2L83A

A protein from haloferax volcanii
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
MEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Small archaeal modifier protein 1
publication title A protein from Haloferax volcanii
rcsb
source organism Haloferax volcanii
total genus 7
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2011-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2l83A00
3AE9B 2QJLA 1QOAA 1TYGB 3DWGC 2WDQB 2PVGC 1ROEA 1XLNA 2B76B 3FC4A 3P4PB 1GAQB 3B2FA 1QF6A 1KF6B 1JWAD 1R7SA 2WP9B 1OQQA 1SF0A 1WYGA 3P1MA 4YTNB 1GPXA 1JQ4A 2WQYB 1FXIA 3VR8B 2CJOA 3AE4B 1L6VA 1FMAD 1NYRA 2W54A 1T3QA 5EE3A 3AEGB 3AMZA 3NVWA 1DOYA 1V97A 4US8A 4ZOHC 1CJEA 3CWIA 2H88B 1L0VB 3NS1A 1XO3A 1WXQA 2W3RA 1FO4A 3AE2B 3AH7A 3B9JA 3SFDB 1UWMA 4YTMB 3AE7B 4YSZB 3P63A 2W3SA 1L6UA 5AUKA 1FXAA 5C3JB 4LTUA 1RM6C 3KWLA 3P4SB 2MJEA 2BT6A 1CZPA 1WRIA 2K5PA 1VLBA 3B2GA 4N59A 1PUTA 3NVYA 1JALA 2BS2B 2M19A 2WLBA 4WWMA 1XLQA 2L52A 1ZP0B 5AUIA 2FBWB 3AEFB 3AV8A 5H92C 1PFDA 3W9CB 3FAHA 2JQRB 1JRPA 4ITKA 4YTPB 2K9XA 2MJDA 2WU2B 1IUEA 2CJNA 5G5GA 1DOIA 1KFYB 1ZXIA 3AN1A 3P4QB 1XLPA 2OHFA 3NVZA 4ZHOA 2BS3B 2MJ3A 3AEAB 4A9AA 4YXDB 3W5VB 1FRDA 2G1EA 1NYQA 3AM9A 1EWYC 2HTME 3PO0A 4N58A 1L5PA 3AECB 1YJIA 4US9A 4USAA 4C7YA 2L83A 3AE5B 1FM0D 4KX6B 5MPOA 1QOFA 1J7AA 4JWUC 1XLOA 3LB8C 4N6EB 3ZYYX 1N60A 4YT0B 1I7HA 3VRBB 1AWDA 1N5WA 1RFKA 3BIID 3AB5A 4C80A 1FIQA 4JX1C 2DWQA 3RPFC 3VR9B 1J7BA 1FFVA 1NI3A 1V8CA 5C2TB 3P4RB 1JROA 1QT9A 2EKIA 2PVOD 4YSYB 2K22A 2MH7A 2WDVB 2Y5CA 1VJKA 1WGKA 1A70A 1NENB 1JWBD 1FFUA 1RWSA 3HVZA 4YSXB 3EUB2 4HRSA 1WWTA 5EE0A 3SFEB 3W5UB 3HUIA 1JW9D 2M56B 3AE6B 1PDXA 1N5XA 2CU3A 2BS4B 2PIAA 3HRDD 3LXFA 1B9RA 2E3TA 1ZOYB 3NVVA 1DGJA 1VDVA 3NRZA 5EE9A 1TKEA 1YJJA 1N61A 2LEKA 3AEEB 5EE1A 3ABVB 1TKYA 2WS3B 1RYJA 4ZHPA 3VRAB 1FRRA 2QIEB 1DOXA 1F0ZA 1E6EB 1KRHA 1QOBA 4FXCA 3AE8B 2DBYA 4HROA 4P6VF 1E0ZA 3AE3B 1AYFA 2PKOA 5GXGB 3AEDB 1TJEA 2N0SB 4JWSC 3DWMA 1E7PB 1OQRA 2KAJA 2WU5B 2Q5WD 2WDRB 1J7CA 1YQ4B 1YQ3B 1SIJA 4WQMA 1N63A 2W55A 3WCQA 2ACZB 2JX5A 3CIRB 2H89B 2KMMA 3L4PA 3ETRA 1NEKB 1ZUD2 2AX5A 1E10A 3AE1B 1OFFA 3AEBB 4C7ZA 1QOGA 1E9MA 1TKGA 5G5HA 4IDIA 1QLBB 3SR6A 1NVID 5H8YE 1N62A 1SB3C
chains in the Genus database with same CATH superfamily
4KDLB 3PV1A 4MT5A 3PRMB 1J19A 1F2RI 4XDCA 3ZXRA 4NNJB 4E3CA 1JWAD 1SF0A 2NCNA 1JQ4A 1E8XA 1KLUD 4FLHA 1L6VA 3TMPB 3NVWA 4US8A 5BYRA 4BKGA 2LVQA 2AL3A 3ZQ4A 2AL6A 4FHKA 1FPYA 2I2YA 4P1BC 1BT0A 1F2RC 1KJTA 4OZCA 1ET6A 3E56A 1CZPA 3U7DA 2ON8A 1SEBD 3SU8X 4EEWA 4IWQA 2KACA 4YTPB 5CHWA 3H7PA 1ZXIA 1WY8A 3L54A 1I4GA 4WQOB 3Q8FA 1EWYC 4WAAA 5DPWA 3TSSA 5L83A 2HTHA 3ZYYX 4ZYSA 3DBLI 1S3SG 3TBLD 5EDSA 1HEZE 4EZJA 2MQJA 2Y5CA 1L4DB 2RGFA 3V61A 4DDGD 2AEHA 4KKJA 4P16A 2FCQA 1ET9A 4C4VB 2FCMA 3EUB2 4PYUA 3DQVA 2N9LA 4IKGA 5D7GA 2JPHA 2J42A 4FULA 3LDZE 2MLBA 3JYUA 1H8CA 1K51A 1SBBB 2MBOA 1JMLA 2DZJA 4A8XC 2WWZA 1BXTA 3ONSA 2ACZB 2JX5A 3HM3A 3PPAA 4J3OD 1NI2A 2M17A 3Q8CA 2L7RA 2V0GA 3RCZA 2IO1B 3BVZA 3W9CB 3TIXA 4W9LA 2V3NA 2AWTA 4KGSA 4II2B 4ANXA 2WP9B 4TV3A 1LO5D 4LDTB 4YTNB 3ZXVA 1PGXA 1SSNA 4JGHB 4WJNA 2OEDA 2W54A 1P98A 4RMAA 4E71A 1UELA 3AEGB 3IFWB 2WX1A 1XQQA 2MWSB 1V1OA 1KOTA 1XD3B 1WJUA 1UWMA 3R8BA 5D3DA 5C3JB 3VXWA 1V86A 2B3AA 2N1VA 4RNAA 3B2GA 1VLBA 2SEBD 1HE8A 2R61A 3KYDD 2D3BA 4KIKB 5AUIA 3OG5A 3QIJA 2CHZA 4MACA 4YXDB 4G0NB 4GB9A 4DHZE 4KDIC 4E74A 4EOYA 3PLVA 2G45B 2QSDA 2J53A 4JX1C 1ZGUB 2DWQA 4JLCA 5JHAA 3ZLZA 4FBJB 2QCZA 3AU5A 1LQBA 1SE4A 2DYBA 2K22A 5E6JA 2MP2B 1FFUA 3HVZA 2RSUA 2LGIA 3FKYA 4MH8A 3HUIA 1D5ZC 3H7SA 3HRDD 1A5RA 1V5TA 4H2AA 4HROA 3UF8A 3PTFC 3B0AA 3PHWB 2PKOA 1TJEA 2N0SB 3RNFC 4II3B 1J7CA 1IYFA 2PE9A 2G3QB 1I42A 4KVGB 1J0GA 3ZJVA 1HA5A 3KYCD 2V3PA 4IDIA 2ZPNA 5G5HA 2BQQA 4B0EA 1PQSA 2WYQA 1ACCA 2KDEB 1K53A 4AP4C 3P4PB 2G4SA 3P1MA 2GBKA 5FKAC 5J2RA 3VR8B 2ICIA 1NYRA 1K52A 2W9NA 2VZKD 3URYA 3U4EG 1Q10A 2BKFA 3TCAA 4LNNA 2GOWA 3B9JA 2KKCA 1WGHA 2W3SA 2RR9A 2Z0DB 4DQOC 3RFZB 2KX3A 4LK0M 1DYQA 1S1QB 3DHIC 1UUPA 1MI0A 1XLQA 3QJZA 2J0KA 4DWFA 1MHHE 1GUAB 3RI7C 4KGRA 3Q3JA 5DPSA 1E8YA 3RNEC 1TS5A 5D3IB 1IP9A 2DENB 1YMHE 2I1KA 4AUQC 4HDOA 2BW2A 4FN2A 1NBFC 2OOBB 4WJOA 1NDDA 3I63C 3MC0B 3DBLB 3VR9B 4AOFA 1NI3A 2J4XA 3EHVA 1UF0A 4UDUC 4AJYB 2WDVB 1L7YA 3RN9C 2RPVA 2KWVB 3R2TA 1P9DU 2I1JA 4B95A 2MRPA 4C56C 1TS3A 3NOBA 1SE3A 4W9FA 5AUKA 5EE9A 2ZNVC 3A9JA 4W9IA 4HJKA 2YVCA 2KHWB 1KRHA 3M95A 3MJ5A 1XCQL 5L95C 2L76A 4XZ4A 3N1XC 1D3ZA 4RGMA 1YX6B 1N63A 3ZJUA 2KLGA 2MBHA 2INPE 3OAWA 1WX8A 4I6LB 3UQBA 4IC7B 2WXIA 3VTWA 1ZW7A 1KF6B 2LJ5A 1QKZA 2IO0B 2LRWA 3PZ7A 2N1WA 3NG0A 1WYWB 4FJYA 4GU2A 1WGGA 3DPDA 4LJOB 2HD5B 3Q3NC 4ZYNA 1FCCC 4M02A 4GDKB 3WA0A 2IPKD 3Q69A 3SD5A 2JXTA 4X57B 2NTSA 1WGRA 3AE7B 4LTUA 1WX7A 4RH6A 3NZ3A 5LLIA 3U8ZA 1JALA 2WLBA 3RMKC 1ZKHA 3IT6B 4MJSA 2JQRB 4JE3B 5BYQA 2INCC 2K9XA 2MJDA 3NZUA 2FAZA 4KZCA 3L0WB 2RPQA 4D2KA 5AZHA 4A6QA 3QWZB 2KO3A 2XK5B 1VCBA 1XLOA 1YQBA 1AWDA 2C7NB 2KQ4X 5HG2A 1M4VA 4OZBA 2D5GA 4YSYB 4ZRIA 3A4SC 1IGCA 3PLUA 2LJIA 5DPRA 1XEEA 4WAFA 1F1HA 1WWTA 4PT5A 4EFOA 1Z5SB 3BINA 5C1ZA 1T0QC 3ABVB 2QIEB 3JSVA 1CQVA 3AE8B 4GDLA 4P6VF 1V9JA 2JRHA 3AEDB 3VUWA 1OQRA 5BMIA 2ZPYA 2AX5A 4ZRQA 3W1SA 3RNBC 1JRUA 4XGAB 1LXDA 1F52A 4XDDA 4BOSC 3M63B 3WAMA 3UI3A 3EFCA 3P42A 5HFYA 3DDCB 1N6ZA 4KSLC 2KJHB 4IM0A 2DZMA 1ESFA 2L3ZA 5EE3A 3KH0A 1RLFA 4HEA1 1FNUA 3APCA 4YTMB 4K7SA 3O13A 5IN7A 4XE0A 3L17A 2L8JA 2MJEA 1WRIA 2DLBA 3HM6X 2HE7A 1T0SC 2KXJA 2ONQA 2DZKA 2REXA 3DOWA 2DYOA 4B0MA 3N20C 3MFGA 2YLMA 4PYZA 2BS3B 3ZVVA 2M0AA 1NYQA 4MELA 3EC8A 3FILA 