2JVCA

Nmr solution structure of ubiquitin like protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
82
Chain Sequence
GPLGSMQIFVKTLTGKTITIDVDHADTVGAVKAKIYDKEGIPPDQQRLIFGGKQLEDSNAMSDYNVQKESTLHLVLRLRGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of ubiquitin like protein
rcsb
molecule tags Unknown function
molecule keywords ubiquitin_like protein
total genus 11
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jvcA00
4EKUA 1FXTB 2MWSB 4GU2A 2WX0A 1P9DU 3SDLC 2LWPA 3RULA 2LUEA 3EHVA 1WI0A 5D6JB 1V9JA 2IO3B 5E6PA 2BYVE 1WF9A 3U7DA 2NPTB 1WE6A 4KDLB 2KLCA 4B9KA 2AEHA 2KN5A 2V4LA 3DBLI 3Q3FA 3TBLD 4CYEA 4GIVA 2MP2B 3ECIA 2QHOA 2CKHB 2CHWA 2DYOA 2FCSA 2UYZB 2VRRB 2JRIB 4FJYA 4GSWA 4WJPA 4JIOU 2I1KA 4NQLB 2MSED 2LRWA 2KQSA 5FR6A 1V49A 4MSMB 4WJOA 4BKSA 2W9NA 1CMXB 2G45B 4FBJB 2JF5A 3SHQA 3OJ3A 2IYDB 4FA6A 3TMPB 2DZKA 2ZPYA 1LM8B 3CSFA 5DPRA 1V5TA 1K8RB 4ANVA 4IWPA 4I6NB 2MW5A 1V2YA 4M0WB 1WGDA 2KFKA 4IM2A 3WANA 1LFDA 1JRUA 2WYQA 5JH5C 3AXCA 3RZFA 4W9JA 2MRPA 3PTFC 5DPTA 3VXWA 5J17A 3UQAA 1WY8A 1WIAA 4W9IA 3HHMA 3PVLA 1H8CA 2PEAA 2JWZA 3MTNB 4TQ0A 3WAMA 4DHZB 3IVFA 3DVGX 2IZVB 2JVCA 4JLCA 3A1QB 2FNJB 4HXDA 1Q5WB 1V81A 2DENB 2L7RA 3DBRI 3M3JA 3NZSA 3RYTA 2XK5B 2BYEA 3UIPB 2N7DA 3K9OB 4LDTB 2CR5A 4JL9A 4I6PA 3QARA 4MJSA 2C7HA 4F8CB 2RD0A 3DQVA 4NJ6A 4EZKA 1V80A 3VH3B 2BPSA 2BF8B 2KXJA 2IY0B 1WMHA 2YLMA 3QIJA 3UIOB 3X23A 4K7WA 1WR6E 2EMSA 2KWVB 3A9JA 4HCPB 3HK0A 3GOEA 2ZZPB 3RD2A 2PE6B 4A3PA 2IY1B 2LVOA 2KMAA 2RR9A 3H7PA 1I42A 3U8ZA 1S1QB 4W9KA 3EFUA 4ZRJA 1V5OA 4DHJB 2O6VD 2WX1A 1M94A 1ZW7A 4DDID 1J8CA 4ICUA 2A5UA 2C60A 4WWNA 3U30A 4NAWA 3A4RA 4PS8A 2KHWB 3WALA 4W9EA 2DAJA 1OEYJ 5LLIA 3ZTDA 2D2QA 5L95C 1KLVA 3PRPB 3W1YA 3APFA 4PYZA 1WFYA 1EUVB 2L0TA 1F9JA 2MCNB 1AARA 2KDIA 2IO1B 4N9F4 1NDDA 1WX7A 4W9CA 3ONSA 2HE7A 3L13A 5CTRC 4M8MA 4WJNA 2D3GA 3PHXB 4IM0A 2GBKA 4FADA 2HJ8A 3V6EB 3V60A 2DX5B 4DXAB 3ZO5B 1S3SG 2NBVB 5IAAC 3B08A 4MM3A 4EUTA 3UF8A 1WX8A 4K7UA 5C23A 4K7SA 2MBBB 1WE7A 2LASA 1IPGA 5G55A 3H1UA 2EKEC 2K39A 1UBQA 3A9KA 2N7EA 4E71A 1J0GA 3LDZE 3JW0X 2AYOB 2C9WB 3EECA 4WQOB 1V6EA 2REXA 1TZ1A 4KZ0A 3JVZX 1KJTA 5D94A 4E74A 4IWQA 4AWJA 1P0RA 2L3ZA 4MGIE 3ZLZA 4I6LB 2N1VA 3OAWA 2FIDA 1EF1A 4G0NB 2AL6A 1WMHB 5JHBA 4WAAA 4HK2A 1Y8RC 2V3SA 1R4MI 3ZDMC 4DHJD 3PLVA 2KVRA 2LGXA 3VUYA 1SE9A 2O6VA 2J7QB 2UWQA 1Z2MA 3PSEB 4DK5A 4IG7B 4MJSB 2KMCA 2D10A 2K1FA 4X57B 5IA7A 2KTFA 4OVVA 1GC7A 1Z5SB 1GUAB 4DHZE 2XEWA 2G4SA 3CMMB 2DZMA 3QC8B 3VUWA 3A4SC 3ZW3A 3L08A 4LJPB 3VHTC 1I35A 2JT4B 4NNJB 4IW0A 3DBSA 3W1SA 1WXVA 3QHTA 4JQWC 4F1SA 4J6IA 1E7VA 4GDKA 3NOBA 4II3B 3AU5A 4LCDE 3EC8A 2KX3A 3ZRCA 3DOWA 5KHOA 3A33B 1WXMA 2D07B 3APDA 3L16A 1OQYA 1V86A 2KQ7A 2M0XA 4AP4C 3KVFB 3KW5B 4AOFA 3GZNI 3QA8A 1WRDB 2K8CA 4HPLB 5AZFA 1UGMA 2NS5A 3ENEA 3CSTA 5D7GA 1YQBA 3QX1A 4ANXA 3SD5A 3T9LA 1YX5B 3ZIMA 2G4DB 3IHPC 3Q3JA 3B0AA 4WJQA 2DZIA 3APCA 4HJKA 1UD7A 2BWFA 2L76A 2K6DB 4HDQA 1E8YA 4II2B 3UGBB 4DWFA 2K25A 1D3ZA 1XD3B 2MA9B 2ZCBA 3PREA 1VD2A 4B95A 4A3OA 5L83A 1UZXB 3C0RB 2LGYA 2J0JA 3ZNGC 1GG3A 1OEYA 2XBBC 4IC7B 2BWES 4KSLC 2GBMA 2JXXA 2LVQA 3P2BA 4XZ4A 2DYMA 2KKCA 1EO6A 1WXSA 2KDEB 3IBEA 1GJZA 2BYFA 5EDSA 2MBOA 2AL3A 4GMVA 3TCAA 2HTHA 2WWZA 2GMIC 2FCMA 3JYUA 2RSUA 5KHQA 3N30A 3CF6E 2EMTA 4K81A 4G50A 1HE8A 1J19A 4NPNA 4EFOA 3OJ4B 2GBRA 5D2MB 3SU8X 4TV3A 3TJPA 3R7RA 3N3KB 3ML9A 3NZUA 4MGKE 4XX5A 5LXHA 3I3TB 2JPHA 4GDKB 5AZGA 3RCZA 3WA0A 1WJNA 2ASQA 2KWUB 2KFJA 3ML8A 2C5LC 4FHJA 2LD9A 5DPWA 3LJ3A 2KOXA 3H7PB 2KDBA 1IP9A 3PT2B 1WGHA 2KZRA 4MEMA 4M8NA 4EEWA 2N1WA 4DBGA 2JZZA 1WM2A 2GBJA 2KLGA 2FUHB 2KX0A 4MDKE 2PJHA 3PLUA 2O6VB 2IO2B 4BOSC 1ZGUB 4PYUA 1T0YA 5E6NA 3VQIA 3AU4A 4FN2A 3BY4B 4URKA 1Q1OA 2XK5A 4YL8A 2MBHA 1YJ1A 4GXBA 1XT9B 2KFKB 2MLBA 1WGYA 2DHZA 1SGHA 3NHEB 3O65B 4ZYNA 2GBNA 5BO4B 2YVCA 1KOTA 4HCNB 2C7NB 5CX3A 3V62A 2Z0EB 3TIXA 1EF5A 3VVWB 4A20A 2A4ZA 1OTRB 5JZEB 3OLMD 1RAXA 3HM6X 3ZNHB 1E5WA 2V1YA 2ZJDA 3D32A 4NJ7A 2MX2A 3QK0A 5C1ZA 3A9KB 2AWTA 3ZUNA 4WWOA 3KUDB 5LXIB 1L7YA 4GN1A 4JGHB 3RZWC 2MP2A 2CHXA 1WXAA 3QJZA 2NBUA 2NPTA 2KWCA 4GDLB 4AJYB 4G3XB 2J0KA 4FULA 2BGFA 1WX9A 2OJRA 1ZKHA 3KYCD 2CHZA 3B1LX 1WGRA 1KM7A 4CO7A 4AUQC 4RM8A 2K8HA 1P3QU 4W9DA 1WZ0A 2L05A 5E6OA 2FCQA 3PV1A 4ZDVA 3UINB 4BVUC 3K9PB 2BKFA 2ZEQA 1TTNA 4GB9A 1E8WA 1RLFA 4E3CA 3DBHI 4IM3A 3DVGY 1YD8U 4KSKC 1YX6B 1SIFA 5CHVC 1MG8A 2MBQA 3TL5A 1UBIA 4LJOB 4NAWB 4FLHA 2M1MA 5DPSA 3L0WB 4IUMB 4KIKB 4HDOA 4W9HA 2KTRA 2KO3A 2LRUA 2ZNVB 1YIWA 2O2VB 3M63B 2ZCCA 3N32A 4GGQA 4PS7A 3S2AA 2KNBA 3AULA 5AEKB 3PHWB 3HM3A 5AZHA 5TR5A 3JSVB 4G11A 3H9DA 2ZNVC 2C7MB 3VUXA 1WYWB 4K1RB 3NS8A 2LXAA 3MHSD 1OGWA 2KK8A 3A9JB 1Q0WB 2LZ6A 3UQBA 2ZVOA 5DCNA 3NY5A 3IFWB 3PRMB 3DPDA 4MH0E 3V6CB 2LVPA 2KJ6A 2B3AA 2L00B 2R2OA 2KJRA 4HWIB 1A5RA 1IYFA 3H7SA 2CS4A 2M17A 2FAZA 3R3MA 4W9FA 2FCNA 2RGFA 4B6WA 4ANUA 3L10B 4GOCA 3VAWA 2WDTB 5CHWA 5G2NA 4KDIC 3A1QA 3RT3B 2JZ3B 1QZEA 1ISNA 1GC6A 3QWZB 3HIZA 3VTVA 1LXDA 2LJ5A 4ASWC 2DZJA 3ZVVA 3X0WA 2KD0A 1TBEA 3ALBA 1X1MA 1WR1A 2D11A 2G3QB 4W9LA 1BT0A 4ICVA 2N4FA 2PE9A 4OVUA 2KANA 1NI2A 1WJ6A 4MELA 5JHAA 4EZLA 1LQBA 1C3TA 3PGEA 3WAPA 2R2QA 2BKRB 3QAQA 2RPQA 1E90A 3KH0A 3VTWA 4FJVB 4MGYE 4CHKA 1C1YB 3ZRFA 3QCAA 2KJHB 2FIFA 4HLEA 4TUUA 4FHKA 4FJZA 2Z0DB 2DYBA 3DVNV 4BFRA 1UH6A 2MQJA 2DAFA 2J0MA 2NVUI 3DCGA 4W9GA 4BKGA 5J2RA 4GDLA 2CU1A 2N9EB 1P98A 4HVBA 1TGZB 4AJWA 1GNUA 4BKTA 1VCBA 3PRZA 4HPMB 3DVNU 2N9PC 1U4AA 4RM9A 1UELA 4RMAA 4XC2A 5J18A 4MGZE 2K8BA 2L8JA 4EZJA 4MSQB 4IWOA 2Z59B 2K6QA 1WJUA 3QQ8B 3M95A 4ZRIA 3PZDA 3IG3A 2I1JA 3KYDD 1WZ3A 1RFAA 2PPHA 2ZPNA 5GMVA 1WM3A 3DDCB 1NBFC 2JRHA 3VH4B 5HKHA 3PPAA 2L0FA 1WGGA 3KUCB 2M8SA 3W1SC 3ZTCA 3MJWA 2Y5BB 3ZNZB 1G6JA 1H4RA 2IO0B 3R66C 1RRBA 3L54A 1P1AA 1XQQA 5CHFA 1E8XA 3KUZA 4BBNF 1WH3A 4F7ZA 2OOBB 3WAOA 3VTUA 2JY6A 2M4NA 3BINA 4LDTD 3V61A 2KDFB 4BBNC 4EOYA 2LI5A 3M62B 3R7QA 3VDZA 2KC2A 3ZDTA 3ZNID 4KV2A 1WJ4A 2NBWB 3WIMA 1L2NA 2KC1A 4ANWA 3T8MA 2KTRB 4KVGB 4NQKE 1R4NI 2LXCA 2NCNA 2GOWA 4TQ1A 2MBEA 2HD5B 2IBIB 4BOZB 1PQSA 2LGDA 4WWPA 1E8ZA 4TKNA 3ZKJC 4P7IA 4BKSD 3H6NA 4KZCA 3JSVA 2NR2A 3AI5A 2ZVNA 4PS3A 3VFKA 2O2VA 4ZRKA 4DDGD 2N9XA 1E7UA 3PS6A 4NY0A 3RUIB 4KIKA 3L17A 2JUOA
chains in the Genus database with same CATH superfamily
