3VTUA

Crystal structure of human lc3b_2-119
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
SPEFPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Structural basis for phosphorylation-triggered autophagic clearance of Salmonella
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2012-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vtuA00
5D94A 2I1JA 2K8HA 4NNJB 5HKHA 4FJYA 2MBQA 1E90A 1WGYA 2FCNA 3NZSA 1WR6E 4CYEA 3JSVB 2LJ5A 4K7WA 3DBSA 1OQYA 3WAOA 3AU4A 2LI5A 1GJZA 4HVBA 2FCSA 1J0GA 3H7PA 1MG8A 2DHZA 3PRPB 4JLCA 5L83A 1RAXA 2A4ZA 4ANWA 1WMHB 2JY6A 4TQ1A 4HK2A 2LD9A 1J19A 1KM7A 1V5OA 4MDKE 5EDSA 5JHAA 1S3SG 2A5UA 4NY0A 1OEYA 1BT0A 2ZVOA 3A9JA 4G11A 4URKA 1YX5B 3TMPB 3QAQA 3Q3JA 3ZVVA 4W9CA 3X0WA 4KZCA 2FUHB 3APFA 3ECIA 5JZEB 2KC2A 3SU8X 4W9GA 5J18A 4KSKC 2GBMA 3K9PB 2IYDB 3PHWB 4AJYB 4GMVA 4FADA 2KTFA 3JSVA 4LDTD 3WANA 2LGDA 2FCMA 3A4RA 2D2QA 3AXCA 4DHZE 4I6LB 4ASWC 4MELA 2REXA 3HM6X 3KUDB 2KN5A 1TGZB 2RR9A 3A9KB 2MX2A 3SHQA 5TR5A 2MSED 4G0NB 1OTRB 2GOWA 3WAPA 1C1YB 2IY0B 2K25A 4W9EA 3RULA 3UINB 4EKUA 2JF5A 1UGMA 4KIKA 5DPRA 2WX1A 3PPAA 4ANVA 4WWPA 2RD0A 4GU2A 3L08A 2KJHB 3QX1A 4E74A 2LUEA 2MW5A 4BVUC 1CMXB 2K8CA 4NJ6A 1IP9A 1YIWA 2EKEC 3U8ZA 3KYCD 4W9FA 3PRMB 1KLVA 4RM9A 3R3MA 1EF1A 3ML8A 3C0RB 3H7SA 4HWIB 2NR2A 1S1QB 3R66C 1TBEA 3SDLC 3PLVA 4BOSC 3CMMB 4GDKB 1ZGUB 3R7QA 2Y5BB 1GG3A 3L54A 3P2BA 4ICUA 1KJTA 3UIOB 2KKCA 2NBWB 2KJ6A 4WJNA 4ZYNA 3TBLD 2KZRA 2LWPA 3QA8A 5D6JB 2JVCA 4YL8A 3L16A 1WGDA 4I6NB 3WAMA 1J8CA 3RZFA 4AP4C 1OEYJ 2LZ6A 3ZLZA 4X57B 1WXVA 3QWZB 2M4NA 3UF8A 1WZ3A 3T8MA 4EZKA 1G6JA 1UBQA 5G55A 3VTVA 3W1SC 1L2NA 1P0RA 2GBNA 2DYOA 2KDBA 1P98A 2BYVE 4IM3A 4TV3A 4GDLB 2IY1B 5KHOA 3TL5A 4MJSA 2G4DB 2KQSA 3OAWA 2L05A 1M94A 4W9LA 3VH3B 1HE8A 2ZJDA 3ZNZB 4GDKA 2DAFA 2NCNA 4KZ0A 1Z2MA 2MBEA 4OVVA 3H9DA 3K9OB 3WA0A 2N7EA 4BKTA 3QC8B 4EZJA 3TIXA 3GZNI 2GBJA 3EHVA 4IWOA 3NHEB 4IM2A 4CHKA 4ANXA 3RT3B 2DENB 2KDIA 4DHZB 5KHQA 2I1KA 4B95A 1OGWA 3HK0A 1P1AA 1WI0A 4A3OA 2KX3A 2C9WB 3CSFA 4P7IA 1Z5SB 2VRRB 1UZXB 3DBHI 3N30A 4I6PA 1WYWB 4TQ0A 3RZWC 3VXWA 2DZIA 3L0WB 4PYUA 5D2MB 4FHJA 4WJQA 4DHJD 2ZCCA 2DZKA 4F8CB 4EEWA 4GDLA 4M0WB 1WJ4A 2AYOB 4M8NA 1WR1A 2BWES 3BINA 2JRHA 4FBJB 4MGYE 2KK8A 2PE6B 3EFUA 3U30A 2V1YA 2LASA 3PRZA 4BBNF 1EO6A 2Z0EB 3D32A 4K81A 1AARA 3VUXA 4N9F4 2RSUA 5J17A 1SIFA 2N9XA 1WM2A 1T0YA 1V81A 2LVPA 3NZUA 2KVRA 3APCA 3NS8A 3DVNV 4AWJA 1NI2A 3AI5A 1VCBA 4JQWC 1E8YA 4XZ4A 3VTUA 2N9PC 4ZRKA 4ZDVA 4J6IA 1U4AA 1E7VA 1Y8RC 3PHXB 4HPMB 3DBRI 3MHSD 2CR5A 2GBKA 1LFDA 4JGHB 4W9HA 2MA9B 4PS7A 3B08A 3V61A 4W9IA 1P3QU 2KLCA 3M63B 5LLIA 2LRUA 1YJ1A 3RCZA 3QHTA 1V5TA 2N1WA 3N32A 2IZVB 3QCAA 4PS3A 3W1SA 3V60A 2IO2B 2W9NA 3Q3FA 2BYFA 3M62B 1Q5WB 5AEKB 3H1UA 2AL3A 1WGGA 2KMCA 2MWSB 5E6NA 5IAAC 3VH4B 2KFJA 4K7SA 4RMAA 4E71A 2PEAA 1WX8A 2OOBB 5CHWA 4MSMB 1WMHA 2YLMA 3PREA 4KVGB 4A20A 2O2VB 3V6CB 3ZIMA 3EC8A 1XD3B 4FHKA 1Q0WB 1SE9A 3PVLA 4HDOA 3JYUA 1UBIA 3ZTDA 1Q1OA 2KWUB 2M17A 4II2B 3ZDTA 1IPGA 1H8CA 1V80A 3ML9A 4GXBA 3VUWA 3M95A 3ZRCA 4BKGA 3JW0X 4IWQA 1JRUA 4FJVB 3NY5A 3VAWA 4EFOA 2IBIB 2LXCA 3IG3A 1WZ0A 2KD0A 3L10B 1PQSA 2KWVB 1WE6A 4B6WA 2KJRA 2GMIC 3M3JA 4GSWA 2KHWB 2LVOA 4DBGA 5JHBA 4HCPB 2ASQA 2J0JA 3A9KA 2MP2B 3TCAA 2UWQA 1I35A 1NDDA 2D11A 2D3GA 2O2VA 2EMTA 4IW0A 4CO7A 1LQBA 5BO4B 2R2QA 2WWZA 4AOFA 3ZDMC 3LDZE 1RRBA 4W9KA 2MQJA 3TJPA 2XK5B 1WJNA 2JT4B 1E7UA 2DYMA 1YQBA 2LGXA 2V4LA 2KFKB 2L8JA 4JIOU 1WFYA 5GMVA 3JVZX 5E6PA 4ZRJA 5G2NA 3A1QB 3PTFC 2CS4A 2LVQA 4HPLB 4IC7B 2KDEB 5CHVC 4BKSA 5L95C 4AUQC 2IO3B 1L7YA 3KW5B 1WY8A 2MP2A 3EECA 4OVUA 3V62A 4BOZB 2N1VA 4ANUA 1EF5A 4PS8A 5DCNA 2JUOA 1GUAB 3MJWA 4LDTB 2KNBA 2MCNB 2MRPA 4DK5A 4GN1A 2YVCA 3WALA 4B9KA 2M8SA 2N4FA 4DXAB 1R4MI 2HTHA 2XK5A 3PSEB 2KLGA 3UIPB 2BPSA 2C7NB 3SD5A 2N7DA 1GNUA 2KFKA 2KC1A 3RYTA 1EUVB 2DAJA 3ZUNA 4II3B 2BF8B 4WJOA 3V6EB 3IFWB 3QK0A 3ZKJC 3DCGA 4IUMB 1GC6A 1E8WA 5AZFA 3A1QA 4HXDA 4KDLB 1V86A 3PS6A 3HIZA 4NQLB 4NJ7A 1D3ZA 5JH5C 2L00B 2L3ZA 2FIFA 3QJZA 1A5RA 3IHPC 1WRDB 2ZEQA 3DQVA 3T9LA 1WGRA 1V6EA 1WX9A 3DOWA 2K39A 3DPDA 4XX5A 5E6OA 5LXHA 2ZVNA 3ZNHB 4G50A 4KV2A 4BKSD 2MBHA 3IBEA 5CX3A 4FLHA 1UD7A 2DZJA 3VTWA 3UGBB 5AZHA 4PYZA 2KWCA 2M0XA 2FAZA 1RLFA 2NBUA 3WIMA 4EOYA 1UELA 3UQAA 4IM0A 2XBBC 5C23A 2XEWA 2C7MB 2ZCBA 3KVFB 2G45B 3CF6E 1LXDA 4EUTA 1V49A 2CU1A 2KO3A 2K6QA 3RUIB 1V2YA 3B0AA 2C5LC 5C1ZA 1YX6B 5J2RA 1FXTB 2DZMA 2FCQA 2AL6A 3NOBA 3AULA 2KDFB 2JXXA 2BYEA 1VD2A 2PE9A 2WDTB 2KTRB 4FULA 2LRWA 1QZEA 4KIKB 2O6VB 3QIJA 1WXAA 1ZW7A 2KX0A 1TTNA 4HLEA 4DDID 3OJ3A 2UYZB 1WJ6A 2L0FA 1F9JA 3KUZA 1WGHA 4NQKE 1WXSA 1WH3A 5DPTA 1I42A 2QHOA 4KSLC 4A3PA 4DWFA 1K8RB 2PPHA 4EZLA 5DPSA 3AU5A 1E5WA 2RPQA 2L7RA 2V3SA 2KOXA 4W9JA 3QARA 2GBRA 2HJ8A 2BKFA 4MGIE 3LJ3A 3R7RA 3VDZA 4LJOB 5IA7A 4WJPA 3VFKA 1WM3A 2KANA 3KH0A 3ZW3A 2Z59B 4WWOA 3BY4B 4MGKE 5AZGA 3IVFA 1YD8U 4GGQA 4K7UA 2ZPNA 4WAAA 2KTRA 5FR6A 4DHJB 4DDGD 3UQBA 2C7HA 2O6VA 2NPTB 3W1YA 4F7ZA 4TKNA 1P9DU 2EMSA 2KQ7A 4LJPB 4WQOB 2JPHA 2DX5B 2RGFA 4HCNB 2BKRB 2WYQA 4FJZA 3PGEA 2B3AA 3DVGX 2CHWA 4NAWB 2ZPYA 4G3XB 4IWPA 1WE7A 1UH6A 3VUYA 2DYBA 1WJUA 4FA6A 2MBBB 2LGYA 3I3TB 4MJSB 2D07B 4KDIC 2OJRA 3DDCB 1WX7A 3DVGY 3KUCB 3ENEA 4GOCA 2JZ3B 3VVWB 4MH0E 4ZRIA 3B1LX 1WIAA 1X1MA 4BFRA 1XQQA 3PLUA 2Z0DB 1SGHA 3ZTCA 4MEMA 2NPTA 2JZZA 1ZKHA 1WXMA 1NBFC 1KOTA 4MGZE 1IYFA 2N9EB 2M1MA 5CTRC 3A33B 1XT9B 4GIVA 2L76A 1R4NI 3U7DA 3A4SC 2LXAA 3MTNB 3HM3A 2CHXA 2ZNVC 2MBOA 1E8XA 2D10A 2KMAA 5DPWA 2R2OA 4NAWA 3APDA 3ZNID 5LXIB 3S2AA 4BBNC 3ZRFA 1GC7A 1LM8B 2O6VD 3GOEA 4ICVA 4IG7B 3ONSA 4HJKA 1C3TA 2FIDA 2C60A 3PZDA 3VQIA 2NVUI 2K8BA 3L13A 4TUUA 1E8ZA 2IO0B 2J0MA 2AWTA 2JRIB 2K1FA 3HHMA 3L17A 2KXJA 4W9DA 1WF9A 4RM8A 3X23A 2L0TA 2K6DB 2JWZA 3QQ8B 4E3CA 2CHZA 4NPNA 2IO1B 1ISNA 3H7PB 1H4RA 1V9JA 2BGFA 2HD5B 3CSTA 2G4SA 4MM3A 2G3QB 3PT2B 5CHFA 3ZNGC 4GB9A 3ALBA 1RFAA 2NBVB 3DBLI 5D7GA 2AEHA 2HE7A 2J0KA 3H6NA 3OJ4B 2ZZPB 3DVNU 4FN2A 4XC2A 2MLBA 2J7QB 4HDQA 4JL9A 4WWNA 4K1RB 3RD2A 4LCDE 3OLMD 2WX0A 3KYDD 4AJWA 2BWFA 3N3KB 3A9JB 3O65B 1TZ1A 2FNJB 3VHTC 4MSQB 3PV1A 4F1SA 2NS5A 2ZNVB 4M8MA 3ZO5B 2CKHB 2PJHA
chains in the Genus database with same CATH superfamily
