1B9RA

Terpredoxin from pseudomonas sp.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
105
structure length
105
Chain Sequence
PRVVFIDEQSGEYAVDAQDGQSLMEVATQNGVPGIVAECGGSCVCATCRIEIEDAWVEIVGEANPDENDLLQSTGEPMTAGTRLSCQVFIDPSMDGLIVRVPLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A model for the solution structure of oxidized terpredoxin, a Fe2S2 ferredoxin from Pseudomonas.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Ferredoxin
molecule keywords PROTEIN (TERPREDOXIN)
total genus 11
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1999-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b9rA00
4HROA 2CU3A 1E6EB 2L52A 2PIAA 1NYRA 2KAJA 1DOYA 2CJOA 1N63A 4YXDB 3NS1A 1L6UA 1J7BA 1ROEA 5H92C 1SIJA 3NVVA 5MPOA 5EE1A 1NVID 1NI3A 1RWSA 3ETRA 2HTME 5EE3A 3B2FA 1L6VA 1E7PB 1SF0A 1N62A 3FC4A 3LB8C 1DOXA 1YJIA 2MH7A 3AEAB 1SB3C 1TKYA 2LEKA 2W55A 2BT6A 1WXQA 3SR6A 1AYFA 4N58A 1FRRA 1XO3A 1XLNA 2K22A 3P1MA 1F0ZA 1FM0D 3AV8A 1WGKA 2N0SB 2B76B 1UWMA 3AE4B 2K9XA 3VR8B 3BIID 3AEEB 1QF6A 5G5HA 2M19A 2QJLA 1RFKA 1JALA 2QIEB 2W54A 1QOBA 1WRIA 3AM9A 1VDVA 3NVZA 2PVOD 1FO4A 2AX5A 5G5GA 3AE6B 4USAA 3AE3B 1JW9D 4IDIA 3KWLA 1TJEA 2L83A 1QOAA 3NVYA 2E3TA 3AMZA 3AH7A 1IUEA 1ZP0B 1I7HA 3AEDB 2BS4B 1NENB 1DGJA 4YTMB 1E0ZA 3PO0A 5AUKA 3SFDB 3B2GA 4C80A 2H89B 2CJNA 1FFUA 1JWAD 2Y5CA 5AUIA 3AE9B 1VJKA 2EKIA 4N59A 2PVGC 2WDRB 1FXIA 1PUTA 2MJDA 1ZOYB 3P4SB 2PKOA 3SFEB 2OHFA 1E9MA 1KFYB 2FBWB 1WWTA 2WLBA 4US8A 3AB5A 3CWIA 3RPFC 1YQ4B 5H8YE 3AECB 5C2TB 1PDXA 4YTPB 2K5PA 4C7ZA 1GPXA 1TYGB 3P4QB 4YSYB 1A70A 2JQRB 2WDVB 3L4PA 1OQQA 2G1EA 1N5WA 4ZOHC 3VR9B 1FMAD 1L0VB 2WDQB 1KRHA 3VRAB 1N60A 1KF6B 1XLOA 3AEBB 3P63A 4JWUC 5EE0A 2Q5WD 3W5UB 3AEFB 3HVZA 1OFFA 2DWQA 1ZUD2 1ZXIA 1QOGA 1QT9A 1V8CA 1YQ3B 4LTUA 1PFDA 4WWMA 3VRBB 1FFVA 1E10A 4ZHOA 3AE8B 1FRDA 1L5PA 3DWGC 2BS2B 2JX5A 1JWBD 2WU5B 1YJJA 2W3RA 3W9CB 5GXGB 1JROA 3NVWA 1B9RA 1TKGA 1QLBB 2BS3B 1JQ4A 1RM6C 2WP9B 2WQYB 4KX6B 3HUIA 2WS3B 1FXAA 1J7CA 1T3QA 1N5XA 3FAHA 4FXCA 3AE2B 4JX1C 3AE5B 4P6VF 1VLBA 1AWDA 3DWMA 1QOFA 2M56B 3CIRB 4YSZB 1DOIA 4C7YA 2WU2B 3LXFA 5EE9A 2H88B 1RYJA 4JWSC 3AE7B 3WCQA 4ITKA 1OQRA 1JRPA 1EWYC 4YTNB 3AE1B 3ABVB 1NYQA 2DBYA 2MJEA 1TKEA 2KMMA 1FIQA 2MJ3A 1R7SA 3HRDD 3AN1A 3P4PB 3ZYYX 4WQMA 1CZPA 3AEGB 1V97A 1XLPA 3EUB2 4A9AA 2ACZB 2W3SA 1CJEA 1N61A 1NEKB 5C3JB 4YT0B 4N6EB 4ZHPA 1XLQA 4US9A 4YSXB 3NRZA 3P4RB 3W5VB 1GAQB 1J7AA 1WYGA 4HRSA 3B9JA
chains in the Genus database with same CATH superfamily
3JVZX 2CJOA 2O6VB 1EF1A 3NVVA 3PS6A 4E71A 5EE3A 2PE9A 1H8CA 2MH7A 2L8JA 4DDGD 4KZ0A 1TS2A 2LGSA 3I63C 3PLUA 5LNK1 5CTRC 4GXBA 2KO3A 1T0RC 1QF6A 3DVNU 2BTEA 3QAQA 4USAA 1VZ6A 1LGRA 4IOIE 1SSNA 3UQBA 3MHZA 4AP4C 5D2MB 1FNWA 2IJ0A 4MSQB 1YOVB 3UGBB 2VH1A 3QARA 2EKIA 2K25A 4A3PA 5J17A 3SFEB 4PS3A 1UBQA 2FBWB 4WURA 4OW0A 4MELA 1ET9A 3PHWB 2Z0EB 2K5PA 4GDKB 2FCMA 1EUVB 3M95A 4LDTD 1FMAD 2Q5WD 3OJ3A 2NTTA 1E10A 1WIAA 3AE8B 3M62B 3VDZA 2GBJA 2KQ4X 3NVWA 4I6LB 5BMIA 2WP9B 2CR5A 3ZGZA 2RDHA 2LJIA 1BMLC 3C0RB 1PQSA 2BYFA 3C8YA 5HHDG 2DBYA 5CHVC 4BFRA 3TCAA 2KMMA 4FHJA 2X38A 2D3CA 4XX5A 4TKNA 1JWMD 3EUB2 4A9AA 2X8XX 2W3SA 1K50A 1KJTA 2ZNVC 1R4NI 3OWEB 1P7EA 1IPGA 2CU3A 4FN2A 3RNBC 2LI5A 3I9V1 4KSKC 1SE4A 1UWXA 2OOBB 4W9KA 1N62A 2IBIB 2QDFA 2KN4A 4HDOA 4OVUA 3PGEA 3KUCB 1XO3A 4OZBA 1E8WA 1ZDVA 1WM3A 3B0AA 1XD3B 1VD2A 3APFA 4MM3A 2I1KA 1J8CA 1V1PB 1MJDA 1C1YB 4M8NA 3T3NA 5HG2A 1EU4A 3TBLD 2LUMA 1FFUA 2Y5CA 1VJKA 5JXVA 1RLFA 3V05A 1ZPSA 1YD8U 2XEWA 3RUIB 2IGHA 4YSYB 4W9IA 4K7UA 4MGIE 2IO2B 3P63A 1K52A 3B08A 1QOGA 1V8CA 5KHQA 2WGSA 3RYTA 3AULA 3V60A 5EDSA 3SHQA 1RM6C 3ECIA 4FJZA 3FILA 2ZVNA 2WX0A 2JU6X 4C7YA 2WXRA 2GBKA 4II3B 1UF0A 1RYJA 4JWSC 3V6CB 3MP9A 3QC8B 4LLGM 2VRRB 4H2AA 1ZKHA 4GIVA 3SD5A 1WFYA 3A9JB 3QA8A 1F9JA 1V5TA 2KVZA 4JQWC 4L1BA 4KDLB 4JGHB 1GAQB 2PIAA 2KACA 1NBFC 3PHXB 2MEKA 3OJ4B 3RNAC 1WJNA 1UUPA 4KGTA 4K3CA 4W9FA 2VH2A 3ML9A 3LB8C 2ONQA 2N9EB 1SXTA 1ESFA 3RMKC 1U4AA 2J52A 2N0SB 1L4ZB 4TMAB 2LXCA 4WJQA 1E5WA 3QHTA 3WIMA 1WRIA 1IP9A 1JW9D 2KXJA 1TJEA 2L83A 3NVYA 4NAWB 2RD0A 2D2QA 3M63B 1V1OA 1WGDA 4C80A 1XEEA 1JMLA 4K3BA 3TEXA 4M8MA 2JWUA 2KD0A 2JZ3B 1PGXA 3MHSD 2WLBA 2WHIA 1CK1A 3VHTC 4ANXA 1SBBB 5E6JA 2K6DB 2MLBA 4XZ4A 1R4MI 2JSVX 2LD9A 4C7ZA 1GPXA 4II2B 3H8HA 1WF9A 3VFKA 1UGMA 2ZW0A 4LJOB 2PMVA 4HKZE 3DVGX 4K7WA 1E8YA 5BMGA 2MRPA 3UIOB 1L5PA 4B6WA 2W3RA 3H7PA 1JQ4A 1WGYA 2LVPA 2QMTA 2KTFA 2DZKA 2WS3B 4KGSA 1RRBA 1T3QA 2FAZA 3EGRA 3UF8A 4LK0M 4YSZB 2INNE 2WU2B 4URKA 4FULA 3TEYA 1OQRA 2ZPYA 2KTRA 1FCCC 1T6BX 1R7SA 1JWUD 4DHJD 4A55A 4GOCA 4E3CA 4YL8A 4ZHPA 2MQJA 3Q8EA 1ZGUB 2W9NA 3ZXVA 3A1QA 3NS1A 4YXDB 4ICUA 2MBOA 2BPSA 2HTME 2LGDA 2JXTA 1L6VA 5JHAA 4RM9A 1YJ1A 1WGKA 2PJHA 4PK1A 3UQAA 3VTUA 4B0MA 2AX5A 5G5GA 2D5GA 2N4FA 1F77A 3TMPB 2KOXA 4DHZE 3AH7A 3AEDB 2WXPA 4EOYA 3VH3B 2SAKA 4A3OA 3BK2A 4K1RB 4OVVA 2JF5A 4J3OD 4N9F4 2C7MB 3H7PB 1PUTA 2FIDA 3DHGC 1KFYB 2Y5BB 1M94A 2MA9B 2KYWA 1Y56A 1E90A 3RCZA 3R66C 2DX5B 4NJ7A 4RH6A 4MACA 2D07B 3H9DA 2BYTA 1YIWA 3HVZA 1EF5A 1RAXA 2BWFA 2LGXA 4E74A 1GNUA 2MP2A 2WQYB 1WY8A 4JX1C 3ZXRA 1FNVA 3GP7A 2W82A 3TIXA 2NS5A 2XK5B 1JRPA 1YN3A 1F2RI 3R2IA 1NYQA 1WZ3A 4DDID 1P1AA 4CQNA 4MH8A 1C3TA 1SE3A 2N7DA 1KLVA 2ACZB 2UYZB 3WAMA 1ZDXA 2GBMA 1J7AA 3DDCB 4XWWA 4MJSA 5IA7A 2INDC 2NCNA 5J2RA 4DHJB 2Y5PA 5DPSA 1L0YB 2LVQA 3AEAB 2LJ5A 2BT6A 3LDZE 3DBHB 5CX3A 2V3NA 1WZ0A 4ANUA 4F7ZA 1WXSA 2D3GA 3A1QB 2M17A 2RSUA 3CSFA 4HJKA 1L2NA 4RCOA 3V61A 4ANWA 2WYQA 1P7FA 2GBRA 5AUIA 3AE9B 1R4NB 1FXIA 3BYYB 2JY6A 1ZOYB 3ZO5B 3BVZA 2FUHB 2EMTA 3T8MA 1HXYD 3L0WB 1OGWA 1T5XD 