4N9F4

Crystal structure of the vif-cbfbeta-cul5-elob-eloc pentameric complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
95
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFDTFEALCIEPFSSPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for hijacking CBF-b and CUL5 E3 ligase complex by HIV-1 Vif
rcsb
source organism Homo sapiens
molecule tags Ligase/viral protein
molecule keywords Cullin-5
total genus 18
structure length 95
sequence length 98
chains with identical sequence D, H, J, P, W, X, e, g, m, s, y
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4n9f400
1UBQA 2ZZPB 3DDCB 4PYZA 4WWPA 4W9GA 5C23A 4JLCA 2REXA 1OEYA 1KM7A 4I6PA 2CS4A 1LQBA 4RM8A 1WGRA 4HPMB 5J17A 3RD2A 2N7DA 2LASA 3ZTCA 4DWFA 2IO2B 3P2BA 2KHWB 3PRZA 3QJZA 3RULA 2N1WA 3RCZA 2N9PC 4WJOA 2BPSA 4HXDA 5D2MB 1FXTB 1R4MI 3U30A 2MLBA 3LDZE 4M8MA 1F9JA 3ZLZA 3TL5A 5DCNA 3OLMD 4J6IA 3ZNID 4BOZB 2V4LA 2B3AA 2CKHB 2JPHA 3CF6E 5GMVA 3DVGX 4I6LB 3O65B 3QC8B 4IWQA 2ASQA 2NCNA 4MGKE 4FBJB 2JXXA 2KTRA 1XQQA 4GDLB 2KDFB 2ZVNA 2GOWA 2BKFA 4HK2A 2CR5A 1GC7A 4MM3A 3K9PB 4WWNA 2N4FA 4PS7A 3RZFA 2L3ZA 2FIFA 2PJHA 1GG3A 1H4RA 2R2QA 1E5WA 2J7QB 1KOTA 4LJOB 2FCSA 1GUAB 4FJZA 3JW0X 1VD2A 4NQLB 3HM3A 4PS3A 4W9IA 3KH0A 4W9EA 3VFKA 4HVBA 1WI0A 3NY5A 2DYOA 3VUYA 2M17A 4MDKE 4F8CB 1WE6A 2ZPYA 3VAWA 1WJ6A 4LJPB 4TQ0A 3PLUA 4B95A 2MX2A 2KTFA 4IM0A 2IO3B 4GGQA 4K7SA 4II2B 4F7ZA 3B1LX 4TV3A 4TQ1A 1TGZB 3SU8X 3V6CB 2PPHA 3Q3FA 3QX1A 4HCNB 4AJWA 3L54A 4BFRA 2DX5B 3A1QB 3IBEA 2EMTA 2I1JA 3NOBA 2NS5A 2ZEQA 3H7PA 4WJPA 2N9EB 3WIMA 3B08A 5CTRC 3A9KA 3VQIA 3CSFA 1WJ4A 5JH5C 1GNUA 4MJSB 2KK8A 3VXWA 1VCBA 4IWOA 2GMIC 5DPWA 2KTRB 4GDLA 2FUHB 3KVFB 4XZ4A 3APFA 2LXCA 3IG3A 2LRUA 2FCMA 2KFJA 3JVZX 2AL3A 1WX9A 3PREA 4W9HA 4BOSC 4EFOA 1I42A 2MBOA 1NDDA 2XEWA 2BYEA 2DZMA 4TUUA 4HJKA 1V49A 1WGYA 3UINB 4EUTA 2O6VA 1GC6A 2VRRB 5AZFA 2HJ8A 4MGZE 2K8BA 3ZKJC 4FLHA 2JZ3B 3VH3B 2KD0A 1LM8B 1T0YA 3ONSA 1V6EA 3B0AA 4KZ0A 2KDIA 4KVGB 3ZRFA 5J2RA 2MRPA 4GDKA 3UGBB 3NHEB 1ZGUB 3ZUNA 3EHVA 1V5TA 4TKNA 3ZDMC 5LLIA 2RPQA 4DHJB 3DBHI 2NBWB 2N1VA 4IG7B 3ENEA 2JVCA 1ISNA 3UQBA 1Q5WB 2KFKA 2PE6B 3R7RA 3M62B 1J19A 1OGWA 2DHZA 3DVGY 4A3PA 2L0FA 3V6EB 3ZRCA 4BKTA 3PV1A 2XBBC 2KKCA 2D2QA 3AI5A 2K1FA 1C3TA 2AEHA 1H8CA 1WH3A 1WXSA 1WE7A 4B9KA 1YIWA 1U4AA 4URKA 3QA8A 4DHJD 3MTNB 5E6PA 3EECA 2C5LC 3JSVA 3LJ3A 2PEAA 4M8NA 3WALA 2BYFA 4W9KA 1C1YB 1X1MA 2O2VB 3CMMB 1WXMA 3HM6X 3SHQA 4FJVB 2D11A 2MP2A 1WGDA 4HPLB 1UH6A 2JF5A 2RR9A 5HKHA 4X57B 2D10A 2IY0B 2IY1B 2LJ5A 5LXIB 4GSWA 1QZEA 2JRHA 1WJUA 2KDEB 4P7IA 1PQSA 3QWZB 4IW0A 2UYZB 3IHPC 4IWPA 3TMPB 3KW5B 4NY0A 4ANWA 4ANXA 1ZKHA 4K1RB 2M1MA 4CO7A 4BKGA 2MWSB 1J0GA 3H1UA 3U8ZA 2WX1A 3PLVA 3DBRI 4ZRJA 4DDID 1RAXA 5D94A 1WY8A 2KXJA 4MJSA 1WGHA 4DDGD 4BVUC 4GDKB 1UZXB 3NZSA 3S2AA 3WANA 4N9F4 3L17A 1WM2A 4WJQA 3JYUA 3R3MA 1V2YA 2AL6A 2FAZA 2OJRA 2FIDA 1IYFA 3TJPA 1P9DU 2KVRA 2WX0A 3W1YA 4IM2A 4AOFA 4DHZB 4EEWA 2YVCA 2O6VB 4NJ7A 4HDOA 2KN5A 3APDA 2NBVB 2R2OA 1SGHA 2JUOA 4ICUA 5E6NA 2MA9B 2KWUB 2QHOA 1NI2A 4HWIB 1E8XA 3SD5A 2NVUI 3OAWA 1UD7A 1SIFA 2DZJA 3WA0A 2NR2A 3A9KB 4OVVA 1A5RA 1WXAA 2WYQA 4GIVA 2ZCCA 4JGHB 5D6JB 1XD3B 1WXVA 2JY6A 2MP2B 1M94A 2PE9A 4NJ6A 2KZRA 2IZVB 2DYMA 1SE9A 2KFKB 4DXAB 2CHXA 3MHSD 2RGFA 2KQSA 3A9JA 1RLFA 4BBNF 2N7EA 1YQBA 5BO4B 2Z0EB 4RM9A 3NZUA 3T8MA 2MBBB 2CU1A 1V81A 3A9JB 2YLMA 3VTWA 2FNJB 1R4NI 2L00B 3ZVVA 4ZDVA 2KMCA 3PHXB 1WYWB 3HIZA 2LGXA 2LVQA 4LDTD 3L16A 1V80A 2K39A 1TZ1A 4AWJA 2EKEC 1E90A 1L7YA 2HTHA 4KDLB 4HDQA 4K7UA 4RMAA 4GU2A 3QCAA 3U7DA 4IM3A 2ZNVC 3UIPB 4DBGA 3KUCB 1IP9A 1YX5B 2G4SA 3PTFC 4PYUA 3PS6A 1XT9B 3ML8A 4FADA 4E3CA 1RFAA 1RRBA 3IFWB 4MEMA 2LRWA 2C7NB 2DYBA 4GMVA 1OTRB 1Z5SB 1WMHA 1P0RA 2XK5A 5CX3A 2L0TA 2G4DB 2ZVOA 2Z59B 3M3JA 3VDZA 1P98A 3AXCA 2BGFA 2KANA 4AJYB 1L2NA 3EC8A 4AUQC 3H6NA 4NAWB 1WMHB 3PGEA 1ZW7A 3EFUA 3N3KB 1WJNA 4I6NB 2G3QB 2C7HA 3HK0A 4WWOA 4XC2A 2KJHB 3VVWB 5LXHA 2K8CA 3ZNZB 3OJ3A 2CHZA 4W9FA 2EMSA 1Q1OA 1IPGA 4EZKA 3DBSA 2KMAA 1E7UA 1WZ3A 2AYOB 4W9CA 1G6JA 2M4NA 2LWPA 2WDTB 3SDLC 3VUXA 3T9LA 3TBLD 2K6QA 2LGYA 3OJ4B 4II3B 3UF8A 4EKUA 5G2NA 2BF8B 1Y8RC 5CHFA 3ZTDA 2JWZA 4W9JA 3VTVA 3K9OB 4YL8A 2KLGA 2K25A 3M95A 1AARA 4WJNA 1V9JA 3W1SA 4BKSD 5CHVC 1YJ1A 1S3SG 4ICVA 2GBKA 3PPAA 5J18A 2JZZA 2A5UA 1MG8A 4ASWC 4KV2A 4FA6A 3PHWB 1WM3A 2O6VD 1EF1A 1P3QU 2JT4B 2ZCBA 2LI5A 4FN2A 2LZ6A 4W9LA 3ZNGC 4AP4C 4GOCA 2IO0B 4JIOU 4MGIE 3V60A 2JRIB 2MW5A 5L83A 4DK5A 3QIJA 4DHZE 4KSKC 3ZDTA 3L10B 2HE7A 3NS8A 4LDTB 4HCPB 4KDIC 3IVFA 3CSTA 2KWCA 2G45B 4ZYNA 2D3GA 3DCGA 4HLEA 3WAMA 4W9DA 4KZCA 3AU4A 1WIAA 2BWES 1HE8A 5AEKB 4MELA 3KYDD 4G3XB 4PS8A 4B6WA 2GBMA 2MCNB 1TBEA 4WAAA 2KLCA 1WX8A 2A4ZA 2DAJA 3KUZA 1WFYA 2M0XA 3H7SA 4FHJA 3RUIB 2DZKA 1E8YA 5C1ZA 5KHQA 4A3OA 4NPNA 2WWZA 2GBJA 2MBEA 2N9XA 3I3TB 3VTUA 4FULA 3JSVB 4CYEA 2AWTA 4GXBA 3RZWC 2NBUA 3WAOA 3PSEB 3X23A 1S1QB 2LGDA 5AZGA 4XX5A 5IA7A 3APCA 3N32A 1NBFC 3DBLI 5E6OA 2MBHA 2V1YA 3R7QA 3X0WA 3AULA 3BINA 2KOXA 5FR6A 1Z2MA 5AZHA 4EOYA 1UGMA 2KX0A 4JL9A 1WF9A 1LFDA 5JHBA 2KJRA 1WGGA 1WR6E 4NNJB 2RSUA 4ZRKA 1UELA 3Q3JA 2IO1B 2OOBB 3L0WB 1E7VA 2DAFA 3C0RB 3QQ8B 1EF5A 1E8WA 1YD8U 3A4SC 4MGYE 1TTNA 5CHWA 3TIXA 5DPRA 2L05A 2MSED 3ALBA 2MQJA 1WR1A 5TR5A 3DVNV 1K8RB 3V62A 1D3ZA 4OVUA 3VH4B 4JQWC 2KQ7A 4GN1A 2LUEA 4G50A 2C7MB 2KO3A 1V86A 2GBNA 1I35A 4M0WB 3AU5A 3ECIA 3KYCD 1CMXB 3DOWA 3PZDA 1UBIA 2CHWA 2V3SA 4K81A 2L8JA 2ZPNA 2KNBA 3DQVA 5KHOA 4EZLA 2RD0A 3PRMB 4F1SA 3L13A 1EUVB 3TCAA 4ANVA 2J0KA 1BT0A 3PRPB 2KJ6A 2D07B 3QAQA 4BBNC 4EZJA 1P1AA 3A33B 4IC7B 3DVNU 4G0NB 2BKRB 4IUMB 5IAAC 1YX6B 2UWQA 3BY4B 2KC1A 4LCDE 1J8CA 2L76A 2KDBA 3GOEA 4E74A 2I1KA 2KWVB 4BKSA 1KLVA 3UIOB 4E71A 2BWFA 2FCNA 2C9WB 2BYVE 2Y5BB 2ZNVB 1WRDB 3A4RA 2IBIB 3VHTC 4G11A 2LVPA 1OQYA 2J0JA 2XK5B 2ZJDA 4NAWA 5D7GA 2K8HA 4ANUA 1GJZA 1JRUA 3RYTA 2K6DB 3WAPA 2DZIA 3ZW3A 1V5OA 1LXDA 4ZRIA 2KC2A 2KX3A 3R66C 2M8SA 1E8ZA 2DENB 3L08A 3HHMA 5DPTA 3PVLA 3DPDA 2LVOA 2LXAA 4CHKA 2MBQA 3GZNI 4KSLC 2HD5B 2L7RA 4WQOB 2Z0DB 4FJYA 3D32A 2W9NA 3ZO5B 3A1QA 2FCQA 3MJWA 4MH0E 2J0MA 4KIKA 3H7PB 2O2VA 2C60A 3RT3B 4NQKE 1KJTA 2NPTA 3N30A 1OEYJ 3UQAA 4KIKB 3W1SC 4FHKA 1Q0WB 2LD9A 1WX7A 5JZEB 4MSQB 5G55A 3H9DA 3KUDB 3ZNHB 3V61A 3QK0A 2IYDB 4MSMB 5JHAA 1WZ0A 3QHTA 4K7WA 3M63B 5DPSA 2NPTB 5EDSA 1EO6A 2GBRA 3ML9A 3QARA 4A20A 4GB9A 3VUWA 5L95C 3ZIMA 3PT2B
chains in the Genus database with same CATH superfamily
