1B9RA

Terpredoxin from pseudomonas sp.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
105
structure length
105
Chain Sequence
b'PRVVFIDEQSGEYAVDAQDGQSLMEVATQNGVPGIVAECGGSCVCATCRIEIEDAWVEIVGEANPDENDLLQSTGEPMTAGTRLSCQVFIDPSMDGLIVRVPLPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TERPREDOXIN)
publication title A model for the solution structure of oxidized terpredoxin, a Fe2S2 ferredoxin from Pseudomonas.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Ferredoxin
total genus 11
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1999-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b9rA00
1YJJA 2CU3A 3AECB 3DWMA 3AEGB 1QF6A 3AV8A 2QIEB 3EUB2 3ABVB 4YTMB 3W5VB 1JQ4A 1ZUD2 1WWTA 3CIRB 3P4PB 2ACZB 2LEKA 5AUKA 2KAJA 2BT6A 1L0VB 1ROEA 1YJIA 1IUEA 2MJEA 1SIJA 2WDQB 2M19A 5G5HA 2PVOD 2OHFA 3AMZA 3AM9A 4YSZB 3AB5A 1A70A 4YSYB 1AWDA 1CZPA 1R7SA 1ZP0B 2DWQA 2H89B 2K9XA 3AN1A 3NVVA 3WCQA 3W9CB 1DGJA 1WXQA 3NVWA 1ZXIA 1VJKA 1RFKA 4N59A 3FAHA 2L52A 1I7HA 1YQ3B 4C80A 4US8A 1WGKA 2G1EA 4HRSA 1JW9D 1E10A 1OQRA 5H8YE 1EWYC 2EKIA 2H88B 2B76B 1DOIA 4IDIA 4KX6B 5EE9A 4YTNB 1L6UA 5H92C 3P4QB 2DBYA 3AH7A 1N5XA 2BS2B 2L83A 3P4SB 1L5PA 5MPOA 3L4PA 2K5PA 2QJLA 4N6EB 3W5UB 1KRHA 1V97A 3SFEB 3AE2B 2W55A 2CJOA 1B9RA 3RPFC 1JRPA 3CWIA 1SB3C 1TKGA 2W3SA 2PVGC 3AE8B 1QOBA 2W3RA 2MJDA 2WS3B 1VLBA 3AEFB 1V8CA 1VDVA 3PO0A 1NI3A 4JX1C 3AEEB 4JWSC 3P4RB 1TYGB 5GXGB 2JX5A 1TKYA 3FC4A 4US9A 4YTPB 1PFDA 3NVYA 4ZHOA 1SF0A 1TJEA 2M56B 4USAA 1FRDA 2K22A 4C7YA 1N63A 1N62A 5EE0A 2WDVB 3NRZA 1PDXA 4N58A 1TKEA 1FM0D 1AYFA 4P6VF 3AEAB 4A9AA 1FFVA 2HTME 5EE1A 5AUIA 4HROA 1GPXA 1FFUA 3AE4B 1WRIA 4ZHPA 1FRRA 3AE3B 4FXCA 4JWUC 4ZOHC 2FBWB 3B2GA 1ZOYB 2CJNA 4C7ZA 1KFYB 1JWBD 1J7AA 1UWMA 3HUIA 2Y5CA 2BS3B 3AE6B 3AE7B 1JALA 2WLBA 2JQRB 4WWMA 3AE5B 5EE3A 1OFFA 1WYGA 1RYJA 2WU2B 4YXDB 2KMMA 1L6VA 3AE9B 2BS4B 1QOFA 2AX5A 2WDRB 3HRDD 2W54A 3AEBB 1QOAA 3SR6A 3VR8B 1E6EB 5C3JB 1FO4A 1GAQB 1E0ZA 1XLOA 4YSXB 1QT9A 2WQYB 3VR9B 2PKOA 3NVZA 1OQQA 1NYQA 4WQMA 1JWAD 4YT0B 2PIAA 1N5WA 1FIQA 1J7CA 3B9JA 1N60A 1RWSA 1JROA 2WP9B 3AE1B 5G5GA 1QOGA 1XLQA 1QLBB 1NENB 1RM6C 2Q5WD 2E3TA 1N61A 3AEDB 1NVID 3ETRA 2WU5B 4ITKA 1XO3A 3KWLA 3HVZA 3LXFA 1KF6B 3LB8C 1DOXA 1E9MA 1FXAA 3DWGC 2MJ3A 3NS1A 1T3QA 3P1MA 3P63A 2N0SB 1DOYA 5C2TB 1E7PB 1CJEA 1XLPA 1YQ4B 1NEKB 4LTUA 3VRBB 1PUTA 3VRAB 2MH7A 3ZYYX 1NYRA 1F0ZA 1XLNA 1J7BA 1FMAD 3BIID 3SFDB 1FXIA 3B2FA
chains in the Genus database with same CATH superfamily
3AECB 4BVUC 2MBQA 3CMMB 3NZ3A 1JQ4A 1ZUD2 1ZPSA 4MGIE 3VTWA 4EZLA 1I4XA 1SJED 5AZGA 3V05A 3Q8AA 1WXQA 4NPNA 1ZXIA 1PYWD 4C80A 1I7HA 2LRWA 3I9V1 4US8A 2UWQA 2JPHA 4K7UA 3K9OB 2QJLA 3VAWA 1P9DU 2JWZA 4GDLB 3RT3B 2PVGC 1WMHB 1XT9B 2K8CA 2KVZA 3PO0A 1VDVA 2V1YA 1M4VA 2JF5A 2JX5A 1PQSA 4NY0A 3NZUA 2J0KA 5TR5A 1FD6A 1N63A 3U8ZA 2FE8A 1T5XD 4EZJA 4P6VF 3AE4B 4FXCA 1EO6A 4IC7B 1I4HA 2KXJA 1WXVA 5HG2A 2L1AA 4RGMA 1N6ZA 2AX5A 2WDRB 3RNAC 2KOXA 3CSTA 3MC0B 3P42A 2RGFA 5J18A 2IO1B 4ANXA 2FCQA 3RNFC 3ML9A 2JU6X 2EELA 1FXAA 5JXVA 1UGMA 5C2TB 2ICIA 3J9CA 3B08A 4LTUA 4ZRKA 2MH7A 3NJTA 3PZDA 5BMGA 5TSSA 2KJHB 1BMLC 4AJWA 5IO9A 4RH6A 3W1SC 3Q2AC 1XEEA 4LNIA 1JWUD 2LEKA 3L16A 4YSZB 4MSQB 4ZYNA 2H89B 2MBOA 1VZ8A 1SIFA 2D10A 4B0MA 1TS3A 1RFKA 3QCAA 4M8MA 4J6IA 2KQ7A 2N9LA 2B76B 1GC7A 5MPOA 2JUOA 4OHJA 1P7EA 5CHVC 1B9RA 1TKGA 2MJDA 1VLBA 3AEFB 1C77A 1C4PA 3TCAA 2OJRA 1BXTA 2HDEA 1SF0A 4ASWC 4RF1A 2GI9A 1FRDA 3ZTDA 3BINA 1C1YB 3QA8A 2D3BA 1WYWB 2KDBA 4W9IA 5EE1A 3WIMA 4MGZE 3KVFB 2RSUA 3B2GA 1J7AA 1ZDXA 1KLUD 4LJOB 4W9HA 2M0XA 2L7RA 1WYGA 3H7PB 1QOFA 3AU4A 3DBRB 1WY8A 2WXMA 1FO4A 3JW0X 2WQYB 4EKUA 4LCDE 1KM7A 1Q0WB 1RM6C 2VZKD 1E8XA 4WWOA 1ISNA 4BKTA 3SHQA 2J0MA 3HVDA 3LXFA 1WXSA 4II3B 2ONQA 3NS1A 4W9CA 4GDLA 5EDSA 3IG3A 3TL5A 1YQ4B 1V6EA 1WMHA 2KDFB 3DBLB 2NTTA 2LD9A 1V49A 5FK9C 5J2RA 4AJYB 1QF6A 5AZHA 3L17A 1IUEA 4IWQA 2RPQA 1TBEA 1TZ1A 3BYYB 1CZPA 3M62B 3APDA 5G2NA 4Q2JA 2K6QA 3GOEA 1UH6A 3IAS1 4PS7A 2DBYA 2J53A 2K5PA 4TV3A 1KRHA 4L1BA 3URYA 2BYEA 2IZVB 1SB3C 2W3SA 2JRHA 2V3PA 1V8CA 5HFYA 2LGSA 4HDOA 2BBCA 3GE3C 3PRZA 3N32A 2JYEA 4FJVB 3VH4B 2KX3A 4ARCA 4WQOB 3HM3A 2GBRA 1HZ6A 4JL9A 4N58A 2FUHB 5CTRC 2D3GA 4FJYA 5T8IA 1D5ZC 3WAPA 1UWMA 2DYMA 4M0WB 3RD2A 2KFJA 1QILA 4NAWB 2JQRB 3L08A 3MFGA 4KVGB 2C7MB 2WXJA 3HRDD 3EHVA 2YEPB 4URKA 5KHOA 1RWSA 4ZRQA 3A4SC 1UWXA 2DHZA 4IW0A 4O1NA 4BZAA 3T3OA 2E3TA 2MQJA 2X8XX 4KGTA 4BOZB 1Y8RC 2MHJA 3Q6BA 2M1MA 4EE2A 2D3AA 1T3QA 3P1MA 3VVWB 2RDGA 1E7PB 2I1JA 1NEKB 3VRBB 1WE7A 3Q3JA 2ASQA 2L3ZA 2JSVX 4A3PA 1XLNA 2PE6B 1FCLA 1YX5B 3GB1A 1V9JA 3OAWA 2LJ5A 4IWOA 1D5MC 2DZMA 3W1SA 4HXDA 4MACA 2KACA 3AB5A 3DHIC 2DWQA 4GLSC 4IG7B 3ZJTA 5KHQA 2M8SA 2RDHA 4C56C 1U4AA 4IDIA 2IGHA 3H7PA 3CSFA 1C79A 4ANVA 2KHWB 2L83A 1WXMA 4ANWA 1V81A 3OLMD 1I4PA 2CJOA 2W3RA 1E90A 3ZNGC 2ZW0A 4JX1C 4OW0A 4JWSC 3Q14C 2CHWA 1MHHE 4AQ7A 2LMCA 1R4NB 3TIXA 5IA7A 2C60A 1MJDA 4WJOA 2FCSA 3BK2A 1L7YA 2BTEA 3ONSA 4W9LA 5BYQA 3GS2A 4WJQA 3MJWA 1J0GA 2K8HA 1KJTA 4LNNA 1MFWA 2ZNVB 1QOAA 2R2OA 3JVZX 2LGYA 1XLOA 3KYDD 4WWPA 4MGKE 1TY2A 2K39A 2PIAA 5E6OA 1JROA 4FADA 3TUOA 2WP9B 4AWJA 2WXNA 2C9WB 4JPSA 1YIWA 3FKYA 3X23A 2BB6A 3ZUNA 2ZVNA 3VUXA 1FNVA 1CK1A 4HCNB 4BKGA 2J4XA 3ZKJC 1GC6A 4DHJB 2CU3A 2SEBD 4WAFA 4RNAA 3PREA 2WNMA 2KAJA 3Q3MC 4I6PA 2MJEA 4JIOU 4XE0A 1L4ZB 2G45B 2LVPA 3AM9A 2IDYA 3BVGA 3Q3OC 3AN1A 3EA6A 4M0WA 3IXSA 5DPRA 4BBNF 4NAWA 2NCNA 4UDUC 1WX7A 2IGGA 4X57B 2N4FA 3P4QB 3QWZB 1L5PA 2B3AA 2FCMA 2JYTA 4JE3B 1KLGD 2HJ1A 4HKZE 3P4RB 2N9KA 4P16A 3CF6E 3RNGC 5FR3A 2CHXA 4PS8A 4NQKE 3MC9A 4F7ZA 1N62A 2K8BA 3NRZA 