2FCNA 3PSEB 4JPSA 1JRUA 1UD7A 1J19A 2HE7A 1TY0A 2PTLA 4WAAA 3ZKJC 4LNOA 1N60A 2YEPF 1XLOA 1FD6A 2ZJDA 4AOFA 3ML8A 4R3DA 2A5UA 1AW7A 4MDKE 3IBEA 1V80A 3L13A 3W9CB 5GXGB 3TSSA 2BKFA 5C23A 4KGRA 3TEZA 4FXCA 3R7RA 1DOIA 2BKRB 5IO9A 1TGZB 1VCBA 3IHPC 1ACCA 1HQRD 2PE6B 3ABVB 2L00B 5HKHA 1FIQA 1CZPA 1V97A 4XYCA 3O13A 1CJEA 5D7GA 3JSVA 4HJGE 3FILB 4NAWA 4N6EB 3ZTDA 4K81A 3NRZA 1KLGD 2ZPNA 1PGAA 3DOWA 3B9JA 2L52A 3QQ8B 2L3ZA 1VZ7A 2LMCA 3OG5A 2ZNVB 2KLCA 4OVZA 1P3QU 3QK0A 2N1WA 3B2FA 4L2YA 4C56C 1SGHA 4MJSB 1WXQA 2G9HD 1FM0D 2WXLA 1WMHB 1Y8RC 2BW2A 5FK9C 3U30A 4ICVA 2DZJA 4M02A 3UIPB 3Q3FA 3EFCA 3L10B 3LJ3A 2V3PA 2D10A 2LHEA 2RR9A 1WR6E 4CHKA 4N59A 4RF0A 2MP2B 3RT3B 1V1PA 3Q8BA 1E9MA 1WWTA 3AB5A 3CWIA 1YX5B 4YTPB 2BYVE 3X23A 1N5WA 4XDCA 3ZNZB 2N9LA 5TR5A 2GI9A 2KMCA 3VRAB 2CHWA 4DWFA 1ZUD2 2JYEA 1UBIA 4KZCA 2WU5B 3EFUA 3A4SC 4W9GA 2DENB 3RN9C 1TKGA 1ZXHA 2JRHA 2DZIA 1FXAA 2WXKA 1VZ8A 5IAAC 5HI1A 2M0XA 2RMMA 2D11A 3LXFA 5LXIB 1GOZA 5D94A 2KWUB 1MHHE 3NHEB 3VUWA 2BGFA 1TZOA 2WX1A 2KDMA 5JH5C 1HTQA 4NAMA 2N7EA 3ZYYX 2HD5B 1MI0A 1YN4A 1WJUA 4B95A 5DPTA 3OAWA 1WYGA 2DYBA 4W9HA 3DBRI 1D4BA 2HTHA 1V2YA 3N1ZC 1UH6A 2KLGA 5IP4D 3I3TB 3ETRA 2K3UA 2BB6A 3SU8X 4CYEA 2UU7A 1TKYA 2W55A 2INCC 2G4SA 3Q2AC 2NMQA 2K22A 3EA6A 2GBNA 2K9XA 3ZJUA 3R2TA 1JWSD 3AM9A 3TEWA 2PLPA 1MG8A 2WXNA 3T9LA 2LHDA 3APCA 1V86A 1FPYA 1Q5WB 4GU2A 1P9DU 3GB1A 1HZ5A 4A20A 1WE6A 1G6JA 3B2GA 2N1VA 1WX8A 2ZEQA 3U7DA 3N1YC 2IGGA 1GG3A 1ZW7A 2PKOA 4HCPB 2N9XA 5AZHA 1I4QA 1PDXA 3GE3C 1TYGB 3AU4A 1A70A 2DLBA 4WAFA 4WJPA 3ZLZA 3AEBB 4PS7A 1KM7A 3AEFB 3ZDMC 3DHHC 2KQ7A 1FRDA 4RGNA 4W9LA 4HPMB 2MCNB 3KH0A 4BBNF 4NQLB 2EKEC 1V81A 2C7NB 5EE9A 3RD2A 3DCGA 2DHZA 1NI2A 3OLMD 3ZJTA 2CHXA 4KKJA 3AN1A 4BKSD 2LUEA 4WQMA 1XLPA 3GZNI 2VZKD 1NDDA 2M0AA 4YSXB 1I4HA 1KTKA 1WGRA 1E6EB 4GN1A 1WMHA 4MH0E 4IWQA 1N63A 1Q1OA 3RI7C 2MBEA 3MFGA 3DVNV 1E7PB 4IC7B 1WXMA 2AEHA 1WYWB 3AV8A 3K9PB 2B76B 2ZVOA 1GUAB 2O6VA 1OQYA 4IDIA 1EO6A 4B9KA 3AMZA 3SDLC 2L7RA 2YEPB 2JUOA 3PO0A 2HJ8A 1Z5SB 3IXSA 2M1MA 2K0PA 3MC9A 5BO4B 2MJDA 4HXDA 1MHXA 1E8ZA 3VXWA 1C78A 1YQ4B 5H8YE 4KSLC 4NJCA 2GLSA 2XBBC 4IUMB 1E8XA 4ZDVA 2ICIA 3VR9B 1KOTA 2K39A 4UDUC 3VH4B 4JWUC 3Q8AA 1BXTA 4ZYNA 3RNEC 2OEDA 3DBSA 2KJ6A 1FCLA 2LGIA 4MEMA 2WXHA 3ZUNA 3PZ8A 2K8BA 1TTNA 2M8SA 3BVMA 3BK1A 1C4AA 1V49A 4MGYE 4EFOA 2KX0A 1I42A 4MM3B 1E7UA 2IO3B 4GSWA 1YQBA 4XC2A 3P2BA 1HA5A 5G55A 1PGBA 2KMAA 3P4RB 5I4DA 2NPTA 1Z2MA 1F2RC 2YVCA 4BKSA 4RGOS 4PYZA 3H7SA 1IGDA 2SEBD 4S17A 2DAFA 1HE8A 3KW5B 1KH0A 3VTWA 4N58A 1FRRA 1GB1A 2KFJA 2AWTA 3DBLB 4LNIA 4BBNC 3QX1A 3H6NA 5G5HA 2QIEB 1GC6A 4NY0A 2AQ2B 2MBHA 3W1SC 1XQQA 3KWLA 1FEHA 4TQ1A 4ZYSA 2BBCA 2JVCA 1TZ1A 4DK5A 1DGJA 3NOBA 2Y3AA 4BZAA 2N7JA 2XK5A 3KWVA 1SE2A 2PVGC 1QZEA 4K7SA 5FR6A 3L17A 2OHFA 4MGKE 4KDIC 2N9PC 2AYOB 5D3IB 4M0WA 3MTNB 2BF8B 1UELA 3P4QB 1TIFA 2WDVB 4ASWC 4ZOHC 2FUG1 2LRWA 2BYEA 4EKUA 1GJZA 4LTUA 2E6XA 2FCSA 1TS3A 3DBHI 4NNJB 1JROA 2J4XA 3DHIC 2IYDB 2AL6A 4G3XB 2KC1A 3IT4B 1M4VA 2K8CA 2NTSA 3A9KB 1JCKB 1EWYC 3AE1B 2IZVB 1TKEA 3ONSA 5DCNA 5HFYA 1AARA 4AWJA 4IW0A 2KZRA 3I57A 4QAYA 2KX3A 4P1CC 1NEKB 4YT0B 4DQOC 3C19A 3U4EG 3MC8A 2KANA 1WJ6A 1WM2A 4NPNA 5CHFA 4BOZB 3IFWB 1NYRA 1LQBA 1DOYA 4Q2JA 1L6UA 1VRAB 3LYYA 5EE1A 3RZWC 1WE7A 3ZNID 2DAJA 3JSVB 4M0WB 3W1YA 2J0JA 3AE4B 2JZZA 2G3QB 2QJLA 2WXQA 1IBXB 2W54A 3NVZA 4J6IA 4FBJB 1ZP0B 2KWDA 3NZUA 1TBEA 2QCZA 4TSSA 3IAS1 2CJNA 4FJYA 3MJWA 2KN5A 1GB4A 2GRIA 4AQ7A 3AU5A 2RDGA 4HK2A 2V1YA 3CSTA 1ZE3D 4JIOU 3Q8CA 1WX9A 4WH4A 2I1JA 2CHZA 3PRPB 3MC0B 1WR1A 4ZRQA 3U2SC 2RGFA 1HZ6A 4G11A 1WSPA 2L05A 4AJWA 1WXVA 3Q3NC 4HCNB 1SJED 2JX5A 4FJVB 4JE3B 3WALA 1QLBB 2NR2A 1N5XA 2ON8A 4P6VF 3ZNGC 3DWMA 1QOFA 3KUDB 2H88B 2KJHB 4XDDA 4A90A 4ZRIA 1SE9A 3O65B 2NBUA 3GOEA 1D5XC 3HVDA 2REXA 2NVUI 1MPEA 1L7YA 3RFZB 4US9A 5AZFA 3N32A 1STEA 4ANVA 1WJ4A 4A6QA 4KVGB 1SEBD 1RWSA 4NZLB 3N30A 1K8RB 1DOXA 1XF5L 4FA6A 3W1SA 2BVCA 1L4DB 1L0XB 3R8BA 3TUOA 1KLUD 5L83A 1FO4A 3PLVA 2JT4B 2WWZA 1SIFA 5IKCM 1HEZE 5KHOA 1VR9A 3V62A 3NJTA 5GMVA 4CO7A 3ALBA 3AXCA 1CMXB 5AUKA 3GZNB 4BAXA 4DHZB 2G4DB 2KDFB 1C77A 4YWGG 1LFDA 4HPLB 2JWZA 2AQ1B 3CMMB 2WXIA 2OJRA 1F1HA 4DXFA 3VUYA 2JQRB 3L4PA 2PW9A 3PVLA 1L0VB 2WNMA 3E9SA 2DYMA 3MJ5A 4WWNA 1F52A 5EE0A 4TV3A 2ZW1A 2IY1B 3H1UA 2CS4A 1YQ3B 3BYTB 1P0RA 1FFVA 4OZAA 2B3AA 5L95C 1DYQA 3N3KB 1J7CA 4C4VB 5C1ZA 5JZEB 3X0WA 2KNBA 2Z0DB 3Q6BA 2V4LA 3L54A 2LASA 3DQVA 5BYQA 4EE2A 1UGJA 5E6NA 3PZ7A 3S2AA 4RF1A 1C4PA 3A9KA 1C9FA 2N9KA 1D6EC 3KLSX 2WXMA 4AS1A 3W5VB 5E6OA 4WIPA 5BMHA 4HROA 2A4ZA 1ISNA 1SJHD 2KAJA 3U7ZA 4AUQC 4DXAB 4LDTB 5IOIA 3ZNHB 2CKHB 3UINB 1NVID 4W9CA 3PRMB 2M4NA 4ZRKA 3QCAA 3FC4A 2V0GA 1YJIA 3N20C 4HWIB 2MX2A 2ASQA 3ZVVA 4BKGA 1UWMA 4GDLA 4GLSC 3AEEB 4A8XC 2KC2A 1T0QC 2J7QB 1MVKA 1V9JA 3DBRB 2E3TA 4FLHA 1I4XA 2BS4B 3DPDA 4YTMB 1WI0A 3D32A 4GMVA 3BZDB 4C4VA 4TQ0A 4IWPA 4WJNA 3RPFC 3BINA 1P98A 4O1NA 1XCTL 4MGZE 3KQ4A 2DNFA 2KK8A 5J18A 4DXGA 3IAM1 2QILA 4PS8A 2J53A 4BOSC 2C5LC 2LGYA 5LLIA 2WXOA 1JWBD 2J0MA 1D3ZA 3WA0A 1LM8B 4AJYB 3U8ZA 5FR3A 3KYCD 3EC8A 3AE7B 2DZMA 4HDQA 4YTNB 2EMSA 2RPVA 1LXDA 4I6NB 1WXAA 4LNKA 2KDEB 5JHBA 4HLEA 1D5MC 3Q69A 2MSED 1N6ZA 4EZLA 1XXGA 3M3JA 5CHWA 1J7BA 3I5JC 4HPPA 1A5RA 2D3AA 2MBBB 3KVFB 4WWOA 4BKTA 2JXXA 2PEAA 1F0ZA 1QKZA 1OTRB 1Q10A 4RGTA 2XN9C 1T0SC 2M19A 1RFKA 5DPWA 1CQVA 1QOBA 3IG3A 3Q3MC 3CF6E 1E0ZA 3KUZA 3QWZB 2L0TA 5AZGA 3IT6B 2INPE 1YN5A 3EECA 4XWTA 2QHOA 4US8A 3ZIMA 4GB9A 3AECB 2C9WB 2IO1B 1WX7A 2BB5A 4OZCA 4MSMB 2MWSB 1OEYJ 3W5UB 2KVRA 4LNNA 4PYUA 4IKGA 1V5OA 1IGCA 1QT9A 4ARCA 4M01A 4WQOB 3DWGC 1X1MA 3K9OB 