2BQQA

X-ray structure of the n-terminal domain of human doublecortin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
AKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Dc-Module of Doublecortin: Dynamics, Domain Boundaries, and Functional Implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords NEURONAL MIGRATION PROTEIN DOUBLECORTIN
total genus 22
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 2bqqA00
2BQQA 1UF0A 5IO9A 5IP4D 1MG4A 5IOIA 1MFWA 5IKCM 1MJDA 2DNFA 5IN7A
chains in the Genus database with same CATH superfamily
2LFIA 2MX2A 1CK1A 1SE4A 1P7FA 5GXGB 2IBIB 3IT6B 2MRPA 3P4RB 3ZDTA 1ZDVA 4US9A 5C23A 1E8YA 4MGYE 5FR3A 2WXOA 1VD2A 1WSPA 1AW7A 1WFYA 3DBLB 3DHHC 4TQ1A 2L3ZA 4JWUC 4IDIA 2IY1B 3RNFC 3DOWA 4DQOC 3R2TA 3VAWA 2R61A 3H1UA 2GBJA 3AMZA 1V6EA 3DQVA 3WA0A 3AE7B 4H2AA 3B2FA 2BYVE 5TR5A 2TSSA 2V9HA 2KT7A 2B3AA 2KK8A 2D07B 4B0MA 4GSWA 1GPXA 2G3QB 3PLVA 2K0PA 3GZNI 1ZXHA 1V5TA 5E6JA 1ZDXA 3X23A 4P1BC 3BYYB 4ZRJA 1V5OA 3TCAA 1ZXIA 3QX1A 1TJEA 3VH3B 2KJRA 4AP4C 2QIEB 2NBWB 4MGZE 1WXMA 4DDID 3TSSA 3NUHB 1SB3C 1T5XD 2MJDA 4HKQA 2O2VA 3AE5B 2G9HD 4MSMB 3EUB2 3EHVA 3EC8A 5BO4B 3Q14C 4RFBA 5FKAC 1L0VB 3UQBA 3V60A 3MC9A 3TEYA 1Y56A 3U52E 2KXJA 2M19A 1AWDA 1QOGA 5AZFA 3AE6B 1SIJA 3V6CB 4LNNA 1U4AA 4K7SA 1H8CA 2PW9A 4N6EB 3HIZA 1XLPA 1Q5WB 3IAS1 4J6IA 4OVZA 1J8CA 3NZSA 5KHOA 1V86A 2NPTA 3U2SC 3ECIA 1OEYA 1ZUD2 2M8SA 2O6VA 4AWJA 4ICUA 3BK1A 3EFCA 2L76A 1J0GA 1EF5A 2KX0A 2M4NA 2LEKA 2BTEA 4JIOU 4JX1C 1NVID 5HG2A 4ANWA 1TS5A 4GGQA 3U7DA 2MLBA 1RWSA 1PFDA 2Y5PA 3KUZA 3AE4B 1ENFA 2JX5A 3BK2A 3PO0A 3NS1A 3Q3MC 3AB5A 3MC0B 1FPYA 1FNVA 1RM6C 1WRDB 2N9PC 1T0YA 3I9V1 1YD8U 3IBEA 3ZYYX 1XF5L 3PRPB 2V4LA 4WJOA 5C3JB 1GG3A 4MJSA 3W1SC 2LHDA 4Q2JA 2JUOA 4OHJA 1BT0A 2M56B 3EA6A 2WXRA 3V3XA 4I6LB 3V62A 3ML9A 2IGHA 3A9KA 3ZJVA 2X38A 1YJ1A 1WJNA 2IY0B 5KHQA 4NNJB 2RDGA 2E6XA 2K8BA 1BMLC 1BXTA 4IKGA 1N60A 4P6VF 1P3QU 4DK5A 4J3OD 3BVZA 4QAYA 4XZ4A 1PYWD 4G3XB 4HVBA 4YTPB 3RYTA 1WYWB 1YN5A 5G2NA 1F9JA 1I4HA 1RFKA 3PZDA 2M1MA 4M8MA 1WGYA 2DYOA 2JXXA 2H88B 2MA9B 2GBMA 4WWPA 5BYRA 2DZIA 1FNWA 2V3PA 2KDFB 4TUUA 1UZXB 2FAZA 1WR1A 2JZZA 2Y3AA 4LNKA 1HZ5A 1JWBD 3NVWA 4EZLA 3TL5A 1ROEA 4BFRA 2DBYA 1M4VA 3TUOA 4ACFA 1QF6A 3UIOB 1I4GA 1N5XA 3OJ4B 4MM3B 2WP9B 3HK0A 4ZOHC 2FUG1 3B08A 3PS6A 2C9WB 1T0RC 1XLNA 1TY0A 4BZAA 5BMIA 5FK9C 1I4XA 4BBNC 1GUAB 3D32A 4WJPA 3IAM1 3DBSA 4A3OA 2JU6X 4ANUA 2K8CA 2LRWA 4NJ7A 1V80A 4GMVA 4XX5A 1IBXA 1TS4A 1LGRA 1XD3B 3WIMA 5IOIA 2IPKD 2EKEC 2KYWA 4GLSC 3P4SB 1KTKA 2D5GA 2EELA 2LGSA 1WH3A 5C2TB 1UBQA 4OZBA 5E6OA 1TGZB 3R7QA 3RI7C 2KTRB 5IKCM 4NPNA 3MHZA 1Q10A 3H8HA 1NEKB 2ON8A 3RNGC 2KWCA 3Q8AA 3GB1A 5HI1A 2KDIA 1L0XB 2A4ZA 2NTSA 1L4ZB 3KLSX 5LXIB 2V1YA 3JSVA 5HHDG 2UU7A 2JQRB 4ZRKA 1KM7A 1F0ZA 2L83A 1T0SC 2REXA 2JT4B 3Q3FA 4US8A 2INDC 1FIQA 5AUKA 1CQVA 2ICIA 2KWDA 1WGRA 2N1WA 4W9KA 2KOXA 1K50A 5AZGA 3RULA 3VR8B 4WWOA 3QQ8B 1FNUA 4NAWA 1V9JA 1D4BA 1NYQA 2KC2A 3CF6E 4IM0A 3SHQA 4IOIE 1WYGA 5D3IB 2PVOD 4ARIA 4BKSA 4LJPB 3VXWA 4DXGA 3PVLA 5EE0A 1PGAA 2QMTA 3FC4A 2G45B 3AN1A 1OQRA 3W2DA 1I4QA 4YSYB 3AE1B 1FXAA 4YXDB 3T3OA 1Z2MA 3A1QA 1FCLA 1FFUA 3AEBB 3I57A 2FCNA 2HDEA 2FCQA 3APDA 2DAJA 4P16A 3DBLI 1GC7A 4DHZB 3TBLD 3AE9B 3A4RA 4W9JA 2LJIA 2ZZPB 1JRPA 1IYFA 2KN5A 3GOEA 1UUPA 2AQ1B 1R4MB 2BBCA 3JSVB 1WRIA 1ZW7A 3RZWC 5HKHA 1QT9A 1QQRA 3RUIB 2KACA 2YVCA 4W9IA 4EKUA 5IA7A 2WU2B 1TT5B 2K25A 2WXPA 3APCA 1L7YA 3RZFA 3AE3B 2YLMA 2J0KA 5EE9A 2ACZB 2MEKA 3I5JC 4B6WA 2EKIA 2WHIA 2DZKA 2IO1B 2J7QB 1DOYA 2IO3B 3QC8B 3RNBC 1QOFA 1WMHB 4YSZB 1WJ4A 2MBBB 3PZ8A 3T9LA 