2L83A

A protein from haloferax volcanii
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
MEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 1
publication title A protein from Haloferax volcanii
rcsb
source organism Haloferax volcanii
molecule tags Protein binding
total genus 7
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2011-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2l83A00
2PIAA 2WP9B 3AEBB 1XLNA 1SB3C 1CJEA 2PVGC 1JW9D 3FAHA 5EE1A 2W3SA 4YTPB 2AX5A 1VDVA 3AEEB 3RPFC 1TKYA 2HTME 4YTMB 2LEKA 1AYFA 1N60A 4JWSC 4HROA 1XLOA 1QLBB 2QIEB 3ETRA 3WCQA 1J7AA 4C80A 2WDQB 2CU3A 2W3RA 4ZHPA 5C3JB 1PDXA 1FFUA 4ZOHC 1JWAD 3L4PA 1PUTA 2BS4B 1QOAA 3AB5A 2WLBA 1GAQB 4ITKA 4YSZB 1IUEA 3BIID 1FXIA 5EE3A 3NRZA 3ZYYX 1YJIA 1J7BA 2M19A 1NEKB 3W5VB 4YSXB 3AE6B 1VLBA 2G1EA 2K5PA 1N63A 1FRRA 2WU2B 4YSYB 2CJNA 1NENB 1E0ZA 4WWMA 2MJDA 2WS3B 3DWMA 1FRDA 1TYGB 2PVOD 1A70A 3AMZA 3VR9B 1FO4A 1JRPA 1JALA 1L6UA 4N58A 5H92C 3VRAB 1QT9A 3AE7B 3AH7A 3AECB 3SFDB 1UWMA 3NS1A 1V97A 2W55A 5H8YE 3P4RB 5G5GA 3AEFB 1I7HA 2DBYA 2MJEA 3CWIA 4FXCA 1TJEA 3PO0A 1ZOYB 2Q5WD 3AE8B 1L0VB 3AEGB 5MPOA 1QOFA 1OQQA 1WXQA 3W9CB 1ZP0B 1E7PB 1PFDA 1QOBA 2H88B 4C7ZA 1DOYA 2W54A 2OHFA 4YT0B 4A9AA 1KF6B 2KAJA 2L52A 3LB8C 4YTNB 5G5HA 1L6VA 2EKIA 2MJ3A 1WRIA 2BS3B 1NVID 2WDVB 2FBWB 1RFKA 2Y5CA 3HUIA 5AUKA 5GXGB 1FM0D 4USAA 3AE1B 2DWQA 2JX5A 1TKGA 1ZXIA 3B2FA 3VRBB 1F0ZA 3AV8A 3B9JA 1T3QA 1N5XA 1FFVA 2K9XA 3KWLA 3P4SB 3P4PB 1KFYB 2L83A 2BT6A 2WQYB 3FC4A 3AEDB 2CJOA 3HVZA 2H89B 4ZHOA 4US8A 2E3TA 1E6EB 3AE2B 2K22A 3AE3B 1FMAD 3EUB2 1YQ3B 3NVYA 1DOIA 1QF6A 1J7CA 1JROA 1JWBD 3ABVB 4HRSA 1YJJA 4US9A 5C2TB 2QJLA 1DOXA 2BS2B 3NVZA 3LXFA 1ZUD2 1E10A 3AE4B 1SIJA 1L5PA 3AE9B 2N0SB 3CIRB 2KMMA 3P63A 1CZPA 4LTUA 1XLQA 1R7SA 1WGKA 1AWDA 1GPXA 5AUIA 1FIQA 4IDIA 1V8CA 5EE0A 1N5WA 1E9MA 2B76B 1DGJA 1NYRA 1JQ4A 1EWYC 3P1MA 1TKEA 4KX6B 4N59A 4N6EB 1ROEA 2MH7A 1NYQA 1OQRA 1WYGA 3B2GA 3AM9A 2PKOA 4JWUC 2JQRB 3NVWA 5EE9A 1SF0A 1NI3A 3AN1A 3SR6A 3W5UB 1QOGA 3DWGC 1RWSA 1VJKA 1KRHA 4C7YA 1N62A 3AEAB 4P6VF 3P4QB 1RM6C 1WWTA 3HRDD 2ACZB 1XLPA 4WQMA 3AE5B 3SFEB 1XO3A 1B9RA 1OFFA 2WU5B 1YQ4B 1RYJA 2M56B 3NVVA 4JX1C 2WDRB 1N61A 1FXAA 3VR8B 4YXDB
chains in the Genus database with same CATH superfamily
3PZ8A 1E7VA 3U52E 2WDTB 3PZ7A 5JHAA 4C4VB 1TKYA 2HTHA 4X57B 1KJTA 3T8MA 3ETRA 1C77A 3H7PA 4II3B 1WGYA 1BXTA 2KD0A 4GXBA 2WLBA 1T0YA 2LASA 2MWSB 3ZRCA 1IGCA 3Q3NC 4LDTD 4RF1A 4KZ0A 3MC8A 4REZA 2MRPA 3MTNB 4LCDE 4AP4C 3QAQA 4N58A 4WJPA 2FCQA 4IM3A 2MJEA 2J0MA 4FXCA 1FNWA 1P7FA 4NJCA 5LLIA 2KT7A 2LGIA 1KF6B 1KH0A 5G5HA 2N9LA 4GMVA 3TCAA 1WRIA 4W9CA 1NVID 4EUTA 1WJ4A 2FBWB 1RFKA 3AXCA 2L05A 1FCCC 4OVZA 3MC0B 4W9HA 2LI5A 3ZNGC 2Z8LA 1UD7A 4ZRPA 3NVYA 3A9JA 3AE4B 2KMMA 1KM7A 3A33B 4K3CA 4IDIA 1N5WA 2B76B 3KW5B 2PPHA 5BMGA 2BF8B 4MJSB 2N4FA 3SDLC 3PSEB 1UZXB 2ACZB 3Q8FA 4W9LA 1YQ4B 1SE9A 3H6NA 4M0WA 1ZDXA 2CU1A 2IDYA 1WR6E 3CMMB 4FJVB 4BKSD 4GDKB 3QHTA 2QIEB 2GB1A 4E3CA 2CU3A 1P3QU 2IGHA 2KVRA 4ZHPA 3AU4A 1PDXA 1JWAD 1PUTA 5C1ZA 4MGKE 2D11A 4FULA 4BBNC 2KX3A 3ZYYX 3BZDB 1R4MI 2JPHA 2MP2B 1HE8A 1VZ7A 3L54A 1E0ZA 4WWOA 1V81A 4DXGA 2RR9A 1VRAB 1I7HA 2ZCCA 3AEGB 3JW0X 4NPNA 1PFDA 3GS2A 3M3JA 2ZVNA 2KAJA 3TL5A 3RI7C 4KZCA 4A90A 2BS3B 2C5LC 1FM0D 1ET6A 4USAA 3B9JA 3KWLA 2ZW0A 1VZ8A 2WGSA 2WWZA 2H89B 4KV2A 1L0XB 2LWPA 3WIMA 3H7PB 2J42A 1QKZA 2RMMA 1J8CA 3VDZA 4FBJB 3VUWA 3DBLB 4I6LB 5FK9C 2D3CA 3Q8AA 2BYEA 5FKAC 4KX6B 2KC1A 4A3OA 2BYFA 1MVKA 3AM9A 4DXFA 1F2RC 4JQWC 2ON8A 1HZ6A 1N62A 4WJQA 3K9OB 2WXFA 4BKSA 2K8BA 1XQQA 3ZTDA 1J0GA 2MBBB 2BW2A 3VR8B 1GJZA 2WP9B 3A9KA 1MHXA 2NMQA 1XLNA 4ACFA 1CJEA 1JW9D 4BOSC 1YQBA 4HVBA 2RGFA 4GDLA 2WX0A 4HDQA 1TT5B 3RCZA 2EMTA 2RDHA 4ZOHC 2IO1B 3EECA 3IVFA 2AQ1B 4EKUA 3PRPB 3U8ZA 3A9JB 1UF0A 4YSZB 4ICVA 2X38A 4ASWC 4AJWA 4YSXB 4RGTA 1PQSA 4B9KA 1A70A 1FO4A 4KGSA 2LGSA 3FKYA 3Q8EA 4HXDA 3P4RB 1ZXHA 1EF1A 2PJHA 1QOFA 3U2SC 2GI9A 4NZLB 4AOFA 3TEYA 3DVGY 4Q2JA 4W9FA 4BZAA 3R2IA 4M0WB 4HPLB 4GN1A 4XDCA 2GOWA 3V60A 3BWUD 1TKGA 4ARIA 3P4PB 2CR5A 2WQYB 3AEDB 5LXIB 2IO3B 2DZJA 1E6EB 3ZDTA 1NI2A 2VZKD 1J7CA 3GB1A 3NVZA 1E10A 2J0KA 1L5PA 2DAJA 2WXOA 3PRMB 3R7QA 1FNVA 4L23A 4GU2A 1XD3B 2YVCA 3UIOB 3RNGC 3T3OA 2JZZA 2BBCA 3C19A 3Q2AC 3RYTA 4JX1C 5E6PA 4TV3A 1FXAA 2C7HA 3V05A 5EDSA 3J9CA 4CQNA 1YX6B 2YEPB 1UWXA 3DBHI 3N3KB 4MELA 1WXMA 2WXQA 4OHJA 3S2AA 3VUXA 1HTOA 4EZLA 3I5JC 3WCQA 3BYTB 3OAWA 2JYEA 2J7QB 1ISNA 4HPMB 2KJRA 2ASQA 2G9HD 3BIID 4G3XB 2CHXA 2IO2B 1YJIA 3RNAC 2A5UA 3VVWB 2REXA 2PVOD 4LNNA 2DNFA 4HCPB 3KYDD 3AECB 1R4MB 1V97A 5CHVC 1YNTE 1ZGUB 4ZRJA 1RFAA 2K3UA 5TSSA 3VQIA 2KNBA 2VH1A 4K3BA 2OJWA 2JXTA 3OJ3A 2WNMA 3ZDMC 2KJ6A 3A9KB 4MDKE 2Y5CA 3HUIA 4NQLB 5AUKA 1G6JA 2BYTA 2N9PC 4KVGB 2D2QA 3DVGX 1WE7A 2M4NA 3Q3JA 4GDLB 1RAXA 1BMLC 4G50A 3UIPB 2TSSA 2DLBA 5KHOA 3PRZA 1JWBD 1NDDA 4S17A 5D6JB 1WJNA 5IAAC 4P1CC 3VFKA 1SGHA 1V8CA 1VZ6A 2LVOA 1F77A 3QJZA 1JQ4A 3MP9A 4IWOA 1K50A 1TS4A 5EE9A 1SF0A 2KDBA 3DWGC 3PPAA 3PT2B 2LD9A 2IYDB 1Y56A 3VH3B 3DVNU 1VJKA 3PREA 1ENFA 3IBEA 4AUQC 4I6PA 3N1XC 4XDDA 2PIAA 2I38A 4OZCA 1SXTA 1EU4A 1TZ1A 2LRUA 1ZDVA 5IP4D 1N60A 2D3AA 2V9HA 5C3JB 1SE2A 1FFUA 4IWPA 1D4BA 4ITKA 4JL9A 1WJ6A 3W5VB 1VLBA 1FEHA 1TY2A 3QA8A 2KLGA 2MJDA 3ZVVA 2Y5BB 4NJ7A 1UNSA 3L16A 2UWQA 2KN4A 2W55A 2ICIA 2Z59B 1IBXA 4BFRA 1WMHA 1HZ5A 1SE4A 2BPSA 1L0VB 3RNEC 1V1OA 5MPOA 4ZYSA 1STEA 1D5XC 1ZP0B 2H88B 5D2MB 2W54A 5CTRC 3APCA 3TMPB 4B6WA 1YMHE 4KKJA 4M01A 4GB9A 3PLVA 3RZFA 5GXGB 1FCLA 1F1HA 1FNUA 2BB6A 1ZXIA 2MX2A 1GB1A 4GGQA 3AU5A 2HE7A 2N1WA 3FC4A 2L76A 