPWA 4WJNA 1T3QA 3U8ZA 1GOZA 1ISNA 3OJ4B 4BKSA 1SE2A 2MSED 2ZVNA 2MRPA 1SE4A 1FD6A 1JWBD 1STEA 4W9HA 2VH1A 3HUIA 2EELA 4QAYA 3AE6B 3MJ5A 4M0WB 2MBOA 2OJRA 2WXFA 3VR8B 2KFKA 1CQVA 3T3OA 5BMIA 3W1SA 4CHKA 4CQNA 2KDBA 3PZDA 4ASWC 4RF1A 2KNBA 3L54A 4K7SA 1RM6C 5AEKB 4H2AA 1YN5A 4FA6A 1WMHA 3PTFC 3AEDB 3HIZA 1DGJA 2BYEA 4PYUA 1KOTA 1C4PA 4C00A 4ZYNA 2D2QA 4KGTA 3ECIA 4GB9A 3BWUD 4JLCA 5D6JB 2WDRB 1KTKA 2OJWA 2IY0B 3KUZA 3RZFA 2BPSA 3JSVB 2N4FA 2BKRB 3RD2A 3U7DA 4C56C 2BTEA 2L7RA 4ACFA 3P1MA 5G5GA 2JZPA 4KIKB 3MJWA 4N9F4 1YJIA 3ZYYX 1P98A 1T0RC 4HWIB 1JRPA 2JYEA 5IAAC 1T5XD 4YTPB 4HRSA 2XK5A 2W3SA 1GAQB 2LUEA 1T0SC 2ZCCA 2LMCA 2FE8A 4YSYB 4KDLB 2G9HD 2WYQA 4FJYA 1TTNA 3WCQA 1A5RA 3V05A 5D7GA 2Q5WD 4LNOA 1C4AA 2ZPNA 2LJ5A 2UYZB 3RNAC 4B6WA 3FKYA 3Q14C 4WJPA 2Y5CA 3NG0A 5BMHA 3PRZA 1V5TA 1UGJA 3P4SB 1ZGUB 3ZNGC 4EUTA 4P6VF 5EE9A 2X8XX 2L32A 5HG2A 2Z0EB 3PGEA 2AX5A 4F1SA 3AEAB 4A90A 2IDYA 3QHTA 2FAZA 1SF0A 2A4ZA 4FHJA 3B08A 1I4XA 3H7PB 2KN5A 1EU4A 3TEWA 2GB1A 4EZJA 3V62A 3E9SA 2CJOA 4L23A 1ZPSA 3ZTDA 3V61A 3NS1A 1WYWB 3Q3FA 2LGDA 5BYQA 2C5LC 2AQ1B 4A3PA 1I7HA 4AJYB 2IYDB 3TUOA 2LGYA 3DWGC 1IBXB 4HCNB 3TBLD 1P7FA 4E71A 2PE9A 1WXSA 2ZW0A 1L6UA 2QCZA 1WFYA 3ZGZA 1H8CA 2WXHA 2KK8A 4MEMA 3WAOA 1N5XA 4FLHA 2O6VB 3AE1B 2IO2B 5FR3A 2D10A 1Y8RC 3WALA 5BO4B 1AYFA 3P4QB 4ANUA 5LLIA 4K7UA 4MM3B 3KUCB 4NAWB 4ZYSA 2DAJA 4K81A 1R4MB 1YQBA 2O6VD 2QMTA 1NDDA 2W55A 4RH6A 4GOCA 2KKCA 2LVPA 5AZGA 1PYWD 4E74A 2IO1B 3N1YC 3R2TA 1Z5SB 2L05A 4JGHB 5LXIB 1ZKHA 3R7QA 4ZHPA 2EKIA 3APFA 2KJ6A 4G0NB 2RGFA 2FBWB 3K9OB 2WXLA 2WXRA 4ZHOA 2WU2B 4M02A 3AE3B 4MJSB 2MP2A 3KWLA 2BKFA 3URYA 3Q3MC 2ZPYA 4W9DA 5G5HA 2NCNA 3AV8A 3Q8EA 3M62B 2ON8A 3FAHA 4JWSC 3BK2A 5LNK1 2GLSA 2WLBA 3IBEA 4A3OA 1R4NB 2CHXA 5AUKA 2INNE 4PT5A 1KF6B 4OW0A 2M1MA 3WAPA 4WWNA 4HXDA 3NJTA 1HTQA 4MGIE 1ACCA 2J4XA 2BS2B 4RGTA 4K3CA 1J7AA 3A1QA 2IZVB 1M4VA 1RFAA 3KW5B 3ETRA 2KDFB 1M94A 2G3QB 1WRDB 5FKAC 3TSSA 2JRIB 1OQYA 1KFYB 3QX1A 1YQ3B 3OG5A 3TL5A 1G6JA 1GB1A 2KLCA 2M0AA 4IW0A 1YIWA 2W9NA 3CIRB 4C4VB 3TEYA 2XN9C 2GRIA 3SR6A 1P7EA 5TR5A 2KOXA 3IAM1 4CYEA 3P4RB 1VJKA 3DBHB 2PE6B 2HTHA 4A55A 1N60A 3EECA 2G45B 2DZJA 5DCNA 2GBNA 2QC8A 1VDVA 1WH3A 2DYBA 2BS3B 2ASQA 2BW2A 1SE3A 1IP9A 2R61A 2BBCA 2FUG1 2LFIA 4ZRIA 1WF9A 1JMLA 2KTFA 4AOFA 4WJOA 5BMGA 2WXMA 1C78A 1WXAA 1TIFA 1FO4A 1L4DB 3W1SC 2E3TA 2WXPA 4WWMA 5CHVC 3NS8A 5HI1A 1GG3A 3TMPB 1WGRA 4MSMB 3ZJUA 4JQWC 2HD5B 2O2VB 1QLBB 2M19A 3C0RB 3L08A 3B0AA 3J9CA 2C60A 3NHEB 5J17A 1BUIC 1SEBD 2WU5B 1K53A 1ET9A 4WIPA 1F77A 2DAFA 1FFVA 2PTLA 3EGRA 2KQ4X 2L8JA 4XZ4A 3AEGB 2QEJC 4DHZE 5IKCM 4XYCA 3PHWB 2HJ1A 5HHDG 2WX0A 1D4BA 2M8SA 3PLVA 2K22A 2H89B 3K9PB 4WQOB 4IKGA 3IAS1 3Q8BA 3DWMA 3GE3C 3AXCA 4HKQA 4HJGE 1FNVA 3ZRCA 3PRMB 4ARIA 2K6DB 2IO3B 4PS3A 2BT6A 2NS5A 2JU6X 2N9XA 5E6NA 2QHOA 3T3NA 3ZUNA 5BYSA 2WWZA 1VCBA 2UWQA 4XWTA 2LXCA 4ICUA 4ANXA 3ML8A 4KKJA 2E6XA 1ZDXA 2ZW1A 1J0GA 3EHVA 2EMTA 4FJVB 3VRBB 3CMMB 1E8ZA 4N59A 2MBEA 2RD0A 4WWOA 4ZRQA 2JXTA 1HQRD 1KLGD 4DXFA 4I6PA 2N9LA 3ZLZA 2JT4B 3EA6A 3FILA 2KTRA 3NVVA 1C1YB 2MJDA 1F0ZA 4W9FA 1TS5A 2LWPA 4TMAB 1H4RA 3WANA 1FCCC 1I4RA 1XCTL 1Z2MA 2PMVA 3DHIC 1YX6B 3TIXA 3ENEA 1JQ4A 1V1PB 3VFKA 5C23A 4USAA 5IA7A 1V49A 2D3BA 3M63B 3M3JA 2FIDA 2GI9A 2MA9B 2N7EA 3R3MA 3X0WA 4KVGB 4DK5A 2LHDA 1MG4A 2VH2A 4IM2A 4M01A 5EDSA 1WM2A 1N5WA 2J0KA 3MC0B 1XO3A 2IGDA 4YWGG 4G11A 4BKSD 4LNFA 3HRDD 2K8BA 2PKOA 3H9DA 1SJED 1WXQA 3N32A 3Q3JA 4IWOA 3ALBA 3GZNB 3R66C 1D3ZA 3IT6B 3RCZA 4RM8A 4LK0M 2AQ3B 1WJ4A 5JXVA 1ET6A 1VD2A 5DPRA 3Q3OC 1UWMA 2EKEC 2J42A 1E90A 3L16A 1WMHB 2LVQA 5IO9A 2RPQA 4MACA 3QCAA 1KLVA 2V3NA 5T8IA 3O65B 1AW7A 5G55A 3W1YA 4XDCA 1ZXIA 1RWSA 2AYOB 4PS7A 2DZMA 4UDUC 1CZPA 1RAXA 3PVLA 2LGSA 3RNBC 1BT0A 3OAWA 2JUOA 3ZJVA 3RNGC 1EU3A 1I35A 1IUEA 3RUIB 4RFBA 3V60A 2Y5PA 4IWQA 2N9PC 2V1YA 4IM3A 3RZWC 1DOIA 5D3IB 4IWPA 4OZAA 4RGNA 2GOWA 3VH3B 1VLBA 2JXXA 2PPHA 1EUVB 3VRAB 1WR1A 1ROEA 4NY0A 2JZ3B 3GS2A 4LNIA 4ZRKA 2YVCA 2NTTA 4WQMA 3OJ3A 1T6BX 4EFOA 2VRRB 2XK5B 3L13A 2N9KA 3L4PA 2RDGA 1F52A 4IDIA 4M0WA 4WH4A 3WIMA 4KSLC 3GP7A 3AE8B 1WRIA 1XQQA 3KYDD 4AQ7A 1XF5L 3ZNZB 1MHHE 4DBGA 1EF1A 5JHBA 1LO5D 5KHQA 2ZJDA 1PGBA 3QK0A 4II3B 3BVMA 4PYZA 3DBLI 4N6EB 4W9JA 2W54A 1JROA 2FCSA 1HXYD 2ZEQA 1C76A 4REZA 2L52A 3QQ8B 2QDFA 3R8BA 1SE9A 1IPGA 1XLNA 5AUIA 4KDIC 1TKGA 5C1ZA 1E0ZA 2D3AA 1WZ3A 4TV3A 2MBBB 3LDZE 3KYCD 4OVUA 2NBWB 3LJ3A 1VRAB 2INCC 1V86A 2DZIA 2HTME 2KAJA 3N20C 2L3ZA 3MTNB 4M8MA 3ZTCA 1UBQA 3I9V1 1WE7A 3VH4B 4HDOA 2JWUA 3NOBA 1JRUA 2VZKB 3SDLC 4YSXB 1L0VB 2AL6A 2W3RA 5D3DA 2MW5A 3RNCC 3HHMA 4DDGD 2KX0A 4I6NB 4HJKA 2CKHB 3VTWA 4P7IA 1AWDA 2CHWA 2K1FA 2VZKD 1OTRB 2WXGA 4LNNA 3E56A 3C19A 3LYYA 1ZUD2 3CSTA 1ZP0B 2KDEB 2CU3A 1OFFA 1VZ6A 3ZNHB 2Y3AA 2QILA 3H7SA 3IFWB 2IO0B 3A4RA 4HCPB 3Q3NC 3VTVA 1OEYJ 3NZ3A 3AULA 2V9HA 1E8YA 1L0YB 1ZW7A 1J7BA 1UBIA 2PLPA 2N1WA 4GMVA 5FR6A 4BFRA 1ZXHA 2KHWB 1JALA 1I42A 5C3JB 2MQJA 2LZ6A 2YLMA 1QOAA 1WGDA 3P63A 2NBUA 2DYOA 2MJEA 3ZRFA 1E7UA 3HK0A 3VXWA 3AE9B 3UQAA 1YNTE 2PVGC 3IVFA 3NRZA 2WGSA 4FJZA 3ZVVA 2MP2B 4KZ0A 3QC8B 1GNUA 2FIFA 4TQ0A 4YTMB 1WJNA 3QARA 1NYQA 3DDCB 1UD7A 1NI2A 2BF8B 4KX6B 2KWUB 1UUPA 1OEYA 5J18A 1IGCA 4FADA 3DVGY 1DOXA 3DCGA 2NPTB 4XX5A 4RGMA 1E6EB 2J53A 1WIAA 3MC9A 1YN4A 4DQOC 2EMSA 3I57A 1I4PA 2JPHA 3A1QB 4RMAA 2WXKA 4GDKA 1UGMA 2QIEB 4GDLA 2GBRA 2FUHB 2D3CA 2L0FA 2I1KA 4OZCA 3LB8C 1V8CA 2G4DB 4NAWA 2GBKA 2KMAA 5H92C 2RDHA 3RMKC 4W9GA 3HVDA 5C2TB 2BYFA 3P2BA 3CSFA 1SIJA 2DZKA 3AE7B 3U4EG 2RSUA 4A6QA 5LXHA 3W9CB 1WX7A 3O13A 3VDZA 1WE6A 1ESFA 1YQ4B 2AQ2B 1N61A 1V2YA 2FCNA 4B0EA 1F2RC 4EZKA 4M00A 2MEKA 1TS3A 2IGHA 1MHXA 1WJ6A 2W82A 5EE3A 4HKZE 1NYRA 1T0YA 1WXVA 2MBHA 4HVBA 1CMXB 3NVWA 2WDVB 4P16A 4AJWA 1JWSD 3I5JC 3T9LA 3MFGA 4GIVA 1UNSA 1R7SA 1AARA 4ZRPA 2K6QA 1VZ8A 3NY5A 4ANVA 3SEBA 2M0XA 4FXCA 2BB6A 3DBSA 1XLPA 1S3SG 1EWYC 2HE7A 1UWXA 2HDEA 2WDQB 4WJQA 3QA8A 4BKGA 2M4NA 3GB1A 2PJHA 2DNFA 2CR5A 3EC8A 1ZE3D 3L10B 2N9EB 4RNAA 3UIOB 3WAMA 5FK9C 3V6CB 4KSKC 4LJOB 3DHHC 2Y5BB 