2JVCA

Nmr solution structure of ubiquitin like protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
82
Chain Sequence
GPLGSMQIFVKTLTGKTITIDVDHADTVGAVKAKIYDKEGIPPDQQRLIFGGKQLEDSNAMSDYNVQKESTLHLVLRLRGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin_like protein
publication title NMR solution structure of ubiquitin like protein
rcsb
molecule tags Unknown function
total genus 11
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jvcA00
1S1QB 2J0KA 2M17A 3A9JB 2JT4B 1OEYA 1UZXB 2KDFB 2ZPYA 4TQ0A 1Q0WB 2EMSA 4IM3A 3QHTA 2AL6A 5E6NA 3ZNHB 4IWPA 1SIFA 1WJNA 4MGIE 3GOEA 2PJHA 3O65B 4W9IA 3D32A 1IPGA 4GIVA 2NVUI 4BVUC 3QQ8B 5CHWA 3DOWA 4CO7A 3ZTCA 2L7RA 3ZNZB 3KUDB 2RR9A 2LXAA 4GN1A 2GBMA 3IHPC 4BKSA 4W9FA 3H7PA 4BKSD 2D10A 4KIKB 1Y8RC 2AYOB 3L0WB 1LFDA 2LVPA 4WWNA 1UGMA 2MQJA 4KSLC 4TKNA 2FUHB 3N30A 3QA8A 1MG8A 4BKTA 5J17A 2B3AA 3RUIB 2KWVB 4MSMB 3A33B 2Z0DB 1SGHA 2QHOA 2MRPA 4WJQA 4EEWA 1WGHA 4HLEA 2C7NB 3OAWA 3ENEA 3L16A 2I1KA 1IYFA 1YJ1A 5DCNA 4F1SA 1J0GA 5G55A 3RCZA 5JHAA 5CHFA 4TQ1A 2NBWB 2R2QA 2KO3A 3ZRFA 3APFA 2GBRA 1OQYA 2KLGA 2NPTA 4URKA 1E8XA 4NAWA 2KHWB 4PS8A 2AEHA 5KHOA 3PGEA 3CSTA 3H7PB 2DZJA 3PS6A 5FR6A 1WXMA 1WIAA 3B08A 4FJVB 4PYUA 3TBLD 5BO4B 2D11A 5AZGA 2DX5B 3V62A 1KM7A 2KD0A 2CHXA 3PRMB 1K8RB 4FADA 3ALBA 1E8WA 3CSFA 2N1VA 2NCNA 2XEWA 4ZYNA 1V49A 3CMMB 1GC7A 1NI2A 1TGZB 2C9WB 1E5WA 2L00B 1ZKHA 4MELA 3GZNI 3VUWA 4AOFA 5LXHA 2KXJA 3PREA 2LUEA 5D2MB 2AWTA 3V6EB 3ZLZA 2K8BA 1YIWA 1E7UA 1WZ0A 1Z5SB 2JZ3B 3WA0A 1IP9A 2IZVB 1P3QU 4I6NB 3PZDA 2JXXA 2KVRA 1UD7A 2G3QB 2NPTB 2JUOA 4NAWB 3IVFA 1WMHA 1WZ3A 3PLUA 2N4FA 1WR1A 2A5UA 2LGXA 4HDOA 4RMAA 3QC8B 3VH3B 5D7GA 2N1WA 2BKRB 2BYVE 4B6WA 1YX5B 1V9JA 2L8JA 1RAXA 3RULA 3IG3A 4XX5A 5DPRA 3VH4B 2HE7A 3ZVVA 3ML8A 2BPSA 4AJYB 2YVCA 3DVGX 3AI5A 4MM3A 3VAWA 1V5OA 4CHKA 2ZCBA 1WX8A 1WE6A 4ZRKA 4DHZB 1V86A 1LM8B 2KJ6A 2NBVB 2IO0B 2MCNB 2LD9A 1E8ZA 2OJRA 3JYUA 3T8MA 4K1RB 4DXAB 1E8YA 2J0JA 4FHJA 4IM2A 1WMHB 3V60A 1UBQA 2FIDA 2UWQA 3A4SC 4XZ4A 1QZEA 4A20A 2MBBB 2DZKA 1NBFC 4YL8A 4GDKA 1P0RA 2KC2A 3X0WA 3UQAA 1NDDA 4PS3A 3K9OB 2BYFA 2JPHA 2EMTA 4GOCA 2DAFA 3EC8A 2ZPNA 4NQLB 3KYDD 3SDLC 3ZNID 2KN5A 5GMVA 4EFOA 2CR5A 2KKCA 3BY4B 3HIZA 4A3PA 3LJ3A 1WGRA 3OJ3A 1WXVA 3DBHI 1FXTB 2N9XA 3KVFB 3U30A 2MW5A 1WM2A 4MGKE 4F8CB 4GB9A 1LXDA 1PQSA 2KK8A 1T0YA 1WGDA 5JZEB 3ZDTA 3L17A 4WWPA 3ZUNA 2WX1A 3VUXA 3HM3A 3UIPB 4EUTA 4GDKB 2DYMA 2HJ8A 2KMCA 4NJ6A 2WWZA 3PHXB 4BBNF 2LGDA 2N7EA 3AULA 2CKHB 5CX3A 3IBEA 2RGFA 3VQIA 1WJ6A 3H9DA 4MEMA 2V3SA 4HPMB 2V1YA 3QJZA 1D3ZA 4MH0E 4ZRIA 1WGYA 1H4RA 4RM8A 3WANA 1GG3A 3PHWB 3V6CB 1LQBA 4GGQA 1WYWB 2C7HA 3KUCB 2Z59B 2DYBA 4K81A 3QX1A 2LASA 2PPHA 1KJTA 1V2YA 2K25A 1WM3A 2JRIB 4E3CA 5KHQA 4GU2A 4JGHB 2LRWA 5AZHA 2RPQA 2M4NA 3NZSA 2A4ZA 3AU4A 2K6DB 3DPDA 2KX3A 4M8MA 4W9JA 1TTNA 2GBNA 3QARA 2LRUA 3PSEB 3QAQA 3R7QA 2G45B 1A5RA 1WR6E 4KV2A 4FULA 1J19A 4ANUA 3NOBA 4GDLB 3DVNV 2KQ7A 2O6VA 2K6QA 2O6VD 4NJ7A 2LWPA 1WJUA 2VRRB 4K7SA 2ZJDA 5AEKB 4BOSC 4MJSA 3H1UA 4I6PA 1P9DU 4AUQC 4I6LB 2KOXA 2MBQA 4DWFA 3HK0A 4GXBA 3WAOA 1WFYA 3ZDMC 2L76A 3JVZX 3LDZE 1TBEA 4RM9A 1GUAB 1H8CA 4IM0A 4EOYA 3DDCB 2CS4A 3R7RA 3U7DA 1WH3A 5CTRC 4TUUA 2JZZA 3VVWB 2LJ5A 4ZDVA 1F9JA 3VHTC 2KMAA 3M95A 3QK0A 4IW0A 1WY8A 4MGYE 1SE9A 4DHJD 3RD2A 3HM6X 3TIXA 3WAPA 2KTFA 1EF1A 4A3OA 3Q3JA 3WALA 2FAZA 2HD5B 3IFWB 4DDGD 3Q3FA 2N7DA 2KJRA 3ZW3A 1G6JA 2CHWA 5LXIB 2DAJA 2O6VB 5C23A 4AWJA 4LJOB 4EZJA 2ZEQA 1RLFA 2V4LA 4MJSB 4DHZE 1P98A 2FNJB 2CHZA 1GJZA 2K8HA 2D07B 4F7ZA 5AZFA 2HTHA 2PEAA 2KQSA 2MA9B 4W9LA 3VDZA 1L2NA 1KOTA 2DYOA 1WX9A 4MSQB 2LZ6A 3ZO5B 3VUYA 3ZIMA 1C1YB 2GBJA 2L05A 4BKGA 2EKEC 4HJKA 4KSKC 1BT0A 3MHSD 2KDEB 1WF9A 3VTVA 5EDSA 3SHQA 2ZCCA 2C60A 2FCMA 4DHJB 3RZFA 1Z2MA 1R4NI 2KX0A 3H7SA 3VTUA 3ML9A 4FBJB 4KDIC 2G4SA 1P1AA 2KDIA 4HPLB 2FCNA 4TV3A 4II3B 4JL9A 5C1ZA 3RT3B 3PRZA 4BBNC 4FN2A 3A4RA 4II2B 3VFKA 1V81A 3EFUA 3PVLA 3UINB 1WRDB 2M8SA 3PT2B 4JLCA 2L0FA 2OOBB 1WX7A 2KDBA 2G4DB 2MP2B 4MGZE 3V61A 4IUMB 4WJOA 2MBEA 3JW0X 2LVQA 5LLIA 2K1FA 3M62B 5L95C 3PV1A 3N32A 1J8CA 2KWCA 1R4MI 2PE9A 2LXCA 3KUZA 3PTFC 2KFJA 3MJWA 4K7UA 2RSUA 2JF5A 4PS7A 1GNUA 5DPWA 4IWQA 3RZWC 2IBIB 1VCBA 3CF6E 5JHBA 3ZTDA 1XQQA 4ZRJA 2KTRB 4ANVA 2MBHA 1CMXB 1WGGA 1ISNA 1YQBA 2N9EB 3DBLI 3L10B 4BOZB 3SU8X 2AL3A 2YLMA 3W1YA 5J2RA 3S2AA 2J7QB 4GMVA 2KC1A 2KFKA 5DPSA 5TR5A 4LDTD 4IG7B 4NPNA 4GDLA 5E6OA 4FJZA 1RRBA 4EZLA 4FA6A 3DQVA 4N9F4 1WXSA 5CHVC 4HXDA 3APDA 3K9PB 2R2OA 3NS8A 4HCNB 4DK5A 4HWIB 2D2QA 4G50A 2MBOA 3KYCD 3APCA 3T9LA 4B95A 4BFRA 3KH0A 2DZIA 3OJ4B 3PPAA 4ASWC 2KNBA 4G11A 3UIOB 3AXCA 4ICUA 2N9PC 2KLCA 4G3XB 1YD8U 2WDTB 3P2BA 2REXA 4AP4C 3N3KB 1ZW7A 1GC6A 3A1QB 2DHZA 3L13A 4OVVA 2FCSA 2KFKB 1XT9B 3JSVA 2L0TA 3PLVA 2ZZPB 2JVCA 4LDTB 3SD5A 1E7VA 5IA7A 5JH5C 5DPTA 4M8NA 4W9CA 3QWZB 3R3MA 1OEYJ 1VD2A 4LJPB 4JIOU 1L7YA 2JRHA 3B0AA 2GMIC 2BWFA 2IO3B 2LGYA 2LVOA 3DCGA 2O2VA 1E90A 2L3ZA 2WYQA 1U4AA 1ZGUB 2C5LC 5L83A 1WXAA 2Y5BB 5D94A 3QIJA 2KWUB 4KDLB 3UF8A 2DENB 1EF5A 3VTWA 3M63B 3ZRCA 3X23A 2D3GA 4DBGA 1YX6B 5E6PA 4ANWA 2W9NA 1X1MA 3U8ZA 4FHKA 3B1LX 2ASQA 2ZVOA 4W9GA 2NBUA 3UGBB 4W9KA 4AJWA 3JSVB 4KZCA 3VXWA 2IYDB 4WWOA 1V6EA 4HCPB 1WE7A 3DVGY 3EECA 2FCQA 4G0NB 4EZKA 3ECIA 1UELA 2MLBA 2IY0B 4E74A 5D6JB 1I35A 2MP2A 2Z0EB 2XK5A 4KZ0A 2C7MB 2M0XA 4FLHA 2M1MA 3HHMA 2KANA 1OGWA 1KLVA 2O2VB 4XC2A 1OTRB 4W9HA 2FIFA 1RFAA 1TZ1A 1WI0A 2KZRA 2I1JA 2NR2A 2WX0A 2ZNVC 2IY1B 3UQBA 2MX2A 1EUVB 1UBIA 4NY0A 1V5TA 3AU5A 3R66C 2GOWA 4DDID 3ZNGC 2BKFA 1JRUA 3M3JA 3EHVA 2RD0A 4P7IA 2KTRA 4K7WA 4GSWA 3NY5A 4W9DA 4HVBA 4PYZA 3RYTA 1C3TA 1S3SG 3NZUA 2XBBC 4B9KA 2K39A 3W1SC 4FJYA 1Q5WB 3TCAA 3DBSA 2XK5B 1WJ4A 2BYEA 3TMPB 3NHEB 3ZKJC 3A9KA 4M0WB 3BINA 2MWSB 2NS5A 4WAAA 4MDKE 5IAAC 2DZMA 4WQOB 1EO6A 3A9JA 1M94A 4CYEA 4JQWC 1HE8A 2KJHB 2CU1A 3DBRI 3W1SA 3PRPB 3WAMA 1I42A 2MSED 4IC7B 3L54A 2IO2B 3MTNB 3WIMA 4IWOA 2JWZA 2GBKA 2IO1B 1AARA 3KW5B 4WJNA 4NQKE 1Q1OA 1XD3B 2J0MA 2K8CA 3ONSA 4HK2A 4J6IA 4LCDE 3C0RB 1UH6A 2BF8B 2ZNVB 4OVUA 3TL5A 3QCAA 2PE6B 3OLMD 5J18A 4KIKA 4X57B 4HDQA 3A1QA 1V80A 2JY6A 2ZVNA 4ANXA 2BWES 2LI5A 3DVNU 3I3TB 4EKUA 5HKHA 3TJPA 2BGFA 4WJPA 4KVGB 4NNJB 5G2NA 3A9KB 4E71A 2UYZB 4W9EA 3H6NA 4ICVA 3L08A
chains in the Genus database with same CATH superfamily
