2BQQA

X-ray structure of the n-terminal domain of human doublecortin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
AKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NEURONAL MIGRATION PROTEIN DOUBLECORTIN
publication title The Dc-Module of Doublecortin: Dynamics, Domain Boundaries, and Functional Implications.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 2bqqA00
1MFWA 5IO9A 1UF0A 2BQQA 2DNFA 5IOIA 1MJDA 5IP4D 5IN7A 5IKCM 1MG4A
chains in the Genus database with same CATH superfamily
3ML8A 1HTOA 4M0WA 3ZRFA 1WE6A 1T5XD 1GG3A 1OTRB 3V05A 2CJOA 2IPKD 2FUHB 3IHPC 3Q6BA 2QILA 1Y8RC 1FPYA 1IUEA 2KX3A 3KYDD 1FRDA 3U30A 2KKCA 5MPOA 5L95C 5FR3A 1FO4A 2X38A 3Q3NC 4I6LB 1JWMD 2V0GA 3O13A 5LXHA 1WYGA 4EUTA 2REXA 3DBRB 4TUUA 3L10B 1J19A 2G4SA 3Q69A 4KV2A 4MT5A 1F2RI 3N30A 2M0AA 2BS4B 2MSED 1BUIC 1JRPA 4MSMB 3EGRA 3FILB 2UU7A 1ESFA 5E6JA 4AOFA 1J7CA 2NPTB 1B1ZA 3RNCC 2MLBA 2KVRA 1SIJA 3ZJVA 1TIFA 1E90A 1WF9A 1ENFA 1WRDB 1TYGB 4IOIE 1I4RA 2KC2A 2BYVE 2L3ZA 4BKGA 4GOCA 1TS2A 4II3B 4A3PA 2D07B 4IC7B 2KJ6A 2FCNA 2NTTA 4MJSB 1E0ZA 2KTRB 2JXXA 3CSTA 2RDBC 4IM0A 2M1MA 2JY6A 2DZMA 4M01A 2G9HD 1N6ZA 2J0JA 4WJOA 5HG2A 3ZNID 3SD5A 1BT0A 1N60A 5CTRC 4K1RB 4B0MA 3DWGC 4P1BC 2FCQA 4JL9A 2OHFA 3GP7A 4LNKA 2N9KA 2KN4A 4XE0A 2J4XA 4G3XB 3HUIA 3P42A 2ZEQA 1J7AA 2V4LA 3BK2A 2IY1B 1GJZA 2RPQA 3WCQA 1DOYA 4S0RA 4EFOA 4URKA 3ZNGC 1TKYA 2R2OA 3K9PB 4XGAB 2GLSA 1SB3C 2KX0A 3BY4B 4BOZB 5HKHA 4HDQA 2C7HA 3AI5A 2LHDA 2GOWA 2MW5A 3VXWA 2LVOA 3AE3B 4ZDVA 4DXGA 3VVWB 1VJKA 2I2YA 4GDKA 4KKJA 3UINB 2L05A 4A6QA 1GPXA 4NAWA 2O6VD 2LUMA 1AYFA 5H8YE 4Q2JA 3EA6A 4YTMB 1KRHA 1WY8A 2QCZA 2KZRA 2BS2B 3QX1A 4JE3B 2M19A 4AJYB 3ZO5B 3OJ4B 5GMVA 2JYEA 4YTNB 1E8ZA 3EUB2 3ZNHB 4K81A 4TSSA 1YJIA 3QHTA 3ZDTA 2W55A 2X8XX 4A55A 4BBNC 4NPNA 1F2RC 2IBIB 3W9CB 1FFVA 1MHXA 2L1AA 2K8CA 2PJHA 2JZPA 2WYQA 5DCNA 1N61A 2QHOA 3APFA 2G3QB 3WALA 2ZW1A 3W1YA 1CK1A 2DAFA 3T8MA 2IGHA 2MP2A 3ZKJC 1JRUA 2KOXA 2K1FA 3BVGA 1L4DB 1P3QU 4KZ0A 2SAKA 1MG8A 3DHIC 3TEWA 4S17A 2KWDA 2JF5A 3VTVA 3IG3A 1GB4A 2H89B 1P7EA 4NQLB 3MHSD 1ROEA 4KGRA 3AM9A 2ZNVC 1D4BA 3KLSX 2L83A 3AECB 4DHJD 2WQYB 2KO3A 5C1ZA 2N1VA 5JHAA 2DYMA 2N7DA 2NBWB 2K8BA 2NPTA 2ONQA 4N59A 4FADA 1YIWA 4P16A 4WAFA 1WXMA 3H1UA 2HTME 2J7QB 4HVBA 2AQ3B 2ZJDA 4ZRIA 4ZRPA 1VCBA 4RGOS 1IBXB 2DYOA 3RT3B 2D2QA 3ZGZA 2GBRA 4G11A 1WGDA 2WX0A 4J3OD 1WR1A 2KTRA 2BPSA 2BGFA 3EFCA 2FNJB 2FE8A 3TSSA 1UWMA 4AS1A 2NR2A 2RGFA 1WIAA 1Q10A 4K7WA 2C7MB 4G50A 4CO7A 2WDQB 2WXJA 4LDTB 2W54A 3MHZA 2GI9A 1WFYA 1OQQA 3DBLB 3AULA 5G55A 1HQRD 3KUCB 2MJEA 2AEHA 1ZDXA 5H92C 1GAQB 3AEGB 1TY0A 4FHJA 4LNNA 4YSXB 1K8RB 5G5HA 3HM3A 1QOGA 2UYZB 3SDLC 2OEDA 3A9KB 4HLEA 1YQ4B 5DPRA 1OEYJ 3Q3MC 4ZRKA 5BMHA 3CMMB 2UWQA 1N5WA 1JWSD 2K22A 3N1YC 2GBMA 3N32A 4A3OA 5AZFA 1ZXHA 1XLPA 4K7UA 1RRBA 4ANUA 2WXFA 2N9LA 3DBHB 1SE4A 3W1SA 2KN5A 2FBWB 2RD0A 2WXLA 4W9LA 4C80A 3BVZA 3VFKA 2ZVNA 2JRHA 1MG4A 2JZ3B 5DPSA 1S3SG 2BBCA 4REZA 2OJWA 1V6EA 4BVUC 1G6JA 2HJ8A 5JZEB 2ZZPB 5E6NA 2AYOB 3X23A 1JWUD 1VZ6A 3B0AA 2MJ3A 1WXQA 2QJLA 4LLGM 1FNUA 1V49A 5FR6A 1EU4A 1LXDA 3RZFA 3AEFB 5AZHA 2DAJA 3NY5A 3PO0A 2MJDA 2YVCA 3N1XC 4W9DA 1YOVB 4OZBA 2M56B 2JUOA 3ALBA 2A5UA 2IY0B 2AL6A 3DVGX 4XWWA 4RM8A 2WS3B 4O1NA 1XXGA 1KTKA 2WXHA 3KH0A 4PS3A 5CHWA 1RM6C 3AE4B 3MTNB 2I1JA 3TUOA 3K9OB 4YWGG 1OQRA 1ZGUB 3B1LX 4A8XC 2N9PC 2EMSA 2FCMA 1WRIA 3WAPA 3PRMB 4DDGD 4IG7B 4ANVA 2G45B 2M0XA 1TGZB 1B9RA 4KIKB 2WDRB 1ZPSA 1E8WA 2JWUA 3M63B 1WGGA 1VR9A 2JVCA 1SSNA 3A4RA 3QQ8B 1EU3A 4DHJB 3R66C 4GMVA 1WXAA 3PV1A 1YN5A 1L0XB 4YSYB 3DOWA 1WGKA 2WX1A 