4C4VA 3ZW3A 2K25A 2NBVB 4JPSA 2CHZA 4WWPA 3W5UB 3VVWB 4K1RB 3RYTA 4W9KA 1QT9A 2K0PA 3ZXRA 3NVYA 3PO0A 2DX5B 4A8XC 3DBRI 1D5XC 2KACA 4RGOS 3BINA 2BB5A 3U7ZA 2LD9A 1J19A 3BZDB 3TCAA 4NJCA 1P0RA 1LXDA 2BQQA 1HZ5A 1J7CA 4GSWA 5AZFA 4I6LB 4EEWA 1XLQA 1TBEA 1WR6E 3VUWA 1E5WA 1BMLC 2C9WB 5IOIA 4YT0B 1YMHE 1SIFA 2JSVX 2ZZPB 3GOEA 4NQKE 1C77A 1WGGA 3FILB 4L2YA 2KTRB 2K3UA 1XEEA 2KJRA 2I1JA 5E6JA 2PW9A 1QQRA 4OVVA 5CHWA 1I4GA 4K3BA 4OHJA 1TZOA 4BVUC 5IP4D 2KWCA 1YX5B 1ZOYB 2KDMA 2FCMA 2B3AA 3DVGX 4XE0A 4LJPB 2JY6A 2KC2A 4YL8A 2DYMA 2KVRA 4JX1C 3SFEB 2KQ7A 3D32A 3I63C 1VR9A 2CS4A 2WNMA 1YJJA 5HFYA 1JWUD 4RCOA 1EWCA 2K8CA 4K7WA 4II2B 3WA0A 4KKIA 4FN2A 4IC7B 3KH0A 1NEKB 4AWJA 1K52A 5L95C 1TS2A 5D94A 3RN9C 4A20A 2MHJA 2D3GA 1E7VA 3PRPB 4GXBA 2MBQA 2LRUA 4WAFA 1NI3A 1KM7A 4BBNC 2OOBB 2R2QA 3PHXB 4HPLB 4EKUA 3BY4B 1WWTA 3ZKJC 3A9JA 1UZXB 3N3KB 4W9IA 1P3QU 3VHTC 3X23A 2BWFA 3VUXA 2DBYA 4HLEA 2RDBC 3DVNU 3DOWA 3ZIMA 3MC8A 1JWMD 2KFKB 1F9JA 1WZ0A 3NVZA 2KVZA 3RPFC 2JYTA 4MGKE 3BK1A 2AWTA 3BIID 2G1EA 1RFKA 1KRHA 1CJEA 1X1MA 5EE0A 1TKEA 1XD3B 1FEHA 1L7YA 3IHPC 4S0RA 1L4ZB 2RPVA 1FRDA 4TUUA 1FXAA 4IUMB 4DWFA 1WSPA 1GUAB 2GBJA 1U4AA 3W5VB 2IPKD 3I3TB 3A9KA 2JWZA 1XXGA 2AEHA 4HDQA 1PUTA 3S2AA 1OGWA 1V9JA 3PS6A 4JL9A 2J0JA 4C7YA 2L1AA 3V6EB 1MVKA 3JYUA 4XGAB 3R2IA 2K39A 1BXTA 2RMMA 2WP9B 2KDIA 2KANA 4J3OD 4B0MA 3B2GA 1FFUA 1GC7A 2V3SA 3Q8CA 4TKNA 3EUB2 1QF6A 4US9A 2HJ8A 1KH0A 1YOVB 3RT3B 1EF5A 3CF6E 2L83A 1C9FA 2WX1A 3DPDA 1XCQL 1B1ZA 3TJPA 3BVZA 3ZDMC 1FRRA 1E9MA 1FXTB 3VR9B 2XNAC 4ARCA 2DHZA 1N63A 4LDTB 1QOFA 3KVFB 3N9YC 1L5PA 2UU7A 2IY1B 4HEA1 2ICIA 1L2NA 4DDID 4AS1A 1JCKB 2MWSB 3AE2B 4LDTD 1V5OA 3IG3A 2KD0A 4B95A 4XDDA 4XC2A 1WX8A 3IXSA 1TY0A 2JZZA 1HA5A 5CX3A 2WS3B 2J7QB 3T8MA 2WXNA 3KUDB 3SD5A 3AEBB 3ONSA 1Q5WB 4S17A 4W9CA 2V4LA 1XT9B 1WXMA 1PDXA 1KLUD 2JF5A 2X38A 4AP4C 3UI3A 1HE8A 3QIJA 4RF0A 5E6OA 1FNUA 1UF0A 3FC4A 2V0GA 1YD8U 1GB4A 4L1BA 1PFDA 4JE3B 3ZXVA 1WGYA 4WURA 4D2KA 2L0TA 3Q69A 5MPOA 2MH7A 3CWIA 1K51A 4ICVA 1Y56A 4NQLB 3A33B 5IN7A 3V3XA 4NNJB 3JSVA 2BVCA 4GN1A 1MG8A 1HZ6A 4GU2A 1PGAA 5JZEB 1LQBA 4PK1A 2OHFA 2J52A 2PEAA 1E10A 4KIKA 4OZBA 2FCQA 3VAWA 4G50A 5DPSA 3UQBA 4C80A 5E6PA 3AU4A 5EE1A 3H1UA 4BZAA 3BYTB 1WYGA 4FBJB 2KYWA 5TSSA 3VUYA 4MGZE 2I38A 4MH8A
chains in the Genus database with same CATH topology
4TQ1A 4W9GA 3ZRCA 4DXAB 3PRMB 2D07B 5JH5C 2KX3A 2BYFA 2K6DB 3P2BA 4W9HA 2IO3B 4PS3A 3CSFA 2NS5A 2DZKA 2N9XA 5E6NA 2QHOA 2RSUA 4IM0A 5LXHA 4M0WB 3ZUNA 1WX7A 2LASA 2MBOA 2OJRA 2WWZA 2KFKA 3NZSA 2KMCA 1VCBA 3APCA 3VTUA 2UWQA 2NR2A 4BBNF 1R4MI 1WE6A 3VDZA 2LXCA 4ICUA 1TZ1A 1V2YA 2KLGA 2KXJA 3W1SA 2D11A 4CHKA 2FCNA 3ML8A 2ZVOA 4ANXA 4EZKA 4ZDVA 2KDBA 1C3TA 3PZDA 4ASWC 2KNBA 1WJ6A 1J0GA 1NBFC 1WM3A 3EHVA 2EMTA 3L54A 4FJVB 4K7SA 4J6IA 1UELA 3CMMB 1T0YA 1E8ZA 1WXVA 5AEKB 2MBEA 2MBHA 4HVBA 4FA6A 2RD0A 2RR9A 4WWOA 1CMXB 1WMHA 4BKTA 3PTFC 4BOSC 3VQIA 4AJWA 4W9EA 3HIZA 3RULA 3AI5A 3T9LA 4I6PA 2BYEA 1Q1OA 3ZLZA 4PYUA 2JT4B 4GIVA 5G2NA 1KOTA 1AARA 2KTRA 2K6QA 3JW0X 1P9DU 1C1YB 4ZYNA 2D2QA 3NY5A 3ECIA 4GB9A 3SU8X 4ANVA 2M0XA 1V80A 4JLCA 4W9FA 5D6JB 3DBSA 2LRWA 4B9KA 1S3SG 2HE7A 2LWPA 3H7PA 2IY0B 1H4RA 3KUZA 2BPSA 3RZFA 3WANA 3JSVB 2LGXA 2N4FA 4G3XB 4WJQA 3QA8A 4BKGA 1Z2MA 1R4NI 2M4NA 2PJHA 2BKRB 4NJ6A 1YX6B 3RD2A 3TIXA 3ENEA 2CR5A 3EC8A 3L10B 2C7HA 3U7DA 1UH6A 5C23A 3VFKA 5IA7A 4GDKB 1V49A 2L7RA 2N9EB 2Z59B 4GDLB 2G4SA 4KZCA 3UIOB 3M63B 3WAMA 4KIKB 3MJWA 3M3JA 4N9F4 2FIDA 4KSKC 2MA9B 2N7EA 4LJOB 4JIOU 5D2MB 3V6CB 5J2RA 3R3MA 3X0WA 2Y5BB 4KVGB 1P98A 4HWIB 1WX9A 3ZW3A 4DK5A 5IAAC 3HM6X 2K25A 2NBVB 3M95A 2CHZA 4WWPA 1PQSA 2XK5A 2FNJB 2C7NB 4E3CA 3VVWB 4K1RB 2LUEA 3RYTA 1LM8B 4IM2A 2ZCCA 4W9KA 1YJ1A 4KDLB 5EDSA 1WM2A 2WYQA 2K8HA 4FJYA 1TTNA 2J0KA 2DX5B 1A5RA 5D7GA 2BGFA 4G11A 4BOZB 4BKSD 2O6VA 3DBRI 2ZPNA 2LJ5A 2UYZB 3BINA 2K8BA 3H9DA 4KV2A 4IWOA 3N32A 3Q3JA 4B6WA 2LD9A 3ALBA 1J19A 3R66C 2IBIB 3DBHI 3TCAA 1D3ZA 3RCZA 4RM8A 4WJPA 2KZRA 1P0RA 1LXDA 1WJ4A 4MM3A 3UIPB 3H6NA 3PRZA 4GSWA 4WAAA 5AZFA 4I6LB 1VD2A 5DPRA 1V5TA 4EEWA 3L0WB 2DENB 1TBEA 4W9LA 1WR6E 2JRHA 3DQVA 2EKEC 1ZGUB 3VUWA 1E5WA 3ZNGC 4EUTA 3HM3A 2C9WB 1E90A 3L16A 1WMHB 3APDA 2LVQA 4MGYE 4NJ7A 2RPQA 1V6EA 2Z0DB 3QCAA 3UINB 1KLVA 3PREA 2Z0EB 3O65B 2J0MA 3PGEA 1SIFA 2ZZPB 3GOEA 4NQKE 1WGGA 5G55A 3W1YA 4F1SA 2MX2A 2NPTA 2KTRB 3JVZX 2NVUI 2AYOB 4PS7A 2DZMA 1WGHA 1RAXA 3QHTA 2KJRA 4M8NA 2I1JA 2LVOA 3PVLA 4MDKE 2FAZA 1BT0A 3OAWA 2A4ZA 2JUOA 4FHJA 4MJSA 3B08A 3H7PB 2GMIC 4OVVA 3MHSD 5CHWA 2KN5A 1I35A 3RUIB 3V60A 4IWQA 2N9PC 2V1YA 4IM3A 3V62A 4EZJA 3RZWC 4BVUC 2KWCA 1YX5B 4IWPA 3ZDTA 2FCMA 2B3AA 3DVGX 3R7RA 2N1VA 4LJPB 2GOWA 3ZTDA 3V61A 3VH3B 2JY6A 2KC2A 4YL8A 1WYWB 3Q3FA 2DYMA 2LGDA 2JXXA 2PPHA 1EUVB 2C5LC 1WR1A 2KVRA 4NY0A 2JZ3B 2KQ7A 4A3PA 4AJYB 3D32A 2IYDB 4ZRKA 2YVCA 2LGYA 4HCNB 2CS4A 3OJ3A 4EFOA 2ZNVC 2VRRB 2XK5B 3TBLD 3L13A 4E71A 2LI5A 2PE9A 1WXSA 3WA0A 2K8CA 4K7WA 4II2B 1WFYA 4FN2A 4IC7B 3KH0A 5HKHA 3WIMA 4KSLC 4AWJA 1IYFA 2KK8A 4MEMA 3WAOA 5L95C 4ZRJA 1H8CA 2BYVE 1E8XA 5D94A 2R2OA 1XQQA 3KYDD 4A20A 4FLHA 2O6VB 2D3GA 2ZCBA 1E7VA 3ZNZB 3PRPB 4GXBA 2IO2B 2MBQA 2LRUA 4DBGA 1EF1A 5JHBA 2D10A 1Y8RC 3WALA 5BO4B 3DVNV 1KM7A 4NPNA 4BBNC 5KHQA 4ANUA 1J8CA 2ZJDA 4MH0E 2MLBA 2OOBB 2R2QA 3QK0A 4II3B 5LLIA 3PHXB 4HPLB 4K7UA 4PYZA 3DBLI 4W9JA 4EKUA 3KUCB 4NAWB 2C7MB 2FCSA 2DAJA 3BY4B 4K81A 3ZKJC 1SGHA 1YQBA 2O6VD 2ZEQA 2CU1A 3PSEB 3A9JA 1P1AA 1UZXB 1NDDA 3QQ8B 4HK2A 3N3KB 4W9IA 4EOYA 1SE9A 1P3QU 2KJHB 3VHTC 3X23A 2BWFA 4GOCA 1IPGA 3VUXA 4HLEA 3DVNU 2KKCA 2LVPA 3DOWA 4KDIC 3ZIMA 5C1ZA 5AZGA 2KO3A 1WZ3A 1F9JA 2KFKB 1TGZB 2M17A 4E74A 3PV1A 2IO1B 4TV3A 1WZ0A 2MBBB 3EFUA 3LDZE 1Z5SB 2L05A 4JGHB 5LXIB 1ZKHA 3KYCD 3R7QA 4MGKE 2XBBC 4OVUA 2AWTA 2NBWB 3APFA 2KJ6A 4G0NB 3LJ3A 1V86A 2RGFA 2LXAA 3K9OB 2DZIA 4CO7A 4F8CB 1X1MA 2BWES 5DPTA 4FULA 4MJSB 4URKA 1XD3B 2MP2A 1L7YA 1WJUA 2L3ZA 2BKFA 3MTNB 4M8MA 3ZTCA 3IHPC 1UBQA 4TUUA 1WE7A 2ZPYA 2REXA 4IUMB 3ML9A 2N7DA 4W9DA 3VH4B 4DWFA 2KC1A 3U30A 4HDOA 1GUAB 2GBJA 2NCNA 