5AEKB 1FM0D 1J7AA 2RMMA 1R4NB 3RZWC 2LUMA 3A1QA 3U30A 1JROA 4MDKE 4B9KA 1I4QA 2KWUB 1A70A 3VHTC 4C00A 4YSXB 4EZLA 4FJZA 2M56B 2PIAA 3MHSD 3NRZA 5EE1A 2D3CA 2KC1A 4LNFA 2O2VB 1K8RB 2Z59B 4BKSD 3VAWA 2LFIA 4DXFA 2EMSA 3B1LX 2BF8B 1N62A 4XX5A 2FIFA 2X8XX 3RNCC 4DBGA 2LMCA 3FC4A 3R2IA 3L13A 2Z0EB 5CTRC 2WXRA 3ALBA 1FD6A 2C7MB 1EWCA 4MSQB 4EZKA 4F8CB 1MHXA 1P7EA 1SE9A 3RD2A 4BOZB 3L08A 1YN3A 3V60A 1MG4A 2FIDA 3W2DA 1PUTA 2M19A 2WNMA 2L52A 5H92C 3AEFB 3QA8A 1UWXA 1WJ4A 1TBEA 4MM3A 3IVFA 3N1ZC 3T3OA 2CHWA 1V1PA 1UBIA 3TL5A 2L1AA 2JZ3B 2WHIA 2DZIA 1YJ1A 4N58A 3AECB 4C7YA 4GSWA 4NAWB 3LB8C 4M8NA 4YT0B 1HTOA 1N5WA 1RFKA 2L32A 3BY4B 2IGGA 3NUHB 3GE3C 2KX0A 5IKCM 3ZTCA 2WDTB 2LHEA 1WGKA 4WURA 1WRDB 3BVMA 1SXTA 2KFKB 2IY1B 4HPLB 3RULA 1WIAA 4JL9A 1DGJA 4ZHPA 3QC8B 3AI5A 1KH0A 1FRRA 3V3XA 2JWUA 1I4PA 2DBYA 2JVCA 1AARA 2IY0B 2FUG1 2LUEA 3WIMA 4WH4A 1HXYD 3BYTB 4NJCA 2MA9B 1E9MA 1TKGA 1EU4A 1B1ZA 3KVFB 1QOAA 1WR6E 2K1FA 1C4AA 1ROEA 1XLNA 4ZRKA 3RYTA 4BVUC 1C78A 1XF5L 1WYGA 4JQWC 3VVWB 1Y8RC 2WQYB 1L0XB 3AE4B 4RGOS 2RDGA 1G6JA 2KWCA 4ZOHC 1L0VB 3N32A 1E7UA 1WXQA 3TEZA 3U52E 2BPSA 4HXDA 3IG3A 3KQ4A 4BFRA 4S17A 1GB1A 1TY0A 1WGDA 3MJWA 4NJ7A 3TJPA 4NY0A 2KC2A 2FBWB 3V62A 2PE6B 1FNWA 2WU2B 2KQ7A 2ZEQA 4B6WA 5I4DA 1XLPA 2TSSA 3A9KA 2FCSA 3ZKJC 1XT9B 3PO0A 2JZPA 2JF5A 3V05A 2WXQA 4JWUC 2WX0A 4G11A 2JSVX 1AW7A 3AB5A 2KJ6A 1V8CA 5C23A 4HKZE 1VD2A 1I4XA 3BYYB 1RFAA 4HPPA 1V6EA 1D5MC 2IYDB 4TQ0A 3SFEB 1WR1A 4RFBA 1Y56A 1MJDA 2E3TA 3NVVA 4ASWC 2WS3B 3NHEB 1OQYA 4W9EA 2LVOA 2MHJA 3N3KB 3ML9A 3L10B 4JWSC 2Y5PA 1WFYA 3HVDA 1ENFA 3GE8C 3HIZA 2YEPB 2G4DB 4M0WA 2KDIA 2DNFA 2BKRB 1WXMA 2BVCA 3ZO5B 1OGWA 4I6PA 3PSEB 1U4AA 2KN4A 3RUIB 4KKIA 3OJ4B 1SB3C 1RRBA 2GMIC 3BZDB 1WM3A 3DWGC 2WDQB 2MSED 3Q3FA 2PVGC 4IG7B 3B2FA 4ARIA 3V6CB 3TUOA 4PS3A 2CKHB 2PJHA 4NQLB 1R4MB 1FMAD 4CQNA 1V97A 3CWIA 2PPHA 1ZDXA 1IBXB 2VRRB 4ZDVA 2XEWA 4DDID 3P63A 2I38A 2KTRA 1KLGD 3VUXA 2O6VA 2JT4B 1MPEA 3M3JA 4XYCA 4OVUA 3I3TB 4N59A 4Q2JA 4N9F4 1T0YA 2N9EB 4W9KA 1SJED 4HK2A 3AN1A 2K8HA 2WXPA 2MBBB 2NPTB 4FJVB 1E8WA 1YJIA 1QOFA 2C9WB 1N60A 1WMHB 4HVBA 2O2VA 4NAMA 2JYTA 2KVZA 3WANA 3P4RB 3PT2B 3PZDA 3OWEB 2G9HD 4ICVA 2CS4A 2KWDA 1C76A 2JZZA 1N5XA 2CU3A 1VDVA 1TKEA 2KN5A 3EFUA 1WM2A 5AZFA 2KYWA 1R4NI 4XC2A 1WE7A 3KWVA 2KAJA 4BKTA 2Q5WD 2M8SA 1EU3A 4RCOA 3CIRB 4AS1A 2KMMA 4WWOA 1NEKB 5HHDG 4OHJA 5LXIB 1WJNA 2V4IB 5LNK1 3IT4B 1TY2A 1FCLA 2W82A 1F77A 1R7SA 3GZNB 2D2QA 2FNJB 1FXIA 3PHXB 2VH2A 4A3OA 1DOYA 5D6JB 3NS1A 1V2YA 2GBNA 2WXHA 1C79A 1P7FA 2MW5A 3JW0X 3R7QA 2BYTA 4L2YA 3P2BA 4RGTA 4ZRJA 1Q1OA 3DVNU 1GJZA 3AV8A 3HHMA 1PFDA 2K3UA 3H7PB 3AXCA 1UH6A 1WF9A 1KFYB 3NVZA 2GRIA 2ZVOA 3DVGX 3X0WA 1FRDA 1GOZA 4LNKA 2LGDA 3N9YC 3KLSX 4GMVA 4HCNB 3UINB 5CHFA 1J8CA 3QAQA 2N9XA 1YIWA 2IGHA 3MC9A 4HWIB 2QEJC 3X23A 3KUCB 3K9PB 5IAAC 3QCAA 3PS6A 4K7UA 3QX1A 1FFVA 4PS7A 1VJKA 2XBBC 4A20A 1NENB 1RWSA 4CYEA 4C4VA 1JW9D 2VZKB 4TSSA 4MSMB 5D2MB 1TKYA 2QC8A 4P7IA 1P1AA 4LLGM 5JXVA 2JY6A 2WU5B 1ZPSA 2UWQA 2K0PA 2W55A 4F1SA 1E10A 2ZJDA 2IDYA 1E8ZA 1P0RA 2M0XA 3WAOA 3KW5B 4OVZA 4GGQA 3RNAC 4ICUA 5E6PA 4GN1A 3WAPA 4HKQA 3QARA 2FE8A 4WJQA 3CMMB 4J6IA 2EKEC 2DAJA 2SAKA 2V4LA 4YSZB 1UNSA 3IHPC 4WJPA 3I9V1 1VZ7A 2Y5BB 2K5PA 4WWMA 2KVRA 3FAHA 4KIKA 4MGZE 5LXHA 2CJNA 3KUDB 3ZNZB 3NZSA 2K8CA 1WH3A 2BGFA 4W9CA 1EUVB 1BMLC 2MBQA 4N6EB 3EECA 1GG3A 4IWPA 3NY5A 3E9SA 4R3DA 1UGJA 1L2NA 1JWMD 2PVOD 2UU7A 3JVZX 4W9HA 4TQ1A 2FCNA 5AZGA 2MP2A 4HRSA 3C0RB 5EE0A 3J9CA 4TUUA 3AE6B 3RT3B 2BWES 2BS4B 3BWUD 3H6NA 3SR6A 1I4HA 5HKHA 4S0RA 1YOVB 3ZNGC 5BYSA 2BYEA 1E7PB 3OLMD 1TZOA 5G2NA 4L23A 4WWPA 1V5OA 4KSKC 2VH1A 4YWGG 2X38A 4KV2A 1NVID 4G50A 3RZFA 2CR5A 3M62B 2QILA 1WJ6A 2LI5A 3H9DA 1VR9A 5IA7A 2IZVB 2WXGA 2KANA 3TEWA 4DXGA 4OVVA 2WXNA 1TTNA 3Q6BA 1T3QA 3MC8A 1Z2MA 2H88B 1FXTB 3VTVA 1FO4A 1QQRA 3AE2B 4WWNA 3SFDB 3MTNB 1YN5A 4ANWA 2C7HA 1L6UA 3QK0A 2ZVNA 3R7RA 3Q8AA 3K9OB 4NPNA 1R4MI 2V9HA 4ITKA 3DVNV 2BBCA 2V3SA 2WXFA 1IUEA 2J7QB 3VFKA 3W5VB 2R2QA 2RD0A 4TKNA 2LGYA 3DBRB 1ZE3D 3RNGC 2WXJA 1X1MA 3BIID 1FIQA 1L4ZB 3B08A 2EKIA 4ARCA 3U7ZA 1I35A 2JWZA 2C5LC 4REZA 4IM3A 1YD8U 5HI1A 3A9JB 4AJWA 1ZOYB 1LFDA 2LEKA 3APDA 1RYJA 2NBUA 4IOIE 1K50A 2DYMA 3SHQA 1YQ3B 4WQMA 1HQRD 2H89B 5T8IA 3QQ8B 3PGEA 4A55A 3ZIMA 5H8YE 3Q2AC 2C60A 1EM7A 2UYZB 4G3XB 4P1CC 2KMCA 2KNBA 1UGMA 3VQIA 5CHVC 4K3CA 2GBJA 1OQQA 4DHZB 2N4FA 2K8BA 2QDFA 1YX5B 1XXGA 3AMZA 2ZZPB 3NJTA 4GDKA 4JPSA 4MGIE 1XCTL 3ZUNA 3EA6A 2MEKA 1PGBA 4W9JA 4PS8A 5FR6A 3AH7A 2XNAC 2LWPA 3DBHI 4DXAB 2IJ0A 4O1NA 2BT6A 2PTLA 3GZNI 3NVYA 4MJSB 2ASQA 1JRPA 4K81A 3DVGY 3IAM1 4DHJD 3U2SC 4A9AA 3EGRA 3VH4B 3PZ8A 3L16A 4XWWA 2KTFA 3AE5B 5MPOA 3ML8A 2KOXA 2E6XA 4M00A 2XK5A 1I7HA 4HPMB 3RPFC 5C2TB 3UGBB 1QT9A 1WGYA 3DHHC 3PREA 2PEAA 2WGSA 1V81A 3Q3OC 2ZCBA 3LJ3A 2DAFA 1OTRB 3JSVB 2JU6X 4GDLB 1E6EB 2AQ3B 4GXBA 2GB1A 1GC6A 1MVKA 1TIFA 1YQ4B 4IW0A 1V49A 4ACFA 3L4PA 2IO2B 2L05A 4RF1A 4W9GA 5TR5A 3AEBB 4C7ZA 1T6BX 1QLBB 1F0ZA 2A5UA 1ZDVA 1T5XD 2NBVB 1Q0WB 2QJLA 2IBIB 3UIPB 4IWOA 2LGSA 4A3PA 2ZW0A 4XWTA 2AQ2B 1QF6A 1E5WA 2QMTA 2KFJA 1FEHA 4DK5A 4FADA 4YL8A 4K7WA 4MGKE 3PVLA 3DBSA 4NQKE 4NJ6A 1C1YB 2JYEA 3I5JC 1OEYJ 1PYWD 5KHQA 1FXAA 2AQ1B 2DX5B 1RM6C 3P4SB 2KLCA 3Q8BA 4ANUA 1E90A 2JXXA 3VUYA 2BB5A 1VZ6A 3ZDTA 2NR2A 3HK0A 2KK8A 5G5GA 1LM8B 1L0YB 3FILB 5D94A 2HTME 1L5PA 1WX9A 4USAA 3VTUA 5IO9A 4KZ0A 3C8YA 1I4RA 4EKUA 1WZ3A 5CX3A 3VRBB 1BUIC 3A1QB 1WXAA 3A4RA 2INDC 4LJPB 5BMGA 4L1BA 3H8HA 1GC7A 3IAS1 1CK1A 4BBNF 1WXSA 1WXVA 4DHJB 3ZRFA 3W1YA 3ZRCA 3T8MA 4EE2A 2D11A 1YJJA 3TEYA 3ZTDA 5JHBA 1E0ZA 