2JVCA

Nmr solution structure of ubiquitin like protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
82
Chain Sequence
b'GPLGSMQIFVKTLTGKTITIDVDHADTVGAVKAKIYDKEGIPPDQQRLIFGGKQLEDSNAMSDYNVQKESTLHLVLRLRGGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin_like protein
publication title NMR solution structure of ubiquitin like protein
rcsb
molecule tags Unknown function
total genus 11
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jvcA00
2RD0A 1E7VA 3ENEA 3L0WB 1WXSA 3HHMA 2DZJA 4KDLB 4I6LB 4FHJA 5J2RA 4EZJA 3R66C 3UIPB 3T9LA 1UELA 3I3TB 5IA7A 1EUVB 2KZRA 2LD9A 3WIMA 2FCMA 2A5UA 2NBWB 4W9EA 2KOXA 2CR5A 4AWJA 3L54A 4PS3A 1LFDA 2KQSA 4FN2A 2G3QB 4MGYE 3W1SA 3L08A 3ONSA 2MX2A 4ZDVA 4MJSA 3WA0A 3QQ8B 1PQSA 4J6IA 5DPWA 3ZUNA 2AL6A 2GBJA 1RLFA 1V9JA 2LGYA 3DBRI 3DVNV 2ZZPB 3R3MA 1X1MA 3CSFA 5D2MB 3M3JA 4M0WB 1WJNA 1HE8A 2KTRA 3RCZA 1VCBA 2BGFA 2BYEA 2MLBA 4JL9A 3SDLC 1WXMA 3VH3B 3DVGY 3A1QA 5C23A 4KIKA 5C1ZA 1IYFA 2N4FA 1OQYA 5CHVC 2L76A 2FCSA 2K1FA 1IP9A 3GOEA 3RYTA 2RSUA 4NY0A 3QWZB 1E90A 3JSVA 1L2NA 4GB9A 1V80A 2KX3A 3QARA 2JRHA 3HK0A 5KHQA 2O6VA 2KFKB 3H7PB 3UINB 3RZFA 2BYVE 3Q3JA 3VUXA 2FIDA 3VHTC 2BF8B 3TIXA 2NS5A 3UGBB 4DDGD 3PHWB 2HE7A 4ICUA 1WX9A 1WMHB 2DYBA 2FCQA 3VQIA 2K39A 4WJOA 1EF5A 2MBHA 4BVUC 2LXAA 2ZNVB 2L0FA 4URKA 3V60A 4YL8A 5HKHA 5L83A 1UBQA 1V81A 5LXHA 3JVZX 4HVBA 2C7MB 2NVUI 3H6NA 1WX7A 2FNJB 3KUZA 2LUEA 2BYFA 4W9JA 4IWPA 4MGIE 2JUOA 1UZXB 2ZCCA 3OJ4B 4RM9A 4W9DA 5GMVA 4MM3A 1UH6A 2KHWB 2JF5A 3ZIMA 3AU5A 1QZEA 2N1WA 1WM2A 3NS8A 2LVPA 4OVVA 1ZGUB 2KWUB 2C9WB 2MBOA 3LDZE 4GOCA 3UIOB 1P3QU 4HDOA 4WJPA 2MBQA 1G6JA 1D3ZA 2KWCA 1JRUA 3RZWC 2WYQA 2G4SA 3PHXB 4XX5A 1WJUA 2WWZA 2ZVOA 2BPSA 3C0RB 2R2QA 4IUMB 4MJSB 1E8XA 5D94A 4P7IA 1EO6A 2M1MA 4WQOB 4MELA 3RT3B 2HTHA 1V5TA 1A5RA 1SE9A 3ML8A 4G50A 1KOTA 2PPHA 4GSWA 2CHWA 2WX0A 1E8ZA 2L0TA 5KHOA 3VDZA 3X0WA 3CMMB 2KTRB 5D6JB 2C7NB 2PEAA 2M4NA 4FJZA 2XK5A 1AARA 3UQAA 3ZKJC 1P0RA 1WIAA 1S3SG 2EMTA 2N1VA 3A1QB 4KIKB 5D7GA 4LCDE 1NDDA 2KO3A 2KFKA 3H7PA 2J0JA 4DWFA 3QK0A 2LASA 2IY1B 3GZNI 4GN1A 4NNJB 3A33B 3VUWA 3PSEB 2OJRA 3JSVB 3ZNGC 3DBSA 2XEWA 3DBHI 3A4SC 2AEHA 1WMHA 4ASWC 2AL3A 2O6VB 4HCPB 3APCA 1GC7A 3CSTA 3VAWA 2CS4A 3DPDA 1YQBA 1L7YA 2LVOA 2MWSB 3PVLA 4ICVA 3ZLZA 3AXCA 2LRWA 2ZPYA 4HK2A 3DOWA 3NOBA 1WFYA 5DPRA 5EDSA 2KD0A 2YVCA 5G2NA 2V4LA 2G45B 1ZW7A 4AJWA 2LXCA 2J0KA 5LXIB 1V6EA 2L00B 3P2BA 3ZRCA 3K9PB 4DK5A 5E6PA 3BINA 1YX6B 3ZNZB 3PS6A 2KKCA 3HM6X 4HPLB 3U7DA 2N7DA 3IFWB 3ZNID 1OEYA 2D10A 3KUCB 5CHFA 3U8ZA 1E8WA 4IWOA 4JIOU 2LWPA 3UF8A 4HDQA 4W9KA 1SGHA 4NPNA 3PT2B 4JGHB 3ZDMC 2DHZA 2CHZA 4ZRJA 1H4RA 1GJZA 2KJ6A 4B9KA 1WZ3A 2KK8A 3A9KB 2MBEA 4MGKE 4AOFA 3VXWA 2GBRA 4I6PA 3KH0A 2JZ3B 3HM3A 1LQBA 4W9FA 1KM7A 4WJQA 3WANA 4BOSC 3OAWA 2ZVNA 3PRPB 3S2AA 4TV3A 4IM2A 2AWTA 4GMVA 1WRDB 1NI2A 4LDTB 4BBNF 2FIFA 1WGDA 3PV1A 3R7QA 2DYOA 2KMCA 4HLEA 1IPGA 5J18A 4IC7B 3N32A 1R4MI 3EHVA 3ZO5B 1RFAA 1T0YA 3KUDB 4BBNC 2XK5B 4F8CB 4FBJB 4WWNA 4BKGA 1I35A 2NCNA 1TGZB 5LLIA 4W9HA 1EF1A 1F9JA 3RD2A 2MP2A 3IHPC 5IAAC 2D3GA 3EECA 2JZZA 4IM3A 3PPAA 3Q3FA 4EFOA 3QJZA 3VTVA 4PS7A 1GNUA 4OVUA 1I42A 4ZRKA 3ECIA 2DAFA 4K7SA 1R4NI 4TKNA 4EUTA 4NAWA 3KYDD 2UYZB 2DZKA 4B6WA 2O2VB 4XC2A 2DENB 2NBVB 3AULA 3MHSD 2L3ZA 2L7RA 2RPQA 2BWFA 4DHZE 2IO2B 1P1AA 5L95C 5G55A 2O6VD 4W9CA 2DZMA 3NY5A 1WYWB 4EKUA 2EKEC 4A20A 2RGFA 3EFUA 3A9KA 4MGZE 5CTRC 1KLVA 2GBNA 3MTNB 1V49A 3QA8A 3V62A 5AEKB 2KJRA 2K6DB 4TUUA 2IO3B 1E5WA 3DVGX 2M17A 4CO7A 2JY6A 3H7SA 3PLVA 4HXDA 1Z5SB 5AZFA 3V6EB 4PYZA 2YLMA 4GDLB 4WAAA 1WR6E 2MQJA 1P98A 4G3XB 3ZW3A 2C5LC 3AU4A 2NPTA 3B08A 3VFKA 3ZRFA 4F1SA 4MSQB 3QHTA 4BOZB 1J0GA 1TZ1A 4BFRA 1WGGA 2IYDB 4B95A 4XZ4A 3W1SC 1GUAB 2LGXA 2K6QA 2L8JA 1RRBA 3VTWA 1NBFC 2WX1A 3KYCD 4FA6A 4HCNB 4DDID 1XQQA 2I1JA 2JT4B 1WXVA 2LZ6A 4AJYB 4DHZB 4G11A 2Z0DB 1OTRB 4EEWA 3PRMB 3WAOA 2IZVB 2HD5B 1XD3B 3PZDA 1GC6A 4IM0A 4JLCA 4FHKA 3EC8A 3M62B 4MEMA 2ZEQA 3A4RA 3L10B 3L16A 2MP2B 4LDTD 5TR5A 2GMIC 2LJ5A 3B1LX 5BO4B 3WAPA 1WXAA 3ZTDA 4DXAB 2UWQA 3ZTCA 3DBLI 2O2VA 5J17A 3A9JA 4AUQC 2K25A 2KDBA 2OOBB 1WF9A 4KV2A 2ZPNA 4HPMB 4KSLC 4ZRIA 3ZNHB 4NAWB 1C3TA 2KC1A 3V6CB 1Y8RC 4W9IA 3K9OB 3H9DA 3NZUA 3QX1A 4RMAA 4TQ0A 3HIZA 2ASQA 4ZYNA 2RR9A 2NBUA 3OLMD 3PTFC 4N9F4 3TBLD 3ML9A 3WALA 4AP4C 5JHAA 1WR1A 1WJ4A 5AZHA 2V3SA 1V2YA 2JWZA 4EZLA 1FXTB 2KLCA 4BKSA 4II2B 3QIJA 1ZKHA 4WWPA 2MW5A 4PS8A 5DCNA 3PLUA 1WM3A 2NR2A 3N3KB 3RUIB 3DCGA 4K81A 2KJHB 2KXJA 1LM8B 4GDLA 2MSED 3VTUA 2D2QA 4IW0A 2GBKA 3L13A 1OEYJ 4HJKA 2LI5A 2V1YA 3ZDTA 2N7EA 3VVWB 3KVFB 5AZGA 2KX0A 4EZKA 1YJ1A 4CHKA 2AYOB 2N9XA 4FULA 3QC8B 1Z2MA 4NQLB 3B0AA 2PE6B 3APFA 4NJ7A 1BT0A 2KMAA 4NJ6A 5CHWA 3NHEB 2CU1A 3VH4B 1ISNA 2NPTB 3APDA 2MBBB 4M8NA 3CF6E 4DHJB 4FLHA 4BKSD 2FAZA 2XBBC 3X23A 2QHOA 3TJPA 3H1UA 1UD7A 3L17A 2KDEB 4IWQA 2BKFA 2JXXA 4TQ1A 1WY8A 4ANVA 1Q1OA 3D32A 1WX8A 2FCNA 3KW5B 4G0NB 2MA9B 1E7UA 1OGWA 2FUHB 2J0MA 4W9LA 3SHQA 5JZEB 4CYEA 2C7HA 2WDTB 1WGRA 4E74A 2KFJA 2A4ZA 3DQVA 2M8SA 4RM8A 3DVNU 3DDCB 3PGEA 4K7UA 4GIVA 4BKTA 2KDIA 3VUYA 1Q5WB 1S1QB 3A9JB 2M0XA 1YD8U 1YIWA 1J8CA 4I6NB 2JPHA 2KDFB 4KSKC 3TL5A 3U30A 2Y5BB 3QAQA 4WWOA 4GU2A 1V5OA 2KC2A 4X57B 4KDIC 4KVGB 1WE7A 2ZNVC 4WJNA 4E71A 2IO0B 2IY0B 4II3B 2I1KA 2KVRA 3JW0X 4MSMB 3IVFA 3O65B 2MRPA 4LJOB 4A3PA 4MH0E 2K8BA 2MCNB 1WGYA 3JYUA 1KJTA 2Z0EB 3AI5A 4GDKB 2KN5A 4ANWA 4KZ0A 2DYMA 1UGMA 1WH3A 4A3OA 1WI0A 4E3CA 4FADA 1VD2A 4GXBA 1WZ0A 3SD5A 1TTNA 4PYUA 2G4DB 3QCAA 2REXA 5DPSA 2DAJA 2ZCBA 2W9NA 2GOWA 3LJ3A 3V61A 4GGQA 4F7ZA 2D11A 3TCAA 1TBEA 5E6NA 4NQKE 3ZVVA 3MJWA 2KTFA 4FJVB 3W1YA 2Z59B 2CKHB 4MDKE 2VRRB 1J19A 3OJ3A 2IO1B 3SU8X 1UBIA 5CX3A 2R2OA 2KANA 4JQWC 2EMSA 2PJHA 1K8RB 3IBEA 2JVCA 3M63B 1GG3A 1U4AA 3TMPB 5JHBA 2ZJDA 1LXDA 3BY4B 1MG8A 1Q0WB 4DBGA 2KQ7A 2JRIB 2N9EB 2HJ8A 5E6OA 1C1YB 2K8HA 1P9DU 2KLGA 2DZIA 1XT9B 2D07B 2GBMA 2LRUA 2KWVB 1WGHA 3PRZA 4HWIB 2CHXA 4FJYA 5JH5C 1H8CA 2PE9A 3WAMA 2J7QB 4K7WA 4DHJD 3UQBA 4LJPB 4IG7B 4M8MA 3R7RA 1WJ6A 1CMXB 2BKRB 4K1RB 4ANUA 1RAXA 2N9PC 1WE6A 3IG3A 1M94A 4KZCA 3RULA 1V86A 3ALBA 1YX5B 2IBIB 3N30A 4EOYA 5FR6A 3T8MA 5DPTA 4ANXA 4GDKA 4W9GA 2L05A 2DX5B 3PREA 1SIFA 3M95A 2LVQA 2K8CA 2C60A 3NZSA 2BWES 2KNBA 1E8YA 2LGDA 2B3AA
chains in the Genus database with same CATH superfamily
