4N9F4

Crystal structure of the vif-cbfbeta-cul5-elob-eloc pentameric complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
95
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFDTFEALCIEPFSSPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for hijacking CBF-b and CUL5 E3 ligase complex by HIV-1 Vif
rcsb
source organism Homo sapiens
molecule tags Ligase/viral protein
molecule keywords Cullin-5
total genus 18
structure length 95
sequence length 98
chains with identical sequence D, H, J, P, W, X, e, g, m, s, y
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4n9f400
1XQQA 2RD0A 4ANUA 2K1FA 1Y8RC 4TQ0A 2N9EB 2HD5B 1V6EA 4JLCA 2L0FA 3ECIA 1MG8A 3Q3JA 1RAXA 1UZXB 3A4SC 2AL3A 2GBJA 2KTRB 5AEKB 1WJNA 3W1YA 1GUAB 3JSVA 4KSKC 2M8SA 3VUWA 5D94A 3SHQA 2XK5A 1VCBA 2O6VD 1A5RA 2K39A 4GSWA 3OJ4B 4IG7B 5CTRC 4FJYA 2RGFA 3VVWB 1E7UA 2D10A 4M8MA 3ZNZB 2C7HA 1OQYA 3UQBA 4G11A 3R3MA 4RM8A 5CX3A 3SU8X 3RCZA 3NZUA 3V61A 4ASWC 4JL9A 2G45B 5IA7A 3PREA 2KDBA 1KM7A 2IYDB 2L8JA 3CSTA 3X23A 4OVUA 4FLHA 1EUVB 2O6VA 3N3KB 2Z59B 2ZNVC 4ZRIA 2N1VA 3AULA 3HM6X 3PHWB 3VAWA 4E74A 5JH5C 4NJ7A 2EMTA 3UIPB 3ZNID 3RT3B 2L00B 2KX0A 4GDKB 2HE7A 1GJZA 4DDID 2DX5B 4GGQA 3MJWA 2M17A 4A3OA 3PVLA 5G55A 4GOCA 3ZNGC 1WJ4A 3N32A 2BWES 4HWIB 2LGDA 1WGDA 2YLMA 5DCNA 3TJPA 1LM8B 3A9JB 5E6NA 3A9KA 1WJUA 2DZMA 1WGHA 1P98A 3QAQA 4CHKA 3PLUA 1V80A 2ZVNA 4IM3A 1YJ1A 2ZEQA 3ML8A 1OEYJ 2RSUA 2FAZA 1R4NI 2KMCA 3OJ3A 2LXCA 2IO2B 3L16A 2RPQA 1M94A 2Z0EB 3PGEA 2CHWA 2JUOA 2DAJA 4HDQA 4BBNF 2DENB 2AEHA 2CS4A 1WX8A 4XC2A 2B3AA 5AZFA 1IYFA 2KWVB 4W9EA 2NS5A 2BYVE 3EECA 1WXMA 3ZKJC 5D2MB 3DOWA 2IY1B 1WX7A 3HK0A 3JW0X 2KC1A 1WF9A 4W9CA 1EF1A 3GOEA 4WWPA 3RUIB 4EZKA 5E6PA 4XX5A 1GC6A 2PEAA 3APFA 1JRUA 2G3QB 3L17A 3PRPB 1WJ6A 1PQSA 1IPGA 2NBUA 3H6NA 4FN2A 4MH0E 2KJRA 1WE6A 3K9OB 2DZIA 3LDZE 1L2NA 4NAWA 2I1KA 3S2AA 3PSEB 5J2RA 2C7MB 2R2OA 4PS8A 2GBKA 2BPSA 2V1YA 3VH4B 4IWQA 2MP2A 1WM2A 1WXSA 1J19A 5AZHA 2DHZA 3DQVA 4NQLB 3TL5A 1NI2A 2ZJDA 3T8MA 3VHTC 2MW5A 2UWQA 3A9KB 2EKEC 3IBEA 5DPWA 5D7GA 1LXDA 1E8YA 1GNUA 4CYEA 3VDZA 4N9F4 4MSMB 2BYFA 4I6NB 3TBLD 2LRWA 3ZIMA 3OLMD 2ZVOA 4ANVA 1V81A 2D11A 3PRZA 4W9DA 2L05A 4FULA 4HLEA 2KLCA 2L0TA 1UBQA 1WGYA 2PE9A 3DVGX 4HK2A 5IAAC 2LXAA 2IO0B 5KHQA 3NHEB 3QK0A 2D3GA 3CF6E 3H7SA 1YX6B 4MJSA 2FCSA 3KW5B 2LVQA 2KQ7A 4MM3A 4HCPB 1GG3A 2C5LC 4IUMB 3MHSD 4W9IA 3TMPB 4W9KA 3VUXA 4KDLB 2KNBA 2L7RA 4LJPB 1WYWB 4GB9A 2A5UA 4LCDE 1Q5WB 5TR5A 4GN1A 3HM3A 2MBQA 5JZEB 5JHBA 5G2NA 4NJ6A 3U30A 4XZ4A 2MX2A 3NZSA 4BKGA 2KZRA 3APDA 3JYUA 2BKFA 1E5WA 1WFYA 4W9JA 1LFDA 1QZEA 1CMXB 4B6WA 4BBNC 4GDLA 4II2B 1WY8A 4F1SA 4NPNA 3TIXA 1WGGA 3DBHI 2LGYA 2CHZA 2GBMA 2MBHA 3PV1A 4K81A 3AU5A 2GBNA 3DVGY 2JRIB 3QIJA 4ANWA 2GMIC 2KFKB 4IM2A 3DBSA 4W9GA 5J18A 4JQWC 1E7VA 4ZRKA 1J8CA 1KJTA 4BKSD 1E8WA 2ZCBA 3GZNI 2O2VB 5DPRA 2JVCA 5LLIA 2O6VB 3ZO5B 3IG3A 4HPLB 4HJKA 4DHZB 4WWOA 2JF5A 1V86A 2XEWA 2MRPA 2ASQA 4EUTA 5L83A 5LXHA 1S1QB 3L13A 1V9JA 1WM3A 2WX0A 1WR1A 2C60A 3A4RA 3WA0A 1ZW7A 4IC7B 2NR2A 1AARA 3ZNHB 4LDTB 2DYOA 2JT4B 3H7PB 1XT9B 2GOWA 4KZCA 4E3CA 3KYDD 3M3JA 4F7ZA 4ZYNA 3P2BA 2YVCA 3C0RB 2VRRB 3ZRCA 2KVRA 2KJ6A 4CO7A 4DXAB 4GXBA 1RLFA 3MTNB 3L54A 4LDTD 3ZDMC 2FNJB 3H9DA 1WE7A 1WGRA 2KWCA 1IP9A 2MWSB 3APCA 2KQSA 1RFAA 2LASA 1HE8A 4KIKB 4PYUA 3PPAA 2D2QA 3M95A 3ONSA 4PYZA 3RZFA 4F8CB 2K25A 3SD5A 2KK8A 5JHAA 2NCNA 4W9HA 1UH6A 4HVBA 1ISNA 1OEYA 2KD0A 2CU1A 2R2QA 4B95A 4OVVA 2XBBC 1NDDA 2DYMA 1H4RA 2PJHA 3R66C 3KVFB 1GC7A 3JVZX 2NBWB 4TKNA 1YQBA 4HDOA 1WI0A 1P0RA 2PE6B 4GDLB 2GBRA 2M4NA 1UBIA 4NAWB 1WZ0A 2KO3A 2FCMA 1WRDB 3V6EB 4A3PA 3AXCA 3PT2B 1WXVA 3ALBA 2Z0DB 3CMMB 1FXTB 5KHOA 4AJYB 4JIOU 2AL6A 2O2VA 3QA8A 2EMSA 2JWZA 1TZ1A 1E8ZA 3QCAA 4W9LA 2RR9A 3QHTA 1K8RB 4WJNA 1V5TA 3DVNV 5C23A 4MGIE 2FIFA 2N1WA 1E8XA 2D07B 2MSED 3KH0A 2REXA 3UF8A 3JSVB 4GDKA 3W1SC 2K6DB 2JZ3B 2DZJA 2NPTB 3WIMA 5DPTA 3I3TB 4MJSB 2N9PC 2MA9B 1C3TA 1WXAA 3VFKA 3ZRFA 1KLVA 2FCQA 2JPHA 3RZWC 3ENEA 3T9LA 1VD2A 3A1QA 2KDFB 4X57B 3ZLZA 3NS8A 1SE9A 2IBIB 2J0KA 2LRUA 4HCNB 4FBJB 2NVUI 1TBEA 2V4LA 2N7DA 1WZ3A 2PPHA 4MELA 3ZUNA 4I6PA 1L7YA 1F9JA 3V62A 2QHOA 3M63B 1RRBA 4AWJA 5C1ZA 4DDGD 2DZKA 4WAAA 3NOBA 2IY0B 2WWZA 2WYQA 3VQIA 4EZJA 1KOTA 4M0WB 2IO3B 4EKUA 1UGMA 3PZDA 4E71A 4KZ0A 3ZTDA 2I1JA 4YL8A 3L08A 3U7DA 5EDSA 1U4AA 2JXXA 1R4MI 2KTFA 2A4ZA 1I35A 2KJHB 2M0XA 3A9JA 3ZW3A 5CHFA 2BKRB 1WH3A 4ZRJA 3QARA 3DDCB 1T0YA 3PS6A 2MCNB 2BYEA 4TV3A 3VH3B 3QQ8B 1YIWA 3DCGA 3AU4A 2LVOA 5D6JB 2N9XA 2DAFA 4K1RB 3BY4B 5AZGA 3K9PB 4RM9A 2OJRA 3WAMA 3WANA 1J0GA 3L0WB 4J6IA 3X0WA 2KMAA 1LQBA 2M1MA 2J0JA 3CSFA 3KYCD 1ZKHA 3ZDTA 2KDEB 2W9NA 3B1LX 2KWUB 3QWZB 4W9FA 4NNJB 1WMHA 2XK5B 3U8ZA 3IFWB 2N4FA 1H8CA 2BWFA 3EC8A 2Y5BB 1YX5B 3QC8B 4WJOA 3WALA 4DWFA 3IVFA 4BOSC 4G0NB 2HJ8A 4KDIC 5DPSA 2LI5A 2NBVB 3O65B 3PLVA 3IHPC 1Z2MA 2WDTB 3QJZA 4HPMB 4FADA 3VTWA 2CHXA 4AUQC 2J7QB 4BKSA 5HKHA 4AOFA 3UGBB 3A1QB 1WX9A 4WJQA 4KIKA 3KUZA 4PS3A 2CKHB 4RMAA 3ZVVA 3N30A 4HXDA 4I6LB 4IM0A 3L10B 5CHWA 2HTHA 3HIZA 1TTNA 3UINB 4BVUC 1XD3B 1BT0A 4PS7A 4ANXA 4GMVA 3M62B 2KHWB 1UD7A 2L76A 4MEMA 2IZVB 5LXIB 1YD8U 3V6CB 3RYTA 3OAWA 3DBLI 4TUUA 2JY6A 3H7PA 3W1SA 2KXJA 2KDIA 2K8CA 2KLGA 4NQKE 1C1YB 3UQAA 4II3B 1WR6E 4FJZA 1Q0WB 2ZNVB 3BINA 2BGFA 2ZCCA 2L3ZA 2LVPA 3SDLC 3EHVA 1V2YA 2FUHB 4P7IA 3VTUA 3WAOA 1D3ZA 3UIOB 2MQJA 2LJ5A 1E90A 2AYOB 4KVGB 1Q1OA 4MGKE 4FA6A 4DK5A 4WQOB 4AP4C 3EFUA 1S3SG 4IWOA 3WAPA 2ZPNA 5J17A 4FHJA 4K7SA 3PHXB 5FR6A 2UYZB 2J0MA 2G4DB 2JRHA 4IW0A 4DBGA 3R7RA 4NY0A 4G50A 4BFRA 2MBEA 4BKTA 3LJ3A 2C7NB 3RD2A 2FIDA 3VUYA 1WMHB 2C9WB 2BF8B 3KUDB 1P3QU 2KTRA 4EOYA 4A20A 2K8HA 5L95C 4KV2A 4DHJD 2LGXA 2MP2B 2KKCA 3DVNU 2OOBB 2KOXA 4FHKA 2CR5A 1OTRB 2LWPA 4DHZE 1EF5A 2KANA 3TCAA 3QX1A 3AI5A 3RULA 3D32A 1UELA 2IO1B 2K8BA 4M8NA 2KFJA 2N7EA 4DHJB 4FJVB 3B0AA 3VTVA 2ZZPB 2KX3A 4WJPA 5GMVA 3PTFC 2AWTA 5CHVC 3HHMA 1OGWA 4GIVA 2G4SA 2WX1A 3H1UA 4G3XB 2KN5A 1EO6A 1V49A 2MBBB 4EZLA 1P1AA 1X1MA 4ICUA 3NY5A 4TQ1A 4AJWA 4ZDVA 2MLBA 4B9KA 2NPTA 4MSQB 3PRMB 4MGYE 1Z5SB 2LD9A 1ZGUB 4WWNA 3KUCB 4ICVA 4K7WA 5E6OA 3V60A 3VXWA 1TGZB 2JZZA 4URKA 1P9DU 1SIFA 2LUEA 2MBOA 4MDKE 2FCNA 4MGZE 4BOZB 2KC2A 5BO4B 1NBFC 3ML9A 2LZ6A 4GU2A 4EEWA 4K7UA 1I42A 1G6JA 2KFKA 3DBRI 3A33B 2V3SA 4EFOA 4LJOB 1SGHA 2ZPYA 3B08A 3ZTCA 1WIAA 3DPDA 4KSLC 3R7QA 4JGHB 3Q3FA 2DYBA 2K6QA 1V5OA 4IWPA
chains in the Genus database with same CATH superfamily
