2JVCA

Nmr solution structure of ubiquitin like protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
82
Chain Sequence
GPLGSMQIFVKTLTGKTITIDVDHADTVGAVKAKIYDKEGIPPDQQRLIFGGKQLEDSNAMSDYNVQKESTLHLVLRLRGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of ubiquitin like protein
rcsb
molecule tags Unknown function
molecule keywords ubiquitin_like protein
total genus 11
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jvcA00
2HD5B 4W9EA 5LLIA 2CR5A 3PRZA 4KIKA 3AULA 2LXAA 4A20A 2CHXA 3JYUA 2KVRA 3A1QA 2Z0EB 3W1YA 4WWNA 3ONSA 3KUDB 2C9WB 3R7QA 3PRPB 4DK5A 1UGMA 2DYBA 4MDKE 1WI0A 2K8HA 4RM9A 4EUTA 4GDLA 3I3TB 4XZ4A 4HPLB 5TR5A 4W9LA 3ZRCA 4MGYE 4IG7B 1EO6A 4MSMB 4LDTD 4HLEA 3A9KB 2IO2B 4KVGB 2W9NA 5HKHA 2LASA 3V62A 4EZLA 3QIJA 3QWZB 4MGZE 3RD2A 4RM8A 3AU5A 3B08A 3OJ3A 4GN1A 2PJHA 4BKGA 3VH4B 2REXA 1D3ZA 4BOSC 3WAOA 1WM2A 4GIVA 2IBIB 4GMVA 4A3PA 2KANA 3KVFB 3OJ4B 4HWIB 2GMIC 1WE7A 4W9GA 1WJ4A 1OGWA 3CMMB 1RRBA 3H7PB 4LCDE 4W9JA 2NBVB 4TKNA 3DDCB 3PHWB 2UYZB 2KFKB 2OJRA 3N30A 4ZRKA 4AOFA 5EDSA 3VHTC 4X57B 1WGHA 2MBBB 3N32A 1VD2A 2BKRB 2K6DB 3ML8A 1YJ1A 2L7RA 1E8YA 1E7UA 4HDOA 2WX0A 5AZFA 2L76A 1WJUA 4JQWC 4DWFA 2HE7A 1GG3A 3PLVA 1U4AA 4M8NA 2MBEA 1CMXB 2KWVB 3PGEA 3R7RA 3K9PB 2ZNVC 4DDID 2KMCA 4IM3A 1J8CA 1E90A 4DBGA 2N1VA 4YL8A 3NHEB 2JVCA 3HHMA 3EECA 3RUIB 3ZTCA 2L05A 1Y8RC 3R3MA 2V1YA 2BWES 4FJYA 3KW5B 1YQBA 1WZ3A 1XD3B 2KQ7A 3B1LX 1NI2A 3A4SC 3TJPA 1VCBA 3GZNI 4BBNC 2NVUI 1NBFC 2K8BA 4WJOA 2JRIB 3VTVA 1WZ0A 2C7NB 2K1FA 3NY5A 3DVNU 3RCZA 1WX7A 2DZKA 1Z5SB 1H8CA 3QARA 5JHBA 2PE9A 2C7MB 4WWOA 2DYOA 1SIFA 3UIOB 3MTNB 2ZVOA 4URKA 3NZSA 4KV2A 2G4DB 3HIZA 3WAPA 5KHQA 3EHVA 5FR6A 4MGKE 2DZJA 3ZTDA 2HJ8A 1HE8A 3IG3A 3A1QB 3QX1A 1RLFA 2CHZA 2FCSA 2JWZA 3APDA 2ZPYA 4ICVA 4HDQA 4NJ6A 4OVUA 2FCMA 1WR1A 2NPTB 3JSVA 4B9KA 3VVWB 4B6WA 3M3JA 3NOBA 3PRMB 4IM0A 3DBRI 4M8MA 4EKUA 4DXAB 2KDEB 4EFOA 3PREA 1WMHA 1SE9A 2B3AA 2L3ZA 3VAWA 2KXJA 3KYDD 4N9F4 2KO3A 2RSUA 1V5TA 2C7HA 2JRHA 2NS5A 2ZPNA 4GSWA 4M0WB 3ZDMC 4EOYA 2J0JA 2M4NA 4AJWA 1WGDA 3L13A 4PYUA 4PS7A 2D11A 2GOWA 3HK0A 1WX8A 5J18A 2Y5BB 2LZ6A 1SGHA 4XX5A 1KLVA 1QZEA 2WDTB 2JT4B 3ZNHB 4DHJD 1C1YB 2LRWA 1GC6A 3QA8A 4IWQA 3VTUA 2LWPA 2KLCA 3A4RA 3DVGY 5DPWA 3AI5A 2K8CA 3RYTA 1GJZA 2ZCCA 3UGBB 1G6JA 1J19A 2NCNA 3K9OB 2KTRA 2XBBC 4ICUA 1RAXA 4GU2A 3WIMA 3DBSA 2LXCA 2AWTA 3DOWA 2BYVE 1KM7A 1V2YA 3PV1A 3MJWA 5AEKB 3Q3JA 2C5LC 4MELA 4II2B 2G4SA 3H6NA 4KZ0A 4ZRIA 3L10B 1J0GA 2AYOB 4K7SA 4GXBA 2L00B 4NQLB 1LXDA 2N4FA 4K1RB 3EFUA 4NAWA 3ZLZA 1I42A 3O65B 3TL5A 4LJPB 3ZW3A 2KC1A 4TQ1A 3WA0A 3VUWA 2N1WA 1R4NI 1V49A 2NBWB 4FJZA 1WR6E 4II3B 5JH5C 2DX5B 1P9DU 3BINA 3EC8A 4LJOB 5E6NA 2KDIA 4FLHA 1P1AA 4W9FA 4BKTA 1WJNA 4FA6A 4FJVB 2KJHB 3IHPC 3VUXA 1P3QU 2UWQA 3DVGX 2XK5A 2A4ZA 2Z0DB 5E6OA 3TIXA 2BYEA 2YLMA 2KFJA 1K8RB 4WJPA 1X1MA 3P2BA 4LDTB 3VXWA 5IA7A 2M1MA 3KH0A 1WYWB 1WM3A 2KWUB 3C0RB 1M94A 2J7QB 3DBHI 5DCNA 3RULA 1TTNA 2JY6A 3V61A 4BVUC 2O6VD 2ZZPB 1BT0A 1XT9B 3A9JB 1EF1A 2D2QA 3OAWA 3ZNZB 2KFKA 2K25A 3QK0A 2KQSA 2ZNVB 4ANWA 1E7VA 4E71A 5J2RA 2IYDB 2NBUA 3B0AA 2BPSA 3ZNGC 1WE6A 2KLGA 4RMAA 4HCNB 3DPDA 1IYFA 2CU1A 2IO0B 4DHZE 3JW0X 3L17A 4IWOA 2G45B 2MRPA 4IW0A 2IO3B 2J0MA 3PVLA 1UZXB 3IVFA 3LJ3A 3QJZA 2C60A 2OOBB 1TBEA 1ZKHA 4B95A 3L16A 3WAMA 2IY1B 4ANXA 1IP9A 1OEYA 2PPHA 3JSVB 3DCGA 4MM3A 3M63B 4I6PA 3UQAA 2KJRA 2EMTA 2L8JA 4BOZB 4BFRA 4G0NB 4NQKE 3PPAA 3MHSD 5KHOA 2LI5A 3QC8B 3R66C 4J6IA 3T8MA 3L54A 1LQBA 5J17A 1F9JA 2O2VB 3VUYA 2LGXA 2O6VB 4KSKC 1WXSA 4W9HA 2KKCA 4GDKB 4CHKA 4F8CB 4HXDA 2NPTA 4I6LB 3U30A 2L0FA 1WGRA 4KZCA 2Z59B 2FAZA 5IAAC 4IWPA 1WJ6A 2R2QA 3ECIA 4IUMB 2N9PC 4F1SA 1P98A 3RZFA 4AWJA 2FNJB 5CX3A 1OTRB 2XEWA 4BKSA 3A9JA 3SD5A 4PYZA 2YVCA 2DENB 1P0RA 2MBQA 2RPQA 2BWFA 2ZCBA 4MJSA 2MQJA 4ANVA 2RGFA 4EZJA 2LVOA 4F7ZA 3ZVVA 3N3KB 3OLMD 5CHWA 3IBEA 2XK5B 3PT2B 2KJ6A 1FXTB 2KZRA 2HTHA 2MX2A 5D2MB 3JVZX 2N7EA 1UD7A 3RT3B 3UF8A 4BKSD 4MGIE 4FULA 2JF5A 2D3GA 5GMVA 3ZIMA 2MSED 2KK8A 2MA9B 2FUHB 4FBJB 4ZYNA 2L0TA 5CHVC 2N9XA 1GNUA 2LGDA 2DZIA 4E3CA 3VH3B 2CS4A 4FHJA 1WF9A 2M17A 2RD0A 4EZKA 2IY0B 2KOXA 2KD0A 5AZGA 2GBRA 3U8ZA 3WANA 5DPSA 3WALA 3IFWB 4NNJB 1ZGUB 2BGFA 2QHOA 2FCQA 1R4MI 2KC2A 2BKFA 2M8SA 3DQVA 3KUZA 4JGHB 1H4RA 5JZEB 1Z2MA 4HPMB 4E74A 2KDBA 1LM8B 3VDZA 4TQ0A 5LXHA 2KDFB 3PZDA 3ZO5B 3CF6E 2M0XA 1Q0WB 4DHZB 2GBKA 1WFYA 4W9KA 2MLBA 1JRUA 4GB9A 5L83A 3ENEA 3X23A 4PS8A 4HCPB 5D7GA 4XC2A 3S2AA 4KDIC 2KWCA 1E8XA 2I1KA 3PHXB 2DAFA 2LJ5A 1UBQA 2V4LA 1UELA 1GC7A 2CKHB 2G3QB 3TCAA 1I35A 4PS3A 4GDKA 4HVBA 2DHZA 1S1QB 4KDLB 5CHFA 4TUUA 1UH6A 2LUEA 1IPGA 2CHWA 4OVVA 1WGGA 2DAJA 1WY8A 3CSTA 4K7UA 3ZUNA 3CSFA 4NY0A 3SHQA 2KN5A 2A5UA 4NPNA 2IO1B 3HM3A 1OEYJ 4W9IA 3NZUA 2FIFA 3W1SC 3A9KA 4EEWA 2AL3A 2BF8B 2DZMA 3ALBA 1V86A 3KUCB 4G3XB 5DPTA 2BYFA 3D32A 4AP4C 1KJTA 2FCNA 2AL6A 4K7WA 3X0WA 3H1UA 4DHJB 1WMHB 1WXVA 3H9DA 2LVPA 3HM6X 4W9CA 1Q5WB 3PLUA 3RZWC 3SU8X 4GOCA 3APFA 3L0WB 3LDZE 5BO4B 4HK2A 1MG8A 2MWSB 2GBJA 1KOTA 4KIKB 2D10A 4CO7A 3A33B 1AARA 3V6EB 1YIWA 1UBIA 3ZRFA 2RR9A 3W1SA 2KNBA 2MBOA 2EMSA 2I1JA 1ISNA 2K39A 2WX1A 3QAQA 4KSLC 2MP2A 1E8WA 2MW5A 4ZDVA 2ZVNA 2DYMA 5AZHA 4WAAA 2VRRB 2K6QA 3L08A 4JL9A 2N9EB 1V80A 4AUQC 2WYQA 2GBNA 2AEHA 4IM2A 2JPHA 3PTFC 2KX0A 2PEAA 4A3OA 1WGYA 1GUAB 3UINB 3ZNID 3DVNV 2EKEC 4WQOB 2ZJDA 4WWPA 1YX6B 1WRDB 2KHWB 3NS8A 1LFDA 4WJNA 4I6NB 4FHKA 5DPRA 2LVQA 3PSEB 4JIOU 3T9LA 2LD9A 4G50A 1Q1OA 5CTRC 3VTWA 3Q3FA 1EUVB 3GOEA 4FN2A 1V6EA 2ZEQA 4NJ7A 1C3TA 3VFKA 4ANUA 3M95A 3TMPB 1V5OA 2V3SA 1WX9A 5L95C 4FADA 1YX5B 4K81A 3TBLD 3UIPB 3BY4B 3UQBA 2JZ3B 2FIDA 3H7PA 1WXMA 2KX3A 3M62B 2MCNB 3V6CB 5G2NA 2LRUA 1A5RA 1T0YA 5D6JB 3AXCA 4IC7B 3KYCD 4W9DA 5C23A 4MJSB 4G11A 1XQQA 4HJKA 4WJQA 5E6PA 4BBNF 2D07B 1OQYA 2JUOA 3VQIA 1YD8U 2IZVB 2KMAA 2PE6B 4DDGD 4AJYB 3ZKJC 1E5WA 1EF5A 4ZRJA 1WXAA 2R2OA 4MH0E 1WIAA 2J0KA 2KTRB 3H7SA 4NAWB 3ZDTA 2JZZA 4JLCA 5JHAA 2KTFA 1NDDA 5C1ZA 1TGZB 4P7IA 3APCA 4MEMA 2ASQA 1V81A 3ML9A 1L2NA 1WH3A 1V9JA 4CYEA 3QQ8B 2NR2A 5D94A 1PQSA 3DBLI 1S3SG 3QCAA 1TZ1A 3V60A 1E8ZA 2GBMA 4TV3A 3U7DA 2JXXA 3SDLC 1RFAA 4GDLB 2O6VA 4GGQA 5G55A 3PS6A 2LGYA 2MBHA 5LXIB 2N7DA 2O2VA 3QHTA 1L7YA 1ZW7A 2MP2B 4MSQB 4ASWC 2WWZA 3AU4A
chains in the Genus database with same CATH superfamily