2V9HA 3UGBB 4A9AA 5AUIA 1WJ6A 3NOBA 1JWBD 3Q8EA 2KN4A 4FHKA 2D07B 2WLBA 3QJZA 2KC2A 3KH0A 2QMTA 2UU7A 4S0RA 3SR6A 3DBSA 3RMKC 2BYFA 1I4GA 4GIVA 1FIQA 3B9JA 1TGZB 5LXIB 1N60A 2W82A 1E8WA 4TQ0A 3ZW3A 3DBHI 2Q5WD 3RCZA 1N61A 2Y5BB 4DHJD 2WU5B 2KNBA 2V3NA 3U52E 3LDZE 3DWGC 3RYTA 1LFDA 4GB9A 4W9DA 1XLPA 3NUHB 3VDZA 2ZVOA 4XWTA 2Z8LA 2TSSA 2NS5A 3B2FA 1E7VA 3DWMA 3N1XC 3AV8A 2L0TA 3EUB2 3ABVB 4R3DA 3DCGA 2O6VA 1ROEA 2N9XA 2XBBC 2RPVA 3DOWA 3TEXA 3AMZA 4XYCA 4RGTA 1YN5A 3PZ7A 1VJKA 1B1ZA 4ACFA 1CMXB 2LHEA 2EKIA 2LUEA 3L4PA 1F2RI 4M02A 3ZLZA 4N6EB 3KW5B 3QK0A 4PYUA 3LYYA 2KKCA 4FBJB 2I1KA 2IO0B 2YLMA 4MJSB 4RGNA 1I42A 2X38A 3NVYA 5DCNA 2KANA 3V3XA 2L32A 1S1QB 5E6NA 3O13A 3QAQA 3UQBA 2N1VA 4RFBA 1V5TA 2D2QA 2FCNA 1UBIA 2LZ6A 1FNUA 1C9FA 4MEMA 5D3IB 4E74A 3PRMB 1JALA 1EU3A 3WALA 2WU2B 3PLVA 1GG3A 4OVVA 2WHIA 3OJ3A 4NNJB 1HXYD 4HK2A 3B1LX 4WQMA 4YT0B 2WYQA 3ZNHB 4KDIC 1P3QU 4A6QA 4OZAA 4G0NB 1HTQA 4LK0M 1HZ5A 1NVID 4DK5A 3T3NA 2IO2B 1EF1A 4ITKA 1TIFA 1TZOA 2L76A 1GJZA 1YN3A 4HLEA 1V80A 2KJ6A 1H8CA 1GB4A 3IVFA 5IP4D 1XF5L 1FXTB 1YJJA 3B0AA 4ZYSA 1E8YA 3CIRB 2LGIA 2Y3AA 3TSSA 2GRIA 1ZXHA 3R66C 2CS4A 2OHFA 1YN4A 1C3TA 2LXAA 2AWTA 3OWEB 3O65B 1R7SA 1WGRA 4FJZA 3WCQA 4MM3B 2FAZA 2C7NB 2DZJA 2PTLA 1SXTA 5H92C 3VTVA 4GOCA 3P4SB 5BYSA 2GOWA 1GNUA 4PYZA 4CQNA 1TYGB 2FIDA 4TMAB 4MH8A 1WE6A 4AS1A 4YTPB 2MX2A 2KK8A 4EUTA 3NHEB 1MHXA 2BGFA 3L13A 1WZ0A 2REXA 1Q10A 1L0YB 4HROA 4PS3A 4YWGG 3N1ZC 3RFZB 1ZOYB 2XN9C 1YOVB 1F77A 4B9KA 2WXFA 3GZNB 2JZPA 2LASA 1T6BX 2PMVA 1SE9A 5D2MB 3ZJVA 3A9KB 4NJ7A 2LWPA 3ZXVA 2M0AA 5BYRA 1M94A 1QOGA 3Q8FA 2O2VA 4CO7A 1UELA 1KLVA 3N9YC 3UINB 1PGAA 3DBRI 2UYZB 1K51A 4WWNA 2EMTA 4NZLB 1CJEA 1T0RC 2AYOB 4I6NB 1WZ3A 2ZPYA 3SEBA 4MJSA 2DZKA 2BWFA 2WXGA 3ZTCA 2J52A 4TQ1A 3A1QA 2QC8A 2KLCA 1SIJA 2M19A 3DBLI 3A9JB 1C76A 3V6CB 2KJRA 2LVQA 3EGRA 3W9CB 2AQ3B 2HD5B 2V4IB 4XWWA 3FAHA 4B6WA 2N7DA 2L52A 1WGKA 2NBVB 5H8YE 4KX6B 5EE9A 4MDKE 3AH7A 2KWDA 2K3UA 2PE9A 1WM3A 1JRPA 2XEWA 4KV2A 2DYBA 1UUPA 3EC8A 2HTHA 3SDLC 3WANA 1OQYA 4US9A 1EWCA 1XXGA 3ZVVA 1TY0A 4WJPA 1K8RB 4KSKC 4E71A 1VD2A 1WRDB 1TKEA 5DPSA 3X0WA 3RI7C 4G11A 3AI5A 2CR5A 3AE3B 2KD0A 2XK5B 1KFYB 2K25A 1ACCA 2JVCA 2GMIC 2WXKA 5D7GA 5EE3A 1IGDA 5FKAC 1C4AA 1EUVB 2BS4B 3IAM1 3VXWA 4BBNC 3VR8B 2ON8A 2KMAA 2BYTA 2LUMA 1LM8B 3PPAA 2G3QB 2KWCA 4MM3A 3H7SA 1QLBB 1ENFA 3RULA 3ETRA 4EEWA 3DVGY 4KZCA 3JYUA 1SE4A 2NTSA 4GXBA 4HPPA 3V61A 5FR6A 1DOYA 2RMMA 3EFUA 3I3TB 1P7FA 3PV1A 2KX0A 3DQVA 3MHSD 4M8NA 1XQQA 5JHBA 1WX9A 4YTMB 3W5VB 3QIJA 5AUKA 4TUUA 2G4SA 4MELA 3ZRCA 4II2B 3EECA 4YSYB 4MGYE 2MWSB 1I4QA 2JZ3B 4HWIB 2PPHA 2VH1A 1QKZA 1YQ3B 4DXAB 4HRSA 2Z59B 3ZJUA 4W9JA 4C7YA 3L54A 1WJNA 4TKNA 2L8JA 3A9KA 2DYOA 4DXGA 3T9LA 1YNTE 4IWPA 4FLHA 4JQWC 1TJEA 4HPMB 1EM7A 2K22A 1IBXB 1FM0D 4QAYA 4ZRIA 5G55A 2HTME 4WAAA 1GPXA 2K0PA 1SE3A 2LRUA 3NZSA 4RMAA 4GN1A 2LGDA 1LGRA 4LNKA 1R4NI 4LNFA 4DHZE 3HHMA 2D5GA 1RYJA 2WXRA 1JWSD 1TS5A 4FULA 4YXDB 3N1YC 3A9JA 1R4MB 2IO3B 2PKOA 2HE7A 2O6VB 2KTFA 1MVKA 2KMCA 4WIPA 3M63B 4KGSA 2FNJB 3KWLA 4BFRA 3SU8X 5GMVA 2QCZA 2N0SB 2QILA 3MP9A 1OTRB 3C0RB 4GSWA 3ZYYX 3H6NA 3I63C 3DHHC 4OVZA 3BVMA 4MT5A 1V1OA 2N9PC 4WH4A 3AEGB 1J8CA 3C19A 1VZ6A 3PSEB 3RNCC 2LI5A 4OZCA 2C5LC 3OG5A 2EMSA 5JZEB 4XDCA 3ZRFA 1AWDA 2XK5A 3MC8A 4D2KA 2IYDB 5J17A 1E7UA 4ICVA 2CHZA 4A90A 1RRBA 2G1EA 1E10A 4S17A 1DOIA 1F9JA 4G3XB 2OJWA 1V2YA 4WURA 2L0FA 5HHDG 2NBWB 1QOBA 3V6EB 3WAMA 3ZIMA 1ZKHA 4M01A 5D3DA 3FC4A 3TJPA 1J19A 1PFDA 2M56B 3PTFC 1F1HA 1PDXA 1IPGA 4HDQA 1XD3B 3AEAB 1FFVA 4FHJA 4P1BC 1P1AA 2O6VD 2JRIB 3QHTA 1HA5A 4WWMA 1IGCA 3AE5B 2WXQA 3QC8B 1WXAA 2VH2A 5BMHA 2NR2A 4RGOS 4KSLC 4YSXB 3ZXRA 1FCCC 2Y5PA 1WI0A 1WIAA 1J7CA 3UQAA 5G5GA 3R7QA 3HIZA 3AEDB 2Z0DB 2AEHA 3BVZA 3E56A 2L00B 4K3BA 1PGBA 1XCQL 3E9SA 5IOIA 1FEHA 3P63A 3ZO5B 1GOZA 2LGXA 1PUTA 2WXLA 4ZDVA 3IBEA 2V3SA 4DQOC 4AUQC 3BIID 1WF9A 2I38A 3JSVB 1IBXA 3DVNV 2IGDA 3KUCB 4W9KA 2AL6A 4DWFA 2LVOA 1WGYA 2AQ1B 2BKRB 1LQBA 1OQRA 1EWYC 2INDC 1VCBA 2BS2B 2DENB 2I2YA 1V97A 1STEA 3LJ3A 5CX3A 3ZDTA 2W9NA 2Z0EB 2BYVE 1SEBD 1F2RC 1TT5B 1TKYA 2DAFA 1YQBA 4HEA1 2EKEC 3R2IA 3K9PB 2KFKB 1JCKB 2O2VB 5C1ZA 3UIPB 2KVRA 3PVLA 3AU5A 4KIKB 3VTUA 2M17A 4BKSD 1C78A 2NPTB 1NI2A 4HKQA 4JWUC 2FBWB 2KQSA 1RFAA 3GE8C 2KWUB 4XDDA 1SGHA 3NY5A 4ARIA 3VR9B 2KC1A 4DHZB 3NVZA 2AQ2B 3A1QB 5LNK1 2INCC 4A20A 3U7ZA 2D11A 2HJ8A 2LHDA 2SAKA 4ICUA 1OEYJ 3BK1A 1X1MA 3GP7A 5JHAA 4F8CB 3WAOA 4LJPB 3VRAB 2N1WA 3VQIA 2KT7A 1E5WA 5AZFA 2G9HD 3V62A 3PHXB 3VFKA 2WGSA 3PGEA 3TEWA 2ACZB 2J0JA 1L0VB 1YJIA 2A5UA 2PVOD 2WXHA 2WX1A 3W1YA 1K53A 1UZXB 1ZW7A 1ZP0B 2ZCBA 3NS8A 4GGQA 1YJ1A 4XZ4A 1F52A 4JGHB 2J42A 4C4VB 1JW9D 1Y56A 5JH5C 2RD0A 3BZDB 2KDIA 1JWMD 3W5UB 1V1PB 3H8HA 1OEYA 4BKSA 1SSNA 2KTRA 2ZZPB 3HM6X 2DX5B 2JY6A 3RPFC 2E6XA 2VRRB 4A55A 3I5JC 5GXGB 1ZDVA 2IJ0A 2R61A 1S3SG 4ZHOA 2FIFA 2BQQA 4XGAB 4GDKB 2QSDA 2WDVB 2D3CA 4CYEA 4EOYA 5LXHA 1HEZE 4KDLB 1FFUA 1FRRA 2KQ4X 2ZEQA 1LO5D 3Q3FA 3R2TA 1VZ7A 3JSVA 3AE9B 1LXDA 3IHPC 3AEBB 2ZJDA 2BWES 2KDEB 2AL3A 3TMPB 1QT9A 3U2SC 1WFYA 2WWZA 3N3KB 1SE2A 1H4RA 1N5WA 1HE8A 2VZKB 1IP9A 3Q3NC 4K1RB 1NENB 5AEKB 1NBFC 1P98A 1WGDA 3GZNI 1KF6B 1EF5A 1DOXA 3MJ5A 4IM2A 4WJNA 3HK0A 5D94A 1ZE3D 4I6LB 3U4EG 2QEJC 1F0ZA 2N7JA 1FMAD 1TS2A 2OEDA 4HCPB 2CKHB 1FXIA 4ZRJA 3MHZA 4HVBA 3NG0A 2K1FA 1ET9A 2QIEB 2KFKA 4XX5A 1UNSA 4EFOA 4KIKA 2BT6A 2NPTA 2JXXA 3A33B 4MH0E 4ANUA 2WXPA 3RN9C 4KZ0A 2NVUI 4K3CA 1EU4A 1RAXA 1WGGA 4C7ZA 1BUIC 1UD7A 5IKCM 3H1UA 2BKFA 3PS6A 1RLFA 1WX8A 1DYQA 3UIOB 4ZHPA 2WS3B 2GLSA 1NI3A 4OVUA 4RCOA 3AEEB 3L0WB 5IAAC 2JXTA 4KKIA 1VR9A 1AW7A 