2BQQA

X-ray structure of the n-terminal domain of human doublecortin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
b'AKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL MIGRATION PROTEIN DOUBLECORTIN
publication title The Dc-Module of Doublecortin: Dynamics, Domain Boundaries, and Functional Implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 2bqqA00
1MJDA 5IN7A 2BQQA 5IP4D 1UF0A 5IOIA 1MFWA 5IO9A 1MG4A 2DNFA 5IKCM
chains in the Genus database with same CATH superfamily
1ZUD2 5AZGA 3EHVA 2W9NA 1B9RA 2BPSA 4BVUC 3Q8BA 2C7HA 1BT0A 2K8HA 4TV3A 4I6LB 2M0AA 1E8WA 4YTMB 4EKUA 2JWUA 4NY0A 4R3DA 5D94A 2BYVE 3N1ZC 2ZW0A 4OZBA 1AWDA 3RYTA 4NZLB 1E8ZA 2QSDA 5DPRA 1BMLC 3N32A 4FXCA 2W55A 4MH0E 3TEXA 3B08A 3CSFA 3V05A 4PK1A 4BKTA 2MEKA 4HCPB 4BFRA 1V86A 1XF5L 4PYZA 3TMPB 3AEAB 5EE3A 3APDA 2MX2A 4XX5A 4KGTA 2DZKA 4REZA 3ZTDA 3Q2AC 1N5WA 1XLNA 2R2QA 1FNVA 2INPE 3H9DA 2EELA 1J7CA 3GS2A 5C1ZA 2WYQA 1WJ4A 2C7MB 3W1SA 1VZ8A 4DHZE 3DBHB 3LYYA 3MP9A 3MC0B 2L32A 3ZLZA 2KXJA 4YXDB 3VAWA 2IZVB 1CK1A 1WR1A 1XEEA 3KUDB 2ZNVB 3NJTA 2KDFB 4PS7A 2M1MA 3U2SC 2Y5BB 4CHKA 5EDSA 4OVZA 4HPPA 4NNJB 4XC2A 2LGSA 3M63B 3CF6E 1WGDA 5AUKA 4HRSA 3KVFB 3BK1A 3QA8A 5JHAA 1K51A 3PRPB 2KDIA 3W9CB 1N63A 1RFAA 4O1NA 3B0AA 5D3IB 1LM8B 3DPDA 1UF0A 3VHTC 4C4VA 4II2B 1QKZA 1WXQA 5AZFA 2NTSA 4RH6A 3ML9A 2CS4A 1X1MA 3DHGC 4ZDVA 3UF8A 2JZZA 3AEGB 3PGEA 4GXBA 2HDEA 5E6OA 1J8CA 4XWWA 2L52A 1WMHB 3P2BA 4EEWA 1F77A 1GJZA 3IBEA 1I4PA 2JVCA 2L7RA 2RPQA 2WU5B 4KIKB 4KZ0A 3T3OA 4DXGA 1NYQA 3Q3FA 3FAHA 4FJYA 2UU7A 1JMLA 3DBLB 3VH4B 3AE3B 4NAWA 3A9JA 3QCAA 3HUIA 5L83A 2KKCA 2EMSA 2A5UA 2LUMA 1VRAB 2J0KA 1WXAA 2PE6B 4GGQA 4N6EB 2WX0A 1V8CA 3AEEB 1F2RC 1WMHA 2KJRA 1EUVB 2GRIA 2BS2B 1QOAA 3AU4A 1FCLA 2KTFA 1SGHA 2RDHA 2BGFA 1H8CA 4W9DA 4GSWA 2PPHA 2WP9B 1FXTB 4HPLB 2DHZA 3A9KA 2OOBB 1DGJA 1MI0A 2MQJA 5TSSA 5LLIA 1I42A 1N62A 2N9LA 4P1BC 3A4SC 2KLGA 1FMAD 2YEPB 1RM6C 1WIAA 1QQRA 2KDBA 4FLHA 1I7HA 3EUB2 2JYEA 3FC4A 3I5JC 4OVVA 2BWFA 2C7NB 1VLBA 2WXHA 4G0NB 3ZNHB 3QC8B 2N7DA 3BK2A 1J7BA 4G50A 5E6JA 4OZCA 4E3CA 2WXJA 1R4NI 5D7GA 1RRBA 3H8HA 1QOGA 3VQIA 4CO7A 4JL9A 1OFFA 3LB8C 4W9GA 3ETRA 2JZPA 2JF5A 1LQBA 2MHJA 4MGZE 5D2MB 2AL6A 3PRMB 2ZCCA 1E7PB 1UGJA 1ZGUB 1WX9A 2J53A 2CHWA 2MJEA 3N30A 4GDKB 1ZE3D 5FR6A 1YX6B 2O6VD 4M00A 3KWVA 1MHXA 1OQYA 5T8IA 1FPYA 5E6NA 2D3AA 4WIPA 3RNGC 3ZKJC 2D10A 2KDEB 3CSTA 4F7ZA 3T3NA 4MGYE 3UIOB 2DYMA 1GOZA 5HI1A 2MRPA 1XD3B 4RMAA 3ZTCA 4C7YA 1FFVA 4US8A 3DHHC 1ZOYB 1S3SG 4YTNB 2PTLA 4DDID 1CQVA 1SE3A 1EU4A 2KHWB 2XNAC 5EE9A 1V97A 4GDKA 1I4QA 1YOVB 2IY1B 4DQOC 5HKHA 4L1BA 4ZRQA 4H2AA 2O6VA 3APCA 4AJWA 3RNBC 3WANA 2M4NA 1ZW7A 2B3AA 2HE7A 4GDLB 2GBMA 2KQ4X 2RDGA 2OHFA 5E6PA 1FD6A 1WI0A 4M0WA 3U30A 3ZGZA 2KJHB 1WJNA 2E3TA 3A33B 3MTNB 2JWZA 3NG0A 3Q6BA 2ZW1A 1TT5B 1UBIA 1K50A 2XEWA 4MGIE 1V1PB 3LXFA 3QK0A 3V61A 1H4RA 3ZDTA 1V1OA 1T0QC 3P4RB 1E8YA 4YSXB 4RCOA 2X38A 1I4HA 5JZEB 2IGDA 3ZUNA 1WGYA 2JRIB 5JXVA 4B9KA 2LGYA 1TTNA 4LCDE 1FCCC 4W9IA 5D6JB 1SIJA 4KKJA 2MBQA 1WFYA 1NDDA 4AQ7A 1F2RI 5LXHA 1C1YB 2W82A 4ZYSA 1F0ZA 4LJPB 1LFDA 2L76A 1T0YA 2MCNB 2MBEA 2L0TA 2D3BA 1SE9A 4BBNF 3AE9B 1WE6A 2LGXA 1HZ6A 4NJ6A 3HK0A 2KD0A 5GXGB 1P98A 3PLVA 4KKIA 2C9WB 3NS8A 1VCBA 3N9YC 3PZ7A 2FCNA 2ON8A 2WXFA 3WAOA 2BKFA 4FBJB 2G45B 2NTTA 1Q1OA 2YEPF 1C4CA 3L54A 1LO5D 2RR9A 1VZ7A 3GP7A 2DZJA 3PVLA 1QT9A 2D3CA 4K3CA 1WGRA 4JIOU 3V3XA 3TL5A 2NPTA 3C19A 4HWIB 2OEDA 2D11A 4KGSA 3LJ3A 1SB3C 4KGRA 4ICUA 3IAM1 4LK0M 3H7PA 4ITKA 3JYUA 2H89B 3W1SC 3WALA 2KC2A 3OAWA 2QC8A 2XBBC 4KDIC 4K7SA 1PGXA 4NQLB 2KDMA 2CU3A 