1B9RA

Terpredoxin from pseudomonas sp.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
105
structure length
105
Chain Sequence
PRVVFIDEQSGEYAVDAQDGQSLMEVATQNGVPGIVAECGGSCVCATCRIEIEDAWVEIVGEANPDENDLLQSTGEPMTAGTRLSCQVFIDPSMDGLIVRVPLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A model for the solution structure of oxidized terpredoxin, a Fe2S2 ferredoxin from Pseudomonas.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Ferredoxin
molecule keywords PROTEIN (TERPREDOXIN)
total genus 11
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1999-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b9rA00
2W3SA 1E10A 3EUB2 2M56B 1IUEA 2Q5WD 3FC4A 1E0ZA 2WLBA 1JROA 4JWUC 1E6EB 3AEBB 1N61A 2WU2B 3AE5B 2WU5B 4YT0B 3HRDD 2PKOA 1FXAA 1SIJA 1FRRA 3CIRB 4IDIA 3AEGB 1F0ZA 1RYJA 1N63A 1AYFA 3AH7A 3AB5A 1FM0D 3AEDB 1FFUA 1QT9A 1NENB 1J7CA 1FIQA 2H89B 3VR9B 1YQ4B 3AE8B 3P4RB 5EE9A 3B2GA 1FO4A 3B9JA 5AUKA 5C2TB 2AX5A 1B9RA 1OFFA 4JX1C 1JWAD 3WCQA 5G5GA 1KF6B 1QOFA 1RFKA 1GAQB 1WRIA 1XLPA 2MJ3A 1KRHA 3FAHA 2FBWB 2JX5A 3CWIA 3BIID 1ROEA 1WWTA 2W3RA 4C7ZA 1VLBA 2WS3B 1ZXIA 4YTMB 1RWSA 1SF0A 1N62A 1I7HA 1XO3A 3NVVA 1QF6A 2K5PA 4HROA 4US9A 3P1MA 3L4PA 2M19A 3AE4B 1L6VA 1GPXA 4N58A 4WQMA 1JQ4A 1WXQA 2BS2B 3HUIA 4ZHPA 2B76B 3AEAB 1N5WA 1T3QA 2W54A 1JW9D 4KX6B 1A70A 3B2FA 5EE1A 3AN1A 1PFDA 3AMZA 5EE3A 3AM9A 1DOIA 1J7AA 4ZOHC 1FXIA 1NYRA 2W55A 4US8A 2G1EA 2L52A 4ITKA 4LTUA 2PIAA 2CJOA 3AECB 3KWLA 4YTNB 1AWDA 4HRSA 1XLQA 1ZOYB 1WYGA 3W5UB 2HTME 1V97A 1CJEA 1TJEA 1YJIA 2LEKA 1QOGA 3HVZA 1XLOA 3NVWA 3P63A 2EKIA 4WWMA 1L6UA 3VR8B 2OHFA 3AE6B 2K22A 1DOXA 3AE3B 2MJEA 1FMAD 4N6EB 3AE2B 1TKGA 1TYGB 2KAJA 1JWBD 1XLNA 3AEFB 3P4SB 1TKEA 1PUTA 1NVID 4C7YA 2BT6A 1JALA 2WDVB 3W5VB 4ZHOA 3P4PB 3ZYYX 1VJKA 1DGJA 1QOAA 2JQRB 1FFVA 2CJNA 2WDQB 1N60A 1OQRA 2KMMA 2QIEB 3DWMA 2BS3B 5EE0A 1JRPA 1YJJA 2N0SB 4JWSC 5GXGB 1CZPA 1ZP0B 1PDXA 5H8YE 4N59A 1VDVA 4FXCA 2PVGC 1KFYB 3W9CB 3AE1B 2H88B 5H92C 1DOYA 5G5HA 1RM6C 1WGKA 2BS4B 1E7PB 2WQYB 3VRAB 2WDRB 3AE7B 1N5XA 3AEEB 3SR6A 4C80A 4YSYB 3RPFC 2MJDA 3P4QB 4YXDB 1R7SA 4P6VF 3LB8C 1L5PA 1J7BA 1OQQA 1ZUD2 3SFDB 3NVYA 3PO0A 3SFEB 4YSZB 1NYQA 3ETRA 2DBYA 2MH7A 1FRDA 3NS1A 4USAA 4YTPB 2Y5CA 3NRZA 2DWQA 2K9XA 1E9MA 1NEKB 5AUIA 1SB3C 1QLBB 3ABVB 5MPOA 1L0VB 3AV8A 2QJLA 2PVOD 3LXFA 4YSXB 1YQ3B 3DWGC 5C3JB 1UWMA 2WP9B 3VRBB 3AE9B 1EWYC 2ACZB 2L83A 2E3TA 3NVZA 4A9AA 1NI3A 1V8CA 2CU3A 1TKYA 1QOBA
chains in the Genus database with same CATH superfamily
5CTRC 3LJ3A 2AEHA 1Q10A 3AULA 2MP2B 1SIJA 3CIRB 3PSEB 3VAWA 1AW7A 4CYEA 1FFUA 1OEYA 1J7CA 1TT5B 1X1MA 5T8IA 2SEBD 3SDLC 3WCQA 2K0PA 1XLPA 1SGHA 3CWIA 2O2VB 4IM2A 3WA0A 3VHTC 2QSDA 3UIOB 2LFIA 4NZLB 1R4MB 5I4DA 2D10A 1V80A 4ANVA 2YVCA 1FNWA 1JWSD 1E8YA 2JT4B 2JXXA 1MHHE 4BKSA 5JZEB 2IPKD 3PZ7A 2K3UA 4MACA 4AP4C 3WAOA 2ONQA 2RMMA 1H8CA 5BMIA 4W9FA 2NTTA 2LHDA 2RDHA 1ZDXA 2CHXA 3EFUA 1PGXA 3PRPB 3HM3A 3Q6BA 3AU4A 4AJYB 1N60A 3A1QB 2IO3B 2LD9A 1LO5D 3PPAA 3Q3OC 5EE0A 4JWSC 1ACCA 2N9EB 2NTSA 1EF1A 3TIXA 2C7MB 4EZJA 3VXWA 4W9CA 1E8WA 3WALA 4BFRA 1IGCA 2HDEA 2V4LA 3TMPB 3M62B 3KW5B 3W1SC 4B0MA 3LB8C 3M63B 2GRIA 2MRPA 3NVYA 2O2VA 3NS1A 2BGFA 2RDGA 4ARCA 3TBLD 1WJNA 2INNE 2QDFA 3UQAA 1SE2A 3EGRA 5C3JB 1YQ3B 1TZOA 3W1YA 1E8ZA 4DXAB 1STEA 1TKYA 1QOBA 1WM2A 3OG5A 1G6JA 4WWPA 4MGKE 3V60A 1FNUA 3I57A 2V0GA 1F0ZA 1RYJA 1N63A 2WXNA 3VVWB 2RD0A 4LDTB 3P4RB 1OFFA 3I63C 4K1RB 2C7NB 3WIMA 2ZCBA 3NZ3A 2IY0B 3K9PB 4F7ZA 2BB5A 1XO3A 3L16A 2G4DB 3MJWA 4RH6A 4RM9A 3IVFA 3S2AA 3DBLI 4ICVA 3DHIC 2XK5A 2CHZA 3PZDA 4LDTD 3IFWB 4ZYNA 2JRHA 4J6IA 2FUG1 4XDCA 3L08A 1OGWA 3MP9A 2BB6A 1WGGA 2MJEA 2JZ3B 4B9KA 3RNCC 4HDOA 2VZKD 4HEA1 1M94A 4XE0A 2HJ1A 2L1AA 2CJNA 3KVFB 1PGAA 2KTFA 1YN5A 4FULA 4X57B 5GXGB 5H8YE 1ISNA 4KIKB 5G5HA 3WANA 4OVZA 3IXSA 2RGFA 4CHKA 2FIFA 4KZCA 3VUWA 1A5RA 2JY6A 2ZPNA 4P16A 3N30A 4WWOA 1R4NI 4USAA 4AS1A 2I38A 2DWQA 2KN5A 2VH1A 2WYQA 1TS2A 5BYSA 3JSVA 1BXTA 5CHWA 1C4AA 3DWGC 3TSSA 4GDLB 2KLCA 2L83A 2IZVB 1T0SC 4P1BC 1YX5B 4BKTA 2WLBA 4JWUC 1E6EB 4P1CC 4W9DA 2N1VA 3BINA 3IAS1 3Q14C 1AYFA 3L10B 3AEDB 4II3B 1YX6B 4B0EA 1P0RA 4JQWC 5G5GA 2FBWB 4LNKA 4E71A 4YTMB 2KDIA 1I7HA 3P1MA 1K51A 4FLHA 1L6VA 2KHWB 2JYEA 4W9IA 3ENEA 4ZHPA 3H7PB 5BMGA 1T3QA 1JW9D 3PTFC 1VR9A 1A70A 1GG3A 1Y8RC 1PFDA 4DDGD 2HJ8A 1E90A 3URYA 2KTRB 2NPTB 1AWDA 2EMTA 4HPLB 3FKYA 2KTRA 3GOEA 2BQQA 2GBNA 2D3AA 2R2QA 4ZDVA 1XT9B 5AZFA 2N7DA 3VDZA 1QOAA 4NJ6A 3Q2AC 3DWMA 3ZIMA 2KT7A 1NI2A 1WXAA 3C0RB 3AE1B 3ZKJC 5JHAA 1Z5SB 4ANWA 1EUVB 2FE8A 2WXHA 1OQQA 4G11A 2LUEA 1MFWA 2OOBB 3N1ZC 4ARIA 1MG8A 1RLFA 5FKAC 2ZVNA 3A9JA 3PLVA 3BK2A 1NEKB 