2KWVB 3PZ8A 2XNAC 3VUWA 2GBKA 2NBUA 1T0YA 4JLCA 1WRIA 3ALBA 4ZOHC 1OGWA 4B0EA 3HUIA 1P0RA 3AE7B 2DAJA 2MW5A 2KO3A 4G50A 3N20C 4NJ6A 5L95C 1WSPA 5C3JB 1JWAD 1Z2MA 2QHOA 2N7EA 1XLQA 1ET6A 4C4VA 1L2NA 1YX6B 4E3CA 4IM3A 2JWUA 3RZFA 3R8BA 2RR9A 1MG4A 5E6JA 1V1PA 1JRUA 1D6EC 3A4RA 3P2BA 5CHWA 4AOFA 3ENEA 4FN2A 3Q69A 3BYTB 3SFDB 3C8YA 2ZPNA 4GDKA 2FUG1 2NMQA 3KYCD 3APCA 2ZW1A 2DZIA 4ZRPA 5BMIA 5DPWA 3NVVA 4L2YA 1T0SC 1G6JA 1WR1A 4NAMA 1DGJA 1E8ZA 3EFCA 1SJHD 3IFWB 5LLIA 1MPEA 2GB1A 1D5XC 1N5XA 3TEYA 4OZBA 4RF0A 3SFEB 3APFA 4RM8A 3CWIA 4PK1A 4W9GA 2KZRA 2WDTB 1D4BA 5HI1A 1Q1OA 4B95A 2LJIA 4KGRA 1KTKA 3ZDMC 3IT4B 2L05A 1AYFA 2V0GA 3I57A 3VH3B 1UBQA 3D32A 3PT2B 2DNFA 2Y5CA 3M95A 3BWUD 3WA0A 1OFFA 4LLGM 1KH0A 2PEAA 2KMMA 1L6VA 2W54A 3ECIA 3UF8A 3ZNID 3ZGZA 1E0ZA 4F1SA 1V86A 4W9EA 3AE1B 3RNBC 3ZQ4A 4P1CC 1I4RA 3FILB 3N30A 2G4DB 3HVZA 2MBBB 3LB8C 1E9MA 2KLGA 2MJ3A 1R4MI 4KKJA 2DLBA 2ZNVC 2MP2B 2PJHA 2BW2A 1WGHA 2GBNA 3AXCA 4K7WA 1YMHE 1BT0A 2MBEA 1QZEA 1WJUA 4HPLB 1AARA 2BPSA 4H2AA 2MA9B 2WDQB 5L83A 5BO4B 4A8XC 4LNOA 1A70A 2MEKA 3RNEC 2K9XA 1HQRD 3U7DA 1GUAB 2IBIB 1YD8U 1MG8A 1Q5WB 4L23A 4IM0A 3KLSX 5E6PA 3VHTC 3MTNB 3BY4B 2J7QB 2W55A 3AE2B 2INNE 2LFIA 1GB1A 2OOBB 3PLUA 4MSMB 1WH3A 2LXCA 1MI0A 2C7HA 3Q8CA 5I4DA 2BB5A 5CHFA 1L4DB 1CQVA 3KUDB 4XC2A 4USAA 1ZGUB 3S2AA 5HKHA 5EE0A 1KOTA 1A5RA 5IN7A 2GBMA 2WX0A 1I35A 3KQ4A 1WM2A 3ML8A 3AE6B 3KWVA 2N9EB 2A4ZA 4DBGA 4P7IA 1FPYA 3QX1A 2BF8B 4HJKA 5DPTA 2MBHA 3QQ8B 2CU1A 4FA6A 4CHKA 2IY1B 2YEPF 3RUIB 4GMVA 3QARA 1NDDA 1QQRA 4DXFA 2KYWA 3PRPB 4K7SA 1Z5SB 1XO3A 4EZKA 3VUYA 2RDBC 4LDTB 4REZA 4HJGE 4NJCA 1TS4A 4YL8A 1IYFA 1NYRA 1VRAB 3ZNZB 1C4CA 1J7BA 3OJ4B 4AP4C 1TTNA 2KTRB 2JZZA 4DDID 4N9F4 4BAXA 2PLPA 3R3MA 4BOSC 3L10B 1WWTA 3P4PB 1FNWA 1JMLA 1HTOA 1D3ZA 5G5HA 1T0QC 4IUMB 2IPKD 3DDCB 3W2DA 2MRPA 2QDFA 3NVWA 4N59A 3DVNU 4C00A 2BVCA 2IY0B 3V60A 2H88B 4RM9A 4YTNB 1L6UA 4IOIE 3UI3A 2V4LA 1AN8A 1WJ4A 2WXIA 1K52A 2PW9A 3AE8B 4NQLB 4K81A 2MLBA 4A3OA 3FILA 2M4NA 3T8MA 1PGXA 3R7RA 3DVGX 3SD5A 4M00A 5C23A 2K6DB 1K50A 2KN5A 2INPE 3H9DA 4W9FA 1ESFA 4J3OD 3KUZA 5D6JB 2MP2A 2R2QA 3TBLD 2CJNA 3RZWC 2BS3B 3DPDA 3U30A 3DBHB 3PHWB 3M3JA 2WXOA 2JT4B 4IKGA 4LDTD 2ZCCA 3Q8BA 3AULA 1E6EB 2MSED 4TSSA 1GAQB 1UGJA 2YVCA 1OQQA 1NYQA 1L0XB 4PT5A 2GBJA 1V5OA 3DHGC 1UF0A 1SBBB 2MCNB 2KDMA 1XCTL 3IT6B 4GU2A 3TEZA 1WR6E 4DDGD
chains in the Genus database with same CATH topology
2CU3A 3MHZA 2SEBD 4WAFA 3AECB 4RNAA 1ET9A 2QIEB 3NZ3A 4YTMB 2WNMA 3W5VB 1JQ4A 1ZUD2 1UNSA 5AUKA 2KAJA 1ZPSA 2BT6A 2MJEA 4XE0A 1L4ZB 2WXPA 3AM9A 2IDYA 1I4XA 1SJED 3BVGA 4YSYB 3AN1A 3V05A 1I4QA 3Q8AA 3EA6A 4M0WA 3IXSA 1WXQA 1QKZA 1ZXIA 1PYWD 4C80A 1I7HA 1YQ3B 3I9V1 4UDUC 4US8A 1EU4A 2IGGA 4HRSA 4C7ZA 3ZJUA 4C7YA 1BUIC 3P4QB 1L5PA 2QJLA 1DYQA 2DYOA 4DXGA 4GDLB 4ZHPA 2PVGC 2JYTA 2WS3B 4JE3B 1KLGD 1YNTE 3PO0A 1VDVA 1NI3A 4RCOA 3AEEB 1M4VA 4HKZE 3P4RB 2N9KA 4P16A 5FR3A 2JX5A 2JXTA 4KKIA 1TJEA 1VR9A 1AW7A 1EM7A 3PZ8A 1FD6A 2K22A 1N63A 1N62A 2XNAC 3NRZA 2FE8A 1T5XD 1FM0D 1IBXB 4P6VF 4A9AA 2HTME 5AUIA 1GPXA 2K0PA 1WRIA 3AE4B 4FXCA 1SE3A 4ZOHC 1JWBD 3Q8EA 2KN4A 3HUIA 4B0EA 3AE7B 1I4HA 2WLBA 2D5GA 1RYJA 2L1AA 2WXRA 5HG2A 1JWSD 1TS5A 4RGMA 2QMTA 4YXDB 2AX5A 2WDRB 1WSPA 3SR6A 5C3JB 3MC0B 3P42A 1I4GA 2PKOA 1JWAD 1FIQA 3B9JA 1MVKA 1N60A 2W82A 4TQ0A 4WIPA 1XLQA 2Q5WD 1ET6A 4KGSA 1N61A 2WU5B 3KWLA 2JU6X 2EELA 2JWUA 2V3NA 3U52E 1FXAA 3R8BA 3DWGC 5JXVA 5E6JA 1V1PA 2N0SB 2QILA 5C2TB 2ICIA 1D6EC 1XLPA 3J9CA 3NUHB 4LTUA 3MP9A 2MH7A 3ZYYX 4OVZA 3BVMA 3Q69A 4MT5A 5BMGA 5TSSA 4XWTA 1V1OA 2TSSA 1BMLC 2Z8LA 3BYTB 3SFDB 3B2FA 4WH4A 3DWMA 3AEGB 4RH6A 3AV8A 3C8YA 3ABVB 3EUB2 4R3DA 2FUG1 1VZ6A 1XEEA 4OZCA 1JWUD 2LEKA 2NMQA 1ROEA 2RPVA 3TEXA 3AMZA 2ZW1A 4XDCA 4YSZB 4RGTA 4ZRPA 5BMIA 1AWDA 2H89B 3NVVA 4L2YA 1YN5A 1VZ8A 4NAMA 1DGJA 4B0MA 3PZ7A 4D2KA 1TS3A 1RFKA 1VJKA 1B1ZA 4A90A 1SJHD 2G1EA 2LHEA 1E10A 2EKIA 1MPEA 2GB1A 2B76B 1DOIA 2N9LA 1D5XC 1N5XA 3TEYA 5MPOA 4OHJA 3L4PA 1F2RI 1P7EA 4OZBA 4N6EB 4RF0A 3SFEB 1B9RA 4WURA 3CWIA 5HHDG 3LYYA 1TKGA 1QOBA 2MJDA 1VLBA 3AEFB 1C77A 1C4PA 4RGNA 5D3DA 3FC4A 1BXTA 2X38A 1D4BA 2HDEA 1PFDA 5HI1A 3NVYA 1SF0A 2LJIA 4RF1A 2M56B 3V3XA 2GI9A 2L32A 1KTKA 4KGRA 1FRDA 3IT4B 3O13A 1PDXA 4RFBA 1AYFA 2V0GA 3I57A 3AEAB 1FFVA 5EE1A 1C9FA 1FNUA 3B2GA 1J7AA 1ZDXA 5D3IB 1HA5A 1KLUD 2Y5CA 1JALA 3BWUD 4WWMA 1IGCA 1EU3A 3AE5B 1OFFA 1WYGA 4LLGM 1KH0A 2WXQA 2WU2B 2KMMA 1L6VA 1QOFA 5BMHA 2W54A 2WXMA 4RGOS 1FO4A 3ZGZA 1E0ZA 1HXYD 4YSXB 2WQYB 1FCCC 4WQMA 2Y5PA 4YT0B 1J7CA 4A6QA 4OZAA 3AE1B 5G5GA 3ZQ4A 1RM6C 4LK0M 1I4RA 1HZ5A 2VZKD 1NVID 3AEDB 3BVZA 3FILB 3E56A 3T3NA 4ITKA 3HVDA 3HVZA 3LXFA 3LB8C 1TZOA 1E9MA 1PGBA 2ONQA 1XCQL 2MJ3A 3E9SA 3NS1A 1FEHA 3P63A 4KKJA 1GOZA 1YN3A 1YQ4B 2DLBA 1PUTA 2WXLA 2NTTA 1GB4A 4DQOC 2BW2A 1XF5L 3BIID 1YJJA 1YMHE 5FK9C 4ZYSA 1QF6A 2I38A 2LGIA 3CIRB 1IBXA 2Y3AA 4H2AA 3TSSA 2GRIA 2WDQB 1IUEA 1ZXHA 4A8XC 3BYYB 2IGDA 2OHFA 1YN4A 1A70A 3OWEB 2MEKA 1CZPA 1HQRD 1R7SA 2K9XA 3WCQA 4Q2JA 2AQ1B 4MM3B 4L23A 1OQRA 2PTLA 3IAS1 1EWYC 3KLSX 1SXTA 5H92C 2DBYA 3P4SB 2BS2B 2J53A 2K5PA 5BYSA 2I2YA 1KRHA 1V97A 3AE2B 2W55A 4L1BA 2INNE 1STEA 3URYA 2LFIA 1GB1A 1SB3C 2W3SA 2V3PA 1V8CA 1SEBD 4CQNA 1F2RC 1TYGB 5HFYA 4TMAB 4MH8A 1TKYA 1MI0A 2BBCA 4AS1A 3Q8CA 5I4DA 4YTPB 2BB5A 1L4DB 1CQVA 2JYEA 4HEA1 3R2IA 4USAA 4ARCA 5EE0A 1JCKB 1HZ6A 1MHXA 4N58A 1Q10A 1L0YB 1C78A 3KQ4A 4HROA 5T8IA 4HKQA 4JWUC 4YWGG 3RFZB 2FBWB 1ZOYB 2XN9C 1D5ZC 1UWMA 1F77A 2DYMA 3AE6B 1QILA 3KWVA 2WXFA 2JQRB 4NAWB 3MFGA 2JZPA 1T6BX 2PMVA 2WXJA 3HRDD 4XDDA 2YEPB 3ZJVA 4ARIA 3VR9B 3NVZA 2AQ2B 2M0AA 2YEPF 5BYRA 