2PJHA 1WGHA 2NPTB 2MP2A 1WX8A 4MGKE 4EZJA 3I63C 1LO5D 3KWVA 1D6EC 3JYUA 2A5UA 1STEA 1I35A 2KDMA 2ASQA 2WXGA 3IG3A 1EU3A 5E6NA 2HJ8A 2JXTA 2ZNVC 1G6JA 2AYOB 2L0FA 5GMVA 3MTNB 1AN8A 2WXMA 2K6DB 4RGNA 1KOTA 2JYTA 5JXVA 3DBHI 5JHAA 2D2QA 2KO3A 4HLEA 2WGSA 3Q6BA 2KKCA 1YJIA 4I6PA 4NAMA 2LMCA 3RT3B 1RYJA 1EM7A 2BS2B 1V1OA 4HKZE 3LB8C 2ZCCA 3ZRFA 3DDCB 3HUIA 3L16A 3NY5A 3P2BA 3ZNID 1FO4A 4LNOA 2QEJC 3R3MA 1WWTA 1VCBA 1P7EA 5AUIA 3SFDB 3E56A 1FEHA 4WAFA 2LVQA 1UGMA 2LVOA 3CWIA 1R7SA 4A20A 1C78A 1WXSA 3VQIA 3ABVB 1FFVA 3ZXVA 4JGHB 1WX7A 4TQ0A 3Q3JA 3N3KB 1E8WA 5AEKB 3FILA 1WI0A 3VTUA 1YQ3B 1N61A 4BAXA 1L6UA 3ZUNA 1A5RA 1WXVA 4A55A 4KV2A 1C4PA 1TS2A 3DPDA 1C77A 2NMQA 1VDVA 2BKFA 2FBWB 3P63A 2WDRB 3H7SA 2ZW1A 4FHJA 1FM0D 2C7HA 2JZ3B 1SEBD 2BS3B 4GDKB 3M3JA 3LDZE 2MBQA 2R2OA 2DYMA 2RPVA 3BY4B 1SJHD 4BKTA 5EE3A 1ZPSA 4BOSC 1WF9A 1ET6A 3GE8C 1SGHA 3DBRB 2V3SA 5EDSA 4LJOB 4WH4A 2D3GA 2CJOA 2LXAA 4ZHOA 1NYRA 3BIID 1UGJA 2BYFA 2QC8A 3UGBB 1TYGB 4EE2A 1PGBA 2OJWA 1FMAD 2L1AA 1K52A 4FN2A 3MFGA 1T3QA 2Z0EB 3CSFA 2CHWA 3L54A 4K3CA 2PLPA 1FRRA 1E7VA 2N9KA 4OW0A 3U4EG 1T6BX 5DPTA 3HRDD 5H92C 3Q8CA 3ZKJC 3P4PB 4P1CC 3RCZA 2M0AA 3BZDB 4XC2A 3L10B 2NTTA 1E10A 5IO9A 1WXAA 2VZKB 1ZGUB 4FA6A 2N7JA 1J19A 2PPHA 2IO0B 4CYEA 2ONQA 3ENEA 2BB6A 1X1MA 2N0SB 1TZ1A 3L0WB 5H8YE 4URKA 5BYQA 2NR2A 1TTNA 2JYEA 5IN7A 1MI0A 3AECB 4RNAA 2QHOA 4RCOA 2KDBA 2K39A 4MH8A 2L0TA 4REZA 1E0ZA 4LCDE 1N5WA 4YT0B 3NZUA 1OEYJ 1JWUD 4PS3A 3MJWA 4X57B 4LDTB 3ZNZB 3R7RA 1Z5SB 3QK0A 5FR6A 4KIKB 3V05A 4ZRIA 4OZCA 1UWXA 1SBBB 2LJ5A 3AULA 2VH1A 3DBRI 3H7PA 3ML8A 1L0YB 5EE1A 3BYTB 4DHJD 5JHBA 4KSLC 3ZIMA 1E7PB 4KGRA 2KN4A 1F52A 4JQWC 1YOVB 4WJQA 3NHEB 4GN1A 3PV1A 3AH7A 2DZJA 2VZKD 3NOBA 3ETRA 3NRZA 1V49A 1KLGD 5LXHA 1JWAD 3KH0A 4OVUA 4IWQA 4HCPB 4RF1A 3B9JA 3WAMA 4EEWA 2QDFA 1MHXA 2WS3B 2FCSA 3GE3C 1IGDA 4ITKA 3RMKC 3TIXA 2UWQA 1JROA 4AS1A 2KLCA 3QHTA 1XO3A 2WXIA 1JW9D 4E71A 3K9OB 1UWMA 2SAKA 3RNEC 2WXJA 4O1NA 1PGXA 2RSUA 3GZNB 1SXTA 2K22A 1F77A 4M0WB 4KKJA 2OOBB 4KDLB 2KFKA 1UNSA 2RDHA 4HPPA 1B9RA 3ZQ4A 3R8BA 1CMXB 1MPEA 2NS5A 4F7ZA 1M94A 2JWZA 1C79A 2K6QA 5L95C 1WGKA 2XN9C 1KLUD 1R4MI 3RD2A 5I4DA 4MM3A 4C80A 3PRZA 4N58A 1QKZA 1C4CA 1XQQA 3MJ5A 5DPRA 3M62B 2KQSA 4EZKA 2L00B 3Q2AC 1YNTE 1HQRD 1P98A 2FUHB 4PS7A 1KLVA 2NCNA 5CX3A 4G50A 1SE2A 3NZ3A 2D11A 2ZCBA 4YWGG 1K8RB 4KIKA 4M01A 1ZP0B 3RFZB 4FULA 3VTWA 3H7PB 4E3CA 2JVCA 1D5XC 4FJZA 1XCQL 2LRUA 4C00A 4C7YA 2JRHA 3RNCC 4HCNB 2M17A 1KJTA 1L6VA 2LUEA 3SR6A 3VUYA 4MACA 3LJ3A 3NJTA 3LXFA 2CU3A 3QA8A 4JE3B 3ZJTA 1K51A 1YX5B 4HPMB 2LD9A 3PREA 4JL9A 4KZCA 2LGDA 4PYZA 1L2NA 1C4AA 5IAAC 1TKEA 4C4VA 3BWUD 4HPLB 4K1RB 2HJ1A 4A9AA 5BMHA 1MFWA 2AL3A 3N1YC 4IWOA 5DPSA 1HEZE 2WXNA 3WAPA 1YX6B 1XCTL 2RD0A 2JY6A 2LGYA 2JWUA 3KUDB 4KGSA 4ASWC 5HFYA 2LZ6A 5G55A 1BUIC 4HXDA 2PTLA 1YQBA 3WANA 3SEBA 2CHXA 4MT5A 1I4RA 4PYUA 4IM3A 3BINA 2D10A 1V1PA 4K7WA 2IJ0A 4NQLB 1MG4A 1S1QB 3R2IA 2J52A 4E74A 1HTQA 1OQQA 1QOAA 3AM9A 2GOWA 4WAAA 5BMGA 3U7ZA 4ZDVA 4HJGE 2NBUA 4G11A 1DOIA 2FCMA 3OJ3A 2BPSA 4ZHPA 2J4XA 3A9KB 3DHIC 2QSDA 2FNJB 4WURA 4WJNA 1YN3A 2AL6A 1JWSD 2Y5BB 3W9CB 1IPGA 3JVZX 4FXCA 3C8YA 3U8ZA 2KJ6A 3QJZA 1V97A 5J18A 5CHFA 1GAQB 3J9CA 2LGIA 2X8XX 4AJYB 2I38A 2N9LA 2O6VD 4A8XC 2W55A 2Y5CA 2MW5A 2CHZA 2G4DB 4TMAB 1AYFA 4RGMA 2WXQA 2JRIB 2MJ3A 5BYSA 1J7AA 1RFAA 3SFEB 4XYCA 3M95A 2DNFA 3U30A 3UF8A 1XLQA 3L08A 4MDKE 4L23A 4F1SA 1ZE3D 4L1BA 1VJKA 1WJUA 3IXSA 2ZW0A 3CIRB 1WM2A 4K81A 5J17A 1P1AA 2M0XA 4HEA1 1MG8A 3QWZB 1KH0A 4YTNB 2QJLA 2HD5B 4OVVA 1EWCA 2DAFA 2K9XA 3WCQA 3IHPC 2B76B 1J7CA 2K5PA 2SEBD 