2NVUI

Structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
b'MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
publication title Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein turnover, ligase
total genus 17
structure length 76
sequence length 76
chains with identical sequence J
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nvuI00
2DZKA 2DX5B 3PV1A 5AZGA 2WX1A 4E71A 4AOFA 3K9OB 1HE8A 3U30A 4GXBA 4W9EA 1Z5SB 4IWPA 3MJWA 3PVLA 4WWPA 3UINB 2LD9A 3IVFA 1X1MA 4ANWA 4KIKB 1E8WA 1M94A 4M8MA 2ZCCA 4CYEA 2DZJA 5IAAC 4TV3A 2DAJA 4AWJA 4EEWA 3KUZA 2KMAA 2MBHA 2ZEQA 3ZO5B 3RD2A 4X57B 1UBIA 2UWQA 2KANA 2VRRB 4MJSA 2KNBA 3L0WB 3M95A 2L3ZA 3EHVA 2V1YA 1NBFC 2JWZA 2G4DB 2AL6A 2L0TA 2M0XA 3DPDA 3HM3A 4NAWB 5FR6A 4FN2A 4NJ7A 4ANVA 3PSEB 4BKTA 1V2YA 2C5LC 3WA0A 4KDIC 4W9FA 1WGYA 1V5OA 5J18A 1Q5WB 1IP9A 1RFAA 1WF9A 3AU4A 4GSWA 4NJ6A 3VTUA 3LDZE 1K8RB 3KVFB 2XK5A 4FULA 1A5RA 1YIWA 2MWSB 3A9KB 3QQ8B 1Q0WB 1E7VA 2RPQA 3NZUA 3UGBB 4HXDA 2YVCA 3DVGX 4W9JA 2LGXA 2NBVB 4BBNC 4G0NB 1EF1A 1H4RA 4K1RB 2RR9A 2L00B 1WE6A 1NDDA 1I42A 4MH0E 2RSUA 1GC7A 2LWPA 4GDKA 3Q3JA 1LFDA 1WIAA 3VDZA 3O65B 4I6NB 4ZRKA 1IYFA 2ZPNA 1UBQA 2BPSA 2NPTB 4GDLA 4KSLC 3VFKA 3VQIA 4GIVA 1XQQA 3PLUA 4FJYA 4NY0A 2YLMA 2OOBB 3JYUA 4CHKA 1C1YB 2JRHA 3SU8X 3RULA 4DBGA 3QHTA 2KTRB 1WY8A 2MLBA 1E90A 2G4SA 5JHBA 2FUHB 1Z2MA 4FJVB 4YL8A 4B6WA 3ZRCA 2KXJA 1I35A 1TZ1A 2BYVE 4ZDVA 1WXMA 4N9F4 3DVNU 2MBBB 3TIXA 3NZSA 3VVWB 2KKCA 4HCNB 3PREA 1Q1OA 1WR1A 2CKHB 2QHOA 2MSED 3DDCB 4GGQA 3TJPA 2D2QA 1GC6A 2L05A 2N9XA 2MA9B 1WI0A 3QAQA 3W1SC 1GNUA 2BKFA 2MBOA 4M8NA 4DHZB 2JUOA 4KZCA 3GOEA 5D7GA 3PRMB 2LUEA 2DHZA 3EC8A 1P3QU 1WFYA 2LI5A 4RM9A 5DPWA 1YJ1A 4MEMA 3N32A 2KJHB 1Y8RC 1WXVA 5G2NA 4IM0A 2IY0B 4NPNA 3ML9A 4MJSB 2LGYA 2ZJDA 2PPHA 3V61A 3H1UA 3A1QA 4KV2A 4G50A 4MGIE 3ZRFA 2KFKA 1OEYA 4MSMB 2JRIB 2KD0A 3ZW3A 2KDIA 1RLFA 2LVPA 5GMVA 5DPRA 3JVZX 3SHQA 3VHTC 1WRDB 2JVCA 3WAMA 2IO2B 4W9LA 3W1YA 4B95A 2IZVB 1H8CA 2CR5A 2KDFB 4HCPB 2XK5B 2NBUA 4K7WA 3ONSA 1GUAB 4LJOB 2HTHA 2NBWB 1JRUA 2HJ8A 2M4NA 3SD5A 5CX3A 2PE9A 1VD2A 4EFOA 1WX7A 3D32A 2Z0EB 3RZFA 4BVUC 3U7DA 2J7QB 2BKRB 4JQWC 5EDSA 3SDLC 4MDKE 3RZWC 2KVRA 1R4MI 2RGFA 3QCAA 1NI2A 4KVGB 3KUDB 2MQJA 1L2NA 2BWES 2ZPYA 3BY4B 2C9WB 3H7SA 3TL5A 1V80A 2PE6B 3WALA 1WR6E 1YX5B 4GDKB 4II2B 1AARA 4G11A 3NHEB 1WXAA 2CHWA 4HWIB 1KLVA 3UIOB 1V86A 2D07B 1VCBA 4GDLB 4IUMB 1WM2A 3VUXA 1KM7A 3EFUA 4ZRIA 2M8SA 4JL9A 2N7EA 3PGEA 1GJZA 3L13A 4WWOA 5AZFA 3WAPA 5D2MB 5BO4B 4AUQC 5JZEB 2FIFA 3QA8A 5AZHA 4LDTD 2O2VB 1WM3A 1ZGUB 4MSQB 3ZUNA 5L95C 1ZKHA 5HKHA 3PLVA 2DAFA 5TR5A 3DQVA 2ZNVB 3A9JA 2FCMA 2GMIC 3DBSA 3UF8A 4FBJB 1UH6A 2K8CA 4PYZA 1V5TA 1EUVB 2FCQA 4BFRA 3ZTCA 3CF6E 1OEYJ 2UYZB 4GB9A 2ZVNA 2K6QA 3UQAA 3DBHI 1XD3B 3L17A 3N3KB 3VH4B 1P0RA 3PRPB 4BKSA 2W9NA 1J0GA 4F7ZA 2CU1A 2MBQA 3H6NA 1FXTB 1TTNA 1XT9B 2C7HA 2ASQA 2LXAA 2KWVB 2KWUB 2N1WA 1SIFA 2R2OA 2LGDA 1OTRB 4E74A 3U8ZA 1SE9A 1SGHA 2LXCA 4ANXA 1WE7A 2NR2A 3ZVVA 4B9KA 5JH5C 3A1QB 3H7PA 4HK2A 4W9IA 3ZDTA 1T0YA 1EO6A 5D94A 2KFKB 2KX0A 3GZNI 4ZYNA 4ICVA 4PS7A 3C0RB 4TQ0A 3HHMA 4KZ0A 4DWFA 1TBEA 4WJPA 4URKA 4FHJA 4I6LB 1QZEA 2G45B 1RAXA 2DZIA 1P98A 2N1VA 1WZ3A 1YD8U 4BOSC 5J2RA 4AP4C 3M3JA 1F9JA 4EZKA 5C23A 2K6DB 5G55A 3M63B 2ZNVC 2J0JA 4HDQA 4K7SA 1L7YA 4TKNA 2BWFA 3B1LX 3UIPB 2MP2A 3N30A 4KDLB 3NS8A 4LCDE 3S2AA 4KSKC 3NOBA 2K1FA 2LVQA 2KK8A 2O2VA 2K8HA 2WYQA 2D10A 2M17A 2ZCBA 3A4RA 4BKSD 2ZZPB 4FADA 2V4LA 4GU2A 2JT4B 4JGHB 2WDTB 3H9DA 2N4FA 5KHOA 3AXCA 3QWZB 4J6IA 4OVUA 1MG8A 4DDGD 3APDA 1LXDA 3TCAA 3RT3B 5IA7A 4M0WB 2KQ7A 2Z0DB 5J17A 1YQBA 1J19A 4WWNA 4MM3A 3T9LA 4W9DA 2KWCA 4W9CA 5CTRC 1WMHA 1WXSA 3HM6X 3VXWA 2LRUA 4EZJA 2WWZA 2KHWB 1D3ZA 2JPHA 2IO3B 3K9PB 2R2QA 3KYDD 3A9JB 4EOYA 4K7UA 4DDID 2HE7A 4A20A 3NY5A 2KLGA 2K25A 4XZ4A 3LJ3A 2GOWA 4GN1A 2BYEA 2FNJB 2A5UA 4HDOA 4NQLB 2MCNB 2J0KA 2DYMA 2O6VD 3PTFC 5CHFA 2A4ZA 3M62B 3L16A 4IM2A 4HPMB 2K8BA 3X0WA 2KDEB 2BGFA 4BKGA 1YX6B 4IW0A 4HVBA 3APCA 4II3B 3H7PB 3PRZA 2FIDA 1UZXB 1WH3A 2M1MA 1ISNA 1KJTA 4FJZA 3RUIB 3L10B 2LZ6A 3VUYA 2PJHA 3ZNGC 4BOZB 3UQBA 2PEAA 2L7RA 3AULA 2G3QB 2GBJA 4EKUA 4FA6A 5E6PA 1OGWA 4IC7B 1R4NI 3RYTA 4DHJD 1E7UA 4MGZE 3VAWA 1UELA 4MGYE 2Z59B 4IG7B 4JIOU 2ZVOA 5L83A 1KOTA 2JY6A 1P1AA 2L76A 4HLEA 1C3TA 2I1JA 2KN5A 1LQBA 1V49A 3PHXB 4F8CB 1UGMA 3V62A 2FCNA 3DVGY 2MP2B 1U4AA 2GBMA 4AJWA 4DXAB 3ENEA 4HJKA 2KO3A 3WAOA 3X23A 3R66C 4PYUA 2JZZA 1OQYA 3IFWB 2N9PC 5CHWA 2AL3A 3L08A 2EMSA 1TGZB 2C7MB 4TQ1A 2DENB 2MW5A 2KMCA 5JHAA 2AEHA 3VTWA 4I6PA 3ZNZB 3DBLI 3V6EB 2KFJA 2L8JA 4XX5A 2DYBA 2GBKA 2CS4A 4GOCA 4GMVA 3V60A 3ZKJC 1BT0A 2L0FA 3DVNV 2KLCA 1PQSA 5E6NA 3A33B 1WMHB 3L54A 4DHJB 2KX3A 3ECIA 3T8MA 3AU5A 2IYDB 4WJOA 1P9DU 5D6JB 2I1KA 3A4SC 3CSTA 3R7QA 1CMXB 3VUWA 1S3SG 2HD5B 2XBBC 1V6EA 4WAAA 4ASWC 4K81A 4LDTB 4W9KA 3QARA 2KJRA 3DOWA 2B3AA 2IBIB 3QX1A 2Y5BB 3KW5B 4F1SA 4E3CA 4P7IA 3KH0A 5AEKB 2IY1B 3JSVA 3HK0A 1E5WA 3ZDMC 1IPGA 2NS5A 2OJRA 3OAWA 4NNJB 3VTVA 2K39A 2MRPA 4IWQA 2LASA 3IBEA 3IG3A 2KOXA 1WZ0A 2N7DA 2O6VA 3AI5A 3PPAA 3CMMB 4MGKE 4FLHA 2NVUI 2GBRA 4XC2A 1WGGA 3APFA 3PZDA 1E8YA 1WGRA 3ML8A 5KHQA 2FCSA 4IM3A 2KQSA 3MHSD 4ICUA 3QIJA 1RRBA 2CHZA 4DK5A 3P2BA 4ANUA 3VH3B 2N9EB 5LXIB 2DYOA 1WX9A 3ZNID 1LM8B 3ALBA 4KIKA 1WGHA 2KDBA 2GBNA 3PT2B 4OVVA 3R3MA 4PS3A 1ZW7A 4BBNF 3OJ3A 4JLCA 4NQKE 5DPSA 1GG3A 2BF8B 3HIZA 3KYCD 4FHKA 2D11A 3TMPB 4EZLA 4G3XB 4RMAA 3JW0X 4A3OA 4CO7A 5LXHA 3WIMA 4WJQA 3PS6A 3QC8B 2LRWA 4W9GA 3ZTDA 2C60A 1WYWB 4NAWA 4LJPB 1WJ4A 3B0AA 3KUCB 2JZ3B 2FAZA 3B08A 2LVOA 2MX2A 3RCZA 5C1ZA 1J8CA 4TUUA 3MTNB 2EMTA 1V9JA 3ZLZA 1EF5A 1WX8A 2CHXA 2JF5A 2KJ6A 2V3SA 3I3TB 2WX0A 3PHWB 4IWOA 5LLIA 2MBEA 1WJUA 1G6JA 3A9KA 5CHVC 3DCGA 2IO0B 2NCNA 3TBLD 3QK0A 2C7NB 5DCNA 2D3GA 1E8ZA 2JXXA 3DBRI 4A3PA 1UD7A 2KC1A 2RD0A 4RM8A 1V81A 2EKEC 4AJYB 4HPLB 1S1QB 1WGDA 3W1SA 2DZMA 5E6OA 3R7RA 2REXA 2LJ5A 2BYFA 3OJ4B 3OLMD 4EUTA 3ZIMA 3IHPC 4W9HA 4WQOB 2AYOB 1WJ6A 2NPTA 1E8XA 3EECA 1WJNA 3BINA 3WANA 2XEWA 2IO1B 3JSVB 3Q3FA 5DPTA 2KTFA 3CSFA 2KTRA 4PS8A 4WJNA 4ZRJA 2AWTA 2J0MA 4MELA 4DHZE 2KZRA 3ZNHB 2KC2A 2O6VB 3V6CB 3QJZA
chains in the Genus database with same CATH superfamily
