1XLQA

Crystal structure of reduced c73s putidaredoxin from pseudomonas putida
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putidaredoxin
publication title Redox-dependent Structural Reorganization in Putidaredoxin, a Vertebrate-type [2Fe-2S] Ferredoxin from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 28
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature ec 1.9.3.2: Transferred entry: 1.7.2.1.
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xlqA00
2G1EA 4P6VF 1AYFA 1JWAD 1OFFA 3P4QB 4IDIA 2BS4B 2K9XA 3HRDD 3AB5A 1SB3C 1E9MA 1YQ3B 1FRRA 1ZP0B 2PVGC 3AEEB 1OQQA 4N59A 2JQRB 4USAA 1JRPA 1OQRA 1DOIA 2E3TA 2W3RA 1PDXA 2L52A 3AE4B 3WCQA 3AMZA 2WDRB 3ETRA 3SR6A 4ITKA 5MPOA 1SIJA 4HRSA 2Q5WD 3P4SB 1RYJA 1XO3A 3NVWA 1L6UA 1QOBA 1YJIA 2LEKA 3AE6B 3HUIA 4YT0B 2BS2B 3NVYA 1XLQA 4YTNB 1UWMA 4LTUA 4C80A 1J7CA 1ZUD2 3ABVB 3DWGC 1XLPA 1NYRA 1DOXA 1GAQB 3PO0A 1GPXA 3AEAB 1JROA 2K5PA 3B2GA 1CJEA 2B76B 3AE2B 1RFKA 5EE9A 1FO4A 3EUB2 5C2TB 1NEKB 2H89B 2KAJA 2OHFA 3AE7B 2L83A 4JWUC 4ZOHC 2PVOD 1KFYB 2DWQA 3NS1A 3AE1B 5EE0A 1EWYC 2BS3B 5H8YE 4ZHPA 4FXCA 1TKGA 1ROEA 2BT6A 1FRDA 3CWIA 3NVVA 2WDVB 2FBWB 2PIAA 3AEBB 1JWBD 1QOAA 3NVZA 1VDVA 3KWLA 4N58A 3AE5B 3AE9B 4WQMA 1QF6A 1FXAA 1VJKA 1J7BA 2KMMA 1R7SA 1KF6B 2PKOA 1QOGA 3AH7A 4ZHOA 1XLNA 2DBYA 1CZPA 2AX5A 2MJ3A 3W5VB 4YSZB 1E6EB 1AWDA 1SF0A 2WS3B 1L6VA 3AECB 3L4PA 1QT9A 4YTMB 1YQ4B 1N62A 1QLBB 3AN1A 1N5XA 3ZYYX 4YSXB 2EKIA 2WDQB 2WLBA 1WYGA 1N63A 1RWSA 1T3QA 5AUKA 3P1MA 1WWTA 1FFVA 3AEGB 3RPFC 3BIID 2JX5A 2Y5CA 5AUIA 1WXQA 1TKEA 2W3SA 5G5HA 5H92C 3AE3B 2WU2B 3B9JA 2QJLA 1WGKA 2CJOA 3P4PB 4HROA 1E7PB 1L5PA 1B9RA 4C7ZA 4A9AA 3W5UB 4N6EB 2ACZB 2W55A 3P63A 2M56B 3AV8A 3B2FA 3LXFA 2QIEB 1TJEA 2MH7A 3VR8B 5EE1A 1XLOA 1QOFA 1VLBA 3FAHA 5C3JB 1A70A 1N5WA 1TKYA 1ZXIA 1JQ4A 4C7YA 1WRIA 1PUTA 1N60A 3AEDB 1FFUA 4YTPB 1F0ZA 3NRZA 1NVID 1FM0D 3DWMA 2WP9B 3CIRB 1N61A 2W54A 1NYQA 3FC4A 1TYGB 3AEFB 5EE3A 3VRBB 3VR9B 4WWMA 2M19A 2MJEA 3W9CB 3SFEB 5GXGB 1NENB 1J7AA 4YSYB 1PFDA 1I7HA 4YXDB 2N0SB 5G5GA 2MJDA 3AE8B 1E0ZA 2H88B 3LB8C 1DOYA 1ZOYB 1JW9D 3HVZA 4US8A 1V97A 4KX6B 1RM6C 2HTME 1KRHA 1E10A 1JALA 4JWSC 4US9A 1NI3A 1FXIA 2CU3A 1IUEA 4JX1C 1YJJA 3AM9A 1DGJA 1FMAD 2CJNA 2K22A 1V8CA 3SFDB 2WU5B 2WQYB 3VRAB 1FIQA 1L0VB 3P4RB
chains in the Genus database with same CATH superfamily
2KWCA 2BB5A 2L76A 2BS4B 3RUIB 2LGIA 4IWQA 2D5GA 4CO7A 1JRPA 1UBQA 2VZKB 4NQKE 1M94A 1HEZE 3I9V1 3V62A 4KDLB 4C80A 3DWGC 1BT0A 1NYRA 5AZHA 4W9LA 3NG0A 2PE9A 2I38A 2XK5B 2MBHA 1XCTL 3ZXRA 4F7ZA 3EC8A 4JWUC 1WMHB 1KFYB 2C60A 1EWYC 1HQRD 2O2VB 3GS2A 1T0QC 4YTPB 1KTKA 1VRAB 2INNE 3T8MA 1FNVA 5L83A 3IFWB 3HK0A 5BMHA 1EU3A 2AX5A 2ZJDA 2L00B 1C9FA 1EF1A 3V61A 3C8YA 2WDQB 4NAWB 2LGDA 4JGHB 3UINB 2JU6X 5HI1A 3AE3B 1SXTA 4GDKA 4M02A 1YN3A 4WWPA 4C7ZA 1LQBA 2LRWA 3P63A 5IA7A 2KVRA 4RH6A 3MHZA 3B1LX 1EUVB 1S3SG 1GNUA 2DZKA 4HK2A 1JQ4A 4C7YA 3AEDB 4W9IA 4E3CA 2MJEA 2LJ5A 3I3TB 4HPPA 2C5LC 4IKGA 2LUEA 2BYVE 4W9DA 2CHXA 1XF5L 4ZRJA 1KRHA 3FKYA 2G3QB 1WXAA 3VVWB 3E9SA 3PZ7A 2IJ0A 1TZ1A 1I42A 5D3DA 1WJNA 1I35A 3TBLD 4IW0A 4LNNA 3AEEB 4ANWA 1WE6A 2GB1A 1TTNA 4EE2A 3SR6A 2GMIC 4ITKA 3X23A 1T0YA 1WIAA 1GJZA 1ZUD2 1VZ7A 3NOBA 1SE4A 3DVNV 1NEKB 2C7MB 4FA6A 1VZ8A 1D3ZA 2HJ1A 3HM6X 4GOCA 1YN4A 2LD9A 1KLVA 2KOXA 3VH4B 4KIKB 4FBJB 4K3BA 1MHHE 1QOGA 3ZRFA 3S2AA 4ZRKA 2GBMA 4M8NA 4RGMA 5CX3A 2EMSA 2R61A 1WSPA 2D10A 4I6PA 3ZVVA 3IG3A 1C4PA 4LNIA 1SGHA 3BVMA 1P7EA 4OVUA 3C19A 3PVLA 4PS3A 2JYTA 3PLVA 4DHZB 4MGYE 4RGOS 3A1QA 2BWES 1E8ZA 2O6VA 2M56B 4WJPA 2TSSA 3RI7C 1C1YB 2IZVB 2K25A 3URYA 2ONQA 4FJVB 3Q2AC 4L23A 1WGRA 3SFEB 3U4EG 3H1UA 2G4SA 2O6VD 2KACA 2J53A 4US8A 3IBEA 3FILA 1WXMA 5BMGA 1J19A 1UH6A 2BKFA 4RF1A 3QX1A 4BAXA 1AYFA 4A6QA 1SB3C 1C76A 2KD0A 2JQRB 5CTRC 2MSED 2J0KA 4RF0A 2WDRB 4WIPA 3EFCA 1WGGA 1RYJA 2K1FA 2LEKA 2BS2B 3NVYA 3W1YA 1K53A 4OW0A 3N1ZC 5IAAC 3RZFA 3RNBC 3QWZB 2L7RA 1G6JA 4OZBA 3N9YC 1EWCA 2DWQA 3MHSD 1ZE3D 1WI0A 5KHQA 4LJPB 1TKGA 1TZOA 3GE8C 4DDGD 2PIAA 4WAAA 3MC9A 1D4BA 2JRIB 1VR9A 3VUYA 2DLBA 3DVNU 5HFYA 4GB9A 2IO1B 3L0WB 2K0PA 1XQQA 1NDDA 2IGDA 4DQOC 5T8IA 3R8BA 3RD2A 3A4SC 4P7IA 3SEBA 3NY5A 1TBEA 1ZDVA 3V60A 1B1ZA 1Q10A 1UD7A 1L4DB 4G3XB 2JWZA 2WXFA 2D3CA 4RM8A 4DXFA 1HZ5A 4KVGB 1R4MB 3M63B 3BK1A 4WJQA 2ASQA 5LLIA 1MG4A 5DCNA 3NS8A 4A3PA 3RT3B 4JX1C 2WXLA 2WXJA 4IM2A 3QA8A 4G0NB 2WU5B 3A9KB 4HLEA 2WXMA 4IM0A 3JYUA 3AULA 3CF6E 2BGFA 3OAWA 2ZPYA 3APFA 4HRSA 3L16A 3U7ZA 1YJIA 4YTNB 2I2YA 1XLQA 1GC7A 1GB4A 2R2OA 3PO0A 1ENFA 1CMXB 1R4NB 2ZVNA 2KN4A 1RFKA 1L4ZB 4LDTB 3H7PB 3PPAA 4WQOB 3TEYA 4FXCA 4BOSC 3VDZA 4TMAB 1VDVA 2KQ4X 4N58A 3AE9B 1C78A 3C0RB 1K8RB 4HXDA 2FUG1 4BZAA 2PKOA 4FHJA 2OJWA 2LGSA 4XWTA 4ZHOA 4AQ7A 1EO6A 4MACA 2KFKA 2K8HA 3PREA 1V80A 2PPHA 2WXPA 4RFBA 5AEKB 2KDFB 1ZPSA 1FFVA 4K7UA 3IT6B 2AWTA 2M0XA 2JSVX 2G4DB 3TCAA 4C00A 3UIOB 5FR3A 1HE8A 2JF5A 2PW9A 5D94A 3ZJTA 1V6EA 1P1AA 1ACCA 3TL5A 3ZJUA 2ZZPB 1J7AA 3IAM1 5J17A 4HCPB 5C1ZA 1WRDB 1QILA 3AU4A 1E90A 2HJ8A 2L0FA 1C4AA 4KV2A 3P4RB 3P4PB 3Q8FA 4P6VF 3K9PB 3Q3FA 2LGXA 2QDFA 2IPKD 4S17A 3K9OB 3HVDA 2KDIA 1WYWB 3GE3C 1JWMD 3AE6B 2M17A 5J18A 1SJHD 2MP2B 2KWUB 4LNOA 1VD2A 1WZ0A 2J4XA 2PVOD 2QCZA 3ZIMA 4REZA 1MVKA 2BT6A 4DHJB 4HKZE 3QARA 5LXHA 2GBJA 3DVGX 1R7SA 3JSVA 3ZO5B 1CZPA 4WH4A 2N9LA 2MCNB 3N32A 1L6VA 1SE2A 4IM3A 4MGIE 3RNCC 2WLBA 2DZMA 2NTTA 3IVFA 2KK8A 2JX5A 2MHJA 2MQJA 2K39A 5D6JB 4M8MA 1D5MC 2IO3B 4HVBA 4KZ0A 4WWOA 3UGBB 1V5TA 1ISNA 4ANUA 3WIMA 2I1JA 4AJWA 2MA9B 1FCCC 3EECA 3U52E 2PE6B 3DVGY 4RMAA 5IP4D 1FPYA 2N7DA 1TS5A 1UELA 2WXHA 3ZDMC 