1YJJA 1RFAA 4KX6B 3DBLI 3Q14C 2LXAA 3AE5B 2NBWB 4KIKB 1XT9B 4TUUA 2UWQA 4PT5A 2G45B 3V6EB 5TSSA 2TSSA 3HHMA 2K6QA 3L08A 4ITKA 4C00A 2QSDA 3AI5A 4MT5A 3QJZA 5G2NA 1Q0WB 3RNFC 2IY0B 3AEGB 3PTFC 3E56A 4DBGA 3GE8C 2HDEA 3ZW3A 1T0YA 2O2VA 2Z8LA 2L32A 3PT2B 4JLCA 3UI3A 4NQKE 3HK0A 4ACFA 4KV2A 2CU1A 1ROEA 5H92C 2GB1A 3U52E 2KKCA 3RULA 3URYA 4S0RA 3W2DA 1WH3A 2LEKA 1V6EA 2FCQA 3P42A 4EZJA 2WDTB 3NZSA 3Q3OC 2ZZPB 3BIID 2MHJA 2R61A 1WRDB 2L1AA 1EM7A 1VDVA 2L76A 1D5ZC 2R2OA 1QQRA 1QOAA 1I35A 3PRZA 4RFBA 4P16A 4P1BC 3NZ3A 4RGMA 4P7IA 1QILA 4ZRJA 2H89B 4RMAA 1EWCA 2VZKB 3P4SB 2R2QA 1GC7A 5BYRA 3J9CA 3VUXA 2LFIA 2D3BA 3NUHB 3PREA 2QC8A 1FNUA 2WDQB 1FXTB 4LCDE 1KF6B 2DWQA 2DYOA 4WWMA 2GMIC 1BUIC 4ZHOA 2Z59B 2BS2B 2MBQA 3VAWA 2C60A 2BS3B 4HEA1 5DPRA 1WGGA 3RNGC 3AE2B 1VLBA 1AWDA 2M56B 3CIRB 3IVFA 1TY2A 3N1XC 1XCQL 5AEKB 4FADA 2KT7A 2MJEA 2WXJA 4M00A 4BVUC 1ENFA 1HTOA 1E7VA 4I6PA 4X57B 2JYTA 2IGDA 1R4MB 3BVGA 4ARIA 1YX6B 3WAPA 4D2KA 3VTVA 2EELA 2ZCCA 5MPOA 1C76A 1NI3A 2KDIA 3V3XA 1SF0A 2J42A 3Q8FA 1I4GA 4REZA 2IDYA 4W9DA 1AYFA 1K53A 4RNAA 1XLNA 3P1MA 1I4RA 3JW0X 5BYSA 2HJ1A 3VR8B 1TS4A 4RM8A 1JALA 3RZFA 3B1LX 2AL3A 2PVOD 4KKIA 3ZRCA 3AE6B 1WGHA 4KIKA 1J0GA 1TT5B 4W9EA 3BY4B 1NENB 4WJOA 3VVWB 3NS8A 3APDA 4L23A 3PV1A 2WDRB 2WXGA 2J0KA 3NG0A 2WXFA 5C2TB 2XNAC 3N9YC 2RPQA 3A4RA 4EUTA 1OQQA 3DVGY 2LWPA 4OHJA 4GDLB 2G1EA 1I4PA 2KHWB 2OJWA 3ZQ4A 1ET6A 2IO0B 1BT0A 3PZDA 2LRUA 5LXHA 1C79A 3RNCC 3R7QA 2NPTB 2LZ6A 4NJ6A 1H4RA 2I38A 4XGAB 4GDKA 1B9RA 2KFKB 3TJPA 2QEJC 2PPHA 2JPHA 4IM3A 4GGQA 3R3MA 3FKYA 5T8IA 2K8HA 3ZDTA 3EHVA 2KTRB 2KWVB 2MW5A 2LVOA 2AQ3B 1S1QB 5D6JB 3P4PB 2KWCA 2JRIB 1N61A 4HVBA 5C3JB 4HKQA 3BWUD 3SEBA 1S3SG 4LJPB 2KJRA 2KQSA 4HRSA 4F1SA 3KYDD 1UZXB 3ENEA 2IPKD 1SIJA 4XE0A 2FIFA 4ZRPA 1OEYA 1YMHE 5IN7A 2ZCBA 1SB3C 3Q3JA 3SR6A 4WWPA 2GOWA 3WAOA 2L0FA 2V9HA 4EEWA 2FE8A 2V3SA 3AE3B 3PPAA 1K51A 3T3OA 1IUEA 1MFWA 1I7HA 1IYFA 2KDBA 2KFKA 3JYUA 4IG7B 2YLMA 3SFDB 4IM0A 1UNSA 2BWES 1JWAD 4G0NB 2V4IB 2BQQA 3HM6X 3NY5A 2NBVB 1YNTE 5E6PA 3ZTCA 3HM3A 1PYWD 3TL5A 2K1FA 1KRHA 4EZKA 1C4CA 2JZPA 1OFFA 3QIJA 1ZXIA 5FKAC 4JL9A 3HIZA 3A33B 3VRBB 1PFDA 4IM2A 4LNFA 1B1ZA 2O6VD 1TS5A 1AN8A 4FHKA 3WANA 2I2YA 3HUIA 3FAHA 1MG4A 3A9JA 2O2VB 3ZRFA 2C7HA 4F8CB 4G50A 3WCQA 4IWOA 2FNJB 5D3DA 3VQIA 2MJ3A 3ZJVA 4W9JA 3HRDD 4B0EA 1IBXA 3L16A 1LO5D 1XLQA 2RDBC 3GS2A 1EU3A
chains in the Genus database with same CATH topology
1XXGA 5I4DA 4XWWA 1F2RC 2CJOA 1J7BA 3NVVA 4RGOS 5EE3A 2Y5PA 1IGDA 2SEBD 1L0YB 2MH7A 1KH0A 3AEAB 2BT6A 4N58A 1FRRA 1F0ZA 1QKZA 1GB1A 1TS2A 5LNK1 1Q10A 2V3NA 1QF6A 4RGTA 5G5HA 2XN9C 2M19A 1RFKA 2QIEB 2BTEA 1CQVA 1QOBA 4USAA 2AQ2B 1VZ6A 4IOIE 1SSNA 3KWLA 1FEHA 3MHZA 4TQ1A 4ZYSA 2BBCA 4RCOA 1DGJA 1E0ZA 1FNWA 2IJ0A 2Y3AA 1P7FA 2N7JA 3KWVA 3AE9B 2EKIA 5AUIA 1SE2A 2PVGC 3IT6B 2INPE 1FXIA 1YN5A 3BYYB 1ZOYB 3SFEB 2OHFA 3BVZA 2FBWB 4XWTA 4WURA 4US8A 1HXYD 4OW0A 3AECB 1ET9A 5D3IB 1T5XD 4GDKB 2K5PA 4M0WA 4JPSA 2BB5A 4OZCA 3P4QB 2WDVB 4ZOHC 1FMAD 1TY0A 2PTLA 1N60A 2YEPF 1XLOA 2FUG1 3W5UB 1FD6A 2Q5WD 4R3DA 4IKGA 2NTTA 1IGCA 1QT9A 4ARCA 4LTUA 1E10A 2E6XA 3AE8B 1TS3A 3DWGC 1AW7A 1YJJA 2KQ4X 5GXGB 1JROA 3NVWA 3TSSA 3W9CB 2J4XA 5BMIA 2WP9B 4KX6B 4KGRA 3TEZA 4FXCA 3ZGZA 3AE5B 2RDHA 2LJIA 1BMLC 1DOIA 3IT4B 1M4VA 4PT5A 2NTSA 5TSSA 2TSSA 1JCKB 4ITKA 1ACCA 3C8YA 1HQRD 5HHDG 1EWYC 3AE1B 2QSDA 3ABVB 2DBYA 4MT5A 1TKEA 2KMMA 1FIQA 5HFYA 2X38A 3I57A 1CZPA 3AEGB 1V97A 1JWMD 3E56A 3EUB2 4A9AA 3O13A 2W3SA 1CJEA 1NEKB 5D7GA 1K50A 3OWEB 4HJGE 4YT0B 3FILB 4DQOC 3U4EG 4N6EB 3NRZA 1KLGD 2HDEA 1PGAA 1P7EA 2Z8LA 2L32A 3B9JA 2CU3A 3UI3A 2L52A 1NYRA 1DOYA 1VZ7A 2LMCA 1L6UA 4Q2JA 1VRAB 3I9V1 1ROEA 3LYYA 5H92C 5EE1A 1SE4A 2GB1A 4OVZA 3U52E 1UWXA 3B2FA 4L2YA 4C56C 1N62A 3URYA 3W2DA 2KN4A 2LEKA 1WXQA 2G9HD 4OZBA 1XO3A 3P42A 1FM0D 2WXLA 1ZDVA 3AE4B 3BIID 2BW2A 2QJLA 5FK9C 2R61A 2WXQA 1IBXB 2L1AA 2W54A 1V1PB 1EM7A 1VDVA 3NVZA 1D5ZC 1QQRA 1QOAA 1ZP0B 4RFBA 2KWDA 4P16A 3T3NA 3NZ3A 5HG2A 1EU4A 4RGMA 2V3PA 1QILA 2LHEA 2H89B 4TSSA 2LUMA 3IAS1 2CJNA 1FFUA 1EWCA 2Y5CA 1VJKA 4N59A 5JXVA 4RF0A 1GB4A 2GRIA 1V1PA 4AQ7A 2VZKB 3V05A 3P4SB 1ZPSA 3Q8BA 1E9MA 2RDGA 1WWTA 3AB5A 3CWIA 1ZE3D 2IGHA 3Q8CA 5BYRA 3J9CA 2LFIA 4YTPB 4WH4A 3NUHB 4YSYB 3MC0B 1N5WA 4XDCA 4ZRQA 2N9LA 3U2SC 1FNUA 2GI9A 2WDQB 1HZ6A 3VRAB 1KF6B 3P63A 1K52A 1WSPA 2DWQA 1ZUD2 2DYOA 1QOGA 1V8CA 4WWMA 2JYEA 4ZHOA 1BUIC 1SJED 2BS2B 2JX5A 2WU5B 4JE3B 1TKGA 1QLBB 2BS3B 1RM6C 4HEA1 1ZXHA 3FILA 1FXAA 2WXKA 1N5XA 1VZ8A 2ON8A 2JU6X 3AE2B 4P6VF 1VLBA 1AWDA 3DWMA 1QOFA 2M56B 3CIRB 4C7YA 5HI1A 2RMMA 3LXFA 2WXRA 1TY2A 2H88B 1RYJA 4JWSC 1GOZA 4XDDA 4A90A 3MP9A 1XCQL 1MHHE 2MJEA 4LLGM 1TZOA 2WXJA 3HVDA 1D5XC 1ENFA 2KDMA 4H2AA 4NAMA 3ZYYX 1MI0A 1YN4A 1MPEA 4L1BA 2JYTA 3RFZB 4US9A 2IGDA 1STEA 1GAQB 3BVGA 1WYGA 4ARIA 4A6QA 2PIAA 2KACA 4D2KA 2EELA 1D4BA 5MPOA 2MEKA 1C76A 1SEBD 1NI3A 1RWSA 4NZLB 3ETRA 3V3XA 2K3UA 1UUPA 2BB6A 4KGTA 1SF0A 2J42A 3Q8FA 1I4GA 4REZA 1DOXA 1XF5L 3LB8C 2ONQA 1TKYA 2W55A 3W1SA 1SXTA 2IDYA 1AYFA 1ESFA 1K53A 4RNAA 2NMQA 1XLNA 2K22A 3P1MA 3EA6A 1I4RA 2J52A 1L4DB 1L0XB 2N0SB 5BYSA 1L4ZB 2K9XA 3VR8B 1TS4A 3R8BA 4TMAB 3R2TA 3TUOA 3ZJUA 1KLUD 1JALA 1JWSD 1WRIA 3AM9A 1FO4A 3TEWA 2PVOD 4KKIA 2PLPA 3AE6B 1JW9D 2WXNA 1HEZE 1TJEA 2L83A 2LHDA 3NVYA 1VR9A 1NENB 4NAWB 3GB1A 1HZ5A 1V1OA 5AUKA 3B2GA 4C80A 1XEEA 1JMLA 4L23A 3TEXA 2WDRB 2WXGA 2JWUA 2IGGA 1C77A 2PKOA 1PGXA 4YWGG 2WLBA 1CK1A 1SBBB 5E6JA 2AQ1B 2WXFA 5C2TB 2JSVX 1I4QA 2XNAC 1PDXA 3N9YC 2WXIA 4C7ZA 1GPXA 4DXFA 1TYGB 3H8HA 1A70A 2JQRB 3L4PA 2PW9A 1OQQA 2DLBA 2ZW0A 4OHJA 4GDLB 2G1EA 4WAFA 1L0VB 1I4PA 