4N9F4

Crystal structure of the vif-cbfbeta-cul5-elob-eloc pentameric complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
95
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFDTFEALCIEPFSSPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/viral protein
molecule keywords Cullin-5
publication title Structural basis for hijacking CBF-b and CUL5 E3 ligase complex by HIV-1 Vif
rcsb
source organism Homo sapiens
total genus 18
structure length 95
sequence length 98
chains with identical sequence D, H, J, P, W, X, e, g, m, s, y
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4n9f400
3T8MA 4B6WA 3A9JB 3CMMB 1E5WA 4KDIC 2PJHA 2RSUA 1WZ0A 2GBJA 2NBWB 4DK5A 2NPTB 2DZKA 4HDOA 4NPNA 1C3TA 1Q1OA 1V5TA 2JZ3B 3ZKJC 4W9LA 2WX1A 2DZMA 4IUMB 3TBLD 2FCSA 4TV3A 3V6CB 1WE7A 2JZZA 4KIKA 5IAAC 3VDZA 2K1FA 1E8WA 4WWPA 2M17A 4X57B 4GXBA 2CHXA 3APDA 2K8HA 1YIWA 2EKEC 3PLVA 4YL8A 2BKFA 4IWOA 4II2B 1YD8U 4WQOB 3ONSA 3PTFC 5J17A 3GZNI 1WJ4A 2FCNA 3QC8B 2KQ7A 2REXA 4ZDVA 2FUHB 2FCMA 3ZNHB 4EOYA 2N1VA 3DBLI 2LVPA 2RPQA 4A3OA 4FHKA 1KLVA 1EUVB 2BWFA 3DPDA 2KK8A 2DZIA 1UZXB 2KLCA 1WIAA 3NOBA 4K81A 5G2NA 2JXXA 1GJZA 2ZNVC 4HDQA 4BFRA 1MG8A 4OVUA 4AP4C 3UIPB 3U30A 3ZTDA 2UWQA 4MSQB 2K25A 1IPGA 2LUEA 1WI0A 3JSVA 4KSLC 4FJVB 1WR1A 1A5RA 1V9JA 4ICUA 2V1YA 1WXMA 3WAMA 2C60A 3DVGY 2IY1B 3NY5A 4HPLB 5LLIA 4DDID 2CR5A 4FJZA 5D2MB 4LDTD 2N9EB 2LRWA 2Y5BB 3QQ8B 3KUZA 2AEHA 4M0WB 1WGHA 3QA8A 3V61A 2DYBA 5FR6A 3VUXA 3EECA 3JYUA 1U4AA 1EO6A 5DCNA 4DDGD 3LDZE 2AL6A 3QARA 2O2VA 3PLUA 1WYWB 2KWCA 3C0RB 4J6IA 4LCDE 3UQBA 2MBQA 2UYZB 4KDLB 4W9GA 1WXSA 2PE6B 1V80A 1YJ1A 1ISNA 3BY4B 1X1MA 1YX6B 1S1QB 3AI5A 3AU4A 2DYMA 4RMAA 2DHZA 5D94A 3SU8X 1WRDB 2LZ6A 1M94A 3W1SC 2K8BA 3QJZA 5J2RA 1RAXA 4CHKA 1ZGUB 2I1KA 1D3ZA 2FIDA 2IO1B 3DVNV 4ANWA 2KOXA 5JZEB 4W9DA 4M8NA 1WX7A 5L83A 2KJHB 2ZJDA 1E7VA 4MGKE 4BKSA 2MCNB 2DX5B 4EFOA 4DXAB 4ASWC 4KV2A 3LJ3A 5DPSA 4BOZB 4F8CB 1Z2MA 1J19A 4GDKA 3PHWB 2HJ8A 4G0NB 3IG3A 4TQ1A 4NAWA 2DZJA 2GMIC 2BWES 1E8YA 1L2NA 3KW5B 1SIFA 4HCPB 1UELA 4DWFA 2NS5A 4F1SA 4FULA 1R4MI 5GMVA 3H6NA 1TBEA 3O65B 4IW0A 1IYFA 3HIZA 2KJ6A 4WJOA 2MWSB 2CKHB 1CMXB 4DHJD 3DOWA 3WA0A 4BKGA 3V6EB 3PRZA 5TR5A 3ZVVA 2HTHA 3KVFB 3TMPB 1AARA 2JT4B 4GU2A 4XC2A 5CHFA 4NJ7A 2KZRA 2WWZA 3N32A 4GIVA 2Z59B 4CO7A 3TIXA 3ZNID 4RM8A 3A4SC 5E6NA 3VTVA 1XT9B 2D07B 2LRUA 3EC8A 4N9F4 3BINA 4IM0A 4PS8A 2NPTA 4ANXA 3HM6X 4W9FA 2KJRA 3RZWC 3DVNU 1Q5WB 3SDLC 3WIMA 4CYEA 5HKHA 1ZKHA 2R2OA 5CHVC 3VUYA 2EMTA 3N30A 2N4FA 4W9JA 4K7UA 3N3KB 4FN2A 4I6NB 4WWOA 3R7QA 1J8CA 3JVZX 3M3JA 1WXVA 4MH0E 5JH5C 4WAAA 2YLMA 3L54A 2IY0B 1RFAA 3APCA 3PSEB 3VFKA 1RLFA 2ZVNA 2CU1A 3PT2B 1WXAA 2JRIB 2N9XA 3EFUA 1OQYA 3OJ3A 3DVGX 1WY8A 2KD0A 2MQJA 3GOEA 1IP9A 1WGDA 2HE7A 5AZHA 4TQ0A 1SE9A 3L0WB 4AJWA 2KWVB 2GBRA 1I42A 2KN5A 1F9JA 2PE9A 4W9IA 2KMCA 5LXHA 4IM3A 2D3GA 2BKRB 4G11A 2C9WB 3JW0X 3L16A 3ZW3A 1VD2A 3VUWA 3ZO5B 4EEWA 1TZ1A 2IO0B 2L3ZA 2AL3A 1QZEA 4WJQA 4DHZE 5JHBA 4HPMB 4KSKC 2KDEB 4IM2A 2NCNA 1GG3A 2IYDB 2MSED 4ANVA 1WX8A 1L7YA 4JIOU 3X23A 1WH3A 3TJPA 4BKTA 4KZCA 2NVUI 3ALBA 3NS8A 4MJSB 2L0FA 4LJPB 3ZDMC 5JHAA 4EUTA 2BYVE 3ML9A 1XD3B 1UGMA 2NR2A 2JRHA 3NHEB 3CSFA 4EZJA 4MGZE 3VH3B 3KYDD 1YX5B 1T0YA 3Q3FA 2WX0A 4MEMA 2IO3B 3PS6A 4RM9A 2WYQA 1XQQA 3VH4B 4URKA 4XZ4A 1GC6A 4AWJA 4TKNA 1KJTA 3IBEA 3H7PB 3DQVA 3DBHI 3RZFA 4AUQC 2CHWA 4HWIB 2BYFA 2JWZA 4NQLB 4ZRIA 3K9OB 5BO4B 4GMVA 1J0GA 2M4NA 3AU5A 3M63B 2K6QA 1NI2A 4FA6A 3CF6E 3QX1A 4E71A 1WE6A 2J0KA 4FHJA 2LWPA 4XX5A 3SD5A 2K6DB 3OJ4B 3VVWB 4IC7B 3B0AA 5EDSA 2C5LC 2KC1A 2K39A 4MDKE 2MBHA 3KH0A 3QWZB 1VCBA 3CSTA 3ZTCA 3ZIMA 2J7QB 1K8RB 1WM2A 1LFDA 2J0MA 4PS3A 4LJOB 2RD0A 4LDTB 2KHWB 3MTNB 1WZ3A 3NZSA 4JGHB 2MLBA 2IZVB 2LJ5A 3A4RA 4G50A 2MBEA 3ZDTA 4DBGA 2KXJA 4E74A 2KTRA 1WFYA 2G45B 2MW5A 5CHWA 3RCZA 2O6VD 2JVCA 4BBNC 3DCGA 4GDLA 2DENB 3H1UA 2MBBB 2M0XA 1WMHA 2KDBA 2MP2A 3B08A 3D32A 2GOWA 3DBRI 4PYZA 5AZFA 3VHTC 4FADA 2D2QA 5DPTA 1V5OA 2V4LA 3QK0A 1LXDA 2KTRB 2A5UA 3PGEA 3IVFA 3PPAA 3RD2A 3TL5A 1WJUA 4EKUA 1I35A 4GDLB 2Z0EB 1WGYA 4HXDA 4BBNF 3L08A 2C7MB 2MX2A 4P7IA 1WMHB 2MP2B 2KVRA 4ICVA 3L10B 3M62B 2J0JA 5LXIB 2BYEA 4E3CA 2LGXA 1TGZB 1BT0A 2LXCA 4F7ZA 2CHZA 3HHMA 4IWQA 2O6VB 3WALA 1JRUA 4JL9A 2JY6A 2LVQA 3EHVA 2KQSA 1WX9A 3Q3JA 3AULA 3UINB 2KFKB 4HK2A 1V49A 2FNJB 1P0RA 3R7RA 3PV1A 3RYTA 4OVVA 4W9HA 4HJKA 2KDFB 2LXAA 4MM3A 1P3QU 1KM7A 3A9KA 3PHXB 4GB9A 2KLGA 2L8JA 3WANA 4K7SA 3ZRFA 1P98A 3UIOB 3VAWA 4DHJB 1V86A 1S3SG 3ZLZA 1HE8A 3DBSA 2ZVOA 3QHTA 4WWNA 1UH6A 1PQSA 2BGFA 3PVLA 4PS7A 1ZW7A 3A33B 2OJRA 3A9KB 3TCAA 2N1WA 5AZGA 1WJNA 1WJ6A 4EZKA 1GNUA 3DDCB 1OEYA 2V3SA 3UGBB 1E8ZA 1KOTA 3WAOA 2ZPNA 5J18A 2LI5A 3R66C 3IHPC 1WGRA 2QHOA 2KX3A 3U8ZA 4MJSA 4K7WA 4M8MA 2G4DB 4KVGB 1LQBA 3OLMD 5DPWA 2HD5B 2D11A 3ZNZB 4ZYNA 2L0TA 3W1YA 3S2AA 4GSWA 2LASA 2PEAA 3UQAA 3PRPB 3RT3B 1V6EA 5IA7A 2I1JA 4GOCA 2ZEQA 2LVOA 3H7PA 5G55A 4HCNB 4MSMB 5L95C 3AXCA 2B3AA 2A4ZA 2GBKA 2M1MA 4A20A 2KFJA 1GUAB 2KNBA 2G4SA 1EF5A 1E8XA 4B95A 4FBJB 4KIKB 1OTRB 3ENEA 3ML8A 4ANUA 3VQIA 3H7SA 1UBIA 2Z0DB 4NJ6A 1UBQA 1WF9A 2GBNA 5E6PA 3RUIB 4NY0A 4PYUA 2LD9A 1E7UA 2L76A 2MRPA 2DYOA 1P9DU 2NBUA 2CS4A 2KC2A 2KANA 5DPRA 2KTFA 1H8CA 2N9PC 1Y8RC 2LGYA 1UD7A 3ZRCA 4IWPA 3KUCB 1FXTB 3HM3A 2JF5A 5D7GA 3NZUA 2FAZA 1RRBA 4MGYE 2KWUB 5KHQA 2DAJA 1G6JA 3IFWB 4I6LB 3PRMB 4DHZB 1SGHA 3V60A 2D10A 3JSVB 2JUOA 4MELA 2KKCA 3WAPA 3KYCD 2C7HA 3MHSD 4K1RB 4A3PA 4FJYA 2EMSA 2N7DA 1WR6E 2BPSA 2L00B 3I3TB 4BOSC 3OAWA 1NBFC 4NNJB 2AWTA 4AOFA 3SHQA 2WDTB 3VTUA 2FCQA 2FIFA 4II3B 4BKSD 5D6JB 3PREA 2O2VB 3PZDA 3ZUNA 4ZRJA 2R2QA 4GGQA 2DAFA 2ZNVB 1GC7A 1V2YA 2ZZPB 3QIJA 2NBVB 4WJNA 3QAQA 3MJWA 2L05A 2O6VA 4TUUA 4BVUC 2IO2B 2MA9B 3L17A 3VXWA 2ZCCA 4NQKE 2KO3A 2LGDA 2JPHA 2KFKA 3ECIA 2G3QB 1E90A 3U7DA 2KDIA 3APFA 1NDDA 1YQBA 1WM3A 3L13A 3T9LA 2KX0A 1V81A 1WGGA 2AYOB 1TTNA 3RULA 1R4NI 2YVCA 2W9NA 3VTWA 4EZLA 3B1LX 4GN1A 4I6PA 4FLHA 2ASQA 2RR9A 4MGIE 5CX3A 1P1AA 1C1YB 4ZRKA 4W9EA 3X0WA 4W9KA 1LM8B 1OEYJ 4JQWC 3W1SA 4AJYB 5CTRC 4HVBA 3KUDB 3UF8A 2M8SA 3ZNGC 3R3MA 3HK0A 5KHOA 4GDKB 3A1QA 4JLCA 3QCAA 2XBBC 2ZPYA 4NAWB 2VRRB 3K9PB 2RGFA 2IBIB 5E6OA 5AEKB 3M95A 2MBOA 3V62A 2XK5A 1OGWA 2ZCBA 2PPHA 4B9KA 1Z5SB 2N7EA 3A9JA 4G3XB 4IG7B 4WJPA 4W9CA 2KMAA 4HLEA 3P2BA 3A1QB 3H9DA 2OOBB 2XEWA 1Q0WB 5C1ZA 1H4RA 4KZ0A 5C23A 2K8CA 1EF1A 2XK5B 2BF8B 2C7NB 2GBMA 2L7RA
chains in the Genus database with same CATH superfamily
