4N9F4

Crystal structure of the vif-cbfbeta-cul5-elob-eloc pentameric complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
95
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFDTFEALCIEPFSSPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cullin-5
publication title Structural basis for hijacking CBF-b and CUL5 E3 ligase complex by HIV-1 Vif
rcsb
source organism Homo sapiens
molecule tags Ligase/viral protein
total genus 18
structure length 95
sequence length 98
chains with identical sequence D, H, J, P, W, X, e, g, m, s, y
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4n9f400
3S2AA 5EDSA 3JW0X 2I1JA 3APFA 5IAAC 3M63B 3HHMA 1R4NI 2V3SA 3N32A 4JGHB 2GBRA 3PRPB 5AZGA 2WX0A 3PHWB 1XQQA 1XD3B 3WIMA 4BVUC 1PQSA 2BGFA 2IO2B 3HIZA 1UBIA 1E7UA 2O2VA 2KTRA 3QARA 4DHJB 2O6VA 3EECA 2KK8A 2PE9A 1WX7A 2K1FA 3CMMB 5E6NA 3C0RB 1A5RA 4LDTD 4OVVA 1WGYA 2MX2A 1XT9B 2LRUA 2GBNA 4HCPB 1V81A 3NZSA 3ECIA 3L54A 1KOTA 1L7YA 3QQ8B 4FJZA 3WANA 4DHZB 3PTFC 4IC7B 1WJUA 2JWZA 5C23A 2ZVOA 1OEYJ 1WE6A 3AI5A 3H1UA 1EF5A 1GNUA 2YVCA 2M8SA 2M17A 2L0FA 3QC8B 4KSKC 2ZZPB 3U8ZA 4EEWA 1TZ1A 3W1SA 4E74A 3ZO5B 4PYUA 1E8WA 4KV2A 2AYOB 1GC7A 3M95A 3B08A 1UH6A 2L05A 3UIPB 3GOEA 4I6NB 3UGBB 1GG3A 1I35A 5E6OA 2LVQA 4IM3A 2WX1A 4MSMB 2K8BA 4EKUA 5JZEB 4I6LB 1WZ0A 4ANVA 5CHWA 3RZWC 5JHBA 4FN2A 2DYMA 3A9JA 2YLMA 4I6PA 3TL5A 2KDFB 2LGXA 3DPDA 1NDDA 3JYUA 3PREA 4II3B 2JXXA 2KNBA 2LI5A 3N30A 4DK5A 5LXHA 1GJZA 1WXAA 5CHFA 1UBQA 3UF8A 4A3OA 2VRRB 2N9XA 4G11A 5DPTA 4ASWC 4FA6A 2KLCA 3BINA 2KC1A 1P98A 4OVUA 2K8HA 1E8ZA 4HCNB 4F8CB 2DYBA 5G55A 3RUIB 2IYDB 3V61A 4BKSD 5J17A 2BYEA 3VTWA 1GUAB 2HJ8A 2W9NA 1P0RA 3CSFA 3VQIA 2N1VA 2AL6A 4K1RB 2Z0EB 4M8NA 5CX3A 1RAXA 3HM6X 2MLBA 4GGQA 3O65B 2EKEC 4IM2A 2D2QA 2D11A 2ZEQA 2N9EB 2KX0A 1Z5SB 3RZFA 1YIWA 3QA8A 4ANXA 5G2NA 2M1MA 3DDCB 3EHVA 2IO0B 4IWQA 3DBRI 3PHXB 4DDID 2L00B 1UGMA 1BT0A 2ZVNA 2M0XA 4LJPB 3LJ3A 3RULA 2NPTB 2QHOA 4G3XB 4IWPA 2KWUB 3KUZA 4GIVA 4TQ1A 2IY1B 2OJRA 1P3QU 3VUWA 1IP9A 3EC8A 2KFKA 3NHEB 5DPRA 2GBKA 3KH0A 2JPHA 3RD2A 4FHKA 2KANA 3DVGX 3KVFB 2N1WA 2NBWB 4KSLC 3WALA 4CHKA 3H7PB 4RM9A 4K7WA 2DX5B 2K39A 1S1QB 3NS8A 4G0NB 4MSQB 4W9CA 3NOBA 4NPNA 4HXDA 1VCBA 2BKFA 1WRDB 2LVPA 4P7IA 4ZDVA 2ZNVB 3AU5A 1V9JA 2ZPNA 4J6IA 2BYFA 2NVUI 1WJNA 2OOBB 2JT4B 2V4LA 3IFWB 2XK5A 3V60A 1WR1A 3QIJA 2LD9A 4EOYA 3R7QA 4GDKA 2IBIB 2J0KA 3WAPA 4CYEA 4N9F4 2ZNVC 4NY0A 3UINB 2UWQA 2NS5A 2MA9B 3TCAA 2DZKA 1V80A 3RCZA 3U7DA 2K8CA 2WDTB 1WI0A 3M3JA 4IUMB 5CHVC 3ZDMC 2MQJA 2MBBB 4GDLB 2PEAA 4ZRIA 4MGYE 1Q5WB 3VDZA 3A9KB 5AZFA 2RPQA 4ZYNA 5FR6A 4FADA 1WGHA 3APCA 4FULA 3QWZB 2DZIA 2ZCBA 2N7DA 3K9OB 4WJQA 3ZW3A 1WJ4A 2KO3A 4LJOB 1J19A 4KZ0A 2FNJB 2HE7A 3A1QB 3KYDD 4MELA 4W9LA 3RYTA 4FHJA 2DZJA 4FLHA 1ZGUB 2ZPYA 4KVGB 4E3CA 5AZHA 4PYZA 4WWPA 3VVWB 2C60A 3APDA 2NCNA 4URKA 1WX9A 3OJ4B 2BYVE 4JIOU 1V5TA 2NR2A 3ZNHB 4TQ0A 2J7QB 2JZZA 2RSUA 4AOFA 2KDBA 4BBNC 2MP2B 1LXDA 1CMXB 2AL3A 2LVOA 2KWCA 3ZRFA 2MBQA 4W9KA 2G45B 3SDLC 3L10B 2KX3A 4M0WB 3A4SC 2G4SA 3ML9A 3TJPA 1E5WA 2KQSA 4MM3A 3DVNU 4HWIB 4KIKB 4HLEA 5HKHA 3PSEB 4W9IA 4IG7B 3DOWA 2KD0A 2FCMA 4DBGA 2KMCA 4EUTA 1H4RA 1L2NA 3ZTDA 4MGZE 4HPLB 2O2VB 3VH4B 2KTRB 3L0WB 2O6VB 1RFAA 1OTRB 1P9DU 1F9JA 1C3TA 2FCSA 2M4NA 2LGDA 3VTUA 1E90A 1ISNA 2NPTA 3UQAA 1WYWB 1WXMA 2C9WB 4W9HA 3PGEA 4HDOA 4G50A 4K7UA 2NBUA 3P2BA 3PZDA 4FJVB 2LJ5A 1OQYA 4AUQC 2MWSB 1KJTA 4JQWC 2Z59B 3HM3A 2BKRB 3JSVA 2JY6A 1V49A 2CU1A 2XBBC 1Q1OA 2KJ6A 4EZJA 2JUOA 2ASQA 2UYZB 2L8JA 3AU4A 2O6VD 5AEKB 1ZW7A 2KJRA 2DHZA 1WGGA 2JRIB 3IG3A 4PS8A 4KDLB 2KZRA 2MSED 3A9JB 4DDGD 2LASA 2BF8B 3AXCA 2MBHA 3OAWA 3W1SC 3TBLD 4BKTA 4W9EA 2GBMA 2RD0A 3ZRCA 4NAWA 1KLVA 2DAJA 5CTRC 2FIDA 3TIXA 3R7RA 3DVNV 2KVRA 2CHXA 2KKCA 4M8MA 4F7ZA 1YQBA 2J0JA 3PT2B 1WGRA 1X1MA 3L08A 1LM8B 2ZJDA 3WAOA 1SIFA 1U4AA 3R3MA 3KUDB 5DPWA 1H8CA 4TUUA 3PVLA 4MEMA 4X57B 4ICVA 5JH5C 2DYOA 4NQLB 4B95A 3H6NA 4GU2A 1V2YA 3A9KA 5LLIA 1SE9A 2GMIC 1JRUA 4MH0E 3DBLI 1NBFC 1S3SG 3K9PB 4GN1A 2LXAA 5D2MB 1FXTB 1WZ3A 2N7EA 3V6EB 3ZLZA 4DHZE 2PJHA 2LXCA 2AEHA 4A20A 4ANWA 3OJ3A 2L0TA 1T0YA 2CR5A 4MJSB 3A4RA 5E6PA 4F1SA 2KQ7A 3A33B 2KFJA 1RRBA 2MW5A 3Q3JA 1VD2A 2IY0B 2ZCCA 4IM0A 5L83A 2WYQA 3QCAA 1V5OA 4K7SA 1ZKHA 3HK0A 1WY8A 3DBHI 2CKHB 4BKSA 4WJOA 2L7RA 3L13A 1EF1A 2FCNA 2KOXA 3SU8X 3X23A 1J8CA 3OLMD 2NBVB 1WMHB 1YJ1A 4ICUA 3ONSA 3PLVA 4II2B 3W1YA 3ZNGC 3VUXA 4AP4C 2C7NB 5BO4B 3PLUA 3PRZA 2WWZA 4KDIC 2CHZA 4NJ7A 1WX8A 3Q3FA 1YD8U 4KIKA 5C1ZA 3LDZE 4HJKA 3QK0A 4FJYA 4HDQA 1WM3A 3CSTA 4AJYB 1UZXB 2XEWA 1K8RB 4B9KA 5IA7A 1OEYA 1WM2A 5JHAA 4EFOA 1WFYA 4GB9A 2XK5B 1WH3A 2K6QA 5KHOA 3T9LA 2R2QA 2PE6B 1WGDA 4GDKB 4WWNA 3ZNZB 1Q0WB 2IZVB 2KXJA 4MGIE 4LCDE 2LUEA 2KC2A 1R4MI 5D94A 2DAFA 2KWVB 4W9DA 1I42A 1P1AA 3U30A 3X0WA 4RM8A 3SHQA 4EZLA 3PV1A 1NI2A 3ALBA 4DXAB 3AULA 2K25A 4MDKE 1YX5B 2REXA 2MRPA 1UD7A 4A3PA 4EZKA 4BOZB 4TKNA 2KHWB 3DBSA 2DENB 1YX6B 2N4FA 3MJWA 4BBNF 1M94A 2I1KA 4XC2A 3ZDTA 2K6DB 4DHJD 2RR9A 3ML8A 5L95C 2Y5BB 1MG8A 3IVFA 3L16A 3VTVA 2KTFA 4WJPA 4K81A 3VAWA 3RT3B 1C1YB 4JLCA 4NQKE 2RGFA 2AWTA 1E7VA 2FIFA 4E71A 3CF6E 2A4ZA 2C7HA 2MBEA 1WIAA 2JZ3B 1IPGA 2N9PC 3DQVA 1TBEA 2DZMA 5KHQA 2BPSA 1EUVB 2BWES 3N3KB 4PS3A 2FUHB 2B3AA 2L3ZA 3B1LX 4KZCA 4MGKE 4NJ6A 4WAAA 2V1YA 4GXBA 4ZRJA 1WXVA 2C5LC 2EMTA 4WWOA 3H7PA 3IBEA 2MBOA 2MCNB 4B6WA 2Z0DB 2KN5A 2HD5B 3PS6A 1GC6A 3EFUA 3KUCB 4HPMB 4IWOA 3T8MA 3KW5B 4GOCA 1V6EA 3ZKJC 1WF9A 3MTNB 3H9DA 1HE8A 3VHTC 3KYCD 2A5UA 2JVCA 2KJHB 3QAQA 5J18A 4BFRA 2D10A 1WE7A 2D3GA 2LZ6A 2R2OA 3IHPC 1QZEA 5DCNA 3DCGA 1AARA 2LWPA 3PRMB 4YL8A 2FAZA 3I3TB 4MJSA 2KLGA 2C7MB 1LQBA 2KMAA 1WJ6A 3ENEA 2G3QB 4AWJA 3ZIMA 5DPSA 3VFKA 2CS4A 1Z2MA 3ZTCA 3UIOB 5TR5A 4GDLA 1UELA 2CHWA 1TGZB 4XX5A 1KM7A 2LRWA 1SGHA 2G4DB 2JRHA 4FBJB 3VUYA 5D6JB 3VXWA 4XZ4A 1WMHA 4HK2A 1V86A 3V62A 2JF5A 3L17A 3VH3B 2BWFA 4ZRKA 1E8YA 2IO1B 3ZUNA 4WQOB 2KDIA 3TMPB 2GOWA 2PPHA 3WAMA 4CO7A 4DWFA 1Y8RC 1IYFA 3JSVB 1TTNA 3MHSD 1OGWA 4ANUA 5D7GA 1WXSA 3ZVVA 3A1QA 1D3ZA 4JL9A 4W9GA 3B0AA 4WJNA 4GMVA 1WR6E 3BY4B 3H7SA 3D32A 2FCQA 1EO6A 3QHTA 3QJZA 3M62B 3PPAA 3NY5A 2D07B 4RMAA 4W9FA 2KDEB 3DVGY 3QX1A 4NNJB 4BKGA 2J0MA 4HVBA 5LXIB 3V6CB 2EMSA 4GSWA 4LDTB 3GZNI 4W9JA 4TV3A 2MP2A 1J0GA 2IO3B 5GMVA 2KFKB 3WA0A 3ZNID 4NAWB 2LGYA 4PS7A 2HTHA 3JVZX 4BOSC 5J2RA 3R66C 1G6JA 3UQBA 1LFDA 3NZUA 1E8XA 2L76A 4IW0A 4AJWA 1RLFA 3SD5A 2GBJA
chains in the Genus database with same CATH superfamily