2N9EB 2HD5B 1BUIC 1V6EA 2GI9A 1N5XA 1HZ6A 1VJKA 4WWMA 5AEKB 3W1YA 1GUAB 1C4CA 3JSVA 4KSKC 4WAFA 4WIPA 3VUWA 5D94A 4UDUC 3SHQA 2XK5A 1E7UA 1N62A 4M8MA 3ZNZB 5AUIA 1OQYA 2LGSA 4RM8A 5CX3A 5LNK1 3RCZA 3NZUA 4ASWC 2QIEB 1XEEA 3Q8EA 5IA7A 1K53A 1YMHE 2KDBA 2L8JA 3CSTA 2Y3AA 3X23A 3N1ZC 4OVUA 5HHDG 4FLHA 3PO0A 2KMMA 2Z59B 2ZNVC 3PHWB 3HM6X 3VAWA 5JH5C 1FXIA 2M56B 3RT3B 3TUOA 4DDID 4GGQA 4A3OA 2WXPA 5G55A 3N32A 4HWIB 3TJPA 4KKJA 1YJ1A 2ZEQA 3ML8A 2FAZA 1R4NI 2KMCA 1GOZA 2Z0EB 2NTTA 3ZJVA 2JUOA 2CS4A 5AZFA 2B3AA 4C56C 1IYFA 2DNFA 4W9EA 3DOWA 1QKZA 1XF5L 3JW0X 4YTPB 3TEXA 4LNIA 5E6PA 4XX5A 1GC6A 3APFA 1JRUA 4MH0E 1PQSA 1IPGA 2W3SA 1XLOA 3K9OB 1L4ZB 3S2AA 2C7MB 1FEHA 1TJEA 1WM2A 3TL5A 3ZQ4A 3RNFC 2MW5A 3A9KB 2EKEC 4BZAA 1LXDA 1ET6A 1E8YA 1JCKB 1GNUA 2BYFA 2WS3B 3VRAB 3ZIMA 3OLMD 1L5PA 3PRZA 3HRDD 2MHJA 1UBQA 1WGYA 2PE9A 3BYTB 3VR8B 1WYGA 2D3GA 1NI3A 2WXHA 1YX6B 3H7SA 4MJSA 2ON8A 1MJDA 1T3QA 1BXTA 2KQ7A 4W9IA 1AN8A 2BS3B 2DWQA 2VH2A 3MP9A 4YT0B 3HM3A 3R2TA 2MBQA 1EWCA 3RNEC 5G2NA 4NJ6A 2MX2A 3APDA 1WFYA 3DHGC 1QZEA 4B6WA 4GDLA 1V8CA 2WU2B 1VRAB 2CHZA 1AWDA 4K81A 2AX5A 2JRIB 1EU4A 3QIJA 2IGGA 4XDCA 2KFKB 4ZHOA 5J18A 2INDC 4ZRKA 3GE3C 2O2VB 5DPRA 5T8IA 4HJKA 2X8XX 4WWOA 2MRPA 5LXHA 1S1QB 3L13A 1V9JA 1WM3A 2C60A 1ZW7A 4IC7B 3ZNHB 1KF6B 2KVZA 3R2IA 2QEJC 2KVRA 2KJ6A 4CO7A 1VZ8A 3MTNB 3L54A 1SJHD 1FM0D 3ZDMC 1CQVA 4ZHPA 3H9DA 2KQSA 1ROEA 3PPAA 2D2QA 4F8CB 2K25A 3SD5A 2KK8A 1FO4A 2DBYA 1TT5B 2KD0A 2RPVA 2DYMA 2WXLA 2W82A 3KVFB 1SF0A 1YQBA 1JWSD 2LUMA 1C77A 1TY2A 3AE5B 1UBIA 4LTUA 2FCMA 1WRDB 3V6EB 1D6EC 1D4BA 3DBLB 3AE6B 2AL6A 2O2VA 3QA8A 2EMSA 1TZ1A 1XCQL 3DVNV 3DHHC 3AEDB 2FIFA 2N1WA 2D07B 2MSED 3UF8A 3JSVB 2PW9A 1N60A 3I3TB 1C3TA 1WXAA 3RNGC 2JPHA 3ENEA 4X57B 4DQOC 1JMLA 2J0KA 3FILA 4ARCA 5IOIA 2NVUI 4MELA 3V62A 1C4AA 2DZKA 3C8YA 1I4GA 1KOTA 4EKUA 4E71A 4XDDA 1IBXA 3U7DA 5EDSA 1TY0A 1R4MI 2KTFA 1I35A 2BKRB 1SB3C 3IAS1 1LGRA 3E56A 3PS6A 3B2GA 4B0MA 1HXYD 1PFDA 3AM9A 3BVGA 5AZGA 3K9PB 3WAMA 3X0WA 4J6IA 3Q69A 1P7FA 1LQBA 3B2FA 3CSFA 3KYCD 3ZXRA 1ZKHA 2KDEB 1QOGA 1WMHA 3E9SA 2IGDA 1I4QA 1KRHA 2RDGA 3QC8B 3WALA 2ACZB 4DWFA 5DPSA 1UNSA 2NBVB 4XWWA 3EUB2 4NJCA 3O65B 3PLVA 2WDTB 3QJZA 3VTWA 2CHXA 3FILB 2JZPA 1T0QC 1WX9A 2CKHB 4RMAA 4HXDA 3Q8AA 4IM0A 2Z8LA 3L10B 3HIZA 1TTNA 4A55A 1XD3B 4MEMA 3Q8BA 1RYJA 3I5JC 3H7PA 2WQYB 2I2YA 2B76B 3UQAA 1KLUD 3TSSA 5BMGA 3OG5A 2N9KA 4EE2A 1QT9A 5FKAC 3VTUA 4A8XC 1ACCA 3NVZA 4KVGB 2PLPA 4RGMA 1J7AA 2G9HD 1S3SG 5BMIA 5EE1A 2JRHA 3R7RA 1UWMA 3Q3MC 4NY0A 3ETRA 4BKTA 2KDMA 2JU6X 1RWSA 3VUYA 3W5VB 5JXVA 3EA6A 2BB6A 2LMCA 3U4EG 3ZJTA 2KKCA 4FHKA 1V1PA 2KANA 2KWDA 1MG4A 1L6VA 2K8BA 2N7EA 3VTVA 2ZZPB 2KX3A 3AE9B 5GMVA 3HHMA 4HKZE 3ABVB 3BWUD 1EO6A 1X1MA 1SXTA 1L0XB 1AW7A 4B9KA 2AQ1B 3P4QB 4MGYE 1Z5SB 3KUCB 4ICVA 5E6OA 1NYRA 1TGZB 2KAJA 2H89B 2VZKB 4US9A 4BOZB 3IT6B 3ML9A 4EEWA 2KFKA 3DBRI 1YJJA 2G1EA 4EFOA 2ZPYA 3ZTCA 1WRIA 1WIAA 1P7EA 3Q3FA 1D5XC 4AS1A 2M0AA 1ZE3D 1Y8RC 3AE3B 3Q3NC 4JLCA 5TSSA 1QOFA 2AL3A 1XO3A 2KTRB 3PZ7A 4KGRA 2O6VD 2CU3A 1A5RA 4IG7B 5CTRC 2C7HA 4G11A 3R8BA 1V1PB 3PZ8A 1KM7A 4WURA 1QQRA 2V4IB 4ZYSA 1ZDVA 4J3OD 1FIQA 2IPKD 2L00B 5AUKA 4GDKB 2M17A 4GOCA 1WJ4A 3AB5A 3EFCA 5E6NA 3PLUA 1V80A 1HA5A 1B1ZA 2LXCA 4YSXB 2J53A 3L16A 1M94A 2CHWA 4RCOA 2DAJA 4HDQA 4BBNF 2DENB 1ESFA 4RF0A 3AN1A 3ZKJC 1WX7A 3HK0A 4DDGD 2HTME 3AE2B 3GOEA 4TMAB 4EZKA 2PEAA 1C4PA 3L17A 1WJ6A 4FN2A 1PYWD 4NAWA 2I1KA 2NTSA 3PSEB 2N9LA 5J2RA 1ZXHA 2GBKA 3VH4B 4IWQA 1WXSA 2DHZA 1YJIA 1TZOA 2N7JA 3DQVA 1NI2A 3VHTC 2UWQA 2JX5A 5DPWA 2VH1A 4N9F4 4I6NB 2WDRB 1I4PA 3TBLD 2JWUA 2L05A 4HLEA 2KLCA 3KLSX 3Q14C 1F0ZA 1NYQA 2IO0B 1KTKA 4DXGA 4LK0M 4A9AA 3DWMA 4S17A 4D2KA 1D5ZC 1RFKA 2LVQA 4MM3A 2IGHA 2XNAC 3NG0A 2X38A 4C7ZA 4IUMB 3MHSD 4W9KA 4KDLB 2M19A 2KNBA 1FNWA 1XLQA 1GPXA 2RMMA 5JHBA 4H2AA 4Q2JA 3U30A 4YTMB 1KLGD 4BKGA 3NVWA 3I63C 2KZRA 1E5WA 1IGCA 1LFDA 4BBNC 2J52A 1TYGB 3TIXA 1FCLA 3DBHI 2GBMA 2GBNA 4S0RA 4LNOA 4IM2A 3DBSA 1SE3A 1E7VA 1FCCC 1KJTA 1E8WA 2JVCA 3ZO5B 3IG3A 2JF5A 1V86A 4EUTA 5GXGB 1ZP0B 3BYYB 1XXGA 1TKGA 2YEPB 1MVKA 1WR1A 1YQ4B 3A4RA 3V05A 4US8A 2JT4B 4E3CA 4ZYNA 3V3XA 2VRRB 4LDTD 1WE7A 2KWCA 1PGXA 4PYUA 1UUPA 3AE7B 3ONSA 4PYZA 3AV8A 2NCNA 4W9HA 1UH6A 4HVBA 2CU1A 2LHDA 4OVVA 2XBBC 2Y5PA 3R66C 2NBWB 5G5HA 1WI0A 1P0RA 2PE6B 2GBRA 2M4NA 1JWUD 4TSSA 1YQ3B 1UF0A 3H8HA 1WXVA 2Z0DB 5KHOA 1FXTB 3AEEB 1E8ZA 4W9LA 1K8RB 1F2RC 1V5TA 1E10A 1E8XA 5DPTA 2N9PC 3T3NA 4C80A 3ZRFA 2FCQA 5BYSA 1VD2A 3ZLZA 4OZCA 2IBIB 4XWTA 4JWSC 1L7YA 4AWJA 2QHOA 1RRBA 3URYA 3SEBA 4M02A 4WAAA 4EZJA 4M0WB 3PZDA 3ZTDA 4YL8A 3L08A 3BVZA 1U4AA 2A4ZA 3U52E 2KJHB 3NZ3A 3RMKC 4ZRJA 4HKQA 1T0YA 3NRZA 2K5PA 1CJEA 2BBCA 3QQ8B 3P42A 2ONQA 2N9XA 2DAFA 3P4SB 2OJRA 3DWGC 3WANA 4KKIA 1SBBB 4FXCA 2KMAA 2M1MA 1IBXB 2J0JA 3NJTA 3ZDTA 4MACA 5D3IB 2PMVA 1OQQA 2MJEA 1FMAD 2BWFA 1YX5B 3RN9C 2WXRA 3L4PA 3IVFA 4BOSC 4G0NB 4HPMB 5HKHA 2J7QB 4AOFA 3KWLA 1XLNA 1SEBD 4WJQA 2W3RA 4YTNB 2JXTA 3UINB 5BMHA 2FBWB 4PS7A 2IJ0A 3GP7A 1EM7A 1TKEA 4RGTA 4HROA 1Q10A 2ZNVB 2BGFA 2ZCCA 2LVPA 1V2YA 1HEZE 2FUHB 3O13A 3RFZB 3WAOA 1D3ZA 2MQJA 2LJ5A 4N59A 4MGKE 4B0EA 4FA6A 4IWOA 2ZPNA 3Q8FA 3AEAB 4K7SA 3PHXB 1TS2A 4IW0A 3VRBB 2C7NB 2FIDA 2XN9C 2LJIA 2C9WB 2BF8B 1GAQB 3VR9B 2KTRA 3UI3A 1YOVB 2LGXA 2MP2B 2CR5A 3LXFA 1EF5A 4OZAA 2Y5CA 2BT6A 3ZXVA 3U7ZA 4YWGG 3B0AA 2WDQB 1T0SC 2AWTA 3B9JA 2V0GA 3IT4B 2G4SA 2WX1A 1JQ4A 1YN4A 4R3DA 1ZPSA 4EZLA 3CIRB 1P1AA 4ICUA 1WXQA 4RNAA 2LD9A 4WWNA 1VZ6A 3U2SC 3V60A 1SIFA 3MC9A 2FCNA 4ZRPA 3BK2A 5BO4B 1NBFC 2KN4A 2LZ6A 1C76A 2V3SA 3DHIC 3B08A 4KSLC 3R7QA 4K3CA 1F1HA 4IWPA 2RD0A 2L83A 2K1FA 1V97A 4P1BC 3BK1A 3MHZA 2L0FA 1UZXB 2E6XA 2GBJA 1WJNA 3I57A 4RFBA 3BVMA 1VCBA 2K39A 4GSWA 3OJ4B 2RGFA 3R3MA 1N63A 3SU8X 4JL9A 3AMZA 1I4HA 2IYDB 1PUTA 1C78A 3AEGB 4P1CC 2HDEA 1SJED 3N3KB 2V3NA 4ZRIA 3NUHB 3I9V1 2N1VA 3AULA 2WLBA 4E74A 4NJ7A 3UIPB 3ZNID 3C19A 2KX0A 1GJZA 2KT7A 3ZNGC 5HI1A 1FPYA 2BWES 1KH0A 2FUG1 4ITKA 1FRDA 2BW2A 2YLMA 5DCNA 5FR3A 1E9MA 1LM8B 1N5WA 3A9KA 2DZMA 1WGHA 4MM3B 5H92C 2RSUA 1GB1A 2QSDA 2IO2B 2RPQA 2WNMA 3PGEA 3AEFB 5G5GA 4YXDB 2QCZA 1WX8A 2KWVB 4A6QA 2NS5A 1TS3A 4NAMA 2BYVE 1WXMA 2NMQA 4WWPA 4W9CA 1EF1A 5MPOA 2G3QB 3PRPB 3H6NA 2NBUA 1L2NA 4BAXA 2R2OA 4PS8A 3GB1A 1VZ7A 4NQLB 2WHIA 2ZJDA 3IBEA 2QMTA 4CYEA 4LNFA 3RNAC 4JPSA 1V81A 4W9DA 3LYYA 1V1OA 3DVGX 1VDVA 5IAAC 2LXAA 4RH6A 2H88B 2W55A 3CF6E 2FCSA 3KW5B 4N6EB 2QDFA 4HCPB 1GG3A 2TSSA 1FFUA 4IOIE 2D3BA 1DYQA 1N6ZA 1WYWB 2A5UA 1Q5WB 5TR5A 2SEBD 4GN1A 3N1YC 4II2B 2GLSA 1WY8A 4F1SA 4C00A 4NPNA 2JSVX 2LGYA 2MBHA 3PV1A 3AU5A 3DVGY 5H8YE 2GMIC 4W9GA 2QILA 1TS4A 1J8CA 3TEYA 3GZNI 5EE0A 4DHZB 4HPLB 2XEWA 2ASQA 5HG2A 2BS4B 1DOXA 1NENB 2LEKA 4A90A 3CWIA 2WX0A 3J9CA 3WA0A 3IAM1 2NR2A 4LDTB 2W54A 4RGNA 4KZCA 3KYDD 5EE3A 1VLBA 4F7ZA 4HEA1 2YVCA 4USAA 3BZDB 1ZXIA 4DXAB 1RLFA 4L1BA 2FNJB 1WGRA 1IP9A 2MWSB 3APCA 1RFAA 1ET9A 1MHHE 3RZFA 1A70A 4LNKA 2L1AA 2KACA 4B95A 4L23A 1NDDA 1H4RA 2INCC 3JVZX 4TKNA 4HDOA 4GDLB 4NAWB 3KQ4A 2KO3A 2K3UA 3AXCA 4REZA 2RDBC 1JROA 2RR9A 3QHTA 4WJNA 2EELA 2REXA 4YSZB 4N58A 2K6DB 2JZ3B 2NPTB 3WIMA 3AE4B 1MPEA 3MC8A 2MA9B 3KWVA 4PK1A 3VFKA 3T9LA 3A1QA 2KDFB 2PVGC 3NS8A 4FBJB 1SIJA 4HRSA 1TBEA 2V4LA 2N7DA 1QF6A 3M63B 5C1ZA 3TEWA 1WSPA 3NOBA 2WYQA 2IO3B 1E6EB 1UGMA 3P4RB 1CK1A 1J7CA 1FFVA 2M0XA 3A9JA 3ZW3A 1K52A 1F2RI 3QARA 2QJLA 3DDCB 3HVDA 3N20C 4M01A 4MH8A 1PGAA 1DOIA 1YIWA 5D6JB 4K1RB 3AH7A 2HJ1A 4RM9A 2PTLA 1J0GA 3L0WB 1R7SA 3GZNB 2LGIA 2KWUB 3QWZB 4W9FA 2XK5B 3U8ZA 3IFWB 1WGKA 1H8CA 3EC8A 2Y5BB 1JRPA 2HJ8A 4KDIC 2LI5A 3IHPC 1Z2MA 1TKYA 4BKSA 1JALA 4ACFA 3UGBB 3A1QB 4KIKA 3KUZA 4PS3A 3N30A 4I6LB 2HTHA 1BT0A 2KHWB 1UD7A 2L76A 2IZVB 2INPE 3EGRA 3FC4A 3DBLI 1ENFA 3W1SA 2KDIA 2K8CA 2KLGA 1C1YB 2YEPF 4II3B 1WR6E 3Q3OC 1Q0WB 2OHFA 3BINA 2L3ZA 2V9HA 3EHVA 1YNTE 2WDVB 4KX6B 2V3PA 4P7IA 2AYOB 2OJWA 3DBRB 1RM6C 2J4XA 3NVVA 4WQOB 4AP4C 3WAPA 5J17A 2MJDA 4FHJA 5FR6A 2KYWA 2J0MA 