1U4AA 3NOBA 1WY8A 1JRUA 3I3TB 3A9KA 2JWZA 3M62B 4X57B 3SDLC 2KFJA 2AEHA 2AL6A 4HDQA 2MW5A 3HHMA 3IBEA 4A3OA 4DDGD 2CHXA 2KX0A 3S2AA 1S1QB 1GJZA 2O2VA 4I6NB 1OGWA 4HJKA 2CKHB 3VTWA 2M1MA 3PT2B 4P7IA 1V9JA 3PS6A 4JL9A 3WAPA 4WWNA 2J0JA 4HXDA 2CHWA 2K1FA 4RM9A 3V6EB 5L83A 3JYUA 1OTRB 2KWVB 4MGIE 3B1LX 2K39A 1RLFA 3CSTA 2KDEB 2KDIA 3A1QA 2KANA 3PLUA 2IZVB 3AU5A 1GC7A 2V3SA 3QAQA 4TKNA 1RFAA 3ZNHB 2KQSA 4AUQC 3KW5B 2HJ8A 3RT3B 1EF5A 3CF6E 4PS8A 2KDFB 3H7SA 1M94A 2G3QB 1V81A 1WRDB 3IFWB 3OLMD 2JRIB 1OQYA 4HPMB 2WX1A 2IO0B 3A4RA 3DPDA 3UF8A 3QX1A 4HCPB 3TL5A 3VTVA 3TJPA 4EZLA 1G6JA 2WDTB 3ZDMC 1OEYJ 2KLCA 3AULA 1FXTB 1E8YA 5GMVA 4IW0A 3ZO5B 1YIWA 1ZW7A 2DHZA 2W9NA 4LDTB 3KVFB 1UBIA 3UGBB 2IY1B 5TR5A 2N1WA 2KOXA 4GMVA 5FR6A 1WI0A 4BFRA 2KHWB 4CYEA 1I42A 5CTRC 3A9JB 3GZNI 2MQJA 2PE6B 4DHJB 2LZ6A 1L2NA 2YLMA 3ZNID 4DDID 2HTHA 5AZHA 1EO6A 1WGDA 2GBMA 3EECA 2JVCA 5JHAA 2G45B 2NBUA 2MWSB 2DZJA 5DCNA 2A5UA 4LDTD 1V5OA 2DYOA 2GBNA 3ZRFA 3IG3A 2KD0A 4B95A 2L00B 2DYBA 1WH3A 2MCNB 4DHZB 2ASQA 4XC2A 1E7UA 1WX8A 3HK0A 3VXWA 4LCDE 2JZZA 1IP9A 3UQAA 5CX3A 2J7QB 4DHJD 3T8MA 3KUDB 4ZRIA 3IVFA 3SD5A 3ONSA 3SHQA 1Q5WB 1WF9A 4W9CA 4FJZA 3ZVVA 2MP2B 4KZ0A 3QC8B 2KTFA 2V4LA 1GNUA 1XT9B 4WJOA 4AOFA 1WXMA 1Q0WB 1K8RB 1KJTA 2FIFA 3QWZB 1WXAA 3N30A 1WJNA 4TQ0A 1LFDA 2JF5A 3QARA 3W1SC 4IG7B 3DDCB 4AP4C 1HE8A 3QIJA 1UD7A 1GC6A 3A4SC 1NI2A 2BF8B 5KHOA 3A9KB 5E6OA 2KWUB 5CHVC 1QZEA 2ZNVB 3NS8A 1YD8U 4FHKA 5CHFA 1OEYA 2L76A 1GG3A 3TMPB 1E8WA 1WGRA 1WGYA 4MSMB 5J18A 1RRBA 4FADA 3PPAA 2L0TA 4JQWC 3DVGY 2HD5B 2O2VB 3DCGA 3NZUA 2NPTB 4ICVA 4XX5A 3L17A 4NQLB 3C0RB 2XEWA 3L08A 3B0AA 4F7ZA 3A33B 4GGQA 2C60A 1WIAA 3NHEB 5J17A 2EMSA 4NNJB 3JSVA 3QJZA 4GN1A 4MSQB 2DAFA 2JPHA 1MG8A 4ANWA 4GU2A 5JZEB 3A1QB 2L8JA 4XZ4A 4RMAA 1LQBA 4DHZE 4GDKA 2PEAA 1UGMA 4GDLA 2GBRA 2AL3A 3PHWB 2FUHB 4KIKA 4MELA 2WX0A 2FCQA 3VAWA 4G50A 5DPWA 5DPSA 2M8SA 3PLVA 4WJNA 3UQBA 2L0FA 3K9PB 5E6PA 2I1KA 4WQOB 3AU4A 3U8ZA 1ISNA 3H1UA 4FBJB 2G4DB 3OJ4B 4NAWA 3AXCA 4BKSA 2GBKA 2KMAA 3VUYA 2MSED 2ZVNA 4MGZE 2MRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TQ1 A;  4W9G A;  3ZRC A;  4DXA B;  3PRM B;  2D07 B;  5JH5 C;  2KX3 A;  2BYF A;  2K6D B;  3P2B A;  4W9H A;  2IO3 B;  4PS3 A;  3CSF A;  2NS5 A;  2DZK A;  2N9X A;  5E6N A;  2QHO A;  2RSU A;  4IM0 A;  5LXH A;  4M0W B;  3ZUN A;  1WX7 A;  2LAS A;  2MBO A;  2OJR A;  2WWZ A;  2KFK A;  3NZS A;  2KMC A;  1VCB A;  3APC A;  3VTU A;  2UWQ A;  2NR2 A;  4BBN F;  1R4M I;  1WE6 A;  3VDZ A;  2LXC A;  4ICU A;  1TZ1 A;  1V2Y A;  2KLG A;  2KXJ A;  3W1S A;  2D11 A;  4CHK A;  2FCN A;  3ML8 A;  2ZVO A;  4ANX A;  4EZK A;  4ZDV A;  2KDB A;  1C3T A;  3PZD A;  4ASW C;  2KNB A;  1WJ6 A;  1J0G A;  1NBF C;  1WM3 A;  3EHV A;  2EMT A;  3L54 A;  4FJV B;  4K7S A;  4J6I A;  1UEL A;  3CMM B;  1T0Y A;  1E8Z A;  1WXV A;  5AEK B;  2MBE A;  2MBH A;  4HVB A;  4FA6 A;  2RD0 A;  2RR9 A;  4WWO A;  1CMX B;  1WMH A;  4BKT A;  3PTF C;  4BOS C;  3VQI A;  4AJW A;  4W9E A;  3HIZ A;  3RUL A;  3AI5 A;  3T9L A;  4I6P A;  2BYE A;  1Q1O A;  3ZLZ A;  4PYU A;  2JT4 B;  4GIV A;  5G2N A;  1KOT A;  1AAR A;  2KTR A;  2K6Q A;  3JW0 X;  1P9D U;  1C1Y B;  4ZYN A;  2D2Q A;  3NY5 A;  3ECI A;  4GB9 A;  3SU8 X;  4ANV A;  2M0X A;  1V80 A;  4JLC A;  4W9F A;  5D6J B;  3DBS A;  2LRW A;  4B9K A;  1S3S G;  2HE7 A;  2LWP A;  3H7P A;  2IY0 B;  1H4R A;  3KUZ A;  2BPS A;  3RZF A;  3WAN A;  3JSV B;  2LGX A;  2N4F A;  4G3X B;  4WJQ A;  3QA8 A;  4BKG A;  1Z2M A;  1R4N I;  2M4N A;  2PJH A;  2BKR B;  4NJ6 A;  1YX6 B;  3RD2 A;  3TIX A;  3ENE A;  2CR5 A;  3EC8 A;  3L10 B;  2C7H A;  3U7D A;  1UH6 A;  5C23 A;  3VFK A;  5IA7 A;  4GDK B;  1V49 A;  2L7R A;  2N9E B;  2Z59 B;  4GDL B;  2G4S A;  4KZC A;  3UIO B;  3M63 B;  3WAM A;  4KIK B;  3MJW A;  3M3J A;  4N9F 4;  2FID A;  4KSK C;  2MA9 B;  2N7E A;  4LJO B;  4JIO U;  5D2M B;  3V6C B;  5J2R A;  3R3M A;  3X0W A;  2Y5B B;  4KVG B;  1P98 A;  4HWI B;  1WX9 A;  3ZW3 A;  4DK5 A;  5IAA C;  3HM6 X;  2K25 A;  2NBV B;  3M95 A;  2CHZ A;  4WWP A;  1PQS A;  2XK5 A;  2FNJ B;  2C7N B;  4E3C A;  3VVW B;  4K1R B;  2LUE A;  3RYT A;  1LM8 B;  4IM2 A;  2ZCC A;  4W9K A;  1YJ1 A;  4KDL B;  5EDS A;  1WM2 A;  2WYQ A;  2K8H A;  4FJY A;  1TTN A;  2J0K A;  2DX5 B;  1A5R A;  5D7G A;  2BGF A;  4G11 A;  4BOZ B;  4BKS D;  2O6V A;  3DBR I;  2ZPN A;  2LJ5 A;  2UYZ B;  3BIN A;  2K8B A;  3H9D A;  4KV2 A;  4IWO A;  3N32 A;  3Q3J A;  4B6W A;  2LD9 A;  3ALB A;  1J19 A;  3R66 C;  2IBI B;  3DBH I;  3TCA A;  1D3Z A;  3RCZ A;  4RM8 A;  4WJP A;  2KZR A;  1P0R A;  1LXD A;  1WJ4 A;  4MM3 A;  3UIP B;  3H6N A;  3PRZ A;  4GSW A;  4WAA A;  5AZF A;  4I6L B;  1VD2 A;  5DPR A;  1V5T A;  4EEW A;  3L0W B;  2DEN B;  1TBE A;  4W9L A;  1WR6 E;  2JRH A;  3DQV A;  2EKE C;  1ZGU B;  3VUW A;  1E5W A;  3ZNG C;  4EUT A;  3HM3 A;  2C9W B;  1E90 A;  3L16 A;  1WMH B;  3APD A;  2LVQ A;  4MGY E;  4NJ7 A;  2RPQ A;  1V6E A;  2Z0D B;  3QCA A;  3UIN B;  1KLV A;  3PRE A;  2Z0E B;  3O65 B;  2J0M A;  3PGE A;  1SIF A;  2ZZP B;  3GOE A;  4NQK E;  1WGG A;  5G55 A;  3W1Y A;  4F1S A;  2MX2 A;  2NPT A;  2KTR B;  3JVZ X;  2NVU I;  2AYO B;  4PS7 A;  2DZM A;  1WGH A;  1RAX A;  3QHT A;  2KJR A;  4M8N A;  2I1J A;  2LVO A;  3PVL A;  4MDK E;  2FAZ A;  1BT0 A;  3OAW A;  2A4Z A;  2JUO A;  4FHJ A;  4MJS A;  3B08 A;  3H7P B;  2GMI C;  4OVV A;  3MHS D;  5CHW A;  2KN5 A;  1I35 A;  3RUI B;  3V60 A;  4IWQ A;  2N9P C;  2V1Y A;  4IM3 A;  3V62 A;  4EZJ A;  3RZW C;  4BVU C;  2KWC A;  1YX5 B;  4IWP A;  3ZDT A;  2FCM A;  2B3A A;  3DVG X;  3R7R A;  2N1V A;  4LJP B;  2GOW A;  3ZTD A;  3V61 A;  3VH3 B;  2JY6 A;  2KC2 A;  4YL8 A;  1WYW B;  3Q3F A;  2DYM A;  2LGD A;  2JXX A;  2PPH A;  1EUV B;  2C5L C;  1WR1 A;  2KVR A;  4NY0 A;  2JZ3 B;  2KQ7 A;  4A3P A;  4AJY B;  3D32 A;  2IYD B;  4ZRK A;  2YVC A;  2LGY A;  4HCN B;  2CS4 A;  3OJ3 A;  4EFO A;  2ZNV C;  2VRR B;  2XK5 B;  3TBL D;  3L13 A;  4E71 A;  2LI5 A;  2PE9 A;  1WXS A;  3WA0 A;  2K8C A;  4K7W A;  4II2 B;  1WFY A;  4FN2 A;  4IC7 