5LNK1 1RWSA 1QQRA 4DXFA 4ZRQA 1UWXA 1QOGA 3Q8FA 4O1NA 3U7ZA 3T3OA 2E3TA 4KGTA 2LHDA 2SAKA 1XO3A 3N9YC 1PGAA 4EE2A 1K51A 3BK1A 4REZA 1T3QA 3P1MA 3GP7A 4HJGE 2RDGA 4NJCA 4NZLB 1E7PB 1CJEA 1NEKB 1TS4A 3VRBB 3VRAB 1NYRA 1VRAB 2JSVX 3SEBA 3VQIA 1XLNA 1C4CA 1J7BA 1FCLA 3GB1A 2G9HD 2WXGA 2J52A 2PLPA 4TQ1A 3TEWA 1WWTA 3P4PB 2ACZB 1FNWA 1JMLA 1D5MC 1L0VB 1YJIA 3W1SA 1SIJA 4MACA 2KACA 2M19A 5G5HA 2PVOD 2WXHA 1K53A 3AB5A 2IPKD 1C76A 2DWQA 4GLSC 1ZP0B 3W2DA 3EGRA 3W9CB 2AQ3B 2V4IB 3NVWA 4N59A 4XWWA 3ZJTA 3FAHA 2L52A 2RDHA 1WGKA 4C56C 2J42A 1JW9D 5H8YE 4IDIA 2IGHA 2H88B 4KX6B 1C79A 1Y56A 5EE9A 4YTNB 1L6UA 3AH7A 2L83A 4IOIE 2KWDA 3BZDB 1JWMD 3W5UB 1V1PB 2K3UA 3H8HA 1SSNA 3UI3A 1I4PA 2CJOA 3RPFC 1JRPA 1AN8A 2WXIA 2E6XA 1K52A 2PW9A 2W3RA 3AE8B 1UUPA 2ZW0A 4JX1C 4OW0A 4A55A 4JWSC 5GXGB 1MHHE 1EWCA 3FILA 4US9A 4AQ7A 1ZDVA 1PGXA 2IJ0A 2LMCA 1XXGA 2R61A 4ZHOA 1TY0A 4GDKB 1K50A 2QSDA 2WDVB 3BK2A 2INPE 1TKEA 1ESFA 1HEZE 4J3OD 1FFUA 1FRRA 3AE3B 2KQ4X 2CJNA 2BTEA 1KFYB 1ACCA 5BYQA 1LO5D 2BS3B 3GS2A 2WXKA 5D7GA 3R2TA 5EE3A 1IGDA 2WXOA 1VZ7A 5FKAC 1C4AA 3AE9B 4IKGA 2BS4B 3IAM1 3Q8BA 3AEBB 3VR8B 1QOAA 1E6EB 2ON8A 4TSSA 1GAQB 1UGJA 1XLOA 1QT9A 3U2SC 1OQQA 1NYQA 1SE2A 1TY2A 2BYTA 2PIAA 1N5WA 2LUMA 2VZKB 1JROA 3TUOA 2WP9B 1L0XB 4PT5A 1QLBB 1NENB 2WXNA 4JPSA 1ENFA 3ETRA 2BB6A 1KF6B 1DOXA 1SE4A 3MJ5A 2NTSA 1SBBB 1DOYA 2RMMA 1ZE3D 2KDMA 1XCTL 1P7FA 1FNVA 3U4EG 1CK1A 2QEJC 1F0ZA 3IT6B 2J4XA 3TEZA 2N7JA 1FMAD 1TS2A 2OEDA 1FXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJJ A;  2CU3 A;  3AEC B;  3DWM A;  3AEG B;  1QF6 A;  3AV8 A;  2QIE B;  3EUB 2;  3ABV B;  4YTM B;  3W5V B;  1JQ4 A;  1ZUD 2;  1WWT A;  3CIR B;  3P4P B;  2ACZ B;  2LEK A;  5AUK A;  2KAJ A;  2BT6 A;  1L0V B;  1ROE A;  1YJI A;  1IUE A;  2MJE A;  1SIJ A;  2WDQ B;  2M19 A;  5G5H A;  2PVO D;  2OHF A;  3AMZ A;  3AM9 A;  4YSZ B;  3AB5 A;  1A70 A;  4YSY B;  1AWD A;  1CZP A;  1R7S A;  1ZP0 B;  2DWQ A;  2H89 B;  2K9X A;  3AN1 A;  3NVV A;  3WCQ A;  3W9C B;  1DGJ A;  1WXQ A;  3NVW A;  1ZXI A;  1VJK A;  1RFK A;  4N59 A;  3FAH A;  2L52 A;  1I7H A;  1YQ3 B;  4C80 A;  4US8 A;  1WGK A;  2G1E A;  4HRS A;  1JW9 D;  1E10 A;  1OQR A;  5H8Y E;  1EWY C;  2EKI A;  2H88 B;  2B76 B;  1DOI A;  4IDI A;  4KX6 B;  5EE9 A;  4YTN B;  1L6U A;  5H92 C;  3P4Q B;  2DBY A;  3AH7 A;  1N5X A;  2BS2 B;  2L83 A;  3P4S B;  1L5P A;  5MPO A;  3L4P A;  2K5P A;  2QJL A;  4N6E B;  3W5U B;  1KRH A;  1V97 A;  3SFE B;  3AE2 B;  2W55 A;  2CJO A;  1B9R A;  3RPF C;  1JRP A;  3CWI A;  1SB3 C;  1TKG A;  2W3S A;  2PVG C;  3AE8 B;  1QOB A;  2W3R A;  2MJD A;  2WS3 B;  1VLB A;  3AEF B;  1V8C A;  1VDV A;  3PO0 A;  1NI3 A;  4JX1 C;  3AEE B;  4JWS C;  3P4R B;  1TYG B;  5GXG B;  2JX5 A;  1TKY A;  3FC4 A;  4US9 A;  4YTP B;  1PFD A;  3NVY A;  4ZHO A;  1SF0 A;  1TJE A;  2M56 B;  4USA A;  1FRD A;  2K22 A;  4C7Y A;  1N63 A;  1N62 A;  5EE0 A;  2WDV B;  3NRZ A;  1PDX A;  4N58 A;  1TKE A;  1FM0 D;  1AYF A;  4P6V F;  3AEA B;  4A9A A;  1FFV A;  2HTM E;  5EE1 A;  5AUI A;  4HRO A;  1GPX A;  1FFU A;  3AE4 B;  1WRI A;  4ZHP A;  1FRR A;  3AE3 B;  4FXC A;  4JWU C;  4ZOH C;  2FBW B;  3B2G A;  1ZOY B;  2CJN A;  4C7Z A;  1KFY B;  1JWB D;  1J7A A;  1UWM A;  3HUI A;  2Y5C A;  2BS3 B;  3AE6 B;  3AE7 B;  1JAL A;  2WLB A;  2JQR B;  4WWM A;  3AE5 B;  5EE3 A;  1OFF A;  1WYG A;  1RYJ A;  2WU2 B;  4YXD B;  2KMM A;  1L6V A;  3AE9 B;  2BS4 B;  1QOF A;  2AX5 A;  2WDR B;  3HRD D;  2W54 A;  3AEB B;  1QOA A;  3SR6 A;  3VR8 B;  1E6E B;  5C3J B;  1FO4 A;  1GAQ B;  1E0Z A;  1XLO A;  4YSX B;  1QT9 A;  2WQY B;  3VR9 B;  2PKO A;  3NVZ A;  1OQQ A;  1NYQ A;  4WQM A;  1JWA D;  4YT0 B;  2PIA A;  1N5W A;  1FIQ A;  1J7C A;  3B9J A;  1N60 A;  1RWS A;  1JRO A;  2WP9 B;  3AE1 B;  5G5G A;  1QOG A;  1XLQ A;  1QLB B;  1NEN B;  1RM6 C;  2Q5W D;  2E3T A;  1N61 A;  3AED B;  1NVI D;  3ETR A;  2WU5 B;  4ITK A;  1XO3 A;  3KWL A;  3HVZ A;  3LXF A;  1KF6 B;  3LB8 C;  1DOX A;  1E9M A;  1FXA A;  3DWG C;  2MJ3 A;  3NS1 A;  1T3Q A;  3P1M A;  3P63 A;  2N0S B;  1DOY A;  5C2T B;  1E7P B;  1CJE A;  1XLP A;  1YQ4 B;  1NEK B;  4LTU A;  3VRB B;  1PUT A;  3VRA B;  2MH7 A;  3ZYY X;  1NYR A;  1F0Z A;  1XLN A;  1J7B A;  1FMA D;  3BII D;  3SFD B;  1FXI A;  3B2F A; 
#chains in the Genus database with same CATH topology
 3AEC B;  4BVU C;  2MBQ A;  3CMM B;  3NZ3 A;  1JQ4 A;  1ZUD 2;  1ZPS A;  4MGI E;  3VTW A;  4EZL A;  1I4X A;  1SJE D;  5AZG A;  3V05 A;  3Q8A A;  1WXQ A;  4NPN A;  1ZXI A;  1PYW D;  4C80 A;  1I7H A;  2LRW A;  3I9V 1;  4US8 A;  2UWQ A;  2JPH A;  4K7U A;  3K9O B;  2QJL A;  3VAW A;  1P9D U;  2JWZ A;  4GDL B;  3RT3 B;  2PVG C;  1WMH B;  1XT9 B;  2K8C A;  2KVZ A;  3PO0 A;  1VDV A;  2V1Y A;  1M4V A;  2JF5 A;  2JX5 A;  1PQS A;  4NY0 A;  3NZU A;  2J0K A;  5TR5 A;  1FD6 A;  1N63 A;  3U8Z A;  2FE8 A;  1T5X D;  4EZJ A;  4P6V F;  3AE4 B;  4FXC A;  1EO6 A;  4IC7 B;  1I4H A;  2KXJ A;  1WXV A;  5HG2 A;  2L1A A;  4RGM A;  1N6Z A;  2AX5 A;  2WDR B;  3RNA C;  2KOX A;  3CST A;  3MC0 B;  3P42 A;  2RGF A;  5J18 A;  2IO1 B;  4ANX A;  2FCQ A;  3RNF C;  3ML9 A;  2JU6 X;  2EEL A;  1FXA A;  5JXV A;  1UGM A;  5C2T B;  2ICI A;  3J9C A;  3B08 A;  4LTU A;  4ZRK A;  2MH7 A;  3NJT A;  3PZD A;  5BMG A;  5TSS A;  2KJH B;  1BML C;  4AJW A;  5IO9 A;  4RH6 A;  3W1S C;  3Q2A C;  1XEE A;  4LNI A;  1JWU D;  2LEK A;  3L16 A;  4YSZ B;  4MSQ B;  4ZYN A;  2H89 B;  2MBO A;  1VZ8 A;  1SIF A;  2D10 A;  4B0M A;  1TS3 A;  1RFK A;  3QCA A;  4M8M A;  4J6I A;  2KQ7 A;  2N9L A;  2B76 B;  1GC7 A;  5MPO A;  2JUO A;  4OHJ A;  1P7E A;  5CHV C;  1B9R A;  1TKG A;  2MJD A;  