1XLQA

Crystal structure of reduced c73s putidaredoxin from pseudomonas putida
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin
publication title Redox-dependent Structural Reorganization in Putidaredoxin, a Vertebrate-type [2Fe-2S] Ferredoxin from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 28
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature ec 1.9.3.2: Transferred entry: 1.7.2.1.
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xlqA00
2Q5WD 3P4RB 3KWLA 5G5HA 1AYFA 2K9XA 2OHFA 4LTUA 3AE8B 4YSYB 1FXIA 3VRBB 1IUEA 1XLNA 1R7SA 2QIEB 3NVWA 1KRHA 1L0VB 2DWQA 3NVVA 3W5VB 3DWGC 3W9CB 2B76B 4YSXB 1WRIA 2CU3A 1ROEA 1SIJA 1FO4A 3P1MA 1NYRA 2WU5B 1FFVA 3LB8C 1OQRA 5GXGB 1QOBA 4YT0B 1EWYC 3BIID 4HROA 4N6EB 1UWMA 3FC4A 4KX6B 1RM6C 1N62A 1TYGB 3LXFA 1NEKB 1E0ZA 2PIAA 1N5WA 3AE3B 3SR6A 2HTME 2K5PA 1QOFA 2WLBA 3AE9B 3WCQA 2E3TA 3B2FA 1XLPA 1V97A 2MJ3A 2BS3B 1QLBB 1QOGA 3CIRB 1SF0A 1JWAD 3AEEB 1DOYA 3AEDB 1ZP0B 3SFDB 1GAQB 2WS3B 2LEKA 1CZPA 2KAJA 1L6VA 2N0SB 4HRSA 4N58A 3NS1A 2WQYB 3ABVB 3AMZA 2FBWB 5AUIA 2CJOA 1B9RA 2AX5A 3P4PB 1L6UA 5C3JB 1GPXA 3AN1A 5AUKA 1QT9A 1T3QA 1N61A 4FXCA 4JWUC 4C7YA 1JWBD 1V8CA 2H88B 3AE2B 1RYJA 1AWDA 1FM0D 1E9MA 1E6EB 1NYQA 1OFFA 1FRRA 1NI3A 1VLBA 2BS2B 2G1EA 1WYGA 3ETRA 4USAA 1RFKA 1FMAD 1DOIA 2MJDA 1VJKA 2W55A 3EUB2 1JW9D 1PDXA 1TKEA 2DBYA 1J7AA 2W3RA 3CWIA 1CJEA 1YJJA 1JRPA 2JQRB 1FRDA 3AE4B 1E7PB 1OQQA 3NVYA 3P63A 3SFEB 3AE7B 3L4PA 2W54A 3VRAB 4YSZB 1RWSA 2BT6A 4N59A 1YJIA 1WWTA 3AV8A 1PUTA 2PVOD 2WDVB 5H8YE 5EE0A 1QF6A 3AEFB 1E10A 2QJLA 3AEGB 4ZHOA 1L5PA 2Y5CA 3HUIA 1XLQA 2K22A 3AE5B 3AEBB 4IDIA 4A9AA 3AEAB 4YTNB 1QOAA 5H92C 4P6VF 1I7HA 2PKOA 3PO0A 2WU2B 4ITKA 1JALA 1YQ3B 1WGKA 3HVZA 1JROA 1VDVA 2WDRB 3VR9B 5G5GA 4YTMB 1A70A 3NVZA 1ZUD2 1KF6B 3AB5A 1J7BA 2KMMA 2WDQB 1J7CA 2WP9B 1XLOA 3P4QB 4C80A 5EE9A 1ZXIA 1FXAA 2M56B 3VR8B 1DOXA 1F0ZA 5C2TB 4WQMA 1JQ4A 2EKIA 4WWMA 1YQ4B 2ACZB 2BS4B 3AE1B 4YXDB 2L83A 4YTPB 3B2GA 4US8A 1N60A 1TKYA 2PVGC 3AECB 4JX1C 2MJEA 2M19A 3NRZA 4JWSC 4ZOHC 1XO3A 1FFUA 2H89B 3FAHA 3AH7A 4ZHPA 1DGJA 3DWMA 4US9A 3P4SB 1SB3C 3HRDD 3RPFC 2W3SA 1ZOYB 2MH7A 1PFDA 5EE1A 3W5UB 2CJNA 2L52A 1FIQA 1KFYB 3AE6B 1N63A 1NENB 1TJEA 1WXQA 3B9JA 1N5XA 4C7ZA 3ZYYX 5MPOA 2JX5A 1TKGA 1NVID 5EE3A 3AM9A
chains in the Genus database with same CATH superfamily
4DDID 3EGRA 5G5HA 1WE7A 2QIEB 4HPMB 3PTFC 2JXTA 4GMVA 3E56A 1C1YB 1C77A 4KKJA 3PT2B 2IZVB 2EKEC 3V61A 1UGMA 1R4MI 3AE9B 5L95C 3BK2A 3R3MA 1ZE3D 2LGDA 4XDCA 3SFDB 3IXSA 2JRHA 2WQYB 2GBRA 4MH8A 2AX5A 1GC7A 5BYSA 1JWBD 2H88B 4CYEA 2K3UA 2K39A 1YX6B 2DNFA 4A3OA 1DOIA 5D94A 2BWFA 5J17A 1TKEA 1YIWA 1YJJA 4YSZB 1H8CA 1UF0A 1BMLC 1XF5L 5J2RA 2LUMA 2WXQA 3C19A 4TV3A 1GC6A 5H8YE 3O65B 1YOVB 1FEHA 2IDYA 3VH4B 4GDLB 1JWUD 4A9AA 1SJED 4X57B 3LJ3A 4WAFA 1HA5A 2KFKB 4ITKA 4RCOA 1VDVA 1A70A 2WDQB 2L32A 1TGZB 3SEBA 1WX8A 5KHQA 3Q3JA 3DPDA 1EO6A 4WWMA 4E74A 4ZRKA 1P1AA 3KUCB 1C4PA 3MFGA 4UDUC 4ZRJA 3N9YC 3PGEA 1FD6A 4HLEA 4MM3B 1R4NB 1NBFC 2XEWA 1E7VA 3QC8B 2G4DB 2OHFA 4DBGA 1L0VB 3DWGC 3Q3MC 2CU3A 3MTNB 1V5OA 2MX2A 3N30A 4GDLA 4E71A 3PS6A 2KFKA 1QOFA 4LJPB 2C9WB 2E3TA 1J0GA 2C60A 4WWOA 1SEBD 2LHEA 3L16A 2GI9A 2LRUA 3PPAA 1GAQB 4M02A 4AJYB 4XDDA 1XEEA 2KN5A 4IOIE 4W9JA 4RF0A 4JWUC 2DZJA 1PYWD 1SBBB 2G1EA 1F77A 1WMHA 3KUDB 1WSPA 3N1ZC 4RGTA 4GLSC 3P63A 3M62B 1E7PB 3L10B 3TEWA 2KANA 4MM3A 3QA8A 1C3TA 3R7RA 1MG4A 3AV8A 3QCAA 3V60A 3CSFA 3PZ8A 2Z8LA 4HPPA 1QILA 2J42A 1WZ0A 1I4QA 4HXDA 1I7HA 1K52A 2BF8B 4WQOB 4LDTD 2EMTA 3QQ8B 4OZBA 2KWVB 4EKUA 4C80A 3UIOB 4ANWA 4URKA 5G2NA 4XGAB 3VTUA 2NS5A 5BYQA 3RUIB 1EUVB 2PJHA 3IHPC 4B0EA 1C4CA 1KTKA 2R61A 3RFZB 3PHXB 1DGJA 2DZKA 2D3GA 3S2AA 1JWSD 3RPFC 1TY2A 3APDA 3W5UB 4JX1C 3Q3NC 3B9JA 1WR6E 3ZIMA 4YSYB 4LTUA 3AE8B 1EU3A 4B6WA 2V3NA 3NVWA 2MP2B 2WGSA 1WF9A 2FNJB 1N6ZA 2WXFA 2JU6X 4YT0B 4ARCA 2KC1A 3AU4A 1EF1A 1N62A 2K5PA 1HTOA 2NTTA 2MJ3A 3DVGX 4XX5A 1QLBB 5GMVA 4LJOB 2GBNA 4FLHA 2GBMA 3L54A 1K51A 3AXCA 5C3JB 1T3QA 3VVWB 1WYWB 2PTLA 4TSSA 4KV2A 1L4DB 2JF5A 1K50A 2NVUI 1YN3A 1J7AA 4JL9A 3W1SA 3PV1A 2INNE 1BUIC 3VUXA 4MH0E 3K9PB 2KHWB 3ZXRA 1Q1OA 4L1BA 2N7JA 5C1ZA 4P1BC 1L4ZB 2G45B 1QOAA 2LHDA 3A4SC 4HEA1 3PO0A 1C78A 2W9NA 1WGKA 5E6PA 4NQKE 1P7EA 2LXCA 4HPLB 1I4PA 3P4QB 2N4FA 1UH6A 2WX1A 3SDLC 2KWUB 2ACZB 4RFBA 2JYTA 3AECB 3U7DA 3U8ZA 4JWSC 1FFUA 1EU4A 1VZ7A 3P4SB 1P3QU 1ZOYB 1PQSA 5D3DA 4JGHB 1SE2A 2BTEA 3H9DA 1GPXA 1KFYB 2AQ1B 4R3DA 4J3OD 1IUEA 3W9CB 1KRHA 1SSNA 4LNIA 2LWPA 2PLPA 4KX6B 5LXIB 4C4VB 1E0ZA 4YWGG 2L05A 4EFOA 3B2FA 2L00B 2BPSA 5BO4B 1SF0A 1V6EA 4S0RA 4A8XC 3VUWA 3Q3FA 2MA9B 1LO5D 3P4PB 5TSSA 4EZKA 2KN4A 1IGDA 3PRZA 1LXDA 4H2AA 4NY0A 2JVCA 2LUEA 5BMIA 2JSVX 3NVYA 1FNWA 4FADA 3L4PA 3WA0A 4I6LB 1EM7A 2K6QA 1RLFA 1ZXHA 3OJ4B 1QQRA 1WFYA 3Q2AC 5EE0A 3AEFB 4IM3A 1T0YA 2JRIB 4DHZE 2BGFA 2DYOA 2XBBC 2MLBA 1FXTB 2FCMA 1RRBA 2WNMA 4C4VA 1QZEA 3EHVA 5AZHA 2BBCA 3RN9C 4NPNA 5BMHA 1D3ZA 4ICVA 4HCNB 3PRPB 4N9F4 1XXGA 1VZ8A 5C2TB 1F0ZA 1T6BX 1CMXB 1N60A 4MT5A 2ZEQA 1MJDA 3UQBA 3BYYB 2KOXA 2DYBA 2W82A 2Y5PA 3AH7A 4ZHPA 2M1MA 2IO0B 3BZDB 2J53A 1I35A 3RMKC 1PFDA 3ZGZA 3Q8BA 3AE6B 1F52A 5IN7A 1RAXA 1WXSA 4TQ1A 4CO7A 2K9XA 2QEJC 1XLNA 4W9GA 1IP9A 3DHIC 1L2NA 3TCAA 5DPWA 3ZNZB 2JXXA 1OQRA 4KGTA 5G55A 2KTRB 2O2VB 3N1YC 2LRWA 4FN2A 3H6NA 3DBRI 1V80A 1KLUD 3IFWB 1C76A 3IT6B 3P42A 1KLVA 2IO1B 4DXFA 3AEDB 3ZLZA 1AARA 1L6VA 4W9DA 3I57A 5E6OA 1L6UA 2M8SA 4JIOU 3IBEA 2KFJA 3HIZA 3FKYA 3AE2B 4TMAB 5DPTA 1MHHE 1D6EC 3BVMA 1AWDA 1E9MA 3PLUA 2E6XA 3R7QA 3JSVA 4PYUA 3PZDA 4KZ0A 3GS2A 2VH2A 1RWSA 1GG3A 4BBNF 2WDVB 