B;  3KH0 A;  5HKH A;  3WIM A;  4KSL C;  4AWJ A;  1IYF A;  2KK8 A;  4MEM A;  3WAO A;  5L95 C;  4ZRJ A;  1H8C A;  2BYV E;  1E8X A;  5D94 A;  2R2O A;  1XQQ A;  3KYD D;  4A20 A;  4FLH A;  2O6V B;  2D3G A;  2ZCB A;  1E7V A;  3ZNZ B;  3PRP B;  4GXB A;  2IO2 B;  2MBQ A;  2LRU A;  4DBG A;  1EF1 A;  5JHB A;  2D10 A;  1Y8R C;  3WAL A;  5BO4 B;  3DVN V;  1KM7 A;  4NPN A;  4BBN C;  5KHQ A;  4ANU A;  1J8C A;  2ZJD A;  4MH0 E;  2MLB A;  2OOB B;  2R2Q A;  3QK0 A;  4II3 B;  5LLI A;  3PHX B;  4HPL B;  4K7U A;  4PYZ A;  3DBL I;  4W9J A;  4EKU A;  3KUC B;  4NAW B;  2C7M B;  2FCS A;  2DAJ A;  3BY4 B;  4K81 A;  3ZKJ C;  1SGH A;  1YQB A;  2O6V D;  2ZEQ A;  2CU1 A;  3PSE B;  3A9J A;  1P1A A;  1UZX B;  1NDD A;  3QQ8 B;  4HK2 A;  3N3K B;  4W9I A;  4EOY A;  1SE9 A;  1P3Q U;  2KJH B;  3VHT C;  3X23 A;  2BWF A;  4GOC A;  1IPG A;  3VUX A;  4HLE A;  3DVN U;  2KKC A;  2LVP A;  3DOW A;  4KDI C;  3ZIM A;  5C1Z A;  5AZG A;  2KO3 A;  1WZ3 A;  1F9J A;  2KFK B;  1TGZ B;  2M17 A;  4E74 A;  3PV1 A;  2IO1 B;  4TV3 A;  1WZ0 A;  2MBB B;  3EFU A;  3LDZ E;  1Z5S B;  2L05 A;  4JGH B;  5LXI B;  1ZKH A;  3KYC D;  3R7Q A;  4MGK E;  2XBB C;  4OVU A;  2AWT A;  2NBW B;  3APF A;  2KJ6 A;  4G0N B;  3LJ3 A;  1V86 A;  2RGF A;  2LXA A;  3K9O B;  2DZI A;  4CO7 A;  4F8C B;  1X1M A;  2BWE S;  5DPT A;  4FUL A;  4MJS B;  4URK A;  1XD3 B;  2MP2 A;  1L7Y A;  1WJU A;  2L3Z A;  2BKF A;  3MTN B;  4M8M A;  3ZTC A;  3IHP C;  1UBQ A;  4TUU A;  1WE7 A;  2ZPY A;  2REX A;  4IUM B;  3ML9 A;  2N7D A;  4W9D A;  3VH4 B;  4DWF A;  2KC1 A;  3U30 A;  4HDO A;  1GUA B;  2GBJ A;  2NCN A;  1U4A A;  3NOB A;  1WY8 A;  1JRU A;  3I3T B;  3A9K A;  2JWZ A;  3M62 B;  4X57 B;  3SDL C;  2KFJ A;  2AEH A;  2AL6 A;  4HDQ A;  2MW5 A;  3HHM A;  3IBE A;  4A3O A;  4DDG D;  2CHX A;  2KX0 A;  3S2A A;  1S1Q B;  1GJZ A;  2O2V A;  4I6N B;  1OGW A;  4HJK A;  2CKH B;  3VTW A;  2M1M A;  3PT2 B;  4P7I A;  1V9J A;  3PS6 A;  4JL9 A;  3WAP A;  4WWN A;  2J0J A;  4HXD A;  2CHW A;  2K1F A;  4RM9 A;  3V6E B;  5L83 A;  3JYU A;  1OTR B;  2KWV B;  4MGI E;  3B1L X;  2K39 A;  1RLF A;  3CST A;  2KDE B;  2KDI A;  3A1Q A;  2KAN A;  3PLU A;  2IZV B;  3AU5 A;  1GC7 A;  2V3S A;  3QAQ A;  4TKN A;  1RFA A;  3ZNH B;  2KQS A;  4AUQ C;  3KW5 B;  2HJ8 A;  3RT3 B;  1EF5 A;  3CF6 E;  4PS8 A;  2KDF B;  3H7S A;  1M94 A;  2G3Q B;  1V81 A;  1WRD B;  3IFW B;  3OLM D;  2JRI B;  1OQY A;  4HPM B;  2WX1 A;  2IO0 B;  3A4R A;  3DPD A;  3UF8 A;  3QX1 A;  4HCP B;  3TL5 A;  3VTV A;  3TJP A;  4EZL A;  1G6J A;  2WDT B;  3ZDM C;  1OEY J;  2KLC A;  3AUL A;  1FXT B;  1E8Y A;  5GMV A;  4IW0 A;  3ZO5 B;  1YIW A;  1ZW7 A;  2DHZ A;  2W9N A;  4LDT B;  3KVF B;  1UBI A;  3UGB B;  2IY1 B;  5TR5 A;  2N1W A;  2KOX A;  4GMV A;  5FR6 A;  1WI0 A;  4BFR A;  2KHW B;  4CYE A;  1I42 A;  5CTR C;  3A9J B;  3GZN I;  2MQJ A;  2PE6 B;  4DHJ B;  2LZ6 A;  1L2N A;  2YLM A;  3ZNI D;  4DDI D;  2HTH A;  5AZH A;  1EO6 A;  1WGD A;  2GBM A;  3EEC A;  2JVC A;  5JHA A;  2G45 B;  2NBU A;  2MWS B;  2DZJ A;  5DCN A;  2A5U A;  4LDT D;  1V5O A;  2DYO A;  2GBN A;  3ZRF A;  3IG3 A;  2KD0 A;  4B95 A;  2L00 B;  2DYB A;  1WH3 A;  2MCN B;  4DHZ B;  2ASQ A;  4XC2 A;  1E7U A;  1WX8 A;  3HK0 A;  3VXW A;  4LCD E;  2JZZ A;  1IP9 A;  3UQA A;  5CX3 A;  2J7Q B;  4DHJ D;  3T8M A;  3KUD B;  4ZRI A;  3IVF A;  3SD5 A;  3ONS A;  3SHQ A;  1Q5W B;  1WF9 A;  4W9C A;  4FJZ A;  3ZVV A;  2MP2 B;  4KZ0 A;  3QC8 B;  2KTF A;  2V4L A;  1GNU A;  1XT9 B;  4WJO A;  4AOF A;  1WXM A;  1Q0W B;  1K8R B;  1KJT A;  2FIF A;  3QWZ B;  1WXA A;  3N30 A;  1WJN A;  4TQ0 A;  1LFD A;  2JF5 A;  3QAR A;  3W1S C;  4IG7 B;  3DDC B;  4AP4 C;  1HE8 A;  3QIJ A;  1UD7 A;  1GC6 A;  3A4S C;  1NI2 A;  2BF8 B;  5KHO A;  3A9K B;  5E6O A;  2KWU B;  5CHV C;  1QZE A;  2ZNV B;  3NS8 A;  1YD8 U;  4FHK A;  5CHF A;  1OEY A;  2L76 A;  1GG3 A;  3TMP B;  1E8W A;  1WGR A;  1WGY A;  4MSM B;  5J18 A;  1RRB A;  4FAD A;  3PPA A;  2L0T A;  4JQW C;  3DVG Y;  2HD5 B;  2O2V B;  3DCG A;  3NZU A;  2NPT B;  4ICV A;  4XX5 A;  3L17 A;  4NQL B;  3C0R B;  2XEW A;  3L08 A;  3B0A A;  4F7Z A;  3A33 B;  4GGQ A;  2C60 A;  1WIA A;  3NHE B;  5J17 A;  2EMS A;  4NNJ B;  3JSV A;  3QJZ A;  4GN1 A;  4MSQ B;  2DAF A;  2JPH A;  1MG8 A;  4ANW A;  4GU2 A;  5JZE B;  3A1Q B;  2L8J A;  4XZ4 A;  4RMA A;  1LQB A;  4DHZ E;  4GDK A;  2PEA A;  1UGM A;  4GDL A;  2GBR A;  2AL3 A;  3PHW B;  2FUH B;  4KIK A;  4MEL A;  2WX0 A;  2FCQ A;  3VAW A;  4G50 A;  5DPW A;  5DPS A;  2M8S A;  3PLV A;  4WJN A;  3UQB A;  2L0F A;  3K9P B;  5E6P A;  2I1K A;  4WQO B;  3AU4 A;  3U8Z A;  1ISN A;  3H1U A;  4FBJ B;  2G4D B;  3OJ4 B;  4NAW A;  3AXC A;  4BKS A;  2GBK A;  2KMA A;  3VUY A;  2MSE D;  2ZVN A;  4MGZ E;  2MRP A; 
#chains in the Genus database with same CATH topology
 1FMA D;  4TQ1 A;  4DXA B;  1NVI D;  1OQQ A;  2D07 B;  2SEB D;  5JH5 C;  2KX3 A;  4MT5 A;  4IM0 A;  2LAS A;  3DBL B;  4TSS A;  2WQY B;  2KMC A;  3NZS A;  1L6V A;  3APC A;  3VTU A;  2NR2 A;  4BBN F;  1SB3 C;  2KMM A;  1R4M I;  2WXJ A;  3N1X C;  1HEZ E;  1TZ1 A;  2KLG A;  2KXJ A;  2D11 A;  4ZDV A;  2ZVO A;  1C3T A;  1TS4 A;  1V97 A;  1NBF C;  1WM3 A;  2MJ3 A;  4US8 A;  4J6I A;  1T0Q C;  1UEL A;  4NAM A;  3KWV A;  2RR9 A;  4O1N A;  4BKT A;  2OED A;  1EM7 A;  1L0X B;  1HTO A;  4BOS C;  1DYQ A;  3VQI A;  4HRO A;  4W9E A;  1ENF A;  3AI5 A;  3RUL A;  2K9X A;  1Q1O A;  5G2N A;  1TYG B;  2LHE A;  3JW0 X;  1P9D U;  2IJ0 A;  3SU8 X;  1V80 A;  2LRW A;  4B9K A;  4BAX A;  2I2Y A;  2WHI A;  3EFC A;  1FXI A;  3H7P A;  2LGX A;  3NUH B;  2IGG A;  4G3X B;  1R4N I;  4NJ6 A;  3Q8A A;  4P1C C;  1AN8 A;  3RNF C;  3AEF B;  2C7H A;  1UH6 A;  2QSD A;  1QKZ A;  4GDK B;  2Z59 B;  4GDL B;  4KZC A;  4Q2J A;  1SSN A;  2G4S A;  4KGR A;  5J2R A;  1A70 A;  5D2M B;  4JIO U;  3SFD B;  3Q2A C;  1WX9 A;  4ZOH C;  4C7Z A;  3HM6 X;  2CJN A;  2LUM A;  3H8H A;  1IBX A;  1N6Z A;  3M95 A;  2IND C;  1PQS A;  2FNJ B;  2C7N B;  4E3C A;  3MHZ A;  1LM8 B;  1LGR A;  1YJ1 A;  3BVG A;  2K8H A;  4LNK A;  2BGF A;  4BOZ B;  2O6V A;  4KV2 A;  2IBI B;  3DBH I;  2KZR A;  1XLO A;  3TEZ A;  1FCL A;  3UIP B;  4MM3 A;  5BYR A;  3H6N A;  3AEC B;  4WAA A;  3BYY B;  1RYJ A;  3L0W B;  2DEN B;  1IGD A;  4W9L A;  1MPE A;  2JRH A;  3DQV A;  1MJD A;  3HM3 A;  3APD A;  4MGY E;  4NJ7 A;  1V6E A;  2Z0D B;  1D5Z C;  3UIN B;  4YTN B;  1FPY A;  3PRE A;  2J0M A;  2QJL A;  2H88 B;  1Q10 A;  2MX2 A;  2NPT A;  3JVZ X;  1MI0 A;  2NVU I;  4KGS A;  1ZDV A;  1WGH A;  3U2S C;  4M8N A;  2LVO A;  3ABV B;  4MDK E;  4MJS A;  2GMI C;  2V4I B;  3MHS D;  3B2F A;  2TSS A;  4R3D A;  1C4C A;  3AB5 A;  3ZDT A;  3R7R A;  2N1V A;  1JW9 D;  1SXT A;  4NZL B;  3ZJT A;  3AE4 B;  1TY2 A;  2B76 B;  2NMQ A;  3RI7 C;  3AMZ A;  2PVO D;  2ZNV C;  2NTS A;  3Q8F A;  4N58 A;  2LI5 A;  3W2D A;  5HKH A;  3OWE B;  1IYF A;  4ZRJ A;  2BYV E;  1E8X A;  1N62 A;  2WXQ A;  2R2O A;  3AN1 A;  2INP E;  3P4P B;  1K50 A;  2LGI A;  2ZCB A;  1B9R A;  1QOB A;  3DVN V;  4NPN A;  1J8C A;  4MH0 E;  4YXD B;  2MLB A;  2JX5 A;  2C7M B;  2BYT A;  3AE5 B;  1SGH A;  2CU1 A;  3PSE B;  1I4H A;  1P1A A;  4HK2 A;  2ACZ B;  4EOY A;  3LXF A;  2KJH B;  3KQ4 A;  2JQR B;  2KO3 A;  2M17 A;  1TGZ B;  3PV1 A;  3EFU A;  4EE2 A;  3PZ8 A;  2N7J A;  2XBB C;  3AH7 A;  1CK1 A;  2WXI A;  3Q6B A;  2DLB A;  2LXA A;  3C8Y A;  4LTU A;  4CO7 A;  4F8C B;  2BWE S;  5DPT A;  4FUL A;  4URK A;  1WJU A;  1F1H A;  3RFZ B;  2YEP B;  4YSZ B;  2REX A;  3ML9 A;  2N7D A;  3B9J A;  3PZ7 A;  2KC1 A;  1FM0 D;  3U30 A;  4XWW A;  1FIQ A;  1D6E C;  1WY8 A;  4X57 B;  2KFJ A;  1F2R I;  3IT4 B;  1S1Q B;  1GJZ A;  2O2V A;  3PT2 B;  1TJE A;  1V1O A;  1OQR A;  2LJI A;  4RM9 A;  4DXG A;  5L83 A;  1NEN B;  2KWV B;  3B1L X;  4JWU C;  1RLF A;  3PLU A;  1MFW A;  3AU5 A;  3QAQ A;  2KQS A;  4AUQ C;  1DOY A;  3N1Z C;  3ZQ4 A;  4PS8 A;  3MP9 A;  1QOG A;  1V81 A;  3OLM D;  3P42 A;  2YEP F;  2KWD A;  4HPM B;  5GXG B;  1FNW A;  3UF8 A;  3DHG C;  4EZL A;  2K5P A;  2PIA A;  2WDT B;  3KLS X;  2WXO A;  5GMV A;  3ZO5 B;  3GE8 C;  4A9A A;  1TKY A;  1SJH D;  3DBR B;  3UGB B;  1C79 A;  2SAK A;  1WI0 A;  2D5G A;  2M56 B;  5CTR C;  2V3P A;  3A9J B;  5H8Y E;  3GZN I;  1I4Q A;  1SBB B;  4DHJ B;  3ZNI D;  5AZH A;  1EO6 A;  3U52 E;  2GBM A;  5JHA A;  2JVC A;  2A5U A;  1GPX A;  2ONQ A;  2L00 B;  2KT7 A;  2MCN B;  4DHZ B;  4IOI E;  2DWQ A;  4LCD E;  1YN3 A;  4GLS C;  1TT5 B;  4ITK A;  4DHJ D;  5I4D A;  1QIL A;  3SHQ A;  1E7P B;  3RNE C;  2LEK A;  3QWZ B;  1Q0W B;  1K8R B;  1KJT A;  2Z8L A;  3N30 A;  1LFD A;  1JWA D;  4IG7 B;  1GC6 A;  3A4S C;  2N0S B;  5KHO A;  3A9K B;  1QZE A;  2ZNV B;  4FHK A;  2KN4 A;  5CHF A;  2L76 A;  3AEE B;  1E8W A;  1RRB A;  4LLG M;  3PPA A;  3NZU A;  3L17 A;  2XEW A;  4HPP A;  4F7Z A;  4GGQ A;  4P1B C;  2BS4 B;  3QJZ A;  4MSQ B;  4ANW A;  3HVZ A;  1PGX A;  1VZ7 A;  3TEX A;  1WGK A;  1V1P A;  1D5M C;  4OVZ A;  2AL3 A;  3AM9 A;  4MEL A;  5DPW A;  4WJN A;  1T3Q A;  3U8Z A;  1GOZ A;  1ISN A;  3OJ4 B;  4BKS A;  1SE2 A;  2MSE D;  2ZVN A;  2MRP A;  1SE4 A;  1FD6 A;  1JWB D;  1STE A;  4W9H A;  2VH1 A;  3HUI A;  2EEL A;  4QAY A;  3AE6 B;  3MJ5 A;  4M0W B;  2MBO A;  2OJR A;  2WXF A;  3VR8 B;  2KFK A;  1CQV A;  3T3O A;  5BMI A;  3W1S A;  4CHK A;  4CQN A;  2KDB A;  3PZD A;  4ASW C;  4RF1 A;  2KNB A;  3L54 A;  4K7S A;  1RM6 C;  5AEK B;  4H2A A;  1YN5 A;  4FA6 A;  1WMH A;  3PTF C;  3AED B;  3HIZ A;  1DGJ A;  2BYE A;  4PYU A;  1KOT A;  1C4P A;  4C00 A;  4ZYN A;  2D2Q A;  4KGT A;  3ECI A;  4GB9 A;  3BWU D;  4JLC A;  5D6J B;  2WDR B;  1KTK A;  2OJW A;  2IY0 B;  3KUZ A;  3RZF A;  2BPS A;  3JSV B;  2N4F A;  2BKR B;  3RD2 A;  3U7D A;  4C56 C;  2BTE A;  2L7R A;  4ACF A;  3P1M A;  5G5G A;  2JZP A;  4KIK B;  3MJW A;  4N9F 4;  1YJI A;  3ZYY X;  1P98 A;  1T0R C;  4HWI B;  1JRP A;  2JYE A;  5IAA C;  1T5X D;  4YTP B;  4HRS A;  2XK5 A;  2W3S A;  1GAQ B;  2LUE A;  1T0S C;  2ZCC A;  2LMC A;  2FE8 A;  4YSY B;  4KDL B;  2G9H D;  2WYQ A;  4FJY A;  1TTN A;  3WCQ A;  1A5R A;  3V05 A;  5D7G A;  2Q5W D;  4LNO A;  1C4A A;  2ZPN A;  2LJ5 A;  2UYZ B;  3RNA C;  4B6W A;  3FKY A;  3Q14 C;  4WJP A;  2Y5C A;  3NG0 A;  5BMH A;  3PRZ A;  1V5T A;  1UGJ A;  3P4S B;  1ZGU B;  3ZNG C;  4EUT A;  4P6V F;  5EE9 A;  2X8X X;  2L32 A;  5HG2 A;  2Z0E B;  3PGE A;  2AX5 A;  4F1S A;  3AEA B;  4A90 A;  2IDY A;  3QHT A;  2FAZ A;  1SF0 A;  2A4Z A;  4FHJ A;  3B08 A;  1I4X A;  3H7P B;  2KN5 A;  1EU4 A;  3TEW A;  2GB1 A;  4EZJ A;  3V62 A;  3E9S A;  2CJO A;  4L23 A;  1ZPS A;  3ZTD A;  3V61 A;  3NS1 A;  1WYW B;  3Q3F A;  2LGD A;  5BYQ A;  2C5L C;  2AQ1 B;  4A3P A;  1I7H A;  4AJY B;  2IYD B;  3TUO A;  2LGY A;  3DWG C;  1IBX B;  4HCN B;  3TBL D;  1P7F A;  4E71 A;  2PE9 A;  1WXS A;  2ZW0 A;  1L6U A;  2QCZ A;  1WFY A;  3ZGZ A;  1H8C A;  2WXH A;  2KK8 A;  4MEM A;  3WAO A;  1N5X A;  4FLH A;  2O6V B;  3AE1 B;  2IO2 B;  5FR3 A;  2D10 A;  1Y8R C;  3WAL A;  5BO4 B;  1AYF A;  3P4Q B;  4ANU A;  5LLI A;  4K7U A;  4MM3 B;  3KUC B;  4NAW B;  4ZYS A;  2DAJ A;  4K81 A;  1R4M B;  1YQB A;  2O6V D;  2QMT A;  1NDD A;  2W55 A;  4RH6 A;  4GOC A;  2KKC A;  2LVP A;  5AZG A;  1PYW D;  4E74 A;  2IO1 B;  3N1Y C;  3R2T A;  1Z5S B;  2L05 A;  4JGH B;  5LXI B;  1ZKH A;  3R7Q A;  4ZHP A;  2EKI A;  3APF A;  2KJ6 A;  4G0N B;  2RGF A;  2FBW B;  3K9O B;  2WXL A;  2WXR A;  4ZHO A;  2WU2 B;  4M02 A;  3AE3 B;  4MJS B;  2MP2 A;  3KWL A;  2BKF A;  3URY A;  3Q3M C;  2ZPY A;  4W9D A;  5G5H A;  2NCN A;  3AV8 A;  3Q8E A;  3M62 B;  2ON8 A;  3FAH A;  4JWS C;  3BK2 A;  5LNK 1;  2GLS A;  2WLB A;  3IBE A;  4A3O A;  1R4N B;  2CHX A;  5AUK A;  2INN E;  4PT5 A;  1KF6 B;  4OW0 A;  2M1M A;  3WAP A;  4WWN A;  4HXD A;  3NJT A;  1HTQ A;  4MGI E;  1ACC A;  2J4X A;  2BS2 B;  4RGT A;  4K3C A;  1J7A A;  3A1Q A;  2IZV B;  1M4V A;  1RFA A;  3KW5 B;  3ETR A;  2KDF B;  1M94 A;  2G3Q B;  1WRD B;  5FKA C;  3TSS A;  2JRI B;  1OQY A;  1KFY B;  3QX1 A;  1YQ3 B;  3OG5 A;  3TL5 A;  1G6J A;  1GB1 A;  2KLC A;  2M0A A;  4IW0 A;  1YIW A;  2W9N A;  3CIR B;  4C4V B;  3TEY A;  2XN9 C;  2GRI A;  3SR6 A;  1P7E