1VLB A;  3AEF B;  1C77 A;  1C4P A;  3TCA A;  2OJR A;  1BXT A;  2HDE A;  1SF0 A;  4ASW C;  4RF1 A;  2GI9 A;  1FRD A;  3ZTD A;  3BIN A;  1C1Y B;  3QA8 A;  2D3B A;  1WYW B;  2KDB A;  4W9I A;  5EE1 A;  3WIM A;  4MGZ E;  3KVF B;  2RSU A;  3B2G A;  1J7A A;  1ZDX A;  1KLU D;  4LJO B;  4W9H A;  2M0X A;  2L7R A;  1WYG A;  3H7P B;  1QOF A;  3AU4 A;  3DBR B;  1WY8 A;  2WXM A;  1FO4 A;  3JW0 X;  2WQY B;  4EKU A;  4LCD E;  1KM7 A;  1Q0W B;  1RM6 C;  2VZK D;  1E8X A;  4WWO A;  1ISN A;  4BKT A;  3SHQ A;  2J0M A;  3HVD A;  3LXF A;  1WXS A;  4II3 B;  2ONQ A;  3NS1 A;  4W9C A;  4GDL A;  5EDS A;  3IG3 A;  3TL5 A;  1YQ4 B;  1V6E A;  1WMH A;  2KDF B;  3DBL B;  2NTT A;  2LD9 A;  1V49 A;  5FK9 C;  5J2R A;  4AJY B;  1QF6 A;  5AZH A;  3L17 A;  1IUE A;  4IWQ A;  2RPQ A;  1TBE A;  1TZ1 A;  3BYY B;  1CZP A;  3M62 B;  3APD A;  5G2N A;  4Q2J A;  2K6Q A;  3GOE A;  1UH6 A;  3IAS 1;  4PS7 A;  2DBY A;  2J53 A;  2K5P A;  4TV3 A;  1KRH A;  4L1B A;  3URY A;  2BYE A;  2IZV B;  1SB3 C;  2W3S A;  2JRH A;  2V3P A;  1V8C A;  5HFY A;  2LGS A;  4HDO A;  2BBC A;  3GE3 C;  3PRZ A;  3N32 A;  2JYE A;  4FJV B;  3VH4 B;  2KX3 A;  4ARC A;  4WQO B;  3HM3 A;  2GBR A;  1HZ6 A;  4JL9 A;  4N58 A;  2FUH B;  5CTR C;  2D3G A;  4FJY A;  5T8I A;  1D5Z C;  3WAP A;  1UWM A;  2DYM A;  4M0W B;  3RD2 A;  2KFJ A;  1QIL A;  4NAW B;  2JQR B;  3L08 A;  3MFG A;  4KVG B;  2C7M B;  2WXJ A;  3HRD D;  3EHV A;  2YEP B;  4URK A;  5KHO A;  1RWS A;  4ZRQ A;  3A4S C;  1UWX A;  2DHZ A;  4IW0 A;  4O1N A;  4BZA A;  3T3O A;  2E3T A;  2MQJ A;  2X8X X;  4KGT A;  4BOZ B;  1Y8R C;  2MHJ A;  3Q6B A;  2M1M A;  4EE2 A;  2D3A A;  1T3Q A;  3P1M A;  3VVW B;  2RDG A;  1E7P B;  2I1J A;  1NEK B;  3VRB B;  1WE7 A;  3Q3J A;  2ASQ A;  2L3Z A;  2JSV X;  4A3P A;  1XLN A;  2PE6 B;  1FCL A;  1YX5 B;  3GB1 A;  1V9J A;  3OAW A;  2LJ5 A;  4IWO A;  1D5M C;  2DZM A;  3W1S A;  4HXD A;  4MAC A;  2KAC A;  3AB5 A;  3DHI C;  2DWQ A;  4GLS C;  4IG7 B;  3ZJT A;  5KHQ A;  2M8S A;  2RDH A;  4C56 C;  1U4A A;  4IDI A;  2IGH A;  3H7P A;  3CSF A;  1C79 A;  4ANV A;  2KHW B;  2L83 A;  1WXM A;  4ANW A;  1V81 A;  3OLM D;  1I4P A;  2CJO A;  2W3R A;  1E90 A;  3ZNG C;  2ZW0 A;  4JX1 C;  4OW0 A;  4JWS C;  3Q14 C;  2CHW A;  1MHH E;  4AQ7 A;  2LMC A;  1R4N B;  3TIX A;  5IA7 A;  2C60 A;  1MJD A;  4WJO A;  2FCS A;  3BK2 A;  1L7Y A;  2BTE A;  3ONS A;  4W9L A;  5BYQ A;  3GS2 A;  4WJQ A;  3MJW A;  1J0G A;  2K8H A;  1KJT A;  4LNN A;  1MFW A;  2ZNV B;  1QOA A;  2R2O A;  3JVZ X;  2LGY A;  1XLO A;  3KYD D;  4WWP A;  4MGK E;  1TY2 A;  2K39 A;  2PIA A;  5E6O A;  1JRO A;  4FAD A;  3TUO A;  2WP9 B;  4AWJ A;  2WXN A;  2C9W B;  4JPS A;  1YIW A;  3FKY A;  3X23 A;  2BB6 A;  3ZUN A;  2ZVN A;  3VUX A;  1FNV A;  1CK1 A;  4HCN B;  4BKG A;  2J4X A;  3ZKJ C;  1GC6 A;  4DHJ B;  2CU3 A;  2SEB D;  4WAF A;  4RNA A;  3PRE A;  2WNM A;  2KAJ A;  3Q3M C;  4I6P A;  2MJE A;  4JIO U;  4XE0 A;  1L4Z B;  2G45 B;  2LVP A;  3AM9 A;  2IDY A;  3BVG A;  3Q3O C;  3AN1 A;  3EA6 A;  4M0W A;  3IXS A;  5DPR A;  4BBN F;  4NAW A;  2NCN A;  4UDU C;  1WX7 A;  2IGG A;  4X57 B;  2N4F A;  3P4Q B;  3QWZ B;  1L5P A;  2B3A A;  2FCM A;  2JYT A;  4JE3 B;  1KLG D;  2HJ1 A;  4HKZ E;  3P4R B;  2N9K A;  4P16 A;  3CF6 E;  3RNG C;  5FR3 A;  2CHX A;  4PS8 A;  4NQK E;  3MC9 A;  4F7Z A;  1N62 A;  2K8B A;  3NRZ A;  2V9H A;  3UGB B;  4A9A A;  5AUI A;  1WJ6 A;  3NOB A;  1JWB D;  3Q8E A;  2KN4 A;  4FHK A;  2D07 B;  2WLB A;  3QJZ A;  2KC2 A;  3KH0 A;  2QMT A;  2UU7 A;  4S0R A;  3SR6 A;  3DBS A;  3RMK C;  2BYF A;  1I4G A;  4GIV A;  1FIQ A;  3B9J A;  1TGZ B;  5LXI B;  1N60 A;  2W82 A;  1E8W A;  4TQ0 A;  3ZW3 A;  3DBH I;  2Q5W D;  3RCZ A;  1N61 A;  2Y5B B;  4DHJ D;  2WU5 B;  2KNB A;  2V3N A;  3U52 E;  3LDZ E;  3DWG C;  3RYT A;  1LFD A;  4GB9 A;  4W9D A;  1XLP A;  3NUH B;  3VDZ A;  2ZVO A;  4XWT A;  2Z8L A;  2TSS A;  2NS5 A;  3B2F A;  1E7V A;  3DWM A;  3N1X C;  3AV8 A;  2L0T A;  3EUB 2;  3ABV B;  4R3D A;  3DCG A;  2O6V A;  1ROE A;  2N9X A;  2XBB C;  2RPV A;  3DOW A;  3TEX A;  3AMZ A;  4XYC A;  4RGT A;  1YN5 A;  3PZ7 A;  1VJK A;  1B1Z A;  4ACF A;  1CMX B;  2LHE A;  2EKI A;  2LUE A;  3L4P A;  1F2R I;  4M02 A;  3ZLZ A;  4N6E B;  3KW5 B;  3QK0 A;  4PYU A;  3LYY A;  2KKC A;  4FBJ B;  2I1K A;  2IO0 B;  2YLM A;  4MJS B;  4RGN A;  1I42 A;  2X38 A;  3NVY A;  5DCN A;  2KAN A;  3V3X A;  2L32 A;  1S1Q B;  5E6N A;  3O13 A;  3QAQ A;  3UQB A;  2N1V A;  4RFB A;  1V5T A;  2D2Q A;  2FCN A;  1UBI A;  2LZ6 A;  1FNU A;  1C9F A;  4MEM A;  5D3I B;  4E74 A;  3PRM B;  1JAL A;  1EU3 A;  3WAL A;  2WU2 B;  3PLV A;  1GG3 A;  4OVV A;  2WHI A;  3OJ3 A;  4NNJ B;  1HXY D;  4HK2 A;  3B1L X;  4WQM A;  4YT0 B;  2WYQ A;  3ZNH B;  4KDI C;  1P3Q U;  4A6Q A;  4OZA A;  4G0N B;  1HTQ A;  4LK0 M;  1HZ5 A;  1NVI D;  4DK5 A;  3T3N A;  2IO2 B;  1EF1 A;  4ITK A;  1TIF A;  1TZO A;  2L76 A;  1GJZ A;  1YN3 A;  4HLE A;  1V80 A;  2KJ6 A;  1H8C A;  1GB4 A;  3IVF A;  5IP4 D;  1XF5 L;  1FXT B;  1YJJ A;  3B0A A;  4ZYS A;  1E8Y A;  3CIR B;  2LGI A;  2Y3A A;  3TSS A;  2GRI A;  1ZXH A;  3R66 C;  2CS4 A;  2OHF A;  1YN4 A;  1C3T A;  2LXA A;  2AWT A;  3OWE B;  3O65 B;  1R7S A;  1WGR A;  4FJZ A;  3WCQ A;  4MM3 B;  2FAZ A;  2C7N B;  2DZJ A;  2PTL A;  1SXT A;  5H92 C;  3VTV A;  4GOC A;  3P4S B;  5BYS A;  2GOW A;  1GNU A;  4PYZ A;  4CQN A;  1TYG B;  2FID A;  4TMA B;  4MH8 A;  1WE6 A;  4AS1 A;  4YTP B;  2MX2 A;  2KK8 A;  4EUT A;  3NHE B;  1MHX A;  2BGF A;  3L13 A;  1WZ0 A;  2REX A;  1Q10 A;  1L0Y B;  4HRO A;  4PS3 A;  4YWG G;  3N1Z C;  3RFZ B;  1ZOY B;  2XN9 C;  1YOV B;  1F77 A;  4B9K A;  2WXF