4N59A 1F52A 1E7VA 3HHMA 3T3NA 4KDLB 4I6LB 1UELA 1EUVB 5H92C 2KQSA 3MHZA 3L08A 1L0YB 2LFIA 1PQSA 2G9HD 2YEPF 3DBRI 3R3MA 1X1MA 3CSFA 1L0VB 2NMQA 3E56A 2V3PA 3SDLC 5C1ZA 3A1QA 5CHVC 5GXGB 3LYYA 3RYTA 2RSUA 4NY0A 1L2NA 4GB9A 3AM9A 3U4EG 3HK0A 2V9HA 4RGNA 2KFKB 5KHQA 3MC8A 3RZFA 3Q3JA 1KLUD 3VUXA 2FIDA 3TIXA 1I4XA 2KAJA 2FCQA 4OZBA 1I4GA 2N9LA 4JWUC 3P4PB 3V60A 4YL8A 5HKHA 1TKGA 5LXHA 1XO3A 2L83A 2V0GA 4HVBA 4S17A 4IDIA 4W9JA 4IWPA 5IP4D 3MJ5A 3AEAB 1UH6A 2KHWB 1FCCC 3GP7A 1K51A 1V1PB 1ZGUB 2MBOA 3GE8C 4LNFA 2H88B 2M0AA 1G6JA 2KWCA 1UWXA 2WYQA 2X8XX 1MPEA 2BPSA 2LJIA 1FNUA 1V5TA 1ZUD2 4G50A 4GSWA 2CHWA 3VDZA 1EU3A 2KTRB 2JX5A 2PEAA 1ZXIA 5JXVA 1P0RA 4N58A 2KFKA 2LASA 3GZNI 1QF6A 1HA5A 3JSVB 3PSEB 2WLBA 4HRSA 3A4SC 3TEZA 4ASWC 2O6VB 4HCPB 3APCA 1AW7A 3ZLZA 2LRWA 3RNFC 3DOWA 3NOBA 2KD0A 2YVCA 4ZHPA 2V4LA 4AJWA 3BZDB 4C56C 1UNSA 2KQ4X 1ACCA 3K9PB 1C78A 2WGSA 3BINA 1ZPSA 3ZNZB 5G5GA 1GB4A 3I9V1 3NJTA 4EE2A 2N7DA 2VZKD 2KVZA 3V3XA 4DQOC 1SBBB 2LWPA 3ZQ4A 4A8XC 2GRIA 3R2IA 2CHZA 3BVGA 2KK8A 3A9KB 4AOFA 2GBRA 4GLSC 2ON8A 3WANA 1YNTE 2ZW0A 3R7QA 1L0XB 2DYOA 1XLOA 3N32A 1RFAA 1K53A 2XK5B 1VLBA 2GLSA 4YXDB 3RD2A 3NS1A 2D3GA 1PUTA 3RI7C 2Y3AA 2JYEA 4OVUA 2K3UA 4ZRKA 3TEWA 4MT5A 2DAFA 3KYDD 5BYRA 2UYZB 2DZKA 1F2RC 2PIAA 4B6WA 2O2VB 2WDRB 3DWMA 4KGTA 1QLBB 2BWFA 3AE1B 2IO2B 5G55A 3NY5A 1WYWB 1ET9A 3AE5B 4EKUA 4MACA 4A20A 4KX6B 2RGFA 3EFUA 1JW9D 1JQ4A 3A9KA 4MGZE 2GBNA 1MHHE 3WCQA 2KJRA 4TUUA 5C2TB 1D4BA 2M17A 2JY6A 3H7SA 4HXDA 4IKGA 4PYZA 4GDLB 1C79A 1VJKA 3PZ7A 2NPTA 3VFKA 3ZRFA 4MSQB 4BOZB 1TZ1A 3P4RB 3W1SC 3AEBB 3N1ZC 2BBCA 3KYCD 4OZCA 1SB3C 4DDID 2H89B 1L4DB 2WXKA 2LZ6A 3ZGZA 2OHFA 2IDYA 4NJCA 2HD5B 1GC6A 4H2AA 4DXGA 1QQRA 4LDTD 2MP2B 1PFDA 3WAPA 1WXAA 2UWQA 3DBLI 2O2VA 1VZ8A 2PVGC 4KV2A 1B9RA 5BYQA 1C3TA 4JPSA 2FE8A 3NZUA 4TQ0A 2ASQA 4N9F4 1V1OA 1CQVA 1FCLA 3RFZB 5G5HA 3QIJA 1IGCA 3PLUA 3DCGA 1BXTA 3Q3MC 2KJHB 2QJLA 2QCZA 4GDLA 3V05A 2GBKA 3VVWB 3KVFB 5AZGA 1AWDA 1YJ1A 2Z8LA 4CHKA 2AYOB 4JX1C 1FRDA 2AQ2B 4NJ7A 4NJ6A 3VH4B 3CF6E 1VDVA 4BKSD 2KWDA 2K9XA 2Y5PA 4CQNA 4IWQA 2JXXA 2WU2B 4TQ1A 4A90A 1OQRA 4ANVA 2BVCA 1WX8A 1C4CA 4WH4A 3EGRA 3KW5B 1E6EB 1T3QA 2MA9B 1OGWA 4KKIA 4W9LA 5FKAC 2ONQA 3SHQA 3LB8C 3NZ3A 1JMLA 1C4AA 4TSSA 1WGRA 3Q8BA 1DYQA 2KFJA 4OW0A 1T0SC 4RM8A 3DDCB 4K7UA 4GIVA 4BKTA 3A9JB 4LNNA 5FK9C 1YIWA 1J8CA 1HZ6A 1KTKA 3TL5A 3AE4B 1V5OA 2KC2A 4X57B 4WJNA 4II3B 1FFUA 3JW0X 4MSMB 2J4XA 3AEDB 2K8BA 1WGYA 3JYUA 2DWQA 2J53A 2Z0EB 3AI5A 3NVWA 1Y56A 4ANWA 3N9YC 4E3CA 1WI0A 4FADA 1VD2A 1FM0D 1C77A 3B2FA 4WAFA 2ZCBA 1PGBA 3LJ3A 4GGQA 4F7ZA 2D11A 1J7AA 3MJWA 3W1YA 4FJVB 1WYGA 2Z59B 2IO1B 1FMAD 5CX3A 1R4MB 4OZAA 4YTMB 4JQWC 2PJHA 2WU5B 2WXLA 1K8RB 3ETRA 4XWWA 2BS4B 2HJ8A 2KLGA 2DZIA 2D07B 2KWVB 4LK0M 4HWIB 2CHXA 4FJYA 3AE8B 1PGXA 4LJPB 1CMXB 1SXTA 1KRHA 2K5PA 4NZLB 2N9PC 2LGIA 1V86A 1YX5B 2IBIB 5EE3A 3T8MA 3SFEB 2DX5B 1SIFA 2ZW1A 2LGDA 1E8YA 2B3AA 3ENEA 3Q2AC 4BAXA 3R66C 4P6VF 1FRRA 1BMLC 5AUIA 5IA7A 3WIMA 4WURA 2WDQB 1ZXHA 2CR5A 3L54A 4PS3A 4FN2A 4MGYE 3AE9B 3W1SA 3TUOA 4MJSA 1I4QA 1F0ZA 1DOYA 3ZUNA 2GBJA 4HROA 3Q3OC 3M3JA 1XLQA 4YSZB 2BYEA 2WXQA 1WXMA 3VH3B 3DVGY 1TY0A 2N4FA 1OQYA 2L76A 1ENFA 2LMCA 3Q3NC 3QWZB 2KX3A 3H7PB 3BK2A 3HVZA 2ACZB 1K50A 2VZKB 5EE0A 3I5JC 2BF8B 3UGBB 2HE7A 4ICUA 1WX9A 2XNAC 3BYTB 2K39A 4O1NA 4WJOA 2MBHA 2INCC 5D3DA 3Q14C 4URKA 1TKYA 3JVZX 2V3NA 5HG2A 3H6NA 4KGRA 2FNJB 2BYFA 3T3OA 1SF0A 4MGIE 3U52E 1SEBD 2R61A 2ZCCA 4RM9A 1OFFA 3ZIMA 3AV8A 3AU5A 1QZEA 3R2TA 3NS8A 1L5PA 3LDZE 3UIOB 1P3QU 4WJPA 1N5XA 1D3ZA 3RZWC 2RMMA 1UWMA 3J9CA 2M1MA 3IT6B 3RT3B 2HTHA 1NYRA 2WX0A 3CMMB 5D6JB 2C7NB 3VRAB 3ZKJC 5D7GA 2EMTA 3A1QB 4LCDE 4REZA 3H7PA 3DHHC 3QK0A 4NNJB 3A33B 2OJRA 3ZNGC 3DBSA 2XEWA 1R4NB 4RGOS 1GAQB 2AEHA 1NYQA 3CSTA 2MJ3A 2RDBC 1L7YA 2LVOA 4WWMA 4L1BA 2AX5A 3AXCA 1D5XC 4HK2A 4ZOHC 3DHIC 5DPRA 1E10A 2LXCA 5LXIB 1V6EA 3ZRCA 4DK5A 2CJNA 4K3BA 1TKEA 1YX6B 1SJHD 2QILA 3PS6A 3W5VB 4JE3B 2QEJC 3L4PA 1OEYA 3KUCB 5CHFA 3U8ZA 4IWOA 1MVKA 3UF8A 3PT2B 3ZXVA 3ZDMC 2DHZA 1H4RA 2KJ6A 4B9KA 4MGKE 3VXWA 1RWSA 1KM7A 3NRZA 4WJQA 3S2AA 1F1HA 4IM2A 1I4HA 4LDTB 3P4SB 4BBNF 2HDEA 2YEPB 5IO9A 4IC7B 1ZOYB 3EHVA 4A6QA 3NUHB 2MHJA 4FBJB 4WWNA 4BKGA 2NCNA 2KYWA 2RDGA 4C7ZA 5LLIA 4W9HA 1EF1A 2INDC 1TIFA 5IAAC 3PPAA 3AE7B 4EFOA 1FFVA 4PS7A 1WGKA 2WXFA 2PLPA 2J52A 3RNCC 1NI3A 3BYYB 4XC2A 3TEXA 3MHSD 3HVDA 3VR9B 5L95C 3GS2A 2SEBD 4W9CA 2HTME 5CTRC 3RN9C 1KLVA 1I7HA 1ZP0B 1V49A 1YJIA 3QA8A 5AEKB 2IO3B 1E5WA 2K0PA 3DVGX 3B2GA 3KQ4A 1YN4A 2VH1A 1R7SA 2RPVA 3DBRB 1P98A 1N62A 3ZW3A 3B08A 3CWIA 4BFRA 1WGGA 4XDCA 2L8JA 1RRBA 2M56B 2JZPA 1XQQA 3MP9A 1WXVA 3NVZA 1IUEA 2Z0DB 3U2SC 5I4DA 2IZVB 4JLCA 4IM0A 4FHKA 2PKOA 4MEMA 2BT6A 2ZEQA 5TR5A 2GMIC 2UU7A 3ZJUA 4A55A 2WNMA 4DXAB 4XWTA 3B9JA 5J17A 4OHJA 3FC4A 1LO5D 3FKYA 4HPMB 4KSLC 1JWMD 2KC1A 1Y8RC 3N20C 3QX1A 4RCOA 1FXAA 2NBUA 4AP4C 1JROA 5JHAA 3TEYA 2W3SA 3AH7A 2V3SA 2JWZA 4EZLA 4BKSA 3H8HA 1ZKHA 4D2KA 4PS8A 5DCNA 3HRDD 1WM3A 5C3JB 3RUIB 4K81A 3MC0B 3VTUA 1MFWA 4HJKA 3ZDTA 4EZKA 2JU6X 3QC8B 1Z2MA 3IT4B 3AECB 5CHWA 2CU1A 1ZDVA 2NPTB 3APDA 2IGDA 2MBBB 4M8NA 5IOIA 1EU4A 3TJPA 3H1UA 2BKFA 2PMVA 1T0RC 4B0EA 5HHDG 1FPYA 5BMHA 4OVZA 1E7UA 2FUHB 4P16A 2RDHA 2A4ZA 1WWTA 1Q10A 1RFKA 3DQVA 5BMGA 5LNK1 3IAS1 2QIEB 3PGEA 1FNWA 1S1QB 2KDFB 2QC8A 4KSKC 3QAQA 4S0RA 4WWOA 4GU2A 1WE7A 2N9KA 2ZNVC 1N5WA 3IVFA 4A3PA 2WXRA 1TZOA 2TSSA 4GDKB 3IAM1 1UGMA 4ARCA 4A3OA 1TTNA 3QCAA 2L52A 2GOWA 2WXMA 3TCAA 4NQKE 4US8A 2KTFA 3RMKC 4MDKE 1J19A 3OJ3A 4USAA 1V8CA 1UGJA 2KANA 2KN4A 3M63B 1GG3A 3RNGC 1MG8A 4ARIA 5E6OA 2LRUA 3PRZA 4DHJD 3WAMA 4K7WA 1TS3A 3UQBA 1EWCA 3R7RA 4K1RB 1WRIA 1JWUD 3IG3A 1ESFA 3W9CB 4KZCA 3RULA 3AEGB 4EOYA 5DPTA 1RM6C 4GDKA 2L05A 3PREA 1NENB 5T8IA 1SE4A 2K8CA 2BS3B 1DOIA 2BWES 2RD0A 3GE3C 1WXSA 3L0WB 2DZJA 5J2RA 1TT5B 3T9LA 3BVMA 2KZRA 2A5UA 2KOXA 4AWJA 1C9FA 3SEBA 1LFDA 2PTLA 2G3QB 3ONSA 4ZDVA 3WA0A 5H8YE 4J6IA 2W55A 2AL6A 1RLFA 1V9JA 2LGYA 3DVNV 2ICIA 2INPE 5D2MB 4M0WB 2BGFA 2XN9C 4JL9A 2I38A 4AS1A 4KIKA 2DLBA 2WXNA 3DBHB 4HKZE 1IP9A 4IOIE 3GOEA 1E90A 2N0SB 4A9AA 3QARA 1QOBA 4HPPA 1YOVB 3DBLB 2BYVE 1I4RA 3VHTC 4YWGG 4DDGD 1WMHB 3AE3B 1C4PA 2LXAA 2ZNVB 5FR3A 1T5XD 5L83A 1FD6A 1V81A 2N7JA 2V4IB 1B1ZA 3RPFC 2C7MB 4HEA1 2NVUI 1WX7A 2W3RA 1KF6B 2LUEA 3KUZA 1SE3A 1D5MC 2JUOA 5IN7A 1UZXB 4MM3A 3I63C 1QOAA 1XLPA 1WM2A 3W5UB 2LVPA 4OVVA 4GOCA 2J42A 2MBQA 1JRUA 4M0WA 4XX5A 2B76B 3Q69A 2WWZA 2ZVOA 3C0RB 2R2QA 4IUMB 3OWEB 4MJSB 1L6UA 4WQOB 1EO6A 4MELA 1SE9A 2IGHA 4P1CC 2PPHA 2FBWB 3Q8FA 4N6EB 2L0TA 5KHOA 3X0WA 3LXFA 2M4NA 1AARA 2WQYB 2LHEA 1NDDA 1D5ZC 1HQRD 4ZYSA 1FXIA 2BB6A 4GN1A 2LGSA 1VZ7A 1WMHA 1HZ5A 1XXGA 2AL3A 4RH6A 2MWSB 1XF5L 2ZPYA 4QAYA 4RF0A 1HXYD 3RNBC 5G2NA 2J0KA 3P2BA 2GI9A 2WDVB 5E6PA 3CIRB 3HM6X 3IFWB 3ZNID 3FILB 1E8WA 1DGJA 1FNVA 4W9KA 1SGHA 1KH0A 1IBXA 4JGHB 1GJZA 1KLGD 4I6PA 2LEKA 2JZ3B 4W9FA 2IGGA 2ZVNA 3PRPB 3FAHA 1NI2A 3PZ8A 1NVID 1STEA 1IPGA 5J18A 4BZAA 4KGSA 1T0YA 3KUDB 4BBNC 4F8CB 1TGZB 3IHPC 4MH8A 2D3AA 3Q3FA 2KMMA 3DWGC 1E9MA 3QJZA 3SFDB 1N60A 1GNUA 4XDDA 1I42A 3ECIA 5IKCM 1R4NI 4TKNA 4NAWA 1SSNA 4PK1A 1A70A 2W82A 1JRPA 2L3ZA 2L7RA 4DHZE 3FILA 1SE2A 2DZMA 2EKEC 3I57A 4ZRPA 1SJED 1XCQL 3V62A 1KFYB 2YLMA 2L1AA 2AQ1B 4WQMA 3AU4A 4F1SA 3P1MA 1J0GA 3SR6A 3GB1A 2WHIA 3AE2B 4XZ4A 1NBFC 2WX1A 3AMZA 1GOZA 4FA6A 4HCNB 1CJEA 4XGAB 2I1JA 1OTRB 4EEWA 4L23A 2LUMA 3PZDA 2QMTA 1MHXA 2MEKA 3M62B 4YT0B 3RNEC 3A4RA 3L16A 2LJ5A 3B1LX 1C76A 5BO4B 3ZTDA 4YSYB 4C7YA 4AUQC 2K25A 2KDBA 3P4QB 1WF9A 2ZPNA 3V6CB 3K9OB 3H9DA 5BYSA 3HIZA 4ZYNA 2RR9A 3TBLD 4YSXB 1WR1A 1WJ4A 5AZHA 1V2YA 1FXTB 2CJOA 2KLCA 4II2B 2MW5A 2HJ1A 4US9A 3N1XC 3N3KB 3AE6B 4P1BC 2G1EA 4Q2JA 4IW0A 1MI0A 1OEYJ 2LI5A 2KX0A 3BK1A 4FULA 4NQLB 3B0AA 4C4VB 1BT0A 2KMAA 2OEDA 4DHJB 4FLHA 3MFGA 1I4PA 3KWLA 1UD7A 1DOXA 2KDEB 1WY8A 3AEEB 2FCNA 5TSSA 2J0MA 4CYEA 3KWVA 3EUB2 2PVOD 4E74A 4M02A 2DNFA 5EE1A 4UDUC 4ZHOA 2KDIA 3VUYA 3P63A 1YD8U 4I6NB 2BW2A 1JWBD 3U30A 2NTTA 3ZXRA 4KVGB 2IO0B 2KVRA 2I2YA 1YN3A 3EA6A 1GPXA 2MRPA 4LJOB 3ZJTA 