3HHMA 1EWCA 1JROA 1SJED 2JQRB 5AZGA 1XQQA 4DHJB 1UBIA 3QARA 2KTRA 2KK8A 4RGNA 2WXGA 3I57A 3CMMB 1JWAD 4LDTD 4OVVA 2GBNA 1V81A 3NZSA 3QQ8B 5E6JA 3P1MA 1C78A 2YVCA 3SFEB 2M17A 2L0FA 1B1ZA 1MVKA 1AN8A 4EEWA 4LLGM 1E8WA 2AYOB 1VJKA 3GOEA 2JU6X 1XLOA 1GG3A 3P4RB 4MSMB 5CHWA 4FN2A 2DYMA 4I6PA 2LGXA 2IJ0A 3DPDA 2JXXA 2KNBA 4JX1C 4DK5A 1GJZA 5LXHA 4S0RA 2VZKB 4A3OA 2VRRB 4FA6A 2G1EA 1CK1A 2KLCA 2WP9B 4CQNA 2K8HA 1E8ZA 4HCNB 2DYBA 5G55A 3RUIB 3BIID 3VTWA 3N9YC 1GUAB 2BVCA 4LNKA 2W9NA 3ZJVA 2LJIA 2Z0EB 4M8NA 2MLBA 3WCQA 2EKEC 4IM2A 1RM6C 1C4PA 4B0EA 3U2SC 3Q3MC 2M1MA 2VZKD 4EE2A 4YSZB 1KFYB 2ZVNA 3LJ3A 3IXSA 4G3XB 1E0ZA 1P3QU 1IP9A 3EC8A 5DPRA 2JPHA 3RD2A 3DVGX 2N1WA 2H89B 4MSQB 1S1QB 4HXDA 1VCBA 4C80A 2ZPNA 4J6IA 2JT4B 1HEZE 2V4LA 2FE8A 1WR1A 3RMKC 2LD9A 1L4ZB 2AX5A 3BYTB 2D3BA 3WAPA 2WLBA 2GRIA 1EM7A 4CYEA 1JCKB 3UINB 5G5HA 1ET6A 2W55A 1V80A 3U7DA 3DBRB 3DHGC 3M3JA 3ZDMC 3W5UB 4LNFA 4GDLB 4HPPA 2KDMA 1JWUD 2KAJA 5AZFA 4N58A 4YSXB 2DZIA 2W3SA 2ZCBA 1FPYA 2N7DA 1WJ4A 2FNJB 1N62A 2L1AA 4MELA 4W9LA 1L6UA 2DZJA 1GPXA 5AZHA 3GB1A 3APDA 3MJ5A 4WURA 2BS3B 3OJ4B 3OWEB 2J7QB 4LNIA 2EELA 2QJLA 3AE9B 2MP2B 1LXDA 2LVOA 4XGAB 3FC4A 1V97A 2INNE 2WXLA 4KIKB 5HKHA 3PSEB 4W9IA 3BK2A 2WXNA 2IGDA 2FCMA 2WXHA 1H4RA 1L2NA 4QAYA 3BVZA 1OTRB 4MACA 2LGDA 2NPTA 1ISNA 3UQAA 1WXMA 3P2BA 4FJVB 1OQYA 3AE7B 2JY6A 1V49A 1UWMA 1NI3A 3TEXA 3B9JA 4TSSA 1ZW7A 1YQ3B 4UDUC 2V0GA 2LASA 3OAWA 3W1SC 1J7BA 1TKGA 3RNAC 4BKTA 1AWDA 4NAWA 1KLVA 2J53A 5CTRC 2FIDA 3ZXRA 3R7RA 3DVNV 4M8MA 1TKEA 2JX5A 1X1MA 1ESFA 3L08A 1LM8B 2WXOA 5DPWA 1L0XB 3KUDB 3VRAB 1H8CA 4TUUA 1HA5A 3A9KA 3SR6A 4MH0E 1JRUA 3DBLI 3Q14C 1FO4A 4L23A 1WRIA 2RDGA 2N7EA 4DHZE 4ANWA 4F1SA 4MJSB 1F77A 1K53A 3AH7A 1RRBA 1YN4A 1VD2A 1TT5B 4K7SA 2IPKD 1ZKHA 1WY8A 2CKHB 3GE8C 1EF1A 2KOXA 3OLMD 3ONSA 3PLVA 3ZNGC 5BO4B 4YTPB 2WWZA 4KDIC 2CHZA 3Q3FA 1YD8U 5C1ZA 3AB5A 1BUIC 1L5PA 3QK0A 1WM3A 3CSTA 1K8RB 4B9KA 1ROEA 3ZQ4A 1WH3A 1WGDA 1SE4A 2KXJA 2E6XA 2KC2A 1HTQA 2DAFA 3O13A 3RN9C 3U30A 3SHQA 3VR8B 2K25A 1TY0A 2V9HA 2REXA 4BOZB 1T0RC 2BTEA 3R2TA 3MJWA 1YX6B 2N4FA 4PT5A 4RFBA 4KKJA 2RR9A 3ML8A 1K52A 2KTFA 2HDEA 4BZAA 1HXYD 4JLCA 2RGFA 4WH4A 2A4ZA 4B0MA 1KTKA 3DWMA 3AN1A 1EUVB 4M02A 4NJ6A 4ZHOA 2V1YA 2OEDA 4WWOA 1KRHA 2L52A 2MBOA 3RNFC 4B6WA 2M19A 3P42A 3RFZB 4IWOA 3KW5B 3R8BA 3VHTC 3KYCD 3QAQA 3C8YA 4RF1A 3IT4B 2R2OA 1QZEA 2PTLA 3DCGA 4YT0B 2LWPA 2FAZA 3I3TB 3ZYYX 2C7MB 3HRDD 1MHXA 4LNNA 1QOGA 3ZIMA 2QILA 3HVDA 4GDLA 2LRWA 2G4DB 1UUPA 1N5XA 2JXTA 3ZUNA 4WQOB 3N1YC 1N63A 3WAMA 2PPHA 4ZHPA 2AQ3B 5D7GA 2L32A 2K0PA 1YN3A 4JL9A 1MFWA 2MHJA 3QHTA 3M62B 3PPAA 2KDEB 2Y5PA 4NNJB 3NRZA 5LXIB 2EMSA 2MP2A 2IO3B 5GMVA 2LGYA 2DLBA 3JVZX 4OZCA 1SBBB 1LFDA 3NZUA 1E8XA 2L76A 4IW0A 3C19A 4S17A 3APFA 3T3NA 3M63B 1R4NI 3N32A 2GBRA 2X8XX 2MJ3A 2WXRA 2WXFA 4BVUC 2BGFA 2L83A 3EECA 4AS1A 1WX7A 2KYWA 5E6NA 3BK1A 1WGYA 1TYGB 1TS2A 1YQ4B 3KLSX 4TMAB 3WANA 4DHZB 3PTFC 5IOIA 2ZVOA 3VRBB 1OEYJ 2KACA 2RDHA 1WE6A 3AI5A 4DXFA 1EF5A 1GNUA 4KSKC 4JWUC 3U8ZA 4KV2A 1J7AA 2LHDA 1J7CA 3M95A 5H92C 1UH6A 5JZEB 4A9AA 2WX1A 1MPEA 3RZWC 5JHBA 3Q2AC 3ZJUA 2MH7A 1NDDA 3JYUA 5I4DA 1FRDA 4II3B 3N30A 1WXAA 3NVWA 5EE0A 5CHFA 1UBQA 3UF8A 4ASWC 1F1HA 1PYWD 2KC1A 3EFCA 3B2GA 4OVUA 4ACFA 3BVMA 2V3PA 2LUMA 4PK1A 3V61A 5IP4D 5J17A 2BYEA 1TS4A 2AQ2B 3RPFC 1TZOA 2AL6A 2YEPF 3AM9A 4FXCA 2ZEQA 1Z5SB 2WU2B 4A55A 3EA6A 4YTMB 3EHVA 5BYRA 1N5WA 3PHXB 4OHJA 3FAHA 2NPTB 2KWUB 2IY1B 3VUWA 1I4HA 3NHEB 5EE1A 2INPE 4ARCA 4IKGA 2KANA 3I9V1 4JE3B 4RM9A 4K7WA 3NS8A 4W9CA 1L0YB 2FBWB 2LVPA 3DHHC 1NYRA 3AU5A 2BYFA 3V60A 3QIJA 2J0KA 4N9F4 4R3DA 4KKIA 2NS5A 1LO5D 5H8YE 4MT5A 2PKOA 4ZRIA 1D4BA 1Q5WB 1HZ6A 3A9KB 2RPQA 1C9FA 5FR6A 1JALA 2BS2B 1WGHA 1GB1A 3KQ4A 3K9OB 3NZ3A 4KZ0A 3CIRB 4E3CA 4PYZA 1C79A 3Q3OC 1XLQA 2LFIA 2NR2A 2JZZA 2RSUA 2IGGA 1PGXA 1MJDA 4XWTA 2JZPA 2W54A 2G4SA 1KLGD 3ML9A 3TJPA 1AW7A 1E5WA 3DVNU 4A8XC 4HWIB 5EE9A 1T3QA 2KD0A 4DBGA 2KMCA 3I63C 2O2VB 1QT9A 3BZDB 4HKQA 4NAMA 1F9JA 2FCSA 2M4NA 3VTUA 1E90A 3U52E 2C9WB 4W9HA 4HDOA 4K7UA 1C77A 3PZDA 4AUQC 2LJ5A 2MWSB 1C76A 3HM3A 2CU1A 2XBBC 1Q1OA 2KJ6A 2JUOA 4RCOA 2MJEA 2UYZB 1DOXA 2L8JA 5AEKB 2KJRA 2DHZA 2BS4B 4DQOC 4KDLB 2KZRA 5JXVA 2MSED 2ICIA 3A9JB 4DDGD 2MBHA 3TBLD 3ZRCA 2BB5A 3P4QB 1DGJA 3HVZA 4F7ZA 3AE8B 1YQBA 4P1CC 2ZJDA 3B2FA 4JPSA 3R3MA 3PVLA 4X57B 5JH5C 4ICVA 2DYOA 4NQLB 5LLIA 1SSNA 2GMIC 1UF0A 4MH8A 1YJIA 3AECB 2INCC 1WZ3A 3V6EB 3ZLZA 2PJHA 4A20A 4K3BA 1T0YA 4N59A 2ZCCA 2KMMA 4IM0A 4OZAA 3HK0A 4P6VF 3SEBA 3DBHI 3FILA 4WJOA 3L13A 1QLBB 2FCNA 2NBVB 1YJ1A 1B9RA 4II2B 4AP4C 2N9KA 4M0WA 3LDZE 4HJKA 3TUOA 5IA7A 2QC8A 3DBLB 5JHAA 2E3TA 3NG0A 4GB9A 3T9LA 5KHOA 4L1BA 2VH2A 4LCDE 2LUEA 2WQYB 3U7ZA 5D94A 4W9DA 1I42A 1ZXHA 1P1AA 1YJJA 1L4DB 3PV1A 5HG2A 4OW0A 1FXIA 1RFKA 1OFFA 2M0AA 2WXIA 2MRPA 4A3PA 4TKNA 4BBNF 3ZDTA 1MG8A 5HHDG 3VAWA 1BMLC 1BXTA 4NQKE 1ZOYB 3GE3C 3SFDB 1E7VA 2C7HA 1WIAA 3RI7C 1IPGA 2DZMA 5KHQA 1F2RI 3AEBB 4ZRQA 4KZCA 4WAAA 4GXBA 1WXVA 2EMTA 2V3NA 4REZA 2BB6A 2HD5B 3PS6A 4H2AA 3T8MA 1V6EA 1XCTL 4MM3B 2JVCA 5J18A 3NVZA 2D10A 1FNWA 1WE7A 4N6EB 5BMGA 1IUEA 1FIQA 2N0SB 3GS2A 3Q8AA 3PRMB 1I4QA 2KMAA 1WJ6A 4AWJA 2G3QB 1YN5A 3Q69A 1STEA 1Z2MA 1LGRA 1UELA 2CHWA 2J42A 5G5GA 1FFVA 4XZ4A 3U4EG 4HK2A 3V62A 3L17A 3VH3B 2BWFA 2KDIA 2QEJC 4DWFA 1Y8RC 1IYFA 3JSVB 1TTNA 3EGRA 1C4CA 1C4AA 1L6VA 1WR6E 1EO6A 4RMAA 3QX1A 3AE3B 1F2RC 4HVBA 4A6QA 5AUIA 3NVVA 3WA0A 3J9CA 5J2RA 5D3DA 3R66C 5IKCM 1G6JA 3TMPB 1SEBD 1E9MA 1QILA 2KWDA 2J52A 4JGHB 4Q2JA 3PHWB 1XD3B 2IO2B 2O2VA 1XEEA 2PE9A 5GXGB 2KT7A 4LNOA 3RNEC 2K1FA 1E7PB 2WNMA 3C0RB 3N1XC 4ZYSA 4D2KA 1PFDA 4RGOS 3ECIA 3L54A 1WXQA 1F52A 4FJZA 2JWZA 5C23A 2K9XA 2B76B 4USAA 1QQRA 2VH1A 1TZ1A 1UNSA 3W1SA 4E74A 3ZO5B 2ZW0A 1GC7A 1EWYC 3B08A 4I6NB 3UGBB 2LVQA 2K8BA 1VR9A 1WZ0A 3A9JA 2YLMA 2G9HD 3TL5A 2KDFB 2WHIA 2N7JA 1UWXA 3PREA 1WGKA 1R4NB 4C7ZA 3N20C 3IAS1 4G11A 3BINA 2IYDB 2H88B 2R61A 1A70A 3VQIA 1XLPA 1SE2A 5HFYA 5CX3A 4GGQA 3HM6X 2WGSA 5IN7A 2J4XA 2D2QA 2LMCA 2N9EB 2KX0A 3RZFA 4ANXA 3E9SA 3DDCB 1T6BX 4IWQA 4NJCA 4DDID 3AEFB 2L00B 1JWBD 1VZ8A 2K5PA 2QMTA 2WDRB 3RULA 2QHOA 4WWMA 5IO9A 1WSPA 4TQ1A 3I5JC 3VR9B 3KH0A 1TKYA 2K22A 2DNFA 2CJNA 3KVFB 2PIAA 2NBWB 4KSLC 3WALA 4CHKA 3H7PB 1ZUD2 4NPNA 1ZDXA 2BKFA 1WRDB 2BT6A 1YOVB 3IFWB 2CJOA 1K50A 3AV8A 3Q8BA 4XE0A 2I2YA 3R7QA 1PDXA 2IBIB 3V05A 1IGCA 2ZNVC 4US9A 2MA9B 3TCAA 3RCZA 2K8CA 4IUMB 3RNBC 2MQJA 3AE6B 2MBBB 1MG4A 2D5GA 4J3OD 4ZYNA 1JWSD 1Q10A 4YSYB 4WJQA 3NUHB 2HE7A 3A1QB 3KYDD 3RYTA 4OVZA 4FHJA 4ZRPA 2JSVX 4IDIA 1ZGUB 4ITKA 4KVGB 3Q3NC 4WWPA 4URKA 3FILB 2PVOD 3DHIC 2IGHA 4TQ0A 1QF6A 4AOFA 1T0SC 1CMXB 2AL3A 3ZRFA 2MBQA 4W9KA 1PGBA 3L10B 2KX3A 4M0WB 4RGMA 4MM3A 3AEAB 4US8A 4HLEA 1KLUD 1VZ7A 1MHHE 1CJEA 4KGSA 2PLPA 2DBYA 3VH4B 2O6VB 2YEPB 1WYGA 1C3TA 1I4PA 1V1PB 2ON8A 3PGEA 1HQRD 4G50A 2NBUA 1I7HA 1SB3C 4JQWC 2W82A 3ABVB 3Q8CA 3JSVA 2BKRB 2ASQA 1RYJA 3AU4A 2O6VD 2D3CA 3IG3A 2WXKA 1V1OA 2I38A 4W9EA 4HRSA 2RD0A 2DAJA 2K3UA 4ZOHC 1WGRA 2QSDA 3ZGZA 3AE1B 1XF5L 4MEMA 1PGAA 4B95A 1T0QC 2LXAA 3DWGC 5D2MB 1FXTB 2LXCA 2BQQA 3ETRA 1KOTA 2XN9C 2L0TA 2CR5A 5E6PA 3A4RA 2KQ7A 3A33B 3Q3JA 1WWTA 2WYQA 1V5OA 1NVID 1IBXB 4RH6A 3SU8X 3X23A 2WS3B 1JWMD 3VUXA 3AEEB 2XNAC 4L2YA 3PLUA 2ZW1A 4KGRA 4HDQA 1UZXB 4EFOA 3AEDB 2XK5B 2K6QA 2IDYA 4GDKB 1UGJA 3ZNZB 1Q0WB 2IZVB 4MGIE 3TEWA 3TEYA 1R4MI 2KWVB 4P16A 1JRPA 3X0WA 4RM8A 4EZLA 3ZXVA 3ALBA 3AULA 1TS3A 1HZ5A 2MEKA 1YX5B 3DBHB 1UD7A 4EZKA 4ARIA 2KHWB 3DBSA 2DENB 3LYYA 2I1KA 4DHJD 5L95C 2LGSA 4C56C 1FCLA 1KH0A 3L16A 3VTVA 4WJPA 4K81A 5FR3A 3RT3B 1C1YB 3P63A 4LTUA 1DOYA 2AWTA 2FIFA 3CF6E 3P4PB 2MBEA 2JZ3B 1MI0A 2SEBD 3Q6BA 3DQVA 1TBEA 1TS5A 1VZ6A 2BPSA 2FUHB 4GLSC 4MGKE 4ZRJA 3H7PA 3IBEA 4KGTA 2MCNB 1OQQA 1GC6A 3MTNB 3H9DA 2FUG1 1HE8A 3Q8FA 1NENB 1R7SA 4BFRA 5BMIA 2D3GA 2LZ6A 3AMZA 1FRRA 5DCNA 5TSSA 1AARA 2PVGC 4YL8A 5BYQA 1LQBA 3ENEA 5EE3A 3ZTCA 3UIOB 4WIPA 2ACZB 2RDBC 4XX5A 1KM7A 