1XLQA

Crystal structure of reduced c73s putidaredoxin from pseudomonas putida
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
b'SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin
publication title Redox-dependent Structural Reorganization in Putidaredoxin, a Vertebrate-type [2Fe-2S] Ferredoxin from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 28
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature ec 1.9.3.2: Transferred entry: 1.7.2.1.
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xlqA00
1FMAD 3BIID 3CIRB 3AE7B 1ZP0B 4N59A 4US9A 5G5GA 3W9CB 4ZHPA 4HRSA 2FBWB 1VJKA 1DOYA 5G5HA 1CZPA 1KF6B 2MJ3A 3B9JA 2M56B 1SF0A 4YTPB 4USAA 3B2FA 4YT0B 4YTMB 3P4RB 2H89B 1E9MA 1YQ4B 1NEKB 2W3RA 3L4PA 1RFKA 3P4QB 2MH7A 1QF6A 1NYRA 1SB3C 1NI3A 1QOBA 1IUEA 2Q5WD 5AUIA 1E7PB 3AE8B 3NS1A 3AM9A 3SFDB 1KRHA 5EE0A 4C7YA 1TYGB 1FO4A 1OFFA 1ZUD2 2BS2B 1YJJA 3AB5A 3AECB 4JWUC 1A70A 1L6VA 2BS3B 2PVGC 1N63A 3AEGB 1AYFA 1PFDA 4A9AA 2QIEB 1ZXIA 1UWMA 4C80A 2B76B 1JRPA 1OQRA 2N0SB 5H92C 3SR6A 3ABVB 2DWQA 1FFVA 3NVYA 3AE3B 3CWIA 4LTUA 1ROEA 2Y5CA 3AEFB 4HROA 1SIJA 1FM0D 1JALA 1WXQA 2K5PA 1YQ3B 1VDVA 4P6VF 1FXIA 5H8YE 4N6EB 1WRIA 3W5UB 1PDXA 3FAHA 2WU5B 2LEKA 5EE9A 1B9RA 3P4PB 1NYQA 2KAJA 1N62A 4ZHOA 2JQRB 2MJDA 5C2TB 3RPFC 1TKGA 3AEAB 4FXCA 1V8CA 1VLBA 2PIAA 2WDRB 2DBYA 3AE4B 3AE9B 3NVZA 3VRAB 1I7HA 2QJLA 1CJEA 4IDIA 5EE1A 1E6EB 2G1EA 3AE2B 4YTNB 2HTME 2WU2B 1R7SA 4WQMA 2WLBA 1T3QA 3NRZA 3AMZA 3VR9B 2WQYB 1FRDA 3EUB2 2AX5A 2BS4B 3AE5B 4C7ZA 1GPXA 3AEEB 1FRRA 2WDVB 1XLOA 3AEDB 1GAQB 2OHFA 1N61A 1KFYB 1NVID 2BT6A 1XO3A 3DWMA 4JWSC 5AUKA 2CJNA 3FC4A 3P63A 1JROA 1QOAA 1F0ZA 2W55A 1FXAA 3LXFA 3VR8B 1JQ4A 3AH7A 2WP9B 1J7AA 1WGKA 2PVOD 2PKOA 3NVVA 1FIQA 2E3TA 3AV8A 3AEBB 4YSYB 3KWLA 1FFUA 1RYJA 1L6UA 4YSXB 1JWAD 4YXDB 1XLNA 1QOGA 2W3SA 3ETRA 3LB8C 3NVWA 3P1MA 1E10A 3HVZA 1PUTA 3P4SB 3PO0A 1QOFA 3DWGC 1DOXA 1J7BA 2K9XA 1AWDA 3W5VB 1J7CA 2M19A 3WCQA 2WDQB 1RM6C 1N5XA 3ZYYX 1EWYC 2EKIA 1WWTA 4YSZB 2JX5A 1RWSA 4ZOHC 1ZOYB 2K22A 4N58A 1XLPA 2CU3A 5EE3A 5MPOA 1E0ZA 1L0VB 1NENB 1TKEA 5C3JB 4US8A 1N5WA 1JW9D 3HRDD 2L52A 2MJEA 1YJIA 4KX6B 1QLBB 1JWBD 1TKYA 1V97A 4WWMA 3AE6B 1L5PA 1OQQA 2CJOA 1DOIA 2L83A 1QT9A 2WS3B 3HUIA 3AE1B 1N60A 2W54A 1XLQA 2H88B 1TJEA 3B2GA 2KMMA 3AN1A 2ACZB 4ITKA 1WYGA 4JX1C 1DGJA 3SFEB 3VRBB 5GXGB
chains in the Genus database with same CATH superfamily
2L76A 2IO3B 2AWTA 2K6DB 3SDLC 3VXWA 5E6NA 1L4DB 2JWZA 2H89B 4BOSC 4P16A 1R4MB 1SB3C 4HDOA 2BKRB 4KGRA 3PRMB 3AECB 4IOIE 2LGXA 4WH4A 2BBCA 4ICVA 2J52A 2RPVA 5H92C 4AUQC 3QK0A 4GDLA 2JSVX 2Z0DB 3CMMB 4GXBA 4IM2A 1FXIA 4DDID 1I4QA 1EF1A 3QCAA 4ARIA 4AWJA 2GBMA 2SEBD 3NZUA 3ZO5B 2MEKA 2WXJA 5FKAC 4HCNB 3N1YC 4LNIA 2J7QB 2WX0A 2ZPNA 4XX5A 2WYQA 2WNMA 1PQSA 1KM7A 3ZXRA 1YN3A 4G11A 4JWSC 2WXNA 1WX8A 4YSXB 3O65B 1V86A 4B0EA 1TZOA 3PO0A 1R4NI 2KFJA 4DHZE 4BBNC 2D5GA 3OG5A 2J53A 2KYWA 1WGYA 2L8JA 1NENB 4MJSB 1ZPSA 3RNBC 5C3JB 2JUOA 2YVCA 1V9JA 2J4XA 3ECIA 3H9DA 1V97A 3RNCC 2AQ2B 3UQAA 2ONQA 2WHIA 1FCCC 1WYGA 2IO0B 3C8YA 2BYTA 3RULA 1WE6A 1C79A 5FK9C 4G3XB 3SHQA 4TQ0A 3IAM1 4KV2A 2HD5B 4KIKA 2IJ0A 3DBLI 1A70A 1N63A 1TS3A 2N1VA 3NVYA 3KVFB 3AEFB 2MSED 1G6JA 2K5PA 1VR9A 4MM3B 2REXA 1NDDA 1VD2A 4KKIA 5JZEB 2G9HD 4REZA 2BQQA 3NZ3A 3PLVA 3AE2B 4YTNB 2Z8LA 4WJQA 3NRZA 4HPPA 1UZXB 2RDHA 2KWCA 4NY0A 3ZXVA 1SGHA 3VUWA 2LUEA 1P1AA 1C9FA 2K39A 4MELA 5E6OA 1Q0WB 2K3UA 2RGFA 3M95A 3NVWA 1XCQL 3P4SB 2DZIA 1OGWA 1N5XA 2VZKD 4NAMA 4WIPA 4N58A 3APDA 3DOWA 1Q5WB 1L0VB 4EUTA 2C5LC 5L83A 1SE2A 1ZGUB 3PT2B 3VUYA 2JF5A 4WWMA 3ZDTA 1OTRB 2ZCCA 3ZRFA 2LXCA 1F77A 4MGKE 3QJZA 1F1HA 3WALA 5IP4D 4I6NB 2PW9A 3B9JA 4MJSA 1YX5B 4KVGB 4EKUA 2K6QA 1K53A 1R4MI 2W3RA 2KJ6A 5AZFA 1QF6A 2WXIA 4O1NA 4BBNF 1YQBA 3VHTC 3NG0A 4NPNA 4RCOA 2XN9C 2LVPA 1P3QU 1GB1A 5IOIA 1KJTA 2Y5CA 4AP4C 3ZJTA 1NBFC 3AU4A 4E74A 1SIJA 4JL9A 1XCTL 1K8RB 4XGAB 3FAHA 3IBEA 5FR3A 1NYQA 3PZDA 1V49A 4FHJA 4RF1A 4HVBA 4ZHOA 4WWPA 1YD8U 4XDDA 5AEKB 4RM9A 3TEWA 2N4FA 1K50A 5EDSA 3NY5A 2MHJA 4II2B 2IGHA 1MG4A 4RMAA 2M17A 2V3SA 3AEDB 1GAQB 2CJNA 4MM3A 3ZUNA 3PRPB 1U4AA 1J7AA 2AL3A 3AEBB 1ZE3D 2OEDA 5J18A 1QOGA 5TSSA 3ETRA 4EZKA 1AARA 2L0TA 3WAOA 2GBKA 3IAS1 5DPTA 4C4VA 1MHHE 1RWSA 2K1FA 1FEHA 1UF0A 5BYQA 5MPOA 1ET9A 4W9CA 1P0RA 2K8HA 2NVUI 3PHXB 3BY4B 3DQVA 3QX1A 4BKSA 4RGMA 5GXGB 2DYBA 3M62B 3EECA 1VJKA 2K8BA 5BYSA 3UGBB 3MHSD 4AS1A 3CF6E 2LVQA 1F9JA 1EU3A 2UYZB 2KDIA 4WAAA 2LMCA 1QKZA 5IN7A 2LUMA 1OFFA 2BS2B 1SJHD 2QIEB 1UWMA 1IBXB 1WI0A 1JRPA 3DPDA 1SE4A 1OQRA 3IG3A 2LGYA 1HEZE 1ROEA 3H6NA 3VH3B 1GNUA 1V6EA 3VFKA 4WJNA 3BWUD 4XYCA 3WAPA 2JRHA 1WH3A 1WR1A 2WDRB 4DDGD 2OJRA 2VZKB 3HHMA 2HJ8A 1E6EB 1WIAA 1ISNA 3PRZA 4JIOU 4PS8A 2LHEA 1TBEA 2CHZA 3GB1A 2WGSA 3MC9A 2RSUA 3BYYB 3P63A 3Q8CA 2JYEA 3VR8B 3LDZE 2KQSA 2R61A 4RGOS 3AV8A 2E3TA 3Q8EA 3L17A 1V5TA 1L6UA 4URKA 2W3SA 2ASQA 1E10A 1E90A 3HVZA 1GC7A 3UINB 1ENFA 2RPQA 2KVZA 2D10A 4LNFA 2IPKD 3HIZA 2N9LA 1EF5A 4OHJA 5HFYA 3GS2A 3I3TB 1N5WA 1UGJA 2L52A 4CQNA 4W9DA 3DBHB 2L05A 4FHKA 1H4RA 3OJ3A 3KQ4A 3UQBA 1QT9A 2PE9A 4NJ6A 3VRBB 2L7RA 2FUHB 5LXIB 2ZW1A 2W82A 1R4NB 4N59A 4RNAA 3DHIC 4JGHB 2O6VD 1D3ZA 5KHQA 4GIVA 1KF6B 3DDCB 1E9MA 3JSVB 2KDEB 3VTVA 4E71A 2IO1B 3P4QB 1WFYA 4C56C 2J0JA 3PTFC 5EE0A 5IA7A 2V3NA 1YJJA 2BS3B 1PFDA 2Z0EB 3VH4B 1MI0A 3DVNU 3ABVB 2JXXA 2OOBB 1WXVA 4S0RA 3ZDMC 4KKJA 3N20C 4IM3A 1WMHA 4MH8A 2AQ1B 4LNKA 5DPSA 4B9KA 2PIAA 1J0GA 4OW0A 4A3PA 2KQ7A 1WJNA 1M94A 4MT5A 4HPMB 1IBXA 4S17A 1CK1A 3N1XC 2V4LA 2D3CA 3IT6B 3L0WB 5BO4B 1N61A 1KFYB 3ZNHB 3EFUA 3KUCB 3NZSA 1I4GA 4IKGA 2WXRA 