3HIZA 4DXGA 3PV1A 4XZ4A 4G50A 2FUHB 4MT5A 2KANA 1EWYC 2LVOA 2VH2A 4A20A 2QMTA 2LRUA 2V3PA 1R4NB 4DWFA 5AEKB 3A33B 1FRRA 2AQ1B 3ZJUA 3W2DA 1NENB 1FIQA 4WIPA 1C76A 1D5ZC 1JWAD 1RFAA 2WXMA 3KQ4A 2V4IB 4MEMA 1I4GA 5E6PA 1ZXIA 4C56C 2K5PA 2M19A 2WWZA 2L7RA 4NQKE 3CSFA 5BYQA 2W54A 1WXVA 3B1LX 4L23A 2PEAA 2MBOA 2JWUA 1DOIA 4PK1A 4EKUA 4GN1A 4FHKA 4BVUC 1GPXA 2LRWA 4PS3A 3VTUA 2LEKA 2MHJA 2Z59B 2KQSA 1EO6A 2G45B 2J0MA 2PPHA 3U2SC 1L6UA 1ZKHA 2C9WB 3PHWB 3UINB 1JRUA 1TYGB 2KAJA 3IBEA 4AQ7A 3P4SB 2JWZA 5TR5A 1VJKA 1DGJA 4DDID 1TTNA 1OQRA 2MLBA 2V3SA 2BS3B 1C9FA 3VTWA 3APCA 4ZRJA 4BAXA 4OZCA 4LNIA 2KN4A 4C4VB 4MSQB 3JYUA 4MGYE 4UDUC 3IAM1 3U7ZA 1E9MA 2IGHA 1C4CA 4RF0A 5L95C 4NQLB 2KWDA 3ML8A 3Q8CA 3ZJVA 4HPPA 5G2NA 2WU2B 1FEHA 4KGRA 4G3XB 2AQ3B 4GDKB 2AL6A 2KWUB 3ZNGC 2J7QB 5D3IB 1SJED 1WGYA 2JVCA 1UBQA 4KSLC 3TEXA 4W9GA 1IBXA 1KH0A 5E6JA 4WAAA 3RCZA 3NVVA 5LLIA 2IJ0A 4HROA 1K50A 3EC8A 4GOCA 5J2RA 1WXQA 1WFYA 1OQYA 1QILA 1KLUD 4GB9A 4D2KA 2M17A 3GS2A 3QC8B 1ZW7A 4DHJB 1XCQL 4W9LA 2A4ZA 4DHZB 3TCAA 3W5UB 2YLMA 3NVWA 4BBNC 1U4AA 2M4NA 5JH5C 3H7SA 3L0WB 3Q3JA 2WXOA 1JWBD 4TSSA 1PQSA 4GIVA 3KYCD 4HK2A 1UELA 2GLSA 1FFVA 2WGSA 3QAQA 1I4HA 4MJSA 2WXQA 3EFCA 2N0SB 4ZRKA 5DPSA 4M0WA 1GC7A 3MC0B 2PMVA 5C23A 2SAKA 2KJ6A 2OEDA 2AL3A 3RZFA 3L13A 2JPHA 3RYTA 3RUIB 1FRDA 1EF5A 1I4QA 2MCNB 4A3PA 2KJRA 1WX7A 4E74A 2PVOD 1EWCA 1V5TA 2ZVOA 1TBEA 1V8CA 2ZNVC 1JRPA 2DYBA 2DNFA 2VZKB 1VZ7A 3PLUA 2EMSA 4N9F4 3HK0A 2BYTA 4ASWC 3N1YC 3GZNB 3VH4B 4ICUA 4IOIE 2J4XA 2WDTB 2O6VB 2QILA 2NS5A 1FCLA 2PE6B 2C5LC 2KD0A 1KRHA 2L0TA 3FILA 1FNVA 1V49A 3VTVA 1WWTA 2WS3B 3AI5A 4WWNA 4M01A 1HEZE 3ZXRA 3BYTB 2D3BA 3I5JC 1WJ4A 4OHJA 4MM3B 5JXVA 2FCNA 3AMZA 1FPYA 4WAFA 1GJZA 1DYQA 1E7UA 2J0KA 1FXIA 4ITKA 3NHEB 1VRAB 1ZOYB 4NY0A 2L0FA 4B95A 2NMQA 3I9V1 1TS4A 4WJNA 2PW9A 4N6EB 4XC2A 1WXMA 2D5GA 4FADA 3PRMB 3W5VB 4DBGA 3E9SA 3ZYYX 2BW2A 1V1PA 5CHVC 1C1YB 1WRDB 1VZ8A 2JU6X 4FA6A 2LVPA 2DHZA 1Z2MA 2KX0A 4GDKA 1D4BA 2CHWA 4R3DA 1YNTE 3ML9A 3J9CA 3ZGZA 2INCC 4EZLA 4RMAA 4P6VF 4PS8A 3PRZA 2D2QA 3PT2B 3U30A 1OEYJ 3SFEB 1WE7A 3APFA 3ETRA 5LXIB 3X0WA 2K9XA 1SB3C 1ZGUB 2N9PC 4HJGE 2QJLA 1Q0WB 1ET6A 4FJVB 4Q2JA 1I4RA 4KVGB 1EU3A 2LXAA 5DCNA 4C00A 2INPE 2I1KA 1ZPSA 3GE3C 3ZTCA 4HCPB 3PS6A 2WU5B 1YOVB 1WM3A 3TEZA 4EEWA 4JPSA 3K9OB 2L3ZA 2ZEQA 3BY4B 2WXIA 1ESFA 3ZVVA 3O13A 1GAQB 1WI0A 2KYWA 2L00B 4C7ZA 4US9A 3RNEC 4ZRQA 1S3SG 3TEYA 3TL5A 4AJWA 3V05A 3AN1A 3H9DA 1HTQA 3X23A 2D07B 1WYWB 2L05A 4AOFA 1HA5A 3R2TA 3KWLA 2QCZA 1V97A 2M0AA 1YJIA 3HVZA 1QOGA 3R7RA 2ZNVB 2LGSA 1JWMD 2JZZA 2DAFA 4ZHOA 3NUHB 1YD8U 5HG2A 3ZO5B 1WSPA 1YJ1A 2GBRA 4AWJA 3JW0X 2MBBB 4JLCA 2BBCA 3UIPB 1E7PB 1C3TA 3ZNZB 1P3QU 4C80A 1KTKA 3TEWA 3NG0A 3DBHB 2W82A 1R7SA 2JUOA 1J7BA 2PJHA 4K7UA 3RI7C 1NYQA 3SEBA 2DBYA 2DLBA 3Q8BA 4RGMA 1NDDA 3HVDA 4LNOA 1L0VB 1I4PA 3U4EG 1RRBA 4LNFA 2NBVB 3VRBB 2K8HA 2Q5WD 4G0NB 1UNSA 3FILB 3VUYA 5D94A 4YT0B 1QZEA 3Q3NC 2IO2B 3U7DA 4K3BA 3VR9B 2IBIB 1VD2A 5IP4D 1TY2A 3QQ8B 2MJ3A 3FAHA 1AARA 2O6VD 3PHXB 3VH3B 5LXHA 1KOTA 1QF6A 2MBQA 1E8XA 2DAJA 1OTRB 1SSNA 3PGEA 2YEPB 2ZW1A 4CO7A 4FN2A 4KDLB 4GSWA 1J7AA 1TY0A 2IO1B 4F8CB 5C1ZA 4US8A 4IC7B 4HRSA 1XEEA 3UGBB 1HTOA 1MI0A 3UI3A 2DENB 3IG3A 4GXBA 4NAMA 3QX1A 5IOIA 2LI5A 5HFYA 2DZMA 2Y3AA 4ZYSA 2J52A 2IGGA 5BYRA 1YJJA 2M1MA 1V6EA 4FXCA 5E6OA 3ZQ4A 4HKQA 3C19A 3W9CB 2G9HD 5H92C 2BS4B 3AEEB 2LGYA 3CF6E 3BYYB 3O65B 3DBLB 4C4VA 4YTPB 2OJRA 1TZ1A 1JWUD 2MA9B 2FAZA 1S1QB 3KUCB 1UGJA 2G4SA 2ACZB 3QCAA 2CU3A 3B08A 2W3SA 2M56B 1V81A 1JROA 1IBXB 3AEBB 5L83A 4DHZE 1WGHA 1UUPA 2AYOB 3AB5A 2W9NA 1IGDA 2DX5B 1L4ZB 3B9JA 1LFDA 5JHBA 5LNK1 1WRIA 3V3XA 1FD6A 2JF5A 4NNJB 3BIID 1L0XB 1WZ3A 2KFKB 3Q69A 4AUQC 3IT6B 1EU4A 3BVZA 4HKZE 2GI9A 2NBUA 4WJOA 4MDKE 4M00A 2DYOA 3GP7A 4M8NA 5HKHA 4YTNB 5EDSA 1V9JA 3JVZX 3RT3B 4I6LB 4MELA 2MX2A 3A1QA 1KLVA 3UF8A 1IP9A 4LK0M 1JMLA 4TQ1A 1TIFA 2GMIC 2IO0B 2K8CA 3GE8C 3Q3FA 1TS5A 3ZDTA 2WHIA 2KKCA 1ZP0B 1BUIC 2UWQA 5DPTA 5IAAC 3KUZA 3VRAB 1SE3A 3ZUNA 4II2B 4YSYB 3P4QB 4NJ7A 4W9JA 5J17A 2WX1A 3KUDB 2VRRB 1I42A 3OWEB 2DZIA 2RPQA 1P7FA 3LYYA 2KQ4X 2BYEA 1BMLC 3EA6A 2PTLA 3LXFA 1UWMA 2WP9B 1V1PB 2E3TA 4A9AA 2N1WA 4IKGA 3AE5B 1V2YA 1FXAA 2JRIB 3NZSA 2MSED 1T0RC 5GMVA 2KJHB 4LCDE 3AE8B 4JX1C 2J53A 1WX8A 1MPEA 1LGRA 3I3TB 3EHVA 4N58A 2Y5BB 1JQ4A 2KWCA 3QK0A 3QHTA 4YSZB 3B2FA 5EE1A 4J3OD 1WMHA 4REZA 5EE3A 3DVNU 1F77A 3RNFC 4A3OA 2LJ5A 1C77A 1F9JA 1Q1OA 4HCNB 2XNAC 3UQBA 4F1SA 1R4MI 3SD5A 1TJEA 1VCBA 1K53A 2EKIA 1FMAD 3RMKC 2V3NA 1P9DU 3QARA 2UU7A 2X8XX 1WR1A 1L0YB 2KFKA 2JQRB 2QIEB 5D6JB 2KMCA 1MG4A 2YEPF 4I6PA 5HI1A 2M8SA 4MH0E 3KYDD 2MP2A 1CMXB 1XCTL 