2UYZB 2PKOA 2MJ3A 3GE8C 3RD2A 1QOAA 1M4VA 4AQ7A 3KUDB 1P3QU 1STEA 4EOYA 2K8HA 5L95C 4KV2A 3DVNU 4OZBA 2OOBB 2UU7A 5C2TB 4DHZE 1I4RA 1TIFA 3GS2A 3AE8B 3QX1A 1SE2A 3D32A 2R61A 1UELA 2IO1B 4M8NA 2KFJA 2WXFA 2ZW0A 4DHJB 4WJPA 3PTFC 5CHVC 1OGWA 2PIAA 2CJOA 1ZDXA 3H1UA 2D5GA 4K3BA 4WQMA 1MFWA 1EU3A 4TQ1A 4AJWA 2MLBA 3PRMB 1JWMD 1E7PB 2VZKD 4K7WA 3VXWA 4NZLB 2LUEA 1UWXA 4MGZE 2JYEA 2KC2A 2WU5B 4GU2A 4K7UA 1I42A 1D5MC 2CJNA 3LB8C 1SGHA 4MT5A 4JGHB 2K6QA 4HPPA 4IDIA 1XQQA 4ANUA 4TQ0A 4YSYB 3ECIA 1MG8A 3Q3JA 1RAXA 3A4SC 2BVCA 2M8SA 4FJYA 1FXAA 3VVWB 2D10A 3UQBA 2JYTA 1R4MB 3V61A 2EKIA 5BYRA 2G45B 3PREA 1PDXA 4M00A 1EUVB 4ZOHC 2O6VA 3DBHB 5IKCM 1XLPA 4OHJA 2EMTA 1FRRA 2HE7A 2DX5B 1HTOA 3MJWA 3PVLA 2D3CA 1JWBD 2LGDA 1WGDA 1QOBA 1JWAD 3A9JB 1WJUA 1P98A 3QAQA 4CHKA 2ZVNA 4IM3A 1OEYJ 3OJ3A 4JWUC 4XC2A 2AEHA 2BQQA 3EECA 4OVZA 3RNCC 5D2MB 3VH3B 2IY1B 2KC1A 1WF9A 3RUIB 1UGJA 1DOYA 1MI0A 2KJRA 1WE6A 3LDZE 2DZIA 1K50A 1J7BA 2V1YA 2BPSA 2MP2A 1J19A 5AZHA 1L4DB 3RI7C 3T8MA 1Y56A 5D7GA 3VDZA 1GB4A 4MSMB 5FK9C 2LRWA 2ZVOA 4ANVA 2D11A 1FD6A 4FULA 4IKGA 2L0TA 4HK2A 2QC8A 5KHQA 3NHEB 3QK0A 3SFEB 2BTEA 1BMLC 3OWEB 3WCQA 2C5LC 2LFIA 2WP9B 3TMPB 3VUXA 3BIID 4ZRQA 3NVYA 1EWYC 2L7RA 4LJPB 4GB9A 4LCDE 2FE8A 3W5UB 4CQNA 5JZEB 4XZ4A 2DLBA 3NZSA 3JYUA 2BKFA 3P63A 4W9JA 1CMXB 1WGGA 1JW9D 4O1NA 4ANWA 2GB1A 4P16A 3ZGZA 1T0RC 4JQWC 2K22A 1ZOYB 4BKSD 2ZCBA 3Q6BA 2RDHA 5E6JA 5LLIA 2O6VB 5L83A 2WXJA 4OW0A 1KFYB 4HJGE 3FAHA 4ARIA 1IUEA 2BB5A 1I7HA 1AARA 2DYOA 1R4NB 3H7PB 1XT9B 2GOWA 5EE9A 2MH7A 3MJ5A 3M3JA 3AECB 3P2BA 3C0RB 1OFFA 3ZRCA 4GXBA 1VR9A 3NS1A 1CZPA 2N0SB 2PVOD 4RGOS 1OQRA 2LASA 1HE8A 2ZW1A 4KIKB 3M95A 1T6BX 1C79A 2AQ3B 5JHAA 2LHEA 2IDYA 2E3TA 1ISNA 1OEYA 2D3AA 1N61A 2R2QA 4XGAB 2BS2B 2PJHA 1GC7A 4C4VA 4XE0A 3MC0B 1WZ0A 4A3PA 3PT2B 3ALBA 3CMMB 4AJYB 4M0WA 4JIOU 4C7YA 4LLGM 2JWZA 3QCAA 2WXOA 4JE3B 5C23A 4MGIE 3KH0A 2WXQA 2WGSA 4GDKA 2WXNA 3SR6A 3W1SC 1K51A 4WH4A 2DZJA 2JQRB 2ICIA 4MJSB 1KLVA 3TEZA 3RZWC 1B9RA 3RPFC 1SE9A 4HCNB 1YN5A 2LRUA 3AEBB 3ZUNA 1WZ3A 2PPHA 4I6PA 1L0VB 1F9JA 2SAKA 1YN3A 4KGSA 2IY0B 2WWZA 3VQIA 4KZ0A 1HTQA 2I1JA 3P4PB 2JXXA 4KGTA 5CHFA 2INNE 1WH3A 5HFYA 4C4VB 4LNNA 2J42A 3AE1B 2WXGA 2K0PA 2MCNB 2BYEA 4TV3A 3DCGA 3AU4A 1F77A 2LVOA 3BY4B 5IO9A 2AQ2B 1FNUA 1I4XA 4DXFA 2Q5WD 3W2DA 2W9NA 3B1LX 4XYCA 4NNJB 1TS5A 1HZ5A 2N4FA 2KQ4X 4WJOA 1QLBB 1C9FA 4FADA 4AUQC 3HUIA 4RF1A 2L32A 3W9CB 3ZVVA 5CHWA 1PGBA 1FNVA 4BVUC 2WXIA 4ANXA 4GMVA 3M62B 5LXIB 1YD8U 4QAYA 3V6CB 3RYTA 3OAWA 2BYTA 4TUUA 2JY6A 2KXJA 4NQKE 4P6VF 1SSNA 4FJZA 1F52A 5I4DA 3SDLC 2L52A 3HVZA 3ZYYX 5IP4D 3SFDB 3P1MA 3UIOB 1E90A 1Q1OA 3FKYA 1L0YB 4DK5A 3EFUA 1ZUD2 2MEKA 2G4DB 2I38A 4DBGA 4G50A 4BFRA 2MBEA 3LJ3A 1IGDA 4JX1C 1WMHB 4A20A 2GRIA 5BYQA 3MFGA 1MHXA 3Q8CA 5D3DA 4DHJD 1E0ZA 2KOXA 1L6UA 1HQRD 1OTRB 2LWPA 3TCAA 1T5XD 3T3OA 3AI5A 3RULA 1LO5D 1DGJA 3ZJUA 1NVID 4FJVB 4GIVA 4GLSC 3N1XC 4G3XB 2KN5A 2K9XA 1V49A 2MBBB 2WXKA 3NY5A 4ZDVA 2WXMA 1XCTL 2NPTA 4MSQB 1ZGUB 3IXSA 4L2YA 4PT5A 2JZZA 4URKA 1P9DU 1QILA 4MDKE 2MBOA 1WWTA 3N9YC 1G6JA 1AYFA 1SE4A 3A33B 2OEDA 4LJOB 1NEKB 3Q2AC 3DPDA 3RNBC 5IN7A 2DYBA 1V5OA 5C3JB
chains in the Genus database with same CATH topology
1XQQA 2RD0A 4ANUA 2K1FA 1Y8RC 4TQ0A 2N9EB 2HD5B 1V6EA 4JLCA 2L0FA 3ECIA 1MG8A 3Q3JA 1RAXA 1UZXB 3A4SC 2AL3A 2GBJA 2KTRB 5AEKB 1WJNA 3W1YA 1GUAB 3JSVA 4KSKC 2M8SA 3VUWA 5D94A 3SHQA 2XK5A 1VCBA 2O6VD 1A5RA 2K39A 4GSWA 3OJ4B 4IG7B 5CTRC 4FJYA 2RGFA 3VVWB 1E7UA 2D10A 4M8MA 3ZNZB 2C7HA 1OQYA 3UQBA 4G11A 3R3MA 4RM8A 5CX3A 3SU8X 3RCZA 3NZUA 3V61A 4ASWC 4JL9A 2G45B 5IA7A 3PREA 2KDBA 1KM7A 2IYDB 2L8JA 3CSTA 3X23A 4OVUA 4FLHA 1EUVB 2O6VA 3N3KB 2Z59B 2ZNVC 4ZRIA 2N1VA 3AULA 3HM6X 3PHWB 3VAWA 4E74A 5JH5C 4NJ7A 2EMTA 3UIPB 3ZNID 3RT3B 2L00B 2KX0A 4GDKB 2HE7A 1GJZA 4DDID 2DX5B 4GGQA 3MJWA 2M17A 4A3OA 3PVLA 5G55A 4GOCA 3ZNGC 1WJ4A 3N32A 2BWES 4HWIB 2LGDA 1WGDA 2YLMA 5DCNA 3TJPA 1LM8B 3A9JB 5E6NA 3A9KA 1WJUA 2DZMA 1WGHA 1P98A 3QAQA 4CHKA 3PLUA 1V80A 2ZVNA 4IM3A 1YJ1A 2ZEQA 3ML8A 1OEYJ 2RSUA 2FAZA 1R4NI 2KMCA 3OJ3A 2LXCA 2IO2B 3L16A 2RPQA 1M94A 2Z0EB 3PGEA 2CHWA 2JUOA 2DAJA 4HDQA 4BBNF 2DENB 2AEHA 2CS4A 1WX8A 4XC2A 2B3AA 5AZFA 1IYFA 2KWVB 4W9EA 2NS5A 2BYVE 3EECA 1WXMA 3ZKJC 5D2MB 3DOWA 2IY1B 1WX7A 3HK0A 3JW0X 2KC1A 1WF9A 4W9CA 1EF1A 3GOEA 4WWPA 3RUIB 4EZKA 5E6PA 4XX5A 1GC6A 2PEAA 3APFA 1JRUA 2G3QB 3L17A 3PRPB 1WJ6A 1PQSA 1IPGA 2NBUA 3H6NA 4FN2A 4MH0E 2KJRA 1WE6A 3K9OB 2DZIA 3LDZE 1L2NA 4NAWA 2I1KA 3S2AA 3PSEB 5J2RA 2C7MB 2R2OA 4PS8A 2GBKA 2BPSA 2V1YA 3VH4B 4IWQA 2MP2A 1WM2A 1WXSA 1J19A 5AZHA 2DHZA 3DQVA 4NQLB 3TL5A 1NI2A 2ZJDA 3T8MA 3VHTC 2MW5A 2UWQA 3A9KB 2EKEC 3IBEA 5DPWA 5D7GA 1LXDA 1E8YA 1GNUA 4CYEA 3VDZA 4N9F4 4MSMB 2BYFA 4I6NB 3TBLD 2LRWA 3ZIMA 3OLMD 2ZVOA 4ANVA 1V81A 2D11A 3PRZA 4W9DA 2L05A 4FULA 4HLEA 2KLCA 2L0TA 1UBQA 1WGYA 2PE9A 3DVGX 4HK2A 5IAAC 2LXAA 2IO0B 5KHQA 3NHEB 3QK0A 2D3GA 3CF6E 3H7SA 1YX6B 4MJSA 2FCSA 3KW5B 2LVQA 2KQ7A 4MM3A 4HCPB 1GG3A 2C5LC 4IUMB 3MHSD 4W9IA 3TMPB 4W9KA 3VUXA 4KDLB 2KNBA 2L7RA 4LJPB 1WYWB 4GB9A 2A5UA 4LCDE 1Q5WB 5TR5A 4GN1A 3HM3A 2MBQA 5JZEB 5JHBA 5G2NA 4NJ6A 3U30A 4XZ4A 2MX2A 3NZSA 4BKGA 2KZRA 3APDA 3JYUA 2BKFA 1E5WA 1WFYA 4W9JA 1LFDA 1QZEA 1CMXB 4B6WA 4BBNC 4GDLA 4II2B 1WY8A 4F1SA 4NPNA 3TIXA 1WGGA 3DBHI 2LGYA 2CHZA 2GBMA 2MBHA 3PV1A 4K81A 3AU5A 2GBNA 3DVGY 2JRIB 3QIJA 4ANWA 2GMIC 2KFKB 4IM2A 3DBSA 4W9GA 5J18A 4JQWC 1E7VA 4ZRKA 1J8CA 1KJTA 4BKSD 1E8WA 2ZCBA 3GZNI 2O2VB 5DPRA 2JVCA 5LLIA 2O6VB 3ZO5B 3IG3A 4HPLB 4HJKA 4DHZB 4WWOA 2JF5A 1V86A 2XEWA 2MRPA 2ASQA 4EUTA 5L83A 5LXHA 1S1QB 3L13A 1V9JA 1WM3A 2WX0A 1WR1A 2C60A 3A4RA 3WA0A 1ZW7A 4IC7B 2NR2A 1AARA 3ZNHB 4LDTB 2DYOA 2JT4B 3H7PB 1XT9B 2GOWA 4KZCA 4E3CA 3KYDD 3M3JA 4F7ZA 4ZYNA 3P2BA 2YVCA 3C0RB 2VRRB 3ZRCA 2KVRA 2KJ6A 4CO7A 4DXAB 4GXBA 1RLFA 3MTNB 3L54A 4LDTD 3ZDMC 2FNJB 3H9DA 1WE7A 1WGRA 2KWCA 1IP9A 2MWSB 3APCA 2KQSA 1RFAA 2LASA 1HE8A 4KIKB 4PYUA 3PPAA 2D2QA 3M95A 3ONSA 4PYZA 3RZFA 4F8CB 2K25A 3SD5A 2KK8A 5JHAA 2NCNA 4W9HA 1UH6A 4HVBA 1ISNA 1OEYA 2KD0A 2CU1A 2R2QA 4B95A 4OVVA 2XBBC 1NDDA 2DYMA 1H4RA 2PJHA 3R66C 3KVFB 1GC7A 3JVZX 2NBWB 4TKNA 1YQBA 4HDOA 1WI0A 1P0RA 2PE6B 4GDLB 2GBRA 2M4NA 1UBIA 4NAWB 1WZ0A 2KO3A 2FCMA 1WRDB 3V6EB 4A3PA 3AXCA 3PT2B 1WXVA 3ALBA 2Z0DB 3CMMB 1FXTB 5KHOA 4AJYB 4JIOU 2AL6A 2O2VA 3QA8A 2EMSA 2JWZA 1TZ1A 1E8ZA 3QCAA 4W9LA 2RR9A 3QHTA 1K8RB 4WJNA 1V5TA 3DVNV 5C23A 4MGIE 2FIFA 2N1WA 1E8XA 2D07B 2MSED 3KH0A 2REXA 3UF8A 3JSVB 4GDKA 3W1SC 2K6DB 2JZ3B 2DZJA 2NPTB 3WIMA 5DPTA 3I3TB 4MJSB 2N9PC 2MA9B 1C3TA 1WXAA 3VFKA 3ZRFA 1KLVA 2FCQA 2JPHA 3RZWC 3ENEA 3T9LA 1VD2A 3A1QA 2KDFB 4X57B 3ZLZA 3NS8A 1SE9A 2IBIB 2J0KA 2LRUA 4HCNB 4FBJB 2NVUI 1TBEA 2V4LA 2N7DA 1WZ3A 2PPHA 4MELA 3ZUNA 4I6PA 1L7YA 1F9JA 3V62A 2QHOA 3M63B 1RRBA 4AWJA 5C1ZA 4DDGD 2DZKA 4WAAA 3NOBA 2IY0B 2WWZA 2WYQA 3VQIA 4EZJA 1KOTA 4M0WB 2IO3B 4EKUA 1UGMA 3PZDA 4E71A 4KZ0A 3ZTDA 2I1JA 4YL8A 3L08A 3U7DA 5EDSA 1U4AA 2JXXA 1R4MI 2KTFA 2A4ZA 1I35A 2KJHB 2M0XA 3A9JA 3ZW3A 5CHFA 2BKRB 1WH3A 4ZRJA 3QARA 3DDCB 1T0YA 3PS6A 2MCNB 2BYEA 4TV3A 3VH3B 3QQ8B 1YIWA 3DCGA 3AU4A 2LVOA 5D6JB 2N9XA 2DAFA 4K1RB 3BY4B 5AZGA 3K9PB 4RM9A 2OJRA 3WAMA 3WANA 1J0GA 3L0WB 