1B9RA

Terpredoxin from pseudomonas sp.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
105
structure length
105
Chain Sequence
PRVVFIDEQSGEYAVDAQDGQSLMEVATQNGVPGIVAECGGSCVCATCRIEIEDAWVEIVGEANPDENDLLQSTGEPMTAGTRLSCQVFIDPSMDGLIVRVPLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TERPREDOXIN)
publication title A model for the solution structure of oxidized terpredoxin, a Fe2S2 ferredoxin from Pseudomonas.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Ferredoxin
total genus 11
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1999-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b9rA00
4ZOHC 1OFFA 1QF6A 1N5XA 5EE3A 3W5UB 5EE9A 2HTME 1WXQA 1E7PB 1XLNA 1FO4A 1WRIA 1TKYA 3B2FA 3NVZA 3W9CB 2BS3B 2JQRB 3LXFA 1JQ4A 4C7ZA 2W3SA 1JALA 1A70A 2CJNA 2W55A 1E0ZA 1WWTA 2AX5A 4YSXB 1SB3C 3RPFC 1E9MA 3AE4B 4WQMA 5C2TB 1N61A 3B9JA 1RM6C 1RWSA 3DWMA 5EE1A 3ETRA 2G1EA 3NVVA 3BIID 3AEDB 1NVID 3B2GA 2WLBA 1N5WA 2M19A 4US9A 3AE3B 2M56B 1EWYC 2E3TA 1J7CA 4N58A 5H92C 1V97A 2DBYA 3LB8C 1IUEA 1TJEA 5AUIA 3AV8A 1TKEA 1JW9D 3CWIA 2WQYB 1UWMA 1ZOYB 2PVOD 2BS2B 1N60A 2WDRB 1XLPA 3AE2B 4JWSC 4YSYB 1E6EB 1N63A 2L52A 3P1MA 4FXCA 1DOIA 1KFYB 1KRHA 1T3QA 2MJEA 1ROEA 1QOFA 2WS3B 2DWQA 3KWLA 1DOYA 1DGJA 3AE5B 1GPXA 3NRZA 5H8YE 2FBWB 2BS4B 1NYQA 3HUIA 1E10A 3P4RB 1FRRA 1YJIA 4ZHOA 1V8CA 1QT9A 4YT0B 3AEFB 3SFDB 3L4PA 1ZXIA 3AE6B 4YSZB 4A9AA 1J7AA 2Q5WD 4IDIA 2K22A 3VR8B 2W3RA 1FFVA 4ITKA 1VDVA 4WWMA 1RFKA 3FAHA 3AB5A 1GAQB 1FM0D 3PO0A 4USAA 5MPOA 3AMZA 2L83A 5EE0A 3P4SB 1XLOA 2Y5CA 3AEEB 3P4PB 5GXGB 1YQ3B 1JROA 1ZUD2 2K5PA 1AYFA 2LEKA 3FC4A 1RYJA 2MJDA 2QJLA 4LTUA 1OQRA 1OQQA 1QOBA 3AECB 1TYGB 3P4QB 2PVGC 3AEBB 5G5HA 1SIJA 4YTNB 3W5VB 2WDQB 2PKOA 1QOGA 1PUTA 3HVZA 2B76B 3HRDD 3P63A 3VR9B 3WCQA 3ZYYX 1CJEA 5C3JB 3AM9A 4US8A 1FMAD 1FXAA 4HROA 1FXIA 3SR6A 1FFUA 4JWUC 1WYGA 1F0ZA 4YXDB 1NYRA 1L5PA 1SF0A 1R7SA 3SFEB 2K9XA 1YJJA 1DOXA 1L0VB 4C7YA 3NS1A 1VJKA 2BT6A 1NEKB 3AEGB 3VRAB 3AE8B 1XLQA 1YQ4B 2EKIA 1B9RA 4JX1C 2MH7A 1FIQA 1VLBA 2CU3A 1JRPA 2WDVB 2WU5B 1FRDA 2WU2B 3AEAB 2CJOA 1XO3A 2KAJA 2OHFA 1I7HA 1L6VA 3AH7A 1KF6B 3ABVB 1JWBD 2MJ3A 2N0SB 3AN1A 1J7BA 2WP9B 1PDXA 1AWDA 2H89B 1ZP0B 2H88B 2PIAA 1CZPA 3AE1B 3NVYA 3NVWA 4N59A 4P6VF 1QOAA 5G5GA 4HRSA 4YTPB 1JWAD 1TKGA 3VRBB 4ZHPA 3AE9B 4N6EB 1PFDA 4YTMB 1L6UA 1NI3A 4KX6B 2ACZB 5AUKA 3DWGC 3AE7B 4C80A 1NENB 2KMMA 1N62A 2QIEB 3CIRB 2JX5A 1QLBB 3EUB2 1WGKA 2W54A
chains in the Genus database with same CATH superfamily
3QARA 1N5XA 3Q6BA 4C4VA 2LGXA 4ANWA 2KKCA 5LXIB 3H8HA 2PPHA 4A3OA 1C1YB 1UH6A 3RPFC 1C79A 2OEDA 2RDBC 4WQMA 4CHKA 1RM6C 3VH3B 2LGYA 2FUG1 4A3PA 3UI3A 4US9A 1GUAB 1WX9A 1UD7A 1NBFC 4NNJB 2MA9B 2MBQA 4OZBA 2WQYB 1UWMA 1TY2A 2ZW1A 1JWSD 4HPMB 4ANVA 2EMSA 4GOCA 4WWPA 1WF9A 2EMTA 4W9HA 1YN3A 1ISNA 4II2B 5E6OA 1ZW7A 2DYBA 4KVGB 1WM3A 2WXGA 3P4PB 3UQAA 2LEKA 1SEBD 3AECB 2PVGC 3ML9A 2MHJA 4RGNA 1QOGA 1WXAA 1FMAD 4HKZE 1BMLC 4IC7B 1L5PA 2PW9A 2K9XA 4L2YA 2G4SA 3NS1A 4URKA 3VRAB 1XLQA 2MX2A 2WX0A 3PHXB 2NBVB 2KAJA 2WXRA 5TSSA 2UWQA 1PDXA 2H89B 3EA6A 5DPTA 2C5LC 3WAPA 1R4NB 3ENEA 4EUTA 4JQWC 1I42A 2L05A 2KNBA 3AE7B 4ZYSA 1V81A 2ZPYA 2BB6A 1L2NA 4RGTA 3MTNB 1CMXB 3I9V1 1E5WA 4KIKA 3W1YA 1N6ZA 2KQSA 5LNK1 2KHWB 4G3XB 1E7PB 5L83A 1LO5D 2IDYA 1I4HA 3LXFA 3QK0A 4OVZA 2KN5A 2JUOA 3MC0B 1F2RC 2FCMA 1ZGUB 3TMPB 5FR3A 1EUVB 2BB5A 3ETRA 3VTUA 1T0QC 2BTEA 4TV3A 2M56B 2QCZA 1V6EA 4E74A 4FHJA 4XX5A 1M4VA 4S17A 3JW0X 3N20C 1P7FA 2WDRB 2WHIA 4XWWA 4BZAA 2BWES 5L95C 3HM6X 1WX7A 1WI0A 1KLVA 1BT0A 3H9DA 4TMAB 5JZEB 4GU2A 2WXKA 3AE6B 1YMHE 5IA7A 2KDMA 4TSSA 1WXVA 4OVVA 1JROA 1I4QA 3DBHB 4LTUA 4MM3A 3QCAA 1JMLA 3M3JA 1NYRA 4AP4C 1FXTB 2MCNB 1PGAA 2MQJA 2V3SA 2QSDA 1JRUA 1L6VA 3ABVB 1ET6A 3AN1A 3A9KA 1JWUD 1KOTA 1IBXA 3R2IA 3DBLI 2NPTB 1Z5SB 4YTPB 4IWPA 2YLMA 4WWNA 4BOZB 1EM7A 2G3QB 4C56C 2DAFA 1C76A 2EELA 2VRRB 1C4AA 1TBEA 1BUIC 3Q2AC 2V3PA 2YVCA 3N3KB 3V05A 3DBRB 2Z8LA 3JSVB 3RT3B 4PS3A 2KZRA 2ZNVB 4HCPB 3DBSA 1V97A 4B95A 5J17A 4KGSA 1D5XC 4BOSC 2NTSA 1D3ZA 1UGJA 3L17A 4ZDVA 3ZW3A 1ROEA 1MPEA 2KD0A 2WWZA 1WJNA 4ZRJA 2MWSB 2J42A 3O13A 3X23A 1ENFA 3IAS1 3P2BA 4GIVA 4AQ7A 3L4PA 3APCA 2SAKA 2Q5WD 2W3RA 2INNE 4HLEA 3PGEA 1GAQB 1EF1A 1WGDA 1ZUD2 2OJRA 3U30A 2KX0A 1TIFA 2VH2A 3W5VB 2V1YA 5FR6A 1LXDA 1PUTA 3HVZA 4GDKB 1FXIA 3L08A 4G0NB 1X1MA 4ACFA 4WAAA 4H2AA 1NEKB 4HJGE 1RFAA 3E9SA 3ECIA 2MH7A 3C0RB 3DHGC 1PQSA 1WR1A 3WAMA 1AWDA 4XZ4A 3N1YC 5G5GA 4P1CC 2JRHA 1KLUD 4KX6B 2G4DB 1C3TA 2JPHA 1F2RI 3ZTCA 5DPRA 3QC8B 3ALBA 1Q1OA 4MELA 2I2YA 5BYSA 1A70A 4HPLB 4L1BA 2N1WA 1SJHD 5HG2A 2XEWA 4B6WA 4LDTB 1V5OA 1UBQA 1WGGA 4I6NB 4IWOA 3OWEB 5IAAC 2PVOD 1QKZA 1V1PA 4ZRKA 2BYTA 1J19A 2REXA 2N1VA 2MJEA 1GPXA 5I4DA 1TZOA 4MH0E 3NHEB 3R3MA 2XK5B 4IM0A 4BBNC 4DXAB 3RUIB 2J53A 4GB9A 1VDVA 4BFRA 1HQRD 3GOEA 3J9CA 1SE3A 3CSTA 4KKJA 3SD5A 1C4CA 2PE6B 2N7EA 4MJSA 1AW7A 1SE2A 2IBIB 1P1AA 1BXTA 3DPDA 3RNFC 3SR6A 3TCAA 4LCDE 2PEAA 1YJJA 3VUXA 4GDLB 1TTNA 4GMVA 4DHZE 2N9PC 4JGHB 1LFDA 4G11A 4RNAA 4FJVB 3NVYA 2QHOA 4P6VF 2LUEA 2LXAA 4W9IA 4NZLB 1PGXA 1NI3A 2V4LA 4TQ0A 1S1QB 2BPSA 2KYWA 1NENB 2G45B 1K50A 2MBEA 2DZJA 5G2NA 3NY5A 1WRIA 2IGGA 3JVZX 3M95A 3VVWB 3PTFC 2R2QA 1XT9B 4RFBA 1E9MA 3BVGA 1WZ0A 2WXNA 1WE6A 1WSPA 1ZE3D 2KC1A 4RMAA 3KLSX 3DCGA 4NQLB 1KH0A 2LVOA 4OVUA 4YSYB 2Y5PA 3RULA 3ZLZA 2M8SA 5J2RA 1PGBA 1U4AA 3CMMB 3VQIA 4HWIB 4BKSA 1NYQA 1I4RA 2CHZA 2Z0DB 4A6QA 3HM3A 1WMHA 1V8CA 1QT9A 2MBOA 3KWVA 1GJZA 4K7WA 3A1QA 4IM2A 4N9F4 2KWDA 1YQ3B 2CR5A 1E8WA 4BKSD 1PYWD 1SXTA 2NBUA 2RSUA 1ZXHA 4F8CB 1XCQL 4REZA 2VZKD 1FXAA 4HROA 3HVDA 3O65B 3URYA 3I57A 