3VTUA

Crystal structure of human lc3b_2-119
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
SPEFPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for phosphorylation-triggered autophagic clearance of Salmonella
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2012-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vtuA00
2MA9B 2DENB 3KYCD 1WR6E 3JYUA 3OJ3A 4AJYB 3Q3FA 3BY4B 1WGYA 3AI5A 1WJ6A 1LQBA 5DPWA 3L0WB 3U7DA 2BYVE 2N9XA 2NR2A 5IA7A 3O65B 2XBBC 3EECA 3RULA 2XK5A 1WX7A 3A1QB 3CF6E 3H9DA 5DPTA 2KNBA 2JVCA 2O6VB 4IM2A 3ZNID 1C3TA 2KWUB 2KOXA 2KFKB 3L54A 4LJPB 4W9HA 1XT9B 3JW0X 3V60A 4KDLB 3UGBB 3ZDMC 3PS6A 4WJPA 1WJUA 1S3SG 3QIJA 3PREA 2L05A 4IWOA 1H4RA 3W1SA 4EKUA 1P1AA 2LVPA 2MBQA 1WX9A 1WE7A 1E7VA 3QQ8B 2DHZA 4II2B 3NS8A 2KMCA 2ZVOA 1WXSA 1UELA 2KMAA 4B9KA 2N4FA 1RLFA 4GB9A 3KYDD 2MBBB 3WAOA 5D7GA 1Q0WB 3LDZE 2OJRA 2LRWA 2L00B 3T8MA 2G4SA 2WYQA 4KZCA 4F1SA 2XK5B 3A1QA 4OVVA 2N7DA 4CYEA 3RUIB 3JVZX 1WGDA 3L13A 5E6NA 2KTRB 4W9EA 2L0FA 2KZRA 3KUCB 4FBJB 1P98A 4GIVA 2WWZA 4XC2A 4WWOA 1CMXB 2KTFA 2FCSA 2R2OA 3IG3A 4NNJB 2M0XA 2N9PC 2OOBB 1QZEA 3WAPA 1V2YA 1KJTA 1V5OA 4DHZE 4GGQA 2FCMA 4CHKA 1L2NA 2RPQA 4URKA 3A9KA 2KC2A 4NQLB 3L08A 2IY0B 1RRBA 4KSLC 3VUYA 5J2RA 1J8CA 4M8NA 5E6PA 5G2NA 2LRUA 4BVUC 2M4NA 1GNUA 1UZXB 4WJOA 1I35A 2MX2A 2DZMA 1UD7A 1E90A 2KJHB 1E8XA 2DYOA 3DCGA 4KSKC 3ZNHB 3ZRCA 2LJ5A 2KQSA 2AL3A 2LASA 1M94A 1TTNA 2V4LA 4JL9A 3RYTA 3S2AA 1EO6A 2MBOA 1OGWA 2FIDA 3ZO5B 3PLUA 3AU4A 3DBSA 4X57B 3TBLD 1XD3B 3AULA 5KHQA 3B1LX 3PGEA 3H7PA 2KC1A 4I6LB 3IBEA 2PE6B 2NBVB 5AZFA 2BKRB 2KJRA 4MJSA 4IG7B 4DHZB 3PVLA 2GBRA 1V9JA 3HHMA 4IWPA 4F7ZA 2BWES 4CO7A 2JRHA 4KDIC 2HE7A 3EC8A 2O2VA 4F8CB 1WGRA 1OTRB 1NI2A 1UGMA 4EOYA 3I3TB 2JUOA 2G45B 2NBWB 4IWQA 2K6DB 4HCNB 2V1YA 2KANA 4G50A 1WMHB 3OJ4B 4EZLA 4KZ0A 2ZPYA 5J17A 1R4MI 3WANA 2K25A 5BO4B 4TQ0A 2REXA 2HTHA 2W9NA 2C7MB 1ZW7A 4HPMB 1T0YA 2GBKA 2D07B 4NJ6A 4ZRJA 2EKEC 2UWQA 4NAWB 4MH0E 2CS4A 2LXCA 3ZIMA 1WM3A 2ZEQA 4WJQA 2LWPA 3AU5A 1WY8A 2KTRA 1WGHA 2BPSA 4YL8A 2I1JA 2GBJA 4W9FA 3L10B 4NJ7A 2AWTA 2BWFA 3DVNV 3M63B 4W9KA 5D94A 4FJZA 4KV2A 4BKSD 5J18A 2O6VD 2C60A 2FNJB 3HM3A 4BBNC 2L0TA 3TCAA 3DBRI 3PSEB 3Q3JA 4WWPA 4IW0A 3V61A 3DQVA 3M95A 1RAXA 2IZVB 3KVFB 1A5RA 4TV3A 4DK5A 2MW5A 1WI0A 2PJHA 3PV1A 3ML8A 3WIMA 2JXXA 2DZKA 2IYDB 1IPGA 1EUVB 1E8WA 3A4RA 4HLEA 1V86A 2Z59B 2D3GA 1E8YA 3VFKA 3DVGY 2MQJA 2FCQA 2KVRA 2K8HA 1WX8A 2J0KA 2JRIB 2UYZB 5G55A 2ZVNA 3SU8X 3ZDTA 1TBEA 2DZIA 4MGKE 2GBNA 1ISNA 4ANVA 1WXAA 2DZJA 3DBLI 1E7UA 2YVCA 1WXMA 4G3XB 3APCA 2Z0DB 3K9PB 4GSWA 3UQBA 4PS7A 4ZDVA 4ANWA 1P0RA 2GBMA 2KFKA 3PZDA 2M17A 2EMSA 2ASQA 2CHZA 2KXJA 2BF8B 2VRRB 2PEAA 3QC8B 5CX3A 1I42A 3PRMB 4BOZB 3C0RB 1WM2A 4G11A 4GXBA 2D2QA 2O2VB 3A9KB 2NS5A 2JPHA 2RR9A 1YX5B 1H8CA 4FHJA 3OAWA 4FHKA 2JZ3B 2IO3B 4DBGA 2KX3A 4MEMA 4FA6A 3DPDA 3IFWB 4W9CA 1TGZB 1GJZA 3VUXA 4LJOB 5DPRA 1ZGUB 3ENEA 1YQBA 4B6WA 2MLBA 4BKTA 5LXIB 1NBFC 2CKHB 3GOEA 1V80A 4FULA 5JZEB 4ANUA 3UF8A 3SDLC 4HJKA 1SGHA 2N9EB 3UIPB 2CHWA 4DHJD 2MBEA 4IM0A 4EZJA 5C23A 5AEKB 3V6EB 4LCDE 3GZNI 2Y5BB 2BGFA 2JF5A 4M8MA 4NQKE 3TIXA 1NDDA 1G6JA 2ZCBA 5AZHA 1YX6B 1P3QU 3ONSA 4GDKB 4MGIE 4I6PA 3W1YA 2KO3A 2DYMA 1JRUA 1KLVA 3B08A 4WAAA 5JHAA 3DBHI 1KOTA 3VUWA 2G3QB 4M0WB 2YLMA 4ICUA 1WZ3A 4K7WA 3X0WA 1V5TA 2M1MA 5CHVC 3BINA 2CU1A 2CR5A 4FJVB 1IYFA 3DVNU 5EDSA 4NAWA 1LXDA 1Q1OA 2LVQA 4W9LA 2ZPNA 4HWIB 2XEWA 1GC6A 1WGGA 2KX0A 4HDOA 2D10A 3LJ3A 2KN5A 3APDA 3JSVB 4ZRIA 4B95A 2IO2B 2K6QA 5AZGA 5DPSA 4DHJB 3VH3B 1Y8RC 2BYFA 2N1WA 1OEYJ 2KHWB 2LVOA 3ALBA 3N32A 3SD5A 3NZUA 5L83A 3T9LA 3DOWA 1WIAA 1RFAA 4ICVA 3PRZA 2IY1B 3EHVA 2MP2A 1HE8A 1WF9A 2Z0EB 3QA8A 5CHFA 4ZYNA 3QJZA 4DXAB 4A20A 2LZ6A 3RZWC 4WQOB 3QARA 4RM9A 1J0GA 2JWZA 1WXVA 1GG3A 4W9JA 4W9GA 2CHXA 4KIKA 3VXWA 3WAMA 4ASWC 2J0JA 2DX5B 4PYZA 4OVUA 4HDQA 1TZ1A 3ZW3A 1WFYA 4TQ1A 4E74A 4N9F4 2RSUA 2KWVB 2NCNA 1GUAB 5CHWA 4G0NB 2NPTB 3PHXB 1WH3A 1OEYA 3A4SC 3NZSA 4LDTD 4TKNA 2WX0A 2A4ZA 3SHQA 3QHTA 4KVGB 1IP9A 5IAAC 1K8RB 4GN1A 2JY6A 4II3B 2C5LC 2DAJA 2M8SA 1UBQA 3MHSD 3A9JB 2A5UA 2HD5B 2KDBA 3R66C 2FAZA 2N7EA 5L95C 4BKSA 2ZCCA 3QAQA 3ZTDA 4WJNA 3MJWA 4HVBA 2EMTA 3H1UA 2KK8A 1MG8A 3U30A 1EF1A 3PT2B 5E6OA 3QCAA 3M62B 4AWJA 4GDLA 4EEWA 3A9JA 3PRPB 2D11A 3IVFA 2L7RA 4GU2A 1P9DU 2J0MA 1D3ZA 1L7YA 5GMVA 5DCNA 5KHOA 2G4DB 3APFA 1LFDA 2LGXA 1LM8B 2IO1B 4PS3A 3X23A 1Z2MA 1WR1A 3WA0A 2BKFA 2MP2B 3L16A 2IO0B 5JHBA 3KW5B 4I6NB 1GC7A 2O6VA 1ZKHA 3NHEB 1WE6A 2KQ7A 2QHOA 2KWCA 3M3JA 1VD2A 2I1KA 3N30A 4IUMB 4KIKB 4RM8A 3MTNB 3UQAA 2K1FA 3CSTA 3ZUNA 4IC7B 3VAWA 4GMVA 3VH4B 4AOFA 2WDTB 1V6EA 1WRDB 3H7PB 2KFJA 1C1YB 2AYOB 2PPHA 5FR6A 3RT3B 1E5WA 3ML9A 3A33B 4DDGD 3CMMB 4GDLB 2LD9A 3ZRFA 3ECIA 4AP4C 3KUZA 1SIFA 3PLVA 2ZZPB 2LI5A 1WJ4A 3TJPA 2MCNB 3ZKJC 3ZVVA 1BT0A 3HK0A 2GOWA 3NY5A 2C7HA 2MBHA 4K7UA 2BYEA 3PTFC 5D6JB 3QWZB 3W1SC 2C9WB 2L8JA 2MRPA 3P2BA 2KD0A 4EUTA 4K1RB 1WMHA 4ANXA 4GDKA 3PHWB 4JLCA 2JT4B 4FADA 2J7QB 2C7NB 2GMIC 3QX1A 4XZ4A 1WYWB 3ZNZB 3VTVA 3L17A 2ZJDA 1FXTB 4HXDA 4BKGA 2HJ8A 2KKCA 2FCNA 3V6CB 4DWFA 5HKHA 1WJNA 4FJYA 4MSMB 2N1VA 3VQIA 4WWNA 1UBIA 1X1MA 4TUUA 2DAFA 2FUHB 4HCPB 2K8BA 2LUEA 2ZNVB 2AEHA 4BFRA 2R2QA 3ZNGC 3RD2A 4BBNF 4MDKE 4NY0A 1J19A 3DVGX 1UH6A 1F9JA 2K39A 1SE9A 5C1ZA 3VTUA 1R4NI 2RGFA 5CTRC 2L3ZA 4RMAA 4W9IA 2KDEB 3R3MA 4HPLB 3KH0A 3VTWA 1VCBA 2ZNVC 4ZRKA 2V3SA 4W9DA 1U4AA 5LXHA 3QK0A 2WX1A 1AARA 2KJ6A 1XQQA 3N3KB 1S1QB 2AL6A 2L76A 4LDTB 4PS8A 2JZZA 4JIOU 3IHPC 1V49A 4FN2A 3ZTCA 2RD0A 5D2MB 3TL5A 1YJ1A 2LGDA 1KM7A 1YIWA 4DDID 3EFUA 3JSVA 4AUQC 3UINB 3PPAA 2B3AA 4J6IA 3DDCB 3R7RA 1EF5A 2KLCA 5JH5C 1OQYA 3H7SA 4P7IA 4HK2A 2IBIB 4EZKA 1PQSA 3VDZA 3VHTC 3K9OB 3R7QA 5TR5A 3KUDB 4A3PA 4BOSC 3U8ZA 2PE9A 4A3OA 4K81A 2KDIA 3TMPB 3D32A 4NPNA 2KDFB 2K8CA 2NPTA 4JGHB 1Q5WB 3RZFA 1WZ0A 2FIFA 4EFOA 1V81A 3OLMD 3VVWB 4GOCA 3UIOB 4MSQB 4FLHA 2LGYA 4MM3A 3B0AA 3ZLZA 2NBUA 4MGYE 4MGZE 1YD8U 3HIZA 3V62A 3WALA 2LXAA 3H6NA 4IM3A 4K7SA 4XX5A 2MWSB 3NOBA 1E8ZA 3CSFA 5LLIA 3RCZA 4E3CA 4MELA 1Z5SB 2MSED 2DYBA 2NVUI 4JQWC 4PYUA 3AXCA 4MJSB 4AJWA 3HM6X 4E71A 2KLGA
chains in the Genus database with same CATH superfamily