4J6IA 3X0WA 2KMAA 1LQBA 2M1MA 2J0JA 3CSFA 3KYCD 1ZKHA 3ZDTA 2KDEB 2W9NA 3B1LX 2KWUB 3QWZB 4W9FA 4NNJB 1WMHA 2XK5B 3U8ZA 3IFWB 2N4FA 1H8CA 2BWFA 3EC8A 2Y5BB 1YX5B 3QC8B 4WJOA 3WALA 4DWFA 3IVFA 4BOSC 4G0NB 2HJ8A 4KDIC 5DPSA 2LI5A 2NBVB 3O65B 3PLVA 3IHPC 1Z2MA 2WDTB 3QJZA 4HPMB 4FADA 3VTWA 2CHXA 4AUQC 2J7QB 4BKSA 5HKHA 4AOFA 3UGBB 3A1QB 1WX9A 4WJQA 4KIKA 3KUZA 4PS3A 2CKHB 4RMAA 3ZVVA 3N30A 4HXDA 4I6LB 4IM0A 3L10B 5CHWA 2HTHA 3HIZA 1TTNA 3UINB 4BVUC 1XD3B 1BT0A 4PS7A 4ANXA 4GMVA 3M62B 2KHWB 1UD7A 2L76A 4MEMA 2IZVB 5LXIB 1YD8U 3V6CB 3RYTA 3OAWA 3DBLI 4TUUA 2JY6A 3H7PA 3W1SA 2KXJA 2KDIA 2K8CA 2KLGA 4NQKE 1C1YB 3UQAA 4II3B 1WR6E 4FJZA 1Q0WB 2ZNVB 3BINA 2BGFA 2ZCCA 2L3ZA 2LVPA 3SDLC 3EHVA 1V2YA 2FUHB 4P7IA 3VTUA 3WAOA 1D3ZA 3UIOB 2MQJA 2LJ5A 1E90A 2AYOB 4KVGB 1Q1OA 4MGKE 4FA6A 4DK5A 4WQOB 4AP4C 3EFUA 1S3SG 4IWOA 3WAPA 2ZPNA 5J17A 4FHJA 4K7SA 3PHXB 5FR6A 2UYZB 2J0MA 2G4DB 2JRHA 4IW0A 4DBGA 3R7RA 4NY0A 4G50A 4BFRA 2MBEA 4BKTA 3LJ3A 2C7NB 3RD2A 2FIDA 3VUYA 1WMHB 2C9WB 2BF8B 3KUDB 1P3QU 2KTRA 4EOYA 4A20A 2K8HA 5L95C 4KV2A 4DHJD 2LGXA 2MP2B 2KKCA 3DVNU 2OOBB 2KOXA 4FHKA 2CR5A 1OTRB 2LWPA 4DHZE 1EF5A 2KANA 3TCAA 3QX1A 3AI5A 3RULA 3D32A 1UELA 2IO1B 2K8BA 4M8NA 2KFJA 2N7EA 4DHJB 4FJVB 3B0AA 3VTVA 2ZZPB 2KX3A 4WJPA 5GMVA 3PTFC 2AWTA 5CHVC 3HHMA 1OGWA 4GIVA 2G4SA 2WX1A 3H1UA 4G3XB 2KN5A 1EO6A 1V49A 2MBBB 4EZLA 1P1AA 1X1MA 4ICUA 3NY5A 4TQ1A 4AJWA 4ZDVA 2MLBA 4B9KA 2NPTA 4MSQB 3PRMB 4MGYE 1Z5SB 2LD9A 1ZGUB 4WWNA 3KUCB 4ICVA 4K7WA 5E6OA 3V60A 3VXWA 1TGZB 2JZZA 4URKA 1P9DU 1SIFA 2LUEA 2MBOA 4MDKE 2FCNA 4MGZE 4BOZB 2KC2A 5BO4B 1NBFC 3ML9A 2LZ6A 4GU2A 4EEWA 4K7UA 1I42A 1G6JA 2KFKA 3DBRI 3A33B 2V3SA 4EFOA 4LJOB 1SGHA 2ZPYA 3B08A 3ZTCA 1WIAA 3DPDA 4KSLC 3R7QA 4JGHB 3Q3FA 2DYBA 2K6QA 1V5OA 4IWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQQ A;  2RD0 A;  4ANU A;  2K1F A;  1Y8R C;  4TQ0 A;  2N9E B;  2HD5 B;  1V6E A;  4JLC A;  2L0F A;  3ECI A;  1MG8 A;  3Q3J A;  1RAX A;  1UZX B;  3A4S C;  2AL3 A;  2GBJ A;  2KTR B;  5AEK B;  1WJN A;  3W1Y A;  1GUA B;  3JSV A;  4KSK C;  2M8S A;  3VUW A;  5D94 A;  3SHQ A;  2XK5 A;  1VCB A;  2O6V D;  1A5R A;  2K39 A;  4GSW A;  3OJ4 B;  4IG7 B;  5CTR C;  4FJY A;  2RGF A;  3VVW B;  1E7U A;  2D10 A;  4M8M A;  3ZNZ B;  2C7H A;  1OQY A;  3UQB A;  4G11 A;  3R3M A;  4RM8 A;  5CX3 A;  3SU8 X;  3RCZ A;  3NZU A;  3V61 A;  4ASW C;  4JL9 A;  2G45 B;  5IA7 A;  3PRE A;  2KDB A;  1KM7 A;  2IYD B;  2L8J A;  3CST A;  3X23 A;  4OVU A;  4FLH A;  1EUV B;  2O6V A;  3N3K B;  2Z59 B;  2ZNV C;  4ZRI A;  2N1V A;  3AUL A;  3HM6 X;  3PHW B;  3VAW A;  4E74 A;  5JH5 C;  4NJ7 A;  2EMT A;  3UIP B;  3ZNI D;  3RT3 B;  2L00 B;  2KX0 A;  4GDK B;  2HE7 A;  1GJZ A;  4DDI D;  2DX5 B;  4GGQ A;  3MJW A;  2M17 A;  4A3O A;  3PVL A;  5G55 A;  4GOC A;  3ZNG C;  1WJ4 A;  3N32 A;  2BWE S;  4HWI B;  2LGD A;  1WGD A;  2YLM A;  5DCN A;  3TJP A;  1LM8 B;  3A9J B;  5E6N A;  3A9K A;  1WJU A;  2DZM A;  1WGH A;  1P98 A;  3QAQ A;  4CHK A;  3PLU A;  1V80 A;  2ZVN A;  4IM3 A;  1YJ1 A;  2ZEQ A;  3ML8 A;  1OEY J;  2RSU A;  2FAZ A;  1R4N I;  2KMC A;  3OJ3 A;  2LXC A;  2IO2 B;  3L16 A;  2RPQ A;  1M94 A;  2Z0E B;  3PGE A;  2CHW A;  2JUO A;  2DAJ A;  4HDQ A;  4BBN F;  2DEN B;  2AEH A;  2CS4 A;  1WX8 A;  4XC2 A;  2B3A A;  5AZF A;  1IYF A;  2KWV B;  4W9E A;  2NS5 A;  2BYV E;  3EEC A;  1WXM A;  3ZKJ C;  5D2M B;  3DOW A;  2IY1 B;  1WX7 A;  3HK0 A;  3JW0 X;  2KC1 A;  1WF9 A;  4W9C A;  1EF1 A;  3GOE A;  4WWP A;  3RUI B;  4EZK A;  5E6P A;  4XX5 A;  1GC6 A;  2PEA A;  3APF A;  1JRU A;  2G3Q B;  3L17 A;  3PRP B;  1WJ6 A;  1PQS A;  1IPG A;  2NBU A;  3H6N A;  4FN2 A;  4MH0 E;  2KJR A;  1WE6 A;  3K9O B;  2DZI A;  3LDZ E;  1L2N A;  4NAW A;  2I1K A;  3S2A A;  3PSE B;  5J2R A;  2C7M B;  2R2O A;  4PS8 A;  2GBK A;  2BPS A;  2V1Y A;  3VH4 B;  4IWQ A;  2MP2 A;  1WM2 A;  1WXS A;  1J19 A;  5AZH A;  2DHZ A;  3DQV A;  4NQL B;  3TL5 A;  1NI2 A;  2ZJD A;  3T8M A;  3VHT C;  2MW5 A;  2UWQ A;  3A9K B;  2EKE C;  3IBE A;  5DPW A;  5D7G A;  1LXD A;  1E8Y A;  1GNU A;  4CYE A;  3VDZ A;  4N9F 4;  4MSM B;  2BYF A;  4I6N B;  3TBL D;  2LRW A;  3ZIM A;  3OLM D;  2ZVO A;  4ANV A;  1V81 A;  2D11 A;  3PRZ A;  4W9D A;  2L05 A;  4FUL A;  4HLE A;  2KLC A;  2L0T A;  1UBQ A;  1WGY A;  2PE9 A;  3DVG X;  4HK2 A;  5IAA C;  2LXA A;  2IO0 B;  5KHQ A;  3NHE B;  3QK0 A;  2D3G A;  3CF6 E;  3H7S A;  1YX6 B;  4MJS A;  2FCS A;  3KW5 B;  2LVQ A;  2KQ7 A;  4MM3 A;  4HCP B;  1GG3 A;  2C5L C;  4IUM B;  3MHS D;  4W9I A;  3TMP B;  4W9K A;  3VUX A;  4KDL B;  2KNB A;  2L7R A;  4LJP B;  1WYW B;  4GB9 A;  2A5U A;  4LCD E;  1Q5W B;  5TR5 A;  4GN1 A;  3HM3 A;  2MBQ A;  5JZE B;  5JHB A;  5G2N A;  4NJ6 A;  3U30 A;  4XZ4 A;  2MX2 A;  3NZS A;  4BKG A;  2KZR A;  3APD A;  3JYU A;  2BKF A;  1E5W A;  1WFY A;  4W9J A;  1LFD A;  1QZE A;  1CMX B;  4B6W A;  4BBN C;  4GDL A;  4II2 B;  1WY8 A;  4F1S A;  4NPN A;  3TIX A;  1WGG A;  3DBH I;  2LGY A;  2CHZ A;  2GBM A;  2MBH A;  3PV1 A;  4K81 A;  3AU5 A;  2GBN A;  3DVG Y;  2JRI B;  3QIJ A;  4ANW A;  2GMI C;  2KFK B;  4IM2 A;  3DBS A;  4W9G A;  5J18 A;  4JQW C;  1E7V A;  4ZRK A;  1J8C A;  1KJT A;  4BKS D;  1E8W A;  2ZCB A;  3GZN I;  2O2V B;  5DPR A;  2JVC A;  5LLI A;  2O6V B;  3ZO5 B;  3IG3 A;  4HPL B;  4HJK A;  4DHZ B;  4WWO A;  2JF5 A;  1V86 A;  2XEW A;  2MRP A;  2ASQ A;  4EUT A;  5L83 A;  5LXH A;  1S1Q B;  3L13 A;  1V9J A;  1WM3 A;  2WX0 A;  1WR1 A;  2C60 A;  3A4R A;  3WA0 A;  1ZW7 A;  4IC7 B;  2NR2 A;  1AAR A;  3ZNH B;  4LDT B;  2DYO A;  2JT4 B;  3H7P B;  1XT9 B;  2GOW A;  4KZC A;  4E3C A;  3KYD D;  3M3J A;  4F7Z A;  4ZYN A;  3P2B A;  2YVC A;  3C0R B;  2VRR B;  3ZRC A;  2KVR A;  2KJ6 A;  4CO7 A;  4DXA B;  4GXB A;  1RLF A;  3MTN B;  3L54 A;  4LDT D;  3ZDM C;  2FNJ B;  3H9D A;  1WE7 A;  1WGR A;  2KWC A;  1IP9 A;  2MWS B;  3APC A;  2KQS A;  1RFA A;  2LAS A;  1HE8 A;  4KIK B;  4PYU A;  3PPA A;  2D2Q A;  3M95 A;  3ONS A;  4PYZ A;  3RZF A;  4F8C B;  2K25 A;  3SD5 A;  2KK8 A;  5JHA A;  2NCN A;  4W9H A;  1UH6 A;  4HVB A;  1ISN A;  1OEY A;  2KD0 A;  2CU1 A;  2R2Q A;  4B95 A;  4OVV A;  2XBB C;  1NDD A;  2DYM A;  1H4R A;  2PJH A;  3R66 C;  3KVF B;  1GC7 A;  3JVZ X;  2NBW B;  4TKN A;  1YQB A;  4HDO A;  1WI0 A;  1P0R A;  2PE6 B;  4GDL B;  2GBR A;  2M4N A;  1UBI A;  4NAW B;  1WZ0 A;  2KO3 A;  2FCM A;  1WRD B;  3V6E B;  4A3P A;  3AXC A;  3PT2 B;  1WXV A;  3ALB A;  2Z0D B;  3CMM B;  1FXT B;  5KHO A;  4AJY B;  4JIO U;  2AL6 A;  2O2V A;  3QA8 A;  2EMS A;  2JWZ A;  1TZ1 A;  1E8Z A;  3QCA A;  4W9L A;  2RR9 A;  3QHT A;  1K8R B;  4WJN A;  1V5T A;  3DVN V;  5C23 A;  4MGI E;  2FIF A;  2N1W A;  1E8X A;  2D07 B;  2MSE D;  3KH0 A;  2REX A;  3UF8 A;  3JSV B;  4GDK A;  3W1S C;  2K6D B;  2JZ3 B;  2DZJ A;  2NPT B;  3WIM A;  5DPT A;  3I3T B;  4MJS B;  2N9P C;  2MA9 B;  1C3T A;  1WXA A;  3VFK A;  3ZRF A;  1KLV A;  2FCQ A;  2JPH A;  3RZW C;  3ENE A;  3T9L A;  1VD2 A;  3A1Q A;  2KDF B;  4X57 B;  3ZLZ A;  3NS8 A;  1SE9 A;  2IBI B;  2J0K A;  2LRU A;  4HCN B;  4FBJ B;  2NVU I;  1TBE A;  2V4L A;  2N7D A;  1WZ3 A;  2PPH A;  4MEL A;  3ZUN A;  4I6P A;  1L7Y A;  1F9J A;  3V62 A;  2QHO A;  3M63 B;  1RRB A;  4AWJ A;  