1B9RA

Terpredoxin from pseudomonas sp.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
105
structure length
105
Chain Sequence
PRVVFIDEQSGEYAVDAQDGQSLMEVATQNGVPGIVAECGGSCVCATCRIEIEDAWVEIVGEANPDENDLLQSTGEPMTAGTRLSCQVFIDPSMDGLIVRVPLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A model for the solution structure of oxidized terpredoxin, a Fe2S2 ferredoxin from Pseudomonas.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Ferredoxin
molecule keywords PROTEIN (TERPREDOXIN)
total genus 11
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1999-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b9rA00
2WLBA 3CIRB 2M56B 2W3SA 2WQYB 2CJOA 2WU2B 3AEGB 1ROEA 1T3QA 2E3TA 4JWSC 3AMZA 4P6VF 2BS3B 1FFUA 4YTNB 2M19A 1KFYB 1RYJA 4YSYB 1E6EB 4YTMB 3AEBB 1FXAA 1YQ3B 3NVZA 3NVVA 5EE9A 3B2GA 2WP9B 2OHFA 2MJDA 1A70A 3VR8B 1SIJA 1E0ZA 5G5HA 3KWLA 3FC4A 1QOBA 1QT9A 1I7HA 3AM9A 4WWMA 1XLNA 1GAQB 1N61A 2AX5A 5MPOA 1AYFA 1FFVA 1NI3A 1NVID 4YXDB 1PFDA 4N58A 1N5XA 1EWYC 1TKYA 2K9XA 1PUTA 3PO0A 2WU5B 1QOFA 4FXCA 1FMAD 3AE2B 4US9A 4A9AA 4YSXB 1TYGB 4YTPB 3AE7B 1SB3C 2HTME 2L83A 4HRSA 2W3RA 1OQQA 3AN1A 5H92C 3SR6A 1JQ4A 1UWMA 1XO3A 2L52A 2W55A 4ZOHC 1E9MA 1L6UA 4LTUA 3AE5B 3BIID 1ZXIA 1J7BA 1WXQA 3NVYA 2H89B 1V8CA 1N62A 1QLBB 1YJIA 2FBWB 3RPFC 2Q5WD 1JWAD 3AB5A 1OQRA 2MH7A 1ZP0B 1NYRA 2K22A 4USAA 3DWMA 1WYGA 1XLQA 1WRIA 4JWUC 4HROA 2CJNA 2CU3A 2LEKA 3SFDB 3ABVB 4ZHPA 1YJJA 3AH7A 3AEEB 4N6EB 2KMMA 3ETRA 1B9RA 2B76B 1NENB 2PVOD 3W5UB 1OFFA 1XLPA 3AECB 1IUEA 3WCQA 1TKGA 3AE1B 2EKIA 2MJ3A 3P63A 1PDXA 1FO4A 1QOAA 3AE6B 1E7PB 1CZPA 3AE3B 5H8YE 3VR9B 2WDVB 3ZYYX 5C2TB 5C3JB 2W54A 1RWSA 1SF0A 2DBYA 3P4SB 2DWQA 1VLBA 1CJEA 2N0SB 2QIEB 3NS1A 4JX1C 3HUIA 1RM6C 1AWDA 1N60A 1FRRA 1L0VB 3AEDB 1KRHA 1N5WA 1V97A 5EE0A 3HRDD 1JROA 3LB8C 1VJKA 3AE8B 1N63A 3W5VB 1QOGA 2H88B 3P1MA 2BS4B 4C7YA 3LXFA 3B9JA 1DGJA 5AUKA 2JQRB 3B2FA 1FRDA 3NVWA 1WGKA 2JX5A 3DWGC 2PKOA 3P4RB 3AE4B 3CWIA 4IDIA 4N59A 2BT6A 5GXGB 1TKEA 4C7ZA 2Y5CA 2K5PA 4ZHOA 1ZUD2 3HVZA 3AEAB 1JALA 1JWBD 2ACZB 1FXIA 1QF6A 1L6VA 2PVGC 1WWTA 3VRAB 4WQMA 5G5GA 1NEKB 3NRZA 2QJLA 1J7AA 1DOXA 1RFKA 1YQ4B 1TJEA 2PIAA 4US8A 4YT0B 1DOYA 3AE9B 3L4PA 3FAHA 4C80A 1F0ZA 3VRBB 4ITKA 3AV8A 1JW9D 1FM0D 4YSZB 3AEFB 2KAJA 2WS3B 3P4QB 3P4PB 1NYQA 1VDVA 1FIQA 1L5PA 1R7SA 2G1EA 1XLOA 5EE1A 2MJEA 2WDRB 3W9CB 1GPXA 3SFEB 2WDQB 1J7CA 5AUIA 4KX6B 1DOIA 1KF6B 1ZOYB 2BS2B 3EUB2 1JRPA 1E10A 5EE3A
chains in the Genus database with same CATH superfamily
2W3SA 3H7SA 3V62A 2WXLA 2J53A 1FFUA 2ZNVC 1SXTA 1WXVA 3PREA 3RNEC 3IAS1 3M62B 1GAQB 3DHHC 1WGGA 5MPOA 1EF1A 2V4LA 4O1NA 1YOVB 2WU5B 1QOFA 4FXCA 2LMCA 1D5XC 3JYUA 2JRHA 2QMTA 3DHGC 3VAWA 1TT5B 4A20A 4GDLB 3GP7A 4USAA 4NAWA 2IBIB 2CU3A 4N9F4 2CHWA 1UF0A 3AEEB 3R7QA 4CHKA 2NS5A 1YN5A 2N7JA 2PVOD 4RCOA 1OFFA 2Z59B 2FCSA 2EKIA 4URKA 3H7PA 2I38A 2Y3AA 2D3CA 2GMIC 1VLBA 2KXJA 2LUEA 4MM3B 4ZRJA 1K53A 2WXRA 1SEBD 2LI5A 3V61A 1WGRA 2UYZB 3PLVA 3Q3MC 5CHFA 3NZUA 3HVZA 1JALA 4AUQC 2KD0A 1WR6E 3RNCC 2LJ5A 4MGIE 1NEKB 4MELA 2BQQA 4DXAB 2NVUI 1TJEA 2TSSA 1KOTA 1T5XD 1KJTA 5FKAC 1WMHB 3PPAA 4WJNA 5CX3A 1XLOA 4LJOB 2KKCA 1E10A 3M3JA 4RF0A 2WXNA 3CIRB 3DVNV 2N9KA 2PMVA 4WWNA 4HWIB 1WMHA 1WRDB 4LDTD 4EE2A 2N1WA 3N9YC 1NI3A 4N58A 2KMAA 1OEYA 4US9A 5H92C 3AN1A 4OW0A 5CHWA 2DX5B 2BB6A 3AE5B 4DK5A 2JUOA 2AL3A 5JXVA 2JYEA 2JT4B 1C76A 1L7YA 4L23A 2MSED 4HPLB 4KIKA 3BZDB 4GGQA 2YLMA 3Q3FA 3VR9B 1LO5D 5C2TB 1F1HA 1L0XB 3URYA 1KRHA 1C3TA 3APFA 3CSTA 3HHMA 1IBXA 4ZRQA 2KC1A 1MG4A 1WGKA 1ET6A 1ZE3D 4XWWA 4HK2A 2LHDA 2NBVB 3MJWA 2LGIA 1UBIA 4BZAA 3DVGX 4DDID 1VD2A 2I2YA 3A9KA 3VTVA 3PRPB 5KHOA 4A3OA 4RGOS 4XC2A 1LQBA 3AE9B 1S1QB 2L8JA 1JW9D 3DBLI 2VH2A 1Q5WB 1NDDA 4KVGB 4I6LB 2WDQB 4KX6B 3SU8X 3ZXVA 4KGSA 3GOEA 4W9IA 3HM6X 4OZBA 3AMZA 2R2QA 1WJ6A 2XBBC 2MHJA 3B2GA 4AJYB 4XE0A 4MACA 4BOSC 2KDEB 3PGEA 2PPHA 3T8MA 3EHVA 4C4VB 3ZNHB 5FR3A 4W9JA 4AQ7A 2K0PA 1FD6A 2OJWA 2AQ3B 3N1ZC 5LNK1 1P9DU 5EDSA 4HPPA 3WAPA 2J42A 1C4AA 2M17A 3BK2A 3RNFC 3U52E 5JHBA 3MTNB 1GC7A 3PV1A 5D3IB 2YEPF 4B9KA 2IPKD 3NZ3A 2D3GA 1V1PB 1P3QU 3AE6B 4WURA 3E56A 2K8BA 2JXXA 3SDLC 3I63C 5DCNA 2JY6A 2RDBC 1H4RA 4D2KA 3DCGA 2DYMA 1JROA 3UF8A 3TEZA 3VUYA 4TMAB 1FCCC 2XNAC 3ZIMA 1WY8A 3NZSA 1TKEA 2Y5CA 3TEXA 2BGFA 5BYQA 1WWTA 1E8WA 1ET9A 3Q8AA 3BINA 4US8A 3I3TB 2LZ6A 2KAJA 4W9CA 2LGXA 3V60A 1V49A 4A3PA 4P1CC 1Q0WB 4LNIA 4JIOU 3VTUA 4I6PA 1EWCA 4JWSC 4P6VF 4MGKE 2JVCA 2WGSA 1FXAA 1YQ3B 5EE9A 4KIKB 4KDLB 4NNJB 4MDKE 1WM3A 1LM8B 2FCMA 3W1YA 4KZ0A 3H6NA 1AYFA 2FAZA 4A90A 3FKYA 2X38A 1PUTA 3AE2B 1XCTL 3EGRA 3SR6A 2W55A 1HTOA 4DHJD 1NBFC 1J7BA 3BYTB 2JZPA 4WIPA 1R4MI 5AZGA 4NJ7A 2D3BA 2SAKA 4NJ6A 4PS7A 4IOIE 2KMMA 1D5MC 3I5JC 4IM0A 3Q14C 3QJZA 2ZEQA 1WSPA 3P4SB 2DWQA 1CJEA 4AS1A 4JGHB 3W1SC 2RGFA 1R4MB 1FRRA 1L0VB 4LDTB 2W9NA 2VH1A 1C4PA 4C7YA 3APDA 3SEBA 4IDIA 2MBOA 2LHEA 5LXHA 1YD8U 2LWPA 4CQNA 2WXGA 2D07B 1Q10A 4M0WB 1YIWA 1MG8A 2QJLA 3AI5A 1N6ZA 2BWFA 1RAXA 4FBJB 2DAFA 2C7NB 1F0ZA 4EOYA 1T0RC 1KLVA 4FN2A 1PGAA 4IWQA 1PYWD 1WH3A 5DPWA 1V86A 3H1UA 4M8NA 2CU1A 1MHHE 2WQYB 3UI3A 1M4VA 4YTNB 2QDFA 4GB9A 4RGMA 3KWVA 1JWSD 3NVZA 4KV2A 3A4RA 4DXGA 4WQOB 2MBBB 2LVPA 4F1SA 2L1AA 4EZJA 4Q2JA 1EF5A 1QT9A 2ZVNA 4WWMA 3R66C 5IA7A 1N61A 2LGYA 4II2B 1PFDA 2KLGA 1MJDA 3TL5A 2L83A 1K50A 3NOBA 3RFZB 4MH8A 1EO6A 3BVGA 5E6OA 2ZPYA 1E9MA 2N9XA 3KUDB 4RF1A 1V8CA 1N62A 3RPFC 2BKRB 1P7EA 5E6JA 1NYRA 1WYGA 2IY0B 1D4BA 2QSDA 2BPSA 3B08A 1XLPA 1IBXB 2MJ3A 3UQBA 1YQBA 3ALBA 3Q8CA 4MH0E 4JX1C 4M02A 5EE0A 2GRIA 2KN4A 2N7DA 2A4ZA 3A9KB 1OQYA 4DQOC 4W9HA 2MQJA 4W9KA 2BT6A 2QILA 3C19A 