5I4DA 2RDGA 2KMCA 2WP9B 4LLGM 2WX1A 4YSYB 1RAXA 4FULA 3KWLA 3VAWA 1STEA 3Q3JA 3QHTA 1QOFA 4RGTA 3DVGX 2EKIA 1TS4A 3QQ8B 1SXTA 1OEYA 4MGIE 2LFIA 4G50A 3URYA 5AZGA 4K81A 1P98A 4GSWA 3MC8A 4M00A 3EHVA 3NS8A 1WJ4A 2Z59B 1SIFA 2FE8A 3U7ZA 2KC2A 1N60A 2H88B 1TJEA 1XEEA 2KO3A 1I4XA 2DAJA 2MBQA 1PYWD 4HCPB 4LCDE 2QMTA 4USAA 4IM0A 3RNGC 4HEA1 5TR5A 4W9IA 4F1SA 1BXTA 1WZ3A 2WXLA 3V62A 4CO7A 1TTNA 4G0NB 1T5XD 3VTUA 2R2OA 3MJ5A 1LQBA 2ZZPB 4RGNA 3N32A 3PGEA 1LXDA 2D2QA 4MSMB 2DWQA 1KOTA 3HM6X 3RD2A 2EMSA 1TZ1A 1YQ3B 3JSVA 3B1LX 1TGZB 3BVGA 5E6PA 4EOYA 4GN1A 1C4CA 3O13A 3AE9B 1TT5B 4IDIA 3FILB 2KX0A 3U30A 4C7ZA 3I63C 1BMLC 3ML9A 1JRUA 5DCNA 1WRDB 2JVCA 4HPLB 2DYMA 4AJWA 5JHBA 1WGKA 1TS5A 4ZDVA 3P42A 1YN4A 4F7ZA 2MW5A 1J7BA 2K9XA 4K7WA 3U2SC 1F2RI 2O6VB 1ZXHA 2Y3AA 5EE3A 1MFWA 2V0GA 3DBHI 4BZAA 1XF5L 2PLPA 3QARA 4KSLC 2EELA 2WS3B 2W54A 1DYQA 3KYDD 4XDCA 1RLFA 2WWZA 4LDTD 2ZW0A 4WWOA 4US9A 2CU1A 2INPE 4EE2A 1D6EC 3I9V1 4TKNA 4M8MA 1HA5A 3RI7C 2WXKA 3LJ3A 4FJVB 2MP2A 3L4PA 3GOEA 1WR6E 4NNJB 1HTOA 3HVDA 2KXJA 1I4HA 2D3BA 1LGRA 1UNSA 3Q3FA 3SU8X 4UDUC 2ZNVB 2KZRA 2G4SA 4RF0A 4CYEA 1EO6A 2PVGC 1AYFA 1A5RA 2NCNA 2B76B 3VTWA 2NTTA 4KZ0A 2CS4A 3T9LA 1FFVA 4KZCA 2KDBA 3CWIA 5LLIA 3UF8A 2DHZA 2JU6X 3ZTCA 1E8YA 4L2YA 1C4AA 4N6EB 2KLCA 1CMXB 1WF9A 1GB4A 4IW0A 2MBEA 3ENEA 2OJWA 1WM3A 4KSKC 3R2TA 2KKCA 3J9CA 1FRRA 4RFBA 3P2BA 2WDVB 4ACFA 2M1MA 1YIWA 4TSSA 2MA9B 2TSSA 2N9XA 4PT5A 4KDLB 1FFUA 1RYJA 1UGMA 2BYFA 4HXDA 2FCQA 3ONSA 1HZ6A 1WGGA 3ZJUA 2I38A 2WXGA 3FILA 1WGDA 2KWUB 2GMIC 4ZOHC 2ZCBA 4HLEA 4ANWA 4M8NA 1TKEA 2Y5PA 3IVFA 4MH0E 1B1ZA 1S1QB 4A55A 2KC1A 2ZNVC 4XWTA 3RT3B 2HDEA 1F52A 2XK5B 2O6VA 3V6EB 1DGJA 1E8XA 3KLSX 1FMAD 1SE9A 3BIID 3CIRB 2KN5A 2YLMA 1QILA 4I6LB 3H7SA 1OQYA 2M0AA 3IT4B 3QA8A 1I42A 4YT0B 3SD5A 3E9SA 4RM8A 1NI2A 2UU7A 2N7JA 1GUAB 4GDKB 1KH0A 3JVZX 3PZ8A 3MTNB 1V1OA 4K3CA 3PVLA 1SJED 1KRHA 3IHPC 2VH1A 3NOBA 1K51A 3U4EG 1PGAA 3HM3A 2WXPA 2GBRA 3W5UB 3X0WA 4F8CB 5EE9A 4P1BC 3RPFC 3A4RA 3PREA 5G2NA 1QZEA 2L1AA 4K3BA 4FBJB 4WURA 2ICIA 2KT7A 5J17A 1J19A 3RN9C 3AE5B 2DZJA 1GPXA 3L08A 1WZ0A 2AQ3B 2GB1A 3T3OA 3FC4A 4B95A 3R3MA 1FXAA 2KACA 4FJZA 1UWXA 2LGDA 4LDTB 3I57A 1PGBA 1MG8A 3Q8BA 3R7RA 2LHDA 1ZOYB 2LZ6A 3X23A 1P9DU 1EM7A 1FCLA 1UUPA 2N7EA 1JW9D 4LNNA 5BMIA 3S2AA 1BUIC 1JMLA 3RFZB 3B0AA 5D3DA 4ICUA 4ANVA 2W9NA 1LM8B 3AE1B 1GJZA 2FCMA 2ZVOA 2MRPA 2FAZA 4ZHPA 1YN5A 4LJPB 2FBWB 2BPSA 2KJHB 3L10B 2MJ3A 2R2QA 1Y56A 4KGTA 3IFWB 2NBUA 3I5JC 1BT0A 1PGXA 3N1ZC 1C77A 2XK5A 1ZXIA 3GE3C 1ZKHA 5HHDG 3A9JB 2PJHA 2DZMA 1RFAA 2PPHA 1SE3A 1YOVB 1WXQA 1E7VA 3T3NA 4DK5A 2RMMA 2KD0A 1WJ6A 4GDKA 2WU5B 2XBBC 4FADA 1C3TA 1IYFA 3RUIB 3KYCD 4WQOB 1GC6A 4BFRA 3QWZB 2HE7A 1EU4A 3AU5A 3RNFC 3OLMD 3TBLD 2KFKB 3AEEB 2IY1B 4W9GA 4W9HA 1V5OA 4J6IA 1WX9A 2INNE 2BT6A 1WXMA 3PSEB 1WE7A 2L0FA 2BW2A 2G4DB 5JH5C 2DLBA 3PPAA 5BMGA 2JWUA 3K9OB 2CKHB 4PS3A 1UELA 5DPRA 1ET6A 4ZYSA 4BKTA 1EWYC 2VRRB 3RMKC 2KK8A 2L00B 2BYEA 1H8CA 3R2IA 3VQIA 4TV3A 2WXMA 2CHWA 4JQWC 4NQKE 3AXCA 4OVVA 1X1MA 1L7YA 3Q3OC 1DOIA 2L83A 2PE6B 2KWDA 4NQLB 1V1PB 3EFCA 2IDYA 4ANXA 2KMMA 1C4PA 2WXFA 3TEYA 2KHWB 1WXAA 4WJPA 1Q10A 2I1KA 2BWFA 2RD0A 3BINA 4C00A 1FNUA 1D4BA 3P4RB 1WM2A 2LGSA 2NBVB 4AOFA 1RFKA 1NYRA 3A4SC 5AUIA 1E7PB 2D3AA 1TYGB 3Q69A 4IWQA 1KLGD 1VCBA 1L6VA 4NZLB 4HKQA 2N0SB 3GZNB 1D5XC 1T0SC 2IYDB 1E8ZA 4HROA 4DXFA 1JALA 3MJWA 4DWFA 2N7DA 1WRIA 1CQVA 3QAQA 3TL5A 3VUXA 1B9RA 2LXAA 2JQRB 4ASWC 1FPYA 2SAKA 1TKGA 1VLBA 2DBYA 3TUOA 3WA0A 2KTRB 3Q3MC 2NTSA 3RZFA 1T0QC 1MHXA 3PS6A 3VR9B 3RNEC 2CR5A 1XLOA 5C1ZA 2IGGA 3BK2A 4GB9A 2JRIB 3ZW3A 1XLNA 2PMVA 2C7HA 3IXSA 4K1RB 1ZDXA 1F2RC 1FNVA 2JX5A 4R3DA 1YMHE 2KFKA 2MQJA 2QSDA 3H8HA 3ZLZA 4GU2A 5D94A 4DXAB 2MWSB 4Q2JA 1UH6A 1FXTB 3M63B 4IWPA 2CJOA 3Q8AA 1XQQA 3A9KB 3MP9A 3BYTB 3W1YA 4HKZE 1L0XB 2BWES 2J0MA 1EUVB 2MLBA 3KH0A 1V81A 2Q5WD 2HTHA 2WXOA 5C23A 4J3OD 5LNK1 1V1PA 2BKFA 3L54A 1WSPA 2X8XX 4B0MA 2Y5BB 2ZEQA 3UI3A 3TMPB 4JPSA 4BVUC 2IO2B 2KDFB 4DBGA 1XT9B 2V9HA 2LEKA 3N3KB 1C78A 1V8CA 4MGYE 3ZJVA 4H2AA 4M0WB 2FIDA 1FNWA 2HTME 1UBQA 1R7SA 3M3JA 4L1BA 4B6WA 1HE8A 2KVRA 2MBOA 3DHHC 3DWMA 5AUKA 1VZ8A 3VVWB 2W55A 2INDC 2GOWA 1JQ4A 2V4IB 3AH7A 2RDBC 5IAAC 3ML8A 3JW0X 4YXDB 4IUMB 2DAFA 2KTRA 1AWDA 1ACCA 1J7CA 4P7IA 1HZ5A 1XLPA 1KLUD 2GRIA 3V60A 4OZCA 3HRDD 4II3B 1LFDA 2KWVB 4LJOB 2C60A 4CHKA 3AE6B 4RH6A 2LRUA 2YEPB 3LYYA 4JX1C 4HK2A 3JYUA 4E3CA 4ARCA 3EC8A 3AE7B 1ZP0B 3HK0A 1YNTE 2JPHA 2DNFA 5BYRA 2D11A 3Q6BA 2MCNB 4EEWA 3TIXA 2LJIA 1SF0A 2B3AA 2K25A 1NEKB 3DVNV 5CHVC 2I2YA 3N30A 3RCZA 4KDIC 2FIFA 3APCA 2AEHA 3C19A 3TSSA 1VRAB 3AE8B 2BGFA 3AM9A 1QQRA 3DBSA 3A9KA 1T0RC 2IBIB 3WANA 3GZNI 2IGDA 3A1QB 4A90A 1WYWB 3EGRA 4I6PA 2DZKA 1I4PA 4OZBA 3AULA 1JCKB 5D3IB 3GP7A 4EFOA 4OVZA 5CHFA 3UIPB 3ZQ4A 2MJDA 2QJLA 1CJEA 4ZRJA 4PK1A 4A8XC 1HQRD 2QHOA 2BS4B 3WAMA 4TMAB 2A5UA 1F0ZA 5D6JB 3WIMA 4PYUA 2FCSA 5T8IA 4DHJD 4IG7B 1JWAD 4W9FA 4ZRIA 3ZIMA 4WWNA 1HXYD 4ZRKA 4M0WA 2QEJC 1DOXA 1M4VA 3W5VB 1C1YB 2M19A 4YSZB 4L23A 4PYZA 2G3QB 3ZKJC 1N6ZA 3ZGZA 3NJTA 4HJGE 3R7QA 4NAWB 2LASA 1JWSD 1J8CA 2G45B 1IPGA 4QAYA 3TCAA 2DENB 1L5PA 1HTQA 2UWQA 1ZW7A 4HWIB 2BB5A 3Q3NC 3KW5B 5L95C 4HRSA 4NJCA 1CZPA 5KHOA 1L2NA 1WX7A 1WGRA 5JXVA 2RR9A 4N9F4 2QCZA 4DXGA 2KDMA 3AB5A 1SBBB 4JWUC 3AEGB 1MJDA 1TIFA 1WJUA 4A9AA 4ZRQA 4C4VB 4ANUA 2GLSA 2N9EB 1TY2A 1SSNA 1S3SG 4K7SA 4MGZE 3P4PB 2N1WA 3OAWA 1JWUD 5EE1A 4TQ1A 5AZHA 2O2VB 3A1QA 3H7PB 2WQYB 4W9KA 2NMQA 2JZPA 3PHWB 2ZVNA 2ZJDA 3PV1A 1NVID 2K8CA 3MC0B 3LXFA 2KANA 2D3GA 4M02A 5G55A 2JY6A 2PVOD 2PKOA 2DYOA 1PUTA 3DWGC 4IWOA 5DPWA 3WCQA 2A4ZA 