1XLOA 4NNJB 4FJYA 1VZ8A 3VRAB 4CYEA 1KLGD 3DBSA 5E6JA 3WAOA 2LI5A 2Y5CA 4JLCA 2DHZA 5L83A 1RAXA 1D5XC 1ET6A 1IUEA 2LHDA 3KWVA 1WMHB 1K51A 2CU3A 2ON8A 2N0SB 2A5UA 4NY0A 4URKA 1YX5B 3Q3JA 4KZCA 3R8BA 3MP9A 2GBMA 2IYDB 4AJYB 4FADA 4GMVA 2KTFA 3JSVA 3WANA 1ZOYB 4I6LB 4ASWC 2AX5A 1N6ZA 2J52A 4EKUA 2JF5A 4KIKA 3AV8A 2RD0A 4GU2A 3L08A 1XXGA 4C4VB 4BVUC 1CMXB 1PDXA 1P7FA 1IP9A 2EKEC 3U8ZA 4RH6A 4W9FA 4RM9A 3ML8A 3TEZA 4HWIB 2NR2A 1S1QB 3DWMA 3SDLC 2YEPF 3PLVA 4BOSC 3BYTB 1WXQA 3Q8FA 1TJEA 3P2BA 4ICUA 1C4CA 4WAFA 2M19A 1JWBD 2KZRA 1BUIC 4A90A 1VZ7A 2BS4B 1OEYJ 1UWXA 1VDVA 3NVVA 2LHEA 3R2IA 3UF8A 1MFWA 1WZ3A 3AE1B 3T8MA 1L2NA 2GBNA 2QEJC 1C4PA 1J7BA 5GXGB 3TL5A 3R2TA 1FNWA 1M94A 2L05A 3BYYB 2ZJDA 3ZNZB 2DAFA 4OVVA 3WA0A 4EZJA 4IWOA 3MHZA 4IM2A 4ANXA 2DENB 2I1KA 4EE2A 5FKAC 2KX3A 3HVDA 2C9WB 3DBHI 3RZWC 2WXGA 3L0WB 4WJQA 3RI7C 1L6VA 2IGGA 4GDLA 1PGXA 1WR1A 2JRHA 2KK8A 2LGSA 2V1YA 2LASA 1CZPA 4BBNF 2BB6A 1AWDA 2W54A 2D5GA 2QCZA 1C76A 5J17A 1V81A 3C8YA 3NS8A 1ZDVA 3DVNV 1PGBA 1VCBA 2DNFA 1E8YA 1JCKB 3N9YC 2N9PC 4ZDVA 2N7JA 3T3NA 3AM9A 1GB1A 3H8HA 3B2FA 1QOGA 2CR5A 1LFDA 4W9HA 4OZAA 3V61A 4W9IA 2INCC 4N58A 3RCZA 2N1WA 2IZVB 3W1SA 1NI3A 2WXJA 5TSSA 2M56B 2IO2B 1JMLA 1VJKA 2PLPA 4K7SA 1WX8A 1PYWD 3PREA 2L52A 3AE6B 2O2VB 3V6CB 2JYTA 1YJJA 4FHKA 1XD3B 4KX6B 1SE9A 4LNKA 4YSXB 1HQRD 3JYUA 4MH8A 2H88B 1H8CA 1E9MA 2MJ3A 3L4PA 3DWGC 3AN1A 1T0QC 4K3BA 5IN7A 2IBIB 2LXCA 1R4NB 2KD0A 1PQSA 4HPPA 2JQRB 4DQOC 2ZW1A 2LVOA 4DBGA 1B9RA 2BYTA 1NDDA 4DXGA 5LNK1 2FUG1 2PTLA 5BO4B 2R2QA 3AEAB 2XK5B 2L83A 1LGRA 1TIFA 2DYMA 3ETRA 2V4LA 1WFYA 5E6PA 4ZRJA 2LVQA 4HPLB 5L95C 2MP2A 2BT6A 4PS8A 4XGAB 3RNBC 1CK1A 2AQ1B 1FXIA 4DXAB 1FFVA 3PSEB 1JWSD 2KLGA 3MC9A 1IGDA 3FILB 1GNUA 2KC1A 3RYTA 2DAJA 4IOIE 2BF8B 4WJOA 3V6EB 2WU5B 1FPYA 3KQ4A 2I38A 3RNAC 1D3ZA 5AUKA 3AE8B 2K0PA 2J4XA 2L00B 2FIFA 3T9LA 2H89B 3DOWA 1ET9A 1V6EA 2ZVNA 4G50A 1L4DB 2K9XA 1XCTL 2MBHA 5CX3A 4FLHA 2DZJA 3Q8CA 3UGBB 4PYZA 4S17A 2M0XA 4RNAA 1UELA 3DHGC 4LNFA 5C23A 2E3TA 3AEEB 4M0WA 1V2YA 5BMIA 1F2RI 1YX6B 2JXXA 2PE9A 1K52A 2BB5A 4KIKB 1SEBD 1WXAA 2HTME 2UYZB 2JX5A 1PUTA 3RNEC 1XLQA 1WXSA 1ZE3D 5DPTA 1I42A 2G1EA 4A3PA 1OQQA 4DWFA 1MVKA 4LTUA 2NTSA 2L7RA 2KOXA 4W9JA 2HJ8A 2BKFA 5H8YE 1QF6A 4P1BC 5IA7A 4WJPA 1WM3A 2KANA 3LXFA 3ZW3A 2Z59B 4WWOA 4A8XC 4GGQA 2O6VA 1SB3C 4TKNA 1P9DU 1QILA 2KQ7A 2K22A 4FJZA 3V3XA 3BVGA 2MJDA 4IWPA 3VUYA 1SF0A 1WJUA 3GZNB 2MBBB 2D07B 5I4DA 2AQ2B 2OJRA 1WX7A 1KFYB 1FFUA 3B1LX 2SEBD 3AEDB 1X1MA 1XQQA 2OEDA 2VH2A 1SGHA 2JZZA 1ZKHA 1NBFC 4H2AA 4MGZE 2N9EB 4KGRA 1XT9B 5HG2A 1R4NI 2OHFA 2Z8LA 2BTEA 1FCLA 2CHXA 1E8XA 2GI9A 3SFEB 2R2OA 4BBNC 1GPXA 4IG7B 4JE3B 3ZXVA 1HEZE 4PT5A 1E8ZA 1WF9A 4OHJA 4RM8A 3BK1A 5BMGA 3X23A 2K6DB 2JWZA 2QJLA 2IO1B 1ISNA 3DBRB 2BGFA 2HD5B 2DLBA 2VH1A 1EU3A 2DBYA 1RFAA 3IT6B 3SEBA 4FN2A 2MLBA 4JL9A 3RD2A 3A9JB 3O65B 2LUMA 2FNJB 3VHTC 2NS5A 1SJHD 2CKHB 5D94A 2K8HA 2WXMA 4RF0A 2MBQA 1WGYA 2FCNA 1WR6E 2LGIA 2LJ5A 1C4AA 1OQYA 3AU4A 1ENFA 2FCSA 1J0GA 3PRPB 4LNNA 1SE3A 2JY6A 5BYQA 1SJED 2K5PA 1Y56A 1V5OA 1KM7A 4O1NA 1WWTA 5JHAA 1S3SG 2PMVA 1OEYA 3TMPB 3QAQA 2NTTA 3ECIA 3SU8X 1JROA 4KSKC 3K9PB 2KN4A 4KKJA 4RFBA 1ZPSA 3TUOA 2WXOA 1LO5D 1CJEA 1OFFA 2GOWA 3WAPA 1C1YB 4W9EA 3RULA 2INDC 2WX1A 1N62A 4WH4A 1TY0A 2KJHB 3QX1A 4NJ6A 1YIWA 1UUPA 1FM0D 2BS2B 1EF1A 4MACA 1ESFA 1TS5A 2I2YA 1ZGUB 3R7QA 2Y5BB 3L54A 3TBLD 2JXTA 4M00A 4RGTA 5D6JB 3Q3NC 2KWDA 1F2RC 1EU4A 3W2DA 4AP4C 2LZ6A 3QWZB 2M4NA 4JPSA 1G6JA 4EZKA 4WURA 2KDBA 1ROEA 4A55A 4MJSA 2G4DB 4W9LA 4GDKA 1Z2MA 2V9HA 3H9DA 3K9OB 3QC8B 2WGSA 3TIXA 1BXTA 3GZNI 1HTOA 4NJCA 1OGWA 1WI0A 1Z5SB 3N30A 1HZ6A 3TEXA 2IPKD 2W55A 1T0RC 2ZCCA 4EEWA 4M0WB 4M8NA 4NAMA 1HA5A 1SBBB 3BINA 4FBJB 1SSNA 3EFUA 1DOXA 3PRZA 2Z0EB 2AQ3B 1AARA 1JW9D 3URYA 3VUXA 3LYYA 1SIFA 3AE4B 3NZUA 2KVRA 2B76B 1E7VA 3DBRI 2GBKA 2MA9B 3FAHA 5LLIA 2LRUA 1YJ1A 1V5TA 3N32A 3V60A 4P1CC 2QDFA 4YSYB 2V0GA 1Q5WB 5AEKB 1C78A 2AL3A 2KMCA 5E6NA 3WCQA 4JWUC 2WQYB 2RDBC 2YLMA 1YN3A 3ZTDA 2M17A 3ZDTA 4II2B 1L5PA 1IPGA 1ZXHA 3VUWA 3ML9A 4GXBA 3P4PB 2INPE 1T5XD 1FNUA 2PW9A 1XCQL 3JW0X 2LMCA 2L32A 4IWQA 1E10A 4EFOA 3Q69A 3IG3A 1WZ0A 2WHIA 3L10B 3AEBB 3NS1A 2GMIC 4GSWA 5G5HA 3A9KA 3BIID 2XN9C 4L23A 1FO4A 2D11A 1YMHE 3IAM1 3IT4B 4CO7A 4YSZB 3CIRB 2JT4B 4HKQA 1YQ3B 2BQQA 4AQ7A 1FD6A 3EGRA 1UF0A 2LGXA 2KFKB 4GLSC 3AE2B 3JVZX 2MHJA 2KDEB 1CQVA 2IGDA 2WP9B 1V1PA 4BOZB 1P7EA 2JUOA 1GUAB 3MJWA 4LDTB 2KNBA 1TKGA 4A6QA 2PKOA 2WXKA 2M8SA 2HTHA 4TMAB 3I5JC 2ACZB 3UI3A 1YOVB 4R3DA 1KF6B 3QK0A 3DCGA 4LLGM 5AZFA 1N61A 3A1QA 4HXDA 4ZRPA 4MT5A 4RF1A 2L3ZA 3QJZA 3IHPC 1WRDB 3DQVA 2BS3B 1WGRA 1WX9A 1TKYA 4XX5A 5E6OA 3ZNHB 3ZQ4A 3NRZA 3Q3MC 4BKSD 3IBEA 2G9HD 3KWLA 1UD7A 4WWMA 4C00A 2FAZA 1RLFA 2NBUA 3WIMA 4JX1C 1JWMD 2ZCBA 1DOIA 5IOIA 2AL6A 5FR3A 1L6UA 3AULA 2KDFB 2KTRB 1WRIA 2WLBA 1QZEA 3QIJA 1ZW7A 2VZKB 2DWQA 3OJ3A 1WJ6A 2L0FA 1F9JA 1FMAD 3KUZA 1D5ZC 4KSLC 1N63A 4ITKA 4XE0A 1K8RB 4ACFA 1E5WA 2RPQA 1MHXA 4L1BA 3QARA 2GBRA 4MGIE 3LJ3A 1D5MC 3P42A 3BY4B 5AZGA 2KYWA 4WAAA 4DHJB 1F1HA 2LJIA 4DDGD 3UQBA 1Q10A 2NPTB 3IAS1 1FRRA 2DX5B 4N59A 4HCNB 3PGEA 2B3AA 1MI0A 2QSDA 2CHWA 2Y5PA 2ZPYA 4G3XB 1D6EC 4FA6A 4D2KA 4MJSB 4KDIC 3DDCB 4GOCA 1DGJA 1UGJA 4HKZE 3N1ZC 2M0AA 2HJ1A 2Z0DB 4LK0M 3MC8A 4MEMA 4MM3B 2EELA 1XO3A 1QT9A 5CTRC 3A33B 3MTNB 4Q2JA 2KMAA 4NAWA 4P16A 2FIDA 3PZDA 3L17A 3QQ8B 2CHZA 1H4RA 1TZOA 2IJ0A 3ZNGC 4GB9A 3ALBA 2HE7A 3DVNU 4XC2A 1IBXA 4K1RB 2WXNA 3N3KB 1TZ1A 3NVZA 4KGTA 4M8MA 3ZO5B 5EDSA 2PJHA 3VR9B 2I1JA 3NZSA 4US9A 3JSVB 3I63C 4K7WA 1GJZA 1M4VA 1MG8A 3H7PA 2SAKA 3GE3C 3I57A 3Q2AC 4TQ1A 1J19A 3AE7B 5HI1A 1HTQA 1WSPA 3ZVVA 4W9CA 2FUHB 3APFA 3HVZA 2KC2A 4ZOHC 3PHWB 1SXTA 4XDCA 2LGDA 3A4RA 3AXCA 2X38A 4MELA 2PIAA 1GB4A 1TGZB 3A9KB 3B9JA 2JWUA 2MX2A 3OG5A 3SHQA 4DXFA 4REZA 3HRDD 4G0NB 3AEFB 2K25A 3UINB 1UGMA 4OW0A 5DPRA 4WWPA 2MW5A 3KYCD 3PRMB 2NMQA 3P4SB 3C0RB 3H7SA 3R66C 3ZXRA 1TBEA 1R7SA 3CMMB 5IO9A 2QILA 1R4MB 1GG3A 1KJTA 2NBWB 3Q3OC 2KJ6A 3ZJTA 3L16A 4I6NB 1C79A 3WAMA 5AUIA 2ONQA 3ZLZA 1AN8A 3B2GA 1KLUD 5G55A 1P0RA 3AE5B 2BYVE 4IM3A 4TV3A 4GDLB 5KHOA 4YT0B 3IXSA 1RM6C 1SE2A 1I7HA 2NCNA 4KZ0A 1K53A 2MBEA 3U2SC 3GP7A 3U4EG 2N7EA 4BKTA 2GBJA 1YN5A 5KHQA 4RGNA 3HK0A 1F52A 4A3OA 3NJTA 3CSFA 4P7IA 1ZP0B 2VRRB 5IKCM 5BYRA 1WYWB 3VXWA 1MHHE 4RGMA 5HHDG 4F8CB 1YN4A 2AYOB 2RDHA 1SIJA 2BWES 1V8CA 2JSVX 3AE9B 2PE6B 3U30A 3MJ5A 1EO6A 2EKIA 2RSUA 2V3PA 1T0YA 1FCCC 1FEHA 1NI2A 4JQWC 1TS2A 4UDUC 4J6IA 1U4AA 1TT5B 3MFGA 1Y8RC 5EE9A 4HPMB 1GAQB 2J53A 3MHSD 3B08A 1P3QU 2KLCA 3QCAA 1NYQA 1RYJA 2W9NA 3Q3FA 2BYFA 3M62B 3H1UA 1WGGA 2MWSB 5IAAC 3ZYYX 2KFJA 2WXHA 4E71A 5BMHA 2PEAA 4C7YA 2OOBB 5CHWA 3AMZA 3ZIMA 3EC8A 3EA6A 3PVLA 1MJDA 4HDOA 3V05A 2D3CA 2RMMA 1UBIA 2KWUB 2ZW0A 3M95A 3J9CA 4PK1A 3ZRCA 4BKGA 3NUHB 2BBCA 1JRUA 3VAWA 3NY5A 1J7AA 1I4XA 1L0VB 2KHWB 2Y3AA 2J0JA 2RDGA 2IDYA 1JWUD 2MP2B 3Q8AA 3TCAA 1I35A 2O2VA 5FK9C 2EMTA 2INNE 4IW0A 1LQBA 4M02A 4A9AA 2WWZA 4W9KA 2MQJA 3TJPA 1PGAA 1YQBA 2L8JA 2IGHA 3TEYA 5G2NA 4IC7B 3PTFC 2CS4A 3VR8B 5CHVC 4AUQC 3RMKC 1N5XA 2IO3B 4NZLB 3Q14C 1WY8A 4IDIA 1TS4A 3EECA 4OVUA 1HZ5A 2N1VA 4ANUA 1EF5A 5DCNA 2MCNB 4GN1A 2YVCA 3WALA 4RGOS 1R4MI 2XK5A 5C3JB 1PFDA 1SE4A 2MJEA 3UIPB 2BPSA 2WXPA 3BVZA 1QOFA 2C7NB 2N7DA 1EUVB 3ZUNA 3FC4A 3IFWB 1GC6A 1E8WA 4FXCA 4KDLB 1V86A 3HIZA 1NENB 5JH5C 4ZHOA 2WDVB 2K39A 5LXHA 2V4IB 4XWWA 2QMTA 3O13A 4KV2A 4HRSA 3VTWA 5AZHA 4L2YA 1JRPA 1L0YB 4B0MA 3FILA 3UQAA 1FRDA 2C7MB 1I4RA 3RPFC 3KVFB 3RNCC 4EUTA 1E0ZA 2GRIA 2K6QA 3B0AA 5C1ZA 2E6XA 5J2RA 2KMMA 1FXTB 4P6VF 1QQRA 3CWIA 4ARCA 3HUIA 3ZJVA 1UNSA 4FULA 2LRWA 1I4QA 2O6VB 2KX0A 3NVYA 4HLEA 4DDID 4US8A 2KDMA 1TY2A 4NQKE 1WGHA 1GOZA 5DPSA 3AU5A 5G5GA 4C7ZA 3AB5A 2V3SA 5BYSA 4AS1A 3VDZA 4LJOB 3VFKA 3BK2A 2LFIA 4MGKE 3IVFA 1YD8U 2MH7A 4K7UA 2ZPNA 5FR6A 2C7HA 4F7ZA 1T6BX 4LJPB 4WQOB 1EWCA 2N9LA 2BKRB 3N1XC 4LNIA 1UH6A 2LGYA 3I3TB 4ZHPA 4ARIA 3DVGY 3KUCB 3ENEA 5C2TB 2JZ3B 3RN9C 3SFDB 3VVWB 4ZRIA 1YQ4B 4K3CA 4BFRA 3PLUA 3ZTCA 3RFZB 1IYFA 4HROA 4GIVA 1N5WA 5D3DA 3HM3A 4XWTA 2D10A 2HDEA 4RCOA 5DPWA 2WXRA 1ZUD2 3APDA 3VRBB 3ZNID 5LXIB 3S2AA 5HFYA 