3VTUA

Crystal structure of human lc3b_2-119
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
SPEFPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Structural basis for phosphorylation-triggered autophagic clearance of Salmonella
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2012-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vtuA00
2I1JA 4RM8A 2A4ZA 2LZ6A 4IM3A 3VUYA 2FCMA 2FUHB 3ZUNA 2V3SA 2KFKB 3L08A 3MTNB 4IC7B 4WJOA 2D10A 2IY1B 1UGMA 2GBMA 1GJZA 2ZJDA 2EKEC 3SD5A 1M94A 3DVNV 4WWOA 1C3TA 2NBVB 3PT2B 5E6NA 4HLEA 4GB9A 2MBQA 2KJRA 5E6OA 4NNJB 2WDTB 3DCGA 4FJZA 1OTRB 2OOBB 3IBEA 4RM9A 1X1MA 3IHPC 2L0TA 3A1QB 3ZDTA 3QAQA 4E71A 5EDSA 3U8ZA 1I35A 1NBFC 3A9KB 4MH0E 4F1SA 2G3QB 4EZJA 4FADA 4LJPB 2KWVB 3H6NA 2KDEB 1WR1A 5G2NA 2DENB 2LD9A 3WANA 4FN2A 4ASWC 4BFRA 2O2VA 2BYVE 4IWOA 2ZPNA 2V4LA 3EHVA 3L13A 3RD2A 2JZ3B 4NJ7A 2DX5B 2QHOA 3WA0A 5J18A 3AU4A 4FA6A 2LVQA 2KX0A 3VAWA 3X23A 2MA9B 3A9JA 3B08A 4BKSA 3RYTA 2CHXA 2LRWA 1VCBA 2MBBB 2JVCA 2BKFA 2IBIB 2MP2A 2N4FA 1IP9A 5AZFA 2KHWB 5CHFA 2BYEA 2V1YA 4K1RB 3T8MA 4A20A 1E8WA 1S3SG 2YVCA 4WWNA 1E8XA 4WJPA 2IY0B 4M8MA 2Z59B 2CKHB 3DVGY 2LVPA 3KUDB 2GOWA 1V5OA 2KWCA 2JXXA 3PTFC 3OJ3A 4WAAA 3QA8A 3V6CB 2K8HA 2K6QA 3PS6A 1WJ4A 1TGZB 4EFOA 2D3GA 3HIZA 5DPWA 3NZSA 4MSMB 3ECIA 3ZNHB 3A4SC 5CHVC 4ZDVA 1V9JA 1WYWB 2CR5A 3BY4B 4PYUA 2KK8A 2JUOA 3UQBA 4W9EA 4GDKA 3V61A 4AWJA 5C1ZA 2KJHB 3ZW3A 2BKRB 2NCNA 1V5TA 4GU2A 4MGIE 1YX5B 4TKNA 2JPHA 2ZCBA 4ANXA 3R7QA 3QK0A 4GMVA 1LFDA 4GGQA 4HJKA 4W9JA 2BF8B 2JRHA 4MJSB 4EEWA 3L17A 2LJ5A 3AU5A 1Z5SB 2FAZA 2N1VA 2FIFA 3C0RB 3N30A 1WZ0A 2MSED 3IG3A 2W9NA 3TCAA 3KUZA 4JL9A 3APDA 2MBHA 2DYOA 3VTWA 4ZRKA 2LXCA 2N9PC 3H7SA 4II3B 4NJ6A 1G6JA 1EO6A 3WAOA 2GMIC 3DDCB 3NOBA 4KDIC 1WM2A 4KSKC 2ZNVB 2FNJB 2UYZB 1GUAB 2HJ8A 5JHBA 3KYDD 2LWPA 1U4AA 2GBKA 1E7VA 2KDFB 2WWZA 4FLHA 4W9KA 3UF8A 5D94A 4JQWC 4KIKB 5DPRA 5BO4B 2JT4B 4HPLB 4HDQA 3P2BA 3DQVA 2M1MA 1V81A 4K7SA 4HCPB 2IO3B 3ZTCA 2BWFA 1V49A 4ANVA 3QQ8B 2KX3A 3I3TB 2KLCA 3UINB 4GIVA 4DK5A 4FBJB 1ZGUB 4HDOA 2MQJA 1VD2A 2I1KA 3VTVA 3ONSA 1XT9B 4F7ZA 3W1SA 2KDBA 2EMTA 5CTRC 1HE8A 4ANWA 2LXAA 5LXIB 2ZZPB 1ZW7A 2HTHA 3QJZA 2C60A 3TL5A 2ZNVC 2KXJA 4E74A 3DPDA 4JLCA 4WQOB 3A1QA 4W9CA 3W1YA 3ZVVA 3ENEA 4ZRJA 2C7HA 2KNBA 1WJUA 4EZLA 1OGWA 2KQSA 3A9KA 4CHKA 2B3AA 2N9EB 1TTNA 3WAPA 2CHZA 4PS8A 3UIOB 3Q3FA 2K39A 4JGHB 4M0WB 4IM0A 4CO7A 2DAFA 1ZKHA 4W9HA 2L8JA 4BVUC 4DBGA 4DDID 3ML9A 4KVGB 4KSLC 3S2AA 5AZGA 2ZEQA 4MEMA 4N9F4 3WAMA 1WGYA 2RGFA 5E6PA 3VHTC 3O65B 1Q5WB 4EUTA 4A3PA 2LVOA 3HK0A 2ASQA 4ZYNA 2CU1A 1KJTA 2IYDB 1WFYA 4KZCA 1WMHB 2L7RA 2KFJA 3DVNU 3VUWA 1UH6A 3PLVA 3L54A 1UELA 3PGEA 4DHZB 1BT0A 2PPHA 4G0NB 4BOZB 3OLMD 1WM3A 2R2OA 4EOYA 4HWIB 3DOWA 2J0KA 1P98A 4FJYA 1LXDA 4B9KA 2N7DA 1OEYJ 3K9OB 1IPGA 4FHKA 1I42A 5IAAC 2NS5A 2OJRA 1WXMA 1TZ1A 2G4DB 5LXHA 3D32A 3K9PB 3W1SC 2XK5A 2BWES 4GDLB 3SDLC 4NAWB 2KKCA 1WXAA 1GC7A 4WJQA 2KZRA 1H4RA 1UBIA 3T9LA 3VH4B 3DBRI 4II2B 3AI5A 3BINA 1TBEA 3NHEB 3M95A 4I6LB 4B6WA 2RPQA 1H8CA 3ZRFA 1WJ6A 5G55A 1E5WA 4XZ4A 4AP4C 5FR6A 2KVRA 1WR6E 1WI0A 1EF1A 4OVUA 3RCZA 4BKTA 4CYEA 2C9WB 2K8CA 1AARA 4HPMB 2WX0A 2NPTB 4DXAB 5J17A 1EF5A 1E90A 1YX6B 4IW0A 4GSWA 4IWPA 4URKA 3A33B 1LM8B 4MJSA 3B1LX 4X57B 3HM6X 3Q3JA 4LCDE 2O2VB 2DZMA 2M4NA 2LGDA 2JRIB 4W9GA 3ZNID 2LGXA 1V80A 4XX5A 5D7GA 2M8SA 2HD5B 4HVBA 2JZZA 3NY5A 3PVLA 2AYOB 2MX2A 3N32A 4WJNA 2KTRB 3VFKA 1J8CA 1GC6A 3JSVB 3V60A 3JW0X 2G4SA 3HM3A 4G11A 3A9JB 1E8ZA 2RSUA 1P0RA 2FCNA 2LRUA 4IUMB 4B95A 3H7PB 3VDZA 2KN5A 4EKUA 2RD0A 2O6VA 2D07B 4KIKA 3A4RA 4DHJD 1WXVA 1JRUA 1GG3A 3IVFA 3QARA 1V6EA 4MM3A 5L83A 1V2YA 2FCQA 3ZLZA 4J6IA 2WYQA 1E7UA 1PQSA 1YIWA 3ZO5B 2PE6B 3TIXA 2NVUI 3KVFB 4MGYE 4K81A 1E8YA 3SHQA 1FXTB 3DBSA 4FULA 3M3JA 4AUQC 3KUCB 3RULA 4NPNA 1KLVA 3QCAA 4TQ1A 1OEYA 3UIPB 3M62B 3KYCD 2ZPYA 4E3CA 2KFKA 4GDKB 3KW5B 1UZXB 5IA7A 4I6NB 5DPSA 1K8RB 4W9LA 1WE7A 4K7WA 2XBBC 4DHJB 1EUVB 4I6PA 1WX9A 2NBWB 4PS7A 1SIFA 4IG7B 1L7YA 3PLUA 3CF6E 3ZRCA 2IZVB 2LGYA 3QX1A 3EFUA 3B0AA 4ZRIA 1L2NA 1Q1OA 3PRMB 5KHQA 4F8CB 5DCNA 3RUIB 1WIAA 2AL6A 2C5LC 4AJWA 3U30A 3ZIMA 2GBJA 2JWZA 4W9DA 2K8BA 4GN1A 4K7UA 2KWUB 3OAWA 3QIJA 2C7NB 1D3ZA 2HE7A 1WMHA 3MJWA 4IWQA 2DYBA 3GOEA 4NY0A 3ZNZB 1J19A 1WXSA 2GBRA 4PS3A 5LLIA 2G45B 5HKHA 3V62A 2DHZA 4HK2A 3RT3B 2BYFA 3DVGX 3IFWB 4PYZA 4FHJA 5C23A 3LDZE 1P3QU 2LASA 3PV1A 3CMMB 2C7MB 4GDLA 3R3MA 2PE9A 2NR2A 3JVZX 2AL3A 4KV2A 4NAWA 1WGHA 1WE6A 2PJHA 5J2RA 2FCSA 1C1YB 2L05A 2PEAA 2KMAA 3RZFA 2KTFA 2Y5BB 2NBUA 1P1AA 3NZUA 2EMSA 3QWZB 4XC2A 4IM2A 4KDLB 2KQ7A 2REXA 3CSTA 2AWTA 3X0WA 2Z0EB 1SGHA 4MSQB 1SE9A 2KANA 2NPTA 1NDDA 3ZNGC 4MELA 3TMPB 2MBOA 2KJ6A 2K1FA 4LJOB 1S1QB 3M63B 4W9FA 4G3XB 4OVVA 3U7DA 1F9JA 3UQAA 3EECA 3PRZA 1XQQA 3V6EB 3VXWA 1J0GA 2MCNB 4BBNC 3H1UA 3PREA 2DZJA 2KC1A 1WGDA 2AEHA 2M17A 2DZIA 2MRPA 4HCNB 1R4MI 2MLBA 4BKSD 5JH5C 5JZEB 5L95C 3ZTDA 4AJYB 2KTRA 2J0JA 2MW5A 1Q0WB 3JSVA 4DWFA 4P7IA 1WH3A 3HHMA 3AULA 3ZKJC 1V86A 1Z2MA 3H7PA 2K25A 2VRRB 1WZ3A 3DBLI 4LDTD 2KD0A 2ZVOA 4WWPA 4TQ0A 5JHAA 4G50A 3VH3B 5CX3A 3QHTA 3OJ4B 1LQBA 3PZDA 1WGGA 3PSEB 1IYFA 1WF9A 1RFAA 4ANUA 2UWQA 3VVWB 3APCA 3MHSD 4TUUA 3SU8X 2MWSB 4GXBA 3PHWB 2XK5B 1RLFA 2YLMA 4BOSC 2J7QB 1RRBA 3TJPA 2XEWA 2KO3A 3L16A 4A3OA 2DAJA 4MGZE 2MP2B 1KM7A 1QZEA 2RR9A 3ALBA 1P9DU 2IO0B 2FIDA 2L76A 3H9DA 2LI5A 4LDTB 4W9IA 3RZWC 4NQKE 5DPTA 3PRPB 2KMCA 1WX7A 4ICUA 2N9XA 3N3KB 4AOFA 2LUEA 3LJ3A 2O6VD 3PPAA 2DYMA 3L0WB 4TV3A 3QC8B 4EZKA 1Y8RC 3R66C 2JY6A 2M0XA 3KH0A 1WJNA 2IO2B 3L10B 1A5RA 3VQIA 5AZHA 1CMXB 2CHWA 4MDKE 4BKGA 1WX8A 2KC2A 1WY8A 2BGFA 1NI2A 2KLGA 4FJVB 1ISNA 1UBQA 1OQYA 4GOCA 3PHXB 4DHZE 3JYUA 1T0YA 1R4NI 2Z0DB 5GMVA 3CSFA 3ZDMC 2L3ZA 2A5UA 2MBEA 4MGKE 3WIMA 1UD7A 3GZNI 2D11A 2BPSA 1YJ1A 3UGBB 3NS8A 2IO1B 4DDGD 2O6VB 2ZCCA 2L0FA 4RMAA 3EC8A 4KZ0A 1KOTA 1XD3B 3VUXA 1GNUA 4HXDA 1RAXA 2JF5A 2WX1A 3VTUA 2CS4A 3TBLD 4YL8A 5KHOA 1YD8U 1WGRA 2J0MA 2R2QA 2GBNA 2KDIA 3APFA 2K6DB 3DBHI 5D6JB 2L00B 5AEKB 4BBNF 2DZKA 5TR5A 1YQBA 4ICVA 2D2QA 2N1WA 2N7EA 5D2MB 5CHWA 1MG8A 1WRDB 3AXCA 4M8NA 3R7RA 2KOXA 3ML8A 2ZVNA 4JIOU 4NQLB 3WALA
chains in the Genus database with same CATH superfamily
