1B9RA

Terpredoxin from pseudomonas sp.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
105
structure length
105
Chain Sequence
PRVVFIDEQSGEYAVDAQDGQSLMEVATQNGVPGIVAECGGSCVCATCRIEIEDAWVEIVGEANPDENDLLQSTGEPMTAGTRLSCQVFIDPSMDGLIVRVPLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ferredoxin
molecule keywords PROTEIN (TERPREDOXIN)
publication title A model for the solution structure of oxidized terpredoxin, a Fe2S2 ferredoxin from Pseudomonas.
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 11
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1999-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b9rA00
3LXFA 2N0SB 1J7CA 3AM9A 3NVVA 1NYRA 2Y5CA 2W3SA 1RM6C 2CJOA 3AE2B 2MJDA 1KF6B 3DWMA 1FIQA 3SFEB 3P63A 1N63A 5H92C 1ZOYB 1OQQA 4JWUC 3AEDB 2FBWB 3W9CB 1NI3A 2DWQA 4A9AA 1E0ZA 1WYGA 2G1EA 4IDIA 3VR9B 1NENB 1QOBA 4US9A 4JX1C 1ZXIA 3AE8B 3AEGB 3B2FA 3VRBB 2L52A 3P4PB 3W5UB 3P1MA 5EE3A 3SR6A 3AEFB 2KAJA 2WU5B 2WU2B 1AYFA 1V8CA 1SB3C 2Q5WD 4YT0B 3B9JA 2H88B 5EE1A 3HVZA 1WGKA 5AUKA 1FFVA 4C80A 4N59A 1VJKA 1RYJA 3AEAB 1FMAD 2HTME 1WRIA 1B9RA 1QT9A 2W3RA 5MPOA 5EE9A 1GAQB 1A70A 1J7AA 1QOGA 1ZUD2 3AN1A 1VDVA 4P6VF 2WDRB 4HRSA 1YQ3B 4JWSC 1ROEA 1WWTA 1AWDA 1YJJA 4ZHPA 3HUIA 3NVYA 4N6EB 1KRHA 4YSYB 1I7HA 1DGJA 3ZYYX 1F0ZA 1L6VA 1N62A 3LB8C 3EUB2 4KX6B 3VR8B 1FRDA 1N5WA 1JALA 3AE3B 4FXCA 3FAHA 1XLOA 2MJ3A 5AUIA 3P4QB 1PUTA 2E3TA 2WS3B 2QIEB 4YSZB 1DOYA 1DOIA 3AE9B 1QLBB 2MJEA 3AE1B 3BIID 3ETRA 1IUEA 1FM0D 2KMMA 5G5GA 3WCQA 4YTMB 2JX5A 1E10A 1XLPA 1JRPA 3SFDB 1N5XA 1L6UA 1KFYB 2K5PA 3L4PA 1ZP0B 2BS2B 2W55A 1YJIA 5H8YE 2BS4B 1JQ4A 3FC4A 2CJNA 1N61A 1RFKA 4C7ZA 1XLQA 3CIRB 1E6EB 1UWMA 3AB5A 1VLBA 3AECB 3AV8A 1R7SA 3NRZA 1RWSA 1TYGB 1CZPA 1TKEA 4C7YA 2CU3A 1FXIA 1JROA 2PKOA 1NEKB 3AH7A 1YQ4B 1PDXA 2PIAA 1JW9D 5G5HA 5GXGB 1J7BA 5C2TB 2WDQB 2JQRB 2M19A 3AEEB 1E7PB 1DOXA 2BT6A 1NVID 4YTPB 2LEKA 3P4RB 1N60A 3B2GA 3AE5B 3CWIA 3VRAB 1CJEA 2WP9B 1QF6A 1E9MA 4HROA 5C3JB 1XLNA 2K9XA 1JWAD 2WDVB 4YXDB 2M56B 2H89B 2BS3B 3NS1A 4YTNB 3AE4B 2WQYB 2L83A 1OFFA 5EE0A 1FO4A 2DBYA 4USAA 2QJLA 2AX5A 1JWBD 2K22A 2WLBA 1L5PA 4ZOHC 2PVOD 1WXQA 2B76B 1SF0A 2OHFA 3ABVB 3AEBB 1NYQA 4ITKA 1XO3A 4LTUA 4US8A 3KWLA 1QOAA 3NVZA 1GPXA 1SIJA 2MH7A 2PVGC 1FXAA 1T3QA 3PO0A 4ZHOA 3DWGC 2EKIA 1FRRA 3AE6B 4WWMA 3NVWA 4WQMA 1QOFA 2ACZB 1OQRA 3P4SB 1L0VB 1TKYA 4N58A 2W54A 3HRDD 1V97A 3AE7B 1TJEA 4YSXB 3W5VB 1PFDA 3RPFC 1EWYC 1TKGA 3AMZA 1FFUA
chains in the Genus database with same CATH superfamily
4NNJB 3K9OB 5KHQA 2W3SA 3RNCC 4J6IA 4EEWA 4ZYNA 1B1ZA 3I3TB 1E0ZA 3JVZX 1U4AA 4K7UA 3BVZA 4IDIA 3R2TA 1GJZA 4MGZE 2L52A 3H7SA 4GMVA 3SR6A 4CQNA 2J0JA 5EE1A 2RSUA 3R3MA 3W1YA 1ZPSA 5LNK1 2MBHA 2WWZA 2IYDB 3KUCB 1YQ3B 1V86A 2PTLA 2QC8A 3EFCA 1KRHA 4GDKA 1UNSA 1V2YA 2GMIC 3A9KB 3KH0A 3MC8A 3MJWA 4AJWA 2LVQA 4OW0A 3TEYA 1P7FA 1C3TA 4OVZA 3R7RA 2KZRA 4M02A 2BS2B 4XDDA 5D3DA 3ZJUA 3QK0A 4IWPA 1HA5A 2WYQA 3W1SA 2KDFB 3ZNID 1XD3B 1PDXA 4KGSA 2V3SA 4BKGA 2KDMA 2PLPA 4KZCA 2ICIA 1L2NA 1WGDA 1VZ7A 4RNAA 3IAS1 3QC8B 2J0MA 3IG3A 1K50A 3AI5A 1ZKHA 1GUAB 2MW5A 2DYOA 4BAXA 1I4QA 1WXQA 3Q69A 4DDGD 4IM0A 3NVZA 3KLSX 1P0RA 2D3GA 4MT5A 1CQVA 1IPGA 5C1ZA 1UELA 4OVVA 1WZ3A 5TR5A 1HE8A 5D2MB 4IW0A 2WNMA 1RM6C 2WX1A 1EU3A 3J9CA 2N7DA 4ANXA 1OQQA 3GZNB 4JWUC 4K1RB 2L76A 1Y8RC 1GOZA 3U4EG 2V0GA 4HVBA 3W5UB 3FILA 2WU5B 4L23A 1V8CA 2QHOA 4R3DA 2BKRB 1VJKA 2D3CA 1GB4A 2NCNA 3R7QA 1GAQB 3H9DA 1K52A 4N6EB 4FLHA 4GDLB 1I7HA 3QQ8B 3LB8C 3EUB2 3OWEB 3QIJA 2L05A 3WIMA 3PS6A 4M8NA 3DHHC 1T6BX 4C00A 3P4QB 3RYTA 2EELA 3IVFA 4ZHPA 2LRUA 1MPEA 4YTMB 2W9NA 2K6DB 4HCNB 1R4MB 2ZVNA 1NBFC 2MX2A 1SE3A 2IDYA 3I57A 3M62B 3BVMA 3P42A 5FR3A 2HDEA 1RAXA 1Q0WB 3WAOA 4ICUA 2KVZA 2M19A 2K3UA 5D3IB 4EZJA 4I6PA 4G3XB 5IP4D 4XC2A 3AE5B 1CJEA 2BB5A 2LJ5A 2LHDA 1WH3A 3OAWA 4BFRA 3AE4B 3B1LX 5JHAA 2IGDA 3PPAA 4NJCA 4BVUC 2KX0A 1NYQA 4MSMB 1GPXA 1UZXB 4MGKE 4W9LA 1HXYD 3QHTA 2WXHA 5TSSA 2JXXA 4HEA1 3RZWC 1UF0A 3AU4A 3MC9A 2GRIA 3RPFC 2LGIA 4HDQA 5DPTA 2FCMA 3KQ4A 1ZOYB 4KV2A 2JYEA 1HTOA 3LJ3A 1OEYJ 2N1WA 2WXRA 2KHWB 2ON8A 4P7IA 4ANUA 2MEKA 2Q5WD 4RF0A 2H88B 3HVZA 4OVUA 4C80A 1YN5A 1RYJA 1KM7A 1QT9A 2OEDA 1BUIC 1EWCA 2QMTA 2QCZA 4JWSC 3A1QA 2NPTB 4L1BA 1I4RA 3PHXB 3JSVA 1P9DU 2DZMA 2WXOA 4KVGB 4KX6B 4A3OA 3UQAA 2RPQA 3PRPB 2O6VD 3ML8A 1QLBB 5G5GA 2D10A 4K3BA 2LHEA 5IKCM 4KIKA 3NZSA 2BS4B 1L4ZB 1S3SG 3WANA 3GZNI 1E6EB 4RGNA 3NZ3A 4DWFA 2Y5PA 1NEKB 1A5RA 4B0MA 4FA6A 3SU8X 3T8MA 3HM3A 4YTPB 4K7WA 4K81A 2NBWB 1HQRD 1WX9A 1SEBD 3T3NA 5E6JA 3NS1A 2LZ6A 1WX8A 1OFFA 3ZRFA 1YIWA 2JYTA 1SF0A 3TIXA 2MBEA 3GB1A 3OJ4B 4BKTA 1K8RB 2PE6B 4LNKA 4N58A 2AL3A 2IZVB 3N9YC 1PFDA 1R4MI 1EWYC 1FFUA 2INCC 4J3OD 1J7CA 1V9JA 3NVVA 2O6VA 3RNAC 3IT4B 4LJPB 1KJTA 2N1VA 1NI3A 4DBGA 3TSSA 4AQ7A 1E90A 3VR9B 2IO1B 2K8CA 4LNOA 2KOXA 3JW0X 4RF1A 1F2RI 4PYZA 4W9HA 4N59A 2HTHA 1L0YB 4WIPA 4FJYA 1K53A 1SGHA 1OGWA 4DDID 4W9FA 3U2SC 3PT2B 3RCZA 3Q14C 2WS3B 4E3CA 3AE1B 3MP9A 2CU1A 2CHXA 1XLPA 2DYBA 3FKYA 4Q2JA 4L2YA 2KJ6A 1JQ4A 3ZO5B 1DYQA 3EFUA 2INPE 3URYA 4A90A 1R7SA 2E6XA 2K8BA 1OTRB 1FXIA 3N30A 1I42A 2WGSA 4PS7A 4KKJA 3C19A 3P4RB 1QQRA 3B0AA 2M56B 3PLUA 3H1UA 2XNAC 4II3B 3MTNB 2OHFA 4EE2A 4G0NB 3KWLA 4W9IA 2MA9B 2Z0DB 3RFZB 4HLEA 3UINB 3ALBA 3LYYA 4AOFA 3OG5A 1QOFA 1L0VB 3B08A 1C4CA 3HRDD 3Q8AA 3APFA 2LVOA 2PW9A 4CHKA 2WXJA 2ZW1A 2N0SB 2Y5CA 2NVUI 3L16A 4KDIC 1FIQA 1T0SC 4F7ZA 1F77A 2FUHB 2G45B 4RH6A 1Z5SB 4JX1C 2KJHB 2BF8B 4BBNF 5LXIB 1D5ZC 5AZFA 4XWWA 1JWMD 1XCQL 2J0KA 5AZHA 2DZKA 2JZ3B 1LGRA 3L08A 2J7QB 1C76A 1TIFA 4NQKE 1E7VA 1VDVA 4HPMB 1WGHA 2JF5A 4EZKA 4GDLA 3KUZA 