2NVUI

Structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein turnover, ligase
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
publication title Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 76
sequence length 76
chains with identical sequence J
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nvuI00
4JGHB 4BVUC 4I6PA 2DZMA 4PYUA 4W9EA 4B95A 2J0MA 1FXTB 2N4FA 3T9LA 2LJ5A 1WXSA 2IO3B 5LXIB 4GSWA 3QQ8B 2KWCA 3B1LX 1OQYA 2C7NB 2C60A 4MM3A 2HE7A 5JZEB 4GU2A 5TR5A 4FBJB 1CMXB 4W9LA 2D11A 4EZJA 1A5RA 3D32A 2R2OA 2KC1A 3R7QA 3N32A 2KFKA 2G4DB 3VH4B 2DZKA 3DVGX 3R66C 2HJ8A 2KTRB 4IWQA 4MJSA 4FADA 3A4RA 2JT4B 1KOTA 4MSQB 3QARA 1Y8RC 3WANA 4DBGA 4MGYE 2K6QA 1E7UA 2O2VA 4NJ7A 2I1KA 2KDFB 3VDZA 3SU8X 3A9JA 3W1SA 1E8ZA 2XK5B 2ZCBA 1KLVA 4LJOB 1D3ZA 2GBRA 1V86A 4FJVB 4LCDE 1RAXA 2GMIC 2UWQA 3KUCB 4HCPB 1TZ1A 5EDSA 2G3QB 2AYOB 2KWUB 3PREA 4K1RB 2BKRB 3UF8A 3VVWB 5JHBA 1WJ6A 3EFUA 2A5UA 1Q5WB 1J19A 5CHWA 3RYTA 1GC6A 1UD7A 2Z0DB 4KDIC 1PQSA 2K6DB 4AJYB 4YL8A 3U30A 2CS4A 4DDGD 3PT2B 5E6NA 1XD3B 1ZKHA 4XZ4A 4NJ6A 4E74A 1OEYA 2AEHA 1XT9B 2DYBA 4FJYA 1P9DU 1V5OA 2KDIA 2O6VA 2DX5B 1WGGA 4WJPA 4K7UA 3VUXA 3DVNU 3IFWB 3S2AA 3R7RA 3ML9A 3QAQA 4TQ1A 4PYZA 3V6EB 4AOFA 2DYOA 3KVFB 5HKHA 2NR2A 3PSEB 3BINA 3A4SC 3L0WB 4G0NB 1I35A 2LRWA 2ASQA 3V62A 2BYEA 2LZ6A 3ZVVA 4ANVA 2KZRA 3ZTDA 3ML8A 3TBLD 1ZW7A 3VTVA 2HD5B 3DBLI 4DXAB 3WALA 1MG8A 1WJ4A 2Z0EB 2K8HA 2N9PC 4XX5A 2AL6A 2PPHA 2V4LA 4NQLB 4KIKB 2C7HA 3PGEA 5J18A 3RCZA 1IPGA 3OLMD 4K81A 4J6IA 2KDEB 5L95C 2VRRB 2LXAA 1XQQA 2L7RA 2KWVB 5KHQA 3UQBA 1RRBA 1Z2MA 4GB9A 1WGDA 2BF8B 2KMCA 2C7MB 4KVGB 3H7PA 3B0AA 4RM8A 2KFJA 2KO3A 1WIAA 4NAWA 2FCQA 2KVRA 2C9WB 1YD8U 3IG3A 1E90A 2L3ZA 3BY4B 3Q3FA 3RZWC 3SDLC 4W9DA 2FAZA 2JZZA 1WJNA 3K9PB 3W1YA 3X0WA 2DAFA 2CHZA 4ANUA 1R4NI 2K8CA 3ZDTA 4BOZB 1WM2A 2L8JA 4MDKE 2JF5A 1OGWA 1IP9A 2KLGA 2KJRA 5AZFA 4IUMB 3WAMA 2KJ6A 2JXXA 1NDDA 2KX3A 2M0XA 3NS8A 1UBIA 3VQIA 4TQ0A 4JQWC 2DHZA 2LD9A 3DBRI 5CHVC 1WZ3A 2BYFA 2OOBB 3KW5B 4AWJA 4W9HA 1P3QU 4M8NA 3TJPA 3PLVA 4PS8A 3OJ4B 3M62B 3ZLZA 1LQBA 2CHWA 3CSFA 3EC8A 3EHVA 1GC7A 4W9GA 4ZRJA 1WE6A 2NBWB 4HXDA 1Z5SB 4DK5A 2A4ZA 1E8XA 4DHZE 5J17A 2CU1A 4K7SA 2IY1B 2WWZA 3OJ3A 4AUQC 4K7WA 4RM9A 5CTRC 2MBHA 2LVPA 2JRIB 3APFA 4LDTD 3LJ3A 3A9KA 1QZEA 1EO6A 2WX0A 4HPLB 2NBUA 4FHKA 4EZKA 4F7ZA 4A3PA 2L0FA 2EKEC 4GDLB 2NBVB 1AARA 2M8SA 1ZGUB 1YIWA 3MHSD 4CO7A 3VAWA 1HE8A 1P98A 4FULA 2IO2B 3IVFA 5D6JB 2KX0A 4EEWA 1GNUA 4NPNA 1WJUA 4BOSC 3AU4A 3NZSA 2BGFA 3QWZB 3DBHI 2K25A 1WRDB 3X23A 3HIZA 4ZRKA 3A1QB 4ZRIA 3QX1A 4KSKC 3M63B 2NPTA 3UINB 4GOCA 2PEAA 3GOEA 2NS5A 4N9F4 3U8ZA 3KYCD 4HDOA 2L76A 2PJHA 4E71A 2DENB 2MW5A 4CHKA 2MCNB 4HLEA 4NQKE 2MBQA 1YJ1A 3KUDB 3TIXA 4FA6A 4EOYA 2MLBA 1UH6A 4KZ0A 4W9JA 1S1QB 4FJZA 1WX8A 4BBNC 2FNJB 2GBMA 1K8RB 4TKNA 1SIFA 2REXA 3DDCB 4BBNF 2MP2B 4GDKB 5LLIA 5LXHA 1E8WA 3QK0A 5DPSA 5AZHA 4B9KA 4IWPA 3OAWA 4HCNB 3NOBA 2NCNA 2KK8A 2MA9B 2IO0B 5G55A 1LM8B 2KN5A 2KTRA 3CMMB 2XBBC 4FLHA 3UIPB 5JH5C 4DWFA 1L7YA 2GBNA 3PZDA 3VH3B 4DDID 1LXDA 1V9JA 2MBBB 3VFKA 1NI2A 2FIFA 2CHXA 2NVUI 3WA0A 4IG7B 3ZO5B 4HVBA 4WJNA 5BO4B 1J0GA 2O6VD 2XK5A 1V6EA 2YLMA 3WAPA 2BYVE 2N7EA 4B6WA 4I6NB 3AXCA 3JSVB 2LWPA 4WWPA 4DHJD 3JYUA 4XC2A 2MSED 5G2NA 4IM0A 2JPHA 3H9DA 3KUZA 4W9FA 4WWNA 4ANWA 3PTFC 4ZYNA 3L13A 3ZKJC 2FCSA 2D07B 2KD0A 5L83A 4EKUA 1GUAB 2K1FA 1WGYA 1TBEA 4BKGA 2IZVB 1V2YA 2Y5BB 2WDTB 5DPTA 4WQOB 1V80A 3ZNZB 4W9IA 5FR6A 2BWFA 1VCBA 2CR5A 2GOWA 4HK2A 2G45B 2RD0A 2LGXA 3M3JA 3L08A 1WH3A 3CF6E 3A33B 5D2MB 4BKTA 4P7IA 1V49A 2BWES 4NY0A 3RZFA 4LDTB 4AJWA 1WMHB 4HPMB 4BKSA 2AL3A 4FN2A 4GXBA 3ZNID 4MEMA 1EUVB 2KQ7A 1V5TA 3PRMB 3WAOA 1SE9A 3I3TB 3HM3A 4PS7A 1YX6B 2W9NA 3C0RB 3DVNV 4JL9A 4JLCA 4GN1A 2BKFA 3TCAA 2ZVNA 1WGRA 4E3CA 3QIJA 4G11A 1P0RA 1C3TA 2GBJA 2KQSA 4KIKA 5CHFA 2N1WA 1YQBA 4M8MA 5AEKB 2K39A 2KC2A 1NBFC 3K9OB 3Q3JA 2IO1B 4A20A 1SGHA 2FCNA 4II3B 1TTNA 2N7DA 2M17A 3VXWA 3H6NA 1TGZB 2D10A 2IY0B 2KFKB 1E8YA 4F8CB 4OVUA 4MELA 4MJSB 4IM3A 3MJWA 4II2B 2ZCCA 1UELA 1V81A 1T0YA 4LJPB 2IYDB 3IHPC 3L54A 2O2VB 2EMTA 2FUHB 2MBEA 2PE9A 2G4SA 1YX5B 2RPQA 5DCNA 2JUOA 2KTFA 2WYQA 3A9JB 4ICUA 3CSTA 1OTRB 3GZNI 5GMVA 1GG3A 2KMAA 5E6PA 2V1YA 3DPDA 3NZUA 2L0TA 4HDQA 4ASWC 1F9JA 1WR6E 2LGDA 5DPRA 2KXJA 3DCGA 2MQJA 1EF1A 1WFYA 2KLCA 3AULA 2LGYA 2MRPA 4TUUA 5AZGA 3VHTC 3L17A 4MGKE 5CX3A 5C23A 3VTUA 4IM2A 3PRZA 5D7GA 4I6LB 3H1UA 2KDBA 1IYFA 3DOWA 3ZRFA 3QJZA 3N30A 2I1JA 2ZEQA 4G50A 2L05A 3PV1A 4KSLC 2O6VB 2LASA 2KKCA 3H7SA 1WXAA 2LVQA 1I42A 3DBSA 2N1VA 3HK0A 3PHWB 3VUWA 1L2NA 1Q0WB 4ICVA 3ONSA 3APCA 3RULA 3UIOB 2N9EB 2QHOA 4DHJB 1E5WA 4M0WB 4ANXA 4EFOA 3MTNB 3ZW3A 3ZDMC 3VTWA 2J7QB 1WZ0A 4GDLA 2LUEA 3PPAA 3UQAA 4EUTA 2Z59B 1WI0A 3L16A 3V61A 2DZIA 2ZPNA 1X1MA 3B08A 1P1AA 2PE6B 3V60A 2D2QA 3ZUNA 1UZXB 1S3SG 2D3GA 4IWOA 3V6CB 2ZJDA 2BPSA 3RT3B 1ISNA 4PS3A 4KDLB 4A3OA 2L00B 2RR9A 3U7DA 3A1QA 2AWTA 5D94A 2DAJA 3QHTA 2FCMA 4W9CA 1U4AA 1WE7A 1KM7A 1M94A 3L10B 3NHEB 3VUYA 2ZPYA 1WXMA 3H7PB 3HM6X 2N9XA 2V3SA 4NAWB 2ZNVB 3SHQA 3W1SC 4MGIE 3KH0A 4GGQA 3QC8B 4ZDVA 3PRPB 4HJKA 3R3MA 1WXVA 4X57B 2YVCA 1R4MI 3JW0X 2IBIB 3PVLA 3HHMA 3ENEA 4WJQA 3EECA 1VD2A 4TV3A 2J0JA 4WAAA 2R2QA 2MX2A 1JRUA 3ZIMA 4BFRA 3RUIB 4MGZE 2LRUA 2MP2A 4G3XB 2KHWB 3PLUA 4GDKA 5DPWA 1WGHA 4IW0A 4KZCA 4MSMB 4GMVA 3KYDD 2JZ3B 1UBQA 1WX7A 2LI5A 4HWIB 2GBKA 4F1SA 2J0KA 2RGFA 1EF5A 3ALBA 4GIVA 4KV2A 2KANA 3LDZE 5JHAA 3PS6A 2JY6A 2M1MA 1BT0A 3PHXB 4WWOA 4DHZB 1E7VA 4URKA 5J2RA 4EZLA 2M4NA 1GJZA 3T8MA 2K8BA 1H8CA 2WX1A 3O65B 2KNBA 3APDA 2MWSB 3QA8A 1H4RA 2KOXA 2RSUA 3JSVA 2ZVOA 5E6OA 3A9KB 3WIMA 4BKSD 1J8CA 1OEYJ 3AU5A 2XEWA 4RMAA 2HTHA 4IC7B 3ECIA 2LXCA 2FIDA 2B3AA 1RFAA 1WR1A 4OVVA 2JRHA 3DVGY 4WJOA 1C1YB 1WF9A 1WM3A 5IAAC 3IBEA 2JVCA 3DQVA 3SD5A 3RD2A 3AI5A 1UGMA 2LVOA 3NY5A 3M95A 4W9KA 5C1ZA 1WX9A 3JVZX 3QCAA 3ZNGC 1WY8A 2ZNVC 5IA7A 2UYZB 3TL5A 1WYWB 2CKHB 1LFDA 2C5LC 1KJTA 2OJRA 2ZZPB 2NPTB 1WMHA 3TMPB 1G6JA 2EMSA 3P2BA 2DZJA 3ZRCA 3N3KB 1Q1OA 3UGBB 4NNJB 3ZTCA 5KHOA 2JWZA 2MBOA 4JIOU 2DYMA 4FHJA 4MH0E 1RLFA 3ZNHB 4AP4C 2KJHB 4CYEA
chains in the Genus database with same CATH superfamily