1GC7A 1LM8B 2O6VD 3GB1A 4ICVA 4HJKA 2C60A 1F0ZA 2NVUI 2K8BA 5EE1A 3L13A 4TUUA 2J0MA 4XDDA 1L4ZB 4NPNA 1V9JA 3SR6A 3CSTA 2G4SA 2NBVB 5D7GA 2AEHA 2J0KA 3H6NA 1IGCA 2PVOD 1DOYA 2J7QB 4HDQA 4LCDE 2WX0A 3KYDD 4TSSA 2BWFA 4AJWA 1T0SC 4F1SA 3P63A 2ZNVB 1UWMA 3LB8C 1C9FA 4USAA 5HKHA 2KACA 4OZBA 1E90A 1XF5L 2D3BA 4HVBA 3U7ZA 2A4ZA 4ANWA 1VZ6A 3OWEB 1ZXIA 4HK2A 2LD9A 2WNMA 4MDKE 4C56C 3W5UB 1BT0A 2ZVOA 3A9JA 4G11A 5MPOA 5EE3A 3X0WA 4S0RA 1ZDXA 5JZEB 1DYQA 1FNVA 4W9GA 5J18A 4LDTD 4DHZE 2FCMA 2D2QA 4B0EA 2REXA 3HM6X 3KUDB 1KH0A 2KN5A 4IKGA 2RR9A 4HEA1 1VLBA 5TR5A 2GLSA 2MSED 1E6EB 1OTRB 2IY0B 4LNOA 4ANVA 3Q6BA 2FE8A 3PPAA 1F77A 4BAXA 4E74A 2LUEA 5H92C 3TEWA 3W5VB 2K8CA 4OVZA 1K50A 1KLVA 3R3MA 2TSSA 3RNFC 5D3IB 2BW2A 4GDKB 3EUB2 2JU6X 1VR9A 1L0XB 3UIOB 2KKCA 2J42A 4WJNA 4ZYNA 2LWPA 3QA8A 2JVCA 5T8IA 4YL8A 1WGDA 1J8CA 3RZFA 4X57B 1WXVA 3AE3B 1T3QA 4YWGG 1UBQA 3VTVA 3W1SC 2DYOA 1P98A 3AECB 4N6EB 2IY1B 2VZKD 2KQSA 3OAWA 3VH3B 2V3NA 1HE8A 4BZAA 2CJNA 3NZ3A 1I4PA 2D3AA 3EHVA 1NYRA 3NHEB 1YJIA 4CHKA 3RT3B 1J7CA 2KDIA 4DHZB 4B95A 1P1AA 3N1YC 1UZXB 4I6PA 3U52E 4TQ0A 2DZIA 1QOAA 3BWUD 1D4BA 4PYUA 5D2MB 4FHJA 4DHJD 1STEA 2DZKA 1QOBA 1WJ4A 4MGYE 3ABVB 3NG0A 2JZPA 3D32A 4K81A 4N9F4 2N9XA 1WM2A 2LVPA 3APCA 4AWJA 3AI5A 4XZ4A 2WU2B 2JYEA 3VTUA 4ZRKA 1TKEA 1N60A 3PHXB 4JGHB 4PS7A 1TYGB 2FBWB 3N20C 5EE0A 3M63B 4YTNB 2WS3B 3QHTA 4PS3A 3PZ8A 2W3SA 2W82A 3VH4B 3E9SA 4RMAA 2LEKA 2WXIA 2KVZA 4MSMB 1WMHA 1V97A 4KVGB 4A20A 4ZRQA 1Q0WB 1Q1OA 1V80A 2KQ4X 4WQMA 4ZYSA 1FXAA 4FJVB 1MPEA 2KWVB 1WE6A 4B6WA 2KJRA 3M3JA 5JHBA 4HCPB 2ASQA 2QIEB 1V1PB 2UWQA 4JWSC 3BZDB 2D3GA 4AOFA 3ZDMC 2KAJA 1RRBA 3LDZE 2MEKA 1I4GA 1WJNA 4C4VA 4YXDB 1E7UA 2RPVA 1B1ZA 4JIOU 3DBLB 4WIPA 5GMVA 3BVMA 3A1QB 3GE8C 3P1MA 4BKSA 1BMLC 1L7YA 3KW5B 3V62A 1QLBB 3KLSX 3Q8EA 1EM7A 2MRPA 3ZJUA 4YTPB 4DK5A 2UU7A 4B9KA 2N4FA 3RNGC 1YNTE 2N9KA 3SD5A 1RFKA 2K3UA 2KFKA 3AH7A 4II3B 5JXVA 3ZKJC 2L1AA 4IUMB 3PS6A 4NQLB 3NVWA 4NJ7A 1A5RA 1RWSA 2ZEQA 1KTKA 3DPDA 2PVGC 1MG4A 2CJOA 3TSSA 4XYCA 4YTMB 4CQNA 4QAYA 1NEKB 2KWCA 4EOYA 2WXQA 4M01A 4KGSA 4IM0A 2XBBC 2XEWA 1JALA 2WXFA 2G45B 3CF6E 1LXDA 3MC0B 1V49A 2CU1A 1AW7A 2KO3A 3RUIB 2C5LC 1QKZA 1WYGA 2GB1A 2DZMA 2FCQA 3NOBA 2BYEA 1VD2A 2WDTB 3E56A 2BVCA 3P4QB 1TTNA 1KRHA 1AYFA 1WH3A 2WXLA 2QHOA 2PPHA 2W3RA 4EZLA 1V1OA 5IP4D 1A70A 4HJGE 3W9CB 3R7RA 3C19A 1E7PB 3KH0A 4KKIA 1TS3A 2KTRA 1WGKA 1XEEA 3W1YA 4C80A 3I9V1 2EMSA 2JPHA 1C77A 2RGFA 2WYQA 1OQRA 2WDQB 3DVGX 3EFCA 4NAWB 2WDRB 4J3OD 1WE7A 2DYBA 2YEPB 2R61A 3P4RB 2ICIA 3FKYA 3DHIC 1ACCA 4MH0E 3DBHB 1WIAA 3T3OA 1JWAD 2NPTA 1WXMA 1KOTA 2M1MA 3U7DA 2L76A 3A4SC 2KT7A 1XLNA 2LXAA 1VRAB 3ZGZA 2ZNVC 3PZ7A 2MBOA 1IBXB 2XNAC 3PO0A 3AEGB 3ZRFA 3GOEA 2Q5WD 3ONSA 1C3TA 1I4HA 3VQIA 2JRIB 2IO0B 2K1FA 2AWTA 4W9DA 3HHMA 3GS2A 2KXJA 2OJWA 2L0TA 4E3CA 2X8XX 3H7PB 1JQ4A 4MM3A 1NVID 2G3QB 3PT2B 5CHFA 1FIQA 3Q8BA 3DBLI 2QC8A 2ZZPB 3OJ4B 4WWNA 3OLMD 3DHHC 1HXYD 4MSQB 3PV1A 1EWYC 1XLPA 4OZCA
chains in the Genus database with same CATH topology
5D94A 2I1JA 2K8HA 4NNJB 5HKHA 4FJYA 2MBQA 1E90A 1WGYA 2FCNA 3NZSA 1WR6E 4CYEA 3JSVB 2LJ5A 4K7WA 3DBSA 1OQYA 3WAOA 3AU4A 2LI5A 1GJZA 4HVBA 2FCSA 1J0GA 3H7PA 1MG8A 2DHZA 3PRPB 4JLCA 5L83A 1RAXA 2A4ZA 4ANWA 1WMHB 2JY6A 4TQ1A 4HK2A 2LD9A 1J19A 1KM7A 1V5OA 4MDKE 5EDSA 5JHAA 1S3SG 2A5UA 4NY0A 1OEYA 1BT0A 2ZVOA 3A9JA 4G11A 4URKA 1YX5B 3TMPB 3QAQA 3Q3JA 3ZVVA 4W9CA 3X0WA 4KZCA 2FUHB 3APFA 3ECIA 5JZEB 2KC2A 3SU8X 4W9GA 5J18A 4KSKC 2GBMA 3K9PB 2IYDB 3PHWB 4AJYB 4GMVA 4FADA 2KTFA 3JSVA 4LDTD 3WANA 2LGDA 2FCMA 3A4RA 2D2QA 3AXCA 4DHZE 4I6LB 4ASWC 4MELA 2REXA 3HM6X 3KUDB 2KN5A 1TGZB 2RR9A 3A9KB 2MX2A 3SHQA 5TR5A 2MSED 4G0NB 1OTRB 2GOWA 3WAPA 1C1YB 2IY0B 2K25A 4W9EA 3RULA 3UINB 4EKUA 2JF5A 1UGMA 4KIKA 5DPRA 2WX1A 3PPAA 4ANVA 4WWPA 2RD0A 4GU2A 3L08A 2KJHB 3QX1A 4E74A 2LUEA 2MW5A 4BVUC 1CMXB 2K8CA 4NJ6A 1IP9A 1YIWA 2EKEC 3U8ZA 3KYCD 4W9FA 3PRMB 1KLVA 4RM9A 3R3MA 1EF1A 3ML8A 3C0RB 3H7SA 4HWIB 2NR2A 1S1QB 3R66C 1TBEA 3SDLC 3PLVA 4BOSC 3CMMB 4GDKB 1ZGUB 3R7QA 2Y5BB 1GG3A 3L54A 3P2BA 4ICUA 1KJTA 3UIOB 2KKCA 2NBWB 2KJ6A 4WJNA 4ZYNA 3TBLD 2KZRA 2LWPA 3QA8A 5D6JB 2JVCA 4YL8A 3L16A 1WGDA 4I6NB 3WAMA 1J8CA 3RZFA 4AP4C 1OEYJ 2LZ6A 3ZLZA 4X57B 1WXVA 3QWZB 2M4NA 3UF8A 1WZ3A 3T8MA 4EZKA 1G6JA 1UBQA 5G55A 3VTVA 3W1SC 1L2NA 1P0RA 2GBNA 2DYOA 2KDBA 1P98A 2BYVE 4IM3A 4TV3A 4GDLB 2IY1B 5KHOA 3TL5A 4MJSA 2G4DB 2KQSA 3OAWA 2L05A 1M94A 4W9LA 3VH3B 1HE8A 2ZJDA 3ZNZB 4GDKA 2DAFA 2NCNA 4KZ0A 1Z2MA 2MBEA 4OVVA 3H9DA 3K9OB 3WA0A 2N7EA 4BKTA 3QC8B 4EZJA 3TIXA 3GZNI 2GBJA 3EHVA 4IWOA 3NHEB 4IM2A 4CHKA 4ANXA 3RT3B 2DENB 2KDIA 4DHZB 5KHQA 2I1KA 4B95A 1OGWA 3HK0A 1P1AA 1WI0A 4A3OA 2KX3A 2C9WB 3CSFA 4P7IA 1Z5SB 2VRRB 1UZXB 3DBHI 3N30A 4I6PA 1WYWB 4TQ0A 3RZWC 3VXWA 2DZIA 3L0WB 4PYUA 5D2MB 4FHJA 4WJQA 4DHJD 2ZCCA 2DZKA 4F8CB 4EEWA 4GDLA 4M0WB 1WJ4A 2AYOB 4M8NA 1WR1A 2BWES 3BINA 2JRHA 4FBJB 4MGYE 2KK8A 2PE6B 3EFUA 3U30A 2V1YA 2LASA 3PRZA 4BBNF 1EO6A 2Z0EB 3D32A 4K81A 1AARA 3VUXA 4N9F4 2RSUA 5J17A 1SIFA 2N9XA 1WM2A 1T0YA 1V81A 2LVPA 3NZUA 2KVRA 3APCA 3NS8A 3DVNV 4AWJA 1NI2A 3AI5A 1VCBA 4JQWC 1E8YA 4XZ4A 3VTUA 2N9PC 4ZRKA 4ZDVA 4J6IA 1U4AA 1E7VA 1Y8RC 3PHXB 4HPMB 3DBRI 3MHSD 2CR5A 2GBKA 1LFDA 4JGHB 4W9HA 2MA9B 4PS7A 3B08A 3V61A 4W9IA 1P3QU 2KLCA 3M63B 5LLIA 2LRUA 1YJ1A 3RCZA 3QHTA 1V5TA 2N1WA 3N32A 2IZVB 3QCAA 4PS3A 3W1SA 3V60A 2IO2B 2W9NA 3Q3FA 2BYFA 3M62B 1Q5WB 5AEKB 3H1UA 2AL3A 1WGGA 2KMCA 2MWSB 5E6NA 5IAAC 3VH4B 2KFJA 4K7SA 4RMAA 4E71A 2PEAA 1WX8A 2OOBB 5CHWA 4MSMB 1WMHA 2YLMA 3PREA 4KVGB 4A20A 2O2VB 3V6CB 3ZIMA 3EC8A 1XD3B 4FHKA 1Q0WB 1SE9A 3PVLA 4HDOA 3JYUA 1UBIA 3ZTDA 1Q1OA 2KWUB 2M17A 4II2B 3ZDTA 1IPGA 1H8CA 1V80A 3ML9A 4GXBA 3VUWA 3M95A 3ZRCA 4BKGA 3JW0X 4IWQA 1JRUA 4FJVB 3NY5A 3VAWA 4EFOA 2IBIB 2LXCA 3IG3A 1WZ0A 2KD0A 3L10B 1PQSA 2KWVB 1WE6A 4B6WA 2KJRA 2GMIC 3M3JA 4GSWA 2KHWB 2LVOA 4DBGA 5JHBA 4HCPB 2ASQA 2J0JA 3A9KA 2MP2B 3TCAA 2UWQA 1I35A 1NDDA 2D11A 2D3GA 2O2VA 2EMTA 4IW0A 4CO7A 1LQBA 5BO4B 2R2QA 2WWZA 4AOFA 3ZDMC 3LDZE 1RRBA 4W9KA 2MQJA 3TJPA 2XK5B 1WJNA 2JT4B 1E7UA 2DYMA 1YQBA 2LGXA 2V4LA 2KFKB 2L8JA 4JIOU 1WFYA 5GMVA 3JVZX 5E6PA 4ZRJA 5G2NA 3A1QB 3PTFC 2CS4A 2LVQA 4HPLB 4IC7B 2KDEB 5CHVC 4BKSA 5L95C 4AUQC 2IO3B 1L7YA 3KW5B 1WY8A 2MP2A 3EECA 4OVUA 3V62A 4BOZB 2N1VA 4ANUA 1EF5A 4PS8A 5DCNA 2JUOA 1GUAB 3MJWA 4LDTB 2KNBA 2MCNB 2MRPA 4DK5A 4GN1A 2YVCA 3WALA 4B9KA 2M8SA 2N4FA 4DXAB 1R4MI 2HTHA 2XK5A 3PSEB 2KLGA 3UIPB 2BPSA 2C7NB 3SD5A 2N7DA 1GNUA 2KFKA 2KC1A 3RYTA 1EUVB 2DAJA 3ZUNA 4II3B 2BF8B 4WJOA 3V6EB 3IFWB 3QK0A 3ZKJC 3DCGA 4IUMB 1GC6A 1E8WA 5AZFA 3A1QA 4HXDA 4KDLB 1V86A 3PS6A 3HIZA 4NQLB 4NJ7A 1D3ZA 5JH5C 2L00B 2L3ZA 2FIFA 3QJZA 1A5RA 3IHPC 1WRDB 2ZEQA 3DQVA 3T9LA 1WGRA 1V6EA 1WX9A 3DOWA 2K39A 3DPDA 4XX5A 5E6OA 5LXHA 2ZVNA 3ZNHB 4G50A 4KV2A 4BKSD 2MBHA 3IBEA 5CX3A 4FLHA 1UD7A 2DZJA 3VTWA 3UGBB 5AZHA 4PYZA 2KWCA 2M0XA 2FAZA 1RLFA 2NBUA 3WIMA 4EOYA 1UELA 3UQAA 4IM0A 2XBBC 5C23A 2XEWA 2C7MB 2ZCBA 3KVFB 2G45B 3CF6E 1LXDA 4EUTA 1V49A 2CU1A 2KO3A 2K6QA 3RUIB 1V2YA 3B0AA 2C5LC 5C1ZA 1YX6B 5J2RA 1FXTB 2DZMA 2FCQA 2AL6A 3NOBA 3AULA 2KDFB 2JXXA 2BYEA 1VD2A 2PE9A 2WDTB 2KTRB 4FULA 