1FRDA 3AE3B 1T0YA 4F1SA 1IUEA 3HIZA 2XEWA 3DBLB 2LMCA 1RFKA 2G9HD 2IO0B 1XLQA 2J52A 3A9JB 2WXMA 2V1YA 1RWSA 1AN8A 1E8ZA 2KTFA 4ZRKA 1JRUA 1C77A 4S0RA 3X0WA 3VRAB 2WXKA 1QF6A 3ZXRA 2SAKA 4IOIE 3NY5A 3VUYA 3DDCB 2VRRB 2PVOD 3U7ZA 3EA6A 3VAWA 2VZKD 1SIJA 3ONSA 3RNFC 1VD2A 3DWGC 2DAJA 4MGYE 5J2RA 4FJVB 1TKYA 2N9KA 2W54A 4N9F4 1V97A 3AE7B 1HZ6A 1TJEA 5IO9A 1TKGA 3N1XC 4JLCA 1Z2MA 2C9WB 3ZXVA 3RUIB 3EHVA 3BYTB 1MHHE 1YQBA 2RD0A 3PHWB 4B9KA 2DWQA 1RFAA 2Z59B 1L4DB 4ACFA 3QX1A 3AEGB 2KAJA 2GB1A 1C78A 4WWOA 1TS4A 2ZW0A 5BMIA 1ESFA 3AU5A 1TBEA 2KQ7A 1UGMA 2WXGA 1P3QU 1CK1A 3H6NA 2V3PA 2GBKA 2NPTA 4KSKC 1UD7A 1TZOA 4WAAA 4RM8A 5D94A 3MC0B 2K8HA 2DZIA 1PUTA 2DX5B 2QIEB 1LXDA 2QILA 1UH6A 3IFWB 2KWDA 3SFDB 1L6UA 5LLIA 5DPSA 4A8XC 4GU2A 4NJ7A 1NDDA 2BPSA 3HK0A 2XK5B 2AL6A 2LFIA 3PREA 1C79A 2JWZA 4OZAA 5GXGB 1PGBA 2NBVB 2JQRB 2KJRA 1ZDVA 4HPPA 4M00A 4E74A 2KQSA 4XYCA 1SJED 3ABVB 4ITKA 2NR2A 4JPSA 1TGZB 3HHMA 2EKIA 1YX6B 3P4SB 1WI0A 4IUMB 4K7SA 4YSXB 2JWUA 1IBXA 3DBLI 1XEEA 4A20A 1V1PB 3RI7C 3ZW3A 4DHZB 2KLGA 3DWMA 1TS3A 4PS3A 3M63B 4MDKE 1R4NB 5D6JB 4BZAA 2KANA 1SBBB 3V6EB 1AYFA 4FULA 1TY2A 4JGHB 1WY8A 4IG7B 2LASA 1F9JA 1FMAD 1AW7A 2HJ8A 3U52E 4S17A 1WXVA 5AEKB 4MEMA 4HRSA 2MRPA 2VH2A 1ROEA 2KWCA 2FNJB 4MACA 3SD5A 1MFWA 3HVDA 1FXTB 1JALA 2R61A 3VTVA 3PRMB 3WCQA 3EGRA 2JX5A 2L0FA 1X1MA 1N5XA 3ZNHB 1F2RC 2IGHA 1ZP0B 4BOSC 4DXAB 2L8JA 3VVWB 3DBHI 4DHJB 1WMHB 4HKQA 1D3ZA 2CJNA 2JU6X 3AECB 4GN1A 4AUQC 3DQVA 4BOZB 3Q3OC 4P1CC 3E56A 3V62A 2LVPA 4IM2A 1JWSD 2LJIA 3V60A 4HROA 3ENEA 4MJSA 5E6NA 4HK2A 2BS3B 2WQYB 2W82A 2FCQA 2K22A 2ZNVB 1XT9B 2L32A 2AYOB 4WWPA 2FE8A 2KC1A 3ML9A 1UGJA 3Q3MC 2NTSA 2INNE 3VDZA 1BT0A 1XF5L 3KWVA 1WE7A 5JHBA 1OQRA 4IC7B 2KT7A 2L7RA 3ZDTA 2RDBC 3K9PB 1M94A 4JL9A 5L83A 3U30A 2LGXA 1PYWD 3MJ5A 2MP2A 3SFEB 1EUVB 5G55A 2KTRB 4RMAA 4W9EA 4H2AA 2JRIB 3L17A 3ZTCA 3VH3B 1FNVA 3RT3B 2I2YA 4US9A 3NS8A 1K51A 4FJZA 3P4PB 3DBRB 3WALA 2KACA 2DHZA 5HKHA 3N1YC 3RZFA 1KLVA 2KFKA 2W3RA 4LCDE 5MPOA 1T0QC 2EMSA 1QOGA 3JYUA 1V80A 1EF5A 2ZZPB 2LGYA 2FCSA 3VR8B 4LK0M 5BO4B 2BYFA 4TSSA 1XLOA 4OHJA 4YL8A 3D32A 2LGSA 4YSZB 2KMMA 2LRWA 3PGEA 2RPVA 1JMLA 2KDBA 1ZGUB 2HE7A 4LDTD 4K3CA 4M0WB 4ANVA 3CIRB 4XWTA 4MSQB 3H7PA 1CMXB 1JROA 2QDFA 1FD6A 1R4NI 4WAFA 2ZPYA 5G5HA 1D6EC 1OEYA 5CHFA 4BBNC 2WX0A 4WH4A 5HHDG 2ZEQA 4FHKA 4IKGA 5EE0A 2D3AA 1WIAA 2O2VA 4I6NB 4USAA 4HKZE 2D11A 3NJTA 2IBIB 2GBJA 5IN7A 1VRAB 2BVCA 1BXTA 1KTKA 2IO3B 1IGCA 4WWMA 2WXFA 3H8HA 4NAWA 1J0GA 2CHWA 3I5JC 1L0XB 3QJZA 1YMHE 4DXFA 5HI1A 3CMMB 2XBBC 4AWJA 5HFYA 2OJRA 2MJDA 5DPRA 1KF6B 4GDKB 2KVRA 3GOEA 5DPWA 3AEDB 2KK8A 2YLMA 4DQOC 1QKZA 2KMAA 2JXTA 4EKUA 1SE9A 5AUKA 2ONQA 3DVGY 1FFVA 1LQBA 1WXAA 3AEAB 3L54A 2MBBB 3UGBB 1A70A 2FUG1 2IPKD 3RD2A 2GOWA 1ACCA 4ZYSA 4REZA 2HJ1A 2R2QA 2QSDA 4FXCA 3RNEC 3N3KB 1E8YA 1TT5B 1G6JA 2WDTB 1YNTE 3IBEA 3PVLA 5H8YE 3SHQA 1WXMA 2JT4B 4CYEA 1EF1A 2OJWA 1S1QB 3NRZA 2N9XA 3BINA 4HJGE 3Q6BA 3OJ3A 5C2TB 3ZRCA 3DBRI 4DXGA 5LXHA 3AEEB 4A55A 1GB1A 2IY1B 3A9KA 3B2GA 5L95C 2WP9B 2QEJC 1E9MA 3Q2AC 4YXDB 1FCLA 2H89B 4WJPA 1D5MC 1FO4A 1I35A 3RULA 3AEBB 2DLBA 1WJ4A 2KN5A 4LJOB 1QOAA 3T3OA 2BYVE 2WHIA 4W9GA 3SDLC 1UWXA 3FILB 1D4BA 1J8CA 1Q10A 3ZNZB 2WXLA 3KW5B 2R2OA 3LXFA 3N1ZC 1I4XA 2X38A 4MM3B 1MHXA 3AE2B 3E9SA 4TQ0A 4PT5A 4FADA 2M17A 4WWNA 2CKHB 2M4NA 3BK2A 3W2DA 5FK9C 1XQQA 3AEFB 1YOVB 1WX7A 4W9JA 3MHSD 4GSWA 2ZVOA 2I1KA 2HTME 2FIFA 4P6VF 1ZUD2 4PK1A 2WDRB 3I63C 3ZUNA 2J42A 1WWTA 2V4IB 1V6EA 3ZYYX 4C4VB 4HJKA 2KC2A 1N5WA 3FAHA 3ECIA 2MJ3A 5AUIA 2UWQA 2MBOA 2AWTA 1FEHA 1I4HA 1QILA 1E8WA 3BVGA 2BBCA 3R8BA 2MQJA 3L0WB 5J18A 2INDC 2Z8LA 2CS4A 3I9V1 3VHTC 1C1YB 1N61A 2K1FA 1UBIA 5EDSA 2KDIA 2IJ0A 4B6WA 2IGGA 1TKEA 1MG4A 4GLSC 2PKOA 1JW9D 4XDCA 2BT6A 1KOTA 1C4PA 5HG2A 3MHZA 3GE3C 4ZRPA 3TL5A 2IO2B 1JWUD 2DYMA 1OQYA 4E71A 4KKIA 2AX5A 2WLBA 1L5PA 2FIDA 3Q3FA 4ZOHC 2LXAA 4TKNA 3VQIA 2MH7A 3DHGC 3WA0A 3BY4B 1FRRA 1V1OA 3TEWA 2DNFA 4KSLC 3W5VB 1V81A 2KMCA 2BYEA 3RNGC 2I38A 1P7EA 3A1QB 4MGIE 2C7HA 3U7DA 5D7GA 2PJHA 3JSVB 5IAAC 4B0EA 3W9CB 2Y5BB 2D5GA 2MHJA 4RCOA 4AJYB 5EE3A 4URKA 4EFOA 4KIKB 3UF8A 5BYSA 4G11A 3B9JA 1WRIA 3TJPA 1HTQA 2XN9C 5J17A 2VH1A 3DCGA 3BWUD 3DBSA 2G3QB 2LGDA 2NS5A 2RDGA 2KWUB 2J4XA 4ZDVA 1WJ6A 3ETRA 3EC8A 4RGOS 1E10A 1JRPA 1YD8U 1YJIA 1ENFA 3AB5A 4IWQA 1H8CA 4GOCA 3N32A 1TYGB 3ZJVA 2PIAA 2Y3AA 3WAPA 1Q1OA 3UIOB 5AZGA 4OZCA 1WGRA 2X8XX 4JIOU 4JE3B 3MFGA 1XLNA 5CHVC 1STEA 2O6VB 2GI9A 4O1NA 4RFBA 4GXBA 2V9HA 2BTEA 4KZ0A 1Y56A 1FXAA 4ZHOA 1L7YA 3V6CB 4JQWC 1Q5WB 1TTNA 4P1BC 1WYWB 2K6QA 2RMMA 2M0AA 3ZTDA 3AMZA 2ZCBA 3AM9A 1P98A 1WZ0A 3T9LA 2M8SA 2FAZA 2LD9A 1N63A 4NQLB 1HEZE 4A9AA 2G1EA 4W9CA 2JY6A 3AE8B 3B2FA 4ZRQA 2BKFA 2K0PA 5DCNA 2N4FA 1IYFA 3N20C 2D3BA 2LXCA 4YT0B 1SB3C 5FKAC 2G4SA 2OOBB 2RR9A 2CR5A 1B9RA 4TV3A 2DAFA 3HUIA 4YSYB 1L6VA 2DZJA 1N62A 4MH0E 1IGDA 1ISNA 4G50A 3BK1A 1DOYA 4DK5A 3KYCD 1BMLC 2UU7A 1YN3A 2KN4A 4LNFA 3OLMD 2ZNVC 3NHEB 1ET9A 1VR9A 3PLVA 2L3ZA 1CZPA 2PPHA 3QA8A 2NTTA 4NZLB 5IOIA 2M1MA 2N7EA 3PSEB 2GBNA 3ZDMC 3APDA 4A3PA 3IAM1 2IY0B 5E6OA 1FPYA 4MH8A 3QAQA 1WR1A 2DBYA 2I1JA 1PGAA 4US8A 3GS2A 3PTFC 4II2B 2MBQA 1FCCC 3PV1A 2NMQA 2JUOA 3V61A 2AQ1B 2J53A 2HD5B 4W9KA 2ZJDA 4WQMA 5BYQA 3A4RA 3M3JA 3HM6X 4NJ6A 1GG3A 3P2BA 1I4GA 2BWFA 2WXPA 1SXTA 1NYRA 4MM3A 3KVFB 2LUMA 2NBUA 3NZUA 4XGAB 3R66C 1PQSA 2JSVX 2FBWB 1YN4A 2D07B 4LNIA 1WYGA 4I6LB 1J19A 1GC6A 4X57B 2PMVA 3TEZA 4TQ1A 3IT6B 1MI0A 3NUHB 1LM8B 5BMGA 2L0TA 3AN1A 3ZNGC 5KHOA 1F0ZA 3KYDD 2KWVB 5GMVA 4YWGG 4C4VA 1T0RC 3V05A 4OZBA 1WFYA 2JVCA 2N9PC 1DOIA 3L4PA 2UYZB 2PEAA 1GNUA 1V49A 4XZ4A 