2PW9A 2DZMA 4B95A 1WXSA 1NENB 4P6VF 2UU7A 1HXYD 2C60A 2HE7A 1I4XA 1HQRD 1M4VA 3D32A 3AE2B 2KFKA 2G4DB 3R66C 4FADA 4IWQA 4MJSA 3IT6B 4MSQB 4US9A 1E7UA 3AECB 1P7EA 4R3DA 2XK5B 2ZCBA 3NVVA 4LCDE 3Q69A 2GMIC 2UWQA 4K1RB 1J8CA 1PGXA 1J19A 5CHWA 3GZNB 4KDIC 1PQSA 3AEFB 2CS4A 5E6NA 1XD3B 3AEDB 1MVKA 1HEZE 5AUKA 1D6EC 1P9DU 4C7ZA 2O6VA 4A90A 1K52A 1FXIA 5HG2A 3R7RA 3QAQA 4PYZA 4RFBA 1ZPSA 3BINA 2BYEA 3ZTDA 4XX5A 2LJIA 2VZKD 3BIID 1IPGA 4K81A 4J6IA 3RFZB 1SE4A 1C78A 2LGSA 1K53A 1IGCA 3AEAB 2RDGA 4P16A 4KVGB 2KVRA 3B2FA 2C9WB 3IG3A 2MJEA 3SDLC 2FAZA 3X0WA 5T8IA 3NVYA 3ZDTA 1I4PA 1N6ZA 4WIPA 2KLGA 2KJRA 1QT9A 2Y3AA 2KJ6A 2JXXA 1NDDA 1JW9D 1ROEA 2V3PA 3VQIA 5TSSA 2DHZA 1XLNA 3N1YC 1N5XA 3ZXRA 5CHVC 2BYFA 2OOBB 3KW5B 4W9HA 3RNBC 2W54A 5BYSA 2JU6X 2BS4B 1WE6A 4JWSC 4DK5A 2A4ZA 5IOIA 5J17A 1FRRA 3Q2AC 4RM9A 2BT6A 3APFA 2WDQB 4HPLB 2WX0A 2NBUA 1KH0A 2M8SA 1ZGUB 1HE8A 4FULA 2W3SA 5D6JB 4TMAB 4NPNA 1CJEA 3AE1B 1R4NB 4YTNB 1WRDB 5EE0A 2BB5A 2SAKA 4ZRKA 3QX1A 1UF0A 4KSKC 2D3AA 2NPTA 3UINB 2BVCA 3GOEA 2NS5A 4HDOA 1N62A 4HLEA 2MCNB 3TIXA 2WDVB 4FA6A 2ACZB 2MLBA 2NMQA 4W9JA 3ZYYX 1K8RB 2L32A 2IDYA 2MP2B 4GDKB 5LLIA 3QK0A 5AZHA 5FK9C 4HCNB 3NOBA 4IDIA 1FRDA 2XBBC 3GP7A 4FLHA 3UIPB 5JH5C 4DWFA 1LXDA 4L1BA 1NI2A 2FIFA 2NVUI 2DBYA 5BO4B 2O6VD 3WAPA 2N7EA 2JZPA 4B6WA 4I6NB 1C77A 1JWBD 1PGBA 3JYUA 3NZ3A 3RNAC 1RM6C 2IGDA 1TBEA 1C4PA 4OZBA 4WQOB 1C76A 3EFCA 2IGGA 1F2RI 2LGXA 3M3JA 4BKTA 2BWES 2MJ3A 1JMLA 3Q8AA 3RZFA 4AJWA 3IT4B 3U4EG 2BB6A 2ON8A 1D5ZC 1SE9A 3I3TB 3CIRB 4PS7A 1YX6B 4JLCA 3C0RB 3NVZA 1E9MA 4KX6B 3AE9B 4G11A 1P0RA 4KIKA 1I4GA 5CHFA 2GB1A 2N1WA 4BZAA 4KGTA 1YQBA 4M8MA 5AEKB 2K39A 3C8YA 1NBFC 3K9OB 1XCTL 3DBLB 4MM3B 4A20A 3P63A 3RN9C 1TTNA 4HKZE 1E8YA 4F8CB 2WXOA 4MELA 2PLPA 4IM3A 2ZCCA 1JROA 1UELA 2OHFA 3L54A 2O2VB 2EMTA 4GLSC 2XN9C 1YX5B 2X38A 1CK1A 2N9KA 5G5GA 1C4AA 2JUOA 3A9JB 5GMVA 3GZNI 5C3JB 1N5WA 2LGDA 5DPRA 2WU5B 2MHJA 2MQJA 1EF1A 5AZGA 4TUUA 3PRZA 1GOZA 1WWTA 1YN3A 1IYFA 1UUPA 3N30A 3ZQ4A 2L05A 4K3BA 2WXPA 2LVQA 3VUWA 1L2NA 3ONSA 3APCA 1V1OA 2PKOA 3MTNB 3VTWA 1WZ0A 2WXIA 4OW0A 2Z59B 1WI0A 3DWMA 2DZIA 1DOYA 2BBCA 1P1AA 2PE6B 3AE7B 2MJDA 4IWOA 3I5JC 3V6CB 2DNFA 1ISNA 3E9SA 4A3OA 3P42A 2DAJA 3QHTA 1WE7A 1KM7A 3L10B 1TY2A 2ZPYA 1FNWA 4HJKA 1PFDA 3R3MA 3ABVB 1SIJA 1MHHE 2M0AA 1FCCC 1HZ6A 3ENEA 1CQVA 2R2QA 1JRUA 1ET9A 4PT5A 2K3UA 3Q8CA 2LRUA 1ZOYB 1WGHA 4IW0A 4KZCA 4GMVA 3ZJUA 1WX7A 2LI5A 1JWUD 4F1SA 2J0KA 2RGFA 1XF5L 3PZ8A 5JHAA 2FUG1 1BT0A 4URKA 1E7VA 4EZLA 1YJJA 4YSZB 2K8BA 1H8CA 3VR8B 3APDA 1H4RA 4C56C 1SJED 1BXTA 2W55A 3JSVA 3WIMA 2XEWA 3ECIA 2FIDA 2JRHA 2Q5WD 3AE3B 1C1YB 2KMMA 4KKJA 5IAAC 3IBEA 3RD2A 3AI5A 1VZ8A 3M95A 3UI3A 4YT0B 1E6EB 1WY8A 2ZNVC 3MC8A 3TL5A 2C5LC 4KGRA 2M19A 2L83A 2OJRA 1WMHA 2INNE 3DHHC 4AS1A 1TS3A 3ZRCA 3N3KB 2LUMA 4NNJB 2JWZA 1Y56A 1XXGA 4CYEA 4I6PA 5HI1A 3W2DA 1JCKB 1QLBB 2LJ5A 2IO3B 1FFUA 2KWCA 2C7NB 3MC0B 3FILB 1YOVB 5JZEB 4FBJB 1CMXB 2D11A 3NVWA 1L0XB 1MHXA 3VH4B 3TEZA 1KOTA 1Y8RC 3WANA 2BTEA 4MGYE 2K6QA 3RMKC 2JXTA 4N6EB 4LJOB 3NS1A 1V86A 4FJVB 2Y5CA 3UF8A 5JHBA 1WJ6A 4YTPB 1Q5WB 1UD7A 2N0SB 2K6DB 4YL8A 3U30A 4XZ4A 3RNEC 2WXJA 4IKGA 4NJ6A 1OEYA 2B76B 4RCOA 2R61A 1QKZA 1F2RC 4K7UA 3V6EB 3ML9A 4MT5A 4ARCA 3A4SC 2QMTA 3BYYB 3GS2A 3ZVVA 4ANVA 2KZRA 1L5PA 2D3BA 5BMHA 2HD5B 3DBLI 2V3NA 4DXAB 4M00A 2INDC 4DQOC 3HRDD 3PGEA 5J18A 3OLMD 2KDEB 4DXGA 5KHQA 2KMCA 5HHDG 4LNOA 2KFJA 2WXMA 4NAWA 2E6XA 2FCQA 1YD8U 3Q3FA 1E90A 2LMCA 3LXFA 2DAFA 4ANUA 4BOZB 2N7JA 4XE0A 1TS2A 2JF5A 1OGWA 4KKIA 4IUMB 2INPE 3WAMA 1ZDXA 3NS8A 1UBIA 4YSYB 2D5GA 4JPSA 2LFIA 5HFYA 3HUIA 3OJ4B 3ZLZA 1LQBA 3CSFA 3EHVA 3BVZA 2WXQA 4HXDA 2K9XA 1Z5SB 5IKCM 2CU1A 1FCLA 3MFGA 4K7SA 1VRAB 2MBHA 2LVPA 2JRIB 4LDTD 1IUEA 1QZEA 1XO3A 1FNVA 4FHKA 4A3PA 2EKEC 2WXHA 1AARA 3MHSD 2E3TA 1B1ZA 4EEWA 1GNUA 4BOSC 2K25A 3GE8C 3FAHA 3BZDB 3HIZA 1MFWA 3M63B 2YEPB 4GOCA 4N9F4 3U8ZA 2WHIA 3KYCD 2L76A 2ONQA 2PJHA 4E71A 2MW5A 4LNFA 2DLBA 4CHKA 4NQKE 4LNIA 1QOFA 4HRSA 2LEKA 4KZ0A 2SEBD 4FJZA 1I4HA 1E8WA 1L0VB 4B9KA 1FPYA 1J7BA 2KDMA 4NAMA 3VR9B 2NCNA 2H88B 2IO0B 4KGSA 1L7YA 2GBNA 4DDID 2IGHA 4HVBA 1TIFA 4WJNA 1K51A 2XK5A 1V6EA 2YLMA 3FC4A 3SEBA 2BYVE 3BVGA 2G9HD 1LO5D 3KWVA 3Q8BA 4WWPA 2MSED 2JPHA 3H9DA 2CJNA 3KUZA 4OVZA 3ZKJC 1V1PB 3L13A 2D07B 1GUAB 4XWWA 2HTME 4BKGA 2VH2A 2JYEA 3T3OA 5DPTA 2BWFA 2CR5A 1JALA 1HTQA 2YEPF 1WH3A 1XCQL 3A33B 5D2MB 1V49A 2LHDA 4FN2A 5D3IB 3WAOA 2IPKD 2W9NA 4JL9A 4ZRPA 1JWAD 2ZVNA 1WGRA 4CQNA 4ZHOA 2KC2A 3W9CB 3RNGC 3Q3JA 1SGHA 2FCNA 1SE2A 2N7DA 1ACCA 3AE6B 1TGZB 2IY0B 2V0GA 4JWUC 1V81A 4LJPB 4XYCA 4HPPA 1B9RA 2WYQA 1V8CA 3C19A 1XLPA 2KMAA 1IBXB 1ET6A 2V1YA 3DPDA 4HDQA 1F9JA 1YNTE 1WR6E 3URYA 2KLCA 2D3CA 4BAXA 1QOGA 4MGKE 5CX3A 2RDBC 3AB5A 3H1UA 2NTSA 2LHEA 2IJ0A 2I1JA 4NJCA 2ZEQA 4G50A 4KSLC 1FM0D 3H7SA 2KKCA 3DBSA 1Q0WB 4MH8A 1UGJA 4HROA 4A55A 4DHJB 1TT5B 3LYYA 4M0WB 1MJDA 3ZDMC 3V61A 3V60A 1E7PB 2D3GA 2ZJDA 4ITKA 3BVMA 2AWTA 3EA6A 4W9CA 2FCMA 1LGRA 1U4AA 3NHEB 1T6BX 1WXMA 3H7PB 3W1SC 4MGIE 5JXVA 3DBHB 4ZDVA 1SBBB 2RPVA 3AE4B 1WXVA 4X57B 5H8YE 2YVCA 3N9YC 1R4MI 3HHMA 1VD2A 4WAAA 2WXNA 2MX2A 4QAYA 3ZIMA 4BFRA 3RUIB 1EWYC 1NYQA 2MP2A 4GDKA 1NYRA 5DPWA 1UBQA 3SFEB 4REZA 1EF5A 2JYTA 3OG5A 2KANA 2JY6A 2M1MA 3PHXB 4WWOA 5J2RA 2M4NA 2J4XA 2WX1A 1PUTA 4MACA 2RSUA 1T3QA 3HVDA 2INCC 3A9KB 2HTHA 3GE3C 2LXCA 2B3AA 1HTOA 1WR1A 4OVVA 4WJOA 4Q2JA 1WM3A 3PZ7A 2JVCA 3SD5A 4C7YA 2LVOA 3NY5A 1ZP0B 1SF0A 3ZNGC 2UYZB 2V4IB 2CKHB 1NEKB 4XWTA 4OHJA 1IGDA 1L6UA 2PVGC 3P2BA 2WU2B 3LB8C 3UGBB 5KHOA 2WXRA 1FFVA 2DYMA 3AEEB 3ZNHB 4AP4C 4BVUC 1WSPA 1FXTB 3AH7A 4GSWA 4P1BC 1KFYB 1AN8A 1OQYA 4MM3A 1ZXIA 4EZJA 2R2OA 3R7QA 1HA5A 2DZKA 2KTRB 1T0SC 3A4RA 2JT4B 3AE8B 4OZAA 2O2VA 4O1NA 4NJ7A 2I1KA 3VDZA 2WP9B 3SU8X 3A9JA 3I63C 1TJEA 3I57A 3W1SA 3KLSX 3J9CA 1N61A 1D3ZA 2ZW0A 2GBRA 1RAXA 3TEXA 2L1AA 3KUCB 5EDSA 3VVWB 3PREA 2FBWB 2KACA 2G1EA 4H2AA 4P1CC 2WLBA 4DDGD 3PT2B 2PMVA 2DYBA 2AEHA 1XT9B 1F0ZA 2KAJA 4ZOHC 1V5OA 2DX5B 1WGGA 1ZE3D 2LGIA 4WURA 2EELA 4TQ1A 4AOFA 2DYOA 1J7AA 1I4QA 3Q8FA 3WCQA 2LRWA 2LZ6A 3NRZA 2QILA 1QF6A 1SSNA 3Q3NC 2OJWA 1MG8A 1WJ4A 2ICIA 2Z0EB 2N9PC 2AL6A 4B0EA 3TSSA 2V4LA 4NQLB 2K5PA 2C7HA 5L95C 2VRRB 2LXAA 2L7RA 2AQ2B 1RRBA 2C7MB 3B0AA 2KO3A 3BY4B 2L3ZA 4W9DA 1R4NI 2K8CA 1WM2A 1GAQB 2HDEA 3R2IA 5AZFA 4D2KA 2KX3A 4TQ0A 5MPOA 3PO0A 3N1ZC 3MP9A 3RPFC 1EU4A 1SEBD 2I38A 5FR3A 4RF0A 1P3QU 3V05A 4M8NA 3TJPA 3M62B 3EC8A 4WH4A 5E6JA 4ZRJA 3P4QB 1JRPA 4USAA 2IY1B 2BS2B 2WWZA 3OJ3A 4K7WA 4LNKA 1DOIA 2WXFA 3LJ3A 1DYQA 4F7ZA 4EZKA 2L0FA 4GDLB 2NBVB 1SB3C 3RI7C 3VAWA 1DGJA 1P98A 1SXTA 3IVFA 3U52E 1NI3A 1KTKA 3DBHI 3KQ4A 3A1QB 1QILA 2PEAA 1UWXA 4C4VB 1QOBA 1YN4A 2MBQA 2MEKA 1YJ1A 2PVOD 3KUDB 4EOYA 1UH6A 2QJLA 1DOXA 2VZKB 1WX8A 4ZHPA 2GBMA 1FD6A 4TKNA 1VR9A 3DDCB 4BBNF 3FILA 5LXHA 5DPSA 1XLOA 3RNCC 3AV8A 3O13A 2KK8A 2X8XX 5G55A 1LM8B 3CMMB 4M01A 1VDVA 1RFKA 3VH3B 1V9JA 2MBBB 3VFKA 2CHXA 4IG7B 4B0MA 3EGRA 3ZO5B 2AQ1B 3BYTB 3AXCA 4RGNA 4C00A 5G2NA 4WQMA 4ANWA 4ZYNA 2FCSA 2KD0A 3IXSA 2K1FA 1P7FA 2KN4A 3N20C 2TSSA 1V80A 4W9IA 2KWDA 1VCBA 3BK1A 2WXGA 2G45B 2RD0A 3AN1A 4BKSA 3U2SC 3ZNID 1I7HA 1EUVB 4N59A 3PRMB 3DVNV 3B2GA 4GN1A 1BMLC 3QIJA 2GBJA 1BUIC 1I4RA 1OQQA 2IO1B 3E56A 4II3B 3VXWA 3H6NA 2D10A 2KFKB 3OWEB 4MJSB 4J3OD 4II2B 1QOAA 1KLGD 1JWMD 2EKIA 1T0YA 1E10A 2IYDB 4N58A 2FUHB 2G4SA 2RPQA 4LTUA 2KTFA 2CU3A 1GG3A 2J42A 5E6PA 1WYGA 1Q10A 2L0TA 1EWCA 4ASWC 2QC8A 1UWMA 4TSSA 1FO4A 2KXJA 1MG4A 3DCGA 1WFYA 3AULA 3FKYA 3MHZA 3ETRA 3VHTC 4S0RA 1L0YB 4IM2A 1RYJA 1C4CA 3P4SB 1YMHE 3DOWA 1T5XD 3QJZA 3DBRB 3AEBB 3PV1A 2O6VB 2LASA 4A8XC 2RMMA 4RGMA 1I42A 3HK0A 1RWSA 3PHWB 3ZJTA 4ICVA 3RULA 3EUB2 3UIOB 1TKGA 3SR6A 1E5WA 1VJKA 3BWUD 4ANXA 4EFOA 2J7QB 1EU3A 3PPAA 4EUTA 3AMZA 3L16A 2ZPNA 2D2QA 3ZUNA 1UZXB 1GPXA 3RT3B 2J53A 4PS3A 2RR9A 3HVZA 4K3CA 3VUYA 1STEA 2V3SA 3AEGB 4RNAA 3NJTA 4ZRQA 4ZYSA 2K22A 3QC8B 3PRPB 4M02A 5IP4D 1QQRA 1E0ZA 4WJQA 3EECA 4TV3A 2HJ1A 5BMIA 1GB1A 2KYWA 2JZ3B 4YSXB 1A70A 1K50A 3ZJVA 4HEA1 1ENFA 2WXKA 3PS6A 1GJZA 4A9AA 3O65B 2KNBA 3MC9A 1MI0A 2KOXA 4PK1A 2ZVOA 5E6OA 4BKSD 1D4BA 4RMAA 2BQQA 3R2TA 1RFAA 1V1PA 2QIEB 4AQ7A 1AWDA 