4BAXA 4AOFA 3K9OB 4GXBA 3PVLA 4WWPA 4ANWA 3IVFA 4C4VB 4KIKB 4A9AA 4CYEA 3GE8C 4AWJA 1TIFA 3HUIA 3ZO5B 2GB1A 4X57B 1UBIA 5BYQA 3TUOA 2L3ZA 2EKIA 4M00A 2L0TA 2M0XA 1SSNA 4ANVA 4FN2A 4NJ7A 2DLBA 2JYEA 3WA0A 5J18A 4J3OD 3KVFB 4FULA 1PGBA 3A9KB 2M56B 2BYTA 2PLPA 2YVCA 3DVGX 4W9JA 5EE1A 1EF1A 1WE6A 1I42A 1ZOYB 1SE3A 1L0YB 3VDZA 3O65B 3P42A 4ZRKA 1IYFA 2BPSA 2WXFA 3VQIA 3PLUA 2YLMA 3JYUA 2WXQA 1I4HA 3RULA 1N62A 2G4SA 5JHBA 2FUHB 4YL8A 1XLPA 3IAM1 1GOZA 3J9CA 2KXJA 1I35A 1DYQA 1TZ1A 1C4CA 3OWEB 3QAQA 3FAHA 4N59A 4DHZB 2JUOA 3VR8B 3BYYB 5D7GA 1FMAD 3NVYA 2LI5A 1TYGB 5HI1A 2BT6A 3N32A 1C4PA 3PO0A 3ML9A 4MJSB 1HTQA 2LGYA 2PW9A 4NJCA 4ZHPA 3A1QA 2BS3B 4R3DA 1IBXB 1TJEA 3Q3NC 5AUKA 2KDIA 3DHHC 5GMVA 5DPRA 3JVZX 3VHTC 3IAS1 2IO2B 1KLGD 5FR3A 1H8CA 4LJOB 1SF0A 1VD2A 3RZFA 4JQWC 1KFYB 4MDKE 3RZWC 1YJJA 2PVGC 2C9WB 2YEPF 1WR6E 1AARA 3MP9A 1KLVA 1V86A 2W55A 1TS5A 1VCBA 3VUXA 4JL9A 3PGEA 3L13A 1CJEA 2LUMA 2CU3A 2J42A 5D2MB 2FE8A 4LNOA 3QA8A 4LDTD 5L95C 4MSQB 1FRRA 1ZKHA 3AE4B 5HKHA 3T3NA 1KF6B 1QLBB 4P6VF 3DBSA 2WGSA 3DHIC 4BFRA 3ZTCA 3HVZA 2K6QA 3DBHI 2J4XA 2W9NA 3URYA 1CQVA 2C7HA 2N1WA 2KWUB 3MHZA 1OTRB 4E74A 1WE7A 3EA6A 3H7PA 4HK2A 3ZDTA 5D94A 1TZOA 4ZYNA 3GZNI 3AE3B 4PS7A 4DQOC 4DWFA 2W3RA 4BOSC 4S0RA 1C4AA 4AP4C 3AEFB 5G55A 1T3QA 2J0JA 1T0SC 4L1BA 4ACFA 2MP2A 2LGSA 4KSKC 3NOBA 2O2VA 2M17A 3TEXA 5IKCM 3RMKC 1YN4A 2ZZPB 4FADA 2WXPA 2N4FA 1N5XA 5KHOA 1MG8A 4LNFA 5J17A 5IA7A 4M0WB 2Z0DB 2V0GA 4RNAA 3T9LA 4RCOA 1NYRA 1WXSA 1L5PA 2IO3B 3KYDD 3A9JB 1HTOA 2KAJA 3P4RB 1XF5L 1N63A 2GOWA 1E0ZA 2BYEA 5HHDG 1XLOA 4HDOA 3M62B 3L16A 4HPMB 3X0WA 2KDEB 4P1BC 2MHJA 2N7JA 1N5WA 1L0XB 1UZXB 1WH3A 1ISNA 4FJZA 1I4XA 2PJHA 4XWTA 1I4QA 4FA6A 5E6PA 1OGWA 3RYTA 3RPFC 4MGYE 2Z59B 1NVID 4CQNA 4YT0B 4OZBA 2PTLA 5IP4D 1LQBA 3Q6BA 1U4AA 1JW9D 2KO3A 3X23A 2ACZB 2JZZA 4OZAA 5CHWA 2KMMA 3NG0A 1XCTL 4TQ1A 2DENB 2RDGA 3N1XC 2V4IB 3EGRA 3DBLI 4JWUC 1SB3C 2CS4A 1FCLA 2KLCA 1JROA 5E6NA 2WDVB 1WMHB 2PKOA 4M01A 3AMZA 1FXAA 1I4PA 5D6JB 3A4SC 3R7QA 1CMXB 1IGCA 1GPXA 1MPEA 2JU6X 2HD5B 1V6EA 4WAAA 4W9KA 2D3BA 3DOWA 2RDBC 1R4NB 3ZDMC 2MRPA 2LASA 3AI5A 1FRDA 1FXIA 4FLHA 3N9YC 1E7PB 3VRBB 4XC2A 1ET9A 3BWUD 4ARCA 4DK5A 1QF6A 1EM7A 2N9EB 2DYOA 2JQRB 5HFYA 4C4VA 2LHDA 4KIKA 4IDIA 1WGHA 2GBNA 3R3MA 4YSZB 2MEKA 1GG3A 3HIZA 3LXFA 3DBHB 2K3UA 4RMAA 5LXHA 3WIMA 1YMHE 1AYFA 2WNMA 1D5XC 5T8IA 4LJPB 1B1ZA 2FAZA 3AEAB 4C7YA 4WWMA 1J8CA 4RGNA 1V9JA 3RFZB 3ZLZA 3U52E 2VZKB 2WX0A 1WJUA 3P4QB 3A9KA 5DCNA 2JXXA 1E10A 2LEKA 1V8CA 1WRIA 1WGDA 4QAYA 4FXCA 2JSVX 2DZMA 1E6EB 2BYFA 4WIPA 3OLMD 4IKGA 1ROEA 2AYOB 1BMLC 3BINA 2IO1B 4LNNA 3JSVB 2IGHA 4WJNA 2Y5CA 4ZRJA 5MPOA 2TSSA 2AWTA 4MELA 3RNEC 2Y3AA 3ZNHB 3QJZA 3NRZA 1A70A 3P1MA 5AZGA 2WX1A 2QIEB 4E71A 3TEZA 2WDRB 4W9EA 2BS2B 3I63C 4M8MA 2ZCCA 2DAJA 2VRRB 4MJSA 2QEJC 2LFIA 3AM9A 3EHVA 1IBXA 1F0ZA 3DPDA 3HM3A 3PSEB 3AE2B 2C5LC 4GSWA 1A5RA 1L4ZB 1YIWA 2MWSB 1D4BA 2H89B 3UGBB 1KLUD 2LGXA 2NBVB 4BBNC 2RR9A 4MH0E 2MJDA 1GC7A 2LWPA 1K50A 3MJ5A 1LFDA 2JZPA 2IDYA 3VFKA 4GIVA 4NY0A 3SU8X 4DBGA 2KTRB 3SFEB 3DBLB 1K51A 1Z2MA 3ZRCA 4YSYB 1TKGA 1KH0A 1WXMA 1N60A 2AQ1B 2XNAC 3TIXA 1SE4A 4HCNB 1WR1A 4HROA 2MSED 3TJPA 1DGJA 2L05A 1GNUA 2RDHA 2MBOA 4M8NA 4N58A 3ZJUA 3GOEA 4XGAB 1RFKA 2LUEA 4A6QA 1P3QU 1PYWD 1WFYA 1YJ1A 2RPVA 5G2NA 2WXNA 4IOIE 4IM0A 2WXJA 3H1UA 4KV2A 3ZXVA 4MGIE 2INNE 3AE6B 2D3CA 2D5GA 1ZDXA 2KD0A 3E56A 1RLFA 2K22A 2LVPA 1WRDB 2IZVB 2WXLA 2ZW1A 4K7WA 1FD6A 1GUAB 1ZP0B 2NBWB 1JRUA 3SD5A 5CX3A 2V3PA 4EFOA 5EDSA 2SAKA 4KVGB 3KUDB 2MQJA 1JMLA 1L2NA 2PE6B 3WALA 1V97A 4HWIB 2WS3B 1TS3A 4GDLB 1WM2A 3NS1A 4M0WA 1GJZA 4WWOA 1P7FA 3I5JC 3RI7C 3WAPA 1QT9A 1SJHD 1WM3A 3ZUNA 2MJEA 1TY2A 3A9JA 3UF8A 1FFVA 1UH6A 1EUVB 1OEYJ 1JRPA 1VZ8A 1PGAA 2UYZB 2WXGA 1XD3B 3I9V1 3PRPB 3Q8BA 2MBQA 3H6NA 1XT9B 2LXAA 4AS1A 2R2OA 1V1PB 1SE9A 1SGHA 2MH7A 2NR2A 1T0YA 4HKQA 2KFKB 2NTTA 4ICVA 2LJIA 3C0RB 4RF0A 3BK2A 4KZ0A 4WJPA 2X8XX 5E6JA 4URKA 1QZEA 1RAXA 1YD8U 2K6DB 2LGIA 2E6XA 3B1LX 3UIPB 3N30A 4KDLB 2VH1A 1QKZA 3NS8A 1NYQA 3Q14C 3KQ4A 4H2AA 3Q3OC 3Q2AC 4YTNB 2QDFA 3T3OA 2WDTB 5TSSA 1PGXA 4DDGD 1F2RI 1LXDA 1YJIA 4W9DA 2KWCA 4YSXB 1FO4A 4W9CA 1TT5B 2BVCA 1WMHA 3HM6X 3VXWA 5IO9A 2JPHA 4EOYA 2R2QA 4K7UA 2HE7A 3NY5A 2KLGA 3LJ3A 4GN1A 2WP9B 2MJ3A 2A4ZA 2JWUA 1VZ6A 1YX6B 4HVBA 1M4VA 4WAFA 1JWUD 2WU5B 2FIDA 3PRZA 2L52A 2M1MA 3NZ3A 1ESFA 2OJWA 2G3QB 2GBJA 3AE9B 4L23A 1SBBB 1R4NI 5GXGB 1E7UA 3VAWA 1WWTA 1D5MC 1KOTA 4JIOU 2JY6A 2L76A 3PHXB 1T0RC 1EU4A 1VR9A 2GBMA 1N6ZA 4HJKA 3R2TA 2AL3A 2WXOA 2C7MB 1D6EC 1IUEA 1XEEA 2ICIA 2AEHA 3ZNZB 2KFJA 4LTUA 2DYBA 4XX5A 3MC8A 3ZKJC 4MM3B 1BT0A 2L0FA 1C78A 4DHJB 1SJED 1T6BX 4LNKA 2GI9A 2KWDA 3T8MA 2IYDB 1P9DU 2I1KA 3CSTA 1S3SG 4RH6A 4ASWC 3RNCC 4C80A 3QARA 1E9MA 4OW0A 2BB5A 2KJRA 3QX1A 3KW5B 4E3CA 3L4PA 2IY1B 3JSVA 3Q8AA 1DOYA 3ZYYX 3NVZA 4JWSC 2GLSA 1ACCA 1B9RA 3BIID 3CMMB 2NVUI 1AWDA 2WXMA 4IM3A 4ICUA 2CHZA 3P2BA 4ANUA 3VH3B 1NI3A 3ZNID 1OQRA 4BBNF 1ZW7A 3KYCD 4FHKA 2I38A 3NUHB 2E3TA 2G9HD 1JWAD 2LRWA 1HZ5A 3KUCB 2MX2A 4AQ7A 4TUUA 1WX8A 3PHWB 5LLIA 1JQ4A 3FILB 3Q8CA 5CHVC 5AUIA 1WSPA 2D3GA 1E8ZA 1V81A 1I4GA 5E6OA 3R7RA 2BTEA 4EUTA 3IHPC 1HQRD 1WJ6A 1WJNA 3WANA 2M19A 3Q3FA 1AW7A 2KTRA 3ZXRA 4D2KA 1C79A 1GB1A 1XO3A 2J0MA 3AV8A 3R8BA 2KZRA 2O6VB 3V6CB 2INDC 3GB1A 3PV1A 4TMAB 1HE8A 3U30A 3U2SC 1Z5SB 4IWPA 4C00A 4ZYSA 3MJWA 2LD9A 4C56C 2W3SA 2QILA 2DZJA 2K0PA 4LLGM 5IAAC 2ZEQA 3RD2A 2UWQA 3AEEB 2KNBA 3M95A 1NBFC 3AE7B 3IT4B 2G4DB 2AL6A 1ZE3D 4NAWB 4BKTA 2PVOD 3FC4A 4W9FA 1F2RC 3IXSA 2H88B 1WF9A 3AU4A 4NJ6A 2ZW0A 3QQ8B 4S17A 1Q0WB 4HXDA 4XDDA 3BZDB 2X38A 2FBWB 1H4RA 4PT5A 1HA5A 3SFDB 4TSSA 1NDDA 4L2YA 2D3AA 1WIAA 1UF0A 4M02A 1EU3A 4GDLA 1PUTA 4KSLC 4FJYA 2OOBB 4CHKA 1C1YB 2JRHA 2HTME 1E90A 4FJVB 2YEPB 4B6WA 1ET6A 2BYVE 1HXYD 2MBBB 3VVWB 3NZSA 3BVZA 3P4PB 2KKCA 3PREA 1Q1OA 3DDCB 3P4SB 4GGQA 4XE0A 2D2QA 2N9XA 2MA9B 1WI0A 3W1SC 4KZCA 3PRMB 2DHZA 3EC8A 5DPWA 3AEBB 4MEMA 2KJHB 1Y8RC 1V1PA 4NPNA 4RGMA 1ZXHA 2ZJDA 3V61A 5G5GA 2QJLA 4G50A 3ZRFA 2NMQA 2KFKA 2CJOA 1N61A 3W1YA 2CR5A 3ZQ4A 2XK5B 2WDQB 1T0QC 2HJ8A 2M4NA 2DBYA 3D32A 2Z0EB 4BVUC 2J7QB 3PZ8A 3Q3MC 3SDLC 2WXHA 2KVRA 3QCAA 1MG4A 2BWES 2ZPYA 3BY4B 3H7SA 1LGRA 3TL5A 4MACA 4GDKB 4G11A 1WXAA 3NJTA 3Q69A 3B9JA 1XCQL 2J52A 4IUMB 3EFUA 5AZFA 3MFGA 4ZRPA 5BO4B 4AUQC 2CJNA 1YN3A 2FIFA 5AZHA 1QOGA 2O2VB 3PLVA 5TR5A 4REZA 1MVKA 3EFCA 2ZNVB 2FCMA 2GMIC 4FBJB 2K8CA 2FCQA 2N9KA 5BMIA 3V3XA 2SEBD 3N3KB 3VH4B 1P0RA 4BKSA 1J0GA 4F7ZA 2KWVB 2ON8A 3O13A 4JPSA 1JALA 4ANXA 2LXCA 3ZVVA 3RNAC 4W9IA 3HVDA 3AECB 2WXRA 4USAA 4DXFA 3HHMA 1TBEA 4FHJA 4I6LB 1YQ4B 4ZHOA 5J2RA 1F9JA 4EZKA 3HRDD 5C23A 2ZNVC 3NVWA 3BVMA 1L7YA 4TKNA 1KTKA 3FKYA 2K1FA 2KK8A 2K8HA 3AH7A 2D10A 2WXIA 2QCZA 4P1CC 1EWCA 2V4LA 1EWYC 4GU2A 1QILA 1NEKB 3H9DA 2Z8LA 2WQYB 3AXCA 3OG5A 4J6IA 3H8HA 3TCAA 2KQ7A 1YQBA 1J19A 4MM3A 1SEBD 5CTRC 3DHGC 2LRUA 4EZJA 4P16A 2KHWB 4RGTA 3K9PB 1K52A 4A20A 2K25A 5HG2A 3AEDB 2A5UA 4NQLB 2J0KA 2DYMA 2O6VD 4HKZE 4IM2A 2K8BA 1L4DB 2BGFA 4IW0A 5IN7A 4II3B 2Y5PA 3RUIB 1C9FA 2LZ6A 3UQBA 2PEAA 2L7RA 3TSSA 2INPE 4KKIA 4MGZE 1UELA 4N6EB 4IG7B 5L83A 2ZVOA 3TEWA 2QMTA 3KLSX 1WYGA 1DOXA 1V49A 4F8CB 2JYTA 2FCNA 3DVGY 4US8A 3WAOA 4KGTA 4PYUA 1IGDA 1FM0D 2N9PC 2EMSA 2INCC 3Q8FA 2BQQA 1WGKA 2MW5A 2KMCA 4I6PA 3MC0B 2JX5A 2W82A 2L8JA 2GBKA 5IOIA 1AN8A 3V60A 3FILA 1TY0A 1PQSA 4K3CA 3MC9A 1RM6C 2KX3A 3ECIA 3CIRB 2K5PA 1ZUD2 3AU5A 4WJOA 5BMGA 5I4DA 2W54A 2OEDA 1TS4A 1PDXA 2IBIB 2KQ4X 2Y5BB 5AEKB 2KN4A 2R61A 1YQ3B 1TKEA 3HK0A 2KACA 1IPGA 2OJRA 1UWXA 3OAWA 1MHXA 4NNJB 1D5ZC 2K39A 1JWSD 4IWQA 3GE3C 3IG3A 2KOXA 1L6UA 2O6VA 2VZKD 3I57A 3PPAA 3U4EG 3LB8C 1E8YA 1WGRA 3ML8A 4B0MA 2FCSA 4ZRQA 2KQSA 3PZ7A 5LXIB 1F77A 1WX9A 5BMHA 1VRAB 2KDBA 4OVVA 2BW2A 5DPSA 2BF8B 3TMPB 2ONQA 3JW0X 3IT6B 5EE3A 3LYYA 2M0AA 3QC8B 4W9GA 3ZTDA 4NAWA 4NAMA 3B0AA 2JZ3B 3B08A 4HPPA 2LVOA 1ENFA 1BUIC 5D3DA 3MTNB 4PK1A 4YTPB 1YNTE 1EF5A 2CHXA 2JF5A 2EELA 2KJ6A 2V3SA 4IWOA 3DCGA 2IO0B 2NCNA 1VZ7A 2C7NB 3V05A 4A3PA 1BXTA 1UD7A 1JWMD 2EKEC 2J53A 2PIAA 4HPLB 3W1SA 2FUG1 4ZOHC 4Q2JA 5JXVA 4W9HA 4JX1C 2OHFA 4GLSC 2KTFA 3CSFA 3DWGC 