2WDVB 1Q0WB 4IM3A 3QHTA 4IWPA 4N6EB 4MGIE 3D32A 3OWEB 4BVUC 2NVUI 5CHWA 1V1PB 3EFCA 2L7RA 3ZNZB 3MC9A 1JW9D 3E56A 3IHPC 4W9FA 3H7PA 1Y8RC 2AYOB 4WWNA 1UGMA 4BKTA 3QA8A 5J17A 3RUIB 2PW9A 2KWVB 1SGHA 4A55A 3Q6BA 1FO4A 3EUB2 3L16A 2LMCA 2BQQA 2WGSA 1XCQL 1YJ1A 1SE2A 2EKIA 1EM7A 4IOIE 5JHAA 3LB8C 2QILA 2NBWB 2R2QA 2KO3A 4R3DA 4Q2JA 1OQYA 2KLGA 3SEBA 4PS8A 1YNTE 3W5VB 1JWSD 2DZJA 4C00A 1WXMA 1WIAA 3B08A 1SJHD 1TY0A 4AS1A 1KM7A 2CHXA 2AX5A 2JXTA 2TSSA 3CSFA 4ZYNA 1N5WA 3CMMB 5IKCM 1C77A 1E5WA 4AOFA 2LUEA 4WIPA 1Z5SB 1WZ0A 2JZ3B 4I6NB 3PZDA 2G3QB 1J7BA 1T0RC 4NAWB 1WMHA 1TZOA 5H8YE 1WR1A 1VJKA 2LGXA 3LYYA 4HDOA 1YN4A 1IUEA 2L8JA 2J53A 2RDHA 4AJYB 1SSNA 3U7ZA 4CHKA 4MM3A 4LK0M 1JWAD 2AQ3B 3AN1A 4DHZB 1V86A 3IT6B 2NBVB 1XLPA 2LD9A 3JYUA 3T8MA 4DXAB 2FIDA 2Z8LA 1QOAA 4A20A 1L4DB 1NEKB 1TS4A 1P0RA 3UQAA 1HA5A 2BYFA 2JPHA 3EC8A 3ZNID 3SDLC 2HDEA 3HIZA 2L32A 4LTUA 3OJ3A 1TS3A 1FXTB 3KVFB 4XDDA 4ZYSA 2LHEA 1PQSA 4A8XC 1MFWA 5HG2A 3WCQA 1I4HA 2WX1A 2KWDA 3UIPB 4GDKB 5BMIA 1ET9A 1C78A 5CX3A 3IBEA 3H9DA 4MEMA 2ACZB 2V4IB 3AB5A 3SFDB 1WGYA 1GG3A 3V6CB 3EA6A 1FNUA 3T3NA 2LASA 1RFKA 1ROEA 1WM3A 2HJ1A 2PVOD 5KHQA 5AZHA 1N6ZA 2RPQA 2QCZA 3NZSA 2LFIA 3DBRB 3ZJTA 2WU2B 2G45B 1A5RA 4KV2A 4ANUA 1HTOA 2K6QA 4NJ7A 1P7EA 2VRRB 3DWGC 4WURA 5AEKB 4BOSC 1T5XD 3Q8CA 3JVZX 5D3DA 1GUAB 4BZAA 3NJTA 3AECB 5CTRC 2LEKA 3QK0A 4DHJD 3TIXA 3HM6X 3WAPA 4C4VA 3AV8A 3TSSA 4A3OA 4HPPA 3RNCC 5LXIB 2K22A 1DGJA 3Q8FA 1RLFA 4MJSB 1P98A 1HQRD 2D3BA 3RNFC 1YOVB 3N9YC 1LGRA 1VR9A 2WNMA 1WX9A 3GP7A 3RNBC 3ZO5B 1TS5A 1FD6A 2L05A 5JXVA 1BT0A 4KGSA 4RF0A 2KDEB 4C56C 2BB6A 2C60A 2FCMA 3RZFA 3VR8B 3NVYA 2W54A 3AE9B 3N1YC 4KDIC 1P1AA 2KDIA 5C1ZA 3Q8AA 4FN2A 2M8SA 4JLCA 1PFDA 3DWMA 2L0FA 5G5GA 2MBEA 5D3IB 1V97A 1J7CA 3JW0X 2WQYB 3PV1A 1E9MA 3TEXA 2PE9A 2LXCA 4HJGE 1BMLC 2WXPA 1ZXIA 4K7UA 1TT5B 2RSUA 2JF5A 4XYCA 1AYFA 1WXQA 1WGGA 4P1CC 4RGMA 3DBLI 4BOZB 3W1YA 3P1MA 3S2AA 3J9CA 3TEZA 1SEBD 4LDTD 1VLBA 4GDLA 2HTME 1DOYA 3DQVA 1WXSA 1VDVA 4GLSC 4HXDA 3BWUD 1AWDA 3MHZA 3APDA 3K9PB 4HCNB 1AW7A 1F0ZA 4DK5A 2WU5B 1UWXA 1UF0A 4WAFA 4G50A 2MBOA 4BAXA 4B95A 2DZIA 3FILA 3R2IA 2D3CA 1KH0A 1MG4A 4G3XB 1EWCA 3P2BA 4DXGA 3N3KB 2QDFA 3L13A 2KFKB 4WH4A 5BMHA 3SD5A 2JVCA 1E7VA 3HRDD 4A9AA 5JH5C 4M8NA 1VD2A 3NZ3A 2D5GA 3B0AA 2GMIC 4A90A 1GOZA 2IO3B 2LGYA 2O2VA 2WYQA 2M0AA 4L23A 2C5LC 4N58A 2Y5BB 2KWUB 1I4QA 3Q69A 2W9NA 3U8ZA 1JQ4A 4FHKA 2ZVOA 3UGBB 1F1HA 4AJWA 2DWQA 1VZ8A 3DVGY 1FRDA 2CJOA 2KMMA 4KZ0A 2XN9C 2KANA 1OGWA 1OTRB 4W9HA 3UQBA 2IY1B 4LNFA 1GB4A 1EUVB 3R66C 2GOWA 1SXTA 1MJDA 1JRUA 3EHVA 2KTRA 1L0YB 1S3SG 1SE4A 3N1ZC 2WXOA 1I7HA 3TCAA 1QOBA 2XK5B 3NHEB 4M0WB 1QOGA 2RDGA 4JWUC 4MDKE 1EO6A 1QQRA 2KJHB 5EE9A 2BTEA 4IC7B 3MTNB 2GBKA 4UDUC 2J0MA 2K8CA 4WWMA 1V1PA 3AE3B 1QOFA 2BF8B 2ZNVB 3C8YA 1QILA 3IT4B 1EU3A 2DLBA 3DVNU 3ZJUA 4EKUA 5G2NA 3A9KB 4W9EA 3L4PA 3H6NA 2ZW0A 5HHDG 4YWGG 1UZXB 2KDFB 4TQ0A 5E6NA 1SIFA 1IPGA 3DOWA 4CO7A 1XCTL 1GPXA 4GN1A 1ZPSA 4BKSA 2INNE 4BKSD 2D10A 2MQJA 2FUHB 4HKZE 2ZW1A 3A33B 2QHOA 2MRPA 1WGHA 4HLEA 2RDBC 3NVZA 3ENEA 3OAWA 2I1KA 1L4ZB 4M00A 1KRHA 3RCZA 5CHFA 3AE8B 4FXCA 3ZRFA 2D3AA 2QIEB 4C7ZA 4HRSA 4URKA 4NAWA 2AEHA 3CSTA 3TBLD 4FJVB 4YSZB 5FR3A 5BO4B 1SBBB 2BS4B 3PRMB 4XWWA 4FADA 3ALBA 1E8WA 4P6VF 2VH2A 2NCNA 1DOXA 1DOIA 1OQQA 4OZBA 2L00B 2CJNA 2WLBA 3ZLZA 3DHIC 4YSYB 1IP9A 3NVWA 4LNOA 1FMAD 1UD7A 3P4RB 4NJCA 1YJJA 2WXJA 3QC8B 3VH3B 2N1WA 2BKRB 1YMHE 2BYVE 2R61A 1RAXA 4XX5A 5DPRA 1JALA 2HE7A 3ZVVA 2JX5A 2YVCA 1ZUD2 3DVGX 4D2KA 3B2FA 1KF6B 2KVZA 2X8XX 2INCC 1QF6A 2JYEA 2OHFA 1E8YA 4JX1C 3SFEB 3A4SC 2MBBB 4GDKA 3X0WA 3AE6B 1NDDA 4GOCA 2EMTA 1VZ7A 2DAFA 3ABVB 1STEA 2ZPNA 5GMVA 2KKCA 3LJ3A 2WXHA 1WXVA 2K9XA 1HXYD 1FCCC 1WM2A 5E6JA 3Q3NC 4GB9A 2PMVA 2Y3AA 1T0YA 1WGDA 3ZDTA 3HM3A 3AEFB 3Q8EA 4EUTA 2HJ8A 3RNGC 4NJ6A 4BBNF 2LGDA 2JYTA 3AULA 4ARIA 1WJ6A 4HPMB 4YTPB 4MH0E 4XE0A 2BVCA 2L83A 1I4XA 1DYQA 1CJEA 4K81A 3QX1A 2FUG1 1WSPA 1C79A 2JRIB 4GU2A 4JGHB 2GRIA 2A4ZA 2KX3A 3QAQA 3R7QA 4FULA 1J19A 1RYJA 2KQ7A 2M19A 2ZJDA 4MJSA 1K50A 2KACA 3H1UA 4AUQC 1P9DU 1C9FA 4I6LB 2MBQA 3HUIA 3HK0A 5BYQA 2XNAC 3DDCB 3R7RA 3VVWB 4NZLB 3VHTC 1WY8A 4MGYE 1SE9A 3RD2A 3KWVA 3PZ8A 5LNK1 1YN3A 4ZHPA 3IFWB 3ZW3A 2DAJA 2O6VB 3Q8BA 3NS1A 4EZJA 2BW2A 2ZEQA 4DHZE 2FNJB 1FFVA 4F7ZA 5AZFA 2HTHA 3VDZA 4YTMB 2EKEC 4EE2A 3MHSD 3W5UB 3VTVA 3SHQA 2ZCCA 1R4NI 3VTUA 1JWMD 2VZKB 3CIRB 4JL9A 2FBWB 4II2B 2QMTA 3PVLA 2KQ4X 3URYA 2OOBB 3N1XC 2G4DB 2MP2B 4WJOA 2LVQA 1L0XB 2K1FA 3AEGB 1MPEA 3N32A 1J8CA 3PTFC 2KFJA 3MJWA 5BMGA 4PS7A 4IWQA 2IBIB 2MH7A 1VCBA 3CF6E 3FC4A 3RNAC 3ZTDA 4ZRJA 2MBHA 4OVZA 1ISNA 4K3BA 2N9EB 2ON8A 2J7QB 2KC1A 2KFKA 5TR5A 4IG7B 4NPNA 1IBXB 4EZLA 2J42A 1JRPA 3BYYB 1MI0A 1L0VB 2R2OA 2YEPF 2INDC 4HWIB 2KT7A 4MT5A 4BFRA 1FM0D 3KH0A 3PPAA 1FIQA 1F2RC 1R4NB 1E7PB 3GE8C 1E10A 2NTSA 1ZW7A 2WHIA 2L0TA 2ZZPB 5DPTA 4W9CA 3QWZB 2IGDA 1TYGB 1JWBD 2JRHA 5EE1A 1WXAA 1XLNA 1FXIA 3BVGA 1EF5A 3M63B 3ZRCA 3R2TA 3P63A 1ZDVA 4XWTA 1L5PA 4JPSA 1XLQA 3JSVB 1CK1A 4KZCA 5GXGB 1V6EA 2FCQA 3ECIA 1UELA 2MLBA 4E74A 2H89B 1I35A 1XXGA 2Z0EB 2XK5A 4M0WA 2M1MA 3HHMA 2FIFA 1TZ1A 1WI0A 2NR2A 1YQ4B 3RFZB 2MX2A 4O1NA 1QKZA 4MACA 1UBIA 1SJED 1V5TA 3ZNGC 2BKFA 2RD0A 4YTNB 3NRZA 4K7WA 3RYTA 5AUKA 2XBBC 4B9KA 3FAHA 1PGXA 3W1SC 4FJYA 1Q5WB 4ACFA 2BYEA 3ZKJC 3A9KA 4WAAA 5IAAC 2DZMA 3ZQ4A 2MJEA 1I42A 1EWYC 4IWOA 1I4RA 4NQKE 3OG5A 1PYWD 4OVUA 1ZDXA 3TL5A 3OLMD 2WXMA 4MM3B 3A1QA 2JY6A 4ANXA 2ZVNA 5IN7A 2BWES 4LNIA 2LI5A 4NAMA 4WJPA 4E71A 2Y5CA 3A9JB 2I2YA 1OEYA 2EMSA 1EU4A 2AL6A 4RF1A 4IKGA 3GOEA 3O65B 1R7SA 2MJ3A 3ZTCA 2GBMA 2SEBD 4KIKB 3L0WB 1LFDA 4TKNA 3N30A 1MG8A 2V9HA 4MSMB 2Z0DB 4WJQA 1ZE3D 1B9RA 2C7NB 3AEEB 1AN8A 1IYFA 1D5ZC 4F1SA 1NYQA 1ACCA 4M02A 2QEJC 3I63C 1E8XA 3MC8A 3PS6A 5FR6A 3HVDA 4PYUA 2WS3B 5AZGA 2KD0A 2BB5A 3DBLB 1FCLA 2N1VA 2IGGA 1GC7A 2BYTA 4ZOHC 2C9WB 1ZKHA 3GZNI 5LXHA 2KXJA 5D2MB 2AWTA 1NENB 1YIWA 1FFUA 1E7UA 3WA0A 1V8CA 2IZVB 2NPTB 2JUOA 4RGNA 3PLUA 1WZ3A 1NI3A 2WXIA 2N4FA 2A5UA 4RMAA 2MEKA 1LO5D 3AE5B 3VH4B 4JE3B 1QLBB 5HFYA 1KLGD 1V5OA 2ZCBA 4RCOA 3LXFA 2J52A 2KN4A 1LM8B 4JWSC 3KQ4A 3BVMA 3ZGZA 3Q3OC 2DNFA 2GLSA 2N0SB 2UWQA 1NBFC 1WYGA 2GI9A 4YL8A 3TEWA 4ZRQA 2KC2A 5G5HA 4PS3A 3K9OB 1Q10A 3BVZA 2UU7A 2WXGA 2KN5A 4EFOA 5I4DA 3BY4B 1WGRA 2M56B 2N9XA 1K53A 2MW5A 4MGKE 3KWLA 1LXDA 3L17A 3ZUNA 2H88B 1A70A 2YEPB 2LGSA 1FNWA 3U52E 2KMCA 3MC0B 3PHXB 2RGFA 3VQIA 2WXKA 2V3SA 2V1YA 4USAA 4ZRIA 4ITKA 4RM8A 1NVID 3WANA 2BT6A 3PHWB 2C7HA 3KUCB 1UWMA 3ZXRA 2NMQA 2Z59B 2RPVA 4OZAA 2PPHA 3I5JC 4US8A 3B9JA 1K52A 5EE3A 1T0QC 2LRWA 2JSVX 2M4NA 3AU4A 2K6DB 3V05A 2FE8A 1V1OA 4M8MA 4W9JA 5IO9A 4KX6B 2CU3A 3PSEB 3O13A 1MHXA 3NOBA 4GDLB 2O6VA 2O6VD 3AE2B 2V3PA 3VRBB 4I6PA 1TJEA 1WFYA 2L76A 1JWUD 3LDZE 1TBEA 4RM9A 1H8CA 4YXDB 5TSSA 4EOYA 2WXNA 2CS4A 4IDIA 3SR6A 1WH3A 3U7DA 2JZZA 2WDQB 3M95A 4IW0A 1J7AA 2WXRA 3P4SB 1EF1A 2WXFA 2FAZA 2VZKD 2N7DA 2KJRA 2JQRB 1G6JA 5C23A 1GJZA 2K8HA 3AH7A 2PEAA 2KQSA 4W9LA 4B0EA 1KOTA 3AE4B 4MSQB 2LZ6A 2J4XA 3ZIMA 2GBJA 4HJKA 4KSKC 5EDSA 4L1BA 4K3CA 3E9SA 1YN5A 3H7SA 3ML9A 4FBJB 2G4SA 3T3OA 4HPLB 2FCNA 3MP9A 4TV3A 1SIJA 1N60A 2JU6X 1KLUD 3VFKA 3UINB 3V3XA 2OJWA 2PTLA 3BIID 1D4BA 4QAYA 1IBXA 5L95C 3AEBB 2KWCA 1R4MI 1JROA 3KUZA 1MVKA 1F77A 1NYRA 5DPWA 1GNUA 1HEZE 3RZWC 5JHBA 1XQQA 4ANVA 2KTRB 1CMXB 4LNKA 1YQBA 1F2RI 2PVGC 2AL3A 2YLMA 3SU8X 5J2RA 4GMVA 5DPSA 5E6OA 4FJZA 4FA6A 5BYRA 4N9F4 5CHVC 4CQNA 2I38A 3APCA 3T9LA 3OJ4B 2KNBA 2L52A 4G11A 5C2TB 3UIOB 3AXCA 2N9PC 2KLCA 1YD8U 1TKEA 3P42A 3DHGC 2REXA 1GC6A 2DHZA 4OVVA 4PT5A 3JSVA 4KGRA 5EE0A 1OEYJ 4XGAB 4JIOU 1CQVA 1L7YA 2BWFA 3DCGA 2LVOA 1C76A 5T8IA 1GB1A 1R4MB 1E90A 4DQOC 2DENB 2DBYA 3X23A 4DBGA 2E3TA 5E6PA 4ANWA 4YT0B 1JMLA 1X1MA 2NBUA 2IYDB 4WWOA 2EELA 4HCPB 3EECA 4EZKA 4G0NB 2IY0B 4P16A 1N61A 3RNEC 3UI3A 4OZCA 2M0XA 4A6QA 4XC2A 2LUMA 3HVZA 4J3OD 2KZRA 4N59A 1KFYB 1F52A 4TMAB 1QT9A 3NY5A 4HVBA 4ZHOA 4PYZA 3NZUA 3P4QB 3Q3MC 1WJ4A 2B76B 3BINA 4P1BC 5MPOA 1UGJA 3A9JA 1M94A 3BYTB 1HE8A 2CU1A 3DBRI 3PRPB 1ZP0B 2MSED 3L54A 2IGHA 