2JSVX 4PYZA 4W9GA 2ACZB 4JLCA 2REXA 1OEYA 4YXDB 4I6PA 1LQBA 1NVID 1WGRA 3RD2A 2HJ1A 2N7DA 4NAMA 1QOGA 3RCZA 1L0XB 5D2MB 1R4MI 4M01A 3LDZE 2ONQA 5DCNA 4J6IA 2B3AA 3CF6E 1TIFA 2BW2A 3O65B 2ICIA 1TYGB 1XQQA 1KF6B 1NYQA 2L3ZA 1BMLC 1H4RA 2R2QA 2VH1A 3IXSA 3JW0X 1MI0A 1VD2A 3HM3A 3KH0A 3VFKA 3W2DA 2V4IB 2DYOA 3VUYA 1N61A 1WE6A 1TY0A 5FR3A 4MACA 2I38A 3EFCA 2IO3B 4GGQA 2QSDA 1TGZB 1JCKB 3Q3FA 2DX5B 2RMMA 4N58A 3NOBA 4PT5A 1ROEA 3HUIA 3WIMA 4YTPB 4RGOS 4MJSB 3J9CA 1VCBA 3Q69A 1XLOA 3KVFB 2IGDA 3APFA 4BOSC 2LRUA 4W9HA 2IDYA 1NDDA 1PFDA 2BYEA 2DZMA 1E0ZA 3UINB 2J42A 3ZJUA 2KAJA 1SJHD 3AMZA 1LM8B 1T0YA 1V6EA 2JQRB 2KDIA 2IJ0A 5IP4D 4KVGB 3ZRFA 5J2RA 4IKGA 5FKAC 3UGBB 3NHEB 1ZGUB 2H89B 3ZUNA 3ZDMC 5LLIA 4RGTA 2G1EA 2JVCA 3UQBA 4ACFA 1F2RC 3M62B 3IT6B 3DVGY 1UGJA 3LYYA 4YSZB 2AEHA 1H8CA 4B9KA 1YIWA 1U4AA 4URKA 3VR9B 5E6PA 1HZ6A 1C1YB 3HM6X 1WXMA 3SHQA 4FJVB 2D11A 2MP2A 1VR9A 2JF5A 2IY0B 1STEA 3B9JA 2PLPA 4IW0A 3OG5A 3AB5A 3KW5B 1UNSA 4ANWA 2M1MA 2EKIA 1YOVB 1EU4A 2WX1A 1I4PA 1RAXA 4JWSC 5EE0A 4DDGD 4BVUC 1FM0D 3L17A 4JPSA 2BB5A 4WJQA 2AL6A 2FAZA 1IYFA 1P9DU 1R4NB 2R2OA 1SGHA 2MA9B 1PGBA 4HWIB 3OAWA 1SIFA 3A9KB 4OVVA 2DLBA 4GIVA 1WXVA 2MP2B 2PE9A 4JX1C 3P63A 2KZRA 2DYMA 1R7SA 2KFKB 2INPE 1QT9A 2NTTA 4BBNF 2IGGA 2PVOD 1VZ6A 3NZUA 2CU1A 4EE2A 2KMCA 4LDTD 2VZKD 3U2SC 2EKEC 1E90A 2HTHA 4K7UA 2WQYB 1QF6A 4IM3A 1I4GA 4DBGA 3KUCB 1YX5B 3PTFC 4FADA 2D3AA 4E3CA 4USAA 1RFAA 1RRBA 4MEMA 2C7NB 2DYBA 1OTRB 1Z5SB 5CX3A 2L0TA 2G4DB 3VDZA 5BYSA 3TEWA 2KANA 4AJYB 3EC8A 4RFBA 2QIEB 4NAWB 3PGEA 1BXTA 3RNGC 3N3KB 3RMKC 4W9FA 1XO3A 2D3CA 4EZKA 1TY2A 1WZ3A 2AYOB 2E3TA 2ZW0A 4HEA1 3VUXA 3UF8A 5G2NA 1T0SC 3ZTDA 2PTLA 3AV8A 2BS2B 2BVCA 1RFKA 4BKSD 1AARA 1V9JA 1YJ1A 2GBKA 2A5UA 1N62A 1WM3A 3N20C 4TSSA 4W9LA 2LZ6A 3RN9C 1ZPSA 5L83A 3ZDTA 1F52A 1L4DB 4KDIC 2G45B 4ZYNA 2D3GA 3DCGA 4HLEA 3FILA 2W55A 4R3DA 4W9DA 3AU4A 1TZOA 2BWES 5AEKB 4HKQA 4G3XB 2YEPF 4DQOC 1SSNA 1TBEA 1I4QA 1FXAA 1FXIA 3KUZA 3ETRA 4A90A 2DZKA 5C1ZA 1BUIC 4A3OA 1MJDA 3I3TB 3Q3NC 4CYEA 3RZWC 3DHIC 1FFVA 4ZHOA 5BMHA 3DBLI 5E6OA 3AULA 3E56A 4MM3B 5FR6A 2RSUA 4ZRKA 1TT5B 1UELA 2KWDA 2OOBB 3QQ8B 3C0RB 1YD8U 1C79A 1I4XA 3TIXA 4HKZE 5TR5A 3V62A 2KQ7A 4G50A 3GP7A 1CZPA 1I35A 1YQ4B 1SE2A 4KGTA 1CMXB 4LK0M 3DQVA 5KHOA 4EZLA 1T5XD 2BYTA 4XE0A 4ANVA 4C7YA 2L83A 1QOBA 3AE2B 2KJ6A 2D07B 1P1AA 1PGAA 2UWQA 3BY4B 2KC1A 3TUOA 1SE4A 3DBHB 3IT4B 2KWVB 4BKSA 4XYCA 3GE8C 4E71A 4L1BA 3MC8A 2IBIB 2LVPA 2W82A 2XK5B 4O1NA 5G5GA 2PIAA 2DZIA 2JYTA 4XGAB 2KC2A 1E8ZA 2N9LA 1Y56A 5HFYA 4CHKA 2HD5B 2L7RA 4MH0E 3GB1A 4KIKA 3H7PB 4KX6B 2C60A 4NQKE 3AECB 4KIKB 1Q0WB 1F77A 2ZW1A 1P7FA 5G55A 3KUDB 3NRZA 3BK2A 5JHAA 4OVZA 2L1AA 5EDSA 3ML9A 4A20A 4GB9A 1GPXA 5C2TB 1UBQA 2ZZPB 4P16A 5C23A 3BYYB 3GS2A 2CS4A 5IOIA 3VRBB 2RDBC 4C4VB 3ZTCA 3BK1A 4DWFA 3P4QB 3P2BA 3PRZA 3P4SB 1SIJA 3NJTA 2N1WA 3LB8C 2N9PC 4HXDA 1F9JA 3ZLZA 3DVGX 3GE3C 2K5PA 3QC8B 4C80A 4FBJB 2KTRA 1V1PA 3AEDB 4UDUC 2KDFB 3AH7A 4J3OD 1GC7A 3B2FA 2FIFA 4XWTA 1YJIA 2PJHA 1EM7A 1E5WA 2J7QB 4FJZA 3MFGA 4NQLB 4W9IA 2FBWB 2M17A 3VAWA 2WXPA 2XN9C 3PLUA 4B95A 2KTFA 1KRHA 4K7SA 4II2B 3RNEC 4TV3A 3QX1A 2WDQB 4BFRA 2NTSA 2GLSA 3IBEA 2I1JA 2ZEQA 4WJPA 3DWGC 3A9KA 3CSFA 1JWAD 4MT5A 2KTRB 5MPOA 2DBYA 3JVZX 2FCMA 1XEEA 1WX9A 4TUUA 1KFYB 1IBXA 4HJKA 1GC6A 2K8BA 2JZ3B 3B0AA 3I9V1 1KH0A 4XWWA 1V5TA 4TKNA 1GB4A 2QEJC 2RPQA 4K3BA 3DBHI 2NBWB 4IG7B 3DHGC 3ZJVA 3TEYA 4DXFA 3R7RA 1J19A 1OGWA 2KYWA 2XBBC 2M56B 1ET9A 3AEBB 2K1FA 2WDRB 1WE7A 2L32A 1M4VA 2V3PA 3QA8A 2SEBD 1SBBB 3EECA 1VJKA 5EE3A 2KVZA 1UH6A 5HKHA 1HTQA 1EWYC 4X57B 2LJ5A 4M02A 2JRHA 4P7IA 4M00A 3QWZB 4A55A 2UYZB 3TMPB 4NY0A 4K1RB 1MHXA 2N0SB 2K22A 3AE4B 3N9YC 4MJSA 5G5HA 1J7BA 3ZQ4A 2HDEA 1UZXB 3S2AA 1D5MC 2RPVA 3WANA 4N9F4 3JYUA 2FIDA 4RH6A 2WX0A 2O6VB 4RGMA 1XF5L 3APDA 2NBVB 2LGSA 4ICUA 1YN5A 1L6VA 3P4RB 1E8XA 2NVUI 1UD7A 3WA0A 2NR2A 1XLQA 2WYQA 2ZCCA 1SE3A 1XD3B 1D5ZC 4K3CA 1F1HA 1C78A 1V97A 2CHXA 3MHSD 1TKYA 2KQSA 4US9A 2PW9A 1YQBA 1TS2A 1SF0A 5BO4B 1UUPA 4LTUA 4JWUC 2YLMA 1R4NI 1AYFA 2LJIA 1L5PA 2LGXA 2LVQA 3RI7C 4AWJA 4KDLB 5D3DA 4RMAA 4GU2A 4KGSA 3U7DA 3UIPB 2D3BA 3RNBC 2G4SA 3Q3OC 4N6EB 1XT9B 4FXCA 2YEPB 2RDGA 1UWMA 3NUHB 1IGDA 3IFWB 5AUKA 4GMVA 1WMHA 1P0RA 3HRDD 2WNMA 3M3JA 1L2NA 3H6NA 1SEBD 1ZW7A 2WXIA 2C7HA 4WWOA 2GI9A 1GOZA 4XC2A 2KJHB 3VVWB 5LXHA 1FRRA 2CHZA 2LEKA 3TEZA 2V0GA 2BS3B 2M19A 2LWPA 3SDLC 2K6QA 1ET6A 1UF0A 2BF8B 2LHEA 1C9FA 2KN4A 4WJNA 4ZHPA 3W1SA 3DHHC 1S3SG 3Q8EA 1ZP0B 1MG8A 2O6VD 2JT4B 2IO0B 2JRIB 4DHZE 3L10B 4LDTB 4HCPB 2WU5B 4KZCA 1MFWA 1WIAA 3WCQA 2WXJA 1VLBA 3AM9A 4B6WA 2AQ3B 4WAAA 2J52A 2KLCA 2A4ZA 3R2IA 2DAJA 1WFYA 3H7SA 1DOXA 1E8YA 1XCTL 4ZRQA 4KKIA 4NPNA 2GBJA 1FEHA 5E6JA 2AWTA 4GXBA 3WAOA 2NBUA 4XX5A 4P1BC 2J4XA 1TJEA 1Z2MA 5AZHA 1UGMA 5IN7A 1WF9A 1LFDA 1WGGA 3U4EG 1CK1A 1VZ7A 4NNJB 3N1XC 3L0WB 2R61A 2LUMA 4ZRPA 1EF5A 1N63A 5I4DA 2L05A 2H88B 1JMLA 1D3ZA 2QDFA 5D3IB 2C7MB 3MC9A 4M0WB 3AU5A 3ECIA 3PZDA 2L8JA 2KNBA 2CJOA 4LNIA 3BVZA 3L13A 1R4MB 1QOAA 3QAQA 1J7AA 3A33B 4IC7B 1LO5D 3DVNU 4IUMB 1YX6B 2L76A 2KDBA 3GOEA 3NVWA 2WXGA 3AE5B 1KLVA 3UIOB 2V9HA 4JE3B 1OQYA 5H92C 2OEDA 3RYTA 1WXQA 2K6DB 1L0YB 3ZW3A 2L52A 5C3JB 1V5OA 4WIPA 3R66C 5H8YE 2DENB 3HHMA 5DPTA 3DPDA 3GZNI 4NZLB 2Z0DB 4FJYA 3TEXA 3ZO5B 1ZOYB 3A1QA 2PVGC 3RT3B 3N30A 3ABVB 3T3NA 1JRPA 3BWUD 1WX7A 1MG4A 3H9DA 2LMCA 3BVMA 5DPSA 2BTEA 2GBRA 2PMVA 3QARA 3VUWA 4LNFA 2INCC 3ZIMA 3PT2B 1FO4A 4WWPA 3DDCB 1KM7A 4RM8A 2WP9B 5HHDG 1N5XA 1TKEA 2IO2B 2KHWB 3QJZA 4WJOA 2BPSA 4WAFA 3U30A 2MLBA 3IAS1 4C00A 3ZNID 3N1YC 2V4LA 1GAQB 2W3RA 3SFEB 2ASQA 4MGKE 1KLGD 1ZXIA 2JXXA 2BKFA 2UU7A 3K9PB 4ARCA 2N4FA 3RZFA 3KWVA 3BIID 2GB1A 1GG3A 4WWMA 3AEAB 1N60A 2FCSA 3KWLA 1GUAB 2W54A 2JU6X 4PS3A 1I4HA 3URYA 3AE9B 4HVBA 4WH4A 2BS4B 3NY5A 3TSSA 3V3XA 4F8CB 3PZ8A 1NENB 1WJ6A 4LJPB 3RNCC 1WWTA 2CJNA 3NVVA 1PGXA 2WXOA 1HQRD 1JW9D 2WXNA 2PPHA 3V6CB 3L54A 3AEEB 3A1QB 4B0MA 2NS5A 3H7PA 2N9EB 4A6QA 3B08A 5CTRC 3VQIA 2KACA 2KK8A 3VXWA 4IWOA 2GMIC 4S0RA 4AS1A 1XLPA 1SJED 1ZDVA 4XZ4A 3IG3A 2LXCA 2JWUA 3CWIA 2KFJA 1I42A 2MBOA 2XEWA 3O13A 2VH2A 1WGYA 4EUTA 3N1ZC 2VRRB 4MGZE 1F0ZA 4HRSA 3AE7B 2B76B 3ONSA 1B9RA 5HI1A 1P7EA 2MRPA 4GDKA 4PK1A 1C76A 4L23A 1FFUA 2D5GA 1K51A 2N1VA 3FC4A 1ISNA 1Q5WB 2PE6B 4GLSC 2L0FA 1T3QA 3ZRCA 1EWCA 1FD6A 2KKCA 2D2QA 2N7JA 3Q8BA 1WH3A 1WXSA 4LNNA 2LGIA 4DHJD 1HA5A 3WALA 2C5LC 3LJ3A 1K50A 2PEAA 2BBCA 3LXFA 1OQRA 2FUG1 1WGDA 2IY1B 3KLSX 5LXIB 2IGHA 1QZEA 2G9HD 2MJEA 1WJUA 3IHPC 4IWPA 1I7HA 1ZKHA 4YSXB 4BKGA 1J0GA 3H1UA 4DDID 2KXJA 2WXKA 4GDKB 4RF0A 5BMIA 1WM2A 1TS3A 3EA6A 4LLGM 2OJRA 3TJPA 3W1YA 4DHZB 4EEWA 3V05A 2YVCA 5AUIA 4YTNB 2JUOA 4KGRA 1MPEA 5E6NA 1V1PB 2KWUB 4KKJA 3SD5A 3DBRB 3NG0A 1A5RA 2MJ3A 1WXAA 3ZXRA 4JGHB 3BZDB 3AEFB 1M94A 5IKCM 4H2AA 4C4VA 1FNWA 4ITKA 1SXTA 2Z0EB 4RM9A 3T8MA 1E7PB 2MBBB 1JQ4A 2FNJB 2M0AA 1E9MA 3ZVVA 1WYWB 1KLUD 3L16A 1L7YA 4HDQA 3R2TA 5BYQA 1XXGA 3QCAA 2ZNVC 4PYUA 4P6VF 4OHJA 2LFIA 2BT6A 3NVYA 4REZA 2ZVOA 2Z59B 1FIQA 1P98A 3AXCA 1NEKB 4AUQC 2VZKB 1WMHB 4YWGG 1WJNA 3AE3B 1XCQL 3ZNZB 3OJ3A 2EMSA 1IPGA 3DBSA 1UWXA 1G6JA 1K53A 2HTME 2M4NA 3T9LA 3TBLD 2LGYA 4II3B 1K52A 1Y8RC 3ZGZA 5IO9A 4YL8A 1WYGA 3M95A 3RFZB 5CHVC 1FCLA 3PPAA 4BAXA 4ASWC 4KV2A 4FA6A 1EF1A 2ZCBA 4FN2A 1DGJA 4MGIE 1C4AA 1MVKA 3QIJA 2HE7A 3NS8A 3IVFA 3CSTA 2KWCA 4A8XC 2QMTA 3WAMA 3VRAB 1VZ8A 2WS3B 2GBMA 2WXRA 4OZBA 3C8YA 3AN1A 3I63C 4FHJA 2M0XA 1HTOA 2WXFA 4TMAB 2N9XA 3VTUA 4HJGE 1S1QB 5IA7A 3APCA 3N32A 1NBFC 3PO0A 3BINA 1JWSD 1SB3C 2KOXA 2K0PA 2KX0A 5JHBA 3RNFC 3Q3JA 3MJ5A 2JXTA 3U52E 3A4SC 1IGCA 1TTNA 1CQVA 2MSED 3ALBA 2MQJA 1WR1A 1OFFA 3DVNV 3W5UB 1OQQA 1K8RB 3VH4B 1FNVA 2IPKD 3Q8FA 4LNKA 2KO3A 1V86A 1ZXHA 1VDVA 3KYCD 3DOWA 2MEKA 5BMGA 1UBIA 2V3SA 1RWSA 5BYRA 2ZPNA 3P42A 3EGRA 1TKGA 3PRMB 4F1SA 4C7ZA 3L4PA 3VR8B 1D6EC 2WXMA 1Q10A 4G0NB 5IAAC 2X38A 3ZYYX 4LCDE 1J8CA 1ZE3D 4DXGA 2I1KA 2BWFA 3NVZA 2FCNA 2C9WB 2ZNVB 3VHTC 4YSYB 