1KLGD 5FR3A 4MELA 4BKTA 2RDGA 2FCNA 3VTVA 2FUHB 2KLGA 2JZ3B 3DCGA 3UGBB 1YQ3B 3VTWA 2O2VA 4KVGB 2ONQA 2FAZA 1SXTA 2LI5A 3A9JB 1YQ4B 1TKYA 2KX3A 5HI1A 4DWFA 1E8ZA 3RZFA 2OOBB 4AQ7A 2MBQA 1WGRA 1P0RA 2M4NA 1ZKHA 4NJ6A 3GZNB 2KJRA 2GBKA 3WIMA 1FCLA 2Z0DB 1WXQA 5KHOA 4Q2JA 5DCNA 4OVUA 3VRBB 1R7SA 3RNAC 2QC8A 2V1YA 4YSXB 2HJ1A 3P1MA 2BYFA 1UWXA 1P7FA 1QOBA 1FNVA 1Z2MA 1TYGB 2KLCA 2PIAA 3V6EB 4MJSB 3Q8CA 2C7HA 3OLMD 3R2IA 4BVUC 1DOYA 1YD8U 4YL8A 3T3NA 2INCC 4IWQA 4AUQC 2MRPA 3A9JA 3UI3A 1H4RA 2LJIA 4ZYSA 4K7UA 2O6VD 1YQBA 2BS2B 5JXVA 3I9V1 2KWDA 3HM3A 4ASWC 1JW9D 3CSTA 2RPQA 3M63B 1FRDA 3ML9A 3KLSX 1V9JA 1R4NI 1P9DU 4ZDVA 2KACA 2N1VA 4HDOA 3ZUNA 4WJPA 1VCBA 4EE2A 2V3PA 4A90A 1FNUA 1EF5A 1STEA 2KQ4X 2MHJA 5G5GA 4YTMB 2V0GA 3KW5B 2B3AA 1M4VA 3H8HA 4NZLB 1QKZA 1FXAA 2WYQA 3B2GA 5HG2A 2HDEA 4LLGM 5HKHA 1TS3A 5BMGA 3DVGY 3PVLA 2W3SA 5DPSA 4EUTA 5D7GA 5EE1A 3W1SC 3NG0A 5BYRA 2AEHA 1UNSA 3QWZB 4HK2A 2V9HA 1Q10A 2DWQA 3KH0A 4MGIE 1WGGA 1SIJA 2MSED 1F9JA 3IG3A 2A4ZA 2MWSB 4HROA 3FC4A 3AE3B 1NDDA 4TUUA 4XWWA 1HQRD 1WJNA 2J52A 2V3SA 2L3ZA 4RNAA 2LEKA 1J8CA 4F8CB 3ZNHB 2CJOA 4CHKA 3BY4B 2YVCA 4RH6A 1QT9A 1WGHA 2N9PC 3ZRCA 2KQSA 3UQAA 2YLMA 1UBIA 1NYQA 2M17A 1E6EB 5IAAC 2N9XA 2MJDA 1VJKA 3CWIA 1WI0A 1MHXA 2WXOA 3EECA 2ZZPB 4AWJA 4EZJA 4RGOS 3V05A 2RSUA 2ZNVB 4ANXA 1DYQA 2QJLA 1TIFA 2NBWB 3AEAB 4YTNB 4DXAB 1WH3A 3RULA 1P98A 1F2RI 1E8WA 4M01A 5CHWA 3VDZA 1J7CA 3U7ZA 4E3CA 5EE9A 2C7MB 3VR8B 1BT0A 3BINA 3DOWA 3CMMB 2L0FA 2CR5A 4DXGA 4OVVA 1TY0A 3Q6BA 2WX0A 3AU5A 1WY8A 2WHIA 3W1YA 1TS5A 2L52A 3DBLI 4FULA 3NS8A 1IYFA 2FCQA 2GLSA 1YNTE 2V4LA 3RNBC 4KDIC 1FXIA 4FJVB 2BW2A 2DLBA 2J0JA 1VD2A 1C79A 2JWUA 1WM3A 2FIFA 4IG7B 2KO3A 3BIID 4NQLB 2KJ6A 4K3BA 4L23A 4REZA 5LNK1 4GU2A 2N7DA 1JWAD 2LGIA 3AEEB 3BWUD 2MBOA 2BB5A 3N1XC 2FBWB 1B9RA 4WURA 4PS7A 3DBSA 2DAFA 3I63C 1WM2A 4C7YA 2GBJA 3RNGC 3ZKJC 3A9KB 2IGDA 2HTHA 3VAWA 1WYGA 4AP4C 2PMVA 1Y8RC 1JRPA 2REXA 3VH3B 3NJTA 2O6VB 2BT6A 2N9KA 1ISNA 2WXHA 1I42A 2K1FA 3AULA 4W9FA 2UYZB 1FPYA 3MC8A 2Y5CA 2KK8A 3HUIA 5J18A 2N9EB 2N7EA 3BVZA 4P6VF 3OAWA 3DBLB 1S3SG 1FCCC 3O13A 3KYCD 1KF6B 3AB5A 3C8YA 3QX1A 2KQ7A 4DHZB 2PW9A 1V2YA 3RCZA 3V62A 2FUG1 2ZPNA 2KMAA 2M56B 3WAMA 4WQMA 2IGHA 3GP7A 3AE1B 3TBLD 5JZEB 3QAQA 3X0WA 4GIVA 1XO3A 4HCPB 3RI7C 2MP2A 2DENB 4W9EA 2IPKD 1V1OA 4QAYA 1CK1A 3A9KA 1D5MC 1V5TA 1FIQA 2QSDA 2JX5A 1I4RA 1V49A 2JY6A 4BOSC 2O6VA 3SD5A 4LCDE 3VHTC 2DHZA 1ZGUB 2FCSA 2QDFA 1UWMA 1NEKB 1X1MA 3QJZA 1ZPSA 4L2YA 3CIRB 2L1AA 4ZRIA 3X23A 2WXLA 3L13A 1GUAB 5AUIA 4JLCA 1SGHA 4MGYE 3ZVVA 1FM0D 1NI3A 2J0MA 2LXAA 3IVFA 1K8RB 3DBHB 3PHWB 2QILA 4BKSA 3I3TB 4B9KA 2EELA 1WWTA 1ET6A 4GXBA 2I2YA 4WJQA 3ALBA 3RNFC 2RDBC 5CHFA 2CHXA 4II3B 2NBVB 2JYEA 1M94A 4KKIA 2NBUA 4S17A 3TEYA 3VUYA 2BB6A 4EZLA 1AW7A 4MGZE 2G9HD 2GMIC 3TIXA 4RF1A 1A5RA 5IA7A 1L0XB 3A1QB 3RYTA 1TBEA 2J4XA 3ZJTA 1HZ5A 3ZO5B 3GE3C 3BK1A 5CTRC 4GN1A 2DYMA 4WWNA 2RPVA 4KGRA 4NJCA 3HRDD 1XQQA 1WIAA 3VFKA 2XNAC 4DQOC 2CJNA 4ANVA 3J9CA 2WDTB 1N5XA 2D11A 2IGGA 2IJ0A 5MPOA 1L0YB 4TQ0A 3LYYA 1OTRB 2KDBA 3KWLA 4MEMA 4M0WB 4O1NA 4IC7B 2RDHA 1D5ZC 4HVBA 4N6EB 3EC8A 2MQJA 1RM6C 4K1RB 3UF8A 2MCNB 1WR1A 3VQIA 2L0TA 4GSWA 3Q69A 2Z0EB 4LK0M 1QOGA 3B1LX 4WH4A 3GE8C 2KAJA 4HRSA 3NS1A 1JWMD 3ABVB 3A1QA 5D6JB 1GB1A 1V8CA 2I38A 3HK0A 2DBYA 4WWPA 2W3RA 2HJ8A 4OZAA 3AE4B 3RD2A 3GZNI 4WJOA 1TTNA 1YMHE 2K0PA 4IM2A 2KC2A 2HD5B 2KX0A 2K22A 1WX7A 3AE5B 4M0WA 2EMSA 3NHEB 4NAWB 3L0WB 2C7NB 3WAOA 3ENEA 5JHBA 3EFCA 2D3CA 2BQQA 3R8BA 3H7PB 4BZAA 1XLOA 1VRAB 3M95A 1DOXA 2LMCA 3APCA 2MJEA 2M19A 2LJ5A 2QCZA 2KKCA 1TS2A 4RGNA 4XWTA 3Q14C 2MH7A 3IAS1 3KWVA 4G11A 2KDEB 2KTRA 2AWTA 1TJEA 1HTQA 5AZGA 3M3JA 1AYFA 2I1KA 1Q0WB 4IM0A 2LASA 3L08A 3NVVA 2ZW1A 2KD0A 3Q8FA 2LGSA 1WJ4A 5AEKB 2NMQA 4OHJA 3AI5A 2RD0A 3Q8EA 4IUMB 4RM9A 4B0MA 4NAWA 4JE3B 2NPTB 1WGDA 3GB1A 2LGXA 1SIFA 2CKHB 3ZDTA 4BFRA 3U30A 2WS3B 1F1HA 1CZPA 4N58A 3TMPB 2IYDB 2KWCA 4JPSA 1OQYA 4I6NB 3SHQA 2AL3A 1FRRA 3W2DA 3ETRA 2VH1A 2N9LA 1FMAD 4BAXA 3U2SC 2RMMA 1ZDVA 3R2TA 4HJKA 1OQQA 1TZOA 4IKGA 2G4SA 1OEYJ 4KSLC 1UZXB 3HM6X 4ZHOA 2AL6A 3E9SA 2KTFA 4IDIA 2DX5B 1UGJA 5C23A 5DPRA 1I4GA 3PZ7A 2WU2B 4ZRPA 1MI0A 3QIJA 4FHJA 4WJNA 2WP9B 2UWQA 2DZMA 2NPTA 2VZKD 2A5UA 2EKIA 4OVZA 2K6DB 1UUPA 3OG5A 4GDKB 4IWOA 4PK1A 4DHJD 4IWPA 2PEAA 3FILB 4US9A 3URYA 2R2OA 2BYTA 3GOEA 2QMTA 4BKGA 1LFDA 1KM7A 2JPHA 4MJSA 1NVID 3QK0A 4DK5A 3ZJUA 3BYTB 2UU7A 1E8YA 3P4RB 1MFWA 3CF6E 3NY5A 4GOCA 1MVKA 1T5XD 4BKSD 3QARA 2DAJA 4P7IA 1YN4A 4ARIA 1N5WA 2R2QA 2HTME 2WLBA 4MACA 2JWZA 1WXVA 2WXKA 3EFUA 4MGKE 4G0NB 3KVFB 2KVZA 4XZ4A 4PYZA 3JVZX 2WXNA 5AUKA 5FKAC 4OW0A 1N61A 4GDKA 1RFAA 3LDZE 3L17A 2XN9C 2AQ3B 4USAA 3T9LA 3FILA 1RFKA 2JZZA 1F2RC 1WRDB 3R66C 1XCQL 1IGCA 1LGRA 2NR2A 4KZCA 3PSEB 3VRAB 5JH5C 1ESFA 3VXWA 4N59A 2D3AA 2MBHA 2PVOD 2L76A 1K53A 3A33B 1PGBA 1R4MB 3ECIA 2CS4A 4LNNA 2RR9A 1WMHB 4WIPA 2KT7A 1TT5B 2WDRB 1T0RC 3KYDD 3NVZA 1YN5A 1ZUD2 4KSKC 1G6JA 2WWZA 1E7UA 1T0QC 1CQVA 3RT3B 4US8A 2PVGC 4LNFA 4M8MA 3FAHA 1VR9A 3A4RA 1Z5SB 1SE9A 4EEWA 2Y3AA 1JRUA 2L7RA 1IBXB 1N63A 2PE9A 5CHVC 4A3PA 1TKGA 4HJGE 2JT4B 2NCNA 2LVPA 3NZUA 1WZ3A 4OZCA 3B0AA 2I1JA 3IT4B 5IOIA 5JHAA 2M0AA 1NYRA 5GXGB 4BOZB 3WANA 4MSQB 2PPHA 1UBQA 1L7YA 4W9KA 2BS3B 4GB9A 3V6CB 4KIKB 2YEPB 2IBIB 1ZP0B 1V86A 2ZVOA 3ZNID 2ON8A 4BBNC 3ZTCA 3KQ4A 4FXCA 2D5GA 3PLVA 3RNEC 1T0SC 2WXGA 2BYVE 2W55A 3EUB2 2KNBA 2K8HA 4NAMA 3AE7B 4IW0A 4FA6A 3TEZA 1IBXA 1PGAA 4F1SA 2KVRA 3TJPA 3DHGC 2LVOA 2ZPYA 4ACFA 2C5LC 3ML8A 3NZ3A 5D3IB 1C9FA 4AJWA 3ZQ4A 2FE8A 3U52E 2KMCA 4A6QA 2QHOA 1JALA 3APFA 4NJ7A 1J7BA 