2BQQA 1WJNA 3NG0A 3VXWA 1GC7A 5BMHA 1WSPA 1XCTL 3NOBA 3QARA 3CSFA 4HPLB 2JZPA 1J7BA 2BB6A 2L1AA 1NVID 5C3JB 1JWAD 3AULA 4LLGM 2AQ2B 2B76B 3C0RB 2KD0A 3A4SC 3A9JA 3M95A 4EZLA 3AE6B 2KO3A 4AP4C 4FHJA 1C9FA 4ZRJA 1F52A 5JH5C 3Q3JA 2N9EB 1SSNA 3W1SC 3UQBA 3VTWA 3CSTA 1WF9A 3P63A 3DPDA 3RMKC 2KXJA 1V5OA 2AEHA 1F1HA 5CHWA 3A33B 4IM3A 2B3AA 4XX5A 1QOBA 3SEBA 2VZKB 1ET6A 4MELA 1FNUA 3PRZA 2KDEB 1IP9A 1WGKA 3GE8C 3Q8EA 2BYTA 1H4RA 3V3XA 5FR6A 3ZQ4A 2KQ4X 5EE9A 2LUEA 3DVNU 3IHPC 4ASWC 2DENB 2D2QA 3BZDB 3PZDA 2EMTA 3ZJTA 4WQOB 4ANWA 3X23A 3O13A 2RDHA 3CF6E 4NY0A 3U8ZA 4GIVA 1EM7A 4EOYA 1LO5D 1UBQA 4NPNA 2JPHA 2C5LC 4GGQA 3PZ7A 1VLBA 3AV8A 3RNBC 2C60A 3UIPB 3EECA 1KLUD 1YQ4B 1SJHD 5JXVA 1VCBA 1TZ1A 1DOXA 2YVCA 4HDOA 2LEKA 1WGGA 1D5XC 1N60A 1IBXB 4YTNB 2WXNA 1WE6A 4AS1A 3VUXA 4WJNA 2XK5A 2PVGC 1ZE3D 3DVGX 4TMAB 3PO0A 2LI5A 3DVNV 4XE0A 2MSED 3AXCA 5C23A 2A5UA 2V3NA 4WJQA 4F8CB 3TCAA 1EU4A 4KGTA 3IXSA 4BKSD 1PGXA 4KGRA 4D2KA 2BW2A 3RN9C 1WM3A 3APCA 2JRHA 3Q3NC 3GP7A 4FN2A 2KKCA 4NAMA 3L10B 1NENB 1ZXIA 4TUUA 2ASQA 4W9DA 1WR6E 1M4VA 4DHJD 4HXDA 2N9LA 2AQ3B 1V1PA 2KYWA 1LFDA 1RLFA 1AWDA 1YJJA 3NVYA 1DGJA 3PZ8A 2MWSB 3ZGZA 2L00B 2GBRA 2WXIA 1TS5A 2ZPNA 3TUOA 3QCAA 2WXQA 3R2IA 4MJSB 4HCPB 1WJUA 4PS8A 3S2AA 3VFKA 1KFYB 2W55A 2GLSA 2MCNB 1TS2A 1MVKA 1TY0A 2YEPB 2Z0EB 4BKSA 3QWZB 1MJDA 3Q8BA 2WDQB 1NI2A 5T8IA 1E7PB 1V5TA 4C56C 1XXGA 3CWIA 4ARCA 2ZCCA 3ZVVA 1SE4A 2WDVB 1E8XA 1ZDXA 2L83A 2MP2B 1WMHA 1YX5B 2A4ZA 4LTUA 2K25A 1WXSA 4A6QA 3BYYB 1T3QA 2JZZA 4UDUC 4P16A 2M0XA 3ZKJC 1C4AA 4RM9A 4LNNA 4RGTA 2FCNA 1WRDB 2C7MB 5G2NA 3KUDB 5BYRA 4WURA 4M01A 1E7UA 2BWES 1N6ZA 5IA7A 2KFKB 1SIFA 4PYUA 3O65B 2CJOA 4RGMA 1I4PA 2K39A 2BGFA 1EO6A 1T5XD 3TBLD 2CHZA 3L13A 1FNWA 5H92C 4GB9A 1UUPA 1JCKB 2RGFA 1VZ8A 5I4DA 3VRBB 4WJOA 4IWOA 3P1MA 3TMPB 2WU2B 1SE2A 1WM2A 1ZW7A 1KLGD 3WAMA 3C8YA 3ZLZA 1J7AA 2V4LA 3H7PB 5E6PA 1MG8A 2KX3A 4B95A 2KTRA 4QAYA 4HWIB 5JZEB 1AARA 2KLCA 2E3TA 3AE9B 2MJEA 4EUTA 3BIID 1KH0A 1FM0D 3LDZE 2O2VB 2G4DB 2N7JA 2K5PA 1QZEA 2PE9A 4M8MA 3FC4A 3VUWA 4C7ZA 1UWMA 1RRBA 4C7YA 3VH4B 2CU3A 4DHZE 3AH7A 3ZIMA 4NAWB 2EKEC 4FBJB 4CO7A 2KFJA 2C7NB 4KDLB 3Q8FA 1YJ1A 1P1AA 2K9XA 3DOWA 1WGYA 2REXA 2QJLA 1JWBD 3DBHB 2GBMA 2KNBA 4M0WA 1ZXHA 4ZRIA 1XO3A 4LDTB 1E5WA 3TEXA 5CTRC 2YEPF 1HZ5A 1VZ6A 2SEBD 4ARIA 3UI3A 3Q8CA 3DHIC 3NVWA 2MLBA 4ICVA 2ACZB 2LWPA 5CX3A 2TSSA 3VTUA
chains in the Genus database with same CATH topology
1SXTA 2WXJA 2ZW1A 2N0SB 1NYRA 2Y5CA 2W3SA 2LUMA 5HFYA 2MJDA 1KF6B 1FIQA 4GDKB 1B1ZA 2JSVX 3AEDB 2FBWB 1F77A 1YN4A 1E0ZA 4DQOC 1QKZA 1WYGA 3BVZA 4IDIA 4RH6A 2JXTA 3R2TA 4JX1C 2L52A 1D5ZC 3SR6A 4CQNA 2PMVA 4XWWA 3TEZA 1JWMD 1XCQL 5EE1A 5AUKA 2ONQA 1ZPSA 1FFVA 4TQ1A 3IT6B 1MI0A 5LNK1 3AEAB 3NUHB 1C76A 5BMGA 1A70A 3AN1A 1VDVA 1YQ3B 2FUG1 2IPKD 2PTLA 1F0ZA 1ACCA 1KRHA 4ZYSA 4REZA 4YWGG 1FRDA 1UNSA 3AE3B 2QSDA 4FXCA 3V05A 4OZBA 4OW0A 3TEYA 1DOIA 1P7FA 4OVZA 1IUEA 1YNTE 3L4PA 4XDDA 2BS2B 5D3DA 3ZJUA 5H8YE 2LMCA 1RFKA 2G9HD 1HA5A 1XLQA 2J52A 2WXMA 3W1SA 3NRZA 5BMHA 1RWSA 1WSPA 1XCTL 1AN8A 4HJGE 2JZPA 1PDXA 1J7BA 2BB6A 4KGSA 5C2TB 4DXGA 2L1AA 3AEEB 4A55A 1NVID 2KDMA 2PLPA 2ICIA 1GB1A 1C77A 3B2GA 1VZ7A 4RNAA 3IAS1 2WP9B 2QEJC 2WXKA 1E9MA 3VRAB 5C3JB 1QF6A 1JWAD 4YXDB 1FCLA 1K50A 2SAKA 2H89B 4IOIE 1D5MC 4LLGM 1FO4A 2AQ2B 2DYOA 1I4QA 2PVOD 3U7ZA 1WXQA 3Q69A 2B76B 3AEBB 2DLBA 1QOAA 3NVZA 3EA6A 3KLSX 3T3OA 2VZKD 1SIJA 3DWGC 1UWXA 3AE6B 4MT5A 3FILB 1D4BA 1CQVA 1TKYA 1Q10A 2N9KA 2W54A 1V97A 3AE7B 1C9FA 1HZ6A 1TJEA 2WXLA 1TKGA 3LXFA 1I4XA 2WNMA 2X38A 4MM3B 1RM6C 1MHXA 1EU3A 3AE2B 1SSNA 3BYTB 3E9SA 3J9CA 1MHHE 3P63A 1OQQA 4TQ0A 4PT5A 4JWUC 2DWQA 1GOZA 1L4DB 3U4EG 1QOBA 3SEBA 3AEGB 2VZKB 2V0GA 1ET6A 3BK2A 3W5UB 3W2DA 1FNUA 5FK9C 3FILA 3AEFB 2KAJA 2WU5B 4L23A 2GB1A 1V8CA 1C78A 1TS4A 1WGKA 3Q8EA 2BYTA 4R3DA 3V3XA 2ZW0A 1VJKA 5BMIA 1GB4A 1ESFA 2HTME 3ZQ4A 2KQ4X 5EE9A 1GAQB 4P6VF 1ZUD2 2WDRB 2WXGA 1K52A 2J42A 1CK1A 1WWTA 2V3PA 2V4IB 4N6EB 4GDLB 1I7HA 3ZYYX 1TZOA 3LB8C 3EUB2 3OWEB 3BZDB 1N5WA 3MC0B 3ZJTA 3FAHA 1T6BX 2MJ3A 5AUIA 3O13A 3P4QB 1PUTA 2EELA 2QIEB 2RDHA 2QILA 4ZHPA 1MPEA 1FEHA 1EM7A 1I4HA 1LO5D 1QILA 2BBCA 3BVGA 3R8BA 2KWDA 3SFDB 4YTMB 1L6UA 4A8XC 2Z8LA 3I9V1 1N61A 1SE3A 3PZ7A 2IDYA 1VLBA 3AV8A 2IJ0A 3I57A 3BVMA 2IGGA 1TKEA 2LFIA 3P42A 5FR3A 2HDEA 1C79A 4GLSC 2PKOA 1KLUD 1YQ4B 1JW9D 4OZAA 1SJHD 1PGBA 5GXGB 5JXVA 4XDCA 2JQRB 2M19A 2K3UA 5D3IB 1DOXA 2BT6A 1ZDVA 2LEKA 1C4PA 5HG2A 1D5XC 1N60A 3MHZA 3AE5B 1CJEA 2BB5A 4ZRPA 1IBXB 1JWUD 2LHDA 4YTNB 2WXNA 2DYMA 3AE4B 4AS1A 4KKIA 2IGDA 2AX5A 4NJCA 1SJED 2WLBA 1L5PA 4ZOHC 3ABVB 1NYQA 4ITKA 3VQIA 4JPSA 1GPXA 2MH7A 1ZE3D 2PVGC 4TMAB 3PO0A 1HXYD 2EKIA 4XE0A 1FRRA 1V1OA 3TEWA 2WXHA 5TSSA 4HEA1 3P4SB 2V3NA 4YSXB 3W5VB 2GRIA 3RPFC 1EU4A 2JWUA 2LGIA 4KGTA 1IBXA 2I38A 1XEEA 3IXSA 1V1PB 1P7EA 1PGXA 4KGRA 4D2KA 2BW2A 3DWMA 3KQ4A 5D7GA 1ZOYB 3GP7A 4B0EA 3W9CB 1TS3A 2JYEA 2D5GA 4NAMA 4RCOA 1NENB 2WXRA 2ON8A 1ZXIA 5EE3A 1SBBB 1M4VA 1AYFA 5BYSA 2MEKA 2Q5WD 4RF0A 3B9JA 2H88B 3HVZA 1TY2A 4C80A 1YN5A 1RYJA 1FMAD 2N9LA 1AW7A 1WRIA 1QT9A 2AQ3B 1V1PA 2OEDA 3U52E 1BUIC 1EWCA 2QMTA 2XN9C 4HRSA 4JWSC 1ROEA 1AWDA 1YJJA 4L1BA 1I4RA 3NVYA 4MACA 1DGJA 3PZ8A 3BWUD 2WXOA 4KX6B 3HVDA 3ZGZA 1JALA 2WXIA 1TS5A 3TUOA 2R61A 2RDGA 2WXQA 3R2IA 2J4XA 1QLBB 3ETRA 5G5GA 3WCQA 3EGRA 4RGOS 1E10A 2JX5A 2LHEA 1JRPA 1N5XA 1F2RC 1KFYB 2IGHA 1ZP0B 2W55A 1YJIA 1ENFA 2BS4B 4HKQA 1L4ZB 2CJNA 1TS2A 1E6EB 2JU6X 3AB5A 3AECB 1MVKA 4RGNA 3NZ3A 1TYGB 3ZJVA 2Y5PA 1TY0A 2YEPB 1NEKB 2PIAA 2Y3AA 3E56A 3Q8BA 2WDQB 5T8IA 4B0MA 4OZCA 1E7PB 4YTPB 1JWSD 4C56C 1XXGA 3CWIA 2LJIA 1HQRD 