1E8XA 2KAJA 2M19A 3T8MA 3KUZA 1STEA 4HKZE 4L23A 2LUEA 2Y3AA 4MT5A 1VD2A 4ZHPA 2QCZA 2KTRA 3IG3A 3Q8CA 1VJKA 4C7ZA 2N4FA 1XLQA 2FUHB 3AE4B 4B0MA 3QJZA 4BKSD 1I4XA 4IUMB 4NJ7A 2K5PA 2N1VA 1N5XA 1TKGA 4KV2A 3ZRFA 4RF1A 5CTRC 4FJZA 4MGKE 3AEBB 2DX5B 1SEBD 5EE0A 3AE7B 2KJ6A 1NVID 4W9JA 1C4PA 1WGGA 1AYFA 3ZRCA 4L2YA 3HM6X 2QILA 1RYJA 1C78A 2ZEQA 1WF9A 1YN4A 3OLMD 2LFIA 4A3PA 4YL8A 2RSUA 3AE1B 2IGHA 4US9A 3SR6A 3GE8C 4I6NB 2MBHA 5H8YE 1GAQB 4A20A 2X8XX 5HHDG 4BKSA 2ZVNA 3ML8A 4MELA 4HROA 5BYRA 1R4MI 3RFZB 2DZMA 2GI9A 4W9CA 2NMQA 2HTHA 2WXRA 1JALA 3L10B 3KUCB 2G4DB 3SU8X 2VH1A 3M3JA 1Q10A 1ZDVA 1JQ4A 4GN1A 3WCQA 2KNBA 4B0EA 2BBCA 3AI5A 3I57A 5IA7A 4ZYNA 4A9AA 2LEKA 2QJLA 2PVGC 1E0ZA 4YWGG 4DK5A 4PYUA 4ANWA 3KWLA 1EO6A 4MEMA 1FIQA 1N6ZA 1WJUA 1TJEA 2K25A 3PREA 1C3TA 2Y5CA 3NHEB 3Q69A 4LDTB 4USAA 2KMCA 1C4AA 4ZRIA 4JQWC 4NAMA 3QARA 2C60A 1FRDA 5BMGA 1OQRA 4BZAA 4JGHB 2LHDA 2N9XA 2WHIA 2KWUB 4IM2A 4LJOB 1XO3A 3ZDMC 2V4LA 2BYFA 3Q3OC 3BZDB 4A55A 2IYDB 2K0PA 4GU2A 2MP2B 4XWTA 4HPMB 1HTOA 3Q14C 1TIFA 3DVNV 3JSVB 1XXGA 1YJ1A 2DZIA 4RM9A 2AQ3B 3JVZX 3PO0A 3GZNI 3ZW3A 2LHEA 2WXLA 1ACCA 3PPAA 4IDIA 2Y5PA 4GOCA 3WIMA 2M17A 4IW0A 3DBRI 3TCAA 2KN4A 1TS2A 2B76B 1B1ZA 1SJHD 2INCC 2LASA 1WXMA 4DXAB 2V3NA 2AQ1B 2CJOA 2NVUI 1OEYJ 1HQRD 4HEA1 3M62B 1JRPA 1ZXHA 4JPSA 5AEKB 3P4SB 4S0RA 1E7VA 1YJIA 3URYA 2IO2B 2KWCA 1D5MC 2QIEB 2LD9A 4JE3B 4F8CB 4FJVB 1JWSD 2KWDA 3PHXB 4IWPA 3RI7C 1R7SA 2KWVB 1WY8A 1WSPA 3E9SA 3EFCA 1I4RA 3KYDD 1UBQA 1PGBA 2KO3A 2N0SB 1R4NB 4XE0A 4DDGD 2BWES 2V1YA 4MDKE 3L16A 1F52A 1HEZE 4I6PA 1IBXB 1PDXA 1CMXB 3RT3B 4GIVA 4LNIA 1Y8RC 1PFDA 5G5HA 2DNFA 2GMIC 3C8YA 3VRAB 3SHQA 2EMTA 2KVZA 2SEBD 4C56C 4G11A 3QWZB 2MBBB 5IN7A 1IP9A 3SEBA 3S2AA 4NQKE 4WAFA 2GBNA 2UWQA 4KIKA 3AV8A 4MJSB 1K8RB 1NBFC 3DBSA 3MJ5A 4PS3A 2LXAA 2ZPNA 4AOFA 4RFBA 4S17A 2EKIA 5FR3A 1JWMD 3GOEA 4OW0A 3WAPA 2KN5A 3VUWA 2O2VB 3HVZA 3R66C 3V60A 4M02A 3R2TA 2AWTA 1UNSA 4P7IA 5BMHA 5KHOA 2IPKD 4P1CC 1YQ4B 3OWEB 1KLUD 3Q8AA 4GLSC 1IYFA 2MJDA 3V6CB 2WXQA 3RPFC 3AM9A 2LRUA 4TSSA 1WX7A 2PJHA 3TSSA 1QILA 1JWAD 3BVZA 4ANUA 4RGOS 1RLFA 3U8ZA 4ZHOA 1HXYD 3ZNGC 2RGFA 4E71A 3AE2B 1WZ3A 3X23A 1ZP0B 5FK9C 2D3GA 3AU5A 4PS8A 4YT0B 4WURA 1AW7A 1E6EB 4HVBA 3RMKC 3DOWA 3DBLI 2G1EA 5C23A 3RNEC 2VZKB 2HTME 3P42A 5IAAC 2KT7A 2W3RA 4TQ0A 1L5PA 1C79A 4MSQB 2WDQB 4NJCA 3NZ3A 2WS3B 5BMIA 3ENEA 1JW9D 3IHPC 1IGCA 1TKYA 4UDUC 1WRDB 1MJDA 2R61A 2OJWA 3AE8B 5LNK1 1FRRA 2DWQA 3BIID 1A70A 2FCQA 1FXIA 3EGRA 3PHWB 2BW2A 4ICVA 4IM3A 3VUXA 4FA6A 2LRWA 3B2FA 3UI3A 2K1FA 3GE3C 1ROEA 2Q5WD 2KOXA 4W9KA 5CHFA 3ZJUA 2KANA 2A4ZA 3MHSD 5AZHA 2KX3A 2N7JA 2ZJDA 4IG7B 4HDOA 3HHMA 1XT9B 4RGTA 3UQAA 1V5OA 2TSSA 3ABVB 4MM3B 2MJ3A 1FFUA 5DCNA 3V62A 3P63A 4EZKA 4IM0A 1NI2A 5C2TB 2W3SA 2LVOA 1SBBB 2K8BA 3HIZA 4URKA 2BS4B 1OGWA 2QDFA 4WWPA 1GB4A 3U4EG 4GDLA 2C5LC 3ZXRA 4BAXA 2HD5B 3FILB 3TUOA 1FO4A 1K53A 2N1WA 3R7QA 3TJPA 3O65B 4LNNA 2BQQA 4EZJA 3BY4B 1WXSA 2NCNA 4RGNA 1N60A 2V4IB 4ZRPA 5IKCM 1YIWA 2K22A 3DCGA 1V1PA 4PT5A 1KRHA 3MC9A 1GNUA 2BVCA 4AWJA 3KW5B 3H6NA 4B6WA 1HE8A 1YN3A 2XK5B 3U7DA 2JY6A 2CKHB 2KFKB 5CHVC 4HLEA 2WXIA 4ACFA 3A1QB 1D6EC 1L6VA 2JSVX 4A6QA 2NBUA 2W54A 2MH7A 4A3OA 3ZYYX 3Q3JA 3P4PB 4K3BA 4HJKA 2AQ2B 2H88B 1N61A 4XDCA 3UINB 2PMVA 3C0RB 2K3UA 3X0WA 1KLVA 4ASWC 2G3QB 2JXTA 3ZXVA 4DHJB 2KFJA 1TS5A 1JWUD 3AH7A 2PEAA 4DBGA 4TUUA 2AYOB 1P1AA 2FIDA 3Q3MC 1AN8A 3W5UB 1OTRB 4A8XC 2VRRB 5MPOA 4B95A 3KYCD 2J0MA 1UUPA 4RM8A 2XK5A 1TBEA 1I35A 2DAFA 2G9HD 1V6EA 4LNKA 1J0GA 3VVWB 1MVKA 2DYOA 3AEFB 3A4RA 1BXTA 1SJED 4AP4C 1YQBA 1IGDA 3NUHB 2CU1A 2LWPA 