2KWVB 5LLIA 4F8CB 4W9HA 4GDKA 3N1ZC 2FE8A 4IUMB 1NI3A 1QLBB 4S0RA 4KZ0A 2L32A 3DVGY 3Q8FA 3TEZA 4S17A 4K7UA 4HWIB 2KMCA 3PHWB 4ICVA 5JZEB 3GS2A 4II3B 2BQQA 2BS4B 2W9NA 4BVUC 1ACCA 2KAJA 2LXCA 2Q5WD 1YN4A 2N4FA 2I1KA 2MBOA 4LK0M 3KQ4A 3O65B 1OGWA 1R4NI 2EMTA 2IZVB 3EGRA 3DWMA 2MWSB 1V8CA 2IGGA 1WE6A 4C56C 2LVPA 4KSKC 3VDZA 3N20C 3ZXRA 2N7EA 2GBKA 4CQNA 2XEWA 4ZYSA 4FJVB 1EO6A 1E6EB 2D3AA 1A70A 1IUEA 1VZ6A 3OAWA 2CU1A 4M0WA 2KFKB 1FCCC 2CS4A 5D94A 2K3UA 1F2RC 4PT5A 2V4IB 3APFA 4M02A 4HRSA 2WU5B 2WXLA 3DVNU 5J2RA 2IDYA 3KVFB 1E8XA 4ANXA 4WQOB 1MJDA 1FXTB 2MHJA 3HVDA 2KANA 3ZVVA 1C1YB 1GC6A 4AUQC 3H9DA 4FBJB 1HE8A 2L05A 4DHJB 2BF8B 4DXFA 1QILA 1RAXA 3W5VB 3N32A 2JSVX 2GBRA 3WAOA 1N63A 4FJYA 4B0EA 2BYEA 2C5LC 3NVZA 1MHHE 3KW5B 5CTRC 3KYDD 3I3TB 4IWPA 2WNMA 2LUMA 2IGDA 4HK2A 1N62A 5C1ZA 3HM6X 4EUTA 3H6NA 3DWGC 4HJKA 4ZRQA 3NVVA 3ZRCA 1WJ6A 2KVRA 3V61A 4GDLA 1UELA 4NY0A 3EFUA 4WWNA 2I2YA 2XK5A 1LQBA 3Q69A 2BWES 3BVGA 2BGFA 4TSSA 3PSEB 2BKRB 2CJNA 3A9JB 3KYCD 5G5HA 4BKSD 2ZEQA 3UINB 3AEGB 2BB5A 2RDBC 3AEAB 4UDUC 3PRMB 5D2MB 2BW2A 4RM9A 2VRRB 1SIFA 1VZ7A 2K8HA 3QAQA 4DHZE 3PHXB 4KX6B 2KD0A 2WDVB 2AQ2B 3ZNGC 1ESFA 3B0AA 1SE3A 5LNK1 1WR6E 2XBBC 5TSSA 1WY8A 1YQ4B 1AARA 3HVZA 3QCAA 1GB1A 3AV8A 1HA5A 3ZGZA 3K9PB 2D3BA 1TY2A 1WXQA 2WDTB 3AE8B 1MVKA 2V3NA 3MHSD 1JCKB 2W54A 4TV3A 2YEPF 1JRUA 1ISNA 1E90A 3AE2B 1V1PB 2KHWB 4GOCA 1SSNA 3AEFB 3ZTDA 1SJED 4EFOA 1WGGA 4CO7A 2INPE 5D6JB 4ANVA 2E3TA 3VHTC 2KQ7A 2L7RA 4LLGM 1B1ZA 2Z59B 3PPAA 4A90A 1KF6B 1VR9A 1WX9A 4LNFA 4NAWB 3VTVA 1NDDA 2ZVNA 2D3CA 1IGCA 2JZPA 3N30A 4KDIC 4OZAA 1VRAB 2IO2B 1QOBA 3AU4A 3W5UB 1TS3A 2KC1A 2HTHA 1S3SG 4DXAB 2O2VB 2PE6B 2ZNVB 2KQ4X 1TKGA 2ZPNA 2OJRA 2EMSA 3C0RB 4W9GA 1ET9A 2O6VB 5E6PA 4KGTA 2ZJDA 2INNE 3ZJUA 1D5MC 2H89B 4AOFA 1JALA 1FRDA 3QIJA 2XNAC 3V6EB 2V0GA 2LHEA 4XWWA 3T3NA 4XDCA 2GBNA 4IW0A 1E8ZA 1GNUA 2KZRA 2WDQB 2YEPB 3TMPB 3IT4B 2WXHA 2J0MA 4HROA 1XXGA 2FIDA 3L4PA 3TJPA 2BVCA 4WWMA 2J42A 1LM8B 2WWZA 3PGEA 3A4SC 3X0WA 3E9SA 3A1QB 4IM2A 2LASA 1C76A 2WX1A 4MJSB 5T8IA 3VUXA 2KMAA 1TZOA 1HZ6A 1FD6A 3T8MA 1P0RA 3R66C 2L8JA 2K1FA 3PT2B 4ZYNA 3N1XC 2L52A 4A6QA 1XLOA 4LNIA 4M00A 5CHWA 3N9YC 4JPSA 4I6NB 3AU5A 3O13A 2C7MB 4IG7B 2QILA 4RM8A 2RPQA 2PKOA 3HHMA 1Q0WB 3VFKA 1WMHA 4GB9A 4GXBA 3NG0A 2KWUB 3OLMD 2C60A 4K3BA 1JMLA 4MEMA 4WQMA 3B1LX 4RMAA 2MH7A 4XDDA 4KKIA 5AZHA 3VRBB 2W82A 4YTMB 1Y8RC 2UYZB 3ALBA 1WZ3A 3FILB 3LYYA 3RN9C 1WGDA 1RLFA 3VH4B 4YL8A 4AQ7A 3WALA 1VZ8A 4PS8A 3W1YA 1DOXA 1V2YA 4MGIE 1GOZA 4MELA 1XT9B 3CMMB 3VVWB 5CHVC 1QZEA 4FHKA 2R2QA 2MCNB 4LTUA 2BYTA 2NVUI 3DVGX 5D7GA 2WX0A 2HTME 3CSTA 3C19A 3M63B 2MP2B 1D5ZC 5D3DA 1WIAA 3ZTCA 1GB4A 4NJ6A 3VRAB 1NI2A 3AXCA 2RGFA 2GB1A 2AWTA 1F2RI 3DHGC 2Z0DB 4RGOS 2DWQA 2BT6A 1NENB 1WM3A 4L2YA 3EECA 2N7DA 2WXFA 4II2B 1N6ZA 2G1EA 1OFFA 1LFDA 1TKYA 3SD5A 4FADA 2KX3A 1ZOYB 2KFJA 3DBHB 1LXDA 5G5GA 4XGAB 1C9FA 1T0QC 4RH6A 2KVZA 1IP9A 4EOYA 3Q8EA 4R3DA 3UQAA 1V81A 3S2AA 4BOZB 2KNBA 2OHFA 2LGXA 2JPHA 4ARCA 3IVFA 4TKNA 3W1SA 4CHKA 3DCGA 5IP4D 1CJEA 2VH2A 2JF5A 2N9XA 2J0JA 4N9F4 4RGTA 1F1HA 1OTRB 2DX5B 4G0NB 4N59A 1YIWA 2LWPA 4HDQA 1PDXA 3NVYA 4P7IA 1XEEA 1E5WA 1TBEA 1EU4A 2C7NB 2J53A 1KFYB 3A9JA 4W9DA 3BVMA 1I42A 4GU2A 1DYQA 1K53A 1CZPA 2DLBA 1J7BA 1WE7A 2FIFA 1YMHE 2ZVOA 3ZLZA 1HTOA 3Q3OC 1E9MA 1Q1OA 3IFWB 2DZMA 4C7ZA 4FLHA 4DDGD 1SE9A 2DYBA 3ZNHB 3HM3A 2KTRA 2WYQA 1UF0A 1DGJA 4LDTD 1NBFC 1KRHA 2Z8LA 3P1MA 2I1JA 2PIAA 3Q3NC 3GP7A 3KUCB 3A33B 3B2GA 2PEAA 3L17A 2HE7A 2CKHB 1P9DU 5DCNA 1L5PA 2PE9A 1HXYD 2MBEA 3TEXA 3SU8X 2WQYB 3UIPB 1IBXB 4M8NA 2N9EB 2LI5A 1OQYA 3QARA 