1TIFA 2VH1A 3BYTB 3R7RA 4TUUA 3WAPA 1NI3A 1QQRA 1IUEA 2NPTB 3BVZA 1L0VB 4PS8A 1E8YA 2RGFA 1ESFA 2IGHA 4NQLB 2WXGA 3SD5A 2PVGC 3DBRI 2KQ7A 3HIZA 2L52A 2Y5BB 2HTHA 4XE0A 2Z0EB 2HDEA 1K50A 3GP7A 1XO3A 2N9XA 2Y5PA 2FIDA 4NPNA 3AI5A 3MTNB 1GPXA 1P98A 4XZ4A 3QJZA 4OHJA 2B76B 3NHEB 4L1BA 5EE9A 1M4VA 3EUB2 4II3B 2ZW0A 2KC2A 3Q14C 3JW0X 1V1PB 1ROEA 4H2AA 2FBWB 2KLCA 4M00A 4MH8A 5JZEB 5EDSA 2IYDB 3H7SA 3MP9A 2EMTA 3RPFC 2BW2A 2UWQA 3MFGA 5LNK1 2N9EB 1T0SC 3VQIA 2WXQA 1WGKA 1RLFA 2KZRA 2W55A 2N4FA 1D5ZC 2AEHA 3LXFA 2JXTA 1TJEA 3PS6A 5JXVA 2ZPNA 2J0JA 3UQBA 3CSFA 1TKYA 4M0WA 4AP4C 4HKQA 1WRIA 3R2TA 1N60A 5CHVC 1HXYD 3Q3MC 2KO3A 2MRPA 4S0RA 4AJYB 3VRBB 4C4VA 2GLSA 1YJ1A 5GXGB 1PFDA 5FR6A 3QHTA 3MC8A 2HE7A 1V97A 3LJ3A 3ONSA 3DPDA 4JWSC 4RCOA 1DGJA 2WQYB 5AZFA 5DPSA 3OJ3A 5E6OA 1WGDA 2V9HA 4IDIA 1IP9A 4ACFA 1E9MA 1LM8B 1SE9A 1ZP0B 4NAMA 1WR1A 1DOIA 3SDLC 1WX7A 3ZGZA 3WCQA 3A9JA 2LZ6A 2IY1B 2ZEQA 2WXRA 1L6UA 2D11A 2WXKA 1F77A 3QAQA 2JY6A 1XLPA 1DOXA 1GAQB 4IC7B 2BQQA 1CJEA 1HZ6A 1WJ4A 2V4IB 3U7DA 4WAFA 1IBXA 4WWNA 2DYBA 1PGXA 3L54A 1JWUD 2VRRB 3BY4B 1FRDA 3CWIA 3AEBB 3BVGA 4W9JA 4PYZA 4DHZE 4FJZA 4W9FA 1H8CA 4I6LB 2RR9A 5JHBA 1JMLA 2JXXA 1QT9A 2WX0A 1N62A 1N5XA 4B0EA 4BBNC 3P1MA 3ECIA 2ICIA 4LK0M 1TT5B 4XWWA 3EFUA 2DNFA 3BWUD 4N6EB 2G9HD 4MDKE 2CKHB 3VR8B 1QOFA 2L8JA 3U2SC 3NZSA 4M01A 4G11A 2KT7A 1I4QA 1DYQA 1I4HA 5EE3A 1OGWA 4RGTA 1CQVA 3QQ8B 3DBLI 3KW5B 5LXIB 3DDCB 4MSQB 1H4RA 4BVUC 1MI0A 3B0AA 3OG5A 3SFDB 1PYWD 1V8CA 4TQ0A 1J7CA 3ENEA 2INDC 3TIXA 4MJSB 5E6NA 1UBIA 2BYFA 3BYYB 4MM3A 1FRRA 3L17A 2GBKA 3NJTA 4IUMB 4HDQA 3TJPA 2KJ6A 5BYQA 3HUIA 1V9JA 3ZQ4A 4YT0B 1D6EC 1XXGA 4BKTA 1ZGUB 3L13A 2KTRB 4W9GA 3OLMD 2N1VA 1YN5A 3AE7B 1U4AA 4EZJA 2WX1A 3ZRCA 3AXCA 1UUPA 4ZRIA 1PQSA 1WJ6A 4PT5A 1TY2A 1J7BA 2KMMA 2UYZB 1KF6B 2GBRA 4GDLA 4NJ6A 1WXVA 3Q69A 1AWDA 3EGRA 3L4PA 2GRIA 4AS1A 1OTRB 3L08A 4HJKA 3ML9A 1KJTA 4LNFA 3I5JC 2CU1A 3H8HA 5HHDG 4HJGE 4A55A 3TMPB 2AQ3B 3B2FA 3VHTC 4AOFA 2PEAA 2MH7A 4G50A 5C3JB 5IN7A 1N5WA 1PUTA 1WF9A 2JT4B 3FC4A 3PZ8A 4GDKB 1WXSA 3ALBA 2SAKA 3U30A 2V0GA 1L0YB 3EHVA 2NCNA 1I4GA 5D2MB 4JE3B 2HTME 2IO2B 5IO9A 1EM7A 2RPVA 1LXDA 1FIQA 1D5XC 1FNWA 1OFFA 4JL9A 3KUDB 1GC6A 2Z8LA 3OWEB 2KFJA 1J0GA 5E6PA 5DPWA 5CHFA 1UGMA 3WAOA 4DHJD 2RMMA 5BMIA 5MPOA 2LASA 2D3AA 2Q5WD 4LNKA 2JZ3B 4JQWC 4L2YA 1QOBA 1J8CA 2KDMA 2W9NA 3N1XC 4HEA1 2K5PA 1WM2A 2PTLA 5I4DA 4MGKE 2D07B 5C2TB 2OHFA 2NBUA 1P7FA 2J7QB 4YWGG 4TKNA 3ZNID 4F1SA 2MBEA 2BS3B 2FCQA 2Y3AA 3KQ4A 2MEKA 1FXAA 3VTUA 2AQ2B 4MEMA 4K3CA 4E71A 4KZCA 3AECB 3RCZA 2KJHB 4NJ7A 2JUOA 2GI9A 1E8WA 1GOZA 3DCGA 1YD8U 1V5OA 3KH0A 3Q8BA 1JWSD 2NTSA 1E7PB 2CHZA 4NJCA 3KYCD 3DBRB 1V81A 1VZ6A 5TR5A 4UDUC 2NS5A 5FKAC 1V49A 3SU8X 1CK1A 1VLBA 4A90A 2LVPA 4NNJB 2KWDA 3UQAA 2RD0A 4KGSA 1F0ZA 2WP9B 2G45B 4ZYNA 4B9KA 1F2RI 4YSYB 1LO5D 2JZPA 3VTWA 3A1QB 3I57A 1Z2MA 4XC2A 4BKGA 3DOWA 1IGDA 2O6VB 1JW9D 1GG3A 2NBVB 1ET9A 3DHGC 1Q0WB 2LFIA 2PMVA 2LVOA 4EFOA 2PLPA 2CU3A 1SIFA 1FMAD 3DHIC 3M95A 4FULA 1TGZB 2JPHA 2XK5A 1FXTB 1Y56A 2K9XA 2FCMA 2WXOA 2NR2A 1I4PA 2C9WB 2UU7A 2YEPB 1WMHA 3VFKA 4PK1A 2O2VA 2VZKD 3ETRA 1Y8RC 3ZJVA 3P4SB 4ICVA 3FILB 1WFYA 2QHOA 3ZNGC 4KGRA 3AEAB 4DXAB 2QILA 3AE2B 5JH5C 2N7JA 2BVCA 1FO4A 3V3XA 2K3UA 1Z5SB 3T3OA 3RMKC 3RFZB 4ZOHC 4NAWA 3AE1B 5H8YE 4MT5A 3NUHB 3NVZA 2RPQA 4XX5A 3GZNI 4LCDE 4KKJA 2XN9C 4ASWC 3AH7A 4JPSA 3TEXA 2L1AA 5E6JA 2LHDA 4A20A 2EKIA 2BF8B 4F8CB 4R3DA 3H6NA 1N63A 4YL8A 3R3MA 3RNAC 2OJRA 5BO4B 4FJYA 1WGYA 1YNTE 2WU2B 3HM3A 4FN2A 4GN1A 2CJOA 5D7GA 2DAJA 4B95A 2V4LA 1SEBD 1TS3A 3WA0A 1FD6A 1AARA 2K8CA 3WAMA 3KVFB 3NZUA 1WY8A 2CR5A 3RNFC 1YOVB 3U8ZA 4B6WA 3VR9B 4K81A 3AEFB 3BZDB 3APDA 1SE3A 4P16A 1I7HA 2AL3A 3L10B 2V3SA 1E0ZA 4GIVA 2KXJA 4HPMB 3OJ4B 3R2IA 2L0TA 1XEEA 3HHMA 3P4QB 3MJWA 2KDEB 1OEYA 4FHKA 3AE4B 4K7WA 3P42A 3VUWA 1SIJA 1NBFC 3VAWA 3IAS1 3CSTA 4KIKA 1Q5WB 1UWXA 5DPRA 5C23A 2YVCA 3PT2B 5BYRA 4KDIC 3IHPC 1ZW7A 3NVVA 3UF8A 4KGTA 1T5XD 1YMHE 1ET6A 3O13A 3DBLB 1LGRA 4MGZE 2CS4A 3TEZA 2MJ3A 3Q3NC 2KMCA 2QSDA 1QLBB 4YSXB 3PZDA 4ZYSA 3RN9C 3DBHI 3CMMB 2KHWB 2DAFA 1WXQA 1TKEA 5AUIA 1KLGD 1K52A 3B9JA 2QJLA 2QMTA 4K1RB 3B08A 1GUAB 4BOZB 2K6QA 1MJDA 2KWVB 4RNAA 1JCKB 1UNSA 2KFKB 2KKCA 5CHWA 3PRZA 1A70A 3M62B 1F2RC 2BYEA 2WXIA 2LXCA 3IXSA 1FM0D 1FNUA 4XDCA 4QAYA 3W9CB 1WJUA 5G5GA 3VXWA 4WURA 1JRUA 3NZ3A 3N30A 3WALA 2RDBC 3PSEB 1RM6C 2ON8A 1KH0A 1WGHA 4US9A 3ZKJC 2IDYA 2Z0DB 3VTVA 1WX9A 2I1KA 4N59A 1OQQA 4USAA 3E56A 2FNJB 3SHQA 4B0MA 4KSKC 2FIFA 2WGSA 1IGCA 2X8XX 1IPGA 2X38A 3QCAA 1KOTA 3ABVB 2A5UA 2W82A 3KUCB 3TSSA 2BKRB 2BTEA 2DENB 2M1MA 1RRBA 2WDVB 1S1QB 1QOAA 3RYTA 1OQYA 3LYYA 3DQVA 2E6XA 1HA5A 3AE5B 4RGNA 1FCLA 1VJKA 2J42A 3LDZE 1E7UA 1XLNA 2DBYA 2SEBD 1C3TA 3Q3JA 2WS3B 2DZJA 2OOBB 4PYUA 1RWSA 2LXAA 2REXA 3ZDTA 3PRPB 3BINA 3BIID 3R66C 4DWFA 1T0RC 1YX6B 4JLCA 3RNGC 5H92C 2LGYA 5TSSA 1C4CA 3W2DA 1ZDXA 3JSVB 3T3NA 2QEJC 2RDGA 5GMVA 4C56C 4LJOB 1VCBA 2AL6A 4II2B 2RDHA 1XLOA 2RSUA 4IOIE 2BB6A 2D2QA 3A9KA 3Q6BA 3ZTDA 3NRZA 1N61A 1NYQA 1TYGB 2QC8A 2K6DB 4TV3A 4WWMA 2FAZA 5J2RA 3PTFC 2WHIA 4KX6B 1E10A 1FXIA 3KUZA 3RNEC 3NS1A 4FADA 5DPTA 3H7PA 2XBBC 2A4ZA 4IWOA 1X1MA 2LJIA 1FEHA 4GMVA 2GOWA 2ZVOA 2KMAA 3NVWA 1P3QU 2GBNA 3N1YC 4EUTA 3ZLZA 1ZKHA 4CHKA 4E74A 4LDTD 2KJRA 2LVQA 1UF0A 4RM9A 2L83A 2JVCA 4OVZA 1BXTA 3Q3OC 4EKUA 2MBOA 1JWBD 2Z59B 2KDBA 4WQMA 1QF6A 3H9DA 1YX5B 2DYOA 1YQBA 4HWIB 1WM3A 4D2KA 1SF0A 4OVVA 1WX8A 3ZYYX 2LMCA 2HD5B 2DZIA 3PHXB 2IY0B 2JRHA 2V3PA 1WWTA 2IGGA 3PRMB 1EF5A 4ARCA 2MX2A 1UZXB 1B9RA 1L5PA 3V05A 3PV1A 4GGQA 3AV8A 1C77A 5JHAA 4J6IA 4WJNA 2WYQA 