3RNAC 3A9JB 5H8YE 1E5WA 4CQNA 2CU3A 2WXMA 1B1ZA 2NBWB 2NPTB 2JZ3B 1ROEA 2I38A 1N61A 2DZMA 3TBLD 2FCSA 4TV3A 3V6CB 1WE7A 4KIKA 5IAAC 1YIWA 3RI7C 3TEXA 3PLVA 4II2B 1AW7A 4H2AA 1FEHA 3DWGC 1FCCC 3IAM1 2WXJA 2FUHB 2LVPA 2RPQA 4A3OA 1EUVB 3DBRB 1T5XD 1UZXB 2KLCA 4WURA 4OVUA 3ZTDA 2UWQA 4MSQB 2K25A 2K3UA 4ICUA 1ESFA 2Y5PA 4DDID 4LDTD 2N9EB 3KUZA 4M0WB 3ZXRA 3P1MA 3V61A 3VUXA 3JYUA 3ZQ4A 1EO6A 4LCDE 3C0RB 3UQBA 4W9GA 2PE6B 1PGXA 1YJ1A 3BY4B 1X1MA 2DHZA 1DYQA 2Y5CA 5T8IA 1FIQA 5J2RA 1I4RA 3Q8AA 1D3ZA 2FIDA 2IO1B 3MHZA 1MHXA 3TEZA 5L83A 2AQ2B 2KJHB 5HFYA 3TEYA 2LEKA 1ZUD2 4DXAB 3UI3A 1XLNA 4KV2A 3LJ3A 4F8CB 3ZJUA 2HJ8A 4G0NB 4TQ1A 4HCPB 2IGHA 2PVOD 3Q8BA 5GMVA 4KX6B 5H92C 1IYFA 1MI0A 2MWSB 4B0MA 3U7ZA 3V6EB 2JT4B 3RFZB 4A9AA 3TIXA 4RM8A 3E56A 2NPTA 1XLOA 3DVNU 1ZKHA 3FKYA 2N4FA 4FN2A 4ZHOA 2W3SA 4RCOA 5BMIA 1WXVA 1EU3A 2BQQA 4N58A 5AUKA 3APCA 3PSEB 1RLFA 3PT2B 1WXAA 3EFUA 4MM3B 4K3CA 3W5VB 2MQJA 1WGDA 2HE7A 1SE9A 5IP4D 4AJWA 1VLBA 4O1NA 1PDXA 2KMCA 2BKRB 3CWIA 1VD2A 3B2FA 2WXFA 4WJQA 4KSKC 2IYDB 1B9RA 4ANVA 4M02A 4KZCA 2JU6X 4RGNA 1T0QC 4EUTA 1MJDA 3Q3MC 4M0WA 3NHEB 2CJOA 4EZJA 3KYDD 1YX5B 3NRZA 4N59A 4RM9A 2IGGA 3RZFA 4AUQC 2WXKA 2BYFA 1ET9A 2M4NA 4S0RA 1QLBB 2K6QA 3I9V1 3CF6E 1C78A 1WE6A 2LWPA 4XX5A 2K6DB 3GS2A 3DHHC 4IC7B 2RDGA 2OEDA 2AQ1B 2K39A 2MBHA 1J7CA 1RM6C 3IT6B 1LFDA 2RD0A 1HZ5A 3Q8EA 4JGHB 5TSSA 4DBGA 1L0VB 1WFYA 1SBBB 2JVCA 4GDLA 2DENB 3AE5B 2GOWA 2D2QA 3MP9A 2K9XA 1LXDA 5G5GA 2A5UA 3PGEA 1ZDXA 1WRIA 3TL5A 1WJUA 3AE7B 1I35A 1WGYA 3L08A 1KLGD 4XDCA 3CIRB 3Q69A 2WXHA 4IWQA 3V05A 2N9LA 2KQSA 1KFYB 3BK2A 3PV1A 2KDFB 3C8YA 4MM3A 3A9KA 2DNFA 3P42A 2L8JA 4K7SA 2IDYA 1JW9D 4DHJB 1V86A 3NUHB 3DBSA 2BGFA 1OQQA 2D3CA 5AZGA 4EZKA 3VR9B 3DDCB 1OEYA 2V3SA 1LGRA 5J18A 2IJ0A 2LI5A 3R66C 1HXYD 2QHOA 2KX3A 4K7WA 2N0SB 1TS3A 3NVWA 3W1YA 1SB3C 3UQAA 1VR9A 5GXGB 4GOCA 4MSMB 2D3AA 4HRSA 1GUAB 1OQRA 2BBCA 2VH2A 3ENEA 4BAXA 2GBNA 2FE8A 1E7UA 2LD9A 3BVMA 4US8A 1P9DU 1V1PA 1V8CA 5DPRA 1H8CA 3KUCB 2JF5A 2H89B 3NZUA 2KDMA 2PLPA 1RFKA 1ZXIA 2HJ1A 1FXAA 4QAYA 3PRMB 4DHZB 1SGHA 1WSPA 4MELA 3KYCD 1EU4A 4A3PA 2EMSA 2N7DA 2BPSA 2DLBA 1WWTA 3OAWA 4RNAA 1NBFC 2DBYA 2WDTB 4II3B 5BMGA 1A70A 4BKSD 1E9MA 2WQYB 4DXFA 3PZDA 1WGKA 2DAFA 2NBVB 3AE3B 1CK1A 4BVUC 2MA9B 3MC9A 2LGDA 2KQ4X 2RMMA 2JPHA 2G3QB 3GB1A 1KLUD 2KDIA 3APFA 3GE3C 2WHIA 1WM3A 2QC8A 1V81A 2AYOB 4OZBA 3RULA 4C56C 4I6PA 4FLHA 3HVZA 2RR9A 4MGIE 4ZRKA 1C79A 2EELA 1MPEA 4YWGG 1KTKA 1JALA 5KHOA 4JLCA 2SAKA 3QCAA 4P6VF 2XBBC 2RGFA 3DHGC 4C7YA 2MBOA 1J7AA 1ENFA 4EE2A 2MJ3A 2ZCBA 3I63C 4G3XB 3NVZA 4WJPA 1TT5B 2BB5A 2W55A 2QILA 5C23A 3HIZA 1EF1A 3EFCA 2C7NB 3T8MA 3R2IA 1Y56A 4KDIC 1SJED 5EE3A 2PJHA 1WZ0A 2GBJA 2MH7A 4DK5A 2DZKA 4HDOA 4NPNA 1C3TA 3BYTB 2WX1A 4W9LA 4IUMB 4C00A 2E6XA 2JZZA 1YN3A 1E8WA 1SJHD 2CHXA 4YL8A 2BKFA 4IWOA 1YD8U 1K51A 3ONSA 5J17A 1WJ4A 2FCNA 1ZDVA 3ZNHB 3LB8C 1KLVA 3DPDA 2DZIA 3N1YC 4K81A 1R4MB 1GJZA 2ZNVC 1GAQB 4BFRA 1MG8A 3UIPB 2WXRA 4ZRQA 3KWLA 1TS5A 1SE2A 4FJVB 1WR1A 2V1YA 1WXMA 1XCQL 3WAMA 3NVVA 3DVGY 3H8HA 2CR5A 4FJZA 1CQVA 1FNWA 5BYSA 4OHJA 2AEHA 1PGBA 3QA8A 5FR6A 2PW9A 1U4AA 1GB1A 3AEFB 3SR6A 3QARA 2AL6A 3PLUA 1WYWB 4NZLB 2NTTA 2UYZB 1WXSA 1V80A 1TIFA 2DYMA 1XLQA 4RMAA 1WRDB 3RPFC 1RAXA 2K5PA 2J42A 1YN5A 1I4XA 1ZGUB 5JZEB 2MCNB 4EFOA 4IDIA 4KGRA 4ASWC 1J19A 3AN1A 1OFFA 3IG3A 1YOVB 2GMIC 2BWES 3Q2AC 1E8YA 4M00A 3KW5B 2D3BA 2NS5A 2LFIA 1R4MI 1TBEA 4IW0A 2KJ6A 2CKHB 1CMXB 2E3TA 3B9JA 3DOWA 4BKGA 3AH7A 3PRZA 3VRAB 3TMPB 1AARA 1T6BX 2IPKD 4XC2A 4IOIE 4GIVA 2NTSA 4XE0A 3VTVA 1XT9B 4N9F4 4KKIA 4PS8A 2KJRA 4CYEA 1Q5WB 4ZOHC 3WIMA 2R2OA 5CHVC 1YJIA 3VUYA 1QOGA 4K7UA 1FRRA 1XXGA 3P4QB 1RYJA 4XWWA 3I5JC 5JH5C 1RFAA 2JRIB 2LHDA 2WXIA 5HG2A 2LGSA 2KN5A 1V1OA 4IM3A 2D3GA 4MT5A 4HKQA 2QEJC 3ZJTA 3VUWA 3ZO5B 2V3PA 2AL3A 2WXPA 2X38A 3FILA 3NJTA 1HTQA 1WX8A 1L7YA 4YSYB 3X23A 2WXQA 3BVZA 4B0EA 4BKTA 1SE3A 2NVUI 3ZDMC 2L0FA 4LJPB 5JHAA 1PUTA 4RH6A 3ML9A 3CSFA 4MGZE 1T0YA 1NVID 2WX0A 2WYQA 1XQQA 3VH4B 3IBEA 1SIJA 3H7PB 3DQVA 2CHWA 2JWZA 3K9OB 5BO4B 1J0GA 3M63B 3AEAB 1NI2A 4FA6A 2GI9A 4FHJA 1JMLA 1MVKA 3AE6B 2R61A 3AMZA 2UU7A 3QWZB 1VCBA 3ZTCA 3ZIMA 2L1AA 2J7QB 1WM2A 1TZOA 1JROA 1LO5D 3NZSA 3IXSA 3T3OA 2IZVB 1V97A 3A4RA 3EA6A 1HEZE 4LNIA 2KTRA 2QSDA 2G45B 2MW5A 4A55A 1ZP0B 4P1CC 3H1UA 2V9HA 2MBBB 2M0XA 1WMHA 2MP2A 1UNSA 3DBRI 5AZFA 4FADA 5DPTA 1V5OA 3IVFA 1N62A 4GDLB 1N6ZA 1D6EC 2J53A 3M62B 4F7ZA 1JRUA 4JL9A 3HRDD 2LVQA 1FMAD 3R7RA 4OVVA 3VRBB 2ZW0A 1P3QU 3AEDB 3Q8CA 3PHXB 4GB9A 3WANA 1AWDA 2Z8LA 1P98A 3VAWA 1HE8A 1UH6A 2INCC 1ZW7A 3A33B 3A9KB 3TCAA 4WQMA 1Q10A 3EGRA 5IN7A 1FNUA 1E8ZA 2G1EA 1KOTA 2LHEA 2ZPNA 2BS3B 1ET6A 4HEA1 2LGIA 4YSZB 2XNAC 4KVGB 3OLMD 5DPWA 5C2TB 4ZYNA 2L0TA 5IA7A 2I1JA 5FKAC 2ZEQA 3H7PA 3ZXVA 3WCQA 5HHDG 3AXCA 1L5PA 2B3AA 2GBKA 2KFJA 1EF5A 3I57A 4B95A 4FBJB 4HKZE 2KT7A 4ANUA 2QDFA 3VQIA 1K52A 2Z0DB 1E6EB 2VZKB 3DWMA 1UBQA 4PYUA 2MRPA 1QOAA 2KANA 3R2TA 2N9PC 1N60A 2AX5A 2DAJA 3HUIA 4I6LB 1V1PB 2WDVB 3JSVB 2JUOA 1KH0A 3WAPA 2C7HA 3MHSD 3RNFC 4FJYA 1EWCA 3IAS1 4A90A 1P7FA 2INPE 4XDDA 2AWTA 4AOFA 3SHQA 4AS1A 3N1ZC 2B76B 5D6JB 2O2VB 3MFGA 4ZRJA 1D5MC 2ZNVB 4LTUA 2ZW1A 3AV8A 3QAQA 3MJWA 1WYGA 1CZPA 4RF0A 2L05A 4TUUA 4ARCA 3VXWA 4YTPB 1MFWA 2OHFA 2KO3A 3ECIA 3W9CB 3RMKC 3L13A 3ETRA 2KX0A 1WGGA 3MC8A 1BUIC 4EZLA 3B1LX 1KF6B 2ASQA 3ZJVA 1C1YB 1DOYA 5CTRC 1VZ8A 3UF8A 2JQRB 3R3MA 3HK0A 1NI3A 4J3OD 4NAWB 1T0SC 2VRRB 3N1XC 2IBIB 5E6OA 1ZE3D 3M95A 4A6QA 2XK5A 1VRAB 5D3IB 1OGWA 2PPHA 2MHJA 4IG7B 4W9CA 5G5HA 2BS4B 3RN9C 4YTNB 4P16A 1Q0WB 3OG5A 2RDBC 1HTOA 3AE2B 2KVZA 3CMMB 4OZCA 2ICIA 2JYTA 1VZ7A 2RSUA 3AE9B 1MG4A 3ZKJC 1JCKB 3GE8C 2IGDA 2PVGC 1ZOYB 2K1FA 4WWPA 2M17A 1E0ZA 3T3NA 4WQOB 1L4ZB 1TS2A 2KN4A 4TMAB 2MJDA 2KQ7A 2FCMA 4HJGE 1L6VA 1ACCA 4FHKA 2NMQA 2HTME 1XO3A 2KK8A 4C7ZA 1RWSA 3NOBA 4HDQA 2ONQA 1N5XA 3U30A 2LUEA 4BZAA 2JX5A 3JSVA 4KSLC 4ACFA 1YQ4B 3NZ3A 1V9JA 2C60A 2IY1B 3NY5A 5D2MB 3Q3NC 1VZ6A 2LRWA 2Y5BB 4YTMB 1F2RC 3QQ8B 5IOIA 4LNFA 3AE1B 3EECA 2J52A 4J6IA 2O2VA 2KWCA 1EWYC 4KDLB 1ISNA 1PGAA 2L52A 1S1QB 3AI5A 3AU4A 4HROA 5D94A 4JWSC 2LZ6A 1M94A 1TJEA 3QJZA 3TSSA 4CHKA 2I1KA 3DVNV 4ANWA 2GLSA 3RNGC 4NJCA 2EKIA 3AE4B 4MGKE 4BKSA 4WIPA 5DPSA 4BOZB 1FPYA 2RDHA 4NAWA 2W54A 1L2NA 1SIFA 4PK1A 1QOBA 4XWTA 3AEGB 2LMCA 4DHJD 4R3DA 5TR5A 3KVFB 2KZRA 3BIID 4RFBA 2Z59B 3DBHB 4CO7A 4N6EB 3A4SC 2LRUA 2D07B 3EC8A 3BINA 4IM0A 4D2KA 1FFUA 4W9FA 2MEKA 2RPVA 3RZWC 5HKHA 2V4IB 3RNCC 2EMTA 3N3KB 3R7QA 1SE4A 3AE8B 1J8CA 3M3JA 1I4HA 2WDRB 2YLMA 3L54A 2IY0B 3NS1A 3VFKA 2ZVNA 2CU1A 2N9XA 1IGDA 1OQYA 4LNOA 1VJKA 3DVGX 1JWBD 2KMMA 3GOEA 1IP9A 4ZYSA 5AZHA 2GBRA 2M19A 1F9JA 2PE9A 5LXHA 4G11A 1DGJA 3JW0X 3L4PA 1JRPA 1E7PB 1TZ1A 4DHZE 2L3ZA 2M0AA 4HPMB 3U4EG 4IM2A 2NCNA 1F1HA 5AUIA 1K50A 2BT6A 4JIOU 3TJPA 3PO0A 4MJSB 3NVYA 1XD3B 1UGMA 3N20C 3VH3B 3FILB 3Q3FA 2IO3B 4URKA 1ZXHA 1GC6A 2JSVX 3DBHI 5FR3A 4ZRIA 1XF5L 2WU2B 3QX1A 4E71A 2J0KA 3BZDB 1FO4A 2KC1A 1K8RB 1C77A 2J0MA 4LJOB 4LDTB 3MTNB 1WZ3A 1QILA 1UWXA 1F0ZA 1GOZA 2MBEA 3ZDTA 1YQ3B 5CHWA 2O6VD 4RGOS 4BBNC 3DCGA 2W3RA 1PFDA 1GB4A 3U52E 5LNK1 3B08A 3ABVB 3D32A 3E9SA 3W2DA 2V4LA 2KTRB 3VR8B 4RF1A 1HZ6A 4TSSA 4KGSA 2KACA 4BBNF 4P7IA 2MX2A 3W5UB 1WMHB 2MP2B 5LXIB 2J0JA 2FUG1 4E3CA 2LGXA 1TGZB 1BT0A 2LXCA 4XGAB 3WALA 1WX9A 3AULA 1V49A 2FNJB 1P0RA 1QF6A 4W9HA 3KQ4A 1HA5A 2LXAA 3P4RB 1KM7A 4L23A 1MHHE 3HVDA 3KLSX 1P7EA 2KLGA 2M56B 3UIOB 4IKGA 1S3SG 2N7JA 2ZVOA 3QHTA 4WWNA 4LNNA 2OJRA 4YSXB 2N1WA 1WJNA 1GNUA 2J4XA 4ITKA 4WWMA 1TY2A 4MJSA 4M8MA 2G4DB 3AM9A 1LQBA 2BB6A 2HD5B 3BWUD 1I4GA 2LASA 2PEAA 2QIEB 3PRPB 4C4VB 1FRDA 2LVOA 5G55A 4KKJA 2A4ZA 2M1MA 2G4SA 1NENB 1R4NB 2JWUA 1OTRB 1SF0A 2MJEA 3DHIC 2BVCA 3H7SA 1UBIA 2JYEA 4NJ6A 1EM7A 1I4PA 1WF9A 4REZA 3RUIB 4NY0A 2WXNA 2L76A 2NBUA 2CS4A 2YEPB 2KC2A 1TYGB 2KTFA 1UD7A 3ZRCA 4IWPA 2PMVA 3HM3A 5D7GA 4M01A 2FAZA 1RRBA 4MGYE 2OJWA 4JWUC 1G6JA 1QKZA 1IGCA 2SEBD 3V60A 2KKCA 