1XLQA

Crystal structure of reduced c73s putidaredoxin from pseudomonas putida
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-dependent Structural Reorganization in Putidaredoxin, a Vertebrate-type [2Fe-2S] Ferredoxin from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Putidaredoxin
total genus 28
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature ec 1.9.3.2: Transferred entry: 1.7.2.1.
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xlqA00
1N61A 1ZXIA 2BT6A 4ZHPA 4US9A 1QLBB 3KWLA 1N63A 2B76B 3AV8A 5EE1A 4YSXB 1WGKA 1ZOYB 1KRHA 2DWQA 2M56B 1FIQA 2WU5B 2H88B 1J7BA 1JW9D 1VLBA 4ZOHC 5EE3A 1E0ZA 3SR6A 4US8A 3FAHA 2H89B 1TKYA 1CZPA 2L52A 1NYQA 3EUB2 3LB8C 3P4QB 3P4SB 4YT0B 3ETRA 4YTPB 1PFDA 1RWSA 3FC4A 1NVID 3NVVA 5EE0A 1XLNA 3AEGB 1WXQA 2BS2B 2HTME 1T3QA 3AB5A 3P1MA 4YTNB 1AYFA 2CJNA 1DOYA 2DBYA 2EKIA 3ABVB 4HRSA 1FMAD 1RM6C 1TKEA 4C7YA 4ZHOA 2L83A 3P4PB 4YSYB 2W3SA 4JWSC 3HVZA 1RYJA 2W3RA 3SFEB 1J7AA 4HROA 5H8YE 1N60A 2MJ3A 3AE4B 1FFUA 3LXFA 1YQ3B 4P6VF 4YTMB 3AE7B 4FXCA 3CWIA 2JQRB 2PIAA 5G5GA 5H92C 1TYGB 2PVGC 1SB3C 1OQQA 1N5XA 4N59A 1V97A 3WCQA 1NENB 2LEKA 2N0SB 1JWBD 3NVWA 5C3JB 1XLQA 1FXIA 3AMZA 1QOAA 1L6VA 4WWMA 1TJEA 2PVOD 2K9XA 1B9RA 3NVYA 2ACZB 3VR9B 2QIEB 1N5WA 3B2GA 1CJEA 1L6UA 1SF0A 3AEFB 1OQRA 4N58A 3DWGC 3AN1A 1DOIA 3NS1A 2W55A 3HRDD 1NEKB 1I7HA 3AECB 1NI3A 3NVZA 2MJDA 1QT9A 2JX5A 2KMMA 4JWUC 1WRIA 1L0VB 1JQ4A 1XLPA 1FFVA 1IUEA 2Q5WD 1A70A 3CIRB 4N6EB 1J7CA 1E10A 4C7ZA 2Y5CA 2WP9B 2K22A 1YJJA 2BS3B 3VR8B 1EWYC 4ITKA 1YJIA 1GPXA 1JRPA 4YSZB 1VJKA 3SFDB 2W54A 3AE6B 1E7PB 3PO0A 1FXAA 4A9AA 1NYRA 2CU3A 3BIID 1JALA 1ZP0B 3RPFC 3W5UB 1YQ4B 1RFKA 5EE9A 1WYGA 1QOFA 1WWTA 3VRAB 5C2TB 1QOBA 1E6EB 3B2FA 3B9JA 1QF6A 3AEAB 1JWAD 1XO3A 2CJOA 2K5PA 3AE1B 4KX6B 3AEDB 1QOGA 2PKOA 4USAA 1SIJA 2AX5A 1KF6B 2G1EA 1L5PA 2MH7A 2WS3B 5G5HA 2WQYB 3AE2B 1FO4A 2FBWB 5MPOA 1PDXA 1XLOA 1PUTA 2KAJA 2QJLA 2BS4B 3HUIA 1FRRA 3P63A 2WDVB 3ZYYX 1ZUD2 1ROEA 1VDVA 2MJEA 4JX1C 1FM0D 4IDIA 3P4RB 1V8CA 4YXDB 5GXGB 1GAQB 4LTUA 3AE3B 2M19A 3NRZA 3W9CB 4WQMA 2WU2B 4C80A 3AE5B 1OFFA 2WDRB 3AH7A 2WLBA 3AE8B 3L4PA 1DGJA 5AUKA 1R7SA 3AEEB 1FRDA 1UWMA 1KFYB 2OHFA 3AEBB 3DWMA 1TKGA 5AUIA 1JROA 2E3TA 1F0ZA 3VRBB 1E9MA 1DOXA 3AE9B 1N62A 3W5VB 3AM9A 1AWDA 2WDQB
chains in the Genus database with same CATH superfamily
1AW7A 3V6CB 2RDBC 2L05A 3UGBB 3ML8A 4WJPA 4LJPB 1K50A 5EE3A 1SSNA 3ZQ4A 3V60A 1WZ3A 2E6XA 3UINB 1Y56A 4HLEA 2KWUB 5EE0A 2VZKB 2EKIA 1RM6C 1OEYA 3QWZB 2IY0B 2FCQA 3AE7B 2MRPA 5G5GA 3RNGC 1V9JA 1OQQA 1N5XA 2ZCBA 3WCQA 1IP9A 2N0SB 2O6VA 1YIWA 2K9XA 4IUMB 1FEHA 2GB1A 1CJEA 2C7NB 2XN9C 3KUZA 2I2YA 3DHIC 3ZNGC 2ZPYA 3A9KA 1XEEA 3WANA 4BKSD 1R4NI 1AN8A 4I6LB 3K9PB 5JH5C 4WJNA 2KKCA 3NG0A 2K22A 4L2YA 1K8RB 2WXKA 4AWJA 3ZXRA 1K52A 2GRIA 3RYTA 4OZBA 5HG2A 3PV1A 1YQBA 1JALA 4IWOA 1P3QU 3GS2A 1T0YA 4B95A 3AXCA 4OZAA 4A90A 1VCBA 1QF6A 2K5PA 2INCC 1WMHB 5E6OA 1KF6B 1SXTA 3OLMD 3NZSA 1FO4A 1D5XC 2FBWB 1IGCA 5FKAC 1ZUD2 2MJEA 3GZNB 3ZJTA 2KQ4X 4WJOA 4NJ7A 1MJDA 5AUKA 3RCZA 3DWMA 1UGMA 4XWWA 5FR3A 5TR5A 1WH3A 2JRHA 5G2NA 3L13A 1TZOA 2B76B 1ZOYB 1TIFA 4ANXA 2A4ZA 2JY6A 1E7VA 3EFUA 2V4LA 1Q0WB 3J9CA 5KHOA 4EOYA 5IAAC 2CKHB 3NVVA 2DZMA 2KMAA 1XLNA 3HVDA 1WMHA 3UQAA 3TMPB 1DYQA 2L8JA 2IO2B 4HROA 1Z5SB 2DAFA 4KZ0A 5GMVA 5LXIB 2Z0EB 1TYGB 3TEYA 2PVGC 1R4MB 1ZXHA 1V86A 3Q8CA 2KQ7A 1TS3A 2IDYA 1TJEA 2D5GA 2M4NA 1JCKB 1TS4A 5J17A 4KVGB 3N32A 4K7UA 2WWZA 1YJJA 3NHEB 1GPXA 4XDDA 2HD5B 4B9KA 1FXAA 2D10A 4UDUC 3H9DA 1TZ1A 3I3TB 4P16A 3RNFC 3U8ZA 2WS3B 5G5HA 3KWVA 3IAM1 2D07B 2KC2A 4FHKA 4RM9A 3A9JB 2PEAA 1P7EA 3P42A 4RCOA 4OHJA 4BFRA 4EUTA 2N9EB 1OFFA 1TS5A 3M3JA 2BTEA 1V1OA 2NBVB 2CHZA 2XBBC 1TKGA 2JZ3B 4ZDVA 1E9MA 1YX6B 4W9LA 2UWQA 5JZEB 1WJ4A 4X57B 3PZ8A 3KVFB 2LJ5A 4KDIC 3AV8A 4MEMA 1KRHA 2LXCA 1JW9D 4ZOHC 2QHOA 4US8A 3R8BA 3HK0A 1CZPA 2NTTA 3ONSA 2NBUA 1JWUD 1V5TA 3PREA 3WA0A 2MBOA 3VFKA 1WFYA 3ABVB 5IA7A 2K3UA 4F1SA 3V6EB 2LEKA 1QOAA 1PGAA 1L6VA 2PVOD 3C8YA 4BOSC 4HKZE 1P9DU 4PS7A 3AEFB 4LCDE 2DAJA 2MJDA 1L0VB 2Q5WD 3DBSA 3UIOB 1MG4A 1YJIA 3QHTA 4YWGG 3EC8A 4GN1A 2SEBD 4XGAB 3VUXA 1WXSA 3SD5A 1M94A 3P2BA 1QOFA 4KIKB 4ZRQA 2G9HD 2KJHB 4IOIE 2CJOA 3GP7A 2BS4B 4JQWC 1Q10A 4JX1C 4L1BA 4B0EA 1V8CA 1CMXB 2BB6A 1L0XB 3W9CB 2D3BA 4ZRPA 2JUOA 1R7SA 3M63B 1YX5B 2VRRB 3CSTA 1WYWB 1FNVA 1WX8A 4US9A 2KACA 2ON8A 4RMAA 3OJ3A 3U4EG 3O65B 3ZW3A 1SGHA 2OJWA 3ZGZA 4HEA1 5JHAA 3H7PB 2WDTB 1I42A 3C0RB 1PFDA 3ZUNA 2LGXA 2I1KA 1T3QA 3ZRCA 1AYFA 1PQSA 4ICUA 3R2TA 3L08A 4MH0E 3P4PB 4KKJA 4HK2A 4BBNF 2CHWA 3QARA 3T8MA 3NVWA 3ZVVA 3MJ5A 2KJRA 3UIPB 3NOBA 4WWPA 2AL6A 2MBHA 2NBWB 4NAWA 1JWSD 2NPTA 2N1WA 5JXVA 3U7DA 1OQRA 3DWGC 4GOCA 2KD0A 3DBLI 1OTRB 5KHQA 1PGBA 4IM2A 2WXQA 4F7ZA 2JU6X 1MHHE 1SE4A 1X1MA 2K6QA 3AE6B 3WAPA 4J3OD 1WYGA 1TY2A 2BYVE 2LJIA 3AEDB 1GB4A 2J0MA 4GDKA 2GBJA 3QC8B 3Q3FA 2J53A 4YXDB 1RAXA 1OEYJ 4G0NB 1XD3B 4GDLA 3PPAA 1WY8A 3LJ3A 1QKZA 2A5UA 1JROA 4NZLB 2FUHB 3W5VB 5D7GA 4A3PA 3APFA 1BXTA 2M56B 1V6EA 2H88B 3QX1A 2EMSA 2AYOB 3R66C 1C77A 3VQIA 1T0QC 2NMQA 4MACA 1WXQA 2HTME 3AI5A 1E8WA 2MQJA 4HRSA 2FAZA 1FMAD 1XXGA 1RYJA 3APDA 1G6JA 4XZ4A 4MSQB 4CYEA 1C4CA 4Q2JA 3HM3A 1GUAB 2J4XA 2JZPA 2INPE 1ZDXA 3TEWA 1AARA 2L1AA 3APCA 4KZCA 3ZIMA 3AMZA 2IYDB 1V1PA 4F8CB 3FILB 3CF6E 5BMGA 2KLCA 2BQQA 4MM3B 2Z8LA 5L83A 3VDZA 1GC6A 3X23A 3HHMA 3SU8X 1F2RI 3PS6A 2NVUI 5CHFA 4G11A 1JRPA 3ML9A 3VH3B 2KK8A 2CU3A 3MFGA 3N1ZC 5DPWA 2WYQA 1YNTE 4O1NA 2JWZA 5BMHA 1XO3A 1KH0A 2M8SA 4ARCA 2D11A 3HUIA 3KQ4A 2INDC 2PLPA 2V1YA 4LTUA 4J6IA 2QCZA 2WXHA 4AOFA 3L4PA 4IM0A 5LXHA 