3L54A 3RNBC 3KWLA 3A33B 2C9WB 2DWQA 1VDVA 3RULA 1R4MI 2BWFA 3PTFC 1NYQA 3I5JC 1CQVA 4XWTA 3ZJTA 2HTHA 3PT2B 2NS5A 4WH4A 3BK1A 1KJTA 4E74A 4TV3A 3VH4B 1OFFA 2D11A 3L08A 3E56A 3PHWB 4F1SA 3HHMA 3J9CA 1JWBD 3HRDD 3NS1A 4NAWB 1D5XC 1DYQA 2B76B 5TR5A 4EEWA 3UGBB 2MA9B 3KWVA 2WLBA 2KYWA 1FMAD 2XBBC 2QIEB 3Q8FA 3ZXVA 1R4NI 5D7GA 3DQVA 3AU5A 4QAYA 1V9JA 1SE3A 3H7PA 3CWIA 4D2KA 1F9JA 1T0RC 1MJDA 1XO3A 3QCAA 1KF6B 4PK1A 1ZXIA 5G5GA 4WWNA 1WGYA 4P1CC 1GC6A 3V61A 1WM3A 3VRAB 4XDCA 4YT0B 2KDEB 1UH6A 1KH0A 2V9HA 3ZQ4A 1WSPA 3LXFA 2O6VA 4MH0E 4KGTA 2IGDA 2ZNVB 4HROA 2CHXA 2MBEA 3MFGA 1I4XA 3UI3A 4LK0M 3L17A 4M00A 2INPE 5LNK1 3JYUA 4JLCA 2MP2B 3NZSA 1WX9A 3ZJUA 1F52A 4AUQC 1XLOA 2WXOA 2LJIA 2V4IB 1L5PA 3V60A 2V3SA 2JXTA 1KLVA 1DOIA 3ENEA 3T9LA 2D5GA 3Q3OC 2MBOA 4JQWC 3IFWB 4W9JA 4M8NA 2YEPF 1V5TA 1I35A 2D10A 4ARCA 3B08A 3Q8AA 1JQ4A 1TZOA 3V6EB 3SU8X 4IW0A 1WJUA 3V3XA 1FD6A 3HVZA 1RWSA 3VTUA 3PSEB 3P4RB 4FA6A 2Z0DB 5D3DA 1UUPA 2DZJA 1C4CA 2KT7A 1WXVA 3P4QB 3TJPA 3E9SA 2VH2A 1NBFC 3NZUA 2CS4A 2K3UA 1C1YB 2DLBA 4TKNA 4KIKA 3ZVVA 3U7ZA 3Q8BA 1WJ6A 2KDIA 4K3CA 5D6JB 2ON8A 2NCNA 1JWAD 2L76A 4PYUA 4HJGE 3VAWA 2IYDB 3IXSA 1K53A 1C77A 1LQBA 1SE9A 3AE1B 1P7FA 3I57A 4DQOC 5C3JB 5BO4B 4ZOHC 2IO0B 3T3NA 3M62B 4FXCA 3VRBB 3DVGY 5D2MB 4LJPB 1H8CA 1ZOYB 3KQ4A 1YMHE 1FFUA 1XF5L 3PGEA 3ZYYX 4BBNF 4F7ZA 1NDDA 2CU1A 2MWSB 5EE3A 4MELA 3IAS1 1UNSA 2LD9A 4LCDE 1S1QB 2PKOA 2FIFA 5EE0A 2JU6X 2ICIA 2LUEA 2MX2A 1XT9B 1FXIA 1BMLC 4PYZA 4BKTA 1PGXA 1SF0A 1RAXA 5EDSA 2FCSA 1KLUD 1Q0WB 3AE6B 1T3QA 1LM8B 4GGQA 1MI0A 4I6NB 2K39A 4ITKA 2WXIA 3RYTA 2WXNA 2KLGA 2ZCCA 3M3JA 2QEJC 4F8CB 2N4FA 2WXMA 3EFUA 4TQ1A 2K5PA 3B2GA 2EKIA 1JW9D 2LGDA 4EZLA 4NNJB 3A9JA 3AE7B 2KTFA 4US8A 1GOZA 1V80A 2PW9A 4C00A 2PVOD 5IA7A 4N9F4 4OW0A 4ZYNA 4X57B 3GZNI 1H4RA 1PUTA 3P63A 3QC8B 2KFKA 4KX6B 1KOTA 1E9MA 4WQOB 2LRUA 1TY2A 3L13A 2WXPA 1IGDA 4GB9A 4C56C 3ABVB 2SEBD 2WNMA 1GNUA 3U8ZA 3MJ5A 1SE2A 3LDZE 5CX3A 2N1WA 3EECA 4IUMB 1XCQL 2KMMA 2ZPNA 1SJHD 2LGIA 5G2NA 2NMQA 2WWZA 2I38A 2KNBA 2KXJA 2KC1A 4FULA 4YXDB 4GSWA 1HXYD 2K25A 3AMZA 3GOEA 1HEZE 2PMVA 2MBBB 2Q5WD 1FIQA 3RZWC 3SHQA 1ET9A 2R2QA 3VR8B 3M95A 2N0SB 1WX7A 2QSDA 4JPSA 3NVWA 4JWUC 1ACCA 2BB6A 4IDIA 2AQ1B 4K7SA 2BTEA 2KVZA 4FJZA 4JX1C 4RF0A 1EO6A 1RLFA 4XX5A 1OQYA 2JT4B 1PFDA 3UQAA 2KACA 2K0PA 3W2DA 2XNAC 4RH6A 2G4DB 1ZKHA 3ZLZA 4J6IA 4DDID 1OGWA 2K9XA 3PREA 5IOIA 4CYEA 4NZLB 1SEBD 4IWPA 2OOBB 5IP4D 1WE7A 3R7RA 4HCNB 3PHXB 2LRWA 4DXAB 4AJWA 3UF8A 3FAHA 2LGXA 1V8CA 4EZKA 3B2FA 3R2IA 5BYQA 2LVPA 1P1AA 1J7BA 3U2SC 2DENB 3ZIMA 4HDOA 1EF1A 2LHEA 3KW5B 5GXGB 4ZYSA 3ZUNA 1PGAA 2INCC 1UF0A 4HKZE 2LJ5A 2FAZA 3AB5A 1E7PB 5D94A 2JPHA 2A4ZA 2PIAA 4DK5A 3AE2B 4BKSA 3P2BA 2MH7A 2N9EB 2VRRB 3AH7A 3H7PB 3KVFB 4MM3A 1XLQA 2W82A 3DPDA 2EKEC 3NS8A 2CHZA 5D3IB 4A90A 1K52A 2GB1A 3SFDB 5KHOA 4ARIA 1V2YA 5HI1A 1E8XA 1CMXB 5EE9A 2KQ7A 1TZ1A 1X1MA 2LVQA 4NJ6A 3ZTDA 2LASA 3CSFA 1R7SA 3BYTB 1QOAA 2O6VB 3MC9A 2AWTA 1HZ6A 2KK8A 2XEWA 4WIPA 1HA5A 2HDEA 3Q3FA 1Q1OA 2MCNB 2YLMA 4IKGA 3N20C 1UWXA 3C19A 4R3DA 1AARA 5L83A 3X0WA 2H88B 3AE5B 4PT5A 3ZNZB 1NI2A 2L52A 1R4MB 3RNEC 2E6XA 3W1SC 2ZPYA 3AE9B 3H9DA 2IZVB 1I4PA 3MP9A 3VHTC 4P7IA 2EMTA 4HPMB 4ANXA 4WWOA 3AEAB 1TKGA 3DVNU 1YQ3B 3I9V1 3OG5A 2YEPB 2GBJA 2ZVOA 2WP9B 3GB1A 4FJVB 4ICVA 4MGKE 2KD0A 3DBHI 3I63C 3AE8B 4USAA 2DZKA 2KWVB 2LEKA 2MEKA 1E7VA 4W9KA 1R4NB 4KSKC 1ZDVA 4M8MA 2CHWA 3AEEB 1YX5B 3VTWA 3Q14C 2V3PA 3L0WB 3I3TB 2PPHA 4DHZB 2ZCBA 3KUDB 2V1YA 3A1QA 3R8BA 1LFDA 2J0KA 3QWZB 4MH8A 1V97A 2R61A 3ZTCA 4HWIB 1FCCC 2LWPA 4A20A 4GXBA 1V86A 1EWYC 3RNAC 1I7HA 