3AE2B 1C76A 1WX9A 3I3TB 2DENB 1ZUD2 3AE9B 3ZQ4A 1XLQA 4B0EA 1S1QB 1ROEA 2FIFA 1Z5SB 2MEKA 2KACA 3CSFA 3QQ8B 3W5UB 3WA0A 4M02A 5DPWA 2KDMA 3D32A 1KRHA 2V0GA 2D3GA 2I1KA 3WALA 5IA7A 4HLEA 4YXDB 1MI0A 1L0YB 2QMTA 4BKTA 1SEBD 4G0NB 2L7RA 3RPFC 1IGDA 5DCNA 2PMVA 2NPTA 3URYA 3EFCA 2W3RA 4XX5A 3N32A 2GMIC 4HWIB 4P16A 2V3PA 4O1NA 5HHDG 5BMIA 5DPRA 1TS2A 3UF8A 2WXMA 2M19A 4HPPA 3PS6A 1UGMA 2IJ0A 5BYQA 5TR5A 4A6QA 2ONQA 4K7UA 4YWGG 4IKGA 1CK1A 2JWZA 2FAZA 3V6CB 2WXKA 1UWMA 3NS1A 4WWPA 4W9KA 2KDEB 2J53A 4C00A 1SSNA 3CSTA 1WRDB 4RH6A 1UBQA 2LMCA 1I4GA 1ESFA 1M94A 3EGRA 4OVVA 3VAWA 2BTEA 1VD2A 2V3SA 4BBNF 5D3IB 1YIWA 3Q3FA 3TUOA 4PS7A 3N1YC 1XCQL 4HEA1 3RMKC 4HJGE 2NBWB 3DQVA 4DQOC 5IKCM 2JWUA 1I4RA 5HKHA 4DHJB 2N0SB 1CZPA 4IOIE 4EZKA 3IAS1 1DGJA 3P1MA 3KVFB 4LJOB 2N7JA 2K0PA 1OQRA 3B2GA 4DXAB 3DBRI 5E6JA 4HKQA 4N9F4 1IBXB 1WMHB 1XT9B 3K9PB 2WXNA 4WQMA 5D94A 2RDBC 4S0RA 2MLBA 2WU5B 1D5ZC 1UH6A 4W9DA 5CX3A 4KGRA 3RUIB 1SB3C 1T0RC 3FAHA 3NS8A 3HHMA 4MH8A 1AYFA 1XLOA 3KH0A 3UQAA 2L00B 1FXTB 2LFIA 1WZ3A 1E7UA 1V80A 4TQ0A 1P9DU 1TIFA 2JT4B 4EOYA 1IP9A 2G1EA 1FRRA 3N30A 4AS1A 1P1AA 3GE3C 3P2BA 4WWMA 1TYGB 3E9SA 3HK0A 2NTSA 3AE7B 4B95A 2NCNA 3BK2A 4JLCA 2IGDA 5G5GA 2BWFA 2DZMA 3WAOA 2GBJA 4RM9A 3DPDA 3KUDB 1GUAB 3HIZA 2IO0B 4ZRIA 4YL8A 1C78A 4WJNA 2WDVB 1JRUA 2KO3A 2DWQA 3ZIMA 1U4AA 1F0ZA 1T3QA 2EMSA 5J2RA 3NG0A 2NPTB 4NAWA 3ZXVA 4ZHOA 3W1SC 1YQ3B 4RGOS 1WJUA 3KYCD 1LQBA 2JUOA 1WGKA 2XK5B 3L17A 2KQSA 3X0WA 1D6EC 2O2VB 1BT0A 5JH5C 1TBEA 1YX5B 2ZEQA 4JWUC 2FIDA 1T0SC 3Q3OC 3SR6A 5IOIA 4P7IA 1L4ZB 3P4QB 4MT5A 2LHDA 4P1BC 4WAAA 4WURA 4KDIC 3UGBB 2PVGC 2ZPYA 5CHWA 2WXHA 1MJDA 4YTPB 3T9LA 2INNE 1WFYA 4KGTA 4EE2A 4W9EA 1XXGA 3DHGC 4DDGD 3Q8CA 3AULA 2K6QA 2KTRA 2WXJA 4DDID 1TZOA 1C3TA 1WF9A 3VHTC 2KWDA 1E8ZA 1P0RA 2WX1A 2ZJDA 1C79A 3PGEA 2FCNA 1JALA 2BKFA 3VRAB 4NJ6A 3ZJTA 1MG8A 2IY0B 1ZOYB 3L08A 2DZIA 4MGYE 2M0AA 2PLPA 1C1YB 2KXJA 2MJ3A 1JWMD 2RPQA 4LNOA 4D2KA 2L0FA 3V61A 2N7EA 2NBVB 3W1SA 4NY0A 3C8YA 5DPSA 1GB4A 1JROA 3LDZE 2QJLA 4ANVA 1YN4A 1SE3A 1WM2A 5J18A 4CHKA 1HEZE 2BYVE 4CO7A 1EWYC 4JGHB 4PT5A 2OOBB 4A20A 2PKOA 2LJ5A 2JQRB 5BMHA 3RN9C 3DDCB 5JZEB 2QCZA 3ECIA 1I4QA 2C60A 3DBRB 2L8JA 5C23A 2AL6A 3TIXA 3DBSA 2WYQA 4LNIA 2B3AA 3ONSA 4K7SA 2W3SA 4HDOA 2CKHB 1EO6A 4NAWB 4HKZE 4XWWA 2MHJA 1IUEA 2WXRA 1FXIA 4MACA 5EE3A 3EHVA 4TMAB 2MBEA 4PK1A 1EF5A 2WU2B 4YSYB 2CJNA 3SHQA 2G45B 2UYZB 2KLCA 1DYQA 4F1SA 3CWIA 1R4NI 2DX5B 2FUHB 2LVQA 2INPE 2ZPNA 4FJYA 4M8NA 3AE8B 2JRHA 4ZYNA 1F52A 1WGHA 1TY0A 3RNCC 3U7ZA 1Q0WB 2KANA 2LXCA 2ZW1A 2L52A 2JRIB 3GZNI 4IUMB 3JSVA 5D3DA 4ZDVA 4ZRQA 4WJOA 2JX5A 3VRBB 3T3NA 3VTWA 3NZ3A 2QSDA 2L83A 4DHJD 1OTRB 3WAMA 3V62A 3EUB2 3AE3B 3R7RA 2XEWA 1QF6A 2J4XA 3LXFA 2KMCA 2KTRB 2HD5B 4NQKE 3ZNID 2KQ7A 3TJPA 1T5XD 2GBKA 2NR2A 2MW5A 4RM8A 4ZRKA 3A4SC 3A1QA 3A4RA 1GC6A 1WYGA 1T0QC 3QARA 4DK5A 1YN3A 1XCTL 3L13A 1KTKA 4RNAA 3N20C 3R66C 3LYYA 2JVCA 2KC2A 3HRDD 1XO3A 2OJRA 3Q8BA 2VH2A 3OJ4B 1I35A 3O13A 3B0AA 2M1MA 3ZUNA 5EE1A 1Q10A 4J6IA 4OW0A 1E90A 5CHFA 4C80A 2KJHB 3ZW3A 1CMXB 1V6EA 1MPEA 3PTFC 3NRZA 1J7BA 2G3QB 5IN7A 3AE6B 2L32A 1JWUD 4EFOA 3OLMD 1CQVA 1PYWD 2JZ3B 1L6UA 1QT9A 3PHXB 4FN2A 4UDUC 3V3XA 3AEFB 4KDLB 3DVNV 2HJ1A 3ZJUA 2KKCA 4XC2A 1E7PB 2QEJC 4FLHA 2OHFA 2PTLA 2RD0A 3VTUA 4OZBA 1Q1OA 2EKIA 2L1AA 2SEBD 5G55A 2WHIA 3B08A 4M00A 3ZTCA 4WAFA 3P4SB 4GSWA 3FILB 3HVZA 1QZEA 4GIVA 2E3TA 3GOEA 1WY8A 5L95C 3ABVB 4US9A 3RULA 2K6DB 2IPKD 4DBGA 5AUIA 3W2DA 4PS3A 4I6NB 1TKEA 2K8CA 3UINB 2MH7A 3X23A 2FCSA 3NZSA 4QAYA 2MCNB 1OEYA 3BVMA 1H4RA 2C7NB 4HCNB 3KLSX 2IZVB 1VCBA 2FNJB 2I1JA 1B9RA 3NVVA 3PZDA 5AZFA 2FE8A 2JZPA 3AEBB 3JSVB 1K8RB 3TEZA 3I9V1 2KFKA 3ZO5B 2JSVX 4YTMB 4HROA 5GMVA 2KTFA 4TSSA 3RT3B 3MFGA 1L7YA 3H9DA 4M8MA 3QWZB 2YEPF 1GAQB 4MEMA 2NS5A 1HTQA 3PLUA 1LFDA 4IC7B 1N6ZA 1SIFA 1WGRA 4CYEA 3DWMA 4IG7B 1XF5L 1UBIA 3A1QB 4JE3B 4DHZB 5J17A 2BWES 2CS4A 1EU3A 2PE9A 3DBHB 3VH4B 4WWNA 1BUIC 3QCAA 1QOBA 1ZW7A 4PYZA 3V6EB 1SJED 1R4NB 2N9EB 4YTNB 3B1LX 2XK5A 2M0XA 2K25A 2C7MB 2LUEA 2O2VA 3RZWC 4W9GA 1HXYD 3GP7A 3GZNB 5FR6A 2BT6A 2PEAA 3MJ5A 5BYRA 1ZKHA 3TEWA 4WH4A 3I57A 2AEHA 2KK8A 5C2TB 1GOZA 2FCMA 4NNJB 3OWEB 2MA9B 1R7SA 3NZUA 1A5RA 1GPXA 2ZNVC 1FIQA 3IAM1 4RFBA 1YN5A 2LHEA 4B0MA 3HM3A 2O6VA 2MBQA 1RRBA 1P98A 1NBFC 3AN1A 3N9YC 2R2QA 4XGAB 4BAXA 2DYOA 4L1BA 3PHWB 1V5TA 2V3NA 2INDC 3NUHB 2ZCBA 2G4DB 3DCGA 1PGXA 2LZ6A 2GRIA 3AEEB 4XZ4A 3EA6A 4JPSA 4GLSC 2WDQB 2KWCA 4H2AA 3L4PA 3TSSA 3QX1A 3RFZB 3H8HA 1WR1A 3C0RB 3HVDA 2ZZPB 2K5PA 1N63A 1V1PA 1I4HA 1V9JA 3IFWB 5L83A 3AH7A 4ICUA 1GG3A 2LGXA 1WGDA 2RSUA 2DBYA 1TJEA 2CHZA 2DYMA 1WXQA 4RMAA 5FR3A 2KOXA 2BVCA 3SU8X 2INCC 3SEBA 4MSQB 4LJPB 2KFKB 5HG2A 1YD8U 1E8XA 2SAKA 2BKRB 1V5OA 4EEWA 2W82A 4BOZB 2CJOA 5IO9A 3BK1A 1DOIA 2KQ4X 2G4SA 2Y3AA 1YJJA 2LRWA 4AQ7A 2BS2B 1WX7A 2VRRB 5EE0A 3WAPA 3I63C 2L3ZA 5KHQA 4N59A 4N6EB 1KOTA 2AQ2B 1HA5A 4A8XC 2MBHA 4KSKC 4AJYB 2BQQA 1RWSA 1AN8A 1D3ZA 3SFEB 1T6BX 1EUVB 4FHJA 5AEKB 3KUZA 3KWVA 2M56B 4GOCA 4MH0E 2R2OA 2N9XA 4TQ1A 3Q14C 1OEYJ 4IWQA 2AYOB 3M62B 1WXAA 2QILA 2QHOA 2KMAA 5JHBA 3RD2A 3P42A 2J52A 2JYTA 1UELA 1HQRD 2JXXA 2MBOA 4F7ZA 1QOAA 1WYWB 3ZNZB 4IM0A 3U30A 2KDIA 2GBRA 2D10A 4RGMA 1NEKB 3R3MA 1TTNA 1I4PA 4HK2A 2MSED 3LJ3A 2XN9C 1FRDA 1ET9A 4WIPA 2O6VB 5H8YE 2KWUB 1I42A 1H8CA 1ZPSA 3BVGA 3RNFC 2PE6B 2PW9A 5E6NA 4KKIA 3W9CB 2Z0EB 1V2YA 4J3OD 4K1RB 4YT0B 4FA6A 3DHHC 3GE8C 3L0WB 5DPTA 2N7DA 1TS5A 3R8BA 1K51A 3VXWA 2DHZA 1LM8B 3NHEB 1KFYB 2IY1B 3RNBC 2KVZA 3APDA 1EM7A 4NAMA 1KLGD 1MG4A 2AWTA 2DYBA 4A3PA 2KYWA 1FPYA 4LTUA 1UGJA 4JIOU 1V86A 