A;  3GZN B;  2JZP A;  2LAS A;  1T6B X;  2PMV A;  1SE9 A;  5D2M B;  3ZJV A;  3A9K B;  4NJ7 A;  2LWP A;  3ZXV A;  2M0A A;  5BYR A;  1M94 A;  1QOG A;  3Q8F A;  2O2V A;  4CO7 A;  1UEL A;  1KLV A;  3N9Y C;  3UIN B;  1PGA A;  3DBR I;  2UYZ B;  1K51 A;  4WWN A;  2EMT A;  4NZL B;  1CJE A;  1T0R C;  2AYO B;  4I6N B;  1WZ3 A;  2ZPY A;  3SEB A;  4MJS A;  2DZK A;  2BWF A;  2WXG A;  3ZTC A;  2J52 A;  4TQ1 A;  3A1Q A;  2QC8 A;  2KLC A;  1SIJ A;  2M19 A;  3DBL I;  3A9J B;  1C76 A;  3V6C B;  2KJR A;  2LVQ A;  3EGR A;  3W9C B;  2AQ3 B;  2HD5 B;  2V4I B;  4XWW A;  3FAH A;  4B6W A;  2N7D A;  2L52 A;  1WGK A;  2NBV B;  5H8Y E;  4KX6 B;  5EE9 A;  4MDK E;  3AH7 A;  2KWD A;  2K3U A;  2PE9 A;  1WM3 A;  1JRP A;  2XEW A;  4KV2 A;  2DYB A;  1UUP A;  3EC8 A;  2HTH A;  3SDL C;  3WAN A;  1OQY A;  4US9 A;  1EWC A;  1XXG A;  3ZVV A;  1TY0 A;  4WJP A;  1K8R B;  4KSK C;  4E71 A;  1VD2 A;  1WRD B;  1TKE A;  5DPS A;  3X0W A;  3RI7 C;  4G11 A;  3AI5 A;  2CR5 A;  3AE3 B;  2KD0 A;  2XK5 B;  1KFY B;  2K25 A;  1ACC A;  2JVC A;  2GMI C;  2WXK A;  5D7G A;  5EE3 A;  1IGD A;  5FKA C;  1C4A A;  1EUV B;  2BS4 B;  3IAM 1;  3VXW A;  4BBN C;  3VR8 B;  2ON8 A;  2KMA A;  2BYT A;  2LUM A;  1LM8 B;  3PPA A;  2G3Q B;  2KWC A;  4MM3 A;  3H7S A;  1QLB B;  1ENF A;  3RUL A;  3ETR A;  4EEW A;  3DVG Y;  4KZC A;  3JYU A;  1SE4 A;  2NTS A;  4GXB A;  4HPP A;  3V61 A;  5FR6 A;  1DOY A;  2RMM A;  3EFU A;  3I3T B;  1P7F A;  3PV1 A;  2KX0 A;  3DQV A;  3MHS D;  4M8N A;  1XQQ A;  5JHB A;  1WX9 A;  4YTM B;  3W5V B;  3QIJ A;  5AUK A;  4TUU A;  2G4S A;  4MEL A;  3ZRC A;  4II2 B;  3EEC A;  4YSY B;  4MGY E;  2MWS B;  1I4Q A;  2JZ3 B;  4HWI B;  2PPH A;  2VH1 A;  1QKZ A;  1YQ3 B;  4DXA B;  4HRS A;  2Z59 B;  3ZJU A;  4W9J A;  4C7Y A;  3L54 A;  1WJN A;  4TKN A;  2L8J A;  3A9K A;  2DYO A;  4DXG A;  3T9L A;  1YNT E;  4IWP A;  4FLH A;  4JQW C;  1TJE A;  4HPM B;  1EM7 A;  2K22 A;  1IBX B;  1FM0 D;  4QAY A;  4ZRI A;  5G55 A;  2HTM E;  4WAA A;  1GPX A;  2K0P A;  1SE3 A;  2LRU A;  3NZS A;  4RMA A;  4GN1 A;  2LGD A;  1LGR A;  4LNK A;  1R4N I;  4LNF A;  4DHZ E;  3HHM A;  2D5G A;  1RYJ A;  2WXR A;  1JWS D;  1TS5 A;  4FUL A;  4YXD B;  3N1Y C;  3A9J A;  1R4M B;  2IO3 B;  2PKO A;  2HE7 A;  2O6V B;  2KTF A;  1MVK A;  2KMC A;  4WIP A;  3M63 B;  4KGS A;  2FNJ B;  3KWL A;  4BFR A;  3SU8 X;  5GMV A;  2QCZ A;  2N0S B;  2QIL A;  3MP9 A;  1OTR B;  3C0R B;  4GSW A;  3ZYY X;  3H6N A;  3I63 C;  3DHH C;  4OVZ A;  3BVM A;  4MT5 A;  1V1O A;  2N9P C;  4WH4 A;  3AEG B;  1J8C A;  3C19 A;  1VZ6 A;  3PSE B;  3RNC C;  2LI5 A;  4OZC A;  2C5L C;  3OG5 A;  2EMS A;  5JZE B;  4XDC A;  3ZRF A;  1AWD A;  2XK5 A;  3MC8 A;  4D2K A;  2IYD B;  5J17 A;  1E7U A;  4ICV A;  2CHZ A;  4A90 A;  1RRB A;  2G1E A;  1E10 A;  4S17 A;  1DOI A;  1F9J A;  4G3X B;  2OJW A;  1V2Y A;  4WUR A;  2L0F A;  5HHD G;  2NBW B;  1QOB A;  3V6E B;  3WAM A;  3ZIM A;  1ZKH A;  4M01 A;  5D3D A;  3FC4 A;  3TJP A;  1J19 A;  1PFD A;  2M56 B;  3PTF C;  1F1H A;  1PDX A;  1IPG A;  4HDQ A;  1XD3 B;  3AEA B;  1FFV A;  4FHJ A;  4P1B C;  1P1A A;  2O6V D;  2JRI B;  3QHT A;  1HA5 A;  4WWM A;  1IGC A;  3AE5 B;  2WXQ A;  3QC8 B;  1WXA A;  2VH2 A;  5BMH A;  2NR2 A;  4RGO S;  4KSL C;  4YSX B;  3ZXR A;  1FCC C;  2Y5P A;  1WI0 A;  1WIA A;  1J7C A;  3UQA A;  5G5G A;  3R7Q A;  3HIZ A;  3AED B;  2Z0D B;  2AEH A;  3BVZ A;  3E56 A;  2L00 B;  4K3B A;  1PGB A;  1XCQ L;  3E9S A;  5IOI A;  1FEH A;  3P63 A;  3ZO5 B;  1GOZ A;  2LGX A;  1PUT A;  2WXL A;  4ZDV A;  3IBE A;  2V3S A;  4DQO C;  4AUQ C;  3BII D;  1WF9 A;  2I38 A;  3JSV B;  1IBX A;  3DVN V;  2IGD A;  3KUC B;  4W9K A;  2AL6 A;  4DWF A;  2LVO A;  1WGY A;  2AQ1 B;  2BKR B;  1LQB A;  1OQR A;  1EWY C;  2IND C;  1VCB A;  2BS2 B;  2DEN B;  2I2Y A;  1V97 A;  1STE A;  3LJ3 A;  5CX3 A;  3ZDT A;  2W9N A;  2Z0E B;  2BYV E;  1SEB D;  1F2R C;  1TT5 B;  1TKY A;  2DAF A;  1YQB A;  4HEA 1;  2EKE C;  3R2I A;  3K9P B;  2KFK B;  1JCK B;  2O2V B;  5C1Z A;  3UIP B;  2KVR A;  3PVL A;  3AU5 A;  4KIK B;  3VTU A;  2M17 A;  4BKS D;  1C78 A;  2NPT B;  1NI2 A;  4HKQ A;  4JWU C;  2FBW B;  2KQS A;  1RFA A;  3GE8 C;  2KWU B;  4XDD A;  1SGH A;  3NY5 A;  4ARI A;  3VR9 B;  2KC1 A;  4DHZ B;  3NVZ A;  2AQ2 B;  3A1Q B;  5LNK 1;  2INC C;  4A20 A;  3U7Z A;  2D11 A;  2HJ8 A;  2LHD A;  2SAK A;  4ICU A;  1OEY J;  3BK1 A;  1X1M A;  3GP7 A;  5JHA A;  4F8C B;  3WAO A;  4LJP B;  3VRA B;  2N1W A;  3VQI A;  2KT7 A;  1E5W A;  5AZF A;  2G9H D;  3V62 A;  3PHX B;  3VFK A;  2WGS A;  3PGE A;  3TEW A;  2ACZ B;  2J0J A;  1L0V B;  1YJI A;  2A5U A;  2PVO D;  2WXH A;  2WX1 A;  3W1Y A;  1K53 A;  1UZX B;  1ZW7 A;  1ZP0 B;  2ZCB A;  3NS8 A;  4GGQ A;  1YJ1 A;  4XZ4 A;  1F52 A;  4JGH B;  2J42 A;  4C4V B;  1JW9 D;  1Y56 A;  5JH5 C;  2RD0 A;  3BZD B;  2KDI A;  1JWM D;  3W5U B;  1V1P B;  3H8H A;  1OEY A;  4BKS A;  1SSN A;  2KTR A;  2ZZP B;  3HM6 X;  2DX5 B;  2JY6 A;  3RPF C;  2E6X A;  2VRR B;  4A55 A;  3I5J C;  5GXG B;  1ZDV A;  2IJ0 A;  2R61 A;  1S3S G;  4ZHO A;  2FIF A;  2BQQ A;  4XGA B;  4GDK B;  2QSD A;  2WDV B;  2D3C A;  4CYE A;  4EOY A;  5LXH A;  1HEZ E;  4KDL B;  1FFU A;  1FRR A;  2KQ4 X;  2ZEQ A;  1LO5 D;  3Q3F A;  3R2T A;  1VZ7 A;  3JSV A;  3AE9 B;  1LXD A;  3IHP C;  3AEB B;  2ZJD A;  2BWE S;  2KDE B;  2AL3 A;  3TMP B;  1QT9 A;  3U2S C;  1WFY A;  2WWZ A;  3N3K B;  1SE2 A;  1H4R A;  1N5W A;  1HE8 A;  2VZK B;  1IP9 A;  3Q3N C;  4K1R B;  1NEN B;  5AEK B;  1NBF C;  1P98 A;  1WGD A;  3GZN I;  1KF6 B;  1EF5 A;  1DOX A;  3MJ5 A;  4IM2 A;  4WJN A;  3HK0 A;  5D94 A;  1ZE3 D;  4I6L B;  3U4E G;  2QEJ C;  1F0Z A;  