3AULA 3Q3MC 2JY6A 1VJKA 2BT6A 1B9RA 1L4ZB 2M1MA 5TR5A 2LWPA 4B9KA 1VLBA 2WU2B 3E56A 3HIZA 3PRPB 2MP2A 2OHFA 3GE8C 1FPYA 2KMAA 4GLSC 2GI9A 4P16A 5BMHA 1MVKA 2D3AA 3RNBC 1L6UA 3ZNHB 3ZDMC 2L00B 1SE9A 1HE8A 1UGMA 1WGKA 2JU6X 1WJ6A 2X8XX 1H4RA 2W54A 4EOYA 4WWOA 1OGWA 2WXJA 2K8CA 2L0FA 2PLPA 4MGYE 1XXGA 1JQ4A 2FAZA 5JHAA 2LRWA 4GN1A 4YSXB 1KM7A 2HJ8A 4DXGA 1K8RB 2M19A 5BYQA 2XNAC 1HTQA 2DENB 4IG7B 2KTRB 3B08A 2QDFA 5E6NA 2PJHA 4QAYA 3MC9A 3A9JB 2K8BA 2NR2A 1SBBB 1RLFA 4HJKA 5HHDG 5H8YE 3QA8A 4NAWB 1R4NI 2GBKA 2V4IB 3M63B 5GMVA 4USAA 3IT6B 4DK5A 4FULA 1T5XD 3EGRA 3APDA 3P42A 4P1BC 1WJUA 2MJDA 4W9FA 2GB1A 3VXWA 2INCC 4JIOU 5CHVC 4YTNB 3I5JC 2Z59B 2KWUB 3Q8CA 3TSSA 2W82A 2LGIA 1FNVA 3OLMD 4KIKB 4K7UA 2V3NA 3BK1A 1L0VB 1EF5A 4OZCA 3AEAB 1H8CA 1G6JA 2AWTA 1KF6B 1D5ZC 2QILA 4K7SA 2INDC 3L13A 3VRBB 3AE9B 4YTMB 1QZEA 1ZPSA 4HDOA 2DZMA 1SSNA 4FHKA 1WH3A 2QIEB 3CIRB 3PS6A 3BK2A 1MG4A 4W9DA 3KUZA 3FILA 4A8XC 1TS3A 3L16A 5JXVA 3VFKA 5EE9A 3ZXRA 2D3GA 3W9CB 4AUQC 1JALA 3DQVA 4IM3A 1LQBA 2AQ2B 1ET9A 3BINA 2RD0A 1RWSA 4ANXA 3TEZA 2G1EA 2WXFA 5KHOA 2D07B 3PHWB 1J7CA 2KQ7A 2RMMA 3W1SA 1TJEA 4K3BA 1TKEA 1WX8A 4E3CA 3DDCB 2RPVA 4JWSC 3ZQ4A 4FADA 1GOZA 4TQ1A 1KRHA 3Q8AA 4IOIE 1DOYA 4JLCA 2WYQA 3Q69A 4FA6A 5AEKB 4NJCA 3PREA 4WJQA 1TS5A 2ASQA 1E10A 3OJ4B 2M4NA 2FIFA 1T0YA 1MG8A 4KGTA 3BVZA 2KLGA 3QWZB 4MEMA 3T3NA 2ZPNA 2LJ5A 2CS4A 1XLOA 1AYFA 2KJRA 1WRDB 4DQOC 1WZ3A 1M94A 3Q3JA 4RF0A 3P63A 1YQBA 2KVZA 3V60A 3ZO5B 2KJHB 3ZJUA 1UZXB 4KDLB 2HJ1A 2RDHA 3LJ3A 1TS2A 4ARCA 3AEGB 1MHXA 2DYMA 1JRPA 3FKYA 3AH7A 2V9HA 3RZFA 2H88B 3RNGC 4C80A 1ZP0B 2UYZB 3MFGA 1WJ4A 4FLHA 3WALA 2MSED 3DVNV 3DWGC 2IO0B 3H6NA 3ZKJC 3IBEA 5LLIA 4CQNA 3Q8BA 3I3TB 3ZJVA 1OFFA 1D5MC 4HPPA 2N7JA 1HEZE 3N30A 2INPE 3NVZA 3HK0A 1GB1A 3QIJA 2FIDA 2FNJB 1E0ZA 2IPKD 4MDKE 1L7YA 1VD2A 4WJNA 2QC8A 2LXCA 4RM9A 4KDIC 1NVID 3GE3C 2AL6A 4N58A 5AZHA 2TSSA 3R8BA 5IOIA 3PSEB 1XLPA 1C77A 2KACA 2WXMA 1KFYB 1UELA 1GB4A 4FJYA 1TT5B 2ZEQA 3U7ZA 1ZDVA 1J7AA 3MHSD 4A9AA 5BO4B 3L10B 3TBLD 1XF5L 4ANUA 1FM0D 1UWXA 2DNFA 2J0JA 3K9PB 3P4SB 3FC4A 2QJLA 4RH6A 4CYEA 3ZTDA 2D5GA 3WA0A 4E71A 5G5HA 3VTWA 3HRDD 4YL8A 1K52A 3ZNID 1HZ6A 2J7QB 2KTFA 1STEA 4MSMB 3TIXA 4BKGA 4C7YA 1D4BA 3MC8A 3U4EG 3RZWC 3C8YA 4Q2JA 4WJPA 2C9WB 2O2VB 3BYYB 2IZVB 3ZDTA 3Q14C 3B1LX 2MEKA 3ML8A 3BWUD 1EU4A 1ZDXA 5D3DA 1E7UA 4EE2A 3UIPB 1TS4A 4M0WB 3T3OA 1JWAD 2J52A 1PFDA 3A33B 2NPTA 3NJTA 3ZIMA 3IHPC 3KYDD 3DHHC 1YD8U 1E8YA 4ZOHC 1QF6A 1D6EC 2KO3A 4EFOA 3DVGX 2HTME 3B2FA 1NDDA 1FD6A 2W3SA 2BW2A 3TL5A 4ASWC 4LK0M 2AX5A 5KHQA 1F1HA 4IUMB 3AE4B 3LYYA 3DWMA 3NVVA 3W1SC 1IP9A 5CHFA 3JSVA 2NBWB 2L7RA 5LXHA 3H7PB 1IUEA 4UDUC 4DHJB 3CWIA 2ON8A 3Q3OC 3KUDB 2J4XA 3P1MA 2KWCA 3R2TA 1WXMA 5J18A 3NRZA 2BYEA 2BS4B 1VZ8A 3NS8A 1V9JA 3Q8FA 2O6VB 4LNKA 2GRIA 4YSZB 3Q8EA 2FE8A 2K22A 1GC7A 2KDIA 3PVLA 3C19A 3AB5A 4ZRIA 1L0XB 2KDBA 2Y5CA 1Q0WB 5C23A 3L0WB 2WXQA 2KANA 2WDQB 1P9DU 4HVBA 2KXJA 2JZPA 2D3BA 1V49A 4YXDB 4PT5A 2IGHA 2DX5B 2FCSA 5CTRC 1TY0A 1P0RA 3V6EB 1L4DB 2LASA 3TUOA 2WXLA 2EKIA 2CU3A 1FRDA 3WAOA 5HFYA 1GC6A 4YWGG 2ZVOA 3PLUA 1AN8A 2K0PA 4G50A 4XGAB 4EZJA 2CKHB 4EEWA 2KN4A 2I1JA 5DPSA 3NZSA 4NPNA 3W5UB 2BS3B 1MI0A 5FK9C 1Q5WB 4XYCA 3TEYA 2KLCA 1WMHB 5C2TB 1T0RC 2VZKB 4FJZA 2BF8B 4M00A 2MBBB 3AEDB 3A1QB 3VHTC 3VUWA 3IFWB 1EWCA 3IXSA 1ACCA 4WAFA 2BWFA 1I4PA 1QILA 4ZRPA 1OQYA 4MGIE 2NTTA 1YJ1A 2BS2B 1N60A 2NCNA 1I4XA 4A90A 3DOWA 2M17A 3HHMA 3ONSA 1VCBA 1V5TA 3APFA 3VH4B 4P7IA 2L32A 1TZ1A 2GBNA 2L1AA 4IW0A 1I35A 1ZXIA 4LDTD 4MACA 1SE4A 4IDIA 2BKFA 3N1ZC 2C7NB 2XK5A 4JPSA 2AEHA 5E6JA 5C1ZA 3ZNZB 4ARIA 1MFWA 5EE1A 2HTHA 3ZNGC 5D7GA 1OQRA 1OQQA 1QOBA 2L0TA 1E90A 3OAWA 4PYZA 1SIJA 3A4SC 2N9KA 2PKOA 3JYUA 3SEBA 4PS8A 1HZ5A 3OJ3A 2IJ0A 2B3AA 2LD9A 1SF0A 2D11A 2RPQA 3RNAC 4KZ0A 2NS5A 2AYOB 2KQ4X 3PT2B 4GDLA 2N0SB 5AZFA 2KDFB 1TKGA 1T6BX 2NMQA 4NJ7A 2ACZB 4MT5A 2JZZA 2JX5A 2KFKB 3Q3NC 4TUUA 1V80A 4C4VB 1UBIA 4RM8A 1WXQA 2G9HD 1TKYA 2IY1B 3U7DA 1P7EA 3DVGY 1RAXA 4MH8A 4HXDA 3QX1A 4ICVA 1QQRA 3KH0A 3R7RA 4F7ZA 2JYTA 4NJ6A 1WGHA 2RDGA 3AI5A 3BIID 3B2GA 2ZNVC 2LUMA 2KJ6A 2RGFA 1MHHE 3SHQA 4JE3B 3AV8A 2ZCBA 2AQ3B 1ZOYB 2QEJC 5FKAC 2GBRA 3TEXA 4KGRA 2N9XA 1T3QA 3EFUA 4NAMA 1C9FA 4K81A 2JWZA 5D2MB 3RD2A 3DVNU 1AARA 2LMCA 1UNSA 2DAJA 1RFKA 2CU1A 3U8ZA 2L83A 4W9LA 4K1RB 1RYJA 4W9CA 2KC2A 1JCKB 2M0XA 2GMIC 3WCQA 3V62A 1R4MB 1XD3B 3SDLC 2JWUA 1YIWA 2HE7A 4OW0A 3R7QA 2UU7A 3AE8B 1YNTE 1I7HA 4ZYNA 2C7MB 4XDCA 1J0GA 4II3B 2WP9B 5IP4D 4LLGM 1LM8B 2VH1A 2KMMA 1N62A 2PTLA 2WX1A 1FCLA 3VTVA 2D3CA 3GZNB 2LZ6A 3QAQA 4RGMA 5BYRA 1CQVA 3X0WA 4C7ZA 5E6PA 4BBNF 1E7VA 1FCCC 2DZIA 2JZ3B 1WWTA 2FUHB 1YX6B 2LVQA 2IGDA 3KUCB 3EFCA 1VR9A 2GBMA 1HA5A 3UGBB 4M02A 2WLBA 4XE0A 2KT7A 4PS7A 1IYFA 3NOBA 2MW5A 2IO2B 3LB8C 3MJ5A 2KTRA 3AE2B 1E6EB 4DXFA 2KX3A 3EECA 3M62B 4HCNB 4LNOA 2M0AA 2K8HA 3A9JA 2DWQA 3AE5B 3MJWA 3IAM1 2BGFA 3RNCC 2GBJA 3DBHI 3H7SA 2JF5A 1V2YA 4DHZB 3BZDB 1XCTL 4NAWA 3UQBA 4X57B 2BKRB 2EKEC 3UF8A 3H1UA 4HEA1 3PLVA 3RCZA 3BYTB 4WWMA 3PRZA 2A4ZA 4I6PA 2JRIB 3MHZA 4MM3B 4BKTA 1J8CA 3B0AA 2KDEB 3ZXVA 4EKUA 4NQKE 3K9OB 3QQ8B 1E8XA 3AM9A 4JWUC 1WYGA 3D32A 4XC2A 1WGYA 5D94A 1YQ4B 2HD5B 2WU5B 2CJOA 3A9KB 4GXBA 3IG3A 2D2QA 4L23A 1JWBD 1IBXB 2AQ1B 2N7DA 5JH5C 3NVWA 2FCNA 4HRSA 3RFZB 4RCOA 2D10A 3GP7A 5AZGA 3U2SC 3V61A 3SU8X 3TJPA 3DBRI 2ICIA 2LHEA 5IO9A 1T0SC 5DCNA 5EE3A 4LNIA 5EDSA 2LI5A 4EZLA 1JWMD 2Y5BB 3VUYA 3KQ4A 4WIPA 1N61A 3EC8A 1P3QU 2C7HA 1CK1A 3AE3B 5CX3A 1IGCA 3UIOB 1EWYC 3AXCA 3N32A 4IKGA 3AU4A 3ZUNA 4B0EA 2AL3A 1N63A 5IN7A 3PZDA 4W9KA 1QOFA 2N9EB 1DGJA 3KVFB 3QJZA 2N4FA 2WGSA 2FBWB 