2LRWA 1QZEA 4KIKB 2O6VB 3QIJA 1WXAA 1ZW7A 2KX0A 1TTNA 4HLEA 4DDID 3OJ3A 2UYZB 1WJ6A 2L0FA 1F9JA 3KUZA 1WGHA 4NQKE 1WXSA 1WH3A 5DPTA 1I42A 2QHOA 4KSLC 4A3PA 4DWFA 1K8RB 2PPHA 4EZLA 5DPSA 3AU5A 1E5WA 2RPQA 2L7RA 2V3SA 2KOXA 4W9JA 3QARA 2GBRA 2HJ8A 2BKFA 4MGIE 3LJ3A 3R7RA 3VDZA 4LJOB 5IA7A 4WJPA 3VFKA 1WM3A 2KANA 3KH0A 3ZW3A 2Z59B 4WWOA 3BY4B 4MGKE 5AZGA 3IVFA 1YD8U 4GGQA 4K7UA 2ZPNA 4WAAA 2KTRA 5FR6A 4DHJB 4DDGD 3UQBA 2C7HA 2O6VA 2NPTB 3W1YA 4F7ZA 4TKNA 1P9DU 2EMSA 2KQ7A 4LJPB 4WQOB 2JPHA 2DX5B 2RGFA 4HCNB 2BKRB 2WYQA 4FJZA 3PGEA 2B3AA 3DVGX 2CHWA 4NAWB 2ZPYA 4G3XB 4IWPA 1WE7A 1UH6A 3VUYA 2DYBA 1WJUA 4FA6A 2MBBB 2LGYA 3I3TB 4MJSB 2D07B 4KDIC 2OJRA 3DDCB 1WX7A 3DVGY 3KUCB 3ENEA 4GOCA 2JZ3B 3VVWB 4MH0E 4ZRIA 3B1LX 1WIAA 1X1MA 4BFRA 1XQQA 3PLUA 2Z0DB 1SGHA 3ZTCA 4MEMA 2NPTA 2JZZA 1ZKHA 1WXMA 1NBFC 1KOTA 4MGZE 1IYFA 2N9EB 2M1MA 5CTRC 3A33B 1XT9B 4GIVA 2L76A 1R4NI 3U7DA 3A4SC 2LXAA 3MTNB 3HM3A 2CHXA 2ZNVC 2MBOA 1E8XA 2D10A 2KMAA 5DPWA 2R2OA 4NAWA 3APDA 3ZNID 5LXIB 3S2AA 4BBNC 3ZRFA 1GC7A 1LM8B 2O6VD 3GOEA 4ICVA 4IG7B 3ONSA 4HJKA 1C3TA 2FIDA 2C60A 3PZDA 3VQIA 2NVUI 2K8BA 3L13A 4TUUA 1E8ZA 2IO0B 2J0MA 2AWTA 2JRIB 2K1FA 3HHMA 3L17A 2KXJA 4W9DA 1WF9A 4RM8A 3X23A 2L0TA 2K6DB 2JWZA 3QQ8B 4E3CA 2CHZA 4NPNA 2IO1B 1ISNA 3H7PB 1H4RA 1V9JA 2BGFA 2HD5B 3CSTA 2G4SA 4MM3A 2G3QB 3PT2B 5CHFA 3ZNGC 4GB9A 3ALBA 1RFAA 2NBVB 3DBLI 5D7GA 2AEHA 2HE7A 2J0KA 3H6NA 3OJ4B 2ZZPB 3DVNU 4FN2A 4XC2A 2MLBA 2J7QB 4HDQA 4JL9A 4WWNA 4K1RB 3RD2A 4LCDE 3OLMD 2WX0A 3KYDD 4AJWA 2BWFA 3N3KB 3A9JB 3O65B 1TZ1A 2FNJB 3VHTC 4MSQB 3PV1A 4F1SA 2NS5A 2ZNVB 4M8MA 3ZO5B 2CKHB 2PJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D94 A;  2I1J A;  2K8H A;  4NNJ B;  5HKH A;  4FJY A;  2MBQ A;  1E90 A;  1WGY A;  2FCN A;  3NZS A;  1WR6 E;  4CYE A;  3JSV B;  2LJ5 A;  4K7W A;  3DBS A;  1OQY A;  3WAO A;  3AU4 A;  2LI5 A;  1GJZ A;  4HVB A;  2FCS A;  1J0G A;  3H7P A;  1MG8 A;  2DHZ A;  3PRP B;  4JLC A;  5L83 A;  1RAX A;  2A4Z A;  4ANW A;  1WMH B;  2JY6 A;  4TQ1 A;  4HK2 A;  2LD9 A;  1J19 A;  1KM7 A;  1V5O A;  4MDK E;  5EDS A;  5JHA A;  1S3S G;  2A5U A;  4NY0 A;  1OEY A;  1BT0 A;  2ZVO A;  3A9J A;  4G11 A;  4URK A;  1YX5 B;  3TMP B;  3QAQ A;  3Q3J A;  3ZVV A;  4W9C A;  3X0W A;  4KZC A;  2FUH B;  3APF A;  3ECI A;  5JZE B;  2KC2 A;  3SU8 X;  4W9G A;  5J18 A;  4KSK C;  2GBM A;  3K9P B;  2IYD B;  3PHW B;  4AJY B;  4GMV A;  4FAD A;  2KTF A;  3JSV A;  4LDT D;  3WAN A;  2LGD A;  2FCM A;  3A4R A;  2D2Q A;  3AXC A;  4DHZ E;  4I6L B;  4ASW C;  4MEL A;  2REX A;  3HM6 X;  3KUD B;  2KN5 A;  1TGZ B;  2RR9 A;  3A9K B;  2MX2 A;  3SHQ A;  5TR5 A;  2MSE D;  4G0N B;  1OTR B;  2GOW A;  3WAP A;  1C1Y B;  2IY0 B;  2K25 A;  4W9E A;  3RUL A;  3UIN B;  4EKU A;  2JF5 A;  1UGM A;  4KIK A;  5DPR A;  2WX1 A;  3PPA A;  4ANV A;  4WWP A;  2RD0 A;  4GU2 A;  3L08 A;  2KJH B;  3QX1 A;  4E74 A;  2LUE A;  2MW5 A;  4BVU C;  1CMX B;  2K8C A;  4NJ6 A;  1IP9 A;  1YIW A;  2EKE C;  3U8Z A;  3KYC D;  4W9F A;  3PRM B;  1KLV A;  4RM9 A;  3R3M A;  1EF1 A;  3ML8 A;  3C0R B;  3H7S A;  4HWI B;  2NR2 A;  1S1Q B;  3R66 C;  1TBE A;  3SDL C;  3PLV A;  4BOS C;  3CMM B;  4GDK B;  1ZGU B;  3R7Q A;  2Y5B B;  1GG3 A;  3L54 A;  3P2B A;  4ICU A;  1KJT A;  3UIO B;  2KKC A;  2NBW B;  2KJ6 A;  4WJN A;  4ZYN A;  3TBL D;  2KZR A;  2LWP A;  3QA8 A;  5D6J B;  2JVC A;  4YL8 A;  3L16 A;  1WGD A;  4I6N B;  3WAM A;  1J8C A;  3RZF A;  4AP4 C;  1OEY J;  2LZ6 A;  3ZLZ A;  4X57 B;  1WXV A;  3QWZ B;  2M4N A;  3UF8 A;  1WZ3 A;  3T8M A;  4EZK A;  1G6J A;  1UBQ A;  5G55 A;  3VTV A;  3W1S C;  1L2N A;  1P0R A;  2GBN A;  2DYO A;  2KDB A;  1P98 A;  2BYV E;  4IM3 A;  4TV3 A;  4GDL B;  2IY1 B;  5KHO A;  3TL5 A;  4MJS A;  2G4D B;  2KQS A;  3OAW A;  2L05 A;  1M94 A;  4W9L A;  3VH3 B;  1HE8 A;  2ZJD A;  3ZNZ B;  4GDK A;  2DAF A;  2NCN A;  4KZ0 A;  1Z2M A;  2MBE A;  4OVV A;  3H9D A;  3K9O B;  3WA0 A;  2N7E A;  4BKT A;  3QC8 B;  4EZJ A;  3TIX A;  3GZN I;  2GBJ A;  3EHV A;  4IWO A;  3NHE B;  4IM2 A;  4CHK A;  4ANX A;  3RT3 B;  2DEN B;  2KDI A;  4DHZ B;  5KHQ A;  2I1K A;  4B95 A;  1OGW A;  3HK0 A;  1P1A A;  1WI0 A;  4A3O A;  2KX3 A;  2C9W B;  3CSF A;  4P7I A;  1Z5S B;  2VRR B;  1UZX B;  3DBH I;  3N30 A;  4I6P A;  1WYW B;  4TQ0 A;  3RZW C;  3VXW A;  2DZI A;  3L0W B;  4PYU A;  5D2M B;  4FHJ A;  4WJQ A;  4DHJ D;  2ZCC A;  2DZK A;  4F8C B;  4EEW A;  4GDL A;  4M0W B;  1WJ4 A;  2AYO B;  4M8N A;  1WR1 A;  2BWE S;  3BIN A;  2JRH A;  4FBJ B;  4MGY E;  2KK8 A;  2PE6 B;  3EFU A;  3U30 A;  2V1Y A;  2LAS A;  3PRZ A;  4BBN F;  1EO6 A;  2Z0E B;  3D32 A;  4K81 A;  1AAR A;  3VUX A;  4N9F 4;  2RSU A;  5J17 A;  1SIF A;  2N9X A;  1WM2 A;  1T0Y A;  1V81 A;  2LVP A;  3NZU A;  2KVR A;  3APC A;  3NS8 A;  3DVN V;  4AWJ A;  1NI2 A;  3AI5 A;  1VCB A;  4JQW C;  1E8Y A;  4XZ4 A;  3VTU A;  2N9P C;  4ZRK A;  4ZDV A;  4J6I A;  1U4A A;  1E7V A;  1Y8R C;  3PHX B;  4HPM B;  3DBR I;  3MHS D;  2CR5 A;  2GBK A;  1LFD A;  4JGH B;  4W9H A;  2MA9 B;  4PS7 A;  3B08 A;  3V61 A;  4W9I A;  1P3Q U;  2KLC A;  3M63 B;  5LLI A;  2LRU A;  1YJ1 A;  3RCZ A;  3QHT A;  1V5T A;  2N1W A;  3N32 A;  2IZV B;  3QCA A;  4PS3 A;  3W1S A;  3V60 A;  2IO2 B;  2W9N A;  3Q3F A;  2BYF A;  3M62 B;  1Q5W B;  5AEK B;  3H1U A;  2AL3 A;  1WGG A;  2KMC A;  2MWS B;  5E6N A;  5IAA C;  3VH4 B;  2KFJ A;  4K7S A;  4RMA A;  4E71 A;  2PEA A;  1WX8 A;  2OOB B;  5CHW A;  4MSM B;  1WMH A;  2YLM A;  3PRE A;  4KVG B;  4A20 A;  2O2V B;  3V6C B;  3ZIM A;  3EC8 A;  1XD3 B;  4FHK A;  1Q0W B;  1SE9 A;  3PVL A;  4HDO A;  3JYU A;  1UBI A;  3ZTD A;  1Q1O A;  2KWU B;  2M17 A;  4II2 B;  3ZDT A;  1IPG A;  1H8C A;  1V80 A;  3ML9 A;  4GXB A;  3VUW A;  3M95 A;  3ZRC A;  4BKG A;  3JW0 X;  4IWQ A;  1JRU A;  4FJV B;  3NY5 A;  3VAW A;  4EFO A;  2IBI B;  2LXC A;  3IG3 A;  1WZ0 A;  2KD0 A;  3L10 B;  1PQS A;  2KWV B;  1WE6 A;  4B6W A;  2KJR A;  2GMI C;  3M3J A;  4GSW A;  2KHW B;  2LVO A;  4DBG A;  5JHB A;  4HCP B;  2ASQ A;  2J0J A;  3A9K A;  2MP2 B;  3TCA A;  2UWQ A;  1I35 A;  1NDD A;  2D11 A;  2D3G A;  2O2V A;  2EMT A;  4IW0 A;  4CO7 A;  1LQB A;  5BO4 B;  2R2Q A;  2WWZ A;  4AOF A;  3ZDM C;  3LDZ E;  1RRB A;  4W9K A;  2MQJ A;  3TJP A;  2XK5 B;  1WJN A;  2JT4 B;  1E7U A;  2DYM A;  1YQB A;  2LGX A;  2V4L A;  2KFK B;  2L8J A;  4JIO U;  1WFY A;  5GMV A;  3JVZ X;  5E6P A;  4ZRJ A;  5G2N A;  3A1Q B;  3PTF C;  2CS4 A;  2LVQ A;  4HPL B;  4IC7 B;  2KDE B;  5CHV C;  4BKS A;  5L95 C;  4AUQ C;  2IO3 B;  1L7Y A;  3KW5 B;  1WY8 A;  2MP2 A;  3EEC A;  4OVU A;  3V62 A;  4BOZ B;  2N1V A;  4ANU A;  1EF5 A;  4PS8 A;  5DCN A;  2JUO A;  1GUA B;  3MJW A;  4LDT B;  2KNB A;  2MCN B;  2MRP A;  4DK5 A;  4GN1 A;  2YVC A;  3WAL A;  4B9K A;  2M8S A;  2N4F A;  4DXA B;  1R4M I;  2HTH A;  2XK5 A;  3PSE B;  2KLG A;  3UIP B;  2BPS A;  2C7N B;  3SD5 A;  2N7D A;  1GNU A;  2KFK A;  2KC1 A;  3RYT A;  1EUV B;  2DAJ A;  3ZUN A;  4II3 B;  2BF8 B;  4WJO A;  3V6E B;  3IFW B;  3QK0 A;  3ZKJ C;  3DCG A;  4IUM B;  1GC6 A;  1E8W A;  5AZF A;  3A1Q A;  4HXD A;  4KDL B;  1V86 A;  3PS6 A;  3HIZ A;  4NQL B;  4NJ7 A;  1D3Z A;  5JH5 C;  2L00 B;  2L3Z A;  2FIF A;  3QJZ A;  