2PMVA 2WNMA 3E9SA 2DYMA 3MJ5A 3ZQ4A 4HKZE 3AEBB 1ET6A 5EE0A 2ZW1A 3AEFB 5BMGA 1C79A 1YQ3B 3BYTB 1FFVA 4OZAA 1FRDA 1L5PA 4RGNA 2I38A 1B9RA 2W3RA 1JQ4A 2QEJC 1DYQA 2QMTA 4KGSA 2WS3B 1J7CA 1T3QA 3EGRA 4LK0M 4YSZB 2INNE 2WU2B 5EE9A 5T8IA 3TEYA 1OQRA 5BYQA 4EE2A 3ZJTA 1UGJA 2AQ3B 1FCCC 1T6BX 3PZ7A 4KKJA 1R7SA 3AN1A 4RF1A 1JWUD 1C4PA 3P4PB 4WQMA 1XLPA 1C9FA 2VZKD 2N9KA 1D6EC 1N61A 3KLSX 4A55A 5C3JB 4HKQA 2WXMA 2M0AA 3BWUD 4AS1A 4ZHPA 3SEBA 4YSXB 1I4HA 3W5VB 1KTKA 4WIPA 4HRSA 3Q8EA 5BMHA 4HROA 1E6EB 1SJHD 2KAJA 1N63A 3U7ZA 3NS1A 4YXDB 4XE0A 2IPKD 1SIJA 1NVID 2HTME 3MFGA 4ZRPA 2JXTA 1YMHE 1L6VA 1E7PB 3FC4A 2V0GA 1YJIA 1SB3C 3SR6A 3AV8A 1WGKA 2B76B 1UWMA 4GLSC 3AEEB 4A8XC 1MVKA 4B0MA 2AX5A 5G5GA 2D5GA 2FE8A 3AE3B 1F77A 4IDIA 1K51A 2E3TA 3AMZA 3T3OA 3AH7A 1IUEA 1I7HA 3AEDB 2WXPA 1I4XA 2BS4B 2YEPB 2SAKA 4YTMB 3PO0A 3BK2A 3SFDB 4J3OD 1UNSA 1JWAD 3BZDB 2V4IB 3IXSA 2K0PA 1PUTA 4TQ0A 2MJDA 1MHXA 1KFYB 3RPFC 1C78A 1YQ4B 1Y56A 1YNTE 4O1NA 5H8YE 1XCTL 4NJCA 3KQ4A 4RH6A 2ICIA 1PYWD 4MACA 3VR9B 2BYTA 1KRHA 4UDUC 4DXGA 4JWUC 1C4CA 3Q8AA 3HVZA 2JZPA 1OFFA 2QILA 3IAM1 1ZXIA 5FKAC 1BXTA 2J53A 3VRBB 1PFDA 2WXOA 1B1ZA 2OEDA 1JWBD 1TS5A 1AN8A 2I2YA 2WQYB 1FCLA 3HUIA 2LGIA 3FAHA 4JX1C 2WXHA 3PZ8A 1FNVA 3GP7A 2W82A 5FR3A 3BVMA 3AE7B 3WCQA 1JRPA 5D3DA 1YN3A 4YTNB 3BK1A 1C4AA 1F2RI 3R2IA 1NYQA 3VQIA 2RPVA 2MJ3A 3ZJVA 4MH8A 3HRDD 4CQNA 1SE3A 4B0EA 1IBXA 4MM3B 2ACZB 1HA5A 1LO5D 1ZDXA 1PGBA 1XLQA 1D5MC 3P4RB 3Q69A 1J7AA 3GS2A 1EU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRO A;  2CU3 A;  1E6E B;  2L52 A;  2PIA A;  1NYR A;  2KAJ A;  1DOY A;  2CJO A;  1N63 A;  4YXD B;  3NS1 A;  1L6U A;  1J7B A;  1ROE A;  5H92 C;  1SIJ A;  3NVV A;  5MPO A;  5EE1 A;  1NVI D;  1NI3 A;  1RWS A;  3ETR A;  2HTM E;  5EE3 A;  3B2F A;  1L6V A;  1E7P B;  1SF0 A;  1N62 A;  3FC4 A;  3LB8 C;  1DOX A;  1YJI A;  2MH7 A;  3AEA B;  1SB3 C;  1TKY A;  2LEK A;  2W55 A;  2BT6 A;  1WXQ A;  3SR6 A;  1AYF A;  4N58 A;  1FRR A;  1XO3 A;  1XLN A;  2K22 A;  3P1M A;  1F0Z A;  1FM0 D;  3AV8 A;  1WGK A;  2N0S B;  2B76 B;  1UWM A;  3AE4 B;  2K9X A;  3VR8 B;  3BII D;  3AEE B;  1QF6 A;  5G5H A;  2M19 A;  2QJL A;  1RFK A;  1JAL A;  2QIE B;  2W54 A;  1QOB A;  1WRI A;  3AM9 A;  1VDV A;  3NVZ A;  2PVO D;  1FO4 A;  2AX5 A;  5G5G A;  3AE6 B;  4USA A;  3AE3 B;  1JW9 D;  4IDI A;  3KWL A;  1TJE A;  2L83 A;  1QOA A;  3NVY A;  2E3T A;  3AMZ A;  3AH7 A;  1IUE A;  1ZP0 B;  1I7H A;  3AED B;  2BS4 B;  1NEN B;  1DGJ A;  4YTM B;  1E0Z A;  3PO0 A;  5AUK A;  3SFD B;  3B2G A;  4C80 A;  2H89 B;  2CJN A;  1FFU A;  1JWA D;  2Y5C A;  5AUI A;  3AE9 B;  1VJK A;  2EKI A;  4N59 A;  2PVG C;  2WDR B;  1FXI A;  1PUT A;  2MJD A;  1ZOY B;  3P4S B;  2PKO A;  3SFE B;  2OHF A;  1E9M A;  1KFY B;  2FBW B;  1WWT A;  2WLB A;  4US8 A;  3AB5 A;  3CWI A;  3RPF C;  1YQ4 B;  5H8Y E;  3AEC B;  5C2T B;  1PDX A;  4YTP B;  2K5P A;  4C7Z A;  1GPX A;  1TYG B;  3P4Q B;  4YSY B;  1A70 A;  2JQR B;  2WDV B;  3L4P A;  1OQQ A;  2G1E A;  1N5W A;  4ZOH C;  3VR9 B;  1FMA D;  1L0V B;  2WDQ B;  1KRH A;  3VRA B;  1N60 A;  1KF6 B;  1XLO A;  3AEB B;  3P63 A;  4JWU C;  5EE0 A;  2Q5W D;  3W5U B;  3AEF B;  3HVZ A;  1OFF A;  2DWQ A;  1ZUD 2;  1ZXI A;  1QOG A;  1QT9 A;  1V8C A;  1YQ3 B;  4LTU A;  1PFD A;  4WWM A;  3VRB B;  1FFV A;  1E10 A;  4ZHO A;  3AE8 B;  1FRD A;  1L5P A;  3DWG C;  2BS2 B;  2JX5 A;  1JWB D;  2WU5 B;  1YJJ A;  2W3R A;  3W9C B;  5GXG B;  1JRO A;  3NVW A;  1B9R A;  1TKG A;  1QLB B;  2BS3 B;  1JQ4 A;  1RM6 C;  2WP9 B;  2WQY B;  4KX6 B;  3HUI A;  2WS3 B;  1FXA A;  1J7C A;  1T3Q A;  1N5X A;  3FAH A;  4FXC A;  3AE2 B;  4JX1 C;  3AE5 B;  4P6V F;  1VLB A;  1AWD A;  3DWM A;  1QOF A;  2M56 B;  3CIR B;  4YSZ B;  1DOI A;  4C7Y A;  2WU2 B;  3LXF A;  5EE9 A;  2H88 B;  1RYJ A;  4JWS C;  3AE7 B;  3WCQ A;  4ITK A;  1OQR A;  1JRP A;  1EWY C;  4YTN B;  3AE1 B;  3ABV B;  1NYQ A;  2DBY A;  2MJE A;  1TKE A;  2KMM A;  1FIQ A;  2MJ3 A;  1R7S A;  3HRD D;  3AN1 A;  3P4P B;  3ZYY X;  4WQM A;  1CZP A;  3AEG B;  1V97 A;  1XLP A;  3EUB 2;  4A9A A;  2ACZ B;  2W3S A;  1CJE A;  1N61 A;  1NEK B;  5C3J B;  4YT0 B;  4N6E B;  4ZHP A;  1XLQ A;  4US9 A;  4YSX B;  3NRZ A;  3P4R B;  3W5V B;  1GAQ B;  1J7A A;  1WYG A;  4HRS A;  3B9J A; 
#chains in the Genus database with same CATH topology
 3JVZ X;  2CJO A;  2O6V B;  1EF1 A;  3NVV A;  3PS6 A;  4E71 A;  5EE3 A;  2PE9 A;  1H8C A;  2MH7 A;  2L8J A;  4DDG D;  4KZ0 A;  1TS2 A;  2LGS A;  3I63 C;  3PLU A;  5LNK 1;  5CTR C;  4GXB A;  2KO3 A;  1T0R C;  1QF6 A;  3DVN U;  2BTE A;  3QAQ A;  4USA A;  1VZ6 A;  1LGR A;  4IOI E;  1SSN A;  3UQB A;  3MHZ A;  4AP4 C;  5D2M B;  1FNW A;  2IJ0 A;  4MSQ B;  1YOV B;  3UGB B;  2VH1 A;  3QAR A;  2EKI A;  2K25 A;  4A3P A;  5J17 A;  3SFE B;  4PS3 A;  1UBQ A;  2FBW B;  4WUR A;  4OW0 A;  4MEL A;  1ET9 A;  3PHW B;  2Z0E B;  2K5P A;  4GDK B;  2FCM A;  1EUV B;  3M95 A;  4LDT D;  1FMA D;  2Q5W D;  3OJ3 A;  2NTT A;  1E10 A;  1WIA A;  3AE8 B;  3M62 B;  3VDZ A;  2GBJ A;  2KQ4 X;  3NVW A;  4I6L B;  5BMI A;  2WP9 B;  2CR5 A;  3ZGZ A;  2RDH A;  2LJI A;  1BML C;  3C0R B;  1PQS A;  2BYF A;  3C8Y A;  5HHD G;  2DBY A;  5CHV C;  4BFR A;  3TCA A;  2KMM A;  4FHJ A;  2X38 A;  2D3C A;  4XX5 A;  4TKN A;  1JWM D;  3EUB 2;  4A9A A;  2X8X X;  2W3S A;  1K50 A;  1KJT A;  2ZNV C;  1R4N I;  3OWE B;  1P7E A;  1IPG A;  2CU3 A;  4FN2 A;  3RNB C;  2LI5 A;  3I9V 1;  4KSK C;  1SE4 A;  1UWX A;  2OOB B;  4W9K A;  1N62 A;  2IBI B;  2QDF A;  2KN4 A;  4HDO A;  4OVU A;  3PGE A;  3KUC B;  1XO3 A;  4OZB A;  1E8W A;  1ZDV A;  1WM3 A;  3B0A A;  1XD3 B;  1VD2 A;  3APF