4K7SA 4C00A 5IO9A 1OEYA 1WXMA 4RM8A 1WJUA 1WX9A 1YX5B 2DZIA 3MC0B 2D07B 4KIKA 2WXJA 2SEBD 3IAM1 5I4DA 4FJYA 1KOTA 3MJWA 4LNKA 3NRZA 5TR5A 2HE7A 2VZKB 3TEXA 2FIDA 3TUOA 2J0KA 3N20C 3WAPA 1GNUA 4DHJB 4JQWC 2M0XA 2X8XX 4RGMA 3Q3OC 4XE0A 5EE3A 2JZPA 2D10A 3DBHI 1D4BA 2WXPA 4G50A 4A20A 2WU5B 1IPGA 2G3QB 4M00A 4CQNA 1SJHD 1ZW7A 3I5JC 4D2KA 1XLPA 2INDC 2ZJDA 1Q5WB 4FBJB 4DDGD 2INPE 5LLIA 3ZW3A 5HFYA 4B95A 1LQBA 4AS1A 1B1ZA 2IO2B 4ICUA 4ANUA 3AN1A 3KUZA 4KGSA 4K7WA 1SE3A 3HVDA 4KDLB 4F7ZA 3QHTA 2LVQA 3PRMB 2Y5BB 1VZ6A 3SFEB 4FHKA 2LD9A 3B08A 4W9HA 1V81A 5T8IA 1ENFA 2ICIA 2KDIA 2MBEA 1QF6A 1HZ6A 3OWEB 1E10A 1SE4A 2RGFA 4II2B 2ZW0A 3AEBB 3MC9A 3DQVA 4HKQA 1XT9B 2TSSA 2ZVNA 3Q8AA 1C4AA 4PT5A 4ZRQA 5FR6A 2YEPF 2CHWA 2XK5B 2MBBB 2L83A 1J19A 4ZOHC 1WE6A 3JW0X 1MG8A 1SB3C 1TZ1A 4ZYNA 3EA6A 2BWES 4GGQA 3T8MA 5CX3A 3U4EG 4C7ZA 3UIPB 2KJHB 3AM9A 2Q5WD 3UINB 2KXJA 3V3XA 4XYCA 2X38A 2WXIA 3RNCC 1FO4A 5HHDG 3LB8C 2AQ2B 2IY0B 4LNOA 1GOZA 3DHHC 2GB1A 4M8NA 2CHZA 2VRRB 1UELA 2J7QB 3LXFA 3WCQA 1I4XA 4I6PA 1V97A 1GJZA 3ZDMC 1JMLA 3DDCB 2L8JA 3NUHB 1YJ1A 5D2MB 2N0SB 3AMZA 4HKZE 4WAAA 1MPEA 2XK5A 2CU1A 3NOBA 1RYJA 2PE6B 3N3KB 1OFFA 2MEKA 2OEDA 1VLBA 1Y56A 1ET9A 3TSSA 2OJWA 2JQRB 2KDFB 2W54A 5AZFA 4LDTB 1XD3B 3ZXVA 4HDQA 1V1PB 3RZWC 2OJRA 2D3BA 5IKCM 2BVCA 4W9IA 1XCTL 4C56C 3JSVB 2PKOA 2WXRA 2KZRA 3HVZA 2IO3B 2IY1B 3ZNGC 4FJZA 2NTSA 2WXMA 3TL5A 1LM8B 5L83A 4YXDB 1KJTA 4W9CA 3C0RB 3DVNV 4RMAA 2AYOB 1HXYD 2LFIA 3OJ3A 3DWMA 1EWCA 3ZJVA 1OGWA 1ACCA 3DVNU 2MW5A 4AOFA 3ZYYX 5EDSA 3PREA 1E8XA 3K9OB 2K8BA 3H7SA 3W5VB 1V1PA 4W9LA 2B76B 3D32A 1WRIA 1ROEA 1KH0A 1AN8A 1FFVA 1EWYC 2ASQA 1S1QB 2KYWA 4TKNA 3ZTDA 3SR6A 2D2QA 1WGYA 3MJ5A 2ZCCA 1E5WA 3ZRFA 4MSMB 2JUOA 3BVGA 3P2BA 4XC2A 4K81A 5E6NA 2KDMA 1BXTA 1JCKB 2K25A 3NZSA 1PDXA 2BKRB 3MP9A 1CJEA 1ZDXA 2LZ6A 1GB4A 1NI2A 3MHZA 5IP4D 1HEZE 1YJIA 4PS8A 3H7PA 1PUTA 4HWIB 4P16A 4MDKE 1I4HA 1E90A 1D5XC 1WJ6A 3SU8X 3AEGB 3JYUA 1L5PA 3HHMA 1XLQA 1UD7A 4J6IA 3DBRB 4P1CC 3MHSD 5H92C 4EOYA 2N1WA 1WXAA 4NNJB 1JROA 2V4IB 3VR9B 5LXHA 3H1UA 2GRIA 2KMMA 4A55A 2LGYA 1ZXIA 2GOWA 5FK9C 3T3OA 1JQ4A 2BS4B 4YTPB 1HE8A 2ZCBA 4PS3A 2Z59B 5E6JA 2H89B 1TS4A 1PGXA 2ZNVC 3N32A 1U4AA 2BYEA 3ONSA 4G3XB 4K3CA 3WALA 1NENB 2BKFA 2SAKA 2K8CA
chains in the Genus database with same CATH topology
3EGRA 4TQ1A 5G5HA 2K9XA 2QEJC 1XLNA 2QIEB 2JXTA 4OZCA 3IT4B 2M0AA 1NYRA 5GXGB 1OQRA 3E56A 1C77A 4KKJA 4KGTA 1UWMA 1NEKB 1KLUD 3AE9B 1C76A 1ZPSA 3BK2A 3IT6B 4L2YA 2BS3B 3P42A 1ZE3D 3CIRB 4DXFA 2YEPB 2L1AA 4XDCA 3AEDB 1ZP0B 3SFDB 3IXSA 2WXLA 1L6VA 2ON8A 2WQYB 3I57A 5AUIA 4MH8A 2AX5A 3KQ4A 5BYSA 1L6UA 4FXCA 2D5GA 1JWBD 2H88B 3AE2B 4TMAB 1MHHE 1D6EC 3BVMA 1AWDA 1FM0D 1E9MA 2K3UA 1NI3A 2WXGA 2W55A 3EUB2 1DOIA 2E6XA 1TKEA 4NAMA 1YJJA 2QILA 4YSZB 3AE7B 3GS2A 1RWSA 2EELA 3TEZA 1BMLC 1IBXA 1PGAA 1WWTA 1XF5L 2LUMA 2WXQA 1ET6A 2I2YA 2WDVB 1KLGD 5H8YE 5FR3A 3NZ3A 2RDGA 1FEHA 2IDYA 5D3IB 1C9FA 3ZQ4A 2FE8A 4GDLB 1JWUD 3U52E 1SJED 4WAFA 4A9AA 2JYEA 1HA5A 4KKIA 4A6QA 4ITKA 4RCOA 3TEYA 2BB6A 1JALA 1YQ3B 1AW7A 1VDVA 2G9HD 4RF1A 1A70A 2ONQA 1J7BA 2WDQB 2L32A 3SEBA 1L0XB 1SXTA 3MC0B 2WXJA 2SEBD 4WWMA 1YQ4B 2J4XA 3IAM1 5I4DA 3ZJTA 1HZ5A 3BK1A 1TKYA 2DYMA 5HI1A 1C4PA 3NRZA 3MFGA 4AQ7A 2VZKB 4UDUC 3TEXA 3TUOA 2RPVA 4KGRA 3N9YC 1FD6A 4NJCA 3HRDD 2XNAC 1FCLA 4DQOC 2CJNA 4MM3B 3J9CA 1WXQA 4RGMA 1N5XA 2IGGA 5MPOA 2IJ0A 4XE0A 5EE3A 2JZPA 1L0YB 4TQ0A 3LYYA 3KWLA 4Q2JA 2OHFA 3VRBB 1D4BA 2WXPA 1R7SA 1L0VB 3DWGC 4O1NA 4YSXB 2CU3A 2RDHA 3P1MA 1UWXA 1P7FA 2WU5B 1D5ZC 1QOBA 4N6EB 1FNVA 1RM6C 1TYGB 2PIAA 3VQIA 3Q8CA 1QOFA 4CQNA 2E3TA 1SJHD 3Q69A 4D2KA 1XLPA 4LK0M 1QOGA 1SEBD 2LHEA 4WH4A 3R2IA 1DOYA 2INPE 2GI9A 3T3NA 1GAQB 5HFYA 2KAJA 4HRSA 4XDDA 3NS1A 1JWMD 4AS1A 3ABVB 1B1ZA 1XEEA 3UI3A 2LJIA 4IOIE 4RF0A 3AN1A 4KGSA 1GB1A 4JWUC 1SE3A 4ZYSA 1V8CA 3HVDA 1PYWD 1SBBB 2G1EA 2BS2B 5JXVA 3I9V1 1F77A 2KWDA 2I38A 1JW9D 1WSPA 2DBYA 2W3RA 4RGTA 4OZAA 4GLSC 3AE4B 3P63A 1FRDA 1VZ6A 1E7PB 3SFEB 1YMHE 2K0PA 3TEWA 5T8IA 1ENFA 3AV8A 2ICIA 3KLSX 1QF6A 1HZ6A 3OWEB 1E10A 2KACA 3PZ8A 1SE4A 2Z8LA 2K22A 2ZW0A 1QILA 3AE5B 3AEBB 4M0WA 2J42A 1I4QA 1I7HA 4EE2A 1K52A 2V3PA 4NAWB 4A90A 4HKQA 1FNUA 1STEA 2TSSA 2KQ4X 4OZBA 5G5GA 4YTMB 2V0GA 3R8BA 3Q8AA 1C4AA 1M4VA 3H8HA 1XLOA 4PT5A 4ZRQA 4C80A 4NZLB 1VRAB 1QKZA 1FXAA 2YEPF 1DOXA 2LMCA 5BYQA 2L83A 5HG2A 3B2GA 2HDEA 4B0EA 1C4CA 1KTKA 4LLGM 2R61A 2MJEA 2M19A 1TS3A 4ZOHC 5BMGA 3RFZB 1TS2A 4RGNA 1DGJA 1SB3C 4XWTA 1JWSD 3RPFC 2W3SA 1TY2A 2MH7A 3IAS1 3EA6A 3KWVA 5D7GA 5EE1A 3W5UB 4JX1C 3B9JA 1TJEA 5BYRA 3U4EG 4C7ZA 1UNSA 3AM9A 2Q5WD 1AYFA 4YSYB 4LTUA 3AE8B 1EU3A 2V3NA 3NVWA 1Q10A 3NVVA 2DWQA 2ZW1A 3V3XA 3Q8FA 2X38A 1SIJA 2WXIA 1FO4A 5HHDG 3LB8C 2WXFA 2AQ2B 2JU6X 2NMQA 4OHJA 4YT0B 4ARCA 1GOZA 4HROA 2GB1A 3FC4A 3Q8EA 4B0MA 1N62A 3LXFA 3AE3B 2K5PA 4JE3B 1I4XA 3GB1A 3WCQA 4XWWA 2NTTA 1V97A 2MJ3A 1QLBB 1JMLA 1HQRD 2J52A 2WS3B 3NUHB 4RNAA 2LEKA 1CZPA 2N0SB 4N58A 3AMZA 2CJOA 4HKZE 1K51A 1MPEA 5C3JB 4RH6A 4JPSA 1QT9A 1T3QA 1RYJA 2PTLA 1NYQA 1E6EB 1OFFA 1FRRA 2MEKA 1VLBA 2OEDA 3ETRA 2N9LA 4TSSA 1Y56A 1ET9A 1FMAD 1L4DB 2MJDA 1VJKA 1K50A 1YN3A 3U2SC 2RMMA 3TSSA 1J7AA 3CWIA 1ZDVA 3W1SA 2JQRB 3R2TA 1OQQA 1TZOA 2INNE 2W54A 1BUIC 1MHXA 4IKGA 2WXOA 1V1PB 4RGOS 3V05A 1DYQA 2QJLA 4L1BA 2N7JA 4ZHOA 1XCTL 3E9SA 1L4ZB 4IDIA 4C56C 1UGJA 3AEAB 4YTNB 1QOAA 1I4GA 2LHDA 3PZ7A 4HEA1 3PO0A 2PKOA 2WXRA 1C78A 2WU2B 4ZRPA 1WGKA 3HVZA 1MI0A 1F2RI 1P7EA 2NTSA 2WXMA 2WP9B 1J7CA 1I4PA 3U7ZA 3P4QB 5EE9A 3VR8B 2VZKD 2EKIA 2ACZB 4OVZA 4RFBA 4YXDB 1UUPA 3W2DA 4GDKB 2JYTA 3AECB 4JWSC 1FFUA 1HXYD 2LFIA 4DXGA 1EU4A 1VZ7A 3FILB 1TY0A 3DWMA 1EWCA 3ZJVA 4US9A 3P4SB 3URYA 1ZOYB 5D3DA 2BYTA 1ACCA 2BTEA 1SE2A 2QMTA 1TS5A 2L52A 1GPXA 1KFYB 2AQ1B 3ZYYX 1NVID 3ZJUA 3BYTB 4R3DA 1YNTE 3P4RB 1FXIA 4J3OD 1IUEA 3W9CB 1KRHA 1SSNA 2BW2A 2DLBA 1V1PA 3W5VB 2B76B 1WRIA 1ROEA 1MVKA 1KH0A 1C79A 2JWUA 1T5XD 1AN8A 1FFVA 2PLPA 1EWYC 3BIID 4KX6B 1YN4A 4ARIA 1E0ZA 4YWGG 1N5WA 3SR6A 2HTME 2WLBA 4MACA 4L23A 3B2FA 4REZA 5LNK1 2WXKA 3MJ5A 1SF0A 1JWAD 2LGIA 3AEEB 3BWUD 4A8XC 2BB5A 3BVGA 2FBWB 1B9RA 1LO5D 4WURA 2WXNA 3P4PB 5TSSA 2KDMA 5AUKA 5FKAC 4OW0A 1N61A 2KN4A 2XN9C 1IGDA 4C7YA 1BXTA 2AQ3B 4USAA 2IGDA 1JCKB 1WYGA 3FILA 4H2AA 1RFKA 2PMVA 1F2RC 5BMIA 1PDXA 1XCQL 3MP9A 1IGCA 1CJEA 1JRPA 1ZDXA 2JSVX 3NVYA 1FNWA 3VRAB 3L4PA 1GB4A 1ESFA 2BT6A 1EM7A 3MHZA 4N59A 1HEZE 1YJIA 2N9KA 2WXHA 1ZXHA 1PUTA 4P16A 2PVOD 1I4HA 1QQRA 1K53A 5EE0A 1D5XC 3AEFB 3AEGB 1L5PA 2Y5CA 3HUIA 1XLQA 2DYOA 1PGBA 5H92C 3BVZA 4P6VF 4WIPA 1JROA 2V4IB 1FCCC 2WDRB 3VR9B 3O13A 2WNMA 3NVZA 1YN5A 1ZUD2 1KF6B 2GRIA 3AB5A 2KMMA 3C8YA 4A55A 2BBCA 2PW9A 5BMHA 1ZXIA 2FUG1 2M56B 1XXGA 1VZ8A 5FK9C 5C2TB 1F0ZA 4WQMA 3T3OA 1JQ4A 2IGHA 2BS4B 3AE1B 3GP7A 1T6BX 4YTPB 1CQVA 4US8A 1N60A 4MT5A 2PVGC 3BYYB 5E6JA 1XO3A 2W82A 2Y5PA 2H89B 3FAHA 1TS4A 1PGXA 3AH7A 4ZHPA 1VR9A 3BZDB 2IPKD 2J53A 1V1OA 1PFDA 3ZGZA 1CK1A 1D5MC 3Q8BA 2Y3AA 3AE6B 1FIQA 1IBXB 1N63A 1NENB 2QSDA 2JX5A 1I4RA 1TKGA 2SAKA 4HJGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q5W D;  3P4R B;  3KWL A;  5G5H A;  1AYF A;  2K9X A;  2OHF A;  4LTU A;  3AE8 B;  4YSY B;  1FXI A;  3VRB B;  1IUE A;  1XLN A;  1R7S A;  2QIE B;  3NVW A;  1KRH A;  1L0V B;  2DWQ A;  3NVV A;  3W5V B;  3DWG C;  3W9C B;  2B76 B;  4YSX B;  1WRI A;  2CU3 A;  1ROE A;  1SIJ A;  1FO4 A;  3P1M A;  1NYR A;  2WU5 B;  1FFV A;  3LB8 C;  1OQR A;  5GXG B;  1QOB A;  4YT0 B;  1EWY C;  3BII D;  4HRO A;  4N6E B;  1UWM A;  3FC4 A;  4KX6 B;  1RM6 C;  1N62 A;  1TYG B;  3LXF A;  1NEK B;  1E0Z A;  2PIA A;  1N5W A;  3AE3 B;  3SR6 A;  2HTM E;  2K5P A;  1QOF A;  2WLB A;  3AE9 B;  3WCQ A;  2E3T A;  3B2F A;  1XLP A;  1V97 A;  2MJ3 A;  2BS3 B;  1QLB B;  1QOG A;  3CIR B;  1SF0 A;  1JWA D;  3AEE B;  1DOY A;  3AED B;  1ZP0 B;  3SFD B;  1GAQ B;  2WS3 B;  2LEK A;  1CZP A;  2KAJ A;  1L6V A;  2N0S B;  4HRS A;  4N58 A;  3NS1 A;  2WQY B;  3ABV B;  3AMZ A;  2FBW B;  5AUI A;  2CJO A;  1B9R A;  2AX5 A;  3P4P B;  1L6U A;  5C3J B;  1GPX A;  3AN1 A;  5AUK A;  1QT9 A;  1T3Q A;  1N61 A;  4FXC A;  4JWU C;  4C7Y A;  1JWB D;  1V8C A;  2H88 B;  3AE2 B;  1RYJ A;  1AWD A;  1FM0 D;  1E9M A;  1E6E B;  1NYQ A;  1OFF A;  1FRR A;  1NI3 A;  1VLB A;  2BS2 B;  2G1E A;  1WYG A;  3ETR A;  4USA A;  1RFK A;  1FMA D;  1DOI A;  2MJD A;  1VJK A;  2W55 A;  3EUB 2;  1JW9 D;  1PDX A;  1TKE A;  2DBY A;  1J7A A;  2W3R A;  3CWI A;  1CJE A;  1YJJ A;  1JRP A;  2JQR B;  1FRD A;  3AE4 B;  1E7P B;  1OQQ A;  3NVY A;  3P63 A;  3SFE B;  3AE7 B;  3L4P A;  2W54 A;  3VRA B;  4YSZ B;  1RWS A;  2BT6 A;  4N59 A;  1YJI A;  1WWT A;  3AV8 A;  1PUT A;  2PVO D;  2WDV B;  5H8Y E;  5EE0 A;  1QF6 A;  3AEF B;  1E10 A;  2QJL A;  3AEG B;  4ZHO A;  1L5P A;  2Y5C A;  3HUI A;  1XLQ A;  2K22 A;  3AE5 B;  3AEB B;  4IDI A;  4A9A A;  3AEA B;  4YTN B;  1QOA A;  5H92 C;  4P6V F;  1I7H A;  2PKO A;  3PO0 A;  2WU2 B;  4ITK A;  1JAL A;  1YQ3 B;  1WGK A;  3HVZ A;  1JRO A;  1VDV A;  2WDR B;  3VR9 B;  5G5G A;  4YTM B;  1A70 A;  3NVZ A;  1ZUD 2;  1KF6 B;  3AB5 A;  1J7B A;  2KMM A;  2WDQ B;  1J7C A;  2WP9 B;  1XLO A;  3P4Q B;  4C80 A;  5EE9 A;  1ZXI A;  1FXA A;  2M56 B;  3VR8 B;  1DOX A;  1F0Z A;  5C2T B;  4WQM A;  1JQ4 A;  2EKI A;  4WWM A;  1YQ4 B;  2ACZ B;  2BS4 B;  3AE1 B;  4YXD B;  2L83 A;  4YTP B;  3B2G A;  4US8 A;  1N60 A;  1TKY A;  2PVG C;  3AEC B;  4JX1 C;  2MJE A;  2M19 A;  3NRZ A;  4JWS C;  4ZOH C;  1XO3 A;  1FFU A;  2H89 B;  3FAH A;  3AH7 A;  4ZHP A;  1DGJ A;  3DWM A;  4US9 A;  3P4S B;  1SB3 C;  3HRD D;  3RPF C;  2W3S A;  1ZOY B;  2MH7 A;  1PFD A;  5EE1 A;  3W5U B;  2CJN A;  2L52 A;  1FIQ A;  1KFY B;  3AE6 B;  1N63 A;  1NEN B;  1TJE A;  1WXQ A;  3B9J A;  1N5X A;  4C7Z A;  3ZYY X;  5MPO A;  2JX5 A;  1TKG A;  1NVI D;  5EE3 A;  3AM9 A; 
#chains in the Genus database with same CATH topology
 4DDI D;  3EGR A;  5G5H A;  1WE7 A;  2QIE B;  4HPM B;  3PTF C;  2JXT A;  4GMV A;  3E56 A;  1C1Y B;  1C77 A;  4KKJ A;  3PT2 B;  2IZV B;  2EKE C;  3V61 A;  1UGM A;  1R4M I;  3AE9 B;  5L95 C;  3BK2 A;  3R3M A;  1ZE3 D;  2LGD A;  4XDC A;  3SFD B;  3IXS A;  2JRH A;  2WQY B;  2GBR A;  4MH8 A;  2AX5 A;  1GC7 A;  5BYS A;  1JWB D;  2H88 B;  4CYE A;  2K3U A;  2K39 A;  1YX6 B;  2DNF A;  4A3O A;  1DOI A;  5D94 A;  2BWF A;  5J17 A;  1TKE A;  1YIW A;  1YJJ A;  4YSZ B;  1H8C A;  1UF0 A;  1BML C;  1XF5 L;  5J2R A;  2LUM A;  2WXQ A;  3C19 A;  4TV3 A;  1GC6 A;  5H8Y E;  3O65 B;  1YOV B;  1FEH A;  2IDY A;  3VH4 B;  4GDL B;  1JWU D;  4A9A A;  1SJE D;  4X57 B;  3LJ3 A;  4WAF A;  1HA5 A;  2KFK B;  4ITK A;  4RCO A;  1VDV A;  1A70 A;  2WDQ B;  2L32 A;  1TGZ B;  3SEB A;  1WX8 A;  5KHQ A;  3Q3J A;  3DPD A;  1EO6 A;  4WWM A;  4E74 A;  4ZRK A;  1P1A A;  3KUC B;  1C4P A;  3MFG A;  4UDU C;  4ZRJ A;  3N9Y C;  3PGE A;  1FD6 A;  4HLE A;  4MM3 B;  1R4N B;  1NBF C;  2XEW A;  1E7V A;  3QC8 B;  2G4D B;  2OHF A;  4DBG A;  1L0V B;  3DWG C;  3Q3M C;  2CU3 A;  3MTN B;  1V5O A;  2MX2 A;  3N30 A;  4GDL A;  4E71 A;  3PS6 A;  2KFK A;  1QOF A;  4LJP B;  2C9W B;  2E3T A;  1J0G A;  2C60 A;  4WWO A;  1SEB D;  2LHE A;  3L16 A;  2GI9 A;  2LRU A;  3PPA A;  1GAQ B;  4M02 A;  4AJY B;  4XDD A;  1XEE A;  2KN5 A;  4IOI E;  4W9J A;  4RF0 A;  