2EMTA 1IP9A 1WWTA 2J42A 3RZWC 2L3ZA 2QDFA 1OEYJ 1E0ZA 3B08A 1T6BX 3FKYA 2MJEA 1TY0A 1VZ6A 2JYTA 3DHGC 1YJIA 4KX6B 2LRWA 1JWBD 1TKYA 1OQQA 4JLCA 2FUG1 5CHWA 3DCGA 3HUIA 3DBRB 1MVKA 1V2YA 2X38A 4W9JA 4FLHA 5D7GA 5G5GA 1DOYA 5G5HA 4A6QA 4XC2A 5D2MB 1MPEA 2YEPF 4NAWA 4BKGA 1RRBA 1YQ4B 4DHZB 1KLVA 2XEWA 1NI3A 1QOBA 2WDTB 1I35A 4ZYNA 1AW7A 3SFDB 2JT4B 2BTEA 4BAXA 4C7YA 1FO4A 1ZUD2 5C2TB 2XNAC 3D32A 3RNAC 3Q2AC 3U8ZA 1WXSA 2GI9A 2PEAA 1VZ7A 3AE3B 5IKCM 1L0YB 4IC7B 3GE8C 1FM0D 5LXHA 5H8YE 1E8WA 3Q14C 4DHJB 3AI5A 3NUHB 3AEAB 4FXCA 3NVZA 4FN2A 4EZLA 2WU2B 4YWGG 4WQMA 1T3QA 4FA6A 3KUZA 2WXQA 3U52E 2OHFA 1XO3A 3TEXA 4A3OA 1JROA 2NPTB 3ZTDA 1Y8RC 4YL8A 1D5ZC 4BOZB 3SEBA 3TEZA 2MBHA 2C9WB 1ZDVA 4LNOA 5E6JA 3BVMA 3NHEB 1TS2A 2WDQB 2JZZA 2O2VA 3H7PA 2KLGA 2LGIA 1T0YA 2NS5A 1WMHB 1QLBB 3PLUA 2BF8B 3UIOB 2AL6A 5BMHA 1YJ1A 3EA6A 2MBBB 1JWMD 4XZ4A 3AN1A 3SFEB 2GBNA 4M01A 2AYOB 4LK0M 4NJ7A 3N9YC 4AJYB 3W1SC 3QC8B 4OZAA 4MEMA 2IY0B 2MH7A 2KMAA 2EKEC 1IUEA 2BB6A 5CTRC 5HG2A 3Q8FA 4XWWA 5HI1A 3SR6A 4K7UA 4JE3B 2NR2A 2KJRA 4MACA 3ZNID 2FNJB 2V3PA 3KUDB 1VDVA 4P6VF 2MX2A 3ZVVA 1V80A 4W9EA 1K52A 4ZRPA 2KAJA 2KX3A 4A20A 2LVOA 1I7HA 4MSQB 1D5MC 2G1EA 2IZVB 4D2KA 2D07B 3CSFA 2INCC 3EUB2 3ZNGC 1ESFA 1IGDA 4HJKA 1GG3A 4HDQA 1E7UA 4OVUA 4TUUA 3W1SA 3ZNZB 4W9LA 1P7EA 2N9KA 3BK1A 4AQ7A 2N9PC 5GMVA 1Z2MA 2KNBA 2GBJA 2M0XA 1UD7A 3V3XA 3A9JA 2C7NB 1GOZA 2CU3A 3H1UA 3E56A 3BZDB 1WY8A 2KTFA 2FCNA 4X57B 2NPTA 4GLSC 1E5WA 4PS7A 3TJPA 3DBRI 2WXHA 4P1CC 4MDKE 2ON8A 3A33B 1XLQA 4ITKA 2ACZB 4GGQA 3W9CB 2LI5A 4XE0A 3VDZA 4GDLB 2C7MB 2LD9A 2M56B 3KWVA 4YTPB 2QILA 3B2FA 4YTMB 2V1YA 1SEBD 1LO5D 1EWCA 2BYVE 3NS1A 2QC8A 1L4ZB 2M4NA 5JHAA 3V61A 1YX6B 1UBIA 1XXGA 3OWEB 3W2DA 3DBLB 3R66C 2BVCA 4C80A 2E6XA 4EZJA 2ZPYA 1AN8A 3CSTA 2K0PA 3APFA 4LTUA 3L16A 3MHZA 1KTKA 2I1JA 1PDXA 1N62A 3C0RB 1Q1OA 3ZRCA 3L13A 3VRAB 3AE4B 2CHXA 3QIJA 3OJ4B 2JXTA 1FD6A 5IO9A 1WGHA 2WLBA 2KOXA 3AMZA 3T8MA 1FRDA 2AX5A 5J2RA 2KQ4X 3MFGA 3R8BA 3ALBA 5CX3A 2JZ3B 1QOAA 3K9PB 2MP2B 5HKHA 2LWPA 1C76A 3NVVA 1FIQA 1IGCA 2LJ5A 2M8SA 2VH2A 2J0KA 4GOCA 2L32A 3PZ7A 3LB8C 3P1MA 1XD3B 3DVGY 5FR6A 4GMVA 1RM6C 3ZYYX 2HJ1A 2K22A 3U7DA 4WJOA 1P7FA 4US8A 4FJYA 2DX5B 1I4RA 2PTLA 2KN4A 3V05A 4DQOC 4WAFA 3V6CB 4KIKB 3RYTA 3BVZA 1Z5SB 2NBWB 3B2GA 4KGSA 4BKSD
chains in the Genus database with same CATH topology
4N59A 4RNAA 4ZHPA 1YN5A 4HRSA 2FBWB 4NJCA 1CZPA 1KF6B 2MJ3A 1L4DB 1Y56A 4KGTA 2H89B 5JXVA 1E9MA 3P4QB 4C56C 4P16A 1SB3C 4DXGA 1PGXA 4KGRA 2KDMA 5EE0A 2V3NA 1YJJA 3AB5A 1SBBB 1C77A 3AECB 2BS3B 4IOIE 4JWUC 3AEGB 1PFDA 4WH4A 2BBCA 4A9AA 1ZXIA 1MI0A 4ZRQA 5HHDG 2J52A 2RPVA 5H92C 3ABVB 1TY2A 1SSNA 2JSVX 1SE3A 1WXQA 4KKJA 1FXIA 3T3NA 1I4QA 2RMMA 4ARIA 2WU5B 2SEBD 4MH8A 3P4PB 2AQ1B 2MEKA 2WXJA 5FKAC 2PIAA 4OW0A 1JWUD 5EE1A 4MT5A 1IBXA 4TQ1A 1CK1A 1EU4A 2WQYB 2NMQA 2JZPA 3AEEB 3IT6B 2WNMA 2ZW1A 1YN3A 1N61A 2INNE 1KFYB 1NVID 2BT6A 4JWSC 2WXNA 3MC0B 1I4GA 3LXFA 4IKGA 2WXRA 5I4DA 2BW2A 2RDGA 4LLGM 2WP9B 2PVOD 2PKOA 2DLBA 4YSYB 5BMGA 3KWLA 2JWUA 4YSXB 2DYOA 1STEA 1PUTA 1TZOA 3PO0A 4B0EA 1QOFA 3DWGC 3WCQA 4RGTA 1ET6A 4ZYSA 1EWYC 2EKIA 1WWTA 1TS4A 2J42A 2D5GA 2J53A 1SXTA 2LFIA 1E0ZA 1NENB 1ZPSA 3URYA 5C3JB 1T6BX 3R2IA 2MJEA 3VQIA 1TY0A 1VZ6A 2JYTA 2J4XA 1YJIA 4KX6B 1JWBD 2WXMA 1TKYA 1V97A 2AQ2B 1OQQA 2FUG1 2FE8A 1DOIA 2L83A 2KWDA 2ONQA 3HUIA 3U7ZA 1V1PB 1MVKA 1N60A 2IDYA 2H88B 1TJEA 2X38A 2KMMA 1C4PA 1FCCC 1XEEA 1WYGA 5D7GA 3C8YA 2WXFA 3TEYA 5G5GA 2BYTA 1I4XA 1Q10A 1DOYA 5G5HA 4A6QA 1PYWD 1C79A 5FK9C 1FNUA 1D4BA 1MPEA 2QMTA 2YEPF 4USAA 4TQ0A 3P4RB 3IAM1 4HEA1 1YQ4B 1RFKA 2IJ0A 1NYRA 1NI3A 1QOBA 5AUIA 1BXTA 1E7PB 2WXLA 1AW7A 3SFDB 2BTEA 4C7YA 1FO4A 1TYGB 3Q69A 1KLGD 1ZUD2 1T5XD 5C2TB 1A70A 1L6VA 2XNAC 1N63A 3MJ5A 4NZLB 1TS3A 4HKQA 4RGNA 2N0SB 2DWQA 2GI9A 1VZ7A 3AE3B 3NVYA 1D5XC 1L0YB 3AEFB 4HROA 4DXFA 1FM0D 1JALA 2K5PA 1VR9A 1YQ3B 4MM3B 5H8YE 1WRIA 1CQVA 3BVGA 1B9RA 4KKIA 2G9HD 2JQRB 3NUHB 2SAKA 1TKGA 1C4CA 3AEAB 3O13A 1VLBA 3NZ3A 3AE9B 4FXCA 2DBYA 3NVZA 3TUOA 4IDIA 2NTSA 3AE2B 4YTNB 2WU2B 2Z8LA 4YWGG 3FILB 4WQMA 1MHXA 1T3QA 3NRZA 3VR9B 4C7ZA 1BMLC 2WXQA 1XLOA 3U52E 2OHFA 1XO3A 2RDHA 3TEXA 1JROA 2IGGA 3BK2A 2DYMA 1WGKA 1TS5A 1C9FA 1D5ZC 3SEBA 2K3UA 3P42A 3TEZA 1YN4A 1XLNA 3NVWA 2PMVA 1ZDVA 1XCQL 3P4SB 5E6JA 3BVMA 1J7BA 2K9XA 3U2SC 1F2RI 1TS2A 3IXSA 2WDQB 1N5XA 1ZXHA 1ZDXA 1F2RC 2VZKD 4NAMA 1FNVA 2JX5A 4R3DA 1YMHE 4WIPA 2QSDA 2Y3AA 4N58A 5EE3A 3H8HA 1L0VB 2LGIA 2V0GA 4Q2JA 1SE2A 1XF5L 1QLBB 2PLPA 4WWMA 2CJOA 2EELA 5BMHA 2WS3B 3EA6A 2W54A 1JWMD 1DYQA 3Q8AA 1F77A 3AN1A 4XDCA 3SFEB 3MP9A 2ZW0A 3BYTB 4US9A 4LK0M 4HKZE 1L0XB 2INPE 4EE2A 1D6EC 2PW9A 3I9V1 3N9YC 3B9JA 1HA5A 2WXKA 4OZAA 1K53A 2W3RA 3L4PA 2MH7A 3HVDA 1QF6A 2Q5WD 1IUEA 1I4HA 2WXOA 1UNSA 2WXIA 4O1NA 2BB6A 5HG2A 4UDUC 3Q8FA 4J3OD 4RF0A 5LNK1 1V1PA 2PVGC 1WSPA 1AYFA 4XWWA 4RCOA 2XN9C 4B0MA 2B76B 5HI1A 3UI3A 2NTTA 4JPSA 3SR6A 1GB1A 1FFVA 4JE3B 3CWIA 2Y5CA 3ZJTA 4MACA 1SIJA 2JU6X 2V3PA 4L2YA 1XCTL 1VDVA 1C4AA 4P6VF 4N6EB 1K52A 3FAHA 4ZRPA 2LEKA 5FR3A 1NYQA 2KAJA 4RF1A 4ZHOA 1C78A 1V8CA 4XDDA 1GB4A 3ZJVA 4H2AA 3TEWA 1I7HA 1K50A 1D5MC 2G1EA 1FNWA 4D2KA 2HTME 1R7SA 3EUB2 2IGHA 3R2TA 4L1BA 3J9CA 1FRRA 1ESFA 1IGDA 4RFBA 2WDVB 3AEDB 1GAQB 3DWMA 5AUKA 1VZ8A 2CJNA 4TSSA 2W55A 1JQ4A 3W1SA 2TSSA 2V4IB 3AH7A 1J7AA 4PT5A 1P7EA 3AEBB 2N9KA 3BK1A 1FFUA 1RYJA 1ZE3D 4AQ7A 2OEDA 4YXDB 1QOGA 5TSSA 3ETRA 1HZ6A 3ZJUA 2I38A 1AWDA 1ACCA 1J7CA 3IAS1 2WXGA 3FILA 1HZ5A 1MHHE 3V3XA 4ZOHC 1RWSA 1GOZA 1FEHA 5MPOA 1XLPA 2CU3A 5BYQA 3E56A 1TKEA 1KLUD 2GRIA 3BZDB 1ET9A 2Y5PA 4OZCA 3HRDD 4GLSC 1B1ZA 4A55A 