3AEBB 3RMKC 3AI5A 1WJ6A 1GOZA 1KFYB 2NR2A 1STEA 2XBBC 1FCCC 3EECA 1P7FA 3DHHC 4LTUA 1JWSD 5DPTA 3ZNID 4W9HA 1XT9B 4KDLB 1WJUA 2HTME 4IWOA 1QILA 1P1AA 1N60A 2DHZA 3AE6B 2ZVOA 1UELA 4JWUC 4GB9A 3AEAB 1MPEA 2MBBB 4KKJA 5D7GA 2LRWA 4H2AA 4JE3B 3A1QA 2N7DA 3L13A 1WGDA 2KTRB 2L0FA 2WHIA 4WURA 2R2OA 3IG3A 2M0XA 1N5WA 1QZEA 1E9MA 1V2YA 1QKZA 1KJTA 2KT7A 4GGQA 4J3OD 1L2NA 1TS2A 1K53A 2PVGC 4NQLB 3L08A 1UWXA 2IY0B 3VUYA 2KDMA 1J8CA 4XGAB 2M4NA 1UGJA 3GS2A 3P63A 4WJOA 1I35A 2MX2A 5EE3A 2PMVA 3UI3A 1UD7A 4KSKC 4JL9A 2V4LA 2MBOA 4NAMA 4WH4A 4GLSC 3TBLD 3AULA 3H7PA 5AZFA 4MJSA 4IG7B 2I2YA 1V9JA 4F7ZA 2WXJA 1EWYC 2LGIA 2BTEA 1C4CA 2G45B 2DNFA 2K6DB 3FILB 3FAHA 2WXNA 4KZ0A 1R4MI 2YEPF 1ZW7A 1D5MC 2WXOA 1T0YA 1TKEA 4NAWB 2AQ2B 4C4VB 2LXCA 1AW7A 1B1ZA 3P1MA 2HJ1A 2QDFA 2BPSA 4NJCA 2BWFA 1DOXA 3M63B 1TIFA 1B9RA 4KV2A 2FNJB 1FMAD 2H89B 4L23A 3DBRI 3V61A 1JWBD 1K51A 2IZVB 1A5RA 2MW5A 1WI0A 3PV1A 4M02A 2IYDB 1KF6B 3W5UB 1JMLA 2PTLA 3RNGC 2M19A 3U2SC 2KVRA 2JRIB 3ZDTA 2K5PA 2GBNA 1WXAA 4LK0M 3DBLI 4XWTA 2SAKA 4PT5A 4YSYB 5BMGA 1YJJA 1ZP0B 2Z0DB 3K9PB 3BVZA 4ZDVA 2M17A 2ASQA 2PEAA 4P16A 4C80A 1YX5B 4JPSA 4DBGA 4FA6A 4W9CA 3VUXA 1N61A 3GP7A 4RGNA 4BKTA 1L0XB 2LHDA 2CKHB 3GOEA 5JZEB 1WXQA 4HJKA 1SGHA 1WSPA 3AE8B 3U4EG 3UIPB 2MBEA 4EZJA 4C4VA 1J7BA 3GZNI 1N63A 2JF5A 4M8MA 1R4MB 1NDDA 1G6JA 1MVKA 2DYMA 2LJIA 1JRUA 2MJEA 3NJTA 1KOTA 1T0QC 2GRIA 3Q69A 4ICUA 3X0WA 2M1MA 3AE3B 3GE3C 3RNEC 4HDOA 4EE2A 3IXSA 3IAS1 5DPSA 2KHWB 2LVOA 1GAQB 3ALBA 1L0VB 2WXIA 3N32A 5L83A 1MHXA 4ICVA 3EHVA 5H92C 2MP2A 2RDHA 1C76A 1QOGA 1DOYA 2TSSA 4HJGE 2NTTA 1EWCA 4RGMA 2LZ6A 3RZWC 1WGKA 2YEPB 1Q10A 1WXVA 2MJDA 2QJLA 2CHXA 3DHIC 4PYZA 2DX5B 3ZW3A 4E74A 2RSUA 3ZXVA 2NPTB 2WX0A 1K8RB 2JY6A 2M8SA 2G1EA 3A9JB 2KDBA 3R66C 2FAZA 2N7EA 5BMHA 5L95C 4WJNA 4HVBA 2EMTA 3H1UA 3TEYA 1MG8A 4HRSA 4GDLA 2L7RA 1P9DU 2QMTA 1L7YA 1LFDA 2LGXA 3AEGB 1LM8B 3BWUD 2IO1B 1Z2MA 1WR1A 3L16A 1YN4A 3V3XA 2CJNA 2D3AA 3KW5B 1ZKHA 3NHEB 1WE6A 1ZPSA 1VD2A 2I1KA 5BYQA 4IUMB 4IC7B 4GMVA 1V6EA 1C1YB 1E5WA 2Y5CA 4DDGD 4GDLB 2LD9A 3ZRFA 1QQRA 5GXGB 3PLVA 4A90A 1L6UA 4A8XC 2ZZPB 2BQQA 2GOWA 3NZ3A 1N6ZA 4JLCA 4FADA 3QX1A 3RNBC 2ZJDA 1FXTB 2VZKB 2WXLA 2KKCA 3P4PB 3IT6B 4DWFA 1WJNA 4WWNA 3CIRB 2FUHB 2K8BA 4S0RA 5E6JA 4NY0A 3DVGX 5C3JB 2K39A 1TT5B 4YWGG 1FNVA 4KGTA 3VTWA 3KH0A 4O1NA 1N5XA 1NI3A 2W3RA 3Q3MC 2ZNVC 4ZRKA 2WLBA 4W9DA 4B0EA 1U4AA 3RI7C 3Q3OC 3AN1A 2V3PA 2AL6A 4PS8A 3DHGC 3IHPC 2WXPA 1T0SC 2IGDA 4AQ7A 3PZ8A 2LGDA 1YIWA 3EFUA 1P7EA 4AUQC 3P4SB 2B3AA 3BIID 3W5VB 4P7IA 2K22A 4HK2A 2RPVA 1GB1A 4EZKA 3VDZA 3R7QA 4K81A 2KDIA 4NPNA 3N1ZC 2KACA 2INDC 1V81A 4MM3A 2INNE 4MGZE 3HIZA 3V62A 2DWQA 4LLGM 4KGSA 2OEDA 4YTPB 2DYBA 4PYUA 5H8YE 4K3CA 4E71A 2ZW0A 2KLGA 2MA9B 3OJ3A 1CQVA 2IPKD 1ZUD2 2Q5WD 2XK5A 1WX7A 3CF6E 3H9DA 2KNBA 2KWUB 4BZAA 1I7HA 3ZXRA 3ZDMC 4WJPA 2L05A 2W55A 3ZGZA 2MBQA 1F2RI 3DBHB 2LUMA 3QQ8B 1WE7A 2KMAA 1L4ZB 1Q0WB 3LDZE 2OJRA 2PKOA 2KVZA 5IOIA 2JSVX 4US8A 2FUG1 3RUIB 3JVZX 2K9XA 5E6NA 1JW9D 4FBJB 3KUCB 4TSSA 1CMXB 2FCSA 1C4AA 2N9PC 1PDXA 1JCKB 3WAPA 1V5OA 4CHKA 1I4HA 1GPXA 1PFDA 2KC2A 1K52A 4N59A 2D5GA 1T6BX 2WXGA 5G2NA 1R7SA 4JX1C 3NVYA 2JU6X 1GNUA 4RCOA 2KJHB 3DCGA 4M01A 3ZRCA 3W2DA 2AL3A 2LASA 5FKAC 3N1YC 1RYJA 3EGRA 1HQRD 2R61A 4MACA 1OGWA 2FIDA 3AU4A 3DBSA 4HKQA 4OZAA 4I6LB 2KMMA 2XNAC 2GLSA 2KJRA 1TY2A 3V05A 2BWES 2ONQA 4KDIC 3EC8A 2FE8A 1SBBB 1OTRB 3IT4B 2N9KA 2NBWB 3AEFB 3RNAC 5BMIA 4HCNB 2KANA 3OJ4B 1A70A 2BW2A 2K25A 1QLBB 2W9NA 2L52A 2D07B 4NJ6A 2EKEC 1WWTA 1I4QA 1HTOA 3Q8AA 3ZIMA 2ZEQA 2LWPA 1WY8A 4ZRPA 1WGHA 1BUIC 2GBJA 2I1JA 1KLUD 4ARIA 5D94A 4BKSD 2O6VD 3MC8A 1JQ4A 4BBNC 2L0TA 4IW0A 3DQVA 4DK5A 1EUVB 5HI1A 4HLEA 2D3GA 1UNSA 3DVGY 1WX8A 2ZVNA 1TBEA 2DZIA 4ANVA 2WDQB 1WXMA 3AE4B 3APCA 1V1OA 3UQBA 2GBMA 2BF8B 3QC8B 1L4DB 3PRMB 3DWGC 3C0RB 4BOZB 1VZ6A 4GXBA 3A9KB 4TMAB 1H8CA 4FHJA 2KX3A 1AWDA 1C9FA 4LJOB 2M0AA 4C00A 1ZGUB 3ENEA 2MLBA 1LO5D 1NBFC 1I4XA 1V80A 4ANUA 2WXRA 3AE9B 4IM0A 1NEKB 2Y5PA 2ICIA 4BAXA 3V6EB 4LCDE 4IDIA 3OWEB 2OHFA 2IDYA 4OW0A 3BK1A 1WYGA 1YX6B 1P3QU 2KQ4X 2LFIA 2QILA 4WAAA 3VUWA 1HXYD 1WZ3A 4K7WA 1V5TA 5CHVC 2CU1A 2CR5A 4FJVB 1Q1OA 1N62A 4HWIB 2J42A 2DLBA 3HUIA 5IN7A 2WDRB 4N6EB 3AE7B 3LJ3A 1C78A 1Y8RC 2N1WA 3AM9A 3SD5A 2V3NA 3DOWA 4K3BA 3PRZA 5I4DA 2G9HD 3GB1A 1HE8A 1WF9A 3QJZA 5AUIA 1T3QA 1C79A 3AMZA 3NRZA 1HZ6A 4W9GA 4C56C 3VRBB 4KIKA 1NVID 4ASWC 4HDQA 1TZ1A 1WFYA 3U52E 2NCNA 1J7AA 4IOIE 1DGJA 3A4SC 1OEYA 3NZSA 4LDTD 5IP4D 2C5LC 4XE0A 1UBQA 1E10A 2HD5B 4BKSA 1NYRA 2ZCCA 1UF0A 1IBXA 2GI9A 4WAFA 4ACFA 3U30A 1EF1A 3NVVA 3NVZA 3Q8BA 1SJED 3AB5A 5DCNA 5KHOA 2G4DB 3EFCA 1V8CA 4IKGA 4XYCA 1TKGA 4KIKB 4RM8A 2K1FA 3CSTA 3VAWA 2OJWA 1FXIA 1F1HA 3ML9A 3A33B 1SSNA 1PUTA 4L2YA 1E0ZA 1D4BA 1SIFA 3TJPA 1BT0A 1F77A 3HK0A 5D6JB 2C9WB 2MRPA 4K1RB 1WMHA 4ANXA 4GDKA 2MEKA 2C7NB 1FFUA 4JWSC 1WYWB 4BKGA 3VTVA 4HXDA 4YSZB 5EE9A 2FCNA 3V6CB 3LB8C 5HKHA 2BYTA 4FJYA 1QF6A 2N1VA 3VQIA 1UBIA 1X1MA 5TSSA 4HCPB 3RD2A 1IGDA 5C1ZA 2RGFA 2W3SA 4RMAA 4W9IA 1SE2A 3R3MA 1FM0D 2QEJC 1XO3A 1ET9A 4DXFA 2WX1A 1J7CA 3RNFC 1AARA 2KJ6A 1LGRA 3WCQA 2CJOA 3ZTCA 3VR8B 2RD0A 3TL5A 1YJ1A 3HVZA 3I63C 1KM7A 3JSVA 2MJ3A 3FC4A 3DDCB 3R7RA 1OQYA 3AV8A 3H7SA 3B9JA 5JXVA 1PQSA 1RFKA 3VHTC 1YN3A 4A3PA 2W54A 3U8ZA 1VR9A 2PE9A 2KDFB 4JGHB 1JROA 3RZFA 1WZ0A 2FIFA 4EFOA 3VVWB 4GOCA 3UIOB 4HEA1 4FLHA 3ZLZA 4YXDB 3FKYA 3WALA 1CK1A 2LXAA 4IM3A 4K7SA 2MWSB 3NOBA 1E8ZA 3CSFA 5LLIA 4E3CA 2MSED 4JQWC 4MJSB 1HEZE 1ROEA 3KYCD 1WR6E 3JYUA 3Q3FA 1WGYA 1ET6A 1XCQL 5DPWA 2D3CA 4L1BA 2BYVE 3O65B 3VR9B 3RULA 2O6VB 4IM2A 1ZXHA 4D2KA 4PK1A 2KOXA 2KFKB 2LEKA 3V60A 3PS6A 1YN5A 3PREA 1H4RA 4EKUA 3TEWA 3J9CA 2LVPA 1WX9A 2JXTA 2EKIA 2I38A 1OQQA 1WXSA 5MPOA 4B9KA 2AQ1B 1SF0A 3KYDD 3R2TA 3WAOA 3BVMA 4LNKA 4KZCA 4F1SA 2XK5B 3SFEB 2WU5B 1L5PA 2KZRA 4DXGA 1P98A 4XC2A 4WWOA 2KTFA 4NNJB 2JYEA 1OQRA 1WRIA 4DHZE 2ZW1A 1FFVA 2RPQA 1SIJA 2V0GA 2WXFA 1RRBA 4KSLC 3N9YC 4M8NA 2PW9A 4BVUC 4RFBA 1R4NB 1UZXB 4WQMA 2DZMA 4OZBA 1E90A 3C8YA 2DYOA 3AE5B 3ZNHB 2LJ5A 1M94A 3S2AA 1EO6A 3PLUA 3NS1A 3EUB2 4X57B 2FBWB 5KHQA 3PGEA 2KC1A 4N58A 2PE6B 2NBVB 3BK2A 2INPE 3PVLA 1ZXIA 3HHMA 4IWPA 2JRHA 2O2VA 1WGRA 3AH7A 4IWQA 2Y3AA 4HKZE 1YNTE 4EZLA 2ZPYA 5J17A 3WANA 4TQ0A 3OG5A 4A6QA 5C2TB 4HPMB 2GBKA 1TYGB 2UWQA 2CS4A 3BYYB 3EA6A 1WM3A 4WJQA 3AU5A 1ACCA 4ITKA 4YL8A 4S17A 4NJ7A 2AWTA 3DVNV 4W9KA 4FJZA 1I4RA 3HM3A 3RPFC 3I57A 2QIEB 1I4PA 3Q3JA 3M95A 1RAXA 4TV3A 3ML8A 4NZLB 2N9LA 5HG2A 2NMQA 3VFKA 2QCZA 2N7JA 2MQJA 2K8HA 5G55A 2QC8A 1FEHA 1ISNA 2DZJA 4G3XB 4KKIA 4PS7A 2WS3B 2KXJA 2CHZA 1WM2A 2O2VB 3PO0A 4XDCA 2NS5A 2JPHA 3MFGA 3OAWA 4FHKA 2JZ3B 2IO3B 3DPDA 1VJKA 1TGZB 5DPRA 1NYQA 3Q14C 4ZRQA 5LXIB 4FULA 1JWMD 3UF8A 2WXKA 3AEEB 1VDVA 1JWAD 3BZDB 2CHWA 4DHJD 2WU2B 5C23A 5AEKB 3AEDB 1FNUA 1CJEA 2WGSA 3TIXA 4NQKE 2WP9B 5AZHA 3ONSA 4GDKB 3W1YA 2KO3A 3SFDB 3FILA 1K50A 4WIPA 1TY0A 4M0WB 1D5ZC 5AUKA 2YLMA 1IBXB 3DVNU 2LVQA 2ZPNA 2L1AA 1MFWA 1GC6A 2KX0A 2D10A 1XCTL 2KN5A 3APDA 4ZRIA 2RDGA 2IO2B 1D6EC 5AZGA 4LNFA 3VH3B 1OEYJ 1L6VA 3T9LA 1WIAA 1F52A 3KWVA 2IY1B 3QA8A 1SXTA 2KYWA 2Z0EB 5CHFA 4LNIA 4ZYNA 3TUOA 2BS4B 1FRDA 4RM9A 1J0GA 2JWZA 4ZYSA 1GG3A 4W9JA 3VXWA 3Q8CA 2J0JA 5T8IA 1FIQA 4TQ1A 4G0NB 2L83A 2RMMA 1BMLC 2A4ZA 1XLOA 3SHQA 1IP9A 2A5UA 2BVCA 5BYSA 3KQ4A 3PT2B 1DOIA 5E6OA 3QCAA 3M62B 4AWJA 1ZDXA 5LNK1 3A9JA 3PRPB 3IVFA 2J0MA 2BT6A 1FCLA 5GMVA 2WDVB 3APFA 1RWSA 3IAM1 2SEBD 1SJHD 1V97A 3T3NA 4I6NB 3MJ5A 2O6VA 1PGAA 5FK9C 1CZPA 3M3JA 4HPPA 2KWDA 3TEXA 1SE4A 3LXFA 2GB1A 3MC0B 1TKYA 3VH4B 2WDTB 3H7PB 1SE3A 2PPHA 2NTSA 2BB5A 3RT3B 3BYTB 3CMMB 1FNWA 1ENFA 1YMHE 3ECIA 4AP4C 2WXMA 2LI5A 1WJ4A 5D3IB 2MCNB 3ZKJC 3ZVVA 1NENB 2DBYA 3L4PA 3I9V1 2MBHA 4K7UA 1AYFA 2IGHA 3PTFC 2L8JA 2KD0A 2WXHA 3PHWB 4M00A 2JT4B 2V4IB 2GMIC 2JQRB 5EE0A 3ZNZB 3T3OA 1ZE3D 2HJ8A 4TUUA 1UWMA 2ZNVB 4BFRA 1IUEA 2R2QA 1VZ7A 1J19A 1UH6A 1F9JA 3RNCC 2X38A 4A9AA 1JWUD 4HPLB 3O13A 1ESFA 3MC9A 5LXHA 3DWMA 1VLBA 2J53A 4YTNB 1XQQA 3N3KB 1S1QB 2L76A 5EE1A 4OHJA 2EELA 2JZZA 1V49A 4FN2A 1TS5A 1YOVB 1QOBA 4DDID 2PLPA 4RNAA 3PPAA 4J6IA 1MG4A 1EF5A 1XF5L 2J52A 3DBRB 3TEZA 4BOSC 2MHJA 