5C1Z A;  4DDG D;  2DZK A;  4WAA A;  3NOB A;  2IY0 B;  2WWZ A;  2WYQ A;  3VQI A;  4EZJ A;  1KOT A;  4M0W B;  2IO3 B;  4EKU A;  1UGM A;  3PZD A;  4E71 A;  4KZ0 A;  3ZTD A;  2I1J A;  4YL8 A;  3L08 A;  3U7D A;  5EDS A;  1U4A A;  2JXX A;  1R4M I;  2KTF A;  2A4Z A;  1I35 A;  2KJH B;  2M0X A;  3A9J A;  3ZW3 A;  5CHF A;  2BKR B;  1WH3 A;  4ZRJ A;  3QAR A;  3DDC B;  1T0Y A;  3PS6 A;  2MCN B;  2BYE A;  4TV3 A;  3VH3 B;  3QQ8 B;  1YIW A;  3DCG A;  3AU4 A;  2LVO A;  5D6J B;  2N9X A;  2DAF A;  4K1R B;  3BY4 B;  5AZG A;  3K9P B;  4RM9 A;  2OJR A;  3WAM A;  3WAN A;  1J0G A;  3L0W B;  4J6I A;  3X0W A;  2KMA A;  1LQB A;  2M1M A;  2J0J A;  3CSF A;  3KYC D;  1ZKH A;  3ZDT A;  2KDE B;  2W9N A;  3B1L X;  2KWU B;  3QWZ B;  4W9F A;  4NNJ B;  1WMH A;  2XK5 B;  3U8Z A;  3IFW B;  2N4F A;  1H8C A;  2BWF A;  3EC8 A;  2Y5B B;  1YX5 B;  3QC8 B;  4WJO A;  3WAL A;  4DWF A;  3IVF A;  4BOS C;  4G0N B;  2HJ8 A;  4KDI C;  5DPS A;  2LI5 A;  2NBV B;  3O65 B;  3PLV A;  3IHP C;  1Z2M A;  2WDT B;  3QJZ A;  4HPM B;  4FAD A;  3VTW A;  2CHX A;  4AUQ C;  2J7Q B;  4BKS A;  5HKH A;  4AOF A;  3UGB B;  3A1Q B;  1WX9 A;  4WJQ A;  4KIK A;  3KUZ A;  4PS3 A;  2CKH B;  4RMA A;  3ZVV A;  3N30 A;  4HXD A;  4I6L B;  4IM0 A;  3L10 B;  5CHW A;  2HTH A;  3HIZ A;  1TTN A;  3UIN B;  4BVU C;  1XD3 B;  1BT0 A;  4PS7 A;  4ANX A;  4GMV A;  3M62 B;  2KHW B;  1UD7 A;  2L76 A;  4MEM A;  2IZV B;  5LXI B;  1YD8 U;  3V6C B;  3RYT A;  3OAW A;  3DBL I;  4TUU A;  2JY6 A;  3H7P A;  3W1S A;  2KXJ A;  2KDI A;  2K8C A;  2KLG A;  4NQK E;  1C1Y B;  3UQA A;  4II3 B;  1WR6 E;  4FJZ A;  1Q0W B;  2ZNV B;  3BIN A;  2BGF A;  2ZCC A;  2L3Z A;  2LVP A;  3SDL C;  3EHV A;  1V2Y A;  2FUH B;  4P7I A;  3VTU A;  3WAO A;  1D3Z A;  3UIO B;  2MQJ A;  2LJ5 A;  1E90 A;  2AYO B;  4KVG B;  1Q1O A;  4MGK E;  4FA6 A;  4DK5 A;  4WQO B;  4AP4 C;  3EFU A;  1S3S G;  4IWO A;  3WAP A;  2ZPN A;  5J17 A;  4FHJ A;  4K7S A;  3PHX B;  5FR6 A;  2UYZ B;  2J0M A;  2G4D B;  2JRH A;  4IW0 A;  4DBG A;  3R7R A;  4NY0 A;  4G50 A;  4BFR A;  2MBE A;  4BKT A;  3LJ3 A;  2C7N B;  3RD2 A;  2FID A;  3VUY A;  1WMH B;  2C9W B;  2BF8 B;  3KUD B;  1P3Q U;  2KTR A;  4EOY A;  4A20 A;  2K8H A;  5L95 C;  4KV2 A;  4DHJ D;  2LGX A;  2MP2 B;  2KKC A;  3DVN U;  2OOB B;  2KOX A;  4FHK A;  2CR5 A;  1OTR B;  2LWP A;  4DHZ E;  1EF5 A;  2KAN A;  3TCA A;  3QX1 A;  3AI5 A;  3RUL A;  3D32 A;  1UEL A;  2IO1 B;  2K8B A;  4M8N A;  2KFJ A;  2N7E A;  4DHJ B;  4FJV B;  3B0A A;  3VTV A;  2ZZP B;  2KX3 A;  4WJP A;  5GMV A;  3PTF C;  2AWT A;  5CHV C;  3HHM A;  1OGW A;  4GIV A;  2G4S A;  2WX1 A;  3H1U A;  4G3X B;  2KN5 A;  1EO6 A;  1V49 A;  2MBB B;  4EZL A;  1P1A A;  1X1M A;  4ICU A;  3NY5 A;  4TQ1 A;  4AJW A;  4ZDV A;  2MLB A;  4B9K A;  2NPT A;  4MSQ B;  3PRM B;  4MGY E;  1Z5S B;  2LD9 A;  1ZGU B;  4WWN A;  3KUC B;  4ICV A;  4K7W A;  5E6O A;  3V60 A;  3VXW A;  1TGZ B;  2JZZ A;  4URK A;  1P9D U;  1SIF A;  2LUE A;  2MBO A;  4MDK E;  2FCN A;  4MGZ E;  4BOZ B;  2KC2 A;  5BO4 B;  1NBF C;  3ML9 A;  2LZ6 A;  4GU2 A;  4EEW A;  4K7U A;  1I42 A;  1G6J A;  2KFK A;  3DBR I;  3A33 B;  2V3S A;  4EFO A;  4LJO B;  1SGH A;  2ZPY A;  3B08 A;  3ZTC A;  1WIA A;  3DPD A;  4KSL C;  3R7Q A;  4JGH B;  3Q3F A;  2DYB A;  2K6Q A;  1V5O A;  4IWP A; 
#chains in the Genus database with same CATH topology
 2N9E B;  2HD5 B;  1BUI C;  1V6E A;  2GI9 A;  1N5X A;  1HZ6 A;  1VJK A;  4WWM A;  5AEK B;  3W1Y A;  1GUA B;  1C4C A;  3JSV A;  4KSK C;  4WAF A;  4WIP A;  3VUW A;  5D94 A;  4UDU C;  3SHQ A;  2XK5 A;  1E7U A;  1N62 A;  4M8M A;  3ZNZ B;  5AUI A;  1OQY A;  2LGS A;  4RM8 A;  5CX3 A;  5LNK 1;  3RCZ A;  3NZU A;  4ASW C;  2QIE B;  1XEE A;  3Q8E A;  5IA7 A;  1K53 A;  1YMH E;  2KDB A;  2L8J A;  3CST A;  2Y3A A;  3X23 A;  3N1Z C;  4OVU A;  5HHD G;  4FLH A;  3PO0 A;  2KMM A;  2Z59 B;  2ZNV C;  3PHW B;  3HM6 X;  3VAW A;  5JH5 C;  1FXI A;  2M56 B;  3RT3 B;  3TUO A;  4DDI D;  4GGQ A;  4A3O A;  2WXP A;  5G55 A;  3N32 A;  4HWI B;  3TJP A;  4KKJ A;  1YJ1 A;  2ZEQ A;  3ML8 A;  2FAZ A;  1R4N I;  2KMC A;  1GOZ A;  2Z0E B;  2NTT A;  3ZJV A;  2JUO A;  2CS4 A;  5AZF A;  2B3A A;  4C56 C;  1IYF A;  2DNF A;  4W9E A;  3DOW A;  1QKZ A;  1XF5 L;  3JW0 X;  4YTP B;  3TEX A;  4LNI A;  5E6P A;  4XX5 A;  1GC6 A;  3APF A;  1JRU A;  4MH0 E;  1PQS A;  1IPG A;  2W3S A;  1XLO A;  3K9O B;  1L4Z B;  3S2A A;  2C7M B;  1FEH A;  1TJE A;  1WM2 A;  3TL5 A;  3ZQ4 A;  3RNF C;  2MW5 A;  3A9K B;  2EKE C;  4BZA A;  1LXD A;  1ET6 A;  1E8Y A;  1JCK B;  1GNU A;  2BYF A;  2WS3 B;  3VRA B;  3ZIM A;  3OLM D;  1L5P A;  3PRZ A;  3HRD D;  2MHJ A;  1UBQ A;  1WGY A;  2PE9 A;  3BYT B;  3VR8 B;  1WYG A;  2D3G A;  1NI3 A;  2WXH A;  1YX6 B;  3H7S A;  4MJS A;  2ON8 A;  1MJD A;  1T3Q A;  1BXT A;  2KQ7 A;  4W9I A;  1AN8 A;  2BS3 B;  2DWQ A;  2VH2 A;  3MP9 A;  4YT0 B;  3HM3 A;  3R2T A;  2MBQ A;  1EWC A;  3RNE C;  5G2N A;  4NJ6 A;  2MX2 A;  3APD A;  1WFY A;  3DHG C;  1QZE A;  4B6W A;  4GDL A;  1V8C A;  2WU2 B;  1VRA B;  2CHZ A;  1AWD A;  4K81 A;  2AX5 A;  2JRI B;  1EU4 A;  3QIJ A;  2IGG A;  4XDC A;  2KFK B;  4ZHO A;  5J18 A;  2IND C;  4ZRK A;  3GE3 C;  2O2V B;  5DPR A;  5T8I A;  4HJK A;  2X8X X;  4WWO A;  2MRP A;  5LXH A;  1S1Q B;  3L13 A;  1V9J A;  1WM3 A;  2C60 A;  1ZW7 A;  4IC7 B;  3ZNH B;  1KF6 B;  2KVZ A;  3R2I A;  2QEJ C;  2KVR A;  2KJ6 A;  4CO7 A;  1VZ8 A;  3MTN B;  3L54 A;  1SJH D;  1FM0 D;  3ZDM C;  1CQV A;  4ZHP A;  3H9D A;  2KQS A;  1ROE A;  3PPA A;  2D2Q A;  4F8C B;  2K25 A;  3SD5 A;  2KK8 A;  1FO4 A;  2DBY A;  1TT5 B;  2KD0 A;  2RPV A;  2DYM A;  2WXL A;  2W82 A;  3KVF B;  1SF0 A;  1YQB A;  1JWS D;  2LUM A;  1C77 A;  1TY2 A;  3AE5 B;  1UBI A;  4LTU A;  2FCM A;  1WRD B;  3V6E B;  1D6E C;  1D4B A;  3DBL B;  3AE6 B;  2AL6 A;  2O2V A;  3QA8 A;  2EMS A;  1TZ1 A;  1XCQ L;  3DVN V;  3DHH C;  3AED B;  2FIF A;  2N1W A;  2D07 B;  2MSE D;  3UF8 A;  3JSV B;  2PW9 A;  1N60 A;  3I3T B;  1C3T A;  1WXA A;  3RNG C;  2JPH A;  3ENE A;  4X57 B;  4DQO C;  1JML A;  2J0K A;  3FIL A;  4ARC A;  5IOI A;  2NVU I;  4MEL A;  3V62 A;  1C4A A;  2DZK A;  3C8Y A;  1I4G A;  1KOT A;  4EKU A;  4E71 A;  4XDD A;  1IBX A;  3U7D A;  5EDS A;  1TY0 A;  1R4M I;  2KTF A;  1I35 A;  2BKR B;  1SB3 C;  3IAS 1;  1LGR A;  3E56 A;  3PS6 A;  3B2G A;  4B0M A;  1HXY D;  1PFD A;  3AM9 A;  3BVG A;  5AZG A;  3K9P B;  3WAM A;  3X0W A;  4J6I A;  3Q69 A;  1P7F A;  1LQB A;  3B2F A;  3CSF A;  3KYC D;  3ZXR A;  1ZKH A;  2KDE B;  1QOG A;  1WMH A;  3E9S A;  2IGD A;  1I4Q A;  1KRH A;  2RDG A;  3QC8 B;  3WAL A;  2ACZ B;  4DWF A;  5DPS A;  1UNS A;  2NBV B;  4XWW A;  3EUB 2;  4NJC A;  3O65 B;  3PLV A;  2WDT B;  3QJZ A;  3VTW A;  2CHX A;  3FIL B;  2JZP A;  1T0Q C;  1WX9 A;  2CKH B;  4RMA A;  4HXD A;  3Q8A A;  4IM0 A;  2Z8L A;  3L10 B;  3HIZ A;  1TTN A;  4A55 A;  1XD3 B;  4MEM A;  3Q8B A;  1RYJ A;  3I5J C;  3H7P A;  2WQY B;  2I2Y A;  2B76 B;  3UQA A;  1KLU D;  3TSS A;  5BMG A;  3OG5 A;  2N9K A;  4EE2 A;  1QT9 A;  5FKA C;  3VTU A;  4A8X C;  1ACC A;  3NVZ A;  4KVG B;  2PLP A;  4RGM A;  1J7A A;  2G9H D;  1S3S G;  5BMI A;  5EE1 A;  2JRH A;  3R7R A;  1UWM A;  3Q3M C;  4NY0 A;  3ETR A;  4BKT A;  2KDM A;  