2FE8A 1PQSA 3VR8B 1L7YA 3J9CA 4FULA 1IPGA 1EWCA 5J17A 2DBYA 2CHXA 2QEJC 1R4MB 4HKQA 3PLUA 2PKOA 1D3ZA 4DHZB 5KHQA 4K81A 4W9EA 4J3OD 3H1UA 3L0WB 2L0FA 5JHBA 1EF5A 2GLSA 3RD2A 3RUIB 4ANVA 3VR9B 4RGMA 3BYTB 1A5RA 1HZ5A 1QOFA 5AUIA 3RCZA 4OHJA 3W2DA 1PGAA 3ECIA 1I4GA 1TZOA 1V81A 3PT2B 2PVOD 3AULA 4LNFA 1P9DU 2GB1A 3RN9C 1WYWB 2IGGA 2JXXA 3W5VB 2ZNVC 2WXGA 4WWOA 1SIFA 3VRBB 3D32A 5CHWA 2ZVOA 4II3B 1V49A 2D07B 1L2NA 2L8JA 1E90A 2FIFA 2BYEA 1V2YA 2NR2A 3Q8EA 2I38A 5CX3A 2ZCBA 3CWIA 4YTPB 1ZDXA 2WWZA 4C00A 4JWUC 2GBKA 1P7FA 3DBRB 4YSYB 4WWMA 2XN9C 2FCSA 2LI5A 4WJPA 3H7SA 3ZVVA 1WM3A 1GUAB 2LGDA 5TR5A 3JW0X 5J2RA 2WXMA 1UWMA 2RMMA 4M8NA 3RULA 4JWSC 2K8CA 3TIXA 1T3QA 2WX1A 2CR5A 4HCNB 4WJOA 4CQNA 1NI3A 4Q2JA 5C3JB 4P16A 1V9JA 4BKGA 2L3ZA 2J42A 3R7RA 4LDTD 2LJIA 3TBLD 3DWGC 1L0XB 2IBIB 5D3DA 1RFKA 2VH2A 3B1LX 5G55A 2KX0A 2FBWB 5LXIB 1L0VB 1G6JA 1DOYA 3N3KB 4IKGA 3BYYB 3OJ4B 3N1XC 3QX1A 4LTUA 1U4AA 3K9OB 1HA5A 4EZLA 3DVGY 2IO1B 2L05A 4W9FA 3VTVA 1YD8U 4K7WA 4C4VB 3DQVA 1MPEA 2WXPA 2MW5A 1KH0A 3R3MA 3BINA 2HJ1A 5IO9A 1V5TA 3ALBA 5BYQA 2AX5A 3EECA 2JU6X 2LJ5A 4FADA 2GBJA 1EM7A 2KVRA 3NY5A 4BBNC 1D5XC 4K7UA 1SF0A 2REXA 4DWFA 3DVNU 1XCTL 4GB9A 3I9V1 2BKRB 4TQ1A 3TEYA 1YMHE 2BS3B 2WU2B 2I1JA 4E74A 4W9HA 3Q3NC 2SAKA 2MP2A 4ZRKA 4GMVA 1FNUA 2KACA 4WJNA 1WGHA 3JSVA 3N1YC 1L0YB 2OJRA 4IC7B 2PE9A 3PZ8A 4NAWB 1DYQA 2LVQA 3A9JB 1WWTA 2MA9B 3ZJVA 3KQ4A 3QHTA 2IO0B 3DDCB 3VH3B 1GB1A 2LZ6A 2DYBA 3I63C 2MWSB 2WDTB 4KDLB 3SFDB 4N59A 1E5WA 3M95A 4FHKA 1Q5WB 3L17A 3DBHI 1S1QB 1QOBA 1TY2A 4A90A 2FCMA 1DOIA 1QZEA 1WZ0A 1KLGD 2JYTA 1ET6A 1MG4A 3Q8FA 3NZSA 1WM2A 1ENFA 3KH0A 2G4SA 3A9KB 5G5GA 1KF6B 2BF8B 4AJYB 5FKAC 2NBWB 3SDLC 2BT6A 5BYSA 2JRHA 1WE7A 3R8BA 3APFA 3P4QB 2L1AA 2R2OA 3AE5B 3PTFC 2CHZA 3NVZA 1LGRA 3RZWC 2AEHA 1ISNA 2KC1A 1K52A 2KMMA 3VUYA 1RAXA 2MSED 3NZUA 2WNMA 1IBXA 3HRDD 4XZ4A 1MG8A 4OZAA 3FKYA 2J4XA 2KLCA 1EF1A 1SXTA 2PIAA 1WR6E 3IT4B 1LXDA 1PYWD 1UH6A 1WJ6A 2WXKA 3HVDA 3R2IA 3UQBA 3AE6B 2WXNA 3ZIMA 3QAQA 2WXOA 3IXSA 2IY0B 1UZXB 3T9LA 3QIJA 4ZRJA 1ET9A 4MJSA 5IP4D 1FXAA 4WQOB 1GG3A 2IO3B 2DLBA 1J19A 1WRIA 2YVCA 1UELA 1YNTE 3NOBA 4G3XB 1T0RC 3IFWB 3MHZA 4F1SA 3PSEB 2O2VA 4ARCA 1JRUA 4WH4A 4N58A 1WX8A 5HG2A 1C77A 2Z0EB 3AN1A 1UWXA 2YLMA 2HJ8A 3IT6B 3K9PB 4FN2A 2ASQA 3BVGA 2BB6A 1VDVA 2WDRB 2VZKD 4AUQC 2NBVB 4JX1C 1QF6A 1NYRA 3WA0A 2L83A 1KFYB 4ARIA 4C80A 1WXVA 3QQ8B 4DXFA 1TS3A 3B2GA 1EWYC 3AECB 3LDZE 4HK2A 2JT4B 1XLOA 5DPWA 2PW9A 3NVYA 3U7ZA 4KX6B 1NEKB 1XQQA 2M8SA 2DAJA 4OVUA 1E10A 2JPHA 3OJ3A 2K6QA 3BVMA 2O6VB 3VDZA 1OEYA 2WLBA 3NVWA 4N9F4 2V9HA 4BOZB 4J6IA 5EE1A 2KMAA 2Z8LA 1MFWA 4AS1A 1P0RA 3UIPB 1XLPA 4MH8A 5IOIA 4M0WB 3VTUA 2N9KA 4X57B 3I3TB 2I1KA 1AARA 3B9JA 2KYWA 1SE2A 2RDBC 1C76A 2E6XA 2D5GA 2V3PA 3O13A 4JLCA 1WYGA 3ZNZB 5L95C 1GPXA 2J0JA 1ESFA 3WAMA 3RNFC 3PS6A 1XCQL 3ZNID 4KSLC 1YJJA 4CYEA 2KQSA 3L4PA 2BB5A 4EFOA 4TMAB 4NPNA 3E56A 5HFYA 3PV1A 1WGKA 2Z0DB 3MJWA 4XGAB 4ZOHC 3ONSA 4HJGE 4MSMB 2GOWA 2LXCA 2BYTA 1GC6A 3EC8A 4FHJA 4WAAA 1M4VA 2K9XA 4TKNA 1SSNA 1T6BX 1NENB 1UGMA 2BTEA 4WWNA 1FM0D 3RNCC 1L4ZB 3DVGX 3CIRB 4D2KA 1F1HA 2WQYB 3U52E 1F9JA 2KZRA 2RD0A 1Z2MA 1D4BA 3VXWA 3DHIC 5G2NA 4EUTA 1DOXA 4IOIE 4MM3A 2FUG1 4RNAA 1OQQA 2J52A 1UD7A 5DPSA 2LVPA 2JUOA 1T0SC 1CJEA 3IAS1 3AXCA 3HM3A 3IVFA 1CZPA 1SE4A 2L00B 2V3SA 2WDVB 4KVGB 4IWOA 1YN5A 2K39A 3FILA 4DHJD 4M01A 2GBRA 4IWQA 4XDDA 2NS5A 3AMZA 3N20C 3ZQ4A 2KK8A 2NPTB 1P3QU 4LNOA 4KZCA 3KLSX 4WJQA 2UYZB 2IDYA 2N9PC 3L08A 1VR9A 1Y56A 1IUEA 2KQ7A 3H7PB 1L6UA 4MACA 3UGBB 2FNJB 2JZ3B 3OG5A 2QMTA 3GB1A 1FEHA 2DENB 1JWBD 