4JE3B 3N1XC 3U7ZA 1VZ6A 2KVZA 3W5VB 1AW7A 5BYRA 1KJTA 2L52A 2ZZPB 2NPTB 1G6JA 2EMSA 1JQ4A 3P4RB 4RGOS 1WRIA 4JIOU 3Q8EA 2DWQA 1RLFA 4JGHB 4A6QA 1J7CA 4W9EA 4PYUA 2J0MA 2N4FA 2N9LA 4LLGM 2RDHA 3T9LA 5LXIB 3QQ8B 3B1LX 3SFDB 2AQ3B 2WS3B 4GU2A 5TR5A 4W9LA 1A5RA 2KC1A 3N32A 3DVGX 2HJ8A 3QARA 4DBGA 2VH1A 3ZXVA 2KDFB 4ARIA 1E8ZA 1KLVA 3V3XA 1IBXA 4HCPB 1TZ1A 2G3QB 2AYOB 2KWUB 2BKRB 3EFUA 2A5UA 4S17A 3RYTA 3H8HA 1GC6A 2Z0DB 1OFFA 1F77A 4AJYB 1ZKHA 1V97A 4E74A 4FJYA 1KRHA 2KDIA 4WJPA 3W5UB 1FIQA 3VUXA 1R7SA 1N63A 3DVNU 3IFWB 3S2AA 5HKHA 3KVFB 2NR2A 3PSEB 4G0NB 3L0WB 1I35A 2M56B 2ASQA 4M0WA 3V62A 1PYWD 3ML8A 3TBLD 1UNSA 1ZW7A 3VTVA 3WALA 2QEJC 2K8HA 1L6VA 2PPHA 4JX1C 1TS4A 4KIKB 3RCZA 1CZPA 3KWLA 2QSDA 1XQQA 2KWVB 3UQBA 1Z2MA 4GB9A 1WGDA 2Y5PA 3Q6BA 2BF8B 3H7PA 4RM8A 1WIAA 1YJIA 4FXCA 3RZWC 2FE8A 2JZZA 1WJNA 3K9PB 4YWGG 3W1YA 2CHZA 2L8JA 3IAS1 4MDKE 1IP9A 3TEWA 2M0XA 3L4PA 5I4DA 4JQWC 2LD9A 3DBRI 1WZ3A 4RF1A 1ESFA 3TEYA 4AWJA 4EE2A 5EE3A 2BW2A 4WAFA 2PTLA 3PLVA 4PS8A 2CHWA 4W9GA 1GC7A 3T3NA 1T0QC 2NBWB 1D5MC 1E8XA 4DHZE 1L4ZB 3GB1A 4AUQC 1WXQA 2QCZA 5CTRC 4IOIE 3A9KA 1EO6A 1ZXHA 4XDDA 1XEEA 1YIWA 4CO7A 1FNUA 2PIAA 2IO2B 2KX0A 3ZGZA 2WXLA 5C2TB 1WJUA 3AU4A 3NZSA 2BGFA 3QWZB 1SJHD 3X23A 4ZRIA 1TY0A 4LK0M 1F52A 2BS3B 2JWUA 3NUHB 2DENB 3B9JA 4XDCA 1S1QB 1PDXA 4BBNC 2FNJB 1OQRA 5H92C 1SIFA 2REXA 3AE5B 1WGKA 1TKEA 3I9V1 4RH6A 4IWPA 3OAWA 5BMGA 2JSVX 2MA9B 2KTRA 2KN5A 3VRAB 5G5HA 1T0RC 3PZDA 2WNMA 3WA0A 3CWIA 4DXFA 1J0GA 3RNFC 2WGSA 3JSVB 2LWPA 4DHJD 4C80A 4XC2A 5D3DA 1TS5A 4IM0A 4W9FA 4WWNA 3PTFC 1MPEA 5L83A 4EKUA 2WQYB 1WGYA 2IZVB 5EE9A 1V2YA 2Y5BB 1YN5A 2WDTB 3ZNZB 5FR6A 2GOWA 4HK2A 4YTMB 2CJOA 3L08A 3CF6E 2H89B 3P4PB 4P7IA 4NY0A 4WWMA 4LDTB 1WMHB 4HPMB 5IN7A 2AL3A 4GXBA 1FMAD 4MEMA 1PGAA 2KQ7A 1V5TA 3DHIC 3HM3A 2BKFA 3TCAA 4E3CA 1C3TA 2KQSA 5LNK1 5BYQA 5GXGB 2BYTA 1C79A 3VRBB 3P1MA 3Q3OC 3DWGC 2M17A 4OVUA 1GB4A 3MJWA 1KLUD 1TYGB 2W82A 3IHPC 2MBEA 2PE9A 5DCNA 4OZCA 4ICUA 3CSTA 1OTRB 3NZUA 1VZ7A 1C9FA 3BK2A 4L23A 2AX5A 2J52A 2V9HA 3IAM1 3NG0A 2LGYA 2MRPA 3L17A 5C23A 3VTUA 2NTTA 5D7GA 4I6LB 2KDBA 3ZRFA 1N60A 4RGTA 1WXAA 2N1VA 2GRIA 1XLQA 1TZOA 4LNNA 2N9EB 2QHOA 3ZW3A 4GDLA 2GLSA 2LUEA 2GI9A 1VLBA 3UQAA 3Q3MC 5AUIA 1X1MA 3B08A 4L2YA 1S3SG 2JQRB 2BPSA 1EM7A 2WDRB 1F1HA 4KDLB 2L00B 3U7DA 3A1QA 5D94A 3MJ5A 1M94A 2ZW1A 4ACFA 3HM6X 2N9XA 4NAWB 2ZNVB 3SHQA 3KH0A 4GGQA 2KT7A 1ZUD2 5IO9A 4C4VA 1ZDVA 1L4DB 1KF6B 3JW0X 2IBIB 3PVLA 2J0JA 3AM9A 4MGZE 4G3XB 2KHWB 3PLUA 5FKAC 3TUOA 4MSMB 2MH7A 3KYDD 4HWIB 2GBKA 3ALBA 4XGAB 4GIVA 2JX5A 4KV2A 4NZLB 3LDZE 3Q14C 1D5XC 1FEHA 4DHZB 3T8MA 2XNAC 1FXAA 2I2YA 1YQ4B 2MWSB 3QA8A 1HZ5A 1OEYJ 3AU5A 2W3RA 4IC7B 1SE3A 1JWSD 3DVGY 4YXDB 5EE1A 1WF9A 4HKQA 2QDFA 4UDUC 3DQVA 1UGMA 4US8A 4W9KA 5C1ZA 1WX9A 3JVZX 3QCAA 1R4MB 4HJGE 5IA7A 1YQ3B 3DHGC 1WYWB 2KQ4X 1LFDA 2K0PA 1TKYA 1AYFA 1NVID 2Z8LA 3TMPB 2DZJA 2OEDA 1Q1OA 3ZTCA 3R8BA 2MBOA 4FHJA 4MH0E 2KJHB
chains in the Genus database with same CATH topology
4JGHB 4BVUC 4I6PA 2DZMA 4PYUA 4W9EA 4B95A 2J0MA 1FXTB 2N4FA 3T9LA 2LJ5A 1WXSA 2IO3B 5LXIB 4GSWA 3QQ8B 2KWCA 3B1LX 1OQYA 2C7NB 2C60A 4MM3A 2HE7A 5JZEB 4GU2A 5TR5A 4FBJB 1CMXB 4W9LA 2D11A 4EZJA 1A5RA 3D32A 2R2OA 2KC1A 3R7QA 3N32A 2KFKA 2G4DB 3VH4B 2DZKA 3DVGX 3R66C 2HJ8A 2KTRB 4IWQA 4MJSA 4FADA 3A4RA 2JT4B 1KOTA 4MSQB 3QARA 1Y8RC 3WANA 4DBGA 4MGYE 2K6QA 1E7UA 2O2VA 4NJ7A 2I1KA 2KDFB 3VDZA 3SU8X 3A9JA 3W1SA 1E8ZA 2XK5B 2ZCBA 1KLVA 4LJOB 1D3ZA 2GBRA 1V86A 4FJVB 4LCDE 1RAXA 2GMIC 2UWQA 3KUCB 4HCPB 1TZ1A 5EDSA 2G3QB 2AYOB 2KWUB 3PREA 4K1RB 2BKRB 3UF8A 3VVWB 5JHBA 1WJ6A 3EFUA 2A5UA 1Q5WB 1J19A 5CHWA 3RYTA 1GC6A 1UD7A 2Z0DB 4KDIC 1PQSA 2K6DB 4AJYB 4YL8A 3U30A 2CS4A 4DDGD 3PT2B 5E6NA 1XD3B 1ZKHA 4XZ4A 4NJ6A 4E74A 1OEYA 2AEHA 1XT9B 2DYBA 4FJYA 1P9DU 1V5OA 2KDIA 2O6VA 2DX5B 1WGGA 4WJPA 4K7UA 3VUXA 3DVNU 3IFWB 3S2AA 3R7RA 3ML9A 3QAQA 4TQ1A 4PYZA 3V6EB 4AOFA 2DYOA 3KVFB 5HKHA 2NR2A 3PSEB 3BINA 3A4SC 3L0WB 4G0NB 1I35A 2LRWA 2ASQA 3V62A 2BYEA 2LZ6A 3ZVVA 4ANVA 2KZRA 3ZTDA 3ML8A 3TBLD 1ZW7A 3VTVA 2HD5B 3DBLI 4DXAB 3WALA 1MG8A 1WJ4A 2Z0EB 2K8HA 2N9PC 4XX5A 2AL6A 2PPHA 2V4LA 4NQLB 4KIKB 2C7HA 3PGEA 5J18A 3RCZA 1IPGA 3OLMD 4K81A 4J6IA 2KDEB 5L95C 2VRRB 2LXAA 1XQQA 2L7RA 2KWVB 5KHQA 3UQBA 1RRBA 1Z2MA 4GB9A 1WGDA 2BF8B 2KMCA 2C7MB 4KVGB 3H7PA 3B0AA 4RM8A 2KFJA 2KO3A 1WIAA 4NAWA 2FCQA 2KVRA 2C9WB 1YD8U 3IG3A 1E90A 2L3ZA 3BY4B 3Q3FA 3RZWC 3SDLC 4W9DA 2FAZA 2JZZA 1WJNA 3K9PB 3W1YA 3X0WA 2DAFA 2CHZA 4ANUA 1R4NI 2K8CA 3ZDTA 4BOZB 1WM2A 2L8JA 4MDKE 2JF5A 1OGWA 1IP9A 2KLGA 2KJRA 5AZFA 4IUMB 3WAMA 2KJ6A 2JXXA 1NDDA 2KX3A 2M0XA 3NS8A 1UBIA 3VQIA 4TQ0A 4JQWC 2DHZA 2LD9A 3DBRI 5CHVC 1WZ3A 2BYFA 2OOBB 3KW5B 4AWJA 4W9HA 1P3QU 4M8NA 3TJPA 3PLVA 4PS8A 3OJ4B 3M62B 3ZLZA 1LQBA 2CHWA 3CSFA 3EC8A 3EHVA 1GC7A 4W9GA 4ZRJA 1WE6A 2NBWB 4HXDA 1Z5SB 4DK5A 2A4ZA 1E8XA 4DHZE 5J17A 2CU1A 4K7SA 2IY1B 2WWZA 3OJ3A 4AUQC 4K7WA 4RM9A 5CTRC 2MBHA 2LVPA 2JRIB 3APFA 4LDTD 3LJ3A 3A9KA 1QZEA 1EO6A 2WX0A 4HPLB 2NBUA 4FHKA 4EZKA 4F7ZA 4A3PA 2L0FA 2EKEC 4GDLB 2NBVB 1AARA 2M8SA 1ZGUB 1YIWA 3MHSD 4CO7A 3VAWA 1HE8A 1P98A 4FULA 2IO2B 3IVFA 5D6JB 2KX0A 4EEWA 1GNUA 4NPNA 1WJUA 4BOSC 3AU4A 3NZSA 2BGFA 3QWZB 3DBHI 2K25A 1WRDB 3X23A 3HIZA 4ZRKA 3A1QB 4ZRIA 3QX1A 4KSKC 3M63B 2NPTA 3UINB 4GOCA 2PEAA 3GOEA 2NS5A 4N9F4 3U8ZA 3KYCD 4HDOA 2L76A 2PJHA 4E71A 2DENB 2MW5A 4CHKA 2MCNB 4HLEA 4NQKE 2MBQA 1YJ1A 3KUDB 3TIXA 4FA6A 4EOYA 2MLBA 1UH6A 4KZ0A 4W9JA 1S1QB 4FJZA 1WX8A 4BBNC 2FNJB 2GBMA 1K8RB 4TKNA 1SIFA 2REXA 3DDCB 4BBNF 2MP2B 4GDKB 5LLIA 5LXHA 1E8WA 3QK0A 5DPSA 5AZHA 4B9KA 4IWPA 3OAWA 4HCNB 3NOBA 2NCNA 2KK8A 2MA9B 2IO0B 5G55A 1LM8B 2KN5A 2KTRA 3CMMB 2XBBC 4FLHA 3UIPB 5JH5C 4DWFA 1L7YA 2GBNA 3PZDA 3VH3B 4DDID 1LXDA 1V9JA 2MBBB 3VFKA 1NI2A 2FIFA 2CHXA 2NVUI 3WA0A 4IG7B 3ZO5B 4HVBA 4WJNA 5BO4B 1J0GA 2O6VD 2XK5A 1V6EA 2YLMA 3WAPA 2BYVE 2N7EA 4B6WA 4I6NB 3AXCA 3JSVB 2LWPA 4WWPA 4DHJD 3JYUA 4XC2A 2MSED 5G2NA 4IM0A 2JPHA 3H9DA 3KUZA 4W9FA 4WWNA 4ANWA 3PTFC 4ZYNA 3L13A 3ZKJC 2FCSA 2D07B 2KD0A 5L83A 4EKUA 1GUAB 2K1FA 1WGYA 1TBEA 4BKGA 2IZVB 1V2YA 2Y5BB 2WDTB 5DPTA 4WQOB 1V80A 3ZNZB 4W9IA 5FR6A 2BWFA 1VCBA 2CR5A 2GOWA 4HK2A 2G45B 2RD0A 2LGXA 3M3JA 3L08A 1WH3A 3CF6E 3A33B 5D2MB 4BKTA 4P7IA 1V49A 2BWES 4NY0A 3RZFA 4LDTB 4AJWA 1WMHB 4HPMB 4BKSA 2AL3A 4FN2A 4GXBA 3ZNID 4MEMA 1EUVB 2KQ7A 1V5TA 3PRMB 3WAOA 1SE9A 3I3TB 3HM3A 4PS7A 1YX6B 2W9NA 3C0RB 3DVNV 4JL9A 4JLCA 4GN1A 2BKFA 3TCAA 2ZVNA 1WGRA 4E3CA 3QIJA 4G11A 1P0RA 1C3TA 2GBJA 2KQSA 4KIKA 5CHFA 2N1WA 1YQBA 4M8MA 5AEKB 2K39A 2KC2A 1NBFC 3K9OB 3Q3JA 2IO1B 4A20A 1SGHA 2FCNA 4II3B 1TTNA 2N7DA 2M17A 3VXWA 3H6NA 1TGZB 2D10A 2IY0B 2KFKB 1E8YA 4F8CB 4OVUA 4MELA 4MJSB 4IM3A 3MJWA 4II2B 2ZCCA 1UELA 1V81A 1T0YA 4LJPB 2IYDB 3IHPC 3L54A 2O2VB 2EMTA 2FUHB 2MBEA 2PE9A 2G4SA 1YX5B 2RPQA 5DCNA 2JUOA 2KTFA 2WYQA 3A9JB 4ICUA 3CSTA 1OTRB 3GZNI 5GMVA 1GG3A 2KMAA 5E6PA 2V1YA 3DPDA 3NZUA 2L0TA 4HDQA 4ASWC 1F9JA 1WR6E 2LGDA 5DPRA 2KXJA 3DCGA 2MQJA 1EF1A 1WFYA 2KLCA 3AULA 2LGYA 2MRPA 4TUUA 5AZGA 3VHTC 3L17A 4MGKE 5CX3A 5C23A 3VTUA 4IM2A 3PRZA 5D7GA 4I6LB 3H1UA 2KDBA 1IYFA 3DOWA 3ZRFA 3QJZA 3N30A 2I1JA 2ZEQA 4G50A 