1H4RA 2XK5B 2KTFA 4IC7B 4NZLB 2PMVA 2WLBA 5MPOA 2MBHA 1EWYC 3MP9A 1YJJA 1EUVB 3VR9B 3PTFC 1D3ZA 2OEDA 4BBNF 2MQJA 4ZRPA 4RF0A 4DBGA 1VLBA 3AEDB 4B9KA 2W3SA 3SDLC 2RMMA 3NS8A 3OWEB 4YSXB 2G4SA 3P42A 4A3PA 2GRIA 3ZW3A 2DHZA 4W9EA 3ZO5B 3PLUA 4GDLB 4NJCA 4XWTA 1UD7A 3AEEB 2KMMA 2W3RA 2KDEB 2BWFA 1PUTA 2GMIC 4AJWA 3JW0X 1TIFA 2AQ3B 2AEHA 3PZ7A 3DVNV 5DPWA 2KLGA 3TEWA 3VUWA 2MSED 3ONSA 3FAHA 4JWSC 1UBIA 4JLCA 4USAA 3URYA 3OG5A 2RR9A 4B95A 2INCC 1FXIA 2KJHB 3FKYA 1I4PA 4W9LA 1RRBA 2PVGC 3L13A 3ZDMC 4C4VB 1EF1A 1JQ4A 2IYDB 4W9CA 4WIPA 2GI9A 4HDOA 2GLSA 2CR5A 1WZ0A 1L4DB 4MSQB 3KWLA 2WXKA 5JH5C 4XE0A 1E7UA 1GJZA 4DWFA 1JWMD 1PQSA 2DENB 4PK1A 2AX5A 5L83A 1C3TA 2QCZA 2ZPYA 1I7HA 3RNAC 2NBVB 4MH0E 3RPFC 4GIVA 1ZKHA 3Q8BA 4D2KA 4KVGB 2N1VA 3UI3A 3MC8A 1SF0A 4W9FA 1UH6A 4NQKE 3P4QB 2MJEA 3AI5A 4BKGA 1R4NB
chains in the Genus database with same CATH topology
2BQQA 1UF0A 5IO9A 5IP4D 1MG4A 5IOIA 1MFWA 5IKCM 1MJDA 2DNFA 5IN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BQQ A;  1UF0 A;  5IO9 A;  5IP4 D;  1MG4 A;  5IOI A;  1MFW A;  5IKC M;  1MJD A;  2DNF A;  5IN7 A; 
#chains in the Genus database with same CATH topology
 2LFI A;  2MX2 A;  1CK1 A;  1SE4 A;  1P7F A;  5GXG B;  2IBI B;  3IT6 B;  2MRP A;  3P4R B;  3ZDT A;  1ZDV A;  4US9 A;  5C23 A;  1E8Y A;  4MGY E;  5FR3 A;  2WXO A;  1VD2 A;  1WSP A;  1AW7 A;  1WFY A;  3DBL B;  3DHH C;  4TQ1 A;  2L3Z A;  4JWU C;  4IDI A;  2IY1 B;  3RNF C;  3DOW A;  4DQO C;  3R2T A;  3VAW A;  2R61 A;  3H1U A;  2GBJ A;  3AMZ A;  1V6E A;  3DQV A;  3WA0 A;  3AE7 B;  4H2A A;  3B2F A;  2BYV E;  5TR5 A;  2TSS A;  2V9H A;  2KT7 A;  2B3A A;  2KK8 A;  2D07 B;  4B0M A;  4GSW A;  1GPX A;  2G3Q B;  3PLV A;  2K0P A;  3GZN I;  1ZXH A;  1V5T A;  5E6J A;  1ZDX A;  3X23 A;  4P1B C;  3BYY B;  4ZRJ A;  1V5O A;  3TCA A;  1ZXI A;  3QX1 A;  1TJE A;  3VH3 B;  2KJR A;  4AP4 C;  2QIE B;  2NBW B;  4MGZ E;  1WXM A;  4DDI D;  3TSS A;  3NUH B;  1SB3 C;  1T5X D;  2MJD A;  4HKQ A;  2O2V A;  3AE5 B;  2G9H D;  4MSM B;  3EUB 2;  3EHV A;  3EC8 A;  5BO4 B;  3Q14 C;  4RFB A;  5FKA C;  1L0V B;  3UQB A;  3V60 A;  3MC9 A;  3TEY A;  1Y56 A;  3U52 E;  2KXJ A;  2M19 A;  1AWD A;  1QOG A;  5AZF A;  3AE6 B;  1SIJ A;  3V6C B;  4LNN A;  1U4A A;  4K7S A;  1H8C A;  2PW9 A;  4N6E B;  3HIZ A;  1XLP A;  1Q5W B;  3IAS 1;  4J6I A;  4OVZ A;  1J8C A;  3NZS A;  5KHO A;  1V86 A;  2NPT A;  3U2S C;  3ECI A;  1OEY A;  1ZUD 2;  2M8S A;  2O6V A;  4AWJ A;  4ICU A;  3BK1 A;  3EFC A;  2L76 A;  1J0G A;  1EF5 A;  2KX0 A;  2M4N A;  2LEK A;  2BTE A;  4JIO U;  4JX1 C;  1NVI D;  5HG2 A;  4ANW A;  1TS5 A;  4GGQ A;  3U7D A;  2MLB A;  1RWS A;  1PFD A;  2Y5P A;  3KUZ A;  3AE4 B;  1ENF A;  2JX5 A;  3BK2 A;  3PO0 A;  3NS1 A;  3Q3M C;  3AB5 A;  3MC0 B;  1FPY A;  1FNV A;  1RM6 C;  1WRD B;  2N9P C;  1T0Y A;  3I9V 1;  1YD8 U;  3IBE A;  3ZYY X;  1XF5 L;  3PRP B;  2V4L A;  4WJO A;  5C3J B;  1GG3 A;  4MJS A;  3W1S C;  2LHD A;  4Q2J A;  2JUO A;  4OHJ A;  1BT0 A;  2M56 B;  3EA6 A;  2WXR A;  3V3X A;  4I6L B;  3V62 A;  3ML9 A;  2IGH A;  3A9K A;  3ZJV A;  2X38 A;  1YJ1 A;  1WJN A;  2IY0 B;  5KHQ A;  4NNJ B;  2RDG A;  2E6X A;  2K8B A;  1BML C;  1BXT A;  4IKG A;  1N60 A;  4P6V F;  1P3Q U;  4DK5 A;  4J3O D;  3BVZ A;  4QAY A;  4XZ4 A;  1PYW D;  4G3X B;  4HVB A;  4YTP B;  3RYT A;  1WYW B;  1YN5 A;  5G2N A;  1F9J A;  1I4H A;  1RFK A;  3PZD A;  2M1M A;  4M8M A;  1WGY A;  2DYO A;  2JXX A;  2H88 B;  2MA9 B;  2GBM A;  4WWP A;  5BYR A;  2DZI A;  1FNW A;  2V3P A;  2KDF B;  4TUU A;  1UZX B;  2FAZ A;  1WR1 A;  2JZZ A;  2Y3A A;  4LNK A;  1HZ5 A;  