1AYFA 3DWMA 2KDBA 2WDRB 4OZAA 2N9PC 4LNOA 2LHDA 4RM9A 2GBMA 4KGTA 1EO6A 2KJRA 1SIFA 4LCDE 3SDLC 4TMAB 3AE9B 1TYGB 2DHZA 3GP7A 4F7ZA 1E7VA 3ZGZA 3ZW3A 4RGNA 1TT5B 2K6DB 2LXAA 2CHXA 5BO4B 5IP4D 2KZRA 2KD0A 1TZ1A 1XO3A 5FK9C 2YEPF 4CO7A 1UBQA 2N9KA 4CHKA 2Z8LA 2HDEA 2L0FA 1D4BA 3DBHB 4QAYA 2OJRA 1JWUD 1D5XC 4WIPA 1ZP0B 2D3GA 4MM3B 4I6NB 3PRPB 3SEBA 1V1PB 1MG8A 2OHFA 2KDMA 2D10A 3AM9A 3IXSA 1OEYA 2NVUI 2L83A 5DPTA 4IUMB 5IOIA 1LGRA 4NAWA 3VDZA 2N7JA 2LD9A 4C80A 3S2AA 2L0TA 3AULA 3GB1A 1ISNA 1C3TA 1WE6A 3T3NA 4W9DA 3BK1A 3H1UA 4HLEA 2MX2A 2KFKA 4LNIA 1PDXA 2BB6A 1SE2A 4RM8A 2K39A 1AN8A 1M94A 2WXLA 1N61A 3DBRI 2ZW1A 3VH3B 1FNVA 2KDFB 2MBEA 5G55A 5GXGB 1CMXB 5DCNA 2IO3B 2M1MA 1C9FA 3WCQA 3ETRA 2QHOA 2JUOA 3AE1B 5E6NA 1YNTE 2LGXA 5GMVA 1YN4A 3WALA 3I57A 3AU4A 3R66C 1ZXHA 2O6VD 5BMHA 2KQSA 2B76B 4GIVA 5J17A 2ZCCA 3N30A 1GAQB 3CF6E 1V80A 4OW0A 2BYVE 3UIOB 2CJOA 2J0MA 4BKSA 3GOEA 3NS8A 1JCKB 2WXOA 3UQAA 1VZ8A 3IBEA 1P3QU 2W3RA 3GS2A 5JZEB 2N7EA 1C77A 3Q8EA 2HJ1A 2D07B 3KWLA 2RDBC 2WXKA 4IM2A 5J18A 3DHGC 1DOIA 3A9KB 2MCNB 3AEAB 1RAXA 2LVPA 3APFA 2NBWB 2HJ8A 4NZLB 1STEA 2INNE 3Q14C 1EF1A 1TS4A 2EELA 2M4NA 3ZJTA 2EMTA 3V6EB 2NS5A 1J7BA 3ECIA 1F9JA 1TGZB 1HZ6A 1SGHA 2LRUA 2AYOB 2CU1A 4BAXA 3Q3MC 1C4CA 1JWBD 1KLVA 3ZNHB 3W5UB 2XN9C 1GNUA 4MH0E 4K3BA 2V1YA 2BWFA 1EF5A 4AWJA 1DOXA 1HZ5A 1QOBA 3AE3B 1KTKA 2R2OA 5JH5C 4M0WB 1SIJA 1MFWA 1ZUD2 1IGDA 3O65B 3ZDMC 2GBRA 3MP9A 4MGYE 2OJWA 2RDHA 2J0JA 2KMAA 3C19A 4FA6A 3DCGA 4FHJA 3BK2A 4GOCA 3MHZA 1GB4A 1UD7A 2NMQA 2FUHB 4K1RB 4URKA 5FR3A 1GPXA 1IPGA 4BBNC 2IGDA 4RF0A 3A33B 1H4RA 4JIOU 2J52A 1CJEA 2A4ZA 3CSFA 5E6OA 2D3AA 1HTQA 2PMVA 2JRIB 2LASA 1C4PA 1IBXA 1T0RC 2KTRB 3CSTA 2BTEA 2ZNVB 2PW9A 4BZAA 1WSPA 2O6VB 3ZNID 4PK1A 1WZ0A 3ENEA 1D6EC 2BS2B 1PGAA 3W1SC 3D32A 2LXCA 4GLSC 3P4QB 2K25A 2K6QA 3OJ3A 2NTTA 1VRAB 4ZHOA 2MJ3A 1UZXB 3R3MA 2G1EA 4M01A 2NPTA 1SJHD 3LYYA 3T9LA 1KM7A 4AQ7A 4US9A 4KX6B 5KHOA 4ZRPA 2N7DA 1Q5WB 4MEMA 4M8MA 1WMHA 2WXMA 5TSSA 1QILA 4HJGE 2KT7A 2MH7A 1QZEA 2BYFA 3N1YC 4HDQA 3LXFA 1B9RA 4A90A 4EUTA 2LZ6A 3AEEB 3VRAB 3BVGA 4HCPB 2L00B 4FXCA 3TEXA 4LDTD 4ANVA 1JWSD 3KUZA 2Y3AA 3QHTA 2PLPA 2GI9A 1TS2A 2GLSA 1OFFA 3PRZA 1QOGA 1WI0A
chains in the Genus database with same CATH topology
5LNK1 3IT4B 2QJLA 4XDDA 4MT5A 1TY2A 1FCLA 2W82A 1F2RI 4XDCA 3UI3A 2ZW0A 4XWTA 2AQ2B 1QF6A 1F77A 1JWAD 1R7SA 2QMTA 1SF0A 3P42A 5HFYA 1FEHA 1JQ4A 1FXIA 1KLUD 1ESFA 1L6VA 5EE3A 3NVWA 1DOYA 4US8A 5BYRA 3NS1A 3ZQ4A 2JYEA 4HEA1 1FNUA 2WXHA 1C79A 4YTMB 1P7FA 3O13A 1PYWD 4XE0A 2I2YA 1FXAA 2AQ1B 1F2RC 1RM6C 4OZCA 2BYTA 3P4SB 1ET6A 2MJEA 3E56A 1CZPA 1WRIA 2DLBA 4L2YA 4RGTA 3Q8BA 2ONQA 2ON8A 1SEBD 3AV8A 1PFDA 2BB5A 1VZ6A 2DYOA 2K3UA 2KACA 4YTPB 4B0MA 5G5GA 1KFYB 1ZXIA 3MFGA 1L0YB 3NVZA 2GRIA 2BS3B 1I4GA 1FRDA 2M0AA 3Q8FA 1NYQA 1GOZA 3FILB 1EWYC 2HTME 1L5PA 3TSSA 3FILA 3N9YC 4USAA 3KLSX 1FM0D 3C8YA 1I4RA 1J7AA 2RMMA 3ZYYX 4ZYSA 2IGHA 3VRBB 2QEJC 1BUIC 1HEZE 2LUMA 1FFVA 1JROA 2Y5CA 1L4DB 5BMGA 1VJKA 4L1BA 3H8HA 4KKJA 4P16A 1I4QA 1A70A 1NENB 1ET9A 3IAS1 1CK1A 1RWSA 4YSXB 3EUB2 2N9LA 1JW9D 2M56B 2VZKB 4IKGA 2PIAA 5D7GA 4TSSA 2J42A 3NRZA 4EE2A 1YJJA 5EE1A 1TKYA 3TEYA 1K51A 1SBBB 4LLGM 1E0ZA 1AYFA 5JXVA 1JMLA 3DWMA 2WU5B 4A8XC 1ZPSA 2WDRB 4OZAA 2LFIA 2K0PA 1BXTA 2W55A 2ACZB 2JX5A 1E10A 4DXFA 2IDYA 2LHDA 4J3OD 3Q8CA 4KGTA 2V0GA 4TMAB 4OVZA 3BVZA 3W9CB 1N62A 3AE9B 1TYGB 2V3NA 3GP7A 2LMCA 3FC4A 3R2IA 4KGSA 4HKQA 2WXRA 2WP9B 1LO5D 4YTNB 3ZGZA 4RGNA 1FD6A 1PGXA 1SSNA 2OEDA 2FE8A 2W54A 3AEGB 1EWCA 1XO3A 5FK9C 2YEPF 1MHXA 1P7EA 1V1OA 2SAKA 1UWMA 3R8BA 4YSZB 1UNSA 5D3DA 2N9KA 2Z8LA 2HDEA 5C3JB 3I9V1 1YN3A 1D4BA 1VZ7A 4RNAA 2K5PA 1VLBA 2SEBD 1JWUD 3B2GA 1D5XC 1PUTA 2R61A 4WIPA 3W2DA 2M19A 4WWMA 2WNMA 2L52A 5H92C 1ZP0B 5AUIA 4MM3B 3AEFB 1UWXA 3FAHA 3SEBA 1V1PB 3T3OA 2CJNA 1V1PA 2OHFA 2L1AA 2KDMA 4MACA 4YXDB 3AM9A 3IXSA 4N58A 3AECB 4C7YA 2L83A 4NAWB 1BMLC 3LB8C 4N6EB 4YT0B 2QSDA 1N5WA 2N7JA 1RFKA 4C80A 2J53A 2L32A 2DWQA 2IGGA 3E9SA 3NUHB 4JX1C 4R3DA 1UGJA 1JWMD 3GB1A 1SE4A 2PVOD 2K22A 5E6JA 3T3NA 4TQ1A 2LHEA 1WGKA 3BK1A 4WURA 1FFUA 3HVZA 3BVMA 1SXTA 2LGIA 4HRSA 5EE0A 3J9CA 4MH8A 3HUIA 1D5ZC 3AE6B 1PDXA 2BB6A 1SE2A 2BS4B 3HRDD 3BWUD 3SR6A 1DGJA 1AN8A 2WXLA 1I4HA 1N61A 4ZHPA 1KH0A 2ZW1A 1FRRA 1FNVA 3V3XA 2JWUA 4H2AA 4HROA 1I4PA 2DBYA 2PKOA 5BYSA 5GXGB 1TJEA 2N0SB 2FUG1 1E7PB 4WH4A 1TZOA 1J7CA 1C9FA 1HXYD 4L23A 3WCQA 3BYTB 4NJCA 3ETRA 3AE1B 3ZJVA 1HA5A 1YNTE 4YWGG 1E9MA 1YN4A 2X38A 2V3PA 1TKGA 3I57A 4IDIA 5G5HA 1ZXHA 1NVID 1EU4A 1B1ZA 4B0EA 1QOAA 2QILA 5BMHA 1ACCA 1C4AA 1ROEA 1XLNA 2B76B 1VR9A 1K53A 1C78A 3P4PB 1GAQB 2WXGA 3TEWA 4DXGA 4OW0A 1XF5L 1WYGA 3P1MA 2WXNA 2WQYB 1L0XB 5FKAC 3VR8B 2CJOA 2ICIA 3AE4B 4RGOS 1NYRA 1T3QA 2RDGA 1K52A 1JCKB 2WXOA 4ZOHC 1VZ8A 2VZKD 3URYA 2H88B 3U4EG 1L0VB 1Q10A 1WXQA 2W3RA 3GS2A 1FO4A 1QQRA 3TEZA 3U52E 3AE2B 3B9JA 3SFDB 1YN5A 1C77A 3Q8EA 2W3SA 3KQ4A 1L6UA 4DQOC 1GB1A 1TY0A 3KWLA 3RFZB 3Q8AA 4LK0M 1DYQA 1UUPA 1MI0A 2WXKA 1XLQA 2FBWB 1MHHE 4ITKA 2BBCA 4KGRA 1FNWA 2WU2B 2WXFA 1IUEA 5I4DA 1DOIA 1TS5A 1XLPA 2TSSA 5D3IB 3AEAB 3W5VB 1YMHE 3PO0A 3V05A 2JZPA 2BW2A 4NZLB 2WXQA 1STEA 1ZE3D 2INNE 4JWUC 2WXJA 1TS4A 2JSVX 2EELA 3MC0B 3BIID 1AW7A 3AB5A 3ZJTA 1FIQA 3VR9B 1J7BA 1V8CA 2J4XA 1L4ZB 1NI3A 2EKIA 1HZ6A 4UDUC 4ARCA 2WDVB 4HKZE 3U7ZA 1C4CA 1I4XA 4REZA 3BYYB 1JWBD 1D5MC 2RPVA 3R2TA 4TQ0A 3SFEB 3W5UB 4C56C 1TS3A 2XN9C 5HI1A 4RFBA 1Y56A 1SE3A 2E3TA 1ZOYB 3NVVA 5AUKA 5EE9A 2LEKA 2WS3B 1RYJA 1DOXA 1F0ZA 1HZ5A 1KRHA 1QOBA 3MJ5A 3AE3B 4IOIE 1XCQL 1K50A 1KTKA 4JWSC 2Y5PA 3HVDA 2DYMA 1ENFA 4RGMA 1YQ3B 