2NVUI

Structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
publication title Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein turnover, ligase
total genus 17
structure length 76
sequence length 76
chains with identical sequence J
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nvuI00
1I42A 3DCGA 3AULA 5DPSA 4ZDVA 4MSQB 2ZCBA 3A9KB 2FNJB 2HJ8A 4MM3A 4ZRJA 2ZPNA 3V60A 1VCBA 2J0MA 3ZLZA 1WXAA 1AARA 2WWZA 1K8RB 1GNUA 1TTNA 2JZ3B 3N30A 5AEKB 3NOBA 3APFA 4GMVA 4CHKA 2BGFA 2BKRB 3UIPB 3KUDB 2D11A 1IPGA 1L2NA 3TMPB 5D94A 5DCNA 3A4SC 3B1LX 5CTRC 4GB9A 2CHZA 3RD2A 4HK2A 3VUWA 4E3CA 2K8HA 2JPHA 2AYOB 3L13A 4W9DA 3ZO5B 1XT9B 1RFAA 2BWES 2KDBA 4FN2A 3UF8A 2LVQA 5CHFA 3ZNGC 5D2MB 2O2VB 4I6LB 3CMMB 2YLMA 1WGYA 3H7SA 2KJRA 4OVVA 4MEMA 3DVNV 4ZRIA 1YX5B 4WQOB 3UIOB 2LZ6A 1WJNA 3A1QB 4FJYA 1LFDA 1RRBA 3MTNB 2N7EA 2BWFA 3A33B 3KYDD 4OVUA 3PT2B 5HKHA 2FCSA 2R2OA 5D7GA 1WFYA 5C23A 2RPQA 4K7SA 1I35A 1WJ4A 2KKCA 4NY0A 1ZKHA 3HM6X 3VXWA 4AOFA 2UYZB 3CF6E 1FXTB 3D32A 2CKHB 4HDQA 2KFKA 2Z0DB 4EFOA 3H6NA 1WGGA 4IM0A 3RYTA 4W9GA 2A5UA 4IM3A 4AP4C 5GMVA 3WA0A 1EF1A 3NHEB 3IG3A 2WYQA 4IC7B 3H7PB 5CHVC 3TCAA 2LRWA 4XX5A 2EMSA 4LJOB 1WX8A 3SHQA 4DXAB 2KJHB 2AL3A 4CYEA 2KNBA 3UINB 4LDTB 5TR5A 2RR9A 1WR6E 2NR2A 1GG3A 3WALA 3ZNID 2KK8A 3SD5A 4BOZB 2V1YA 4IW0A 4ANUA 2KWCA 3GOEA 3H9DA 3QARA 2ZZPB 1IP9A 4GU2A 4A20A 2MWSB 3APDA 3LDZE 4FHKA 1KLVA 1WM2A 3OJ4B 1OEYA 2CU1A 4GXBA 4MELA 4DWFA 4F1SA 3M63B 2HE7A 2L76A 2CHXA 2IY0B 2KTFA 2OOBB 1YIWA 3TJPA 3AI5A 1WIAA 1YX6B 2KDEB 4LDTD 4W9LA 4WJOA 3AXCA 3VTWA 3WAMA 3DBHI 4NJ7A 5JZEB 3PSEB 2LGYA 3KYCD 4URKA 5D6JB 2KMCA 2DZMA 3U8ZA 4EOYA 5JHAA 2LWPA 3PPAA 5L95C 3EECA 2N1WA 4NNJB 3VH3B 3A9JB 5G2NA 3QWZB 4RM9A 3ZNZB 1UZXB 2KTRA 1GC6A 4I6PA 3NY5A 3QA8A 4HLEA 3ALBA 3DQVA 2DENB 3L0WB 3ZNHB 1A5RA 1WXMA 4GDLB 4II2B 5EDSA 1U4AA 2A4ZA 2JZZA 4AWJA 3KH0A 2PPHA 2CS4A 3ZRFA 1KM7A 2JRIB 4BKTA 4BOSC 1E7UA 2IO3B 1E8XA 1E8YA 1V81A 1V5OA 1VD2A 3KUZA 2PJHA 5FR6A 4HPMB 4AJYB 3KUCB 2K8BA 2V4LA 2GBKA 4AJWA 1WZ3A 3BINA 5C1ZA 2N9XA 3DBSA 3LJ3A 3KW5B 2C60A 3Q3FA 3QAQA 2DZJA 4W9HA 3DVGX 2KC1A 2D3GA 5LXHA 4LCDE 1E90A 4MH0E 5IA7A 1EUVB 2IY1B 3PS6A 2D2QA 2Y5BB 4BFRA 2IO0B 2K8CA 2XK5A 3QC8B 2C7NB 1WX7A 1YJ1A 3PRMB 4CO7A 3AU5A 3I3TB 3SU8X 2ZNVB 1R4NI 3K9OB 1RAXA 1ISNA 3UQBA 2ZNVC 3DOWA 4EZLA 1UELA 3TBLD 4NJ6A 3ENEA 4PYZA 1WXVA 3L10B 2KLGA 3A9JA 1F9JA 4WWOA 1P3QU 3ZTCA 1H8CA 1J19A 4KZCA 2DYBA 2C5LC 5AZHA 4KSLC 2REXA 3RULA 2LJ5A 2PE6B 2BKFA 2BYFA 2KN5A 2DYOA 2RSUA 4GDLA 3RZWC 1Z5SB 2IYDB 3R66C 4E74A 4HCPB 5J18A 3W1YA 4EEWA 4EKUA 4ASWC 3NS8A 3RT3B 4TQ1A 1V49A 2AWTA 2NBUA 4YL8A 1WGDA 2KMAA 4FULA 4HCNB 2BF8B 2KTRB 5CX3A 4W9CA 3ZKJC 2NCNA 4F8CB 2MRPA 2NBVB 2EKEC 4EZJA 2KHWB 4DHZE 3ZDTA 2M17A 2NPTB 3JSVB 3IBEA 3JVZX 4ANVA 3R7QA 1OTRB 1SGHA 2N1VA 2G4SA 3PGEA 3BY4B 5KHOA 2KOXA 1ZW7A 3QHTA 4W9FA 5AZFA 3S2AA 3ECIA 1WGHA 4MSMB 1WM3A 4ANXA 2L05A 4WWNA 4BKSD 2DX5B 2LASA 4IM2A 1SIFA 1E5WA 2JY6A 2UWQA 4TKNA 3C0RB 3QQ8B 3X23A 4NQKE 3W1SC 2M0XA 1Y8RC 1E8ZA 4HPLB 3RUIB 2WX0A 3JYUA 2J0JA 2JRHA 2N7DA 2LVPA 4WAAA 4K81A 1WRDB 4DDID 3GZNI 3PHXB 3RCZA 4IUMB 3R7RA 5DPWA 2L8JA 2GBRA 2KDFB 4X57B 3WAOA 2JVCA 3EC8A 3WIMA 3DVGY 1WI0A 5BO4B 1WZ0A 3DBRI 3PV1A 2KO3A 4MGIE 2RD0A 4G11A 4ICVA 2ASQA 1P9DU 2D07B 1WY8A 1WH3A 3R3MA 4JLCA 4WWPA 4DHJB 2XK5B 3DVNU 5IAAC 2DAFA 2WDTB 2CR5A 2FUHB 4K7WA 3V6CB 2ZPYA 1YD8U 3QX1A 4KVGB 4MJSA 5AZGA 2AL6A 1T0YA 4GSWA 1GJZA 5DPRA 3VAWA 3VVWB 4BKSA 2N9EB 2K39A 1H4RA 4DHJD 4G0NB 1OGWA 2MCNB 2I1KA 2NPTA 4ZRKA 3JSVA 4GN1A 2IO2B 2VRRB 1P98A 1V9JA 3PREA 3VUXA 2DZKA 5JHBA 5J17A 3L54A 2OJRA 3PRPB 3V61A 3QIJA 3CSTA 2EMTA 4II3B 4LJPB 5L83A 4IWPA 3EHVA 4W9KA 3IFWB 4MGKE 5DPTA 2KDIA 2RGFA 4DK5A 1MG8A 3QCAA 2GOWA 2XBBC 4J6IA 2PE9A 1V2YA 3ZRCA 4A3PA 2FCQA 1E8WA 2L00B 3W1SA 1WMHB 2MQJA 2AEHA 3MHSD 1C3TA 2JWZA 4BBNC 5JH5C 3HHMA 3VQIA 2V3SA 2DAJA 4KIKB 3VUYA 1X1MA 1UBIA 2LRUA 1WX9A 2IBIB 4IWOA 1L7YA 1WJUA 3V62A 3PLVA 4RM8A 4M8MA 4FADA 2QHOA 2MBBB 4K1RB 1V80A 2MW5A 4ANWA 1SE9A 3X0WA 1UD7A 1J8CA 3L16A 1WGRA 4WJQA 1NBFC 3SDLC 4A3OA 3A4RA 4NAWA 2L0FA 1GC7A 3ZTDA 2KZRA 3M95A 2WX1A 4GGQA 4B6WA 4GDKA 2NS5A 1UBQA 1C1YB 2LD9A 4HWIB 2R2QA 3QJZA 2J0KA 4WJPA 1TBEA 2C7HA 3PVLA 2LI5A 3T9LA 2MA9B 1OEYJ 2LUEA 2IO1B 2ZCCA 2M4NA 1ZGUB 2MP2B 5KHQA 1BT0A 3VDZA 4M8NA 2KX3A 3DDCB 3OJ3A 4M0WB 2FIFA 3L17A 4MJSB 3NZUA 2MBOA 1V5TA 4HJKA 2L7RA 2FCMA 4IWQA 2K1FA 4DDGD 2MBEA 2FCNA 4FBJB 4RMAA 3JW0X 1HE8A 4JIOU 1E7VA 1Q0WB 2KWVB 2Z0EB 4FA6A 1KOTA 2LVOA 3RZFA 1S3SG 1WXSA 2BYEA 4XC2A 3HM3A 1WMHA 2CHWA 2ZVNA 2DZIA 3PTFC 1Q5WB 3UQAA 3N32A 2KWUB 4PS3A 2JT4B 3M62B 5CHWA 2MX2A 4BVUC 1NI2A 1G6JA 3T8MA 2O6VA 3UGBB 2MLBA 4KIKA 1S1QB 2MSED 4HDOA 2KD0A 1YQBA 4BBNF 4PS8A 4TV3A 4MGYE 1XQQA 1LXDA 4KV2A 2W9NA 2Z59B 3PLUA 4FJVB 1Q1OA 3DPDA 1P0RA 2GMIC 2FIDA 2NBWB 1UGMA 2C9WB 3ONSA 4AUQC 2KANA 2JF5A 3TIXA 2YVCA 2BYVE 2KX0A 2LGXA 1PQSA 3M3JA 4P7IA 4EZKA 1EF5A 2C7MB 1TZ1A 4KSKC 4W9EA 4FJZA 4JGHB 3NZSA 4NQLB 3U7DA 3WAPA 3KVFB 4FLHA 1P1AA 3EFUA 4N9F4 3ZW3A 2L0TA 4EUTA 3O65B 3APCA 4GIVA 3A9KA 4FHJA 1R4MI 2BPSA 1IYFA 1WF9A 2LXCA 4NPNA 1JRUA 3L08A 2M1MA 2MP2A 2N9PC 3QK0A 2KQ7A 2ZVOA 4NAWB 1D3ZA 3AU4A 2I1JA 1CMXB 3H1UA 2HD5B 1WYWB 4G3XB 2IZVB 4W9IA 4F7ZA 5J2RA 3VFKA 4W9JA 4TUUA 4GDKB 4K7UA 2K6DB 4XZ4A 2KFJA 3HK0A 4B95A 2KJ6A 2PEAA 4JQWC 3OAWA 4TQ0A 1GUAB 2FAZA 4G50A 1OQYA 1EO6A 3PHWB 2G3QB 2NVUI 3B08A 5LLIA 5LXIB 2D10A 2G4DB 4HXDA 1NDDA 1UH6A 1J0GA 4BKGA 2KVRA 1WR1A 2GBMA 4I6NB 1WJ6A 3P2BA 2MBHA 1XD3B 2O2VA 3VTUA 3U30A 3WANA 2K25A 1KJTA 3PRZA 1WE7A 2MBQA 4DHZB 4HVBA 5G55A 3HIZA 3TL5A 3A1QA 2M8SA 2ZEQA 1V86A 4GOCA 3V6EB 1V6EA 4ICUA 1RLFA 2B3AA 2KXJA 3CSFA 4IG7B 3N3KB 5E6OA 4ZYNA 4E71A 2KC2A 2KQSA 3VHTC 2O6VB 2GBNA 1WE6A 4MGZE 4PS7A 2L3ZA 2N4FA 3ZVVA 3PZDA 2DYMA 2DHZA 1LQBA 2ZJDA 3B0AA 1LM8B 5E6PA 1M94A 2K6QA 3Q3JA 4JL9A 3VH4B 1Z2MA 4PYUA 3IHPC 2LXAA 2KLCA 2XEWA 3H7PA 3MJWA 3OLMD 2HTHA 4MDKE 3ML9A 3DBLI 3ZIMA 3K9PB 4KDLB 2O6VD 3ZUNA 3VTVA 2JXXA 2JUOA 4KDIC 1TGZB 4WJNA 1QZEA 4KZ0A 2KFKB 3IVFA 4B9KA 2G45B 3ML8A 2J7QB 4DBGA 2LGDA 5E6NA 2GBJA 3ZDMC
chains in the Genus database with same CATH superfamily