3GE3C 1RFAA 3AEAB 1JWBD 2MRPA 2W82A 4E74A 2FIFA 3U4EG 4B0EA 1C4CA 4BBNF 4MSMB 2K8HA 1I4GA 4XDCA 4YT0B 3FAHA 4CYEA 2CKHB 2DAJA 2G1EA 3AU4A 1KF6B 2LGSA 1I42A 1CQVA 1JRPA 2K3UA 4PYZA 3PZ8A 3AEGB 1J0GA 4ASWC 3VVWB 4GU2A 4RGNA 1RYJA 3DQVA 2K6DB 4J3OD 4HDOA 2AWTA 3KQ4A 2B3AA 1SIJA 3KH0A 2QEJC 1HA5A 3PS6A 1E7VA 2EKEC 5DPSA 3EA6A 3MC8A 2ICIA 4M00A 4A8XC 2G4SA 2M4NA 2RD0A 1L6UA 3N30A 1QQRA 1GOZA 1P98A 1WJNA 5D2MB 2G9HD 3AB5A 4IWPA 2MH7A 2NPTB 2K39A 5J18A 2KX3A 2M0AA 2PE9A 3SFDB 2KNBA 4H2AA 3AH7A 1RLFA 3VXWA 1ZDXA 1YMHE 1I4RA 1TTNA 2LXCA 1ESFA 4EEWA 4MEMA 2ZVOA 1RM6C 2GBNA 4OZAA 1QOGA 3MHZA 4XX5A 4LLGM 3WANA 4MJSB 1LFDA 2V3NA 4JQWC 2LRWA 4K7SA 2DENB 1V2YA 4AJWA 1MVKA 4ANVA 4HCNB 3B1LX 1DOXA 2HE7A 2ZZPB 4BKSA 4KGRA 1SIFA 4C80A 3IT4B 4S17A 1FM0D 1WX8A 3JSVA 3P4PB 1VDVA 2MX2A 2O6VB 3AXCA 1K51A 2J0MA 2PLPA 1ZOYB 3EUB2 2UWQA 3ZTDA 3ZXRA 1GB4A 2BBCA 4BKTA 4HVBA 3L0WB 3V6CB 2ASQA 3QHTA 2OHFA 1E0ZA 3IAM1 2WXJA 1I4QA 5J17A 3JSVB 1D3ZA 4TQ1A 1TS4A 3N1YC 3AULA 3PO0A 2RDHA 2NR2A 3RZWC 2Y5PA 1SB3C 2WXMA 2KFKA 2W3RA 2KWCA 3K9PB 2L52A 4ZOHC 2EELA 1X1MA 2GBMA 4EZKA 1LXDA 1QLBB 5IO9A 4WAAA 2JZZA 5KHQA 2G45B 3ZQ4A 3HIZA 4KKJA 4EUTA 4ZHPA 2GB1A 1UZXB 4FHKA 2KJ6A 2O6VD 4C56C 2KACA 2KN5A 3QCAA 1IUEA 1FO4A 3ZRCA 1Q1OA 2HD5B 3ZLZA 3MC9A 3RMKC 2MBHA 2DBYA 2J4XA 3TIXA 3L17A 3AEDB 3L10B 3RULA 2ZJDA 2HDEA 4KSKC 2KK8A 2NTTA 2RPQA 3SD5A 2JQRB 1IPGA 1E8ZA 2MEKA 1J8CA 3A4SC 3PZ7A 4NY0A 2XEWA 3HK0A 4K1RB 1FXIA 5AZHA 1V6EA 1UNSA 1EU4A 3NY5A 1J7AA 3H7PB 1RFKA 2KDBA 3MHSD 3MFGA 4FA6A 2UU7A 3IT6B 3WALA 3AEFB 3GZNI 3DVNU 5EE1A 1J7CA 4E71A 3UIPB 1H8CA 2R2OA 1WE7A 1BUIC 4A6QA 2KANA 5TSSA 2CJOA 3W2DA 2LXAA 4GIVA 2JU6X 1ACCA 5D7GA 2KVZA 3AEBB 4HJGE 3RT3B 2JWUA 3DVGY 3ECIA 4KSLC 5HG2A 4YXDB 4HKQA 4A9AA 4LNOA 1IYFA 1JQ4A 5BMIA 1IGCA 1SE3A 2Q5WD 1JWAD 2C7MB 1ZP0B 4ZRIA 2N9EB 5J2RA 2LD9A 4CO7A 2NTSA 1NENB 2C7HA 1WX7A 3RCZA 2IO0B 3R3MA 3U2SC 4B0MA 5LXIB 5T8IA 2WDVB 2KJHB 1WJUA 2W54A 4FJZA 3EC8A 3OJ4B 2N0SB 3OJ3A 3NS1A 3U7DA 3NHEB 2IO3B 2MWSB 1VCBA 1FPYA 3I9V1 3P1MA 1PGBA 1E90A 1QZEA 2BB5A 2KDMA 3Q8FA 4BBNC 1V9JA 1UGMA 2AL6A 2GI9A 2INNE 3CWIA 3D32A 1UH6A 1FNWA 4ZRKA 2WX1A 1L6VA 2KDIA 4EFOA 5G5GA 2IO2B 1I4PA 2KTRB 3L13A 2PIAA 4XZ4A 3T3OA 3AV8A 2IZVB 5DPRA 1Z5SB 1YN4A 2D5GA 3P4QB 3RNGC 3L08A 4WH4A 2KMCA 2MJEA 4ZYSA 1DOIA 4IUMB 1FRDA 3RUIB 4NAMA 1FEHA 3TJPA 1FNVA 2KVRA 2ON8A 2WU2B 1ROEA 3ZDMC 1DYQA 3N3KB 4YTMB 3ML9A 1ZXHA 1SE4A 1WXAA 4W9GA 2WP9B 2IYDB 3VR8B 4EKUA 3KWLA 1I7HA 2KTRA 2M0XA 3AM9A 5BMHA 2DLBA 1T0YA 2K9XA 1KM7A 3T9LA 4AOFA 2RMMA 1TYGB 3WA0A 1HQRD 1ISNA 3TEYA 1BXTA 2ZCCA 1WXQA 2H89B 2V3PA 2ZW1A 2DNFA 4EZLA 5HI1A 3KW5B 3Q3NC 3ZTCA 3VUWA 4W9FA 2YVCA 4N6EB 4FLHA 4J6IA 2BF8B 5IOIA 3VH4B 3Q3JA 3ZW3A 4W9LA 1A5RA 2PW9A 4XGAB 3MC0B 1N5WA 3A33B 3AE8B 1N63A 4LNKA 1IP9A 2KQ7A 1J19A 2PKOA 3GE8C 4HDQA 1HEZE 2A5UA 2AYOB 3QC8B 1K52A 4HXDA 2QC8A 2ACZB 2L3ZA 2JYTA 4BFRA 2LASA 2PVGC 5BYSA 4ARCA 2IGGA 3KUCB 2KLCA 2BYVE 2GBJA 3HM3A 3UGBB 5D6JB 3OLMD 5HKHA 2GBKA 3VRBB 4G0NB 2WS3B 3DDCB 1VZ8A 2VRRB 1L5PA 2REXA 1E5WA 1WXSA 1GPXA 5AUIA 4K3CA 1TGZB 2K6QA 1V5OA 1AW7A 5EE3A 1C79A 1OEYJ 1GUAB 1CK1A 2WXKA 1WXMA 3R2TA 4M8MA 2K8CA 2E3TA 3A1QB 2BYTA 1TS3A 4OZCA 4YSYB 2IY1B 4DHZE 2N9PC 1A70A 1Y8RC 4TKNA 2AX5A 3U7ZA 4ARIA 1N5XA 3RYTA 3BVZA 3TCAA 1FMAD 3PT2B 4HRSA 4ICVA 3ZJVA 1GNUA 2YEPB 1R4NI 1OQRA 3T3NA 2MLBA 1XLQA 3A1QA 3C8YA 4LK0M 4ZYNA 2C9WB 2LEKA 2O2VA 1YJJA 3IHPC 4F7ZA 1GG3A 2IJ0A 5C23A 1TZOA 1B9RA 2PJHA 2V4IB 3FILA 3A9JB 4NJCA 1VZ6A 3P63A 4BKGA 3EECA 2LVQA 2C60A 2V9HA 2MBEA 1WE6A 1AARA 3CF6E 2L0TA 4IC7B 4TSSA 1LGRA 2KHWB 2MCNB 3NJTA 3RZFA 4II3B 4RM8A 1XXGA 1JRUA 4W9EA 2D11A 3LXFA 2WXFA 3B2FA 2BYFA 3DWGC 1E8XA 4ZDVA 1C9FA 2ZPNA 1EM7A 2HJ1A 4ANUA 1MHXA 2IGDA 3ONSA 3ZRFA 1L2NA 1YN3A 3BYYB 2KZRA 2JPHA 3GZNB 2LVOA 1HXYD 4ITKA 2KYWA 1SJHD 2WDTB 3W9CB 2WDRB 5FK9C 4OHJA 5IP4D 2WLBA 2DZKA 4K3BA 1S3SG 4DHJB 2VZKD 2HTHA 1WJ4A 3MJ5A 3S2AA 3ZJTA 4GN1A 3V05A 1SE9A 2MJDA 4PS8A 4HEA1 4M0WA 2O6VA 1WGHA 4R3DA 3OWEB 2Z8LA 2SEBD 3GB1A 1FFVA 1HZ5A 4PK1A 1E7UA 1L0YB 3M63B 3ZVVA 5AEKB 1WF9A 4YSXB 3ZGZA 4NQLB 2LFIA 2PTLA 1UWMA 2L76A 4GDKB 4B95A 3QIJA 3CMMB 2BYEA 4NQKE 4HKZE 2CJNA 1WX9A 2BW2A 3PZDA 1ENFA 1TKGA 2BWES 3AE1B 4F8CB 1PDXA 2RR9A 1SSNA 4ZRPA 3R8BA 3VDZA 3ZNID 1QILA 4NZLB 3E9SA 1PGXA 3ML8A 2R61A 2MBQA 2KOXA 2H88B 2NBWB 4REZA 2L0FA 3EFCA 1TS2A 2JX5A 2I1JA 1ZW7A 4C7ZA 2HJ8A 3RN9C 4MM3A 3RI7C 1QF6A 5IKCM 3QA8A 1P0RA 4FJVB 2KDFB 4GOCA 3PRZA 1KLGD 3KYDD 3TSSA 2V0GA 4K81A 1DOYA 1I4XA 2D3AA 2NBUA 1WI0A 2MW5A 1HE8A 4ANWA 2JZ3B 2BS2B 1D6EC 1T6BX 2L00B 3X23A 2MP2A 4K7WA 2INDC 3JW0X 3DHIC 2M19A 1KFYB 1E6EB 1BT0A 2L32A 3W1SA 2CS4A 3PSEB 4DDGD 1TIFA 4PYUA 2WX0A 1QKZA 4XDDA 1EUVB 3LDZE 3IXSA 1Z2MA 3ENEA 1EWYC 4NPNA 5D94A 4WAFA 3Q8BA 2RSUA 2ZNVB 4LTUA 5L83A 2FNJB 3J9CA 1MFWA 3P42A 2RPVA 2K22A 3R7RA 4JE3B 4KZCA 3DWMA 1UGJA 2PE6B 4JWUC 2N7EA 2JSVX 4HLEA 3ETRA 2FE8A 3O13A 3ZUNA 3BY4B 1WIAA 3AECB 3UINB 3APCA 5L95C 4OVZA 1E7PB 3PRMB 3AE3B 4G11A 3VHTC 5JH5C 1XEEA 3PLUA 2FUG1 2KFJA 3HUIA 4NAWB 5E6PA 4IM3A 3L54A 2ZCBA 4GDKA 3KUZA 2D10A 4WJPA 3Q6BA 2FUHB 1YNTE 3N32A 1TY2A 4RMAA 2INCC 5GMVA 2INPE 2NPTA 4C00A 1YQ4B 3ZNGC 3N20C 2JXTA 1WYWB 3AU5A 1SGHA 5H8YE 1I4HA 2WNMA 3V3XA 3C0RB 2JWZA 1VR9A 2XK5A 4L2YA 2ZW0A 4TV3A 2OOBB 1VRAB 2CHXA 4K7UA 3RNBC 3TMPB 3NS8A 1XD3B 2BKFA 2MA9B 2M1MA 3QX1A 1HZ6A 5G5HA 1UUPA 1XLNA 4WJQA 4X57B 2JF5A 2G4DB 4WWPA 3EFUA 3WAMA 2AEHA 3KVFB 4PS3A 3MP9A 2HTME 3DOWA 3H8HA 1XO3A 2WXHA 5HHDG 1ZXIA 2PEAA 4P16A 4QAYA 2X8XX 4ICUA 2FBWB 3QQ8B 5CTRC 2KTFA 1WRIA 3R2IA 1WFYA 3TUOA 2IO1B 5JZEB 2J0JA 2LGDA 5C3JB 4JLCA 4A55A 2DZJA 