2J52A 3BIID 2CHXA 3A1QA 2Z0EB 2Z8LA 4WWNA 4DK5A 1N6ZA 5HI1A 4J3OD 1FM0D 4W9LA 1JWUD 2HJ1A 4MGYE 1Y56A 1EO6A 3U7ZA 2IO2B 1AW7A 2LASA 3OWEB 3QIJA 1FNWA 3RD2A 4RM8A 4GN1A 4WQMA 1NI3A 2JU6X 1D3ZA 4BOSC 4GMVA 3OJ4B 4XWTA 3Q3NC 1BMLC 2GMIC 1WGKA 4W9GA 1WJ4A 1YQ4B 1QT9A 1RRBA 4UDUC 3C8YA 2NBVB 3P42A 1FFVA 1HZ5A 1PYWD 4AOFA 1HEZE 3OG5A 1ET6A 1VD2A 1YJ1A 4HDOA 2K9XA 2L76A 4JQWC 1GG3A 1YMHE 3PLVA 4M8NA 1V1PB 1OFFA 3VRAB 1MVKA 4XWWA 2KMCA 4DBGA 3HHMA 4HPPA 1Y8RC 2V1YA 1XD3B 3B1LX 3P1MA 2XNAC 3A4SC 3TJPA 2IJ0A 3VTVA 2HTME 1JW9D 2C7MB 1D4BA 2WXGA 3GP7A 2ZVOA 1KH0A 4MGKE 4M8MA 2G1EA 2ZPYA 4HDQA 2FCMA 3JSVA 5JXVA 3NOBA 1FCLA 3DBRI 4EFOA 1SE9A 2LUMA 2RDGA 1MPEA 4N9F4 2TSSA 4N58A 4M0WB 1V5TA 1YQ3B 3ZDMC 2M4NA 4YSXB 1QZEA 1C1YB 1E9MA 3VTUA 2LWPA 1RAXA 1R4MB 2LXCA 2NTSA 2AWTA 3FILB 4C80A 1DOXA 4MELA 4KZ0A 4ZHOA 1DYQA 4AS1A 1LXDA 1TY0A 3ZW3A 3VUWA 2N1WA 1V49A 2NBWB 1YJJA 2WU5B 3PZ8A 2DX5B 1HXYD 2KDIA 4FLHA 1P1AA 3RI7C 4FA6A 3VUXA 1P3QU 2XK5A 3TIXA 1N61A 1K8RB 4WJPA 3VXWA 2GLSA 2M1MA 3FILA 3N1ZC 1M94A 1TKEA 1I4GA 1F77A 2O6VD 3OAWA 2K25A 4ANWA 1UF0A 2NBUA 3B0AA 3DPDA 3LXFA 2G45B 3PVLA 3Q3MC 2C60A 4LNOA 1TBEA 3L16A 1GPXA 4RNAA 3GB1A 1CJEA 1FIQA 3DCGA 4I6PA 3BVMA 3T8MA 3L54A 5J17A 2O2VB 1DGJA 4OZBA 2O6VB 4B0MA 2FUG1 3U2SC 4I6LB 4P1CC 1WGRA 4KZCA 4TSSA 3MC0B 3AEDB 5IAAC 4IWPA 1WJ6A 2N9PC 4F1SA 3WCQA 2PVOD 1R7SA 2OJWA 4AWJA 2FNJB 1L5PA 1I7HA 1MG4A 2RPQA 2BWFA 2ZCBA 4MH8A 2D3BA 2KMMA 2DBYA 3AE5B 4HJGE 3OLMD 4HKZE 2BS4B 2KZRA 1SJED 2N7EA 1UD7A 4C4VB 2BS3B 2JF5A 2MSED 1XCQL 2N9XA 4E3CA 2RDBC 1NYRA 2WXPA 1F2RC 2KD0A 2N9KA 2GBRA 3CWIA 5AZGA 3U8ZA 1A70A 3WALA 2X38A 3TSSA 2BGFA 3ZYYX 1R4MI 3DQVA 3AM9A 3KUZA 5AUIA 2D3CA 5JZEB 4HPMB 3ZJVA 2N7JA 3VDZA 2QILA 3RN9C 3PZDA 5EE3A 1Q0WB 1WFYA 4GB9A 3ENEA 4PS8A 4HCPB 5D7GA 4XC2A 2KWCA 3U52E 1E8XA 1ET9A 3ETRA 2YEPF 3CIRB 3MFGA 4PS3A 4GDKA 4HVBA 1IPGA 4NJCA 1ZUD2 3CSFA 1F2RI 4ZYSA 2IO1B 1OEYJ 1TIFA 3NZUA 2N0SB 4BZAA 2AL3A 2BF8B 2DZMA 2JWUA 3KUCB 4G3XB 4EEWA 1D5MC 1EWYC 1SEBD 2H88B 4KGRA 1WMHB 1WXVA 1Q5WB 3RZWC 3SU8X 4GOCA 3APFA 5BO4B 1N5XA 2MH7A 2EELA 4CO7A 2D10A 2H89B 3A33B 4YTNB 4ZHPA 1UBIA 3ZRFA 4KSLC 3RNCC 2I1JA 2W55A 4WIPA 1ZDXA 3L08A 4JL9A 4HEA1 2GBNA 2AEHA 2K0PA 2JPHA 1E0ZA 1WGYA 1GUAB 1WRDB 3NS8A 4WJNA 2LVQA 3PSEB 4A90A 1ESFA 1ZP0B 2VZKB 2WXIA 5CTRC 3UI3A 4NJ7A 1C3TA 4K3CA 1P7EA 5L95C 4GLSC 1JALA 3H7PA 2KX3A 3V6CB 5G2NA 5D6JB 4W9DA 4AQ7A 4WJQA 2D07B 1OQYA 3VQIA 1JWAD 2PE6B 4AJYB 3ZKJC 1E5WA 1EF5A 4ZRJA 1WXAA 1WIAA 2KTRB 3ZDTA 2K22A 5C1ZA 1TGZB 3Q8FA 1T6BX 3DHIC 5E6JA 1YN4A 2INCC 1PQSA 1QOBA 1S3SG 3QCAA 2JXXA 3SDLC 4GDLB 1YN5A 1KLUD 2LGYA 2MBHA 2MP2B 4ASWC 4OW0A 2WWZA 2CR5A 1ROEA 3PRZA 2JSVX 1IUEA 1SJHD 2LXAA 4A20A 3DWMA 2J53A 2BYTA 4M02A 1NENB 2WXFA 2ACZB 2C9WB 3PRPB 3TEZA 2LHDA 2K8HA 1N60A 4GDLA 3I3TB 1RWSA 2CU3A 1L6VA 4M01A 4IG7B 2IDYA 1FPYA 5MPOA 4MSMB 1NEKB 4HLEA 4ACFA 2W9NA 2WS3B 2RMMA 2L32A 2KN4A 3AEBB 3E9SA 2WDRB 4BKGA 3VH4B 2REXA 5IKCM 1L4DB 3N1XC 4A3PA 1OQRA 3KVFB 4HWIB 4D2KA 4IOIE 3H7PB 3RPFC 3DDCB 3PHWB 1QLBB 2HDEA 2LJIA 5HG2A 4TMAB 1KF6B 1JWMD 3VHTC 1BXTA 1WWTA 1QILA 2L7RA 2VH1A 1E7UA 5AZFA 1WJUA 4DWFA 3MC8A 2MBEA 1ZE3D 1EU4A 3ZXRA 4C7YA 1QQRA 4YL8A 3R3MA 4FJYA 4NZLB 1YQBA 3SFEB 1V1OA 3U4EG 1VCBA 1XLPA 2WXJA 4BBNC 4WJOA 2JRIB 1UUPA 3DVNU 1MI0A 4XE0A 5FK9C 1N62A 4US8A 2W54A 3BK2A 1T0SC 3MTNB 2WHIA 3J9CA 2KT7A 2V3PA 1YNTE 4KV2A 3HIZA 3WAPA 5FR6A 2DZJA 1RLFA 2FCSA 2MJEA 4ZOHC 5H8YE 2NPTB 4B6WA 4C56C 3PRMB 3ZXVA 1FO4A 3PREA 1WMHA 2RDHA 3HRDD 3VAWA 4YXDB 2KXJA 2C7HA 1CZPA 1C4PA 2D11A 1WX8A 2LZ6A 4XX5A 2JQRB 2WDTB 3AN1A 3P4PB 3ZNHB 1GB1A 2LRWA 1GC6A 4IWQA 2JX5A 3AI5A 2K8CA 1GJZA 2E3TA 1J19A 2NCNA 4ICUA 1F1HA 3DBSA 3Q8BA 3AEEB 1EWCA 1KM7A 4KGTA 2ICIA 3BVZA 2JZPA 2LHEA 2C5LC 2G4SA 2WP9B 2AYOB 4GXBA 2N4FA 4K1RB 1WYGA 3ZLZA 1JRPA 3WA0A 1R4NI 3ZGZA 2W3SA 5G5HA 2FE8A 3EC8A 1P7FA 1HZ6A 2KJHB 3IHPC 1F0ZA 3DVGX 2A4ZA 2Z0DB 1X1MA 3P2BA 1B1ZA 5FKAC 2KWUB 3I57A 3Q8AA 3IT6B 1F52A 1TTNA 2JY6A 4BVUC 1VLBA 2CJNA 1XT9B 3P63A 2LGSA 1I4HA 2KQSA 2BS2B 1E7VA 1NVID 1QOFA 3MHZA 3ZNGC 1WE6A 4RMAA 4HCNB 3V05A 3RNBC 3JW0X 3L17A 4IWOA 2MRPA 2IO3B 3NVZA 3IVFA 1D6EC 3LJ3A 3GS2A 3QJZA 2OOBB 3NRZA 1ZKHA 1D5XC 3WAMA 1HQRD 1OEYA 1NYQA 4XYCA 2KJRA 4NQKE 4S17A 4J6IA 1LQBA 1WSPA 3P4SB 4KSKC 2BT6A 1WXSA 1ACCA 1T3QA 1E6EB 2SAKA 4F8CB 2NPTA 1C4AA 2MEKA 3ECIA 3W2DA 2D3AA 1PUTA 3A9JA 4PYZA 5HFYA 3RNFC 1RFKA 2RGFA 4EZJA 2LVOA 2PKOA 5CHWA 1PDXA 2XK5B 4BKSD 4MGIE 3ZIMA 2KK8A 4FBJB 3R2TA 2L0TA 1GNUA 3VH3B 1WF9A 1SE2A 5DPSA 2IGGA 2Y5PA 1ZGUB 2FCQA 2KC2A 1XEEA 2WXRA 4JGHB 5BYQA 4E74A 2KDBA 1GB4A 3R2IA 1LO5D 5LXHA 2KDFB 2M0XA 1E7PB 1SE4A 2KAJA 4USAA 4DHZB 2GBKA 4W9KA 2MLBA 3NJTA 3X23A 2B76B 4KDIC 4QAYA 1XXGA 3SEBA 5BYSA 2LJ5A 2V4LA 1GC7A 4KKJA 2AQ2B 1I35A 2DHZA 4KDLB 4HRSA 5CHFA 4TUUA 2NTTA 3AE8B 2CHWA 1WGGA 2DAJA 3T3NA 5EE0A 5C2TB 1IBXA 2A5UA 4ITKA 1J7CA 1I4PA 1V86A 2BYFA 1LGRA 1KJTA 4YTMB 1FEHA 4LK0M 4DHJB 3H9DA 2OEDA 1UGJA 3BZDB 3LDZE 2QMTA 1MG8A 2LEKA 1TKGA 4A8XC 3AE1B 1AARA 1YIWA 3N9YC 2EMSA 2MP2A 4ZDVA 2KYWA 1AYFA 2DYMA 2K6QA 2N9EB 1V80A 4XDCA 1TZOA 3MP9A 2KX0A 4YSZB 3DVNV 4WQOB 2V0GA 4OZAA 1L0XB 4L23A 2ZJDA 5C3JB 2KHWB 1LFDA 5DPRA 4FHKA 3AB5A 2GI9A 3T9LA 3DHGC 4ARCA 2V3SA 3FAHA 2E6XA 4C4VA 1GOZA 2X8XX 3IAM1 4K81A 3TBLD 3UIPB 2L83A 3BY4B 2FIDA 3M62B 2MCNB 2PIAA 1A5RA 1T0YA 1KRHA 4N59A 4LNFA 4G11A 1XQQA 3KWLA 3IAS1 2JUOA 1TT5B 2V9HA 2J0KA 3H7SA 5JHAA 1UWMA 2JZZA 4JLCA 1FMAD 5HHDG 2JXTA 4P7IA 1TKYA 1V81A 1V9JA 4CYEA 1ZDVA 3QQ8B 1MHXA 3V60A 1E8ZA 1C79A 4M0WA 2O6VA 4GGQA 2BTEA 3QHTA 1ZW7A 3FKYA 3TEXA 3Q14C 3GE3C 2ON8A 2KVRA 3W1YA 5IO9A 3I63C 3NVWA 4RM9A 5T8IA 4EUTA 4XZ4A 2WQYB 1K52A 3ZRCA 3A9KB 4KVGB 1PGAA 4N6EB 4MGZE 3AU5A 3Q8CA 1IBXB 1EU3A 1AWDA 3WAOA 1WM2A 3MJ5A 2KANA 4XDDA 1RYJA 4REZA 1WE7A 4HKQA 1OGWA 1TYGB 3CMMB 2NMQA 4LCDE 4S0RA 1UWXA 4W9JA 4TKNA 3AEGB 2UYZB 3AEAB 2BVCA 2OJRA 1C78A 5EDSA 1T0RC 1WGHA 2MBBB 3N32A 4JPSA 1QF6A 3ML8A 1E8YA 2WX0A 2PVGC 2Y3AA 1CMXB 3PGEA 1BUIC 2ZNVC 4DDID 4BAXA 3ZJTA 1J8CA 2QCZA 2CJOA 1E90A 2N1VA 3ZTCA 3EECA 1NI2A 3HVZA 3GZNI 3LYYA 1NBFC 2K8BA 2GB1A 1WZ0A 2K1FA 3NY5A 1JCKB 2DZKA 1Z5SB 1H8CA 3QARA 2PE9A 4WWOA 4K3BA 3UIOB 1YN3A 2G4DB 4RGTA 2HJ8A 1HE8A 4IDIA 3A1QB 3N20C 2CHZA 2AQ1B 4ICVA 4NJ6A 1QKZA 4OVUA 4B9KA 3VVWB 4IM0A 4EKUA 2WXLA 2KDEB 4DXAB 2B3AA 4R3DA 2NS5A 5BMIA 2J0JA 1FCCC 1XF5L 4PS7A 2GOWA 1CK1A 2Y5BB 1N63A 1SGHA 1KLVA 4DHJD 3I5JC 4MM3B 3AE7B 3DHHC 2KLCA 3AE4B 3DVGY 4EE2A 5DPWA 3PO0A 1C77A 1C76A 3K9OB 4YWGG 3WIMA 3AEFB 1VJKA 1JROA 2BYVE 3PV1A 3MJWA 5AEKB 3Q3JA 3EFCA 1V1PA 3H6NA 4NAMA 1MFWA 4ZRIA 4K7SA 2L00B 3EGRA 3EFUA 4NAWA 1I42A 3O65B 4YT0B 1TS4A 4TQ1A 1WR6E 5JH5C 1FNUA 1ZOYB 4LJOB 3C19A 4W9FA 1YJIA 1WJNA 3KLSX 2N9LA 3ZJUA 2KFJA 1RM6C 4LDTB 4LLGM 3NUHB 2J7QB 3NZ3A 3RULA 3BVGA 4O1NA 2D2QA 3B2GA 2ZNVB 2JYTA 1L4ZB 4OZCA 5J2RA 3NVYA 2BW2A 3W5UB 2VH2A 1Q10A 1QOAA 4IW0A 4C00A 1UZXB 5IN7A 3ABVB 3O13A 2LGIA 2WXNA 1ENFA 3JSVB 4MM3A 2L8JA 4G0NB 3PPAA 3V3XA 4RF1A 2AX5A 3VUYA 2LGXA 3URYA 2KKCA 4GDKB 2BB5A 3BYTB 2Z59B 2RPVA 2KACA 2K3UA 1P98A 5TSSA 5CX3A 1OTRB 2XEWA 3SD5A 2YVCA 1P0RA 2WGSA 5BMHA 4MJSA 1ZXHA 4ANVA 1VR9A 4F7ZA 1WRIA 4KKIA 3PT2B 1XLOA 2I2YA 1EM7A 1FXTB 2HTHA 1DOYA 3L4PA 3JVZX 3RT3B 3UF8A 4FULA 5GMVA 2MA9B 2FUHB 4ZYNA 2LGDA 2KDMA 1PGBA 4EZKA 3DBRB 3WANA 3IFWB 2BKFA 1H4RA 2SEBD 1Z2MA 3VR9B 1LM8B 1JWBD 3B9JA 3CF6E 1JRUA 5L83A 4OHJA 1OQQA 1E10A 4A55A 3S2AA 3ZQ4A 1WXQA 1J7BA 2I1KA 3PHXB 2QJLA 1XLQA 1UBQA 1JWSD 4DXFA 2CKHB 4YTPB 2WXMA 3RFZB 2WNMA 2LUEA 2WXKA 4P16A 1WY8A 3CSTA 4NY0A 1TJEA 2KN5A 2Q5WD 4Q2JA 2WXHA 3HM3A 4W9IA 4L2YA 4RGOS 3W1SC 3A9KA 4JX1C 3ALBA 1I4XA 5DPTA 5IOIA 3RNEC 1B9RA 4FXCA 2AL6A 1ZPSA 4K7WA 2BQQA 3PLUA 2QDFA 1FXIA 2MWSB 1FRDA 2PLPA 2GBJA 4MT5A 4KIKB 3V6EB 2RR9A 3W1SA 2MBOA 3QAQA 2MW5A 1E8WA 5I4DA 1T5XD 1KFYB 3AV8A 2VRRB 2WLBA 1I4QA 3HUIA 4LTUA 2WYQA 4B0EA 4IM2A 3PTFC 2PEAA 2WDQB 2V3NA 3UINB 4A3OA 3ZNID 2EKEC 5G5GA 4I6NB 4ARIA 4JIOU 4G50A 3Q3FA 1EUVB 4FN2A 1V6EA 1J7AA 3VFKA 3M95A 2M56B 3SFDB 1WX9A 2L52A 5LNK1 4FADA 3RMKC 3BYYB 1C4CA 3UQBA 2JZ3B 1WXMA 3AXCA 5C23A 