4NAWA 5D7GA 2K8HA 5GXGB 3R8BA 3Q8AA 2FE8A 2SAKA 3WAPA 2X8XX 1LXDA 4ZRIA 2KX3A 2M8SA 2AX5A 4XDDA 1AWDA 1JWBD 2TSSA 2LXAA 2MBQA 4XDCA 4WQOB 1WSPA 1IBXB 3D32A 2W9NA 3T3OA 1MHHE 2J0MA 2O2VA 2NPTA 4AQ7A 2WHIA 4L2YA 1OEYJ 3UQAA 2NMQA 3W1SC 4FHKA 4OZCA 5JXVA 4BZAA 2LD9A 1VRAB 2CU3A 2RDHA 4RGNA 5JZEB 1EU3A 3Q6BA 1DYQA 1F2RI 3MHZA 3QK0A 2IYDB 1WZ0A 2ON8A 4K7WA 4RCOA 2DWQA 1EO6A 5L95C 2WXQA 1PUTA 5EE9A 1A70A 1JROA 3W9CB 4OZAA 1YMHE 1PYWD 4HPMB 5J17A 2LASA 3NZ3A 1DOYA 3RULA 3FAHA 1FXTB 1C4PA 4M8MA 3TL5A 3OLMD 4BOZB 2CKHB 2JPHA 1XLNA 1YN3A 4I6LB 5GMVA 1YJJA 3Q8CA 4IWQA 2NCNA 4GDLB 2JX5A 2ZVNA 2GOWA 3DBLB 4MH8A 4HK2A 2CR5A 4MM3A 4WWNA 4PS7A 1QQRA 1YNTE 1AN8A 4HROA 4B0EA 2KT7A 1KOTA 2WXHA 4LJOB 1L4ZB 2AQ1B 4RNAA 4W9EA 1WI0A 4MDKE 2ZPYA 2OJWA 2Z8LA 4TQ0A 4ARIA 2MX2A 2WGSA 4IM0A 4Q2JA 2BB6A 4F7ZA 3B1LX 4TQ1A 3SU8X 4HCNB 4AJWA 2EMTA 1PDXA 1WJ4A 5JH5C 1GNUA 3SEBA 1FMAD 5DPWA 2INDC 4GDLA 1ZUD2 4C56C 2FUHB 3PREA 2AL3A 4EFOA 1V49A 3I5JC 1LGRA 2K3UA 2O6VA 5AZFA 2HJ8A 5T8IA 3ZKJC 4FLHA 3VH3B 2KD0A 2QILA 4KZ0A 1YQ3B 1V8CA 2JYEA 3SFDB 3AE1B 1JALA 3EHVA 4N59A 4DHJB 4WQMA 3Q3MC 3ENEA 1ESFA 2KFKA 3ZXVA 1C77A 2DHZA 4A3PA 3V6EB 4BKTA 3PV1A 3AI5A 2PKOA 1C3TA 1D4BA 3EUB2 1QILA 1NI3A 3ZJTA 3MTNB 3JSVA 4M8NA 3W5VB 2BYFA 4W9KA 1X1MA 3CMMB 2O2VB 3FKYA 4RF1A 1DOIA 4HPLB 2RR9A 2D10A 3MC0B 2K9XA 4GSWA 2INNE 2KDEB 1PQSA 4US8A 2N9KA 4CO7A 4ANXA 1RM6C 4S17A 2MWSB 3U8ZA 3PLVA 3DBRI 4ZRJA 5D94A 1WY8A 1WGHA 3KQ4A 3AE8B 4ZOHC 3NZSA 5HG2A 1C4CA 2WXLA 3R3MA 1V2YA 4M0WA 2KVRA 4IM2A 4AOFA 1TS5A 4NJ7A 1D5XC 4HDOA 2KN5A 2Y3AA 2QHOA 1NI2A 2LHDA 5FK9C 2DZJA 4IDIA 2JZPA 1NYRA 5D6JB 2JY6A 2MJDA 4NJ6A 1ENFA 2IZVB 4D2KA 1SE9A 4DXAB 1T6BX 2RGFA 1T0RC 3A9JA 1RLFA 2N7EA 4ZYSA 3PZ7A 3A9JB 1V81A 3VTWA 2L00B 4ZDVA 1FRDA 3PHXB 3HIZA 1V80A 2K39A 1TZ1A 2KQ4X 2QJLA 2I2YA 2QC8A 1N5WA 2E6XA 1IP9A 1GB1A 3PS6A 3ML8A 3AE6B 1AW7A 2LRWA 3HVDA 3U7ZA 2XK5A 2BGFA 1E6EB 2WDVB 3EFUA 4I6NB 2G3QB 3HK0A 2MHJA 2K8CA 2KDMA 1Q1OA 1N6ZA 2QCZA 2KMAA 1E7UA 4W9CA 2WDTB 3OJ4B 3GZNB 4EKUA 1QOFA 4LNOA 5CHFA 2JWZA 4W9JA 3VTVA 3Q2AC 3K9OB 2KLGA 2K25A 4IOIE 2J53A 4ICVA 1T0QC 2EELA 5J18A 2JZZA 3PHWB 1P3QU 3ZNGC 4AP4C 2LI5A 4GOCA 4JIOU 3V60A 2MW5A 1WGKA 5EE1A 4DK5A 4KSKC 3B2GA 4P1CC 3IAM1 4QAYA 1B1ZA 1HE8A 4MELA 3KYDD 3FILB 4PS8A 5LNK1 3RPFC 3OWEB 3UI3A 2MCNB 4WURA 1JWMD 1WX8A 1ACCA 3HVZA 3RUIB 1FCCC 5KHQA 3BYTB 2WWZA 2MBEA 4FULA 3JSVB 3PSEB 3X23A 2LGDA 5AZGA 2GRIA 2MBHA 2V1YA 3CIRB 3E9SA 3R7QA 3X0WA 4CQNA 4YT0B 4EOYA 4JL9A 2KJRA 1WR6E 1FNUA 2IO1B 5TSSA 1RYJA 1E7VA 2DAFA 3BVGA 1CJEA 1E8WA 1V1OA 2KMMA 4MGYE 5CHWA 2WLBA 5DPRA 1HEZE 1WRIA 4YTMB 1E10A 3AEGB 1QKZA 1ZDXA 2MH7A 4OVUA 4JQWC 4GN1A 2LUEA 3MP9A 2GBNA 3Q14C 2WU2B 3NS1A 4K81A 2CHWA 2RD0A 3C19A 2OHFA 3I57A 1EUVB 3TCAA 2J0KA 1QLBB 1BT0A 3PRPB 3P4PB 4BBNC 4EZJA 2BKRB 1YN4A 2AQ2B 4E74A 1FPYA 3RNAC 1KTKA 2BYVE 1HZ5A 2Y5BB 1HXYD 1WRDB 3A4RA 4G11A 1J7CA 2J0JA 2Y5PA 4ANUA 2ZJDA 1GJZA 4A9AA 1JRUA 2W3SA 1TS4A 2XNAC 3H8HA 3L08A 2Q5WD 3DWMA 3PVLA 1L6UA 4OW0A 2LVOA 4HPPA 3SR6A 4KSLC 1JWUD 2Y5CA 2FCQA 3MJWA 2DNFA 2V3NA 1KJTA 2BQQA 1I4RA 1L0VB 4MSQB 4NJCA 3P1MA 1IUEA 3ZNHB 3V61A 4MSMB 3QHTA 3M63B 2NPTB
chains in the Genus database with same CATH topology
1UBQA 2ZZPB 3DDCB 4PYZA 4WWPA 4W9GA 5C23A 4JLCA 2REXA 1OEYA 1KM7A 4I6PA 2CS4A 1LQBA 4RM8A 1WGRA 4HPMB 5J17A 3RD2A 2N7DA 2LASA 3ZTCA 4DWFA 2IO2B 3P2BA 2KHWB 3PRZA 3QJZA 3RULA 2N1WA 3RCZA 2N9PC 4WJOA 2BPSA 4HXDA 5D2MB 1FXTB 1R4MI 3U30A 2MLBA 3LDZE 4M8MA 1F9JA 3ZLZA 3TL5A 5DCNA 3OLMD 4J6IA 3ZNID 4BOZB 2V4LA 2B3AA 2CKHB 2JPHA 3CF6E 5GMVA 3DVGX 4I6LB 3O65B 3QC8B 4IWQA 2ASQA 2NCNA 4MGKE 4FBJB 2JXXA 2KTRA 1XQQA 4GDLB 2KDFB 2ZVNA 2GOWA 2BKFA 4HK2A 2CR5A 1GC7A 4MM3A 3K9PB 4WWNA 2N4FA 4PS7A 3RZFA 2L3ZA 2FIFA 2PJHA 1GG3A 1H4RA 2R2QA 1E5WA 2J7QB 1KOTA 4LJOB 2FCSA 1GUAB 4FJZA 3JW0X 1VD2A 4NQLB 3HM3A 4PS3A 4W9IA 3KH0A 4W9EA 3VFKA 4HVBA 1WI0A 3NY5A 2DYOA 3VUYA 2M17A 4MDKE 4F8CB 1WE6A 2ZPYA 3VAWA 1WJ6A 4LJPB 4TQ0A 3PLUA 4B95A 2MX2A 2KTFA 4IM0A 2IO3B 4GGQA 4K7SA 4II2B 4F7ZA 3B1LX 4TV3A 4TQ1A 1TGZB 3SU8X 3V6CB 2PPHA 3Q3FA 3QX1A 4HCNB 4AJWA 3L54A 4BFRA 2DX5B 3A1QB 3IBEA 2EMTA 2I1JA 3NOBA 2NS5A 2ZEQA 3H7PA 4WJPA 2N9EB 3WIMA 3B08A 5CTRC 3A9KA 3VQIA 3CSFA 1WJ4A 5JH5C 1GNUA 4MJSB 2KK8A 3VXWA 1VCBA 4IWOA 2GMIC 5DPWA 2KTRB 4GDLA 2FUHB 3KVFB 4XZ4A 3APFA 2LXCA 3IG3A 2LRUA 2FCMA 2KFJA 3JVZX 2AL3A 1WX9A 3PREA 4W9HA 4BOSC 4EFOA 1I42A 2MBOA 1NDDA 2XEWA 2BYEA 2DZMA 4TUUA 4HJKA 1V49A 1WGYA 3UINB 4EUTA 2O6VA 1GC6A 2VRRB 5AZFA 2HJ8A 4MGZE 2K8BA 3ZKJC 4FLHA 2JZ3B 3VH3B 2KD0A 1LM8B 1T0YA 3ONSA 1V6EA 3B0AA 4KZ0A 2KDIA 4KVGB 3ZRFA 5J2RA 2MRPA 4GDKA 3UGBB 3NHEB 1ZGUB 3ZUNA 3EHVA 1V5TA 4TKNA 3ZDMC 5LLIA 2RPQA 4DHJB 3DBHI 2NBWB 2N1VA 4IG7B 3ENEA 2JVCA 1ISNA 3UQBA 1Q5WB 2KFKA 2PE6B 3R7RA 3M62B 1J19A 1OGWA 2DHZA 3DVGY 4A3PA 2L0FA 3V6EB 3ZRCA 4BKTA 3PV1A 2XBBC 2KKCA 2D2QA 3AI5A 2K1FA 1C3TA 2AEHA 1H8CA 1WH3A 1WXSA 1WE7A 4B9KA 1YIWA 1U4AA 4URKA 3QA8A 4DHJD 3MTNB 5E6PA 3EECA 2C5LC 3JSVA 3LJ3A 2PEAA 4M8NA 3WALA 2BYFA 4W9KA 1C1YB 1X1MA 2O2VB 3CMMB 1WXMA 3HM6X 3SHQA 4FJVB 2D11A 2MP2A 1WGDA 4HPLB 1UH6A 2JF5A 2RR9A 5HKHA 4X57B 2D10A 2IY0B 2IY1B 2LJ5A 5LXIB 4GSWA 1QZEA 2JRHA 1WJUA 2KDEB 4P7IA 1PQSA 3QWZB 4IW0A 2UYZB 3IHPC 4IWPA 3TMPB 3KW5B 4NY0A 4ANWA 4ANXA 1ZKHA 4K1RB 2M1MA 4CO7A 4BKGA 2MWSB 1J0GA 3H1UA 3U8ZA 2WX1A 3PLVA 3DBRI 4ZRJA 4DDID 1RAXA 5D94A 1WY8A 2KXJA 4MJSA 1WGHA 4DDGD 4BVUC 4GDKB 1UZXB 3NZSA 3S2AA 3WANA 4N9F4 3L17A 1WM2A 4WJQA 3JYUA 3R3MA 1V2YA 2AL6A 2FAZA 2OJRA 2FIDA 1IYFA 3TJPA 1P9DU 2KVRA 2WX0A 3W1YA 4IM2A 4AOFA 4DHZB 4EEWA 2YVCA 2O6VB 4NJ7A 4HDOA 2KN5A 3APDA 2NBVB 2R2OA 1SGHA 2JUOA 4ICUA 5E6NA 2MA9B 2KWUB 2QHOA 1NI2A 4HWIB 1E8XA 3SD5A 2NVUI 3OAWA 1UD7A 1SIFA 2DZJA 3WA0A 2NR2A 3A9KB 4OVVA 1A5RA 1WXAA 2WYQA 4GIVA 2ZCCA 4JGHB 5D6JB 1XD3B 1WXVA 2JY6A 2MP2B 1M94A 2PE9A 4NJ6A 2KZRA 2IZVB 2DYMA 1SE9A 2KFKB 4DXAB 2CHXA 3MHSD 2RGFA 2KQSA 3A9JA 1RLFA 4BBNF 2N7EA 1YQBA 5BO4B 2Z0EB 4RM9A 3NZUA 3T8MA 2MBBB 2CU1A 1V81A 3A9JB 2YLMA 3VTWA 2FNJB 1R4NI 2L00B 3ZVVA 4ZDVA 2KMCA 3PHXB 1WYWB 3HIZA 2LGXA 2LVQA 4LDTD 3L16A 1V80A 2K39A 1TZ1A 4AWJA 2EKEC 1E90A 1L7YA 2HTHA 4KDLB 4HDQA 4K7UA 4RMAA 4GU2A 3QCAA 3U7DA 4IM3A 2ZNVC 3UIPB 4DBGA 3KUCB 1IP9A 1YX5B 2G4SA 3PTFC 4PYUA 3PS6A 1XT9B 3ML8A 4FADA 4E3CA 1RFAA 1RRBA 3IFWB 4MEMA 2LRWA 2C7NB 2DYBA 4GMVA 1OTRB 1Z5SB 1WMHA 1P0RA 2XK5A 5CX3A 2L0TA 2G4DB 2ZVOA 2Z59B 3M3JA 3VDZA 1P98A 3AXCA 2BGFA 2KANA 4AJYB 1L2NA 3EC8A 4AUQC 3H6NA 4NAWB 1WMHB 3PGEA 1ZW7A 3EFUA 3N3KB 1WJNA 4I6NB 2G3QB 2C7HA 3HK0A 4WWOA 4XC2A 2KJHB 3VVWB 5LXHA 2K8CA 3ZNZB 3OJ3A 2CHZA 4W9FA 2EMSA 1Q1OA 1IPGA 4EZKA 3DBSA 2KMAA 1E7UA 1WZ3A 2AYOB 4W9CA 1G6JA 2M4NA 2LWPA 2WDTB 3SDLC 3VUXA 3T9LA 3TBLD 2K6QA 2LGYA 3OJ4B 4II3B 3UF8A 4EKUA 5G2NA 2BF8B 1Y8RC 5CHFA 3ZTDA 2JWZA 4W9JA 3VTVA 3K9OB 4YL8A 2KLGA 2K25A 3M95A 1AARA 4WJNA 1V9JA 3W1SA 4BKSD 5CHVC 1YJ1A 1S3SG 4ICVA 2GBKA 3PPAA 5J18A 2JZZA 2A5UA 1MG8A 4ASWC 4KV2A 4FA6A 3PHWB 1WM3A 2O6VD 1EF1A 1P3QU 2JT4B 2ZCBA 2LI5A 4FN2A 2LZ6A 4W9LA 3ZNGC 4AP4C 4GOCA 2IO0B 4JIOU 4MGIE 3V60A 2JRIB 2MW5A 5L83A 4DK5A 3QIJA 4DHZE 4KSKC 3ZDTA 3L10B 2HE7A 3NS8A 4LDTB 4HCPB 4KDIC 3IVFA 3CSTA 2KWCA 2G45B 4ZYNA 2D3GA 3DCGA 4HLEA 