2JVCA

Nmr solution structure of ubiquitin like protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
82
Chain Sequence
GPLGSMQIFVKTLTGKTITIDVDHADTVGAVKAKIYDKEGIPPDQQRLIFGGKQLEDSNAMSDYNVQKESTLHLVLRLRGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords ubiquitin_like protein
publication title NMR solution structure of ubiquitin like protein
rcsb
total genus 11
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jvcA00
2IYDB 1GNUA 2Z59B 2LVOA 3AU5A 2VRRB 3ENEA 1I35A 4TQ0A 1OQYA 3RYTA 1EO6A 1E8WA 4KVGB 2G3QB 3JW0X 2BGFA 2CHWA 5E6PA 2KK8A 4MGZE 4KDIC 4EOYA 2GBJA 1P3QU 2LI5A 2ZNVB 3WANA 2C7MB 4FJZA 2OJRA 3ZNHB 4AJYB 1L2NA 4FJYA 1Q0WB 2MRPA 2K25A 4RMAA 2Z0DB 3H1UA 2K6DB 2ZZPB 2KX0A 1CMXB 4GDLA 4LJOB 4E3CA 2V3SA 3V6CB 4W9JA 2PEAA 2KLGA 1V86A 2AL3A 2NVUI 3PHXB 3QHTA 3H6NA 3UGBB 1SIFA 4BKGA 2C9WB 3N30A 2G4DB 4BKSD 4TKNA 2DYOA 4XX5A 5CHVC 1GG3A 2GBKA 4I6LB 2FAZA 2K8BA 1S1QB 2D10A 3RT3B 4IW0A 4HK2A 3VFKA 2GBNA 4WJPA 3EECA 3T9LA 3IHPC 1R4NI 2MBOA 3TMPB 1WR1A 2KXJA 4WJQA 2L0FA 2MW5A 3WAOA 1IYFA 4HCNB 2KNBA 3UIOB 3ZNID 2D11A 5HKHA 3D32A 5DCNA 3L16A 1EUVB 1WYWB 3EHVA 4KZ0A 1WZ3A 3VDZA 5EDSA 1KLVA 4B6WA 2KTRB 3ZLZA 2JXXA 4ANUA 4HWIB 4IWQA 2XK5A 3K9PB 3DOWA 2BYFA 3KYCD 3VH3B 2PPHA 2LGXA 1WI0A 2NPTA 1X1MA 2KFKA 3PREA 4MH0E 4HCPB 1TGZB 1JRUA 2ZPYA 3L13A 3RD2A 1P9DU 2LVQA 3MTNB 2DENB 5G55A 3R3MA 3ZVVA 2KWVB 4BFRA 3Q3FA 3APCA 1E90A 4P7IA 2J7QB 1NI2A 5E6OA 5AZFA 3A9KB 3QA8A 3ONSA 4AP4C 4DDGD 3RZWC 4G3XB 1OGWA 3I3TB 4IM3A 3V61A 2FIFA 2IZVB 2V1YA 5GMVA 1YIWA 2LASA 2AEHA 1P1AA 1C1YB 3PT2B 3PTFC 4ANVA 4GSWA 3HK0A 1MG8A 2FCNA 2KDBA 4GDKB 3RZFA 2N9EB 2DX5B 4MJSB 4URKA 3WIMA 1GC7A 2D07B 2OOBB 1OEYA 2NBUA 3O65B 2DZMA 2G45B 3VVWB 1WFYA 4MSQB 3HHMA 4WQOB 1V5OA 1RRBA 2FCQA 2MA9B 2KQSA 2KX3A 4DDID 2LXAA 4TV3A 3NS8A 2UWQA 5IA7A 2PE6B 3ZKJC 2N1VA 3QK0A 2Z0EB 2JZZA 2LRUA 4PYZA 4BBNC 2MBHA 4FBJB 2FUHB 2HJ8A 2J0MA 4N9F4 3UQBA 3SU8X 1Z2MA 3ZTCA 4ANWA 5L95C 2I1JA 3N3KB 3ZUNA 1WH3A 1SE9A 3Q3JA 4ZDVA 2GBMA 3R66C 2K1FA 3V62A 2M4NA 4YL8A 4DHJB 5DPSA 3V60A 1E7VA 2ZEQA 4KDLB 4IM2A 3DBSA 2M1MA 5J17A 1VCBA 2KLCA 2WWZA 2KN5A 1GC6A 3H9DA 3SD5A 1YX6B 4K7WA 2BPSA 3PZDA 3QCAA 3PV1A 4K1RB 2W9NA 3UF8A 3B0AA 1P0RA 4KIKB 2KKCA 1P98A 4BVUC 1KOTA 1WF9A 2KC2A 3PLUA 4NAWB 2IO1B 4DHJD 3P2BA 3ZDTA 1XQQA 2ZCCA 2AL6A 4LCDE 3KUZA 4W9FA 3M62B 4GN1A 4LJPB 2BKRB 4G11A 4NY0A 3DBRI 4FN2A 1ISNA 1WX7A 2IY0B 3V6EB 3M3JA 1E8YA 2I1KA 2LWPA 1WJUA 2KHWB 4BOSC 1Y8RC 4HPLB 3A4SC 2EMSA 2R2OA 4EZJA 3TIXA 4AJWA 1RFAA 3HM6X 3SHQA 2MBBB 5C1ZA 4II3B 3TCAA 1K8RB 2B3AA 1F9JA 1C3TA 3IVFA 5LLIA 3VHTC 2BYEA 3KUCB 2HTHA 4M8NA 2KJHB 4FJVB 2KTRA 1J19A 2KVRA 3TJPA 2EKEC 1WGRA 2L3ZA 4MGIE 4OVUA 4NJ6A 4XC2A 3VXWA 3MHSD 1WXSA 2A5UA 2EMTA 4A20A 2DYBA 2LVPA 3CMMB 3K9OB 3BY4B 2O6VA 4DHZE 3A4RA 2J0KA 3ML8A 4RM8A 1V81A 3QARA 1E8ZA 1WX8A 2DAJA 4IUMB 4GMVA 1FXTB 5JZEB 3HM3A 4X57B 3B1LX 3A9KA 1U4AA 2HE7A 4FULA 2JRIB 1S3SG 4M0WB 3ZRFA 2NBVB 3QX1A 2IBIB 1UZXB 1V9JA 2PE9A 2IO2B 1QZEA 4W9HA 1T0YA 3A9JB 2JUOA 3UQAA 4JGHB 4MEMA 3X0WA 4W9DA 1WGDA 2RR9A 3QQ8B 1YQBA 2KMCA 2R2QA 3APDA 4GDLB 2IO3B 4GDKA 4NQKE 4BKTA 4CO7A 4EZLA 4NJ7A 4MJSA 4WWOA 2XBBC 3WALA 3APFA 3C0RB 5D6JB 4WJNA 2MP2A 3ECIA 3IG3A 3PSEB 5DPWA 4LDTB 3A33B 1EF5A 1V6EA 1WXVA 4ASWC 4E71A 3PHWB 3ML9A 4BBNF 2O2VB 2REXA 3AI5A 2JZ3B 4HPMB 3NY5A 2KTFA 4B9KA 2LRWA 4GXBA 2C60A 2RD0A 2L05A 2KDEB 3CSTA 1XT9B 5D2MB 1WGYA 3EC8A 4DBGA 2WYQA 4F7ZA 2LD9A 3PRPB 2M8SA 4E74A 4HDQA 4WWPA 2KC1A 1BT0A 1YD8U 5AZGA 3EFUA 3WAMA 4DXAB 3ZTDA 2M17A 4LDTD 4KSLC 2NR2A 2XK5B 2L0TA 1A5RA 2LGDA 3JSVA 5JHBA 2DZJA 1Q5WB 1GJZA 3H7PB 1V5TA 4G0NB 2ZCBA 4WJOA 5D7GA 2N1WA 1YX5B 2C7HA 4GIVA 4WAAA 3L54A 5IAAC 4XZ4A 2N9PC 2A4ZA 5CTRC 1RLFA 1AARA 2D2QA 3IBEA 1LQBA 3ZIMA 3WA0A 2BF8B 2MSED 4FLHA 1L7YA 3PPAA 2KANA 2L76A 2V4LA 4NAWA 1Z5SB 2ZNVC 2AYOB 1WIAA 2FCSA 3R7QA 3U7DA 3ZDMC 3CF6E 3PLVA 3U8ZA 1TBEA 2N7EA 4W9GA 5FR6A 3VH4B 1NBFC 2KWUB 4AUQC 4BKSA 1TZ1A 3PGEA 1ZGUB 2KJRA 4AOFA 4NQLB 2WX1A 3L08A 4F8CB 2C7NB 2JF5A 2MBQA 2BYVE 3B08A 3PS6A 5KHOA 4G50A 1G6JA 5LXIB 1WY8A 3AULA 4WWNA 3L0WB 3L10B 2MBEA 2ASQA 5CHWA 2KWCA 2KJ6A 3OJ3A 1UBIA 3VUWA 3H7SA 2IO0B 5G2NA 2IY1B 2JWZA 4CHKA 1WZ0A 4ANXA 2J0JA 3ZRCA 3N32A 1WM2A 4NNJB 3DVGX 3ZNZB 1ZW7A 3QJZA 4IG7B 1WMHB 5TR5A 2K6QA 2L7RA 1WM3A 2XEWA 1LFDA 4OVVA 5J18A 3S2AA 4IWOA 1J8CA 3NHEB 1HE8A 2CHZA 2KO3A 3CSFA 2BWES 4CYEA 1E7UA 5J2RA 3A1QB 2KFJA 3ZNGC 2LUEA 4II2B 4ICUA 3AU4A 4FADA 4GGQA 1GUAB 2YLMA 2UYZB 2WX0A 1XD3B 5E6NA 1H4RA 2K8HA 1WGGA 2K8CA 3GOEA 3T8MA 5DPTA 4EFOA 1UELA 1VD2A 3PRMB 4JLCA 4ZRIA 3OLMD 2DAFA 2NCNA 2N7DA 4FHKA 2NBWB 3A9JA 2KDFB 2ZVNA 2BKFA 1TTNA 3OJ4B 2G4SA 3UIPB 3VTWA 4W9IA 4GU2A 4A3OA 2CU1A 2KZRA 4HXDA 5KHQA 3DQVA 5C23A 3SDLC 2NS5A 2MQJA 1UGMA 2JY6A 2DYMA 3L17A 1YJ1A 4A3PA 3VQIA 3ZO5B 1V2YA 1WGHA 1E8XA 2JT4B 2KD0A 2O2VA 2RPQA 3QC8B 4PYUA 4K7SA 4W9KA 4KV2A 4W9CA 4FHJA 1WJ6A 1RAXA 2N9XA 1LM8B 1V49A 3DPDA 4PS3A 2ZVOA 4HVBA 2LXCA 4DWFA 4GB9A 2GMIC 3X23A 1WE7A 2DZKA 4IC7B 2DZIA 2RSUA 4EEWA 1WXAA 2AWTA 4NPNA 4EZKA 2JRHA 4I6PA 3PVLA 3MJWA 1KJTA 3TL5A 2MX2A 3QAQA 1WXMA 2BWFA 4MGYE 3U30A 3VAWA 1UH6A 3KYDD 2MLBA 2O6VB 1E5WA 4ZYNA 3H7PA 3KW5B 4MDKE 4W9EA 4RM9A 3W1SC 5AZHA 4AWJA 5LXHA 1PQSA 5CHFA 4ICVA 4TQ1A 2HD5B 3NZUA 5DPRA 3VUXA 4FA6A 1IPGA 3TBLD 3OAWA 2DHZA 1M94A 2M0XA 4DK5A 4BOZB 2FCMA 3W1SA 3JYUA 1I42A 3R7RA 3DVNV 2NPTB 4JQWC 3WAPA 2KFKB 1WJ4A 2ZJDA 4KZCA 2KMAA 4MSMB 4GOCA 2LZ6A 3KVFB 1ZKHA 2PJHA 1R4MI 2D3GA 2LJ5A 2O6VD 5AEKB 3ALBA 3GZNI 1KM7A 3DBHI 3KUDB 5JHAA 4HJKA 4KIKA 2FNJB 3BINA 3AXCA 3JVZX 1V80A 4M8MA 5L83A 2N4FA 1WX9A 2MP2B 1OTRB 4I6NB 4JIOU 3DVNU 4KSKC 4JL9A 4F1SA 2RGFA 5D94A 4TUUA 3W1YA 3RCZA 1UD7A 1WRDB 4PS8A 3RULA 1Q1OA 3IFWB 1OEYJ 1D3ZA 4HDOA 4EUTA 1H8CA 2YVCA 5CX3A 4MM3A 2Y5BB 4ZRJA 2CKHB 2L8JA 3RUIB 1IP9A 1NDDA 3KH0A 2CR5A 3LJ3A 1WMHA 3QIJA 4K7UA 3VTVA 1SGHA 1WE6A 2KDIA 3NOBA 3PRZA 4J6IA 2QHOA 3UINB 4EKUA 3DCGA 5JH5C 2MWSB 3DVGY 3DDCB 3NZSA 4IM0A 4ZRKA 2FIDA 2CS4A 2WDTB 4W9LA 2GBRA 3A1QA 3JSVB 2K39A 2MCNB 4DHZB 2L00B 3HIZA 3LDZE 1WJNA 3M63B 4K81A 5BO4B 3M95A 3ZW3A 2LGYA 2JVCA 1WR6E 2KQ7A 2ZPNA 1J0GA 3DBLI 1LXDA 4HLEA 2C5LC 1EF1A 3QWZB 4PS7A 2KOXA 2CHXA 4MGKE 3VTUA 4B95A 2JPHA 2GOWA 3VUYA 4IWPA 4MELA 1UBQA
chains in the Genus database with same CATH superfamily