5HFYA 4BKSD 3UQBA 3QJZA 4WJNA 3W5UB 1M94A 2M8SA 2GBNA 1T6BX 1C4AA 1XLNA 2HJ1A 4MGIE 3ZDMC 4TQ0A 3R2TA 1E7UA 1YX6B 3APDA 1J0GA 2Y5PA 1L4ZB 2J53A 4RFBA 4P6VF 4B9KA 1P98A 1C3TA 3GE8C 1WM2A 1LO5D 2KDMA 3QIJA 2WDVB 2MBHA 4WAAA 1F0ZA 2KWCA 4RGTA 3RNFC 2GBKA 1AW7A 3TL5A 4WQMA 3R3MA 2AL3A 2BW2A 2LI5A 3RNGC 1D6EC 1WXSA 4WWMA 3PS6A 1LGRA 2BWES 2BYEA 1FEHA 2KFJA 4HCPB 1JCKB 4RGMA 3RD2A 2WDTB 1JALA 4LJOB 3MC0B 4N6EB 3A9JB 2CKHB 4XDDA 4HK2A 1QLBB 2L0TA 1JMLA 2N7EA 1L6VA 1QILA 2W3SA 3LYYA 2IO1B 3ONSA 3Q3JA 5FK9C 2LGYA 2JZZA 2CJNA 2INNE 2I1KA 5CHVC 3CIRB 4NQKE 1GC7A 2BT6A 4BAXA 3GE3C 4L23A 1QOBA 2RPVA 4WURA 1KLGD 1QKZA 2N9XA 2LXAA 1NEKB 3QK0A 5FKAC 2XN9C 4LTUA 2KFKB 3ZW3A 4EKUA 1TTNA 2L7RA 1E10A 1PQSA 4HPLB 4IM2A 4NAMA 3RN9C 5JXVA 3TCAA 2FUG1 1OEYA 3ZXRA 2D3GA 5C2TB 2MRPA 5AEKB 2ASQA 1XQQA 5AUKA 5HHDG 2QMTA 3KUZA 2C5LC 3DVNV 4OZCA 3RPFC 2K8HA 4HKQA 3ML9A 1VZ7A 1ZE3D 3RCZA 2LMCA 2Y5BB 1KFYB 2JX5A 4II2B 2Z59B 1WI0A 4RGNA 3JVZX 3OJ3A 5AUIA 1XD3B 5BMGA 1WMHB 2LFIA 4EZJA 3P4PB 4ZRQA 3Q8EA 1FRRA 4JGHB 1N63A 4W9GA 2AQ2B 1L6UA 2O2VA 5BYRA 1C76A 3A4SC 1V5OA 3DCGA 3MC8A 4XZ4A 4ASWC 3WAOA 2B3AA 3C0RB 4C7ZA 3S2AA 5IAAC 4W9CA 4LDTD 4HJKA 2VZKD 1UBIA 4OVZA 4HXDA 1UZXB 4A9AA 4OZAA 3R7QA 2CU3A 5E6OA 1QQRA 4B6WA 1E6EB 1SJED 1WJ4A 1N62A 1UBQA 5AZGA 1N5XA 2IO3B 1TS5A 2V3NA 1WYWB 2C7NB 3AXCA 4C7YA 2JQRB 1PGBA 1NYRA 4KDIC 3AU4A 1PYWD 2KJRA 4AWJA 2RMMA 4E3CA 3RI7C 1P0RA 1HE8A 3PZ8A 4ZRJA 4EE2A 2KWUB 1UELA 3PZ7A 3DBRI 4RMAA 1P9DU 4GDLB 4RF1A 2IDYA 2KANA 3U7DA 1D5MC 1TS3A 2J42A 3AV8A 3GZNB 3N1ZC 4C4VA 1SBBB 1UGJA 1I42A 3JSVB 2PE6B 2DYBA 2J52A 4JIOU 4WWPA 1J8CA 3U4EG 3H7SA 2CR5A 4MACA 3NJTA 3NUHB 4MM3B 3DWMA 1CJEA 2Y3AA 3DDCB 2DZIA 1WWTA 2PE9A 1D3ZA 4L2YA 1ZW7A 1UD7A 5JH5C 3QAQA 3BVMA 1NENB 1DOXA 4FJYA 1TKEA 1WGRA 2WXRA 2NTSA 4ANWA 1YN3A 3VUXA 1TBEA 4HPPA 3AEBB 2KJHB 2L32A 1FM0D 1I4GA 1E5WA 2BF8B 2WU5B 4GLSC 3NVVA 2Z8LA 4L1BA 2RDGA 4LNOA 1Y56A 3JW0X 2LZ6A 1PDXA 4AQ7A 3BINA 3APCA 3Q2AC 1V1PA 2HD5B 5E6PA 2GMIC 4W9EA 1ZUD2 4LNIA 1EWCA 4E71A 1HTQA 3PPAA 3PVLA 4US9A 2IO2B 4ZHOA 3HK0A 1V1OA 1U4AA 1WJNA 4KDLB 2BB5A 2K6DB 3WA0A 3V62A 3LB8C 3TBLD 1XCTL 2W3RA 1C79A 3RMKC 2D3AA 3LJ3A 2M4NA 2WXGA 1IPGA 2JSVX 4LNFA 2C60A 1IYFA 2G1EA 3CF6E 2DBYA 3UIOB 2W9NA 3HIZA 5J17A 3HM6X 4TMAB 3NVYA 1RFAA 2K6QA 1F1HA 2WGSA 5EE1A 1WX8A 3P4SB 3WIMA 1QZEA 3H8HA 1WMHA 2NBUA 2BKFA 4NJCA 1D5ZC 3AN1A 3FILA 1MVKA 2RDHA 3PZDA 1WZ3A 2LGSA 4CQNA 2RSUA 3VUWA 5DPWA 4PS7A 2KDFB 2IJ0A 3IBEA 5IKCM 5LLIA 4FBJB 4HEA1 3N3KB 4MEMA 4EOYA 4ZHPA 3A1QB 1L7YA 1VZ8A 4RM9A 2TSSA 3PRPB 4JWSC 4FLHA 3TMPB 1BXTA 2NBVB 3HVDA 4PS8A 3SEBA 2J0MA 4MJSA 1Q5WB 2KDBA 4MSQB 5I4DA 5BMIA 1FXAA 2GRIA 2AX5A 1Z5SB 4DWFA 2JRIB 2MBQA 4WJQA 3NVZA 3IT4B 1WZ0A 2QDFA 1T0SC 1WGHA 1ZP0B 4IM3A 4W9IA 3WANA 2VZKB 2BYTA 1STEA 4GDLA 5DPTA 1QT9A 2KMAA 2DNFA 1GB1A 1K51A 1TS4A 3ZRCA 2KAJA 1SXTA 2QC8A 2FIDA 1KM7A 2WU2B 3L16A 3ETRA 3JSVA 4FHKA 3PLUA 2PVGC 1YQBA 1FNWA 4XC2A 2VH1A 4YL8A 3NHEB 1K50A 1FCLA 4N58A 5IN7A 4YTPB 3OAWA 3EHVA 4H2AA 4W9FA 4M02A 2XK5B 1XEEA 3EC8A 4K3BA 2E3TA 3ECIA 1FXTB 1YNTE 1DGJA 2M17A 1M4VA 1ET6A 3URYA 1RFKA 1VLBA 2D3BA 3IAM1 4KVGB 1HZ5A 1IGCA 4W9HA 1A5RA 3IT6B 3D32A 4MGZE 4RCOA 4WJPA 3VQIA 3PLVA 2N7JA 3DBSA 3SR6A 4YSZB 4BZAA 1WR6E 4M0WB 1L2NA 3VR9B 1JROA 4NY0A 4ACFA 4OVVA 2MQJA 4OVUA 2BKRB 3DHHC 1NI3A 3DBLI 2Z0EB 5C23A 1FNVA 3VDZA 1YJ1A 1WH3A 4BFRA 3NG0A 4XYCA 4CHKA 1T0QC 3OWEB 1L0VB 5TSSA 4I6PA 1IP9A 3FKYA 1RYJA 2WHIA 1TJEA 1E8YA 5LXIB 1I4QA 1EF5A 2EELA 1I4HA 4AP4C 2INDC 4NJ7A 1SGHA 4KSLC 3VH3B 1MPEA 3L4PA 3DHGC 2KHWB 5T8IA 1EM7A 2Y5CA 2WXKA 2ZW0A 5BYSA 