3WAMA 4W9DA 4KZCA 3AU4A 1WIAA 2BWES 1HE8A 5AEKB 4MELA 3KYDD 4G3XB 4PS8A 4B6WA 2GBMA 2MCNB 1TBEA 4WAAA 2KLCA 1WX8A 2A4ZA 2DAJA 3KUZA 1WFYA 2M0XA 3H7SA 4FHJA 3RUIB 2DZKA 1E8YA 5C1ZA 5KHQA 4A3OA 4NPNA 2WWZA 2GBJA 2MBEA 2N9XA 3I3TB 3VTUA 4FULA 3JSVB 4CYEA 2AWTA 4GXBA 3RZWC 2NBUA 3WAOA 3PSEB 3X23A 1S1QB 2LGDA 5AZGA 4XX5A 5IA7A 3APCA 3N32A 1NBFC 3DBLI 5E6OA 2MBHA 2V1YA 3R7QA 3X0WA 3AULA 3BINA 2KOXA 5FR6A 1Z2MA 5AZHA 4EOYA 1UGMA 2KX0A 4JL9A 1WF9A 1LFDA 5JHBA 2KJRA 1WGGA 1WR6E 4NNJB 2RSUA 4ZRKA 1UELA 3Q3JA 2IO1B 2OOBB 3L0WB 1E7VA 2DAFA 3C0RB 3QQ8B 1EF5A 1E8WA 1YD8U 3A4SC 4MGYE 1TTNA 5CHWA 3TIXA 5DPRA 2L05A 2MSED 3ALBA 2MQJA 1WR1A 5TR5A 3DVNV 1K8RB 3V62A 1D3ZA 4OVUA 3VH4B 4JQWC 2KQ7A 4GN1A 2LUEA 4G50A 2C7MB 2KO3A 1V86A 2GBNA 1I35A 4M0WB 3AU5A 3ECIA 3KYCD 1CMXB 3DOWA 3PZDA 1UBIA 2CHWA 2V3SA 4K81A 2L8JA 2ZPNA 2KNBA 3DQVA 5KHOA 4EZLA 2RD0A 3PRMB 4F1SA 3L13A 1EUVB 3TCAA 4ANVA 2J0KA 1BT0A 3PRPB 2KJ6A 2D07B 3QAQA 4BBNC 4EZJA 1P1AA 3A33B 4IC7B 3DVNU 4G0NB 2BKRB 4IUMB 5IAAC 1YX6B 2UWQA 3BY4B 2KC1A 4LCDE 1J8CA 2L76A 2KDBA 3GOEA 4E74A 2I1KA 2KWVB 4BKSA 1KLVA 3UIOB 4E71A 2BWFA 2FCNA 2C9WB 2BYVE 2Y5BB 2ZNVB 1WRDB 3A4RA 2IBIB 3VHTC 4G11A 2LVPA 1OQYA 2J0JA 2XK5B 2ZJDA 4NAWA 5D7GA 2K8HA 4ANUA 1GJZA 1JRUA 3RYTA 2K6DB 3WAPA 2DZIA 3ZW3A 1V5OA 1LXDA 4ZRIA 2KC2A 2KX3A 3R66C 2M8SA 1E8ZA 2DENB 3L08A 3HHMA 5DPTA 3PVLA 3DPDA 2LVOA 2LXAA 4CHKA 2MBQA 3GZNI 4KSLC 2HD5B 2L7RA 4WQOB 2Z0DB 4FJYA 3D32A 2W9NA 3ZO5B 3A1QA 2FCQA 3MJWA 4MH0E 2J0MA 4KIKA 3H7PB 2O2VA 2C60A 3RT3B 4NQKE 1KJTA 2NPTA 3N30A 1OEYJ 3UQAA 4KIKB 3W1SC 4FHKA 1Q0WB 2LD9A 1WX7A 5JZEB 4MSQB 5G55A 3H9DA 3KUDB 3ZNHB 3V61A 3QK0A 2IYDB 4MSMB 5JHAA 1WZ0A 3QHTA 4K7WA 3M63B 5DPSA 2NPTB 5EDSA 1EO6A 2GBRA 3ML9A 3QARA 4A20A 4GB9A 3VUWA 5L95C 3ZIMA 3PT2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UBQ A;  2ZZP B;  3DDC B;  4PYZ A;  4WWP A;  4W9G A;  5C23 A;  4JLC A;  2REX A;  1OEY A;  1KM7 A;  4I6P A;  2CS4 A;  1LQB A;  4RM8 A;  1WGR A;  4HPM B;  5J17 A;  3RD2 A;  2N7D A;  2LAS A;  3ZTC A;  4DWF A;  2IO2 B;  3P2B A;  2KHW B;  3PRZ A;  3QJZ A;  3RUL A;  2N1W A;  3RCZ A;  2N9P C;  4WJO A;  2BPS A;  4HXD A;  5D2M B;  1FXT B;  1R4M I;  3U30 A;  2MLB A;  3LDZ E;  4M8M A;  1F9J A;  3ZLZ A;  3TL5 A;  5DCN A;  3OLM D;  4J6I A;  3ZNI D;  4BOZ B;  2V4L A;  2B3A A;  2CKH B;  2JPH A;  3CF6 E;  5GMV A;  3DVG X;  4I6L B;  3O65 B;  3QC8 B;  4IWQ A;  2ASQ A;  2NCN A;  4MGK E;  4FBJ B;  2JXX A;  2KTR A;  1XQQ A;  4GDL B;  2KDF B;  2ZVN A;  2GOW A;  2BKF A;  4HK2 A;  2CR5 A;  1GC7 A;  4MM3 A;  3K9P B;  4WWN A;  2N4F A;  4PS7 A;  3RZF A;  2L3Z A;  2FIF A;  2PJH A;  1GG3 A;  1H4R A;  2R2Q A;  1E5W A;  2J7Q B;  1KOT A;  4LJO B;  2FCS A;  1GUA B;  4FJZ A;  3JW0 X;  1VD2 A;  4NQL B;  3HM3 A;  4PS3 A;  4W9I A;  3KH0 A;  4W9E A;  3VFK A;  4HVB A;  1WI0 A;  3NY5 A;  2DYO A;  3VUY A;  2M17 A;  4MDK E;  4F8C B;  1WE6 A;  2ZPY A;  3VAW A;  1WJ6 A;  4LJP B;  4TQ0 A;  3PLU A;  4B95 A;  2MX2 A;  2KTF A;  4IM0 A;  2IO3 B;  4GGQ A;  4K7S A;  4II2 B;  4F7Z A;  3B1L X;  4TV3 A;  4TQ1 A;  1TGZ B;  3SU8 X;  3V6C B;  2PPH A;  3Q3F A;  3QX1 A;  4HCN B;  4AJW A;  3L54 A;  4BFR A;  2DX5 B;  3A1Q B;  3IBE A;  2EMT A;  2I1J A;  3NOB A;  2NS5 A;  2ZEQ A;  3H7P A;  4WJP A;  2N9E B;  3WIM A;  3B08 A;  5CTR C;  3A9K A;  3VQI A;  3CSF A;  1WJ4 A;  5JH5 C;  1GNU A;  4MJS B;  2KK8 A;  3VXW A;  1VCB A;  4IWO A;  2GMI C;  5DPW A;  2KTR B;  4GDL A;  2FUH B;  3KVF B;  4XZ4 A;  3APF A;  2LXC A;  3IG3 A;  2LRU A;  2FCM A;  2KFJ A;  3JVZ X;  2AL3 A;  1WX9 A;  3PRE A;  4W9H A;  4BOS C;  4EFO A;  1I42 A;  2MBO A;  1NDD A;  2XEW A;  2BYE A;  2DZM A;  4TUU A;  4HJK A;  1V49 A;  1WGY A;  3UIN B;  4EUT A;  2O6V A;  1GC6 A;  2VRR B;  5AZF A;  2HJ8 A;  4MGZ E;  2K8B A;  3ZKJ C;  4FLH A;  2JZ3 B;  3VH3 B;  2KD0 A;  1LM8 B;  1T0Y A;  3ONS A;  1V6E A;  3B0A A;  4KZ0 A;  2KDI A;  4KVG B;  3ZRF A;  5J2R A;  2MRP A;  4GDK A;  3UGB B;  3NHE B;  1ZGU B;  3ZUN A;  3EHV A;  1V5T A;  4TKN A;  3ZDM C;  5LLI A;  2RPQ A;  4DHJ B;  3DBH I;  2NBW B;  2N1V A;  4IG7 B;  3ENE A;  2JVC A;  1ISN A;  3UQB A;  1Q5W B;  2KFK A;  2PE6 B;  3R7R A;  3M62 B;  1J19 A;  1OGW A;  2DHZ A;  3DVG Y;  4A3P A;  2L0F A;  3V6E B;  3ZRC A;  4BKT A;  3PV1 A;  2XBB C;  2KKC A;  2D2Q A;  3AI5 A;  2K1F A;  1C3T A;  2AEH A;  1H8C A;  1WH3 A;  1WXS A;  1WE7 A;  4B9K A;  1YIW A;  1U4A A;  4URK A;  3QA8 A;  4DHJ D;  3MTN B;  5E6P A;  3EEC A;  2C5L C;  3JSV A;  3LJ3 A;  2PEA A;  4M8N A;  3WAL A;  2BYF A;  4W9K A;  1C1Y B;  1X1M A;  2O2V B;  3CMM B;  1WXM A;  3HM6 X;  3SHQ A;  4FJV B;  2D11 A;  2MP2 A;  1WGD A;  4HPL B;  1UH6 A;  2JF5 A;  2RR9 A;  5HKH A;  4X57 B;  2D10 A;  2IY0 B;  2IY1 B;  2LJ5 A;  5LXI B;  4GSW A;  1QZE A;  2JRH A;  1WJU A;  2KDE B;  4P7I A;  1PQS A;  3QWZ B;  4IW0 A;  2UYZ B;  3IHP C;  4IWP A;  3TMP B;  3KW5 B;  4NY0 A;  4ANW A;  4ANX A;  1ZKH A;  4K1R B;  2M1M A;  4CO7 A;  4BKG A;  2MWS B;  1J0G A;  3H1U A;  3U8Z A;  2WX1 A;  3PLV A;  3DBR I;  4ZRJ A;  4DDI D;  1RAX A;  5D94 A;  1WY8 A;  2KXJ A;  4MJS A;  1WGH A;  4DDG D;  4BVU C;  4GDK B;  1UZX B;  3NZS A;  3S2A A;  3WAN A;  4N9F 4;  3L17 A;  1WM2 A;  4WJQ A;  3JYU A;  3R3M A;  1V2Y A;  2AL6 A;  2FAZ A;  2OJR A;  2FID A;  1IYF A;  3TJP A;  1P9D U;  2KVR A;  2WX0 A;  3W1Y A;  4IM2 A;  4AOF A;  4DHZ B;  4EEW A;  2YVC A;  2O6V B;  4NJ7 A;  4HDO A;  2KN5 A;  3APD A;  2NBV B;  2R2O A;  1SGH A;  2JUO A;  4ICU A;  5E6N A;  2MA9 B;  2KWU B;  2QHO A;  1NI2 A;  4HWI B;  1E8X A;  3SD5 A;  2NVU I;  3OAW A;  1UD7 A;  1SIF A;  2DZJ A;  3WA0 A;  2NR2 A;  3A9K B;  4OVV A;  1A5R A;  1WXA A;  2WYQ A;  4GIV A;  2ZCC A;  4JGH B;  5D6J B;  1XD3 B;  1WXV A;  2JY6 A;  2MP2 B;  1M94 A;  2PE9 A;  4NJ6 A;  2KZR A;  2IZV B;  2DYM A;  1SE9 A;  2KFK B;  4DXA B;  2CHX A;  3MHS D;  2RGF A;  2KQS A;  3A9J A;  1RLF A;  4BBN F;  2N7E A;  1YQB A;  5BO4 B;  2Z0E B;  4RM9 A;  3NZU A;  3T8M A;  2MBB B;  2CU1 A;  1V81 A;  3A9J B;  2YLM A;  3VTW A;  2FNJ B;  1R4N I;  2L00 B;  3ZVV A;  4ZDV A;  2KMC A;  3PHX B;  1WYW B;  3HIZ A;  2LGX A;  2LVQ A;  4LDT D;  3L16 A;  1V80 A;  2K39 A;  1TZ1 A;  4AWJ A;  2EKE C;  1E90 A;  1L7Y A;  2HTH A;  4KDL B;  4HDQ A;  4K7U A;  4RMA A;  4GU2 A;  3QCA A;  3U7D A;  4IM3 A;  2ZNV C;  3UIP B;  4DBG A;  3KUC B;  1IP9 A;  1YX5 B;  2G4S A;  3PTF C;  4PYU A;  3PS6 A;  1XT9 B;  3ML8 A;  4FAD A;  4E3C A;  1RFA A;  1RRB A;  3IFW B;  4MEM A;  2LRW A;  2C7N B;  2DYB A;  4GMV A;  1OTR B;  1Z5S B;  1WMH A;  1P0R A;  2XK5 A;  5CX3 A;  2L0T A;  2G4D B;  2ZVO A;  2Z59 B;  3M3J A;  3VDZ A;  1P98 A;  3AXC A;  2BGF A;  2KAN A;  4AJY B;  1L2N A;  3EC8 A;  4AUQ C;  3H6N A;  4NAW B;  1WMH B;  3PGE A;  1ZW7 A;  3EFU A;  3N3K B;  1WJN A;  4I6N B;  2G3Q B;  2C7H A;  3HK0 A;  4WWO A;  4XC2 A;  2KJH B;  3VVW B;  5LXH A;  2K8C A;  3ZNZ B;  3OJ3 A;  2CHZ A;  4W9F A;  2EMS A;  1Q1O A;  1IPG A;  4EZK A;  3DBS A;  2KMA A;  1E7U A;  1WZ3 A;  2AYO B;  4W9C A;  1G6J A;  2M4N A;  2LWP A;  2WDT B;  3SDL C;  3VUX A;  3T9L A;  3TBL D;  2K6Q A;  2LGY A;  3OJ4 B;  4II3 B;  3UF8 A;  4EKU A;  5G2N A;  2BF8 B;  1Y8R C;  5CHF A;  3ZTD A;  2JWZ A;  4W9J A;  