A;  4MM3 A;  2I1K A;  1J8C A;  1V1P B;  1MJD A;  1C1Y B;  4M8N A;  3T3N A;  5HG2 A;  1EU4 A;  3TBL D;  2LUM A;  1FFU A;  2Y5C A;  1VJK A;  5JXV A;  1RLF A;  3V05 A;  1ZPS A;  1YD8 U;  2XEW A;  3RUI B;  2IGH A;  4YSY B;  4W9I A;  4K7U A;  4MGI E;  2IO2 B;  3P63 A;  1K52 A;  3B08 A;  1QOG A;  1V8C A;  5KHQ A;  2WGS A;  3RYT A;  3AUL A;  3V60 A;  5EDS A;  3SHQ A;  1RM6 C;  3ECI A;  4FJZ A;  3FIL A;  2ZVN A;  2WX0 A;  2JU6 X;  4C7Y A;  2WXR A;  2GBK A;  4II3 B;  1UF0 A;  1RYJ A;  4JWS C;  3V6C B;  3MP9 A;  3QC8 B;  4LLG M;  2VRR B;  4H2A A;  1ZKH A;  4GIV A;  3SD5 A;  1WFY A;  3A9J B;  3QA8 A;  1F9J A;  1V5T A;  2KVZ A;  4JQW C;  4L1B A;  4KDL B;  4JGH B;  1GAQ B;  2PIA A;  2KAC A;  1NBF C;  3PHX B;  2MEK A;  3OJ4 B;  3RNA C;  1WJN A;  1UUP A;  4KGT A;  4K3C A;  4W9F A;  2VH2 A;  3ML9 A;  3LB8 C;  2ONQ A;  2N9E B;  1SXT A;  1ESF A;  3RMK C;  1U4A A;  2J52 A;  2N0S B;  1L4Z B;  4TMA B;  2LXC A;  4WJQ A;  1E5W A;  3QHT A;  3WIM A;  1WRI A;  1IP9 A;  1JW9 D;  2KXJ A;  1TJE A;  2L83 A;  3NVY A;  4NAW B;  2RD0 A;  2D2Q A;  3M63 B;  1V1O A;  1WGD A;  4C80 A;  1XEE A;  1JML A;  4K3B A;  3TEX A;  4M8M A;  2JWU A;  2KD0 A;  2JZ3 B;  1PGX A;  3MHS D;  2WLB A;  2WHI A;  1CK1 A;  3VHT C;  4ANX A;  1SBB B;  5E6J A;  2K6D B;  2MLB A;  4XZ4 A;  1R4M I;  2JSV X;  2LD9 A;  4C7Z A;  1GPX A;  4II2 B;  3H8H A;  1WF9 A;  3VFK A;  1UGM A;  2ZW0 A;  4LJO B;  2PMV A;  4HKZ E;  3DVG X;  4K7W A;  1E8Y A;  5BMG A;  2MRP A;  3UIO B;  1L5P A;  4B6W A;  2W3R A;  3H7P A;  1JQ4 A;  1WGY A;  2LVP A;  2QMT A;  2KTF A;  2DZK A;  2WS3 B;  4KGS A;  1RRB A;  1T3Q A;  2FAZ A;  3EGR A;  3UF8 A;  4LK0 M;  4YSZ B;  2INN E;  2WU2 B;  4URK A;  4FUL A;  3TEY A;  1OQR A;  2ZPY A;  2KTR A;  1FCC C;  1T6B X;  1R7S A;  1JWU D;  4DHJ D;  4A55 A;  4GOC A;  4E3C A;  4YL8 A;  4ZHP A;  2MQJ A;  3Q8E A;  1ZGU B;  2W9N A;  3ZXV A;  3A1Q A;  3NS1 A;  4YXD B;  4ICU A;  2MBO A;  2BPS A;  2HTM E;  2LGD A;  2JXT A;  1L6V A;  5JHA A;  4RM9 A;  1YJ1 A;  1WGK A;  2PJH A;  4PK1 A;  3UQA A;  3VTU A;  4B0M A;  2AX5 A;  5G5G A;  2D5G A;  2N4F A;  1F77 A;  3TMP B;  2KOX A;  4DHZ E;  3AH7 A;  3AED B;  2WXP A;  4EOY A;  3VH3 B;  2SAK A;  4A3O A;  3BK2 A;  4K1R B;  4OVV A;  2JF5 A;  4J3O D;  4N9F 4;  2C7M B;  3H7P B;  1PUT A;  2FID A;  3DHG C;  1KFY B;  2Y5B B;  1M94 A;  2MA9 B;  2KYW A;  1Y56 A;  1E90 A;  3RCZ A;  3R66 C;  2DX5 B;  4NJ7 A;  4RH6 A;  4MAC A;  2D07 B;  3H9D A;  2BYT A;  1YIW A;  3HVZ A;  1EF5 A;  1RAX A;  2BWF A;  2LGX A;  4E74 A;  1GNU A;  2MP2 A;  2WQY B;  1WY8 A;  4JX1 C;  3ZXR A;  1FNV A;  3GP7 A;  2W82 A;  3TIX A;  2NS5 A;  2XK5 B;  1JRP A;  1YN3 A;  1F2R I;  3R2I A;  1NYQ A;  1WZ3 A;  4DDI D;  1P1A A;  4CQN A;  4MH8 A;  1C3T A;  1SE3 A;  2N7D A;  1KLV A;  2ACZ B;  2UYZ B;  3WAM A;  1ZDX A;  2GBM A;  1J7A A;  3DDC B;  4XWW A;  4MJS A;  5IA7 A;  2IND C;  2NCN A;  5J2R A;  4DHJ B;  2Y5P A;  5DPS A;  1L0Y B;  2LVQ A;  3AEA B;  2LJ5 A;  2BT6 A;  3LDZ E;  3DBH B;  5CX3 A;  2V3N A;  1WZ0 A;  4ANU A;  4F7Z A;  1WXS A;  2D3G A;  3A1Q B;  2M17 A;  2RSU A;  3CSF A;  4HJK A;  1L2N A;  4RCO A;  3V61 A;  4ANW A;  2WYQ A;  1P7F A;  2GBR A;  5AUI A;  3AE9 B;  1R4N B;  1FXI A;  3BYY B;  2JY6 A;  1ZOY B;  3ZO5 B;  3BVZ A;  2FUH B;  2EMT A;  3T8M A;  1HXY D;  3L0W B;  1OGW A;  1T5X D;  2FCN A;  3PSE B;  4JPS A;  1JRU A;  1UD7 A;  1J19 A;  2HE7 A;  1TY0 A;  2PTL A;  4WAA A;  3ZKJ C;  4LNO A;  1N60 A;  2YEP F;  1XLO A;  1FD6 A;  2ZJD A;  4AOF A;  3ML8 A;  4R3D A;  2A5U A;  1AW7 A;  4MDK E;  3IBE A;  1V80 A;  3L13 A;  3W9C B;  5GXG B;  3TSS A;  2BKF A;  5C23 A;  4KGR A;  3TEZ A;  4FXC A;  3R7R A;  1DOI A;  2BKR B;  5IO9 A;  1TGZ B;  1VCB A;  3IHP C;  1ACC A;  1HQR D;  2PE6 B;  3ABV B;  2L00 B;  5HKH A;  1FIQ A;  1CZP A;  1V97 A;  4XYC A;  3O13 A;  1CJE A;  5D7G A;  3JSV A;  4HJG E;  3FIL B;  4NAW A;  4N6E B;  3ZTD A;  4K81 A;  3NRZ A;  1KLG D;  2ZPN A;  1PGA A;  3DOW A;  3B9J A;  2L52 A;  3QQ8 B;  2L3Z A;  1VZ7 A;  2LMC A;  3OG5 A;  2ZNV B;  2KLC A;  4OVZ A;  1P3Q U;  3QK0 A;  2N1W A;  3B2F A;  4L2Y A;  4C56 C;  1SGH A;  4MJS B;  1WXQ A;  2G9H D;  1FM0 D;  2WXL A;  1WMH B;  1Y8R C;  2BW2 A;  5FK9 C;  3U30 A;  4ICV A;  2DZJ A;  4M02 A;  3UIP B;  3Q3F A;  3EFC A;  3L10 B;  3LJ3 A;  2V3P A;  2D10 A;  2LHE A;  2RR9 A;  1WR6 E;  4CHK A;  4N59 A;  4RF0 A;  2MP2 B;  3RT3 B;  1V1P A;  3Q8B A;  1E9M A;  1WWT A;  3AB5 A;  3CWI A;  1YX5 B;  4YTP B;  2BYV E;  3X23 A;  1N5W A;  4XDC A;  3ZNZ B;  2N9L A;  5TR5 A;  2GI9 A;  2KMC A;  3VRA B;  2CHW A;  4DWF A;  1ZUD 2;  2JYE A;  1UBI A;  4KZC A;  2WU5 B;  3EFU A;  3A4S C;  4W9G A;  2DEN B;  3RN9 C;  1TKG A;  1ZXH A;  2JRH A;  2DZI A;  1FXA A;  2WXK A;  1VZ8 A;  5IAA C;  5HI1 A;  2M0X A;  2RMM A;  2D11 A;  3LXF A;  5LXI B;  1GOZ A;  5D94 A;  2KWU B;  1MHH E;  3NHE B;  3VUW A;  2BGF A;  1TZO A;  2WX1 A;  2KDM A;  5JH5 C;  1HTQ A;  4NAM A;  2N7E A;  3ZYY X;  2HD5 B;  1MI0 A;  1YN4 A;  1WJU A;  4B95 A;  5DPT A;  3OAW A;  1WYG A;  2DYB A;  4W9H A;  3DBR I;  1D4B A;  2HTH A;  1V2Y A;  3N1Z C;  1UH6 A;  2KLG A;  5IP4 D;  3I3T B;  3ETR A;  2K3U A;  2BB6 A;  3SU8 X;  4CYE A;  2UU7 A;  1TKY A;  2W55 A;  2INC C;  2G4S A;  3Q2A C;  2NMQ A;  2K22 A;  3EA6 A;  2GBN A;  2K9X A;  3ZJU A;  3R2T A;  1JWS D;  3AM9 A;  3TEW A;  2PLP A;  1MG8 A;  2WXN A;  3T9L A;  2LHD A;  3APC A;  1V86 A;  1FPY A;  1Q5W B;  4GU2 A;  1P9D U;  3GB1 A;  1HZ5 A;  4A20 A;  1WE6 A;  1G6J A;  3B2G A;  2N1V A;  1WX8 A;  2ZEQ A;  3U7D A;  3N1Y C;  2IGG A;  1GG3 A;  1ZW7 A;  2PKO A;  4HCP B;  2N9X A;  5AZH A;  1I4Q