2LMCA 1P7EA 2RPVA 2KFKA 2QHOA 3SFEB 4QAYA 3DWMA 3A1QA 1D5ZC 2LGIA 3ZO5B 2ZZPB 2I2YA 2N9EB 3TEZA 2INDC 1ZXIA 3RZFA 1TS4A 4ANXA 3W1YA 2INNE 2ACZB 4KSKC 1JCKB 4RF0A 2PLPA 1E9MA 1WH3A 1KJTA 2KTRB 1JROA 1HTQA 1YX5B 1Q0WB 3SD5A 1MHHE 4XYCA 5J18A 1FNWA 1BUIC 1ZPSA 4EOYA 3ZJTA 3CMMB 2CJNA 2WGSA 1TGZB 2J7QB 2Z59B 3L13A 5DPTA 3NVVA 1E7UA 2AL3A 1TKEA 2K6DB 3EFUA 4K1RB 2V0GA 3VTWA 3RNAC 4W9LA 3MFGA 1KOTA 4P6VF 2JQRB 2D2QA 2EKEC 1GC7A 1Z5SB 1T5XD 2N7EA 2JX5A 1KTKA 1TYGB 2ONQA 4BOSC 1ZKHA 1KM7A 3NRZA 1YQ3B 4HDQA 4LLGM 1PUTA 5H92C 3AEDB 1RWSA 2FAZA 1QLBB 4WQMA 3PRZA 1V80A 2ZPYA 3AB5A 2ICIA 3TEWA 4YSZB 4HXDA 5BO4B 1TZ1A 3VFKA 3P1MA 3V6EB 1L4DB 4M8MA 1TY0A 1C9FA 1M94A 3MC8A 2M0XA 1J7AA 5I4DA 3BWUD 4EE2A 1VZ6A 3NS1A 5GMVA 2IJ0A 2MBOA 5JH5C 3PZDA 2MLBA 3EA6A 1EU3A 2M56B 3GZNB
chains in the Genus database with same CATH topology
1MJDA 5IN7A 2BQQA 5IP4D 1UF0A 5IOIA 1MFWA 5IO9A 1MG4A 2DNFA 5IKCM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJD A;  5IN7 A;  2BQQ A;  5IP4 D;  1UF0 A;  5IOI A;  1MFW A;  5IO9 A;  1MG4 A;  2DNF A;  5IKC M; 
#chains in the Genus database with same CATH topology
 1ZUD 2;  5AZG A;  3EHV A;  2W9N A;  1B9R A;  2BPS A;  4BVU C;  3Q8B A;  2C7H A;  1BT0 A;  2K8H A;  4TV3 A;  4I6L B;  2M0A A;  1E8W A;  4YTM B;  4EKU A;  2JWU A;  4NY0 A;  4R3D A;  5D94 A;  2BYV E;  3N1Z C;  2ZW0 A;  4OZB A;  1AWD A;  3RYT A;  4NZL B;  1E8Z A;  2QSD A;  5DPR A;  1BML C;  3N32 A;  4FXC A;  2W55 A;  4MH0 E;  3TEX A;  3B08 A;  3CSF A;  3V05 A;  4PK1 A;  4BKT A;  2MEK A;  4HCP B;  4BFR A;  1V86 A;  1XF5 L;  4PYZ A;  3TMP B;  3AEA B;  5EE3 A;  3APD A;  2MX2 A;  4XX5 A;  4KGT A;  2DZK A;  4REZ A;  3ZTD A;  3Q2A C;  1N5W A;  1XLN A;  2R2Q A;  1FNV A;  2INP E;  3H9D A;  2EEL A;  1J7C A;  3GS2 A;  5C1Z A;  2WYQ A;  1WJ4 A;  2C7M B;  3W1S A;  1VZ8 A;  4DHZ E;  3DBH B;  3LYY A;  3MP9 A;  3MC0 B;  2L32 A;  3ZLZ A;  2KXJ A;  4YXD B;  3VAW A;  2IZV B;  1CK1 A;  1WR1 A;  1XEE A;  3KUD B;  2ZNV B;  3NJT A;  2KDF B;  4PS7 A;  2M1M A;  3U2S C;  2Y5B B;  4CHK A;  5EDS A;  4OVZ A;  4HPP A;  4NNJ B;  4XC2 A;  2LGS A;  3M63 B;  3CF6 E;  1WGD A;  5AUK A;  4HRS A;  3KVF B;  3BK1 A;  3QA8 A;  5JHA A;  1K51 A;  3PRP B;  2KDI A;  3W9C B;  1N63 A;  1RFA A;  4O1N A;  3B0A A;  5D3I B;  1LM8 B;  3DPD A;  1UF0 A;  3VHT C;  4C4V A;  4II2 B;  1QKZ A;  1WXQ A;  5AZF A;  2NTS A;  4RH6 A;  3ML9 A;  2CS4 A;  1X1M A;  3DHG C;  4ZDV A;  3UF8 A;  2JZZ A;  3AEG B;  3PGE A;  4GXB A;  2HDE A;  5E6O A;  1J8C A;  4XWW A;  2L52 A;  1WMH B;  3P2B A;  4EEW A;  1F77 A;  1GJZ A;  3IBE A;  1I4P A;  2JVC A;  2L7R A;  2RPQ A;  2WU5 B;  4KIK B;  4KZ0 A;  3T3O A;  4DXG A;  1NYQ A;  3Q3F A;  3FAH A;  4FJY A;  2UU7 A;  1JML A;  3DBL B;  3VH4 B;  3AE3 B;  4NAW A;  3A9J A;  3QCA A;  3HUI A;  5L83 A;  2KKC A;  2EMS A;  2A5U A;  2LUM A;  1VRA B;  2J0K A;  1WXA A;  2PE6 B;  4GGQ A;  4N6E B;  2WX0 A;  1V8C A;  3AEE B;  1F2R C;  1WMH A;  2KJR A;  1EUV B;  2GRI A;  2BS2 B;  1QOA A;  3AU4 A;  1FCL A;  2KTF A;  1SGH A;  2RDH A;  2BGF A;  1H8C A;  4W9D A;  4GSW A;  2PPH A;  2WP9 B;  1FXT B;  4HPL B;  2DHZ A;  3A9K A;  2OOB B;  1DGJ A;  1MI0 A;  2MQJ A;  5TSS A;  5LLI A;  1I42 A;  1N62 A;  2N9L A;  4P1B C;  3A4S C;  2KLG A;  1FMA D;  2YEP B;  1RM6 C;  1WIA A;  1QQR A;  2KDB A;  4FLH A;  1I7H A;  3EUB 2;  2JYE A;  3FC4 A;  3I5J C;  4OVV A;  2BWF A;  2C7N B;  1VLB A;  2WXH A;  4G0N B;  3ZNH B;  3QC8 B;  2N7D A;  3BK2 A;  1J7B A;  4G50 A;  5E6J A;  4OZC A;  4E3C A;  2WXJ A;  1R4N I;  5D7G A;  1RRB A;  3H8H A;  1QOG A;  3VQI A;  4CO7 A;  4JL9 