2V9HA 1ESFA 3Q8EA 1YN5A 3JSVA 2LGSA 3VRBB 1WX7A 1FXTB 2KN4A 1N61A 1ZXIA 2WXGA 3QA8A 3ZRFA 1WGKA 3JVZX 4LNNA 1M4VA 5D3DA 3S2AA 1YJ1A 4JL9A 4YT0B 4ZRJA 3ETRA 1C76A 4CO7A 1NVID 3TJPA 3VTVA 2DENB 5D94A 5DCNA 1TKEA 1UELA 2L83A 3QIJA 4KIKA 2LVPA 1WXMA 3AE4B 3TUOA 2ZPNA 3NUHB 1B1ZA 1OGWA 2KT7A 1NI2A 4P1BC 4WWMA 2ACZB 4WJQA 1WF9A 3AULA 3WALA 4BVUC 2J7QB 4DWFA 2BBCA 3NY5A 4LNFA 2W55A 3RNEC 3Q3MC 1GNUA 4AJWA 1U4AA 2N7DA 2EMTA 3TBLD 1T0RC 4DHZB 1Q5WB 3FKYA 1STEA 3RN9C 4ASWC 2HJ8A 3DBHI 4FJZA 2DZJA 5C2TB 3IT4B 3BY4B 3B2FA 4REZA 2QILA 4NJCA 2PKOA 3AE2B 2UYZB 4KKIA 2PE9A 1J19A 1I35A 3N3KB 2QMTA 5HHDG 3ZYYX 1UZXB 2Y5PA 5GXGB 3VXWA 3EGRA 2IPKD 1TTNA 2N9KA 3PT2B 3GE8C 1K53A 4BAXA 1D3ZA 2GLSA 2WXLA 1WGYA 4OVVA 2ZCCA 4EZLA 1S1QB 3IG3A 4MDKE 3VUYA 2BT6A 2LVQA 1SBBB 4RGNA 1IBXA 1VLBA 2L3ZA 3VTWA 2MEKA 3ZTCA 5AZFA 1KJTA 2L52A 3P4QB 2G4DB 4JIOU 2KOXA 3W1SC 3FC4A 4MSMB 1H4RA 4NNJB 2KO3A 1HE8A 2DBYA 4HPMB 3WAMA 3UI3A 1VR9A 2W3RA 2YLMA 5H8YE 2JRIB 5JHBA 5H92C 3KUDB 3VAWA 2V3NA 5TSSA 2J52A 2RSUA 1TT5B 3BYTB 1KM7A 4DXFA 1EM7A 4FADA 3L16A 1N5WA 3B2GA 1SF0A 4HVBA 2KFKA 4BZAA 3NS1A 4HCPB 3Q8FA 2IGDA 3OG5A 1TGZB 1KOTA 2PE6B 1MVKA 2K6DB 2PJHA 2FCNA 4AS1A 4ITKA 1HA5A 2IGHA 4MJSA 4LLGM 5IKCM 4FLHA 4NY0A 3DHHC 2LXAA 2O6VB 4G3XB 1J0GA 4YTMB 3KH0A 5G55A 1TBEA 4PYZA 3N1XC 1L5PA 2IBIB 4RGTA 5MPOA 2QJLA 4W9FA 4DXAB 1FRRA 3CSFA 4A6QA 3PSEB 2MHJA 1HZ6A 4ICVA 2WU2B 2KZRA 2Z0DB 4JLCA 3AEBB 2PMVA 3QAQA 3Q2AC 1UWXA 2IZVB 3PZ7A 4LJOB 1SE2A 2ZJDA 1N63A 4FN2A 2JXXA 1A5RA 2M0XA 5BO4B 1NDDA 2B3AA 2LD9A 3MC0B 1FCCC 2KX3A 1I4PA 3IFWB 5E6NA 4GMVA 2I38A 1HZ5A 2M1MA 3V05A 4FJVB 3Q3NC 1VD2A 2LVOA 2GOWA 4N9F4 2CJNA 4TV3A 4E74A 1BT0A 4JWSC 1C79A 2WNMA 3BZDB 4NAWB 3H6NA 3CWIA 4ANVA 3NS8A 1BMLC 3MP9A 1VZ8A 1VZ7A 1RFAA 2NS5A 4OVUA 2MBBB 2DZIA 1B9RA 1QILA 3PRMB 2AL3A 3ECIA 2AQ2B 2BWES 3L54A 4XYCA 3PRPB 3TL5A 1MI0A 4M02A 1E8ZA 3RUIB 2LUEA 4JWUC 1IYFA 3QQ8B 4ANUA 2MP2B 3VUWA 3ZDTA 3TEXA 2WP9B 2BS3B 3IBEA 4DBGA 2Y3AA 1Q1OA 2LZ6A 1VJKA 3SFDB 1FNUA 5C23A 1WRDB 2BW2A 1ZE3D 3BIID 1ZP0B 2JYTA 3ZJUA 3LDZE 1L4ZB 2FCSA 1WGHA 4C56C 4M0WB 2AX5A 3R7QA 4G50A 4ANWA 2KAJA 5CHVC 3TEZA 3U2SC 1L7YA 3V3XA 4WAAA 1FM0D 4IKGA 2QSDA 4IC7B 1IGDA 1MHXA 1OQYA 2KMCA 2OHFA 1WGDA 4WWOA 1Y8RC 1SE3A 4H2AA 4KSLC 3MTNB 4GDKB 3DBRI 4XWTA 4WURA 4L23A 2OEDA 5E6JA 1QLBB 2RPVA 3H1UA 2DLBA 3IAS1 1TKYA 4K3CA 1NYQA 3Q3OC 4YTPB 3PHWB 3E9SA 3QJZA 1YMHE 3OJ4B 4NAMA 2KANA 2WXNA 5HFYA 2N7EA 1J7AA 4GXBA 4PK1A 2REXA 3L0WB 1D5ZC 1UF0A 4KSKC 1EUVB 2V4IB 1V97A 2LUMA 1YN3A 3VHTC 3NZUA 4LDTB 4WH4A 4P7IA 2KX0A 3AU4A 3VR9B 2QIEB 1WE7A 4RF1A 3AN1A 1N6ZA 5LLIA 1KLVA 5D6JB 3RD2A 2CHXA 2G4SA 3PLVA 3N9YC 3U52E 2D3GA 2NCNA 2KTFA 3ZDMC 5CX3A 1R4MI 2GBNA 1S3SG 2M17A 2LRUA 3AEAB 2JSVX 2AWTA 2MH7A 3IT6B 1V5OA 3BK1A 1UD7A 4RF0A 1VDVA 4C4VA 2IGGA 3JSVB 4DHJB 3AE3B 1GB1A 1UUPA 4TSSA 4YL8A 4GB9A 1XCQL 3EFCA 3H8HA 1WE6A 1EU4A 2C9WB 4FA6A 4MJSB 4RNAA 2G45B 4QAYA 1E7UA 5EE1A 4YSXB 3HRDD 2L76A 3BVGA 2V0GA 4K7SA 3DPDA 2K8CA 3EUB2 4LK0M 4TKNA 3ZJVA 4FBJB 1UH6A 4GGQA 3MJWA 4M0WA 2GBKA 3NZ3A 1RLFA 1ISNA 2N9LA 1LGRA 3HVZA 1N60A 1QQRA 2MJ3A 2J42A 1VRAB 4IM3A 1EF1A 4K81A 1WR6E 4FULA 1XLQA 4MELA 1FXIA 1WZ0A 1L0YB 3N1YC 5C1ZA 1GC7A 2WHIA 1MPEA 3GB1A 3IHPC 2MWSB 5J2RA 1ZW7A 3GZNI 2V3SA 4GIVA 3T9LA 1WXVA 3AECB 2EELA 3I5JC 3IVFA 3SHQA 5AZHA 3RI7C 4CQNA 1E10A 1YOVB 1KLGD 2Y5CA 1C4AA 2XK5A 2PPHA 4YSZB 2LASA 4TMAB 3SEBA 4GU2A 5AZGA 4EE2A 2IJ0A 1RFKA 1WWTA 2CS4A 2KDFB 3M95A 5IN7A 2WQYB 2ZZPB 1Z2MA 2LGDA 1ZGUB 1IPGA 1EU3A 2N4FA 3VTUA 1HTOA 2W82A 2WDVB 1ROEA 1SJHD 3EHVA 4IWPA 1WGGA 2WX0A 4KV2A 4A20A 4AQ7A 2KYWA 1WGRA 2WLBA 2JF5A 4RM8A 2MBQA 4DDID 2LGYA 1FRDA 1WXAA 3HIZA 1UWMA 4K7WA 5AUIA 1WSPA 5BYRA 2OOBB 4A8XC 3SDLC 1HEZE 4M8NA 3DVGY 2DWQA 2JT4B 3T3NA 1E0ZA 3DDCB 3SR6A 5LNK1 4A3OA 3ENEA 2MCNB 2GMIC 3Q3JA 4EZKA 2BS2B 1E8YA 4WIPA 2LHDA 2BWFA 1XCTL 5FR6A 2KWCA 3O13A 1P0RA 3MC9A 2PIAA 4K1RB 2FIFA 3L17A 4N59A 3KLSX 4KDLB 1V80A 1JWBD 1T5XD 5T8IA 1T0SC 3NVYA 2R2OA 3E56A 1QZEA 3N30A 4N58A 2O2VA 2RDGA 1RRBA 2JZZA 2RGFA 2BGFA 4BOZB 1F52A 1NI3A 1QT9A 1WRIA 3KUCB 3DBHB 1A70A 2KWVB 4N6EB 5AEKB 4C7ZA 2XNAC 4OVZA 1SEBD 1VZ6A 2KQSA 4FJYA 2W54A 4W9GA 2QDFA 1EWCA 1L2NA 1QOBA 3U30A 2IO1B 4KX6B 3AE1B 2RR9A 3RT3B 2C5LC 4JE3B 2JYEA 2RMMA 4RH6A 4EEWA 1XLOA 1PGXA 1I4GA 4ACFA 1E8XA 5DPTA 4P1CC 2K8BA 3URYA 2M19A 4WQMA 2WXMA 2M0AA 2UU7A 2GBRA 3R3MA 2PTLA 5E6PA 2RPQA 2Z59B 2FCMA 3A9JA 5D2MB 2MW5A 3I9V1 3AEEB 1ET9A 5IOIA 3ZO5B 2R2QA 4P6VF 4EFOA 1FD6A 2LWPA 4LNOA 2DYMA 3GE3C 4PT5A 4IW0A 3R7RA 3NJTA 4WAFA 1FIQA 1LXDA 3WIMA 4LDTD 5BMIA 1WJUA 1TS2A 4W9KA 4XDCA 3VVWB 3DOWA 1FFUA 2LHEA 4NQLB 4DDGD 1BUIC 3KW5B 3X0WA 4ARIA 3KYDD 3EECA 1K51A 1NENB 4NJ6A 3DVNV 2ICIA 4WWNA 4I6NB 4C4VB 1UBIA 3JYUA 1HTQA 2AQ1B 2KXJA 2K25A 4CHKA 2KTRB 5HI1A 2KMMA 2DYBA 2MLBA 3I63C 4E3CA 3RFZB 4HDOA 2CR5A 2HDEA 1EWYC 3W1YA 1GJZA 1D4BA 3B08A 1V49A 3FILA 4MGKE 1FPYA 4GSWA 4MGYE 1R4NB 3UF8A 4MM3A 2JVCA 3RZFA 4HXDA 3B9JA 5EDSA 1QOGA 2D2QA 4HWIB 1SIJA 2MSED 3PHXB 2G1EA 4M01A 5J18A 5DPSA 2DYOA 2K8HA 2DNFA 1UBQA 1ZPSA 3CMMB 1YN4A 2JPHA 3PLUA 2ZW1A 2AEHA 4EKUA 4OZCA 1DGJA 3IXSA 4I6PA 3WAOA 3BVZA 2RD0A 1WX9A 1SIFA 2HJ1A 2MP2A 2KN5A 3AM9A 1F9JA 2FNJB 4II3B 4FHJA 2DX5B 2FUG1 4NQKE 4ZYSA 4XC2A 1V2YA 3Q8AA 2OJRA 4DXGA 2N9PC 1JWMD 3AB5A 3QCAA 3P1MA 4YTNB 1TY0A 2NPTB 2KVRA 5IP4D 4YSYB 1FNWA 1P98A 1ET6A 2GI9A 2W3SA 2JQRB 2INNE 3ZLZA 1I4QA 3EA6A 4MGZE 3PZDA 1E90A 3A1QA 2C7HA 1L6UA 1ZDVA 2KDIA 4M00A 3AU5A 3MHSD 2R61A 4K3BA 1NEKB 3B0AA 2BPSA 3Q8BA 3PTFC 2JWUA 3CIRB 2BVCA 3LYYA 3VR8B 2NTSA 3MHZA 1V1PB 4MT5A 2BYEA 3BWUD 4TQ0A 4BKSA 4A9AA 2WXOA 2XEWA 3W5UB 2SAKA 4LNIA 3VRAB 1E6EB 1F77A 2KDEB 3V61A 1E5WA 3BYYB 1J8CA 3DCGA 4RGMA 3P63A 2O6VD 2X38A 2MX2A 4W9JA 2BB5A 3GOEA 1YD8U 3AH7A 4IG7B 3L10B 2K39A 4RFBA 2LI5A 4TUUA 1F0ZA 2ZW0A 2FIDA 1XQQA 1I4RA 1N62A 2VH2A 4GDLB 1AWDA 3OAWA 2W9NA 3DHGC 4E71A 2WU5B 3HM6X 1J7BA 4RGOS 4BKGA 1CK1A 3DQVA 4GLSC 3LB8C 4ZYNA 1ACCA 4BKTA 1NBFC 1RWSA 4A55A 4C7YA 5CTRC 2FE8A 4DQOC 4XE0A 3LXFA 3ZNID 3BINA 1C4PA 2DHZA 1P1AA 3Q6BA 3D32A 3T3OA 5CHWA 4MGIE 1GG3A 2TSSA 4NPNA 2L0FA 1XT9B 1JMLA 2HTHA 2WX1A 2XK5B 3ZNHB 2WXRA 1I7HA 5FK9C 3H7SA 4WQOB 1JQ4A 1IUEA 2KJ6A 1T6BX 2ASQA 2DZKA 1I4XA 2YEPF 3BK2A 5IO9A 5EE9A 2K0PA 4JGHB 4AJYB 1ENFA 1GOZA 1JWAD 2EKEC 4XX5A 2Y5BB 3VH4B 3H7PA 1C9FA 1PUTA 1LO5D 2V3PA 4JPSA 2YVCA 2KVZA 3PRZA 3RULA 2KLGA 4IWQA 3RNAC 2IO0B 3NRZA 4TQ1A 4W9DA 2ZVOA 4BBNC 4C80A 2C60A 4HPLB 2CU1A 3RZWC 3AE8B 2KDBA 4W9EA 5D3IB 2KHWB 3I57A 2BF8B 2KWDA 4DHJD 3K9OB 1P7FA 1DOXA 1D5MC 2IY1B 4AP4C 1V81A 2D3AA 1H8CA 2GBMA 3KWLA 1HXYD 1C1YB 4HCNB 1MG8A 2BYFA 1FCLA 2YEPB 2H89B 1F2RC 3V62A 3P4SB 1WM2A 2WGSA 3RNCC 3AEGB 2ZNVB 1SE9A 4HDQA 5DPRA 2KFKB 3ALBA 3PVLA 2LFIA 1MFWA 1YQ3B 4FXCA 1WR1A 3ZKJC 1CQVA 2N1VA 4AUQC 1KLUD 4KGSA 1C3TA 1WM3A 3Q14C 2C7MB 4HPPA 3W2DA 2BKRB 1KTKA 4B6WA 2VH1A 1UNSA 1L4DB 2LMCA 4DHZE 5L95C 4W9CA 2QEJC 2K1FA 2JXTA 2JX5A 1XLPA 2AQ3B 3W1SA 1F1HA 2KDMA 3DBLB 2N7JA 1E7PB 1ZKHA 2ONQA 4W9IA 3RPFC 2O2VB 2I1JA 3UQBA 1JRUA 1WJNA 4USAA 2LRWA 1LQBA 3TIXA 3M62B 2L32A 3B1LX 3TCAA 2LGIA 3A33B 1SJED 2WXPA 2NR2A 5HKHA 4PYUA 3ZTDA 1HQRD 4IDIA 3DVGX 4II2B 2RDHA 3PGEA 4PS3A 4S17A 3ZXVA 4ZRKA 4OW0A 3A4RA 1KFYB 1C78A 4S0RA 1PYWD 4ZHPA 3U7ZA 1LM8B 4PS8A 2L0TA 2MA9B 4HJKA 1EO6A 3A9KB 3FAHA 4D2KA 2N9XA 1I4HA 1WJ6A 1IBXB 2J0JA 3RNBC 5BYQA 1DOYA 3ZNZB 2G3QB 4ZHOA 2L7RA 2BKFA 4URKA 2QC8A 3RMKC 3SFEB 3QK0A 3A4SC 2X8XX 3A1QB 1SB3C 2J0KA 3DBRB 1XF5L 5C3JB 3OWEB 3JW0X 2KFJA 4M8MA 2HE7A 4HKQA 4EZJA 2ZNVC 1EF5A 1DOIA 2D3CA 2WXIA 3MC8A 2KNBA 3BVMA 3N20C 3DVNU 3NVZA 2KC1A 1FFVA 1J7CA 1LFDA 3KYCD 2BYTA 1WIAA 2IO3B 4R3DA 3PO0A 2PW9A 2ZEQA 4LNKA 1NYRA 4DK5A 1YQ4B 1D6EC 4C00A 4B0MA 5I4DA 2ZVNA 4KGRA 4ZRIA 4MH8A 2WXJA 1PDXA 2WXFA 3P4RB 3Q69A 1GAQB 4W9HA 3TSSA 5BYSA 3AE5B 4KGTA 1WI0A 2WDRB 2VZKD 2KTRA 1UGJA 3R2IA 4HJGE 2E3TA 3AE9B 2L00B 3C19A 2MBEA 2WDQB
chains in the Genus database with same CATH topology
1AW7A 4WURA 4L23A 2OEDA 5E6JA 1QLBB 2RPVA 1BXTA 2M56B 2H88B 1K50A 2DLBA 3IAS1 5EE3A 1SSNA 2FUG1 3ZQ4A 4ZYSA 1TKYA 1NYQA 1C77A 3VQIA 2E6XA 3Q8AA 4DXGA 4YTPB 3E9SA 1Y56A 5EE0A 2NMQA 4MACA 1YMHE 1JWMD 1WXQA 2HTME 2VZKB 3AB5A 3P1MA 4YTNB 1TY0A 4NAMA 2EKIA 4HRSA 2WXNA 1FMAD 1RM6C 1XXGA 4YSYB 5HFYA 1FNWA 2W3SA 1ET6A 2GI9A 1RYJA 1J7AA 1C4CA 3AE7B 4Q2JA 1D5ZC 2JQRB 5G5GA 2INNE 2J4XA 1I4QA 1OQQA 1N5XA 2INPE 2JZPA 2V4IB 1V97A 3EA6A 3WCQA 1ZDXA 2N0SB 3TEWA 2LUMA 2L1AA 1YN3A 3AMZA 4WH4A 2K9XA 1V1PA 3FILB 1FEHA 3VR9B 2QIEB 2GB1A 1CJEA 1L6UA 1ZDVA 5BMGA 2XN9C 4RF1A 3AN1A 4MM3B 2I2YA 2Z8LA 2R61A 1NEKB 1XEEA 3Q8BA 1F2RI 2JWUA 3N9YC 3CIRB 3U52E 1AN8A 2K22A 3LYYA 4L2YA 3VR8B 2WXKA 2NTSA 3MHZA 1V1PB 4MT5A 1JRPA 5D7GA 1K52A 3BWUD 4TQ0A 2GRIA 4A9AA 2WXOA 4OZBA 5HG2A 2CU3A 3MFGA 1JALA 3W5UB 2SAKA 3GS2A 3VRAB 1YNTE 4O1NA 5BMHA 4OZAA 4A90A 1E6EB 1F77A 1QF6A 3AEAB 1XO3A 1KH0A 2JSVX 2K5PA 3BYYB 4ARCA 1KF6B 1SXTA 2MH7A 3IT6B 1FO4A 3BK1A 1D5XC 2FBWB 1IGCA 4RGMA 3P63A 3HUIA 5FKAC 2X38A 4RF0A 1ZUD2 2MJEA 1VDVA 3KQ4A 3ZJTA 2KQ4X 2PLPA 2IGGA 4LTUA 3AE3B 1GB1A 1UUPA 2BB5A 4TSSA 2WXHA 3AH7A 1XCQL 3L4PA 4RFBA 5AUKA 3H8HA 1ESFA 3Q8EA 1EU4A 1YN5A 3DWMA 1F0ZA 2ZW0A 3VRBB 4XWWA 4RNAA 1I4RA 1N62A 5FR3A 4GDLB 1AWDA 2KN4A 1N61A 1ZXIA 2WXGA 1TZOA 5EE1A 2B76B 4YSXB 1WGKA 1ZOYB 2WU5B 3HRDD 3BVGA 1J7BA 1M4VA 2V0GA 4RGOS 1CK1A 5D3DA 4GLSC 3EUB2 4LK0M 3LB8C 3J9CA 4YT0B 1ACCA 3ETRA 1C76A 3ZJVA 1RWSA 1NVID 3NVVA 3HVDA 4M0WA 1XLNA 3NZ3A 4A55A 4C7YA 1TKEA 2N9LA 1DYQA 2L83A 3HVZA 4HROA 1N60A 1QQRA 2MJ3A 2FE8A 3AE4B 2J42A 4XE0A 3TUOA 4DQOC 3NUHB 3LXFA 1VRAB 1C4PA 1B1ZA 1TYGB 3TEYA 2PVGC 1ZXHA 3Q8CA 3T3OA 1XLQA 1TS3A 1FXIA 2IDYA 4WWMA 1TJEA 1L0YB 2D5GA 2ACZB 2TSSA 1MPEA 3GB1A 1JCKB 1TS4A 1JMLA 2BBCA 2W55A 2WXRA 1I7HA 5FK9C 3AECB 2EELA 1JQ4A 1IUEA 4CQNA 1E10A 1KLGD 1T6BX 2Y5CA 1C4AA 1YJJA 1GPXA 1I4XA 4YSZB 1STEA 4TMAB 4XDDA 1FXAA 3SEBA 4UDUC 2YEPF 3BK2A 4EE2A 2IJ0A 1RFKA 5EE9A 1WWTA 2K0PA 5C2TB 3IT4B 3B2FA 1ENFA 4P16A 1GOZA 4REZA 2QILA 1JWAD 4NJCA 2PKOA 2WS3B 5G5HA 2WQYB 3AE2B 4KKIA 1EU3A 3KWVA 3IAM1 1C9FA 1PUTA 1LO5D 2W82A 2WDVB 2V3PA 4JPSA 2QMTA 5HHDG 1ROEA 1SJHD 3ZYYX 2Y5PA 5GXGB 1P7EA 3P42A 3NRZA 4RCOA 4TQ1A 4OHJA 4C80A 4AQ7A 3EGRA 2IPKD 2N9KA 1OFFA 2WLBA 3AE8B 1TS5A 2BTEA 1K53A 1V1OA 1FRDA 1UWMA 2WXLA 5D3IB 1TKGA 3I57A 5AUIA 2KWDA 1E9MA 1P7FA 1DOXA 1D5MC 1WSPA 5BYRA 4A8XC 1HEZE 2BT6A 3PZ8A 1SBBB 3KWLA 1HXYD 3AV8A 2DWQA 4RGNA 1KRHA 3T3NA 1IBXA 1JW9D 1VLBA 4ZOHC 1E0ZA 1FCLA 2MEKA 2YEPB 3SR6A 4US8A 2H89B 3R8BA 1F2RC 5LNK1 1CZPA 2L52A 2NTTA 3P4QB 3P4SB 1JWUD 3FC4A 3AEGB 2BS2B 2DBYA 4WIPA 3ABVB 2LHDA 3UI3A 1VR9A 2W3RA 5H8YE 1XCTL 2LFIA 3O13A 1YQ3B 2K3UA 4FXCA 5H92C 2PIAA 4N59A 3KLSX 2V3NA 2LEKA 1JWBD 5TSSA 1CQVA 2J52A 1QOAA 1PGAA 1L6VA 1T5XD 2PVOD 1KLUD 3BYTB 3C8YA 3NVYA 4KGSA 5T8IA 4DXFA 4HKZE 1EM7A 3W2DA 3E56A 1KTKA 1N5WA 3B2GA 1SF0A 3AEFB 1UNSA 1L4DB 2LMCA 4N58A 2RDGA 3NS1A 3Q8FA 2QEJC 2IGDA 1NI3A 2MJDA 1QT9A 2JXTA 2JX5A 1MVKA 1L0VB 1WRIA 1XLPA 2AQ3B 2Q5WD 1A70A 4N6EB 4C7ZA 4AS1A 2XNAC 3W1SA 4OVZA 1SEBD 4ITKA 1YJIA 1HA5A 4YWGG 1VZ6A 2IGHA 2KDMA 2SEBD 2W54A 2N7JA 1E7PB 4LLGM 2ONQA 1EWCA 3RPFC 1QOFA 4ZRQA 1QOBA 2G9HD 4IOIE 3AE1B 4KX6B 2CJOA 4YTMB 4USAA 1L5PA 4JE3B 2JYEA 2RMMA 4RGTA 4RH6A 2L32A 3GP7A 