2JU6 X;  1RWS A;  3VUY A;  3W5V B;  5JXV A;  3EA6 A;  2BB6 A;  2LMC A;  3U4E G;  3ZJT A;  2KKC A;  4FHK A;  1V1P A;  2KAN A;  2KWD A;  1MG4 A;  1L6V A;  2K8B A;  2N7E A;  3VTV A;  2ZZP B;  2KX3 A;  3AE9 B;  5GMV A;  3HHM A;  4HKZ E;  3ABV B;  3BWU D;  1EO6 A;  1X1M A;  1SXT A;  1L0X B;  1AW7 A;  4B9K A;  2AQ1 B;  3P4Q B;  4MGY E;  1Z5S B;  3KUC B;  4ICV A;  5E6O A;  1NYR A;  1TGZ B;  2KAJ A;  2H89 B;  2VZK B;  4US9 A;  4BOZ B;  3IT6 B;  3ML9 A;  4EEW A;  2KFK A;  3DBR I;  1YJJ A;  2G1E A;  4EFO A;  2ZPY A;  3ZTC A;  1WRI A;  1WIA A;  1P7E A;  3Q3F A;  1D5X C;  4AS1 A;  2M0A A;  1ZE3 D;  1Y8R C;  3AE3 B;  3Q3N C;  4JLC A;  5TSS A;  1QOF A;  2AL3 A;  1XO3 A;  2KTR B;  3PZ7 A;  4KGR A;  2O6V D;  2CU3 A;  1A5R A;  4IG7 B;  5CTR C;  2C7H A;  4G11 A;  3R8B A;  1V1P B;  3PZ8 A;  1KM7 A;  4WUR A;  1QQR A;  2V4I B;  4ZYS A;  1ZDV A;  4J3O D;  1FIQ A;  2IPK D;  2L00 B;  5AUK A;  4GDK B;  2M17 A;  4GOC A;  1WJ4 A;  3AB5 A;  3EFC A;  5E6N A;  3PLU A;  1V80 A;  1HA5 A;  1B1Z A;  2LXC A;  4YSX B;  2J53 A;  3L16 A;  1M94 A;  2CHW A;  4RCO A;  2DAJ A;  4HDQ A;  4BBN F;  2DEN B;  1ESF A;  4RF0 A;  3AN1 A;  3ZKJ C;  1WX7 A;  3HK0 A;  4DDG D;  2HTM E;  3AE2 B;  3GOE A;  4TMA B;  4EZK A;  2PEA A;  1C4P A;  3L17 A;  1WJ6 A;  4FN2 A;  1PYW D;  4NAW A;  2I1K A;  2NTS A;  3PSE B;  2N9L A;  5J2R A;  1ZXH A;  2GBK A;  3VH4 B;  4IWQ A;  1WXS A;  2DHZ A;  1YJI A;  1TZO A;  2N7J A;  3DQV A;  1NI2 A;  3VHT C;  2UWQ A;  2JX5 A;  5DPW A;  2VH1 A;  4N9F 4;  4I6N B;  2WDR B;  1I4P A;  3TBL D;  2JWU A;  2L05 A;  4HLE A;  2KLC A;  3KLS X;  3Q14 C;  1F0Z A;  1NYQ A;  2IO0 B;  1KTK A;  4DXG A;  4LK0 M;  4A9A A;  3DWM A;  4S17 A;  4D2K A;  1D5Z C;  1RFK A;  2LVQ A;  4MM3 A;  2IGH A;  2XNA C;  3NG0 A;  2X38 A;  4C7Z A;  4IUM B;  3MHS D;  4W9K A;  4KDL B;  2M19 A;  2KNB A;  1FNW A;  1XLQ A;  1GPX A;  2RMM A;  5JHB A;  4H2A A;  4Q2J A;  3U30 A;  4YTM B;  1KLG D;  4BKG A;  3NVW A;  3I63 C;  2KZR A;  1E5W A;  1IGC A;  1LFD A;  4BBN C;  2J52 A;  1TYG B;  3TIX A;  1FCL A;  3DBH I;  2GBM A;  2GBN A;  4S0R A;  4LNO A;  4IM2 A;  3DBS A;  1SE3 A;  1E7V A;  1FCC C;  1KJT A;  1E8W A;  2JVC A;  3ZO5 B;  3IG3 A;  2JF5 A;  1V86 A;  4EUT A;  5GXG B;  1ZP0 B;  3BYY B;  1XXG A;  1TKG A;  2YEP B;  1MVK A;  1WR1 A;  1YQ4 B;  3A4R A;  3V05 A;  4US8 A;  2JT4 B;  4E3C A;  4ZYN A;  3V3X A;  2VRR B;  4LDT D;  1WE7 A;  2KWC A;  1PGX A;  4PYU A;  1UUP A;  3AE7 B;  3ONS A;  4PYZ A;  3AV8 A;  2NCN A;  4W9H A;  1UH6 A;  4HVB A;  2CU1 A;  2LHD A;  4OVV A;  2XBB C;  2Y5P A;  3R66 C;  2NBW B;  5G5H A;  1WI0 A;  1P0R A;  2PE6 B;  2GBR A;  2M4N A;  1JWU D;  4TSS A;  1YQ3 B;  1UF0 A;  3H8H A;  1WXV A;  2Z0D B;  5KHO A;  1FXT B;  3AEE B;  1E8Z A;  4W9L A;  1K8R B;  1F2R C;  1V5T A;  1E10 A;  1E8X A;  5DPT A;  2N9P C;  3T3N A;  4C80 A;  3ZRF A;  2FCQ A;  5BYS A;  1VD2 A;  3ZLZ A;  4OZC A;  2IBI B;  4XWT A;  4JWS C;  1L7Y A;  4AWJ A;  2QHO A;  1RRB A;  3URY A;  3SEB A;  4M02 A;  4WAA A;  4EZJ A;  4M0W B;  3PZD A;  3ZTD A;  4YL8 A;  3L08 A;  3BVZ A;  1U4A A;  2A4Z A;  3U52 E;  2KJH B;  3NZ3 A;  3RMK C;  4ZRJ A;  4HKQ A;  1T0Y A;  3NRZ A;  2K5P A;  1CJE A;  2BBC A;  3QQ8 B;  3P42 A;  2ONQ A;  2N9X A;  2DAF A;  3P4S B;  2OJR A;  3DWG C;  3WAN A;  4KKI A;  1SBB B;  4FXC A;  2KMA A;  2M1M A;  1IBX B;  2J0J A;  3NJT A;  3ZDT A;  4MAC A;  5D3I B;  2PMV A;  1OQQ A;  2MJE A;  1FMA D;  2BWF A;  1YX5 B;  3RN9 C;  2WXR A;  3L4P A;  3IVF A;  4BOS C;  4G0N B;  4HPM B;  5HKH A;  2J7Q B;  4AOF A;  3KWL A;  1XLN A;  1SEB D;  4WJQ A;  2W3R A;  4YTN B;  2JXT A;  3UIN B;  5BMH A;  2FBW B;  4PS7 A;  2IJ0 A;  3GP7 A;  1EM7 A;  1TKE A;  4RGT A;  4HRO A;  1Q10 A;  2ZNV B;  2BGF A;  2ZCC A;  2LVP A;  1V2Y A;  1HEZ E;  2FUH B;  3O13 A;  3RFZ B;  3WAO A;  1D3Z A;  2MQJ A;  2LJ5 A;  4N59 A;  4MGK E;  4B0E A;  4FA6 A;  4IWO A;  2ZPN A;  3Q8F A;  3AEA B;  4K7S A;  3PHX B;  1TS2 A;  4IW0 A;  3VRB B;  2C7N B;  2FID A;  2XN9 C;  2LJI A;  2C9W B;  2BF8 B;  1GAQ B;  3VR9 B;  2KTR A;  3UI3 A;  1YOV B;  2LGX A;  2MP2 B;  2CR5 A;  3LXF A;  1EF5 A;  4OZA A;  2Y5C A;  2BT6 A;  3ZXV A;  3U7Z A;  4YWG G;  3B0A A;  2WDQ B;  1T0S C;  2AWT A;  3B9J A;  2V0G A;  3IT4 B;  2G4S A;  2WX1 A;  1JQ4 A;  1YN4 A;  4R3D A;  1ZPS A;  4EZL A;  3CIR B;  1P1A A;  4ICU A;  1WXQ A;  4RNA A;  2LD9 A;  4WWN A;  1VZ6 A;  3U2S C;  3V60 A;  1SIF A;  3MC9 A;  2FCN A;  4ZRP A;  3BK2 A;  5BO4 B;  1NBF C;  2KN4 A;  2LZ6 A;  1C76 A;  2V3S A;  3DHI C;  3B08 A;  4KSL C;  3R7Q A;  4K3C A;  1F1H A;  4IWP A;  2RD0 A;  2L83 A;  2K1F A;  1V97 A;  4P1B C;  3BK1 A;  3MHZ A;  2L0F A;  1UZX B;  2E6X A;  2GBJ A;  1WJN A;  3I57 A;  4RFB A;  3BVM A;  1VCB A;  2K39 A;  4GSW A;  3OJ4 B;  2RGF A;  3R3M A;  1N63 A;  3SU8 X;  4JL9 A;  3AMZ A;  1I4H A;  2IYD B;  1PUT A;  1C78 A;  3AEG B;  4P1C C;  2HDE A;  1SJE D;  3N3K B;  2V3N A;  4ZRI A;  3NUH B;  3I9V 1;  2N1V A;  3AUL A;  2WLB A;  4E74 A;  4NJ7 A;  3UIP B;  3ZNI D;  3C19 A;  2KX0 A;  1GJZ A;  2KT7 A;  3ZNG C;  5HI1 A;  1FPY A;  2BWE S;  1KH0 A;  2FUG 1;  4ITK A;  1FRD A;  2BW2 A;  2YLM A;  5DCN A;  5FR3 A;  1E9M A;  1LM8 B;  1N5W A;  3A9K A;  2DZM A;  1WGH A;  4MM3 B;  5H92 C;  2RSU A;  1GB1 A;  2QSD A;  2IO2 B;  2RPQ A;  2WNM A;  3PGE A;  3AEF B;  5G5G A;  4YXD B;  2QCZ A;  1WX8 A;  2KWV B;  4A6Q A;  2NS5 A;  1TS3 A;  4NAM A;  2BYV E;  1WXM A;  2NMQ A;  4WWP A;  4W9C A;  1EF1 A;  5MPO A;  2G3Q B;  3PRP B;  3H6N A;  2NBU A;  1L2N A;  4BAX A;  2R2O A;  4PS8 A;  3GB1 A;  1VZ7 A;  4NQL B;  2WHI A;  2ZJD A;  3IBE A;  2QMT A;  4CYE A;  4LNF A;  3RNA C;  4JPS A;  1V81 A;  4W9D A;  3LYY A;  1V1O A;  3DVG X;  1VDV A;  5IAA C;  2LXA A;  4RH6 A;  2H88 B;  2W55 A;  3CF6 E;  2FCS A;  3KW5 B;  4N6E B;  2QDF A;  4HCP B;  1GG3 A;  2TSS A;  1FFU A;  4IOI E;  2D3B A;  1DYQ A;  1N6Z A;  1WYW B;  2A5U A;  1Q5W B;  5TR5 A;  2SEB D;  4GN1 A;  3N1Y C;  4II2 B;  2GLS A;  1WY8 A;  4F1S A;  4C00 A;  4NPN A;  2JSV X;  2LGY A;  2MBH A;  3PV1 A;  3AU5 A;  3DVG Y;  5H8Y E;  2GMI C;  4W9G A;  2QIL A;  1TS4 A;  1J8C A;  3TEY A;  3GZN I;  5EE0 A;  4DHZ B;  4HPL B;  2XEW A;  2ASQ A;  5HG2 A;  2BS4 B;  1DOX A;  1NEN B;  2LEK A;  4A90 A;  3CWI A;  2WX0 A;  3J9C A;  3WA0 A;  3IAM 1;  2NR2 A;  4LDT B;  2W54 A;  4RGN A;  4KZC A;  3KYD D;  5EE3 A;  1VLB A;  4F7Z A;  4HEA 1;  2YVC A;  4USA A;  3BZD B;  1ZXI A;  4DXA B;  1RLF A;  4L1B A;  2FNJ B;  1WGR A;  1IP9 A;  2MWS B;  3APC A;  1RFA A;  1ET9 A;  1MHH E;  3RZF A;  1A70 A;  4LNK A;  2L1A A;  2KAC A;  4B95 A;  4L23 A;  1NDD A;  1H4R A;  2INC C;  3JVZ X;  4TKN A;  4HDO A;  4GDL B;  4NAW B;  3KQ4 A;  2KO3 A;  2K3U A;  3AXC A;  4REZ A;  2RDB C;  1JRO A;  2RR9 A;  3QHT A;  4WJN A;  2EEL A;  2REX A;  4YSZ B;  4N58 A;  2K6D B;  2JZ3 B;  2NPT B;  3WIM A;  3AE4 B;  1MPE A;  3MC8 A;  2MA9 B;  3KWV A;  4PK1 A;  3VFK A;  3T9L A;  3A1Q A;  2KDF B;  2PVG C;  3NS8 A;  4FBJ B;  1SIJ A;  4HRS A;  1TBE A;  2V4L A;  2N7D A;  1QF6 A;  3M63 B;  5C1Z A;  3TEW A;  1WSP A;  3NOB A;  2WYQ A;  2IO3 B;  1E6E B;  1UGM A;  3P4R B;  1CK1 A;  1J7C A;  1FFV A;  2M0X A;  3A9J A;  3ZW3 A;  1K52 A;  1F2R I;  3QAR A;  2QJL