1RWSA 2DYOA 1WGYA 1Y56A 3WIMA 1TS5A 4RM9A 1AWDA 1T0QC 3V6EB 2N9LA 4DBGA 3TEWA 3H9DA 3NVWA 2O2VB 1R4NB 3P4RB 2KJRA 4ZHOA 4W9DA 1MI0A 3DBRB 2DZMA 2L7RA 1V1OA 2Y5BB 1XQQA 4RFBA 4P7IA 5FR6A 3ZO5B 3VRAB 4G3XB 4L1BA 1JWMD 2G3QB 4DXFA 5BYRA 1STEA 4YSZB 1ZDVA 1FIQA 2KWVB 2EMTA 2KWUB 2J7QB 3JVZX 4GDLA 1TY0A 2FIDA 2N4FA 3VQIA 2M56B 5C1ZA 3ZKJC 1XT9B 3ZJUA 1K8RB 2BS3B 3TBLD 4JL9A 4B6WA 3NVVA 1UELA 2DYBA 4TUUA 5IAAC 2OJRA 3BK1A 4M01A 2GBRA 3UQAA 1SE2A 3Q2AC 1GC6A 1GB1A 2LRUA 3QK0A 4BAXA 1L4ZB 2JRIB 4E3CA 1CMXB 3DBSA 2BTEA 3OG5A 4FJYA 3U8ZA 1BMLC 1P1AA 3NVYA 1UBQA 1YJIA 5G55A 1WGDA 3N1XC 2NMQA 4GSWA 2KX0A 2DHZA 1EU3A 4G50A 4TQ0A 2V3SA 1C1YB 4C4VA 1I35A 1FCLA 1FNUA 3Q69A 1F77A 4JPSA 1SJED 4UDUC 3NG0A 4MJSA 2L05A 1IGDA 1PQSA 5BO4B 2WXOA 3Q8EA 4LNNA 4DWFA 4P1BC 4HCPB 1FXTB 2KQSA 3B0AA 4WWOA 1B1ZA 1ZGUB 2D2QA 2IDYA 1V97A 3DBLB 3SHQA 1JCKB 2ONQA 2NCNA 1KTKA 2N1VA 3U30A 2BS4B 1V80A 2KC2A 1JWUD 1T0SC 3LJ3A 1GJZA 5DPTA 5AZFA 4RGTA 5TR5A 3O65B 1RRBA 1UWXA 3QAQA 4GMVA 4GXBA 3VTWA 3L4PA 1C78A 2QCZA 4OVVA 1P7FA 1R7SA 1WM2A 3LYYA 2QHOA 2KWDA 1KH0A 1HTQA 2K1FA 3HVDA 4I6NB 1T3QA 1V5TA 3K9OB 2WXIA 2LJIA 4IM2A 4RH6A 3Q3OC 3P2BA 3FC4A 4LJPB 5IN7A 1NVID 3RNAC 1V1PA 2WXPA 1F52A 3AE7B 3RD2A 1VZ7A 1YJ1A 4IWOA 4MGYE 1TZ1A 3DPDA 1F2RC 2VZKB 3UIOB 1SBBB 5BMGA 3QWZB 2I1KA 4LNFA 5CHVC 4PT5A 4HROA 4ANXA 3PHXB 4HJKA 2LUMA 2J52A 2E6XA 3W5UB 2K25A 3L16A 2BVCA 1CZPA 2OEDA 3FILB 3IBEA 4YL8A 3ZYYX 2KQ4X 1SF0A 1OTRB 2QIEB 3I57A 5LLIA 1N60A 2GOWA 3HRDD 3W5VB 1M94A 1KLUD 2WWZA 1DGJA 5E6NA 4MT5A 1MPEA 2FCNA 2KO3A 4FHJA 5D3DA 3PVLA 3ZDTA 1ZUD2 2AQ1B 2Z0DB 4BKSD 2Z0EB 2FCQA 5JHAA 3OAWA 4GLSC 3BVMA 3WAOA 3DBRI 2CHZA 1ZPSA 4WJOA 4RNAA 1NYQA 3DBHB 2KFKB 1C77A 3SFEB 4BVUC 2M8SA 1F2RI 1YX6B 2CR5A 5HFYA 4IG7B 4LCDE 1WZ0A 2J0KA 2V1YA 5I4DA 2WXQA 2AQ2B 3VFKA 4KGTA 3KLSX 4IKGA 3NUHB 3M95A 1QOBA 4MGZE 2EMSA 4YWGG 3VUXA 4FULA 1TKYA 4FADA 1F9JA 3GS2A 4YTPB 1XF5L 1JMLA 1OQQA 1UD7A 1ZKHA 3BIID 3PHWB 2WHIA 2IGHA 2XK5B 2C5LC 4AWJA 1TBEA 1OGWA 4S0RA 1V81A 1WR1A 3ABVB 1G6JA 4KKIA 4HPMB 2B76B 3QARA 3WCQA 1QOAA 1AN8A 3IVFA 3PTFC 3ZNZB 2RDGA 4AP4C 3IFWB 1WZ3A 3CSFA 2DZIA 4ACFA 3LB8C 1VJKA 4IW0A 1NI2A 3B9JA 5AUKA 1U4AA 1L4DB 3AE4B 4N59A 5GXGB 2XN9C 4KDIC 2GLSA 2K5PA 1D5ZC 4XYCA 3KYCD 3X0WA 1E8YA 4WQMA 3NRZA 5G2NA 3A9JA 1YX5B 3VH3B 2MP2B 3IG3A 4XWTA 2WYQA 2KT7A 4DHZB 3BWUD 4OVUA 3DBHI 4MSQB 4BOZB 1XCQL
chains in the Genus database with same CATH topology
4NAMA 2W3SA 1FEHA 1MHHE 2WQYB 1FNVA 2WU2B 2ON8A 2WXLA 1ROEA 1M4VA 2ZW0A 1VRAB 4L2YA 3UI3A 1DYQA 4YTNB 2J53A 1FFUA 4RGMA 1SXTA 4YTMB 3KWVA 1JWSD 3NVZA 1ZXHA 1SE4A 4DXGA 3IAS1 2WP9B 3VR8B 1HZ6A 5G5HA 1UUPA 2L1AA 3KWLA 4Q2JA 1QT9A 1I7HA 3AM9A 4WWMA 1XLNA 1GAQB 5BMHA 1N61A 2DLBA 5MPOA 1PFDA 2K9XA 4O1NA 2WU5B 1QOFA 4FXCA 2LMCA 1D5XC 2RMMA 1TYGB 2QMTA 2L83A 1K50A 2HTME 3MP9A 4MH8A 1HQRD 3RFZB 3BVGA 3H8HA 1XO3A 2WXHA 1E9MA 5HHDG 3TEYA 1BXTA 1ZXIA 4P16A 1WXQA 4RF1A 2H89B 1V8CA 2V3PA 1N62A 2FBWB 2ZW1A 4GDLB 3RPFC 3GP7A 1P7EA 5E6JA 1NYRA 4USAA 5HI1A 1WYGA 1WRIA 1D4BA 2CU3A 3R2IA 2QSDA 3TUOA 3AEEB 4N6EB 2N7JA 1YN5A 2PVOD 4RCOA 1OFFA 1XLPA 1IBXB 2EKIA 2MJ3A 5C3JB 2I38A 4A55A 1RWSA 2Y3AA 2PW9A 3Q8CA 2DYOA 1VLBA 3MC0B 1Y56A 4JX1C 1TS5A 4MM3B 1K53A 2WXRA 1AWDA 2GRIA 5EE0A 1N5WA 1SEBD 2KN4A 2N9LA 1N63A 3AE8B 4DQOC 3TEWA 3NVWA 2PKOA 3P4RB 4ZHOA 2BT6A 2QILA 1HEZE 1MI0A 3HVZA 3AEAB 1JALA 1K52A 1JWBD 1V1OA 2ACZB 2W82A 2JYTA 3U4EG 4RFBA 2PVGC 4B0EA 1C4CA 3VRAB 5BYSA 4ARCA 2IGGA 1NEKB 1I4GA 1TJEA 4XDCA 4YT0B 2TSSA 1T5XD 3FAHA 4L1BA 1JWMD 3VRBB 4DXFA 5BYRA 1STEA 5FKAC 4YSZB 1ZDVA 2WS3B 1VZ8A 2G1EA 1FIQA 1L5PA 1XLOA 1GPXA 5AUIA 1KF6B 1CQVA 1JRPA 1AW7A 5EE3A 1CK1A 1C79A 2WXKA 1TY0A 2WXNA 4RF0A 3CIRB 1E10A 3VQIA 2M56B 2K3UA 2N9KA 2PMVA 3R2TA 3PZ8A 3AEGB 3ZJUA 2E3TA 2BYTA 1TS3A 2BS3B 4OZCA 4RGNA 1RYJA 4YSYB 4J3OD 3NVVA 3KQ4A 1A70A 3BK1A 1SIJA 4EE2A 2QEJC 1HA5A 1SE2A 1GB1A 2AX5A 3N9YC 3U7ZA 4ARIA 1NI3A 1L4ZB 4N58A 1N5XA 3BVZA 1FMAD 3EA6A 4US9A 2ICIA 4HRSA 5H92C 4A8XC 3AN1A 3ZJVA 2BTEA 4OW0A 1BMLC 1L6UA 2BB6A 3AE5B 1QQRA 1GOZA 3NVYA 2YEPB 1YJIA 2G9HD 3AB5A 5JXVA 1OQRA 2MH7A 2NMQA 3T3NA 1XLQA 3C8YA 1EU3A 4LK0M 2M0AA 2LEKA 3SFDB 2JYEA 4TQ0A 4H2AA 1YJJA 3AH7A 1C76A 4L23A 2IJ0A 1TZOA 1FCLA 1FNUA 1B9RA 3Q69A 1F77A 3BZDB 1ZDXA 3FILA 2V4IB 4JPSA 1YMHE 1I4RA 4NJCA 1VZ6A 3P63A 1SJED 4UDUC 3VR9B 1LO5D 5C2TB 1IGDA 2WXOA 3Q8EA 1ESFA 4TSSA 1L0XB 1B1ZA 2IDYA 1RM6C 3URYA 1KRHA 1V97A 1JCKB 2ONQA 1KTKA 1XXGA 4ZRQA 1IBXA 4OZAA 1QOGA 3MHZA 2BS4B 4LLGM 3LXFA 2WXFA 3B2FA 1WGKA 1JWUD 3DWGC 1ET6A 1ZE3D 2V3NA 4XWWA 1C9FA 2LHDA 1EM7A 2LGIA 1MVKA 1MHXA 2I2YA 2IGDA 4RGTA 1DOXA 1YN3A 1UWXA 3BYYB 4RGOS 4KGRA 3AE9B 3L4PA 1C78A 4C80A 3IT4B 1HXYD 4ITKA 1JW9D 1FM0D 1SJHD 1P7FA 3P4PB 1VDVA 1R7SA 3W9CB 2WDRB 1K51A 2WDQB 5FK9C 2PLPA 4KX6B 4OHJA 1ZOYB 3EUB2 3LYYA 4KGSA 2KWDA 1KH0A 2WLBA 1GB4A 3HVDA 4OZBA 1T3QA 2VZKD 3AMZA 2BBCA 2WXIA 2LJIA 3MJ5A 3ZJTA 3B2GA 4RH6A 3V05A 4XE0A 4MACA 2OHFA 2MJDA 1E0ZA 3IAM1 2WXJA 4HEA1 1I4QA 4M0WA 3FC4A 4R3DA 3OWEB 2Z8LA 2SEBD 3GB1A 1FFVA 1NVID 1HZ5A 4TQ1A 1TS4A 1L0YB 5FR3A 3PO0A 2RDHA 4YSXB 1V1PA 2WXPA 4AQ7A 2Y5PA 3ZGZA 2K0PA 2LFIA 3AE7B 1SB3C 2WXMA 2AQ3B 2PTLA 1VZ7A 2W3RA 1FD6A 1UWMA 2L52A 4ZOHC 2EELA 5LNK1 4GDKB 2J42A 1F2RC 1C4AA 2VZKB 1SBBB 3BK2A 1QLBB 3U52E 5BMGA 3ZQ4A 4HKZE 4PT5A 5D3IB 4HROA 2CJNA 4KKJA 2YEPF 2GB1A 2LUMA 4ZHPA 2J52A 2BW2A 2IPKD 3NZ3A 4C56C 2KACA 2E6XA 3W5UB 1ENFA 1IUEA 1V1PB 1TKGA 3AE1B 1PDXA 1FO4A 3AE6B 1CZPA 2OEDA 1SSNA 3FILB 4WURA 3E56A 4ZRPA 3R8BA 3ZYYX 2KQ4X 1QILA 4NZLB 1SF0A 2DBYA 2J4XA 2QIEB 3E9SA 1PGXA 3I57A 1N60A 2R61A 3AEDB 4D2KA 2DYMA 2HDEA 1JROA 3HRDD 