2JYEA 4US9A 3W5VB 1FRRA 1YD8U 4DDGD 3Q2AC 1KLGD 3B2FA 2R2OA 3Q3OC 2INPE 2KTFA 4JWSC 4P6VF 1NDDA 2ASQA 5D94A 2WXQA 3DBLI 1TZ1A 2WXOA 2GBMA 1C9FA 4M00A 1TY2A 3U7DA 2PW9A 1FXAA 5G55A 2N7DA 2HD5B 3H8HA 4W9EA 5LLIA 4KIKA 2M19A 3AULA 3JYUA 3KQ4A 5D3IB 3ONSA 3KUDB 3R7QA 1L0YB 1UGMA 2DYBA 4MDKE 2L1AA 4WWMA 2G9HD 1WI0A 2WDVB 4HPLB 5TR5A 3N1YC 4LDTD 5HKHA 3V62A 3TEWA 4EZLA 1TS3A 3QWZB 3B08A 3OJ3A 2PJHA 3AE2B 4GIVA 1VRAB 2IBIB 4JWUC 1DOIA 1MJDA 1TS2A 1L0VB 4CQNA 4WURA 2KFKB 3N30A 4ZRKA 3E56A 1IGDA 3FC4A 3EUB2 4X57B 3AMZA 2K6DB 2BKRB 2HE7A 1HTOA 1U4AA 2KWVB 1K50A 2UU7A 3R7RA 3K9PB 3NG0A 2XN9C 4IM3A 1I4RA 3NHEB 2JVCA 2MHJA 3RUIB 2L05A 2J4XA 2BWES 1SF0A 3KW5B 5D3DA 1JMLA 1WZ3A 2KQ7A 1PFDA 2QEJC 5EE9A 2NVUI 2C7NB 3BWUD 3RCZA 1WX7A 1GAQB 5JHBA 1UNSA 2DYOA 1SIFA 2AQ3B 2ONQA 4URKA 3NZSA 5KHQA 3EHVA 3ZTDA 3TEYA 3IG3A 3QX1A 3APDA 2JWZA 2DWQA 1WR1A 2PMVA 3M3JA 2KQ4X 2L3ZA 1HA5A 4MACA 3KYDD 2OHFA 3GZNB 2KO3A 2RSUA 4EOYA 2JRHA 2ZPNA 4GSWA 4AJWA 1WGDA 3L13A 4PT5A 4PYUA 5J18A 3HK0A 1MHHE 4DQOC 3HVDA 2JT4B 3QA8A 4RGNA 3DWGC 3A4RA 5AUKA 3RYTA 2ZCCA 3UGBB 1K51A 2KTRA 2XBBC 4GU2A 4RFBA 1FFUA 3DOWA 1KTKA 1V2YA 2QSDA 1SBBB 4II2B 3L10B 1J0GA 2D5GA 4NQLB 3MC9A 1L6UA 3EA6A 3TL5A 4LJPB 2KC1A 4DXGA 1SIJA 4FJZA 4II3B 3AECB 1P9DU 3BINA 5E6NA 2BBCA 2W3RA 4BKTA 4FJVB 2UWQA 5E6OA 2BYEA 2YLMA 3SR6A 2KVZA 5IA7A 3KH0A 1WYWB 1WM3A 3C0RB 1M4VA 1N5WA 3DBHI 5DCNA 3V61A 2FBWB 2ZZPB 3A9JB 1BT0A 1EF1A 3ZNZB 2KWDA 2KFKA 3QK0A 4WAFA 4E71A 2IYDB 2BPSA 4ZRPA 2KLGA 3TUOA 3Q8EA 1IYFA 2CU1A 2IO0B 4DHZE 2V4IB 1D5ZC 2VZKD 3IT4B 4RH6A 2W82A 2ZW0A 2J0MA 2GRIA 1IGCA 1SB3C 4B95A 2IY1B 4ANXA 1IP9A 2PPHA 3M63B 3UQAA 2EMTA 4BOZB 2PTLA 4BFRA 3MHSD 5KHOA 2LI5A 3NVVA 3QC8B 3R66C 1K53A 1F9JA 3AE6B 3VRBB 3KWVA 4W9HA 1YOVB 1QOGA 2LFIA 4OVZA 3RNAC 4CHKA 3LB8C 2DNFA 4HXDA 3U30A 2L0FA 4C7ZA 2FAZA 2QIEB 1SSNA 3DBHB 2R2QA 4HROA 4IUMB 3RZFA 4YSYB 3BK1A 1VZ8A 4BKSA 1SE3A 1VDVA 2DENB 2MBQA 1XO3A 4XGAB 1FD6A 2MQJA 2Y5CA 3ZVVA 3N3KB 3IBEA 2KJ6A 2MX2A 1FNVA 5D2MB 2D3GA 5BYRA 2YEPB 5CHVC 2DZIA 2CS4A 4FHJA 4IKGA 3DBLB 1HTQA 2M17A 2RD0A 2IY0B 2KOXA 1V8CA 4KGSA 4NNJB 2QHOA 3T3OA 2M8SA 4TQ0A 3I9V1 3ZO5B 2IGHA 4L1BA 3Q6BA 3P4RB 5EE1A 1STEA 3R8BA 2DAFA 1UELA 2DLBA 2G3QB 3TCAA 3Q69A 1S1QB 1UH6A 4OVVA 4K7UA 4H2AA 3ZUNA 3SHQA 4NPNA 2FIFA 2EKIA 5GXGB 1VZ7A 2K5PA 4LNKA 4A6QA 3VR8B 3D32A 4JE3B 4RGMA 4AP4C 2FCNA 2ZW1A 3W9CB 3X0WA 4LNIA 1XCTL 4KX6B 3H1UA 4ZRQA 2LVPA 3HM6X 4W9CA 1T0QC 2INDC 5FR3A 1R4NB 3L0WB 2IGDA 4HK2A 1CQVA 1KOTA 2KNBA 4AUQC 2K39A 1ISNA 2WX1A 2LMCA 2ZVNA 3PZ7A 3AE9B 4WAAA 5AZHA 2BB6A 2MJ3A 3RNGC 5H92C 2IPKD 4PK1A 2M0AA 4WH4A 4WWPA 1VZ6A 1YX6B 3GE8C 2LD9A 2J42A 3P4QB 1PGXA 1JQ4A 1AN8A 1Q1OA 3AE3B 3VTWA 3GOEA 2I38A 2ZEQA 4ANUA 5IP4D 3IXSA 3TMPB 1V5OA 1YX5B 3NS1A 4A9AA 2LRUA 4IC7B 3KYCD 1XLNA 4RF0A 1V97A 4MJSB 5E6PA 4HJKA 4BBNF 2INNE 2IZVB 2KMAA 4P1BC 1SXTA 1G6JA 4MH0E 2QC8A 4NAWB 2R61A 3AH7A 3APCA 4MEMA 4RCOA 3ML9A 1L2NA 1WH3A 2NR2A 5BMGA 4LNNA 4TV3A 1RFAA 2WU2B 3PS6A 5LXIB 1TS5A 2MJDA 2O2VA 1ZXIA 1L7YA 4MSQB 3AU4A
chains in the Genus database with same CATH topology
2HD5B 4W9EA 5LLIA 2CR5A 3PRZA 4KIKA 3AULA 2LXAA 4A20A 2CHXA 3JYUA 2KVRA 3A1QA 2Z0EB 3W1YA 4WWNA 3ONSA 3KUDB 2C9WB 3R7QA 3PRPB 4DK5A 1UGMA 2DYBA 4MDKE 1WI0A 2K8HA 4RM9A 4EUTA 4GDLA 3I3TB 4XZ4A 4HPLB 5TR5A 4W9LA 3ZRCA 4MGYE 4IG7B 1EO6A 4MSMB 4LDTD 4HLEA 3A9KB 2IO2B 4KVGB 2W9NA 5HKHA 2LASA 3V62A 4EZLA 3QIJA 3QWZB 4MGZE 3RD2A 4RM8A 3AU5A 3B08A 3OJ3A 4GN1A 2PJHA 4BKGA 3VH4B 2REXA 1D3ZA 4BOSC 3WAOA 1WM2A 4GIVA 2IBIB 4GMVA 4A3PA 2KANA 3KVFB 3OJ4B 4HWIB 2GMIC 1WE7A 4W9GA 1WJ4A 1OGWA 3CMMB 1RRBA 3H7PB 4LCDE 4W9JA 2NBVB 4TKNA 3DDCB 3PHWB 2UYZB 2KFKB 2OJRA 3N30A 4ZRKA 4AOFA 5EDSA 3VHTC 4X57B 1WGHA 2MBBB 3N32A 1VD2A 2BKRB 2K6DB 3ML8A 1YJ1A 2L7RA 1E8YA 1E7UA 4HDOA 2WX0A 5AZFA 2L76A 1WJUA 4JQWC 4DWFA 2HE7A 1GG3A 3PLVA 1U4AA 4M8NA 2MBEA 1CMXB 2KWVB 3PGEA 3R7RA 3K9PB 2ZNVC 4DDID 2KMCA 4IM3A 1J8CA 1E90A 4DBGA 2N1VA 4YL8A 3NHEB 2JVCA 3HHMA 3EECA 3RUIB 3ZTCA 2L05A 1Y8RC 3R3MA 2V1YA 2BWES 4FJYA 3KW5B 1YQBA 1WZ3A 1XD3B 2KQ7A 3B1LX 1NI2A 3A4SC 3TJPA 1VCBA 3GZNI 4BBNC 2NVUI 1NBFC 2K8BA 4WJOA 2JRIB 3VTVA 1WZ0A 2C7NB 2K1FA 3NY5A 3DVNU 3RCZA 1WX7A 2DZKA 1Z5SB 1H8CA 3QARA 5JHBA 2PE9A 2C7MB 4WWOA 2DYOA 1SIFA 3UIOB 3MTNB 2ZVOA 4URKA 3NZSA 4KV2A 2G4DB 3HIZA 3WAPA 5KHQA 3EHVA 5FR6A 4MGKE 2DZJA 3ZTDA 2HJ8A 1HE8A 3IG3A 3A1QB 3QX1A 1RLFA 2CHZA 2FCSA 2JWZA 3APDA 2ZPYA 4ICVA 4HDQA 4NJ6A 4OVUA 2FCMA 1WR1A 2NPTB 3JSVA 4B9KA 3VVWB 4B6WA 3M3JA 3NOBA 3PRMB 4IM0A 3DBRI 4M8MA 4EKUA 4DXAB 2KDEB 4EFOA 3PREA 1WMHA 1SE9A 2B3AA 2L3ZA 3VAWA 2KXJA 3KYDD 4N9F4 2KO3A 2RSUA 1V5TA 2C7HA 2JRHA 2NS5A 2ZPNA 4GSWA 4M0WB 3ZDMC 4EOYA 2J0JA 2M4NA 4AJWA 1WGDA 3L13A 4PYUA 4PS7A 2D11A 2GOWA 3HK0A 1WX8A 5J18A 2Y5BB 2LZ6A 1SGHA 4XX5A 1KLVA 1QZEA 2WDTB 2JT4B 3ZNHB 4DHJD 1C1YB 2LRWA 1GC6A 3QA8A 4IWQA 3VTUA 2LWPA 2KLCA 3A4RA 3DVGY 5DPWA 3AI5A 2K8CA 3RYTA 1GJZA 2ZCCA 3UGBB 1G6JA 1J19A 2NCNA 3K9OB 2KTRA 2XBBC 4ICUA 1RAXA 4GU2A 3WIMA 3DBSA 2LXCA 2AWTA 3DOWA 2BYVE 1KM7A 1V2YA 3PV1A 3MJWA 5AEKB 3Q3JA 2C5LC 4MELA 4II2B 2G4SA 3H6NA 4KZ0A 4ZRIA 3L10B 1J0GA 2AYOB 4K7SA 4GXBA 2L00B 4NQLB 1LXDA 2N4FA 4K1RB 3EFUA 4NAWA 3ZLZA 1I42A 3O65B 3TL5A 4LJPB 3ZW3A 2KC1A 4TQ1A 3WA0A 3VUWA 2N1WA 1R4NI 1V49A 2NBWB 4FJZA 1WR6E 4II3B 5JH5C 2DX5B 1P9DU 3BINA 3EC8A 4LJOB 5E6NA 2KDIA 4FLHA 1P1AA 4W9FA 4BKTA 1WJNA 4FA6A 4FJVB 2KJHB 3IHPC 3VUXA 1P3QU 2UWQA 3DVGX 2XK5A 2A4ZA 2Z0DB 5E6OA 3TIXA 2BYEA 2YLMA 2KFJA 1K8RB 4WJPA 1X1MA 3P2BA 4LDTB 3VXWA 5IA7A 2M1MA 3KH0A 1WYWB 1WM3A 2KWUB 3C0RB 1M94A 2J7QB 3DBHI 5DCNA 3RULA 1TTNA 2JY6A 3V61A 4BVUC 2O6VD 2ZZPB 1BT0A 1XT9B 3A9JB 1EF1A 2D2QA 3OAWA 3ZNZB 2KFKA 2K25A 3QK0A 2KQSA 2ZNVB 4ANWA 1E7VA 4E71A 5J2RA 2IYDB 2NBUA 3B0AA 2BPSA 3ZNGC 1WE6A 2KLGA 4RMAA 4HCNB 3DPDA 1IYFA 2CU1A 2IO0B 4DHZE 3JW0X 3L17A 4IWOA 2G45B 2MRPA 4IW0A 2IO3B 2J0MA 3PVLA 1UZXB 3IVFA 3LJ3A 3QJZA 2C60A 2OOBB 1TBEA 1ZKHA 4B95A 3L16A 3WAMA 2IY1B 4ANXA 1IP9A 1OEYA 2PPHA 3JSVB 3DCGA 4MM3A 3M63B 4I6PA 3UQAA 2KJRA 2EMTA 2L8JA 4BOZB 4BFRA 4G0NB 4NQKE 3PPAA 3MHSD 5KHOA 2LI5A 3QC8B 3R66C 4J6IA 3T8MA 3L54A 1LQBA 5J17A 1F9JA 2O2VB 3VUYA 2LGXA 2O6VB 4KSKC 1WXSA 4W9HA 2KKCA 4GDKB 4CHKA 4F8CB 4HXDA 2NPTA 4I6LB 3U30A 2L0FA 1WGRA 4KZCA 2Z59B 2FAZA 5IAAC 4IWPA 1WJ6A 2R2QA 3ECIA 4IUMB 2N9PC 4F1SA 1P98A 3RZFA 4AWJA 2FNJB 5CX3A 1OTRB 2XEWA 4BKSA 3A9JA 3SD5A 4PYZA 2YVCA 2DENB 1P0RA 2MBQA 2RPQA 2BWFA 2ZCBA 4MJSA 2MQJA 4ANVA 2RGFA 4EZJA 2LVOA 4F7ZA 3ZVVA 3N3KB 3OLMD 5CHWA 3IBEA 2XK5B 3PT2B 2KJ6A 1FXTB 2KZRA 2HTHA 2MX2A 5D2MB 3JVZX 2N7EA 1UD7A 3RT3B 3UF8A 4BKSD 4MGIE 4FULA 2JF5A 2D3GA 5GMVA 3ZIMA 2MSED 2KK8A 2MA9B 2FUHB 4FBJB 4ZYNA 2L0TA 5CHVC 2N9XA 1GNUA 2LGDA 2DZIA 4E3CA 3VH3B 2CS4A 4FHJA 1WF9A 2M17A 2RD0A 4EZKA 2IY0B 2KOXA 2KD0A 5AZGA 2GBRA 3U8ZA 3WANA 5DPSA 3WALA 3IFWB 4NNJB 1ZGUB 2BGFA 2QHOA 2FCQA 1R4MI 2KC2A 2BKFA 2M8SA 3DQVA 3KUZA 4JGHB 1H4RA 5JZEB 1Z2MA 4HPMB 4E74A 2KDBA 1LM8B 3VDZA 4TQ0A 5LXHA 2KDFB 3PZDA 3ZO5B 3CF6E 2M0XA 1Q0WB 4DHZB 2GBKA 1WFYA 4W9KA 2MLBA 1JRUA 4GB9A 5L83A 3ENEA 3X23A 4PS8A 4HCPB 5D7GA 4XC2A 3S2AA 4KDIC 2KWCA 1E8XA 2I1KA 3PHXB 2DAFA 2LJ5A 1UBQA 2V4LA 1UELA 1GC7A 2CKHB 2G3QB 