4LLGM 1N63A 1L0XB 1WR6E 2L00B 3I3TB 2TSSA 4NNJB 3VTUA 1ZPSA 3ZUNA 4ARIA 4GGQA 3RNBC 1V2YA 2ZZPB 2N9KA 4WJNA 5EE0A 3BYYB 2IO2B 2V3NA 2ZCCA 5BYQA 3GZNB 4USAA 4US9A 3U7DA 1E90A 1NDDA 1YQBA 3DBLB 1R4NI 2H88B 3VTWA 2K22A 4GN1A 1XCTL 4OVZA 5CX3A 1P1AA 1FCLA 4W9KA 1OEYJ 3AECB 3W1SA 4AJYB 4HVBA 2M8SA 4GDKB 3A1QA 4ZRPA 5D3DA 5EE1A 3K9PB 3V62A 2QJLA 4B9KA 1Z5SB 2N7EA 3A9JA 2KMAA 2WDQB 4RGMA 4DXGA 3H9DA 2XEWA 5C1ZA 4KZ0A 1FNVA 2JZPA 2XK5B 4K3BA 2BF8B 3S2AA 3Q6BA 4B6WA 4C4VA 1E10A 3ZGZA 5BYRA 4PT5A 3SFDB 1Q1OA 5I4DA 1V5TA 1NYQA 1TS4A 3VDZA 4X57B 4GXBA 3APDA 2K8HA 3URYA 2EKEC 3PTFC 3GZNI 3QC8B 2REXA 4ZDVA 4DQOC 4L2YA 4EOYA 2N1VA 3DBLI 2BWFA 1FD6A 1AYFA 1C4PA 1F2RI 1T3QA 1WIAA 5G2NA 1D5XC 2JXXA 3J9CA 4AP4C 1IPGA 1WI0A 4JE3B 4XYCA 2WLBA 1A5RA 2L83A 4HPLB 5LLIA 5JXVA 2K0PA 1L4DB 1WGHA 1M4VA 2DYBA 5DCNA 4DDGD 3LDZE 5FK9C 2MBQA 3RNEC 1YX6B 5E6JA 1J7BA 3SU8X 1YMHE 3W1SC 2K8BA 3P4PB 1CJEA 3AB5A 1AN8A 2KOXA 3PZ8A 3Q3OC 4W9DA 4M8NA 1WX7A 2ZJDA 1E7VA 2DX5B 1QT9A 1HQRD 1Z2MA 4GDKA 3PHWB 3MJ5A 4L1BA 2DZJA 2GRIA 4OW0A 1QQRA 3MC0B 1UELA 3TUOA 4DWFA 2VH1A 4F1SA 4FULA 4NAMA 3H6NA 3O65B 5BMHA 3P4SB 4WJOA 3WA0A 2INNE 1SEBD 4HPPA 3ZVVA 2HTHA 4GU2A 5CHFA 4NJ7A 2ON8A 1UWMA 2WWZA 3N32A 2WXGA 1D5ZC 4WAFA 3ZNID 5E6NA 2ACZB 2WNMA 4ANXA 3HM6X 3SDLC 1JQ4A 3N30A 4WWOA 1TKEA 4W9JA 4I6NB 3JVZX 4MH0E 4WAAA 2BYTA 1TKYA 3GP7A 3LYYA 2BS2B 3OJ3A 1WY8A 3BK1A 2YEPF 2KD0A 1L6UA 3C19A 4TQ0A 2I2YA 1UGJA 3L0WB 2KWVB 1I42A 2PKOA 4W9IA 2C9WB 3L16A 3ZW3A 1YJJA 4EEWA 3Q8FA 2IO0B 2VZKD 1QZEA 1N5WA 5JHBA 2X8XX 2KDEB 1GG3A 2MSED 1TY0A 1DOIA 3TEWA 1WH3A 2FBWB 2KYWA 3ALBA 3NS8A 1YNTE 2LUMA 2BYVE 4MACA 3R8BA 2NR2A 2JRHA 1C76A 1WXQA 4MEMA 1KRHA 3PS6A 2Y3AA 4XZ4A 4AWJA 4TKNA 1KJTA 2GB1A 3SFEB 4HWIB 4NQLB 2BW2A 4GMVA 4LNKA 2WGSA 3AU5A 2WXOA 1STEA 3SD5A 2KWDA 3OJ4B 3VVWB 1K53A 3B0AA 3OWEB 2C5LC 3O13A 5EDSA 2W82A 3LXFA 4MDKE 2QMTA 3KH0A 1PYWD 3CSTA 1F77A 4PS3A 2KHWB 1IBXB 2JXTA 2MLBA 2INDC 2LJ5A 3V3XA 5C3JB 1JWSD 1VDVA 4G50A 2KXJA 4E74A 2PIAA 3RCZA 2WP9B 1IUEA 4UDUC 2KDBA 4PYZA 3VHTC 2XN9C 3QK0A 1R7SA 3PZ7A 4A8XC 3PPAA 3RD2A 4EKUA 3IT4B 2Z0EB 4HXDA 2C7MB 2KVRA 4ICVA 3L10B 4YXDB 1D4BA 4AQ7A 2BYEA 4C80A 3AEEB 3FC4A 3P63A 2CHZA 3HHMA 4OZAA 2O6VB 2JY6A 3EHVA 5EE9A 3Q3JA 3UINB 2KFKB 4HK2A 2HDEA 4LK0M 3RYTA 4HJKA 1XLPA 1C4CA 1FFVA 2LJIA 3ZRFA 1JWMD 4YT0B 3ZYYX 3ZLZA 1DOXA 1PQSA 3PVLA 4PS7A 2WXLA 1WJ6A 3N9YC 1SXTA 1I4QA 3UGBB 3WAOA 4JX1C 2G9HD 5HI1A 3IHPC 3Q14C 1I7HA 1WGRA 3U8ZA 3AEBB 2Q5WD 1TKGA 2D11A 3ZNZB 3BVGA 2BTEA 1YN4A 4GSWA 4WH4A 3RT3B 1V6EA 5IKCM 2L32A 4HCNB 5L95C 1C9FA 1FM0D 1L0YB 1BMLC 3SEBA 4A20A 2KNBA 2DWQA 1E8XA 1UF0A 4KGTA 4KIKB 1GPXA 3ML8A 5MPOA 1QOFA 5E6PA 1FXIA 2DYOA 1Y8RC 2LGYA 1UUPA 1FXTB 1IBXA 2KWUB 5KHQA 3IFWB 4MH8A 2PTLA 2D10A 3NG0A 4K1RB 1C4AA 4BOSC 1JWAD 4RGTA 1T0RC 2KAJA 1NYRA 2FCQA 2FIFA 2WS3B 2AQ3B 3PREA 2WU5B 2R2QA 4GLSC 3B2GA 1GC7A 3QIJA 4JPSA 2O6VA 3L17A 4NQKE 2KFKA 1BXTA 2V0GA 3T9LA 1XEEA 2QCZA 1NEKB 1TTNA 2YVCA 2W9NA 4S17A 3U2SC 4W9EA 3X0WA 1LM8B 4ZHPA 4JQWC 4FXCA 3KUDB 3ZNGC 1SSNA 5IO9A 4Q2JA 2ZPYA 2D5GA 5AEKB 3EUB2 3KWVA 4HLEA 3P2BA 1JWUD 3A1QB 2CJNA 4P1BC 2OOBB 1F52A 1H4RA 2K8CA 3FAHA 2GBMA 2L7RA
chains in the Genus database with same CATH topology
3T8MA 4B6WA 3A9JB 3CMMB 1E5WA 4KDIC 2PJHA 2RSUA 1WZ0A 2GBJA 2NBWB 4DK5A 2NPTB 2DZKA 4HDOA 4NPNA 1C3TA 1Q1OA 1V5TA 2JZ3B 3ZKJC 4W9LA 2WX1A 2DZMA 4IUMB 3TBLD 2FCSA 4TV3A 3V6CB 1WE7A 2JZZA 4KIKA 5IAAC 3VDZA 2K1FA 1E8WA 4WWPA 2M17A 4X57B 4GXBA 2CHXA 3APDA 2K8HA 1YIWA 2EKEC 3PLVA 4YL8A 2BKFA 4IWOA 4II2B 1YD8U 4WQOB 3ONSA 3PTFC 5J17A 3GZNI 1WJ4A 2FCNA 3QC8B 2KQ7A 2REXA 4ZDVA 2FUHB 2FCMA 3ZNHB 4EOYA 2N1VA 3DBLI 2LVPA 2RPQA 4A3OA 4FHKA 1KLVA 1EUVB 2BWFA 3DPDA 2KK8A 2DZIA 1UZXB 2KLCA 1WIAA 3NOBA 4K81A 5G2NA 2JXXA 1GJZA 2ZNVC 4HDQA 4BFRA 1MG8A 4OVUA 4AP4C 3UIPB 3U30A 3ZTDA 2UWQA 4MSQB 2K25A 1IPGA 2LUEA 1WI0A 3JSVA 4KSLC 4FJVB 1WR1A 1A5RA 1V9JA 4ICUA 2V1YA 1WXMA 3WAMA 2C60A 3DVGY 2IY1B 3NY5A 4HPLB 5LLIA 4DDID 2CR5A 4FJZA 5D2MB 4LDTD 2N9EB 2LRWA 2Y5BB 3QQ8B 3KUZA 2AEHA 4M0WB 1WGHA 3QA8A 3V61A 2DYBA 5FR6A 3VUXA 3EECA 3JYUA 1U4AA 1EO6A 5DCNA 4DDGD 3LDZE 2AL6A 3QARA 2O2VA 3PLUA 1WYWB 2KWCA 3C0RB 4J6IA 4LCDE 3UQBA 2MBQA 2UYZB 4KDLB 4W9GA 1WXSA 2PE6B 1V80A 1YJ1A 1ISNA 3BY4B 1X1MA 1YX6B 1S1QB 3AI5A 3AU4A 2DYMA 4RMAA 2DHZA 5D94A 3SU8X 1WRDB 2LZ6A 1M94A 3W1SC 2K8BA 3QJZA 5J2RA 1RAXA 4CHKA 1ZGUB 2I1KA 1D3ZA 2FIDA 2IO1B 3DVNV 4ANWA 2KOXA 5JZEB 4W9DA 4M8NA 1WX7A 5L83A 2KJHB 2ZJDA 1E7VA 4MGKE 4BKSA 2MCNB 2DX5B 4EFOA 4DXAB 4ASWC 4KV2A 3LJ3A 5DPSA 4BOZB 4F8CB 1Z2MA 1J19A 4GDKA 3PHWB 2HJ8A 4G0NB 3IG3A 4TQ1A 4NAWA 2DZJA 2GMIC 2BWES 1E8YA 1L2NA 3KW5B 1SIFA 4HCPB 1UELA 4DWFA 2NS5A 4F1SA 4FULA 1R4MI 5GMVA 3H6NA 1TBEA 3O65B 4IW0A 1IYFA 3HIZA 2KJ6A 4WJOA 2MWSB 2CKHB 1CMXB 4DHJD 3DOWA 3WA0A 4BKGA 3V6EB 3PRZA 5TR5A 3ZVVA 2HTHA 3KVFB 3TMPB 1AARA 2JT4B 4GU2A 4XC2A 5CHFA 4NJ7A 2KZRA 2WWZA 3N32A 4GIVA 2Z59B 4CO7A 3TIXA 3ZNID 4RM8A 3A4SC 5E6NA 3VTVA 1XT9B 2D07B 2LRUA 3EC8A 4N9F4 3BINA 4IM0A 4PS8A 2NPTA 4ANXA 3HM6X 4W9FA 2KJRA 3RZWC 3DVNU 1Q5WB 3SDLC 3WIMA 4CYEA 5HKHA 1ZKHA 2R2OA 5CHVC 3VUYA 2EMTA 3N30A 2N4FA 4W9JA 4K7UA 3N3KB 4FN2A 4I6NB 4WWOA 3R7QA 1J8CA 3JVZX 3M3JA 1WXVA 4MH0E 5JH5C 4WAAA 2YLMA 3L54A 2IY0B 1RFAA 3APCA 3PSEB 3VFKA 1RLFA 2ZVNA 2CU1A 3PT2B 1WXAA 2JRIB 2N9XA 3EFUA 1OQYA 3OJ3A 3DVGX 1WY8A 2KD0A 2MQJA 3GOEA 1IP9A 1WGDA 2HE7A 5AZHA 4TQ0A 1SE9A 3L0WB 4AJWA 2KWVB 2GBRA 1I42A 2KN5A 1F9JA 2PE9A 4W9IA 2KMCA 5LXHA 4IM3A 2D3GA 2BKRB 4G11A 2C9WB 3JW0X 3L16A 3ZW3A 1VD2A 3VUWA 3ZO5B 4EEWA 1TZ1A 2IO0B 2L3ZA 2AL3A 1QZEA 4WJQA 4DHZE 5JHBA 4HPMB 4KSKC 2KDEB 4IM2A 2NCNA 1GG3A 2IYDB 2MSED 4ANVA 1WX8A 1L7YA 4JIOU 3X23A 1WH3A 3TJPA 4BKTA 4KZCA 2NVUI 3ALBA 3NS8A 4MJSB 2L0FA 4LJPB 3ZDMC 5JHAA 4EUTA 2BYVE 3ML9A 1XD3B 1UGMA 2NR2A 2JRHA 3NHEB 3CSFA 4EZJA 4MGZE 3VH3B 3KYDD 1YX5B 1T0YA 3Q3FA 2WX0A 4MEMA 2IO3B 3PS6A 4RM9A 2WYQA 1XQQA 3VH4B 4URKA 4XZ4A 1GC6A 4AWJA 4TKNA 1KJTA 3IBEA 3H7PB 3DQVA 3DBHI 3RZFA 4AUQC 2CHWA 4HWIB 2BYFA 2JWZA 4NQLB 4ZRIA 3K9OB 5BO4B 4GMVA 1J0GA 2M4NA 3AU5A 3M63B 2K6QA 1NI2A 4FA6A 3CF6E 3QX1A 4E71A 1WE6A 2J0KA 4FHJA 2LWPA 4XX5A 3SD5A 2K6DB 3OJ4B 3VVWB 4IC7B 3B0AA 5EDSA 2C5LC 2KC1A 2K39A 4MDKE 2MBHA 3KH0A 3QWZB 1VCBA 3CSTA 3ZTCA 3ZIMA 2J7QB 1K8RB 1WM2A 1LFDA 2J0MA 4PS3A 4LJOB 2RD0A 4LDTB 2KHWB 3MTNB 1WZ3A 3NZSA 4JGHB 2MLBA 2IZVB 2LJ5A 3A4RA 4G50A 2MBEA 3ZDTA 4DBGA 2KXJA 4E74A 2KTRA 1WFYA 2G45B 2MW5A 5CHWA 3RCZA 2O6VD 2JVCA 4BBNC 3DCGA 4GDLA 2DENB 3H1UA 2MBBB 2M0XA 1WMHA 2KDBA 2MP2A 3B08A 3D32A 2GOWA 3DBRI 4PYZA 5AZFA 3VHTC 4FADA 2D2QA 5DPTA 1V5OA 2V4LA 3QK0A 1LXDA 2KTRB 2A5UA 3PGEA 3IVFA 3PPAA 3RD2A 3TL5A 1WJUA 4EKUA 1I35A 4GDLB 2Z0EB 1WGYA 4HXDA 4BBNF 3L08A 2C7MB 2MX2A 4P7IA 1WMHB 2MP2B 2KVRA 4ICVA 3L10B 3M62B 2J0JA 5LXIB 2BYEA 4E3CA 2LGXA 1TGZB 1BT0A 2LXCA 4F7ZA 2CHZA 3HHMA 4IWQA 2O6VB 3WALA 1JRUA 4JL9A 2JY6A 2LVQA 3EHVA 2KQSA 1WX9A 3Q3JA 3AULA 3UINB 2KFKB 4HK2A 1V49A 2FNJB 1P0RA 3R7RA 3PV1A 3RYTA 4OVVA 4W9HA 4HJKA 2KDFB 2LXAA 4MM3A 1P3QU 1KM7A 3A9KA 3PHXB 4GB9A 2KLGA 2L8JA 3WANA 4K7SA 3ZRFA 1P98A 3UIOB 3VAWA 4DHJB 1V86A 1S3SG 3ZLZA 1HE8A 3DBSA 2ZVOA 3QHTA 4WWNA 1UH6A 1PQSA 2BGFA 3PVLA 4PS7A 1ZW7A 3A33B 2OJRA 3A9KB 