2NVUI

Structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein turnover, ligase
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
total genus 17
structure length 76
sequence length 76
chains with identical sequence J
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nvuI00
1WJNA 1WJ4A 2BYVE 4KSLC 2C9WB 3L10B 1OQYA 4W9EA 2LGDA 4BOSC 3RULA 1EO6A 2KOXA 3KH0A 5GMVA 1E5WA 3L54A 5CHVC 2PJHA 2KWUB 2ZCBA 3L0WB 3ZUNA 4BKSA 2LZ6A 3PLUA 4FHKA 3PHWB 1R4NI 2DZJA 4GB9A 4CYEA 3JYUA 3R66C 4KDIC 4KZCA 2ZJDA 3LDZE 2V4LA 3DVGY 4RM9A 1FXTB 1P0RA 3CSTA 3U7DA 2GBJA 1YX5B 3L13A 1WY8A 1RFAA 1TBEA 3OJ4B 2J7QB 2DZMA 4RM8A 2ZEQA 1WFYA 2M4NA 3IG3A 4JGHB 2JZ3B 2C7MB 4JIOU 4J6IA 4M8MA 4MGKE 1E8XA 3APFA 2BYEA 2KX3A 3VTWA 3V62A 2UYZB 3ONSA 3KUDB 3DBSA 3RYTA 5J18A 3AU4A 1GG3A 1VD2A 1WZ0A 2AWTA 4FLHA 5KHQA 2UWQA 1P98A 2NR2A 1WX8A 2BWES 3V6EB 3NZSA 4II2B 2C60A 4MSQB 4W9CA 4BKTA 2KVRA 4TV3A 5G2NA 2ASQA 2LGYA 3M62B 2NPTA 3Q3JA 2K25A 4E71A 3A9KA 3RUIB 2N4FA 3ZIMA 4KDLB 3PSEB 3WANA 4BKSD 5C1ZA 3IFWB 4LDTB 2K8CA 3MTNB 4EFOA 2NCNA 2FNJB 3GZNI 4HXDA 1WF9A 4W9HA 3DVNU 2REXA 1A5RA 2KC1A 2BPSA 3I3TB 2G4SA 3MJWA 4MGYE 1Z5SB 2WDTB 4FADA 1HE8A 4LDTD 2DAJA 2CU1A 5G55A 2KTRA 1IP9A 4IWPA 4F8CB 1T0YA 4BOZB 2YVCA 4K1RB 2A4ZA 2IY1B 1V6EA 3SU8X 1WI0A 1WM3A 2IO3B 1WH3A 4MM3A 3VTUA 4E3CA 2DYMA 1GC7A 4WJPA 1E7VA 3PREA 3VTVA 2AL3A 2JY6A 2MBHA 2K1FA 2DHZA 3IVFA 4G50A 4BKGA 4XC2A 4NAWB 4NPNA 2VRRB 3RCZA 4DBGA 3L08A 2KTRB 1GC6A 1WGRA 2KJRA 1MG8A 3OLMD 3ZNHB 1SIFA 3D32A 5E6NA 1R4MI 4JL9A 2KJHB 3NS8A 3T9LA 3H7PB 1AARA 3GOEA 3NHEB 2KZRA 3VXWA 3TJPA 3BY4B 3VVWB 1GUAB 2KHWB 3UIPB 4F7ZA 4MDKE 1KLVA 1WX9A 3ENEA 3L16A 3PVLA 2L3ZA 3ZDTA 3WALA 4GXBA 2NVUI 1WIAA 1V5OA 3PLVA 2CHXA 2KFKA 4BVUC 1WGYA 3B08A 4NJ7A 4X57B 1UD7A 3M3JA 2A5UA 3KYCD 4FBJB 4MGIE 1EF1A 1NI2A 2KXJA 2G3QB 4GGQA 5TR5A 3QA8A 2K6DB 4FJZA 4GDKB 1LQBA 4FULA 3OAWA 3QARA 2C7NB 2JRHA 5DPWA 2WX0A 3CMMB 3DPDA 4FJYA 4W9FA 4LJPB 3SD5A 4HVBA 4FN2A 2DYBA 2KWCA 2DZKA 2KJ6A 5DPRA 2BYFA 2MCNB 1J8CA 3VH3B 1EF5A 4TQ1A 1K8RB 4A3PA 1V2YA 1UGMA 3B0AA 3UIOB 3CF6E 3QJZA 3ZTCA 2JT4B 1CMXB 2MSED 2MBEA 2I1JA 3N32A 3NY5A 4G11A 4AWJA 2V1YA 3VHTC 1S3SG 4M0WB 4BFRA 4ZYNA 2ZPYA 1H4RA 3ZNZB 4KIKB 3RZFA 1I35A 1TZ1A 4DK5A 3VH4B 1WGHA 5C23A 1KOTA 2MP2B 3AULA 2KK8A 1WM2A 2MP2A 2RGFA 4W9GA 2N1WA 5D7GA 2DZIA 3U8ZA 3EC8A 4IUMB 5HKHA 5J17A 2FIFA 1YJ1A 2LXAA 2KC2A 2PEAA 3QK0A 4KSKC 5CX3A 1LXDA 1WYWB 3VDZA 5AEKB 1KM7A 2NBVB 3KVFB 5E6OA 3WAOA 3HK0A 1WXSA 4AUQC 5JHAA 2MBBB 4WJOA 2LRWA 2KO3A 1L2NA 1C3TA 1EUVB 3KW5B 3PS6A 1IYFA 2JF5A 1RRBA 2GBNA 2MWSB 2KQ7A 4FHJA 2KDFB 2Z59B 4TKNA 3WAPA 1GJZA 1XQQA 3EHVA 3P2BA 3MHSD 3RT3B 1WGGA 1PQSA 4DHZE 1V9JA 2PE9A 3UINB 3VAWA 4ANVA 4E74A 3VQIA 3DVNV 2IZVB 3A9JB 3N30A 4DWFA 4K81A 2IO1B 2NBWB 4KIKA 2JXXA 3ZNID 2AYOB 5J2RA 2GBMA 2LASA 3W1SC 3DCGA 4HPMB 4PYZA 3L17A 1Q1OA 4DXAB 2ZVNA 2LWPA 3JSVB 4WWNA 2BGFA 2KQSA 4K7SA 4AP4C 3Q3FA 1ZGUB 4W9IA 3WA0A 3X0WA 4ZRIA 2ZPNA 2MX2A 1X1MA 1WXAA 2JUOA 2O6VB 2FCSA 4ZRJA 3A4RA 5IAAC 4GU2A 3UGBB 3PV1A 1Z2MA 2L76A 1RAXA 4I6PA 2KTFA 4EZLA 2KKCA 1QZEA 2LVOA 3KUCB 3M63B 2LD9A 3ZLZA 3NOBA 2N9XA 4ASWC 2CHZA 4DDID 3JSVA 2KDBA 4MGZE 1E8ZA 3H9DA 4CHKA 3K9PB 1TGZB 2J0MA 2D3GA 1J0GA 5D6JB 1WRDB 2O2VB 3DBRI 4ANUA 4IG7B 1WR6E 2AEHA 3JVZX 2K39A 2KDEB 3W1SA 2LGXA 1XT9B 3BINA 1OTRB 3X23A 3AI5A 4HWIB 3TL5A 2MLBA 4K7WA 3V61A 3ZKJC 1M94A 2Z0DB 4HK2A 3QCAA 1KJTA 1P1AA 2BF8B 2OOBB 4W9DA 3UQAA 2LJ5A 2HTHA 1WGDA 3ZVVA 1E8WA 2RD0A 4I6NB 2EMTA 4GN1A 2O2VA 4GOCA 3APCA 5KHOA 5DPTA 4A3OA 1G6JA 2ZVOA 3VFKA 4EEWA 1WR1A 1YQBA 2PPHA 2XBBC 4HCPB 3SDLC 3O65B 2CS4A 2MA9B 3QWZB 5CHWA 2D2QA 2JRIB 1OEYJ 4F1SA 2J0KA 1WJUA 4MJSB 4FA6A 3K9OB 4BBNF 4NNJB 3KUZA 3W1YA 3APDA 2L8JA 1I42A 2DYOA 2GMIC 2KMCA 4KVGB 2NPTB 2G4DB 4G3XB 1UBIA 4AJYB 4URKA 5JH5C 5L95C 4LCDE 1Q5WB 3A9KB 3CSFA 3ZO5B 1J19A 5AZHA 4MSMB 4AJWA 4JLCA 2LVQA 2FCNA 1WE7A 1OGWA 2M8SA 1P9DU 5D94A 3DDCB 2WYQA 1WJ6A 1E7UA 2KD0A 3KYDD 4ICVA 2IY0B 4CO7A 4WWPA 2XK5A 4IWQA 3PRZA 2V3SA 3HIZA 2KWVB 3HM3A 3ZW3A 4OVUA 4DDGD 3PPAA 4GDLB 1IPGA 2M17A 4GDLA 4MJSA 4XZ4A 2CR5A 4HDQA 3TIXA 1ISNA 4ANXA 2LXCA 2IBIB 3QC8B 1XD3B 4HPLB 4DHJD 1WXVA 4ICUA 2FAZA 1E90A 5FR6A 3R3MA 1C1YB 4NQLB 2ZNVC 4FJVB 4OVVA 2IO2B 2GOWA 4IM0A 2D07B 5BO4B 2ZZPB 4GMVA 4NY0A 2L7RA 2C7HA 3IBEA 2O6VD 2G45B 1UZXB 4RMAA 3JW0X 3TMPB 4HLEA 4IM2A 4EZJA 2M0XA 2HD5B 2KN5A 2AL6A 1V81A 2FCMA 1E8YA 1UELA 4PS7A 4B95A 2JVCA 2W9NA 2N1VA 4BBNC 2N7EA 3EFUA 3A9JA 3IHPC 4PS3A 1D3ZA 2K8BA 2KNBA 2CKHB 3DOWA 2DENB 3N3KB 3PZDA 4B6WA 1V5TA 2QHOA 5LLIA 3B1LX 3VUWA 2M1MA 3A1QB 3ML9A 4IM3A 2L00B 2MQJA 3ALBA 5LXHA 2N9PC 4TQ0A 2B3AA 4EZKA 2RR9A 3DBLI 3QX1A 1H8CA 2KX0A 3NZUA 3WAMA 2C5LC 1UBQA 2EMSA 2IYDB 1VCBA 3PHXB 2KFJA 4M8NA 3UQBA 2JPHA 3DVGX 2DX5B 4LJOB 1WXMA 3DQVA 1UH6A 3OJ3A 2L0FA 2LRUA 3DBHI 3PRMB 5IA7A 2LUEA 2N9EB 2FIDA 3TCAA 2I1KA 2MRPA 1NDDA 1F9JA 2EKEC 5AZGA 4B9KA 3WIMA 4EOYA 2RPQA 2J0JA 2MBQA 2LVPA 1Y8RC 2N7DA 3EECA 2KLCA 3AU5A 2KMAA 5JHBA 2YLMA 5JZEB 1V49A 1OEYA 4GDKA 2RSUA 3QAQA 1WX7A 2D10A 5E6PA 5AZFA 4MH0E 4K7UA 1BT0A 3U30A 2DAFA 2K8HA 5DCNA 1V86A 2KFKB 4ZRKA 3ML8A 2Z0EB 4JQWC 1S1QB 1JRUA 3A4SC 4HJKA 3HM6X 3QIJA 4DHZB 2ZNVB 2OJRA 4GIVA 2WX1A 5LXIB 3V6CB 1RLFA 5DPSA 4EUTA 1ZKHA 2LI5A 4IW0A 4WWOA 3HHMA 1P3QU 1YD8U 1V80A 2L05A 2R2OA 1LFDA 4PYUA 4G0NB 2MW5A 1WZ3A 4EKUA 1NBFC 3M95A 2K6QA 4GSWA 3T8MA 3LJ3A 5CTRC 3ZNGC 4AOFA 2HE7A 4W9LA 3S2AA 4I6LB 4TUUA 2BKRB 3A33B 3QQ8B 4WQOB 3AXCA 1SGHA 4II3B 4IC7B 2BWFA 1SE9A 2HJ8A 3R7QA 4ZDVA 2FCQA 1LM8B 2JWZA 4W9JA 3SHQA 3PGEA 4NAWA 3H7SA 4MEMA 4KV2A 2KANA 5L83A 2O6VA 1TTNA 3RZWC 3VUYA 2Y5BB 4N9F4 3ZRCA 2IO0B 2MBOA 4NJ6A 4WAAA 3V60A 4W9KA 2PE6B 3C0RB 4XX5A 2FUHB 4P7IA 2KLGA 4PS8A 1WMHB 2NS5A 2GBKA 3PTFC 2CHWA 1L7YA 4HCNB 1WMHA 4WJQA 3VUXA 3R7RA 3ZDMC 3ZTDA 3A1QA 4ANWA 5EDSA 4KZ0A 3TBLD 4NQKE 1WE6A 3PT2B 4DHJB 3RD2A 3H7PA 4A20A 1U4AA 2D11A 2BKFA 5D2MB 4HDOA 4MELA 4IWOA 3H6NA 4WJNA 3ECIA 2NBUA 1YX6B 2L0TA 2ZCCA 3QHTA 3ZRFA 1GNUA 2GBRA 2WWZA 1ZW7A 1YIWA 3UF8A 2R2QA 5CHFA 2KDIA 1Q0WB 3PRPB 3H1UA 4YL8A 2JZZA 2XEWA 2XK5B
chains in the Genus database with same CATH superfamily