3TCAA 1I35A 4PS3A 4GDKA 4HVBA 2DHZA 1S1QB 4KDLB 5CHFA 4TUUA 1UH6A 2LUEA 1IPGA 2CHWA 4OVVA 1WGGA 2DAJA 1WY8A 3CSTA 4K7UA 3ZUNA 3CSFA 4NY0A 3SHQA 2KN5A 2A5UA 4NPNA 2IO1B 3HM3A 1OEYJ 4W9IA 3NZUA 2FIFA 3W1SC 3A9KA 4EEWA 2AL3A 2BF8B 2DZMA 3ALBA 1V86A 3KUCB 4G3XB 5DPTA 2BYFA 3D32A 4AP4C 1KJTA 2FCNA 2AL6A 4K7WA 3X0WA 3H1UA 4DHJB 1WMHB 1WXVA 3H9DA 2LVPA 3HM6X 4W9CA 1Q5WB 3PLUA 3RZWC 3SU8X 4GOCA 3APFA 3L0WB 3LDZE 5BO4B 4HK2A 1MG8A 2MWSB 2GBJA 1KOTA 4KIKB 2D10A 4CO7A 3A33B 1AARA 3V6EB 1YIWA 1UBIA 3ZRFA 2RR9A 3W1SA 2KNBA 2MBOA 2EMSA 2I1JA 1ISNA 2K39A 2WX1A 3QAQA 4KSLC 2MP2A 1E8WA 2MW5A 4ZDVA 2ZVNA 2DYMA 5AZHA 4WAAA 2VRRB 2K6QA 3L08A 4JL9A 2N9EB 1V80A 4AUQC 2WYQA 2GBNA 2AEHA 4IM2A 2JPHA 3PTFC 2KX0A 2PEAA 4A3OA 1WGYA 1GUAB 3UINB 3ZNID 3DVNV 2EKEC 4WQOB 2ZJDA 4WWPA 1YX6B 1WRDB 2KHWB 3NS8A 1LFDA 4WJNA 4I6NB 4FHKA 5DPRA 2LVQA 3PSEB 4JIOU 3T9LA 2LD9A 4G50A 1Q1OA 5CTRC 3VTWA 3Q3FA 1EUVB 3GOEA 4FN2A 1V6EA 2ZEQA 4NJ7A 1C3TA 3VFKA 4ANUA 3M95A 3TMPB 1V5OA 2V3SA 1WX9A 5L95C 4FADA 1YX5B 4K81A 3TBLD 3UIPB 3BY4B 3UQBA 2JZ3B 2FIDA 3H7PA 1WXMA 2KX3A 3M62B 2MCNB 3V6CB 5G2NA 2LRUA 1A5RA 1T0YA 5D6JB 3AXCA 4IC7B 3KYCD 4W9DA 5C23A 4MJSB 4G11A 1XQQA 4HJKA 4WJQA 5E6PA 4BBNF 2D07B 1OQYA 2JUOA 3VQIA 1YD8U 2IZVB 2KMAA 2PE6B 4DDGD 4AJYB 3ZKJC 1E5WA 1EF5A 4ZRJA 1WXAA 2R2OA 4MH0E 1WIAA 2J0KA 2KTRB 3H7SA 4NAWB 3ZDTA 2JZZA 4JLCA 5JHAA 2KTFA 1NDDA 5C1ZA 1TGZB 4P7IA 3APCA 4MEMA 2ASQA 1V81A 3ML9A 1L2NA 1WH3A 1V9JA 4CYEA 3QQ8B 2NR2A 5D94A 1PQSA 3DBLI 1S3SG 3QCAA 1TZ1A 3V60A 1E8ZA 2GBMA 4TV3A 3U7DA 2JXXA 3SDLC 1RFAA 4GDLB 2O6VA 4GGQA 5G55A 3PS6A 2LGYA 2MBHA 5LXIB 2N7DA 2O2VA 3QHTA 1L7YA 1ZW7A 2MP2B 4MSQB 4ASWC 2WWZA 3AU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HD5 B;  4W9E A;  5LLI A;  2CR5 A;  3PRZ A;  4KIK A;  3AUL A;  2LXA A;  4A20 A;  2CHX A;  3JYU A;  2KVR A;  3A1Q A;  2Z0E B;  3W1Y A;  4WWN A;  3ONS A;  3KUD B;  2C9W B;  3R7Q A;  3PRP B;  4DK5 A;  1UGM A;  2DYB A;  4MDK E;  1WI0 A;  2K8H A;  4RM9 A;  4EUT A;  4GDL A;  3I3T B;  4XZ4 A;  4HPL B;  5TR5 A;  4W9L A;  3ZRC A;  4MGY E;  4IG7 B;  1EO6 A;  4MSM B;  4LDT D;  4HLE A;  3A9K B;  2IO2 B;  4KVG B;  2W9N A;  5HKH A;  2LAS A;  3V62 A;  4EZL A;  3QIJ A;  3QWZ B;  4MGZ E;  3RD2 A;  4RM8 A;  3AU5 A;  3B08 A;  3OJ3 A;  4GN1 A;  2PJH A;  4BKG A;  3VH4 B;  2REX A;  1D3Z A;  4BOS C;  3WAO A;  1WM2 A;  4GIV A;  2IBI B;  4GMV A;  4A3P A;  2KAN A;  3KVF B;  3OJ4 B;  4HWI B;  2GMI C;  1WE7 A;  4W9G A;  1WJ4 A;  1OGW A;  3CMM B;  1RRB A;  3H7P B;  4LCD E;  4W9J A;  2NBV B;  4TKN A;  3DDC B;  3PHW B;  2UYZ B;  2KFK B;  2OJR A;  3N30 A;  4ZRK A;  4AOF A;  5EDS A;  3VHT C;  4X57 B;  1WGH A;  2MBB B;  3N32 A;  1VD2 A;  2BKR B;  2K6D B;  3ML8 A;  1YJ1 A;  2L7R A;  1E8Y A;  1E7U A;  4HDO A;  2WX0 A;  5AZF A;  2L76 A;  1WJU A;  4JQW C;  4DWF A;  2HE7 A;  1GG3 A;  3PLV A;  1U4A A;  4M8N A;  2MBE A;  1CMX B;  2KWV B;  3PGE A;  3R7R A;  3K9P B;  2ZNV C;  4DDI D;  2KMC A;  4IM3 A;  1J8C A;  1E90 A;  4DBG A;  2N1V A;  4YL8 A;  3NHE B;  2JVC A;  3HHM A;  3EEC A;  3RUI B;  3ZTC A;  2L05 A;  1Y8R C;  3R3M A;  2V1Y A;  2BWE S;  4FJY A;  3KW5 B;  1YQB A;  1WZ3 A;  1XD3 B;  2KQ7 A;  3B1L X;  1NI2 A;  3A4S C;  3TJP A;  1VCB A;  3GZN I;  4BBN C;  2NVU I;  1NBF C;  2K8B A;  4WJO A;  2JRI B;  3VTV A;  1WZ0 A;  2C7N B;  2K1F A;  3NY5 A;  3DVN U;  3RCZ A;  1WX7 A;  2DZK A;  1Z5S B;  1H8C A;  3QAR A;  5JHB A;  2PE9 A;  2C7M B;  4WWO A;  2DYO A;  1SIF A;  3UIO B;  3MTN B;  2ZVO A;  4URK A;  3NZS A;  4KV2 A;  2G4D B;  3HIZ A;  3WAP A;  5KHQ A;  3EHV A;  5FR6 A;  4MGK E;  2DZJ A;  3ZTD A;  2HJ8 A;  1HE8 A;  3IG3 A;  3A1Q B;  3QX1 A;  1RLF A;  2CHZ A;  2FCS A;  2JWZ A;  3APD A;  2ZPY A;  4ICV A;  4HDQ A;  4NJ6 A;  4OVU A;  2FCM A;  1WR1 A;  2NPT B;  3JSV A;  4B9K A;  3VVW B;  4B6W A;  3M3J A;  3NOB A;  3PRM B;  4IM0 A;  3DBR I;  4M8M A;  4EKU A;  4DXA B;  2KDE B;  4EFO A;  3PRE A;  1WMH A;  1SE9 A;  2B3A A;  2L3Z A;  3VAW A;  2KXJ A;  3KYD D;  4N9F 4;  2KO3 A;  2RSU A;  1V5T A;  2C7H A;  2JRH A;  2NS5 A;  2ZPN A;  4GSW A;  4M0W B;  3ZDM C;  4EOY A;  2J0J A;  2M4N A;  4AJW A;  1WGD A;  3L13 A;  4PYU A;  4PS7 A;  2D11 A;  2GOW A;  3HK0 A;  1WX8 A;  5J18 A;  2Y5B B;  2LZ6 A;  1SGH A;  4XX5 A;  1KLV A;  1QZE A;  2WDT B;  2JT4 B;  3ZNH B;  4DHJ D;  1C1Y B;  2LRW A;  1GC6 A;  3QA8 A;  4IWQ A;  3VTU A;  2LWP A;  2KLC A;  3A4R A;  3DVG Y;  5DPW A;  3AI5 A;  2K8C A;  3RYT A;  1GJZ A;  2ZCC A;  3UGB B;  1G6J A;  1J19 A;  2NCN A;  3K9O B;  2KTR A;  2XBB C;  4ICU A;  1RAX A;  4GU2 A;  3WIM A;  3DBS A;  2LXC A;  2AWT A;  3DOW A;  2BYV E;  1KM7 A;  1V2Y A;  3PV1 A;  3MJW A;  5AEK B;  3Q3J A;  2C5L C;  4MEL A;  4II2 B;  2G4S A;  3H6N A;  4KZ0 A;  4ZRI A;  3L10 B;  1J0G A;  2AYO B;  4K7S A;  4GXB A;  2L00 B;  4NQL B;  1LXD A;  2N4F A;  4K1R B;  3EFU A;  4NAW A;  3ZLZ A;  1I42 A;  3O65 B;  3TL5 A;  4LJP B;  3ZW3 A;  2KC1 A;  4TQ1 A;  3WA0 A;  3VUW A;  2N1W A;  1R4N I;  1V49 A;  2NBW B;  4FJZ A;  1WR6 E;  4II3 B;  5JH5 C;  2DX5 B;  1P9D U;  3BIN A;  3EC8 A;  4LJO B;  5E6N A;  2KDI A;  4FLH A;  1P1A A;  4W9F A;  4BKT A;  1WJN A;  4FA6 A;  4FJV B;  2KJH B;  3IHP C;  3VUX A;  1P3Q U;  2UWQ A;  3DVG X;  2XK5 A;  2A4Z A;  2Z0D B;  5E6O A;  3TIX A;  2BYE A;  2YLM A;  2KFJ A;  1K8R B;  4WJP A;  1X1M A;  3P2B A;  4LDT B;  3VXW A;  5IA7 A;  2M1M A;  3KH0 A;  1WYW B;  1WM3 A;  2KWU B;  3C0R B;  1M94 A;  2J7Q B;  3DBH I;  5DCN A;  3RUL A;  1TTN A;  2JY6 A;  3V61 A;  4BVU C;  2O6V D;  2ZZP B;  1BT0 A;  1XT9 B;  3A9J B;  1EF1 A;  2D2Q A;  3OAW A;  3ZNZ B;  2KFK A;  2K25 A;  3QK0 A;  2KQS A;  2ZNV B;  4ANW A;  1E7V A;  4E71 A;  5J2R A;  2IYD B;  2NBU A;  3B0A A;  2BPS A;  3ZNG C;  1WE6 A;  2KLG A;  4RMA A;  4HCN B;  3DPD A;  1IYF A;  2CU1 A;  2IO0 B;  4DHZ E;  3JW0 X;  3L17 A;  4IWO A;  2G45 B;  2MRP A;  4IW0 A;  2IO3 B;  2J0M A;  3PVL A;  1UZX B;  3IVF A;  3LJ3 A;  3QJZ A;  2C60 A;  2OOB B;  1TBE A;  1ZKH A;  4B95 A;  3L16 A;  3WAM A;  2IY1 B;  4ANX A;  1IP9 A;  1OEY A;  2PPH A;  3JSV B;  3DCG A;  4MM3 A;  3M63 B;  4I6P A;  3UQA A;  2KJR A;  2EMT A;  2L8J A;  4BOZ B;  4BFR A;  4G0N B;  4NQK E;  3PPA A;  3MHS D;  5KHO A;  2LI5 A;  3QC8 B;  3R66 C;  4J6I A;  3T8M A;  3L54 A;  1LQB A;  5J17 A;  1F9J A;  2O2V B;  3VUY A;  2LGX A;  2O6V B;  4KSK C;  1WXS A;  4W9H A;  2KKC A;  4GDK B;  4CHK A;  4F8C B;  4HXD A;  2NPT A;  4I6L B;  3U30 A;  2L0F A;  1WGR A;  4KZC A;  2Z59 B;  2FAZ A;  5IAA C;  4IWP A;  1WJ6 A;  2R2Q A;  3ECI A;  4IUM B;  2N9P C;  4F1S A;  1P98 A;  3RZF A;  4AWJ A;  2FNJ B;  5CX3 A;  1OTR B;  2XEW A;  4BKS A;  3A9J A;  3SD5 A;  4PYZ A;  2YVC A;  2DEN B;  1P0R A;  2MBQ A;  2RPQ A;  2BWF A;  2ZCB A;  4MJS A;  2MQJ A;  4ANV A;  2RGF A;  4EZJ A;  2LVO A;  4F7Z A;  3ZVV A;  3N3K B;  3OLM D;  5CHW A;  3IBE A;  2XK5 B;  3PT2 B;  2KJ6 A;  1FXT B;  2KZR A;  2HTH A;  2MX2 A;  5D2M B;  3JVZ X;  2N7E A;  1UD7 A;  3RT3 B;  3UF8 A;  4BKS D;  4MGI E;  4FUL A;  2JF5 A;  2D3G A;  5GMV A;  3ZIM A;  2MSE D;  2KK8 A;  2MA9 B;  2FUH B;  4FBJ B;  4ZYN A;  2L0T A;  5CHV C;  2N9X A;  1GNU A;  2LGD A;  2DZI A;  4E3C A;  3VH3 B;  2CS4 