1V1OA 4PS8A 4DHZE 1F52A 2DNFA 2KC2A 4RGOS 2IPKD 2DZKA 2DX5B 2PMVA 4RF1A 3B2GA 2JXTA 3UINB 1X1MA 1E8WA 1M94A 3SR6A 4EEWA 4TV3A 3TEYA 3KUZA 2KMAA 2MBHA 3BVGA 2KANA 3L0WB 4JE3B 2V1YA 1T5XD 2AX5A 2UU7A 2JWZA 4NZLB 5FR6A 3DBRB 3W5UB 1V2YA 1OQQA 4KDIC 1CZPA 1WGYA 1V5OA 1Q5WB 1IP9A 1RFAA 3VTUA 3LDZE 1K8RB 2XK5A 2L32A 1E7VA 1CK1A 2RPQA 3NZUA 3SEBA 4HJGE 5H8YE 3R2IA 4G0NB 4K1RB 2L00B 1MHHE 2RSUA 1L6VA 4WH4A 4GDKA 3Q3JA 4I6NB 2ZPNA 1UBQA 2NPTB 1XQQA 2HJ1A 5C2TB 1J7BA 3QHTA 1WY8A 2DWQA 2MLBA 1J7AA 5H92C 3AE1B 1WXQA 3ETRA 4ZDVA 4N9F4 3DVNU 5FKAC 1DOIA 2CKHB 2BBCA 2QHOA 2QSDA 3W2DA 1GC6A 2BKFA 1TS2A 3VRAB 2IJ0A 4RM9A 2B76B 1WXVA 1MI0A 3C8YA 2IY0B 2Q5WD 2AQ3B 2PPHA 4A90A 1OEYA 4K3BA 4MSMB 2JRIB 1FEHA 3ZW3A 3SHQA 1ZXIA 3ZJVA 2JVCA 3WAMA 4W9LA 4B95A 2N9LA 2KDFB 4HCPB 4UDUC 2NBUA 1SIJA 3ONSA 2HTHA 1ZDVA 2PE9A 1WX7A 3U7DA 2BKRB 2G1EA 1FNUA 1SXTA 1R4MI 2RGFA 1NI2A 2LMCA 1XXGA 1V80A 1UUPA 4LK0M 1YX5B 2KYWA 4A55A 4II2B 3NHEB 2CHWA 3AEGB 3UIOB 2D07B 3BYTB 2L1AA 2XN9C 1KM7A 4ZRIA 2M8SA 2N7EA 2BB6A 1MJDA 5G5HA 3DWMA 5JZEB 3RN9C 1I7HA 1ZGUB 4KKJA 2DAFA 4B0EA 2KT7A 4BZAA 3ZGZA 3DQVA 4PYZA 1V5TA 1FCCC 2NTSA 3P63A 3CF6E 1K53A 4GB9A 2ZVNA 3UQAA 3L17A 5EE9A 1XLNA 1YOVB 4C7ZA 1I4RA 2CU1A 5FK9C 1FXTB 1TTNA 2ASQA 1HZ6A 1UNSA 1P7EA 1SIFA 2LGDA 1UGJA 3U8ZA 3KWLA 3N1ZC 1Y56A 4B9KA 4WURA 5JH5C 3A1QB 2KVZA 1QOBA 1EO6A 2QC8A 2KX0A 2WU2B 3ABVB 4TQ0A 1NENB 1SE2A 2G45B 2DZIA 1P98A 2N1VA 1WZ3A 3W9CB 3M3JA 4OVZA 5C3JB 3AE8B 5BYRA 3M63B 2LHEA 4HDQA 4K7SA 4O1NA 1GAQB 2BWFA 1F1HA 1LO5D 4LCDE 1RWSA 3S2AA 2LVQA 2WYQA 2ZCBA 4BKSD 3A4RA 1C76A 1L0VB 4ARIA 2JT4B 3E9SA 4JGHB 3RNGC 3QWZB 3BK1A 4OVUA 3APDA 3RT3B 4WWNA 1YN5A 2WWZA 1VJKA 1D3ZA 3Q8EA 3RNFC 4DDID 4XZ4A 5LNK1 2FNJB 4MH8A 3GZNB 4KGSA 2MCNB 2WXKA 5CHFA 3PTFC 3C19A 2WHIA 4BKGA 2IGGA 5EE0A 3APCA 3H7PB 4EE2A 1KJTA 5BYSA 3L10B 3VUYA 4RFBA 3ZNGC 4OZCA 4BOZB 3AULA 4OHJA 4EKUA 2IGDA 4IC7B 4DHJD 4XYCA 3W5VB 3AE5B 1VDVA 3B2FA 3AN1A 1P1AA 4HLEA 1C3TA 2I1JA 2KN5A 1OFFA 4LNIA 1UGMA 3V62A 4MT5A 2MP2B 4AJWA 1PFDA 1RYJA 4DXAB 3ENEA 4XDCA 3R66C 3KWVA 1OQYA 3IFWB 2I2YA 1STEA 3L08A 1TGZB 1TKYA 1R7SA 5JHAA 3VTWA 1QOAA 3V6EB 3N20C 4A8XC 4GOCA 4GMVA 3GP7A 4YXDB 3DVNV 4HRSA 2HDEA 3A33B 3L54A 1KRHA 4ITKA 1MFWA 4KX6B 4YWGG 1FPYA 3VUWA 2XBBC 4K81A 1R4MB 3EUB2 4LDTB 4WQMA 2B3AA 1VLBA 4F1SA 1UWMA 4P7IA 3KH0A 4DXGA 1E5WA 2NS5A 2AQ2B 3VR9B 3VTVA 2L83A 3IBEA 1WZ0A 2N7DA 4MGKE 1JWBD 2GBRA 1WGGA 3APFA 3AB5A 3PZDA 3RNBC 5KHQA 1JCKB 3MHSD 3QIJA 1RRBA 1FNWA 1FFUA 1LM8B 3ALBA 2VH2A 3PT2B 4PS3A 3OJ3A 4JLCA 4NQKE 3U7ZA 2D11A 1HEZE 4EZLA 4G3XB 4A3OA 2WLBA 4CO7A 2GRIA 4WJQA 3PS6A 2C60A 1WYWB 4US9A 1WJ4A 3RCZA 5C1ZA 1XLQA 1QOFA 2RMMA 2EMTA 4YTMB 3I3TB 2MBEA 1G6JA 1QQRA 3TBLD 1GB4A 3QK0A 3UI3A 3DBRI 2KC1A 2RD0A 4RM8A 1ZPSA 4AJYB 1S1QB 2REXA 2LJ5A 2N0SB 3OJ4B 1FNVA 3NVVA 3N1YC 3ZIMA 4KGRA 2V3NA 2V9HA 4WQOB 3CWIA 4XWWA 4HEA1 2NPTA 1E8XA 3EECA 3GS2A 1Q10A 2XEWA 3WCQA 5DPTA 2KDMA 1FIQA 2BS4B 1J7CA 2K9XA 3ZJTA 5D3IB 1C77A
chains in the Genus database with same CATH topology
2DZKA 2DX5B 3PV1A 5AZGA 2WX1A 4E71A 4AOFA 3K9OB 1HE8A 3U30A 4GXBA 4W9EA 1Z5SB 4IWPA 3MJWA 3PVLA 4WWPA 3UINB 2LD9A 3IVFA 1X1MA 4ANWA 4KIKB 1E8WA 1M94A 4M8MA 2ZCCA 4CYEA 2DZJA 5IAAC 4TV3A 2DAJA 4AWJA 4EEWA 3KUZA 2KMAA 2MBHA 2ZEQA 3ZO5B 3RD2A 4X57B 1UBIA 2UWQA 2KANA 2VRRB 4MJSA 2KNBA 3L0WB 3M95A 2L3ZA 3EHVA 2V1YA 1NBFC 2JWZA 2G4DB 2AL6A 2L0TA 2M0XA 3DPDA 3HM3A 4NAWB 5FR6A 4FN2A 4NJ7A 4ANVA 3PSEB 4BKTA 1V2YA 2C5LC 3WA0A 4KDIC 4W9FA 1WGYA 1V5OA 5J18A 1Q5WB 1IP9A 1RFAA 1WF9A 3AU4A 4GSWA 4NJ6A 3VTUA 3LDZE 1K8RB 3KVFB 2XK5A 4FULA 1A5RA 1YIWA 2MWSB 3A9KB 3QQ8B 1Q0WB 1E7VA 2RPQA 3NZUA 3UGBB 4HXDA 2YVCA 3DVGX 4W9JA 2LGXA 2NBVB 4BBNC 4G0NB 1EF1A 1H4RA 4K1RB 2RR9A 2L00B 1WE6A 1NDDA 1I42A 4MH0E 2RSUA 1GC7A 2LWPA 4GDKA 3Q3JA 1LFDA 1WIAA 3VDZA 3O65B 4I6NB 4ZRKA 1IYFA 2ZPNA 1UBQA 2BPSA 2NPTB 4GDLA 4KSLC 3VFKA 3VQIA 4GIVA 1XQQA 3PLUA 4FJYA 4NY0A 2YLMA 2OOBB 3JYUA 4CHKA 1C1YB 2JRHA 3SU8X 3RULA 4DBGA 3QHTA 2KTRB 1WY8A 2MLBA 1E90A 2G4SA 5JHBA 2FUHB 1Z2MA 4FJVB 4YL8A 4B6WA 3ZRCA 2KXJA 1I35A 1TZ1A 2BYVE 4ZDVA 1WXMA 4N9F4 3DVNU 2MBBB 3TIXA 3NZSA 3VVWB 2KKCA 4HCNB 3PREA 1Q1OA 1WR1A 2CKHB 2QHOA 2MSED 3DDCB 4GGQA 3TJPA 2D2QA 1GC6A 2L05A 2N9XA 2MA9B 1WI0A 3QAQA 3W1SC 1GNUA 2BKFA 2MBOA 4M8NA 4DHZB 2JUOA 4KZCA 3GOEA 5D7GA 3PRMB 2LUEA 2DHZA 3EC8A 1P3QU 1WFYA 2LI5A 4RM9A 5DPWA 1YJ1A 4MEMA 3N32A 2KJHB 1Y8RC 1WXVA 5G2NA 4IM0A 2IY0B 4NPNA 3ML9A 4MJSB 2LGYA 2ZJDA 2PPHA 3V61A 3H1UA 3A1QA 4KV2A 4G50A 4MGIE 3ZRFA 2KFKA 1OEYA 4MSMB 2JRIB 2KD0A 3ZW3A 2KDIA 1RLFA 2LVPA 5GMVA 5DPRA 3JVZX 3SHQA 3VHTC 1WRDB 2JVCA 3WAMA 2IO2B 4W9LA 3W1YA 4B95A 2IZVB 1H8CA 2CR5A 2KDFB 4HCPB 2XK5B 2NBUA 4K7WA 3ONSA 1GUAB 4LJOB 2HTHA 2NBWB 1JRUA 2HJ8A 2M4NA 3SD5A 5CX3A 2PE9A 1VD2A 4EFOA 1WX7A 3D32A 2Z0EB 3RZFA 4BVUC 3U7DA 2J7QB 2BKRB 4JQWC 5EDSA 3SDLC 4MDKE 3RZWC 2KVRA 1R4MI 2RGFA 3QCAA 1NI2A 4KVGB 3KUDB 2MQJA 1L2NA 2BWES 2ZPYA 3BY4B 2C9WB 3H7SA 3TL5A 1V80A 2PE6B 3WALA 1WR6E 1YX5B 4GDKB 4II2B 1AARA 4G11A 3NHEB 1WXAA 2CHWA 4HWIB 1KLVA 3UIOB 1V86A 2D07B 1VCBA 4GDLB 4IUMB 1WM2A 3VUXA 1KM7A 3EFUA 4ZRIA 2M8SA 4JL9A 2N7EA 3PGEA 1GJZA 3L13A 4WWOA 5AZFA 3WAPA 5D2MB 5BO4B 4AUQC 5JZEB 2FIFA 3QA8A 5AZHA 4LDTD 2O2VB 1WM3A 1ZGUB 4MSQB 3ZUNA 5L95C 1ZKHA 5HKHA 3PLVA 2DAFA 5TR5A 3DQVA 2ZNVB 3A9JA 2FCMA 2GMIC 3DBSA 3UF8A 4FBJB 1UH6A 2K8CA 4PYZA 1V5TA 1EUVB 2FCQA 4BFRA 3ZTCA 3CF6E 1OEYJ 2UYZB 4GB9A 2ZVNA 2K6QA 3UQAA 3DBHI 1XD3B 3L17A 3N3KB 3VH4B 1P0RA 3PRPB 4BKSA 2W9NA 1J0GA 4F7ZA 2CU1A 2MBQA 3H6NA 1FXTB 1TTNA 1XT9B 2C7HA 2ASQA 2LXAA 2KWVB 2KWUB 2N1WA 1SIFA 2R2OA 2LGDA 1OTRB 4E74A 3U8ZA 1SE9A 1SGHA 2LXCA 4ANXA 1WE7A 2NR2A 3ZVVA 4B9KA 5JH5C 3A1QB 3H7PA 4HK2A 4W9IA 3ZDTA 1T0YA 1EO6A 5D94A 2KFKB 2KX0A 3GZNI 4ZYNA 4ICVA 4PS7A 3C0RB 4TQ0A 3HHMA 4KZ0A 4DWFA 1TBEA 4WJPA 4URKA 4FHJA 4I6LB 1QZEA 2G45B 1RAXA 2DZIA 1P98A 2N1VA 1WZ3A 1YD8U 4BOSC 5J2RA 4AP4C 3M3JA 1F9JA 4EZKA 5C23A 2K6DB 5G55A 3M63B 2ZNVC 2J0JA 4HDQA 4K7SA 1L7YA 4TKNA 2BWFA 3B1LX 3UIPB 2MP2A 3N30A 4KDLB 3NS8A 4LCDE 3S2AA 4KSKC 3NOBA 2K1FA 2LVQA 2KK8A 2O2VA 2K8HA 2WYQA 2D10A 2M17A 2ZCBA 3A4RA 4BKSD 2ZZPB 4FADA 2V4LA 4GU2A 2JT4B 4JGHB 2WDTB 3H9DA 2N4FA 5KHOA 3AXCA 3QWZB 4J6IA 4OVUA 1MG8A 4DDGD 3APDA 1LXDA 3TCAA 3RT3B 5IA7A 4M0WB 2KQ7A 2Z0DB 5J17A 1YQBA 1J19A 4WWNA 4MM3A 3T9LA 4W9DA 2KWCA 4W9CA 5CTRC 1WMHA 1WXSA 3HM6X 3VXWA 2LRUA 4EZJA 2WWZA 2KHWB 1D3ZA 2JPHA 2IO3B 3K9PB 2R2QA 3KYDD 3A9JB 4EOYA 4K7UA 4DDID 2HE7A 4A20A 3NY5A 2KLGA 2K25A 4XZ4A 3LJ3A 2GOWA 4GN1A 2BYEA 2FNJB 2A5UA 4HDOA 4NQLB 2MCNB 2J0KA 2DYMA 2O6VD 3PTFC 5CHFA 2A4ZA 3M62B 3L16A 4IM2A 4HPMB 2K8BA 3X0WA 2KDEB 2BGFA 4BKGA 1YX6B 4IW0A 4HVBA 3APCA 4II3B 3H7PB 3PRZA 2FIDA 1UZXB 1WH3A 2M1MA 1ISNA 1KJTA 4FJZA 3RUIB 3L10B 2LZ6A 3VUYA 2PJHA 3ZNGC 4BOZB 3UQBA 2PEAA 2L7RA 3AULA 2G3QB 2GBJA 4EKUA 4FA6A 5E6PA 1OGWA 4IC7B 1R4NI 3RYTA 4DHJD 1E7UA 4MGZE 3VAWA 1UELA 4MGYE 2Z59B 4IG7B 4JIOU 2ZVOA 5L83A 1KOTA 2JY6A 1P1AA 2L76A 4HLEA 1C3TA 2I1JA 2KN5A 1LQBA 1V49A 3PHXB 4F8CB 1UGMA 3V62A 2FCNA 3DVGY 2MP2B 1U4AA 2GBMA 4AJWA 4DXAB 3ENEA 4HJKA 2KO3A 3WAOA 3X23A 3R66C 4PYUA 2JZZA 1OQYA 3IFWB 2N9PC 5CHWA 2AL3A 3L08A 2EMSA 1TGZB 