2LVOA 2VRRB 1I35A 3FILB 3RYTA 1EO6A 4KVGB 4EOYA 2GBJA 1MHXA 2OEDA 1E10A 2LI5A 3ZNHB 3WANA 2C7MB 4FJZA 1UF0A 1Q0WB 1F1HA 3DHHC 1CMXB 4E3CA 1FEHA 4W9JA 1VRAB 2NVUI 1M4VA 5G5HA 4A9AA 1V1PA 2XNAC 4BKSD 4TKNA 5JXVA 1UGJA 2KVZA 2GBKA 4IW0A 4HK2A 1K52A 3T9LA 2G1EA 3RMKC 4IDIA 3D32A 3VDZA 1WYWB 3EHVA 1WZ3A 3L4PA 4HROA 4IWQA 3VH3B 1WI0A 2NPTA 1X1MA 2KFKA 2Y5PA 4BZAA 1CQVA 2GI9A 3RD2A 1CZPA 3MTNB 5G55A 3ZVVA 1E90A 5HFYA 3A9KB 3ONSA 1WXQA 4DDGD 1Q10A 5GMVA 2OHFA 4IKGA 2AEHA 3PTFC 4ANVA 4GSWA 2FCNA 4GDKB 3RZFA 5FK9C 4NJCA 1PGAA 1YQ4B 2OOBB 1OEYA 2G45B 4OZBA 1A70A 3HHMA 2KT7A 4DDID 2UWQA 5IA7A 3ZKJC 4HRSA 3BZDB 2JZZA 4OVZA 4FBJB 2FUHB 2J0MA 1KF6B 3NS1A 1Z2MA 3SU8X 3ZTCA 5L95C 3N3KB 2RMMA 1WH3A 4ZDVA 1L4DB 2GBMA 3R66C 4LK0M 4DHJB 1N5WA 5DPSA 4JE3B 3HVDA 5BYSA 4C7ZA 3FILA 1ZE3D 1SXTA 2WWZA 4KX6B 3SR6A 3QCAA 3PV1A 5HI1A 3O13A 2KN4A 2WS3B 2KC2A 3GS2A 3P2BA 3Q3NC 4LCDE 3KUZA 4W9FA 4GN1A 2WXFA 2BKRB 4G11A 4NY0A 2IY0B 4QAYA 4DXGA 4RGMA 3M3JA 1E8YA 2I1KA 2LWPA 1C79A 3AMZA 4EZJA 4AJWA 3SHQA 3TCAA 2L52A 2B3AA 5C2TB 4REZA 3Q2AC 1I4QA 2BYEA 2BVCA 1IBXA 3BIID 1J19A 3TJPA 5HG2A 2MEKA 4KGSA 2EMTA 3K9OB 3BY4B 1C9FA 4WWMA 2O6VA 1AWDA 1R4MB 3H8HA 4RM8A 4PK1A 2DAJA 2WHIA 1QF6A 3DHGC 5JZEB 3IT4B 4XE0A 5G5GA 3A9KA 2RPVA 1S3SG 4M0WB 1HQRD 2IBIB 1V9JA 1N62A 4W9HA 1UUPA 3A9JB 3X0WA 1FRRA 3APDA 3HVZA 4GDKA 4RGTA 4BKTA 2IO3B 2XBBC 2LUMA 4C7YA 3Q6BA 1T0SC 2QSDA 2I2YA 4E71A 2KYWA 3PHWB 2REXA 3P4RB 2BT6A 3DWGC 3NY5A 4GXBA 2C60A 3LYYA 3CSTA 1XT9B 3PRPB 1HZ6A 3WAMA 4RGNA 3ZTDA 2NR2A 1A5RA 2L0TA 4A55A 2DZJA 4AQ7A 4DQOC 2N1WA 2J42A 1YX5B 2GB1A 1ZUD2 3L54A 1XCTL 1PUTA 2A4ZA 5CTRC 3ZIMA 4YTNB 2EKIA 1V97A 2ZNVC 2AYOB 3R7QA 1MJDA 3U7DA 3P1MA 3CF6E 4W9GA 3VH4B 1VJKA 1NBFC 3PGEA 2FUG1 4AOFA 3EFCA 4F8CB 2C7NB 2JF5A 5BMIA 3PS6A 5KHOA 2BQQA 3B2FA 1D4BA 2MBEA 5CHWA 2KWCA 3OJ3A 2J0JA 3DVGX 1ZW7A 3QJZA 3AEAB 1LFDA 4HKZE 4IWOA 1J8CA 2WXNA 2CHZA 4CYEA 5J2RA 5H92C 4OW0A 3AU4A 2WLBA 1JCKB 1NENB 3VRBB 1XD3B 1WGGA 3Q8AA 1VD2A 3PRMB 3A9JA 4O1NA 2KDFB 3CIRB 4W9IA 3GZNB 1L0XB 3U7ZA 4HXDA 1SE4A 2K5PA 4A3PA 2WDVB 1WGHA 2RPQA 1F52A 4RFBA 1NYRA 3ZJVA 1WJ6A 2N9KA 1LM8B 1V49A 2ZVOA 1WE7A 3Q69A 4EEWA 2AWTA 2ZW0A 3AECB 4WH4A 3PVLA 2IGDA 1UWXA 3QAQA 2LHEA 2BWFA 3T3OA 4N6EB 4YXDB 2MLBA 4AWJA 3KW5B 4RM9A 4K3BA 5CHFA 3NZUA 1FCLA 2DHZA 3R2TA 3WCQA 1I42A 1ROEA 3ZQ4A 4ARCA 3WAPA 1WJ4A 2KMAA 2JYEA 2D3GA 1KM7A 3DBHI 5JHAA 4KIKA 1TY0A 4K3CA 3OWEB 3AEDB 1FO4A 1OTRB 4I6NB 4F1SA 1UWMA 3W1YA 2DNFA 3RCZA 2KDMA 3ZGZA 3RULA 1DYQA 1H8CA 1LO5D 3EUB2 4ZRJA 2CKHB 3RUIB 1NDDA 3KH0A 2VH1A 2WXGA 2BW2A 2M19A 3PRZA 3UINB 3ZXRA 1XO3A 4S0RA 2QMTA 3DVGY 3NZSA 2FIDA 3NVWA 3AEGB 2KMMA 3JSVB 2K39A 2MCNB 4TMAB 5FKAC 3LDZE 5BO4B 2BB5A 3M95A 1YOVB 1C76A 2LGYA 2PKOA 2KQ7A 1FMAD 2KOXA 2CHXA 3VTUA 4B95A 2K9XA 2GOWA 1LGRA 3VUYA 3E9SA 2EELA 3ABVB 4TQ0A 1OQYA 2TSSA 1IUEA 3JW0X 2BGFA 1DGJA 1P3QU 1F0ZA 2OJRA 4AJYB 3RFZB 4OZAA 2Z0DB 4MT5A 2RDBC 3GP7A 2K6DB 4XYCA 2WXQA 4L2YA 2KLGA 3QHTA 2C9WB 1QQRA 2K8BA 1P7FA 3EECA 3MHZA 1BMLC 2PLPA 4WJQA 3Q8FA 3AE2B 5DCNA 3L16A 3NJTA 1V1OA 3P4SB 2BYFA 4M01A 2LGXA 3PREA 1JRUA 3IAS1 3L13A 1P9DU 3R3MA 3MC0B 3Q3FA 4P7IA 3QA8A 2INPE 2WNMA 3I3TB 1JW9D 3V61A 3AE3B 2IZVB 2V1YA 1TS4A 1YIWA 1FPYA 3DBRB 2DX5B 2LGIA 5AUKA 1UNSA 2WXOA 3SFEB 1DOYA 1GC7A 4XWWA 2NBUA 1L0YB 1WFYA 1RRBA 1YNTE 2MA9B 2KQSA 2KX3A 3AV8A 2LXAA 3NS8A 2N1VA 2LRUA 4PYZA 4C00A 4BBNC 2MBHA 2HJ8A 1SE3A 3UQBA 2RDHA 1N61A 4ANWA 2N9LA 2INCC 4RCOA 4JWSC 1TKGA 3V62A 2Q5WD 3V60A 1E7VA 2ZEQA 3SEBA 1TYGB 1SJED 3DBSA 2M1MA 5J17A 1VCBA 1FRDA 1GC6A 3H9DA 3SD5A 1YX6B 4MH8A 3PZDA 3B0AA 1P0RA 1P98A 3P4PB 1WF9A 2ICIA 3EA6A 3ZDTA 1XQQA 1XXGA 4L23A 4LJPB 2BBCA 5GXGB 1WX7A 4MM3B 1WJUA 4HPLB 1C78A 2R2OA 2N0SB 4M00A 3TIXA 4AS1A 2YEPF 4WAFA 5C1ZA 2MBBB 3PZ7A 4KGRA 3VHTC 2UU7A 4OZCA 2BTEA 4M8NA 3MHSD 3KWLA 2A5UA 4P1CC 4A20A 3CMMB 1ZP0B 2W55A 3AE9B 2M56B 4DHZE 1E8ZA 4IUMB 4GMVA 2WGSA 2ACZB 3HM3A 4X57B 3BYYB 1I4XA 2HE7A 3ZRFA 2NBVB 3QX1A 2PE9A 4ZRPA 2IO2B 1TZOA 1T0YA 1E7PB 3UI3A 3J9CA 5AUIA 2KMCA 4GDLB 1ENFA 2WU5B 4CO7A 4NJ7A 4RF0A 2KWDA 2MP2A 3ECIA 4KKIA 3A33B 1VLBA 2O2VB 3AI5A 2QC8A 3Q8CA 1TKEA 1DOIA 1IGCA 4B9KA 1I4PA 1GB1A 2JSVX 2KDEB 5D2MB 4HEA1 4F7ZA 2JX5A 1XLQA 1ZDVA 3U52E 1BT0A 3CWIA 1D5XC 3EFUA 3PO0A 4LNOA 4DXAB 2M0AA 4LDTD 2XK5B 1FXIA 2W82A 1JWSD 3DHIC 3H7PB 4G0NB 5D7GA 2PTLA 1RLFA 1L7YA 1N63A 3PPAA 2L76A 2V4LA 5IOIA 2MH7A 1WIAA 1I7HA 3MC9A 2N7EA 3ZYYX 2KWUB 2INDC 4WIPA 4NQLB 2WU2B 5D3DA 4DXFA 1WY8A 1JWAD 2AQ2B 2CU3A 3L10B 3L0WB 2ASQA 2IDYA 2KJ6A 2BS4B 1GPXA 5G2NA 1L6VA 1TS2A 3RN9C 1WZ0A 2E3TA 4NNJB 1WMHB 5TR5A 2XEWA 2W54A 1FNWA 2KO3A 2BWES 1E7UA 2KFJA 4ICUA 4GGQA 5E6JA 2YLMA 1QOBA 5E6NA 2K8HA 4B0MA 5DPTA 4ZRIA 1XLPA 3Q14C 2G4SA 3KLSX 2WXKA 4A3OA 4C56C 2N7JA 5C23A 1HTOA 2NS5A 4M02A 2DYMA 1YJ1A 3FKYA 1OFFA 5EE3A 1E8XA 2JT4B 2O2VA 4PYUA 4PS3A 3DPDA 3NZ3A 1BXTA 3NUHB 2LXCA 4GB9A 2GMIC 3X23A 2DZKA 4IC7B 2QDFA 4P1BC 4NPNA 5C3JB 3AE7B 2V0GA 3TL5A 1I4GA 1JWMD 5T8IA 3ZJUA 4MGYE 1WXMA 3VAWA 3AEFB 3KYDD 2DWQA 1QILA 1L4ZB 3H7PA 3W1SC 4W9EA 1E9MA 3DBLB 1JWBD 2HDEA 1EWYC 1PGXA 4BOZB 3W1SA 3JYUA 1C4CA 3PZ8A 2ZJDA 4YSYB 2LZ6A 2O6VD 3ALBA 3GZNI 4A8XC 4HJKA 4H2AA 2FNJB 3JVZX 1WX9A 1ZOYB 1WSPA 1PGBA 4JL9A 1L0VB 4PS8A 3IFWB 4HDOA 2YVCA 5CX3A 2Y5BB 1EU3A 1IP9A 2QJLA 3C8YA 3ZXVA 4ZHOA 3LJ3A 1WMHA 3BK1A 4J6IA 1ZXHA 2QHOA 5FR3A 1TIFA 1QT9A 3DCGA 2MWSB 3DDCB 1R4NB 4W9LA 1E6EB 2QIEB 1YQ3B 3HIZA 1WR6E 2ZPNA 1J0GA 2C5LC 1EF1A 5D3IB 2J52A 1VR9A 3LXFA 1TS5A 4MGKE 2QILA 1MFWA 2IYDB 2Z59B 3AU5A 5EE0A 2CHWA 4P6VF 5E6PA 2KK8A 4MGZE 4KDIC 2BS3B 3TEXA 4M0WA 1Y56A 2BYTA 2K25A 4RMAA 3RNCC 2VZKD 2H88B 2ZZPB 1N60A 2KX0A 4LJOB 3V6CB 1BUIC 1MI0A 2PMVA 2AL3A 3PHXB 2WQYB 1SIFA 4BKGA 2PIAA 3N30A 2G4DB 4ZHPA 2DYOA 4JWUC 2WDQB 2WP9B 4I6LB 2D10A 1SIJA 2JYTA 3RT3B 3VFKA 3IHPC 2MBOA 3TMPB 4TSSA 3WAOA 3ZNID 1KLVA 5EDSA 1GB4A 1ACCA 2LHDA 1EU4A 1SE2A 3ZLZA 2L32A 2NTTA 2B76B 3DOWA 2R61A 2PPHA 3TEZA 4BAXA 2JQRB 4MH0E 4HCPB 3FC4A 1TGZB 2CJOA 1VZ7A 2ZPYA 2LVQA 2I38A 2DENB 2KWVB 4BFRA 2DBYA 3TUOA 1MPEA 2J7QB 1NI2A 4HJGE 5AZFA 2IGHA 1TY2A 1XEEA 4PT5A 4AP4C 2H89B 3RZWC 4G3XB 2E6XA 1QOFA 3TEWA 2FIFA 2DLBA 3Q3OC 1XF5L 2FE8A 3PT2B 1MG8A 3VR8B 2KDBA 4NAMA 2N9EB 1L6UA 1XLNA 1RFKA 4MJSB 4URKA 4A90A 3ETRA 3O65B 1TJEA 1VDVA 2DZMA 4GLSC 4MSQB 4WQOB 3DWMA 1HA5A 4US8A 4TV3A 2PE6B 3QK0A 2Z0EB 1GOZA 4RNAA 1OQRA 4N9F4 3AE8B 3N1YC 4LNIA 5IN7A 3ZUNA 1K53A 3RNGC 2X38A 3Q3JA 1FCCC 4YL8A 2LFIA 1STEA 3P42A 3BWUD 4YSZB 3AE5B 2W9NA 1QOGA 4BVUC 3SFDB 1HEZE 2ZCCA 1WRIA 3AB5A 2ONQA 1HZ5A 2V4IB 3DBRI 4FN2A 1FD6A 3OG5A 3MP9A 4BOSC 1RFAA 3HM6X 2MJEA 1C3TA 3IVFA 3KUCB 1QKZA 2HTHA 1QOAA 2EKEC 2L3ZA 4MGIE 4LNNA 2Y3AA 4OVUA 4XC2A 1OQQA 3ZJTA 1KFYB 3R8BA 3A4RA 3ML8A 3I5JC 3DBHB 1ET9A 1U4AA 4FULA 3AE1B 2JRIB 4YTPB 1UZXB 1QZEA 2JUOA 3UQAA 4JGHB 3QQ8B 2PVOD 2RR9A 1YQBA 1FNVA 2R2QA 3N9YC 3BVMA 1B9RA 1TKYA 4MJSA 1V1PB 2HTME 3APFA 3C0RB 2RDGA 4LNKA 1XLOA 1K51A 4LDTB 1EF5A 1D6EC 1V6EA 1WXVA 1KH0A 4BBNF 2JZ3B 3I57A 4HPMB 4ZYSA 2PVGC 3TSSA 2RD0A 3EC8A 4DBGA 2WYQA 2M8SA 4WWPA 5AZGA 3U2SC 2M17A 3AH7A 4KSLC 3Q3MC 2YEPB 3JSVA 5JHBA 2KAJA 4HPPA 1GJZA 1V5TA 1RWSA 4WAAA 3URYA 5IAAC 3IBEA 1LQBA 1T0RC 2MSED 4FLHA 2FBWB 2JZPA 2SAKA 1Z5SB 2LEKA 1KRHA 4NZLB 3ZDMC 1EWCA 3U8ZA 1TBEA 4YT0B 4ZRQA 4BKSA 1TZ1A 1ZGUB 2SEBD 2W3SA 2KJRA 4OHJA 1P7EA 2WX1A 3B08A 2BYVE 4G50A 2GLSA 2INNE 1FNUA 3AULA 4WWNA 2D3AA 1UBIA 5BYRA 3H7SA 3VUWA 2IY1B 2JWZA 1N5XA 2MJDA 3N32A 1ZPSA 1WM2A 3KWVA 3ZNZB 2IGGA 4ACFA 1SB3C 1WM3A 4OVVA 3MJ5A 3NHEB 2KQ4X 1IGDA 3CSFA 4LLGM 3ZNGC 2LUEA 4IOIE 2JWUA 4FADA 4RF1A 4RH6A 3BVZA 1DOXA 3RI7C 3GOEA 3T8MA 4EFOA 1UELA 4JLCA 2ON8A 3HUIA 2N7DA 1F2RI 4US9A 2K3UA 2OJWA 2ZVNA 3RNBC 1TTNA 1KTKA 3UIPB 3GE3C 3VTWA 5BMGA 5KHQA 3SDLC 3W2DA 2D3BA 3VQIA 3ZO5B 4RGOS 5EE9A 2KD0A 3QC8B 4K7SA 5LNK1 4W9KA 1NVID 2QEJC 4JX1C 4DWFA 2MHJA 1WXAA 1IBXB 4EZKA 4I6PA 3MJWA 4HKQA 3B9JA 1KJTA 2MX2A 1UH6A 2HJ1A 2O6VB 5AZHA 1PQSA 1JRPA 4TQ1A 3IXSA 3OAWA 1T3QA 4DK5A 2FCMA 4JQWC 3IAM1 4GOCA 1WYGA 2PJHA 1R4MI 2LJ5A 5BYQA 3KUDB 2WXIA 3AXCA 5L83A 3VRAB 1QLBB 2N4FA 1JWUD 3Q8EA 1C4AA 