2MWSB 1JW9D 3N1ZC 2WX0A 1P9DU 3MHZA 4RFBA 3ZYYX 3RULA 1WI0A 2BYVE 2KAJA 4JE3B 4B9KA 2V4LA 2VZKD 4BZAA 2QCZA 3ECIA 1HA5A 2CKHB 2CHWA 2MSED 2FE8A 1MJDA 1V49A 4FBJB 2JF5A 4C4VA 1VR9A 1LO5D 5DPRA 4ANVA 1AW7A 1V1OA 1F2RC 3AECB 4I6NB 1WGDA 4IM2A 2CU3A 1JRUA 3RZFA 2MRPA 2W55A 3RPFC 2IDYA 3HHMA 1QOFA 3MTNB 4TQ0A 2K9XA 3IVFA 2IZVB 4JLCA 1L6VA 4HXDA 1Q5WB 2DENB 3M3JA 2L52A 2L7RA 3NZSA 3UIPB 2XK5B 3RNAC 3UI3A 2WQYB 1YQ4B 2RD0A 4NJ6A 4OVZA 3VH3B 2KXJA 3J9CA 3AE5B 2DLBA 2KMAA 3H7PA 1I42A 1FM0D 3U8ZA 4KKIA 4W9KA 3EFUA 4DHJB 3NVZA 2WXJA 4WWNA 4NAWA 1HZ5A 4PS8A 3WALA 5MPOA 2DAJA 3NS1A 5L95C 3PRPB 2X38A 4A6QA 4REZA 2L0TA 4XWTA 2INDC 2IO1B 4WIPA 2D5GA 3L13A 1XEEA 3HUIA 5BYQA 1N62A 3HRDD 2MJEA 2DX5B 2NBVB 2PW9A 1V1PA 3Q2AC 3W5UB 2J42A 5C23A 2MBBB 1TY2A 2OHFA 2LASA 1ET9A 5G55A 2QC8A 2EKEC 1ZP0B 2K39A 3AE2B 1OQRA 4E71A 1KF6B 3LDZE 2AYOB 1TIFA 3EECA 1V6EA 2REXA 4KZ0A 4E74A 3GZNB 4YSZB 4IWQA 4AWJA 2H88B 3ZLZA 1WGKA 4RGOS 1FNWA 1EF1A 2IGGA 2PLPA 1WMHB 4WAFA 3ZDMC 2LGXA 4OZBA 2J7QB 2QJLA 4DK5A 4IG7B 2K1FA 3DWGC 1GC7A 4DHZE 3AH7A 3CMMB 3L08A 1F2RI 3EC8A 2KX3A 1ET6A 3B2GA 5KHOA 2D07B 1IUEA 3L16A 4KGSA 4AP4C 1MHHE 4AOFA 3ZJTA 1OFFA 4HPLB 1UGMA 3ENEA 3CSTA 1YQBA 3QX1A 4DXFA 1VZ8A 3T9LA 2G4DB 3Q3JA 3B0AA 3Q8FA 1PGXA 2DZIA 3BVZA 1D3ZA 2MA9B 2INNE 4HRSA 4JWSC 1BUIC 3FKYA 2J0JA 2ZW1A 2BWES 2GBMA 3P2BA 4XZ4A 2DYMA 1WXSA 1EO6A 4A55A 5EDSA 5EE9A 2HTHA 3CF6E 2EMTA 4K81A 4G50A 1TS4A 4MACA 1L4DB 2BS3B 4NPNA 3ETRA 4LTUA 3OJ4B 2GBRA 3SU8X 3N3KB 5IO9A 1ZXIA 2LHEA 4MGKE 4XX5A 3MC9A 5LXHA 3RCZA 3RFZB 1ROEA 1WJNA 2WHIA 2KWUB 3LJ3A 3PT2B 4OHJA 2MJ3A 2W3RA 1WM2A 2KLGA 2FUHB 5D3IB 3PLUA 4BOSC 1ZGUB 4QAYA 2BBCA 2Y5PA 1Q1OA 5IKCM 2V3PA 2WU5B 1WGYA 1SGHA 5BO4B 4LK0M 1KOTA 1K52A 4HCNB 2WXLA 5I4DA 1T0RC 1EF5A 3T3OA 3U7ZA 1FIQA 2SEBD 3ZNHB 3D32A 1KFYB 2MX2A 5C1ZA 2VH2A 1TKEA 4RH6A 3RZWC 3Q8BA 1SE3A 1V1PB 2NPTA 5HI1A 2KWCA 4AJYB 3ZJUA 4FULA 2BGFA 3KYCD 3OWEB 1FPYA 1KM7A 4AUQC 2AX5A 2K8HA 4W9DA 1VDVA 2FCQA 4ZDVA 4BVUC 2BKFA 1TTNA 4E3CA 1DOXA 1D5XC 3DVGY 4O1NA 1YD8U 3O13A 4IM3A 4KSKC 5BMHA 1P7EA 3CIRB 4NAWB 4W9HA 2JYEA 1YIWA 5AEKB 4PS7A 3S2AA 1JWBD 3PHWB 1WWTA 1WYWB 3NS8A 2CJOA 3BVGA 5HFYA 3PRMB 1HTOA 3MC0B 2WNMA 1C76A 4HWIB 1IYFA 2CS4A 2FAZA 2RGFA 2RDHA 3L10B 3VAWA 1BMLC 4XWWA 1YQ3B 2MHJA 2DZJA 3X0WA 3I63C 2KD0A 1TBEA 2D11A 4W9LA 1BT0A 2PE9A 3MFGA 4MELA 1I4GA 1ZDVA 1SIJA 2KACA 2XNAC 1EU4A 2BKRB 3KH0A 1C1YB 3MP9A 4FHKA 3Q8CA 1T6BX 1JALA 3NJTA 2J0MA 2RPVA 3URYA 4IOIE 3DCGA 2CU1A 1P98A 1TGZB 4ARIA 3KQ4A 1U4AA 1UELA 1KLGD 4RMAA 2L8JA 1T0SC 2KWDA 3KYDD 5GMVA 1WM3A 3PO0A 3GS2A 1NBFC 2WXKA 1WGGA 3KUCB 2IJ0A 2Y5BB 5BYRA 2WDRB 1G6JA 3L54A 1P1AA 1E8XA 3KUZA 3FAHA 2JY6A 2M4NA 3BINA 4LDTD 1F1HA 4C80A 2BB6A 3P63A 3M62B 3R7QA 2KC2A 1WJ4A 2NBWB 3WIMA 1KRHA 4ANWA 4LNKA 2Y5CA 2KTRB 2N0SB 2LXCA 4HKZE 4C00A 4CQNA 4NJCA 4WH4A 2O2VA 4ZRKA 4DDGD 2JUOA 1TS2A 1NENB 4S0RA 2VZKB 3VRBB 4EKUA 1WYGA 3SDLC 2LUEA 2IO3B 3U7DA 2KLCA 2KN5A 3IT4B 2MP2B 2DYOA 1XLOA 4JIOU 1YNTE 4NQLB 2LRWA 2KQSA 4MSMB 4WJOA 2W9NA 1CMXB 2WLBA 4FA6A 3TMPB 2ZPYA 1NYRA 3CSFA 2PTLA 2WXPA 5H92C 1FMAD 1IGCA 1DGJA 1V2YA 2KFKA 3WANA 2KT7A 4ZRQA 5JH5C 5J17A 3PTFC 3VXWA 4JPSA 1QOGA 3Q6BA 3PVLA 2JWZA 4BAXA 3I5JC 1RYJA 4KGTA 1V81A 3SFEB 2GLSA 3RYTA 2BYEA 2N9KA 2N7DA 4MJSA 2CR5A 4JL9A 3AEGB 1JWMD 4F8CB 3B2FA 2IGDA 1QT9A 2BF8B 1WMHA 2YLMA 3QIJA 5FR3A 4K7WA 1D6EC 3A9JA 1YN4A 3RD2A 2PE6B 5H8YE 4A3PA 2RR9A 1SSNA 3RNBC 3BK2A 2WX1A 3R2IA 2KMMA 1M94A 1AN8A 1J8CA 1KH0A 4ICUA 2C60A 3U30A 3ZTDA 4LNOA 4PYZA 2BT6A 1WFYA 5C2TB 4M01A 2MCNB 1NDDA 4W9CA 1PFDA 5CTRC 4M8MA 2KVZA 4IDIA 2WXMA 2E6XA 1B1ZA 2HJ8A 3IAS1 3V6EB 4DXAB 3HVZA 3IAM1 5G5GA 3UF8A 3FILA 1C4PA 4K7UA 1IPGA 1UBQA 3A9KA 2N7EA 1SXTA 1J0GA 2C9WB 4LNNA 1T0QC 3TEWA 3RN9C 3JVZX 1KJTA 1SBBB 2L3ZA 4I6LB 1RFKA 2AL6A 3DBHB 1FNVA 4WAAA 1Y8RC 1RWSA 3NVWA 4Q2JA 2KMCA 4X57B 4OZAA 1JRPA 4OVVA 1Z5SB 3KLSX 2XEWA 4RF0A 1XLPA 1L0VB 3QC8B 4NNJB 1I4QA 2QILA 3KWVA 4L23A 1E7VA 4GDKA 4NAMA 3ZRCA 1WXMA 1YJJA 3APDA 1OQYA 1HQRD 3BVMA 3GZNI 5AZFA 5D7GA 2QDFA 4ANXA 3SD5A 3ZIMA 2QMTA 3EGRA 1QQRA 4DXGA 4HJKA 2BWFA 5JXVA 2K6DB 1E8YA 2K5PA 2M0AA 3PREA 1ACCA 2BB5A 5L83A 2YEPF 1N63A 2LGYA 4IC7B 2KKCA 2W54A 1TY0A 2AL3A 3Q14C 2WWZA 2GMIC 3JYUA 2RSUA 1HE8A 1J19A 2Z8LA 1JWAD 4RGTA 3R7RA 3ML9A 2BYTA 3MJ5A 2KFJA 1V97A 4FHJA 2LD9A 2MEKA 3GP7A 2JXTA 2KDBA 1IP9A 1WGHA 1GPXA 4MEMA 2JZZA 3U4EG 2KX0A 2PJHA 2O6VB 4ZOHC 1L4ZB 3AE1B 1T0YA 3VQIA 3AU4A 2KYWA 3BY4B 2XK5A 2MBHA 4GXBA 3ABVB 2KFKB 2DHZA 2WU2B 4ZYNA 1NI3A 4KX6B 5CX3A 2Z0EB 1I7HA 1OTRB 3OLMD 1RAXA 2V1YA 2ZJDA 1FXIA 1VZ6A 1JCKB 4WWOA 1L7YA 2NTSA 1SJHD 2MP2A 4USAA 3QJZA 4XDDA 2NTTA 4XE0A 1FNUA 2OJRA 1ZKHA 1AWDA 2LGIA 4L1BA 4RM8A 2L05A 5E6OA 5HHDG 3K9PB 2LEKA 1TKGA 1DYQA 1E0ZA 1E8WA 1NVID 1RLFA 3W2DA 1XF5L 1PDXA 2DWQA 5CHVC 1M4VA 2MBQA 1UBIA 4LJOB 2M1MA 3VR9B 4IUMB 4HDOA 5AUIA 4A9AA 1UWMA 2ZNVB 3RNCC 2O2VB 1VZ7A 4DQOC 3NVVA 3VUXA 1OGWA 1Q0WB 3UQBA 2ZVOA 5DCNA 3NY5A 3IFWB 4R3DA 3V6CB 3CWIA 2JX5A 3P4SB 2KJ6A 2L00B 2R2OA 4W9FA 4ANUA 4B6WA 2GI9A 2WDTB 3Q69A 4KDIC 3A1QA 3RT3B 2JZ3B 1WXQA 3QWZB 1LXDA 3ZVVA 3N1XC 3IT6B 5JHAA 1LQBA 1C3TA 3WAPA 3RNEC 3B9JA 3BK1A 3QAQA 2RPQA 4MGYE 3QCAA 2FIFA 2WDVB 2K22A 2MQJA 2DAFA 2NVUI 4C7YA 4W9GA 5J2RA 3AE3B 4GDLA 2N9EB 1ZE3D 4BKTA 1GNUA 1VCBA 3Q3NC 1T5XD 4HPMB 2N9PC 3AV8A 3DBRB 1EWYC 4XC2A 2K8BA 1GAQB 4MSQB 4IWOA 1I4PA 2Z59B 2K6QA 2WXOA 1WJUA 1WZ3A 3LXFA 3DDCB 2IPKD 4L2YA 3VH4B 3PPAA 4C56C 2YEPB 1KTKA 2M8SA 1RRBA 4F7ZA 2OOBB 3WCQA 3WAOA 3VTUA 1R4NB 4ITKA 3AEDB 3V61A 5IP4D 2KDFB 3VDZA 3ZDTA 3AE4B 1TS5A 1KLUD 2KC1A 4KVGB 1Q10A 1R4NI 2LGDA 2R61A 4ZYSA 4P7IA 3EA6A 2CJNA 2NR2A 1FFUA 1OQQA 4MH8A 4PS3A 3VFKA 1YN3A 2V4IB 1A70A 2LWPA 5D6JB 3EHVA 1V9JA 2NPTB 4GLSC 4KDLB 2AEHA 4ARCA 3DBLI 4FJYA 2UYZB 2VRRB 2FCSA 4K3CA 2WXFA 3MC8A 5FR6A 4BKSA 3P42A 2G45B 2IYDB 2DZKA 1IBXA 5HG2A 4IWPA 1HTQA 3HVDA 3AXCA 1WY8A 4US9A 1WIAA 5BYSA 1RM6C 3Q3MC 1ZOYB 3WAMA 3V3XA 3AEAB 3DVGX 1F52A 3A1QB 2FNJB 4CHKA 3DBRI 3ZNID 3K9OB 1L5PA 4I6PA 1V80A 2DBYA 2BPSA 4P1BC 1WR6E 2EMSA 3AB5A 3AM9A 3I57A 3HK0A 1FFVA 3GOEA 2MJDA 2ZZPB 5LNK1 1V5OA 2O6VD 4DDID 1L0XB 2A5UA 1GB4A 1SE4A 3A4RA 1EWCA 2KHWB 1PYWD 4W9EA 1OEYJ 5LLIA 1QOAA 2RMMA 3W1YA 2ACZB 1EUVB 1F9JA 1AARA 2KDIA 1WX7A 3ONSA 2HE7A 1C9FA 4WJNA 2D3GA 1JROA 2BS2B 3EFCA 2V3NA 4FADA 2JQRB 4LNIA 3DHGC 3BYYB 1N5WA 1YN5A 3DHIC 4AS1A 1MG4A 3U52E 1DOIA 1WE7A 5FK9C 3H1UA 2EELA 1K51A 1CQVA 2NMQA 1TZ1A 2UU7A 2ZW0A 1XCQL 4MGIE 3OAWA 3H8HA 2FIDA 4G0NB 5JHBA 2PVOD 3GE8C 2V3SA 4DHJD 2MH7A 3VUYA 1SE9A 2WP9B 2D10A 5IA7A 2KTFA 4YSXB 3ZQ4A 2G4SA 2DZMA 3ZW3A 4LJPB 3W1SA 3C19A 3DBSA 4M00A 4JQWC 3P4PB 4F1SA 1V8CA 4J6IA 1C78A 4II3B 3AU5A 1YMHE 1MFWA 3DOWA 2K3UA 3A33B 5T8IA 1V86A 2DNFA 2KQ7A 1IGDA 2L1AA 2K8CA 4OZCA 3L4PA 3SR6A 3TEZA 1YX5B 4WURA 1XLNA 4WJQA 3APCA 2L76A 4II2B 3UGBB 4DWFA 2K25A 2N7JA 2WXNA 1XD3B 4RGMA 1QOBA 4A3OA 3C0RB 3ZNGC 1GG3A 1JWSD 2XBBC 4KSLC 2JXXA 1GJZA 2KDEB 2BYFA 3W5VB 2MBOA 1MHXA 4JWUC 4GMVA 3NG0A 3N30A 5D2MB 3DHHC 3TJPA 5BMGA 3I3TB 2JPHA 5AZGA 1QF6A 2V0GA 3WA0A 1FD6A 2KOXA 3H7PB 2XN9C 4M8NA 4EEWA 4DBGA 1CK1A 2GBJA 1STEA 1C77A 2KN4A 2KQ4X 1JQ4A 3DWMA 4PYUA 4A90A 4YL8A 3PZ7A 2WXRA 2MLBA 3AE9B 2TSSA 2YVCA 2C7NB 3V62A 1F0ZA 3VVWB 1CZPA 2OEDA 4C4VB 3HM6X 1E5WA 3GE3C 3A9KB 3IXSA 2AWTA 3ZUNA 5LXIB 1N6ZA 4ZRPA 4WQMA 1WXAA 4YSYB 5C3JB 5EE1A 4G3XB 2J0KA 1ZUD2 1WX9A 5TSSA 2GB1A 2CHZA 1WGRA 3RNGC 2INPE 1SF0A 3UINB 5IN7A 2ZEQA 4GB9A 2LFIA 3DBHI 1YX6B 1SIFA 2D3BA 1MG8A 3TL5A 4FLHA 3L0WB 3LYYA 2KTRA 4GGQA 4PT5A 3HM3A 5AZHA 3JSVB 3H9DA 1BXTA 1MI0A 3TSSA 3E9SA 2LZ6A 4MH0E 3PZ8A 2LVPA 4MT5A 3KWLA 1A5RA 2M17A 3R3MA 2FCNA 1E10A 4EE2A 4XYCA 1QZEA 5EE3A 3ZJVA 2LJ5A 4ASWC 1FCCC 2G3QB 1FEHA 3EUB2 4OVUA 1NI2A 1NYQA 4XDCA 4N59A 2SAKA 1VLBA 2BS4B 2OJWA 2L32A 4FJVB 1D5ZC 4K3BA 1YOVB 4HEA1 1IBXB 2KJHB 2J4XA 3AE8B 4FJZA 2DYBA 1UH6A 1D5MC 1SJED 2WXQA 2BW2A 2WDQB 4ZHPA 1I4XA 1J7AA 3PRZA 1E9MA 3W9CB 5J18A 4EZJA 1EU3A 2K0PA 3QQ8B 4YT0B 3M95A 4ZRIA 2PIAA 3AEBB 2HJ1A 1RFAA 2ONQA 3VR8B 3SFDB 1MPEA 5HKHA 4ACFA 5EE0A 2L0FA 3W1SC 3MJWA 1H4RA 2IO0B 1HXYD 1XQQA 