2JRHA 2UU7A 3LXFA 1I4GA 3VUYA 5D6JB 1WMHA 2JF5A 2IO1B 1SE3A 2GOWA 4CO7A 2BYTA 4LK0M 1OGWA 4ANUA 1QOAA 3URYA 1WXSA 3ZVVA 3A1QA 1D3ZA 1ZPSA 2HTME 3B0AA 4WJNA 3MC0B 4XDDA 3BY4B 1E10A 3H7SA 3D32A 3QJZA 2LEKA 4YWGG 4BKGA 1I4XA 2MJDA 2J0MA 3MHZA 3V6CB 4WQMA 4GSWA 1E6EB 4W9JA 4C4VB 3ZNID 4JWSC 2JYEA 3UQBA 4AJWA 3AE5B 1ZDVA 1QKZA 2GBJA 3S2AA 5EDSA 3JW0X 2I1JA 5IAAC 2V3SA 2NMQA 3PRPB 2ONQA 2QIEB 2WX0A 1VLBA 3WIMA 1PQSA 3AE2B 3HIZA 1E7UA 2O6VA 4BAXA 1Y56A 4XDCA 3L4PA 1A5RA 2GB1A 2MX2A 1XT9B 4WAFA 4YXDB 2LRUA 4HCPB 1V1PA 1L7YA 1QOBA 4IC7B 1WJUA 1YNTE 3H1UA 2M8SA 3QC8B 2N9LA 2ZZPB 4PYUA 2WXJA 3UIPB 2L05A 2SAKA 1I35A 4NZLB 5E6OA 4IM3A 4EKUA 3KWLA 4I6LB 4ANVA 1SIJA 2KVZA 3NS1A 3PZ8A 2PW9A 1N6ZA 2LI5A 2HJ1A 2N9XA 5DPTA 4XYCA 1P98A 4AQ7A 4F8CB 4BKSD 1P7EA 4M01A 3BWUD 2HJ8A 1P0RA 3CSFA 2N1VA 3W2DA 4HEA1 4K1RB 1RAXA 5MPOA 3O65B 1DYQA 2D11A 1YIWA 3QA8A 5G2NA 1CZPA 1VDVA 2IO0B 3DBRI 3UI3A 1FMAD 1UGMA 1BT0A 1ET9A 2M0XA 1AYFA 4LJPB 1QOFA 1IBXA 1EU3A 4RGTA 4IWPA 1FM0D 1OQRA 3KUZA 4GIVA 2OJRA 1NEKB 3AEGB 2KFKA 2WXPA 2GBKA 4IOIE 4FHKA 2WDQB 1FXAA 1GOZA 1M4VA 2DX5B 2K39A 3NJTA 4G0NB 3NOBA 3MFGA 4P7IA 2AQ1B 2ZNVB 4ZDVA 1V9JA 2EKIA 3P4SB 2NVUI 2JYTA 1WJNA 2OOBB 2BBCA 2XK5A 1T5XD 4EOYA 4GDKA 2D3AA 4NY0A 2UWQA 2WXMA 2DZKA 4M00A 2WDTB 4HJGE 1WI0A 1ENFA 1ZP0B 2NTSA 5CHVC 4K3CA 2PEAA 4MGYE 3VDZA 4FADA 3APCA 1FCCC 4FULA 1FEHA 3QWZB 4C7YA 1CQVA 3ZW3A 2DWQA 2JWUA 3Q8EA 4LJOB 2KO3A 2CU3A 1J19A 1N61A 2OHFA 1SXTA 4FLHA 2Y3AA 2ZPYA 3NVYA 4DXGA 3VVWB 2C60A 2NCNA 1N60A 1WX9A 2BYVE 4JIOU 1V5TA 3ZNHB 1JQ4A 2GI9A 4A90A 1D6EC 2KDBA 4BBNC 5T8IA 1TJEA 2KWCA 2G45B 3SDLC 1K51A 2KN4A 3A4SC 1XXGA 2KQSA 2QDFA 2RMMA 1FFUA 1L0VB 4IG7B 3DOWA 4EUTA 3ZTDA 4MGZE 1IGDA 2M56B 3IT6B 4HPLB 2KTRB 3L0WB 1RFAA 1EU4A 1P9DU 2Y5CA 3E56A 1SJHD 5HI1A 1WYWB 2RPVA 2LHEA 3BVGA 1KJTA 2Z59B 4RF0A 2WXQA 2KQ4X 1FNVA 5AUKA 4EZJA 3PZ7A 1ZE3D 5C3JB 4HROA 2Z8LA 3V3XA 2JRIB 1WGGA 5LNK1 4PS8A 1ACCA 3AXCA 2BF8B 1JMLA 1D5MC 2GBMA 4C4VA 1PUTA 3TIXA 2KVRA 2BW2A 2CHXA 2KKCA 1YMHE 3R2IA 3W9CB 2J0JA 3PT2B 3WAOA 1SIFA 1U4AA 3T3OA 3AE4B 3N1ZC 3H6NA 4GU2A 1V2YA 1D5ZC 1SE9A 2GLSA 1NBFC 3CWIA 1S3SG 3K9PB 4GN1A 3EUB2 3PO0A 1V8CA 5FKAC 1FNUA 2AEHA 3OG5A 3OJ3A 1XCQL 3FKYA 2KFJA 1GB4A 3MC8A 2MW5A 2IY0B 4P1BC 1XLNA 5L83A 3QCAA 2QCZA 1VRAB 4BKSA 2L7RA 2INDC 1F0ZA 1J8CA 1WMHB 4ICUA 3W1YA 2C7NB 3PRZA 2NTTA 3MC9A 4NJ7A 1WX8A 4KIKA 1P7FA 4C00A 2PMVA 3RNCC 4FJYA 1ZXIA 4XWWA 4AJYB 2XEWA 3GP7A 2LGIA 1OEYA 1WM2A 1WFYA 2V4IB 2R2QA 2PE6B 4WWNA 4KX6B 2OJWA 3HUIA 1NI2A 4DXAB 4MDKE 1FD6A 1TY2A 3GZNB 1M94A 4XC2A 2K6DB 2WU5B 2X38A 2Y5BB 1SF0A 3RNGC 3IVFA 1TIFA 2WDVB 3TSSA 2Q5WD 4E71A 4RNAA 2N9PC 3N3KB 2BWES 5FK9C 4PS3A 1GAQB 2B3AA 2L3ZA 3B1LX 1KF6B 4HKZE 2C5LC 1JW9D 2Z0DB 2KN5A 3EFUA 3KUCB 4HPMB 3ZJTA 4GOCA 3TEZA 3ZKJC 1WF9A 1R4MB 2A5UA 2KJHB 5C2TB 4YTNB 1I4RA 1HTOA 3IHPC 1NYQA 3W5VB 1RWSA 4MJSA 2KLGA 1XO3A 3IAM1 3KWVA 5DPSA 3VFKA 2CS4A 5TR5A 5BMHA 2W3RA 5BYSA 1TGZB 1SGHA 1DOIA 4FBJB 3VXWA 4O1NA 1V86A 1D5XC 4ZRKA 1E8YA 3BYYB 3H8HA 3MHSD 2TSSA 3LB8C 4W9GA 4GMVA 5D3IB 2FCQA 3NY5A 2D07B 4W9FA 3DVGY 4OZBA 4LDTB 3GZNI 4TV3A 1J0GA 2KFKB 3MP9A 4NAWB 4PS7A 2HTHA 4BOSC 1RLFA 3SD5A
chains in the Genus database with same CATH topology
3S2AA 5EDSA 3JW0X 2I1JA 3APFA 5IAAC 3M63B 3HHMA 1R4NI 2V3SA 3N32A 4JGHB 2GBRA 3PRPB 5AZGA 2WX0A 3PHWB 1XQQA 1XD3B 3WIMA 4BVUC 1PQSA 2BGFA 2IO2B 3HIZA 1UBIA 1E7UA 2O2VA 2KTRA 3QARA 4DHJB 2O6VA 3EECA 2KK8A 2PE9A 1WX7A 2K1FA 3CMMB 5E6NA 3C0RB 1A5RA 4LDTD 4OVVA 1WGYA 2MX2A 1XT9B 2LRUA 2GBNA 4HCPB 1V81A 3NZSA 3ECIA 3L54A 1KOTA 1L7YA 3QQ8B 4FJZA 3WANA 4DHZB 3PTFC 4IC7B 1WJUA 2JWZA 5C23A 2ZVOA 1OEYJ 1WE6A 3AI5A 3H1UA 1EF5A 1GNUA 2YVCA 2M8SA 2M17A 2L0FA 3QC8B 4KSKC 2ZZPB 3U8ZA 4EEWA 1TZ1A 3W1SA 4E74A 3ZO5B 4PYUA 1E8WA 4KV2A 2AYOB 1GC7A 3M95A 3B08A 1UH6A 2L05A 3UIPB 3GOEA 4I6NB 3UGBB 1GG3A 1I35A 5E6OA 2LVQA 4IM3A 2WX1A 4MSMB 2K8BA 4EKUA 5JZEB 4I6LB 1WZ0A 4ANVA 5CHWA 3RZWC 5JHBA 4FN2A 2DYMA 3A9JA 2YLMA 4I6PA 3TL5A 2KDFB 2LGXA 3DPDA 1NDDA 3JYUA 3PREA 4II3B 2JXXA 2KNBA 2LI5A 3N30A 4DK5A 5LXHA 1GJZA 1WXAA 5CHFA 1UBQA 3UF8A 4A3OA 2VRRB 2N9XA 4G11A 5DPTA 4ASWC 4FA6A 2KLCA 3BINA 2KC1A 1P98A 4OVUA 2K8HA 1E8ZA 4HCNB 4F8CB 2DYBA 5G55A 3RUIB 2IYDB 3V61A 4BKSD 5J17A 2BYEA 3VTWA 1GUAB 2HJ8A 2W9NA 1P0RA 3CSFA 3VQIA 2N1VA 2AL6A 4K1RB 2Z0EB 4M8NA 5CX3A 1RAXA 3HM6X 2MLBA 4GGQA 3O65B 2EKEC 4IM2A 2D2QA 2D11A 2ZEQA 2N9EB 2KX0A 1Z5SB 3RZFA 1YIWA 3QA8A 4ANXA 5G2NA 2M1MA 3DDCB 3EHVA 2IO0B 4IWQA 3DBRI 3PHXB 4DDID 2L00B 1UGMA 1BT0A 2ZVNA 2M0XA 4LJPB 3LJ3A 3RULA 2NPTB 2QHOA 4G3XB 4IWPA 2KWUB 3KUZA 4GIVA 4TQ1A 2IY1B 2OJRA 1P3QU 3VUWA 1IP9A 3EC8A 2KFKA 3NHEB 5DPRA 2GBKA 3KH0A 2JPHA 3RD2A 4FHKA 2KANA 3DVGX 3KVFB 2N1WA 2NBWB 4KSLC 3WALA 4CHKA 3H7PB 4RM9A 4K7WA 2DX5B 2K39A 1S1QB 3NS8A 4G0NB 4MSQB 4W9CA 3NOBA 4NPNA 4HXDA 1VCBA 2BKFA 1WRDB 2LVPA 4P7IA 4ZDVA 2ZNVB 3AU5A 1V9JA 2ZPNA 4J6IA 2BYFA 2NVUI 1WJNA 2OOBB 2JT4B 2V4LA 3IFWB 2XK5A 3V60A 1WR1A 3QIJA 2LD9A 4EOYA 3R7QA 4GDKA 2IBIB 2J0KA 3WAPA 4CYEA 4N9F4 2ZNVC 4NY0A 3UINB 2UWQA 2NS5A 2MA9B 3TCAA 2DZKA 1V80A 3RCZA 3U7DA 2K8CA 2WDTB 1WI0A 3M3JA 4IUMB 5CHVC 3ZDMC 2MQJA 2MBBB 4GDLB 2PEAA 4ZRIA 4MGYE 1Q5WB 3VDZA 3A9KB 5AZFA 2RPQA 4ZYNA 5FR6A 4FADA 1WGHA 3APCA 4FULA 3QWZB 2DZIA 2ZCBA 2N7DA 3K9OB 4WJQA 3ZW3A 1WJ4A 2KO3A 4LJOB 1J19A 4KZ0A 2FNJB 2HE7A 3A1QB 3KYDD 4MELA 4W9LA 3RYTA 4FHJA 2DZJA 4FLHA 1ZGUB 2ZPYA 4KVGB 4E3CA 5AZHA 4PYZA 4WWPA 3VVWB 2C60A 3APDA 2NCNA 4URKA 1WX9A 3OJ4B 2BYVE 4JIOU 1V5TA 2NR2A 3ZNHB 4TQ0A 2J7QB 2JZZA 2RSUA 4AOFA 2KDBA 4BBNC 2MP2B 1LXDA 1CMXB 2AL3A 2LVOA 2KWCA 3ZRFA 2MBQA 4W9KA 2G45B 3SDLC 3L10B 2KX3A 4M0WB 3A4SC 2G4SA 3ML9A 3TJPA 1E5WA 2KQSA 4MM3A 3DVNU 4HWIB 4KIKB 4HLEA 5HKHA 3PSEB 4W9IA 4IG7B 3DOWA 2KD0A 2FCMA 4DBGA 2KMCA 4EUTA 1H4RA 1L2NA 3ZTDA 4MGZE 4HPLB 2O2VB 3VH4B 2KTRB 3L0WB 2O6VB 1RFAA 1OTRB 1P9DU 1F9JA 1C3TA 2FCSA 2M4NA 2LGDA 3VTUA 1E90A 1ISNA 2NPTA 3UQAA 1WYWB 1WXMA 2C9WB 4W9HA 3PGEA 4HDOA 4G50A 4K7UA 2NBUA 3P2BA 3PZDA 4FJVB 2LJ5A 1OQYA 4AUQC 2MWSB 1KJTA 4JQWC 2Z59B 3HM3A 2BKRB 3JSVA 2JY6A 1V49A 2CU1A 2XBBC 1Q1OA 2KJ6A 4EZJA 2JUOA 2ASQA 2UYZB 2L8JA 3AU4A 2O6VD 5AEKB 1ZW7A 2KJRA 2DHZA 1WGGA 2JRIB 3IG3A 4PS8A 4KDLB 2KZRA 2MSED 3A9JB 4DDGD 2LASA 2BF8B 3AXCA 2MBHA 3OAWA 3W1SC 3TBLD 4BKTA 4W9EA 2GBMA 2RD0A 3ZRCA 4NAWA 1KLVA 2DAJA 5CTRC 2FIDA 3TIXA 3R7RA 3DVNV 2KVRA 2CHXA 2KKCA 4M8MA 4F7ZA 1YQBA 2J0JA 3PT2B 1WGRA 1X1MA 3L08A 1LM8B 2ZJDA 3WAOA 1SIFA 1U4AA 3R3MA 3KUDB 5DPWA 1H8CA 4TUUA 3PVLA 4MEMA 4X57B 4ICVA 5JH5C 2DYOA 4NQLB 4B95A 3H6NA 4GU2A 1V2YA 3A9KA 5LLIA 1SE9A 2GMIC 1JRUA 4MH0E 3DBLI 1NBFC 1S3SG 3K9PB 4GN1A 2LXAA 5D2MB 1FXTB 1WZ3A 2N7EA 3V6EB 3ZLZA 4DHZE 2PJHA 2LXCA 2AEHA 4A20A 4ANWA 3OJ3A 2L0TA 1T0YA 2CR5A 4MJSB 3A4RA 5E6PA 4F1SA 2KQ7A 3A33B 2KFJA 1RRBA 2MW5A 3Q3JA 1VD2A 2IY0B 2ZCCA 4IM0A 5L83A 2WYQA 3QCAA 1V5OA 4K7SA 1ZKHA 3HK0A 1WY8A 3DBHI 2CKHB 4BKSA 4WJOA 2L7RA 3L13A 1EF1A 2FCNA 2KOXA 3SU8X 3X23A 1J8CA 3OLMD 2NBVB 1WMHB 1YJ1A 4ICUA 3ONSA 3PLVA 4II2B 3W1YA 3ZNGC 3VUXA 4AP4C 2C7NB 5BO4B 3PLUA 3PRZA 2WWZA 4KDIC 2CHZA 4NJ7A 1WX8A 3Q3FA 1YD8U 4KIKA 5C1ZA 3LDZE 4HJKA 3QK0A 4FJYA 4HDQA 1WM3A 3CSTA 4AJYB 1UZXB 2XEWA 1K8RB 4B9KA 5IA7A 1OEYA 1WM2A 