1OQYA 4W9EA 2LGDA 1EO6A 2KOXA 3L54A 2PJHA 2KWUB 3V05A 4BKSA 5TSSA 4FHKA 1PGAA 4GB9A 4KDIC 1TJEA 2ZJDA 3LDZE 4A55A 1V1OA 1JWAD 1XLOA 2ZEQA 2M4NA 4YTNB 2C7MB 4MGKE 3AE9B 3VTWA 1EU3A 1KLGD 3ONSA 3T3OA 2IGGA 2W54A 1VD2A 2UWQA 2BWES 1WXQA 3NZSA 4II2B 2C60A 4W9CA 2VH1A 4BKTA 5G2NA 3IT6B 4HRSA 3BVGA 2DBYA 4BKSD 4EFOA 2NCNA 1WF9A 2V3NA 2REXA 2KC1A 3SFEB 3I3TB 2RDBC 3MJWA 4FADA 4M0WA 4LDTD 2RDHA 4BOZB 2YVCA 4YTMB 2BB6A 5BMGA 1FXIA 4E3CA 3VTUA 2DYMA 4WJPA 3PREA 4XC2A 2VRRB 4KGTA 4DBGA 2HJ1A 1JRPA 4LTUA 4US8A 1MG8A 3OLMD 3ZNHB 1R4MI 2BQQA 4GLSC 4K3BA 4IDIA 3H7PB 4JX1C 1NYRA 4OVZA 2LGIA 1D5XC 1KLVA 2JX5A 3PVLA 3DBLB 3NS1A 2CHXA 1I4QA 4OZBA 2GB1A 1UNSA 3M3JA 2A5UA 2WLBA 3DHHC 1KH0A 1LQBA 3DPDA 3SD5A 4HVBA 4FN2A 5C3JB 2DYBA 2DZKA 3P63A 5DPRA 3RNGC 2BYFA 1EF5A 1VR9A 1WGKA 3OWEB 1JMLA 1DYQA 2MBEA 4AWJA 1CK1A 3VHTC 4BFRA 3VR8B 2WQYB 1FMAD 3VH4B 1WGHA 3J9CA 5C23A 2V3PA 1T6BX 1KOTA 2INCC 2MP2B 1WM2A 5BYSA 3T3NA 3QK0A 4KSKC 3ZYYX 5AEKB 2Y5CA 4TSSA 4L1BA 1RWSA 2MBBB 1L2NA 2WU2B 5JXVA 4C56C 2JF5A 1RRBA 2GBNA 3MC8A 5I4DA 3AE1B 1FIQA 1N6ZA 3EHVA 5EE1A 3MHSD 3RT3B 2PE9A 4E74A 3N30A 2IZVB 2IO1B 3DWGC 2JXXA 3ZNID 2GBMA 3W1SC 2Q5WD 2DNFA 1QLBB 3JSVB 3RMKC 2GI9A 5IN7A 2BGFA 4W9IA 3X0WA 2ZPNA 2JUOA 2FCSA 3R2TA 3VRAB 1RAXA 4I6PA 1C9FA 5HI1A 2LVOA 2PLPA 2LD9A 1DOIA 4ASWC 3ZJVA 2KDBA 4MGZE 2V0GA 4JPSA 2J0MA 1WRDB 2O2VB 1QILA 1TY2A 4RGNA 3QCAA 3UQAA 3RNAC 2LJ5A 2K22A 4GN1A 2O2VA 1XLQA 4GOCA 5DPTA 3VFKA 1IBXB 2XBBC 3AEGB 4NZLB 5CHWA 4FA6A 1YN5A 1DOXA 2NMQA 4NNJB 2BW2A 1WYGA 3EGRA 1BMLC 3IXSA 1I42A 4KVGB 3A9KB 3CSFA 3ZO5B 4JLCA 3Q8FA 1WE7A 5BYRA 2M8SA 5D94A 4D2KA 4CO7A 3PZ8A 1SE3A 3KQ4A 2XK5A 4H2AA 3PRZA 5H8YE 2V3SA 3HIZA 4XZ4A 3FILB 4QAYA 3QC8B 2WNMA 1I4HA 2FAZA 1J7BA 1E90A 2RMMA 1E6EB 1QOGA 3LYYA 2ZZPB 3IBEA 2O6VD 1FNUA 4EZJA 4YSZB 1V81A 3AMZA 1E8YA 4PS7A 4ZOHC 2N7EA 3EFUA 3A9JA 4M02A 3Q3OC 4LNNA 2DENB 1KRHA 4B6WA 1V5TA 3B1LX 3A1QB 3ML9A 3I57A 2KX0A 1TY0A 2IYDB 1V8CA 3P4SB 4P1CC 1UH6A 2WXKA 3DBHI 2X8XX 2FIDA 2LMCA 2IGDA 4B9KA 1NDDA 3WIMA 2MBQA 2LVPA 1DGJA 1Y8RC 2ZW1A 5JHBA 2YLMA 1OEYA 2QSDA 4GDKA 4YT0B 2RSUA 3W5VB 3Q2AC 1BT0A 2RDGA 2DAFA 4MH8A 1A5RA 1NEKB 2ZNVB 3RNFC 4A6QA 4PT5A 4WWOA 3OG5A 1I4PA 3DBRB 1V80A 2L05A 2W3RA 2OJWA 1GB1A 4EKUA 3P42A 2K6QA 4GSWA 2FUG1 2D3AA 2HE7A 4W9LA 3BWUD 1ACCA 4TUUA 2BKRB 5BYQA 4WQOB 3R7QA 1IGDA 2FCQA 1LM8B 4YSXB 3I63C 4W9JA 3H7SA 4MEMA 2KANA 2O6VA 4N9F4 3V60A 3DHGC 4P7IA 2KLGA 4PS8A 2SAKA 1WWTA 2NS5A 3PTFC 2BT6A 3PT2B 2D11A 1PUTA 5FKAC 1TKEA 3ECIA 5AUKA 1YX6B 2L0TA 3LXFA 1E7PB 1ZW7A 1PFDA 2NTSA 4YTPB 4YL8A 2XEWA 3AXCA 2XK5B 1WJNA 1WJ4A 2WXJA 3KH0A 5GMVA 1E5WA 1SEBD 2ZCBA 1FM0D 3H8HA 1R4NI 2DZJA 2I2YA 3JYUA 1FFUA 3BYTB 3R66C 3DVGY 4RM9A 4DXFA 1P0RA 2GBJA 1YX5B 1WY8A 1RFAA 2DZMA 4RM8A 1WFYA 4ANXA 4M8MA 2JZ3B 3MC0B 4JIOU 5HFYA 3APFA 2BYEA 1C4PA 3MFGA 1EM7A 2WDRB 2UYZB 3Q14C 3KUDB 3DBSA 4MT5A 1IBXA 3AU4A 1GG3A 2AWTA 3N20C 4FLHA 5KHQA 4MSQB 3AM9A 2L83A 3RFZB 2LGYA 1JALA 2N4FA 5IOIA 4KDLB 1JWUD 4LDTB 2K8CA 2WXRA 3GZNI 1LO5D 4N58A 2PTLA 4MGYE 5T8IA 1HE8A 3EA6A 2MEKA 4F8CB 3I9V1 1AN8A 1TKYA 3SU8X 1WI0A 2IO3B 1GC7A 1FO4A 3VTVA 2JY6A 2DHZA 2N0SB 3IVFA 4BKGA 2LJIA 2KDMA 3RPFC 2WXQA 1C79A 1MG4A 2EELA 2KT7A 2KJHB 4M00A 4RGTA 3N9YC 3GOEA 1TIFA 1XEEA 3TJPA 1KTKA 3VVWB 2KHWB 1WX9A 3ENEA 2W3SA 1V5OA 3PLVA 5BMHA 3B08A 4NJ7A 4WIPA 5IP4D 4MM3B 3ABVB 1NI2A 2G3QB 4GGQA 1YJJA 1YN4A 4YWGG 5TR5A 3QA8A 4FJZA 3U4EG 3QARA 2C7NB 3IT4B 5DPWA 1VDVA 1CJEA 2Y3AA 3NVWA 1GOZA 1XCQL 3DWMA 1J7AA 1SXTA 5GXGB 1K8RB 4A3PA 2KAJA 1V2YA 4WH4A 2JT4B 2JU6X 4P6VF 2I1JA 1ZE3D 4G11A 2QJLA 4RGOS 1H4RA 2BYTA 1IUEA 1C4CA 1I35A 4S0RA 1VRAB 2J4XA 3AULA 4W9GA 2N1WA 2DZIA 4IUMB 4RF0A 1HTQA 2KC2A 5CX3A 1LXDA 3AE8B 4EE2A 1GPXA 2G9HD 3KVFB 3WAOA 4C80A 2LRWA 1K52A 1C3TA 4XE0A 1EUVB 3PS6A 4C00A 2MWSB 1JQ4A 4FHJA 4CQNA 3WAPA 1GJZA 1XQQA 2K9XA 1WGGA 1N62A 3URYA 1V9JA 3UINB 4ANVA 2J53A 2AYOB 1UUPA 4PYZA 3IAS1 4DXAB 4HROA 4WWNA 4K7SA 1ZGUB 1NYQA 2QIEB 2M0AA 1UF0A 1Z2MA 2L76A 3P4QB 2KTFA 3EUB2 1R7SA 3M63B 5BMIA 1JW9D 3NOBA 2CHZA 4XGAB 4ARCA 1E8ZA 2WXLA 3K9PB 2D3GA 1FRDA 1V1PA 3DBRI 3AEAB 2K39A 2LGXA 3FKYA 2L32A 3BINA 3X23A 3TL5A 3GS2A 4HWIB 1M94A 1XLNA 3PO0A 3CIRB 1KJTA 1P1AA 2BF8B 2OOBB 3AECB 3ZVVA 1E8WA 1FCCC 2RD0A 4P1BC 2WDQB 1V1PB 1AWDA 2BS2B 4LNKA 4EEWA 1WR1A 4HCPB 3SDLC 3O65B 1MHXA 2MA9B 3QWZB 1L5PA 2JRIB 4F1SA 1WJUA 4OZCA 1MJDA 1KLUD 1D5MC 2G4DB 4URKA 3HRDD 1NI3A 1J19A 4MSMB 1J7CA 3C8YA 1C76A 1OGWA 2UU7A 1ZXHA 3DDCB 4ICVA 4WWPA 4IWQA 2ACZB 1ET6A 2KWVB 4OVUA 3BYYB 4GDLA 2CR5A 1DOYA 3TIXA 2K3UA 4HPLB 5HHDG 4DHJD 4ZRQA 1M4VA 5FR6A 1C1YB 1SF0A 4XWTA 1GAQB 2LFIA 4IM0A 4RFBA 2D07B 4NY0A 1SJED 2L7RA 4HLEA 3JW0X 1L0XB 2FCMA 1UELA 2JVCA 2W9NA 3IHPC 4PS3A 2CKHB 4K3CA 2M1MA 4IM3A 1VJKA 3RNCC 1FCLA 2N9PC 4EZKA 2RR9A 1UBQA 1E10A 3NVVA 4KGRA 3PHXB 2KFJA 4RGMA 3ZXRA 4REZA 1WXMA 3OJ3A 3Q8AA 3MP9A 2LUEA 2N9EB 1F9JA 2RPQA 2IDYA 2J0JA 1QKZA 1FFVA 3AU5A 1TS5A 5JZEB 3I5JC 1WX7A 2D10A 4MH0E 4K7UA 1L4DB 2K8HA 1FEHA 5DCNA 1V86A 1T0SC 3ML8A 4JQWC 1S1QB 1JRUA 3A4SC 3QIJA 4GIVA 2WX1A 3V6CB 3B9JA 5D3IB 3E9SA 5FR3A 1P3QU 1YD8U 2X38A 2MW5A 1WZ3A 3L4PA 1NBFC 3ZNGC 2G1EA 1L6VA 3QQ8B 2BWFA 1SE9A 2HJ8A 3BK1A 2JWZA 3PGEA 4NAWA 5L83A 1QOBA 1TTNA 4S17A 2PE6B 4XX5A 2FUHB 3RI7C 2KVZA 4FXCA 1SBBB 2WU5B 5LXHA 1L7YA 1MPEA 1WMHA 4HCNB 3VUXA 5EDSA 4KZ0A 3AEDB 5EE3A 3N1XC 3RD2A 1SIJA 4A20A 1LGRA 1ENFA 3H6NA 4TMAB 3QHTA 2GBRA 2WWZA 4ACFA 1EWCA 2WGSA 3UF8A 4OW0A 1Q0WB 2L1AA 2JZZA 2BYVE 2FE8A 2C9WB 2OEDA 4WURA 1QOFA 1L6UA 4ITKA 5CHVC 1E9MA 1RM6C 3ZUNA 2WXNA 2I38A 2LZ6A 4A9AA 3PHWB 4KZCA 2V4LA 1XF5L 3L13A 1JROA 1TZOA 4C4VB 2J7QB 4JGHB 4J6IA 1E8XA 1TS2A 2KX3A 2D3BA 4MACA 3V62A 4YXDB 2QDFA 2MJEA 3RYTA 1F2RI 5J18A 4KGSA 1WZ0A 4HPPA 2MH7A 1NVID 1P98A 1I4GA 4R3DA 3NVYA 2KVRA 2CU3A 4TV3A 1MVKA 2ASQA 2NPTA 1FPYA 2K25A 2AX5A 4E71A 3RUIB 3ZIMA 3EFCA 4BZAA 3IFWB 1XLPA 2JZPA 4HXDA 2CJOA 2BBCA 2BPSA 3AE5B 2AQ2B 2H88B 1D4BA 1VZ7A 2PKOA 2DAJA 2CU1A 2KTRA 1IP9A 4IWPA 2A4ZA 1SJHD 1WM3A 1WH3A 4MM3A 1VZ6A 2Y5PA 1WSPA 2AL3A 2MBHA 4G50A 4NPNA 1HQRD 5H92C 3ZJTA 2ONQA 3NZ3A 2KJRA 3D32A 3NS8A 3T9LA 3NHEB 2KZRA 3VXWA 3BY4B 2E6XA 4MDKE 1JWSD 2HTME 3ZDTA 2NVUI 2KFKA 1WGYA 4X57B 3TEXA 2KYWA 1T0RC 1HZ5A 3KYCD 4FBJB 2R61A 2KXJA 3TSSA 2JRHA 2WX0A 3CMMB 4FJYA 4ARIA 3KWVA 1C4AA 4LJPB 2KWCA 3Q3NC 2KJ6A 4RF1A 3TEZA 1EU4A 2MCNB 1SE4A 3VH3B 1ROEA 2RPVA 1UGMA 1L0YB 4LNIA 3UIOB 3CF6E 3QJZA 3ZTCA 3N32A 4M0WB 1OQQA 1WRIA 4KIKB 3RZFA 1TZ1A 3MC9A 3GE8C 2VZKD 4PK1A 1YMHE 3EC8A 3VR9B 2FIFA 3VDZA 1WYWB 2N9KA 3W9CB 1KM7A 2NBVB 2FBWB 4NJCA 5E6OA 1FNVA 4AUQC 3MHZA 1IYFA 2KQ7A 3ZJUA 2KDFB 5EE0A 2Z59B 4TKNA 4ZHOA 4WWMA 1VLBA 3CWIA 4DWFA 4K81A 2NBWB 4KIKA 4C7YA 2PVOD 2WXPA 3U7ZA 5J2RA 3DCGA 4HPMB 2KACA 1Q1OA 2ZVNA 2LWPA 2KQSA 3P4PB 4XDCA 4AP4C 3Q3FA 3WA0A 4ZRIA 2JYEA 3GZNB 2MX2A 1X1MA 2O6VB 4ZRJA 3A4RA 3UGBB 3PV1A 2MJ3A 4EZLA 1HZ6A 3KUCB 3N1YC 3ZLZA 3V3XA 2N9XA 3AV8A 2DLBA 1P7EA 4CHKA 1J0GA 5D6JB 2B76B 3JVZX 4YSYB 2KDEB 3W1SA 1XT9B 3V61A 1IGCA 2MLBA 4K7WA 2Z0DB 4Q2JA 1ET9A 1UWMA 4W9DA 2HTHA 3NG0A 1WGDA 3TUOA 2H89B 1B1ZA 3APCA 2XN9C 4A3OA 1YN3A 1YQBA 2CS4A 1NENB 2D2QA 2J0KA 2LHDA 2K0PA 3K9OB 4BBNF 3GP7A 2LEKA 3KUZA 2IPKD 2PVGC 1BUIC 3W1YA 2L8JA 2DYOA 2NPTB 4G3XB 4A90A 5L95C 1Q5WB 1C77A 5AZHA 4J3OD 4AJWA 3DBHB 2LVQA 2FCNA 2WXOA 1TT5B 5MPOA 1I4RA 1OFFA 1P9DU 1K51A 2WYQA 1WJ6A 2W82A 3KYDD 1ZDXA 3HM3A 2IGHA 3PPAA 4GDLB 1IPGA 2M17A 2INNE 3ZXVA 4HDQA 1ISNA 2LXCA 2IBIB 1WXVA 2OHFA 2JSVX 3B2FA 3NUHB 5AUIA 2ZNVC 2ZW0A 2GOWA 2BVCA 4ZHPA 4GMVA 2WXGA 1ESFA 2JXTA 2G45B 1UZXB 4IM2A 4LNOA 5G5GA 2AL6A 5IKCM 1D5ZC 4B95A 4BBNC 1D3ZA 2N1VA 4XDDA 2K8BA 2KNBA 3PZDA 3BK2A 2QHOA 5LLIA 1N5WA 2IJ0A 1YOVB 2L00B 2MQJA 3ALBA 3QX1A 3AE7B 1F1HA 4KX6B 3NZUA 3WAMA 3AH7A 2EMSA 4M8NA 2QILA 2JPHA 1MI0A 3DVGX 2WDVB 3C19A 3AE4B 4LJOB 1F0ZA 3DQVA 2LRUA 3MJ5A 2INDC 3PRMB 5IA7A 2DWQA 3HUIA 4B0MA 5E6JA 4KKJA 2KFKB 2Z0EB 1Q10A 3HM6X 2LHEA 3P1MA 1D6EC 3AE3B 1RLFA 3N1ZC 1ZKHA 4IW0A 1QT9A 4XWWA 4PYUA 3M95A 5CTRC 4AOFA 3S2AA 4I6LB 3TEWA 3A33B 4RNAA 3RNEC 1XXGA 4IC7B 4ZDVA 2M56B 3SHQA 4B0EA 4C7ZA 3ZRCA 3RZWC 3VUYA 2Y5BB 3AE2B 2IO0B 2MBOA 4HKZE 4NJ6A 4W9KA 3C0RB 1WMHB 1F52A 2GBKA 2NTTA 4ANWA 4WJQA 3R7RA 5HG2A 