2YEPB 1SIJA 4WQMA 1HQRD 1N63A 3ZJUA 4M0WA 2H89B 5T8IA 1ZUD2 1IGDA 2INPE 3MP9A 2KN4A 2RDHA 4A55A 5H8YE 4KKIA 1SB3C 3BZDB 1EM7A 3BK2A 3DWGC 2WDQB 2WXIA 3MHZA 1GB4A 2PVGC 2NMQA 3VQIA 3B2FA 4ARIA 1KF6B 1QKZA 3TUOA 1GPXA 5FR3A 1OQQA 3PZ7A 2IGDA 4RF0A 1FCCC 1FMAD 1XXGA 4GDKB 3AMZA 4CQNA 1V97A 2J52A 1CJEA 3CWIA 4JPSA 2IPKD 3Q69A 1XCTL 2JXTA 3EA6A 2MEKA 2PMVA 1PGBA 1ZDXA 1IBXB 3AH7A 1C4PA 1IBXA 2BTEA 2NTSA 2XNAC 3AE7B 2PW9A 2I38A 3P63A 1WSPA 1KLGD 2IJ0A 4O1NA 4LTUA 1MPEA 4RH6A 2BT6A 2PTLA 3NZ3A 4N59A 4Q2JA 1D6EC 3NVYA 1JALA 2BS2B 2WLBA 3IT6B 1SJED 2JQRB 4JE3B 5BYQA 1PGAA 1JRPA 2K9XA 2MJDA 3AN1A 3IAM1 3P4QB 4GLSC 2WXPA 3U2SC 2NTTA 1VRAB 4ZHOA 4D2KA 2MJ3A 4A9AA 2G1EA 1SJHD 3EGRA 3LYYA 3PZ8A 4A6QA 4AQ7A 1YJIA 4US9A 4XWWA 3AE5B 4KX6B 5MPOA 1QOFA 1XLOA 2E6XA 4ZRPA 1N60A 1I7HA 1AWDA 2KQ4X 4NAMA 5HG2A 2WXMA 1M4VA 3RPFC 2JYTA 4OZBA 5TSSA 5C2TB 2D5GA 3P4RB 1QILA 1QT9A 4HJGE 4YSYB 2MH7A 1IGCA 2LJIA 3OWEB 2G9HD 1XEEA 4WAFA 1WWTA 4PT5A 2KWDA 1C76A 1N5XA 2CU3A 3LXFA 1B9RA 4A90A 1VDVA 1TKEA 3AEEB 3ABVB 3VRAB 3BVGA 2QIEB 2JU6X 1CQVA 4GDLB 1E6EB 4FXCA 3TEXA 3AE8B 2AQ3B 4P6VF 2GB1A 3AEDB 1JWSD 3KWVA 1OQRA 2KAJA 1MVKA 5BMIA 2Q5WD 2Y3AA 1EU3A 1YQ4B 2PLPA 4RCOA 2GI9A 3CIRB 4AS1A 2KMMA 3L4PA 1NEKB 5HHDG 2AX5A 4ZRQA 3W1SA 1TS2A 1OFFA 4RF1A 4OHJA 3AEBB 4C7ZA 1QOGA 1T6BX 1QLBB 2V4IB 1ZDVA 1T5XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE9 B;  2QJL A;  1QOA A;  1TYG B;  3DWG C;  2WDQ B;  2PVG C;  1ROE A;  1XLN A;  2B76 B;  3FC4 A;  3P4P B;  1GAQ B;  3B2F A;  1QF6 A;  1KF6 B;  1JWA D;  1R7S A;  2WP9 B;  1OQQ A;  1SF0 A;  1WYG A;  3P1M A;  4YTN B;  1GPX A;  1JQ4 A;  2WQY B;  1FXI A;  3VR8 B;  2CJO A;  3AE4 B;  1L6V A;  1FMA D;  1NYR A;  2W54 A;  1T3Q A;  5EE3 A;  3AEG B;  3AMZ A;  3NVW A;  1DOY A;  1V97 A;  4US8 A;  4ZOH C;  1CJE A;  3CWI A;  2H88 B;  1L0V B;  3NS1 A;  1XO3 A;  1WXQ A;  2W3R A;  1FO4 A;  3AE2 B;  3AH7 A;  3B9J A;  3SFD B;  1UWM A;  4YTM B;  3AE7 B;  4YSZ B;  3P63 A;  2W3S A;  1L6U A;  5AUK A;  1FXA A;  5C3J B;  4LTU A;  1RM6 C;  3KWL A;  3P4S B;  2MJE A;  2BT6 A;  1CZP A;  1WRI A;  2K5P A;  1VLB A;  3B2G A;  4N59 A;  1PUT A;  3NVY A;  1JAL A;  2BS2 B;  2M19 A;  2WLB A;  4WWM A;  1XLQ A;  2L52 A;  1ZP0 B;  5AUI A;  2FBW B;  3AEF B;  3AV8 A;  5H92 C;  1PFD A;  3W9C B;  3FAH A;  2JQR B;  1JRP A;  4ITK A;  4YTP B;  2K9X A;  2MJD A;  2WU2 B;  1IUE A;  2CJN A;  5G5G A;  1DOI A;  1KFY B;  1ZXI A;  3AN1 A;  3P4Q B;  1XLP A;  2OHF A;  3NVZ A;  4ZHO A;  2BS3 B;  2MJ3 A;  3AEA B;  4A9A A;  4YXD B;  3W5V B;  1FRD A;  2G1E A;  1NYQ A;  3AM9 A;  1EWY C;  2HTM E;  3PO0 A;  4N58 A;  1L5P A;  3AEC B;  1YJI A;  4US9 A;  4USA A;  4C7Y A;  2L83 A;  3AE5 B;  1FM0 D;  4KX6 B;  5MPO A;  1QOF A;  1J7A A;  4JWU C;  1XLO A;  3LB8 C;  4N6E B;  3ZYY X;  1N60 A;  4YT0 B;  1I7H A;  3VRB B;  1AWD A;  1N5W A;  1RFK A;  3BII D;  3AB5 A;  4C80 A;  1FIQ A;  4JX1 C;  2DWQ A;  3RPF C;  3VR9 B;  1J7B A;  1FFV A;  1NI3 A;  1V8C A;  5C2T B;  3P4R B;  1JRO A;  1QT9 A;  2EKI A;  2PVO D;  4YSY B;  2K22 A;  2MH7 A;  2WDV B;  2Y5C A;  1VJK A;  1WGK A;  1A70 A;  1NEN B;  1JWB D;  1FFU A;  1RWS A;  3HVZ A;  4YSX B;  3EUB 2;  4HRS A;  1WWT A;  5EE0 A;  3SFE B;  3W5U B;  3HUI A;  1JW9 D;  2M56 B;  3AE6 B;  1PDX A;  1N5X A;  2CU3 A;  2BS4 B;  2PIA A;  3HRD D;  3LXF A;  1B9R A;  2E3T A;  1ZOY B;  3NVV A;  1DGJ A;  1VDV A;  3NRZ A;  5EE9 A;  1TKE A;  1YJJ A;  1N61 A;  2LEK A;  3AEE B;  5EE1 A;  3ABV B;  1TKY A;  2WS3 B;  1RYJ A;  4ZHP A;  3VRA B;  1FRR A;  2QIE B;  1DOX A;  1F0Z A;  1E6E B;  1KRH A;  1QOB A;  4FXC A;  3AE8 B;  2DBY A;  4HRO A;  4P6V F;  1E0Z A;  3AE3 B;  1AYF A;  2PKO A;  5GXG B;  3AED B;  1TJE A;  2N0S B;  4JWS C;  3DWM A;  1E7P B;  1OQR A;  2KAJ A;  2WU5 B;  2Q5W D;  2WDR B;  1J7C A;  1YQ4 B;  1YQ3 B;  1SIJ A;  4WQM A;  1N63 A;  2W55 A;  3WCQ A;  2ACZ B;  2JX5 A;  3CIR B;  2H89 B;  2KMM A;  3L4P A;  3ETR A;  1NEK B;  1ZUD 2;  2AX5 A;  1E10 A;  3AE1 B;  1OFF A;  3AEB B;  4C7Z A;  1QOG A;  1E9M A;  1TKG A;  5G5H A;  4IDI A;  1QLB B;  3SR6 A;  1NVI D;  5H8Y E;  1N62 A;  1SB3 C; 
#chains in the Genus database with same CATH topology
 4KDL B;  3PV1 A;  4MT5 A;  3PRM B;  1J19 A;  1F2R I;  4XDC A;  3ZXR A;  4NNJ B;  4E3C A;  1JWA D;  1SF0 A;  2NCN A;  1JQ4 A;  1E8X A;  1KLU D;  4FLH A;  1L6V A;  3TMP B;  3NVW A;  4US8 A;  5BYR A;  4BKG A;  2LVQ A;  2AL3 A;  3ZQ4 A;  2AL6 A;  4FHK A;  1FPY A;  2I2Y A;  4P1B C;  1BT0 A;  1F2R C;  1KJT A;  4OZC A;  1ET6 A;  3E56 A;  1CZP A;  3U7D A;  2ON8 A;  1SEB D;  3SU8 X;  4EEW A;  4IWQ A;  2KAC A;  4YTP B;  5CHW A;  3H7P A;  1ZXI A;  1WY8 A;  3L54 A;  1I4G A;  4WQO B;  3Q8F A;  1EWY C;  4WAA A;  5DPW A;  3TSS A;  5L83 A;  2HTH A;  3ZYY X;  4ZYS A;  3DBL I;  1S3S G;  3TBL D;  5EDS A;  1HEZ E;  4EZJ A;  2MQJ A;  2Y5C A;  1L4D B;  2RGF A;  3V61 A;  4DDG D;  2AEH A;  4KKJ A;  4P16 A;  2FCQ A;  1ET9 A;  4C4V B;  2FCM A;  3EUB 2;  4PYU A;  3DQV A;  2N9L A;  4IKG A;  5D7G A;  2JPH A;  2J42 A;  4FUL A;  3LDZ E;  2MLB A;  3JYU A;  1H8C A;  1K51 A;  1SBB B;  2MBO A;  1JML A;  2DZJ A;  4A8X C;  2WWZ A;  1BXT A;  3ONS A;  2ACZ B;  2JX5 A;  3HM3 A;  3PPA A;  4J3O D;  1NI2 A;  2M17 A;  3Q8C A;  2L7R A;  2V0G A;  3RCZ A;  2IO1 B;  3BVZ A;  3W9C B;  3TIX A;  4W9L A;  2V3N A;  2AWT A;  4KGS A;  4II2 B;  4ANX A;  2WP9 B;  4TV3 A;  1LO5 D;  4LDT B;  4YTN B;  3ZXV A;  1PGX A;  1SSN A;  4JGH B;  4WJN A;  2OED A;  2W54 A;  1P98 A;  4RMA A;  4E71 A;  1UEL A;  3AEG B;  3IFW B;  2WX1 A;  1XQQ A;  2MWS B;  1V1O A;  1KOT A;  1XD3 B;  1WJU