2BF8B 1D3ZA 5D7GA 4YXDB 2FCMA 3A4SC 1LQBA 2NPTA 3PO0A 1T5XD 3ZRFA 1ZXHA 2MH7A 2TSSA 4M0WB 3Q8FA 3ABVB 1WY8A 2MEKA 4NAWB 3DBHI 3L54A 1C4PA 1KLGD 4OZAA 1UBIA 2HE7A 1N61A 1GC6A 3NS8A 3H1UA 2PKOA 4A6QA 2WXJA 4KKIA 2N9LA 1FM0D 5DPRA 3B2GA 3NOBA 1B9RA 1D6EC 2WXPA 1KF6B 5E6NA 4GDLA 3E56A 4M8MA 3BK1A 2K8BA 1Q5WB 3RNBC 2WNMA 4XX5A 2Z0DB 3PVLA 1T0YA 4RM8A 4URKA 4L2YA 2KFJA 3JSVB 2N7EA 2WXFA 4P7IA 1E7VA 1K8RB 2A5UA 3NY5A 4WJQA 5AZGA 1ENFA 4XWWA 4PT5A 3ECIA 3W1SA 1MJDA 1XLOA 1QQRA 2BWES 4S17A 3C8YA 3AE6B 2K22A 3SU8X 2KO3A 2C7HA 1PYWD 2XEWA 4IWQA 4BOZB 1PUTA 1HQRD 2V9HA 1D5MC 2WXKA 1L2NA 2WX0A 2PE9A 4HDQA 4LJOB 2I1JA 3DVNV 3BVGA 2WXLA 4IW0A 1GB1A 1NBFC 3DDCB 2BKFA 2WXGA 4IWOA 2R61A 3T3NA 3U52E 1ZUD2 1BT0A 4YL8A 2FCSA 2Y5CA 3SHQA 3R3MA 2XK5B 2QC8A 2LGIA 2MBHA 3AE9B 2LHEA 1XXGA 2L32A 2K1FA 2HTHA 1C78A 3EUB2 1IUEA 1YIWA 2GBKA 3ZNID 3HM6X 4BBNF 5AZHA 4HLEA 2DZJA 3M3JA 2H89B 3MC8A 3DCGA 5C2TB 2D3CA 3DHGC 3QWZB 3N20C 2JSVX 3HHMA 1WH3A 2K6DB 1SF0A 1UZXB 2KDFB 4LNNA 4A90A 2KVZA 3AE4B 3APDA 3HUIA 5D2MB 2B76B 3AEAB 5AUIA 2O6VA 3RULA 2EKEC 2XN9C 2D11A 4KKJA 2W55A 1NYRA 2CR5A 4OW0A 4TMAB 2KNBA 3AECB 2RPVA 4CQNA 4IWPA 5FR3A 4WWMA 2ZZPB 4DHJD 4KV2A 1UD7A 4DXFA 1F52A 3MC9A 4BKSD 1PGBA 1RAXA 2KOXA 1HZ6A 2LASA 3GZNI 2J42A 3BVMA 4OVVA 1CK1A 1WIAA 4BZAA 4N59A 1KFYB 3DOWA 1D5XC 1RM6C 2WQYB 2WDRB 1UGMA 4MM3A 4ZRIA 1SJHD 3DVGY 3OJ3A 4K7SA 4HPMB 4KDIC 1L7YA 2MJDA 1FXTB 4FJYA 3AXCA 4A55A 2GBJA 1P1AA 4IG7B 4BOSC 5IKCM 3NRZA 1HXYD 3T9LA 1QLBB 3ZW3A 2ICIA 3DBRI 5MPOA 1UF0A 3WAPA 4RGTA 2AWTA 4RGOS 1L4DB 2PLPA 1NI3A 2KLGA 3QA8A 4O1NA 2FIDA 1GB4A 3QIJA 1SE9A 2ZPYA 4K7WA 2LUMA 4IDIA 1F1HA 3AEGB 3CMMB 5J18A 2KVRA 2BKRB 2LGDA 3RNAC 4MGZE 1RFKA 5KHOA 4JGHB 3D32A 1FCCC 1VLBA 2K25A 4RGNA 1WJ6A 4W9EA 1P98A 4EZKA 2FNJB 1SE4A 3RNGC 4KIKA 3R8BA 1T0QC 3MTNB 3AM9A 4OVUA 1JCKB 1J0GA 4LTUA 4TQ0A 5CHFA 2KZRA 2HTME 2BPSA 3DVGX 1DOXA 4FJZA 3MFGA 2KMAA 5TSSA 3AE2B 1XLNA 2G3QB 1TKEA 2KWVB 4L1BA 1NVID 3TJPA 2WDVB 3RD2A 4ANUA 1CQVA 3P4PB 2KDMA 2WDQB 5CX3A 2RDBC 1ZDVA 2JXTA 1IPGA 1VDVA 2KC1A 4RCOA 1SIFA 3ZRCA 1UWXA 2GB1A 3AU5A 2HD5B 2QHOA 1WX9A 3N3KB 4HWIB 4A8XC 2BWFA 2WXRA 4NAWA 4TUUA 4WQOB 4E3CA 2V1YA 4GMVA 1LM8B 4WURA 1MVKA 3Q8AA 4HJKA 2IDYA 1AN8A 1YN4A 3N9YC 3T8MA 2ZCCA 3AV8A 4LJPB 1QKZA 4TKNA 2EELA 2G1EA 3M95A 1SXTA 2XBBC 2X38A 1P7EA 4GGQA 2L8JA 3QJZA 4LLGM 2RSUA 2JZPA 3CSTA 4JL9A 1QT9A 3PREA 1YQ4B 5EE9A 5AUKA 4ACFA 3Q3MC 1QOFA 2KXJA 2GBMA 1XD3B 2I2YA 1IYFA 1EM7A 3P2BA 4WQMA 4WH4A 3R66C 4IM3A 4KX6B 3B0AA 1GNUA 1TGZB 1H4RA 4KZ0A 3RFZB 3EECA 1WYGA 2ZJDA 4S0RA 2ZW0A 2LJIA 3P63A 2R2OA 4FBJB 3AE3B 2CS4A 1TKGA 3KH0A 1WGDA 3OAWA 2L76A 4C7YA 5BMHA 2JYTA 1WE6A 4H2AA 4XWTA 1F2RI 3DHHC 5FK9C 3A9JB 1GUAB 1M4VA 4XYCA 2LGXA 3DQVA 4ANXA 3AE7B 4MSMB 4IM0A 2M0XA 3RPFC 1F2RC 3SFDB 1WXSA 3NZUA 1YMHE 2GOWA 2KDEB 2IY1B 2NCNA 1GOZA 2LZ6A 3PZ8A 2Y5PA 1XF5L 1YQBA 2LWPA 4JE3B 3NJTA 2Z0EB 2IGDA 5IO9A 4M02A 1WMHB 2KQ7A 1E10A 1E0ZA 3R2IA 4XDDA 3U8ZA 3HRDD 2LMCA 1YN3A 3MHSD 3L17A 1E5WA 1UH6A 3KLSX 1K52A 4HXDA 2AX5A 4JIOU 1WZ0A 2KACA 5D3DA 2BTEA 4KSKC 1TS3A 4NPNA 2JX5A 2DYMA 1V1OA 1V86A 4PYZA 5FR6A 3OJ4B 1RWSA 1N62A 2MBEA 1HZ5A 3L4PA 4KGTA 2N7JA 1SEBD 3A4RA 3V6CB 1I4XA 4BKGA 1VZ6A 3MHZA 1ZE3D 4NJCA 4RF1A 3BZDB 3ZJTA 1SBBB 1HE8A 3ZDMC 1XLQA 4WJPA 3RZWC 2MQJA 3H8HA 2N4FA 2N9XA 3WAMA 2OHFA 3A9KB 2ASQA 4GLSC 3AEFB 2BT6A 1JALA 3N1XC 4B6WA 3IHPC 4IUMB 4MGIE 1WJUA 4K81A 3TUOA 4HVBA 1XQQA 3R7QA 2CKHB 1PDXA 4TV3A 2D3GA 2H88B 1DOYA 1MHXA 4MH8A 2UYZB 3H7PA 1Y56A 3SR6A 1V5OA 4QAYA 4GU2A 2C60A 1L5PA 2BVCA 2E6XA 3Q8EA 4DK5A 3MJ5A 1B1ZA 5BO4B 2K39A 2FCQA 3DPDA 4W9HA 5IA7A 2J0JA 4FHJA 3H6NA 2INDC 2OJWA 3DBSA 4PYUA 2MWSB 2RR9A 1KM7A 2LVQA 2AQ2B 2B3AA 3FC4A 1C79A 3VUXA 4KGSA 2CU1A 1WF9A 3ALBA 3AH7A 4EFOA 1FO4A 1WR6E 2Z8LA 4EOYA 2KC2A 1N6ZA 1ROEA 2W3RA 1KJTA 3ZLZA 3KWVA 3V6EB 1T6BX 1J19A 4W9KA 2BS2B 1N5WA 3OLMD 4I6NB 1I35A 4ZOHC 4XGAB 1LXDA 3V61A 1J8CA 4OZBA 2L52A 2PIAA 2CJOA 2NVUI 1CJEA 5HHDG 4ZRPA 3ONSA 4YWGG 3GB1A 3VR8B 5DPWA 2DZKA 3LDZE 2IYDB 2MW5A 3A9KA 5KHQA 2BYVE 2NBWB 3IT4B 3V62A 3T3OA 3ZNHB 3VFKA 3RN9C 3ZTDA 2LXCA 5IN7A 4PS7A 2KMMA 2KX3A 1CZPA 1WGRA 2KK8A 2N9KA 2K6QA 4MJSB 2PVGC 4DQOC 1WGKA 1N5XA 3BWUD 3N32A 2KDBA 3VQIA 4RNAA 2BYFA 4RFBA 2QEJC 4K3CA 4EE2A 2REXA 5G55A 2NR2A 3ZXVA 4YSXB 2ON8A 1ET9A 4EUTA 3NVZA 3DBRB 3P42A
chains in the Genus database with same CATH topology
2W3SA 2M56B 1GB4A 1JROA 1IBXB 3AEBB 2WU2B 1FEHA 2LUMA 1Q10A 4KGRA 2AQ3B 4GDKB 1SIJA 4IDIA 3CIRB 1UUPA 3AEGB 1AW7A 3AB5A 5D3IB 1FFUA 1IGDA 1J7CA 1SJED 5T8IA 1L4ZB 3B9JA 2SEBD 3WCQA 2K0PA 5LNK1 1RFKA 1WRIA 1XLPA 3TEXA 3V3XA 1FD6A 1IBXA 3CWIA 1KH0A 5E6JA 3BIID 1FCCC 1L0XB 1VLBA 3NVVA 2IJ0A 2QSDA 4HROA 4RGNA 1K50A 2LFIA 4NZLB 3Q69A 5I4DA 1WXQA 1FNWA 1JWSD 1QILA 1SE4A 1EU4A 3IT6B 1MHHE 3BVZA 1KLUD 4HKZE 4D2KA 2GI9A 3GS2A 3R8BA 3AM9A 2IPKD 1XCQL 3PZ7A 2K3UA 1JCKB 2DYOA 4MACA 3GP7A 4LTUA 4TQ0A 4YTNB 3W5UB 2HTME 2ONQA 2RMMA 3NVWA 5BMIA 1DOXA 3MFGA 2NTTA 5TSSA 2LHDA 2RDHA 3AE2B 2WXOA 1JWBD 1XLNA 4LK0M 4TSSA 1ZDXA 1JMLA 1TKEA 4L1BA 4TQ1A 1NVID 1PGXA 2WDVB 1CQVA 3P4PB 1TS5A 2KDMA 1FFVA 2WDQB 1N60A 1I4HA 1ZDVA 1LO5D 5EE0A 2WXQA 2JXTA 2N0SB 4JWSC 1ACCA 1ZP0B 2NTSA 1BUIC 1VDVA 4RCOA 4M0WA 3VRAB 1SE3A 1UWXA 2GB1A 1IGCA 3MC0B 2PMVA 4YSYB 2HDEA 4B0MA 3P4QB 3LB8C 4A8XC 2GRIA 2SAKA 2OEDA 2WXRA 3NVYA 3NS1A 1FRDA 4WURA 1MVKA 3OWEB 3Q8AA 2RDGA 1I4QA 4ARCA 1P7FA 3LYYA 2IDYA 1AN8A 2KQ4X 1YN4A 2INNE 3N9YC 3AV8A 1SE2A 1BMLC 2PVOD 1EWCA 3EA6A 2PTLA 3EGRA 3LXFA 5C3JB 1YQ3B 1TZOA 1UWMA 2WP9B 1V1PB 1QKZA 2E3TA 4A9AA 1V8CA 1STEA 1TKYA 2EELA 2G1EA 1QOBA 1JRPA 4IKGA 1SXTA 2X38A 1P7EA 3AE5B 1FNUA 2VZKB 1VZ7A 1FXAA 4LLGM 3I57A 2V0GA 1F0ZA 1RYJA 2BYTA 1N63A 2JZPA 2WXNA 1QT9A 4IOIE 1YQ4B 3AE8B 3P4RB 5EE9A 5AUKA 2J4XA 1OFFA 4JX1C 2QILA 1QOFA 2J53A 1FCLA 1KRHA 3NZ3A 3FILA 1FNVA 2I2YA 1MPEA 1WWTA 2BB5A 2WS3B 1XO3A 1EM7A 1HEZE 4RH6A 3BYTB 4N58A 4WQMA 4WH4A 1JQ4A 4OHJA 4MM3B 4YSZB 4KX6B 3B2FA 5EE1A 5JXVA 4J3OD 3AMZA 4REZA 5EE3A 1F77A 4WAFA 1DYQA 1FXIA 1C77A 4ITKA 2FUG1 3RFZB 2XNAC 1VRAB 4XDCA 1ZOYB 1WYGA 1TJEA 1K53A 2ZW0A 3MP9A 2LJIA 3P63A 2NMQA 2BB6A 1TS4A 2EKIA 3I9V1 3AE3B 2MJEA 2PW9A 1FMAD 4N6EB 1TKGA 2D5GA 2V3NA 2VZKD 4C7YA 4HEA1 3W5VB 5BMHA 2JYTA 1L0YB 3E9SA 4H2AA 4XE0A 3ZYYX 2BW2A 4XWTA 1F2RI 2L1AA 2JQRB 2CJNA 1V1PA 1PGAA 5FK9C 2QIEB 1YN5A 1VZ8A 2JU6X 5GXGB 5H8YE 2YEPF 1M4VA 5HI1A 5G5HA 4OVZA 3IXSA 3AE7B 1D4BA 4R3DA 1XCTL 1YNTE 3ZGZA 3J9CA 5D7GA 3RPFC 1F2RC 4YXDB 4P6VF 3SFDB 3PO0A 3SFEB 1T5XD 1YMHE 4P16A 1ZXHA 2MH7A 2TSSA 3ETRA 4USAA 4AS1A 2I38A 2DWQA 1GOZA 2K9XA 3PZ8A 1SB3C 2Y5PA 3Q8FA 1XF5L 1TS2A 3ABVB 4HJGE 5BYSA 1BXTA 1C4AA 2QJLA 1ET6A 2MEKA 4Q2JA 1I4RA 3DWGC 3TSSA 4GDLB 4JE3B 1EU3A 2IGDA 2L83A 4NAWB 1C4PA 2INPE 1KLGD 4OZAA 1E10A 1E0ZA 2WLBA 4JWUC 1E6EB 3R2IA 1ZPSA 1N61A 4XDDA 2WU5B 3HRDD 2PKOA 2LMCA 1YN3A 4A6QA 3TEZA 2WXJA 3IAS1 1AYFA 2N9LA 4KKIA 4JPSA 1FM0D 3AEDB 3KLSX 1K52A 3B2GA 2WXIA 1ESFA 3O13A 2AX5A 1B9RA 1D6EC 4B0EA 2KACA 2WXPA 5G5GA 5D3DA 2BTEA 1KF6B 1GAQB 1TS3A 3E56A 2FBWB 2JX5A 2DYMA 3BK1A 1V1OA 4C7ZA 4YTMB 1RWSA 1I7HA 1N62A 1HZ5A 2WNMA 4US9A 3P1MA 1K51A 3L4PA 4KGTA 1L6VA 4ZRQA 2JYEA 2N7JA 1SEBD 3TEYA 4ZHPA 1I4XA 5BMGA 1T3QA 3V05A 1JW9D 1A70A 1VR9A 4L2YA 3AN1A 1PFDA 1VZ6A 3MHZA 2WXFA 1ZE3D 4NJCA 4RF1A 3BZDB 3URYA 3ZJTA 1HA5A 1SBBB 3R2TA 3KWLA 1ENFA 1AWDA 4PT5A 1XLQA 4XWWA 1V97A 3H8HA 2M0AA 1YJIA 3HVZA 1QOGA 3W1SA 1XLOA 1JWMD 1QQRA 3C8YA 2OHFA 3AE6B 2K22A 4GLSC 1PYWD 3AEFB 1PUTA 1HQRD 2BT6A 1JALA 3NUHB 4ZHOA 1D5MC 5HG2A 2WXKA 1WSPA 1QOAA 3TUOA 3DWMA 1PDXA 2BBCA 3BVGA 2WXLA 3AE1B 2H88B 1DOYA 1MHXA 4MH8A 1E7PB 1GB1A 4C80A 1Y56A 3SR6A 1KTKA 3TEWA 2W82A 1R7SA 2WXGA 2R61A 1L5PA 3T3NA 2FE8A 2WXHA 1J7BA 1OQQA 1ZUD2 3U52E 2E6XA 3Q8EA 4ARIA 3MJ5A 1B1ZA 1NYQA 3SEBA 5FKAC 2DBYA 2DLBA 2Y5CA 3Q8BA 3BK2A 1NEKB 4DXGA 4RGMA 3HVDA 1L0VB 1I4PA 3U4EG 4MT5A 2LGIA 3VRBB 3AE9B 1EWYC 2LHEA 1XXGA 2L32A 2QMTA 2V3PA 2AQ2B 1C78A 3EUB2 2Q5WD 1IUEA 3FC4A 1C79A 1UNSA 3FILB 4KGSA 4YT0B 1FRRA 2AQ1B 3ZJUA 3W2DA 3AH7A 1NENB 1FIQA 2H89B 3VR9B 1FO4A 4WIPA 2Z8LA 5C2TB 1C76A 1D5ZC 1JWAD 1TY2A 2WXMA 2MJ3A 3KQ4A 3FAHA 2JSVX 2V4IB 1I4GA 1ROEA 2W3RA 1ZXIA 4C56C 1SF0A 1QF6A 3KWVA 4A90A 2K5PA 1T6BX 2M19A 3AE4B 2BS2B 1SSNA 3HUIA 2B76B 3AEAB 1N5WA 2W54A 5AUIA 2YEPB 5BYQA 4L23A 2XN9C 2ZW1A 2JWUA 1DOIA 1J7AA 1TY0A 4ZOHC 4KKJA 2W55A 1NYRA 4US8A 4OZBA 2L52A 4OW0A 4TMAB 2PIAA 2CJOA 2RPVA 3AECB 1GPXA 4HRSA 4CQNA 1XEEA 1CJEA 2LEKA 5HHDG 1MI0A 5FR3A 3UI3A 4WWMA 4ZRPA 4YWGG 1L6UA 3GB1A 3U2SC 3VR8B 1TYGB 2KAJA 4NAMA 4DXFA 4AQ7A 3P4SB 5HFYA 3IT4B 3T3OA 1PGBA 1VJKA 3ZJVA 1DGJA 2Y3AA 4ZYSA 2J52A 1HZ6A 2IGGA 1OQRA 2J42A 2KMMA 3BVMA 2BS3B 5BYRA 1C9FA 1YJJA 1CZPA 1CK1A 2N9KA 4N59A 4FXCA 2PVGC 3ZQ4A 1KFYB 3W9CB 4HKQA 2G9HD 5H92C 4OZCA 4DQOC 1D5XC 1RM6C 1WGKA 2BS4B 2WQYB 2WDRB 2KN4A 1N5XA 3AEEB 1SJHD 3BWUD 2MJDA 3BYYB 3VQIA 4RNAA 4A55A 4RFBA 2QEJC 4UDUC 4YTPB 4EE2A 3IAM1 3NRZA 1HXYD 3U7ZA 1E9MA 1JWUD 1QLBB 2IGHA 1C4CA 4RF0A 2ICIA 5MPOA 1UGJA 2KWDA 4YSXB 2ON8A 1ET9A 4RGTA 2ACZB 4RGOS 1L4DB 3NVZA 2PLPA 3P42A 3Q8CA 1NI3A 2CU3A 4O1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3S A;  1E10 A;  3EUB 2;  2M56 B;  1IUE A;  2Q5W D;  3FC4 A;  1E0Z A;  2WLB A;  1JRO A;  4JWU C;  1E6E B;  3AEB B;  1N61 A;  2WU2 B;  3AE5 B;  2WU5 B;  4YT0 B;  3HRD D;  2PKO A;  1FXA A;  