2AQ1B 4KSKC 2RGFA 5D94A 1UD7A 1D3ZA 4MM3A 1MG4A 2L8JA 5IKCM 2CR5A 1XCQL 3VTVA 1SGHA 1WE6A 5JH5C 3NVVA 1V8CA 2CS4A 2WDTB 1ZDXA 2L00B 1WJNA 3ZW3A 3NG0A 1T6BX 5I4DA 3DBLI 4HLEA 5IO9A 2VZKB 2AQ3B 3AEBB 4IWPA 1GNUA 3ENEA 1E8WA 2G3QB 1FIQA 1KLGD 1JMLA 2ZNVB 1L2NA 1SSNA 2V9HA 4FJYA 4KGTA 2MRPA 3H1UA 1YJJA 1FFUA 4GDLA 2V3SA 3AN1A 3RNFC 2PEAA 2WXLA 4YSXB 1V86A 4ARIA 3H6NA 3UGBB 4XX5A 3W5UB 5CHVC 1GG3A 2FAZA 2Z8LA 1S1QB 4XDCA 2GBNA 1T5XD 4WJPA 3GB1A 1R4NI 1WR1A 1FM0D 2KXJA 2L0FA 1YN4A 5HHDG 2MW5A 1IYFA 4HCNB 2KNBA 3UIOB 5HKHA 2D11A 1SJHD 1EUVB 4KZ0A 4B6WA 2KTRB 4LNFA 2JXXA 4ANUA 4XWTA 4HWIB 2XK5A 3K9PB 3KYCD 2W3RA 1NI3A 1T0QC 1FFVA 3W9CB 1F2RC 3V05A 1WWTA 3APCA 3EGRA 5E6OA 1OGWA 4IM3A 2LASA 2KACA 4ITKA 1P1AA 1C1YB 3HK0A 3WIMA 2D07B 2X8XX 4B0EA 5MPOA 2ZW1A 1AW7A 3VR9B 3P4QB 3VVWB 3KQ4A 3P63A 1V5OA 2FCQA 3AEEB 1K50A 1VZ8A 2JU6X 3TEYA 4USAA 1RM6C 2I1JA 1SE9A 2K1FA 2M4NA 2K0PA 3NVZA 1ZXIA 4KDLB 5EE1A 4IM2A 3AM9A 1CK1A 2KLCA 2KN5A 3T3NA 4K7WA 2BPSA 1HTQA 4K1RB 3UF8A 4KIKB 1PFDA 2KKCA 1SBBB 1KOTA 1I4HA 3PLUA 4NAWB 2IO1B 4DHJD 4XGAB 2AL6A 1C4PA 4C80A 3M62B 1PDXA 4UDUC 3GE8C 2QCZA 1SF0A 1ISNA 3V6EB 1YN3A 4S17A 2MJ3A 2KHWB 4JPSA 1Y8RC 2D3CA 1J7CA 3A4SC 2EMSA 1VZ6A 3N20C 1R7SA 4C4VB 2IPKD 1FXAA 4II3B 1C77A 1K8RB 1F9JA 1PYWD 5TSSA 5LLIA 3I63C 1CJEA 2PW9A 2KJHB 4FJVB 2KTRA 2KVRA 1WGRA 1JQ4A 1AYFA 1YN5A 4NJ6A 3VXWA 1WXSA 2DYBA 2LVPA 2NMQA 2VH2A 2J0KA 1V81A 3QARA 1WX8A 1TS3A 1FXTB 2XN9C 3B1LX 3E56A 2L83A 2Y5CA 2NTSA 2BB6A 4MEMA 1B1ZA 4W9DA 1WGDA 4NQKE 4D2KA 4MACA 4EZLA 2WDRB 1E0ZA 4WWOA 1D5ZC 3WALA 5D6JB 4WJNA 3PSEB 3IG3A 5DPWA 2JXTA 3NRZA 4ASWC 3ML9A 2KTFA 1GAQB 2LRWA 2L05A 1WGYA 2LD9A 2G9HD 4E74A 1I4RA 2WXRA 1KLUD 4HDQA 2KC1A 1YD8U 5H8YE 3BK2A 2WXPA 4A6QA 2J53A 1NYQA 2WXHA 2K22A 2LGDA 4N59A 1Q5WB 4WJOA 1ESFA 2ZCBA 4YTMB 2C7HA 2WXMA 3RPFC 4GIVA 4XZ4A 1ET6A 2N9PC 1AARA 2D2QA 3WA0A 2BF8B 2KANA 4NAWA 1YMHE 3C19A 2V3NA 3AE6B 2FCSA 3PLVA 5FR6A 4AUQC 3MC8A 2LMCA 3L08A 2MBQA 1G6JA 5LXIB 4C4VA 3NVYA 1N6ZA 2IO0B 4CHKA 4ANXA 2IJ0A 3ZRCA 3W5VB 4IG7B 3IT6B 2K6QA 2L7RA 4EE2A 5J18A 3S2AA 2V3PA 4ZOHC 1HE8A 4WQMA 1MVKA 2D5GA 1J7AA 2AX5A 3A1QB 4II2B 3V3XA 1GUAB 1HXYD 2UYZB 2WX0A 3RNEC 3RNAC 1H4RA 2K8CA 5BMHA 3OLMD 2DAFA 1D5MC 2NCNA 3HRDD 4FHKA 2NBWB 4WURA 2LJIA 1AN8A 1J7BA 2BKFA 3OJ4B 4GU2A 2CU1A 2KZRA 3DQVA 1MHHE 2MQJA 1UGMA 2LGSA 2JY6A 3L17A 4FXCA 5IP4D 1V2YA 4CQNA 2J4XA 2GRIA 2L1AA 4XDDA 1YJIA 4KV2A 4R3DA 1JROA 4W9CA 4FHJA 1RAXA 2N9XA 4KKJA 4J3OD 4HVBA 2DZIA 2RSUA 2JRHA 1L5PA 3N1XC 3U30A 4ZYNA 1E5WA 4MDKE 3N1ZC 5LXHA 4YWGG 4ICVA 1RYJA 2WXJA 3AE4B 2HD5B 5DPRA 3VUXA 4FA6A 1IPGA 3TBLD 1F77A 1M94A 2M0XA 3R7RA 3BYTB 4P16A 3DVNV 2NPTB 2KFKB 4KZCA 4MSMB 4N58A 3KVFB 1ZKHA 5AEKB 3R2IA 1WGKA 3BINA 4M8MA 1V80A 2MP2B 1SEBD 4JIOU 3DVNU 3BVGA 4TUUA 3FAHA 4L1BA 1WRDB 1Q1OA 1OEYJ 1JALA 4EUTA 3LB8C 2BS2B 3Q8BA 4K7UA 3QIJA 2KDIA 3NOBA 4LTUA 3MFGA 4EKUA 4IM0A 4ZRKA 2CJNA 2GBRA 3A1QA 4DHZB 3I9V1 3B2GA 4K81A 4Q2JA 3M63B 3U4EG 1NEKB 2JVCA 1TT5B 1LXDA 3QWZB 4PS7A 2JPHA 1EM7A 4MELA 1UBQA
chains in the Genus database with same CATH topology
2IYDB 1GNUA 2Z59B 2LVOA 3AU5A 2VRRB 3ENEA 1I35A 4TQ0A 1OQYA 3RYTA 1EO6A 1E8WA 4KVGB 2G3QB 3JW0X 2BGFA 2CHWA 5E6PA 2KK8A 4MGZE 4KDIC 4EOYA 2GBJA 1P3QU 2LI5A 2ZNVB 3WANA 2C7MB 4FJZA 2OJRA 3ZNHB 4AJYB 1L2NA 4FJYA 1Q0WB 2MRPA 2K25A 4RMAA 2Z0DB 3H1UA 2K6DB 2ZZPB 2KX0A 1CMXB 4GDLA 4LJOB 4E3CA 2V3SA 3V6CB 4W9JA 2PEAA 2KLGA 1V86A 2AL3A 2NVUI 3PHXB 3QHTA 3H6NA 3UGBB 1SIFA 4BKGA 2C9WB 3N30A 2G4DB 4BKSD 4TKNA 2DYOA 4XX5A 5CHVC 1GG3A 2GBKA 4I6LB 2FAZA 2K8BA 1S1QB 2D10A 3RT3B 4IW0A 4HK2A 3VFKA 2GBNA 4WJPA 3EECA 3T9LA 3IHPC 1R4NI 2MBOA 3TMPB 1WR1A 2KXJA 4WJQA 2L0FA 2MW5A 3WAOA 1IYFA 4HCNB 2KNBA 3UIOB 3ZNID 2D11A 5HKHA 3D32A 5DCNA 3L16A 1EUVB 1WYWB 3EHVA 4KZ0A 1WZ3A 3VDZA 5EDSA 1KLVA 4B6WA 2KTRB 3ZLZA 2JXXA 4ANUA 4HWIB 4IWQA 2XK5A 3K9PB 3DOWA 2BYFA 3KYCD 3VH3B 2PPHA 2LGXA 1WI0A 2NPTA 1X1MA 2KFKA 3PREA 4MH0E 4HCPB 1TGZB 1JRUA 2ZPYA 3L13A 3RD2A 1P9DU 2LVQA 3MTNB 2DENB 5G55A 3R3MA 3ZVVA 2KWVB 4BFRA 3Q3FA 3APCA 1E90A 4P7IA 2J7QB 1NI2A 5E6OA 5AZFA 3A9KB 3QA8A 3ONSA 4AP4C 4DDGD 3RZWC 4G3XB 1OGWA 3I3TB 4IM3A 3V61A 2FIFA 2IZVB 2V1YA 5GMVA 1YIWA 2LASA 2AEHA 1P1AA 1C1YB 3PT2B 3PTFC 4ANVA 4GSWA 3HK0A 1MG8A 2FCNA 2KDBA 4GDKB 3RZFA 2N9EB 2DX5B 4MJSB 4URKA 3WIMA 1GC7A 2D07B 2OOBB 1OEYA 2NBUA 3O65B 2DZMA 2G45B 3VVWB 1WFYA 4MSQB 3HHMA 4WQOB 1V5OA 1RRBA 2FCQA 2MA9B 2KQSA 2KX3A 4DDID 2LXAA 4TV3A 3NS8A 2UWQA 5IA7A 2PE6B 3ZKJC 2N1VA 3QK0A 2Z0EB 2JZZA 2LRUA 4PYZA 4BBNC 2MBHA 4FBJB 2FUHB 2HJ8A 2J0MA 4N9F4 3UQBA 3SU8X 1Z2MA 3ZTCA 4ANWA 5L95C 2I1JA 3N3KB 3ZUNA 1WH3A 1SE9A 3Q3JA 4ZDVA 2GBMA 3R66C 2K1FA 3V62A 2M4NA 4YL8A 4DHJB 5DPSA 3V60A 1E7VA 2ZEQA 4KDLB 4IM2A 3DBSA 2M1MA 5J17A 1VCBA 2KLCA 2WWZA 2KN5A 1GC6A 3H9DA 3SD5A 1YX6B 4K7WA 2BPSA 3PZDA 3QCAA 3PV1A 4K1RB 2W9NA 3UF8A 3B0AA 1P0RA 4KIKB 2KKCA 1P98A 4BVUC 1KOTA 1WF9A 2KC2A 3PLUA 4NAWB 2IO1B 4DHJD 3P2BA 3ZDTA 1XQQA 2ZCCA 2AL6A 4LCDE 3KUZA 4W9FA 3M62B 4GN1A 4LJPB 2BKRB 4G11A 4NY0A 3DBRI 4FN2A 1ISNA 1WX7A 2IY0B 3V6EB 3M3JA 1E8YA 2I1KA 2LWPA 1WJUA 2KHWB 4BOSC 1Y8RC 4HPLB 3A4SC 2EMSA 2R2OA 4EZJA 3TIXA 4AJWA 1RFAA 3HM6X 3SHQA 2MBBB 5C1ZA 4II3B 3TCAA 1K8RB 2B3AA 1F9JA 1C3TA 3IVFA 5LLIA 3VHTC 2BYEA 3KUCB 2HTHA 4M8NA 2KJHB 4FJVB 2KTRA 1J19A 2KVRA 3TJPA 2EKEC 1WGRA 2L3ZA 4MGIE 4OVUA 4NJ6A 4XC2A 3VXWA 3MHSD 1WXSA 2A5UA 2EMTA 4A20A 2DYBA 2LVPA 3CMMB 3K9OB 3BY4B 2O6VA 4DHZE 3A4RA 2J0KA 3ML8A 4RM8A 1V81A 3QARA 1E8ZA 1WX8A 2DAJA 4IUMB 4GMVA 1FXTB 5JZEB 3HM3A 4X57B 3B1LX 3A9KA 1U4AA 2HE7A 4FULA 2JRIB 1S3SG 4M0WB 3ZRFA 2NBVB 3QX1A 2IBIB 1UZXB 1V9JA 2PE9A 2IO2B 1QZEA 4W9HA 1T0YA 3A9JB 2JUOA 3UQAA 4JGHB 4MEMA 3X0WA 4W9DA 1WGDA 2RR9A 3QQ8B 1YQBA 2KMCA 2R2QA 3APDA 4GDLB 2IO3B 4GDKA 4NQKE 4BKTA 4CO7A 4EZLA 4NJ7A 4MJSA 4WWOA 2XBBC 3WALA 3APFA 3C0RB 5D6JB 4WJNA 2MP2A 3ECIA 3IG3A 3PSEB 5DPWA 4LDTB 3A33B 1EF5A 1V6EA 1WXVA 4ASWC 4E71A 3PHWB 3ML9A 4BBNF 2O2VB 2REXA 3AI5A 2JZ3B 4HPMB 3NY5A 2KTFA 4B9KA 2LRWA 4GXBA 2C60A 2RD0A 2L05A 2KDEB 3CSTA 1XT9B 5D2MB 1WGYA 3EC8A 4DBGA 2WYQA 4F7ZA 2LD9A 3PRPB 2M8SA 4E74A 4HDQA 4WWPA 2KC1A 1BT0A 1YD8U 5AZGA 3EFUA 3WAMA 4DXAB 3ZTDA 2M17A 4LDTD 4KSLC 2NR2A 2XK5B 2L0TA 1A5RA 2LGDA 3JSVA 5JHBA 2DZJA 1Q5WB 1GJZA 3H7PB 1V5TA 4G0NB 2ZCBA 4WJOA 5D7GA 2N1WA 1YX5B 2C7HA 4GIVA 4WAAA 3L54A 5IAAC 4XZ4A 2N9PC 2A4ZA 5CTRC 1RLFA 1AARA 2D2QA 3IBEA 1LQBA 3ZIMA 3WA0A 2BF8B 2MSED 4FLHA 1L7YA 3PPAA 2KANA 2L76A 2V4LA 4NAWA 1Z5SB 2ZNVC 2AYOB 1WIAA 2FCSA 3R7QA 3U7DA 3ZDMC 3CF6E 3PLVA 3U8ZA 1TBEA 2N7EA 4W9GA 5FR6A 3VH4B 1NBFC 2KWUB 4AUQC 4BKSA 1TZ1A 3PGEA 1ZGUB 2KJRA 4AOFA 4NQLB 2WX1A 3L08A 4F8CB 2C7NB 2JF5A 2MBQA 2BYVE 3B08A 3PS6A 5KHOA 4G50A 1G6JA 5LXIB 1WY8A 3AULA 4WWNA 3L0WB 3L10B 2MBEA 2ASQA 5CHWA 2KWCA 2KJ6A 3OJ3A 1UBIA 3VUWA 3H7SA 2IO0B 5G2NA 2IY1B 2JWZA 4CHKA 1WZ0A 4ANXA 2J0JA 3ZRCA 3N32A 1WM2A 4NNJB 3DVGX 3ZNZB 1ZW7A 3QJZA 4IG7B 1WMHB 5TR5A 2K6QA 2L7RA 1WM3A 2XEWA 1LFDA 4OVVA 5J18A 3S2AA 4IWOA 1J8CA 3NHEB 1HE8A 2CHZA 2KO3A 3CSFA 2BWES 4CYEA 1E7UA 5J2RA 3A1QB 2KFJA 3ZNGC 2LUEA 4II2B 4ICUA 3AU4A 4FADA 4GGQA 1GUAB 2YLMA 2UYZB 2WX0A 1XD3B 5E6NA 1H4RA 2K8HA 1WGGA 2K8CA 3GOEA 3T8MA 5DPTA 