3AE6B 2WXHA 4XWTA 4RH6A 4RGMA 2HDEA 2ON8A 2YEPB 1XLQA 3LYYA 4ITKA 4JX1C 2ACZB 1DGJA 5GXGB 3KLSX 4ARCA 1FMAD 3BIID 3CIRB 3AE7B 1ZP0B 3W9CB 4XE0A 1YNTE 1QILA 1VJKA 4GDLB 5BYRA 2M0AA 3IT4B 2M56B 2LJIA 3KWVA 1SF0A 4YTPB 4YT0B 2QILA 3B2FA 3E9SA 4YTMB 5BYSA 4AS1A 1NEKB 2I2YA 2N7JA 3PZ8A 1KH0A 4GDKB 1SEBD 1V1OA 1EU3A 1LO5D 3TSSA 2LMCA 1VRAB 1EWCA 1QKZA 3AE8B 3NS1A 3AM9A 1L4ZB 1QQRA 1SJED 1KRHA 1XXGA 2LUMA 1OFFA 2BS2B 3OWEB 3W2DA 1SJHD 2QIEB 1UWMA 1IBXB 4C80A 2IGDA 1JRPA 1SE4A 1OQRA 2E6XA 1AN8A 1HEZE 2K0PA 1K51A 4LTUA 1ROEA 3U4EG 4A90A 3EGRA 1PGAA 1I4PA 4OZBA 1JCKB 3MHZA 1KTKA 2WXPA 3BWUD 3GP7A 5D3IB 3W5UB 1PDXA 5EE9A 4OVZA 3ZQ4A 1N62A 2MJDA 3RPFC 2WDRB 3VRAB 3AE4B 2L1AA 2QJLA 1CJEA 2VZKB 1E6EB 2JXTA 4A8XC 1HQRD 1FD6A 4WURA 2ICIA 2WLBA 3AMZA 1FRDA 2LHEA 2AX5A 2BS4B 3AE5B 1GPXA 3GB1A 4TMAB 2AQ3B 2GB1A 2KQ4X 3MFGA 3R8BA 3T3OA 3BYYB 3FC4A 1QOAA 3P63A 3Q8CA 1F0ZA 2JYEA 1FXAA 3VR8B 2KACA 2R61A 1C76A 3NVVA 4REZA 4RGOS 1FIQA 1IGCA 2E3TA 3AV8A 3Q8EA 5T8IA 1UWXA 1L6UA 1JWAD 2L32A 3PZ7A 2W3SA 3LB8C 3P1MA 1E10A 3HVZA 1HXYD 4M0WA 2QEJC 1DOXA 1M4VA 1ENFA 3W5VB 2M19A 3I57A 1RM6C 2IPKD 3ZYYX 1PGBA 4YSZB 3Q8BA 4L23A 2N9LA 2LHDA 1ZOYB 2K22A 4OHJA 1EM7A 1FCLA 5HFYA 1UUPA 3GS2A 1P7FA 3ZGZA 4HJGE 4US8A 1N5WA 4NAWB 1JW9D 1UGJA 2L52A 1I4RA 2PTLA 2KN4A 3V05A 4DQOC 1JWSD 4WAFA 5BMIA 4CQNA 1BUIC 1JMLA 3RFZB 5D3DA 3KQ4A 3BVZA 1L5PA 1QT9A 3AE1B 3B2GA 4KGSA 2BB5A 3VRBB 2W82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FMA D;  3BII D;  3CIR B;  3AE7 B;  1ZP0 B;  4N59 A;  4US9 A;  5G5G A;  3W9C B;  4ZHP A;  4HRS A;  2FBW B;  1VJK A;  1DOY A;  5G5H A;  1CZP A;  1KF6 B;  2MJ3 A;  3B9J A;  2M56 B;  1SF0 A;  4YTP B;  4USA A;  3B2F A;  4YT0 B;  4YTM B;  3P4R B;  2H89 B;  1E9M A;  1YQ4 B;  1NEK B;  2W3R A;  3L4P A;  1RFK A;  3P4Q B;  2MH7 A;  1QF6 A;  1NYR A;  1SB3 C;  1NI3 A;  1QOB A;  1IUE A;  2Q5W D;  5AUI A;  1E7P B;  3AE8 B;  3NS1 A;  3AM9 A;  3SFD B;  1KRH A;  5EE0 A;  4C7Y A;  1TYG B;  1FO4 A;  1OFF A;  1ZUD 2;  2BS2 B;  1YJJ A;  3AB5 A;  3AEC B;  4JWU C;  1A70 A;  1L6V A;  2BS3 B;  2PVG C;  1N63 A;  3AEG B;  1AYF A;  1PFD A;  4A9A A;  2QIE B;  1ZXI A;  1UWM A;  4C80 A;  2B76 B;  1JRP A;  1OQR A;  2N0S B;  5H92 C;  3SR6 A;  3ABV B;  2DWQ A;  1FFV A;  3NVY A;  3AE3 B;  3CWI A;  4LTU A;  1ROE A;  2Y5C A;  3AEF B;  4HRO A;  1SIJ A;  1FM0 D;  1JAL A;  1WXQ A;  2K5P A;  1YQ3 B;  1VDV A;  4P6V F;  1FXI A;  5H8Y E;  4N6E B;  1WRI A;  3W5U B;  1PDX A;  3FAH A;  2WU5 B;  2LEK A;  5EE9 A;  1B9R A;  3P4P B;  1NYQ A;  2KAJ A;  1N62 A;  4ZHO A;  2JQR B;  2MJD A;  5C2T B;  3RPF C;  1TKG A;  3AEA B;  4FXC A;  1V8C A;  1VLB A;  2PIA A;  2WDR B;  2DBY A;  3AE4 B;  3AE9 B;  3NVZ A;  3VRA B;  1I7H A;  2QJL A;  1CJE A;  4IDI A;  5EE1 A;  1E6E B;  2G1E A;  3AE2 B;  4YTN B;  2HTM E;  2WU2 B;  1R7S A;  4WQM A;  2WLB A;  1T3Q A;  3NRZ A;  3AMZ A;  3VR9 B;  2WQY B;  1FRD A;  3EUB 2;  2AX5 A;  2BS4 B;  3AE5 B;  4C7Z A;  1GPX A;  3AEE B;  1FRR A;  2WDV B;  1XLO A;  3AED B;  1GAQ B;  2OHF A;  1N61 A;  1KFY B;  1NVI D;  2BT6 A;  1XO3 A;  3DWM A;  4JWS C;  5AUK A;  2CJN A;  3FC4 A;  3P63 A;  1JRO A;  1QOA A;  1F0Z A;  2W55 A;  1FXA A;  3LXF A;  3VR8 B;  1JQ4 A;  3AH7 A;  2WP9 B;  1J7A A;  1WGK A;  2PVO D;  2PKO A;  3NVV A;  1FIQ A;  2E3T A;  3AV8 A;  3AEB B;  4YSY B;  3KWL A;  1FFU A;  1RYJ A;  1L6U A;  4YSX B;  1JWA D;  4YXD B;  1XLN A;  1QOG A;  2W3S A;  3ETR A;  3LB8 C;  3NVW A;  3P1M A;  1E10 A;  3HVZ A;  1PUT A;  3P4S B;  3PO0 A;  1QOF A;  3DWG C;  1DOX A;  1J7B A;  2K9X A;  1AWD A;  3W5V B;  1J7C A;  2M19 A;  3WCQ A;  2WDQ B;  1RM6 C;  1N5X A;  3ZYY X;  1EWY C;  2EKI A;  1WWT A;  4YSZ B;  2JX5 A;  1RWS A;  4ZOH C;  1ZOY B;  2K22 A;  4N58 A;  1XLP A;  2CU3 A;  5EE3 A;  5MPO A;  1E0Z A;  1L0V B;  1NEN B;  1TKE A;  5C3J B;  4US8 A;  1N5W A;  1JW9 D;  3HRD D;  2L52 A;  2MJE A;  1YJI A;  4KX6 B;  1QLB B;  1JWB D;  1TKY A;  1V97 A;  4WWM A;  3AE6 B;  1L5P A;  1OQQ A;  2CJO A;  1DOI A;  2L83 A;  1QT9 A;  2WS3 B;  3HUI A;  3AE1 B;  1N60 A;  2W54 A;  1XLQ A;  2H88 B;  1TJE A;  3B2G A;  2KMM A;  3AN1 A;  2ACZ B;  4ITK A;  1WYG A;  4JX1 C;  1DGJ A;  3SFE B;  3VRB B;  5GXG B; 
#chains in the Genus database with same CATH topology
 2L76 A;  2IO3 B;  2AWT A;  2K6D B;  3SDL C;  3VXW A;  5E6N A;  1L4D B;  2JWZ A;  2H89 B;  4BOS C;  4P16 A;  1R4M B;  1SB3 C;  4HDO A;  2BKR B;  4KGR A;  3PRM B;  3AEC B;  4IOI E;  2LGX A;  4WH4 A;  2BBC A;  4ICV A;  2J52 A;  2RPV A;  5H92 C;  4AUQ C;  3QK0 A;  4GDL A;  2JSV X;  2Z0D B;  3CMM B;  4GXB A;  4IM2 A;  1FXI A;  4DDI D;  1I4Q A;  1EF1 A;  3QCA A;  4ARI A;  4AWJ A;  2GBM A;  2SEB D;  3NZU A;  3ZO5 B;  2MEK A;  2WXJ A;  5FKA C;  4HCN B;  3N1Y C;  4LNI A;  2J7Q B;  2WX0 A;  2ZPN A;  4XX5 A;  2WYQ A;  2WNM A;  1PQS A;  1KM7 A;  3ZXR A;  1YN3 A;  4G11 A;  4JWS C;  2WXN A;  1WX8 A;  4YSX B;  3O65 B;  1V86 A;  4B0E A;  1TZO A;  3PO0 A;  1R4N I;  2KFJ A;  4DHZ E;  4BBN C;  2D5G A;  3OG5 A;  2J53 A;  2KYW A;  1WGY A;  2L8J A;  1NEN B;  4MJS B;  1ZPS A;  3RNB C;  5C3J B;  2JUO A;  2YVC A;  1V9J A;  2J4X A;  3ECI A;  3H9D A;  1V97 A;  3RNC C;  2AQ2 B;  3UQA A;  2ONQ A;  2WHI A;  1FCC C;  1WYG A;  2IO0 B;  3C8Y A;  2BYT A;  3RUL A;  1WE6 A;  1C79 A;  5FK9 C;  4G3X B;  3SHQ A;  4TQ0 A;  3IAM 1;  4KV2 A;  2HD5 B;  4KIK A;  2IJ0 A;  3DBL I;  1A70 A;  1N63 A;  1TS3 A;  2N1V A;  3NVY A;  3KVF B;  3AEF B;  2MSE D;  1G6J A;  2K5P A;  1VR9 A;  4MM3 B;  2REX A;  1NDD A;  1VD2 A;  4KKI A;  5JZE B;  2G9H D;  4REZ A;  2BQQ A;  3NZ3 A;  3PLV A;  3AE2 B;  4YTN B;  2Z8L