1SIJ A;  1FRR A;  3CIR B;  4IDI A;  3AEG B;  1F0Z A;  1RYJ A;  1N63 A;  1AYF A;  3AH7 A;  3AB5 A;  1FM0 D;  3AED B;  1FFU A;  1QT9 A;  1NEN B;  1J7C A;  1FIQ A;  2H89 B;  3VR9 B;  1YQ4 B;  3AE8 B;  3P4R B;  5EE9 A;  3B2G A;  1FO4 A;  3B9J A;  5AUK A;  5C2T B;  2AX5 A;  1B9R A;  1OFF A;  4JX1 C;  1JWA D;  3WCQ A;  5G5G A;  1KF6 B;  1QOF A;  1RFK A;  1GAQ B;  1WRI A;  1XLP A;  2MJ3 A;  1KRH A;  3FAH A;  2FBW B;  2JX5 A;  3CWI A;  3BII D;  1ROE A;  1WWT A;  2W3R A;  4C7Z A;  1VLB A;  2WS3 B;  1ZXI A;  4YTM B;  1RWS A;  1SF0 A;  1N62 A;  1I7H A;  1XO3 A;  3NVV A;  1QF6 A;  2K5P A;  4HRO A;  4US9 A;  3P1M A;  3L4P A;  2M19 A;  3AE4 B;  1L6V A;  1GPX A;  4N58 A;  4WQM A;  1JQ4 A;  1WXQ A;  2BS2 B;  3HUI A;  4ZHP A;  2B76 B;  3AEA B;  1N5W A;  1T3Q A;  2W54 A;  1JW9 D;  4KX6 B;  1A70 A;  3B2F A;  5EE1 A;  3AN1 A;  1PFD A;  3AMZ A;  5EE3 A;  3AM9 A;  1DOI A;  1J7A A;  4ZOH C;  1FXI A;  1NYR A;  2W55 A;  4US8 A;  2G1E A;  2L52 A;  4ITK A;  4LTU A;  2PIA A;  2CJO A;  3AEC B;  3KWL A;  4YTN B;  1AWD A;  4HRS A;  1XLQ A;  1ZOY B;  1WYG A;  3W5U B;  2HTM E;  1V97 A;  1CJE A;  1TJE A;  1YJI A;  2LEK A;  1QOG A;  3HVZ A;  1XLO A;  3NVW A;  3P63 A;  2EKI A;  4WWM A;  1L6U A;  3VR8 B;  2OHF A;  3AE6 B;  2K22 A;  1DOX A;  3AE3 B;  2MJE A;  1FMA D;  4N6E B;  3AE2 B;  1TKG A;  1TYG B;  2KAJ A;  1JWB D;  1XLN A;  3AEF B;  3P4S B;  1TKE A;  1PUT A;  1NVI D;  4C7Y A;  2BT6 A;  1JAL A;  2WDV B;  3W5V B;  4ZHO A;  3P4P B;  3ZYY X;  1VJK A;  1DGJ A;  1QOA A;  2JQR B;  1FFV A;  2CJN A;  2WDQ B;  1N60 A;  1OQR A;  2KMM A;  2QIE B;  3DWM A;  2BS3 B;  5EE0 A;  1JRP A;  1YJJ A;  2N0S B;  4JWS C;  5GXG B;  1CZP A;  1ZP0 B;  1PDX A;  5H8Y E;  4N59 A;  1VDV A;  4FXC A;  2PVG C;  1KFY B;  3W9C B;  3AE1 B;  2H88 B;  5H92 C;  1DOY A;  5G5H A;  1RM6 C;  1WGK A;  2BS4 B;  1E7P B;  2WQY B;  3VRA B;  2WDR B;  3AE7 B;  1N5X A;  3AEE B;  3SR6 A;  4C80 A;  4YSY B;  3RPF C;  2MJD A;  3P4Q B;  4YXD B;  1R7S A;  4P6V F;  3LB8 C;  1L5P A;  1J7B A;  1OQQ A;  1ZUD 2;  3SFD B;  3NVY A;  3PO0 A;  3SFE B;  4YSZ B;  1NYQ A;  3ETR A;  2DBY A;  2MH7 A;  1FRD A;  3NS1 A;  4USA A;  4YTP B;  2Y5C A;  3NRZ A;  2DWQ A;  2K9X A;  1E9M A;  1NEK B;  5AUI A;  1SB3 C;  1QLB B;  3ABV B;  5MPO A;  1L0V B;  3AV8 A;  2QJL A;  2PVO D;  3LXF A;  4YSX B;  1YQ3 B;  3DWG C;  5C3J B;  1UWM A;  2WP9 B;  3VRB B;  3AE9 B;  1EWY C;  2ACZ B;  2L83 A;  2E3T A;  3NVZ A;  4A9A A;  1NI3 A;  1V8C A;  2CU3 A;  1TKY A;  1QOB A; 
#chains in the Genus database with same CATH topology
 5CTR C;  3LJ3 A;  2AEH A;  1Q10 A;  3AUL A;  2MP2 B;  1SIJ A;  3CIR B;  3PSE B;  3VAW A;  1AW7 A;  4CYE A;  1FFU A;  1OEY A;  1J7C A;  1TT5 B;  1X1M A;  5T8I A;  2SEB D;  3SDL C;  3WCQ A;  2K0P A;  1XLP A;  1SGH A;  3CWI A;  2O2V B;  4IM2 A;  3WA0 A;  3VHT C;  2QSD A;  3UIO B;  2LFI A;  4NZL B;  1R4M B;  5I4D A;  2D10 A;  1V80 A;  4ANV A;  2YVC A;  1FNW A;  1JWS D;  1E8Y A;  2JT4 B;  2JXX A;  1MHH E;  4BKS A;  5JZE B;  2IPK D;  3PZ7 A;  2K3U A;  4MAC A;  4AP4 C;  3WAO A;  2ONQ A;  2RMM A;  1H8C A;  5BMI A;  4W9F A;  2NTT A;  2LHD A;  2RDH A;  1ZDX A;  2CHX A;  3EFU A;  1PGX A;  3PRP B;  3HM3 A;  3Q6B A;  3AU4 A;  4AJY B;  1N60 A;  3A1Q B;  2IO3 B;  2LD9 A;  1LO5 D;  3PPA A;  3Q3O C;  5EE0 A;  4JWS C;  1ACC A;  2N9E B;  2NTS A;  1EF1 A;  3TIX A;  2C7M B;  4EZJ A;  3VXW A;  4W9C A;  1E8W A;  3WAL A;  4BFR A;  1IGC A;  2HDE A;  2V4L A;  3TMP B;  3M62 B;  3KW5 B;  3W1S C;  4B0M A;  3LB8 C;  3M63 B;  2GRI A;  2MRP A;  3NVY A;  2O2V A;  3NS1 A;  2BGF A;  2RDG A;  4ARC A;  3TBL D;  1WJN A;  2INN E;  2QDF A;  3UQA A;  1SE2 A;  3EGR A;  5C3J B;  1YQ3 B;  1TZO A;  3W1Y A;  1E8Z A;  4DXA B;  1STE A;  1TKY A;  1QOB A;  1WM2 A;  3OG5 A;  1G6J A;  4WWP A;  4MGK E;  3V60 A;  1FNU A;  3I57 A;  2V0G A;  1F0Z A;  1RYJ A;  1N63 A;  2WXN A;  3VVW B;  2RD0 A;  4LDT B;  3P4R B;  1OFF A;  3I63 C;  4K1R B;  2C7N B;  3WIM A;  2ZCB A;  3NZ3 A;  2IY0 B;  3K9P B;  4F7Z A;  2BB5 A;  1XO3 A;  3L16 A;  2G4D B;  3MJW A;  4RH6 A;  4RM9 A;  3IVF A;  3S2A A;  3DBL I;  4ICV A;  3DHI C;  2XK5 A;  2CHZ A;  3PZD A;  4LDT D;  3IFW B;  4ZYN A;  2JRH A;  4J6I A;  2FUG 1;  4XDC A;  3L08 A;  1OGW A;  3MP9 A;  2BB6 A;  1WGG A;  2MJE A;  2JZ3 B;  4B9K A;  3RNC C;  4HDO A;  2VZK D;  4HEA 1;  1M94 A;  4XE0 A;  2HJ1 A;  2L1A A;  2CJN A;  3KVF B;  1PGA A;  2KTF A;  1YN5 A;  4FUL A;  4X57 B;  5GXG B;  5H8Y E;  1ISN A;  4KIK B;  5G5H A;  3WAN A;  4OVZ A;  3IXS A;  2RGF A;  4CHK A;  2FIF A;  4KZC A;  3VUW A;  1A5R A;  2JY6 A;  2ZPN A;  4P16 A;  3N30 A;  4WWO A;  1R4N I;  4USA A;  4AS1 