1YJ1A 1V1PB 2QC8A 3EFUA 2NBUA 5LXHA 2EELA 4C56C 4PYUA 3DOWA 1QOGA 2KHWB 3WANA 2K8HA 1RM6C 1F2RI 2LXAA 1OFFA 3Q69A 2DZKA 2GBMA 3Q6BA 2I2YA 4EZJA 1WX8A 4L2YA 3TEXA 4URKA 2LGDA 3ZKJC 2Y5PA 2LEKA 1OQYA 4MGIE 4RF0A 3IXSA 3VTVA 1KLUD 2A4ZA 2ZNVB 1IPGA 1E8YA 3ZLZA 3KUCB 1KLVA 4ANUA 1NENB 3ENEA 1ZE3D 4FJZA 2YLMA 2WS3B 1TS3A 1WGGA 3NOBA 5H92C 4LDTB 4IW0A 3NJTA 3ZRFA 1QQRA 3FILA 3L10B 1C9FA 4MM3A 1K53A 2BB5A 2D5GA 1SJHD 2R61A 4C7ZA 3U4EG 1E5WA 3LB8C 4G11A 5HI1A 1OGWA 2IGGA 2NTTA 4BKGA 5I4DA 3TBLD 2M17A 1MHHE 3B2FA 2AL3A 3AV8A 1WM3A 2JF5A 1FFVA 3U7DA 4E74A 4US8A 2Z0DB 2K22A 1FMAD 4HRSA 2V1YA 2KZRA 1ACCA 3CIRB 4F8CB 3P63A 4W9IA 1WSPA 2C9WB 1E9MA 4LLGM 3JVZX 3UQBA 1C4CA 3IG3A 2N1VA 3EC8A 2M8SA 1S3SG 2WXLA 1NI3A 1LGRA 4ARCA 2XBBC 1XLPA 4W9JA 1GNUA 3AE5B 3CF6E 1GC7A 2GLSA 3MHZA 2LUMA 1B1ZA 3ML9A 2WDRB 2CHWA 3PVLA 4LNFA 1Y8RC 5BO4B 3ZGZA 2MQJA 1I4XA 2LVPA 1QILA 5E6OA 5LNK1 1F9JA 2HTME 3BY4B 3SD5A 3PV1A 5HFYA 1M4VA 1TGZB 2BS4B 3AB5A 3UI3A 2BGFA 1D5MC 1SBBB 1UUPA 1AARA 3IHPC 2NVUI 1LO5D 4KIKA 2L0TA 3BVZA 2W9NA 3VR9B 1JRPA 3MJWA 2JY6A 3SFDB 2K39A 4TKNA 3VUYA 2WXPA 1K52A 3PO0A 3E56A 1MFWA 1OQQA 2IBIB 2OEDA 4OZAA 2KX0A 1DOYA 3NY5A 1L2NA 4A9AA 5D7GA 1L6VA 3H1UA 3ZJVA 2QDFA 2GBNA 3M95A 4XWTA 3APFA 2UU7A 4C4VA 1N5XA 3IT6B 3QC8B 3BYYB 2XNAC 4IM2A 1PGAA 4RCOA 1FD6A 2RDGA 4KSLC 4HJKA 1AWDA 3N1ZC 3ALBA 1C4AA 2ZVOA 1X1MA 1NYRA 1LXDA 4K7WA 2V4LA 1RLFA 1V49A 2AQ3B 2EKEC 2KN5A 3KQ4A 3MC9A 4LK0M 1WXVA 2D07B 3QK0A 3ML8A 1WE6A 4MM3B 4C7YA 3AEAB 1Z2MA 4LNKA 2LJIA 2X8XX 4DWFA 1WI0A 3IT4B 4DHZE 3R2TA 2KWVB 4PS8A 2N9KA 3M63B 3O65B 1VR9A 1PGBA 2AX5A 1VDVA 4R3DA 4ANWA 4JWSC 4RGNA 1QLBB 1J7AA 5JXVA 5T8IA 3ZXRA 3MHSD 3HM6X 1Q5WB 1WH3A 2KFJA 1J19A 1E8WA 2JU6X 2LGYA 3DHIC 2O6VD 4E71A 1JWSD 3BINA 4XE0A 2HJ8A 2HDEA 2DAFA 4MGZE 3AMZA 2D3BA 4MJSA 2KDFB 4A55A 5BYSA 2Q5WD 4XYCA 4FADA 5G2NA 3QIJA 1WXSA 4AWJA 2WXGA 4ANXA 4WQOB 2E6XA 1AW7A 3Q3MC 3ZNHB 2K1FA 3AE1B 4GDKA 2K9XA 2V4IB 1YOVB 4OVUA 3H7SA 2FUG1 2J0JA 3DBLI 5AZGA 3W1YA 1JMLA 1DOXA 3JYUA 1SIJA 1C4PA 1JCKB 4KIKB 2MP2A 2VZKB 1XEEA 5AZHA 4II2B 4MSMB 1WIAA 1NYQA 4BVUC 1P7EA 4K81A 3NVWA 3AI5A 2RPVA 4TUUA 3OG5A 1WZ0A 2WXIA 4P6VF 1WWTA 4FHKA 1L4DB 1IYFA 1RYJA 1N61A 1EWCA
chains in the Genus database with same CATH topology
2PIAA 2I38A 3PZ8A 4OZCA 1SXTA 3U52E 1EU4A 3PZ7A 2W3SA 1ZDVA 1TKYA 2QILA 1N60A 3ETRA 3P42A 4NAWB 4HKZE 2J52A 1C77A 2JYTA 4XWWA 1HQRD 5C3JB 1BXTA 1SE2A 1FFUA 1QOAA 2WLBA 1D4BA 4ITKA 1IUEA 2WXRA 1FXIA 4MACA 5EE3A 4TMAB 4RGMA 1NEKB 1IGCA 3W5VB 4RF1A 1VLBA 2WU2B 4YSYB 1FEHA 2CJNA 1TY2A 1I4PA 4REZA 2MJDA 2XN9C 1FRDA 1ET9A 4N58A 1UNSA 4WIPA 2KN4A 1DYQA 2W55A 5H8YE 2ICIA 3CWIA 2MJEA 1ZPSA 1IBXA 4FXCA 1FNWA 1HZ5A 1P7FA 1SE4A 2INPE 3AE8B 1L0VB 2PW9A 1V1OA 3BVGA 4NJCA 4ZYSA 5MPOA 1STEA 4KKIA 1D5XC 3W9CB 1ZP0B 1TY0A 2H88B 3U7ZA 2W54A 4J3OD 4YT0B 2LGIA 2ZW1A 1KF6B 1KH0A 2L52A 2N9LA 5G5HA 1WRIA 1YMHE 4KKJA 5D3DA 1NVID 2FBWB 1RFKA 4ZRQA 5GXGB 1FCLA 1FCCC 1TS5A 1FNUA 2BB6A 4OVZA 1K51A 1ZXIA 2JX5A 3R8BA 3VRBB 1GB1A 3T3NA 3MC0B 3NZ3A 1KFYB 2QSDA 2L83A 3FC4A 2Z8LA 3AE2B 1EM7A 3EUB2 3AE3B 4NAMA 1C76A 4ZRPA 3NVYA 1KLGD 1QF6A 2J4XA 3LXFA 1ZUD2 3AE4B 3AE9B 3ZQ4A 2KMMA 4LTUA 1UGJA 1XLQA 4B0EA 4IDIA 1V1PB 1N5WA 2B76B 1T5XD 1ROEA 5BMGA 1WYGA 2EELA 4C56C 1YN3A 1XCTL 1KTKA 2MEKA 2KACA 3W5UB 1QOGA 4RNAA 2KDMA 1KRHA 3LYYA 1RM6C 3HRDD 2ACZB 2V0GA 1F2RI 3Q8FA 1XO3A 1OFFA 1YQ4B 3Q69A 3Q8BA 4YXDB 1MI0A 1L0YB 2QMTA 4M0WA 2I2YA 3O13A 4L2YA 1SEBD 3TEXA 1ZDXA 5EE1A 2IDYA 1Q10A 3RPFC 1IGDA 2PMVA 2Y5PA 2LEKA 4GDKB 4OW0A 2QIEB 4C80A 2GB1A 3URYA 2CU3A 2IGHA 2W3RA 4RF0A 4P16A 4ZHPA 1PDXA 2V3PA 4O1NA 1JWAD 5HHDG 1PUTA 3IXSA 5BMIA 1KLUD 1TS2A 1MPEA 2WXMA 3NRZA 3ZYYX 2M19A 1J7BA 3BZDB 3AE6B 2L32A 2IJ0A 5BYQA 1JWUD 4A6QA 1NENB 2ONQA 4YWGG 1VZ7A 1E0ZA 1ZE3D 1CQVA 4IKGA 1PYWD 2WS3B 1TS3A 1CK1A 1L6UA 5H92C 1QT9A 2WXKA 1UWMA 4DXGA 1QQRA 3NS1A 4UDUC 3V3XA 1VRAB 3AEFB 3FILA 1I7HA 2J53A 1C9FA 1SSNA 4RH6A 2LMCA 3AEGB 1I4GA 1K53A 2BB5A 3ZJUA 1ESFA 2D5GA 1SJHD 1E7PB 1PFDA 2QEJC 2R61A 3EGRA 3GS2A 3U4EG 4C7ZA 2OHFA 2PTLA 2KAJA 3LB8C 4OZBA 2BTEA 2EKIA 2L1AA 2SEBD 4A90A 2BS3B 5D3IB 5HI1A 3TUOA 1FM0D 2IGGA 2NTTA 1ET6A 5I4DA 4USAA 1MHHE 3B2FA 3AV8A 3B9JA 4WAFA 1FFVA 1XCQL 3KWLA 3P4SB 2ZW0A 1VZ8A 3FILB 3HVZA 4HEA1 4US8A 2H89B 1L0XB 2E3TA 2K22A 1FMAD 4HJGE 2J42A 1QKZA 3ABVB 2RMMA 4DQOC 4HRSA 4US9A 2JWUA 1I4RA 1ACCA 3CIRB 2N0SB 2IPKD 3P63A 1CZPA 4IOIE 5AUIA 1WSPA 5FK9C 3W2DA 3IAS1 1E9MA 3Q8AA 1DGJA 4LLGM 3P1MA 1TKEA 4KX6B 5FKAC 1C4CA 2MH7A 2N7JA 2K0PA 1OQRA 3B2GA 1MVKA 3AM9A 4DXFA 2WXLA 1F2RC 3BVMA 5E6JA 1NI3A 4HKQA 4ARCA 3KLSX 1IBXB 2ON8A 1HZ6A 1N62A 2WXNA 4WQMA 1XLPA 2WXFA 3AE5B 3MHZA 1B9RA 2LUMA 1D5ZC 1B1ZA 2WU5B 3NVVA 2WDRB 2BW2A 3VR8B 2FE8A 2WP9B 1MHXA 2NMQA 2JZPA 3AEBB 3TEZA 4KGRA 1XLNA 3ZGZA 3I9V1 1I4XA 1SB3C 1CJEA 1JW9D 2JSVX 1QILA 3FAHA 5LNK1 4YTMB 2HTME 4MH8A 1AYFA 4HROA 1XLOA 2LFIA 4TSSA 4TQ0A 5HFYA 1M4VA 3MFGA 4ZOHC 2RDHA 2BS4B 3AB5A 2AQ1B 3UI3A 2YEPF 1GAQB 1D5MC 1SBBB 4YSZB 1UUPA 2X38A 4YSXB 2G1EA 1LO5D 4RGTA 1FRRA 4AS1A 4WWMA 3BVZA 3DWMA 1TYGB 1A70A 3E9SA 3VR9B 1XF5L 1FO4A 1JRPA 4JE3B 2NTSA 4KGSA 3AE7B 3SFDB 3BK2A 3Q8EA 3P4RB 2IGDA 5G5GA 1ZXHA 1EU3A 2WXPA 1K52A 3PO0A 3E56A 1QOFA 1OQQA 3U2SC 1BUIC 2GI9A 2OEDA 4NZLB 4OZAA 1QOBA 1DOYA 3TEYA 1SJED 4A9AA 4Q2JA 4YTNB 5D7GA 1L6VA 1C78A 3ZJVA 2WDVB 3R2IA 4XWTA 4XDCA 3BWUD 1HXYD 3GP7A 2DWQA 1TKGA 1F0ZA 4ARIA 1T3QA 1N5XA 3P4PB 3IT6B 2BT6A 2WQYB 3MJ5A 3AEDB 5BYRA 3TEWA 4ZHOA 1E6EB 4WH4A 1YQ3B 4RGOS 3I57A 2VZKD 1J7CA 5C2TB 1GOZA 3BYYB 3GB1A 3NVZA 1E10A 2XNAC 1L5PA 1PGAA 2WXOA 3OWEB 4RCOA 1FD6A 2RDGA 