2V9HA 3DCGA 1GB4A 1ZE3D 2WXKA 2WXHA 4ZRJA 2KN4A 5AUKA 1VCBA 2LFIA 1K8RB 1TTNA 2RDBC 2AQ1B 3N30A 3NOBA 2X8XX 3UIPB 4NAMA 4US8A 1IPGA 4A90A 3A4SC 1L4ZB 3VUWA 4E3CA 1ET9A 3L13A 3ZO5B 4OZAA 1RFAA 1FD6A 2OJWA 4BZAA 3DVNV 4ZRIA 1F0ZA 5D3IB 1WJNA 4FJYA 3U52E 1RRBA 4OVUA 3EFCA 3KYDD 2WU2B 3PT2B 2EELA 2E3TA 1WJ4A 2KKCA 4NY0A 3EA6A 4YSYB 4LLGM 2CKHB 4EFOA 1WGGA 1WWTA 2JSVX 4W9GA 5GMVA 3WA0A 2I38A 4D2KA 2TSSA 5CHVC 3TCAA 4LJOB 3U2SC 1C9FA 2WXPA 2BT6A 2KNBA 3UINB 4LDTB 3ZXRA 1GG3A 3AEDB 1FNVA 4BOZB 3NJTA 3H9DA 1R4NB 4A20A 4USAA 2MWSB 3OWEB 1KLVA 1OEYA 2CU1A 4MELA 3M63B 4HRSA 2HE7A 2CHXA 4A55A 2OOBB 3AI5A 4WJOA 3KYCD 3U8ZA 4EOYA 3N20C 2LWPA 5L95C 3Q3MC 3VH3B 4OHJA 3QWZB 1UZXB 4HLEA 3L0WB 2GI9A 2WGSA 1WXMA 2K9XA 3KH0A 2PPHA 1D5MC 1CJEA 2IO3B 1E8XA 2ICIA 3DHGC 2RDGA 1E8YA 2PJHA 1NYRA 2L1AA 5BMGA 2KWDA 4RH6A 2M56B 4YTNB 3MC9A 2QDFA 3Q3NC 1F1HA 3SFEB 1QF6A 4N58A 2KC1A 2D3GA 4HKZE 4LCDE 4MH0E 1KRHA 3BVGA 5IA7A 2NMQA 4YT0B 2Y5BB 2K8CA 2C7NB 1WX7A 3PRMB 3I3TB 2ZNVB 3K9OB 3AE7B 1ISNA 2ZNVC 4JWSC 3DOWA 4PYZA 3V3XA 1F9JA 3ZTCA 4KZCA 1TKEA 5AZHA 2REXA 3RNFC 3BWUD 2BYFA 3TEXA 2Q5WD 3GE3C 4HCPB 4EEWA 4EKUA 3V05A 4YL8A 2KMAA 2PLPA 5CX3A 5D3DA 3ZKJC 4L23A 2MRPA 2EKEC 3MC8A 2M17A 3JSVB 1SXTA 1C76A 1OTRB 2G4SA 1XLQA 1DYQA 4W9FA 1KTKA 3S2AA 3ZJVA 1WGHA 3RPFC 4K3CA 3AE2B 2LASA 2JY6A 2UWQA 1TIFA 1I7HA 3X23A 3W1SC 4M02A 4HPLB 5EE3A 3SEBA 4K81A 3RFZB 4IUMB 3P4RB 3EC8A 1JALA 1QLBB 3PV1A 3KLSX 1WY8A 1WH3A 4WWPA 4JX1C 2DAFA 2BW2A 2WDTB 5G5GA 1YD8U 3QX1A 4M0WA 4KVGB 1IUEA 1C4AA 1SJED 2PMVA 4WAFA 1XLNA 4G0NB 4A8XC 2MCNB 1XLPA 2NPTA 2VRRB 3LB8C 3VUXA 3AEAB 5IP4D 1PGXA 3QIJA 4M00A 5DPTA 4MGKE 1XLOA 4DK5A 2Y5PA 2GOWA 2X38A 2XBBC 4J6IA 2PE9A 1V2YA 1K51A 2MQJA 2AEHA 3MHSD 2JWZA 2JYTA 1E6EB 5FK9C 3VUYA 2JYEA 4DXFA 3NVZA 1C77A 4RM8A 4M8MA 1FXIA 2MW5A 4NZLB 3X0WA 2I2YA 1SF0A 3L16A 2INPE 1R4MB 3SDLC 3ZTDA 2WX1A 4GGQA 3W5UB 3N9YC 1C1YB 2GRIA 2WNMA 2MEKA 1RM6C 2M4NA 1ZGUB 2MP2B 3BK2A 1BT0A 3VDZA 3OJ3A 3C8YA 4M0WB 1JWBD 2W55A 3L17A 3NZUA 1M4VA 4HJGE 3BK1A 4IWQA 1CZPA 4FBJB 3JW0X 2N0SB 1KOTA 2LVOA 3MFGA 2BYEA 3HM3A 3P4QB 4XGAB 5GXGB 4IDIA 1Q5WB 2KWUB 4BVUC 1G6JA 3UGBB 4HDOA 4LTUA 4MGYE 3P4PB 5EE0A 2W9NA 4FJVB 3NVYA 4O1NA 1Q1OA 2V0GA 2BB5A 4RF1A 1TKGA 5BYRA 3TIXA 1EWYC 2KX0A 2LGXA 1PQSA 4A9AA 1AYFA 1PYWD 3ZXVA 3RNBC 3WAPA 3EFUA 1I4HA 2WLBA 2BPSA 3E56A 4AQ7A 4NPNA 3WCQA 3KWLA 1JRUA 2M1MA 1HEZE 1ENFA 3H1UA 1JWAD 4W9JA 4TUUA 3BZDB 2LGSA 1XEEA 1GUAB 2ZW1A 3PHWB 2NVUI 5LLIA 4TSSA 1VZ7A 1P7EA 2KVRA 3RNCC 1WR1A 2AX5A 4I6NB 3WANA 1T0QC 4DHZB 1JQ4A 3HIZA 2WHIA 3TL5A 2G1EA 4GOCA 3UI3A 3VRBB 1V6EA 4ICUA 2B3AA 5T8IA 4ZYNA 4C56C 4HEA1 3VHTC 2L3ZA 3ZVVA 2DHZA 2ZJDA 1UWXA 3RNGC 2J4XA 1I4XA 1KLGD 3VH4B 4DXGA 1C4CA 2LXAA 3AMZA 3AE9B 2KLCA 2XEWA 3OLMD 2HTHA 4XWTA 1I4RA 2UU7A 3K9PB 4KDLB 1MVKA 2BS2B 2VZKD 1TGZB 1QZEA 2G45B 4KX6B 3GZNB 2NTSA 2KVZA 5IOIA 2LGDA 3ZDMC 4MSQB 3N1ZC 2FNJB 2HJ8A 1GAQB 5AUIA 1I4PA 3Q3OC 4ZOHC 2D11A 3SR6A 3TMPB 2CHZA 3DHIC 4HKQA 1MHHE 2AYOB 4RGNA 4W9DA 3U4EG 2KDBA 2LVQA 5HG2A 5D2MB 3DWMA 3AB5A 2YLMA 1D6EC 2OEDA 1LFDA 2WXFA 2N7EA 1K52A 1L4DB 2BWFA 2R2OA 5C23A 2K5PA 1RFKA 1I35A 1B9RA 2R61A 3CF6E 3TEWA 1BMLC 2KFKA 4IM0A 4AP4C 1EF1A 1OFFA 3NHEB 4IKGA 4KGTA 2GB1A 4IC7B 2N7JA 2LRWA 2EMSA 1WX8A 2KJHB 2YEPB 3WALA 2KK8A 4ANUA 4GU2A 4S17A 2VH2A 3LDZE 2HJ1A 4GXBA 3IT4B 3U7ZA 2RMMA 2IY0B 2XN9C 4LDTD 4W9LA 3IAS1 2G9HD 2LGYA 2ON8A 5JHAA 2WDRB 4TMAB 3ZNZB 2KTRA 4I6PA 3ALBA 2DENB 4RGOS 1A5RA 1RYJA 3IAM1 4GDLB 1EU3A 5H92C 3NZ3A 1E7UA 2BTEA 1FPYA 4RF0A 1V81A 1VD2A 3KUZA 3AV8A 4AJWA 2LHDA 1KF6B 3LJ3A 3Q8AA 1AWDA 2DZJA 1XF5L 3PS6A 2IPKD 4R3DA 2D2QA 4BFRA 3QC8B 1V1OA 2QCZA 4CO7A 3AU5A 3C19A 2QIEB 4KKJA 1TS3A 1KH0A 2KLGA 1P3QU 1YN3A 1J19A 1JROA 4ZRPA 2LJ5A 2BKFA 2KN5A 5BYSA 1Z5SB 2IYDB 4E74A 4ZHPA 5J18A 4ASWC 3NS8A 2AWTA 4FULA 3NS1A 4HCNB 2KTRB 1L0YB 3PZ8A 2NCNA 4F8CB 1ZDXA 2H88B 2NBVB 2KHWB 4DHZE 1BXTA 2D3AA 3ZDTA 3IBEA 2V3NA 2B76B 3R7QA 3RN9C 1MFWA 1FFVA 5KHOA 1TJEA 1OQRA 1BUIC 2WDQB 1WM3A 4ANXA 1UGJA 5TSSA 2DX5B 1SIFA 3LXFA 1Y8RC 3RUIB 1STEA 2MHJA 3JYUA 2N7DA 2LVPA 3GZNI 4X57B 4P1BC 1WZ0A 2WXLA 2KO3A 1AW7A 4ICVA 4YSXB 4K7WA 1MHXA 5AZGA 2QSDA 2WU5B 2LEKA 1GJZA 5DPRA 2K39A 1H4RA 2I1KA 2BB6A 3JSVA 4GN1A 1P98A 1V9JA 4YWGG 5J17A 1VJKA 2WXIA 1VR9A 1FM0D 2EMTA 4MACA 4IWPA 1JWSD 3IFWB 4Q2JA 1MG8A 3QCAA 2L00B 3W1SA 1WMHB 1C3TA 4BBNC 5JH5C 3VQIA 2V3SA 4REZA 2DAJA 4KIKB 2IDYA 1UBIA 2LRUA 1WX9A 2IBIB 3AEBB 2RDHA 1TY0A 3RI7C 4AS1A 2MBBB 2QJLA 4K1RB 1MI0A 5E6JA 3I57A 2CJNA 2LUMA 3BYTB 1FNUA 1NBFC 4J3OD 4A3OA 2EKIA 3A4RA 2Y5CA 1DOIA 3Q14C 1GC7A 2KZRA 4GDKA 1UBQA 1TBEA 3FC4A 3VRAB 2C7HA 3AN1A 3T9LA 3HRDD 1OEYJ 1EWCA 1K53A 1UF0A 2FCMA 2FCNA 4FA6A 1E7VA 1Q0WB 2Z0EB 4HROA 2WXGA 3RZFA 4XC2A 1WSPA 1T0SC 2O6VA 2KD0A 4PS8A 2WDVB 3N1YC 3P4SB 1E10A 1XQQA 3IXSA 1JWMD 3DPDA 2IGHA 1UGMA 3PO0A 2KAJA 2M19A 5BMIA 2YVCA 1F52A 3M3JA 4EZKA 1FO4A 1KFYB 2C7MB 2INCC 4JGHB 4KGRA 3KVFB 4EUTA 3O65B 3APCA 4FHJA 1IYFA 2LXCA 3Q8CA 2MP2A 3QK0A 4C4VB 2KQ7A 1R7SA 1D3ZA 2VH1A 1SSNA 1NI3A 1WYWB 2HD5B 2IZVB 4WIPA 4GDKB 3MHZA 3HK0A 4B95A 1TY2A 4JQWC 3OAWA 2FAZA 5EE9A 2D10A 1J0GA 1UH6A 4BKGA 1V1PA 2GBMA 2MBHA 1XD3B 3U30A 2K25A 3PRZA 2K3UA 2J53A 3MJ5A 3A1QA 3V6EB 1ROEA 1PGAA 3N3KB 5E6OA 4E71A 2KC2A 2O6VB 2GBNA 4MGZE 3PZDA 1Q10A 1LQBA 1PDXA 4N59A 1CK1A 1T5XD 1LM8B 5E6PA 2AQ3B 4PYUA 1IGDA 3Q69A 2HDEA 2WXRA 1L6UA 2W82A 3MJWA 1GPXA 2QEJC 3ZUNA 1C4PA 2JXXA 4M01A 1ESFA 1YOVB 4KZ0A 3IVFA 2YEPF 2W54A 1IBXA 2K0PA 4ZDVA 1VZ6A 1F77A 3V60A 3ZLZA 3VR8B 2WWZA 1GNUA 5AEKB 1YNTE 4CHKA 4GMVA 2BGFA 1WYGA 5DCNA 1YMHE 3B1LX 5CTRC 3RD2A 4HK2A 3ZJUA 2JPHA 2BWES 1V1PB 5CHFA 2N9LA 3ETRA 1YJIA 3Q8EA 4I6LB 3CMMB 3DHHC 4XDCA 2KJRA 4S0RA 4MEMA 1FCCC 1YX5B 4WQOB 1SE4A 3UIOB 2D3CA 1I4GA 3A1QB 1MJDA 3MTNB 5HKHA 2FCSA 5D7GA 3BYYB 2RPQA 2ZW0A 1ZKHA 3HM6X 3VXWA 4AOFA 1KLUD 2UYZB 3D32A 1XCQL 3R8BA 2Z0DB 3H6NA 2BBCA 3AEFB 3IG3A 1L0XB 4XX5A 3SHQA 4DXAB 3MP9A 2AL3A 1A70A 1WR6E 1YQ3B 1D5XC 2NR2A 2RPVA 3ZNID 2V1YA 3GS2A 4IW0A 3GOEA 3QARA 2ZZPB 2BYTA 1IP9A 1IBXB 3APDA 4FHKA 3OJ4B 3OG5A 2L76A 4PT5A 2KTFA 1YIWA 3AE8B 3TJPA 1TKYA 2KMMA 2L32A 1WIAA 1YX6B 2WXNA 5JZEB 3VTWA 3DBHI 3PSEB 2KMCA 2DZMA 3R2TA 1J7CA 2SEBD 3E9SA 4NNJB 3H8HA 3A9JB 2WXMA 5G2NA 2QC8A 3I5JC 3NY5A 3QA8A 2L52A 3ZNHB 3DQVA 2J42A 4II2B 5EDSA 2A4ZA 2JZZA 1VDVA 2CS4A 1D4BA 1KM7A 4ZRQA 3HVZA 2JU6X 4PK1A 1HTOA 1V5OA 4CQNA 1SEBD 5FR6A 4AJYB 3KUCB 2NTTA 1VLBA 2GBKA 1WZ3A 5C1ZA 4ACFA 4L1BA 3KW5B 1FIQA 2C60A 4XYCA 2ONQA 3DVGX 1V97A 4H2AA 2BQQA 1E90A 1QOAA 4DQOC 2N9KA 1YJ1A 3SU8X 3UQBA 5G5HA 4EZLA 1UELA 4NJ6A 3ENEA 4XE0A 1WXVA 4XDDA 4WWOA 1GB1A 1N61A 2C5LC 1YQ4B 4GDLA 3RZWC 2QMTA 3R66C 4LNKA 1VRAB 1V49A 4JE3B 1YN5A 3TUOA 2BF8B 5I4DA 1TS2A 2D3BA 4EZJA 3FILB 4KKIA 3BVZA 1P7FA 3JVZX 5H8YE 1ZUD2 4ANVA 1SGHA 2N1VA 3BY4B 2KOXA 5AZFA 4US9A 1FRDA 4MSMB 2SAKA 2E6XA 2JWUA 1SE3A 1N5XA 4WWNA 4BKSD 3O13A 4IM2A 4NQKE 1Y56A 2J0JA 4B0MA 5JXVA 1WRDB 3DBLB 1E9MA 2KDFB 2LJIA 2JVCA 1WI0A 4P6VF 4MGIE 2ASQA 1F2RI 4DHJB 3AE6B 3DVNU 2CR5A 3V6CB 2ZPYA 2PW9A 4JPSA 3ZGZA 1TT5B 1SJHD 1ZOYB 4GSWA 1N62A 3VVWB 4BKSA 2N9EB 1OGWA 3NVVA 2IO2B 3PREA 1L5PA 2DZKA 3L54A 1HZ5A 3V61A 1NVID 1NEKB 4II3B 2MJDA 4LJPB 4W9KA 3EHVA 2JQRB 2RGFA 3ZRCA 2WQYB 4A3PA 2CJOA 1GOZA 1FNWA 1K50A 3B9JA 1X1MA 5FR3A 2FUG1 1FMAD 1WJUA 5MPOA 3PLVA 4N6EB 4FADA 1E0ZA 1HTQA 1SE9A 1UD7A 2D5GA 4WJQA 4WH4A 3KQ4A 4NAWA 4B0EA 3M95A 1LO5D 1MPEA 2R2QA 1QKZA 3PVLA 1QOBA 2LI5A 2ZCCA 2MH7A 5KHQA 1L6VA 4M8NA 2KX3A 2MBOA 2L83A 4HJKA 1HA5A 2KWVB 4WQMA 1S3SG 1WMHA 2CHWA 3UQAA 4PS3A 5CHWA 3T8MA 3R2IA 1ZP0B 4KIKA 1S1QB 1FCLA 3T3NA 1LXDA 4KV2A 1ZDVA 1N63A 2Z59B 3PLUA 4ZYSA 2M0AA 2GMIC 4QAYA 2NBWB 2MJ3A 2C9WB 2WS3B 1TZ1A 4KSKC 3PZ7A 4RNAA 3Q6BA 4NQLB 3U7DA 2FBWB 4FLHA 4N9F4 3ZW3A 2L0TA 4GIVA 3A9KA 4P1CC 2N9PC 3KWVA 4NAWB 3Q2AC 1YN4A 4JWUC 2GLSA 2I1JA 3HVDA 4G3XB 4W9IA 4F7ZA 5J2RA 3VFKA 3NUHB 4K7UA 4XZ4A 2KFJA 1QQRA 2KJ6A 3Q8FA 1ZXIA 4TQ0A 1QOFA 4G50A 2Z8LA 2G3QB 1PUTA 5LXIB 2G4DB 4HXDA 5BYQA 1WJ6A 4LNIA 2DNFA 2O2VA 3VTUA 4RFBA 2PKOA 3TEZA 3W2DA 4HVBA 4LNNA 1RLFA 5HI1A 1B1ZA 2KXJA 3CSFA 1T3QA 4YTPB 4PS7A 1M94A 3Q3JA 3EUB2 2IJ0A 3H7PA 4FXCA 1FFUA 3ML9A 3DBLI 2FE8A 2O6VD 2WXJA 4C4VA 