4EFOA 1UELA 1VD2A 3PRMB 4JLCA 4ZRIA 3OLMD 2DAFA 2NCNA 2N7DA 4FHKA 2NBWB 3A9JA 2KDFB 2ZVNA 2BKFA 1TTNA 3OJ4B 2G4SA 3UIPB 3VTWA 4W9IA 4GU2A 4A3OA 2CU1A 2KZRA 4HXDA 5KHQA 3DQVA 5C23A 3SDLC 2NS5A 2MQJA 1UGMA 2JY6A 2DYMA 3L17A 1YJ1A 4A3PA 3VQIA 3ZO5B 1V2YA 1WGHA 1E8XA 2JT4B 2KD0A 2O2VA 2RPQA 3QC8B 4PYUA 4K7SA 4W9KA 4KV2A 4W9CA 4FHJA 1WJ6A 1RAXA 2N9XA 1LM8B 1V49A 3DPDA 4PS3A 2ZVOA 4HVBA 2LXCA 4DWFA 4GB9A 2GMIC 3X23A 1WE7A 2DZKA 4IC7B 2DZIA 2RSUA 4EEWA 1WXAA 2AWTA 4NPNA 4EZKA 2JRHA 4I6PA 3PVLA 3MJWA 1KJTA 3TL5A 2MX2A 3QAQA 1WXMA 2BWFA 4MGYE 3U30A 3VAWA 1UH6A 3KYDD 2MLBA 2O6VB 1E5WA 4ZYNA 3H7PA 3KW5B 4MDKE 4W9EA 4RM9A 3W1SC 5AZHA 4AWJA 5LXHA 1PQSA 5CHFA 4ICVA 4TQ1A 2HD5B 3NZUA 5DPRA 3VUXA 4FA6A 1IPGA 3TBLD 3OAWA 2DHZA 1M94A 2M0XA 4DK5A 4BOZB 2FCMA 3W1SA 3JYUA 1I42A 3R7RA 3DVNV 2NPTB 4JQWC 3WAPA 2KFKB 1WJ4A 2ZJDA 4KZCA 2KMAA 4MSMB 4GOCA 2LZ6A 3KVFB 1ZKHA 2PJHA 1R4MI 2D3GA 2LJ5A 2O6VD 5AEKB 3ALBA 3GZNI 1KM7A 3DBHI 3KUDB 5JHAA 4HJKA 4KIKA 2FNJB 3BINA 3AXCA 3JVZX 1V80A 4M8MA 5L83A 2N4FA 1WX9A 2MP2B 1OTRB 4I6NB 4JIOU 3DVNU 4KSKC 4JL9A 4F1SA 2RGFA 5D94A 4TUUA 3W1YA 3RCZA 1UD7A 1WRDB 4PS8A 3RULA 1Q1OA 3IFWB 1OEYJ 1D3ZA 4HDOA 4EUTA 1H8CA 2YVCA 5CX3A 4MM3A 2Y5BB 4ZRJA 2CKHB 2L8JA 3RUIB 1IP9A 1NDDA 3KH0A 2CR5A 3LJ3A 1WMHA 3QIJA 4K7UA 3VTVA 1SGHA 1WE6A 2KDIA 3NOBA 3PRZA 4J6IA 2QHOA 3UINB 4EKUA 3DCGA 5JH5C 2MWSB 3DVGY 3DDCB 3NZSA 4IM0A 4ZRKA 2FIDA 2CS4A 2WDTB 4W9LA 2GBRA 3A1QA 3JSVB 2K39A 2MCNB 4DHZB 2L00B 3HIZA 3LDZE 1WJNA 3M63B 4K81A 5BO4B 3M95A 3ZW3A 2LGYA 2JVCA 1WR6E 2KQ7A 2ZPNA 1J0GA 3DBLI 1LXDA 4HLEA 2C5LC 1EF1A 3QWZB 4PS7A 2KOXA 2CHXA 4MGKE 3VTUA 4B95A 2JPHA 2GOWA 3VUYA 4IWPA 4MELA 1UBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IYD B;  1GNU A;  2Z59 B;  2LVO A;  3AU5 A;  2VRR B;  3ENE A;  1I35 A;  4TQ0 A;  1OQY A;  3RYT A;  1EO6 A;  1E8W A;  4KVG B;  2G3Q B;  3JW0 X;  2BGF A;  2CHW A;  5E6P A;  2KK8 A;  4MGZ E;  4KDI C;  4EOY A;  2GBJ A;  1P3Q U;  2LI5 A;  2ZNV B;  3WAN A;  2C7M B;  4FJZ A;  2OJR A;  3ZNH B;  4AJY B;  1L2N A;  4FJY A;  1Q0W B;  2MRP A;  2K25 A;  4RMA A;  2Z0D B;  3H1U A;  2K6D B;  2ZZP B;  2KX0 A;  1CMX B;  4GDL A;  4LJO B;  4E3C A;  2V3S A;  3V6C B;  4W9J A;  2PEA A;  2KLG A;  1V86 A;  2AL3 A;  2NVU I;  3PHX B;  3QHT A;  3H6N A;  3UGB B;  1SIF A;  4BKG A;  2C9W B;  3N30 A;  2G4D B;  4BKS D;  4TKN A;  2DYO A;  4XX5 A;  5CHV C;  1GG3 A;  2GBK A;  4I6L B;  2FAZ A;  2K8B A;  1S1Q B;  2D10 A;  3RT3 B;  4IW0 A;  4HK2 A;  3VFK A;  2GBN A;  4WJP A;  3EEC A;  3T9L A;  3IHP C;  1R4N I;  2MBO A;  3TMP B;  1WR1 A;  2KXJ A;  4WJQ A;  2L0F A;  2MW5 A;  3WAO A;  1IYF A;  4HCN B;  2KNB A;  3UIO B;  3ZNI D;  2D11 A;  5HKH A;  3D32 A;  5DCN A;  3L16 A;  1EUV B;  1WYW B;  3EHV A;  4KZ0 A;  1WZ3 A;  3VDZ A;  5EDS A;  1KLV A;  4B6W A;  2KTR B;  3ZLZ A;  2JXX A;  4ANU A;  4HWI B;  4IWQ A;  2XK5 A;  3K9P B;  3DOW A;  2BYF A;  3KYC D;  3VH3 B;  2PPH A;  2LGX A;  1WI0 A;  2NPT A;  1X1M A;  2KFK A;  3PRE A;  4MH0 E;  4HCP B;  1TGZ B;  1JRU A;  2ZPY A;  3L13 A;  3RD2 A;  1P9D U;  2LVQ A;  3MTN B;  2DEN B;  5G55 A;  3R3M A;  3ZVV A;  2KWV B;  4BFR A;  3Q3F A;  3APC A;  1E90 A;  4P7I A;  2J7Q B;  1NI2 A;  5E6O A;  5AZF A;  3A9K B;  3QA8 A;  3ONS A;  4AP4 C;  4DDG D;  3RZW C;  4G3X B;  1OGW A;  3I3T B;  4IM3 A;  3V61 A;  2FIF A;  2IZV B;  2V1Y A;  5GMV A;  1YIW A;  2LAS A;  2AEH A;  1P1A A;  1C1Y B;  3PT2 B;  3PTF C;  4ANV A;  4GSW A;  3HK0 A;  1MG8 A;  2FCN A;  2KDB A;  4GDK B;  3RZF A;  2N9E B;  2DX5 B;  4MJS B;  4URK A;  3WIM A;  1GC7 A;  2D07 B;  2OOB B;  1OEY A;  2NBU A;  3O65 B;  2DZM A;  2G45 B;  3VVW B;  1WFY A;  4MSQ B;  3HHM A;  4WQO B;  1V5O A;  1RRB A;  2FCQ A;  2MA9 B;  2KQS A;  2KX3 A;  4DDI D;  2LXA A;  4TV3 A;  3NS8 A;  2UWQ A;  5IA7 A;  2PE6 B;  3ZKJ C;  2N1V A;  3QK0 A;  2Z0E B;  2JZZ A;  2LRU A;  4PYZ A;  4BBN C;  2MBH A;  4FBJ B;  2FUH B;  2HJ8 A;  2J0M A;  4N9F 4;  3UQB A;  3SU8 X;  1Z2M A;  3ZTC A;  4ANW A;  5L95 C;  2I1J A;  3N3K B;  3ZUN A;  1WH3 A;  1SE9 A;  3Q3J A;  4ZDV A;  2GBM A;  3R66 C;  2K1F A;  3V62 A;  2M4N A;  4YL8 A;  4DHJ B;  5DPS A;  3V60 A;  1E7V A;  2ZEQ A;  4KDL B;  4IM2 A;  3DBS A;  2M1M A;  5J17 A;  1VCB A;  2KLC A;  2WWZ A;  2KN5 A;  1GC6 A;  3H9D A;  3SD5 A;  1YX6 B;  4K7W A;  2BPS A;  3PZD A;  3QCA A;  3PV1 A;  4K1R B;  2W9N A;  3UF8 A;  3B0A A;  1P0R A;  4KIK B;  2KKC A;  1P98 A;  4BVU C;  1KOT A;  1WF9 A;  2KC2 A;  3PLU A;  4NAW B;  2IO1 B;  4DHJ D;  3P2B A;  3ZDT A;  1XQQ A;  2ZCC A;  2AL6 A;  4LCD E;  3KUZ A;  4W9F A;  3M62 B;  4GN1 A;  4LJP B;  2BKR B;  4G11 A;  4NY0 A;  3DBR I;  4FN2 A;  1ISN A;  1WX7 A;  2IY0 B;  3V6E B;  3M3J A;  1E8Y A;  2I1K A;  2LWP A;  1WJU A;  2KHW B;  4BOS C;  1Y8R C;  4HPL B;  3A4S C;  2EMS A;  2R2O A;  4EZJ A;  3TIX A;  4AJW A;  1RFA A;  3HM6 X;  3SHQ A;  2MBB B;  5C1Z A;  4II3 B;  3TCA A;  1K8R B;  2B3A A;  1F9J A;  1C3T A;  3IVF A;  5LLI A;  3VHT C;  2BYE A;  3KUC B;  2HTH A;  4M8N A;  2KJH B;  4FJV B;  2KTR A;  1J19 A;  2KVR A;  3TJP A;  2EKE C;  1WGR A;  2L3Z A;  4MGI E;  4OVU A;  4NJ6 A;  4XC2 A;  3VXW A;  3MHS D;  1WXS A;  2A5U A;  2EMT A;  4A20 A;  2DYB A;  2LVP A;  3CMM B;  3K9O B;  3BY4 B;  2O6V A;  4DHZ E;  3A4R A;  2J0K A;  3ML8 A;  4RM8 A;  1V81 A;  3QAR A;  1E8Z A;  1WX8 A;  2DAJ A;  4IUM B;  4GMV A;  1FXT B;  5JZE B;  3HM3 A;  4X57 B;  3B1L X;  3A9K A;  1U4A A;  2HE7 A;  4FUL A;  2JRI B;  1S3S G;  4M0W B;  3ZRF A;  2NBV B;  3QX1 A;  2IBI B;  1UZX B;  1V9J A;  2PE9 A;  2IO2 B;  1QZE A;  4W9H A;  1T0Y A;  3A9J B;  2JUO A;  3UQA A;  4JGH B;  4MEM A;  3X0W A;  4W9D A;  1WGD A;  2RR9 A;  3QQ8 B;  1YQB A;  2KMC A;  2R2Q A;  3APD A;  4GDL B;  2IO3 B;  4GDK A;  4NQK E;  4BKT A;  4CO7 A;  4EZL A;  4NJ7 A;  4MJS A;  4WWO A;  2XBB C;  3WAL A;  3APF A;  3C0R B;  5D6J B;  4WJN A;  2MP2 A;  3ECI A;  3IG3 A;  3PSE B;  5DPW A;  4LDT B;  3A33 B;  1EF5 A;  1V6E A;  1WXV A;  4ASW C;  4E71 A;  3PHW B;  3ML9 A;  4BBN F;  2O2V B;  2REX A;  3AI5 A;  2JZ3 B;  4HPM B;  3NY5 A;  2KTF A;  4B9K A;  2LRW A;  4GXB A;  2C60 A;  2RD0 A;  2L05 A;  2KDE B;  3CST A;  1XT9 B;  5D2M B;  1WGY A;  3EC8 A;  4DBG A;  2WYQ A;  4F7Z A;  2LD9 A;  3PRP B;  2M8S A;  4E74 A;  4HDQ A;  4WWP A;  2KC1 A;  1BT0 A;  1YD8 U;  5AZG A;  3EFU A;  3WAM A;  4DXA B;  3ZTD A;  2M17 A;  4LDT D;  4KSL C;  2NR2 A;  2XK5 B;  2L0T A;  1A5R A;  2LGD A;  3JSV A;  5JHB A;  2DZJ A;  1Q5W B;  1GJZ A;  3H7P B;  1V5T A;  4G0N B;  2ZCB A;  4WJO A;  5D7G A;  2N1W A;  1YX5 B;  2C7H A;  4GIV A;  4WAA A;  3L54 A;  5IAA C;  4XZ4 A;  2N9P C;  2A4Z A;  5CTR C;  1RLF A;  1AAR A;  2D2Q A;  3IBE A;  1LQB A;  3ZIM A;  3WA0 A;  2BF8 B;  2MSE D;  4FLH A;  1L7Y A;  3PPA A;  2KAN A;  2L76 A;  2V4L A;  4NAW A;  1Z5S B;  2ZNV C;  2AYO B;  1WIA A;  2FCS A;  3R7Q A;  3U7D A;  3ZDM C;  3CF6 E;  3PLV A;  3U8Z A;  1TBE A;  2N7E A;  4W9G A;  5FR6 A;  3VH4 B;  1NBF C;  2KWU B;  4AUQ C;  4BKS A;  1TZ1 A;  3PGE A;  1ZGU B;  2KJR A;  4AOF A;  4NQL B;  2WX1 A;  3L08 A;  4F8C B;  2C7N B;  2JF5 A;  2MBQ A;  2BYV E;  3B08 A;  3PS6 A;  5KHO A;  4G50 A;  1G6J A;  5LXI B;  1WY8 A;  3AUL A;  4WWN