3TCAA 2N1WA 5AZGA 1WJNA 1WJ6A 4EZKA 1GNUA 3DDCB 1OEYA 2V3SA 3UGBB 1E8ZA 1KOTA 3WAOA 2ZPNA 5J18A 2LI5A 3R66C 3IHPC 1WGRA 2QHOA 2KX3A 3U8ZA 4MJSA 4K7WA 4M8MA 2G4DB 4KVGB 1LQBA 3OLMD 5DPWA 2HD5B 2D11A 3ZNZB 4ZYNA 2L0TA 3W1YA 3S2AA 4GSWA 2LASA 2PEAA 3UQAA 3PRPB 3RT3B 1V6EA 5IA7A 2I1JA 4GOCA 2ZEQA 2LVOA 3H7PA 5G55A 4HCNB 4MSMB 5L95C 3AXCA 2B3AA 2A4ZA 2GBKA 2M1MA 4A20A 2KFJA 1GUAB 2KNBA 2G4SA 1EF5A 1E8XA 4B95A 4FBJB 4KIKB 1OTRB 3ENEA 3ML8A 4ANUA 3VQIA 3H7SA 1UBIA 2Z0DB 4NJ6A 1UBQA 1WF9A 2GBNA 5E6PA 3RUIB 4NY0A 4PYUA 2LD9A 1E7UA 2L76A 2MRPA 2DYOA 1P9DU 2NBUA 2CS4A 2KC2A 2KANA 5DPRA 2KTFA 1H8CA 2N9PC 1Y8RC 2LGYA 1UD7A 3ZRCA 4IWPA 3KUCB 1FXTB 3HM3A 2JF5A 5D7GA 3NZUA 2FAZA 1RRBA 4MGYE 2KWUB 5KHQA 2DAJA 1G6JA 3IFWB 4I6LB 3PRMB 4DHZB 1SGHA 3V60A 2D10A 3JSVB 2JUOA 4MELA 2KKCA 3WAPA 3KYCD 2C7HA 3MHSD 4K1RB 4A3PA 4FJYA 2EMSA 2N7DA 1WR6E 2BPSA 2L00B 3I3TB 4BOSC 3OAWA 1NBFC 4NNJB 2AWTA 4AOFA 3SHQA 2WDTB 3VTUA 2FCQA 2FIFA 4II3B 4BKSD 5D6JB 3PREA 2O2VB 3PZDA 3ZUNA 4ZRJA 2R2QA 4GGQA 2DAFA 2ZNVB 1GC7A 1V2YA 2ZZPB 3QIJA 2NBVB 4WJNA 3QAQA 3MJWA 2L05A 2O6VA 4TUUA 4BVUC 2IO2B 2MA9B 3L17A 3VXWA 2ZCCA 4NQKE 2KO3A 2LGDA 2JPHA 2KFKA 3ECIA 2G3QB 1E90A 3U7DA 2KDIA 3APFA 1NDDA 1YQBA 1WM3A 3L13A 3T9LA 2KX0A 1V81A 1WGGA 2AYOB 1TTNA 3RULA 1R4NI 2YVCA 2W9NA 3VTWA 4EZLA 3B1LX 4GN1A 4I6PA 4FLHA 2ASQA 2RR9A 4MGIE 5CX3A 1P1AA 1C1YB 4ZRKA 4W9EA 3X0WA 4W9KA 1LM8B 1OEYJ 4JQWC 3W1SA 4AJYB 5CTRC 4HVBA 3KUDB 3UF8A 2M8SA 3ZNGC 3R3MA 3HK0A 5KHOA 4GDKB 3A1QA 4JLCA 3QCAA 2XBBC 2ZPYA 4NAWB 2VRRB 3K9PB 2RGFA 2IBIB 5E6OA 5AEKB 3M95A 2MBOA 3V62A 2XK5A 1OGWA 2ZCBA 2PPHA 4B9KA 1Z5SB 2N7EA 3A9JA 4G3XB 4IG7B 4WJPA 4W9CA 2KMAA 4HLEA 3P2BA 3A1QB 3H9DA 2OOBB 2XEWA 1Q0WB 5C1ZA 1H4RA 4KZ0A 5C23A 2K8CA 1EF1A 2XK5B 2BF8B 2C7NB 2GBMA 2L7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8M A;  4B6W A;  3A9J B;  3CMM B;  1E5W A;  4KDI C;  2PJH A;  2RSU A;  1WZ0 A;  2GBJ A;  2NBW B;  4DK5 A;  2NPT B;  2DZK A;  4HDO A;  4NPN A;  1C3T A;  1Q1O A;  1V5T A;  2JZ3 B;  3ZKJ C;  4W9L A;  2WX1 A;  2DZM A;  4IUM B;  3TBL D;  2FCS A;  4TV3 A;  3V6C B;  1WE7 A;  2JZZ A;  4KIK A;  5IAA C;  3VDZ A;  2K1F A;  1E8W A;  4WWP A;  2M17 A;  4X57 B;  4GXB A;  2CHX A;  3APD A;  2K8H A;  1YIW A;  2EKE C;  3PLV A;  4YL8 A;  2BKF A;  4IWO A;  4II2 B;  1YD8 U;  4WQO B;  3ONS A;  3PTF C;  5J17 A;  3GZN I;  1WJ4 A;  2FCN A;  3QC8 B;  2KQ7 A;  2REX A;  4ZDV A;  2FUH B;  2FCM A;  3ZNH B;  4EOY A;  2N1V A;  3DBL I;  2LVP A;  2RPQ A;  4A3O A;  4FHK A;  1KLV A;  1EUV B;  2BWF A;  3DPD A;  2KK8 A;  2DZI A;  1UZX B;  2KLC A;  1WIA A;  3NOB A;  4K81 A;  5G2N A;  2JXX A;  1GJZ A;  2ZNV C;  4HDQ A;  4BFR A;  1MG8 A;  4OVU A;  4AP4 C;  3UIP B;  3U30 A;  3ZTD A;  2UWQ A;  4MSQ B;  2K25 A;  1IPG A;  2LUE A;  1WI0 A;  3JSV A;  4KSL C;  4FJV B;  1WR1 A;  1A5R A;  1V9J A;  4ICU A;  2V1Y A;  1WXM A;  3WAM A;  2C60 A;  3DVG Y;  2IY1 B;  3NY5 A;  4HPL B;  5LLI A;  4DDI D;  2CR5 A;  4FJZ A;  5D2M B;  4LDT D;  2N9E B;  2LRW A;  2Y5B B;  3QQ8 B;  3KUZ A;  2AEH A;  4M0W B;  1WGH A;  3QA8 A;  3V61 A;  2DYB A;  5FR6 A;  3VUX A;  3EEC A;  3JYU A;  1U4A A;  1EO6 A;  5DCN A;  4DDG D;  3LDZ E;  2AL6 A;  3QAR A;  2O2V A;  3PLU A;  1WYW B;  2KWC A;  3C0R B;  4J6I A;  4LCD E;  3UQB A;  2MBQ A;  2UYZ B;  4KDL B;  4W9G A;  1WXS A;  2PE6 B;  1V80 A;  1YJ1 A;  1ISN A;  3BY4 B;  1X1M A;  1YX6 B;  1S1Q B;  3AI5 A;  3AU4 A;  2DYM A;  4RMA A;  2DHZ A;  5D94 A;  3SU8 X;  1WRD B;  2LZ6 A;  1M94 A;  3W1S C;  2K8B A;  3QJZ A;  5J2R A;  1RAX A;  4CHK A;  1ZGU B;  2I1K A;  1D3Z A;  2FID A;  2IO1 B;  3DVN V;  4ANW A;  2KOX A;  5JZE B;  4W9D A;  4M8N A;  1WX7 A;  5L83 A;  2KJH B;  2ZJD A;  1E7V A;  4MGK E;  4BKS A;  2MCN B;  2DX5 B;  4EFO A;  4DXA B;  4ASW C;  4KV2 A;  3LJ3 A;  5DPS A;  4BOZ B;  4F8C B;  1Z2M A;  1J19 A;  4GDK A;  3PHW B;  2HJ8 A;  4G0N B;  3IG3 A;  4TQ1 A;  4NAW A;  2DZJ A;  2GMI C;  2BWE S;  1E8Y A;  1L2N A;  3KW5 B;  1SIF A;  4HCP B;  1UEL A;  4DWF A;  2NS5 A;  4F1S A;  4FUL A;  1R4M I;  5GMV A;  3H6N A;  1TBE A;  3O65 B;  4IW0 A;  1IYF A;  3HIZ A;  2KJ6 A;  4WJO A;  2MWS B;  2CKH B;  1CMX B;  4DHJ D;  3DOW A;  3WA0 A;  4BKG A;  3V6E B;  3PRZ A;  5TR5 A;  3ZVV A;  2HTH A;  3KVF B;  3TMP B;  1AAR A;  2JT4 B;  4GU2 A;  4XC2 A;  5CHF A;  4NJ7 A;  2KZR A;  2WWZ A;  3N32 A;  4GIV A;  2Z59 B;  4CO7 A;  3TIX A;  3ZNI D;  4RM8 A;  3A4S C;  5E6N A;  3VTV A;  1XT9 B;  2D07 B;  2LRU A;  3EC8 A;  4N9F 4;  3BIN A;  4IM0 A;  4PS8 A;  2NPT A;  4ANX A;  3HM6 X;  4W9F A;  2KJR A;  3RZW C;  3DVN U;  1Q5W B;  3SDL C;  3WIM A;  4CYE A;  5HKH A;  1ZKH A;  2R2O A;  5CHV C;  3VUY A;  2EMT A;  3N30 A;  2N4F A;  4W9J A;  4K7U A;  3N3K B;  4FN2 A;  4I6N B;  4WWO A;  3R7Q A;  1J8C A;  3JVZ X;  3M3J A;  1WXV A;  4MH0 E;  5JH5 C;  4WAA A;  2YLM A;  3L54 A;  2IY0 B;  1RFA A;  3APC A;  3PSE B;  3VFK A;  1RLF A;  2ZVN A;  2CU1 A;  3PT2 B;  1WXA A;  2JRI B;  2N9X A;  3EFU A;  1OQY A;  3OJ3 A;  3DVG X;  1WY8 A;  2KD0 A;  2MQJ A;  3GOE A;  1IP9 A;  1WGD A;  2HE7 A;  5AZH A;  4TQ0 A;  1SE9 A;  3L0W B;  4AJW A;  2KWV B;  2GBR A;  1I42 A;  2KN5 A;  1F9J A;  2PE9 A;  4W9I A;  2KMC A;  5LXH A;  4IM3 A;  2D3G A;  2BKR B;  4G11 A;  2C9W B;  3JW0 X;  3L16 A;  3ZW3 A;  1VD2 A;  3VUW A;  3ZO5 B;  4EEW A;  1TZ1 A;  2IO0 B;  2L3Z A;  2AL3 A;  1QZE A;  4WJQ A;  4DHZ E;  5JHB A;  4HPM B;  4KSK C;  2KDE B;  4IM2 A;  2NCN A;  1GG3 A;  2IYD B;  2MSE D;  4ANV A;  1WX8 A;  1L7Y A;  4JIO U;  3X23 A;  1WH3 A;  3TJP A;  4BKT A;  4KZC A;  2NVU I;  3ALB A;  3NS8 A;  4MJS B;  2L0F A;  4LJP B;  3ZDM C;  5JHA A;  4EUT A;  2BYV E;  3ML9 A;  1XD3 B;  1UGM A;  2NR2 A;  2JRH A;  3NHE B;  3CSF A;  4EZJ A;  4MGZ E;  3VH3 B;  3KYD D;  1YX5 B;  1T0Y A;  3Q3F A;  2WX0 A;  4MEM A;  2IO3 B;  3PS6 A;  4RM9 A;  2WYQ A;  1XQQ A;  3VH4 B;  4URK A;  4XZ4 A;  1GC6 A;  4AWJ A;  4TKN A;  1KJT A;  3IBE A;  3H7P B;  3DQV A;  3DBH I;  3RZF A;  4AUQ C;  2CHW A;  4HWI B;  2BYF A;  2JWZ A;  4NQL B;  4ZRI A;  3K9O B;  5BO4 B;  4GMV A;  1J0G A;  2M4N A;  3AU5 A;  3M63 B;  2K6Q A;  1NI2 A;  4FA6 A;  3CF6 E;  3QX1 A;  4E71 A;  1WE6 A;  2J0K A;  4FHJ A;  2LWP A;  4XX5 A;  3SD5 A;  2K6D B;  3OJ4 B;  3VVW B;  4IC7 B;  3B0A A;  5EDS A;  2C5L C;  2KC1 A;  2K39 A;  4MDK E;  2MBH A;  3KH0 A;  3QWZ B;  1VCB A;  3CST A;  3ZTC A;  3ZIM A;  2J7Q B;  1K8R B;  1WM2 A;  1LFD A;  2J0M A;  4PS3 A;  4LJO B;  2RD0 A;  4LDT B;  2KHW B;  3MTN B;  1WZ3 A;  3NZS A;  4JGH B;  2MLB A;  2IZV B;  2LJ5 A;  3A4R A;  4G50 A;  2MBE A;  3ZDT A;  4DBG A;  2KXJ A;  4E74 A;  2KTR A;  1WFY A;  2G45 B;  2MW5 A;  5CHW A;  3RCZ A;  2O6V D;  2JVC A;  4BBN C;  3DCG A;  4GDL A;  2DEN B;  3H1U A;  2MBB B;  2M0X A;  1WMH A;  2KDB A;  2MP2 A;  3B08 A;  3D32 A;  2GOW A;  3DBR I;  4PYZ A;  5AZF A;  3VHT C;  4FAD A;  2D2Q A;  5DPT A;  1V5O A;  2V4L A;  3QK0 A;  1LXD A;  2KTR B;  2A5U A;  3PGE A;  3IVF A;  3PPA A;  3RD2 A;  3TL5 A;  1WJU A;  4EKU A;  1I35 A;  4GDL B;  2Z0E B;  1WGY A;  4HXD A;  4BBN F;  3L08 A;  2C7M B;  2MX2 A;  4P7I A;  1WMH B;  2MP2 B;  2KVR A;  4ICV A;  3L10 B;  3M62 B;  2J0J A;  5LXI B;  2BYE A;  4E3C A;  2LGX A;  1TGZ B;  1BT0 A;  2LXC A;  4F7Z A;  2CHZ A;  3HHM A;  4IWQ A;  2O6V B;  3WAL A;  1JRU A;  4JL9 A;  2JY6 A;  2LVQ A;  3EHV A;  2KQS A;  1WX9 A;  3Q3J A;  3AUL A;  3UIN B;  2KFK B;  4HK2 A;  1V49 A;  2FNJ B;  1P0R A;  3R7R A;  3PV1 A;  3RYT A;  4OVV A;  4W9H A;  4HJK A;  2KDF B;  2LXA A;  4MM3 A;  1P3Q U;  1KM7 A;  3A9K A;  3PHX B;  4GB9 A;  2KLG A;  2L8J A;  3WAN A;  4K7S A;  3ZRF A;  1P98 A;  3UIO B;  3VAW A;  4DHJ B;  1V86 A;  1S3S G;  3ZLZ A;  1HE8 A;  3DBS A;  2ZVO A;  3QHT A;  4WWN A;  1UH6 A;  1PQS A;  2BGF A;  3PVL A;  4PS7 A;  1ZW7 A;  3A33 B;  2OJR A;  3A9K B;  3TCA A;  2N1W A;  5AZG A;  1WJN A;  1WJ6 A;  4EZK A;  1GNU A;  3DDC B;  1OEY A;  2V3S A;  3UGB B;  1E8Z A;  1KOT A;  3WAO A;  2ZPN A;  5J18 A;  2LI5 A;  3R66 C;  3IHP C;  1WGR A;  2QHO A;  2KX3 A;  3U8Z A;  4MJS A;  4K7W A;  4M8M A;  2G4D B;  4KVG B;  1LQB A;  3OLM D;  5DPW A;  2HD5 B;  2D11 A;  3ZNZ B;  4ZYN A;  2L0T A;  3W1Y A;  3S2A A;  4GSW A;  2LAS A;  2PEA A;  3UQA A;  3PRP B;  3RT3 B;  1V6E A;  5IA7 A;  2I1J A;  4GOC A;  2ZEQ A;  2LVO A;  3H7P A;  5G55 A;  4HCN B;  4MSM B;  5L95 C;  3AXC A;  2B3A A;  2A4Z A;  2GBK A;  2M1M A;  4A20 A;  2KFJ A;  1GUA B;  2KNB A;  2G4S A;  1EF5 A;  1E8X A;  4B95 A;  4FBJ B;  4KIK B;  1OTR B;  3ENE A;  3ML8 A;  4ANU A;  3VQI A;  3H7S A;  1UBI A;  2Z0D B;  4NJ6 A;  1UBQ A;  1WF9 A;  2GBN A;  5E6P A;  3RUI B;  4NY0 A;  4PYU A;  2LD9 A;  1E7U A;  2L76 A;  2MRP A;  2DYO A;  1P9D U;  2NBU A;  2CS4 A;  2KC2 A;  2KAN A;  5DPR A;  2KTF A;  1H8C A;  2N9P C;  1Y8R C;  2LGY A;  1UD7 A;  3ZRC A;  4IWP A;  3KUC B;  1FXT B;  3HM3 A;  2JF5 A;  5D7G A;  3NZU A;  2FAZ A;  1RRB A;  4MGY E;  2KWU B;  5KHQ A;  2DAJ A;  1G6J A;  3IFW B;  4I6L B;  3PRM B;  4DHZ B;  1SGH A;  3V60 A;  2D10 A;  3JSV B;  2JUO A;  4MEL A;  2KKC A;  3WAP A;  3KYC D;  2C7H A;  3MHS D;  4K1R B;  4A3P A;  4FJY A;  2EMS A;  2N7D A;  1WR6 E;  2BPS A;  2L00 B;  3I3T B;  4BOS C;  3OAW A;  1NBF C;  4NNJ B;  2AWT A;  4AOF A;  3SHQ A;  2WDT B;  3VTU A;  2FCQ A;  2FIF A;  4II3 B;  4BKS D;  5D6J B;  3PRE A;  2O2V B;  3PZD A;  3ZUN A;  4ZRJ A;  2R2Q A;  4GGQ A;  2DAF A;  2ZNV B;  1GC7 A;  1V2Y A;  2ZZP B;  3QIJ A;  2NBV B;  4WJN A;  3QAQ A;  3MJW A;  2L05 A;  2O6V A;  4TUU A;  4BVU C;  2IO2 B;  2MA9 B;  3L17 A;  3VXW A;  2ZCC A;  4NQK E;  2KO3 A;  2LGD A;  2JPH A;  2KFK A;  3ECI A;  2G3Q B;  1E90 A;  3U7D A;  2KDI A;  3APF A;  1NDD A;  1YQB A;  1WM3 A;  3L13 A;  3T9L A;  2KX0 A;  1V81 A;  1WGG A;  2AYO B;  1TTN A;  3RUL A;  1R4N I;  2YVC A;  2W9N A;  3VTW A;  4EZL A;  3B1L X;  4GN1 A;  4I6P A;  4FLH A;  2ASQ A;  2RR9 A;  4MGI E;  5CX3 A;  1P1A A;  1C1Y B;  4ZRK A;  4W9E A;  3X0W A;  4W9K A;  1LM8 B;  1OEY J;  4JQW C;  3W1S A;  4AJY B;  5CTR C;  4HVB A;  3KUD B;  3UF8 A;  2M8S A;  3ZNG C;  3R3M A;  3HK0 A;  5KHO A;  4GDK B;  3A1Q A;  4JLC A;  3QCA A;  2XBB C;  2ZPY A;  4NAW B;  2VRR B;  3K9P B;  2RGF A;  2IBI B;  5E6O A;  5AEK B;  3M95 A;  2MBO A;  3V62 A;  2XK5 A;  1OGW A;  2ZCB A;  2PPH A;  4B9K A;  1Z5S B;  2N7E A;  3A9J A;  4G3X B;  4IG7 B;  4WJP A;  4W9C A;  2KMA A;  4HLE A;  3P2B A;  3A1Q B;  3H9D A;  2OOB B;  2XEW A;  1Q0W B;  5C1Z A;  1H4R A;  4KZ0 A;  5C23 A;  2K8C A;  1EF1 A;  2XK5 B;  2BF8 B;  2C7N B;  2GBM A;  2L7R A; 
#chains in the Genus database with same CATH topology
 3RNA C;  3A9J B;  5H8Y E;  1E5W A;  4CQN A;  2CU3 A;  2WXM A;  1B1Z A;  2NBW B;  2NPT B;  2JZ3 B;  1ROE A;  2I38 A;  1N61 A;  2DZM A;  3TBL D;  2FCS A;  4TV3 A;  3V6C B;  1WE7 A;  4KIK A;  5IAA C;  1YIW A;  3RI7 C;  3TEX A;  3PLV A;  4II2 B;  1AW7 A;  4H2A A;  1FEH A;  3DWG C;  1FCC C;  3IAM 1;  2WXJ A;  2FUH B;  2LVP A;  2RPQ A;  4A3O A;  1EUV B;  3DBR B;  1T5X D;  1UZX B;  2KLC A;  4WUR A;  4OVU A;  3ZTD A;  2UWQ A;  4MSQ B;  2K25 A;  2K3U A;  4ICU A;  1ESF A;  2Y5P A;  4DDI D;  4LDT D;  2N9E B;  3KUZ A;  4M0W B;  3ZXR A;  3P1M A;  3V61 A;  3VUX A;  3JYU A;  3ZQ4 A;  1EO6 A;  4LCD E;  3C0R B;  3UQB A;  4W9G A;  2PE6 B;  1PGX A;  1YJ1 A;  3BY4 B;  1X1M A;  2DHZ A;  1DYQ A;  2Y5C A;  5T8I A;  1FIQ A;  5J2R A;  1I4R A;  3Q8A A;  1D3Z A;  2FID A;  2IO1 B;  3MHZ A;  1MHX A;  3TEZ A;  5L83 A;  2AQ2 B;  2KJH B;  5HFY A;  3TEY A;  2LEK A;  1ZUD 2;  4DXA B;  3UI3 A;  1XLN A;  4KV2 A;  3LJ3 A;  4F8C B;  3ZJU A;  2HJ8 A;  4G0N B;  4TQ1 A;  4HCP B;  2IGH A;  2PVO D;  3Q8B A;  5GMV A;  4KX6 B;  5H92 C;  1IYF A;  1MI0 A;  2MWS B;  4B0M A;  3U7Z A;  3V6E B;  2JT4 B;  3RFZ B;  4A9A A;  3TIX A;  4RM8 A;  3E56 A;  2NPT A;  1XLO A;  3DVN U;  1ZKH A;  3FKY A;  2N4F A;  4FN2 A;  4ZHO A;  2W3S A;  4RCO A;  5BMI A;  1WXV A;  1EU3 A;  2BQQ A;  4N58 A;  5AUK A;  3APC A;  3PSE B;  1RLF A;  3PT2 B;  1WXA A;  3EFU A;  4MM3 B;  4K3C A;  3W5V B;  2MQJ A;  1WGD A;  2HE7 A;  1SE9 A;  5IP4 D;  4AJW A;  1VLB A;  4O1N A;  1PDX A;  2KMC A;  2BKR B;  3CWI A;  1VD2 A;  3B2F A;  2WXF A;  4WJQ A;  4KSK C;  2IYD B;  1B9R A;  4ANV A;  4M02 A;  4KZC A;  2JU6 X;  4RGN A;  1T0Q C;  4EUT A;  1MJD A;  3Q3M C;  4M0W A;  3NHE B;  2CJO A;  4EZJ A;  3KYD D;  1YX5 B;  3NRZ A;  4N59 A;  4RM9 A;  2IGG A;  3RZF A;  4AUQ C;  2WXK A;  2BYF A;  1ET9 A;  2M4N A;  4S0R A;  1QLB B;  2K6Q A;  3I9V 1;  3CF6 E;  1C78 A;  1WE6 A;  2LWP A;  4XX5 A;  2K6D B;  3GS2 A;  3DHH C;  4IC7 B;  2RDG A;  2OED A;  2AQ1 B;  2K39 A;  2MBH A;  1J7C A;  1RM6 C;  3IT6 B;  1LFD A;  2RD0 A;  1HZ5 A;  3Q8E A;  4JGH B;  5TSS A;  4DBG A;  1L0V B;  1WFY A;  1SBB B;  2JVC A;  4GDL A;  2DEN B;  3AE5 B;  2GOW A;  2D2Q A;  3MP9 A;  2K9X A;  1LXD A;  5G5G A;  2A5U A;  3PGE A;  1ZDX A;  1WRI A;  3TL5 A;  1WJU A;  3AE7 B;  1I35 A;  1WGY A;  3L08 A;  1KLG D;  4XDC A;  3CIR B;  3Q69 A;  2WXH A;  4IWQ A;  3V05 A;  2N9L A;  2KQS A;  1KFY B;  3BK2 A;  3PV1 A;  2KDF B;  3C8Y A;  4MM3 A;  3A9K A;  2DNF A;  3P42 A;  2L8J A;  4K7S A;  2IDY A;  1JW9 D;  4DHJ B;  1V86 A;  3NUH B;  3DBS A;  2BGF A;  1OQQ A;  2D3C A;  5AZG A;  4EZK A;  3VR9 B;  3DDC B;  1OEY A;  2V3S A;  1LGR A;  5J18 A;  2IJ0 A;  2LI5 A;  3R66 C;  1HXY D;  2QHO A;  2KX3 A;  4K7W A;  2N0S B;  1TS3 A;  3NVW A;  3W1Y A;  1SB3 C;  3UQA A;  1VR9 A;  5GXG B;  4GOC A;  4MSM B;  2D3A A;  4HRS A;  1GUA B;  1OQR A;  2BBC A;  2VH2 A;  3ENE A;  4BAX A;  2GBN A;  2FE8 A;  1E7U A;  2LD9 A;  3BVM A;  4US8 A;  1P9D U;  1V1P A;  1V8C A;  5DPR A;  1H8C A;  3KUC B;  2JF5 A;  2H89 B;  3NZU A;  2KDM A;  2PLP A;  1RFK A;  1ZXI A;  2HJ1 A;  1FXA A;  4QAY A;  3PRM B;  4DHZ B;  1SGH A;  1WSP A;  4MEL A;  3KYC D;  1EU4 A;  4A3P A;  2EMS A;  2N7D A;  2BPS A;  2DLB A;  1WWT A;  3OAW A;  4RNA A;  1NBF C;  2DBY A;  2WDT B;  4II3 B;  5BMG A;  1A70 A;  4BKS D;  1E9M A;  2WQY B;  4DXF A;  3PZD A;  1WGK A;  2DAF A;  2NBV B;  3AE3 B;  1CK1 A;  4BVU C;  2MA9 B;  3MC9 A;  2LGD A;  2KQ4 X;  2RMM A;  2JPH A;  2G3Q B;  3GB1 A;  1KLU D;  2KDI A;  3APF A;  3GE3 C;  2WHI A;  1WM3 A;  2QC8 A;  1V81 A;  2AYO B;  4OZB A;  3RUL A;  4C56 C;  4I6P A;  4FLH A;  3HVZ A;  2RR9 A;  4MGI E;  4ZRK A;  1C79 A;  2EEL A;  1MPE A;  4YWG G;  1KTK A;  1JAL A;  5KHO A;  4JLC A;  2SAK A;  3QCA A;  4P6V F;  2XBB C;  2RGF A;  3DHG C;  4C7Y A;  2MBO A;  1J7A A;  1ENF