5JHAA 4EFOA 1WFYA 4GB9A 2XK5B 1WH3A 2K6QA 5KHOA 3T9LA 2R2QA 2PE6B 1WGDA 4GDKB 4WWNA 3ZNZB 1Q0WB 2IZVB 2KXJA 4MGIE 4LCDE 2LUEA 2KC2A 1R4MI 5D94A 2DAFA 2KWVB 4W9DA 1I42A 1P1AA 3U30A 3X0WA 4RM8A 3SHQA 4EZLA 3PV1A 1NI2A 3ALBA 4DXAB 3AULA 2K25A 4MDKE 1YX5B 2REXA 2MRPA 1UD7A 4A3PA 4EZKA 4BOZB 4TKNA 2KHWB 3DBSA 2DENB 1YX6B 2N4FA 3MJWA 4BBNF 1M94A 2I1KA 4XC2A 3ZDTA 2K6DB 4DHJD 2RR9A 3ML8A 5L95C 2Y5BB 1MG8A 3IVFA 3L16A 3VTVA 2KTFA 4WJPA 4K81A 3VAWA 3RT3B 1C1YB 4JLCA 4NQKE 2RGFA 2AWTA 1E7VA 2FIFA 4E71A 3CF6E 2A4ZA 2C7HA 2MBEA 1WIAA 2JZ3B 1IPGA 2N9PC 3DQVA 1TBEA 2DZMA 5KHQA 2BPSA 1EUVB 2BWES 3N3KB 4PS3A 2FUHB 2B3AA 2L3ZA 3B1LX 4KZCA 4MGKE 4NJ6A 4WAAA 2V1YA 4GXBA 4ZRJA 1WXVA 2C5LC 2EMTA 4WWOA 3H7PA 3IBEA 2MBOA 2MCNB 4B6WA 2Z0DB 2KN5A 2HD5B 3PS6A 1GC6A 3EFUA 3KUCB 4HPMB 4IWOA 3T8MA 3KW5B 4GOCA 1V6EA 3ZKJC 1WF9A 3MTNB 3H9DA 1HE8A 3VHTC 3KYCD 2A5UA 2JVCA 2KJHB 3QAQA 5J18A 4BFRA 2D10A 1WE7A 2D3GA 2LZ6A 2R2OA 3IHPC 1QZEA 5DCNA 3DCGA 1AARA 2LWPA 3PRMB 4YL8A 2FAZA 3I3TB 4MJSA 2KLGA 2C7MB 1LQBA 2KMAA 1WJ6A 3ENEA 2G3QB 4AWJA 3ZIMA 5DPSA 3VFKA 2CS4A 1Z2MA 3ZTCA 3UIOB 5TR5A 4GDLA 1UELA 2CHWA 1TGZB 4XX5A 1KM7A 2LRWA 1SGHA 2G4DB 2JRHA 4FBJB 3VUYA 5D6JB 3VXWA 4XZ4A 1WMHA 4HK2A 1V86A 3V62A 2JF5A 3L17A 3VH3B 2BWFA 4ZRKA 1E8YA 2IO1B 3ZUNA 4WQOB 2KDIA 3TMPB 2GOWA 2PPHA 3WAMA 4CO7A 4DWFA 1Y8RC 1IYFA 3JSVB 1TTNA 3MHSD 1OGWA 4ANUA 5D7GA 1WXSA 3ZVVA 3A1QA 1D3ZA 4JL9A 4W9GA 3B0AA 4WJNA 4GMVA 1WR6E 3BY4B 3H7SA 3D32A 2FCQA 1EO6A 3QHTA 3QJZA 3M62B 3PPAA 3NY5A 2D07B 4RMAA 4W9FA 2KDEB 3DVGY 3QX1A 4NNJB 4BKGA 2J0MA 4HVBA 5LXIB 3V6CB 2EMSA 4GSWA 4LDTB 3GZNI 4W9JA 4TV3A 2MP2A 1J0GA 2IO3B 5GMVA 2KFKB 3WA0A 3ZNID 4NAWB 2LGYA 4PS7A 2HTHA 3JVZX 4BOSC 5J2RA 3R66C 1G6JA 3UQBA 1LFDA 3NZUA 1E8XA 2L76A 4IW0A 4AJWA 1RLFA 3SD5A 2GBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2A A;  5EDS A;  3JW0 X;  2I1J A;  3APF A;  5IAA C;  3M63 B;  3HHM A;  1R4N I;  2V3S A;  3N32 A;  4JGH B;  2GBR A;  3PRP B;  5AZG A;  2WX0 A;  3PHW B;  1XQQ A;  1XD3 B;  3WIM A;  4BVU C;  1PQS A;  2BGF A;  2IO2 B;  3HIZ A;  1UBI A;  1E7U A;  2O2V A;  2KTR A;  3QAR A;  4DHJ B;  2O6V A;  3EEC A;  2KK8 A;  2PE9 A;  1WX7 A;  2K1F A;  3CMM B;  5E6N A;  3C0R B;  1A5R A;  4LDT D;  4OVV A;  1WGY A;  2MX2 A;  1XT9 B;  2LRU A;  2GBN A;  4HCP B;  1V81 A;  3NZS A;  3ECI A;  3L54 A;  1KOT A;  1L7Y A;  3QQ8 B;  4FJZ A;  3WAN A;  4DHZ B;  3PTF C;  4IC7 B;  1WJU A;  2JWZ A;  5C23 A;  2ZVO A;  1OEY J;  1WE6 A;  3AI5 A;  3H1U A;  1EF5 A;  1GNU A;  2YVC A;  2M8S A;  2M17 A;  2L0F A;  3QC8 B;  4KSK C;  2ZZP B;  3U8Z A;  4EEW A;  1TZ1 A;  3W1S A;  4E74 A;  3ZO5 B;  4PYU A;  1E8W A;  4KV2 A;  2AYO B;  1GC7 A;  3M95 A;  3B08 A;  1UH6 A;  2L05 A;  3UIP B;  3GOE A;  4I6N B;  3UGB B;  1GG3 A;  1I35 A;  5E6O A;  2LVQ A;  4IM3 A;  2WX1 A;  4MSM B;  2K8B A;  4EKU A;  5JZE B;  4I6L B;  1WZ0 A;  4ANV A;  5CHW A;  3RZW C;  5JHB A;  4FN2 A;  2DYM A;  3A9J A;  2YLM A;  4I6P A;  3TL5 A;  2KDF B;  2LGX A;  3DPD A;  1NDD A;  3JYU A;  3PRE A;  4II3 B;  2JXX A;  2KNB A;  2LI5 A;  3N30 A;  4DK5 A;  5LXH A;  1GJZ A;  1WXA A;  5CHF A;  1UBQ A;  3UF8 A;  4A3O A;  2VRR B;  2N9X A;  4G11 A;  5DPT A;  4ASW C;  4FA6 A;  2KLC A;  3BIN A;  2KC1 A;  1P98 A;  4OVU A;  2K8H A;  1E8Z A;  4HCN B;  4F8C B;  2DYB A;  5G55 A;  3RUI B;  2IYD B;  3V61 A;  4BKS D;  5J17 A;  2BYE A;  3VTW A;  1GUA B;  2HJ8 A;  2W9N A;  1P0R A;  3CSF A;  3VQI A;  2N1V A;  2AL6 A;  4K1R B;  2Z0E B;  4M8N A;  5CX3 A;  1RAX A;  3HM6 X;  2MLB A;  4GGQ A;  3O65 B;  2EKE C;  4IM2 A;  2D2Q A;  2D11 A;  2ZEQ A;  2N9E B;  2KX0 A;  1Z5S B;  3RZF A;  1YIW A;  3QA8 A;  4ANX A;  5G2N A;  2M1M A;  3DDC B;  3EHV A;  2IO0 B;  4IWQ A;  3DBR I;  3PHX B;  4DDI D;  2L00 B;  1UGM A;  1BT0 A;  2ZVN A;  2M0X A;  4LJP B;  3LJ3 A;  3RUL A;  2NPT B;  2QHO A;  4G3X B;  4IWP A;  2KWU B;  3KUZ A;  4GIV A;  4TQ1 A;  2IY1 B;  2OJR A;  1P3Q U;  3VUW A;  1IP9 A;  3EC8 A;  2KFK A;  3NHE B;  5DPR A;  2GBK A;  3KH0 A;  2JPH A;  3RD2 A;  4FHK A;  2KAN A;  3DVG X;  3KVF B;  2N1W A;  2NBW B;  4KSL C;  3WAL A;  4CHK A;  3H7P B;  4RM9 A;  4K7W A;  2DX5 B;  2K39 A;  1S1Q B;  3NS8 A;  4G0N B;  4MSQ B;  4W9C A;  3NOB A;  4NPN A;  4HXD A;  1VCB A;  2BKF A;  1WRD B;  2LVP A;  4P7I A;  4ZDV A;  2ZNV B;  3AU5 A;  1V9J A;  2ZPN A;  4J6I A;  2BYF A;  2NVU I;  1WJN A;  2OOB B;  2JT4 B;  2V4L A;  3IFW B;  2XK5 A;  3V60 A;  1WR1 A;  3QIJ A;  2LD9 A;  4EOY A;  3R7Q A;  4GDK A;  2IBI B;  2J0K A;  3WAP A;  4CYE A;  4N9F 4;  2ZNV C;  4NY0 A;  3UIN B;  2UWQ A;  2NS5 A;  2MA9 B;  3TCA A;  2DZK A;  1V80 A;  3RCZ A;  3U7D A;  2K8C A;  2WDT B;  1WI0 A;  3M3J A;  4IUM B;  5CHV C;  3ZDM C;  2MQJ A;  2MBB B;  4GDL B;  2PEA A;  4ZRI A;  4MGY E;  1Q5W B;  3VDZ A;  3A9K B;  5AZF A;  2RPQ A;  4ZYN A;  5FR6 A;  4FAD A;  1WGH A;  3APC A;  4FUL A;  3QWZ B;  2DZI A;  2ZCB A;  2N7D A;  3K9O B;  4WJQ A;  3ZW3 A;  1WJ4 A;  2KO3 A;  4LJO B;  1J19 A;  4KZ0 A;  2FNJ B;  2HE7 A;  3A1Q B;  3KYD D;  4MEL A;  4W9L A;  3RYT A;  4FHJ A;  2DZJ A;  4FLH A;  1ZGU B;  2ZPY A;  4KVG B;  4E3C A;  5AZH A;  4PYZ A;  4WWP A;  3VVW B;  2C60 A;  3APD A;  2NCN A;  4URK A;  1WX9 A;  3OJ4 B;  2BYV E;  4JIO U;  1V5T A;  2NR2 A;  3ZNH B;  4TQ0 A;  2J7Q B;  2JZZ A;  2RSU A;  4AOF A;  2KDB A;  4BBN C;  2MP2 B;  1LXD A;  1CMX B;  2AL3 A;  2LVO A;  2KWC A;  3ZRF A;  2MBQ A;  4W9K A;  2G45 B;  3SDL C;  3L10 B;  2KX3 A;  4M0W B;  3A4S C;  2G4S A;  3ML9 A;  3TJP A;  1E5W A;  2KQS A;  4MM3 A;  3DVN U;  4HWI B;  4KIK B;  4HLE A;  5HKH A;  3PSE B;  4W9I A;  4IG7 B;  3DOW A;  2KD0 A;  2FCM A;  4DBG A;  2KMC A;  4EUT A;  1H4R A;  1L2N A;  3ZTD A;  4MGZ E;  4HPL B;  2O2V B;  3VH4 B;  2KTR B;  3L0W B;  2O6V B;  1RFA A;  1OTR B;  1P9D U;  1F9J A;  1C3T A;  2FCS A;  2M4N A;  2LGD A;  3VTU A;  1E90 A;  1ISN A;  2NPT A;  3UQA A;  1WYW B;  1WXM A;  2C9W B;  4W9H A;  3PGE A;  4HDO A;  4G50 A;  4K7U A;  2NBU A;  3P2B A;  3PZD A;  4FJV B;  2LJ5 A;  1OQY A;  4AUQ C;  2MWS B;  1KJT A;  4JQW C;  2Z59 B;  3HM3 A;  2BKR B;  3JSV A;  2JY6 A;  1V49 A;  2CU1 A;  2XBB C;  1Q1O A;  2KJ6 A;  4EZJ A;  2JUO A;  2ASQ A;  2UYZ B;  2L8J A;  3AU4 A;  2O6V D;  5AEK B;  1ZW7 A;  2KJR A;  2DHZ A;  1WGG A;  2JRI B;  3IG3 A;  4PS8 A;  4KDL B;  2KZR A;  2MSE D;  3A9J B;  4DDG D;  2LAS A;  2BF8 B;  3AXC A;  2MBH A;  3OAW A;  3W1S C;  3TBL D;  4BKT A;  4W9E A;  2GBM A;  2RD0 A;  3ZRC A;  4NAW A;  1KLV A;  2DAJ A;  5CTR C;  2FID A;  3TIX A;  3R7R A;  3DVN V;  2KVR A;  2CHX A;  2KKC A;  4M8M A;  4F7Z A;  1YQB A;  2J0J A;  3PT2 B;  1WGR A;  1X1M A;  3L08 A;  1LM8 B;  2ZJD A;  3WAO A;  1SIF A;  1U4A A;  3R3M A;  3KUD B;  5DPW A;  1H8C A;  4TUU A;  3PVL A;  4MEM A;  4X57 B;  4ICV A;  5JH5 C;  2DYO A;  4NQL B;  4B95 A;  3H6N A;  4GU2 A;  1V2Y A;  3A9K A;  5LLI A;  1SE9 A;  2GMI C;  1JRU A;  4MH0 E;  3DBL I;  1NBF C;  1S3S G;  3K9P B;  4GN1 A;  2LXA A;  5D2M B;  1FXT B;  1WZ3 A;  2N7E A;  3V6E B;  3ZLZ A;  4DHZ E;  2PJH A;  2LXC A;  2AEH A;  4A20 A;  4ANW A;  3OJ3 A;  2L0T A;  1T0Y A;  2CR5 A;  4MJS B;  3A4R A;  5E6P A;  4F1S A;  2KQ7 A;  3A33 B;  2KFJ A;  1RRB A;  2MW5 A;  3Q3J A;  1VD2 A;  