1R7SA 1WGKA 1AWDA 1GPXA 1FIQA 1C4AA 3IAM1 1FNVA 4RFBA 1YN5A 1D6EC 1NYRA 2LHEA 4L23A 4B0MA 2AQ3B 3KQ4A 4JWUC 4LK0M 3SR6A 3AN1A 3T3OA 4MM3B 3N9YC 4C7YA 2BBCA 1L4ZB 3AEAB 3P4QB 2LJIA 4MT5A 4JX1C 2LHDA 1FXAA 3IT4B 2DYOA 4L1BA 3V05A 4WURA 2V3NA 3R2TA 3NUHB 3J9CA 4CQNA 2YEPB 2N9KA 2PVGC 2WXHA 1UWXA 1PGXA 1VR9A 2GRIA 4YTPB 1PGBA 2WXQA 2AX5A 1VDVA 3AEEB 4OHJA 4R3DA 3EA6A 4JWSC 4RGNA 4JPSA 2INNE 1QLBB 3WCQA 1J7AA 4GLSC 2WDQB 5JXVA 3BYTB 4H2AA 4KGTA 5T8IA 4EE2A 1XXGA 2JYEA 3L4PA 3Q8CA 3TSSA 3RFZB 2G9HD 3BIID 3H8HA 2JU6X 2WXJA 1YJIA 1TZOA 3HVDA 2K5PA 1JWSD 1N63A 1V1PA 2KWDA 4XE0A 2HDEA 1I4HA 1C79A 2PVOD 3AMZA 1JALA 3VRAB 3AH7A 3AECB 1V97A 2DBYA 1YNTE 4A55A 3ZJTA 1TJEA 5BYSA 1ZOYB 2Q5WD 2K3UA 2DYMA 1WXQA 5TSSA 3VQIA 2M0AA 2PLPA 5FR3A 2MJ3A 2JXTA 1JWMD 3SEBA 2WNMA 2WXGA 2Y5CA 4D2KA 2E6XA 3HUIA 5AUKA 5HG2A 2BYTA 1AW7A 2SAKA 3AE1B 3W1SA 2K9XA 2V4IB 2W82A 4GDLB 2CJOA 1BMLC 2FUG1 3C8YA 2TSSA 3BK1A 2DLBA 1DOIA 1JMLA 2KQ4X 2Y3AA 1GB4A 1JROA 1JWBD 1DOXA 1YJJA 2QJLA 4AQ7A 2BS2B 1SIJA 1C4PA 1JCKB 1YN4A 1SE3A 1V8CA 1VZ6A 5EE0A 1F77A 2VZKB 1XEEA 1JQ4A 1HEZE 1EWYC 4N59A 3MP9A 4N6EB 4PT5A 1NYQA 2AQ2B 1P7EA 1HA5A 2PKOA 5BMHA 2JQRB 1K50A 3NVWA 1TS4A 5EE9A 1SF0A 2RPVA 4A8XC 3DWGC 1RWSA 1Y56A 2WXIA 1VJKA 1AN8A 1ENFA 1I4QA 1T6BX 4P6VF 1WWTA 3SFEB 3KWVA 1L4DB 1RYJA 2M56B 1N61A 4TQ1A 1EWCA 4XDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PIA A;  2WP9 B;  3AEB B;  1XLN A;  1SB3 C;  1CJE A;  2PVG C;  1JW9 D;  3FAH A;  5EE1 A;  2W3S A;  4YTP B;  2AX5 A;  1VDV A;  3AEE B;  3RPF C;  1TKY A;  2HTM E;  4YTM B;  2LEK A;  1AYF A;  1N60 A;  4JWS C;  4HRO A;  1XLO A;  1QLB B;  2QIE B;  3ETR A;  3WCQ A;  1J7A A;  4C80 A;  2WDQ B;  2CU3 A;  2W3R A;  4ZHP A;  5C3J B;  1PDX A;  1FFU A;  4ZOH C;  1JWA D;  3L4P A;  1PUT A;  2BS4 B;  1QOA A;  3AB5 A;  2WLB A;  1GAQ B;  4ITK A;  4YSZ B;  1IUE A;  3BII D;  1FXI A;  5EE3 A;  3NRZ A;  3ZYY X;  1YJI A;  1J7B A;  2M19 A;  1NEK B;  3W5V B;  4YSX B;  3AE6 B;  1VLB A;  2G1E A;  2K5P A;  1N63 A;  1FRR A;  2WU2 B;  4YSY B;  2CJN A;  1NEN B;  1E0Z A;  4WWM A;  2MJD A;  2WS3 B;  3DWM A;  1FRD A;  1TYG B;  2PVO D;  1A70 A;  3AMZ A;  3VR9 B;  1FO4 A;  1JRP A;  1JAL A;  1L6U A;  4N58 A;  5H92 C;  3VRA B;  1QT9 A;  3AE7 B;  3AH7 A;  3AEC B;  3SFD B;  1UWM A;  3NS1 A;  1V97 A;  2W55 A;  5H8Y E;  3P4R B;  5G5G A;  3AEF B;  1I7H A;  2DBY A;  2MJE A;  3CWI A;  4FXC A;  1TJE A;  3PO0 A;  1ZOY B;  2Q5W D;  3AE8 B;  1L0V B;  3AEG B;  5MPO A;  1QOF A;  1OQQ A;  1WXQ A;  3W9C B;  1ZP0 B;  1E7P B;  1PFD A;  1QOB A;  2H88 B;  4C7Z A;  1DOY A;  2W54 A;  2OHF A;  4YT0 B;  4A9A A;  1KF6 B;  2KAJ A;  2L52 A;  3LB8 C;  4YTN B;  5G5H A;  1L6V A;  2EKI A;  2MJ3 A;  1WRI A;  2BS3 B;  1NVI D;  2WDV B;  2FBW B;  1RFK A;  2Y5C A;  3HUI A;  5AUK A;  5GXG B;  1FM0 D;  4USA A;  3AE1 B;  2DWQ A;  2JX5 A;  1TKG A;  1ZXI A;  3B2F A;  3VRB B;  1F0Z A;  3AV8 A;  3B9J A;  1T3Q A;  1N5X A;  1FFV A;  2K9X A;  3KWL A;  3P4S B;  3P4P B;  1KFY B;  2L83 A;  2BT6 A;  2WQY B;  3FC4 A;  3AED B;  2CJO A;  3HVZ A;  2H89 B;  4ZHO A;  4US8 A;  2E3T A;  1E6E B;  3AE2 B;  2K22 A;  3AE3 B;  1FMA D;  3EUB 2;  1YQ3 B;  3NVY A;  1DOI A;  1QF6 A;  1J7C A;  1JRO A;  1JWB D;  3ABV B;  4HRS A;  1YJJ A;  4US9 A;  5C2T B;  2QJL A;  1DOX A;  2BS2 B;  3NVZ A;  3LXF A;  1ZUD 2;  1E10 A;  3AE4 B;  1SIJ A;  1L5P A;  3AE9 B;  2N0S B;  3CIR B;  2KMM A;  3P63 A;  1CZP A;  4LTU A;  1XLQ A;  1R7S A;  1WGK A;  1AWD A;  1GPX A;  5AUI A;  1FIQ A;  4IDI A;  1V8C A;  5EE0 A;  1N5W A;  1E9M A;  2B76 B;  1DGJ A;  1NYR A;  1JQ4 A;  1EWY C;  3P1M A;  1TKE A;  4KX6 B;  4N59 A;  4N6E B;  1ROE A;  2MH7 A;  1NYQ A;  1OQR A;  1WYG A;  3B2G A;  3AM9 A;  2PKO A;  4JWU C;  2JQR B;  3NVW A;  5EE9 A;  1SF0 A;  1NI3 A;  3AN1 A;  3SR6 A;  3W5U B;  1QOG A;  3DWG C;  1RWS A;  1VJK A;  1KRH A;  4C7Y A;  1N62 A;  3AEA B;  4P6V F;  3P4Q B;  1RM6 C;  1WWT A;  3HRD D;  2ACZ B;  1XLP A;  4WQM A;  3AE5 B;  3SFE B;  1XO3 A;  1B9R A;  1OFF A;  2WU5 B;  1YQ4 B;  1RYJ A;  2M56 B;  3NVV A;  4JX1 C;  2WDR B;  1N61 A;  1FXA A;  3VR8 B;  4YXD B; 
#chains in the Genus database with same CATH topology
 3PZ8 A;  1E7V A;  3U52 E;  2WDT B;  3PZ7 A;  5JHA A;  4C4V B;  1TKY A;  2HTH A;  4X57 B;  1KJT A;  3T8M A;  3ETR A;  1C77 A;  3H7P A;  4II3 B;  1WGY A;  1BXT A;  2KD0 A;  4GXB A;  2WLB A;  1T0Y A;  2LAS A;  2MWS B;  3ZRC A;  1IGC A;  3Q3N C;  4LDT D;  4RF1 A;  4KZ0 A;  3MC8 A;  4REZ A;  2MRP A;  3MTN B;  4LCD E;  4AP4 C;  3QAQ A;  4N58 A;  4WJP A;  2FCQ A;  4IM3 A;  2MJE A;  2J0M A;  4FXC A;  1FNW A;  1P7F A;  4NJC A;  5LLI A;  2KT7 A;  2LGI A;  1KF6 B;  1KH0 A;  5G5H A;  2N9L A;  4GMV A;  3TCA A;  1WRI A;  4W9C A;  1NVI D;  4EUT A;  1WJ4 A;  2FBW B;  1RFK A;  3AXC A;  2L05 A;  1FCC C;  4OVZ A;  3MC0 B;  4W9H A;  2LI5 A;  3ZNG C;  2Z8L A;  1UD7 A;  4ZRP A;  3NVY A;  3A9J A;  3AE4 B;  2KMM A;  1KM7 A;  3A33 B;  4K3C A;  4IDI A;  1N5W A;  2B76 B;  3KW5 B;  2PPH A;  5BMG A;  2BF8 B;  4MJS B;  2N4F A;  3SDL C;  3PSE B;  1UZX B;  2ACZ B;  3Q8F A;  4W9L A;  1YQ4 B;  1SE9 A;  3H6N A;  4M0W A;  1ZDX A;  2CU1 A;  2IDY A;  1WR6 E;  3CMM B;  4FJV B;  4BKS D;  4GDK B;  3QHT A;  2QIE B;  2GB1 A;  4E3C A;  2CU3 A;  1P3Q U;  2IGH A;  2KVR A;  4ZHP A;  3AU4 A;  1PDX A;  1JWA D;  1PUT A;  5C1Z A;  4MGK E;  2D11 A;  4FUL A;  4BBN C;  2KX3 A;  3ZYY X;  3BZD B;  1R4M I;  2JPH A;  2MP2 B;  1HE8 A;  1VZ7 A;  3L54 A;  1E0Z A;  4WWO A;  1V81 A;  4DXG A;  2RR9 A;  1VRA B;  1I7H A;  2ZCC A;  3AEG B;  3JW0 X;  4NPN A;  1PFD A;  3GS2 A;  3M3J