2LZ6A 4IM3A 1C77A 2FUHB 3C8YA 1BUIC 4WJOA 1FD6A 2H88B 2IY1B 4WQMA 3RNGC 4WWOA 1LO5D 1SF0A 4C4VB 3DCGA 2GLSA 1EM7A 1OTRB 2OOBB 3O13A 1F77A 3IBEA 4RM9A 1JQ4A 3NVYA 3ZDTA 3P1MA 3QAQA 1FXIA 2KQ4X 3A9KB 1R4NB 4MH0E 4F1SA 4EZJA 1M4VA 1ZXIA 3H6NA 2KDEB 2O2VA 4IWOA 3L13A 3P4RB 4AQ7A 2QHOA 3WA0A 3AU4A 2LVQA 2KX0A 3VAWA 2R61A 2WXQA 3X23A 4D2KA 4BKSA 2BB6A 2LRWA 1VCBA 1TKGA 2MBBB 3URYA 1TKEA 2MJEA 5AZFA 4K1RB 3DHIC 2JYTA 1L4ZB 2IY0B 2CKHB 3KUDB 2KWCA 2JXXA 2WQYB 2D3AA 1C79A 1TGZB 1EWCA 1JWBD 3HIZA 1QQRA 3NZSA 4ZDVA 2VZKD 2BKRB 2NCNA 1V5TA 4GU2A 4TKNA 1YX5B 2JPHA 3EGRA 4CQNA 3AN1A 4HJKA 2KYWA 3V3XA 3L17A 1Z5SB 2FAZA 3C0RB 3N30A 1WZ0A 3IG3A 3RNFC 3Q69A 3TCAA 1V1PB 2MBHA 3WAOA 2Y3AA 5JHBA 3KYDD 1E7VA 2WWZA 4JQWC 4KIKB 3CWIA 4HPLB 3P2BA 3BVMA 1HQRD 1FO4A 2M1MA 2WDRB 1V49A 3QQ8B 3I3TB 3H8HA 2LHDA 2MQJA 3W1SA 5CTRC 4ANWA 2LXAA 2M19A 2ZZPB 2HTHA 4E74A 2ZNVC 4RF1A 4WQOB 1I4GA 3A1QA 1GAQB 1L0VB 1TY2A 2KNBA 2KQSA 2K22A 4CHKA 2N9EB 1WRIA 2QSDA 4BAXA 4PS8A 2AQ1B 2K39A 1YOVB 1FPYA 4IM0A 2WXPA 2DAFA 4DBGA 4NAMA 3ML9A 4KVGB 3S2AA 2BYTA 3W2DA 4TMAB 4N9F4 1UWXA 1WGYA 5E6PA 1Q5WB 4EUTA 4A6QA 2KAJA 3HK0A 2IYDB 1WMHB 3VUWA 1UELA 2BS4B 3PGEA 4DHZB 1WSPA 5E6JA 2R2OA 4HWIB 2IJ0A 2N7DA 2WXRA 1HXYD 1TZ1A 1CZPA 3W1SC 2BWES 4GDLB 2KZRA 5LNK1 1UBIA 3T9LA 2RPQA 1H8CA 3EFCA 1ZXHA 4AP4C 1WR6E 2PMVA 4IDIA 1EF1A 4DXAB 1YX6B 1JW9D 1ZDXA 3NRZA 4Q2JA 2DZMA 4EE2A 5D7GA 2M8SA 2HD5B 4HVBA 4IKGA 2JZZA 4LLGM 4WJNA 1J8CA 3V60A 2G4SA 3A9JB 2RSUA 2PTLA 2RD0A 2D07B 1J7CA 4DHJD 2KWDA 1NENB 3AEBB 3ETRA 1E7UA 3Q8BA 1PQSA 1YIWA 3TIXA 3Q3MC 3SHQA 3BIID 1FEHA 4FULA 3M3JA 3RULA 2D3CA 3M62B 4E3CA 4MH8A 2XBBC 1WX9A 2NBWB 4PS7A 4IG7B 5IP4D 3ZRCA 4C4VA 2IPKD 3B0AA 5H8YE 1I4XA 1Q1OA 2WGSA 5DCNA 1WIAA 4PK1A 3ZIMA 3AE7B 4W9DA 4LNKA 4K7UA 3AH7A 4ZHPA 2BS3B 3ZJVA 3B9JA 4IWQA 3GOEA 1J19A 2ON8A 3MHZA 5LLIA 4HK2A 3IFWB 5BMGA 2Z8LA 2ONQA 2LASA 3PV1A 4NAWA 3JVZX 1TS2A 4HROA 1PUTA 5T8IA 1GPXA 3SR6A 3RZFA 2OHFA 4XC2A 2EMSA 1SSNA 4KDLB 2KQ7A 2ICIA 4ZRQA 2Z0EB 1SGHA 3SFEB 2KANA 2NPTA 1NDDA 2KVZA 1S1QB 1ZE3D 1SE3A 1Q10A 3FAHA 2MJDA 5EE0A 4LTUA 3AB5A 4HCNB 2K5PA 5JZEB 3R8BA 2MW5A 3TEZA 2MH7A 1WH3A 5TSSA 3ZKJC 1V86A 1D6EC 2K25A 2ZVOA 4G50A 3QHTA 3OJ4B 1LQBA 3AE6B 3DWGC 3PSEB 3NVZA 1AWDA 3VVWB 4TUUA 2MWSB 4L1BA 2LJIA 2XK5B 2J7QB 1RRBA 4A3OA 3P63A 1P9DU 4KKJA 3LXFA 2IO0B 4KGRA 3TEWA 4AS1A 3RZWC 1V8CA 3WCQA 1WX7A 1HZ5A 2N9XA 2SAKA 1E0ZA 4AOFA 2LUEA 3LJ3A 2O6VD 1N63A 2V3PA 1R7SA 3QC8B 3RPFC 4EZKA 3KH0A 4LNOA 4BKGA 1WY8A 1QT9A 1E6EB 3Q8EA 1UBQA 1NYQA 4RNAA 1B1ZA 3PHXB 4DHZE 1T0YA 3Q8CA 3ZDMC 2D5GA 2L3ZA 2A5UA 2MBEA 4MGKE 1UD7A 3GZNI 3NS8A 1ET6A 1FM0D 4RMAA 1NEKB 3EC8A 4ACFA 4HXDA 3VTUA 4MM3B 5KHOA 1ZDVA 3IT6B 2GBNA 2K6DB 3P42A 5AUIA 1YQBA 4HKZE 2N9KA 2N7EA 4ITKA 5CHWA 4M8NA 3ML8A 2ZVNA 2BTEA 2YEPF 2FCMA 2KFKB 3ZJUA 2GBMA 1XLNA 3RFZB 2V9HA 1M94A 2NBVB 3PT2B 4HLEA 4S17A 4FXCA 2WDTB 4FJZA 3GP7A 2PW9A 1VR9A 3J9CA 1KTKA 2BB5A 2L0TA 3A1QB 5FK9C 4WWMA 4E71A 3EUB2 1FCLA 3U8ZA 2G3QB 1TY0A 4LJPB 2KWVB 2QEJC 3GZNB 2DENB 4K3BA 2BYVE 2ZPNA 2L52A 4FA6A 1SEBD 4A8XC 2MA9B 3A9JA 3B08A 1SXTA 2JVCA 2CJNA 1VJKA 1IP9A 1T6BX 3DHHC 3GE3C 3KLSX 5G5GA 1E8WA 4WWNA 3AEGB 4M8MA 3V6CB 4P1BC 2K6QA 3PS6A 4EFOA 2D3GA 4MSMB 1F0ZA 2CR5A 1WYGA 3ZJTA 2KK8A 2M0AA 4W9EA 4AWJA 3UQBA 1ACCA 3HVDA 2I38A 1NI3A 1SBBB 2ZCBA 3W9CB 3R7QA 3QK0A 5G5HA 1YN5A 2L32A 4JWUC 1TJEA 4GGQA 2BF8B 2CJOA 4EEWA 2JXTA 2W9NA 2N0SB 4JL9A 4KGSA 2DYOA 2W82A 4ZRKA 2LXCA 3H7SA 1G6JA 1EO6A 3DDCB 4KSKC 1WM2A 3AEFB 4M02A 4GLSC 1EU4A 2V0GA 2GBKA 4FLHA 1GOZA 1FXAA 5BO4B 3NJTA 1MVKA 4HDQA 1XLQA 4ZRPA 2K0PA 2IO3B 2E6XA 2K3UA 3GB1A 2BWFA 4YTPB 1AYFA 1ZGUB 2WU5B 1XT9B 2WXLA 4F7ZA 2KDBA 2EMTA 3QJZA 2KXJA 2V3NA 3DPDA 2D3BA 3W1YA 3ENEA 1JALA 1WXQA 4ZRJA 1WJUA 1OGWA 1N62A 1TTNA 3WAPA 3VR8B 4CO7A 3BVZA 2INNE 4B0MA 4DDID 4KSLC 4YSXB 4LK0M 4MEMA 4R3DA 1OQQA 4JE3B 3IAM1 3P4SB 1TZOA 4XDDA 1KJTA 1WFYA 1XLOA 2KFJA 3L54A 2PPHA 3OLMD 1WM3A 1UUPA 2GB1A 4FJYA 1P98A 3K9OB 2IGDA 1I42A 2OJRA 4LNNA 2G4DB 2QMTA 3K9PB 2XK5A 3SDLC 4NAWB 5BMIA 4WJQA 3NHEB 5D3DA 1WJ6A 1ENFA 2FE8A 2Q5WD 2KVRA 5FR6A 2K8CA 1D4BA 1L6VA 2NPTB 5BYRA 3A33B 1LM8B 3IT4B 4X57B 1PGBA 3ZNID 1XF5L 1IGDA 2JRIB 2LGDA 1TS5A 3NZ3A 2B76B 4B0EA 1GC6A 4YSZB 3JW0X 1FFVA 1KH0A 2ZW1A 1UNSA 1P0RA 1JWMD 2KN5A 3AEEB 3Q3OC 2LFIA 4KGTA 1ZOYB 1C9FA 3QARA 4MM3A 5L83A 1CQVA 2WNMA 1XEEA 4M01A 2DNFA 5IOIA 1SE2A 4K3CA 2EKIA 1KLVA 1CJEA 3VR9B 2DLBA 1YMHE 5AUKA 3KYCD 2ZPYA 2KFKA 4GDKB 3KW5B 1UZXB 4I6NB 3MFGA 5DPSA 3VRBB 1WE7A 4PT5A 1I4HA 5BYSA 2PVGC 3PO0A 1SIFA 1KLUD 3C19A 2IZVB 3QX1A 4F8CB 3RI7C 2JQRB 1MHHE 2JWZA 4GN1A 1I4QA 2EELA 3OAWA 2C7NB 2BT6A 2HE7A 2L83A 2WDQB 2WLBA 3FKYA 2G45B 4RGTA 5HKHA 2PIAA 3RT3B 4PYZA 2K9XA 1RM6C 3FC4A 3NS1A 2NR2A 2AL3A 1L0YB 2KACA 4YT0B 3TUOA 1HA5A 2CU3A 4US8A 2KMAA 2L1AA 2NBUA 3NZUA 3QWZB 1A70A 2REXA 4DXFA 4HJGE 3OWEB 4MELA 3ABVB 4LJOB 3LB8C 4W9FA 4OVVA 3UQAA 1TIFA 3PRZA 3V6EB 3VXWA 1J0GA 4ARCA 3H1UA 2KC1A 3RNEC 1L6UA 2M17A 4A9AA 2KTRA 4L2YA 4JWSC 1PGAA 2SEBD 4P7IA 3W5UB 2H89B 1UGJA 1WZ3A 4LDTD 1HTQA 3U4EG 1FMAD 1IYFA 3BK2A 1RFAA 4ANUA 2TSSA 1C4CA 2WXMA 1RLFA 3TJPA 2XEWA 3ZGZA 3MC9A 1TT5B 2RR9A 3L4PA 1TS4A 3Q3NC 2L76A 1N60A 2LI5A 4W9IA 4NQKE 2KMCA 5GXGB 3N9YC 1OQRA 2PVOD 2DYMA 4NJCA 3TEYA 1ZUD2 2JY6A 2M0XA 2WXKA 5EE1A 1YJJA 1XCTL 2IO2B 1RYJA 3VQIA 5AZHA 1CMXB 3SFDB 1NI2A 1RWSA 2KLGA 1ISNA 3AEAB 2QJLA 1MI0A 1YJ1A 3UGBB 1YQ4B 2L0FA 4KZ0A 1KOTA 3VUXA 3U7ZA 2AQ3B 1PYWD 4YL8A 1HEZE 1WGRA 3OG5A 1FCCC 2L00B 4ICVA 2D2QA 5D2MB 1WRDB 3AXCA 1V1OA 4JIOU 4NQLB 2I1JA 4RM8A 2KDMA 3BYYB 3VUYA 1C76A 3ZUNA 3MTNB 4IC7B 4KX6B 1UGMA 4LNFA 1GJZA 1HTOA 2EKEC 1TKYA 1C3TA 5E6NA 1YNTE 2MBQA 2KJRA 3NG0A 3B2FA 1JWSD 4REZA 3AE5B 1X1MA 1L5PA 1NBFC 2G1EA 1WR1A 5G2NA 4FN2A 4ASWC 2V4LA 1FRDA 3RD2A 2WXIA 2DX5B 3ZXRA 2RDGA 2MEKA 4US9A 3VRAB 5IKCM 1C4AA 1VZ7A 3RYTA 2CHXA 2MP2A 4TSSA 2KHWB 1TS3A 5HI1A 4KKIA 2V1YA 4ARIA 3T8MA 1T0RC 1S3SG 2DWQA 4WJPA 1K50A 2Z59B 3AE3B 3QA8A 3AE9B 2K8HA 1WJ4A 3ZNHB 3A4SC 1V9JA 4DQOC 3BY4B 4PYUA 2JUOA 4GDKA 2J42A 4MGIE 3GE8C 1LFDA 3AU5A 2N1VA 3APDA 2N9PC 4II3B 4NJ6A 3NOBA 2ZNVB 2HJ8A 4WH4A 1FNVA 2VZKB 2LWPA 3I57A 3UF8A 5D94A 1N6ZA 3Q2AC 4RGMA 3AE4B 2JT4B 3BK1A 3DQVA 1V81A 4K7SA 5BYQA 3ZTCA 4QAYA 2KX3A 2KLCA 3UINB 4DK5A 1DYQA 4HDOA 2J53A 4OVZA 1VZ8A 2HTME 2I1KA 3VTVA 1L0XB 2VH1A 5LXIB 1ZW7A 2C60A 2GI9A 3TL5A 1JWUD 3ZVVA 3W5VB 4EZLA 5JXVA 2B3AA 4YXDB 1WWTA 2Y5CA 1E10A 2CHZA 3Q3FA 1QOGA 3MC8A 1ZKHA 2L8JA 2RMMA 3PZ7A 4RCOA 5AZGA 2ZEQA 4RF0A 2RGFA 3Q14C 3VHTC 2LVOA 2CU1A 4KZCA 3DVNU 4YSYB 5HFYA 1UH6A 3B2GA 3PLVA 1GB4A 4G0NB 4BOZB 4RGOS 4EOYA 1LXDA 4B9KA 1XO3A 4WAFA 2WXGA 5MPOA 4FHKA 4N58A 3N20C 2KKCA 1WXAA 1GC7A 1H4RA 2NTTA 1Y56A 2AX5A 3DBRI 3AI5A 3BINA 1MHXA 4B6WA 3ZRFA 2WXHA 1E5WA 1HZ6A 4OVUA 1F1HA 4XWTA 1AARA 2WX0A 4URKA 4MJSA 3B1LX 3RN9C 1VDVA 3HM6X 3FILA 1J7AA 2J4XA 4LCDE 1UWMA 1BXTA 2LGXA 1V80A 2JYEA 2PLPA 4ZHOA 2KTRB 1B9RA 1MFWA 3HM3A 4P1CC 1E8ZA 4IUMB 4B95A 5EE9A 3VDZA 4LNIA 4EKUA 1JRPA 2W54A 3A4RA 4N59A 3AE8B 1VRAB 3IVFA 1V6EA 2FCQA 4J6IA 2WYQA 4A55A 2NVUI 3KVFB 4L23A 1D5XC 4K81A 3DBRB 1FXTB 3DBSA 1QOFA 4NPNA 4TQ1A 1OEYA 3PZ8A 3MC0B 5C3JB 5IA7A 1K8RB 4W9LA 4DHJB 1EUVB 1I4RA 2OEDA 4I6PA 4P6VF 2LGIA 1N5XA 3RMKC 3PLUA 3CF6E 4M0WA 1L2NA 4C56C 4ZRIA 3PRMB 3RUIB 2AL6A 2W3RA 2M56B 3HRDD 4AJWA 3U30A 2GBJA 4YTMB 3RNCC 1FIQA 3HUIA 3AV8A 2KWUB 1D3ZA 3QIJA 3N1XC 4DXGA 3MJWA 2DYBA 4NY0A 1DOXA 2GBRA 4PS3A 3CIRB 3LYYA 1ET9A 3V62A 2BYFA 3AMZA 4FHJA 5C23A 3LDZE 1P7EA 3CMMB 4KV2A 2WDVB 1WGHA 1IGCA 1WE6A 2PJHA 2QIEB 3AM9A 1C1YB 2NMQA 2L05A 2PEAA 4IM2A 3CSTA 2BBCA 1NYRA 1T3QA 3TMPB 2KJ6A 2K1FA 2KT7A 4G3XB 3RNBC 3U7DA 1F9JA 4OZCA 3AE2B 4JX1C 3EECA 1QF6A 1EWYC 3PREA 4H2AA 1QKZA 1WGDA 2FBWB 2DZIA 2MRPA 4BKSD 1R4MI 5L95C 1SE4A 3I9V1 2AQ2B 3ZTDA 3JSVA 2X38A 1D5ZC 4JPSA 2INDC 3HHMA 3AULA 2W55A 3MJ5A 1Z2MA 3H7PA 2VRRB 3DBLI 1OFFA 2KD0A 5JHAA 4TQ0A 3BYTB 5CX3A 1D5MC 1WGGA 1WF9A 3DWMA 1SJED 2PKOA 2UWQA 2LEKA 3SU8X 4GXBA 5EE3A 3T3OA 2YLMA 3ZXVA 2KO3A 2MP2B 1XCQL 3ALBA 3Q6BA 3E9SA 3PRPB 4ICUA 1YN3A 4YWGG 3L0WB 4TV3A 4XE0A 3L10B 4OW0A 3E56A 2CHWA 1R4MB 2BGFA 4FJVB 5H92C 1OQYA 4GOCA 1PDXA 2HDEA 