A;  1PDX A;  3GE3 C;  1TYG B;  3AU4 A;  1A70 A;  2DLB A;  4WAF A;  4WJP A;  3ZLZ A;  3AEB B;  4PS7 A;  1KM7 A;  3AEF B;  3ZDM C;  3DHH C;  2KQ7 A;  1FRD A;  4RGN A;  4W9L A;  4HPM B;  2MCN B;  3KH0 A;  4BBN F;  4NQL B;  2EKE C;  1V81 A;  2C7N B;  5EE9 A;  3RD2 A;  3DCG A;  2DHZ A;  1NI2 A;  3OLM D;  3ZJT A;  2CHX A;  4KKJ A;  3AN1 A;  4BKS D;  2LUE A;  4WQM A;  1XLP A;  3GZN I;  2VZK D;  1NDD A;  2M0A A;  4YSX B;  1I4H A;  1KTK A;  1WGR A;  1E6E B;  4GN1 A;  1WMH A;  4MH0 E;  4IWQ A;  1N63 A;  1Q1O A;  3RI7 C;  2MBE A;  3MFG A;  3DVN V;  1E7P B;  4IC7 B;  1WXM A;  2AEH A;  1WYW B;  3AV8 A;  3K9P B;  2B76 B;  2ZVO A;  1GUA B;  2O6V A;  1OQY A;  4IDI A;  1EO6 A;  4B9K A;  3AMZ A;  3SDL C;  2L7R A;  2YEP B;  2JUO A;  3PO0 A;  2HJ8 A;  1Z5S B;  3IXS A;  2M1M A;  2K0P A;  3MC9 A;  5BO4 B;  2MJD A;  4HXD A;  1MHX A;  1E8Z A;  3VXW A;  1C78 A;  1YQ4 B;  5H8Y E;  4KSL C;  4NJC A;  2GLS A;  2XBB C;  4IUM B;  1E8X A;  4ZDV A;  2ICI A;  3VR9 B;  1KOT A;  2K39 A;  4UDU C;  3VH4 B;  4JWU C;  3Q8A A;  1BXT A;  4ZYN A;  3RNE C;  2OED A;  3DBS A;  2KJ6 A;  1FCL A;  2LGI A;  4MEM A;  2WXH A;  3ZUN A;  3PZ8 A;  2K8B A;  1TTN A;  2M8S A;  3BVM A;  3BK1 A;  1C4A A;  1V49 A;  4MGY E;  4EFO A;  2KX0 A;  1I42 A;  4MM3 B;  1E7U A;  2IO3 B;  4GSW A;  1YQB A;  4XC2 A;  3P2B A;  1HA5 A;  5G55 A;  1PGB A;  2KMA A;  3P4R B;  5I4D A;  2NPT A;  1Z2M A;  1F2R C;  2YVC A;  4BKS A;  4RGO S;  4PYZ A;  3H7S A;  1IGD A;  2SEB D;  4S17 A;  2DAF A;  1HE8 A;  3KW5 B;  1KH0 A;  3VTW A;  4N58 A;  1FRR A;  1GB1 A;  2KFJ A;  2AWT A;  3DBL B;  4LNI A;  4BBN C;  3QX1 A;  3H6N A;  5G5H A;  2QIE B;  1GC6 A;  4NY0 A;  2AQ2 B;  2MBH A;  3W1S C;  1XQQ A;  3KWL A;  1FEH A;  4TQ1 A;  4ZYS A;  2BBC A;  2JVC A;  1TZ1 A;  4DK5 A;  1DGJ A;  3NOB A;  2Y3A A;  4BZA A;  2N7J A;  2XK5 A;  3KWV A;  1SE2 A;  2PVG C;  1QZE A;  4K7S A;  5FR6 A;  3L17 A;  2OHF A;  4MGK E;  4KDI C;  2N9P C;  2AYO B;  5D3I B;  4M0W A;  3MTN B;  2BF8 B;  1UEL A;  3P4Q B;  1TIF A;  2WDV B;  4ASW C;  4ZOH C;  2FUG 1;  2LRW A;  2BYE A;  4EKU A;  1GJZ A;  4LTU A;  2E6X A;  2FCS A;  1TS3 A;  3DBH I;  4NNJ B;  1JRO A;  2J4X A;  3DHI C;  2IYD B;  2AL6 A;  4G3X B;  2KC1 A;  3IT4 B;  1M4V A;  2K8C A;  2NTS A;  3A9K B;  1JCK B;  1EWY C;  3AE1 B;  2IZV B;  1TKE A;  3ONS A;  5DCN A;  5HFY A;  1AAR A;  4AWJ A;  4IW0 A;  2KZR A;  3I57 A;  4QAY A;  2KX3 A;  4P1C C;  1NEK B;  4YT0 B;  4DQO C;  3C19 A;  3U4E G;  3MC8 A;  2KAN A;  1WJ6 A;  1WM2 A;  4NPN A;  5CHF A;  4BOZ B;  3IFW B;  1NYR A;  1LQB A;  1DOY A;  4Q2J A;  1L6U A;  1VRA B;  3LYY A;  5EE1 A;  3RZW C;  1WE7 A;  3ZNI D;  2DAJ A;  3JSV B;  4M0W B;  3W1Y A;  2J0J A;  3AE4 B;  2JZZ A;  2G3Q B;  2QJL A;  2WXQ A;  1IBX B;  2W54 A;  3NVZ A;  4J6I A;  4FBJ B;  1ZP0 B;  2KWD A;  3NZU A;  1TBE A;  2QCZ A;  4TSS A;  3IAS 1;  2CJN A;  4FJY A;  3MJW A;  2KN5 A;  1GB4 A;  2GRI A;  4AQ7 A;  3AU5 A;  2RDG A;  4HK2 A;  2V1Y A;  3CST A;  1ZE3 D;  4JIO U;  3Q8C A;  1WX9 A;  4WH4 A;  2I1J A;  2CHZ A;  3PRP B;  3MC0 B;  1WR1 A;  4ZRQ A;  3U2S C;  2RGF A;  1HZ6 A;  4G11 A;  1WSP A;  2L05 A;  4AJW A;  1WXV A;  3Q3N C;  4HCN B;  1SJE D;  2JX5 A;  4FJV B;  4JE3 B;  3WAL A;  1QLB B;  2NR2 A;  1N5X A;  2ON8 A;  4P6V F;  3ZNG C;  3DWM A;  1QOF A;  3KUD B;  2H88 B;  2KJH B;  4XDD A;  4A90 A;  4ZRI A;  1SE9 A;  3O65 B;  2NBU A;  3GOE A;  1D5X C;  3HVD A;  2REX A;  2NVU I;  1MPE A;  1L7Y A;  3RFZ B;  4US9 A;  5AZF A;  3N32 A;  1STE A;  4ANV A;  1WJ4 A;  4A6Q A;  4KVG B;  1SEB D;  1RWS A;  4NZL B;  3N30 A;  1K8R B;  1DOX A;  1XF5 L;  4FA6 A;  3W1S A;  2BVC A;  1L4D B;  1L0X B;  3R8B A;  3TUO A;  1KLU D;  5L83 A;  1FO4 A;  3PLV A;  2JT4 B;  2WWZ A;  1SIF A;  5IKC M;  1HEZ E;  5KHO A;  1VR9 A;  3V62 A;  3NJT A;  5GMV A;  4CO7 A;  3ALB A;  3AXC A;  1CMX B;  5AUK A;  3GZN B;  4BAX A;  4DHZ B;  2G4D B;  2KDF B;  1C77 A;  4YWG G;  1LFD A;  4HPL B;  2JWZ A;  2AQ1 B;  3CMM B;  2WXI A;  2OJR A;  1F1H A;  4DXF A;  3VUY A;  2JQR B;  3L4P A;  2PW9 A;  3PVL A;  1L0V B;  2WNM A;  3E9S A;  2DYM A;  3MJ5 A;  4WWN A;  1F52 A;  5EE0 A;  4TV3 A;  2ZW1 A;  2IY1 B;  3H1U A;  2CS4 A;  1YQ3 B;  3BYT B;  1P0R A;  1FFV A;  4OZA A;  2B3A A;  5L95 C;  1DYQ A;  3N3K B;  1J7C A;  4C4V B;  5C1Z A;  5JZE B;  3X0W A;  2KNB A;  2Z0D B;  3Q6B A;  2V4L A;  3L54 A;  2LAS A;  3DQV A;  5BYQ A;  4EE2 A;  1UGJ A;  5E6N A;  3PZ7 A;  3S2A A;  4RF1 A;  1C4P A;  3A9K A;  1C9F A;  2N9K A;  1D6E C;  3KLS X;  2WXM A;  4AS1 A;  3W5V B;  5E6O A;  4WIP A;  5BMH A;  4HRO A;  2A4Z A;  1ISN A;  1SJH D;  2KAJ A;  3U7Z A;  4AUQ C;  4DXA B;  4LDT B;  5IOI A;  3ZNH B;  2CKH B;  3UIN B;  1NVI D;  4W9C A;  3PRM B;  2M4N A;  4ZRK A;  3QCA A;  3FC4 A;  2V0G A;  1YJI A;  3N20 C;  4HWI B;  2MX2 A;  2ASQ A;  3ZVV A;  4BKG A;  1UWM A;  4GDL A;  4GLS C;  3AEE B;  4A8X C;  2KC2 A;  1T0Q C;  2J7Q B;  1MVK A;  1V9J A;  3DBR B;  2E3T A;  4FLH A;  1I4X A;  2BS4 B;  3DPD A;  4YTM B;  1WI0 A;  3D32 A;  4GMV A;  3BZD B;  4C4V A;  4TQ0 A;  4IWP A;  4WJN A;  3RPF C;  3BIN A;  1P98 A;  4O1N A;  1XCT L;  4MGZ E;  3KQ4 A;  2DNF A;  2KK8 A;  5J18 A;  4DXG A;  3IAM 1;  2QIL A;  4PS8 A;  2J53 A;  4BOS C;  2C5L C;  2LGY A;  5LLI A;  2WXO A;  1JWB D;  2J0M A;  1D3Z A;  3WA0 A;  1LM8 B;  4AJY B;  3U8Z A;  5FR3 A;  3KYC D;  3EC8 A;  3AE7 B;  2DZM A;  4HDQ A;  4YTN B;  2EMS A;  2RPV A;  1LXD A;  4I6N B;  1WXA A;  4LNK A;  2KDE B;  5JHB A;  4HLE A;  1D5M C;  3Q69 A;  2MSE D;  1N6Z A;  4EZL A;  1XXG A;  3M3J A;  5CHW A;  1J7B A;  3I5J C;  4HPP A;  1A5R A;  2D3A A;  2MBB B;  3KVF B;  