A;  1UWM A;  3R8B A;  5D3D A;  5C3J B;  3VXW A;  1V86 A;  2B3A A;  2N1V A;  4RNA A;  3B2G A;  1VLB A;  2SEB D;  1HE8 A;  2R61 A;  3KYD D;  2D3B A;  4KIK B;  5AUI A;  3OG5 A;  3QIJ A;  2CHZ A;  4MAC A;  4YXD B;  4G0N B;  4GB9 A;  4DHZ E;  4KDI C;  4E74 A;  4EOY A;  3PLV A;  2G45 B;  2QSD A;  2J53 A;  4JX1 C;  1ZGU B;  2DWQ A;  4JLC A;  5JHA A;  3ZLZ A;  4FBJ B;  2QCZ A;  3AU5 A;  1LQB A;  1SE4 A;  2DYB A;  2K22 A;  5E6J A;  2MP2 B;  1FFU A;  3HVZ A;  2RSU A;  2LGI A;  3FKY A;  4MH8 A;  3HUI A;  1D5Z C;  3H7S A;  3HRD D;  1A5R A;  1V5T A;  4H2A A;  4HRO A;  3UF8 A;  3PTF C;  3B0A A;  3PHW B;  2PKO A;  1TJE A;  2N0S B;  3RNF C;  4II3 B;  1J7C A;  1IYF A;  2PE9 A;  2G3Q B;  1I42 A;  4KVG B;  1J0G A;  3ZJV A;  1HA5 A;  3KYC D;  2V3P A;  4IDI A;  2ZPN A;  5G5H A;  2BQQ A;  4B0E A;  1PQS A;  2WYQ A;  1ACC A;  2KDE B;  1K53 A;  4AP4 C;  3P4P B;  2G4S A;  3P1M A;  2GBK A;  5FKA C;  5J2R A;  3VR8 B;  2ICI A;  1NYR A;  1K52 A;  2W9N A;  2VZK D;  3URY A;  3U4E G;  1Q10 A;  2BKF A;  3TCA A;  4LNN A;  2GOW A;  3B9J A;  2KKC A;  1WGH A;  2W3S A;  2RR9 A;  2Z0D B;  4DQO C;  3RFZ B;  2KX3 A;  4LK0 M;  1DYQ A;  1S1Q B;  3DHI C;  1UUP A;  1MI0 A;  1XLQ A;  3QJZ A;  2J0K A;  4DWF A;  1MHH E;  1GUA B;  3RI7 C;  4KGR A;  3Q3J A;  5DPS A;  1E8Y A;  3RNE C;  1TS5 A;  5D3I B;  1IP9 A;  2DEN B;  1YMH E;  2I1K A;  4AUQ C;  4HDO A;  2BW2 A;  4FN2 A;  1NBF C;  2OOB B;  4WJO A;  1NDD A;  3I63 C;  3MC0 B;  3DBL B;  3VR9 B;  4AOF A;  1NI3 A;  2J4X A;  3EHV A;  1UF0 A;  4UDU C;  4AJY B;  2WDV B;  1L7Y A;  3RN9 C;  2RPV A;  2KWV B;  3R2T A;  1P9D U;  2I1J A;  4B95 A;  2MRP A;  4C56 C;  1TS3 A;  3NOB A;  1SE3 A;  4W9F A;  5AUK A;  5EE9 A;  2ZNV C;  3A9J A;  4W9I A;  4HJK A;  2YVC A;  2KHW B;  1KRH A;  3M95 A;  3MJ5 A;  1XCQ L;  5L95 C;  2L76 A;  4XZ4 A;  3N1X C;  1D3Z A;  4RGM A;  1YX6 B;  1N63 A;  3ZJU A;  2KLG A;  2MBH A;  2INP E;  3OAW A;  1WX8 A;  4I6L B;  3UQB A;  4IC7 B;  2WXI A;  3VTW A;  1ZW7 A;  1KF6 B;  2LJ5 A;  1QKZ A;  2IO0 B;  2LRW A;  3PZ7 A;  2N1W A;  3NG0 A;  1WYW B;  4FJY A;  4GU2 A;  1WGG A;  3DPD A;  4LJO B;  2HD5 B;  3Q3N C;  4ZYN A;  1FCC C;  4M02 A;  4GDK B;  3WA0 A;  2IPK D;  3Q69 A;  3SD5 A;  2JXT A;  4X57 B;  2NTS A;  1WGR A;  3AE7 B;  4LTU A;  1WX7 A;  4RH6 A;  3NZ3 A;  5LLI A;  3U8Z A;  1JAL A;  2WLB A;  3RMK C;  1ZKH A;  3IT6 B;  4MJS A;  2JQR B;  4JE3 B;  5BYQ A;  2INC C;  2K9X A;  2MJD A;  3NZU A;  2FAZ A;  4KZC A;  3L0W B;  2RPQ A;  4D2K A;  5AZH A;  4A6Q A;  3QWZ B;  2KO3 A;  2XK5 B;  1VCB A;  1XLO A;  1YQB A;  1AWD A;  2C7N B;  2KQ4 X;  5HG2 A;  1M4V A;  4OZB A;  2D5G A;  4YSY B;  4ZRI A;  3A4S C;  1IGC A;  3PLU A;  2LJI A;  5DPR A;  1XEE A;  4WAF A;  1F1H A;  1WWT A;  4PT5 A;  4EFO A;  1Z5S B;  3BIN A;  5C1Z A;  1T0Q C;  3ABV B;  2QIE B;  3JSV A;  1CQV A;  3AE8 B;  4GDL A;  4P6V F;  1V9J A;  2JRH A;  3AED B;  3VUW A;  1OQR A;  5BMI A;  2ZPY A;  2AX5 A;  4ZRQ A;  3W1S A;  3RNB C;  1JRU A;  4XGA B;  1LXD A;  1F52 A;  4XDD A;  4BOS C;  3M63 B;  3WAM A;  3UI3 A;  3EFC A;  3P42 A;  5HFY A;  3DDC B;  1N6Z A;  4KSL C;  2KJH B;  4IM0 A;  2DZM A;  1ESF A;  2L3Z A;  5EE3 A;  3KH0 A;  1RLF A;  4HEA 1;  1FNU A;  3APC A;  4YTM B;  4K7S A;  3O13 A;  5IN7 A;  4XE0 A;  3L17 A;  2L8J A;  2MJE A;  1WRI A;  2DLB A;  3HM6 X;  2HE7 A;  1T0S C;  2KXJ A;  2ONQ A;  2DZK A;  2REX A;  3DOW A;  2DYO A;  4B0M A;  3N20 C;  3MFG A;  2YLM A;  4PYZ A;  2BS3 B;  3ZVV A;  2M0A A;  1NYQ A;  4MEL A;  3EC8 A;  3FIL A;  5AEK B;  1FM0 D;  1J7A A;  2RMM A;  1R4N B;  3RZW C;  2LUM A;  3A1Q A;  3U30 A;  1JRO A;  4MDK E;  4B9K A;  1I4Q A;  2KWU B;  1A70 A;  3VHT C;  4C00 A;  4YSX B;  4EZL A;  4FJZ A;  2M56 B;  2PIA A;  3MHS D;  3NRZ A;  5EE1 A;  2D3C A;  2KC1 A;  4LNF A;  2O2V B;  1K8R B;  2Z59 B;  4BKS D;  3VAW A;  2LFI A;  4DXF A;  2EMS A;  3B1L X;  2BF8 B;  1N62 A;  4XX5 A;  2FIF A;  2X8X X;  3RNC C;  4DBG A;  2LMC A;  3FC4 A;  3R2I A;  3L13 A;  2Z0E B;  5CTR C;  2WXR A;  3ALB A;  1FD6 A;  2C7M B;  1EWC A;  4MSQ B;  4EZK A;  4F8C B;  1MHX A;  1P7E A;  1SE9 A;  3RD2 A;  4BOZ B;  3L08 A;  1YN3 A;  3V60 A;  1MG4 A;  2FID A;  3W2D A;  1PUT A;  2M19 A;  2WNM A;  2L52 A;  5H92 C;  3AEF B;  3QA8 A;  1UWX A;  1WJ4 A;  1TBE A;  4MM3 A;  3IVF A;  3N1Z C;  3T3O A;  2CHW A;  1V1P A;  1UBI A;  3TL5 A;  2L1A A;  2JZ3 B;  2WHI A;  2DZI A;  1YJ1 A;  4N58 A;  3AEC B;  4C7Y A;  4GSW A;  4NAW B;  3LB8 C;  4M8N A;  4YT0 B;  1HTO A;  1N5W A;  1RFK A;  2L32 A;  3BY4 B;  2IGG A;  3NUH B;  3GE3 C;  2KX0 A;  5IKC M;  3ZTC A;  2WDT B;  2LHE A;  1WGK A;  4WUR A;  1WRD B;  3BVM A;  1SXT A;  2KFK B;  2IY1 B;  4HPL B;  3RUL A;  1WIA A;  4JL9 A;  1DGJ A;  4ZHP A;  3QC8 B;  3AI5 A;  1KH0 A;  1FRR A;  3V3X A;  2JWU A;  1I4P A;  2DBY A;  2JVC A;  1AAR A;  2IY0 B;  2FUG 1;  2LUE A;  3WIM A;  4WH4 A;  1HXY D;  3BYT B;  4NJC A;  2MA9 B;  1E9M A;  1TKG A;  1EU4 A;  1B1Z A;  3KVF B;  1QOA A;  1WR6 E;  2K1F A;  1C4A A;  1ROE A;  1XLN A;  4ZRK A;  3RYT A;  4BVU C;  1C78 A;  1XF5 L;  1WYG A;  4JQW C;  3VVW B;  1Y8R C;  2WQY B;  1L0X B;  3AE4 B;  4RGO S;  2RDG A;  1G6J A;  2KWC A;  4ZOH C;  1L0V B;  3N32 A;  1E7U A;  1WXQ A;  3TEZ A;  3U52 E;  2BPS A;  4HXD A;  3IG3 A;  3KQ4 A;  4BFR A;  4S17 A;  1GB1 A;  1TY0 A;  1WGD A;  3MJW A;  4NJ7 A;  3TJP A;  4NY0 A;  2KC2 A;  2FBW B;  3V62 A;  2PE6 B;  1FNW A;  2WU2 B;  2KQ7 A;  2ZEQ A;  4B6W A;  5I4D A;  1XLP A;  2TSS A;  3A9K A;  2FCS A;  3ZKJ C;  1XT9 B;  3PO0 A;  2JZP A;  2JF5 A;  3V05 A;  2WXQ A;  4JWU C;  2WX0 A;  4G11 A;  2JSV X;  