2IY0 B;  2ZCC A;  4IM0 A;  5L83 A;  2WYQ A;  3QCA A;  1V5O A;  4K7S A;  1ZKH A;  3HK0 A;  1WY8 A;  3DBH I;  2CKH B;  4BKS A;  4WJO A;  2L7R A;  3L13 A;  1EF1 A;  2FCN A;  2KOX A;  3SU8 X;  3X23 A;  1J8C A;  3OLM D;  2NBV B;  1WMH B;  1YJ1 A;  4ICU A;  3ONS A;  3PLV A;  4II2 B;  3W1Y A;  3ZNG C;  3VUX A;  4AP4 C;  2C7N B;  5BO4 B;  3PLU A;  3PRZ A;  2WWZ A;  4KDI C;  2CHZ A;  4NJ7 A;  1WX8 A;  3Q3F A;  1YD8 U;  4KIK A;  5C1Z A;  3LDZ E;  4HJK A;  3QK0 A;  4FJY A;  4HDQ A;  1WM3 A;  3CST A;  4AJY B;  1UZX B;  2XEW A;  1K8R B;  4B9K A;  5IA7 A;  1OEY A;  1WM2 A;  5JHA A;  4EFO A;  1WFY A;  4GB9 A;  2XK5 B;  1WH3 A;  2K6Q A;  5KHO A;  3T9L A;  2R2Q A;  2PE6 B;  1WGD A;  4GDK B;  4WWN A;  3ZNZ B;  1Q0W B;  2IZV B;  2KXJ A;  4MGI E;  4LCD E;  2LUE A;  2KC2 A;  1R4M I;  5D94 A;  2DAF A;  2KWV B;  4W9D A;  1I42 A;  1P1A A;  3U30 A;  3X0W A;  4RM8 A;  3SHQ A;  4EZL A;  3PV1 A;  1NI2 A;  3ALB A;  4DXA B;  3AUL A;  2K25 A;  4MDK E;  1YX5 B;  2REX A;  2MRP A;  1UD7 A;  4A3P A;  4EZK A;  4BOZ B;  4TKN A;  2KHW B;  3DBS A;  2DEN B;  1YX6 B;  2N4F A;  3MJW A;  4BBN F;  1M94 A;  2I1K A;  4XC2 A;  3ZDT A;  2K6D B;  4DHJ D;  2RR9 A;  3ML8 A;  5L95 C;  2Y5B B;  1MG8 A;  3IVF A;  3L16 A;  3VTV A;  2KTF A;  4WJP A;  4K81 A;  3VAW A;  3RT3 B;  1C1Y B;  4JLC A;  4NQK E;  2RGF A;  2AWT A;  1E7V A;  2FIF A;  4E71 A;  3CF6 E;  2A4Z A;  2C7H A;  2MBE A;  1WIA A;  2JZ3 B;  1IPG A;  2N9P C;  3DQV A;  1TBE A;  2DZM A;  5KHQ A;  2BPS A;  1EUV B;  2BWE S;  3N3K B;  4PS3 A;  2FUH B;  2B3A A;  2L3Z A;  3B1L X;  4KZC A;  4MGK E;  4NJ6 A;  4WAA A;  2V1Y A;  4GXB A;  4ZRJ A;  1WXV A;  2C5L C;  2EMT A;  4WWO A;  3H7P A;  3IBE A;  2MBO A;  2MCN B;  4B6W A;  2Z0D B;  2KN5 A;  2HD5 B;  3PS6 A;  1GC6 A;  3EFU A;  3KUC B;  4HPM B;  4IWO A;  3T8M A;  3KW5 B;  4GOC A;  1V6E A;  3ZKJ C;  1WF9 A;  3MTN B;  3H9D A;  1HE8 A;  3VHT C;  3KYC D;  2A5U A;  2JVC A;  2KJH B;  3QAQ A;  5J18 A;  4BFR A;  2D10 A;  1WE7 A;  2D3G A;  2LZ6 A;  2R2O A;  3IHP C;  1QZE A;  5DCN A;  3DCG A;  1AAR A;  2LWP A;  3PRM B;  4YL8 A;  2FAZ A;  3I3T B;  4MJS A;  2KLG A;  2C7M B;  1LQB A;  2KMA A;  1WJ6 A;  3ENE A;  2G3Q B;  4AWJ A;  3ZIM A;  5DPS A;  3VFK A;  2CS4 A;  1Z2M A;  3ZTC A;  3UIO B;  5TR5 A;  4GDL A;  1UEL A;  2CHW A;  1TGZ B;  4XX5 A;  1KM7 A;  2LRW A;  1SGH A;  2G4D B;  2JRH A;  4FBJ B;  3VUY A;  5D6J B;  3VXW A;  4XZ4 A;  1WMH A;  4HK2 A;  1V86 A;  3V62 A;  2JF5 A;  3L17 A;  3VH3 B;  2BWF A;  4ZRK A;  1E8Y A;  2IO1 B;  3ZUN A;  4WQO B;  2KDI A;  3TMP B;  2GOW A;  2PPH A;  3WAM A;  4CO7 A;  4DWF A;  1Y8R C;  1IYF A;  3JSV B;  1TTN A;  3MHS D;  1OGW A;  4ANU A;  5D7G A;  1WXS A;  3ZVV A;  3A1Q A;  1D3Z A;  4JL9 A;  4W9G A;  3B0A A;  4WJN A;  4GMV A;  1WR6 E;  3BY4 B;  3H7S A;  3D32 A;  2FCQ A;  1EO6 A;  3QHT A;  3QJZ A;  3M62 B;  3PPA A;  3NY5 A;  2D07 B;  4RMA A;  4W9F A;  2KDE B;  3DVG Y;  3QX1 A;  4NNJ B;  4BKG A;  2J0M A;  4HVB A;  5LXI B;  3V6C B;  2EMS A;  4GSW A;  4LDT B;  3GZN I;  4W9J A;  4TV3 A;  2MP2 A;  1J0G A;  2IO3 B;  5GMV A;  2KFK B;  3WA0 A;  3ZNI D;  4NAW B;  2LGY A;  4PS7 A;  2HTH A;  3JVZ X;  4BOS C;  5J2R A;  3R66 C;  1G6J A;  3UQB A;  1LFD A;  3NZU A;  1E8X A;  2L76 A;  4IW0 A;  4AJW A;  1RLF A;  3SD5 A;  2GBJ A; 
#chains in the Genus database with same CATH topology
 3HHM A;  1EWC A;  1JRO A;  1SJE D;  2JQR B;  5AZG A;  1XQQ A;  4DHJ B;  1UBI A;  3QAR A;  2KTR A;  2KK8 A;  4RGN A;  2WXG A;  3I57 A;  3CMM B;  1JWA D;  4LDT D;  4OVV A;  2GBN A;  1V81 A;  3NZS A;  3QQ8 B;  5E6J A;  3P1M A;  1C78 A;  2YVC A;  3SFE B;  2M17 A;  2L0F A;  1B1Z A;  1MVK A;  1AN8 A;  4EEW A;  4LLG M;  1E8W A;  2AYO B;  1VJK A;  3GOE A;  2JU6 X;  1XLO A;  1GG3 A;  3P4R B;  4MSM B;  5CHW A;  4FN2 A;  2DYM A;  4I6P A;  2LGX A;  2IJ0 A;  3DPD A;  2JXX A;  2KNB A;  4JX1 C;  4DK5 A;  1GJZ A;  5LXH A;  4S0R A;  2VZK B;  4A3O A;  2VRR B;  4FA6 A;  2G1E A;  1CK1 A;  2KLC A;  2WP9 B;  4CQN A;  2K8H A;  1E8Z A;  4HCN B;  2DYB A;  5G55 A;  3RUI B;  3BII D;  3VTW A;  3N9Y C;  1GUA B;  2BVC A;  4LNK A;  2W9N A;  3ZJV A;  2LJI A;  2Z0E B;  4M8N A;  2MLB A;  3WCQ A;  2EKE C;  4IM2 A;  1RM6 C;  1C4P A;  4B0E A;  3U2S C;  3Q3M C;  2M1M A;  2VZK D;  4EE2 A;  4YSZ B;  1KFY B;  2ZVN A;  3LJ3 A;  3IXS A;  4G3X B;  1E0Z A;  1P3Q U;  1IP9 A;  3EC8 A;  5DPR A;  2JPH A;  3RD2 A;  3DVG X;  2N1W A;  2H89 B;  4MSQ B;  1S1Q B;  4HXD A;  1VCB A;  4C80 A;  2ZPN A;  4J6I A;  2JT4 B;  1HEZ E;  2V4L A;  2FE8 A;  1WR1 A;  3RMK C;  2LD9 A;  1L4Z B;  2AX5 A;  3BYT B;  2D3B A;  3WAP A;  2WLB A;  2GRI A;  1EM7 A;  4CYE A;  1JCK B;  3UIN B;  5G5H A;  1ET6 A;  2W55 A;  1V80 A;  3U7D A;  3DBR B;  3DHG C;  3M3J A;  3ZDM C;  3W5U B;  4LNF A;  4GDL B;  4HPP A;  2KDM A;  1JWU D;  2KAJ A;  5AZF A;  4N58 A;  4YSX B;  2DZI A;  2W3S A;  2ZCB A;  1FPY A;  2N7D A;  1WJ4 A;  2FNJ B;  1N62 A;  2L1A A;  4MEL A;  4W9L A;  1L6U A;  2DZJ A;  1GPX A;  5AZH A;  3GB1 A;  3APD A;  3MJ5 A;  4WUR A;  2BS3 B;  3OJ4 B;  3OWE B;  2J7Q B;  4LNI A;  2EEL A;  2QJL A;  3AE9 B;  2MP2 B;  1LXD A;  2LVO A;  4XGA B;  3FC4 A;  1V97 A;  2INN E;  2WXL A;  4KIK B;  5HKH A;  3PSE B;  4W9I A;  3BK2 A;  2WXN A;  2IGD A;  2FCM A;  2WXH A;  1H4R A;  1L2N A;  4QAY A;  3BVZ A;  1OTR B;  4MAC A;  2LGD A;  2NPT A;  1ISN A;  3UQA A;  1WXM A;  3P2B A;  4FJV B;  1OQY A;  3AE7 B;  2JY6 A;  1V49 A;  1UWM A;  1NI3 A;  3TEX A;  3B9J A;  4TSS A;  1ZW7 A;  1YQ3 B;  4UDU C;  2V0G A;  2LAS A;  3OAW A;  3W1S C;  1J7B A;  1TKG A;  3RNA C;  4BKT A;  1AWD A;  4NAW A;  1KLV A;  2J53 A;  5CTR C;  2FID A;  3ZXR A;  3R7R A;  3DVN V;  4M8M A;  1TKE A;  2JX5 A;  1X1M A;  1ESF A;  3L08 A;  1LM8 B;  2WXO A;  5DPW A;  1L0X B;  3KUD B;  3VRA B;  1H8C A;  4TUU A;  1HA5 A;  3A9K A;  3SR6 A;  4MH0 E;  1JRU A;  3DBL I;  3Q14 C;  1FO4 A;  4L23 A;  1WRI A;  2RDG A;  2N7E A;  4DHZ E;  4ANW A;  4F1S A;  4MJS B;  1F77 A;  1K53 A;  3AH7 A;  1RRB A;  1YN4 A;  1VD2 A;  1TT5 B;  4K7S A;  2IPK D;  1ZKH A;  1WY8 A;  2CKH B;  3GE8 C;  1EF1 A;  2KOX A;  3OLM D;  3ONS A;  3PLV A;  3ZNG C;  5BO4 B;  4YTP B;  2WWZ A;  4KDI C;  2CHZ A;  3Q3F A;  1YD8 U;  5C1Z A;  3AB5 A;  1BUI C;  1L5P A;  3QK0 A;  1WM3 A;  3CST A;  1K8R B;  4B9K A;  1ROE A;  3ZQ4 A;  1WH3 A;  1WGD A;  1SE4 A;  2KXJ A;  2E6X A;  2KC2 A;  1HTQ A;  2DAF A;  3O13 A;  3RN9 C;  3U30 A;  3SHQ A;  3VR8 B;  2K25 A;  1TY0 A;  2V9H A;  2REX A;  4BOZ B;  1T0R C;  2BTE A;  3R2T A;  3MJW A;  1YX6 B;  2N4F A;  4PT5 A;  4RFB A;  4KKJ A;  2RR9 A;  3ML8 A;  1K52 A;  2KTF A;  2HDE A;  4BZA A;  1HXY D;  4JLC A;  2RGF A;  4WH4 A;  2A4Z A;  4B0M A;  1KTK A;  3DWM A;  3AN1 A;  1EUV B;  4M02 A;  4NJ6 A;  4ZHO A;  2V1Y A;  2OED A;  4WWO A;  1KRH A;  2L52 A;  2MBO A;  3RNF C;  4B6W A;  2M19 A;  3P42 A;  3RFZ B;  4IWO A;  3KW5 B;  3R8B A;  3VHT C;  3KYC D;  3QAQ A;  3C8Y A;  4RF1 A;  3IT4 B;  2R2O A;  1QZE A;  2PTL A;  3DCG A;  4YT0 B;  2LWP A;  2FAZ A;  3I3T B;  3ZYY X;  2C7M B;  3HRD D;  1MHX A;  4LNN A;  1QOG A;  3ZIM A;  2QIL A;  3HVD A;  4GDL A;  2LRW A;  2G4D B;  1UUP A;  1N5X A;  2JXT A;  3ZUN A;  4WQO B;  3N1Y C;  1N63 A;  3WAM A;  2PPH