3VTV A;  3K9O B;  4YL8 A;  2KLG A;  2K25 A;  3M95 A;  1AAR A;  4WJN A;  1V9J A;  3W1S A;  4BKS D;  5CHV C;  1YJ1 A;  1S3S G;  4ICV A;  2GBK A;  3PPA A;  5J18 A;  2JZZ A;  2A5U A;  1MG8 A;  4ASW C;  4KV2 A;  4FA6 A;  3PHW B;  1WM3 A;  2O6V D;  1EF1 A;  1P3Q U;  2JT4 B;  2ZCB A;  2LI5 A;  4FN2 A;  2LZ6 A;  4W9L A;  3ZNG C;  4AP4 C;  4GOC A;  2IO0 B;  4JIO U;  4MGI E;  3V60 A;  2JRI B;  2MW5 A;  5L83 A;  4DK5 A;  3QIJ A;  4DHZ E;  4KSK C;  3ZDT A;  3L10 B;  2HE7 A;  3NS8 A;  4LDT B;  4HCP B;  4KDI C;  3IVF A;  3CST A;  2KWC A;  2G45 B;  4ZYN A;  2D3G A;  3DCG A;  4HLE A;  3WAM A;  4W9D A;  4KZC A;  3AU4 A;  1WIA A;  2BWE S;  1HE8 A;  5AEK B;  4MEL A;  3KYD D;  4G3X B;  4PS8 A;  4B6W A;  2GBM A;  2MCN B;  1TBE A;  4WAA A;  2KLC A;  1WX8 A;  2A4Z A;  2DAJ A;  3KUZ A;  1WFY A;  2M0X A;  3H7S A;  4FHJ A;  3RUI B;  2DZK A;  1E8Y A;  5C1Z A;  5KHQ A;  4A3O A;  4NPN A;  2WWZ A;  2GBJ A;  2MBE A;  2N9X A;  3I3T B;  3VTU A;  4FUL A;  3JSV B;  4CYE A;  2AWT A;  4GXB A;  3RZW C;  2NBU A;  3WAO A;  3PSE B;  3X23 A;  1S1Q B;  2LGD A;  5AZG A;  4XX5 A;  5IA7 A;  3APC A;  3N32 A;  1NBF C;  3DBL I;  5E6O A;  2MBH A;  2V1Y A;  3R7Q A;  3X0W A;  3AUL A;  3BIN A;  2KOX A;  5FR6 A;  1Z2M A;  5AZH A;  4EOY A;  1UGM A;  2KX0 A;  4JL9 A;  1WF9 A;  1LFD A;  5JHB A;  2KJR A;  1WGG A;  1WR6 E;  4NNJ B;  2RSU A;  4ZRK A;  1UEL A;  3Q3J A;  2IO1 B;  2OOB B;  3L0W B;  1E7V A;  2DAF A;  3C0R B;  3QQ8 B;  1EF5 A;  1E8W A;  1YD8 U;  3A4S C;  4MGY E;  1TTN A;  5CHW A;  3TIX A;  5DPR A;  2L05 A;  2MSE D;  3ALB A;  2MQJ A;  1WR1 A;  5TR5 A;  3DVN V;  1K8R B;  3V62 A;  1D3Z A;  4OVU A;  3VH4 B;  4JQW C;  2KQ7 A;  4GN1 A;  2LUE A;  4G50 A;  2C7M B;  2KO3 A;  1V86 A;  2GBN A;  1I35 A;  4M0W B;  3AU5 A;  3ECI A;  3KYC D;  1CMX B;  3DOW A;  3PZD A;  1UBI A;  2CHW A;  2V3S A;  4K81 A;  2L8J A;  2ZPN A;  2KNB A;  3DQV A;  5KHO A;  4EZL A;  2RD0 A;  3PRM B;  4F1S A;  3L13 A;  1EUV B;  3TCA A;  4ANV A;  2J0K A;  1BT0 A;  3PRP B;  2KJ6 A;  2D07 B;  3QAQ A;  4BBN C;  4EZJ A;  1P1A A;  3A33 B;  4IC7 B;  3DVN U;  4G0N B;  2BKR B;  4IUM B;  5IAA C;  1YX6 B;  2UWQ A;  3BY4 B;  2KC1 A;  4LCD E;  1J8C A;  2L76 A;  2KDB A;  3GOE A;  4E74 A;  2I1K A;  2KWV B;  4BKS A;  1KLV A;  3UIO B;  4E71 A;  2BWF A;  2FCN A;  2C9W B;  2BYV E;  2Y5B B;  2ZNV B;  1WRD B;  3A4R A;  2IBI B;  3VHT C;  4G11 A;  2LVP A;  1OQY A;  2J0J A;  2XK5 B;  2ZJD A;  4NAW A;  5D7G A;  2K8H A;  4ANU A;  1GJZ A;  1JRU A;  3RYT A;  2K6D B;  3WAP A;  2DZI A;  3ZW3 A;  1V5O A;  1LXD A;  4ZRI A;  2KC2 A;  2KX3 A;  3R66 C;  2M8S A;  1E8Z A;  2DEN B;  3L08 A;  3HHM A;  5DPT A;  3PVL A;  3DPD A;  2LVO A;  2LXA A;  4CHK A;  2MBQ A;  3GZN I;  4KSL C;  2HD5 B;  2L7R A;  4WQO B;  2Z0D B;  4FJY A;  3D32 A;  2W9N A;  3ZO5 B;  3A1Q A;  2FCQ A;  3MJW A;  4MH0 E;  2J0M A;  4KIK A;  3H7P B;  2O2V A;  2C60 A;  3RT3 B;  4NQK E;  1KJT A;  2NPT A;  3N30 A;  1OEY J;  3UQA A;  4KIK B;  3W1S C;  4FHK A;  1Q0W B;  2LD9 A;  1WX7 A;  5JZE B;  4MSQ B;  5G55 A;  3H9D A;  3KUD B;  3ZNH B;  3V61 A;  3QK0 A;  2IYD B;  4MSM B;  5JHA A;  1WZ0 A;  3QHT A;  4K7W A;  3M63 B;  5DPS A;  2NPT B;  5EDS A;  1EO6 A;  2GBR A;  3ML9 A;  3QAR A;  4A20 A;  4GB9 A;  3VUW A;  5L95 C;  3ZIM A;  3PT2 B; 
#chains in the Genus database with same CATH topology
 2JSV X;  4PYZ A;  4W9G A;  2ACZ B;  4JLC A;  2REX A;  1OEY A;  4YXD B;  4I6P A;  1LQB A;  1NVI D;  1WGR A;  3RD2 A;  2HJ1 A;  2N7D A;  4NAM A;  1QOG A;  3RCZ A;  1L0X B;  5D2M B;  1R4M I;  4M01 A;  3LDZ E;  2ONQ A;  5DCN A;  4J6I A;  2B3A A;  3CF6 E;  1TIF A;  2BW2 A;  3O65 B;  2ICI A;  1TYG B;  1XQQ A;  1KF6 B;  1NYQ A;  2L3Z A;  1BML C;  1H4R A;  2R2Q A;  2VH1 A;  3IXS A;  3JW0 X;  1MI0 A;  1VD2 A;  3HM3 A;  3KH0 A;  3VFK A;  3W2D A;  2V4I B;  2DYO A;  3VUY A;  1N61 A;  1WE6 A;  1TY0 A;  5FR3 A;  4MAC A;  2I38 A;  3EFC A;  2IO3 B;  4GGQ A;  2QSD A;  1TGZ B;  1JCK B;  3Q3F A;  2DX5 B;  2RMM A;  4N58 A;  3NOB A;  4PT5 A;  1ROE A;  3HUI A;  3WIM A;  4YTP B;  4RGO S;  4MJS B;  3J9C A;  1VCB A;  3Q69 A;  1XLO A;  3KVF B;  2IGD A;  3APF A;  4BOS C;  2LRU A;  4W9H A;  2IDY A;  1NDD A;  1PFD A;  2BYE A;  2DZM A;  1E0Z A;  3UIN B;  2J42 A;  3ZJU A;  2KAJ A;  1SJH D;  3AMZ A;  1LM8 B;  1T0Y A;  1V6E A;  2JQR B;  2KDI A;  2IJ0 A;  5IP4 D;  4KVG B;  3ZRF A;  5J2R A;  4IKG A;  5FKA C;  3UGB B;  3NHE B;  1ZGU B;  2H89 B;  3ZUN A;  3ZDM C;  5LLI A;  4RGT A;  2G1E A;  2JVC A;  3UQB A;  4ACF A;  1F2R C;  3M62 B;  3IT6 B;  3DVG Y;  1UGJ A;  3LYY A;  4YSZ B;  2AEH A;  1H8C A;  4B9K A;  1YIW A;  1U4A A;  4URK A;  3VR9 B;  5E6P A;  1HZ6 A;  1C1Y B;  3HM6 X;  1WXM A;  3SHQ A;  4FJV B;  2D11 A;  2MP2 A;  1VR9 A;  2JF5 A;  2IY0 B;  1STE A;  3B9J A;  2PLP A;  4IW0 A;  3OG5 A;  3AB5 A;  3KW5 B;  1UNS A;  4ANW A;  2M1M A;  2EKI A;  1YOV B;  1EU4 A;  2WX1 A;  1I4P A;  1RAX A;  4JWS C;  5EE0 A;  4DDG D;  4BVU C;  1FM0 D;  3L17 A;  4JPS A;  2BB5 A;  4WJQ A;  2AL6 A;  2FAZ A;  1IYF A;  1P9D U;  1R4N B;  2R2O A;  1SGH A;  2MA9 B;  1PGB A;  4HWI B;  3OAW A;  1SIF A;  3A9K B;  4OVV A;  2DLB A;  4GIV A;  1WXV A;  2MP2 B;  2PE9 A;  4JX1 C;  3P63 A;  2KZR A;  2DYM A;  1R7S A;  2KFK B;  2INP E;  1QT9 A;  2NTT A;  4BBN F;  2IGG A;  2PVO D;  1VZ6 A;  3NZU A;  2CU1 A;  4EE2 A;  2KMC A;  4LDT D;  2VZK D;  3U2S C;  2EKE C;  1E90 A;  2HTH A;  4K7U A;  2WQY B;  1QF6 A;  4IM3 A;  1I4G A;  4DBG A;  3KUC B;  1YX5 B;  3PTF C;  4FAD A;  2D3A A;  4E3C A;  4USA A;  1RFA A;  1RRB A;  4MEM A;  2C7N B;  2DYB A;  1OTR B;  1Z5S B;  5CX3 A;  2L0T A;  2G4D B;  3VDZ A;  5BYS A;  3TEW A;  2KAN A;  4AJY B;  3EC8 A;  4RFB A;  2QIE B;  4NAW B;  3PGE A;  1BXT A;  3RNG C;  3N3K B;  3RMK C;  4W9F A;  1XO3 A;  2D3C A;  4EZK A;  1TY2 A;  1WZ3 A;  2AYO B;  2E3T A;  2ZW0 A;  4HEA 1;  3VUX A;  3UF8 A;  5G2N A;  1T0S C;  3ZTD A;  2PTL A;  3AV8 A;  2BS2 B;  2BVC A;  1RFK A;  4BKS D;  1AAR A;  1V9J A;  1YJ1 A;  2GBK A;  2A5U A;  1N62 A;  1WM3 A;  3N20 C;  4TSS A;  4W9L A;  2LZ6 A;  3RN9 C;  1ZPS A;  5L83 A;  3ZDT A;  1F52 A;  1L4D B;  4KDI C;  2G45 B;  4ZYN A;  2D3G A;  3DCG A;  4HLE A;  3FIL A;  2W55 A;  4R3D A;  4W9D A;  3AU4 A;  1TZO A;  2BWE S;  5AEK B;  4HKQ A;  4G3X B;  2YEP F;  4DQO C;  1SSN A;  1TBE A;  1I4Q A;  1FXA A;  1FXI A;  3KUZ A;  3ETR A;  4A90 A;  2DZK A;  5C1Z A;  1BUI C;  4A3O A;  1MJD A;  3I3T B;  3Q3N C;  4CYE A;  3RZW C;  3DHI C;  1FFV A;  4ZHO A;  5BMH A;  3DBL I;  5E6O A;  3AUL A;  3E56 A;  4MM3 B;  5FR6 A;  2RSU A;  4ZRK A;  1TT5 B;  1UEL A;  2KWD A;  2OOB B;  3QQ8 B;  3C0R B;  1YD8 U;  1C79 A;  1I4X A;  3TIX A;  4HKZ E;  5TR5 A;  3V62 A;  2KQ7 A;  4G50 A;  3GP7 A;  1CZP A;  1I35 A;  1YQ4 B;  1SE2 A;  4KGT A;  1CMX B;  4LK0 M;  3DQV A;  5KHO A;  4EZL A;  1T5X D;  2BYT A;  4XE0 A;  4ANV A;  4C7Y A;  2L83 A;  1QOB A;  3AE2 B;  2KJ6 A;  2D07 B;  1P1A A;  1PGA A;  2UWQ A;  3BY4 B;  2KC1 A;  3TUO A;  1SE4 A;  3DBH B;  3IT4 B;  2KWV B;  4BKS A;  4XYC A;  3GE8 C;  4E71 A;  4L1B A;  3MC8 A;  2IBI B;  2LVP A;  2W82 A;  2XK5 B;  4O1N A;  5G5G A;  2PIA A;  2DZI A;  2JYT A;  4XGA B;  2KC2 A;  1E8Z A;  2N9L A;  1Y56 A;  5HFY A;  