2N7J A;  1FMA D;  1TS2 A;  2OED A;  4HCP B;  2CKH B;  1FXI A;  4ZRJ A;  3MHZ A;  4HVB A;  3NG0 A;  2K1F A;  1ET9 A;  2QIE B;  2KFK A;  4XX5 A;  1UNS A;  4EFO A;  4KIK A;  2BT6 A;  2NPT A;  2JXX A;  3A33 B;  4MH0 E;  4ANU A;  2WXP A;  3RN9 C;  4KZ0 A;  2NVU I;  4K3C A;  1EU4 A;  1RAX A;  1WGG A;  4C7Z A;  1BUI C;  1UD7 A;  5IKC M;  3H1U A;  2BKF A;  3PS6 A;  1RLF A;  1WX8 A;  1DYQ A;  3UIO B;  4ZHP A;  2WS3 B;  2GLS A;  1NI3 A;  4OVU A;  4RCO A;  3AEE B;  3L0W B;  5IAA C;  2JXT A;  4KKI A;  1VR9 A;  1AW7 A;  2KWV B;  3PZ8 A;  2XNA C;  3VUW A;  2GBK A;  2NBU A;  1T0Y A;  4JLC A;  1WRI A;  3ALB A;  4ZOH C;  1OGW A;  4B0E A;  3HUI A;  1P0R A;  3AE7 B;  2DAJ A;  2MW5 A;  2KO3 A;  4G50 A;  3N20 C;  4NJ6 A;  5L95 C;  1WSP A;  5C3J B;  1JWA D;  1Z2M A;  2QHO A;  2N7E A;  1XLQ A;  1ET6 A;  4C4V A;  1L2N A;  1YX6 B;  4E3C A;  4IM3 A;  2JWU A;  3RZF A;  3R8B A;  2RR9 A;  1MG4 A;  5E6J A;  1V1P A;  1JRU A;  1D6E C;  3A4R A;  3P2B A;  5CHW A;  4AOF A;  3ENE A;  4FN2 A;  3Q69 A;  3BYT B;  3SFD B;  3C8Y A;  2ZPN A;  4GDK A;  2FUG 1;  2NMQ A;  3KYC D;  3APC A;  2ZW1 A;  2DZI A;  4ZRP A;  5BMI A;  5DPW A;  3NVV A;  4L2Y A;  1T0S C;  1G6J A;  1WR1 A;  4NAM A;  1DGJ A;  1E8Z A;  3EFC A;  1SJH D;  3IFW B;  5LLI A;  1MPE A;  2GB1 A;  1D5X C;  1N5X A;  3TEY A;  4OZB A;  4RF0 A;  3SFE B;  3APF A;  4RM8 A;  3CWI A;  4PK1 A;  4W9G A;  2KZR A;  2WDT B;  1D4B A;  5HI1 A;  1Q1O A;  4B95 A;  2LJI A;  4KGR A;  1KTK A;  3ZDM C;  3IT4 B;  2L05 A;  1AYF A;  2V0G A;  3I57 A;  3VH3 B;  1UBQ A;  3D32 A;  3PT2 B;  2DNF A;  2Y5C A;  3M95 A;  3BWU D;  3WA0 A;  1OFF A;  4LLG M;  1KH0 A;  2PEA A;  2KMM A;  1L6V A;  2W54 A;  3ECI A;  3UF8 A;  3ZNI D;  3ZGZ A;  1E0Z A;  4F1S A;  1V86 A;  4W9E A;  3AE1 B;  3RNB C;  3ZQ4 A;  4P1C C;  1I4R A;  3FIL B;  3N30 A;  2G4D B;  3HVZ A;  2MBB B;  3LB8 C;  1E9M A;  2KLG A;  2MJ3 A;  1R4M I;  4KKJ A;  2DLB A;  2ZNV C;  2MP2 B;  2PJH A;  2BW2 A;  1WGH A;  2GBN A;  3AXC A;  4K7W A;  1YMH E;  1BT0 A;  2MBE A;  1QZE A;  1WJU A;  4HPL B;  1AAR A;  2BPS A;  4H2A A;  2MA9 B;  2WDQ B;  5L83 A;  5BO4 B;  4A8X C;  4LNO A;  1A70 A;  2MEK A;  3RNE C;  2K9X A;  1HQR D;  3U7D A;  1GUA B;  2IBI B;  1YD8 U;  1MG8 A;  1Q5W B;  4L23 A;  4IM0 A;  3KLS X;  5E6P A;  3VHT C;  3MTN B;  3BY4 B;  2J7Q B;  2W55 A;  3AE2 B;  2INN E;  2LFI A;  1GB1 A;  2OOB B;  3PLU A;  4MSM B;  1WH3 A;  2LXC A;  1MI0 A;  2C7H A;  3Q8C A;  5I4D A;  2BB5 A;  5CHF A;  1L4D B;  1CQV A;  3KUD B;  4XC2 A;  4USA A;  1ZGU B;  3S2A A;  5HKH A;  5EE0 A;  1KOT A;  1A5R A;  5IN7 A;  2GBM A;  2WX0 A;  1I35 A;  3KQ4 A;  1WM2 A;  3ML8 A;  3AE6 B;  3KWV A;  2N9E B;  2A4Z A;  4DBG A;  4P7I A;  1FPY A;  3QX1 A;  2BF8 B;  4HJK A;  5DPT A;  2MBH A;  3QQ8 B;  2CU1 A;  4FA6 A;  4CHK A;  2IY1 B;  2YEP F;  3RUI B;  4GMV A;  3QAR A;  1NDD A;  1QQR A;  4DXF A;  2KYW A;  3PRP B;  4K7S A;  1Z5S B;  1XO3 A;  4EZK A;  3VUY A;  2RDB C;  4LDT B;  4REZ A;  4HJG E;  4NJC A;  1TS4 A;  4YL8 A;  1IYF A;  1NYR A;  1VRA B;  3ZNZ B;  1C4C A;  1J7B A;  3OJ4 B;  4AP4 C;  1TTN A;  2KTR B;  2JZZ A;  4DDI D;  4N9F 4;  4BAX A;  2PLP A;  3R3M A;  4BOS C;  3L10 B;  1WWT A;  3P4P B;  1FNW A;  1JML A;  1HTO A;  1D3Z A;  5G5H A;  1T0Q C;  4IUM B;  2IPK D;  3DDC B;  3W2D A;  2MRP A;  2QDF A;  3NVW A;  4N59 A;  3DVN U;  4C00 A;  2BVC A;  2IY0 B;  3V60 A;  2H88 B;  4RM9 A;  4YTN B;  1L6U A;  4IOI E;  3UI3 A;  2V4L A;  1AN8 A;  1WJ4 A;  2WXI A;  1K52 A;  2PW9 A;  3AE8 B;  4NQL B;  4K81 A;  2MLB A;  4A3O A;  3FIL A;  2M4N A;  3T8M A;  1PGX A;  3R7R A;  3DVG X;  3SD5 A;  4M00 A;  5C23 A;  2K6D B;  1K50 A;  2KN5 A;  2INP E;  3H9D A;  4W9F A;  1ESF A;  4J3O D;  3KUZ A;  5D6J B;  2MP2 A;  2R2Q A;  3TBL D;  2CJN A;  3RZW C;  2BS3 B;  3DPD A;  3U30 A;  3DBH B;  3PHW B;  3M3J A;  2WXO A;  2JT4 B;  4IKG A;  4LDT D;  2ZCC A;  3Q8B A;  3AUL A;  1E6E B;  2MSE D;  4TSS A;  1GAQ B;  1UGJ A;  2YVC A;  1OQQ A;  1NYQ A;  1L0X B;  4PT5 A;  2GBJ A;  1V5O A;  3DHG C;  1UF0 A;  1SBB B;  2MCN B;  2KDM A;  1XCT L;  3IT6 B;  4GU2 A;  3TEZ A;  1WR6 E;  4DDG D; 
#chains in the Genus database with same CATH homology
 2CU3 A;  3MHZ A;  2SEB D;  4WAF A;  3AEC B;  4RNA A;  1ET9 A;  2QIE B;  3NZ3 A;  4YTM B;  2WNM A;  3W5V B;  1JQ4 A;  1ZUD 2;  1UNS A;  5AUK A;  2KAJ A;  1ZPS A;  2BT6 A;  2MJE A;  4XE0 A;  1L4Z B;  2WXP A;  3AM9 A;  2IDY A;  1I4X A;  1SJE D;  3BVG A;  4YSY B;  3AN1 A;  3V05 A;  1I4Q A;  3Q8A A;  3EA6 A;  4M0W A;  3IXS A;  1WXQ A;  1QKZ A;  1ZXI A;  1PYW D;  4C80 A;  1I7H A;  1YQ3 B;  3I9V 1;  4UDU C;  4US8 A;  1EU4 A;  2IGG A;  4HRS A;  4C7Z A;  3ZJU A;  4C7Y A;  1BUI C;  3P4Q B;  1L5P A;  2QJL A;  1DYQ A;  2DYO A;  4DXG A;  4GDL B;  4ZHP A;  2PVG C;  2JYT A;  2WS3 B;  4JE3 B;  1KLG D;  1YNT E;  3PO0 A;  1VDV A;  1NI3 A;  4RCO A;  3AEE B;  1M4V A;  4HKZ E;  3P4R B;  2N9K A;  4P16 A;  5FR3 A;  2JX5 A;  2JXT A;  4KKI A;  1TJE A;  1VR9 A;  1AW7 A;  1EM7 A;  3PZ8 A;  1FD6 A;  2K22 A;  1N63 A;  1N62 A;  2XNA C;  3NRZ A;  2FE8 A;  1T5X D;  1FM0 D;  1IBX B;  4P6V F;  4A9A A;  2HTM E;  5AUI A;  1GPX A;  2K0P A;  1WRI A;  3AE4 B;  4FXC A;  1SE3 A;  4ZOH C;  1JWB D;  3Q8E A;  2KN4 A;  3HUI A;  4B0E A;  3AE7 B;  1I4H A;  2WLB A;  2D5G A;  1RYJ A;  2L1A A;  2WXR A;  5HG2 A;  1JWS D;  1TS5 A;  4RGM A;  2QMT A;  4YXD B;  2AX5 A;  2WDR B;  1WSP A;  3SR6 A;  5C3J B;  3MC0 B;  3P42 A;  1I4G A;  2PKO A;  1JWA D;  1FIQ A;  3B9J A;  1MVK A;  1N60 A;  2W82 A;  4TQ0 A;  4WIP A;  1XLQ A;  2Q5W D;  1ET6 A;  4KGS A;  1N61 A;  2WU5 B;  3KWL A;  2JU6 X;  2EEL A;  2JWU A;  