1AN8A 4WJNA 3NG0A 4DBGA 1I42A 1QT9A 2LGIA 3AULA 5DPSA 3P1MA 2XNAC 2ZCBA 3A9KB 3DBRB 4MM3A 2ZPNA 2J0MA 1WXAA 1AARA 2JZ3B 4IOIE 3APFA 4NJCA 2BKRB 4ZHOA 1D5ZC 2INNE 3SFDB 3DBHB 3KUDB 3LYYA 1L2NA 5D94A 4GB9A 3MC0B 4MT5A 5IO9A 2K8HA 1XT9B 1WXQA 3UF8A 4FN2A 3ZNGC 1UWMA 2O2VB 3BIID 1SBBB 1WGYA 3H7SA 1TS5A 4XWWA 4OVVA 2LZ6A 3AECB 1E7PB 3A33B 4L2YA 1WFYA 4K7SA 3IT6B 4MH8A 1FXTB 2K22A 4HDQA 3TSSA 3RYTA 3AE5B 2A5UA 4IM3A 4OZCA 4OZBA 3N1XC 4YTMB 2WYQA 3NVWA 3H7PB 2ACZB 4LK0M 5FKAC 4LNOA 4CYEA 5TR5A 1L0VB 2RR9A 2J52A 3SD5A 1JMLA 2KWCA 1WM2A 4DWFA 4MM3B 2CU3A 4F1SA 3RNAC 2KDEB 3WAMA 3AXCA 4NJ7A 3HUIA 1LGRA 4URKA 5D6JB 3PPAA 3EECA 2N1WA 4RM9A 2JXTA 3ZJTA 1JRPA 3AH7A 4RCOA 1GC6A 2JX5A 3P63A 1XO3A 1U4AA 4AWJA 3ZRFA 2JRIB 4BOSC 4BKTA 3AE3B 1SB3C 3I63C 2PIAA 3AEEB 4HPMB 5HFYA 2K8BA 1JWUD 2V4LA 1JCKB 3BINA 2N9XA 3DBSA 2DBYA 3B2FA 3FKYA 3Q3FA 3T3OA 3QAQA 4W9HA 5LXHA 1EUVB 2IY1B 2IO0B 2XK5A 1F2RC 4OW0A 3DWGC 1EM7A 1R4NI 1N5WA 2OHFA 1RAXA 3ABVB 4C80A 3TBLD 4HPPA 1N6ZA 1IGCA 2AQ2B 3L10B 1FEHA 3A9JA 1NENB 2KT7A 3W9CB 1H8CA 2DYBA 4C7YA 4KSLC 3RULA 1DOYA 2PE6B 2DYOA 2RSUA 3ZYYX 1J7AA 3W1YA 3RT3B 4TQ1A 2NBUA 1WGDA 2V3PA 4W9CA 3I9V1 1I4QA 1DOXA 4P16A 1HQRD 2NPTB 1VZ8A 3Q8BA 3PGEA 1ZW7A 3QHTA 1TYGB 3ECIA 1V8CA 2L05A 3GB1A 4TKNA 3L4PA 2PVOD 1E5WA 2V4IB 3C0RB 3QQ8B 2PTLA 2M0XA 1E8ZA 2WX0A 2MJEA 2JRHA 2KACA 3GP7A 4WAAA 4DDID 2LHEA 2H89B 3PHXB 3RCZA 3R7RA 5DPWA 2L8JA 2GBRA 5EE1A 3WAOA 3WIMA 1HZ6A 3DVGY 5BO4B 3DBRI 2RD0A 4G11A 1P9DU 1T0RC 2D07B 3R3MA 4JLCA 2XK5B 5IAAC 3P42A 2FUHB 1OQQA 2IGDA 3W5VB 1J7BA 4MJSA 2LMCA 2WXQA 2AL6A 1T0YA 3B2GA 2DWQA 4RGTA 1PFDA 2W3RA 3VAWA 4EE2A 3RNEC 4DHJD 1WRIA 3FILA 4ZRKA 1C79A 3NRZA 5JHBA 2OJRA 3PRPB 1C78A 2DLBA 3CSTA 3AE1B 5L83A 5BMHA 3CWIA 1T6BX 2KDIA 3RMKC 1QILA 2FCQA 1E8WA 1QOGA 4C7ZA 1YJJA 3J9CA 3URYA 2W3SA 1DGJA 3HHMA 1UNSA 3AM9A 4IWOA 4C00A 1L7YA 1EU4A 1SIJA 3V62A 4GLSC 2PVGC 2QHOA 4OVZA 1V80A 2Y3AA 4ANWA 3GE8C 1J8CA 1CQVA 4RGMA 1WGRA 1ZPSA 2L0FA 1ACCA 1NYQA 4B6WA 2NS5A 2LD9A 3FAHA 2INDC 4HWIB 3QJZA 2J0KA 4WJPA 2BVCA 4WURA 2BS4B 2MA9B 2LUEA 2IO1B 1UUPA 2KYWA 1JW9D 3DDCB 3AE4B 2FIFA 4MJSB 1V5TA 2L7RA 4UDUC 2K1FA 4DDGD 1PGBA 2MBEA 5IKCM 4RMAA 1HE8A 4JIOU 1RWSA 1XCTL 1WXSA 2KQ4X 1FXAA 1ET6A 2DZIA 2ZVNA 3PTFC 3N32A 2JT4B 3M62B 2MX2A 1NI2A 2BS3B 2MLBA 4YXDB 3EGRA 2MSED 1YQBA 4BBNF 4TV3A 3TEYA 1HXYD 1P0RA 2KDMA 4K3BA 2FIDA 3ONSA 4AUQC 2KANA 2JF5A 5LNK1 2BYVE 4P7IA 1EF5A 4W9EA 4FJZA 5HHDG 3BVMA 1MG4A 3NZSA 5C3JB 4KGSA 1P1AA 1FRRA 1R4MI 1WF9A 3L08A 4BAXA 3ZQ4A 2ZVOA 3AU4A 4WWMA 1CMXB 2K6DB 4ARCA 2PEAA 1OQYA 1EO6A 3B08A 1NDDA 5C2TB 1TS4A 2QILA 4LNFA 3P2BA 1ZXHA 1KJTA 1WE7A 2MBQA 4YSZB 3AEGB 2WP9B 5G55A 2M8SA 2ZEQA 1V86A 1N60A 4ARIA 2WXOA 4IG7B 2KQSA 2VZKB 1WE6A 5IN7A 2N4FA 1TZOA 2DYMA 3B0AA 3CIRB 2K6QA 4JL9A 1WGKA 1Z2MA 1XXGA 3IHPC 4MDKE 2HTME 4A6QA 3ZIMA 3VTVA 2JUOA 3VR9B 4KDIC 4ITKA 4B9KA 2KFKB 3ML8A 2IGGA 2JZPA 2J7QB 5E6NA 2GBJA 1SE2A
chains in the Genus database with same CATH topology
1I42A 3DCGA 3AULA 5DPSA 4ZDVA 4MSQB 2ZCBA 3A9KB 2FNJB 2HJ8A 4MM3A 4ZRJA 2ZPNA 3V60A 1VCBA 2J0MA 3ZLZA 1WXAA 1AARA 2WWZA 1K8RB 1GNUA 1TTNA 2JZ3B 3N30A 5AEKB 3NOBA 3APFA 4GMVA 4CHKA 2BGFA 2BKRB 3UIPB 3KUDB 2D11A 1IPGA 1L2NA 3TMPB 5D94A 5DCNA 3A4SC 3B1LX 5CTRC 4GB9A 2CHZA 3RD2A 4HK2A 3VUWA 4E3CA 2K8HA 2JPHA 2AYOB 3L13A 4W9DA 3ZO5B 1XT9B 1RFAA 2BWES 2KDBA 4FN2A 3UF8A 2LVQA 5CHFA 3ZNGC 5D2MB 2O2VB 4I6LB 3CMMB 2YLMA 1WGYA 3H7SA 2KJRA 4OVVA 4MEMA 3DVNV 4ZRIA 1YX5B 4WQOB 3UIOB 2LZ6A 1WJNA 3A1QB 4FJYA 1LFDA 1RRBA 3MTNB 2N7EA 2BWFA 3A33B 3KYDD 4OVUA 3PT2B 5HKHA 2FCSA 2R2OA 5D7GA 1WFYA 5C23A 2RPQA 4K7SA 1I35A 1WJ4A 2KKCA 4NY0A 1ZKHA 3HM6X 3VXWA 4AOFA 2UYZB 3CF6E 1FXTB 3D32A 2CKHB 4HDQA 2KFKA 2Z0DB 4EFOA 3H6NA 1WGGA 4IM0A 3RYTA 4W9GA 2A5UA 4IM3A 4AP4C 5GMVA 3WA0A 1EF1A 3NHEB 3IG3A 2WYQA 4IC7B 3H7PB 5CHVC 3TCAA 2LRWA 4XX5A 2EMSA 4LJOB 1WX8A 3SHQA 4DXAB 2KJHB 2AL3A 4CYEA 2KNBA 3UINB 4LDTB 5TR5A 2RR9A 1WR6E 2NR2A 1GG3A 3WALA 3ZNID 2KK8A 3SD5A 4BOZB 2V1YA 4IW0A 4ANUA 2KWCA 3GOEA 3H9DA 3QARA 2ZZPB 1IP9A 4GU2A 4A20A 2MWSB 3APDA 3LDZE 4FHKA 1KLVA 1WM2A 3OJ4B 1OEYA 2CU1A 4GXBA 4MELA 4DWFA 4F1SA 3M63B 2HE7A 2L76A 2CHXA 2IY0B 2KTFA 2OOBB 1YIWA 3TJPA 3AI5A 1WIAA 1YX6B 2KDEB 4LDTD 4W9LA 4WJOA 3AXCA 3VTWA 3WAMA 3DBHI 4NJ7A 5JZEB 3PSEB 2LGYA 3KYCD 4URKA 5D6JB 2KMCA 2DZMA 3U8ZA 4EOYA 5JHAA 2LWPA 3PPAA 5L95C 3EECA 2N1WA 4NNJB 3VH3B 3A9JB 5G2NA 3QWZB 4RM9A 3ZNZB 1UZXB 2KTRA 1GC6A 4I6PA 3NY5A 3QA8A 4HLEA 3ALBA 3DQVA 2DENB 3L0WB 3ZNHB 1A5RA 1WXMA 4GDLB 4II2B 5EDSA 1U4AA 2A4ZA 2JZZA 4AWJA 3KH0A 2PPHA 2CS4A 3ZRFA 1KM7A 2JRIB 4BKTA 4BOSC 1E7UA 2IO3B 1E8XA 1E8YA 1V81A 1V5OA 1VD2A 3KUZA 2PJHA 5FR6A 4HPMB 4AJYB 3KUCB 2K8BA 2V4LA 2GBKA 4AJWA 1WZ3A 3BINA 5C1ZA 2N9XA 3DBSA 3LJ3A 3KW5B 2C60A 3Q3FA 3QAQA 2DZJA 4W9HA 3DVGX 2KC1A 2D3GA 5LXHA 4LCDE 1E90A 4MH0E 5IA7A 1EUVB 2IY1B 3PS6A 2D2QA 2Y5BB 4BFRA 2IO0B 2K8CA 2XK5A 3QC8B 2C7NB 1WX7A 1YJ1A 3PRMB 4CO7A 3AU5A 3I3TB 3SU8X 2ZNVB 1R4NI 3K9OB 1RAXA 1ISNA 3UQBA 2ZNVC 3DOWA 4EZLA 1UELA 3TBLD 4NJ6A 3ENEA 4PYZA 1WXVA 3L10B 2KLGA 3A9JA 1F9JA 4WWOA 1P3QU 3ZTCA 1H8CA 1J19A 4KZCA 2DYBA 2C5LC 5AZHA 4KSLC 2REXA 3RULA 2LJ5A 2PE6B 2BKFA 2BYFA 2KN5A 2DYOA 2RSUA 4GDLA 3RZWC 1Z5SB 2IYDB 3R66C 4E74A 4HCPB 5J18A 3W1YA 4EEWA 4EKUA 4ASWC 3NS8A 3RT3B 4TQ1A 1V49A 2AWTA 2NBUA 4YL8A 1WGDA 2KMAA 4FULA 4HCNB 2BF8B 2KTRB 5CX3A 4W9CA 3ZKJC 2NCNA 4F8CB 2MRPA 2NBVB 2EKEC 4EZJA 2KHWB 4DHZE 3ZDTA 2M17A 2NPTB 3JSVB 3IBEA 3JVZX 4ANVA 3R7QA 1OTRB 1SGHA 2N1VA 2G4SA 3PGEA 3BY4B 5KHOA 2KOXA 1ZW7A 3QHTA 4W9FA 5AZFA 3S2AA 3ECIA 1WGHA 4MSMB 1WM3A 4ANXA 2L05A 4WWNA 4BKSD 2DX5B 2LASA 4IM2A 1SIFA 1E5WA 2JY6A 2UWQA 4TKNA 3C0RB 3QQ8B 3X23A 4NQKE 3W1SC 2M0XA 1Y8RC 1E8ZA 4HPLB 3RUIB 2WX0A 3JYUA 2J0JA 2JRHA 2N7DA 2LVPA 4WAAA 4K81A 1WRDB 4DDID 3GZNI 3PHXB 3RCZA 4IUMB 3R7RA 5DPWA 2L8JA 2GBRA 2KDFB 4X57B 3WAOA 2JVCA 3EC8A 3WIMA 3DVGY 1WI0A 5BO4B 1WZ0A 3DBRI 3PV1A 2KO3A 4MGIE 2RD0A 4G11A 4ICVA 2ASQA 1P9DU 2D07B 1WY8A 1WH3A 3R3MA 4JLCA 4WWPA 4DHJB 2XK5B 3DVNU 5IAAC 2DAFA 2WDTB 2CR5A 2FUHB 4K7WA 3V6CB 2ZPYA 1YD8U 3QX1A 4KVGB 4MJSA 5AZGA 2AL6A 1T0YA 4GSWA 1GJZA 5DPRA 3VAWA 3VVWB 4BKSA 2N9EB 2K39A 1H4RA 4DHJD 4G0NB 1OGWA 2MCNB 2I1KA 2NPTA 4ZRKA 3JSVA 4GN1A 2IO2B 2VRRB 1P98A 1V9JA 3PREA 3VUXA 2DZKA 5JHBA 5J17A 3L54A 2OJRA 3PRPB 3V61A 3QIJA 3CSTA 2EMTA 4II3B 4LJPB 5L83A 4IWPA 3EHVA 4W9KA 3IFWB 4MGKE 5DPTA 2KDIA 2RGFA 4DK5A 1MG8A 3QCAA 2GOWA 2XBBC 4J6IA 2PE9A 1V2YA 3ZRCA 4A3PA 2FCQA 1E8WA 2L00B 3W1SA 1WMHB 2MQJA 2AEHA 3MHSD 1C3TA 2JWZA 4BBNC 5JH5C 3HHMA 3VQIA 2V3SA 2DAJA 4KIKB 3VUYA 1X1MA 1UBIA 2LRUA 1WX9A 2IBIB 4IWOA 1L7YA 1WJUA 3V62A 3PLVA 4RM8A 4M8MA 4FADA 2QHOA 2MBBB 4K1RB 1V80A 2MW5A 4ANWA 1SE9A 3X0WA 1UD7A 1J8CA 3L16A 1WGRA 4WJQA 1NBFC 3SDLC 4A3OA 3A4RA 4NAWA 2L0FA 1GC7A 3ZTDA 2KZRA 3M95A 2WX1A 4GGQA 4B6WA 4GDKA 2NS5A 1UBQA 1C1YB 2LD9A 4HWIB 2R2QA 3QJZA 2J0KA 4WJPA 1TBEA 2C7HA 3PVLA 2LI5A 3T9LA 2MA9B 1OEYJ 2LUEA 2IO1B 2ZCCA 2M4NA 1ZGUB 2MP2B 5KHQA 1BT0A 3VDZA 4M8NA 2KX3A 3DDCB 3OJ3A 4M0WB 2FIFA 3L17A 4MJSB 3NZUA 2MBOA 1V5TA 4HJKA 2L7RA 2FCMA 4IWQA 2K1FA 4DDGD 2MBEA 2FCNA 4FBJB 4RMAA 3JW0X 1HE8A 4JIOU 1E7VA 1Q0WB 2KWVB 