1AW7 A;  3AB5 A;  2KJ6 A;  1V8C A;  5C23 A;  4HKZ E;  1VD2 A;  1I4X A;  3BYY B;  1RFA A;  4HPP A;  1V6E A;  1D5M C;  2IYD B;  4TQ0 A;  3SFE B;  1WR1 A;  4RFB A;  1Y56 A;  1MJD A;  2E3T A;  3NVV A;  4ASW C;  2WS3 B;  3NHE B;  1OQY A;  4W9E A;  2LVO A;  2MHJ A;  3N3K B;  3ML9 A;  3L10 B;  4JWS C;  2Y5P A;  1WFY A;  3HVD A;  1ENF A;  3GE8 C;  3HIZ A;  2YEP B;  2G4D B;  4M0W A;  2KDI A;  2DNF A;  2BKR B;  1WXM A;  2BVC A;  3ZO5 B;  1OGW A;  4I6P A;  3PSE B;  1U4A A;  2KN4 A;  3RUI B;  4KKI A;  3OJ4 B;  1SB3 C;  1RRB A;  2GMI C;  3BZD B;  1WM3 A;  3DWG C;  2WDQ B;  2MSE D;  3Q3F A;  2PVG C;  4IG7 B;  3B2F A;  4ARI A;  3V6C B;  3TUO A;  4PS3 A;  2CKH B;  2PJH A;  4NQL B;  1R4M B;  1FMA D;  4CQN A;  1V97 A;  3CWI A;  2PPH A;  1ZDX A;  1IBX B;  2VRR B;  4ZDV A;  2XEW A;  4DDI D;  3P63 A;  2I38 A;  2KTR A;  1KLG D;  3VUX A;  2O6V A;  2JT4 B;  1MPE A;  3M3J A;  4XYC A;  4OVU A;  3I3T B;  4N59 A;  4Q2J A;  4N9F 4;  1T0Y A;  2N9E B;  4W9K A;  1SJE D;  4HK2 A;  3AN1 A;  2K8H A;  2WXP A;  2MBB B;  2NPT B;  4FJV B;  1E8W A;  1YJI A;  1QOF A;  2C9W B;  1N60 A;  1WMH B;  4HVB A;  2O2V A;  4NAM A;  2JYT A;  2KVZ A;  3WAN A;  3P4R B;  3PT2 B;  3PZD A;  3OWE B;  2G9H D;  4ICV A;  2CS4 A;  2KWD A;  1C76 A;  2JZZ A;  1N5X A;  2CU3 A;  1VDV A;  1TKE A;  2KN5 A;  3EFU A;  1WM2 A;  5AZF A;  2KYW A;  1R4N I;  4XC2 A;  1WE7 A;  3KWV A;  2KAJ A;  4BKT A;  2Q5W D;  2M8S A;  1EU3 A;  4RCO A;  3CIR B;  4AS1 A;  2KMM A;  4WWO A;  1NEK B;  5HHD G;  4OHJ A;  5LXI B;  1WJN A;  2V4I B;  5LNK 1;  3IT4 B;  1TY2 A;  1FCL A;  2W82 A;  1F77 A;  1R7S A;  3GZN B;  2D2Q A;  2FNJ B;  1FXI A;  3PHX B;  2VH2 A;  4A3O A;  1DOY A;  5D6J B;  3NS1 A;  1V2Y A;  2GBN A;  2WXH A;  1C79 A;  1P7F A;  2MW5 A;  3JW0 X;  3R7Q A;  2BYT A;  4L2Y A;  3P2B A;  4RGT A;  4ZRJ A;  1Q1O A;  3DVN U;  1GJZ A;  3AV8 A;  3HHM A;  1PFD A;  2K3U A;  3H7P B;  3AXC A;  1UH6 A;  1WF9 A;  1KFY B;  3NVZ A;  2GRI A;  2ZVO A;  3DVG X;  3X0W A;  1FRD A;  1GOZ A;  4LNK A;  2LGD A;  3N9Y C;  3KLS X;  4GMV A;  4HCN B;  3UIN B;  5CHF A;  1J8C A;  3QAQ A;  2N9X A;  1YIW A;  2IGH A;  3MC9 A;  4HWI B;  2QEJ C;  3X23 A;  3KUC B;  3K9P B;  5IAA C;  3QCA A;  3PS6 A;  4K7U A;  3QX1 A;  1FFV A;  4PS7 A;  1VJK A;  2XBB C;  4A20 A;  1NEN B;  1RWS A;  4CYE A;  4C4V A;  1JW9 D;  2VZK B;  4TSS A;  4MSM B;  5D2M B;  1TKY A;  2QC8 A;  4P7I A;  1P1A A;  4LLG M;  5JXV A;  2JY6 A;  2WU5 B;  1ZPS A;  2UWQ A;  2K0P A;  2W55 A;  4F1S A;  1E10 A;  2ZJD A;  2IDY A;  1E8Z A;  1P0R A;  2M0X A;  3WAO A;  3KW5 B;  4OVZ A;  4GGQ A;  3RNA C;  4ICU A;  5E6P A;  4GN1 A;  3WAP A;  4HKQ A;  3QAR A;  2FE8 A;  4WJQ A;  3CMM B;  4J6I A;  2EKE C;  2DAJ A;  2SAK A;  2V4L A;  4YSZ B;  1UNS A;  3IHP C;  4WJP A;  3I9V 1;  1VZ7 A;  2Y5B B;  2K5P A;  4WWM A;  2KVR A;  3FAH A;  4KIK A;  4MGZ E;  5LXH A;  2CJN A;  3KUD B;  3ZNZ B;  3NZS A;  2K8C A;  1WH3 A;  2BGF A;  4W9C A;  1EUV B;  1BML C;  2MBQ A;  4N6E B;  3EEC A;  1GG3 A;  4IWP A;  3NY5 A;  3E9S A;  4R3D A;  1UGJ A;  1L2N A;  1JWM D;  2PVO D;  2UU7 A;  3JVZ X;  4W9H A;  4TQ1 A;  2FCN A;  5AZG A;  2MP2 A;  4HRS A;  3C0R B;  5EE0 A;  3J9C A;  4TUU A;  3AE6 B;  3RT3 B;  2BWE S;  2BS4 B;  3BWU D;  3H6N A;  3SR6 A;  1I4H A;  5HKH A;  4S0R A;  1YOV B;  3ZNG C;  5BYS A;  2BYE A;  1E7P B;  3OLM D;  1TZO A;  5G2N A;  4L23 A;  4WWP A;  1V5O A;  4KSK C;  2VH1 A;  4YWG G;  2X38 A;  4KV2 A;  1NVI D;  4G50 A;  3RZF A;  2CR5 A;  3M62 B;  2QIL A;  1WJ6 A;  2LI5 A;  3H9D A;  1VR9 A;  5IA7 A;  2IZV B;  2WXG A;  2KAN A;  3TEW A;  4DXG A;  4OVV A;  2WXN A;  1TTN A;  3Q6B A;  1T3Q A;  3MC8 A;  1Z2M A;  2H88 B;  1FXT B;  3VTV A;  1FO4 A;  1QQR A;  3AE2 B;  4WWN A;  3SFD B;  3MTN B;  1YN5 A;  4ANW A;  2C7H A;  1L6U A;  3QK0 A;  2ZVN A;  3R7R A;  3Q8A A;  3K9O B;  4NPN A;  1R4M I;  2V9H A;  4ITK A;  3DVN V;  2BBC A;  2V3S A;  2WXF A;  1IUE A;  2J7Q B;  3VFK A;  3W5V B;  2R2Q A;  2RD0 A;  4TKN A;  2LGY A;  3DBR B;  1ZE3 D;  3RNG C;  2WXJ A;  1X1M A;  3BII D;  1FIQ A;  1L4Z B;  3B08 A;  2EKI A;  4ARC A;  3U7Z A;  1I35 A;  2JWZ A;  2C5L C;  4REZ A;  4IM3 A;  1YD8 U;  5HI1 A;  3A9J B;  4AJW A;  1ZOY B;  1LFD A;  2LEK A;  3APD A;  1RYJ A;  2NBU A;  4IOI E;  1K50 A;  2DYM A;  3SHQ A;  1YQ3 B;  4WQM A;  1HQR D;  2H89 B;  5T8I A;  3QQ8 B;  3PGE A;  4A55 A;  3ZIM A;  5H8Y E;  3Q2A C;  2C60 A;  1EM7 A;  2UYZ B;  4G3X B;  4P1C C;  2KMC A;  2KNB A;  1UGM A;  3VQI A;  5CHV C;  4K3C A;  2GBJ A;  1OQQ A;  4DHZ B;  2N4F A;  2K8B A;  2QDF A;  1YX5 B;  1XXG A;  3AMZ A;  2ZZP B;  3NJT A;  4GDK A;  4JPS A;  4MGI E;  1XCT L;  3ZUN A;  3EA6 A;  2MEK A;  1PGB A;  4W9J A;  4PS8 A;  5FR6 A;  3AH7 A;  2XNA C;  2LWP A;  3DBH I;  4DXA B;  2IJ0 A;  4O1N A;  2BT6 A;  2PTL A;  3GZN I;  3NVY A;  4MJS B;  2ASQ A;  1JRP A;  4K81 A;  3DVG Y;  3IAM 1;  4DHJ D;  3U2S C;  4A9A A;  3EGR A;  3VH4 B;  3PZ8 A;  3L16 A;  4XWW A;  2KTF A;  3AE5 B;  5MPO A;  3ML8 A;  2KOX A;  2E6X A;  4M00 A;  2XK5 A;  1I7H A;  4HPM B;  3RPF C;  5C2T B;  3UGB B;  1QT9 A;  1WGY A;  3DHH C;  3PRE A;  2PEA A;  2WGS A;  1V81 A;  3Q3O C;  2ZCB A;  3LJ3 A;  2DAF A;  1OTR B;  3JSV B;  2JU6 X;  4GDL B;  1E6E B;  2AQ3 B;  4GXB A;  2GB1 A;  1GC6 A;  1MVK A;  1TIF A;  1YQ4 B;  4IW0 A;  1V49 A;  4ACF A;  3L4P A;  2IO2 B;  2L05 A;  4RF1 A;  4W9G A;  5TR5 A;  3AEB B;  4C7Z A;  1T6B X;  1QLB B;  1F0Z A;  2A5U A;  1ZDV A;  1T5X D;  2NBV B;  1Q0W B;  2QJL A;  2IBI B;  3UIP B;  4IWO A;  2LGS A;  4A3P A;  2ZW0 A;  4XWT A;  2AQ2 B;  1QF6 A;  1E5W A;  2QMT A;  2KFJ A;  1FEH A;  