5MPOA 1XLOA 1PGXA 2QJLA 2BS4B 1FRRA 1I4GA 2LGIA 1SJED 4A6QA 2WXPA 1Q10A 1HQRD 4IDIA 4JX1C 1V8CA 4L1BA 3URYA 4B0EA 2BB6A 1HZ6A 1L0XB 2M19A 2RDHA 3W9CB 4WQMA 2WXMA 2M0AA 2WU2B 4ZRPA 2PTLA 1R7SA 3I9V1 4OW0A 3AEEB 3AEBB 2PMVA 1KFYB 1ET9A 1UWXA 1C78A 3PZ7A 4P6VF 1SE2A 1FNVA 1FD6A 1PYWD 2DYMA 4PT5A 4US9A 2KACA 2ON8A 3U7ZA 4ZHPA 1N63A 4WAFA 1FIQA 3U4EG 3FAHA 3ZGZA 4D2KA 3MC0B 1FCCC 4HEA1 5BMIA 1I4HA 1I4PA 1TS2A 2I38A 1PFDA 4XDCA 1HZ5A 3V05A 1IBXB 1T3QA 5BYQA 1DOYA 1AYFA 2CJNA 3R2TA 4ZHOA 3P4PB 4JWSC 3SFEB 1C79A 4KKJA 1FFUA 2WNMA 2LHEA 3BZDB 4NAWB 3CWIA 1BUIC 1BMLC 1SB3C 3MP9A 1VZ8A 4ARIA 1VZ7A 1K51A 1NENB 1XF5L 3NVWA 5C3JB 3MJ5A 2ICIA 3OWEB 1B9RA 1JWSD 1QILA 2AQ2B 2AQ1B 5JXVA 4HKQA 1OQRA 3DWGC 1DOIA 1MI0A 5HI1A 2WXIA 3BVMA 3NVZA 1PGBA 2KMMA 4JWUC 1FFVA 3RFZB 1J7CA 3TEXA 2WXQA 2HDEA 2WP9B 2JU6X 1MHHE 1SE4A 2BS3B 1EWYC 2Y3AA 2BYTA 1D4BA 1VJKA 3FILA 4R3DA 3SFDB 3PO0A 3AE6B 2PW9A 1FNUA 1NYRA 2BW2A 1ZE3D 3BIID 1ZP0B 2JYTA 1YQ4B 4J3OD 1WYGA 3ZJUA 1TY2A 1L4ZB 1D6EC 2LJIA 3B9JA 4B0MA 4C56C 3AEDB 1QOGA 5I4DA 1SIJA 2AX5A 2G1EA 1GB4A 4KGRA 4MH8A 2WXJA 2DYOA 1PDXA 2KAJA 2WXFA 3TEZA 3U2SC 1ZPSA 3V3XA 1FM0D 1YN4A 2J53A 3P4RB 3Q69A 4YXDB 1GAQB 3TSSA 4IKGA 5BYSA 2QSDA 3AE5B 2ZW1A 4KGTA 2WDRB 1IGDA 2VZKD 1MHXA 4OZCA 1DGJA 3IXSA 1QKZA 1UGJA 2OHFA 3BVZA 3R2IA 1JROA 4HJGE 1SE3A 2E3TA 4NZLB 3AE9B 4H2AA 3W5VB 3AM9A 4GDKB 4XWTA 2WDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N61 A;  1ZXI A;  2BT6 A;  4ZHP A;  4US9 A;  1QLB B;  3KWL A;  1N63 A;  2B76 B;  3AV8 A;  5EE1 A;  4YSX B;  1WGK A;  1ZOY B;  1KRH A;  2DWQ A;  2M56 B;  1FIQ A;  2WU5 B;  2H88 B;  1J7B A;  1JW9 D;  1VLB A;  4ZOH C;  5EE3 A;  1E0Z A;  3SR6 A;  4US8 A;  3FAH A;  2H89 B;  1TKY A;  1CZP A;  2L52 A;  1NYQ A;  3EUB 2;  3LB8 C;  3P4Q B;  3P4S B;  4YT0 B;  3ETR A;  4YTP B;  1PFD A;  1RWS A;  3FC4 A;  1NVI D;  3NVV A;  5EE0 A;  1XLN A;  3AEG B;  1WXQ A;  2BS2 B;  2HTM E;  1T3Q A;  3AB5 A;  3P1M A;  4YTN B;  1AYF A;  2CJN A;  1DOY A;  2DBY A;  2EKI A;  3ABV B;  4HRS A;  1FMA D;  1RM6 C;  1TKE A;  4C7Y A;  4ZHO A;  2L83 A;  3P4P B;  4YSY B;  2W3S A;  4JWS C;  3HVZ A;  1RYJ A;  2W3R A;  3SFE B;  1J7A A;  4HRO A;  5H8Y E;  1N60 A;  2MJ3 A;  3AE4 B;  1FFU A;  3LXF A;  1YQ3 B;  4P6V F;  4YTM B;  3AE7 B;  4FXC A;  3CWI A;  2JQR B;  2PIA A;  5G5G A;  5H92 C;  1TYG B;  2PVG C;  1SB3 C;  1OQQ A;  1N5X A;  4N59 A;  1V97 A;  3WCQ A;  1NEN B;  2LEK A;  2N0S B;  1JWB D;  3NVW A;  5C3J B;  1XLQ A;  1FXI A;  3AMZ A;  1QOA A;  1L6V A;  4WWM A;  1TJE A;  2PVO D;  2K9X A;  1B9R A;  3NVY A;  2ACZ B;  3VR9 B;  2QIE B;  1N5W A;  3B2G A;  1CJE A;  1L6U A;  1SF0 A;  3AEF B;  1OQR A;  4N58 A;  3DWG C;  3AN1 A;  1DOI A;  3NS1 A;  2W55 A;  3HRD D;  1NEK B;  1I7H A;  3AEC B;  1NI3 A;  3NVZ A;  2MJD A;  1QT9 A;  2JX5 A;  2KMM A;  4JWU C;  1WRI A;  1L0V B;  1JQ4 A;  1XLP A;  1FFV A;  1IUE A;  2Q5W D;  1A70 A;  3CIR B;  4N6E B;  1J7C A;  1E10 A;  4C7Z A;  2Y5C A;  2WP9 B;  2K22 A;  1YJJ A;  2BS3 B;  3VR8 B;  1EWY C;  4ITK A;  1YJI A;  1GPX A;  1JRP A;  4YSZ B;  1VJK A;  3SFD B;  2W54 A;  3AE6 B;  1E7P B;  3PO0 A;  1FXA A;  4A9A A;  1NYR A;  2CU3 A;  3BII D;  1JAL A;  1ZP0 B;  3RPF C;  3W5U B;  1YQ4 B;  1RFK A;  5EE9 A;  1WYG A;  1QOF A;  1WWT A;  3VRA B;  5C2T B;  1QOB A;  1E6E B;  3B2F A;  3B9J A;  1QF6 A;  3AEA B;  1JWA D;  1XO3 A;  2CJO A;  2K5P A;  3AE1 B;  4KX6 B;  3AED B;  1QOG A;  2PKO A;  4USA A;  1SIJ A;  2AX5 A;  1KF6 B;  2G1E A;  1L5P A;  2MH7 A;  2WS3 B;  5G5H A;  2WQY B;  3AE2 B;  1FO4 A;  2FBW B;  5MPO A;  1PDX A;  1XLO A;  1PUT A;  2KAJ A;  2QJL A;  2BS4 B;  3HUI A;  1FRR A;  3P63 A;  2WDV B;  3ZYY X;  1ZUD 2;  1ROE A;  1VDV A;  2MJE A;  4JX1 C;  1FM0 D;  4IDI A;  3P4R B;  1V8C A;  4YXD B;  5GXG B;  1GAQ B;  4LTU A;  3AE3 B;  2M19 A;  3NRZ A;  3W9C B;  4WQM A;  2WU2 B;  4C80 A;  3AE5 B;  1OFF A;  2WDR B;  3AH7 A;  2WLB A;  3AE8 B;  3L4P A;  1DGJ A;  5AUK A;  1R7S A;  3AEE B;  1FRD A;  1UWM A;  1KFY B;  2OHF A;  3AEB B;  3DWM A;  1TKG A;  5AUI A;  1JRO A;  2E3T A;  1F0Z A;  3VRB B;  1E9M A;  1DOX A;  3AE9 B;  1N62 A;  3W5V B;  3AM9 A;  1AWD A;  2WDQ B; 
#chains in the Genus database with same CATH topology
 1AW7 A;  3V6C B;  2RDB C;  2L05 A;  3UGB B;  3ML8 A;  4WJP A;  4LJP B;  1K50 A;  5EE3 A;  1SSN A;  3ZQ4 A;  3V60 A;  1WZ3 A;  2E6X A;  3UIN B;  1Y56 A;  4HLE A;  2KWU B;  5EE0 A;  2VZK B;  2EKI A;  1RM6 C;  1OEY A;  3QWZ B;  2IY0 B;  2FCQ A;  3AE7 B;  2MRP A;  5G5G A;  3RNG C;  1V9J A;  1OQQ A;  1N5X A;  2ZCB A;  3WCQ A;  1IP9 A;  2N0S B;  2O6V A;  1YIW A;  2K9X A;  4IUM B;  1FEH A;  2GB1 A;  1CJE A;  2C7N B;  2XN9 C;  3KUZ A;  2I2Y A;  3DHI C;  3ZNG C;  2ZPY A;  3A9K A;  1XEE A;  3WAN A;  4BKS D;  1R4N I;  1AN8 A;  4I6L B;  3K9P B;  5JH5 C;  4WJN A;  2KKC A;  3NG0 A;  2K22 A;  4L2Y A;  1K8R B;  2WXK A;  4AWJ A;  3ZXR A;  1K52 A;  2GRI A;  3RYT A;  4OZB A;  5HG2 A;  3PV1 A;  1YQB A;  1JAL A;  4IWO A;  1P3Q U;  3GS2 A;  1T0Y A;  4B95 A;  3AXC A;  4OZA A;  4A90 A;  1VCB A;  1QF6 A;  2K5P A;  2INC C;  1WMH B;  5E6O A;  1KF6 B;  1SXT A;  3OLM D;  3NZS A;  1FO4 A;  1D5X C;  2FBW B;  1IGC A;  5FKA C;  1ZUD 2;  2MJE A;  3GZN B;  3ZJT A;  2KQ4 X;  4WJO A;  4NJ7 A;  1MJD A;  5AUK A;  3RCZ A;  3DWM A;  1UGM A;  4XWW A;  5FR3 A;  5TR5 A;  1WH3 A;  2JRH A;  5G2N A;  3L13 A;  1TZO A;  2B76 B;  1ZOY B;  1TIF A;  4ANX A;  2A4Z A;  2JY6 A;  1E7V A;  3EFU A;  2V4L A;  1Q0W B;  3J9C A;  5KHO A;  4EOY A;  5IAA C;  2CKH B;  3NVV A;  2DZM A;  2KMA A;  1XLN A;  3HVD A;  1WMH A;  3UQA A;  3TMP B;  1DYQ A;  