4WWO A;  4BKT A;  2JXX A;  2PEA A;  1F0Z A;  1QKZ A;  1OTR B;  1Q10 A;  4RGT A;  2XN9 C;  1T0S C;  2M19 A;  1RFK A;  5DPW A;  1CQV A;  1QOB A;  3IG3 A;  3Q3M C;  3CF6 E;  1E0Z A;  3KUZ A;  3QWZ B;  2L0T A;  5AZG A;  3IT6 B;  2INP E;  1YN5 A;  3EEC A;  4XWT A;  2QHO A;  4US8 A;  3ZIM A;  4GB9 A;  3AEC B;  2C9W B;  2IO1 B;  1WX7 A;  2BB5 A;  4OZC A;  4MSM B;  2MWS B;  1OEY J;  3W5U B;  2KVR A;  4LNN A;  4PYU A;  4IKG A;  1V5O A;  1IGC A;  1QT9 A;  4ARC A;  4M01 A;  4WQO B;  3DWG C;  1X1M A;  3K9O B;  1YJJ A;  1RFA A;  4KX6 B;  3DBL I;  3Q14 C;  2LXA A;  3AE5 B;  2NBW B;  4KIK B;  1XT9 B;  4TUU A;  2UWQ A;  4PT5 A;  2G45 B;  3V6E B;  5TSS A;  2TSS A;  3HHM A;  2K6Q A;  3L08 A;  4ITK A;  4C00 A;  2QSD A;  3AI5 A;  4MT5 A;  3QJZ A;  5G2N A;  1Q0W B;  3RNF C;  2IY0 B;  3AEG B;  3PTF C;  3E56 A;  4DBG A;  3GE8 C;  2HDE A;  3ZW3 A;  1T0Y A;  2O2V A;  2Z8L A;  2L32 A;  3PT2 B;  4JLC A;  3UI3 A;  4NQK E;  3HK0 A;  4ACF A;  4KV2 A;  2CU1 A;  1ROE A;  5H92 C;  2GB1 A;  3U52 E;  2KKC A;  3RUL A;  3URY A;  4S0R A;  3W2D A;  1WH3 A;  2LEK A;  1V6E A;  2FCQ A;  3P42 A;  4EZJ A;  2WDT B;  3NZS A;  3Q3O C;  2ZZP B;  3BII D;  2MHJ A;  2R61 A;  1WRD B;  2L1A A;  1EM7 A;  1VDV A;  2L76 A;  1D5Z C;  2R2O A;  1QQR A;  1QOA A;  1I35 A;  3PRZ A;  4RFB A;  4P16 A;  4P1B C;  3NZ3 A;  4RGM A;  4P7I A;  1QIL A;  4ZRJ A;  2H89 B;  4RMA A;  1EWC A;  2VZK B;  3P4S B;  2R2Q A;  1GC7 A;  5BYR A;  3J9C A;  3VUX A;  2LFI A;  2D3B A;  3NUH B;  3PRE A;  2QC8 A;  1FNU A;  2WDQ B;  1FXT B;  4LCD E;  1KF6 B;  2DWQ A;  2DYO A;  4WWM A;  2GMI C;  1BUI C;  4ZHO A;  2Z59 B;  2BS2 B;  2MBQ A;  3VAW A;  2C60 A;  2BS3 B;  4HEA 1;  5DPR A;  1WGG A;  3RNG C;  3AE2 B;  1VLB A;  1AWD A;  2M56 B;  3CIR B;  3IVF A;  1TY2 A;  3N1X C;  1XCQ L;  5AEK B;  4FAD A;  2KT7 A;  2MJE A;  2WXJ A;  4M00 A;  4BVU C;  1ENF A;  1HTO A;  1E7V A;  4I6P A;  4X57 B;  2JYT A;  2IGD A;  1R4M B;  3BVG A;  4ARI A;  1YX6 B;  3WAP A;  4D2K A;  3VTV A;  2EEL A;  2ZCC A;  5MPO A;  1C76 A;  1NI3 A;  2KDI A;  3V3X A;  1SF0 A;  2J42 A;  3Q8F A;  1I4G A;  4REZ A;  2IDY A;  4W9D A;  1AYF A;  1K53 A;  4RNA A;  1XLN A;  3P1M A;  1I4R A;  3JW0 X;  5BYS A;  2HJ1 A;  3VR8 B;  1TS4 A;  4RM8 A;  1JAL A;  3RZF A;  3B1L X;  2AL3 A;  2PVO D;  4KKI A;  3ZRC A;  3AE6 B;  1WGH A;  4KIK A;  1J0G A;  1TT5 B;  4W9E A;  3BY4 B;  1NEN B;  4WJO A;  3VVW B;  3NS8 A;  3APD A;  4L23 A;  3PV1 A;  2WDR B;  2WXG A;  2J0K A;  3NG0 A;  2WXF A;  5C2T B;  2XNA C;  3N9Y C;  2RPQ A;  3A4R A;  4EUT A;  1OQQ A;  3DVG Y;  2LWP A;  4OHJ A;  4GDL B;  2G1E A;  1I4P A;  2KHW B;  2OJW A;  3ZQ4 A;  1ET6 A;  2IO0 B;  1BT0 A;  3PZD A;  2LRU A;  5LXH A;  1C79 A;  3RNC C;  3R7Q A;  2NPT B;  2LZ6 A;  4NJ6 A;  1H4R A;  2I38 A;  4XGA B;  4GDK A;  1B9R A;  2KFK B;  3TJP A;  2QEJ C;  2PPH A;  2JPH A;  4IM3 A;  4GGQ A;  3R3M A;  3FKY A;  5T8I A;  2K8H A;  3ZDT A;  3EHV A;  2KTR B;  2KWV B;  2MW5 A;  2LVO A;  2AQ3 B;  1S1Q B;  5D6J B;  3P4P B;  2KWC A;  2JRI B;  1N61 A;  4HVB A;  5C3J B;  4HKQ A;  3BWU D;  3SEB A;  1S3S G;  4LJP B;  2KJR A;  2KQS A;  4HRS A;  4F1S A;  3KYD D;  1UZX B;  3ENE A;  2IPK D;  1SIJ A;  4XE0 A;  2FIF A;  4ZRP A;  1OEY A;  1YMH E;  5IN7 A;  2ZCB A;  1SB3 C;  3Q3J A;  3SR6 A;  4WWP A;  2GOW A;  3WAO A;  2L0F A;  2V9H A;  4EEW A;  2FE8 A;  2V3S A;  3AE3 B;  3PPA A;  1K51 A;  3T3O A;  1IUE A;  1MFW A;  1I7H A;  1IYF A;  2KDB A;  2KFK A;  3JYU A;  4IG7 B;  2YLM A;  3SFD B;  4IM0 A;  1UNS A;  2BWE S;  1JWA D;  4G0N B;  2V4I B;  2BQQ A;  3HM6 X;  3NY5 A;  2NBV B;  1YNT E;  5E6P A;  3ZTC A;  3HM3 A;  1PYW D;  3TL5 A;  2K1F A;  1KRH A;  4EZK A;  1C4C A;  2JZP A;  1OFF A;  3QIJ A;  1ZXI A;  5FKA C;  4JL9 A;  3HIZ A;  3A33 B;  3VRB B;  1PFD A;  4IM2 A;  4LNF A;  1B1Z A;  2O6V D;  1TS5 A;  1AN8 A;  4FHK A;  3WAN A;  2I2Y A;  3HUI A;  3FAH A;  1MG4 A;  3A9J A;  2O2V B;  3ZRF A;  2C7H A;  4F8C B;  4G50 A;  3WCQ A;  4IWO A;  2FNJ B;  5D3D A;  3VQI A;  2MJ3 A;  3ZJV A;  4W9J A;  3HRD D;  4B0E A;  1IBX A;  3L16 A;  1LO5 D;  1XLQ A;  2RDB C;  3GS2 A;  1EU3 A; 
#chains in the Genus database with same CATH homology
 1XXG A;  5I4D A;  4XWW A;  1F2R C;  2CJO A;  1J7B A;  3NVV A;  4RGO S;  5EE3 A;  2Y5P A;  1IGD A;  2SEB D;  1L0Y B;  2MH7 A;  1KH0 A;  3AEA B;  2BT6 A;  4N58 A;  1FRR A;  1F0Z A;  1QKZ A;  1GB1 A;  1TS2 A;  5LNK 1;  1Q10 A;  2V3N A;  1QF6 A;  4RGT A;  5G5H A;  2XN9 C;  2M19 A;  1RFK A;  2QIE B;  2BTE A;  1CQV A;  1QOB A;  4USA A;  2AQ2 B;  1VZ6 A;  4IOI E;  1SSN A;  3KWL A;  1FEH A;  3MHZ A;  4TQ1 A;  4ZYS A;  2BBC A;  4RCO A;  1DGJ A;  1E0Z A;  1FNW A;  2IJ0 A;  2Y3A A;  1P7F A;  2N7J A;  3KWV A;  3AE9 B;  2EKI A;  5AUI A;  1SE2 A;  2PVG C;  3IT6 B;  2INP E;  1FXI A;  1YN5 A;  3BYY B;  1ZOY B;  3SFE B;  2OHF A;  3BVZ A;  2FBW B;  4XWT A;  4WUR A;  4US8 A;  1HXY D;  4OW0 A;  3AEC B;  1ET9 A;  5D3I B;  1T5X D;  4GDK B;  2K5P A;  4M0W A;  4JPS A;  2BB5 A;  4OZC A;  3P4Q B;  2WDV B;  4ZOH C;  1FMA D;  1TY0 A;  2PTL A;  1N60 A;  2YEP F;  1XLO A;  2FUG 1;  3W5U B;  1FD6 A;  2Q5W D;  4R3D A;  4IKG A;  2NTT A;  1IGC A;  1QT9 A;  4ARC A;  4LTU A;  1E10 A;  2E6X A;  3AE8 B;  1TS3 A;  3DWG C;  1AW7 A;  1YJJ A;  2KQ4 X;  5GXG B;  1JRO A;  3NVW A;  3TSS A;  3W9C B;  2J4X A;  5BMI A;  2WP9 B;  4KX6 B;  4KGR A;  3TEZ A;  4FXC A;  3ZGZ A;  3AE5 B;  2RDH A;  2LJI A;  1BML C;  1DOI A;  3IT4 B;  1M4V A;  4PT5 A;  2NTS A;  5TSS A;  2TSS A;  1JCK B;  4ITK A;  1ACC A;  3C8Y A;  1HQR D;  5HHD G;  1EWY C;  3AE1 B;  2QSD A;  3ABV B;  2DBY A;  4MT5 A;  1TKE A;  2KMM