1WH3A 1LGRA 2BVCA 4EOYA 3TEXA 1ZXHA 4KV2A 2N9LA 1VJKA 2D3CA 2G9HD 3T8MA 4C7ZA 4US8A 2NCNA 4TQ1A 2GOWA 1VRAB 1F77A 2HD5B 1PQSA 1J7BA 4WWPA 3BZDB 3H6NA 2LUMA 2JSVX 3AI5A 1DOYA 2ZVNA 4B0MA 2N9XA 1E7UA 4NY0A 3RUIB 4KIKA 3L17A 3N20C 1FXTB 4GU2A 3T3NA 3RMKC 5E6PA 1WF9A 1I4HA 1WE6A 1QLBB 2LGSA 3RNFC 3Q3FA 3TBLD 1TKYA 4CYEA 4GIVA 2QHOA 4GSWA 4WJPA 2JRIB 2VH1A 1SE2A 2I1KA 2D3AA 4TMAB 2J52A 2J53A 3V05A 3AEFB 3SHQA 3OJ3A 1LM8B 1V5TA 4J3OD 1K8RB 1GOZA 4P6VF 2MW5A 2JWUA 4M0WB 1LFDA 2WYQA 4W9JA 5DPTA 3NRZA 3P4QB 3UQAA 2LJIA 4W9IA 1H8CA 2PEAA 4DHZB 2JVCA 4HKQA 1JMLA 1UNSA 4LDTB 3Q8EA 3QARA 2C7HA 3DQVA 2IGHA 4B0EA 4EZKA 4RGNA 2IY0B 3X23A 3UIOB 2JZPA 2KWVB 4HCPB 4OW0A 2IY1B 2LVOA 2E3TA 1S1QB 1E6EB 4ZRJA 3AN1A 2ON8A 1ZW7A 4YTMB 1R4MB 2D2QA 2HTME 1KLVA 1ZDXA 3APFA 1C4AA 1B9RA 4N9F4 2KDMA 1C79A 3PHXB 4IM0A 2GBKA 1SB3C 3V60A 3TEYA 2BTEA 3ZO5B 1AYFA 1S3SG 5IAAC 3B08A 4MM3A 4EUTA 4H2AA 1NEKB 3N9YC 4TSSA 1WX8A 4K7SA 1C4CA 1ZPSA 3JW0X 2BQQA 4WQOB 1HZ6A 2HDEA 1WRIA 5D94A 4IKGA 1JWUD 1XXGA 1P0RA 2N1VA 4NZLB 4HK2A 1R4MI 5BMIA 3PLVA 2KVRA 2O6VA 2UWQA 1Z2MA 3PSEB 3GB1A 4MJSB 4JX1C 1E7PB 1SEBD 1GUAB 3VUWA 2WXGA 3A4SC 3VHTC 1I35A 2JT4B 4IW0A 1WXVA 3QHTA 2AQ2B 3NOBA 4LCDE 1D4BA 4WWMA 1TS3A 1K53A 2M0XA 2EKIA 3KVFB 3KW5B 3QA8A 1WRDB 3Q8AA 2NS5A 1J7CA 3IHPC 3AMZA 3OG5A 1N60A 1UD7A 3AE6B 4HDQA 5G5HA 1XCTL 2Y3AA 4KGRA 1ENFA 4YTPB 2I38A 2ZCBA 1MVKA 1VD2A 4B95A 1UZXB 4MM3B 5GXGB 1OEYA 3R2TA 5E6JA 2LVQA 2X8XX 2FBWB 1QKZA 3IBEA 2GRIA 4P1CC 4UDUC 2M19A 2WXHA 3TCAA 2FCMA 3Q3OC 4RF1A 5KHQA 1FRDA 3ZXVA 1K50A 4EFOA 4M02A 1FRRA 4TV3A 2JU6X 3NZUA 1R7SA 4GDKB 1GB1A 2ASQA 3ML8A 2C5LC 5DPWA 2PMVA 5AUKA 3DBLB 1FCLA 1N5XA 2KZRA 3TUOA 2PKOA 2L83A 1EM7A 2N1WA 3E56A 4YTNB 2AQ1B 4YXDB 2RDBC 4MDKE 2RDGA 2IO2B 2LHDA 5E6NA 3LB8C 4FN2A 4URKA 3ZXRA 1YJ1A 1XT9B 4M0WA 1FO4A 3NHEB 3O65B 3P4RB 2GBNA 3TIXA 4A8XC 4A20A 2A4ZA 5JZEB 1ESFA 3NUHB 3ZGZA 4NJ7A 3VRAB 3QK0A 3NZ3A 4RNAA 3KUDB 4GN1A 4JGHB 2CHXA 2W82A 3BWUD 3FILB 2NBUA 4FXCA 4GDLB 2LMCA 4ZHOA 3U2SC 3B1LX 4CO7A 1WSPA 1UUPA 2M56B 1P3QU 4D2KA 1WZ0A 3PV1A 3P1MA 1L0YB 4HROA 1I4RA 3C8YA 2AQ3B 3RI7C 1L6UA 1Y56A 3AE7B 1PGBA 3N1YC 1P7FA 5DPSA 4HJGE 4KIKB 2KO3A 2LRUA 1UGJA 1HEZE 2FUG1 3M63B 2ZCCA 3N32A 2KNBA 3AULA 3FC4A 5TR5A 4G11A 1XO3A 4N58A 2ZNVC 2C7MB 1CJEA 4K1RB 2LXAA 3MHSD 2KK8A 3A9JB 2B76B 3DPDA 3I9V1 2INCC 1PGAA 2B3AA 4PK1A 4S17A 2KJRA 3H7SA 5IOIA 4GOCA 1T3QA 5CHWA 5G2NA 3SEBA 1PUTA 1ISNA 1GC6A 3HIZA 3VTVA 4HPPA 1TZOA 3ALBA 4LNFA 1X1MA 1WR1A 4ICVA 2N4FA 2KANA 1WJ6A 4EZLA 2ICIA 4YWGG 3PGEA 4P16A 2R2QA 3VTWA 1E90A 1UF0A 3ZRFA 3BYTB 4HLEA 4TUUA 2JYTA 5FKAC 2I2YA 2Z0DB 3DVNV 4BFRA 4N6EB 4BKGA 4HVBA 4LLGM 2G1EA 4AJWA 4XGAB 2PVGC 3DVNU 2QSDA 4RM9A 4MGZE 3NVYA 3R8BA 2Q5WD 3BIID 3PZDA 2I1JA 2W3SA 2PPHA 2ZPNA 5D3DA 4KKJA 2JRHA 1TYGB 1XLQA 1QILA 3ZTCA 3ZNZB 3R66C 1N61A 5CHFA 4BBNF 1FXAA 2V9HA 4AQ7A 4BBNC 2LI5A 2WS3B 2QIEB 1L2NA 1YJIA 1TJEA 4NQKE 2MBEA 2IBIB 1UWXA 2WGSA 4BOZB 4RCOA 1E8ZA 4TKNA 3ZKJC 4BKSD 1TT5B 4KZCA 3JSVA 3AEEB 2QEJC 2WXIA 3PS6A 2H89B 3IG3A
chains in the Genus database with same CATH topology
4EKUA 1FXTB 2MWSB 4GU2A 2WX0A 1P9DU 3SDLC 2LWPA 3RULA 2LUEA 3EHVA 1WI0A 5D6JB 1V9JA 2IO3B 5E6PA 2BYVE 1WF9A 3U7DA 2NPTB 1WE6A 4KDLB 2KLCA 4B9KA 2AEHA 2KN5A 2V4LA 3DBLI 3Q3FA 3TBLD 4CYEA 4GIVA 2MP2B 3ECIA 2QHOA 2CKHB 2CHWA 2DYOA 2FCSA 2UYZB 2VRRB 2JRIB 4FJYA 4GSWA 4WJPA 4JIOU 2I1KA 4NQLB 2MSED 2LRWA 2KQSA 5FR6A 1V49A 4MSMB 4WJOA 4BKSA 2W9NA 1CMXB 2G45B 4FBJB 2JF5A 3SHQA 3OJ3A 2IYDB 4FA6A 3TMPB 2DZKA 2ZPYA 1LM8B 3CSFA 5DPRA 1V5TA 1K8RB 4ANVA 4IWPA 4I6NB 2MW5A 1V2YA 4M0WB 1WGDA 2KFKA 4IM2A 3WANA 1LFDA 1JRUA 2WYQA 5JH5C 3AXCA 3RZFA 4W9JA 2MRPA 3PTFC 5DPTA 3VXWA 5J17A 3UQAA 1WY8A 1WIAA 4W9IA 3HHMA 3PVLA 1H8CA 2PEAA 2JWZA 3MTNB 4TQ0A 3WAMA 4DHZB 3IVFA 3DVGX 2IZVB 2JVCA 4JLCA 3A1QB 2FNJB 4HXDA 1Q5WB 1V81A 2DENB 2L7RA 3DBRI 3M3JA 3NZSA 3RYTA 2XK5B 2BYEA 3UIPB 2N7DA 3K9OB 4LDTB 2CR5A 4JL9A 4I6PA 3QARA 4MJSA 2C7HA 4F8CB 2RD0A 3DQVA 4NJ6A 4EZKA 1V80A 3VH3B 2BPSA 2BF8B 2KXJA 2IY0B 1WMHA 2YLMA 3QIJA 3UIOB 3X23A 4K7WA 1WR6E 2EMSA 2KWVB 3A9JA 4HCPB 3HK0A 3GOEA 2ZZPB 3RD2A 2PE6B 4A3PA 2IY1B 2LVOA 2KMAA 2RR9A 3H7PA 1I42A 3U8ZA 1S1QB 4W9KA 3EFUA 4ZRJA 1V5OA 4DHJB 2O6VD 2WX1A 1M94A 1ZW7A 4DDID 1J8CA 4ICUA 2A5UA 2C60A 4WWNA 3U30A 4NAWA 3A4RA 4PS8A 2KHWB 3WALA 4W9EA 2DAJA 1OEYJ 5LLIA 3ZTDA 2D2QA 5L95C 1KLVA 3PRPB 3W1YA 3APFA 4PYZA 1WFYA 1EUVB 2L0TA 1F9JA 2MCNB 1AARA 2KDIA 2IO1B 4N9F4 1NDDA 1WX7A 4W9CA 3ONSA 2HE7A 3L13A 5CTRC 4M8MA 4WJNA 2D3GA 3PHXB 4IM0A 2GBKA 4FADA 2HJ8A 3V6EB 3V60A 2DX5B 4DXAB 3ZO5B 1S3SG 2NBVB 5IAAC 3B08A 4MM3A 4EUTA 3UF8A 1WX8A 4K7UA 5C23A 4K7SA 2MBBB 1WE7A 2LASA 1IPGA 5G55A 3H1UA 2EKEC 2K39A 1UBQA 3A9KA 2N7EA 4E71A 1J0GA 3LDZE 3JW0X 2AYOB 2C9WB 3EECA 4WQOB 1V6EA 2REXA 1TZ1A 4KZ0A 3JVZX 1KJTA 5D94A 4E74A 4IWQA 4AWJA 1P0RA 2L3ZA 4MGIE 3ZLZA 4I6LB 2N1VA 3OAWA 2FIDA 1EF1A 4G0NB 2AL6A 1WMHB 5JHBA 4WAAA 4HK2A 1Y8RC 2V3SA 1R4MI 3ZDMC 4DHJD 3PLVA 2KVRA 2LGXA 3VUYA 1SE9A 2O6VA 2J7QB 2UWQA 1Z2MA 3PSEB 4DK5A 4IG7B 4MJSB 2KMCA 2D10A 2K1FA 4X57B 5IA7A 2KTFA 4OVVA 1GC7A 1Z5SB 1GUAB 4DHZE 2XEWA 2G4SA 3CMMB 2DZMA 3QC8B 3VUWA 3A4SC 3ZW3A 3L08A 4LJPB 3VHTC 1I35A 2JT4B 4NNJB 4IW0A 3DBSA 3W1SA 1WXVA 3QHTA 4JQWC 4F1SA 4J6IA 1E7VA 4GDKA 3NOBA 4II3B 3AU5A 4LCDE 3EC8A 2KX3A 3ZRCA 3DOWA 5KHOA 3A33B 1WXMA 2D07B 3APDA 3L16A 1OQYA 1V86A 2KQ7A 2M0XA 4AP4C 3KVFB 3KW5B 4AOFA 3GZNI 3QA8A 1WRDB 2K8CA 4HPLB 5AZFA 1UGMA 2NS5A 3ENEA 3CSTA 5D7GA 1YQBA 3QX1A 4ANXA 3SD5A 3T9LA 1YX5B 3ZIMA 2G4DB 3IHPC 3Q3JA 3B0AA 4WJQA 2DZIA 3APCA 4HJKA 1UD7A 2BWFA 2L76A 2K6DB 4HDQA 1E8YA 4II2B 3UGBB 4DWFA 2K25A 1D3ZA 1XD3B 2MA9B 2ZCBA 3PREA 1VD2A 4B95A 4A3OA 5L83A 1UZXB 3C0RB 2LGYA 2J0JA 3ZNGC 1GG3A 1OEYA 2XBBC 4IC7B 2BWES 4KSLC 2GBMA 2JXXA 2LVQA 3P2BA 4XZ4A 2DYMA 2KKCA 1EO6A 1WXSA 2KDEB 3IBEA 1GJZA 2BYFA 5EDSA 2MBOA 2AL3A 4GMVA 3TCAA 2HTHA 2WWZA 2GMIC 2FCMA 3JYUA 2RSUA 5KHQA 3N30A 3CF6E 2EMTA 4K81A 4G50A 1HE8A 1J19A 4NPNA 4EFOA 3OJ4B 2GBRA 5D2MB 3SU8X 4TV3A 3TJPA 3R7RA 3N3KB 3ML9A 3NZUA 4MGKE 4XX5A 5LXHA 3I3TB 2JPHA 4GDKB 5AZGA 3RCZA 3WA0A 1WJNA 2ASQA 2KWUB 2KFJA 3ML8A 2C5LC 4FHJA 2LD9A 5DPWA 3LJ3A 2KOXA 3H7PB 2KDBA 1IP9A 3PT2B 1WGHA 2KZRA 4MEMA 4M8NA 4EEWA 2N1WA 4DBGA 2JZZA 1WM2A 2GBJA 2KLGA 2FUHB 2KX0A 4MDKE 2PJHA 3PLUA 2O6VB 2IO2B 4BOSC 1ZGUB 4PYUA 1T0YA 5E6NA 3VQIA 3AU4A 4FN2A 3BY4B 4URKA 1Q1OA 2XK5A 4YL8A 2MBHA 1YJ1A 4GXBA 1XT9B 2KFKB 2MLBA 1WGYA 2DHZA 1SGHA 3NHEB 3O65B 4ZYNA 2GBNA 5BO4B 2YVCA 1KOTA 4HCNB 2C7NB 5CX3A 3V62A 2Z0EB 3TIXA 1EF5A 3VVWB 4A20A 2A4ZA 1OTRB 5JZEB 3OLMD 1RAXA 3HM6X 3ZNHB 1E5WA 2V1YA 2ZJDA 3D32A 4NJ7A 2MX2A 3QK0A 5C1ZA 3A9KB 2AWTA 3ZUNA 4WWOA 3KUDB 5LXIB 1L7YA 4GN1A 4JGHB 3RZWC 2MP2A 2CHXA 1WXAA 3QJZA 2NBUA 2NPTA 2KWCA 4GDLB 4AJYB 4G3XB 2J0KA 4FULA 2BGFA 1WX9A 2OJRA 1ZKHA 3KYCD 2CHZA 3B1LX 1WGRA 1KM7A 4CO7A 4AUQC 4RM8A 2K8HA 1P3QU 4W9DA 1WZ0A 2L05A 5E6OA 2FCQA 3PV1A 4ZDVA 3UINB 4BVUC 3K9PB 2BKFA 2ZEQA 1TTNA 4GB9A 1E8WA 1RLFA 4E3CA 3DBHI 4IM3A 3DVGY 1YD8U 4KSKC 1YX6B 1SIFA 5CHVC 1MG8A 2MBQA 3TL5A 1UBIA 4LJOB 4NAWB 4FLHA 2M1MA 5DPSA 3L0WB 4IUMB 4KIKB 4HDOA 4W9HA 2KTRA 2KO3A 2LRUA 2ZNVB 1YIWA 2O2VB 3M63B 2ZCCA 3N32A 