A;  4EE2 A;  2MJ3 A;  2ZCB A;  3I63 C;  4G3X B;  3NVZ A;  4WJP A;  1TT5 B;  2BB5 A;  2W55 A;  2QIL A;  5C23 A;  3HIZ A;  1EF1 A;  3EFC A;  2C7N B;  3T8M A;  3R2I A;  1Y56 A;  4KDI C;  1SJE D;  5EE3 A;  2PJH A;  1WZ0 A;  2GBJ A;  2MH7 A;  4DK5 A;  2DZK A;  4HDO A;  4NPN A;  1C3T A;  3BYT B;  2WX1 A;  4W9L A;  4IUM B;  4C00 A;  2E6X A;  2JZZ A;  1YN3 A;  1E8W A;  1SJH D;  2CHX A;  4YL8 A;  2BKF A;  4IWO A;  1YD8 U;  1K51 A;  3ONS A;  5J17 A;  1WJ4 A;  2FCN A;  1ZDV A;  3ZNH B;  3LB8 C;  1KLV A;  3DPD A;  2DZI A;  3N1Y C;  4K81 A;  1R4M B;  1GJZ A;  2ZNV C;  1GAQ B;  4BFR A;  1MG8 A;  3UIP B;  2WXR A;  4ZRQ A;  3KWL A;  1TS5 A;  1SE2 A;  4FJV B;  1WR1 A;  2V1Y A;  1WXM A;  1XCQ L;  3WAM A;  3NVV A;  3DVG Y;  3H8H A;  2CR5 A;  4FJZ A;  1CQV A;  1FNW A;  5BYS A;  4OHJ A;  2AEH A;  1PGB A;  3QA8 A;  5FR6 A;  2PW9 A;  1U4A A;  1GB1 A;  3AEF B;  3SR6 A;  3QAR A;  2AL6 A;  3PLU A;  1WYW B;  4NZL B;  2NTT A;  2UYZ B;  1WXS A;  1V80 A;  1TIF A;  2DYM A;  1XLQ A;  4RMA A;  1WRD B;  3RPF C;  1RAX A;  2K5P A;  2J42 A;  1YN5 A;  1I4X A;  1ZGU B;  5JZE B;  2MCN B;  4EFO A;  4IDI A;  4KGR A;  4ASW C;  1J19 A;  3AN1 A;  1OFF A;  3IG3 A;  1YOV B;  2GMI C;  2BWE S;  3Q2A C;  1E8Y A;  4M00 A;  3KW5 B;  2D3B A;  2NS5 A;  2LFI A;  1R4M I;  1TBE A;  4IW0 A;  2KJ6 A;  2CKH B;  1CMX B;  2E3T A;  3B9J A;  3DOW A;  4BKG A;  3AH7 A;  3PRZ A;  3VRA B;  3TMP B;  1AAR A;  1T6B X;  2IPK D;  4XC2 A;  4IOI E;  4GIV A;  2NTS A;  4XE0 A;  3VTV A;  1XT9 B;  4N9F 4;  4KKI A;  4PS8 A;  2KJR A;  4CYE A;  1Q5W B;  4ZOH C;  3WIM A;  2R2O A;  5CHV C;  1YJI A;  3VUY A;  1QOG A;  4K7U A;  1FRR A;  1XXG A;  3P4Q B;  1RYJ A;  4XWW A;  3I5J C;  5JH5 C;  1RFA A;  2JRI B;  2LHD A;  2WXI A;  5HG2 A;  2LGS A;  2KN5 A;  1V1O A;  4IM3 A;  2D3G A;  4MT5 A;  4HKQ A;  2QEJ C;  3ZJT A;  3VUW A;  3ZO5 B;  2V3P A;  2AL3 A;  2WXP A;  2X38 A;  3FIL A;  3NJT A;  1HTQ A;  1WX8 A;  1L7Y A;  4YSY B;  3X23 A;  2WXQ A;  3BVZ A;  4B0E A;  4BKT A;  1SE3 A;  2NVU I;  3ZDM C;  2L0F A;  4LJP B;  5JHA A;  1PUT A;  4RH6 A;  3ML9 A;  3CSF A;  4MGZ E;  1T0Y A;  1NVI D;  2WX0 A;  2WYQ A;  1XQQ A;  3VH4 B;  3IBE A;  1SIJ A;  3H7P B;  3DQV A;  2CHW A;  2JWZ A;  3K9O B;  5BO4 B;  1J0G A;  3M63 B;  3AEA B;  1NI2 A;  4FA6 A;  2GI9 A;  4FHJ A;  1JML A;  1MVK A;  3AE6 B;  2R61 A;  3AMZ A;  2UU7 A;  3QWZ B;  1VCB A;  3ZTC A;  3ZIM A;  2L1A A;  2J7Q B;  1WM2 A;  1TZO A;  1JRO A;  1LO5 D;  3NZS A;  3IXS A;  3T3O A;  2IZV B;  1V97 A;  3A4R A;  3EA6 A;  1HEZ E;  4LNI A;  2KTR A;  2QSD A;  2G45 B;  2MW5 A;  4A55 A;  1ZP0 B;  4P1C C;  3H1U A;  2V9H A;  2MBB B;  2M0X A;  1WMH A;  2MP2 A;  1UNS A;  3DBR I;  5AZF A;  4FAD A;  5DPT A;  1V5O A;  3IVF A;  1N62 A;  4GDL B;  1N6Z A;  1D6E C;  2J53 A;  3M62 B;  4F7Z A;  1JRU A;  4JL9 A;  3HRD D;  2LVQ A;  1FMA D;  3R7R A;  4OVV A;  3VRB B;  2ZW0 A;  1P3Q U;  3AED B;  3Q8C A;  3PHX B;  4GB9 A;  3WAN A;  1AWD A;  2Z8L A;  1P98 A;  3VAW A;  1HE8 A;  1UH6 A;  2INC C;  1ZW7 A;  3A33 B;  3A9K B;  3TCA A;  4WQM A;  1Q10 A;  3EGR A;  5IN7 A;  1FNU A;  1E8Z A;  2G1E A;  1KOT A;  2LHE A;  2ZPN A;  2BS3 B;  1ET6 A;  4HEA 1;  2LGI A;  4YSZ B;  2XNA C;  4KVG B;  3OLM D;  5DPW A;  5C2T B;  4ZYN A;  2L0T A;  5IA7 A;  2I1J A;  5FKA C;  2ZEQ A;  3H7P A;  3ZXV A;  3WCQ A;  5HHD G;  3AXC A;  1L5P A;  2B3A A;  2GBK A;  2KFJ A;  1EF5 A;  3I57 A;  4B95 A;  4FBJ B;  4HKZ E;  2KT7 A;  4ANU A;  2QDF A;  3VQI A;  1K52 A;  2Z0D B;  1E6E B;  2VZK B;  3DWM A;  1UBQ A;  4PYU A;  2MRP A;  1QOA A;  2KAN A;  3R2T A;  2N9P C;  1N60 A;  2AX5 A;  2DAJ A;  3HUI A;  4I6L B;  1V1P B;  2WDV B;  3JSV B;  2JUO A;  1KH0 A;  3WAP A;  2C7H A;  3MHS D;  3RNF C;  4FJY A;  1EWC A;  3IAS 1;  4A90 A;  1P7F A;  2INP E;  4XDD A;  2AWT A;  4AOF A;  3SHQ A;  4AS1 A;  3N1Z C;  2B76 B;  5D6J B;  2O2V B;  3MFG A;  4ZRJ A;  1D5M C;  2ZNV B;  4LTU A;  2ZW1 A;  3AV8 A;  3QAQ A;  3MJW A;  1WYG A;  1CZP A;  4RF0 A;  2L05 A;  4TUU A;  4ARC A;  3VXW A;  4YTP B;  1MFW A;  2OHF A;  2KO3 A;  3ECI A;  3W9C B;  3RMK C;  3L13 A;  3ETR A;  2KX0 A;  1WGG A;  3MC8 A;  1BUI C;  4EZL A;  3B1L X;  1KF6 B;  2ASQ A;  3ZJV A;  1C1Y B;  1DOY A;  5CTR C;  1VZ8 A;  3UF8 A;  2JQR B;  3R3M A;  3HK0 A;  1NI3 A;  4J3O D;  4NAW B;  1T0S C;  2VRR B;  3N1X C;  2IBI B;  5E6O A;  1ZE3 D;  3M95 A;  4A6Q A;  2XK5 A;  1VRA B;  5D3I B;  1OGW A;  2PPH A;  2MHJ A;  4IG7 B;  4W9C A;  5G5H A;  2BS4 B;  3RN9 C;  4YTN B;  4P16 A;  1Q0W B;  3OG5 A;  2RDB C;  1HTO A;  3AE2 B;  2KVZ A;  3CMM B;  4OZC A;  2ICI A;  2JYT A;  1VZ7 A;  2RSU A;  3AE9 B;  1MG4 A;  3ZKJ C;  1JCK B;  3GE8 C;  2IGD A;  2PVG C;  1ZOY B;  2K1F A;  4WWP A;  2M17 A;  1E0Z A;  3T3N A;  4WQO B;  1L4Z B;  1TS2 A;  2KN4 A;  4TMA B;  2MJD A;  2KQ7 A;  2FCM A;  4HJG E;  1L6V A;  1ACC A;  4FHK A;  2NMQ A;  2HTM E;  1XO3 A;  2KK8 A;  4C7Z A;  1RWS A;  3NOB A;  4HDQ A;  2ONQ A;  1N5X A;  3U30 A;  2LUE A;  4BZA A;  2JX5 A;  3JSV A;  4KSL C;  4ACF A;  1YQ4 B;  3NZ3 A;  1V9J A;  2C60 A;  2IY1 B;  3NY5 A;  5D2M B;  3Q3N C;  1VZ6 A;  2LRW A;  2Y5B B;  4YTM B;  1F2R C;  3QQ8 B;  5IOI A;  4LNF A;  3AE1 B;  3EEC A;  2J52 A;  4J6I A;  2O2V A;  2KWC A;  1EWY C;  4KDL B;  1ISN A;  1PGA A;  2L52 A;  1S1Q B;  3AI5 A;  3AU4 A;  4HRO A;  5D94 A;  4JWS C;  2LZ6 A;  1M94 A;  1TJE A;  3QJZ A;  3TSS A;  4CHK A;  2I1K A;  3DVN V;  4ANW A;  2GLS A;  3RNG C;  4NJC A;  2EKI A;  3AE4 B;  4MGK E;  4BKS A;  4WIP A;  5DPS A;  4BOZ B;  1FPY A;  2RDH A;  4NAW A;  2W54 A;  1L2N A;  1SIF A;  4PK1 A;  1QOB A;  4XWT A;  3AEG B;  2LMC A;  4DHJ D;  4R3D A;  5TR5 A;  3KVF B;  2KZR A;  3BII D;  4RFB A;  2Z59 B;  3DBH B;  4CO7 A;  4N6E B;  3A4S C;  2LRU A;  2D07 B;  3EC8 A;  3BIN A;  4IM0 A;  4D2K A;  1FFU A;  4W9F A;  2MEK A;  2RPV A;  3RZW C;  5HKH A;  2V4I B;  3RNC C;  2EMT A;  3N3K B;  3R7Q A;  1SE4 A;  3AE8 B;  1J8C A;  3M3J A;  1I4H A;  2WDR B;  2YLM A;  3L54 A;  2IY0 B;  3NS1 A;  3VFK A;  2ZVN A;  2CU1 A;  2N9X A;  1IGD A;  1OQY A;  4LNO A;  1VJK A;  3DVG X;  1JWB D;  2KMM A;  3GOE A;  1IP9 A;  4ZYS A;  5AZH A;  2GBR A;  2M19 A;  1F9J A;  2PE9 A;  5LXH A;  4G11 A;  1DGJ A;  3JW0 X;  3L4P A;  1JRP A;  1E7P B;  1TZ1 A;  4DHZ E;  2L3Z A;  2M0A A;  4HPM B;  3U4E G;  4IM2 A;  2NCN A;  1F1H A;  5AUI A;  1K50 A;  2BT6 A;  4JIO U;  3TJP A;  3PO0 A;  4MJS B;  3NVY A;  1XD3 B;  1UGM A;  3N20 C;  3VH3 B;  3FIL B;  3Q3F A;  2IO3 B;  4URK A;  1ZXH A;  1GC6 A;  2JSV X;  3DBH I;  5FR3 A;  4ZRI A;  1XF5 L;  2WU2 B;  3QX1 A;  4E71 A;  2J0K A;  3BZD B;  1FO4 A;  2KC1 A;  1K8R B;  1C77 A;  2J0M A;  4LJO B;  4LDT B;  3MTN B;  1WZ3 A;  1QIL A;  1UWX A;  1F0Z A;  1GOZ A;  2MBE A;  3ZDT A;  1YQ3 B;  5CHW A;  2O6V D;  4RGO S;  4BBN C;  3DCG A;  2W3R A;  1PFD A;  1GB4 A;  3U52 E;  5LNK 1;  3B08 A;  3ABV B;  3D32 A;  3E9S A;  3W2D A;  2V4L A;  2KTR B;  3VR8 B;  4RF1 A;  1HZ6 A;  4TSS A;  4KGS A;  2KAC A;  4BBN F;  4P7I A;  2MX2 A;  3W5U B;  1WMH B;  2MP2 B;  5LXI B;  2J0J A;  2FUG 1;  4E3C A;  2LGX A;  1TGZ B;  1BT0 A;  2LXC A;  4XGA B;  3WAL A;  1WX9 A;  3AUL A;  1V49 A;  2FNJ B;  1P0R A;  1QF6 A;  4W9H A;  3KQ4 A;  1HA5 A;  2LXA A;  