A;  3L0W B;  3L10 B;  2MBE A;  2ASQ A;  5CHW A;  2KWC A;  2KJ6 A;  3OJ3 A;  1UBI A;  3VUW A;  3H7S A;  2IO0 B;  5G2N A;  2IY1 B;  2JWZ A;  4CHK A;  1WZ0 A;  4ANX A;  2J0J A;  3ZRC A;  3N32 A;  1WM2 A;  4NNJ B;  3DVG X;  3ZNZ B;  1ZW7 A;  3QJZ A;  4IG7 B;  1WMH B;  5TR5 A;  2K6Q A;  2L7R A;  1WM3 A;  2XEW A;  1LFD A;  4OVV A;  5J18 A;  3S2A A;  4IWO A;  1J8C A;  3NHE B;  1HE8 A;  2CHZ A;  2KO3 A;  3CSF A;  2BWE S;  4CYE A;  1E7U A;  5J2R A;  3A1Q B;  2KFJ A;  3ZNG C;  2LUE A;  4II2 B;  4ICU A;  3AU4 A;  4FAD A;  4GGQ A;  1GUA B;  2YLM A;  2UYZ B;  2WX0 A;  1XD3 B;  5E6N A;  1H4R A;  2K8H A;  1WGG A;  2K8C A;  3GOE A;  3T8M A;  5DPT A;  4EFO A;  1UEL A;  1VD2 A;  3PRM B;  4JLC A;  4ZRI A;  3OLM D;  2DAF A;  2NCN A;  2N7D A;  4FHK A;  2NBW B;  3A9J A;  2KDF B;  2ZVN A;  2BKF A;  1TTN A;  3OJ4 B;  2G4S A;  3UIP B;  3VTW A;  4W9I A;  4GU2 A;  4A3O A;  2CU1 A;  2KZR A;  4HXD A;  5KHQ A;  3DQV A;  5C23 A;  3SDL C;  2NS5 A;  2MQJ A;  1UGM A;  2JY6 A;  2DYM A;  3L17 A;  1YJ1 A;  4A3P A;  3VQI A;  3ZO5 B;  1V2Y A;  1WGH A;  1E8X A;  2JT4 B;  2KD0 A;  2O2V A;  2RPQ A;  3QC8 B;  4PYU A;  4K7S A;  4W9K A;  4KV2 A;  4W9C A;  4FHJ A;  1WJ6 A;  1RAX A;  2N9X A;  1LM8 B;  1V49 A;  3DPD A;  4PS3 A;  2ZVO A;  4HVB A;  2LXC A;  4DWF A;  4GB9 A;  2GMI C;  3X23 A;  1WE7 A;  2DZK A;  4IC7 B;  2DZI A;  2RSU A;  4EEW A;  1WXA A;  2AWT A;  4NPN A;  4EZK A;  2JRH A;  4I6P A;  3PVL A;  3MJW A;  1KJT A;  3TL5 A;  2MX2 A;  3QAQ A;  1WXM A;  2BWF A;  4MGY E;  3U30 A;  3VAW A;  1UH6 A;  3KYD D;  2MLB A;  2O6V B;  1E5W A;  4ZYN A;  3H7P A;  3KW5 B;  4MDK E;  4W9E A;  4RM9 A;  3W1S C;  5AZH A;  4AWJ A;  5LXH A;  1PQS A;  5CHF A;  4ICV A;  4TQ1 A;  2HD5 B;  3NZU A;  5DPR A;  3VUX A;  4FA6 A;  1IPG A;  3TBL D;  3OAW A;  2DHZ A;  1M94 A;  2M0X A;  4DK5 A;  4BOZ B;  2FCM A;  3W1S A;  3JYU A;  1I42 A;  3R7R A;  3DVN V;  2NPT B;  4JQW C;  3WAP A;  2KFK B;  1WJ4 A;  2ZJD A;  4KZC A;  2KMA A;  4MSM B;  4GOC A;  2LZ6 A;  3KVF B;  1ZKH A;  2PJH A;  1R4M I;  2D3G A;  2LJ5 A;  2O6V D;  5AEK B;  3ALB A;  3GZN I;  1KM7 A;  3DBH I;  3KUD B;  5JHA A;  4HJK A;  4KIK A;  2FNJ B;  3BIN A;  3AXC A;  3JVZ X;  1V80 A;  4M8M A;  5L83 A;  2N4F A;  1WX9 A;  2MP2 B;  1OTR B;  4I6N B;  4JIO U;  3DVN U;  4KSK C;  4JL9 A;  4F1S A;  2RGF A;  5D94 A;  4TUU A;  3W1Y A;  3RCZ A;  1UD7 A;  1WRD B;  4PS8 A;  3RUL A;  1Q1O A;  3IFW B;  1OEY J;  1D3Z A;  4HDO A;  4EUT A;  1H8C A;  2YVC A;  5CX3 A;  4MM3 A;  2Y5B B;  4ZRJ A;  2CKH B;  2L8J A;  3RUI B;  1IP9 A;  1NDD A;  3KH0 A;  2CR5 A;  3LJ3 A;  1WMH A;  3QIJ A;  4K7U A;  3VTV A;  1SGH A;  1WE6 A;  2KDI A;  3NOB A;  3PRZ A;  4J6I A;  2QHO A;  3UIN B;  4EKU A;  3DCG A;  5JH5 C;  2MWS B;  3DVG Y;  3DDC B;  3NZS A;  4IM0 A;  4ZRK A;  2FID A;  2CS4 A;  2WDT B;  4W9L A;  2GBR A;  3A1Q A;  3JSV B;  2K39 A;  2MCN B;  4DHZ B;  2L00 B;  3HIZ A;  3LDZ E;  1WJN A;  3M63 B;  4K81 A;  5BO4 B;  3M95 A;  3ZW3 A;  2LGY A;  2JVC A;  1WR6 E;  2KQ7 A;  2ZPN A;  1J0G A;  3DBL I;  1LXD A;  4HLE A;  2C5L C;  1EF1 A;  3QWZ B;  4PS7 A;  2KOX A;  2CHX A;  4MGK E;  3VTU A;  4B95 A;  2JPH A;  2GOW A;  3VUY A;  4IWP A;  4MEL A;  1UBQ A; 
#chains in the Genus database with same CATH topology
 2LVO A;  2VRR B;  1I35 A;  3FIL B;  3RYT A;  1EO6 A;  4KVG B;  4EOY A;  2GBJ A;  1MHX A;  2OED A;  1E10 A;  2LI5 A;  3ZNH B;  3WAN A;  2C7M B;  4FJZ A;  1UF0 A;  1Q0W B;  1F1H A;  3DHH C;  1CMX B;  4E3C A;  1FEH A;  4W9J A;  1VRA B;  2NVU I;  1M4V A;  5G5H A;  4A9A A;  1V1P A;  2XNA C;  4BKS D;  4TKN A;  5JXV A;  1UGJ A;  2KVZ A;  2GBK A;  4IW0 A;  4HK2 A;  1K52 A;  3T9L A;  2G1E A;  3RMK C;  4IDI A;  3D32 A;  3VDZ A;  1WYW B;  3EHV A;  1WZ3 A;  3L4P A;  4HRO A;  4IWQ A;  3VH3 B;  1WI0 A;  2NPT A;  1X1M A;  2KFK A;  2Y5P A;  4BZA A;  1CQV A;  2GI9 A;  3RD2 A;  1CZP A;  3MTN B;  5G55 A;  3ZVV A;  1E90 A;  5HFY A;  3A9K B;  3ONS A;  1WXQ A;  4DDG D;  1Q10 A;  5GMV A;  2OHF A;  4IKG A;  2AEH A;  3PTF C;  4ANV A;  4GSW A;  2FCN A;  4GDK B;  3RZF A;  5FK9 C;  4NJC A;  1PGA A;  1YQ4 B;  2OOB B;  1OEY A;  2G45 B;  4OZB A;  1A70 A;  3HHM A;  2KT7 A;  4DDI D;  2UWQ A;  5IA7 A;  3ZKJ C;  4HRS A;  3BZD B;  2JZZ A;  4OVZ A;  4FBJ B;  2FUH B;  2J0M A;  1KF6 B;  3NS1 A;  1Z2M A;  3SU8 X;  3ZTC A;  5L95 C;  3N3K B;  2RMM A;  1WH3 A;  4ZDV A;  1L4D B;  2GBM A;  3R66 C;  4LK0 M;  4DHJ B;  1N5W A;  5DPS A;  4JE3 B;  3HVD A;  5BYS A;  4C7Z A;  3FIL A;  1ZE3 D;  1SXT A;  2WWZ A;  4KX6 B;  3SR6 A;  3QCA A;  3PV1 A;  5HI1 A;  3O13 A;  2KN4 A;  2WS3 B;  2KC2 A;  3GS2 A;  3P2B A;  3Q3N C;  4LCD E;  3KUZ A;  4W9F A;  4GN1 A;  2WXF A;  2BKR B;  4G11 A;  4NY0 A;  2IY0 B;  4QAY A;  4DXG A;  4RGM A;  3M3J A;  1E8Y A;  2I1K A;  2LWP A;  1C79 A;  3AMZ A;  4EZJ A;  4AJW A;  3SHQ A;  3TCA A;  2L52 A;  2B3A A;  5C2T B;  4REZ A;  3Q2A C;  1I4Q A;  2BYE A;  2BVC A;  1IBX A;  3BII D;  1J19 A;  3TJP A;  5HG2 A;  2MEK A;  4KGS A;  2EMT A;  3K9O B;  3BY4 B;  1C9F A;  4WWM A;  2O6V A;  1AWD A;  1R4M B;  3H8H A;  4RM8 A;  4PK1 A;  2DAJ A;  2WHI A;  1QF6 A;  3DHG C;  5JZE B;  3IT4 B;  4XE0 A;  5G5G A;  3A9K A;  2RPV A;  1S3S G;  4M0W B;  1HQR D;  2IBI B;  1V9J A;  1N62 A;  4W9H A;  1UUP A;  3A9J B;  3X0W A;  1FRR A;  3APD A;  3HVZ A;  4GDK A;  4RGT A;  4BKT A;  2IO3 B;  2XBB C;  2LUM A;  4C7Y A;  3Q6B A;  1T0S C;  2QSD A;  2I2Y A;  4E71 A;  2KYW A;  3PHW B;  2REX A;  3P4R B;  2BT6 A;  3DWG C;  3NY5 A;  4GXB A;  2C60 A;  3LYY A;  3CST A;  1XT9 B;  3PRP B;  1HZ6 A;  3WAM A;  4RGN A;  3ZTD A;  2NR2 A;  1A5R A;  2L0T A;  4A55 A;  2DZJ A;  4AQ7 A;  4DQO C;  2N1W A;  2J42 A;  1YX5 B;  2GB1 A;  1ZUD 2;  3L54 A;  1XCT L;  1PUT A;  2A4Z A;  5CTR C;  3ZIM A;  4YTN B;  2EKI A;  1V97 A;  2ZNV C;  2AYO B;  3R7Q A;  1MJD A;  3U7D A;  3P1M A;  3CF6 E;  4W9G A;  3VH4 B;  1VJK A;  1NBF C;  3PGE A;  2FUG 1;  4AOF A;  3EFC A;  4F8C B;  2C7N B;  2JF5 A;  5BMI A;  3PS6 A;  5KHO A;  2BQQ A;  3B2F A;  1D4B A;  2MBE A;  5CHW A;  2KWC A;  3OJ3 A;  2J0J A;  3DVG X;  1ZW7 A;  3QJZ A;  3AEA B;  1LFD A;  4HKZ E;  4IWO A;  1J8C A;  2WXN A;  2CHZ A;  4CYE A;  5J2R A;  5H92 C;  4OW0 A;  3AU4 A;  2WLB A;  1JCK B;  1NEN B;  3VRB B;  1XD3 B;  1WGG A;  3Q8A A;  1VD2 A;  3PRM B;  3A9J A;  4O1N A;  2KDF B;  3CIR B;  4W9I A;  3GZN B;  1L0X B;  3U7Z A;  4HXD A;  1SE4 A;  2K5P A;  4A3P A;  2WDV B;  1WGH A;  2RPQ A;  1F52 A;  4RFB A;  1NYR A;  3ZJV A;  1WJ6 A;  2N9K A;  1LM8 B;  1V49 A;  2ZVO A;  1WE7 A;  3Q69 A;  4EEW A;  2AWT A;  2ZW0 A;  3AEC B;  4WH4 A;  3PVL A;  2IGD A;  1UWX A;  3QAQ A;  2LHE A;  2BWF A;  3T3O A;  4N6E B;  4YXD B;  2MLB A;  4AWJ A;  3KW5 B;  4RM9 A;  4K3B A;  5CHF A;  3NZU A;  1FCL A;  2DHZ A;  3R2T A;  3WCQ A;  1I42 A;  1ROE A;  3ZQ4 A;  4ARC A;  3WAP A;  1WJ4 A;  2KMA A;  2JYE A;  2D3G A;  1KM7 A;  3DBH I;  5JHA A;  4KIK A;  1TY0 A;  4K3C A;  3OWE B;  3AED B;  1FO4 A;  1OTR B;  4I6N B;  4F1S A;  1UWM A;  3W1Y A;  2DNF A;  3RCZ A;  2KDM A;  3ZGZ A;  3RUL A;  1DYQ A;  1H8C A;  1LO5 D;  3EUB 2;  4ZRJ A;  2CKH B;  3RUI B;  1NDD A;  3KH0 A;  2VH1 A;  2WXG A;  2BW2 A;  2M19 A;  3PRZ A;  3UIN