A;  4FHJ A;  1WF9 A;  2M17 A;  2RD0 A;  4EZK A;  2IY0 B;  2KOX A;  2KD0 A;  5AZG A;  2GBR A;  3U8Z A;  3WAN A;  5DPS A;  3WAL A;  3IFW B;  4NNJ B;  1ZGU B;  2BGF A;  2QHO A;  2FCQ A;  1R4M I;  2KC2 A;  2BKF A;  2M8S A;  3DQV A;  3KUZ A;  4JGH B;  1H4R A;  5JZE B;  1Z2M A;  4HPM B;  4E74 A;  2KDB A;  1LM8 B;  3VDZ A;  4TQ0 A;  5LXH A;  2KDF B;  3PZD A;  3ZO5 B;  3CF6 E;  2M0X A;  1Q0W B;  4DHZ B;  2GBK A;  1WFY A;  4W9K A;  2MLB A;  1JRU A;  4GB9 A;  5L83 A;  3ENE A;  3X23 A;  4PS8 A;  4HCP B;  5D7G A;  4XC2 A;  3S2A A;  4KDI C;  2KWC A;  1E8X A;  2I1K A;  3PHX B;  2DAF A;  2LJ5 A;  1UBQ A;  2V4L A;  1UEL A;  1GC7 A;  2CKH B;  2G3Q B;  3TCA A;  1I35 A;  4PS3 A;  4GDK A;  4HVB A;  2DHZ A;  1S1Q B;  4KDL B;  5CHF A;  4TUU A;  1UH6 A;  2LUE A;  1IPG A;  2CHW A;  4OVV A;  1WGG A;  2DAJ A;  1WY8 A;  3CST A;  4K7U A;  3ZUN A;  3CSF A;  4NY0 A;  3SHQ A;  2KN5 A;  2A5U A;  4NPN A;  2IO1 B;  3HM3 A;  1OEY J;  4W9I A;  3NZU A;  2FIF A;  3W1S C;  3A9K A;  4EEW A;  2AL3 A;  2BF8 B;  2DZM A;  3ALB A;  1V86 A;  3KUC B;  4G3X B;  5DPT A;  2BYF A;  3D32 A;  4AP4 C;  1KJT A;  2FCN A;  2AL6 A;  4K7W A;  3X0W A;  3H1U A;  4DHJ B;  1WMH B;  1WXV A;  3H9D A;  2LVP A;  3HM6 X;  4W9C A;  1Q5W B;  3PLU A;  3RZW C;  3SU8 X;  4GOC A;  3APF A;  3L0W B;  3LDZ E;  5BO4 B;  4HK2 A;  1MG8 A;  2MWS B;  2GBJ A;  1KOT A;  4KIK B;  2D10 A;  4CO7 A;  3A33 B;  1AAR A;  3V6E B;  1YIW A;  1UBI A;  3ZRF A;  2RR9 A;  3W1S A;  2KNB A;  2MBO A;  2EMS A;  2I1J A;  1ISN A;  2K39 A;  2WX1 A;  3QAQ A;  4KSL C;  2MP2 A;  1E8W A;  2MW5 A;  4ZDV A;  2ZVN A;  2DYM A;  5AZH A;  4WAA A;  2VRR B;  2K6Q A;  3L08 A;  4JL9 A;  2N9E B;  1V80 A;  4AUQ C;  2WYQ A;  2GBN A;  2AEH A;  4IM2 A;  2JPH A;  3PTF C;  2KX0 A;  2PEA A;  4A3O A;  1WGY A;  1GUA B;  3UIN B;  3ZNI D;  3DVN V;  2EKE C;  4WQO B;  2ZJD A;  4WWP A;  1YX6 B;  1WRD B;  2KHW B;  3NS8 A;  1LFD A;  4WJN A;  4I6N B;  4FHK A;  5DPR A;  2LVQ A;  3PSE B;  4JIO U;  3T9L A;  2LD9 A;  4G50 A;  1Q1O A;  5CTR C;  3VTW A;  3Q3F A;  1EUV B;  3GOE A;  4FN2 A;  1V6E A;  2ZEQ A;  4NJ7 A;  1C3T A;  3VFK A;  4ANU A;  3M95 A;  3TMP B;  1V5O A;  2V3S A;  1WX9 A;  5L95 C;  4FAD A;  1YX5 B;  4K81 A;  3TBL D;  3UIP B;  3BY4 B;  3UQB A;  2JZ3 B;  2FID A;  3H7P A;  1WXM A;  2KX3 A;  3M62 B;  2MCN B;  3V6C B;  5G2N A;  2LRU A;  1A5R A;  1T0Y A;  5D6J B;  3AXC A;  4IC7 B;  3KYC D;  4W9D A;  5C23 A;  4MJS B;  4G11 A;  1XQQ A;  4HJK A;  4WJQ A;  5E6P A;  4BBN F;  2D07 B;  1OQY A;  2JUO A;  3VQI A;  1YD8 U;  2IZV B;  2KMA A;  2PE6 B;  4DDG D;  4AJY B;  3ZKJ C;  1E5W A;  1EF5 A;  4ZRJ A;  1WXA A;  2R2O A;  4MH0 E;  1WIA A;  2J0K A;  2KTR B;  3H7S A;  4NAW B;  3ZDT A;  2JZZ A;  4JLC A;  5JHA A;  2KTF A;  1NDD A;  5C1Z A;  1TGZ B;  4P7I A;  3APC A;  4MEM A;  2ASQ A;  1V81 A;  3ML9 A;  1L2N A;  1WH3 A;  1V9J A;  4CYE A;  3QQ8 B;  2NR2 A;  5D94 A;  1PQS A;  3DBL I;  1S3S G;  3QCA A;  1TZ1 A;  3V60 A;  1E8Z A;  2GBM A;  4TV3 A;  3U7D A;  2JXX A;  3SDL C;  1RFA A;  4GDL B;  2O6V A;  4GGQ A;  5G55 A;  3PS6 A;  2LGY A;  2MBH A;  5LXI B;  2N7D A;  2O2V A;  3QHT A;  1L7Y A;  1ZW7 A;  2MP2 B;  4MSQ B;  4ASW C;  2WWZ A;  3AU4 A; 
#chains in the Genus database with same CATH topology
 2J52 A;  3BII D;  2CHX A;  3A1Q A;  2Z0E B;  2Z8L A;  4WWN A;  4DK5 A;  1N6Z A;  5HI1 A;  4J3O D;  1FM0 D;  4W9L A;  1JWU D;  2HJ1 A;  4MGY E;  1Y56 A;  1EO6 A;  3U7Z A;  2IO2 B;  1AW7 A;  2LAS A;  3OWE B;  3QIJ A;  1FNW A;  3RD2 A;  4RM8 A;  4GN1 A;  4WQM A;  1NI3 A;  2JU6 X;  1D3Z A;  4BOS C;  4GMV A;  3OJ4 B;  4XWT A;  3Q3N C;  1BML C;  2GMI C;  1WGK A;  4W9G A;  1WJ4 A;  1YQ4 B;  1QT9 A;  1RRB A;  4UDU C;  3C8Y A;  2NBV B;  3P42 A;  1FFV A;  1HZ5 A;  1PYW D;  4AOF A;  1HEZ E;  3OG5 A;  1ET6 A;  1VD2 A;  1YJ1 A;  4HDO A;  2K9X A;  2L76 A;  4JQW C;  1GG3 A;  1YMH E;  3PLV A;  4M8N A;  1V1P B;  1OFF A;  3VRA B;  1MVK A;  4XWW A;  2KMC A;  4DBG A;  3HHM A;  4HPP A;  1Y8R C;  2V1Y A;  1XD3 B;  3B1L X;  3P1M A;  2XNA C;  3A4S C;  3TJP A;  2IJ0 A;  3VTV A;  2HTM E;  1JW9 D;  2C7M B;  1D4B A;  2WXG A;  3GP7 A;  2ZVO A;  1KH0 A;  4MGK E;  4M8M A;  2G1E A;  2ZPY A;  4HDQ A;  2FCM A;  3JSV A;  5JXV A;  3NOB A;  1FCL A;  3DBR I;  4EFO A;  1SE9 A;  2LUM A;  2RDG A;  1MPE A;  4N9F 4;  2TSS A;  4N58 A;  4M0W B;  1V5T A;  1YQ3 B;  3ZDM C;  2M4N A;  4YSX B;  1QZE A;  1C1Y B;  1E9M A;  3VTU A;  2LWP A;  1RAX A;  1R4M B;  2LXC A;  2NTS A;  2AWT A;  3FIL B;  4C80 A;  1DOX A;  4MEL A;  4KZ0 A;  4ZHO A;  1DYQ A;  4AS1 A;  1LXD A;  1TY0 A;  3ZW3 A;  3VUW A;  2N1W A;  1V49 A;  2NBW B;  1YJJ A;  2WU5 B;  3PZ8 A;  2DX5 B;  1HXY D;  2KDI A;  4FLH A;  1P1A A;  3RI7 C;  4FA6 A;  3VUX A;  1P3Q U;  2XK5 A;  3TIX A;  1N61 A;  1K8R B;  4WJP A;  3VXW A;  2GLS A;  2M1M A;  3FIL A;  3N1Z C;  1M94 A;  1TKE A;  1I4G A;  1F77 A;  2O6V D;  3OAW A;  2K25 A;  4ANW A;  1UF0 A;  2NBU A;  3B0A A;  3DPD A;  3LXF A;  2G45 B;  3PVL A;  3Q3M C;  2C60 A;  4LNO A;  1TBE A;  3L16 A;  1GPX A;  4RNA A;  3GB1 A;  1CJE A;  1FIQ A;  3DCG A;  4I6P A;  3BVM A;  3T8M A;  3L54 A;  5J17 A;  2O2V B;  1DGJ A;  4OZB A;  2O6V B;  4B0M A;  2FUG 1;  3U2S C;  4I6L B;  4P1C C;  1WGR A;  4KZC A;  4TSS A;  3MC0 B;  3AED B;  5IAA C;  4IWP A;  1WJ6 A;  2N9P C;  4F1S A;  3WCQ A;  2PVO D;  1R7S A;  2OJW A;  4AWJ A;  2FNJ B;  1L5P A;  1I7H A;  1MG4 A;  2RPQ A;  2BWF A;  2ZCB A;  4MH8 A;  2D3B A;  2KMM A;  2DBY A;  3AE5 B;  4HJG E;  3OLM D;  4HKZ E;  2BS4 B;  2KZR A;  1SJE D;  2N7E A;  1UD7 A;  4C4V B;  2BS3 B;  2JF5 A;  2MSE D;  1XCQ L;  2N9X A;  4E3C A;  2RDB C;  1NYR A;  2WXP A;  1F2R C;  2KD0 A;  2N9K A;  2GBR A;  3CWI A;  5AZG A;  3U8Z A;  1A70 A;  3WAL A;  2X38 A;  3TSS A;  2BGF A;  3ZYY X;  1R4M I;  3DQV A;  3AM9 A;  3KUZ A;  5AUI A;  2D3C A;  5JZE B;  4HPM B;  3ZJV A;  2N7J A;  3VDZ A;  2QIL A;  3RN9 C;  3PZD A;  5EE3 A;  1Q0W B;  1WFY A;  4GB9 A;  3ENE A;  4PS8 A;  4HCP B;  5D7G A;  4XC2 A;  2KWC A;  3U52 E;  1E8X A;  1ET9 A;  3ETR A;  2YEP F;  3CIR B;  3MFG A;  4PS3 A;  4GDK A;  4HVB A;  1IPG A;  4NJC A;  1ZUD 2;  3CSF A;  1F2R I;  4ZYS A;  2IO1 B;  1OEY J;  1TIF A;  3NZU A;  2N0S B;  4BZA A;  2AL3 A;  2BF8 B;  2DZM A;  2JWU A;  3KUC B;  4G3X B;  4EEW A;  1D5M C;  1EWY C;  1SEB D;  2H88 B;  4KGR A;  1WMH B;  1WXV A;  1Q5W B;  3RZW C;  3SU8 X;  4GOC A;  3APF A;  5BO4 B;  1N5X A;  2MH7 A;  2EEL A;  4CO7 A;  2D10 A;  2H89 B;  3A33 B;  4YTN B;  4ZHP A;  1UBI A;  3ZRF A;  4KSL C;  3RNC C;  2I1J A;  2W55 A;  4WIP A;  1ZDX A;  3L08 A;  4JL9 A;  4HEA 1;  2GBN A;  2AEH A;  2K0P A;  2JPH A;  1E0Z A;  1WGY A;  1GUA B;  1WRD B;  3NS8 A;  4WJN A;  2LVQ A;  3PSE B;  4A90 A;  1ESF A;  1ZP0 B;  2VZK B;  2WXI A;  5CTR C;  3UI3 A;  4NJ7 A;  1C3T A;  4K3C A;  1P7E A;  5L95 C;  4GLS C;  1JAL A;  3H7P A;  2KX3 A;  3V6C B;  5G2N A;  5D6J B;  4W9D A;  4AQ7 A;  4WJQ A;  2D07 B;  1OQY A;  3VQI A;  1JWA D;  2PE6 B;  4AJY B;  3ZKJ C;  1E5W A;  1EF5 A;  4ZRJ A;  1WXA A;  1WIA A;  2KTR B;  3ZDT A;  2K22 A;  5C1Z A;  1TGZ B;  3Q8F A;  1T6B X;  3DHI C;  5E6J A;  1YN4 A;  2INC C;  1PQS A;  1QOB A;  1S3S G;  3QCA A;  2JXX