A;  4ZHP A;  2AQ3 B;  5D7G A;  2L32 A;  2K0P A;  1YN3 A;  4JL9 A;  1MFW A;  2MHJ A;  3QHT A;  3M62 B;  3PPA A;  2KDE B;  2Y5P A;  4NNJ B;  3NRZ A;  5LXI B;  2EMS A;  2MP2 A;  2IO3 B;  5GMV A;  2LGY A;  2DLB A;  3JVZ X;  4OZC A;  1SBB B;  1LFD A;  3NZU A;  1E8X A;  2L76 A;  4IW0 A;  3C19 A;  4S17 A;  3APF A;  3T3N A;  3M63 B;  1R4N I;  3N32 A;  2GBR A;  2X8X X;  2MJ3 A;  2WXR A;  2WXF A;  4BVU C;  2BGF A;  2L83 A;  3EEC A;  4AS1 A;  1WX7 A;  2KYW A;  5E6N A;  3BK1 A;  1WGY A;  1TYG B;  1TS2 A;  1YQ4 B;  3KLS X;  4TMA B;  3WAN A;  4DHZ B;  3PTF C;  5IOI A;  2ZVO A;  3VRB B;  1OEY J;  2KAC A;  2RDH A;  1WE6 A;  3AI5 A;  4DXF A;  1EF5 A;  1GNU A;  4KSK C;  4JWU C;  3U8Z A;  4KV2 A;  1J7A A;  2LHD A;  1J7C A;  3M95 A;  5H92 C;  1UH6 A;  5JZE B;  4A9A A;  2WX1 A;  1MPE A;  3RZW C;  5JHB A;  3Q2A C;  3ZJU A;  2MH7 A;  1NDD A;  3JYU A;  5I4D A;  1FRD A;  4II3 B;  3N30 A;  1WXA A;  3NVW A;  5EE0 A;  5CHF A;  1UBQ A;  3UF8 A;  4ASW C;  1F1H A;  1PYW D;  2KC1 A;  3EFC A;  3B2G A;  4OVU A;  4ACF A;  3BVM A;  2V3P A;  2LUM A;  4PK1 A;  3V61 A;  5IP4 D;  5J17 A;  2BYE A;  1TS4 A;  2AQ2 B;  3RPF C;  1TZO A;  2AL6 A;  2YEP F;  3AM9 A;  4FXC A;  2ZEQ A;  1Z5S B;  2WU2 B;  4A55 A;  3EA6 A;  4YTM B;  3EHV A;  5BYR A;  1N5W A;  3PHX B;  4OHJ A;  3FAH A;  2NPT B;  2KWU B;  2IY1 B;  3VUW A;  1I4H A;  3NHE B;  5EE1 A;  2INP E;  4ARC A;  4IKG A;  2KAN A;  3I9V 1;  4JE3 B;  4RM9 A;  4K7W A;  3NS8 A;  4W9C A;  1L0Y B;  2FBW B;  2LVP A;  3DHH C;  1NYR A;  3AU5 A;  2BYF A;  3V60 A;  3QIJ A;  2J0K A;  4N9F 4;  4R3D A;  4KKI A;  2NS5 A;  1LO5 D;  5H8Y E;  4MT5 A;  2PKO A;  4ZRI A;  1D4B A;  1Q5W B;  1HZ6 A;  3A9K B;  2RPQ A;  1C9F A;  5FR6 A;  1JAL A;  2BS2 B;  1WGH A;  1GB1 A;  3KQ4 A;  3K9O B;  3NZ3 A;  4KZ0 A;  3CIR B;  4E3C A;  4PYZ A;  1C79 A;  3Q3O C;  1XLQ A;  2LFI A;  2NR2 A;  2JZZ A;  2RSU A;  2IGG A;  1PGX A;  1MJD A;  4XWT A;  2JZP A;  2W54 A;  2G4S A;  1KLG D;  3ML9 A;  3TJP A;  1AW7 A;  1E5W A;  3DVN U;  4A8X C;  4HWI B;  5EE9 A;  1T3Q A;  2KD0 A;  4DBG A;  2KMC A;  3I63 C;  2O2V B;  1QT9 A;  3BZD B;  4HKQ A;  4NAM A;  1F9J A;  2FCS A;  2M4N A;  3VTU A;  1E90 A;  3U52 E;  2C9W B;  4W9H A;  4HDO A;  4K7U A;  1C77 A;  3PZD A;  4AUQ C;  2LJ5 A;  2MWS B;  1C76 A;  3HM3 A;  2CU1 A;  2XBB C;  1Q1O A;  2KJ6 A;  2JUO A;  4RCO A;  2MJE A;  2UYZ B;  1DOX A;  2L8J A;  5AEK B;  2KJR A;  2DHZ A;  2BS4 B;  4DQO C;  4KDL B;  2KZR A;  5JXV A;  2MSE D;  2ICI A;  3A9J B;  4DDG D;  2MBH A;  3TBL D;  3ZRC A;  2BB5 A;  3P4Q B;  1DGJ A;  3HVZ A;  4F7Z A;  3AE8 B;  1YQB A;  4P1C C;  2ZJD A;  3B2F A;  4JPS A;  3R3M A;  3PVL A;  4X57 B;  5JH5 C;  4ICV A;  2DYO A;  4NQL B;  5LLI A;  1SSN A;  2GMI C;  1UF0 A;  4MH8 A;  1YJI A;  3AEC B;  2INC C;  1WZ3 A;  3V6E B;  3ZLZ A;  2PJH A;  4A20 A;  4K3B A;  1T0Y A;  4N59 A;  2ZCC A;  2KMM A;  4IM0 A;  4OZA A;  3HK0 A;  4P6V F;  3SEB A;  3DBH I;  3FIL A;  4WJO A;  3L13 A;  1QLB B;  2FCN A;  2NBV B;  1YJ1 A;  1B9R A;  4II2 B;  4AP4 C;  2N9K A;  4M0W A;  3LDZ E;  4HJK A;  3TUO A;  5IA7 A;  2QC8 A;  3DBL B;  5JHA A;  2E3T A;  3NG0 A;  4GB9 A;  3T9L A;  5KHO A;  4L1B A;  2VH2 A;  4LCD E;  2LUE A;  2WQY B;  3U7Z A;  5D94 A;  4W9D A;  1I42 A;  1ZXH A;  1P1A A;  1YJJ A;  1L4D B;  3PV1 A;  5HG2 A;  4OW0 A;  1FXI A;  1RFK A;  1OFF A;  2M0A A;  2WXI A;  2MRP A;  4A3P A;  4TKN A;  4BBN F;  3ZDT A;  1MG8 A;  5HHD G;  3VAW A;  1BML C;  1BXT A;  4NQK E;  1ZOY B;  3GE3 C;  3SFD B;  1E7V A;  2C7H A;  1WIA A;  3RI7 C;  1IPG A;  2DZM A;  5KHQ A;  1F2R I;  3AEB B;  4ZRQ A;  4KZC A;  4WAA A;  4GXB A;  1WXV A;  2EMT A;  2V3N A;  4REZ A;  2BB6 A;  2HD5 B;  3PS6 A;  4H2A A;  3T8M A;  1V6E A;  1XCT L;  4MM3 B;  2JVC A;  5J18 A;  3NVZ A;  2D10 A;  1FNW A;  1WE7 A;  4N6E B;  5BMG A;  1IUE A;  1FIQ A;  2N0S B;  3GS2 A;  3Q8A A;  3PRM B;  1I4Q A;  2KMA A;  1WJ6 A;  4AWJ A;  2G3Q B;  1YN5 A;  3Q69 A;  1STE A;  1Z2M A;  1LGR A;  1UEL A;  2CHW A;  2J42 A;  5G5G A;  1FFV A;  4XZ4 A;  3U4E G;  4HK2 A;  3V62 A;  3L17 A;  3VH3 B;  2BWF A;  2KDI A;  2QEJ C;  4DWF A;  1Y8R C;  1IYF A;  3JSV B;  1TTN A;  3EGR A;  1C4C A;  1C4A A;  1L6V A;  1WR6 E;  1EO6 A;  4RMA A;  3QX1 A;  3AE3 B;  1F2R C;  4HVB A;  4A6Q A;  5AUI A;  3NVV A;  3WA0 A;  3J9C A;  5J2R A;  5D3D A;  3R66 C;  5IKC M;  1G6J A;  3TMP B;  1SEB D;  1E9M A;  1QIL A;  2KWD A;  2J52 A;  4JGH B;  4Q2J A;  3PHW B;  1XD3 B;  2IO2 B;  2O2V A;  1XEE A;  2PE9 A;  5GXG B;  2KT7 A;  4LNO A;  3RNE C;  2K1F A;  1E7P B;  2WNM A;  3C0R B;  3N1X C;  4ZYS A;  4D2K A;  1PFD A;  4RGO S;  3ECI A;  3L54 A;  1WXQ A;  1F52 A;  4FJZ A;  2JWZ A;  5C23 A;  2K9X A;  2B76 B;  4USA A;  1QQR A;  2VH1 A;  1TZ1 A;  1UNS A;  3W1S A;  4E74 A;  3ZO5 B;  2ZW0 A;  1GC7 A;  1EWY C;  3B08 A;  4I6N B;  3UGB B;  2LVQ A;  2K8B A;  1VR9 A;  1WZ0 A;  3A9J A;  2YLM A;  2G9H D;  3TL5 A;  2KDF B;  2WHI A;  2N7J A;  1UWX A;  3PRE A;  1WGK A;  1R4N B;  4C7Z A;  3N20 C;  3IAS 1;  4G11 A;  3BIN A;  2IYD B;  2H88 B;  2R61 A;  1A70 A;  3VQI A;  1XLP A;  1SE2 A;  5HFY A;  5CX3 A;  4GGQ A;  3HM6 X;  2WGS A;  5IN7 A;  2J4X A;  2D2Q A;  2LMC A;  2N9E B;  2KX0 A;  3RZF A;  4ANX A;  3E9S A;  3DDC B;  1T6B X;  4IWQ A;  4NJC A;  4DDI D;  3AEF B;  2L00 B;  1JWB D;  1VZ8 A;  2K5P A;  2QMT A;  2WDR B;  3RUL A;  2QHO A;  4WWM A;  5IO9 A;  1WSP A;  4TQ1 A;  3I5J C;  3VR9 B;  3KH0 A;  1TKY A;  2K22 A;  2DNF A;  2CJN A;  3KVF B;  2PIA A;  2NBW B;  4KSL C;  3WAL A;  4CHK A;  3H7P B;  1ZUD 2;  4NPN A;  1ZDX A;  2BKF A;  1WRD B;  2BT6 A;  1YOV B;  3IFW B;  2CJO A;  1K50 A;  3AV8 A;  3Q8B A;  4XE0 A;  2I2Y A;  3R7Q A;  1PDX A;  2IBI B;  3V05 A;  1IGC A;  2ZNV C;  4US9 A;  2MA9 B;  3TCA A;  3RCZ A;  2K8C A;  4IUM B;  3RNB C;  2MQJ A;  3AE6 B;  2MBB B;  1MG4 A;  2D5G A;  4J3O D;  4ZYN A;  1JWS D;  1Q10 A;  4YSY B;  4WJQ A;  3NUH B;  2HE7 A;  3A1Q B;  3KYD D;  3RYT A;  4OVZ A;  4FHJ A;  4ZRP A;  2JSV X;  4IDI A;  1ZGU B;  4ITK A;  4KVG B;  3Q3N C;  4WWP A;  4URK A;  3FIL B;  2PVO D;  3DHI C;  2IGH A;  4TQ0 A;  1QF6 A;  4AOF A;  1T0S C;  1CMX B;  2AL3 A;  3ZRF A;  2MBQ A;  4W9K A;  1PGB A;  3L10 B;  2KX3 A;  4M0W B;  4RGM A;  4MM3 A;  3AEA B;  4US8 A;  4HLE A;  1KLU D;  1VZ7 A;  1MHH E;  1CJE A;  4KGS A;  2PLP A;  2DBY A;  3VH4 B;  2O6V B;  2YEP B;  1WYG A;  1C3T A;  1I4P A;  1V1P B;  2ON8 A;  3PGE A;  1HQR D;  4G50 A;  2NBU A;  1I7H A;  1SB3 C;  4JQW C;  2W82 A;  3ABV B;  3Q8C A;  3JSV A;  2BKR B;  2ASQ A;  1RYJ A;  3AU4 A;  2O6V D;  2D3C A;  3IG3 A;  2WXK A;  1V1O A;  2I38 A;  4W9E A;  4HRS A;  2RD0 A;  2DAJ A;  2K3U A;  4ZOH C;  1WGR A;  2QSD A;  3ZGZ A;  3AE1 B;  1XF5 L;  4MEM A;  1PGA A;  4B95 A;  1T0Q C;  2LXA A;  3DWG C;  5D2M B;  1FXT B;  2LXC A;  2BQQ A;  3ETR A;  1KOT A;  2XN9 C;  2L0T A;  2CR5 A;  5E6P A;  3A4R A;  2KQ7 A;  3A33 B;  3Q3J A;  1WWT A;  2WYQ A;  1V5O A;  1NVI D;  1IBX B;  4RH6 A;  3SU8 X;  3X23 A;  2WS3 B;  1JWM D;  3VUX A;  3AEE B;  2XNA C;  4L2Y A;  3PLU A;  2ZW1 A;  4KGR A;  4HDQ A;  1UZX B;  4EFO A;  3AED B;  2XK5 B;  2K6Q A;  2IDY A;  4GDK B;  1UGJ A;  3ZNZ B;  1Q0W B;  2IZV B;  4MGI E;  3TEW A;  3TEY A;  1R4M I;  