B;  3ZXR A;  1XO3 A;  4S0R A;  2QMT A;  3DVG Y;  3NZS A;  2FID A;  3NVW A;  3AEG B;  2KMM A;  3JSV B;  2K39 A;  2MCN B;  4TMA B;  5FKA C;  3LDZ E;  5BO4 B;  2BB5 A;  3M95 A;  1YOV B;  1C76 A;  2LGY A;  2PKO A;  2KQ7 A;  1FMA D;  2KOX A;  2CHX A;  3VTU A;  4B95 A;  2K9X A;  2GOW A;  1LGR A;  3VUY A;  3E9S A;  2EEL A;  3ABV B;  4TQ0 A;  1OQY A;  2TSS A;  1IUE A;  3JW0 X;  2BGF A;  1DGJ A;  1P3Q U;  1F0Z A;  2OJR A;  4AJY B;  3RFZ B;  4OZA A;  2Z0D B;  4MT5 A;  2RDB C;  3GP7 A;  2K6D B;  4XYC A;  2WXQ A;  4L2Y A;  2KLG A;  3QHT A;  2C9W B;  1QQR A;  2K8B A;  1P7F A;  3EEC A;  3MHZ A;  1BML C;  2PLP A;  4WJQ A;  3Q8F A;  3AE2 B;  5DCN A;  3L16 A;  3NJT A;  1V1O A;  3P4S B;  2BYF A;  4M01 A;  2LGX A;  3PRE A;  1JRU A;  3IAS 1;  3L13 A;  1P9D U;  3R3M A;  3MC0 B;  3Q3F A;  4P7I A;  3QA8 A;  2INP E;  2WNM A;  3I3T B;  1JW9 D;  3V61 A;  3AE3 B;  2IZV B;  2V1Y A;  1TS4 A;  1YIW A;  1FPY A;  3DBR B;  2DX5 B;  2LGI A;  5AUK A;  1UNS A;  2WXO A;  3SFE B;  1DOY A;  1GC7 A;  4XWW A;  2NBU A;  1L0Y B;  1WFY A;  1RRB A;  1YNT E;  2MA9 B;  2KQS A;  2KX3 A;  3AV8 A;  2LXA A;  3NS8 A;  2N1V A;  2LRU A;  4PYZ A;  4C00 A;  4BBN C;  2MBH A;  2HJ8 A;  1SE3 A;  3UQB A;  2RDH A;  1N61 A;  4ANW A;  2N9L A;  2INC C;  4RCO A;  4JWS C;  1TKG A;  3V62 A;  2Q5W D;  3V60 A;  1E7V A;  2ZEQ A;  3SEB A;  1TYG B;  1SJE D;  3DBS A;  2M1M A;  5J17 A;  1VCB A;  1FRD A;  1GC6 A;  3H9D A;  3SD5 A;  1YX6 B;  4MH8 A;  3PZD A;  3B0A A;  1P0R A;  1P98 A;  3P4P B;  1WF9 A;  2ICI A;  3EA6 A;  3ZDT A;  1XQQ A;  1XXG A;  4L23 A;  4LJP B;  2BBC A;  5GXG B;  1WX7 A;  4MM3 B;  1WJU A;  4HPL B;  1C78 A;  2R2O A;  2N0S B;  4M00 A;  3TIX A;  4AS1 A;  2YEP F;  4WAF A;  5C1Z A;  2MBB B;  3PZ7 A;  4KGR A;  3VHT C;  2UU7 A;  4OZC A;  2BTE A;  4M8N A;  3MHS D;  3KWL A;  2A5U A;  4P1C C;  4A20 A;  3CMM B;  1ZP0 B;  2W55 A;  3AE9 B;  2M56 B;  4DHZ E;  1E8Z A;  4IUM B;  4GMV A;  2WGS A;  2ACZ B;  3HM3 A;  4X57 B;  3BYY B;  1I4X A;  2HE7 A;  3ZRF A;  2NBV B;  3QX1 A;  2PE9 A;  4ZRP A;  2IO2 B;  1TZO A;  1T0Y A;  1E7P B;  3UI3 A;  3J9C A;  5AUI A;  2KMC A;  4GDL B;  1ENF A;  2WU5 B;  4CO7 A;  4NJ7 A;  4RF0 A;  2KWD A;  2MP2 A;  3ECI A;  4KKI A;  3A33 B;  1VLB A;  2O2V B;  3AI5 A;  2QC8 A;  3Q8C A;  1TKE A;  1DOI A;  1IGC A;  4B9K A;  1I4P A;  1GB1 A;  2JSV X;  2KDE B;  5D2M B;  4HEA 1;  4F7Z A;  2JX5 A;  1XLQ A;  1ZDV A;  3U52 E;  1BT0 A;  3CWI A;  1D5X C;  3EFU A;  3PO0 A;  4LNO A;  4DXA B;  2M0A A;  4LDT D;  2XK5 B;  1FXI A;  2W82 A;  1JWS D;  3DHI C;  3H7P B;  4G0N B;  5D7G A;  2PTL A;  1RLF A;  1L7Y A;  1N63 A;  3PPA A;  2L76 A;  2V4L A;  5IOI A;  2MH7 A;  1WIA A;  1I7H A;  3MC9 A;  2N7E A;  3ZYY X;  2KWU B;  2IND C;  4WIP A;  4NQL B;  2WU2 B;  5D3D A;  4DXF A;  1WY8 A;  1JWA D;  2AQ2 B;  2CU3 A;  3L10 B;  3L0W B;  2ASQ A;  2IDY A;  2KJ6 A;  2BS4 B;  1GPX A;  5G2N A;  1L6V A;  1TS2 A;  3RN9 C;  1WZ0 A;  2E3T A;  4NNJ B;  1WMH B;  5TR5 A;  2XEW A;  2W54 A;  1FNW A;  2KO3 A;  2BWE S;  1E7U A;  2KFJ A;  4ICU A;  4GGQ A;  5E6J A;  2YLM A;  1QOB A;  5E6N A;  2K8H A;  4B0M A;  5DPT A;  4ZRI A;  1XLP A;  3Q14 C;  2G4S A;  3KLS X;  2WXK A;  4A3O A;  4C56 C;  2N7J A;  5C23 A;  1HTO A;  2NS5 A;  4M02 A;  2DYM A;  1YJ1 A;  3FKY A;  1OFF A;  5EE3 A;  1E8X A;  2JT4 B;  2O2V A;  4PYU A;  4PS3 A;  3DPD A;  3NZ3 A;  1BXT A;  3NUH B;  2LXC A;  4GB9 A;  2GMI C;  3X23 A;  2DZK A;  4IC7 B;  2QDF A;  4P1B C;  4NPN A;  5C3J B;  3AE7 B;  2V0G A;  3TL5 A;  1I4G A;  1JWM D;  5T8I A;  3ZJU A;  4MGY E;  1WXM A;  3VAW A;  3AEF B;  3KYD D;  2DWQ A;  1QIL A;  1L4Z B;  3H7P A;  3W1S C;  4W9E A;  1E9M A;  3DBL B;  1JWB D;  2HDE A;  1EWY C;  1PGX A;  4BOZ B;  3W1S A;  3JYU A;  1C4C A;  3PZ8 A;  2ZJD A;  4YSY B;  2LZ6 A;  2O6V D;  3ALB A;  3GZN I;  4A8X C;  4HJK A;  4H2A A;  2FNJ B;  3JVZ X;  1WX9 A;  1ZOY B;  1WSP A;  1PGB A;  4JL9 A;  1L0V B;  4PS8 A;  3IFW B;  4HDO A;  2YVC A;  5CX3 A;  2Y5B B;  1EU3 A;  1IP9 A;  2QJL A;  3C8Y A;  3ZXV A;  4ZHO A;  3LJ3 A;  1WMH A;  3BK1 A;  4J6I A;  1ZXH A;  2QHO A;  5FR3 A;  1TIF A;  1QT9 A;  3DCG A;  2MWS B;  3DDC B;  1R4N B;  4W9L A;  1E6E B;  2QIE B;  1YQ3 B;  3HIZ A;  1WR6 E;  2ZPN A;  1J0G A;  2C5L C;  1EF1 A;  5D3I B;  2J52 A;  1VR9 A;  3LXF A;  1TS5 A;  4MGK E;  2QIL A;  1MFW A;  2IYD B;  2Z59 B;  3AU5 A;  5EE0 A;  2CHW A;  4P6V F;  5E6P A;  2KK8 A;  4MGZ E;  4KDI C;  2BS3 B;  3TEX A;  4M0W A;  1Y56 A;  2BYT A;  2K25 A;  4RMA A;  3RNC C;  2VZK D;  2H88 B;  2ZZP B;  1N60 A;  2KX0 A;  4LJO B;  3V6C B;  1BUI C;  1MI0 A;  2PMV A;  2AL3 A;  3PHX B;  2WQY B;  1SIF A;  4BKG A;  2PIA A;  3N30 A;  2G4D B;  4ZHP A;  2DYO A;  4JWU C;  2WDQ B;  2WP9 B;  4I6L B;  2D10 A;  1SIJ A;  2JYT A;  3RT3 B;  3VFK A;  3IHP C;  2MBO A;  3TMP B;  4TSS A;  3WAO A;  3ZNI D;  1KLV A;  5EDS A;  1GB4 A;  1ACC A;  2LHD A;  1EU4 A;  1SE2 A;  3ZLZ A;  2L32 A;  2NTT A;  2B76 B;  3DOW A;  2R61 A;  2PPH A;  3TEZ A;  4BAX A;  2JQR B;  4MH0 E;  4HCP B;  3FC4 A;  1TGZ B;  2CJO A;  1VZ7 A;  2ZPY A;  2LVQ A;  2I38 A;  2DEN B;  2KWV B;  4BFR A;  2DBY A;  3TUO A;  1MPE A;  2J7Q B;  1NI2 A;  4HJG E;  5AZF A;  2IGH A;  1TY2 A;  1XEE A;  4PT5 A;  4AP4 C;  2H89 B;  3RZW C;  4G3X B;  2E6X A;  1QOF A;  3TEW A;  2FIF A;  2DLB A;  3Q3O C;  1XF5 L;  2FE8 A;  3PT2 B;  1MG8 A;  3VR8 B;  2KDB A;  4NAM A;  2N9E B;  1L6U A;  1XLN A;  1RFK A;  4MJS B;  4URK A;  4A90 A;  3ETR A;  3O65 B;  1TJE A;  1VDV A;  2DZM A;  4GLS C;  4MSQ B;  4WQO B;  3DWM A;  1HA5 A;  4US8 A;  4TV3 A;  2PE6 B;  3QK0 A;  2Z0E B;  1GOZ A;  4RNA A;  1OQR A;  4N9F 4;  3AE8 B;  3N1Y C;  4LNI A;  5IN7 A;  3ZUN A;  1K53 A;  3RNG C;  2X38 A;  3Q3J A;  1FCC C;  4YL8 A;  2LFI A;  1STE A;  3P42 A;  3BWU D;  4YSZ B;  3AE5 B;  2W9N A;  1QOG A;  4BVU C;  3SFD B;  1HEZ E;  2ZCC A;  1WRI A;  3AB5 A;  2ONQ A;  1HZ5 A;  2V4I B;  3DBR I;  4FN2 A;  1FD6 A;  3OG5 A;  3MP9 A;  4BOS C;  1RFA A;  3HM6 X;  2MJE A;  1C3T A;  3IVF A;  3KUC B;  1QKZ A;  2HTH A;  1QOA A;  2EKE C;  2L3Z A;  4MGI E;  4LNN A;  2Y3A A;  4OVU A;  4XC2 A;  1OQQ A;  3ZJT A;  1KFY B;  3R8B A;  3A4R A;  3ML8 A;  3I5J C;  3DBH B;  1ET9 A;  1U4A A;  4FUL A;  3AE1 B;  2JRI B;  4YTP B;  1UZX B;  1QZE A;  2JUO A;  3UQA A;  4JGH B;  3QQ8 B;  2PVO D;  2RR9 A;  1YQB A;  1FNV A;  2R2Q A;  3N9Y C;  3BVM A;  1B9R A;  1TKY A;  4MJS A;  1V1P B;  2HTM E;  3APF A;  3C0R B;  2RDG A;  4LNK A;  1XLO A;  1K51 A;  4LDT B;  1EF5 A;  1D6E C;  1V6E A;  1WXV A;  1KH0 A;  4BBN F;  2JZ3 B;  3I57 A;  4HPM B;  4ZYS A;  2PVG C;  3TSS A;  2RD0 A;  3EC8 A;  4DBG A;  2WYQ A;  2M8S A;  4WWP A;  5AZG A;  3U2S C;  2M17 A;  3AH7 A;  4KSL C;  3Q3M C;  2YEP B;  3JSV A;  5JHB A;  2KAJ A;  4HPP A;  1GJZ A;  1V5T A;  1RWS A;  4WAA A;  3URY A;  5IAA C;  3IBE A;  1LQB A;  1T0R C;  2MSE D;  4FLH A;  2FBW B;  2JZP A;  2SAK A;  1Z5S B;  2LEK A;  1KRH A;  4NZL B;  3ZDM C;  1EWC A;  3U8Z A;  1TBE A;  4YT0 B;  4ZRQ A;  4BKS A;  1TZ1 A;  1ZGU B;  2SEB D;  2W3S A;  2KJR A;  4OHJ A;  1P7E A;  2WX1 A;  3B08 A;  2BYV E;  4G50 A;  2GLS A;  2INN E;  1FNU A;  3AUL A;  4WWN A;  2D3A A;  1UBI A;  5BYR A;  3H7S