3KLSX 3D32A 1YQ4B 2K8CA 2AQ3B 4RF0A 4MSQB 1PYWD 3E56A 3U7ZA 4MGYE 3H6NA 1T0RC 4ZHPA 1XLPA 2NVUI 4AJWA 1MHHE 3ZJVA 2DENB 4AJYB 3BY4B 1LQBA 3H8HA 3L0WB 3U7DA 2N9XA 5IA7A 3A1QB 2JVCA 1XEEA 3I5JC 1V1PB 1C3TA 4LJPB 3L54A 3JW0X 2KN4A 3UGBB 1S3SG 3QIJA 3W1SA 4P1BC 2E6XA 3URYA 4YSXB 1E7VA 3C19A 4II2B 3NS8A 2KMCA 4LNNA 4YT0B 1FXAA 3MHZA 2N4FA 1RLFA 3W9CB 1OFFA 2L00B 3T8MA 2G4SA 2WYQA 4OVVA 4CYEA 3AECB 1L0YB 4W9EA 4RF1A 4GIVA 2WWZA 3R2IA 1XLNA 2WXQA 4ARCA 1PGXA 3Q6BA 2OOBB 3ZJTA 2IGGA 1E6EB 1E7PB 2FCMA 1FO4A 4US9A 2ON8A 4URKA 3A9KA 3MP9A 2UU7A 2K0PA 2LHEA 5J2RA 5E6PA 2LRUA 1Y56A 4MH8A 1V1PA 4DQOC 3ETRA 1TJEA 2PIAA 1E8XA 1M4VA 2KQSA 3RYTA 1TTNA 3ZO5B 1SB3C 4R3DA 3NG0A 1XD3B 3B1LX 1F0ZA 2JYTA 3IBEA 4CQNA 2BKRB 4DHZB 2GBRA 5HFYA 2VH1A 2BBCA 4KX6B 4CO7A 2HE7A 2L32A 4F8CB 1NI2A 1UGMA 4EOYA 4ZOHC 3I3TB 2JUOA 2V1YA 4G50A 3HRDD 1WMHB 5BO4B 2REXA 1JRPA 2HTHA 2C7MB 4ZRJA 4RGTA 3VRAB 4MH0E 4REZA 1SEBD 2KTRA 4W9FA 3L10B 3TSSA 5J18A 3P4RB 2C60A 2HDEA 1KLGD 5BYRA 3TCAA 4KGRA 3PSEB 4WWPA 4B0MA 3KVFB 4ZHOA 2VH2A 2PJHA 3WIMA 1KH0A 2JXXA 2DZKA 1IPGA 1E8WA 3AE1B 3A4RA 3B2GA 1V86A 2Z59B 1E8YA 1XLQA 4M0WA 2FCQA 5G5HA 2UYZB 3SU8X 2J0KA 3RFZB 2J4XA 4MGKE 1EM7A 2Z8LA 1E7UA 2YVCA 3P42A 5G5GA 4GSWA 4ANWA 1P0RA 2KFKA 3PZDA 2EMSA 2VRRB 1I42A 5CX3A 4G11A 2D2QA 2LGSA 1F2RC 2PVOD 1JALA 2RR9A 3RN9C 3ABVB 1T5XD 4MEMA 2K3UA 3IFWB 1GJZA 3N20C 1YQBA 4B6WA 1FD6A 3SDLC 4YTMB 2N9EB 2BS3B 2BS2B 3ZYYX 5FR3A 1KRHA 2Y5BB 1VRAB 2BGFA 4HROA 2ZCBA 4MGIE 4I6PA 1KLVA 1FRRA 5HHDG 2D3BA 3B08A 5JHAA 3DBHI 4RGOS 1ZDVA 2G3QB 4LNOA 3BINA 1IYFA 5EDSA 4NAWA 1LXDA 4W9LA 5D3DA 1C77A 2XEWA 1WGGA 2LMCA 3ZQ4A 3JSVB 4B95A 4A55A 3B2FA 2BB6A 4AS1A 2K6QA 4DHJB 2W82A 2BYFA 3Q2AC 3NZUA 1I4GA 1RFAA 4FXCA 4Q2JA 2V9HA 3N1XC 4DXAB 4OVZA 1EU4A 4A20A 1AN8A 4WQOB 3QARA 1TS4A 1QOFA 2JZPA 2B76B 3E9SA 3WAMA 4OVUA 2JX5A 1ZOYB 3R8BA 1HA5A 4N9F4 2KWVB 1GUAB 5CHWA 3PHXB 4MM3B 1WH3A 4TKNA 3CWIA 2RDBC 4MT5A 3QHTA 4KVGB 5IAAC 4GN1A 4II3B 4C7ZA 2DAJA 3P4QB 3MHSD 1QOAA 3QAQA 3ZTDA 3MJWA 1TS3A 2KK8A 2INCC 4EEWA 2D11A 4GU2A 3KWLA 1D3ZA 1RM6C 3GE8C 4QAYA 4USAA 1EU3A 4PS3A 2N0SB 2IJ0A 3WA0A 2VZKD 2BKFA 3X23A 2MP2B 2QSDA 2IO0B 5JHBA 1YJIA 1GC7A 2KQ7A 2QHOA 2KWCA 3N30A 4P1CC 2AX5A 3MTNB 3UQAA 3ZUNA 4AOFA 1WRDB 4XDDA 2KFJA 2AYOB 5FR6A 2WQYB 4OZCA 1YQ3B 3KUZA 1UUPA 4XWWA 1PGBA 2H88B 1HZ5A 3GZNB 3Q8EA 2M56B 3LYYA 3NY5A 2C7HA 2BYEA 3QWZB 3W1SC 3P2BA 4EUTA 4P6VF 5IO9A 3AE2B 2J7QB 4XZ4A 3L17A 1VZ8A 1D5XC 1QT9A 3SR6A 4MSMB 2DAFA 2KAJA 2LUEA 2AEHA 2ACZB 3ZNGC 4BBNF 1TZOA 4MDKE 1SE9A 3VTUA 1R4NI 5CTRC 2L3ZA 2KDEB 3Q3NC 1VCBA 4C7YA 2V3SA 3QK0A 3DBLB 1MI0A 1IGCA 2XN9C 5IKCM 4LDTB 4JIOU 1MJDA 2JWUA 4RH6A 5D2MB 4UDUC 3ZJUA 1HTQA 3UINB 1C4PA 2KLCA 5JH5C 4WWMA 2IBIB 3SEBA 3K9OB 5TR5A 1BXTA 3KUDB 1KTKA 4A3OA 2X8XX 3TMPB 1XXGA 2NPTA 2MH7A 1Q5WB 3Q8FA 1FPYA 3OLMD 2E3TA 2LGYA 3B0AA 2NBUA 3NUHB 3PZ7A 1YD8U 3BVGA 4XX5A 3RCZA 3HVDA 3NVWA 4MELA 1DYQA 1Z5SB 2CU3A 3AXCA 3HM6X 2WNMA 1GB4A
chains in the Genus database with same CATH topology
2MA9B 2DENB 3KYCD 1WR6E 3JYUA 3OJ3A 4AJYB 3Q3FA 3BY4B 1WGYA 3AI5A 1WJ6A 1LQBA 5DPWA 3L0WB 3U7DA 2BYVE 2N9XA 2NR2A 5IA7A 3O65B 2XBBC 3EECA 3RULA 2XK5A 1WX7A 3A1QB 3CF6E 3H9DA 5DPTA 2KNBA 2JVCA 2O6VB 4IM2A 3ZNID 1C3TA 2KWUB 2KOXA 2KFKB 3L54A 4LJPB 4W9HA 1XT9B 3JW0X 3V60A 4KDLB 3UGBB 3ZDMC 3PS6A 4WJPA 1WJUA 1S3SG 3QIJA 3PREA 2L05A 4IWOA 1H4RA 3W1SA 4EKUA 1P1AA 2LVPA 2MBQA 1WX9A 1WE7A 1E7VA 3QQ8B 2DHZA 4II2B 3NS8A 2KMCA 2ZVOA 1WXSA 1UELA 2KMAA 4B9KA 2N4FA 1RLFA 4GB9A 3KYDD 2MBBB 3WAOA 5D7GA 1Q0WB 3LDZE 2OJRA 2LRWA 2L00B 3T8MA 2G4SA 2WYQA 4KZCA 4F1SA 2XK5B 3A1QA 4OVVA 2N7DA 4CYEA 3RUIB 3JVZX 1WGDA 3L13A 5E6NA 2KTRB 4W9EA 2L0FA 2KZRA 3KUCB 4FBJB 1P98A 4GIVA 2WWZA 4XC2A 4WWOA 1CMXB 2KTFA 2FCSA 2R2OA 3IG3A 4NNJB 2M0XA 2N9PC 2OOBB 1QZEA 3WAPA 1V2YA 1KJTA 1V5OA 4DHZE 4GGQA 2FCMA 4CHKA 1L2NA 2RPQA 4URKA 3A9KA 2KC2A 4NQLB 3L08A 2IY0B 1RRBA 4KSLC 3VUYA 5J2RA 1J8CA 4M8NA 5E6PA 5G2NA 2LRUA 4BVUC 2M4NA 1GNUA 1UZXB 4WJOA 1I35A 2MX2A 2DZMA 1UD7A 1E90A 2KJHB 1E8XA 2DYOA 3DCGA 4KSKC 3ZNHB 3ZRCA 2LJ5A 2KQSA 2AL3A 2LASA 1M94A 1TTNA 2V4LA 4JL9A 3RYTA 3S2AA 1EO6A 2MBOA 1OGWA 2FIDA 3ZO5B 3PLUA 3AU4A 3DBSA 4X57B 3TBLD 1XD3B 3AULA 5KHQA 3B1LX 3PGEA 3H7PA 2KC1A 4I6LB 3IBEA 2PE6B 2NBVB 5AZFA 2BKRB 2KJRA 4MJSA 4IG7B 4DHZB 3PVLA 2GBRA 1V9JA 3HHMA 4IWPA 4F7ZA 2BWES 4CO7A 2JRHA 4KDIC 2HE7A 3EC8A 2O2VA 4F8CB 1WGRA 1OTRB 1NI2A 1UGMA 4EOYA 3I3TB 2JUOA 2G45B 2NBWB 4IWQA 2K6DB 4HCNB 2V1YA 2KANA 4G50A 1WMHB 3OJ4B 4EZLA 4KZ0A 2ZPYA 5J17A 1R4MI 3WANA 2K25A 5BO4B 4TQ0A 2REXA 2HTHA 2W9NA 2C7MB 1ZW7A 4HPMB 1T0YA 2GBKA 2D07B 4NJ6A 4ZRJA 2EKEC 2UWQA 4NAWB 4MH0E 2CS4A 2LXCA 3ZIMA 1WM3A 2ZEQA 4WJQA 2LWPA 3AU5A 1WY8A 2KTRA 1WGHA 2BPSA 4YL8A 2I1JA 2GBJA 4W9FA 3L10B 4NJ7A 2AWTA 2BWFA 3DVNV 3M63B 4W9KA 5D94A 4FJZA 4KV2A 4BKSD 5J18A 2O6VD 2C60A 2FNJB 3HM3A 4BBNC 2L0TA 3TCAA 3DBRI 3PSEB 3Q3JA 4WWPA 4IW0A 3V61A 3DQVA 3M95A 1RAXA 2IZVB 3KVFB 1A5RA 4TV3A 4DK5A 2MW5A 1WI0A 2PJHA 3PV1A 3ML8A 3WIMA 2JXXA 2DZKA 2IYDB 1IPGA 1EUVB 1E8WA 3A4RA 4HLEA 1V86A 2Z59B 2D3GA 1E8YA 3VFKA 3DVGY 2MQJA 2FCQA 2KVRA 2K8HA 1WX8A 2J0KA 2JRIB 2UYZB 5G55A 2ZVNA 3SU8X 3ZDTA 1TBEA 2DZIA 4MGKE 2GBNA 1ISNA 4ANVA 1WXAA 2DZJA 3DBLI 1E7UA 2YVCA 1WXMA 4G3XB 3APCA 2Z0DB 3K9PB 4GSWA 3UQBA 4PS7A 4ZDVA 4ANWA 1P0RA 2GBMA 2KFKA 3PZDA 2M17A 2EMSA 2ASQA 2CHZA 2KXJA 2BF8B 2VRRB 2PEAA 3QC8B 5CX3A 1I42A 3PRMB 4BOZB 3C0RB 1WM2A 4G11A 4GXBA 2D2QA 2O2VB 3A9KB 2NS5A 2JPHA 2RR9A 1YX5B 1H8CA 4FHJA 3OAWA 4FHKA 2JZ3B 2IO3B 4DBGA 2KX3A 4MEMA 4FA6A 3DPDA 3IFWB 4W9CA 1TGZB 1GJZA 3VUXA 4LJOB 5DPRA 1ZGUB 3ENEA 1YQBA 4B6WA 2MLBA 4BKTA 5LXIB 1NBFC 2CKHB 3GOEA 1V80A 4FULA 5JZEB 4ANUA 3UF8A 3SDLC 4HJKA 1SGHA 2N9EB 3UIPB 2CHWA 4DHJD 2MBEA 4IM0A 4EZJA 5C23A 5AEKB 3V6EB 4LCDE 3GZNI 2Y5BB 2BGFA 2JF5A 4M8MA 4NQKE 3TIXA 1NDDA 1G6JA 2ZCBA 5AZHA 1YX6B 1P3QU 3ONSA 4GDKB 4MGIE 4I6PA 3W1YA 2KO3A 2DYMA 1JRUA 1KLVA 3B08A 4WAAA 5JHAA 3DBHI 1KOTA 3VUWA 2G3QB 4M0WB 2YLMA 4ICUA 1WZ3A 4K7WA 3X0WA 1V5TA 2M1MA 5CHVC 3BINA 2CU1A 2CR5A 4FJVB 1IYFA 3DVNU 5EDSA 4NAWA 1LXDA 1Q1OA 2LVQA 4W9LA 2ZPNA 4HWIB 2XEWA 1GC6A 1WGGA 2KX0A 4HDOA 2D10A 3LJ3A 2KN5A 3APDA 3JSVB 4ZRIA 4B95A 2IO2B 2K6QA 5AZGA 5DPSA 4DHJB 3VH3B 1Y8RC 2BYFA 2N1WA 1OEYJ 2KHWB 2LVOA 3ALBA 3N32A 3SD5A 3NZUA 5L83A 3T9LA 3DOWA 1WIAA 1RFAA 4ICVA 3PRZA 2IY1B 3EHVA 2MP2A 1HE8A 1WF9A 2Z0EB 3QA8A 5CHFA 4ZYNA 3QJZA 4DXAB 4A20A 2LZ6A 3RZWC 4WQOB 3QARA 4RM9A 1J0GA 2JWZA 1WXVA 1GG3A 4W9JA 4W9GA 2CHXA 4KIKA 3VXWA 3WAMA 4ASWC 2J0JA 2DX5B 4PYZA 4OVUA 4HDQA 1TZ1A 3ZW3A 1WFYA 4TQ1A 4E74A 4N9F4 2RSUA 2KWVB 2NCNA 1GUAB 5CHWA 4G0NB 2NPTB 3PHXB 1WH3A 1OEYA 3A4SC 3NZSA 4LDTD 4TKNA 2WX0A 2A4ZA 3SHQA 3QHTA 4KVGB 1IP9A 5IAAC 1K8RB 4GN1A 2JY6A 4II3B 2C5LC 2DAJA 2M8SA 1UBQA 3MHSD 3A9JB 2A5UA 2HD5B 2KDBA 3R66C 2FAZA 2N7EA 5L95C 4BKSA 2ZCCA 3QAQA 3ZTDA 4WJNA 3MJWA 4HVBA 2EMTA 3H1UA 2KK8A 1MG8A 3U30A 1EF1A 3PT2B 5E6OA 3QCAA 3M62B 4AWJA 4GDLA 4EEWA 3A9JA 3PRPB 2D11A 3IVFA 2L7RA 4GU2A 1P9DU 2J0MA 1D3ZA 1L7YA 5GMVA 5DCNA 5KHOA 2G4DB 3APFA 1LFDA 2LGXA 1LM8B 2IO1B 4PS3A 3X23A 1Z2MA 1WR1A 3WA0A 2BKFA 2MP2B 3L16A 2IO0B 5JHBA 3KW5B 4I6NB 1GC7A 2O6VA 1ZKHA 3NHEB 