2C7MB 4TQ1A 2DENB 2MW5A 2KMCA 5JHAA 2AEHA 3VTWA 4I6PA 3ZNZB 3DBLI 3V6EB 2KFJA 2L8JA 4XX5A 2DYBA 2GBKA 2CS4A 4GOCA 4GMVA 3V60A 3ZKJC 1BT0A 2L0FA 3DVNV 2KLCA 1PQSA 5E6NA 3A33B 1WMHB 3L54A 4DHJB 2KX3A 3ECIA 3T8MA 3AU5A 2IYDB 4WJOA 1P9DU 5D6JB 2I1KA 3A4SC 3CSTA 3R7QA 1CMXB 3VUWA 1S3SG 2HD5B 2XBBC 1V6EA 4WAAA 4ASWC 4K81A 4LDTB 4W9KA 3QARA 2KJRA 3DOWA 2B3AA 2IBIB 3QX1A 2Y5BB 3KW5B 4F1SA 4E3CA 4P7IA 3KH0A 5AEKB 2IY1B 3JSVA 3HK0A 1E5WA 3ZDMC 1IPGA 2NS5A 2OJRA 3OAWA 4NNJB 3VTVA 2K39A 2MRPA 4IWQA 2LASA 3IBEA 3IG3A 2KOXA 1WZ0A 2N7DA 2O6VA 3AI5A 3PPAA 3CMMB 4MGKE 4FLHA 2NVUI 2GBRA 4XC2A 1WGGA 3APFA 3PZDA 1E8YA 1WGRA 3ML8A 5KHQA 2FCSA 4IM3A 2KQSA 3MHSD 4ICUA 3QIJA 1RRBA 2CHZA 4DK5A 3P2BA 4ANUA 3VH3B 2N9EB 5LXIB 2DYOA 1WX9A 3ZNID 1LM8B 3ALBA 4KIKA 1WGHA 2KDBA 2GBNA 3PT2B 4OVVA 3R3MA 4PS3A 1ZW7A 4BBNF 3OJ3A 4JLCA 4NQKE 5DPSA 1GG3A 2BF8B 3HIZA 3KYCD 4FHKA 2D11A 3TMPB 4EZLA 4G3XB 4RMAA 3JW0X 4A3OA 4CO7A 5LXHA 3WIMA 4WJQA 3PS6A 3QC8B 2LRWA 4W9GA 3ZTDA 2C60A 1WYWB 4NAWA 4LJPB 1WJ4A 3B0AA 3KUCB 2JZ3B 2FAZA 3B08A 2LVOA 2MX2A 3RCZA 5C1ZA 1J8CA 4TUUA 3MTNB 2EMTA 1V9JA 3ZLZA 1EF5A 1WX8A 2CHXA 2JF5A 2KJ6A 2V3SA 3I3TB 2WX0A 3PHWB 4IWOA 5LLIA 2MBEA 1WJUA 1G6JA 3A9KA 5CHVC 3DCGA 2IO0B 2NCNA 3TBLD 3QK0A 2C7NB 5DCNA 2D3GA 1E8ZA 2JXXA 3DBRI 4A3PA 1UD7A 2KC1A 2RD0A 4RM8A 1V81A 2EKEC 4AJYB 4HPLB 1S1QB 1WGDA 3W1SA 2DZMA 5E6OA 3R7RA 2REXA 2LJ5A 2BYFA 3OJ4B 3OLMD 4EUTA 3ZIMA 3IHPC 4W9HA 4WQOB 2AYOB 1WJ6A 2NPTA 1E8XA 3EECA 1WJNA 3BINA 3WANA 2XEWA 2IO1B 3JSVB 3Q3FA 5DPTA 2KTFA 3CSFA 2KTRA 4PS8A 4WJNA 4ZRJA 2AWTA 2J0MA 4MELA 4DHZE 2KZRA 3ZNHB 2KC2A 2O6VB 3V6CB 3QJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZK A;  2DX5 B;  3PV1 A;  5AZG A;  2WX1 A;  4E71 A;  4AOF A;  3K9O B;  1HE8 A;  3U30 A;  4GXB A;  4W9E A;  1Z5S B;  4IWP A;  3MJW A;  3PVL A;  4WWP A;  3UIN B;  2LD9 A;  3IVF A;  1X1M A;  4ANW A;  4KIK B;  1E8W A;  1M94 A;  4M8M A;  2ZCC A;  4CYE A;  2DZJ A;  5IAA C;  4TV3 A;  2DAJ A;  4AWJ A;  4EEW A;  3KUZ A;  2KMA A;  2MBH A;  2ZEQ A;  3ZO5 B;  3RD2 A;  4X57 B;  1UBI A;  2UWQ A;  2KAN A;  2VRR B;  4MJS A;  2KNB A;  3L0W B;  3M95 A;  2L3Z A;  3EHV A;  2V1Y A;  1NBF C;  2JWZ A;  2G4D B;  2AL6 A;  2L0T A;  2M0X A;  3DPD A;  3HM3 A;  4NAW B;  5FR6 A;  4FN2 A;  4NJ7 A;  4ANV A;  3PSE B;  4BKT A;  1V2Y A;  2C5L C;  3WA0 A;  4KDI C;  4W9F A;  1WGY A;  1V5O A;  5J18 A;  1Q5W B;  1IP9 A;  1RFA A;  1WF9 A;  3AU4 A;  4GSW A;  4NJ6 A;  3VTU A;  3LDZ E;  1K8R B;  3KVF B;  2XK5 A;  4FUL A;  1A5R A;  1YIW A;  2MWS B;  3A9K B;  3QQ8 B;  1Q0W B;  1E7V A;  2RPQ A;  3NZU A;  3UGB B;  4HXD A;  2YVC A;  3DVG X;  4W9J A;  2LGX A;  2NBV B;  4BBN C;  4G0N B;  1EF1 A;  1H4R A;  4K1R B;  2RR9 A;  2L00 B;  1WE6 A;  1NDD A;  1I42 A;  4MH0 E;  2RSU A;  1GC7 A;  2LWP A;  4GDK A;  3Q3J A;  1LFD A;  1WIA A;  3VDZ A;  3O65 B;  4I6N B;  4ZRK A;  1IYF A;  2ZPN A;  1UBQ A;  2BPS A;  2NPT B;  4GDL A;  4KSL C;  3VFK A;  3VQI A;  4GIV A;  1XQQ A;  3PLU A;  4FJY A;  4NY0 A;  2YLM A;  2OOB B;  3JYU A;  4CHK A;  1C1Y B;  2JRH A;  3SU8 X;  3RUL A;  4DBG A;  3QHT A;  2KTR B;  1WY8 A;  2MLB A;  1E90 A;  2G4S A;  5JHB A;  2FUH B;  1Z2M A;  4FJV B;  4YL8 A;  4B6W A;  3ZRC A;  2KXJ A;  1I35 A;  1TZ1 A;  2BYV E;  4ZDV A;  1WXM A;  4N9F 4;  3DVN U;  2MBB B;  3TIX A;  3NZS A;  3VVW B;  2KKC A;  4HCN B;  3PRE A;  1Q1O A;  1WR1 A;  2CKH B;  2QHO A;  2MSE D;  3DDC B;  4GGQ A;  3TJP A;  2D2Q A;  1GC6 A;  2L05 A;  2N9X A;  2MA9 B;  1WI0 A;  3QAQ A;  3W1S C;  1GNU A;  2BKF A;  2MBO A;  4M8N A;  4DHZ B;  2JUO A;  4KZC A;  3GOE A;  5D7G A;  3PRM B;  2LUE A;  2DHZ A;  3EC8 A;  1P3Q U;  1WFY A;  2LI5 A;  4RM9 A;  5DPW A;  1YJ1 A;  4MEM A;  3N32 A;  2KJH B;  1Y8R C;  1WXV A;  5G2N A;  4IM0 A;  2IY0 B;  4NPN A;  3ML9 A;  4MJS B;  2LGY A;  2ZJD A;  2PPH A;  3V61 A;  3H1U A;  3A1Q A;  4KV2 A;  4G50 A;  4MGI E;  3ZRF A;  2KFK A;  1OEY A;  4MSM B;  2JRI B;  2KD0 A;  3ZW3 A;  2KDI A;  1RLF A;  2LVP A;  5GMV A;  5DPR A;  3JVZ X;  3SHQ A;  3VHT C;  1WRD B;  2JVC A;  3WAM A;  2IO2 B;  4W9L A;  3W1Y A;  4B95 A;  2IZV B;  1H8C A;  2CR5 A;  2KDF B;  4HCP B;  2XK5 B;  2NBU A;  4K7W A;  3ONS A;  1GUA B;  4LJO B;  2HTH A;  2NBW B;  1JRU A;  2HJ8 A;  2M4N A;  3SD5 A;  5CX3 A;  2PE9 A;  1VD2 A;  4EFO A;  1WX7 A;  3D32 A;  2Z0E B;  3RZF A;  4BVU C;  3U7D A;  2J7Q B;  2BKR B;  4JQW C;  5EDS A;  3SDL C;  4MDK E;  3RZW C;  2KVR A;  1R4M I;  2RGF A;  3QCA A;  1NI2 A;  4KVG B;  3KUD B;  2MQJ A;  1L2N A;  2BWE S;  2ZPY A;  3BY4 B;  2C9W B;  3H7S A;  3TL5 A;  1V80 A;  2PE6 B;  3WAL A;  1WR6 E;  1YX5 B;  4GDK B;  4II2 B;  1AAR A;  4G11 A;  3NHE B;  1WXA A;  2CHW A;  4HWI B;  1KLV A;  3UIO B;  1V86 A;  2D07 B;  1VCB A;  4GDL B;  4IUM B;  1WM2 A;  3VUX A;  1KM7 A;  3EFU A;  4ZRI A;  2M8S A;  4JL9 A;  2N7E A;  3PGE A;  1GJZ A;  3L13 A;  4WWO A;  5AZF A;  3WAP A;  5D2M B;  5BO4 B;  4AUQ C;  5JZE B;  2FIF A;  3QA8 A;  5AZH A;  4LDT D;  2O2V B;  1WM3 A;  1ZGU B;  4MSQ B;  3ZUN A;  5L95 C;  1ZKH A;  5HKH A;  3PLV A;  2DAF A;  5TR5 A;  3DQV A;  2ZNV B;  3A9J A;  2FCM A;  2GMI C;  3DBS A;  3UF8 A;  4FBJ B;  1UH6 A;  2K8C A;  4PYZ A;  1V5T A;  1EUV B;  2FCQ A;  4BFR A;  3ZTC A;  3CF6 E;  1OEY J;  2UYZ B;  4GB9 A;  2ZVN A;  2K6Q A;  3UQA A;  3DBH I;  1XD3 B;  3L17 A;  3N3K B;  3VH4 B;  1P0R A;  3PRP B;  4BKS A;  2W9N A;  1J0G A;  4F7Z A;  2CU1 A;  2MBQ A;  3H6N A;  1FXT B;  1TTN A;  1XT9 B;  2C7H A;  2ASQ A;  2LXA A;  2KWV B;  2KWU B;  2N1W A;  1SIF A;  2R2O A;  2LGD A;  1OTR B;  4E74 A;  3U8Z A;  1SE9 A;  1SGH A;  2LXC A;  4ANX A;  1WE7 A;  2NR2 A;  3ZVV A;  4B9K A;  5JH5 C;  3A1Q B;  3H7P A;  4HK2 A;  4W9I A;  3ZDT A;  1T0Y A;  1EO6 A;  5D94 A;  2KFK B;  2KX0 A;  3GZN I;  4ZYN A;  4ICV A;  4PS7 A;  3C0R B;  4TQ0 A;  3HHM A;  4KZ0 A;  4DWF A;  1TBE A;  4WJP A;  4URK A;  4FHJ A;  4I6L B;  1QZE A;  2G45 B;  1RAX A;  2DZI A;  1P98 A;  2N1V A;  1WZ3 A;  1YD8 U;  4BOS C;  5J2R A;  4AP4 C;  3M3J A;  1F9J A;  4EZK A;  5C23 A;  2K6D B;  5G55 A;  3M63 B;  2ZNV C;  2J0J A;  4HDQ A;  4K7S A;  1L7Y A;  4TKN A;  2BWF A;  3B1L X;  3UIP B;  2MP2 A;  3N30 A;  4KDL B;  3NS8 A;  4LCD E;  3S2A A;  4KSK C;  3NOB A;  2K1F A;  2LVQ A;  2KK8 A;  2O2V A;  2K8H A;  2WYQ A;  2D10 A;  2M17 A;  2ZCB A;  3A4R A;  4BKS D;  2ZZP B;  4FAD A;  2V4L A;  4GU2 A;  2JT4 B;  4JGH B;  2WDT B;  3H9D A;  2N4F A;  5KHO A;  3AXC A;  3QWZ B;  4J6I A;  4OVU A;  1MG8 A;  4DDG D;  3APD A;  1LXD A;  3TCA A;  3RT3 B;  5IA7 A;  4M0W B;  2KQ7 A;  2Z0D B;  5J17 A;  1YQB A;  1J19 A;  4WWN A;  4MM3 A;  3T9L A;  4W9D A;  2KWC A;  4W9C A;  5CTR C;  1WMH A;  1WXS A;  3HM6 X;  3VXW A;  2LRU A;  4EZJ A;  2WWZ A;  2KHW B;  1D3Z A;  2JPH A;  2IO3 B;  3K9P B;  2R2Q A;  3KYD D;  3A9J B;  4EOY A;  4K7U A;  4DDI D;  2HE7 A;  4A20 A;  3NY5 A;  2KLG A;  2K25 A;  4XZ4 A;  3LJ3 A;  2GOW A;  4GN1 A;  2BYE A;  2FNJ B;  2A5U A;  4HDO A;  4NQL B;  2MCN B;  2J0K A;  2DYM A;  2O6V D;  3PTF C;  5CHF A;  2A4Z A;  3M62 B;  3L16 A;  4IM2 A;  4HPM B;  2K8B A;  3X0W A;  2KDE B;  2BGF A;  4BKG A;  1YX6 B;  4IW0 A;  4HVB A;  3APC A;  4II3 B;  3H7P B;  3PRZ A;  2FID A;  1UZX B;  1WH3 A;  2M1M A;  1ISN A;  1KJT A;  4FJZ A;  3RUI B;  3L10 B;  2LZ6 A;  3VUY A;  2PJH A;  3ZNG C;  4BOZ B;  3UQB A;  2PEA A;  2L7R A;  3AUL A;  2G3Q B;  2GBJ A;  4EKU A;  4FA6 A;  5E6P A;  1OGW A;  4IC7 B;  1R4N I;  3RYT A;  4DHJ D;  1E7U A;  4MGZ E;  3VAW A;  1UEL A;  4MGY E;  2Z59 B;  4IG7 B;  4JIO U;  2ZVO A;  5L83 A;  1KOT A;  2JY6 A;  1P1A A;  2L76 A;  4HLE A;  1C3T A;  2I1J A;  2KN5 A;  1LQB A;  1V49 A;  3PHX B;  4F8C B;  1UGM A;  3V62 A;  2FCN A;  3DVG Y;  2MP2 B;  1U4A A;  2GBM A;  4AJW A;  4DXA B;  3ENE A;  4HJK A;  2KO3 A;  3WAO A;  3X23 A;  3R66 C;  4PYU A;  2JZZ A;  1OQY A;  3IFW B;  2N9P C;  5CHW A;  2AL3 A;  3L08 A;  2EMS A;  1TGZ B;  2C7M B;  4TQ1 A;  2DEN B;  2MW5 A;  2KMC A;  5JHA A;  2AEH A;  3VTW A;  4I6P A;  3ZNZ B;  3DBL I;  3V6E B;  2KFJ A;  2L8J A;  4XX5 A;  2DYB A;  2GBK A;  2CS4 A;  4GOC A;  4GMV A;  3V60 A;  3ZKJ C;  1BT0 A;  2L0F A;  3DVN V;  2KLC A;  1PQS A;  5E6N A;  3A33 B;  1WMH B;  3L54 A;  4DHJ B;  2KX3 A;  3ECI A;  3T8M A;  3AU5 A;  2IYD B;  4WJO A;  1P9D U;  5D6J B;  2I1K A;  3A4S C;  3CST A;  3R7Q A;  1CMX B;  3VUW A;  1S3S G;  2HD5 B;  2XBB C;  1V6E A;  4WAA A;  4ASW C;  4K81 A;  4LDT B;  4W9K A;  3QAR A;  2KJR A;  3DOW A;  2B3A A;  2IBI B;  3QX1 A;  2Y5B B;  3KW5 B;  4F1S A;  4E3C A;  4P7I A;  3KH0 A;  5AEK B;  2IY1 B;  3JSV A;  3HK0 A;  1E5W A;  3ZDM C;  1IPG A;  2NS5 A;  2OJR A;  3OAW A;  4NNJ B;  3VTV A;  2K39 A;  2MRP A;  4IWQ A;  2LAS A;  3IBE A;  3IG3 A;  2KOX A;  1WZ0 A;  2N7D A;  2O6V A;  3AI5 A;  3PPA A;  3CMM B;  4MGK E;  4FLH A;  2NVU I;  2GBR A;  4XC2 A;  1WGG A;  3APF A;  3PZD A;  1E8Y A;  1WGR A;  3ML8 A;  5KHQ A;  2FCS A;  4IM3 A;  2KQS A;  3MHS D;  4ICU A;  3QIJ A;  1RRB A;  2CHZ A;  4DK5 A;  3P2B A;  4ANU A;  3VH3 B;  2N9E B;  5LXI B;  2DYO A;  1WX9 A;  3ZNI D;  1LM8 B;  3ALB A;  4KIK A;  1WGH A;  2KDB A;  2GBN A;  3PT2 B;  4OVV A;  3R3M A;  4PS3 A;  1ZW7 A;  4BBN F;  3OJ3 A;  4JLC A;  4NQK E;  5DPS A;  1GG3 A;  2BF8 B;  3HIZ A;  3KYC D;  4FHK A;  2D11 A;  3TMP B;  4EZL A;  4G3X B;  4RMA A;  3JW0 X;  4A3O A;  4CO7 A;  5LXH A;  3WIM A;  4WJQ A;  3PS6 A;  3QC8 B;  2LRW A;  4W9G A;  3ZTD A;  2C60 A;  1WYW B;  4NAW A;  4LJP B;  1WJ4 A;  3B0A A;  3KUC B;  2JZ3 B;  2FAZ A;  3B08 A;  2LVO A;  2MX2 A;  3RCZ A;  5C1Z A;  1J8C A;  4TUU A;  3MTN B;  2EMT A;  1V9J A;  3ZLZ A;  1EF5 A;  1WX8 A;  2CHX A;  2JF5 A;  2KJ6 A;  2V3S A;  3I3T B;  2WX0 A;  3PHW B;  4IWO A;  5LLI A;  2MBE A;  1WJU A;  1G6J A;  3A9K A;  5CHV C;  3DCG A;  2IO0 B;  2NCN A;  3TBL D;  3QK0 A;  2C7N B;  5DCN A;  2D3G A;  1E8Z A;  2JXX A;  3DBR I;  4A3P A;  1UD7 A;  2KC1 A;  2RD0 A;  4RM8 A;  1V81 A;  2EKE C;  4AJY B;  4HPL B;  1S1Q B;  1WGD A;  3W1S A;  2DZM A;  5E6O A;  3R7R A;  2REX A;  2LJ5 A;  2BYF A;  3OJ4 B;  3OLM D;  4EUT A;  3ZIM A;  3IHP C;  4W9H A;  4WQO B;  2AYO B;  1WJ6 A;  2NPT A;  1E8X A;  3EEC A;  1WJN A;  3BIN A;  3WAN A;  2XEW A;  2IO1 B;  3JSV B;  3Q3F A;  5DPT A;  2KTF A;  3CSF A;  2KTR A;  4PS8 A;  4WJN A;  4ZRJ A;  2AWT A;  2J0M A;  4MEL A;  4DHZ E;  2KZR A;  3ZNH B;  2KC2 A;  2O6V B;  3V6C B;  3QJZ A; 
#chains in the Genus database with same CATH topology
 4BAX A;  4AOF A;  3K9O B;  4GXB A;  3PVL A;  4WWP A;  4ANW A;  3IVF A;  4C4V B;  4KIK B;  4A9A A;  4CYE A;  3GE8 C;  4AWJ A;  1TIF A;  3HUI A;  3ZO5 B;  2GB1 A;  4X57 B;  1UBI A;  5BYQ A;  3TUO A;  2L3Z A;  2EKI A;  4M00 A;  2L0T A;  2M0X A;  1SSN A;  4ANV A;  4FN2 A;  4NJ7 A;  2DLB A;  2JYE A;  3WA0 A;  5J18 A;  4J3O D;  3KVF B;  4FUL A;  1PGB A;  3A9K B;  2M56 B;  2BYT A;  2PLP A;  2YVC A;  3DVG X;  4W9J A;  5EE1 A;  1EF1 A;  1WE6 A;  1I42 A;  1ZOY B;  1SE3 A;  1L0Y B;  3VDZ A;  3O65 B;  3P42 A;  4ZRK A;  1IYF A;  2BPS A;  2WXF A;  3VQI A;  3PLU A;  2YLM A;  3JYU A;  2WXQ A;  1I4H A;  3RUL A;  1N62 A;  2G4S A;  5JHB A;  2FUH B;  4YL8 A;  1XLP A;  3IAM 1;  1GOZ A;  3J9C A;  2KXJ A;  1I35 A;  1DYQ A;  1TZ1 A;  1C4C A;  3OWE B;  3QAQ A;  3FAH A;  4N59 A;  4DHZ B;  2JUO A;  3VR8 B;  3BYY B;  5D7G A;  1FMA D;  3NVY A;  2LI5 A;  1TYG B;  5HI1 A;  2BT6 A;  3N32 A;  1C4P A;  3PO0 A;  3ML9 A;  4MJS B;  1HTQ A;  2LGY A;  2PW9 A;  4NJC A;  4ZHP A;  3A1Q A;  2BS3 B;  4R3D A;  1IBX B;  1TJE A;  3Q3N C;  5AUK A;  2KDI A;  3DHH C;  5GMV A;  5DPR A;  3JVZ X;  3VHT C;  3IAS 1;  2IO2 B;  1KLG D;  5FR3 A;  1H8C A;  4LJO B;  1SF0 A;  1VD2 A;  3RZF A;  4JQW C;  1KFY B;  4MDK E;  3RZW C;  1YJJ A;  2PVG C;  2C9W B;  2YEP F;  1WR6 E;  1AAR A;  3MP9 A;  1KLV A;  1V86 A;  2W55 A;  1TS5 A;  1VCB A;  3VUX A;  4JL9 A;  3PGE A;  3L13 A;  1CJE A;  2LUM A;  2CU3 A;  2J42 A;  5D2M B;  2FE8 A;  4LNO A;  3QA8 A;  4LDT D;  5L95 C;  4MSQ B;  1FRR A;  1ZKH A;  3AE4 B;  5HKH A;  3T3N A;  1KF6 B;  1QLB B;  4P6V F;  3DBS A;  2WGS A;  3DHI C;  4BFR A;  3ZTC A;  3HVZ A;  2K6Q A;  3DBH I;  2J4X A;  2W9N A;  3URY A;  1CQV A;  2C7H A;  2N1W A;  2KWU B;  3MHZ A;  1OTR B;  4E74 A;  1WE7 A;  3EA6 A;  3H7P A;  4HK2 A;  3ZDT A;  5D94 A;  1TZO A;  4ZYN A;  3GZN I;  3AE3 B;  4PS7 A;  4DQO C;  4DWF A;  2W3R A;  4BOS C;  4S0R A;  1C4A A;  4AP4 C;  3AEF B;  5G55 A;  1T3Q A;  2J0J A;  1T0S C;  4L1B A;  4ACF A;  2MP2 A;  2LGS A;  4KSK C;  3NOB A;  2O2V A;  2M17 A;  3TEX A;  5IKC M;  3RMK C;  1YN4 A;  2ZZP B;  4FAD A;  2WXP A;  2N4F A;  1N5X A;  5KHO A;  1MG8 A;  4LNF A;  5J17 A;  5IA7 A;  4M0W B;  2Z0D B;  2V0G A;  4RNA A;  3T9L A;  4RCO A;  1NYR A;  1WXS A;  1L5P A;  2IO3 B;  3KYD D;  3A9J B;  1HTO A;  2KAJ A;  3P4R B;  1XF5 L;  1N63 A;  2GOW A;  1E0Z A;  2BYE A;  5HHD G;  1XLO A;  4HDO A;  3M62 B;  3L16 A;  4HPM B;  3X0W A;  2KDE B;  4P1B C;  2MHJ A;  2N7J A;  1N5W A;  1L0X B;  1UZX B;  1WH3 A;  1ISN A;  4FJZ A;  1I4X A;  2PJH A;  4XWT A;  1I4Q A;  4FA6 A;  5E6P A;  1OGW A;  3RYT A;  3RPF C;  4MGY E;  2Z59 B;  1NVI D;  4CQN A;  4YT0 B;  4OZB A;  2PTL A;  5IP4 D;  1LQB A;  3Q6B A;  1U4A A;  1JW9 D;  2KO3 A;  3X23 A;  2ACZ B;  2JZZ A;  4OZA A;  5CHW A;  2KMM A;  3NG0 A;  1XCT L;  4TQ1 A;  2DEN B;  2RDG A;  3N1X C;  2V4I B;  3EGR A;  3DBL I;  4JWU C;  1SB3 C;  2CS4 A;  1FCL A;  2KLC A;  1JRO A;  5E6N A;  2WDV B;  1WMH B;  2PKO A;  4M01 A;  3AMZ A;  1FXA A;  1I4P A;  5D6J B;  3A4S C;  3R7Q A;  1CMX B;  1IGC A;  1GPX A;  1MPE A;  2JU6 X;  2HD5 B;  1V6E A;  4WAA A;  4W9K A;  2D3B A;  3DOW A;  2RDB C;  1R4N B;  3ZDM C;  2MRP A;  2LAS A;  3AI5 A;  1FRD A;  1FXI A;  4FLH A;  3N9Y C;  1E7P B;  3VRB B;  4XC2 A;  1ET9 A;  3BWU D;  4ARC A;  4DK5 A;  1QF6 A;  1EM7 A;  2N9E B;  2DYO A;  2JQR B;  5HFY A;  4C4V A;  2LHD A;  4KIK A;  4IDI A;  1WGH A;  2GBN A;  3R3M A;  4YSZ B;  2MEK A;  1GG3 A;  3HIZ A;  3LXF A;  3DBH B;  2K3U A;  4RMA A;  5LXH A;  3WIM A;  1YMH E;  1AYF A;  2WNM A;  1D5X C;  5T8I A;  4LJP B;  1B1Z A;  2FAZ A;  3AEA B;  4C7Y A;  4WWM A;  1J8C A;  4RGN A;  1V9J A;  3RFZ B;  3ZLZ A;  3U52 E;  2VZK B;  2WX0 A;  1WJU A;  3P4Q B;  3A9K A;  5DCN A;  2JXX A;  1E10 A;  2LEK A;  1V8C A;  1WRI A;  1WGD A;  4QAY A;  4FXC A;  2JSV X;  2DZM A;  1E6E B;  2BYF A;  4WIP A;  3OLM D;  4IKG A;  1ROE A;  2AYO B;  1BML C;  3BIN