A;  5TR5 A;  2KOX A;  3IAM 1;  4CYE A;  3P4R B;  1VJK A;  3DBH B;  2PE6 B;  2HTH A;  4A55 A;  1N60 A;  3EEC A;  2G45 B;  2DZJ A;  5DCN A;  2GBN A;  2QC8 A;  1VDV A;  1WH3 A;  2DYB A;  2BS3 B;  2ASQ A;  2BW2 A;  1SE3 A;  1IP9 A;  2R61 A;  2BBC A;  2FUG 1;  2LFI A;  4ZRI A;  1WF9 A;  1JML A;  2KTF A;  4AOF A;  4WJO A;  5BMG A;  2WXM A;  1C78 A;  1WXA A;  1TIF A;  1FO4 A;  1L4D B;  3W1S C;  2E3T A;  2WXP A;  4WWM A;  5CHV C;  3NS8 A;  5HI1 A;  1GG3 A;  3TMP B;  1WGR A;  4MSM B;  3ZJU A;  4JQW C;  2HD5 B;  2O2V B;  1QLB B;  2M19 A;  3C0R B;  3L08 A;  3B0A A;  3J9C A;  2C60 A;  3NHE B;  5J17 A;  1BUI C;  1SEB D;  2WU5 B;  1K53 A;  1ET9 A;  4WIP A;  1F77 A;  2DAF A;  1FFV A;  2PTL A;  3EGR A;  2KQ4 X;  2L8J A;  4XZ4 A;  3AEG B;  2QEJ C;  4DHZ E;  5IKC M;  4XYC A;  3PHW B;  2HJ1 A;  5HHD G;  2WX0 A;  1D4B A;  2M8S A;  3PLV A;  2K22 A;  2H89 B;  3K9P B;  4WQO B;  4IKG A;  3IAS 1;  3Q8B A;  3DWM A;  3GE3 C;  3AXC A;  4HKQ A;  4HJG E;  1FNV A;  3ZRC A;  3PRM B;  4ARI A;  2K6D B;  2IO3 B;  4PS3 A;  2BT6 A;  2NS5 A;  2JU6 X;  2N9X A;  5E6N A;  2QHO A;  3T3N A;  3ZUN A;  5BYS A;  2WWZ A;  1VCB A;  2UWQ A;  4XWT A;  2LXC A;  4ICU A;  4ANX A;  3ML8 A;  4KKJ A;  2E6X A;  1ZDX A;  2ZW1 A;  1J0G A;  3EHV A;  2EMT A;  4FJV B;  3VRB B;  3CMM B;  1E8Z A;  4N59 A;  2MBE A;  2RD0 A;  4WWO A;  4ZRQ A;  2JXT A;  1HQR D;  1KLG D;  4DXF A;  4I6P A;  2N9L A;  3ZLZ A;  2JT4 B;  3EA6 A;  3FIL A;  2KTR A;  3NVV A;  1C1Y B;  2MJD A;  1F0Z A;  4W9F A;  1TS5 A;  2LWP A;  4TMA B;  1H4R A;  3WAN A;  1FCC C;  1I4R A;  1XCT L;  1Z2M A;  2PMV A;  3DHI C;  1YX6 B;  3TIX A;  3ENE A;  1JQ4 A;  1V1P B;  3VFK A;  5C23 A;  4USA A;  5IA7 A;  1V49 A;  2D3B A;  3M63 B;  3M3J A;  2FID A;  2GI9 A;  2MA9 B;  2N7E A;  3R3M A;  3X0W A;  4KVG B;  4DK5 A;  2LHD A;  1MG4 A;  2VH2 A;  4IM2 A;  4M01 A;  5EDS A;  1WM2 A;  1N5W A;  2J0K A;  3MC0 B;  1XO3 A;  2IGD A;  4YWG G;  4G11 A;  4BKS D;  4LNF A;  3HRD D;  2K8B A;  2PKO A;  3H9D A;  1SJE D;  1WXQ A;  3N32 A;  3Q3J A;  4IWO A;  3ALB A;  3GZN B;  3R66 C;  1D3Z A;  3IT6 B;  3RCZ A;  4RM8 A;  4LK0 M;  2AQ3 B;  1WJ4 A;  5JXV A;  1ET6 A;  1VD2 A;  5DPR A;  3Q3O C;  1UWM A;  2EKE C;  2J42 A;  1E90 A;  3L16 A;  1WMH B;  2LVQ A;  5IO9 A;  2RPQ A;  4MAC A;  3QCA A;  1KLV A;  2V3N A;  5T8I A;  3O65 B;  1AW7 A;  5G55 A;  3W1Y A;  4XDC A;  1ZXI A;  1RWS A;  2AYO B;  4PS7 A;  2DZM A;  4UDU C;  1CZP A;  1RAX A;  3PVL A;  2LGS A;  3RNB C;  1BT0 A;  3OAW A;  2JUO A;  3ZJV A;  3RNG C;  1EU3 A;  1I35 A;  1IUE A;  3RUI B;  4RFB A;  3V60 A;  2Y5P A;  4IWQ A;  2N9P C;  2V1Y A;  4IM3 A;  3RZW C;  1DOI A;  5D3I B;  4IWP A;  4OZA A;  4RGN A;  2GOW A;  3VH3 B;  1VLB A;  2JXX A;  2PPH A;  1EUV B;  3VRA B;  1WR1 A;  1ROE A;  4NY0 A;  2JZ3 B;  3GS2 A;  4LNI A;  4ZRK A;  2YVC A;  2NTT A;  4WQM A;  3OJ3 A;  1T6B X;  4EFO A;  2VRR B;  2XK5 B;  3L13 A;  2N9K A;  3L4P A;  2RDG A;  1F52 A;  4IDI A;  4M0W A;  4WH4 A;  3WIM A;  4KSL C;  3GP7 A;  3AE8 B;  1WRI A;  1XQQ A;  3KYD D;  4AQ7 A;  1XF5 L;  3ZNZ B;  1MHH E;  4DBG A;  1EF1 A;  5JHB A;  1LO5 D;  5KHQ A;  2ZJD A;  1PGB A;  3QK0 A;  4II3 B;  3BVM A;  4PYZ A;  3DBL I;  4N6E B;  4W9J A;  2W54 A;  1JRO A;  2FCS A;  1HXY D;  2ZEQ A;  1C76 A;  4REZ A;  2L52 A;  3QQ8 B;  2QDF A;  3R8B A;  1SE9 A;  1IPG A;  1XLN A;  5AUI A;  4KDI C;  1TKG A;  5C1Z A;  1E0Z A;  2D3A A;  1WZ3 A;  4TV3 A;  2MBB B;  3LDZ E;  3KYC D;  4OVU A;  2NBW B;  3LJ3 A;  1VRA B;  2INC C;  1V86 A;  2DZI A;  2HTM E;  2KAJ A;  3N20 C;  2L3Z A;  3MTN B;  4M8M A;  3ZTC A;  1UBQ A;  3I9V 1;  1WE7 A;  3VH4 B;  4HDO A;  2JWU A;  3NOB A;  1JRU A;  2VZK B;  3SDL C;  4YSX B;  1L0V B;  2AL6 A;  2W3R A;  5D3D A;  2MW5 A;  3RNC C;  3HHM A;  4DDG D;  2KX0 A;  4I6N B;  4HJK A;  2CKH B;  3VTW A;  4P7I A;  1AWD A;  2CHW A;  2K1F A;  2VZK D;  1OTR B;  2WXG A;  4LNN A;  3E56 A;  3C19 A;  3LYY A;  1ZUD 2;  3CST A;  1ZP0 B;  2KDE B;  2CU3 A;  1OFF A;  1VZ6 A;  3ZNH B;  2Y3A A;  2QIL A;  3H7S A;  3IFW B;  2IO0 B;  3A4R A;  4HCP B;  3Q3N C;  3VTV A;  1OEY J;  3NZ3 A;  3AUL A;  2V9H A;  1E8Y A;  1L0Y B;  1ZW7 A;  1J7B A;  1UBI A;  2PLP A;  2N1W A;  4GMV A;  5FR6 A;  4BFR A;  1ZXH A;  2KHW B;  1JAL A;  1I42 A;  5C3J B;  2MQJ A;  2LZ6 A;  2YLM A;  1QOA A;  1WGD A;  3P63 A;  2NBU A;  2DYO A;  2MJE A;  3ZRF A;  1E7U A;  3HK0 A;  3VXW A;  3AE9 B;  3UQA A;  1YNT E;  2PVG C;  3IVF A;  3NRZ A;  2WGS A;  4FJZ A;  3ZVV A;  2MP2 B;  4KZ0 A;  3QC8 B;  1GNU A;  2FIF A;  4TQ0 A;  4YTM B;  1WJN A;  3QAR A;  1NYQ A;  3DDC B;  1UD7 A;  1NI2 A;  2BF8 B;  4KX6 B;  2KWU B;  1UUP A;  1OEY A;  5J18 A;  1IGC A;  4FAD A;  3DVG Y;  1DOX A;  3DCG A;  2NPT B;  4XX5 A;  4RGM A;  1E6E B;  2J53 A;  1WIA A;  3MC9 A;  1YN4 A;  4DQO C;  2EMS A;  3I57 A;  1I4P A;  2JPH A;  3A1Q B;  4RMA A;  2WXK A;  4GDK A;  1UGM A;  2QIE B;  4GDL A;  2GBR A;  2FUH B;  2D3C A;  2L0F A;  2I1K A;  4OZC A;  3LB8 C;  1V8C A;  2G4D B;  4NAW A;  2GBK A;  2KMA A;  5H92 C;  2RDH A;  3RMK C;  4W9G A;  3HVD A;  5C2T B;  2BYF A;  3P2B A;  3CSF A;  1SIJ A;  2DZK A;  3AE7 B;  3U4E G;  2RSU A;  4A6Q A;  5LXH A;  3W9C B;  1WX7 A;  3O13 A;  3VDZ A;  1WE6 A;  1ESF A;  1YQ4 B;  2AQ2 B;  1N61 A;  1V2Y A;  2FCN A;  4B0E A;  1F2R C;  4EZK A;  4M00 A;  2MEK A;  1TS3 A;  2IGH A;  1MHX A;  1WJ6 A;  2W82 A;  5EE3 A;  4HKZ E;  1NYR A;  1T0Y A;  1WXV A;  2MBH A;  4HVB A;  1CMX B;  3NVW A;  2WDV B;  4P16 A;  4AJW A;  1JWS D;  3I5J C;  3T9L A;  3MFG A;  4GIV A;  1UNS A;  1R7S A;  1AAR A;  4ZRP A;  2K6Q A;  1VZ8 A;  3NY5 A;  4ANV A;  3SEB A;  2M0X A;  4FXC A;  2BB6 A;  3DBS A;  1XLP A;  1S3S G;  1EWY C;  2HE7 A;  1UWX A;  2HDE A;  2WDQ B;  4WJQ A;  3QA8 A;  4BKG A;  2M4N A;  3GB1 A;  2PJH A;  2DNF A;  2CR5 A;  3EC8 A;  1ZE3 D;  3L10 B;  2N9E B;  4RNA A;  3UIO B;  3WAM A;  5FK9 C;  3V6C B;  4KSK C;  4LJO B;  3DHH C;  2Y5B B;  4C4V A;  3ZW3 A;  2K25 A;  2NBV B;  4JPS A;  2CHZ A;  4WWP A;  3W5U B;  3VVW B;  4K1R B;  3RYT A;  4W9K A;  1QT9 A;  2K0P