A;  1FIQ A;  5HFY A;  2X38 A;  3I57 A;  1CZP A;  3AEG B;  1V97 A;  1JWM D;  3E56 A;  3EUB 2;  4A9A A;  3O13 A;  2W3S A;  1CJE A;  1NEK B;  5D7G A;  1K50 A;  3OWE B;  4HJG E;  4YT0 B;  3FIL B;  4DQO C;  3U4E G;  4N6E B;  3NRZ A;  1KLG D;  2HDE A;  1PGA A;  1P7E A;  2Z8L A;  2L32 A;  3B9J A;  2CU3 A;  3UI3 A;  2L52 A;  1NYR A;  1DOY A;  1VZ7 A;  2LMC A;  1L6U A;  4Q2J A;  1VRA B;  3I9V 1;  1ROE A;  3LYY A;  5H92 C;  5EE1 A;  1SE4 A;  2GB1 A;  4OVZ A;  3U52 E;  1UWX A;  3B2F A;  4L2Y A;  4C56 C;  1N62 A;  3URY A;  3W2D A;  2KN4 A;  2LEK A;  1WXQ A;  2G9H D;  4OZB A;  1XO3 A;  3P42 A;  1FM0 D;  2WXL A;  1ZDV A;  3AE4 B;  3BII D;  2BW2 A;  2QJL A;  5FK9 C;  2R61 A;  2WXQ A;  1IBX B;  2L1A A;  2W54 A;  1V1P B;  1EM7 A;  1VDV A;  3NVZ A;  1D5Z C;  1QQR A;  1QOA A;  1ZP0 B;  4RFB A;  2KWD A;  4P16 A;  3T3N A;  3NZ3 A;  5HG2 A;  1EU4 A;  4RGM A;  2V3P A;  1QIL A;  2LHE A;  2H89 B;  4TSS A;  2LUM A;  3IAS 1;  2CJN A;  1FFU A;  1EWC A;  2Y5C A;  1VJK A;  4N59 A;  5JXV A;  4RF0 A;  1GB4 A;  2GRI A;  1V1P A;  4AQ7 A;  2VZK B;  3V05 A;  3P4S B;  1ZPS A;  3Q8B A;  1E9M A;  2RDG A;  1WWT A;  3AB5 A;  3CWI A;  1ZE3 D;  2IGH A;  3Q8C A;  5BYR A;  3J9C A;  2LFI A;  4YTP B;  4WH4 A;  3NUH B;  4YSY B;  3MC0 B;  1N5W A;  4XDC A;  4ZRQ A;  2N9L A;  3U2S C;  1FNU A;  2GI9 A;  2WDQ B;  1HZ6 A;  3VRA B;  1KF6 B;  3P63 A;  1K52 A;  1WSP A;  2DWQ A;  1ZUD 2;  2DYO A;  1QOG A;  1V8C A;  4WWM A;  2JYE A;  4ZHO A;  1BUI C;  1SJE D;  2BS2 B;  2JX5 A;  2WU5 B;  4JE3 B;  1TKG A;  1QLB B;  2BS3 B;  1RM6 C;  4HEA 1;  1ZXH A;  3FIL A;  1FXA A;  2WXK A;  1N5X A;  1VZ8 A;  2ON8 A;  2JU6 X;  3AE2 B;  4P6V F;  1VLB A;  1AWD A;  3DWM A;  1QOF A;  2M56 B;  3CIR B;  4C7Y A;  5HI1 A;  2RMM A;  3LXF A;  2WXR A;  1TY2 A;  2H88 B;  1RYJ A;  4JWS C;  1GOZ A;  4XDD A;  4A90 A;  3MP9 A;  1XCQ L;  1MHH E;  2MJE A;  4LLG M;  1TZO A;  2WXJ A;  3HVD A;  1D5X C;  1ENF A;  2KDM A;  4H2A A;  4NAM A;  3ZYY X;  1MI0 A;  1YN4 A;  1MPE A;  4L1B A;  2JYT A;  3RFZ B;  4US9 A;  2IGD A;  1STE A;  1GAQ B;  3BVG A;  1WYG A;  4ARI A;  4A6Q A;  2PIA A;  2KAC A;  4D2K A;  2EEL A;  1D4B A;  5MPO A;  2MEK A;  1C76 A;  1SEB D;  1NI3 A;  1RWS A;  4NZL B;  3ETR A;  3V3X A;  2K3U A;  1UUP A;  2BB6 A;  4KGT A;  1SF0 A;  2J42 A;  3Q8F A;  1I4G A;  4REZ A;  1DOX A;  1XF5 L;  3LB8 C;  2ONQ A;  1TKY A;  2W55 A;  3W1S A;  1SXT A;  2IDY A;  1AYF A;  1ESF A;  1K53 A;  4RNA A;  2NMQ A;  1XLN A;  2K22 A;  3P1M A;  3EA6 A;  1I4R A;  2J52 A;  1L4D B;  1L0X B;  2N0S B;  5BYS A;  1L4Z B;  2K9X A;  3VR8 B;  1TS4 A;  3R8B A;  4TMA B;  3R2T A;  3TUO A;  3ZJU A;  1KLU D;  1JAL A;  1JWS D;  1WRI A;  3AM9 A;  1FO4 A;  3TEW A;  2PVO D;  4KKI A;  2PLP A;  3AE6 B;  1JW9 D;  2WXN A;  1HEZ E;  1TJE A;  2L83 A;  2LHD A;  3NVY A;  1VR9 A;  1NEN B;  4NAW B;  3GB1 A;  1HZ5 A;  1V1O A;  5AUK A;  3B2G A;  4C80 A;  1XEE A;  1JML A;  4L23 A;  3TEX A;  2WDR B;  2WXG A;  2JWU A;  2IGG A;  1C77 A;  2PKO A;  1PGX A;  4YWG G;  2WLB A;  1CK1 A;  1SBB B;  5E6J A;  2AQ1 B;  2WXF A;  5C2T B;  2JSV X;  1I4Q A;  2XNA C;  1PDX A;  3N9Y C;  2WXI A;  4C7Z A;  1GPX A;  4DXF A;  1TYG B;  3H8H A;  1A70 A;  2JQR B;  3L4P A;  2PW9 A;  1OQQ A;  2DLB A;  2ZW0 A;  4OHJ A;  4GDL B;  2G1E A;  4WAF A;  1L0V B;  1I4P A;  2PMV A;  2WNM A;  3E9S A;  2DYM A;  3MJ5 A;  3ZQ4 A;  4HKZ E;  3AEB B;  1ET6 A;  5EE0 A;  2ZW1 A;  3AEF B;  5BMG A;  1C79 A;  1YQ3 B;  3BYT B;  1FFV A;  4OZA A;  1FRD A;  1L5P A;  4RGN A;  2I38 A;  1B9R A;  2W3R A;  1JQ4 A;  2QEJ C;  1DYQ A;  2QMT A;  4KGS A;  2WS3 B;  1J7C A;  1T3Q A;  3EGR A;  4LK0 M;  4YSZ B;  2INN E;  2WU2 B;  5EE9 A;  5T8I A;  3TEY A;  1OQR A;  5BYQ A;  4EE2 A;  3ZJT A;  1UGJ A;  2AQ3 B;  1FCC C;  1T6B X;  3PZ7 A;  4KKJ A;  1R7S A;  3AN1 A;  4RF1 A;  1JWU D;  1C4P A;  3P4P B;  4WQM A;  1XLP A;  1C9F A;  2VZK D;  2N9K A;  1D6E C;  1N61 A;  3KLS X;  4A55 A;  5C3J B;  4HKQ A;  2WXM A;  2M0A A;  3BWU D;  4AS1 A;  4ZHP A;  3SEB A;  4YSX B;  1I4H A;  3W5V B;  1KTK A;  4WIP A;  4HRS A;  3Q8E A;  5BMH A;  4HRO A;  1E6E B;  1SJH D;  2KAJ A;  1N63 A;  3U7Z A;  3NS1 A;  4YXD B;  4XE0 A;  2IPK D;  1SIJ A;  1NVI D;  2HTM E;  3MFG A;  4ZRP A;  2JXT A;  1YMH E;  1L6V A;  1E7P B;  3FC4 A;  2V0G A;  1YJI A;  1SB3 C;  3SR6 A;  3AV8 A;  1WGK A;  2B76 B;  1UWM A;  4GLS C;  3AEE B;  4A8X C;  1MVK A;  4B0M A;  2AX5 A;  5G5G A;  2D5G A;  2FE8 A;  3AE3 B;  1F77 A;  4IDI A;  1K51 A;  2E3T A;  3AMZ A;  3T3O A;  3AH7 A;  1IUE A;  1I7H A;  3AED B;  2WXP A;  1I4X A;  2BS4 B;  2YEP B;  2SAK A;  4YTM B;  3PO0 A;  3BK2 A;  3SFD B;  4J3O D;  1UNS A;  1JWA D;  3BZD B;  2V4I B;  3IXS A;  2K0P A;  1PUT A;  4TQ0 A;  2MJD A;  1MHX A;  1KFY B;  3RPF C;  1C78 A;  1YQ4 B;  1Y56 A;  1YNT E;  4O1N A;  5H8Y E;  1XCT L;  4NJC A;  3KQ4 A;  4RH6 A;  2ICI A;  1PYW D;  4MAC A;  3VR9 B;  2BYT A;  1KRH A;  4UDU C;  4DXG A;  4JWU C;  1C4C A;  3Q8A A;  3HVZ A;  2JZP A;  1OFF A;  2QIL A;  3IAM 1;  1ZXI A;  5FKA C;  1BXT A;  2J53 A;  3VRB B;  1PFD A;  2WXO A;  1B1Z A;  2OED A;  1JWB D;  1TS5 A;  1AN8 A;  2I2Y A;  2WQY B;  1FCL A;  3HUI A;  2LGI A;  3FAH A;  4JX1 C;  2WXH A;  3PZ8 A;  1FNV A;  3GP7 A;  2W82 A;  5FR3 A;  3BVM A;  3AE7 B;  3WCQ A;  1JRP A;  5D3D A;  1YN3 A;  4YTN B;  3BK1 A;  1C4A A;  1F2R I;  3R2I A;  1NYQ A;  3VQI A;  2RPV A;  2MJ3 A;  3ZJV A;  4MH8 A;  3HRD D;  4CQN A;  1SE3 A;  4B0E A;  1IBX A;  4MM3 B;  2ACZ B;  1HA5 A;  1LO5 D;  1ZDX A;  1PGB A;  1XLQ A;  1D5M C;  3P4R B;  3Q69 A;  1J7A A;  3GS2 A;  1EU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...