3WIMA 3BK2A 2IO1B 3B2GA 3KW5B 1Q1OA 1XD3B 3ONSA 2BS2B 4J6IA 4LCDE 1L6VA 1UH6A 1FNVA 3QCAA 3R8BA 5J18A 4KIKA 4ZRPA 1T3QA 5HKHA 4NNJB 3NUHB 2UYZB 2LHDA 1UNSA 4ICVA 1S1QB 1PDXA 2J0KA 2M17A 2PLPA 2JT4B 3AMZA 3RI7C 2ZPYA 3W9CB 3NVVA 3ZNHB 1WJNA 2PJHA 4W9IA 4GIVA 4TSSA 3QQ8B 1TKYA 4L2YA 3KUDB 2RR9A 2LXAA 2LVPA 5BYSA 4HKQA 4KSLC 1KTKA 2B3AA 4HEA1 1TIFA 4S17A 4EEWA 4LLGM 2Q5WD 2NTTA 5DCNA 1FEHA 1XLOA 1J0GA 5G55A 4TQ1A 1Y56A 3APFA 2GBRA 2NPTA 1K51A 2KHWB 1MHHE 5KHOA 3PGEA 3H7PB 2ONQA 2WXQA 3ZXVA 2D11A 2DX5B 3V62A 1K8RB 3VRAB 3GE3C 2XEWA 1RWSA 1V49A 2MJDA 1TGZB 1NI2A 1FPYA 4MELA 2KAJA 3VUWA 3VR9B 3PREA 2RMMA 3V6EB 2K8BA 3TUOA 1P3QU 2JXXA 1D5XC 2KVRA 3IVFA 1C4AA 4H2AA 2INPE 5D7GA 4B6WA 3NG0A 1YX5B 1V9JA 2QJLA 3RULA 3IG3A 3AE7B 3ML8A 2BPSA 3U2SC 1FRRA 3AI5A 3VAWA 1BXTA 1WX8A 1WE6A 4ZRKA 4HROA 4LNNA 2KJ6A 1OQRA 2IO0B 1XEEA 2MCNB 1E8ZA 2OJRA 2V0GA 1ZOYB 1TS2A 4C7YA 4K1RB 4FHJA 2J0JA 4IM2A 1WMHB 4S0RA 1UBQA 3V60A 3RPFC 4XZ4A 1QZEA 2DZKA 2BS3B 2L1AA 2QSDA 3KLSX 2ICIA 1I4PA 3PZ7A 4NQLB 3KYDD 2CR5A 4WQMA 4RGTA 4US9A 4A3PA 3GB1A 3DBHI 1WWTA 4ARCA 1SB3C 3U30A 4F8CB 4RH6A 2KK8A 5JZEB 2WP9B 4WWPA 2G1EA 4REZA 3VUXA 1BUIC 1TKGA 2DYMA 1PGAA 2WWZA 2V3NA 2N7EA 2CKHB 1CZPA 1UUPA 1VZ6A 2AQ1B 3QJZA 2LJIA 1D3ZA 3CWIA 1H4RA 3IAM1 1LQBA 4GGQA 1WYWB 2W55A 2DYBA 1KJTA 1V2YA 5AUIA 2K25A 4E3CA 3Q2AC 2JZPA 4B0MA 3DPDA 2W82A 1TTNA 2K3UA 2PIAA 2GBNA 3QARA 2LRUA 1C4PA 1WR6E 3DVNV 2LWPA 3W2DA 1WJUA 4K7SA 3U4EG 2KOXA 4DWFA 4GXBA 5C3JB 3WAOA 3ZDMC 2WXLA 3BZDB 3AEDB 3I57A 1WGKA 4IM0A 3DBHB 1T6BX 2G9HD 4TUUA 1N5XA 4ZDVA 2LJ5A 3TEYA 1F9JA 3IAS1 2KMAA 1HTQA 4M01A 1GAQB 5IP4D 2KTFA 1M4VA 3Q3JA 3WALA 3H8HA 2HD5B 4DDGD 3Q3FA 3N20C 4DXFA 2CHWA 4AWJA 4LJOB 2N9KA 2V4LA 1B1ZA 2CHZA 4AQ7A 2D07B 1T0SC 1XO3A 2MA9B 3MJ5A 1L2NA 2DYOA 3VUYA 1C1YB 1IGCA 4BKGA 1WF9A 1N62A 4DHJB 2LGIA 1TY2A 3C19A 1Z2MA 1YJIA 4C4VB 2KX0A 3ZYYX 3AEAB 4II3B 2N7JA 3RT3B 1IGDA 3PRZA 4BBNC 3A4RA 5FKAC 1V81A 3EFUA 1WRDB 3PT2B 2QC8A 3MFGA 1WX7A 2KDBA 5FK9C 3V61A 4MGZE 4IUMB 5LLIA 3M62B 1N63A 2E6XA 1L6UA 4C80A 3GZNB 1PUTA 4RFBA 1E6EB 2KDMA 3DHHC 3L10B 2OEDA 1D5MC 2X38A 4MH8A 1ET6A 1RRBA 1SF0A 1JCKB 1WRIA 3NS8A 2D2QA 3KYCD 4ASWC 1C4CA 4ICUA 5H92C 2WDTB 1I4GA 4AP4C 5IOIA 3A1QB 4XDCA 3FKYA 2FCSA 1VRAB 1XT9B 4LDTB 3PLVA 1HZ5A 5IA7A 3R3MA 1YQ3B 4LJPB 2WDRB 4KKIA 2L3ZA 1U4AA 4KKJA 3FILB 1ZGUB 5L83A 5D94A 3UF8A 3QIJA 2W3RA 4KDLB 1FXAA 3VTWA 1RM6C 2D3GA 4RNAA 1YX6B 3RMKC 2MHJA 1HZ6A 1ESFA 3B1LX 2ASQA 4OW0A 4W9GA 4W9KA 2VH1A 3VXWA 3RN9C 3AE1B 1WE7A 2K0PA 2BBCA 1ZXHA 4RGOS 3BK1A 5D6JB 3PO0A 2MP2A 3GS2A 1ENFA 2C7MB 4FLHA 2IPKD 2K5PA 1KLVA 2O2VB 3AM9A 1RFAA 2ZNVC 2WX0A 2I1JA 3ETRA 3Q14C 3P4PB 4NY0A 3AU5A 3I9V1 4OHJA 4DDID 3M3JA 4P7IA 4YSXB 1SE3A 4W9DA 4GSWA 2W3SA 1C3TA 2PKOA 2IJ0A 2K39A 1P7FA 2JWUA 3DBSA 5HI1A 3TMPB 2SAKA 2MWSB 2NS5A 2AQ2B 1E0ZA 2N9LA 4WQOB 2Y5PA 4CYEA 3IXSA 4JQWC 3W1SA 1D6EC 3WAMA 2IO2B 2GB1A 2JWZA 1PGBA 1AARA 4WJNA 3EGRA 4HK2A 3C0RB 2PE6B 4X57B 4HDQA 1V80A 2IDYA 3ZJVA 4PK1A 3I3TB 1XF5L 2BGFA 3TJPA 4KGTA 4KVGB 1OFFA 2KYWA 3L08A
chains in the Genus database with same CATH topology
1S1QB 2J0KA 2M17A 3A9JB 2JT4B 1OEYA 1UZXB 2KDFB 2ZPYA 4TQ0A 1Q0WB 2EMSA 4IM3A 3QHTA 2AL6A 5E6NA 3ZNHB 4IWPA 1SIFA 1WJNA 4MGIE 3GOEA 2PJHA 3O65B 4W9IA 3D32A 1IPGA 4GIVA 2NVUI 4BVUC 3QQ8B 5CHWA 3DOWA 4CO7A 3ZTCA 2L7RA 3ZNZB 3KUDB 2RR9A 2LXAA 4GN1A 2GBMA 3IHPC 4BKSA 4W9FA 3H7PA 4BKSD 2D10A 4KIKB 1Y8RC 2AYOB 3L0WB 1LFDA 2LVPA 4WWNA 1UGMA 2MQJA 4KSLC 4TKNA 2FUHB 3N30A 3QA8A 1MG8A 4BKTA 5J17A 2B3AA 3RUIB 2KWVB 4MSMB 3A33B 2Z0DB 1SGHA 2QHOA 2MRPA 4WJQA 4EEWA 1WGHA 4HLEA 2C7NB 3OAWA 3ENEA 3L16A 2I1KA 1IYFA 1YJ1A 5DCNA 4F1SA 1J0GA 5G55A 3RCZA 5JHAA 5CHFA 4TQ1A 2NBWB 2R2QA 2KO3A 3ZRFA 3APFA 2GBRA 1OQYA 2KLGA 2NPTA 4URKA 1E8XA 4NAWA 2KHWB 4PS8A 2AEHA 5KHOA 3PGEA 3CSTA 3H7PB 2DZJA 3PS6A 5FR6A 1WXMA 1WIAA 3B08A 4FJVB 4PYUA 3TBLD 5BO4B 2D11A 5AZGA 2DX5B 3V62A 1KM7A 2KD0A 2CHXA 3PRMB 1K8RB 4FADA 3ALBA 1E8WA 3CSFA 2N1VA 2NCNA 2XEWA 4ZYNA 1V49A 3CMMB 1GC7A 1NI2A 1TGZB 2C9WB 1E5WA 2L00B 1ZKHA 4MELA 3GZNI 3VUWA 4AOFA 5LXHA 2KXJA 3PREA 2LUEA 5D2MB 2AWTA 3V6EB 3ZLZA 2K8BA 1YIWA 1E7UA 1WZ0A 1Z5SB 2JZ3B 3WA0A 1IP9A 2IZVB 1P3QU 4I6NB 3PZDA 2JXXA 2KVRA 1UD7A 2G3QB 2NPTB 2JUOA 4NAWB 3IVFA 1WMHA 1WZ3A 3PLUA 2N4FA 1WR1A 2A5UA 2LGXA 4HDOA 4RMAA 3QC8B 3VH3B 5D7GA 2N1WA 2BKRB 2BYVE 4B6WA 1YX5B 1V9JA 2L8JA 1RAXA 3RULA 3IG3A 4XX5A 5DPRA 3VH4B 2HE7A 3ZVVA 3ML8A 2BPSA 4AJYB 2YVCA 3DVGX 3AI5A 4MM3A 3VAWA 1V5OA 4CHKA 2ZCBA 1WX8A 1WE6A 4ZRKA 4DHZB 1V86A 1LM8B 2KJ6A 2NBVB 2IO0B 2MCNB 2LD9A 1E8ZA 2OJRA 3JYUA 3T8MA 4K1RB 4DXAB 1E8YA 2J0JA 4FHJA 4IM2A 1WMHB 3V60A 1UBQA 2FIDA 2UWQA 3A4SC 4XZ4A 1QZEA 4A20A 2MBBB 2DZKA 1NBFC 4YL8A 4GDKA 1P0RA 2KC2A 3X0WA 3UQAA 1NDDA 4PS3A 3K9OB 2BYFA 2JPHA 2EMTA 4GOCA 2DAFA 3EC8A 2ZPNA 4NQLB 3KYDD 3SDLC 3ZNID 2KN5A 5GMVA 4EFOA 2CR5A 2KKCA 3BY4B 3HIZA 4A3PA 3LJ3A 1WGRA 3OJ3A 1WXVA 3DBHI 1FXTB 2N9XA 3KVFB 3U30A 2MW5A 1WM2A 4MGKE 4F8CB 4GB9A 1LXDA 1PQSA 2KK8A 1T0YA 1WGDA 5JZEB 3ZDTA 3L17A 4WWPA 3ZUNA 2WX1A 3VUXA 3HM3A 3UIPB 4EUTA 4GDKB 2DYMA 2HJ8A 2KMCA 4NJ6A 2WWZA 3PHXB 4BBNF 2LGDA 2N7EA 3AULA 2CKHB 5CX3A 3IBEA 2RGFA 3VQIA 1WJ6A 3H9DA 4MEMA 2V3SA 4HPMB 2V1YA 3QJZA 1D3ZA 4MH0E 4ZRIA 1WGYA 1H4RA 4RM8A 3WANA 1GG3A 3PHWB 3V6CB 1LQBA 4GGQA 1WYWB 2C7HA 3KUCB 2Z59B 2DYBA 4K81A 3QX1A 2LASA 2PPHA 1KJTA 1V2YA 2K25A 1WM3A 2JRIB 4E3CA 5KHQA 4GU2A 4JGHB 2LRWA 5AZHA 2RPQA 2M4NA 3NZSA 2A4ZA 3AU4A 2K6DB 3DPDA 2KX3A 4M8MA 4W9JA 1TTNA 2GBNA 3QARA 2LRUA 3PSEB 3QAQA 3R7QA 2G45B 1A5RA 1WR6E 4KV2A 4FULA 1J19A 4ANUA 3NOBA 4GDLB 3DVNV 2KQ7A 2O6VA 2K6QA 2O6VD 4NJ7A 2LWPA 1WJUA 2VRRB 4K7SA 2ZJDA 5AEKB 4BOSC 4MJSA 3H1UA 4I6PA 1P9DU 4AUQC 4I6LB 2KOXA 2MBQA 4DWFA 3HK0A 4GXBA 3WAOA 1WFYA 3ZDMC 2L76A 3JVZX 3LDZE 1TBEA 4RM9A 1GUAB 1H8CA 4IM0A 4EOYA 3DDCB 2CS4A 3R7RA 3U7DA 1WH3A 5CTRC 4TUUA 2JZZA 3VVWB 2LJ5A 4ZDVA 1F9JA 3VHTC 2KMAA 3M95A 3QK0A 4IW0A 1WY8A 4MGYE 1SE9A 4DHJD 3RD2A 3HM6X 3TIXA 3WAPA 2KTFA 1EF1A 4A3OA 3Q3JA 3WALA 2FAZA 2HD5B 3IFWB 4DDGD 3Q3FA 2N7DA 2KJRA 3ZW3A 1G6JA 2CHWA 5LXIB 2DAJA 2O6VB 5C23A 4AWJA 4LJOB 4EZJA 2ZEQA 1RLFA 2V4LA 4MJSB 4DHZE 1P98A 2FNJB 2CHZA 1GJZA 2K8HA 2D07B 4F7ZA 5AZFA 2HTHA 2PEAA 2KQSA 2MA9B 4W9LA 3VDZA 1L2NA 1KOTA 2DYOA 1WX9A 4MSQB 2LZ6A 3ZO5B 3VUYA 3ZIMA 1C1YB 2GBJA 2L05A 4BKGA 2EKEC 4HJKA 4KSKC 1BT0A 3MHSD 2KDEB 1WF9A 3VTVA 5EDSA 3SHQA 2ZCCA 2C60A 2FCMA 4DHJB 3RZFA 1Z2MA 1R4NI 2KX0A 3H7SA 3VTUA 3ML9A 4FBJB 4KDIC 2G4SA 1P1AA 2KDIA 4HPLB 2FCNA 4TV3A 4II3B 4JL9A 5C1ZA 3RT3B 3PRZA 4BBNC 4FN2A 3A4RA 4II2B 3VFKA 1V81A 3EFUA 3PVLA 3UINB 1WRDB 2M8SA 3PT2B 4JLCA 2L0FA 2OOBB 1WX7A 2KDBA 2G4DB 2MP2B 4MGZE 3V61A 4IUMB 4WJOA 2MBEA 3JW0X 2LVQA 5LLIA 2K1FA 3M62B 5L95C 3PV1A 3N32A 1J8CA 2KWCA 1R4MI 2PE9A 2LXCA 3KUZA 3PTFC 2KFJA 3MJWA 4K7UA 2RSUA 2JF5A 4PS7A 1GNUA 5DPWA 4IWQA 3RZWC 2IBIB 1VCBA 3CF6E 5JHBA 3ZTDA 1XQQA 4ZRJA 2KTRB 4ANVA 2MBHA 1CMXB 1WGGA 1ISNA 1YQBA 2N9EB 3DBLI 3L10B 4BOZB 3SU8X 2AL3A 2YLMA 3W1YA 5J2RA 3S2AA 2J7QB 4GMVA 2KC1A 2KFKA 5DPSA 5TR5A 4LDTD 4IG7B 4NPNA 4GDLA 5E6OA 4FJZA 1RRBA 4EZLA 4FA6A 3DQVA 4N9F4 1WXSA 5CHVC 4HXDA 3APDA 3K9PB 2R2OA 3NS8A 4HCNB 4DK5A 4HWIB 2D2QA 4G50A 2MBOA 