4JE3B 3MFGA 4ARCA 4HROA 1SEBD 1XLNA 1SE4A 1STEA 2WDVB 3T3NA 5E6JA 2GI9A 2BS3B 3NS1A 1ZDXA 2L83A 1OFFA 2W82A 2WQYB 4O1NA 4RFBA 2K22A 2JYTA 2L32A 1SF0A 4LTUA 2BTEA 2FE8A 1UGJA 1Y56A 3GB1A 4A6QA 3BYYB 2NTSA 1FXAA 1T3QA 2INNE 4UDUC 4P16A 4ZHOA 1C4AA 1XF5L 3KWVA 4RGTA 1OQRA 4N58A 5BYRA 4WURA 2RMMA 2M0AA 3N9YC 1PFDA 1EWYC 3AMZA 1FFUA 4J3OD 1J7CA 3AM9A 3NVVA 2CJOA 4RGMA 1PYWD 3IT4B 1I4PA 3MJ5A 3SFEB 1T5XD 1N63A 1FNWA 5H92C 1NI3A 1HEZE 1UUPA 4H2AA 4A9AA 3TSSA 1JCKB 1VZ8A 2G1EA 1FNVA 4AQ7A 3VR9B 5I4DA 2I2YA 4US9A 3AE8B 3B2FA 4ZRQA 1K51A 2K0PA 3VRBB 3P4PB 3P1MA 2WU2B 4RF1A 2KACA 1SE2A 1F2RI 1SB3C 4YT0B 5FKAC 4N59A 1KLGD 1L0YB 4WIPA 3C8YA 1B9RA 2W3RA 5MPOA 1J7AA 1QOGA 1K53A 3HUIA 4YSYB 1L6VA 1N62A 3VR8B 4LK0M 3U2SC 1IGDA 4TSSA 1XLOA 4OHJA 3BK1A 2E3TA 2WS3B 4YSZB 1DOYA 3AE9B 2MJEA 3AE1B 3BIID 1KH0A 1FM0D 3MP9A 2KMMA 1BMLC 1XLPA 2RPVA 4Q2JA 2N7JA 1JMLA 2K5PA 4L2YA 1YN3A 1JQ4A 3FC4A 2KN4A 1DYQA 4C7ZA 1ET9A 1VR9A 3CIRB 4XWTA 1UWMA 2INPE 3URYA 4A90A 1R7SA 4C7YA 2E6XA 1CZPA 2CU3A 1FXIA 1JROA 1FD6A 4WAFA 3AH7A 5G5HA 1D6EC 2NTTA 4NZLB 4NAWB 4KKJA 4DXFA 3P4RB 1QQRA 3IAM1 3Q8FA 2K9XA 4WH4A 4MH8A 2M56B 5HHDG 4IKGA 5EE0A 2DBYA 4USAA 2QJLA 2XNAC 1JWBD 4HKZE 4M0WA 1PGAA 1ZXHA 4US8A 2OHFA 4EE2A 1XO3A 3KWLA 3TEXA 3RFZB 2YEPF 3GS2A 1HZ5A 1VRAB 1VZ6A 3LYYA 1FCCC 2SEBD 1BXTA 1KTKA 3UI3A 4ARIA 1IGCA 2NMQA 3Q8CA 4WWMA 2AQ1B 2J53A 2WXFA 3NVWA 4WQMA 3H8HA 1QOFA 2ACZB 5BYQA 1L0VB 1C4CA 3HRDD 3Q8AA 2TSSA 1L0XB 1I4GA 1YMHE 2PW9A 2WXPA 5HI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LXF A;  2N0S B;  1J7C A;  3AM9 A;  3NVV A;  1NYR A;  2Y5C A;  2W3S A;  1RM6 C;  2CJO A;  3AE2 B;  2MJD A;  1KF6 B;  3DWM A;  1FIQ A;  3SFE B;  3P63 A;  1N63 A;  5H92 C;  1ZOY B;  1OQQ A;  4JWU C;  3AED B;  2FBW B;  3W9C B;  1NI3 A;  2DWQ A;  4A9A A;  1E0Z A;  1WYG A;  2G1E A;  4IDI A;  3VR9 B;  1NEN B;  1QOB A;  4US9 A;  4JX1 C;  1ZXI A;  3AE8 B;  3AEG B;  3B2F A;  3VRB B;  2L52 A;  3P4P B;  3W5U B;  3P1M A;  5EE3 A;  3SR6 A;  3AEF B;  2KAJ A;  2WU5 B;  2WU2 B;  1AYF A;  1V8C A;  1SB3 C;  2Q5W D;  4YT0 B;  3B9J A;  2H88 B;  5EE1 A;  3HVZ A;  1WGK A;  5AUK A;  1FFV A;  4C80 A;  4N59 A;  1VJK A;  1RYJ A;  3AEA B;  1FMA D;  2HTM E;  1WRI A;  1B9R A;  1QT9 A;  2W3R A;  5MPO A;  5EE9 A;  1GAQ B;  1A70 A;  1J7A A;  1QOG A;  1ZUD 2;  3AN1 A;  1VDV A;  4P6V F;  2WDR B;  4HRS A;  1YQ3 B;  4JWS C;  1ROE A;  1WWT A;  1AWD A;  1YJJ A;  4ZHP A;  3HUI A;  3NVY A;  4N6E B;  1KRH A;  4YSY B;  1I7H A;  1DGJ A;  3ZYY X;  1F0Z A;  1L6V A;  1N62 A;  3LB8 C;  3EUB 2;  4KX6 B;  3VR8 B;  1FRD A;  1N5W A;  1JAL A;  3AE3 B;  4FXC A;  3FAH A;  1XLO A;  2MJ3 A;  5AUI A;  3P4Q B;  1PUT A;  2E3T A;  2WS3 B;  2QIE B;  4YSZ B;  1DOY A;  1DOI A;  3AE9 B;  1QLB B;  2MJE A;  3AE1 B;  3BII D;  3ETR A;  1IUE A;  1FM0 D;  2KMM A;  5G5G A;  3WCQ A;  4YTM B;  2JX5 A;  1E10 A;  1XLP A;  1JRP A;  3SFD B;  1N5X A;  1L6U A;  1KFY B;  2K5P A;  3L4P A;  1ZP0 B;  2BS2 B;  2W55 A;  1YJI A;  5H8Y E;  2BS4 B;  1JQ4 A;  3FC4 A;  2CJN A;  1N61 A;  1RFK A;  4C7Z A;  1XLQ A;  3CIR B;  1E6E B;  1UWM A;  3AB5 A;  1VLB A;  3AEC B;  3AV8 A;  1R7S A;  3NRZ A;  1RWS A;  1TYG B;  1CZP A;  1TKE A;  4C7Y A;  2CU3 A;  1FXI A;  1JRO A;  2PKO A;  1NEK B;  3AH7 A;  1YQ4 B;  1PDX A;  2PIA A;  1JW9 D;  5G5H A;  5GXG B;  1J7B A;  5C2T B;  2WDQ B;  2JQR B;  2M19 A;  3AEE B;  1E7P B;  1DOX A;  2BT6 A;  1NVI D;  4YTP B;  2LEK A;  3P4R B;  1N60 A;  3B2G A;  3AE5 B;  3CWI A;  3VRA B;  1CJE A;  2WP9 B;  1QF6 A;  1E9M A;  4HRO A;  5C3J B;  1XLN A;  2K9X A;  1JWA D;  2WDV B;  4YXD B;  2M56 B;  2H89 B;  2BS3 B;  3NS1 A;  4YTN B;  3AE4 B;  2WQY B;  2L83 A;  1OFF A;  5EE0 A;  1FO4 A;  2DBY A;  4USA A;  2QJL A;  2AX5 A;  1JWB D;  2K22 A;  2WLB A;  1L5P A;  4ZOH C;  2PVO D;  1WXQ A;  2B76 B;  1SF0 A;  2OHF A;  3ABV B;  3AEB B;  1NYQ A;  4ITK A;  1XO3 A;  4LTU A;  4US8 A;  3KWL A;  1QOA A;  3NVZ A;  1GPX A;  1SIJ A;  2MH7 A;  2PVG C;  1FXA A;  1T3Q A;  3PO0 A;  4ZHO A;  3DWG C;  2EKI A;  1FRR A;  3AE6 B;  4WWM A;  3NVW A;  4WQM A;  1QOF A;  2ACZ B;  1OQR A;  3P4S B;  1L0V B;  1TKY A;  4N58 A;  2W54 A;  3HRD D;  1V97 A;  3AE7 B;  1TJE A;  4YSX B;  3W5V B;  1PFD A;  3RPF C;  1EWY C;  1TKG A;  3AMZ A;  1FFU A; 
#chains in the Genus database with same CATH topology
 4NNJ B;  3K9O B;  5KHQ A;  2W3S A;  3RNC C;  4J6I A;  4EEW A;  4ZYN A;  1B1Z A;  3I3T B;  1E0Z A;  3JVZ X;  1U4A A;  4K7U A;  3BVZ A;  4IDI A;  3R2T A;  1GJZ A;  4MGZ E;  2L52 A;  3H7S A;  4GMV A;  3SR6 A;  4CQN A;  2J0J A;  5EE1 A;  2RSU A;  3R3M A;  3W1Y A;  1ZPS A;  5LNK 1;  2MBH A;  2WWZ A;  2IYD B;  3KUC B;  1YQ3 B;  1V86 A;  2PTL A;  2QC8 A;  3EFC A;  1KRH A;  4GDK A;  1UNS A;  1V2Y A;  2GMI C;  3A9K B;  3KH0 A;  3MC8 A;  3MJW A;  4AJW A;  2LVQ A;  4OW0 A;  3TEY A;  1P7F A;  1C3T A;  4OVZ A;  3R7R A;  2KZR A;  4M02 A;  2BS2 B;  4XDD A;  5D3D A;  3ZJU A;  3QK0 A;  4IWP A;  1HA5 A;  2WYQ A;  3W1S A;  2KDF B;  3ZNI D;  1XD3 B;  1PDX A;  4KGS A;  2V3S A;  4BKG A;  2KDM A;  2PLP A;  4KZC A;  2ICI A;  1L2N A;  1WGD A;  1VZ7 A;  4RNA A;  3IAS 1;  3QC8 B;  2J0M A;  3IG3 A;  1K50 A;  3AI5 A;  1ZKH A;  1GUA B;  2MW5 A;  2DYO A;  4BAX A;  1I4Q A;  1WXQ A;  3Q69 A;  4DDG D;  4IM0 A;  3NVZ A;  3KLS X;  1P0R A;  2D3G A;  4MT5 A;  1CQV A;  1IPG A;  5C1Z A;  1UEL A;  4OVV A;  1WZ3 A;  5TR5 A;  1HE8 A;  5D2M B;  4IW0 A;  2WNM A;  1RM6 C;  2WX1 A;  1EU3 A;  3J9C A;  2N7D A;  4ANX A;  1OQQ A;  3GZN B;  4JWU C;  4K1R B;  2L76 A;  1Y8R C;  1GOZ A;  3U4E G;  2V0G A;  4HVB A;  3W5U B;  3FIL A;  2WU5 B;  4L23 A;  1V8C A;  