3A1QA 2LGSA 5C2TB 4DQOC 4NQKE 1L0VB 4AS1A 1GB4A 3AEBB 2EKIA 1K50A 5D2MB 4MELA 4L23A 1TYGB 3NJTA 2QEJC 3BVMA 2NBUA 3ZRFA 2M19A 1N63A 2AQ3B 4WAFA 3VRBB 2L52A 3NVZA 2KDIA 3PRPB 3FC4A 2WXHA 1AW7A 4KSLC 2BS3B 3L10B 4BOSC 3RULA 1E0ZA 2MJDA 4OZAA 3L0WB 3PLUA 4XYCA 4JE3B 4CYEA 2WXFA 3U7DA 1FXTB 1TKGA 3CSTA 3OJ4B 1TBEA 1STEA 3IG3A 4KKIA 1F2RC 1T0QC 2J52A 1MHHE 3ZQ4A 3Q8EA 1ZUD2 2NR2A 1WX8A 4NAMA 3V6EB 1TS4A 3M62B 3Q3JA 1YJIA 4RH6A 2J42A 3A9KA 4BAXA 4ZRPA 3PSEB 3WANA 5D3DA 5C1ZA 3SFDB 3MTNB 2TSSA 2JQRB 2FNJB 4W9HA 1SSNA 3DVNU 2G4SA 1Z5SB 2WDTB 2SEBD 5G55A 1T0YA 4K1RB 2IY1B 1V6EA 2E3TA 1P7FA 1VZ8A 1QOAA 1E7VA 2K1FA 1N60A 1FXAA 4NAWB 3RCZA 3L08A 2WS3B 1GC6A 2KTRB 2WHIA 1WGRA 1KF6B 4HEA1 3U2SC 1SIFA 5E6NA 4JL9A 3PZ7A 1RYJA 1AARA 5FK9C 1TS3A 3KWLA 1GUAB 1XCTL 1R4MB 3UIPB 4F7ZA 1AYFA 2INPE 4DXGA 1RFKA 3L16A 2L3ZA 3WALA 4GXBA 1WIAA 2WXIA 1MFWA 4BVUC 5LNK1 2AQ1B 1UD7A 3GB1A 1I7HA 4MGIE 1EF1A 2K6DB 4GDKB 4L2YA 4FULA 3OAWA 4M01A 4US9A 4W9FA 2QCZA 2D5GA 4UDUC 3GE3C 4C4VA 1J8CA 3LB8C 1JCKB 4TQ1A 4RCOA 3AE6B 3B0AA 2K5PA 4LK0M 2ICIA 1T5XD 1CMXB 2MSED 4IKGA 2PIAA 3NY5A 2V1YA 1R4NB 1S3SG 1QQRA 2V4IB 3HVDA 4ZYNA 3BZDB 2ZPYA 1HXYD 3ZNZB 4DK5A 2KQ4X 1OQRA 2YEPB 1HEZE 2KK8A 3P4RB 2MP2A 2RGFA 5D7GA 3U8ZA 5HKHA 5J17A 1YJ1A 2LXAA 2PEAA 3RN9C 2KWDA 3AEEB 3AN1A 1YQ3B 3O13A 1ZOYB 3Q69A 3HK0A 1WXSA 5JHAA 4WJOA 2KO3A 3KW5B 1C78A 1B9RA 3Q6BA 2BTEA 3HVZA 2HDEA 3P2BA 1PQSA 4DHZE 3VAWA 3VQIA 3DVNV 1JWMD 3A9JB 3ETRA 1N61A 2LASA 1HTOA 2XNAC 3R2IA 3L17A 2KN4A 2YEPF 1QF6A 2GRIA 1WXAA 5IAAC 4GU2A 4JWUC 1FRRA 1Y56A 1V97A 1CZPA 1YNTE 2KKCA 1QZEA 2JYTA 4WQMA 4DDID 3JSVA 3H9DA 1TGZB 3DHIC 4ANUA 4IG7B 1WR6E 2AEHA 2QMTA 3BIID 1HA5A 1OTRB 1ZDVA 3AI5A 4N59A 3ZKJC 4HK2A 1XO3A 3E56A 3AEFB 3NRZA 4I6NB 2EMTA 5KHOA 3UI3A 1G6JA 2ZVOA 1KFYB 2PPHA 3Q3MC 1ZPSA 1OEYJ 4MJSB 4IOIE 1SE2A 1K53A 3APDA 4HKQA 2GMIC 2KMCA 5JH5C 1UBIA 4AJYB 1PGXA 4LCDE 4A8XC 3IAM1 1ZP0B 1A70A 2PW9A 1E7UA 2KD0A 2IY0B 3Q8BA 3ZW3A 4DDGD 4MJSA 4O1NA 2ON8A 2WXMA 1UGJA 1XD3B 3R8BA 4ICUA 3R3MA 4P16A 4LNFA 2VH2A 4NQLB 4FJVB 4OVVA 2IO2B 2JWUA 5BO4B 3W5UB 2MHJA 2C7HA 4RMAA 3TMPB 2M0XA 2HD5B 2KN5A 3FILA 2QC8A 3DOWA 3N3KB 1I4XA 3VUWA 4TQ0A 2B3AA 3DBLI 4N6EB 1H8CA 2C5LC 3UQBA 1VCBA 3SEBA 4LLGM 2DX5B 2GLSA 2L0FA 2KMMA 3TEYA 1L4ZB 3TCAA 2I1KA 2MRPA 5AZGA 2EKEC 1N5XA 4EOYA 2PMVA 2N7DA 3EECA 3WCQA 2KLCA 2KMAA 1V49A 4USAA 3QAQA 2N9LA 2VZKB 5E6PA 5AZFA 1FD6A 3U30A 2LUMA 4ZRKA 3KLSX 1UWXA 4DHZB 4HJKA 3W2DA 2OJRA 5LXIB 2Z8LA 5DPSA 4EUTA 2LI5A 3HHMA 1JWBD 2R2OA 1LFDA 4G0NB 2D3CA 3T8MA 3LJ3A 3AB5A 3U52E 4HJGE 1YQ4B 3Q8CA 1ZXIA 4ZYSA 3BVZA 1SGHA 4II3B 4KV2A 3SR6A 2V9HA 4WAAA 3B2GA 5EE9A 1F77A 2BB5A 3RNBC 2CHWA 3ZTDA 1EWYC 1PDXA 3ZDMC 4AQ7A 1PGBA 3TBLD 4JWSC 1WE6A 4OHJA 3ZGZA 5IO9A 4DHJB 3H7PA 1U4AA 1FNWA 1CQVA 2BKFA 4HDOA 2WP9B 2CJNA 4IWOA 1PYWD 4WJNA 2ZCCA 1GNUA 1YIWA 2R2QA 5CHFA 2N7JA 1T3QA 3FAHA 2BS4B 1BXTA 5G5HA 2W55A 3H1UA 1SB3C
chains in the Genus database with same CATH topology
1WJNA 1WJ4A 2BYVE 4KSLC 2C9WB 3L10B 1OQYA 4W9EA 2LGDA 4BOSC 3RULA 1EO6A 2KOXA 3KH0A 5GMVA 1E5WA 3L54A 5CHVC 2PJHA 2KWUB 2ZCBA 3L0WB 3ZUNA 4BKSA 2LZ6A 3PLUA 4FHKA 3PHWB 1R4NI 2DZJA 4GB9A 4CYEA 3JYUA 3R66C 4KDIC 4KZCA 2ZJDA 3LDZE 2V4LA 3DVGY 4RM9A 1FXTB 1P0RA 3CSTA 3U7DA 2GBJA 1YX5B 3L13A 1WY8A 1RFAA 1TBEA 3OJ4B 2J7QB 2DZMA 4RM8A 2ZEQA 1WFYA 2M4NA 3IG3A 4JGHB 2JZ3B 2C7MB 4JIOU 4J6IA 4M8MA 4MGKE 1E8XA 3APFA 2BYEA 2KX3A 3VTWA 3V62A 2UYZB 3ONSA 3KUDB 3DBSA 3RYTA 5J18A 3AU4A 1GG3A 1VD2A 1WZ0A 2AWTA 4FLHA 5KHQA 2UWQA 1P98A 2NR2A 1WX8A 2BWES 3V6EB 3NZSA 4II2B 2C60A 4MSQB 4W9CA 4BKTA 2KVRA 4TV3A 5G2NA 2ASQA 2LGYA 3M62B 2NPTA 3Q3JA 2K25A 4E71A 3A9KA 3RUIB 2N4FA 3ZIMA 4KDLB 3PSEB 3WANA 4BKSD 5C1ZA 3IFWB 4LDTB 2K8CA 3MTNB 4EFOA 2NCNA 2FNJB 3GZNI 4HXDA 1WF9A 4W9HA 3DVNU 2REXA 1A5RA 2KC1A 2BPSA 3I3TB 2G4SA 3MJWA 4MGYE 1Z5SB 2WDTB 4FADA 1HE8A 4LDTD 2DAJA 2CU1A 5G55A 2KTRA 1IP9A 4IWPA 4F8CB 1T0YA 4BOZB 2YVCA 4K1RB 2A4ZA 2IY1B 1V6EA 3SU8X 1WI0A 1WM3A 2IO3B 1WH3A 4MM3A 3VTUA 4E3CA 2DYMA 1GC7A 4WJPA 1E7VA 3PREA 3VTVA 2AL3A 2JY6A 2MBHA 2K1FA 2DHZA 3IVFA 4G50A 4BKGA 4XC2A 4NAWB 4NPNA 2VRRB 3RCZA 4DBGA 3L08A 2KTRB 1GC6A 1WGRA 2KJRA 1MG8A 3OLMD 3ZNHB 1SIFA 3D32A 5E6NA 1R4MI 4JL9A 2KJHB 3NS8A 3T9LA 3H7PB 1AARA 3GOEA 3NHEB 2KZRA 3VXWA 3TJPA 3BY4B 3VVWB 1GUAB 2KHWB 3UIPB 4F7ZA 4MDKE 1KLVA 1WX9A 3ENEA 3L16A 3PVLA 2L3ZA 3ZDTA 3WALA 4GXBA 2NVUI 1WIAA 1V5OA 3PLVA 2CHXA 2KFKA 4BVUC 1WGYA 3B08A 4NJ7A 4X57B 1UD7A 3M3JA 2A5UA 3KYCD 4FBJB 4MGIE 1EF1A 1NI2A 2KXJA 2G3QB 4GGQA 5TR5A 3QA8A 2K6DB 4FJZA 4GDKB 1LQBA 4FULA 3OAWA 3QARA 2C7NB 2JRHA 5DPWA 2WX0A 3CMMB 3DPDA 4FJYA 4W9FA 4LJPB 3SD5A 4HVBA 4FN2A 2DYBA 2KWCA 2DZKA 2KJ6A 5DPRA 2BYFA 2MCNB 1J8CA 3VH3B 1EF5A 4TQ1A 1K8RB 4A3PA 1V2YA 1UGMA 3B0AA 3UIOB 3CF6E 3QJZA 3ZTCA 2JT4B 1CMXB 2MSED 2MBEA 2I1JA 3N32A 3NY5A 4G11A 4AWJA 2V1YA 3VHTC 1S3SG 4M0WB 4BFRA 4ZYNA 2ZPYA 1H4RA 3ZNZB 4KIKB 3RZFA 1I35A 1TZ1A 4DK5A 3VH4B 1WGHA 5C23A 1KOTA 2MP2B 3AULA 2KK8A 1WM2A 2MP2A 2RGFA 4W9GA 2N1WA 5D7GA 2DZIA 3U8ZA 3EC8A 4IUMB 5HKHA 5J17A 2FIFA 1YJ1A 2LXAA 2KC2A 2PEAA 3QK0A 4KSKC 5CX3A 1LXDA 1WYWB 3VDZA 5AEKB 1KM7A 2NBVB 3KVFB 5E6OA 3WAOA 3HK0A 1WXSA 4AUQC 5JHAA 2MBBB 4WJOA 2LRWA 2KO3A 1L2NA 1C3TA 1EUVB 3KW5B 3PS6A 1IYFA 2JF5A 1RRBA 2GBNA 2MWSB 2KQ7A 4FHJA 2KDFB 2Z59B 4TKNA 3WAPA 1GJZA 1XQQA 3EHVA 3P2BA 3MHSD 3RT3B 1WGGA 1PQSA 4DHZE 1V9JA 2PE9A 3UINB 3VAWA 4ANVA 4E74A 3VQIA 3DVNV 2IZVB 3A9JB 3N30A 4DWFA 4K81A 2IO1B 2NBWB 4KIKA 2JXXA 3ZNID 2AYOB 5J2RA 2GBMA 2LASA 3W1SC 3DCGA 4HPMB 4PYZA 3L17A 1Q1OA 4DXAB 2ZVNA 2LWPA 3JSVB 4WWNA 2BGFA 2KQSA 4K7SA 4AP4C 3Q3FA 1ZGUB 4W9IA 3WA0A 3X0WA 4ZRIA 2ZPNA 2MX2A 1X1MA 1WXAA 2JUOA 2O6VB 2FCSA 4ZRJA 3A4RA 5IAAC 4GU2A 3UGBB 3PV1A 1Z2MA 2L76A 1RAXA 4I6PA 2KTFA 4EZLA 2KKCA 1QZEA 2LVOA 3KUCB 3M63B 2LD9A 3ZLZA 3NOBA 2N9XA 4ASWC 2CHZA 4DDID 3JSVA 2KDBA 4MGZE 1E8ZA 3H9DA 4CHKA 3K9PB 1TGZB 2J0MA 2D3GA 1J0GA 5D6JB 1WRDB 2O2VB 3DBRI 4ANUA 4IG7B 1WR6E 2AEHA 3JVZX 2K39A 2KDEB 3W1SA 2LGXA 1XT9B 3BINA 1OTRB 3X23A 3AI5A 4HWIB 3TL5A 2MLBA 4K7WA 3V61A 3ZKJC 1M94A 2Z0DB 4HK2A 3QCAA 1KJTA 1P1AA 2BF8B 2OOBB 4W9DA 3UQAA 2LJ5A 2HTHA 1WGDA 3ZVVA 1E8WA 2RD0A 4I6NB 2EMTA 4GN1A 2O2VA 4GOCA 3APCA 5KHOA 5DPTA 4A3OA 1G6JA 2ZVOA 3VFKA 4EEWA 1WR1A 1YQBA 2PPHA 2XBBC 4HCPB 3SDLC 3O65B 2CS4A 2MA9B 3QWZB 5CHWA 2D2QA 2JRIB 1OEYJ 4F1SA 2J0KA 1WJUA 4MJSB 4FA6A 3K9OB 4BBNF 4NNJB 3KUZA 3W1YA 3APDA 2L8JA 1I42A 2DYOA 2GMIC 2KMCA 4KVGB 2NPTB 2G4DB 4G3XB 1UBIA 4AJYB 4URKA 5JH5C 5L95C 4LCDE 1Q5WB 3A9KB 3CSFA 3ZO5B 1J19A 5AZHA 4MSMB 4AJWA 4JLCA 2LVQA 2FCNA 1WE7A 1OGWA 2M8SA 1P9DU 5D94A 3DDCB 2WYQA 1WJ6A 1E7UA 2KD0A 3KYDD 4ICVA 2IY0B 4CO7A 4WWPA 2XK5A 4IWQA 3PRZA 2V3SA 3HIZA 2KWVB 3HM3A 3ZW3A 4OVUA 4DDGD 3PPAA 4GDLB 1IPGA 2M17A 4GDLA 4MJSA 4XZ4A 2CR5A 4HDQA 3TIXA 1ISNA 4ANXA 2LXCA 2IBIB 3QC8B 1XD3B 4HPLB 4DHJD 1WXVA 4ICUA 2FAZA 1E90A 5FR6A 3R3MA 1C1YB 4NQLB 2ZNVC 4FJVB 4OVVA 2IO2B 2GOWA 4IM0A 2D07B 5BO4B 2ZZPB 4GMVA 4NY0A 2L7RA 2C7HA 3IBEA 2O6VD 2G45B 1UZXB 4RMAA 3JW0X 3TMPB 4HLEA 4IM2A 4EZJA 2M0XA 2HD5B 2KN5A 2AL6A 1V81A 2FCMA 1E8YA 1UELA 4PS7A 4B95A 2JVCA 2W9NA 2N1VA 4BBNC 2N7EA 3EFUA 3A9JA 3IHPC 