2L8J A;  2IO2 B;  4HRO A;  1Z5S B;  2DAF A;  4KZ0 A;  5GMV A;  5LXI B;  2Z0E B;  1TYG B;  3TEY A;  2PVG C;  1R4M B;  1ZXH A;  1V86 A;  3Q8C A;  2KQ7 A;  1TS3 A;  2IDY A;  1TJE A;  2D5G A;  2M4N A;  1JCK B;  1TS4 A;  5J17 A;  4KVG B;  3N32 A;  4K7U A;  2WWZ A;  1YJJ A;  3NHE B;  1GPX A;  4XDD A;  2HD5 B;  4B9K A;  1FXA A;  2D10 A;  4UDU C;  3H9D A;  1TZ1 A;  3I3T B;  4P16 A;  3RNF C;  3U8Z A;  2WS3 B;  5G5H A;  3KWV A;  3IAM 1;  2D07 B;  2KC2 A;  4FHK A;  4RM9 A;  3A9J B;  2PEA A;  1P7E A;  3P42 A;  4RCO A;  4OHJ A;  4BFR A;  4EUT A;  2N9E B;  1OFF A;  1TS5 A;  3M3J A;  2BTE A;  1V1O A;  2NBV B;  2CHZ A;  2XBB C;  1TKG A;  2JZ3 B;  4ZDV A;  1E9M A;  1YX6 B;  4W9L A;  2UWQ A;  5JZE B;  1WJ4 A;  4X57 B;  3PZ8 A;  3KVF B;  2LJ5 A;  4KDI C;  3AV8 A;  4MEM A;  1KRH A;  2LXC A;  1JW9 D;  4ZOH C;  2QHO A;  4US8 A;  3R8B A;  3HK0 A;  1CZP A;  2NTT A;  3ONS A;  2NBU A;  1JWU D;  1V5T A;  3PRE A;  3WA0 A;  2MBO A;  3VFK A;  1WFY A;  3ABV B;  5IA7 A;  2K3U A;  4F1S A;  3V6E B;  2LEK A;  1QOA A;  1PGA A;  1L6V A;  2PVO D;  3C8Y A;  4BOS C;  4HKZ E;  1P9D U;  4PS7 A;  3AEF B;  4LCD E;  2DAJ A;  2MJD A;  1L0V B;  2Q5W D;  3DBS A;  3UIO B;  1MG4 A;  1YJI A;  3QHT A;  4YWG G;  3EC8 A;  4GN1 A;  2SEB D;  4XGA B;  3VUX A;  1WXS A;  3SD5 A;  1M94 A;  3P2B A;  1QOF A;  4KIK B;  4ZRQ A;  2G9H D;  2KJH B;  4IOI E;  2CJO A;  3GP7 A;  2BS4 B;  4JQW C;  1Q10 A;  4JX1 C;  4L1B A;  4B0E A;  1V8C A;  1CMX B;  2BB6 A;  1L0X B;  3W9C B;  2D3B A;  4ZRP A;  2JUO A;  1R7S A;  3M63 B;  1YX5 B;  2VRR B;  3CST A;  1WYW B;  1FNV A;  1WX8 A;  4US9 A;  2KAC A;  2ON8 A;  4RMA A;  3OJ3 A;  3U4E G;  3O65 B;  3ZW3 A;  1SGH A;  2OJW A;  3ZGZ A;  4HEA 1;  5JHA A;  3H7P B;  2WDT B;  1I42 A;  3C0R B;  1PFD A;  3ZUN A;  2LGX A;  2I1K A;  1T3Q A;  3ZRC A;  1AYF A;  1PQS A;  4ICU A;  3R2T A;  3L08 A;  4MH0 E;  3P4P B;  4KKJ A;  4HK2 A;  4BBN F;  2CHW A;  3QAR A;  3T8M A;  3NVW A;  3ZVV A;  3MJ5 A;  2KJR A;  3UIP B;  3NOB A;  4WWP A;  2AL6 A;  2MBH A;  2NBW B;  4NAW A;  1JWS D;  2NPT A;  2N1W A;  5JXV A;  3U7D A;  1OQR A;  3DWG C;  4GOC A;  2KD0 A;  3DBL I;  1OTR B;  5KHQ A;  1PGB A;  4IM2 A;  2WXQ A;  4F7Z A;  2JU6 X;  1MHH E;  1SE4 A;  1X1M A;  2K6Q A;  3AE6 B;  3WAP A;  4J3O D;  1WYG A;  1TY2 A;  2BYV E;  2LJI A;  3AED B;  1GB4 A;  2J0M A;  4GDK A;  2GBJ A;  3QC8 B;  3Q3F A;  2J53 A;  4YXD B;  1RAX A;  1OEY J;  4G0N B;  1XD3 B;  4GDL A;  3PPA A;  1WY8 A;  3LJ3 A;  1QKZ A;  2A5U A;  1JRO A;  4NZL B;  2FUH B;  3W5V B;  5D7G A;  4A3P A;  3APF A;  1BXT A;  2M56 B;  1V6E A;  2H88 B;  3QX1 A;  2EMS A;  2AYO B;  3R66 C;  1C77 A;  3VQI A;  1T0Q C;  2NMQ A;  4MAC A;  1WXQ A;  2HTM E;  3AI5 A;  1E8W A;  2MQJ A;  4HRS A;  2FAZ A;  1FMA D;  1XXG A;  1RYJ A;  3APD A;  1G6J A;  4XZ4 A;  4MSQ B;  4CYE A;  1C4C A;  4Q2J A;  3HM3 A;  1GUA B;  2J4X A;  2JZP A;  2INP E;  1ZDX A;  3TEW A;  1AAR A;  2L1A A;  3APC A;  4KZC A;  3ZIM A;  3AMZ A;  2IYD B;  1V1P A;  4F8C B;  3FIL B;  3CF6 E;  5BMG A;  2KLC A;  2BQQ A;  4MM3 B;  2Z8L A;  5L83 A;  3VDZ A;  1GC6 A;  3X23 A;  3HHM A;  3SU8 X;  1F2R I;  3PS6 A;  2NVU I;  5CHF A;  4G11 A;  1JRP A;  3ML9 A;  3VH3 B;  2KK8 A;  2CU3 A;  3MFG A;  3N1Z C;  5DPW A;  2WYQ A;  1YNT E;  4O1N A;  2JWZ A;  5BMH A;  1XO3 A;  1KH0 A;  2M8S A;  4ARC A;  2D11 A;  3HUI A;  3KQ4 A;  2IND C;  2PLP A;  2V1Y A;  4LTU A;  4J6I A;  2QCZ A;  2WXH A;  4AOF A;  3L4P A;  4IM0 A;  5LXH A;  2V9H A;  1ESF A;  3Q8E A;  1YN5 A;  3JSV A;  2LGS A;  3VRB B;  1WX7 A;  1FXT B;  2KN4 A;  1N61 A;  1ZXI A;  2WXG A;  3QA8 A;  3ZRF A;  1WGK A;  3JVZ X;  4LNN A;  1M4V A;  5D3D A;  3S2A A;  1YJ1 A;  4JL9 A;  4YT0 B;  4ZRJ A;  3ETR A;  1C76 A;  4CO7 A;  1NVI D;  3TJP A;  3VTV A;  2DEN B;  5D94 A;  5DCN A;  1TKE A;  1UEL A;  2L83 A;  3QIJ A;  4KIK A;  2LVP A;  1WXM A;  3AE4 B;  3TUO A;  2ZPN A;  3NUH B;  1B1Z A;  1OGW A;  2KT7 A;  1NI2 A;  4P1B C;  4WWM A;  2ACZ B;  4WJQ A;  1WF9 A;  3AUL A;  3WAL A;  4BVU C;  2J7Q B;  4DWF A;  2BBC A;  3NY5 A;  4LNF A;  2W55 A;  3RNE C;  3Q3M C;  1GNU A;  4AJW A;  1U4A A;  2N7D A;  2EMT A;  3TBL D;  1T0R C;  4DHZ B;  1Q5W B;  3FKY A;  1STE A;  3RN9 C;  4ASW C;  2HJ8 A;  3DBH I;  4FJZ A;  2DZJ A;  5C2T B;  3IT4 B;  3BY4 B;  3B2F A;  4REZ A;  2QIL A;  4NJC A;  2PKO A;  3AE2 B;  2UYZ B;  4KKI A;  2PE9 A;  1J19 A;  1I35 A;  3N3K B;  2QMT A;  5HHD G;  3ZYY X;  1UZX B;  2Y5P A;  5GXG B;  3VXW A;  3EGR A;  2IPK D;  1TTN A;  2N9K A;  3PT2 B;  3GE8 C;  1K53 A;  4BAX A;  1D3Z A;  2GLS A;  2WXL A;  1WGY A;  4OVV A;  2ZCC A;  4EZL A;  1S1Q B;  3IG3 A;  4MDK E;  3VUY A;  2BT6 A;  2LVQ A;  1SBB B;  4RGN A;  1IBX A;  1VLB A;  2L3Z A;  3VTW A;  2MEK A;  3ZTC A;  5AZF A;  1KJT A;  2L52 A;  3P4Q B;  2G4D B;  4JIO U;  2KOX A;  3W1S C;  3FC4 A;  4MSM B;  1H4R A;  4NNJ B;  2KO3 A;  1HE8 A;  2DBY A;  4HPM B;  3WAM A;  3UI3 A;  1VR9 A;  2W3R A;  2YLM A;  5H8Y E;  2JRI B;  5JHB A;  5H92 C;  3KUD B;  3VAW A;  2V3N A;  5TSS A;  2J52 A;  2RSU A;  1TT5 B;  3BYT B;  1KM7 A;  4DXF A;  1EM7 A;  4FAD A;  3L16 A;  1N5W A;  3B2G A;  1SF0 A;  4HVB A;  2KFK A;  4BZA A;  3NS1 A;  4HCP B;  3Q8F A;  2IGD A;  3OG5 A;  1TGZ B;  1KOT A;  2PE6 B;  1MVK A;  2K6D B;  2PJH A;  2FCN A;  4AS1 A;  4ITK A;  1HA5 A;  2IGH A;  4MJS A;  4LLG M;  5IKC M;  4FLH A;  4NY0 A;  3DHH C;  2LXA A;  2O6V B;  4G3X B;  1J0G A;  4YTM B;  3KH0 A;  5G55 A;  1TBE A;  4PYZ A;  3N1X C;  1L5P A;  2IBI B;  4RGT A;  5MPO A;  2QJL A;  4W9F A;  4DXA B;  1FRR A;  3CSF A;  4A6Q A;  3PSE B;  2MHJ A;  1HZ6 A;  4ICV A;  2WU2 