2MLBA 5D6JB 3QHTA 3HUIA 2IO3B 1FRRA 4W9GA 1EU3A 4R3DA 3AEFB 4I6LB 1Q10A 2ZJDA 2N9LA 1XQQA 2YEPF 1FFVA 4ITKA 3FAHA 3PO0A 5MPOA 2V0GA 1WYWB 2ZVNA 3RYTA 3TEWA 3NZUA 3P4QB 4A55A 3NUHB 2WDTB 1EO6A 4XWTA 5C3JB 1CJEA 4HKQA 4M8MA 1FFUA 1YN4A 2OOBB 4LJOB 5HI1A 2K3UA 2BVCA 2CHWA 3R66C 1R7SA 2XN9C 1K53A 2DYOA 1S3SG 4S0RA 4IWQA 1OEYA 1UF0A 4ICUA 4K3CA 1L0YB 3AE1B 3PV1A 4F1SA 3N1XC 1SGHA 1E8ZA 3ZRFA 4N6EB 2A5UA 5AUKA 3N9YC 4DDID 2YEPB 1VRAB 3EUB2 2E6XA 2PE9A 4WJOA 2OJWA 4KZCA 3DHIC 3V3XA 2CJNA 2W55A 5BMGA 2RR9A 3MP9A 1NI2A 1WE7A 1KLGD 1YX5B 4KSLC 4M8NA 3PZ8A 4AJWA 1N5WA 3L54A 1SJED 4FN2A 2GOWA 2LGSA 3PRMB 2DBYA 1V1PB 4KKIA 2BYVE 3DBLB 2R61A 1I4GA 1RRBA 2XBBC 4TKNA 1OEYJ 4HK2A 3ZRCA 4PK1A 2K39A 4YT0B 1VZ7A 3WIMA 2LHDA 3SFDB 4FBJB 2IO1B 2K6QA 1WM2A 4J3OD 4J6IA 4MJSB 3RN9C 3PZ7A 3AEBB 1WY8A 2B76B 3VR9B 2WXHA 4MSQB 4ZRQA 3WANA 2ONQA 2ZW0A 1YN5A 2SEBD 1VZ6A 2MBHA 3OG5A 4JX1C 2WDVB 5DPWA 3AU5A 4AOFA 2O2VA 2MJ3A 1KTKA 1KJTA 1C4PA 2IY0B 2GLSA 4WQOB 5G55A 4M0WA 1B1ZA 4HDQA 4BVUC 1QLBB 4GDKA 2X38A 1TGZB 1XEEA 1XLNA 5T8IA 4KSKC 2JQRB 1A5RA 2JXTA 3GS2A 4MGZE 2LVPA 1SIFA 1GNUA 1IGDA 3V6CB 1WR6E 3CSFA 3B9JA 3NZ3A 1FNWA 2JXXA 1P98A 4EZKA 4AWJA 2ZZPB 1FNUA 1WIAA 3IVFA 2LJIA 2KK8A 5HKHA 2Z0EB 3S2AA 3H7PA 2ZCCA 4WH4A 2LRUA 2C60A 2I1KA 3ZGZA 2L52A 4C00A 3LDZE 4LJPB 2NVUI 1C78A 4FXCA 3T9LA 3VAWA 2JSVX 3KWLA 5CHWA 3W2DA 4LNNA 4ZHOA 4W9EA 4NY0A 2O6VA 2HDEA 3CF6E 3BVMA 2LFIA 4DHJD 1WGRA 3AMZA 5EE0A 5H92C 3AEEB 3T8MA 3A4RA 1GG3A 5GXGB 2J0MA 2K5PA 4B0MA 3KW5B 2L76A 2J0KA 2KVRA 2LGDA 3ZYYX 3ZVVA 2O6VD 4US8A 4DDGD 1F52A 2L3ZA 2WXPA 4CO7A 2JT4B 2W9NA 1DYQA 2MP2B 1OTRB 2K1FA 2IYDB 1F77A 1WFYA 3ZJTA 1UUPA 2PMVA 3SFEB 2PIAA 1QOAA 1YOVB 1ZKHA 2BQQA 2WXIA 1LGRA 4M01A 2K25A 3BY4B 2KOXA 2R2OA 2WXOA 2MRPA 2QMTA 1FO4A 5D3IB 2JYEA 4XDDA 1V1OA 3VDZA 2JVCA 3I63C 1SB3C 4OHJA 5IKCM 5BMIA 4KV2A 4LNFA 2DHZA 4MGKE 3NG0A 2KWVB 3KYCD 1R4MI 1ESFA 2E3TA 4D2KA 5AUIA 2Y3AA 3RI7C 1JW9D 2L8JA 2CHXA 1Y8RC 3RNEC 1DOIA 1Z2MA 2WS3B 4BAXA 5JHBA 4RGOS 2BBCA 4DBGA 4W9JA 3RMKC 3P4RB 1YJIA 2KMCA 4OZAA 4AJYB 4A20A 1WXSA 3VR8B 2I38A 4GGQA 1HXYD 1MJDA 2DZKA 3GZNI 3EHVA 3U52E 1TYGB 4RF1A 1K51A 4PYUA 3GB1A 2BYFA 2KFJA 1F0ZA 3IT4B 1DOXA 2DLBA 1FIQA 4O1NA 3UINB 1XO3A 3PPAA 4GSWA 1Y56A 1HTOA 1J7BA 1F9JA 4WURA 1CZPA 2K6DB 4N59A 3Q3FA 2FCQA 1FEHA 4ZHPA 1IPGA 2WNMA 3FILB 4JL9A 4DWFA 4AS1A 1V86A 2KFKA
chains in the Genus database with same CATH topology
4ZOHC 1QF6A 1D6EC 1N5XA 5EE3A 2HTME 1WRIA 3B2FA 2IGGA 1FD6A 2W3SA 2BW2A 3H8HA 1JWMD 4LK0M 4RFBA 2AX5A 3KQ4A 3RPFC 1C79A 1E9MA 2OEDA 3AE4B 3BVGA 4WIPA 1N61A 4WQMA 3LYYA 1RM6C 2WXNA 3DWMA 1WSPA 3NVVA 2FUG1 1ZE3D 3UI3A 4US9A 1CK1A 3AE3B 1IGCA 1EWYC 3KLSX 1IUEA 4IKGA 1KH0A 4UDUC 4OZBA 3CWIA 2ON8A 2WQYB 1UWMA 4YSYB 1TY2A 4B0EA 2Y5PA 1N63A 2ZW1A 1JWSD 2J4XA 3P1MA 1PGBA 1QOFA 3R2TA 1DGJA 3NRZA 2FBWB 3VQIA 2BS4B 1NYQA 1VZ8A 3Q8FA 3HUIA 1I4RA 4A6QA 1FRRA 1V8CA 1EU3A 1QT9A 3AEFB 4R3DA 1Q10A 2GRIA 2N9LA 3KWVA 1YN3A 3Q8EA 4YSZB 2FE8A 2K22A 2YEPF 1FFVA 4ITKA 3FAHA 3AB5A 3PO0A 5MPOA 2V0GA 1L0XB 2WXGA 2Y5CA 3P4PB 2KWDA 1YQ3B 2LEKA 1SEBD 3TEWA 3AECB 2WXQA 3P4QB 4A55A 2PVGC 1PYWD 1SXTA 2WDQB 4RGNA 1QOGA 1ZXHA 3NUHB 1XCQL 4XWTA 4REZA 5C3JB 1CJEA 2VZKD 4HKQA 2JZPA 1FMAD 1FXAA 4HROA 4HKZE 3HVDA 1FFUA 1YN4A 3URYA 1BMLC 3I57A 5HI1A 4YXDB 4PT5A 2K3UA 1L5PA 1R7SA 2IGHA 2PW9A 2XN9C 2K9XA 1K53A 2DYOA 1TY0A 4L2YA 3NS1A 1VJKA 2BT6A 1B9RA 1L4DB 3TUOA 1L4ZB 1XLQA 2WXLA 2EKIA 3VRAB 1VLBA 2CU3A 2WU2B 3E56A 1FRDA 2KAJA 2OHFA 2WXRA 5TSSA 5HFYA 4GLSC 1PDXA 2H89B 3EA6A 4YWGG 1AN8A 1L0YB 2GI9A 3AE1B 2K0PA 4P16A 5BMHA 1MVKA 4N6EB 1L6UA 5AUKA 3N9YC 2YEPB 3AE7B 4ZYSA 2KN4A 2BB6A 1VRAB 3EUB2 4RGTA 1WGKA 2E6XA 2JU6X 3I9V1 2W54A 3W5UB 2WXJA 5LNK1 1E7PB 1LO5D 2IDYA 2PLPA 1I4HA 2BS3B 1MI0A 1XXGA 3LXFA 4OVZA 5FK9C 3V3XA 1JQ4A 3MC0B 2CJNA 2W55A 5BMGA 3MP9A 3TEYA 4YSXB 1F2RC 5C2TB 2VZKB 5FR3A 1KLGD 2BB5A 3ETRA 3AEDB 2BTEA 3PZ8A 4DXGA 1N5WA 2M19A 5BYQA 1SJED 2XNAC 1EWCA 2M56B 3IXSA 1ACCA 4WAFA 1I4PA 1QILA 2DBYA 1M4VA 1V1PB 4ZRPA 4KKIA 1P7FA 2NTTA 2BS2B 1N60A 2WDRB 1I4XA 4A90A 2R61A 4XWWA 1I4GA 1SBBB 2L32A 5HHDG 5H8YE 4NAWB 4TMAB 2L1AA 4YT0B 1VZ7A 2LHDA 3SFDB 1ZXIA 2WXKA 3AE6B 1YMHE 4MACA 2V4IB 1SE4A 4IDIA 2KDMA 4TSSA 4JPSA 4USAA 5E6JA 3IT6B 1T5XD 4J3OD 4ARIA 3EGRA 1JROA 3P42A 1I4QA 5EE1A 2MJDA 5D7GA 3PZ7A 2GB1A 1OQRA 1OQQA 1QOBA 4LTUA 3AEBB 1SIJA 4YTNB 2N9KA 2PKOA 3SEBA 1JMLA 2B76B 3Q8CA 3VR9B 3TSSA 1HZ5A 2W82A 2WXHA 2LGIA 1FNVA 2IJ0A 4ZRQA 1NYRA 2ONQA 2ZW0A 2V3NA 1SF0A 1YN5A 2SEBD 3BK1A 1L0VB 1VZ6A 1PGAA 2QSDA 4JX1C 4OZCA 2WDVB 3AEAB 2KQ4X 1L6VA 1KF6B 3ABVB 1ET6A 2MJ3A 1D5ZC 2N0SB 3AN1A 2QILA 1KTKA 1JWUD 1IBXA 3R2IA 1C4PA 4YTPB 1TKGA 1T6BX 3VRBB 3AE9B 4YTMB 2NMQA 4M0WA 1B1ZA 1ZPSA 2ACZB 1EM7A 1SSNA 4MT5A 2QIEB 3CIRB 2JX5A 3BK2A 1QLBB 2X38A 3FILA 4A8XC 1TS3A 4C56C 5JXVA 1C76A 5EE9A 2EELA 1WXQA 1XEEA 1XLNA 5T8IA 2G9HD 1TKYA 3W9CB 2JQRB 1JALA 2JXTA 3GS2A 1P7EA 1C4AA 2AQ2B 1ET9A 1BUIC 1IGDA 2V3PA 4MH8A 1QQRA 3B9JA 3NZ3A 2JYTA 3V05A 1RWSA 3TEZA 2RDGA 2Z8LA 2G1EA 2WXFA 3BIID 1FNWA 3B2GA 2LUMA 1MHHE 1FNUA 4JE3B 1J7CA 2RMMA 3W1SA 1V97A 2LJIA 1TJEA 3AV8A 1TKEA 4KGSA 1D5XC 2AQ3B 4WH4A 1ZOYB 2NTSA 2QEJC 5FKAC 2RPVA 4JWSC 3TEXA 3ZGZA 2L52A 3ZQ4A 1GOZA 4TQ1A 4KGRA 1C78A 1UGJA 4FXCA 1KRHA 1T3QA 2JSVX 3Q8AA 4IOIE 1ROEA 1MPEA 3KWLA 4NAMA 1DOYA 1C9FA 3Q69A 2J42A 3W2DA 3O13A 4NJCA 1ENFA 1TS5A 1E10A 3IAS1 4ZHOA 2HDEA 3L4PA 4KGTA 4AQ7A 3BVZA 2SAKA 2Q5WD 2LMCA 2W3RA 3T3NA 2INNE 1UNSA 3BVMA 2LFIA 1RFKA 1GAQB 3AMZA 2L83A 5EE0A 5H92C 1XLOA 3AEEB 5GXGB 1ZUD2 2K5PA 1AYFA 1RYJA 4B0MA 4DQOC 3W5VB 1JCKB 1PUTA 3HVZA 4RF0A 3P63A 3WCQA 