4DK5 A;  4FAD A;  4YL8 A;  4K7W A;  4MGK E;  3PVL A;  3DBS A;  4NQK E;  4NJ6 A;  1C1Y B;  2JYE A;  3I5J C;  1OEY J;  1PYW D;  5KHQ A;  1FXA A;  2AQ1 B;  2DX5 B;  1RM6 C;  3P4S B;  2KLC A;  3Q8B A;  4ANU A;  1E90 A;  2JXX A;  3VUY A;  2BB5 A;  1VZ6 A;  3ZDT A;  2NR2 A;  3HK0 A;  2KK8 A;  5G5G A;  1LM8 B;  1L0Y B;  3FIL B;  5D94 A;  2HTM E;  1L5P A;  1WX9 A;  4USA A;  3VTU A;  5IO9 A;  4KZ0 A;  3C8Y A;  1I4R A;  4EKU A;  1WZ3 A;  5CX3 A;  3VRB B;  1BUI C;  3A1Q B;  1WXA A;  3A4R A;  2IND C;  4LJP B;  5BMG A;  4L1B A;  3H8H A;  1GC7 A;  3IAS 1;  1CK1 A;  4BBN F;  1WXS A;  1WXV A;  4DHJ B;  3ZRF A;  3W1Y A;  3ZRC A;  3T8M A;  4EE2 A;  2D11 A;  1YJJ A;  3TEY A;  3ZTD A;  5JHB A;  1E0Z A;  1AYF A;  3DWM A;  2KDB A;  2WDR B;  4OZA A;  2N9P C;  4LNO A;  2LHD A;  4RM9 A;  2GBM A;  4KGT A;  1EO6 A;  2KJR A;  1SIF A;  4LCD E;  3SDL C;  4TMA B;  3AE9 B;  1TYG B;  2DHZ A;  3GP7 A;  4F7Z A;  1E7V A;  3ZGZ A;  3ZW3 A;  4RGN A;  1TT5 B;  2K6D B;  2LXA A;  2CHX A;  5BO4 B;  5IP4 D;  2KZR A;  2KD0 A;  1TZ1 A;  1XO3 A;  5FK9 C;  2YEP F;  4CO7 A;  1UBQ A;  2N9K A;  4CHK A;  2Z8L A;  2HDE A;  2L0F A;  1D4B A;  3DBH B;  4QAY A;  2OJR A;  1JWU D;  1D5X C;  4WIP A;  1ZP0 B;  2D3G A;  4MM3 B;  4I6N B;  3PRP B;  3SEB A;  1V1P B;  1MG8 A;  2OHF A;  2KDM A;  2D10 A;  3AM9 A;  3IXS A;  1OEY A;  2NVU I;  2L83 A;  5DPT A;  4IUM B;  5IOI A;  1LGR A;  4NAW A;  3VDZ A;  2N7J A;  2LD9 A;  4C80 A;  3S2A A;  2L0T A;  3AUL A;  3GB1 A;  1ISN A;  1C3T A;  1WE6 A;  3T3N A;  4W9D A;  3BK1 A;  3H1U A;  4HLE A;  2MX2 A;  2KFK A;  4LNI A;  1PDX A;  2BB6 A;  1SE2 A;  4RM8 A;  2K39 A;  1AN8 A;  1M94 A;  2WXL A;  1N61 A;  3DBR I;  2ZW1 A;  3VH3 B;  1FNV A;  2KDF B;  2MBE A;  5G55 A;  5GXG B;  1CMX B;  5DCN A;  2IO3 B;  2M1M A;  1C9F A;  3WCQ A;  3ETR A;  2QHO A;  2JUO A;  3AE1 B;  5E6N A;  1YNT E;  2LGX A;  5GMV A;  1YN4 A;  3WAL A;  3I57 A;  3AU4 A;  3R66 C;  1ZXH A;  2O6V D;  5BMH A;  2KQS A;  2B76 B;  4GIV A;  5J17 A;  2ZCC A;  3N30 A;  1GAQ B;  3CF6 E;  1V80 A;  4OW0 A;  2BYV E;  3UIO B;  2CJO A;  2J0M A;  4BKS A;  3GOE A;  3NS8 A;  1JCK B;  2WXO A;  3UQA A;  1VZ8 A;  3IBE A;  1P3Q U;  2W3R A;  3GS2 A;  5JZE B;  2N7E A;  1C77 A;  3Q8E A;  2HJ1 A;  2D07 B;  3KWL A;  2RDB C;  2WXK A;  4IM2 A;  5J18 A;  3DHG C;  1DOI A;  3A9K B;  2MCN B;  3AEA B;  1RAX A;  2LVP A;  3APF A;  2NBW B;  2HJ8 A;  4NZL B;  1STE A;  2INN E;  3Q14 C;  1EF1 A;  1TS4 A;  2EEL A;  2M4N A;  3ZJT A;  2EMT A;  3V6E B;  2NS5 A;  1J7B A;  3ECI A;  1F9J A;  1TGZ B;  1HZ6 A;  1SGH A;  2LRU A;  2AYO B;  2CU1 A;  4BAX A;  3Q3M C;  1C4C A;  1JWB D;  1KLV A;  3ZNH B;  3W5U B;  2XN9 C;  1GNU A;  4MH0 E;  4K3B A;  2V1Y A;  2BWF A;  1EF5 A;  4AWJ A;  1DOX A;  1HZ5 A;  1QOB A;  3AE3 B;  1KTK A;  2R2O A;  5JH5 C;  4M0W B;  1SIJ A;  1MFW A;  1ZUD 2;  1IGD A;  3O65 B;  3ZDM C;  2GBR A;  3MP9 A;  4MGY E;  2OJW A;  2RDH A;  2J0J A;  2KMA A;  3C19 A;  4FA6 A;  3DCG A;  4FHJ A;  3BK2 A;  4GOC A;  3MHZ A;  1GB4 A;  1UD7 A;  2NMQ A;  2FUH B;  4K1R B;  4URK A;  5FR3 A;  1GPX A;  1IPG A;  4BBN C;  2IGD A;  4RF0 A;  3A33 B;  1H4R A;  4JIO U;  2J52 A;  1CJE A;  2A4Z A;  3CSF A;  5E6O A;  2D3A A;  1HTQ A;  2PMV A;  2JRI B;  2LAS A;  1C4P A;  1IBX A;  1T0R C;  2KTR B;  3CST A;  2BTE A;  2ZNV B;  2PW9 A;  4BZA A;  1WSP A;  2O6V B;  3ZNI D;  4PK1 A;  1WZ0 A;  3ENE A;  1D6E C;  2BS2 B;  1PGA A;  3W1S C;  3D32 A;  2LXC A;  4GLS C;  3P4Q B;  2K25 A;  2K6Q A;  3OJ3 A;  2NTT A;  1VRA B;  4ZHO A;  2MJ3 A;  1UZX B;  3R3M A;  2G1E A;  4M01 A;  2NPT A;  1SJH D;  3LYY A;  3T9L A;  1KM7 A;  4AQ7 A;  4US9 A;  4KX6 B;  5KHO A;  4ZRP A;  2N7D A;  1Q5W B;  4MEM A;  4M8M A;  1WMH A;  2WXM A;  5TSS A;  1QIL A;  4HJG E;  2KT7 A;  2MH7 A;  1QZE A;  2BYF A;  3N1Y C;  4HDQ A;  3LXF A;  1B9R A;  4A90 A;  4EUT A;  2LZ6 A;  3AEE B;  3VRA B;  3BVG A;  4HCP B;  2L00 B;  4FXC A;  3TEX A;  4LDT D;  4ANV A;  1JWS D;  3KUZ A;  2Y3A A;  3QHT A;  2PLP A;  2GI9 A;  1TS2 A;  2GLS A;  1OFF A;  3PRZ A;  1QOG A;  1WI0 A; 
#chains in the Genus database with same CATH homology
 5LNK 1;  3IT4 B;  2QJL A;  4XDD A;  4MT5 A;  1TY2 A;  1FCL A;  2W82 A;  1F2R I;  4XDC A;  3UI3 A;  2ZW0 A;  4XWT A;  2AQ2 B;  1QF6 A;  1F77 A;  1JWA D;  1R7S A;  2QMT A;  1SF0 A;  3P42 A;  5HFY A;  1FEH A;  1JQ4 A;  1FXI A;  1KLU D;  1ESF A;  1L6V A;  5EE3 A;  3NVW A;  1DOY A;  4US8 A;  5BYR A;  3NS1 A;  3ZQ4 A;  2JYE A;  4HEA 1;  1FNU A;  2WXH A;  1C79 A;  4YTM B;  1P7F A;  3O13 A;  1PYW D;  4XE0 A;  2I2Y A;  1FXA A;  2AQ1 B;  1F2R C;  1RM6 C;  4OZC A;  2BYT A;  3P4S B;  1ET6 A;  2MJE A;  3E56 A;  1CZP A;  1WRI A;  2DLB A;  4L2Y A;  4RGT A;  3Q8B A;  2ONQ A;  2ON8 A;  1SEB D;  3AV8 A;  1PFD A;  2BB5 A;  1VZ6 A;  2DYO A;  2K3U A;  2KAC A;  4YTP B;  4B0M A;  5G5G A;  1KFY B;  1ZXI A;  3MFG A;  1L0Y B;  3NVZ A;  2GRI A;  2BS3 B;  1I4G A;  1FRD A;  2M0A A;  3Q8F A;  1NYQ A;  1GOZ A;  3FIL B;  1EWY C;  2HTM E;  1L5P A;  3TSS A;  3FIL A;  3N9Y C;  4USA A;  3KLS X;  1FM0 D;  3C8Y A;  1I4R A;  1J7A A;  2RMM A;  3ZYY X;  4ZYS A;  2IGH A;  3VRB B;  2QEJ C;  1BUI C;  1HEZ E;  2LUM A;  1FFV A;  1JRO A;  2Y5C A;  1L4D B;  5BMG A;  1VJK A;  4L1B A;  3H8H A;  4KKJ A;  4P16 A;  1I4Q A;  1A70 A;  1NEN B;  1ET9 A;  3IAS 1;  1CK1 A;  1RWS A;  4YSX B;  3EUB 2;  2N9L A;  1JW9 D;  2M56 B;  2VZK B;  4IKG A;  2PIA A;  5D7G A;  4TSS A;  2J42 A;  3NRZ A;  4EE2 A;  1YJJ A;  5EE1 A;  1TKY A;  3TEY A;  1K51 A;  1SBB B;  4LLG M;  1E0Z A;  1AYF A;  5JXV A;  1JML A;  3DWM A;  2WU5 B;  4A8X C;  1ZPS A;  