A;  3SDL C;  4GDL B;  1YN5 A;  1KLU D;  2LGY A;  2MBH A;  2MP2 B;  4ASW C;  4OW0 A;  2WWZ A;  2CR5 A;  1ROE A;  3PRZ A;  2JSV X;  1IUE A;  1SJH D;  2LXA A;  4A20 A;  3DWM A;  2J53 A;  2BYT A;  4M02 A;  1NEN B;  2WXF A;  2ACZ B;  2C9W B;  3PRP B;  3TEZ A;  2LHD A;  2K8H A;  1N60 A;  4GDL A;  3I3T B;  1RWS A;  2CU3 A;  1L6V A;  4M01 A;  4IG7 B;  2IDY A;  1FPY A;  5MPO A;  4MSM B;  1NEK B;  4HLE A;  4ACF A;  2W9N A;  2WS3 B;  2RMM A;  2L32 A;  2KN4 A;  3AEB B;  3E9S A;  2WDR B;  4BKG A;  3VH4 B;  2REX A;  5IKC M;  1L4D B;  3N1X C;  4A3P A;  1OQR A;  3KVF B;  4HWI B;  4D2K A;  4IOI E;  3H7P B;  3RPF C;  3DDC B;  3PHW B;  1QLB B;  2HDE A;  2LJI A;  5HG2 A;  4TMA B;  1KF6 B;  1JWM D;  3VHT C;  1BXT A;  1WWT A;  1QIL A;  2L7R A;  2VH1 A;  1E7U A;  5AZF A;  1WJU A;  4DWF A;  3MC8 A;  2MBE A;  1ZE3 D;  1EU4 A;  3ZXR A;  4C7Y A;  1QQR A;  4YL8 A;  3R3M A;  4FJY A;  4NZL B;  1YQB A;  3SFE B;  1V1O A;  3U4E G;  1VCB A;  1XLP A;  2WXJ A;  4BBN C;  4WJO A;  2JRI B;  1UUP A;  3DVN U;  1MI0 A;  4XE0 A;  5FK9 C;  1N62 A;  4US8 A;  2W54 A;  3BK2 A;  1T0S C;  3MTN B;  2WHI A;  3J9C A;  2KT7 A;  2V3P A;  1YNT E;  4KV2 A;  3HIZ A;  3WAP A;  5FR6 A;  2DZJ A;  1RLF A;  2FCS A;  2MJE A;  4ZOH C;  5H8Y E;  2NPT B;  4B6W A;  4C56 C;  3PRM B;  3ZXV A;  1FO4 A;  3PRE A;  1WMH A;  2RDH A;  3HRD D;  3VAW A;  4YXD B;  2KXJ A;  2C7H A;  1CZP A;  1C4P A;  2D11 A;  1WX8 A;  2LZ6 A;  4XX5 A;  2JQR B;  2WDT B;  3AN1 A;  3P4P B;  3ZNH B;  1GB1 A;  2LRW A;  1GC6 A;  4IWQ A;  2JX5 A;  3AI5 A;  2K8C A;  1GJZ A;  2E3T A;  1J19 A;  2NCN A;  4ICU A;  1F1H A;  3DBS A;  3Q8B A;  3AEE B;  1EWC A;  1KM7 A;  4KGT A;  2ICI A;  3BVZ A;  2JZP A;  2LHE A;  2C5L C;  2G4S A;  2WP9 B;  2AYO B;  4GXB A;  2N4F A;  4K1R B;  1WYG A;  3ZLZ A;  1JRP A;  3WA0 A;  1R4N I;  3ZGZ A;  2W3S A;  5G5H A;  2FE8 A;  3EC8 A;  1P7F A;  1HZ6 A;  2KJH B;  3IHP C;  1F0Z A;  3DVG X;  2A4Z A;  2Z0D B;  1X1M A;  3P2B A;  1B1Z A;  5FKA C;  2KWU B;  3I57 A;  3Q8A A;  3IT6 B;  1F52 A;  1TTN A;  2JY6 A;  4BVU C;  1VLB A;  2CJN A;  1XT9 B;  3P63 A;  2LGS A;  1I4H A;  2KQS A;  2BS2 B;  1E7V A;  1NVI D;  1QOF A;  3MHZ A;  3ZNG C;  1WE6 A;  4RMA A;  4HCN B;  3V05 A;  3RNB C;  3JW0 X;  3L17 A;  4IWO A;  2MRP A;  2IO3 B;  3NVZ A;  3IVF A;  1D6E C;  3LJ3 A;  3GS2 A;  3QJZ A;  2OOB B;  3NRZ A;  1ZKH A;  1D5X C;  3WAM A;  1HQR D;  1OEY A;  1NYQ A;  4XYC A;  2KJR A;  4NQK E;  4S17 A;  4J6I A;  1LQB A;  1WSP A;  3P4S B;  4KSK C;  2BT6 A;  1WXS A;  1ACC A;  1T3Q A;  1E6E B;  2SAK A;  4F8C B;  2NPT A;  1C4A A;  2MEK A;  3ECI A;  3W2D A;  2D3A A;  1PUT A;  3A9J A;  4PYZ A;  5HFY A;  3RNF C;  1RFK A;  2RGF A;  4EZJ A;  2LVO A;  2PKO A;  5CHW A;  1PDX A;  2XK5 B;  4BKS D;  4MGI E;  3ZIM A;  2KK8 A;  4FBJ B;  3R2T A;  2L0T A;  1GNU A;  3VH3 B;  1WF9 A;  1SE2 A;  5DPS A;  2IGG A;  2Y5P A;  1ZGU B;  2FCQ A;  2KC2 A;  1XEE A;  2WXR A;  4JGH B;  5BYQ A;  4E74 A;  2KDB A;  1GB4 A;  3R2I A;  1LO5 D;  5LXH A;  2KDF B;  2M0X A;  1E7P B;  1SE4 A;  2KAJ A;  4USA A;  4DHZ B;  2GBK A;  4W9K A;  2MLB A;  3NJT A;  3X23 A;  2B76 B;  4KDI C;  4QAY A;  1XXG A;  3SEB A;  5BYS A;  2LJ5 A;  2V4L A;  1GC7 A;  4KKJ A;  2AQ2 B;  1I35 A;  2DHZ A;  4KDL B;  4HRS A;  5CHF A;  4TUU A;  2NTT A;  3AE8 B;  2CHW A;  1WGG A;  2DAJ A;  3T3N A;  5EE0 A;  5C2T B;  1IBX A;  2A5U A;  4ITK A;  1J7C A;  1I4P A;  1V86 A;  2BYF A;  1LGR A;  1KJT A;  4YTM B;  1FEH A;  4LK0 M;  4DHJ B;  3H9D A;  2OED A;  1UGJ A;  3BZD B;  3LDZ E;  2QMT A;  1MG8 A;  2LEK A;  1TKG A;  4A8X C;  3AE1 B;  1AAR A;  1YIW A;  3N9Y C;  2EMS A;  2MP2 A;  4ZDV A;  2KYW A;  1AYF A;  2DYM A;  2K6Q A;  2N9E B;  1V80 A;  4XDC A;  1TZO A;  3MP9 A;  2KX0 A;  4YSZ B;  3DVN V;  4WQO B;  2V0G A;  4OZA A;  1L0X B;  4L23 A;  2ZJD A;  5C3J B;  2KHW B;  1LFD A;  5DPR A;  4FHK A;  3AB5 A;  2GI9 A;  3T9L A;  3DHG C;  4ARC A;  2V3S A;  3FAH A;  2E6X A;  4C4V A;  1GOZ A;  2X8X X;  3IAM 1;  4K81 A;  3TBL D;  3UIP B;  2L83 A;  3BY4 B;  2FID A;  3M62 B;  2MCN B;  2PIA A;  1A5R A;  1T0Y A;  1KRH A;  4N59 A;  4LNF A;  4G11 A;  1XQQ A;  3KWL A;  3IAS 1;  2JUO A;  1TT5 B;  2V9H A;  2J0K A;  3H7S A;  5JHA A;  1UWM A;  2JZZ A;  4JLC A;  1FMA D;  5HHD G;  2JXT A;  4P7I A;  1TKY A;  1V81 A;  1V9J A;  4CYE A;  1ZDV A;  3QQ8 B;  1MHX A;  3V60 A;  1E8Z A;  1C79 A;  4M0W A;  2O6V A;  4GGQ A;  2BTE A;  3QHT A;  1ZW7 A;  3FKY A;  3TEX A;  3Q14 C;  3GE3 C;  2ON8 A;  2KVR A;  3W1Y A;  5IO9 A;  3I63 C;  3NVW A;  4RM9 A;  5T8I A;  4EUT A;  4XZ4 A;  2WQY B;  1K52 A;  3ZRC A;  3A9K B;  4KVG B;  1PGA A;  4N6E B;  4MGZ E;  3AU5 A;  3Q8C A;  1IBX B;  1EU3 A;  1AWD A;  3WAO A;  1WM2 A;  3MJ5 A;  2KAN A;  4XDD A;  1RYJ A;  4REZ A;  1WE7 A;  4HKQ A;  1OGW A;  1TYG B;  3CMM B;  2NMQ A;  4LCD E;  4S0R A;  1UWX A;  4W9J A;  4TKN A;  3AEG B;  2UYZ B;  3AEA B;  2BVC A;  2OJR A;  1C78 A;  5EDS A;  1T0R C;  1WGH A;  2MBB B;  3N32 A;  4JPS A;  1QF6 A;  3ML8 A;  1E8Y A;  2WX0 A;  2PVG C;  2Y3A A;  1CMX B;  3PGE A;  1BUI C;  2ZNV C;  4DDI D;  4BAX A;  3ZJT A;  1J8C A;  2QCZ A;  2CJO A;  1E90 A;  2N1V A;  3ZTC A;  3EEC A;  1NI2 A;  3HVZ A;  3GZN I;  3LYY A;  1NBF C;  2K8B A;  2GB1 A;  1WZ0 A;  2K1F A;  3NY5 A;  1JCK B;  2DZK A;  1Z5S B;  1H8C A;  3QAR A;  2PE9 A;  4WWO A;  4K3B A;  3UIO B;  1YN3 A;  2G4D B;  4RGT A;  2HJ8 A;  1HE8 A;  4IDI A;  3A1Q B;  3N20 C;  2CHZ A;  2AQ1 B;  4ICV A;  4NJ6 A;  1QKZ A;  4OVU A;  4B9K A;  3VVW B;  4IM0 A;  4EKU A;  2WXL A;  2KDE B;  4DXA B;  2B3A A;  4R3D A;  2NS5 A;  5BMI A;  2J0J A;  1FCC C;  1XF5 L;  4PS7 A;  2GOW A;  1CK1 A;  2Y5B B;  1N63 A;  1SGH A;  1KLV A;  4DHJ D;  3I5J C;  4MM3 B;  3AE7 B;  3DHH C;  2KLC A;  3AE4 B;  3DVG Y;  4EE2 A;  5DPW A;  3PO0 A;  1C77 A;  1C76 A;  3K9O B;  4YWG G;  3WIM A;  3AEF B;  1VJK A;  1JRO A;  2BYV E;  3PV1 A;  3MJW A;  5AEK B;  3Q3J A;  3EFC A;  1V1P A;  3H6N A;  4NAM A;  1MFW A;  4ZRI A;  4K7S A;  2L00 B;  3EGR A;  3EFU A;  4NAW A;  1I42 A;  3O65 B;  4YT0 B;  1TS4 A;  4TQ1 A;  1WR6 E;  5JH5 C;  1FNU A;  1ZOY B;  4LJO B;  3C19 A;  4W9F A;  1YJI A;  1WJN A;  3KLS X;  2N9L A;  3ZJU A;  2KFJ A;  1RM6 C;  4LDT B;  4LLG M;  3NUH B;  2J7Q B;  3NZ3 A;  3RUL A;  3BVG A;  4O1N A;  2D2Q A;  3B2G A;  2ZNV B;  2JYT A;  1L4Z B;  4OZC A;  5J2R A;  3NVY A;  2BW2 A;  3W5U B;  2VH2 A;  1Q10 A;  1QOA A;  4IW0 A;  4C00 A;  1UZX B;  5IN7 A;  3ABV B;  3O13 A;  2LGI A;  2WXN A;  1ENF A;  3JSV B;  4MM3 A;  2L8J A;  4G0N B;  3PPA A;  3V3X A;  4RF1 A;  2AX5 A;  3VUY A;  2LGX A;  3URY A;  2KKC A;  4GDK B;  2BB5 A;  3BYT B;  2Z59 B;  2RPV A;  2KAC A;  2K3U A;  1P98 A;  5TSS A;  5CX3 A;  1OTR B;  2XEW A;  3SD5 A;  2YVC A;  1P0R A;  2WGS A;  5BMH A;  4MJS A;  1ZXH A;  4ANV A;  1VR9 A;  4F7Z A;  1WRI A;  4KKI A;  3PT2 B;  1XLO A;  2I2Y A;  1EM7 A;  1FXT B;  2HTH A;  1DOY A;  3L4P A;  3JVZ X;  3RT3 B;  3UF8 A;  4FUL A;  5GMV A;  2MA9 B;  2FUH B;  4ZYN A;  2LGD A;  2KDM A;  1PGB A;  4EZK A;  3DBR B;  3WAN A;  3IFW B;  2BKF A;  1H4R A;  2SEB D;  1Z2M A;  3VR9 B;  1LM8 B;  1JWB D;  3B9J A;  3CF6 E;  1JRU A;  5L83 A;  4OHJ A;  1OQQ A;  1E10 A;  4A55 