2L05A 3PV1A 4KSLC 2O6VB 2LASA 2KKCA 3H7SA 1WXAA 2LVQA 1I42A 3DBSA 2N1VA 3HK0A 3PHWB 3VUWA 1L2NA 1Q0WB 4ICVA 3ONSA 3APCA 3RULA 3UIOB 2N9EB 2QHOA 4DHJB 1E5WA 4M0WB 4ANXA 4EFOA 3MTNB 3ZW3A 3ZDMC 3VTWA 2J7QB 1WZ0A 4GDLA 2LUEA 3PPAA 3UQAA 4EUTA 2Z59B 1WI0A 3L16A 3V61A 2DZIA 2ZPNA 1X1MA 3B08A 1P1AA 2PE6B 3V60A 2D2QA 3ZUNA 1UZXB 1S3SG 2D3GA 4IWOA 3V6CB 2ZJDA 2BPSA 3RT3B 1ISNA 4PS3A 4KDLB 4A3OA 2L00B 2RR9A 3U7DA 3A1QA 2AWTA 5D94A 2DAJA 3QHTA 2FCMA 4W9CA 1U4AA 1WE7A 1KM7A 1M94A 3L10B 3NHEB 3VUYA 2ZPYA 1WXMA 3H7PB 3HM6X 2N9XA 2V3SA 4NAWB 2ZNVB 3SHQA 3W1SC 4MGIE 3KH0A 4GGQA 3QC8B 4ZDVA 3PRPB 4HJKA 3R3MA 1WXVA 4X57B 2YVCA 1R4MI 3JW0X 2IBIB 3PVLA 3HHMA 3ENEA 4WJQA 3EECA 1VD2A 4TV3A 2J0JA 4WAAA 2R2QA 2MX2A 1JRUA 3ZIMA 4BFRA 3RUIB 4MGZE 2LRUA 2MP2A 4G3XB 2KHWB 3PLUA 4GDKA 5DPWA 1WGHA 4IW0A 4KZCA 4MSMB 4GMVA 3KYDD 2JZ3B 1UBQA 1WX7A 2LI5A 4HWIB 2GBKA 4F1SA 2J0KA 2RGFA 1EF5A 3ALBA 4GIVA 4KV2A 2KANA 3LDZE 5JHAA 3PS6A 2JY6A 2M1MA 1BT0A 3PHXB 4WWOA 4DHZB 1E7VA 4URKA 5J2RA 4EZLA 2M4NA 1GJZA 3T8MA 2K8BA 1H8CA 2WX1A 3O65B 2KNBA 3APDA 2MWSB 3QA8A 1H4RA 2KOXA 2RSUA 3JSVA 2ZVOA 5E6OA 3A9KB 3WIMA 4BKSD 1J8CA 1OEYJ 3AU5A 2XEWA 4RMAA 2HTHA 4IC7B 3ECIA 2LXCA 2FIDA 2B3AA 1RFAA 1WR1A 4OVVA 2JRHA 3DVGY 4WJOA 1C1YB 1WF9A 1WM3A 5IAAC 3IBEA 2JVCA 3DQVA 3SD5A 3RD2A 3AI5A 1UGMA 2LVOA 3NY5A 3M95A 4W9KA 5C1ZA 1WX9A 3JVZX 3QCAA 3ZNGC 1WY8A 2ZNVC 5IA7A 2UYZB 3TL5A 1WYWB 2CKHB 1LFDA 2C5LC 1KJTA 2OJRA 2ZZPB 2NPTB 1WMHA 3TMPB 1G6JA 2EMSA 3P2BA 2DZJA 3ZRCA 3N3KB 1Q1OA 3UGBB 4NNJB 3ZTCA 5KHOA 2JWZA 2MBOA 4JIOU 2DYMA 4FHJA 4MH0E 1RLFA 3ZNHB 4AP4C 2KJHB 4CYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGH B;  4BVU C;  4I6P A;  2DZM A;  4PYU A;  4W9E A;  4B95 A;  2J0M A;  1FXT B;  2N4F A;  3T9L A;  2LJ5 A;  1WXS A;  2IO3 B;  5LXI B;  4GSW A;  3QQ8 B;  2KWC A;  3B1L X;  1OQY A;  2C7N B;  2C60 A;  4MM3 A;  2HE7 A;  5JZE B;  4GU2 A;  5TR5 A;  4FBJ B;  1CMX B;  4W9L A;  2D11 A;  4EZJ A;  1A5R A;  3D32 A;  2R2O A;  2KC1 A;  3R7Q A;  3N32 A;  2KFK A;  2G4D B;  3VH4 B;  2DZK A;  3DVG X;  3R66 C;  2HJ8 A;  2KTR B;  4IWQ A;  4MJS A;  4FAD A;  3A4R A;  2JT4 B;  1KOT A;  4MSQ B;  3QAR A;  1Y8R C;  3WAN A;  4DBG A;  4MGY E;  2K6Q A;  1E7U A;  2O2V A;  4NJ7 A;  2I1K A;  2KDF B;  3VDZ A;  3SU8 X;  3A9J A;  3W1S A;  1E8Z A;  2XK5 B;  2ZCB A;  1KLV A;  4LJO B;  1D3Z A;  2GBR A;  1V86 A;  4FJV B;  4LCD E;  1RAX A;  2GMI C;  2UWQ A;  3KUC B;  4HCP B;  1TZ1 A;  5EDS A;  2G3Q B;  2AYO B;  2KWU B;  3PRE A;  4K1R B;  2BKR B;  3UF8 A;  3VVW B;  5JHB A;  1WJ6 A;  3EFU A;  2A5U A;  1Q5W B;  1J19 A;  5CHW A;  3RYT A;  1GC6 A;  1UD7 A;  2Z0D B;  4KDI C;  1PQS A;  2K6D B;  4AJY B;  4YL8 A;  3U30 A;  2CS4 A;  4DDG D;  3PT2 B;  5E6N A;  1XD3 B;  1ZKH A;  4XZ4 A;  4NJ6 A;  4E74 A;  1OEY A;  2AEH A;  1XT9 B;  2DYB A;  4FJY A;  1P9D U;  1V5O A;  2KDI A;  2O6V A;  2DX5 B;  1WGG A;  4WJP A;  4K7U A;  3VUX A;  3DVN U;  3IFW B;  3S2A A;  3R7R A;  3ML9 A;  3QAQ A;  4TQ1 A;  4PYZ A;  3V6E B;  4AOF A;  2DYO A;  3KVF B;  5HKH A;  2NR2 A;  3PSE B;  3BIN A;  3A4S C;  3L0W B;  4G0N B;  1I35 A;  2LRW A;  2ASQ A;  3V62 A;  2BYE A;  2LZ6 A;  3ZVV A;  4ANV A;  2KZR A;  3ZTD A;  3ML8 A;  3TBL D;  1ZW7 A;  3VTV A;  2HD5 B;  3DBL I;  4DXA B;  3WAL A;  1MG8 A;  1WJ4 A;  2Z0E B;  2K8H A;  2N9P C;  4XX5 A;  2AL6 A;  2PPH A;  2V4L A;  4NQL B;  4KIK B;  2C7H A;  3PGE A;  5J18 A;  3RCZ A;  1IPG A;  3OLM D;  4K81 A;  4J6I A;  2KDE B;  5L95 C;  2VRR B;  2LXA A;  1XQQ A;  2L7R A;  2KWV B;  5KHQ A;  3UQB A;  1RRB A;  1Z2M A;  4GB9 A;  1WGD A;  2BF8 B;  2KMC A;  2C7M B;  4KVG B;  3H7P A;  3B0A A;  4RM8 A;  2KFJ A;  2KO3 A;  1WIA A;  4NAW A;  2FCQ A;  2KVR A;  2C9W B;  1YD8 U;  3IG3 A;  1E90 A;  2L3Z A;  3BY4 B;  3Q3F A;  3RZW C;  3SDL C;  4W9D A;  2FAZ A;  2JZZ A;  1WJN A;  3K9P B;  3W1Y A;  3X0W A;  2DAF A;  2CHZ A;  4ANU A;  1R4N I;  2K8C A;  3ZDT A;  4BOZ B;  1WM2 A;  2L8J A;  4MDK E;  2JF5 A;  1OGW A;  1IP9 A;  2KLG A;  2KJR A;  5AZF A;  4IUM B;  3WAM A;  2KJ6 A;  2JXX A;  1NDD A;  2KX3 A;  2M0X A;  3NS8 A;  1UBI A;  3VQI A;  4TQ0 A;  4JQW C;  2DHZ A;  2LD9 A;  3DBR I;  5CHV C;  1WZ3 A;  2BYF A;  2OOB B;  3KW5 B;  4AWJ A;  4W9H A;  1P3Q U;  4M8N A;  3TJP A;  3PLV A;  4PS8 A;  3OJ4 B;  3M62 B;  3ZLZ A;  1LQB A;  2CHW A;  3CSF A;  3EC8 A;  3EHV A;  1GC7 A;  4W9G A;  4ZRJ A;  1WE6 A;  2NBW B;  4HXD A;  1Z5S B;  4DK5 A;  2A4Z A;  1E8X A;  4DHZ E;  5J17 A;  2CU1 A;  4K7S A;  2IY1 B;  2WWZ A;  3OJ3 A;  4AUQ C;  4K7W A;  4RM9 A;  5CTR C;  2MBH A;  2LVP A;  2JRI B;  3APF A;  4LDT D;  3LJ3 A;  3A9K A;  1QZE A;  1EO6 A;  2WX0 A;  4HPL B;  2NBU A;  4FHK A;  4EZK A;  4F7Z A;  4A3P A;  2L0F A;  2EKE C;  4GDL B;  2NBV B;  1AAR A;  2M8S A;  1ZGU B;  1YIW A;  3MHS D;  4CO7 A;  3VAW A;  1HE8 A;  1P98 A;  4FUL A;  2IO2 B;  3IVF A;  5D6J B;  2KX0 A;  4EEW A;  1GNU A;  4NPN A;  1WJU A;  4BOS C;  3AU4 A;  3NZS A;  2BGF A;  3QWZ B;  3DBH I;  2K25 A;  1WRD B;  3X23 A;  3HIZ A;  4ZRK A;  3A1Q B;  4ZRI A;  3QX1 A;  4KSK C;  3M63 B;  2NPT A;  3UIN B;  4GOC A;  2PEA A;  3GOE A;  2NS5 A;  4N9F 4;  3U8Z A;  3KYC D;  4HDO A;  2L76 A;  2PJH A;  4E71 A;  2DEN B;  2MW5 A;  4CHK A;  2MCN B;  4HLE A;  4NQK E;  2MBQ A;  1YJ1 A;  3KUD B;  3TIX A;  4FA6 A;  4EOY A;  2MLB A;  1UH6 A;  4KZ0 A;  4W9J A;  1S1Q B;  4FJZ A;  1WX8 A;  4BBN C;  2FNJ B;  2GBM A;  1K8R B;  4TKN A;  1SIF A;  2REX A;  3DDC B;  4BBN F;  2MP2 B;  4GDK B;  5LLI A;  5LXH A;  1E8W A;  3QK0 A;  5DPS A;  5AZH A;  4B9K A;  4IWP A;  3OAW A;  4HCN B;  3NOB A;  2NCN A;  2KK8 A;  2MA9 B;  2IO0 B;  5G55 A;  1LM8 B;  2KN5 A;  2KTR A;  3CMM B;  2XBB C;  4FLH A;  3UIP B;  5JH5 C;  4DWF A;  1L7Y A;  2GBN A;  3PZD A;  3VH3 B;  4DDI D;  1LXD A;  1V9J A;  2MBB B;  3VFK A;  1NI2 A;  2FIF A;  2CHX A;  2NVU I;  3WA0 A;  4IG7 B;  3ZO5 B;  4HVB A;  4WJN A;  5BO4 B;  1J0G A;  2O6V D;  2XK5 A;  1V6E A;  2YLM A;  3WAP A;  2BYV E;  2N7E A;  4B6W A;  4I6N B;  3AXC A;  3JSV B;  2LWP A;  4WWP A;  4DHJ D;  3JYU A;  4XC2 A;  2MSE D;  5G2N A;  4IM0 A;  2JPH A;  3H9D A;  3KUZ A;  4W9F A;  4WWN A;  4ANW A;  3PTF C;  4ZYN A;  3L13 A;  3ZKJ C;  2FCS A;  2D07 B;  2KD0 A;  5L83 A;  4EKU A;  1GUA B;  2K1F A;  1WGY A;  1TBE A;  4BKG A;  2IZV B;  1V2Y A;  2Y5B B;  2WDT B;  5DPT A;  4WQO B;  1V80 A;  3ZNZ B;  4W9I A;  5FR6 A;  2BWF A;  1VCB A;  2CR5 A;  2GOW A;  4HK2 A;  2G45 B;  2RD0 A;  2LGX A;  3M3J A;  3L08 A;  1WH3 A;  3CF6 E;  3A33 B;  5D2M B;  4BKT A;  4P7I A;  1V49 A;  2BWE S;  4NY0 A;  3RZF A;  4LDT B;  4AJW A;  1WMH B;  4HPM B;  4BKS A;  2AL3 A;  4FN2 A;  4GXB A;  3ZNI D;  4MEM A;  1EUV B;  2KQ7 A;  1V5T A;  3PRM B;  3WAO A;  1SE9 A;  3I3T B;  3HM3 A;  4PS7 A;  1YX6 B;  2W9N A;  3C0R B;  3DVN V;  4JL9 A;  4JLC A;  4GN1 A;  2BKF A;  3TCA A;  2ZVN A;  1WGR A;  4E3C A;  3QIJ A;  4G11 A;  1P0R A;  1C3T A;  2GBJ A;  2KQS A;  4KIK A;  5CHF A;  2N1W A;  1YQB A;  4M8M A;  5AEK B;  2K39 A;  2KC2 A;  1NBF C;  3K9O B;  3Q3J A;  2IO1 B;  4A20 A;  1SGH A;  2FCN A;  4II3 B;  1TTN A;  2N7D A;  2M17 A;  3VXW A;  3H6N A;  1TGZ B;  2D10 A;  2IY0 B;  2KFK B;  1E8Y A;  4F8C