3W5VB 3TEZA 2NTTA 2H88B 1KLUD 4REZA 1DGJA 4TMAB 1FCCC 2XNAC 2JQRB 1TS2A 4MT5A 1MPEA 2JX5A 2MEKA 5D3DA 4C7ZA 1TKEA 2Y5CA 1ZUD2 2AQ1B 3PZ7A 1FXIA 3TEXA 1QF6A 5BYQA 1UNSA 1WWTA 1EU4A 4GLSC 1ET9A 3Q8AA 3BVMA 1J7AA 1RFKA 1KLGD 3TSSA 4US8A 2V0GA 1DOYA 1ZPSA 3MFGA 1I4XA 3IT6B 3AEFB 2KAJA 4RNAA 1NYQA 5EE1A 1C77A 3SFEB 1J7CA 2BS2B 1F2RI 1D6EC 1T6BX 1BUIC 5HFYA 4A6QA 5TSSA 2CJOA 3W2DA 1EWCA 5I4DA 2JU6X 2WXQA 1ACCA 4JWSC 4P6VF 2M19A 1KFYB 5D7GA 2AQ2B 1E6EB 3AEBB 4HJGE 2L32A 1FXAA 1YQ3B 4KGTA 3W1SA 3KLSX 5EE9A 2JWUA 4IKGA 3NUHB 1QOBA 4YWGG 1QKZA 1AYFA 5HG2A 4XDDA 4YXDB 3IXSA 4A90A 1EWYC 1TKYA 4WAFA 2X38A 4HKQA 1PUTA 4A9AA 3AE2B 1XCTL 3GS2A 4YTPB 3EGRA 1XF5L 1JMLA 1OQQA 1JQ4A 3SR6A 2W55A 3Q8BA 4LTUA 3BIID 1J7BA 5BMIA 1IGCA 1SE3A 3BYTB 2JZPA 4WIPA 3J9CA 2IGHA 2Q5WD 1JWAD 3P42A 2RPVA 1ZP0B 2K22A 4JE3B 3DWMA 2SAKA 1UGJA 4JWUC 3ABVB 2JSVX 4IOIE 4KKIA 2KMMA 3ETRA 2FE8A 3O13A 2NTSA 2B76B 1NENB 1D5MC 3AECB 3WCQA 4OVZA 1QOAA 1AN8A 1E7PB 3U2SC 3AE3B 4B0MA 5T8IA 2WDVB 2W54A 2RDGA 1WSPA 3P4SB 2DWQA 1XEEA 1CJEA 4AS1A 2N0SB 3NS1A 2FUG1 3HUIA 4NAWB 1FRRA 1L0VB 3I9V1 3LB8C 1VJKA 1C4PA 3P1MA 1PGBA 2KDMA 3Q8FA 2BB5A 4C7YA 3B9JA 5AUKA 3SEBA 2GI9A 1L4DB 2INNE 3AE4B 3CWIA 4IDIA 4N59A 2XN9C 5GXGB 2K5PA 2LHEA 1D5ZC 1FNWA 1YNTE 4CQNA 1L6VA 1TY2A 2WXGA 1Q10A 4WQMA 5G5GA 1I4PA 2INPE 2QJLA 3NRZA 1YQ4B 2PIAA 2JXTA 1F0ZA 3T3OA 3AV8A 4XWTA 2D5GA 1YN4A 3P4QB 5H8YE 1PGAA 4WH4A 3BWUD 2MJEA 4ZYSA 1I4HA 1PYWD 2WNMA 3V3XA 1DOIA 1FRDA 1XCQL 1VR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLB A;  3CIR B;  2M56 B;  2W3S A;  2WQY B;  2CJO A;  2WU2 B;  3AEG B;  1ROE A;  1T3Q A;  2E3T A;  4JWS C;  3AMZ A;  4P6V F;  2BS3 B;  1FFU A;  4YTN B;  2M19 A;  1KFY B;  1RYJ A;  4YSY B;  1E6E B;  4YTM B;  3AEB B;  1FXA A;  1YQ3 B;  3NVZ A;  3NVV A;  5EE9 A;  3B2G A;  2WP9 B;  2OHF A;  2MJD A;  1A70 A;  3VR8 B;  1SIJ A;  1E0Z A;  5G5H A;  3KWL A;  3FC4 A;  1QOB A;  1QT9 A;  1I7H A;  3AM9 A;  4WWM A;  1XLN A;  1GAQ B;  1N61 A;  2AX5 A;  5MPO A;  1AYF A;  1FFV A;  1NI3 A;  1NVI D;  4YXD B;  1PFD A;  4N58 A;  1N5X A;  1EWY C;  1TKY A;  2K9X A;  1PUT A;  3PO0 A;  2WU5 B;  1QOF A;  4FXC A;  1FMA D;  3AE2 B;  4US9 A;  4A9A A;  4YSX B;  1TYG B;  4YTP B;  3AE7 B;  1SB3 C;  2HTM E;  2L83 A;  4HRS A;  2W3R A;  1OQQ A;  3AN1 A;  5H92 C;  3SR6 A;  1JQ4 A;  1UWM A;  1XO3 A;  2L52 A;  2W55 A;  4ZOH C;  1E9M A;  1L6U A;  4LTU A;  3AE5 B;  3BII D;  1ZXI A;  1J7B A;  1WXQ A;  3NVY A;  2H89 B;  1V8C A;  1N62 A;  1QLB B;  1YJI A;  2FBW B;  3RPF C;  2Q5W D;  1JWA D;  3AB5 A;  1OQR A;  2MH7 A;  1ZP0 B;  1NYR A;  2K22 A;  4USA A;  3DWM A;  1WYG A;  1XLQ A;  1WRI A;  4JWU C;  4HRO A;  2CJN A;  2CU3 A;  2LEK A;  3SFD B;  3ABV B;  4ZHP A;  1YJJ A;  3AH7 A;  3AEE B;  4N6E B;  2KMM A;  3ETR A;  1B9R A;  2B76 B;  1NEN B;  2PVO D;  3W5U B;  1OFF A;  1XLP A;  3AEC B;  1IUE A;  3WCQ A;  1TKG A;  3AE1 B;  2EKI A;  2MJ3 A;  3P63 A;  1PDX A;  1FO4 A;  1QOA A;  3AE6 B;  1E7P B;  1CZP A;  3AE3 B;  5H8Y E;  3VR9 B;  2WDV B;  3ZYY X;  5C2T B;  5C3J B;  2W54 A;  1RWS A;  1SF0 A;  2DBY A;  3P4S B;  2DWQ A;  1VLB A;  1CJE A;  2N0S B;  2QIE B;  3NS1 A;  4JX1 C;  3HUI A;  1RM6 C;  1AWD A;  1N60 A;  1FRR A;  1L0V B;  3AED B;  1KRH A;  1N5W A;  1V97 A;  5EE0 A;  3HRD D;  1JRO A;  3LB8 C;  1VJK A;  3AE8 B;  1N63 A;  3W5V B;  1QOG A;  2H88 B;  3P1M A;  2BS4 B;  4C7Y A;  3LXF A;  3B9J A;  1DGJ A;  5AUK A;  2JQR B;  3B2F A;  1FRD A;  3NVW A;  1WGK A;  2JX5 A;  3DWG C;  2PKO A;  3P4R B;  3AE4 B;  3CWI A;  4IDI A;  4N59 A;  2BT6 A;  5GXG B;  1TKE A;  4C7Z A;  2Y5C A;  2K5P A;  4ZHO A;  1ZUD 2;  3HVZ A;  3AEA B;  1JAL A;  1JWB D;  2ACZ B;  1FXI A;  1QF6 A;  1L6V A;  2PVG C;  1WWT A;  3VRA B;  4WQM A;  5G5G A;  1NEK B;  3NRZ A;  2QJL A;  1J7A A;  1DOX A;  1RFK A;  1YQ4 B;  1TJE A;  2PIA A;  4US8 A;  4YT0 B;  1DOY A;  3AE9 B;  3L4P A;  3FAH A;  4C80 A;  1F0Z A;  3VRB B;  4ITK A;  3AV8 A;  1JW9 D;  1FM0 D;  4YSZ B;  3AEF B;  2KAJ A;  2WS3 B;  3P4Q B;  3P4P B;  1NYQ A;  1VDV A;  1FIQ A;  1L5P A;  1R7S A;  2G1E A;  1XLO A;  5EE1 A;  2MJE A;  2WDR B;  3W9C B;  1GPX A;  3SFE B;  2WDQ B;  1J7C A;  5AUI A;  4KX6 B;  1DOI A;  1KF6 B;  1ZOY B;  2BS2 B;  3EUB 2;  1JRP A;  1E10 A;  5EE3 A; 
#chains in the Genus database with same CATH topology
 2W3S A;  3H7S A;  3V62 A;  2WXL A;  2J53 A;  1FFU A;  2ZNV C;  1SXT A;  1WXV A;  3PRE A;  3RNE C;  3IAS 1;  3M62 B;  1GAQ B;  3DHH C;  1WGG A;  5MPO A;  1EF1 A;  2V4L A;  4O1N A;  1YOV B;  2WU5 B;  1QOF A;  4FXC A;  2LMC A;  1D5X C;  3JYU A;  2JRH A;  2QMT A;  3DHG C;  3VAW A;  1TT5 B;  4A20 A;  4GDL B;  3GP7 A;  4USA A;  4NAW A;  2IBI B;  2CU3 A;  4N9F 4;  2CHW A;  1UF0 A;  3AEE B;  3R7Q A;  4CHK A;  2NS5 A;  1YN5 A;  2N7J A;  2PVO D;  4RCO A;  1OFF A;  2Z59 B;  2FCS A;  2EKI A;  4URK A;  3H7P A;  2I38 A;  2Y3A A;  2D3C A;  2GMI C;  1VLB A;  2KXJ A;  2LUE A;  4MM3 B;  4ZRJ A;  1K53 A;  2WXR A;  1SEB D;  2LI5 A;  3V61 A;  1WGR A;  2UYZ B;  3PLV A;  3Q3M C;  5CHF A;  3NZU A;  3HVZ A;  1JAL A;  4AUQ C;  2KD0 A;  1WR6 E;  3RNC C;  2LJ5 A;  4MGI E;  1NEK B;  4MEL A;  2BQQ A;  4DXA B;  2NVU I;  1TJE A;  2TSS A;  1KOT A;  1T5X D;  1KJT A;  5FKA C;  1WMH B;  3PPA A;  4WJN A;  5CX3 A;  1XLO A;  4LJO B;  2KKC A;  1E10 A;  3M3J A;  4RF0 A;  2WXN A;  3CIR B;  3DVN V;  2N9K A;  2PMV A;  4WWN A;  4HWI B;  1WMH A;  1WRD B;  4LDT D;  4EE2 A;  2N1W A;  3N9Y C;  1NI3 A;  4N58 A;  2KMA A;  1OEY A;  4US9 A;  5H92 C;  3AN1 A;  4OW0 A;  5CHW A;  2DX5 B;  2BB6 A;  3AE5 B;  4DK5 A;  2JUO A;  2AL3 A;  5JXV A;  2JYE A;  2JT4 B;  1C76 