3ZYYX 4US8A 4GDKB 1FXIA 3ZJUA 2WXPA 2RDHA 1DYQA 1TS2A 2JWUA 4ARCA 4OW0A 4H2AA 3AEGB 1NEKB 4HJGE 1MHXA 3AE8B 3E9SA 2DYMA 2MH7A 1JRPA 1YNTE 1I7HA 1F77A 3AH7A 3ZJTA 4XDCA 1UUPA 2WP9B 2H88B 1AWDA 2PMVA 1ZP0B 2PIAA 3MFGA 3SFEB 4C80A 5G5GA 1QOAA 2WXIA 4LLGM 1KLUD 4KX6B 3DWGC 2KMMA 1N62A 2PTLA 1FCLA 1F2RI 4CQNA 2WXOA 3Q8BA 3ZJVA 2QMTA 1OFFA 1D5MC 2N7JA 1FO4A 1HEZE 5D3IB 2INPE 4RGMA 3NVZA 2JYEA 5BYRA 2I2YA 1CQVA 4XDDA 4C7ZA 5BYSA 1V1OA 1A70A 1GB1A 1FCCC 1E0ZA 2IPKD 4L1BA 1WWTA 2IGDA 1SB3C 4OHJA 5BMIA 1VR9A 1HA5A 1SJHD 5HG2A 1NVID 2WLBA 4XE0A 4D2KA 1ESFA 2E3TA 4N58A 3LB8C 2TSSA 3MJ5A 5AUIA 2Y3AA 3OWEB 1JW9D 3R8BA 2PVOD 3AE2B 1QKZA 1V1PA 1C77A 1XLPA 2BYTA 1E6EB 4DXFA 2KACA 2WXMA 1DOIA 1KFYB 2MJEA 2M0AA 2WS3B 2DWQA 1GPXA 3AE5B 3IAM1 4RGOS 2BBCA 5I4DA 1TZOA 1GB4A 3P4RB 1YJIA 4OZAA 3BZDB 1XCTL 4A9AA 3U7ZA 1ZDVA 1J7AA 4HEA1 3VR8B 2I38A 3BYTB 2J53A 1VDVA 4WWMA 1XF5L 1HXYD 1FM0D 1HQRD 3MHZA 1UWXA 3J9CA 1SE3A 3P4SB 4KKJA 4MM3B 1C4CA 3FC4A 2QJLA 4RH6A 3U52E 1TYGB 4RF1A 2D5GA 1AW7A 1SE2A 1K51A 5G5HA 1BXTA 3HRDD 3AM9A 1K52A 3SR6A 3GB1A 4JWUC 1WYGA 1HZ6A 1F0ZA 3IT4B 1STEA 1YJJA 1DOXA 4C7YA 1D4BA 3U4EG 1YQ4B 2DLBA 3C8YA 4Q2JA 1FIQA 2WU5B 4GDLB 4O1NA 3BYYB 2CJOA 1XO3A 1Y56A 2MEKA 4L23A 3BWUD 1JWBD 1IBXB 1J7BA 2AQ1B 4RNAA 1EU4A 4WURA 1ZDXA 5D3DA 3NVYA 3NVWA 4EE2A 1CZPA 4P6VF 4N59A 1TS4A 4HRSA 3RFZB 1JWAD 1FEHA 2J52A 4NZLB 1PGXA 4RCOA 3T3OA 4ZHPA 3GP7A 1PFDA 1NI3A 3U2SC 4TQ0A 2WNMA 1NENB 1K50A 3FILB 4AS1A 2ICIA 2LHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZOH C;  1OFF A;  1QF6 A;  1N5X A;  5EE3 A;  3W5U B;  5EE9 A;  2HTM E;  1WXQ A;  1E7P B;  1XLN A;  1FO4 A;  1WRI A;  1TKY A;  3B2F A;  3NVZ A;  3W9C B;  2BS3 B;  2JQR B;  3LXF A;  1JQ4 A;  4C7Z A;  2W3S A;  1JAL A;  1A70 A;  2CJN A;  2W55 A;  1E0Z A;  1WWT A;  2AX5 A;  4YSX B;  1SB3 C;  3RPF C;  1E9M A;  3AE4 B;  4WQM A;  5C2T B;  1N61 A;  3B9J A;  1RM6 C;  1RWS A;  3DWM A;  5EE1 A;  3ETR A;  2G1E A;  3NVV A;  3BII D;  3AED B;  1NVI D;  3B2G A;  2WLB A;  1N5W A;  2M19 A;  4US9 A;  3AE3 B;  2M56 B;  1EWY C;  2E3T A;  1J7C A;  4N58 A;  5H92 C;  1V97 A;  2DBY A;  3LB8 C;  1IUE A;  1TJE A;  5AUI A;  3AV8 A;  1TKE A;  1JW9 D;  3CWI A;  2WQY B;  1UWM A;  1ZOY B;  2PVO D;  2BS2 B;  1N60 A;  2WDR B;  1XLP A;  3AE2 B;  4JWS C;  4YSY B;  1E6E B;  1N63 A;  2L52 A;  3P1M A;  4FXC A;  1DOI A;  1KFY B;  1KRH A;  1T3Q A;  2MJE A;  1ROE A;  1QOF A;  2WS3 B;  2DWQ A;  3KWL A;  1DOY A;  1DGJ A;  3AE5 B;  1GPX A;  3NRZ A;  5H8Y E;  2FBW B;  2BS4 B;  1NYQ A;  3HUI A;  1E10 A;  3P4R B;  1FRR A;  1YJI A;  4ZHO A;  1V8C A;  1QT9 A;  4YT0 B;  3AEF B;  3SFD B;  3L4P A;  1ZXI A;  3AE6 B;  4YSZ B;  4A9A A;  1J7A A;  2Q5W D;  4IDI A;  2K22 A;  3VR8 B;  2W3R A;  1FFV A;  4ITK A;  1VDV A;  4WWM A;  1RFK A;  3FAH A;  3AB5 A;  1GAQ B;  1FM0 D;  3PO0 A;  4USA A;  5MPO A;  3AMZ A;  2L83 A;  5EE0 A;  3P4S B;  1XLO A;  2Y5C A;  3AEE B;  3P4P B;  5GXG B;  1YQ3 B;  1JRO A;  1ZUD 2;  2K5P A;  1AYF A;  2LEK A;  3FC4 A;  1RYJ A;  2MJD A;  2QJL A;  4LTU A;  1OQR A;  1OQQ A;  1QOB A;  3AEC B;  1TYG B;  3P4Q B;  2PVG C;  3AEB B;  5G5H A;  1SIJ A;  4YTN B;  3W5V B;  2WDQ B;  2PKO A;  1QOG A;  1PUT A;  3HVZ A;  2B76 B;  3HRD D;  3P63 A;  3VR9 B;  3WCQ A;  3ZYY X;  1CJE A;  5C3J B;  3AM9 A;  4US8 A;  1FMA D;  1FXA A;  4HRO A;  1FXI A;  3SR6 A;  1FFU A;  4JWU C;  1WYG A;  1F0Z A;  4YXD B;  1NYR A;  1L5P A;  1SF0 A;  1R7S A;  3SFE B;  2K9X A;  1YJJ A;  1DOX A;  1L0V B;  4C7Y A;  3NS1 A;  1VJK A;  2BT6 A;  1NEK B;  3AEG B;  3VRA B;  3AE8 B;  1XLQ A;  1YQ4 B;  2EKI A;  1B9R A;  4JX1 C;  2MH7 A;  1FIQ A;  1VLB A;  2CU3 A;  1JRP A;  2WDV B;  2WU5 B;  1FRD A;  2WU2 B;  3AEA B;  2CJO A;  1XO3 A;  2KAJ A;  2OHF A;  1I7H A;  1L6V A;  3AH7 A;  1KF6 B;  3ABV B;  1JWB D;  2MJ3 A;  2N0S B;  3AN1 A;  1J7B A;  2WP9 B;  1PDX A;  1AWD A;  2H89 B;  1ZP0 B;  2H88 B;  2PIA A;  1CZP A;  3AE1 B;  3NVY A;  3NVW A;  4N59 A;  4P6V F;  1QOA A;  5G5G A;  4HRS A;  4YTP B;  1JWA D;  1TKG A;  3VRB B;  4ZHP A;  3AE9 B;  4N6E B;  1PFD A;  4YTM B;  1L6U A;  1NI3 A;  4KX6 B;  2ACZ B;  5AUK A;  3DWG C;  3AE7 B;  4C80 A;  1NEN B;  2KMM A;  1N62 A;  2QIE B;  3CIR B;  2JX5 A;  1QLB B;  3EUB 2;  1WGK A;  2W54 A; 
#chains in the Genus database with same CATH topology
 3QAR A;  1N5X A;  3Q6B A;  4C4V A;  2LGX A;  4ANW A;  2KKC A;  5LXI B;  3H8H A;  2PPH A;  4A3O A;  1C1Y B;  1UH6 A;  3RPF C;  1C79 A;  2OED A;  2RDB C;  4WQM A;  4CHK A;  1RM6 C;  3VH3 B;  2LGY A;  2FUG 1;  4A3P A;  3UI3 A;  4US9 A;  1GUA B;  1WX9 A;  1UD7 A;  1NBF C;  4NNJ B;  2MA9 B;  2MBQ A;  4OZB A;  2WQY B;  1UWM A;  1TY2 A;  2ZW1 A;  1JWS D;  4HPM B;  4ANV A;  2EMS A;  4GOC A;  4WWP A;  1WF9 A;  2EMT A;  4W9H A;  1YN3 A;  1ISN A;  4II2 B;  5E6O A;  1ZW7 A;  2DYB A;  4KVG B;  1WM3 A;  2WXG A;  3P4P B;  3UQA A;  2LEK A;  1SEB D;  3AEC B;  2PVG C;  3ML9 A;  2MHJ A;  4RGN A;  1QOG A;  1WXA A;  1FMA D;  4HKZ E;  1BML C;  4IC7 B;  1L5P A;  2PW9 A;  2K9X A;  4L2Y A;  2G4S A;  3NS1 A;  4URK A;  3VRA B;  1XLQ A;  2MX2 A;  2WX0 A;  3PHX B;  2NBV B;  2KAJ A;  2WXR A;  5TSS A;  2UWQ A;  1PDX A;  2H89 B;  3EA6 A;  5DPT A;  2C5L C;  3WAP A;  1R4N B;  3ENE A;  4EUT A;  4JQW C;  1I42 A;  2L05 A;  2KNB A;  3AE7 B;  4ZYS A;  1V81 A;  2ZPY A;  2BB6 A;  1L2N A;  4RGT A;  3MTN B;  1CMX B;  3I9V 1;  1E5W A;  4KIK A;  3W1Y A;  1N6Z A;  2KQS A;  5LNK 1;  2KHW B;  4G3X B;  1E7P B;  5L83 A;  1LO5 D;  2IDY A;  1I4H A;  3LXF A;  3QK0 A;  4OVZ A;  2KN5 A;  2JUO A;  3MC0 B;  1F2R C;  2FCM A;  1ZGU B;  3TMP B;  5FR3 A;  1EUV B;  2BB5 A;  