B;  4OVU A;  4MEL A;  4MJS B;  4IM3 A;  3MJW A;  4II2 B;  2ZCC A;  1UEL A;  1V81 A;  1T0Y A;  4LJP B;  2IYD B;  3IHP C;  3L54 A;  2O2V B;  2EMT A;  2FUH B;  2MBE A;  2PE9 A;  2G4S A;  1YX5 B;  2RPQ A;  5DCN A;  2JUO A;  2KTF A;  2WYQ A;  3A9J B;  4ICU A;  3CST A;  1OTR B;  3GZN I;  5GMV A;  1GG3 A;  2KMA A;  5E6P A;  2V1Y A;  3DPD A;  3NZU A;  2L0T A;  4HDQ A;  4ASW C;  1F9J A;  1WR6 E;  2LGD A;  5DPR A;  2KXJ A;  3DCG A;  2MQJ A;  1EF1 A;  1WFY A;  2KLC A;  3AUL A;  2LGY A;  2MRP A;  4TUU A;  5AZG A;  3VHT C;  3L17 A;  4MGK E;  5CX3 A;  5C23 A;  3VTU A;  4IM2 A;  3PRZ A;  5D7G A;  4I6L B;  3H1U A;  2KDB A;  1IYF A;  3DOW A;  3ZRF A;  3QJZ A;  3N30 A;  2I1J A;  2ZEQ A;  4G50 A;  2L05 A;  3PV1 A;  4KSL C;  2O6V B;  2LAS A;  2KKC A;  3H7S A;  1WXA A;  2LVQ A;  1I42 A;  3DBS A;  2N1V A;  3HK0 A;  3PHW B;  3VUW A;  1L2N A;  1Q0W B;  4ICV A;  3ONS A;  3APC A;  3RUL A;  3UIO B;  2N9E B;  2QHO A;  4DHJ B;  1E5W A;  4M0W B;  4ANX A;  4EFO A;  3MTN B;  3ZW3 A;  3ZDM C;  3VTW A;  2J7Q B;  1WZ0 A;  4GDL A;  2LUE A;  3PPA A;  3UQA A;  4EUT A;  2Z59 B;  1WI0 A;  3L16 A;  3V61 A;  2DZI A;  2ZPN A;  1X1M A;  3B08 A;  1P1A A;  2PE6 B;  3V60 A;  2D2Q A;  3ZUN A;  1UZX B;  1S3S G;  2D3G A;  4IWO A;  3V6C B;  2ZJD A;  2BPS A;  3RT3 B;  1ISN A;  4PS3 A;  4KDL B;  4A3O A;  2L00 B;  2RR9 A;  3U7D A;  3A1Q A;  2AWT A;  5D94 A;  2DAJ A;  3QHT A;  2FCM A;  4W9C A;  1U4A A;  1WE7 A;  1KM7 A;  1M94 A;  3L10 B;  3NHE B;  3VUY A;  2ZPY A;  1WXM A;  3H7P B;  3HM6 X;  2N9X A;  2V3S A;  4NAW B;  2ZNV B;  3SHQ A;  3W1S C;  4MGI E;  3KH0 A;  4GGQ A;  3QC8 B;  4ZDV A;  3PRP B;  4HJK A;  3R3M A;  1WXV A;  4X57 B;  2YVC A;  1R4M I;  3JW0 X;  2IBI B;  3PVL A;  3HHM A;  3ENE A;  4WJQ A;  3EEC A;  1VD2 A;  4TV3 A;  2J0J A;  4WAA A;  2R2Q A;  2MX2 A;  1JRU A;  3ZIM A;  4BFR A;  3RUI B;  4MGZ E;  2LRU A;  2MP2 A;  4G3X B;  2KHW B;  3PLU A;  4GDK A;  5DPW A;  1WGH A;  4IW0 A;  4KZC A;  4MSM B;  4GMV A;  3KYD D;  2JZ3 B;  1UBQ A;  1WX7 A;  2LI5 A;  4HWI B;  2GBK A;  4F1S A;  2J0K A;  2RGF A;  1EF5 A;  3ALB A;  4GIV A;  4KV2 A;  2KAN A;  3LDZ E;  5JHA A;  3PS6 A;  2JY6 A;  2M1M A;  1BT0 A;  3PHX B;  4WWO A;  4DHZ B;  1E7V A;  4URK A;  5J2R A;  4EZL A;  2M4N A;  1GJZ A;  3T8M A;  2K8B A;  1H8C A;  2WX1 A;  3O65 B;  2KNB A;  3APD A;  2MWS B;  3QA8 A;  1H4R A;  2KOX A;  2RSU A;  3JSV A;  2ZVO A;  5E6O A;  3A9K B;  3WIM A;  4BKS D;  1J8C A;  1OEY J;  3AU5 A;  2XEW A;  4RMA A;  2HTH A;  4IC7 B;  3ECI A;  2LXC A;  2FID A;  2B3A A;  1RFA A;  1WR1 A;  4OVV A;  2JRH A;  3DVG Y;  4WJO A;  1C1Y B;  1WF9 A;  1WM3 A;  5IAA C;  3IBE A;  2JVC A;  3DQV A;  3SD5 A;  3RD2 A;  3AI5 A;  1UGM A;  2LVO A;  3NY5 A;  3M95 A;  4W9K A;  5C1Z A;  1WX9 A;  3JVZ X;  3QCA A;  3ZNG C;  1WY8 A;  2ZNV C;  5IA7 A;  2UYZ B;  3TL5 A;  1WYW B;  2CKH B;  1LFD A;  2C5L C;  1KJT A;  2OJR A;  2ZZP B;  2NPT B;  1WMH A;  3TMP B;  1G6J A;  2EMS A;  3P2B A;  2DZJ A;  3ZRC A;  3N3K B;  1Q1O A;  3UGB B;  4NNJ B;  3ZTC A;  5KHO A;  2JWZ A;  2MBO A;  4JIO U;  2DYM A;  4FHJ A;  4MH0 E;  1RLF A;  3ZNH B;  4AP4 C;  2KJH B;  4CYE A; 
#chains in the Genus database with same CATH topology
 2PW9 A;  2DZM A;  4B95 A;  1WXS A;  1NEN B;  4P6V F;  2UU7 A;  1HXY D;  2C60 A;  2HE7 A;  1I4X A;  1HQR D;  1M4V A;  3D32 A;  3AE2 B;  2KFK A;  2G4D B;  3R66 C;  4FAD A;  4IWQ A;  4MJS A;  3IT6 B;  4MSQ B;  4US9 A;  1E7U A;  3AEC B;  1P7E A;  4R3D A;  2XK5 B;  2ZCB A;  3NVV A;  4LCD E;  3Q69 A;  2GMI C;  2UWQ A;  4K1R B;  1J8C A;  1PGX A;  1J19 A;  5CHW A;  3GZN B;  4KDI C;  1PQS A;  3AEF B;  2CS4 A;  5E6N A;  1XD3 B;  3AED B;  1MVK A;  1HEZ E;  5AUK A;  1D6E C;  1P9D U;  4C7Z A;  2O6V A;  4A90 A;  1K52 A;  1FXI A;  5HG2 A;  3R7R A;  3QAQ A;  4PYZ A;  4RFB A;  1ZPS A;  3BIN A;  2BYE A;  3ZTD A;  4XX5 A;  2LJI A;  2VZK D;  3BII D;  1IPG A;  4K81 A;  4J6I A;  3RFZ B;  1SE4 A;  1C78 A;  2LGS A;  1K53 A;  1IGC A;  3AEA B;  2RDG A;  4P16 A;  4KVG B;  2KVR A;  3B2F A;  2C9W B;  3IG3 A;  2MJE A;  3SDL C;  2FAZ A;  3X0W A;  5T8I A;  3NVY A;  3ZDT A;  1I4P A;  1N6Z A;  4WIP A;  2KLG A;  2KJR A;  1QT9 A;  2Y3A A;  2KJ6 A;  2JXX A;  1NDD A;  1JW9 D;  1ROE A;  2V3P A;  3VQI A;  5TSS A;  2DHZ A;  1XLN A;  3N1Y C;  1N5X A;  3ZXR A;  5CHV C;  2BYF A;  2OOB B;  3KW5 B;  4W9H A;  3RNB C;  2W54 A;  5BYS A;  2JU6 X;  2BS4 B;  1WE6 A;  4JWS C;  4DK5 A;  2A4Z A;  5IOI A;  5J17 A;  1FRR A;  3Q2A C;  4RM9 A;  2BT6 A;  3APF A;  2WDQ B;  4HPL B;  2WX0 A;  2NBU A;  1KH0 A;  2M8S A;  1ZGU B;  1HE8 A;  4FUL A;  2W3S A;  5D6J B;  4TMA B;  4NPN A;  1CJE A;  3AE1 B;  1R4N B;  4YTN B;  1WRD B;  5EE0 A;  2BB5 A;  2SAK A;  4ZRK A;  3QX1 A;  1UF0 A;  4KSK C;  2D3A A;  2NPT A;  3UIN B;  2BVC A;  3GOE A;  2NS5 A;  4HDO A;  1N62 A;  4HLE A;  2MCN B;  3TIX A;  2WDV B;  4FA6 A;  2ACZ B;  2MLB A;  2NMQ A;  4W9J A;  3ZYY X;  1K8R B;  2L32 A;  2IDY A;  2MP2 B;  4GDK B;  5LLI A;  3QK0 A;  5AZH A;  5FK9 C;  4HCN B;  3NOB A;  4IDI A;  1FRD A;  2XBB C;  3GP7 A;  4FLH A;  3UIP B;  5JH5 C;  4DWF A;  1LXD A;  4L1B A;  1NI2 A;  2FIF A;  2NVU I;  2DBY A;  5BO4 B;  2O6V D;  3WAP A;  2N7E A;  2JZP A;  4B6W A;  4I6N B;  1C77 A;  1JWB D;  1PGB A;  3JYU A;  3NZ3 A;  3RNA C;  1RM6 C;  2IGD A;  1TBE A;  1C4P A;  4OZB A;  4WQO B;  1C76 A;  3EFC A;  2IGG A;  1F2R I;  2LGX A;  3M3J A;  4BKT A;  2BWE S;  2MJ3 A;  1JML A;  3Q8A A;  3RZF A;  4AJW A;  3IT4 B;  3U4E G;  2BB6 A;  2ON8 A;  1D5Z C;  1SE9 A;  3I3T B;  3CIR B;  4PS7 A;  1YX6 B;  4JLC A;  3C0R B;  3NVZ A;  1E9M A;  4KX6 B;  3AE9 B;  4G11 A;  1P0R A;  4KIK A;  1I4G A;  5CHF A;  2GB1 A;  2N1W A;  4BZA A;  4KGT A;  1YQB A;  4M8M A;  5AEK B;  2K39 A;  3C8Y A;  1NBF C;  3K9O B;  1XCT L;  3DBL B;  4MM3 B;  4A20 A;  3P63 A;  3RN9 C;  1TTN A;  4HKZ E;  1E8Y A;  4F8C B;  2WXO A;  4MEL A;  2PLP A;  4IM3 A;  2ZCC A;  1JRO A;  1UEL A;  2OHF A;  3L54 A;  2O2V B;  2EMT A;  4GLS C;  2XN9 C;  1YX5 B;  2X38 A;  1CK1 A;  2N9K A;  5G5G A;  1C4A A;  2JUO A;  3A9J B;  5GMV A;  3GZN I;  5C3J B;  1N5W A;  2LGD A;  5DPR A;  2WU5 B;  2MHJ A;  2MQJ A;  1EF1 A;  5AZG A;  4TUU A;  3PRZ A;  1GOZ A;  1WWT A;  1YN3 A;  1IYF A;  1UUP A;  3N30 A;  3ZQ4 A;  2L05 A;  4K3B A;  2WXP A;  2LVQ A;  3VUW A;  1L2N A;  3ONS A;  3APC A;  1V1O A;  2PKO A;  3MTN B;  3VTW A;  1WZ0 A;  2WXI A;  4OW0 A;  2Z59 B;  1WI0 A;  3DWM A;  2DZI A;  1DOY A;  2BBC A;  1P1A A;  2PE6 B;  3AE7 B;  2MJD A;  4IWO A;  3I5J C;  3V6C B;  2DNF A;  1ISN A;  3E9S A;  4A3O A;  3P42 A;  2DAJ A;  3QHT A;  1WE7 A;  1KM7 A;  3L10 B;  1TY2 A;  2ZPY A;  1FNW A;  4HJK A;  1PFD A;  3R3M A;  3ABV B;  1SIJ A;  1MHH E;  2M0A A;  1FCC C;  1HZ6 A;  3ENE A;  1CQV A;  2R2Q A;  1JRU A;  1ET9 A;  4PT5 A;  2K3U A;  3Q8C A;  2LRU A;  1ZOY B;  1WGH A;  4IW0 A;  4KZC A;  4GMV A;  3ZJU A;  1WX7 A;  2LI5 A;  1JWU D;  4F1S A;  2J0K A;  2RGF A;  1XF5 L;  3PZ8 A;  5JHA A;  2FUG 1;  1BT0 A;  4URK A;  1E7V A;  4EZL A;  1YJJ A;  4YSZ B;  2K8B A;  1H8C A;  3VR8 B;  3APD A;  1H4R A;  4C56 C;  1SJE D;  1BXT A;  2W55 A;  3JSV A;  3WIM A;  2XEW A;  3ECI A;  2FID A;  2JRH A;  