A;  1L7Y A;  4L23 A;  2MSE D;  4HPL B;  4KIK A;  3BZD B;  4GGQ A;  2YLM A;  3Q3F A;  3VR9 B;  1LO5 D;  5C2T B;  1F1H A;  1L0X B;  3URY A;  1KRH A;  1C3T A;  3APF A;  3CST A;  3HHM A;  1IBX A;  4ZRQ A;  2KC1 A;  1MG4 A;  1WGK A;  1ET6 A;  1ZE3 D;  4XWW A;  4HK2 A;  2LHD A;  2NBV B;  3MJW A;  2LGI A;  1UBI A;  4BZA A;  3DVG X;  4DDI D;  1VD2 A;  2I2Y A;  3A9K A;  3VTV A;  3PRP B;  5KHO A;  4A3O A;  4RGO S;  4XC2 A;  1LQB A;  3AE9 B;  1S1Q B;  2L8J A;  1JW9 D;  3DBL I;  2VH2 A;  1Q5W B;  1NDD A;  4KVG B;  4I6L B;  2WDQ B;  4KX6 B;  3SU8 X;  3ZXV A;  4KGS A;  3GOE A;  4W9I A;  3HM6 X;  4OZB A;  3AMZ A;  2R2Q A;  1WJ6 A;  2XBB C;  2MHJ A;  3B2G A;  4AJY B;  4XE0 A;  4MAC A;  4BOS C;  2KDE B;  3PGE A;  2PPH A;  3T8M A;  3EHV A;  4C4V B;  3ZNH B;  5FR3 A;  4W9J A;  4AQ7 A;  2K0P A;  1FD6 A;  2OJW A;  2AQ3 B;  3N1Z C;  5LNK 1;  1P9D U;  5EDS A;  4HPP A;  3WAP A;  2J42 A;  1C4A A;  2M17 A;  3BK2 A;  3RNF C;  3U52 E;  5JHB A;  3MTN B;  1GC7 A;  3PV1 A;  5D3I B;  2YEP F;  4B9K A;  2IPK D;  3NZ3 A;  2D3G A;  1V1P B;  1P3Q U;  3AE6 B;  4WUR A;  3E56 A;  2K8B A;  2JXX A;  3SDL C;  3I63 C;  5DCN A;  2JY6 A;  2RDB C;  1H4R A;  4D2K A;  3DCG A;  2DYM A;  1JRO A;  3UF8 A;  3TEZ A;  3VUY A;  4TMA B;  1FCC C;  2XNA C;  3ZIM A;  1WY8 A;  3NZS A;  1TKE A;  2Y5C A;  3TEX A;  2BGF A;  5BYQ A;  1WWT A;  1E8W A;  1ET9 A;  3Q8A A;  3BIN A;  4US8 A;  3I3T B;  2LZ6 A;  2KAJ A;  4W9C A;  2LGX A;  3V60 A;  1V49 A;  4A3P A;  4P1C C;  1Q0W B;  4LNI A;  4JIO U;  3VTU A;  4I6P A;  1EWC A;  4JWS C;  4P6V F;  4MGK E;  2JVC A;  2WGS A;  1FXA A;  1YQ3 B;  5EE9 A;  4KIK B;  4KDL B;  4NNJ B;  4MDK E;  1WM3 A;  1LM8 B;  2FCM A;  3W1Y A;  4KZ0 A;  3H6N A;  1AYF A;  2FAZ A;  4A90 A;  3FKY A;  2X38 A;  1PUT A;  3AE2 B;  1XCT L;  3EGR A;  3SR6 A;  2W55 A;  1HTO A;  4DHJ D;  1NBF C;  1J7B A;  3BYT B;  2JZP A;  4WIP A;  1R4M I;  5AZG A;  4NJ7 A;  2D3B A;  2SAK A;  4NJ6 A;  4PS7 A;  4IOI E;  2KMM A;  1D5M C;  3I5J C;  4IM0 A;  3Q14 C;  3QJZ A;  2ZEQ A;  1WSP A;  3P4S B;  2DWQ A;  1CJE A;  4AS1 A;  4JGH B;  3W1S C;  2RGF A;  1R4M B;  1FRR A;  1L0V B;  4LDT B;  2W9N A;  2VH1 A;  1C4P A;  4C7Y A;  3APD A;  3SEB A;  4IDI A;  2MBO A;  2LHE A;  5LXH A;  1YD8 U;  2LWP A;  4CQN A;  2WXG A;  2D07 B;  1Q10 A;  4M0W B;  1YIW A;  1MG8 A;  2QJL A;  3AI5 A;  1N6Z A;  2BWF A;  1RAX A;  4FBJ B;  2DAF A;  2C7N B;  1F0Z A;  4EOY A;  1T0R C;  1KLV A;  4FN2 A;  1PGA A;  4IWQ A;  1PYW D;  1WH3 A;  5DPW A;  1V86 A;  3H1U A;  4M8N A;  2CU1 A;  1MHH E;  2WQY B;  3UI3 A;  1M4V A;  4YTN B;  2QDF A;  4GB9 A;  4RGM A;  3KWV A;  1JWS D;  3NVZ A;  4KV2 A;  3A4R A;  4DXG A;  4WQO B;  2MBB B;  2LVP A;  4F1S A;  2L1A A;  4EZJ A;  4Q2J A;  1EF5 A;  1QT9 A;  2ZVN A;  4WWM A;  3R66 C;  5IA7 A;  1N61 A;  2LGY A;  4II2 B;  1PFD A;  2KLG A;  1MJD A;  3TL5 A;  2L83 A;  1K50 A;  3NOB A;  3RFZ B;  4MH8 A;  1EO6 A;  3BVG A;  5E6O A;  2ZPY A;  1E9M A;  2N9X A;  3KUD B;  4RF1 A;  1V8C A;  1N62 A;  3RPF C;  2BKR B;  1P7E A;  5E6J A;  1NYR A;  1WYG A;  2IY0 B;  1D4B A;  2QSD A;  2BPS A;  3B08 A;  1XLP A;  1IBX B;  2MJ3 A;  3UQB A;  1YQB A;  3ALB A;  3Q8C A;  4MH0 E;  4JX1 C;  4M02 A;  5EE0 A;  2GRI A;  2KN4 A;  2N7D A;  2A4Z A;  3A9K B;  1OQY A;  4DQO C;  4W9H A;  2MQJ A;  4W9K A;  2BT6 A;  2QIL A;  3C19 A;  3GE3 C;  1RFA A;  3AEA B;  1JWB D;  2MRP A;  2W82 A;  4E74 A;  2FIF A;  3U4E G;  4B0E A;  1C4C A;  4BBN F;  4MSM B;  2K8H A;  1I4G A;  4XDC A;  4YT0 B;  3FAH A;  4CYE A;  2CKH B;  2DAJ A;  2G1E A;  3AU4 A;  1KF6 B;  2LGS A;  1I42 A;  1CQV A;  1JRP A;  2K3U A;  4PYZ A;  3PZ8 A;  3AEG B;  1J0G A;  4ASW C;  3VVW B;  4GU2 A;  4RGN A;  1RYJ A;  3DQV A;  2K6D B;  4J3O D;  4HDO A;  2AWT A;  3KQ4 A;  2B3A A;  1SIJ A;  3KH0 A;  2QEJ C;  1HA5 A;  3PS6 A;  1E7V A;  2EKE C;  5DPS A;  3EA6 A;  3MC8 A;  2ICI A;  4M00 A;  4A8X C;  2G4S A;  2M4N A;  2RD0 A;  1L6U A;  3N30 A;  1QQR A;  1GOZ A;  1P98 A;  1WJN A;  5D2M B;  2G9H D;  3AB5 A;  4IWP A;  2MH7 A;  2NPT B;  2K39 A;  5J18 A;  2KX3 A;  2M0A A;  2PE9 A;  3SFD B;  2KNB A;  4H2A A;  3AH7 A;  1RLF A;  3VXW A;  1ZDX A;  1YMH E;  1I4R A;  1TTN A;  2LXC A;  1ESF A;  4EEW A;  4MEM A;  2ZVO A;  1RM6 C;  2GBN A;  4OZA A;  1QOG A;  3MHZ A;  4XX5 A;  4LLG M;  3WAN A;  4MJS B;  1LFD A;  2V3N A;  4JQW C;  2LRW A;  4K7S A;  2DEN B;  1V2Y A;  4AJW A;  1MVK A;  4ANV A;  4HCN B;  3B1L X;  1DOX A;  2HE7 A;  2ZZP B;  4BKS A;  4KGR A;  1SIF A;  4C80 A;  3IT4 B;  4S17 A;  1FM0 D;  1WX8 A;  3JSV A;  3P4P B;  1VDV A;  2MX2 A;  2O6V B;  3AXC A;  1K51 A;  2J0M A;  2PLP A;  1ZOY B;  3EUB 2;  2UWQ A;  3ZTD A;  3ZXR A;  1GB4 A;  2BBC A;  4BKT A;  4HVB A;  3L0W B;  3V6C B;  2ASQ A;  3QHT A;  2OHF A;  1E0Z A;  3IAM 1;  2WXJ A;  1I4Q A;  5J17 A;  3JSV B;  1D3Z A;  4TQ1 A;  1TS4 A;  3N1Y C;  3AUL A;  3PO0 A;  2RDH A;  2NR2 A;  3RZW C;  2Y5P A;  1SB3 C;  2WXM A;  2KFK A;  2W3R A;  2KWC A;  3K9P B;  2L52 A;  4ZOH C;  2EEL A;  1X1M A;  2GBM A;  4EZK A;  1LXD A;  1QLB B;  5IO9 A;  4WAA A;  2JZZ A;  5KHQ A;  2G45 B;  3ZQ4 A;  3HIZ A;  4KKJ A;  4EUT A;  4ZHP A;  2GB1 A;  1UZX B;  4FHK A;  2KJ6 A;  2O6V D;  4C56 C;  2KAC A;  2KN5 A;  3QCA A;  1IUE A;  1FO4 A;  3ZRC A;  1Q1O A;  2HD5 B;  3ZLZ A;  3MC9 A;  3RMK C;  2MBH A;  2DBY A;  2J4X A;  3TIX A;  3L17 A;  3AED B;  3L10 B;  3RUL A;  2ZJD A;  2HDE A;  4KSK C;  2KK8 A;  2NTT A;  2RPQ A;  3SD5 A;  2JQR B;  1IPG A;  1E8Z A;  2MEK A;  1J8C A;  3A4S C;  3PZ7 A;  4NY0 A;  2XEW A;  3HK0 A;  4K1R B;  1FXI A;  5AZH A;  1V6E A;  1UNS A;  1EU4 A;  3NY5 A;  1J7A A;  3H7P B;  1RFK