2Z0EB 4FA6A 1KOTA 2LVOA 3RZFA 1S3SG 1WXSA 2BYEA 4XC2A 3HM3A 1WMHA 2CHWA 2ZVNA 2DZIA 3PTFC 1Q5WB 3UQAA 3N32A 2KWUB 4PS3A 2JT4B 3M62B 5CHWA 2MX2A 4BVUC 1NI2A 1G6JA 3T8MA 2O6VA 3UGBB 2MLBA 4KIKA 1S1QB 2MSED 4HDOA 2KD0A 1YQBA 4BBNF 4PS8A 4TV3A 4MGYE 1XQQA 1LXDA 4KV2A 2W9NA 2Z59B 3PLUA 4FJVB 1Q1OA 3DPDA 1P0RA 2GMIC 2FIDA 2NBWB 1UGMA 2C9WB 3ONSA 4AUQC 2KANA 2JF5A 3TIXA 2YVCA 2BYVE 2KX0A 2LGXA 1PQSA 3M3JA 4P7IA 4EZKA 1EF5A 2C7MB 1TZ1A 4KSKC 4W9EA 4FJZA 4JGHB 3NZSA 4NQLB 3U7DA 3WAPA 3KVFB 4FLHA 1P1AA 3EFUA 4N9F4 3ZW3A 2L0TA 4EUTA 3O65B 3APCA 4GIVA 3A9KA 4FHJA 1R4MI 2BPSA 1IYFA 1WF9A 2LXCA 4NPNA 1JRUA 3L08A 2M1MA 2MP2A 2N9PC 3QK0A 2KQ7A 2ZVOA 4NAWB 1D3ZA 3AU4A 2I1JA 1CMXB 3H1UA 2HD5B 1WYWB 4G3XB 2IZVB 4W9IA 4F7ZA 5J2RA 3VFKA 4W9JA 4TUUA 4GDKB 4K7UA 2K6DB 4XZ4A 2KFJA 3HK0A 4B95A 2KJ6A 2PEAA 4JQWC 3OAWA 4TQ0A 1GUAB 2FAZA 4G50A 1OQYA 1EO6A 3PHWB 2G3QB 2NVUI 3B08A 5LLIA 5LXIB 2D10A 2G4DB 4HXDA 1NDDA 1UH6A 1J0GA 4BKGA 2KVRA 1WR1A 2GBMA 4I6NB 1WJ6A 3P2BA 2MBHA 1XD3B 2O2VA 3VTUA 3U30A 3WANA 2K25A 1KJTA 3PRZA 1WE7A 2MBQA 4DHZB 4HVBA 5G55A 3HIZA 3TL5A 3A1QA 2M8SA 2ZEQA 1V86A 4GOCA 3V6EB 1V6EA 4ICUA 1RLFA 2B3AA 2KXJA 3CSFA 4IG7B 3N3KB 5E6OA 4ZYNA 4E71A 2KC2A 2KQSA 3VHTC 2O6VB 2GBNA 1WE6A 4MGZE 4PS7A 2L3ZA 2N4FA 3ZVVA 3PZDA 2DYMA 2DHZA 1LQBA 2ZJDA 3B0AA 1LM8B 5E6PA 1M94A 2K6QA 3Q3JA 4JL9A 3VH4B 1Z2MA 4PYUA 3IHPC 2LXAA 2KLCA 2XEWA 3H7PA 3MJWA 3OLMD 2HTHA 4MDKE 3ML9A 3DBLI 3ZIMA 3K9PB 4KDLB 2O6VD 3ZUNA 3VTVA 2JXXA 2JUOA 4KDIC 1TGZB 4WJNA 1QZEA 4KZ0A 2KFKB 3IVFA 4B9KA 2G45B 3ML8A 2J7QB 4DBGA 2LGDA 5E6NA 2GBJA 3ZDMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I42 A;  3DCG A;  3AUL A;  5DPS A;  4ZDV A;  4MSQ B;  2ZCB A;  3A9K B;  2FNJ B;  2HJ8 A;  4MM3 A;  4ZRJ A;  2ZPN A;  3V60 A;  1VCB A;  2J0M A;  3ZLZ A;  1WXA A;  1AAR A;  2WWZ A;  1K8R B;  1GNU A;  1TTN A;  2JZ3 B;  3N30 A;  5AEK B;  3NOB A;  3APF A;  4GMV A;  4CHK A;  2BGF A;  2BKR B;  3UIP B;  3KUD B;  2D11 A;  1IPG A;  1L2N A;  3TMP B;  5D94 A;  5DCN A;  3A4S C;  3B1L X;  5CTR C;  4GB9 A;  2CHZ A;  3RD2 A;  4HK2 A;  3VUW A;  4E3C A;  2K8H A;  2JPH A;  2AYO B;  3L13 A;  4W9D A;  3ZO5 B;  1XT9 B;  1RFA A;  2BWE S;  2KDB A;  4FN2 A;  3UF8 A;  2LVQ A;  5CHF A;  3ZNG C;  5D2M B;  2O2V B;  4I6L B;  3CMM B;  2YLM A;  1WGY A;  3H7S A;  2KJR A;  4OVV A;  4MEM A;  3DVN V;  4ZRI A;  1YX5 B;  4WQO B;  3UIO B;  2LZ6 A;  1WJN A;  3A1Q B;  4FJY A;  1LFD A;  1RRB A;  3MTN B;  2N7E A;  2BWF A;  3A33 B;  3KYD D;  4OVU A;  3PT2 B;  5HKH A;  2FCS A;  2R2O A;  5D7G A;  1WFY A;  5C23 A;  2RPQ A;  4K7S A;  1I35 A;  1WJ4 A;  2KKC A;  4NY0 A;  1ZKH A;  3HM6 X;  3VXW A;  4AOF A;  2UYZ B;  3CF6 E;  1FXT B;  3D32 A;  2CKH B;  4HDQ A;  2KFK A;  2Z0D B;  4EFO A;  3H6N A;  1WGG A;  4IM0 A;  3RYT A;  4W9G A;  2A5U A;  4IM3 A;  4AP4 C;  5GMV A;  3WA0 A;  1EF1 A;  3NHE B;  3IG3 A;  2WYQ A;  4IC7 B;  3H7P B;  5CHV C;  3TCA A;  2LRW A;  4XX5 A;  2EMS A;  4LJO B;  1WX8 A;  3SHQ A;  4DXA B;  2KJH B;  2AL3 A;  4CYE A;  2KNB A;  3UIN B;  4LDT B;  5TR5 A;  2RR9 A;  1WR6 E;  2NR2 A;  1GG3 A;  3WAL A;  3ZNI D;  2KK8 A;  3SD5 A;  4BOZ B;  2V1Y A;  4IW0 A;  4ANU A;  2KWC A;  3GOE A;  3H9D A;  3QAR A;  2ZZP B;  1IP9 A;  4GU2 A;  4A20 A;  2MWS B;  3APD A;  3LDZ E;  4FHK A;  1KLV A;  1WM2 A;  3OJ4 B;  1OEY A;  2CU1 A;  4GXB A;  4MEL A;  4DWF A;  4F1S A;  3M63 B;  2HE7 A;  2L76 A;  2CHX A;  2IY0 B;  2KTF A;  2OOB B;  1YIW A;  3TJP A;  3AI5 A;  1WIA A;  1YX6 B;  2KDE B;  4LDT D;  4W9L A;  4WJO A;  3AXC A;  3VTW A;  3WAM A;  3DBH I;  4NJ7 A;  5JZE B;  3PSE B;  2LGY A;  3KYC D;  4URK A;  5D6J B;  2KMC A;  2DZM A;  3U8Z A;  4EOY A;  5JHA A;  2LWP A;  3PPA A;  5L95 C;  3EEC A;  2N1W A;  4NNJ B;  3VH3 B;  3A9J B;  5G2N A;  3QWZ B;  4RM9 A;  3ZNZ B;  1UZX B;  2KTR A;  1GC6 A;  4I6P A;  3NY5 A;  3QA8 A;  4HLE A;  3ALB A;  3DQV A;  2DEN B;  3L0W B;  3ZNH B;  1A5R A;  1WXM A;  4GDL B;  4II2 B;  5EDS A;  1U4A A;  2A4Z A;  2JZZ A;  4AWJ A;  3KH0 A;  2PPH A;  2CS4 A;  3ZRF A;  1KM7 A;  2JRI B;  4BKT A;  4BOS C;  1E7U A;  2IO3 B;  1E8X A;  1E8Y A;  1V81 A;  1V5O A;  1VD2 A;  3KUZ A;  2PJH A;  5FR6 A;  4HPM B;  4AJY B;  3KUC B;  2K8B A;  2V4L A;  2GBK A;  4AJW A;  1WZ3 A;  3BIN A;  5C1Z A;  2N9X A;  3DBS A;  3LJ3 A;  3KW5 B;  2C60 A;  3Q3F A;  3QAQ A;  2DZJ A;  4W9H A;  3DVG X;  2KC1 A;  2D3G A;  5LXH A;  4LCD E;  1E90 A;  4MH0 E;  5IA7 A;  1EUV B;  2IY1 B;  3PS6 A;  2D2Q A;  2Y5B B;  4BFR A;  2IO0 B;  2K8C A;  2XK5 A;  3QC8 B;  2C7N B;  1WX7 A;  1YJ1 A;  3PRM B;  4CO7 A;  3AU5 A;  3I3T B;  3SU8 X;  2ZNV B;  1R4N I;  3K9O B;  1RAX A;  1ISN A;  3UQB A;  2ZNV C;  3DOW A;  4EZL A;  1UEL A;  3TBL D;  4NJ6 A;  3ENE A;  4PYZ A;  1WXV A;  3L10 B;  2KLG A;  3A9J A;  1F9J A;  4WWO A;  1P3Q U;  3ZTC A;  1H8C A;  1J19 A;  4KZC A;  2DYB A;  2C5L C;  5AZH A;  4KSL C;  2REX A;  3RUL A;  2LJ5 A;  2PE6 B;  2BKF A;  2BYF A;  2KN5 A;  2DYO A;  2RSU A;  4GDL A;  3RZW C;  1Z5S B;  2IYD B;  3R66 C;  4E74 A;  4HCP B;  5J18 A;  3W1Y A;  4EEW A;  4EKU A;  4ASW C;  3NS8 A;  3RT3 B;  4TQ1 A;  1V49 A;  2AWT A;  2NBU A;  4YL8 A;  1WGD A;  2KMA A;  4FUL A;  4HCN B;  2BF8 B;  2KTR B;  5CX3 A;  4W9C A;  3ZKJ C;  2NCN A;  4F8C B;  2MRP A;  2NBV B;  2EKE C;  4EZJ A;  2KHW B;  4DHZ E;  3ZDT A;  2M17 A;  2NPT B;  3JSV B;  3IBE A;  3JVZ X;  4ANV A;  3R7Q A;  1OTR B;  1SGH A;  2N1V A;  2G4S A;  3PGE A;  3BY4 B;  5KHO A;  2KOX A;  1ZW7 A;  3QHT A;  4W9F A;  5AZF A;  3S2A A;  3ECI A;  1WGH A;  4MSM B;  1WM3 A;  4ANX A;  2L05 A;  4WWN A;  4BKS D;  2DX5 B;  2LAS A;  4IM2 A;  1SIF A;  1E5W A;  2JY6 A;  2UWQ A;  4TKN A;  3C0R B;  3QQ8 B;  3X23 A;  4NQK E;  3W1S C;  2M0X A;  1Y8R C;  1E8Z A;  4HPL B;  3RUI B;  2WX0 A;  3JYU A;  2J0J A;  2JRH A;  2N7D A;  2LVP A;  4WAA A;  4K81 A;  1WRD B;  4DDI D;  3GZN I;  3PHX B;  3RCZ A;  4IUM B;  3R7R A;  5DPW A;  2L8J A;  2GBR A;  2KDF B;  4X57 B;  3WAO A;  2JVC A;  3EC8 A;  3WIM A;  3DVG Y;  1WI0 A;  5BO4 B;  1WZ0 A;  3DBR I;  3PV1 A;  2KO3 A;  4MGI E;  2RD0 A;  4G11 A;  4ICV A;  2ASQ A;  1P9D U;  2D07 B;  1WY8 A;  1WH3 A;  3R3M A;  4JLC A;  4WWP A;  4DHJ B;  2XK5 B;  3DVN U;  5IAA C;  2DAF A;  2WDT B;  2CR5 A;  2FUH B;  4K7W A;  3V6C B;  2ZPY A;  1YD8 U;  3QX1 A;  4KVG B;  4MJS A;  5AZG A;  2AL6 A;  1T0Y A;  4GSW A;  1GJZ A;  5DPR A;  3VAW A;  3VVW B;  4BKS A;  2N9E B;  2K39 A;  1H4R A;  4DHJ D;  4G0N B;  1OGW A;  2MCN B;  2I1K A;  2NPT A;  4ZRK A;  3JSV A;  4GN1 A;  2IO2 B;  2VRR B;  1P98 A;  1V9J A;  3PRE A;  3VUX A;  2DZK A;  5JHB A;  5J17 A;  3L54 A;  2OJR A;  3PRP B;  3V61 A;  3QIJ A;  3CST A;  2EMT A;  4II3 B;  4LJP B;  5L83 A;  4IWP A;  3EHV A;  4W9K A;  3IFW B;  4MGK E;  5DPT A;  2KDI A;  2RGF A;  4DK5 A;  1MG8 A;  3QCA A;  2GOW A;  2XBB C;  4J6I A;  2PE9 A;  1V2Y A;  3ZRC A;  4A3P A;  2FCQ A;  1E8W A;  2L00 B;  3W1S A;  1WMH B;  2MQJ A;  2AEH A;  3MHS D;  1C3T A;  2JWZ A;  4BBN C;  5JH5 C;  3HHM A;  3VQI A;  2V3S A;  2DAJ A;  4KIK B;  3VUY A;  1X1M A;  1UBI A;  2LRU A;  1WX9 A;  2IBI B;  4IWO A;  1L7Y A;  1WJU A;  3V62 A;  3PLV A;  4RM8 A;  4M8M A;  4FAD A;  2QHO A;  