4C00A 2Z0DB 5GMVA 3CSFA 3DBLB 2D11A 1ZPSA 2BPSA 2O6VB 1KF6B 2ACZB 5IN7A 2GRIA 4ZOHC 1T0QC 1RAXA 2WX1A 2CS4A 2QCZA 2IGHA 1XXGA 1YD8U 2J0MA 2R2QA 3DBHI 2KDIA 3APFA 2QILA 4BBNF 2DZKA 5TR5A 2INCC 1MG8A 2KOXA 5HHDG 3WALA 4HPPA 4ZYSA 2WXJA 2V4IB 2A4ZA 1E9MA 4OZAA 2V3SA 3L08A 1UF0A 2D10A 1JCKB 2BW2A 2ZJDA 3AEDB 3SD5A 3DHGC 1ESFA 1YQ3B 1DOYA 3DVNV 5HG2A 3R2TA 4GB9A 5E6OA 3EA6A 4NNJB 3AECB 1F2RC 3IHPC 5EDSA 1WGKA 1I35A 2BQQA 2FUG1 3AE1B 4FADA 3ZQ4A 2LD9A 1QILA 3WANA 4BFRA 1C78A 2X8XX 3EHVA 2JZ3B 4NJ7A 5J18A 3DBHB 1BMLC 2RDBC 3HVZA 1CK1A 4YTNB 2BKFA 2IBIB 2N4FA 3NUHB 5CHFA 2BYEA 1IBXA 4A20A 2J52A 2KN4A 2YVCA 3T3NA 1E8XA 2G9HD 1K52A 1DOIA 3DVGY 2LVPA 2GOWA 1V5OA 3PTFC 3OJ3A 4WAAA 5DPWA 3ECIA 5CHVC 1J7BA 1WYWB 2JSVX 3V61A 5C1ZA 4A90A 2KJHB 3ZW3A 4HKQA 4HRSA 4RH6A 1FRRA 4ANXA 4GMVA 4W9JA 2JRHA 4MJSB 2LJ5A 2FIFA 2MSED 3FILB 3KUZA 3VTWA 3Q8AA 2UU7A 3R2IA 2GMIC 3RNAC 3N1YC 4KDIC 1QOAA 1FFUA 1AW7A 2FNJB 2JZPA 2UYZB 1GUAB 2ZW0A 1U4AA 2KDFB 4RGNA 4W9KA 3V05A 2WU2B 5DPRA 4XDCA 2MJ3A 1QOBA 4P16A 4C7ZA 4HCPB 4ANVA 4GIVA 4FBJB 1VD2A 3ONSA 1K53A 5D3IB 1HE8A 1T0SC 4IOIE 3P4QB 4JLCA 2QC8A 4W9CA 1SB3C 2C7HA 3A9KA 3TEXA 1F52A 2IDYA 3UIOB 3U2SC 4JGHB 4M0WB 2BS2B 3Q8FA 4W9HA 4BVUC 1MJDA 2XN9C 3NVVA 2OJWA 3WAMA 4OZBA 3O65B 2WHIA 4A3PA 1IUEA 2ASQA 4ZYNA 4M00A 1KRHA 2L7RA 3ZYYX 1BT0A 1KLGD 1NVID 5FKAC 3DOWA 2J0KA 1OEYJ 1IPGA 5IAAC 2NS5A 1WXMA 4C7YA 1JROA 5LXHA 3D32A 2LMCA 2NTSA 1YN4A 3UI3A 3VH4B 4II2B 1FNWA 1TBEA 4I6LB 3M95A 4BZAA 3GS2A 2JU6X 5G55A 4XZ4A 1E7PB 1WI0A 5C2TB 3RCZA 4BKTA 3IXSA 2C9WB 4CYEA 2DBYA 2HJ1A 4HPMB 5J17A 1EF5A 1E90A 4IW0A 4GSWA 4IWPA 1V1PA 1T5XD 3BZDB 5FR3A 1GB1A 3Q3JA 2O2VB 2M4NA 4W9GA 4XX5A 4MT5A 2WXFA 3NY5A 3PVLA 2AYOB 2MX2A 3N32A 2LUMA 3VFKA 3JSVB 4NZLB 3SEBA 4G11A 4S0RA 1F2RI 2Y5PA 2FCNA 2LRUA 3H7PB 4C80A 2O6VA 4KIKA 1WXVA 1JRUA 3I5JC 4MACA 1GG3A 5IO9A 1V2YA 3ZLZA 3ZO5B 2PE6B 3MP9A 4MGYE 1P7FA 2IGGA 3I63C 1E8YA 4AUQC 3KUCB 1N61A 3QCAA 2KMMA 3UIPB 4XYCA 4XGAB 3NVWA 4K7WA 2JWUA 1LGRA 1L7YA 2JX5A 2LGYA 3EFUA 5KHQA 3KWVA 1MPEA 2C5LC 1PFDA 1RFKA 2K8BA 2LHEA 3N1ZC 1WMHA 3KQ4A 1VLBA 3ZNZB 1WXSA 4XWWA 1L4DB 2RDHA 3KWLA 4OHJA 2I2YA 2VH2A 2DHZA 3DVGX 1AN8A 1P3QU 2C7MB 4GDLA 2XNAC 3R3MA 2PE9A 4O1NA 4RFBA 2WP9B 2YEPB 1JMLA 5J2RA 2FCSA 1TYGB 2KTFA 2Y5BB 2BVCA 1P1AA 2W3SA 1YJIA 3X0WA 2AWTA 4MSQB 1SE9A 3ZNGC 2MBOA 3M63B 3BVGA 3P4PB 5BMHA 1XQQA 1STEA 2MCNB 1SJHD 4BBNC 2DZJA 2AEHA 1C4PA 2MHJA 5JH5C 2MLBA 1MG4A 4AJYB 4UDUC 2J0JA 1Q0WB 2RPVA 4DWFA 4WURA 1I4PA 4WWPA 1PGXA 3VH3B 2WS3B 3PZDA 4N6EB 1V97A 5I4DA 4J3OD 3APCA 3MHSD 4HEA1 2WXNA 3PHWB 4BOSC 2WXOA 4WIPA 3L16A 2DAJA 4MGZE 1KM7A 1QZEA 2E3TA 1IBXB 3BWUD 2FIDA 3H9DA 1ZP0B 4LDTB 1N5WA 2QDFA 5DPTA 3N3KB 1SIJA 2INPE 3PPAA 1KFYB 3TSSA 1Y8RC 3R66C 2N7JA 1VZ6A 1WJNA 2N9LA 1A5RA 4MDKE 1ROEA 1WX8A 2KC2A 2LGSA 3JYUA 1R4NI 3WIMA 4USAA 2IO1B 4DDGD 1QLBB 2ZCCA 1DGJA 1XD3B 1GNUA 2JF5A 3TBLD 1FNUA 1XLPA 5D6JB 5AEKB 1I7HA 3IAS1 2N1WA 1K51A 1EU3A 1JWAD 3R7RA 3U52E
chains in the Genus database with same CATH topology
2I1JA 4RM8A 2A4ZA 2LZ6A 4IM3A 3VUYA 2FCMA 2FUHB 3ZUNA 2V3SA 2KFKB 3L08A 3MTNB 4IC7B 4WJOA 2D10A 2IY1B 1UGMA 2GBMA 1GJZA 2ZJDA 2EKEC 3SD5A 1M94A 3DVNV 4WWOA 1C3TA 2NBVB 3PT2B 5E6NA 4HLEA 4GB9A 2MBQA 2KJRA 5E6OA 4NNJB 2WDTB 3DCGA 4FJZA 1OTRB 2OOBB 3IBEA 4RM9A 1X1MA 3IHPC 2L0TA 3A1QB 3ZDTA 3QAQA 4E71A 5EDSA 3U8ZA 1I35A 1NBFC 3A9KB 4MH0E 4F1SA 2G3QB 4EZJA 4FADA 4LJPB 2KWVB 3H6NA 2KDEB 1WR1A 5G2NA 2DENB 2LD9A 3WANA 4FN2A 4ASWC 4BFRA 2O2VA 2BYVE 4IWOA 2ZPNA 2V4LA 3EHVA 3L13A 3RD2A 2JZ3B 4NJ7A 2DX5B 2QHOA 3WA0A 5J18A 3AU4A 4FA6A 2LVQA 2KX0A 3VAWA 3X23A 2MA9B 3A9JA 3B08A 4BKSA 3RYTA 2CHXA 2LRWA 1VCBA 2MBBB 2JVCA 2BKFA 2IBIB 2MP2A 2N4FA 1IP9A 5AZFA 2KHWB 5CHFA 2BYEA 2V1YA 4K1RB 3T8MA 4A20A 1E8WA 1S3SG 2YVCA 4WWNA 1E8XA 4WJPA 2IY0B 4M8MA 2Z59B 2CKHB 3DVGY 2LVPA 3KUDB 2GOWA 1V5OA 2KWCA 2JXXA 3PTFC 3OJ3A 4WAAA 3QA8A 3V6CB 2K8HA 2K6QA 3PS6A 1WJ4A 1TGZB 4EFOA 2D3GA 3HIZA 5DPWA 3NZSA 4MSMB 3ECIA 3ZNHB 3A4SC 5CHVC 4ZDVA 1V9JA 1WYWB 2CR5A 3BY4B 4PYUA 2KK8A 2JUOA 3UQBA 4W9EA 4GDKA 3V61A 4AWJA 5C1ZA 2KJHB 3ZW3A 2BKRB 2NCNA 1V5TA 4GU2A 4MGIE 1YX5B 4TKNA 2JPHA 2ZCBA 4ANXA 3R7QA 3QK0A 4GMVA 1LFDA 4GGQA 4HJKA 4W9JA 2BF8B 2JRHA 4MJSB 4EEWA 3L17A 2LJ5A 3AU5A 1Z5SB 2FAZA 2N1VA 2FIFA 3C0RB 3N30A 1WZ0A 2MSED 3IG3A 2W9NA 3TCAA 3KUZA 4JL9A 3APDA 2MBHA 2DYOA 3VTWA 4ZRKA 2LXCA 2N9PC 3H7SA 4II3B 4NJ6A 1G6JA 1EO6A 3WAOA 2GMIC 3DDCB 3NOBA 4KDIC 1WM2A 4KSKC 2ZNVB 2FNJB 2UYZB 1GUAB 2HJ8A 5JHBA 3KYDD 2LWPA 1U4AA 2GBKA 1E7VA 2KDFB 2WWZA 4FLHA 4W9KA 3UF8A 5D94A 4JQWC 4KIKB 5DPRA 5BO4B 2JT4B 4HPLB 4HDQA 3P2BA 3DQVA 2M1MA 1V81A 4K7SA 4HCPB 2IO3B 3ZTCA 2BWFA 1V49A 4ANVA 3QQ8B 2KX3A 3I3TB 2KLCA 3UINB 4GIVA 4DK5A 4FBJB 1ZGUB 4HDOA 2MQJA 1VD2A 2I1KA 3VTVA 3ONSA 1XT9B 4F7ZA 3W1SA 2KDBA 2EMTA 5CTRC 1HE8A 4ANWA 2LXAA 5LXIB 2ZZPB 1ZW7A 2HTHA 3QJZA 2C60A 3TL5A 2ZNVC 2KXJA 4E74A 3DPDA 4JLCA 4WQOB 3A1QA 4W9CA 3W1YA 3ZVVA 3ENEA 4ZRJA 2C7HA 2KNBA 1WJUA 4EZLA 1OGWA 2KQSA 3A9KA 4CHKA 2B3AA 2N9EB 1TTNA 3WAPA 2CHZA 4PS8A 3UIOB 3Q3FA 2K39A 4JGHB 4M0WB 4IM0A 4CO7A 2DAFA 1ZKHA 4W9HA 2L8JA 4BVUC 4DBGA 4DDID 3ML9A 4KVGB 4KSLC 3S2AA 5AZGA 2ZEQA 4MEMA 4N9F4 3WAMA 1WGYA 2RGFA 5E6PA 3VHTC 3O65B 1Q5WB 4EUTA 4A3PA 2LVOA 3HK0A 2ASQA 4ZYNA 2CU1A 1KJTA 2IYDB 1WFYA 4KZCA 1WMHB 2L7RA 2KFJA 3DVNU 3VUWA 1UH6A 3PLVA 3L54A 1UELA 3PGEA 4DHZB 1BT0A 2PPHA 4G0NB 4BOZB 3OLMD 1WM3A 2R2OA 4EOYA 4HWIB 3DOWA 2J0KA 1P98A 4FJYA 1LXDA 4B9KA 2N7DA 1OEYJ 3K9OB 1IPGA 4FHKA 1I42A 5IAAC 2NS5A 2OJRA 1WXMA 1TZ1A 2G4DB 5LXHA 3D32A 3K9PB 3W1SC 2XK5A 2BWES 4GDLB 3SDLC 4NAWB 2KKCA 1WXAA 1GC7A 4WJQA 2KZRA 1H4RA 1UBIA 3T9LA 3VH4B 3DBRI 4II2B 3AI5A 3BINA 1TBEA 3NHEB 3M95A 4I6LB 4B6WA 2RPQA 1H8CA 3ZRFA 1WJ6A 5G55A 1E5WA 4XZ4A 4AP4C 5FR6A 2KVRA 1WR6E 1WI0A 1EF1A 4OVUA 3RCZA 4BKTA 4CYEA 2C9WB 2K8CA 1AARA 4HPMB 2WX0A 2NPTB 4DXAB 5J17A 1EF5A 1E90A 1YX6B 4IW0A 4GSWA 4IWPA 4URKA 3A33B 1LM8B 4MJSA 3B1LX 4X57B 3HM6X 3Q3JA 4LCDE 2O2VB 2DZMA 2M4NA 2LGDA 2JRIB 4W9GA 3ZNID 2LGXA 1V80A 4XX5A 5D7GA 2M8SA 2HD5B 4HVBA 2JZZA 3NY5A 3PVLA 2AYOB 2MX2A 3N32A 4WJNA 2KTRB 3VFKA 1J8CA 1GC6A 3JSVB 3V60A 3JW0X 2G4SA 3HM3A 4G11A 3A9JB 1E8ZA 2RSUA 1P0RA 2FCNA 2LRUA 4IUMB 4B95A 3H7PB 3VDZA 2KN5A 4EKUA 2RD0A 2O6VA 2D07B 4KIKA 3A4RA 4DHJD 1WXVA 1JRUA 1GG3A 3IVFA 3QARA 1V6EA 4MM3A 5L83A 1V2YA 2FCQA 3ZLZA 4J6IA 2WYQA 1E7UA 1PQSA 1YIWA 3ZO5B 2PE6B 3TIXA 2NVUI 3KVFB 4MGYE 4K81A 1E8YA 3SHQA 1FXTB 3DBSA 4FULA 3M3JA 4AUQC 3KUCB 3RULA 4NPNA 1KLVA 3QCAA 4TQ1A 1OEYA 3UIPB 3M62B 3KYCD 2ZPYA 4E3CA 2KFKA 4GDKB 3KW5B 1UZXB 5IA7A 4I6NB 5DPSA 1K8RB 4W9LA 1WE7A 4K7WA 2XBBC 4DHJB 1EUVB 4I6PA 1WX9A 2NBWB 4PS7A 1SIFA 4IG7B 1L7YA 3PLUA 3CF6E 3ZRCA 2IZVB 2LGYA 3QX1A 3EFUA 3B0AA 4ZRIA 1L2NA 1Q1OA 3PRMB 5KHQA 4F8CB 5DCNA 3RUIB 1WIAA 2AL6A 2C5LC 4AJWA 3U30A 3ZIMA 2GBJA 2JWZA 4W9DA 2K8BA 4GN1A 4K7UA 2KWUB 3OAWA 3QIJA 2C7NB 1D3ZA 2HE7A 1WMHA 3MJWA 4IWQA 2DYBA 3GOEA 4NY0A 3ZNZB 1J19A 1WXSA 2GBRA 4PS3A 5LLIA 2G45B 5HKHA 3V62A 2DHZA 4HK2A 3RT3B 2BYFA 3DVGX 3IFWB 4PYZA 4FHJA 5C23A 3LDZE 1P3QU 2LASA 3PV1A 3CMMB 2C7MB 4GDLA 3R3MA 2PE9A 2NR2A 3JVZX 2AL3A 4KV2A 4NAWA 1WGHA 1WE6A 2PJHA 5J2RA 2FCSA 1C1YB 