2Q5W D;  3AE3 B;  1C1Y B;  2KMM A;  4KKJ A;  5IAA C;  3IBE A;  3RD2 A;  3AI5 A;  1VZ8 A;  3M95 A;  3UI3 A;  4YT0 B;  1E6E B;  1WY8 A;  2ZNV C;  3MC8 A;  3TL5 A;  2C5L C;  4KGR A;  2M19 A;  2L83 A;  2OJR A;  1WMH A;  2INN E;  3DHH C;  4AS1 A;  1TS3 A;  3ZRC A;  3N3K B;  2LUM A;  4NNJ B;  2JWZ A;  1Y56 A;  1XXG A;  4CYE A;  4I6P A;  5HI1 A;  3W2D A;  1JCK B;  1QLB B;  2LJ5 A;  2IO3 B;  1FFU A;  2KWC A;  2C7N B;  3MC0 B;  3FIL B;  1YOV B;  5JZE B;  4FBJ B;  1CMX B;  2D11 A;  3NVW A;  1L0X B;  1MHX A;  3VH4 B;  3TEZ A;  1KOT A;  1Y8R C;  3WAN A;  2BTE A;  4MGY E;  2K6Q A;  3RMK C;  2JXT A;  4N6E B;  4LJO B;  3NS1 A;  1V86 A;  4FJV B;  2Y5C A;  3UF8 A;  5JHB A;  1WJ6 A;  4YTP B;  1Q5W B;  1UD7 A;  2N0S B;  2K6D B;  4YL8 A;  3U30 A;  4XZ4 A;  3RNE C;  2WXJ A;  4IKG A;  4NJ6 A;  1OEY A;  2B76 B;  4RCO A;  2R61 A;  1QKZ A;  1F2R C;  4K7U A;  3V6E B;  3ML9 A;  4MT5 A;  4ARC A;  3A4S C;  2QMT A;  3BYY B;  3GS2 A;  3ZVV A;  4ANV A;  2KZR A;  1L5P A;  2D3B A;  5BMH A;  2HD5 B;  3DBL I;  2V3N A;  4DXA B;  4M00 A;  2IND C;  4DQO C;  3HRD D;  3PGE A;  5J18 A;  3OLM D;  2KDE B;  4DXG A;  5KHQ A;  2KMC A;  5HHD G;  4LNO A;  2KFJ A;  2WXM A;  4NAW A;  2E6X A;  2FCQ A;  1YD8 U;  3Q3F A;  1E90 A;  2LMC A;  3LXF A;  2DAF A;  4ANU A;  4BOZ B;  2N7J A;  4XE0 A;  1TS2 A;  2JF5 A;  1OGW A;  4KKI A;  4IUM B;  2INP E;  3WAM A;  1ZDX A;  3NS8 A;  1UBI A;  4YSY B;  2D5G A;  4JPS A;  2LFI A;  5HFY A;  3HUI A;  3OJ4 B;  3ZLZ A;  1LQB A;  3CSF A;  3EHV A;  3BVZ A;  2WXQ A;  4HXD A;  2K9X A;  1Z5S B;  5IKC M;  2CU1 A;  1FCL A;  3MFG A;  4K7S A;  1VRA B;  2MBH A;  2LVP A;  2JRI B;  4LDT D;  1IUE A;  1QZE A;  1XO3 A;  1FNV A;  4FHK A;  4A3P A;  2EKE C;  2WXH A;  1AAR A;  3MHS D;  2E3T A;  1B1Z A;  4EEW A;  1GNU A;  4BOS C;  2K25 A;  3GE8 C;  3FAH A;  3BZD B;  3HIZ A;  1MFW A;  3M63 B;  2YEP B;  4GOC A;  4N9F 4;  3U8Z A;  2WHI A;  3KYC D;  2L76 A;  2ONQ A;  2PJH A;  4E71 A;  2MW5 A;  4LNF A;  2DLB A;  4CHK A;  4NQK E;  4LNI A;  1QOF A;  4HRS A;  2LEK A;  4KZ0 A;  2SEB D;  4FJZ A;  1I4H A;  1E8W A;  1L0V B;  4B9K A;  1FPY A;  1J7B A;  2KDM A;  4NAM A;  3VR9 B;  2NCN A;  2H88 B;  2IO0 B;  4KGS A;  1L7Y A;  2GBN A;  4DDI D;  2IGH A;  4HVB A;  1TIF A;  4WJN A;  1K51 A;  2XK5 A;  1V6E A;  2YLM A;  3FC4 A;  3SEB A;  2BYV E;  3BVG A;  2G9H D;  1LO5 D;  3KWV A;  3Q8B A;  4WWP A;  2MSE D;  2JPH A;  3H9D A;  2CJN A;  3KUZ A;  4OVZ A;  3ZKJ C;  1V1P B;  3L13 A;  2D07 B;  1GUA B;  4XWW A;  2HTM E;  4BKG A;  2VH2 A;  2JYE A;  3T3O A;  5DPT A;  2BWF A;  2CR5 A;  1JAL A;  1HTQ A;  2YEP F;  1WH3 A;  1XCQ L;  3A33 B;  5D2M B;  1V49 A;  2LHD A;  4FN2 A;  5D3I B;  3WAO A;  2IPK D;  2W9N A;  4JL9 A;  4ZRP A;  1JWA D;  2ZVN A;  1WGR A;  4CQN A;  4ZHO A;  2KC2 A;  3W9C B;  3RNG C;  3Q3J A;  1SGH A;  2FCN A;  1SE2 A;  2N7D A;  1ACC A;  3AE6 B;  1TGZ B;  2IY0 B;  2V0G A;  4JWU C;  1V81 A;  4LJP B;  4XYC A;  4HPP A;  1B9R A;  2WYQ A;  1V8C A;  3C19 A;  1XLP A;  2KMA A;  1IBX B;  1ET6 A;  2V1Y A;  3DPD A;  4HDQ A;  1F9J A;  1YNT E;  1WR6 E;  3URY A;  2KLC A;  2D3C A;  4BAX A;  1QOG A;  4MGK E;  5CX3 A;  2RDB C;  3AB5 A;  3H1U A;  2NTS A;  2LHE A;  2IJ0 A;  2I1J A;  4NJC A;  2ZEQ A;  4G50 A;  4KSL C;  1FM0 D;  3H7S A;  2KKC A;  3DBS A;  1Q0W B;  4MH8 A;  1UGJ A;  4HRO A;  4A55 A;  4DHJ B;  1TT5 B;  3LYY A;  4M0W B;  1MJD A;  3ZDM C;  3V61 A;  3V60 A;  1E7P B;  2D3G A;  2ZJD A;  4ITK A;  3BVM A;  2AWT A;  3EA6 A;  4W9C A;  2FCM A;  1LGR A;  1U4A A;  3NHE B;  1T6B X;  1WXM A;  3H7P B;  3W1S C;  4MGI E;  5JXV A;  3DBH B;  4ZDV A;  1SBB B;  2RPV A;  3AE4 B;  1WXV A;  4X57 B;  5H8Y E;  2YVC A;  3N9Y C;  1R4M I;  3HHM A;  1VD2 A;  4WAA A;  2WXN A;  2MX2 A;  4QAY A;  3ZIM A;  4BFR A;  3RUI B;  1EWY C;  1NYQ A;  2MP2 A;  4GDK A;  1NYR A;  5DPW A;  1UBQ A;  3SFE B;  4REZ A;  1EF5 A;  2JYT A;  3OG5 A;  2KAN A;  2JY6 A;  2M1M A;  3PHX B;  4WWO A;  5J2R A;  2M4N A;  2J4X A;  2WX1 A;  1PUT A;  4MAC A;  2RSU A;  1T3Q A;  3HVD A;  2INC C;  3A9K B;  2HTH A;  3GE3 C;  2LXC A;  2B3A A;  1HTO A;  1WR1 A;  4OVV A;  4WJO A;  4Q2J A;  1WM3 A;  3PZ7 A;  2JVC A;  3SD5 A;  4C7Y A;  2LVO A;  3NY5 A;  1ZP0 B;  1SF0 A;  3ZNG C;  2UYZ B;  2V4I B;  2CKH B;  1NEK B;  4XWT A;  4OHJ A;  1IGD A;  1L6U A;  2PVG C;  3P2B A;  2WU2 B;  3LB8 C;  3UGB B;  5KHO A;  2WXR A;  1FFV A;  2DYM A;  3AEE B;  3ZNH B;  4AP4 C;  4BVU C;  1WSP A;  1FXT B;  3AH7 A;  4GSW A;  4P1B C;  1KFY B;  1AN8 A;  1OQY A;  4MM3 A;  1ZXI A;  4EZJ A;  2R2O A;  3R7Q A;  1HA5 A;  2DZK A;  2KTR B;  1T0S C;  3A4R A;  2JT4 B;  3AE8 B;  4OZA A;  2O2V A;  4O1N A;  4NJ7 A;  2I1K A;  3VDZ A;  2WP9 B;  3SU8 X;  3A9J A;  3I63 C;  1TJE A;  3I57 A;  3W1S A;  3KLS X;  3J9C A;  1N61 A;  1D3Z A;  2ZW0 A;  2GBR A;  1RAX A;  3TEX A;  2L1A A;  3KUC B;  5EDS A;  3VVW B;  3PRE A;  2FBW B;  2KAC A;  2G1E A;  4H2A A;  4P1C C;  2WLB A;  4DDG D;  3PT2 B;  2PMV A;  2DYB A;  2AEH A;  1XT9 B;  1F0Z A;  2KAJ A;  4ZOH C;  1V5O A;  2DX5 B;  1WGG A;  1ZE3 D;  2LGI A;  4WUR A;  2EEL A;  4TQ1 A;  4AOF A;  2DYO A;  1J7A A;  1I4Q A;  3Q8F A;  3WCQ A;  2LRW A;  2LZ6 A;  3NRZ A;  2QIL A;  1QF6 A;  1SSN A;  3Q3N C;  2OJW A;  1MG8 A;  1WJ4 A;  2ICI A;  2Z0E B;  2N9P C;  2AL6 A;  4B0E A;  3TSS A;  2V4L A;  4NQL B;  2K5P A;  2C7H A;  5L95 C;  2VRR B;  2LXA A;  2L7R A;  2AQ2 B;  1RRB A;  2C7M B;  3B0A A;  2KO3 A;  3BY4 B;  2L3Z A;  4W9D A;  1R4N I;  2K8C A;  1WM2 A;  1GAQ B;  2HDE A;  3R2I A;  5AZF A;  4D2K A;  2KX3 A;  4TQ0 A;  5MPO A;  3PO0 A;  3N1Z C;  3MP9 A;  3RPF C;  1EU4 A;  1SEB D;  2I38 A;  5FR3 A;  4RF0 A;  1P3Q U;  3V05 A;  4M8N A;  3TJP A;  3M62 B;  3EC8 A;  4WH4 A;  5E6J A;  4ZRJ A;  3P4Q B;  1JRP A;  4USA A;  2IY1 B;  2BS2 B;  2WWZ A;  3OJ3 A;  4K7W A;  4LNK A;  1DOI A;  2WXF A;  3LJ3 A;  1DYQ A;  4F7Z A;  4EZK A;  2L0F A;  4GDL B;  2NBV B;  1SB3 C;  3RI7 C;  3VAW A;  1DGJ A;  1P98 A;  1SXT A;  3IVF A;  3U52 E;  1NI3 A;  1KTK A;  3DBH I;  3KQ4 A;  3A1Q B;  1QIL A;  2PEA A;  1UWX A;  4C4V B;  1QOB A;  1YN4 A;  2MBQ A;  2MEK A;  1YJ1 A;  2PVO D;  3KUD B;  4EOY A;  1UH6 A;  2QJL A;  1DOX A;  2VZK B;  1WX8 A;  4ZHP A;  2GBM A;  1FD6 A;  4TKN A;  1VR9 A;  3DDC B;  4BBN F;  3FIL A;  5LXH A;  5DPS A;  1XLO A;  3RNC C;  3AV8 A;  3O13 A;  2KK8 A;  2X8X X;  5G55 A;  1LM8 B;  3CMM B;  4M01 A;  1VDV A;  1RFK A;  3VH3 B;  1V9J A;  2MBB B;  3VFK A;  2CHX A;  4IG7 B;  4B0M A;  3EGR A;  3ZO5 B;  2AQ1 B;  3BYT B;  3AXC A;  4RGN A;  4C00 A;  5G2N A;  4WQM A;  4ANW A;  4ZYN A;  2FCS A;  2KD0 A;  3IXS A;  2K1F A;  1P7F A;  2KN4 A;  3N20 C;  2TSS A;  1V80 A;  4W9I A;  2KWD A;  1VCB A;  3BK1 A;  2WXG A;  2G45 B;  2RD0 A;  3AN1 A;  4BKS A;  3U2S C;  3ZNI D;  1I7H A;  1EUV B;  4N59 A;  3PRM B;  3DVN V;  3B2G A;  4GN1 A;  1BML C;  3QIJ A;  2GBJ A;  1BUI C;  1I4R A;  1OQQ A;  2IO1 B;  3E56 A;  4II3 B;  3VXW A;  3H6N A;  2D10 A;  2KFK B;  3OWE B;  4MJS B;  4J3O D;  4II2 B;  1QOA A;  1KLG D;  1JWM D;  2EKI A;  1T0Y A;  1E10 A;  2IYD B;  4N58 A;  2FUH B;  2G4S A;  2RPQ A;  4LTU A;  2KTF A;  2CU3 A;  1GG3 A;  2J42 A;  5E6P A;  1WYG A;  1Q10 