2MBB B;  4K1R B;  1V80 A;  2MW5 A;  4ANW A;  1SE9 A;  3X0W A;  1UD7 A;  1J8C A;  3L16 A;  1WGR A;  4WJQ A;  1NBF C;  3SDL C;  4A3O A;  3A4R A;  4NAW A;  2L0F A;  1GC7 A;  3ZTD A;  2KZR A;  3M95 A;  2WX1 A;  4GGQ A;  4B6W A;  4GDK A;  2NS5 A;  1UBQ A;  1C1Y B;  2LD9 A;  4HWI B;  2R2Q A;  3QJZ A;  2J0K A;  4WJP A;  1TBE A;  2C7H A;  3PVL A;  2LI5 A;  3T9L A;  2MA9 B;  1OEY J;  2LUE A;  2IO1 B;  2ZCC A;  2M4N A;  1ZGU B;  2MP2 B;  5KHQ A;  1BT0 A;  3VDZ A;  4M8N A;  2KX3 A;  3DDC B;  3OJ3 A;  4M0W B;  2FIF A;  3L17 A;  4MJS B;  3NZU A;  2MBO A;  1V5T A;  4HJK A;  2L7R A;  2FCM A;  4IWQ A;  2K1F A;  4DDG D;  2MBE A;  2FCN A;  4FBJ B;  4RMA A;  3JW0 X;  1HE8 A;  4JIO U;  1E7V A;  1Q0W B;  2KWV B;  2Z0E B;  4FA6 A;  1KOT A;  2LVO A;  3RZF A;  1S3S G;  1WXS A;  2BYE A;  4XC2 A;  3HM3 A;  1WMH A;  2CHW A;  2ZVN A;  2DZI A;  3PTF C;  1Q5W B;  3UQA A;  3N32 A;  2KWU B;  4PS3 A;  2JT4 B;  3M62 B;  5CHW A;  2MX2 A;  4BVU C;  1NI2 A;  1G6J A;  3T8M A;  2O6V A;  3UGB B;  2MLB A;  4KIK A;  1S1Q B;  2MSE D;  4HDO A;  2KD0 A;  1YQB A;  4BBN F;  4PS8 A;  4TV3 A;  4MGY E;  1XQQ A;  1LXD A;  4KV2 A;  2W9N A;  2Z59 B;  3PLU A;  4FJV B;  1Q1O A;  3DPD A;  1P0R A;  2GMI C;  2FID A;  2NBW B;  1UGM A;  2C9W B;  3ONS A;  4AUQ C;  2KAN A;  2JF5 A;  3TIX A;  2YVC A;  2BYV E;  2KX0 A;  2LGX A;  1PQS A;  3M3J A;  4P7I A;  4EZK A;  1EF5 A;  2C7M B;  1TZ1 A;  4KSK C;  4W9E A;  4FJZ A;  4JGH B;  3NZS A;  4NQL B;  3U7D A;  3WAP A;  3KVF B;  4FLH A;  1P1A A;  3EFU A;  4N9F 4;  3ZW3 A;  2L0T A;  4EUT A;  3O65 B;  3APC A;  4GIV A;  3A9K A;  4FHJ A;  1R4M I;  2BPS A;  1IYF A;  1WF9 A;  2LXC A;  4NPN A;  1JRU A;  3L08 A;  2M1M A;  2MP2 A;  2N9P C;  3QK0 A;  2KQ7 A;  2ZVO A;  4NAW B;  1D3Z A;  3AU4 A;  2I1J A;  1CMX B;  3H1U A;  2HD5 B;  1WYW B;  4G3X B;  2IZV B;  4W9I A;  4F7Z A;  5J2R A;  3VFK A;  4W9J A;  4TUU A;  4GDK B;  4K7U A;  2K6D B;  4XZ4 A;  2KFJ A;  3HK0 A;  4B95 A;  2KJ6 A;  2PEA A;  4JQW C;  3OAW A;  4TQ0 A;  1GUA B;  2FAZ A;  4G50 A;  1OQY A;  1EO6 A;  3PHW B;  2G3Q B;  2NVU I;  3B08 A;  5LLI A;  5LXI B;  2D10 A;  2G4D B;  4HXD A;  1NDD A;  1UH6 A;  1J0G A;  4BKG A;  2KVR A;  1WR1 A;  2GBM A;  4I6N B;  1WJ6 A;  3P2B A;  2MBH A;  1XD3 B;  2O2V A;  3VTU A;  3U30 A;  3WAN A;  2K25 A;  1KJT A;  3PRZ A;  1WE7 A;  2MBQ A;  4DHZ B;  4HVB A;  5G55 A;  3HIZ A;  3TL5 A;  3A1Q A;  2M8S A;  2ZEQ A;  1V86 A;  4GOC A;  3V6E B;  1V6E A;  4ICU A;  1RLF A;  2B3A A;  2KXJ A;  3CSF A;  4IG7 B;  3N3K B;  5E6O A;  4ZYN A;  4E71 A;  2KC2 A;  2KQS A;  3VHT C;  2O6V B;  2GBN A;  1WE6 A;  4MGZ E;  4PS7 A;  2L3Z A;  2N4F A;  3ZVV A;  3PZD A;  2DYM A;  2DHZ A;  1LQB A;  2ZJD A;  3B0A A;  1LM8 B;  5E6P A;  1M94 A;  2K6Q A;  3Q3J A;  4JL9 A;  3VH4 B;  1Z2M A;  4PYU A;  3IHP C;  2LXA A;  2KLC A;  2XEW A;  3H7P A;  3MJW A;  3OLM D;  2HTH A;  4MDK E;  3ML9 A;  3DBL I;  3ZIM A;  3K9P B;  4KDL B;  2O6V D;  3ZUN A;  3VTV A;  2JXX A;  2JUO A;  4KDI C;  1TGZ B;  4WJN A;  1QZE A;  4KZ0 A;  2KFK B;  3IVF A;  4B9K A;  2G45 B;  3ML8 A;  2J7Q B;  4DBG A;  2LGD A;  5E6N A;  2GBJ A;  3ZDM C; 
#chains in the Genus database with same CATH topology
 2V9H A;  3DCG A;  1GB4 A;  1ZE3 D;  2WXK A;  2WXH A;  4ZRJ A;  2KN4 A;  5AUK A;  1VCB A;  2LFI A;  1K8R B;  1TTN A;  2RDB C;  2AQ1 B;  3N30 A;  3NOB A;  2X8X X;  3UIP B;  4NAM A;  4US8 A;  1IPG A;  4A90 A;  3A4S C;  1L4Z B;  3VUW A;  4E3C A;  1ET9 A;  3L13 A;  3ZO5 B;  4OZA A;  1RFA A;  1FD6 A;  2OJW A;  4BZA A;  3DVN V;  4ZRI A;  1F0Z A;  5D3I B;  1WJN A;  4FJY A;  3U52 E;  1RRB A;  4OVU A;  3EFC A;  3KYD D;  2WU2 B;  3PT2 B;  2EEL A;  2E3T A;  1WJ4 A;  2KKC A;  4NY0 A;  3EA6 A;  4YSY B;  4LLG M;  2CKH B;  4EFO A;  1WGG A;  1WWT A;  2JSV X;  4W9G A;  5GMV A;  3WA0 A;  2I38 A;  4D2K A;  2TSS A;  5CHV C;  3TCA A;  4LJO B;  3U2S C;  1C9F A;  2WXP A;  2BT6 A;  2KNB A;  3UIN B;  4LDT B;  3ZXR A;  1GG3 A;  3AED B;  1FNV A;  4BOZ B;  3NJT A;  3H9D A;  1R4N B;  4A20 A;  4USA A;  2MWS B;  3OWE B;  1KLV A;  1OEY A;  2CU1 A;  4MEL A;  3M63 B;  4HRS A;  2HE7 A;  2CHX A;  4A55 A;  2OOB B;  3AI5 A;  4WJO A;  3KYC D;  3U8Z A;  4EOY A;  3N20 C;  2LWP A;  5L95 C;  3Q3M C;  3VH3 B;  4OHJ A;  3QWZ B;  1UZX B;  4HLE A;  3L0W B;  2GI9 A;  2WGS A;  1WXM A;  2K9X A;  3KH0 A;  2PPH A;  1D5M C;  1CJE A;  2IO3 B;  1E8X A;  2ICI A;  3DHG C;  2RDG A;  1E8Y A;  2PJH A;  1NYR A;  2L1A A;  5BMG A;  2KWD A;  4RH6 A;  2M56 B;  4YTN B;  3MC9 A;  2QDF A;  3Q3N C;  1F1H A;  3SFE B;  1QF6 A;  4N58 A;  2KC1 A;  2D3G A;  4HKZ E;  4LCD E;  4MH0 E;  1KRH A;  3BVG A;  5IA7 A;  2NMQ A;  4YT0 B;  2Y5B B;  2K8C A;  2C7N B;  1WX7 A;  3PRM B;  3I3T B;  2ZNV B;  3K9O B;  3AE7 B;  1ISN A;  2ZNV C;  4JWS C;  3DOW A;  4PYZ A;  3V3X A;  1F9J A;  3ZTC A;  4KZC A;  1TKE A;  5AZH A;  2REX A;  3RNF C;  3BWU D;  2BYF A;  3TEX A;  2Q5W D;  3GE3 C;  4HCP B;  4EEW A;  4EKU A;  3V05 A;  4YL8 A;  2KMA A;  2PLP A;  5CX3 A;  5D3D A;  3ZKJ C;  4L23 A;  2MRP A;  2EKE C;  3MC8 A;  2M17 A;  3JSV B;  1SXT A;  1C76 A;  1OTR B;  2G4S A;  1XLQ A;  1DYQ A;  4W9F A;  1KTK A;  3S2A A;  3ZJV A;  1WGH A;  3RPF C;  4K3C A;  3AE2 B;  2LAS A;  2JY6 A;  2UWQ A;  1TIF A;  1I7H A;  3X23 A;  3W1S C;  4M02 A;  4HPL B;  5EE3 A;  3SEB A;  4K81 A;  3RFZ B;  4IUM B;  3P4R B;  3EC8 A;  1JAL A;  1QLB B;  3PV1 A;  3KLS X;  1WY8 A;  1WH3 A;  4WWP A;  4JX1 C;  2DAF A;  2BW2 A;  2WDT B;  5G5G A;  1YD8 U;  3QX1 A;  4M0W A;  4KVG B;  1IUE A;  1C4A A;  1SJE D;  2PMV A;  4WAF A;  1XLN A;  4G0N B;  4A8X C;  2MCN B;  1XLP A;  2NPT A;  2VRR B;  3LB8 C;  3VUX A;  3AEA B;  5IP4 D;  1PGX A;  3QIJ A;  4M00 A;  5DPT A;  4MGK E;  1XLO A;  4DK5 A;  2Y5P A;  2GOW A;  2X38 A;  2XBB C;  4J6I A;  2PE9 A;  1V2Y A;  1K51 A;  2MQJ A;  2AEH A;  3MHS D;  2JWZ A;  2JYT A;  1E6E B;  5FK9 C;  3VUY A;  2JYE A;  4DXF A;  3NVZ A;  1C77 A;  4RM8 A;  4M8M A;  1FXI A;  2MW5 A;  4NZL B;  3X0W A;  2I2Y A;  1SF0 A;  3L16 A;  2INP E;  1R4M B;  3SDL C;  3ZTD A;  2WX1 A;  4GGQ A;  3W5U B;  3N9Y C;  1C1Y B;  2GRI A;  2WNM A;  2MEK A;  1RM6 C;  2M4N A;  1ZGU B;  2MP2 B;  3BK2 A;  1BT0 A;  3VDZ A;  3OJ3 A;  3C8Y A;  4M0W B;  1JWB D;  2W55 A;  3L17 A;  3NZU A;  1M4V A;  4HJG E;  3BK1 A;  4IWQ A;  1CZP A;  4FBJ B;  3JW0 X;  2N0S B;  1KOT A;  2LVO A;  3MFG A;  2BYE A;  3HM3 A;  3P4Q B;  4XGA B;  5GXG B;  4IDI A;  1Q5W B;  2KWU B;  4BVU C;  1G6J A;  3UGB B;  4HDO A;  4LTU A;  4MGY E;  3P4P B;  5EE0 A;  2W9N A;  4FJV B;  3NVY A;  4O1N A;  1Q1O A;  2V0G A;  2BB5 A;  4RF1 A;  1TKG A;  5BYR A;  3TIX A;  1EWY C;  2KX0 A;  2LGX A;  1PQS A;  4A9A A;  1AYF A;  1PYW D;  3ZXV A;  3RNB C;  3WAP A;  3EFU A;  1I4H A;  2WLB A;  2BPS A;  3E56 A;  4AQ7 A;  4NPN A;  3WCQ A;  3KWL A;  1JRU A;  2M1M A;  1HEZ E;  1ENF A;  3H1U A;  1JWA D;  4W9J A;  4TUU A;  3BZD B;  2LGS A;  1XEE A;  1GUA B;  2ZW1 A;  3PHW B;  2NVU I;  5LLI A;  4TSS A;  1VZ7 A;  1P7E A;  2KVR A;  3RNC C;  1WR1 A;  2AX5 A;  4I6N B;  3WAN A;  1T0Q C;  4DHZ B;  1JQ4 A;  3HIZ A;  2WHI A;  3TL5 A;  2G1E A;  4GOC A;  3UI3 A;  3VRB B;  1V6E A;  4ICU A;  2B3A A;  5T8I A;  