4JWU C;  2DZJ A;  1PYW D;  1SBB B;  2G1E A;  1F77 A;  1WMH A;  3KUD B;  1WSP A;  3N1Z C;  4RGT A;  4GLS C;  3P63 A;  3M62 B;  1E7P B;  3L10 B;  3TEW A;  2KAN A;  4MM3 A;  3QA8 A;  1C3T A;  3R7R A;  1MG4 A;  3AV8 A;  3QCA A;  3V60 A;  3CSF A;  3PZ8 A;  2Z8L A;  4HPP A;  1QIL A;  2J42 A;  1WZ0 A;  1I4Q A;  4HXD A;  1I7H A;  1K52 A;  2BF8 B;  4WQO B;  4LDT D;  2EMT A;  3QQ8 B;  4OZB A;  2KWV B;  4EKU A;  4C80 A;  3UIO B;  4ANW A;  4URK A;  5G2N A;  4XGA B;  3VTU A;  2NS5 A;  5BYQ A;  3RUI B;  1EUV B;  2PJH A;  3IHP C;  4B0E A;  1C4C A;  1KTK A;  2R61 A;  3RFZ B;  3PHX B;  1DGJ A;  2DZK A;  2D3G A;  3S2A A;  1JWS D;  3RPF C;  1TY2 A;  3APD A;  3W5U B;  4JX1 C;  3Q3N C;  3B9J A;  1WR6 E;  3ZIM A;  4YSY B;  4LTU A;  3AE8 B;  1EU3 A;  4B6W A;  2V3N A;  3NVW A;  2MP2 B;  2WGS A;  1WF9 A;  2FNJ B;  1N6Z A;  2WXF A;  2JU6 X;  4YT0 B;  4ARC A;  2KC1 A;  3AU4 A;  1EF1 A;  1N62 A;  2K5P A;  1HTO A;  2NTT A;  2MJ3 A;  3DVG X;  4XX5 A;  1QLB B;  5GMV A;  4LJO B;  2GBN A;  4FLH A;  2GBM A;  3L54 A;  1K51 A;  3AXC A;  5C3J B;  1T3Q A;  3VVW B;  1WYW B;  2PTL A;  4TSS A;  4KV2 A;  1L4D B;  2JF5 A;  1K50 A;  2NVU I;  1YN3 A;  1J7A A;  4JL9 A;  3W1S A;  3PV1 A;  2INN E;  1BUI C;  3VUX A;  4MH0 E;  3K9P B;  2KHW B;  3ZXR A;  1Q1O A;  4L1B A;  2N7J A;  5C1Z A;  4P1B C;  1L4Z B;  2G45 B;  1QOA A;  2LHD A;  3A4S C;  4HEA 1;  3PO0 A;  1C78 A;  2W9N A;  1WGK A;  5E6P A;  4NQK E;  1P7E A;  2LXC A;  4HPL B;  1I4P A;  3P4Q B;  2N4F A;  1UH6 A;  2WX1 A;  3SDL C;  2KWU B;  2ACZ B;  4RFB A;  2JYT A;  3AEC B;  3U7D A;  3U8Z A;  4JWS C;  1FFU A;  1EU4 A;  1VZ7 A;  3P4S B;  1P3Q U;  1ZOY B;  1PQS A;  5D3D A;  4JGH B;  1SE2 A;  2BTE A;  3H9D A;  1GPX A;  1KFY B;  2AQ1 B;  4R3D A;  4J3O D;  1IUE A;  3W9C B;  1KRH A;  1SSN A;  4LNI A;  2LWP A;  2PLP A;  4KX6 B;  5LXI B;  4C4V B;  1E0Z A;  4YWG G;  2L05 A;  4EFO A;  3B2F A;  2L00 B;  2BPS A;  5BO4 B;  1SF0 A;  1V6E A;  4S0R A;  4A8X C;  3VUW A;  3Q3F A;  2MA9 B;  1LO5 D;  3P4P B;  5TSS A;  4EZK A;  2KN4 A;  1IGD A;  3PRZ A;  1LXD A;  4H2A A;  4NY0 A;  2JVC A;  2LUE A;  5BMI A;  2JSV X;  3NVY A;  1FNW A;  4FAD A;  3L4P A;  3WA0 A;  4I6L B;  1EM7 A;  2K6Q A;  1RLF A;  1ZXH A;  3OJ4 B;  1QQR A;  1WFY A;  3Q2A C;  5EE0 A;  3AEF B;  4IM3 A;  1T0Y A;  2JRI B;  4DHZ E;  2BGF A;  2DYO A;  2XBB C;  2MLB A;  1FXT B;  2FCM A;  1RRB A;  2WNM A;  4C4V A;  1QZE A;  3EHV A;  5AZH A;  2BBC A;  3RN9 C;  4NPN A;  5BMH A;  1D3Z A;  4ICV A;  4HCN B;  3PRP B;  4N9F 4;  1XXG A;  1VZ8 A;  5C2T B;  1F0Z A;  1T6B X;  1CMX B;  1N60 A;  4MT5 A;  2ZEQ A;  1MJD A;  3UQB A;  3BYY B;  2KOX A;  2DYB A;  2W82 A;  2Y5P A;  3AH7 A;  4ZHP A;  2M1M A;  2IO0 B;  3BZD B;  2J53 A;  1I35 A;  3RMK C;  1PFD A;  3ZGZ A;  3Q8B A;  3AE6 B;  1F52 A;  5IN7 A;  1RAX A;  1WXS A;  4TQ1 A;  4CO7 A;  2K9X A;  2QEJ C;  1XLN A;  4W9G A;  1IP9 A;  3DHI C;  1L2N A;  3TCA A;  5DPW A;  3ZNZ B;  2JXX A;  1OQR A;  4KGT A;  5G55 A;  2KTR B;  2O2V B;  3N1Y C;  2LRW A;  4FN2 A;  3H6N A;  3DBR I;  1V80 A;  1KLU D;  3IFW B;  1C76 A;  3IT6 B;  3P42 A;  1KLV A;  2IO1 B;  4DXF A;  3AED B;  3ZLZ A;  1AAR A;  1L6V A;  4W9D A;  3I57 A;  5E6O A;  1L6U A;  2M8S A;  4JIO U;  3IBE A;  2KFJ A;  3HIZ A;  3FKY A;  3AE2 B;  4TMA B;  5DPT A;  1MHH E;  1D6E C;  3BVM A;  1AWD A;  1E9M A;  3PLU A;  2E6X A;  3R7Q A;  3JSV A;  4PYU A;  3PZD A;  4KZ0 A;  3GS2 A;  2VH2 A;  1RWS A;  1GG3 A;  4BBN F;  2WDV B;  1KLG D;  5FR3 A;  4MEL A;  4BKT A;  2RDG A;  2FCN A;  3VTV A;  2FUH B;  2KLG A;  2JZ3 B;  3DCG A;  3UGB B;  1YQ3 B;  3VTW A;  2O2V A;  4KVG B;  2ONQ A;  2FAZ A;  1SXT A;  2LI5 A;  3A9J B;  1YQ4 B;  1TKY A;  2KX3 A;  5HI1 A;  4DWF A;  1E8Z A;  3RZF A;  2OOB B;  4AQ7 A;  2MBQ A;  1WGR A;  1P0R A;  2M4N A;  1ZKH A;  4NJ6 A;  3GZN B;  2KJR A;  2GBK A;  3WIM A;  1FCL A;  2Z0D B;  1WXQ A;  5KHO A;  4Q2J A;  5DCN A;  4OVU A;  3VRB B;  1R7S A;  3RNA C;  2QC8 A;  2V1Y A;  4YSX B;  2HJ1 A;  3P1M A;  2BYF A;  1UWX A;  1P7F A;  1QOB A;  1FNV A;  1Z2M A;  1TYG B;  2KLC A;  2PIA A;  3V6E B;  4MJS B;  3Q8C A;  2C7H A;  3OLM D;  3R2I A;  4BVU C;  1DOY A;  1YD8 U;  4YL8 A;  3T3N A;  2INC C;  4IWQ A;  4AUQ C;  2MRP A;  3A9J A;  3UI3 A;  1H4R A;  2LJI A;  4ZYS A;  4K7U A;  2O6V D;  1YQB A;  2BS2 B;  5JXV A;  3I9V 1;  2KWD A;  3HM3 A;  4ASW C;  1JW9 D;  3CST A;  2RPQ A;  3M63 B;  1FRD A;  3ML9 A;  3KLS X;  1V9J A;  1R4N I;  1P9D U;  4ZDV A;  2KAC A;  2N1V A;  4HDO A;  3ZUN A;  4WJP A;  1VCB A;  4EE2 A;  2V3P A;  4A90 A;  1FNU A;  1EF5 A;  1STE A;  2KQ4 X;  2MHJ A;  5G5G A;  4YTM B;  2V0G A;  3KW5 B;  2B3A A;  1M4V A;  3H8H A;  4NZL B;  1QKZ A;  1FXA A;  2WYQ A;  3B2G A;  5HG2 A;  2HDE A;  4LLG M;  5HKH A;  1TS3 A;  5BMG A;  3DVG Y;  3PVL A;  2W3S A;  5DPS A;  4EUT A;  5D7G A;  5EE1 A;  3W1S C;  3NG0 A;  5BYR A;  2AEH A;  1UNS A;  3QWZ B;  4HK2 A;  2V9H A;  1Q10 A;  2DWQ A;  3KH0 A;  4MGI E;  1WGG A;  1SIJ A;  2MSE D;  1F9J A;  3IG3 A;  2A4Z A;  2MWS B;  4HRO A;  3FC4 A;  3AE3 B;  1NDD A;  4TUU A;  4XWW A;  1HQR D;  1WJN A;  2J52 A;  2V3S A;  2L3Z A;  4RNA A;  2LEK A;  1J8C A;  4F8C B;  3ZNH B;  2CJO A;  4CHK A;  3BY4 B;  2YVC A;  4RH6 A;  1QT9 A;  1WGH A;  2N9P C;  3ZRC A;  2KQS A;  3UQA A;  2YLM A;  1UBI A;  1NYQ A;  2M17 A;  1E6E B;  5IAA C;  2N9X A;  2MJD A;  1VJK A;  3CWI A;  1WI0 A;  1MHX A;  2WXO A;  3EEC A;  2ZZP B;  4AWJ A;  4EZJ A;  4RGO S;  3V05 A;  2RSU A;  2ZNV B;  4ANX A;  1DYQ A;  2QJL A;  1TIF A;  2NBW B;  3AEA B;  4YTN B;  4DXA B;  1WH3 A;  3RUL A;  1P98 A;  1F2R I;  1E8W A;  4M01 