4GGQA 4PS7A 3S2AA 2KNBA 3AULA 5AEKB 3PHWB 3HM3A 5AZHA 5TR5A 3JSVB 4G11A 3H9DA 2ZNVC 2C7MB 3VUXA 1WYWB 4K1RB 3NS8A 2LXAA 3MHSD 1OGWA 2KK8A 3A9JB 1Q0WB 2LZ6A 3UQBA 2ZVOA 5DCNA 3NY5A 3IFWB 3PRMB 3DPDA 4MH0E 3V6CB 2LVPA 2KJ6A 2B3AA 2L00B 2R2OA 2KJRA 4HWIB 1A5RA 1IYFA 3H7SA 2CS4A 2M17A 2FAZA 3R3MA 4W9FA 2FCNA 2RGFA 4B6WA 4ANUA 3L10B 4GOCA 3VAWA 2WDTB 5CHWA 5G2NA 4KDIC 3A1QA 3RT3B 2JZ3B 1QZEA 1ISNA 1GC6A 3QWZB 3HIZA 3VTVA 1LXDA 2LJ5A 4ASWC 2DZJA 3ZVVA 3X0WA 2KD0A 1TBEA 3ALBA 1X1MA 1WR1A 2D11A 2G3QB 4W9LA 1BT0A 4ICVA 2N4FA 2PE9A 4OVUA 2KANA 1NI2A 1WJ6A 4MELA 5JHAA 4EZLA 1LQBA 1C3TA 3PGEA 3WAPA 2R2QA 2BKRB 3QAQA 2RPQA 1E90A 3KH0A 3VTWA 4FJVB 4MGYE 4CHKA 1C1YB 3ZRFA 3QCAA 2KJHB 2FIFA 4HLEA 4TUUA 4FHKA 4FJZA 2Z0DB 2DYBA 3DVNV 4BFRA 1UH6A 2MQJA 2DAFA 2J0MA 2NVUI 3DCGA 4W9GA 4BKGA 5J2RA 4GDLA 2CU1A 2N9EB 1P98A 4HVBA 1TGZB 4AJWA 1GNUA 4BKTA 1VCBA 3PRZA 4HPMB 3DVNU 2N9PC 1U4AA 4RM9A 1UELA 4RMAA 4XC2A 5J18A 4MGZE 2K8BA 2L8JA 4EZJA 4MSQB 4IWOA 2Z59B 2K6QA 1WJUA 3QQ8B 3M95A 4ZRIA 3PZDA 3IG3A 2I1JA 3KYDD 1WZ3A 1RFAA 2PPHA 2ZPNA 5GMVA 1WM3A 3DDCB 1NBFC 2JRHA 3VH4B 5HKHA 3PPAA 2L0FA 1WGGA 3KUCB 2M8SA 3W1SC 3ZTCA 3MJWA 2Y5BB 3ZNZB 1G6JA 1H4RA 2IO0B 3R66C 1RRBA 3L54A 1P1AA 1XQQA 5CHFA 1E8XA 3KUZA 4BBNF 1WH3A 4F7ZA 2OOBB 3WAOA 3VTUA 2JY6A 2M4NA 3BINA 4LDTD 3V61A 2KDFB 4BBNC 4EOYA 2LI5A 3M62B 3R7QA 3VDZA 2KC2A 3ZDTA 3ZNID 4KV2A 1WJ4A 2NBWB 3WIMA 1L2NA 2KC1A 4ANWA 3T8MA 2KTRB 4KVGB 4NQKE 1R4NI 2LXCA 2NCNA 2GOWA 4TQ1A 2MBEA 2HD5B 2IBIB 4BOZB 1PQSA 2LGDA 4WWPA 1E8ZA 4TKNA 3ZKJC 4P7IA 4BKSD 3H6NA 4KZCA 3JSVA 2NR2A 3AI5A 2ZVNA 4PS3A 3VFKA 2O2VA 4ZRKA 4DDGD 2N9XA 1E7UA 3PS6A 4NY0A 3RUIB 4KIKA 3L17A 2JUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EKU A;  1FXT B;  2MWS B;  4GU2 A;  2WX0 A;  1P9D U;  3SDL C;  2LWP A;  3RUL A;  2LUE A;  3EHV A;  1WI0 A;  5D6J B;  1V9J A;  2IO3 B;  5E6P A;  2BYV E;  1WF9 A;  3U7D A;  2NPT B;  1WE6 A;  4KDL B;  2KLC A;  4B9K A;  2AEH A;  2KN5 A;  2V4L A;  3DBL I;  3Q3F A;  3TBL D;  4CYE A;  4GIV A;  2MP2 B;  3ECI A;  2QHO A;  2CKH B;  2CHW A;  2DYO A;  2FCS A;  2UYZ B;  2VRR B;  2JRI B;  4FJY A;  4GSW A;  4WJP A;  4JIO U;  2I1K A;  4NQL B;  2MSE D;  2LRW A;  2KQS A;  5FR6 A;  1V49 A;  4MSM B;  4WJO A;  4BKS A;  2W9N A;  1CMX B;  2G45 B;  4FBJ B;  2JF5 A;  3SHQ A;  3OJ3 A;  2IYD B;  4FA6 A;  3TMP B;  2DZK A;  2ZPY A;  1LM8 B;  3CSF A;  5DPR A;  1V5T A;  1K8R B;  4ANV A;  4IWP A;  4I6N B;  2MW5 A;  1V2Y A;  4M0W B;  1WGD A;  2KFK A;  4IM2 A;  3WAN A;  1LFD A;  1JRU A;  2WYQ A;  5JH5 C;  3AXC A;  3RZF A;  4W9J A;  2MRP A;  3PTF C;  5DPT A;  3VXW A;  5J17 A;  3UQA A;  1WY8 A;  1WIA A;  4W9I A;  3HHM A;  3PVL A;  1H8C A;  2PEA A;  2JWZ A;  3MTN B;  4TQ0 A;  3WAM A;  4DHZ B;  3IVF A;  3DVG X;  2IZV B;  2JVC A;  4JLC A;  3A1Q B;  2FNJ B;  4HXD A;  1Q5W B;  1V81 A;  2DEN B;  2L7R A;  3DBR I;  3M3J A;  3NZS A;  3RYT A;  2XK5 B;  2BYE A;  3UIP B;  2N7D A;  3K9O B;  4LDT B;  2CR5 A;  4JL9 A;  4I6P A;  3QAR A;  4MJS A;  2C7H A;  4F8C B;  2RD0 A;  3DQV A;  4NJ6 A;  4EZK A;  1V80 A;  3VH3 B;  2BPS A;  2BF8 B;  2KXJ A;  2IY0 B;  1WMH A;  2YLM A;  3QIJ A;  3UIO B;  3X23 A;  4K7W A;  1WR6 E;  2EMS A;  2KWV B;  3A9J A;  4HCP B;  3HK0 A;  3GOE A;  2ZZP B;  3RD2 A;  2PE6 B;  4A3P A;  2IY1 B;  2LVO A;  2KMA A;  2RR9 A;  3H7P A;  1I42 A;  3U8Z A;  1S1Q B;  4W9K A;  3EFU A;  4ZRJ A;  1V5O A;  4DHJ B;  2O6V D;  2WX1 A;  1M94 A;  1ZW7 A;  4DDI D;  1J8C A;  4ICU A;  2A5U A;  2C60 A;  4WWN A;  3U30 A;  4NAW A;  3A4R A;  4PS8 A;  2KHW B;  3WAL A;  4W9E A;  2DAJ A;  1OEY J;  5LLI A;  3ZTD A;  2D2Q A;  5L95 C;  1KLV A;  3PRP B;  3W1Y A;  3APF A;  4PYZ A;  1WFY A;  1EUV B;  2L0T A;  1F9J A;  2MCN B;  1AAR A;  2KDI A;  2IO1 B;  4N9F 4;  1NDD A;  1WX7 A;  4W9C A;  3ONS A;  2HE7 A;  3L13 A;  5CTR C;  4M8M A;  4WJN A;  2D3G A;  3PHX B;  4IM0 A;  2GBK A;  4FAD A;  2HJ8 A;  3V6E B;  3V60 A;  2DX5 B;  4DXA B;  3ZO5 B;  1S3S G;  2NBV B;  5IAA C;  3B08 A;  4MM3 A;  4EUT A;  3UF8 A;  1WX8 A;  4K7U A;  5C23 A;  4K7S A;  2MBB B;  1WE7 A;  2LAS A;  1IPG A;  5G55 A;  3H1U A;  2EKE C;  2K39 A;  1UBQ A;  3A9K A;  2N7E A;  4E71 A;  1J0G A;  3LDZ E;  3JW0 X;  2AYO B;  2C9W B;  3EEC A;  4WQO B;  1V6E A;  2REX A;  1TZ1 A;  4KZ0 A;  3JVZ X;  1KJT A;  5D94 A;  4E74 A;  4IWQ A;  4AWJ A;  1P0R A;  2L3Z A;  4MGI E;  3ZLZ A;  4I6L B;  2N1V A;  3OAW A;  2FID A;  1EF1 A;  4G0N B;  2AL6 A;  1WMH B;  5JHB A;  4WAA A;  4HK2 A;  1Y8R C;  2V3S A;  1R4M I;  3ZDM C;  4DHJ D;  3PLV A;  2KVR A;  2LGX A;  3VUY A;  1SE9 A;  2O6V A;  2J7Q B;  2UWQ A;  1Z2M A;  3PSE B;  4DK5 A;  4IG7 B;  4MJS B;  2KMC A;  2D10 A;  2K1F A;  4X57 B;  5IA7 A;  2KTF A;  4OVV A;  1GC7 A;  1Z5S B;  1GUA B;  4DHZ E;  2XEW A;  2G4S A;  3CMM B;  2DZM A;  3QC8 B;  3VUW A;  3A4S C;  3ZW3 A;  3L08 A;  4LJP B;  3VHT C;  1I35 A;  2JT4 B;  4NNJ B;  4IW0 A;  3DBS A;  3W1S A;  1WXV A;  3QHT A;  4JQW C;  4F1S A;  4J6I A;  1E7V A;  4GDK A;  3NOB A;  4II3 B;  3AU5 A;  4LCD E;  3EC8 A;  2KX3 A;  3ZRC A;  3DOW A;  5KHO A;  3A33 B;  1WXM A;  2D07 B;  3APD A;  3L16 A;  1OQY A;  1V86 A;  2KQ7 A;  2M0X A;  4AP4 C;  3KVF B;  3KW5 B;  4AOF A;  3GZN I;  3QA8 A;  1WRD B;  2K8C A;  4HPL B;  5AZF A;  1UGM A;  2NS5 A;  3ENE A;  3CST A;  5D7G A;  1YQB A;  3QX1 A;  4ANX A;  3SD5 A;  3T9L A;  1YX5 B;  3ZIM A;  2G4D B;  3IHP C;  3Q3J A;  3B0A A;  4WJQ A;  2DZI A;  3APC A;  4HJK A;  1UD7 A;  2BWF A;  2L76 A;  2K6D B;  4HDQ A;  1E8Y A;  4II2 B;  3UGB B;  4DWF A;  2K25 A;  1D3Z A;  1XD3 B;  2MA9 B;  2ZCB A;  3PRE A;  1VD2 A;  4B95 A;  4A3O A;  5L83 A;  1UZX B;  3C0R B;  2LGY A;  2J0J A;  3ZNG C;  1GG3 A;  1OEY A;  2XBB C;  4IC7 B;  2BWE S;  4KSL C;  2GBM A;  2JXX A;  2LVQ A;  3P2B A;  4XZ4 A;  2DYM A;  2KKC A;  1EO6 A;  1WXS A;  2KDE B;  3IBE A;  1GJZ A;  2BYF A;  5EDS A;  2MBO A;  2AL3 A;  4GMV A;  3TCA A;  2HTH A;  2WWZ A;  2GMI C;  2FCM A;  3JYU A;  2RSU A;  5KHQ A;  3N30 A;  3CF6 E;  2EMT A;  4K81 A;  4G50 A;  1HE8 A;  1J19 A;  4NPN A;  4EFO A;  3OJ4 B;  2GBR A;  5D2M B;  3SU8 X;  4TV3 A;  3TJP A;  3R7R A;  3N3K B;  3ML9 A;  3NZU A;  4MGK E;  4XX5 A;  5LXH A;  3I3T B;  2JPH A;  4GDK B;  5AZG A;  3RCZ A;  3WA0 A;  1WJN A;  2ASQ A;  2KWU B;  2KFJ A;  3ML8 A;  2C5L C;  4FHJ A;  2LD9 A;  5DPW A;  3LJ3 A;  2KOX A;  3H7P B;  2KDB A;  1IP9 A;  3PT2 B;  1WGH A;  2KZR A;  4MEM A;  4M8N A;  4EEW A;  2N1W A;  4DBG A;  2JZZ A;  1WM2 A;  2GBJ A;  2KLG A;  2FUH B;  2KX0 A;  4MDK E;  2PJH A;  3PLU A;  2O6V B;  2IO2 B;  4BOS C;  1ZGU B;  4PYU A;  1T0Y A;  5E6N A;  3VQI A;  3AU4 A;  4FN2 A;  3BY4 B;  4URK A;  1Q1O A;  2XK5 A;  4YL8 A;  2MBH A;  1YJ1 A;  4GXB A;  1XT9 B;  2KFK B;  2MLB A;  1WGY A;  2DHZ A;  1SGH A;  3NHE B;  3O65 B;  4ZYN A;  2GBN A;  5BO4 B;  2YVC A;  1KOT A;  4HCN B;  2C7N B;  5CX3 A;  3V62 A;  2Z0E B;  3TIX A;  1EF5 A;  3VVW B;  4A20 A;  2A4Z A;  1OTR B;  5JZE B;  3OLM D;  1RAX A;  3HM6 X;  3ZNH B;  1E5W A;  2V1Y A;  2ZJD A;  3D32 A;  4NJ7 A;  2MX2 A;  3QK0 A;  5C1Z A;  3A9K B;  2AWT A;  3ZUN A;  4WWO A;  3KUD B;  5LXI B;  1L7Y A;  4GN1 A;  4JGH B;  3RZW C;  2MP2 A;  2CHX A;  1WXA