1TS5A 2KN5A 4LTUA 2DYMA 5HI1A 4GXBA 4C4VA 4ITKA 4PYUA 2WS3B 5DPSA 1LGRA 2MJEA 2DAJA 2BS2B 2W9NA 3V61A 1N63A 5E6NA 1XCTL 3C8YA 2KACA 2VRRB 1QOGA 1ZE3D 2R2OA 2EMSA 2PW9A 1UUPA 3IBEA 1IGDA 1U4AA 5JHBA 2ZJDA 1LXDA 3BY4B 1Q0WB 2KQ7A 2JRIB 3ZYYX 4ZRQA 2N9EB 2KT7A 1YN5A 1P9DU 2GBMA 1XT9B 1E0ZA 1WGHA 1H8CA 2PE9A 2J7QB 1BUIC 4M8MA 1SIJA 1QILA 1RAXA 3VRBB 3ALBA 3N30A 5FR6A 4RFBA 3NVYA 2LVQA 2MH7A 3NZSA 1NEKB 2INNE 2JWUA 1TYGB 4FHJA 4EZJA 3UIPB 1V1PA 3I3TB 2LD9A 2FCMA 3Q8EA 4LNIA 2NBWB 4W9EA 1HEZE 1MJDA 3KLSX 2MX2A 2GB1A 1FIQA 1HTQA 3QQ8B 5DPWA 1PGAA 4RGTA 2ZZPB 1VZ6A 1WJNA 1HE8A 2KTRA 3RCZA 1VCBA 3GZNB 2MLBA 1IYFA 5C23A 4TMAB 2BB5A 4KKJA 2FCSA 2K1FA 3AN1A 2DBYA 3JSVA 1JWSD 2WXIA 1V80A 1RYJA 1K52A 2JRHA 2O6VA 3UINB 3AEFB 2NTSA 2W54A 4RGMA 2LHDA 2NS5A 1P7EA 3PHWB 3VQIA 2DYBA 1EF5A 1CK1A 4BVUC 5E6JA 2L0FA 3P42A 1UBQA 3BWUD 3Q8CA 2E6XA 1N61A 3OJ4B 4W9DA 3TSSA 5GMVA 3HUIA 2JF5A 4DXFA 1ZDXA 2N1WA 1J7CA 2KWUB 2C9WB 3PO0A 1L4ZB 2BQQA 4HDOA 3URYA 2G4SA 3PHXB 1WJUA 2WXGA 1E8XA 5D94A 1YMHE 1YQ3B 4P7IA 1AN8A 4C80A 1A5RA 3ML8A 4PT5A 1KOTA 1TS2A 1TJEA 1E8ZA 1E7PB 4FJZA 2XK5A 3UQAA 1WIAA 1S3SG 2N1VA 4KIKB 1XLNA 2KO3A 4ACFA 2J0JA 4DWFA 4RNAA 2IY1B 3VUWA 3DBHI 3O13A 1GC7A 3VAWA 2CS4A 3DPDA 1YQBA 3PVLA 4ICVA 1WFYA 5EDSA 2G45B 1ZW7A 1F2RI 1QT9A 5MPOA 2L00B 2BYTA 2KKCA 4HPLB 3U7DA 2D10A 3UI3A 4JIOU 3E9SA 4HDQA 4MM3B 4NPNA 2QSDA 4ZRJA 2JQRB 1V97A 1WZ3A 2OJWA 2MBEA 2KDMA 3KH0A 3HM3A 1LQBA 4NAMA 4BOSC 3OAWA 4TV3A 2D3CA 2AWTA 4GMVA 1WRDB 4R3DA 2FIFA 2FUG1 1WGDA 3PV1A 4XE0A 2KMCA 4HLEA 2WP9B 1R4MI 3ZO5B 1I35A 4B0MA 4M00A 1F9JA 2MP2A 1JWAD 1PDXA 4YTNB 3EECA 4IM3A 2JZZA 1L6VA 3VTVA 3C19A 1WSPA 4K7SA 4EUTA 4L2YA 2WXOA 4HKQA 2BTEA 2Y5CA 2DENB 2NBVB 3AULA 2RPQA 4C00A 1WXQA 1P1AA 4JWSC 2O6VD 4LNKA 2EELA 1YJJA 5HFYA 3NVVA 1T0QC 1F77A 3MTNB 2K6DB 1IBXB 4CO7A 3VR8B 2WXPA 3PLVA 5AZFA 1Z5SB 3V6EB 1T6BX 4FXCA 1UF0A 4WAAA 1WR6E 2MQJA 4G3XB 2C5LC 4M01A 3QHTA 3N1YC 1VR9A 2IYDB 4B95A 1GUAB 2LGXA 2K6QA 3VTWA 4J3OD 1EWYC 2JT4B 3W2DA 4AJYB 4DHZB 4G11A 2Q5WD 5AUKA 3PRMB 3WAOA 2X38A 1XD3B 4WIPA 2D3BA 3EC8A 1XEEA 3BIID 4LLGM 3L10B 4AQ7A 3ZTCA 3A9JA 2OOBB 4ZRIA 4YTPB 3ZNHB 4NAWB 4W9IA 2MJDA 2QDFA 4RMAA 1GB1A 3OLMD 3PTFC 3ML9A 3WALA 2K22A 1M4VA 2JSVX 3MC9A 1AYFA 4WWPA 3DHGC 2NR2A 3Q8AA 2KXJA 1LM8B 2MSED 1FO4A 2D2QA 3L13A 2V1YA 2N7EA 3OG5A 5D3IB 1JCKB 2N9XA 5EE9A 2PE6B 3APFA 3NHEB 1ISNA 1P7FA 1ET6A 3NG0A 2WXHA 2FAZA 1TS4A 1HTOA 2XBBC 3X23A 2QHOA 3L17A 2L32A 1TY2A 1Q1OA 3D32A 4LNOA 4HJGE 1CZPA 4G0NB 2IPKD 5JZEB 2D5GA 2C7HA 1JALA 2WDTB 2M8SA 3DVNU 1EM7A 1OQQA 1PYWD 2CU3A 3ABVB 1D6EC 1Q5WB 2M0XA 2E3TA 3Q6BA 2JPHA 2Y5BB 4KDIC 4E71A 2IY0B 2I1KA 1ROEA 1QOFA 3O65B 4MH0E 2MCNB 1KJTA 2JXTA 4KZ0A 1WH3A 3R8BA 1WZ0A 3SD5A 5BMIA 3EFCA 2G4DB 2REXA 2AQ3B 3ZVVA 1TBEA 2CKHB 2JYTA 3RNAC 3SU8X 1UBIA 2WXJA 2EKIA 3ZJVA 1QKZA 2JVCA 3BVZA 3TMPB 4K3CA 4DBGA 1FEHA 1C1YB 2SAKA 2K8HA 1YQ4B 5JH5C 3U7ZA 4IG7B 1MG4A 1VRAB 1WJ6A 2BKRB 1N6ZA 4XYCA 4ANUA 1WE6A 1M94A 3AB5A 1J7BA 2VH2A 4RF1A 4ANXA 4W9GA 2M19A 3M95A 2C60A 2IJ0A 2KNBA 3IXSA
chains in the Genus database with same CATH topology
2RD0A 1E7VA 3ENEA 3L0WB 1WXSA 3HHMA 2DZJA 4KDLB 4I6LB 4FHJA 5J2RA 4EZJA 3R66C 3UIPB 3T9LA 1UELA 3I3TB 5IA7A 1EUVB 2KZRA 2LD9A 3WIMA 2FCMA 2A5UA 2NBWB 4W9EA 2KOXA 2CR5A 4AWJA 3L54A 4PS3A 1LFDA 2KQSA 4FN2A 2G3QB 4MGYE 3W1SA 3L08A 3ONSA 2MX2A 4ZDVA 4MJSA 3WA0A 3QQ8B 1PQSA 4J6IA 5DPWA 3ZUNA 2AL6A 2GBJA 1RLFA 1V9JA 2LGYA 3DBRI 3DVNV 2ZZPB 3R3MA 1X1MA 3CSFA 5D2MB 3M3JA 4M0WB 1WJNA 1HE8A 2KTRA 3RCZA 1VCBA 2BGFA 2BYEA 2MLBA 4JL9A 3SDLC 1WXMA 3VH3B 3DVGY 3A1QA 5C23A 4KIKA 5C1ZA 1IYFA 2N4FA 1OQYA 5CHVC 2L76A 2FCSA 2K1FA 1IP9A 3GOEA 3RYTA 2RSUA 4NY0A 3QWZB 1E90A 3JSVA 1L2NA 4GB9A 1V80A 2KX3A 3QARA 2JRHA 3HK0A 5KHQA 2O6VA 2KFKB 3H7PB 3UINB 3RZFA 2BYVE 3Q3JA 3VUXA 2FIDA 3VHTC 2BF8B 3TIXA 2NS5A 3UGBB 4DDGD 3PHWB 2HE7A 4ICUA 1WX9A 1WMHB 2DYBA 2FCQA 3VQIA 2K39A 4WJOA 1EF5A 2MBHA 4BVUC 2LXAA 2ZNVB 2L0FA 4URKA 3V60A 4YL8A 5HKHA 5L83A 1UBQA 1V81A 5LXHA 3JVZX 4HVBA 2C7MB 2NVUI 3H6NA 1WX7A 2FNJB 3KUZA 2LUEA 2BYFA 4W9JA 4IWPA 4MGIE 2JUOA 1UZXB 2ZCCA 3OJ4B 4RM9A 4W9DA 5GMVA 4MM3A 1UH6A 2KHWB 2JF5A 3ZIMA 3AU5A 1QZEA 2N1WA 1WM2A 3NS8A 2LVPA 4OVVA 1ZGUB 2KWUB 2C9WB 2MBOA 3LDZE 4GOCA 3UIOB 1P3QU 4HDOA 4WJPA 2MBQA 1G6JA 1D3ZA 2KWCA 1JRUA 3RZWC 2WYQA 2G4SA 3PHXB 4XX5A 1WJUA 2WWZA 2ZVOA 2BPSA 3C0RB 2R2QA 4IUMB 4MJSB 1E8XA 5D94A 4P7IA 1EO6A 2M1MA 4WQOB 4MELA 3RT3B 2HTHA 1V5TA 1A5RA 1SE9A 3ML8A 4G50A 1KOTA 2PPHA 4GSWA 2CHWA 2WX0A 1E8ZA 2L0TA 5KHOA 3VDZA 3X0WA 3CMMB 2KTRB 5D6JB 2C7NB 2PEAA 2M4NA 4FJZA 2XK5A 1AARA 3UQAA 3ZKJC 1P0RA 1WIAA 1S3SG 2EMTA 2N1VA 3A1QB 4KIKB 5D7GA 4LCDE 1NDDA 2KO3A 2KFKA 3H7PA 2J0JA 4DWFA 3QK0A 2LASA 2IY1B 3GZNI 4GN1A 4NNJB 3A33B 3VUWA 3PSEB 2OJRA 3JSVB 3ZNGC 3DBSA 2XEWA 3DBHI 3A4SC 2AEHA 1WMHA 4ASWC 2AL3A 2O6VB 4HCPB 3APCA 1GC7A 3CSTA 3VAWA 2CS4A 3DPDA 1YQBA 1L7YA 2LVOA 2MWSB 3PVLA 4ICVA 3ZLZA 3AXCA 2LRWA 2ZPYA 4HK2A 3DOWA 3NOBA 1WFYA 5DPRA 5EDSA 2KD0A 2YVCA 5G2NA 2V4LA 2G45B 1ZW7A 4AJWA 2LXCA 2J0KA 5LXIB 1V6EA 2L00B 3P2BA 3ZRCA 3K9PB 4DK5A 5E6PA 3BINA 1YX6B 3ZNZB 3PS6A 2KKCA 3HM6X 4HPLB 3U7DA 2N7DA 3IFWB 3ZNID 1OEYA 2D10A 3KUCB 5CHFA 3U8ZA 1E8WA 4IWOA 4JIOU 2LWPA 3UF8A 4HDQA 4W9KA 1SGHA 4NPNA 3PT2B 4JGHB 3ZDMC 2DHZA 2CHZA 4ZRJA 1H4RA 1GJZA 2KJ6A 4B9KA 1WZ3A 2KK8A 3A9KB 2MBEA 4MGKE 4AOFA 3VXWA 2GBRA 4I6PA 3KH0A 2JZ3B 3HM3A 1LQBA 4W9FA 1KM7A 4WJQA 3WANA 4BOSC 3OAWA 2ZVNA 3PRPB 3S2AA 4TV3A 4IM2A 2AWTA 4GMVA 1WRDB 1NI2A 4LDTB 4BBNF 2FIFA 1WGDA 3PV1A 3R7QA 2DYOA 2KMCA 4HLEA 1IPGA 5J18A 4IC7B 3N32A 1R4MI 3EHVA 3ZO5B 1RFAA 1T0YA 3KUDB 4BBNC 2XK5B 4F8CB 4FBJB 4WWNA 4BKGA 1I35A 2NCNA 1TGZB 5LLIA 4W9HA 1EF1A 1F9JA 3RD2A 2MP2A 3IHPC 5IAAC 2D3GA 3EECA 2JZZA 4IM3A 3PPAA 3Q3FA 4EFOA 3QJZA 3VTVA 4PS7A 1GNUA 4OVUA 1I42A 4ZRKA 3ECIA 2DAFA 4K7SA 1R4NI 4TKNA 4EUTA 4NAWA 3KYDD 2UYZB 2DZKA 4B6WA 2O2VB 4XC2A 2DENB 2NBVB 3AULA 3MHSD 2L3ZA 2L7RA 2RPQA 2BWFA 4DHZE 2IO2B 1P1AA 5L95C 5G55A 2O6VD 4W9CA 2DZMA 3NY5A 1WYWB 4EKUA 2EKEC 4A20A 2RGFA 3EFUA 3A9KA 4MGZE 5CTRC 1KLVA 2GBNA 3MTNB 1V49A 3QA8A 3V62A 5AEKB 2KJRA 2K6DB 4TUUA 2IO3B 1E5WA 3DVGX 2M17A 4CO7A 2JY6A 3H7SA 3PLVA 4HXDA 1Z5SB 5AZFA 3V6EB 4PYZA 2YLMA 4GDLB 4WAAA 1WR6E 2MQJA 1P98A 4G3XB 3ZW3A 2C5LC 3AU4A 2NPTA 3B08A 3VFKA 3ZRFA 4F1SA 4MSQB 3QHTA 4BOZB 1J0GA 1TZ1A 4BFRA 1WGGA 2IYDB 4B95A 4XZ4A 3W1SC 1GUAB 2LGXA 2K6QA 2L8JA 1RRBA 3VTWA 1NBFC 2WX1A 3KYCD 4FA6A 4HCNB 4DDID 1XQQA 2I1JA 2JT4B 1WXVA 2LZ6A 4AJYB 4DHZB 4G11A 2Z0DB 1OTRB 4EEWA 3PRMB 3WAOA 2IZVB 2HD5B 1XD3B 3PZDA 1GC6A 4IM0A 4JLCA 4FHKA 3EC8A 3M62B 4MEMA 2ZEQA 3A4RA 3L10B 3L16A 2MP2B 4LDTD 5TR5A 2GMIC 2LJ5A 3B1LX 5BO4B 3WAPA 1WXAA 3ZTDA 4DXAB 2UWQA 3ZTCA 3DBLI 2O2VA 5J17A 3A9JA 4AUQC 2K25A 2KDBA 2OOBB 1WF9A 4KV2A 2ZPNA 4HPMB 4KSLC 4ZRIA 3ZNHB 4NAWB 1C3TA 2KC1A 3V6CB 1Y8RC 4W9IA 3K9OB 3H9DA 3NZUA 3QX1A 4RMAA 4TQ0A 3HIZA 2ASQA 4ZYNA 2RR9A 2NBUA 3OLMD 3PTFC 4N9F4 3TBLD 3ML9A 3WALA 4AP4C 5JHAA 1WR1A 1WJ4A 5AZHA 2V3SA 1V2YA 2JWZA 4EZLA 1FXTB 2KLCA 4BKSA 4II2B 3QIJA 1ZKHA 4WWPA 2MW5A 4PS8A 5DCNA 3PLUA 1WM3A 2NR2A 3N3KB 3RUIB 3DCGA 4K81A 2KJHB 2KXJA 1LM8B 4GDLA 2MSED 3VTUA 2D2QA 4IW0A 2GBKA 3L13A 1OEYJ 