2L05A 2PEAA 2KMAA 3RZFA 2KTFA 2Y5BB 2NBUA 1P1AA 3NZUA 2EMSA 3QWZB 4XC2A 4IM2A 4KDLB 2KQ7A 2REXA 3CSTA 2AWTA 3X0WA 2Z0EB 1SGHA 4MSQB 1SE9A 2KANA 2NPTA 1NDDA 3ZNGC 4MELA 3TMPB 2MBOA 2KJ6A 2K1FA 4LJOB 1S1QB 3M63B 4W9FA 4G3XB 4OVVA 3U7DA 1F9JA 3UQAA 3EECA 3PRZA 1XQQA 3V6EB 3VXWA 1J0GA 2MCNB 4BBNC 3H1UA 3PREA 2DZJA 2KC1A 1WGDA 2AEHA 2M17A 2DZIA 2MRPA 4HCNB 1R4MI 2MLBA 4BKSD 5JH5C 5JZEB 5L95C 3ZTDA 4AJYB 2KTRA 2J0JA 2MW5A 1Q0WB 3JSVA 4DWFA 4P7IA 1WH3A 3HHMA 3AULA 3ZKJC 1V86A 1Z2MA 3H7PA 2K25A 2VRRB 1WZ3A 3DBLI 4LDTD 2KD0A 2ZVOA 4WWPA 4TQ0A 5JHAA 4G50A 3VH3B 5CX3A 3QHTA 3OJ4B 1LQBA 3PZDA 1WGGA 3PSEB 1IYFA 1WF9A 1RFAA 4ANUA 2UWQA 3VVWB 3APCA 3MHSD 4TUUA 3SU8X 2MWSB 4GXBA 3PHWB 2XK5B 1RLFA 2YLMA 4BOSC 2J7QB 1RRBA 3TJPA 2XEWA 2KO3A 3L16A 4A3OA 2DAJA 4MGZE 2MP2B 1KM7A 1QZEA 2RR9A 3ALBA 1P9DU 2IO0B 2FIDA 2L76A 3H9DA 2LI5A 4LDTB 4W9IA 3RZWC 4NQKE 5DPTA 3PRPB 2KMCA 1WX7A 4ICUA 2N9XA 3N3KB 4AOFA 2LUEA 3LJ3A 2O6VD 3PPAA 2DYMA 3L0WB 4TV3A 3QC8B 4EZKA 1Y8RC 3R66C 2JY6A 2M0XA 3KH0A 1WJNA 2IO2B 3L10B 1A5RA 3VQIA 5AZHA 1CMXB 2CHWA 4MDKE 4BKGA 1WX8A 2KC2A 1WY8A 2BGFA 1NI2A 2KLGA 4FJVB 1ISNA 1UBQA 1OQYA 4GOCA 3PHXB 4DHZE 3JYUA 1T0YA 1R4NI 2Z0DB 5GMVA 3CSFA 3ZDMC 2L3ZA 2A5UA 2MBEA 4MGKE 3WIMA 1UD7A 3GZNI 2D11A 2BPSA 1YJ1A 3UGBB 3NS8A 2IO1B 4DDGD 2O6VB 2ZCCA 2L0FA 4RMAA 3EC8A 4KZ0A 1KOTA 1XD3B 3VUXA 1GNUA 4HXDA 1RAXA 2JF5A 2WX1A 3VTUA 2CS4A 3TBLD 4YL8A 5KHOA 1YD8U 1WGRA 2J0MA 2R2QA 2GBNA 2KDIA 3APFA 2K6DB 3DBHI 5D6JB 2L00B 5AEKB 4BBNF 2DZKA 5TR5A 1YQBA 4ICVA 2D2QA 2N1WA 2N7EA 5D2MB 5CHWA 1MG8A 1WRDB 3AXCA 4M8NA 3R7RA 2KOXA 3ML8A 2ZVNA 4JIOU 4NQLB 3WALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1J A;  4RM8 A;  2A4Z A;  2LZ6 A;  4IM3 A;  3VUY A;  2FCM A;  2FUH B;  3ZUN A;  2V3S A;  2KFK B;  3L08 A;  3MTN B;  4IC7 B;  4WJO A;  2D10 A;  2IY1 B;  1UGM A;  2GBM A;  1GJZ A;  2ZJD A;  2EKE C;  3SD5 A;  1M94 A;  3DVN V;  4WWO A;  1C3T A;  2NBV B;  3PT2 B;  5E6N A;  4HLE A;  4GB9 A;  2MBQ A;  2KJR A;  5E6O A;  4NNJ B;  2WDT B;  3DCG A;  4FJZ A;  1OTR B;  2OOB B;  3IBE A;  4RM9 A;  1X1M A;  3IHP C;  2L0T A;  3A1Q B;  3ZDT A;  3QAQ A;  4E71 A;  5EDS A;  3U8Z A;  1I35 A;  1NBF C;  3A9K B;  4MH0 E;  4F1S A;  2G3Q B;  4EZJ A;  4FAD A;  4LJP B;  2KWV B;  3H6N A;  2KDE B;  1WR1 A;  5G2N A;  2DEN B;  2LD9 A;  3WAN A;  4FN2 A;  4ASW C;  4BFR A;  2O2V A;  2BYV E;  4IWO A;  2ZPN A;  2V4L A;  3EHV A;  3L13 A;  3RD2 A;  2JZ3 B;  4NJ7 A;  2DX5 B;  2QHO A;  3WA0 A;  5J18 A;  3AU4 A;  4FA6 A;  2LVQ A;  2KX0 A;  3VAW A;  3X23 A;  2MA9 B;  3A9J A;  3B08 A;  4BKS A;  3RYT A;  2CHX A;  2LRW A;  1VCB A;  2MBB B;  2JVC A;  2BKF A;  2IBI B;  2MP2 A;  2N4F A;  1IP9 A;  5AZF A;  2KHW B;  5CHF A;  2BYE A;  2V1Y A;  4K1R B;  3T8M A;  4A20 A;  1E8W A;  1S3S G;  2YVC A;  4WWN A;  1E8X A;  4WJP A;  2IY0 B;  4M8M A;  2Z59 B;  2CKH B;  3DVG Y;  2LVP A;  3KUD B;  2GOW A;  1V5O A;  2KWC A;  2JXX A;  3PTF C;  3OJ3 A;  4WAA A;  3QA8 A;  3V6C B;  2K8H A;  2K6Q A;  3PS6 A;  1WJ4 A;  1TGZ B;  4EFO A;  2D3G A;  3HIZ A;  5DPW A;  3NZS A;  4MSM B;  3ECI A;  3ZNH B;  3A4S C;  5CHV C;  4ZDV A;  1V9J A;  1WYW B;  2CR5 A;  3BY4 B;  4PYU A;  2KK8 A;  2JUO A;  3UQB A;  4W9E A;  4GDK A;  3V61 A;  4AWJ A;  5C1Z A;  2KJH B;  3ZW3 A;  2BKR B;  2NCN A;  1V5T A;  4GU2 A;  4MGI E;  1YX5 B;  4TKN A;  2JPH A;  2ZCB A;  4ANX A;  3R7Q A;  3QK0 A;  4GMV A;  1LFD A;  4GGQ A;  4HJK A;  4W9J A;  2BF8 B;  2JRH A;  4MJS B;  4EEW A;  3L17 A;  2LJ5 A;  3AU5 A;  1Z5S B;  2FAZ A;  2N1V A;  2FIF A;  3C0R B;  3N30 A;  1WZ0 A;  2MSE D;  3IG3 A;  2W9N A;  3TCA A;  3KUZ A;  4JL9 A;  3APD A;  2MBH A;  2DYO A;  3VTW A;  4ZRK A;  2LXC A;  2N9P C;  3H7S A;  4II3 B;  4NJ6 A;  1G6J A;  1EO6 A;  3WAO A;  2GMI C;  3DDC B;  3NOB A;  4KDI C;  1WM2 A;  4KSK C;  2ZNV B;  2FNJ B;  2UYZ B;  1GUA B;  2HJ8 A;  5JHB A;  3KYD D;  2LWP A;  1U4A A;  2GBK A;  1E7V A;  2KDF B;  2WWZ A;  4FLH A;  4W9K A;  3UF8 A;  5D94 A;  4JQW C;  4KIK B;  5DPR A;  5BO4 B;  2JT4 B;  4HPL B;  4HDQ A;  3P2B A;  3DQV A;  2M1M A;  1V81 A;  4K7S A;  4HCP B;  2IO3 B;  3ZTC A;  2BWF A;  1V49 A;  4ANV A;  3QQ8 B;  2KX3 A;  3I3T B;  2KLC A;  3UIN B;  4GIV A;  4DK5 A;  4FBJ B;  1ZGU B;  4HDO A;  2MQJ A;  1VD2 A;  2I1K A;  3VTV A;  3ONS A;  1XT9 B;  4F7Z A;  3W1S A;  2KDB A;  2EMT A;  5CTR C;  1HE8 A;  4ANW A;  2LXA A;  5LXI B;  2ZZP B;  1ZW7 A;  2HTH A;  3QJZ A;  2C60 A;  3TL5 A;  2ZNV C;  2KXJ A;  4E74 A;  3DPD A;  4JLC A;  4WQO B;  3A1Q A;  4W9C A;  3W1Y A;  3ZVV A;  3ENE A;  4ZRJ A;  2C7H A;  2KNB A;  1WJU A;  4EZL A;  1OGW A;  2KQS A;  3A9K A;  4CHK A;  2B3A A;  2N9E B;  1TTN A;  3WAP A;  2CHZ A;  4PS8 A;  3UIO B;  3Q3F A;  2K39 A;  4JGH B;  4M0W B;  4IM0 A;  4CO7 A;  2DAF A;  1ZKH A;  4W9H A;  2L8J A;  4BVU C;  4DBG A;  4DDI D;  3ML9 A;  4KVG B;  4KSL C;  3S2A A;  5AZG A;  2ZEQ A;  4MEM A;  4N9F 4;  3WAM A;  1WGY A;  2RGF A;  5E6P A;  3VHT C;  3O65 B;  1Q5W B;  4EUT A;  4A3P A;  2LVO A;  3HK0 A;  2ASQ A;  4ZYN A;  2CU1 A;  1KJT A;  2IYD B;  1WFY A;  4KZC A;  1WMH B;  2L7R A;  2KFJ A;  3DVN U;  3VUW A;  1UH6 A;  3PLV A;  3L54 A;  1UEL A;  3PGE A;  4DHZ B;  1BT0 A;  2PPH A;  4G0N B;  4BOZ B;  3OLM D;  1WM3 A;  2R2O A;  4EOY A;  4HWI B;  3DOW A;  2J0K A;  1P98 A;  4FJY A;  1LXD A;  4B9K A;  2N7D A;  1OEY J;  3K9O B;  1IPG A;  4FHK A;  1I42 A;  5IAA C;  2NS5 A;  2OJR A;  1WXM A;  1TZ1 A;  2G4D B;  5LXH A;  3D32 A;  3K9P B;  3W1S C;  2XK5 A;  2BWE S;  4GDL B;  3SDL C;  4NAW B;  2KKC A;  1WXA A;  1GC7 A;  4WJQ A;  2KZR A;  1H4R A;  1UBI A;  3T9L A;  3VH4 B;  3DBR I;  4II2 B;  3AI5 A;  3BIN A;  1TBE A;  3NHE B;  3M95 A;  4I6L B;  4B6W A;  2RPQ A;  1H8C A;  3ZRF A;  1WJ6 A;  5G55 A;  1E5W A;  4XZ4 A;  4AP4 C;  5FR6 A;  2KVR A;  1WR6 E;  1WI0 A;  1EF1 A;  4OVU A;  3RCZ A;  4BKT A;  4CYE A;  2C9W B;  2K8C A;  1AAR A;  4HPM B;  2WX0 A;  2NPT B;  4DXA B;  5J17 A;  1EF5 A;  1E90 A;  1YX6 B;  4IW0 A;  4GSW A;  4IWP A;  4URK A;  3A33 B;  1LM8 B;  4MJS A;  3B1L X;  4X57 B;  3HM6 X;  3Q3J A;  4LCD E;  2O2V B;  2DZM A;  2M4N A;  2LGD A;  2JRI B;  4W9G A;  3ZNI D;  2LGX A;  1V80 A;  4XX5 A;  5D7G A;  2M8S A;  2HD5 B;  4HVB A;  2JZZ A;  3NY5 A;  3PVL A;  2AYO B;  2MX2 A;  3N32 A;  4WJN A;  2KTR B;  3VFK A;  1J8C A;  1GC6 A;  3JSV B;  3V60 A;  3JW0 X;  2G4S A;  3HM3 A;  4G11 A;  3A9J B;  1E8Z A;  2RSU A;  1P0R A;  2FCN A;  2LRU A;  4IUM B;  4B95 A;  3H7P B;  3VDZ A;  2KN5 A;  4EKU A;  2RD0 A;  2O6V A;  2D07 B;  4KIK A;  3A4R A;  4DHJ D;  1WXV A;  1JRU A;  1GG3 A;  3IVF A;  3QAR A;  1V6E A;  4MM3 A;  5L83 A;  1V2Y A;  2FCQ A;  3ZLZ A;  4J6I A;  2WYQ A;  1E7U A;  1PQS A;  1YIW A;  3ZO5 B;  2PE6 B;  3TIX A;  2NVU I;  3KVF B;  4MGY E;  4K81 A;  1E8Y A;  3SHQ A;  1FXT B;  3DBS A;  4FUL A;  3M3J A;  4AUQ C;  3KUC B;  3RUL A;  4NPN A;  1KLV A;  3QCA A;  4TQ1 A;  1OEY A;  3UIP B;  3M62 B;  3KYC D;  2ZPY A;  4E3C A;  2KFK A;  4GDK B;  3KW5 B;  1UZX B;  5IA7 A;  4I6N B;  5DPS A;  1K8R B;  4W9L A;  1WE7 A;  4K7W A;  2XBB C;  4DHJ B;  1EUV B;  4I6P A;  1WX9 A;  2NBW B;  4PS7 A;  1SIF A;  4IG7 B;  1L7Y A;  3PLU A;  3CF6 E;  3ZRC A;  