1JWB D;  3NVW A;  4EZL A;  3TL5 A;  1ROE A;  4BFR A;  2DBY A;  1M4V A;  3TUO A;  4ACF A;  1QF6 A;  3UIO B;  1I4G A;  1N5X A;  3OJ4 B;  4MM3 B;  2WP9 B;  3HK0 A;  4ZOH C;  2FUG 1;  3B08 A;  3PS6 A;  2C9W B;  1T0R C;  1XLN A;  1TY0 A;  4BZA A;  5BMI A;  5FK9 C;  1I4X A;  4BBN C;  1GUA B;  3D32 A;  4WJP A;  3IAM 1;  3DBS A;  4A3O A;  2JU6 X;  4ANU A;  2K8C A;  2LRW A;  4NJ7 A;  1V80 A;  4GMV A;  4XX5 A;  1IBX A;  1TS4 A;  1LGR A;  1XD3 B;  3WIM A;  5IOI A;  2IPK D;  2EKE C;  2KYW A;  4GLS C;  3P4S B;  1KTK A;  2D5G A;  2EEL A;  2LGS A;  1WH3 A;  5C2T B;  1UBQ A;  4OZB A;  5E6O A;  1TGZ B;  3R7Q A;  3RI7 C;  2KTR B;  5IKC M;  4NPN A;  3MHZ A;  1Q10 A;  3H8H A;  1NEK B;  2ON8 A;  3RNG C;  2KWC A;  3Q8A A;  3GB1 A;  5HI1 A;  2KDI A;  1L0X B;  2A4Z A;  2NTS A;  1L4Z B;  3KLS X;  5LXI B;  2V1Y A;  3JSV A;  5HHD G;  2UU7 A;  2JQR B;  4ZRK A;  1KM7 A;  1F0Z A;  2L83 A;  1T0S C;  2REX A;  2JT4 B;  3Q3F A;  4US8 A;  2IND C;  1FIQ A;  5AUK A;  1CQV A;  2ICI A;  2KWD A;  1WGR A;  2N1W A;  4W9K A;  2KOX A;  1K50 A;  5AZG A;  3RUL A;  3VR8 B;  4WWO A;  3QQ8 B;  1FNU A;  4NAW A;  1V9J A;  1D4B A;  1NYQ A;  2KC2 A;  3CF6 E;  4IM0 A;  3SHQ A;  4IOI E;  1WYG A;  5D3I B;  2PVO D;  4ARI A;  4BKS A;  4LJP B;  3VXW A;  4DXG A;  3PVL A;  5EE0 A;  1PGA A;  2QMT A;  3FC4 A;  2G45 B;  3AN1 A;  1OQR A;  3W2D A;  1I4Q A;  4YSY B;  3AE1 B;  1FXA A;  4YXD B;  3T3O A;  1Z2M A;  3A1Q A;  1FCL A;  1FFU A;  3AEB B;  3I57 A;  2FCN A;  2HDE A;  2FCQ A;  3APD A;  2DAJ A;  4P16 A;  3DBL I;  1GC7 A;  4DHZ B;  3TBL D;  3AE9 B;  3A4R A;  4W9J A;  2LJI A;  2ZZP B;  1JRP A;  1IYF A;  2KN5 A;  3GOE A;  1UUP A;  2AQ1 B;  1R4M B;  2BBC A;  3JSV B;  1WRI A;  1ZW7 A;  3RZW C;  5HKH A;  1QT9 A;  1QQR A;  3RUI B;  2KAC A;  2YVC A;  4W9I A;  4EKU A;  5IA7 A;  2WU2 B;  1TT5 B;  2K25 A;  2WXP A;  3APC A;  1L7Y A;  3RZF A;  3AE3 B;  2YLM A;  2J0K A;  5EE9 A;  2ACZ B;  2MEK A;  3I5J C;  4B6W A;  2EKI A;  2WHI A;  2DZK A;  2IO1 B;  2J7Q B;  1DOY A;  2IO3 B;  3QC8 B;  3RNB C;  1QOF A;  1WMH B;  4YSZ B;  1WJ4 A;  2MBB B;  3PZ8 A;  3T9L A;  2PJH A;  1WGH A;  2NPT B;  2MP2 A;  1WX8 A;  4MGK E;  4EZJ A;  3I63 C;  1LO5 D;  3KWV A;  1D6E C;  3JYU A;  2A5U A;  1STE A;  1I35 A;  2KDM A;  2ASQ A;  2WXG A;  3IG3 A;  1EU3 A;  5E6N A;  2HJ8 A;  2JXT A;  2ZNV C;  1G6J A;  2AYO B;  2L0F A;  5GMV A;  3MTN B;  1AN8 A;  2WXM A;  2K6D B;  4RGN A;  1KOT A;  2JYT A;  5JXV A;  3DBH I;  5JHA A;  2D2Q A;  2KO3 A;  4HLE A;  2WGS A;  3Q6B A;  2KKC A;  1YJI A;  4I6P A;  4NAM A;  2LMC A;  3RT3 B;  1RYJ A;  1EM7 A;  2BS2 B;  1V1O A;  4HKZ E;  3LB8 C;  2ZCC A;  3ZRF A;  3DDC B;  3HUI A;  3L16 A;  3NY5 A;  3P2B A;  3ZNI D;  1FO4 A;  4LNO A;  2QEJ C;  3R3M A;  1WWT A;  1VCB A;  1P7E A;  5AUI A;  3SFD B;  3E56 A;  1FEH A;  4WAF A;  2LVQ A;  1UGM A;  2LVO A;  3CWI A;  1R7S A;  4A20 A;  1C78 A;  1WXS A;  3VQI A;  3ABV B;  1FFV A;  3ZXV A;  4JGH B;  1WX7 A;  4TQ0 A;  3Q3J A;  3N3K B;  1E8W A;  5AEK B;  3FIL A;  1WI0 A;  3VTU A;  1YQ3 B;  1N61 A;  4BAX A;  1L6U A;  3ZUN A;  1A5R A;  1WXV A;  4A55 A;  4KV2 A;  1C4P A;  1TS2 A;  3DPD A;  1C77 A;  2NMQ A;  1VDV A;  2BKF A;  2FBW B;  3P63 A;  2WDR B;  3H7S A;  2ZW1 A;  4FHJ A;  1FM0 D;  2C7H A;  2JZ3 B;  1SEB D;  2BS3 B;  4GDK B;  3M3J A;  3LDZ E;  2MBQ A;  2R2O A;  2DYM A;  2RPV A;  3BY4 B;  1SJH D;  4BKT A;  5EE3 A;  1ZPS A;  4BOS C;  1WF9 A;  1ET6 A;  3GE8 C;  1SGH A;  3DBR B;  2V3S A;  5EDS A;  4LJO B;  4WH4 A;  2D3G A;  2CJO A;  2LXA A;  4ZHO A;  1NYR A;  3BII D;  1UGJ A;  2BYF A;  2QC8 A;  3UGB B;  1TYG