A;  2ZVN A;  2KAJ A;  3TL5 A;  3RI7 C;  4KZC A;  4A90 A;  2BS3 B;  2C5L C;  1FM0 D;  1ET6 A;  4USA A;  3B9J A;  3KWL A;  2ZW0 A;  1VZ8 A;  2WGS A;  2WWZ A;  2H89 B;  4KV2 A;  1L0X B;  2LWP A;  3WIM A;  3H7P B;  2J42 A;  1QKZ A;  2RMM A;  1J8C A;  3VDZ A;  4FBJ B;  3VUW A;  3DBL B;  4I6L B;  5FK9 C;  2D3C A;  3Q8A A;  2BYE A;  5FKA C;  4KX6 B;  2KC1 A;  4A3O A;  2BYF A;  1MVK A;  3AM9 A;  4DXF A;  1F2R C;  4JQW C;  2ON8 A;  1HZ6 A;  1N62 A;  4WJQ A;  3K9O B;  2WXF A;  4BKS A;  2K8B A;  1XQQ A;  3ZTD A;  1J0G A;  2MBB B;  2BW2 A;  3VR8 B;  1GJZ A;  2WP9 B;  3A9K A;  1MHX A;  2NMQ A;  1XLN A;  4ACF A;  1CJE A;  1JW9 D;  4BOS C;  1YQB A;  4HVB A;  2RGF A;  4GDL A;  2WX0 A;  4HDQ A;  1TT5 B;  3RCZ A;  2EMT A;  2RDH A;  4ZOH C;  2IO1 B;  3EEC A;  3IVF A;  2AQ1 B;  4EKU A;  3PRP B;  3U8Z A;  3A9J B;  1UF0 A;  4YSZ B;  4ICV A;  2X38 A;  4ASW C;  4AJW A;  4YSX B;  4RGT A;  1PQS A;  4B9K A;  1A70 A;  1FO4 A;  4KGS A;  2LGS A;  3FKY A;  3Q8E A;  4HXD A;  3P4R B;  1ZXH A;  1EF1 A;  2PJH A;  1QOF A;  3U2S C;  2GI9 A;  4NZL B;  4AOF A;  3TEY A;  3DVG Y;  4Q2J A;  4W9F A;  4BZA A;  3R2I A;  4M0W B;  4HPL B;  4GN1 A;  4XDC A;  2GOW A;  3V60 A;  3BWU D;  1TKG A;  4ARI A;  3P4P B;  2CR5 A;  2WQY B;  3AED B;  5LXI B;  2IO3 B;  2DZJ A;  1E6E B;  3ZDT A;  1NI2 A;  2VZK D;  1J7C A;  3GB1 A;  3NVZ A;  1E10 A;  2J0K A;  1L5P A;  2DAJ A;  2WXO A;  3PRM B;  3R7Q A;  1FNV A;  4L23 A;  4GU2 A;  1XD3 B;  2YVC A;  3UIO B;  3RNG C;  3T3O A;  2JZZ A;  2BBC A;  3C19 A;  3Q2A C;  3RYT A;  4JX1 C;  5E6P A;  4TV3 A;  1FXA A;  2C7H A;  3V05 A;  5EDS A;  3J9C A;  4CQN A;  1YX6 B;  2YEP B;  1UWX A;  3DBH I;  3N3K B;  4MEL A;  1WXM A;  2WXQ A;  4OHJ A;  3S2A A;  3VUX A;  1HTO A;  4EZL A;  3I5J C;  3WCQ A;  3BYT B;  3OAW A;  2JYE A;  2J7Q B;  1ISN A;  4HPM B;  2KJR A;  2ASQ A;  2G9H D;  3BII D;  4G3X B;  2CHX A;  2IO2 B;  1YJI A;  3RNA C;  2A5U A;  3VVW B;  2REX A;  2PVO D;  4LNN A;  2DNF A;  4HCP B;  3KYD D;  3AEC B;  1R4M B;  1V97 A;  5CHV C;  1YNT E;  1ZGU B;  4ZRJ A;  1RFA A;  2K3U A;  5TSS A;  3VQI A;  2KNB A;  2VH1 A;  4K3B A;  2OJW A;  2JXT A;  3OJ3 A;  2WNM A;  3ZDM C;  2KJ6 A;  3A9K B;  4MDK E;  2Y5C A;  3HUI A;  4NQL B;  5AUK A;  1G6J A;  2BYT A;  2N9P C;  4KVG B;  2D2Q A;  3DVG X;  1WE7 A;  2M4N A;  3Q3J A;  4GDL B;  1RAX A;  1BML C;  4G50 A;  3UIP B;  2TSS A;  2DLB A;  5KHO A;  3PRZ A;  1JWB D;  1NDD A;  4S17 A;  5D6J B;  1WJN A;  5IAA C;  4P1C C;  3VFK A;  1SGH A;  1V8C A;  1VZ6 A;  2LVO A;  1F77 A;  3QJZ A;  1JQ4 A;  3MP9 A;  4IWO A;  1K50 A;  1TS4 A;  5EE9 A;  1SF0 A;  2KDB A;  3DWG C;  3PPA A;  3PT2 B;  2LD9 A;  2IYD B;  1Y56 A;  3VH3 B;  3DVN U;  1VJK A;  3PRE A;  1ENF A;  3IBE A;  4AUQ C;  4I6P A;  3N1X C;  4XDD A;  2PIA A;  2I38 A;  4OZC A;  1SXT A;  1EU4 A;  1TZ1 A;  2LRU A;  1ZDV A;  5IP4 D;  1N60 A;  2D3A A;  2V9H A;  5C3J B;  1SE2 A;  1FFU A;  4IWP A;  1D4B A;  4ITK A;  4JL9 A;  1WJ6 A;  3W5V B;  1VLB A;  1FEH A;  1TY2 A;  3QA8 A;  2KLG A;  2MJD A;  3ZVV A;  2Y5B B;  4NJ7 A;  1UNS A;  3L16 A;  2UWQ A;  2KN4 A;  2W55 A;  2ICI A;  2Z59 B;  1IBX A;  4BFR A;  1WMH A;  1HZ5 A;  1SE4 A;  2BPS A;  1L0V B;  3RNE C;  1V1O A;  5MPO A;  4ZYS A;  1STE A;  1D5X C;  1ZP0 B;  2H88 B;  5D2M B;  2W54 A;  5CTR C;  3APC A;  3TMP B;  4B6W A;  1YMH E;  4KKJ A;  4M01 A;  4GB9 A;  3PLV A;  3RZF A;  5GXG B;  1FCL A;  1F1H A;  1FNU A;  2BB6 A;  1ZXI A;  2MX2 A;  1GB1 A;  4GGQ A;  3AU5 A;  2HE7 A;  2N1W A;  3FC4 A;  2L76 A;  3AE2 B;  1C76 A;  1WX9 A;  3I3T B;  2DEN B;  1ZUD 2;  3AE9 B;  3ZQ4 A;  1XLQ A;  4B0E A;  1S1Q B;  1ROE A;  2FIF A;  1Z5S B;  2MEK A;  2KAC A;  3CSF A;  3QQ8 B;  3W5U B;  3WA0 A;  4M02 A;  5DPW A;  2KDM A;  3D32 A;  1KRH A;  2V0G A;  2D3G A;  2I1K A;  3WAL A;  5IA7 A;  4HLE A;  4YXD B;  1MI0 A;  1L0Y B;  2QMT A;  4BKT A;  1SEB D;  4G0N B;  2L7R A;  3RPF C;  1IGD A;  5DCN A;  2PMV A;  2NPT A;  3URY A;  3EFC A;  2W3R A;  4XX5 A;  3N32 A;  2GMI C;  4HWI B;  4P16 A;  2V3P A;  4O1N A;  5HHD G;  5BMI A;  5DPR A;  1TS2 A;  3UF8 A;  2WXM A;  2M19 A;  4HPP A;  3PS6 A;  1UGM A;  2IJ0 A;  5BYQ A;  5TR5 A;  4A6Q A;  2ONQ A;  4K7U A;  4YWG G;  4IKG A;  1CK1 A;  2JWZ A;  2FAZ A;  3V6C B;  2WXK A;  1UWM A;  3NS1 A;  4WWP A;  4W9K A;  2KDE B;  2J53 A;  4C00 A;  1SSN A;  3CST A;  1WRD B;  4RH6 A;  1UBQ A;  2LMC A;  1I4G A;  1ESF A;  1M94 A;  3EGR A;  4OVV A;  3VAW A;  2BTE A;  1VD2 A;  2V3S A;  4BBN F;  5D3I B;  1YIW A;  3Q3F A;  3TUO A;  4PS7 A;  3N1Y C;  1XCQ L;  4HEA 1;  3RMK C;  4HJG E;  2NBW B;  3DQV A;  4DQO C;  5IKC M;  2JWU A;  1I4R A;  5HKH A;  4DHJ B;  2N0S B;  1CZP A;  4IOI E;  4EZK A;  3IAS 1;  1DGJ A;  3P1M A;  3KVF B;  4LJO B;  2N7J A;  2K0P A;  1OQR A;  3B2G A;  4DXA B;  3DBR I;  5E6J A;  4HKQ A;  4N9F 4;  1IBX B;  1WMH B;  1XT9 B;  3K9P B;  2WXN A;  4WQM A;  5D94 A;  2RDB C;  4S0R A;  2MLB A;  2WU5 B;  1D5Z C;  1UH6 A;  4W9D A;  5CX3 A;  4KGR A;  3RUI B;  1SB3 C;  1T0R C;  3FAH A;  3NS8 A;  3HHM A;  4MH8 A;  1AYF A;  1XLO A;  3KH0 A;  3UQA A;  2L00 B;  1FXT B;  2LFI A;  1WZ3 A;  1E7U A;  1V80 A;  4TQ0 A;  1P9D U;  1TIF A;  2JT4 B;  4EOY A;  1IP9 A;  2G1E A;  1FRR A;  3N30 A;  4AS1 A;  1P1A A;  3GE3 C;  3P2B A;  4WWM A;  1TYG B;  3E9S A;  3HK0 A;  2NTS A;  3AE7 B;  4B95 A;  2NCN A;  3BK2 A;  4JLC A;  2IGD A;  5G5G A;  2BWF A;  2DZM A;  3WAO A;  2GBJ A;  4RM9 A;  3DPD A;  3KUD B;  1GUA B;  3HIZ A;  2IO0 B;  4ZRI A;  4YL8 A;  1C78 A;  4WJN A;  2WDV B;  1JRU A;  2KO3 A;  2DWQ A;  3ZIM A;  1U4A A;  1F0Z A;  1T3Q A;  2EMS A;  