A;  2L0T A;  1EWC A;  4ASW C;  2QC8 A;  1UWM A;  4TSS A;  1FO4 A;  2KXJ A;  1MG4 A;  3DCG A;  1WFY A;  3AUL A;  3FKY A;  3MHZ A;  3ETR A;  3VHT C;  4S0R A;  1L0Y B;  4IM2 A;  1RYJ A;  1C4C A;  3P4S B;  1YMH E;  3DOW A;  1T5X D;  3QJZ A;  3DBR B;  3AEB B;  3PV1 A;  2O6V B;  2LAS A;  4A8X C;  2RMM A;  4RGM A;  1I42 A;  3HK0 A;  1RWS A;  3PHW B;  3ZJT A;  4ICV A;  3RUL A;  3EUB 2;  3UIO B;  1TKG A;  3SR6 A;  1E5W A;  1VJK A;  3BWU D;  4ANX A;  4EFO A;  2J7Q B;  1EU3 A;  3PPA A;  4EUT A;  3AMZ A;  3L16 A;  2ZPN A;  2D2Q A;  3ZUN A;  1UZX B;  1GPX A;  3RT3 B;  2J53 A;  4PS3 A;  2RR9 A;  3HVZ A;  4K3C A;  3VUY A;  1STE A;  2V3S A;  3AEG B;  4RNA A;  3NJT A;  4ZRQ A;  4ZYS A;  2K22 A;  3QC8 B;  3PRP B;  4M02 A;  5IP4 D;  1QQR A;  1E0Z A;  4WJQ A;  3EEC A;  4TV3 A;  2HJ1 A;  5BMI A;  1GB1 A;  2KYW A;  2JZ3 B;  4YSX B;  1A70 A;  1K50 A;  3ZJV A;  4HEA 1;  1ENF A;  2WXK A;  3PS6 A;  1GJZ A;  4A9A A;  3O65 B;  2KNB A;  3MC9 A;  1MI0 A;  2KOX A;  4PK1 A;  2ZVO A;  5E6O A;  4BKS D;  1D4B A;  4RMA A;  2BQQ A;  3R2T A;  1RFA A;  1V1P A;  2QIE B;  4AQ7 A;  1AWD A;  4JE3 B;  3N1X C;  3U7Z A;  1VZ6 A;  2KVZ A;  3W5V B;  1AW7 A;  5BYR A;  1KJT A;  2L52 A;  2ZZP B;  2NPT B;  1G6J A;  2EMS A;  1JQ4 A;  3P4R B;  4RGO S;  1WRI A;  4JIO U;  3Q8E A;  2DWQ A;  1RLF A;  4JGH B;  4A6Q A;  1J7C A;  4W9E A;  4PYU A;  2J0M A;  2N4F A;  2N9L A;  4LLG M;  2RDH A;  3T9L A;  5LXI B;  3QQ8 B;  3B1L X;  3SFD B;  2AQ3 B;  2WS3 B;  4GU2 A;  5TR5 A;  4W9L A;  1A5R A;  2KC1 A;  3N32 A;  3DVG X;  2HJ8 A;  3QAR A;  4DBG A;  2VH1 A;  3ZXV A;  2KDF B;  4ARI A;  1E8Z A;  1KLV A;  3V3X A;  1IBX A;  4HCP B;  1TZ1 A;  2G3Q B;  2AYO B;  2KWU B;  2BKR B;  3EFU A;  2A5U A;  4S17 A;  3RYT A;  3H8H A;  1GC6 A;  2Z0D B;  1OFF A;  1F77 A;  4AJY B;  1ZKH A;  1V97 A;  4E74 A;  4FJY A;  1KRH A;  2KDI A;  4WJP A;  3W5U B;  1FIQ A;  3VUX A;  1R7S A;  1N63 A;  3DVN U;  3IFW B;  3S2A A;  5HKH A;  3KVF B;  2NR2 A;  3PSE B;  4G0N B;  3L0W B;  1I35 A;  2M56 B;  2ASQ A;  4M0W A;  3V62 A;  1PYW D;  3ML8 A;  3TBL D;  1UNS A;  1ZW7 A;  3VTV A;  3WAL A;  2QEJ C;  2K8H A;  1L6V A;  2PPH A;  4JX1 C;  1TS4 A;  4KIK B;  3RCZ A;  1CZP A;  3KWL A;  2QSD A;  1XQQ A;  2KWV B;  3UQB A;  1Z2M A;  4GB9 A;  1WGD A;  2Y5P A;  3Q6B A;  2BF8 B;  3H7P A;  4RM8 A;  1WIA A;  1YJI A;  4FXC A;  3RZW C;  2FE8 A;  2JZZ A;  1WJN A;  3K9P B;  4YWG G;  3W1Y A;  2CHZ A;  2L8J A;  3IAS 1;  4MDK E;  1IP9 A;  3TEW A;  2M0X A;  3L4P A;  5I4D A;  4JQW C;  2LD9 A;  3DBR I;  1WZ3 A;  4RF1 A;  1ESF A;  3TEY A;  4AWJ A;  4EE2 A;  5EE3 A;  2BW2 A;  4WAF A;  2PTL A;  3PLV A;  4PS8 A;  2CHW A;  4W9G A;  1GC7 A;  3T3N A;  1T0Q C;  2NBW B;  1D5M C;  1E8X A;  4DHZ E;  1L4Z B;  3GB1 A;  4AUQ C;  1WXQ A;  2QCZ A;  5CTR C;  4IOI E;  3A9K A;  1EO6 A;  1ZXH A;  4XDD A;  1XEE A;  1YIW A;  4CO7 A;  1FNU A;  2PIA A;  2IO2 B;  2KX0 A;  3ZGZ A;  2WXL A;  5C2T B;  1WJU A;  3AU4 A;  3NZS A;  2BGF A;  3QWZ B;  1SJH D;  3X23 A;  4ZRI A;  1TY0 A;  4LK0 M;  1F52 A;  2BS3 B;  2JWU A;  3NUH B;  2DEN B;  3B9J A;  4XDC A;  1S1Q B;  1PDX A;  4BBN C;  2FNJ B;  1OQR A;  5H92 C;  1SIF A;  2REX A;  3AE5 B;  1WGK A;  1TKE A;  3I9V 1;  4RH6 A;  4IWP A;  3OAW A;  5BMG A;  2JSV X;  2MA9 B;  2KTR A;  2KN5 A;  3VRA B;  5G5H A;  1T0R C;  3PZD A;  2WNM A;  3WA0 A;  3CWI A;  4DXF A;  1J0G A;  3RNF C;  2WGS A;  3JSV B;  2LWP A;  4DHJ D;  4C80 A;  4XC2 A;  5D3D A;  1TS5 A;  4IM0 A;  4W9F A;  4WWN A;  3PTF C;  1MPE A;  5L83 A;  4EKU A;  2WQY B;  1WGY A;  2IZV B;  5EE9 A;  1V2Y A;  2Y5B B;  1YN5 A;  2WDT B;  3ZNZ B;  5FR6 A;  2GOW A;  4HK2 A;  4YTM B;  2CJO A;  3L08 A;  3CF6 E;  2H89 B;  3P4P B;  4P7I A;  4NY0 A;  4WWM A;  4LDT B;  1WMH B;  4HPM B;  5IN7 A;  2AL3 A;  4GXB A;  1FMA D;  4MEM A;  1PGA A;  2KQ7 A;  1V5T A;  3DHI C;  3HM3 A;  2BKF A;  3TCA A;  4E3C A;  1C3T A;  2KQS A;  5LNK 1;  5BYQ A;  5GXG B;  2BYT A;  1C79 A;  3VRB B;  3P1M A;  3Q3O C;  3DWG C;  2M17 A;  4OVU A;  1GB4 A;  3MJW A;  1KLU D;  1TYG B;  2W82 A;  3IHP C;  2MBE A;  2PE9 A;  5DCN A;  4OZC A;  4ICU A;  3CST A;  1OTR B;  3NZU A;  1VZ7 A;  1C9F A;  3BK2 A;  4L23 A;  2AX5 A;  2J52 A;  2V9H A;  3IAM 1;  3NG0 A;  2LGY A;  2MRP A;  3L17 A;  5C23 A;  3VTU A;  2NTT A;  5D7G A;  4I6L B;  2KDB A;  3ZRF A;  1N60 A;  4RGT A;  1WXA A;  2N1V A;  2GRI A;  1XLQ A;  1TZO A;  4LNN A;  2N9E B;  2QHO A;  3ZW3 A;  4GDL A;  2GLS A;  2LUE A;  2GI9 A;  1VLB A;  3UQA A;  3Q3M C;  5AUI A;  1X1M A;  3B08 A;  4L2Y A;  1S3S G;  2JQR B;  2BPS A;  1EM7 A;  2WDR B;  1F1H A;  4KDL B;  2L00 B;  3U7D A;  3A1Q A;  5D94 A;  3MJ5 A;  1M94 A;  2ZW1 A;  4ACF A;  3HM6 X;  2N9X A;  4NAW B;  2ZNV B;  3SHQ A;  3KH0 A;  4GGQ A;  2KT7 A;  1ZUD 2;  5IO9 A;  4C4V A;  1ZDV A;  1L4D B;  1KF6 B;  3JW0 X;  2IBI B;  3PVL A;  2J0J A;  3AM9 A;  4MGZ E;  4G3X B;  2KHW B;  3PLU A;  5FKA C;  3TUO A;  4MSM B;  2MH7 A;  3KYD D;  4HWI B;  2GBK A;  3ALB A;  4XGA B;  4GIV A;  2JX5 A;  4KV2 A;  4NZL B;  3LDZ E;  3Q14 C;  1D5X C;  1FEH A;  4DHZ B;  3T8M A;  2XNA C;  1FXA A;  2I2Y A;  1YQ4 B;  2MWS B;  3QA8 A;  1HZ5 A;  1OEY J;  3AU5 A;  2W3R A;  4IC7 B;  1SE3 A;  1JWS D;  3DVG Y;  4YXD B;  5EE1 A;  1WF9 A;  4HKQ A;  2QDF A;  4UDU C;  3DQV A;  1UGM A;  4US8 A;  4W9K A;  5C1Z A;  1WX9 A;  3JVZ X;  3QCA A;  1R4M B;  4HJG E;  5IA7 A;  1YQ3 B;  3DHG C;  1WYW B;  2KQ4 X;  1LFD A;  2K0P A;  1TKY A;  1AYF A;  1NVI D;  2Z8L A;  3TMP B;  2DZJ A;  2OED A;  1Q1O A;  3ZTC A;  3R8B A;  2MBO A;  4FHJ A;  4MH0 E;  2KJH B; 
#chains in the Genus database with same CATH homology
 4JGH B;  4BVU C;  4I6P A;  2DZM A;  4PYU A;  4W9E A;  4B95 A;  2J0M A;  1FXT B;  2N4F A;  3T9L A;  2LJ5 A;  1WXS A;  2IO3 B;  5LXI B;  4GSW A;  3QQ8 B;  2KWC A;  3B1L X;  1OQY A;  2C7N B;  2C60 A;  4MM3 A;  2HE7 A;  5JZE B;  4GU2 A;  5TR5 A;  4FBJ B;  1CMX B;  4W9L A;  2D11 A;  4EZJ A;  1A5R A;  3D32 A;  2R2O A;  2KC1 A;  3R7Q A;  3N32 A;  2KFK A;  2G4D B;  3VH4 B;  2DZK A;  3DVG X;  3R66 C;  2HJ8 A;  2KTR B;  4IWQ A;  4MJS A;  4FAD A;  3A4R A;  2JT4 B;  1KOT A;  4MSQ B;  3QAR A;  1Y8R C;  3WAN A;  4DBG A;  4MGY E;  2K6Q A;  1E7U A;  2O2V A;  4NJ7 A;  2I1K A;  2KDF B;  3VDZ A;  3SU8 X;  3A9J A;  3W1S A;  1E8Z A;  2XK5 B;  2ZCB A;  1KLV A;  4LJO B;  1D3Z A;  2GBR A;  1V86 A;  4FJV B;  4LCD E;  1RAX A;  2GMI C;  2UWQ A;  3KUC B;  4HCP B;  1TZ1 A;  5EDS A;  2G3Q B;  2AYO B;  2KWU B;  3PRE A;  4K1R B;  2BKR B;  3UF8 A;  3VVW B;  5JHB A;  1WJ6 A;  3EFU A;  2A5U A;  1Q5W B;  1J19 A;  5CHW A;  3RYT A;  1GC6 A;  1UD7 A;  2Z0D B;  4KDI C;  1PQS A;  2K6D B;  4AJY B;  4YL8 A;  3U30 A;  2CS4 A;  4DDG D;  3PT2 B;  5E6N A;  1XD3 B;  1ZKH A;  4XZ4 A;  4NJ6 A;  4E74 A;  1OEY A;  2AEH A;  1XT9 B;  2DYB A;  4FJY A;  1P9D U;  1V5O A;  2KDI A;  2O6V A;  2DX5 B;  1WGG A;  4WJP A;  4K7U A;  3VUX A;  3DVN U;  3IFW B;  3S2A A;  3R7R A;  3ML9 A;  3QAQ A;  4TQ1 A;  4PYZ A;  3V6E B;  4AOF A;  2DYO A;  3KVF B;  5HKH A;  2NR2 A;  3PSE B;  3BIN A;  3A4S C;  3L0W B;  4G0N B;  1I35 A;  2LRW A;  2ASQ A;  3V62 A;  2BYE A;  2LZ6 A;  3ZVV A;  4ANV A;  2KZR A;  3ZTD A;  