3KYCD 3APCA 3T9LA 4B95A 4BFRA 3KH0A 2DZIA 3OJ4B 3PPAA 4ASWC 2KNBA 4G11A 3UIOB 3AXCA 4ICUA 2N9PC 2KLCA 4G3XB 1YD8U 2WDTB 3P2BA 2REXA 4AP4C 3N3KB 1ZW7A 1GC6A 3A1QB 2DHZA 3L13A 4OVVA 2FCSA 2KFKB 1XT9B 3JSVA 2L0TA 3PLVA 2ZZPB 2JVCA 4LDTB 3SD5A 1E7VA 5IA7A 5JH5C 5DPTA 4M8NA 4W9CA 3QWZB 3R3MA 1OEYJ 1VD2A 4LJPB 4JIOU 1L7YA 2JRHA 3B0AA 2GMIC 2BWFA 2IO3B 2LGYA 2LVOA 3DCGA 2O2VA 1E90A 2L3ZA 2WYQA 1U4AA 1ZGUB 2C5LC 5L83A 1WXAA 2Y5BB 5D94A 3QIJA 2KWUB 4KDLB 3UF8A 2DENB 1EF5A 3VTWA 3M63B 3ZRCA 3X23A 2D3GA 4DBGA 1YX6B 5E6PA 4ANWA 2W9NA 1X1MA 3U8ZA 4FHKA 3B1LX 2ASQA 2ZVOA 4W9GA 2NBUA 3UGBB 4W9KA 4AJWA 3JSVB 4KZCA 3VXWA 2IYDB 4WWOA 1V6EA 4HCPB 1WE7A 3DVGY 3EECA 2FCQA 4G0NB 4EZKA 3ECIA 1UELA 2MLBA 2IY0B 4E74A 5D6JB 1I35A 2MP2A 2Z0EB 2XK5A 4KZ0A 2C7MB 2M0XA 4FLHA 2M1MA 3HHMA 2KANA 1OGWA 1KLVA 2O2VB 4XC2A 1OTRB 4W9HA 2FIFA 1RFAA 1TZ1A 1WI0A 2KZRA 2I1JA 2NR2A 2WX0A 2ZNVC 2IY1B 3UQBA 2MX2A 1EUVB 1UBIA 4NY0A 1V5TA 3AU5A 3R66C 2GOWA 4DDID 3ZNGC 2BKFA 1JRUA 3M3JA 3EHVA 2RD0A 4P7IA 2KTRA 4K7WA 4GSWA 3NY5A 4W9DA 4HVBA 4PYZA 3RYTA 1C3TA 1S3SG 3NZUA 2XBBC 4B9KA 2K39A 3W1SC 4FJYA 1Q5WB 3TCAA 3DBSA 2XK5B 1WJ4A 2BYEA 3TMPB 3NHEB 3ZKJC 3A9KA 4M0WB 3BINA 2MWSB 2NS5A 4WAAA 4MDKE 5IAAC 2DZMA 4WQOB 1EO6A 3A9JA 1M94A 4CYEA 4JQWC 1HE8A 2KJHB 2CU1A 3DBRI 3W1SA 3PRPB 3WAMA 1I42A 2MSED 4IC7B 3L54A 2IO2B 3MTNB 3WIMA 4IWOA 2JWZA 2GBKA 2IO1B 1AARA 3KW5B 4WJNA 4NQKE 1Q1OA 1XD3B 2J0MA 2K8CA 3ONSA 4HK2A 4J6IA 4LCDE 3C0RB 1UH6A 2BF8B 2ZNVB 4OVUA 3TL5A 3QCAA 2PE6B 3OLMD 5J18A 4KIKA 4X57B 4HDQA 3A1QA 1V80A 2JY6A 2ZVNA 4ANXA 2BWES 2LI5A 3DVNU 3I3TB 4EKUA 5HKHA 3TJPA 2BGFA 4WJPA 4KVGB 4NNJB 5G2NA 3A9KB 4E71A 2UYZB 4W9EA 3H6NA 4ICVA 3L08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Q B;  2J0K A;  2M17 A;  3A9J B;  2JT4 B;  1OEY A;  1UZX B;  2KDF B;  2ZPY A;  4TQ0 A;  1Q0W B;  2EMS A;  4IM3 A;  3QHT A;  2AL6 A;  5E6N A;  3ZNH B;  4IWP A;  1SIF A;  1WJN A;  4MGI E;  3GOE A;  2PJH A;  3O65 B;  4W9I A;  3D32 A;  1IPG A;  4GIV A;  2NVU I;  4BVU C;  3QQ8 B;  5CHW A;  3DOW A;  4CO7 A;  3ZTC A;  2L7R A;  3ZNZ B;  3KUD B;  2RR9 A;  2LXA A;  4GN1 A;  2GBM A;  3IHP C;  4BKS A;  4W9F A;  3H7P A;  4BKS D;  2D10 A;  4KIK B;  1Y8R C;  2AYO B;  3L0W B;  1LFD A;  2LVP A;  4WWN A;  1UGM A;  2MQJ A;  4KSL C;  4TKN A;  2FUH B;  3N30 A;  3QA8 A;  1MG8 A;  4BKT A;  5J17 A;  2B3A A;  3RUI B;  2KWV B;  4MSM B;  3A33 B;  2Z0D B;  1SGH A;  2QHO A;  2MRP A;  4WJQ A;  4EEW A;  1WGH A;  4HLE A;  2C7N B;  3OAW A;  3ENE A;  3L16 A;  2I1K A;  1IYF A;  1YJ1 A;  5DCN A;  4F1S A;  1J0G A;  5G55 A;  3RCZ A;  5JHA A;  5CHF A;  4TQ1 A;  2NBW B;  2R2Q A;  2KO3 A;  3ZRF A;  3APF A;  2GBR A;  1OQY A;  2KLG A;  2NPT A;  4URK A;  1E8X A;  4NAW A;  2KHW B;  4PS8 A;  2AEH A;  5KHO A;  3PGE A;  3CST A;  3H7P B;  2DZJ A;  3PS6 A;  5FR6 A;  1WXM A;  1WIA A;  3B08 A;  4FJV B;  4PYU A;  3TBL D;  5BO4 B;  2D11 A;  5AZG A;  2DX5 B;  3V62 A;  1KM7 A;  2KD0 A;  2CHX A;  3PRM B;  1K8R B;  4FAD A;  3ALB A;  1E8W A;  3CSF A;  2N1V A;  2NCN A;  2XEW A;  4ZYN A;  1V49 A;  3CMM B;  1GC7 A;  1NI2 A;  1TGZ B;  2C9W B;  1E5W A;  2L00 B;  1ZKH A;  4MEL A;  3GZN I;  3VUW A;  4AOF A;  5LXH A;  2KXJ A;  3PRE A;  2LUE A;  5D2M B;  2AWT A;  3V6E B;  3ZLZ A;  2K8B A;  1YIW A;  1E7U A;  1WZ0 A;  1Z5S B;  2JZ3 B;  3WA0 A;  1IP9 A;  2IZV B;  1P3Q U;  4I6N B;  3PZD A;  2JXX A;  2KVR A;  1UD7 A;  2G3Q B;  2NPT B;  2JUO A;  4NAW B;  3IVF A;  1WMH A;  1WZ3 A;  3PLU A;  2N4F A;  1WR1 A;  2A5U A;  2LGX A;  4HDO A;  4RMA A;  3QC8 B;  3VH3 B;  5D7G A;  2N1W A;  2BKR B;  2BYV E;  4B6W A;  1YX5 B;  1V9J A;  2L8J A;  1RAX A;  3RUL A;  3IG3 A;  4XX5 A;  5DPR A;  3VH4 B;  2HE7 A;  3ZVV A;  3ML8 A;  2BPS A;  4AJY B;  2YVC A;  3DVG X;  3AI5 A;  4MM3 A;  3VAW A;  1V5O A;  4CHK A;  2ZCB A;  1WX8 A;  1WE6 A;  4ZRK A;  4DHZ B;  1V86 A;  1LM8 B;  2KJ6 A;  2NBV B;  2IO0 B;  2MCN B;  2LD9 A;  1E8Z A;  2OJR A;  3JYU A;  3T8M A;  4K1R B;  4DXA B;  1E8Y A;  2J0J A;  4FHJ A;  4IM2 A;  1WMH B;  3V60 A;  1UBQ A;  2FID A;  2UWQ A;  3A4S C;  4XZ4 A;  1QZE A;  4A20 A;  2MBB B;  2DZK A;  1NBF C;  4YL8 A;  4GDK A;  1P0R A;  2KC2 A;  3X0W A;  3UQA A;  1NDD A;  4PS3 A;  3K9O B;  2BYF A;  2JPH A;  2EMT A;  4GOC A;  2DAF A;  3EC8 A;  2ZPN A;  4NQL B;  3KYD D;  3SDL C;  3ZNI D;  2KN5 A;  5GMV A;  4EFO A;  2CR5 A;  2KKC A;  3BY4 B;  3HIZ A;  4A3P A;  3LJ3 A;  1WGR A;  3OJ3 A;  1WXV A;  3DBH I;  1FXT B;  2N9X A;  3KVF B;  3U30 A;  2MW5 A;  1WM2 A;  4MGK E;  4F8C B;  4GB9 A;  1LXD A;  1PQS A;  2KK8 A;  1T0Y A;  1WGD A;  5JZE B;  3ZDT A;  3L17 A;  4WWP A;  3ZUN A;  2WX1 A;  3VUX A;  3HM3 A;  3UIP B;  4EUT A;  4GDK B;  2DYM A;  2HJ8 A;  2KMC A;  4NJ6 A;  2WWZ A;  3PHX B;  4BBN F;  2LGD A;  2N7E A;  3AUL A;  2CKH B;  5CX3 A;  3IBE A;  2RGF A;  3VQI A;  1WJ6 A;  3H9D A;  4MEM A;  2V3S A;  4HPM B;  2V1Y A;  3QJZ A;  1D3Z A;  4MH0 E;  4ZRI A;  1WGY A;  1H4R A;  4RM8 A;  3WAN A;  1GG3 A;  3PHW B;  3V6C B;  1LQB A;  4GGQ A;  1WYW B;  2C7H A;  3KUC B;  2Z59 B;  2DYB A;  4K81 A;  3QX1 A;  2LAS A;  2PPH A;  1KJT A;  1V2Y A;  2K25 A;  1WM3 A;  2JRI B;  4E3C A;  5KHQ A;  4GU2 A;  4JGH B;  2LRW A;  5AZH A;  2RPQ A;  2M4N A;  3NZS A;  2A4Z A;  3AU4 A;  2K6D B;  3DPD A;  2KX3 A;  4M8M A;  4W9J A;  1TTN A;  2GBN A;  3QAR A;  2LRU A;  3PSE B;  3QAQ A;  3R7Q A;  2G45 B;  1A5R A;  1WR6 E;  4KV2 A;  4FUL A;  1J19 A;  4ANU A;  3NOB A;  4GDL B;  3DVN V;  2KQ7 A;  2O6V A;  2K6Q A;  2O6V D;  4NJ7 A;  2LWP A;  1WJU A;  2VRR B;  4K7S A;  2ZJD A;  5AEK B;  4BOS C;  4MJS A;  3H1U A;  4I6P A;  1P9D U;  4AUQ C;  4I6L B;  2KOX A;  2MBQ A;  4DWF A;  3HK0 A;  4GXB A;  3WAO A;  1WFY A;  3ZDM C;  2L76 A;  3JVZ X;  3LDZ E;  1TBE A;  4RM9 A;  1GUA B;  1H8C A;  4IM0 A;  4EOY A;  3DDC B;  2CS4 A;  3R7R A;  3U7D A;  1WH3 A;  5CTR C;  4TUU A;  2JZZ A;  3VVW B;  2LJ5 A;  4ZDV A;  1F9J A;  3VHT C;  2KMA A;  3M95 A;  3QK0 A;  4IW0 A;  1WY8 A;  4MGY E;  1SE9 A;  4DHJ D;  3RD2 A;  3HM6 X;  3TIX A;  3WAP A;  2KTF A;  1EF1 A;  4A3O A;  3Q3J A;  3WAL A;  2FAZ A;  2HD5 B;  3IFW B;  4DDG D;  3Q3F A;  2N7D A;  2KJR A;  3ZW3 A;  1G6J A;  2CHW A;  5LXI B;  2DAJ A;  2O6V B;  5C23 A;  4AWJ A;  4LJO B;  4EZJ A;  2ZEQ A;  1RLF A;  2V4L A;  4MJS B;  4DHZ E;  1P98 A;  2FNJ B;  2CHZ A;  1GJZ A;  2K8H A;  2D07 B;  4F7Z A;  5AZF A;  2HTH A;  2PEA A;  2KQS A;  2MA9 B;  4W9L A;  3VDZ A;  1L2N A;  1KOT A;  2DYO A;  1WX9 A;  4MSQ B;  2LZ6 A;  3ZO5 B;  3VUY A;  3ZIM A;  1C1Y B;  2GBJ A;  2L05 A;  4BKG A;  2EKE C;  4HJK A;  4KSK C;  1BT0 A;  3MHS D;  2KDE B;  1WF9 A;  3VTV A;  5EDS A;  3SHQ A;  2ZCC A;  2C60 A;  2FCM A;  4DHJ B;  3RZF A;  1Z2M A;  1R4N I;  2KX0 A;  3H7S A;  3VTU A;  3ML9 A;  4FBJ B;  4KDI C;  2G4S A;  1P1A A;  2KDI A;  4HPL B;  2FCN A;  4TV3 A;  4II3 B;  4JL9 A;  5C1Z A;  3RT3 B;  3PRZ A;  4BBN C;  4FN2 A;  3A4R A;  4II2 B;  3VFK A;  1V81 A;  3EFU A;  3PVL A;  3UIN B;  1WRD B;  2M8S A;  3PT2 B;  4JLC A;  2L0F A;  2OOB B;  1WX7 A;  2KDB A;  2G4D B;  2MP2 B;  4MGZ E;  3V61 A;  4IUM B;  4WJO A;  2MBE A;  3JW0 X;  2LVQ A;  5LLI A;  2K1F A;  3M62 B;  5L95 C;  3PV1 A;  3N32 A;  1J8C A;  