4CHK A;  2HD5 B;  2L7R A;  4MH0 E;  3GB1 A;  4KIK A;  3H7P B;  4KX6 B;  2C60 A;  4NQK E;  3AEC B;  4KIK B;  1Q0W B;  1F77 A;  2ZW1 A;  1P7F A;  5G55 A;  3KUD B;  3NRZ A;  3BK2 A;  5JHA A;  4OVZ A;  2L1A A;  5EDS A;  3ML9 A;  4A20 A;  4GB9 A;  1GPX A;  5C2T B;  1UBQ A;  2ZZP B;  4P16 A;  5C23 A;  3BYY B;  3GS2 A;  2CS4 A;  5IOI A;  3VRB B;  2RDB C;  4C4V B;  3ZTC A;  3BK1 A;  4DWF A;  3P4Q B;  3P2B A;  3PRZ A;  3P4S B;  1SIJ A;  3NJT A;  2N1W A;  3LB8 C;  2N9P C;  4HXD A;  1F9J A;  3ZLZ A;  3DVG X;  3GE3 C;  2K5P A;  3QC8 B;  4C80 A;  4FBJ B;  2KTR A;  1V1P A;  3AED B;  4UDU C;  2KDF B;  3AH7 A;  4J3O D;  1GC7 A;  3B2F A;  2FIF A;  4XWT A;  1YJI A;  2PJH A;  1EM7 A;  1E5W A;  2J7Q B;  4FJZ A;  3MFG A;  4NQL B;  4W9I A;  2FBW B;  2M17 A;  3VAW A;  2WXP A;  2XN9 C;  3PLU A;  4B95 A;  2KTF A;  1KRH A;  4K7S A;  4II2 B;  3RNE C;  4TV3 A;  3QX1 A;  2WDQ B;  4BFR A;  2NTS A;  2GLS A;  3IBE A;  2I1J A;  2ZEQ A;  4WJP A;  3DWG C;  3A9K A;  3CSF A;  1JWA D;  4MT5 A;  2KTR B;  5MPO A;  2DBY A;  3JVZ X;  2FCM A;  1XEE A;  1WX9 A;  4TUU A;  1KFY B;  1IBX A;  4HJK A;  1GC6 A;  2K8B A;  2JZ3 B;  3B0A A;  3I9V 1;  1KH0 A;  4XWW A;  1V5T A;  4TKN A;  1GB4 A;  2QEJ C;  2RPQ A;  4K3B A;  3DBH I;  2NBW B;  4IG7 B;  3DHG C;  3ZJV A;  3TEY A;  4DXF A;  3R7R A;  1J19 A;  1OGW A;  2KYW A;  2XBB C;  2M56 B;  1ET9 A;  3AEB B;  2K1F A;  2WDR B;  1WE7 A;  2L32 A;  1M4V A;  2V3P A;  3QA8 A;  2SEB D;  1SBB B;  3EEC A;  1VJK A;  5EE3 A;  2KVZ A;  1UH6 A;  5HKH A;  1HTQ A;  1EWY C;  4X57 B;  2LJ5 A;  4M02 A;  2JRH A;  4P7I A;  4M00 A;  3QWZ B;  4A55 A;  2UYZ B;  3TMP B;  4NY0 A;  4K1R B;  1MHX A;  2N0S B;  2K22 A;  3AE4 B;  3N9Y C;  4MJS A;  5G5H A;  1J7B A;  3ZQ4 A;  2HDE A;  1UZX B;  3S2A A;  1D5M C;  2RPV A;  3WAN A;  4N9F 4;  3JYU A;  2FID A;  4RH6 A;  2WX0 A;  2O6V B;  4RGM A;  1XF5 L;  3APD A;  2NBV B;  2LGS A;  4ICU A;  1YN5 A;  1L6V A;  3P4R B;  1E8X A;  2NVU I;  1UD7 A;  3WA0 A;  2NR2 A;  1XLQ A;  2WYQ A;  2ZCC A;  1SE3 A;  1XD3 B;  1D5Z C;  4K3C A;  1F1H A;  1C78 A;  1V97 A;  2CHX A;  3MHS D;  1TKY A;  2KQS A;  4US9 A;  2PW9 A;  1YQB A;  1TS2 A;  1SF0 A;  5BO4 B;  1UUP A;  4LTU A;  4JWU C;  2YLM A;  1R4N I;  1AYF A;  2LJI A;  1L5P A;  2LGX A;  2LVQ A;  3RI7 C;  4AWJ A;  4KDL B;  5D3D A;  4RMA A;  4GU2 A;  4KGS A;  3U7D A;  3UIP B;  2D3B A;  3RNB C;  2G4S A;  3Q3O C;  4N6E B;  1XT9 B;  4FXC A;  2YEP B;  2RDG A;  1UWM A;  3NUH B;  1IGD A;  3IFW B;  5AUK A;  4GMV A;  1WMH A;  1P0R A;  3HRD D;  2WNM A;  3M3J A;  1L2N A;  3H6N A;  1SEB D;  1ZW7 A;  2WXI A;  2C7H A;  4WWO A;  2GI9 A;  1GOZ A;  4XC2 A;  2KJH B;  3VVW B;  5LXH A;  1FRR A;  2CHZ A;  2LEK A;  3TEZ A;  2V0G A;  2BS3 B;  2M19 A;  2LWP A;  3SDL C;  2K6Q A;  1ET6 A;  1UF0 A;  2BF8 B;  2LHE A;  1C9F A;  2KN4 A;  4WJN A;  4ZHP A;  3W1S A;  3DHH C;  1S3S G;  3Q8E A;  1ZP0 B;  1MG8 A;  2O6V D;  2JT4 B;  2IO0 B;  2JRI B;  4DHZ E;  3L10 B;  4LDT B;  4HCP B;  2WU5 B;  4KZC A;  1MFW A;  1WIA A;  3WCQ A;  2WXJ A;  1VLB A;  3AM9 A;  4B6W A;  2AQ3 B;  4WAA A;  2J52 A;  2KLC A;  2A4Z A;  3R2I A;  2DAJ A;  1WFY A;  3H7S A;  1DOX A;  1E8Y A;  1XCT L;  4ZRQ A;  4KKI A;  4NPN A;  2GBJ A;  1FEH A;  5E6J A;  2AWT A;  4GXB A;  3WAO A;  2NBU A;  4XX5 A;  4P1B C;  2J4X A;  1TJE A;  1Z2M A;  5AZH A;  1UGM A;  5IN7 A;  1WF9 A;  1LFD A;  1WGG A;  3U4E G;  1CK1 A;  1VZ7 A;  4NNJ B;  3N1X C;  3L0W B;  2R61 A;  2LUM A;  4ZRP A;  1EF5 A;  1N63 A;  5I4D A;  2L05 A;  2H88 B;  1JML A;  1D3Z A;  2QDF A;  5D3I B;  2C7M B;  3MC9 A;  4M0W B;  3AU5 A;  3ECI A;  3PZD A;  2L8J A;  2KNB A;  2CJO A;  4LNI A;  3BVZ A;  3L13 A;  1R4M B;  1QOA A;  3QAQ A;  1J7A A;  3A33 B;  4IC7 B;  1LO5 D;  3DVN U;  4IUM B;  1YX6 B;  2L76 A;  2KDB A;  3GOE A;  3NVW A;  2WXG A;  3AE5 B;  1KLV A;  3UIO B;  2V9H A;  4JE3 B;  1OQY A;  5H92 C;  2OED A;  3RYT A;  1WXQ A;  2K6D B;  1L0Y B;  3ZW3 A;  2L52 A;  5C3J B;  1V5O A;  4WIP A;  3R66 C;  5H8Y E;  2DEN B;  3HHM A;  5DPT A;  3DPD A;  3GZN I;  4NZL B;  2Z0D B;  4FJY A;  3TEX A;  3ZO5 B;  1ZOY B;  3A1Q A;  2PVG C;  3RT3 B;  3N30 A;  3ABV B;  3T3N A;  1JRP A;  3BWU D;  1WX7 A;  1MG4 A;  3H9D A;  2LMC A;  3BVM A;  5DPS A;  2BTE A;  2GBR A;  2PMV A;  3QAR A;  3VUW A;  4LNF A;  2INC C;  3ZIM A;  3PT2 B;  1FO4 A;  4WWP A;  3DDC B;  1KM7 A;  4RM8 A;  2WP9 B;  5HHD G;  1N5X A;  1TKE A;  2IO2 B;  2KHW B;  3QJZ A;  4WJO A;  2BPS A;  4WAF A;  3U30 A;  2MLB A;  3IAS 1;  4C00 A;  3ZNI D;  3N1Y C;  2V4L A;  1GAQ B;  2W3R A;  3SFE B;  2ASQ A;  4MGK E;  1KLG D;  1ZXI A;  2JXX A;  2BKF A;  2UU7 A;  3K9P B;  4ARC A;  2N4F A;  3RZF A;  3KWV A;  3BII D;  2GB1 A;  1GG3 A;  4WWM A;  3AEA B;  1N60 A;  2FCS A;  3KWL A;  1GUA B;  2W54 A;  2JU6 X;  4PS3 A;  1I4H A;  3URY A;  3AE9 B;  4HVB A;  4WH4 A;  2BS4 B;  3NY5 A;  3TSS A;  3V3X A;  4F8C B;  3PZ8 A;  1NEN B;  1WJ6 A;  4LJP B;  3RNC C;  1WWT A;  2CJN A;  3NVV A;  1PGX A;  2WXO A;  1HQR D;  1JW9 D;  2WXN A;  2PPH A;  3V6C B;  3L54 A;  3AEE B;  3A1Q B;  4B0M A;  2NS5 A;  3H7P A;  2N9E B;  4A6Q A;  3B08 A;  5CTR C;  3VQI A;  2KAC A;  2KK8 A;  3VXW A;  4IWO A;  2GMI C;  4S0R A;  4AS1 A;  1XLP A;  1SJE D;  1ZDV A;  4XZ4 A;  3IG3 A;  2LXC A;  2JWU A;  3CWI A;  2KFJ A;  1I42 A;  2MBO A;  2XEW A;  3O13 A;  2VH2 A;  1WGY A;  4EUT A;  3N1Z C;  2VRR B;  4MGZ E;  1F0Z A;  4HRS A;  3AE7 B;  2B76 B;  3ONS A;  1B9R A;  5HI1 A;  1P7E A;  2MRP A;  4GDK A;  4PK1 A;  1C76 A;  4L23 A;  1FFU A;  2D5G A;  1K51 A;  2N1V A;  3FC4 A;  1ISN A;  1Q5W B;  2PE6 B;  4GLS C;  2L0F A;  1T3Q A;  3ZRC A;  1EWC A;  1FD6 A;  2KKC A;  2D2Q A;  2N7J A;  3Q8B A;  1WH3 A;  1WXS A;  4LNN A;  2LGI A;  4DHJ D;  1HA5 A;  3WAL A;  2C5L C;  3LJ3 A;  1K50 A;  2PEA A;  2BBC A;  3LXF A;  1OQR A;  2FUG 1;  1WGD A;  2IY1 B;  3KLS X;  5LXI B;  2IGH A;  1QZE A;  2G9H D;  2MJE A;  1WJU A;  3IHP C;  4IWP A;  1I7H A;  1ZKH A;  4YSX B;  4BKG A;  1J0G A;  3H1U A;  4DDI D;  2KXJ A;  2WXK A;  4GDK B;  4RF0 A;  5BMI A;  1WM2 A;  1TS3 A;  3EA6 A;  4LLG M;  2OJR A;  3TJP A;  3W1Y A;  4DHZ B;  4EEW A;  3V05 A;  2YVC A;  5AUI A;  4YTN B;  2JUO A;  4KGR A;  1MPE A;  5E6N A;  1V1P B;  2KWU B;  4KKJ A;  3SD5 A;  3DBR B;  3NG0 A;  1A5R A;  2MJ3 A;  1WXA A;  3ZXR A;  4JGH B;  3BZD B;  3AEF B;  1M94 A;  5IKC M;  4H2A A;  4C4V A;  1FNW A;  4ITK A;  1SXT A;  2Z0E B;  4RM9 A;  3T8M A;  1E7P B;  2MBB B;  1JQ4 A;  2FNJ B;  2M0A A;  1E9M A;  3ZVV A;  1WYW B;  1KLU D;  3L16 A;  1L7Y A;  4HDQ A;  3R2T A;  5BYQ A;  1XXG A;  3QCA A;  2ZNV C;  4PYU A;  4P6V F;  4OHJ A;  2LFI A;  2BT6 A;  3NVY A;  4REZ A;  2ZVO A;  2Z59 B;  1FIQ A;  1P98 A;  3AXC A;  1NEK B;  4AUQ C;  2VZK B;  1WMH B;  4YWG G;  1WJN A;  3AE3 B;  1XCQ L;  3ZNZ B;  3OJ3 A;  2EMS A;  1IPG A;  3DBS A;  1UWX A;  1G6J A;  1K53 A;  2HTM E;  2M4N A;  3T9L A;  3TBL D;  2LGY A;  4II3 B;  1K52 A;  1Y8R C;  3ZGZ A;  5IO9 A;  4YL8 A;  1WYG A;  3M95 A;  3RFZ B;  5CHV C;  1FCL A;  3PPA A;  4BAX A;  4ASW C;  4KV2 A;  4FA6 A;  1EF1 A;  2ZCB A;  4FN2 A;  1DGJ A;  4MGI E;  1C4A A;  1MVK A;  3QIJ A;  2HE7 A;  3NS8 A;  3IVF A;  3CST A;  2KWC A;  4A8X C;  2QMT A;  3WAM A;  3VRA