1A5R A;  3IHP C;  1WRD B;  2ZEQ A;  3DQV A;  3T9L A;  1WGR A;  1V6E A;  1WX9 A;  3DOW A;  2K39 A;  3DPD A;  4XX5 A;  5E6O A;  5LXH A;  2ZVN A;  3ZNH B;  4G50 A;  4KV2 A;  4BKS D;  2MBH A;  3IBE A;  5CX3 A;  4FLH A;  1UD7 A;  2DZJ A;  3VTW A;  3UGB B;  5AZH A;  4PYZ A;  2KWC A;  2M0X A;  2FAZ A;  1RLF A;  2NBU A;  3WIM A;  4EOY A;  1UEL A;  3UQA A;  4IM0 A;  2XBB C;  5C23 A;  2XEW A;  2C7M B;  2ZCB A;  3KVF B;  2G45 B;  3CF6 E;  1LXD A;  4EUT A;  1V49 A;  2CU1 A;  2KO3 A;  2K6Q A;  3RUI B;  1V2Y A;  3B0A A;  2C5L C;  5C1Z A;  1YX6 B;  5J2R A;  1FXT B;  2DZM A;  2FCQ A;  2AL6 A;  3NOB A;  3AUL A;  2KDF B;  2JXX A;  2BYE A;  1VD2 A;  2PE9 A;  2WDT B;  2KTR B;  4FUL A;  2LRW A;  1QZE A;  4KIK B;  2O6V B;  3QIJ A;  1WXA A;  1ZW7 A;  2KX0 A;  1TTN A;  4HLE A;  4DDI D;  3OJ3 A;  2UYZ B;  1WJ6 A;  2L0F A;  1F9J A;  3KUZ A;  1WGH A;  4NQK E;  1WXS A;  1WH3 A;  5DPT A;  1I42 A;  2QHO A;  4KSL C;  4A3P A;  4DWF A;  1K8R B;  2PPH A;  4EZL A;  5DPS A;  3AU5 A;  1E5W A;  2RPQ A;  2L7R A;  2V3S A;  2KOX A;  4W9J A;  3QAR A;  2GBR A;  2HJ8 A;  2BKF A;  4MGI E;  3LJ3 A;  3R7R A;  3VDZ A;  4LJO B;  5IA7 A;  4WJP A;  3VFK A;  1WM3 A;  2KAN A;  3KH0 A;  3ZW3 A;  2Z59 B;  4WWO A;  3BY4 B;  4MGK E;  5AZG A;  3IVF A;  1YD8 U;  4GGQ A;  4K7U A;  2ZPN A;  4WAA A;  2KTR A;  5FR6 A;  4DHJ B;  4DDG D;  3UQB A;  2C7H A;  2O6V A;  2NPT B;  3W1Y A;  4F7Z A;  4TKN A;  1P9D U;  2EMS A;  2KQ7 A;  4LJP B;  4WQO B;  2JPH A;  2DX5 B;  2RGF A;  4HCN B;  2BKR B;  2WYQ A;  4FJZ A;  3PGE A;  2B3A A;  3DVG X;  2CHW A;  4NAW B;  2ZPY A;  4G3X B;  4IWP A;  1WE7 A;  1UH6 A;  3VUY A;  2DYB A;  1WJU A;  4FA6 A;  2MBB B;  2LGY A;  3I3T B;  4MJS B;  2D07 B;  4KDI C;  2OJR A;  3DDC B;  1WX7 A;  3DVG Y;  3KUC B;  3ENE A;  4GOC A;  2JZ3 B;  3VVW B;  4MH0 E;  4ZRI A;  3B1L X;  1WIA A;  1X1M A;  4BFR A;  1XQQ A;  3PLU A;  2Z0D B;  1SGH A;  3ZTC A;  4MEM A;  2NPT A;  2JZZ A;  1ZKH A;  1WXM A;  1NBF C;  1KOT A;  4MGZ E;  1IYF A;  2N9E B;  2M1M A;  5CTR C;  3A33 B;  1XT9 B;  4GIV A;  2L76 A;  1R4N I;  3U7D A;  3A4S C;  2LXA A;  3MTN B;  3HM3 A;  2CHX A;  2ZNV C;  2MBO A;  1E8X A;  2D10 A;  2KMA A;  5DPW A;  2R2O A;  4NAW A;  3APD A;  3ZNI D;  5LXI B;  3S2A A;  4BBN C;  3ZRF A;  1GC7 A;  1LM8 B;  2O6V D;  3GOE A;  4ICV A;  4IG7 B;  3ONS A;  4HJK A;  1C3T A;  2FID A;  2C60 A;  3PZD A;  3VQI A;  2NVU I;  2K8B A;  3L13 A;  4TUU A;  1E8Z A;  2IO0 B;  2J0M A;  2AWT A;  2JRI B;  2K1F A;  3HHM A;  3L17 A;  2KXJ A;  4W9D A;  1WF9 A;  4RM8 A;  3X23 A;  2L0T A;  2K6D B;  2JWZ A;  3QQ8 B;  4E3C A;  2CHZ A;  4NPN A;  2IO1 B;  1ISN A;  3H7P B;  1H4R A;  1V9J A;  2BGF A;  2HD5 B;  3CST A;  2G4S A;  4MM3 A;  2G3Q B;  3PT2 B;  5CHF A;  3ZNG C;  4GB9 A;  3ALB A;  1RFA A;  2NBV B;  3DBL I;  5D7G A;  2AEH A;  2HE7 A;  2J0K A;  3H6N A;  3OJ4 B;  2ZZP B;  3DVN U;  4FN2 A;  4XC2 A;  2MLB A;  2J7Q B;  4HDQ A;  4JL9 A;  4WWN A;  4K1R B;  3RD2 A;  4LCD E;  3OLM D;  2WX0 A;  3KYD D;  4AJW A;  2BWF A;  3N3K B;  3A9J B;  3O65 B;  1TZ1 A;  2FNJ B;  3VHT C;  4MSQ B;  3PV1 A;  4F1S A;  2NS5 A;  2ZNV B;  4M8M A;  3ZO5 B;  2CKH B;  2PJH A; 
#chains in the Genus database with same CATH topology
 1XLO A;  4NNJ B;  4FJY A;  1VZ8 A;  3VRA B;  4CYE A;  1KLG D;  3DBS A;  5E6J A;  3WAO A;  2LI5 A;  2Y5C A;  4JLC A;  2DHZ A;  5L83 A;  1RAX A;  1D5X C;  1ET6 A;  1IUE A;  2LHD A;  3KWV A;  1WMH B;  1K51 A;  2CU3 A;  2ON8 A;  2N0S B;  2A5U A;  4NY0 A;  4URK A;  1YX5 B;  3Q3J A;  4KZC A;  3R8B A;  3MP9 A;  2GBM A;  2IYD B;  4AJY B;  4FAD A;  4GMV A;  2KTF A;  3JSV A;  3WAN A;  1ZOY B;  4I6L B;  4ASW C;  2AX5 A;  1N6Z A;  2J52 A;  4EKU A;  2JF5 A;  4KIK A;  3AV8 A;  2RD0 A;  4GU2 A;  3L08 A;  1XXG A;  4C4V B;  4BVU C;  1CMX B;  1PDX A;  1P7F A;  1IP9 A;  2EKE C;  3U8Z A;  4RH6 A;  4W9F A;  4RM9 A;  3ML8 A;  3TEZ A;  4HWI B;  2NR2 A;  1S1Q B;  3DWM A;  3SDL C;  2YEP F;  3PLV A;  4BOS C;  3BYT B;  1WXQ A;  3Q8F A;  1TJE A;  3P2B A;  4ICU A;  1C4C A;  4WAF A;  2M19 A;  1JWB D;  2KZR A;  1BUI C;  4A90 A;  1VZ7 A;  2BS4 B;  1OEY J;  1UWX A;  1VDV A;  3NVV A;  2LHE A;  3R2I A;  3UF8 A;  1MFW A;  1WZ3 A;  3AE1 B;  3T8M A;  1L2N A;  2GBN A;  2QEJ C;  1C4P A;  1J7B A;  5GXG B;  3TL5 A;  3R2T A;  1FNW A;  1M94 A;  2L05 A;  3BYY B;  2ZJD A;  3ZNZ B;  2DAF A;  4OVV A;  3WA0 A;  4EZJ A;  4IWO A;  3MHZ A;  4IM2 A;  4ANX A;  2DEN B;  2I1K A;  4EE2 A;  5FKA C;  2KX3 A;  3HVD A;  2C9W B;  3DBH I;  3RZW C;  2WXG A;  3L0W B;  4WJQ A;  3RI7 C;  1L6V A;  2IGG A;  4GDL A;  1PGX A;  1WR1 A;  2JRH A;  2KK8 A;  2LGS A;  2V1Y A;  2LAS A;  1CZP A;  4BBN F;  2BB6 A;  1AWD A;  2W54 A;  2D5G A;  2QCZ A;  1C76 A;  5J17 A;  1V81 A;  3C8Y A;  3NS8 A;  1ZDV A;  3DVN V;  1PGB A;  1VCB A;  2DNF A;  1E8Y A;  1JCK B;  3N9Y C;  2N9P C;  4ZDV A;  2N7J A;  3T3N A;  3AM9 A;  1GB1 A;  3H8H A;  3B2F A;  1QOG A;  2CR5 A;  1LFD A;  4W9H A;  4OZA A;  3V61 A;  4W9I A;  2INC C;  4N58 A;  3RCZ A;  2N1W A;  2IZV B;  3W1S A;  1NI3 A;  2WXJ A;  5TSS A;  2M56 B;  2IO2 B;  1JML A;  1VJK A;  2PLP A;  4K7S A;  1WX8 A;  1PYW D;  3PRE A;  2L52 A;  3AE6 B;  2O2V B;  3V6C B;  2JYT A;  1YJJ A;  4FHK A;  1XD3 B;  4KX6 B;  1SE9 A;  4LNK A;  4YSX B;  1HQR D;  3JYU A;  4MH8 A;  2H88 B;  1H8C A;  1E9M A;  2MJ3 A;  3L4P A;  3DWG C;  3AN1 A;  1T0Q C;  4K3B A;  5IN7 A;  2IBI B;  2LXC A;  1R4N B;  2KD0 A;  1PQS A;  4HPP A;  2JQR B;  4DQO C;  2ZW1 A;  2LVO A;  4DBG A;  1B9R A;  2BYT A;  1NDD A;  4DXG A;  5LNK 1;  2FUG 1;  2PTL A;  5BO4 B;  2R2Q A;  3AEA B;  2XK5 B;  2L83 A;  1LGR A;  1TIF A;  2DYM A;  3ETR A;  2V4L A;  1WFY A;  5E6P A;  4ZRJ A;  2LVQ A;  4HPL B;  5L95 C;  2MP2 A;  2BT6 A;  4PS8 A;  4XGA B;  3RNB C;  1CK1 A;  2AQ1 B;  1FXI A;  4DXA B;  1FFV A;  3PSE B;  1JWS D;  2KLG A;  3MC9 A;  1IGD A;  3FIL B;  1GNU A;  2KC1 A;  3RYT A;  2DAJ A;  4IOI E;  2BF8 B;  4WJO A;  3V6E B;  2WU5 B;  1FPY A;  3KQ4 A;  2I38 A;  3RNA C;  1D3Z A;  5AUK A;  3AE8 B;  2K0P A;  2J4X A;  2L00 B;  2FIF A;  3T9L A;  2H89 B;  3DOW A;  1ET9 A;  1V6E A;  2ZVN A;  4G50 A;  1L4D B;  2K9X A;  1XCT L;  2MBH A;  5CX3 A;  4FLH A;  2DZJ A;  3Q8C A;  3UGB B;  4PYZ A;  4S17 A;  2M0X A;  4RNA A;  1UEL A;  3DHG C;  4LNF A;  5C23 A;  2E3T A;  3AEE B;  4M0W A;  1V2Y A;  5BMI A;  1F2R I;  1YX6 B;  2JXX A;  2PE9 A;  1K52 A;  2BB5 A;  4KIK B;  1SEB D;  1WXA A;  2HTM E;  2UYZ B;  2JX5 A;  1PUT A;  3RNE C;  1XLQ A;  1WXS A;  1ZE3 D;  5DPT A;  1I42 A;  2G1E A;  4A3P A;  1OQQ A;  4DWF A;  1MVK A;  4LTU A;  2NTS A;  2L7R A;  2KOX A;  4W9J A;  2HJ8 A;  2BKF A;  5H8Y E;  1QF6 A;  4P1B C;  5IA7 A;  4WJP A;  1WM3 A;  2KAN A;  3LXF A;  3ZW3 A;  2Z59 B;  4WWO A;  4A8X C;  4GGQ A;  2O6V A;  1SB3 C;  4TKN A;  1P9D U;  1QIL A;  2KQ7 A;  2K22 A;  4FJZ A;  3V3X A;  3BVG A;  2MJD A;  4IWP A;  3VUY A;  1SF0 A;  1WJU A;  3GZN B;  2MBB B;  2D07 B;  5I4D A;  2AQ2 B;  2OJR A;  1WX7 A;  1KFY B;  1FFU A;  3B1L X;  2SEB D;  3AED B;  1X1M A;  1XQQ A;  2OED A;  2VH2 A;  1SGH A;  2JZZ A;  1ZKH A;  1NBF C;  4H2A A;  4MGZ E;  2N9E B;  4KGR A;  1XT9 B;  5HG2 A;  1R4N I;  2OHF A;  2Z8L A;  2BTE A;  