3P4R B;  1KM7 A;  4L23 A;  1MHH E;  3HVD A;  3KLS X;  1P7E A;  2KLG A;  2M56 B;  3UIO B;  4IKG A;  1S3S G;  2N7J A;  2ZVO A;  3QHT A;  4WWN A;  4LNN A;  2OJR A;  4YSX B;  2N1W A;  1WJN A;  1GNU A;  2J4X A;  4ITK A;  4WWM A;  1TY2 A;  4MJS A;  4M8M A;  2G4D B;  3AM9 A;  1LQB A;  2BB6 A;  2HD5 B;  3BWU D;  1I4G A;  2LAS A;  2PEA A;  2QIE B;  3PRP B;  4C4V B;  1FRD A;  2LVO A;  5G55 A;  4KKJ A;  2A4Z A;  2M1M A;  2G4S A;  1NEN B;  1R4N B;  2JWU A;  1OTR B;  1SF0 A;  2MJE A;  3DHI C;  2BVC A;  3H7S A;  1UBI A;  2JYE A;  4NJ6 A;  1EM7 A;  1I4P A;  1WF9 A;  4REZ A;  3RUI B;  4NY0 A;  2WXN A;  2L76 A;  2NBU A;  2CS4 A;  2YEP B;  2KC2 A;  1TYG B;  2KTF A;  1UD7 A;  3ZRC A;  4IWP A;  2PMV A;  3HM3 A;  5D7G A;  4M01 A;  2FAZ A;  1RRB A;  4MGY E;  2OJW A;  4JWU C;  1G6J A;  1QKZ A;  1IGC A;  2SEB D;  3V60 A;  2KKC A;  4LLG M;  1N63 A;  1L0X B;  1WR6 E;  2L00 B;  3I3T B;  2TSS A;  4NNJ B;  3VTU A;  1ZPS A;  3ZUN A;  4ARI A;  4GGQ A;  3RNB C;  1V2Y A;  2ZZP B;  2N9K A;  4WJN A;  5EE0 A;  3BYY B;  2IO2 B;  2V3N A;  2ZCC A;  5BYQ A;  3GZN B;  4USA A;  4US9 A;  3U7D A;  1E90 A;  1NDD A;  1YQB A;  3DBL B;  1R4N I;  2H88 B;  3VTW A;  2K22 A;  4GN1 A;  1XCT L;  4OVZ A;  5CX3 A;  1P1A A;  1FCL A;  4W9K A;  1OEY J;  3AEC B;  3W1S A;  4AJY B;  4HVB A;  2M8S A;  4GDK B;  3A1Q A;  4ZRP A;  5D3D A;  5EE1 A;  3K9P B;  3V62 A;  2QJL A;  4B9K A;  1Z5S B;  2N7E A;  3A9J A;  2KMA A;  2WDQ B;  4RGM A;  4DXG A;  3H9D A;  2XEW A;  5C1Z A;  4KZ0 A;  1FNV A;  2JZP A;  2XK5 B;  4K3B A;  2BF8 B;  3S2A A;  3Q6B A;  4B6W A;  4C4V A;  1E10 A;  3ZGZ A;  5BYR A;  4PT5 A;  3SFD B;  1Q1O A;  5I4D A;  1V5T A;  1NYQ A;  1TS4 A;  3VDZ A;  4X57 B;  4GXB A;  3APD A;  2K8H A;  3URY A;  2EKE C;  3PTF C;  3GZN I;  3QC8 B;  2REX A;  4ZDV A;  4DQO C;  4L2Y A;  4EOY A;  2N1V A;  3DBL I;  2BWF A;  1FD6 A;  1AYF A;  1C4P A;  1F2R I;  1T3Q A;  1WIA A;  5G2N A;  1D5X C;  2JXX A;  3J9C A;  4AP4 C;  1IPG A;  1WI0 A;  4JE3 B;  4XYC A;  2WLB A;  1A5R A;  2L83 A;  4HPL B;  5LLI A;  5JXV A;  2K0P A;  1L4D B;  1WGH A;  1M4V A;  2DYB A;  5DCN A;  4DDG D;  3LDZ E;  5FK9 C;  2MBQ A;  3RNE C;  1YX6 B;  5E6J A;  1J7B A;  3SU8 X;  1YMH E;  3W1S C;  2K8B A;  3P4P B;  1CJE A;  3AB5 A;  1AN8 A;  2KOX A;  3PZ8 A;  3Q3O C;  4W9D A;  4M8N A;  1WX7 A;  2ZJD A;  1E7V A;  2DX5 B;  1QT9 A;  1HQR D;  1Z2M A;  4GDK A;  3PHW B;  3MJ5 A;  4L1B A;  2DZJ A;  2GRI A;  4OW0 A;  1QQR A;  3MC0 B;  1UEL A;  3TUO A;  4DWF A;  2VH1 A;  4F1S A;  4FUL A;  4NAM A;  3H6N A;  3O65 B;  5BMH A;  3P4S B;  4WJO A;  3WA0 A;  2INN E;  1SEB D;  4HPP A;  3ZVV A;  2HTH A;  4GU2 A;  5CHF A;  4NJ7 A;  2ON8 A;  1UWM A;  2WWZ A;  3N32 A;  2WXG A;  1D5Z C;  4WAF A;  3ZNI D;  5E6N A;  2ACZ B;  2WNM A;  4ANX A;  3HM6 X;  3SDL C;  1JQ4 A;  3N30 A;  4WWO A;  1TKE A;  4W9J A;  4I6N B;  3JVZ X;  4MH0 E;  4WAA A;  2BYT A;  1TKY A;  3GP7 A;  3LYY A;  2BS2 B;  3OJ3 A;  1WY8 A;  3BK1 A;  2YEP F;  2KD0 A;  1L6U A;  3C19 A;  4TQ0 A;  2I2Y A;  1UGJ A;  3L0W B;  2KWV B;  1I42 A;  2PKO A;  4W9I A;  2C9W B;  3L16 A;  3ZW3 A;  1YJJ A;  4EEW A;  3Q8F A;  2IO0 B;  2VZK D;  1QZE A;  1N5W A;  5JHB A;  2X8X X;  2KDE B;  1GG3 A;  2MSE D;  1TY0 A;  1DOI A;  3TEW A;  1WH3 A;  2FBW B;  2KYW A;  3ALB A;  3NS8 A;  1YNT E;  2LUM A;  2BYV E;  4MAC A;  3R8B A;  2NR2 A;  2JRH A;  1C76 A;  1WXQ A;  4MEM A;  1KRH A;  3PS6 A;  2Y3A A;  4XZ4 A;  4AWJ A;  4TKN A;  1KJT A;  2GB1 A;  3SFE B;  4HWI B;  4NQL B;  2BW2 A;  4GMV A;  4LNK A;  2WGS A;  3AU5 A;  2WXO A;  1STE A;  3SD5 A;  2KWD A;  3OJ4 B;  3VVW B;  1K53 A;  3B0A A;  3OWE B;  2C5L C;  3O13 A;  5EDS A;  2W82 A;  3LXF A;  4MDK E;  2QMT A;  3KH0 A;  1PYW D;  3CST A;  1F77 A;  4PS3 A;  2KHW B;  1IBX B;  2JXT A;  2MLB A;  2IND C;  2LJ5 A;  3V3X A;  5C3J B;  1JWS D;  1VDV A;  4G50 A;  2KXJ A;  4E74 A;  2PIA A;  3RCZ A;  2WP9 B;  1IUE A;  4UDU C;  2KDB A;  4PYZ A;  3VHT C;  2XN9 C;  3QK0 A;  1R7S A;  3PZ7 A;  4A8X C;  3PPA A;  3RD2 A;  4EKU A;  3IT4 B;  2Z0E B;  4HXD A;  2C7M B;  2KVR A;  4ICV A;  3L10 B;  4YXD B;  1D4B A;  4AQ7 A;  2BYE A;  4C80 A;  3AEE B;  3FC4 A;  3P63 A;  2CHZ A;  3HHM A;  4OZA A;  2O6V B;  2JY6 A;  3EHV A;  5EE9 A;  3Q3J A;  3UIN B;  2KFK B;  4HK2 A;  2HDE A;  4LK0 M;  3RYT A;  4HJK A;  1XLP A;  1C4C A;  1FFV A;  2LJI A;  3ZRF A;  1JWM D;  4YT0 B;  3ZYY X;  3ZLZ A;  1DOX A;  1PQS A;  3PVL A;  4PS7 A;  2WXL A;  1WJ6 A;  3N9Y C;  1SXT A;  1I4Q A;  3UGB B;  3WAO A;  4JX1 C;  2G9H D;  5HI1 A;  3IHP C;  3Q14 C;  1I7H A;  1WGR A;  3U8Z A;  3AEB B;  2Q5W D;  1TKG A;  2D11 A;  3ZNZ B;  3BVG A;  2BTE A;  1YN4 A;  4GSW A;  4WH4 A;  3RT3 B;  1V6E A;  5IKC M;  2L32 A;  4HCN B;  5L95 C;  1C9F A;  1FM0 D;  1L0Y B;  1BML C;  3SEB A;  4A20 A;  2KNB A;  2DWQ A;  1E8X A;  1UF0 A;  4KGT A;  4KIK B;  1GPX A;  3ML8 A;  5MPO A;  1QOF A;  5E6P A;  1FXI A;  2DYO A;  1Y8R C;  2LGY A;  1UUP A;  1FXT B;  1IBX A;  2KWU B;  5KHQ A;  3IFW B;  4MH8 A;  2PTL A;  2D10 A;  3NG0 A;  4K1R B;  1C4A A;  4BOS C;  1JWA D;  4RGT A;  1T0R C;  2KAJ A;  1NYR A;  2FCQ A;  2FIF A;  2WS3 B;  2AQ3 B;  3PRE A;  2WU5 B;  2R2Q A;  4GLS C;  3B2G A;  1GC7 A;  3QIJ A;  4JPS A;  2O6V A;  3L17 A;  4NQK E;  2KFK A;  1BXT A;  2V0G A;  3T9L A;  1XEE A;  2QCZ A;  1NEK B;  1TTN A;  2YVC A;  2W9N A;  4S17 A;  3U2S C;  4W9E A;  3X0W A;  1LM8 B;  4ZHP A;  4JQW C;  4FXC A;  3KUD B;  3ZNG C;  1SSN A;  5IO9 A;  4Q2J A;  2ZPY A;  2D5G A;  5AEK B;  3EUB 2;  3KWV A;  4HLE A;  3P2B A;  1JWU D;  3A1Q B;  2CJN A;  4P1B C;  2OOB B;  1F52 A;  1H4R A;  2K8C A;  3FAH A;  2GBM A;  2L7R A; 
#chains in the Genus database with same CATH homology
 3T8M A;  4B6W A;  3A9J B;  3CMM B;  1E5W A;  4KDI C;  2PJH A;  2RSU A;  1WZ0 A;  2GBJ A;  2NBW B;  4DK5 A;  2NPT B;  2DZK A;  4HDO A;  4NPN A;  1C3T A;  1Q1O A;  1V5T A;  2JZ3 B;  3ZKJ C;  4W9L A;  2WX1 A;  2DZM A;  4IUM B;  3TBL D;  2FCS A;  4TV3 A;  3V6C B;  1WE7 A;  2JZZ A;  4KIK A;  5IAA C;  3VDZ A;  2K1F A;  1E8W A;  4WWP A;  2M17 A;  4X57 B;  4GXB A;  2CHX A;  3APD A;  2K8H A;  1YIW A;  2EKE C;  3PLV A;  4YL8 A;  2BKF A;  4IWO A;  4II2 B;  1YD8 U;  4WQO B;  3ONS A;  3PTF C;  5J17 A;  3GZN I;  1WJ4 A;  2FCN A;  3QC8 B;  2KQ7 A;  2REX A;  4ZDV A;  2FUH B;  2FCM A;  3ZNH B;  4EOY A;  2N1V A;  3DBL I;  2LVP A;  2RPQ A;  4A3O A;  4FHK A;  1KLV A;  1EUV B;  2BWF A;  3DPD A;  2KK8 A;  2DZI A;  1UZX B;  2KLC A;  1WIA A;  3NOB A;  4K81 A;  5G2N A;  2JXX A;  1GJZ A;  2ZNV C;  4HDQ A;  4BFR A;  1MG8 A;  4OVU A;  4AP4 C;  3UIP B;  3U30 A;  3ZTD A;  2UWQ A;  4MSQ B;  2K25 A;  1IPG A;  2LUE A;  1WI0 A;  3JSV A;  4KSL C;  4FJV B;  1WR1 A;  1A5R A;  1V9J A;  4ICU A;  2V1Y A;  1WXM A;  3WAM A;  2C60 A;  3DVG Y;  2IY1 B;  3NY5 A;  4HPL B;  5LLI A;  4DDI D;  2CR5 A;  4FJZ A;  5D2M B;  4LDT D;  2N9E B;  2LRW A;  2Y5B B;  3QQ8 B;  3KUZ A;  2AEH A;  4M0W B;  1WGH A;  3QA8 A;  3V61 A;  2DYB A;  5FR6 A;  3VUX A;  3EEC A;  3JYU A;  1U4A A;  1EO6 A;  5DCN A;  4DDG D;  3LDZ E;  2AL6 A;  3QAR A;  2O2V A;  3PLU A;  1WYW B;  2KWC A;  3C0R B;  4J6I A;  4LCD E;  3UQB A;  2MBQ A;  2UYZ B;  4KDL B;  4W9G A;  1WXS A;  2PE6 B;  