A;  2IO1 B;  4LNN A;  3JSV B;  2IGH A;  4WJN A;  2Y5C A;  4ZRJ A;  5MPO A;  2TSS A;  2AWT A;  4MEL A;  3RNE C;  2Y3A A;  3ZNH B;  3QJZ A;  3NRZ A;  1A70 A;  3P1M A;  5AZG A;  2WX1 A;  2QIE B;  4E71 A;  3TEZ A;  2WDR B;  4W9E A;  2BS2 B;  3I63 C;  4M8M A;  2ZCC A;  2DAJ A;  2VRR B;  4MJS A;  2QEJ C;  2LFI A;  3AM9 A;  3EHV A;  1IBX A;  1F0Z A;  3DPD A;  3HM3 A;  3PSE B;  3AE2 B;  2C5L C;  4GSW A;  1A5R A;  1L4Z B;  1YIW A;  2MWS B;  1D4B A;  2H89 B;  3UGB B;  1KLU D;  2LGX A;  2NBV B;  4BBN C;  2RR9 A;  4MH0 E;  2MJD A;  1GC7 A;  2LWP A;  1K50 A;  3MJ5 A;  1LFD A;  2JZP A;  2IDY A;  3VFK A;  4GIV A;  4NY0 A;  3SU8 X;  4DBG A;  2KTR B;  3SFE B;  3DBL B;  1K51 A;  1Z2M A;  3ZRC A;  4YSY B;  1TKG A;  1KH0 A;  1WXM A;  1N60 A;  2AQ1 B;  2XNA C;  3TIX A;  1SE4 A;  4HCN B;  1WR1 A;  4HRO A;  2MSE D;  3TJP A;  1DGJ A;  2L05 A;  1GNU A;  2RDH A;  2MBO A;  4M8N A;  4N58 A;  3ZJU A;  3GOE A;  4XGA B;  1RFK A;  2LUE A;  4A6Q A;  1P3Q U;  1PYW D;  1WFY A;  1YJ1 A;  2RPV A;  5G2N A;  2WXN A;  4IOI E;  4IM0 A;  2WXJ A;  3H1U A;  4KV2 A;  3ZXV A;  4MGI E;  2INN E;  3AE6 B;  2D3C A;  2D5G A;  1ZDX A;  2KD0 A;  3E56 A;  1RLF A;  2K22 A;  2LVP A;  1WRD B;  2IZV B;  2WXL A;  2ZW1 A;  4K7W A;  1FD6 A;  1GUA B;  1ZP0 B;  2NBW B;  1JRU A;  3SD5 A;  5CX3 A;  2V3P A;  4EFO A;  5EDS A;  2SAK A;  4KVG B;  3KUD B;  2MQJ A;  1JML A;  1L2N A;  2PE6 B;  3WAL A;  1V97 A;  4HWI B;  2WS3 B;  1TS3 A;  4GDL B;  1WM2 A;  3NS1 A;  4M0W A;  1GJZ A;  4WWO A;  1P7F A;  3I5J C;  3RI7 C;  3WAP A;  1QT9 A;  1SJH D;  1WM3 A;  3ZUN A;  2MJE A;  1TY2 A;  3A9J A;  3UF8 A;  1FFV A;  1UH6 A;  1EUV B;  1OEY J;  1JRP A;  1VZ8 A;  1PGA A;  2UYZ B;  2WXG A;  1XD3 B;  3I9V 1;  3PRP B;  3Q8B A;  2MBQ A;  3H6N A;  1XT9 B;  2LXA A;  4AS1 A;  2R2O A;  1V1P B;  1SE9 A;  1SGH A;  2MH7 A;  2NR2 A;  1T0Y A;  4HKQ A;  2KFK B;  2NTT A;  4ICV A;  2LJI A;  3C0R B;  4RF0 A;  3BK2 A;  4KZ0 A;  4WJP A;  2X8X X;  5E6J A;  4URK A;  1QZE A;  1RAX A;  1YD8 U;  2K6D B;  2LGI A;  2E6X A;  3B1L X;  3UIP B;  3N30 A;  4KDL B;  2VH1 A;  1QKZ A;  3NS8 A;  1NYQ A;  3Q14 C;  3KQ4 A;  4H2A A;  3Q3O C;  3Q2A C;  4YTN B;  2QDF A;  3T3O A;  2WDT B;  5TSS A;  1PGX A;  4DDG D;  1F2R I;  1LXD A;  1YJI A;  4W9D A;  2KWC A;  4YSX B;  1FO4 A;  4W9C A;  1TT5 B;  2BVC A;  1WMH A;  3HM6 X;  3VXW A;  5IO9 A;  2JPH A;  4EOY A;  2R2Q A;  4K7U A;  2HE7 A;  3NY5 A;  2KLG A;  3LJ3 A;  4GN1 A;  2WP9 B;  2MJ3 A;  2A4Z A;  2JWU A;  1VZ6 A;  1YX6 B;  4HVB A;  1M4V A;  4WAF A;  1JWU D;  2WU5 B;  2FID A;  3PRZ A;  2L52 A;  2M1M A;  3NZ3 A;  1ESF A;  2OJW A;  2G3Q B;  2GBJ A;  3AE9 B;  4L23 A;  1SBB B;  1R4N I;  5GXG B;  1E7U A;  3VAW A;  1WWT A;  1D5M C;  1KOT A;  4JIO U;  2JY6 A;  2L76 A;  3PHX B;  1T0R C;  1EU4 A;  1VR9 A;  2GBM A;  1N6Z A;  4HJK A;  3R2T A;  2AL3 A;  2WXO A;  2C7M B;  1D6E C;  1IUE A;  1XEE A;  2ICI A;  2AEH A;  3ZNZ B;  2KFJ A;  4LTU A;  2DYB A;  4XX5 A;  3MC8 A;  3ZKJ C;  4MM3 B;  1BT0 A;  2L0F A;  1C78 A;  4DHJ B;  1SJE D;  1T6B X;  4LNK A;  2GI9 A;  2KWD A;  3T8M A;  2IYD B;  1P9D U;  2I1K A;  3CST A;  1S3S G;  4RH6 A;  4ASW C;  3RNC C;  4C80 A;  3QAR A;  1E9M A;  4OW0 A;  2BB5 A;  2KJR A;  3QX1 A;  3KW5 B;  4E3C A;  3L4P A;  2IY1 B;  3JSV A;  3Q8A A;  1DOY A;  3ZYY X;  3NVZ A;  4JWS C;  2GLS A;  1ACC A;  1B9R A;  3BII D;  3CMM B;  2NVU I;  1AWD A;  2WXM A;  4IM3 A;  4ICU A;  2CHZ A;  3P2B A;  4ANU A;  3VH3 B;  1NI3 A;  3ZNI D;  1OQR A;  4BBN F;  1ZW7 A;  3KYC D;  4FHK A;  2I38 A;  3NUH B;  2E3T A;  2G9H D;  1JWA D;  2LRW A;  1HZ5 A;  3KUC B;  2MX2 A;  4AQ7 A;  4TUU A;  1WX8 A;  3PHW B;  5LLI A;  1JQ4 A;  3FIL B;  3Q8C A;  5CHV C;  5AUI A;  1WSP A;  2D3G A;  1E8Z A;  1V81 A;  1I4G A;  5E6O A;  3R7R A;  2BTE A;  4EUT A;  3IHP C;  1HQR D;  1WJ6 A;  1WJN A;  3WAN A;  2M19 A;  3Q3F A;  1AW7 A;  2KTR A;  3ZXR A;  4D2K A;  1C79 A;  1GB1 A;  1XO3 A;  2J0M A;  3AV8 A;  3R8B A;  2KZR A;  2O6V B;  3V6C B;  2IND C;  3GB1 A;  3PV1 A;  4TMA B;  1HE8 A;  3U30 A;  3U2S C;  1Z5S B;  4IWP A;  4C00 A;  4ZYS A;  3MJW A;  2LD9 A;  4C56 C;  2W3S A;  2QIL A;  2DZJ A;  2K0P A;  4LLG M;  5IAA C;  2ZEQ A;  3RD2 A;  2UWQ A;  3AEE B;  2KNB A;  3M95 A;  1NBF C;  3AE7 B;  3IT4 B;  2G4D B;  2AL6 A;  1ZE3 D;  4NAW B;  4BKT A;  2PVO D;  3FC4 A;  4W9F A;  1F2R C;  3IXS A;  2H88 B;  1WF9 A;  3AU4 A;  4NJ6 A;  2ZW0 A;  3QQ8 B;  4S17 A;  1Q0W B;  4HXD A;  4XDD A;  3BZD B;  2X38 A;  2FBW B;  1H4R A;  4PT5 A;  1HA5 A;  3SFD B;  4TSS A;  1NDD A;  4L2Y A;  2D3A A;  1WIA A;  1UF0 A;  4M02 A;  1EU3 A;  4GDL A;  1PUT A;  4KSL C;  4FJY A;  2OOB B;  4CHK A;  1C1Y B;  2JRH A;  2HTM E;  1E90 A;  4FJV B;  2YEP B;  4B6W A;  1ET6 A;  2BYV E;  1HXY D;  2MBB B;  3VVW B;  3NZS A;  3BVZ A;  3P4P B;  2KKC A;  3PRE A;  1Q1O A;  3DDC B;  3P4S B;  4GGQ A;  4XE0 A;  2D2Q A;  2N9X A;  2MA9 B;  1WI0 A;  3W1S C;  4KZC A;  3PRM B;  2DHZ A;  3EC8 A;  5DPW A;  3AEB B;  4MEM A;  2KJH B;  1Y8R C;  1V1P A;  4NPN A;  4RGM A;  1ZXH A;  2ZJD A;  3V61 A;  5G5G A;  2QJL A;  4G50 A;  3ZRF A;  2NMQ A;  2KFK A;  2CJO A;  1N61 A;  3W1Y A;  2CR5 A;  3ZQ4 A;  2XK5 B;  2WDQ B;  1T0Q C;  2HJ8 A;  2M4N A;  2DBY A;  3D32 A;  2Z0E B;  4BVU C;  2J7Q B;  3PZ8 A;  3Q3M C;  3SDL C;  2WXH A;  2KVR A;  3QCA A;  1MG4 A;  2BWE S;  2ZPY A;  3BY4 B;  3H7S A;  1LGR A;  3TL5 A;  4MAC A;  4GDK B;  4G11 A;  1WXA A;  3NJT A;  3Q69 A;  3B9J A;  1XCQ L;  2J52 A;  4IUM B;  3EFU A;  5AZF A;  3MFG A;  4ZRP A;  5BO4 B;  4AUQ C;  2CJN A;  1YN3 A;  2FIF A;  5AZH A;  1QOG A;  2O2V B;  3PLV A;  5TR5 A;  4REZ A;  1MVK A;  3EFC A;  2ZNV B;  2FCM A;  2GMI C;  4FBJ B;  2K8C A;  2FCQ A;  2N9K A;  5BMI A;  3V3X A;  2SEB D;  3N3K B;  3VH4 B;  1P0R A;  4BKS A;  1J0G A;  4F7Z A;  2KWV B;  2ON8 A;  3O13 A;  4JPS A;  1JAL A;  4ANX A;  2LXC A;  3ZVV A;  3RNA C;  4W9I A;  3HVD A;  3AEC B;  2WXR A;  4USA A;  4DXF A;  3HHM A;  1TBE A;  4FHJ A;  4I6L B;  1YQ4 B;  4ZHO A;  5J2R A;  1F9J A;  4EZK A;  3HRD D;  5C23 A;  2ZNV C;  3NVW A;  3BVM A;  1L7Y A;  4TKN A;  1KTK A;  3FKY A;  2K1F A;  2KK8 A;  2K8H A;  3AH7 A;  2D10 A;  2WXI A;  2QCZ A;  4P1C C;  1EWC A;  2V4L A;  1EWY C;  4GU2 A;  1QIL A;  1NEK B;  3H9D A;  2Z8L A;  2WQY B;  3AXC A;  3OG5 A;  4J6I A;  3H8H A;  3TCA A;  2KQ7 A;  1YQB A;  1J19 A;  4MM3 A;  1SEB D;  5CTR C;  3DHG C;  2LRU A;  4EZJ A;  4P16 A;  2KHW B;  4RGT A;  3K9P B;  1K52 A;  4A20 A;  2K25 A;  5HG2 A;  3AED B;  2A5U A;  4NQL B;  2J0K A;  2DYM A;  2O6V D;  4HKZ E;  4IM2 A;  2K8B A;  1L4D B;  2BGF A;  4IW0 A;  5IN7 A;  4II3 B;  2Y5P A;  3RUI B;  1C9F A;  2LZ6 A;  3UQB A;  2PEA A;  2L7R A;  3TSS A;  2INP E;  4KKI A;  4MGZ E;  1UEL A;  4N6E B;  4IG7 B;  5L83 A;  2ZVO A;  3TEW A;  2QMT A;  3KLS X;  1WYG A;  1DOX A;  1V49 A;  4F8C B;  2JYT A;  2FCN A;  3DVG Y;  4US8 A;  3WAO A;  4KGT A;  4PYU A;  1IGD A;  1FM0 D;  2N9P C;  2EMS A;  2INC C;  3Q8F A;  2BQQ A;  1WGK A;  2MW5 A;  2KMC A;  4I6P A;  3MC0 B;  2JX5 A;  2W82 A;  2L8J A;  2GBK A;  5IOI A;  1AN8 A;  3V60 A;  3FIL A;  1TY0 A;  1PQS A;  4K3C A;  3MC9 A;  1RM6 C;  2KX3 A;  3ECI A;  3CIR B;  2K5P