A;  3VUW A;  2IY1 B;  2JWZ A;  1N5X A;  2MJD A;  3N32 A;  1ZPS A;  1WM2 A;  3KWV A;  3ZNZ B;  2IGG A;  4ACF A;  1SB3 C;  1WM3 A;  4OVV A;  3MJ5 A;  3NHE B;  2KQ4 X;  1IGD A;  3CSF A;  4LLG M;  3ZNG C;  2LUE A;  4IOI E;  2JWU A;  4FAD A;  4RF1 A;  4RH6 A;  3BVZ A;  1DOX A;  3RI7 C;  3GOE A;  3T8M A;  4EFO A;  1UEL A;  4JLC A;  2ON8 A;  3HUI A;  2N7D A;  1F2R I;  4US9 A;  2K3U A;  2OJW A;  2ZVN A;  3RNB C;  1TTN A;  1KTK A;  3UIP B;  3GE3 C;  3VTW A;  5BMG A;  5KHQ A;  3SDL C;  3W2D A;  2D3B A;  3VQI A;  3ZO5 B;  4RGO S;  5EE9 A;  2KD0 A;  3QC8 B;  4K7S A;  5LNK 1;  4W9K A;  1NVI D;  2QEJ C;  4JX1 C;  4DWF A;  2MHJ A;  1WXA A;  1IBX B;  4EZK A;  4I6P A;  3MJW A;  4HKQ A;  3B9J A;  1KJT A;  2MX2 A;  1UH6 A;  2HJ1 A;  2O6V B;  5AZH A;  1PQS A;  1JRP A;  4TQ1 A;  3IXS A;  3OAW A;  1T3Q A;  4DK5 A;  2FCM A;  4JQW C;  3IAM 1;  4GOC A;  1WYG A;  2PJH A;  1R4M I;  2LJ5 A;  5BYQ A;  3KUD B;  2WXI A;  3AXC A;  5L83 A;  3VRA B;  1QLB B;  2N4F A;  1JWU D;  3Q8E A;  1C4A A;  2AQ1 B;  4KSK C;  2RGF A;  5D94 A;  1UD7 A;  1D3Z A;  4MM3 A;  1MG4 A;  2L8J A;  5IKC M;  2CR5 A;  1XCQ L;  3VTV A;  1SGH A;  1WE6 A;  5JH5 C;  3NVV A;  1V8C A;  2CS4 A;  2WDT B;  1ZDX A;  2L00 B;  1WJN A;  3ZW3 A;  3NG0 A;  1T6B X;  5I4D A;  3DBL I;  4HLE A;  5IO9 A;  2VZK B;  2AQ3 B;  3AEB B;  4IWP A;  1GNU A;  3ENE A;  1E8W A;  2G3Q B;  1FIQ A;  1KLG D;  1JML A;  2ZNV B;  1L2N A;  1SSN A;  2V9H A;  4FJY A;  4KGT A;  2MRP A;  3H1U A;  1YJJ A;  1FFU A;  4GDL A;  2V3S A;  3AN1 A;  3RNF C;  2PEA A;  2WXL A;  4YSX B;  1V86 A;  4ARI A;  3H6N A;  3UGB B;  4XX5 A;  3W5U B;  5CHV C;  1GG3 A;  2FAZ A;  2Z8L A;  1S1Q B;  4XDC A;  2GBN A;  1T5X D;  4WJP A;  3GB1 A;  1R4N I;  1WR1 A;  1FM0 D;  2KXJ A;  2L0F A;  1YN4 A;  5HHD G;  2MW5 A;  1IYF A;  4HCN B;  2KNB A;  3UIO B;  5HKH A;  2D11 A;  1SJH D;  1EUV B;  4KZ0 A;  4B6W A;  2KTR B;  4LNF A;  2JXX A;  4ANU A;  4XWT A;  4HWI B;  2XK5 A;  3K9P B;  3KYC D;  2W3R A;  1NI3 A;  1T0Q C;  1FFV A;  3W9C B;  1F2R C;  3V05 A;  1WWT A;  3APC A;  3EGR A;  5E6O A;  1OGW A;  4IM3 A;  2LAS A;  2KAC A;  4ITK A;  1P1A A;  1C1Y B;  3HK0 A;  3WIM A;  2D07 B;  2X8X X;  4B0E A;  5MPO A;  2ZW1 A;  1AW7 A;  3VR9 B;  3P4Q B;  3VVW B;  3KQ4 A;  3P63 A;  1V5O A;  2FCQ A;  3AEE B;  1K50 A;  1VZ8 A;  2JU6 X;  3TEY A;  4USA A;  1RM6 C;  2I1J A;  1SE9 A;  2K1F A;  2M4N A;  2K0P A;  3NVZ A;  1ZXI A;  4KDL B;  5EE1 A;  4IM2 A;  3AM9 A;  1CK1 A;  2KLC A;  2KN5 A;  3T3N A;  4K7W A;  2BPS A;  1HTQ A;  4K1R B;  3UF8 A;  4KIK B;  1PFD A;  2KKC A;  1SBB B;  1KOT A;  1I4H A;  3PLU A;  4NAW B;  2IO1 B;  4DHJ D;  4XGA B;  2AL6 A;  1C4P A;  4C80 A;  3M62 B;  1PDX A;  4UDU C;  3GE8 C;  2QCZ A;  1SF0 A;  1ISN A;  3V6E B;  1YN3 A;  4S17 A;  2MJ3 A;  2KHW B;  4JPS A;  1Y8R C;  2D3C A;  1J7C A;  3A4S C;  2EMS A;  1VZ6 A;  3N20 C;  1R7S A;  4C4V B;  2IPK D;  1FXA A;  4II3 B;  1C77 A;  1K8R B;  1F9J A;  1PYW D;  5TSS A;  5LLI A;  3I63 C;  1CJE A;  2PW9 A;  2KJH B;  4FJV B;  2KTR A;  2KVR A;  1WGR A;  1JQ4 A;  1AYF A;  1YN5 A;  4NJ6 A;  3VXW A;  1WXS A;  2DYB A;  2LVP A;  2NMQ A;  2VH2 A;  2J0K A;  1V81 A;  3QAR A;  1WX8 A;  1TS3 A;  1FXT B;  2XN9 C;  3B1L X;  3E56 A;  2L83 A;  2Y5C A;  2NTS A;  2BB6 A;  4MEM A;  1B1Z A;  4W9D A;  1WGD A;  4NQK E;  4D2K A;  4MAC A;  4EZL A;  2WDR B;  1E0Z A;  4WWO A;  1D5Z C;  3WAL A;  5D6J B;  4WJN A;  3PSE B;  3IG3 A;  5DPW A;  2JXT A;  3NRZ A;  4ASW C;  3ML9 A;  2KTF A;  1GAQ B;  2LRW A;  2L05 A;  1WGY A;  2LD9 A;  2G9H D;  4E74 A;  1I4R A;  2WXR A;  1KLU D;  4HDQ A;  2KC1 A;  1YD8 U;  5H8Y E;  3BK2 A;  2WXP A;  4A6Q A;  2J53 A;  1NYQ A;  2WXH A;  2K22 A;  2LGD A;  4N59 A;  1Q5W B;  4WJO A;  1ESF A;  2ZCB A;  4YTM B;  2C7H A;  2WXM A;  3RPF C;  4GIV A;  4XZ4 A;  1ET6 A;  2N9P C;  1AAR A;  2D2Q A;  3WA0 A;  2BF8 B;  2KAN A;  4NAW A;  1YMH E;  3C19 A;  2V3N A;  3AE6 B;  2FCS A;  3PLV A;  5FR6 A;  4AUQ C;  3MC8 A;  2LMC A;  3L08 A;  2MBQ A;  1G6J A;  5LXI B;  4C4V A;  3NVY A;  1N6Z A;  2IO0 B;  4CHK A;  4ANX A;  2IJ0 A;  3ZRC A;  3W5V B;  4IG7 B;  3IT6 B;  2K6Q A;  2L7R A;  4EE2 A;  5J18 A;  3S2A A;  2V3P A;  4ZOH C;  1HE8 A;  4WQM A;  1MVK A;  2D5G A;  1J7A A;  2AX5 A;  3A1Q B;  4II2 B;  3V3X A;  1GUA B;  1HXY D;  2UYZ B;  2WX0 A;  3RNE C;  3RNA C;  1H4R A;  2K8C A;  5BMH A;  3OLM D;  2DAF A;  1D5M C;  2NCN A;  3HRD D;  4FHK A;  2NBW B;  4WUR A;  2LJI A;  1AN8 A;  1J7B A;  2BKF A;  3OJ4 B;  4GU2 A;  2CU1 A;  2KZR A;  3DQV A;  1MHH E;  2MQJ A;  1UGM A;  2LGS A;  2JY6 A;  3L17 A;  4FXC A;  5IP4 D;  1V2Y A;  4CQN A;  2J4X A;  2GRI A;  2L1A A;  4XDD A;  1YJI A;  4KV2 A;  4R3D A;  1JRO A;  4W9C A;  4FHJ A;  1RAX A;  2N9X A;  4KKJ A;  4J3O D;  4HVB A;  2DZI A;  2RSU A;  2JRH A;  1L5P A;  3N1X C;  3U30 A;  4ZYN A;  1E5W A;  4MDK E;  3N1Z C;  5LXH A;  4YWG G;  4ICV A;  1RYJ A;  2WXJ A;  3AE4 B;  2HD5 B;  5DPR A;  3VUX A;  4FA6 A;  1IPG A;  3TBL D;  1F77 A;  1M94 A;  2M0X A;  3R7R A;  3BYT B;  4P16 A;  3DVN V;  2NPT B;  2KFK B;  4KZC A;  4MSM B;  4N58 A;  3KVF B;  1ZKH A;  5AEK B;  3R2I A;  1WGK A;  3BIN A;  4M8M A;  1V80 A;  2MP2 B;  1SEB D;  4JIO U;  3DVN U;  3BVG A;  4TUU A;  3FAH A;  4L1B A;  1WRD B;  1Q1O A;  1OEY J;  1JAL A;  4EUT A;  3LB8 C;  2BS2 B;  3Q8B A;  4K7U A;  3QIJ A;  2KDI A;  3NOB A;  4LTU A;  3MFG A;  4EKU A;  4IM0 A;  4ZRK A;  2CJN A;  2GBR A;  3A1Q A;  4DHZ B;  3I9V 1;  3B2G A;  4K81 A;  4Q2J A;  3M63 B;  3U4E G;  1NEK B;  2JVC A;  1TT5 B;  1LXD A;  3QWZ B;  4PS7 A;  2JPH A;  1EM7 A;  4MEL A;  1UBQ A; 
#chains in the Genus database with same CATH homology
 2IYD B;  1GNU A;  2Z59 B;  2LVO A;  3AU5 A;  2VRR B;  3ENE A;  1I35 A;  4TQ0 A;  1OQY A;  3RYT A;  1EO6 A;  1E8W A;  4KVG B;  2G3Q B;  3JW0 X;  2BGF A;  2CHW A;  5E6P A;  2KK8 A;  4MGZ E;  4KDI C;  4EOY A;  2GBJ A;  1P3Q U;  2LI5 A;  2ZNV B;  3WAN A;  2C7M B;  4FJZ A;  2OJR A;  3ZNH B;  4AJY B;  1L2N A;  4FJY A;  1Q0W B;  2MRP A;  2K25 A;  4RMA A;  2Z0D B;  3H1U A;  2K6D B;  2ZZP B;  2KX0 A;  1CMX B;  4GDL A;  4LJO B;  4E3C A;  2V3S A;  3V6C B;  4W9J A;  2PEA A;  2KLG A;  1V86 A;  2AL3 A;  2NVU I;  3PHX B;  3QHT A;  3H6N A;  3UGB B;  1SIF A;  4BKG A;  2C9W B;  3N30 A;  2G4D B;  4BKS D;  4TKN A;  2DYO A;  4XX5 A;  5CHV C;  1GG3 A;  2GBK A;  4I6L B;  2FAZ A;  2K8B A;  1S1Q B;  2D10 A;  3RT3 B;  4IW0 A;  4HK2 A;  3VFK A;  2GBN A;  4WJP A;  3EEC A;  3T9L A;  3IHP C;  1R4N I;  2MBO A;  3TMP B;  1WR1 A;  2KXJ A;  4WJQ A;  2L0F A;  2MW5 A;  3WAO A;  1IYF A;  4HCN B;  2KNB A;  3UIO B;  3ZNI D;  2D11 A;  5HKH A;  3D32 A;  5DCN A;  3L16 A;  1EUV B;  1WYW B;  3EHV A;  4KZ0 A;  1WZ3 A;  3VDZ A;  5EDS A;  1KLV A;  4B6W A;  2KTR B;  3ZLZ A;  2JXX A;  4ANU A;  4HWI B;  4IWQ A;  2XK5 A;  3K9P B;  3DOW A;  2BYF A;  3KYC D;  3VH3 B;  2PPH A;  2LGX A;  1WI0 A;  2NPT A;  1X1M A;  2KFK A;  3PRE A;  4MH0 E;  4HCP B;  1TGZ B;  1JRU A;  2ZPY A;  3L13 A;  3RD2 A;  1P9D U;  2LVQ A;  3MTN B;  2DEN B;  5G55 A;  3R3M A;  3ZVV A;  2KWV B;  4BFR A;  3Q3F A;  3APC A;  1E90 A;  4P7I A;  2J7Q B;  1NI2 A;  5E6O A;  5AZF A;  3A9K B;  3QA8 A;  3ONS A;  4AP4 