1FCL A;  2CHX A;  1E8X A;  2GI9 A;  3SFE B;  2R2O A;  4BBN C;  1GPX A;  4IG7 B;  4JE3 B;  3ZXV A;  1HEZ E;  4PT5 A;  1E8Z A;  1WF9 A;  4OHJ A;  4RM8 A;  3BK1 A;  5BMG A;  3X23 A;  2K6D B;  2JWZ A;  2QJL A;  2IO1 B;  1ISN A;  3DBR B;  2BGF A;  2HD5 B;  2DLB A;  2VH1 A;  1EU3 A;  2DBY A;  1RFA A;  3IT6 B;  3SEB A;  4FN2 A;  2MLB A;  4JL9 A;  3RD2 A;  3A9J B;  3O65 B;  2LUM A;  2FNJ B;  3VHT C;  2NS5 A;  1SJH D;  2CKH B;  5D94 A;  2K8H A;  2WXM A;  4RF0 A;  2MBQ A;  1WGY A;  2FCN A;  1WR6 E;  2LGI A;  2LJ5 A;  1C4A A;  1OQY A;  3AU4 A;  1ENF A;  2FCS A;  1J0G A;  3PRP B;  4LNN A;  1SE3 A;  2JY6 A;  5BYQ A;  1SJE D;  2K5P A;  1Y56 A;  1V5O A;  1KM7 A;  4O1N A;  1WWT A;  5JHA A;  1S3S G;  2PMV A;  1OEY A;  3TMP B;  3QAQ A;  2NTT A;  3ECI A;  3SU8 X;  1JRO A;  4KSK C;  3K9P B;  2KN4 A;  4KKJ A;  4RFB A;  1ZPS A;  3TUO A;  2WXO A;  1LO5 D;  1CJE A;  1OFF A;  2GOW A;  3WAP A;  1C1Y B;  4W9E A;  3RUL A;  2IND C;  2WX1 A;  1N62 A;  4WH4 A;  1TY0 A;  2KJH B;  3QX1 A;  4NJ6 A;  1YIW A;  1UUP A;  1FM0 D;  2BS2 B;  1EF1 A;  4MAC A;  1ESF A;  1TS5 A;  2I2Y A;  1ZGU B;  3R7Q A;  2Y5B B;  3L54 A;  3TBL D;  2JXT A;  4M00 A;  4RGT A;  5D6J B;  3Q3N C;  2KWD A;  1F2R C;  1EU4 A;  3W2D A;  4AP4 C;  2LZ6 A;  3QWZ B;  2M4N A;  4JPS A;  1G6J A;  4EZK A;  4WUR A;  2KDB A;  1ROE A;  4A55 A;  4MJS A;  2G4D B;  4W9L A;  4GDK A;  1Z2M A;  2V9H A;  3H9D A;  3K9O B;  3QC8 B;  2WGS A;  3TIX A;  1BXT A;  3GZN I;  1HTO A;  4NJC A;  1OGW A;  1WI0 A;  1Z5S B;  3N30 A;  1HZ6 A;  3TEX A;  2IPK D;  2W55 A;  1T0R C;  2ZCC A;  4EEW A;  4M0W B;  4M8N A;  4NAM A;  1HA5 A;  1SBB B;  3BIN A;  4FBJ B;  1SSN A;  3EFU A;  1DOX A;  3PRZ A;  2Z0E B;  2AQ3 B;  1AAR A;  1JW9 D;  3URY A;  3VUX A;  3LYY A;  1SIF A;  3AE4 B;  3NZU A;  2KVR A;  2B76 B;  1E7V A;  3DBR I;  2GBK A;  2MA9 B;  3FAH A;  5LLI A;  2LRU A;  1YJ1 A;  1V5T A;  3N32 A;  3V60 A;  4P1C C;  2QDF A;  4YSY B;  2V0G A;  1Q5W B;  5AEK B;  1C78 A;  2AL3 A;  2KMC A;  5E6N A;  3WCQ A;  4JWU C;  2WQY B;  2RDB C;  2YLM A;  1YN3 A;  3ZTD A;  2M17 A;  3ZDT A;  4II2 B;  1L5P A;  1IPG A;  1ZXH A;  3VUW A;  3ML9 A;  4GXB A;  3P4P B;  2INP E;  1T5X D;  1FNU A;  2PW9 A;  1XCQ L;  3JW0 X;  2LMC A;  2L32 A;  4IWQ A;  1E10 A;  4EFO A;  3Q69 A;  3IG3 A;  1WZ0 A;  2WHI A;  3L10 B;  3AEB B;  3NS1 A;  2GMI C;  4GSW A;  5G5H A;  3A9K A;  3BII D;  2XN9 C;  4L23 A;  1FO4 A;  2D11 A;  1YMH E;  3IAM 1;  3IT4 B;  4CO7 A;  4YSZ B;  3CIR B;  2JT4 B;  4HKQ A;  1YQ3 B;  2BQQ A;  4AQ7 A;  1FD6 A;  3EGR A;  1UF0 A;  2LGX A;  2KFK B;  4GLS C;  3AE2 B;  3JVZ X;  2MHJ A;  2KDE B;  1CQV A;  2IGD A;  2WP9 B;  1V1P A;  4BOZ B;  1P7E A;  2JUO A;  1GUA B;  3MJW A;  4LDT B;  2KNB A;  1TKG A;  4A6Q A;  2PKO A;  2WXK A;  2M8S A;  2HTH A;  4TMA B;  3I5J C;  2ACZ B;  3UI3 A;  1YOV B;  4R3D A;  1KF6 B;  3QK0 A;  3DCG A;  4LLG M;  5AZF A;  1N61 A;  3A1Q A;  4HXD A;  4ZRP A;  4MT5 A;  4RF1 A;  2L3Z A;  3QJZ A;  3IHP C;  1WRD B;  3DQV A;  2BS3 B;  1WGR A;  1WX9 A;  1TKY A;  4XX5 A;  5E6O A;  3ZNH B;  3ZQ4 A;  3NRZ A;  3Q3M C;  4BKS D;  3IBE A;  2G9H D;  3KWL A;  1UD7 A;  4WWM A;  4C00 A;  2FAZ A;  1RLF A;  2NBU A;  3WIM A;  4JX1 C;  1JWM D;  2ZCB A;  1DOI A;  5IOI A;  2AL6 A;  5FR3 A;  1L6U A;  3AUL A;  2KDF B;  2KTR B;  1WRI A;  2WLB A;  1QZE A;  3QIJ A;  1ZW7 A;  2VZK B;  2DWQ A;  3OJ3 A;  1WJ6 A;  2L0F A;  1F9J A;  1FMA D;  3KUZ A;  1D5Z C;  4KSL C;  1N63 A;  4ITK A;  4XE0 A;  1K8R B;  4ACF A;  1E5W A;  2RPQ A;  1MHX A;  4L1B A;  3QAR A;  2GBR A;  4MGI E;  3LJ3 A;  1D5M C;  3P42 A;  3BY4 B;  5AZG A;  2KYW A;  4WAA A;  4DHJ B;  1F1H A;  2LJI A;  4DDG D;  3UQB A;  1Q10 A;  2NPT B;  3IAS 1;  1FRR A;  2DX5 B;  4N59 A;  4HCN B;  3PGE A;  2B3A A;  1MI0 A;  2QSD A;  2CHW A;  2Y5P A;  2ZPY A;  4G3X B;  1D6E C;  4FA6 A;  4D2K A;  4MJS B;  4KDI C;  3DDC B;  4GOC A;  1DGJ A;  1UGJ A;  4HKZ E;  3N1Z C;  2M0A A;  2HJ1 A;  2Z0D B;  4LK0 M;  3MC8 A;  4MEM A;  4MM3 B;  2EEL A;  1XO3 A;  1QT9 A;  5CTR C;  3A33 B;  3MTN B;  4Q2J A;  2KMA A;  4NAW A;  4P16 A;  2FID A;  3PZD A;  3L17 A;  3QQ8 B;  2CHZ A;  1H4R A;  1TZO A;  2IJ0 A;  3ZNG C;  4GB9 A;  3ALB A;  2HE7 A;  3DVN U;  4XC2 A;  1IBX A;  4K1R B;  2WXN A;  3N3K B;  1TZ1 A;  3NVZ A;  4KGT A;  4M8M A;  3ZO5 B;  5EDS A;  2PJH A;  3VR9 B;  2I1J A;  3NZS A;  4US9 A;  3JSV B;  3I63 C;  4K7W A;  1GJZ A;  1M4V A;  1MG8 A;  3H7P A;  2SAK A;  3GE3 C;  3I57 A;  3Q2A C;  4TQ1 A;  1J19 A;  3AE7 B;  5HI1 A;  1HTQ A;  1WSP A;  3ZVV A;  4W9C A;  2FUH B;  3APF A;  3HVZ A;  2KC2 A;  4ZOH C;  3PHW B;  1SXT A;  4XDC A;  2LGD A;  3A4R A;  3AXC A;  2X38 A;  4MEL A;  2PIA A;  1GB4 A;  1TGZ B;  3A9K B;  3B9J A;  2JWU A;  2MX2 A;  3OG5 A;  3SHQ A;  4DXF A;  4REZ A;  3HRD D;  4G0N B;  3AEF B;  2K25 A;  3UIN B;  1UGM A;  4OW0 A;  5DPR A;  4WWP A;  2MW5 A;  3KYC D;  3PRM B;  2NMQ A;  3P4S B;  3C0R B;  3H7S A;  3R66 C;  3ZXR A;  1TBE A;  1R7S A;  3CMM B;  5IO9 A;  2QIL A;  1R4M B;  1GG3 A;  1KJT A;  2NBW B;  3Q3O C;  2KJ6 A;  3ZJT A;  3L16 A;  4I6N B;  1C79 A;  3WAM A;  5AUI A;  2ONQ A;  3ZLZ A;  1AN8 A;  3B2G A;  1KLU D;  5G55 A;  1P0R A;  3AE5 B;  2BYV E;  4IM3 A;  4TV3 A;  4GDL B;  5KHO A;  4YT0 B;  3IXS A;  1RM6 C;  1SE2 A;  1I7H A;  2NCN A;  4KZ0 A;  1K53 A;  2MBE A;  3U2S C;  3GP7 A;  3U4E G;  2N7E A;  4BKT A;  2GBJ A;  1YN5 A;  5KHQ A;  4RGN A;  3HK0 A;  1F52 A;  4A3O A;  3NJT A;  3CSF A;  4P7I A;  1ZP0 B;  2VRR B;  5IKC M;  5BYR A;  1WYW B;  3VXW A;  1MHH E;  4RGM A;  5HHD G;  4F8C B;  1YN4 A;  2AYO B;  2RDH A;  1SIJ A;  2BWE S;  1V8C A;  2JSV X;  3AE9 B;  2PE6 B;  3U30 A;  3MJ5 A;  1EO6 A;  2EKI A;  2RSU A;  2V3P A;  1T0Y A;  1FCC C;  1FEH A;  1NI2 A;  4JQW C;  1TS2 A;  4UDU C;  4J6I A;  1U4A A;  1TT5 B;  3MFG A;  1Y8R C;  5EE9 A;  4HPM B;  1GAQ B;  2J53 A;  3MHS D;  3B08 A;  1P3Q U;  2KLC A;  3QCA A;  1NYQ A;  1RYJ A;  2W9N A;  3Q3F A;  2BYF A;  3M62 B;  3H1U A;  1WGG A;  2MWS B;  5IAA C;  3ZYY X;  2KFJ A;  2WXH A;  4E71 A;  5BMH A;  2PEA A;  4C7Y A;  2OOB B;  5CHW A;  3AMZ A;  3ZIM A;  3EC8 A;  3EA6 A;  3PVL A;  1MJD A;  4HDO A;  3V05 A;  2D3C A;  2RMM A;  1UBI A;  2KWU B;  2ZW0 A;  3M95 A;  3J9C A;  4PK1 A;  3ZRC A;  4BKG A;  3NUH B;  2BBC A;  1JRU A;  3VAW A;  3NY5 A;  1J7A A;  1I4X A;  1L0V B;  2KHW B;  2Y3A A;  2J0J A;  2RDG A;  2IDY A;  1JWU D;  2MP2 B;  3Q8A A;  3TCA A;  1I35 A;  2O2V A;  5FK9 C;  2EMT A;  2INN E;  4IW0 A;  1LQB A;  4M02 A;  4A9A A;  2WWZ A;  4W9K A;  2MQJ A;  3TJP A;  1PGA A;  1YQB A;  2L8J A;  2IGH A;  3TEY A;  5G2N A;  4IC7 B;  3PTF C;  2CS4 A;  3VR8 B;  5CHV C;  4AUQ C;  3RMK C;  1N5X A;  2IO3 B;  4NZL B;  3Q14 C;  1WY8 A;  4IDI A;  1TS4 A;  3EEC A;  4OVU A;  1HZ5 A;  2N1V A;  4ANU A;  1EF5 A;  5DCN A;  2MCN B;  4GN1 A;  2YVC A;  3WAL A;  4RGO S;  1R4M I;  2XK5 A;  5C3J B;  1PFD A;  1SE4 A;  2MJE A;  3UIP B;  2BPS A;  2WXP A;  3BVZ A;  1QOF A;  2C7N B;  2N7D A;  1EUV B;  3ZUN A;  3FC4 A;  3IFW B;  1GC6 A;  1E8W A;  4FXC A;  4KDL B;  1V86 A;  3HIZ A;  1NEN B;  5JH5 C;  4ZHO A;  2WDV B;  2K39 A;  5LXH A;  2V4I B;  4XWW A;  2QMT A;  3O13 A;  4KV2 