B;  4EE2 A;  1PGB A;  2OJW A;  1FMA D;  2L1A A;  1K52 A;  4FN2 A;  3MFG A;  1T3Q A;  2Z0E B;  3CSF A;  2CHW A;  3L54 A;  4K3C A;  2PLP A;  1FRR A;  1E7V A;  2N9K A;  4OW0 A;  3U4E G;  1T6B X;  5DPT A;  3HRD D;  5H92 C;  3Q8C A;  3ZKJ C;  3P4P B;  4P1C C;  3RCZ A;  2M0A A;  3BZD B;  4XC2 A;  3L10 B;  2NTT A;  1E10 A;  5IO9 A;  1WXA A;  2VZK B;  1ZGU B;  4FA6 A;  2N7J A;  1J19 A;  2PPH A;  2IO0 B;  4CYE A;  2ONQ A;  3ENE A;  2BB6 A;  1X1M A;  2N0S B;  1TZ1 A;  3L0W B;  5H8Y E;  4URK A;  5BYQ A;  2NR2 A;  1TTN A;  2JYE A;  5IN7 A;  1MI0 A;  3AEC B;  4RNA A;  2QHO A;  4RCO A;  2KDB A;  2K39 A;  4MH8 A;  2L0T A;  4REZ A;  1E0Z A;  4LCD E;  1N5W A;  4YT0 B;  3NZU A;  1OEY J;  1JWU D;  4PS3 A;  3MJW A;  4X57 B;  4LDT B;  3ZNZ B;  3R7R A;  1Z5S B;  3QK0 A;  5FR6 A;  4KIK B;  3V05 A;  4ZRI A;  4OZC A;  1UWX A;  1SBB B;  2LJ5 A;  3AUL A;  2VH1 A;  3DBR I;  3H7P A;  3ML8 A;  1L0Y B;  5EE1 A;  3BYT B;  4DHJ D;  5JHB A;  4KSL C;  3ZIM A;  1E7P B;  4KGR A;  2KN4 A;  1F52 A;  4JQW C;  1YOV B;  4WJQ A;  3NHE B;  4GN1 A;  3PV1 A;  3AH7 A;  2DZJ A;  2VZK D;  3NOB A;  3ETR A;  3NRZ A;  1V49 A;  1KLG D;  5LXH A;  1JWA D;  3KH0 A;  4OVU A;  4IWQ A;  4HCP B;  4RF1 A;  3B9J A;  3WAM A;  4EEW A;  2QDF A;  1MHX A;  2WS3 B;  2FCS A;  3GE3 C;  1IGD A;  4ITK A;  3RMK C;  3TIX A;  2UWQ A;  1JRO A;  4AS1 A;  2KLC A;  3QHT A;  1XO3 A;  2WXI A;  1JW9 D;  4E71 A;  3K9O B;  1UWM A;  2SAK A;  3RNE C;  2WXJ A;  4O1N A;  1PGX A;  2RSU A;  3GZN B;  1SXT A;  2K22 A;  1F77 A;  4M0W B;  4KKJ A;  2OOB B;  4KDL B;  2KFK A;  1UNS A;  2RDH A;  4HPP A;  1B9R A;  3ZQ4 A;  3R8B A;  1CMX B;  1MPE A;  2NS5 A;  4F7Z A;  1M94 A;  2JWZ A;  1C79 A;  2K6Q A;  5L95 C;  1WGK A;  2XN9 C;  1KLU D;  1R4M I;  3RD2 A;  5I4D A;  4MM3 A;  4C80 A;  3PRZ A;  4N58 A;  1QKZ A;  1C4C A;  1XQQ A;  3MJ5 A;  5DPR A;  3M62 B;  2KQS A;  4EZK A;  2L00 B;  3Q2A C;  1YNT E;  1HQR D;  1P98 A;  2FUH B;  4PS7 A;  1KLV A;  2NCN A;  5CX3 A;  4G50 A;  1SE2 A;  3NZ3 A;  2D11 A;  2ZCB A;  4YWG G;  1K8R B;  4KIK A;  4M01 A;  1ZP0 B;  3RFZ B;  4FUL A;  3VTW A;  3H7P B;  4E3C A;  2JVC A;  1D5X C;  4FJZ A;  1XCQ L;  2LRU A;  4C00 A;  4C7Y A;  2JRH A;  3RNC C;  4HCN B;  2M17 A;  1KJT A;  1L6V A;  2LUE A;  3SR6 A;  3VUY A;  4MAC A;  3LJ3 A;  3NJT A;  3LXF A;  2CU3 A;  3QA8 A;  4JE3 B;  3ZJT A;  1K51 A;  1YX5 B;  4HPM B;  2LD9 A;  3PRE A;  4JL9 A;  4KZC A;  2LGD A;  4PYZ A;  1L2N A;  1C4A A;  5IAA C;  1TKE A;  4C4V A;  3BWU D;  4HPL B;  4K1R B;  2HJ1 A;  4A9A A;  5BMH A;  1MFW A;  2AL3 A;  3N1Y C;  4IWO A;  5DPS A;  1HEZ E;  2WXN A;  3WAP A;  1YX6 B;  1XCT L;  2RD0 A;  2JY6 A;  2LGY A;  2JWU A;  3KUD B;  4KGS A;  4ASW C;  5HFY A;  2LZ6 A;  5G55 A;  1BUI C;  4HXD A;  2PTL A;  1YQB A;  3WAN A;  3SEB A;  2CHX A;  4MT5 A;  1I4R A;  4PYU A;  4IM3 A;  3BIN A;  2D10 A;  1V1P A;  4K7W A;  2IJ0 A;  4NQL B;  1MG4 A;  1S1Q B;  3R2I A;  2J52 A;  4E74 A;  1HTQ A;  1OQQ A;  1QOA A;  3AM9 A;  2GOW A;  4WAA A;  5BMG A;  3U7Z A;  4ZDV A;  4HJG E;  2NBU A;  4G11 A;  1DOI A;  2FCM A;  3OJ3 A;  2BPS A;  4ZHP A;  2J4X A;  3A9K B;  3DHI C;  2QSD A;  2FNJ B;  4WUR A;  4WJN A;  1YN3 A;  2AL6 A;  1JWS D;  2Y5B B;  3W9C B;  1IPG A;  3JVZ X;  4FXC A;  3C8Y A;  3U8Z A;  2KJ6 A;  3QJZ A;  1V97 A;  5J18 A;  5CHF A;  1GAQ B;  3J9C A;  2LGI A;  2X8X X;  4AJY B;  2I38 A;  2N9L A;  2O6V D;  4A8X C;  2W55 A;  2Y5C A;  2MW5 A;  2CHZ A;  2G4D B;  4TMA B;  1AYF A;  4RGM A;  2WXQ A;  2JRI B;  2MJ3 A;  5BYS A;  1J7A A;  1RFA A;  3SFE B;  4XYC A;  3M95 A;  2DNF A;  3U30 A;  3UF8 A;  1XLQ A;  