4PS3A 1D3ZA 2K8BA 2KNBA 2CKHB 3DOWA 2DENB 3N3KB 3PZDA 4B6WA 1V5TA 2QHOA 5LLIA 3B1LX 3VUWA 2M1MA 3A1QB 3ML9A 4IM3A 2L00B 2MQJA 3ALBA 5LXHA 2N9PC 4TQ0A 2B3AA 4EZKA 2RR9A 3DBLI 3QX1A 1H8CA 2KX0A 3NZUA 3WAMA 2C5LC 1UBQA 2EMSA 2IYDB 1VCBA 3PHXB 2KFJA 4M8NA 3UQBA 2JPHA 3DVGX 2DX5B 4LJOB 1WXMA 3DQVA 1UH6A 3OJ3A 2L0FA 2LRUA 3DBHI 3PRMB 5IA7A 2LUEA 2N9EB 2FIDA 3TCAA 2I1KA 2MRPA 1NDDA 1F9JA 2EKEC 5AZGA 4B9KA 3WIMA 4EOYA 2RPQA 2J0JA 2MBQA 2LVPA 1Y8RC 2N7DA 3EECA 2KLCA 3AU5A 2KMAA 5JHBA 2YLMA 5JZEB 1V49A 1OEYA 4GDKA 2RSUA 3QAQA 1WX7A 2D10A 5E6PA 5AZFA 4MH0E 4K7UA 1BT0A 3U30A 2DAFA 2K8HA 5DCNA 1V86A 2KFKB 4ZRKA 3ML8A 2Z0EB 4JQWC 1S1QB 1JRUA 3A4SC 4HJKA 3HM6X 3QIJA 4DHZB 2ZNVB 2OJRA 4GIVA 2WX1A 5LXIB 3V6CB 1RLFA 5DPSA 4EUTA 1ZKHA 2LI5A 4IW0A 4WWOA 3HHMA 1P3QU 1YD8U 1V80A 2L05A 2R2OA 1LFDA 4PYUA 4G0NB 2MW5A 1WZ3A 4EKUA 1NBFC 3M95A 2K6QA 4GSWA 3T8MA 3LJ3A 5CTRC 3ZNGC 4AOFA 2HE7A 4W9LA 3S2AA 4I6LB 4TUUA 2BKRB 3A33B 3QQ8B 4WQOB 3AXCA 1SGHA 4II3B 4IC7B 2BWFA 1SE9A 2HJ8A 3R7QA 4ZDVA 2FCQA 1LM8B 2JWZA 4W9JA 3SHQA 3PGEA 4NAWA 3H7SA 4MEMA 4KV2A 2KANA 5L83A 2O6VA 1TTNA 3RZWC 3VUYA 2Y5BB 4N9F4 3ZRCA 2IO0B 2MBOA 4NJ6A 4WAAA 3V60A 4W9KA 2PE6B 3C0RB 4XX5A 2FUHB 4P7IA 2KLGA 4PS8A 1WMHB 2NS5A 2GBKA 3PTFC 2CHWA 1L7YA 4HCNB 1WMHA 4WJQA 3VUXA 3R7RA 3ZDMC 3ZTDA 3A1QA 4ANWA 5EDSA 4KZ0A 3TBLD 4NQKE 1WE6A 3PT2B 4DHJB 3RD2A 3H7PA 4A20A 1U4AA 2D11A 2BKFA 5D2MB 4HDOA 4MELA 4IWOA 3H6NA 4WJNA 3ECIA 2NBUA 1YX6B 2L0TA 2ZCCA 3QHTA 3ZRFA 1GNUA 2GBRA 2WWZA 1ZW7A 1YIWA 3UF8A 2R2QA 5CHFA 2KDIA 1Q0WB 3PRPB 3H1UA 4YL8A 2JZZA 2XEWA 2XK5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJN A;  1WJ4 A;  2BYV E;  4KSL C;  2C9W B;  3L10 B;  1OQY A;  4W9E A;  2LGD A;  4BOS C;  3RUL A;  1EO6 A;  2KOX A;  3KH0 A;  5GMV A;  1E5W A;  3L54 A;  5CHV C;  2PJH A;  2KWU B;  2ZCB A;  3L0W B;  3ZUN A;  4BKS A;  2LZ6 A;  3PLU A;  4FHK A;  3PHW B;  1R4N I;  2DZJ A;  4GB9 A;  4CYE A;  3JYU A;  3R66 C;  4KDI C;  4KZC A;  2ZJD A;  3LDZ E;  2V4L A;  3DVG Y;  4RM9 A;  1FXT B;  1P0R A;  3CST A;  3U7D A;  2GBJ A;  1YX5 B;  3L13 A;  1WY8 A;  1RFA A;  1TBE A;  3OJ4 B;  2J7Q B;  2DZM A;  4RM8 A;  2ZEQ A;  1WFY A;  2M4N A;  3IG3 A;  4JGH B;  2JZ3 B;  2C7M B;  4JIO U;  4J6I A;  4M8M A;  4MGK E;  1E8X A;  3APF A;  2BYE A;  2KX3 A;  3VTW A;  3V62 A;  2UYZ B;  3ONS A;  3KUD B;  3DBS A;  3RYT A;  5J18 A;  3AU4 A;  1GG3 A;  1VD2 A;  1WZ0 A;  2AWT A;  4FLH A;  5KHQ A;  2UWQ A;  1P98 A;  2NR2 A;  1WX8 A;  2BWE S;  3V6E B;  3NZS A;  4II2 B;  2C60 A;  4MSQ B;  4W9C A;  4BKT A;  2KVR A;  4TV3 A;  5G2N A;  2ASQ A;  2LGY A;  3M62 B;  2NPT A;  3Q3J A;  2K25 A;  4E71 A;  3A9K A;  3RUI B;  2N4F A;  3ZIM A;  4KDL B;  3PSE B;  3WAN A;  4BKS D;  5C1Z A;  3IFW B;  4LDT B;  2K8C A;  3MTN B;  4EFO A;  2NCN A;  2FNJ B;  3GZN I;  4HXD A;  1WF9 A;  4W9H A;  3DVN U;  2REX A;  1A5R A;  2KC1 A;  2BPS A;  3I3T B;  2G4S A;  3MJW A;  4MGY E;  1Z5S B;  2WDT B;  4FAD A;  1HE8 A;  4LDT D;  2DAJ A;  2CU1 A;  5G55 A;  2KTR A;  1IP9 A;  4IWP A;  4F8C B;  1T0Y A;  4BOZ B;  2YVC A;  4K1R B;  2A4Z A;  2IY1 B;  1V6E A;  3SU8 X;  1WI0 A;  1WM3 A;  2IO3 B;  1WH3 A;  4MM3 A;  3VTU A;  4E3C A;  2DYM A;  1GC7 A;  4WJP A;  1E7V A;  3PRE A;  3VTV A;  2AL3 A;  2JY6 A;  2MBH A;  2K1F A;  2DHZ A;  3IVF A;  4G50 A;  4BKG A;  4XC2 A;  4NAW B;  4NPN A;  2VRR B;  3RCZ A;  4DBG A;  3L08 A;  2KTR B;  1GC6 A;  1WGR A;  2KJR A;  1MG8 A;  3OLM D;  3ZNH B;  1SIF A;  3D32 A;  5E6N A;  1R4M I;  4JL9 A;  2KJH B;  3NS8 A;  3T9L A;  3H7P B;  1AAR A;  3GOE A;  3NHE B;  2KZR A;  3VXW A;  3TJP A;  3BY4 B;  3VVW B;  1GUA B;  2KHW B;  3UIP B;  4F7Z A;  4MDK E;  1KLV A;  1WX9 A;  3ENE A;  3L16 A;  3PVL A;  2L3Z A;  3ZDT A;  3WAL A;  4GXB A;  2NVU I;  1WIA A;  1V5O A;  3PLV A;  2CHX A;  2KFK A;  4BVU C;  1WGY A;  3B08 A;  4NJ7 A;  4X57 B;  1UD7 A;  3M3J A;  2A5U A;  3KYC D;  4FBJ B;  4MGI E;  1EF1 A;  1NI2 A;  2KXJ A;  2G3Q B;  4GGQ A;  5TR5 A;  3QA8 A;  2K6D B;  4FJZ A;  4GDK B;  1LQB A;  4FUL A;  3OAW A;  3QAR A;  2C7N B;  2JRH A;  5DPW A;  2WX0 A;  3CMM B;  3DPD A;  4FJY A;  4W9F A;  4LJP B;  3SD5 A;  4HVB A;  4FN2 A;  2DYB A;  2KWC A;  2DZK A;  2KJ6 A;  5DPR A;  2BYF A;  2MCN B;  1J8C A;  3VH3 B;  1EF5 A;  4TQ1 A;  1K8R B;  4A3P A;  1V2Y A;  1UGM A;  3B0A A;  3UIO B;  3CF6 E;  3QJZ A;  3ZTC A;  2JT4 B;  1CMX B;  2MSE D;  2MBE A;  2I1J A;  3N32 A;  3NY5 A;  4G11 A;  4AWJ A;  2V1Y A;  3VHT C;  1S3S G;  4M0W B;  4BFR A;  4ZYN A;  2ZPY A;  1H4R A;  3ZNZ B;  4KIK B;  3RZF A;  1I35 A;  1TZ1 A;  4DK5 A;  3VH4 B;  1WGH A;  5C23 A;  1KOT A;  2MP2 B;  3AUL A;  2KK8 A;  1WM2 A;  2MP2 A;  2RGF A;  4W9G A;  2N1W A;  5D7G A;  2DZI A;  3U8Z A;  3EC8 A;  4IUM B;  5HKH A;  5J17 A;  2FIF A;  1YJ1 A;  2LXA A;  2KC2 A;  2PEA A;  3QK0 A;  4KSK C;  5CX3 A;  1LXD A;  1WYW B;  3VDZ A;  5AEK B;  1KM7 A;  2NBV B;  3KVF B;  5E6O A;  3WAO A;  3HK0 A;  1WXS A;  4AUQ C;  5JHA A;  2MBB B;  4WJO A;  2LRW A;  2KO3 A;  1L2N A;  1C3T A;  1EUV B;  3KW5 B;  3PS6 A;  1IYF A;  2JF5 A;  1RRB A;  2GBN A;  2MWS B;  2KQ7 A;  4FHJ A;  2KDF B;  2Z59 B;  4TKN A;  3WAP A;  1GJZ A;  1XQQ A;  3EHV A;  3P2B A;  3MHS D;  3RT3 B;  1WGG A;  1PQS A;  4DHZ E;  1V9J A;  2PE9 A;  3UIN B;  3VAW A;  4ANV A;  4E74 A;  3VQI A;  3DVN V;  2IZV B;  3A9J B;  3N30 A;  4DWF A;  4K81 A;  2IO1 B;  2NBW B;  4KIK A;  2JXX A;  3ZNI D;  2AYO B;  5J2R A;  2GBM A;  2LAS A;  3W1S C;  3DCG A;  4HPM B;  4PYZ A;  3L17 A;  1Q1O A;  4DXA B;  2ZVN A;  2LWP A;  3JSV B;  4WWN A;  2BGF A;  2KQS A;  4K7S A;  4AP4 C;  3Q3F A;  1ZGU B;  4W9I A;  3WA0 A;  3X0W A;  4ZRI A;  2ZPN A;  2MX2 A;  1X1M A;  1WXA A;  2JUO A;  2O6V B;  2FCS A;  4ZRJ A;  3A4R A;  5IAA C;  4GU2 A;  3UGB B;  3PV1 A;  1Z2M A;  2L76 A;  1RAX A;  4I6P A;  2KTF A;  4EZL A;  2KKC A;  1QZE A;  2LVO A;  3KUC B;  3M63 B;  2LD9 A;  3ZLZ A;  3NOB A;  2N9X A;  4ASW C;  2CHZ A;  4DDI D;  3JSV A;  2KDB A;  4MGZ E;  1E8Z A;  3H9D A;  4CHK A;  3K9P B;  1TGZ B;  2J0M A;  2D3G A;  1J0G A;  5D6J B;  1WRD B;  2O2V B;  3DBR I;  4ANU A;  4IG7 B;  1WR6 E;  2AEH A;  3JVZ X;  2K39 A;  2KDE B;  3W1S A;  2LGX A;  1XT9 B;  3BIN A;  1OTR B;  3X23 A;  3AI5 A;  4HWI B;  3TL5 A;  2MLB A;  4K7W A;  3V61 A;  3ZKJ C;  1M94 A;  2Z0D B;  4HK2 A;  3QCA A;  1KJT A;  1P1A A;  2BF8 B;  2OOB B;  4W9D A;  3UQA A;  2LJ5 A;  2HTH A;  1WGD A;  3ZVV A;  1E8W A;  2RD0 A;  4I6N B;  2EMT A;  4GN1 A;  2O2V A;  4GOC A;  3APC A;  5KHO A;  5DPT A;  4A3O A;  1G6J A;  2ZVO A;  3VFK A;  4EEW A;  1WR1 A;  1YQB A;  2PPH A;  2XBB C;  4HCP B;  3SDL C;  3O65 B;  2CS4 A;  2MA9 B;  3QWZ B;  5CHW A;  2D2Q A;  2JRI B;  1OEY J;  4F1S A;  2J0K A;  1WJU A;  4MJS B;  4FA6 A;  3K9O B;  4BBN F;  4NNJ B;  3KUZ A;  3W1Y A;  3APD A;  2L8J A;  1I42 A;  2DYO A;  2GMI C;  2KMC A;  4KVG B;  2NPT B;  2G4D B;  4G3X B;  1UBI A;  4AJY B;  4URK A;  5JH5 C;  5L95 C;  4LCD E;  1Q5W B;  3A9K B;  3CSF A;  3ZO5 B;  1J19 A;  5AZH A;  4MSM B;  4AJW A;  4JLC A;  2LVQ A;  2FCN A;  1WE7 A;  1OGW A;  2M8S A;  1P9D U;  5D94 A;  3DDC B;  2WYQ A;  1WJ6 A;  1E7U A;  2KD0 A;  3KYD D;  4ICV A;  2IY0 B;  4CO7 A;  4WWP A;  2XK5 A;  4IWQ A;  3PRZ A;  2V3S A;  3HIZ A;  2KWV B;  3HM3 A;  3ZW3 A;  4OVU A;  4DDG D;  3PPA A;  4GDL B;  1IPG A;  2M17 A;  4GDL A;  4MJS A;  4XZ4 A;  2CR5 A;  4HDQ A;  3TIX A;  1ISN A;  4ANX A;  2LXC A;  2IBI B;  3QC8 B;  1XD3 B;  4HPL B;  4DHJ D;  1WXV A;  4ICU A;  2FAZ A;  1E90 A;  5FR6 A;  3R3M A;  1C1Y B;  4NQL B;  2ZNV C;  4FJV B;  4OVV A;  2IO2 B;  2GOW A;  4IM0 A;  2D07 B;  5BO4 B;  2ZZP B;  4GMV A;  4NY0 A;  2L7R A;  2C7H A;  3IBE A;  2O6V D;  2G45 B;  1UZX B;  4RMA A;  3JW0 X;  3TMP B;  4HLE A;  4IM2 A;  4EZJ A;  2M0X A;  2HD5 B;  2KN5 A;  2AL6 A;  1V81 A;  2FCM A;  1E8Y A;  1UEL A;  4PS7 A;  4B95 A;  2JVC A;  2W9N A;  2N1V A;  4BBN C;  2N7E A;  3EFU A;  3A9J A;  3IHP C;  4PS3 A;  1D3Z A;  2K8B A;  2KNB A;  2CKH B;  3DOW A;  2DEN B;  3N3K B;  3PZD A;  4B6W A;  1V5T A;  2QHO A;  5LLI A;  3B1L X;  3VUW A;  2M1M A;  3A1Q B;  3ML9 A;  4IM3 A;  2L00 B;  2MQJ A;  3ALB A;  5LXH A;  2N9P C;  4TQ0 A;  2B3A A;  4EZK A;  2RR9 A;  3DBL I;  3QX1 A;  1H8C A;  2KX0 A;  3NZU A;  3WAM A;  2C5L C;  1UBQ A;  2EMS A;  2IYD B;  1VCB A;  3PHX B;  2KFJ A;  4M8N A;  3UQB A;  2JPH A;  3DVG X;  2DX5 B;  4LJO B;  1WXM A;  3DQV A;  1UH6 A;  3OJ3 A;  2L0F A;  2LRU A;  3DBH I;  3PRM B;  5IA7 A;  2LUE A;  2N9E B;  2FID A;  3TCA A;  2I1K A;  2MRP A;  1NDD A;  1F9J A;  2EKE C;  5AZG A;  4B9K A;  3WIM A;  4EOY A;  2RPQ A;  2J0J A;  2MBQ A;  2LVP A;  1Y8R C;  2N7D A;  3EEC A;  2KLC A;  3AU5 A;  2KMA A;  5JHB A;  2YLM A;  5JZE B;  1V49 A;  1OEY A;  4GDK A;  2RSU A;  3QAQ A;  1WX7 A;  2D10 A;  5E6P A;  5AZF A;  4MH0 E;  4K7U A;  1BT0 A;  3U30 A;  2DAF A;  2K8H A;  5DCN A;  1V86 A;  2KFK B;  4ZRK A;  3ML8 A;  2Z0E B;  4JQW C;  1S1Q B;  1JRU A;  3A4S C;  4HJK A;  3HM6 X;  3QIJ A;  4DHZ B;  2ZNV B;  2OJR A;  4GIV A;  2WX1 A;  5LXI B;  3V6C B;  1RLF A;  5DPS A;  4EUT A;  1ZKH A;  2LI5 A;  4IW0 A;  4WWO A;  3HHM A;  1P3Q U;  1YD8 U;  1V80 A;  2L05 A;  2R2O A;  1LFD A;  4PYU A;  4G0N B;  2MW5 A;  1WZ3 A;  4EKU A;  1NBF C;  3M95 A;  2K6Q A;  4GSW A;  3T8M A;  3LJ3 A;  5CTR C;  3ZNG C;  4AOF A;  2HE7 A;  4W9L A;  3S2A A;  4I6L B;  4TUU A;  2BKR B;  3A33 B;  3QQ8 B;  4WQO B;  3AXC A;  1SGH A;  4II3 B;  4IC7 B;  2BWF A;  1SE9 A;  2HJ8 A;  3R7Q A;  4ZDV A;  2FCQ A;  1LM8 B;  2JWZ A;  4W9J A;  3SHQ A;  3PGE A;  4NAW A;  3H7S A;  4MEM A;  4KV2 A;  2KAN A;  5L83 A;  2O6V A;  1TTN A;  3RZW C;  3VUY A;  2Y5B B;  4N9F 4;  3ZRC A;  2IO0 B;  2MBO A;  4NJ6 A;  4WAA A;  3V60 A;  4W9K A;  2PE6 B;  3C0R B;  4XX5 A;  2FUH B;  4P7I A;  2KLG A;  4PS8 A;  1WMH B;  2NS5 A;  2GBK A;  3PTF C;  2CHW A;  1L7Y A;  4HCN B;  1WMH A;  4WJQ A;  3VUX A;  3R7R A;  3ZDM C;  3ZTD A;  3A1Q A;  4ANW A;  5EDS A;  4KZ0 A;  3TBL D;  4NQK E;  1WE6 A;  3PT2 B;  4DHJ B;  3RD2 A;  3H7P A;  4A20 A;  1U4A A;  2D11 A;  2BKF A;  5D2M B;  4HDO A;  4MEL A;  4IWO A;  3H6N A;  4WJN A;  3ECI A;  2NBU A;  1YX6 B;  2L0T A;  2ZCC A;  3QHT A;  3ZRF A;  1GNU A;  2GBR A;  2WWZ A;  1ZW7 A;  1YIW A;  3UF8 A;  2R2Q A;  5CHF A;  2KDI A;  1Q0W B;  3PRP B;  3H1U A;  4YL8 A;  2JZZ A;  2XEW A;  2XK5 B; 
#chains in the Genus database with same CATH topology
 1OQY A;  4W9E A;  2LGD A;  1EO6 A;  2KOX A;  3L54 A;  2PJH A;  2KWU B;  3V05 A;  4BKS A;  5TSS A;  4FHK A;  1PGA A;  4GB9 A;  4KDI C;  1TJE A;  2ZJD A;  3LDZ E;  4A55 A;  1V1O A;  1JWA D;  1XLO A;  2ZEQ A;  2M4N A;  4YTN B;  2C7M B;  4MGK E;  3AE9 B;  3VTW A;  1EU3 A;  1KLG D;  3ONS A;  3T3O A;  2IGG A;  2W54 A;  1VD2 A;  2UWQ A;  2BWE S;  1WXQ A;  3NZS A;  4II2 B;  2C60 A;  4W9C A;  2VH1 A;  4BKT A;  5G2N A;  3IT6 B;  4HRS A;  3BVG A;  2DBY A;  4BKS D;  4EFO A;  2NCN A;  1WF9 A;  2V3N A;  2REX A;  2KC1 A;  3SFE B;  3I3T B;  2RDB C;  3MJW A;  4FAD A;  4M0W A;  4LDT D;  2RDH A;  4BOZ B;  2YVC A;  4YTM B;  2BB6 A;  5BMG A;  1FXI A;  4E3C A;  3VTU A;  2DYM A;  4WJP A;  3PRE A;  4XC2 A;  2VRR B;  4KGT A;  4DBG A;  2HJ1 A;  1JRP A;  4LTU A;  4US8 A;  1MG8 A;  3OLM D;  3ZNH B;  1R4M I;  2BQQ A;  4GLS C;  4K3B A;  4IDI A;  3H7P B;  4JX1 C;  1NYR A;  4OVZ A;  2LGI A;  1D5X C;  1KLV A;  2JX5 A;  3PVL A;  3DBL B;  3NS1 A;  2CHX A;  1I4Q A;  4OZB A;  2GB1 A;  1UNS A;  3M3J A;  2A5U A;  2WLB A;  3DHH C;  1KH0 A;  1LQB A;  3DPD A;  3SD5 A;  4HVB A;  4FN2 A;  5C3J B;  2DYB A;  2DZK A;  3P63 A;  5DPR A;  3RNG C;  2BYF A;  1EF5 A;  1VR9 A;  1WGK A;  3OWE B;  1JML A;  1DYQ A;  2MBE A;  4AWJ A;  1CK1 A;  3VHT C;  4BFR A;  3VR8 B;  2WQY B;  1FMA D;  3VH4 B;  1WGH A;  3J9C A;  5C23 A;  2V3P A;  1T6B X;  1KOT A;  2INC C;  2MP2 B;  1WM2 A;  5BYS A;  3T3N A;  3QK0 A;  4KSK C;  3ZYY X;  5AEK B;  2Y5C A;  4TSS A;  4L1B A;  1RWS A;  2MBB B;  1L2N A;  2WU2 B;  5JXV A;  4C56 C;  2JF5 A;  1RRB A;  2GBN A;  3MC8 A;  5I4D A;  3AE1 B;  1FIQ A;  1N6Z A;  3EHV A;  5EE1 A;  3MHS D;  3RT3 B;  2PE9 A;  4E74 A;  3N30 A;  2IZV B;  2IO1 B;  3DWG C;  2JXX A;  3ZNI D;  2GBM A;  3W1S C;  2Q5W D;  2DNF A;  1QLB B;  3JSV B;  3RMK C;  2GI9 A;  5IN7 A;  2BGF A;  4W9I A;  3X0W A;  2ZPN A;  2JUO A;  2FCS A;  3R2T A;  3VRA B;  1RAX A;  4I6P A;  1C9F A;  5HI1 A;  2LVO A;  2PLP A;  2LD9 A;  1DOI A;  4ASW C;  3ZJV A;  2KDB A;  4MGZ E;  2V0G A;  4JPS A;  2J0M A;  1WRD B;  2O2V B;  1QIL A;  1TY2 A;  4RGN A;  3QCA A;  3UQA A;  3RNA C;  2LJ5 A;  2K22 A;  4GN1 A;  2O2V A;  1XLQ A;  4GOC A;  5DPT A;  3VFK A;  1IBX B;  2XBB C;  3AEG B;  4NZL B;  5CHW A;  4FA6 A;  1YN5 A;  1DOX A;  2NMQ A;  4NNJ B;  2BW2 A;  1WYG A;  3EGR A;  1BML C;  3IXS A;  1I42 A;  4KVG B;  3A9K B;  3CSF A;  3ZO5 B;  4JLC A;  3Q8F A;  1WE7 A;  5BYR A;  2M8S A;  5D94 A;  4D2K A;  4CO7 A;  3PZ8 A;  1SE3 A;  3KQ4 A;  2XK5 A;  4H2A A;  3PRZ A;  5H8Y E;  2V3S A;  3HIZ A;  4XZ4 A;  3FIL B;  4QAY A;  3QC8 B;  2WNM A;  1I4H A;  2FAZ A;  1J7B A;  1E90 A;  2RMM A;  1E6E B;  1QOG A;  3LYY A;  2ZZP B;  3IBE A;  2O6V D;  1FNU A;  4EZJ A;  4YSZ B;  1V81 A;  3AMZ A;  1E8Y A;  4PS7 A;  4ZOH C;  2N7E A;  3EFU A;  3A9J A;  4M02 A;  3Q3O C;  4LNN A;  2DEN B;  1KRH A;  4B6W A;  1V5T A;  3B1L X;  3A1Q B;  3ML9 A;  3I57 A;  2KX0 A;  1TY0 A;  2IYD B;  1V8C A;  3P4S B;  4P1C C;  1UH6 A;  2WXK A;  3DBH I;  2X8X X;  2FID A;  2LMC A;  2IGD A;  4B9K A;  1NDD A;  3WIM A;  2MBQ A;  2LVP A;  1DGJ A;  1Y8R C;  2ZW1 A;  5JHB A;  2YLM A;  1OEY A;  2QSD A;  4GDK A;  4YT0 B;  2RSU A;  3W5V B;  3Q2A C;  1BT0 A;  2RDG A;  2DAF A;  4MH8 A;  1A5R A;  1NEK B;  2ZNV B;  3RNF C;  4A6Q A;  4PT5 A;  4WWO A;  3OG5 A;  1I4P A;  3DBR B;  1V80 A;  2L05 A;  2W3R A;  2OJW A;  1GB1 A;  4EKU A;  3P42 A;  2K6Q A;  4GSW A;  2FUG 1;  2D3A A;  2HE7 A;  4W9L A;  3BWU D;  1ACC A;  4TUU A;  2BKR B;  5BYQ A;  4WQO B;  3R7Q A;  1IGD A;  2FCQ A;  1LM8 B;  4YSX B;  3I63 C;  4W9J A;  3H7S A;  4MEM A;  2KAN A;  2O6V A;  4N9F 4;  3V60 A;  3DHG C;  4P7I A;  2KLG A;  4PS8 A;  2SAK A;  1WWT A;  2NS5 A;  3PTF C;  2BT6 A;  3PT2 B;  2D11 A;  1PUT A;  5FKA C;  1TKE A;  3ECI A;  5AUK A;  1YX6 B;  2L0T A;  3LXF A;  1E7P B;  1ZW7 A;  1PFD A;  2NTS A;  4YTP B;  4YL8 A;  2XEW A;  3AXC A;  2XK5 B;  1WJN A;  1WJ4 A;  2WXJ A;  3KH0 A;  5GMV A;  1E5W