2KWC A;  1R4M I;  2PE9 A;  2LXC A;  3KUZ A;  3PTF C;  2KFJ A;  3MJW A;  4K7U A;  2RSU A;  2JF5 A;  4PS7 A;  1GNU A;  5DPW A;  4IWQ A;  3RZW C;  2IBI B;  1VCB A;  3CF6 E;  5JHB A;  3ZTD A;  1XQQ A;  4ZRJ A;  2KTR B;  4ANV A;  2MBH A;  1CMX B;  1WGG A;  1ISN A;  1YQB A;  2N9E B;  3DBL I;  3L10 B;  4BOZ B;  3SU8 X;  2AL3 A;  2YLM A;  3W1Y A;  5J2R A;  3S2A A;  2J7Q B;  4GMV A;  2KC1 A;  2KFK A;  5DPS A;  5TR5 A;  4LDT D;  4IG7 B;  4NPN A;  4GDL A;  5E6O A;  4FJZ A;  1RRB A;  4EZL A;  4FA6 A;  3DQV A;  4N9F 4;  1WXS A;  5CHV C;  4HXD A;  3APD A;  3K9P B;  2R2O A;  3NS8 A;  4HCN B;  4DK5 A;  4HWI B;  2D2Q A;  4G50 A;  2MBO A;  3KYC D;  3APC A;  3T9L A;  4B95 A;  4BFR A;  3KH0 A;  2DZI A;  3OJ4 B;  3PPA A;  4ASW C;  2KNB A;  4G11 A;  3UIO B;  3AXC A;  4ICU A;  2N9P C;  2KLC A;  4G3X B;  1YD8 U;  2WDT B;  3P2B A;  2REX A;  4AP4 C;  3N3K B;  1ZW7 A;  1GC6 A;  3A1Q B;  2DHZ A;  3L13 A;  4OVV A;  2FCS A;  2KFK B;  1XT9 B;  3JSV A;  2L0T A;  3PLV A;  2ZZP B;  2JVC A;  4LDT B;  3SD5 A;  1E7V A;  5IA7 A;  5JH5 C;  5DPT A;  4M8N A;  4W9C A;  3QWZ B;  3R3M A;  1OEY J;  1VD2 A;  4LJP B;  4JIO U;  1L7Y A;  2JRH A;  3B0A A;  2GMI C;  2BWF A;  2IO3 B;  2LGY A;  2LVO A;  3DCG A;  2O2V A;  1E90 A;  2L3Z A;  2WYQ A;  1U4A A;  1ZGU B;  2C5L C;  5L83 A;  1WXA A;  2Y5B B;  5D94 A;  3QIJ A;  2KWU B;  4KDL B;  3UF8 A;  2DEN B;  1EF5 A;  3VTW A;  3M63 B;  3ZRC A;  3X23 A;  2D3G A;  4DBG A;  1YX6 B;  5E6P A;  4ANW A;  2W9N A;  1X1M A;  3U8Z A;  4FHK A;  3B1L X;  2ASQ A;  2ZVO A;  4W9G A;  2NBU A;  3UGB B;  4W9K A;  4AJW A;  3JSV B;  4KZC A;  3VXW A;  2IYD B;  4WWO A;  1V6E A;  4HCP B;  1WE7 A;  3DVG Y;  3EEC A;  2FCQ A;  4G0N B;  4EZK A;  3ECI A;  1UEL A;  2MLB A;  2IY0 B;  4E74 A;  5D6J B;  1I35 A;  2MP2 A;  2Z0E B;  2XK5 A;  4KZ0 A;  2C7M B;  2M0X A;  4FLH A;  2M1M A;  3HHM A;  2KAN A;  1OGW A;  1KLV A;  2O2V B;  4XC2 A;  1OTR B;  4W9H A;  2FIF A;  1RFA A;  1TZ1 A;  1WI0 A;  2KZR A;  2I1J A;  2NR2 A;  2WX0 A;  2ZNV C;  2IY1 B;  3UQB A;  2MX2 A;  1EUV B;  1UBI A;  4NY0 A;  1V5T A;  3AU5 A;  3R66 C;  2GOW A;  4DDI D;  3ZNG C;  2BKF A;  1JRU A;  3M3J A;  3EHV A;  2RD0 A;  4P7I A;  2KTR A;  4K7W A;  4GSW A;  3NY5 A;  4W9D A;  4HVB A;  4PYZ A;  3RYT A;  1C3T A;  1S3S G;  3NZU A;  2XBB C;  4B9K A;  2K39 A;  3W1S C;  4FJY A;  1Q5W B;  3TCA A;  3DBS A;  2XK5 B;  1WJ4 A;  2BYE A;  3TMP B;  3NHE B;  3ZKJ C;  3A9K A;  4M0W B;  3BIN A;  2MWS B;  2NS5 A;  4WAA A;  4MDK E;  5IAA C;  2DZM A;  4WQO B;  1EO6 A;  3A9J A;  1M94 A;  4CYE A;  4JQW C;  1HE8 A;  2KJH B;  2CU1 A;  3DBR I;  3W1S A;  3PRP B;  3WAM A;  1I42 A;  2MSE D;  4IC7 B;  3L54 A;  2IO2 B;  3MTN B;  3WIM A;  4IWO A;  2JWZ A;  2GBK A;  2IO1 B;  1AAR A;  3KW5 B;  4WJN A;  4NQK E;  1Q1O A;  1XD3 B;  2J0M A;  2K8C A;  3ONS A;  4HK2 A;  4J6I A;  4LCD E;  3C0R B;  1UH6 A;  2BF8 B;  2ZNV B;  4OVU A;  3TL5 A;  3QCA A;  2PE6 B;  3OLM D;  5J18 A;  4KIK A;  4X57 B;  4HDQ A;  3A1Q A;  1V80 A;  2JY6 A;  2ZVN A;  4ANX A;  2BWE S;  2LI5 A;  3DVN U;  3I3T B;  4EKU A;  5HKH A;  3TJP A;  2BGF A;  4WJP A;  4KVG B;  4NNJ B;  5G2N A;  3A9K B;  4E71 A;  2UYZ B;  4W9E A;  3H6N A;  4ICV A;  3L08 A; 
#chains in the Genus database with same CATH topology
 2WDV B;  1Q0W B;  4IM3 A;  3QHT A;  4IWP A;  4N6E B;  4MGI E;  3D32 A;  3OWE B;  4BVU C;  2NVU I;  5CHW A;  1V1P B;  3EFC A;  2L7R A;  3ZNZ B;  3MC9 A;  1JW9 D;  3E56 A;  3IHP C;  4W9F A;  3H7P A;  1Y8R C;  2AYO B;  4WWN A;  1UGM A;  4BKT A;  3QA8 A;  5J17 A;  3RUI B;  2PW9 A;  2KWV B;  1SGH A;  4A55 A;  3Q6B A;  1FO4 A;  3EUB 2;  3L16 A;  2LMC A;  2BQQ A;  2WGS A;  1XCQ L;  1YJ1 A;  1SE2 A;  2EKI A;  1EM7 A;  4IOI E;  5JHA A;  3LB8 C;  2QIL A;  2NBW B;  2R2Q A;  2KO3 A;  4R3D A;  4Q2J A;  1OQY A;  2KLG A;  3SEB A;  4PS8 A;  1YNT E;  3W5V B;  1JWS D;  2DZJ A;  4C00 A;  1WXM A;  1WIA A;  3B08 A;  1SJH D;  1TY0 A;  4AS1 A;  1KM7 A;  2CHX A;  2AX5 A;  2JXT A;  2TSS A;  3CSF A;  4ZYN A;  1N5W A;  3CMM B;  5IKC M;  1C77 A;  1E5W A;  4AOF A;  2LUE A;  4WIP A;  1Z5S B;  1WZ0 A;  2JZ3 B;  4I6N B;  3PZD A;  2G3Q B;  1J7B A;  1T0R C;  4NAW B;  1WMH A;  1TZO A;  5H8Y E;  1WR1 A;  1VJK A;  2LGX A;  3LYY A;  4HDO A;  1YN4 A;  1IUE A;  2L8J A;  2J53 A;  2RDH A;  4AJY B;  1SSN A;  3U7Z A;  4CHK A;  4MM3 A;  4LK0 M;  1JWA D;  2AQ3 B;  3AN1 A;  4DHZ B;  1V86 A;  3IT6 B;  2NBV B;  1XLP A;  2LD9 A;  3JYU A;  3T8M A;  4DXA B;  2FID A;  2Z8L A;  1QOA A;  4A20 A;  1L4D B;  1NEK B;  1TS4 A;  1P0R A;  3UQA A;  1HA5 A;  2BYF A;  2JPH A;  3EC8 A;  3ZNI D;  3SDL C;  2HDE A;  3HIZ A;  2L32 A;  4LTU A;  3OJ3 A;  1TS3 A;  1FXT B;  3KVF B;  4XDD A;  4ZYS A;  2LHE A;  1PQS A;  4A8X C;  1MFW A;  5HG2 A;  3WCQ A;  1I4H A;  2WX1 A;  2KWD A;  3UIP B;  4GDK B;  5BMI A;  1ET9 A;  1C78 A;  5CX3 A;  3IBE A;  3H9D A;  4MEM A;  2ACZ B;  2V4I B;  3AB5 A;  3SFD B;  1WGY A;  1GG3 A;  3V6C B;  3EA6 A;  1FNU A;  3T3N A;  2LAS A;  1RFK A;  1ROE A;  1WM3 A;  2HJ1 A;  2PVO D;  5KHQ A;  5AZH A;  1N6Z A;  2RPQ A;  2QCZ A;  3NZS A;  2LFI A;  3DBR B;  3ZJT A;  2WU2 B;  2G45 B;  1A5R A;  4KV2 A;  4ANU A;  1HTO A;  2K6Q A;  4NJ7 A;  1P7E A;  2VRR B;  3DWG C;  4WUR A;  5AEK B;  4BOS C;  1T5X D;  3Q8C A;  3JVZ X;  5D3D A;  1GUA B;  4BZA A;  3NJT A;  3AEC B;  5CTR C;  2LEK A;  3QK0 A;  4DHJ D;  3TIX A;  3HM6 X;  3WAP A;  4C4V A;  3AV8 A;  3TSS A;  4A3O A;  4HPP A;  3RNC C;  5LXI B;  2K22 A;  1DGJ A;  3Q8F A;  1RLF A;  4MJS B;  1P98 A;  1HQR D;  2D3B A;  3RNF C;  1YOV B;  3N9Y C;  1LGR A;  1VR9 A;  2WNM A;  1WX9 A;  3GP7 A;  3RNB C;  3ZO5 B;  1TS5 A;  1FD6 A;  2L05 A;  5JXV A;  1BT0 A;  4KGS A;  4RF0 A;  2KDE B;  4C56 C;  2BB6 A;  2C60 A;  2FCM A;  3RZF A;  3VR8 B;  3NVY A;  2W54 A;  3AE9 B;  3N1Y C;  4KDI C;  1P1A A;  2KDI A;  5C1Z A;  3Q8A A;  4FN2 A;  2M8S A;  4JLC A;  1PFD A;  3DWM A;  2L0F A;  5G5G A;  2MBE A;  5D3I B;  1V97 A;  1J7C A;  3JW0 X;  2WQY B;  3PV1 A;  1E9M A;  3TEX A;  2PE9 A;  2LXC A;  4HJG E;  1BML C;  2WXP A;  1ZXI A;  4K7U A;  1TT5 B;  2RSU A;  2JF5 A;  4XYC A;  1AYF A;  1WXQ A;  1WGG A;  4P1C C;  4RGM A;  3DBL I;  4BOZ B;  3W1Y A;  3P1M A;  3S2A A;  3J9C A;  3TEZ A;  1SEB D;  4LDT D;  1VLB A;  4GDL A;  2HTM E;  1DOY A;  3DQV A;  1WXS A;  1VDV A;  4GLS C;  4HXD A;  3BWU D;  1AWD A;  3MHZ A;  3APD A;  3K9P B;  4HCN B;  1AW7 A;  1F0Z A;  4DK5 A;  2WU5 B;  1UWX A;  1UF0 A;  4WAF A;  4G50 A;  2MBO A;  4BAX A;  4B95 A;  2DZI A;  3FIL A;  3R2I A;  2D3C A;  1KH0 A;  1MG4 A;  4G3X B;  1EWC A;  3P2B A;  4DXG A;  3N3K B;  2QDF A;  3L13 A;  2KFK B;  4WH4 A;  5BMH A;  3SD5 A;  2JVC A;  1E7V A;  3HRD D;  4A9A A;  5JH5 C;  4M8N A;  1VD2 A;  3NZ3 A;  2D5G A;  3B0A A;  2GMI C;  4A90 A;  1GOZ A;  2IO3 B;  2LGY A;  2O2V A;  2WYQ A;  2M0A A;  4L23 A;  2C5L C;  4N58 A;  2Y5B B;  2KWU B;  1I4Q A;  3Q69 A;  2W9N A;  3U8Z A;  1JQ4 A;  4FHK A;  2ZVO A;  3UGB B;  1F1H A;  4AJW A;  2DWQ A;  1VZ8 A;  3DVG Y;  1FRD A;  2CJO A;  2KMM A;  4KZ0 A;  2XN9 C;  2KAN A;  1OGW A;  1OTR B;  4W9H A;  3UQB A;  2IY1 B;  4LNF A;  1GB4 A;  1EUV B;  3R66 C;  2GOW A;  1SXT A;  1MJD A;  1JRU A;  3EHV A;  