3ETR A;  3VTU A;  1T0Q C;  2BTE A;  4TV3 A;  2M56 B;  2QCZ A;  1V6E A;  4E74 A;  4FHJ A;  4XX5 A;  1M4V A;  4S17 A;  3JW0 X;  3N20 C;  1P7F A;  2WDR B;  2WHI A;  4XWW A;  4BZA A;  2BWE S;  5L95 C;  3HM6 X;  1WX7 A;  1WI0 A;  1KLV A;  1BT0 A;  3H9D A;  4TMA B;  5JZE B;  4GU2 A;  2WXK A;  3AE6 B;  1YMH E;  5IA7 A;  2KDM A;  4TSS A;  1WXV A;  4OVV A;  1JRO A;  1I4Q A;  3DBH B;  4LTU A;  4MM3 A;  3QCA A;  1JML A;  3M3J A;  1NYR A;  4AP4 C;  1FXT B;  2MCN B;  1PGA A;  2MQJ A;  2V3S A;  2QSD A;  1JRU A;  1L6V A;  3ABV B;  1ET6 A;  3AN1 A;  3A9K A;  1JWU D;  1KOT A;  1IBX A;  3R2I A;  3DBL I;  2NPT B;  1Z5S B;  4YTP B;  4IWP A;  2YLM A;  4WWN A;  4BOZ B;  1EM7 A;  2G3Q B;  4C56 C;  2DAF A;  1C76 A;  2EEL A;  2VRR B;  1C4A A;  1TBE A;  1BUI C;  3Q2A C;  2V3P A;  2YVC A;  3N3K B;  3V05 A;  3DBR B;  2Z8L A;  3JSV B;  3RT3 B;  4PS3 A;  2KZR A;  2ZNV B;  4HCP B;  3DBS A;  1V97 A;  4B95 A;  5J17 A;  4KGS A;  1D5X C;  4BOS C;  2NTS A;  1D3Z A;  1UGJ A;  3L17 A;  4ZDV A;  3ZW3 A;  1ROE A;  1MPE A;  2KD0 A;  2WWZ A;  1WJN A;  4ZRJ A;  2MWS B;  2J42 A;  3O13 A;  3X23 A;  1ENF A;  3IAS 1;  3P2B A;  4GIV A;  4AQ7 A;  3L4P A;  3APC A;  2SAK A;  2Q5W D;  2W3R A;  2INN E;  4HLE A;  3PGE A;  1GAQ B;  1EF1 A;  1WGD A;  1ZUD 2;  2OJR A;  3U30 A;  2KX0 A;  1TIF A;  2VH2 A;  3W5V B;  2V1Y A;  5FR6 A;  1LXD A;  1PUT A;  3HVZ A;  4GDK B;  1FXI A;  3L08 A;  4G0N B;  1X1M A;  4ACF A;  4WAA A;  4H2A A;  1NEK B;  4HJG E;  1RFA A;  3E9S A;  3ECI A;  2MH7 A;  3C0R B;  3DHG C;  1PQS A;  1WR1 A;  3WAM A;  1AWD A;  4XZ4 A;  3N1Y C;  5G5G A;  4P1C C;  2JRH A;  1KLU D;  4KX6 B;  2G4D B;  1C3T A;  2JPH A;  1F2R I;  3ZTC A;  5DPR A;  3QC8 B;  3ALB A;  1Q1O A;  4MEL A;  2I2Y A;  5BYS A;  1A70 A;  4HPL B;  4L1B A;  2N1W A;  1SJH D;  5HG2 A;  2XEW A;  4B6W A;  4LDT B;  1V5O A;  1UBQ A;  1WGG A;  4I6N B;  4IWO A;  3OWE B;  5IAA C;  2PVO D;  1QKZ A;  1V1P A;  4ZRK A;  2BYT A;  1J19 A;  2REX A;  2N1V A;  2MJE A;  1GPX A;  5I4D A;  1TZO A;  4MH0 E;  3NHE B;  3R3M A;  2XK5 B;  4IM0 A;  4BBN C;  4DXA B;  3RUI B;  2J53 A;  4GB9 A;  1VDV A;  4BFR A;  1HQR D;  3GOE A;  3J9C A;  1SE3 A;  3CST A;  4KKJ A;  3SD5 A;  1C4C A;  2PE6 B;  2N7E A;  4MJS A;  1AW7 A;  1SE2 A;  2IBI B;  1P1A A;  1BXT A;  3DPD A;  3RNF C;  3SR6 A;  3TCA A;  4LCD E;  2PEA A;  1YJJ A;  3VUX A;  4GDL B;  1TTN A;  4GMV A;  4DHZ E;  2N9P C;  4JGH B;  1LFD A;  4G11 A;  4RNA A;  4FJV B;  3NVY A;  2QHO A;  4P6V F;  2LUE A;  2LXA A;  4W9I A;  4NZL B;  1PGX A;  1NI3 A;  2V4L A;  4TQ0 A;  1S1Q B;  2BPS A;  2KYW A;  1NEN B;  2G45 B;  1K50 A;  2MBE A;  2DZJ A;  5G2N A;  3NY5 A;  1WRI A;  2IGG A;  3JVZ X;  3M95 A;  3VVW B;  3PTF C;  2R2Q A;  1XT9 B;  4RFB A;  1E9M A;  3BVG A;  1WZ0 A;  2WXN A;  1WE6 A;  1WSP A;  1ZE3 D;  2KC1 A;  4RMA A;  3KLS X;  3DCG A;  4NQL B;  1KH0 A;  2LVO A;  4OVU A;  4YSY B;  2Y5P A;  3RUL A;  3ZLZ A;  2M8S A;  5J2R A;  1PGB A;  1U4A A;  3CMM B;  3VQI A;  4HWI B;  4BKS A;  1NYQ A;  1I4R A;  2CHZ A;  2Z0D B;  4A6Q A;  3HM3 A;  1WMH A;  1V8C A;  1QT9 A;  2MBO A;  3KWV A;  1GJZ A;  4K7W A;  3A1Q A;  4IM2 A;  4N9F 4;  2KWD A;  1YQ3 B;  2CR5 A;  1E8W A;  4BKS D;  1PYW D;  1SXT A;  2NBU A;  2RSU A;  1ZXH A;  4F8C B;  1XCQ L;  4REZ A;  2VZK D;  1FXA A;  4HRO A;  3HVD A;  3O65 B;  3URY A;  3I57 A;  3AUL A;  3Q3M C;  2JY6 A;  1VJK A;  2BT6 A;  1B9R A;  1L4Z B;  2M1M A;  5TR5 A;  2LWP A;  4B9K A;  1VLB A;  2WU2 B;  3E56 A;  3HIZ A;  3PRP B;  2MP2 A;  2OHF A;  3GE8 C;  1FPY A;  2KMA A;  4GLS C;  2GI9 A;  4P16 A;  5BMH A;  1MVK A;  2D3A A;  3RNB C;  1L6U A;  3ZNH B;  3ZDM C;  2L00 B;  1SE9 A;  1HE8 A;  1UGM A;  1WGK A;  2JU6 X;  1WJ6 A;  2X8X X;  1H4R A;  2W54 A;  4EOY A;  4WWO A;  1OGW A;  2WXJ A;  2K8C A;  2L0F A;  2PLP A;  4MGY E;  1XXG A;  1JQ4 A;  2FAZ A;  5JHA A;  2LRW A;  4GN1 A;  4YSX B;  1KM7 A;  2HJ8 A;  4DXG A;  1K8R B;  2M19 A;  5BYQ A;  2XNA C;  1HTQ A;  2DEN B;  4IG7 B;  2KTR B;  3B08 A;  2QDF A;  5E6N A;  2PJH A;  4QAY A;  3MC9 A;  3A9J B;  2K8B A;  2NR2 A;  1SBB B;  1RLF A;  4HJK A;  5HHD G;  5H8Y E;  3QA8 A;  4NAW B;  1R4N I;  2GBK A;  2V4I B;  3M63 B;  5GMV A;  4USA A;  3IT6 B;  4DK5 A;  4FUL A;  1T5X D;  3EGR A;  3APD A;  3P42 A;  4P1B C;  1WJU A;  2MJD A;  4W9F A;  2GB1 A;  3VXW A;  2INC C;  4JIO U;  5CHV C;  4YTN B;  3I5J C;  2Z59 B;  2KWU B;  3Q8C A;  3TSS A;  2W82 A;  2LGI A;  1FNV A;  3OLM D;  4KIK B;  4K7U A;  2V3N A;  3BK1 A;  1L0V B;  1EF5 A;  4OZC A;  3AEA B;  1H8C A;  1G6J A;  2AWT A;  1KF6 B;  1D5Z C;  2QIL A;  4K7S A;  2IND C;  3L13 A;  3VRB B;  3AE9 B;  4YTM B;  1QZE A;  1ZPS A;  4HDO A;  2DZM A;  1SSN A;  4FHK A;  1WH3 A;  2QIE B;  3CIR B;  3PS6 A;  3BK2 A;  1MG4 A;  4W9D A;  3KUZ A;  3FIL A;  4A8X C;  1TS3 A;  3L16 A;  5JXV A;  3VFK A;  5EE9 A;  3ZXR A;  2D3G A;  3W9C B;  4AUQ C;  1JAL A;  3DQV A;  4IM3 A;  1LQB A;  2AQ2 B;  1ET9 A;  3BIN A;  2RD0 A;  1RWS A;  4ANX A;  3TEZ A;  2G1E A;  2WXF A;  5KHO A;  2D07 B;  3PHW B;  1J7C A;  2KQ7 A;  2RMM A;  3W1S A;  1TJE A;  4K3B A;  1TKE A;  1WX8 A;  4E3C A;  3DDC B;  2RPV A;  4JWS C;  3ZQ4 A;  4FAD A;  1GOZ A;  4TQ1 A;  1KRH A;  3Q8A A;  4IOI E;  1DOY A;  4JLC A;  2WYQ A;  3Q69 A;  4FA6 A;  5AEK B;  4NJC A;  3PRE A;  4WJQ A;  1TS5 A;  2ASQ A;  1E10 A;  3OJ4 B;  2M4N A;  2FIF A;  1T0Y A;  1MG8 A;  4KGT A;  3BVZ A;  2KLG A;  3QWZ B;  4MEM A;  3T3N A;  2ZPN A;  2LJ5 A;  2CS4 A;  1XLO A;  1AYF A;  2KJR A;  1WRD B;  4DQO C;  1WZ3 A;  1M94 A;  3Q3J A;  4RF0 A;  3P63 A;  1YQB A;  2KVZ A;  3V60 A;  3ZO5 B;  2KJH B;  3ZJU A;  1UZX B;  4KDL