A;  2KDB A;  3MHS D;  3MFG A;  4FA6 A;  2UU7 A;  3IT6 B;  3WAL A;  3AEF B;  3GZN I;  3DVN U;  5EE1 A;  1J7C A;  4E71 A;  3UIP B;  1H8C A;  2R2O A;  1WE7 A;  1BUI C;  4A6Q A;  2KAN A;  5TSS A;  2CJO A;  3W2D A;  2LXA A;  4GIV A;  2JU6 X;  1ACC A;  5D7G A;  2KVZ A;  3AEB B;  4HJG E;  3RT3 B;  2JWU A;  3DVG Y;  3ECI A;  4KSL C;  5HG2 A;  4YXD B;  4HKQ A;  4A9A A;  4LNO A;  1IYF A;  1JQ4 A;  5BMI A;  1IGC A;  1SE3 A;  2Q5W D;  1JWA D;  2C7M B;  1ZP0 B;  4ZRI A;  2N9E B;  5J2R A;  2LD9 A;  4CO7 A;  2NTS A;  1NEN B;  2C7H A;  1WX7 A;  3RCZ A;  2IO0 B;  3R3M A;  3U2S C;  4B0M A;  5LXI B;  5T8I A;  2WDV B;  2KJH B;  1WJU A;  2W54 A;  4FJZ A;  3EC8 A;  3OJ4 B;  2N0S B;  3OJ3 A;  3NS1 A;  3U7D A;  3NHE B;  2IO3 B;  2MWS B;  1VCB A;  1FPY A;  3I9V 1;  3P1M A;  1PGB A;  1E90 A;  1QZE A;  2BB5 A;  2KDM A;  3Q8F A;  4BBN C;  1V9J A;  1UGM A;  2AL6 A;  2GI9 A;  2INN E;  3CWI A;  3D32 A;  1UH6 A;  1FNW A;  4ZRK A;  2WX1 A;  1L6V A;  2KDI A;  4EFO A;  5G5G A;  2IO2 B;  1I4P A;  2KTR B;  3L13 A;  2PIA A;  4XZ4 A;  3T3O A;  3AV8 A;  2IZV B;  5DPR A;  1Z5S B;  1YN4 A;  2D5G A;  3P4Q B;  3RNG C;  3L08 A;  4WH4 A;  2KMC A;  2MJE A;  4ZYS A;  1DOI A;  4IUM B;  1FRD A;  3RUI B;  4NAM A;  1FEH A;  3TJP A;  1FNV A;  2KVR A;  2ON8 A;  2WU2 B;  1ROE A;  3ZDM C;  1DYQ A;  3N3K B;  4YTM B;  3ML9 A;  1ZXH A;  1SE4 A;  1WXA A;  4W9G A;  2WP9 B;  2IYD B;  3VR8 B;  4EKU A;  3KWL A;  1I7H A;  2KTR A;  2M0X A;  3AM9 A;  5BMH A;  2DLB A;  1T0Y A;  2K9X A;  1KM7 A;  3T9L A;  4AOF A;  2RMM A;  1TYG B;  3WA0 A;  1HQR D;  1ISN A;  3TEY A;  1BXT A;  2ZCC A;  1WXQ A;  2H89 B;  2V3P A;  2ZW1 A;  2DNF A;  4EZL A;  5HI1 A;  3KW5 B;  3Q3N C;  3ZTC A;  3VUW A;  4W9F A;  2YVC A;  4N6E B;  4FLH A;  4J6I A;  2BF8 B;  5IOI A;  3VH4 B;  3Q3J A;  3ZW3 A;  4W9L A;  1A5R A;  2PW9 A;  4XGA B;  3MC0 B;  1N5W A;  3A33 B;  3AE8 B;  1N63 A;  4LNK A;  1IP9 A;  2KQ7 A;  1J19 A;  2PKO A;  3GE8 C;  4HDQ A;  1HEZ E;  2A5U A;  2AYO B;  3QC8 B;  1K52 A;  4HXD A;  2QC8 A;  2ACZ B;  2L3Z A;  2JYT A;  4BFR A;  2LAS A;  2PVG C;  5BYS A;  4ARC A;  2IGG A;  3KUC B;  2KLC A;  2BYV E;  2GBJ A;  3HM3 A;  3UGB B;  5D6J B;  3OLM D;  5HKH A;  2GBK A;  3VRB B;  4G0N B;  2WS3 B;  3DDC B;  1VZ8 A;  2VRR B;  1L5P A;  2REX A;  1E5W A;  1WXS A;  1GPX A;  5AUI A;  4K3C A;  1TGZ B;  2K6Q A;  1V5O A;  1AW7 A;  5EE3 A;  1C79 A;  1OEY J;  1GUA B;  1CK1 A;  2WXK A;  1WXM A;  3R2T A;  4M8M A;  2K8C A;  2E3T A;  3A1Q B;  2BYT A;  1TS3 A;  4OZC A;  4YSY B;  2IY1 B;  4DHZ E;  2N9P C;  1A70 A;  1Y8R C;  4TKN A;  2AX5 A;  3U7Z A;  4ARI A;  1N5X A;  3RYT A;  3BVZ A;  3TCA A;  1FMA D;  3PT2 B;  4HRS A;  4ICV A;  3ZJV A;  1GNU A;  2YEP B;  1R4N I;  1OQR A;  3T3N A;  2MLB A;  1XLQ A;  3A1Q A;  3C8Y A;  4LK0 M;  4ZYN A;  2C9W B;  2LEK A;  2O2V A;  1YJJ A;  3IHP C;  4F7Z A;  1GG3 A;  2IJ0 A;  5C23 A;  1TZO A;  1B9R A;  2PJH A;  2V4I B;  3FIL A;  3A9J B;  4NJC A;  1VZ6 A;  3P63 A;  4BKG A;  3EEC A;  2LVQ A;  2C60 A;  2V9H A;  2MBE A;  1WE6 A;  1AAR A;  3CF6 E;  2L0T A;  4IC7 B;  4TSS A;  1LGR A;  2KHW B;  2MCN B;  3NJT A;  3RZF A;  4II3 B;  4RM8 A;  1XXG A;  1JRU A;  4W9E A;  2D11 A;  3LXF A;  2WXF A;  3B2F A;  2BYF A;  3DWG C;  1E8X A;  4ZDV A;  1C9F A;  2ZPN A;  1EM7 A;  2HJ1 A;  4ANU A;  1MHX A;  2IGD A;  3ONS A;  3ZRF A;  1L2N A;  1YN3 A;  3BYY B;  2KZR A;  2JPH A;  3GZN B;  2LVO A;  1HXY D;  4ITK A;  2KYW A;  1SJH D;  2WDT B;  3W9C B;  2WDR B;  5FK9 C;  4OHJ A;  5IP4 D;  2WLB A;  2DZK A;  4K3B A;  1S3S G;  4DHJ B;  2VZK D;  2HTH A;  1WJ4 A;  3MJ5 A;  3S2A A;  3ZJT A;  4GN1 A;  3V05 A;  1SE9 A;  2MJD A;  4PS8 A;  4HEA 1;  4M0W A;  2O6V A;  1WGH A;  4R3D A;  3OWE B;  2Z8L A;  2SEB D;  3GB1 A;  1FFV A;  1HZ5 A;  4PK1 A;  1E7U A;  1L0Y B;  3M63 B;  3ZVV A;  5AEK B;  1WF9 A;  4YSX B;  3ZGZ A;  4NQL B;  2LFI A;  2PTL A;  1UWM A;  2L76 A;  4GDK B;  4B95 A;  3QIJ A;  3CMM B;  2BYE A;  4NQK E;  4HKZ E;  2CJN A;  1WX9 A;  2BW2 A;  3PZD A;  1ENF A;  1TKG A;  2BWE S;  3AE1 B;  4F8C B;  1PDX A;  2RR9 A;  1SSN A;  4ZRP A;  3R8B A;  3VDZ A;  3ZNI D;  1QIL A;  4NZL B;  3E9S A;  1PGX A;  3ML8 A;  2R61 A;  2MBQ A;  2KOX A;  2H88 B;  2NBW B;  4REZ A;  2L0F A;  3EFC A;  1TS2 A;  2JX5 A;  2I1J A;  1ZW7 A;  4C7Z A;  2HJ8 A;  3RN9 C;  4MM3 A;  3RI7 C;  1QF6 A;  5IKC M;  3QA8 A;  1P0R A;  4FJV B;  2KDF B;  4GOC A;  3PRZ A;  1KLG D;  3KYD D;  3TSS A;  2V0G A;  4K81 A;  1DOY A;  1I4X A;  2D3A A;  2NBU A;  1WI0 A;  2MW5 A;  1HE8 A;  4ANW A;  2JZ3 B;  2BS2 B;  1D6E C;  1T6B X;  2L00 B;  3X23 A;  2MP2 A;  4K7W A;  2IND C;  3JW0 X;  3DHI C;  2M19 A;  1KFY B;  1E6E B;  1BT0 A;  2L32 A;  3W1S A;  2CS4 A;  3PSE B;  4DDG D;  1TIF A;  4PYU A;  2WX0 A;  1QKZ A;  4XDD A;  1EUV B;  3LDZ E;  3IXS A;  1Z2M A;  3ENE A;  1EWY C;  4NPN A;  5D94 A;  4WAF A;  3Q8B A;  2RSU A;  2ZNV B;  4LTU A;  5L83 A;  2FNJ B;  3J9C A;  1MFW A;  3P42 A;  2RPV A;  2K22 A;  3R7R A;  4JE3 B;  4KZC A;  3DWM A;  1UGJ A;  2PE6 B;  4JWU C;  2N7E A;  2JSV X;  4HLE A;  3ETR A;  2FE8 A;  3O13 A;  3ZUN A;  3BY4 B;  1WIA A;  3AEC B;  3UIN B;  3APC A;  5L95 C;  4OVZ A;  1E7P B;  3PRM B;  3AE3 B;  4G11 A;  3VHT C;  5JH5 C;  1XEE A;  3PLU A;  2FUG 1;  2KFJ A;  3HUI A;  4NAW B;  5E6P A;  4IM3 A;  3L54 A;  2ZCB A;  4GDK A;  3KUZ A;  2D10 A;  4WJP A;  3Q6B A;  2FUH B;  1YNT E;  3N32 A;  1TY2 A;  4RMA A;  2INC C;  5GMV A;  2INP E;  2NPT A;  4C00 A;  1YQ4 B;  3ZNG C;  3N20 C;  2JXT A;  1WYW B;  3AU5 A;  1SGH A;  5H8Y E;  1I4H A;  2WNM A;  3V3X A;  3C0R B;  2JWZ A;  1VR9 A;  2XK5 A;  4L2Y A;  2ZW0 A;  