A;  1ZUD 2;  3AU5 A;  4WJO A;  5BMG A;  5I4D A;  2W54 A;  2OED A;  1TS4 A;  1PDX A;  2IBI B;  2KQ4 X;  2Y5B B;  5AEK B;  2KN4 A;  2R61 A;  1YQ3 B;  1TKE A;  3HK0 A;  2KAC A;  1IPG A;  2OJR A;  1UWX A;  3OAW A;  1MHX A;  4NNJ B;  1D5Z C;  2K39 A;  1JWS D;  4IWQ A;  3GE3 C;  3IG3 A;  2KOX A;  1L6U A;  2O6V A;  2VZK D;  3I57 A;  3PPA A;  3U4E G;  3LB8 C;  1E8Y A;  1WGR A;  3ML8 A;  4B0M A;  2FCS A;  4ZRQ A;  2KQS A;  3PZ7 A;  5LXI B;  1F77 A;  1WX9 A;  5BMH A;  1VRA B;  2KDB A;  4OVV A;  2BW2 A;  5DPS A;  2BF8 B;  3TMP B;  2ONQ A;  3JW0 X;  3IT6 B;  5EE3 A;  3LYY A;  2M0A A;  3QC8 B;  4W9G A;  3ZTD A;  4NAW A;  4NAM A;  3B0A A;  2JZ3 B;  3B08 A;  4HPP A;  2LVO A;  1ENF A;  1BUI C;  5D3D A;  3MTN B;  4PK1 A;  4YTP B;  1YNT E;  1EF5 A;  2CHX A;  2JF5 A;  2EEL A;  2KJ6 A;  2V3S A;  4IWO A;  3DCG A;  2IO0 B;  2NCN A;  1VZ7 A;  2C7N B;  3V05 A;  4A3P A;  1BXT A;  1UD7 A;  1JWM D;  2EKE C;  2J53 A;  2PIA A;  4HPL B;  3W1S A;  2FUG 1;  4ZOH C;  4Q2J A;  5JXV A;  4W9H A;  4JX1 C;  2OHF A;  4GLS C;  2KTF A;  3CSF A;  3DWG C;  1V1O A;  4PS8 A;  4DHZ E;  1F52 A;  2DNF A;  2KC2 A;  4RGO S;  2IPK D;  2DZK A;  2DX5 B;  2PMV A;  4RF1 A;  3B2G A;  2JXT A;  3UIN B;  1X1M A;  1E8W A;  1M94 A;  3SR6 A;  4EEW A;  4TV3 A;  3TEY A;  3KUZ A;  2KMA A;  2MBH A;  3BVG A;  2KAN A;  3L0W B;  4JE3 B;  2V1Y A;  1T5X D;  2AX5 A;  2UU7 A;  2JWZ A;  4NZL B;  5FR6 A;  3DBR B;  3W5U B;  1V2Y A;  1OQQ A;  4KDI C;  1CZP A;  1WGY A;  1V5O A;  1Q5W B;  1IP9 A;  1RFA A;  3VTU A;  3LDZ E;  1K8R B;  2XK5 A;  2L32 A;  1E7V A;  1CK1 A;  2RPQ A;  3NZU A;  3SEB A;  4HJG E;  5H8Y E;  3R2I A;  4G0N B;  4K1R B;  2L00 B;  1MHH E;  2RSU A;  1L6V A;  4WH4 A;  4GDK A;  3Q3J A;  4I6N B;  2ZPN A;  1UBQ A;  2NPT B;  1XQQ A;  2HJ1 A;  5C2T B;  1J7B A;  3QHT A;  1WY8 A;  2DWQ A;  2MLB A;  1J7A A;  5H92 C;  3AE1 B;  1WXQ A;  3ETR A;  4ZDV A;  4N9F 4;  3DVN U;  5FKA C;  1DOI A;  2CKH B;  2BBC A;  2QHO A;  2QSD A;  3W2D A;  1GC6 A;  2BKF A;  1TS2 A;  3VRA B;  2IJ0 A;  4RM9 A;  2B76 B;  1WXV A;  1MI0 A;  3C8Y A;  2IY0 B;  2Q5W D;  2AQ3 B;  2PPH A;  4A90 A;  1OEY A;  4K3B A;  4MSM B;  2JRI B;  1FEH A;  3ZW3 A;  3SHQ A;  1ZXI A;  3ZJV A;  2JVC A;  3WAM A;  4W9L A;  4B95 A;  2N9L A;  2KDF B;  4HCP B;  4UDU C;  2NBU A;  1SIJ A;  3ONS A;  2HTH A;  1ZDV A;  2PE9 A;  1WX7 A;  3U7D A;  2BKR B;  2G1E A;  1FNU A;  1SXT A;  1R4M I;  2RGF A;  1NI2 A;  2LMC A;  1XXG A;  1V80 A;  1UUP A;  4LK0 M;  1YX5 B;  2KYW A;  4A55 A;  4II2 B;  3NHE B;  2CHW A;  3AEG B;  3UIO B;  2D07 B;  3BYT B;  2L1A A;  2XN9 C;  1KM7 A;  4ZRI A;  2M8S A;  2N7E A;  2BB6 A;  1MJD A;  5G5H A;  3DWM A;  5JZE B;  3RN9 C;  1I7H A;  1ZGU B;  4KKJ A;  2DAF A;  4B0E A;  2KT7 A;  4BZA A;  3ZGZ A;  3DQV A;  4PYZ A;  1V5T A;  1FCC C;  2NTS A;  3P63 A;  3CF6 E;  1K53 A;  4GB9 A;  2ZVN A;  3UQA A;  3L17 A;  5EE9 A;  1XLN A;  1YOV B;  4C7Z A;  1I4R A;  2CU1 A;  5FK9 C;  1FXT B;  1TTN A;  2ASQ A;  1HZ6 A;  1UNS A;  1P7E A;  1SIF A;  2LGD A;  1UGJ A;  3U8Z A;  3KWL A;  3N1Z C;  1Y56 A;  4B9K A;  4WUR A;  5JH5 C;  3A1Q B;  2KVZ A;  1QOB A;  1EO6 A;  2QC8 A;  2KX0 A;  2WU2 B;  3ABV B;  4TQ0 A;  1NEN B;  1SE2 A;  2G45 B;  2DZI A;  1P98 A;  2N1V A;  1WZ3 A;  3W9C B;  3M3J A;  4OVZ A;  5C3J B;  3AE8 B;  5BYR A;  3M63 B;  2LHE A;  4HDQ A;  4K7S A;  4O1N A;  1GAQ B;  2BWF A;  1F1H A;  1LO5 D;  4LCD E;  1RWS A;  3S2A A;  2LVQ A;  2WYQ A;  2ZCB A;  4BKS D;  3A4R A;  1C76 A;  1L0V B;  4ARI A;  2JT4 B;  3E9S A;  4JGH B;  3RNG C;  3QWZ B;  3BK1 A;  4OVU A;  3APD A;  3RT3 B;  4WWN A;  1YN5 A;  2WWZ A;  1VJK A;  1D3Z A;  3Q8E A;  3RNF C;  4DDI D;  4XZ4 A;  5LNK 1;  2FNJ B;  4MH8 A;  3GZN B;  4KGS A;  2MCN B;  2WXK A;  5CHF A;  3PTF C;  3C19 A;  2WHI A;  4BKG A;  2IGG A;  5EE0 A;  3APC A;  3H7P B;  4EE2 A;  1KJT A;  5BYS A;  3L10 B;  3VUY A;  4RFB A;  3ZNG C;  4OZC A;  4BOZ B;  3AUL A;  4OHJ A;  4EKU A;  2IGD A;  4IC7 B;  4DHJ D;  4XYC A;  3W5V B;  3AE5 B;  1VDV A;  3B2F A;  3AN1 A;  1P1A A;  4HLE A;  1C3T A;  2I1J A;  2KN5 A;  1OFF A;  4LNI A;  1UGM A;  3V62 A;  4MT5 A;  2MP2 B;  4AJW A;  1PFD A;  1RYJ A;  4DXA B;  3ENE A;  4XDC A;  3R66 C;  3KWV A;  1OQY A;  3IFW B;  2I2Y A;  1STE A;  3L08 A;  1TGZ B;  1TKY A;  1R7S A;  5JHA A;  3VTW A;  1QOA A;  3V6E B;  3N20 C;  4A8X C;  4GOC A;  4GMV A;  3GP7 A;  4YXD B;  3DVN V;  4HRS A;  2HDE A;  3A33 B;  3L54 A;  1KRH A;  4ITK A;  1MFW A;  4KX6 B;  4YWG G;  1FPY A;  3VUW A;  2XBB C;  4K81 A;  1R4M B;  3EUB 2;  4LDT B;  4WQM A;  2B3A A;  1VLB A;  4F1S A;  1UWM A;  4P7I A;  3KH0 A;  4DXG A;  1E5W A;  2NS5 A;  2AQ2 B;  3VR9 B;  3VTV A;  2L83 A;  3IBE A;  1WZ0 A;  2N7D A;  4MGK E;  1JWB D;  2GBR A;  1WGG A;  3APF A;  3AB5 A;  3PZD A;  3RNB C;  5KHQ A;  1JCK B;  3MHS D;  3QIJ A;  1RRB A;  1FNW A;  1FFU A;  1LM8 B;  3ALB A;  2VH2 A;  3PT2 B;  4PS3 A;  3OJ3 A;  4JLC A;  4NQK E;  3U7Z A;  2D11 A;  1HEZ E;  4EZL A;  4G3X B;  4A3O A;  2WLB A;  4CO7 A;  2GRI A;  4WJQ A;  3PS6 A;  2C60 A;  1WYW B;  4US9 A;  1WJ4 A;  3RCZ A;  5C1Z A;  1XLQ A;  1QOF A;  2RMM A;  2EMT A;  4YTM B;  3I3T B;  2MBE A;  1G6J A;  1QQR A;  3TBL D;  1GB4 A;  3QK0 A;  3UI3 A;  3DBR I;  2KC1 A;  2RD0 A;  4RM8 A;  1ZPS A;  4AJY B;  1S1Q B;  2REX A;  2LJ5 A;  2N0S B;  3OJ4 B;  1FNV A;  3NVV A;  3N1Y C;  3ZIM A;  4KGR A;  2V3N A;  2V9H A;  4WQO B;  3CWI A;  4XWW A;  4HEA 1;  2NPT A;  1E8X A;  3EEC A;  3GS2 A;  1Q10 A;  2XEW A;  3WCQ A;  5DPT A;  2KDM A;  1FIQ A;  2BS4 B;  1J7C A;  2K9X A;  3ZJT A;  5D3I B;  1C77 A; 
#chains in the Genus database with same CATH homology
 2DZK A;  2DX5 B;  3PV1 A;  5AZG A;  2WX1 A;  4E71 A;  4AOF A;  3K9O B;  1HE8 A;  3U30 A;  4GXB A;  4W9E A;  1Z5S B;  4IWP A;  3MJW A;  3PVL A;  4WWP A;  3UIN B;  2LD9 A;  3IVF A;  1X1M A;  4ANW A;  4KIK B;  1E8W A;  1M94 A;  4M8M A;  2ZCC A;  4CYE A;  2DZJ A;  5IAA C;  4TV3 A;  2DAJ A;  4AWJ A;  4EEW A;  3KUZ A;  2KMA A;  2MBH A;  2ZEQ A;  3ZO5 B;  3RD2 A;  4X57 B;  1UBI A;  2UWQ A;  2KAN A;  2VRR B;  4MJS A;  2KNB A;  3L0W B;  3M95 A;  2L3Z A;  3EHV A;  2V1Y A;  1NBF C;  2JWZ A;  2G4D B;  2AL6 A;  2L0T A;  2M0X A;  3DPD A;  3HM3 A;  4NAW B;  5FR6 A;  4FN2 A;  4NJ7 A;  4ANV A;  3PSE B;  4BKT A;  1V2Y A;  2C5L C;  3WA0 A;  4KDI C;  4W9F A;  1WGY A;  1V5O A;  5J18 A;  1Q5W B;  1IP9 A;  1RFA A;  1WF9 A;  3AU4 A;  4GSW A;  4NJ6 A;  3VTU A;  3LDZ E;  1K8R B;  3KVF B;  2XK5 A;  4FUL A;  1A5R A;  1YIW A;  2MWS B;  3A9K B;  3QQ8 B;  1Q0W B;  1E7V A;  2RPQ A;  3NZU A;  3UGB B;  4HXD A;  2YVC A;  3DVG X;  4W9J A;  2LGX A;  2NBV B;  4BBN C;  4G0N B;  1EF1 A;  1H4R A;  4K1R B;  2RR9 A;  2L00 B;  1WE6 A;  1NDD A;  1I42 A;  4MH0 E;  2RSU A;  1GC7 A;  2LWP A;  4GDK A;  3Q3J A;  1LFD A;  1WIA A;  3VDZ A;  3O65 B;  4I6N B;  4ZRK A;  1IYF A;  2ZPN A;  1UBQ A;  2BPS A;  2NPT B;  4GDL A;  4KSL C;  3VFK A;  3VQI A;  4GIV A;  1XQQ A;  3PLU A;  4FJY A;  4NY0 A;  2YLM A;  2OOB B;  3JYU A;  4CHK A;  1C1Y B;  2JRH A;  3SU8 X;  3RUL A;  4DBG A;  3QHT A;  2KTR B;  1WY8 A;  2MLB A;  1E90 A;  2G4S A;  5JHB A;  2FUH B;  1Z2M A;  4FJV B;  4YL8 A;  4B6W A;  3ZRC