2WDR B;  4OZA A;  2LFI A;  2K0P A;  1BXT A;  2W55 A;  2ACZ B;  2JX5 A;  1E10 A;  4DXF A;  2IDY A;  2LHD A;  4J3O D;  3Q8C A;  4KGT A;  2V0G A;  4TMA B;  4OVZ A;  3BVZ A;  3W9C B;  1N62 A;  3AE9 B;  1TYG B;  2V3N A;  3GP7 A;  2LMC A;  3FC4 A;  3R2I A;  4KGS A;  4HKQ A;  2WXR A;  2WP9 B;  1LO5 D;  4YTN B;  3ZGZ A;  4RGN A;  1FD6 A;  1PGX A;  1SSN A;  2OED A;  2FE8 A;  2W54 A;  3AEG B;  1EWC A;  1XO3 A;  5FK9 C;  2YEP F;  1MHX A;  1P7E A;  1V1O A;  2SAK A;  1UWM A;  3R8B A;  4YSZ B;  1UNS A;  5D3D A;  2N9K A;  2Z8L A;  2HDE A;  5C3J B;  3I9V 1;  1YN3 A;  1D4B A;  1VZ7 A;  4RNA A;  2K5P A;  1VLB A;  2SEB D;  1JWU D;  3B2G A;  1D5X C;  1PUT A;  2R61 A;  4WIP A;  3W2D A;  2M19 A;  4WWM A;  2WNM A;  2L52 A;  5H92 C;  1ZP0 B;  5AUI A;  4MM3 B;  3AEF B;  1UWX A;  3FAH A;  3SEB A;  1V1P B;  3T3O A;  2CJN A;  1V1P A;  2OHF A;  2L1A A;  2KDM A;  4MAC A;  4YXD B;  3AM9 A;  3IXS A;  4N58 A;  3AEC B;  4C7Y A;  2L83 A;  4NAW B;  1BML C;  3LB8 C;  4N6E B;  4YT0 B;  2QSD A;  1N5W A;  2N7J A;  1RFK A;  4C80 A;  2J53 A;  2L32 A;  2DWQ A;  2IGG A;  3E9S A;  3NUH B;  4JX1 C;  4R3D A;  1UGJ A;  1JWM D;  3GB1 A;  1SE4 A;  2PVO D;  2K22 A;  5E6J A;  3T3N A;  4TQ1 A;  2LHE A;  1WGK A;  3BK1 A;  4WUR A;  1FFU A;  3HVZ A;  3BVM A;  1SXT A;  2LGI A;  4HRS A;  5EE0 A;  3J9C A;  4MH8 A;  3HUI A;  1D5Z C;  3AE6 B;  1PDX A;  2BB6 A;  1SE2 A;  2BS4 B;  3HRD D;  3BWU D;  3SR6 A;  1DGJ A;  1AN8 A;  2WXL A;  1I4H A;  1N61 A;  4ZHP A;  1KH0 A;  2ZW1 A;  1FRR A;  1FNV A;  3V3X A;  2JWU A;  4H2A A;  4HRO A;  1I4P A;  2DBY A;  2PKO A;  5BYS A;  5GXG B;  1TJE A;  2N0S B;  2FUG 1;  1E7P B;  4WH4 A;  1TZO A;  1J7C A;  1C9F A;  1HXY D;  4L23 A;  3WCQ A;  3BYT B;  4NJC A;  3ETR A;  3AE1 B;  3ZJV A;  1HA5 A;  1YNT E;  4YWG G;  1E9M A;  1YN4 A;  2X38 A;  2V3P A;  1TKG A;  3I57 A;  4IDI A;  5G5H A;  1ZXH A;  1NVI D;  1EU4 A;  1B1Z A;  4B0E A;  1QOA A;  2QIL A;  5BMH A;  1ACC A;  1C4A A;  1ROE A;  1XLN A;  2B76 B;  1VR9 A;  1K53 A;  1C78 A;  3P4P B;  1GAQ B;  2WXG A;  3TEW A;  4DXG A;  4OW0 A;  1XF5 L;  1WYG A;  3P1M A;  2WXN A;  2WQY B;  1L0X B;  5FKA C;  3VR8 B;  2CJO A;  2ICI A;  3AE4 B;  4RGO S;  1NYR A;  1T3Q A;  2RDG A;  1K52 A;  1JCK B;  2WXO A;  4ZOH C;  1VZ8 A;  2VZK D;  3URY A;  2H88 B;  3U4E G;  1L0V B;  1Q10 A;  1WXQ A;  2W3R A;  3GS2 A;  1FO4 A;  1QQR A;  3TEZ A;  3U52 E;  3AE2 B;  3B9J A;  3SFD B;  1YN5 A;  1C77 A;  3Q8E A;  2W3S A;  3KQ4 A;  1L6U A;  4DQO C;  1GB1 A;  1TY0 A;  3KWL A;  3RFZ B;  3Q8A A;  4LK0 M;  1DYQ A;  1UUP A;  1MI0 A;  2WXK A;  1XLQ A;  2FBW B;  1MHH E;  4ITK A;  2BBC A;  4KGR A;  1FNW A;  2WU2 B;  2WXF A;  1IUE A;  5I4D A;  1DOI A;  1TS5 A;  1XLP A;  2TSS A;  5D3I B;  3AEA B;  3W5V B;  1YMH E;  3PO0 A;  3V05 A;  2JZP A;  2BW2 A;  4NZL B;  2WXQ A;  1STE A;  1ZE3 D;  2INN E;  4JWU C;  2WXJ A;  1TS4 A;  2JSV X;  2EEL A;  3MC0 B;  3BII D;  1AW7 A;  3AB5 A;  3ZJT A;  1FIQ A;  3VR9 B;  1J7B A;  1V8C A;  2J4X A;  1L4Z B;  1NI3 A;  2EKI A;  1HZ6 A;  4UDU C;  4ARC A;  2WDV B;  4HKZ E;  3U7Z A;  1C4C A;  1I4X A;  4REZ A;  3BYY B;  1JWB D;  1D5M C;  2RPV A;  3R2T A;  4TQ0 A;  3SFE B;  3W5U B;  4C56 C;  1TS3 A;  2XN9 C;  5HI1 A;  4RFB A;  1Y56 A;  1SE3 A;  2E3T A;  1ZOY B;  3NVV A;  5AUK A;  5EE9 A;  2LEK A;  2WS3 B;  1RYJ A;  1DOX A;  1F0Z A;  1HZ5 A;  1KRH A;  1QOB A;  3MJ5 A;  3AE3 B;  4IOI E;  1XCQ L;  1K50 A;  1KTK A;  4JWS C;  2Y5P A;  3HVD A;  2DYM A;  1ENF A;  4RGM A;  1YQ3 B;  2YEP B;  1SIJ A;  4WQM A;  1HQR D;  1N63 A;  3ZJU A;  4M0W A;  2H89 B;  5T8I A;  1ZUD 2;  1IGD A;  2INP E;  3MP9 A;  2KN4 A;  2RDH A;  4A55 A;  5H8Y E;  4KKI A;  1SB3 C;  3BZD B;  1EM7 A;  3BK2 A;  3DWG C;  2WDQ B;  2WXI A;  3MHZ A;  1GB4 A;  2PVG C;  2NMQ A;  3VQI A;  3B2F A;  4ARI A;  1KF6 B;  1QKZ A;  3TUO A;  1GPX A;  5FR3 A;  1OQQ A;  3PZ7 A;  2IGD A;  4RF0 A;  1FCC C;  1FMA D;  1XXG A;  4GDK B;  3AMZ A;  4CQN A;  1V97 A;  2J52 A;  1CJE A;  3CWI A;  4JPS A;  2IPK D;  3Q69 A;  1XCT L;  2JXT A;  3EA6 A;  2MEK A;  2PMV A;  1PGB A;  1ZDX A;  1IBX B;  3AH7 A;  1C4P A;  1IBX A;  2BTE A;  2NTS A;  2XNA C;  3AE7 B;  2PW9 A;  2I38 A;  3P63 A;  1WSP A;  1KLG D;  2IJ0 A;  4O1N A;  4LTU A;  1MPE A;  4RH6 A;  2BT6 A;  2PTL A;  3NZ3 A;  4N59 A;  4Q2J A;  1D6E C;  3NVY A;  1JAL A;  2BS2 B;  2WLB A;  3IT6 B;  1SJE D;  2JQR B;  4JE3 B;  5BYQ A;  1PGA A;  1JRP A;  2K9X A;  2MJD A;  3AN1 A;  3IAM 1;  3P4Q B;  4GLS C;  2WXP A;  3U2S C;  2NTT A;  1VRA B;  4ZHO A;  4D2K A;  2MJ3 A;  4A9A A;  2G1E A;  1SJH D;  3EGR A;  3LYY A;  3PZ8 A;  4A6Q A;  4AQ7 A;  1YJI A;  4US9 A;  4XWW A;  3AE5 B;  4KX6 B;  5MPO A;  1QOF A;  1XLO A;  2E6X A;  4ZRP A;  1N60 A;  1I7H A;  1AWD A;  2KQ4 X;  4NAM A;  5HG2 A;  2WXM A;  1M4V A;  3RPF C;  2JYT A;  4OZB A;  5TSS A;  5C2T B;  2D5G A;  3P4R B;  1QIL A;  1QT9 A;  4HJG E;  4YSY B;  2MH7 A;  1IGC A;  2LJI A;  3OWE B;  2G9H D;  1XEE A;  4WAF A;  1WWT A;  4PT5 A;  2KWD A;  1C76 A;  1N5X A;  2CU3 A;  3LXF A;  1B9R A;  4A90 A;  1VDV A;  1TKE A;  3AEE B;  3ABV B;  3VRA B;  3BVG A;  2QIE B;  2JU6 X;  1CQV A;  4GDL B;  1E6E B;  4FXC A;  3TEX A;  3AE8 B;  2AQ3 B;  4P6V F;  2GB1 A;  3AED B;  1JWS D;  3KWV A;  1OQR A;  2KAJ A;  1MVK A;  5BMI A;  2Q5W D;  2Y3A A;  1EU3 A;  1YQ4 B;  2PLP A;  4RCO A;  2GI9 A;  3CIR B;  4AS1 A;  2KMM A;  3L4P A;  1NEK B;  5HHD G;  2AX5 A;  4ZRQ A;  3W1S A;  1TS2 A;  1OFF A;  4RF1 A;  4OHJ A;  3AEB B;  4C7Z A;  1QOG A;  1T6B X;  1QLB B;  2V4I B;  1ZDV A;  1T5X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...