2QHO A;  4R3D A;  2BKR B;  1VJK A;  2D3C A;  1GB4 A;  2NCN A;  3R7Q A;  1GAQ B;  3H9D A;  1K52 A;  4N6E B;  4FLH A;  4GDL B;  1I7H A;  3QQ8 B;  3LB8 C;  3EUB 2;  3OWE B;  3QIJ A;  2L05 A;  3WIM A;  3PS6 A;  4M8N A;  3DHH C;  1T6B X;  4C00 A;  3P4Q B;  3RYT A;  2EEL A;  3IVF A;  4ZHP A;  2LRU A;  1MPE A;  4YTM B;  2W9N A;  2K6D B;  4HCN B;  1R4M B;  2ZVN A;  1NBF C;  2MX2 A;  1SE3 A;  2IDY A;  3I57 A;  3M62 B;  3BVM A;  3P42 A;  5FR3 A;  2HDE A;  1RAX A;  1Q0W B;  3WAO A;  4ICU A;  2KVZ A;  2M19 A;  2K3U A;  5D3I B;  4EZJ A;  4I6P A;  4G3X B;  5IP4 D;  4XC2 A;  3AE5 B;  1CJE A;  2BB5 A;  2LJ5 A;  2LHD A;  1WH3 A;  3OAW A;  4BFR A;  3AE4 B;  3B1L X;  5JHA A;  2IGD A;  3PPA A;  4NJC A;  4BVU C;  2KX0 A;  1NYQ A;  4MSM B;  1GPX A;  1UZX B;  4MGK E;  4W9L A;  1HXY D;  3QHT A;  2WXH A;  5TSS A;  2JXX A;  4HEA 1;  3RZW C;  1UF0 A;  3AU4 A;  3MC9 A;  2GRI A;  3RPF C;  2LGI A;  4HDQ A;  5DPT A;  2FCM A;  3KQ4 A;  1ZOY B;  4KV2 A;  2JYE A;  1HTO A;  3LJ3 A;  1OEY J;  2N1W A;  2WXR A;  2KHW B;  2ON8 A;  4P7I A;  4ANU A;  2MEK A;  2Q5W D;  4RF0 A;  2H88 B;  3HVZ A;  4OVU A;  4C80 A;  1YN5 A;  1RYJ A;  1KM7 A;  1QT9 A;  2OED A;  1BUI C;  1EWC A;  2QMT A;  2QCZ A;  4JWS C;  3A1Q A;  2NPT B;  4L1B A;  1I4R A;  3PHX B;  3JSV A;  1P9D U;  2DZM A;  2WXO A;  4KVG B;  4KX6 B;  4A3O A;  3UQA A;  2RPQ A;  3PRP B;  2O6V D;  3ML8 A;  1QLB B;  5G5G A;  2D10 A;  4K3B A;  2LHE A;  5IKC M;  4KIK A;  3NZS A;  2BS4 B;  1L4Z B;  1S3S G;  3WAN A;  3GZN I;  1E6E B;  4RGN A;  3NZ3 A;  4DWF A;  2Y5P A;  1NEK B;  1A5R A;  4B0M A;  4FA6 A;  3SU8 X;  3T8M A;  3HM3 A;  4YTP B;  4K7W A;  4K81 A;  2NBW B;  1HQR D;  1WX9 A;  1SEB D;  3T3N A;  5E6J A;  3NS1 A;  2LZ6 A;  1WX8 A;  1OFF A;  3ZRF A;  1YIW A;  2JYT A;  1SF0 A;  3TIX A;  2MBE A;  3GB1 A;  3OJ4 B;  4BKT A;  1K8R B;  2PE6 B;  4LNK A;  4N58 A;  2AL3 A;  2IZV B;  3N9Y C;  1PFD A;  1R4M I;  1EWY C;  1FFU A;  2INC C;  4J3O D;  1J7C A;  1V9J A;  3NVV A;  2O6V A;  3RNA C;  3IT4 B;  4LJP B;  1KJT A;  2N1V A;  1NI3 A;  4DBG A;  3TSS A;  4AQ7 A;  1E90 A;  3VR9 B;  2IO1 B;  2K8C A;  4LNO A;  2KOX A;  3JW0 X;  4RF1 A;  1F2R I;  4PYZ A;  4W9H A;  4N59 A;  2HTH A;  1L0Y B;  4WIP A;  4FJY A;  1K53 A;  1SGH A;  1OGW A;  4DDI D;  4W9F A;  3U2S C;  3PT2 B;  3RCZ A;  3Q14 C;  2WS3 B;  4E3C A;  3AE1 B;  3MP9 A;  2CU1 A;  2CHX A;  1XLP A;  2DYB A;  3FKY A;  4Q2J A;  4L2Y A;  2KJ6 A;  1JQ4 A;  3ZO5 B;  1DYQ A;  3EFU A;  2INP E;  3URY A;  4A90 A;  1R7S A;  2E6X A;  2K8B A;  1OTR B;  1FXI A;  3N30 A;  1I42 A;  2WGS A;  4PS7 A;  4KKJ A;  3C19 A;  3P4R B;  1QQR A;  3B0A A;  2M56 B;  3PLU A;  3H1U A;  2XNA C;  4II3 B;  3MTN B;  2OHF A;  4EE2 A;  4G0N B;  3KWL A;  4W9I A;  2MA9 B;  2Z0D B;  3RFZ B;  4HLE A;  3UIN B;  3ALB A;  3LYY A;  4AOF A;  3OG5 A;  1QOF A;  1L0V B;  3B08 A;  1C4C A;  3HRD D;  3Q8A A;  3APF A;  2LVO A;  2PW9 A;  4CHK A;  2WXJ A;  2ZW1 A;  2N0S B;  2Y5C A;  2NVU I;  3L16 A;  4KDI C;  1FIQ A;  1T0S C;  4F7Z A;  1F77 A;  2FUH B;  2G45 B;  4RH6 A;  1Z5S B;  4JX1 C;  2KJH B;  2BF8 B;  4BBN F;  5LXI B;  1D5Z C;  5AZF A;  4XWW A;  1JWM D;  1XCQ L;  2J0K A;  5AZH A;  2DZK A;  2JZ3 B;  1LGR A;  3L08 A;  2J7Q B;  1C76 A;  1TIF A;  4NQK E;  1E7V A;  1VDV A;  4HPM B;  1WGH A;  2JF5 A;  4EZK A;  4GDL A;  3KUZ A;  1FRD A;  3AE3 B;  1T0Y A;  4F1S A;  1IUE A;  3HIZ A;  2XEW A;  3DBL B;  2LMC A;  1RFK A;  2G9H D;  2IO0 B;  1XLQ A;  2J52 A;  3A9J B;  2WXM A;  2V1Y A;  1RWS A;  1AN8 A;  1E8Z A;  2KTF A;  4ZRK A;  1JRU A;  1C77 A;  4S0R A;  3X0W A;  3VRA B;  2WXK A;  1QF6 A;  3ZXR A;  2SAK A;  4IOI E;  3NY5 A;  3VUY A;  3DDC B;  2VRR B;  2PVO D;  3U7Z A;  3EA6 A;  3VAW A;  2VZK D;  1SIJ A;  3ONS A;  3RNF C;  1VD2 A;  3DWG C;  2DAJ A;  4MGY E;  5J2R A;  4FJV B;  1TKY A;  2N9K A;  2W54 A;  4N9F 4;  1V97 A;  3AE7 B;  1HZ6 A;  1TJE A;  5IO9 A;  1TKG A;  3N1X C;  4JLC A;  1Z2M A;  2C9W B;  3ZXV A;  3RUI B;  3EHV A;  3BYT B;  1MHH E;  1YQB A;  2RD0 A;  3PHW B;  4B9K A;  2DWQ A;  1RFA A;  2Z59 B;  1L4D B;  4ACF A;  3QX1 A;  3AEG B;  2KAJ A;  2GB1 A;  1C78 A;  4WWO A;  1TS4 A;  2ZW0 A;  5BMI A;  1ESF A;  3AU5 A;  1TBE A;  2KQ7 A;  1UGM A;  2WXG A;  1P3Q U;  1CK1 A;  3H6N A;  2V3P A;  2GBK A;  2NPT A;  4KSK C;  1UD7 A;  1TZO A;  4WAA A;  4RM8 A;  5D94 A;  3MC0 B;  2K8H A;  2DZI A;  1PUT A;  2DX5 B;  2QIE B;  1LXD A;  2QIL A;  1UH6 A;  3IFW B;  2KWD A;  3SFD B;  1L6U A;  5LLI A;  5DPS A;  4A8X C;  4GU2 A;  4NJ7 A;  1NDD A;  2BPS A;  3HK0 A;  2XK5 B;  2AL6 A;  2LFI A;  3PRE A;  1C79 A;  2JWZ A;  4OZA A;  5GXG B;  1PGB A;  2NBV B;  2JQR B;  2KJR A;  1ZDV A;  4HPP A;  4M00 A;  4E74 A;  2KQS A;  4XYC A;  1SJE D;  3ABV B;  4ITK A;  2NR2 A;  4JPS A;  1TGZ B;  3HHM A;  2EKI A;  1YX6 B;  3P4S B;  1WI0 A;  4IUM B;  4K7S A;  4YSX B;  2JWU A;  1IBX A;  3DBL I;  1XEE A;  4A20 A;  1V1P B;  3RI7 C;  3ZW3 A;  4DHZ B;  2KLG A;  3DWM A;  1TS3 A;  4PS3 A;  3M63 B;  4MDK E;  1R4N B;  5D6J B;  4BZA A;  2KAN A;  1SBB B;  3V6E B;  1AYF A;  4FUL A;  1TY2 A;  4JGH B;  1WY8 A;  4IG7 B;  2LAS A;  1F9J A;  1FMA D;  1AW7 A;  2HJ8 A;  3U52 E;  4S17 A;  1WXV A;  5AEK B;  4MEM A;  4HRS A;  2MRP A;  2VH2 A;  1ROE A;  2KWC A;  2FNJ B;  4MAC A;  3SD5 A;  1MFW A;  3HVD A;  1FXT B;  1JAL A;  2R61 A;  3VTV A;  3PRM B;  3WCQ A;  3EGR A;  2JX5 A;  2L0F A;  1X1M A;  1N5X A;  3ZNH B;  1F2R C;  2IGH A;  1ZP0 B;  4BOS C;  4DXA B;  2L8J A;  3VVW B;  3DBH I;  4DHJ B;  1WMH B;  4HKQ A;  1D3Z A;  2CJN A;  2JU6 X;  3AEC B;  4GN1 A;  4AUQ C;  3DQV A;  4BOZ B;  3Q3O C;  4P1C C;  3E56 A;  3V62 A;  