C;  4DDG D;  3RZW C;  4G3X B;  1OGW A;  3I3T B;  4IM3 A;  3V61 A;  2FIF A;  2IZV B;  2V1Y A;  5GMV A;  1YIW A;  2LAS A;  2AEH A;  1P1A A;  1C1Y B;  3PT2 B;  3PTF C;  4ANV A;  4GSW A;  3HK0 A;  1MG8 A;  2FCN A;  2KDB A;  4GDK B;  3RZF A;  2N9E B;  2DX5 B;  4MJS B;  4URK A;  3WIM A;  1GC7 A;  2D07 B;  2OOB B;  1OEY A;  2NBU A;  3O65 B;  2DZM A;  2G45 B;  3VVW B;  1WFY A;  4MSQ B;  3HHM A;  4WQO B;  1V5O A;  1RRB A;  2FCQ A;  2MA9 B;  2KQS A;  2KX3 A;  4DDI D;  2LXA A;  4TV3 A;  3NS8 A;  2UWQ A;  5IA7 A;  2PE6 B;  3ZKJ C;  2N1V A;  3QK0 A;  2Z0E B;  2JZZ A;  2LRU A;  4PYZ A;  4BBN C;  2MBH A;  4FBJ B;  2FUH B;  2HJ8 A;  2J0M A;  4N9F 4;  3UQB A;  3SU8 X;  1Z2M A;  3ZTC A;  4ANW A;  5L95 C;  2I1J A;  3N3K B;  3ZUN A;  1WH3 A;  1SE9 A;  3Q3J A;  4ZDV A;  2GBM A;  3R66 C;  2K1F A;  3V62 A;  2M4N A;  4YL8 A;  4DHJ B;  5DPS A;  3V60 A;  1E7V A;  2ZEQ A;  4KDL B;  4IM2 A;  3DBS A;  2M1M A;  5J17 A;  1VCB A;  2KLC A;  2WWZ A;  2KN5 A;  1GC6 A;  3H9D A;  3SD5 A;  1YX6 B;  4K7W A;  2BPS A;  3PZD A;  3QCA A;  3PV1 A;  4K1R B;  2W9N A;  3UF8 A;  3B0A A;  1P0R A;  4KIK B;  2KKC A;  1P98 A;  4BVU C;  1KOT A;  1WF9 A;  2KC2 A;  3PLU A;  4NAW B;  2IO1 B;  4DHJ D;  3P2B A;  3ZDT A;  1XQQ A;  2ZCC A;  2AL6 A;  4LCD E;  3KUZ A;  4W9F A;  3M62 B;  4GN1 A;  4LJP B;  2BKR B;  4G11 A;  4NY0 A;  3DBR I;  4FN2 A;  1ISN A;  1WX7 A;  2IY0 B;  3V6E B;  3M3J A;  1E8Y A;  2I1K A;  2LWP A;  1WJU A;  2KHW B;  4BOS C;  1Y8R C;  4HPL B;  3A4S C;  2EMS A;  2R2O A;  4EZJ A;  3TIX A;  4AJW A;  1RFA A;  3HM6 X;  3SHQ A;  2MBB B;  5C1Z A;  4II3 B;  3TCA A;  1K8R B;  2B3A A;  1F9J A;  1C3T A;  3IVF A;  5LLI A;  3VHT C;  2BYE A;  3KUC B;  2HTH A;  4M8N A;  2KJH B;  4FJV B;  2KTR A;  1J19 A;  2KVR A;  3TJP A;  2EKE C;  1WGR A;  2L3Z A;  4MGI E;  4OVU A;  4NJ6 A;  4XC2 A;  3VXW A;  3MHS D;  1WXS A;  2A5U A;  2EMT A;  4A20 A;  2DYB A;  2LVP A;  3CMM B;  3K9O B;  3BY4 B;  2O6V A;  4DHZ E;  3A4R A;  2J0K A;  3ML8 A;  4RM8 A;  1V81 A;  3QAR A;  1E8Z A;  1WX8 A;  2DAJ A;  4IUM B;  4GMV A;  1FXT B;  5JZE B;  3HM3 A;  4X57 B;  3B1L X;  3A9K A;  1U4A A;  2HE7 A;  4FUL A;  2JRI B;  1S3S G;  4M0W B;  3ZRF A;  2NBV B;  3QX1 A;  2IBI B;  1UZX B;  1V9J A;  2PE9 A;  2IO2 B;  1QZE A;  4W9H A;  1T0Y A;  3A9J B;  2JUO A;  3UQA A;  4JGH B;  4MEM A;  3X0W A;  4W9D A;  1WGD A;  2RR9 A;  3QQ8 B;  1YQB A;  2KMC A;  2R2Q A;  3APD A;  4GDL B;  2IO3 B;  4GDK A;  4NQK E;  4BKT A;  4CO7 A;  4EZL A;  4NJ7 A;  4MJS A;  4WWO A;  2XBB C;  3WAL A;  3APF A;  3C0R B;  5D6J B;  4WJN A;  2MP2 A;  3ECI A;  3IG3 A;  3PSE B;  5DPW A;  4LDT B;  3A33 B;  1EF5 A;  1V6E A;  1WXV A;  4ASW C;  4E71 A;  3PHW B;  3ML9 A;  4BBN F;  2O2V B;  2REX A;  3AI5 A;  2JZ3 B;  4HPM B;  3NY5 A;  2KTF A;  4B9K A;  2LRW A;  4GXB A;  2C60 A;  2RD0 A;  2L05 A;  2KDE B;  3CST A;  1XT9 B;  5D2M B;  1WGY A;  3EC8 A;  4DBG A;  2WYQ A;  4F7Z A;  2LD9 A;  3PRP B;  2M8S A;  4E74 A;  4HDQ A;  4WWP A;  2KC1 A;  1BT0 A;  1YD8 U;  5AZG A;  3EFU A;  3WAM A;  4DXA B;  3ZTD A;  2M17 A;  4LDT D;  4KSL C;  2NR2 A;  2XK5 B;  2L0T A;  1A5R A;  2LGD A;  3JSV A;  5JHB A;  2DZJ A;  1Q5W B;  1GJZ A;  3H7P B;  1V5T A;  4G0N B;  2ZCB A;  4WJO A;  5D7G A;  2N1W A;  1YX5 B;  2C7H A;  4GIV A;  4WAA A;  3L54 A;  5IAA C;  4XZ4 A;  2N9P C;  2A4Z A;  5CTR C;  1RLF A;  1AAR A;  2D2Q A;  3IBE A;  1LQB A;  3ZIM A;  3WA0 A;  2BF8 B;  2MSE D;  4FLH A;  1L7Y A;  3PPA A;  2KAN A;  2L76 A;  2V4L A;  4NAW A;  1Z5S B;  2ZNV C;  2AYO B;  1WIA A;  2FCS A;  3R7Q A;  3U7D A;  3ZDM C;  3CF6 E;  3PLV A;  3U8Z A;  1TBE A;  2N7E A;  4W9G A;  5FR6 A;  3VH4 B;  1NBF C;  2KWU B;  4AUQ C;  4BKS A;  1TZ1 A;  3PGE A;  1ZGU B;  2KJR A;  4AOF A;  4NQL B;  2WX1 A;  3L08 A;  4F8C B;  2C7N B;  2JF5 A;  2MBQ A;  2BYV E;  3B08 A;  3PS6 A;  5KHO A;  4G50 A;  1G6J A;  5LXI B;  1WY8 A;  3AUL A;  4WWN A;  3L0W B;  3L10 B;  2MBE A;  2ASQ A;  5CHW A;  2KWC A;  2KJ6 A;  3OJ3 A;  1UBI A;  3VUW A;  3H7S A;  2IO0 B;  5G2N A;  2IY1 B;  2JWZ A;  4CHK A;  1WZ0 A;  4ANX A;  2J0J A;  3ZRC A;  3N32 A;  1WM2 A;  4NNJ B;  3DVG X;  3ZNZ B;  1ZW7 A;  3QJZ A;  4IG7 B;  1WMH B;  5TR5 A;  2K6Q A;  2L7R A;  1WM3 A;  2XEW A;  1LFD A;  4OVV A;  5J18 A;  3S2A A;  4IWO A;  1J8C A;  3NHE B;  1HE8 A;  2CHZ A;  2KO3 A;  3CSF A;  2BWE S;  4CYE A;  1E7U A;  5J2R A;  3A1Q B;  2KFJ A;  3ZNG C;  2LUE A;  4II2 B;  4ICU A;  3AU4 A;  4FAD A;  4GGQ A;  1GUA B;  2YLM A;  2UYZ B;  2WX0 A;  1XD3 B;  5E6N A;  1H4R A;  2K8H A;  1WGG A;  2K8C A;  3GOE A;  3T8M A;  5DPT A;  4EFO A;  1UEL A;  1VD2 A;  3PRM B;  4JLC A;  4ZRI A;  3OLM D;  2DAF A;  2NCN A;  2N7D A;  4FHK A;  2NBW B;  3A9J A;  2KDF B;  2ZVN A;  2BKF A;  1TTN A;  3OJ4 B;  2G4S A;  3UIP B;  3VTW A;  4W9I A;  4GU2 A;  4A3O A;  2CU1 A;  2KZR A;  4HXD A;  5KHQ A;  3DQV A;  5C23 A;  3SDL C;  2NS5 A;  2MQJ A;  1UGM A;  2JY6 A;  2DYM A;  3L17 A;  1YJ1 A;  4A3P A;  3VQI A;  3ZO5 B;  1V2Y A;  1WGH A;  1E8X A;  2JT4 B;  2KD0 A;  2O2V A;  2RPQ A;  3QC8 B;  4PYU A;  4K7S A;  4W9K A;  4KV2 A;  4W9C A;  4FHJ A;  1WJ6 A;  1RAX A;  2N9X A;  1LM8 B;  1V49 A;  3DPD A;  4PS3 A;  2ZVO A;  4HVB A;  2LXC A;  4DWF A;  4GB9 A;  2GMI C;  3X23 A;  1WE7 A;  2DZK A;  4IC7 B;  2DZI A;  2RSU A;  4EEW A;  1WXA A;  2AWT A;  4NPN A;  4EZK A;  2JRH A;  4I6P A;  3PVL A;  3MJW A;  1KJT A;  3TL5 A;  2MX2 A;  3QAQ A;  1WXM A;  2BWF A;  4MGY E;  3U30 A;  3VAW A;  1UH6 A;  3KYD D;  2MLB A;  2O6V B;  1E5W A;  4ZYN A;  3H7P A;  3KW5 B;  4MDK E;  4W9E A;  4RM9 A;  3W1S C;  5AZH A;  4AWJ A;  5LXH A;  1PQS A;  5CHF A;  4ICV A;  4TQ1 A;  2HD5 B;  3NZU A;  5DPR A;  3VUX A;  4FA6 A;  1IPG A;  3TBL D;  3OAW A;  2DHZ A;  1M94 A;  2M0X A;  4DK5 A;  4BOZ B;  2FCM A;  3W1S A;  3JYU A;  1I42 A;  3R7R A;  3DVN V;  2NPT B;  4JQW C;  3WAP A;  2KFK B;  1WJ4 A;  2ZJD A;  4KZC A;  2KMA A;  4MSM B;  4GOC A;  2LZ6 A;  3KVF B;  1ZKH A;  2PJH A;  1R4M I;  2D3G A;  2LJ5 A;  2O6V D;  5AEK B;  3ALB A;  3GZN I;  1KM7 A;  3DBH I;  3KUD B;  5JHA A;  4HJK A;  4KIK A;  2FNJ B;  3BIN A;  3AXC A;  3JVZ X;  1V80 A;  4M8M A;  5L83 A;  2N4F A;  1WX9 A;  2MP2 B;  1OTR B;  4I6N B;  4JIO U;  3DVN U;  4KSK C;  4JL9 A;  4F1S A;  2RGF A;  5D94 A;  4TUU A;  3W1Y A;  3RCZ A;  1UD7 A;  1WRD B;  4PS8 A;  3RUL A;  1Q1O A;  3IFW B;  1OEY J;  1D3Z A;  4HDO A;  4EUT A;  1H8C A;  2YVC A;  5CX3 A;  4MM3 A;  2Y5B B;  4ZRJ A;  2CKH B;  2L8J A;  3RUI B;  1IP9 A;  1NDD A;  3KH0 A;  2CR5 A;  3LJ3 A;  1WMH A;  3QIJ A;  4K7U A;  3VTV A;  1SGH A;  1WE6 A;  2KDI A;  3NOB A;  3PRZ A;  4J6I A;  2QHO A;  3UIN B;  4EKU A;  3DCG A;  5JH5 C;  2MWS B;  3DVG Y;  3DDC B;  3NZS A;  4IM0 A;  4ZRK A;  2FID A;  2CS4 A;  2WDT B;  4W9L A;  2GBR A;  3A1Q A;  3JSV B;  2K39 A;  2MCN B;  4DHZ B;  2L00 B;  3HIZ A;  3LDZ E;  1WJN A;  3M63 B;  4K81 A;  5BO4 B;  3M95 A;  3ZW3 A;  2LGY A;  2JVC A;  1WR6 E;  2KQ7 A;  2ZPN A;  1J0G A;  3DBL I;  1LXD A;  4HLE A;  2C5L C;  1EF1 A;  3QWZ B;  4PS7 A;  2KOX A;  2CHX A;  4MGK E;  3VTU A;  4B95 A;  2JPH A;  2GOW A;  3VUY A;  4IWP A;  4MEL A;  1UBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...