A;  1OFF A;  3LB8 C;  4W9G A;  3ETR A;  2JZP A;  2JF5 A;  1LQB A;  2MHJ A;  4MGZ E;  5D2M B;  2AL6 A;  3PRM B;  2ZCC A;  1E7P B;  1UGJ A;  1ZGU B;  1WX9 A;  2J53 A;  2CHW A;  2MJE A;  3N30 A;  4GDK B;  1ZE3 D;  5FR6 A;  1YX6 B;  2O6V D;  4M00 A;  3KWV A;  1MHX A;  1OQY A;  5T8I A;  1FPY A;  5E6N A;  2D3A A;  4WIP A;  3RNG C;  3ZKJ C;  2D10 A;  2KDE B;  3CST A;  4F7Z A;  3T3N A;  4MGY E;  3UIO B;  2DYM A;  1GOZ A;  5HI1 A;  2MRP A;  1XD3 B;  4RMA A;  3ZTC A;  4C7Y A;  1FFV A;  4US8 A;  3DHH C;  1ZOY B;  1S3S G;  4YTN B;  2PTL A;  4DDI D;  1CQV A;  1SE3 A;  1EU4 A;  2KHW B;  2XNA C;  5EE9 A;  1V97 A;  4GDK A;  1I4Q A;  1YOV B;  2IY1 B;  4DQO C;  5HKH A;  4L1B A;  4ZRQ A;  4H2A A;  2O6V A;  3APC A;  4AJW A;  3RNB C;  3WAN A;  2M4N A;  1ZW7 A;  2B3A A;  2HE7 A;  4GDL B;  2GBM A;  2KQ4 X;  2RDG A;  2OHF A;  5E6P A;  1FD6 A;  1WI0 A;  4M0W A;  3U30 A;  3ZGZ A;  2KJH B;  1WJN A;  2E3T A;  3A33 B;  3MTN B;  2JWZ A;  3NG0 A;  3Q6B A;  2ZW1 A;  1TT5 B;  1UBI A;  1K50 A;  2XEW A;  4MGI E;  1V1P B;  3LXF A;  3QK0 A;  3V61 A;  1H4R A;  3ZDT A;  1V1O A;  1T0Q C;  3P4R B;  1E8Y A;  4YSX B;  4RCO A;  2X38 A;  1I4H A;  5JZE B;  2IGD A;  3ZUN A;  1WGY A;  2JRI B;  5JXV A;  4B9K A;  2LGY A;  1TTN A;  4LCD E;  1FCC C;  4W9I A;  5D6J B;  1SIJ A;  4KKJ A;  2MBQ A;  1WFY A;  1NDD A;  4AQ7 A;  1F2R I;  5LXH A;  1C1Y B;  2W82 A;  4ZYS A;  1F0Z A;  4LJP B;  1LFD A;  2L76 A;  1T0Y A;  2MCN B;  2MBE A;  2L0T A;  2D3B A;  1SE9 A;  4BBN F;  3AE9 B;  1WE6 A;  2LGX A;  1HZ6 A;  4NJ6 A;  3HK0 A;  2KD0 A;  5GXG B;  1P98 A;  3PLV A;  4KKI A;  2C9W B;  3NS8 A;  1VCB A;  3N9Y C;  3PZ7 A;  2FCN A;  2ON8 A;  2WXF A;  3WAO A;  2BKF A;  4FBJ B;  2G45 B;  2NTT A;  1Q1O A;  2YEP F;  1C4C A;  3L54 A;  1LO5 D;  2RR9 A;  1VZ7 A;  3GP7 A;  2DZJ A;  3PVL A;  1QT9 A;  2D3C A;  4K3C A;  1WGR A;  4JIO U;  3V3X A;  3TL5 A;  2NPT A;  3C19 A;  4HWI B;  2OED A;  2D11 A;  4KGS A;  3LJ3 A;  1SB3 C;  4KGR A;  4ICU A;  3IAM 1;  4LK0 M;  3H7P A;  4ITK A;  3JYU A;  2H89 B;  3W1S C;  3WAL A;  2KC2 A;  3OAW A;  2QC8 A;  2XBB C;  4KDI C;  4K7S A;  1PGX A;  4NQL B;  2KDM A;  2CU3 A;  1E8X A;  2KAJ A;  2M19 A;  3T8M A;  3KUZ A;  1STE A;  4HKZ E;  4L23 A;  2LUE A;  2Y3A A;  4MT5 A;  1VD2 A;  4ZHP A;  2QCZ A;  2KTR A;  3IG3 A;  3Q8C A;  1VJK A;  4C7Z A;  2N4F A;  1XLQ A;  2FUH B;  3AE4 B;  4B0M A;  3QJZ A;  4BKS D;  1I4X A;  4IUM B;  4NJ7 A;  2K5P A;  2N1V A;  1N5X A;  1TKG A;  4KV2 A;  3ZRF A;  4RF1 A;  5CTR C;  4FJZ A;  4MGK E;  3AEB B;  2DX5 B;  1SEB D;  5EE0 A;  3AE7 B;  2KJ6 A;  1NVI D;  4W9J A;  1C4P A;  1WGG A;  1AYF A;  3ZRC A;  4L2Y A;  3HM6 X;  2QIL A;  1RYJ A;  1C78 A;  2ZEQ A;  1WF9 A;  1YN4 A;  3OLM D;  2LFI A;  4A3P A;  4YL8 A;  2RSU A;  3AE1 B;  2IGH A;  4US9 A;  3SR6 A;  3GE8 C;  4I6N B;  2MBH A;  5H8Y E;  1GAQ B;  4A20 A;  2X8X X;  5HHD G;  4BKS A;  2ZVN A;  3ML8 A;  4MEL A;  4HRO A;  5BYR A;  1R4M I;  3RFZ B;  2DZM A;  2GI9 A;  4W9C A;  2NMQ A;  2HTH A;  2WXR A;  1JAL A;  3L10 B;  3KUC B;  2G4D B;  3SU8 X;  2VH1 A;  3M3J A;  1Q10 A;  1ZDV A;  1JQ4 A;  4GN1 A;  3WCQ A;  2KNB A;  4B0E A;  2BBC A;  3AI5 A;  3I57 A;  5IA7 A;  4ZYN A;  4A9A A;  2LEK A;  2QJL A;  2PVG C;  1E0Z A;  4YWG G;  4DK5 A;  4PYU A;  4ANW A;  3KWL A;  1EO6 A;  4MEM A;  1FIQ A;  1N6Z A;  1WJU A;  1TJE A;  2K25 A;  3PRE A;  1C3T A;  2Y5C A;  3NHE B;  3Q69 A;  4LDT B;  4USA A;  2KMC A;  1C4A A;  4ZRI A;  4JQW C;  4NAM A;  3QAR A;  2C60 A;  1FRD A;  5BMG A;  1OQR A;  4BZA A;  4JGH B;  2LHD A;  2N9X A;  2WHI A;  2KWU B;  4IM2 A;  4LJO B;  