2LVP A;  4IM2 A;  1JWS D;  2LJI A;  3V60 A;  4HRO A;  3ENE A;  4MJS A;  5E6N A;  4HK2 A;  2BS3 B;  2WQY B;  2W82 A;  2FCQ A;  2K22 A;  2ZNV B;  1XT9 B;  2L32 A;  2AYO B;  4WWP A;  2FE8 A;  2KC1 A;  3ML9 A;  1UGJ A;  3Q3M C;  2NTS A;  2INN E;  3VDZ A;  1BT0 A;  1XF5 L;  3KWV A;  1WE7 A;  5JHB A;  1OQR A;  4IC7 B;  2KT7 A;  2L7R A;  3ZDT A;  2RDB C;  3K9P B;  1M94 A;  4JL9 A;  5L83 A;  3U30 A;  2LGX A;  1PYW D;  3MJ5 A;  2MP2 A;  3SFE B;  1EUV B;  5G55 A;  2KTR B;  4RMA A;  4W9E A;  4H2A A;  2JRI B;  3L17 A;  3ZTC A;  3VH3 B;  1FNV A;  3RT3 B;  2I2Y A;  4US9 A;  3NS8 A;  1K51 A;  4FJZ A;  3P4P B;  3DBR B;  3WAL A;  2KAC A;  2DHZ A;  5HKH A;  3N1Y C;  3RZF A;  1KLV A;  2KFK A;  2W3R A;  4LCD E;  5MPO A;  1T0Q C;  2EMS A;  1QOG A;  3JYU A;  1V80 A;  1EF5 A;  2ZZP B;  2LGY A;  2FCS A;  3VR8 B;  4LK0 M;  5BO4 B;  2BYF A;  4TSS A;  1XLO A;  4OHJ A;  4YL8 A;  3D32 A;  2LGS A;  4YSZ B;  2KMM A;  2LRW A;  3PGE A;  2RPV A;  1JML A;  2KDB A;  1ZGU B;  2HE7 A;  4LDT D;  4K3C A;  4M0W B;  4ANV A;  3CIR B;  4XWT A;  4MSQ B;  3H7P A;  1CMX B;  1JRO A;  2QDF A;  1FD6 A;  1R4N I;  4WAF A;  2ZPY A;  5G5H A;  1D6E C;  1OEY A;  5CHF A;  4BBN C;  2WX0 A;  4WH4 A;  5HHD G;  2ZEQ A;  4FHK A;  4IKG A;  5EE0 A;  2D3A A;  1WIA A;  2O2V A;  4I6N B;  4USA A;  4HKZ E;  2D11 A;  3NJT A;  2IBI B;  2GBJ A;  5IN7 A;  1VRA B;  2BVC A;  1BXT A;  1KTK A;  2IO3 B;  1IGC A;  4WWM A;  2WXF A;  3H8H A;  4NAW A;  1J0G A;  2CHW A;  3I5J C;  1L0X B;  3QJZ A;  1YMH E;  4DXF A;  5HI1 A;  3CMM B;  2XBB C;  4AWJ A;  5HFY A;  2OJR A;  2MJD A;  5DPR A;  1KF6 B;  4GDK B;  2KVR A;  3GOE A;  5DPW A;  3AED B;  2KK8 A;  2YLM A;  4DQO C;  1QKZ A;  2KMA A;  2JXT A;  4EKU A;  1SE9 A;  5AUK A;  2ONQ A;  3DVG Y;  1FFV A;  1LQB A;  1WXA A;  3AEA B;  3L54 A;  2MBB B;  3UGB B;  1A70 A;  2FUG 1;  2IPK D;  3RD2 A;  2GOW A;  1ACC A;  4ZYS A;  4REZ A;  2HJ1 A;  2R2Q A;  2QSD A;  4FXC A;  3RNE C;  3N3K B;  1E8Y A;  1TT5 B;  1G6J A;  2WDT B;  1YNT E;  3IBE A;  3PVL A;  5H8Y E;  3SHQ A;  1WXM A;  2JT4 B;  4CYE A;  1EF1 A;  2OJW A;  1S1Q B;  3NRZ A;  2N9X A;  3BIN A;  4HJG E;  3Q6B A;  3OJ3 A;  5C2T B;  3ZRC A;  3DBR I;  4DXG A;  5LXH A;  3AEE B;  4A55 A;  1GB1 A;  2IY1 B;  3A9K A;  3B2G A;  5L95 C;  2WP9 B;  2QEJ C;  1E9M A;  3Q2A C;  4YXD B;  1FCL A;  2H89 B;  4WJP A;  1D5M C;  1FO4 A;  1I35 A;  3RUL A;  3AEB B;  2DLB A;  1WJ4 A;  2KN5 A;  4LJO B;  1QOA A;  3T3O A;  2BYV E;  2WHI A;  4W9G A;  3SDL C;  1UWX A;  3FIL B;  1D4B A;  1J8C A;  1Q10 A;  3ZNZ B;  2WXL A;  3KW5 B;  2R2O A;  3LXF A;  3N1Z C;  1I4X A;  2X38 A;  4MM3 B;  1MHX A;  3AE2 B;  3E9S A;  4TQ0 A;  4PT5 A;  4FAD A;  2M17 A;  4WWN A;  2CKH B;  2M4N A;  3BK2 A;  3W2D A;  5FK9 C;  1XQQ A;  3AEF B;  1YOV B;  1WX7 A;  4W9J A;  3MHS D;  4GSW A;  2ZVO A;  2I1K A;  2HTM E;  2FIF A;  4P6V F;  1ZUD 2;  4PK1 A;  2WDR B;  3I63 C;  3ZUN A;  2J42 A;  1WWT A;  2V4I B;  1V6E A;  3ZYY X;  4C4V B;  4HJK A;  2KC2 A;  1N5W A;  3FAH A;  3ECI A;  2MJ3 A;  5AUI A;  2UWQ A;  2MBO A;  2AWT A;  1FEH A;  1I4H A;  1QIL A;  1E8W A;  3BVG A;  2BBC A;  3R8B A;  2MQJ A;  3L0W B;  5J18 A;  2IND C;  2Z8L A;  2CS4 A;  3I9V 1;  3VHT C;  1C1Y B;  1N61 A;  2K1F A;  1UBI A;  5EDS A;  2KDI A;  2IJ0 A;  4B6W A;  2IGG A;  1TKE A;  1MG4 A;  4GLS C;  2PKO A;  1JW9 D;  4XDC A;  2BT6 A;  1KOT A;  1C4P A;  5HG2 A;  3MHZ A;  3GE3 C;  4ZRP A;  3TL5 A;  2IO2 B;  1JWU D;  2DYM A;  1OQY A;  4E71 A;  4KKI A;  2AX5 A;  2WLB A;  1L5P A;  2FID A;  3Q3F A;  4ZOH C;  2LXA A;  4TKN A;  3VQI A;  2MH7 A;  3DHG C;  3WA0 A;  3BY4 B;  1FRR A;  1V1O A;  3TEW A;  2DNF A;  4KSL C;  3W5V B;  1V81 A;  2KMC A;  2BYE A;  3RNG C;  2I38 A;  1P7E A;  3A1Q B;  4MGI E;  2C7H A;  3U7D A;  5D7G A;  2PJH A;  3JSV B;  5IAA C;  4B0E A;  3W9C B;  2Y5B B;  2D5G A;  2MHJ A;  4RCO A;  4AJY B;  5EE3 A;  4URK A;  4EFO A;  4KIK B;  3UF8 A;  5BYS A;  4G11 A;  3B9J A;  1WRI A;  3TJP A;  1HTQ A;  2XN9 C;  5J17 A;  2VH1 A;  3DCG A;  3BWU D;  3DBS A;  2G3Q B;  2LGD A;  2NS5 A;  2RDG A;  2KWU B;  2J4X A;  4ZDV A;  1WJ6 A;  3ETR A;  3EC8 A;  4RGO S;  1E10 A;  1JRP A;  1YD8 U;  1YJI A;  1ENF A;  3AB5 A;  4IWQ A;  1H8C A;  4GOC A;  3N32 A;  1TYG B;  3ZJV A;  2PIA A;  2Y3A A;  3WAP A;  1Q1O A;  3UIO B;  5AZG A;  4OZC A;  1WGR A;  2X8X X;  4JIO U;  4JE3 B;  3MFG A;  1XLN A;  5CHV C;  1STE A;  2O6V B;  2GI9 A;  4O1N A;  4RFB A;  4GXB A;  2V9H A;  2BTE A;  4KZ0 A;  1Y56 A;  1FXA A;  4ZHO A;  1L7Y A;  3V6C B;  4JQW C;  1Q5W B;  1TTN A;  4P1B C;  1WYW B;  2K6Q A;  2RMM A;  2M0A A;  3ZTD A;  3AMZ A;  2ZCB A;  3AM9 A;  1P98 A;  1WZ0 A;  3T9L A;  2M8S A;  2FAZ A;  2LD9 A;  1N63 A;  4NQL B;  1HEZ E;  4A9A A;  2G1E A;  4W9C A;  2JY6 A;  3AE8 B;  3B2F A;  4ZRQ A;  2BKF A;  2K0P A;  5DCN A;  2N4F A;  1IYF A;  3N20 C;  2D3B A;  2LXC A;  4YT0 B;  1SB3 C;  5FKA C;  2G4S A;  2OOB B;  2RR9 A;  2CR5 A;  1B9R A;  4TV3 A;  2DAF A;  3HUI A;  4YSY B;  1L6V A;  2DZJ A;  1N62 A;  4MH0 E;  1IGD A;  1ISN A;  4G50 A;  3BK1 A;  1DOY A;  4DK5 A;  3KYC D;  1BML C;  2UU7 A;  1YN3 A;  2KN4 A;  4LNF A;  3OLM D;  2ZNV C;  3NHE B;  1ET9 A;  1VR9 A;  3PLV A;  2L3Z A;  1CZP A;  2PPH A;  3QA8 A;  2NTT A;  4NZL B;  5IOI A;  2M1M A;  2N7E A;  3PSE B;  2GBN A;  3ZDM C;  3APD A;  4A3P A;  3IAM 1;  2IY0 B;  5E6O A;  1FPY A;  4MH8 A;  3QAQ A;  1WR1 A;  2DBY A;  2I1J A;  1PGA A;  4US8 A;  3GS2 A;  3PTF C;  4II2 B;  2MBQ A;  1FCC C;  3PV1 A;  2NMQ A;  2JUO A;  3V61 A;  2AQ1 B;  2J53 A;  2HD5 B;  4W9K A;  2ZJD A;  4WQM A;  5BYQ A;  3A4R A;  3M3J A;  3HM6 X;  4NJ6 A;  1GG3 A;  