A;  3ZXR A;  3NVY A;  3PO0 A;  2DX5 B;  4A8X C;  3DBR I;  1D5X C;  2KAC A;  4RGO S;  3BIN A;  2BB5 A;  3U7Z A;  2LD9 A;  1J19 A;  3BZD B;  3TCA A;  4NJC A;  1P0R A;  1LXD A;  2BQQ A;  1HZ5 A;  1J7C A;  4GSW A;  5AZF A;  4I6L B;  4EEW A;  1XLQ A;  1TBE A;  1WR6 E;  3VUW A;  1E5W A;  1BML C;  2C9W B;  5IOI A;  4YT0 B;  1YMH E;  1SIF A;  2JSV X;  2ZZP B;  3GOE A;  4NQK E;  1C77 A;  1WGG A;  3FIL B;  4L2Y A;  2KTR B;  2K3U A;  1XEE A;  2KJR A;  2I1J A;  5E6J A;  2PW9 A;  1QQR A;  4OVV A;  5CHW A;  1I4G A;  4K3B A;  4OHJ A;  1TZO A;  4BVU C;  5IP4 D;  2KWC A;  1YX5 B;  1ZOY B;  2KDM A;  2FCM A;  2B3A A;  3DVG X;  4XE0 A;  4LJP B;  2JY6 A;  2KC2 A;  4YL8 A;  2DYM A;  2KVR A;  4JX1 C;  3SFE B;  2KQ7 A;  3D32 A;  3I63 C;  1VR9 A;  2CS4 A;  2WNM A;  1YJJ A;  5HFY A;  1JWU D;  4RCO A;  1EWC A;  2K8C A;  4K7W A;  4II2 B;  3WA0 A;  4KKI A;  4FN2 A;  4IC7 B;  3KH0 A;  1NEK B;  4AWJ A;  1K52 A;  5L95 C;  1TS2 A;  5D94 A;  3RN9 C;  4A20 A;  2MHJ A;  2D3G A;  1E7V A;  3PRP B;  4GXB A;  2MBQ A;  2LRU A;  4WAF A;  1NI3 A;  1KM7 A;  4BBN C;  2OOB B;  2R2Q A;  3PHX B;  4HPL B;  4EKU A;  3BY4 B;  1WWT A;  3ZKJ C;  3A9J A;  1UZX B;  3N3K B;  4W9I A;  1P3Q U;  3VHT C;  3X23 A;  2BWF A;  3VUX A;  2DBY A;  4HLE A;  2RDB C;  3DVN U;  3DOW A;  3ZIM A;  3MC8 A;  1JWM D;  2KFK B;  1F9J A;  1WZ0 A;  3NVZ A;  2KVZ A;  3RPF C;  2JYT A;  4MGK E;  3BK1 A;  2AWT A;  3BII D;  2G1E A;  1RFK A;  1KRH A;  1CJE A;  1X1M A;  5EE0 A;  1TKE A;  1XD3 B;  1FEH A;  1L7Y A;  3IHP C;  4S0R A;  1L4Z B;  2RPV A;  1FRD A;  4TUU A;  1FXA A;  4IUM B;  4DWF A;  1WSP A;  1GUA B;  2GBJ A;  1U4A A;  3W5V B;  2IPK D;  3I3T B;  3A9K A;  2JWZ A;  1XXG A;  2AEH A;  4HDQ A;  1PUT A;  3S2A A;  1OGW A;  1V9J A;  3PS6 A;  4JL9 A;  2J0J A;  4C7Y A;  2L1A A;  3V6E B;  1MVK A;  3JYU A;  4XGA B;  3R2I A;  2K39 A;  1BXT A;  2RMM A;  2WP9 B;  2KDI A;  2KAN A;  4J3O D;  4B0M A;  3B2G A;  1FFU A;  1GC7 A;  2V3S A;  3Q8C A;  4TKN A;  3EUB 2;  1QF6 A;  4US9 A;  2HJ8 A;  1KH0 A;  1YOV B;  3RT3 B;  1EF5 A;  3CF6 E;  2L83 A;  1C9F A;  2WX1 A;  3DPD A;  1XCQ L;  1B1Z A;  3TJP A;  3BVZ A;  3ZDM C;  1FRR A;  1E9M A;  1FXT B;  3VR9 B;  2XNA C;  4ARC A;  2DHZ A;  1N63 A;  4LDT B;  1QOF A;  3KVF B;  3N9Y C;  1L5P A;  2UU7 A;  2IY1 B;  4HEA 1;  2ICI A;  1L2N A;  4DDI D;  4AS1 A;  1JCK B;  2MWS B;  3AE2 B;  4LDT D;  1V5O A;  3IG3 A;  2KD0 A;  4B95 A;  4XDD A;  4XC2 A;  1WX8 A;  3IXS A;  1TY0 A;  2JZZ A;  1HA5 A;  5CX3 A;  2WS3 B;  2J7Q B;  3T8M A;  2WXN A;  3KUD B;  3SD5 A;  3AEB B;  3ONS A;  1Q5W B;  4S17 A;  4W9C A;  2V4L A;  1XT9 B;  1WXM A;  1PDX A;  1KLU D;  2JF5 A;  2X38 A;  4AP4 C;  3UI3 A;  1HE8 A;  3QIJ A;  4RF0 A;  5E6O A;  1FNU A;  1UF0 A;  3FC4 A;  2V0G A;  1YD8 U;  1GB4 A;  4L1B A;  1PFD A;  4JE3 B;  3ZXV A;  1WGY A;  4WUR A;  4D2K A;  2L0T A;  3Q69 A;  5MPO A;  2MH7 A;  3CWI A;  1K51 A;  4ICV A;  1Y56 A;  4NQL B;  3A33 B;  5IN7 A;  3V3X A;  4NNJ B;  3JSV A;  2BVC A;  4GN1 A;  1MG8 A;  1HZ6 A;  4GU2 A;  1PGA A;  5JZE B;  1LQB A;  4PK1 A;  2OHF A;  2J52 A;  2PEA A;  1E10 A;  4KIK A;  4OZB A;  2FCQ A;  3VAW A;  4G50 A;  5DPS A;  3UQB A;  4C80 A;  5E6P A;  3AU4 A;  5EE1 A;  3H1U A;  4BZA A;  3BYT B;  1WYG A;  4FBJ B;  2KYW A;  5TSS A;  3VUY A;  4MGZ E;  2I38 A;  4MH8 A; 
#chains in the Genus database with same CATH homology
 4TQ1 A;  4W9G A;  3ZRC A;  4DXA B;  3PRM B;  2D07 B;  5JH5 C;  2KX3 A;  2BYF A;  2K6D B;  3P2B A;  4W9H A;  2IO3 B;  4PS3 A;  3CSF A;  2NS5 A;  2DZK A;  2N9X A;  5E6N A;  2QHO A;  2RSU A;  4IM0 A;  5LXH A;  4M0W B;  3ZUN A;  1WX7 A;  2LAS A;  2MBO A;  2OJR A;  2WWZ A;  2KFK A;  3NZS A;  2KMC A;  1VCB A;  3APC A;  3VTU A;  2UWQ A;  2NR2 A;  4BBN F;  1R4M I;  1WE6 A;  3VDZ A;  2LXC A;  4ICU A;  1TZ1 A;  1V2Y A;  2KLG A;  2KXJ A;  3W1S A;  2D11 A;  4CHK A;  2FCN A;  3ML8 A;  2ZVO A;  4ANX A;  4EZK A;  4ZDV A;  2KDB A;  1C3T A;  3PZD A;  4ASW C;  2KNB A;  1WJ6 A;  1J0G A;  1NBF C;  1WM3 A;  3EHV A;  2EMT A;  3L54 A;  4FJV B;  4K7S A;  4J6I A;  1UEL A;  3CMM B;  1T0Y A;  1E8Z A;  1WXV A;  5AEK B;  2MBE A;  2MBH A;  4HVB A;  4FA6 A;  2RD0 A;  2RR9 A;  4WWO A;  1CMX B;  1WMH A;  4BKT A;  3PTF C;  4BOS C;  3VQI A;  4AJW A;  4W9E A;  3HIZ A;  3RUL A;  3AI5 A;  3T9L A;  4I6P A;  2BYE A;  1Q1O A;  3ZLZ A;  4PYU A;  2JT4 B;  4GIV A;  5G2N A;  1KOT A;  1AAR A;  2KTR A;  2K6Q A;  3JW0 X;  1P9D U;  1C1Y B;  4ZYN A;  2D2Q A;  3NY5 A;  3ECI A;  4GB9 A;  3SU8 X;  4ANV A;  2M0X A;  1V80 A;  4JLC A;  4W9F A;  5D6J B;  3DBS A;  2LRW A;  4B9K A;  1S3S G;  2HE7 A;  2LWP A;  3H7P A;  2IY0 B;  1H4R A;  3KUZ A;  2BPS A;  3RZF A;  3WAN A;  3JSV B;  2LGX A;  2N4F A;  4G3X B;  4WJQ A;  3QA8 A;  4BKG A;  1Z2M A;  1R4N I;  2M4N A;  2PJH A;  2BKR B;  4NJ6 A;  1YX6 B;  3RD2 A;  3TIX A;  3ENE A;  2CR5 A;  3EC8 A;  3L10 B;  2C7H A;  3U7D A;  1UH6 A;  5C23 A;  3VFK A;  5IA7 A;  4GDK B;  1V49 A;  2L7R A;  2N9E B;  2Z59 B;  4GDL B;  2G4S A;  4KZC A;  3UIO B;  3M63 B;  3WAM A;  4KIK B;  3MJW A;  3M3J A;  4N9F 4;  2FID A;  4KSK C;  2MA9 B;  2N7E A;  4LJO B;  4JIO U;  5D2M B;  3V6C B;  5J2R A;  3R3M A;  3X0W A;  2Y5B B;  4KVG B;  1P98 A;  4HWI B;  1WX9 A;  3ZW3 A;  4DK5 A;  5IAA C;  3HM6 X;  2K25 A;  2NBV B;  3M95 A;  2CHZ A;  4WWP A;  1PQS A;  2XK5 A;  2FNJ B;  2C7N B;  4E3C A;  3VVW B;  4K1R B;  2LUE A;  3RYT A;  1LM8 B;  4IM2 A;  2ZCC A;  4W9K A;  1YJ1 A;  4KDL B;  5EDS A;  1WM2 A;  2WYQ A;  2K8H A;  4FJY A;  1TTN A;  2J0K A;  2DX5 B;  1A5R A;  5D7G A;  2BGF A;  4G11 A;  4BOZ B;  4BKS D;  2O6V A;  3DBR I;  2ZPN A;  2LJ5 A;  2UYZ B;  3BIN A;  2K8B A;  3H9D A;  4KV2 A;  4IWO A;  3N32 A;  3Q3J A;  4B6W A;  2LD9 A;  3ALB A;  1J19 A;  3R66 C;  2IBI B;  3DBH I;  3TCA A;  1D3Z A;  3RCZ A;  4RM8 A;  4WJP A;  2KZR A;  1P0R A;  1LXD A;  1WJ4 A;  4MM3 A;  3UIP B;  3H6N A;  3PRZ A;  4GSW A;  4WAA A;  5AZF A;  4I6L B;  1VD2 A;  5DPR A;  1V5T A;  4EEW A;  3L0W B;  2DEN B;  1TBE A;  4W9L A;  1WR6 E;  2JRH A;  3DQV A;  2EKE