2KWV B;  4P16 A;  1JRP A;  3X0W A;  4RM8 A;  4EZL A;  3ZXV A;  3ALB A;  3AUL A;  1TS3 A;  1HZ5 A;  2MEK A;  1YX5 B;  3DBH B;  1UD7 A;  4EZK A;  4ARI A;  2KHW B;  3DBS A;  2DEN B;  3LYY A;  2I1K A;  4DHJ D;  5L95 C;  2LGS A;  4C56 C;  1FCL A;  1KH0 A;  3L16 A;  3VTV A;  4WJP A;  4K81 A;  5FR3 A;  3RT3 B;  1C1Y B;  3P63 A;  4LTU A;  1DOY A;  2AWT A;  2FIF A;  3CF6 E;  3P4P B;  2MBE A;  2JZ3 B;  1MI0 A;  2SEB D;  3Q6B A;  3DQV A;  1TBE A;  1TS5 A;  1VZ6 A;  2BPS A;  2FUH B;  4GLS C;  4MGK E;  4ZRJ A;  3H7P A;  3IBE A;  4KGT A;  2MCN B;  1OQQ A;  1GC6 A;  3MTN B;  3H9D A;  2FUG 1;  1HE8 A;  3Q8F A;  1NEN B;  1R7S A;  4BFR A;  5BMI A;  2D3G A;  2LZ6 A;  3AMZ A;  1FRR A;  5DCN A;  5TSS A;  1AAR A;  2PVG C;  4YL8 A;  5BYQ A;  1LQB A;  3ENE A;  5EE3 A;  3ZTC A;  3UIO B;  4WIP A;  2ACZ B;  2RDB C;  4XX5 A;  1KM7 A;  2JRH A;  2UU7 A;  3LXF A;  1I4G A;  3VUY A;  5D6J B;  1WMH A;  2JF5 A;  2IO1 B;  1SE3 A;  2GOW A;  4CO7 A;  2BYT A;  4LK0 M;  1OGW A;  4ANU A;  1QOA A;  3URY A;  1WXS A;  3ZVV A;  3A1Q A;  1D3Z A;  1ZPS A;  2HTM E;  3B0A A;  4WJN A;  3MC0 B;  4XDD A;  3BY4 B;  1E10 A;  3H7S A;  3D32 A;  3QJZ A;  2LEK A;  4YWG G;  4BKG A;  1I4X A;  2MJD A;  2J0M A;  3MHZ A;  3V6C B;  4WQM A;  4GSW A;  1E6E B;  4W9J A;  4C4V B;  3ZNI D;  4JWS C;  2JYE A;  3UQB A;  4AJW A;  3AE5 B;  1ZDV A;  1QKZ A;  2GBJ A;  3S2A A;  5EDS A;  3JW0 X;  2I1J A;  5IAA C;  2V3S A;  2NMQ A;  3PRP B;  2ONQ A;  2QIE B;  2WX0 A;  1VLB A;  3WIM A;  1PQS A;  3AE2 B;  3HIZ A;  1E7U A;  2O6V A;  4BAX A;  1Y56 A;  4XDC A;  3L4P A;  1A5R A;  2GB1 A;  2MX2 A;  1XT9 B;  4WAF A;  4YXD B;  2LRU A;  4HCP B;  1V1P A;  1L7Y A;  1QOB A;  4IC7 B;  1WJU A;  1YNT E;  3H1U A;  2M8S A;  3QC8 B;  2N9L A;  2ZZP B;  4PYU A;  2WXJ A;  3UIP B;  2L05 A;  2SAK A;  1I35 A;  4NZL B;  5E6O A;  4IM3 A;  4EKU A;  3KWL A;  4I6L B;  4ANV A;  1SIJ A;  2KVZ A;  3NS1 A;  3PZ8 A;  2PW9 A;  1N6Z A;  2LI5 A;  2HJ1 A;  2N9X A;  5DPT A;  4XYC A;  1P98 A;  4AQ7 A;  4F8C B;  4BKS D;  1P7E A;  4M01 A;  3BWU D;  2HJ8 A;  1P0R A;  3CSF A;  2N1V A;  3W2D A;  4HEA 1;  4K1R B;  1RAX A;  5MPO A;  3O65 B;  1DYQ A;  2D11 A;  1YIW A;  3QA8 A;  5G2N A;  1CZP A;  1VDV A;  2IO0 B;  3DBR I;  3UI3 A;  1FMA D;  1UGM A;  1BT0 A;  1ET9 A;  2M0X A;  1AYF A;  4LJP B;  1QOF A;  1IBX A;  1EU3 A;  4RGT A;  4IWP A;  1FM0 D;  1OQR A;  3KUZ A;  4GIV A;  2OJR A;  1NEK B;  3AEG B;  2KFK A;  2WXP A;  2GBK A;  4IOI E;  4FHK A;  2WDQ B;  1FXA A;  1GOZ A;  1M4V A;  2DX5 B;  2K39 A;  3NJT A;  4G0N B;  3NOB A;  3MFG A;  4P7I A;  2AQ1 B;  2ZNV B;  4ZDV A;  1V9J A;  2EKI A;  3P4S B;  2NVU I;  2JYT A;  1WJN A;  2OOB B;  2BBC A;  2XK5 A;  1T5X D;  4EOY A;  4GDK A;  2D3A A;  4NY0 A;  2UWQ A;  2WXM A;  2DZK A;  4M00 A;  2WDT B;  4HJG E;  1WI0 A;  1ENF A;  1ZP0 B;  2NTS A;  5CHV C;  4K3C A;  2PEA A;  4MGY E;  3VDZ A;  4FAD A;  3APC A;  1FCC C;  4FUL A;  1FEH A;  3QWZ B;  4C7Y A;  1CQV A;  3ZW3 A;  2DWQ A;  2JWU A;  3Q8E A;  4LJO B;  2KO3 A;  2CU3 A;  1J19 A;  1N61 A;  2OHF A;  1SXT A;  4FLH A;  2Y3A A;  2ZPY A;  3NVY A;  4DXG A;  3VVW B;  2C60 A;  2NCN A;  1N60 A;  1WX9 A;  2BYV E;  4JIO U;  1V5T A;  3ZNH B;  1JQ4 A;  2GI9 A;  4A90 A;  1D6E C;  2KDB A;  4BBN C;  5T8I A;  1TJE A;  2KWC A;  2G45 B;  3SDL C;  1K51 A;  2KN4 A;  3A4S C;  1XXG A;  2KQS A;  2QDF A;  2RMM A;  1FFU A;  1L0V B;  4IG7 B;  3DOW A;  4EUT A;  3ZTD A;  4MGZ E;  1IGD A;  2M56 B;  3IT6 B;  4HPL B;  2KTR B;  3L0W B;  1RFA A;  1EU4 A;  1P9D U;  2Y5C A;  3E56 A;  1SJH D;  5HI1 A;  1WYW B;  2RPV A;  2LHE A;  3BVG A;  1KJT A;  2Z59 B;  4RF0 A;  2WXQ A;  2KQ4 X;  1FNV A;  5AUK A;  4EZJ A;  3PZ7 A;  1ZE3 D;  5C3J B;  4HRO A;  2Z8L A;  3V3X A;  2JRI B;  1WGG A;  5LNK 1;  4PS8 A;  1ACC A;  3AXC A;  2BF8 B;  1JML A;  1D5M C;  2GBM A;  4C4V A;  1PUT A;  3TIX A;  2KVR A;  2BW2 A;  2CHX A;  2KKC A;  1YMH E;  3R2I A;  3W9C B;  2J0J A;  3PT2 B;  3WAO A;  1SIF A;  1U4A A;  3T3O A;  3AE4 B;  3N1Z C;  3H6N A;  4GU2 A;  1V2Y A;  1D5Z C;  1SE9 A;  2GLS A;  1NBF C;  3CWI A;  1S3S G;  3K9P B;  4GN1 A;  3EUB 2;  3PO0 A;  1V8C A;  5FKA C;  1FNU A;  2AEH A;  3OG5 A;  3OJ3 A;  1XCQ L;  3FKY A;  2KFJ A;  1GB4 A;  3MC8 A;  2MW5 A;  2IY0 B;  4P1B C;  1XLN A;  5L83 A;  3QCA A;  2QCZ A;  1VRA B;  4BKS A;  2L7R A;  2IND C;  1F0Z A;  1J8C A;  1WMH B;  4ICU A;  3W1Y A;  2C7N B;  3PRZ A;  2NTT A;  3MC9 A;  4NJ7 A;  1WX8 A;  4KIK A;  1P7F A;  4C00 A;  2PMV A;  3RNC C;  4FJY A;  1ZXI A;  4XWW A;  4AJY B;  2XEW A;  3GP7 A;  2LGI A;  1OEY A;  1WM2 A;  1WFY A;  2V4I B;  2R2Q A;  2PE6 B;  4WWN A;  4KX6 B;  2OJW A;  3HUI A;  1NI2 A;  4DXA B;  4MDK E;  1FD6 A;  1TY2 A;  3GZN B;  1M94 A;  4XC2 A;  2K6D B;  2WU5 B;  2X38 A;  2Y5B B;  1SF0 A;  3RNG C;  3IVF A;  1TIF A;  2WDV B;  3TSS A;  2Q5W D;  4E71 A;  4RNA A;  2N9P C;  3N3K B;  2BWE S;  5FK9 C;  4PS3 A;  1GAQ B;  2B3A A;  2L3Z A;  3B1L X;  1KF6 B;  4HKZ E;  2C5L C;  1JW9 D;  2Z0D B;  2KN5 A;  3EFU A;  3KUC B;  4HPM B;  3ZJT A;  4GOC A;  3TEZ A;  3ZKJ C;  1WF9 A;  1R4M B;  2A5U A;  2KJH B;  5C2T B;  4YTN B;  1I4R A;  1HTO A;  3IHP C;  1NYQ A;  3W5V B;  1RWS A;  4MJS A;  2KLG A;  1XO3 A;  3IAM 1;  3KWV A;  5DPS A;  3VFK A;  2CS4 A;  5TR5 A;  5BMH A;  2W3R A;  5BYS A;  1TGZ B;  1SGH A;  1DOI A;  4FBJ B;  3VXW A;  4O1N A;  1V86 A;  1D5X C;  4ZRK A;  1E8Y A;  3BYY B;  3H8H A;  3MHS D;  2TSS A;  3LB8 C;  4W9G A;  4GMV A;  5D3I B;  2FCQ A;  3NY5 A;  2D07 B;  4W9F A;  3DVG Y;  4OZB A;  4LDT B;  3GZN I;  4TV3 A;  1J0G A;  2KFK B;  3MP9 A;  4NAW B;  4PS7 A;  2HTH A;  4BOS C;  1RLF A;  3SD5 A; 
#chains in the Genus database with same CATH homology
 3S2A A;  5EDS A;  3JW0 X;  2I1J A;  3APF A;  5IAA C;  3M63 B;  3HHM A;  1R4N I;  2V3S A;  3N32 A;  4JGH B;  2GBR A;  3PRP B;  5AZG A;  2WX0 A;  3PHW B;  1XQQ A;  1XD3 B;  3WIM A;  4BVU C;  1PQS A;  2BGF A;  2IO2 B;  3HIZ A;  1UBI A;  1E7U A;  2O2V A;  2KTR A;  3QAR A;  4DHJ B;  2O6V A;  3EEC A;  2KK8 A;  2PE9 A;  1WX7 A;  2K1F A;  3CMM B;  5E6N A;  3C0R B;  1A5R A;  4LDT D;  4OVV A;  1WGY A;  2MX2 A;  1XT9 B;  2LRU A;  2GBN A;  4HCP B;  1V81 A;  3NZS A;  3ECI A;  3L54 A;  1KOT A;  1L7Y A;  3QQ8 B;  4FJZ A;  3WAN A;  4DHZ B;  3PTF C;  4IC7 B;  1WJU A;  2JWZ A;  5C23 A;  2ZVO A;  1OEY J;  1WE6 A;  3AI5 A;  3H1U A;  1EF5 A;  1GNU A;  2YVC A;  2M8S A;  2M17 A;  2L0F A;  3QC8 B;  4KSK C;  2ZZP B;  3U8Z A;  4EEW A;  1TZ1 A;  3W1S A;  4E74 A;  3ZO5 B;  4PYU A;  1E8W A;  4KV2 A;  2AYO B;  1GC7 A;  3M95 A;  3B08 A;  1UH6 A;  2L05 A;  3UIP B;  3GOE A;  4I6N B;  3UGB B;  1GG3 A;  1I35 A;  5E6O A;  2LVQ A;  4IM3 A;  2WX1 A;  4MSM B;  2K8B A;  4EKU A;  5JZE B;  4I6L B;  1WZ0 A;  4ANV A;  5CHW A;  3RZW C;  5JHB A;  4FN2 A;  2DYM A;  3A9J A;  2YLM A;  4I6P A;  3TL5 A;  2KDF B;  2LGX A;  3DPD A;  1NDD A;  3JYU A;  3PRE A;  4II3 B;  2JXX A;  2KNB A;  2LI5 A;  3N30 A;  4DK5 A;  5LXH A;  1GJZ A;  1WXA A;  5CHF A;  1UBQ A;  3UF8 A;  4A3O A;  2VRR B;  2N9X A;  4G11 A;  5DPT A;  4ASW C;  4FA6 A;  2KLC A;  3BIN A;  2KC1 A;  1P98 A;  4OVU A;  2K8H A;  1E8Z A;  4HCN B;  4F8C B;  2DYB A;  5G55 A;  3RUI B;  2IYD B;  3V61 A;  