A;  4HRS A;  3VTW A;  5AZH A;  4L2Y A;  1JRP A;  1L0Y B;  4B0M A;  3FIL A;  3UQA A;  1FRD A;  2C7M B;  1I4R A;  3RPF C;  3KVF B;  3RNC C;  4EUT A;  1E0Z A;  2GRI A;  2K6Q A;  3B0A A;  5C1Z A;  2E6X A;  5J2R A;  2KMM A;  1FXT B;  4P6V F;  1QQR A;  3CWI A;  4ARC A;  3HUI A;  3ZJV A;  1UNS A;  4FUL A;  2LRW A;  1I4Q A;  2O6V B;  2KX0 A;  3NVY A;  4HLE A;  4DDI D;  4US8 A;  2KDM A;  1TY2 A;  4NQK E;  1WGH A;  1GOZ A;  5DPS A;  3AU5 A;  5G5G A;  4C7Z A;  3AB5 A;  2V3S A;  5BYS A;  4AS1 A;  3VDZ A;  4LJO B;  3VFK A;  3BK2 A;  2LFI A;  4MGK E;  3IVF A;  1YD8 U;  2MH7 A;  4K7U A;  2ZPN A;  5FR6 A;  2C7H A;  4F7Z A;  1T6B X;  4LJP B;  4WQO B;  1EWC A;  2N9L A;  2BKR B;  3N1X C;  4LNI A;  1UH6 A;  2LGY A;  3I3T B;  4ZHP A;  4ARI A;  3DVG Y;  3KUC B;  3ENE A;  5C2T B;  2JZ3 B;  3RN9 C;  3SFD B;  3VVW B;  4ZRI A;  1YQ4 B;  4K3C A;  4BFR A;  3PLU A;  3ZTC A;  3RFZ B;  1IYF A;  4HRO A;  4GIV A;  1N5W A;  5D3D A;  3HM3 A;  4XWT A;  2D10 A;  2HDE A;  4RCO A;  5DPW A;  2WXR A;  1ZUD 2;  3APD A;  3VRB B;  3ZNI D;  5LXI B;  3S2A A;  5HFY A;  1GC7 A;  1LM8 B;  2O6V D;  3GB1 A;  4ICV A;  4HJK A;  2C60 A;  1F0Z A;  2NVU I;  2K8B A;  5EE1 A;  3L13 A;  4TUU A;  2J0M A;  4XDD A;  1L4Z B;  4NPN A;  1V9J A;  3SR6 A;  3CST A;  2G4S A;  2NBV B;  5D7G A;  2AEH A;  2J0K A;  3H6N A;  1IGC A;  2PVO D;  1DOY A;  2J7Q B;  4HDQ A;  4LCD E;  2WX0 A;  3KYD D;  4TSS A;  2BWF A;  4AJW A;  1T0S C;  4F1S A;  3P63 A;  2ZNV B;  1UWM A;  3LB8 C;  1C9F A;  4USA A;  5HKH A;  2KAC A;  4OZB A;  1E90 A;  1XF5 L;  2D3B A;  4HVB A;  3U7Z A;  2A4Z A;  4ANW A;  1VZ6 A;  3OWE B;  1ZXI A;  4HK2 A;  2LD9 A;  2WNM A;  4MDK E;  4C56 C;  3W5U B;  1BT0 A;  2ZVO A;  3A9J A;  4G11 A;  5MPO A;  5EE3 A;  3X0W A;  4S0R A;  1ZDX A;  5JZE B;  1DYQ A;  1FNV A;  4W9G A;  5J18 A;  4LDT D;  4DHZ E;  2FCM A;  2D2Q A;  4B0E A;  2REX A;  3HM6 X;  3KUD B;  1KH0 A;  2KN5 A;  4IKG A;  2RR9 A;  4HEA 1;  1VLB A;  5TR5 A;  2GLS A;  2MSE D;  1E6E B;  1OTR B;  2IY0 B;  4LNO A;  4ANV A;  3Q6B A;  2FE8 A;  3PPA A;  1F77 A;  4BAX A;  4E74 A;  2LUE A;  5H92 C;  3TEW A;  3W5V B;  2K8C A;  4OVZ A;  1K50 A;  1KLV A;  3R3M A;  2TSS A;  3RNF C;  5D3I B;  2BW2 A;  4GDK B;  3EUB 2;  2JU6 X;  1VR9 A;  1L0X B;  3UIO B;  2KKC A;  2J42 A;  4WJN A;  4ZYN A;  2LWP A;  3QA8 A;  2JVC A;  5T8I A;  4YL8 A;  1WGD A;  1J8C A;  3RZF A;  4X57 B;  1WXV A;  3AE3 B;  1T3Q A;  4YWG G;  1UBQ A;  3VTV A;  3W1S C;  2DYO A;  1P98 A;  3AEC B;  4N6E B;  2IY1 B;  2VZK D;  2KQS A;  3OAW A;  3VH3 B;  2V3N A;  1HE8 A;  4BZA A;  2CJN A;  3NZ3 A;  1I4P A;  2D3A A;  3EHV A;  1NYR A;  3NHE B;  1YJI A;  4CHK A;  3RT3 B;  1J7C A;  2KDI A;  4DHZ B;  4B95 A;  1P1A A;  3N1Y C;  1UZX B;  4I6P A;  3U52 E;  4TQ0 A;  2DZI A;  1QOA A;  3BWU D;  1D4B A;  4PYU A;  5D2M B;  4FHJ A;  4DHJ D;  1STE A;  2DZK A;  1QOB A;  1WJ4 A;  4MGY E;  3ABV B;  3NG0 A;  2JZP A;  3D32 A;  4K81 A;  4N9F 4;  2N9X A;  1WM2 A;  2LVP A;  3APC A;  4AWJ A;  3AI5 A;  4XZ4 A;  2WU2 B;  2JYE A;  3VTU A;  4ZRK A;  1TKE A;  1N60 A;  3PHX B;  4JGH B;  4PS7 A;  1TYG B;  2FBW B;  3N20 C;  5EE0 A;  3M63 B;  4YTN B;  2WS3 B;  3QHT A;  4PS3 A;  3PZ8 A;  2W3S A;  2W82 A;  3VH4 B;  3E9S A;  4RMA A;  2LEK A;  2WXI A;  2KVZ A;  4MSM B;  1WMH A;  1V97 A;  4KVG B;  4A20 A;  4ZRQ A;  1Q0W B;  1Q1O A;  1V80 A;  2KQ4 X;  4WQM A;  4ZYS A;  1FXA A;  4FJV B;  1MPE A;  2KWV B;  1WE6 A;  4B6W A;  2KJR A;  3M3J A;  5JHB A;  4HCP B;  2ASQ A;  2QIE B;  1V1P B;  2UWQ A;  4JWS C;  3BZD B;  2D3G A;  4AOF A;  3ZDM C;  2KAJ A;  1RRB A;  3LDZ E;  2MEK A;  1I4G A;  1WJN A;  4C4V A;  4YXD B;  1E7U A;  2RPV A;  1B1Z A;  4JIO U;  3DBL B;  4WIP A;  5GMV A;  3BVM A;  3A1Q B;  3GE8 C;  3P1M A;  4BKS A;  1BML C;  1L7Y A;  3KW5 B;  3V62 A;  1QLB B;  3KLS X;  3Q8E A;  1EM7 A;  2MRP A;  3ZJU A;  4YTP B;  4DK5 A;  2UU7 A;  4B9K A;  2N4F A;  3RNG C;  1YNT E;  2N9K A;  3SD5 A;  1RFK A;  2K3U A;  2KFK A;  3AH7 A;  4II3 B;  5JXV A;  3ZKJ C;  2L1A A;  4IUM B;  3PS6 A;  4NQL B;  3NVW A;  4NJ7 A;  1A5R A;  1RWS A;  2ZEQ A;  1KTK A;  3DPD A;  2PVG C;  1MG4 A;  2CJO A;  3TSS A;  4XYC A;  4YTM B;  4CQN A;  4QAY A;  1NEK B;  2KWC A;  4EOY A;  2WXQ A;  4M01 A;  4KGS A;  4IM0 A;  2XBB C;  2XEW A;  1JAL A;  2WXF A;  2G45 B;  3CF6 E;  1LXD A;  3MC0 B;  1V49 A;  2CU1 A;  1AW7 A;  2KO3 A;  3RUI B;  2C5L C;  1QKZ A;  1WYG A;  2GB1 A;  2DZM A;  2FCQ A;  3NOB A;  2BYE A;  1VD2 A;  2WDT B;  3E56 A;  2BVC A;  3P4Q B;  1TTN A;  1KRH A;  1AYF A;  1WH3 A;  2WXL A;  2QHO A;  2PPH A;  2W3R A;  4EZL A;  1V1O A;  5IP4 D;  1A70 A;  4HJG E;  3W9C B;  3R7R A;  3C19 A;  1E7P B;  3KH0 A;  4KKI A;  1TS3 A;  2KTR A;  1WGK A;  1XEE A;  3W1Y A;  4C80 A;  3I9V 1;  2EMS A;  2JPH A;  1C77 A;  2RGF A;  2WYQ A;  1OQR A;  2WDQ B;  3DVG X;  3EFC A;  4NAW B;  2WDR B;  4J3O D;  1WE7 A;  2DYB A;  2YEP B;  2R61 A;  3P4R B;  2ICI A;  3FKY A;  3DHI C;  1ACC A;  4MH0 E;  3DBH B;  1WIA A;  3T3O A;  1JWA D;  2NPT A;  1WXM A;  1KOT A;  2M1M A;  3U7D A;  2L76 A;  3A4S C;  2KT7 A;  1XLN A;  2LXA A;  1VRA B;  3ZGZ A;  2ZNV C;  3PZ7 A;  2MBO A;  1IBX B;  2XNA C;  3PO0 A;  3AEG B;  3ZRF A;  3GOE A;  2Q5W D;  3ONS A;  1C3T A;  1I4H A;  3VQI A;  2JRI B;  2IO0 B;  2K1F A;  2AWT A;  4W9D A;  3HHM A;  3GS2 A;  2KXJ A;  2OJW A;  2L0T A;  4E3C A;  2X8X X;  3H7P B;  1JQ4 A;  4MM3 A;  1NVI D;  2G3Q B;  3PT2 B;  5CHF A;  1FIQ A;  3Q8B A;  3DBL I;  2QC8 A;  2ZZP B;  3OJ4 B;  4WWN A;  3OLM D;  3DHH C;  1HXY D;  4MSQ B;  3PV1 A;  1EWY C;  1XLP A;  4OZC A; 
#chains in the Genus database with same CATH homology
 5D94 A;  2I1J A;  2K8H A;  4NNJ B;  5HKH A;  4FJY A;  2MBQ A;  1E90 A;  1WGY A;  2FCN A;  3NZS A;  1WR6 E;  4CYE A;  3JSV B;  2LJ5 A;  4K7W A;  3DBS A;  1OQY A;  3WAO A;  3AU4 A;  2LI5 A;  1GJZ A;  4HVB A;  2FCS A;  1J0G A;  3H7P A;  1MG8 A;  2DHZ A;  3PRP B;  4JLC A;  5L83 A;  1RAX A;  2A4Z A;  4ANW A;  1WMH B;  2JY6 A;  4TQ1 A;  4HK2 A;  2LD9 A;  1J19 A;  1KM7 A;  1V5O A;  4MDK E;  5EDS A;  5JHA A;  1S3S G;  2A5U A;  4NY0 A;  1OEY A;  1BT0 A;  2ZVO A;  3A9J A;  4G11 A;  4URK A;  1YX5 B;  3TMP B;  3QAQ A;  3Q3J A;  3ZVV A;  4W9C A;  3X0W A;  4KZC A;  2FUH B;  3APF A;  3ECI A;  5JZE B;  2KC2 A;  3SU8 X;  4W9G A;  5J18 A;  4KSK C;  2GBM A;  3K9P B;  2IYD B;  3PHW B;  4AJY B;  4GMV A;  4FAD A;  2KTF A;  3JSV A;  4LDT D;  3WAN A;  2LGD A;  2FCM A;  3A4R A;  2D2Q A;  3AXC A;  4DHZ E;  4I6L B;  4ASW C;  4MEL A;  2REX A;  3HM6 X;  3KUD B;  2KN5 A;  1TGZ B;  2RR9 A;  3A9K B;  2MX2 A;  3SHQ A;  5TR5 A;  2MSE D;  4G0N B;  1OTR B;  2GOW A;  3WAP A;  1C1Y B;  2IY0 B;  2K25 A;  4W9E A;  3RUL A;  3UIN B;  4EKU A;  2JF5 A;  1UGM A;  4KIK A;  5DPR A;  2WX1 A;  3PPA A;  4ANV A;  4WWP A;  2RD0 A;  4GU2 A;  3L08 A;  2KJH B;  3QX1 A;  4E74 A;  2LUE A;  2MW5 A;  4BVU C;  1CMX B;  2K8C A;  4NJ6 A;  1IP9 A;  1YIW A;  2EKE C;  3U8Z A;  3KYC D;  4W9F A;  3PRM B;  1KLV A;  4RM9 A;  3R3M A;  1EF1 A;  3ML8 A;  3C0R B;  3H7S A;  4HWI B;  2NR2 A;  1S1Q B;  3R66 C;  1TBE A;  3SDL C;  3PLV A;  4BOS C;  3CMM B;  4GDK B;  1ZGU B;  3R7Q A;  2Y5B B;  1GG3 A;  3L54 