5J2R A;  3NG0 A;  2NPT B;  4NAW A;  3ZXV A;  4ZHO A;  3W1S C;  1YQ3 B;  4RGO S;  1WJU A;  3KYC D;  1LQB A;  2JUO A;  1WGK A;  2XK5 B;  3L17 A;  2KQS A;  3X0W A;  1D6E C;  2O2V B;  1BT0 A;  5JH5 C;  1TBE A;  1YX5 B;  2ZEQ A;  4JWU C;  2FID A;  1T0S C;  3Q3O C;  3SR6 A;  5IOI A;  4P7I A;  1L4Z B;  3P4Q B;  4MT5 A;  2LHD A;  4P1B C;  4WAA A;  4WUR A;  4KDI C;  3UGB B;  2PVG C;  2ZPY A;  5CHW A;  2WXH A;  1MJD A;  4YTP B;  3T9L A;  2INN E;  1WFY A;  4KGT A;  4EE2 A;  4W9E A;  1XXG A;  3DHG C;  4DDG D;  3Q8C A;  3AUL A;  2K6Q A;  2KTR A;  2WXJ A;  4DDI D;  1TZO A;  1C3T A;  1WF9 A;  3VHT C;  2KWD A;  1E8Z A;  1P0R A;  2WX1 A;  2ZJD A;  1C79 A;  3PGE A;  2FCN A;  1JAL A;  2BKF A;  3VRA B;  4NJ6 A;  3ZJT A;  1MG8 A;  2IY0 B;  1ZOY B;  3L08 A;  2DZI A;  4MGY E;  2M0A A;  2PLP A;  1C1Y B;  2KXJ A;  2MJ3 A;  1JWM D;  2RPQ A;  4LNO A;  4D2K A;  2L0F A;  3V61 A;  2N7E A;  2NBV B;  3W1S A;  4NY0 A;  3C8Y A;  5DPS A;  1GB4 A;  1JRO A;  3LDZ E;  2QJL A;  4ANV A;  1YN4 A;  1SE3 A;  1WM2 A;  5J18 A;  4CHK A;  1HEZ E;  2BYV E;  4CO7 A;  1EWY C;  4JGH B;  4PT5 A;  2OOB B;  4A20 A;  2PKO A;  2LJ5 A;  2JQR B;  5BMH A;  3RN9 C;  3DDC B;  5JZE B;  2QCZ A;  3ECI A;  1I4Q A;  2C60 A;  3DBR B;  2L8J A;  5C23 A;  2AL6 A;  3TIX A;  3DBS A;  2WYQ A;  4LNI A;  2B3A A;  3ONS A;  4K7S A;  2W3S A;  4HDO A;  2CKH B;  1EO6 A;  4NAW B;  4HKZ E;  4XWW A;  2MHJ A;  1IUE A;  2WXR A;  1FXI A;  4MAC A;  5EE3 A;  3EHV A;  4TMA B;  2MBE A;  4PK1 A;  1EF5 A;  2WU2 B;  4YSY B;  2CJN A;  3SHQ A;  2G45 B;  2UYZ B;  2KLC A;  1DYQ A;  4F1S A;  3CWI A;  1R4N I;  2DX5 B;  2FUH B;  2LVQ A;  2INP E;  2ZPN A;  4FJY A;  4M8N A;  3AE8 B;  2JRH A;  4ZYN A;  1F52 A;  1WGH A;  1TY0 A;  3RNC C;  3U7Z A;  1Q0W B;  2KAN A;  2LXC A;  2ZW1 A;  2L52 A;  2JRI B;  3GZN I;  4IUM B;  3JSV A;  5D3D A;  4ZDV A;  4ZRQ A;  4WJO A;  2JX5 A;  3VRB B;  3T3N A;  3VTW A;  3NZ3 A;  2QSD A;  2L83 A;  4DHJ D;  1OTR B;  3WAM A;  3V62 A;  3EUB 2;  3AE3 B;  3R7R A;  2XEW A;  1QF6 A;  2J4X A;  3LXF A;  2KMC A;  2KTR B;  2HD5 B;  4NQK E;  3ZNI D;  2KQ7 A;  3TJP A;  1T5X D;  2GBK A;  2NR2 A;  2MW5 A;  4RM8 A;  4ZRK A;  3A4S C;  3A1Q A;  3A4R A;  1GC6 A;  1WYG A;  1T0Q C;  3QAR A;  4DK5 A;  1YN3 A;  1XCT L;  3L13 A;  1KTK A;  4RNA A;  3N20 C;  3R66 C;  3LYY A;  2JVC A;  2KC2 A;  3HRD D;  1XO3 A;  2OJR A;  3Q8B A;  2VH2 A;  3OJ4 B;  1I35 A;  3O13 A;  3B0A A;  2M1M A;  3ZUN A;  5EE1 A;  1Q10 A;  4J6I A;  4OW0 A;  1E90 A;  5CHF A;  4C80 A;  2KJH B;  3ZW3 A;  1CMX B;  1V6E A;  1MPE A;  3PTF C;  3NRZ A;  1J7B A;  2G3Q B;  5IN7 A;  3AE6 B;  2L32 A;  1JWU D;  4EFO A;  3OLM D;  1CQV A;  1PYW D;  2JZ3 B;  1L6U A;  1QT9 A;  3PHX B;  4FN2 A;  4UDU C;  3V3X A;  3AEF B;  4KDL B;  3DVN V;  2HJ1 A;  3ZJU A;  2KKC A;  4XC2 A;  1E7P B;  2QEJ C;  4FLH A;  2OHF A;  2PTL A;  2RD0 A;  3VTU A;  4OZB A;  1Q1O A;  2EKI A;  2L1A A;  2SEB D;  5G55 A;  2WHI A;  3B08 A;  4M00 A;  3ZTC A;  4WAF A;  3P4S B;  4GSW A;  3FIL B;  3HVZ A;  1QZE A;  4GIV A;  2E3T A;  3GOE A;  1WY8 A;  5L95 C;  3ABV B;  4US9 A;  3RUL A;  2K6D B;  2IPK D;  4DBG A;  5AUI A;  3W2D A;  4PS3 A;  4I6N B;  1TKE A;  2K8C A;  3UIN B;  2MH7 A;  3X23 A;  2FCS A;  3NZS A;  4QAY A;  2MCN B;  1OEY A;  3BVM A;  1H4R A;  2C7N B;  4HCN B;  3KLS X;  2IZV B;  1VCB A;  2FNJ B;  2I1J A;  1B9R A;  3NVV A;  3PZD A;  5AZF A;  2FE8 A;  2JZP A;  3AEB B;  3JSV B;  1K8R B;  3TEZ A;  3I9V 1;  2KFK A;  3ZO5 B;  2JSV X;  4YTM B;  4HRO A;  5GMV A;  2KTF A;  4TSS A;  3RT3 B;  3MFG A;  1L7Y A;  3H9D A;  4M8M A;  3QWZ B;  2YEP F;  1GAQ B;  4MEM A;  2NS5 A;  1HTQ A;  3PLU A;  1LFD A;  4IC7 B;  1N6Z A;  1SIF A;  1WGR A;  4CYE A;  3DWM A;  4IG7 B;  1XF5 L;  1UBI A;  3A1Q B;  4JE3 B;  4DHZ B;  5J17 A;  2BWE S;  2CS4 A;  1EU3 A;  2PE9 A;  3DBH B;  3VH4 B;  4WWN A;  1BUI C;  3QCA A;  1QOB A;  1ZW7 A;  4PYZ A;  3V6E B;  1SJE D;  1R4N B;  2N9E B;  4YTN B;  3B1L X;  2XK5 A;  2M0X A;  2K25 A;  2C7M B;  2LUE A;  2O2V A;  3RZW C;  4W9G A;  1HXY D;  3GP7 A;  3GZN B;  5FR6 A;  2BT6 A;  2PEA A;  3MJ5 A;  5BYR A;  1ZKH A;  3TEW A;  4WH4 A;  3I57 A;  2AEH A;  2KK8 A;  5C2T B;  1GOZ A;  2FCM A;  4NNJ B;  3OWE B;  2MA9 B;  1R7S A;  3NZU A;  1A5R A;  1GPX A;  2ZNV C;  1FIQ A;  3IAM 1;  4RFB A;  1YN5 A;  2LHE A;  4B0M A;  3HM3 A;  2O6V A;  2MBQ A;  1RRB A;  1P98 A;  1NBF C;  3AN1 A;  3N9Y C;  2R2Q A;  4XGA B;  4BAX A;  2DYO A;  4L1B A;  3PHW B;  1V5T A;  2V3N A;  2IND C;  3NUH B;  2ZCB A;  2G4D B;  3DCG A;  1PGX A;  2LZ6 A;  2GRI A;  3AEE B;  4XZ4 A;  3EA6 A;  4JPS A;  4GLS C;  2WDQ B;  2KWC A;  4H2A A;  3L4P A;  3TSS A;  3QX1 A;  3RFZ B;  3H8H A;  1WR1 A;  3C0R B;  3HVD A;  2ZZP B;  2K5P A;  1N63 A;  1V1P A;  1I4H A;  1V9J A;  3IFW B;  5L83 A;  3AH7 A;  4ICU A;  1GG3 A;  2LGX A;  1WGD A;  2RSU A;  2DBY A;  1TJE A;  2CHZ A;  2DYM A;  1WXQ A;  4RMA A;  5FR3 A;  2KOX A;  2BVC A;  3SU8 X;  2INC C;  3SEB A;  4MSQ B;  4LJP B;  2KFK B;  5HG2 A;  1YD8 U;  1E8X A;  2SAK A;  2BKR B;  1V5O A;  4EEW A;  2W82 A;  4BOZ B;  2CJO A;  5IO9 A;  3BK1 A;  1DOI A;  2KQ4 X;  2G4S A;  2Y3A A;  1YJJ A;  2LRW A;  4AQ7 A;  2BS2 B;  1WX7 A;  2VRR B;  5EE0 A;  3WAP A;  3I63 C;  2L3Z A;  5KHQ A;  4N59 A;  4N6E B;  1KOT A;  2AQ2 B;  1HA5 A;  4A8X C;  2MBH A;  4KSK C;  4AJY B;  2BQQ A;  1RWS A;  1AN8 A;  1D3Z A;  3SFE B;  1T6B X;  1EUV B;  4FHJ A;  5AEK B;  3KUZ A;  3KWV A;  2M56 B;  4GOC A;  4MH0 E;  2R2O A;  2N9X A;  4TQ1 A;  3Q14 C;  1OEY J;  4IWQ A;  2AYO B;  3M62 B;  1WXA A;  2QIL A;  2QHO A;  2KMA A;  5JHB A;  3RD2 A;  