3ML8 A;  3TBL D;  1ZW7 A;  3VTV A;  2HD5 B;  3DBL I;  4DXA B;  3WAL A;  1MG8 A;  1WJ4 A;  2Z0E B;  2K8H A;  2N9P C;  4XX5 A;  2AL6 A;  2PPH A;  2V4L A;  4NQL B;  4KIK B;  2C7H A;  3PGE A;  5J18 A;  3RCZ A;  1IPG A;  3OLM D;  4K81 A;  4J6I A;  2KDE B;  5L95 C;  2VRR B;  2LXA A;  1XQQ A;  2L7R A;  2KWV B;  5KHQ A;  3UQB A;  1RRB A;  1Z2M A;  4GB9 A;  1WGD A;  2BF8 B;  2KMC A;  2C7M B;  4KVG B;  3H7P A;  3B0A A;  4RM8 A;  2KFJ A;  2KO3 A;  1WIA A;  4NAW A;  2FCQ A;  2KVR A;  2C9W B;  1YD8 U;  3IG3 A;  1E90 A;  2L3Z A;  3BY4 B;  3Q3F A;  3RZW C;  3SDL C;  4W9D A;  2FAZ A;  2JZZ A;  1WJN A;  3K9P B;  3W1Y A;  3X0W A;  2DAF A;  2CHZ A;  4ANU A;  1R4N I;  2K8C A;  3ZDT A;  4BOZ B;  1WM2 A;  2L8J A;  4MDK E;  2JF5 A;  1OGW A;  1IP9 A;  2KLG A;  2KJR A;  5AZF A;  4IUM B;  3WAM A;  2KJ6 A;  2JXX A;  1NDD A;  2KX3 A;  2M0X A;  3NS8 A;  1UBI A;  3VQI A;  4TQ0 A;  4JQW C;  2DHZ A;  2LD9 A;  3DBR I;  5CHV C;  1WZ3 A;  2BYF A;  2OOB B;  3KW5 B;  4AWJ A;  4W9H A;  1P3Q U;  4M8N A;  3TJP A;  3PLV A;  4PS8 A;  3OJ4 B;  3M62 B;  3ZLZ A;  1LQB A;  2CHW A;  3CSF A;  3EC8 A;  3EHV A;  1GC7 A;  4W9G A;  4ZRJ A;  1WE6 A;  2NBW B;  4HXD A;  1Z5S B;  4DK5 A;  2A4Z A;  1E8X A;  4DHZ E;  5J17 A;  2CU1 A;  4K7S A;  2IY1 B;  2WWZ A;  3OJ3 A;  4AUQ C;  4K7W A;  4RM9 A;  5CTR C;  2MBH A;  2LVP A;  2JRI B;  3APF A;  4LDT D;  3LJ3 A;  3A9K A;  1QZE A;  1EO6 A;  2WX0 A;  4HPL B;  2NBU A;  4FHK A;  4EZK A;  4F7Z A;  4A3P A;  2L0F A;  2EKE C;  4GDL B;  2NBV B;  1AAR A;  2M8S A;  1ZGU B;  1YIW A;  3MHS D;  4CO7 A;  3VAW A;  1HE8 A;  1P98 A;  4FUL A;  2IO2 B;  3IVF A;  5D6J B;  2KX0 A;  4EEW A;  1GNU A;  4NPN A;  1WJU A;  4BOS C;  3AU4 A;  3NZS A;  2BGF A;  3QWZ B;  3DBH I;  2K25 A;  1WRD B;  3X23 A;  3HIZ A;  4ZRK A;  3A1Q B;  4ZRI A;  3QX1 A;  4KSK C;  3M63 B;  2NPT A;  3UIN B;  4GOC A;  2PEA A;  3GOE A;  2NS5 A;  4N9F 4;  3U8Z A;  3KYC D;  4HDO A;  2L76 A;  2PJH A;  4E71 A;  2DEN B;  2MW5 A;  4CHK A;  2MCN B;  4HLE A;  4NQK E;  2MBQ A;  1YJ1 A;  3KUD B;  3TIX A;  4FA6 A;  4EOY A;  2MLB A;  1UH6 A;  4KZ0 A;  4W9J A;  1S1Q B;  4FJZ A;  1WX8 A;  4BBN C;  2FNJ B;  2GBM A;  1K8R B;  4TKN A;  1SIF A;  2REX A;  3DDC B;  4BBN F;  2MP2 B;  4GDK B;  5LLI A;  5LXH A;  1E8W A;  3QK0 A;  5DPS A;  5AZH A;  4B9K A;  4IWP A;  3OAW A;  4HCN B;  3NOB A;  2NCN A;  2KK8 A;  2MA9 B;  2IO0 B;  5G55 A;  1LM8 B;  2KN5 A;  2KTR A;  3CMM B;  2XBB C;  4FLH A;  3UIP B;  5JH5 C;  4DWF A;  1L7Y A;  2GBN A;  3PZD A;  3VH3 B;  4DDI D;  1LXD A;  1V9J A;  2MBB B;  3VFK A;  1NI2 A;  2FIF A;  2CHX A;  2NVU I;  3WA0 A;  4IG7 B;  3ZO5 B;  4HVB A;  4WJN A;  5BO4 B;  1J0G A;  2O6V D;  2XK5 A;  1V6E A;  2YLM A;  3WAP A;  2BYV E;  2N7E A;  4B6W A;  4I6N B;  3AXC A;  3JSV B;  2LWP A;  4WWP A;  4DHJ D;  3JYU A;  4XC2 A;  2MSE D;  5G2N A;  4IM0 A;  2JPH A;  3H9D A;  3KUZ A;  4W9F A;  4WWN A;  4ANW A;  3PTF C;  4ZYN A;  3L13 A;  3ZKJ C;  2FCS A;  2D07 B;  2KD0 A;  5L83 A;  4EKU A;  1GUA B;  2K1F A;  1WGY A;  1TBE A;  4BKG A;  2IZV B;  1V2Y A;  2Y5B B;  2WDT B;  5DPT A;  4WQO B;  1V80 A;  3ZNZ B;  4W9I A;  5FR6 A;  2BWF A;  1VCB A;  2CR5 A;  2GOW A;  4HK2 A;  2G45 B;  2RD0 A;  2LGX A;  3M3J A;  3L08 A;  1WH3 A;  3CF6 E;  3A33 B;  5D2M B;  4BKT A;  4P7I A;  1V49 A;  2BWE S;  4NY0 A;  3RZF A;  4LDT B;  4AJW A;  1WMH B;  4HPM B;  4BKS A;  2AL3 A;  4FN2 A;  4GXB A;  3ZNI D;  4MEM A;  1EUV B;  2KQ7 A;  1V5T A;  3PRM B;  3WAO A;  1SE9 A;  3I3T B;  3HM3 A;  4PS7 A;  1YX6 B;  2W9N A;  3C0R B;  3DVN V;  4JL9 A;  4JLC A;  4GN1 A;  2BKF A;  3TCA A;  2ZVN A;  1WGR A;  4E3C A;  3QIJ A;  4G11 A;  1P0R A;  1C3T A;  2GBJ A;  2KQS A;  4KIK A;  5CHF A;  2N1W A;  1YQB A;  4M8M A;  5AEK B;  2K39 A;  2KC2 A;  1NBF C;  3K9O B;  3Q3J A;  2IO1 B;  4A20 A;  1SGH A;  2FCN A;  4II3 B;  1TTN A;  2N7D A;  2M17 A;  3VXW A;  3H6N A;  1TGZ B;  2D10 A;  2IY0 B;  2KFK B;  1E8Y A;  4F8C B;  4OVU A;  4MEL A;  4MJS B;  4IM3 A;  3MJW A;  4II2 B;  2ZCC A;  1UEL A;  1V81 A;  1T0Y A;  4LJP B;  2IYD B;  3IHP C;  3L54 A;  2O2V B;  2EMT A;  2FUH B;  2MBE A;  2PE9 A;  2G4S A;  1YX5 B;  2RPQ A;  5DCN A;  2JUO A;  2KTF A;  2WYQ A;  3A9J B;  4ICU A;  3CST A;  1OTR B;  3GZN I;  5GMV A;  1GG3 A;  2KMA A;  5E6P A;  2V1Y A;  3DPD A;  3NZU A;  2L0T A;  4HDQ A;  4ASW C;  1F9J A;  1WR6 E;  2LGD A;  5DPR A;  2KXJ A;  3DCG A;  2MQJ A;  1EF1 A;  1WFY A;  2KLC A;  3AUL A;  2LGY A;  2MRP A;  4TUU A;  5AZG A;  3VHT C;  3L17 A;  4MGK E;  5CX3 A;  5C23 A;  3VTU A;  4IM2 A;  3PRZ A;  5D7G A;  4I6L B;  3H1U A;  2KDB A;  1IYF A;  3DOW A;  3ZRF A;  3QJZ A;  3N30 A;  2I1J A;  2ZEQ A;  4G50 A;  2L05 A;  3PV1 A;  4KSL C;  2O6V B;  2LAS A;  2KKC A;  3H7S A;  1WXA A;  2LVQ A;  1I42 A;  3DBS A;  2N1V A;  3HK0 A;  3PHW B;  3VUW A;  1L2N A;  1Q0W B;  4ICV A;  3ONS A;  3APC A;  3RUL A;  3UIO B;  2N9E B;  2QHO A;  4DHJ B;  1E5W A;  4M0W B;  4ANX A;  4EFO A;  3MTN B;  3ZW3 A;  3ZDM C;  3VTW A;  2J7Q B;  1WZ0 A;  4GDL A;  2LUE A;  3PPA A;  3UQA A;  4EUT A;  2Z59 B;  1WI0 A;  3L16 A;  3V61 A;  2DZI A;  2ZPN A;  1X1M A;  3B08 A;  1P1A A;  2PE6 B;  3V60 A;  2D2Q A;  3ZUN A;  1UZX B;  1S3S G;  2D3G A;  4IWO A;  3V6C B;  2ZJD A;  2BPS A;  3RT3 B;  1ISN A;  4PS3 A;  4KDL B;  4A3O A;  2L00 B;  2RR9 A;  3U7D A;  3A1Q A;  2AWT A;  5D94 A;  2DAJ A;  3QHT A;  2FCM A;  4W9C A;  1U4A A;  1WE7 A;  1KM7 A;  1M94 A;  3L10 B;  3NHE B;  3VUY A;  2ZPY A;  1WXM A;  3H7P B;  3HM6 X;  2N9X A;  2V3S A;  4NAW B;  2ZNV B;  3SHQ A;  3W1S C;  4MGI E;  3KH0 A;  4GGQ A;  3QC8 B;  4ZDV A;  3PRP B;  4HJK A;  3R3M A;  1WXV A;  4X57 B;  2YVC A;  1R4M I;  3JW0 X;  2IBI B;  3PVL A;  3HHM A;  3ENE A;  4WJQ A;  3EEC A;  1VD2 A;  4TV3 A;  2J0J A;  4WAA A;  2R2Q A;  2MX2 A;  1JRU A;  3ZIM A;  4BFR A;  3RUI B;  4MGZ E;  2LRU A;  2MP2 A;  4G3X B;  2KHW B;  3PLU A;  4GDK A;  5DPW A;  1WGH A;  4IW0 A;  4KZC A;  4MSM B;  4GMV A;  3KYD D;  2JZ3 B;  1UBQ A;  1WX7 A;  2LI5 A;  4HWI B;  2GBK A;  4F1S A;  2J0K A;  2RGF A;  1EF5 A;  3ALB A;  4GIV A;  4KV2 A;  2KAN A;  3LDZ E;  5JHA A;  3PS6 A;  2JY6 A;  2M1M A;  1BT0 A;  3PHX B;  4WWO A;  4DHZ B;  1E7V A;  4URK A;  5J2R A;  4EZL A;  2M4N A;  1GJZ A;  3T8M A;  2K8B A;  1H8C A;  2WX1 A;  3O65 B;  2KNB A;  3APD A;  2MWS B;  3QA8 A;  1H4R A;  2KOX A;  2RSU A;  3JSV A;  2ZVO A;  5E6O A;  3A9K B;  3WIM A;  4BKS D;  1J8C A;  1OEY J;  3AU5 A;  2XEW A;  4RMA A;  2HTH A;  4IC7 B;  3ECI A;  2LXC A;  2FID A;  2B3A A;  1RFA A;  1WR1 A;  4OVV A;  2JRH A;  3DVG Y;  4WJO A;  1C1Y B;  1WF9 A;  1WM3 A;  5IAA C;  3IBE A;  2JVC A;  3DQV A;  3SD5 A;  3RD2 A;  3AI5 A;  1UGM A;  2LVO A;  3NY5 A;  3M95 A;  4W9K A;  5C1Z A;  1WX9 A;  3JVZ X;  3QCA A;  3ZNG C;  1WY8 A;  2ZNV C;  5IA7 A;  2UYZ B;  3TL5 A;  1WYW B;  2CKH B;  1LFD A;  2C5L C;  1KJT A;  2OJR A;  2ZZP B;  2NPT B;  1WMH A;  3TMP B;  1G6J A;  2EMS A;  3P2B A;  2DZJ A;  3ZRC A;  3N3K B;  1Q1O A;  3UGB B;  4NNJ B;  3ZTC A;  5KHO A;  2JWZ A;  2MBO A;  4JIO U;  2DYM A;  4FHJ A;  4MH0 E;  1RLF A;  3ZNH B;  4AP4 C;  2KJH B;  4CYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...