C;  1ZGU B;  3VUW A;  1E5W A;  3ZNG C;  4EUT A;  3HM3 A;  2C9W B;  1E90 A;  3L16 A;  1WMH B;  3APD A;  2LVQ A;  4MGY E;  4NJ7 A;  2RPQ A;  1V6E A;  2Z0D B;  3QCA A;  3UIN B;  1KLV A;  3PRE A;  2Z0E B;  3O65 B;  2J0M A;  3PGE A;  1SIF A;  2ZZP B;  3GOE A;  4NQK E;  1WGG A;  5G55 A;  3W1Y A;  4F1S A;  2MX2 A;  2NPT A;  2KTR B;  3JVZ X;  2NVU I;  2AYO B;  4PS7 A;  2DZM A;  1WGH A;  1RAX A;  3QHT A;  2KJR A;  4M8N A;  2I1J A;  2LVO A;  3PVL A;  4MDK E;  2FAZ A;  1BT0 A;  3OAW A;  2A4Z A;  2JUO A;  4FHJ A;  4MJS A;  3B08 A;  3H7P B;  2GMI C;  4OVV A;  3MHS D;  5CHW A;  2KN5 A;  1I35 A;  3RUI B;  3V60 A;  4IWQ A;  2N9P C;  2V1Y A;  4IM3 A;  3V62 A;  4EZJ A;  3RZW C;  4BVU C;  2KWC A;  1YX5 B;  4IWP A;  3ZDT A;  2FCM A;  2B3A A;  3DVG X;  3R7R A;  2N1V A;  4LJP B;  2GOW A;  3ZTD A;  3V61 A;  3VH3 B;  2JY6 A;  2KC2 A;  4YL8 A;  1WYW B;  3Q3F A;  2DYM A;  2LGD A;  2JXX A;  2PPH A;  1EUV B;  2C5L C;  1WR1 A;  2KVR A;  4NY0 A;  2JZ3 B;  2KQ7 A;  4A3P A;  4AJY B;  3D32 A;  2IYD B;  4ZRK A;  2YVC A;  2LGY A;  4HCN B;  2CS4 A;  3OJ3 A;  4EFO A;  2ZNV C;  2VRR B;  2XK5 B;  3TBL D;  3L13 A;  4E71 A;  2LI5 A;  2PE9 A;  1WXS A;  3WA0 A;  2K8C A;  4K7W A;  4II2 B;  1WFY A;  4FN2 A;  4IC7 B;  3KH0 A;  5HKH A;  3WIM A;  4KSL C;  4AWJ A;  1IYF A;  2KK8 A;  4MEM A;  3WAO A;  5L95 C;  4ZRJ A;  1H8C A;  2BYV E;  1E8X A;  5D94 A;  2R2O A;  1XQQ A;  3KYD D;  4A20 A;  4FLH A;  2O6V B;  2D3G A;  2ZCB A;  1E7V A;  3ZNZ B;  3PRP B;  4GXB A;  2IO2 B;  2MBQ A;  2LRU A;  4DBG A;  1EF1 A;  5JHB A;  2D10 A;  1Y8R C;  3WAL A;  5BO4 B;  3DVN V;  1KM7 A;  4NPN A;  4BBN C;  5KHQ A;  4ANU A;  1J8C A;  2ZJD A;  4MH0 E;  2MLB A;  2OOB B;  2R2Q A;  3QK0 A;  4II3 B;  5LLI A;  3PHX B;  4HPL B;  4K7U A;  4PYZ A;  3DBL I;  4W9J A;  4EKU A;  3KUC B;  4NAW B;  2C7M B;  2FCS A;  2DAJ A;  3BY4 B;  4K81 A;  3ZKJ C;  1SGH A;  1YQB A;  2O6V D;  2ZEQ A;  2CU1 A;  3PSE B;  3A9J A;  1P1A A;  1UZX B;  1NDD A;  3QQ8 B;  4HK2 A;  3N3K B;  4W9I A;  4EOY A;  1SE9 A;  1P3Q U;  2KJH B;  3VHT C;  3X23 A;  2BWF A;  4GOC A;  1IPG A;  3VUX A;  4HLE A;  3DVN U;  2KKC A;  2LVP A;  3DOW A;  4KDI C;  3ZIM A;  5C1Z A;  5AZG A;  2KO3 A;  1WZ3 A;  1F9J A;  2KFK B;  1TGZ B;  2M17 A;  4E74 A;  3PV1 A;  2IO1 B;  4TV3 A;  1WZ0 A;  2MBB B;  3EFU A;  3LDZ E;  1Z5S B;  2L05 A;  4JGH B;  5LXI B;  1ZKH A;  3KYC D;  3R7Q A;  4MGK E;  2XBB C;  4OVU A;  2AWT A;  2NBW B;  3APF A;  2KJ6 A;  4G0N B;  3LJ3 A;  1V86 A;  2RGF A;  2LXA A;  3K9O B;  2DZI A;  4CO7 A;  4F8C B;  1X1M A;  2BWE S;  5DPT A;  4FUL A;  4MJS B;  4URK A;  1XD3 B;  2MP2 A;  1L7Y A;  1WJU A;  2L3Z A;  2BKF A;  3MTN B;  4M8M A;  3ZTC A;  3IHP C;  1UBQ A;  4TUU A;  1WE7 A;  2ZPY A;  2REX A;  4IUM B;  3ML9 A;  2N7D A;  4W9D A;  3VH4 B;  4DWF A;  2KC1 A;  3U30 A;  4HDO A;  1GUA B;  2GBJ A;  2NCN A;  1U4A A;  3NOB A;  1WY8 A;  1JRU A;  3I3T B;  3A9K A;  2JWZ A;  3M62 B;  4X57 B;  3SDL C;  2KFJ A;  2AEH A;  2AL6 A;  4HDQ A;  2MW5 A;  3HHM A;  3IBE A;  4A3O A;  4DDG D;  2CHX A;  2KX0 A;  3S2A A;  1S1Q B;  1GJZ A;  2O2V A;  4I6N B;  1OGW A;  4HJK A;  2CKH B;  3VTW A;  2M1M A;  3PT2 B;  4P7I A;  1V9J A;  3PS6 A;  4JL9 A;  3WAP A;  4WWN A;  2J0J A;  4HXD A;  2CHW A;  2K1F A;  4RM9 A;  3V6E B;  5L83 A;  3JYU A;  1OTR B;  2KWV B;  4MGI E;  3B1L X;  2K39 A;  1RLF A;  3CST A;  2KDE B;  2KDI A;  3A1Q A;  2KAN A;  3PLU A;  2IZV B;  3AU5 A;  1GC7 A;  2V3S A;  3QAQ A;  4TKN A;  1RFA A;  3ZNH B;  2KQS A;  4AUQ C;  3KW5 B;  2HJ8 A;  3RT3 B;  1EF5 A;  3CF6 E;  4PS8 A;  2KDF B;  3H7S A;  1M94 A;  2G3Q B;  1V81 A;  1WRD B;  3IFW B;  3OLM D;  2JRI B;  1OQY A;  4HPM B;  2WX1 A;  2IO0 B;  3A4R A;  3DPD A;  3UF8 A;  3QX1 A;  4HCP B;  3TL5 A;  3VTV A;  3TJP A;  4EZL A;  1G6J A;  2WDT B;  3ZDM C;  1OEY J;  2KLC A;  3AUL A;  1FXT B;  1E8Y A;  5GMV A;  4IW0 A;  3ZO5 B;  1YIW A;  1ZW7 A;  2DHZ A;  2W9N A;  4LDT B;  3KVF B;  1UBI A;  3UGB B;  2IY1 B;  5TR5 A;  2N1W A;  2KOX A;  4GMV A;  5FR6 A;  1WI0 A;  4BFR A;  2KHW B;  4CYE A;  1I42 A;  5CTR C;  3A9J B;  3GZN I;  2MQJ A;  2PE6 B;  4DHJ B;  2LZ6 A;  1L2N A;  2YLM A;  3ZNI D;  4DDI D;  2HTH A;  5AZH A;  1EO6 A;  1WGD A;  2GBM A;  3EEC A;  2JVC A;  5JHA A;  2G45 B;  2NBU A;  2MWS B;  2DZJ A;  5DCN A;  2A5U A;  4LDT D;  1V5O A;  2DYO A;  2GBN A;  3ZRF A;  3IG3 A;  2KD0 A;  4B95 A;  2L00 B;  2DYB A;  1WH3 A;  2MCN B;  4DHZ B;  2ASQ A;  4XC2 A;  1E7U A;  1WX8 A;  3HK0 A;  3VXW A;  4LCD E;  2JZZ A;  1IP9 A;  3UQA A;  5CX3 A;  2J7Q B;  4DHJ D;  3T8M A;  3KUD B;  4ZRI A;  3IVF A;  3SD5 A;  3ONS A;  3SHQ A;  1Q5W B;  1WF9 A;  4W9C A;  4FJZ A;  3ZVV A;  2MP2 B;  4KZ0 A;  3QC8 B;  2KTF A;  2V4L A;  1GNU A;  1XT9 B;  4WJO A;  4AOF A;  1WXM A;  1Q0W B;  1K8R B;  1KJT A;  2FIF A;  3QWZ B;  1WXA A;  3N30 A;  1WJN A;  4TQ0 A;  1LFD A;  2JF5 A;  3QAR A;  3W1S C;  4IG7 B;  3DDC B;  4AP4 C;  1HE8 A;  3QIJ A;  1UD7 A;  1GC6 A;  3A4S C;  1NI2 A;  2BF8 B;  5KHO A;  3A9K B;  5E6O A;  2KWU B;  5CHV C;  1QZE A;  2ZNV B;  3NS8 A;  1YD8 U;  4FHK A;  5CHF A;  1OEY A;  2L76 A;  1GG3 A;  3TMP B;  1E8W A;  1WGR A;  1WGY A;  4MSM B;  5J18 A;  1RRB A;  4FAD A;  3PPA A;  2L0T A;  4JQW C;  3DVG Y;  2HD5 B;  2O2V B;  3DCG A;  3NZU A;  2NPT B;  4ICV A;  4XX5 A;  3L17 A;  4NQL B;  3C0R B;  2XEW A;  3L08 A;  3B0A A;  4F7Z A;  3A33 B;  4GGQ A;  2C60 A;  1WIA A;  3NHE B;  5J17 A;  2EMS A;  4NNJ B;  3JSV A;  3QJZ A;  4GN1 A;  4MSQ B;  2DAF A;  2JPH A;  1MG8 A;  4ANW A;  4GU2 A;  5JZE B;  3A1Q B;  2L8J A;  4XZ4 A;  4RMA A;  1LQB A;  4DHZ E;  4GDK A;  2PEA A;  1UGM A;  4GDL A;  2GBR A;  2AL3 A;  3PHW B;  2FUH B;  4KIK A;  4MEL A;  2WX0 A;  2FCQ A;  3VAW A;  4G50 A;  5DPW A;  5DPS A;  2M8S A;  3PLV A;  4WJN A;  3UQB A;  2L0F A;  3K9P B;  5E6P A;  2I1K A;  4WQO B;  3AU4 A;  3U8Z A;  1ISN A;  3H1U A;  4FBJ B;  2G4D B;  3OJ4 B;  4NAW A;  3AXC A;  4BKS A;  2GBK A;  2KMA A;  3VUY A;  2MSE D;  2ZVN A;  4MGZ E;  2MRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...