1YN4A 3IVFA 3BYYB 4FN2A 2BS3B 3FC4A 3V6CB 1C78A 1L0YB 3BWUD 2O2VB 1CZPA 1T0YA 3TEYA 2KMCA 3QARA 3N9YC 2PEAA 1UGMA 4MDKE 5JHBA 1EUVB 3NRZA 4B95A 2OJRA 4UDUC 5IO9A 4G0NB 3U52E 4DHZE 3P1MA 4HRSA 4RNAA 2L0FA 1MHHE 3C8YA 4MGYE 2NVUI 3WAMA 5J18A 1IBXA 2D3CA 4ICUA 2WXQA 2KQSA 2ACZB 1VRAB 2RR9A 1TT5B 3RUIB 3UIPB 2KQ4X 3TIXA 1ISNA 1F77A 1AWDA 4BOSC 2DX5B 1YJJA 3NOBA 3AEDB 3NZ3A 3B9JA 1NVID 3SFEB 3RFZB 1V81A 4OHJA 4C4VB 2JYTA 5J2RA 3BIID 1YD8U 3T3OA 2PTLA 1QF6A 2DHZA 3KYCD 1VD2A 4DXFA 5KHQA 3BZDB 3VUYA 4IWOA 2JWZA 4DBGA 1AN8A 2LXCA 4GDKB 3A9KA 1A70A 3Q8CA 2BYFA 4KGSA 3TEXA 2BVCA 2IGGA 1GUAB 3O65B 2XK5A 2HE7A 4B0EA 1MFWA 3W5VB 2PLPA 5CHFA 3QA8A 2L00B 2MHJA 2L8JA 3OLMD 1QOFA 4GN1A 3GS2A 4GIVA 4IWQA 1C9FA 3TEZA 1SIFA 4KKIA 3MJWA 1V1PB 2KLCA 1Z2MA 3H6NA 2BQQA 4GU2A 4KZCA 3PRZA 1C4PA
chains in the Genus database with same CATH topology
1MFWA 5IO9A 1UF0A 2BQQA 2DNFA 5IOIA 1MJDA 5IP4D 5IN7A 5IKCM 1MG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MFW A;  5IO9 A;  1UF0 A;  2BQQ A;  2DNF A;  5IOI A;  1MJD A;  5IP4 D;  5IN7 A;  5IKC M;  1MG4 A; 
#chains in the Genus database with same CATH topology
 3ML8 A;  1HTO A;  4M0W A;  3ZRF A;  1WE6 A;  1T5X D;  1GG3 A;  1OTR B;  3V05 A;  2CJO A;  2IPK D;  2FUH B;  3IHP C;  3Q6B A;  2QIL A;  1Y8R C;  1FPY A;  1IUE A;  2KX3 A;  3KYD D;  1FRD A;  3U30 A;  2KKC A;  5MPO A;  5L95 C;  5FR3 A;  1FO4 A;  2X38 A;  3Q3N C;  4I6L B;  1JWM D;  2V0G A;  3O13 A;  5LXH A;  1WYG A;  4EUT A;  2REX A;  3DBR B;  4TUU A;  3L10 B;  1J19 A;  2G4S A;  3Q69 A;  4KV2 A;  4MT5 A;  1F2R I;  3N30 A;  2M0A A;  2BS4 B;  2MSE D;  1BUI C;  1JRP A;  4MSM B;  3EGR A;  3FIL B;  2UU7 A;  1ESF A;  5E6J A;  4AOF A;  1J7C A;  2NPT B;  1B1Z A;  3RNC C;  2MLB A;  2KVR A;  1SIJ A;  3ZJV A;  1TIF A;  1E90 A;  1WF9 A;  1ENF A;  1WRD B;  1TYG B;  4IOI E;  1I4R A;  2KC2 A;  2BYV E;  2L3Z A;  4BKG A;  4GOC A;  1TS2 A;  4II3 B;  4A3P A;  2D07 B;  4IC7 B;  2KJ6 A;  2FCN A;  2NTT A;  4MJS B;  1E0Z A;  2KTR B;  2JXX A;  3CST A;  2RDB C;  4IM0 A;  2M1M A;  2JY6 A;  2DZM A;  4M01 A;  2G9H D;  1N6Z A;  2J0J A;  4WJO A;  5HG2 A;  3ZNI D;  3SD5 A;  1BT0 A;  1N60 A;  5CTR C;  4K1R B;  4B0M A;  3DWG C;  4P1B C;  2FCQ A;  4JL9 A;  2OHF A;  3GP7 A;  4LNK A;  2N9K A;  2KN4 A;  4XE0 A;  2J4X A;  4G3X B;  3HUI A;  3P42 A;  2ZEQ A;  1J7A A;  2V4L A;  3BK2 A;  2IY1 B;  1GJZ A;  2RPQ A;  3WCQ A;  1DOY A;  4S0R A;  4EFO A;  4URK A;  3ZNG C;  1TKY A;  2R2O A;  3K9P B;  4XGA B;  2GLS A;  1SB3 C;  2KX0 A;  3BY4 B;  4BOZ B;  5HKH A;  4HDQ A;  2C7H A;  3AI5 A;  2LHD A;  2GOW A;  2MW5 A;  3VXW A;  2LVO A;  3AE3 B;  4ZDV A;  4DXG A;  3VVW B;  1VJK A;  2I2Y A;  4GDK A;  4KKJ A;  3UIN B;  2L05 A;  4A6Q A;  1GPX A;  4NAW A;  2O6V D;  2LUM A;  1AYF A;  5H8Y E;  4Q2J A;  3EA6 A;  4YTM B;  1KRH A;  1WY8 A;  2QCZ A;  2KZR A;  2BS2 B;  3QX1 A;  4JE3 B;  2M19 A;  4AJY B;  3ZO5 B;  3OJ4 B;  5GMV A;  2JYE A;  4YTN B;  1E8Z A;  3EUB 2;  3ZNH B;  4K81 A;  4TSS A;  1YJI A;  3QHT A;  3ZDT A;  2W55 A;  2X8X X;  4A55 A;  4BBN C;  4NPN A;  1F2R C;  2IBI B;  3W9C B;  1FFV A;  1MHX A;  2L1A A;  2K8C A;  2PJH A;  2JZP A;  2WYQ A;  5DCN A;  1N61 A;  2QHO A;  3APF A;  2G3Q B;  3WAL A;  2ZW1 A;  3W1Y A;  1CK1 A;  2DAF A;  3T8M A;  2IGH A;  2MP2 A;  3ZKJ C;  1JRU A;  2KOX A;  2K1F A;  3BVG A;  1L4D B;  1P3Q U;  4KZ0 A;  2SAK A;  1MG8 A;  3DHI C;  3TEW A;  4S17 A;  2KWD A;  2JF5 A;  3VTV A;  3IG3 A;  1GB4 A;  2H89 B;  1P7E A;  4NQL B;  3MHS D;  1ROE A;  4KGR A;  3AM9 A;  2ZNV C;  1D4B A;  3KLS X;  2L83 A;  3AEC B;  4DHJ D;  2WQY