2IZV B;  2LGY A;  3QX1 A;  3EFU A;  3B0A A;  4ZRI A;  1L2N A;  1Q1O A;  3PRM B;  5KHQ A;  4F8C B;  5DCN A;  3RUI B;  1WIA A;  2AL6 A;  2C5L C;  4AJW A;  3U30 A;  3ZIM A;  2GBJ A;  2JWZ A;  4W9D A;  2K8B A;  4GN1 A;  4K7U A;  2KWU B;  3OAW A;  3QIJ A;  2C7N B;  1D3Z A;  2HE7 A;  1WMH A;  3MJW A;  4IWQ A;  2DYB A;  3GOE A;  4NY0 A;  3ZNZ B;  1J19 A;  1WXS A;  2GBR A;  4PS3 A;  5LLI A;  2G45 B;  5HKH A;  3V62 A;  2DHZ A;  4HK2 A;  3RT3 B;  2BYF A;  3DVG X;  3IFW B;  4PYZ A;  4FHJ A;  5C23 A;  3LDZ E;  1P3Q U;  2LAS A;  3PV1 A;  3CMM B;  2C7M B;  4GDL A;  3R3M A;  2PE9 A;  2NR2 A;  3JVZ X;  2AL3 A;  4KV2 A;  4NAW A;  1WGH A;  1WE6 A;  2PJH A;  5J2R A;  2FCS A;  1C1Y B;  2L05 A;  2PEA A;  2KMA A;  3RZF A;  2KTF A;  2Y5B B;  2NBU A;  1P1A A;  3NZU A;  2EMS A;  3QWZ B;  4XC2 A;  4IM2 A;  4KDL B;  2KQ7 A;  2REX A;  3CST A;  2AWT A;  3X0W A;  2Z0E B;  1SGH A;  4MSQ B;  1SE9 A;  2KAN A;  2NPT A;  1NDD A;  3ZNG C;  4MEL A;  3TMP B;  2MBO A;  2KJ6 A;  2K1F A;  4LJO B;  1S1Q B;  3M63 B;  4W9F A;  4G3X B;  4OVV A;  3U7D A;  1F9J A;  3UQA A;  3EEC A;  3PRZ A;  1XQQ A;  3V6E B;  3VXW A;  1J0G A;  2MCN B;  4BBN C;  3H1U A;  3PRE A;  2DZJ A;  2KC1 A;  1WGD A;  2AEH A;  2M17 A;  2DZI A;  2MRP A;  4HCN B;  1R4M I;  2MLB A;  4BKS D;  5JH5 C;  5JZE B;  5L95 C;  3ZTD A;  4AJY B;  2KTR A;  2J0J A;  2MW5 A;  1Q0W B;  3JSV A;  4DWF A;  4P7I A;  1WH3 A;  3HHM A;  3AUL A;  3ZKJ C;  1V86 A;  1Z2M A;  3H7P A;  2K25 A;  2VRR B;  1WZ3 A;  3DBL I;  4LDT D;  2KD0 A;  2ZVO A;  4WWP A;  4TQ0 A;  5JHA A;  4G50 A;  3VH3 B;  5CX3 A;  3QHT A;  3OJ4 B;  1LQB A;  3PZD A;  1WGG A;  3PSE B;  1IYF A;  1WF9 A;  1RFA A;  4ANU A;  2UWQ A;  3VVW B;  3APC A;  3MHS D;  4TUU A;  3SU8 X;  2MWS B;  4GXB A;  3PHW B;  2XK5 B;  1RLF A;  2YLM A;  4BOS C;  2J7Q B;  1RRB A;  3TJP A;  2XEW A;  2KO3 A;  3L16 A;  4A3O A;  2DAJ A;  4MGZ E;  2MP2 B;  1KM7 A;  1QZE A;  2RR9 A;  3ALB A;  1P9D U;  2IO0 B;  2FID A;  2L76 A;  3H9D A;  2LI5 A;  4LDT B;  4W9I A;  3RZW C;  4NQK E;  5DPT A;  3PRP B;  2KMC A;  1WX7 A;  4ICU A;  2N9X A;  3N3K B;  4AOF A;  2LUE A;  3LJ3 A;  2O6V D;  3PPA A;  2DYM A;  3L0W B;  4TV3 A;  3QC8 B;  4EZK A;  1Y8R C;  3R66 C;  2JY6 A;  2M0X A;  3KH0 A;  1WJN A;  2IO2 B;  3L10 B;  1A5R A;  3VQI A;  5AZH A;  1CMX B;  2CHW A;  4MDK E;  4BKG A;  1WX8 A;  2KC2 A;  1WY8 A;  2BGF A;  1NI2 A;  2KLG A;  4FJV B;  1ISN A;  1UBQ A;  1OQY A;  4GOC A;  3PHX B;  4DHZ E;  3JYU A;  1T0Y A;  1R4N I;  2Z0D B;  5GMV A;  3CSF A;  3ZDM C;  2L3Z A;  2A5U A;  2MBE A;  4MGK E;  3WIM A;  1UD7 A;  3GZN I;  2D11 A;  2BPS A;  1YJ1 A;  3UGB B;  3NS8 A;  2IO1 B;  4DDG D;  2O6V B;  2ZCC A;  2L0F A;  4RMA A;  3EC8 A;  4KZ0 A;  1KOT A;  1XD3 B;  3VUX A;  1GNU A;  4HXD A;  1RAX A;  2JF5 A;  2WX1 A;  3VTU A;  2CS4 A;  3TBL D;  4YL8 A;  5KHO A;  1YD8 U;  1WGR A;  2J0M A;  2R2Q A;  2GBN A;  2KDI A;  3APF A;  2K6D B;  3DBH I;  5D6J B;  2L00 B;  5AEK B;  4BBN F;  2DZK A;  5TR5 A;  1YQB A;  4ICV A;  2D2Q A;  2N1W A;  2N7E A;  5D2M B;  5CHW A;  1MG8 A;  1WRD B;  3AXC A;  4M8N A;  3R7R A;  2KOX A;  3ML8 A;  2ZVN A;  4JIO U;  4NQL B;  3WAL A; 
#chains in the Genus database with same CATH topology
 2LZ6 A;  4IM3 A;  1C77 A;  2FUH B;  3C8Y A;  1BUI C;  4WJO A;  1FD6 A;  2H88 B;  2IY1 B;  4WQM A;  3RNG C;  4WWO A;  1LO5 D;  1SF0 A;  4C4V B;  3DCG A;  2GLS A;  1EM7 A;  1OTR B;  2OOB B;  3O13 A;  1F77 A;  3IBE A;  4RM9 A;  1JQ4 A;  3NVY A;  3ZDT A;  3P1M A;  3QAQ A;  1FXI A;  2KQ4 X;  3A9K B;  1R4N B;  4MH0 E;  4F1S A;  4EZJ A;  1M4V A;  1ZXI A;  3H6N A;  2KDE B;  2O2V A;  4IWO A;  3L13 A;  3P4R B;  4AQ7 A;  2QHO A;  3WA0 A;  3AU4 A;  2LVQ A;  2KX0 A;  3VAW A;  2R61 A;  2WXQ A;  3X23 A;  4D2K A;  4BKS A;  2BB6 A;  2LRW A;  1VCB A;  1TKG A;  2MBB B;  3URY A;  1TKE A;  2MJE A;  5AZF A;  4K1R B;  3DHI C;  2JYT A;  1L4Z B;  2IY0 B;  2CKH B;  3KUD B;  2KWC A;  2JXX A;  2WQY B;  2D3A A;  1C79 A;  1TGZ B;  1EWC A;  1JWB D;  3HIZ A;  1QQR A;  3NZS A;  4ZDV A;  2VZK D;  2BKR B;  2NCN A;  1V5T A;  4GU2 A;  4TKN A;  1YX5 B;  2JPH A;  3EGR A;  4CQN A;  3AN1 A;  4HJK A;  2KYW A;  3V3X A;  3L17 A;  1Z5S B;  2FAZ A;  3C0R B;  3N30 A;  1WZ0 A;  3IG3 A;  3RNF C;  3Q69 A;  3TCA A;  1V1P B;  2MBH A;  3WAO A;  2Y3A A;  5JHB A;  3KYD D;  1E7V A;  2WWZ A;  4JQW C;  4KIK B;  3CWI A;  4HPL B;  3P2B A;  3BVM A;  1HQR D;  1FO4 A;  2M1M A;  2WDR B;  1V49 A;  3QQ8 B;  3I3T B;  3H8H A;  2LHD A;  2MQJ A;  3W1S A;  5CTR C;  4ANW A;  2LXA A;  2M19 A;  2ZZP B;  2HTH A;  4E74 A;  2ZNV C;  4RF1 A;  4WQO B;  1I4G A;  3A1Q A;  1GAQ B;  1L0V B;  1TY2 A;  2KNB A;  2KQS A;  2K22 A;  4CHK A;  2N9E B;  1WRI A;  2QSD A;  4BAX A;  4PS8 A;  2AQ1 B;  2K39 A;  1YOV B;  1FPY A;  4IM0 A;  2WXP A;  2DAF A;  4DBG A;  4NAM A;  3ML9 A;  4KVG B;  3S2A A;  2BYT A;  3W2D A;  4TMA B;  4N9F 4;  1UWX A;  1WGY A;  5E6P A;  1Q5W B;  4EUT A;  4A6Q A;  2KAJ A;  3HK0 A;  2IYD B;  1WMH B;  3VUW A;  1UEL A;  2BS4 B;  3PGE A;  4DHZ B;  1WSP A;  5E6J A;  2R2O A;  4HWI B;  2IJ0 A;  2N7D A;  2WXR A;  1HXY D;  1TZ1 A;  1CZP A;  3W1S C;  2BWE S;  4GDL B;  2KZR A;  5LNK 1;  1UBI A;  3T9L A;  2RPQ A;  1H8C A;  3EFC A;  1ZXH A;  4AP4 C;  1WR6 E;  2PMV A;  4IDI A;  1EF1 A;  4DXA B;  1YX6 B;  1JW9 D;  1ZDX A;  3NRZ A;  4Q2J A;  2DZM A;  4EE2 A;  5D7G A;  2M8S A;  2HD5 B;  4HVB A;  4IKG A;  2JZZ A;  4LLG M;  4WJN A;  1J8C A;  3V60 A;  2G4S A;  3A9J B;  2RSU A;  2PTL A;  2RD0 A;  2D07 B;  1J7C A;  4DHJ D;  2KWD A;  1NEN B;  3AEB B;  3ETR A;  1E7U A;  3Q8B A;  1PQS A;  1YIW A;  3TIX A;  3Q3M C;  3SHQ A;  3BII D;  1FEH A;  4FUL A;  3M3J A;  3RUL A;  2D3C A;  3M62 B;  4E3C A;  4MH8 A;  2XBB C;  1WX9 A;  2NBW B;  4PS7 A;  4IG7 B;  5IP4 D;  3ZRC A;  4C4V A;  2IPK D;  3B0A A;  5H8Y E;  1I4X A;  1Q1O A;  2WGS A;  5DCN A;  1WIA A;  4PK1 A;  3ZIM A;  3AE7 B;  4W9D A;  4LNK A;  4K7U A;  3AH7 A;  4ZHP A;  2BS3 B;  3ZJV A;  3B9J A;  4IWQ A;  3GOE A;  1J19 A;  2ON8 A;  3MHZ A;  5LLI A;  4HK2 A;  3IFW B;  5BMG A;  2Z8L A;  2ONQ A;  2LAS A;  3PV1 A;  4NAW A;  3JVZ X;  1TS2 A;  4HRO A;  1PUT A;  5T8I A;  1GPX A;  3SR6 A;  3RZF A;  2OHF A;  4XC2 A;  2EMS A;  1SSN A;  4KDL B;  2KQ7 A;  2ICI A;  4ZRQ A;  2Z0E B;  1SGH A;  3SFE B;  2KAN A;  2NPT A;  1NDD A;  2KVZ A;  1S1Q B;  1ZE3 D;  1SE3 A;  1Q10 A;  3FAH A;  2MJD A;  5EE0 A;  4LTU A;  3AB5 A;  4HCN B;  2K5P A;  5JZE B;  3R8B A;  2MW5 A;  3TEZ A;  2MH7 A;  1WH3 A;  5TSS A;  3ZKJ C;  1V86 A;  1D6E C;  2K25 A;  2ZVO A;  4G50 A;  3QHT A;  3OJ4 B;  1LQB A;  3AE6 B;  3DWG C;  3PSE B;  3NVZ A;  1AWD A;  3VVW B;  4TUU A;  2MWS B;  4L1B A;  2LJI A;  2XK5 B;  2J7Q B;  1RRB A;  4A3O A;  3P63 A;  1P9D U;  4KKJ A;  3LXF A;  2IO0 B;  4KGR A;  3TEW A;  4AS1 A;  3RZW C;  1V8C A;  3WCQ A;  1WX7 A;  1HZ5 A;  2N9X A;  2SAK A;  1E0Z A;  4AOF A;  2LUE A;  3LJ3 A;  2O6V D;  1N63 A;  2V3P A;  1R7S A;  3QC8 B;  3RPF C;  4EZK A;  3KH0 A;  4LNO A;  4BKG A;  1WY8 A;  1QT9 A;  1E6E B;  3Q8E A;  1UBQ A;  1NYQ A;  4RNA A;  1B1Z A;  3PHX B;  4DHZ E;  1T0Y A;  3Q8C A;  3ZDM C;  2D5G A;  2L3Z A;  2A5U A;  2MBE A;  4MGK E;  1UD7 A;  