1WE6A 2KQ7A 2QHOA 2KWCA 3M3JA 1VD2A 2I1KA 3N30A 4IUMB 4KIKB 4RM8A 3MTNB 3UQAA 2K1FA 3CSTA 3ZUNA 4IC7B 3VAWA 4GMVA 3VH4B 4AOFA 2WDTB 1V6EA 1WRDB 3H7PB 2KFJA 1C1YB 2AYOB 2PPHA 5FR6A 3RT3B 1E5WA 3ML9A 3A33B 4DDGD 3CMMB 4GDLB 2LD9A 3ZRFA 3ECIA 4AP4C 3KUZA 1SIFA 3PLVA 2ZZPB 2LI5A 1WJ4A 3TJPA 2MCNB 3ZKJC 3ZVVA 1BT0A 3HK0A 2GOWA 3NY5A 2C7HA 2MBHA 4K7UA 2BYEA 3PTFC 5D6JB 3QWZB 3W1SC 2C9WB 2L8JA 2MRPA 3P2BA 2KD0A 4EUTA 4K1RB 1WMHA 4ANXA 4GDKA 3PHWB 4JLCA 2JT4B 4FADA 2J7QB 2C7NB 2GMIC 3QX1A 4XZ4A 1WYWB 3ZNZB 3VTVA 3L17A 2ZJDA 1FXTB 4HXDA 4BKGA 2HJ8A 2KKCA 2FCNA 3V6CB 4DWFA 5HKHA 1WJNA 4FJYA 4MSMB 2N1VA 3VQIA 4WWNA 1UBIA 1X1MA 4TUUA 2DAFA 2FUHB 4HCPB 2K8BA 2LUEA 2ZNVB 2AEHA 4BFRA 2R2QA 3ZNGC 3RD2A 4BBNF 4MDKE 4NY0A 1J19A 3DVGX 1UH6A 1F9JA 2K39A 1SE9A 5C1ZA 3VTUA 1R4NI 2RGFA 5CTRC 2L3ZA 4RMAA 4W9IA 2KDEB 3R3MA 4HPLB 3KH0A 3VTWA 1VCBA 2ZNVC 4ZRKA 2V3SA 4W9DA 1U4AA 5LXHA 3QK0A 2WX1A 1AARA 2KJ6A 1XQQA 3N3KB 1S1QB 2AL6A 2L76A 4LDTB 4PS8A 2JZZA 4JIOU 3IHPC 1V49A 4FN2A 3ZTCA 2RD0A 5D2MB 3TL5A 1YJ1A 2LGDA 1KM7A 1YIWA 4DDID 3EFUA 3JSVA 4AUQC 3UINB 3PPAA 2B3AA 4J6IA 3DDCB 3R7RA 1EF5A 2KLCA 5JH5C 1OQYA 3H7SA 4P7IA 4HK2A 2IBIB 4EZKA 1PQSA 3VDZA 3VHTC 3K9OB 3R7QA 5TR5A 3KUDB 4A3PA 4BOSC 3U8ZA 2PE9A 4A3OA 4K81A 2KDIA 3TMPB 3D32A 4NPNA 2KDFB 2K8CA 2NPTA 4JGHB 1Q5WB 3RZFA 1WZ0A 2FIFA 4EFOA 1V81A 3OLMD 3VVWB 4GOCA 3UIOB 4MSQB 4FLHA 2LGYA 4MM3A 3B0AA 3ZLZA 2NBUA 4MGYE 4MGZE 1YD8U 3HIZA 3V62A 3WALA 2LXAA 3H6NA 4IM3A 4K7SA 4XX5A 2MWSB 3NOBA 1E8ZA 3CSFA 5LLIA 3RCZA 4E3CA 4MELA 1Z5SB 2MSED 2DYBA 2NVUI 4JQWC 4PYUA 3AXCA 4MJSB 4AJWA 3HM6X 4E71A 2KLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MA9 B;  2DEN B;  3KYC D;  1WR6 E;  3JYU A;  3OJ3 A;  4AJY B;  3Q3F A;  3BY4 B;  1WGY A;  3AI5 A;  1WJ6 A;  1LQB A;  5DPW A;  3L0W B;  3U7D A;  2BYV E;  2N9X A;  2NR2 A;  5IA7 A;  3O65 B;  2XBB C;  3EEC A;  3RUL A;  2XK5 A;  1WX7 A;  3A1Q B;  3CF6 E;  3H9D A;  5DPT A;  2KNB A;  2JVC A;  2O6V B;  4IM2 A;  3ZNI D;  1C3T A;  2KWU B;  2KOX A;  2KFK B;  3L54 A;  4LJP B;  4W9H A;  1XT9 B;  3JW0 X;  3V60 A;  4KDL B;  3UGB B;  3ZDM C;  3PS6 A;  4WJP A;  1WJU A;  1S3S G;  3QIJ A;  3PRE A;  2L05 A;  4IWO A;  1H4R A;  3W1S A;  4EKU A;  1P1A A;  2LVP A;  2MBQ A;  1WX9 A;  1WE7 A;  1E7V A;  3QQ8 B;  2DHZ A;  4II2 B;  3NS8 A;  2KMC A;  2ZVO A;  1WXS A;  1UEL A;  2KMA A;  4B9K A;  2N4F A;  1RLF A;  4GB9 A;  3KYD D;  2MBB B;  3WAO A;  5D7G A;  1Q0W B;  3LDZ E;  2OJR A;  2LRW A;  2L00 B;  3T8M A;  2G4S A;  2WYQ A;  4KZC A;  4F1S A;  2XK5 B;  3A1Q A;  4OVV A;  2N7D A;  4CYE A;  3RUI B;  3JVZ X;  1WGD A;  3L13 A;  5E6N A;  2KTR B;  4W9E A;  2L0F A;  2KZR A;  3KUC B;  4FBJ B;  1P98 A;  4GIV A;  2WWZ A;  4XC2 A;  4WWO A;  1CMX B;  2KTF A;  2FCS A;  2R2O A;  3IG3 A;  4NNJ B;  2M0X A;  2N9P C;  2OOB B;  1QZE A;  3WAP A;  1V2Y A;  1KJT A;  1V5O A;  4DHZ E;  4GGQ A;  2FCM A;  4CHK A;  1L2N A;  2RPQ A;  4URK A;  3A9K A;  2KC2 A;  4NQL B;  3L08 A;  2IY0 B;  1RRB A;  4KSL C;  3VUY A;  5J2R A;  1J8C A;  4M8N A;  5E6P A;  5G2N A;  2LRU A;  4BVU C;  2M4N A;  1GNU A;  1UZX B;  4WJO A;  1I35 A;  2MX2 A;  2DZM A;  1UD7 A;  1E90 A;  2KJH B;  1E8X A;  2DYO A;  3DCG A;  4KSK C;  3ZNH B;  3ZRC A;  2LJ5 A;  2KQS A;  2AL3 A;  2LAS A;  1M94 A;  1TTN A;  2V4L A;  4JL9 A;  3RYT A;  3S2A A;  1EO6 A;  2MBO A;  1OGW A;  2FID A;  3ZO5 B;  3PLU A;  3AU4 A;  3DBS A;  4X57 B;  3TBL D;  1XD3 B;  3AUL A;  5KHQ A;  3B1L X;  3PGE A;  3H7P A;  2KC1 A;  4I6L B;  3IBE A;  2PE6 B;  2NBV B;  5AZF A;  2BKR B;  2KJR A;  4MJS A;  4IG7 B;  4DHZ B;  3PVL A;  2GBR A;  1V9J A;  3HHM A;  4IWP A;  4F7Z A;  2BWE S;  4CO7 A;  2JRH A;  4KDI C;  2HE7 A;  3EC8 A;  2O2V A;  4F8C B;  1WGR A;  1OTR B;  1NI2 A;  1UGM A;  4EOY A;  3I3T B;  2JUO A;  2G45 B;  2NBW B;  4IWQ A;  2K6D B;  4HCN B;  2V1Y A;  2KAN A;  4G50 A;  1WMH B;  3OJ4 B;  4EZL A;  4KZ0 A;  2ZPY A;  5J17 A;  1R4M I;  3WAN A;  2K25 A;  5BO4 B;  4TQ0 A;  2REX A;  2HTH A;  2W9N A;  2C7M B;  1ZW7 A;  4HPM B;  1T0Y A;  2GBK A;  2D07 B;  4NJ6 A;  4ZRJ A;  2EKE C;  2UWQ A;  4NAW B;  4MH0 E;  2CS4 A;  2LXC A;  3ZIM A;  1WM3 A;  2ZEQ A;  4WJQ A;  2LWP A;  3AU5 A;  1WY8 A;  2KTR A;  1WGH A;  2BPS A;  4YL8 A;  2I1J A;  2GBJ A;  4W9F A;  3L10 B;  4NJ7 A;  2AWT A;  2BWF A;  3DVN V;  3M63 B;  4W9K A;  5D94 A;  4FJZ A;  4KV2 A;  4BKS D;  5J18 A;  2O6V D;  2C60 A;  2FNJ B;  3HM3 A;  4BBN C;  2L0T A;  3TCA A;  3DBR I;  3PSE B;  3Q3J A;  4WWP A;  4IW0 A;  3V61 A;  3DQV A;  3M95 A;  1RAX A;  2IZV B;  3KVF B;  1A5R A;  4TV3 A;  4DK5 A;  2MW5 A;  1WI0 A;  2PJH A;  3PV1 A;  3ML8 A;  3WIM A;  2JXX A;  2DZK A;  2IYD B;  1IPG A;  1EUV B;  1E8W A;  3A4R A;  4HLE A;  1V86 A;  2Z59 B;  2D3G A;  1E8Y A;  3VFK A;  3DVG Y;  2MQJ A;  2FCQ A;  2KVR A;  2K8H A;  1WX8 A;  2J0K A;  2JRI B;  2UYZ B;  5G55 A;  2ZVN A;  3SU8 X;  3ZDT A;  1TBE A;  2DZI A;  4MGK E;  2GBN A;  1ISN A;  4ANV A;  1WXA A;  2DZJ A;  3DBL I;  1E7U A;  2YVC A;  1WXM A;  4G3X B;  3APC A;  2Z0D B;  3K9P B;  4GSW A;  3UQB A;  4PS7 A;  4ZDV A;  4ANW A;  1P0R A;  2GBM A;  2KFK A;  3PZD A;  2M17 A;  2EMS A;  2ASQ A;  2CHZ A;  2KXJ A;  2BF8 B;  2VRR B;  2PEA A;  3QC8 B;  5CX3 A;  1I42 A;  3PRM B;  4BOZ B;  3C0R B;  1WM2 A;  4G11 A;  4GXB A;  2D2Q A;  2O2V B;  3A9K B;  2NS5 A;  2JPH A;  2RR9 A;  1YX5 B;  1H8C A;  4FHJ A;  3OAW A;  4FHK A;  2JZ3 B;  2IO3 B;  4DBG A;  2KX3 A;  4MEM A;  4FA6 A;  3DPD A;  3IFW B;  4W9C A;  1TGZ B;  1GJZ A;  3VUX A;  4LJO B;  5DPR A;  1ZGU B;  3ENE A;  1YQB A;  4B6W A;  2MLB A;  4BKT A;  5LXI B;  1NBF C;  2CKH B;  3GOE A;  1V80 A;  4FUL A;  5JZE B;  4ANU A;  3UF8 A;  3SDL C;  4HJK A;  1SGH A;  2N9E B;  3UIP B;  2CHW A;  4DHJ D;  2MBE A;  4IM0 A;  4EZJ A;  5C23 A;  5AEK B;  3V6E B;  4LCD E;  3GZN I;  2Y5B B;  2BGF A;  2JF5 A;  4M8M A;  4NQK E;  3TIX A;  1NDD A;  1G6J A;  2ZCB A;  5AZH A;  1YX6 B;  1P3Q U;  3ONS A;  4GDK B;  4MGI E;  4I6P A;  3W1Y A;  2KO3 A;  2DYM A;  1JRU A;  1KLV A;  3B08 A;  4WAA A;  5JHA A;  3DBH I;  1KOT A;  3VUW A;  2G3Q B;  4M0W B;  2YLM A;  4ICU A;  1WZ3 A;  4K7W A;  3X0W A;  1V5T A;  2M1M A;  5CHV C;  3BIN A;  2CU1 A;  2CR5 A;  4FJV B;  1IYF A;  3DVN U;  5EDS A;  4NAW A;  1LXD A;  1Q1O A;  2LVQ A;  4W9L A;  2ZPN A;  4HWI B;  2XEW A;  1GC6 A;  1WGG A;  2KX0 A;  4HDO A;  2D10 A;  3LJ3 A;  2KN5 A;  3APD A;  3JSV B;  4ZRI A;  4B95 A;  2IO2 B;  2K6Q A;  5AZG A;  5DPS A;  4DHJ B;  3VH3 B;  1Y8R C;  2BYF A;  2N1W A;  1OEY J;  2KHW B;  2LVO A;  3ALB A;  3N32 A;  3SD5 A;  3NZU A;  5L83 A;  3T9L A;  3DOW A;  1WIA A;  1RFA A;  4ICV A;  3PRZ A;  2IY1 B;  3EHV A;  2MP2 A;  1HE8 A;  1WF9 A;  2Z0E B;  3QA8 A;  5CHF A;  4ZYN A;  3QJZ A;  4DXA B;  4A20 A;  2LZ6 A;  3RZW C;  4WQO B;  3QAR A;  4RM9 A;  1J0G A;  2JWZ A;  1WXV A;  1GG3 A;  4W9J A;  4W9G A;  2CHX A;  4KIK A;  3VXW A;  3WAM A;  4ASW C;  2J0J A;  2DX5 B;  4PYZ A;  4OVU A;  4HDQ A;  1TZ1 A;  3ZW3 A;  1WFY A;  4TQ1 A;  4E74 A;  4N9F 4;  2RSU A;  2KWV B;  2NCN A;  1GUA B;  5CHW A;  4G0N B;  2NPT B;  3PHX B;  1WH3 A;  1OEY A;  3A4S C;  3NZS A;  4LDT D;  4TKN A;  2WX0 A;  2A4Z A;  3SHQ A;  