3FAHA 2N9PC 4IG7B 3TEWA 1L0XB 1NVID 4LLGM 3DWMA 4ANXA 4O1NA 2W54A 4HDOA 4J3OD 2KYWA 3BK2A 1MHXA 2M4NA 1NENB 4CQNA 1RFAA 3GOEA 1TS2A 4GSWA 2WXNA 4DXGA 2AQ1B 1MFWA 2FCSA 3AM9A 3GZNB 2MP2A 4XDDA 4M0WB 3ZXVA 2ZNVC 2G1EA 1JWAD 2N9KA 3N3KB 1YQ3B 1I4RA 4C4VB 3ZNZB 1OQRA 4EEWA 1LFDA 4OZCA 4A3OA 2BWFA 2NMQA 4LTUA 5FK9C 3UIPB 4K7SA 3TUOA 4AWJA 3B2GA 3R7QA 2KAJA 2B3AA 3I63C 5BYSA 1QKZA 3A9JB 3X0WA 1STEA 1SJED 2MW5A 2VH2A 4ZRPA 3KWLA 4AUQC 3WANA 4YSZB 1E6EB 4YTMB 1YQ4B 1E5WA 1HTQA 4KSLC 1IBXB 3Q8CA 3A4RA 2JYEA 4NZLB 2FUHB 4HCNB 2C7HA 5G5HA 1F52A 4ICUA 2OEDA 3KYDD 5D3IB 2EELA 4HROA 2BPSA 4A9AA 2N1WA 2PJHA 1P9DU 2L3ZA 5EE1A 1QZEA 2M0AA 2LUMA 2N7EA 4MSMB 2NPTA 3VH3B 4HPLB 4P1BC 2KNBA 3CIRB 1E8XA 2KX3A 1P0RA 3V6EB 4YXDB 5G55A 2MJDA 4N9F4 4MELA 3V6CB 4BKSA 2KX0A 4TSSA 1EU4A 2D3BA 3Q8EA 3T9LA 3VRAB 2IO0B 5IKCM 2EKEC 3VUXA 4FLHA 4DBGA 3A33B 2M8SA 3PGEA 3ZUNA 4EZKA 2E3TA 3IT4B 2KQSA 3QC8B 2MLBA 1V1PA 3DBHB 3MC0B 1PGBA 4BKSD 5AZGA 2J52A 2L05A 2XEWA 2R2QA 1JROA 3O65B 4MM3B 1AW7A 1I4XA 2H89B 2J0MA 1YIWA 1ZXHA 2DHZA 2JWUA 2XNAC 2LI5A 1MPEA 2LWPA 1K51A 1TS4A 5KHOA 2KLGA 4DDID 2L32A 4CYEA 2MWSB 4X57B 1A5RA 1UGJA 1L7YA 3RZWC 4BBNF 2KN5A 2KANA 1WYGA 3M3JA 1T3QA 3AEGB 2DYMA 2JZZA 2W3SA 1WH3A 2FCNA 4W9EA 2ZCBA 2MBQA 4WJOA 2ZNVB 3W5UB 2ACZB 4GDLB 2ZW1A 1WZ3A 2KC1A 3PLUA 4GLSC 2QIEB 2NBWB 1KM7A 2KTFA 2WDTB 3RULA 2YLMA 4P1CC 1ZXIA 2FE8A 1FFUA 3DBSA 3P2BA 4ZDVA 4XGAB 2M19A 1C79A 2MBBB 1BMLC 2N0SB 1MG8A 2AYOB 3AE8B 2H88B 4EZLA 3PHWB 4GU2A 1AN8A 1JALA 1BUIC 1Q1OA 2IBIB 1TY0A 3ZNHB 1NI2A 4I6NB 3HRDD 3AB5A 1V86A 3UI3A 2K8BA 2W3RA 1PDXA 3QK0A 2LRUA 3AMZA 4JIOU 3EA6A 1XD3B 4Q2JA 3APCA 1HTOA 4URKA 1F9JA 1V2YA 1UWMA 2D3GA 1IYFA 2KVZA 1E7VA 5HKHA 3QIJA 4DK5A 2CHWA 2C7NB 1R4MI 4ANVA 4A8XC 4W9HA 3AU5A 1F1HA 3DHHC 4W9CA 5EE0A 2INCC 3D32A 4ZHPA 2INPE 2YEPF 4W9KA 4ARIA 1PGAA 3GB1A 1SSNA 2WNMA 3W5VB 1KLUD 4XYCA 4NY0A 2ZCCA 3AN1A 3W1SA 2BYTA 4MH0E 5AUKA 3JVZX 4GXBA 1T6BX 2Y5CA 1WR6E 1N6ZA 5L95C 3KWVA 4EOYA 2V1YA 1GB1A 2WWZA 1OEYJ 3J9CA 1R4NI 3KLSX 2V3NA 4PS7A 5IOIA 1XCQL 3ZTCA 1XT9B 5G2NA 3ML8A 1SBBB 3Q8AA 5HG2A 4TQ1A 4MJSA 1RAXA 3ZW3A 2BBCA 2NVUI 4IWPA 4OZAA 4BFRA 3W1SC 2LHEA 3LB8C 1DOYA 1ZOYB 3MJ5A 2DX5B 3HVZA 3N20C 4KKIA 4ZRQA 1L2NA 1YJJA 1V1OA 2CJNA 2K22A 1WE7A 2KTRA
chains in the Genus database with same CATH topology
3Q8FA 1OFFA 4P6VF 2BB5A 2BS4B 2LGIA 2Z8LA 3OWEB 2D5GA 1JRPA 2IPKD 1FEHA 2LJIA 2VZKB 2RMMA 5BMIA 5MPOA 3HVDA 2Q5WD 4L2YA 1HEZE 3NVWA 1JWMD 1QOBA 3AE6B 3I9V1 1SJHD 4C80A 3DWGC 2KDMA 1NYRA 4HEA1 2K5PA 2I38A 2PTLA 1XCTL 5I4DA 5C2TB 2OHFA 4JWUC 2L83A 2J4XA 1P7FA 2PVOD 4YWGG 1KFYB 4OVZA 1EWYC 2BS3B 4REZA 1BXTA 1HQRD 1MVKA 3GS2A 2Y3AA 2BT6A 4YTPB 1KTKA 1VRAB 2INNE 1JWBD 4HKZE 1FNVA 3KQ4A 4WQMA 2MEKA 1QF6A 1FXAA 5BMHA 2DYOA 1R7SA 2AQ2B 1EU3A 1CZPA 2AX5A 4WH4A 2N9LA 4D2KA 1SF0A 3AECB 1L6VA 1SE2A 1C9FA 3ZYYX 2LMCA 3C8YA 2WDQB 2WLBA 4NAWB 2GI9A 2NTTA 2V3PA 1WWTA 1GOZA 2JX5A 2IGGA 4ARCA 2JU6X 5HI1A 3AE3B 1SXTA 1YN3A 1JWSD 3P4RB 3Q8BA 1B9RA 2NTSA 1D5MC 1E7PB 1L5PA 4NJCA 3V05A 4C7ZA 1VZ6A 3P63A 4RH6A 3MHZA 4UDUC 3AV8A 1C77A 5FKAC 1CK1A 1VLBA 3FAHA 4A90A 2KWDA 3TEWA 1JQ4A 4C7YA 3AEDB 1L0XB 4KGSA 1NVID 4LLGM 3DWMA 1F0ZA 2WP9B 4O1NA 2W54A 1FCCC 4J3OD 3U52E 3BK2A 1MHXA 2MJEA 1F2RI 1NENB 4CQNA 4YSYB 1LO5D 2JZPA 1TS5A 2WXHA 3I57A 4IKGA 1TS2A 1IGDA 1JW9D 1ET9A 3BYTB 2WXNA 1XF5L 2LFIA 2PMVA 1KRHA 4DXGA 1NI3A 1QQRA 2AQ1B 2CU3A 2PLPA 1IUEA 3AM9A 1FMAD 4XDDA 3BVZA 1L0VB 2G1EA 1JWAD 3E9SA 3PZ7A 2IJ0A 1ESFA 1Y56A 2K9XA 2N9KA 5D3DA 2IGHA 2WXOA 2WXGA 1YQ3B 1I4PA 1I4RA 2PVGC 3AEEB 2YEPB 1OQRA 2GB1A 4EE2A 2L52A 4XE0A 2VZKD 3ETRA 3SR6A 4ITKA 3ZJVA 2HDEA 1K50A 3P4SB 3GP7A 3FILB 1XO3A 4OZCA 2Y5PA 4LTUA 2NMQA 1ZUD2 1VZ7A 5FK9C 4KGRA 3TUOA 3AEAB 1GPXA 2QILA 3B2GA 4OHJA 2B76B 3AE2B 2N7JA 4L1BA 1SE4A 5EE9A 1M4VA 3V3XA 1FO4A 2K3UA 3EUB2 1NEKB 2KAJA 2ZW0A 3T3OA 3RFZB 4ZOHC 5BYSA 1VZ8A 3AE1B 1QKZA 5H8YE 1STEA 1V1PB 1SJED 4MT5A 1ROEA 3NUHB 3NVZA 4H2AA 2FBWB 4ZRPA 1YN4A 3KWLA 4MH8A 4KKJA 2XN9C 1MHHE 1QOGA 3AH7A 4JPSA 3TEXA 2L1AA 5E6JA 4YSZB 1E6EB 3MP9A 4RGMA 4YTMB 2LHDA 1YQ4B 2R61A 1WSPA 2EKIA 1IBXB 3Q8CA 4R3DA 1N63A 2JYEA 1C4PA 4NZLB 3RPFC 3BVMA 1P7EA 2BW2A 5G5HA 1YNTE 2OEDA 3MFGA 5LNK1 2WU2B 5D3IB 3VQIA 2EELA 1WGKA 2CJOA 2JYTA 2WXQA 3P4PB 4HROA 5D7GA 4A9AA 1SEBD 4RGOS 2W55A 1TS3A 2M56B 1D5ZC 2TSSA 3LXFA 1FD6A 2JXTA 1TJEA 5EE1A 5JXVA 2M0AA 2LUMA 1TKYA 4M0WA 4HKQA 1WRIA 3R2TA 3URYA 1N60A 1HXYD 2ONQA 4L23A 3CIRB 3VR9B 3AEFB 3VRBB 3BZDB 3SFEB 5GXGB 1SE3A 1PFDA 1I7HA 4P16A 4YXDB 2MJDA 1E0ZA 3U4EG 4US8A 2KACA 1V97A 2J53A 3FILA 5BMGA 4TSSA 4JWSC 4RCOA 1EU4A 3Q8EA 3R2IA 4RF1A 1DGJA 3VRAB 2WQYB 1XEEA 1AYFA 3P4QB 4IDIA 4A6QA 1SB3C 1C76A 1E9MA 1ZP0B 2JQRB 4NAMA 1DOIA 2E3TA 3ZGZA 3AE4B 3WCQA 3IT4B 3P42A 4RF0A 2WDRB 1V1PA 4WIPA 3MC0B 1PGBA 1SIJA 1RYJA 2WXRA 1L6UA 2LEKA 2WXKA 1F77A 2BS2B 3NVYA 2J52A 1K53A 3IAS1 4OW0A 1XLPA 1DOXA 1GAQB 1JROA 1CJEA 1HZ6A 4MM3B 1AW7A 1I4XA 2V4IB 1UWXA 2H89B 4WAFA 1ZXHA 1IBXA 2JWUA 5BYRA 2XNAC 3N9YC 4OZBA 1EWCA 2DWQA 1PGXA 1ZE3D 1MPEA 1JWUD 1K51A 1TKGA 1TZOA 1FRDA 1TS4A 3CWIA 3AEBB 2PIAA 3NVVA 4KGTA 2L32A 1T5XD 1D4BA 3BVGA 1VR9A 2DLBA 1YMHE 1ET6A 3O13A 5HFYA 3TEZA 1UGJA 2MJ3A 1JMLA 1QT9A 2QSDA 1N62A 1QLBB 4YSXB 1N5XA 4B0EA 4ZYSA 1WYGA 1T3QA 2K0PA 3P1MA 3AEGB 2DYMA 5AUIA 1WXQA 1TKEA 2W3SA 2IGDA 4DQOC 1KLGD 2ICIA 5T8IA 3R8BA 4LK0M 1K52A 3B9JA 2QJLA 2QMTA 4XWWA 3W5UB 3BWUD 2ACZB 4GDLB 4N6EB 2ZW1A 3SEBA 2G9HD 4RNAA 4GLSC 1JCKB 1UNSA 1ZDVA 2QIEB 3VR8B 1B1ZA 1Q10A 1L4DB 1QOFA 3U2SC 1A70A 1ZXIA 1F2RC 2WXFA 2WXIA 1I4QA 2FE8A 1DYQA 1FFUA 3IXSA 1FM0D 1I4HA 5EE3A 4DXFA 1HZ5A 