A;  2I38 A;  2DWQ A;  2KN5 A;  2VH1 A;  2WYQ A;  1TS2 A;  5BYS A;  3JSV A;  1BXT A;  5CHW A;  1C4A A;  3DWG C;  3TSS A;  4GDL B;  2KLC A;  2L83 A;  2IZV B;  1T0S C;  4P1B C;  1YX5 B;  4BKT A;  2WLB A;  4JWU C;  1E6E B;  4P1C C;  4W9D A;  2N1V A;  3BIN A;  3IAS 1;  3Q14 C;  1AYF A;  3L10 B;  3AED B;  4II3 B;  1YX6 B;  4B0E A;  1P0R A;  4JQW C;  5G5G A;  2FBW B;  4LNK A;  4E71 A;  4YTM B;  2KDI A;  1I7H A;  3P1M A;  1K51 A;  4FLH A;  1L6V A;  2KHW B;  2JYE A;  4W9I A;  3ENE A;  4ZHP A;  3H7P B;  5BMG A;  1T3Q A;  1JW9 D;  3PTF C;  1VR9 A;  1A70 A;  1GG3 A;  1Y8R C;  1PFD A;  4DDG D;  2HJ8 A;  1E90 A;  3URY A;  2KTR B;  2NPT B;  1AWD A;  2EMT A;  4HPL B;  3FKY A;  2KTR A;  3GOE A;  2BQQ A;  2GBN A;  2D3A A;  2R2Q A;  4ZDV A;  1XT9 B;  5AZF A;  2N7D A;  3VDZ A;  1QOA A;  4NJ6 A;  3Q2A C;  3DWM A;  3ZIM A;  2KT7 A;  1NI2 A;  1WXA A;  3C0R B;  3AE1 B;  3ZKJ C;  5JHA A;  1Z5S B;  4ANW A;  1EUV B;  2FE8 A;  2WXH A;  1OQQ A;  4G11 A;  2LUE A;  1MFW A;  2OOB B;  3N1Z C;  4ARI A;  1MG8 A;  1RLF A;  5FKA C;  2ZVN A;  3A9J A;  3PLV A;  3BK2 A;  1NEK B;  3HIZ A;  4DXG A;  3PV1 A;  4XZ4 A;  4G50 A;  2FUH B;  4MT5 A;  2KAN A;  1EWY C;  2LVO A;  2VH2 A;  4A20 A;  2QMT A;  2LRU A;  2V3P A;  1R4N B;  4DWF A;  5AEK B;  3A33 B;  1FRR A;  2AQ1 B;  3ZJU A;  3W2D A;  1NEN B;  1FIQ A;  4WIP A;  1C76 A;  1D5Z C;  1JWA D;  1RFA A;  2WXM A;  3KQ4 A;  2V4I B;  4MEM A;  1I4G A;  5E6P A;  1ZXI A;  4C56 C;  2K5P A;  2M19 A;  2WWZ A;  2L7R A;  4NQK E;  3CSF A;  5BYQ A;  2W54 A;  1WXV A;  3B1L X;  4L23 A;  2PEA A;  2MBO A;  2JWU A;  1DOI A;  4PK1 A;  4EKU A;  4GN1 A;  4FHK A;  4BVU C;  1GPX A;  2LRW A;  4PS3 A;  3VTU A;  2LEK A;  2MHJ A;  2Z59 B;  2KQS A;  1EO6 A;  2G45 B;  2J0M A;  2PPH A;  3U2S C;  1L6U A;  1ZKH A;  2C9W B;  3PHW B;  3UIN B;  1JRU A;  1TYG B;  2KAJ A;  3IBE A;  4AQ7 A;  3P4S B;  2JWZ A;  5TR5 A;  1VJK A;  1DGJ A;  4DDI D;  1TTN A;  1OQR A;  2MLB A;  2V3S A;  2BS3 B;  1C9F A;  3VTW A;  3APC A;  4ZRJ A;  4BAX A;  4OZC A;  4LNI A;  2KN4 A;  4C4V B;  4MSQ B;  3JYU A;  4MGY E;  4UDU C;  3IAM 1;  3U7Z A;  1E9M A;  2IGH A;  1C4C A;  4RF0 A;  5L95 C;  4NQL B;  2KWD A;  3ML8 A;  3Q8C A;  3ZJV A;  4HPP A;  5G2N A;  2WU2 B;  1FEH A;  4KGR A;  4G3X B;  2AQ3 B;  4GDK B;  2AL6 A;  2KWU B;  3ZNG C;  2J7Q B;  5D3I B;  1SJE D;  1WGY A;  2JVC A;  1UBQ A;  4KSL C;  3TEX A;  4W9G A;  1IBX A;  1KH0 A;  5E6J A;  4WAA A;  3RCZ A;  3NVV A;  5LLI A;  2IJ0 A;  4HRO A;  1K50 A;  3EC8 A;  4GOC A;  5J2R A;  1WXQ A;  1WFY A;  1OQY A;  1QIL A;  1KLU D;  4GB9 A;  4D2K A;  2M17 A;  3GS2 A;  3QC8 B;  1ZW7 A;  4DHJ B;  1XCQ L;  4W9L A;  2A4Z A;  4DHZ B;  3TCA A;  3W5U B;  2YLM A;  3NVW A;  4BBN C;  1U4A A;  2M4N A;  5JH5 C;  3H7S A;  3L0W B;  3Q3J A;  2WXO A;  1JWB D;  4TSS A;  1PQS A;  4GIV A;  3KYC D;  4HK2 A;  1UEL A;  2GLS A;  1FFV A;  2WGS A;  3QAQ A;  1I4H A;  4MJS A;  2WXQ A;  3EFC A;  2N0S B;  4ZRK A;  5DPS A;  4M0W A;  1GC7 A;  3MC0 B;  2PMV A;  5C23 A;  2SAK A;  2KJ6 A;  2OED A;  2AL3 A;  3RZF A;  3L13 A;  2JPH A;  3RYT A;  3RUI B;  1FRD A;  1EF5 A;  1I4Q A;  2MCN B;  4A3P A;  2KJR A;  1WX7 A;  4E74 A;  2PVO D;  1EWC A;  1V5T A;  2ZVO A;  1TBE A;  1V8C A;  2ZNV C;  1JRP A;  2DYB A;  2DNF A;  2VZK B;  1VZ7 A;  3PLU A;  2EMS A;  4N9F 4;  3HK0 A;  2BYT A;  4ASW C;  3N1Y C;  3GZN B;  3VH4 B;  4ICU A;  4IOI E;  2J4X A;  2WDT B;  2O6V B;  2QIL A;  2NS5 A;  1FCL A;  2PE6 B;  2C5L C;  2KD0 A;  1KRH A;  2L0T A;  3FIL A;  1FNV A;  1V49 A;  3VTV A;  1WWT A;  2WS3 B;  3AI5 A;  4WWN A;  4M01 A;  1HEZ E;  3ZXR A;  3BYT B;  2D3B A;  3I5J C;  1WJ4 A;  4OHJ A;  4MM3 B;  5JXV A;  2FCN A;  3AMZ A;  1FPY A;  4WAF A;  1GJZ A;  1DYQ A;  1E7U A;  2J0K A;  1FXI A;  4ITK A;  3NHE B;  1VRA B;  1ZOY B;  4NY0 A;  2L0F A;  4B95 A;  2NMQ A;  3I9V 1;  1TS4 A;  4WJN A;  2PW9 A;  4N6E B;  4XC2 A;  1WXM A;  2D5G A;  4FAD A;  3PRM B;  3W5V B;  4DBG A;  3E9S A;  3ZYY X;  2BW2 A;  1V1P A;  5CHV C;  1C1Y B;  1WRD B;  1VZ8 A;  2JU6 X;  4FA6 A;  2LVP A;  2DHZ A;  1Z2M A;  2KX0 A;  4GDK A;  1D4B A;  2CHW A;  4R3D A;  1YNT E;  3ML9 A;  3J9C A;  3ZGZ A;  2INC C;  4EZL A;  4RMA A;  4P6V F;  4PS8 A;  3PRZ A;  2D2Q A;  3PT2 B;  3U30 A;  1OEY J;  3SFE B;  1WE7 A;  3APF A;  3ETR A;  5LXI B;  3X0W A;  2K9X A;  1SB3 C;  1ZGU B;  2N9P C;  4HJG E;  2QJL A;  1Q0W B;  1ET6 A;  4FJV B;  4Q2J A;  1I4R A;  4KVG B;  1EU3 A;  2LXA A;  5DCN A;  4C00 A;  2INP E;  2I1K A;  1ZPS A;  3GE3 C;  3ZTC A;  4HCP B;  3PS6 A;  2WU5 B;  1YOV B;  1WM3 A;  3TEZ A;  4EEW A;  4JPS A;  3K9O B;  2L3Z A;  2ZEQ A;  3BY4 B;  2WXI A;  1ESF A;  3ZVV