A;  5CHW A;  3VDZ A;  1J7C A;  3U7Z A;  4E3C A;  5EE9 A;  2C7M B;  3VR8 B;  1BT0 A;  3BIN A;  3DOW A;  3CMM B;  2L0F A;  2CR5 A;  4DXG A;  4OVV A;  1TY0 A;  3Q6B A;  2WX0 A;  3AU5 A;  1WY8 A;  2WHI A;  3W1Y A;  1TS5 A;  2L52 A;  3DBL I;  4FUL A;  3NS8 A;  1IYF A;  2FCQ A;  2GLS A;  1YNT E;  2V4L A;  3RNB C;  4KDI C;  1FXI A;  4FJV B;  2BW2 A;  2DLB A;  2J0J A;  1VD2 A;  1C79 A;  2JWU A;  1WM3 A;  2FIF A;  4IG7 B;  2KO3 A;  3BII D;  4NQL B;  2KJ6 A;  4K3B A;  4L23 A;  4REZ A;  5LNK 1;  4GU2 A;  2N7D A;  1JWA D;  2LGI A;  3AEE B;  3BWU D;  2MBO A;  2BB5 A;  3N1X C;  2FBW B;  1B9R A;  4WUR A;  4PS7 A;  3DBS A;  2DAF A;  3I63 C;  1WM2 A;  4C7Y A;  2GBJ A;  3RNG C;  3ZKJ C;  3A9K B;  2IGD A;  2HTH A;  3VAW A;  1WYG A;  4AP4 C;  2PMV A;  1Y8R C;  1JRP A;  2REX A;  3VH3 B;  3NJT A;  2O6V B;  2BT6 A;  2N9K A;  1ISN A;  2WXH A;  1I42 A;  2K1F A;  3AUL A;  4W9F A;  2UYZ B;  1FPY A;  3MC8 A;  2Y5C A;  2KK8 A;  3HUI A;  5J18 A;  2N9E B;  2N7E A;  3BVZ A;  4P6V F;  3OAW A;  3DBL B;  1S3S G;  1FCC C;  3O13 A;  3KYC D;  1KF6 B;  3AB5 A;  3C8Y A;  3QX1 A;  2KQ7 A;  4DHZ B;  2PW9 A;  1V2Y A;  3RCZ A;  3V62 A;  2FUG 1;  2ZPN A;  2KMA A;  2M56 B;  3WAM A;  4WQM A;  2IGH A;  3GP7 A;  3AE1 B;  3TBL D;  5JZE B;  3QAQ A;  3X0W A;  4GIV A;  1XO3 A;  4HCP B;  3RI7 C;  2MP2 A;  2DEN B;  4W9E A;  2IPK D;  1V1O A;  4QAY A;  1CK1 A;  3A9K A;  1D5M C;  1V5T A;  1FIQ A;  2QSD A;  2JX5 A;  1I4R A;  1V49 A;  2JY6 A;  4BOS C;  2O6V A;  3SD5 A;  4LCD E;  3VHT C;  2DHZ A;  1ZGU B;  2FCS A;  2QDF A;  1UWM A;  1NEK B;  1X1M A;  3QJZ A;  1ZPS A;  4L2Y A;  3CIR B;  2L1A A;  4ZRI A;  3X23 A;  2WXL A;  3L13 A;  1GUA B;  5AUI A;  4JLC A;  1SGH A;  4MGY E;  3ZVV A;  1FM0 D;  1NI3 A;  2J0M A;  2LXA A;  3IVF A;  1K8R B;  3DBH B;  3PHW B;  2QIL A;  4BKS A;  3I3T B;  4B9K A;  2EEL A;  1WWT A;  1ET6 A;  4GXB A;  2I2Y A;  4WJQ A;  3ALB A;  3RNF C;  2RDB C;  5CHF A;  2CHX A;  4II3 B;  2NBV B;  2JYE A;  1M94 A;  4KKI A;  2NBU A;  4S17 A;  3TEY A;  3VUY A;  2BB6 A;  4EZL A;  1AW7 A;  4MGZ E;  2G9H D;  2GMI C;  3TIX A;  4RF1 A;  1A5R A;  5IA7 A;  1L0X B;  3A1Q B;  3RYT A;  1TBE A;  2J4X A;  3ZJT A;  1HZ5 A;  3ZO5 B;  3GE3 C;  3BK1 A;  5CTR C;  4GN1 A;  2DYM A;  4WWN A;  2RPV A;  4KGR A;  4NJC A;  3HRD D;  1XQQ A;  1WIA A;  3VFK A;  2XNA C;  4DQO C;  2CJN A;  4ANV A;  3J9C A;  2WDT B;  1N5X A;  2D11 A;  2IGG A;  2IJ0 A;  5MPO A;  1L0Y B;  4TQ0 A;  3LYY A;  1OTR B;  2KDB A;  3KWL A;  4MEM A;  4M0W B;  4O1N A;  4IC7 B;  2RDH A;  1D5Z C;  4HVB A;  4N6E B;  3EC8 A;  2MQJ A;  1RM6 C;  4K1R B;  3UF8 A;  2MCN B;  1WR1 A;  3VQI A;  2L0T A;  4GSW A;  3Q69 A;  2Z0E B;  4LK0 M;  1QOG A;  3B1L X;  4WH4 A;  3GE8 C;  2KAJ A;  4HRS A;  3NS1 A;  1JWM D;  3ABV B;  3A1Q A;  5D6J B;  1GB1 A;  1V8C A;  2I38 A;  3HK0 A;  2DBY A;  4WWP A;  2W3R A;  2HJ8 A;  4OZA A;  3AE4 B;  3RD2 A;  3GZN I;  4WJO A;  1TTN A;  1YMH E;  2K0P A;  4IM2 A;  2KC2 A;  2HD5 B;  2KX0 A;  2K22 A;  1WX7 A;  3AE5 B;  4M0W A;  2EMS A;  3NHE B;  4NAW B;  3L0W B;  2C7N B;  3WAO A;  3ENE A;  5JHB A;  3EFC A;  2D3C A;  2BQQ A;  3R8B A;  3H7P B;  4BZA A;  1XLO A;  1VRA B;  3M95 A;  1DOX A;  2LMC A;  3APC A;  2MJE A;  2M19 A;  2LJ5 A;  2QCZ A;  2KKC A;  1TS2 A;  4RGN A;  4XWT A;  3Q14 C;  2MH7 A;  3IAS 1;  3KWV A;  4G11 A;  2KDE B;  2KTR A;  2AWT A;  1TJE A;  1HTQ A;  5AZG A;  3M3J A;  1AYF A;  2I1K A;  1Q0W B;  4IM0 A;  2LAS A;  3L08 A;  3NVV A;  2ZW1 A;  2KD0 A;  3Q8F A;  2LGS A;  1WJ4 A;  5AEK B;  2NMQ A;  4OHJ A;  3AI5 A;  2RD0 A;  3Q8E A;  4IUM B;  4RM9 A;  4B0M A;  4NAW A;  4JE3 B;  2NPT B;  1WGD A;  3GB1 A;  2LGX A;  1SIF A;  2CKH B;  3ZDT A;  4BFR A;  3U30 A;  2WS3 B;  1F1H A;  1CZP A;  4N58 A;  3TMP B;  2IYD B;  2KWC A;  4JPS A;  1OQY A;  4I6N B;  3SHQ A;  2AL3 A;  1FRR A;  3W2D A;  3ETR A;  2VH1 A;  2N9L A;  1FMA D;  4BAX A;  3U2S C;  2RMM A;  1ZDV A;  3R2T A;  4HJK A;  1OQQ A;  1TZO A;  4IKG A;  2G4S A;  1OEY J;  4KSL C;  1UZX B;  3HM6 X;  4ZHO A;  2AL6 A;  3E9S A;  2KTF A;  4IDI A;  2DX5 B;  1UGJ A;  5C23 A;  5DPR A;  1I4G A;  3PZ7 A;  2WU2 B;  4ZRP A;  1MI0 A;  3QIJ A;  4FHJ A;  4WJN A;  2WP9 B;  2UWQ A;  2DZM A;  2NPT A;  2VZK D;  2A5U A;  2EKI A;  4OVZ A;  2K6D B;  1UUP A;  3OG5 A;  4GDK B;  4IWO A;  4PK1 A;  4DHJ D;  4IWP A;  2PEA A;  3FIL B;  4US9 A;  3URY A;  2R2O A;  2BYT A;  3GOE A;  2QMT A;  4BKG A;  1LFD A;  1KM7 A;  2JPH A;  4MJS A;  1NVI D;  3QK0 A;  4DK5 A;  3ZJU A;  3BYT B;  2UU7 A;  1E8Y A;  3P4R B;  1MFW A;  3CF6 E;  3NY5 A;  4GOC A;  1MVK A;  1T5X D;  4BKS D;  3QAR A;  2DAJ A;  4P7I A;  1YN4 A;  4ARI A;  1N5W A;  2R2Q A;  2HTM E;  2WLB A;  4MAC A;  2JWZ A;  1WXV A;  2WXK A;  3EFU A;  4MGK E;  4G0N B;  3KVF B;  2KVZ A;  4XZ4 A;  4PYZ A;  3JVZ X;  2WXN A;  5AUK A;  5FKA C;  4OW0 A;  1N61 A;  4GDK A;  1RFA A;  3LDZ E;  3L17 A;  2XN9 C;  2AQ3 B;  4USA A;  3T9L A;  3FIL A;  1RFK A;  2JZZ A;  1F2R C;  1WRD B;  3R66 C;  1XCQ L;  1IGC A;  1LGR A;  2NR2 A;  4KZC A;  3PSE B;  3VRA B;  5JH5 C;  1ESF A;  3VXW A;  4N59 A;  2D3A A;  2MBH A;  2PVO D;  2L76 A;  1K53 A;  3A33 B;  1PGB A;  1R4M B;  3ECI A;  2CS4 A;  4LNN A;  2RR9 A;  1WMH B;  4WIP A;  2KT7 A;  1TT5 B;  2WDR B;  1T0R C;  3KYD D;  3NVZ A;  1YN5 A;  1ZUD 2;  4KSK C;  1G6J A;  2WWZ A;  1E7U A;  1T0Q C;  1CQV A;  3RT3 B;  4US8 A;  2PVG C;  4LNF A;  4M8M A;  3FAH A;  1VR9 A;  3A4R A;  1Z5S B;  1SE9 A;  4EEW A;  2Y3A A;  1JRU A;  2L7R A;  1IBX B;  1N63 A;  2PE9 A;  5CHV C;  4A3P A;  1TKG A;  4HJG E;  2JT4 B;  2NCN A;  2LVP A;  3NZU A;  1WZ3 A;  4OZC