A;  3S2A A;  3ZQ4 A;  1WXQ A;  1J7B A;  2I1K A;  3PHX B;  2QJL A;  1XLQ A;  1UBQ A;  1JWS D;  4DXF A;  2CKH B;  4YTP B;  2WXM A;  3RFZ B;  2WNM A;  2LUE A;  2WXK A;  4P16 A;  1WY8 A;  3CST A;  4NY0 A;  1TJE A;  2KN5 A;  2Q5W D;  4Q2J A;  2WXH A;  3HM3 A;  4W9I A;  4L2Y A;  4RGO S;  3W1S C;  3A9K A;  4JX1 C;  3ALB A;  1I4X A;  5DPT A;  5IOI A;  3RNE C;  1B9R A;  4FXC A;  2AL6 A;  1ZPS A;  4K7W A;  2BQQ A;  3PLU A;  2QDF A;  1FXI A;  2MWS B;  1FRD A;  2PLP A;  2GBJ A;  4MT5 A;  4KIK B;  3V6E B;  2RR9 A;  3W1S A;  2MBO A;  3QAQ A;  2MW5 A;  1E8W A;  5I4D A;  1T5X D;  1KFY B;  3AV8 A;  2VRR B;  2WLB A;  1I4Q A;  3HUI A;  4LTU A;  2WYQ A;  4B0E A;  4IM2 A;  3PTF C;  2PEA A;  2WDQ B;  2V3N A;  3UIN B;  4A3O A;  3ZNI D;  2EKE C;  5G5G A;  4I6N B;  4ARI A;  4JIO U;  4G50 A;  3Q3F A;  1EUV B;  4FN2 A;  1V6E A;  1J7A A;  3VFK A;  3M95 A;  2M56 B;  3SFD B;  1WX9 A;  2L52 A;  5LNK 1;  4FAD A;  3RMK C;  3BYY B;  1C4C A;  3UQB A;  2JZ3 B;  1WXM A;  3AXC A;  5C23 A;  2JYE A;  4US9 A;  3W5V B;  1FRR A;  1YD8 U;  4DDG D;  3Q2A C;  1KLG D;  3B2F A;  2R2O A;  3Q3O C;  2INP E;  2KTF A;  4JWS C;  4P6V F;  1NDD A;  2ASQ A;  5D94 A;  2WXQ A;  3DBL I;  1TZ1 A;  2WXO A;  2GBM A;  1C9F A;  4M00 A;  1TY2 A;  3U7D A;  2PW9 A;  1FXA A;  5G55 A;  2N7D A;  2HD5 B;  3H8H A;  4W9E A;  5LLI A;  4KIK A;  2M19 A;  3AUL A;  3JYU A;  3KQ4 A;  5D3I B;  3ONS A;  3KUD B;  3R7Q A;  1L0Y B;  1UGM A;  2DYB A;  4MDK E;  2L1A A;  4WWM A;  2G9H D;  1WI0 A;  2WDV B;  4HPL B;  5TR5 A;  3N1Y C;  4LDT D;  5HKH A;  3V62 A;  3TEW A;  4EZL A;  1TS3 A;  3QWZ B;  3B08 A;  3OJ3 A;  2PJH A;  3AE2 B;  4GIV A;  1VRA B;  2IBI B;  4JWU C;  1DOI A;  1MJD A;  1TS2 A;  1L0V B;  4CQN A;  4WUR A;  2KFK B;  3N30 A;  4ZRK A;  3E56 A;  1IGD A;  3FC4 A;  3EUB 2;  4X57 B;  3AMZ A;  2K6D B;  2BKR B;  2HE7 A;  1HTO A;  1U4A A;  2KWV B;  1K50 A;  2UU7 A;  3R7R A;  3K9P B;  3NG0 A;  2XN9 C;  4IM3 A;  1I4R A;  3NHE B;  2JVC A;  2MHJ A;  3RUI B;  2L05 A;  2J4X A;  2BWE S;  1SF0 A;  3KW5 B;  5D3D A;  1JML A;  1WZ3 A;  2KQ7 A;  1PFD A;  2QEJ C;  5EE9 A;  2NVU I;  2C7N B;  3BWU D;  3RCZ A;  1WX7 A;  1GAQ B;  5JHB A;  1UNS A;  2DYO A;  1SIF A;  2AQ3 B;  2ONQ A;  4URK A;  3NZS A;  5KHQ A;  3EHV A;  3ZTD A;  3TEY A;  3IG3 A;  3QX1 A;  3APD A;  2JWZ A;  2DWQ A;  1WR1 A;  2PMV A;  3M3J A;  2KQ4 X;  2L3Z A;  1HA5 A;  4MAC A;  3KYD D;  2OHF A;  3GZN B;  2KO3 A;  2RSU A;  4EOY A;  2JRH A;  2ZPN A;  4GSW A;  4AJW A;  1WGD A;  3L13 A;  4PT5 A;  4PYU A;  5J18 A;  3HK0 A;  1MHH E;  4DQO C;  3HVD A;  2JT4 B;  3QA8 A;  4RGN A;  3DWG C;  3A4R A;  5AUK A;  3RYT A;  2ZCC A;  3UGB B;  1K51 A;  2KTR A;  2XBB C;  4GU2 A;  4RFB A;  1FFU A;  3DOW A;  1KTK A;  1V2Y A;  2QSD A;  1SBB B;  4II2 B;  3L10 B;  1J0G A;  2D5G A;  4NQL B;  3MC9 A;  1L6U A;  3EA6 A;  3TL5 A;  4LJP B;  2KC1 A;  4DXG A;  1SIJ A;  4FJZ A;  4II3 B;  3AEC B;  1P9D U;  3BIN A;  5E6N A;  2BBC A;  2W3R A;  4BKT A;  4FJV B;  2UWQ A;  5E6O A;  2BYE A;  2YLM A;  3SR6 A;  2KVZ A;  5IA7 A;  3KH0 A;  1WYW B;  1WM3 A;  3C0R B;  1M4V A;  1N5W A;  3DBH I;  5DCN A;  3V61 A;  2FBW B;  2ZZP B;  3A9J B;  1BT0 A;  1EF1 A;  3ZNZ B;  2KWD A;  2KFK A;  3QK0 A;  4WAF A;  4E71 A;  2IYD B;  2BPS A;  4ZRP A;  2KLG A;  3TUO A;  3Q8E A;  1IYF A;  2CU1 A;  2IO0 B;  4DHZ E;  2V4I B;  1D5Z C;  2VZK D;  3IT4 B;  4RH6 A;  2W82 A;  2ZW0 A;  2J0M A;  2GRI A;  1IGC A;  1SB3 C;  4B95 A;  2IY1 B;  4ANX A;  1IP9 A;  2PPH A;  3M63 B;  3UQA A;  2EMT A;  4BOZ B;  2PTL A;  4BFR A;  3MHS D;  5KHO A;  2LI5 A;  3NVV A;  3QC8 B;  3R66 C;  1K53 A;  1F9J A;  3AE6 B;  3VRB B;  3KWV A;  4W9H A;  1YOV B;  1QOG A;  2LFI A;  4OVZ A;  3RNA C;  4CHK A;  3LB8 C;  2DNF A;  4HXD A;  3U30 A;  2L0F A;  4C7Z A;  2FAZ A;  2QIE B;  1SSN A;  3DBH B;  2R2Q A;  4HRO A;  4IUM B;  3RZF A;  4YSY B;  3BK1 A;  1VZ8 A;  4BKS A;  1SE3 A;  1VDV A;  2DEN B;  2MBQ A;  1XO3 A;  4XGA B;  1FD6 A;  2MQJ A;  2Y5C A;  3ZVV A;  3N3K B;  3IBE A;  2KJ6 A;  2MX2 A;  1FNV A;  5D2M B;  2D3G A;  5BYR A;  2YEP B;  5CHV C;  2DZI A;  2CS4 A;  4FHJ A;  4IKG A;  3DBL B;  1HTQ A;  2M17 A;  2RD0 A;  2IY0 B;  2KOX A;  1V8C A;  4KGS A;  4NNJ B;  2QHO A;  3T3O A;  2M8S A;  4TQ0 A;  3I9V 1;  3ZO5 B;  2IGH A;  4L1B A;  3Q6B A;  3P4R B;  5EE1 A;  1STE A;  3R8B A;  2DAF A;  1UEL A;  2DLB A;  2G3Q B;  3TCA A;  3Q69 A;  1S1Q B;  1UH6 A;  4OVV A;  4K7U A;  4H2A A;  3ZUN A;  3SHQ A;  4NPN A;  2FIF A;  2EKI A;  5GXG B;  1VZ7 A;  2K5P A;  4LNK A;  4A6Q A;  3VR8 B;  3D32 A;  4JE3 B;  4RGM A;  4AP4 C;  2FCN A;  2ZW1 A;  3W9C B;  3X0W A;  4LNI A;  1XCT L;  4KX6 B;  3H1U A;  4ZRQ A;  2LVP A;  3HM6 X;  4W9C A;  1T0Q C;  2IND C;  5FR3 A;  1R4N B;  3L0W B;  2IGD A;  4HK2 A;  1CQV A;  1KOT A;  2KNB A;  4AUQ C;  2K39 A;  1ISN A;  2WX1 A;  2LMC A;  2ZVN A;  3PZ7 A;  3AE9 B;  4WAA A;  5AZH A;  2BB6 A;  2MJ3 A;  3RNG C;  5H92 C;  2IPK D;  4PK1 A;  2M0A A;  4WH4 A;  4WWP A;  1VZ6 A;  1YX6 B;  3GE8 C;  2LD9 A;  2J42 A;  3P4Q B;  1PGX A;  1JQ4 A;  1AN8 A;  1Q1O A;  3AE3 B;  3VTW A;  3GOE A;  2I38 A;  2ZEQ A;  4ANU A;  5IP4 D;  3IXS A;  3TMP B;  1V5O A;  1YX5 B;  3NS1 A;  4A9A A;  2LRU A;  4IC7 B;  3KYC D;  1XLN A;  4RF0 A;  1V97 A;  4MJS B;  5E6P A;  4HJK A;  4BBN F;  2INN E;  2IZV B;  2KMA A;  4P1B C;  1SXT A;  1G6J A;  4MH0 E;  2QC8 A;  4NAW B;  2R61 A;  3AH7 A;  3APC A;  4MEM A;  4RCO A;  3ML9 A;  1L2N A;  1WH3 A;  2NR2 A;  5BMG A;  4LNN A;  4TV3 A;  1RFA A;  2WU2 B;  3PS6 A;  5LXI B;  1TS5 A;  2MJD A;  2O2V A;  1ZXI A;  1L7Y A;  4MSQ B;  3AU4 A; 
#chains in the Genus database with same CATH homology
 2HD5 B;  4W9E A;  5LLI A;  2CR5 A;  3PRZ A;  4KIK A;  3AUL A;  2LXA A;  4A20 A;  2CHX A;  3JYU A;  2KVR A;  3A1Q A;  2Z0E B;  3W1Y A;  4WWN A;  3ONS A;  3KUD B;  2C9W B;  3R7Q A;  3PRP B;  4DK5 A;  1UGM A;  2DYB A;  4MDK E;  1WI0 A;  2K8H A;  4RM9 A;  4EUT A;  4GDL A;  3I3T B;  4XZ4 A;  4HPL B;  5TR5 A;  4W9L A;  3ZRC A;  4MGY E;  4IG7 B;  1EO6 A;  4MSM B;  4LDT D;  4HLE A;  3A9K B;  2IO2 B;  4KVG B;  2W9N A;  5HKH A;  2LAS A;  3V62 A;  4EZL A;  3QIJ A;  3QWZ B;  4MGZ E;  3RD2 A;  4RM8 A;  3AU5 A;  3B08 A;  3OJ3 A;  4GN1 A;  2PJH A;  4BKG A;  3VH4 B;  2REX A;  1D3Z A;  4BOS C;  3WAO A;  1WM2 A;  4GIV A;  2IBI B;  4GMV A;  4A3P A;  2KAN A;  3KVF B;  3OJ4 B;  4HWI B;  2GMI C;  1WE7 A;  4W9G A;  1WJ4 A;  1OGW A;  3CMM B;  1RRB A;  3H7P B;  4LCD E;  4W9J A;  2NBV B;  4TKN A;  3DDC B;  3PHW B;  2UYZ B;  2KFK B;  2OJR A;  3N30 A;  4ZRK A;  4AOF A;  5EDS A;  3VHT C;  4X57 B;  1WGH A;  2MBB B;  3N32 A;  1VD2 A;  2BKR B;  2K6D B;  3ML8 A;  1YJ1 A;  2L7R A;  1E8Y A;  1E7U A;  4HDO A;  2WX0 A;  5AZF A;  2L76 A;  1WJU A;  4JQW C;  4DWF A;  2HE7 A;  1GG3 A;  3PLV A;  1U4A A;  4M8N A;  2MBE A;  1CMX B;  2KWV B;  3PGE A;  3R7R A;  3K9P B;  2ZNV C;  4DDI D;  2KMC A;  4IM3 A;  1J8C A;  1E90 A;  4DBG A;  2N1V A;  4YL8 A;  3NHE B;  2JVC A;  3HHM A;  3EEC A;  3RUI B;  3ZTC A;  2L05 A;  1Y8R C;  3R3M A;  2V1Y A;  2BWE S;  4FJY A;  3KW5 B;  1YQB A;  1WZ3 A;  1XD3 B;  2KQ7 A;  3B1L X;  1NI2 A;  3A4S C;  3TJP A;  1VCB A;  3GZN I;  4BBN C;  2NVU