3L08 A;  4MDK E;  4L23 A;  4F1S A;  1ZE3 D;  4L1B A;  1VJK A;  1WJU A;  3IXS A;  2ZW0 A;  3CIR B;  1WM2 A;  4K81 A;  5J17 A;  1P1A A;  2M0X A;  4HEA 1;  1MG8 A;  3QWZ B;  1KH0 A;  4YTN B;  2QJL A;  2HD5 B;  4OVV A;  1EWC A;  2DAF A;  2K9X A;  3WCQ A;  3IHP C;  2B76 B;  1J7C A;  2K5P A;  2SEB D;  2KWV B;  5LLI A;  4F8C B;  4W9H A;  4GDK A;  3N1Z C;  2FE8 A;  4IUM B;  1NI3 A;  1QLB B;  4S0R A;  4KZ0 A;  2L32 A;  3DVG Y;  3Q8F A;  3TEZ A;  4S17 A;  4K7U A;  4HWI B;  2KMC A;  3PHW B;  4ICV A;  5JZE B;  3GS2 A;  4II3 B;  2BQQ A;  2BS4 B;  2W9N A;  4BVU C;  1ACC A;  2KAJ A;  2LXC A;  2Q5W D;  1YN4 A;  2N4F A;  2I1K A;  2MBO A;  4LK0 M;  3KQ4 A;  3O65 B;  1OGW A;  1R4N I;  2EMT A;  2IZV B;  3EGR A;  3DWM A;  2MWS B;  1V8C A;  2IGG A;  1WE6 A;  4C56 C;  2LVP A;  4KSK C;  3VDZ A;  3N20 C;  3ZXR A;  2N7E A;  2GBK A;  4CQN A;  2XEW A;  4ZYS A;  4FJV B;  1EO6 A;  1E6E B;  2D3A A;  1A70 A;  1IUE A;  1VZ6 A;  3OAW A;  2CU1 A;  4M0W A;  2KFK B;  1FCC C;  2CS4 A;  5D94 A;  2K3U A;  1F2R C;  4PT5 A;  2V4I B;  3APF A;  4M02 A;  4HRS A;  2WU5 B;  2WXL A;  3DVN U;  5J2R A;  2IDY A;  3KVF B;  1E8X A;  4ANX A;  4WQO B;  1MJD A;  1FXT B;  2MHJ A;  3HVD A;  2KAN A;  3ZVV A;  1C1Y B;  1GC6 A;  4AUQ C;  3H9D A;  4FBJ B;  1HE8 A;  2L05 A;  4DHJ B;  2BF8 B;  4DXF A;  1QIL A;  1RAX A;  3W5V B;  3N32 A;  2JSV X;  2GBR A;  3WAO A;  1N63 A;  4FJY A;  4B0E A;  2BYE A;  2C5L C;  3NVZ A;  1MHH E;  3KW5 B;  5CTR C;  3KYD D;  3I3T B;  4IWP A;  2WNM A;  2LUM A;  2IGD A;  4HK2 A;  1N62 A;  5C1Z A;  3HM6 X;  4EUT A;  3H6N A;  3DWG C;  4HJK A;  4ZRQ A;  3NVV A;  3ZRC A;  1WJ6 A;  2KVR A;  3V61 A;  4GDL A;  1UEL A;  4NY0 A;  3EFU A;  4WWN A;  2I2Y A;  2XK5 A;  1LQB A;  3Q69 A;  2BWE S;  3BVG A;  2BGF A;  4TSS A;  3PSE B;  2BKR B;  2CJN A;  3A9J B;  3KYC D;  5G5H A;  4BKS D;  2ZEQ A;  3UIN B;  3AEG B;  2BB5 A;  2RDB C;  3AEA B;  4UDU C;  3PRM B;  5D2M B;  2BW2 A;  4RM9 A;  2VRR B;  1SIF A;  1VZ7 A;  2K8H A;  3QAQ A;  4DHZ E;  3PHX B;  4KX6 B;  2KD0 A;  2WDV B;  2AQ2 B;  3ZNG C;  1ESF A;  3B0A A;  1SE3 A;  5LNK 1;  1WR6 E;  2XBB C;  5TSS A;  1WY8 A;  1YQ4 B;  1AAR A;  3HVZ A;  3QCA A;  1GB1 A;  3AV8 A;  1HA5 A;  3ZGZ A;  3K9P B;  2D3B A;  1TY2 A;  1WXQ A;  2WDT B;  3AE8 B;  1MVK A;  2V3N A;  3MHS D;  1JCK B;  2W54 A;  4TV3 A;  2YEP F;  1JRU A;  1ISN A;  1E90 A;  3AE2 B;  1V1P B;  2KHW B;  4GOC A;  1SSN A;  3AEF B;  3ZTD A;  1SJE D;  4EFO A;  1WGG A;  4CO7 A;  2INP E;  5D6J B;  4ANV A;  2E3T A;  3VHT C;  2KQ7 A;  2L7R A;  4LLG M;  1B1Z A;  2Z59 B;  3PPA A;  4A90 A;  1KF6 B;  1VR9 A;  1WX9 A;  4LNF A;  4NAW B;  3VTV A;  1NDD A;  2ZVN A;  2D3C A;  1IGC A;  2JZP A;  3N30 A;  4KDI C;  4OZA A;  1VRA B;  2IO2 B;  1QOB A;  3AU4 A;  3W5U B;  1TS3 A;  2KC1 A;  2HTH A;  1S3S G;  4DXA B;  2O2V B;  2PE6 B;  2ZNV B;  2KQ4 X;  1TKG A;  2ZPN A;  2OJR A;  2EMS A;  3C0R B;  4W9G A;  1ET9 A;  2O6V B;  5E6P A;  4KGT A;  2ZJD A;  2INN E;  3ZJU A;  1D5M C;  2H89 B;  4AOF A;  1JAL A;  1FRD A;  3QIJ A;  2XNA C;  3V6E B;  2V0G A;  2LHE A;  4XWW A;  3T3N A;  4XDC A;  2GBN A;  4IW0 A;  1E8Z A;  1GNU A;  2KZR A;  2WDQ B;  2YEP B;  3TMP B;  3IT4 B;  2WXH A;  2J0M A;  4HRO A;  1XXG A;  2FID A;  3L4P A;  3TJP A;  2BVC A;  4WWM A;  2J42 A;  1LM8 B;  2WWZ A;  3PGE A;  3A4S C;  3X0W A;  3E9S A;  3A1Q B;  4IM2 A;  2LAS A;  1C76 A;  2WX1 A;  4MJS B;  5T8I A;  3VUX A;  2KMA A;  1TZO A;  1HZ6 A;  1FD6 A;  3T8M A;  1P0R A;  3R66 C;  2L8J A;  2K1F A;  3PT2 B;  4ZYN A;  3N1X C;  2L52 A;  4A6Q A;  1XLO A;  4LNI A;  4M00 A;  5CHW A;  3N9Y C;  4JPS