1XO3 A;  3ZDM C;  2V4L A;  2BYF A;  3Q3O C;  3BZD B;  4A55 A;  2IYD B;  2K0P A;  4GU2 A;  2MP2 B;  4XWT A;  4HPM B;  1HTO A;  3Q14 C;  1TIF A;  3DVN V;  3JSV B;  1XXG A;  1YJ1 A;  2DZI A;  4RM9 A;  2AQ3 B;  3JVZ X;  3PO0 A;  3GZN I;  3ZW3 A;  2LHE A;  2WXL A;  1ACC A;  3PPA A;  4IDI A;  2Y5P A;  4GOC A;  3WIM A;  2M17 A;  4IW0 A;  3DBR I;  3TCA A;  2KN4 A;  1TS2 A;  2B76 B;  1B1Z A;  1SJH D;  2INC C;  2LAS A;  1WXM A;  4DXA B;  2V3N A;  2AQ1 B;  2CJO A;  2NVU I;  1OEY J;  1HQR D;  4HEA 1;  3M62 B;  1JRP A;  1ZXH A;  4JPS A;  5AEK B;  3P4S B;  4S0R A;  1E7V A;  1YJI A;  3URY A;  2IO2 B;  2KWC A;  1D5M C;  2QIE B;  2LD9 A;  4JE3 B;  4F8C B;  4FJV B;  1JWS D;  2KWD A;  3PHX B;  4IWP A;  3RI7 C;  1R7S A;  2KWV B;  1WY8 A;  1WSP A;  3E9S A;  3EFC A;  1I4R A;  3KYD D;  1UBQ A;  1PGB A;  2KO3 A;  2N0S B;  1R4N B;  4XE0 A;  4DDG D;  2BWE S;  2V1Y A;  4MDK E;  3L16 A;  1F52 A;  1HEZ E;  4I6P A;  1IBX B;  1PDX A;  1CMX B;  3RT3 B;  4GIV A;  4LNI A;  1Y8R C;  1PFD A;  5G5H A;  2DNF A;  2GMI C;  3C8Y A;  3VRA B;  3SHQ A;  2EMT A;  2KVZ A;  2SEB D;  4C56 C;  4G11 A;  3QWZ B;  2MBB B;  5IN7 A;  1IP9 A;  3SEB A;  3S2A A;  4NQK E;  4WAF A;  2GBN A;  2UWQ A;  4KIK A;  3AV8 A;  4MJS B;  1K8R B;  1NBF C;  3DBS A;  3MJ5 A;  4PS3 A;  2LXA A;  2ZPN A;  4AOF A;  4RFB A;  4S17 A;  2EKI A;  5FR3 A;  1JWM D;  3GOE A;  4OW0 A;  3WAP A;  2KN5 A;  3VUW A;  2O2V B;  3HVZ A;  3R66 C;  3V60 A;  4M02 A;  3R2T A;  2AWT A;  1UNS A;  4P7I A;  5BMH A;  5KHO A;  2IPK D;  4P1C C;  1YQ4 B;  3OWE B;  1KLU D;  3Q8A A;  4GLS C;  1IYF A;  2MJD A;  3V6C B;  2WXQ A;  3RPF C;  3AM9 A;  2LRU A;  4TSS A;  1WX7 A;  2PJH A;  3TSS A;  1QIL A;  1JWA D;  3BVZ A;  4ANU A;  4RGO S;  1RLF A;  3U8Z A;  4ZHO A;  1HXY D;  3ZNG C;  2RGF A;  4E71 A;  3AE2 B;  1WZ3 A;  3X23 A;  1ZP0 B;  5FK9 C;  2D3G A;  3AU5 A;  4PS8 A;  4YT0 B;  4WUR A;  1AW7 A;  1E6E B;  4HVB A;  3RMK C;  3DOW A;  3DBL I;  2G1E A;  5C23 A;  3RNE C;  2VZK B;  2HTM E;  3P42 A;  5IAA C;  2KT7 A;  2W3R A;  4TQ0 A;  1L5P A;  1C79 A;  4MSQ B;  2WDQ B;  4NJC A;  3NZ3 A;  2WS3 B;  5BMI A;  3ENE A;  1JW9 D;  3IHP C;  1IGC A;  1TKY A;  4UDU C;  1WRD B;  1MJD A;  2R61 A;  2OJW A;  3AE8 B;  5LNK 1;  1FRR A;  2DWQ A;  3BII D;  1A70 A;  2FCQ A;  1FXI A;  3EGR A;  3PHW B;  2BW2 A;  4ICV A;  4IM3 A;  3VUX A;  4FA6 A;  2LRW A;  3B2F A;  3UI3 A;  2K1F A;  3GE3 C;  1ROE A;  2Q5W D;  2KOX A;  4W9K A;  5CHF A;  3ZJU A;  2KAN A;  2A4Z A;  3MHS D;  5AZH A;  2KX3 A;  2N7J A;  2ZJD A;  4IG7 B;  4HDO A;  3HHM A;  1XT9 B;  4RGT A;  3UQA A;  1V5O A;  2TSS A;  3ABV B;  4MM3 B;  2MJ3 A;  1FFU A;  5DCN A;  3V62 A;  3P63 A;  4EZK A;  4IM0 A;  1NI2 A;  5C2T B;  2W3S A;  2LVO A;  1SBB B;  2K8B A;  3HIZ A;  4URK A;  2BS4 B;  1OGW A;  2QDF A;  4WWP A;  1GB4 A;  3U4E G;  4GDL A;  2C5L C;  3ZXR A;  4BAX A;  2HD5 B;  3FIL B;  3TUO A;  1FO4 A;  1K53 A;  2N1W A;  3R7Q A;  3TJP A;  3O65 B;  4LNN A;  2BQQ A;  4EZJ A;  3BY4 B;  1WXS A;  2NCN A;  4RGN A;  1N60 A;  2V4I B;  4ZRP A;  5IKC M;  1YIW A;  2K22 A;  3DCG A;  1V1P A;  4PT5 A;  1KRH A;  3MC9 A;  1GNU A;  2BVC A;  4AWJ A;  3KW5 B;  3H6N A;  4B6W A;  1HE8 A;  1YN3 A;  2XK5 B;  3U7D A;  2JY6 A;  2CKH B;  2KFK B;  5CHV C;  4HLE A;  2WXI A;  4ACF A;  3A1Q B;  1D6E C;  1L6V A;  2JSV X;  4A6Q A;  2NBU A;  2W54 A;  2MH7 A;  4A3O A;  3ZYY X;  3Q3J A;  3P4P B;  4K3B A;  4HJK A;  2AQ2 B;  2H88 B;  1N61 A;  4XDC A;  3UIN B;  2PMV A;  3C0R B;  2K3U A;  3X0W A;  1KLV A;  4ASW C;  2G3Q B;  2JXT A;  3ZXV A;  4DHJ B;  2KFJ A;  1TS5 A;  1JWU D;  3AH7 