3GZN I;  3NS8 A;  1ET6 A;  1FM0 D;  4RMA A;  1NEK B;  3EC8 A;  4ACF A;  4HXD A;  3VTU A;  4MM3 B;  5KHO A;  1ZDV A;  3IT6 B;  2GBN A;  2K6D B;  3P42 A;  5AUI A;  1YQB A;  4HKZ E;  2N9K A;  2N7E A;  4ITK A;  5CHW A;  4M8N A;  3ML8 A;  2ZVN A;  2BTE A;  2YEP F;  2FCM A;  2KFK B;  3ZJU A;  2GBM A;  1XLN A;  3RFZ B;  2V9H A;  1M94 A;  2NBV B;  3PT2 B;  4HLE A;  4S17 A;  4FXC A;  2WDT B;  4FJZ A;  3GP7 A;  2PW9 A;  1VR9 A;  3J9C A;  1KTK A;  2BB5 A;  2L0T A;  3A1Q B;  5FK9 C;  4WWM A;  4E71 A;  3EUB 2;  1FCL A;  3U8Z A;  2G3Q B;  1TY0 A;  4LJP B;  2KWV B;  2QEJ C;  3GZN B;  2DEN B;  4K3B A;  2BYV E;  2ZPN A;  2L52 A;  4FA6 A;  1SEB D;  4A8X C;  2MA9 B;  3A9J A;  3B08 A;  1SXT A;  2JVC A;  2CJN A;  1VJK A;  1IP9 A;  1T6B X;  3DHH C;  3GE3 C;  3KLS X;  5G5G A;  1E8W A;  4WWN A;  3AEG B;  4M8M A;  3V6C B;  4P1B C;  2K6Q A;  3PS6 A;  4EFO A;  2D3G A;  4MSM B;  1F0Z A;  2CR5 A;  1WYG A;  3ZJT A;  2KK8 A;  2M0A A;  4W9E A;  4AWJ A;  3UQB A;  1ACC A;  3HVD A;  2I38 A;  1NI3 A;  1SBB B;  2ZCB A;  3W9C B;  3R7Q A;  3QK0 A;  5G5H A;  1YN5 A;  2L32 A;  4JWU C;  1TJE A;  4GGQ A;  2BF8 B;  2CJO A;  4EEW A;  2JXT A;  2W9N A;  2N0S B;  4JL9 A;  4KGS A;  2DYO A;  2W82 A;  4ZRK A;  2LXC A;  3H7S A;  1G6J A;  1EO6 A;  3DDC B;  4KSK C;  1WM2 A;  3AEF B;  4M02 A;  4GLS C;  1EU4 A;  2V0G A;  2GBK A;  4FLH A;  1GOZ A;  1FXA A;  5BO4 B;  3NJT A;  1MVK A;  4HDQ A;  1XLQ A;  4ZRP A;  2K0P A;  2IO3 B;  2E6X A;  2K3U A;  3GB1 A;  2BWF A;  4YTP B;  1AYF A;  1ZGU B;  2WU5 B;  1XT9 B;  2WXL A;  4F7Z A;  2KDB A;  2EMT A;  3QJZ A;  2KXJ A;  2V3N A;  3DPD A;  2D3B A;  3W1Y A;  3ENE A;  1JAL A;  1WXQ A;  4ZRJ A;  1WJU A;  1OGW A;  1N62 A;  1TTN A;  3WAP A;  3VR8 B;  4CO7 A;  3BVZ A;  2INN E;  4B0M A;  4DDI D;  4KSL C;  4YSX B;  4LK0 M;  4MEM A;  4R3D A;  1OQQ A;  4JE3 B;  3IAM 1;  3P4S B;  1TZO A;  4XDD A;  1KJT A;  1WFY A;  1XLO A;  2KFJ A;  3L54 A;  2PPH A;  3OLM D;  1WM3 A;  1UUP A;  2GB1 A;  4FJY A;  1P98 A;  3K9O B;  2IGD A;  1I42 A;  2OJR A;  4LNN A;  2G4D B;  2QMT A;  3K9P B;  2XK5 A;  3SDL C;  4NAW B;  5BMI A;  4WJQ A;  3NHE B;  5D3D A;  1WJ6 A;  1ENF A;  2FE8 A;  2Q5W D;  2KVR A;  5FR6 A;  2K8C A;  1D4B A;  1L6V A;  2NPT B;  5BYR A;  3A33 B;  1LM8 B;  3IT4 B;  4X57 B;  1PGB A;  3ZNI D;  1XF5 L;  1IGD A;  2JRI B;  2LGD A;  1TS5 A;  3NZ3 A;  2B76 B;  4B0E A;  1GC6 A;  4YSZ B;  3JW0 X;  1FFV A;  1KH0 A;  2ZW1 A;  1UNS A;  1P0R A;  1JWM D;  2KN5 A;  3AEE B;  3Q3O C;  2LFI A;  4KGT A;  1ZOY B;  1C9F A;  3QAR A;  4MM3 A;  5L83 A;  1CQV A;  2WNM A;  1XEE A;  4M01 A;  2DNF A;  5IOI A;  1SE2 A;  4K3C A;  2EKI A;  1KLV A;  1CJE A;  3VR9 B;  2DLB A;  1YMH E;  5AUK A;  3KYC D;  2ZPY A;  2KFK A;  4GDK B;  3KW5 B;  1UZX B;  4I6N B;  3MFG A;  5DPS A;  3VRB B;  1WE7 A;  4PT5 A;  1I4H A;  5BYS A;  2PVG C;  3PO0 A;  1SIF A;  1KLU D;  3C19 A;  2IZV B;  3QX1 A;  4F8C B;  3RI7 C;  2JQR B;  1MHH E;  2JWZ A;  4GN1 A;  1I4Q A;  2EEL A;  3OAW A;  2C7N B;  2BT6 A;  2HE7 A;  2L83 A;  2WDQ B;  2WLB A;  3FKY A;  2G45 B;  4RGT A;  5HKH A;  2PIA A;  3RT3 B;  4PYZ A;  2K9X A;  1RM6 C;  3FC4 A;  3NS1 A;  2NR2 A;  2AL3 A;  1L0Y B;  2KAC A;  4YT0 B;  3TUO A;  1HA5 A;  2CU3 A;  4US8 A;  2KMA A;  2L1A A;  2NBU A;  3NZU A;  3QWZ B;  1A70 A;  2REX A;  4DXF A;  4HJG E;  3OWE B;  4MEL A;  3ABV B;  4LJO B;  3LB8 C;  4W9F A;  4OVV A;  3UQA A;  1TIF A;  3PRZ A;  3V6E B;  3VXW A;  1J0G A;  4ARC A;  3H1U A;  2KC1 A;  3RNE C;  1L6U A;  2M17 A;  4A9A A;  2KTR A;  4L2Y A;  4JWS C;  1PGA A;  2SEB D;  4P7I A;  3W5U B;  2H89 B;  1UGJ A;  1WZ3 A;  4LDT D;  1HTQ A;  3U4E G;  1FMA D;  1IYF A;  3BK2 A;  1RFA A;  4ANU A;  2TSS A;  1C4C A;  2WXM A;  1RLF A;  3TJP A;  2XEW A;  3ZGZ A;  3MC9 A;  1TT5 B;  2RR9 A;  3L4P A;  1TS4 A;  3Q3N C;  2L76 A;  1N60 A;  2LI5 A;  4W9I A;  4NQK E;  2KMC A;  5GXG B;  3N9Y C;  1OQR A;  2PVO D;  2DYM A;  4NJC A;  3TEY A;  1ZUD 2;  2JY6 A;  2M0X A;  2WXK A;  5EE1 A;  1YJJ A;  1XCT L;  2IO2 B;  1RYJ A;  3VQI A;  5AZH A;  1CMX B;  3SFD B;  1NI2 A;  1RWS A;  2KLG A;  1ISN A;  3AEA B;  2QJL A;  1MI0 A;  1YJ1 A;  3UGB B;  1YQ4 B;  2L0F A;  4KZ0 A;  1KOT A;  3VUX A;  3U7Z A;  2AQ3 B;  1PYW D;  4YL8 A;  1HEZ E;  1WGR A;  3OG5 A;  1FCC C;  2L00 B;  4ICV A;  2D2Q A;  5D2M B;  1WRD B;  3AXC A;  1V1O A;  4JIO U;  4NQL B;  2I1J A;  4RM8 A;  2KDM A;  3BYY B;  3VUY A;  1C76 A;  3ZUN A;  3MTN B;  4IC7 B;  4KX6 B;  1UGM A;  4LNF A;  1GJZ A;  1HTO A;  2EKE C;  1TKY A;  1C3T A;  5E6N A;  1YNT E;  2MBQ A;  2KJR A;  3NG0 A;  3B2F A;  1JWS D;  4REZ A;  3AE5 B;  1X1M A;  1L5P A;  1NBF C;  2G1E A;  1WR1 A;  5G2N A;  4FN2 A;  4ASW C;  2V4L A;  1FRD A;  3RD2 A;  2WXI A;  2DX5 B;  3ZXR A;  2RDG A;  2MEK A;  4US9 A;  3VRA B;  5IKC M;  1C4A A;  1VZ7 A;  3RYT A;  2CHX A;  2MP2 A;  4TSS A;  2KHW B;  1TS3 A;  5HI1 A;  4KKI A;  2V1Y A;  4ARI A;  3T8M A;  1T0R C;  1S3S G;  2DWQ A;  4WJP A;  1K50 A;  2Z59 B;  3AE3 B;  3QA8 A;  3AE9 B;  2K8H A;  1WJ4 A;  3ZNH B;  3A4S C;  1V9J A;  4DQO C;  3BY4 B;  4PYU A;  2JUO A;  4GDK A;  2J42 A;  4MGI E;  3GE8 C;  1LFD A;  3AU5 A;  2N1V A;  3APD A;  2N9P C;  4II3 B;  4NJ6 A;  3NOB A;  2ZNV B;  2HJ8 A;  4WH4 A;  1FNV A;  2VZK B;  2LWP A;  3I57 A;  3UF8 A;  5D94 A;  1N6Z A;  3Q2A C;  4RGM A;  3AE4 B;  2JT4 B;  3BK1 A;  3DQV A;  1V81 A;  4K7S A;  5BYQ A;  3ZTC A;  4QAY A;  2KX3 A;  2KLC A;  3UIN B;  4DK5 A;  1DYQ A;  4HDO A;  2J53 A;  4OVZ A;  1VZ8 A;  2HTM E;  2I1K A;  3VTV A;  1L0X B;  2VH1 A;  5LXI B;  1ZW7 A;  2C60 A;  2GI9 A;  3TL5 A;  1JWU D;  3ZVV A;  3W5V B;  4EZL A;  5JXV A;  2B3A A;  4YXD B;  1WWT A;  2Y5C A;  1E10 A;  2CHZ A;  3Q3F A;  1QOG A;  3MC8 A;  1ZKH A;  2L8J A;  2RMM A;  3PZ7 A;  4RCO A;  5AZG A;  2ZEQ A;  4RF0 A;  2RGF A;  3Q14 C;  3VHT C;  2LVO A;  2CU1 A;  4KZC A;  3DVN U;  4YSY B;  5HFY A;  1UH6 A;  3B2G A;  3PLV A;  1GB4 A;  4G0N B;  4BOZ B;  4RGO S;  4EOY A;  1LXD A;  4B9K A;  1XO3 A;  4WAF A;  2WXG A;  5MPO A;  4FHK A;  4N58 A;  3N20 C;  2KKC A;  1WXA A;  1GC7 A;  1H4R A;  2NTT A;  1Y56 A;  2AX5 A;  3DBR I;  3AI5 A;  3BIN A;  1MHX A;  4B6W A;  3ZRF A;  2WXH A;  1E5W A;  1HZ6 A;  4OVU A;  1F1H A;  4XWT A;  1AAR A;  2WX0 A;  4URK A;  4MJS A;  3B1L X;  3RN9 C;  1VDV A;  3HM6 X;  3FIL A;  1J7A A;  2J4X A;  4LCD E;  1UWM A;  1BXT A;  2LGX A;  1V80 A;  2JYE A;  2PLP A;  4ZHO A;  2KTR B;  1B9R A;  1MFW A;  3HM3 A;  4P1C C;  1E8Z A;  4IUM B;  4B95 A;  5EE9 A;  3VDZ A;  4LNI A;  4EKU A;  1JRP A;  2W54 A;  3A4R A;  4N59 A;  3AE8 B;  1VRA B;  3IVF A;  1V6E A;  2FCQ A;  4J6I A;  2WYQ A;  4A55 A;  2NVU I;  3KVF B;  4L23 A;  1D5X C;  4K81 A;  3DBR B;  1FXT B;  3DBS A;  1QOF A;  4NPN A;  4TQ1 A;  1OEY A;  3PZ8 A;  3MC0 B;  5C3J B;  5IA7 A;  1K8R B;  4W9L A;  4DHJ B;  1EUV B;  1I4R A;  2OED A;  4I6P A;  4P6V F;  2LGI A;  1N5X A;  3RMK C;  3PLU A;  3CF6 E;  4M0W A;  1L2N A;  4C56 C;  4ZRI A;  3PRM B;  3RUI B;  2AL6 A;  2W3R A;  2M56 B;  3HRD D;  4AJW A;  3U30 A;  2GBJ A;  4YTM B;  3RNC C;  1FIQ A;  3HUI A;  3AV8 A;  2KWU B;  1D3Z A;  3QIJ A;  3N1X C;  4DXG A;  3MJW A;  2DYB A;  4NY0 A;  1DOX A;  2GBR