4TV3 A;  2OOB B;  1VRA B;  2CHX A;  4K7U A;  3RNB C;  3TMP B;  3NS8 A;  1XD3 B;  2BKF A;  2MA9 B;  2M1M A;  3QX1 A;  1HZ6 A;  5G5H A;  1UUP A;  1XLN A;  4WJQ A;  4X57 B;  2JF5 A;  2G4D B;  4WWP A;  3EFU A;  3WAM A;  2AEH A;  3KVF B;  4PS3 A;  3MP9 A;  2HTM E;  3DOW A;  3H8H A;  1XO3 A;  2WXH A;  5HHD G;  1ZXI A;  2PEA A;  4P16 A;  4QAY A;  2X8X X;  4ICU A;  2FBW B;  3QQ8 B;  5CTR C;  2KTF A;  1WRI A;  3R2I A;  1WFY A;  3TUO A;  2IO1 B;  5JZE B;  2J0J A;  2LGD A;  5C3J B;  4JLC A;  4A55 A;  2DZJ A;  1RWS A;  2DYO A;  1WGY A;  1Y56 A;  3WIM A;  1TS5 A;  4RM9 A;  1AWD A;  1T0Q C;  3V6E B;  2N9L A;  4DBG A;  3TEW A;  3H9D A;  3NVW A;  2O2V B;  1R4N B;  3P4R B;  2KJR A;  4ZHO A;  4W9D A;  1MI0 A;  3DBR B;  2DZM A;  2L7R A;  1V1O A;  2Y5B B;  1XQQ A;  4RFB A;  4P7I A;  5FR6 A;  3ZO5 B;  3VRA B;  4G3X B;  4L1B A;  1JWM D;  2G3Q B;  4DXF A;  5BYR A;  1STE A;  4YSZ B;  1ZDV A;  1FIQ A;  2KWV B;  2EMT A;  2KWU B;  2J7Q B;  3JVZ X;  4GDL A;  1TY0 A;  2FID A;  2N4F A;  3VQI A;  2M56 B;  5C1Z A;  3ZKJ C;  1XT9 B;  3ZJU A;  1K8R B;  2BS3 B;  3TBL D;  4JL9 A;  4B6W A;  3NVV A;  1UEL A;  2DYB A;  4TUU A;  5IAA C;  2OJR A;  3BK1 A;  4M01 A;  2GBR A;  3UQA A;  1SE2 A;  3Q2A C;  1GC6 A;  1GB1 A;  2LRU A;  3QK0 A;  4BAX A;  1L4Z B;  2JRI B;  4E3C A;  1CMX B;  3DBS A;  2BTE A;  3OG5 A;  4FJY A;  3U8Z A;  1BML C;  1P1A A;  3NVY A;  1UBQ A;  1YJI A;  5G55 A;  1WGD A;  3N1X C;  2NMQ A;  4GSW A;  2KX0 A;  2DHZ A;  1EU3 A;  4G50 A;  4TQ0 A;  2V3S A;  1C1Y B;  4C4V A;  1I35 A;  1FCL A;  1FNU A;  3Q69 A;  1F77 A;  4JPS A;  1SJE D;  4UDU C;  3NG0 A;  4MJS A;  2L05 A;  1IGD A;  1PQS A;  5BO4 B;  2WXO A;  3Q8E A;  4LNN A;  4DWF A;  4P1B C;  4HCP B;  1FXT B;  2KQS A;  3B0A A;  4WWO A;  1B1Z A;  1ZGU B;  2D2Q A;  2IDY A;  1V97 A;  3DBL B;  3SHQ A;  1JCK B;  2ONQ A;  2NCN A;  1KTK A;  2N1V A;  3U30 A;  2BS4 B;  1V80 A;  2KC2 A;  1JWU D;  1T0S C;  3LJ3 A;  1GJZ A;  5DPT A;  5AZF A;  4RGT A;  5TR5 A;  3O65 B;  1RRB A;  1UWX A;  3QAQ A;  4GMV A;  4GXB A;  3VTW A;  3L4P A;  1C78 A;  2QCZ A;  4OVV A;  1P7F A;  1R7S A;  1WM2 A;  3LYY A;  2QHO A;  2KWD A;  1KH0 A;  1HTQ A;  2K1F A;  3HVD A;  4I6N B;  1T3Q A;  1V5T A;  3K9O B;  2WXI A;  2LJI A;  4IM2 A;  4RH6 A;  3Q3O C;  3P2B A;  3FC4 A;  4LJP B;  5IN7 A;  1NVI D;  3RNA C;  1V1P A;  2WXP A;  1F52 A;  3AE7 B;  3RD2 A;  1VZ7 A;  1YJ1 A;  4IWO A;  4MGY E;  1TZ1 A;  3DPD A;  1F2R C;  2VZK B;  3UIO B;  1SBB B;  5BMG A;  3QWZ B;  2I1K A;  4LNF A;  5CHV C;  4PT5 A;  4HRO A;  4ANX A;  3PHX B;  4HJK A;  2LUM A;  2J52 A;  2E6X A;  3W5U B;  2K25 A;  3L16 A;  2BVC A;  1CZP A;  2OED A;  3FIL B;  3IBE A;  4YL8 A;  3ZYY X;  2KQ4 X;  1SF0 A;  1OTR B;  2QIE B;  3I57 A;  5LLI A;  1N60 A;  2GOW A;  3HRD D;  3W5V B;  1M94 A;  1KLU D;  2WWZ A;  1DGJ A;  5E6N A;  4MT5 A;  1MPE A;  2FCN A;  2KO3 A;  4FHJ A;  5D3D A;  3PVL A;  3ZDT A;  1ZUD 2;  2AQ1 B;  2Z0D B;  4BKS D;  2Z0E B;  2FCQ A;  5JHA A;  3OAW A;  4GLS C;  3BVM A;  3WAO A;  3DBR I;  2CHZ A;  1ZPS A;  4WJO A;  4RNA A;  1NYQ A;  3DBH B;  2KFK B;  1C77 A;  3SFE B;  4BVU C;  2M8S A;  1F2R I;  1YX6 B;  2CR5 A;  5HFY A;  4IG7 B;  4LCD E;  1WZ0 A;  2J0K A;  2V1Y A;  5I4D A;  2WXQ A;  2AQ2 B;  3VFK A;  4KGT A;  3KLS X;  4IKG A;  3NUH B;  3M95 A;  1QOB A;  4MGZ E;  2EMS A;  4YWG G;  3VUX A;  4FUL A;  1TKY A;  4FAD A;  1F9J A;  3GS2 A;  4YTP B;  1XF5 L;  1JML A;  1OQQ A;  1UD7 A;  1ZKH A;  3BII D;  3PHW B;  2WHI A;  2IGH A;  2XK5 B;  2C5L C;  4AWJ A;  1TBE A;  1OGW A;  4S0R A;  1V81 A;  1WR1 A;  3ABV B;  1G6J A;  4KKI A;  4HPM B;  2B76 B;  3QAR A;  3WCQ A;  1QOA A;  1AN8 A;  3IVF A;  3PTF C;  3ZNZ B;  2RDG A;  4AP4 C;  3IFW B;  1WZ3 A;  3CSF A;  2DZI A;  4ACF A;  3LB8 C;  1VJK A;  4IW0 A;  1NI2 A;  3B9J A;  5AUK A;  1U4A A;  1L4D B;  3AE4 B;  4N59 A;  5GXG B;  2XN9 C;  4KDI C;  2GLS A;  2K5P A;  1D5Z C;  4XYC A;  3KYC D;  3X0W A;  1E8Y A;  4WQM A;  3NRZ A;  5G2N A;  3A9J A;  1YX5 B;  3VH3 B;  2MP2 B;  3IG3 A;  4XWT A;  2WYQ A;  2KT7 A;  4DHZ B;  3BWU D;  4OVU A;  3DBH I;  4MSQ B;  4BOZ B;  1XCQ L; 
#chains in the Genus database with same CATH homology
 4NAM A;  2W3S A;  1FEH A;  1MHH E;  2WQY B;  1FNV A;  2WU2 B;  2ON8 A;  2WXL A;  1ROE A;  1M4V A;  2ZW0 A;  1VRA B;  4L2Y A;  3UI3 A;  1DYQ A;  4YTN B;  2J53 A;  1FFU A;  4RGM A;  1SXT A;  4YTM B;  3KWV A;  1JWS D;  3NVZ A;  1ZXH A;  1SE4 A;  4DXG A;  3IAS 1;  2WP9 B;  3VR8 B;  1HZ6 A;  5G5H A;  1UUP A;  2L1A A;  3KWL A;  4Q2J A;  1QT9 A;  1I7H A;  3AM9 A;  4WWM A;  1XLN A;  1GAQ B;  5BMH A;  1N61 A;  2DLB A;  5MPO A;  1PFD A;  2K9X A;  4O1N A;  2WU5 B;  1QOF A;  4FXC A;  2LMC A;  1D5X C;  2RMM A;  1TYG B;  2QMT A;  2L83 A;  1K50 A;  2HTM E;  3MP9 A;  4MH8 A;  1HQR D;  3RFZ B;  3BVG A;  3H8H A;  1XO3 A;  2WXH A;  1E9M A;  5HHD G;  3TEY A;  1BXT A;  1ZXI A;  4P16 A;  1WXQ A;  4RF1 A;  2H89 B;  1V8C A;  2V3P A;  1N62 A;  2FBW B;  2ZW1 A;  4GDL B;  3RPF C;  3GP7 A;  1P7E A;  5E6J A;  1NYR A;  4USA A;  5HI1 A;  1WYG A;  1WRI A;  1D4B A;  2CU3 A;  3R2I A;  2QSD A;  3TUO A;  3AEE B;  4N6E B;  2N7J A;  1YN5 A;  2PVO D;  4RCO A;  1OFF A;  1XLP A;  1IBX B;  2EKI A;  2MJ3 A;  5C3J B;  2I38 A;  4A55 A;  1RWS A;  2Y3A A;  2PW9 A;  3Q8C A;  2DYO A;  1VLB A;  3MC0 B;  1Y56 A;  4JX1 C;  1TS5 A;  4MM3 B;  1K53 A;  2WXR A;  1AWD A;  2GRI A;  5EE0 A;  1N5W A;  1SEB D;  2KN4 A;  2N9L A;  1N63 A;  3AE8 B;  4DQO C;  3TEW A;  3NVW A;  2PKO A;  3P4R B;  4ZHO A;  2BT6 A;  2QIL A;  1HEZ E;  1MI0 A;  3HVZ A;  3AEA B;  1JAL A;  1K52 A;  1JWB D;  1V1O A;  2ACZ B;  2W82 