B;  1VZ8 A;  2WS3 B;  2GBM A;  2WXR A;  4OZB A;  3C8Y A;  3AN1 A;  3I63 C;  4FHJ A;  2M0X A;  1HTO A;  2WXF A;  4TMA B;  2N9X A;  3VTU A;  4HJG E;  1S1Q B;  5IA7 A;  3APC A;  3N32 A;  1NBF C;  3PO0 A;  3BIN A;  1JWS D;  1SB3 C;  2KOX A;  2K0P A;  2KX0 A;  5JHB A;  3RNF C;  3Q3J A;  3MJ5 A;  2JXT A;  3U52 E;  3A4S C;  1IGC A;  1TTN A;  1CQV A;  2MSE D;  3ALB A;  2MQJ A;  1WR1 A;  1OFF A;  3DVN V;  3W5U B;  1OQQ A;  1K8R B;  3VH4 B;  1FNV A;  2IPK D;  3Q8F A;  4LNK A;  2KO3 A;  1V86 A;  1ZXH A;  1VDV A;  3KYC D;  3DOW A;  2MEK A;  5BMG A;  1UBI A;  2V3S A;  1RWS A;  5BYR A;  2ZPN A;  3P42 A;  3EGR A;  1TKG A;  3PRM B;  4F1S A;  4C7Z A;  3L4P A;  3VR8 B;  1D6E C;  2WXM A;  1Q10 A;  4G0N B;  5IAA C;  2X38 A;  3ZYY X;  4LCD E;  1J8C A;  1ZE3 D;  4DXG A;  2I1K A;  2BWF A;  3NVZ A;  2FCN A;  2C9W B;  2ZNV B;  3VHT C;  4YSY B;  4NAW A;  5D7G A;  2K8H A;  5GXG B;  3R8B A;  3Q8A A;  2FE8 A;  2SAK A;  3WAP A;  2X8X X;  1LXD A;  4ZRI A;  2KX3 A;  2M8S A;  2AX5 A;  4XDD A;  1AWD A;  1JWB D;  2TSS A;  2LXA A;  2MBQ A;  4XDC A;  4WQO B;  1WSP A;  1IBX B;  3D32 A;  2W9N A;  3T3O A;  1MHH E;  2J0M A;  2O2V A;  2NPT A;  4AQ7 A;  2WHI A;  4L2Y A;  1OEY J;  3UQA A;  2NMQ A;  3W1S C;  4FHK A;  4OZC A;  5JXV A;  4BZA A;  2LD9 A;  1VRA B;  2CU3 A;  2RDH A;  4RGN A;  5JZE B;  1EU3 A;  3Q6B A;  1DYQ A;  1F2R I;  3MHZ A;  3QK0 A;  2IYD B;  1WZ0 A;  2ON8 A;  4K7W A;  4RCO A;  2DWQ A;  1EO6 A;  5L95 C;  2WXQ A;  1PUT A;  5EE9 A;  1A70 A;  1JRO A;  3W9C B;  4OZA A;  1YMH E;  1PYW D;  4HPM B;  5J17 A;  2LAS A;  3NZ3 A;  1DOY A;  3RUL A;  3FAH A;  1FXT B;  1C4P A;  4M8M A;  3TL5 A;  3OLM D;  4BOZ B;  2CKH B;  2JPH A;  1XLN A;  1YN3 A;  4I6L B;  5GMV A;  1YJJ A;  3Q8C A;  4IWQ A;  2NCN A;  4GDL B;  2JX5 A;  2ZVN A;  2GOW A;  3DBL B;  4MH8 A;  4HK2 A;  2CR5 A;  4MM3 A;  4WWN A;  4PS7 A;  1QQR A;  1YNT E;  1AN8 A;  4HRO A;  4B0E A;  2KT7 A;  1KOT A;  2WXH A;  4LJO B;  1L4Z B;  2AQ1 B;  4RNA A;  4W9E A;  1WI0 A;  4MDK E;  2ZPY A;  2OJW A;  2Z8L A;  4TQ0 A;  4ARI A;  2MX2 A;  2WGS A;  4IM0 A;  4Q2J A;  2BB6 A;  4F7Z A;  3B1L X;  4TQ1 A;  3SU8 X;  4HCN B;  4AJW A;  2EMT A;  1PDX A;  1WJ4 A;  5JH5 C;  1GNU A;  3SEB A;  1FMA D;  5DPW A;  2IND C;  4GDL A;  1ZUD 2;  4C56 C;  2FUH B;  3PRE A;  2AL3 A;  4EFO A;  1V49 A;  3I5J C;  1LGR A;  2K3U A;  2O6V A;  5AZF A;  2HJ8 A;  5T8I A;  3ZKJ C;  4FLH A;  3VH3 B;  2KD0 A;  2QIL A;  4KZ0 A;  1YQ3 B;  1V8C A;  2JYE A;  3SFD B;  3AE1 B;  1JAL A;  3EHV A;  4N59 A;  4DHJ B;  4WQM A;  3Q3M C;  3ENE A;  1ESF A;  2KFK A;  3ZXV A;  1C77 A;  2DHZ A;  4A3P A;  3V6E B;  4BKT A;  3PV1 A;  3AI5 A;  2PKO A;  1C3T A;  1D4B A;  3EUB 2;  1QIL A;  1NI3 A;  3ZJT A;  3MTN B;  3JSV A;  4M8N A;  3W5V B;  2BYF A;  4W9K A;  1X1M A;  3CMM B;  2O2V B;  3FKY A;  4RF1 A;  1DOI A;  4HPL B;  2RR9 A;  2D10 A;  3MC0 B;  2K9X A;  4GSW A;  2INN E;  2KDE B;  1PQS A;  4US8 A;  2N9K A;  4CO7 A;  4ANX A;  1RM6 C;  4S17 A;  2MWS B;  3U8Z A;  3PLV A;  3DBR I;  4ZRJ A;  5D94 A;  1WY8 A;  1WGH A;  3KQ4 A;  3AE8 B;  4ZOH C;  3NZS A;  5HG2 A;  1C4C A;  2WXL A;  3R3M A;  1V2Y A;  4M0W A;  2KVR A;  4IM2 A;  4AOF A;  1TS5 A;  4NJ7 A;  1D5X C;  4HDO A;  2KN5 A;  2Y3A A;  2QHO A;  1NI2 A;  2LHD A;  5FK9 C;  2DZJ A;  4IDI A;  2JZP A;  1NYR A;  5D6J B;  2JY6 A;  2MJD A;  4NJ6 A;  1ENF A;  2IZV B;  4D2K A;  1SE9 A;  4DXA B;  1T6B X;  2RGF A;  1T0R C;  3A9J A;  1RLF A;  2N7E A;  4ZYS A;  3PZ7 A;  3A9J B;  1V81 A;  3VTW A;  2L00 B;  4ZDV A;  1FRD A;  3PHX B;  3HIZ A;  1V80 A;  2K39 A;  1TZ1 A;  2KQ4 X;  2QJL A;  2I2Y A;  2QC8 A;  1N5W A;  2E6X A;  1IP9 A;  1GB1 A;  3PS6 A;  3ML8 A;  3AE6 B;  1AW7 A;  2LRW A;  3HVD A;  3U7Z A;  2XK5 A;  2BGF A;  1E6E B;  2WDV B;  3EFU A;  4I6N B;  2G3Q B;  3HK0 A;  2MHJ A;  2K8C A;  2KDM A;  1Q1O A;  1N6Z A;  2QCZ A;  2KMA A;  1E7U A;  4W9C A;  2WDT B;  3OJ4 B;  3GZN B;  4EKU A;  1QOF A;  4LNO A;  5CHF A;  2JWZ A;  4W9J A;  3VTV A;  3Q2A C;  3K9O B;  2KLG A;  2K25 A;  4IOI E;  2J53 A;  4ICV A;  1T0Q C;  2EEL A;  5J18 A;  2JZZ A;  3PHW B;  1P3Q U;  3ZNG C;  4AP4 C;  2LI5 A;  4GOC A;  4JIO U;  3V60 A;  2MW5 A;  1WGK A;  5EE1 A;  4DK5 A;  4KSK C;  3B2G A;  4P1C C;  3IAM 1;  4QAY A;  1B1Z A;  1HE8 A;  4MEL A;  3KYD D;  3FIL B;  4PS8 A;  5LNK 1;  3RPF C;  3OWE B;  3UI3 A;  2MCN B;  4WUR A;  1JWM D;  1WX8 A;  1ACC A;  3HVZ A;  3RUI B;  1FCC C;  5KHQ A;  3BYT B;  2WWZ A;  2MBE A;  4FUL A;  3JSV B;  3PSE B;  3X23 A;  2LGD A;  5AZG A;  2GRI A;  2MBH A;  2V1Y A;  3CIR B;  3E9S A;  3R7Q A;  3X0W A;  4CQN A;  4YT0 B;  4EOY A;  4JL9 A;  2KJR A;  1WR6 E;  1FNU A;  2IO1 B;  5TSS A;  1RYJ A;  1E7V A;  2DAF A;  3BVG A;  1CJE A;  1E8W A;  1V1O A;  2KMM A;  4MGY E;  5CHW A;  2WLB A;  5DPR A;  1HEZ E;  1WRI A;  4YTM B;  1E10 A;  3AEG B;  1QKZ A;  1ZDX A;  2MH7 A;  4OVU A;  4JQW C;  4GN1 A;  2LUE A;  3MP9 A;  2GBN A;  3Q14 C;  2WU2 B;  3NS1 A;  4K81 A;  2CHW A;  2RD0 A;  3C19 A;  2OHF A;  3I57 A;  1EUV B;  3TCA A;  2J0K A;  1QLB B;  1BT0 A;  3PRP B;  3P4P B;  4BBN C;  4EZJ A;  2BKR B;  1YN4 A;  2AQ2 B;  4E74 A;  1FPY A;  3RNA C;  1KTK A;  2BYV E;  1HZ5 A;  2Y5B B;  1HXY D;  1WRD B;  3A4R A;  4G11 A;  1J7C A;  2J0J A;  2Y5P A;  4ANU A;  2ZJD A;  1GJZ A;  4A9A A;  1JRU A;  2W3S A;  1TS4 A;  2XNA C;  3H8H A;  3L08 A;  2Q5W D;  3DWM A;  3PVL A;  1L6U A;  4OW0 A;  2LVO A;  4HPP A;  3SR6 A;  4KSL C;  1JWU D;  2Y5C A;  2FCQ A;  3MJW A;  2DNF A;  2V3N A;  1KJT A;  2BQQ A;  1I4R A;  1L0V B;  4MSQ B;  4NJC A;  3P1M A;  1IUE A;  3ZNH B;  3V61 A;  4MSM B;  3QHT A;  3M63 B;  2NPT B; 
#chains in the Genus database with same CATH homology
 1UBQ A;  2ZZP B;  3DDC B;  4PYZ A;  4WWP A;  4W9G A;  5C23 A;  4JLC A;  2REX A;  1OEY A;  1KM7 A;  4I6P A;  2CS4 A;  1LQB A;  4RM8 A;  1WGR A;  4HPM B;  5J17 A;  3RD2 A;  2N7D A;  2LAS A;  3ZTC A;  4DWF A;  2IO2 B;  3P2B A;  2KHW B;  3PRZ A;  3QJZ A;  3RUL A;  2N1W A;  3RCZ A;  2N9P C;  4WJO A;  2BPS A;  4HXD A;  5D2M B;  1FXT B;  1R4M I;  3U30 A;  2MLB A;  3LDZ E;  4M8M A;  1F9J A;  3ZLZ A;  3TL5 A;  5DCN A;  3OLM D;  4J6I A;  3ZNI D;  4BOZ B;  2V4L A;  2B3A A;  2CKH B;  2JPH A;  3CF6 E;  5GMV A;  3DVG X;  4I6L B;  3O65 B;  3QC8 B;  4IWQ A;  2ASQ A;  2NCN A;  4MGK E;  4FBJ B;  2JXX A;  2KTR A;  1XQQ A;  4GDL B;  2KDF B;  2ZVN A;  2GOW A;  2BKF A;  4HK2 A;  2CR5 A;  1GC7 A;  4MM3 A;  3K9P B;  4WWN A;  2N4F A;  4PS7 A;  3RZF A;  2L3Z A;  2FIF A;  2PJH A;  1GG3 A;  1H4R A;  2R2Q A;  1E5W A;  2J7Q B;  1KOT A;  4LJO B;  2FCS A;  1GUA B;  4FJZ A;  3JW0 X;  1VD2 A;  4NQL B;  3HM3 A;  4PS3 A;  4W9I A;  3KH0 A;  4W9E A;  3VFK A;  4HVB A;  1WI0 A;  3NY5 A;  2DYO A;  3VUY A;  2M17 A;  4MDK E;  4F8C B;  1WE6 A;  2ZPY A;  3VAW A;  1WJ6 A;  4LJP B;  4TQ0 A;  3PLU A;  4B95 A;  2MX2 A;  2KTF A;  4IM0 A;  2IO3 B;  4GGQ A;  4K7S A;  4II2 B;  4F7Z A;  3B1L X;  4TV3 A;  4TQ1 A;  1TGZ B;  3SU8 X;  3V6C B;  2PPH A;  3Q3F A;  3QX1 A;  4HCN B;  4AJW A;  3L54 A;  4BFR A;  2DX5 B;  3A1Q B;  3IBE A;  2EMT A;  2I1J A;  3NOB A;  2NS5 A;  2ZEQ A;  3H7P A;  4WJP A;  2N9E B;  3WIM A;  3B08 A;  5CTR C;  3A9K A;  3VQI A;  3CSF A;  1WJ4 