4HJKA 2LI5A 2V1YA 3ZDTA 2N7EA 3VVWB 3KVFB 5AZGA 2KX0A 4EZKA 1YJ1A 4CHKA 2AYOB 2N9XA 4FULA 3QC8B 1Z2MA 4NQLB 3B0AA 2PE6B 3APFA 4NJ7A 1BT0A 2KMAA 4NJ6A 5CHWA 3NHEB 2CU1A 3VH4B 1ISNA 2NPTB 3APDA 2MBBB 4M8NA 3CF6E 4DHJB 4FLHA 4BKSD 2FAZA 2XBBC 3X23A 2QHOA 3TJPA 3H1UA 1UD7A 3L17A 2KDEB 4IWQA 2BKFA 2JXXA 4TQ1A 1WY8A 4ANVA 1Q1OA 3D32A 1WX8A 2FCNA 3KW5B 4G0NB 2MA9B 1E7UA 1OGWA 2FUHB 2J0MA 4W9LA 3SHQA 5JZEB 4CYEA 2C7HA 2WDTB 1WGRA 4E74A 2KFJA 2A4ZA 3DQVA 2M8SA 4RM8A 3DVNU 3DDCB 3PGEA 4K7UA 4GIVA 4BKTA 2KDIA 3VUYA 1Q5WB 1S1QB 3A9JB 2M0XA 1YD8U 1YIWA 1J8CA 4I6NB 2JPHA 2KDFB 4KSKC 3TL5A 3U30A 2Y5BB 3QAQA 4WWOA 4GU2A 1V5OA 2KC2A 4X57B 4KDIC 4KVGB 1WE7A 2ZNVC 4WJNA 4E71A 2IO0B 2IY0B 4II3B 2I1KA 2KVRA 3JW0X 4MSMB 3IVFA 3O65B 2MRPA 4LJOB 4A3PA 4MH0E 2K8BA 2MCNB 1WGYA 3JYUA 1KJTA 2Z0EB 3AI5A 4GDKB 2KN5A 4ANWA 4KZ0A 2DYMA 1UGMA 1WH3A 4A3OA 1WI0A 4E3CA 4FADA 1VD2A 4GXBA 1WZ0A 3SD5A 1TTNA 4PYUA 2G4DB 3QCAA 2REXA 5DPSA 2DAJA 2ZCBA 2W9NA 2GOWA 3LJ3A 3V61A 4GGQA 4F7ZA 2D11A 3TCAA 1TBEA 5E6NA 4NQKE 3ZVVA 3MJWA 2KTFA 4FJVB 3W1YA 2Z59B 2CKHB 4MDKE 2VRRB 1J19A 3OJ3A 2IO1B 3SU8X 1UBIA 5CX3A 2R2OA 2KANA 4JQWC 2EMSA 2PJHA 1K8RB 3IBEA 2JVCA 3M63B 1GG3A 1U4AA 3TMPB 5JHBA 2ZJDA 1LXDA 3BY4B 1MG8A 1Q0WB 4DBGA 2KQ7A 2JRIB 2N9EB 2HJ8A 5E6OA 1C1YB 2K8HA 1P9DU 2KLGA 2DZIA 1XT9B 2D07B 2GBMA 2LRUA 2KWVB 1WGHA 3PRZA 4HWIB 2CHXA 4FJYA 5JH5C 1H8CA 2PE9A 3WAMA 2J7QB 4K7WA 4DHJD 3UQBA 4LJPB 4IG7B 4M8MA 3R7RA 1WJ6A 1CMXB 2BKRB 4K1RB 4ANUA 1RAXA 2N9PC 1WE6A 3IG3A 1M94A 4KZCA 3RULA 1V86A 3ALBA 1YX5B 2IBIB 3N30A 4EOYA 5FR6A 3T8MA 5DPTA 4ANXA 4GDKA 4W9GA 2L05A 2DX5B 3PREA 1SIFA 3M95A 2LVQA 2K8CA 2C60A 3NZSA 2BWES 2KNBA 1E8YA 2LGDA 2B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RD0 A;  1E7V A;  3ENE A;  3L0W B;  1WXS A;  3HHM A;  2DZJ A;  4KDL B;  4I6L B;  4FHJ A;  5J2R A;  4EZJ A;  3R66 C;  3UIP B;  3T9L A;  1UEL A;  3I3T B;  5IA7 A;  1EUV B;  2KZR A;  2LD9 A;  3WIM A;  2FCM A;  2A5U A;  2NBW B;  4W9E A;  2KOX A;  2CR5 A;  4AWJ A;  3L54 A;  4PS3 A;  1LFD A;  2KQS A;  4FN2 A;  2G3Q B;  4MGY E;  3W1S A;  3L08 A;  3ONS A;  2MX2 A;  4ZDV A;  4MJS A;  3WA0 A;  3QQ8 B;  1PQS A;  4J6I A;  5DPW A;  3ZUN A;  2AL6 A;  2GBJ A;  1RLF A;  1V9J A;  2LGY A;  3DBR I;  3DVN V;  2ZZP B;  3R3M A;  1X1M A;  3CSF A;  5D2M B;  3M3J A;  4M0W B;  1WJN A;  1HE8 A;  2KTR A;  3RCZ A;  1VCB A;  2BGF A;  2BYE A;  2MLB A;  4JL9 A;  3SDL C;  1WXM A;  3VH3 B;  3DVG Y;  3A1Q A;  5C23 A;  4KIK A;  5C1Z A;  1IYF A;  2N4F A;  1OQY A;  5CHV C;  2L76 A;  2FCS A;  2K1F A;  1IP9 A;  3GOE A;  3RYT A;  2RSU A;  4NY0 A;  3QWZ B;  1E90 A;  3JSV A;  1L2N A;  4GB9 A;  1V80 A;  2KX3 A;  3QAR A;  2JRH A;  3HK0 A;  5KHQ A;  2O6V A;  2KFK B;  3H7P B;  3UIN B;  3RZF A;  2BYV E;  3Q3J A;  3VUX A;  2FID A;  3VHT C;  2BF8 B;  3TIX A;  2NS5 A;  3UGB B;  4DDG D;  3PHW B;  2HE7 A;  4ICU A;  1WX9 A;  1WMH B;  2DYB A;  2FCQ A;  3VQI A;  2K39 A;  4WJO A;  1EF5 A;  2MBH A;  4BVU C;  2LXA A;  2ZNV B;  2L0F A;  4URK A;  3V60 A;  4YL8 A;  5HKH A;  5L83 A;  1UBQ A;  1V81 A;  5LXH A;  3JVZ X;  4HVB A;  2C7M B;  2NVU I;  3H6N A;  1WX7 A;  2FNJ B;  3KUZ A;  2LUE A;  2BYF A;  4W9J A;  4IWP A;  4MGI E;  2JUO A;  1UZX B;  2ZCC A;  3OJ4 B;  4RM9 A;  4W9D A;  5GMV A;  4MM3 A;  1UH6 A;  2KHW B;  2JF5 A;  3ZIM A;  3AU5 A;  1QZE A;  2N1W A;  1WM2 A;  3NS8 A;  2LVP A;  4OVV A;  1ZGU B;  2KWU B;  2C9W B;  2MBO A;  3LDZ E;  4GOC A;  3UIO B;  1P3Q U;  4HDO A;  4WJP A;  2MBQ A;  1G6J A;  1D3Z A;  2KWC A;  1JRU A;  3RZW C;  2WYQ A;  2G4S A;  3PHX B;  4XX5 A;  1WJU A;  2WWZ A;  2ZVO A;  2BPS A;  3C0R B;  2R2Q A;  4IUM B;  4MJS B;  1E8X A;  5D94 A;  4P7I A;  1EO6 A;  2M1M A;  4WQO B;  4MEL A;  3RT3 B;  2HTH A;  1V5T A;  1A5R A;  1SE9 A;  3ML8 A;  4G50 A;  1KOT A;  2PPH A;  4GSW A;  2CHW A;  2WX0 A;  1E8Z A;  2L0T A;  5KHO A;  3VDZ A;  3X0W A;  3CMM B;  2KTR B;  5D6J B;  2C7N B;  2PEA A;  2M4N A;  4FJZ A;  2XK5 A;  1AAR A;  3UQA A;  3ZKJ C;  1P0R A;  1WIA A;  1S3S G;  2EMT A;  2N1V A;  3A1Q B;  4KIK B;  5D7G A;  4LCD E;  1NDD A;  2KO3 A;  2KFK A;  3H7P A;  2J0J A;  4DWF A;  3QK0 A;  2LAS A;  2IY1 B;  3GZN I;  4GN1 A;  4NNJ B;  3A33 B;  3VUW A;  3PSE B;  2OJR A;  3JSV B;  3ZNG C;  3DBS A;  2XEW A;  3DBH I;  3A4S C;  2AEH A;  1WMH A;  4ASW C;  2AL3 A;  2O6V B;  4HCP B;  3APC A;  1GC7 A;  3CST A;  3VAW A;  2CS4 A;  3DPD A;  1YQB A;  1L7Y A;  2LVO A;  2MWS B;  3PVL A;  4ICV A;  3ZLZ A;  3AXC A;  2LRW A;  2ZPY A;  4HK2 A;  3DOW A;  3NOB A;  1WFY A;  5DPR A;  5EDS A;  2KD0 A;  2YVC A;  5G2N A;  2V4L A;  2G45 B;  1ZW7 A;  4AJW A;  2LXC A;  2J0K A;  5LXI B;  1V6E A;  2L00 B;  3P2B A;  3ZRC A;  3K9P B;  4DK5 A;  5E6P A;  3BIN A;  1YX6 B;  3ZNZ B;  3PS6 A;  2KKC A;  3HM6 X;  4HPL B;  3U7D A;  2N7D A;  3IFW B;  3ZNI D;  1OEY A;  2D10 A;  3KUC B;  5CHF A;  3U8Z A;  1E8W A;  4IWO A;  4JIO U;  2LWP A;  3UF8 A;  4HDQ A;  4W9K A;  1SGH A;  4NPN A;  3PT2 B;  4JGH B;  3ZDM C;  2DHZ A;  2CHZ A;  4ZRJ A;  1H4R A;  1GJZ A;  2KJ6 A;  4B9K A;  1WZ3 A;  2KK8 A;  3A9K B;  2MBE A;  4MGK E;  4AOF A;  3VXW A;  2GBR A;  4I6P A;  3KH0 A;  2JZ3 B;  3HM3 A;  1LQB A;  4W9F A;  1KM7 A;  4WJQ A;  3WAN A;  4BOS C;  3OAW A;  2ZVN A;  3PRP B;  3S2A A;  4TV3 A;  4IM2 A;  2AWT A;  4GMV A;  1WRD B;  1NI2 A;  4LDT B;  4BBN F;  2FIF A;  1WGD A;  3PV1 A;  3R7Q A;  2DYO A;  2KMC A;  4HLE A;  1IPG A;  5J18 A;  4IC7 B;  3N32 A;  1R4M I;  3EHV A;  3ZO5 B;  1RFA A;  1T0Y A;  3KUD B;  4BBN C;  2XK5 B;  4F8C B;  4FBJ B;  4WWN A;  4BKG A;  1I35 A;  2NCN A;  1TGZ B;  5LLI A;  4W9H A;  1EF1 A;  1F9J A;  3RD2 A;  2MP2 A;  3IHP C;  5IAA C;  2D3G A;  3EEC A;  2JZZ A;  4IM3 A;  3PPA A;  3Q3F A;  4EFO A;  3QJZ A;  3VTV A;  4PS7 A;  1GNU A;  4OVU A;  1I42 A;  4ZRK A;  3ECI A;  2DAF A;  4K7S A;  1R4N I;  4TKN A;  4EUT A;  4NAW A;  3KYD D;  2UYZ B;  2DZK A;  4B6W A;  2O2V B;  4XC2 A;  2DEN B;  2NBV B;  3AUL A;  3MHS D;  2L3Z A;  2L7R A;  2RPQ A;  2BWF A;  4DHZ E;  2IO2 B;  1P1A A;  5L95 C;  5G55 A;  2O6V D;  4W9C A;  2DZM A;  3NY5 A;  1WYW B;  4EKU A;  2EKE C;  4A20 A;  2RGF A;  3EFU A;  3A9K A;  4MGZ E;  5CTR C;  1KLV A;  2GBN A;  3MTN B;  1V49 A;  3QA8 A;  3V62 A;  5AEK B;  2KJR A;  2K6D B;  4TUU A;  2IO3 B;  1E5W A;  3DVG X;  2M17 A;  4CO7 A;  2JY6 A;  3H7S A;  3PLV A;  4HXD A;  1Z5S B;  5AZF A;  3V6E B;  4PYZ A;  2YLM A;  4GDL B;  4WAA A;  1WR6 E;  2MQJ A;  1P98 A;  4G3X B;  3ZW3 A;  2C5L C;  3AU4 A;  2NPT A;  3B08 A;  3VFK A;  3ZRF A;  4F1S A;  4MSQ B;  3QHT A;  4BOZ B;  1J0G A;  1TZ1 A;  4BFR A;  1WGG A;  2IYD B;  4B95 A;  4XZ4 A;  3W1S C;  1GUA B;  2LGX A;  2K6Q A;  2L8J A;  1RRB A;  3VTW A;  1NBF C;  2WX1 A;  3KYC D;  4FA6 A;  4HCN B;  4DDI D;  1XQQ A;  2I1J A;  2JT4 B;  1WXV A;  2LZ6 A;  4AJY B;  4DHZ B;  4G11 A;  2Z0D B;  1OTR B;  4EEW A;  3PRM B;  3WAO A;  2IZV B;  2HD5 B;  1XD3 B;  3PZD A;  1GC6 A;  4IM0 A;  4JLC A;  4FHK A;  3EC8 A;  3M62 B;  4MEM A;  2ZEQ A;  3A4R A;  3L10 B;  3L16 A;  2MP2 B;  4LDT D;  5TR5 A;  2GMI C;  2LJ5 A;  3B1L X;  5BO4 B;  3WAP A;  1WXA A;  3ZTD A;  4DXA B;  2UWQ A;  3ZTC A;  3DBL I;  2O2V A;  5J17 A;  3A9J A;  4AUQ C;  2K25 A;  2KDB A;  2OOB B;  1WF9 A;  4KV2 A;  2ZPN A;  4HPM B;  4KSL C;  4ZRI A;  3ZNH B;  4NAW B;  1C3T A;  2KC1 A;  3V6C B;  1Y8R C;  4W9I A;  3K9O B;  3H9D A;  3NZU A;  3QX1 A;  4RMA A;  4TQ0 A;  3HIZ A;  2ASQ A;  4ZYN A;  2RR9 A;  2NBU A;  3OLM D;  3PTF C;  4N9F 4;  3TBL D;  3ML9 A;  3WAL A;  4AP4 C;  5JHA A;  1WR1 A;  1WJ4 A;  5AZH A;  2V3S A;  1V2Y A;  2JWZ A;  4EZL A;  1FXT B;  2KLC A;  4BKS A;  4II2 B;  3QIJ A;  1ZKH A;  4WWP A;  2MW5 A;  4PS8 A;  5DCN A;  3PLU A;  1WM3 A;  2NR2 A;  3N3K B;  3RUI B;  3DCG A;  4K81 A;  2KJH B;  2KXJ A;  1LM8 B;  4GDL A;  2MSE D;  3VTU A;  2D2Q A;  4IW0 A;  2GBK A;  3L13 A;  1OEY J;  4HJK A;  2LI5 A;  2V1Y A;  3ZDT A;  2N7E A;  3VVW B;  3KVF B;  5AZG A;  2KX0 A;  4EZK A;  1YJ1 A;  4CHK A;  2AYO B;  2N9X A;  4FUL A;  3QC8 B;  1Z2M A;  4NQL B;  3B0A A;  2PE6 B;  3APF A;  4NJ7 A;  1BT0 A;  2KMA A;  4NJ6 A;  5CHW A;  3NHE B;  2CU1 A;  3VH4 B;  1ISN A;  2NPT B;  3APD A;  2MBB B;  4M8N A;  3CF6 E;  4DHJ B;  4FLH A;  4BKS D;  2FAZ A;  2XBB C;  3X23 A;  2QHO A;  3TJP A;  3H1U A;  1UD7 A;  3L17 A;  2KDE B;  4IWQ A;  2BKF A;  2JXX A;  4TQ1 A;  1WY8 A;  4ANV A;  1Q1O A;  3D32 A;  1WX8 A;  2FCN A;  3KW5 B;  4G0N B;  2MA9 B;  1E7U A;  1OGW A;  2FUH B;  2J0M A;  4W9L A;  3SHQ A;  5JZE B;  4CYE A;  2C7H A;  2WDT B;  1WGR A;  4E74 A;  2KFJ A;  2A4Z A;  3DQV A;  2M8S A;  4RM8 A;  3DVN U;  3DDC B;  3PGE A;  4K7U A;  4GIV A;  4BKT A;  2KDI A;  3VUY A;  1Q5W B;  1S1Q B;  3A9J B;  2M0X A;  1YD8 U;  1YIW A;  1J8C A;  4I6N B;  2JPH A;  2KDF B;  4KSK C;  3TL5 A;  3U30 A;  2Y5B B;  3QAQ A;  4WWO A;  4GU2 A;  1V5O A;  2KC2 A;  4X57 B;  4KDI C;  4KVG B;  1WE7 A;  2ZNV C;  4WJN A;  4E71 A;  2IO0 B;  2IY0 B;  4II3 B;  2I1K A;  2KVR A;  3JW0 X;  4MSM B;  3IVF A;  3O65 B;  2MRP A;  4LJO B;  4A3P A;  4MH0 E;  2K8B A;  2MCN B;  1WGY A;  3JYU A;  1KJT A;  2Z0E B;  3AI5 A;  4GDK B;  2KN5 A;  4ANW A;  4KZ0 A;  2DYM A;  1UGM A;  1WH3 A;  4A3O A;  1WI0 A;  4E3C A;  4FAD A;  1VD2 A;  4GXB A;  1WZ0 A;  3SD5 A;  1TTN A;  4PYU A;  2G4D B;  3QCA A;  2REX A;  5DPS A;  2DAJ A;  2ZCB A;  2W9N A;  2GOW A;  3LJ3 A;  3V61 A;  4GGQ A;  4F7Z A;  2D11 A;  3TCA A;  1TBE A;  5E6N A;  4NQK E;  3ZVV A;  3MJW A;  2KTF A;  4FJV B;  3W1Y A;  2Z59 B;  2CKH B;  4MDK E;  2VRR B;  1J19 A;  3OJ3 A;  2IO1 B;  3SU8 X;  1UBI A;  5CX3 A;  2R2O A;  2KAN A;  4JQW C;  2EMS A;  2PJH A;  1K8R B;  3IBE A;  2JVC A;  3M63 B;  1GG3 A;  1U4A A;  3TMP B;  5JHB A;  2ZJD A;  1LXD A;  3BY4 B;  1MG8 A;  1Q0W B;  4DBG A;  2KQ7 A;  2JRI B;  2N9E B;  2HJ8 A;  5E6O A;  1C1Y B;  2K8H A;  1P9D U;  2KLG A;  2DZI A;  1XT9 B;  2D07 B;  2GBM A;  2LRU A;  2KWV B;  1WGH A;  3PRZ A;  4HWI B;  2CHX A;  4FJY A;  5JH5 C;  1H8C A;  2PE9 A;  3WAM A;  2J7Q B;  4K7W A;  4DHJ D;  3UQB A;  4LJP B;  4IG7 B;  4M8M A;  3R7R A;  1WJ6 A;  1CMX B;  2BKR B;  4K1R B;  4ANU A;  1RAX A;  2N9P C;  1WE6 A;  3IG3 A;  1M94 A;  4KZC A;  3RUL A;  1V86 A;  3ALB A;  1YX5 B;  2IBI B;  3N30 A;  4EOY A;  5FR6 A;  3T8M A;  5DPT A;  4ANX A;  4GDK A;  4W9G A;  2L05 A;  2DX5 B;  3PRE A;  1SIF A;  3M95 A;  2LVQ A;  2K8C A;  2C60 A;  3NZS A;  2BWE S;  2KNB A;  1E8Y A;  2LGD A;  2B3A A; 
#chains in the Genus database with same CATH topology
 4N59 A;  1F52 A;  1E7V A;  3HHM A;  3T3N A;  4KDL B;  4I6L B;  1UEL A;  1EUV B;  5H92 C;  2KQS A;  3MHZ A;  3L08 A;  1L0Y B;  2LFI A;  1PQS A;  2G9H D;  2YEP F;  3DBR I;  3R3M A;  1X1M A;  3CSF A;  1L0V B;  2NMQ A;  3E56 A;  2V3P A;  3SDL C;  5C1Z A;  3A1Q A;  5CHV C;  5GXG B;  3LYY A;  3RYT A;  2RSU A;  4NY0 A;  1L2N A;  4GB9 A;  3AM9 A;  3U4E G;  3HK0 A;  2V9H A;  4RGN A;  2KFK B;  5KHQ A;  3MC8 A;  3RZF A;  3Q3J A;  1KLU D;  3VUX A;  2FID A;  3TIX A;  1I4X A;  2KAJ A;  2FCQ A;  4OZB A;  1I4G A;  2N9L A;  4JWU C;  3P4P B;  3V60 A;  4YL8 A;  5HKH A;  1TKG A;  5LXH A;  1XO3 A;  2L83 A;  2V0G A;  4HVB A;  4S17 A;  4IDI A;  4W9J A;  4IWP A;  5IP4 D;  3MJ5 A;  3AEA B;  1UH6 A;  2KHW B;  1FCC C;  3GP7 A;  1K51 A;  1V1P B;  1ZGU B;  2MBO A;  3GE8 C;  4LNF A;  2H88 B;  2M0A A;  1G6J A;  2KWC A;  1UWX A;  2WYQ A;  2X8X X;  1MPE A;  2BPS A;  2LJI A;  1FNU A;  1V5T A;  1ZUD 2;  4G50 A;  4GSW A;  2CHW A;  3VDZ A;  1EU3 A;  2KTR B;  2JX5 A;  2PEA A;  1ZXI A;  5JXV A;  1P0R A;  4N58 A;  2KFK A;  2LAS A;  3GZN I;  1QF6 A;  1HA5 A;  3JSV B;  3PSE B;  2WLB A;  4HRS A;  3A4S C;  3TEZ A;  4ASW C;  2O6V B;  4HCP B;  3APC A;  1AW7 A;  3ZLZ A;  2LRW A;  3RNF C;  3DOW A;  3NOB A;  2KD0 A;  2YVC A;  4ZHP A;  2V4L A;  4AJW A;  3BZD B;  4C56 C;  1UNS A;  2KQ4 X;  1ACC A;  3K9P B;  1C78 A;  2WGS A;  3BIN A;  1ZPS A;  3ZNZ B;  5G5G A;  1GB4 A;  3I9V 1;  3NJT A;  4EE2 A;  2N7D A;  2VZK D;  2KVZ A;  3V3X A;  4DQO C;  1SBB B;  2LWP A;  3ZQ4 A;  4A8X C;  2GRI A;  3R2I A;  2CHZ A;  3BVG A;  2KK8 A;  3A9K B;  4AOF A;  2GBR A;  4GLS C;  2ON8 A;  3WAN A;  1YNT E;  2ZW0 A;  3R7Q A;  1L0X B;  2DYO A;  1XLO A;  3N32 A;  1RFA A;  1K53 A;  2XK5 B;  1VLB A;  2GLS A;  4YXD B;  3RD2 A;  3NS1 A;  2D3G A;  1PUT A;  3RI7 C;  2Y3A A;  2JYE A;  4OVU A;  2K3U A;  4ZRK A;  3TEW A;  4MT5 A;  2DAF A;  3KYD D;  5BYR A;  2UYZ B;  2DZK A;  1F2R C;  2PIA A;  4B6W A;  2O2V B;  2WDR B;  3DWM A;  4KGT A;  1QLB B;  2BWF A;  3AE1 B;  2IO2 B;  5G55 A;  3NY5 A;  1WYW B;  1ET9 A;  3AE5 B;  4EKU A;  4MAC A;  4A20 A;  4KX6 B;  2RGF A;  3EFU A;  1JW9 D;  1JQ4 A;  3A9K A;  4MGZ E;  2GBN A;  1MHH E;  3WCQ A;  2KJR A;  4TUU A;  5C2T B;  1D4B A;  2M17 A;  2JY6 A;  3H7S A;  4HXD A;  4IKG A;  4PYZ A;  4GDL B;  1C79 A;  1VJK A;  3PZ7 A;  2NPT A;  3VFK A;  3ZRF A;  4MSQ B;  4BOZ B;  1TZ1 A;  3P4R B;  3W1S C;  3AEB B;  3N1Z C;  2BBC A;  3KYC D;  4OZC A;  1SB3 C;  4DDI D;  2H89 B;  1L4D B;  2WXK A;  2LZ6 A;  3ZGZ A;  2OHF A;  2IDY A;  4NJC A;  2HD5 B;  1GC6 A;  4H2A A;  4DXG A;  1QQR A;  4LDT D;  2MP2 B;  1PFD A;  3WAP A;  1WXA A;  2UWQ A;  3DBL I;  2O2V A;  1VZ8 A;  2PVG C;  4KV2 A;  1B9R A;  5BYQ A;  1C3T A;  4JPS A;  2FE8 A;  3NZU A;  4TQ0 A;  2ASQ A;  4N9F 4;  1V1O A;  1CQV A;  1FCL A;  3RFZ B;  5G5H A;  3QIJ A;  1IGC A;  3PLU A;  3DCG A;  1BXT A;  3Q3M C;  2KJH B;  2QJL A;  2QCZ A;  4GDL A;  3V05 A;  2GBK A;  3VVW B;  3KVF B;  5AZG A;  1AWD A;  1YJ1 A;  2Z8L A;  4CHK A;  2AYO B;  4JX1 C;  1FRD A;  2AQ2 B;  4NJ7 A;  4NJ6 A;  3VH4 B;  3CF6 E;  1VDV A;  4BKS D;  2KWD A;  2K9X A;  2Y5P A;  4CQN A;  4IWQ A;  2JXX A;  2WU2 B;  4TQ1 A;  4A90 A;  1OQR A;  4ANV A;  2BVC A;  1WX8 A;  1C4C A;  4WH4 A;  3EGR A;  3KW5 B;  1E6E B;  1T3Q A;  2MA9 B;  1OGW A;  4KKI A;  4W9L A;  5FKA C;  2ONQ A;  3SHQ A;  3LB8 C;  3NZ3 A;  1JML A;  1C4A A;  4TSS A;  1WGR A;  3Q8B A;  1DYQ A;  2KFJ A;  4OW0 A;  1T0S C;  4RM8 A;  3DDC B;  4K7U A;  4GIV A;  4BKT A;  3A9J B;  4LNN A;  5FK9 C;  1YIW A;  1J8C A;  1HZ6 A;  1KTK A;  3TL5 A;  3AE4 B;  1V5O A;  2KC2 A;  4X57 B;  4WJN A;  4II3 B;  1FFU A;  3JW0 X;  4MSM B;  2J4X A;  3AED B;  2K8B A;  1WGY A;  3JYU A;  2DWQ A;  2J53 A;  2Z0E B;  3AI5 A;  3NVW A;  1Y56 A;  4ANW A;  3N9Y C;  4E3C A;  1WI0 A;  4FAD A;  1VD2 A;  1FM0 D;  1C77 A;  3B2F A;  4WAF A;  2ZCB A;  1PGB A;  3LJ3 