3QHT A;  4KVG B;  1IP9 A;  5IAA C;  1K8R B;  4GN1 A;  2JY6 A;  4II3 B;  2C5L C;  2DAJ A;  2M8S A;  1UBQ A;  3MHS D;  3A9J B;  2A5U A;  2HD5 B;  2KDB A;  3R66 C;  2FAZ A;  2N7E A;  5L95 C;  4BKS A;  2ZCC A;  3QAQ A;  3ZTD A;  4WJN A;  3MJW A;  4HVB A;  2EMT A;  3H1U A;  2KK8 A;  1MG8 A;  3U30 A;  1EF1 A;  3PT2 B;  5E6O A;  3QCA A;  3M62 B;  4AWJ A;  4GDL A;  4EEW A;  3A9J A;  3PRP B;  2D11 A;  3IVF A;  2L7R A;  4GU2 A;  1P9D U;  2J0M A;  1D3Z A;  1L7Y A;  5GMV A;  5DCN A;  5KHO A;  2G4D B;  3APF A;  1LFD A;  2LGX A;  1LM8 B;  2IO1 B;  4PS3 A;  3X23 A;  1Z2M A;  1WR1 A;  3WA0 A;  2BKF A;  2MP2 B;  3L16 A;  2IO0 B;  5JHB A;  3KW5 B;  4I6N B;  1GC7 A;  2O6V A;  1ZKH A;  3NHE B;  1WE6 A;  2KQ7 A;  2QHO A;  2KWC A;  3M3J A;  1VD2 A;  2I1K A;  3N30 A;  4IUM B;  4KIK B;  4RM8 A;  3MTN B;  3UQA A;  2K1F A;  3CST A;  3ZUN A;  4IC7 B;  3VAW A;  4GMV A;  3VH4 B;  4AOF A;  2WDT B;  1V6E A;  1WRD B;  3H7P B;  2KFJ A;  1C1Y B;  2AYO B;  2PPH A;  5FR6 A;  3RT3 B;  1E5W A;  3ML9 A;  3A33 B;  4DDG D;  3CMM B;  4GDL B;  2LD9 A;  3ZRF A;  3ECI A;  4AP4 C;  3KUZ A;  1SIF A;  3PLV A;  2ZZP B;  2LI5 A;  1WJ4 A;  3TJP A;  2MCN B;  3ZKJ C;  3ZVV A;  1BT0 A;  3HK0 A;  2GOW A;  3NY5 A;  2C7H A;  2MBH A;  4K7U A;  2BYE A;  3PTF C;  5D6J B;  3QWZ B;  3W1S C;  2C9W B;  2L8J A;  2MRP A;  3P2B A;  2KD0 A;  4EUT A;  4K1R B;  1WMH A;  4ANX A;  4GDK A;  3PHW B;  4JLC A;  2JT4 B;  4FAD A;  2J7Q B;  2C7N B;  2GMI C;  3QX1 A;  4XZ4 A;  1WYW B;  3ZNZ B;  3VTV A;  3L17 A;  2ZJD A;  1FXT B;  4HXD A;  4BKG A;  2HJ8 A;  2KKC A;  2FCN A;  3V6C B;  4DWF A;  5HKH A;  1WJN A;  4FJY A;  4MSM B;  2N1V A;  3VQI A;  4WWN A;  1UBI A;  1X1M A;  4TUU A;  2DAF A;  2FUH B;  4HCP B;  2K8B A;  2LUE A;  2ZNV B;  2AEH A;  4BFR A;  2R2Q A;  3ZNG C;  3RD2 A;  4BBN F;  4MDK E;  4NY0 A;  1J19 A;  3DVG X;  1UH6 A;  1F9J A;  2K39 A;  1SE9 A;  5C1Z A;  3VTU A;  1R4N I;  2RGF A;  5CTR C;  2L3Z A;  4RMA A;  4W9I A;  2KDE B;  3R3M A;  4HPL B;  3KH0 A;  3VTW A;  1VCB A;  2ZNV C;  4ZRK A;  2V3S A;  4W9D A;  1U4A A;  5LXH A;  3QK0 A;  2WX1 A;  1AAR A;  2KJ6 A;  1XQQ A;  3N3K B;  1S1Q B;  2AL6 A;  2L76 A;  4LDT B;  4PS8 A;  2JZZ A;  4JIO U;  3IHP C;  1V49 A;  4FN2 A;  3ZTC A;  2RD0 A;  5D2M B;  3TL5 A;  1YJ1 A;  2LGD A;  1KM7 A;  1YIW A;  4DDI D;  3EFU A;  3JSV A;  4AUQ C;  3UIN B;  3PPA A;  2B3A A;  4J6I A;  3DDC B;  3R7R A;  1EF5 A;  2KLC A;  5JH5 C;  1OQY A;  3H7S A;  4P7I A;  4HK2 A;  2IBI B;  4EZK A;  1PQS A;  3VDZ A;  3VHT C;  3K9O B;  3R7Q A;  5TR5 A;  3KUD B;  4A3P A;  4BOS C;  3U8Z A;  2PE9 A;  4A3O A;  4K81 A;  2KDI A;  3TMP B;  3D32 A;  4NPN A;  2KDF B;  2K8C A;  2NPT A;  4JGH B;  1Q5W B;  3RZF A;  1WZ0 A;  2FIF A;  4EFO A;  1V81 A;  3OLM D;  3VVW B;  4GOC A;  3UIO B;  4MSQ B;  4FLH A;  2LGY A;  4MM3 A;  3B0A A;  3ZLZ A;  2NBU A;  4MGY E;  4MGZ E;  1YD8 U;  3HIZ A;  3V62 A;  3WAL A;  2LXA A;  3H6N A;  4IM3 A;  4K7S A;  4XX5 A;  2MWS B;  3NOB A;  1E8Z A;  3CSF A;  5LLI A;  3RCZ A;  4E3C A;  4MEL A;  1Z5S B;  2MSE D;  2DYB A;  2NVU I;  4JQW C;  4PYU A;  3AXC A;  4MJS B;  4AJW A;  3HM6 X;  4E71 A;  2KLG A; 
#chains in the Genus database with same CATH topology
 3AEB B;  3RMK C;  3AI5 A;  1WJ6 A;  1GOZ A;  1KFY B;  2NR2 A;  1STE A;  2XBB C;  1FCC C;  3EEC A;  1P7F A;  3DHH C;  4LTU A;  1JWS D;  5DPT A;  3ZNI D;  4W9H A;  1XT9 B;  4KDL B;  1WJU A;  2HTM E;  4IWO A;  1QIL A;  1P1A A;  1N60 A;  2DHZ A;  3AE6 B;  2ZVO A;  1UEL A;  4JWU C;  4GB9 A;  3AEA B;  1MPE A;  2MBB B;  4KKJ A;  5D7G A;  2LRW A;  4H2A A;  4JE3 B;  3A1Q A;  2N7D A;  3L13 A;  1WGD A;  2KTR B;  2L0F A;  2WHI A;  4WUR A;  2R2O A;  3IG3 A;  2M0X A;  1N5W A;  1QZE A;  1E9M A;  1V2Y A;  1QKZ A;  1KJT A;  2KT7 A;  4GGQ A;  4J3O D;  1L2N A;  1TS2 A;  1K53 A;  2PVG C;  4NQL B;  3L08 A;  1UWX A;  2IY0 B;  3VUY A;  2KDM A;  1J8C A;  4XGA B;  2M4N A;  1UGJ A;  3GS2 A;  3P63 A;  4WJO A;  1I35 A;  2MX2 A;  5EE3 A;  2PMV A;  3UI3 A;  1UD7 A;  4KSK C;  4JL9 A;  2V4L A;  2MBO A;  4NAM A;  4WH4 A;  4GLS C;  3TBL D;  3AUL A;  3H7P A;  5AZF A;  4MJS A;  4IG7 B;  2I2Y A;  1V9J A;  4F7Z A;  2WXJ A;  1EWY C;  2LGI A;  2BTE A;  1C4C A;  2G45 B;  2DNF A;  2K6D B;  3FIL B;  3FAH A;  2WXN A;  4KZ0 A;  1R4M I;  2YEP F;  1ZW7 A;  1D5M C;  2WXO A;  1T0Y A;  1TKE A;  4NAW B;  2AQ2 B;  4C4V B;  2LXC A;  1AW7 A;  1B1Z A;  3P1M A;  2HJ1 A;  2QDF A;  2BPS A;  4NJC A;  2BWF A;  1DOX A;  3M63 B;  1TIF A;  1B9R A;  4KV2 A;  2FNJ B;  1FMA D;  2H89 B;  4L23 A;  3DBR I;  3V61 A;  1JWB D;  1K51 A;  2IZV B;  1A5R A;  2MW5 A;  1WI0 A;  3PV1 A;  4M02 A;  2IYD B;  1KF6 B;  3W5U B;  1JML A;  2PTL A;  3RNG C;  2M19 A;  3U2S C;  2KVR A;  2JRI B;  3ZDT A;  2K5P A;  2GBN A;  1WXA A;  4LK0 M;  3DBL I;  4XWT A;  2SAK A;  4PT5 A;  4YSY B;  5BMG A;  1YJJ A;  1ZP0 B;  2Z0D B;  3K9P B;  3BVZ A;  4ZDV A;  2M17 A;  2ASQ A;  2PEA A;  4P16 A;  4C80 A;  1YX5 B;  4JPS A;  4DBG A;  4FA6 A;  4W9C A;  3VUX A;  1N61 A;  3GP7 A;  4RGN A;  4BKT A;  1L0X B;  2LHD A;  2CKH B;  3GOE A;  5JZE B;  1WXQ A;  4HJK A;  1SGH A;  1WSP A;  3AE8 B;  3U4E G;  3UIP B;  2MBE A;  4EZJ A;  4C4V A;  1J7B A;  3GZN I;  1N63 A;  2JF5 A;  4M8M A;  1R4M B;  1NDD A;  1G6J A;  1MVK A;  2DYM A;  2LJI A;  1JRU A;  2MJE A;  3NJT A;  1KOT A;  1T0Q C;  2GRI A;  3Q69 A;  4ICU A;  3X0W A;  2M1M A;  3AE3 B;  3GE3 C;  3RNE C;  4HDO A;  4EE2 A;  3IXS A;  3IAS 1;  5DPS A;  2KHW B;  2LVO A;  1GAQ B;  3ALB A;  1L0V B;  2WXI A;  3N32 A;  5L83 A;  1MHX A;  4ICV A;  3EHV A;  5H92 C;  2MP2 A;  2RDH A;  1C76 A;  1QOG A;  1DOY A;  2TSS A;  4HJG E;  2NTT A;  1EWC A;  4RGM A;  2LZ6 A;  3RZW C;  1WGK A;  2YEP B;  1Q10 A;  1WXV A;  2MJD A;  2QJL A;  2CHX A;  3DHI C;  4PYZ A;  2DX5 B;  3ZW3 A;  4E74 A;  2RSU A;  3ZXV A;  2NPT B;  2WX0 A;  1K8R B;  2JY6 A;  2M8S A;  2G1E A;  3A9J B;  2KDB A;  3R66 C;  2FAZ A;  2N7E A;  5BMH A;  5L95 C;  4WJN A;  4HVB A;  2EMT A;  3H1U A;  3TEY A;  1MG8 A;  4HRS A;  4GDL A;  2L7R A;  1P9D U;  2QMT A;  1L7Y A;  1LFD A;  2LGX A;  3AEG B;  1LM8 B;  3BWU D;  2IO1 B;  1Z2M A;  1WR1 A;  3L16 A;  1YN4 A;  3V3X A;  2CJN A;  2D3A A;  3KW5 B;  1ZKH A;  3NHE B;  1WE6 A;  1ZPS A;  1VD2 A;  2I1K A;  5BYQ A;  4IUM B;  4IC7 B;  4GMV A;  1V6E A;  1C1Y B;  1E5W A;  2Y5C A;  4DDG D;  4GDL B;  2LD9 A;  3ZRF A;  1QQR A;  5GXG B;  3PLV A;  4A90 A;  1L6U A;  4A8X C;  2ZZP B;  2BQQ A;  2GOW A;  3NZ3 A;  1N6Z A;  4JLC A;  4FAD A;  3QX1 A;  3RNB C;  2ZJD A;  1FXT B;  2VZK B;  2WXL A;  2KKC A;  3P4P B;  3IT6 B;  4DWF A;  1WJN A;  4WWN A;  3CIR B;  2FUH B;  2K8B A;  4S0R A;  5E6J A;  4NY0 A;  3DVG X;  5C3J B;  2K39 A;  1TT5 B;  4YWG G;  1FNV A;  4KGT A;  3VTW A;  3KH0 A;  4O1N A;  1N5X A;  1NI3 A;  2W3R A;  3Q3M C;  2ZNV C;  4ZRK A;  2WLB A;  4W9D A;  4B0E A;  1U4A A;  3RI7 C;  3Q3O C;  3AN1 A;  2V3P A;  2AL6 A;  4PS8 A;  3DHG C;  3IHP C;  2WXP A;  1T0S C;  2IGD A;  4AQ7 A;  3PZ8 A;  2LGD A;  1YIW A;  3EFU A;  1P7E A;  4AUQ C;  3P4S B;  2B3A A;  3BII D;  3W5V B;  4P7I A;  2K22 A;  4HK2 A;  2RPV A;  1GB1 A;  4EZK A;  3VDZ A;  3R7Q A;  4K81 A;  2KDI A;  4NPN A;  3N1Z