1FNUA 4RGTA 4XDCA 2M19A 3W9CB 1C79A 1CQVA 1BMLC 2N0SB 3BK1A 3AE8B 4WURA 5G5GA 3NZ3A 2H88B 1MI0A 1RM6C 1AN8A 1JALA 1BUIC 1KH0A 2ON8A 4US9A 4JX1C 1TY0A 2WXLA 2WXJA 3SFDB 1PYWD 1V8CA 4TQ0A 2WU5B 1J7CA 2IDYA 2WXMA 3HRDD 3BYYB 3AB5A 1FRRA 3UI3A 4N59A 1OQQA 4USAA 3E56A 2W3RA 4B0MA 1PDXA 3AMZA 3EA6A 1IGCA 4HRSA 5BYQA 3U7ZA 2X38A 4Q2JA 1YJIA 3HUIA 3ZQ4A 4YT0B 4YTNB 2I2YA 1XLQA 1D6EC 1UWMA 1GB4A 1XXGA 3ABVB 3PO0A 1ENFA 2W82A 2KN4A 1RFKA 1L4ZB 3TSSA 4A8XC 1YN5A 3AE7B 5EE0A 2BTEA 3TEYA 4ZHPA 4FXCA 1UUPA 4TMAB 2INPE 2WDVB 2YEPF 1QOAA 3LYYA 1VDVA 2KQ4X 4ARIA 1PGAA 1HA5A 2E6XA 3AE5B 3AE9B 4N58A 4PT5A 1C78A 4RGNA 1FCLA 1VJKA 2J42A 1TY2A 3GB1A 1J7BA 1SSNA 2FUG1 2KMMA 1KF6B 2PKOA 4ZHOA 4XWTA 4AQ7A 1XLNA 2SEBD 2DBYA 2WNMA 4MACA 3W5VB 3Q69A 1KLUD 1AWDA 2WS3B 3EGRA 3L4PA 2GRIA 3AN1A 4AS1A 3W1SA 2BYTA 2WXPA 1RWSA 4RFBA 5AUKA 1ZPSA 1FFVA 3BIID 1T6BX 3IT6B 2Y5CA 5H92C 3KWVA 2JSVX 3H8HA 5TSSA 1C4CA 5HHDG 3W2DA 1GB1A 4HJGE 4A55A 1ZDXA 3T3NA 2QEJC 2RDGA 3J9CA 3KLSX 4C56C 2AQ3B 2V3NA 3B2FA 5FR3A 1XCQL 1FIQA 2MH7A 2RDHA 1XLOA 4IOIE 2BB6A 2PW9A 5C3JB 3ZJTA 1N5WA 1SBBB 3Q8AA 5HG2A 4TQ1A 1PUTA 3NRZA 1ACCA 1N61A 2BBCA 1NYQA 3FC4A 1TYGB 3PZ8A 4OZAA 3ZJUA 4GDKB 4WWMA 1J7AA 2SAKA 2LHEA 3IAM1 2V0GA 1L0YB 3LB8C 1DOYA 1ZOYB 3MJ5A 3HVZA 1I4GA 4KKIA 4ZRQA 4KX6B 4JE3B 2HTME 1QILA 1E10A 1EM7A 2RPVA 1FXIA 1C4AA 1YJJA 1V1OA 2CJNA 2K22A 3NS1A 1D5XC 1FNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G1E A;  4P6V F;  1AYF A;  1JWA D;  1OFF A;  3P4Q B;  4IDI A;  2BS4 B;  2K9X A;  3HRD D;  3AB5 A;  1SB3 C;  1E9M A;  1YQ3 B;  1FRR A;  1ZP0 B;  2PVG C;  3AEE B;  1OQQ A;  4N59 A;  2JQR B;  4USA A;  1JRP A;  1OQR A;  1DOI A;  2E3T A;  2W3R A;  1PDX A;  2L52 A;  3AE4 B;  3WCQ A;  3AMZ A;  2WDR B;  3ETR A;  3SR6 A;  4ITK A;  5MPO A;  1SIJ A;  4HRS A;  2Q5W D;  3P4S B;  1RYJ A;  1XO3 A;  3NVW A;  1L6U A;  1QOB A;  1YJI A;  2LEK A;  3AE6 B;  3HUI A;  4YT0 B;  2BS2 B;  3NVY A;  1XLQ A;  4YTN B;  1UWM A;  4LTU A;  4C80 A;  1J7C A;  1ZUD 2;  3ABV B;  3DWG C;  1XLP A;  1NYR A;  1DOX A;  1GAQ B;  3PO0 A;  1GPX A;  3AEA B;  1JRO A;  2K5P A;  3B2G A;  1CJE A;  2B76 B;  3AE2 B;  1RFK A;  5EE9 A;  1FO4 A;  3EUB 2;  5C2T B;  1NEK B;  2H89 B;  2KAJ A;  2OHF A;  3AE7 B;  2L83 A;  4JWU C;  4ZOH C;  2PVO D;  1KFY B;  2DWQ A;  3NS1 A;  3AE1 B;  5EE0 A;  1EWY C;  2BS3 B;  5H8Y E;  4ZHP A;  4FXC A;  1TKG A;  1ROE A;  2BT6 A;  1FRD A;  3CWI A;  3NVV A;  2WDV B;  2FBW B;  2PIA A;  3AEB B;  1JWB D;  1QOA A;  3NVZ A;  1VDV A;  3KWL A;  4N58 A;  3AE5 B;  3AE9 B;  4WQM A;  1QF6 A;  1FXA A;  1VJK A;  1J7B A;  2KMM A;  1R7S A;  1KF6 B;  2PKO A;  1QOG A;  3AH7 A;  4ZHO A;  1XLN A;  2DBY A;  1CZP A;  2AX5 A;  2MJ3 A;  3W5V B;  4YSZ B;  1E6E B;  1AWD A;  1SF0 A;  2WS3 B;  1L6V A;  3AEC B;  3L4P A;  1QT9 A;  4YTM B;  1YQ4 B;  1N62 A;  1QLB B;  3AN1 A;  1N5X A;  3ZYY X;  4YSX B;  2EKI A;  2WDQ B;  2WLB A;  1WYG A;  1N63 A;  1RWS A;  1T3Q A;  5AUK A;  3P1M A;  1WWT A;  1FFV A;  3AEG B;  3RPF C;  3BII D;  2JX5 A;  2Y5C A;  5AUI A;  1WXQ A;  1TKE A;  2W3S A;  5G5H A;  5H92 C;  3AE3 B;  2WU2 B;  3B9J A;  2QJL A;  1WGK A;  2CJO A;  3P4P B;  4HRO A;  1E7P B;  1L5P A;  1B9R A;  4C7Z A;  4A9A A;  3W5U B;  4N6E B;  2ACZ B;  2W55 A;  3P63 A;  2M56 B;  3AV8 A;  3B2F A;  3LXF A;  2QIE B;  1TJE A;  2MH7 A;  3VR8 B;  5EE1 A;  1XLO A;  1QOF A;  1VLB A;  3FAH A;  5C3J B;  1A70 A;  1N5W A;  1TKY A;  1ZXI A;  1JQ4 A;  4C7Y A;  1WRI A;  1PUT A;  1N60 A;  3AED B;  1FFU A;  4YTP B;  1F0Z A;  3NRZ A;  1NVI D;  1FM0 D;  3DWM A;  2WP9 B;  3CIR B;  1N61 A;  2W54 A;  1NYQ A;  3FC4 A;  1TYG B;  3AEF B;  5EE3 A;  3VRB B;  3VR9 B;  4WWM A;  2M19 A;  2MJE A;  3W9C B;  3SFE B;  5GXG B;  1NEN B;  1J7A A;  4YSY B;  1PFD A;  1I7H A;  4YXD B;  2N0S B;  5G5G A;  2MJD A;  3AE8 B;  1E0Z A;  2H88 B;  3LB8 C;  1DOY A;  1ZOY B;  1JW9 D;  3HVZ A;  4US8 A;  1V97 A;  4KX6 B;  1RM6 C;  2HTM E;  1KRH A;  1E10 A;  1JAL A;  4JWS C;  4US9 A;  1NI3 A;  1FXI A;  2CU3 A;  1IUE A;  4JX1 C;  1YJJ A;  3AM9 A;  1DGJ A;  1FMA D;  2CJN A;  2K22 A;  1V8C A;  3SFD B;  2WU5 B;  2WQY B;  3VRA B;  1FIQ A;  1L0V B;  3P4R B; 
#chains in the Genus database with same CATH topology
 2KWC A;  2BB5 A;  2L76 A;  2BS4 B;  3RUI B;  2LGI A;  4IWQ A;  2D5G A;  4CO7 A;  1JRP A;  1UBQ A;  2VZK B;  4NQK E;  1M94 A;  1HEZ E;  3I9V 1;  3V62 A;  4KDL B;  4C80 A;  3DWG C;  1BT0 A;  1NYR A;  5AZH A;  4W9L A;  3NG0 A;  2PE9 A;  2I38 A;  2XK5 B;  2MBH A;  1XCT L;  3ZXR A;  4F7Z A;  3EC8 A;  4JWU C;  1WMH B;  1KFY B;  2C60 A;  1EWY C;  1HQR D;  2O2V B;  3GS2 A;  1T0Q C;  4YTP B;  1KTK A;  1VRA B;  2INN E;  3T8M A;  1FNV A;  5L83 A;  3IFW B;  3HK0 A;  5BMH A;  1EU3 A;  2AX5 A;  2ZJD A;  2L00 B;  1C9F A;  1EF1 A;  3V61 A;  3C8Y A;  2WDQ B;  4NAW B;  2LGD A;  4JGH B;  3UIN B;  2JU6 X;  5HI1 A;  3AE3 B;  1SXT A;  4GDK A;  4M02 A;  1YN3 A;  4WWP A;  4C7Z A;  1LQB A;  2LRW A;  3P63 A;  5IA7 A;  2KVR A;  4RH6 A;  3MHZ A;  3B1L X;  1EUV B;  1S3S G;  1GNU A;  2DZK A;  4HK2 A;  1JQ4 A;  4C7Y A;  3AED B;  4W9I A;  4E3C A;  2MJE A;  2LJ5 A;  3I3T B;  4HPP A;  2C5L C;  4IKG A;  2LUE A;  2BYV E;  4W9D A;  2CHX A;  1XF5 L;  4ZRJ A;  1KRH A;  3FKY A;  2G3Q B;  1WXA A;  3VVW B;  3E9S A;  3PZ7 A;  2IJ0 A;  1TZ1 A;  1I42 A;  5D3D A;  1WJN A;  1I35 A;  3TBL D;  4IW0 A;  4LNN A;  3AEE B;  4ANW A;  1WE6 A;  2GB1 A;  1TTN A;  4EE2 A;  3SR6 A;  2GMI C;  4ITK A;  3X23 A;  1T0Y A;  1WIA A;  1GJZ A;  1ZUD 2;  1VZ7 A;  3NOB A;  1SE4 A;  3DVN V;  1NEK B;  2C7M B;  4FA6 A;  1VZ8 A;  1D3Z A;  2HJ1 A;  