B;  2KO3 A;  5C1Z A;  2N1V A;  5JHA A;  2DYM A;  2N7D A;  2NBW B;  2K8B A;  2NPT A;  2ONQ A;  4N59 A;  4FAD A;  1YIW A;  4P16 A;  4WAF A;  1WXM A;  3H1U A;  2HTM E;  2J7Q B;  4HVB A;  2AQ3 B;  2ZJD A;  4ZRI A;  4ZRP A;  1VCB A;  4RGO S;  1IBX B;  2DYO A;  3RT3 B;  2D2Q A;  3ZGZ A;  2GBR A;  4G11 A;  1WGD A;  2WX0 A;  4J3O D;  1WR1 A;  2KTR A;  2BPS A;  2BGF A;  3EFC A;  2FNJ B;  2FE8 A;  3TSS A;  1UWM A;  4AS1 A;  2NR2 A;  2RGF A;  1WIA A;  1Q10 A;  4K7W A;  2C7M B;  4G50 A;  4CO7 A;  2WDQ B;  2WXJ A;  4LDT B;  2W54 A;  3MHZ A;  2GI9 A;  1WFY A;  1OQQ A;  3DBL B;  3AUL A;  5G55 A;  1HQR D;  3KUC B;  2MJE A;  2AEH A;  1ZDX A;  5H92 C;  1GAQ B;  3AEG B;  1TY0 A;  4FHJ A;  4LNN A;  4YSX B;  1K8R B;  5G5H A;  3HM3 A;  1QOG A;  2UYZ B;  3SDL C;  2OED A;  3A9K B;  4HLE A;  1YQ4 B;  5DPR A;  1OEY J;  3Q3M C;  4ZRK A;  5BMH A;  3CMM B;  2UWQ A;  1N5W A;  1JWS D;  2K22 A;  3N1Y C;  2GBM A;  3N32 A;  4A3O A;  5AZF A;  1ZXH A;  1XLP A;  4K7U A;  1RRB A;  4ANU A;  2WXF A;  2N9L A;  3DBH B;  1SE4 A;  3W1S A;  2KN5 A;  2FBW B;  2RD0 A;  2WXL A;  4W9L A;  4C80 A;  3BVZ A;  3VFK A;  2ZVN A;  2JRH A;  1MG4 A;  2JZ3 B;  5DPS A;  1S3S G;  2BBC A;  4REZ A;  2OJW A;  1V6E A;  4BVU C;  1G6J A;  2HJ8 A;  5JZE B;  2ZZP B;  5E6N A;  2AYO B;  3X23 A;  1JWU D;  1VZ6 A;  3B0A A;  2MJ3 A;  1WXQ A;  2QJL A;  4LLG M;  1FNU A;  1V49 A;  5FR6 A;  1EU4 A;  1LXD A;  3RZF A;  3AEF B;  5AZH A;  2DAJ A;  3NY5 A;  3PO0 A;  2MJD A;  2YVC A;  3N1X C;  4W9D A;  1YOV B;  4OZB A;  2M56 B;  2JUO A;  3ALB A;  2A5U A;  2IY0 B;  2AL6 A;  3DVG X;  4XWW A;  4RM8 A;  2WS3 B;  4O1N A;  1XXG A;  1KTK A;  2WXH A;  3KH0 A;  4PS3 A;  5CHW A;  1RM6 C;  3AE4 B;  3MTN B;  2I1J A;  3TUO A;  3K9O B;  4YWG G;  1OQR A;  1ZGU B;  3B1L X;  4A8X C;  2N9P C;  2EMS A;  2FCM A;  1WRI A;  3WAP A;  3PRM B;  4DDG D;  4IG7 B;  4ANV A;  2G45 B;  2M0X A;  1TGZ B;  1B9R A;  4KIK B;  2WDR B;  1ZPS A;  1E8W A;  2JWU A;  3M63 B;  1WGG A;  1VR9 A;  2JVC A;  1SSN A;  3A4R A;  3QQ8 B;  1EU3 A;  4DHJ B;  3R66 C;  4GMV A;  1WXA A;  3PV1 A;  1YN5 A;  1L0X B;  4YSY B;  3DOW A;  1WGK A;  2WX1 A;  3L54 A;  3RNB C;  3KWL A;  3A33 B;  2C9W B;  2DWQ A;  1VDV A;  3RUL A;  1R4M I;  2BWF A;  3PTF C;  1NYQ A;  3I5J C;  1CQV A;  4XWT A;  3ZJT A;  2HTH A;  3PT2 B;  2NS5 A;  4WH4 A;  3BK1 A;  1KJT A;  4E74 A;  4TV3 A;  3VH4 B;  1OFF A;  2D11 A;  3L08 A;  3E56 A;  3PHW B;  4F1S A;  3HHM A;  3J9C A;  1JWB D;  3HRD D;  3NS1 A;  4NAW B;  1D5X C;  1DYQ A;  2B76 B;  5TR5 A;  4EEW A;  3UGB B;  2MA9 B;  3KWV A;  2WLB A;  2KYW A;  1FMA D;  2XBB C;  2QIE B;  3Q8F A;  3ZXV A;  1R4N I;  5D7G A;  3DQV A;  3AU5 A;  4QAY A;  1V9J A;  1SE3 A;  3H7P A;  3CWI A;  4D2K A;  1F9J A;  1T0R C;  1MJD A;  1XO3 A;  3QCA A;  1KF6 B;  4PK1 A;  1ZXI A;  5G5G A;  4WWN A;  1WGY A;  4P1C C;  1GC6 A;  3V61 A;  1WM3 A;  3VRA B;  4XDC A;  4YT0 B;  2KDE B;  1UH6 A;  1KH0 A;  2V9H A;  3ZQ4 A;  1WSP A;  3LXF A;  2O6V A;  4MH0 E;  4KGT A;  2IGD A;  2ZNV B;  4HRO A;  2CHX A;  2MBE A;  3MFG A;  1I4X A;  3UI3 A;  4LK0 M;  3L17 A;  4M00 A;  2INP E;  5LNK 1;  3JYU A;  4JLC A;  2MP2 B;  3NZS A;  1WX9 A;  3ZJU A;  1F52 A;  4AUQ C;  1XLO A;  2WXO A;  2LJI A;  2V4I B;  1L5P A;  3V60 A;  2V3S A;  2JXT A;  1KLV A;  1DOI A;  3ENE A;  3T9L A;  2D5G A;  3Q3O C;  2MBO A;  4JQW C;  3IFW B;  4W9J A;  4M8N A;  2YEP F;  1V5T A;  1I35 A;  2D10 A;  4ARC A;  3B08 A;  3Q8A A;  1JQ4 A;  1TZO A;  3V6E B;  3SU8 X;  4IW0 A;  1WJU A;  3V3X A;  1FD6 A;  3HVZ A;  1RWS A;  3VTU A;  3PSE B;  3P4R B;  4FA6 A;  2Z0D B;  5D3D