A;  2PEA A;  4DBG A;  4TUU A;  2AYO B;  1P1A A;  2FID A;  3Q3M C;  1AN8 A;  3W5U B;  1OTR B;  4A8X C;  2VRR B;  5MPO A;  4B95 A;  3KYC D;  2J0M A;  1UUP A;  4RM8 A;  2XK5 A;  1TBE A;  1I35 A;  2DAF A;  2G9H D;  1V6E A;  4LNK A;  1J0G A;  3VVW B;  1MVK A;  2DYO A;  3AEF B;  3A4R A;  1BXT A;  1SJE D;  4AP4 C;  1YQB A;  1IGD A;  3NUH B;  2CU1 A;  2LWP A;  2FE8 A;  1PQS A;  3VR8 B;  1L7Y A;  3J9C A;  4FUL A;  1IPG A;  1EWC A;  5J17 A;  2DBY A;  2CHX A;  2QEJ C;  1R4M B;  4HKQ A;  3PLU A;  2PKO A;  1D3Z A;  4DHZ B;  5KHQ A;  4K81 A;  4W9E A;  4J3O D;  3H1U A;  3L0W B;  2L0F A;  5JHB A;  1EF5 A;  2GLS A;  3RD2 A;  3RUI B;  4ANV A;  3VR9 B;  4RGM A;  3BYT B;  1A5R A;  1HZ5 A;  1QOF A;  5AUI A;  3RCZ A;  4OHJ A;  3W2D A;  1PGA A;  3ECI A;  1I4G A;  1TZO A;  1V81 A;  3PT2 B;  2PVO D;  3AUL A;  4LNF A;  1P9D U;  2GB1 A;  3RN9 C;  1WYW B;  2IGG A;  2JXX A;  3W5V B;  2ZNV C;  2WXG A;  4WWO A;  1SIF A;  3VRB B;  3D32 A;  5CHW A;  2ZVO A;  4II3 B;  1V49 A;  2D07 B;  1L2N A;  2L8J A;  1E90 A;  2FIF A;  2BYE A;  1V2Y A;  2NR2 A;  3Q8E A;  2I38 A;  5CX3 A;  2ZCB A;  3CWI A;  4YTP B;  1ZDX A;  2WWZ A;  4C00 A;  4JWU C;  2GBK A;  1P7F A;  3DBR B;  4YSY B;  4WWM A;  2XN9 C;  2FCS A;  2LI5 A;  4WJP A;  3H7S A;  3ZVV A;  1WM3 A;  1GUA B;  2LGD A;  5TR5 A;  3JW0 X;  5J2R A;  2WXM A;  1UWM A;  2RMM A;  4M8N A;  3RUL A;  4JWS C;  2K8C A;  3TIX A;  1T3Q A;  2WX1 A;  2CR5 A;  4HCN B;  4WJO A;  4CQN A;  1NI3 A;  4Q2J A;  5C3J B;  4P16 A;  1V9J A;  4BKG A;  2L3Z A;  2J42 A;  3R7R A;  4LDT D;  2LJI A;  3TBL D;  3DWG C;  1L0X B;  2IBI B;  5D3D A;  1RFK A;  2VH2 A;  3B1L X;  5G55 A;  2KX0 A;  2FBW B;  5LXI B;  1L0V B;  1G6J A;  1DOY A;  3N3K B;  4IKG A;  3BYY B;  3OJ4 B;  3N1X C;  3QX1 A;  4LTU A;  1U4A A;  3K9O B;  1HA5 A;  4EZL A;  3DVG Y;  2IO1 B;  2L05 A;  4W9F A;  3VTV A;  1YD8 U;  4K7W A;  4C4V B;  3DQV A;  1MPE A;  2WXP A;  2MW5 A;  1KH0 A;  3R3M A;  3BIN A;  2HJ1 A;  5IO9 A;  1V5T A;  3ALB A;  5BYQ A;  2AX5 A;  3EEC A;  2JU6 X;  2LJ5 A;  4FAD A;  2GBJ A;  1EM7 A;  2KVR A;  3NY5 A;  4BBN C;  1D5X C;  4K7U A;  1SF0 A;  2REX A;  4DWF A;  3DVN U;  1XCT L;  4GB9 A;  3I9V 1;  2BKR B;  4TQ1 A;  3TEY A;  1YMH E;  2BS3 B;  2WU2 B;  2I1J A;  4E74 A;  4W9H A;  3Q3N C;  2SAK A;  2MP2 A;  4ZRK A;  4GMV A;  1FNU A;  2KAC A;  4WJN A;  1WGH A;  3JSV A;  3N1Y C;  1L0Y B;  2OJR A;  4IC7 B;  2PE9 A;  3PZ8 A;  4NAW B;  1DYQ A;  2LVQ A;  3A9J B;  1WWT A;  2MA9 B;  3ZJV A;  3KQ4 A;  3QHT A;  2IO0 B;  3DDC B;  3VH3 B;  1GB1 A;  2LZ6 A;  2DYB A;  3I63 C;  2MWS B;  2WDT B;  4KDL B;  3SFD B;  4N59 A;  1E5W A;  3M95 A;  4FHK A;  1Q5W B;  3L17 A;  3DBH I;  1S1Q B;  1QOB A;  1TY2 A;  4A90 A;  2FCM A;  1DOI A;  1QZE A;  1WZ0 A;  1KLG D;  2JYT A;  1ET6 A;  1MG4 A;  3Q8F A;  3NZS A;  1WM2 A;  1ENF A;  3KH0 A;  2G4S A;  3A9K B;  5G5G A;  1KF6 B;  2BF8 B;  4AJY B;  5FKA C;  2NBW B;  3SDL C;  2BT6 A;  5BYS A;  2JRH A;  1WE7 A;  3R8B A;  3APF A;  3P4Q B;  2L1A A;  2R2O A;  3AE5 B;  3PTF C;  2CHZ A;  3NVZ A;  1LGR A;  3RZW C;  2AEH A;  1ISN A;  2KC1 A;  1K52 A;  2KMM A;  3VUY A;  1RAX A;  2MSE D;  3NZU A;  2WNM A;  1IBX A;  3HRD D;  4XZ4 A;  1MG8 A;  4OZA A;  3FKY A;  2J4X A;  2KLC A;  1EF1 A;  1SXT A;  2PIA A;  1WR6 E;  3IT4 B;  1LXD A;  1PYW D;  1UH6 A;  1WJ6 A;  2WXK A;  3HVD A;  3R2I A;  3UQB A;  3AE6 B;  2WXN A;  3ZIM A;  3QAQ A;  2WXO A;  3IXS A;  2IY0 B;  1UZX B;  3T9L A;  3QIJ A;  4ZRJ A;  1ET9 A;  4MJS A;  5IP4 D;  1FXA A;  4WQO B;  1GG3 A;  2IO3 B;  2DLB A;  1J19 A;  1WRI A;  2YVC A;  1UEL A;  1YNT E;  3NOB