C;  2KAC A;  2IND C;  1V81 A;  4MM3 A;  2INN E;  4MGZ E;  3HIZ A;  3V62 A;  2DWQ A;  4LLG M;  4KGS A;  2OED A;  4YTP B;  2DYB A;  4PYU A;  5H8Y E;  4K3C A;  4E71 A;  2ZW0 A;  2KLG A;  2MA9 B;  3OJ3 A;  1CQV A;  2IPK D;  1ZUD 2;  2Q5W D;  2XK5 A;  1WX7 A;  3CF6 E;  3H9D A;  2KNB A;  2KWU B;  4BZA A;  1I7H A;  3ZXR A;  3ZDM C;  4WJP A;  2L05 A;  2W55 A;  3ZGZ A;  2MBQ A;  1F2R I;  3DBH B;  2LUM A;  3QQ8 B;  1WE7 A;  2KMA A;  1L4Z B;  1Q0W B;  3LDZ E;  2OJR A;  2PKO A;  2KVZ A;  5IOI A;  2JSV X;  4US8 A;  2FUG 1;  3RUI B;  3JVZ X;  2K9X A;  5E6N A;  1JW9 D;  4FBJ B;  3KUC B;  4TSS A;  1CMX B;  2FCS A;  1C4A A;  2N9P C;  1PDX A;  1JCK B;  3WAP A;  1V5O A;  4CHK A;  1I4H A;  1GPX A;  1PFD A;  2KC2 A;  1K52 A;  4N59 A;  2D5G A;  1T6B X;  2WXG A;  5G2N A;  1R7S A;  4JX1 C;  3NVY A;  2JU6 X;  1GNU A;  4RCO A;  2KJH B;  3DCG A;  4M01 A;  3ZRC A;  3W2D A;  2AL3 A;  2LAS A;  5FKA C;  3N1Y C;  1RYJ A;  3EGR A;  1HQR D;  2R61 A;  4MAC A;  1OGW A;  2FID A;  3AU4 A;  3DBS A;  4HKQ A;  4OZA A;  4I6L B;  2KMM A;  2XNA C;  2GLS A;  2KJR A;  1TY2 A;  3V05 A;  2BWE S;  2ONQ A;  4KDI C;  3EC8 A;  2FE8 A;  1SBB B;  1OTR B;  3IT4 B;  2N9K A;  2NBW B;  3AEF B;  3RNA C;  5BMI A;  4HCN B;  2KAN A;  3OJ4 B;  1A70 A;  2BW2 A;  2K25 A;  1QLB B;  2W9N A;  2L52 A;  2D07 B;  4NJ6 A;  2EKE C;  1WWT A;  1I4Q A;  1HTO A;  3Q8A A;  3ZIM A;  2ZEQ A;  2LWP A;  1WY8 A;  4ZRP A;  1WGH A;  1BUI C;  2GBJ A;  2I1J A;  1KLU D;  4ARI A;  5D94 A;  4BKS D;  2O6V D;  3MC8 A;  1JQ4 A;  4BBN C;  2L0T A;  4IW0 A;  3DQV A;  4DK5 A;  1EUV B;  5HI1 A;  4HLE A;  2D3G A;  1UNS A;  3DVG Y;  1WX8 A;  2ZVN A;  1TBE A;  2DZI A;  4ANV A;  2WDQ B;  1WXM A;  3AE4 B;  3APC A;  1V1O A;  3UQB A;  2GBM A;  2BF8 B;  3QC8 B;  1L4D B;  3PRM B;  3DWG C;  3C0R B;  4BOZ B;  1VZ6 A;  4GXB A;  3A9K B;  4TMA B;  1H8C A;  4FHJ A;  2KX3 A;  1AWD A;  1C9F A;  4LJO B;  2M0A A;  4C00 A;  1ZGU B;  3ENE A;  2MLB A;  1LO5 D;  1NBF C;  1I4X A;  1V80 A;  4ANU A;  2WXR A;  3AE9 B;  4IM0 A;  1NEK B;  2Y5P A;  2ICI A;  4BAX A;  3V6E B;  4LCD E;  4IDI A;  3OWE B;  2OHF A;  2IDY A;  4OW0 A;  3BK1 A;  1WYG A;  1YX6 B;  1P3Q U;  2KQ4 X;  2LFI A;  2QIL A;  4WAA A;  3VUW A;  1HXY D;  1WZ3 A;  4K7W A;  1V5T A;  5CHV C;  2CU1 A;  2CR5 A;  4FJV B;  1Q1O A;  1N62 A;  4HWI B;  2J42 A;  2DLB A;  3HUI A;  5IN7 A;  2WDR B;  4N6E B;  3AE7 B;  3LJ3 A;  1C78 A;  1Y8R C;  2N1W A;  3AM9 A;  3SD5 A;  2V3N A;  3DOW A;  4K3B A;  3PRZ A;  5I4D A;  2G9H D;  3GB1 A;  1HE8 A;  1WF9 A;  3QJZ A;  5AUI A;  1T3Q A;  1C79 A;  3AMZ A;  3NRZ A;  1HZ6 A;  4W9G A;  4C56 C;  3VRB B;  4KIK A;  1NVI D;  4ASW C;  4HDQ A;  1TZ1 A;  1WFY A;  3U52 E;  2NCN A;  1J7A A;  4IOI E;  1DGJ A;  3A4S C;  1OEY A;  3NZS A;  4LDT D;  5IP4 D;  2C5L C;  4XE0 A;  1UBQ A;  1E10 A;  2HD5 B;  4BKS A;  1NYR A;  2ZCC A;  1UF0 A;  1IBX A;  2GI9 A;  4WAF A;  4ACF A;  3U30 A;  1EF1 A;  3NVV A;  3NVZ A;  3Q8B A;  1SJE D;  3AB5 A;  5DCN A;  5KHO A;  2G4D B;  3EFC A;  1V8C A;  4IKG A;  4XYC A;  1TKG A;  4KIK B;  4RM8 A;  2K1F A;  3CST A;  3VAW A;  2OJW A;  1FXI A;  1F1H A;  3ML9 A;  3A33 B;  1SSN A;  1PUT A;  4L2Y A;  1E0Z A;  1D4B A;  1SIF A;  3TJP A;  1BT0 A;  1F77 A;  3HK0 A;  5D6J B;  2C9W B;  2MRP A;  4K1R B;  1WMH A;  4ANX A;  4GDK A;  2MEK A;  2C7N B;  1FFU A;  4JWS C;  1WYW B;  4BKG A;  3VTV A;  4HXD A;  4YSZ B;  5EE9 A;  2FCN A;  3V6C B;  3LB8 C;  5HKH A;  2BYT A;  4FJY A;  1QF6 A;  2N1V A;  3VQI A;  1UBI A;  1X1M A;  5TSS A;  4HCP B;  3RD2 A;  1IGD A;  5C1Z A;  2RGF A;  2W3S A;  4RMA A;  4W9I A;  1SE2 A;  3R3M A;  1FM0 D;  2QEJ C;  1XO3 A;  1ET9 A;  4DXF A;  2WX1 A;  1J7C A;  3RNF C;  1AAR A;  2KJ6 A;  1LGR A;  3WCQ A;  2CJO A;  3ZTC A;  3VR8 B;  2RD0 A;  3TL5 A;  1YJ1 A;  3HVZ A;  3I63 C;  1KM7 A;  3JSV A;  2MJ3 A;  3FC4 A;  3DDC B;  3R7R A;  1OQY A;  3AV8 A;  3H7S A;  3B9J A;  5JXV A;  1PQS A;  1RFK A;  3VHT C;  1YN3 A;  4A3P A;  2W54 A;  3U8Z A;  1VR9 A;  2PE9 A;  2KDF B;  4JGH B;  1JRO A;  3RZF A;  1WZ0 A;  2FIF A;  4EFO A;  3VVW B;  4GOC A;  3UIO B;  4HEA 1;  4FLH A;  3ZLZ A;  4YXD B;  3FKY A;  3WAL A;  1CK1 A;  2LXA A;  4IM3 A;  4K7S A;  2MWS B;  3NOB A;  1E8Z A;  3CSF A;  5LLI A;  4E3C A;  2MSE D;  4JQW C;  4MJS B;  1HEZ E;  1ROE A;  3KYC D;  1WR6 E;  3JYU A;  3Q3F A;  1WGY A;  1ET6 A;  1XCQ L;  5DPW A;  2D3C A;  4L1B A;  2BYV E;  3O65 B;  3VR9 B;  3RUL A;  2O6V B;  4IM2 A;  1ZXH A;  4D2K A;  4PK1 A;  2KOX A;  2KFK B;  2LEK A;  3V60 A;  3PS6 A;  1YN5 A;  3PRE A;  1H4R A;  4EKU A;  3TEW A;  3J9C A;  2LVP A;  1WX9 A;  2JXT A;  2EKI A;  2I38 A;  1OQQ A;  1WXS A;  5MPO A;  4B9K A;  2AQ1 B;  1SF0 A;  3KYD D;  3R2T A;  3WAO A;  3BVM A;  4LNK A;  4KZC A;  4F1S A;  2XK5 B;  3SFE B;  2WU5 B;  1L5P A;  2KZR A;  4DXG A;  1P98 A;  4XC2 A;  4WWO A;  2KTF A;  4NNJ B;  2JYE A;  1OQR A;  1WRI A;  4DHZ E;  2ZW1 A;  1FFV A;  2RPQ A;  1SIJ A;  2V0G A;  2WXF A;  1RRB A;  4KSL C;  3N9Y C;  4M8N A;  2PW9 A;  4BVU C;  4RFB A;  1R4N B;  1UZX B;  4WQM A;  2DZM A;  4OZB A;  1E90 A;  3C8Y A;  2DYO A;  3AE5 B;  3ZNH B;  2LJ5 A;  1M94 A;  3S2A A;  1EO6 A;  3PLU A;  3NS1 A;  3EUB 2;  4X57 B;  2FBW B;  5KHQ A;  3PGE A;  2KC1 A;  4N58 A;  2PE6 B;  2NBV B;  3BK2 A;  2INP E;  3PVL A;  1ZXI A;  3HHM A;  4IWP A;  2JRH A;  2O2V A;  1WGR A;  3AH7 A;  4IWQ A;  2Y3A A;  4HKZ E;  1YNT E;  4EZL A;  2ZPY A;  5J17 A;  3WAN A;  4TQ0 A;  3OG5 A;  4A6Q A;  5C2T B;  4HPM B;  2GBK A;  1TYG B;  2UWQ A;  2CS4 A;  3BYY B;  3EA6 A;  1WM3 A;  4WJQ A;  3AU5 A;  1ACC A;  4ITK A;  4YL8 A;  4S17 A;  4NJ7 A;  2AWT A;  3DVN V;  4W9K A;  4FJZ A;  1I4R A;  3HM3 A;  3RPF C;  3I57 A;  2QIE B;  1I4P A;  3Q3J A;  3M95 A;  1RAX A;  4TV3 A;  3ML8 A;  4NZL B;  2N9L A;  5HG2 A;  2NMQ A;  3VFK A;  2QCZ A;  2N7J A;  2MQJ A;  2K8H A;  5G55 A;  2QC8 A;  1FEH A;  1ISN A;  2DZJ A;  4G3X B;  4KKI A;  4PS7 A;  2WS3 B;  2KXJ A;  2CHZ A;  1WM2 A;  2O2V B;  3PO0 A;  4XDC A;  2NS5 A;  2JPH A;  3MFG A;  3OAW A;  4FHK A;  2JZ3 B;  2IO3 B;  3DPD A;  1VJK A;  1TGZ B;  5DPR A;  1NYQ A;  3Q14 C;  4ZRQ A;  5LXI B;  4FUL A;  1JWM D;  3UF8 A;  2WXK A;  3AEE B;  1VDV A;  1JWA D;  3BZD B;  2CHW A;  4DHJ D;  2WU2 B;  5C23 A;  5AEK B;  3AED B;  1FNU A;  1CJE A;  2WGS A;  3TIX A;  4NQK E;  2WP9 B;  5AZH A;  3ONS A;  4GDK B;  3W1Y A;  2KO3 A;  3SFD B;  3FIL A;  1K50 A;  4WIP A;  1TY0 A;  4M0W B;  1D5Z C;  5AUK A;  2YLM A;  1IBX B;  3DVN U;  2LVQ A;  2ZPN A;  2L1A A;  1MFW A;  1GC6 A;  2KX0 A;  2D10 A;  1XCT L;  2KN5 A;  3APD A;  4ZRI A;  2RDG A;  2IO2 B;  1D6E C;  5AZG A;  4LNF A;  3VH3 B;  1OEY J;  1L6V A;  3T9L A;  1WIA A;  1F52 A;  3KWV A;  2IY1 B;  3QA8 A;  1SXT A;  2KYW A;  2Z0E B;  5CHF A;  4LNI A;  4ZYN A;  3TUO A;  2BS4 B;  1FRD A;  4RM9 A;  1J0G A;  2JWZ A;  4ZYS A;  1GG3 A;  4W9J A;  3VXW A;  3Q8C A;  2J0J A;  5T8I A;  1FIQ A;  4TQ1 A;  4G0N B;  2L83 A;  2RMM A;  1BML C;  2A4Z A;  1XLO A;  3SHQ A;  1IP9 A;  2A5U A;  2BVC A;  5BYS A;  3KQ4 A;  3PT2 B;  1DOI A;  5E6O A;  3QCA A;  3M62 B;  4AWJ A;  1ZDX A;  5LNK 1;  3A9J A;  3PRP B;  3IVF A;  2J0M A;  2BT6 A;  1FCL A;  5GMV A;  