A;  2KXJ A;  1I35 A;  1TZ1 A;  2BYV E;  4ZDV A;  1WXM A;  4N9F 4;  3DVN U;  2MBB B;  3TIX A;  3NZS A;  3VVW B;  2KKC A;  4HCN B;  3PRE A;  1Q1O A;  1WR1 A;  2CKH B;  2QHO A;  2MSE D;  3DDC B;  4GGQ A;  3TJP A;  2D2Q A;  1GC6 A;  2L05 A;  2N9X A;  2MA9 B;  1WI0 A;  3QAQ A;  3W1S C;  1GNU A;  2BKF A;  2MBO A;  4M8N A;  4DHZ B;  2JUO A;  4KZC A;  3GOE A;  5D7G A;  3PRM B;  2LUE A;  2DHZ A;  3EC8 A;  1P3Q U;  1WFY A;  2LI5 A;  4RM9 A;  5DPW A;  1YJ1 A;  4MEM A;  3N32 A;  2KJH B;  1Y8R C;  1WXV A;  5G2N A;  4IM0 A;  2IY0 B;  4NPN A;  3ML9 A;  4MJS B;  2LGY A;  2ZJD A;  2PPH A;  3V61 A;  3H1U A;  3A1Q A;  4KV2 A;  4G50 A;  4MGI E;  3ZRF A;  2KFK A;  1OEY A;  4MSM B;  2JRI B;  2KD0 A;  3ZW3 A;  2KDI A;  1RLF A;  2LVP A;  5GMV A;  5DPR A;  3JVZ X;  3SHQ A;  3VHT C;  1WRD B;  2JVC A;  3WAM A;  2IO2 B;  4W9L A;  3W1Y A;  4B95 A;  2IZV B;  1H8C A;  2CR5 A;  2KDF B;  4HCP B;  2XK5 B;  2NBU A;  4K7W A;  3ONS A;  1GUA B;  4LJO B;  2HTH A;  2NBW B;  1JRU A;  2HJ8 A;  2M4N A;  3SD5 A;  5CX3 A;  2PE9 A;  1VD2 A;  4EFO A;  1WX7 A;  3D32 A;  2Z0E B;  3RZF A;  4BVU C;  3U7D A;  2J7Q B;  2BKR B;  4JQW C;  5EDS A;  3SDL C;  4MDK E;  3RZW C;  2KVR A;  1R4M I;  2RGF A;  3QCA A;  1NI2 A;  4KVG B;  3KUD B;  2MQJ A;  1L2N A;  2BWE S;  2ZPY A;  3BY4 B;  2C9W B;  3H7S A;  3TL5 A;  1V80 A;  2PE6 B;  3WAL A;  1WR6 E;  1YX5 B;  4GDK B;  4II2 B;  1AAR A;  4G11 A;  3NHE B;  1WXA A;  2CHW A;  4HWI B;  1KLV A;  3UIO B;  1V86 A;  2D07 B;  1VCB A;  4GDL B;  4IUM B;  1WM2 A;  3VUX A;  1KM7 A;  3EFU A;  4ZRI A;  2M8S A;  4JL9 A;  2N7E A;  3PGE A;  1GJZ A;  3L13 A;  4WWO A;  5AZF A;  3WAP A;  5D2M B;  5BO4 B;  4AUQ C;  5JZE B;  2FIF A;  3QA8 A;  5AZH A;  4LDT D;  2O2V B;  1WM3 A;  1ZGU B;  4MSQ B;  3ZUN A;  5L95 C;  1ZKH A;  5HKH A;  3PLV A;  2DAF A;  5TR5 A;  3DQV A;  2ZNV B;  3A9J A;  2FCM A;  2GMI C;  3DBS A;  3UF8 A;  4FBJ B;  1UH6 A;  2K8C A;  4PYZ A;  1V5T A;  1EUV B;  2FCQ A;  4BFR A;  3ZTC A;  3CF6 E;  1OEY J;  2UYZ B;  4GB9 A;  2ZVN A;  2K6Q A;  3UQA A;  3DBH I;  1XD3 B;  3L17 A;  3N3K B;  3VH4 B;  1P0R A;  3PRP B;  4BKS A;  2W9N A;  1J0G A;  4F7Z A;  2CU1 A;  2MBQ A;  3H6N A;  1FXT B;  1TTN A;  1XT9 B;  2C7H A;  2ASQ A;  2LXA A;  2KWV B;  2KWU B;  2N1W A;  1SIF A;  2R2O A;  2LGD A;  1OTR B;  4E74 A;  3U8Z A;  1SE9 A;  1SGH A;  2LXC A;  4ANX A;  1WE7 A;  2NR2 A;  3ZVV A;  4B9K A;  5JH5 C;  3A1Q B;  3H7P A;  4HK2 A;  4W9I A;  3ZDT A;  1T0Y A;  1EO6 A;  5D94 A;  2KFK B;  2KX0 A;  3GZN I;  4ZYN A;  4ICV A;  4PS7 A;  3C0R B;  4TQ0 A;  3HHM A;  4KZ0 A;  4DWF A;  1TBE A;  4WJP A;  4URK A;  4FHJ A;  4I6L B;  1QZE A;  2G45 B;  1RAX A;  2DZI A;  1P98 A;  2N1V A;  1WZ3 A;  1YD8 U;  4BOS C;  5J2R A;  4AP4 C;  3M3J A;  1F9J A;  4EZK A;  5C23 A;  2K6D B;  5G55 A;  3M63 B;  2ZNV C;  2J0J A;  4HDQ A;  4K7S A;  1L7Y A;  4TKN A;  2BWF A;  3B1L X;  3UIP B;  2MP2 A;  3N30 A;  4KDL B;  3NS8 A;  4LCD E;  3S2A A;  4KSK C;  3NOB A;  2K1F A;  2LVQ A;  2KK8 A;  2O2V A;  2K8H A;  2WYQ A;  2D10 A;  2M17 A;  2ZCB A;  3A4R A;  4BKS D;  2ZZP B;  4FAD A;  2V4L A;  4GU2 A;  2JT4 B;  4JGH B;  2WDT B;  3H9D A;  2N4F A;  5KHO A;  3AXC A;  3QWZ B;  4J6I A;  4OVU A;  1MG8 A;  4DDG D;  3APD A;  1LXD A;  3TCA A;  3RT3 B;  5IA7 A;  4M0W B;  2KQ7 A;  2Z0D B;  5J17 A;  1YQB A;  1J19 A;  4WWN A;  4MM3 A;  3T9L A;  4W9D A;  2KWC A;  4W9C A;  5CTR C;  1WMH A;  1WXS A;  3HM6 X;  3VXW A;  2LRU A;  4EZJ A;  2WWZ A;  2KHW B;  1D3Z A;  2JPH A;  2IO3 B;  3K9P B;  2R2Q A;  3KYD D;  3A9J B;  4EOY A;  4K7U A;  4DDI D;  2HE7 A;  4A20 A;  3NY5 A;  2KLG A;  2K25 A;  4XZ4 A;  3LJ3 A;  2GOW A;  4GN1 A;  2BYE A;  2FNJ B;  2A5U A;  4HDO A;  4NQL B;  2MCN B;  2J0K A;  2DYM A;  2O6V D;  3PTF C;  5CHF A;  2A4Z A;  3M62 B;  3L16 A;  4IM2 A;  4HPM B;  2K8B A;  3X0W A;  2KDE B;  2BGF A;  4BKG A;  1YX6 B;  4IW0 A;  4HVB A;  3APC A;  4II3 B;  3H7P B;  3PRZ A;  2FID A;  1UZX B;  1WH3 A;  2M1M A;  1ISN A;  1KJT A;  4FJZ A;  3RUI B;  3L10 B;  2LZ6 A;  3VUY A;  2PJH A;  3ZNG C;  4BOZ B;  3UQB A;  2PEA A;  2L7R A;  3AUL A;  2G3Q B;  2GBJ A;  4EKU A;  4FA6 A;  5E6P A;  1OGW A;  4IC7 B;  1R4N I;  3RYT A;  4DHJ D;  1E7U A;  4MGZ E;  3VAW A;  1UEL A;  4MGY E;  2Z59 B;  4IG7 B;  4JIO U;  2ZVO A;  5L83 A;  1KOT A;  2JY6 A;  1P1A A;  2L76 A;  4HLE A;  1C3T A;  2I1J A;  2KN5 A;  1LQB A;  1V49 A;  3PHX B;  4F8C B;  1UGM A;  3V62 A;  2FCN A;  3DVG Y;  2MP2 B;  1U4A A;  2GBM A;  4AJW A;  4DXA B;  3ENE A;  4HJK A;  2KO3 A;  3WAO A;  3X23 A;  3R66 C;  4PYU A;  2JZZ A;  1OQY A;  3IFW B;  2N9P C;  5CHW A;  2AL3 A;  3L08 A;  2EMS A;  1TGZ B;  2C7M B;  4TQ1 A;  2DEN B;  2MW5 A;  2KMC A;  5JHA A;  2AEH A;  3VTW A;  4I6P A;  3ZNZ B;  3DBL I;  3V6E B;  2KFJ A;  2L8J A;  4XX5 A;  2DYB A;  2GBK A;  2CS4 A;  4GOC A;  4GMV A;  3V60 A;  3ZKJ C;  1BT0 A;  2L0F A;  3DVN V;  2KLC A;  1PQS A;  5E6N A;  3A33 B;  1WMH B;  3L54 A;  4DHJ B;  2KX3 A;  3ECI A;  3T8M A;  3AU5 A;  2IYD B;  4WJO A;  1P9D U;  5D6J B;  2I1K A;  3A4S C;  3CST A;  3R7Q A;  1CMX B;  3VUW A;  1S3S G;  2HD5 B;  2XBB C;  1V6E A;  4WAA A;  4ASW C;  4K81 A;  4LDT B;  4W9K A;  3QAR A;  2KJR A;  3DOW A;  2B3A A;  2IBI B;  3QX1 A;  2Y5B B;  3KW5 B;  4F1S A;  4E3C A;  4P7I A;  3KH0 A;  5AEK B;  2IY1 B;  3JSV A;  3HK0 A;  1E5W A;  3ZDM C;  1IPG A;  2NS5 A;  2OJR A;  3OAW A;  4NNJ B;  3VTV A;  2K39 A;  2MRP A;  4IWQ A;  2LAS A;  3IBE A;  3IG3 A;  2KOX A;  1WZ0 A;  2N7D A;  2O6V A;  3AI5 A;  3PPA A;  3CMM B;  4MGK E;  4FLH A;  2NVU I;  2GBR A;  4XC2 A;  1WGG A;  3APF A;  3PZD A;  1E8Y A;  1WGR A;  3ML8 A;  5KHQ A;  2FCS A;  4IM3 A;  2KQS A;  3MHS D;  4ICU A;  3QIJ A;  1RRB A;  2CHZ A;  4DK5 A;  3P2B A;  4ANU A;  3VH3 B;  2N9E B;  5LXI B;  2DYO A;  1WX9 A;  3ZNI D;  1LM8 B;  3ALB A;  4KIK A;  1WGH A;  2KDB A;  2GBN A;  3PT2 B;  4OVV A;  3R3M A;  4PS3 A;  1ZW7 A;  4BBN F;  3OJ3 A;  4JLC A;  4NQK E;  5DPS A;  1GG3 A;  2BF8 B;  3HIZ A;  3KYC D;  4FHK A;  2D11 A;  3TMP B;  4EZL A;  4G3X B;  4RMA A;  3JW0 X;  4A3O A;  4CO7 A;  5LXH A;  3WIM A;  4WJQ A;  3PS6 A;  3QC8 B;  2LRW A;  4W9G A;  3ZTD A;  2C60 A;  1WYW B;  4NAW A;  4LJP B;  1WJ4 A;  3B0A A;  3KUC B;  2JZ3 B;  2FAZ A;  3B08 A;  2LVO A;  2MX2 A;  3RCZ A;  5C1Z A;  1J8C A;  4TUU A;  3MTN B;  2EMT A;  1V9J A;  3ZLZ A;  1EF5 A;  1WX8 A;  2CHX A;  2JF5 A;  2KJ6 A;  2V3S A;  3I3T B;  2WX0 A;  3PHW B;  4IWO A;  5LLI A;  2MBE A;  1WJU A;  1G6J A;  3A9K A;  5CHV C;  3DCG A;  2IO0 B;  2NCN A;  3TBL D;  3QK0 A;  2C7N B;  5DCN A;  2D3G A;  1E8Z A;  2JXX A;  3DBR I;  4A3P A;  1UD7 A;  2KC1 A;  2RD0 A;  4RM8 A;  1V81 A;  2EKE C;  4AJY B;  4HPL B;  1S1Q B;  1WGD A;  3W1S A;  2DZM A;  5E6O A;  3R7R A;  2REX A;  2LJ5 A;  2BYF A;  3OJ4 B;  3OLM D;  4EUT A;  3ZIM A;  3IHP C;  4W9H A;  4WQO B;  2AYO B;  1WJ6 A;  2NPT A;  1E8X A;  3EEC A;  1WJN A;  3BIN A;  3WAN A;  2XEW A;  2IO1 B;  3JSV B;  3Q3F A;  5DPT A;  2KTF A;  3CSF A;  2KTR A;  4PS8 A;  4WJN A;  4ZRJ A;  2AWT A;  2J0M A;  4MEL A;  4DHZ E;  2KZR A;  3ZNH B;  2KC2 A;  2O6V B;  3V6C B;  3QJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...