A;  4GGQ A;  4F7Z A;  2D11 A;  1J7A A;  3MJW A;  3W1Y A;  4FJV B;  1WYG A;  2Z59 B;  2IO1 B;  1FMA D;  5CX3 A;  1R4M B;  4OZA A;  4YTM B;  4JQW C;  2PJH A;  2WU5 B;  2WXL A;  1K8R B;  3ETR A;  4XWW A;  2BS4 B;  2HJ8 A;  2KLG A;  2DZI A;  2D07 B;  2KWV B;  4LK0 M;  4HWI B;  2CHX A;  4FJY A;  3AE8 B;  1PGX A;  4LJP B;  1CMX B;  1SXT A;  1KRH A;  2K5P A;  4NZL B;  2N9P C;  2LGI A;  1V86 A;  1YX5 B;  2IBI B;  5EE3 A;  3T8M A;  3SFE B;  2DX5 B;  1SIF A;  2ZW1 A;  2LGD A;  1E8Y A;  2B3A A;  3ENE A;  3Q2A C;  4BAX A;  3R66 C;  4P6V F;  1FRR A;  1BML C;  5AUI A;  5IA7 A;  3WIM A;  4WUR A;  2WDQ B;  1ZXH A;  2CR5 A;  3L54 A;  4PS3 A;  4FN2 A;  4MGY E;  3AE9 B;  3W1S A;  3TUO A;  4MJS A;  1I4Q A;  1F0Z A;  1DOY A;  3ZUN A;  2GBJ A;  4HRO A;  3Q3O C;  3M3J A;  1XLQ A;  4YSZ B;  2BYE A;  2WXQ A;  1WXM A;  3VH3 B;  3DVG Y;  1TY0 A;  2N4F A;  1OQY A;  2L76 A;  1ENF A;  2LMC A;  3Q3N C;  3QWZ B;  2KX3 A;  3H7P B;  3BK2 A;  3HVZ A;  2ACZ B;  1K50 A;  2VZK B;  5EE0 A;  3I5J C;  2BF8 B;  3UGB B;  2HE7 A;  4ICU A;  1WX9 A;  2XNA C;  3BYT B;  2K39 A;  4O1N A;  4WJO A;  2MBH A;  2INC C;  5D3D A;  3Q14 C;  4URK A;  1TKY A;  3JVZ X;  2V3N A;  5HG2 A;  3H6N A;  4KGR A;  2FNJ B;  2BYF A;  3T3O A;  1SF0 A;  4MGI E;  3U52 E;  1SEB D;  2R61 A;  2ZCC A;  4RM9 A;  1OFF A;  3ZIM A;  3AV8 A;  3AU5 A;  1QZE A;  3R2T A;  3NS8 A;  1L5P A;  3LDZ E;  3UIO B;  1P3Q U;  4WJP A;  1N5X A;  1D3Z A;  3RZW C;  2RMM A;  1UWM A;  3J9C A;  2M1M A;  3IT6 B;  3RT3 B;  2HTH A;  1NYR A;  2WX0 A;  3CMM B;  5D6J B;  2C7N B;  3VRA B;  3ZKJ C;  5D7G A;  2EMT A;  3A1Q B;  4LCD E;  4REZ A;  3H7P A;  3DHH C;  3QK0 A;  4NNJ B;  3A33 B;  2OJR A;  3ZNG C;  3DBS A;  2XEW A;  1R4N B;  4RGO S;  1GAQ B;  2AEH A;  1NYQ A;  3CST A;  2MJ3 A;  2RDB C;  1L7Y A;  2LVO A;  4WWM A;  4L1B A;  2AX5 A;  3AXC A;  1D5X C;  4HK2 A;  4ZOH C;  3DHI C;  5DPR A;  1E10 A;  2LXC A;  5LXI B;  1V6E A;  3ZRC A;  4DK5 A;  2CJN A;  4K3B A;  1TKE A;  1YX6 B;  1SJH D;  2QIL A;  3PS6 A;  3W5V B;  4JE3 B;  2QEJ C;  3L4P A;  1OEY A;  3KUC B;  5CHF A;  3U8Z A;  4IWO A;  1MVK A;  3UF8 A;  3PT2 B;  3ZXV A;  3ZDM C;  2DHZ A;  1H4R A;  2KJ6 A;  4B9K A;  4MGK E;  3VXW A;  1RWS A;  1KM7 A;  3NRZ A;  4WJQ A;  3S2A A;  1F1H A;  4IM2 A;  1I4H A;  4LDT B;  3P4S B;  4BBN F;  2HDE A;  2YEP B;  5IO9 A;  4IC7 B;  1ZOY B;  3EHV A;  4A6Q A;  3NUH B;  2MHJ A;  4FBJ B;  4WWN A;  4BKG A;  2NCN A;  2KYW A;  2RDG A;  4C7Z A;  5LLI A;  4W9H A;  1EF1 A;  2IND C;  1TIF A;  5IAA C;  3PPA A;  3AE7 B;  4EFO A;  1FFV A;  4PS7 A;  1WGK A;  2WXF A;  2PLP A;  2J52 A;  3RNC C;  1NI3 A;  3BYY B;  4XC2 A;  3TEX A;  3MHS D;  3HVD A;  3VR9 B;  5L95 C;  3GS2 A;  2SEB D;  4W9C A;  2HTM E;  5CTR C;  3RN9 C;  1KLV A;  1I7H A;  1ZP0 B;  1V49 A;  1YJI A;  3QA8 A;  5AEK B;  2IO3 B;  1E5W A;  2K0P A;  3DVG X;  3B2G A;  3KQ4 A;  1YN4 A;  2VH1 A;  1R7S A;  2RPV A;  3DBR B;  1P98 A;  1N62 A;  3ZW3 A;  3B08 A;  3CWI A;  4BFR A;  1WGG A;  4XDC A;  2L8J A;  1RRB A;  2M56 B;  2JZP A;  1XQQ A;  3MP9 A;  1WXV A;  3NVZ A;  1IUE A;  2Z0D B;  3U2S C;  5I4D A;  2IZV B;  4JLC A;  4IM0 A;  4FHK A;  2PKO A;  4MEM A;  2BT6 A;  2ZEQ A;  5TR5 A;  2GMI C;  2UU7 A;  3ZJU A;  4A55 A;  2WNM A;  4DXA B;  4XWT A;  3B9J A;  5J17 A;  4OHJ A;  3FC4 A;  1LO5 D;  3FKY A;  4HPM B;  4KSL C;  1JWM D;  2KC1 A;  1Y8R C;  3N20 C;  3QX1 A;  4RCO A;  1FXA A;  2NBU A;  4AP4 C;  1JRO A;  5JHA A;  3TEY A;  2W3S A;  3AH7 A;  2V3S A;  2JWZ A;  4EZL A;  4BKS A;  3H8H A;  1ZKH A;  4D2K A;  4PS8 A;  5DCN A;  3HRD D;  1WM3 A;  5C3J B;  3RUI B;  4K81 A;  3MC0 B;  3VTU A;  1MFW A;  4HJK A;  3ZDT A;  4EZK A;  2JU6 X;  3QC8 B;  1Z2M A;  3IT4 B;  3AEC B;  5CHW A;  2CU1 A;  1ZDV A;  2NPT B;  3APD A;  2IGD A;  2MBB B;  4M8N A;  5IOI A;  1EU4 A;  3TJP A;  3H1U A;  2BKF A;  2PMV A;  1T0R C;  4B0E A;  5HHD G;  1FPY A;  5BMH A;  4OVZ A;  1E7U A;  2FUH B;  4P16 A;  2RDH A;  2A4Z A;  1WWT A;  1Q10 A;  1RFK A;  3DQV A;  5BMG A;  5LNK 1;  3IAS 1;  2QIE B;  3PGE A;  1FNW A;  1S1Q B;  2KDF B;  2QC8 A;  4KSK C;  3QAQ A;  4S0R A;  4WWO A;  4GU2 A;  1WE7 A;  2N9K A;  2ZNV C;  1N5W A;  3IVF A;  4A3P A;  2WXR A;  1TZO A;  2TSS A;  4GDK B;  3IAM 1;  1UGM A;  4ARC A;  4A3O A;  1TTN A;  3QCA A;  2L52 A;  2GOW A;  2WXM A;  3TCA A;  4NQK E;  4US8 A;  2KTF A;  3RMK C;  4MDK E;  1J19 A;  3OJ3 A;  4USA A;  1V8C A;  1UGJ A;  2KAN A;  2KN4 A;  3M63 B;  1GG3 A;  3RNG C;  1MG8 A;  4ARI A;  5E6O A;  2LRU A;  3PRZ A;  4DHJ D;  3WAM A;  4K7W A;  1TS3 A;  3UQB A;  1EWC A;  3R7R A;  4K1R B;  1WRI A;  1JWU D;  3IG3 A;  1ESF A;  3W9C B;  4KZC A;  3RUL A;  3AEG B;  4EOY A;  5DPT A;  1RM6 C;  4GDK A;  2L05 A;  3PRE A;  1NEN B;  5T8I A;  1SE4 A;  2K8C A;  2BS3 B;  1DOI A;  2BWE S;  2RD0 A;  3GE3 C;  1WXS A;  3L0W B;  2DZJ A;  5J2R A;  1TT5 B;  3T9L A;  3BVM A;  2KZR A;  2A5U A;  2KOX A;  4AWJ A;  1C9F A;  3SEB A;  1LFD A;  2PTL A;  2G3Q B;  3ONS A;  4ZDV A;  3WA0 A;  5H8Y E;  4J6I A;  2W55 A;  2AL6 A;  1RLF A;  1V9J A;  2LGY A;  3DVN V;  2ICI A;  2INP E;  5D2M B;  4M0W B;  2BGF A;  2XN9 C;  4JL9 A;  2I38 A;  4AS1 A;  4KIK A;  2DLB A;  2WXN A;  3DBH B;  4HKZ E;  1IP9 A;  4IOI E;  3GOE A;  1E90 A;  2N0S B;  4A9A A;  3QAR A;  1QOB A;  4HPP A;  1YOV B;  3DBL B;  2BYV E;  1I4R A;  3VHT C;  4YWG G;  4DDG D;  1WMH B;  3AE3 B;  1C4P A;  2LXA A;  2ZNV B;  5FR3 A;  1T5X D;  5L83 A;  1FD6 A;  1V81 A;  2N7J A;  2V4I B;  1B1Z A;  3RPF C;  2C7M B;  4HEA 1;  2NVU I;  1WX7 A;  2W3R A;  1KF6 B;  2LUE A;  3KUZ A;  1SE3 A;  1D5M C;  2JUO A;  5IN7 A;  1UZX B;  4MM3 A;  3I63 C;  1QOA A;  1XLP A;  1WM2 A;  3W5U B;  2LVP A;  4OVV A;  4GOC A;  2J42 A;  2MBQ A;  1JRU A;  4M0W A;  4XX5 A;  2B76 B;  3Q69 A;  2WWZ A;  2ZVO A;  3C0R B;  2R2Q A;  4IUM B;  3OWE B;  4MJS B;  1L6U A;  4WQO B;  1EO6 A;  4MEL A;  1SE9 A;  2IGH A;  4P1C C;  2PPH A;  2FBW B;  3Q8F A;  4N6E B;  2L0T A;  5KHO A;  3X0W A;  3LXF A;  2M4N A;  1AAR A;  2WQY B;  2LHE A;  1NDD A;  1D5Z C;  1HQR D;  4ZYS A;  1FXI A;  2BB6 A;  4GN1 A;  2LGS A;  1VZ7 A;  1WMH A;  1HZ5 A;  1XXG A;  2AL3 A;  4RH6 A;  2MWS B;  1XF5 L;  2ZPY A;  4QAY A;  4RF0 A;  1HXY D;  3RNB C;  5G2N A;  2J0K A;  3P2B A;  2GI9 A;  2WDV B;  5E6P A;  3CIR B;  3HM6 X;  3IFW B;  3ZNI D;  3FIL B;  1E8W A;  1DGJ A;  1FNV A;  4W9K A;  1SGH A;  1KH0 A;  1IBX A;  4JGH B;  1GJZ A;  1KLG D;  4I6P A;  2LEK A;  2JZ3 B;  4W9F A;  2IGG A;  2ZVN A;  3PRP B;  3FAH A;  1NI2 A;  3PZ8 A;  1NVI D;  1STE A;  1IPG A;  5J18 A;  4BZA A;  4KGS A;  1T0Y A;  3KUD B;  4BBN C;  4F8C B;  1TGZ B;  3IHP C;  4MH8 A;  2D3A A;  3Q3F A;  2KMM A;  3DWG C;  1E9M A;  3QJZ A;  3SFD B;  1N60 A;  1GNU A;  4XDD A;  1I42 A;  3ECI A;  5IKC M;  1R4N I;  4TKN A;  4NAW A;  1SSN A;  4PK1 A;  1A70 A;  2W82 A;  1JRP A;  2L3Z A;  2L7R A;  4DHZ E;  3FIL A;  1SE2 A;  2DZM A;  2EKE C;  3I57 A;  4ZRP A;  1SJE D;  1XCQ L;  3V62 A;  1KFY B;  2YLM A;  2L1A A;  2AQ1 B;  4WQM A;  3AU4 A;  4F1S A;  3P1M A;  1J0G A;  3SR6 A;  3GB1 A;  2WHI A;  3AE2 B;  4XZ4 A;  1NBF C;  2WX1 A;  3AMZ A;  1GOZ A;  4FA6 A;  4HCN B;  1CJE A;  4XGA B;  2I1J A;  1OTR B;  4EEW A;  