A;  3QJZ A;  2NBU A;  2NPT A;  2KWC A;  4GDL B;  4AJY B;  4G3X B;  2J0K A;  4FUL A;  2BGF A;  1WX9 A;  2OJR A;  1ZKH A;  3KYC D;  2CHZ A;  3B1L X;  1WGR A;  1KM7 A;  4CO7 A;  4AUQ C;  4RM8 A;  2K8H A;  1P3Q U;  4W9D A;  1WZ0 A;  2L05 A;  5E6O A;  2FCQ A;  3PV1 A;  4ZDV A;  3UIN B;  4BVU C;  3K9P B;  2BKF A;  2ZEQ A;  1TTN A;  4GB9 A;  1E8W A;  1RLF A;  4E3C A;  3DBH I;  4IM3 A;  3DVG Y;  1YD8 U;  4KSK C;  1YX6 B;  1SIF A;  5CHV C;  1MG8 A;  2MBQ A;  3TL5 A;  1UBI A;  4LJO B;  4NAW B;  4FLH A;  2M1M A;  5DPS A;  3L0W B;  4IUM B;  4KIK B;  4HDO A;  4W9H A;  2KTR A;  2KO3 A;  2LRU A;  2ZNV B;  1YIW A;  2O2V B;  3M63 B;  2ZCC A;  3N32 A;  4GGQ A;  4PS7 A;  3S2A A;  2KNB A;  3AUL A;  5AEK B;  3PHW B;  3HM3 A;  5AZH A;  5TR5 A;  3JSV B;  4G11 A;  3H9D A;  2ZNV C;  2C7M B;  3VUX A;  1WYW B;  4K1R B;  3NS8 A;  2LXA A;  3MHS D;  1OGW A;  2KK8 A;  3A9J B;  1Q0W B;  2LZ6 A;  3UQB A;  2ZVO A;  5DCN A;  3NY5 A;  3IFW B;  3PRM B;  3DPD A;  4MH0 E;  3V6C B;  2LVP A;  2KJ6 A;  2B3A A;  2L00 B;  2R2O A;  2KJR A;  4HWI B;  1A5R A;  1IYF A;  3H7S A;  2CS4 A;  2M17 A;  2FAZ A;  3R3M A;  4W9F A;  2FCN A;  2RGF A;  4B6W A;  4ANU A;  3L10 B;  4GOC A;  3VAW A;  2WDT B;  5CHW A;  5G2N A;  4KDI C;  3A1Q A;  3RT3 B;  2JZ3 B;  1QZE A;  1ISN A;  1GC6 A;  3QWZ B;  3HIZ A;  3VTV A;  1LXD A;  2LJ5 A;  4ASW C;  2DZJ A;  3ZVV A;  3X0W A;  2KD0 A;  1TBE A;  3ALB A;  1X1M A;  1WR1 A;  2D11 A;  2G3Q B;  4W9L A;  1BT0 A;  4ICV A;  2N4F A;  2PE9 A;  4OVU A;  2KAN A;  1NI2 A;  1WJ6 A;  4MEL A;  5JHA A;  4EZL A;  1LQB A;  1C3T A;  3PGE A;  3WAP A;  2R2Q A;  2BKR B;  3QAQ A;  2RPQ A;  1E90 A;  3KH0 A;  3VTW A;  4FJV B;  4MGY E;  4CHK A;  1C1Y B;  3ZRF A;  3QCA A;  2KJH B;  2FIF A;  4HLE A;  4TUU A;  4FHK A;  4FJZ A;  2Z0D B;  2DYB A;  3DVN V;  4BFR A;  1UH6 A;  2MQJ A;  2DAF A;  2J0M A;  2NVU I;  3DCG A;  4W9G A;  4BKG A;  5J2R A;  4GDL A;  2CU1 A;  2N9E B;  1P98 A;  4HVB A;  1TGZ B;  4AJW A;  1GNU A;  4BKT A;  1VCB A;  3PRZ A;  4HPM B;  3DVN U;  2N9P C;  1U4A A;  4RM9 A;  1UEL A;  4RMA A;  4XC2 A;  5J18 A;  4MGZ E;  2K8B A;  2L8J A;  4EZJ A;  4MSQ B;  4IWO A;  2Z59 B;  2K6Q A;  1WJU A;  3QQ8 B;  3M95 A;  4ZRI A;  3PZD A;  3IG3 A;  2I1J A;  3KYD D;  1WZ3 A;  1RFA A;  2PPH A;  2ZPN A;  5GMV A;  1WM3 A;  3DDC B;  1NBF C;  2JRH A;  3VH4 B;  5HKH A;  3PPA A;  2L0F A;  1WGG A;  3KUC B;  2M8S A;  3W1S C;  3ZTC A;  3MJW A;  2Y5B B;  3ZNZ B;  1G6J A;  1H4R A;  2IO0 B;  3R66 C;  1RRB A;  3L54 A;  1P1A A;  1XQQ A;  5CHF A;  1E8X A;  3KUZ A;  4BBN F;  1WH3 A;  4F7Z A;  2OOB B;  3WAO A;  3VTU A;  2JY6 A;  2M4N A;  3BIN A;  4LDT D;  3V61 A;  2KDF B;  4BBN C;  4EOY A;  2LI5 A;  3M62 B;  3R7Q A;  3VDZ A;  2KC2 A;  3ZDT A;  3ZNI D;  4KV2 A;  1WJ4 A;  2NBW B;  3WIM A;  1L2N A;  2KC1 A;  4ANW A;  3T8M A;  2KTR B;  4KVG B;  4NQK E;  1R4N I;  2LXC A;  2NCN A;  2GOW A;  4TQ1 A;  2MBE A;  2HD5 B;  2IBI B;  4BOZ B;  1PQS A;  2LGD A;  4WWP A;  1E8Z A;  4TKN A;  3ZKJ C;  4P7I A;  4BKS D;  3H6N A;  4KZC A;  3JSV A;  2NR2 A;  3AI5 A;  2ZVN A;  4PS3 A;  3VFK A;  2O2V A;  4ZRK A;  4DDG D;  2N9X A;  1E7U A;  3PS6 A;  4NY0 A;  3RUI B;  4KIK A;  3L17 A;  2JUO A; 
#chains in the Genus database with same CATH topology
 2MWS B;  1JW9 D;  3N1Z C;  2WX0 A;  1P9D U;  3MHZ A;  4RFB A;  3ZYY X;  3RUL A;  1WI0 A;  2BYV E;  2KAJ A;  4JE3 B;  4B9K A;  2V4L A;  2VZK D;  4BZA A;  2QCZ A;  3ECI A;  1HA5 A;  2CKH B;  2CHW A;  2MSE D;  2FE8 A;  1MJD A;  1V49 A;  4FBJ B;  2JF5 A;  4C4V A;  1VR9 A;  1LO5 D;  5DPR A;  4ANV A;  1AW7 A;  1V1O A;  1F2R C;  3AEC B;  4I6N B;  1WGD A;  4IM2 A;  2CU3 A;  1JRU A;  3RZF A;  2MRP A;  2W55 A;  3RPF C;  2IDY A;  3HHM A;  1QOF A;  3MTN B;  4TQ0 A;  2K9X A;  3IVF A;  2IZV B;  4JLC A;  1L6V A;  4HXD A;  1Q5W B;  2DEN B;  3M3J A;  2L52 A;  2L7R A;  3NZS A;  3UIP B;  2XK5 B;  3RNA C;  3UI3 A;  2WQY B;  1YQ4 B;  2RD0 A;  4NJ6 A;  4OVZ A;  3VH3 B;  2KXJ A;  3J9C A;  3AE5 B;  2DLB A;  2KMA A;  3H7P A;  1I42 A;  1FM0 D;  3U8Z A;  4KKI A;  4W9K A;  3EFU A;  4DHJ B;  3NVZ A;  2WXJ A;  4WWN A;  4NAW A;  1HZ5 A;  4PS8 A;  3WAL A;  5MPO A;  2DAJ A;  3NS1 A;  5L95 C;  3PRP B;  2X38 A;  4A6Q A;  4REZ A;  2L0T A;  4XWT A;  2IND C;  2IO1 B;  4WIP A;  2D5G A;  3L13 A;  1XEE A;  3HUI A;  5BYQ A;  1N62 A;  3HRD D;  2MJE A;  2DX5 B;  2NBV B;  2PW9 A;  1V1P A;  3Q2A C;  3W5U B;  2J42 A;  5C23 A;  2MBB B;  1TY2 A;  2OHF A;  2LAS A;  1ET9 A;  5G55 A;  2QC8 A;  2EKE C;  1ZP0 B;  2K39 A;  3AE2 B;  1OQR A;  4E71 A;  1KF6 B;  3LDZ E;  2AYO B;  1TIF A;  3EEC A;  1V6E A;  2REX A;  4KZ0 A;  4E74 A;  3GZN B;  4YSZ B;  4IWQ A;  4AWJ A;  2H88 B;  3ZLZ A;  1WGK A;  4RGO S;  1FNW A;  1EF1 A;  2IGG A;  2PLP A;  1WMH B;  4WAF A;  3ZDM C;  2LGX A;  4OZB A;  2J7Q B;  2QJL A;  4DK5 A;  4IG7 B;  2K1F A;  3DWG C;  1GC7 A;  4DHZ E;  3AH7 A;  3CMM B;  3L08 A;  1F2R I;  3EC8 A;  2KX3 A;  1ET6 A;  3B2G A;  5KHO A;  2D07 B;  1IUE A;  3L16 A;  4KGS A;  4AP4 C;  1MHH E;  4AOF A;  3ZJT A;  1OFF A;  4HPL B;  1UGM A;  3ENE A;  3CST A;  1YQB A;  3QX1 A;  4DXF A;  1VZ8 A;  3T9L A;  2G4D B;  3Q3J A;  3B0A A;  3Q8F A;  1PGX A;  2DZI A;  3BVZ A;  1D3Z A;  2MA9 B;  2INN E;  4HRS A;  4JWS C;  1BUI C;  3FKY A;  2J0J A;  2ZW1 A;  2BWE S;  2GBM A;  3P2B A;  4XZ4 A;  2DYM A;  1WXS A;  1EO6 A;  4A55 A;  5EDS A;  5EE9 A;  2HTH A;  3CF6 E;  2EMT A;  4K81 A;  4G50 A;  1TS4 A;  4MAC A;  1L4D B;  2BS3 B;  4NPN A;  3ETR A;  4LTU A;  3OJ4 B;  2GBR A;  3SU8 X;  3N3K B;  5IO9 A;  1ZXI A;  2LHE A;  4MGK E;  4XX5 A;  3MC9 A;  5LXH A;  3RCZ A;  3RFZ B;  1ROE A;  1WJN A;  2WHI A;  2KWU B;  3LJ3 A;  3PT2 B;  4OHJ A;  2MJ3 A;  2W3R A;  1WM2 A;  2KLG A;  2FUH B;  5D3I B;  3PLU A;  4BOS C;  1ZGU B;  4QAY A;  2BBC A;  2Y5P A;  1Q1O A;  5IKC M;  2V3P A;  2WU5 B;  1WGY A;  1SGH A;  5BO4 B;  4LK0 M;  1KOT A;  1K52 A;  4HCN B;  2WXL A;  5I4D A;  1T0R C;  1EF5 A;  3T3O A;  3U7Z A;  1FIQ A;  2SEB D;  3ZNH B;  3D32 A;  1KFY B;  2MX2 A;  5C1Z A;  2VH2 A;  1TKE A;  4RH6 A;  3RZW C;  3Q8B A;  1SE3 A;  1V1P B;  2NPT A;  5HI1 A;  2KWC A;  4AJY B;  3ZJU A;  4FUL A;  2BGF A;  3KYC D;  3OWE B;  1FPY A;  1KM7 A;  4AUQ C;  2AX5 A;  2K8H A;  4W9D A;  1VDV A;  2FCQ A;  4ZDV A;  4BVU C;  2BKF A;  1TTN A;  4E3C A;  1DOX A;  1D5X C;  3DVG Y;  4O1N A;  1YD8 U;  3O13 A;  4IM3 A;  4KSK C;  5BMH A;  1P7E A;  3CIR B;  4NAW B;  4W9H A;  2JYE A;  1YIW A;  5AEK B;  4PS7 A;  3S2A A;  1JWB D;  3PHW B;  1WWT A;  1WYW B;  3NS8 A;  2CJO A;  3BVG A;  5HFY A;  3PRM B;  1HTO A;  3MC0 B;  2WNM A;  1C76 A;  4HWI B;  1IYF A;  2CS4 A;  2FAZ A;  2RGF A;  2RDH A;  3L10 B;  3VAW A;  1BML C;  4XWW A;  1YQ3 B;  2MHJ A;  2DZJ A;  3X0W A;  3I63 C;  2KD0 A;  1TBE A;  2D11 A;  4W9L A;  1BT0 A;  2PE9 A;  3MFG A;  4MEL A;  1I4G A;  1ZDV A;  1SIJ A;  2KAC A;  2XNA C;  1EU4 A;  2BKR B;  3KH0 A;  1C1Y B;  3MP9 A;  4FHK A;  3Q8C A;  1T6B X;  1JAL A;  3NJT A;  2J0M A;  2RPV A;  3URY A;  4IOI E;  3DCG A;  2CU1 A;  1P98 A;  1TGZ B;  4ARI A;  3KQ4 A;  1U4A A;  1UEL A;  1KLG D;  4RMA A;  2L8J A;  1T0S C;  2KWD A;  3KYD D;  5GMV A;  1WM3 A;  3PO0 A;  3GS2 A;  1NBF