A;  4PS3 A;  3CIR B;  3LYY A;  1ET9 A;  3V62 A;  2BYF A;  3AMZ A;  4FHJ A;  5C23 A;  3LDZ E;  1P7E A;  3CMM B;  4KV2 A;  2WDV B;  1WGH A;  1IGC A;  1WE6 A;  2PJH A;  2QIE B;  3AM9 A;  1C1Y B;  2NMQ A;  2L05 A;  2PEA A;  4IM2 A;  3CST A;  2BBC A;  1NYR A;  1T3Q A;  3TMP B;  2KJ6 A;  2K1F A;  2KT7 A;  4G3X B;  3RNB C;  3U7D A;  1F9J A;  4OZC A;  3AE2 B;  4JX1 C;  3EEC A;  1QF6 A;  1EWY C;  3PRE A;  4H2A A;  1QKZ A;  1WGD A;  2FBW B;  2DZI A;  2MRP A;  4BKS D;  1R4M I;  5L95 C;  1SE4 A;  3I9V 1;  2AQ2 B;  3ZTD A;  3JSV A;  2X38 A;  1D5Z C;  4JPS A;  2IND C;  3HHM A;  3AUL A;  2W55 A;  3MJ5 A;  1Z2M A;  3H7P A;  2VRR B;  3DBL I;  1OFF A;  2KD0 A;  5JHA A;  4TQ0 A;  3BYT B;  5CX3 A;  1D5M C;  1WGG A;  1WF9 A;  3DWM A;  1SJE D;  2PKO A;  2UWQ A;  2LEK A;  3SU8 X;  4GXB A;  5EE3 A;  3T3O A;  2YLM A;  3ZXV A;  2KO3 A;  2MP2 B;  1XCQ L;  3ALB A;  3Q6B A;  3E9S A;  3PRP B;  4ICU A;  1YN3 A;  4YWG G;  3L0W B;  4TV3 A;  4XE0 A;  3L10 B;  4OW0 A;  3E56 A;  2CHW A;  1R4M B;  2BGF A;  4FJV B;  5H92 C;  1OQY A;  4GOC A;  1PDX A;  2HDE A;  4C00 A;  2Z0D B;  5GMV A;  3CSF A;  3DBL B;  2D11 A;  1ZPS A;  2BPS A;  2O6V B;  1KF6 B;  2ACZ B;  5IN7 A;  2GRI A;  4ZOH C;  1T0Q C;  1RAX A;  2WX1 A;  2CS4 A;  2QCZ A;  2IGH A;  1XXG A;  1YD8 U;  2J0M A;  2R2Q A;  3DBH I;  2KDI A;  3APF A;  2QIL A;  4BBN F;  2DZK A;  5TR5 A;  2INC C;  1MG8 A;  2KOX A;  5HHD G;  3WAL A;  4HPP A;  4ZYS A;  2WXJ A;  2V4I B;  2A4Z A;  1E9M A;  4OZA A;  2V3S A;  3L08 A;  1UF0 A;  2D10 A;  1JCK B;  2BW2 A;  2ZJD A;  3AED B;  3SD5 A;  3DHG C;  1ESF A;  1YQ3 B;  1DOY A;  3DVN V;  5HG2 A;  3R2T A;  4GB9 A;  5E6O A;  3EA6 A;  4NNJ B;  3AEC B;  1F2R C;  3IHP C;  5EDS A;  1WGK A;  1I35 A;  2BQQ A;  2FUG 1;  3AE1 B;  4FAD A;  3ZQ4 A;  2LD9 A;  1QIL A;  3WAN A;  4BFR A;  1C78 A;  2X8X X;  3EHV A;  2JZ3 B;  4NJ7 A;  5J18 A;  3DBH B;  1BML C;  2RDB C;  3HVZ A;  1CK1 A;  4YTN B;  2BKF A;  2IBI B;  2N4F A;  3NUH B;  5CHF A;  2BYE A;  1IBX A;  4A20 A;  2J52 A;  2KN4 A;  2YVC A;  3T3N A;  1E8X A;  2G9H D;  1K52 A;  1DOI A;  3DVG Y;  2LVP A;  2GOW A;  1V5O A;  3PTF C;  3OJ3 A;  4WAA A;  5DPW A;  3ECI A;  5CHV C;  1J7B A;  1WYW B;  2JSV X;  3V61 A;  5C1Z A;  4A90 A;  2KJH B;  3ZW3 A;  4HKQ A;  4HRS A;  4RH6 A;  1FRR A;  4ANX A;  4GMV A;  4W9J A;  2JRH A;  4MJS B;  2LJ5 A;  2FIF A;  2MSE D;  3FIL B;  3KUZ A;  3VTW A;  3Q8A A;  2UU7 A;  3R2I A;  2GMI C;  3RNA C;  3N1Y C;  4KDI C;  1QOA A;  1FFU A;  1AW7 A;  2FNJ B;  2JZP A;  2UYZ B;  1GUA B;  2ZW0 A;  1U4A A;  2KDF B;  4RGN A;  4W9K A;  3V05 A;  2WU2 B;  5DPR A;  4XDC A;  2MJ3 A;  1QOB A;  4P16 A;  4C7Z A;  4HCP B;  4ANV A;  4GIV A;  4FBJ B;  1VD2 A;  3ONS A;  1K53 A;  5D3I B;  1HE8 A;  1T0S C;  4IOI E;  3P4Q B;  4JLC A;  2QC8 A;  4W9C A;  1SB3 C;  2C7H A;  3A9K A;  3TEX A;  1F52 A;  2IDY A;  3UIO B;  3U2S C;  4JGH B;  4M0W B;  2BS2 B;  3Q8F A;  4W9H A;  4BVU C;  1MJD A;  2XN9 C;  3NVV A;  2OJW A;  3WAM A;  4OZB A;  3O65 B;  2WHI A;  4A3P A;  1IUE A;  2ASQ A;  4ZYN A;  4M00 A;  1KRH A;  2L7R A;  3ZYY X;  1BT0 A;  1KLG D;  1NVI D;  5FKA C;  3DOW A;  2J0K A;  1OEY J;  1IPG A;  5IAA C;  2NS5 A;  1WXM A;  4C7Y A;  1JRO A;  5LXH A;  3D32 A;  2LMC A;  2NTS A;  1YN4 A;  3UI3 A;  3VH4 B;  4II2 B;  1FNW A;  1TBE A;  4I6L B;  3M95 A;  4BZA A;  3GS2 A;  2JU6 X;  5G55 A;  4XZ4 A;  1E7P B;  1WI0 A;  5C2T B;  3RCZ A;  4BKT A;  3IXS A;  2C9W B;  4CYE A;  2DBY A;  2HJ1 A;  4HPM B;  5J17 A;  1EF5 A;  1E90 A;  4IW0 A;  4GSW A;  4IWP A;  1V1P A;  1T5X D;  3BZD B;  5FR3 A;  1GB1 A;  3Q3J A;  2O2V B;  2M4N A;  4W9G A;  4XX5 A;  4MT5 A;  2WXF A;  3NY5 A;  3PVL A;  2AYO B;  2MX2 A;  3N32 A;  2LUM A;  3VFK A;  3JSV B;  4NZL B;  3SEB A;  4G11 A;  4S0R A;  1F2R I;  2Y5P A;  2FCN A;  2LRU A;  3H7P B;  4C80 A;  2O6V A;  4KIK A;  1WXV A;  1JRU A;  3I5J C;  4MAC A;  1GG3 A;  5IO9 A;  1V2Y A;  3ZLZ A;  3ZO5 B;  2PE6 B;  3MP9 A;  4MGY E;  1P7F A;  2IGG A;  3I63 C;  1E8Y A;  4AUQ C;  3KUC B;  1N61 A;  3QCA A;  2KMM A;  3UIP B;  4XYC A;  4XGA B;  3NVW A;  4K7W A;  2JWU A;  1LGR A;  1L7Y A;  2JX5 A;  2LGY A;  3EFU A;  5KHQ A;  3KWV A;  1MPE A;  2C5L C;  1PFD A;  1RFK A;  2K8B A;  2LHE A;  3N1Z C;  1WMH A;  3KQ4 A;  1VLB A;  3ZNZ B;  1WXS A;  4XWW A;  1L4D B;  2RDH A;  3KWL A;  4OHJ A;  2I2Y A;  2VH2 A;  2DHZ A;  3DVG X;  1AN8 A;  1P3Q U;  2C7M B;  4GDL A;  2XNA C;  3R3M A;  2PE9 A;  4O1N A;  4RFB A;  2WP9 B;  2YEP B;  1JML A;  5J2R A;  2FCS A;  1TYG B;  2KTF A;  2Y5B B;  2BVC A;  1P1A A;  2W3S A;  1YJI A;  3X0W A;  2AWT A;  4MSQ B;  1SE9 A;  3ZNG C;  2MBO A;  3M63 B;  3BVG A;  3P4P B;  5BMH A;  1XQQ A;  1STE A;  2MCN B;  1SJH D;  4BBN C;  2DZJ A;  2AEH A;  1C4P A;  2MHJ A;  5JH5 C;  2MLB A;  1MG4 A;  4AJY B;  4UDU C;  2J0J A;  1Q0W B;  2RPV A;  4DWF A;  4WUR A;  1I4P A;  4WWP A;  1PGX A;  3VH3 B;  2WS3 B;  3PZD A;  4N6E B;  1V97 A;  5I4D A;  4J3O D;  3APC A;  3MHS D;  4HEA 1;  2WXN A;  3PHW B;  4BOS C;  2WXO A;  4WIP A;  3L16 A;  2DAJ A;  4MGZ E;  1KM7 A;  1QZE A;  2E3T A;  1IBX B;  3BWU D;  2FID A;  3H9D A;  1ZP0 B;  4LDT B;  1N5W A;  2QDF A;  5DPT A;  3N3K B;  1SIJ A;  2INP E;  3PPA A;  1KFY B;  3TSS A;  1Y8R C;  3R66 C;  2N7J A;  1VZ6 A;  1WJN A;  2N9L A;  1A5R A;  4MDK E;  1ROE A;  1WX8 A;  2KC2 A;  2LGS A;  3JYU A;  1R4N I;  3WIM A;  4USA A;  2IO1 B;  4DDG D;  1QLB B;  2ZCC A;  1DGJ A;  1XD3 B;  1GNU A;  2JF5 A;  3TBL D;  1FNU A;  1XLP A;  5D6J B;  5AEK B;  1I7H A;  3IAS 1;  2N1W A;  1K51 A;  1EU3 A;  1JWA D;  3R7R A;  3U52 E; 
#chains in the Genus database with same CATH homology
 2I1J A;  4RM8 A;  2A4Z A;  2LZ6 A;  4IM3 A;  3VUY A;  2FCM A;  2FUH B;  3ZUN A;  2V3S A;  2KFK B;  3L08 A;  3MTN B;  4IC7 B;  4WJO A;  2D10 A;  2IY1 B;  1UGM A;  2GBM A;  1GJZ A;  2ZJD A;  2EKE C;  3SD5 A;  1M94 A;  3DVN V;  4WWO A;  1C3T A;  2NBV B;  3PT2 B;  5E6N A;  4HLE A;  4GB9 A;  2MBQ A;  2KJR A;  5E6O A;  4NNJ B;  2WDT B;  3DCG A;  4FJZ A;  1OTR B;  2OOB B;  3IBE A;  4RM9 A;  1X1M A;  3IHP C;  2L0T A;  3A1Q B;  3ZDT A;  3QAQ A;  4E71 A;  5EDS A;  3U8Z A;  1I35 A;  1NBF C;  3A9K B;  4MH0 E;  4F1S A;  2G3Q B;  4EZJ A;  4FAD A;  4LJP B;  2KWV B;  3H6N A;  2KDE B;  1WR1 A;  5G2N A;  2DEN B;  2LD9 A;  3WAN A;  4FN2 A;  4ASW C;  4BFR A;  2O2V A;  2BYV E;  4IWO A;  2ZPN A;  2V4L A;  3EHV A;  3L13 A;  3RD2 A;  2JZ3 B;  4NJ7 A;  2DX5 B;  2QHO A;  3WA0 A;  5J18 A;  3AU4 A;  4FA6 A;  2LVQ A;  2KX0 A;  3VAW A;  3X23 A;  2MA9 B;  3A9J A;  3B08 A;  4BKS A;  3RYT A;  2CHX A;  2LRW A;  1VCB A;  2MBB B;  2JVC A;  2BKF A;  2IBI B;  2MP2 A;  2N4F A;  1IP9 A;  5AZF A;  2KHW B;  5CHF A;  2BYE A;  2V1Y A;  4K1R B;  3T8M A;  4A20 A;  1E8W A;  1S3S G;  2YVC A;  4WWN A;  1E8X A;  4WJP A;  2IY0 B;  4M8M A;  2Z59 B;  2CKH B;  3DVG Y;  2LVP A;  3KUD B;  2GOW A;  1V5O A;  2KWC A;  2JXX A;  3PTF C;  3OJ3 A;  4WAA A;  3QA8 A;  3V6C B;  2K8H A;  2K6Q A;  3PS6 A;  1WJ4 A;  1TGZ B;  4EFO A;  2D3G A;  3HIZ A;  5DPW A;  3NZS A;  4MSM B;  3ECI A;  3ZNH B;  3A4S C;  5CHV C;  4ZDV A;  1V9J A;  1WYW B;  2CR5 A;  3BY4 B;  4PYU A;  2KK8 A;  2JUO A;  3UQB A;  4W9E