4ZYN A;  4C56 C;  4HEA 1;  3VHT C;  2L3Z A;  3ZVV A;  2DHZ A;  2ZJD A;  1UWX A;  3RNG C;  2J4X A;  1I4X A;  1KLG D;  3VH4 B;  4DXG A;  1C4C A;  2LXA A;  3AMZ A;  3AE9 B;  2KLC A;  2XEW A;  3OLM D;  2HTH A;  4XWT A;  1I4R A;  2UU7 A;  3K9P B;  4KDL B;  1MVK A;  2BS2 B;  2VZK D;  1TGZ B;  1QZE A;  2G45 B;  4KX6 B;  3GZN B;  2NTS A;  2KVZ A;  5IOI A;  2LGD A;  3ZDM C;  4MSQ B;  3N1Z C;  2FNJ B;  2HJ8 A;  1GAQ B;  5AUI A;  1I4P A;  3Q3O C;  4ZOH C;  2D11 A;  3SR6 A;  3TMP B;  2CHZ A;  3DHI C;  4HKQ A;  1MHH E;  2AYO B;  4RGN A;  4W9D A;  3U4E G;  2KDB A;  2LVQ A;  5HG2 A;  5D2M B;  3DWM A;  3AB5 A;  2YLM A;  1D6E C;  2OED A;  1LFD A;  2WXF A;  2N7E A;  1K52 A;  1L4D B;  2BWF A;  2R2O A;  5C23 A;  2K5P A;  1RFK A;  1I35 A;  1B9R A;  2R61 A;  3CF6 E;  3TEW A;  1BML C;  2KFK A;  4IM0 A;  4AP4 C;  1EF1 A;  1OFF A;  3NHE B;  4IKG A;  4KGT A;  2GB1 A;  4IC7 B;  2N7J A;  2LRW A;  2EMS A;  1WX8 A;  2KJH B;  2YEP B;  3WAL A;  2KK8 A;  4ANU A;  4GU2 A;  4S17 A;  2VH2 A;  3LDZ E;  2HJ1 A;  4GXB A;  3IT4 B;  3U7Z A;  2RMM A;  2IY0 B;  2XN9 C;  4LDT D;  4W9L A;  3IAS 1;  2G9H D;  2LGY A;  2ON8 A;  5JHA A;  2WDR B;  4TMA B;  3ZNZ B;  2KTR A;  4I6P A;  3ALB A;  2DEN B;  4RGO S;  1A5R A;  1RYJ A;  3IAM 1;  4GDL B;  1EU3 A;  5H92 C;  3NZ3 A;  1E7U A;  2BTE A;  1FPY A;  4RF0 A;  1V81 A;  1VD2 A;  3KUZ A;  3AV8 A;  4AJW A;  2LHD A;  1KF6 B;  3LJ3 A;  3Q8A A;  1AWD A;  2DZJ A;  1XF5 L;  3PS6 A;  2IPK D;  4R3D A;  2D2Q A;  4BFR A;  3QC8 B;  1V1O A;  2QCZ A;  4CO7 A;  3AU5 A;  3C19 A;  2QIE B;  4KKJ A;  1TS3 A;  1KH0 A;  2KLG A;  1P3Q U;  1YN3 A;  1J19 A;  1JRO A;  4ZRP A;  2LJ5 A;  2BKF A;  2KN5 A;  5BYS A;  1Z5S B;  2IYD B;  4E74 A;  4ZHP A;  5J18 A;  4ASW C;  3NS8 A;  2AWT A;  4FUL A;  3NS1 A;  4HCN B;  2KTR B;  1L0Y B;  3PZ8 A;  2NCN A;  4F8C B;  1ZDX A;  2H88 B;  2NBV B;  2KHW B;  4DHZ E;  1BXT A;  2D3A A;  3ZDT A;  3IBE A;  2V3N A;  2B76 B;  3R7Q A;  3RN9 C;  1MFW A;  1FFV A;  5KHO A;  1TJE A;  1OQR A;  1BUI C;  2WDQ B;  1WM3 A;  4ANX A;  1UGJ A;  5TSS A;  2DX5 B;  1SIF A;  3LXF A;  1Y8R C;  3RUI B;  1STE A;  2MHJ A;  3JYU A;  2N7D A;  2LVP A;  3GZN I;  4X57 B;  4P1B C;  1WZ0 A;  2WXL A;  2KO3 A;  1AW7 A;  4ICV A;  4YSX B;  4K7W A;  1MHX A;  5AZG A;  2QSD A;  2WU5 B;  2LEK A;  1GJZ A;  5DPR A;  2K39 A;  1H4R A;  2I1K A;  2BB6 A;  3JSV A;  4GN1 A;  1P98 A;  1V9J A;  4YWG G;  5J17 A;  1VJK A;  2WXI A;  1VR9 A;  1FM0 D;  2EMT A;  4MAC A;  4IWP A;  1JWS D;  3IFW B;  4Q2J A;  1MG8 A;  3QCA A;  2L00 B;  3W1S A;  1WMH B;  1C3T A;  4BBN C;  5JH5 C;  3VQI A;  2V3S A;  4REZ A;  2DAJ A;  4KIK B;  2IDY A;  1UBI A;  2LRU A;  1WX9 A;  2IBI B;  3AEB B;  2RDH A;  1TY0 A;  3RI7 C;  4AS1 A;  2MBB B;  2QJL A;  4K1R B;  1MI0 A;  5E6J A;  3I57 A;  2CJN A;  2LUM A;  3BYT B;  1FNU A;  1NBF C;  4J3O D;  4A3O A;  2EKI A;  3A4R A;  2Y5C A;  1DOI A;  3Q14 C;  1GC7 A;  2KZR A;  4GDK A;  1UBQ A;  1TBE A;  3FC4 A;  3VRA B;  2C7H A;  3AN1 A;  3T9L A;  3HRD D;  1OEY J;  1EWC A;  1K53 A;  1UF0 A;  2FCM A;  2FCN A;  4FA6 A;  1E7V A;  1Q0W B;  2Z0E B;  4HRO A;  2WXG A;  3RZF A;  4XC2 A;  1WSP A;  1T0S C;  2O6V A;  2KD0 A;  4PS8 A;  2WDV B;  3N1Y C;  3P4S B;  1E10 A;  1XQQ A;  3IXS A;  1JWM D;  3DPD A;  2IGH A;  1UGM A;  3PO0 A;  2KAJ A;  2M19 A;  5BMI A;  2YVC A;  1F52 A;  3M3J A;  4EZK A;  1FO4 A;  1KFY B;  2C7M B;  2INC C;  4JGH B;  4KGR A;  3KVF B;  4EUT A;  3O65 B;  3APC A;  4FHJ A;  1IYF A;  2LXC A;  3Q8C A;  2MP2 A;  3QK0 A;  4C4V B;  2KQ7 A;  1R7S A;  1D3Z A;  2VH1 A;  1SSN A;  1NI3 A;  1WYW B;  2HD5 B;  2IZV B;  4WIP A;  4GDK B;  3MHZ A;  3HK0 A;  4B95 A;  1TY2 A;  4JQW C;  3OAW A;  2FAZ A;  5EE9 A;  2D10 A;  1J0G A;  1UH6 A;  4BKG A;  1V1P A;  2GBM A;  2MBH A;  1XD3 B;  3U30 A;  2K25 A;  3PRZ A;  2K3U A;  2J53 A;  3MJ5 A;  3A1Q A;  3V6E B;  1ROE A;  1PGA A;  3N3K B;  5E6O A;  4E71 A;  2KC2 A;  2O6V B;  2GBN A;  4MGZ E;  3PZD A;  1Q10 A;  1LQB A;  1PDX A;  4N59 A;  1CK1 A;  1T5X D;  1LM8 B;  5E6P A;  2AQ3 B;  4PYU A;  1IGD A;  3Q69 A;  2HDE A;  2WXR A;  1L6U A;  2W82 A;  3MJW A;  1GPX A;  2QEJ C;  3ZUN A;  1C4P A;  2JXX A;  4M01 A;  1ESF A;  1YOV B;  4KZ0 A;  3IVF A;  2YEP F;  2W54 A;  1IBX A;  2K0P A;  4ZDV A;  1VZ6 A;  1F77 A;  3V60 A;  3ZLZ A;  3VR8 B;  2WWZ A;  1GNU A;  5AEK B;  1YNT E;  4CHK A;  4GMV A;  2BGF A;  1WYG A;  5DCN A;  1YMH E;  3B1L X;  5CTR C;  3RD2 A;  4HK2 A;  3ZJU A;  2JPH A;  2BWE S;  1V1P B;  5CHF A;  2N9L A;  3ETR A;  1YJI A;  3Q8E A;  4I6L B;  3CMM B;  3DHH C;  4XDC A;  2KJR A;  4S0R A;  4MEM A;  1FCC C;  1YX5 B;  4WQO B;  1SE4 A;  3UIO B;  2D3C A;  1I4G A;  3A1Q B;  1MJD A;  3MTN B;  5HKH A;  2FCS A;  5D7G A;  3BYY B;  2RPQ A;  2ZW0 A;  1ZKH A;  3HM6 X;  3VXW A;  4AOF A;  1KLU D;  2UYZ B;  3D32 A;  1XCQ L;  3R8B A;  2Z0D B;  3H6N A;  2BBC A;  3AEF B;  3IG3 A;  1L0X B;  4XX5 A;  3SHQ A;  4DXA B;  3MP9 A;  2AL3 A;  1A70 A;  1WR6 E;  1YQ3 B;  1D5X C;  2NR2 A;  2RPV A;  3ZNI D;  2V1Y A;  3GS2 A;  4IW0 A;  3GOE A;  3QAR A;  2ZZP B;  2BYT A;  1IP9 A;  1IBX B;  3APD A;  4FHK A;  3OJ4 B;  3OG5 A;  2L76 A;  4PT5 A;  2KTF A;  1YIW A;  3AE8 B;  3TJP A;  1TKY A;  2KMM A;  2L32 A;  1WIA A;  1YX6 B;  2WXN A;  5JZE B;  3VTW A;  3DBH I;  3PSE B;  2KMC A;  2DZM A;  3R2T A;  1J7C A;  2SEB D;  3E9S A;  4NNJ B;  3H8H A;  3A9J B;  2WXM A;  5G2N A;  2QC8 A;  3I5J C;  3NY5 A;  3QA8 A;  2L52 A;  3ZNH B;  3DQV A;  2J42 A;  4II2 B;  5EDS A;  2A4Z A;  2JZZ A;  1VDV A;  2CS4 A;  1D4B A;  1KM7 A;  4ZRQ A;  3HVZ A;  2JU6 X;  4PK1 A;  1HTO A;  1V5O A;  4CQN A;  1SEB D;  5FR6 A;  4AJY B;  3KUC B;  2NTT A;  1VLB A;  2GBK A;  1WZ3 A;  5C1Z A;  4ACF A;  4L1B A;  3KW5 B;  1FIQ A;  2C60 A;  4XYC A;  2ONQ A;  3DVG X;  1V97 A;  4H2A A;  2BQQ A;  1E90 A;  1QOA A;  4DQO C;  2N9K A;  1YJ1 A;  3SU8 X;  3UQB A;  5G5H A;  4EZL A;  1UEL A;  4NJ6 A;  3ENE A;  4XE0 A;  1WXV A;  4XDD A;  4WWO A;  1GB1 A;  1N61 A;  2C5L C;  1YQ4 B;  4GDL A;  3RZW C;  2QMT A;  3R66 C;  4LNK A;  1VRA B;  1V49 A;  4JE3 B;  1YN5 A;  3TUO A;  2BF8 B;  5I4D A;  1TS2 A;  2D3B A;  4EZJ A;  3FIL B;  4KKI A;  3BVZ A;  1P7F A;  3JVZ X;  5H8Y E;  1ZUD 2;  4ANV A;  1SGH A;  2N1V A;  3BY4 B;  2KOX A;  5AZF A;  4US9 A;  1FRD A;  4MSM B;  2SAK A;  2E6X A;  2JWU A;  1SE3 A;  1N5X A;  4WWN A;  4BKS D;  3O13 A;  4IM2 A;  4NQK E;  1Y56 A;  2J0J A;  4B0M A;  5JXV A;  1WRD B;  3DBL B;  1E9M A;  2KDF B;  2LJI A;  2JVC A;  1WI0 A;  4P6V F;  4MGI E;  2ASQ A;  1F2R I;  4DHJ B;  3AE6 B;  3DVN U;  2CR5 A;  3V6C B;  2ZPY A;  2PW9 A;  4JPS A;  3ZGZ A;  1TT5 B;  1SJH D;  1ZOY B;  4GSW A;  1N62 A;  3VVW B;  4BKS A;  2N9E B;  1OGW A;  3NVV A;  2IO2 B;  3PRE A;  1L5P A;  2DZK A;  3L54 A;  1HZ5 A;  3V61 A;  1NVI D;  1NEK B;  4II3 B;  2MJD A;  4LJP B;  4W9K A;  3EHV A;  2JQR B;  2RGF A;  3ZRC A;  2WQY B;  4A3P A;  2CJO A;  1GOZ A;  1FNW A;  1K50 A;  3B9J A;  1X1M A;  5FR3 A;  2FUG 1;  1FMA D;  1WJU A;  5MPO A;  3PLV A;  4N6E B;  4FAD A;  1E0Z A;  1HTQ A;  1SE9 A;  1UD7 A;  2D5G A;  4WJQ A;  4WH4 A;  3KQ4 A;  4NAW A;  4B0E A;  3M95 A;  1LO5 D;  1MPE A;  2R2Q A;  1QKZ A;  