A;  3DDC B;  3HVD A;  3N20 C;  4M01 A;  4MH8 A;  1PGA A;  1DOI A;  1YIW A;  5D6J B;  4K1R B;  3AH7 A;  2HJ1 A;  4RM9 A;  2PTL A;  1J0G A;  3L0W B;  1R7S A;  3GZN B;  2LGI A;  2KWU B;  3QWZ B;  4W9F A;  2XK5 B;  3U8Z A;  3IFW B;  1WGK A;  1H8C A;  3EC8 A;  2Y5B B;  1JRP A;  2HJ8 A;  4KDI C;  2LI5 A;  3IHP C;  1Z2M A;  1TKY A;  4BKS A;  1JAL A;  4ACF A;  3UGB B;  3A1Q B;  4KIK A;  3KUZ A;  4PS3 A;  3N30 A;  4I6L B;  2HTH A;  1BT0 A;  2KHW B;  1UD7 A;  2L76 A;  2IZV B;  2INP E;  3EGR A;  3FC4 A;  3DBL I;  1ENF A;  3W1S A;  2KDI A;  2K8C A;  2KLG A;  1C1Y B;  2YEP F;  4II3 B;  1WR6 E;  3Q3O C;  1Q0W B;  2OHF A;  3BIN A;  2L3Z A;  2V9H A;  3EHV A;  1YNT E;  2WDV B;  4KX6 B;  2V3P A;  4P7I A;  2AYO B;  2OJW A;  3DBR B;  1RM6 C;  2J4X A;  3NVV A;  4WQO B;  4AP4 C;  3WAP A;  5J17 A;  2MJD A;  4FHJ A;  5FR6 A;  2KYW A;  2J0M A;  2UYZ B;  2PKO A;  2MJ3 A;  3GE8 C;  3RD2 A;  1QOA A;  1M4V A;  4AQ7 A;  3KUD B;  1P3Q U;  1STE A;  4EOY A;  2K8H A;  5L95 C;  4KV2 A;  3DVN U;  4OZB A;  2OOB B;  2UU7 A;  5C2T B;  4DHZ E;  1I4R A;  1TIF A;  3GS2 A;  3AE8 B;  3QX1 A;  1SE2 A;  3D32 A;  2R61 A;  1UEL A;  2IO1 B;  4M8N A;  2KFJ A;  2WXF A;  2ZW0 A;  4DHJ B;  4WJP A;  3PTF C;  5CHV C;  1OGW A;  2PIA A;  2CJO A;  1ZDX A;  3H1U A;  2D5G A;  4K3B A;  4WQM A;  1MFW A;  1EU3 A;  4TQ1 A;  4AJW A;  2MLB A;  3PRM B;  1JWM D;  1E7P B;  2VZK D;  4K7W A;  3VXW A;  4NZL B;  2LUE A;  1UWX A;  4MGZ E;  2JYE A;  2KC2 A;  2WU5 B;  4GU2 A;  4K7U A;  1I42 A;  1D5M C;  2CJN A;  3LB8 C;  1SGH A;  4MT5 A;  4JGH B;  2K6Q A;  4HPP A;  4IDI A;  1XQQ A;  4ANU A;  4TQ0 A;  4YSY B;  3ECI A;  1MG8 A;  3Q3J A;  1RAX A;  3A4S C;  2BVC A;  2M8S A;  4FJY A;  1FXA A;  3VVW B;  2D10 A;  3UQB A;  2JYT A;  1R4M B;  3V61 A;  2EKI A;  5BYR A;  2G45 B;  3PRE A;  1PDX A;  4M00 A;  1EUV B;  4ZOH C;  2O6V A;  3DBH B;  5IKC M;  1XLP A;  4OHJ A;  2EMT A;  1FRR A;  2HE7 A;  2DX5 B;  1HTO A;  3MJW A;  3PVL A;  2D3C A;  1JWB D;  2LGD A;  1WGD A;  1QOB A;  1JWA D;  3A9J B;  1WJU A;  1P98 A;  3QAQ A;  4CHK A;  2ZVN A;  4IM3 A;  1OEY J;  3OJ3 A;  4JWU C;  4XC2 A;  2AEH A;  2BQQ A;  3EEC A;  4OVZ A;  3RNC C;  5D2M B;  3VH3 B;  2IY1 B;  2KC1 A;  1WF9 A;  3RUI B;  1UGJ A;  1DOY A;  1MI0 A;  2KJR A;  1WE6 A;  3LDZ E;  2DZI A;  1K50 A;  1J7B A;  2V1Y A;  2BPS A;  2MP2 A;  1J19 A;  5AZH A;  1L4D B;  3RI7 C;  3T8M A;  1Y56 A;  5D7G A;  3VDZ A;  1GB4 A;  4MSM B;  5FK9 C;  2LRW A;  2ZVO A;  4ANV A;  2D11 A;  1FD6 A;  4FUL A;  4IKG A;  2L0T A;  4HK2 A;  2QC8 A;  5KHQ A;  3NHE B;  3QK0 A;  3SFE B;  2BTE A;  1BML C;  3OWE B;  3WCQ A;  2C5L C;  2LFI A;  2WP9 B;  3TMP B;  3VUX A;  3BII D;  4ZRQ A;  3NVY A;  1EWY C;  2L7R A;  4LJP B;  4GB9 A;  4LCD E;  2FE8 A;  3W5U B;  4CQN A;  5JZE B;  4XZ4 A;  2DLB A;  3NZS A;  3JYU A;  2BKF A;  3P63 A;  4W9J A;  1CMX B;  1WGG A;  1JW9 D;  4O1N A;  4ANW A;  2GB1 A;  4P16 A;  3ZGZ A;  1T0R C;  4JQW C;  2K22 A;  1ZOY B;  4BKS D;  2ZCB A;  3Q6B A;  2RDH A;  5E6J A;  5LLI A;  2O6V B;  5L83 A;  2WXJ A;  4OW0 A;  1KFY B;  4HJG E;  3FAH A;  4ARI A;  1IUE A;  2BB5 A;  1I7H A;  1AAR A;  2DYO A;  1R4N B;  3H7P B;  1XT9 B;  2GOW A;  5EE9 A;  2MH7 A;  3MJ5 A;  3M3J A;  3AEC B;  3P2B A;  3C0R B;  1OFF A;  3ZRC A;  4GXB A;  1VR9 A;  3NS1 A;  1CZP A;  2N0S B;  2PVO D;  4RGO S;  1OQR A;  2LAS A;  1HE8 A;  2ZW1 A;  4KIK B;  3M95 A;  1T6B X;  1C79 A;  2AQ3 B;  5JHA A;  2LHE A;  2IDY A;  2E3T A;  1ISN A;  1OEY A;  2D3A A;  1N61 A;  2R2Q A;  4XGA B;  2BS2 B;  2PJH A;  1GC7 A;  4C4V A;  4XE0 A;  3MC0 B;  1WZ0 A;  4A3P A;  3PT2 B;  3ALB A;  3CMM B;  4AJY B;  4M0W A;  4JIO U;  4C7Y A;  4LLG M;  2JWZ A;  3QCA A;  2WXO A;  4JE3 B;  5C23 A;  4MGI E;  3KH0 A;  2WXQ A;  2WGS A;  4GDK A;  2WXN A;  3SR6 A;  3W1S C;  1K51 A;  4WH4 A;  2DZJ A;  2JQR B;  2ICI A;  4MJS B;  1KLV A;  3TEZ A;  3RZW C;  1B9R A;  3RPF C;  1SE9 A;  4HCN B;  1YN5 A;  2LRU A;  3AEB B;  3ZUN A;  1WZ3 A;  2PPH A;  4I6P A;  1L0V B;  1F9J A;  2SAK A;  1YN3 A;  4KGS A;  2IY0 B;  2WWZ A;  3VQI A;  4KZ0 A;  1HTQ A;  2I1J A;  3P4P B;  2JXX A;  4KGT A;  5CHF A;  2INN E;  1WH3 A;  5HFY A;  4C4V B;  4LNN A;  2J42 A;  3AE1 B;  2WXG A;  2K0P A;  2MCN B;  2BYE A;  4TV3 A;  3DCG A;  3AU4 A;  1F77 A;  2LVO A;  3BY4 B;  5IO9 A;  2AQ2 B;  1FNU A;  1I4X A;  4DXF A;  2Q5W D;  3W2D A;  2W9N A;  3B1L X;  4XYC A;  4NNJ B;  1TS5 A;  1HZ5 A;  2N4F A;  2KQ4 X;  4WJO A;  1QLB B;  1C9F A;  4FAD A;  4AUQ C;  3HUI A;  4RF1 A;  2L32 A;  3W9C B;  3ZVV A;  5CHW A;  1PGB A;  1FNV A;  4BVU C;  2WXI A;  4ANX A;  4GMV A;  3M62 B;  5LXI B;  1YD8 U;  4QAY A;  3V6C B;  3RYT A;  3OAW A;  2BYT A;  4TUU A;  2JY6 A;  2KXJ A;  4NQK E;  4P6V F;  1SSN A;  4FJZ A;  1F52 A;  5I4D A;  3SDL C;  2L52 A;  3HVZ A;  3ZYY X;  5IP4 D;  3SFD B;  3P1M A;  3UIO B;  1E90 A;  1Q1O A;  3FKY A;  1L0Y B;  4DK5 A;  3EFU A;  1ZUD 2;  2MEK A;  2G4D B;  2I38 A;  4DBG A;  4G50 A;  4BFR A;  2MBE A;  3LJ3 A;  1IGD A;  4JX1 C;  1WMH B;  4A20 A;  2GRI A;  5BYQ A;  3MFG A;  1MHX A;  3Q8C A;  5D3D A;  4DHJ D;  1E0Z A;  2KOX A;  1L6U A;  1HQR D;  1OTR B;  2LWP A;  3TCA A;  1T5X D;  3T3O A;  3AI5 A;  3RUL A;  1LO5 D;  1DGJ A;  3ZJU A;  1NVI D;  4FJV B;  4GIV A;  4GLS C;  3N1X C;  4G3X B;  2KN5 A;  2K9X A;  1V49 A;  2MBB B;  2WXK A;  3NY5 A;  4ZDV A;  2WXM A;  1XCT L;  2NPT A;  4MSQ B;  1ZGU B;  3IXS A;  4L2Y A;  4PT5 A;  2JZZ A;  4URK A;  1P9D U;  1QIL A;  4MDK E;  2MBO A;  1WWT A;  3N9Y C;  1G6J A;  1AYF A;  1SE4 A;  3A33 B;  2OED A;  4LJO B;  1NEK B;  3Q2A C;  3DPD A;  3RNB C;  5IN7 A;  2DYB A;  1V5O A;  5C3J B; 
#chains in the Genus database with same CATH homology
 1XQQ A;  2RD0 A;  4ANU A;  2K1F A;  1Y8R C;  4TQ0 A;  2N9E B;  2HD5 B;  1V6E A;  4JLC A;  2L0F A;  3ECI A;  1MG8 A;  3Q3J A;  1RAX A;  1UZX B;  3A4S C;  2AL3 A;  2GBJ A;  2KTR B;  5AEK B;  1WJN A;  3W1Y A;  1GUA B;  3JSV A;  4KSK C;  2M8S A;  3VUW A;  5D94 A;  3SHQ A;  2XK5 A;  1VCB A;  2O6V D;  1A5R A;  2K39 A;  4GSW A;  3OJ4 B;  4IG7 B;  5CTR C;  4FJY A;  2RGF A;  3VVW B;  1E7U A;  2D10 A;  4M8M A;  3ZNZ B;  2C7H A;  1OQY A;  3UQB A;  4G11 A;  3R3M A;  4RM8 A;  5CX3 A;  3SU8 X;  3RCZ A;  3NZU A;  3V61 A;  4ASW C;  4JL9 A;  2G45 B;  5IA7 A;  3PRE A;  2KDB A;  1KM7 A;  2IYD B;  2L8J A;  3CST A;  3X23 A;  4OVU A;  4FLH A;  1EUV B;  2O6V A;  3N3K B;  2Z59 B;  2ZNV C;  4ZRI A;  2N1V A;  3AUL A;  3HM6 X;  3PHW B;  3VAW A;  4E74 A;  5JH5 C;  4NJ7 A;  2EMT A;  3UIP B;  3ZNI D;  3RT3 B;  2L00 B;  2KX0 A;  4GDK B;  2HE7 A;  1GJZ A;  4DDI D;  2DX5 B;  4GGQ A;  3MJW A;  2M17 A;  4A3O A;  3PVL A;  5G55 A;  4GOC A;  3ZNG C;  1WJ4 A;  3N32 A;  2BWE S;  4HWI B;  2LGD A;  1WGD A;  2YLM A;  5DCN A;  3TJP A;  1LM8 B;  3A9J B;  5E6N A;  3A9K A;  1WJU A;  2DZM A;  1WGH A;  1P98 A;  3QAQ A;  4CHK A;  3PLU A;  1V80 A;  2ZVN A;  4IM3 A;  1YJ1 A;  2ZEQ A;  3ML8 A;  1OEY J;  2RSU A;  2FAZ A;  1R4N I;  2KMC A;  3OJ3 A;  2LXC A;  2IO2 B;  3L16 A;  2RPQ A;  1M94 A;  2Z0E B;  3PGE A;  2CHW A;  2JUO A;  2DAJ A;  4HDQ A;  4BBN F;  2DEN B;  2AEH A;  2CS4 A;  1WX8 A;  4XC2 A;  2B3A A;  5AZF A;  1IYF A;  2KWV B;  4W9E A;  2NS5 A;  2BYV