3HM6 X;  4GOC A;  1YN4 A;  2LD9 A;  1KLV A;  2KOX A;  3VH4 B;  4KIK B;  4FBJ B;  4K3B A;  1MHH E;  1QOG A;  3ZRF A;  3S2A A;  4ZRK A;  2GBM A;  4M8N A;  4RGM A;  5CX3 A;  2EMS A;  2R61 A;  1WSP A;  2D10 A;  4I6P A;  3ZVV A;  3IG3 A;  1C4P A;  4LNI A;  1SGH A;  3BVM A;  1P7E A;  4OVU A;  3C19 A;  3PVL A;  4PS3 A;  2JYT A;  3PLV A;  4DHZ B;  4MGY E;  4RGO S;  3A1Q A;  2BWE S;  1E8Z A;  2O6V A;  2M56 B;  4WJP A;  2TSS A;  3RI7 C;  1C1Y B;  2IZV B;  2K25 A;  3URY A;  2ONQ A;  4FJV B;  3Q2A C;  4L23 A;  1WGR A;  3SFE B;  3U4E G;  3H1U A;  2G4S A;  2O6V D;  2KAC A;  2J53 A;  4US8 A;  3IBE A;  3FIL A;  1WXM A;  5BMG A;  1J19 A;  1UH6 A;  2BKF A;  4RF1 A;  3QX1 A;  4BAX A;  1AYF A;  4A6Q A;  1SB3 C;  1C76 A;  2KD0 A;  2JQR B;  5CTR C;  2MSE D;  2J0K A;  4RF0 A;  2WDR B;  4WIP A;  3EFC A;  1WGG A;  1RYJ A;  2K1F A;  2LEK A;  2BS2 B;  3NVY A;  3W1Y A;  1K53 A;  4OW0 A;  3N1Z C;  5IAA C;  3RZF A;  3RNB C;  3QWZ B;  2L7R A;  1G6J A;  4OZB A;  3N9Y C;  1EWC A;  2DWQ A;  3MHS D;  1ZE3 D;  1WI0 A;  5KHQ A;  4LJP B;  1TKG A;  1TZO A;  3GE8 C;  4DDG D;  2PIA A;  4WAA A;  3MC9 A;  1D4B A;  2JRI B;  1VR9 A;  3VUY A;  2DLB A;  3DVN U;  5HFY A;  4GB9 A;  2IO1 B;  3L0W B;  2K0P A;  1XQQ A;  1NDD A;  2IGD A;  4DQO C;  5T8I A;  3R8B A;  3RD2 A;  3A4S C;  4P7I A;  3SEB A;  3NY5 A;  1TBE A;  1ZDV A;  3V60 A;  1B1Z A;  1Q10 A;  1UD7 A;  1L4D B;  4G3X B;  2JWZ A;  2WXF A;  2D3C A;  4RM8 A;  4DXF A;  1HZ5 A;  4KVG B;  1R4M B;  3M63 B;  3BK1 A;  4WJQ A;  2ASQ A;  5LLI A;  1MG4 A;  5DCN A;  3NS8 A;  4A3P A;  3RT3 B;  4JX1 C;  2WXL A;  2WXJ A;  4IM2 A;  3QA8 A;  4G0N B;  2WU5 B;  3A9K B;  4HLE A;  2WXM A;  4IM0 A;  3JYU A;  3AUL A;  3CF6 E;  2BGF A;  3OAW A;  2ZPY A;  3APF A;  4HRS A;  3L16 A;  3U7Z A;  1YJI A;  4YTN B;  2I2Y A;  1XLQ A;  1GC7 A;  1GB4 A;  2R2O A;  3PO0 A;  1ENF A;  1CMX B;  1R4N B;  2ZVN A;  2KN4 A;  1RFK A;  1L4Z B;  4LDT B;  3H7P B;  3PPA A;  4WQO B;  3TEY A;  4FXC A;  4BOS C;  3VDZ A;  4TMA B;  1VDV A;  2KQ4 X;  4N58 A;  3AE9 B;  1C78 A;  3C0R B;  1K8R B;  4HXD A;  2FUG 1;  4BZA A;  2PKO A;  4FHJ A;  2OJW A;  2LGS A;  4XWT A;  4ZHO A;  4AQ7 A;  1EO6 A;  4MAC A;  2KFK A;  2K8H A;  3PRE A;  1V80 A;  2PPH A;  2WXP A;  4RFB A;  5AEK B;  2KDF B;  1ZPS A;  1FFV A;  4K7U A;  3IT6 B;  2AWT A;  2M0X A;  2JSV X;  2G4D B;  3TCA A;  4C00 A;  3UIO B;  5FR3 A;  1HE8 A;  2JF5 A;  2PW9 A;  5D94 A;  3ZJT A;  1V6E A;  1P1A A;  1ACC A;  3TL5 A;  3ZJU A;  2ZZP B;  1J7A A;  3IAM 1;  5J17 A;  4HCP B;  5C1Z A;  1WRD B;  1QIL A;  3AU4 A;  1E90 A;  2HJ8 A;  2L0F A;  1C4A A;  4KV2 A;  3P4R B;  3P4P B;  3Q8F A;  4P6V F;  3K9P B;  3Q3F A;  2LGX A;  2QDF A;  2IPK D;  4S17 A;  3K9O B;  3HVD A;  2KDI A;  1WYW B;  3GE3 C;  1JWM D;  3AE6 B;  2M17 A;  5J18 A;  1SJH D;  2MP2 B;  2KWU B;  4LNO A;  1VD2 A;  1WZ0 A;  2J4X A;  2PVO D;  2QCZ A;  3ZIM A;  4REZ A;  1MVK A;  2BT6 A;  4DHJ B;  4HKZ E;  3QAR A;  5LXH A;  2GBJ A;  3DVG X;  1R7S A;  3JSV A;  3ZO5 B;  1CZP A;  4WH4 A;  2N9L A;  2MCN B;  3N32 A;  1L6V A;  1SE2 A;  4IM3 A;  4MGI E;  3RNC C;  2WLB A;  2DZM A;  2NTT A;  3IVF A;  2KK8 A;  2JX5 A;  2MHJ A;  2MQJ A;  2K39 A;  5D6J B;  4M8M A;  1D5M C;  2IO3 B;  4HVB A;  4KZ0 A;  4WWO A;  3UGB B;  1V5T A;  1ISN A;  4ANU A;  3WIM A;  2I1J A;  4AJW A;  2MA9 B;  1FCC C;  3EEC A;  3U52 E;  2PE6 B;  3DVG Y;  4RMA A;  5IP4 D;  1FPY A;  2N7D A;  1TS5 A;  1UEL A;  2WXH A;  3ZDM C;  1TIF A;  2VH1 A;  3BYT B;  3R7R A;  4TUU A;  3WAP A;  1NI3 A;  1QQR A;  1IUE A;  2NPT B;  3BVZ A;  1L0V B;  4PS8 A;  1E8Y A;  2RGF A;  1ESF A;  2IGH A;  4NQL B;  2WXG A;  3SD5 A;  2PVG C;  3DBR I;  2KQ7 A;  3HIZ A;  2L52 A;  2Y5B B;  2HTH A;  4XE0 A;  2Z0E B;  2HDE A;  1K50 A;  3GP7 A;  1XO3 A;  2N9X A;  2Y5P A;  2FID A;  4NPN A;  3AI5 A;  3MTN B;  1GPX A;  1P98 A;  4XZ4 A;  3QJZ A;  4OHJ A;  2B76 B;  3NHE B;  4L1B A;  5EE9 A;  1M4V A;  3EUB 2;  4II3 B;  2ZW0 A;  2KC2 A;  3Q14 C;  3JW0 X;  1V1P B;  1ROE A;  4H2A A;  2FBW B;  2KLC A;  4M00 A;  4MH8 A;  5JZE B;  5EDS A;  2IYD B;  3H7S A;  3MP9 A;  2EMT A;  3RPF C;  2BW2 A;  2UWQ A;  3MFG A;  5LNK 1;  2N9E B;  1T0S C;  3VQI A;  2WXQ A;  1WGK A;  1RLF A;  2KZR A;  2W55 A;  2N4F A;  1D5Z C;  2AEH A;  3LXF A;  2JXT A;  1TJE A;  3PS6 A;  5JXV A;  2ZPN A;  2J0J A;  3UQB A;  3CSF A;  1TKY A;  4M0W A;  4AP4 C;  4HKQ A;  1WRI A;  3R2T A;  1N60 A;  5CHV C;  1HXY D;  3Q3M C;  2KO3 A;  2MRP A;  4S0R A;  4AJY B;  3VRB B;  4C4V A;  2GLS A;  1YJ1 A;  5GXG B;  1PFD A;  5FR6 A;  3QHT A;  3MC8 A;  2HE7 A;  1V97 A;  3LJ3 A;  3ONS A;  3DPD A;  4JWS C;  4RCO A;  1DGJ A;  2WQY B;  5AZF A;  5DPS A;  3OJ3 A;  5E6O A;  1WGD A;  2V9H A;  4IDI A;  1IP9 A;  4ACF A;  1E9M A;  1LM8 B;  1SE9 A;  1ZP0 B;  4NAM A;  1WR1 A;  1DOI A;  3SDL C;  1WX7 A;  3ZGZ A;  3WCQ A;  3A9J A;  2LZ6 A;  2IY1 B;  2ZEQ A;  2WXR A;  1L6U A;  2D11 A;  2WXK A;  1F77 A;  3QAQ A;  2JY6 A;  1XLP A;  1DOX A;  1GAQ B;  4IC7 B;  2BQQ A;  1CJE A;  1HZ6 A;  1WJ4 A;  2V4I B;  3U7D A;  4WAF A;  1IBX A;  4WWN A;  2DYB A;  1PGX A;  3L54 A;  1JWU D;  2VRR B;  3BY4 B;  1FRD A;  3CWI A;  3AEB B;  3BVG A;  4W9J A;  4PYZ A;  4DHZ E;  4FJZ A;  4W9F A;  1H8C A;  4I6L B;  2RR9 A;  5JHB A;  1JML A;  2JXX A;  1QT9 A;  2WX0 A;  1N62 A;  1N5X A;  4B0E A;  4BBN C;  3P1M A;  3ECI A;  2ICI A;  4LK0 M;  1TT5 B;  4XWW A;  3EFU A;  2DNF A;  3BWU D;  4N6E B;  2G9H D;  4MDK E;  2CKH B;  3VR8 B;  1QOF A;  2L8J A;  3U2S C;  3NZS A;  4M01 A;  4G11 A;  2KT7 A;  1I4Q A;  1DYQ A;  1I4H A;  5EE3 A;  1OGW A;  4RGT A;  1CQV A;  3QQ8 B;  