3P2B A;  1I4G A;  2BWF A;  2WXP A;  1SXT A;  1NYR A;  4MM3 A;  3KVF B;  2LUM A;  2NBU A;  3NZU A;  4XGA B;  3R66 C;  1PQS A;  2JSV X;  2FBW B;  1YN4 A;  2D07 B;  4LNI A;  1WYG A;  4I6L B;  1J19 A;  1GC6 A;  4X57 B;  2PMV A;  3TEZ A;  4TQ1 A;  3IT6 B;  1MI0 A;  3NUH B;  1LM8 B;  5BMG A;  2L0T A;  3AN1 A;  3ZNG C;  5KHO A;  1F0Z A;  3KYD D;  2KWV B;  5GMV A;  4YWG G;  4C4V A;  1T0R C;  3V05 A;  4OZB A;  1WFY A;  2JVC A;  2N9P C;  1DOI A;  3L4P A;  2UYZ B;  2PEA A;  1GNU A;  1V49 A;  4XZ4 A;  2BQQ A;  1WJN A;  3NG0 A;  3VXW A;  1GC7 A;  5BMH A;  1WSP A;  1XCT L;  3NOB A;  3QAR A;  3CSF A;  4HPL B;  2JZP A;  1J7B A;  2BB6 A;  2L1A A;  1NVI D;  5C3J B;  1JWA D;  3AUL A;  4LLG M;  2AQ2 B;  2B76 B;  3C0R B;  2KD0 A;  3A4S C;  3A9J A;  3M95 A;  4EZL A;  3AE6 B;  2KO3 A;  4AP4 C;  4FHJ A;  1C9F A;  4ZRJ A;  1F52 A;  5JH5 C;  3Q3J A;  2N9E B;  1SSN A;  3W1S C;  3UQB A;  3VTW A;  3CST A;  1WF9 A;  3P63 A;  3DPD A;  3RMK C;  2KXJ A;  1V5O A;  2AEH A;  1F1H A;  5CHW A;  3A33 B;  4IM3 A;  2B3A A;  4XX5 A;  1QOB A;  3SEB A;  2VZK B;  1ET6 A;  4MEL A;  1FNU A;  3PRZ A;  2KDE B;  1IP9 A;  1WGK A;  3GE8 C;  3Q8E A;  2BYT A;  1H4R A;  3V3X A;  5FR6 A;  3ZQ4 A;  2KQ4 X;  5EE9 A;  2LUE A;  3DVN U;  3IHP C;  4ASW C;  2DEN B;  2D2Q A;  3BZD B;  3PZD A;  2EMT A;  3ZJT A;  4WQO B;  4ANW A;  3X23 A;  3O13 A;  2RDH A;  3CF6 E;  4NY0 A;  3U8Z A;  4GIV A;  1EM7 A;  4EOY A;  1LO5 D;  1UBQ A;  4NPN A;  2JPH A;  2C5L C;  4GGQ A;  3PZ7 A;  1VLB A;  3AV8 A;  3RNB C;  2C60 A;  3UIP B;  3EEC A;  1KLU D;  1YQ4 B;  1SJH D;  5JXV A;  1VCB A;  1TZ1 A;  1DOX A;  2YVC A;  4HDO A;  2LEK A;  1WGG A;  1D5X C;  1N60 A;  1IBX B;  4YTN B;  2WXN A;  1WE6 A;  4AS1 A;  3VUX A;  4WJN A;  2XK5 A;  2PVG C;  1ZE3 D;  3DVG X;  4TMA B;  3PO0 A;  2LI5 A;  3DVN V;  4XE0 A;  2MSE D;  3AXC A;  5C23 A;  2A5U A;  2V3N A;  4WJQ A;  4F8C B;  3TCA A;  1EU4 A;  4KGT A;  3IXS A;  4BKS D;  1PGX A;  4KGR A;  4D2K A;  2BW2 A;  3RN9 C;  1WM3 A;  3APC A;  2JRH A;  3Q3N C;  3GP7 A;  4FN2 A;  2KKC A;  4NAM A;  3L10 B;  1NEN B;  1ZXI A;  4TUU A;  2ASQ A;  4W9D A;  1WR6 E;  1M4V A;  4DHJ D;  4HXD A;  2N9L A;  2AQ3 B;  1V1P A;  2KYW A;  1LFD A;  1RLF A;  1AWD A;  1YJJ A;  3NVY A;  1DGJ A;  3PZ8 A;  2MWS B;  3ZGZ A;  2L00 B;  2GBR A;  2WXI A;  1TS5 A;  2ZPN A;  3TUO A;  3QCA A;  2WXQ A;  3R2I A;  4MJS B;  4HCP B;  1WJU A;  4PS8 A;  3S2A A;  3VFK A;  1KFY B;  2W55 A;  2GLS A;  2MCN B;  1TS2 A;  1MVK A;  1TY0 A;  2YEP B;  2Z0E B;  4BKS A;  3QWZ B;  1MJD A;  3Q8B A;  2WDQ B;  1NI2 A;  5T8I A;  1E7P B;  1V5T A;  4C56 C;  1XXG A;  3CWI A;  4ARC A;  2ZCC A;  3ZVV A;  1SE4 A;  2WDV B;  1E8X A;  1ZDX A;  2L83 A;  2MP2 B;  1WMH A;  1YX5 B;  2A4Z A;  4LTU A;  2K25 A;  1WXS A;  4A6Q A;  3BYY B;  1T3Q A;  2JZZ A;  4UDU C;  4P16 A;  2M0X A;  3ZKJ C;  1C4A A;  4RM9 A;  4LNN A;  4RGT A;  2FCN A;  1WRD B;  2C7M B;  5G2N A;  3KUD B;  5BYR A;  4WUR A;  4M01 A;  1E7U A;  2BWE S;  1N6Z A;  5IA7 A;  2KFK B;  1SIF A;  4PYU A;  3O65 B;  2CJO A;  4RGM A;  1I4P A;  2K39 A;  2BGF A;  1EO6 A;  1T5X D;  3TBL D;  2CHZ A;  3L13 A;  1FNW A;  5H92 C;  4GB9 A;  1UUP A;  1JCK B;  2RGF A;  1VZ8 A;  5I4D A;  3VRB B;  4WJO A;  4IWO A;  3P1M A;  3TMP B;  2WU2 B;  1SE2 A;  1WM2 A;  1ZW7 A;  1KLG D;  3WAM A;  3C8Y A;  3ZLZ A;  1J7A A;  2V4L A;  3H7P B;  5E6P A;  1MG8 A;  2KX3 A;  4B95 A;  2KTR A;  4QAY A;  4HWI B;  5JZE B;  1AAR A;  2KLC A;  2E3T A;  3AE9 B;  2MJE A;  4EUT A;  3BII D;  1KH0 A;  1FM0 D;  3LDZ E;  2O2V B;  2G4D B;  2N7J A;  2K5P A;  1QZE A;  2PE9 A;  4M8M A;  3FC4 A;  3VUW A;  4C7Z A;  1UWM A;  1RRB A;  4C7Y A;  3VH4 B;  2CU3 A;  4DHZ E;  3AH7 A;  3ZIM A;  4NAW B;  2EKE C;  4FBJ B;  4CO7 A;  2KFJ A;  2C7N B;  4KDL B;  3Q8F A;  1YJ1 A;  1P1A A;  2K9X A;  3DOW A;  1WGY A;  2REX A;  2QJL A;  1JWB D;  3DBH B;  2GBM A;  2KNB A;  4M0W A;  1ZXH A;  4ZRI A;  1XO3 A;  4LDT B;  1E5W A;  3TEX A;  5CTR C;  2YEP F;  1HZ5 A;  1VZ6 A;  2SEB D;  4ARI A;  3UI3 A;  3Q8C A;  3DHI C;  3NVW A;  2MLB A;  4ICV A;  2ACZ B;  2LWP A;  5CX3 A;  2TSS A;  3VTU A; 
#chains in the Genus database with same CATH homology
 1SXT A;  2WXJ A;  2ZW1 A;  2N0S B;  1NYR A;  2Y5C A;  2W3S A;  2LUM A;  5HFY A;  2MJD A;  1KF6 B;  1FIQ A;  4GDK B;  1B1Z A;  2JSV X;  3AED B;  2FBW B;  1F77 A;  1YN4 A;  1E0Z A;  4DQO C;  1QKZ A;  1WYG A;  3BVZ A;  4IDI A;  4RH6 A;  2JXT A;  3R2T A;  4JX1 C;  2L52 A;  1D5Z C;  3SR6 A;  4CQN A;  2PMV A;  4XWW A;  3TEZ A;  1JWM D;  1XCQ L;  5EE1 A;  5AUK A;  2ONQ A;  1ZPS A;  1FFV A;  4TQ1 A;  3IT6 B;  1MI0 A;  5LNK 1;  3AEA B;  3NUH B;  1C76 A;  5BMG A;  1A70 A;  3AN1 A;  1VDV A;  1YQ3 B;  2FUG 1;  2IPK D;  2PTL A;  1F0Z A;  1ACC A;  1KRH A;  4ZYS A;  4REZ A;  4YWG G;  1FRD A;  1UNS A;  3AE3 B;  2QSD A;  4FXC A;  3V05 A;  4OZB A;  4OW0 A;  3TEY A;  1DOI A;  1P7F A;  4OVZ A;  1IUE A;  1YNT E;  3L4P A;  4XDD A;  2BS2 B;  5D3D A;  3ZJU A;  5H8Y E;  2LMC A;  1RFK A;  2G9H D;  1HA5 A;  1XLQ A;  2J52 A;  2WXM A;  3W1S A;  3NRZ A;  5BMH A;  1RWS A;  1WSP A;  1XCT L;  1AN8 A;  4HJG E;  2JZP A;  1PDX A;  1J7B A;  2BB6 A;  4KGS A;  5C2T B;  4DXG A;  2L1A A;  3AEE B;  4A55 A;  1NVI D;  2KDM A;  2PLP A;  2ICI A;  1GB1 A;  1C77 A;  3B2G A;  1VZ7 A;  4RNA A;  3IAS 1;  2WP9 B;  2QEJ C;  2WXK A;  1E9M A;  3VRA B;  5C3J B;  1QF6 A;  1JWA D;  4YXD B;  1FCL A;  1K50 A;  2SAK A;  2H89 B;  4IOI E;  1D5M C;  4LLG M;  1FO4 A;  2AQ2 B;  2DYO A;  1I4Q A;  2PVO D;  3U7Z A;  1WXQ A;  3Q69 A;  2B76 B;  3AEB B;  2DLB A;  1QOA A;  3NVZ A;  3EA6 A;  3KLS X;  3T3O A;  2VZK