3P42 A;  2J52 A;  2JYT A;  1UEL A;  1HQR D;  2JXX A;  2MBO A;  4F7Z A;  1QOA A;  1WYW B;  3ZNZ B;  4IM0 A;  3U30 A;  2KDI A;  2GBR A;  2D10 A;  4RGM A;  1NEK B;  3R3M A;  1TTN A;  1I4P A;  4HK2 A;  2MSE D;  3LJ3 A;  2XN9 C;  1FRD A;  1ET9 A;  4WIP A;  2O6V B;  5H8Y E;  2KWU B;  1I42 A;  1H8C A;  1ZPS A;  3BVG A;  3RNF C;  2PE6 B;  2PW9 A;  5E6N A;  4KKI A;  3W9C B;  2Z0E B;  1V2Y A;  4J3O D;  4K1R B;  4YT0 B;  4FA6 A;  3DHH C;  3GE8 C;  3L0W B;  5DPT A;  2N7D A;  1TS5 A;  3R8B A;  1K51 A;  3VXW A;  2DHZ A;  1LM8 B;  3NHE B;  1KFY B;  2IY1 B;  3RNB C;  2KVZ A;  3APD A;  1EM7 A;  4NAM A;  1KLG D;  1MG4 A;  2AWT A;  2DYB A;  4A3P A;  2KYW A;  1FPY A;  4LTU A;  1UGJ A;  4JIO U;  1V86 A;  1YJ1 A;  1V1P B;  2QC8 A;  3EFU A;  2NBU A;  5LXH A;  2EEL A;  4C56 C;  4PYU A;  3DOW A;  1QOG A;  2KHW B;  3WAN A;  2K8H A;  1RM6 C;  1F2R I;  2LXA A;  1OFF A;  3Q69 A;  2DZK A;  2GBM A;  3Q6B A;  2I2Y A;  4EZJ A;  1WX8 A;  4L2Y A;  3TEX A;  4URK A;  2LGD A;  3ZKJ C;  2Y5P A;  2LEK A;  1OQY A;  4MGI E;  4RF0 A;  3IXS A;  3VTV A;  1KLU D;  2A4Z A;  2ZNV B;  1IPG A;  1E8Y A;  3ZLZ A;  3KUC B;  1KLV A;  4ANU A;  1NEN B;  3ENE A;  1ZE3 D;  4FJZ A;  2YLM A;  2WS3 B;  1TS3 A;  1WGG A;  3NOB A;  5H92 C;  4LDT B;  4IW0 A;  3NJT A;  3ZRF A;  1QQR A;  3FIL A;  3L10 B;  1C9F A;  4MM3 A;  1K53 A;  2BB5 A;  2D5G A;  1SJH D;  2R61 A;  4C7Z A;  3U4E G;  1E5W A;  3LB8 C;  4G11 A;  5HI1 A;  1OGW A;  2IGG A;  2NTT A;  4BKG A;  5I4D A;  3TBL D;  2M17 A;  1MHH E;  3B2F A;  2AL3 A;  3AV8 A;  1WM3 A;  2JF5 A;  1FFV A;  3U7D A;  4E74 A;  4US8 A;  2Z0D B;  2K22 A;  1FMA D;  4HRS A;  2V1Y A;  2KZR A;  1ACC A;  3CIR B;  4F8C B;  3P63 A;  4W9I A;  1WSP A;  2C9W B;  1E9M A;  4LLG M;  3JVZ X;  3UQB A;  1C4C A;  3IG3 A;  2N1V A;  3EC8 A;  2M8S A;  1S3S G;  2WXL A;  1NI3 A;  1LGR A;  4ARC A;  2XBB C;  1XLP A;  4W9J A;  1GNU A;  3AE5 B;  3CF6 E;  1GC7 A;  2GLS A;  3MHZ A;  2LUM A;  1B1Z A;  3ML9 A;  2WDR B;  2CHW A;  3PVL A;  4LNF A;  1Y8R C;  5BO4 B;  3ZGZ A;  2MQJ A;  1I4X A;  2LVP A;  1QIL A;  5E6O A;  5LNK 1;  1F9J A;  2HTM E;  3BY4 B;  3SD5 A;  3PV1 A;  5HFY A;  1M4V A;  1TGZ B;  2BS4 B;  3AB5 A;  3UI3 A;  2BGF A;  1D5M C;  1SBB B;  1UUP A;  1AAR A;  3IHP C;  2NVU I;  1LO5 D;  4KIK A;  2L0T A;  3BVZ A;  2W9N A;  3VR9 B;  1JRP A;  3MJW A;  2JY6 A;  3SFD B;  2K39 A;  4TKN A;  3VUY A;  2WXP A;  1K52 A;  3PO0 A;  3E56 A;  1MFW A;  1OQQ A;  2IBI B;  2OED A;  4OZA A;  2KX0 A;  1DOY A;  3NY5 A;  1L2N A;  4A9A A;  5D7G A;  1L6V A;  3H1U A;  3ZJV A;  2QDF A;  2GBN A;  3M95 A;  4XWT A;  3APF A;  2UU7 A;  4C4V A;  1N5X A;  3IT6 B;  3QC8 B;  3BYY B;  2XNA C;  4IM2 A;  1PGA A;  4RCO A;  1FD6 A;  2RDG A;  4KSL C;  4HJK A;  1AWD A;  3N1Z C;  3ALB A;  1C4A A;  2ZVO A;  1X1M A;  1NYR A;  1LXD A;  4K7W A;  2V4L A;  1RLF A;  1V49 A;  2AQ3 B;  2EKE C;  2KN5 A;  3KQ4 A;  3MC9 A;  4LK0 M;  1WXV A;  2D07 B;  3QK0 A;  3ML8 A;  1WE6 A;  4MM3 B;  4C7Y A;  3AEA B;  1Z2M A;  4LNK A;  2LJI A;  2X8X X;  4DWF A;  1WI0 A;  3IT4 B;  4DHZ E;  3R2T A;  2KWV B;  4PS8 A;  2N9K A;  3M63 B;  3O65 B;  1VR9 A;  1PGB A;  2AX5 A;  1VDV A;  4R3D A;  4ANW A;  4JWS C;  4RGN A;  1QLB B;  1J7A A;  5JXV A;  5T8I A;  3ZXR A;  3MHS D;  3HM6 X;  1Q5W B;  1WH3 A;  2KFJ A;  1J19 A;  1E8W A;  2JU6 X;  2LGY A;  3DHI C;  2O6V D;  4E71 A;  1JWS D;  3BIN A;  4XE0 A;  2HJ8 A;  2HDE A;  2DAF A;  4MGZ E;  3AMZ A;  2D3B A;  4MJS A;  2KDF B;  4A55 A;  5BYS A;  2Q5W D;  4XYC A;  4FAD A;  5G2N A;  3QIJ A;  1WXS A;  4AWJ A;  2WXG A;  4ANX A;  4WQO B;  2E6X A;  1AW7 A;  3Q3M C;  3ZNH B;  2K1F A;  3AE1 B;  4GDK A;  2K9X A;  2V4I B;  1YOV B;  4OVU A;  3H7S A;  2FUG 1;  2J0J A;  3DBL I;  5AZG A;  3W1Y A;  1JML A;  1DOX A;  3JYU A;  1SIJ A;  1C4P A;  1JCK B;  4KIK B;  2MP2 A;  2VZK B;  1XEE A;  5AZH A;  4II2 B;  4MSM B;  1WIA A;  1NYQ A;  4BVU C;  1P7E A;  4K81 A;  3NVW A;  3AI5 A;  2RPV A;  4TUU A;  3OG5 A;  1WZ0 A;  2WXI A;  4P6V F;  1WWT A;  4FHK A;  1L4D B;  1IYF A;  1RYJ A;  1N61 A;  1EWC A; 
#chains in the Genus database with same CATH homology
 2PIA A;  2I38 A;  3PZ8 A;  4OZC A;  1SXT A;  3U52 E;  1EU4 A;  3PZ7 A;  2W3S A;  1ZDV A;  1TKY A;  2QIL A;  1N60 A;  3ETR A;  3P42 A;  4NAW B;  4HKZ E;  2J52 A;  1C77 A;  2JYT A;  4XWW A;  1HQR D;  5C3J B;  1BXT A;  1SE2 A;  1FFU A;  1QOA A;  2WLB A;  1D4B A;  4ITK A;  1IUE A;  2WXR A;  1FXI A;  4MAC A;  5EE3 A;  4TMA B;  4RGM A;  1NEK B;  1IGC A;  3W5V B;  4RF1 A;  1VLB A;  2WU2 B;  4YSY B;  1FEH A;  2CJN A;  1TY2 A;  1I4P A;  4REZ A;  2MJD A;  2XN9 C;  1FRD A;  1ET9 A;  4N58 A;  1UNS A;  4WIP A;  2KN4 A;  1DYQ A;  2W55 A;  5H8Y E;  2ICI A;  3CWI A;  2MJE A;  1ZPS A;  1IBX A;  4FXC A;  1FNW A;  1HZ5 A;  1P7F A;  1SE4 A;  2INP E;  3AE8 B;  1L0V B;  2PW9 A;  1V1O A;  3BVG A;  4NJC A;  4ZYS A;  5MPO A;  1STE A;  4KKI A;  1D5X C;  3W9C B;  1ZP0 B;  1TY0 A;  2H88 B;  3U7Z A;  2W54 A;  4J3O D;  4YT0 B;  2LGI A;  2ZW1 A;  1KF6 B;  1KH0 A;  2L52 A;  2N9L A;  5G5H A;  1WRI A;  1YMH E;  4KKJ A;  5D3D A;  1NVI D;  2FBW B;  1RFK A;  4ZRQ A;  5GXG B;  1FCL A;  1FCC C;  1TS5 A;  1FNU A;  2BB6 A;  4OVZ A;  1K51 A;  1ZXI A;  2JX5 A;  3R8B A;  3VRB B;  1GB1 A;  3T3N A;  3MC0 B;  3NZ3 A;  1KFY B;  2QSD A;  2L83 A;  3FC4 A;  2Z8L A;  3AE2 B;  1EM7 A;  3EUB 2;  3AE3 B;  4NAM A;  1C76 A;  4ZRP A;  3NVY A;  1KLG D;  1QF6 A;  2J4X A;  3LXF A;  1ZUD 2;  3AE4 B;  3AE9 B;  3ZQ4 A;  2KMM A;  4LTU A;  1UGJ A;  1XLQ A;  4B0E A;  4IDI A;  1V1P B;  1N5W A;  2B76 B;  1T5X D;  1ROE A;  5BMG A;  1WYG