B;  2HJ1 A;  2RDH A;  3LJ3 A;  1TS2 A;  4ARC A;  3AEG B;  1MHX A;  2DYM A;  1JRP A;  3FKY A;  3AH7 A;  2V9H A;  3RZF A;  2H88 B;  3RNG C;  4C80 A;  1ZP0 B;  2UYZ B;  3MFG A;  1WJ4 A;  4FLH A;  3WAL A;  2MSE D;  3DVN V;  3DWG C;  2IO0 B;  3H6N A;  3ZKJ C;  3IBE A;  5LLI A;  4CQN A;  3Q8B A;  3I3T B;  3ZJV A;  1OFF A;  1D5M C;  4HPP A;  2N7J A;  1HEZ E;  3N30 A;  2INP E;  3NVZ A;  3HK0 A;  1GB1 A;  3QIJ A;  2FID A;  2FNJ B;  1E0Z A;  2IPK D;  4MDK E;  1L7Y A;  1VD2 A;  4WJN A;  2QC8 A;  2LXC A;  4RM9 A;  4KDI C;  1NVI D;  3GE3 C;  2AL6 A;  4N58 A;  5AZH A;  2TSS A;  3R8B A;  5IOI A;  3PSE B;  1XLP A;  1C77 A;  2KAC A;  2WXM A;  1KFY B;  1UEL A;  1GB4 A;  4FJY A;  1TT5 B;  2ZEQ A;  3U7Z A;  1ZDV A;  1J7A A;  3MHS D;  4A9A A;  5BO4 B;  3L10 B;  3TBL D;  1XF5 L;  4ANU A;  1FM0 D;  1UWX A;  2DNF A;  2J0J A;  3K9P B;  3P4S B;  3FC4 A;  2QJL A;  4RH6 A;  4CYE A;  3ZTD A;  2D5G A;  3WA0 A;  4E71 A;  5G5H A;  3VTW A;  3HRD D;  4YL8 A;  1K52 A;  3ZNI D;  1HZ6 A;  2J7Q B;  2KTF A;  1STE A;  4MSM B;  3TIX A;  4BKG A;  4C7Y A;  1D4B A;  3MC8 A;  3U4E G;  3RZW C;  3C8Y A;  4Q2J A;  4WJP A;  2C9W B;  2O2V B;  3BYY B;  2IZV B;  3ZDT A;  3Q14 C;  3B1L X;  2MEK A;  3ML8 A;  3BWU D;  1EU4 A;  1ZDX A;  5D3D A;  1E7U A;  4EE2 A;  3UIP B;  1TS4 A;  4M0W B;  3T3O A;  1JWA D;  2J52 A;  1PFD A;  3A33 B;  2NPT A;  3NJT A;  3ZIM A;  3IHP C;  3KYD D;  3DHH C;  1YD8 U;  1E8Y A;  4ZOH C;  1QF6 A;  1D6E C;  2KO3 A;  4EFO A;  3DVG X;  2HTM E;  3B2F A;  1NDD A;  1FD6 A;  2W3S A;  2BW2 A;  3TL5 A;  4ASW C;  4LK0 M;  2AX5 A;  5KHQ A;  1F1H A;  4IUM B;  3AE4 B;  3LYY A;  3DWM A;  3NVV A;  3W1S C;  1IP9 A;  5CHF A;  3JSV A;  2NBW B;  2L7R A;  5LXH A;  3H7P B;  1IUE A;  4UDU C;  4DHJ B;  3CWI A;  2ON8 A;  3Q3O C;  3KUD B;  2J4X A;  3P1M A;  2KWC A;  3R2T A;  1WXM A;  5J18 A;  3NRZ A;  2BYE A;  2BS4 B;  1VZ8 A;  3NS8 A;  1V9J A;  3Q8F A;  2O6V B;  4LNK A;  2GRI A;  4YSZ B;  3Q8E A;  2FE8 A;  2K22 A;  1GC7 A;  2KDI A;  3PVL A;  3C19 A;  3AB5 A;  4ZRI A;  1L0X B;  2KDB A;  2Y5C A;  1Q0W B;  5C23 A;  3L0W B;  2WXQ A;  2KAN A;  2WDQ B;  1P9D U;  4HVB A;  2KXJ A;  2JZP A;  2D3B A;  1V49 A;  4YXD B;  4PT5 A;  2IGH A;  2DX5 B;  2FCS A;  5CTR C;  1TY0 A;  1P0R A;  3V6E B;  1L4D B;  2LAS A;  3TUO A;  2WXL A;  2EKI A;  2CU3 A;  1FRD A;  3WAO A;  5HFY A;  1GC6 A;  4YWG G;  2ZVO A;  3PLU A;  1AN8 A;  2K0P A;  4G50 A;  4XGA B;  4EZJ A;  2CKH B;  4EEW A;  2KN4 A;  2I1J A;  5DPS A;  3NZS A;  4NPN A;  3W5U B;  2BS3 B;  1MI0 A;  5FK9 C;  1Q5W B;  4XYC A;  3TEY A;  2KLC A;  1WMH B;  5C2T B;  1T0R C;  2VZK B;  4FJZ A;  2BF8 B;  4M00 A;  2MBB B;  3AED B;  3A1Q B;  3VHT C;  3VUW A;  3IFW B;  1EWC A;  3IXS A;  1ACC A;  4WAF A;  2BWF A;  1I4P A;  1QIL A;  4ZRP A;  1OQY A;  4MGI E;  2NTT A;  1YJ1 A;  2BS2 B;  1N60 A;  2NCN A;  1I4X A;  4A90 A;  3DOW A;  2M17 A;  3HHM A;  3ONS A;  1VCB A;  1V5T A;  3APF A;  3VH4 B;  4P7I A;  2L32 A;  1TZ1 A;  2GBN A;  2L1A A;  4IW0 A;  1I35 A;  1ZXI A;  4LDT D;  4MAC A;  1SE4 A;  4IDI A;  2BKF A;  3N1Z C;  2C7N B;  2XK5 A;  4JPS A;  2AEH A;  5E6J A;  5C1Z A;  3ZNZ B;  4ARI A;  1MFW A;  5EE1 A;  2HTH A;  3ZNG C;  5D7G A;  1OQR A;  1OQQ A;  1QOB A;  2L0T A;  1E90 A;  3OAW A;  4PYZ A;  1SIJ A;  3A4S C;  2N9K A;  2PKO A;  3JYU A;  3SEB A;  4PS8 A;  1HZ5 A;  3OJ3 A;  2IJ0 A;  2B3A A;  2LD9 A;  1SF0 A;  2D11 A;  2RPQ A;  3RNA C;  4KZ0 A;  2NS5 A;  2AYO B;  2KQ4 X;  3PT2 B;  4GDL A;  2N0S B;  5AZF A;  2KDF B;  1TKG A;  1T6B X;  2NMQ A;  4NJ7 A;  2ACZ B;  4MT5 A;  2JZZ A;  2JX5 A;  2KFK B;  3Q3N C;  4TUU A;  1V80 A;  4C4V B;  1UBI A;  4RM8 A;  1WXQ A;  2G9H D;  1TKY A;  2IY1 B;  3U7D A;  1P7E A;  3DVG Y;  1RAX A;  4MH8 A;  4HXD A;  3QX1 A;  4ICV A;  1QQR A;  3KH0 A;  3R7R A;  4F7Z A;  2JYT A;  4NJ6 A;  1WGH A;  2RDG A;  3AI5 A;  3BII D;  3B2G A;  2ZNV C;  2LUM A;  2KJ6 A;  2RGF A;  1MHH E;  3SHQ A;  4JE3 B;  3AV8 A;  2ZCB A;  2AQ3 B;  1ZOY B;  2QEJ C;  5FKA C;  2GBR A;  3TEX A;  4KGR A;  2N9X A;  1T3Q A;  3EFU A;  4NAM A;  1C9F A;  4K81 A;  2JWZ A;  5D2M B;  3RD2 A;  3DVN U;  1AAR A;  2LMC A;  1UNS A;  2DAJ A;  1RFK A;  2CU1 A;  3U8Z A;  2L83 A;  4W9L A;  4K1R B;  1RYJ A;  4W9C A;  2KC2 A;  1JCK B;  2M0X A;  2GMI C;  3WCQ A;  3V62 A;  1R4M B;  1XD3 B;  3SDL C;  2JWU A;  1YIW A;  2HE7 A;  4OW0 A;  3R7Q A;  2UU7 A;  3AE8 B;  1YNT E;  1I7H A;  4ZYN A;  2C7M B;  4XDC A;  1J0G A;  4II3 B;  2WP9 B;  5IP4 D;  4LLG M;  1LM8 B;  2VH1 A;  2KMM A;  1N62 A;  2PTL A;  2WX1 A;  1FCL A;  3VTV A;  2D3C A;  3GZN B;  2LZ6 A;  3QAQ A;  4RGM A;  5BYR A;  1CQV A;  3X0W A;  4C7Z A;  5E6P A;  4BBN F;  1E7V A;  1FCC C;  2DZI A;  2JZ3 B;  1WWT A;  2FUH B;  1YX6 B;  2LVQ A;  2IGD A;  3KUC B;  3EFC A;  1VR9 A;  2GBM A;  1HA5 A;  3UGB B;  4M02 A;  2WLB A;  4XE0 A;  2KT7 A;  4PS7 A;  1IYF A;  3NOB A;  2MW5 A;  2IO2 B;  3LB8 C;  3MJ5 A;  2KTR A;  3AE2 B;  1E6E B;  4DXF A;  2KX3 A;  3EEC A;  3M62 B;  4HCN B;  4LNO A;  2M0A A;  2K8H A;  3A9J A;  2DWQ A;  3AE5 B;  3MJW A;  3IAM 1;  2BGF A;  3RNC C;  2GBJ A;  3DBH I;  3H7S A;  2JF5 A;  1V2Y A;  4DHZ B;  3BZD B;  1XCT L;  4NAW A;  3UQB A;  4X57 B;  2BKR B;  2EKE C;  3UF8 A;  3H1U A;  4HEA 1;  3PLV A;  3RCZ A;  3BYT B;  4WWM A;  3PRZ A;  2A4Z A;  4I6P A;  2JRI B;  3MHZ A;  4MM3 B;  4BKT A;  1J8C A;  3B0A A;  2KDE B;  3ZXV A;  4EKU A;  4NQK E;  3K9O B;  3QQ8 B;  1E8X A;  3AM9 A;  4JWU C;  1WYG A;  3D32 A;  4XC2 A;  1WGY A;  5D94 A;  1YQ4 B;  2HD5 B;  2WU5 B;  2CJO A;  3A9K B;  4GXB A;  3IG3 A;  2D2Q A;  4L23 A;  1JWB D;  1IBX B;  2AQ1 B;  2N7D A;  5JH5 