E;  3EEC A;  1WXM A;  3ZKJ C;  5D2M B;  3DOW A;  2IY1 B;  1WX7 A;  3HK0 A;  3JW0 X;  2KC1 A;  1WF9 A;  4W9C A;  1EF1 A;  3GOE A;  4WWP A;  3RUI B;  4EZK A;  5E6P A;  4XX5 A;  1GC6 A;  2PEA A;  3APF A;  1JRU A;  2G3Q B;  3L17 A;  3PRP B;  1WJ6 A;  1PQS A;  1IPG A;  2NBU A;  3H6N A;  4FN2 A;  4MH0 E;  2KJR A;  1WE6 A;  3K9O B;  2DZI A;  3LDZ E;  1L2N A;  4NAW A;  2I1K A;  3S2A A;  3PSE B;  5J2R A;  2C7M B;  2R2O A;  4PS8 A;  2GBK A;  2BPS A;  2V1Y A;  3VH4 B;  4IWQ A;  2MP2 A;  1WM2 A;  1WXS A;  1J19 A;  5AZH A;  2DHZ A;  3DQV A;  4NQL B;  3TL5 A;  1NI2 A;  2ZJD A;  3T8M A;  3VHT C;  2MW5 A;  2UWQ A;  3A9K B;  2EKE C;  3IBE A;  5DPW A;  5D7G A;  1LXD A;  1E8Y A;  1GNU A;  4CYE A;  3VDZ A;  4N9F 4;  4MSM B;  2BYF A;  4I6N B;  3TBL D;  2LRW A;  3ZIM A;  3OLM D;  2ZVO A;  4ANV A;  1V81 A;  2D11 A;  3PRZ A;  4W9D A;  2L05 A;  4FUL A;  4HLE A;  2KLC A;  2L0T A;  1UBQ A;  1WGY A;  2PE9 A;  3DVG X;  4HK2 A;  5IAA C;  2LXA A;  2IO0 B;  5KHQ A;  3NHE B;  3QK0 A;  2D3G A;  3CF6 E;  3H7S A;  1YX6 B;  4MJS A;  2FCS A;  3KW5 B;  2LVQ A;  2KQ7 A;  4MM3 A;  4HCP B;  1GG3 A;  2C5L C;  4IUM B;  3MHS D;  4W9I A;  3TMP B;  4W9K A;  3VUX A;  4KDL B;  2KNB A;  2L7R A;  4LJP B;  1WYW B;  4GB9 A;  2A5U A;  4LCD E;  1Q5W B;  5TR5 A;  4GN1 A;  3HM3 A;  2MBQ A;  5JZE B;  5JHB A;  5G2N A;  4NJ6 A;  3U30 A;  4XZ4 A;  2MX2 A;  3NZS A;  4BKG A;  2KZR A;  3APD A;  3JYU A;  2BKF A;  1E5W A;  1WFY A;  4W9J A;  1LFD A;  1QZE A;  1CMX B;  4B6W A;  4BBN C;  4GDL A;  4II2 B;  1WY8 A;  4F1S A;  4NPN A;  3TIX A;  1WGG A;  3DBH I;  2LGY A;  2CHZ A;  2GBM A;  2MBH A;  3PV1 A;  4K81 A;  3AU5 A;  2GBN A;  3DVG Y;  2JRI B;  3QIJ A;  4ANW A;  2GMI C;  2KFK B;  4IM2 A;  3DBS A;  4W9G A;  5J18 A;  4JQW C;  1E7V A;  4ZRK A;  1J8C A;  1KJT A;  4BKS D;  1E8W A;  2ZCB A;  3GZN I;  2O2V B;  5DPR A;  2JVC A;  5LLI A;  2O6V B;  3ZO5 B;  3IG3 A;  4HPL B;  4HJK A;  4DHZ B;  4WWO A;  2JF5 A;  1V86 A;  2XEW A;  2MRP A;  2ASQ A;  4EUT A;  5L83 A;  5LXH A;  1S1Q B;  3L13 A;  1V9J A;  1WM3 A;  2WX0 A;  1WR1 A;  2C60 A;  3A4R A;  3WA0 A;  1ZW7 A;  4IC7 B;  2NR2 A;  1AAR A;  3ZNH B;  4LDT B;  2DYO A;  2JT4 B;  3H7P B;  1XT9 B;  2GOW A;  4KZC A;  4E3C A;  3KYD D;  3M3J A;  4F7Z A;  4ZYN A;  3P2B A;  2YVC A;  3C0R B;  2VRR B;  3ZRC A;  2KVR A;  2KJ6 A;  4CO7 A;  4DXA B;  4GXB A;  1RLF A;  3MTN B;  3L54 A;  4LDT D;  3ZDM C;  2FNJ B;  3H9D A;  1WE7 A;  1WGR A;  2KWC A;  1IP9 A;  2MWS B;  3APC A;  2KQS A;  1RFA A;  2LAS A;  1HE8 A;  4KIK B;  4PYU A;  3PPA A;  2D2Q A;  3M95 A;  3ONS A;  4PYZ A;  3RZF A;  4F8C B;  2K25 A;  3SD5 A;  2KK8 A;  5JHA A;  2NCN A;  4W9H A;  1UH6 A;  4HVB A;  1ISN A;  1OEY A;  2KD0 A;  2CU1 A;  2R2Q A;  4B95 A;  4OVV A;  2XBB C;  1NDD A;  2DYM A;  1H4R A;  2PJH A;  3R66 C;  3KVF B;  1GC7 A;  3JVZ X;  2NBW B;  4TKN A;  1YQB A;  4HDO A;  1WI0 A;  1P0R A;  2PE6 B;  4GDL B;  2GBR A;  2M4N A;  1UBI A;  4NAW B;  1WZ0 A;  2KO3 A;  2FCM A;  1WRD B;  3V6E B;  4A3P A;  3AXC A;  3PT2 B;  1WXV A;  3ALB A;  2Z0D B;  3CMM B;  1FXT B;  5KHO A;  4AJY B;  4JIO U;  2AL6 A;  2O2V A;  3QA8 A;  2EMS A;  2JWZ A;  1TZ1 A;  1E8Z A;  3QCA A;  4W9L A;  2RR9 A;  3QHT A;  1K8R B;  4WJN A;  1V5T A;  3DVN V;  5C23 A;  4MGI E;  2FIF A;  2N1W A;  1E8X A;  2D07 B;  2MSE D;  3KH0 A;  2REX A;  3UF8 A;  3JSV B;  4GDK A;  3W1S C;  2K6D B;  2JZ3 B;  2DZJ A;  2NPT B;  3WIM A;  5DPT A;  3I3T B;  4MJS B;  2N9P C;  2MA9 B;  1C3T A;  1WXA A;  3VFK A;  3ZRF A;  1KLV A;  2FCQ A;  2JPH A;  3RZW C;  3ENE A;  3T9L A;  1VD2 A;  3A1Q A;  2KDF B;  4X57 B;  3ZLZ A;  3NS8 A;  1SE9 A;  2IBI B;  2J0K A;  2LRU A;  4HCN B;  4FBJ B;  2NVU I;  1TBE A;  2V4L A;  2N7D A;  1WZ3 A;  2PPH A;  4MEL A;  3ZUN A;  4I6P A;  1L7Y A;  1F9J A;  3V62 A;  2QHO A;  3M63 B;  1RRB A;  4AWJ A;  5C1Z A;  4DDG D;  2DZK A;  4WAA A;  3NOB A;  2IY0 B;  2WWZ A;  2WYQ A;  3VQI A;  4EZJ A;  1KOT A;  4M0W B;  2IO3 B;  4EKU A;  1UGM A;  3PZD A;  4E71 A;  4KZ0 A;  3ZTD A;  2I1J A;  4YL8 A;  3L08 A;  3U7D A;  5EDS A;  1U4A A;  2JXX A;  1R4M I;  2KTF A;  2A4Z A;  1I35 A;  2KJH B;  2M0X A;  3A9J A;  3ZW3 A;  5CHF A;  2BKR B;  1WH3 A;  4ZRJ A;  3QAR A;  3DDC B;  1T0Y A;  3PS6 A;  2MCN B;  2BYE A;  4TV3 A;  3VH3 B;  3QQ8 B;  1YIW A;  3DCG A;  3AU4 A;  2LVO A;  5D6J B;  2N9X A;  2DAF A;  4K1R B;  3BY4 B;  5AZG A;  3K9P B;  4RM9 A;  2OJR A;  3WAM A;  3WAN A;  1J0G A;  3L0W B;  4J6I A;  3X0W A;  2KMA A;  1LQB A;  2M1M A;  2J0J A;  3CSF A;  3KYC D;  1ZKH A;  3ZDT A;  2KDE B;  2W9N A;  3B1L X;  2KWU B;  3QWZ B;  4W9F A;  4NNJ B;  1WMH A;  2XK5 B;  3U8Z A;  3IFW B;  2N4F A;  1H8C A;  2BWF A;  3EC8 A;  2Y5B B;  1YX5 B;  3QC8 B;  4WJO A;  3WAL A;  4DWF A;  3IVF A;  4BOS C;  4G0N B;  2HJ8 A;  4KDI C;  5DPS A;  2LI5 A;  2NBV B;  3O65 B;  3PLV A;  3IHP C;  1Z2M A;  2WDT B;  3QJZ A;  4HPM B;  4FAD A;  3VTW A;  2CHX A;  4AUQ C;  2J7Q B;  4BKS A;  5HKH A;  4AOF A;  3UGB B;  3A1Q B;  1WX9 A;  4WJQ A;  4KIK A;  3KUZ A;  4PS3 A;  2CKH B;  4RMA A;  3ZVV A;  3N30 A;  4HXD A;  4I6L B;  4IM0 A;  3L10 B;  5CHW A;  2HTH A;  3HIZ A;  1TTN A;  3UIN B;  4BVU C;  1XD3 B;  1BT0 A;  4PS7 A;  4ANX A;  4GMV A;  3M62 B;  2KHW B;  1UD7 A;  2L76 A;  4MEM A;  2IZV B;  5LXI B;  1YD8 U;  3V6C B;  3RYT A;  3OAW A;  3DBL I;  4TUU A;  2JY6 A;  3H7P A;  3W1S A;  2KXJ A;  2KDI A;  2K8C A;  2KLG A;  4NQK E;  1C1Y B;  3UQA A;  4II3 B;  1WR6 E;  4FJZ A;  1Q0W B;  2ZNV B;  3BIN A;  2BGF A;  2ZCC A;  2L3Z A;  2LVP A;  3SDL C;  3EHV A;  1V2Y A;  2FUH B;  4P7I A;  3VTU A;  3WAO A;  1D3Z A;  3UIO B;  2MQJ A;  2LJ5 A;  1E90 A;  2AYO B;  4KVG B;  1Q1O A;  4MGK E;  4FA6 A;  4DK5 A;  4WQO B;  4AP4 C;  3EFU A;  1S3S G;  4IWO A;  3WAP A;  2ZPN A;  5J17 A;  4FHJ A;  4K7S A;  3PHX B;  5FR6 A;  2UYZ B;  2J0M A;  2G4D B;  2JRH A;  4IW0 A;  4DBG A;  3R7R A;  4NY0 A;  4G50 A;  4BFR A;  2MBE A;  4BKT A;  3LJ3 A;  2C7N B;  3RD2 A;  2FID A;  3VUY A;  1WMH B;  2C9W B;  2BF8 B;  3KUD B;  1P3Q U;  2KTR A;  4EOY A;  4A20 A;  2K8H A;  5L95 C;  4KV2 A;  4DHJ D;  2LGX A;  2MP2 B;  2KKC A;  3DVN U;  2OOB B;  2KOX A;  4FHK A;  2CR5 A;  1OTR B;  2LWP A;  4DHZ E;  1EF5 A;  2KAN A;  3TCA A;  3QX1 A;  3AI5 A;  3RUL A;  3D32 A;  1UEL A;  2IO1 B;  2K8B A;  4M8N A;  2KFJ A;  2N7E A;  4DHJ B;  4FJV B;  3B0A A;  3VTV A;  2ZZP B;  2KX3 A;  4WJP A;  5GMV A;  3PTF C;  2AWT A;  5CHV C;  3HHM A;  1OGW A;  4GIV A;  2G4S A;  2WX1 A;  3H1U A;  4G3X B;  2KN5 A;  1EO6 A;  1V49 A;  2MBB B;  4EZL A;  1P1A A;  1X1M A;  4ICU A;  3NY5 A;  4TQ1 A;  4AJW A;  4ZDV A;  2MLB A;  4B9K A;  2NPT A;  4MSQ B;  3PRM B;  4MGY E;  1Z5S B;  2LD9 A;  1ZGU B;  4WWN A;  3KUC B;  4ICV A;  4K7W A;  5E6O A;  3V60 A;  3VXW A;  1TGZ B;  2JZZ A;  4URK A;  1P9D U;  1SIF A;  2LUE A;  2MBO A;  4MDK E;  2FCN A;  4MGZ E;  4BOZ B;  2KC2 A;  5BO4 B;  1NBF C;  3ML9 A;  2LZ6 A;  4GU2 A;  4EEW A;  4K7U A;  1I42 A;  1G6J A;  2KFK A;  3DBR I;  3A33 B;  2V3S A;  4EFO A;  4LJO B;  1SGH A;  2ZPY A;  3B08 A;  3ZTC A;  1WIA A;  3DPD A;  4KSL C;  3R7Q A;  4JGH B;  3Q3F A;  2DYB A;  2K6Q A;  1V5O A;  4IWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...