B;  2KZR A;  2Z0D B;  4JLC A;  3AEB B;  2PMV A;  3QAQ A;  3Q2A C;  1UWX A;  2IZV B;  3PZ7 A;  4LJO B;  1SE2 A;  2ZJD A;  1N63 A;  4FN2 A;  2JXX A;  1A5R A;  2M0X A;  5BO4 B;  1NDD A;  2B3A A;  2LD9 A;  3MC0 B;  1FCC C;  2KX3 A;  1I4P A;  3IFW B;  5E6N A;  4GMV A;  2I38 A;  1HZ5 A;  2M1M A;  3V05 A;  4FJV B;  3Q3N C;  1VD2 A;  2LVO A;  2GOW A;  4N9F 4;  2CJN A;  4TV3 A;  4E74 A;  1BT0 A;  4JWS C;  1C79 A;  2WNM A;  3BZD B;  4NAW B;  3H6N A;  3CWI A;  4ANV A;  3NS8 A;  1BML C;  3MP9 A;  1VZ8 A;  1VZ7 A;  1RFA A;  2NS5 A;  4OVU A;  2MBB B;  2DZI A;  1B9R A;  1QIL A;  3PRM B;  2AL3 A;  3ECI A;  2AQ2 B;  2BWE S;  3L54 A;  4XYC A;  3PRP B;  3TL5 A;  1MI0 A;  4M02 A;  1E8Z A;  3RUI B;  2LUE A;  4JWU C;  1IYF A;  3QQ8 B;  4ANU A;  2MP2 B;  3VUW A;  3ZDT A;  3TEX A;  2WP9 B;  2BS3 B;  3IBE A;  4DBG A;  2Y3A A;  1Q1O A;  2LZ6 A;  1VJK A;  3SFD B;  1FNU A;  5C23 A;  1WRD B;  2BW2 A;  1ZE3 D;  3BII D;  1ZP0 B;  2JYT A;  3ZJU A;  3LDZ E;  1L4Z B;  2FCS A;  1WGH A;  4C56 C;  4M0W B;  2AX5 A;  3R7Q A;  4G50 A;  4ANW A;  2KAJ A;  5CHV C;  3TEZ A;  3U2S C;  1L7Y A;  3V3X A;  4WAA A;  1FM0 D;  4IKG A;  2QSD A;  4IC7 B;  1IGD A;  1MHX A;  1OQY A;  2KMC A;  2OHF A;  1WGD A;  4WWO A;  1Y8R C;  1SE3 A;  4H2A A;  4KSL C;  3MTN B;  4GDK B;  3DBR I;  4XWT A;  4WUR A;  4L23 A;  2OED A;  5E6J A;  1QLB B;  2RPV A;  3H1U A;  2DLB A;  3IAS 1;  1TKY A;  4K3C A;  1NYQ A;  3Q3O C;  4YTP B;  3PHW B;  3E9S A;  3QJZ A;  1YMH E;  3OJ4 B;  4NAM A;  2KAN A;  2WXN A;  5HFY A;  2N7E A;  1J7A A;  4GXB A;  4PK1 A;  2REX A;  3L0W B;  1D5Z C;  1UF0 A;  4KSK C;  1EUV B;  2V4I B;  1V97 A;  2LUM A;  1YN3 A;  3VHT C;  3NZU A;  4LDT B;  4WH4 A;  4P7I A;  2KX0 A;  3AU4 A;  3VR9 B;  2QIE B;  1WE7 A;  4RF1 A;  3AN1 A;  1N6Z A;  5LLI A;  1KLV A;  5D6J B;  3RD2 A;  2CHX A;  2G4S A;  3PLV A;  3N9Y C;  3U52 E;  2D3G A;  2NCN A;  2KTF A;  3ZDM C;  5CX3 A;  1R4M I;  2GBN A;  1S3S G;  2M17 A;  2LRU A;  3AEA B;  2JSV X;  2AWT A;  2MH7 A;  3IT6 B;  1V5O A;  3BK1 A;  1UD7 A;  4RF0 A;  1VDV A;  4C4V A;  2IGG A;  3JSV B;  4DHJ B;  3AE3 B;  1GB1 A;  1UUP A;  4TSS A;  4YL8 A;  4GB9 A;  1XCQ L;  3EFC A;  3H8H A;  1WE6 A;  1EU4 A;  2C9W B;  4FA6 A;  4MJS B;  4RNA A;  2G45 B;  4QAY A;  1E7U A;  5EE1 A;  4YSX B;  3HRD D;  2L76 A;  3BVG A;  2V0G A;  4K7S A;  3DPD A;  2K8C A;  3EUB 2;  4LK0 M;  4TKN A;  3ZJV A;  4FBJ B;  1UH6 A;  4GGQ A;  3MJW A;  4M0W A;  2GBK A;  3NZ3 A;  1RLF A;  1ISN A;  2N9L A;  1LGR A;  3HVZ A;  1N60 A;  1QQR A;  2MJ3 A;  2J42 A;  1VRA B;  4IM3 A;  1EF1 A;  4K81 A;  1WR6 E;  4FUL A;  1XLQ A;  4MEL A;  1FXI A;  1WZ0 A;  1L0Y B;  3N1Y C;  5C1Z A;  1GC7 A;  2WHI A;  1MPE A;  3GB1 A;  3IHP C;  2MWS B;  5J2R A;  1ZW7 A;  3GZN I;  2V3S A;  4GIV A;  3T9L A;  1WXV A;  3AEC B;  2EEL A;  3I5J C;  3IVF A;  3SHQ A;  5AZH A;  3RI7 C;  4CQN A;  1E10 A;  1YOV B;  1KLG D;  2Y5C A;  1C4A A;  2XK5 A;  2PPH A;  4YSZ B;  2LAS A;  4TMA B;  3SEB A;  4GU2 A;  5AZG A;  4EE2 A;  2IJ0 A;  1RFK A;  1WWT A;  2CS4 A;  2KDF B;  3M95 A;  5IN7 A;  2WQY B;  2ZZP B;  1Z2M A;  2LGD A;  1ZGU B;  1IPG A;  1EU3 A;  2N4F A;  3VTU A;  1HTO A;  2W82 A;  2WDV B;  1ROE A;  1SJH D;  3EHV A;  4IWP A;  1WGG A;  2WX0 A;  4KV2 A;  4A20 A;  4AQ7 A;  2KYW A;  1WGR A;  2WLB A;  2JF5 A;  4RM8 A;  2MBQ A;  4DDI D;  2LGY A;  1FRD A;  1WXA A;  3HIZ A;  1UWM A;  4K7W A;  5AUI A;  1WSP A;  5BYR A;  2OOB B;  4A8X C;  3SDL C;  1HEZ E;  4M8N A;  3DVG Y;  2DWQ A;  2JT4 B;  3T3N A;  1E0Z A;  3DDC B;  3SR6 A;  5LNK 1;  4A3O A;  3ENE A;  2MCN B;  2GMI C;  3Q3J A;  4EZK A;  2BS2 B;  1E8Y A;  4WIP A;  2LHD A;  2BWF A;  1XCT L;  5FR6 A;  2KWC A;  3O13 A;  1P0R A;  3MC9 A;  2PIA A;  4K1R B;  2FIF A;  3L17 A;  4N59 A;  3KLS X;  4KDL B;  1V80 A;  1JWB D;  1T5X D;  5T8I A;  1T0S C;  3NVY A;  2R2O A;  3E56 A;  1QZE A;  3N30 A;  4N58 A;  2O2V A;  2RDG A;  1RRB A;  2JZZ A;  2RGF A;  2BGF A;  4BOZ B;  1F52 A;  1NI3 A;  1QT9 A;  1WRI A;  3KUC B;  3DBH B;  1A70 A;  2KWV B;  4N6E B;  5AEK B;  4C7Z A;  2XNA C;  4OVZ A;  1SEB D;  1VZ6 A;  2KQS A;  4FJY A;  2W54 A;  4W9G A;  2QDF A;  1EWC A;  1L2N A;  1QOB A;  3U30 A;  2IO1 B;  4KX6 B;  3AE1 B;  2RR9 A;  3RT3 B;  2C5L C;  4JE3 B;  2JYE A;  2RMM A;  4RH6 A;  4EEW A;  1XLO A;  1PGX A;  1I4G A;  4ACF A;  1E8X A;  5DPT A;  4P1C C;  2K8B A;  3URY A;  2M19 A;  4WQM A;  2WXM A;  2M0A A;  2UU7 A;  2GBR A;  3R3M A;  2PTL A;  5E6P A;  2RPQ A;  2Z59 B;  2FCM A;  3A9J A;  5D2M B;  2MW5 A;  3I9V 1;  3AEE B;  1ET9 A;  5IOI A;  3ZO5 B;  2R2Q A;  4P6V F;  4EFO A;  1FD6 A;  2LWP A;  4LNO A;  2DYM A;  3GE3 C;  4PT5 A;  4IW0 A;  3R7R A;  3NJT A;  4WAF A;  1FIQ A;  1LXD A;  3WIM A;  4LDT D;  5BMI A;  1WJU A;  1TS2 A;  4W9K A;  4XDC A;  3VVW B;  3DOW A;  1FFU A;  2LHE A;  4NQL B;  4DDG D;  1BUI C;  3KW5 B;  3X0W A;  4ARI A;  3KYD D;  3EEC A;  1K51 A;  1NEN B;  4NJ6 A;  3DVN V;  2ICI A;  4WWN A;  4I6N B;  4C4V B;  1UBI A;  3JYU A;  1HTQ A;  2AQ1 B;  2KXJ A;  2K25 A;  4CHK A;  2KTR B;  5HI1 A;  2KMM A;  2DYB A;  2MLB A;  3I63 C;  4E3C A;  3RFZ B;  4HDO A;  2CR5 A;  2HDE A;  1EWY C;  3W1Y A;  1GJZ A;  1D4B A;  3B08 A;  1V49 A;  3FIL A;  4MGK E;  1FPY A;  4GSW A;  4MGY E;  1R4N B;  3UF8 A;  4MM3 A;  2JVC A;  3RZF A;  4HXD A;  3B9J A;  5EDS A;  1QOG A;  2D2Q A;  4HWI B;  1SIJ A;  2MSE D;  3PHX B;  2G1E A;  4M01 A;  5J18 A;  5DPS A;  2DYO A;  2K8H A;  2DNF A;  1UBQ A;  1ZPS A;  3CMM B;  1YN4 A;  2JPH A;  3PLU A;  2ZW1 A;  2AEH A;  4EKU A;  4OZC A;  1DGJ A;  3IXS A;  4I6P A;  3WAO A;  3BVZ A;  2RD0 A;  1WX9 A;  