A;  3O13 A;  1GAQ B;  1WI0 A;  2KYW A;  2L00 B;  4C7Z A;  4US9 A;  3RNE C;  4ZRQ A;  1S3S G;  3TEY A;  3TL5 A;  4AJW A;  3V05 A;  3AN1 A;  3H9D A;  1HTQ A;  3X23 A;  2D07 B;  1WYW B;  2L05 A;  4AOF A;  1HA5 A;  3R2T A;  3KWL A;  2QCZ A;  1V97 A;  2M0A A;  1YJI A;  3HVZ A;  1QOG A;  3R7R A;  2ZNV B;  2LGS A;  1JWM D;  2JZZ A;  2DAF A;  4ZHO A;  3NUH B;  1YD8 U;  5HG2 A;  3ZO5 B;  1WSP A;  1YJ1 A;  2GBR A;  4AWJ A;  3JW0 X;  2MBB B;  4JLC A;  2BBC A;  3UIP B;  1E7P B;  1C3T A;  3ZNZ B;  1P3Q U;  4C80 A;  1KTK A;  3TEW A;  3NG0 A;  3DBH B;  2W82 A;  1R7S A;  2JUO A;  1J7B A;  2PJH A;  4K7U A;  3RI7 C;  1NYQ A;  3SEB A;  2DBY A;  2DLB A;  3Q8B A;  4RGM A;  1NDD A;  3HVD A;  4LNO A;  1L0V B;  1I4P A;  3U4E G;  1RRB A;  4LNF A;  2NBV B;  3VRB B;  2K8H A;  2Q5W D;  4G0N B;  1UNS A;  3FIL B;  3VUY A;  5D94 A;  4YT0 B;  1QZE A;  3Q3N C;  2IO2 B;  3U7D A;  4K3B A;  3VR9 B;  2IBI B;  1VD2 A;  5IP4 D;  1TY2 A;  3QQ8 B;  2MJ3 A;  3FAH A;  1AAR A;  2O6V D;  3PHX B;  3VH3 B;  5LXH A;  1KOT A;  1QF6 A;  2MBQ A;  1E8X A;  2DAJ A;  1OTR B;  1SSN A;  3PGE A;  2YEP B;  2ZW1 A;  4CO7 A;  4FN2 A;  4KDL B;  4GSW A;  1J7A A;  1TY0 A;  2IO1 B;  4F8C B;  5C1Z A;  4US8 A;  4IC7 B;  4HRS A;  1XEE A;  3UGB B;  1HTO A;  1MI0 A;  3UI3 A;  2DEN B;  3IG3 A;  4GXB A;  4NAM A;  3QX1 A;  5IOI A;  2LI5 A;  5HFY A;  2DZM A;  2Y3A A;  4ZYS A;  2J52 A;  2IGG A;  5BYR A;  1YJJ A;  2M1M A;  1V6E A;  4FXC A;  5E6O A;  3ZQ4 A;  4HKQ A;  3C19 A;  3W9C B;  2G9H D;  5H92 C;  2BS4 B;  3AEE B;  2LGY A;  3CF6 E;  3BYY B;  3O65 B;  3DBL B;  4C4V A;  4YTP B;  2OJR A;  1TZ1 A;  1JWU D;  2MA9 B;  2FAZ A;  1S1Q B;  3KUC B;  1UGJ A;  2G4S A;  2ACZ B;  3QCA A;  2CU3 A;  3B08 A;  2W3S A;  2M56 B;  1V81 A;  1JRO A;  1IBX B;  3AEB B;  5L83 A;  4DHZ E;  1WGH A;  1UUP A;  2AYO B;  3AB5 A;  2W9N A;  1IGD A;  2DX5 B;  1L4Z B;  3B9J A;  1LFD A;  5JHB A;  5LNK 1;  1WRI A;  3V3X A;  1FD6 A;  2JF5 A;  4NNJ B;  3BII D;  1L0X B;  1WZ3 A;  2KFK B;  3Q69 A;  4AUQ C;  3IT6 B;  1EU4 A;  3BVZ A;  4HKZ E;  2GI9 A;  2NBU A;  4WJO A;  4MDK E;  4M00 A;  2DYO A;  3GP7 A;  4M8N A;  5HKH A;  4YTN B;  5EDS A;  1V9J A;  3JVZ X;  3RT3 B;  4I6L B;  4MEL A;  2MX2 A;  3A1Q A;  1KLV A;  3UF8 A;  1IP9 A;  4LK0 M;  1JML A;  4TQ1 A;  1TIF A;  2GMI C;  2IO0 B;  2K8C A;  3GE8 C;  3Q3F A;  1TS5 A;  3ZDT A;  2WHI A;  2KKC A;  1ZP0 B;  1BUI C;  2UWQ A;  5DPT A;  5IAA C;  3KUZ A;  3VRA B;  1SE3 A;  3ZUN A;  4II2 B;  4YSY B;  3P4Q B;  4NJ7 A;  4W9J A;  5J17 A;  2WX1 A;  3KUD B;  2VRR B;  1I42 A;  3OWE B;  2DZI A;  2RPQ A;  1P7F A;  3LYY A;  2KQ4 X;  2BYE A;  1BML C;  3EA6 A;  2PTL A;  3LXF A;  1UWM A;  2WP9 B;  1V1P B;  2E3T A;  4A9A A;  2N1W A;  4IKG A;  3AE5 B;  1V2Y A;  1FXA A;  2JRI B;  3NZS A;  2MSE D;  1T0R C;  5GMV A;  2KJH B;  4LCD E;  3AE8 B;  4JX1 C;  2J53 A;  1WX8 A;  1MPE A;  1LGR A;  3I3T B;  3EHV A;  4N58 A;  2Y5B B;  1JQ4 A;  2KWC A;  3QK0 A;  3QHT A;  4YSZ B;  3B2F A;  5EE1 A;  4J3O D;  1WMH A;  4REZ A;  5EE3 A;  3DVN U;  1F77 A;  3RNF C;  4A3O A;  2LJ5 A;  1C77 A;  1F9J A;  1Q1O A;  4HCN B;  2XNA C;  3UQB A;  4F1S A;  1R4M I;  3SD5 A;  1TJE A;  1VCB A;  1K53 A;  2EKI A;  1FMA D;  3RMK C;  2V3N A;  1P9D U;  3QAR A;  2UU7 A;  2X8X X;  1WR1 A;  1L0Y B;  2KFK A;  2JQR B;  2QIE B;  5D6J B;  2KMC A;  1MG4 A;  2YEP F;  4I6P A;  5HI1 A;  2M8S A;  4MH0 E;  3KYD D;  2MP2 A;  1CMX B;  1XCT L;  2BF8 B;  1D3Z A;  5D7G A;  4YXD B;  2FCM A;  3A4S C;  1LQB A;  2NPT A;  3PO0 A;  1T5X D;  3ZRF A;  1ZXH A;  2MH7 A;  2TSS A;  4M0W B;  3Q8F A;  3ABV B;  1WY8 A;  2MEK A;  4NAW B;  3DBH I;  3L54 A;  1C4P A;  1KLG D;  4OZA A;  1UBI A;  2HE7 A;  1N61 A;  1GC6 A;  3NS8 A;  3H1U A;  2PKO A;  4A6Q A;  2WXJ A;  4KKI A;  2N9L A;  1FM0 D;  5DPR A;  3B2G A;  3NOB A;  1B9R A;  1D6E C;  2WXP A;  1KF6 B;  5E6N A;  4GDL A;  3E56 A;  4M8M A;  3BK1 A;  2K8B A;  1Q5W B;  3RNB C;  2WNM A;  4XX5 A;  2Z0D B;  3PVL A;  1T0Y A;  4RM8 A;  4URK A;  4L2Y A;  2KFJ A;  3JSV B;  2N7E A;  2WXF A;  4P7I A;  1E7V A;  1K8R B;  2A5U A;  3NY5 A;  4WJQ A;  5AZG A;  1ENF A;  4XWW A;  4PT5 A;  3ECI A;  3W1S A;  1MJD A;  1XLO A;  1QQR A;  2BWE S;  4S17 A;  3C8Y A;  3AE6 B;  2K22 A;  3SU8 X;  2KO3 A;  2C7H A;  1PYW D;  2XEW A;  4IWQ A;  4BOZ B;  1PUT A;  1HQR D;  2V9H A;  1D5M C;  2WXK A;  1L2N A;  2WX0 A;  2PE9 A;  4HDQ A;  4LJO B;  2I1J A;  3DVN V;  3BVG A;  2WXL A;  4IW0 A;  1GB1 A;  1NBF C;  3DDC B;  2BKF A;  2WXG A;  4IWO A;  2R61 A;  3T3N A;  3U52 E;  1ZUD 2;  1BT0 A;  4YL8 A;  2FCS A;  2Y5C A;  3SHQ A;  3R3M A;  2XK5 B;  2QC8 A;  2LGI A;  2MBH A;  3AE9 B;  