4BKS D;  5J17 A;  2BYE A;  3VTW A;  1GUA B;  2HJ8 A;  2W9N A;  1P0R A;  3CSF A;  3VQI A;  2N1V A;  2AL6 A;  4K1R B;  2Z0E B;  4M8N A;  5CX3 A;  1RAX A;  3HM6 X;  2MLB A;  4GGQ A;  3O65 B;  2EKE C;  4IM2 A;  2D2Q A;  2D11 A;  2ZEQ A;  2N9E B;  2KX0 A;  1Z5S B;  3RZF A;  1YIW A;  3QA8 A;  4ANX A;  5G2N A;  2M1M A;  3DDC B;  3EHV A;  2IO0 B;  4IWQ A;  3DBR I;  3PHX B;  4DDI D;  2L00 B;  1UGM A;  1BT0 A;  2ZVN A;  2M0X A;  4LJP B;  3LJ3 A;  3RUL A;  2NPT B;  2QHO A;  4G3X B;  4IWP A;  2KWU B;  3KUZ A;  4GIV A;  4TQ1 A;  2IY1 B;  2OJR A;  1P3Q U;  3VUW A;  1IP9 A;  3EC8 A;  2KFK A;  3NHE B;  5DPR A;  2GBK A;  3KH0 A;  2JPH A;  3RD2 A;  4FHK A;  2KAN A;  3DVG X;  3KVF B;  2N1W A;  2NBW B;  4KSL C;  3WAL A;  4CHK A;  3H7P B;  4RM9 A;  4K7W A;  2DX5 B;  2K39 A;  1S1Q B;  3NS8 A;  4G0N B;  4MSQ B;  4W9C A;  3NOB A;  4NPN A;  4HXD A;  1VCB A;  2BKF A;  1WRD B;  2LVP A;  4P7I A;  4ZDV A;  2ZNV B;  3AU5 A;  1V9J A;  2ZPN A;  4J6I A;  2BYF A;  2NVU I;  1WJN A;  2OOB B;  2JT4 B;  2V4L A;  3IFW B;  2XK5 A;  3V60 A;  1WR1 A;  3QIJ A;  2LD9 A;  4EOY A;  3R7Q A;  4GDK A;  2IBI B;  2J0K A;  3WAP A;  4CYE A;  4N9F 4;  2ZNV C;  4NY0 A;  3UIN B;  2UWQ A;  2NS5 A;  2MA9 B;  3TCA A;  2DZK A;  1V80 A;  3RCZ A;  3U7D A;  2K8C A;  2WDT B;  1WI0 A;  3M3J A;  4IUM B;  5CHV C;  3ZDM C;  2MQJ A;  2MBB B;  4GDL B;  2PEA A;  4ZRI A;  4MGY E;  1Q5W B;  3VDZ A;  3A9K B;  5AZF A;  2RPQ A;  4ZYN A;  5FR6 A;  4FAD A;  1WGH A;  3APC A;  4FUL A;  3QWZ B;  2DZI A;  2ZCB A;  2N7D A;  3K9O B;  4WJQ A;  3ZW3 A;  1WJ4 A;  2KO3 A;  4LJO B;  1J19 A;  4KZ0 A;  2FNJ B;  2HE7 A;  3A1Q B;  3KYD D;  4MEL A;  4W9L A;  3RYT A;  4FHJ A;  2DZJ A;  4FLH A;  1ZGU B;  2ZPY A;  4KVG B;  4E3C A;  5AZH A;  4PYZ A;  4WWP A;  3VVW B;  2C60 A;  3APD A;  2NCN A;  4URK A;  1WX9 A;  3OJ4 B;  2BYV E;  4JIO U;  1V5T A;  2NR2 A;  3ZNH B;  4TQ0 A;  2J7Q B;  2JZZ A;  2RSU A;  4AOF A;  2KDB A;  4BBN C;  2MP2 B;  1LXD A;  1CMX B;  2AL3 A;  2LVO A;  2KWC A;  3ZRF A;  2MBQ A;  4W9K A;  2G45 B;  3SDL C;  3L10 B;  2KX3 A;  4M0W B;  3A4S C;  2G4S A;  3ML9 A;  3TJP A;  1E5W A;  2KQS A;  4MM3 A;  3DVN U;  4HWI B;  4KIK B;  4HLE A;  5HKH A;  3PSE B;  4W9I A;  4IG7 B;  3DOW A;  2KD0 A;  2FCM A;  4DBG A;  2KMC A;  4EUT A;  1H4R A;  1L2N A;  3ZTD A;  4MGZ E;  4HPL B;  2O2V B;  3VH4 B;  2KTR B;  3L0W B;  2O6V B;  1RFA A;  1OTR B;  1P9D U;  1F9J A;  1C3T A;  2FCS A;  2M4N A;  2LGD A;  3VTU A;  1E90 A;  1ISN A;  2NPT A;  3UQA A;  1WYW B;  1WXM A;  2C9W B;  4W9H A;  3PGE A;  4HDO A;  4G50 A;  4K7U A;  2NBU A;  3P2B A;  3PZD A;  4FJV B;  2LJ5 A;  1OQY A;  4AUQ C;  2MWS B;  1KJT A;  4JQW C;  2Z59 B;  3HM3 A;  2BKR B;  3JSV A;  2JY6 A;  1V49 A;  2CU1 A;  2XBB C;  1Q1O A;  2KJ6 A;  4EZJ A;  2JUO A;  2ASQ A;  2UYZ B;  2L8J A;  3AU4 A;  2O6V D;  5AEK B;  1ZW7 A;  2KJR A;  2DHZ A;  1WGG A;  2JRI B;  3IG3 A;  4PS8 A;  4KDL B;  2KZR A;  2MSE D;  3A9J B;  4DDG D;  2LAS A;  2BF8 B;  3AXC A;  2MBH A;  3OAW A;  3W1S C;  3TBL D;  4BKT A;  4W9E A;  2GBM A;  2RD0 A;  3ZRC A;  4NAW A;  1KLV A;  2DAJ A;  5CTR C;  2FID A;  3TIX A;  3R7R A;  3DVN V;  2KVR A;  2CHX A;  2KKC A;  4M8M A;  4F7Z A;  1YQB A;  2J0J A;  3PT2 B;  1WGR A;  1X1M A;  3L08 A;  1LM8 B;  2ZJD A;  3WAO A;  1SIF A;  1U4A A;  3R3M A;  3KUD B;  5DPW A;  1H8C A;  4TUU A;  3PVL A;  4MEM A;  4X57 B;  4ICV A;  5JH5 C;  2DYO A;  4NQL B;  4B95 A;  3H6N A;  4GU2 A;  1V2Y A;  3A9K A;  5LLI A;  1SE9 A;  2GMI C;  1JRU A;  4MH0 E;  3DBL I;  1NBF C;  1S3S G;  3K9P B;  4GN1 A;  2LXA A;  5D2M B;  1FXT B;  1WZ3 A;  2N7E A;  3V6E B;  3ZLZ A;  4DHZ E;  2PJH A;  2LXC A;  2AEH A;  4A20 A;  4ANW A;  3OJ3 A;  2L0T A;  1T0Y A;  2CR5 A;  4MJS B;  3A4R A;  5E6P A;  4F1S A;  2KQ7 A;  3A33 B;  2KFJ A;  1RRB A;  2MW5 A;  3Q3J A;  1VD2 A;  2IY0 B;  2ZCC A;  4IM0 A;  5L83 A;  2WYQ A;  3QCA A;  1V5O A;  4K7S A;  1ZKH A;  3HK0 A;  1WY8 A;  3DBH I;  2CKH B;  4BKS A;  4WJO A;  2L7R A;  3L13 A;  1EF1 A;  2FCN A;  2KOX A;  3SU8 X;  3X23 A;  1J8C A;  3OLM D;  2NBV B;  1WMH B;  1YJ1 A;  4ICU A;  3ONS A;  3PLV A;  4II2 B;  3W1Y A;  3ZNG C;  3VUX A;  4AP4 C;  2C7N B;  5BO4 B;  3PLU A;  3PRZ A;  2WWZ A;  4KDI C;  2CHZ A;  4NJ7 A;  1WX8 A;  3Q3F A;  1YD8 U;  4KIK A;  5C1Z A;  3LDZ E;  4HJK A;  3QK0 A;  4FJY A;  4HDQ A;  1WM3 A;  3CST A;  4AJY B;  1UZX B;  2XEW A;  1K8R B;  4B9K A;  5IA7 A;  1OEY A;  1WM2 A;  5JHA A;  4EFO A;  1WFY A;  4GB9 A;  2XK5 B;  1WH3 A;  2K6Q A;  5KHO A;  3T9L A;  2R2Q A;  2PE6 B;  1WGD A;  4GDK B;  4WWN A;  3ZNZ B;  1Q0W B;  2IZV B;  2KXJ A;  4MGI E;  4LCD E;  2LUE A;  2KC2 A;  1R4M I;  5D94 A;  2DAF A;  2KWV B;  4W9D A;  1I42 A;  1P1A A;  3U30 A;  3X0W A;  4RM8 A;  3SHQ A;  4EZL A;  3PV1 A;  1NI2 A;  3ALB A;  4DXA B;  3AUL A;  2K25 A;  4MDK E;  1YX5 B;  2REX A;  2MRP A;  1UD7 A;  4A3P A;  4EZK A;  4BOZ B;  4TKN A;  2KHW B;  3DBS A;  2DEN B;  1YX6 B;  2N4F A;  3MJW A;  4BBN F;  1M94 A;  2I1K A;  4XC2 A;  3ZDT A;  2K6D B;  4DHJ D;  2RR9 A;  3ML8 A;  5L95 C;  2Y5B B;  1MG8 A;  3IVF A;  3L16 A;  3VTV A;  2KTF A;  4WJP A;  4K81 A;  3VAW A;  3RT3 B;  1C1Y B;  4JLC A;  4NQK E;  2RGF A;  2AWT A;  1E7V A;  2FIF A;  4E71 A;  3CF6 E;  2A4Z A;  2C7H A;  2MBE A;  1WIA A;  2JZ3 B;  1IPG A;  2N9P C;  3DQV A;  1TBE A;  2DZM A;  5KHQ A;  2BPS A;  1EUV B;  2BWE S;  3N3K B;  4PS3 A;  2FUH B;  2B3A A;  2L3Z A;  3B1L X;  4KZC A;  4MGK E;  4NJ6 A;  4WAA A;  2V1Y A;  4GXB A;  4ZRJ A;  1WXV A;  2C5L C;  2EMT A;  4WWO A;  3H7P A;  3IBE A;  2MBO A;  2MCN B;  4B6W A;  2Z0D B;  2KN5 A;  2HD5 B;  3PS6 A;  1GC6 A;  3EFU A;  3KUC B;  4HPM B;  4IWO A;  3T8M A;  3KW5 B;  4GOC A;  1V6E A;  3ZKJ C;  1WF9 A;  3MTN B;  3H9D A;  1HE8 A;  3VHT C;  3KYC D;  2A5U A;  2JVC A;  2KJH B;  3QAQ A;  5J18 A;  4BFR A;  2D10 A;  1WE7 A;  2D3G A;  2LZ6 A;  2R2O A;  3IHP C;  1QZE A;  5DCN A;  3DCG A;  1AAR A;  2LWP A;  3PRM B;  4YL8 A;  2FAZ A;  3I3T B;  4MJS A;  2KLG A;  2C7M B;  1LQB A;  2KMA A;  1WJ6 A;  3ENE A;  2G3Q B;  4AWJ A;  3ZIM A;  5DPS A;  3VFK A;  2CS4 A;  1Z2M A;  3ZTC A;  3UIO B;  5TR5 A;  4GDL A;  1UEL A;  2CHW A;  1TGZ B;  4XX5 A;  1KM7 A;  2LRW A;  1SGH A;  2G4D B;  2JRH A;  4FBJ B;  3VUY A;  5D6J B;  3VXW A;  4XZ4 A;  1WMH A;  4HK2 A;  1V86 A;  3V62 A;  2JF5 A;  3L17 A;  3VH3 B;  2BWF A;  4ZRK A;  1E8Y A;  2IO1 B;  3ZUN A;  4WQO B;  2KDI A;  3TMP B;  2GOW A;  2PPH A;  3WAM A;  4CO7 A;  4DWF A;  1Y8R C;  1IYF A;  3JSV B;  1TTN A;  3MHS D;  1OGW A;  4ANU A;  5D7G A;  1WXS A;  3ZVV A;  3A1Q A;  1D3Z A;  4JL9 A;  4W9G A;  3B0A A;  4WJN A;  4GMV A;  1WR6 E;  3BY4 B;  3H7S A;  3D32 A;  2FCQ A;  1EO6 A;  3QHT A;  3QJZ A;  3M62 B;  3PPA A;  3NY5 A;  2D07 B;  4RMA A;  4W9F A;  2KDE B;  3DVG Y;  3QX1 A;  4NNJ B;  4BKG A;  2J0M A;  4HVB A;  5LXI B;  3V6C B;  2EMS A;  4GSW A;  4LDT B;  3GZN I;  4W9J A;  4TV3 A;  2MP2 A;  1J0G A;  2IO3 B;  5GMV A;  2KFK B;  3WA0 A;  3ZNI D;  4NAW B;  2LGY A;  4PS7 A;  2HTH A;  3JVZ X;  4BOS C;  5J2R A;  3R66 C;  1G6J A;  3UQB A;  1LFD A;  3NZU A;  1E8X A;  2L76 A;  4IW0 A;  4AJW A;  1RLF A;  3SD5 A;  2GBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...