A;  4G3X B;  1T0R C;  3IFW B;  3MHZ A;  4F1S A;  3PSE B;  2O2V A;  4ARC A;  1JRU A;  4WH4 A;  4N58 A;  1WX8 A;  5HG2 A;  1C77 A;  2Z0E B;  3AN1 A;  1UWX A;  2YLM A;  2HJ8 A;  3IT6 B;  3K9P B;  4FN2 A;  2ASQ A;  3BVG A;  2BB6 A;  1VDV A;  2WDR B;  2VZK D;  4AUQ C;  2NBV B;  4JX1 C;  1QF6 A;  1NYR A;  3WA0 A;  2L83 A;  1KFY B;  4ARI A;  4C80 A;  1WXV A;  3QQ8 B;  4DXF A;  1TS3 A;  3B2G A;  1EWY C;  3AEC B;  3LDZ E;  4HK2 A;  2JT4 B;  1XLO A;  5DPW A;  2PW9 A;  3NVY A;  3U7Z A;  4KX6 B;  1NEK B;  1XQQ A;  2M8S A;  2DAJ A;  4OVU A;  1E10 A;  2JPH A;  3OJ3 A;  2K6Q A;  3BVM A;  2O6V B;  3VDZ A;  1OEY A;  2WLB A;  3NVW A;  4N9F 4;  2V9H A;  4BOZ B;  4J6I A;  5EE1 A;  2KMA A;  2Z8L A;  1MFW A;  4AS1 A;  1P0R A;  3UIP B;  1XLP A;  4MH8 A;  5IOI A;  4M0W B;  3VTU A;  2N9K A;  4X57 B;  3I3T B;  2I1K A;  1AAR A;  3B9J A;  2KYW A;  1SE2 A;  2RDB C;  1C76 A;  2E6X A;  2D5G A;  2V3P A;  3O13 A;  4JLC A;  1WYG A;  3ZNZ B;  5L95 C;  1GPX A;  2J0J A;  1ESF A;  3WAM A;  3RNF C;  3PS6 A;  1XCQ L;  3ZNI D;  4KSL C;  1YJJ A;  4CYE A;  2KQS A;  3L4P A;  2BB5 A;  4EFO A;  4TMA B;  4NPN A;  3E56 A;  5HFY A;  3PV1 A;  1WGK A;  2Z0D B;  3MJW A;  4XGA B;  4ZOH C;  3ONS A;  4HJG E;  4MSM B;  2GOW A;  2LXC A;  2BYT A;  1GC6 A;  3EC8 A;  4FHJ A;  4WAA A;  1M4V A;  2K9X A;  4TKN A;  1SSN A;  1T6B X;  1NEN B;  1UGM A;  2BTE A;  4WWN A;  1FM0 D;  3RNC C;  1L4Z B;  3DVG X;  3CIR B;  4D2K A;  1F1H A;  2WQY B;  3U52 E;  1F9J A;  2KZR A;  2RD0 A;  1Z2M A;  1D4B A;  3VXW A;  3DHI C;  5G2N A;  4EUT A;  1DOX A;  4IOI E;  4MM3 A;  2FUG 1;  4RNA A;  1OQQ A;  2J52 A;  1UD7 A;  5DPS A;  2LVP A;  2JUO A;  1T0S C;  1CJE A;  3IAS 1;  3AXC A;  3HM3 A;  3IVF A;  1CZP A;  1SE4 A;  2L00 B;  2V3S A;  2WDV B;  4KVG B;  4IWO A;  1YN5 A;  2K39 A;  3FIL A;  4DHJ D;  4M01 A;  2GBR A;  4IWQ A;  4XDD A;  2NS5 A;  3AMZ A;  3N20 C;  3ZQ4 A;  2KK8 A;  2NPT B;  1P3Q U;  4LNO A;  4KZC A;  3KLS X;  4WJQ A;  2UYZ B;  2IDY A;  2N9P C;  3L08 A;  1VR9 A;  1Y56 A;  1IUE A;  2KQ7 A;  3H7P B;  1L6U A;  4MAC A;  3UGB B;  2FNJ B;  2JZ3 B;  3OG5 A;  2QMT A;  3GB1 A;  1FEH A;  2DEN B;  1JWB D;  2LMC A;  1P7E A;  2RPV A;  2KFK A;  2QHO A;  3SFE B;  4QAY A;  3DWM A;  3A1Q A;  1D5Z C;  2LGI A;  3ZO5 B;  2ZZP B;  2I2Y A;  2N9E B;  3TEZ A;  2IND C;  1ZXI A;  3RZF A;  1TS4 A;  4ANX A;  3W1Y A;  2INN E;  2ACZ B;  4KSK C;  1JCK B;  4RF0 A;  2PLP A;  1E9M A;  1WH3 A;  1KJT A;  2KTR B;  1JRO A;  1HTQ A;  1YX5 B;  1Q0W B;  3SD5 A;  1MHH E;  4XYC A;  5J18 A;  1FNW A;  1BUI C;  1ZPS A;  4EOY A;  3ZJT A;  3CMM B;  2CJN A;  2WGS A;  1TGZ B;  2J7Q B;  2Z59 B;  3L13 A;  5DPT A;  3NVV A;  1E7U A;  2AL3 A;  1TKE A;  2K6D B;  3EFU A;  4K1R B;  2V0G A;  3VTW A;  3RNA C;  4W9L A;  3MFG A;  1KOT A;  4P6V F;  2JQR B;  2D2Q A;  2EKE C;  1GC7 A;  1Z5S B;  1T5X D;  2N7E A;  2JX5 A;  1KTK A;  1TYG B;  2ONQ A;  4BOS C;  1ZKH A;  1KM7 A;  3NRZ A;  1YQ3 B;  4HDQ A;  4LLG M;  1PUT A;  5H92 C;  3AED B;  1RWS A;  2FAZ A;  1QLB B;  4WQM A;  3PRZ A;  1V80 A;  2ZPY A;  3AB5 A;  2ICI A;  3TEW A;  4YSZ B;  4HXD A;  5BO4 B;  1TZ1 A;  3VFK A;  3P1M A;  3V6E B;  1L4D B;  4M8M A;  1TY0 A;  1C9F A;  1M94 A;  3MC8 A;  2M0X A;  1J7A A;  5I4D A;  3BWU D;  4EE2 A;  1VZ6 A;  3NS1 A;  5GMV A;  2IJ0 A;  2MBO A;  5JH5 C;  3PZD A;  2MLB A;  3EA6 A;  1EU3 A;  2M56 B;  3GZN B; 
#chains in the Genus database with same CATH homology
 1MJD A;  5IN7 A;  2BQQ A;  5IP4 D;  1UF0 A;  5IOI A;  1MFW A;  5IO9 A;  1MG4 A;  2DNF A;  5IKC M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...