I;  1NBF C;  2K8B A;  4WJO A;  2JRI B;  3VTV A;  1WZ0 A;  2C7N B;  2K1F A;  3NY5 A;  3DVN U;  3RCZ A;  1WX7 A;  2DZK A;  1Z5S B;  1H8C A;  3QAR A;  5JHB A;  2PE9 A;  2C7M B;  4WWO A;  2DYO A;  1SIF A;  3UIO B;  3MTN B;  2ZVO A;  4URK A;  3NZS A;  4KV2 A;  2G4D B;  3HIZ A;  3WAP A;  5KHQ A;  3EHV A;  5FR6 A;  4MGK E;  2DZJ A;  3ZTD A;  2HJ8 A;  1HE8 A;  3IG3 A;  3A1Q B;  3QX1 A;  1RLF A;  2CHZ A;  2FCS A;  2JWZ A;  3APD A;  2ZPY A;  4ICV A;  4HDQ A;  4NJ6 A;  4OVU A;  2FCM A;  1WR1 A;  2NPT B;  3JSV A;  4B9K A;  3VVW B;  4B6W A;  3M3J A;  3NOB A;  3PRM B;  4IM0 A;  3DBR I;  4M8M A;  4EKU A;  4DXA B;  2KDE B;  4EFO A;  3PRE A;  1WMH A;  1SE9 A;  2B3A A;  2L3Z A;  3VAW A;  2KXJ A;  3KYD D;  4N9F 4;  2KO3 A;  2RSU A;  1V5T A;  2C7H A;  2JRH A;  2NS5 A;  2ZPN A;  4GSW A;  4M0W B;  3ZDM C;  4EOY A;  2J0J A;  2M4N A;  4AJW A;  1WGD A;  3L13 A;  4PYU A;  4PS7 A;  2D11 A;  2GOW A;  3HK0 A;  1WX8 A;  5J18 A;  2Y5B B;  2LZ6 A;  1SGH A;  4XX5 A;  1KLV A;  1QZE A;  2WDT B;  2JT4 B;  3ZNH B;  4DHJ D;  1C1Y B;  2LRW A;  1GC6 A;  3QA8 A;  4IWQ A;  3VTU A;  2LWP A;  2KLC A;  3A4R A;  3DVG Y;  5DPW A;  3AI5 A;  2K8C A;  3RYT A;  1GJZ A;  2ZCC A;  3UGB B;  1G6J A;  1J19 A;  2NCN A;  3K9O B;  2KTR A;  2XBB C;  4ICU A;  1RAX A;  4GU2 A;  3WIM A;  3DBS A;  2LXC A;  2AWT A;  3DOW A;  2BYV E;  1KM7 A;  1V2Y A;  3PV1 A;  3MJW A;  5AEK B;  3Q3J A;  2C5L C;  4MEL A;  4II2 B;  2G4S A;  3H6N A;  4KZ0 A;  4ZRI A;  3L10 B;  1J0G A;  2AYO B;  4K7S A;  4GXB A;  2L00 B;  4NQL B;  1LXD A;  2N4F A;  4K1R B;  3EFU A;  4NAW A;  3ZLZ A;  1I42 A;  3O65 B;  3TL5 A;  4LJP B;  3ZW3 A;  2KC1 A;  4TQ1 A;  3WA0 A;  3VUW A;  2N1W A;  1R4N I;  1V49 A;  2NBW B;  4FJZ A;  1WR6 E;  4II3 B;  5JH5 C;  2DX5 B;  1P9D U;  3BIN A;  3EC8 A;  4LJO B;  5E6N A;  2KDI A;  4FLH A;  1P1A A;  4W9F A;  4BKT A;  1WJN A;  4FA6 A;  4FJV B;  2KJH B;  3IHP C;  3VUX A;  1P3Q U;  2UWQ A;  3DVG X;  2XK5 A;  2A4Z A;  2Z0D B;  5E6O A;  3TIX A;  2BYE A;  2YLM A;  2KFJ A;  1K8R B;  4WJP A;  1X1M A;  3P2B A;  4LDT B;  3VXW A;  5IA7 A;  2M1M A;  3KH0 A;  1WYW B;  1WM3 A;  2KWU B;  3C0R B;  1M94 A;  2J7Q B;  3DBH I;  5DCN A;  3RUL A;  1TTN A;  2JY6 A;  3V61 A;  4BVU C;  2O6V D;  2ZZP B;  1BT0 A;  1XT9 B;  3A9J B;  1EF1 A;  2D2Q A;  3OAW A;  3ZNZ B;  2KFK A;  2K25 A;  3QK0 A;  2KQS A;  2ZNV B;  4ANW A;  1E7V A;  4E71 A;  5J2R A;  2IYD B;  2NBU A;  3B0A A;  2BPS A;  3ZNG C;  1WE6 A;  2KLG A;  4RMA A;  4HCN B;  3DPD A;  1IYF A;  2CU1 A;  2IO0 B;  4DHZ E;  3JW0 X;  3L17 A;  4IWO A;  2G45 B;  2MRP A;  4IW0 A;  2IO3 B;  2J0M A;  3PVL A;  1UZX B;  3IVF A;  3LJ3 A;  3QJZ A;  2C60 A;  2OOB B;  1TBE A;  1ZKH A;  4B95 A;  3L16 A;  3WAM A;  2IY1 B;  4ANX A;  1IP9 A;  1OEY A;  2PPH A;  3JSV B;  3DCG A;  4MM3 A;  3M63 B;  4I6P A;  3UQA A;  2KJR A;  2EMT A;  2L8J A;  4BOZ B;  4BFR A;  4G0N B;  4NQK E;  3PPA A;  3MHS D;  5KHO A;  2LI5 A;  3QC8 B;  3R66 C;  4J6I A;  3T8M A;  3L54 A;  1LQB A;  5J17 A;  1F9J A;  2O2V B;  3VUY A;  2LGX A;  2O6V B;  4KSK C;  1WXS A;  4W9H A;  2KKC A;  4GDK B;  4CHK A;  4F8C B;  4HXD A;  2NPT A;  4I6L B;  3U30 A;  2L0F A;  1WGR A;  4KZC A;  2Z59 B;  2FAZ A;  5IAA C;  4IWP A;  1WJ6 A;  2R2Q A;  3ECI A;  4IUM B;  2N9P C;  4F1S A;  1P98 A;  3RZF A;  4AWJ A;  2FNJ B;  5CX3 A;  1OTR B;  2XEW A;  4BKS A;  3A9J A;  3SD5 A;  4PYZ A;  2YVC A;  2DEN B;  1P0R A;  2MBQ A;  2RPQ A;  2BWF A;  2ZCB A;  4MJS A;  2MQJ A;  4ANV A;  2RGF A;  4EZJ A;  2LVO A;  4F7Z A;  3ZVV A;  3N3K B;  3OLM D;  5CHW A;  3IBE A;  2XK5 B;  3PT2 B;  2KJ6 A;  1FXT B;  2KZR A;  2HTH A;  2MX2 A;  5D2M B;  3JVZ X;  2N7E A;  1UD7 A;  3RT3 B;  3UF8 A;  4BKS D;  4MGI E;  4FUL A;  2JF5 A;  2D3G A;  5GMV A;  3ZIM A;  2MSE D;  2KK8 A;  2MA9 B;  2FUH B;  4FBJ B;  4ZYN A;  2L0T A;  5CHV C;  2N9X A;  1GNU A;  2LGD A;  2DZI A;  4E3C A;  3VH3 B;  2CS4 A;  4FHJ A;  1WF9 A;  2M17 A;  2RD0 A;  4EZK A;  2IY0 B;  2KOX A;  2KD0 A;  5AZG A;  2GBR A;  3U8Z A;  3WAN A;  5DPS A;  3WAL A;  3IFW B;  4NNJ B;  1ZGU B;  2BGF A;  2QHO A;  2FCQ A;  1R4M I;  2KC2 A;  2BKF A;  2M8S A;  3DQV A;  3KUZ A;  4JGH B;  1H4R A;  5JZE B;  1Z2M A;  4HPM B;  4E74 A;  2KDB A;  1LM8 B;  3VDZ A;  4TQ0 A;  5LXH A;  2KDF B;  3PZD A;  3ZO5 B;  3CF6 E;  2M0X A;  1Q0W B;  4DHZ B;  2GBK A;  1WFY A;  4W9K A;  2MLB A;  1JRU A;  4GB9 A;  5L83 A;  3ENE A;  3X23 A;  4PS8 A;  4HCP B;  5D7G A;  4XC2 A;  3S2A A;  4KDI C;  2KWC A;  1E8X A;  2I1K A;  3PHX B;  2DAF A;  2LJ5 A;  1UBQ A;  2V4L A;  1UEL A;  1GC7 A;  2CKH B;  2G3Q B;  3TCA A;  1I35 A;  4PS3 A;  4GDK A;  4HVB A;  2DHZ A;  1S1Q B;  4KDL B;  5CHF A;  4TUU A;  1UH6 A;  2LUE A;  1IPG A;  2CHW A;  4OVV A;  1WGG A;  2DAJ A;  1WY8 A;  3CST A;  4K7U A;  3ZUN A;  3CSF A;  4NY0 A;  3SHQ A;  2KN5 A;  2A5U A;  4NPN A;  2IO1 B;  3HM3 A;  1OEY J;  4W9I A;  3NZU A;  2FIF A;  3W1S C;  3A9K A;  4EEW A;  2AL3 A;  2BF8 B;  2DZM A;  3ALB A;  1V86 A;  3KUC B;  4G3X B;  5DPT A;  2BYF A;  3D32 A;  4AP4 C;  1KJT A;  2FCN A;  2AL6 A;  4K7W A;  3X0W A;  3H1U A;  4DHJ B;  1WMH B;  1WXV A;  3H9D A;  2LVP A;  3HM6 X;  4W9C A;  1Q5W B;  3PLU A;  3RZW C;  3SU8 X;  4GOC A;  3APF A;  3L0W B;  3LDZ E;  5BO4 B;  4HK2 A;  1MG8 A;  2MWS B;  2GBJ A;  1KOT A;  4KIK B;  2D10 A;  4CO7 A;  3A33 B;  1AAR A;  3V6E B;  1YIW A;  1UBI A;  3ZRF A;  2RR9 A;  3W1S A;  2KNB A;  2MBO A;  2EMS A;  2I1J A;  1ISN A;  2K39 A;  2WX1 A;  3QAQ A;  4KSL C;  2MP2 A;  1E8W A;  2MW5 A;  4ZDV A;  2ZVN A;  2DYM A;  5AZH A;  4WAA A;  2VRR B;  2K6Q A;  3L08 A;  4JL9 A;  2N9E B;  1V80 A;  4AUQ C;  2WYQ A;  2GBN A;  2AEH A;  4IM2 A;  2JPH A;  3PTF C;  2KX0 A;  2PEA A;  4A3O A;  1WGY A;  1GUA B;  3UIN B;  3ZNI D;  3DVN V;  2EKE C;  4WQO B;  2ZJD A;  4WWP A;  1YX6 B;  1WRD B;  2KHW B;  3NS8 A;  1LFD A;  4WJN A;  4I6N B;  4FHK A;  5DPR A;  2LVQ A;  3PSE B;  4JIO U;  3T9L A;  2LD9 A;  4G50 A;  1Q1O A;  5CTR C;  3VTW A;  3Q3F A;  1EUV B;  3GOE A;  4FN2 A;  1V6E A;  2ZEQ A;  4NJ7 A;  1C3T A;  3VFK A;  4ANU A;  3M95 A;  3TMP B;  1V5O A;  2V3S A;  1WX9 A;  5L95 C;  4FAD A;  1YX5 B;  4K81 A;  3TBL D;  3UIP B;  3BY4 B;  3UQB A;  2JZ3 B;  2FID A;  3H7P A;  1WXM A;  2KX3 A;  3M62 B;  2MCN B;  3V6C B;  5G2N A;  2LRU A;  1A5R A;  1T0Y A;  5D6J B;  3AXC A;  4IC7 B;  3KYC D;  4W9D A;  5C23 A;  4MJS B;  4G11 A;  1XQQ A;  4HJK A;  4WJQ A;  5E6P A;  4BBN F;  2D07 B;  1OQY A;  2JUO A;  3VQI A;  1YD8 U;  2IZV B;  2KMA A;  2PE6 B;  4DDG D;  4AJY B;  3ZKJ C;  1E5W A;  1EF5 A;  4ZRJ A;  1WXA A;  2R2O A;  4MH0 E;  1WIA A;  2J0K A;  2KTR B;  3H7S A;  4NAW B;  3ZDT A;  2JZZ A;  4JLC A;  5JHA A;  2KTF A;  1NDD A;  5C1Z A;  1TGZ B;  4P7I A;  3APC A;  4MEM A;  2ASQ A;  1V81 A;  3ML9 A;  1L2N A;  1WH3 A;  1V9J A;  4CYE A;  3QQ8 B;  2NR2 A;  5D94 A;  1PQS A;  3DBL I;  1S3S G;  3QCA A;  1TZ1 A;  3V60 A;  1E8Z A;  2GBM A;  4TV3 A;  3U7D A;  2JXX A;  3SDL C;  1RFA A;  4GDL B;  2O6V A;  4GGQ A;  5G55 A;  3PS6 A;  2LGY A;  2MBH A;  5LXI B;  2N7D A;  2O2V A;  3QHT A;  1L7Y A;  1ZW7 A;  2MP2 B;  4MSQ B;  4ASW C;  2WWZ A;  3AU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...