A;  1UUP A;  2DZJ A;  1C4C A;  2KT7 A;  1WXV A;  3P4Q B;  3TJP A;  3E9S A;  2VH2 A;  1NBF C;  3NZU A;  2CS4 A;  2K3U A;  1C1Y B;  2DLB A;  4TKN A;  4KIK A;  3ZVV A;  3U7Z A;  3Q8B A;  1WJ6 A;  2KDI A;  4K3C A;  5D6J B;  2ON8 A;  2NCN A;  1JWA D;  2L76 A;  4PYU A;  4HJG E;  3VAW A;  2IYD B;  3IXS A;  1K53 A;  1C77 A;  1LQB A;  1SE9 A;  3AE1 B;  1P7F A;  3I57 A;  4DQO C;  5C3J B;  5BO4 B;  4ZOH C;  2IO0 B;  3T3N A;  3M62 B;  4FXC A;  3VRB B;  3DVG Y;  5D2M B;  4LJP B;  1H8C A;  1ZOY B;  3KQ4 A;  1YMH E;  1FFU A;  1XF5 L;  3PGE A;  3ZYY X;  4BBN F;  4F7Z A;  1NDD A;  2CU1 A;  2MWS B;  5EE3 A;  4MEL A;  3IAS 1;  1UNS A;  2LD9 A;  4LCD E;  1S1Q B;  2PKO A;  2FIF A;  5EE0 A;  2JU6 X;  2ICI A;  2LUE A;  2MX2 A;  1XT9 B;  1FXI A;  1BML C;  4PYZ A;  4BKT A;  1PGX A;  1SF0 A;  1RAX A;  5EDS A;  2FCS A;  1KLU D;  1Q0W B;  3AE6 B;  1T3Q A;  1LM8 B;  4GGQ A;  1MI0 A;  4I6N B;  2K39 A;  4ITK A;  2WXI A;  3RYT A;  2WXN A;  2KLG A;  2ZCC A;  3M3J A;  2QEJ C;  4F8C B;  2N4F A;  2WXM A;  3EFU A;  4TQ1 A;  2K5P A;  3B2G A;  2EKI A;  1JW9 D;  2LGD A;  4EZL A;  4NNJ B;  3A9J A;  3AE7 B;  2KTF A;  4US8 A;  1GOZ A;  1V80 A;  2PW9 A;  4C00 A;  2PVO D;  5IA7 A;  4N9F 4;  4OW0 A;  4ZYN A;  4X57 B;  3GZN I;  1H4R A;  1PUT A;  3P63 A;  3QC8 B;  2KFK A;  4KX6 B;  1KOT A;  1E9M A;  4WQO B;  2LRU A;  1TY2 A;  3L13 A;  2WXP A;  1IGD A;  4GB9 A;  4C56 C;  3ABV B;  2SEB D;  2WNM A;  1GNU A;  3U8Z A;  3MJ5 A;  1SE2 A;  3LDZ E;  5CX3 A;  2N1W A;  3EEC A;  4IUM B;  1XCQ L;  2KMM A;  2ZPN A;  1SJH D;  2LGI A;  5G2N A;  2NMQ A;  2WWZ A;  2I38 A;  2KNB A;  2KXJ A;  2KC1 A;  4FUL A;  4YXD B;  4GSW A;  1HXY D;  2K25 A;  3AMZ A;  3GOE A;  1HEZ E;  2PMV A;  2MBB B;  2Q5W D;  1FIQ A;  3RZW C;  3SHQ A;  1ET9 A;  2R2Q A;  3VR8 B;  3M95 A;  2N0S B;  1WX7 A;  2QSD A;  4JPS A;  3NVW A;  4JWU C;  1ACC A;  2BB6 A;  4IDI A;  2AQ1 B;  4K7S A;  2BTE A;  2KVZ A;  4FJZ A;  4JX1 C;  4RF0 A;  1EO6 A;  1RLF A;  4XX5 A;  1OQY A;  2JT4 B;  1PFD A;  3UQA A;  2KAC A;  2K0P A;  3W2D A;  2XNA C;  4RH6 A;  2G4D B;  1ZKH A;  3ZLZ A;  4J6I A;  4DDI D;  1OGW A;  2K9X A;  3PRE A;  5IOI A;  4CYE A;  4NZL B;  1SEB D;  4IWP A;  2OOB B;  5IP4 D;  1WE7 A;  3R7R A;  4HCN B;  3PHX B;  2LRW A;  4DXA B;  4AJW A;  3UF8 A;  3FAH A;  2LGX A;  1V8C A;  4EZK A;  3B2F A;  3R2I A;  5BYQ A;  2LVP A;  1P1A A;  1J7B A;  3U2S C;  2DEN B;  3ZIM A;  4HDO A;  1EF1 A;  2LHE A;  3KW5 B;  5GXG B;  4ZYS A;  3ZUN A;  1PGA A;  2INC C;  1UF0 A;  4HKZ E;  2LJ5 A;  2FAZ A;  3AB5 A;  1E7P B;  5D94 A;  2JPH A;  2A4Z A;  2PIA A;  4DK5 A;  3AE2 B;  4BKS A;  3P2B A;  2MH7 A;  2N9E B;  2VRR B;  3AH7 A;  3H7P B;  3KVF B;  4MM3 A;  1XLQ A;  2W82 A;  3DPD A;  2EKE C;  3NS8 A;  2CHZ A;  5D3I B;  4A90 A;  1K52 A;  2GB1 A;  3SFD B;  5KHO A;  4ARI A;  1V2Y A;  5HI1 A;  1E8X A;  1CMX B;  5EE9 A;  2KQ7 A;  1TZ1 A;  1X1M A;  2LVQ A;  4NJ6 A;  3ZTD A;  2LAS A;  3CSF A;  1R7S A;  3BYT B;  1QOA A;  2O6V B;  3MC9 A;  2AWT A;  1HZ6 A;  2KK8 A;  2XEW A;  4WIP A;  1HA5 A;  2HDE A;  3Q3F A;  1Q1O A;  2MCN B;  2YLM A;  4IKG A;  3N20 C;  1UWX A;  3C19 A;  4R3D A;  1AAR A;  5L83 A;  3X0W A;  2H88 B;  3AE5 B;  4PT5 A;  3ZNZ B;  1NI2 A;  2L52 A;  1R4M B;  3RNE C;  2E6X A;  3W1S C;  2ZPY A;  3AE9 B;  3H9D A;  2IZV B;  1I4P A;  3MP9 A;  3VHT C;  4P7I A;  2EMT A;  4HPM B;  4ANX A;  4WWO A;  3AEA B;  1TKG A;  3DVN U;  1YQ3 B;  3I9V 1;  3OG5 A;  2YEP B;  2GBJ A;  2ZVO A;  2WP9 B;  3GB1 A;  4FJV B;  4ICV A;  4MGK E;  2KD0 A;  3DBH I;  3I63 C;  3AE8 B;  4USA A;  2DZK A;  2KWV B;  2LEK A;  