A;  5JH5 C;  1GNU A;  4MJS B;  2KK8 A;  3VXW A;  1VCB A;  4IWO A;  2GMI C;  5DPW A;  2KTR B;  4GDL A;  2FUH B;  3KVF B;  4XZ4 A;  3APF A;  2LXC A;  3IG3 A;  2LRU A;  2FCM A;  2KFJ A;  3JVZ X;  2AL3 A;  1WX9 A;  3PRE A;  4W9H A;  4BOS C;  4EFO A;  1I42 A;  2MBO A;  1NDD A;  2XEW A;  2BYE A;  2DZM A;  4TUU A;  4HJK A;  1V49 A;  1WGY A;  3UIN B;  4EUT A;  2O6V A;  1GC6 A;  2VRR B;  5AZF A;  2HJ8 A;  4MGZ E;  2K8B A;  3ZKJ C;  4FLH A;  2JZ3 B;  3VH3 B;  2KD0 A;  1LM8 B;  1T0Y A;  3ONS A;  1V6E A;  3B0A A;  4KZ0 A;  2KDI A;  4KVG B;  3ZRF A;  5J2R A;  2MRP A;  4GDK A;  3UGB B;  3NHE B;  1ZGU B;  3ZUN A;  3EHV A;  1V5T A;  4TKN A;  3ZDM C;  5LLI A;  2RPQ A;  4DHJ B;  3DBH I;  2NBW B;  2N1V A;  4IG7 B;  3ENE A;  2JVC A;  1ISN A;  3UQB A;  1Q5W B;  2KFK A;  2PE6 B;  3R7R A;  3M62 B;  1J19 A;  1OGW A;  2DHZ A;  3DVG Y;  4A3P A;  2L0F A;  3V6E B;  3ZRC A;  4BKT A;  3PV1 A;  2XBB C;  2KKC A;  2D2Q A;  3AI5 A;  2K1F A;  1C3T A;  2AEH A;  1H8C A;  1WH3 A;  1WXS A;  1WE7 A;  4B9K A;  1YIW A;  1U4A A;  4URK A;  3QA8 A;  4DHJ D;  3MTN B;  5E6P A;  3EEC A;  2C5L C;  3JSV A;  3LJ3 A;  2PEA A;  4M8N A;  3WAL A;  2BYF A;  4W9K A;  1C1Y B;  1X1M A;  2O2V B;  3CMM B;  1WXM A;  3HM6 X;  3SHQ A;  4FJV B;  2D11 A;  2MP2 A;  1WGD A;  4HPL B;  1UH6 A;  2JF5 A;  2RR9 A;  5HKH A;  4X57 B;  2D10 A;  2IY0 B;  2IY1 B;  2LJ5 A;  5LXI B;  4GSW A;  1QZE A;  2JRH A;  1WJU A;  2KDE B;  4P7I A;  1PQS A;  3QWZ B;  4IW0 A;  2UYZ B;  3IHP C;  4IWP A;  3TMP B;  3KW5 B;  4NY0 A;  4ANW A;  4ANX A;  1ZKH A;  4K1R B;  2M1M A;  4CO7 A;  4BKG A;  2MWS B;  1J0G A;  3H1U A;  3U8Z A;  2WX1 A;  3PLV A;  3DBR I;  4ZRJ A;  4DDI D;  1RAX A;  5D94 A;  1WY8 A;  2KXJ A;  4MJS A;  1WGH A;  4DDG D;  4BVU C;  4GDK B;  1UZX B;  3NZS A;  3S2A A;  3WAN A;  4N9F 4;  3L17 A;  1WM2 A;  4WJQ A;  3JYU A;  3R3M A;  1V2Y A;  2AL6 A;  2FAZ A;  2OJR A;  2FID A;  1IYF A;  3TJP A;  1P9D U;  2KVR A;  2WX0 A;  3W1Y A;  4IM2 A;  4AOF A;  4DHZ B;  4EEW A;  2YVC A;  2O6V B;  4NJ7 A;  4HDO A;  2KN5 A;  3APD A;  2NBV B;  2R2O A;  1SGH A;  2JUO A;  4ICU A;  5E6N A;  2MA9 B;  2KWU B;  2QHO A;  1NI2 A;  4HWI B;  1E8X A;  3SD5 A;  2NVU I;  3OAW A;  1UD7 A;  1SIF A;  2DZJ A;  3WA0 A;  2NR2 A;  3A9K B;  4OVV A;  1A5R A;  1WXA A;  2WYQ A;  4GIV A;  2ZCC A;  4JGH B;  5D6J B;  1XD3 B;  1WXV A;  2JY6 A;  2MP2 B;  1M94 A;  2PE9 A;  4NJ6 A;  2KZR A;  2IZV B;  2DYM A;  1SE9 A;  2KFK B;  4DXA B;  2CHX A;  3MHS D;  2RGF A;  2KQS A;  3A9J A;  1RLF A;  4BBN F;  2N7E A;  1YQB A;  5BO4 B;  2Z0E B;  4RM9 A;  3NZU A;  3T8M A;  2MBB B;  2CU1 A;  1V81 A;  3A9J B;  2YLM A;  3VTW A;  2FNJ B;  1R4N I;  2L00 B;  3ZVV A;  4ZDV A;  2KMC A;  3PHX B;  1WYW B;  3HIZ A;  2LGX A;  2LVQ A;  4LDT D;  3L16 A;  1V80 A;  2K39 A;  1TZ1 A;  4AWJ A;  2EKE C;  1E90 A;  1L7Y A;  2HTH A;  4KDL B;  4HDQ A;  4K7U A;  4RMA A;  4GU2 A;  3QCA A;  3U7D A;  4IM3 A;  2ZNV C;  3UIP B;  4DBG A;  3KUC B;  1IP9 A;  1YX5 B;  2G4S A;  3PTF C;  4PYU A;  3PS6 A;  1XT9 B;  3ML8 A;  4FAD A;  4E3C A;  1RFA A;  1RRB A;  3IFW B;  4MEM A;  2LRW A;  2C7N B;  2DYB A;  4GMV A;  1OTR B;  1Z5S B;  1WMH A;  1P0R A;  2XK5 A;  5CX3 A;  2L0T A;  2G4D B;  2ZVO A;  2Z59 B;  3M3J A;  3VDZ A;  1P98 A;  3AXC A;  2BGF A;  2KAN A;  4AJY B;  1L2N A;  3EC8 A;  4AUQ C;  3H6N A;  4NAW B;  1WMH B;  3PGE A;  1ZW7 A;  3EFU A;  3N3K B;  1WJN A;  4I6N B;  2G3Q B;  2C7H A;  3HK0 A;  4WWO A;  4XC2 A;  2KJH B;  3VVW B;  5LXH A;  2K8C A;  3ZNZ B;  3OJ3 A;  2CHZ A;  4W9F A;  2EMS A;  1Q1O A;  1IPG A;  4EZK A;  3DBS A;  2KMA A;  1E7U A;  1WZ3 A;  2AYO B;  4W9C A;  1G6J A;  2M4N A;  2LWP A;  2WDT B;  3SDL C;  3VUX A;  3T9L A;  3TBL D;  2K6Q A;  2LGY A;  3OJ4 B;  4II3 B;  3UF8 A;  4EKU A;  5G2N A;  2BF8 B;  1Y8R C;  5CHF A;  3ZTD A;  2JWZ A;  4W9J A;  3VTV A;  3K9O B;  4YL8 A;  2KLG A;  2K25 A;  3M95 A;  1AAR A;  4WJN A;  1V9J A;  3W1S A;  4BKS D;  5CHV C;  1YJ1 A;  1S3S G;  4ICV A;  2GBK A;  3PPA A;  5J18 A;  2JZZ A;  2A5U A;  1MG8 A;  4ASW C;  4KV2 A;  4FA6 A;  3PHW B;  1WM3 A;  2O6V D;  1EF1 A;  1P3Q U;  2JT4 B;  2ZCB A;  2LI5 A;  4FN2 A;  2LZ6 A;  4W9L A;  3ZNG C;  4AP4 C;  4GOC A;  2IO0 B;  4JIO U;  4MGI E;  3V60 A;  2JRI B;  2MW5 A;  5L83 A;  4DK5 A;  3QIJ A;  4DHZ E;  4KSK C;  3ZDT A;  3L10 B;  2HE7 A;  3NS8 A;  4LDT B;  4HCP B;  4KDI C;  3IVF A;  3CST A;  2KWC A;  2G45 B;  4ZYN A;  2D3G A;  3DCG A;  4HLE A;  3WAM A;  4W9D A;  4KZC A;  3AU4 A;  1WIA A;  2BWE S;  1HE8 A;  5AEK B;  4MEL A;  3KYD D;  4G3X B;  4PS8 A;  4B6W A;  2GBM A;  2MCN B;  1TBE A;  4WAA A;  2KLC A;  1WX8 A;  2A4Z A;  2DAJ A;  3KUZ A;  1WFY A;  2M0X A;  3H7S A;  4FHJ A;  3RUI B;  2DZK A;  1E8Y A;  5C1Z A;  5KHQ A;  4A3O A;  4NPN A;  2WWZ A;  2GBJ A;  2MBE A;  2N9X A;  3I3T B;  3VTU A;  4FUL A;  3JSV B;  4CYE A;  2AWT A;  4GXB A;  3RZW C;  2NBU A;  3WAO A;  3PSE B;  3X23 A;  1S1Q B;  2LGD A;  5AZG A;  4XX5 A;  5IA7 A;  3APC A;  3N32 A;  1NBF C;  3DBL I;  5E6O A;  2MBH A;  2V1Y A;  3R7Q A;  3X0W A;  3AUL A;  3BIN A;  2KOX A;  5FR6 A;  1Z2M A;  5AZH A;  4EOY A;  1UGM A;  2KX0 A;  4JL9 A;  1WF9 A;  1LFD A;  5JHB A;  2KJR A;  1WGG A;  1WR6 E;  4NNJ B;  2RSU A;  4ZRK A;  1UEL A;  3Q3J A;  2IO1 B;  2OOB B;  3L0W B;  1E7V A;  2DAF A;  3C0R B;  3QQ8 B;  1EF5 A;  1E8W A;  1YD8 U;  3A4S C;  4MGY E;  1TTN A;  5CHW A;  3TIX A;  5DPR A;  2L05 A;  2MSE D;  3ALB A;  2MQJ A;  1WR1 A;  5TR5 A;  3DVN V;  1K8R B;  3V62 A;  1D3Z A;  4OVU A;  3VH4 B;  4JQW C;  2KQ7 A;  4GN1 A;  2LUE A;  4G50 A;  2C7M B;  2KO3 A;  1V86 A;  2GBN A;  1I35 A;  4M0W B;  3AU5 A;  3ECI A;  3KYC D;  1CMX B;  3DOW A;  3PZD A;  1UBI A;  2CHW A;  2V3S A;  4K81 A;  2L8J A;  2ZPN A;  2KNB A;  3DQV A;  5KHO A;  4EZL A;  2RD0 A;  3PRM B;  4F1S A;  3L13 A;  1EUV B;  3TCA A;  4ANV A;  2J0K A;  1BT0 A;  3PRP B;  2KJ6 A;  2D07 B;  3QAQ A;  4BBN C;  4EZJ A;  1P1A A;  3A33 B;  4IC7 B;  3DVN U;  4G0N B;  2BKR B;  4IUM B;  5IAA C;  1YX6 B;  2UWQ A;  3BY4 B;  2KC1 A;  4LCD E;  1J8C A;  2L76 A;  2KDB A;  3GOE A;  4E74 A;  2I1K A;  2KWV B;  4BKS A;  1KLV A;  3UIO B;  4E71 A;  2BWF A;  2FCN A;  2C9W B;  2BYV E;  2Y5B B;  2ZNV B;  1WRD B;  3A4R A;  2IBI B;  3VHT C;  4G11 A;  2LVP A;  1OQY A;  2J0J A;  2XK5 B;  2ZJD A;  4NAW A;  5D7G A;  2K8H A;  4ANU A;  1GJZ A;  1JRU A;  3RYT A;  2K6D B;  3WAP A;  2DZI A;  3ZW3 A;  1V5O A;  1LXD A;  4ZRI A;  2KC2 A;  2KX3 A;  3R66 C;  2M8S A;  1E8Z A;  2DEN B;  3L08 A;  3HHM A;  5DPT A;  3PVL A;  3DPD A;  2LVO A;  2LXA A;  4CHK A;  2MBQ A;  3GZN I;  4KSL C;  2HD5 B;  2L7R A;  4WQO B;  2Z0D B;  4FJY A;  3D32 A;  2W9N A;  3ZO5 B;  3A1Q A;  2FCQ A;  3MJW A;  4MH0 E;  2J0M A;  4KIK A;  3H7P B;  2O2V A;  2C60 A;  3RT3 B;  4NQK E;  1KJT A;  2NPT A;  3N30 A;  1OEY J;  3UQA A;  4KIK B;  3W1S C;  4FHK A;  1Q0W B;  2LD9 A;  1WX7 A;  5JZE B;  4MSQ B;  5G55 A;  3H9D A;  3KUD B;  3ZNH B;  3V61 A;  3QK0 A;  2IYD B;  4MSM B;  5JHA A;  1WZ0 A;  3QHT A;  4K7W A;  3M63 B;  5DPS A;  2NPT B;  5EDS A;  1EO6 A;  2GBR A;  3ML9 A;  3QAR A;  4A20 A;  4GB9 A;  3VUW A;  5L95 C;  3ZIM A;  3PT2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...