A;  3P2B A;  4ICU A;  1KJT A;  3UIO B;  2KKC A;  2NBW B;  2KJ6 A;  4WJN A;  4ZYN A;  3TBL D;  2KZR A;  2LWP A;  3QA8 A;  5D6J B;  2JVC A;  4YL8 A;  3L16 A;  1WGD A;  4I6N B;  3WAM A;  1J8C A;  3RZF A;  4AP4 C;  1OEY J;  2LZ6 A;  3ZLZ A;  4X57 B;  1WXV A;  3QWZ B;  2M4N A;  3UF8 A;  1WZ3 A;  3T8M A;  4EZK A;  1G6J A;  1UBQ A;  5G55 A;  3VTV A;  3W1S C;  1L2N A;  1P0R A;  2GBN A;  2DYO A;  2KDB A;  1P98 A;  2BYV E;  4IM3 A;  4TV3 A;  4GDL B;  2IY1 B;  5KHO A;  3TL5 A;  4MJS A;  2G4D B;  2KQS A;  3OAW A;  2L05 A;  1M94 A;  4W9L A;  3VH3 B;  1HE8 A;  2ZJD A;  3ZNZ B;  4GDK A;  2DAF A;  2NCN A;  4KZ0 A;  1Z2M A;  2MBE A;  4OVV A;  3H9D A;  3K9O B;  3WA0 A;  2N7E A;  4BKT A;  3QC8 B;  4EZJ A;  3TIX A;  3GZN I;  2GBJ A;  3EHV A;  4IWO A;  3NHE B;  4IM2 A;  4CHK A;  4ANX A;  3RT3 B;  2DEN B;  2KDI A;  4DHZ B;  5KHQ A;  2I1K A;  4B95 A;  1OGW A;  3HK0 A;  1P1A A;  1WI0 A;  4A3O A;  2KX3 A;  2C9W B;  3CSF A;  4P7I A;  1Z5S B;  2VRR B;  1UZX B;  3DBH I;  3N30 A;  4I6P A;  1WYW B;  4TQ0 A;  3RZW C;  3VXW A;  2DZI A;  3L0W B;  4PYU A;  5D2M B;  4FHJ A;  4WJQ A;  4DHJ D;  2ZCC A;  2DZK A;  4F8C B;  4EEW A;  4GDL A;  4M0W B;  1WJ4 A;  2AYO B;  4M8N A;  1WR1 A;  2BWE S;  3BIN A;  2JRH A;  4FBJ B;  4MGY E;  2KK8 A;  2PE6 B;  3EFU A;  3U30 A;  2V1Y A;  2LAS A;  3PRZ A;  4BBN F;  1EO6 A;  2Z0E B;  3D32 A;  4K81 A;  1AAR A;  3VUX A;  4N9F 4;  2RSU A;  5J17 A;  1SIF A;  2N9X A;  1WM2 A;  1T0Y A;  1V81 A;  2LVP A;  3NZU A;  2KVR A;  3APC A;  3NS8 A;  3DVN V;  4AWJ A;  1NI2 A;  3AI5 A;  1VCB A;  4JQW C;  1E8Y A;  4XZ4 A;  3VTU A;  2N9P C;  4ZRK A;  4ZDV A;  4J6I A;  1U4A A;  1E7V A;  1Y8R C;  3PHX B;  4HPM B;  3DBR I;  3MHS D;  2CR5 A;  2GBK A;  1LFD A;  4JGH B;  4W9H A;  2MA9 B;  4PS7 A;  3B08 A;  3V61 A;  4W9I A;  1P3Q U;  2KLC A;  3M63 B;  5LLI A;  2LRU A;  1YJ1 A;  3RCZ A;  3QHT A;  1V5T A;  2N1W A;  3N32 A;  2IZV B;  3QCA A;  4PS3 A;  3W1S A;  3V60 A;  2IO2 B;  2W9N A;  3Q3F A;  2BYF A;  3M62 B;  1Q5W B;  5AEK B;  3H1U A;  2AL3 A;  1WGG A;  2KMC A;  2MWS B;  5E6N A;  5IAA C;  3VH4 B;  2KFJ A;  4K7S A;  4RMA A;  4E71 A;  2PEA A;  1WX8 A;  2OOB B;  5CHW A;  4MSM B;  1WMH A;  2YLM A;  3PRE A;  4KVG B;  4A20 A;  2O2V B;  3V6C B;  3ZIM A;  3EC8 A;  1XD3 B;  4FHK A;  1Q0W B;  1SE9 A;  3PVL A;  4HDO A;  3JYU A;  1UBI A;  3ZTD A;  1Q1O A;  2KWU B;  2M17 A;  4II2 B;  3ZDT A;  1IPG A;  1H8C A;  1V80 A;  3ML9 A;  4GXB A;  3VUW A;  3M95 A;  3ZRC A;  4BKG A;  3JW0 X;  4IWQ A;  1JRU A;  4FJV B;  3NY5 A;  3VAW A;  4EFO A;  2IBI B;  2LXC A;  3IG3 A;  1WZ0 A;  2KD0 A;  3L10 B;  1PQS A;  2KWV B;  1WE6 A;  4B6W A;  2KJR A;  2GMI C;  3M3J A;  4GSW A;  2KHW B;  2LVO A;  4DBG A;  5JHB A;  4HCP B;  2ASQ A;  2J0J A;  3A9K A;  2MP2 B;  3TCA A;  2UWQ A;  1I35 A;  1NDD A;  2D11 A;  2D3G A;  2O2V A;  2EMT A;  4IW0 A;  4CO7 A;  1LQB A;  5BO4 B;  2R2Q A;  2WWZ A;  4AOF A;  3ZDM C;  3LDZ E;  1RRB A;  4W9K A;  2MQJ A;  3TJP A;  2XK5 B;  1WJN A;  2JT4 B;  1E7U A;  2DYM A;  1YQB A;  2LGX A;  2V4L A;  2KFK B;  2L8J A;  4JIO U;  1WFY A;  5GMV A;  3JVZ X;  5E6P A;  4ZRJ A;  5G2N A;  3A1Q B;  3PTF C;  2CS4 A;  2LVQ A;  4HPL B;  4IC7 B;  2KDE B;  5CHV C;  4BKS A;  5L95 C;  4AUQ C;  2IO3 B;  1L7Y A;  3KW5 B;  1WY8 A;  2MP2 A;  3EEC A;  4OVU A;  3V62 A;  4BOZ B;  2N1V A;  4ANU A;  1EF5 A;  4PS8 A;  5DCN A;  2JUO A;  1GUA B;  3MJW A;  4LDT B;  2KNB A;  2MCN B;  2MRP A;  4DK5 A;  4GN1 A;  2YVC A;  3WAL A;  4B9K A;  2M8S A;  2N4F A;  4DXA B;  1R4M I;  2HTH A;  2XK5 A;  3PSE B;  2KLG A;  3UIP B;  2BPS A;  2C7N B;  3SD5 A;  2N7D A;  1GNU A;  2KFK A;  2KC1 A;  3RYT A;  1EUV B;  2DAJ A;  3ZUN A;  4II3 B;  2BF8 B;  4WJO A;  3V6E B;  3IFW B;  3QK0 A;  3ZKJ C;  3DCG A;  4IUM B;  1GC6 A;  1E8W A;  5AZF A;  3A1Q A;  4HXD A;  4KDL B;  1V86 A;  3PS6 A;  3HIZ A;  4NQL B;  4NJ7 A;  1D3Z A;  5JH5 C;  2L00 B;  2L3Z A;  2FIF A;  3QJZ A;  1A5R A;  3IHP C;  1WRD B;  2ZEQ A;  3DQV A;  3T9L A;  1WGR A;  1V6E A;  1WX9 A;  3DOW A;  2K39 A;  3DPD A;  4XX5 A;  5E6O A;  5LXH A;  2ZVN A;  3ZNH B;  4G50 A;  4KV2 A;  4BKS D;  2MBH A;  3IBE A;  5CX3 A;  4FLH A;  1UD7 A;  2DZJ A;  3VTW A;  3UGB B;  5AZH A;  4PYZ A;  2KWC A;  2M0X A;  2FAZ A;  1RLF A;  2NBU A;  3WIM A;  4EOY A;  1UEL A;  3UQA A;  4IM0 A;  2XBB C;  5C23 A;  2XEW A;  2C7M B;  2ZCB A;  3KVF B;  2G45 B;  3CF6 E;  1LXD A;  4EUT A;  1V49 A;  2CU1 A;  2KO3 A;  2K6Q A;  3RUI B;  1V2Y A;  3B0A A;  2C5L C;  5C1Z A;  1YX6 B;  5J2R A;  1FXT B;  2DZM A;  2FCQ A;  2AL6 A;  3NOB A;  3AUL A;  2KDF B;  2JXX A;  2BYE A;  1VD2 A;  2PE9 A;  2WDT B;  2KTR B;  4FUL A;  2LRW A;  1QZE A;  4KIK B;  2O6V B;  3QIJ A;  1WXA A;  1ZW7 A;  2KX0 A;  1TTN A;  4HLE A;  4DDI D;  3OJ3 A;  2UYZ B;  1WJ6 A;  2L0F A;  1F9J A;  3KUZ A;  1WGH A;  4NQK E;  1WXS A;  1WH3 A;  5DPT A;  1I42 A;  2QHO A;  4KSL C;  4A3P A;  4DWF A;  1K8R B;  2PPH A;  4EZL A;  5DPS A;  3AU5 A;  1E5W A;  2RPQ A;  2L7R A;  2V3S A;  2KOX A;  4W9J A;  3QAR A;  2GBR A;  2HJ8 A;  2BKF A;  4MGI E;  3LJ3 A;  3R7R A;  3VDZ A;  4LJO B;  5IA7 A;  4WJP A;  3VFK A;  1WM3 A;  2KAN A;  3KH0 A;  3ZW3 A;  2Z59 B;  4WWO A;  3BY4 B;  4MGK E;  5AZG A;  3IVF A;  1YD8 U;  4GGQ A;  4K7U A;  2ZPN A;  4WAA A;  2KTR A;  5FR6 A;  4DHJ B;  4DDG D;  3UQB A;  2C7H A;  2O6V A;  2NPT B;  3W1Y A;  4F7Z A;  4TKN A;  1P9D U;  2EMS A;  2KQ7 A;  4LJP B;  4WQO B;  2JPH A;  2DX5 B;  2RGF A;  4HCN B;  2BKR B;  2WYQ A;  4FJZ A;  3PGE A;  2B3A A;  3DVG X;  2CHW A;  4NAW B;  2ZPY A;  4G3X B;  4IWP A;  1WE7 A;  1UH6 A;  3VUY A;  2DYB A;  1WJU A;  4FA6 A;  2MBB B;  2LGY A;  3I3T B;  4MJS B;  2D07 B;  4KDI C;  2OJR A;  3DDC B;  1WX7 A;  3DVG Y;  3KUC B;  3ENE A;  4GOC A;  2JZ3 B;  3VVW B;  4MH0 E;  4ZRI A;  3B1L X;  1WIA A;  1X1M A;  4BFR A;  1XQQ A;  3PLU A;  2Z0D B;  1SGH A;  3ZTC A;  4MEM A;  2NPT A;  2JZZ A;  1ZKH A;  1WXM A;  1NBF C;  1KOT A;  4MGZ E;  1IYF A;  2N9E B;  2M1M A;  5CTR C;  3A33 B;  1XT9 B;  4GIV A;  2L76 A;  1R4N I;  3U7D A;  3A4S C;  2LXA A;  3MTN B;  3HM3 A;  2CHX A;  2ZNV C;  2MBO A;  1E8X A;  2D10 A;  2KMA A;  5DPW A;  2R2O A;  4NAW A;  3APD A;  3ZNI D;  5LXI B;  3S2A A;  4BBN C;  3ZRF A;  1GC7 A;  1LM8 B;  2O6V D;  3GOE A;  4ICV A;  4IG7 B;  3ONS A;  4HJK A;  1C3T A;  2FID A;  2C60 A;  3PZD A;  3VQI A;  2NVU I;  2K8B A;  3L13 A;  4TUU A;  1E8Z A;  2IO0 B;  2J0M A;  2AWT A;  2JRI B;  2K1F A;  3HHM A;  3L17 A;  2KXJ A;  4W9D A;  1WF9 A;  4RM8 A;  3X23 A;  2L0T A;  2K6D B;  2JWZ A;  3QQ8 B;  4E3C A;  2CHZ A;  4NPN A;  2IO1 B;  1ISN A;  3H7P B;  1H4R A;  1V9J A;  2BGF A;  2HD5 B;  3CST A;  2G4S A;  4MM3 A;  2G3Q B;  3PT2 B;  5CHF A;  3ZNG C;  4GB9 A;  3ALB A;  1RFA A;  2NBV B;  3DBL I;  5D7G A;  2AEH A;  2HE7 A;  2J0K A;  3H6N A;  3OJ4 B;  2ZZP B;  3DVN U;  4FN2 A;  4XC2 A;  2MLB A;  2J7Q B;  4HDQ A;  4JL9 A;  4WWN A;  4K1R B;  3RD2 A;  4LCD E;  3OLM D;  2WX0 A;  3KYD D;  4AJW A;  2BWF A;  3N3K B;  3A9J B;  3O65 B;  1TZ1 A;  2FNJ B;  3VHT C;  4MSQ B;  3PV1 A;  4F1S A;  2NS5 A;  2ZNV B;  4M8M A;  3ZO5 B;  2CKH B;  2PJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...