3DBL I;  3KW5 B;  5LXI B;  3DDC B;  4MSQ B;  1H4R A;  4BVU C;  1MI0 A;  3B0A A;  3OG5 A;  3SFD B;  1PYW D;  1V8C A;  4TQ0 A;  1J7C A;  3ENE A;  2IND C;  3TIX A;  4MJS B;  5E6N A;  1UBI A;  2BYF A;  3BYY B;  4MM3 A;  1FRR A;  3L17 A;  2GBK A;  3NJT A;  4IUM B;  4HDQ A;  3TJP A;  2KJ6 A;  5BYQ A;  3HUI A;  1V9J A;  3ZQ4 A;  4YT0 B;  1D6E C;  1XXG A;  4BKT A;  1ZGU B;  3L13 A;  2KTR B;  4W9G A;  3OLM D;  2N1V A;  1YN5 A;  3AE7 B;  1U4A A;  4EZJ A;  2WX1 A;  3ZRC A;  3AXC A;  1UUP A;  4ZRI A;  1PQS A;  1WJ6 A;  4PT5 A;  1TY2 A;  1J7B A;  2KMM A;  2UYZ B;  1KF6 B;  2GBR A;  4GDL A;  4NJ6 A;  1WXV A;  3Q69 A;  1AWD A;  3EGR A;  3L4P A;  2GRI A;  4AS1 A;  1OTR B;  3L08 A;  4HJK A;  3ML9 A;  1KJT A;  4LNF A;  3I5J C;  2CU1 A;  3H8H A;  5HHD G;  4HJG E;  4A55 A;  3TMP B;  2AQ3 B;  3B2F A;  3VHT C;  4AOF A;  2PEA A;  2MH7 A;  4G50 A;  5C3J B;  5IN7 A;  1N5W A;  1PUT A;  1WF9 A;  2JT4 B;  3FC4 A;  3PZ8 A;  4GDK B;  1WXS A;  3ALB A;  2SAK A;  3U30 A;  2V0G A;  1L0Y B;  3EHV A;  2NCN A;  1I4G A;  5D2M B;  4JE3 B;  2HTM E;  2IO2 B;  5IO9 A;  1EM7 A;  2RPV A;  1LXD A;  1FIQ A;  1D5X C;  1FNW A;  1OFF A;  4JL9 A;  3KUD B;  1GC6 A;  2Z8L A;  3OWE B;  2KFJ A;  1J0G A;  5E6P A;  5DPW A;  5CHF A;  1UGM A;  3WAO A;  4DHJ D;  2RMM A;  5BMI A;  5MPO A;  2LAS A;  2D3A A;  2Q5W D;  4LNK A;  2JZ3 B;  4JQW C;  4L2Y A;  1QOB A;  1J8C A;  2KDM A;  2W9N A;  3N1X C;  4HEA 1;  2K5P A;  1WM2 A;  2PTL A;  5I4D A;  4MGK E;  2D07 B;  5C2T B;  2OHF A;  2NBU A;  1P7F A;  2J7Q B;  4YWG G;  4TKN A;  3ZNI D;  4F1S A;  2MBE A;  2BS3 B;  2FCQ A;  2Y3A A;  3KQ4 A;  2MEK A;  1FXA A;  3VTU A;  2AQ2 B;  4MEM A;  4K3C A;  4E71 A;  4KZC A;  3AEC B;  3RCZ A;  2KJH B;  4NJ7 A;  2JUO A;  2GI9 A;  1E8W A;  1GOZ A;  3DCG A;  1YD8 U;  1V5O A;  3KH0 A;  3Q8B A;  1JWS D;  2NTS A;  1E7P B;  2CHZ A;  4NJC A;  3KYC D;  3DBR B;  1V81 A;  1VZ6 A;  5TR5 A;  4UDU C;  2NS5 A;  5FKA C;  1V49 A;  3SU8 X;  1CK1 A;  1VLB A;  4A90 A;  2LVP A;  4NNJ B;  2KWD A;  3UQA A;  2RD0 A;  4KGS A;  1F0Z A;  2WP9 B;  2G45 B;  4ZYN A;  4B9K A;  1F2R I;  4YSY B;  1LO5 D;  2JZP A;  3VTW A;  3A1Q B;  3I57 A;  1Z2M A;  4XC2 A;  4BKG A;  3DOW A;  1IGD A;  2O6V B;  1JW9 D;  1GG3 A;  2NBV B;  1ET9 A;  3DHG C;  1Q0W B;  2LFI A;  2PMV A;  2LVO A;  4EFO A;  2PLP A;  2CU3 A;  1SIF A;  1FMA D;  3DHI C;  3M95 A;  4FUL A;  1TGZ B;  2JPH A;  2XK5 A;  1FXT B;  1Y56 A;  2K9X A;  2FCM A;  2WXO A;  2NR2 A;  1I4P A;  2C9W B;  2UU7 A;  2YEP B;  1WMH A;  3VFK A;  4PK1 A;  2O2V A;  2VZK D;  3ETR A;  1Y8R C;  3ZJV A;  3P4S B;  4ICV A;  3FIL B;  1WFY A;  2QHO A;  3ZNG C;  4KGR A;  3AEA B;  4DXA B;  2QIL A;  3AE2 B;  5JH5 C;  2N7J A;  2BVC A;  1FO4 A;  3V3X A;  2K3U A;  1Z5S B;  3T3O A;  3RMK C;  3RFZ B;  4ZOH C;  4NAW A;  3AE1 B;  5H8Y E;  4MT5 A;  3NUH B;  3NVZ A;  2RPQ A;  4XX5 A;  3GZN I;  4LCD E;  4KKJ A;  2XN9 C;  4ASW C;  3AH7 A;  4JPS A;  3TEX A;  2L1A A;  5E6J A;  2LHD A;  4A20 A;  2EKI A;  2BF8 B;  4F8C B;  4R3D A;  3H6N A;  1N63 A;  4YL8 A;  3R3M A;  3RNA C;  2OJR A;  5BO4 B;  4FJY A;  1WGY A;  1YNT E;  2WU2 B;  3HM3 A;  4FN2 A;  4GN1 A;  2CJO A;  5D7G A;  2DAJ A;  4B95 A;  2V4L A;  1SEB D;  1TS3 A;  3WA0 A;  1FD6 A;  1AAR A;  2K8C A;  3WAM A;  3KVF B;  3NZU A;  1WY8 A;  2CR5 A;  3RNF C;  1YOV B;  3U8Z A;  4B6W A;  3VR9 B;  4K81 A;  3AEF B;  3BZD B;  3APD A;  1SE3 A;  4P16 A;  1I7H A;  2AL3 A;  3L10 B;  2V3S A;  1E0Z A;  4GIV A;  2KXJ A;  4HPM B;  3OJ4 B;  3R2I A;  2L0T A;  1XEE A;  3HHM A;  3P4Q B;  3MJW A;  2KDE B;  1OEY A;  4FHK A;  3AE4 B;  4K7W A;  3P42 A;  3VUW A;  1SIJ A;  1NBF C;  3VAW A;  3IAS 1;  3CST A;  4KIK A;  1Q5W B;  1UWX A;  5DPR A;  5C23 A;  2YVC A;  3PT2 B;  5BYR A;  4KDI C;  3IHP C;  1ZW7 A;  3NVV A;  3UF8 A;  4KGT A;  1T5X D;  1YMH E;  1ET6 A;  3O13 A;  3DBL B;  1LGR A;  4MGZ E;  2CS4 A;  3TEZ A;  2MJ3 A;  3Q3N C;  2KMC A;  2QSD A;  1QLB B;  4YSX B;  3PZD A;  4ZYS A;  3RN9 C;  3DBH I;  3CMM B;  2KHW B;  2DAF A;  1WXQ A;  1TKE A;  5AUI A;  1KLG D;  1K52 A;  3B9J A;  2QJL A;  2QMT A;  4K1R B;  3B08 A;  1GUA B;  4BOZ B;  2K6Q A;  1MJD A;  2KWV B;  4RNA A;  1JCK B;  1UNS A;  2KFK B;  2KKC A;  5CHW A;  3PRZ A;  1A70 A;  3M62 B;  1F2R C;  2BYE A;  2WXI A;  2LXC A;  3IXS A;  1FM0 D;  1FNU A;  4XDC A;  4QAY A;  3W9C B;  1WJU A;  5G5G A;  3VXW A;  4WUR A;  1JRU A;  3NZ3 A;  3N30 A;  3WAL A;  2RDB C;  3PSE B;  1RM6 C;  2ON8 A;  1KH0 A;  1WGH A;  4US9 A;  3ZKJ C;  2IDY A;  2Z0D B;  3VTV A;  1WX9 A;  2I1K A;  4N59 A;  1OQQ A;  4USA A;  3E56 A;  2FNJ B;  3SHQ A;  4B0M A;  4KSK C;  2FIF A;  2WGS A;  1IGC A;  2X8X X;  1IPG A;  2X38 A;  3QCA A;  1KOT A;  3ABV B;  2A5U A;  2W82 A;  3KUC B;  3TSS A;  2BKR B;  2BTE A;  2DEN B;  2M1M A;  1RRB A;  2WDV B;  1S1Q B;  1QOA A;  3RYT A;  1OQY A;  3LYY A;  3DQV A;  2E6X A;  1HA5 A;  3AE5 B;  4RGN A;  1FCL A;  1VJK A;  2J42 A;  3LDZ E;  1E7U A;  1XLN A;  2DBY A;  2SEB D;  1C3T A;  3Q3J A;  2WS3 B;  2DZJ A;  2OOB B;  4PYU A;  1RWS A;  2LXA A;  2REX A;  3ZDT A;  3PRP B;  3BIN A;  3BII D;  3R66 C;  4DWF A;  1T0R C;  1YX6 B;  4JLC A;  3RNG C;  5H92 C;  2LGY A;  5TSS A;  1C4C A;  3W2D A;  1ZDX A;  3JSV B;  3T3N A;  2QEJ C;  2RDG A;  5GMV A;  4C56 C;  4LJO B;  1VCB A;  2AL6 A;  4II2 B;  2RDH A;  1XLO A;  2RSU A;  4IOI E;  2BB6 A;  2D2Q A;  3A9K A;  3Q6B A;  3ZTD A;  3NRZ A;  1N61 A;  1NYQ A;  1TYG B;  2QC8 A;  2K6D B;  4TV3 A;  4WWM A;  2FAZ A;  5J2R A;  3PTF C;  2WHI A;  4KX6 B;  1E10 A;  1FXI A;  3KUZ A;  3RNE C;  3NS1 A;  4FAD A;  5DPT A;  3H7P A;  2XBB C;  2A4Z A;  