2MEK A;  1E7V A;  4W9K A;  1R4N B;  4KSK C;  1ZDV A;  4M8M A;  2CHW A;  3AEE B;  1YX5 B;  3VTW A;  3Q14 C;  2V3P A;  3L0W B;  3I3T B;  2PPH A;  4DHZ B;  2ZCB A;  3KUD B;  2V1Y A;  3A1Q A;  3R8B A;  1LFD A;  2J0K A;  3QWZ B;  4MH8 A;  1V97 A;  2R61 A;  3ZTC A;  4HWI B;  1FCC C;  2LWP A;  4A20 A;  4GXB A;  1V86 A;  1EWY C;  3RNA C;  1I7H A;  5HFY A;  4BKS D;  3UQB A;  3QJZ A;  4WJN A;  3W5U B;  1M94 A;  2M8S A;  2GBN A;  1T6B X;  1C4A A;  1XLN A;  2HJ1 A;  4MGI E;  3ZDM C;  4TQ0 A;  3R2T A;  1E7U A;  1YX6 B;  3APD A;  1J0G A;  2Y5P A;  1L4Z B;  2J53 A;  4RFB A;  4P6V F;  4B9K A;  1P98 A;  1C3T A;  3GE8 C;  1WM2 A;  1LO5 D;  2KDM A;  3QIJ A;  2WDV B;  2MBH A;  4WAA A;  1F0Z A;  2KWC A;  4RGT A;  3RNF C;  2GBK A;  1AW7 A;  3TL5 A;  4WQM A;  3R3M A;  2AL3 A;  2BW2 A;  2LI5 A;  3RNG C;  1D6E C;  1WXS A;  4WWM A;  3PS6 A;  1LGR A;  2BWE S;  2BYE A;  1FEH A;  2KFJ A;  4HCP B;  1JCK B;  4RGM A;  3RD2 A;  2WDT B;  1JAL A;  4LJO B;  3MC0 B;  4N6E B;  3A9J B;  2CKH B;  4XDD A;  4HK2 A;  1QLB B;  2L0T A;  1JML A;  2N7E A;  1L6V A;  1QIL A;  2W3S A;  3LYY A;  2IO1 B;  3ONS A;  3Q3J A;  5FK9 C;  2LGY A;  2JZZ A;  2CJN A;  2INN E;  2I1K A;  5CHV C;  3CIR B;  4NQK E;  1GC7 A;  2BT6 A;  4BAX A;  3GE3 C;  4L23 A;  1QOB A;  2RPV A;  4WUR A;  1KLG D;  1QKZ A;  2N9X A;  2LXA A;  1NEK B;  3QK0 A;  5FKA C;  2XN9 C;  4LTU A;  2KFK B;  3ZW3 A;  4EKU A;  1TTN A;  2L7R A;  1E10 A;  1PQS A;  4HPL B;  4IM2 A;  4NAM A;  3RN9 C;  5JXV A;  3TCA A;  2FUG 1;  1OEY A;  3ZXR A;  2D3G A;  5C2T B;  2MRP A;  5AEK B;  2ASQ A;  1XQQ A;  5AUK A;  5HHD G;  2QMT A;  3KUZ A;  2C5L C;  3DVN V;  4OZC A;  3RPF C;  2K8H A;  4HKQ A;  3ML9 A;  1VZ7 A;  1ZE3 D;  3RCZ A;  2LMC A;  2Y5B B;  1KFY B;  2JX5 A;  4II2 B;  2Z59 B;  1WI0 A;  4RGN A;  3JVZ X;  3OJ3 A;  5AUI A;  1XD3 B;  5BMG A;  1WMH B;  2LFI A;  4EZJ A;  3P4P B;  4ZRQ A;  3Q8E A;  1FRR A;  4JGH B;  1N63 A;  4W9G A;  2AQ2 B;  1L6U A;  2O2V A;  5BYR A;  1C76 A;  3A4S C;  1V5O A;  3DCG A;  3MC8 A;  4XZ4 A;  4ASW C;  3WAO A;  2B3A A;  3C0R B;  4C7Z A;  3S2A A;  5IAA C;  4W9C A;  4LDT D;  4HJK A;  2VZK D;  1UBI A;  4OVZ A;  4HXD A;  1UZX B;  4A9A A;  4OZA A;  3R7Q A;  2CU3 A;  5E6O A;  1QQR A;  4B6W A;  1E6E B;  1SJE D;  1WJ4 A;  1N62 A;  1UBQ A;  5AZG A;  1N5X A;  2IO3 B;  1TS5 A;  2V3N A;  1WYW B;  2C7N B;  3AXC A;  4C7Y A;  2JQR B;  1PGB A;  1NYR A;  4KDI C;  3AU4 A;  1PYW D;  2KJR A;  4AWJ A;  2RMM A;  4E3C A;  3RI7 C;  1P0R A;  1HE8 A;  3PZ8 A;  4ZRJ A;  4EE2 A;  2KWU B;  1UEL A;  3PZ7 A;  3DBR I;  4RMA A;  1P9D U;  4GDL B;  4RF1 A;  2IDY A;  2KAN A;  3U7D A;  1D5M C;  1TS3 A;  2J42 A;  3AV8 A;  3GZN B;  3N1Z C;  4C4V A;  1SBB B;  1UGJ A;  1I42 A;  3JSV B;  2PE6 B;  2DYB A;  2J52 A;  4JIO U;  4WWP A;  1J8C A;  3U4E G;  3H7S A;  2CR5 A;  4MAC A;  3NJT A;  3NUH B;  4MM3 B;  3DWM A;  1CJE A;  2Y3A A;  3DDC B;  2DZI A;  1WWT A;  2PE9 A;  1D3Z A;  4L2Y A;  1ZW7 A;  1UD7 A;  5JH5 C;  3QAQ A;  3BVM A;  1NEN B;  1DOX A;  4FJY A;  1TKE A;  1WGR A;  2WXR A;  2NTS A;  4ANW A;  1YN3 A;  3VUX A;  1TBE A;  4HPP A;  3AEB B;  2KJH B;  2L32 A;  1FM0 D;  1I4G A;  1E5W A;  2BF8 B;  2WU5 B;  4GLS C;  3NVV A;  2Z8L A;  4L1B A;  2RDG A;  4LNO A;  1Y56 A;  3JW0 X;  2LZ6 A;  1PDX A;  4AQ7 A;  3BIN A;  3APC A;  3Q2A C;  1V1P A;  2HD5 B;  5E6P A;  2GMI C;  4W9E A;  1ZUD 2;  4LNI A;  1EWC A;  4E71 A;  1HTQ A;  3PPA A;  3PVL A;  4US9 A;  2IO2 B;  4ZHO A;  3HK0 A;  1V1O A;  1U4A A;  1WJN A;  4KDL B;  2BB5 A;  2K6D B;  3WA0 A;  3V62 A;  3LB8 C;  3TBL D;  1XCT L;  2W3R A;  1C79 A;  