1SIF A;  2HJ1 A;  2MP2 A;  2KN5 A;  3AM9 A;  1F9J A;  2FNJ B;  4II3 B;  4FHJ A;  2DX5 B;  2FUG 1;  4NQK E;  4ZYS A;  4XC2 A;  1V2Y A;  3Q8A A;  2OJR A;  4DXG A;  2N9P C;  1JWM D;  3AB5 A;  3QCA A;  3P1M A;  4YTN B;  1TY0 A;  2NPT B;  2KVR A;  5IP4 D;  4YSY B;  1FNW A;  1P98 A;  1ET6 A;  2GI9 A;  2W3S A;  2JQR B;  2INN E;  3ZLZ A;  1I4Q A;  3EA6 A;  4MGZ E;  3PZD A;  1E90 A;  3A1Q A;  2C7H A;  1L6U A;  1ZDV A;  2KDI A;  4M00 A;  3AU5 A;  3MHS D;  2R61 A;  4K3B A;  1NEK B;  3B0A A;  2BPS A;  3Q8B A;  3PTF C;  2JWU A;  3CIR B;  2BVC A;  3LYY A;  3VR8 B;  2NTS A;  3MHZ A;  1V1P B;  4MT5 A;  2BYE A;  3BWU D;  4TQ0 A;  4BKS A;  4A9A A;  2WXO A;  2XEW A;  3W5U B;  2SAK A;  4LNI A;  3VRA B;  1E6E B;  1F77 A;  2KDE B;  3V61 A;  1E5W A;  3BYY B;  1J8C A;  3DCG A;  4RGM A;  3P63 A;  2O6V D;  2X38 A;  2MX2 A;  4W9J A;  2BB5 A;  3GOE A;  1YD8 U;  3AH7 A;  4IG7 B;  3L10 B;  2K39 A;  4RFB A;  2LI5 A;  4TUU A;  1F0Z A;  2ZW0 A;  2FID A;  1XQQ A;  1I4R A;  1N62 A;  2VH2 A;  4GDL B;  1AWD A;  3OAW A;  2W9N A;  3DHG C;  4E71 A;  2WU5 B;  3HM6 X;  1J7B A;  4RGO S;  4BKG A;  1CK1 A;  3DQV A;  4GLS C;  3LB8 C;  4ZYN A;  1ACC A;  4BKT A;  1NBF C;  1RWS A;  4A55 A;  4C7Y A;  5CTR C;  2FE8 A;  4DQO C;  4XE0 A;  3LXF A;  3ZNI D;  3BIN A;  1C4P A;  2DHZ A;  1P1A A;  3Q6B A;  3D32 A;  3T3O A;  5CHW A;  4MGI E;  1GG3 A;  2TSS A;  4NPN A;  2L0F A;  1XT9 B;  1JML A;  2HTH A;  2WX1 A;  2XK5 B;  3ZNH B;  2WXR A;  1I7H A;  5FK9 C;  3H7S A;  4WQO B;  1JQ4 A;  1IUE A;  2KJ6 A;  1T6B X;  2ASQ A;  2DZK A;  1I4X A;  2YEP F;  3BK2 A;  5IO9 A;  5EE9 A;  2K0P A;  4JGH B;  4AJY B;  1ENF A;  1GOZ A;  1JWA D;  2EKE C;  4XX5 A;  2Y5B B;  3VH4 B;  3H7P A;  1C9F A;  1PUT A;  1LO5 D;  2V3P A;  4JPS A;  2YVC A;  2KVZ A;  3PRZ A;  3RUL A;  2KLG A;  4IWQ A;  3RNA C;  2IO0 B;  3NRZ A;  4TQ1 A;  4W9D A;  2ZVO A;  4BBN C;  4C80 A;  2C60 A;  4HPL B;  2CU1 A;  3RZW C;  3AE8 B;  2KDB A;  4W9E A;  5D3I B;  2KHW B;  3I57 A;  2BF8 B;  2KWD A;  4DHJ D;  3K9O B;  1P7F A;  1DOX A;  1D5M C;  2IY1 B;  4AP4 C;  1V81 A;  2D3A A;  1H8C A;  2GBM A;  3KWL A;  1HXY D;  1C1Y B;  4HCN B;  1MG8 A;  2BYF A;  1FCL A;  2YEP B;  2H89 B;  1F2R C;  3V62 A;  3P4S B;  1WM2 A;  2WGS A;  3RNC C;  3AEG B;  2ZNV B;  1SE9 A;  4HDQ A;  5DPR A;  2KFK B;  3ALB A;  3PVL A;  2LFI A;  1MFW A;  1YQ3 B;  4FXC A;  1WR1 A;  3ZKJ C;  1CQV A;  2N1V A;  4AUQ C;  1KLU D;  4KGS A;  1C3T A;  1WM3 A;  3Q14 C;  2C7M B;  4HPP A;  3W2D A;  2BKR B;  1KTK A;  4B6W A;  2VH1 A;  1UNS A;  1L4D B;  2LMC A;  4DHZ E;  5L95 C;  4W9C A;  2QEJ C;  2K1F A;  2JXT A;  2JX5 A;  1XLP A;  2AQ3 B;  3W1S A;  1F1H A;  2KDM A;  3DBL B;  2N7J A;  1E7P B;  1ZKH A;  2ONQ A;  4W9I A;  3RPF C;  2O2V B;  2I1J A;  3UQB A;  1JRU A;  1WJN A;  4USA A;  2LRW A;  1LQB A;  3TIX A;  3M62 B;  2L32 A;  3B1L X;  3TCA A;  2LGI A;  3A33 B;  1SJE D;  2WXP A;  2NR2 A;  5HKH A;  4PYU A;  3ZTD A;  1HQR D;  4IDI A;  3DVG X;  4II2 B;  2RDH A;  3PGE A;  4PS3 A;  4S17 A;  3ZXV A;  4ZRK A;  4OW0 A;  3A4R A;  1KFY B;  1C78 A;  4S0R A;  1PYW D;  4ZHP A;  3U7Z A;  1LM8 B;  4PS8 A;  2L0T A;  2MA9 B;  4HJK A;  1EO6 A;  3A9K B;  3FAH A;  4D2K A;  2N9X A;  1I4H A;  1WJ6 A;  1IBX B;  2J0J A;  3RNB C;  5BYQ A;  1DOY A;  3ZNZ B;  2G3Q B;  4ZHO A;  2L7R A;  2BKF A;  4URK A;  2QC8 A;  3RMK C;  3SFE B;  3QK0 A;  3A4S C;  2X8X X;  3A1Q B;  1SB3 C;  2J0K A;  3DBR B;  1XF5 L;  5C3J B;  3OWE B;  3JW0 X;  2KFJ A;  4M8M A;  2HE7 A;  4HKQ A;  4EZJ A;  2ZNV C;  1EF5 A;  1DOI A;  2D3C A;  2WXI A;  3MC8 A;  2KNB A;  3BVM A;  3N20 C;  3DVN U;  3NVZ A;  2KC1 A;  1FFV A;  1J7C A;  1LFD A;  3KYC D;  2BYT A;  1WIA A;  2IO3 B;  4R3D A;  3PO0 A;  2PW9 A;  2ZEQ A;  4LNK A;  1NYR A;  4DK5 A;  1YQ4 B;  1D6E C;  4C00 A;  4B0M A;  5I4D A;  2ZVN A;  4KGR A;  4ZRI A;  4MH8 A;  2WXJ A;  1PDX A;  2WXF A;  3P4R B;  3Q69 A;  1GAQ B;  4W9H A;  3TSS A;  5BYS A;  3AE5 B;  4KGT A;  1WI0 A;  2WDR B;  2VZK D;  2KTR A;  1UGJ A;  3R2I A;  4HJG E;  2E3T A;  3AE9 B;  2L00 B;  3C19 A;  2MBE A;  2WDQ B; 
#chains in the Genus database with same CATH homology
 1AW7 A;  4WUR A;  4L23 A;  2OED A;  5E6J A;  1QLB B;  2RPV A;  1BXT A;  2M56 B;  2H88 B;  1K50 A;  2DLB A;  3IAS 1;  5EE3 A;  1SSN A;  2FUG 1;  3ZQ4 A;  4ZYS A;  1TKY A;  1NYQ A;  1C77 A;  3VQI A;  2E6X A;  3Q8A A;  4DXG A;  4YTP B;  3E9S A;  1Y56 A;  5EE0 A;  2NMQ A;  4MAC A;  1YMH E;  1JWM D;  1WXQ A;  2HTM E;  2VZK B;  3AB5 A;  3P1M A;  4YTN B;  1TY0 A;  4NAM A;  2EKI A;  4HRS A;  2WXN A;  1FMA D;  1RM6 C;  1XXG A;  4YSY B;  5HFY A;  1FNW A;  2W3S A;  1ET6 A;  2GI9 A;  1RYJ A;  1J7A A;  1C4C A;  3AE7 B;  4Q2J A;  1D5Z C;  2JQR B;  5G5G A;  2INN E;  2J4X A;  1I4Q A;  1OQQ A;  1N5X A;  2INP E;  2JZP A;  2V4I B;  1V97 A;  3EA6 A;  3WCQ A;  1ZDX A;  2N0S B;  3TEW A;  2LUM A;  2L1A A;  1YN3 A;  3AMZ A;  4WH4 A;  2K9X A;  1V1P A;  3FIL B;  1FEH A;  3VR9 B;  2QIE B;  2GB1 A;  1CJE A;  1L6U A;  1ZDV A;  5BMG A;  2XN9 C;  4RF1 A;  3AN1 A;  4MM3 B;  2I2Y A;  2Z8L A;  2R61 A;  1NEK B;  1XEE A;  3Q8B A;  1F2R I;  2JWU A;  3N9Y C;  3CIR B;  3U52 E;  1AN8 A;  2K22 A;  3LYY A;  4L2Y A;  3VR8 B;  2WXK A;  2NTS A;  3MHZ A;  1V1P B;  4MT5 A;  1JRP A;  5D7G A;  1K52 A;  3BWU D;  4TQ0 A;  2GRI A;  4A9A A;  2WXO A;  4OZB A;  5HG2 A;  2CU3 A;  3MFG A;  1JAL A;  3W5U B;  2SAK A;  3GS2 A;  3VRA B;  1YNT E;  4O1N A;  5BMH A;  4OZA A;  4A90 A;  1E6E B;  1F77 A;  1QF6 A;  3AEA B;  1XO3 A;  1KH0 A;  2JSV X;  2K5P A;  3BYY B;  4ARC A;  1KF6 B;  1SXT A;  2MH7 A;  3IT6 B;  1FO4 A;  3BK1 A;  