A;  4I6N B;  3AU5 A;  3O13 A;  2C7M B;  4IG7 B;  2QIL A;  4RM8 A;  2RPQ A;  2PKO A;  3HHM A;  1Q0W B;  3VFK A;  1WMH A;  4GB9 A;  4GXB A;  3NG0 A;  2KWU B;  3OLM D;  2C60 A;  4K3B A;  1JML A;  4MEM A;  4WQM A;  3B1L X;  4RMA A;  2MH7 A;  4XDD A;  4KKI A;  5AZH A;  3VRB B;  2W82 A;  4YTM B;  1Y8R C;  2UYZ B;  3ALB A;  1WZ3 A;  3FIL B;  3LYY A;  3RN9 C;  1WGD A;  1RLF A;  3VH4 B;  4YL8 A;  4AQ7 A;  3WAL A;  1VZ8 A;  4PS8 A;  3W1Y A;  1DOX A;  1V2Y A;  4MGI E;  1GOZ A;  4MEL A;  1XT9 B;  3CMM B;  3VVW B;  5CHV C;  1QZE A;  4FHK A;  2R2Q A;  2MCN B;  4LTU A;  2BYT A;  2NVU I;  3DVG X;  5D7G A;  2WX0 A;  2HTM E;  3CST A;  3C19 A;  3M63 B;  2MP2 B;  1D5Z C;  5D3D A;  1WIA A;  3ZTC A;  1GB4 A;  4NJ6 A;  3VRA B;  1NI2 A;  3AXC A;  2RGF A;  2GB1 A;  2AWT A;  1F2R I;  3DHG C;  2Z0D B;  4RGO S;  2DWQ A;  2BT6 A;  1NEN B;  1WM3 A;  4L2Y A;  3EEC A;  2N7D A;  2WXF A;  4II2 B;  1N6Z A;  2G1E A;  1OFF A;  1LFD A;  1TKY A;  3SD5 A;  4FAD A;  2KX3 A;  1ZOY B;  2KFJ A;  3DBH B;  1LXD A;  5G5G A;  4XGA B;  1C9F A;  1T0Q C;  4RH6 A;  2KVZ A;  1IP9 A;  4EOY A;  3Q8E A;  4R3D A;  3UQA A;  1V81 A;  3S2A A;  4BOZ B;  2KNB A;  2OHF A;  2LGX A;  2JPH A;  4ARC A;  3IVF A;  4TKN A;  3W1S A;  4CHK A;  3DCG A;  5IP4 D;  1CJE A;  2VH2 A;  2JF5 A;  2N9X A;  2J0J A;  4N9F 4;  4RGT A;  1F1H A;  1OTR B;  2DX5 B;  4G0N B;  4N59 A;  1YIW A;  2LWP A;  4HDQ A;  1PDX A;  3NVY A;  4P7I A;  1XEE A;  1E5W A;  1TBE A;  1EU4 A;  2C7N B;  2J53 A;  1KFY B;  3A9J A;  4W9D A;  3BVM A;  1I42 A;  4GU2 A;  1DYQ A;  1K53 A;  1CZP A;  2DLB A;  1J7B A;  1WE7 A;  2FIF A;  1YMH E;  2ZVO A;  3ZLZ A;  1HTO A;  3Q3O C;  1E9M A;  1Q1O A;  3IFW B;  2DZM A;  4C7Z A;  4FLH A;  4DDG D;  1SE9 A;  2DYB A;  3ZNH B;  3HM3 A;  2KTR A;  2WYQ A;  1UF0 A;  1DGJ A;  4LDT D;  1NBF C;  1KRH A;  2Z8L A;  3P1M A;  2I1J A;  2PIA A;  3Q3N C;  3GP7 A;  3KUC B;  3A33 B;  3B2G A;  2PEA A;  3L17 A;  2HE7 A;  2CKH B;  1P9D U;  5DCN A;  1L5P A;  2PE9 A;  1HXY D;  2MBE A;  3TEX A;  3SU8 X;  2WQY B;  3UIP B;  1IBX B;  4M8N A;  2N9E B;  2LI5 A;  1OQY A;  3QAR A;  1H4R A;  2XK5 B;  2KTF A;  4IC7 B;  4NZL B;  2PMV A;  2WLB A;  5MPO A;  2MBH A;  1EWY C;  3MP9 A;  1YJJ A;  1EUV B;  3VR9 B;  3PTF C;  1D3Z A;  2OED A;  4BBN F;  2MQJ A;  4ZRP A;  4RF0 A;  4DBG A;  1VLB A;  3AED B;  4B9K A;  2W3S A;  3SDL C;  2RMM A;  3NS8 A;  3OWE B;  4YSX B;  2G4S A;  3P42 A;  4A3P A;  2GRI A;  3ZW3 A;  2DHZ A;  4W9E A;  3ZO5 B;  3PLU A;  4GDL B;  4NJC A;  4XWT A;  1UD7 A;  3AEE B;  2KMM A;  2W3R A;  2KDE B;  2BWF A;  1PUT A;  2GMI C;  4AJW A;  3JW0 X;  1TIF A;  2AQ3 B;  2AEH A;  3PZ7 A;  3DVN V;  5DPW A;  2KLG A;  3TEW A;  3VUW A;  2MSE D;  3ONS A;  3FAH A;  4JWS C;  1UBI A;  4JLC A;  4USA A;  3URY A;  3OG5 A;  2RR9 A;  4B95 A;  2INC C;  1FXI A;  2KJH B;  3FKY A;  1I4P A;  4W9L A;  1RRB A;  2PVG C;  3L13 A;  3ZDM C;  4C4V B;  1EF1 A;  1JQ4 A;  2IYD B;  4W9C A;  4WIP A;  2GI9 A;  4HDO A;  2GLS A;  2CR5 A;  1WZ0 A;  1L4D B;  4MSQ B;  3KWL A;  2WXK A;  5JH5 C;  4XE0 A;  1E7U A;  1GJZ A;  4DWF A;  1JWM D;  1PQS A;  2DEN B;  4PK1 A;  2AX5 A;  5L83 A;  1C3T A;  2QCZ A;  2ZPY A;  1I7H A;  3RNA C;  2NBV B;  4MH0 E;  3RPF C;  4GIV A;  1ZKH A;  3Q8B A;  4D2K A;  4KVG B;  2N1V A;  3UI3 A;  3MC8 A;  1SF0 A;  4W9F A;  1UH6 A;  4NQK E;  3P4Q B;  2MJE A;  3AI5 A;  4BKG A;  1R4N B; 
#chains in the Genus database with same CATH homology
 2BQQ A;  1UF0 A;  5IO9 A;  5IP4 D;  1MG4 A;  5IOI A;  1MFW A;  5IKC M;  1MJD A;  2DNF A;  5IN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...