2KTR A;  1L0Y B;  1S3S G;  1SE4 A;  3N1Z C;  2WXO A;  1I7H A;  3TCA A;  1QOB A;  2XK5 B;  3NHE B;  4M0W B;  1QOG A;  2RDG A;  4JWU C;  4MDK E;  1EO6 A;  1QQR A;  2KJH B;  5EE9 A;  2BTE A;  4IC7 B;  3MTN B;  2GBK A;  4UDU C;  2J0M A;  2K8C A;  4WWM A;  1V1P A;  3AE3 B;  1QOF A;  2BF8 B;  2ZNV B;  3C8Y A;  1QIL A;  3IT4 B;  1EU3 A;  2DLB A;  3DVN U;  3ZJU A;  4EKU A;  5G2N A;  3A9K B;  4W9E A;  3L4P A;  3H6N A;  2ZW0 A;  5HHD G;  4YWG G;  1UZX B;  2KDF B;  4TQ0 A;  5E6N A;  1SIF A;  1IPG A;  3DOW A;  4CO7 A;  1XCT L;  1GPX A;  4GN1 A;  1ZPS A;  4BKS A;  2INN E;  4BKS D;  2D10 A;  2MQJ A;  2FUH B;  4HKZ E;  2ZW1 A;  3A33 B;  2QHO A;  2MRP A;  1WGH A;  4HLE A;  2RDB C;  3NVZ A;  3ENE A;  3OAW A;  2I1K A;  1L4Z B;  4M00 A;  1KRH A;  3RCZ A;  5CHF A;  3AE8 B;  4FXC A;  3ZRF A;  2D3A A;  2QIE B;  4C7Z A;  4HRS A;  4URK A;  4NAW A;  2AEH A;  3CST A;  3TBL D;  4FJV B;  4YSZ B;  5FR3 A;  5BO4 B;  1SBB B;  2BS4 B;  3PRM B;  4XWW A;  4FAD A;  3ALB A;  1E8W A;  4P6V F;  2VH2 A;  2NCN A;  1DOX A;  1DOI A;  1OQQ A;  4OZB A;  2L00 B;  2CJN A;  2WLB A;  3ZLZ A;  3DHI C;  4YSY B;  1IP9 A;  3NVW A;  4LNO A;  1FMA D;  1UD7 A;  3P4R B;  4NJC A;  1YJJ A;  2WXJ A;  3QC8 B;  3VH3 B;  2N1W A;  2BKR B;  1YMH E;  2BYV E;  2R61 A;  1RAX A;  4XX5 A;  5DPR A;  1JAL A;  2HE7 A;  3ZVV A;  2JX5 A;  2YVC A;  1ZUD 2;  3DVG X;  4D2K A;  3B2F A;  1KF6 B;  2KVZ A;  2X8X X;  2INC C;  1QF6 A;  2JYE A;  2OHF A;  1E8Y A;  4JX1 C;  3SFE B;  3A4S C;  2MBB B;  4GDK A;  3X0W A;  3AE6 B;  1NDD A;  4GOC A;  2EMT A;  1VZ7 A;  2DAF A;  3ABV B;  1STE A;  2ZPN A;  5GMV A;  2KKC A;  3LJ3 A;  2WXH A;  1WXV A;  2K9X A;  1HXY D;  1FCC C;  1WM2 A;  5E6J A;  3Q3N C;  4GB9 A;  2PMV A;  2Y3A A;  1T0Y A;  1WGD A;  3ZDT A;  3HM3 A;  3AEF B;  3Q8E A;  4EUT A;  2HJ8 A;  3RNG C;  4NJ6 A;  4BBN F;  2LGD A;  2JYT A;  3AUL A;  4ARI A;  1WJ6 A;  4HPM B;  4YTP B;  4MH0 E;  4XE0 A;  2BVC A;  2L83 A;  1I4X A;  1DYQ A;  1CJE A;  4K81 A;  3QX1 A;  2FUG 1;  1WSP A;  1C79 A;  2JRI B;  4GU2 A;  4JGH B;  2GRI A;  2A4Z A;  2KX3 A;  3QAQ A;  3R7Q A;  4FUL A;  1J19 A;  1RYJ A;  2KQ7 A;  2M19 A;  2ZJD A;  4MJS A;  1K50 A;  2KAC A;  3H1U A;  4AUQ C;  1P9D U;  1C9F A;  4I6L B;  2MBQ A;  3HUI A;  3HK0 A;  5BYQ A;  2XNA C;  3DDC B;  3R7R A;  3VVW B;  4NZL B;  3VHT C;  1WY8 A;  4MGY E;  1SE9 A;  3RD2 A;  3KWV A;  3PZ8 A;  5LNK 1;  1YN3 A;  4ZHP A;  3IFW B;  3ZW3 A;  2DAJ A;  2O6V B;  3Q8B A;  3NS1 A;  4EZJ A;  2BW2 A;  2ZEQ A;  4DHZ E;  2FNJ B;  1FFV A;  4F7Z A;  5AZF A;  2HTH A;  3VDZ A;  4YTM B;  2EKE C;  4EE2 A;  3MHS D;  3W5U B;  3VTV A;  3SHQ A;  2ZCC A;  1R4N I;  3VTU A;  1JWM D;  2VZK B;  3CIR B;  4JL9 A;  2FBW B;  4II2 B;  2QMT A;  3PVL A;  2KQ4 X;  3URY A;  2OOB B;  3N1X C;  2G4D B;  2MP2 B;  4WJO A;  2LVQ A;  1L0X B;  2K1F A;  3AEG B;  1MPE A;  3N32 A;  1J8C A;  3PTF C;  2KFJ A;  3MJW A;  5BMG A;  4PS7 A;  4IWQ A;  2IBI B;  2MH7 A;  1VCB A;  3CF6 E;  3FC4 A;  3RNA C;  3ZTD A;  4ZRJ A;  2MBH A;  4OVZ A;  1ISN A;  4K3B A;  2N9E B;  2ON8 A;  2J7Q B;  2KC1 A;  2KFK A;  5TR5 A;  4IG7 B;  4NPN A;  1IBX B;  4EZL A;  2J42 A;  1JRP A;  3BYY B;  1MI0 A;  1L0V B;  2R2O A;  2YEP F;  2IND C;  4HWI B;  2KT7 A;  4MT5 A;  4BFR A;  1FM0 D;  3KH0 A;  3PPA A;  1FIQ A;  1F2R C;  1R4N B;  1E7P B;  3GE8 C;  1E10 A;  2NTS A;  1ZW7 A;  2WHI A;  2L0T A;  2ZZP B;  5DPT A;  4W9C A;  3QWZ B;  2IGD A;  1TYG B;  1JWB D;  2JRH A;  5EE1 A;  1WXA A;  1XLN A;  1FXI A;  3BVG A;  1EF5 A;  3M63 B;  3ZRC A;  3R2T A;  3P63 A;  1ZDV A;  4XWT A;  1L5P A;  4JPS A;  1XLQ A;  3JSV B;  1CK1 A;  4KZC A;  5GXG B;  1V6E A;  2FCQ A;  3ECI A;  1UEL A;  2MLB A;  4E74 A;  2H89 B;  1I35 A;  1XXG A;  2Z0E B;  2XK5 A;  4M0W A;  2M1M A;  3HHM A;  2FIF A;  1TZ1 A;  1WI0 A;  2NR2 A;  1YQ4 B;  3RFZ B;  2MX2 A;  4O1N A;  1QKZ A;  4MAC A;  1UBI A;  1SJE D;  1V5T A;  3ZNG C;  2BKF A;  2RD0 A;  4YTN B;  3NRZ A;  4K7W A;  3RYT A;  5AUK A;  2XBB C;  4B9K A;  3FAH A;  1PGX A;  3W1S C;  4FJY A;  1Q5W B;  4ACF A;  2BYE A;  3ZKJ C;  3A9K A;  4WAA A;  5IAA C;  2DZM A;  3ZQ4 A;  2MJE A;  1I42 A;  1EWY C;  4IWO A;  1I4R A;  4NQK E;  3OG5 A;  1PYW D;  4OVU A;  1ZDX A;  3TL5 A;  3OLM D;  2WXM A;  4MM3 B;  3A1Q A;  2JY6 A;  4ANX A;  2ZVN A;  5IN7 A;  2BWE S;  4LNI A;  2LI5 A;  4NAM A;  4WJP A;  4E71 A;  2Y5C A;  3A9J B;  2I2Y A;  1OEY A;  2EMS A;  1EU4 A;  2AL6 A;  4RF1 A;  4IKG A;  3GOE A;  3O65 B;  1R7S A;  2MJ3 A;  3ZTC A;  2GBM A;  2SEB D;  4KIK B;  3L0W B;  1LFD A;  4TKN A;  3N30 A;  1MG8 A;  2V9H A;  4MSM B;  2Z0D B;  4WJQ A;  1ZE3 D;  1B9R A;  2C7N B;  3AEE B;  1AN8 A;  1IYF A;  1D5Z C;  4F1S A;  1NYQ A;  1ACC A;  4M02 A;  2QEJ C;  3I63 C;  1E8X A;  3MC8 A;  3PS6 A;  5FR6 A;  3HVD A;  4PYU A;  2WS3 B;  5AZG A;  2KD0 A;  2BB5 A;  3DBL B;  1FCL A;  2N1V A;  2IGG A;  1GC7 A;  2BYT A;  4ZOH C;  2C9W B;  1ZKH A;  3GZN I;  5LXH A;  2KXJ A;  5D2M B;  2AWT A;  1NEN B;  1YIW A;  1FFU A;  1E7U A;  3WA0 A;  1V8C A;  2IZV B;  2NPT B;  2JUO A;  4RGN A;  3PLU A;  1WZ3 A;  1NI3 A;  2WXI A;  2N4F A;  2A5U A;  4RMA A;  2MEK A;  1LO5 D;  3AE5 B;  3VH4 B;  4JE3 B;  1QLB B;  5HFY A;  1KLG D;  1V5O A;  2ZCB A;  4RCO A;  3LXF A;  2J52 A;  2KN4 A;  1LM8 B;  4JWS C;  3KQ4 A;  3BVM A;  3ZGZ A;  3Q3O C;  2DNF A;  2GLS A;  2N0S B;  2UWQ A;  1NBF C;  1WYG A;  2GI9 A;  4YL8 A;  3TEW A;  4ZRQ A;  2KC2 A;  5G5H A;  4PS3 A;  3K9O B;  1Q10 A;  3BVZ A;  2UU7 A;  2WXG A;  2KN5 A;  4EFO A;  5I4D A;  3BY4 B;  1WGR A;  2M56 B;  2N9X A;  1K53 A;  2MW5 A;  4MGK E;  3KWL A;  1LXD A;  3L17 A;  3ZUN A;  2H88 B;  1A70 A;  2YEP B;  2LGS A;  1FNW A;  3U52 E;  2KMC A;  3MC0 B;  3PHX B;  2RGF A;  3VQI A;  2WXK A;  2V3S A;  2V1Y A;  4USA A;  4ZRI A;  4ITK A;  4RM8 A;  1NVI D;  3WAN A;  2BT6 A;  3PHW B;  2C7H A;  3KUC B;  1UWM A;  3ZXR A;  2NMQ A;  2Z59 B;  2RPV A;  4OZA A;  2PPH A;  3I5J C;  4US8 A;  3B9J A;  1K52 A;  5EE3 A;  1T0Q C;  2LRW A;  2JSV X;  2M4N A;  3AU4 A;  2K6D B;  3V05 A;  2FE8 A;  1V1O A;  4M8M A;  4W9J A;  5IO9 A;  4KX6 B;  2CU3 A;  3PSE B;  3O13 A;  1MHX A;  3NOB A;  4GDL B;  2O6V A;  2O6V D;  3AE2 B;  2V3P A;  3VRB B;  4I6P A;  1TJE A;  1WFY A;  2L76 A;  1JWU D;  3LDZ E;  1TBE A;  4RM9 A;  1H8C A;  4YXD B;  5TSS A;  4EOY A;  2WXN A;  2CS4 A;  4IDI A;  3SR6 A;  1WH3 A;  3U7D A;  2JZZ A;  2WDQ B;  3M95 A;  4IW0 A;  1J7A A;  2WXR A;  3P4S B;  1EF1 A;  2WXF A;  2FAZ A;  2VZK D;  2N7D A;  2KJR A;  2JQR B;  1G6J A;  5C23 A;  1GJZ A;  2K8H A;  3AH7 A;  2PEA A;  2KQS A;  4W9L A;  4B0E A;  1KOT A;  3AE4 B;  4MSQ B;  2LZ6 A;  2J4X A;  3ZIM A;  2GBJ A;  4HJK A;  4KSK C;  5EDS A;  4L1B A;  4K3C A;  3E9S A;  1YN5 A;  3H7S A;  3ML9 A;  4FBJ B;  2G4S A;  3T3O A;  4HPL B;  2FCN A;  3MP9 A;  4TV3 A;  1SIJ A;  1N60 A;  2JU6 X;  1KLU D;  3VFK A;  3UIN B;  3V3X A;  2OJW A;  2PTL A;  3BII D;  1D4B A;  4QAY A;  1IBX A;  5L95 C;  3AEB B;  2KWC A;  1R4M I;  1JRO A;  3KUZ A;  1MVK A;  1F77 A;  1NYR A;  5DPW A;  1GNU A;  1HEZ E;  3RZW C;  5JHB A;  1XQQ A;  4ANV A;  2KTR B;  1CMX B;  4LNK A;  1YQB A;  1F2R I;  2PVG C;  2AL3 A;  2YLM A;  3SU8 X;  5J2R A;  4GMV A;  