1D5X C;  2FBW B;  1IGC A;  4RGM A;  3P63 A;  3HUI A;  5FKA C;  2X38 A;  4RF0 A;  1ZUD 2;  2MJE A;  1VDV A;  3KQ4 A;  3ZJT A;  2KQ4 X;  2PLP A;  2IGG A;  4LTU A;  3AE3 B;  1GB1 A;  1UUP A;  2BB5 A;  4TSS A;  2WXH A;  3AH7 A;  1XCQ L;  3L4P A;  4RFB A;  5AUK A;  3H8H A;  1ESF A;  3Q8E A;  1EU4 A;  1YN5 A;  3DWM A;  1F0Z A;  2ZW0 A;  3VRB B;  4XWW A;  4RNA A;  1I4R A;  1N62 A;  5FR3 A;  4GDL B;  1AWD A;  2KN4 A;  1N61 A;  1ZXI A;  2WXG A;  1TZO A;  5EE1 A;  2B76 B;  4YSX B;  1WGK A;  1ZOY B;  2WU5 B;  3HRD D;  3BVG A;  1J7B A;  1M4V A;  2V0G A;  4RGO S;  1CK1 A;  5D3D A;  4GLS C;  3EUB 2;  4LK0 M;  3LB8 C;  3J9C A;  4YT0 B;  1ACC A;  3ETR A;  1C76 A;  3ZJV A;  1RWS A;  1NVI D;  3NVV A;  3HVD A;  4M0W A;  1XLN A;  3NZ3 A;  4A55 A;  4C7Y A;  1TKE A;  2N9L A;  1DYQ A;  2L83 A;  3HVZ A;  4HRO A;  1N60 A;  1QQR A;  2MJ3 A;  2FE8 A;  3AE4 B;  2J42 A;  4XE0 A;  3TUO A;  4DQO C;  3NUH B;  3LXF A;  1VRA B;  1C4P A;  1B1Z A;  1TYG B;  3TEY A;  2PVG C;  1ZXH A;  3Q8C A;  3T3O A;  1XLQ A;  1TS3 A;  1FXI A;  2IDY A;  4WWM A;  1TJE A;  1L0Y B;  2D5G A;  2ACZ B;  2TSS A;  1MPE A;  3GB1 A;  1JCK B;  1TS4 A;  1JML A;  2BBC A;  2W55 A;  2WXR A;  1I7H A;  5FK9 C;  3AEC B;  2EEL A;  1JQ4 A;  1IUE A;  4CQN A;  1E10 A;  1KLG D;  1T6B X;  2Y5C A;  1C4A A;  1YJJ A;  1GPX A;  1I4X A;  4YSZ B;  1STE A;  4TMA B;  4XDD A;  1FXA A;  3SEB A;  4UDU C;  2YEP F;  3BK2 A;  4EE2 A;  2IJ0 A;  1RFK A;  5EE9 A;  1WWT A;  2K0P A;  5C2T B;  3IT4 B;  3B2F A;  1ENF A;  4P16 A;  1GOZ A;  4REZ A;  2QIL A;  1JWA D;  4NJC A;  2PKO A;  2WS3 B;  5G5H A;  2WQY B;  3AE2 B;  4KKI A;  1EU3 A;  3KWV A;  3IAM 1;  1C9F A;  1PUT A;  1LO5 D;  2W82 A;  2WDV B;  2V3P A;  4JPS A;  2QMT A;  5HHD G;  1ROE A;  1SJH D;  3ZYY X;  2Y5P A;  5GXG B;  1P7E A;  3P42 A;  3NRZ A;  4RCO A;  4TQ1 A;  4OHJ A;  4C80 A;  4AQ7 A;  3EGR A;  2IPK D;  2N9K A;  1OFF A;  2WLB A;  3AE8 B;  1TS5 A;  2BTE A;  1K53 A;  1V1O A;  1FRD A;  1UWM A;  2WXL A;  5D3I B;  1TKG A;  3I57 A;  5AUI A;  2KWD A;  1E9M A;  1P7F A;  1DOX A;  1D5M C;  1WSP A;  5BYR A;  4A8X C;  1HEZ E;  2BT6 A;  3PZ8 A;  1SBB B;  3KWL A;  1HXY D;  3AV8 A;  2DWQ A;  4RGN A;  1KRH A;  3T3N A;  1IBX A;  1JW9 D;  1VLB A;  4ZOH C;  1E0Z A;  1FCL A;  2MEK A;  2YEP B;  3SR6 A;  4US8 A;  2H89 B;  3R8B A;  1F2R C;  5LNK 1;  1CZP A;  2L52 A;  2NTT A;  3P4Q B;  3P4S B;  1JWU D;  3FC4 A;  3AEG B;  2BS2 B;  2DBY A;  4WIP A;  3ABV B;  2LHD A;  3UI3 A;  1VR9 A;  2W3R A;  5H8Y E;  1XCT L;  2LFI A;  3O13 A;  1YQ3 B;  2K3U A;  4FXC A;  5H92 C;  2PIA A;  4N59 A;  3KLS X;  2V3N A;  2LEK A;  1JWB D;  5TSS A;  1CQV A;  2J52 A;  1QOA A;  1PGA A;  1L6V A;  1T5X D;  2PVO D;  1KLU D;  3BYT B;  3C8Y A;  3NVY A;  4KGS A;  5T8I A;  4DXF A;  4HKZ E;  1EM7 A;  3W2D A;  3E56 A;  1KTK A;  1N5W A;  3B2G A;  1SF0 A;  3AEF B;  1UNS A;  1L4D B;  2LMC A;  4N58 A;  2RDG A;  3NS1 A;  3Q8F A;  2QEJ C;  2IGD A;  1NI3 A;  2MJD A;  1QT9 A;  2JXT A;  2JX5 A;  1MVK A;  1L0V B;  1WRI A;  1XLP A;  2AQ3 B;  2Q5W D;  1A70 A;  4N6E B;  4C7Z A;  4AS1 A;  2XNA C;  3W1S A;  4OVZ A;  1SEB D;  4ITK A;  1YJI A;  1HA5 A;  4YWG G;  1VZ6 A;  2IGH A;  2KDM A;  2SEB D;  2W54 A;  2N7J A;  1E7P B;  4LLG M;  2ONQ A;  1EWC A;  3RPF C;  1QOF A;  4ZRQ A;  1QOB A;  2G9H D;  4IOI E;  3AE1 B;  4KX6 B;  2CJO A;  4YTM B;  4USA A;  1L5P A;  4JE3 B;  2JYE A;  2RMM A;  4RGT A;  4RH6 A;  2L32 A;  3GP7 A;  5MPO A;  1XLO A;  1PGX A;  2QJL A;  2BS4 B;  1FRR A;  1I4G A;  2LGI A;  1SJE D;  4A6Q A;  2WXP A;  1Q10 A;  1HQR D;  4IDI A;  4JX1 C;  1V8C A;  4L1B A;  3URY A;  4B0E A;  2BB6 A;  1HZ6 A;  1L0X B;  2M19 A;  2RDH A;  3W9C B;  4WQM A;  2WXM A;  2M0A A;  2WU2 B;  4ZRP A;  2PTL A;  1R7S A;  3I9V 1;  4OW0 A;  3AEE B;  3AEB B;  2PMV A;  1KFY B;  1ET9 A;  1UWX A;  1C78 A;  3PZ7 A;  4P6V F;  1SE2 A;  1FNV A;  1FD6 A;  1PYW D;  2DYM A;  4PT5 A;  4US9 A;  2KAC A;  2ON8 A;  3U7Z A;  4ZHP A;  1N63 A;  4WAF A;  1FIQ A;  3U4E G;  3FAH A;  3ZGZ A;  4D2K A;  3MC0 B;  1FCC C;  4HEA 1;  5BMI A;  1I4H A;  1I4P A;  1TS2 A;  2I38 A;  1PFD A;  4XDC A;  1HZ5 A;  3V05 A;  1IBX B;  1T3Q A;  5BYQ A;  1DOY A;  1AYF A;  2CJN A;  3R2T A;  4ZHO A;  3P4P B;  4JWS C;  3SFE B;  1C79 A;  4KKJ A;  1FFU A;  2WNM A;  2LHE A;  3BZD B;  4NAW B;  3CWI A;  1BUI C;  1BML C;  1SB3 C;  3MP9 A;  1VZ8 A;  4ARI A;  1VZ7 A;  1K51 A;  1NEN B;  1XF5 L;  3NVW A;  5C3J B;  3MJ5 A;  2ICI A;  3OWE B;  1B9R A;  1JWS D;  1QIL A;  2AQ2 B;  2AQ1 B;  5JXV A;  4HKQ A;  1OQR A;  3DWG C;  1DOI A;  1MI0 A;  5HI1 A;  2WXI A;  3BVM A;  3NVZ A;  1PGB A;  2KMM A;  4JWU C;  1FFV A;  3RFZ B;  1J7C A;  3TEX A;  2WXQ A;  2HDE A;  2WP9 B;  2JU6 X;  1MHH E;  1SE4 A;  2BS3 B;  1EWY C;  2Y3A A;  2BYT A;  1D4B A;  1VJK A;  3FIL A;  4R3D A;  3SFD B;  3PO0 A;  3AE6 B;  2PW9 A;  1FNU A;  1NYR A;  2BW2 A;  1ZE3 D;  3BII D;  1ZP0 B;  2JYT A;  1YQ4 B;  4J3O D;  1WYG A;  3ZJU A;  1TY2 A;  1L4Z B;  1D6E C;  2LJI A;  3B9J A;  4B0M A;  4C56 C;  3AED B;  1QOG A;  5I4D A;  1SIJ A;  2AX5 A;  2G1E A;  1GB4 A;  4KGR A;  4MH8 A;  2WXJ A;  2DYO A;  1PDX A;  2KAJ A;  2WXF A;  3TEZ A;  3U2S C;  1ZPS A;  3V3X A;  1FM0 D;  1YN4 A;  2J53 A;  3P4R B;  3Q69 A;  4YXD B;  1GAQ B;  3TSS A;  4IKG A;  5BYS A;  2QSD A;  3AE5 B;  2ZW1 A;  4KGT A;  2WDR B;  1IGD A;  2VZK D;  1MHX A;  4OZC A;  1DGJ A;  3IXS A;  1QKZ A;  1UGJ A;  2OHF A;  3BVZ A;  3R2I A;  1JRO A;  4HJG E;  1SE3 A;  2E3T A;  4NZL B;  3AE9 B;  4H2A A;  3W5V B;  3AM9 A;  4GDK B;  4XWT A;  2WDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...