4IWO A;  1X1M A;  2LJI A;  1FEH A;  4GMV A;  2GOW A;  2ZVO A;  2KMA A;  3NVW A;  1P3Q U;  2GBN A;  3N1Y C;  4EUT A;  3ZLZ A;  1ZKH A;  4CHK A;  4E74 A;  4LDT D;  2KJR A;  2LVQ A;  1UF0 A;  4RM9 A;  2L83 A;  2JVC A;  4OVZ A;  1BXT A;  3Q3O C;  4EKU A;  2MBO A;  1JWB D;  2Z59 B;  2KDB A;  4WQM A;  1QF6 A;  3H9D A;  1YX5 B;  2DYO A;  1YQB A;  4HWI B;  1WM3 A;  4D2K A;  1SF0 A;  4OVV A;  1WX8 A;  3ZYY X;  2LMC A;  2HD5 B;  2DZI A;  3PHX B;  2IY0 B;  2JRH A;  2V3P A;  1WWT A;  2IGG A;  3PRM B;  1EF5 A;  4ARC A;  2MX2 A;  1UZX B;  1B9R A;  1L5P A;  3V05 A;  3PV1 A;  4GGQ A;  3AV8 A;  1C77 A;  5JHA A;  4J6I A;  4WJN A;  2WYQ A;  3FAH A;  2N9P C;  4IG7 B;  3TEW A;  1L0X B;  1NVI D;  4LLG M;  3DWM A;  4ANX A;  4O1N A;  2W54 A;  4HDO A;  4J3O D;  2KYW A;  3BK2 A;  1MHX A;  2M4N A;  1NEN B;  4CQN A;  1RFA A;  3GOE A;  1TS2 A;  4GSW A;  2WXN A;  4DXG A;  2AQ1 B;  1MFW A;  2FCS A;  3AM9 A;  3GZN B;  2MP2 A;  4XDD A;  4M0W B;  3ZXV A;  2ZNV C;  2G1E A;  1JWA D;  2N9K A;  3N3K B;  1YQ3 B;  1I4R A;  4C4V B;  3ZNZ B;  1OQR A;  4EEW A;  1LFD A;  4OZC A;  4A3O A;  2BWF A;  2NMQ A;  4LTU A;  5FK9 C;  3UIP B;  4K7S A;  3TUO A;  4AWJ A;  3B2G A;  3R7Q A;  2KAJ A;  2B3A A;  3I63 C;  5BYS A;  1QKZ A;  3A9J B;  3X0W A;  1STE A;  1SJE D;  2MW5 A;  2VH2 A;  4ZRP A;  3KWL A;  4AUQ C;  3WAN A;  4YSZ B;  1E6E B;  4YTM B;  1YQ4 B;  1E5W A;  1HTQ A;  4KSL C;  1IBX B;  3Q8C A;  3A4R A;  2JYE A;  4NZL B;  2FUH B;  4HCN B;  2C7H A;  5G5H A;  1F52 A;  4ICU A;  2OED A;  3KYD D;  5D3I B;  2EEL A;  4HRO A;  2BPS A;  4A9A A;  2N1W A;  2PJH A;  1P9D U;  2L3Z A;  5EE1 A;  1QZE A;  2M0A A;  2LUM A;  2N7E A;  4MSM B;  2NPT A;  3VH3 B;  4HPL B;  4P1B C;  2KNB A;  3CIR B;  1E8X A;  2KX3 A;  1P0R A;  3V6E B;  4YXD B;  5G55 A;  2MJD A;  4N9F 4;  4MEL A;  3V6C B;  4BKS A;  2KX0 A;  4TSS A;  1EU4 A;  2D3B A;  3Q8E A;  3T9L A;  3VRA B;  2IO0 B;  5IKC M;  2EKE C;  3VUX A;  4FLH A;  4DBG A;  3A33 B;  2M8S A;  3PGE A;  3ZUN A;  4EZK A;  2E3T A;  3IT4 B;  2KQS A;  3QC8 B;  2MLB A;  1V1P A;  3DBH B;  3MC0 B;  1PGB A;  4BKS D;  5AZG A;  2J52 A;  2L05 A;  2XEW A;  2R2Q A;  1JRO A;  3O65 B;  4MM3 B;  1AW7 A;  1I4X A;  2H89 B;  2J0M A;  1YIW A;  1ZXH A;  2DHZ A;  2JWU A;  2XNA C;  2LI5 A;  1MPE A;  2LWP A;  1K51 A;  1TS4 A;  5KHO A;  2KLG A;  4DDI D;  2L32 A;  4CYE A;  2MWS B;  4X57 B;  1A5R A;  1UGJ A;  1L7Y A;  3RZW C;  4BBN F;  2KN5 A;  2KAN A;  1WYG A;  3M3J A;  1T3Q A;  3AEG B;  2DYM A;  2JZZ A;  2W3S A;  1WH3 A;  2FCN A;  4W9E A;  2ZCB A;  2MBQ A;  4WJO A;  2ZNV B;  3W5U B;  2ACZ B;  4GDL B;  2ZW1 A;  1WZ3 A;  2KC1 A;  3PLU A;  4GLS C;  2QIE B;  2NBW B;  1KM7 A;  2KTF A;  2WDT B;  3RUL A;  2YLM A;  4P1C C;  1ZXI A;  2FE8 A;  1FFU A;  3DBS A;  3P2B A;  4ZDV A;  4XGA B;  2M19 A;  1C79 A;  2MBB B;  1BML C;  2N0S B;  1MG8 A;  2AYO B;  3AE8 B;  2H88 B;  4EZL A;  3PHW B;  4GU2 A;  1AN8 A;  1JAL A;  1BUI C;  1Q1O A;  2IBI B;  1TY0 A;  3ZNH B;  1NI2 A;  4I6N B;  3HRD D;  3AB5 A;  1V86 A;  3UI3 A;  2K8B A;  2W3R A;  1PDX A;  3QK0 A;  2LRU A;  3AMZ A;  4JIO U;  3EA6 A;  1XD3 B;  4Q2J A;  3APC A;  1HTO A;  4URK A;  1F9J A;  1V2Y A;  1UWM A;  2D3G A;  1IYF A;  2KVZ A;  1E7V A;  5HKH A;  3QIJ A;  4DK5 A;  2CHW A;  2C7N B;  1R4M I;  4ANV A;  4A8X C;  4W9H A;  3AU5 A;  1F1H A;  3DHH C;  4W9C A;  5EE0 A;  2INC C;  3D32 A;  4ZHP A;  2INP E;  2YEP F;  4W9K A;  4ARI A;  1PGA A;  3GB1 A;  1SSN A;  2WNM A;  3W5V B;  1KLU D;  4XYC A;  4NY0 A;  2ZCC A;  3AN1 A;  3W1S A;  2BYT A;  4MH0 E;  5AUK A;  3JVZ X;  4GXB A;  1T6B X;  2Y5C A;  1WR6 E;  1N6Z A;  5L95 C;  3KWV A;  4EOY A;  2V1Y A;  1GB1 A;  2WWZ A;  1OEY J;  3J9C A;  1R4N I;  3KLS X;  2V3N A;  4PS7 A;  5IOI A;  1XCQ L;  3ZTC A;  1XT9 B;  5G2N A;  3ML8 A;  1SBB B;  3Q8A A;  5HG2 A;  4TQ1 A;  4MJS A;  1RAX A;  3ZW3 A;  2BBC A;  2NVU I;  4IWP A;  4OZA A;  4BFR A;  3W1S C;  2LHE A;  3LB8 C;  1DOY A;  1ZOY B;  3MJ5 A;  2DX5 B;  3HVZ A;  3N20 C;  4KKI A;  4ZRQ A;  1L2N A;  1YJJ A;  1V1O A;  2CJN A;  2K22 A;  1WE7 A;  2KTR A; 
#chains in the Genus database with same CATH homology
 3Q8F A;  1OFF A;  4P6V F;  2BB5 A;  2BS4 B;  2LGI A;  2Z8L A;  3OWE B;  2D5G A;  1JRP A;  2IPK D;  1FEH A;  2LJI A;  2VZK B;  2RMM A;  5BMI A;  5MPO A;  3HVD A;  2Q5W D;  4L2Y A;  1HEZ E;  3NVW A;  1JWM D;  1QOB A;  3AE6 B;  3I9V 1;  1SJH D;  4C80 A;  3DWG C;  2KDM A;  1NYR A;  4HEA 1;  2K5P A;  2I38 A;  2PTL A;  1XCT L;  5I4D A;  5C2T B;  2OHF A;  4JWU C;  2L83 A;  2J4X A;  1P7F A;  2PVO D;  4YWG G;  1KFY B;  4OVZ A;  1EWY C;  2BS3 B;  4REZ A;  1BXT A;  1HQR D;  1MVK A;  3GS2 A;  2Y3A A;  2BT6 A;  4YTP B;  1KTK A;  1VRA B;  2INN E;  1JWB D;  4HKZ E;  1FNV A;  3KQ4 A;  4WQM A;  2MEK A;  1QF6 A;  1FXA A;  5BMH A;  2DYO A;  1R7S A;  2AQ2 B;  1EU3 A;  1CZP A;  2AX5 A;  4WH4 A;  2N9L A;  4D2K A;  1SF0 A;  3AEC B;  1L6V A;  1SE2 A;  1C9F A;  3ZYY X;  2LMC A;  3C8Y A;  2WDQ B;  2WLB A;  4NAW B;  2GI9 A;  2NTT A;  2V3P A;  1WWT A;  1GOZ A;  2JX5 A;  2IGG A;  4ARC A;  2JU6 X;  5HI1 A;  3AE3 B;  1SXT A;  1YN3 A;  1JWS D;  3P4R B;  3Q8B A;  1B9R A;  2NTS A;  1D5M C;  1E7P B;  1L5P A;  4NJC A;  3V05 A;  4C7Z A;  1VZ6 A;  3P63 A;  4RH6 A;  3MHZ A;  4UDU C;  3AV8 A;  1C77 A;  5FKA C;  1CK1 A;  1VLB A;  3FAH A;  4A90 A;  2KWD A;  3TEW A;  1JQ4 A;  4C7Y A;  3AED B;  1L0X B;  4KGS A;  1NVI D;  4LLG M;  3DWM A;  1F0Z A;  2WP9 B;  4O1N A;  2W54 A;  1FCC C;  4J3O D;  3U52 E;  3BK2 A;  1MHX A;  2MJE A;  1F2R I;  1NEN B;  4CQN A;  4YSY B;  1LO5 D;  2JZP A;  1TS5 A;  2WXH A;  3I57 