C;  2WXK A;  1WGG A;  3KUC B;  2IJ0 A;  2Y5B B;  5BYR A;  2WDR B;  1G6J A;  3L54 A;  1P1A A;  1E8X A;  3KUZ A;  3FAH A;  2JY6 A;  2M4N A;  3BIN A;  4LDT D;  1F1H A;  4C80 A;  2BB6 A;  3P63 A;  3M62 B;  3R7Q A;  2KC2 A;  1WJ4 A;  2NBW B;  3WIM A;  1KRH A;  4ANW A;  4LNK A;  2Y5C A;  2KTR B;  2N0S B;  2LXC A;  4HKZ E;  4C00 A;  4CQN A;  4NJC A;  4WH4 A;  2O2V A;  4ZRK A;  4DDG D;  2JUO A;  1TS2 A;  1NEN B;  4S0R A;  2VZK B;  3VRB B;  4EKU A;  1WYG A;  3SDL C;  2LUE A;  2IO3 B;  3U7D A;  2KLC A;  2KN5 A;  3IT4 B;  2MP2 B;  2DYO A;  1XLO A;  4JIO U;  1YNT E;  4NQL B;  2LRW A;  2KQS A;  4MSM B;  4WJO A;  2W9N A;  1CMX B;  2WLB A;  4FA6 A;  3TMP B;  2ZPY A;  1NYR A;  3CSF A;  2PTL A;  2WXP A;  5H92 C;  1FMA D;  1IGC A;  1DGJ A;  1V2Y A;  2KFK A;  3WAN A;  2KT7 A;  4ZRQ A;  5JH5 C;  5J17 A;  3PTF C;  3VXW A;  4JPS A;  1QOG A;  3Q6B A;  3PVL A;  2JWZ A;  4BAX A;  3I5J C;  1RYJ A;  4KGT A;  1V81 A;  3SFE B;  2GLS A;  3RYT A;  2BYE A;  2N9K A;  2N7D A;  4MJS A;  2CR5 A;  4JL9 A;  3AEG B;  1JWM D;  4F8C B;  3B2F A;  2IGD A;  1QT9 A;  2BF8 B;  1WMH A;  2YLM A;  3QIJ A;  5FR3 A;  4K7W A;  1D6E C;  3A9J A;  1YN4 A;  3RD2 A;  2PE6 B;  5H8Y E;  4A3P A;  2RR9 A;  1SSN A;  3RNB C;  3BK2 A;  2WX1 A;  3R2I A;  2KMM A;  1M94 A;  1AN8 A;  1J8C A;  1KH0 A;  4ICU A;  2C60 A;  3U30 A;  3ZTD A;  4LNO A;  4PYZ A;  2BT6 A;  1WFY A;  5C2T B;  4M01 A;  2MCN B;  1NDD A;  4W9C A;  1PFD A;  5CTR C;  4M8M A;  2KVZ A;  4IDI A;  2WXM A;  2E6X A;  1B1Z A;  2HJ8 A;  3IAS 1;  3V6E B;  4DXA B;  3HVZ A;  3IAM 1;  5G5G A;  3UF8 A;  3FIL A;  1C4P A;  4K7U A;  1IPG A;  1UBQ A;  3A9K A;  2N7E A;  1SXT A;  1J0G A;  2C9W B;  4LNN A;  1T0Q C;  3TEW A;  3RN9 C;  3JVZ X;  1KJT A;  1SBB B;  2L3Z A;  4I6L B;  1RFK A;  2AL6 A;  3DBH B;  1FNV A;  4WAA A;  1Y8R C;  1RWS A;  3NVW A;  4Q2J A;  2KMC A;  4X57 B;  4OZA A;  1JRP A;  4OVV A;  1Z5S B;  3KLS X;  2XEW A;  4RF0 A;  1XLP A;  1L0V B;  3QC8 B;  4NNJ B;  1I4Q A;  2QIL A;  3KWV A;  4L23 A;  1E7V A;  4GDK A;  4NAM A;  3ZRC A;  1WXM A;  1YJJ A;  3APD A;  1OQY A;  1HQR D;  3BVM A;  3GZN I;  5AZF A;  5D7G A;  2QDF A;  4ANX A;  3SD5 A;  3ZIM A;  2QMT A;  3EGR A;  1QQR A;  4DXG A;  4HJK A;  2BWF A;  5JXV A;  2K6D B;  1E8Y A;  2K5P A;  2M0A A;  3PRE A;  1ACC A;  2BB5 A;  5L83 A;  2YEP F;  1N63 A;  2LGY A;  4IC7 B;  2KKC A;  2W54 A;  1TY0 A;  2AL3 A;  3Q14 C;  2WWZ A;  2GMI C;  3JYU A;  2RSU A;  1HE8 A;  1J19 A;  2Z8L A;  1JWA D;  4RGT A;  3R7R A;  3ML9 A;  2BYT A;  3MJ5 A;  2KFJ A;  1V97 A;  4FHJ A;  2LD9 A;  2MEK A;  3GP7 A;  2JXT A;  2KDB A;  1IP9 A;  1WGH A;  1GPX A;  4MEM A;  2JZZ A;  3U4E G;  2KX0 A;  2PJH A;  2O6V B;  4ZOH C;  1L4Z B;  3AE1 B;  1T0Y A;  3VQI A;  3AU4 A;  2KYW A;  3BY4 B;  2XK5 A;  2MBH A;  4GXB A;  3ABV B;  2KFK B;  2DHZ A;  2WU2 B;  4ZYN A;  1NI3 A;  4KX6 B;  5CX3 A;  2Z0E B;  1I7H A;  1OTR B;  3OLM D;  1RAX A;  2V1Y A;  2ZJD A;  1FXI A;  1VZ6 A;  1JCK B;  4WWO A;  1L7Y A;  2NTS A;  1SJH D;  2MP2 A;  4USA A;  3QJZ A;  4XDD A;  2NTT A;  4XE0 A;  1FNU A;  2OJR A;  1ZKH A;  1AWD A;  2LGI A;  4L1B A;  4RM8 A;  2L05 A;  5E6O A;  5HHD G;  3K9P B;  2LEK A;  1TKG A;  1DYQ A;  1E0Z A;  1E8W A;  1NVI D;  1RLF A;  3W2D A;  1XF5 L;  1PDX A;  2DWQ A;  5CHV C;  1M4V A;  2MBQ A;  1UBI A;  4LJO B;  2M1M A;  3VR9 B;  4IUM B;  4HDO A;  5AUI A;  4A9A A;  1UWM A;  2ZNV B;  3RNC C;  2O2V B;  1VZ7 A;  4DQO C;  3NVV A;  3VUX A;  1OGW A;  1Q0W B;  3UQB A;  2ZVO A;  5DCN A;  3NY5 A;  3IFW B;  4R3D A;  3V6C B;  3CWI A;  2JX5 A;  3P4S B;  2KJ6 A;  2L00 B;  2R2O A;  4W9F A;  4ANU A;  4B6W A;  2GI9 A;  2WDT B;  3Q69 A;  4KDI C;  3A1Q A;  3RT3 B;  2JZ3 B;  1WXQ A;  3QWZ B;  1LXD A;  3ZVV A;  3N1X C;  3IT6 B;  5JHA A;  1LQB A;  1C3T A;  3WAP A;  3RNE C;  3B9J A;  3BK1 A;  3QAQ A;  2RPQ A;  4MGY E;  3QCA A;  2FIF A;  2WDV B;  2K22 A;  2MQJ A;  2DAF A;  2NVU I;  4C7Y A;  4W9G A;  5J2R A;  3AE3 B;  4GDL A;  2N9E B;  1ZE3 D;  4BKT A;  1GNU A;  1VCB A;  3Q3N C;  1T5X D;  4HPM B;  2N9P C;  3AV8 A;  3DBR B;  1EWY C;  4XC2 A;  2K8B A;  1GAQ B;  4MSQ B;  4IWO A;  1I4P A;  2Z59 B;  2K6Q A;  2WXO A;  1WJU A;  1WZ3 A;  3LXF A;  3DDC B;  2IPK D;  4L2Y A;  3VH4 B;  3PPA A;  4C56 C;  2YEP B;  1KTK A;  2M8S A;  1RRB A;  4F7Z A;  2OOB B;  3WCQ A;  3WAO A;  3VTU A;  1R4N B;  4ITK A;  3AED B;  3V61 A;  5IP4 D;  2KDF B;  3VDZ A;  3ZDT A;  3AE4 B;  1TS5 A;  1KLU D;  2KC1 A;  4KVG B;  1Q10 A;  1R4N I;  2LGD A;  2R61 A;  4ZYS A;  4P7I A;  3EA6 A;  2CJN A;  2NR2 A;  1FFU A;  1OQQ A;  4MH8 A;  4PS3 A;  3VFK A;  1YN3 A;  2V4I B;  1A70 A;  2LWP A;  5D6J B;  3EHV A;  1V9J A;  2NPT B;  4GLS C;  4KDL B;  2AEH A;  4ARC A;  3DBL I;  4FJY A;  2UYZ B;  2VRR B;  2FCS A;  4K3C A;  2WXF A;  3MC8 A;  5FR6 A;  4BKS A;  3P42 A;  2G45 B;  2IYD B;  2DZK A;  1IBX A;  5HG2 A;  4IWP A;  1HTQ A;  3HVD A;  3AXC A;  1WY8 A;  4US9 A;  1WIA A;  5BYS A;  1RM6 C;  3Q3M C;  1ZOY B;  3WAM A;  3V3X A;  3AEA B;  3DVG X;  1F52 A;  3A1Q B;  2FNJ B;  4CHK A;  3DBR I;  3ZNI D;  3K9O B;  1L5P A;  4I6P A;  1V80 A;  2DBY A;  2BPS A;  4P1B C;  1WR6 E;  2EMS A;  3AB5 A;  3AM9 A;  3I57 A;  3HK0 A;  1FFV A;  3GOE A;  2MJD A;  2ZZP B;  5LNK 1;  1V5O A;  2O6V D;  4DDI D;  1L0X B;  2A5U A;  1GB4 A;  1SE4 A;  3A4R A;  1EWC A;  2KHW B;  1PYW D;  4W9E A;  1OEY J;  5LLI A;  1QOA A;  2RMM A;  3W1Y A;  2ACZ B;  1EUV B;  1F9J A;  1AAR A;  2KDI A;  1WX7 A;  3ONS A;  2HE7 A;  1C9F A;  4WJN A;  2D3G A;  1JRO A;  2BS2 B;  3EFC A;  2V3N A;  4FAD A;  2JQR B;  4LNI A;  3DHG C;  3BYY B;  1N5W A;  1YN5 A;  3DHI C;  4AS1 A;  1MG4 A;  3U52 E;  1DOI A;  1WE7 A;  5FK9 C;  3H1U A;  2EEL A;  1K51 A;  1CQV A;  2NMQ A;  1TZ1 A;  2UU7 A;  2ZW0 A;  1XCQ L;  4MGI E;  3OAW A;  3H8H A;  2FID A;  4G0N B;  5JHB A;  2PVO D;  3GE8 C;  2V3S A;  4DHJ D;  2MH7 A;  3VUY A;  1SE9 A;  2WP9 B;  2D10 A;  5IA7 A;  2KTF A;  4YSX B;  3ZQ4 A;  2G4S A;  2DZM A;  3ZW3 A;  4LJP B;  3W1S A;  3C19 A;  3DBS A;  4M00 A;  4JQW C;  3P4P B;  4F1S A;  1V8C A;  4J6I A;  1C78 A;  4II3 B;  3AU5 A;  1YMH E;  1MFW A;  3DOW A;  2K3U A;  3A33 B;  5T8I A;  1V86 A;  2DNF A;  2KQ7 A;  1IGD A;  2L1A A;  2K8C A;  4OZC A;  3L4P A;  3SR6 A;  3TEZ A;  1YX5 B;  4WUR A;  1XLN A;  4WJQ A;  3APC A;  2L76 A;  4II2 B;  3UGB B;  4DWF A;  2K25 A;  2N7J A;  2WXN A;  1XD3 B;  4RGM A;  1QOB A;  4A3O A;  3C0R B;  3ZNG C;  1GG3 A;  1JWS D;  2XBB C;  4KSL C;  2JXX A;  1GJZ A;  2KDE B;  2BYF A;  3W5V B;  2MBO A;  1MHX A;  4JWU C;  4GMV A;  3NG0 A;  3N30 A;  5D2M B;  3DHH C;  3TJP A;  5BMG A;  3I3T B;  2JPH A;  5AZG A;  1QF6 A;  2V0G A;  3WA0 A;  1FD6 A;  2KOX A;  3H7P B;  2XN9 C;  4M8N A;  4EEW A;  4DBG A;  1CK1 A;  2GBJ A;  1STE A;  1C77 A;  2KN4 A;  2KQ4 X;  1JQ4 A;  3DWM A;  4PYU A;  4A90 A;  4YL8 A;  3PZ7 A;  2WXR A;  2MLB A;  3AE9 B;  2TSS A;  2YVC A;  2C7N B;  3V62 A;  1F0Z A;  3VVW B;  1CZP A;  2OED A;  4C4V B;  3HM6 X;  1E5W A;  3GE3 C;  3A9K B;  3IXS A;  2AWT A;  3ZUN A;  5LXI B;  1N6Z A;  4ZRP A;  4WQM A;  1WXA A;  4YSY B;  5C3J B;  5EE1 A;  4G3X B;  2J0K A;  1ZUD 2;  1WX9 A;  5TSS A;  2GB1 A;  2CHZ A;  1WGR A;  3RNG C;  2INP