A;  4WJQ A;  3NRZ A;  4HPP A;  1UZX B;  2RDH A;  2KWC A;  4NY0 A;  3ZXV A;  1SGH A;  3VUW A;  2LUE A;  1P1A A;  1C9F A;  2K39 A;  4MEL A;  5E6O A;  1Q0W B;  2K3U A;  2RGF A;  3M95 A;  3NVW A;  1XCQ L;  3P4S B;  2DZI A;  1OGW A;  1N5X A;  2VZK D;  4NAM A;  4WIP A;  4N58 A;  3APD A;  3DOW A;  1Q5W B;  1L0V B;  4EUT A;  2C5L C;  5L83 A;  1SE2 A;  1ZGU B;  3PT2 B;  3VUY A;  2JF5 A;  4WWM A;  3ZDT A;  1OTR B;  2ZCC A;  3ZRF A;  2LXC A;  1F77 A;  4MGK E;  3QJZ A;  1F1H A;  3WAL A;  5IP4 D;  4I6N B;  2PW9 A;  3B9J A;  4MJS A;  1YX5 B;  4KVG B;  4EKU A;  2K6Q A;  1K53 A;  1R4M I;  2W3R A;  2KJ6 A;  5AZF A;  1QF6 A;  2WXI A;  4O1N A;  4BBN F;  1YQB A;  3VHT C;  3NG0 A;  4NPN A;  4RCO A;  2XN9 C;  2LVP A;  1P3Q U;  1GB1 A;  5IOI A;  1KJT A;  2Y5C A;  4AP4 C;  3ZJT A;  1NBF C;  3AU4 A;  4E74 A;  1SIJ A;  4JL9 A;  1XCT L;  1K8R B;  4XGA B;  3FAH A;  3IBE A;  5FR3 A;  1NYQ A;  3PZD A;  1V49 A;  4FHJ A;  4RF1 A;  4HVB A;  4ZHO A;  4WWP A;  1YD8 U;  4XDD A;  5AEK B;  4RM9 A;  3TEW A;  2N4F A;  1K50 A;  5EDS A;  3NY5 A;  2MHJ A;  4II2 B;  2IGH A;  1MG4 A;  4RMA A;  2M17 A;  2V3S A;  3AED B;  1GAQ B;  2CJN A;  4MM3 A;  3ZUN A;  3PRP B;  1U4A A;  1J7A A;  2AL3 A;  3AEB B;  1ZE3 D;  2OED A;  5J18 A;  1QOG A;  5TSS A;  3ETR A;  4EZK A;  1AAR A;  2L0T A;  3WAO A;  2GBK A;  3IAS 1;  5DPT A;  4C4V A;  1MHH E;  1RWS A;  2K1F A;  1FEH A;  1UF0 A;  5BYQ A;  5MPO A;  1ET9 A;  4W9C A;  1P0R A;  2K8H A;  2NVU I;  3PHX B;  3BY4 B;  3DQV A;  3QX1 A;  4BKS A;  4RGM A;  5GXG B;  2DYB A;  3M62 B;  3EEC A;  1VJK A;  2K8B A;  5BYS A;  3UGB B;  3MHS D;  4AS1 A;  3CF6 E;  2LVQ A;  1F9J A;  1EU3 A;  2UYZ B;  2KDI A;  4WAA A;  2LMC A;  1QKZ A;  5IN7 A;  2LUM A;  1OFF A;  2BS2 B;  1SJH D;  2QIE B;  1UWM A;  1IBX B;  1WI0 A;  1JRP A;  3DPD A;  1SE4 A;  1OQR A;  3IG3 A;  2LGY A;  1HEZ E;  1ROE A;  3H6N A;  3VH3 B;  1GNU A;  1V6E A;  3VFK A;  4WJN A;  3BWU D;  4XYC A;  3WAP A;  2JRH A;  1WH3 A;  1WR1 A;  2WDR B;  4DDG D;  2OJR A;  2VZK B;  3HHM A;  2HJ8 A;  1E6E B;  1WIA A;  1ISN A;  3PRZ A;  4JIO U;  4PS8 A;  2LHE A;  1TBE A;  2CHZ A;  3GB1 A;  2WGS A;  3MC9 A;  2RSU A;  3BYY B;  3P63 A;  3Q8C A;  2JYE A;  3VR8 B;  3LDZ E;  2KQS A;  2R61 A;  4RGO S;  3AV8 A;  2E3T A;  3Q8E A;  3L17 A;  1V5T A;  1L6U A;  4URK A;  2W3S A;  2ASQ A;  1E10 A;  1E90 A;  3HVZ A;  1GC7 A;  3UIN B;  1ENF A;  2RPQ A;  2KVZ A;  2D10 A;  4LNF A;  2IPK D;  3HIZ A;  2N9L A;  1EF5 A;  4OHJ A;  5HFY A;  3GS2 A;  3I3T B;  1N5W A;  1UGJ A;  2L52 A;  4CQN A;  4W9D A;  3DBH B;  2L05 A;  4FHK A;  1H4R A;  3OJ3 A;  3KQ4 A;  3UQB A;  1QT9 A;  2PE9 A;  4NJ6 A;  3VRB B;  2L7R A;  2FUH B;  5LXI B;  2ZW1 A;  2W82 A;  1R4N B;  4N59 A;  4RNA A;  3DHI C;  4JGH B;  2O6V D;  1D3Z A;  5KHQ A;  4GIV A;  1KF6 B;  3DDC B;  1E9M A;  3JSV B;  2KDE B;  3VTV A;  4E71 A;  2IO1 B;  3P4Q B;  1WFY A;  4C56 C;  2J0J A;  3PTF C;  5EE0 A;  5IA7 A;  2V3N A;  1YJJ A;  2BS3 B;  1PFD A;  2Z0E B;  3VH4 B;  1MI0 A;  3DVN U;  3ABV B;  2JXX A;  2OOB B;  1WXV A;  4S0R A;  3ZDM C;  4KKJ A;  3N20 C;  4IM3 A;  1WMH A;  4MH8 A;  2AQ1 B;  4LNK A;  5DPS A;  4B9K A;  2PIA A;  1J0G A;  4OW0 A;  4A3P A;  2KQ7 A;  1WJN A;  1M94 A;  4MT5 A;  4HPM B;  1IBX A;  4S17 A;  1CK1 A;  3N1X C;  2V4L A;  2D3C A;  3IT6 B;  3L0W B;  5BO4 B;  1N61 A;  1KFY B;  3ZNH B;  3EFU A;  3KUC B;  3NZS A;  1I4G A;  4IKG A;  2WXR A;  5I4D A;  2RDG A;  2KMC A;  2WP9 B;  4LLG M;  2WX1 A;  4YSY B;  1RAX A;  4FUL A;  3KWL A;  3VAW A;  1STE A;  3Q3J A;  3QHT A;  1QOF A;  4RGT A;  3DVG X;  2EKI A;  1TS4 A;  3QQ8 B;  1SXT A;  1OEY A;  4MGI E;  2LFI A;  4G50 A;  3URY A;  5AZG A;  4K81 A;  1P98 A;  4GSW A;  3MC8 A;  4M00 A;  3EHV A;  3NS8 A;  1WJ4 A;  2Z59 B;  1SIF A;  2FE8 A;  3U7Z A;  2KC2 A;  1N60 A;  2H88 B;  1TJE A;  1XEE A;  2KO3 A;  1I4X A;  2DAJ A;  2MBQ A;  1PYW D;  4HCP B;  4LCD E;  2QMT A;  4USA A;  4IM0 A;  3RNG C;  4HEA 1;  5TR5 A;  4W9I A;  4F1S A;  1BXT A;  1WZ3 A;  2WXL A;  3V62 A;  4CO7 A;  1TTN A;  4G0N B;  1T5X D;  3VTU A;  2R2O A;  3MJ5 A;  1LQB A;  2ZZP B;  4RGN A;  3N32 A;  3PGE A;  1LXD A;  2D2Q A;  4MSM B;  2DWQ A;  1KOT A;  3HM6 X;  3RD2 A;  2EMS A;  1TZ1 A;  1YQ3 B;  3JSV A;  3B1L X;  1TGZ B;  3BVG A;  5E6P A;  4EOY A;  4GN1 A;  1C4C A;  3O13 A;  3AE9 B;  1TT5 B;  4IDI A;  3FIL B;  2KX0 A;  3U30 A;  4C7Z A;  3I63 C;  1BML C;  3ML9 A;  1JRU A;  5DCN A;  1WRD B;  2JVC A;  4HPL B;  2DYM A;  4AJW A;  5JHB A;  1WGK A;  1TS5 A;  4ZDV A;  3P42 A;  1YN4 A;  4F7Z A;  2MW5 A;  1J7B A;  2K9X A;  4K7W A;  3U2S C;  1F2R I;  2O6V B;  1ZXH A;  2Y3A A;  5EE3 A;  1MFW A;  2V0G A;  3DBH I;  4BZA A;  1XF5 L;  2PLP A;  3QAR A;  4KSL C;  2EEL A;  2WS3 B;  2W54 A;  1DYQ A;  3KYD D;  4XDC A;  1RLF A;  2WWZ A;  4LDT D;  2ZW0 A;  4WWO A;  4US9 A;  2CU1 A;  2INP E;  4EE2 A;  1D6E C;  3I9V 1;  4TKN A;  4M8M A;  1HA5 A;  3RI7 C;  2WXK A;  3LJ3 A;  4FJV B;  2MP2 A;  3L4P A;  3GOE A;  1WR6 E;  4NNJ B;  1HTO A;  3HVD A;  2KXJ A;  1I4H A;  2D3B A;  1LGR A;  1UNS A;  3Q3F A;  3SU8 X;  4UDU C;  2ZNV B;  2KZR A;  2G4S A;  4RF0 A;  4CYE A;  1EO6 A;  2PVG C;  1AYF A;  1A5R A;  2NCN A;  2B76 B;  3VTW A;  2NTT A;  4KZ0 A;  2CS4 A;  3T9L A;  1FFV A;  4KZC A;  2KDB A;  3CWI A;  5LLI A;  3UF8 A;  2DHZ A;  2JU6 X;  3ZTC A;  1E8Y A;  4L2Y A;  1C4A A;  4N6E B;  2KLC A;  1CMX B;  1WF9 A;  1GB4 A;  4IW0 A;  2MBE A;  3ENE A;  2OJW A;  1WM3 A;  4KSK C;  3R2T A;  2KKC A;  3J9C A;  1FRR A;  4RFB A;  3P2B A;  2WDV B;  4ACF A;  2M1M A;  1YIW A;  4TSS A;  2MA9 B;  2TSS A;  2N9X A;  4PT5 A;  4KDL B;  