A;  1SEB D;  2ZCB A;  1FM0 D;  3H8H A;  1R4N I;  2DZJ A;  2I2Y A;  3JYU A;  1FFU A;  3BYT B;  3R66 C;  3DVG Y;  4RM9 A;  4DXF A;  1P0R A;  2GBJ A;  1YX5 B;  1WY8 A;  1RFA A;  2DZM A;  4RM8 A;  1WFY A;  4ANX A;  4M8M A;  2JZ3 B;  3MC0 B;  4JIO U;  5HFY A;  3APF A;  2BYE A;  1C4P A;  3MFG A;  1EM7 A;  2WDR B;  2UYZ B;  3Q14 C;  3KUD B;  3DBS A;  4MT5 A;  1IBX A;  3AU4 A;  1GG3 A;  2AWT A;  3N20 C;  4FLH A;  5KHQ A;  4MSQ B;  3AM9 A;  2L83 A;  3RFZ B;  2LGY A;  1JAL A;  2N4F A;  5IOI A;  4KDL B;  1JWU D;  4LDT B;  2K8C A;  2WXR A;  3GZN I;  1LO5 D;  4N58 A;  2PTL A;  4MGY E;  5T8I A;  1HE8 A;  3EA6 A;  2MEK A;  4F8C B;  3I9V 1;  1AN8 A;  1TKY A;  3SU8 X;  1WI0 A;  2IO3 B;  1GC7 A;  1FO4 A;  3VTV A;  2JY6 A;  2DHZ A;  2N0S B;  3IVF A;  4BKG A;  2LJI A;  2KDM A;  3RPF C;  2WXQ A;  1C79 A;  1MG4 A;  2EEL A;  2KT7 A;  2KJH B;  4M00 A;  4RGT A;  3N9Y C;  3GOE A;  1TIF A;  1XEE A;  3TJP A;  1KTK A;  3VVW B;  2KHW B;  1WX9 A;  3ENE A;  2W3S A;  1V5O A;  3PLV A;  5BMH A;  3B08 A;  4NJ7 A;  4WIP A;  5IP4 D;  4MM3 B;  3ABV B;  1NI2 A;  2G3Q B;  4GGQ A;  1YJJ A;  1YN4 A;  4YWG G;  5TR5 A;  3QA8 A;  4FJZ A;  3U4E G;  3QAR A;  2C7N B;  3IT4 B;  5DPW A;  1VDV A;  1CJE A;  2Y3A A;  3NVW A;  1GOZ A;  1XCQ L;  3DWM A;  1J7A A;  1SXT A;  5GXG B;  1K8R B;  4A3P A;  2KAJ A;  1V2Y A;  4WH4 A;  2JT4 B;  2JU6 X;  4P6V F;  2I1J A;  1ZE3 D;  4G11 A;  2QJL A;  4RGO S;  1H4R A;  2BYT A;  1IUE A;  1C4C A;  1I35 A;  4S0R A;  1VRA B;  2J4X A;  3AUL A;  4W9G A;  2N1W A;  2DZI A;  4IUM B;  4RF0 A;  1HTQ A;  2KC2 A;  5CX3 A;  1LXD A;  3AE8 B;  4EE2 A;  1GPX A;  2G9H D;  3KVF B;  3WAO A;  4C80 A;  2LRW A;  1K52 A;  1C3T A;  4XE0 A;  1EUV B;  3PS6 A;  4C00 A;  2MWS B;  1JQ4 A;  4FHJ A;  4CQN A;  3WAP A;  1GJZ A;  1XQQ A;  2K9X A;  1WGG A;  1N62 A;  3URY A;  1V9J A;  3UIN B;  4ANV A;  2J53 A;  2AYO B;  1UUP A;  4PYZ A;  3IAS 1;  4DXA B;  4HRO A;  4WWN A;  4K7S A;  1ZGU B;  1NYQ A;  2QIE B;  2M0A A;  1UF0 A;  1Z2M A;  2L76 A;  3P4Q B;  2KTF A;  3EUB 2;  1R7S A;  3M63 B;  5BMI A;  1JW9 D;  3NOB A;  2CHZ A;  4XGA B;  4ARC A;  1E8Z A;  2WXL A;  3K9P B;  2D3G A;  1FRD A;  1V1P A;  3DBR I;  3AEA B;  2K39 A;  2LGX A;  3FKY A;  2L32 A;  3BIN A;  3X23 A;  3TL5 A;  3GS2 A;  4HWI B;  1M94 A;  1XLN A;  3PO0 A;  3CIR B;  1KJT A;  1P1A A;  2BF8 B;  2OOB B;  3AEC B;  3ZVV A;  1E8W A;  1FCC C;  2RD0 A;  4P1B C;  2WDQ B;  1V1P B;  1AWD A;  2BS2 B;  4LNK A;  4EEW A;  1WR1 A;  4HCP B;  3SDL C;  3O65 B;  1MHX A;  2MA9 B;  3QWZ B;  1L5P A;  2JRI B;  4F1S A;  1WJU A;  4OZC A;  1MJD A;  1KLU D;  1D5M C;  2G4D B;  4URK A;  3HRD D;  1NI3 A;  1J19 A;  4MSM B;  1J7C A;  3C8Y A;  1C76 A;  1OGW A;  2UU7 A;  1ZXH A;  3DDC B;  4ICV A;  4WWP A;  4IWQ A;  2ACZ B;  1ET6 A;  2KWV B;  4OVU A;  3BYY B;  4GDL A;  2CR5 A;  1DOY A;  3TIX A;  2K3U A;  4HPL B;  5HHD G;  4DHJ D;  4ZRQ A;  1M4V A;  5FR6 A;  1C1Y B;  1SF0 A;  4XWT A;  1GAQ B;  2LFI A;  4IM0 A;  4RFB A;  2D07 B;  4NY0 A;  1SJE D;  2L7R A;  4HLE A;  3JW0 X;  1L0X B;  2FCM A;  1UEL A;  2JVC A;  2W9N A;  3IHP C;  4PS3 A;  2CKH B;  4K3C A;  2M1M A;  4IM3 A;  1VJK A;  3RNC C;  1FCL A;  2N9P C;  4EZK A;  2RR9 A;  1UBQ A;  1E10 A;  3NVV A;  4KGR A;  3PHX B;  2KFJ A;  4RGM A;  3ZXR A;  4REZ A;  1WXM A;  3OJ3 A;  3Q8A A;  3MP9 A;  2LUE A;  2N9E B;  1F9J A;  2RPQ A;  2IDY A;  2J0J A;  1QKZ A;  1FFV A;  3AU5 A;  1TS5 A;  5JZE B;  3I5J C;  1WX7 A;  2D10 A;  4MH0 E;  4K7U A;  1L4D B;  2K8H A;  1FEH A;  5DCN A;  1V86 A;  1T0S C;  3ML8 A;  4JQW C;  1S1Q B;  1JRU A;  3A4S C;  3QIJ A;  4GIV A;  2WX1 A;  3V6C B;  3B9J A;  5D3I B;  3E9S A;  5FR3 A;  1P3Q U;  1YD8 U;  2X38 A;  2MW5 A;  1WZ3 A;  3L4P A;  1NBF C;  3ZNG C;  2G1E A;  1L6V A;  3QQ8 B;  2BWF A;  1SE9 A;  2HJ8 A;  3BK1 A;  2JWZ A;  3PGE A;  4NAW A;  5L83 A;  1QOB A;  1TTN A;  4S17 A;  2PE6 B;  4XX5 A;  2FUH B;  3RI7 C;  2KVZ A;  4FXC A;  1SBB B;  2WU5 B;  5LXH A;  1L7Y A;  1MPE A;  1WMH A;  4HCN B;  3VUX A;  5EDS A;  4KZ0 A;  3AED B;  5EE3 A;  3N1X C;  3RD2 A;  1SIJ A;  4A20 A;  1LGR A;  1ENF A;  3H6N A;  4TMA B;  3QHT A;  2GBR A;  2WWZ A;  4ACF A;  1EWC A;  2WGS A;  3UF8 A;  4OW0 A;  1Q0W B;  2L1A A;  2JZZ A;  2BYV E;  2FE8 A;  2C9W B;  2OED A;  4WUR A;  1QOF A;  1L6U A;  4ITK A;  5CHV C;  1E9M A;  1RM6 C;  3ZUN A;  2WXN A;  2I38 A;  2LZ6 A;  4A9A A;  3PHW B;  4KZC A;  2V4L A;  1XF5 L;  3L13 A;  1JRO A;  1TZO A;  4C4V B;  2J7Q B;  4JGH B;  4J6I A;  1E8X A;  1TS2 A;  2KX3 A;  2D3B A;  4MAC A;  3V62 A;  4YXD B;  2QDF A;  2MJE A;  3RYT A;  1F2R I;  5J18 A;  4KGS A;  1WZ0 A;  4HPP A;  2MH7 A;  1NVI D;  1P98 A;  1I4G A;  4R3D A;  3NVY A;  2KVR A;  2CU3 A;  4TV3 A;  1MVK A;  2ASQ A;  2NPT A;  1FPY A;  2K25 A;  2AX5 A;  4E71 A;  3RUI B;  3ZIM A;  3EFC A;  4BZA A;  3IFW B;  1XLP A;  2JZP A;  4HXD A;  2CJO A;  2BBC A;  2BPS A;  3AE5 B;  2AQ2 B;  2H88 B;  1D4B A;  1VZ7 A;  2PKO A;  2DAJ A;  2CU1 A;  2KTR A;  1IP9 A;  4IWP A;  2A4Z A;  1SJH D;  1WM3 A;  1WH3 A;  4MM3 A;  1VZ6 A;  2Y5P A;  1WSP A;  2AL3 A;  2MBH A;  4G50 A;  4NPN A;  1HQR D;  5H92 C;  3ZJT A;  2ONQ A;  3NZ3 A;  2KJR A;  3D32 A;  3NS8 A;  3T9L A;  3NHE B;  2KZR A;  3VXW A;  3BY4 B;  2E6X A;  4MDK E;  1JWS D;  2HTM E;  3ZDT A;  2NVU I;  2KFK A;  1WGY A;  4X57 B;  3TEX A;  2KYW A;  1T0R C;  1HZ5 A;  3KYC D;  4FBJ B;  2R61 A;  2KXJ A;  3TSS A;  2JRH A;  2WX0 A;  3CMM B;  4FJY A;  4ARI A;  3KWV A;  1C4A A;  4LJP B;  2KWC A;  3Q3N C;  2KJ6 A;  4RF1 A;  3TEZ A;  1EU4 A;  2MCN B;  1SE4 A;  3VH3 B;  1ROE A;  2RPV A;  1UGM A;  1L0Y B;  4LNI A;  3UIO B;  3CF6 E;  3QJZ A;  3ZTC A;  3N32 A;  4M0W B;  1OQQ A;  1WRI A;  4KIK B;  3RZF A;  1TZ1 A;  3MC9 A;  3GE8 C;  2VZK D;  4PK1 A;  1YMH E;  3EC8 A;  3VR9 B;  2FIF A;  3VDZ A;  1WYW B;  2N9K A;  3W9C B;  1KM7 A;  2NBV B;  2FBW B;  4NJC A;  5E6O A;  1FNV A;  4AUQ C;  3MHZ A;  1IYF A;  2KQ7 A;  3ZJU A;  2KDF B;  5EE0 A;  2Z59 B;  4TKN A;  4ZHO A;  4WWM A;  1VLB A;  3CWI A;  4DWF A;  4K81 A;  2NBW B;  4KIK A;  4C7Y A;  2PVO D;  2WXP A;  3U7Z A;  5J2R A;  3DCG A;  4HPM B;  2KAC A;  1Q1O A;  2ZVN A;  2LWP A;  2KQS A;  3P4P B;  4XDC A;  4AP4 C;  3Q3F A;  3WA0 A;  4ZRI A;  2JYE A;  3GZN B;  2MX2 A;  1X1M A;  2O6V B;  4ZRJ A;  3A4R A;  3UGB B;  3PV1 A;  2MJ3 A;  4EZL A;  1HZ6 A;  3KUC B;  3N1Y C;  3ZLZ A;  3V3X A;  2N9X A;  3AV8 A;  2DLB A;  1P7E A;  4CHK A;  1J0G A;  5D6J B;  2B76 B;  3JVZ X;  4YSY B;  2KDE B;  3W1S A;  1XT9 B;  3V61 A;  1IGC A;  2MLB A;  4K7W A;  2Z0D B;  4Q2J A;  1ET9 A;  1UWM A;  4W9D A;  2HTH A;  3NG0 A;  1WGD A;  3TUO A;  2H89 B;  1B1Z A;  3APC A;  2XN9 C;  4A3O A;  1YN3 A;  1YQB A;  2CS4 A;  1NEN B;  2D2Q A;  2J0K A;  2LHD A;  2K0P A;  3K9O B;  4BBN F;  3GP7 A;  2LEK A;  3KUZ A;  2IPK D;  2PVG C;  1BUI C;  3W1Y A;  2L8J A;  2DYO A;  2NPT B;  4G3X B;  4A90 A;  5L95 C;  1Q5W B;  1C77 A;  5AZH A;  4J3O D;  4AJW A;  3DBH B;  2LVQ A;  2FCN A;  2WXO A;  1TT5 B;  5MPO A;  1I4R A;  1OFF A;  1P9D U;  1K51 A;  2WYQ A;  1WJ6 A;  2W82 A;  3KYD D;  1ZDX A;  3HM3 A;  2IGH A;  3PPA A;  4GDL B;  1IPG A;  2M17 A;  2INN E;  3ZXV A;  4HDQ A;  1ISN A;  2LXC A;  2IBI B;  1WXV A;  2OHF A;  2JSV X;  3B2F A;  3NUH B;  5AUI A;  2ZNV C;  2ZW0 A;  2GOW A;  2BVC A;  4ZHP A;  4GMV A;  2WXG A;  1ESF A;  2JXT A;  2G45 B;  1UZX B;  4IM2 A;  4LNO A;  5G5G A;  2AL6 A;  5IKC M;  1D5Z C;  4B95 A;  4BBN C;  1D3Z A;  2N1V A;  4XDD A;  2K8B A;  2KNB A;  3PZD A;  3BK2 A;  2QHO A;  5LLI A;  1N5W A;  2IJ0 A;  1YOV B;  2L00 B;  2MQJ A;  3ALB A;  3QX1 A;  3AE7 B;  1F1H A;  4KX6 B;  3NZU A;  3WAM A;  3AH7 A;  2EMS A;  4M8N A;  2QIL A;  2JPH A;  1MI0 A;  3DVG X;  2WDV B;  3C19 A;  3AE4 B;  4LJO B;  1F0Z A;  3DQV A;  2LRU A;  3MJ5 A;  2IND C;  3PRM B;  5IA7 A;  2DWQ A;  3HUI A;  4B0M A;  5E6J A;  4KKJ A;  2KFK B;  2Z0E B;  1Q10 A;  3HM6 X;  2LHE A;  3P1M A;  1D6E C;  3AE3 B;  1RLF A;  3N1Z C;  1ZKH A;  4IW0 A;  1QT9 A;  4XWW A;  4PYU A;  3M95 A;  5CTR C;  4AOF A;  3S2A A;  4I6L B;  3TEW A;  3A33 B;  4RNA A;  3RNE C;  1XXG A;  4IC7 B;  4ZDV A;  2M56 B;  3SHQ A;  4B0E A;  4C7Z A;  3ZRC A;  3RZW C;  3VUY A;  2Y5B B;  3AE2 B;  2IO0 B;  2MBO A;  4HKZ E;  4NJ6 A;  4W9K A;  3C0R B;  1WMH B;  1F52 A;  2GBK A;  2NTT A;  4ANW A;  4WJQ A;  3R7R A;  5HG2 A;  3A1Q A;  2LGS A;  5C2T B;  4DQO C;  4NQK E;  1L0V B;  4AS1 A;  1GB4 A;  3AEB B;  2EKI A;  1K50 A;  5D2M B;  4MEL A;  4L23 A;  1TYG B;  3NJT A;  2QEJ C;  3BVM A;  2NBU A;  3ZRF A;  2M19 A;  1N63 A;  2AQ3 B;  4WAF A;  3VRB B;  2L52 A;  3NVZ A;  2KDI A;  3PRP B;  3FC4 A;  2WXH A;  1AW7 A;  4KSL C;  2BS3 B;  3L10 B;  4BOS C;  3RUL A;  1E0Z A;  2MJD A;  4OZA A;  3L0W B;  3PLU A;  4XYC A;  4JE3 B;  4CYE A;  2WXF A;  3U7D A;  1FXT B;  1TKG A;  3CST A;  3OJ4 B;  1TBE A;  1STE A;  3IG3 A;  4KKI A;  1F2R C;  1T0Q C;  2J52 A;  1MHH E;  3ZQ4 A;  3Q8E A;  1ZUD 2;  2NR2 A;  1WX8 A;  4NAM A;  3V6E B;  1TS4 A;  3M62 B;  3Q3J A;  1YJI A;  4RH6 A;  2J42 A;  3A9K A;  4BAX A;  4ZRP A;  3PSE B;  3WAN A;  5D3D A;  5C1Z A;  3SFD B;  3MTN B;  2TSS A;  2JQR B;  2FNJ B;  4W9H A;  1SSN A;  3DVN U;  2G4S A;  1Z5S B;  2WDT B;  2SEB D;  5G55 A;  1T0Y A;  4K1R B;  2IY1 B;  1V6E A;  2E3T A;  1P7F A;  1VZ8 A;  1QOA A;  1E7V A;  2K1F A;  1N60 A;  1FXA A;  4NAW B;  3RCZ A;  3L08 A;  2WS3 B;  1GC6 A;  2KTR B;  2WHI A;  1WGR A;  1KF6 B;  4HEA 1;  3U2S C;  1SIF A;  5E6N A;  4JL9 A;  3PZ7 A;  1RYJ A;  1AAR A;  5FK9 C;  1TS3 A;  3KWL A;  1GUA B;  1XCT L;  1R4M B;  3UIP B;  4F7Z A;  1AYF A;  2INP E;  4DXG A;  1RFK A;  3L16 A;  2L3Z A;  3WAL A;  4GXB A;  1WIA A;  2WXI A;  1MFW A;  4BVU C;  5LNK 1;  2AQ1 B;  1UD7 A;  3GB1 A;  1I7H A;  4MGI E;  1EF1 A;  2K6D B;  4GDK B;  4L2Y A;  4FUL A;  3OAW A;  4M01 A;  4US9 A;  4W9F A;  2QCZ A;  2D5G A;  4UDU C;  3GE3 C;  4C4V A;  1J8C A;  3LB8 C;  1JCK B;  4TQ1 A;  4RCO A;  3AE6 B;  3B0A A;  2K5P A;  4LK0 M;  2ICI A;  1T5X D;  1CMX B;  2MSE D;  4IKG A;  2PIA A;  3NY5 A;  2V1Y A;  1R4N B;  1S3S G;  1QQR A;  2V4I B;  3HVD A;  4ZYN A;  3BZD B;  2ZPY A;  1HXY D;  3ZNZ B;  4DK5 A;  2KQ4 X;  1OQR A;  2YEP B;  1HEZ E;  2KK8 A;  3P4R B;  2MP2 A;  2RGF A;  5D7G A;  3U8Z A;  5HKH A;  5J17 A;  1YJ1 A;  2LXA A;  2PEA A;  3RN9 C;  2KWD A;  3AEE B;  3AN1 A;  1YQ3 B;  3O13 A;  1ZOY B;  3Q69 A;  3HK0 A;  1WXS A;  5JHA A;  4WJO A;  2KO3 A;  3KW5 B;  1C78 A;  1B9R A;  3Q6B A;  2BTE A;  3HVZ A;  2HDE A;  3P2B A;  1PQS A;  4DHZ E;  3VAW A;  3VQI A;  3DVN V;  1JWM D;  3A9J B;  3ETR A;  1N61 A;  2LAS A;  1HTO A;  2XNA C;  3R2I A;  3L17 A;  2KN4 A;  2YEP F;  1QF6 A;  2GRI A;  1WXA A;  5IAA C;  4GU2 A;  4JWU C;  1FRR A;  1Y56 A;  1V97 A;  1CZP A;  1YNT E;  2KKC A;  1QZE A;  2JYT A;  4WQM A;  4DDI D;  3JSV A;  3H9D A;  1TGZ B;  3DHI C;  4ANU A;  4IG7 B;  1WR6 E;  2AEH A;  2QMT A;  3BII D;  1HA5 A;  1OTR B;  1ZDV A;  3AI5 A;  4N59 A;  3ZKJ C;  4HK2 A;  1XO3 A;  3E56 A;  3AEF B;  3NRZ A;  4I6N B;  2EMT A;  5KHO A;  3UI3 A;  1G6J A;  2ZVO A;  1KFY B;  2PPH A;  3Q3M C;  1ZPS A;  1OEY J;  4MJS B;  4IOI E;  1SE2 A;  1K53 A;  3APD A;  4HKQ A;  2GMI C;  2KMC A;  5JH5 C;  1UBI A;  4AJY B;  1PGX A;  4LCD E;  4A8X C;  3IAM 1;  1ZP0 B;  1A70 A;  2PW9 A;  1E7U A;  2KD0 A;  2IY0 B;  3Q8B A;  3ZW3 A;  4DDG D;  4MJS A;  4O1N A;  2ON8 A;  2WXM A;  1UGJ A;  1XD3 B;  3R8B A;  4ICU A;  3R3M A;  4P16 A;  4LNF A;  2VH2 A;  4NQL B;  4FJV B;  4OVV A;  2IO2 B;  2JWU A;  5BO4 B;  3W5U B;  2MHJ A;  2C7H A;  4RMA A;  3TMP B;  2M0X A;  2HD5 B;  2KN5 A;  3FIL A;  2QC8 A;  3DOW A;  3N3K B;  1I4X A;  3VUW A;  4TQ0 A;  2B3A A;  3DBL I;  4N6E B;  1H8C A;  2C5L C;  3UQB A;  1VCB A;  3SEB A;  4LLG M;  2DX5 B;  2GLS A;  2L0F A;  2KMM A;  3TEY A;  1L4Z B;  3TCA A;  2I1K A;  2MRP A;  5AZG A;  2EKE C;  1N5X A;  4EOY A;  2PMV A;  2N7D A;  3EEC A;  3WCQ A;  2KLC A;  2KMA A;  1V49 A;  4USA A;  3QAQ A;  2N9L A;  2VZK B;  5E6P A;  5AZF A;  1FD6 A;  3U30 A;  2LUM A;  4ZRK A;  3KLS X;  1UWX A;  4DHZ B;  4HJK A;  3W2D A;  2OJR A;  5LXI B;  2Z8L A;  5DPS A;  4EUT A;  2LI5 A;  3HHM A;  1JWB D;  2R2O A;  1LFD A;  4G0N B;  2D3C A;  3T8M A;  3LJ3 A;  3AB5 A;  3U52 E;  4HJG E;  1YQ4 B;  3Q8C A;  1ZXI A;  4ZYS A;  3BVZ A;  1SGH A;  4II3 B;  4KV2 A;  3SR6 A;  2V9H A;  4WAA A;  3B2G A;  5EE9 A;  1F77 A;  2BB5 A;  3RNB C;  2CHW A;  3ZTD A;  1EWY C;  1PDX A;  3ZDM C;  4AQ7 A;  1PGB A;  3TBL D;  4JWS C;  1WE6 A;  4OHJ A;  3ZGZ A;  5IO9 A;  4DHJ B;  3H7P A;  1U4A A;  1FNW A;  1CQV A;  2BKF A;  4HDO A;  2WP9 B;  2CJN A;  4IWO A;  1PYW D;  4WJN A;  2ZCC A;  1GNU A;  1YIW A;  2R2Q A;  5CHF A;  2N7J A;  1T3Q A;  3FAH A;  2BS4 B;  1BXT A;  5G5H A;  2W55 A;  3H1U A;  1SB3 C; 
#chains in the Genus database with same CATH homology
 1WJN A;  1WJ4 A;  2BYV E;  4KSL C;  2C9W B;  3L10 B;  1OQY A;  4W9E A;  2LGD A;  4BOS C;  3RUL A;  1EO6 A;  2KOX A;  3KH0 A;  5GMV A;  1E5W A;  3L54 A;  5CHV C;  2PJH A;  2KWU B;  2ZCB A;  3L0W B;  3ZUN A;  4BKS A;  2LZ6 A;  3PLU A;  4FHK A;  3PHW B;  1R4N I;  2DZJ A;  4GB9 A;  4CYE A;  3JYU A;  3R66 C;  4KDI C;  4KZC A;  2ZJD A;  3LDZ E;  2V4L A;  3DVG Y;  4RM9 A;  1FXT B;  1P0R A;  3CST A;  3U7D A;  2GBJ A;  1YX5 B;  3L13 A;  1WY8 A;  1RFA A;  1TBE A;  3OJ4 B;  2J7Q B;  2DZM A;  4RM8 A;  2ZEQ A;  1WFY A;  2M4N A;  3IG3 A;  4JGH B;  2JZ3 B;  2C7M B;  4JIO U;  4J6I A;  4M8M A;  4MGK E;  1E8X A;  3APF A;  2BYE A;  2KX3 A;  3VTW A;  3V62 A;  2UYZ B;  3ONS A;  3KUD B;  3DBS A;  3RYT A;  5J18 A;  3AU4 A;  1GG3 A;  1VD2 A;  1WZ0 A;  2AWT A;  4FLH A;  5KHQ A;  2UWQ A;  1P98 A;  2NR2 A;  1WX8 A;  2BWE S;  3V6E B;  3NZS A;  4II2 B;  2C60 A;  4MSQ B;  4W9C A;  4BKT A;  2KVR A;  4TV3 A;  5G2N A;  2ASQ A;  2LGY A;  3M62 B;  2NPT A;  3Q3J A;  2K25 A;  4E71 A;  3A9K A;  3RUI B;  2N4F A;  3ZIM A;  4KDL B;  3PSE B;  3WAN A;  4BKS D;  5C1Z A;  3IFW B;  4LDT B;  2K8C A;  3MTN B;  4EFO A;  2NCN A;  2FNJ B;  3GZN I;  4HXD A;  1WF9 A;  4W9H A;  3DVN U;  2REX A;  1A5R A;  2KC1 A;  2BPS A;  3I3T B;  2G4S A;  3MJW A;  4MGY E;  1Z5S B;  2WDT B;  4FAD A;  1HE8 A;  4LDT D;  2DAJ A;  2CU1 A;  5G55 A;  2KTR A;  1IP9 A;  4IWP A;  4F8C B;  1T0Y A;  4BOZ B;  2YVC A;  4K1R B;  2A4Z A;  2IY1 B;  1V6E A;  3SU8 X;  1WI0 A;  1WM3 A;  2IO3 B;  1WH3 A;  4MM3 A;  3VTU A;  4E3C