A;  2EEL A;  4C56 C;  1YN3 A;  1XCT L;  1KTK A;  2MEK A;  2KAC A;  3W5U B;  1QOG A;  4RNA A;  2KDM A;  1KRH A;  3LYY A;  1RM6 C;  3HRD D;  2ACZ B;  2V0G A;  1F2R I;  3Q8F A;  1XO3 A;  1OFF A;  1YQ4 B;  3Q69 A;  3Q8B A;  4YXD B;  1MI0 A;  1L0Y B;  2QMT A;  4M0W A;  2I2Y A;  3O13 A;  4L2Y A;  1SEB D;  3TEX A;  1ZDX A;  5EE1 A;  2IDY A;  1Q10 A;  3RPF C;  1IGD A;  2PMV A;  2Y5P A;  2LEK A;  4GDK B;  4OW0 A;  2QIE B;  4C80 A;  2GB1 A;  3URY A;  2CU3 A;  2IGH A;  2W3R A;  4RF0 A;  4P16 A;  4ZHP A;  1PDX A;  2V3P A;  4O1N A;  1JWA D;  5HHD G;  1PUT A;  3IXS A;  5BMI A;  1KLU D;  1TS2 A;  1MPE A;  2WXM A;  3NRZ A;  3ZYY X;  2M19 A;  1J7B A;  3BZD B;  3AE6 B;  2L32 A;  2IJ0 A;  5BYQ A;  1JWU D;  4A6Q A;  1NEN B;  2ONQ A;  4YWG G;  1VZ7 A;  1E0Z A;  1ZE3 D;  1CQV A;  4IKG A;  1PYW D;  2WS3 B;  1TS3 A;  1CK1 A;  1L6U A;  5H92 C;  1QT9 A;  2WXK A;  1UWM A;  4DXG A;  1QQR A;  3NS1 A;  4UDU C;  3V3X A;  1VRA B;  3AEF B;  3FIL A;  1I7H A;  2J53 A;  1C9F A;  1SSN A;  4RH6 A;  2LMC A;  3AEG B;  1I4G A;  1K53 A;  2BB5 A;  3ZJU A;  1ESF A;  2D5G A;  1SJH D;  1E7P B;  1PFD A;  2QEJ C;  2R61 A;  3EGR A;  3GS2 A;  3U4E G;  4C7Z A;  2OHF A;  2PTL A;  2KAJ A;  3LB8 C;  4OZB A;  2BTE A;  2EKI A;  2L1A A;  2SEB D;  4A90 A;  2BS3 B;  5D3I B;  5HI1 A;  3TUO A;  1FM0 D;  2IGG A;  2NTT A;  1ET6 A;  5I4D A;  4USA A;  1MHH E;  3B2F A;  3AV8 A;  3B9J A;  4WAF A;  1FFV A;  1XCQ L;  3KWL A;  3P4S B;  2ZW0 A;  1VZ8 A;  3FIL B;  3HVZ A;  4HEA 1;  4US8 A;  2H89 B;  1L0X B;  2E3T A;  2K22 A;  1FMA D;  4HJG E;  2J42 A;  1QKZ A;  3ABV B;  2RMM A;  4DQO C;  4HRS A;  4US9 A;  2JWU A;  1I4R A;  1ACC A;  3CIR B;  2N0S B;  2IPK D;  3P63 A;  1CZP A;  4IOI E;  5AUI A;  1WSP A;  5FK9 C;  3W2D A;  3IAS 1;  1E9M A;  3Q8A A;  1DGJ A;  4LLG M;  3P1M A;  1TKE A;  4KX6 B;  5FKA C;  1C4C A;  2MH7 A;  2N7J A;  2K0P A;  1OQR A;  3B2G A;  1MVK A;  3AM9 A;  4DXF A;  2WXL A;  1F2R C;  3BVM A;  5E6J A;  1NI3 A;  4HKQ A;  4ARC A;  3KLS X;  1IBX B;  2ON8 A;  1HZ6 A;  1N62 A;  2WXN A;  4WQM A;  1XLP A;  2WXF A;  3AE5 B;  3MHZ A;  1B9R A;  2LUM A;  1D5Z C;  1B1Z A;  2WU5 B;  3NVV A;  2WDR B;  2BW2 A;  3VR8 B;  2FE8 A;  2WP9 B;  1MHX A;  2NMQ A;  2JZP A;  3AEB B;  3TEZ A;  4KGR A;  1XLN A;  3ZGZ A;  3I9V 1;  1I4X A;  1SB3 C;  1CJE A;  1JW9 D;  2JSV X;  1QIL A;  3FAH A;  5LNK 1;  4YTM B;  2HTM E;  4MH8 A;  1AYF A;  4HRO A;  1XLO A;  2LFI A;  4TSS A;  4TQ0 A;  5HFY A;  1M4V A;  3MFG A;  4ZOH C;  2RDH A;  2BS4 B;  3AB5 A;  2AQ1 B;  3UI3 A;  2YEP F;  1GAQ B;  1D5M C;  1SBB B;  4YSZ B;  1UUP A;  2X38 A;  4YSX B;  2G1E A;  1LO5 D;  4RGT A;  1FRR A;  4AS1 A;  4WWM A;  3BVZ A;  3DWM A;  1TYG B;  1A70 A;  3E9S A;  3VR9 B;  1XF5 L;  1FO4 A;  1JRP A;  4JE3 B;  2NTS A;  4KGS A;  3AE7 B;  3SFD B;  3BK2 A;  3Q8E A;  3P4R B;  2IGD A;  5G5G A;  1ZXH A;  1EU3 A;  2WXP A;  1K52 A;  3PO0 A;  3E56 A;  1QOF A;  1OQQ A;  3U2S C;  1BUI C;  2GI9 A;  2OED A;  4NZL B;  4OZA A;  1QOB A;  1DOY A;  3TEY A;  1SJE D;  4A9A A;  4Q2J A;  4YTN B;  5D7G A;  1L6V A;  1C78 A;  3ZJV A;  2WDV B;  3R2I A;  4XWT A;  4XDC A;  3BWU D;  1HXY D;  3GP7 A;  2DWQ A;  1TKG A;  1F0Z A;  4ARI A;  1T3Q A;  1N5X A;  3P4P B;  3IT6 B;  2BT6 A;  2WQY B;  3MJ5 A;  3AED B;  5BYR A;  3TEW A;  4ZHO A;  1E6E B;  4WH4 A;  1YQ3 B;  4RGO S;  3I57 A;  2VZK D;  1J7C A;  5C2T B;  1GOZ A;  3BYY B;  3GB1 A;  3NVZ A;  1E10 A;  2XNA C;  1L5P A;  1PGA A;  2WXO A;  3OWE B;  4RCO A;  1FD6 A;  2RDG A;  1R7S A;  1WGK A;  1AWD A;  1GPX A;  1FIQ A;  1C4A A;  3IAM 1;  1FNV A;  4RFB A;  1YN5 A;  1D6E C;  1NYR A;  2LHE A;  4L23 A;  4B0M A;  2AQ3 B;  3KQ4 A;  4JWU C;  4LK0 M;  3SR6 A;  3AN1 A;  3T3O A;  4MM3 B;  3N9Y C;  4C7Y A;  2BBC A;  1L4Z B;  3AEA B;  3P4Q B;  2LJI A;  4MT5 A;  4JX1 C;  2LHD A;  1FXA A;  3IT4 B;  2DYO A;  4L1B A;  3V05 A;  4WUR A;  2V3N A;  3R2T A;  3NUH B;  3J9C A;  4CQN A;  2YEP B;  2N9K A;  2PVG C;  2WXH A;  1UWX A;  1PGX A;  1VR9 A;  2GRI A;  4YTP B;  1PGB A;  2WXQ A;  2AX5 A;  1VDV A;  3AEE B;  4OHJ A;  4R3D A;  3EA6 A;  4JWS C;  4RGN A;  4JPS A;  2INN E;  1QLB B;  3WCQ A;  1J7A A;  4GLS C;  2WDQ B;  5JXV A;  3BYT B;  4H2A A;  4KGT A;  5T8I A;  4EE2 A;  1XXG A;  2JYE A;  3L4P A;  3Q8C A;  3TSS A;  3RFZ B;  2G9H D;  3BII D;  3H8H A;  2JU6 X;  2WXJ A;  1YJI A;  1TZO A;  3HVD A;  2K5P A;  1JWS D;  1N63 A;  1V1P A;  2KWD A;  4XE0 A;  2HDE A;  1I4H A;  1C79 A;  2PVO D;  3AMZ A;  1JAL A;  3VRA B;  3AH7 A;  3AEC B;  1V97 A;  2DBY A;  1YNT E;  4A55 A;  3ZJT A;  1TJE A;  5BYS A;  1ZOY B;  2Q5W D;  2K3U A;  2DYM A;  1WXQ A;  5TSS A;  3VQI A;  2M0A A;  2PLP A;  5FR3 A;  2MJ3 A;  2JXT A;  1JWM D;  3SEB A;  2WNM A;  2WXG A;  2Y5C A;  4D2K A;  2E6X A;  3HUI A;  5AUK A;  5HG2 A;  2BYT A;  1AW7 A;  2SAK A;  3AE1 B;  3W1S A;  2K9X A;  2V4I B;  2W82 A;  4GDL B;  2CJO A;  1BML C;  2FUG 1;  3C8Y A;  2TSS A;  3BK1 A;  2DLB A;  1DOI A;  1JML A;  2KQ4 X;  2Y3A A;  1GB4 A;  1JRO A;  1JWB D;  1DOX A;  1YJJ A;  2QJL A;  4AQ7 A;  2BS2 B;  1SIJ A;  1C4P A;  1JCK B;  1YN4 A;  1SE3 A;  1V8C A;  1VZ6 A;  5EE0 A;  1F77 A;  2VZK B;  1XEE A;  1JQ4 A;  1HEZ E;  1EWY C;  4N59 A;  3MP9 A;  4N6E B;  4PT5 A;  1NYQ A;  2AQ2 B;  1P7E A;  1HA5 A;  2PKO A;  5BMH A;  2JQR B;  1K50 A;  3NVW A;  1TS4 A;  5EE9 A;  1SF0 A;  2RPV A;  4A8X C;  3DWG C;  1RWS A;  1Y56 A;  2WXI A;  1VJK A;  1AN8 A;  1ENF A;  1I4Q A;  1T6B X;  4P6V F;  1WWT A;  3SFE B;  3KWV A;  1L4D B;  1RYJ A;  2M56 B;  1N61 A;  4TQ1 A;  1EWC A;  4XDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...