A;  3B0A A;  2I1J A;  3IT4 B;  5IOI A;  5JHA A;  2M0A A;  1NYR A;  5GXG B;  4BOZ B;  3WAN A;  4MSQ B;  2PPH A;  1UBQ A;  1L7Y A;  4W9K A;  2BS3 B;  4GB9 A;  3V6C B;  4KIK B;  2YEP B;  2IBI B;  1ZP0 B;  1V86 A;  2ZVO A;  3ZNI D;  2ON8 A;  4BBN C;  3ZTC A;  3KQ4 A;  4FXC A;  2D5G A;  3PLV A;  3RNE C;  1T0S C;  2WXG A;  2BYV E;  2W55 A;  3EUB 2;  2KNB A;  2K8H A;  4NAM A;  3AE7 B;  4IW0 A;  4FA6 A;  3TEZ A;  1IBX A;  1PGA A;  4F1S A;  2KVR A;  3TJP A;  3DHG C;  2LVO A;  2ZPY A;  4ACF A;  2C5L C;  3ML8 A;  3NZ3 A;  5D3I B;  1C9F A;  4AJW A;  3ZQ4 A;  2FE8 A;  3U52 E;  2KMC A;  4A6Q A;  2QHO A;  1JAL A;  3APF A;  4NJ7 A;  1J7B A;  4K7S A;  4C00 A;  5IO9 A;  1OEY A;  1WXM A;  4RM8 A;  1WJU A;  1WX9 A;  1YX5 B;  2DZI A;  3MC0 B;  2D07 B;  4KIK A;  2WXJ A;  2SEB D;  3IAM 1;  5I4D A;  4FJY A;  1KOT A;  3MJW A;  4LNK A;  3NRZ A;  5TR5 A;  2HE7 A;  2VZK B;  3TEX A;  2FID A;  3TUO A;  2J0K A;  3N20 C;  3WAP A;  1GNU A;  4DHJ B;  4JQW C;  2M0X A;  2X8X X;  4RGM A;  3Q3O C;  4XE0 A;  5EE3 A;  2JZP A;  2D10 A;  3DBH I;  1D4B A;  2WXP A;  4G50 A;  4A20 A;  2WU5 B;  1IPG A;  2G3Q B;  4M00 A;  4CQN A;  1SJH D;  1ZW7 A;  3I5J C;  4D2K A;  1XLP A;  2IND C;  2ZJD A;  1Q5W B;  4FBJ B;  4DDG D;  2INP E;  5LLI A;  3ZW3 A;  5HFY A;  4B95 A;  1LQB A;  4AS1 A;  1B1Z A;  2IO2 B;  4ICU A;  4ANU A;  3AN1 A;  3KUZ A;  4KGS A;  4K7W A;  1SE3 A;  3HVD A;  4KDL B;  4F7Z A;  3QHT A;  2LVQ A;  3PRM B;  2Y5B B;  1VZ6 A;  3SFE B;  4FHK A;  2LD9 A;  3B08 A;  4W9H A;  1V81 A;  5T8I A;  1ENF A;  2ICI A;  2KDI A;  2MBE A;  1QF6 A;  1HZ6 A;  3OWE B;  1E10 A;  1SE4 A;  2RGF A;  4II2 B;  2ZW0 A;  3AEB B;  3MC9 A;  3DQV A;  4HKQ A;  1XT9 B;  2TSS A;  2ZVN A;  3Q8A A;  1C4A A;  4PT5 A;  4ZRQ A;  5FR6 A;  2YEP F;  2CHW A;  2XK5 B;  2MBB B;  2L83 A;  1J19 A;  4ZOH C;  1WE6 A;  3JW0 X;  1MG8 A;  1SB3 C;  1TZ1 A;  4ZYN A;  3EA6 A;  2BWE S;  4GGQ A;  3T8M A;  5CX3 A;  3U4E G;  4C7Z A;  3UIP B;  2KJH B;  3AM9 A;  2Q5W D;  3UIN B;  2KXJ A;  3V3X A;  4XYC A;  2X38 A;  2WXI A;  3RNC C;  1FO4 A;  5HHD G;  3LB8 C;  2AQ2 B;  2IY0 B;  4LNO A;  1GOZ A;  3DHH C;  2GB1 A;  4M8N A;  2CHZ A;  2VRR B;  1UEL A;  2J7Q B;  3LXF A;  3WCQ A;  1I4X A;  4I6P A;  1V97 A;  1GJZ A;  3ZDM C;  1JML A;  3DDC B;  2L8J A;  3NUH B;  1YJ1 A;  5D2M B;  2N0S B;  3AMZ A;  4HKZ E;  4WAA A;  1MPE A;  2XK5 A;  2CU1 A;  3NOB A;  1RYJ A;  2PE6 B;  3N3K B;  1OFF A;  2MEK A;  2OED A;  1VLB A;  1Y56 A;  1ET9 A;  3TSS A;  2OJW A;  2JQR B;  2KDF B;  2W54 A;  5AZF A;  4LDT B;  1XD3 B;  3ZXV A;  4HDQ A;  1V1P B;  3RZW C;  2OJR A;  2D3B A;  5IKC M;  2BVC A;  4W9I A;  1XCT L;  4C56 C;  3JSV B;  2PKO A;  2WXR A;  2KZR A;  3HVZ A;  2IO3 B;  2IY1 B;  3ZNG C;  4FJZ A;  2NTS A;  2WXM A;  3TL5 A;  1LM8 B;  5L83 A;  4YXD B;  1KJT A;  4W9C A;  3C0R B;  3DVN V;  4RMA A;  2AYO B;  1HXY D;  2LFI A;  3OJ3 A;  3DWM A;  1EWC A;  3ZJV A;  1OGW A;  1ACC A;  3DVN U;  2MW5 A;  4AOF A;  3ZYY X;  5EDS A;  3PRE A;  1E8X A;  3K9O B;  2K8B A;  3H7S A;  3W5V B;  1V1P A;  4W9L A;  2B76 B;  3D32 A;  1WRI A;  1ROE A;  1KH0 A;  1AN8 A;  1FFV A;  1EWY C;  2ASQ A;  1S1Q B;  2KYW A;  4TKN A;  3ZTD A;  3SR6 A;  2D2Q A;  1WGY A;  3MJ5 A;  2ZCC A;  1E5W A;  3ZRF A;  4MSM B;  2JUO A;  3BVG A;  3P2B A;  4XC2 A;  4K81 A;  5E6N A;  2KDM A;  1BXT A;  1JCK B;  2K25 A;  3NZS A;  1PDX A;  2BKR B;  3MP9 A;  1CJE A;  1ZDX A;  2LZ6 A;  1GB4 A;  1NI2 A;  3MHZ A;  5IP4 D;  1HEZ E;  1YJI A;  4PS8 A;  3H7P A;  1PUT A;  4HWI B;  4P16 A;  4MDK E;  1I4H A;  1E90 A;  1D5X C;  1WJ6 A;  3SU8 X;  3AEG B;  3JYU A;  1L5P A;  3HHM A;  1XLQ A;  1UD7 A;  4J6I A;  3DBR B;  4P1C C;  3MHS D;  5H92 C;  4EOY A;  2N1W A;  1WXA A;  4NNJ B;  1JRO A;  2V4I B;  3VR9 B;  5LXH A;  3H1U A;  2GRI A;  2KMM A;  4A55 A;  2LGY A;  1ZXI A;  2GOW A;  5FK9 C;  3T3O A;  1JQ4 A;  2BS4 B;  4YTP B;  1HE8 A;  2ZCB A;  4PS3 A;  2Z59 B;  5E6J A;  2H89 B;  1TS4 A;  1PGX A;  2ZNV C;  3N32 A;  1U4A A;  2BYE A;  3ONS A;  4G3X B;  4K3C A;  3WAL A;  1NEN B;  2BKF A;  2SAK A;  2K8C A; 
#chains in the Genus database with same CATH homology
 3EGR A;  4TQ1 A;  5G5H A;  2K9X A;  2QEJ C;  1XLN A;  2QIE B;  2JXT A;  4OZC A;  3IT4 B;  2M0A A;  1NYR A;  5GXG B;  1OQR A;  3E56 A;  1C77 A;  4KKJ A;  4KGT A;  1UWM A;  1NEK B;  1KLU D;  3AE9 B;  1C76 A;  1ZPS A;  3BK2 A;  3IT6 B;  4L2Y A;  2BS3 B;  3P42 A;  1ZE3 D;  3CIR B;  4DXF A;  2YEP B;  2L1A A;  4XDC A;  3AED B;  1ZP0 B;  3SFD B;  3IXS A;  2WXL A;  1L6V A;  2ON8 A;  2WQY B;  3I57 A;  5AUI A;  4MH8 A;  2AX5 A;  3KQ4 A;  5BYS A;  1L6U A;  4FXC A;  2D5G A;  1JWB D;  2H88 B;  3AE2 B;  4TMA B;  1MHH E;  1D6E C;  3BVM A;  1AWD A;  1FM0 D;  1E9M A;  2K3U A;  1NI3 A;  2WXG A;  2W55 A;  3EUB 2;  1DOI A;  2E6X A;  1TKE A;  4NAM A;  1YJJ A;  2QIL A;  4YSZ B;  3AE7 B;  3GS2 A;  1RWS A;  2EEL A;  3TEZ A;  1BML C;  1IBX A;  1PGA A;  1WWT A;  1XF5 L;  2LUM A;  2WXQ A;  1ET6 A;  2I2Y A;  2WDV B;  1KLG D;  5H8Y E;  5FR3 A;  3NZ3 A;  2RDG A;  1FEH A;  2IDY A;  5D3I B;  1C9F A;  3ZQ4 A;  2FE8 A;  4GDL B;  1JWU D;  3U52 E;  1SJE D;  4WAF A;  4A9A A;  2JYE A;  1HA5 A;  4KKI A;  4A6Q A;  4ITK A;  4RCO A;  3TEY A;  2BB6 A;  1JAL A;  1YQ3 B;  1AW7 A;  1VDV A;  2G9H D;  4RF1 A;  1A70 A;  2ONQ A;  1J7B A;  2WDQ B;  2L32 A;  3SEB A;  1L0X B;  1SXT A;  3MC0 B;  2WXJ A;  2SEB D;  4WWM A;  1YQ4 B;  2J4X A;  3IAM 1;  5I4D A;  3ZJT A;  1HZ5 A;  3BK1 A;  1TKY A;  2DYM A;  5HI1 A;  1C4P A;  3NRZ A;  3MFG A;  4AQ7 A;  2VZK B;  4UDU C;  3TEX A;  3TUO A;  2RPV A;  4KGR A;  3N9Y C;  1FD6 A;  