5DPS A;  5E6O A;  4FJZ A;  4FA6 A;  5BYR A;  4N9F 4;  5CHV C;  4CQN A;  2I38 A;  3APC A;  3T9L A;  3OJ4 B;  2KNB A;  2L52 A;  4G11 A;  5C2T B;  3UIO B;  3AXC A;  2N9P C;  2KLC A;  1YD8 U;  1TKE A;  3P42 A;  3DHG C;  2REX A;  1GC6 A;  2DHZ A;  4OVV A;  4PT5 A;  3JSV A;  4KGR A;  5EE0 A;  1OEY J;  4XGA B;  4JIO U;  1CQV A;  1L7Y A;  2BWF A;  3DCG A;  2LVO A;  1C76 A;  5T8I A;  1GB1 A;  1R4M B;  1E90 A;  4DQO C;  2DEN B;  2DBY A;  3X23 A;  4DBG A;  2E3T A;  5E6P A;  4ANW A;  4YT0 B;  1JML A;  1X1M A;  2NBU A;  2IYD B;  4WWO A;  2EEL A;  4HCP B;  3EEC A;  4EZK A;  4G0N B;  2IY0 B;  4P16 A;  1N61 A;  3RNE C;  3UI3 A;  4OZC A;  2M0X A;  4A6Q A;  4XC2 A;  2LUM A;  3HVZ A;  4J3O D;  2KZR A;  4N59 A;  1KFY B;  1F52 A;  4TMA B;  1QT9 A;  3NY5 A;  4HVB A;  4ZHO A;  4PYZ A;  3NZU A;  3P4Q B;  3Q3M C;  1WJ4 A;  2B76 B;  3BIN A;  4P1B C;  5MPO A;  1UGJ A;  3A9J A;  1M94 A;  3BYT B;  1HE8 A;  2CU1 A;  3DBR I;  3PRP B;  1ZP0 B;  2MSE D;  3L54 A;  2IGH A;  3WIM A;  3BK2 A;  2IO1 B;  3B2G A;  3KW5 B;  1Q1O A;  1XD3 B;  3ONS A;  2BS2 B;  4J6I A;  4LCD E;  1L6V A;  1UH6 A;  1FNV A;  3QCA A;  3R8B A;  5J18 A;  4KIK A;  4ZRP A;  1T3Q A;  5HKH A;  4NNJ B;  3NUH B;  2UYZ B;  2LHD A;  1UNS A;  4ICV A;  1S1Q B;  1PDX A;  2J0K A;  2M17 A;  2PLP A;  2JT4 B;  3AMZ A;  3RI7 C;  2ZPY A;  3W9C B;  3NVV A;  3ZNH B;  1WJN A;  2PJH A;  4W9I A;  4GIV A;  4TSS A;  3QQ8 B;  1TKY A;  4L2Y A;  3KUD B;  2RR9 A;  2LXA A;  2LVP A;  5BYS A;  4HKQ A;  4KSL C;  1KTK A;  2B3A A;  4HEA 1;  1TIF A;  4S17 A;  4EEW A;  4LLG M;  2Q5W D;  2NTT A;  5DCN A;  1FEH A;  1XLO A;  1J0G A;  5G55 A;  4TQ1 A;  1Y56 A;  3APF A;  2GBR A;  2NPT A;  1K51 A;  2KHW B;  1MHH E;  5KHO A;  3PGE A;  3H7P B;  2ONQ A;  2WXQ A;  3ZXV A;  2D11 A;  2DX5 B;  3V62 A;  1K8R B;  3VRA B;  3GE3 C;  2XEW A;  1RWS A;  1V49 A;  2MJD A;  1TGZ B;  1NI2 A;  1FPY A;  4MEL A;  2KAJ A;  3VUW A;  3VR9 B;  3PRE A;  2RMM A;  3V6E B;  2K8B A;  3TUO A;  1P3Q U;  2JXX A;  1D5X C;  2KVR A;  3IVF A;  1C4A A;  4H2A A;  2INP E;  5D7G A;  4B6W A;  3NG0 A;  1YX5 B;  1V9J A;  2QJL A;  3RUL A;  3IG3 A;  3AE7 B;  3ML8 A;  2BPS A;  3U2S C;  1FRR A;  3AI5 A;  3VAW A;  1BXT A;  1WX8 A;  1WE6 A;  4ZRK A;  4HRO A;  4LNN A;  2KJ6 A;  1OQR A;  2IO0 B;  1XEE A;  2MCN B;  1E8Z A;  2OJR A;  2V0G A;  1ZOY B;  1TS2 A;  4C7Y A;  4K1R B;  4FHJ A;  2J0J A;  4IM2 A;  1WMH B;  4S0R A;  1UBQ A;  3V60 A;  3RPF C;  4XZ4 A;  1QZE A;  2DZK A;  2BS3 B;  2L1A A;  2QSD A;  3KLS X;  2ICI A;  1I4P A;  3PZ7 A;  4NQL B;  3KYD D;  2CR5 A;  4WQM A;  4RGT A;  4US9 A;  4A3P A;  3GB1 A;  3DBH I;  1WWT A;  4ARC A;  1SB3 C;  3U30 A;  4F8C B;  4RH6 A;  2KK8 A;  5JZE B;  2WP9 B;  4WWP A;  2G1E A;  4REZ A;  3VUX A;  1BUI C;  1TKG A;  2DYM A;  1PGA A;  2WWZ A;  2V3N A;  2N7E A;  2CKH B;  1CZP A;  1UUP A;  1VZ6 A;  2AQ1 B;  3QJZ A;  2LJI A;  1D3Z A;  3CWI A;  1H4R A;  3IAM 1;  1LQB A;  4GGQ A;  1WYW B;  2W55 A;  2DYB A;  1KJT A;  1V2Y A;  5AUI A;  2K25 A;  4E3C A;  3Q2A C;  2JZP A;  4B0M A;  3DPD A;  2W82 A;  1TTN A;  2K3U A;  2PIA A;  2GBN A;  3QAR A;  2LRU A;  1C4P A;  1WR6 E;  3DVN V;  2LWP A;  3W2D A;  1WJU A;  4K7S A;  3U4E G;  2KOX A;  4DWF A;  4GXB A;  5C3J B;  3WAO A;  3ZDM C;  2WXL A;  3BZD B;  3AED B;  3I57 A;  1WGK A;  4IM0 A;  3DBH B;  1T6B X;  2G9H D;  4TUU A;  1N5X A;  4ZDV A;  2LJ5 A;  3TEY A;  1F9J A;  3IAS 1;  2KMA A;  1HTQ A;  4M01 A;  1GAQ B;  5IP4 D;  2KTF A;  1M4V A;  3Q3J A;  3WAL A;  3H8H A;  2HD5 B;  4DDG D;  3Q3F A;  3N20 C;  4DXF A;  2CHW A;  4AWJ A;  4LJO B;  2N9K A;  2V4L A;  1B1Z A;  2CHZ A;  4AQ7 A;  2D07 B;  1T0S C;  1XO3 A;  2MA9 B;  3MJ5 A;  1L2N A;  2DYO A;  3VUY A;  1C1Y B;  1IGC A;  4BKG A;  1WF9 A;  1N62 A;  4DHJ B;  2LGI A;  1TY2 A;  3C19 A;  1Z2M A;  1YJI A;  4C4V B;  2KX0 A;  3ZYY X;  3AEA B;  4II3 B;  2N7J A;  3RT3 B;  1IGD A;  3PRZ A;  4BBN C;  3A4R A;  5FKA C;  1V81 A;  3EFU A;  1WRD B;  3PT2 B;  2QC8 A;  3MFG A;  1WX7 A;  2KDB A;  5FK9 C;  3V61 A;  4MGZ E;  4IUM B;  5LLI A;  3M62 B;  1N63 A;  2E6X A;  1L6U A;  4C80 A;  3GZN B;  1PUT A;  4RFB A;  1E6E B;  2KDM A;  3DHH C;  3L10 B;  2OED A;  1D5M C;  2X38 A;  4MH8 A;  1ET6 A;  1RRB A;  1SF0 A;  1JCK B;  1WRI A;  3NS8 A;  2D2Q A;  3KYC D;  4ASW C;  1C4C A;  4ICU A;  5H92 C;  2WDT B;  1I4G A;  4AP4 C;  5IOI A;  3A1Q B;  4XDC A;  3FKY A;  2FCS A;  1VRA B;  1XT9 B;  4LDT B;  3PLV A;  1HZ5 A;  5IA7 A;  3R3M A;  1YQ3 B;  4LJP B;  2WDR B;  4KKI A;  2L3Z A;  1U4A A;  4KKJ A;  3FIL B;  1ZGU B;  5L83 A;  5D94 A;  3UF8 A;  3QIJ A;  2W3R A;  4KDL B;  1FXA A;  3VTW A;  1RM6 C;  2D3G A;  4RNA A;  1YX6 B;  3RMK C;  2MHJ A;  1HZ6 A;  1ESF A;  3B1L X;  2ASQ A;  4OW0 A;  4W9G A;  4W9K A;  2VH1 A;  3VXW A;  3RN9 C;  3AE1 B;  1WE7 A;  2K0P A;  2BBC A;  1ZXH A;  4RGO S;  3BK1 A;  5D6J B;  3PO0 A;  2MP2 A;  3GS2 A;  1ENF A;  2C7M B;  4FLH A;  2IPK D;  2K5P A;  1KLV A;  2O2V B;  3AM9 A;  1RFA A;  2ZNV C;  2WX0 A;  2I1J A;  3ETR A;  3Q14 C;  3P4P B;  4NY0 A;  3AU5 A;  3I9V 1;  4OHJ A;  4DDI D;  3M3J A;  4P7I A;  4YSX B;  1SE3 A;  4W9D A;  4GSW A;  2W3S A;  1C3T A;  2PKO A;  2IJ0 A;  2K39 A;  1P7F A;  2JWU A;  3DBS A;  5HI1 A;  3TMP B;  2SAK A;  2MWS B;  2NS5 A;  2AQ2 B;  1E0Z A;  2N9L A;  4WQO B;  2Y5P A;  4CYE A;  3IXS A;  4JQW C;  3W1S A;  1D6E C;  3WAM A;  2IO2 B;  2GB1 A;  2JWZ A;  1PGB A;  1AAR A;  4WJN A;  3EGR A;  4HK2 A;  3C0R B;  2PE6 B;  4X57 B;  4HDQ A;  1V80 A;  2IDY A;  3ZJV A;  4PK1 A;  3I3T B;  1XF5 L;  2BGF A;  3TJP A;  4KGT A;  4KVG B;  1OFF A;  2KYW A;  3L08 A; 
#chains in the Genus database with same CATH homology
 1S1Q B;  2J0K A;  2M17 A;  3A9J B;  2JT4 B;  1OEY A;  1UZX B;  2KDF B;  2ZPY A;  4TQ0 A;  1Q0W B;  2EMS A;  4IM3 A;  3QHT A;  2AL6 A;  5E6N A;  3ZNH B;  4IWP A;  1SIF A;  1WJN A;  4MGI E;  3GOE A;  2PJH A;  3O65 B;  4W9I A;  3D32 A;  1IPG A;  4GIV A;  2NVU I;  4BVU C;  3QQ8 B;  5CHW A;  3DOW A;  4CO7 A;  3ZTC A;  2L7R A;  3ZNZ B;  3KUD B;  2RR9 A;  2LXA A;  4GN1 A;  2GBM A;  3IHP C;  4BKS A;  4W9F A;  3H7P A;  4BKS D;  2D10 A;  4KIK B;  1Y8R C;  2AYO B;  3L0W B;  1LFD A;  2LVP A;  4WWN A;  1UGM A;  2MQJ A;  4KSL C;  4TKN A;  2FUH B;  3N30 A;  3QA8 A;  1MG8 A;  4BKT A;  5J17 A;  2B3A A;  3RUI B;  2KWV B;  4MSM B;  3A33 B;  2Z0D B;  1SGH A;  2QHO A;  2MRP A;  4WJQ A;  4EEW A;  1WGH A;  4HLE A;  2C7N B;  3OAW A;  3ENE A;  3L16 A;  2I1K A;  1IYF A;  1YJ1 A;  5DCN A;  4F1S A;  1J0G A;  5G55 A;  3RCZ A;  5JHA A;  5CHF A;  4TQ1 A;  2NBW B;  2R2Q A;  2KO3 A;  3ZRF A;  3APF A;  2GBR A;  1OQY A;  2KLG A;  2NPT A;  4URK A;  1E8X A;  4NAW A;  2KHW B;  4PS8 A;  2AEH A;  5KHO A;  3PGE A;  3CST A;  3H7P B;  2DZJ A;  3PS6 A;  5FR6 A;  1WXM A;  1WIA A;  3B08 A;  4FJV B;  4PYU A;  3TBL D;  5BO4 B;  2D11 A;  5AZG A;  2DX5 B;  3V62 A;  1KM7 A;  2KD0 A;  2CHX A;  3PRM B;  1K8R B;  4FAD A;  3ALB A;  1E8W A;  3CSF A;  2N1V A;  2NCN A;  2XEW A;  4ZYN A;  1V49 A;  3CMM B;  1GC7 A;  1NI2 A;  1TGZ B;  2C9W B;  1E5W A;  2L00 B;  1ZKH A;  4MEL A;  3GZN I;  3VUW A;  4AOF A;  5LXH A;  2KXJ A;  3PRE A;  2LUE A;  5D2M B;  2AWT A;  3V6E B;  3ZLZ A;  2K8B