C;  3NVW A;  2FCN A;  4HRS A;  3RFZ B;  4RCO A;  2D10 A;  3GP7 A;  5AZG A;  3U2S C;  3V61 A;  3SU8 X;  3TJP A;  3DBR I;  2ICI A;  2LHE A;  5IO9 A;  1T0S C;  5DCN A;  5EE3 A;  4LNI A;  5EDS A;  2LI5 A;  4EZL A;  1JWM D;  2Y5B B;  3VUY A;  3KQ4 A;  4WIP A;  1N61 A;  3EC8 A;  1P3Q U;  2C7H A;  1CK1 A;  3AE3 B;  5CX3 A;  1IGC A;  3UIO B;  1EWY C;  3AXC A;  3N32 A;  4IKG A;  3AU4 A;  3ZUN A;  4B0E A;  2AL3 A;  1N63 A;  5IN7 A;  3PZD A;  4W9K A;  1QOF A;  2N9E B;  1DGJ A;  3KVF B;  3QJZ A;  2N4F A;  2WGS A;  2FBW B;  2MLB A;  5D6J B;  3QHT A;  3HUI A;  2IO3 B;  1FRR A;  4W9G A;  1EU3 A;  4R3D A;  3AEF B;  4I6L B;  1Q10 A;  2ZJD A;  2N9L A;  1XQQ A;  2YEP F;  1FFV A;  4ITK A;  3FAH A;  3PO0 A;  5MPO A;  2V0G A;  1WYW B;  2ZVN A;  3RYT A;  3TEW A;  3NZU A;  3P4Q B;  4A55 A;  3NUH B;  2WDT B;  1EO6 A;  4XWT A;  5C3J B;  1CJE A;  4HKQ A;  4M8M A;  1FFU A;  1YN4 A;  2OOB B;  4LJO B;  5HI1 A;  2K3U A;  2BVC A;  2CHW A;  3R66 C;  1R7S A;  2XN9 C;  1K53 A;  2DYO A;  1S3S G;  4S0R A;  4IWQ A;  1OEY A;  1UF0 A;  4ICU A;  4K3C A;  1L0Y B;  3AE1 B;  3PV1 A;  4F1S A;  3N1X C;  1SGH A;  1E8Z A;  3ZRF A;  4N6E B;  2A5U A;  5AUK A;  3N9Y C;  4DDI D;  2YEP B;  1VRA B;  3EUB 2;  2E6X A;  2PE9 A;  4WJO A;  2OJW A;  4KZC A;  3DHI C;  3V3X A;  2CJN A;  2W55 A;  5BMG A;  2RR9 A;  3MP9 A;  1NI2 A;  1WE7 A;  1KLG D;  1YX5 B;  4KSL C;  4M8N A;  3PZ8 A;  4AJW A;  1N5W A;  3L54 A;  1SJE D;  4FN2 A;  2GOW A;  2LGS A;  3PRM B;  2DBY A;  1V1P B;  4KKI A;  2BYV E;  3DBL B;  2R61 A;  1I4G A;  1RRB A;  2XBB C;  4TKN A;  1OEY J;  4HK2 A;  3ZRC A;  4PK1 A;  2K39 A;  4YT0 B;  1VZ7 A;  3WIM A;  2LHD A;  3SFD B;  4FBJ B;  2IO1 B;  2K6Q A;  1WM2 A;  4J3O D;  4J6I A;  4MJS B;  3RN9 C;  3PZ7 A;  3AEB B;  1WY8 A;  2B76 B;  3VR9 B;  2WXH A;  4MSQ B;  4ZRQ A;  3WAN A;  2ONQ A;  2ZW0 A;  1YN5 A;  2SEB D;  1VZ6 A;  2MBH A;  3OG5 A;  4JX1 C;  2WDV B;  5DPW A;  3AU5 A;  4AOF A;  2O2V A;  2MJ3 A;  1KTK A;  1KJT A;  1C4P A;  2IY0 B;  2GLS A;  4WQO B;  5G55 A;  4M0W A;  1B1Z A;  4HDQ A;  4BVU C;  1QLB B;  4GDK A;  2X38 A;  1TGZ B;  1XEE A;  1XLN A;  5T8I A;  4KSK C;  2JQR B;  1A5R A;  2JXT A;  3GS2 A;  4MGZ E;  2LVP A;  1SIF A;  1GNU A;  1IGD A;  3V6C B;  1WR6 E;  3CSF A;  3B9J A;  3NZ3 A;  1FNW A;  2JXX A;  1P98 A;  4EZK A;  4AWJ A;  2ZZP B;  1FNU A;  1WIA A;  3IVF A;  2LJI A;  2KK8 A;  5HKH A;  2Z0E B;  3S2A A;  3H7P A;  2ZCC A;  4WH4 A;  2LRU A;  2C60 A;  2I1K A;  3ZGZ A;  2L52 A;  4C00 A;  3LDZ E;  4LJP B;  2NVU I;  1C78 A;  4FXC A;  3T9L A;  3VAW A;  2JSV X;  3KWL A;  5CHW A;  3W2D A;  4LNN A;  4ZHO A;  4W9E A;  4NY0 A;  2O6V A;  2HDE A;  3CF6 E;  3BVM A;  2LFI A;  4DHJ D;  1WGR A;  3AMZ A;  5EE0 A;  5H92 C;  3AEE B;  3T8M A;  3A4R A;  1GG3 A;  5GXG B;  2J0M A;  2K5P A;  4B0M A;  3KW5 B;  2L76 A;  2J0K A;  2KVR A;  2LGD A;  3ZYY X;  3ZVV A;  2O6V D;  4US8 A;  4DDG D;  1F52 A;  2L3Z A;  2WXP A;  4CO7 A;  2JT4 B;  2W9N A;  1DYQ A;  2MP2 B;  1OTR B;  2K1F A;  2IYD B;  1F77 A;  1WFY A;  3ZJT A;  1UUP A;  2PMV A;  3SFE B;  2PIA A;  1QOA A;  1YOV B;  1ZKH A;  2BQQ A;  2WXI A;  1LGR A;  4M01 A;  2K25 A;  3BY4 B;  2KOX A;  2R2O A;  2WXO A;  2MRP A;  2QMT A;  1FO4 A;  5D3I B;  2JYE A;  4XDD A;  1V1O A;  3VDZ A;  2JVC A;  3I63 C;  1SB3 C;  4OHJ A;  5IKC M;  5BMI A;  4KV2 A;  4LNF A;  2DHZ A;  4MGK E;  3NG0 A;  2KWV B;  3KYC D;  1R4M I;  1ESF A;  2E3T A;  4D2K A;  5AUI A;  2Y3A A;  3RI7 C;  1JW9 D;  2L8J A;  2CHX A;  1Y8R C;  3RNE C;  1DOI A;  1Z2M A;  2WS3 B;  4BAX A;  5JHB A;  4RGO S;  2BBC A;  4DBG A;  4W9J A;  3RMK C;  3P4R B;  1YJI A;  2KMC A;  4OZA A;  4AJY B;  4A20 A;  1WXS A;  3VR8 B;  2I38 A;  4GGQ A;  1HXY D;  1MJD A;  2DZK A;  3GZN I;  3EHV A;  3U52 E;  1TYG B;  4RF1 A;  1K51 A;  4PYU A;  3GB1 A;  2BYF A;  2KFJ A;  1F0Z A;  3IT4 B;  1DOX A;  2DLB A;  1FIQ A;  4O1N A;  3UIN B;  1XO3 A;  3PPA A;  4GSW A;  1Y56 A;  1HTO A;  1J7B A;  1F9J A;  4WUR A;  1CZP A;  2K6D B;  4N59 A;  3Q3F A;  2FCQ A;  1FEH A;  4ZHP A;  1IPG A;  2WNM A;  3FIL B;  4JL9 A;  4DWF A;  4AS1 A;  1V86 A;  2KFK A; 
#chains in the Genus database with same CATH homology
 4ZOH C;  1QF6 A;  1D6E C;  1N5X A;  5EE3 A;  2HTM E;  1WRI A;  3B2F A;  2IGG A;  1FD6 A;  2W3S A;  2BW2 A;  3H8H A;  1JWM D;  4LK0 M;  4RFB A;  2AX5 A;  3KQ4 A;  3RPF C;  1C79 A;  1E9M A;  2OED A;  3AE4 B;  3BVG A;  4WIP A;  1N61 A;  4WQM A;  3LYY A;  1RM6 C;  2WXN A;  3DWM A;  1WSP A;  3NVV A;  2FUG 1;  1ZE3 D;  3UI3 A;  4US9 A;  1CK1 A;  3AE3 B;  1IGC A;  1EWY C;  3KLS X;  1IUE A;  4IKG A;  1KH0 A;  4UDU C;  4OZB A;  3CWI A;  2ON8 A;  2WQY B;  1UWM A;  4YSY B;  1TY2 A;  4B0E A;  2Y5P A;  1N63 A;  2ZW1 A;  1JWS D;  2J4X A;  3P1M A;  1PGB A;  1QOF A;  3R2T A;  1DGJ A;  3NRZ A;  2FBW B;  3VQI A;  2BS4 B;  1NYQ A;  1VZ8 A;  3Q8F A;  3HUI A;  1I4R A;  4A6Q A;  1FRR A;  1V8C A;  1EU3 A;  1QT9 A;  3AEF B;  4R3D A;  1Q10 A;  2GRI A;  2N9L A;  3KWV A;  1YN3 A;  3Q8E A;  4YSZ B;  2FE8 A;  2K22 A;  2YEP F;  1FFV A;  4ITK A;  3FAH A;  3AB5 A;  3PO0 A;  5MPO A;  2V0G A;  1L0X B;  2WXG A;  2Y5C A;  3P4P B;  2KWD A;  1YQ3 B;  2LEK A;  1SEB D;  3TEW A;  3AEC B;  2WXQ A;  3P4Q B;  4A55 A;  2PVG C;  1PYW D;  1SXT A;  2WDQ B;  4RGN A;  1QOG A;  1ZXH A;  3NUH B;  1XCQ L;  4XWT A;  4REZ A;  5C3J B;  1CJE A;  2VZK D;  4HKQ A;  2JZP A;  1FMA D;  1FXA A;  4HRO A;  4HKZ E;  3HVD A;  1FFU A;  1YN4 A;  3URY A;  1BML C;  3I57 A;  5HI1 A;  4YXD B;  4PT5 A;  2K3U A;  1L5P A;  1R7S A;  2IGH A;  2PW9 A;  2XN9 C;  2K9X A;  1K53 A;  2DYO A;  1TY0 A;  4L2Y A;  3NS1 A;  1VJK A;  