1FFU A;  1RYJ A;  1UGM A;  2BYF A;  4HXD A;  2FCQ A;  3ONS A;  1HZ6 A;  1WGG A;  3ZJU A;  2I38 A;  2WXG A;  3FIL A;  1WGD A;  2KWU B;  2GMI C;  4ZOH C;  2ZCB A;  4HLE A;  4ANW A;  4M8N A;  1TKE A;  2Y5P A;  3IVF A;  4MH0 E;  1B1Z A;  1S1Q B;  4A55 A;  2KC1 A;  2ZNV C;  4XWT A;  3RT3 B;  2HDE A;  1F52 A;  2XK5 B;  2O6V A;  3V6E B;  1DGJ A;  1E8X A;  3KLS X;  1FMA D;  1SE9 A;  3BII D;  3CIR B;  2KN5 A;  2YLM A;  1QIL A;  4I6L B;  3H7S A;  1OQY A;  2M0A A;  3IT4 B;  3QA8 A;  1I42 A;  4YT0 B;  3SD5 A;  3E9S A;  4RM8 A;  1NI2 A;  2UU7 A;  2N7J A;  1GUA B;  4GDK B;  1KH0 A;  3JVZ X;  3PZ8 A;  3MTN B;  1V1O A;  4K3C A;  3PVL A;  1SJE D;  1KRH A;  3IHP C;  2VH1 A;  3NOB A;  1K51 A;  3U4E G;  1PGA A;  3HM3 A;  2WXP A;  2GBR A;  3W5U B;  3X0W A;  4F8C B;  5EE9 A;  4P1B C;  3RPF C;  3A4R A;  3PRE A;  5G2N A;  1QZE A;  2L1A A;  4K3B A;  4FBJ B;  4WUR A;  2ICI A;  2KT7 A;  5J17 A;  1J19 A;  3RN9 C;  3AE5 B;  2DZJ A;  1GPX A;  3L08 A;  1WZ0 A;  2AQ3 B;  2GB1 A;  3T3O A;  3FC4 A;  4B95 A;  3R3M A;  1FXA A;  2KAC A;  4FJZ A;  1UWX A;  2LGD A;  4LDT B;  3I57 A;  1PGB A;  1MG8 A;  3Q8B A;  3R7R A;  2LHD A;  1ZOY B;  2LZ6 A;  3X23 A;  1P9D U;  1EM7 A;  1FCL A;  1UUP A;  2N7E A;  1JW9 D;  4LNN A;  5BMI A;  3S2A A;  1BUI C;  1JML A;  3RFZ B;  3B0A A;  5D3D A;  4ICU A;  4ANV A;  2W9N A;  1LM8 B;  3AE1 B;  1GJZ A;  2FCM A;  2ZVO A;  2MRP A;  2FAZ A;  4ZHP A;  1YN5 A;  4LJP B;  2FBW B;  2BPS A;  2KJH B;  3L10 B;  2MJ3 A;  2R2Q A;  1Y56 A;  4KGT A;  3IFW B;  2NBU A;  3I5J C;  1BT0 A;  1PGX A;  3N1Z C;  1C77 A;  2XK5 A;  1ZXI A;  3GE3 C;  1ZKH A;  5HHD G;  3A9J B;  2PJH A;  2DZM A;  1RFA A;  2PPH A;  1SE3 A;  1YOV B;  1WXQ A;  1E7V A;  3T3N A;  4DK5 A;  2RMM A;  2KD0 A;  1WJ6 A;  4GDK A;  2WU5 B;  2XBB C;  4FAD A;  1C3T A;  1IYF A;  3RUI B;  3KYC D;  4WQO B;  1GC6 A;  4BFR A;  3QWZ B;  2HE7 A;  1EU4 A;  3AU5 A;  3RNF C;  3OLM D;  3TBL D;  2KFK B;  3AEE B;  2IY1 B;  4W9G A;  4W9H A;  1V5O A;  4J6I A;  1WX9 A;  2INN E;  2BT6 A;  1WXM A;  3PSE B;  1WE7 A;  2L0F A;  2BW2 A;  2G4D B;  5JH5 C;  2DLB A;  3PPA A;  5BMG A;  2JWU A;  3K9O B;  2CKH B;  4PS3 A;  1UEL A;  5DPR A;  1ET6 A;  4ZYS A;  4BKT A;  1EWY C;  2VRR B;  3RMK C;  2KK8 A;  2L00 B;  2BYE A;  1H8C A;  3R2I A;  3VQI A;  4TV3 A;  2WXM A;  2CHW A;  4JQW C;  4NQK E;  3AXC A;  4OVV A;  1X1M A;  1L7Y A;  3Q3O C;  1DOI A;  2L83 A;  2PE6 B;  2KWD A;  4NQL B;  1V1P B;  3EFC A;  2IDY A;  4ANX A;  2KMM A;  1C4P A;  2WXF A;  3TEY A;  2KHW B;  1WXA A;  4WJP A;  1Q10 A;  2I1K A;  2BWF A;  2RD0 A;  3BIN A;  4C00 A;  1FNU A;  1D4B A;  3P4R B;  1WM2 A;  2LGS A;  2NBV B;  4AOF A;  1RFK A;  1NYR A;  3A4S C;  5AUI A;  1E7P B;  2D3A A;  1TYG B;  3Q69 A;  4IWQ A;  1KLG D;  1VCB A;  1L6V A;  4NZL B;  4HKQ A;  2N0S B;  3GZN B;  1D5X C;  1T0S C;  2IYD B;  1E8Z A;  4HRO A;  4DXF A;  1JAL A;  3MJW A;  4DWF A;  2N7D A;  1WRI A;  1CQV A;  3QAQ A;  3TL5 A;  3VUX A;  1B9R A;  2LXA A;  2JQR B;  4ASW C;  1FPY A;  2SAK A;  1TKG A;  1VLB A;  2DBY A;  3TUO A;  3WA0 A;  2KTR B;  3Q3M C;  2NTS A;  3RZF A;  1T0Q C;  1MHX A;  3PS6 A;  3VR9 B;  3RNE C;  2CR5 A;  1XLO A;  5C1Z A;  2IGG A;  3BK2 A;  4GB9 A;  2JRI B;  3ZW3 A;  1XLN A;  2PMV A;  2C7H A;  3IXS A;  4K1R B;  1ZDX A;  1F2R C;  1FNV A;  2JX5 A;  4R3D A;  1YMH E;  2KFK A;  2MQJ A;  2QSD A;  3H8H A;  3ZLZ A;  4GU2 A;  5D94 A;  4DXA B;  2MWS B;  4Q2J A;  1UH6 A;  1FXT B;  3M63 B;  4IWP A;  2CJO A;  3Q8A A;  1XQQ A;  3A9K B;  3MP9 A;  3BYT B;  3W1Y A;  4HKZ E;  1L0X B;  2BWE S;  2J0M A;  1EUV B;  2MLB A;  3KH0 A;  1V81 A;  2Q5W D;  2HTH A;  2WXO A;  5C23 A;  4J3O D;  5LNK 1;  1V1P A;  2BKF A;  3L54 A;  1WSP A;  2X8X X;  4B0M A;  2Y5B B;  2ZEQ A;  3UI3 A;  3TMP B;  4JPS A;  4BVU C;  2IO2 B;  2KDF B;  4DBG A;  1XT9 B;  2V9H A;  2LEK A;  3N3K B;  1C78 A;  1V8C A;  4MGY E;  3ZJV A;  4H2A A;  4M0W B;  2FID A;  1FNW A;  2HTM E;  1UBQ A;  1R7S A;  3M3J A;  4L1B A;  4B6W A;  1HE8 A;  2KVR A;  2MBO A;  3DHH C;  3DWM A;  5AUK A;  1VZ8 A;  3VVW B;  2W55 A;  2IND C;  2GOW A;  1JQ4 A;  2V4I B;  3AH7 A;  2RDB C;  5IAA C;  3ML8 A;  3JW0 X;  4YXD B;  4IUM B;  2DAF A;  2KTR A;  1AWD A;  1ACC A;  1J7C A;  4P7I A;  1HZ5 A;  1XLP A;  1KLU D;  2GRI A;  3V60 A;  4OZC A;  3HRD D;  4II3 B;  1LFD A;  2KWV B;  4LJO B;  2C60 A;  4CHK A;  3AE6 B;  4RH6 A;  2LRU A;  2YEP B;  3LYY A;  4JX1 C;  4HK2 A;  3JYU A;  4E3C A;  4ARC A;  3EC8 A;  3AE7 B;  1ZP0 B;  3HK0 A;  1YNT E;  2JPH A;  2DNF A;  5BYR A;  2D11 A;  3Q6B A;  2MCN B;  4EEW A;  3TIX A;  2LJI A;  1SF0 A;  2B3A A;  2K25 A;  1NEK B;  3DVN V;  5CHV C;  2I2Y A;  3N30 A;  3RCZ A;  4KDI C;  2FIF A;  3APC A;  2AEH A;  3C19 A;  3TSS A;  1VRA B;  3AE8 B;  2BGF A;  3AM9 A;  1QQR A;  3DBS A;  3A9K A;  1T0R C;  2IBI B;  3WAN A;  3GZN I;  2IGD A;  3A1Q B;  4A90 A;  1WYW B;  3EGR A;  4I6P A;  2DZK A;  1I4P A;  4OZB A;  3AUL A;  1JCK B;  5D3I B;  3GP7 A;  4EFO A;  4OVZ A;  5CHF A;  3UIP B;  3ZQ4 A;  2MJD A;  2QJL A;  1CJE A;  4ZRJ A;  4PK1 A;  4A8X C;  1HQR D;  2QHO A;  2BS4 B;  3WAM A;  4TMA B;  2A5U A;  1F0Z A;  5D6J B;  3WIM A;  4PYU A;  2FCS A;  5T8I A;  4DHJ D;  4IG7 B;  1JWA D;  4W9F A;  4ZRI A;  3ZIM A;  4WWN A;  1HXY D;  4ZRK A;  4M0W A;  2QEJ C;  1DOX A;  1M4V A;  3W5V B;  1C1Y B;  2M19 A;  4YSZ B;  4L23 A;  4PYZ A;  2G3Q B;  3ZKJ C;  1N6Z A;  3ZGZ A;  3NJT A;  4HJG E;  3R7Q A;  4NAW B;  2LAS A;  1JWS D;  1J8C A;  2G45 B;  1IPG A;  4QAY A;  3TCA A;  2DEN B;  1L5P A;  1HTQ A;  2UWQ A;  1ZW7 A;  4HWI B;  2BB5 A;  3Q3N C;  3KW5 B;  5L95 C;  4HRS A;  4NJC