1V80 A;  1YJ1 A;  1ISN A;  3BY4 B;  1X1M A;  1YX6 B;  1S1Q B;  3AI5 A;  3AU4 A;  2DYM A;  4RMA A;  2DHZ A;  5D94 A;  3SU8 X;  1WRD B;  2LZ6 A;  1M94 A;  3W1S C;  2K8B A;  3QJZ A;  5J2R A;  1RAX A;  4CHK A;  1ZGU B;  2I1K A;  1D3Z A;  2FID A;  2IO1 B;  3DVN V;  4ANW A;  2KOX A;  5JZE B;  4W9D A;  4M8N A;  1WX7 A;  5L83 A;  2KJH B;  2ZJD A;  1E7V A;  4MGK E;  4BKS A;  2MCN B;  2DX5 B;  4EFO A;  4DXA B;  4ASW C;  4KV2 A;  3LJ3 A;  5DPS A;  4BOZ B;  4F8C B;  1Z2M A;  1J19 A;  4GDK A;  3PHW B;  2HJ8 A;  4G0N B;  3IG3 A;  4TQ1 A;  4NAW A;  2DZJ A;  2GMI C;  2BWE S;  1E8Y A;  1L2N A;  3KW5 B;  1SIF A;  4HCP B;  1UEL A;  4DWF A;  2NS5 A;  4F1S A;  4FUL A;  1R4M I;  5GMV A;  3H6N A;  1TBE A;  3O65 B;  4IW0 A;  1IYF A;  3HIZ A;  2KJ6 A;  4WJO A;  2MWS B;  2CKH B;  1CMX B;  4DHJ D;  3DOW A;  3WA0 A;  4BKG A;  3V6E B;  3PRZ A;  5TR5 A;  3ZVV A;  2HTH A;  3KVF B;  3TMP B;  1AAR A;  2JT4 B;  4GU2 A;  4XC2 A;  5CHF A;  4NJ7 A;  2KZR A;  2WWZ A;  3N32 A;  4GIV A;  2Z59 B;  4CO7 A;  3TIX A;  3ZNI D;  4RM8 A;  3A4S C;  5E6N A;  3VTV A;  1XT9 B;  2D07 B;  2LRU A;  3EC8 A;  4N9F 4;  3BIN A;  4IM0 A;  4PS8 A;  2NPT A;  4ANX A;  3HM6 X;  4W9F A;  2KJR A;  3RZW C;  3DVN U;  1Q5W B;  3SDL C;  3WIM A;  4CYE A;  5HKH A;  1ZKH A;  2R2O A;  5CHV C;  3VUY A;  2EMT A;  3N30 A;  2N4F A;  4W9J A;  4K7U A;  3N3K B;  4FN2 A;  4I6N B;  4WWO A;  3R7Q A;  1J8C A;  3JVZ X;  3M3J A;  1WXV A;  4MH0 E;  5JH5 C;  4WAA A;  2YLM A;  3L54 A;  2IY0 B;  1RFA A;  3APC A;  3PSE B;  3VFK A;  1RLF A;  2ZVN A;  2CU1 A;  3PT2 B;  1WXA A;  2JRI B;  2N9X A;  3EFU A;  1OQY A;  3OJ3 A;  3DVG X;  1WY8 A;  2KD0 A;  2MQJ A;  3GOE A;  1IP9 A;  1WGD A;  2HE7 A;  5AZH A;  4TQ0 A;  1SE9 A;  3L0W B;  4AJW A;  2KWV B;  2GBR A;  1I42 A;  2KN5 A;  1F9J A;  2PE9 A;  4W9I A;  2KMC A;  5LXH A;  4IM3 A;  2D3G A;  2BKR B;  4G11 A;  2C9W B;  3JW0 X;  3L16 A;  3ZW3 A;  1VD2 A;  3VUW A;  3ZO5 B;  4EEW A;  1TZ1 A;  2IO0 B;  2L3Z A;  2AL3 A;  1QZE A;  4WJQ A;  4DHZ E;  5JHB A;  4HPM B;  4KSK C;  2KDE B;  4IM2 A;  2NCN A;  1GG3 A;  2IYD B;  2MSE D;  4ANV A;  1WX8 A;  1L7Y A;  4JIO U;  3X23 A;  1WH3 A;  3TJP A;  4BKT A;  4KZC A;  2NVU I;  3ALB A;  3NS8 A;  4MJS B;  2L0F A;  4LJP B;  3ZDM C;  5JHA A;  4EUT A;  2BYV E;  3ML9 A;  1XD3 B;  1UGM A;  2NR2 A;  2JRH A;  3NHE B;  3CSF A;  4EZJ A;  4MGZ E;  3VH3 B;  3KYD D;  1YX5 B;  1T0Y A;  3Q3F A;  2WX0 A;  4MEM A;  2IO3 B;  3PS6 A;  4RM9 A;  2WYQ A;  1XQQ A;  3VH4 B;  4URK A;  4XZ4 A;  1GC6 A;  4AWJ A;  4TKN A;  1KJT A;  3IBE A;  3H7P B;  3DQV A;  3DBH I;  3RZF A;  4AUQ C;  2CHW A;  4HWI B;  2BYF A;  2JWZ A;  4NQL B;  4ZRI A;  3K9O B;  5BO4 B;  4GMV A;  1J0G A;  2M4N A;  3AU5 A;  3M63 B;  2K6Q A;  1NI2 A;  4FA6 A;  3CF6 E;  3QX1 A;  4E71 A;  1WE6 A;  2J0K A;  4FHJ A;  2LWP A;  4XX5 A;  3SD5 A;  2K6D B;  3OJ4 B;  3VVW B;  4IC7 B;  3B0A A;  5EDS A;  2C5L C;  2KC1 A;  2K39 A;  4MDK E;  2MBH A;  3KH0 A;  3QWZ B;  1VCB A;  3CST A;  3ZTC A;  3ZIM A;  2J7Q B;  1K8R B;  1WM2 A;  1LFD A;  2J0M A;  4PS3 A;  4LJO B;  2RD0 A;  4LDT B;  2KHW B;  3MTN B;  1WZ3 A;  3NZS A;  4JGH B;  2MLB A;  2IZV B;  2LJ5 A;  3A4R A;  4G50 A;  2MBE A;  3ZDT A;  4DBG A;  2KXJ A;  4E74 A;  2KTR A;  1WFY A;  2G45 B;  2MW5 A;  5CHW A;  3RCZ A;  2O6V D;  2JVC A;  4BBN C;  3DCG A;  4GDL A;  2DEN B;  3H1U A;  2MBB B;  2M0X A;  1WMH A;  2KDB A;  2MP2 A;  3B08 A;  3D32 A;  2GOW A;  3DBR I;  4PYZ A;  5AZF A;  3VHT C;  4FAD A;  2D2Q A;  5DPT A;  1V5O A;  2V4L A;  3QK0 A;  1LXD A;  2KTR B;  2A5U A;  3PGE A;  3IVF A;  3PPA A;  3RD2 A;  3TL5 A;  1WJU A;  4EKU A;  1I35 A;  4GDL B;  2Z0E B;  1WGY A;  4HXD A;  4BBN F;  3L08 A;  2C7M B;  2MX2 A;  4P7I A;  1WMH B;  2MP2 B;  2KVR A;  4ICV A;  3L10 B;  3M62 B;  2J0J A;  5LXI B;  2BYE A;  4E3C A;  2LGX A;  1TGZ B;  1BT0 A;  2LXC A;  4F7Z A;  2CHZ A;  3HHM A;  4IWQ A;  2O6V B;  3WAL A;  1JRU A;  4JL9 A;  2JY6 A;  2LVQ A;  3EHV A;  2KQS A;  1WX9 A;  3Q3J A;  3AUL A;  3UIN B;  2KFK B;  4HK2 A;  1V49 A;  2FNJ B;  1P0R A;  3R7R A;  3PV1 A;  3RYT A;  4OVV A;  4W9H A;  4HJK A;  2KDF B;  2LXA A;  4MM3 A;  1P3Q U;  1KM7 A;  3A9K A;  3PHX B;  4GB9 A;  2KLG A;  2L8J A;  3WAN A;  4K7S A;  3ZRF A;  1P98 A;  3UIO B;  3VAW A;  4DHJ B;  1V86 A;  1S3S G;  3ZLZ A;  1HE8 A;  3DBS A;  2ZVO A;  3QHT A;  4WWN A;  1UH6 A;  1PQS A;  2BGF A;  3PVL A;  4PS7 A;  1ZW7 A;  3A33 B;  2OJR A;  3A9K B;  3TCA A;  2N1W A;  5AZG A;  1WJN A;  1WJ6 A;  4EZK A;  1GNU A;  3DDC B;  1OEY A;  2V3S A;  3UGB B;  1E8Z A;  1KOT A;  3WAO A;  2ZPN A;  5J18 A;  2LI5 A;  3R66 C;  3IHP C;  1WGR A;  2QHO A;  2KX3 A;  3U8Z A;  4MJS A;  4K7W A;  4M8M A;  2G4D B;  4KVG B;  1LQB A;  3OLM D;  5DPW A;  2HD5 B;  2D11 A;  3ZNZ B;  4ZYN A;  2L0T A;  3W1Y A;  3S2A A;  4GSW A;  2LAS A;  2PEA A;  3UQA A;  3PRP B;  3RT3 B;  1V6E A;  5IA7 A;  2I1J A;  4GOC A;  2ZEQ A;  2LVO A;  3H7P A;  5G55 A;  4HCN B;  4MSM B;  5L95 C;  3AXC A;  2B3A A;  2A4Z A;  2GBK A;  2M1M A;  4A20 A;  2KFJ A;  1GUA B;  2KNB A;  2G4S A;  1EF5 A;  1E8X A;  4B95 A;  4FBJ B;  4KIK B;  1OTR B;  3ENE A;  3ML8 A;  4ANU A;  3VQI A;  3H7S A;  1UBI A;  2Z0D B;  4NJ6 A;  1UBQ A;  1WF9 A;  2GBN A;  5E6P A;  3RUI B;  4NY0 A;  4PYU A;  2LD9 A;  1E7U A;  2L76 A;  2MRP A;  2DYO A;  1P9D U;  2NBU A;  2CS4 A;  2KC2 A;  2KAN A;  5DPR A;  2KTF A;  1H8C A;  2N9P C;  1Y8R C;  2LGY A;  1UD7 A;  3ZRC A;  4IWP A;  3KUC B;  1FXT B;  3HM3 A;  2JF5 A;  5D7G A;  3NZU A;  2FAZ A;  1RRB A;  4MGY E;  2KWU B;  5KHQ A;  2DAJ A;  1G6J A;  3IFW B;  4I6L B;  3PRM B;  4DHZ B;  1SGH A;  3V60 A;  2D10 A;  3JSV B;  2JUO A;  4MEL A;  2KKC A;  3WAP A;  3KYC D;  2C7H A;  3MHS D;  4K1R B;  4A3P A;  4FJY A;  2EMS A;  2N7D A;  1WR6 E;  2BPS A;  2L00 B;  3I3T B;  4BOS C;  3OAW A;  1NBF C;  4NNJ B;  2AWT A;  4AOF A;  3SHQ A;  2WDT B;  3VTU A;  2FCQ A;  2FIF A;  4II3 B;  4BKS D;  5D6J B;  3PRE A;  2O2V B;  3PZD A;  3ZUN A;  4ZRJ A;  2R2Q A;  4GGQ A;  2DAF A;  2ZNV B;  1GC7 A;  1V2Y A;  2ZZP B;  3QIJ A;  2NBV B;  4WJN A;  3QAQ A;  3MJW A;  2L05 A;  2O6V A;  4TUU A;  4BVU C;  2IO2 B;  2MA9 B;  3L17 A;  3VXW A;  2ZCC A;  4NQK E;  2KO3 A;  2LGD A;  2JPH A;  2KFK A;  3ECI A;  2G3Q B;  1E90 A;  3U7D A;  2KDI A;  3APF A;  1NDD A;  1YQB A;  1WM3 A;  3L13 A;  3T9L A;  2KX0 A;  1V81 A;  1WGG A;  2AYO B;  1TTN A;  3RUL A;  1R4N I;  2YVC A;  2W9N A;  3VTW A;  4EZL A;  3B1L X;  4GN1 A;  4I6P A;  4FLH A;  2ASQ A;  2RR9 A;  4MGI E;  5CX3 A;  1P1A A;  1C1Y B;  4ZRK A;  4W9E A;  3X0W A;  4W9K A;  1LM8 B;  1OEY J;  4JQW C;  3W1S A;  4AJY B;  5CTR C;  4HVB A;  3KUD B;  3UF8 A;  2M8S A;  3ZNG C;  3R3M A;  3HK0 A;  5KHO A;  4GDK B;  3A1Q A;  4JLC A;  3QCA A;  2XBB C;  2ZPY A;  4NAW B;  2VRR B;  3K9P B;  2RGF A;  2IBI B;  5E6O A;  5AEK B;  3M95 A;  2MBO A;  3V62 A;  2XK5 A;  1OGW A;  2ZCB A;  2PPH A;  4B9K A;  1Z5S B;  2N7E A;  3A9J A;  4G3X B;  4IG7 B;  4WJP A;  4W9C A;  2KMA A;  4HLE A;  3P2B A;  3A1Q B;  3H9D A;  2OOB B;  2XEW A;  1Q0W B;  5C1Z A;  1H4R A;  4KZ0 A;  5C23 A;  2K8C A;  1EF1 A;  2XK5 B;  2BF8 B;  2C7N B;  2GBM A;  2L7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...