3PVL A;  1QOB A;  2LI5 A;  2ZCC A;  2MH7 A;  5KHQ A;  1L6V A;  4M8N A;  2KX3 A;  2MBO A;  2L83 A;  4HJK A;  1HA5 A;  2KWV B;  4WQM A;  1S3S G;  1WMH A;  2CHW A;  3UQA A;  4PS3 A;  5CHW A;  3T8M A;  3R2I A;  1ZP0 B;  4KIK A;  1S1Q B;  1FCL A;  3T3N A;  1LXD A;  4KV2 A;  1ZDV A;  1N63 A;  2Z59 B;  3PLU A;  4ZYS A;  2M0A A;  2GMI C;  4QAY A;  2NBW B;  2MJ3 A;  2C9W B;  2WS3 B;  1TZ1 A;  4KSK C;  3PZ7 A;  4RNA A;  3Q6B A;  4NQL B;  3U7D A;  2FBW B;  4FLH A;  4N9F 4;  3ZW3 A;  2L0T A;  4GIV A;  3A9K A;  4P1C C;  2N9P C;  3KWV A;  4NAW B;  3Q2A C;  1YN4 A;  4JWU C;  2GLS A;  2I1J A;  3HVD A;  4G3X B;  4W9I A;  4F7Z A;  5J2R A;  3VFK A;  3NUH B;  4K7U A;  4XZ4 A;  2KFJ A;  1QQR A;  2KJ6 A;  3Q8F A;  1ZXI A;  4TQ0 A;  1QOF A;  4G50 A;  2Z8L A;  2G3Q B;  1PUT A;  5LXI B;  2G4D B;  4HXD A;  5BYQ A;  1WJ6 A;  4LNI A;  2DNF A;  2O2V A;  3VTU A;  4RFB A;  2PKO A;  3TEZ A;  3W2D A;  4HVB A;  4LNN A;  1RLF A;  5HI1 A;  1B1Z A;  2KXJ A;  3CSF A;  1T3Q A;  4YTP B;  4PS7 A;  1M94 A;  3Q3J A;  3EUB 2;  2IJ0 A;  3H7P A;  4FXC A;  1FFU A;  3ML9 A;  3DBL I;  2FE8 A;  2O6V D;  2WXJ A;  4C4V A;  1AN8 A;  4WJN A;  3NG0 A;  4DBG A;  1I42 A;  1QT9 A;  2LGI A;  3AUL A;  5DPS A;  3P1M A;  2XNA C;  2ZCB A;  3A9K B;  3DBR B;  4MM3 A;  2ZPN A;  2J0M A;  1WXA A;  1AAR A;  2JZ3 B;  4IOI E;  3APF A;  4NJC A;  2BKR B;  4ZHO A;  1D5Z C;  2INN E;  3SFD B;  3DBH B;  3KUD B;  3LYY A;  1L2N A;  5D94 A;  4GB9 A;  3MC0 B;  4MT5 A;  5IO9 A;  2K8H A;  1XT9 B;  1WXQ A;  3UF8 A;  4FN2 A;  3ZNG C;  1UWM A;  2O2V B;  3BII D;  1SBB B;  1WGY A;  3H7S A;  1TS5 A;  4XWW A;  4OVV A;  2LZ6 A;  3AEC B;  1E7P B;  3A33 B;  4L2Y A;  1WFY A;  4K7S A;  3IT6 B;  4MH8 A;  1FXT B;  2K22 A;  4HDQ A;  3TSS A;  3RYT A;  3AE5 B;  2A5U A;  4IM3 A;  4OZC A;  4OZB A;  3N1X C;  4YTM B;  2WYQ A;  3NVW A;  3H7P B;  2ACZ B;  4LK0 M;  5FKA C;  4LNO A;  4CYE A;  5TR5 A;  1L0V B;  2RR9 A;  2J52 A;  3SD5 A;  1JML A;  2KWC A;  1WM2 A;  4DWF A;  4MM3 B;  2CU3 A;  4F1S A;  3RNA C;  2KDE B;  3WAM A;  3AXC A;  4NJ7 A;  3HUI A;  1LGR A;  4URK A;  5D6J B;  3PPA A;  3EEC A;  2N1W A;  4RM9 A;  2JXT A;  3ZJT A;  1JRP A;  3AH7 A;  4RCO A;  1GC6 A;  2JX5 A;  3P63 A;  1XO3 A;  1U4A A;  4AWJ A;  3ZRF A;  2JRI B;  4BOS C;  4BKT A;  3AE3 B;  1SB3 C;  3I63 C;  2PIA A;  3AEE B;  4HPM B;  5HFY A;  2K8B A;  1JWU D;  2V4L A;  1JCK B;  3BIN A;  2N9X A;  3DBS A;  2DBY A;  3B2F A;  3FKY A;  3Q3F A;  3T3O A;  3QAQ A;  4W9H A;  5LXH A;  1EUV B;  2IY1 B;  2IO0 B;  2XK5 A;  1F2R C;  4OW0 A;  3DWG C;  1EM7 A;  1R4N I;  1N5W A;  2OHF A;  1RAX A;  3ABV B;  4C80 A;  3TBL D;  4HPP A;  1N6Z A;  1IGC A;  2AQ2 B;  3L10 B;  1FEH A;  3A9J A;  1NEN B;  2KT7 A;  3W9C B;  1H8C A;  2DYB A;  4C7Y A;  4KSL C;  3RUL A;  1DOY A;  2PE6 B;  2DYO A;  2RSU A;  3ZYY X;  1J7A A;  3W1Y A;  3RT3 B;  4TQ1 A;  2NBU A;  1WGD A;  2V3P A;  4W9C A;  3I9V 1;  1I4Q A;  1DOX A;  4P16 A;  1HQR D;  2NPT B;  1VZ8 A;  3Q8B A;  3PGE A;  1ZW7 A;  3QHT A;  1TYG B;  3ECI A;  1V8C A;  2L05 A;  3GB1 A;  4TKN A;  3L4P A;  2PVO D;  1E5W A;  2V4I B;  3C0R B;  3QQ8 B;  2PTL A;  2M0X A;  1E8Z A;  2WX0 A;  2MJE A;  2JRH A;  2KAC A;  3GP7 A;  4WAA A;  4DDI D;  2LHE A;  2H89 B;  3PHX B;  3RCZ A;  3R7R A;  5DPW A;  2L8J A;  2GBR A;  5EE1 A;  3WAO A;  3WIM A;  1HZ6 A;  3DVG Y;  5BO4 B;  3DBR I;  2RD0 A;  4G11 A;  1P9D U;  1T0R C;  2D07 B;  3R3M A;  4JLC A;  2XK5 B;  5IAA C;  3P42 A;  2FUH B;  1OQQ A;  2IGD A;  3W5V B;  1J7B A;  4MJS A;  2LMC A;  2WXQ A;  2AL6 A;  1T0Y A;  3B2G A;  2DWQ A;  4RGT A;  1PFD A;  2W3R A;  3VAW A;  4EE2 A;  3RNE C;  4DHJ D;  1WRI A;  3FIL A;  4ZRK A;  1C79 A;  3NRZ A;  5JHB A;  2OJR A;  3PRP B;  1C78 A;  2DLB A;  3CST A;  3AE1 B;  5L83 A;  5BMH A;  3CWI A;  1T6B X;  2KDI A;  3RMK C;  1QIL A;  2FCQ A;  1E8W A;  1QOG A;  4C7Z A;  1YJJ A;  3J9C A;  3URY A;  2W3S A;  1DGJ A;  3HHM A;  1UNS A;  3AM9 A;  4IWO A;  4C00 A;  1L7Y A;  1EU4 A;  1SIJ A;  3V62 A;  4GLS C;  2PVG C;  2QHO A;  4OVZ A;  1V80 A;  2Y3A A;  4ANW A;  3GE8 C;  1J8C A;  1CQV A;  4RGM A;  1WGR A;  1ZPS A;  2L0F A;  1ACC A;  1NYQ A;  4B6W A;  2NS5 A;  2LD9 A;  3FAH A;  2IND C;  4HWI B;  3QJZ A;  2J0K A;  4WJP A;  2BVC A;  4WUR A;  2BS4 B;  2MA9 B;  2LUE A;  2IO1 B;  1UUP A;  2KYW A;  1JW9 D;  3DDC B;  3AE4 B;  2FIF A;  4MJS B;  1V5T A;  2L7R A;  4UDU C;  2K1F A;  4DDG D;  1PGB A;  2MBE A;  5IKC M;  4RMA A;  1HE8 A;  4JIO U;  1RWS A;  1XCT L;  1WXS A;  2KQ4 X;  1FXA A;  1ET6 A;  2DZI A;  2ZVN A;  3PTF C;  3N32 A;  2JT4 B;  3M62 B;  2MX2 A;  1NI2 A;  2BS3 B;  2MLB A;  4YXD B;  3EGR A;  2MSE D;  1YQB A;  4BBN F;  4TV3 A;  3TEY A;  1HXY D;  1P0R A;  2KDM A;  4K3B A;  2FID A;  3ONS A;  4AUQ C;  2KAN A;  2JF5 A;  5LNK 1;  2BYV E;  4P7I A;  1EF5 A;  4W9E A;  4FJZ A;  5HHD G;  3BVM A;  1MG4 A;  3NZS A;  5C3J B;  4KGS A;  1P1A A;  1FRR A;  1R4M I;  1WF9 A;  3L08 A;  4BAX A;  3ZQ4 A;  2ZVO A;  3AU4 A;  4WWM A;  1CMX B;  2K6D B;  4ARC A;  2PEA A;  1OQY A;  1EO6 A;  3B08 A;  1NDD A;  5C2T B;  1TS4 A;  2QIL A;  4LNF A;  3P2B A;  1ZXH A;  1KJT A;  1WE7 A;  2MBQ A;  4YSZ B;  3AEG B;  2WP9 B;  5G55 A;  2M8S A;  2ZEQ A;  1V86 A;  1N60 A;  4ARI A;  2WXO A;  4IG7 B;  2KQS A;  2VZK B;  1WE6 A;  5IN7 A;  2N4F A;  1TZO A;  2DYM A;  3B0A A;  3CIR B;  2K6Q A;  4JL9 A;  1WGK A;  1Z2M A;  1XXG A;  3IHP C;  4MDK E;  2HTM E;  4A6Q A;  3ZIM A;  3VTV A;  2JUO A;  3VR9 B;  4KDI C;  4ITK A;  4B9K A;  2KFK B;  3ML8 A;  2IGG A;  2JZP A;  2J7Q B;  5E6N A;  2GBJ A;  1SE2 A; 
#chains in the Genus database with same CATH homology
 1I42 A;  3DCG A;  3AUL A;  5DPS A;  4ZDV A;  4MSQ B;  2ZCB A;  3A9K B;  2FNJ B;  2HJ8 A;  4MM3 A;  4ZRJ A;  2ZPN A;  3V60 A;  1VCB A;  2J0M A;  3ZLZ A;  1WXA A;  1AAR A;  2WWZ A;  1K8R B;  1GNU A;  1TTN A;  2JZ3 B;  3N30 A;  5AEK B;  3NOB A;  3APF A;  4GMV A;  4CHK A;  2BGF A;  2BKR B;  3UIP B;  3KUD B;  2D11 A;  1IPG A;  1L2N A;  3TMP B;  5D94 A;  5DCN A;  3A4S C;  3B1L X;  5CTR C;  4GB9 A;  2CHZ A;  3RD2 A;  4HK2 A;  3VUW A;  4E3C A;  2K8H A;  2JPH A;  2AYO B;  3L13 A;  4W9D A;  3ZO5 B;  1XT9 B;  1RFA A;  2BWE S;  2KDB A;  4FN2 A;  3UF8 A;  2LVQ A;  5CHF A;  3ZNG C;  5D2M B;  2O2V B;  4I6L B;  3CMM B;  2YLM A;  1WGY A;  3H7S A;  2KJR A;  4OVV A;  4MEM A;  3DVN V;  4ZRI A;  1YX5 B;  4WQO B;  3UIO B;  2LZ6 A;  1WJN A;  3A1Q B;  4FJY A;  1LFD A;  1RRB A;  3MTN B;  2N7E A;  2BWF A;  3A33 B;  3KYD D;  4OVU A;  3PT2 B;  5HKH A;  2FCS A;  2R2O A;  5D7G A;  1WFY A;  5C23 A;  2RPQ A;  4K7S A;  1I35 A;  1WJ4 A;  2KKC A;  4NY0 A;  1ZKH A;  3HM6 X;  3VXW A;  4AOF A;  2UYZ B;  3CF6 E;  1FXT B;  3D32 A;  2CKH B;  4HDQ A;  2KFK A;  2Z0D B;  4EFO A;  3H6N A;  1WGG A;  4IM0 A;  3RYT A;  4W9G A;  2A5U A;  4IM3 A;  4AP4 C;  5GMV A;  3WA0 A;  1EF1 A;  3NHE B;  3IG3 A;  2WYQ A;  4IC7 B;  3H7P B;  5CHV C;  3TCA A;  2LRW A;  4XX5 A;  2EMS A;  4LJO B;  1WX8 A;  3SHQ A;  4DXA B;  2KJH B;  2AL3 A;  4CYE A;  2KNB A;  3UIN B;  4LDT B;  5TR5 A;  2RR9 A;  1WR6 E;  2NR2 A;  1GG3 A;  3WAL A;  3ZNI D;  2KK8 A;  3SD5 A;  4BOZ B;  2V1Y A;  4IW0 A;  4ANU A;  2KWC A;  3GOE