4NJC A;  3HRD D;  2XNA C;  1FCL A;  4DQO C;  2CJN A;  4MM3 B;  3J9C A;  1WXQ A;  4RGM A;  1N5X A;  2IGG A;  5MPO A;  2IJ0 A;  4XE0 A;  5EE3 A;  2JZP A;  1L0Y B;  4TQ0 A;  3LYY A;  3KWL A;  4Q2J A;  2OHF A;  3VRB B;  1D4B A;  2WXP A;  1R7S A;  1L0V B;  3DWG C;  4O1N A;  4YSX B;  2CU3 A;  2RDH A;  3P1M A;  1UWX A;  1P7F A;  2WU5 B;  1D5Z C;  1QOB A;  4N6E B;  1FNV A;  1RM6 C;  1TYG B;  2PIA A;  3VQI A;  3Q8C A;  1QOF A;  4CQN A;  2E3T A;  1SJH D;  3Q69 A;  4D2K A;  1XLP A;  4LK0 M;  1QOG A;  1SEB D;  2LHE A;  4WH4 A;  3R2I A;  1DOY A;  2INP E;  2GI9 A;  3T3N A;  1GAQ B;  5HFY A;  2KAJ A;  4HRS A;  4XDD A;  3NS1 A;  1JWM D;  4AS1 A;  3ABV B;  1B1Z A;  1XEE A;  3UI3 A;  2LJI A;  4IOI E;  4RF0 A;  3AN1 A;  4KGS A;  1GB1 A;  4JWU C;  1SE3 A;  4ZYS A;  1V8C A;  3HVD A;  1PYW D;  1SBB B;  2G1E A;  2BS2 B;  5JXV A;  3I9V 1;  1F77 A;  2KWD A;  2I38 A;  1JW9 D;  1WSP A;  2DBY A;  2W3R A;  4RGT A;  4OZA A;  4GLS C;  3AE4 B;  3P63 A;  1FRD A;  1VZ6 A;  1E7P B;  3SFE B;  1YMH E;  2K0P A;  3TEW A;  5T8I A;  1ENF A;  3AV8 A;  2ICI A;  3KLS X;  1QF6 A;  1HZ6 A;  3OWE B;  1E10 A;  2KAC A;  3PZ8 A;  1SE4 A;  2Z8L A;  2K22 A;  2ZW0 A;  1QIL A;  3AE5 B;  3AEB B;  4M0W A;  2J42 A;  1I4Q A;  1I7H A;  4EE2 A;  1K52 A;  2V3P A;  4NAW B;  4A90 A;  4HKQ A;  1FNU A;  1STE A;  2TSS A;  2KQ4 X;  4OZB A;  5G5G A;  4YTM B;  2V0G A;  3R8B A;  3Q8A A;  1C4A A;  1M4V A;  3H8H A;  1XLO A;  4PT5 A;  4ZRQ A;  4C80 A;  4NZL B;  1VRA B;  1QKZ A;  1FXA A;  2YEP F;  1DOX A;  2LMC A;  5BYQ A;  2L83 A;  5HG2 A;  3B2G A;  2HDE A;  4B0E A;  1C4C A;  1KTK A;  4LLG M;  2R61 A;  2MJE A;  2M19 A;  1TS3 A;  4ZOH C;  5BMG A;  3RFZ B;  1TS2 A;  4RGN A;  1DGJ A;  1SB3 C;  4XWT A;  1JWS D;  3RPF C;  2W3S A;  1TY2 A;  2MH7 A;  3IAS 1;  3EA6 A;  3KWV A;  5D7G A;  5EE1 A;  3W5U B;  4JX1 C;  3B9J A;  1TJE A;  5BYR A;  3U4E G;  4C7Z A;  1UNS A;  3AM9 A;  2Q5W D;  1AYF A;  4YSY B;  4LTU A;  3AE8 B;  1EU3 A;  2V3N A;  3NVW A;  1Q10 A;  3NVV A;  2DWQ A;  2ZW1 A;  3V3X A;  3Q8F A;  2X38 A;  1SIJ A;  2WXI A;  1FO4 A;  5HHD G;  3LB8 C;  2WXF A;  2AQ2 B;  2JU6 X;  2NMQ A;  4OHJ A;  4YT0 B;  4ARC A;  1GOZ A;  4HRO A;  2GB1 A;  3FC4 A;  3Q8E A;  4B0M A;  1N62 A;  3LXF A;  3AE3 B;  2K5P A;  4JE3 B;  1I4X A;  3GB1 A;  3WCQ A;  4XWW A;  2NTT A;  1V97 A;  2MJ3 A;  1QLB B;  1JML A;  1HQR D;  2J52 A;  2WS3 B;  3NUH B;  4RNA A;  2LEK A;  1CZP A;  2N0S B;  4N58 A;  3AMZ A;  2CJO A;  4HKZ E;  1K51 A;  1MPE A;  5C3J B;  4RH6 A;  4JPS A;  1QT9 A;  1T3Q A;  1RYJ A;  2PTL A;  1NYQ A;  1E6E B;  1OFF A;  1FRR A;  2MEK A;  1VLB A;  2OED A;  3ETR A;  2N9L A;  4TSS A;  1Y56 A;  1ET9 A;  1FMA D;  1L4D B;  2MJD A;  1VJK A;  1K50 A;  1YN3 A;  3U2S C;  2RMM A;  3TSS A;  1J7A A;  3CWI A;  1ZDV A;  3W1S A;  2JQR B;  3R2T A;  1OQQ A;  1TZO A;  2INN E;  2W54 A;  1BUI C;  1MHX A;  4IKG A;  2WXO A;  1V1P B;  4RGO S;  3V05 A;  1DYQ A;  2QJL A;  4L1B A;  2N7J A;  4ZHO A;  1XCT L;  3E9S A;  1L4Z B;  4IDI A;  4C56 C;  1UGJ A;  3AEA B;  4YTN B;  1QOA A;  1I4G A;  2LHD A;  3PZ7 A;  4HEA 1;  3PO0 A;  2PKO A;  2WXR A;  1C78 A;  2WU2 B;  4ZRP A;  1WGK A;  3HVZ A;  1MI0 A;  1F2R I;  1P7E A;  2NTS A;  2WXM A;  2WP9 B;  1J7C A;  1I4P A;  3U7Z A;  3P4Q B;  5EE9 A;  3VR8 B;  2VZK D;  2EKI A;  2ACZ B;  4OVZ A;  4RFB A;  4YXD B;  1UUP A;  3W2D A;  4GDK B;  2JYT A;  3AEC B;  4JWS C;  1FFU A;  1HXY D;  2LFI A;  4DXG A;  1EU4 A;  1VZ7 A;  3FIL B;  1TY0 A;  3DWM A;  1EWC A;  3ZJV A;  4US9 A;  3P4S B;  3URY A;  1ZOY B;  5D3D A;  2BYT A;  1ACC A;  2BTE A;  1SE2 A;  2QMT A;  1TS5 A;  2L52 A;  1GPX A;  1KFY B;  2AQ1 B;  3ZYY X;  1NVI D;  3ZJU A;  3BYT B;  4R3D A;  1YNT E;  3P4R B;  1FXI A;  4J3O D;  1IUE A;  3W9C B;  1KRH A;  1SSN A;  2BW2 A;  2DLB A;  1V1P A;  3W5V B;  2B76 B;  1WRI A;  1ROE A;  1MVK A;  1KH0 A;  1C79 A;  2JWU A;  1T5X D;  1AN8 A;  1FFV A;  2PLP A;  1EWY C;  3BII D;  4KX6 B;  1YN4 A;  4ARI A;  1E0Z A;  4YWG G;  1N5W A;  3SR6 A;  2HTM E;  2WLB A;  4MAC A;  4L23 A;  3B2F A;  4REZ A;  5LNK 1;  2WXK A;  3MJ5 A;  1SF0 A;  1JWA D;  2LGI A;  3AEE B;  3BWU D;  4A8X C;  2BB5 A;  3BVG A;  2FBW B;  1B9R A;  1LO5 D;  4WUR A;  2WXN A;  3P4P B;  5TSS A;  2KDM A;  5AUK A;  5FKA C;  4OW0 A;  1N61 A;  2KN4 A;  2XN9 C;  1IGD A;  4C7Y A;  1BXT A;  2AQ3 B;  4USA A;  2IGD A;  1JCK B;  1WYG A;  3FIL A;  4H2A A;  1RFK A;  2PMV A;  1F2R C;  5BMI A;  1PDX A;  1XCQ L;  3MP9 A;  1IGC A;  1CJE A;  1JRP A;  1ZDX A;  2JSV X;  3NVY A;  1FNW A;  3VRA B;  3L4P A;  1GB4 A;  1ESF A;  2BT6 A;  1EM7 A;  3MHZ A;  4N59 A;  1HEZ E;  1YJI A;  2N9K A;  2WXH A;  1ZXH A;  1PUT A;  4P16 A;  2PVO D;  1I4H A;  1QQR A;  1K53 A;  5EE0 A;  1D5X C;  3AEF B;  3AEG B;  1L5P A;  2Y5C A;  3HUI A;  1XLQ A;  2DYO A;  1PGB A;  5H92 C;  3BVZ A;  4P6V F;  4WIP A;  1JRO A;  2V4I B;  1FCC C;  2WDR B;  3VR9 B;  3O13 A;  2WNM A;  3NVZ A;  1YN5 A;  1ZUD 2;  1KF6 B;  2GRI A;  3AB5 A;  2KMM A;  3C8Y A;  4A55 A;  2BBC A;  2PW9 A;  5BMH A;  1ZXI A;  2FUG 1;  2M56 B;  1XXG A;  1VZ8 A;  5FK9 C;  5C2T B;  1F0Z A;  4WQM A;  3T3O A;  1JQ4 A;  2IGH A;  2BS4 B;  3AE1 B;  3GP7 A;  1T6B X;  4YTP B;  1CQV A;  4US8 A;  1N60 A;  4MT5 A;  2PVG C;  3BYY B;  5E6J A;  1XO3 A;  2W82 A;  2Y5P A;  2H89 B;  3FAH A;  1TS4 A;  1PGX A;  3AH7 A;  4ZHP A;  1VR9 A;  3BZD B;  2IPK D;  2J53 A;  1V1O A;  1PFD A;  3ZGZ A;  1CK1 A;  1D5M C;  3Q8B A;  2Y3A A;  3AE6 B;  1FIQ A;  1IBX B;  1N63 A;  1NEN B;  2QSD A;  2JX5 A;  1I4R A;  1TKG A;  2SAK A;  4HJG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...