E;  1SF0 A;  3UIN B;  5IN7 A;  2ZEQ A;  4GB9 A;  2LFI A;  3DBH I;  1YX6 B;  1SIF A;  2D3B A;  1MG8 A;  3TL5 A;  4FLH A;  3L0W B;  3LYY A;  2KTR A;  4GGQ A;  4PT5 A;  3HM3 A;  5AZH A;  3JSV B;  3H9D A;  1BXT A;  1MI0 A;  3TSS A;  3E9S A;  2LZ6 A;  4MH0 E;  3PZ8 A;  2LVP A;  4MT5 A;  3KWL A;  1A5R A;  2M17 A;  3R3M A;  2FCN A;  1E10 A;  4EE2 A;  4XYC A;  1QZE A;  5EE3 A;  3ZJV A;  2LJ5 A;  4ASW C;  1FCC C;  2G3Q B;  1FEH A;  3EUB 2;  4OVU A;  1NI2 A;  1NYQ A;  4XDC A;  4N59 A;  2SAK A;  1VLB A;  2BS4 B;  2OJW A;  2L32 A;  4FJV B;  1D5Z C;  4K3B A;  1YOV B;  4HEA 1;  1IBX B;  2KJH B;  2J4X A;  3AE8 B;  4FJZ A;  2DYB A;  1UH6 A;  1D5M C;  1SJE D;  2WXQ A;  2BW2 A;  2WDQ B;  4ZHP A;  1I4X A;  1J7A A;  3PRZ A;  1E9M A;  3W9C B;  5J18 A;  4EZJ A;  1EU3 A;  2K0P A;  3QQ8 B;  4YT0 B;  3M95 A;  4ZRI A;  2PIA A;  3AEB B;  2HJ1 A;  1RFA A;  2ONQ A;  3VR8 B;  3SFD B;  1MPE A;  5HKH A;  4ACF A;  5EE0 A;  2L0F A;  3W1S C;  3MJW A;  1H4R A;  2IO0 B;  1HXY D;  1XQQ A;  1WH3 A;  1LGR A;  2BVC A;  4EOY A;  3TEX A;  1ZXH A;  4KV2 A;  2N9L A;  1VJK A;  2D3C A;  2G9H D;  3T8M A;  4C7Z A;  4US8 A;  2NCN A;  4TQ1 A;  2GOW A;  1VRA B;  1F77 A;  2HD5 B;  1PQS A;  1J7B A;  4WWP A;  3BZD B;  3H6N A;  2LUM A;  2JSV X;  3AI5 A;  1DOY A;  2ZVN A;  4B0M A;  2N9X A;  1E7U A;  4NY0 A;  3RUI B;  4KIK A;  3L17 A;  3N20 C;  1FXT B;  4GU2 A;  3T3N A;  3RMK C;  5E6P A;  1WF9 A;  1I4H A;  1WE6 A;  1QLB B;  2LGS A;  3RNF C;  3Q3F A;  3TBL D;  1TKY A;  4CYE A;  4GIV A;  2QHO A;  4GSW A;  4WJP A;  2JRI B;  2VH1 A;  1SE2 A;  2I1K A;  2D3A A;  4TMA B;  2J52 A;  2J53 A;  3V05 A;  3AEF B;  3SHQ A;  3OJ3 A;  1LM8 B;  1V5T A;  4J3O D;  1K8R B;  1GOZ A;  4P6V F;  2MW5 A;  2JWU A;  4M0W B;  1LFD A;  2WYQ A;  4W9J A;  5DPT A;  3NRZ A;  3P4Q B;  3UQA A;  2LJI A;  4W9I A;  1H8C A;  2PEA A;  4DHZ B;  2JVC A;  4HKQ A;  1JML A;  1UNS A;  4LDT B;  3Q8E A;  3QAR A;  2C7H A;  3DQV A;  2IGH A;  4B0E A;  4EZK A;  4RGN A;  2IY0 B;  3X23 A;  3UIO B;  2JZP A;  2KWV B;  4HCP B;  4OW0 A;  2IY1 B;  2LVO A;  2E3T A;  1S1Q B;  1E6E B;  4ZRJ A;  3AN1 A;  2ON8 A;  1ZW7 A;  4YTM B;  1R4M B;  2D2Q A;  2HTM E;  1KLV A;  1ZDX A;  3APF A;  1C4A A;  1B9R A;  4N9F 4;  2KDM A;  1C79 A;  3PHX B;  4IM0 A;  2GBK A;  1SB3 C;  3V60 A;  3TEY A;  2BTE A;  3ZO5 B;  1AYF A;  1S3S G;  5IAA C;  3B08 A;  4MM3 A;  4EUT A;  4H2A A;  1NEK B;  3N9Y C;  4TSS A;  1WX8 A;  4K7S A;  1C4C A;  1ZPS A;  3JW0 X;  2BQQ A;  4WQO B;  1HZ6 A;  2HDE A;  1WRI A;  5D94 A;  4IKG A;  1JWU D;  1XXG A;  1P0R A;  2N1V A;  4NZL B;  4HK2 A;  1R4M I;  5BMI A;  3PLV A;  2KVR A;  2O6V A;  2UWQ A;  1Z2M A;  3PSE B;  3GB1 A;  4MJS B;  4JX1 C;  1E7P B;  1SEB D;  1GUA B;  3VUW A;  2WXG A;  3A4S C;  3VHT C;  1I35 A;  2JT4 B;  4IW0 A;  1WXV A;  3QHT A;  2AQ2 B;  3NOB A;  4LCD E;  1D4B A;  4WWM A;  1TS3 A;  1K53 A;  2M0X A;  2EKI A;  3KVF B;  3KW5 B;  3QA8 A;  1WRD B;  3Q8A A;  2NS5 A;  1J7C A;  3IHP C;  3AMZ A;  3OG5 A;  1N60 A;  1UD7 A;  3AE6 B;  4HDQ A;  5G5H A;  1XCT L;  2Y3A A;  4KGR A;  1ENF A;  4YTP B;  2I38 A;  2ZCB A;  1MVK A;  1VD2 A;  4B95 A;  1UZX B;  4MM3 B;  5GXG B;  1OEY A;  3R2T A;  5E6J A;  2LVQ A;  2X8X X;  2FBW B;  1QKZ A;  3IBE A;  2GRI A;  4P1C C;  4UDU C;  2M19 A;  2WXH A;  3TCA A;  2FCM A;  3Q3O C;  4RF1 A;  5KHQ A;  1FRD A;  3ZXV A;  1K50 A;  4EFO A;  4M02 A;  1FRR A;  4TV3 A;  2JU6 X;  3NZU A;  1R7S A;  4GDK B;  1GB1 A;  2ASQ A;  3ML8 A;  2C5L C;  5DPW A;  2PMV A;  5AUK A;  3DBL B;  1FCL A;  1N5X A;  2KZR A;  3TUO A;  2PKO A;  2L83 A;  1EM7 A;  2N1W A;  3E56 A;  4YTN B;  2AQ1 B;  4YXD B;  2RDB C;  4MDK E;  2RDG A;  2IO2 B;  2LHD A;  5E6N A;  3LB8 C;  4FN2 A;  4URK A;  3ZXR A;  1YJ1 A;  1XT9 B;  4M0W A;  1FO4 A;  3NHE B;  3O65 B;  3P4R B;  2GBN A;  3TIX A;  4A8X C;  4A20 A;  2A4Z A;  5JZE B;  1ESF A;  3NUH B;  3ZGZ A;  4NJ7 A;  3VRA B;  3QK0 A;  3NZ3 A;  4RNA A;  3KUD B;  4GN1 A;  4JGH B;  2CHX A;  2W82 A;  3BWU D;  3FIL B;  2NBU A;  4FXC A;  4GDL B;  2LMC A;  4ZHO A;  3U2S C;  3B1L X;  4CO7 A;  1WSP A;  1UUP A;  2M56 B;  1P3Q U;  4D2K A;  1WZ0 A;  3PV1 A;  3P1M A;  1L0Y B;  4HRO A;  1I4R A;  3C8Y A;  2AQ3 B;  3RI7 C;  1L6U A;  1Y56 A;  3AE7 B;  1PGB A;  3N1Y C;  1P7F A;  5DPS A;  4HJG E;  4KIK B;  2KO3 A;  2LRU A;  1UGJ A;  1HEZ E;  2FUG 1;  3M63 B;  2ZCC A;  3N32 A;  2KNB A;  3AUL A;  3FC4 A;  5TR5 A;  4G11 A;  1XO3 A;  4N58 A;  2ZNV C;  2C7M B;  1CJE A;  4K1R B;  2LXA A;  3MHS D;  2KK8 A;  3A9J B;  2B76 B;  3DPD A;  3I9V 1;  2INC C;  1PGA A;  2B3A A;  4PK1 A;  4S17 A;  2KJR A;  3H7S A;  5IOI A;  4GOC A;  1T3Q A;  5CHW A;  5G2N A;  3SEB A;  1PUT A;  1ISN A;  1GC6 A;  3HIZ A;  3VTV A;  4HPP A;  1TZO A;  3ALB A;  4LNF A;  1X1M A;  1WR1 A;  4ICV A;  2N4F A;  2KAN A;  1WJ6 A;  4EZL A;  2ICI A;  4YWG G;  3PGE A;  4P16 A;  2R2Q A;  3VTW A;  1E90 A;  1UF0 A;  3ZRF A;  3BYT B;  4HLE A;  4TUU A;  2JYT A;  5FKA C;  2I2Y A;  2Z0D B;  3DVN V;  4BFR A;  4N6E B;  4BKG A;  4HVB A;  4LLG M;  2G1E A;  4AJW A;  4XGA B;  2PVG C;  3DVN U;  2QSD A;  4RM9 A;  4MGZ E;  3NVY A;  3R8B A;  2Q5W D;  3BII D;  3PZD A;  2I1J A;  2W3S A;  2PPH A;  2ZPN A;  5D3D A;  4KKJ A;  2JRH A;  1TYG B;  1XLQ A;  1QIL A;  3ZTC A;  3ZNZ B;  3R66 C;  1N61 A;  5CHF A;  4BBN F;  1FXA A;  2V9H A;  4AQ7 A;  4BBN C;  2LI5 A;  2WS3 B;  2QIE B;  1L2N A;  1YJI A;  1TJE A;  4NQK E;  2MBE A;  2IBI B;  1UWX A;  2WGS A;  4BOZ B;  4RCO A;  1E8Z A;  4TKN A;  3ZKJ C;  4BKS D;  1TT5 B;  4KZC A;  3JSV A;  3AEE B;  2QEJ C;  2WXI A;  3PS6 A;  2H89 B;  3IG3 A; 
#chains in the Genus database with same CATH homology
 4EKU A;  1FXT B;  2MWS B;  4GU2 A;  2WX0 A;  1P9D U;  3SDL C;  2LWP A;  3RUL A;  2LUE A;  3EHV A;  1WI0 A;  5D6J B;  1V9J A;  2IO3 B;  5E6P A;  2BYV E;  1WF9 A;  3U7D A;  2NPT B;  1WE6 A;  4KDL B;  2KLC A;  4B9K A;  2AEH A;  2KN5 A;  2V4L A;  3DBL I;  3Q3F A;  3TBL D;  4CYE A;  4GIV A;  2MP2 B;  3ECI A;  2QHO A;  2CKH B;  2CHW A;  2DYO A;  2FCS A;  2UYZ B;  2VRR B;  2JRI B;  4FJY A;  4GSW A;  4WJP A;  4JIO U;  2I1K A;  4NQL B;  2MSE D;  2LRW A;  2KQS A;  5FR6 A;  1V49 A;  4MSM B;  4WJO A;  4BKS A;  2W9N A;  1CMX B;  2G45 B;  4FBJ B;  2JF5 A;  3SHQ A;  3OJ3 A;  2IYD B;  4FA6 A;  3TMP B;  2DZK A;  2ZPY A;  1LM8 B;  3CSF A;  5DPR A;  1V5T A;  1K8R B;  4ANV A;  4IWP A;  4I6N B;  2MW5 A;  1V2Y A;  4M0W B;  1WGD A;  2KFK A;  4IM2 A;  3WAN A;  1LFD A;  1JRU A;  2WYQ A;  5JH5 C;  3AXC A;  3RZF A;  4W9J A;  2MRP A;  3PTF C;  5DPT A;  3VXW A;  5J17 A;  3UQA A;  1WY8 A;  1WIA A;  4W9I A;  3HHM A;  3PVL A;  1H8C A;  2PEA A;  2JWZ A;  3MTN B;  4TQ0 A;  3WAM A;  4DHZ B;  3IVF A;  3DVG X;  2IZV B;  2JVC A;  4JLC A;  3A1Q B;  2FNJ B;  4HXD A;  1Q5W B;  1V81 A;  2DEN B;  2L7R A;  3DBR I;  3M3J A;  3NZS A;  3RYT A;  2XK5 B;  2BYE A;  3UIP B;  2N7D A;  3K9O B;  4LDT B;  2CR5 A;  4JL9 A;  4I6P A;  3QAR A;  4MJS A;  2C7H A;  4F8C B;  2RD0 A;  3DQV A;  4NJ6 A;  4EZK A;  1V80 A;  3VH3 B;  2BPS A;  2BF8 B;  2KXJ A;  2IY0 B;  1WMH A;  2YLM A;  3QIJ A;  3UIO B;  3X23 A;  4K7W A;  1WR6 E;  2EMS A;  2KWV B;  3A9J A;  4HCP B;  3HK0 A;  3GOE A;  2ZZP