A;  1CZP A;  5KHO A;  1L2N A;  1WX7 A;  1WGR A;  5JXV A;  2RR9 A;  4N9F 4;  2QCZ A;  4DXG A;  2KDM A;  3AB5 A;  1SBB B;  4JWU C;  3AEG B;  1MJD A;  1TIF A;  1WJU A;  4A9A A;  4ZRQ A;  4C4V B;  4ANU A;  2GLS A;  2N9E B;  1TY2 A;  1SSN A;  1S3S G;  4K7S A;  4MGZ E;  3P4P B;  2N1W A;  3OAW A;  1JWU D;  5EE1 A;  4TQ1 A;  5AZH A;  2O2V B;  3A1Q A;  3H7P B;  2WQY B;  4W9K A;  2NMQ A;  2JZP A;  3PHW B;  2ZVN A;  2ZJD A;  3PV1 A;  1NVI D;  2K8C A;  3MC0 B;  3LXF A;  2KAN A;  2D3G A;  4M02 A;  5G55 A;  2JY6 A;  2PVO D;  2PKO A;  2DYO A;  1PUT A;  3DWG C;  4IWO A;  5DPW A;  3WCQ A;  2A4Z A;  2EMT A;  1IP9 A;  1WWT A;  2J42 A;  3RZW C;  2L3Z A;  2QDF A;  1OEY J;  1E0Z A;  3B08 A;  1T6B X;  3FKY A;  2MJE A;  1TY0 A;  1VZ6 A;  2JYT A;  3DHG C;  1YJI A;  4KX6 B;  2LRW A;  1JWB D;  1TKY A;  1OQQ A;  4JLC A;  2FUG 1;  5CHW A;  3DCG A;  3HUI A;  3DBR B;  1MVK A;  1V2Y A;  2X38 A;  4W9J A;  4FLH A;  5D7G A;  5G5G A;  1DOY A;  5G5H A;  4A6Q A;  4XC2 A;  5D2M B;  1MPE A;  2YEP F;  4NAW A;  4BKG A;  1RRB A;  1YQ4 B;  4DHZ B;  1KLV A;  2XEW A;  1NI3 A;  1QOB A;  2WDT B;  1I35 A;  4ZYN A;  1AW7 A;  3SFD B;  2JT4 B;  2BTE A;  4BAX A;  4C7Y A;  1FO4 A;  1ZUD 2;  5C2T B;  2XNA C;  3D32 A;  3RNA C;  3Q2A C;  3U8Z A;  1WXS A;  2GI9 A;  2PEA A;  1VZ7 A;  3AE3 B;  5IKC M;  1L0Y B;  4IC7 B;  3GE8 C;  1FM0 D;  5LXH A;  5H8Y E;  1E8W A;  3Q14 C;  4DHJ B;  3AI5 A;  3NUH B;  3AEA B;  4FXC A;  3NVZ A;  4FN2 A;  4EZL A;  2WU2 B;  4YWG G;  4WQM A;  1T3Q A;  4FA6 A;  3KUZ A;  2WXQ A;  3U52 E;  2OHF A;  1XO3 A;  3TEX A;  4A3O A;  1JRO A;  2NPT B;  3ZTD A;  1Y8R C;  4YL8 A;  1D5Z C;  4BOZ B;  3SEB A;  3TEZ A;  2MBH A;  2C9W B;  1ZDV A;  4LNO A;  5E6J A;  3BVM A;  3NHE B;  1TS2 A;  2WDQ B;  2JZZ A;  2O2V A;  3H7P A;  2KLG A;  2LGI A;  1T0Y A;  2NS5 A;  1WMH B;  1QLB B;  3PLU A;  2BF8 B;  3UIO B;  2AL6 A;  5BMH A;  1YJ1 A;  3EA6 A;  2MBB B;  1JWM D;  4XZ4 A;  3AN1 A;  3SFE B;  2GBN A;  4M01 A;  2AYO B;  4LK0 M;  4NJ7 A;  3N9Y C;  4AJY B;  3W1S C;  3QC8 B;  4OZA A;  4MEM A;  2IY0 B;  2MH7 A;  2KMA A;  2EKE C;  1IUE A;  2BB6 A;  5CTR C;  5HG2 A;  3Q8F A;  4XWW A;  5HI1 A;  3SR6 A;  4K7U A;  4JE3 B;  2NR2 A;  2KJR A;  4MAC A;  3ZNI D;  2FNJ B;  2V3P A;  3KUD B;  1VDV A;  4P6V F;  2MX2 A;  3ZVV A;  1V80 A;  4W9E A;  1K52 A;  4ZRP A;  2KAJ A;  2KX3 A;  4A20 A;  2LVO A;  1I7H A;  4MSQ B;  1D5M C;  2G1E A;  2IZV B;  4D2K A;  2D07 B;  3CSF A;  2INC C;  3EUB 2;  3ZNG C;  1ESF A;  1IGD A;  4HJK A;  1GG3 A;  4HDQ A;  1E7U A;  4OVU A;  4TUU A;  3W1S A;  3ZNZ B;  4W9L A;  1P7E A;  2N9K A;  3BK1 A;  4AQ7 A;  2N9P C;  5GMV A;  1Z2M A;  2KNB A;  2GBJ A;  2M0X A;  1UD7 A;  3V3X A;  3A9J A;  2C7N B;  1GOZ A;  2CU3 A;  3H1U A;  3E56 A;  3BZD B;  1WY8 A;  2KTF A;  2FCN A;  4X57 B;  2NPT A;  4GLS C;  1E5W A;  4PS7 A;  3TJP A;  3DBR I;  2WXH A;  4P1C C;  4MDK E;  2ON8 A;  3A33 B;  1XLQ A;  4ITK A;  2ACZ B;  4GGQ A;  3W9C B;  2LI5 A;  4XE0 A;  3VDZ A;  4GDL B;  2C7M B;  2LD9 A;  2M56 B;  3KWV A;  4YTP B;  2QIL A;  3B2F A;  4YTM B;  2V1Y A;  1SEB D;  1LO5 D;  1EWC A;  2BYV E;  3NS1 A;  2QC8 A;  1L4Z B;  2M4N A;  5JHA A;  3V61 A;  1YX6 B;  1UBI A;  1XXG A;  3OWE B;  3W2D A;  3DBL B;  3R66 C;  2BVC A;  4C80 A;  2E6X A;  4EZJ A;  2ZPY A;  1AN8 A;  3CST A;  2K0P A;  3APF A;  4LTU A;  3L16 A;  3MHZ A;  1KTK A;  2I1J A;  1PDX A;  1N62 A;  3C0R B;  1Q1O A;  3ZRC A;  3L13 A;  3VRA B;  3AE4 B;  2CHX A;  3QIJ A;  3OJ4 B;  2JXT A;  1FD6 A;  5IO9 A;  1WGH A;  2WLB A;  2KOX A;  3AMZ A;  3T8M A;  1FRD A;  2AX5 A;  5J2R A;  2KQ4 X;  3MFG A;  3R8B A;  3ALB A;  5CX3 A;  2JZ3 B;  1QOA A;  3K9P B;  2MP2 B;  5HKH A;  2LWP A;  1C76 A;  3NVV A;  1FIQ A;  1IGC A;  2LJ5 A;  2M8S A;  2VH2 A;  2J0K A;  4GOC A;  2L32 A;  3PZ7 A;  3LB8 C;  3P1M A;  1XD3 B;  3DVG Y;  5FR6 A;  4GMV A;  1RM6 C;  3ZYY X;  2HJ1 A;  2K22 A;  3U7D A;  4WJO A;  1P7F A;  4US8 A;  4FJY A;  2DX5 B;  1I4R A;  2PTL A;  2KN4 A;  3V05 A;  4DQO C;  4WAF A;  3V6C B;  4KIK B;  3RYT A;  3BVZ A;  1Z5S B;  2NBW B;  3B2G A;  4KGS A;  4BKS D; 
#chains in the Genus database with same CATH homology
 4N59 A;  4RNA A;  4ZHP A;  1YN5 A;  4HRS A;  2FBW B;  4NJC A;  1CZP A;  1KF6 B;  2MJ3 A;  1L4D B;  1Y56 A;  4KGT A;  2H89 B;  5JXV A;  1E9M A;  3P4Q B;  4C56 C;  4P16 A;  1SB3 C;  4DXG A;  1PGX A;  4KGR A;  2KDM A;  5EE0 A;  2V3N A;  1YJJ A;  3AB5 A;  1SBB B;  1C77 A;  3AEC B;  2BS3 B;  4IOI E;  4JWU C;  3AEG B;  1PFD A;  4WH4 A;  2BBC A;  4A9A A;  1ZXI A;  1MI0 A;  4ZRQ A;  5HHD G;  2J52 A;  2RPV A;  5H92 C;  3ABV B;  1TY2 A;  1SSN A;  2JSV X;  1SE3 A;  1WXQ A;  4KKJ A;  1FXI A;  3T3N A;  1I4Q A;  2RMM A;  4ARI A;  2WU5 B;  2SEB D;  4MH8 A;  3P4P B;  2AQ1 B;  2MEK A;  2WXJ A;  5FKA C;  2PIA A;  4OW0 A;  1JWU D;  5EE1 A;  4MT5 A;  1IBX A;  4TQ1 A;  1CK1 A;  1EU4 A;  2WQY B;  2NMQ A;  2JZP A;  3AEE B;  3IT6 B;  2WNM A;  2ZW1 A;  1YN3 A;  1N61 A;  2INN E;  1KFY B;  1NVI D;  2BT6 A;  4JWS C;  2WXN A;  3MC0 B;  1I4G A;  3LXF A;  4IKG A;  2WXR A;  5I4D A;  2BW2 A;  2RDG A;  4LLG M;  2WP9 B;  2PVO D;  2PKO A;  2DLB A;  4YSY B;  5BMG A;  3KWL A;  2JWU A;  4YSX B;  2DYO A;  1STE A;  1PUT A;  1TZO A;  3PO0 A;  4B0E A;  1QOF A;  3DWG C;  3WCQ A;  4RGT A;  1ET6 A;  4ZYS A;  1EWY C;  2EKI A;  1WWT A;  1TS4 A;  2J42 A;  2D5G A;  2J53 A;  1SXT A;  2LFI A;  1E0Z A;  1NEN B;  1ZPS A;  3URY A;  5C3J B;  1T6B X;  3R2I A;  2MJE A;  3VQI A;  1TY0 A;  1VZ6 A;  2JYT A;  2J4X A;  1YJI A;  4KX6 B;  1JWB D;  2WXM A;  1TKY A;  1V97 A;  2AQ2 B;  1OQQ A;  2FUG 1;  2FE8 A;  1DOI A;  