2V3N A;  3U52 E;  1FXA A;  3R8B A;  3DWG C;  5JXV A;  5E6J A;  1V1P A;  2N0S B;  2QIL A;  5C2T B;  2ICI A;  1D6E C;  1XLP A;  3J9C A;  3NUH B;  4LTU A;  3MP9 A;  2MH7 A;  3ZYY X;  4OVZ A;  3BVM A;  3Q69 A;  4MT5 A;  5BMG A;  5TSS A;  4XWT A;  1V1O A;  2TSS A;  1BML C;  2Z8L A;  3BYT B;  3SFD B;  3B2F A;  4WH4 A;  3DWM A;  3AEG B;  4RH6 A;  3AV8 A;  3C8Y A;  3ABV B;  3EUB 2;  4R3D A;  2FUG 1;  1VZ6 A;  1XEE A;  4OZC A;  1JWU D;  2LEK A;  2NMQ A;  1ROE A;  2RPV A;  3TEX A;  3AMZ A;  2ZW1 A;  4XDC A;  4YSZ B;  4RGT A;  4ZRP A;  5BMI A;  1AWD A;  2H89 B;  3NVV A;  4L2Y A;  1YN5 A;  1VZ8 A;  4NAM A;  1DGJ A;  4B0M A;  3PZ7 A;  4D2K A;  1TS3 A;  1RFK A;  1VJK A;  1B1Z A;  4A90 A;  1SJH D;  2G1E A;  2LHE A;  1E10 A;  2EKI A;  1MPE A;  2GB1 A;  2B76 B;  1DOI A;  2N9L A;  1D5X C;  1N5X A;  3TEY A;  5MPO A;  4OHJ A;  3L4P A;  1F2R I;  1P7E A;  4OZB A;  4N6E B;  4RF0 A;  3SFE B;  1B9R A;  4WUR A;  3CWI A;  5HHD G;  3LYY A;  1TKG A;  1QOB A;  2MJD A;  1VLB A;  3AEF B;  1C77 A;  1C4P A;  4RGN A;  5D3D A;  3FC4 A;  1BXT A;  2X38 A;  1D4B A;  2HDE A;  1PFD A;  5HI1 A;  3NVY A;  1SF0 A;  2LJI A;  4RF1 A;  2M56 B;  3V3X A;  2GI9 A;  2L32 A;  1KTK A;  4KGR A;  1FRD A;  3IT4 B;  3O13 A;  1PDX A;  4RFB A;  1AYF A;  2V0G A;  3I57 A;  3AEA B;  1FFV A;  5EE1 A;  1C9F A;  1FNU A;  3B2G A;  1J7A A;  1ZDX A;  5D3I B;  1HA5 A;  1KLU D;  2Y5C A;  1JAL A;  3BWU D;  4WWM A;  1IGC A;  1EU3 A;  3AE5 B;  1OFF A;  1WYG A;  4LLG M;  1KH0 A;  2WXQ A;  2WU2 B;  2KMM A;  1L6V A;  1QOF A;  5BMH A;  2W54 A;  2WXM A;  4RGO S;  1FO4 A;  3ZGZ A;  1E0Z A;  1HXY D;  4YSX B;  2WQY B;  1FCC C;  4WQM A;  2Y5P A;  4YT0 B;  1J7C A;  4A6Q A;  4OZA A;  3AE1 B;  5G5G A;  3ZQ4 A;  1RM6 C;  4LK0 M;  1I4R A;  1HZ5 A;  2VZK D;  1NVI D;  3AED B;  3BVZ A;  3FIL B;  3E56 A;  3T3N A;  4ITK A;  3HVD A;  3HVZ A;  3LXF A;  3LB8 C;  1TZO A;  1E9M A;  1PGB A;  2ONQ A;  1XCQ L;  2MJ3 A;  3E9S A;  3NS1 A;  1FEH A;  3P63 A;  4KKJ A;  1GOZ A;  1YN3 A;  1YQ4 B;  2DLB A;  1PUT A;  2WXL A;  2NTT A;  1GB4 A;  4DQO C;  2BW2 A;  1XF5 L;  3BII D;  1YJJ A;  1YMH E;  5FK9 C;  4ZYS A;  1QF6 A;  2I38 A;  2LGI A;  3CIR B;  1IBX A;  2Y3A A;  4H2A A;  3TSS A;  2GRI A;  2WDQ B;  1IUE A;  1ZXH A;  4A8X C;  3BYY B;  2IGD A;  2OHF A;  1YN4 A;  1A70 A;  3OWE B;  2MEK A;  1CZP A;  1HQR D;  1R7S A;  2K9X A;  3WCQ A;  4Q2J A;  2AQ1 B;  4MM3 B;  4L23 A;  1OQR A;  2PTL A;  3IAS 1;  1EWY C;  3KLS X;  1SXT A;  5H92 C;  2DBY A;  3P4S B;  2BS2 B;  2J53 A;  2K5P A;  5BYS A;  2I2Y A;  1KRH A;  1V97 A;  3AE2 B;  2W55 A;  4L1B A;  2INN E;  1STE A;  3URY A;  2LFI A;  1GB1 A;  1SB3 C;  2W3S A;  2V3P A;  1V8C A;  1SEB D;  4CQN A;  1F2R C;  1TYG B;  5HFY A;  4TMA B;  4MH8 A;  1TKY A;  1MI0 A;  2BBC A;  4AS1 A;  3Q8C A;  5I4D A;  4YTP B;  2BB5 A;  1L4D B;  1CQV A;  2JYE A;  4HEA 1;  3R2I A;  4USA A;  4ARC A;  5EE0 A;  1JCK B;  1HZ6 A;  1MHX A;  4N58 A;  1Q10 A;  1L0Y B;  1C78 A;  3KQ4 A;  4HRO A;  5T8I A;  4HKQ A;  4JWU C;  4YWG G;  3RFZ B;  2FBW B;  1ZOY B;  2XN9 C;  1D5Z C;  1UWM A;  1F77 A;  2DYM A;  3AE6 B;  1QIL A;  3KWV A;  2WXF A;  2JQR B;  4NAW B;  3MFG A;  2JZP A;  1T6B X;  2PMV A;  2WXJ A;  3HRD D;  4XDD A;  2YEP B;  3ZJV A;  4ARI A;  3VR9 B;  3NVZ A;  2AQ2 B;  2M0A A;  2YEP F;  5BYR A;  5LNK 1;  1RWS A;  1QQR A;  4DXF A;  4ZRQ A;  1UWX A;  1QOG A;  3Q8F A;  4O1N A;  3U7Z A;  3T3O A;  2E3T A;  4KGT A;  2LHD A;  2SAK A;  1XO3 A;  3N9Y C;  1PGA A;  4EE2 A;  1K51 A;  3BK1 A;  4REZ A;  1T3Q A;  3P1M A;  3GP7 A;  4HJG E;  2RDG A;  4NJC A;  4NZL B;  1E7P B;  1CJE A;  1NEK B;  1TS4 A;  3VRB B;  3VRA B;  1NYR A;  1VRA B;  2JSV X;  3SEB A;  3VQI A;  1XLN A;  1C4C A;  1J7B A;  1FCL A;  3GB1 A;  2G9H D;  2WXG A;  2J52 A;  2PLP A;  4TQ1 A;  3TEW A;  1WWT A;  3P4P B;  2ACZ B;  1FNW A;  1JML A;  1D5M C;  1L0V B;  1YJI A;  3W1S A;  1SIJ A;  4MAC A;  2KAC A;  2M19 A;  5G5H A;  2PVO D;  2WXH A;  1K53 A;  3AB5 A;  2IPK D;  1C76 A;  2DWQ A;  4GLS C;  1ZP0 B;  3W2D A;  3EGR A;  3W9C B;  2AQ3 B;  2V4I B;  3NVW A;  4N59 A;  4XWW A;  3ZJT A;  3FAH A;  2L52 A;  2RDH A;  1WGK A;  4C56 C;  2J42 A;  1JW9 D;  5H8Y E;  4IDI A;  2IGH A;  2H88 B;  4KX6 B;  1C79 A;  1Y56 A;  5EE9 A;  4YTN B;  1L6U A;  3AH7 A;  2L83 A;  4IOI E;  2KWD A;  3BZD B;  1JWM D;  3W5U B;  1V1P B;  2K3U A;  3H8H A;  1SSN A;  3UI3 A;  1I4P A;  2CJO A;  3RPF C;  1JRP A;  1AN8 A;  2WXI A;  2E6X A;  1K52 A;  2PW9 A;  2W3R A;  3AE8 B;  1UUP A;  2ZW0 A;  4JX1 C;  4OW0 A;  4A55 A;  4JWS C;  5GXG B;  1MHH E;  1EWC A;  3FIL A;  4US9 A;  4AQ7 A;  1ZDV A;  1PGX A;  2IJ0 A;  2LMC A;  1XXG A;  2R61 A;  4ZHO A;  1TY0 A;  4GDK B;  1K50 A;  2QSD A;  2WDV B;  3BK2 A;  2INP E;  1TKE A;  1ESF A;  1HEZ E;  4J3O D;  1FFU A;  1FRR A;  3AE3 B;  2KQ4 X;  2CJN A;  2BTE A;  1KFY B;  1ACC A;  5BYQ A;  1LO5 D;  2BS3 B;  3GS2 A;  2WXK A;  5D7G A;  3R2T A;  5EE3 A;  1IGD A;  2WXO A;  1VZ7 A;  5FKA C;  1C4A A;  3AE9 B;  4IKG A;  2BS4 B;  3IAM 1;  3Q8B A;  3AEB B;  3VR8 B;  1QOA A;  1E6E B;  2ON8 A;  4TSS A;  1GAQ B;  1UGJ A;  1XLO A;  1QT9 A;  3U2S C;  1OQQ A;  1NYQ A;  1SE2 A;  1TY2 A;  2BYT A;  2PIA A;  1N5W A;  2LUM A;  2VZK B;  1JRO A;  3TUO A;  2WP9 B;  1L0X B;  4PT5 A;  1QLB B;  1NEN B;  2WXN A;  4JPS A;  1ENF A;  3ETR A;  2BB6 A;  1KF6 B;  1DOX A;  1SE4 A;  3MJ5 A;  2NTS A;  1SBB B;  1DOY A;  2RMM A;  1ZE3 D;  2KDM A;  1XCT L;  1P7F A;  1FNV A;  3U4E G;  1CK1 A;  2QEJ C;  1F0Z A;  3IT6 B;  2J4X A;  3TEZ A;  2N7J A;  1FMA D;  1TS2 A;  2OED A;  1FXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...