B;  3RD2 A;  2PE6 B;  4A3P A;  2IY1 B;  2LVO A;  2KMA A;  2RR9 A;  3H7P A;  1I42 A;  3U8Z A;  1S1Q B;  4W9K A;  3EFU A;  4ZRJ A;  1V5O A;  4DHJ B;  2O6V D;  2WX1 A;  1M94 A;  1ZW7 A;  4DDI D;  1J8C A;  4ICU A;  2A5U A;  2C60 A;  4WWN A;  3U30 A;  4NAW A;  3A4R A;  4PS8 A;  2KHW B;  3WAL A;  4W9E A;  2DAJ A;  1OEY J;  5LLI A;  3ZTD A;  2D2Q A;  5L95 C;  1KLV A;  3PRP B;  3W1Y A;  3APF A;  4PYZ A;  1WFY A;  1EUV B;  2L0T A;  1F9J A;  2MCN B;  1AAR A;  2KDI A;  2IO1 B;  4N9F 4;  1NDD A;  1WX7 A;  4W9C A;  3ONS A;  2HE7 A;  3L13 A;  5CTR C;  4M8M A;  4WJN A;  2D3G A;  3PHX B;  4IM0 A;  2GBK A;  4FAD A;  2HJ8 A;  3V6E B;  3V60 A;  2DX5 B;  4DXA B;  3ZO5 B;  1S3S G;  2NBV B;  5IAA C;  3B08 A;  4MM3 A;  4EUT A;  3UF8 A;  1WX8 A;  4K7U A;  5C23 A;  4K7S A;  2MBB B;  1WE7 A;  2LAS A;  1IPG A;  5G55 A;  3H1U A;  2EKE C;  2K39 A;  1UBQ A;  3A9K A;  2N7E A;  4E71 A;  1J0G A;  3LDZ E;  3JW0 X;  2AYO B;  2C9W B;  3EEC A;  4WQO B;  1V6E A;  2REX A;  1TZ1 A;  4KZ0 A;  3JVZ X;  1KJT A;  5D94 A;  4E74 A;  4IWQ A;  4AWJ A;  1P0R A;  2L3Z A;  4MGI E;  3ZLZ A;  4I6L B;  2N1V A;  3OAW A;  2FID A;  1EF1 A;  4G0N B;  2AL6 A;  1WMH B;  5JHB A;  4WAA A;  4HK2 A;  1Y8R C;  2V3S A;  1R4M I;  3ZDM C;  4DHJ D;  3PLV A;  2KVR A;  2LGX A;  3VUY A;  1SE9 A;  2O6V A;  2J7Q B;  2UWQ A;  1Z2M A;  3PSE B;  4DK5 A;  4IG7 B;  4MJS B;  2KMC A;  2D10 A;  2K1F A;  4X57 B;  5IA7 A;  2KTF A;  4OVV A;  1GC7 A;  1Z5S B;  1GUA B;  4DHZ E;  2XEW A;  2G4S A;  3CMM B;  2DZM A;  3QC8 B;  3VUW A;  3A4S C;  3ZW3 A;  3L08 A;  4LJP B;  3VHT C;  1I35 A;  2JT4 B;  4NNJ B;  4IW0 A;  3DBS A;  3W1S A;  1WXV A;  3QHT A;  4JQW C;  4F1S A;  4J6I A;  1E7V A;  4GDK A;  3NOB A;  4II3 B;  3AU5 A;  4LCD E;  3EC8 A;  2KX3 A;  3ZRC A;  3DOW A;  5KHO A;  3A33 B;  1WXM A;  2D07 B;  3APD A;  3L16 A;  1OQY A;  1V86 A;  2KQ7 A;  2M0X A;  4AP4 C;  3KVF B;  3KW5 B;  4AOF A;  3GZN I;  3QA8 A;  1WRD B;  2K8C A;  4HPL B;  5AZF A;  1UGM A;  2NS5 A;  3ENE A;  3CST A;  5D7G A;  1YQB A;  3QX1 A;  4ANX A;  3SD5 A;  3T9L A;  1YX5 B;  3ZIM A;  2G4D B;  3IHP C;  3Q3J A;  3B0A A;  4WJQ A;  2DZI A;  3APC A;  4HJK A;  1UD7 A;  2BWF A;  2L76 A;  2K6D B;  4HDQ A;  1E8Y A;  4II2 B;  3UGB B;  4DWF A;  2K25 A;  1D3Z A;  1XD3 B;  2MA9 B;  2ZCB A;  3PRE A;  1VD2 A;  4B95 A;  4A3O A;  5L83 A;  1UZX B;  3C0R B;  2LGY A;  2J0J A;  3ZNG C;  1GG3 A;  1OEY A;  2XBB C;  4IC7 B;  2BWE S;  4KSL C;  2GBM A;  2JXX A;  2LVQ A;  3P2B A;  4XZ4 A;  2DYM A;  2KKC A;  1EO6 A;  1WXS A;  2KDE B;  3IBE A;  1GJZ A;  2BYF A;  5EDS A;  2MBO A;  2AL3 A;  4GMV A;  3TCA A;  2HTH A;  2WWZ A;  2GMI C;  2FCM A;  3JYU A;  2RSU A;  5KHQ A;  3N30 A;  3CF6 E;  2EMT A;  4K81 A;  4G50 A;  1HE8 A;  1J19 A;  4NPN A;  4EFO A;  3OJ4 B;  2GBR A;  5D2M B;  3SU8 X;  4TV3 A;  3TJP A;  3R7R A;  3N3K B;  3ML9 A;  3NZU A;  4MGK E;  4XX5 A;  5LXH A;  3I3T B;  2JPH A;  4GDK B;  5AZG A;  3RCZ A;  3WA0 A;  1WJN A;  2ASQ A;  2KWU B;  2KFJ A;  3ML8 A;  2C5L C;  4FHJ A;  2LD9 A;  5DPW A;  3LJ3 A;  2KOX A;  3H7P B;  2KDB A;  1IP9 A;  3PT2 B;  1WGH A;  2KZR A;  4MEM A;  4M8N A;  4EEW A;  2N1W A;  4DBG A;  2JZZ A;  1WM2 A;  2GBJ A;  2KLG A;  2FUH B;  2KX0 A;  4MDK E;  2PJH A;  3PLU A;  2O6V B;  2IO2 B;  4BOS C;  1ZGU B;  4PYU A;  1T0Y A;  5E6N A;  3VQI A;  3AU4 A;  4FN2 A;  3BY4 B;  4URK A;  1Q1O A;  2XK5 A;  4YL8 A;  2MBH A;  1YJ1 A;  4GXB A;  1XT9 B;  2KFK B;  2MLB A;  1WGY A;  2DHZ A;  1SGH A;  3NHE B;  3O65 B;  4ZYN A;  2GBN A;  5BO4 B;  2YVC A;  1KOT A;  4HCN B;  2C7N B;  5CX3 A;  3V62 A;  2Z0E B;  3TIX A;  1EF5 A;  3VVW B;  4A20 A;  2A4Z A;  1OTR B;  5JZE B;  3OLM D;  1RAX A;  3HM6 X;  3ZNH B;  1E5W A;  2V1Y A;  2ZJD A;  3D32 A;  4NJ7 A;  2MX2 A;  3QK0 A;  5C1Z A;  3A9K B;  2AWT A;  3ZUN A;  4WWO A;  3KUD B;  5LXI B;  1L7Y A;  4GN1 A;  4JGH B;  3RZW C;  2MP2 A;  2CHX A;  1WXA A;  3QJZ A;  2NBU A;  2NPT A;  2KWC A;  4GDL B;  4AJY B;  4G3X B;  2J0K A;  4FUL A;  2BGF A;  1WX9 A;  2OJR A;  1ZKH A;  3KYC D;  2CHZ A;  3B1L X;  1WGR A;  1KM7 A;  4CO7 A;  4AUQ C;  4RM8 A;  2K8H A;  1P3Q U;  4W9D A;  1WZ0 A;  2L05 A;  5E6O A;  2FCQ A;  3PV1 A;  4ZDV A;  3UIN B;  4BVU C;  3K9P B;  2BKF A;  2ZEQ A;  1TTN A;  4GB9 A;  1E8W A;  1RLF A;  4E3C A;  3DBH I;  4IM3 A;  3DVG Y;  1YD8 U;  4KSK C;  1YX6 B;  1SIF A;  5CHV C;  1MG8 A;  2MBQ A;  3TL5 A;  1UBI A;  4LJO B;  4NAW B;  4FLH A;  2M1M A;  5DPS A;  3L0W B;  4IUM B;  4KIK B;  4HDO A;  4W9H A;  2KTR A;  2KO3 A;  2LRU A;  2ZNV B;  1YIW A;  2O2V B;  3M63 B;  2ZCC A;  3N32 A;  4GGQ A;  4PS7 A;  3S2A A;  2KNB A;  3AUL A;  5AEK B;  3PHW B;  3HM3 A;  5AZH A;  5TR5 A;  3JSV B;  4G11 A;  3H9D A;  2ZNV C;  2C7M B;  3VUX A;  1WYW B;  4K1R B;  3NS8 A;  2LXA A;  3MHS D;  1OGW A;  2KK8 A;  3A9J B;  1Q0W B;  2LZ6 A;  3UQB A;  2ZVO A;  5DCN A;  3NY5 A;  3IFW B;  3PRM B;  3DPD A;  4MH0 E;  3V6C B;  2LVP A;  2KJ6 A;  2B3A A;  2L00 B;  2R2O A;  2KJR A;  4HWI B;  1A5R A;  1IYF A;  3H7S A;  2CS4 A;  2M17 A;  2FAZ A;  3R3M A;  4W9F A;  2FCN A;  2RGF A;  4B6W A;  4ANU A;  3L10 B;  4GOC A;  3VAW A;  2WDT B;  5CHW A;  5G2N A;  4KDI C;  3A1Q A;  3RT3 B;  2JZ3 B;  1QZE A;  1ISN A;  1GC6 A;  3QWZ B;  3HIZ A;  3VTV A;  1LXD A;  2LJ5 A;  4ASW C;  2DZJ A;  3ZVV A;  3X0W A;  2KD0 A;  1TBE A;  3ALB A;  1X1M A;  1WR1 A;  2D11 A;  2G3Q B;  4W9L A;  1BT0 A;  4ICV A;  2N4F A;  2PE9 A;  4OVU A;  2KAN A;  1NI2 A;  1WJ6 A;  4MEL A;  5JHA A;  4EZL A;  1LQB A;  1C3T A;  3PGE A;  3WAP A;  2R2Q A;  2BKR B;  3QAQ A;  2RPQ A;  1E90 A;  3KH0 A;  3VTW A;  4FJV B;  4MGY E;  4CHK A;  1C1Y B;  3ZRF A;  3QCA A;  2KJH B;  2FIF A;  4HLE A;  4TUU A;  4FHK A;  4FJZ A;  2Z0D B;  2DYB A;  3DVN V;  4BFR A;  1UH6 A;  2MQJ A;  2DAF A;  2J0M A;  2NVU I;  3DCG A;  4W9G A;  4BKG A;  5J2R A;  4GDL A;  2CU1 A;  2N9E B;  1P98 A;  4HVB A;  1TGZ B;  4AJW A;  1GNU A;  4BKT A;  1VCB A;  3PRZ A;  4HPM B;  3DVN U;  2N9P C;  1U4A A;  4RM9 A;  1UEL A;  4RMA A;  4XC2 A;  5J18 A;  4MGZ E;  2K8B A;  2L8J A;  4EZJ A;  4MSQ B;  4IWO A;  2Z59 B;  2K6Q A;  1WJU A;  3QQ8 B;  3M95 A;  4ZRI A;  3PZD A;  3IG3 A;  2I1J A;  3KYD D;  1WZ3 A;  1RFA A;  2PPH A;  2ZPN A;  5GMV A;  1WM3 A;  3DDC B;  1NBF C;  2JRH A;  3VH4 B;  5HKH A;  3PPA A;  2L0F A;  1WGG A;  3KUC B;  2M8S A;  3W1S C;  3ZTC A;  3MJW A;  2Y5B B;  3ZNZ B;  1G6J A;  1H4R A;  2IO0 B;  3R66 C;  1RRB A;  3L54 A;  1P1A A;  1XQQ A;  5CHF A;  1E8X A;  3KUZ A;  4BBN F;  1WH3 A;  4F7Z A;  2OOB B;  3WAO A;  3VTU A;  2JY6 A;  2M4N A;  3BIN A;  4LDT D;  3V61 A;  2KDF B;  4BBN C;  4EOY A;  2LI5 A;  3M62 B;  3R7Q A;  3VDZ A;  2KC2 A;  3ZDT A;  3ZNI D;  4KV2 A;  1WJ4 A;  2NBW B;  3WIM A;  1L2N A;  2KC1 A;  4ANW A;  3T8M A;  2KTR B;  4KVG B;  4NQK E;  1R4N I;  2LXC A;  2NCN A;  2GOW A;  4TQ1 A;  2MBE A;  2HD5 B;  2IBI B;  4BOZ B;  1PQS A;  2LGD A;  4WWP A;  1E8Z A;  4TKN A;  3ZKJ C;  4P7I A;  4BKS D;  3H6N A;  4KZC A;  3JSV A;  2NR2 A;  3AI5 A;  2ZVN A;  4PS3 A;  3VFK A;  2O2V A;  4ZRK A;  4DDG D;  2N9X A;  1E7U A;  3PS6 A;  4NY0 A;  3RUI B;  4KIK A;  3L17 A;  2JUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...