2L83 A;  2KWD A;  2ONQ A;  3HUI A;  3U7Z A;  1V1P B;  1MVK A;  1N60 A;  2IDY A;  2H88 B;  1TJE A;  2X38 A;  2KMM A;  1C4P A;  1FCC C;  1XEE A;  1WYG A;  5D7G A;  3C8Y A;  2WXF A;  3TEY A;  5G5G A;  2BYT A;  1I4X A;  1Q10 A;  1DOY A;  5G5H A;  4A6Q A;  1PYW D;  1C79 A;  5FK9 C;  1FNU A;  1D4B A;  1MPE A;  2QMT A;  2YEP F;  4USA A;  4TQ0 A;  3P4R B;  3IAM 1;  4HEA 1;  1YQ4 B;  1RFK A;  2IJ0 A;  1NYR A;  1NI3 A;  1QOB A;  5AUI A;  1BXT A;  1E7P B;  2WXL A;  1AW7 A;  3SFD B;  2BTE A;  4C7Y A;  1FO4 A;  1TYG B;  3Q69 A;  1KLG D;  1ZUD 2;  1T5X D;  5C2T B;  1A70 A;  1L6V A;  2XNA C;  1N63 A;  3MJ5 A;  4NZL B;  1TS3 A;  4HKQ A;  4RGN A;  2N0S B;  2DWQ A;  2GI9 A;  1VZ7 A;  3AE3 B;  3NVY A;  1D5X C;  1L0Y B;  3AEF B;  4HRO A;  4DXF A;  1FM0 D;  1JAL A;  2K5P A;  1VR9 A;  1YQ3 B;  4MM3 B;  5H8Y E;  1WRI A;  1CQV A;  3BVG A;  1B9R A;  4KKI A;  2G9H D;  2JQR B;  3NUH B;  2SAK A;  1TKG A;  1C4C A;  3AEA B;  3O13 A;  1VLB A;  3NZ3 A;  3AE9 B;  4FXC A;  2DBY A;  3NVZ A;  3TUO A;  4IDI A;  2NTS A;  3AE2 B;  4YTN B;  2WU2 B;  2Z8L A;  4YWG G;  3FIL B;  4WQM A;  1MHX A;  1T3Q A;  3NRZ A;  3VR9 B;  4C7Z A;  1BML C;  2WXQ A;  1XLO A;  3U52 E;  2OHF A;  1XO3 A;  2RDH A;  3TEX A;  1JRO A;  2IGG A;  3BK2 A;  2DYM A;  1WGK A;  1TS5 A;  1C9F A;  1D5Z C;  3SEB A;  2K3U A;  3P42 A;  3TEZ A;  1YN4 A;  1XLN A;  3NVW A;  2PMV A;  1ZDV A;  1XCQ L;  3P4S B;  5E6J A;  3BVM A;  1J7B A;  2K9X A;  3U2S C;  1F2R I;  1TS2 A;  3IXS A;  2WDQ B;  1N5X A;  1ZXH A;  1ZDX A;  1F2R C;  2VZK D;  4NAM A;  1FNV A;  2JX5 A;  4R3D A;  1YMH E;  4WIP A;  2QSD A;  2Y3A A;  4N58 A;  5EE3 A;  3H8H A;  1L0V B;  2LGI A;  2V0G A;  4Q2J A;  1SE2 A;  1XF5 L;  1QLB B;  2PLP A;  4WWM A;  2CJO A;  2EEL A;  5BMH A;  2WS3 B;  3EA6 A;  2W54 A;  1JWM D;  1DYQ A;  3Q8A A;  1F77 A;  3AN1 A;  4XDC A;  3SFE B;  3MP9 A;  2ZW0 A;  3BYT B;  4US9 A;  4LK0 M;  4HKZ E;  1L0X B;  2INP E;  4EE2 A;  1D6E C;  2PW9 A;  3I9V 1;  3N9Y C;  3B9J A;  1HA5 A;  2WXK A;  4OZA A;  1K53 A;  2W3R A;  3L4P A;  2MH7 A;  3HVD A;  1QF6 A;  2Q5W D;  1IUE A;  1I4H A;  2WXO A;  1UNS A;  2WXI A;  4O1N A;  2BB6 A;  5HG2 A;  4UDU C;  3Q8F A;  4J3O D;  4RF0 A;  5LNK 1;  1V1P A;  2PVG C;  1WSP A;  1AYF A;  4XWW A;  4RCO A;  2XN9 C;  4B0M A;  2B76 B;  5HI1 A;  3UI3 A;  2NTT A;  4JPS A;  3SR6 A;  1GB1 A;  1FFV A;  4JE3 B;  3CWI A;  2Y5C A;  3ZJT A;  4MAC A;  1SIJ A;  2JU6 X;  2V3P A;  4L2Y A;  1XCT L;  1VDV A;  1C4A A;  4P6V F;  4N6E B;  1K52 A;  3FAH A;  4ZRP A;  2LEK A;  5FR3 A;  1NYQ A;  2KAJ A;  4RF1 A;  4ZHO A;  1C78 A;  1V8C A;  4XDD A;  1GB4 A;  3ZJV A;  4H2A A;  3TEW A;  1I7H A;  1K50 A;  1D5M C;  2G1E A;  1FNW A;  4D2K A;  2HTM E;  1R7S A;  3EUB 2;  2IGH A;  3R2T A;  4L1B A;  3J9C A;  1FRR A;  1ESF A;  1IGD A;  4RFB A;  2WDV B;  3AED B;  1GAQ B;  3DWM A;  5AUK A;  1VZ8 A;  2CJN A;  4TSS A;  2W55 A;  1JQ4 A;  3W1S A;  2TSS A;  2V4I B;  3AH7 A;  1J7A A;  4PT5 A;  1P7E A;  3AEB B;  2N9K A;  3BK1 A;  1FFU A;  1RYJ A;  1ZE3 D;  4AQ7 A;  2OED A;  4YXD B;  1QOG A;  5TSS A;  3ETR A;  1HZ6 A;  3ZJU A;  2I38 A;  1AWD A;  1ACC A;  1J7C A;  3IAS 1;  2WXG A;  3FIL A;  1HZ5 A;  1MHH E;  3V3X A;  4ZOH C;  1RWS A;  1GOZ A;  1FEH A;  5MPO A;  1XLP A;  2CU3 A;  5BYQ A;  3E56 A;  1TKE A;  1KLU D;  2GRI A;  3BZD B;  1ET9 A;  2Y5P A;  4OZC A;  3HRD D;  4GLS C;  1B1Z A;  4A55 A;  3AE6 B;  2WXH A;  4XWT A;  4RH6 A;  4RGM A;  2HDE A;  2ON8 A;  2YEP B;  1XLQ A;  3LYY A;  4ITK A;  4JX1 C;  2ACZ B;  1DGJ A;  5GXG B;  3KLS X;  4ARC A;  1FMA D;  3BII D;  3CIR B;  3AE7 B;  1ZP0 B;  3W9C B;  4XE0 A;  1YNT E;  1QIL A;  1VJK A;  4GDL B;  5BYR A;  2M0A A;  3IT4 B;  2M56 B;  2LJI A;  3KWV A;  1SF0 A;  4YTP B;  4YT0 B;  2QIL A;  3B2F A;  3E9S A;  4YTM B;  5BYS A;  4AS1 A;  1NEK B;  2I2Y A;  2N7J A;  3PZ8 A;  1KH0 A;  4GDK B;  1SEB D;  1V1O A;  1EU3 A;  1LO5 D;  3TSS A;  2LMC A;  1VRA B;  1EWC A;  1QKZ A;  3AE8 B;  3NS1 A;  3AM9 A;  1L4Z B;  1QQR A;  1SJE D;  1KRH A;  1XXG A;  2LUM A;  1OFF A;  2BS2 B;  3OWE B;  3W2D A;  1SJH D;  2QIE B;  1UWM A;  1IBX B;  4C80 A;  2IGD A;  1JRP A;  1SE4 A;  1OQR A;  2E6X A;  1AN8 A;  1HEZ E;  2K0P A;  1K51 A;  4LTU A;  1ROE A;  3U4E G;  4A90 A;  3EGR A;  1PGA A;  1I4P A;  4OZB A;  1JCK B;  3MHZ A;  1KTK A;  2WXP A;  3BWU D;  3GP7 A;  5D3I B;  3W5U B;  1PDX A;  5EE9 A;  4OVZ A;  3ZQ4 A;  1N62 A;  2MJD A;  3RPF C;  2WDR B;  3VRA B;  3AE4 B;  2L1A A;  2QJL A;  1CJE A;  2VZK B;  1E6E B;  2JXT A;  4A8X C;  1HQR D;  1FD6 A;  4WUR A;  2ICI A;  2WLB A;  3AMZ A;  1FRD A;  2LHE A;  2AX5 A;  2BS4 B;  3AE5 B;  1GPX A;  3GB1 A;  4TMA B;  2AQ3 B;  2GB1 A;  2KQ4 X;  3MFG A;  3R8B A;  3T3O A;  3BYY B;  3FC4 A;  1QOA A;  3P63 A;  3Q8C A;  1F0Z A;  2JYE A;  1FXA A;  3VR8 B;  2KAC A;  2R61 A;  1C76 A;  3NVV A;  4REZ A;  4RGO S;  1FIQ A;  1IGC A;  2E3T A;  3AV8 A;  3Q8E A;  5T8I A;  1UWX A;  1L6U A;  1JWA D;  2L32 A;  3PZ7 A;  2W3S A;  3LB8 C;  3P1M A;  1E10 A;  3HVZ A;  1HXY D;  4M0W A;  2QEJ C;  1DOX A;  1M4V A;  1ENF A;  3W5V B;  2M19 A;  3I57 A;  1RM6 C;  2IPK D;  3ZYY X;  1PGB A;  4YSZ B;  3Q8B A;  4L23 A;  2N9L A;  2LHD A;  1ZOY B;  2K22 A;  4OHJ A;  1EM7 A;  1FCL A;  5HFY A;  1UUP A;  3GS2 A;  1P7F A;  3ZGZ A;  4HJG E;  4US8 A;  1N5W A;  4NAW B;  1JW9 D;  1UGJ A;  2L52 A;  1I4R A;  2PTL A;  2KN4 A;  3V05 A;  4DQO C;  1JWS D;  4WAF A;  5BMI A;  4CQN A;  1BUI C;  1JML A;  3RFZ B;  5D3D A;  3KQ4 A;  3BVZ A;  1L5P A;  1QT9 A;  3AE1 B;  3B2G A;  4KGS A;  2BB5 A;  3VRB B;  2W82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...