D;  1SIJ A;  3DWG C;  1UWX A;  3AE6 B;  4MT5 A;  3FIL B;  1D4B A;  1CQV A;  1TKY A;  1Q10 A;  2N9K A;  2W54 A;  1V97 A;  3AE7 B;  1C9F A;  1HZ6 A;  1TJE A;  2WXL A;  1TKG A;  3LXF A;  1I4X A;  2WNM A;  2X38 A;  4MM3 B;  1RM6 C;  1MHX A;  1EU3 A;  3AE2 B;  1SSN A;  3BYT B;  3E9S A;  3J9C A;  1MHH E;  3P63 A;  1OQQ A;  4TQ0 A;  4PT5 A;  4JWU C;  2DWQ A;  1GOZ A;  1L4D B;  3U4E G;  1QOB A;  3SEB A;  3AEG B;  2VZK B;  2V0G A;  1ET6 A;  3BK2 A;  3W5U B;  3W2D A;  1FNU A;  5FK9 C;  3FIL A;  3AEF B;  2KAJ A;  2WU5 B;  4L23 A;  2GB1 A;  1V8C A;  1C78 A;  1TS4 A;  1WGK A;  3Q8E A;  2BYT A;  4R3D A;  3V3X A;  2ZW0 A;  1VJK A;  5BMI A;  1GB4 A;  1ESF A;  2HTM E;  3ZQ4 A;  2KQ4 X;  5EE9 A;  1GAQ B;  4P6V F;  1ZUD 2;  2WDR B;  2WXG A;  1K52 A;  2J42 A;  1CK1 A;  1WWT A;  2V3P A;  2V4I B;  4N6E B;  4GDL B;  1I7H A;  3ZYY X;  1TZO A;  3LB8 C;  3EUB 2;  3OWE B;  3BZD B;  1N5W A;  3MC0 B;  3ZJT A;  3FAH A;  1T6B X;  2MJ3 A;  5AUI A;  3O13 A;  3P4Q B;  1PUT A;  2EEL A;  2QIE B;  2RDH A;  2QIL A;  4ZHP A;  1MPE A;  1FEH A;  1EM7 A;  1I4H A;  1LO5 D;  1QIL A;  2BBC A;  3BVG A;  3R8B A;  2KWD A;  3SFD B;  4YTM B;  1L6U A;  4A8X C;  2Z8L A;  3I9V 1;  1N61 A;  1SE3 A;  3PZ7 A;  2IDY A;  1VLB A;  3AV8 A;  2IJ0 A;  3I57 A;  3BVM A;  2IGG A;  1TKE A;  2LFI A;  3P42 A;  5FR3 A;  2HDE A;  1C79 A;  4GLS C;  2PKO A;  1KLU D;  1YQ4 B;  1JW9 D;  4OZA A;  1SJH D;  1PGB A;  5GXG B;  5JXV A;  4XDC A;  2JQR B;  2M19 A;  2K3U A;  5D3I B;  1DOX A;  2BT6 A;  1ZDV A;  2LEK A;  1C4P A;  5HG2 A;  1D5X C;  1N60 A;  3MHZ A;  3AE5 B;  1CJE A;  2BB5 A;  4ZRP A;  1IBX B;  1JWU D;  2LHD A;  4YTN B;  2WXN A;  2DYM A;  3AE4 B;  4AS1 A;  4KKI A;  2IGD A;  2AX5 A;  4NJC A;  1SJE D;  2WLB A;  1L5P A;  4ZOH C;  3ABV B;  1NYQ A;  4ITK A;  3VQI A;  4JPS A;  1GPX A;  2MH7 A;  1ZE3 D;  2PVG C;  4TMA B;  3PO0 A;  1HXY D;  2EKI A;  4XE0 A;  1FRR A;  1V1O A;  3TEW A;  2WXH A;  5TSS A;  4HEA 1;  3P4S B;  2V3N A;  4YSX B;  3W5V B;  2GRI A;  3RPF C;  1EU4 A;  2JWU A;  2LGI A;  4KGT A;  1IBX A;  2I38 A;  1XEE A;  3IXS A;  1V1P B;  1P7E A;  1PGX A;  4KGR A;  4D2K A;  2BW2 A;  3DWM A;  3KQ4 A;  5D7G A;  1ZOY B;  3GP7 A;  4B0E A;  3W9C B;  1TS3 A;  2JYE A;  2D5G A;  4NAM A;  4RCO A;  1NEN B;  2WXR A;  2ON8 A;  1ZXI A;  5EE3 A;  1SBB B;  1M4V A;  1AYF A;  5BYS A;  2MEK A;  2Q5W D;  4RF0 A;  3B9J A;  2H88 B;  3HVZ A;  1TY2 A;  4C80 A;  1YN5 A;  1RYJ A;  1FMA D;  2N9L A;  1AW7 A;  1WRI A;  1QT9 A;  2AQ3 B;  1V1P A;  2OED A;  3U52 E;  1BUI C;  1EWC A;  2QMT A;  2XN9 C;  4HRS A;  4JWS C;  1ROE A;  1AWD A;  1YJJ A;  4L1B A;  1I4R A;  3NVY A;  4MAC A;  1DGJ A;  3PZ8 A;  3BWU D;  2WXO A;  4KX6 B;  3HVD A;  3ZGZ A;  1JAL A;  2WXI A;  1TS5 A;  3TUO A;  2R61 A;  2RDG A;  2WXQ A;  3R2I A;  2J4X A;  1QLB B;  3ETR A;  5G5G A;  3WCQ A;  3EGR A;  4RGO S;  1E10 A;  2JX5 A;  2LHE A;  1JRP A;  1N5X A;  1F2R C;  1KFY B;  2IGH A;  1ZP0 B;  2W55 A;  1YJI A;  1ENF A;  2BS4 B;  4HKQ A;  1L4Z B;  2CJN A;  1TS2 A;  1E6E B;  2JU6 X;  3AB5 A;  3AEC B;  1MVK A;  4RGN A;  3NZ3 A;  1TYG B;  3ZJV A;  2Y5P A;  1TY0 A;  2YEP B;  1NEK B;  2PIA A;  2Y3A A;  3E56 A;  3Q8B A;  2WDQ B;  5T8I A;  4B0M A;  4OZC A;  1E7P B;  4YTP B;  1JWS D;  4C56 C;  1XXG A;  3CWI A;  2LJI A;  1HQR D;  4JE3 B;  3MFG A;  4ARC A;  4HRO A;  1SEB D;  1XLN A;  1SE4 A;  1STE A;  2WDV B;  3T3N A;  5E6J A;  2GI9 A;  2BS3 B;  3NS1 A;  1ZDX A;  2L83 A;  1OFF A;  2W82 A;  2WQY B;  4O1N A;  4RFB A;  2K22 A;  2JYT A;  2L32 A;  1SF0 A;  4LTU A;  2BTE A;  2FE8 A;  1UGJ A;  1Y56 A;  3GB1 A;  4A6Q A;  3BYY B;  2NTS A;  1FXA A;  1T3Q A;  2INN E;  4UDU C;  4P16 A;  4ZHO A;  1C4A A;  1XF5 L;  3KWV A;  4RGT A;  1OQR A;  4N58 A;  5BYR A;  4WUR A;  2RMM A;  2M0A A;  3N9Y C;  1PFD A;  1EWY C;  3AMZ A;  1FFU A;  4J3O D;  1J7C A;  3AM9 A;  3NVV A;  2CJO A;  4RGM A;  1PYW D;  3IT4 B;  1I4P A;  3MJ5 A;  3SFE B;  1T5X D;  1N63 A;  1FNW A;  5H92 C;  1NI3 A;  1HEZ E;  1UUP A;  4H2A A;  4A9A A;  3TSS A;  1JCK B;  1VZ8 A;  2G1E A;  1FNV A;  4AQ7 A;  3VR9 B;  5I4D A;  2I2Y A;  4US9 A;  3AE8 B;  3B2F A;  4ZRQ A;  1K51 A;  2K0P A;  3VRB B;  3P4P B;  3P1M A;  2WU2 B;  4RF1 A;  2KAC A;  1SE2 A;  1F2R I;  1SB3 C;  4YT0 B;  5FKA C;  4N59 A;  1KLG D;  1L0Y B;  4WIP A;  3C8Y A;  1B9R A;  2W3R A;  5MPO A;  1J7A A;  1QOG A;  1K53 A;  3HUI A;  4YSY B;  1L6V A;  1N62 A;  3VR8 B;  4LK0 M;  3U2S C;  1IGD A;  4TSS A;  1XLO A;  4OHJ A;  3BK1 A;  2E3T A;  2WS3 B;  4YSZ B;  1DOY A;  3AE9 B;  2MJE A;  3AE1 B;  3BII D;  1KH0 A;  1FM0 D;  3MP9 A;  2KMM A;  1BML C;  1XLP A;  2RPV A;  4Q2J A;  2N7J A;  1JML A;  2K5P A;  4L2Y A;  1YN3 A;  1JQ4 A;  3FC4 A;  2KN4 A;  1DYQ A;  4C7Z A;  1ET9 A;  1VR9 A;  3CIR B;  4XWT A;  1UWM A;  2INP E;  3URY A;  4A90 A;  1R7S A;  4C7Y A;  2E6X A;  1CZP A;  2CU3 A;  1FXI A;  1JRO A;  1FD6 A;  4WAF A;  3AH7 A;  5G5H A;  1D6E C;  2NTT A;  4NZL B;  4NAW B;  4KKJ A;  4DXF A;  3P4R B;  1QQR A;  3IAM 1;  3Q8F A;  2K9X A;  4WH4 A;  4MH8 A;  2M56 B;  5HHD G;  4IKG A;  5EE0 A;  2DBY A;  4USA A;  2QJL A;  2XNA C;  1JWB D;  4HKZ E;  4M0W A;  1PGA A;  1ZXH A;  4US8 A;  2OHF A;  4EE2 A;  1XO3 A;  3KWL A;  3TEX A;  3RFZ B;  2YEP F;  3GS2 A;  1HZ5 A;  1VRA B;  1VZ6 A;  3LYY A;  1FCC C;  2SEB D;  1BXT A;  1KTK A;  3UI3 A;  4ARI A;  1IGC A;  2NMQ A;  3Q8C A;  4WWM A;  2AQ1 B;  2J53 A;  2WXF A;  3NVW A;  4WQM A;  3H8H A;  1QOF A;  2ACZ B;  5BYQ A;  1L0V B;  1C4C A;  3HRD D;  3Q8A A;  2TSS A;  1L0X B;  1I4G A;  1YMH E;  2PW9 A;  2WXP A;  5HI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...