2WDV B;  3APF A;  1RWS A;  3IAM 1;  2SEB D;  1SJH D;  1V97 A;  3T3N A;  4I6N B;  3MJ5 A;  2O6V A;  1PGA A;  5FK9 C;  1CZP A;  3M3J A;  4HPP A;  2KWD A;  3TEX A;  1SE4 A;  3LXF A;  2GB1 A;  3MC0 B;  1TKY A;  3VH4 B;  2WDT B;  3H7P B;  1SE3 A;  2PPH A;  2NTS A;  2BB5 A;  3RT3 B;  3BYT B;  3CMM B;  1FNW A;  1ENF A;  1YMH E;  3ECI A;  4AP4 C;  2WXM A;  2LI5 A;  1WJ4 A;  5D3I B;  2MCN B;  3ZKJ C;  3ZVV A;  1NEN B;  2DBY A;  3L4P A;  3I9V 1;  2MBH A;  4K7U A;  1AYF A;  2IGH A;  3PTF C;  2L8J A;  2KD0 A;  2WXH A;  3PHW B;  4M00 A;  2JT4 B;  2V4I B;  2GMI C;  2JQR B;  5EE0 A;  3ZNZ B;  3T3O A;  1ZE3 D;  2HJ8 A;  4TUU A;  1UWM A;  2ZNV B;  4BFR A;  1IUE A;  2R2Q A;  1VZ7 A;  1J19 A;  1UH6 A;  1F9J A;  3RNC C;  2X38 A;  4A9A A;  1JWU D;  4HPL B;  3O13 A;  1ESF A;  3MC9 A;  5LXH A;  3DWM A;  1VLB A;  2J53 A;  4YTN B;  1XQQ A;  3N3K B;  1S1Q B;  2L76 A;  5EE1 A;  4OHJ A;  2EEL A;  2JZZ A;  1V49 A;  4FN2 A;  1TS5 A;  1YOV B;  1QOB A;  4DDI D;  2PLP A;  4RNA A;  3PPA A;  4J6I A;  1MG4 A;  1EF5 A;  1XF5 L;  2J52 A;  3DBR B;  3TEZ A;  4BOS C;  2MHJ A;  3KLS X;  3D32 A;  1YQ4 B;  2K8C A;  2AQ3 B;  4RF0 A;  4MSQ B;  1PYW D;  3E56 A;  3U7Z A;  4MGY E;  3H6N A;  1T0R C;  4ZHP A;  1XLP A;  2NVU I;  4AJW A;  1MHH E;  3ZJV A;  2DEN B;  4AJY B;  3BY4 B;  1LQB A;  3H8H A;  3L0W B;  3U7D A;  2N9X A;  5IA7 A;  3A1Q B;  2JVC A;  1XEE A;  3I5J C;  1V1P B;  1C3T A;  4LJP B;  3L54 A;  3JW0 X;  2KN4 A;  3UGB B;  1S3S G;  3QIJ A;  3W1S A;  4P1B C;  2E6X A;  3URY A;  4YSX B;  1E7V A;  3C19 A;  4II2 B;  3NS8 A;  2KMC A;  4LNN A;  4YT0 B;  1FXA A;  3MHZ A;  2N4F A;  1RLF A;  3W9C B;  1OFF A;  2L00 B;  3T8M A;  2G4S A;  2WYQ A;  4OVV A;  4CYE A;  3AEC B;  1L0Y B;  4W9E A;  4RF1 A;  4GIV A;  2WWZ A;  3R2I A;  1XLN A;  2WXQ A;  4ARC A;  1PGX A;  3Q6B A;  2OOB B;  3ZJT A;  2IGG A;  1E6E B;  1E7P B;  2FCM A;  1FO4 A;  4US9 A;  2ON8 A;  4URK A;  3A9K A;  3MP9 A;  2UU7 A;  2K0P A;  2LHE A;  5J2R A;  5E6P A;  2LRU A;  1Y56 A;  4MH8 A;  1V1P A;  4DQO C;  3ETR A;  1TJE A;  2PIA A;  1E8X A;  1M4V A;  2KQS A;  3RYT A;  1TTN A;  3ZO5 B;  1SB3 C;  4R3D A;  3NG0 A;  1XD3 B;  3B1L X;  1F0Z A;  2JYT A;  3IBE A;  4CQN A;  2BKR B;  4DHZ B;  2GBR A;  5HFY A;  2VH1 A;  2BBC A;  4KX6 B;  4CO7 A;  2HE7 A;  2L32 A;  4F8C B;  1NI2 A;  1UGM A;  4EOY A;  4ZOH C;  3I3T B;  2JUO A;  2V1Y A;  4G50 A;  3HRD D;  1WMH B;  5BO4 B;  2REX A;  1JRP A;  2HTH A;  2C7M B;  4ZRJ A;  4RGT A;  3VRA B;  4MH0 E;  4REZ A;  1SEB D;  2KTR A;  4W9F A;  3L10 B;  3TSS A;  5J18 A;  3P4R B;  2C60 A;  2HDE A;  1KLG D;  5BYR A;  3TCA A;  4KGR A;  3PSE B;  4WWP A;  4B0M A;  3KVF B;  4ZHO A;  2VH2 A;  2PJH A;  3WIM A;  1KH0 A;  2JXX A;  2DZK A;  1IPG A;  1E8W A;  3AE1 B;  3A4R A;  3B2G A;  1V86 A;  2Z59 B;  1E8Y A;  1XLQ A;  4M0W A;  2FCQ A;  5G5H A;  2UYZ B;  3SU8 X;  2J0K A;  3RFZ B;  2J4X A;  4MGK E;  1EM7 A;  2Z8L A;  1E7U A;  2YVC A;  3P42 A;  5G5G A;  4GSW A;  4ANW A;  1P0R A;  2KFK A;  3PZD A;  2EMS A;  2VRR B;  1I42 A;  5CX3 A;  4G11 A;  2D2Q A;  2LGS A;  1F2R C;  2PVO D;  1JAL A;  2RR9 A;  3RN9 C;  3ABV B;  1T5X D;  4MEM A;  2K3U A;  3IFW B;  1GJZ A;  3N20 C;  1YQB A;  4B6W A;  1FD6 A;  3SDL C;  4YTM B;  2N9E B;  2BS3 B;  2BS2 B;  3ZYY X;  5FR3 A;  1KRH A;  2Y5B B;  1VRA B;  2BGF A;  4HRO A;  2ZCB A;  4MGI E;  4I6P A;  1KLV A;  1FRR A;  5HHD G;  2D3B A;  3B08 A;  5JHA A;  3DBH I;  4RGO S;  1ZDV A;  2G3Q B;  4LNO A;  3BIN A;  1IYF A;  5EDS A;  4NAW A;  1LXD A;  4W9L A;  5D3D A;  1C77 A;  2XEW A;  1WGG A;  2LMC A;  3ZQ4 A;  3JSV B;  4B95 A;  4A55 A;  3B2F A;  2BB6 A;  4AS1 A;  2K6Q A;  4DHJ B;  2W82 A;  2BYF A;  3Q2A C;  3NZU A;  1I4G A;  1RFA A;  4FXC A;  4Q2J A;  2V9H A;  3N1X C;  4DXA B;  4OVZ A;  1EU4 A;  4A20 A;  1AN8 A;  4WQO B;  3QAR A;  1TS4 A;  1QOF A;  2JZP A;  2B76 B;  3E9S A;  3WAM A;  4OVU A;  2JX5 A;  1ZOY B;  3R8B A;  1HA5 A;  4N9F 4;  2KWV B;  1GUA B;  5CHW A;  3PHX B;  4MM3 B;  1WH3 A;  4TKN A;  3CWI A;  2RDB C;  4MT5 A;  3QHT A;  4KVG B;  5IAA C;  4GN1 A;  4II3 B;  4C7Z A;  2DAJ A;  3P4Q B;  3MHS D;  1QOA A;  3QAQ A;  3ZTD A;  3MJW A;  1TS3 A;  2KK8 A;  2INC C;  4EEW A;  2D11 A;  4GU2 A;  3KWL A;  1D3Z A;  1RM6 C;  3GE8 C;  4QAY A;  4USA A;  1EU3 A;  4PS3 A;  2N0S B;  2IJ0 A;  3WA0 A;  2VZK D;  2BKF A;  3X23 A;  2MP2 B;  2QSD A;  2IO0 B;  5JHB A;  1YJI A;  1GC7 A;  2KQ7 A;  2QHO A;  2KWC A;  3N30 A;  4P1C C;  2AX5 A;  3MTN B;  3UQA A;  3ZUN A;  4AOF A;  1WRD B;  4XDD A;  2KFJ A;  2AYO B;  5FR6 A;  2WQY B;  4OZC A;  1YQ3 B;  3KUZ A;  1UUP A;  4XWW A;  1PGB A;  2H88 B;  1HZ5 A;  3GZN B;  3Q8E A;  2M56 B;  3LYY A;  3NY5 A;  2C7H A;  2BYE A;  3QWZ B;  3W1S C;  3P2B A;  4EUT A;  4P6V F;  5IO9 A;  3AE2 B;  2J7Q B;  4XZ4 A;  3L17 A;  1VZ8 A;  1D5X C;  1QT9 A;  3SR6 A;  4MSM B;  2DAF A;  2KAJ A;  2LUE A;  2AEH A;  2ACZ B;  3ZNG C;  4BBN F;  1TZO A;  4MDK E;  1SE9 A;  3VTU A;  1R4N I;  5CTR C;  2L3Z A;  2KDE B;  3Q3N C;  1VCB A;  4C7Y A;  2V3S A;  3QK0 A;  3DBL B;  1MI0 A;  1IGC A;  2XN9 C;  5IKC M;  4LDT B;  4JIO U;  1MJD A;  2JWU A;  4RH6 A;  5D2M B;  4UDU C;  3ZJU A;  1HTQ A;  3UIN B;  1C4P A;  2KLC A;  5JH5 C;  4WWM A;  2IBI B;  3SEB A;  3K9O B;  5TR5 A;  1BXT A;  3KUD B;  1KTK A;  4A3O A;  2X8X X;  3TMP B;  1XXG A;  2NPT A;  2MH7 A;  1Q5W B;  3Q8F A;  1FPY A;  3OLM D;  2E3T A;  2LGY A;  3B0A A;  2NBU A;  3NUH B;  3PZ7 A;  1YD8 U;  3BVG A;  4XX5 A;  3RCZ A;  3HVD A;  3NVW A;  4MEL A;  1DYQ A;  1Z5S B;  2CU3 A;  3AXC A;  3HM6 X;  2WNM A;  1GB4 A; 
#chains in the Genus database with same CATH homology
 2MA9 B;  2DEN B;  3KYC D;  1WR6 E;  3JYU A;  3OJ3 A;  4AJY B;  3Q3F A;  3BY4 B;  1WGY A;  3AI5 A;  1WJ6 A;  1LQB A;  5DPW A;  3L0W B;  3U7D A;  2BYV E;  2N9X A;  2NR2 A;  5IA7 A;  3O65 B;  2XBB C;  3EEC A;  3RUL A;  2XK5 A;  1WX7 A;  3A1Q B;  3CF6 E;  3H9D A;  5DPT A;  2KNB A;  2JVC A;  2O6V B;  4IM2 A;  3ZNI D;  1C3T A;  2KWU B;  2KOX A;  2KFK B;  3L54 A;  4LJP B;  4W9H A;  1XT9 B;  3JW0 X;  3V60 A;  4KDL B;  3UGB B;  3ZDM C;  3PS6 A;  4WJP A;  1WJU A;  1S3S G;  3QIJ A;  3PRE A;  2L05 A;  4IWO A;  1H4R A;  3W1S A;  4EKU A;  1P1A A;  2LVP A;  2MBQ A;  1WX9 A;  1WE7 A;  1E7V A;  3QQ8 B;  2DHZ A;  4II2 B;  3NS8 A;  2KMC A;  2ZVO A;  1WXS A;  1UEL A;  2KMA A;  4B9K A;  2N4F A;  1RLF A;  4GB9 A;  3KYD D;  2MBB B;  3WAO A;  5D7G A;  1Q0W B;  3LDZ E;  2OJR A;  2LRW A;  2L00 B;  3T8M A;  2G4S A;  2WYQ A;  4KZC A;  4F1S A;  2XK5 B;  3A1Q A;  4OVV A;  2N7D A;  4CYE A;  3RUI B;  3JVZ X;  1WGD A;  3L13 A;  5E6N A;  2KTR B;  4W9E A;  2L0F A;  2KZR A;  3KUC B;  4FBJ B;  1P98 A;  4GIV A;  2WWZ A;  4XC2 A;  4WWO A;  1CMX B;  2KTF A;  2FCS A;  2R2O A;  3IG3 A;  4NNJ B;  2M0X A;  2N9P C;  2OOB B;  1QZE A;  3WAP A;  1V2Y A;  1KJT A;  1V5O A;  4DHZ E;  4GGQ A;  2FCM A;  4CHK A;  1L2N A;  2RPQ A;  4URK A;  3A9K A;  2KC2 A;  4NQL B;  3L08 A;  2IY0 B;  1RRB A;  4KSL C;  3VUY A;  5J2R A;  1J8C A;  4M8N A;  5E6P A;  5G2N A;  2LRU A;  4BVU C;  2M4N A;  1GNU A;  1UZX B;  4WJO A;  1I35 A;  2MX2 A;  2DZM A;  1UD7 A;  1E90 A;  2KJH B;  1E8X A;  2DYO A;  3DCG A;  