A;  4IKG A;  1TS2 A;  1IGD A;  1JW9 D;  1ET9 A;  3BYT B;  2WXN A;  1XF5 L;  2LFI A;  2PMV A;  1KRH A;  4DXG A;  1NI3 A;  1QQR A;  2AQ1 B;  2CU3 A;  2PLP A;  1IUE A;  3AM9 A;  1FMA D;  4XDD A;  3BVZ A;  1L0V B;  2G1E A;  1JWA D;  3E9S A;  3PZ7 A;  2IJ0 A;  1ESF A;  1Y56 A;  2K9X A;  2N9K A;  5D3D A;  2IGH A;  2WXO A;  2WXG A;  1YQ3 B;  1I4P A;  1I4R A;  2PVG C;  3AEE B;  2YEP B;  1OQR A;  2GB1 A;  4EE2 A;  2L52 A;  4XE0 A;  2VZK D;  3ETR A;  3SR6 A;  4ITK A;  3ZJV A;  2HDE A;  1K50 A;  3P4S B;  3GP7 A;  3FIL B;  1XO3 A;  4OZC A;  2Y5P A;  4LTU A;  2NMQ A;  1ZUD 2;  1VZ7 A;  5FK9 C;  4KGR A;  3TUO A;  3AEA B;  1GPX A;  2QIL A;  3B2G A;  4OHJ A;  2B76 B;  3AE2 B;  2N7J A;  4L1B A;  1SE4 A;  5EE9 A;  1M4V A;  3V3X A;  1FO4 A;  2K3U A;  3EUB 2;  1NEK B;  2KAJ A;  2ZW0 A;  3T3O A;  3RFZ B;  4ZOH C;  5BYS A;  1VZ8 A;  3AE1 B;  1QKZ A;  5H8Y E;  1STE A;  1V1P B;  1SJE D;  4MT5 A;  1ROE A;  3NUH B;  3NVZ A;  4H2A A;  2FBW B;  4ZRP A;  1YN4 A;  3KWL A;  4MH8 A;  4KKJ A;  2XN9 C;  1MHH E;  1QOG A;  3AH7 A;  4JPS A;  3TEX A;  2L1A A;  5E6J A;  4YSZ B;  1E6E B;  3MP9 A;  4RGM A;  4YTM B;  2LHD A;  1YQ4 B;  2R61 A;  1WSP A;  2EKI A;  1IBX B;  3Q8C A;  4R3D A;  1N63 A;  2JYE A;  1C4P A;  4NZL B;  3RPF C;  3BVM A;  1P7E A;  2BW2 A;  5G5H A;  1YNT E;  2OED A;  3MFG A;  5LNK 1;  2WU2 B;  5D3I B;  3VQI A;  2EEL A;  1WGK A;  2CJO A;  2JYT A;  2WXQ A;  3P4P B;  4HRO A;  5D7G A;  4A9A A;  1SEB D;  4RGO S;  2W55 A;  1TS3 A;  2M56 B;  1D5Z C;  2TSS A;  3LXF A;  1FD6 A;  2JXT A;  1TJE A;  5EE1 A;  5JXV A;  2M0A A;  2LUM A;  1TKY A;  4M0W A;  4HKQ A;  1WRI A;  3R2T A;  3URY A;  1N60 A;  1HXY D;  2ONQ A;  4L23 A;  3CIR B;  3VR9 B;  3AEF B;  3VRB B;  3BZD B;  3SFE B;  5GXG B;  1SE3 A;  1PFD A;  1I7H A;  4P16 A;  4YXD B;  2MJD A;  1E0Z A;  3U4E G;  4US8 A;  2KAC A;  1V97 A;  2J53 A;  3FIL A;  5BMG A;  4TSS A;  4JWS C;  4RCO A;  1EU4 A;  3Q8E A;  3R2I A;  4RF1 A;  1DGJ A;  3VRA B;  2WQY B;  1XEE A;  1AYF A;  3P4Q B;  4IDI A;  4A6Q A;  1SB3 C;  1C76 A;  1E9M A;  1ZP0 B;  2JQR B;  4NAM A;  1DOI A;  2E3T A;  3ZGZ A;  3AE4 B;  3WCQ A;  3IT4 B;  3P42 A;  4RF0 A;  2WDR B;  1V1P A;  4WIP A;  3MC0 B;  1PGB A;  1SIJ A;  1RYJ A;  2WXR A;  1L6U A;  2LEK A;  2WXK A;  1F77 A;  2BS2 B;  3NVY A;  2J52 A;  1K53 A;  3IAS 1;  4OW0 A;  1XLP A;  1DOX A;  1GAQ B;  1JRO A;  1CJE A;  1HZ6 A;  4MM3 B;  1AW7 A;  1I4X A;  2V4I B;  1UWX A;  2H89 B;  4WAF A;  1ZXH A;  1IBX A;  2JWU A;  5BYR A;  2XNA C;  3N9Y C;  4OZB A;  1EWC A;  2DWQ A;  1PGX A;  1ZE3 D;  1MPE A;  1JWU D;  1K51 A;  1TKG A;  1TZO A;  1FRD A;  1TS4 A;  3CWI A;  3AEB B;  2PIA A;  3NVV A;  4KGT A;  2L32 A;  1T5X D;  1D4B A;  3BVG A;  1VR9 A;  2DLB A;  1YMH E;  1ET6 A;  3O13 A;  5HFY A;  3TEZ A;  1UGJ A;  2MJ3 A;  1JML A;  1QT9 A;  2QSD A;  1N62 A;  1QLB B;  4YSX B;  1N5X A;  4B0E A;  4ZYS A;  1WYG A;  1T3Q A;  2K0P A;  3P1M A;  3AEG B;  2DYM A;  5AUI A;  1WXQ A;  1TKE A;  2W3S A;  2IGD A;  4DQO C;  1KLG D;  2ICI A;  5T8I A;  3R8B A;  4LK0 M;  1K52 A;  3B9J A;  2QJL A;  2QMT A;  4XWW A;  3W5U B;  3BWU D;  2ACZ B;  4GDL B;  4N6E B;  2ZW1 A;  3SEB A;  2G9H D;  4RNA A;  4GLS C;  1JCK B;  1UNS A;  1ZDV A;  2QIE B;  3VR8 B;  1B1Z A;  1Q10 A;  1L4D B;  1QOF A;  3U2S C;  1A70 A;  1ZXI A;  1F2R C;  2WXF A;  2WXI A;  1I4Q A;  2FE8 A;  1DYQ A;  1FFU A;  3IXS A;  1FM0 D;  1I4H A;  5EE3 A;  4DXF A;  1HZ5 A;  1FNU A;  4RGT A;  4XDC A;  2M19 A;  3W9C B;  1C79 A;  1CQV A;  1BML C;  2N0S B;  3BK1 A;  3AE8 B;  4WUR A;  5G5G A;  3NZ3 A;  2H88 B;  1MI0 A;  1RM6 C;  1AN8 A;  1JAL A;  1BUI C;  1KH0 A;  2ON8 A;  4US9 A;  4JX1 C;  1TY0 A;  2WXL A;  2WXJ A;  3SFD B;  1PYW D;  1V8C A;  4TQ0 A;  2WU5 B;  1J7C A;  2IDY A;  2WXM A;  3HRD D;  3BYY B;  3AB5 A;  1FRR A;  3UI3 A;  4N59 A;  1OQQ A;  4USA A;  3E56 A;  2W3R A;  4B0M A;  1PDX A;  3AMZ A;  3EA6 A;  1IGC A;  4HRS A;  5BYQ A;  3U7Z A;  2X38 A;  4Q2J A;  1YJI A;  3HUI A;  3ZQ4 A;  4YT0 B;  4YTN B;  2I2Y A;  1XLQ A;  1D6E C;  1UWM A;  1GB4 A;  1XXG A;  3ABV B;  3PO0 A;  1ENF A;  2W82 A;  2KN4 A;  1RFK A;  1L4Z B;  3TSS A;  4A8X C;  1YN5 A;  3AE7 B;  5EE0 A;  2BTE A;  3TEY A;  4ZHP A;  4FXC A;  1UUP A;  4TMA B;  2INP E;  2WDV B;  2YEP F;  1QOA A;  3LYY A;  1VDV A;  2KQ4 X;  4ARI A;  1PGA A;  1HA5 A;  2E6X A;  3AE5 B;  3AE9 B;  4N58 A;  4PT5 A;  1C78 A;  4RGN A;  1FCL A;  1VJK A;  2J42 A;  1TY2 A;  3GB1 A;  1J7B A;  1SSN A;  2FUG 1;  2KMM A;  1KF6 B;  2PKO A;  4ZHO A;  4XWT A;  4AQ7 A;  1XLN A;  2SEB D;  2DBY A;  2WNM A;  4MAC A;  3W5V B;  3Q69 A;  1KLU D;  1AWD A;  2WS3 B;  3EGR A;  3L4P A;  2GRI A;  3AN1 A;  4AS1 A;  3W1S A;  2BYT A;  2WXP A;  1RWS A;  4RFB A;  5AUK A;  1ZPS A;  1FFV A;  3BII D;  1T6B X;  3IT6 B;  2Y5C A;  5H92 C;  3KWV A;  2JSV X;  3H8H A;  5TSS A;  1C4C A;  5HHD G;  3W2D A;  1GB1 A;  4HJG E;  4A55 A;  1ZDX A;  3T3N A;  2QEJ C;  2RDG A;  3J9C A;  3KLS X;  4C56 C;  2AQ3 B;  2V3N A;  3B2F A;  5FR3 A;  1XCQ L;  1FIQ A;  2MH7 A;  2RDH A;  1XLO A;  4IOI E;  2BB6 A;  2PW9 A;  5C3J B;  3ZJT A;  1N5W A;  1SBB B;  3Q8A A;  5HG2 A;  4TQ1 A;  1PUT A;  3NRZ A;  1ACC A;  1N61 A;  2BBC A;  1NYQ A;  3FC4 A;  1TYG B;  3PZ8 A;  4OZA A;  3ZJU A;  4GDK B;  4WWM A;  1J7A A;  2SAK A;  2LHE A;  3IAM 1;  2V0G A;  1L0Y B;  3LB8 C;  1DOY A;  1ZOY B;  3MJ5 A;  3HVZ A;  1I4G A;  4KKI A;  4ZRQ A;  4KX6 B;  4JE3 B;  2HTM E;  1QIL A;  1E10 A;  1EM7 A;  2RPV A;  1FXI A;  1C4A A;  1YJJ A;  1V1O A;  2CJN A;  2K22 A;  3NS1 A;  1D5X C;  1FNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...