2BT6 A;  1B9R A;  1L4D B;  3TUO A;  1L4Z B;  1XLQ A;  2WXL A;  2EKI A;  3VRA B;  1VLB A;  2CU3 A;  2WU2 B;  3E56 A;  1FRD A;  2KAJ A;  2OHF A;  2WXR A;  5TSS A;  5HFY A;  4GLS C;  1PDX A;  2H89 B;  3EA6 A;  4YWG G;  1AN8 A;  1L0Y B;  2GI9 A;  3AE1 B;  2K0P A;  4P16 A;  5BMH A;  1MVK A;  4N6E B;  1L6U A;  5AUK A;  3N9Y C;  2YEP B;  3AE7 B;  4ZYS A;  2KN4 A;  2BB6 A;  1VRA B;  3EUB 2;  4RGT A;  1WGK A;  2E6X A;  2JU6 X;  3I9V 1;  2W54 A;  3W5U B;  2WXJ A;  5LNK 1;  1E7P B;  1LO5 D;  2IDY A;  2PLP A;  1I4H A;  2BS3 B;  1MI0 A;  1XXG A;  3LXF A;  4OVZ A;  5FK9 C;  3V3X A;  1JQ4 A;  3MC0 B;  2CJN A;  2W55 A;  5BMG A;  3MP9 A;  3TEY A;  4YSX B;  1F2R C;  5C2T B;  2VZK B;  5FR3 A;  1KLG D;  2BB5 A;  3ETR A;  3AED B;  2BTE A;  3PZ8 A;  4DXG A;  1N5W A;  2M19 A;  5BYQ A;  1SJE D;  2XNA C;  1EWC A;  2M56 B;  3IXS A;  1ACC A;  4WAF A;  1I4P A;  1QIL A;  2DBY A;  1M4V A;  1V1P B;  4ZRP A;  4KKI A;  1P7F A;  2NTT A;  2BS2 B;  1N60 A;  2WDR B;  1I4X A;  4A90 A;  2R61 A;  4XWW A;  1I4G A;  1SBB B;  2L32 A;  5HHD G;  5H8Y E;  4NAW B;  4TMA B;  2L1A A;  4YT0 B;  1VZ7 A;  2LHD A;  3SFD B;  1ZXI A;  2WXK A;  3AE6 B;  1YMH E;  4MAC A;  2V4I B;  1SE4 A;  4IDI A;  2KDM A;  4TSS A;  4JPS A;  4USA A;  5E6J A;  3IT6 B;  1T5X D;  4J3O D;  4ARI A;  3EGR A;  1JRO A;  3P42 A;  1I4Q A;  5EE1 A;  2MJD A;  5D7G A;  3PZ7 A;  2GB1 A;  1OQR A;  1OQQ A;  1QOB A;  4LTU A;  3AEB B;  1SIJ A;  4YTN B;  2N9K A;  2PKO A;  3SEB A;  1JML A;  2B76 B;  3Q8C A;  3VR9 B;  3TSS A;  1HZ5 A;  2W82 A;  2WXH A;  2LGI A;  1FNV A;  2IJ0 A;  4ZRQ A;  1NYR A;  2ONQ A;  2ZW0 A;  2V3N A;  1SF0 A;  1YN5 A;  2SEB D;  3BK1 A;  1L0V B;  1VZ6 A;  1PGA A;  2QSD A;  4JX1 C;  4OZC A;  2WDV B;  3AEA B;  2KQ4 X;  1L6V A;  1KF6 B;  3ABV B;  1ET6 A;  2MJ3 A;  1D5Z C;  2N0S B;  3AN1 A;  2QIL A;  1KTK A;  1JWU D;  1IBX A;  3R2I A;  1C4P A;  4YTP B;  1TKG A;  1T6B X;  3VRB B;  3AE9 B;  4YTM B;  2NMQ A;  4M0W A;  1B1Z A;  1ZPS A;  2ACZ B;  1EM7 A;  1SSN A;  4MT5 A;  2QIE B;  3CIR B;  2JX5 A;  3BK2 A;  1QLB B;  2X38 A;  3FIL A;  4A8X C;  1TS3 A;  4C56 C;  5JXV A;  1C76 A;  5EE9 A;  2EEL A;  1WXQ A;  1XEE A;  1XLN A;  5T8I A;  2G9H D;  1TKY A;  3W9C B;  2JQR B;  1JAL A;  2JXT A;  3GS2 A;  1P7E A;  1C4A A;  2AQ2 B;  1ET9 A;  1BUI C;  1IGD A;  2V3P A;  4MH8 A;  1QQR A;  3B9J A;  3NZ3 A;  2JYT A;  3V05 A;  1RWS A;  3TEZ A;  2RDG A;  2Z8L A;  2G1E A;  2WXF A;  3BII D;  1FNW A;  3B2G A;  2LUM A;  1MHH E;  1FNU A;  4JE3 B;  1J7C A;  2RMM A;  3W1S A;  1V97 A;  2LJI A;  1TJE A;  3AV8 A;  1TKE A;  4KGS A;  1D5X C;  2AQ3 B;  4WH4 A;  1ZOY B;  2NTS A;  2QEJ C;  5FKA C;  2RPV A;  4JWS C;  3TEX A;  3ZGZ A;  2L52 A;  3ZQ4 A;  1GOZ A;  4TQ1 A;  4KGR A;  1C78 A;  1UGJ A;  4FXC A;  1KRH A;  1T3Q A;  2JSV X;  3Q8A A;  4IOI E;  1ROE A;  1MPE A;  3KWL A;  4NAM A;  1DOY A;  1C9F A;  3Q69 A;  2J42 A;  3W2D A;  3O13 A;  4NJC A;  1ENF A;  1TS5 A;  1E10 A;  3IAS 1;  4ZHO A;  2HDE A;  3L4P A;  4KGT A;  4AQ7 A;  3BVZ A;  2SAK A;  2Q5W D;  2LMC A;  2W3R A;  3T3N A;  2INN E;  1UNS A;  3BVM A;  2LFI A;  1RFK A;  1GAQ B;  3AMZ A;  2L83 A;  5EE0 A;  5H92 C;  1XLO A;  3AEE B;  5GXG B;  1ZUD 2;  2K5P A;  1AYF A;  1RYJ A;  4B0M A;  4DQO C;  3W5V B;  1JCK B;  1PUT A;  3HVZ A;  4RF0 A;  3P63 A;  3WCQ A;  3ZYY X;  4US8 A;  4GDK B;  1FXI A;  3ZJU A;  2WXP A;  2RDH A;  1DYQ A;  1TS2 A;  2JWU A;  4ARC A;  4OW0 A;  4H2A A;  3AEG B;  1NEK B;  4HJG E;  1MHX A;  3AE8 B;  3E9S A;  2DYM A;  2MH7 A;  1JRP A;  1YNT E;  1I7H A;  1F77 A;  3AH7 A;  3ZJT A;  4XDC A;  1UUP A;  2WP9 B;  2H88 B;  1AWD A;  2PMV A;  1ZP0 B;  2PIA A;  3MFG A;  3SFE B;  4C80 A;  5G5G A;  1QOA A;  2WXI A;  4LLG M;  1KLU D;  4KX6 B;  3DWG C;  2KMM A;  1N62 A;  2PTL A;  1FCL A;  1F2R I;  4CQN A;  2WXO A;  3Q8B A;  3ZJV A;  2QMT A;  1OFF A;  1D5M C;  2N7J A;  1FO4 A;  1HEZ E;  5D3I B;  2INP E;  4RGM A;  3NVZ A;  2JYE A;  5BYR A;  2I2Y A;  1CQV A;  4XDD A;  4C7Z A;  5BYS A;  1V1O A;  1A70 A;  1GB1 A;  1FCC C;  1E0Z A;  2IPK D;  4L1B A;  1WWT A;  2IGD A;  1SB3 C;  4OHJ A;  5BMI A;  1VR9 A;  1HA5 A;  1SJH D;  5HG2 A;  1NVI D;  2WLB A;  4XE0 A;  4D2K A;  1ESF A;  2E3T A;  4N58 A;  3LB8 C;  2TSS A;  3MJ5 A;  5AUI A;  2Y3A A;  3OWE B;  1JW9 D;  3R8B A;  2PVO D;  3AE2 B;  1QKZ A;  1V1P A;  1C77 A;  1XLP A;  2BYT A;  1E6E B;  4DXF A;  2KAC A;  2WXM A;  1DOI A;  1KFY B;  2MJE A;  2M0A A;  2WS3 B;  2DWQ A;  1GPX A;  3AE5 B;  3IAM 1;  4RGO S;  2BBC A;  5I4D A;  1TZO A;  1GB4 A;  3P4R B;  1YJI A;  4OZA A;  3BZD B;  1XCT L;  4A9A A;  3U7Z A;  1ZDV A;  1J7A A;  4HEA 1;  3VR8 B;  2I38 A;  3BYT B;  2J53 A;  1VDV A;  4WWM A;  1XF5 L;  1HXY D;  1FM0 D;  1HQR D;  3MHZ A;  1UWX A;  3J9C A;  1SE3 A;  3P4S B;  4KKJ A;  4MM3 B;  1C4C A;  3FC4 A;  2QJL A;  4RH6 A;  3U52 E;  1TYG B;  4RF1 A;  2D5G A;  1AW7 A;  1SE2 A;  1K51 A;  5G5H A;  1BXT A;  3HRD D;  3AM9 A;  1K52 A;  3SR6 A;  3GB1 A;  4JWU C;  1WYG A;  1HZ6 A;  1F0Z A;  3IT4 B;  1STE A;  1YJJ A;  1DOX A;  4C7Y A;  1D4B A;  3U4E G;  1YQ4 B;  2DLB A;  3C8Y A;  4Q2J A;  1FIQ A;  2WU5 B;  4GDL B;  4O1N A;  3BYY B;  2CJO A;  1XO3 A;  1Y56 A;  2MEK A;  4L23 A;  3BWU D;  1JWB D;  1IBX B;  1J7B A;  2AQ1 B;  4RNA A;  1EU4 A;  4WUR A;  1ZDX A;  5D3D A;  3NVY A;  3NVW A;  4EE2 A;  1CZP A;  4P6V F;  4N59 A;  1TS4 A;  4HRS A;  3RFZ B;  1JWA D;  1FEH A;  2J52 A;  4NZL B;  1PGX A;  4RCO A;  3T3O A;  4ZHP A;  3GP7 A;  1PFD A;  1NI3 A;  3U2S C;  4TQ0 A;  2WNM A;  1NEN B;  1K50 A;  3FIL B;  4AS1 A;  2ICI A;  2LHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...