A;  2DYM A;  1GC7 A;  4WJP A;  1E7V A;  3PRE A;  3VTV A;  2AL3 A;  2JY6 A;  2MBH A;  2K1F A;  2DHZ A;  3IVF A;  4G50 A;  4BKG A;  4XC2 A;  4NAW B;  4NPN A;  2VRR B;  3RCZ A;  4DBG A;  3L08 A;  2KTR B;  1GC6 A;  1WGR A;  2KJR A;  1MG8 A;  3OLM D;  3ZNH B;  1SIF A;  3D32 A;  5E6N A;  1R4M I;  4JL9 A;  2KJH B;  3NS8 A;  3T9L A;  3H7P B;  1AAR A;  3GOE A;  3NHE B;  2KZR A;  3VXW A;  3TJP A;  3BY4 B;  3VVW B;  1GUA B;  2KHW B;  3UIP B;  4F7Z A;  4MDK E;  1KLV A;  1WX9 A;  3ENE A;  3L16 A;  3PVL A;  2L3Z A;  3ZDT A;  3WAL A;  4GXB A;  2NVU I;  1WIA A;  1V5O A;  3PLV A;  2CHX A;  2KFK A;  4BVU C;  1WGY A;  3B08 A;  4NJ7 A;  4X57 B;  1UD7 A;  3M3J A;  2A5U A;  3KYC D;  4FBJ B;  4MGI E;  1EF1 A;  1NI2 A;  2KXJ A;  2G3Q B;  4GGQ A;  5TR5 A;  3QA8 A;  2K6D B;  4FJZ A;  4GDK B;  1LQB A;  4FUL A;  3OAW A;  3QAR A;  2C7N B;  2JRH A;  5DPW A;  2WX0 A;  3CMM B;  3DPD A;  4FJY A;  4W9F A;  4LJP B;  3SD5 A;  4HVB A;  4FN2 A;  2DYB A;  2KWC A;  2DZK A;  2KJ6 A;  5DPR A;  2BYF A;  2MCN B;  1J8C A;  3VH3 B;  1EF5 A;  4TQ1 A;  1K8R B;  4A3P A;  1V2Y A;  1UGM A;  3B0A A;  3UIO B;  3CF6 E;  3QJZ A;  3ZTC A;  2JT4 B;  1CMX B;  2MSE D;  2MBE A;  2I1J A;  3N32 A;  3NY5 A;  4G11 A;  4AWJ A;  2V1Y A;  3VHT C;  1S3S G;  4M0W B;  4BFR A;  4ZYN A;  2ZPY A;  1H4R A;  3ZNZ B;  4KIK B;  3RZF A;  1I35 A;  1TZ1 A;  4DK5 A;  3VH4 B;  1WGH A;  5C23 A;  1KOT A;  2MP2 B;  3AUL A;  2KK8 A;  1WM2 A;  2MP2 A;  2RGF A;  4W9G A;  2N1W A;  5D7G A;  2DZI A;  3U8Z A;  3EC8 A;  4IUM B;  5HKH A;  5J17 A;  2FIF A;  1YJ1 A;  2LXA A;  2KC2 A;  2PEA A;  3QK0 A;  4KSK C;  5CX3 A;  1LXD A;  1WYW B;  3VDZ A;  5AEK B;  1KM7 A;  2NBV B;  3KVF B;  5E6O A;  3WAO A;  3HK0 A;  1WXS A;  4AUQ C;  5JHA A;  2MBB B;  4WJO A;  2LRW A;  2KO3 A;  1L2N A;  1C3T A;  1EUV B;  3KW5 B;  3PS6 A;  1IYF A;  2JF5 A;  1RRB A;  2GBN A;  2MWS B;  2KQ7 A;  4FHJ A;  2KDF B;  2Z59 B;  4TKN A;  3WAP A;  1GJZ A;  1XQQ A;  3EHV A;  3P2B A;  3MHS D;  3RT3 B;  1WGG A;  1PQS A;  4DHZ E;  1V9J A;  2PE9 A;  3UIN B;  3VAW A;  4ANV A;  4E74 A;  3VQI A;  3DVN V;  2IZV B;  3A9J B;  3N30 A;  4DWF A;  4K81 A;  2IO1 B;  2NBW B;  4KIK A;  2JXX A;  3ZNI D;  2AYO B;  5J2R A;  2GBM A;  2LAS A;  3W1S C;  3DCG A;  4HPM B;  4PYZ A;  3L17 A;  1Q1O A;  4DXA B;  2ZVN A;  2LWP A;  3JSV B;  4WWN A;  2BGF A;  2KQS A;  4K7S A;  4AP4 C;  3Q3F A;  1ZGU B;  4W9I A;  3WA0 A;  3X0W A;  4ZRI A;  2ZPN A;  2MX2 A;  1X1M A;  1WXA A;  2JUO A;  2O6V B;  2FCS A;  4ZRJ A;  3A4R A;  5IAA C;  4GU2 A;  3UGB B;  3PV1 A;  1Z2M A;  2L76 A;  1RAX A;  4I6P A;  2KTF A;  4EZL A;  2KKC A;  1QZE A;  2LVO A;  3KUC B;  3M63 B;  2LD9 A;  3ZLZ A;  3NOB A;  2N9X A;  4ASW C;  2CHZ A;  4DDI D;  3JSV A;  2KDB A;  4MGZ E;  1E8Z A;  3H9D A;  4CHK A;  3K9P B;  1TGZ B;  2J0M A;  2D3G A;  1J0G A;  5D6J B;  1WRD B;  2O2V B;  3DBR I;  4ANU A;  4IG7 B;  1WR6 E;  2AEH A;  3JVZ X;  2K39 A;  2KDE B;  3W1S A;  2LGX A;  1XT9 B;  3BIN A;  1OTR B;  3X23 A;  3AI5 A;  4HWI B;  3TL5 A;  2MLB A;  4K7W A;  3V61 A;  3ZKJ C;  1M94 A;  2Z0D B;  4HK2 A;  3QCA A;  1KJT A;  1P1A A;  2BF8 B;  2OOB B;  4W9D A;  3UQA A;  2LJ5 A;  2HTH A;  1WGD A;  3ZVV A;  1E8W A;  2RD0 A;  4I6N B;  2EMT A;  4GN1 A;  2O2V A;  4GOC A;  3APC A;  5KHO A;  5DPT A;  4A3O A;  1G6J A;  2ZVO A;  3VFK A;  4EEW A;  1WR1 A;  1YQB A;  2PPH A;  2XBB C;  4HCP B;  3SDL C;  3O65 B;  2CS4 A;  2MA9 B;  3QWZ B;  5CHW A;  2D2Q A;  2JRI B;  1OEY J;  4F1S A;  2J0K A;  1WJU A;  4MJS B;  4FA6 A;  3K9O B;  4BBN F;  4NNJ B;  3KUZ A;  3W1Y A;  3APD A;  2L8J A;  1I42 A;  2DYO A;  2GMI C;  2KMC A;  4KVG B;  2NPT B;  2G4D B;  4G3X B;  1UBI A;  4AJY B;  4URK A;  5JH5 C;  5L95 C;  4LCD E;  1Q5W B;  3A9K B;  3CSF A;  3ZO5 B;  1J19 A;  5AZH A;  4MSM B;  4AJW A;  4JLC A;  2LVQ A;  2FCN A;  1WE7 A;  1OGW A;  2M8S A;  1P9D U;  5D94 A;  3DDC B;  2WYQ A;  1WJ6 A;  1E7U A;  2KD0 A;  3KYD D;  4ICV A;  2IY0 B;  4CO7 A;  4WWP A;  2XK5 A;  4IWQ A;  3PRZ A;  2V3S A;  3HIZ A;  2KWV B;  3HM3 A;  3ZW3 A;  4OVU A;  4DDG D;  3PPA A;  4GDL B;  1IPG A;  2M17 A;  4GDL A;  4MJS A;  4XZ4 A;  2CR5 A;  4HDQ A;  3TIX A;  1ISN A;  4ANX A;  2LXC A;  2IBI B;  3QC8 B;  1XD3 B;  4HPL B;  4DHJ D;  1WXV A;  4ICU A;  2FAZ A;  1E90 A;  5FR6 A;  3R3M A;  1C1Y B;  4NQL B;  2ZNV C;  4FJV B;  4OVV A;  2IO2 B;  2GOW A;  4IM0 A;  2D07 B;  5BO4 B;  2ZZP B;  4GMV A;  4NY0 A;  2L7R A;  2C7H A;  3IBE A;  2O6V D;  2G45 B;  1UZX B;  4RMA A;  3JW0 X;  3TMP B;  4HLE A;  4IM2 A;  4EZJ A;  2M0X A;  2HD5 B;  2KN5 A;  2AL6 A;  1V81 A;  2FCM A;  1E8Y A;  1UEL A;  4PS7 A;  4B95 A;  2JVC A;  2W9N A;  2N1V A;  4BBN C;  2N7E A;  3EFU A;  3A9J A;  3IHP C;  4PS3 A;  1D3Z A;  2K8B A;  2KNB A;  2CKH B;  3DOW A;  2DEN B;  3N3K B;  3PZD A;  4B6W A;  1V5T A;  2QHO A;  5LLI A;  3B1L X;  3VUW A;  2M1M A;  3A1Q B;  3ML9 A;  4IM3 A;  2L00 B;  2MQJ A;  3ALB A;  5LXH A;  2N9P C;  4TQ0 A;  2B3A A;  4EZK A;  2RR9 A;  3DBL I;  3QX1 A;  1H8C A;  2KX0 A;  3NZU A;  3WAM A;  2C5L C;  1UBQ A;  2EMS A;  2IYD B;  1VCB A;  3PHX B;  2KFJ A;  4M8N A;  3UQB A;  2JPH A;  3DVG X;  2DX5 B;  4LJO B;  1WXM A;  3DQV A;  1UH6 A;  3OJ3 A;  2L0F A;  2LRU A;  3DBH I;  3PRM B;  5IA7 A;  2LUE A;  2N9E B;  2FID A;  3TCA A;  2I1K A;  2MRP A;  1NDD A;  1F9J A;  2EKE C;  5AZG A;  4B9K A;  3WIM A;  4EOY A;  2RPQ A;  2J0J A;  2MBQ A;  2LVP A;  1Y8R C;  2N7D A;  3EEC A;  2KLC A;  3AU5 A;  2KMA A;  5JHB A;  2YLM A;  5JZE B;  1V49 A;  1OEY A;  4GDK A;  2RSU A;  3QAQ A;  1WX7 A;  2D10 A;  5E6P A;  5AZF A;  4MH0 E;  4K7U A;  1BT0 A;  3U30 A;  2DAF A;  2K8H A;  5DCN A;  1V86 A;  2KFK B;  4ZRK A;  3ML8 A;  2Z0E B;  4JQW C;  1S1Q B;  1JRU A;  3A4S C;  4HJK A;  3HM6 X;  3QIJ A;  4DHZ B;  2ZNV B;  2OJR A;  4GIV A;  2WX1 A;  5LXI B;  3V6C B;  1RLF A;  5DPS A;  4EUT A;  1ZKH A;  2LI5 A;  4IW0 A;  4WWO A;  3HHM A;  1P3Q U;  1YD8 U;  1V80 A;  2L05 A;  2R2O A;  1LFD A;  4PYU A;  4G0N B;  2MW5 A;  1WZ3 A;  4EKU A;  1NBF C;  3M95 A;  2K6Q A;  4GSW A;  3T8M A;  3LJ3 A;  5CTR C;  3ZNG C;  4AOF A;  2HE7 A;  4W9L A;  3S2A A;  4I6L B;  4TUU A;  2BKR B;  3A33 B;  3QQ8 B;  4WQO B;  3AXC A;  1SGH A;  4II3 B;  4IC7 B;  2BWF A;  1SE9 A;  2HJ8 A;  3R7Q A;  4ZDV A;  2FCQ A;  1LM8 B;  2JWZ A;  4W9J A;  3SHQ A;  3PGE A;  4NAW A;  3H7S A;  4MEM A;  4KV2 A;  2KAN A;  5L83 A;  2O6V A;  1TTN A;  3RZW C;  3VUY A;  2Y5B B;  4N9F 4;  3ZRC A;  2IO0 B;  2MBO A;  4NJ6 A;  4WAA A;  3V60 A;  4W9K A;  2PE6 B;  3C0R B;  4XX5 A;  2FUH B;  4P7I A;  2KLG A;  4PS8 A;  1WMH B;  2NS5 A;  2GBK A;  3PTF C;  2CHW A;  1L7Y A;  4HCN B;  1WMH A;  4WJQ A;  3VUX A;  3R7R A;  3ZDM C;  3ZTD A;  3A1Q A;  4ANW A;  5EDS A;  4KZ0 A;  3TBL D;  4NQK E;  1WE6 A;  3PT2 B;  4DHJ B;  3RD2 A;  3H7P A;  4A20 A;  1U4A A;  2D11 A;  2BKF A;  5D2M B;  4HDO A;  4MEL A;  4IWO A;  3H6N A;  4WJN A;  3ECI A;  2NBU A;  1YX6 B;  2L0T A;  2ZCC A;  3QHT A;  3ZRF A;  1GNU A;  2GBR A;  2WWZ A;  1ZW7 A;  1YIW A;  3UF8 A;  2R2Q A;  5CHF A;  2KDI A;  1Q0W B;  3PRP B;  3H1U A;  4YL8 A;  2JZZ A;  2XEW A;  2XK5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...