4L23 A;  2LUM A;  3PZD A;  2QMT A;  1MHX A;  2MEK A;  3M62 B;  4YT0 B;  3RNE C;  3A4R A;  3L16 A;  2LJ5 A;  3B1L X;  1C76 A;  5BO4 B;  3ZTD A;  4YSY B;  4C7Y A;  4AUQ C;  2K25 A;  2KDB A;  3P4Q B;  1WF9 A;  2ZPN A;  3V6C B;  3K9O B;  3H9D A;  5BYS A;  3HIZ A;  4ZYN A;  2RR9 A;  3TBL D;  4YSX B;  1WR1 A;  1WJ4 A;  5AZH A;  1V2Y A;  1FXT B;  2CJO A;  2KLC A;  4II2 B;  2MW5 A;  2HJ1 A;  4US9 A;  3N1X C;  3N3K B;  3AE6 B;  4P1B C;  2G1E A;  4Q2J A;  4IW0 A;  1MI0 A;  1OEY J;  2LI5 A;  2KX0 A;  3BK1 A;  4FUL A;  4NQL B;  3B0A A;  4C4V B;  1BT0 A;  2KMA A;  2OED A;  4DHJ B;  4FLH A;  3MFG A;  1I4P A;  3KWL A;  1UD7 A;  1DOX A;  2KDE B;  1WY8 A;  3AEE B;  2FCN A;  5TSS A;  2J0M A;  4CYE A;  3KWV A;  3EUB 2;  2PVO D;  4E74 A;  4M02 A;  2DNF A;  5EE1 A;  4UDU C;  4ZHO A;  2KDI A;  3VUY A;  3P63 A;  1YD8 U;  4I6N B;  2BW2 A;  1JWB D;  3U30 A;  2NTT A;  3ZXR A;  4KVG B;  2IO0 B;  2KVR A;  2I2Y A;  1YN3 A;  3EA6 A;  1GPX A;  2MRP A;  4LJO B;  3ZJT A;  1TS5 A;  2KN5 A;  4LTU A;  2DYM A;  5HI1 A;  4GXB A;  4C4V A;  4ITK A;  4PYU A;  2WS3 B;  5DPS A;  1LGR A;  2MJE A;  2DAJ A;  2BS2 B;  2W9N A;  3V61 A;  1N63 A;  5E6N A;  1XCT L;  3C8Y A;  2KAC A;  2VRR B;  1QOG A;  1ZE3 D;  2R2O A;  2EMS A;  2PW9 A;  1UUP A;  3IBE A;  1IGD A;  1U4A A;  5JHB A;  2ZJD A;  1LXD A;  3BY4 B;  1Q0W B;  2KQ7 A;  2JRI B;  3ZYY X;  4ZRQ A;  2N9E B;  2KT7 A;  1YN5 A;  1P9D U;  2GBM A;  1XT9 B;  1E0Z A;  1WGH A;  1H8C A;  2PE9 A;  2J7Q B;  1BUI C;  4M8M A;  1SIJ A;  1QIL A;  1RAX A;  3VRB B;  3ALB A;  3N30 A;  5FR6 A;  4RFB A;  3NVY A;  2LVQ A;  2MH7 A;  3NZS A;  1NEK B;  2INN E;  2JWU A;  1TYG B;  4FHJ A;  4EZJ A;  3UIP B;  1V1P A;  3I3T B;  2LD9 A;  2FCM A;  3Q8E A;  4LNI A;  2NBW B;  4W9E A;  1HEZ E;  1MJD A;  3KLS X;  2MX2 A;  2GB1 A;  1FIQ A;  1HTQ A;  3QQ8 B;  5DPW A;  1PGA A;  4RGT A;  2ZZP B;  1VZ6 A;  1WJN A;  1HE8 A;  2KTR A;  3RCZ A;  1VCB A;  3GZN B;  2MLB A;  1IYF A;  5C23 A;  4TMA B;  2BB5 A;  4KKJ A;  2FCS A;  2K1F A;  3AN1 A;  2DBY A;  3JSV A;  1JWS D;  2WXI A;  1V80 A;  1RYJ A;  1K52 A;  2JRH A;  2O6V A;  3UIN B;  3AEF B;  2NTS A;  2W54 A;  4RGM A;  2LHD A;  2NS5 A;  1P7E A;  3PHW B;  3VQI A;  2DYB A;  1EF5 A;  1CK1 A;  4BVU C;  5E6J A;  2L0F A;  3P42 A;  1UBQ A;  3BWU D;  3Q8C A;  2E6X A;  1N61 A;  3OJ4 B;  4W9D A;  3TSS A;  5GMV A;  3HUI A;  2JF5 A;  4DXF A;  1ZDX A;  2N1W A;  1J7C A;  2KWU B;  2C9W B;  3PO0 A;  1L4Z B;  2BQQ A;  4HDO A;  3URY A;  2G4S A;  3PHX B;  1WJU A;  2WXG A;  1E8X A;  5D94 A;  1YMH E;  1YQ3 B;  4P7I A;  1AN8 A;  4C80 A;  1A5R A;  3ML8 A;  4PT5 A;  1KOT A;  1TS2 A;  1TJE A;  1E8Z A;  1E7P B;  4FJZ A;  2XK5 A;  3UQA A;  1WIA A;  1S3S G;  2N1V A;  4KIK B;  1XLN A;  2KO3 A;  4ACF A;  2J0J A;  4DWF A;  4RNA A;  2IY1 B;  3VUW A;  3DBH I;  3O13 A;  1GC7 A;  3VAW A;  2CS4 A;  3DPD A;  1YQB A;  3PVL A;  4ICV A;  1WFY A;  5EDS A;  2G45 B;  1ZW7 A;  1F2R I;  1QT9 A;  5MPO A;  2L00 B;  2BYT A;  2KKC A;  4HPL B;  3U7D A;  2D10 A;  3UI3 A;  4JIO U;  3E9S A;  4HDQ A;  4MM3 B;  4NPN A;  2QSD A;  4ZRJ A;  2JQR B;  1V97 A;  1WZ3 A;  2OJW A;  2MBE A;  2KDM A;  3KH0 A;  3HM3 A;  1LQB A;  4NAM A;  4BOS C;  3OAW A;  4TV3 A;  2D3C A;  2AWT A;  4GMV A;  1WRD B;  4R3D A;  2FIF A;  2FUG 1;  1WGD A;  3PV1 A;  4XE0 A;  2KMC A;  4HLE A;  2WP9 B;  1R4M I;  3ZO5 B;  1I35 A;  4B0M A;  4M00 A;  1F9J A;  2MP2 A;  1JWA D;  1PDX A;  4YTN B;  3EEC A;  4IM3 A;  2JZZ A;  1L6V A;  3VTV A;  3C19 A;  1WSP A;  4K7S A;  4EUT A;  4L2Y A;  2WXO A;  4HKQ A;  2BTE A;  2Y5C A;  2DEN B;  2NBV B;  3AUL A;  2RPQ A;  4C00 A;  1WXQ A;  1P1A A;  4JWS C;  2O6V D;  4LNK A;  2EEL A;  1YJJ A;  5HFY A;  3NVV A;  1T0Q C;  1F77 A;  3MTN B;  2K6D B;  1IBX B;  4CO7 A;  3VR8 B;  2WXP A;  3PLV A;  5AZF A;  1Z5S B;  3V6E B;  1T6B X;  4FXC A;  1UF0 A;  4WAA A;  1WR6 E;  2MQJ A;  4G3X B;  2C5L C;  4M01 A;  3QHT A;  3N1Y C;  1VR9 A;  2IYD B;  4B95 A;  1GUA B;  2LGX A;  2K6Q A;  3VTW A;  4J3O D;  1EWY C;  2JT4 B;  3W2D A;  4AJY B;  4DHZ B;  4G11 A;  2Q5W D;  5AUK A;  3PRM B;  3WAO A;  2X38 A;  1XD3 B;  4WIP A;  2D3B A;  3EC8 A;  1XEE A;  3BII D;  4LLG M;  3L10 B;  4AQ7 A;  3ZTC A;  3A9J A;  2OOB B;  4ZRI A;  4YTP B;  3ZNH B;  4NAW B;  4W9I A;  2MJD A;  2QDF A;  4RMA A;  1GB1 A;  3OLM D;  3PTF C;  3ML9 A;  3WAL A;  2K22 A;  1M4V A;  2JSV X;  3MC9 A;  1AYF A;  4WWP A;  3DHG C;  2NR2 A;  3Q8A A;  2KXJ A;  1LM8 B;  2MSE D;  1FO4 A;  2D2Q A;  3L13 A;  2V1Y A;  2N7E A;  3OG5 A;  5D3I B;  1JCK B;  2N9X A;  5EE9 A;  2PE6 B;  3APF A;  3NHE B;  1ISN A;  1P7F A;  1ET6 A;  3NG0 A;  2WXH A;  2FAZ A;  1TS4 A;  1HTO A;  2XBB C;  3X23 A;  2QHO A;  3L17 A;  2L32 A;  1TY2 A;  1Q1O A;  3D32 A;  4LNO A;  4HJG E;  1CZP A;  4G0N B;  2IPK D;  5JZE B;  2D5G A;  2C7H A;  1JAL A;  2WDT B;  2M8S A;  3DVN U;  1EM7 A;  1OQQ A;  1PYW D;  2CU3 A;  3ABV B;  1D6E C;  1Q5W B;  2M0X A;  2E3T A;  3Q6B A;  2JPH A;  2Y5B B;  4KDI C;  4E71 A;  2IY0 B;  2I1K A;  1ROE A;  1QOF A;  3O65 B;  4MH0 E;  2MCN B;  1KJT A;  2JXT A;  4KZ0 A;  1WH3 A;  3R8B A;  1WZ0 A;  3SD5 A;  5BMI A;  3EFC A;  2G4D B;  2REX A;  2AQ3 B;  3ZVV A;  1TBE A;  2CKH B;  2JYT A;  3RNA C;  3SU8 X;  1UBI A;  2WXJ A;  2EKI A;  3ZJV A;  1QKZ A;  2JVC A;  3BVZ A;  3TMP B;  4K3C A;  4DBG A;  1FEH A;  1C1Y B;  2SAK A;  2K8H A;  1YQ4 B;  5JH5 C;  3U7Z A;  4IG7 B;  1MG4 A;  1VRA B;  1WJ6 A;  2BKR B;  1N6Z A;  4XYC A;  4ANU A;  1WE6 A;  1M94 A;  3AB5 A;  1J7B A;  2VH2 A;  4RF1 A;  4ANX A;  4W9G A;  2M19 A;  3M95 A;  2C60 A;  2IJ0 A;  2KNB A;  3IXS A; 
#chains in the Genus database with same CATH homology
 2RD0 A;  1E7V A;  3ENE A;  3L0W B;  1WXS A;  3HHM A;  2DZJ A;  4KDL B;  4I6L B;  4FHJ A;  5J2R A;  4EZJ A;  3R66 C;  3UIP B;  3T9L A;  1UEL A;  3I3T B;  5IA7 A;  1EUV B;  2KZR A;  2LD9 A;  3WIM A;  2FCM A;  2A5U A;  2NBW B;  4W9E A;  2KOX A;  2CR5 A;  4AWJ A;  3L54 A;  4PS3 A;  1LFD A;  2KQS A;  4FN2 A;  2G3Q B;  4MGY E;  3W1S A;  3L08 A;  3ONS A;  2MX2 A;  4ZDV A;  4MJS A;  3WA0 A;  3QQ8 B;  1PQS A;  4J6I A;  5DPW A;  3ZUN A;  2AL6 A;  2GBJ A;  1RLF A;  1V9J A;  2LGY A;  3DBR I;  3DVN V;  2ZZP B;  3R3M A;  1X1M A;  3CSF A;  5D2M B;  3M3J A;  4M0W B;  1WJN A;  1HE8 A;  2KTR A;  3RCZ A;  1VCB A;  2BGF A;  2BYE A;  2MLB A;  4JL9 A;  3SDL C;  1WXM A;  3VH3 B;  3DVG Y;  3A1Q A;  5C23 A;  4KIK A;  5C1Z A;  1IYF A;  2N4F A;  1OQY A;  5CHV C;  2L76 A;  2FCS A;  2K1F A;  1IP9 A;  3GOE A;  3RYT A;  2RSU A;  4NY0 A;  3QWZ B;  1E90 A;  3JSV A;  1L2N A;  4GB9 A;  1V80 A;  2KX3 A;  3QAR A;  2JRH A;  3HK0 A;  5KHQ A;  2O6V A;  2KFK B;  3H7P B;  3UIN B;  3RZF A;  2BYV E;  3Q3J A;  3VUX A;  2FID A;  3VHT C;  2BF8 B;  3TIX A;  2NS5 A;  3UGB B;  4DDG D;  3PHW B;  2HE7 A;  4ICU A;  1WX9 A;  1WMH B;  2DYB A;  2FCQ A;  3VQI A;  2K39 A;  4WJO A;  1EF5 A;  2MBH A;  4BVU C;  2LXA A;  2ZNV B;  2L0F A;  4URK A;  3V60 A;  4YL8 A;  5HKH A;  5L83 A;  1UBQ A;  1V81 A;  5LXH A;  3JVZ X;  4HVB A;  2C7M B;  2NVU I;  3H6N A;  1WX7 A;  2FNJ B;  3KUZ A;  2LUE A;  2BYF A;  4W9J A;  4IWP A;  4MGI E;  2JUO A;  1UZX B;  2ZCC A;  3OJ4 B;  4RM9 A;  4W9D A;  