A;  4GDK A;  3V61 A;  4AWJ A;  5C1Z A;  2KJH B;  3ZW3 A;  2BKR B;  2NCN A;  1V5T A;  4GU2 A;  4MGI E;  1YX5 B;  4TKN A;  2JPH A;  2ZCB A;  4ANX A;  3R7Q A;  3QK0 A;  4GMV A;  1LFD A;  4GGQ A;  4HJK A;  4W9J A;  2BF8 B;  2JRH A;  4MJS B;  4EEW A;  3L17 A;  2LJ5 A;  3AU5 A;  1Z5S B;  2FAZ A;  2N1V A;  2FIF A;  3C0R B;  3N30 A;  1WZ0 A;  2MSE D;  3IG3 A;  2W9N A;  3TCA A;  3KUZ A;  4JL9 A;  3APD A;  2MBH A;  2DYO A;  3VTW A;  4ZRK A;  2LXC A;  2N9P C;  3H7S A;  4II3 B;  4NJ6 A;  1G6J A;  1EO6 A;  3WAO A;  2GMI C;  3DDC B;  3NOB A;  4KDI C;  1WM2 A;  4KSK C;  2ZNV B;  2FNJ B;  2UYZ B;  1GUA B;  2HJ8 A;  5JHB A;  3KYD D;  2LWP A;  1U4A A;  2GBK A;  1E7V A;  2KDF B;  2WWZ A;  4FLH A;  4W9K A;  3UF8 A;  5D94 A;  4JQW C;  4KIK B;  5DPR A;  5BO4 B;  2JT4 B;  4HPL B;  4HDQ A;  3P2B A;  3DQV A;  2M1M A;  1V81 A;  4K7S A;  4HCP B;  2IO3 B;  3ZTC A;  2BWF A;  1V49 A;  4ANV A;  3QQ8 B;  2KX3 A;  3I3T B;  2KLC A;  3UIN B;  4GIV A;  4DK5 A;  4FBJ B;  1ZGU B;  4HDO A;  2MQJ A;  1VD2 A;  2I1K A;  3VTV A;  3ONS A;  1XT9 B;  4F7Z A;  3W1S A;  2KDB A;  2EMT A;  5CTR C;  1HE8 A;  4ANW A;  2LXA A;  5LXI B;  2ZZP B;  1ZW7 A;  2HTH A;  3QJZ A;  2C60 A;  3TL5 A;  2ZNV C;  2KXJ A;  4E74 A;  3DPD A;  4JLC A;  4WQO B;  3A1Q A;  4W9C A;  3W1Y A;  3ZVV A;  3ENE A;  4ZRJ A;  2C7H A;  2KNB A;  1WJU A;  4EZL A;  1OGW A;  2KQS A;  3A9K A;  4CHK A;  2B3A A;  2N9E B;  1TTN A;  3WAP A;  2CHZ A;  4PS8 A;  3UIO B;  3Q3F A;  2K39 A;  4JGH B;  4M0W B;  4IM0 A;  4CO7 A;  2DAF A;  1ZKH A;  4W9H A;  2L8J A;  4BVU C;  4DBG A;  4DDI D;  3ML9 A;  4KVG B;  4KSL C;  3S2A A;  5AZG A;  2ZEQ A;  4MEM A;  4N9F 4;  3WAM A;  1WGY A;  2RGF A;  5E6P A;  3VHT C;  3O65 B;  1Q5W B;  4EUT A;  4A3P A;  2LVO A;  3HK0 A;  2ASQ A;  4ZYN A;  2CU1 A;  1KJT A;  2IYD B;  1WFY A;  4KZC A;  1WMH B;  2L7R A;  2KFJ A;  3DVN U;  3VUW A;  1UH6 A;  3PLV A;  3L54 A;  1UEL A;  3PGE A;  4DHZ B;  1BT0 A;  2PPH A;  4G0N B;  4BOZ B;  3OLM D;  1WM3 A;  2R2O A;  4EOY A;  4HWI B;  3DOW A;  2J0K A;  1P98 A;  4FJY A;  1LXD A;  4B9K A;  2N7D A;  1OEY J;  3K9O B;  1IPG A;  4FHK A;  1I42 A;  5IAA C;  2NS5 A;  2OJR A;  1WXM A;  1TZ1 A;  2G4D B;  5LXH A;  3D32 A;  3K9P B;  3W1S C;  2XK5 A;  2BWE S;  4GDL B;  3SDL C;  4NAW B;  2KKC A;  1WXA A;  1GC7 A;  4WJQ A;  2KZR A;  1H4R A;  1UBI A;  3T9L A;  3VH4 B;  3DBR I;  4II2 B;  3AI5 A;  3BIN A;  1TBE A;  3NHE B;  3M95 A;  4I6L B;  4B6W A;  2RPQ A;  1H8C A;  3ZRF A;  1WJ6 A;  5G55 A;  1E5W A;  4XZ4 A;  4AP4 C;  5FR6 A;  2KVR A;  1WR6 E;  1WI0 A;  1EF1 A;  4OVU A;  3RCZ A;  4BKT A;  4CYE A;  2C9W B;  2K8C A;  1AAR A;  4HPM B;  2WX0 A;  2NPT B;  4DXA B;  5J17 A;  1EF5 A;  1E90 A;  1YX6 B;  4IW0 A;  4GSW A;  4IWP A;  4URK A;  3A33 B;  1LM8 B;  4MJS A;  3B1L X;  4X57 B;  3HM6 X;  3Q3J A;  4LCD E;  2O2V B;  2DZM A;  2M4N A;  2LGD A;  2JRI B;  4W9G A;  3ZNI D;  2LGX A;  1V80 A;  4XX5 A;  5D7G A;  2M8S A;  2HD5 B;  4HVB A;  2JZZ A;  3NY5 A;  3PVL A;  2AYO B;  2MX2 A;  3N32 A;  4WJN A;  2KTR B;  3VFK A;  1J8C A;  1GC6 A;  3JSV B;  3V60 A;  3JW0 X;  2G4S A;  3HM3 A;  4G11 A;  3A9J B;  1E8Z A;  2RSU A;  1P0R A;  2FCN A;  2LRU A;  4IUM B;  4B95 A;  3H7P B;  3VDZ A;  2KN5 A;  4EKU A;  2RD0 A;  2O6V A;  2D07 B;  4KIK A;  3A4R A;  4DHJ D;  1WXV A;  1JRU A;  1GG3 A;  3IVF A;  3QAR A;  1V6E A;  4MM3 A;  5L83 A;  1V2Y A;  2FCQ A;  3ZLZ A;  4J6I A;  2WYQ A;  1E7U A;  1PQS A;  1YIW A;  3ZO5 B;  2PE6 B;  3TIX A;  2NVU I;  3KVF B;  4MGY E;  4K81 A;  1E8Y A;  3SHQ A;  1FXT B;  3DBS A;  4FUL A;  3M3J A;  4AUQ C;  3KUC B;  3RUL A;  4NPN A;  1KLV A;  3QCA A;  4TQ1 A;  1OEY A;  3UIP B;  3M62 B;  3KYC D;  2ZPY A;  4E3C A;  2KFK A;  4GDK B;  3KW5 B;  1UZX B;  5IA7 A;  4I6N B;  5DPS A;  1K8R B;  4W9L A;  1WE7 A;  4K7W A;  2XBB C;  4DHJ B;  1EUV B;  4I6P A;  1WX9 A;  2NBW B;  4PS7 A;  1SIF A;  4IG7 B;  1L7Y A;  3PLU A;  3CF6 E;  3ZRC A;  2IZV B;  2LGY A;  3QX1 A;  3EFU A;  3B0A A;  4ZRI A;  1L2N A;  1Q1O A;  3PRM B;  5KHQ A;  4F8C B;  5DCN A;  3RUI B;  1WIA A;  2AL6 A;  2C5L C;  4AJW A;  3U30 A;  3ZIM A;  2GBJ A;  2JWZ A;  4W9D A;  2K8B A;  4GN1 A;  4K7U A;  2KWU B;  3OAW A;  3QIJ A;  2C7N B;  1D3Z A;  2HE7 A;  1WMH A;  3MJW A;  4IWQ A;  2DYB A;  3GOE A;  4NY0 A;  3ZNZ B;  1J19 A;  1WXS A;  2GBR A;  4PS3 A;  5LLI A;  2G45 B;  5HKH A;  3V62 A;  2DHZ A;  4HK2 A;  3RT3 B;  2BYF A;  3DVG X;  3IFW B;  4PYZ A;  4FHJ A;  5C23 A;  3LDZ E;  1P3Q U;  2LAS A;  3PV1 A;  3CMM B;  2C7M B;  4GDL A;  3R3M A;  2PE9 A;  2NR2 A;  3JVZ X;  2AL3 A;  4KV2 A;  4NAW A;  1WGH A;  1WE6 A;  2PJH A;  5J2R A;  2FCS A;  1C1Y B;  2L05 A;  2PEA A;  2KMA A;  3RZF A;  2KTF A;  2Y5B B;  2NBU A;  1P1A A;  3NZU A;  2EMS A;  3QWZ B;  4XC2 A;  4IM2 A;  4KDL B;  2KQ7 A;  2REX A;  3CST A;  2AWT A;  3X0W A;  2Z0E B;  1SGH A;  4MSQ B;  1SE9 A;  2KAN A;  2NPT A;  1NDD A;  3ZNG C;  4MEL A;  3TMP B;  2MBO A;  2KJ6 A;  2K1F A;  4LJO B;  1S1Q B;  3M63 B;  4W9F A;  4G3X B;  4OVV A;  3U7D A;  1F9J A;  3UQA A;  3EEC A;  3PRZ A;  1XQQ A;  3V6E B;  3VXW A;  1J0G A;  2MCN B;  4BBN C;  3H1U A;  3PRE A;  2DZJ A;  2KC1 A;  1WGD A;  2AEH A;  2M17 A;  2DZI A;  2MRP A;  4HCN B;  1R4M I;  2MLB A;  4BKS D;  5JH5 C;  5JZE B;  5L95 C;  3ZTD A;  4AJY B;  2KTR A;  2J0J A;  2MW5 A;  1Q0W B;  3JSV A;  4DWF A;  4P7I A;  1WH3 A;  3HHM A;  3AUL A;  3ZKJ C;  1V86 A;  1Z2M A;  3H7P A;  2K25 A;  2VRR B;  1WZ3 A;  3DBL I;  4LDT D;  2KD0 A;  2ZVO A;  4WWP A;  4TQ0 A;  5JHA A;  4G50 A;  3VH3 B;  5CX3 A;  3QHT A;  3OJ4 B;  1LQB A;  3PZD A;  1WGG A;  3PSE B;  1IYF A;  1WF9 A;  1RFA A;  4ANU A;  2UWQ A;  3VVW B;  3APC A;  3MHS D;  4TUU A;  3SU8 X;  2MWS B;  4GXB A;  3PHW B;  2XK5 B;  1RLF A;  2YLM A;  4BOS C;  2J7Q B;  1RRB A;  3TJP A;  2XEW A;  2KO3 A;  3L16 A;  4A3O A;  2DAJ A;  4MGZ E;  2MP2 B;  1KM7 A;  1QZE A;  2RR9 A;  3ALB A;  1P9D U;  2IO0 B;  2FID A;  2L76 A;  3H9D A;  2LI5 A;  4LDT B;  4W9I A;  3RZW C;  4NQK E;  5DPT A;  3PRP B;  2KMC A;  1WX7 A;  4ICU A;  2N9X A;  3N3K B;  4AOF A;  2LUE A;  3LJ3 A;  2O6V D;  3PPA A;  2DYM A;  3L0W B;  4TV3 A;  3QC8 B;  4EZK A;  1Y8R C;  3R66 C;  2JY6 A;  2M0X A;  3KH0 A;  1WJN A;  2IO2 B;  3L10 B;  1A5R A;  3VQI A;  5AZH A;  1CMX B;  2CHW A;  4MDK E;  4BKG A;  1WX8 A;  2KC2 A;  1WY8 A;  2BGF A;  1NI2 A;  2KLG A;  4FJV B;  1ISN A;  1UBQ A;  1OQY A;  4GOC A;  3PHX B;  4DHZ E;  3JYU A;  1T0Y A;  1R4N I;  2Z0D B;  5GMV A;  3CSF A;  3ZDM C;  2L3Z A;  2A5U A;  2MBE A;  4MGK E;  3WIM A;  1UD7 A;  3GZN I;  2D11 A;  2BPS A;  1YJ1 A;  3UGB B;  3NS8 A;  2IO1 B;  4DDG D;  2O6V B;  2ZCC A;  2L0F A;  4RMA A;  3EC8 A;  4KZ0 A;  1KOT A;  1XD3 B;  3VUX A;  1GNU A;  4HXD A;  1RAX A;  2JF5 A;  2WX1 A;  3VTU A;  2CS4 A;  3TBL D;  4YL8 A;  5KHO A;  1YD8 U;  1WGR A;  2J0M A;  2R2Q A;  2GBN A;  2KDI A;  3APF A;  2K6D B;  3DBH I;  5D6J B;  2L00 B;  5AEK B;  4BBN F;  2DZK A;  5TR5 A;  1YQB A;  4ICV A;  2D2Q A;  2N1W A;  2N7E A;  5D2M B;  5CHW A;  1MG8 A;  1WRD B;  3AXC A;  4M8N A;  3R7R A;  2KOX A;  3ML8 A;  2ZVN A;  4JIO U;  4NQL B;  3WAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...