A;  2JYT A;  3U4E G;  4RFB A;  2PVG C;  4B0E A;  1C4C A;  3VRA B;  5BYS A;  4ARC A;  2IGG A;  1NEK B;  1I4G A;  1TJE A;  4XDC A;  4YT0 B;  2TSS A;  1T5X D;  3FAH A;  4L1B A;  1JWM D;  3VRB B;  4DXF A;  5BYR A;  1STE A;  5FKA C;  4YSZ B;  1ZDV A;  2WS3 B;  1VZ8 A;  2G1E A;  1FIQ A;  1L5P A;  1XLO A;  1GPX A;  5AUI A;  1KF6 B;  1CQV A;  1JRP A;  1AW7 A;  5EE3 A;  1CK1 A;  1C79 A;  2WXK A;  1TY0 A;  2WXN A;  4RF0 A;  3CIR B;  1E10 A;  3VQI A;  2M56 B;  2K3U A;  2N9K A;  2PMV A;  3R2T A;  3PZ8 A;  3AEG B;  3ZJU A;  2E3T A;  2BYT A;  1TS3 A;  2BS3 B;  4OZC A;  4RGN A;  1RYJ A;  4YSY B;  4J3O D;  3NVV A;  3KQ4 A;  1A70 A;  3BK1 A;  1SIJ A;  4EE2 A;  2QEJ C;  1HA5 A;  1SE2 A;  1GB1 A;  2AX5 A;  3N9Y C;  3U7Z A;  4ARI A;  1NI3 A;  1L4Z B;  4N58 A;  1N5X A;  3BVZ A;  1FMA D;  3EA6 A;  4US9 A;  2ICI A;  4HRS A;  5H92 C;  4A8X C;  3AN1 A;  3ZJV A;  2BTE A;  4OW0 A;  1BML C;  1L6U A;  2BB6 A;  3AE5 B;  1QQR A;  1GOZ A;  3NVY A;  2YEP B;  1YJI A;  2G9H D;  3AB5 A;  5JXV A;  1OQR A;  2MH7 A;  2NMQ A;  3T3N A;  1XLQ A;  3C8Y A;  1EU3 A;  4LK0 M;  2M0A A;  2LEK A;  3SFD B;  2JYE A;  4TQ0 A;  4H2A A;  1YJJ A;  3AH7 A;  1C76 A;  4L23 A;  2IJ0 A;  1TZO A;  1FCL A;  1FNU A;  1B9R A;  3Q69 A;  1F77 A;  3BZD B;  1ZDX A;  3FIL A;  2V4I B;  4JPS A;  1YMH E;  1I4R A;  4NJC A;  1VZ6 A;  3P63 A;  1SJE D;  4UDU C;  3VR9 B;  1LO5 D;  5C2T B;  1IGD A;  2WXO A;  3Q8E A;  1ESF A;  4TSS A;  1L0X B;  1B1Z A;  2IDY A;  1RM6 C;  3URY A;  1KRH A;  1V97 A;  1JCK B;  2ONQ A;  1KTK A;  1XXG A;  4ZRQ A;  1IBX A;  4OZA A;  1QOG A;  3MHZ A;  2BS4 B;  4LLG M;  3LXF A;  2WXF A;  3B2F A;  1WGK A;  1JWU D;  3DWG C;  1ET6 A;  1ZE3 D;  2V3N A;  4XWW A;  1C9F A;  2LHD A;  1EM7 A;  2LGI A;  1MVK A;  1MHX A;  2I2Y A;  2IGD A;  4RGT A;  1DOX A;  1YN3 A;  1UWX A;  3BYY B;  4RGO S;  4KGR A;  3AE9 B;  3L4P A;  1C78 A;  4C80 A;  3IT4 B;  1HXY D;  4ITK A;  1JW9 D;  1FM0 D;  1SJH D;  1P7F A;  3P4P B;  1VDV A;  1R7S A;  3W9C B;  2WDR B;  1K51 A;  2WDQ B;  5FK9 C;  2PLP A;  4KX6 B;  4OHJ A;  1ZOY B;  3EUB 2;  3LYY A;  4KGS A;  2KWD A;  1KH0 A;  2WLB A;  1GB4 A;  3HVD A;  4OZB A;  1T3Q A;  2VZK D;  3AMZ A;  2BBC A;  2WXI A;  2LJI A;  3MJ5 A;  3ZJT A;  3B2G A;  4RH6 A;  3V05 A;  4XE0 A;  4MAC A;  2OHF A;  2MJD A;  1E0Z A;  3IAM 1;  2WXJ A;  4HEA 1;  1I4Q A;  4M0W A;  3FC4 A;  4R3D A;  3OWE B;  2Z8L A;  2SEB D;  3GB1 A;  1FFV A;  1NVI D;  1HZ5 A;  4TQ1 A;  1TS4 A;  1L0Y B;  5FR3 A;  3PO0 A;  2RDH A;  4YSX B;  1V1P A;  2WXP A;  4AQ7 A;  2Y5P A;  3ZGZ A;  2K0P A;  2LFI A;  3AE7 B;  1SB3 C;  2WXM A;  2AQ3 B;  2PTL A;  1VZ7 A;  2W3R A;  1FD6 A;  1UWM A;  2L52 A;  4ZOH C;  2EEL A;  5LNK 1;  4GDK B;  2J42 A;  1F2R C;  1C4A A;  2VZK B;  1SBB B;  3BK2 A;  1QLB B;  3U52 E;  5BMG A;  3ZQ4 A;  4HKZ E;  4PT5 A;  5D3I B;  4HRO A;  2CJN A;  4KKJ A;  2YEP F;  2GB1 A;  2LUM A;  4ZHP A;  2J52 A;  2BW2 A;  2IPK D;  3NZ3 A;  4C56 C;  2KAC A;  2E6X A;  3W5U B;  1ENF A;  1IUE A;  1V1P B;  1TKG A;  3AE1 B;  1PDX A;  1FO4 A;  3AE6 B;  1CZP A;  2OED A;  1SSN A;  3FIL B;  4WUR A;  3E56 A;  4ZRP A;  3R8B A;  3ZYY X;  2KQ4 X;  1QIL A;  4NZL B;  1SF0 A;  2DBY A;  2J4X A;  2QIE B;  3E9S A;  1PGX A;  3I57 A;  1N60 A;  2R61 A;  3AED B;  4D2K A;  2DYM A;  2HDE A;  1JRO A;  3HRD D;  3W5V B;  3TEZ A;  2NTT A;  2H88 B;  1KLU D;  4REZ A;  1DGJ A;  4TMA B;  1FCC C;  2XNA C;  2JQR B;  1TS2 A;  4MT5 A;  1MPE A;  2JX5 A;  2MEK A;  5D3D A;  4C7Z A;  1TKE A;  2Y5C A;  1ZUD 2;  2AQ1 B;  3PZ7 A;  1FXI A;  3TEX A;  1QF6 A;  5BYQ A;  1UNS A;  1WWT A;  1EU4 A;  4GLS C;  1ET9 A;  3Q8A A;  3BVM A;  1J7A A;  1RFK A;  1KLG D;  3TSS A;  4US8 A;  2V0G A;  1DOY A;  1ZPS A;  3MFG A;  1I4X A;  3IT6 B;  3AEF B;  2KAJ A;  4RNA A;  1NYQ A;  5EE1 A;  1C77 A;  3SFE B;  1J7C A;  2BS2 B;  1F2R I;  1D6E C;  1T6B X;  1BUI C;  5HFY A;  4A6Q A;  5TSS A;  2CJO A;  3W2D A;  1EWC A;  5I4D A;  2JU6 X;  2WXQ A;  1ACC A;  4JWS C;  4P6V F;  2M19 A;  1KFY B;  5D7G A;  2AQ2 B;  1E6E B;  3AEB B;  4HJG E;  2L32 A;  1FXA A;  1YQ3 B;  4KGT A;  3W1S A;  3KLS X;  5EE9 A;  2JWU A;  4IKG A;  3NUH B;  1QOB A;  4YWG G;  1QKZ A;  1AYF A;  5HG2 A;  4XDD A;  4YXD B;  3IXS A;  4A90 A;  1EWY C;  1TKY A;  4WAF A;  2X38 A;  4HKQ A;  1PUT A;  4A9A A;  3AE2 B;  1XCT L;  3GS2 A;  4YTP B;  3EGR A;  1XF5 L;  1JML A;  1OQQ A;  1JQ4 A;  3SR6 A;  2W55 A;  3Q8B A;  4LTU A;  3BII D;  1J7B A;  5BMI A;  1IGC A;  1SE3 A;  3BYT B;  2JZP A;  4WIP A;  3J9C A;  2IGH A;  2Q5W D;  1JWA D;  3P42 A;  2RPV A;  1ZP0 B;  2K22 A;  4JE3 B;  3DWM A;  2SAK A;  1UGJ A;  4JWU C;  3ABV B;  2JSV X;  4IOI E;  4KKI A;  2KMM A;  3ETR A;  2FE8 A;  3O13 A;  2NTS A;  2B76 B;  1NEN B;  1D5M C;  3AEC B;  3WCQ A;  4OVZ A;  1QOA A;  1AN8 A;  1E7P B;  3U2S C;  3AE3 B;  4B0M A;  5T8I A;  2WDV B;  2W54 A;  2RDG A;  1WSP A;  3P4S B;  2DWQ A;  1XEE A;  1CJE A;  4AS1 A;  2N0S B;  3NS1 A;  2FUG 1;  3HUI A;  4NAW B;  1FRR A;  1L0V B;  3I9V 1;  3LB8 C;  1VJK A;  1C4P A;  3P1M A;  1PGB A;  2KDM A;  3Q8F A;  2BB5 A;  4C7Y A;  3B9J A;  5AUK A;  3SEB A;  2GI9 A;  1L4D B;  2INN E;  3AE4 B;  3CWI A;  4IDI A;  4N59 A;  2XN9 C;  5GXG B;  2K5P A;  2LHE A;  1D5Z C;  1FNW A;  1YNT E;  4CQN A;  1L6V A;  1TY2 A;  2WXG A;  1Q10 A;  4WQM A;  5G5G A;  1I4P A;  2INP E;  2QJL A;  3NRZ A;  1YQ4 B;  2PIA A;  2JXT A;  1F0Z A;  3T3O A;  3AV8 A;  4XWT A;  2D5G A;  1YN4 A;  3P4Q B;  5H8Y E;  1PGA A;  4WH4 A;  3BWU D;  2MJE A;  4ZYS A;  1I4H A;  1PYW D;  2WNM A;  3V3X A;  1DOI A;  1FRD A;  1XCQ L;  1VR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...