A;  3H9D A;  3QAR A;  2ZZP B;  1IP9 A;  4GU2 A;  4A20 A;  2MWS B;  3APD A;  3LDZ E;  4FHK A;  1KLV A;  1WM2 A;  3OJ4 B;  1OEY A;  2CU1 A;  4GXB A;  4MEL A;  4DWF A;  4F1S A;  3M63 B;  2HE7 A;  2L76 A;  2CHX A;  2IY0 B;  2KTF A;  2OOB B;  1YIW A;  3TJP A;  3AI5 A;  1WIA A;  1YX6 B;  2KDE B;  4LDT D;  4W9L A;  4WJO A;  3AXC A;  3VTW A;  3WAM A;  3DBH I;  4NJ7 A;  5JZE B;  3PSE B;  2LGY A;  3KYC D;  4URK A;  5D6J B;  2KMC A;  2DZM A;  3U8Z A;  4EOY A;  5JHA A;  2LWP A;  3PPA A;  5L95 C;  3EEC A;  2N1W A;  4NNJ B;  3VH3 B;  3A9J B;  5G2N A;  3QWZ B;  4RM9 A;  3ZNZ B;  1UZX B;  2KTR A;  1GC6 A;  4I6P A;  3NY5 A;  3QA8 A;  4HLE A;  3ALB A;  3DQV A;  2DEN B;  3L0W B;  3ZNH B;  1A5R A;  1WXM A;  4GDL B;  4II2 B;  5EDS A;  1U4A A;  2A4Z A;  2JZZ A;  4AWJ A;  3KH0 A;  2PPH A;  2CS4 A;  3ZRF A;  1KM7 A;  2JRI B;  4BKT A;  4BOS C;  1E7U A;  2IO3 B;  1E8X A;  1E8Y A;  1V81 A;  1V5O A;  1VD2 A;  3KUZ A;  2PJH A;  5FR6 A;  4HPM B;  4AJY B;  3KUC B;  2K8B A;  2V4L A;  2GBK A;  4AJW A;  1WZ3 A;  3BIN A;  5C1Z A;  2N9X A;  3DBS A;  3LJ3 A;  3KW5 B;  2C60 A;  3Q3F A;  3QAQ A;  2DZJ A;  4W9H A;  3DVG X;  2KC1 A;  2D3G A;  5LXH A;  4LCD E;  1E90 A;  4MH0 E;  5IA7 A;  1EUV B;  2IY1 B;  3PS6 A;  2D2Q A;  2Y5B B;  4BFR A;  2IO0 B;  2K8C A;  2XK5 A;  3QC8 B;  2C7N B;  1WX7 A;  1YJ1 A;  3PRM B;  4CO7 A;  3AU5 A;  3I3T B;  3SU8 X;  2ZNV B;  1R4N I;  3K9O B;  1RAX A;  1ISN A;  3UQB A;  2ZNV C;  3DOW A;  4EZL A;  1UEL A;  3TBL D;  4NJ6 A;  3ENE A;  4PYZ A;  1WXV A;  3L10 B;  2KLG A;  3A9J A;  1F9J A;  4WWO A;  1P3Q U;  3ZTC A;  1H8C A;  1J19 A;  4KZC A;  2DYB A;  2C5L C;  5AZH A;  4KSL C;  2REX A;  3RUL A;  2LJ5 A;  2PE6 B;  2BKF A;  2BYF A;  2KN5 A;  2DYO A;  2RSU A;  4GDL A;  3RZW C;  1Z5S B;  2IYD B;  3R66 C;  4E74 A;  4HCP B;  5J18 A;  3W1Y A;  4EEW A;  4EKU A;  4ASW C;  3NS8 A;  3RT3 B;  4TQ1 A;  1V49 A;  2AWT A;  2NBU A;  4YL8 A;  1WGD A;  2KMA A;  4FUL A;  4HCN B;  2BF8 B;  2KTR B;  5CX3 A;  4W9C A;  3ZKJ C;  2NCN A;  4F8C B;  2MRP A;  2NBV B;  2EKE C;  4EZJ A;  2KHW B;  4DHZ E;  3ZDT A;  2M17 A;  2NPT B;  3JSV B;  3IBE A;  3JVZ X;  4ANV A;  3R7Q A;  1OTR B;  1SGH A;  2N1V A;  2G4S A;  3PGE A;  3BY4 B;  5KHO A;  2KOX A;  1ZW7 A;  3QHT A;  4W9F A;  5AZF A;  3S2A A;  3ECI A;  1WGH A;  4MSM B;  1WM3 A;  4ANX A;  2L05 A;  4WWN A;  4BKS D;  2DX5 B;  2LAS A;  4IM2 A;  1SIF A;  1E5W A;  2JY6 A;  2UWQ A;  4TKN A;  3C0R B;  3QQ8 B;  3X23 A;  4NQK E;  3W1S C;  2M0X A;  1Y8R C;  1E8Z A;  4HPL B;  3RUI B;  2WX0 A;  3JYU A;  2J0J A;  2JRH A;  2N7D A;  2LVP A;  4WAA A;  4K81 A;  1WRD B;  4DDI D;  3GZN I;  3PHX B;  3RCZ A;  4IUM B;  3R7R A;  5DPW A;  2L8J A;  2GBR A;  2KDF B;  4X57 B;  3WAO A;  2JVC A;  3EC8 A;  3WIM A;  3DVG Y;  1WI0 A;  5BO4 B;  1WZ0 A;  3DBR I;  3PV1 A;  2KO3 A;  4MGI E;  2RD0 A;  4G11 A;  4ICV A;  2ASQ A;  1P9D U;  2D07 B;  1WY8 A;  1WH3 A;  3R3M A;  4JLC A;  4WWP A;  4DHJ B;  2XK5 B;  3DVN U;  5IAA C;  2DAF A;  2WDT B;  2CR5 A;  2FUH B;  4K7W A;  3V6C B;  2ZPY A;  1YD8 U;  3QX1 A;  4KVG B;  4MJS A;  5AZG A;  2AL6 A;  1T0Y A;  4GSW A;  1GJZ A;  5DPR A;  3VAW A;  3VVW B;  4BKS A;  2N9E B;  2K39 A;  1H4R A;  4DHJ D;  4G0N B;  1OGW A;  2MCN B;  2I1K A;  2NPT A;  4ZRK A;  3JSV A;  4GN1 A;  2IO2 B;  2VRR B;  1P98 A;  1V9J A;  3PRE A;  3VUX A;  2DZK A;  5JHB A;  5J17 A;  3L54 A;  2OJR A;  3PRP B;  3V61 A;  3QIJ A;  3CST A;  2EMT A;  4II3 B;  4LJP B;  5L83 A;  4IWP A;  3EHV A;  4W9K A;  3IFW B;  4MGK E;  5DPT A;  2KDI A;  2RGF A;  4DK5 A;  1MG8 A;  3QCA A;  2GOW A;  2XBB C;  4J6I A;  2PE9 A;  1V2Y A;  3ZRC A;  4A3P A;  2FCQ A;  1E8W A;  2L00 B;  3W1S A;  1WMH B;  2MQJ A;  2AEH A;  3MHS D;  1C3T A;  2JWZ A;  4BBN C;  5JH5 C;  3HHM A;  3VQI A;  2V3S A;  2DAJ A;  4KIK B;  3VUY A;  1X1M A;  1UBI A;  2LRU A;  1WX9 A;  2IBI B;  4IWO A;  1L7Y A;  1WJU A;  3V62 A;  3PLV A;  4RM8 A;  4M8M A;  4FAD A;  2QHO A;  2MBB B;  4K1R B;  1V80 A;  2MW5 A;  4ANW A;  1SE9 A;  3X0W A;  1UD7 A;  1J8C A;  3L16 A;  1WGR A;  4WJQ A;  1NBF C;  3SDL C;  4A3O A;  3A4R A;  4NAW A;  2L0F A;  1GC7 A;  3ZTD A;  2KZR A;  3M95 A;  2WX1 A;  4GGQ A;  4B6W A;  4GDK A;  2NS5 A;  1UBQ A;  1C1Y B;  2LD9 A;  4HWI B;  2R2Q A;  3QJZ A;  2J0K A;  4WJP A;  1TBE A;  2C7H A;  3PVL A;  2LI5 A;  3T9L A;  2MA9 B;  1OEY J;  2LUE A;  2IO1 B;  2ZCC A;  2M4N A;  1ZGU B;  2MP2 B;  5KHQ A;  1BT0 A;  3VDZ A;  4M8N A;  2KX3 A;  3DDC B;  3OJ3 A;  4M0W B;  2FIF A;  3L17 A;  4MJS B;  3NZU A;  2MBO A;  1V5T A;  4HJK A;  2L7R A;  2FCM A;  4IWQ A;  2K1F A;  4DDG D;  2MBE A;  2FCN A;  4FBJ B;  4RMA A;  3JW0 X;  1HE8 A;  4JIO U;  1E7V A;  1Q0W B;  2KWV B;  2Z0E B;  4FA6 A;  1KOT A;  2LVO A;  3RZF A;  1S3S G;  1WXS A;  2BYE A;  4XC2 A;  3HM3 A;  1WMH A;  2CHW A;  2ZVN A;  2DZI A;  3PTF C;  1Q5W B;  3UQA A;  3N32 A;  2KWU B;  4PS3 A;  2JT4 B;  3M62 B;  5CHW A;  2MX2 A;  4BVU C;  1NI2 A;  1G6J A;  3T8M A;  2O6V A;  3UGB B;  2MLB A;  4KIK A;  1S1Q B;  2MSE D;  4HDO A;  2KD0 A;  1YQB A;  4BBN F;  4PS8 A;  4TV3 A;  4MGY E;  1XQQ A;  1LXD A;  4KV2 A;  2W9N A;  2Z59 B;  3PLU A;  4FJV B;  1Q1O A;  3DPD A;  1P0R A;  2GMI C;  2FID A;  2NBW B;  1UGM A;  2C9W B;  3ONS A;  4AUQ C;  2KAN A;  2JF5 A;  3TIX A;  2YVC A;  2BYV E;  2KX0 A;  2LGX A;  1PQS A;  3M3J A;  4P7I A;  4EZK A;  1EF5 A;  2C7M B;  1TZ1 A;  4KSK C;  4W9E A;  4FJZ A;  4JGH B;  3NZS A;  4NQL B;  3U7D A;  3WAP A;  3KVF B;  4FLH A;  1P1A A;  3EFU A;  4N9F 4;  3ZW3 A;  2L0T A;  4EUT A;  3O65 B;  3APC A;  4GIV A;  3A9K A;  4FHJ A;  1R4M I;  2BPS A;  1IYF A;  1WF9 A;  2LXC A;  4NPN A;  1JRU A;  3L08 A;  2M1M A;  2MP2 A;  2N9P C;  3QK0 A;  2KQ7 A;  2ZVO A;  4NAW B;  1D3Z A;  3AU4 A;  2I1J A;  1CMX B;  3H1U A;  2HD5 B;  1WYW B;  4G3X B;  2IZV B;  4W9I A;  4F7Z A;  5J2R A;  3VFK A;  4W9J A;  4TUU A;  4GDK B;  4K7U A;  2K6D B;  4XZ4 A;  2KFJ A;  3HK0 A;  4B95 A;  2KJ6 A;  2PEA A;  4JQW C;  3OAW A;  4TQ0 A;  1GUA B;  2FAZ A;  4G50 A;  1OQY A;  1EO6 A;  3PHW B;  2G3Q B;  2NVU I;  3B08 A;  5LLI A;  5LXI B;  2D10 A;  2G4D B;  4HXD A;  1NDD A;  1UH6 A;  1J0G A;  4BKG A;  2KVR A;  1WR1 A;  2GBM A;  4I6N B;  1WJ6 A;  3P2B A;  2MBH A;  1XD3 B;  2O2V A;  3VTU A;  3U30 A;  3WAN A;  2K25 A;  1KJT A;  3PRZ A;  1WE7 A;  2MBQ A;  4DHZ B;  4HVB A;  5G55 A;  3HIZ A;  3TL5 A;  3A1Q A;  2M8S A;  2ZEQ A;  1V86 A;  4GOC A;  3V6E B;  1V6E A;  4ICU A;  1RLF A;  2B3A A;  2KXJ A;  3CSF A;  4IG7 B;  3N3K B;  5E6O A;  4ZYN A;  4E71 A;  2KC2 A;  2KQS A;  3VHT C;  2O6V B;  2GBN A;  1WE6 A;  4MGZ E;  4PS7 A;  2L3Z A;  2N4F A;  3ZVV A;  3PZD A;  2DYM A;  2DHZ A;  1LQB A;  2ZJD A;  3B0A A;  1LM8 B;  5E6P A;  1M94 A;  2K6Q A;  3Q3J A;  4JL9 A;  3VH4 B;  1Z2M A;  4PYU A;  3IHP C;  2LXA A;  2KLC A;  2XEW A;  3H7P A;  3MJW A;  3OLM D;  2HTH A;  4MDK E;  3ML9 A;  3DBL I;  3ZIM A;  3K9P B;  4KDL B;  2O6V D;  3ZUN A;  3VTV A;  2JXX A;  2JUO A;  4KDI C;  1TGZ B;  4WJN A;  1QZE A;  4KZ0 A;  2KFK B;  3IVF A;  4B9K A;  2G45 B;  3ML8 A;  2J7Q B;  4DBG A;  2LGD A;  5E6N A;  2GBJ A;  3ZDM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...