3RMK C;  2D3A A;  3LJ3 A;  2M4N A;  2WXG A;  1IPG A;  2JSV X;  4LNF A;  2C60 A;  1IYF A;  2G1E A;  3CF6 E;  2DBY A;  3UIO B;  2W9N A;  3HIZ A;  5J17 A;  3HM6 X;  4TMA B;  3NVY A;  1RFA A;  2K6Q A;  1F1H A;  2WGS A;  5EE1 A;  1WX8 A;  3P4S B;  3WIM A;  1QZE A;  3H8H A;  1WMH A;  2NBU A;  2BKF A;  4NJC A;  1D5Z C;  3AN1 A;  3FIL A;  1MVK A;  2RDH A;  3PZD A;  1WZ3 A;  2LGS A;  4CQN A;  2RSU A;  3VUW A;  5DPW A;  4PS7 A;  2KDF B;  2IJ0 A;  3IBE A;  5IKC M;  5LLI A;  4FBJ B;  4HEA 1;  3N3K B;  4MEM A;  4EOY A;  4ZHP A;  3A1Q B;  1L7Y A;  1VZ8 A;  4RM9 A;  2TSS A;  3PRP B;  4JWS C;  4FLH A;  3TMP B;  1BXT A;  2NBV B;  3HVD A;  4PS8 A;  3SEB A;  2J0M A;  4MJS A;  1Q5W B;  2KDB A;  4MSQ B;  5I4D A;  5BMI A;  1FXA A;  2GRI A;  2AX5 A;  1Z5S B;  4DWF A;  2JRI B;  2MBQ A;  4WJQ A;  3NVZ A;  3IT4 B;  1WZ0 A;  2QDF A;  1T0S C;  1WGH A;  1ZP0 B;  4IM3 A;  4W9I A;  3WAN A;  2VZK B;  2BYT A;  1STE A;  4GDL A;  5DPT A;  1QT9 A;  2KMA A;  2DNF A;  1GB1 A;  1K51 A;  1TS4 A;  3ZRC A;  2KAJ A;  1SXT A;  2QC8 A;  2FID A;  1KM7 A;  2WU2 B;  3L16 A;  3ETR A;  3JSV A;  4FHK A;  3PLU A;  2PVG C;  1YQB A;  1FNW A;  4XC2 A;  2VH1 A;  4YL8 A;  3NHE B;  1K50 A;  1FCL A;  4N58 A;  5IN7 A;  4YTP B;  3OAW A;  3EHV A;  4H2A A;  4W9F A;  4M02 A;  2XK5 B;  1XEE A;  3EC8 A;  4K3B A;  2E3T A;  3ECI A;  1FXT B;  1YNT E;  1DGJ A;  2M17 A;  1M4V A;  1ET6 A;  3URY A;  1RFK A;  1VLB A;  2D3B A;  3IAM 1;  4KVG B;  1HZ5 A;  1IGC A;  4W9H A;  1A5R A;  3IT6 B;  3D32 A;  4MGZ E;  4RCO A;  4WJP A;  3VQI A;  3PLV A;  2N7J A;  3DBS A;  3SR6 A;  4YSZ B;  4BZA A;  1WR6 E;  4M0W B;  1L2N A;  3VR9 B;  1JRO A;  4NY0 A;  4ACF A;  4OVV A;  2MQJ A;  4OVU A;  2BKR B;  3DHH C;  1NI3 A;  3DBL I;  2Z0E B;  5C23 A;  1FNV A;  3VDZ A;  1YJ1 A;  1WH3 A;  4BFR A;  3NG0 A;  4XYC A;  4CHK A;  1T0Q C;  3OWE B;  1L0V B;  5TSS A;  4I6P A;  1IP9 A;  3FKY A;  1RYJ A;  2WHI A;  1TJE A;  1E8Y A;  5LXI B;  1I4Q A;  1EF5 A;  2EEL A;  1I4H A;  4AP4 C;  2IND C;  4NJ7 A;  1SGH A;  4KSL C;  3VH3 B;  1MPE A;  3L4P A;  3DHG C;  2KHW B;  5T8I A;  1EM7 A;  2Y5C A;  2WXK A;  2ZW0 A;  5BYS A;  1YN4 A;  3IVF A;  3BYY B;  4FN2 A;  2BS3 B;  3FC4 A;  3V6C B;  1C78 A;  1L0Y B;  3BWU D;  2O2V B;  1CZP A;  1T0Y A;  3TEY A;  2KMC A;  3QAR A;  3N9Y C;  2PEA A;  1UGM A;  4MDK E;  5JHB A;  1EUV B;  3NRZ A;  4B95 A;  2OJR A;  4UDU C;  5IO9 A;  4G0N B;  3U52 E;  4DHZ E;  3P1M A;  4HRS A;  4RNA A;  2L0F A;  1MHH E;  3C8Y A;  4MGY E;  2NVU I;  3WAM A;  5J18 A;  1IBX A;  2D3C A;  4ICU A;  2WXQ A;  2KQS A;  2ACZ B;  1VRA B;  2RR9 A;  1TT5 B;  3RUI B;  3UIP B;  2KQ4 X;  3TIX A;  1ISN A;  1F77 A;  1AWD A;  4BOS C;  2DX5 B;  1YJJ A;  3NOB A;  3AED B;  3NZ3 A;  3B9J A;  1NVI D;  3SFE B;  3RFZ B;  1V81 A;  4OHJ A;  4C4V B;  2JYT A;  5J2R A;  3BII D;  1YD8 U;  3T3O A;  2PTL A;  1QF6 A;  2DHZ A;  3KYC D;  1VD2 A;  4DXF A;  5KHQ A;  3BZD B;  3VUY A;  4IWO A;  2JWZ A;  4DBG A;  1AN8 A;  2LXC A;  4GDK B;  3A9K A;  1A70 A;  3Q8C A;  2BYF A;  4KGS A;  3TEX A;  2BVC A;  2IGG A;  1GUA B;  3O65 B;  2XK5 A;  2HE7 A;  4B0E A;  1MFW A;  3W5V B;  2PLP A;  5CHF A;  3QA8 A;  2L00 B;  2MHJ A;  2L8J A;  3OLM D;  1QOF A;  4GN1 A;  3GS2 A;  4GIV A;  4IWQ A;  1C9F A;  3TEZ A;  1SIF A;  4KKI A;  3MJW A;  1V1P B;  2KLC A;  1Z2M A;  3H6N A;  2BQQ A;  4GU2 A;  4KZC A;  3PRZ A;  1C4P A; 
#chains in the Genus database with same CATH homology
 1MFW A;  5IO9 A;  1UF0 A;  2BQQ A;  2DNF A;  5IOI A;  1MJD A;  5IP4 D;  5IN7 A;  5IKC M;  1MG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...