4KSK C;  3ZNH B;  3ZRC A;  2LJ5 A;  2KQS A;  2AL3 A;  2LAS A;  1M94 A;  1TTN A;  2V4L A;  4JL9 A;  3RYT A;  3S2A A;  1EO6 A;  2MBO A;  1OGW A;  2FID A;  3ZO5 B;  3PLU A;  3AU4 A;  3DBS A;  4X57 B;  3TBL D;  1XD3 B;  3AUL A;  5KHQ A;  3B1L X;  3PGE A;  3H7P A;  2KC1 A;  4I6L B;  3IBE A;  2PE6 B;  2NBV B;  5AZF A;  2BKR B;  2KJR A;  4MJS A;  4IG7 B;  4DHZ B;  3PVL A;  2GBR A;  1V9J A;  3HHM A;  4IWP A;  4F7Z A;  2BWE S;  4CO7 A;  2JRH A;  4KDI C;  2HE7 A;  3EC8 A;  2O2V A;  4F8C B;  1WGR A;  1OTR B;  1NI2 A;  1UGM A;  4EOY A;  3I3T B;  2JUO A;  2G45 B;  2NBW B;  4IWQ A;  2K6D B;  4HCN B;  2V1Y A;  2KAN A;  4G50 A;  1WMH B;  3OJ4 B;  4EZL A;  4KZ0 A;  2ZPY A;  5J17 A;  1R4M I;  3WAN A;  2K25 A;  5BO4 B;  4TQ0 A;  2REX A;  2HTH A;  2W9N A;  2C7M B;  1ZW7 A;  4HPM B;  1T0Y A;  2GBK A;  2D07 B;  4NJ6 A;  4ZRJ A;  2EKE C;  2UWQ A;  4NAW B;  4MH0 E;  2CS4 A;  2LXC A;  3ZIM A;  1WM3 A;  2ZEQ A;  4WJQ A;  2LWP A;  3AU5 A;  1WY8 A;  2KTR A;  1WGH A;  2BPS A;  4YL8 A;  2I1J A;  2GBJ A;  4W9F A;  3L10 B;  4NJ7 A;  2AWT A;  2BWF A;  3DVN V;  3M63 B;  4W9K A;  5D94 A;  4FJZ A;  4KV2 A;  4BKS D;  5J18 A;  2O6V D;  2C60 A;  2FNJ B;  3HM3 A;  4BBN C;  2L0T A;  3TCA A;  3DBR I;  3PSE B;  3Q3J A;  4WWP A;  4IW0 A;  3V61 A;  3DQV A;  3M95 A;  1RAX A;  2IZV B;  3KVF B;  1A5R A;  4TV3 A;  4DK5 A;  2MW5 A;  1WI0 A;  2PJH A;  3PV1 A;  3ML8 A;  3WIM A;  2JXX A;  2DZK A;  2IYD B;  1IPG A;  1EUV B;  1E8W A;  3A4R A;  4HLE A;  1V86 A;  2Z59 B;  2D3G A;  1E8Y A;  3VFK A;  3DVG Y;  2MQJ A;  2FCQ A;  2KVR A;  2K8H A;  1WX8 A;  2J0K A;  2JRI B;  2UYZ B;  5G55 A;  2ZVN A;  3SU8 X;  3ZDT A;  1TBE A;  2DZI A;  4MGK E;  2GBN A;  1ISN A;  4ANV A;  1WXA A;  2DZJ A;  3DBL I;  1E7U A;  2YVC A;  1WXM A;  4G3X B;  3APC A;  2Z0D B;  3K9P B;  4GSW A;  3UQB A;  4PS7 A;  4ZDV A;  4ANW A;  1P0R A;  2GBM A;  2KFK A;  3PZD A;  2M17 A;  2EMS A;  2ASQ A;  2CHZ A;  2KXJ A;  2BF8 B;  2VRR B;  2PEA A;  3QC8 B;  5CX3 A;  1I42 A;  3PRM B;  4BOZ B;  3C0R B;  1WM2 A;  4G11 A;  4GXB A;  2D2Q A;  2O2V B;  3A9K B;  2NS5 A;  2JPH A;  2RR9 A;  1YX5 B;  1H8C A;  4FHJ A;  3OAW A;  4FHK A;  2JZ3 B;  2IO3 B;  4DBG A;  2KX3 A;  4MEM A;  4FA6 A;  3DPD A;  3IFW B;  4W9C A;  1TGZ B;  1GJZ A;  3VUX A;  4LJO B;  5DPR A;  1ZGU B;  3ENE A;  1YQB A;  4B6W A;  2MLB A;  4BKT A;  5LXI B;  1NBF C;  2CKH B;  3GOE A;  1V80 A;  4FUL A;  5JZE B;  4ANU A;  3UF8 A;  3SDL C;  4HJK A;  1SGH A;  2N9E B;  3UIP B;  2CHW A;  4DHJ D;  2MBE A;  4IM0 A;  4EZJ A;  5C23 A;  5AEK B;  3V6E B;  4LCD E;  3GZN I;  2Y5B B;  2BGF A;  2JF5 A;  4M8M A;  4NQK E;  3TIX A;  1NDD A;  1G6J A;  2ZCB A;  5AZH A;  1YX6 B;  1P3Q U;  3ONS A;  4GDK B;  4MGI E;  4I6P A;  3W1Y A;  2KO3 A;  2DYM A;  1JRU A;  1KLV A;  3B08 A;  4WAA A;  5JHA A;  3DBH I;  1KOT A;  3VUW A;  2G3Q B;  4M0W B;  2YLM A;  4ICU A;  1WZ3 A;  4K7W A;  3X0W A;  1V5T A;  2M1M A;  5CHV C;  3BIN A;  2CU1 A;  2CR5 A;  4FJV B;  1IYF A;  3DVN U;  5EDS A;  4NAW A;  1LXD A;  1Q1O A;  2LVQ A;  4W9L A;  2ZPN A;  4HWI B;  2XEW A;  1GC6 A;  1WGG A;  2KX0 A;  4HDO A;  2D10 A;  3LJ3 A;  2KN5 A;  3APD A;  3JSV B;  4ZRI A;  4B95 A;  2IO2 B;  2K6Q A;  5AZG A;  5DPS A;  4DHJ B;  3VH3 B;  1Y8R C;  2BYF A;  2N1W A;  1OEY J;  2KHW B;  2LVO A;  3ALB A;  3N32 A;  3SD5 A;  3NZU A;  5L83 A;  3T9L A;  3DOW A;  1WIA A;  1RFA A;  4ICV A;  3PRZ A;  2IY1 B;  3EHV A;  2MP2 A;  1HE8 A;  1WF9 A;  2Z0E B;  3QA8 A;  5CHF A;  4ZYN A;  3QJZ A;  4DXA B;  4A20 A;  2LZ6 A;  3RZW C;  4WQO B;  3QAR A;  4RM9 A;  1J0G A;  2JWZ A;  1WXV A;  1GG3 A;  4W9J A;  4W9G A;  2CHX A;  4KIK A;  3VXW A;  3WAM A;  4ASW C;  2J0J A;  2DX5 B;  4PYZ A;  4OVU A;  4HDQ A;  1TZ1 A;  3ZW3 A;  1WFY A;  4TQ1 A;  4E74 A;  4N9F 4;  2RSU A;  2KWV B;  2NCN A;  1GUA B;  5CHW A;  4G0N B;  2NPT B;  3PHX B;  1WH3 A;  1OEY A;  3A4S C;  3NZS A;  4LDT D;  4TKN A;  2WX0 A;  2A4Z A;  3SHQ A;  3QHT A;  4KVG B;  1IP9 A;  5IAA C;  1K8R B;  4GN1 A;  2JY6 A;  4II3 B;  2C5L C;  2DAJ A;  2M8S A;  1UBQ A;  3MHS D;  3A9J B;  2A5U A;  2HD5 B;  2KDB A;  3R66 C;  2FAZ A;  2N7E A;  5L95 C;  4BKS A;  2ZCC A;  3QAQ A;  3ZTD A;  4WJN A;  3MJW A;  4HVB A;  2EMT A;  3H1U A;  2KK8 A;  1MG8 A;  3U30 A;  1EF1 A;  3PT2 B;  5E6O A;  3QCA A;  3M62 B;  4AWJ A;  4GDL A;  4EEW A;  3A9J A;  3PRP B;  2D11 A;  3IVF A;  2L7R A;  4GU2 A;  1P9D U;  2J0M A;  1D3Z A;  1L7Y A;  5GMV A;  5DCN A;  5KHO A;  2G4D B;  3APF A;  1LFD A;  2LGX A;  1LM8 B;  2IO1 B;  4PS3 A;  3X23 A;  1Z2M A;  1WR1 A;  3WA0 A;  2BKF A;  2MP2 B;  3L16 A;  2IO0 B;  5JHB A;  3KW5 B;  4I6N B;  1GC7 A;  2O6V A;  1ZKH A;  3NHE B;  1WE6 A;  2KQ7 A;  2QHO A;  2KWC A;  3M3J A;  1VD2 A;  2I1K A;  3N30 A;  4IUM B;  4KIK B;  4RM8 A;  3MTN B;  3UQA A;  2K1F A;  3CST A;  3ZUN A;  4IC7 B;  3VAW A;  4GMV A;  3VH4 B;  4AOF A;  2WDT B;  1V6E A;  1WRD B;  3H7P B;  2KFJ A;  1C1Y B;  2AYO B;  2PPH A;  5FR6 A;  3RT3 B;  1E5W A;  3ML9 A;  3A33 B;  4DDG D;  3CMM B;  4GDL B;  2LD9 A;  3ZRF A;  3ECI A;  4AP4 C;  3KUZ A;  1SIF A;  3PLV A;  2ZZP B;  2LI5 A;  1WJ4 A;  3TJP A;  2MCN B;  3ZKJ C;  3ZVV A;  1BT0 A;  3HK0 A;  2GOW A;  3NY5 A;  2C7H A;  2MBH A;  4K7U A;  2BYE A;  3PTF C;  5D6J B;  3QWZ B;  3W1S C;  2C9W B;  2L8J A;  2MRP A;  3P2B A;  2KD0 A;  4EUT A;  4K1R B;  1WMH A;  4ANX A;  4GDK A;  3PHW B;  4JLC A;  2JT4 B;  4FAD A;  2J7Q B;  2C7N B;  2GMI C;  3QX1 A;  4XZ4 A;  1WYW B;  3ZNZ B;  3VTV A;  3L17 A;  2ZJD A;  1FXT B;  4HXD A;  4BKG A;  2HJ8 A;  2KKC A;  2FCN A;  3V6C B;  4DWF A;  5HKH A;  1WJN A;  4FJY A;  4MSM B;  2N1V A;  3VQI A;  4WWN A;  1UBI A;  1X1M A;  4TUU A;  2DAF A;  2FUH B;  4HCP B;  2K8B A;  2LUE A;  2ZNV B;  2AEH A;  4BFR A;  2R2Q A;  3ZNG C;  3RD2 A;  4BBN F;  4MDK E;  4NY0 A;  1J19 A;  3DVG X;  1UH6 A;  1F9J A;  2K39 A;  1SE9 A;  5C1Z A;  3VTU A;  1R4N I;  2RGF A;  5CTR C;  2L3Z A;  4RMA A;  4W9I A;  2KDE B;  3R3M A;  4HPL B;  3KH0 A;  3VTW A;  1VCB A;  2ZNV C;  4ZRK A;  2V3S A;  4W9D A;  1U4A A;  5LXH A;  3QK0 A;  2WX1 A;  1AAR A;  2KJ6 A;  1XQQ A;  3N3K B;  1S1Q B;  2AL6 A;  2L76 A;  4LDT B;  4PS8 A;  2JZZ A;  4JIO U;  3IHP C;  1V49 A;  4FN2 A;  3ZTC A;  2RD0 A;  5D2M B;  3TL5 A;  1YJ1 A;  2LGD A;  1KM7 A;  1YIW A;  4DDI D;  3EFU A;  3JSV A;  4AUQ C;  3UIN B;  3PPA A;  2B3A A;  4J6I A;  3DDC B;  3R7R A;  1EF5 A;  2KLC A;  5JH5 C;  1OQY A;  3H7S A;  4P7I A;  4HK2 A;  2IBI B;  4EZK A;  1PQS A;  3VDZ A;  3VHT C;  3K9O B;  3R7Q A;  5TR5 A;  3KUD B;  4A3P A;  4BOS C;  3U8Z A;  2PE9 A;  4A3O A;  4K81 A;  2KDI A;  3TMP B;  3D32 A;  4NPN A;  2KDF B;  2K8C A;  2NPT A;  4JGH B;  1Q5W B;  3RZF A;  1WZ0 A;  2FIF A;  4EFO A;  1V81 A;  3OLM D;  3VVW B;  4GOC A;  3UIO B;  4MSQ B;  4FLH A;  2LGY A;  4MM3 A;  3B0A A;  3ZLZ A;  2NBU A;  4MGY E;  4MGZ E;  1YD8 U;  3HIZ A;  3V62 A;  3WAL A;  2LXA A;  3H6N A;  4IM3 A;  4K7S A;  4XX5 A;  2MWS B;  3NOB A;  1E8Z A;  3CSF A;  5LLI A;  3RCZ A;  4E3C A;  4MEL A;  1Z5S B;  2MSE D;  2DYB A;  2NVU I;  4JQW C;  4PYU A;  3AXC A;  4MJS B;  4AJW A;  3HM6 X;  4E71 A;  2KLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...