5GMV A;  4MM3 A;  1UH6 A;  2KHW B;  2JF5 A;  3ZIM A;  3AU5 A;  1QZE A;  2N1W A;  1WM2 A;  3NS8 A;  2LVP A;  4OVV A;  1ZGU B;  2KWU B;  2C9W B;  2MBO A;  3LDZ E;  4GOC A;  3UIO B;  1P3Q U;  4HDO A;  4WJP A;  2MBQ A;  1G6J A;  1D3Z A;  2KWC A;  1JRU A;  3RZW C;  2WYQ A;  2G4S A;  3PHX B;  4XX5 A;  1WJU A;  2WWZ A;  2ZVO A;  2BPS A;  3C0R B;  2R2Q A;  4IUM B;  4MJS B;  1E8X A;  5D94 A;  4P7I A;  1EO6 A;  2M1M A;  4WQO B;  4MEL A;  3RT3 B;  2HTH A;  1V5T A;  1A5R A;  1SE9 A;  3ML8 A;  4G50 A;  1KOT A;  2PPH A;  4GSW A;  2CHW A;  2WX0 A;  1E8Z A;  2L0T A;  5KHO A;  3VDZ A;  3X0W A;  3CMM B;  2KTR B;  5D6J B;  2C7N B;  2PEA A;  2M4N A;  4FJZ A;  2XK5 A;  1AAR A;  3UQA A;  3ZKJ C;  1P0R A;  1WIA A;  1S3S G;  2EMT A;  2N1V A;  3A1Q B;  4KIK B;  5D7G A;  4LCD E;  1NDD A;  2KO3 A;  2KFK A;  3H7P A;  2J0J A;  4DWF A;  3QK0 A;  2LAS A;  2IY1 B;  3GZN I;  4GN1 A;  4NNJ B;  3A33 B;  3VUW A;  3PSE B;  2OJR A;  3JSV B;  3ZNG C;  3DBS A;  2XEW A;  3DBH I;  3A4S C;  2AEH A;  1WMH A;  4ASW C;  2AL3 A;  2O6V B;  4HCP B;  3APC A;  1GC7 A;  3CST A;  3VAW A;  2CS4 A;  3DPD A;  1YQB A;  1L7Y A;  2LVO A;  2MWS B;  3PVL A;  4ICV A;  3ZLZ A;  3AXC A;  2LRW A;  2ZPY A;  4HK2 A;  3DOW A;  3NOB A;  1WFY A;  5DPR A;  5EDS A;  2KD0 A;  2YVC A;  5G2N A;  2V4L A;  2G45 B;  1ZW7 A;  4AJW A;  2LXC A;  2J0K A;  5LXI B;  1V6E A;  2L00 B;  3P2B A;  3ZRC A;  3K9P B;  4DK5 A;  5E6P A;  3BIN A;  1YX6 B;  3ZNZ B;  3PS6 A;  2KKC A;  3HM6 X;  4HPL B;  3U7D A;  2N7D A;  3IFW B;  3ZNI D;  1OEY A;  2D10 A;  3KUC B;  5CHF A;  3U8Z A;  1E8W A;  4IWO A;  4JIO U;  2LWP A;  3UF8 A;  4HDQ A;  4W9K A;  1SGH A;  4NPN A;  3PT2 B;  4JGH B;  3ZDM C;  2DHZ A;  2CHZ A;  4ZRJ A;  1H4R A;  1GJZ A;  2KJ6 A;  4B9K A;  1WZ3 A;  2KK8 A;  3A9K B;  2MBE A;  4MGK E;  4AOF A;  3VXW A;  2GBR A;  4I6P A;  3KH0 A;  2JZ3 B;  3HM3 A;  1LQB A;  4W9F A;  1KM7 A;  4WJQ A;  3WAN A;  4BOS C;  3OAW A;  2ZVN A;  3PRP B;  3S2A A;  4TV3 A;  4IM2 A;  2AWT A;  4GMV A;  1WRD B;  1NI2 A;  4LDT B;  4BBN F;  2FIF A;  1WGD A;  3PV1 A;  3R7Q A;  2DYO A;  2KMC A;  4HLE A;  1IPG A;  5J18 A;  4IC7 B;  3N32 A;  1R4M I;  3EHV A;  3ZO5 B;  1RFA A;  1T0Y A;  3KUD B;  4BBN C;  2XK5 B;  4F8C B;  4FBJ B;  4WWN A;  4BKG A;  1I35 A;  2NCN A;  1TGZ B;  5LLI A;  4W9H A;  1EF1 A;  1F9J A;  3RD2 A;  2MP2 A;  3IHP C;  5IAA C;  2D3G A;  3EEC A;  2JZZ A;  4IM3 A;  3PPA A;  3Q3F A;  4EFO A;  3QJZ A;  3VTV A;  4PS7 A;  1GNU A;  4OVU A;  1I42 A;  4ZRK A;  3ECI A;  2DAF A;  4K7S A;  1R4N I;  4TKN A;  4EUT A;  4NAW A;  3KYD D;  2UYZ B;  2DZK A;  4B6W A;  2O2V B;  4XC2 A;  2DEN B;  2NBV B;  3AUL A;  3MHS D;  2L3Z A;  2L7R A;  2RPQ A;  2BWF A;  4DHZ E;  2IO2 B;  1P1A A;  5L95 C;  5G55 A;  2O6V D;  4W9C A;  2DZM A;  3NY5 A;  1WYW B;  4EKU A;  2EKE C;  4A20 A;  2RGF A;  3EFU A;  3A9K A;  4MGZ E;  5CTR C;  1KLV A;  2GBN A;  3MTN B;  1V49 A;  3QA8 A;  3V62 A;  5AEK B;  2KJR A;  2K6D B;  4TUU A;  2IO3 B;  1E5W A;  3DVG X;  2M17 A;  4CO7 A;  2JY6 A;  3H7S A;  3PLV A;  4HXD A;  1Z5S B;  5AZF A;  3V6E B;  4PYZ A;  2YLM A;  4GDL B;  4WAA A;  1WR6 E;  2MQJ A;  1P98 A;  4G3X B;  3ZW3 A;  2C5L C;  3AU4 A;  2NPT A;  3B08 A;  3VFK A;  3ZRF A;  4F1S A;  4MSQ B;  3QHT A;  4BOZ B;  1J0G A;  1TZ1 A;  4BFR A;  1WGG A;  2IYD B;  4B95 A;  4XZ4 A;  3W1S C;  1GUA B;  2LGX A;  2K6Q A;  2L8J A;  1RRB A;  3VTW A;  1NBF C;  2WX1 A;  3KYC D;  4FA6 A;  4HCN B;  4DDI D;  1XQQ A;  2I1J A;  2JT4 B;  1WXV A;  2LZ6 A;  4AJY B;  4DHZ B;  4G11 A;  2Z0D B;  1OTR B;  4EEW A;  3PRM B;  3WAO A;  2IZV B;  2HD5 B;  1XD3 B;  3PZD A;  1GC6 A;  4IM0 A;  4JLC A;  4FHK A;  3EC8 A;  3M62 B;  4MEM A;  2ZEQ A;  3A4R A;  3L10 B;  3L16 A;  2MP2 B;  4LDT D;  5TR5 A;  2GMI C;  2LJ5 A;  3B1L X;  5BO4 B;  3WAP A;  1WXA A;  3ZTD A;  4DXA B;  2UWQ A;  3ZTC A;  3DBL I;  2O2V A;  5J17 A;  3A9J A;  4AUQ C;  2K25 A;  2KDB A;  2OOB B;  1WF9 A;  4KV2 A;  2ZPN A;  4HPM B;  4KSL C;  4ZRI A;  3ZNH B;  4NAW B;  1C3T A;  2KC1 A;  3V6C B;  1Y8R C;  4W9I A;  3K9O B;  3H9D A;  3NZU A;  3QX1 A;  4RMA A;  4TQ0 A;  3HIZ A;  2ASQ A;  4ZYN A;  2RR9 A;  2NBU A;  3OLM D;  3PTF C;  4N9F 4;  3TBL D;  3ML9 A;  3WAL A;  4AP4 C;  5JHA A;  1WR1 A;  1WJ4 A;  5AZH A;  2V3S A;  1V2Y A;  2JWZ A;  4EZL A;  1FXT B;  2KLC A;  4BKS A;  4II2 B;  3QIJ A;  1ZKH A;  4WWP A;  2MW5 A;  4PS8 A;  5DCN A;  3PLU A;  1WM3 A;  2NR2 A;  3N3K B;  3RUI B;  3DCG A;  4K81 A;  2KJH B;  2KXJ A;  1LM8 B;  4GDL A;  2MSE D;  3VTU A;  2D2Q A;  4IW0 A;  2GBK A;  3L13 A;  1OEY J;  4HJK A;  2LI5 A;  2V1Y A;  3ZDT A;  2N7E A;  3VVW B;  3KVF B;  5AZG A;  2KX0 A;  4EZK A;  1YJ1 A;  4CHK A;  2AYO B;  2N9X A;  4FUL A;  3QC8 B;  1Z2M A;  4NQL B;  3B0A A;  2PE6 B;  3APF A;  4NJ7 A;  1BT0 A;  2KMA A;  4NJ6 A;  5CHW A;  3NHE B;  2CU1 A;  3VH4 B;  1ISN A;  2NPT B;  3APD A;  2MBB B;  4M8N A;  3CF6 E;  4DHJ B;  4FLH A;  4BKS D;  2FAZ A;  2XBB C;  3X23 A;  2QHO A;  3TJP A;  3H1U A;  1UD7 A;  3L17 A;  2KDE B;  4IWQ A;  2BKF A;  2JXX A;  4TQ1 A;  1WY8 A;  4ANV A;  1Q1O A;  3D32 A;  1WX8 A;  2FCN A;  3KW5 B;  4G0N B;  2MA9 B;  1E7U A;  1OGW A;  2FUH B;  2J0M A;  4W9L A;  3SHQ A;  5JZE B;  4CYE A;  2C7H A;  2WDT B;  1WGR A;  4E74 A;  2KFJ A;  2A4Z A;  3DQV A;  2M8S A;  4RM8 A;  3DVN U;  3DDC B;  3PGE A;  4K7U A;  4GIV A;  4BKT A;  2KDI A;  3VUY A;  1Q5W B;  1S1Q B;  3A9J B;  2M0X A;  1YD8 U;  1YIW A;  1J8C A;  4I6N B;  2JPH A;  2KDF B;  4KSK C;  3TL5 A;  3U30 A;  2Y5B B;  3QAQ A;  4WWO A;  4GU2 A;  1V5O A;  2KC2 A;  4X57 B;  4KDI C;  4KVG B;  1WE7 A;  2ZNV C;  4WJN A;  4E71 A;  2IO0 B;  2IY0 B;  4II3 B;  2I1K A;  2KVR A;  3JW0 X;  4MSM B;  3IVF A;  3O65 B;  2MRP A;  4LJO B;  4A3P A;  4MH0 E;  2K8B A;  2MCN B;  1WGY A;  3JYU A;  1KJT A;  2Z0E B;  3AI5 A;  4GDK B;  2KN5 A;  4ANW A;  4KZ0 A;  2DYM A;  1UGM A;  1WH3 A;  4A3O A;  1WI0 A;  4E3C A;  4FAD A;  1VD2 A;  4GXB A;  1WZ0 A;  3SD5 A;  1TTN A;  4PYU A;  2G4D B;  3QCA A;  2REX A;  5DPS A;  2DAJ A;  2ZCB A;  2W9N A;  2GOW A;  3LJ3 A;  3V61 A;  4GGQ A;  4F7Z A;  2D11 A;  3TCA A;  1TBE A;  5E6N A;  4NQK E;  3ZVV A;  3MJW A;  2KTF A;  4FJV B;  3W1Y A;  2Z59 B;  2CKH B;  4MDK E;  2VRR B;  1J19 A;  3OJ3 A;  2IO1 B;  3SU8 X;  1UBI A;  5CX3 A;  2R2O A;  2KAN A;  4JQW C;  2EMS A;  2PJH A;  1K8R B;  3IBE A;  2JVC A;  3M63 B;  1GG3 A;  1U4A A;  3TMP B;  5JHB A;  2ZJD A;  1LXD A;  3BY4 B;  1MG8 A;  1Q0W B;  4DBG A;  2KQ7 A;  2JRI B;  2N9E B;  2HJ8 A;  5E6O A;  1C1Y B;  2K8H A;  1P9D U;  2KLG A;  2DZI A;  1XT9 B;  2D07 B;  2GBM A;  2LRU A;  2KWV B;  1WGH A;  3PRZ A;  4HWI B;  2CHX A;  4FJY A;  5JH5 C;  1H8C A;  2PE9 A;  3WAM A;  2J7Q B;  4K7W A;  4DHJ D;  3UQB A;  4LJP B;  4IG7 B;  4M8M A;  3R7R A;  1WJ6 A;  1CMX B;  2BKR B;  4K1R B;  4ANU A;  1RAX A;  2N9P C;  1WE6 A;  3IG3 A;  1M94 A;  4KZC A;  3RUL A;  1V86 A;  3ALB A;  1YX5 B;  2IBI B;  3N30 A;  4EOY A;  5FR6 A;  3T8M A;  5DPT A;  4ANX A;  4GDK A;  4W9G A;  2L05 A;  2DX5 B;  3PRE A;  1SIF A;  3M95 A;  2LVQ A;  2K8C A;  2C60 A;  3NZS A;  2BWE S;  2KNB A;  1E8Y A;  2LGD A;  2B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...