A;  1YIW A;  1E7U A;  1WZ0 A;  1Z5S B;  2JZ3 B;  3WA0 A;  1IP9 A;  2IZV B;  1P3Q U;  4I6N B;  3PZD A;  2JXX A;  2KVR A;  1UD7 A;  2G3Q B;  2NPT B;  2JUO A;  4NAW B;  3IVF A;  1WMH A;  1WZ3 A;  3PLU A;  2N4F A;  1WR1 A;  2A5U A;  2LGX A;  4HDO A;  4RMA A;  3QC8 B;  3VH3 B;  5D7G A;  2N1W A;  2BKR B;  2BYV E;  4B6W A;  1YX5 B;  1V9J A;  2L8J A;  1RAX A;  3RUL A;  3IG3 A;  4XX5 A;  5DPR A;  3VH4 B;  2HE7 A;  3ZVV A;  3ML8 A;  2BPS A;  4AJY B;  2YVC A;  3DVG X;  3AI5 A;  4MM3 A;  3VAW A;  1V5O A;  4CHK A;  2ZCB A;  1WX8 A;  1WE6 A;  4ZRK A;  4DHZ B;  1V86 A;  1LM8 B;  2KJ6 A;  2NBV B;  2IO0 B;  2MCN B;  2LD9 A;  1E8Z A;  2OJR A;  3JYU A;  3T8M A;  4K1R B;  4DXA B;  1E8Y A;  2J0J A;  4FHJ A;  4IM2 A;  1WMH B;  3V60 A;  1UBQ A;  2FID A;  2UWQ A;  3A4S C;  4XZ4 A;  1QZE A;  4A20 A;  2MBB B;  2DZK A;  1NBF C;  4YL8 A;  4GDK A;  1P0R A;  2KC2 A;  3X0W A;  3UQA A;  1NDD A;  4PS3 A;  3K9O B;  2BYF A;  2JPH A;  2EMT A;  4GOC A;  2DAF A;  3EC8 A;  2ZPN A;  4NQL B;  3KYD D;  3SDL C;  3ZNI D;  2KN5 A;  5GMV A;  4EFO A;  2CR5 A;  2KKC A;  3BY4 B;  3HIZ A;  4A3P A;  3LJ3 A;  1WGR A;  3OJ3 A;  1WXV A;  3DBH I;  1FXT B;  2N9X A;  3KVF B;  3U30 A;  2MW5 A;  1WM2 A;  4MGK E;  4F8C B;  4GB9 A;  1LXD A;  1PQS A;  2KK8 A;  1T0Y A;  1WGD A;  5JZE B;  3ZDT A;  3L17 A;  4WWP A;  3ZUN A;  2WX1 A;  3VUX A;  3HM3 A;  3UIP B;  4EUT A;  4GDK B;  2DYM A;  2HJ8 A;  2KMC A;  4NJ6 A;  2WWZ A;  3PHX B;  4BBN F;  2LGD A;  2N7E A;  3AUL A;  2CKH B;  5CX3 A;  3IBE A;  2RGF A;  3VQI A;  1WJ6 A;  3H9D A;  4MEM A;  2V3S A;  4HPM B;  2V1Y A;  3QJZ A;  1D3Z A;  4MH0 E;  4ZRI A;  1WGY A;  1H4R A;  4RM8 A;  3WAN A;  1GG3 A;  3PHW B;  3V6C B;  1LQB A;  4GGQ A;  1WYW B;  2C7H A;  3KUC B;  2Z59 B;  2DYB A;  4K81 A;  3QX1 A;  2LAS A;  2PPH A;  1KJT A;  1V2Y A;  2K25 A;  1WM3 A;  2JRI B;  4E3C A;  5KHQ A;  4GU2 A;  4JGH B;  2LRW A;  5AZH A;  2RPQ A;  2M4N A;  3NZS A;  2A4Z A;  3AU4 A;  2K6D B;  3DPD A;  2KX3 A;  4M8M A;  4W9J A;  1TTN A;  2GBN A;  3QAR A;  2LRU A;  3PSE B;  3QAQ A;  3R7Q A;  2G45 B;  1A5R A;  1WR6 E;  4KV2 A;  4FUL A;  1J19 A;  4ANU A;  3NOB A;  4GDL B;  3DVN V;  2KQ7 A;  2O6V A;  2K6Q A;  2O6V D;  4NJ7 A;  2LWP A;  1WJU A;  2VRR B;  4K7S A;  2ZJD A;  5AEK B;  4BOS C;  4MJS A;  3H1U A;  4I6P A;  1P9D U;  4AUQ C;  4I6L B;  2KOX A;  2MBQ A;  4DWF A;  3HK0 A;  4GXB A;  3WAO A;  1WFY A;  3ZDM C;  2L76 A;  3JVZ X;  3LDZ E;  1TBE A;  4RM9 A;  1GUA B;  1H8C A;  4IM0 A;  4EOY A;  3DDC B;  2CS4 A;  3R7R A;  3U7D A;  1WH3 A;  5CTR C;  4TUU A;  2JZZ A;  3VVW B;  2LJ5 A;  4ZDV A;  1F9J A;  3VHT C;  2KMA A;  3M95 A;  3QK0 A;  4IW0 A;  1WY8 A;  4MGY E;  1SE9 A;  4DHJ D;  3RD2 A;  3HM6 X;  3TIX A;  3WAP A;  2KTF A;  1EF1 A;  4A3O A;  3Q3J A;  3WAL A;  2FAZ A;  2HD5 B;  3IFW B;  4DDG D;  3Q3F A;  2N7D A;  2KJR A;  3ZW3 A;  1G6J A;  2CHW A;  5LXI B;  2DAJ A;  2O6V B;  5C23 A;  4AWJ A;  4LJO B;  4EZJ A;  2ZEQ A;  1RLF A;  2V4L A;  4MJS B;  4DHZ E;  1P98 A;  2FNJ B;  2CHZ A;  1GJZ A;  2K8H A;  2D07 B;  4F7Z A;  5AZF A;  2HTH A;  2PEA A;  2KQS A;  2MA9 B;  4W9L A;  3VDZ A;  1L2N A;  1KOT A;  2DYO A;  1WX9 A;  4MSQ B;  2LZ6 A;  3ZO5 B;  3VUY A;  3ZIM A;  1C1Y B;  2GBJ A;  2L05 A;  4BKG A;  2EKE C;  4HJK A;  4KSK C;  1BT0 A;  3MHS D;  2KDE B;  1WF9 A;  3VTV A;  5EDS A;  3SHQ A;  2ZCC A;  2C60 A;  2FCM A;  4DHJ B;  3RZF A;  1Z2M A;  1R4N I;  2KX0 A;  3H7S A;  3VTU A;  3ML9 A;  4FBJ B;  4KDI C;  2G4S A;  1P1A A;  2KDI A;  4HPL B;  2FCN A;  4TV3 A;  4II3 B;  4JL9 A;  5C1Z A;  3RT3 B;  3PRZ A;  4BBN C;  4FN2 A;  3A4R A;  4II2 B;  3VFK A;  1V81 A;  3EFU A;  3PVL A;  3UIN B;  1WRD B;  2M8S A;  3PT2 B;  4JLC A;  2L0F A;  2OOB B;  1WX7 A;  2KDB A;  2G4D B;  2MP2 B;  4MGZ E;  3V61 A;  4IUM B;  4WJO A;  2MBE A;  3JW0 X;  2LVQ A;  5LLI A;  2K1F A;  3M62 B;  5L95 C;  3PV1 A;  3N32 A;  1J8C A;  2KWC A;  1R4M I;  2PE9 A;  2LXC A;  3KUZ A;  3PTF C;  2KFJ A;  3MJW A;  4K7U A;  2RSU A;  2JF5 A;  4PS7 A;  1GNU A;  5DPW A;  4IWQ A;  3RZW C;  2IBI B;  1VCB A;  3CF6 E;  5JHB A;  3ZTD A;  1XQQ A;  4ZRJ A;  2KTR B;  4ANV A;  2MBH A;  1CMX B;  1WGG A;  1ISN A;  1YQB A;  2N9E B;  3DBL I;  3L10 B;  4BOZ B;  3SU8 X;  2AL3 A;  2YLM A;  3W1Y A;  5J2R A;  3S2A A;  2J7Q B;  4GMV A;  2KC1 A;  2KFK A;  5DPS A;  5TR5 A;  4LDT D;  4IG7 B;  4NPN A;  4GDL A;  5E6O A;  4FJZ A;  1RRB A;  4EZL A;  4FA6 A;  3DQV A;  4N9F 4;  1WXS A;  5CHV C;  4HXD A;  3APD A;  3K9P B;  2R2O A;  3NS8 A;  4HCN B;  4DK5 A;  4HWI B;  2D2Q A;  4G50 A;  2MBO A;  3KYC D;  3APC A;  3T9L A;  4B95 A;  4BFR A;  3KH0 A;  2DZI A;  3OJ4 B;  3PPA A;  4ASW C;  2KNB A;  4G11 A;  3UIO B;  3AXC A;  4ICU A;  2N9P C;  2KLC A;  4G3X B;  1YD8 U;  2WDT B;  3P2B A;  2REX A;  4AP4 C;  3N3K B;  1ZW7 A;  1GC6 A;  3A1Q B;  2DHZ A;  3L13 A;  4OVV A;  2FCS A;  2KFK B;  1XT9 B;  3JSV A;  2L0T A;  3PLV A;  2ZZP B;  2JVC A;  4LDT B;  3SD5 A;  1E7V A;  5IA7 A;  5JH5 C;  5DPT A;  4M8N A;  4W9C A;  3QWZ B;  3R3M A;  1OEY J;  1VD2 A;  4LJP B;  4JIO U;  1L7Y A;  2JRH A;  3B0A A;  2GMI C;  2BWF A;  2IO3 B;  2LGY A;  2LVO A;  3DCG A;  2O2V A;  1E90 A;  2L3Z A;  2WYQ A;  1U4A A;  1ZGU B;  2C5L C;  5L83 A;  1WXA A;  2Y5B B;  5D94 A;  3QIJ A;  2KWU B;  4KDL B;  3UF8 A;  2DEN B;  1EF5 A;  3VTW A;  3M63 B;  3ZRC A;  3X23 A;  2D3G A;  4DBG A;  1YX6 B;  5E6P A;  4ANW A;  2W9N A;  1X1M A;  3U8Z A;  4FHK A;  3B1L X;  2ASQ A;  2ZVO A;  4W9G A;  2NBU A;  3UGB B;  4W9K A;  4AJW A;  3JSV B;  4KZC A;  3VXW A;  2IYD B;  4WWO A;  1V6E A;  4HCP B;  1WE7 A;  3DVG Y;  3EEC A;  2FCQ A;  4G0N B;  4EZK A;  3ECI A;  1UEL A;  2MLB A;  2IY0 B;  4E74 A;  5D6J B;  1I35 A;  2MP2 A;  2Z0E B;  2XK5 A;  4KZ0 A;  2C7M B;  2M0X A;  4FLH A;  2M1M A;  3HHM A;  2KAN A;  1OGW A;  1KLV A;  2O2V B;  4XC2 A;  1OTR B;  4W9H A;  2FIF A;  1RFA A;  1TZ1 A;  1WI0 A;  2KZR A;  2I1J A;  2NR2 A;  2WX0 A;  2ZNV C;  2IY1 B;  3UQB A;  2MX2 A;  1EUV B;  1UBI A;  4NY0 A;  1V5T A;  3AU5 A;  3R66 C;  2GOW A;  4DDI D;  3ZNG C;  2BKF A;  1JRU A;  3M3J A;  3EHV A;  2RD0 A;  4P7I A;  2KTR A;  4K7W A;  4GSW A;  3NY5 A;  4W9D A;  4HVB A;  4PYZ A;  3RYT A;  1C3T A;  1S3S G;  3NZU A;  2XBB C;  4B9K A;  2K39 A;  3W1S C;  4FJY A;  1Q5W B;  3TCA A;  3DBS A;  2XK5 B;  1WJ4 A;  2BYE A;  3TMP B;  3NHE B;  3ZKJ C;  3A9K A;  4M0W B;  3BIN A;  2MWS B;  2NS5 A;  4WAA A;  4MDK E;  5IAA C;  2DZM A;  4WQO B;  1EO6 A;  3A9J A;  1M94 A;  4CYE A;  4JQW C;  1HE8 A;  2KJH B;  2CU1 A;  3DBR I;  3W1S A;  3PRP B;  3WAM A;  1I42 A;  2MSE D;  4IC7 B;  3L54 A;  2IO2 B;  3MTN B;  3WIM A;  4IWO A;  2JWZ A;  2GBK A;  2IO1 B;  1AAR A;  3KW5 B;  4WJN A;  4NQK E;  1Q1O A;  1XD3 B;  2J0M A;  2K8C A;  3ONS A;  4HK2 A;  4J6I A;  4LCD E;  3C0R B;  1UH6 A;  2BF8 B;  2ZNV B;  4OVU A;  3TL5 A;  3QCA A;  2PE6 B;  3OLM D;  5J18 A;  4KIK A;  4X57 B;  4HDQ A;  3A1Q A;  1V80 A;  2JY6 A;  2ZVN A;  4ANX A;  2BWE S;  2LI5 A;  3DVN U;  3I3T B;  4EKU A;  5HKH A;  3TJP A;  2BGF A;  4WJP A;  4KVG B;  4NNJ B;  5G2N A;  3A9K B;  4E71 A;  2UYZ B;  4W9E A;  3H6N A;  4ICV A;  3L08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...