2LHE A;  1XXG A;  2L32 A;  2K1F A;  2HTH A;  1C78 A;  3EUB 2;  1IUE A;  1YIW A;  2GBK A;  3ZNI D;  3HM6 X;  4BBN F;  5AZH A;  4HLE A;  2DZJ A;  3M3J A;  2H89 B;  3MC8 A;  3DCG A;  5C2T B;  2D3C A;  3DHG C;  3QWZ B;  3N20 C;  2JSV X;  3HHM A;  1WH3 A;  2K6D B;  1SF0 A;  1UZX B;  2KDF B;  4LNN A;  4A90 A;  2KVZ A;  3AE4 B;  3APD A;  3HUI A;  5D2M B;  2B76 B;  3AEA B;  5AUI A;  2O6V A;  3RUL A;  2EKE C;  2XN9 C;  2D11 A;  4KKJ A;  2W55 A;  1NYR A;  2CR5 A;  4OW0 A;  4TMA B;  2KNB A;  3AEC B;  2RPV A;  4CQN A;  4IWP A;  5FR3 A;  4WWM A;  2ZZP B;  4DHJ D;  4KV2 A;  1UD7 A;  4DXF A;  1F52 A;  3MC9 A;  4BKS D;  1PGB A;  1RAX A;  2KOX A;  1HZ6 A;  2LAS A;  3GZN I;  2J42 A;  3BVM A;  4OVV A;  1CK1 A;  1WIA A;  4BZA A;  4N59 A;  1KFY B;  3DOW A;  1D5X C;  1RM6 C;  2WQY B;  2WDR B;  1UGM A;  4MM3 A;  4ZRI A;  1SJH D;  3DVG Y;  3OJ3 A;  4K7S A;  4HPM B;  4KDI C;  1L7Y A;  2MJD A;  1FXT B;  4FJY A;  3AXC A;  4A55 A;  2GBJ A;  1P1A A;  4IG7 B;  4BOS C;  5IKC M;  3NRZ A;  1HXY D;  3T9L A;  1QLB B;  3ZW3 A;  2ICI A;  3DBR I;  5MPO A;  1UF0 A;  3WAP A;  4RGT A;  2AWT A;  4RGO S;  1L4D B;  2PLP A;  1NI3 A;  2KLG A;  3QA8 A;  4O1N A;  2FID A;  1GB4 A;  3QIJ A;  1SE9 A;  2ZPY A;  4K7W A;  2LUM A;  4IDI A;  1F1H A;  3AEG B;  3CMM B;  5J18 A;  2KVR A;  2BKR B;  2LGD A;  3RNA C;  4MGZ E;  1RFK A;  5KHO A;  4JGH B;  3D32 A;  1FCC C;  1VLB A;  2K25 A;  4RGN A;  1WJ6 A;  4W9E A;  1P98 A;  4EZK A;  2FNJ B;  1SE4 A;  3RNG C;  4KIK A;  3R8B A;  1T0Q C;  3MTN B;  3AM9 A;  4OVU A;  1JCK B;  1J0G A;  4LTU A;  4TQ0 A;  5CHF A;  2KZR A;  2HTM E;  2BPS A;  3DVG X;  1DOX A;  4FJZ A;  3MFG A;  2KMA A;  5TSS A;  3AE2 B;  1XLN A;  2G3Q B;  1TKE A;  2KWV B;  4L1B A;  1NVI D;  3TJP A;  2WDV B;  3RD2 A;  4ANU A;  1CQV A;  3P4P B;  2KDM A;  2WDQ B;  5CX3 A;  2RDB C;  1ZDV A;  2JXT A;  1IPG A;  1VDV A;  2KC1 A;  4RCO A;  1SIF A;  3ZRC A;  1UWX A;  2GB1 A;  3AU5 A;  2HD5 B;  2QHO A;  1WX9 A;  3N3K B;  4HWI B;  4A8X C;  2BWF A;  2WXR A;  4NAW A;  4TUU A;  4WQO B;  4E3C A;  2V1Y A;  4GMV A;  1LM8 B;  4WUR A;  1MVK A;  3Q8A A;  4HJK A;  2IDY A;  1AN8 A;  1YN4 A;  3N9Y C;  3T8M A;  2ZCC A;  3AV8 A;  4LJP B;  1QKZ A;  4TKN A;  2EEL A;  2G1E A;  3M95 A;  1SXT A;  2XBB C;  2X38 A;  1P7E A;  4GGQ A;  2L8J A;  3QJZ A;  4LLG M;  2RSU A;  2JZP A;  3CST A;  4JL9 A;  1QT9 A;  3PRE A;  1YQ4 B;  5EE9 A;  5AUK A;  4ACF A;  3Q3M C;  1QOF A;  2KXJ A;  2GBM A;  1XD3 B;  2I2Y A;  1IYF A;  1EM7 A;  3P2B A;  4WQM A;  4WH4 A;  3R66 C;  4IM3 A;  4KX6 B;  3B0A A;  1GNU A;  1TGZ B;  1H4R A;  4KZ0 A;  3RFZ B;  3EEC A;  1WYG A;  2ZJD A;  4S0R A;  2ZW0 A;  2LJI A;  3P63 A;  2R2O A;  4FBJ B;  3AE3 B;  2CS4 A;  1TKG A;  3KH0 A;  1WGD A;  3OAW A;  2L76 A;  4C7Y A;  5BMH A;  2JYT A;  1WE6 A;  4H2A A;  4XWT A;  1F2R I;  3DHH C;  5FK9 C;  3A9J B;  1GUA B;  1M4V A;  4XYC A;  2LGX A;  3DQV A;  4ANX A;  3AE7 B;  4MSM B;  4IM0 A;  2M0X A;  3RPF C;  1F2R C;  3SFD B;  1WXS A;  3NZU A;  1YMH E;  2GOW A;  2KDE B;  2IY1 B;  2NCN A;  1GOZ A;  2LZ6 A;  3PZ8 A;  2Y5P A;  1XF5 L;  1YQB A;  2LWP A;  4JE3 B;  3NJT A;  2Z0E B;  2IGD A;  5IO9 A;  4M02 A;  1WMH B;  2KQ7 A;  1E10 A;  1E0Z A;  3R2I A;  4XDD A;  3U8Z A;  3HRD D;  2LMC A;  1YN3 A;  3MHS D;  3L17 A;  1E5W A;  1UH6 A;  3KLS X;  1K52 A;  4HXD A;  2AX5 A;  4JIO U;  1WZ0 A;  2KAC A;  5D3D A;  2BTE A;  4KSK C;  1TS3 A;  4NPN A;  2JX5 A;  2DYM A;  1V1O A;  1V86 A;  4PYZ A;  5FR6 A;  3OJ4 B;  1RWS A;  1N62 A;  2MBE A;  1HZ5 A;  3L4P A;  4KGT A;  2N7J A;  1SEB D;  3A4R A;  3V6C B;  1I4X A;  4BKG A;  1VZ6 A;  3MHZ A;  1ZE3 D;  4NJC A;  4RF1 A;  3BZD B;  3ZJT A;  1SBB B;  1HE8 A;  3ZDM C;  1XLQ A;  4WJP A;  3RZW C;  2MQJ A;  3H8H A;  2N4F A;  2N9X A;  3WAM A;  2OHF A;  3A9K B;  2ASQ A;  4GLS C;  3AEF B;  2BT6 A;  1JAL A;  3N1X C;  4B6W A;  3IHP C;  4IUM B;  4MGI E;  1WJU A;  4K81 A;  3TUO A;  4HVB A;  1XQQ A;  3R7Q A;  2CKH B;  1PDX A;  4TV3 A;  2D3G A;  2H88 B;  1DOY A;  1MHX A;  4MH8 A;  2UYZ B;  3H7P A;  1Y56 A;  3SR6 A;  1V5O A;  4QAY A;  4GU2 A;  2C60 A;  1L5P A;  2BVC A;  2E6X A;  3Q8E A;  4DK5 A;  3MJ5 A;  1B1Z A;  5BO4 B;  2K39 A;  2FCQ A;  3DPD A;  4W9H A;  5IA7 A;  2J0J A;  4FHJ A;  3H6N A;  2IND C;  2OJW A;  3DBS A;  4PYU A;  2MWS B;  2RR9 A;  1KM7 A;  2LVQ A;  2AQ2 B;  2B3A A;  3FC4 A;  1C79 A;  3VUX A;  4KGS A;  2CU1 A;  1WF9 A;  3ALB A;  3AH7 A;  4EFO A;  1FO4 A;  1WR6 E;  2Z8L A;  4EOY A;  2KC2 A;  1N6Z A;  1ROE A;  2W3R A;  1KJT A;  3ZLZ A;  3KWV A;  3V6E B;  1T6B X;  1J19 A;  4W9K A;  2BS2 B;  1N5W A;  3OLM D;  4I6N B;  1I35 A;  4ZOH C;  4XGA B;  1LXD A;  3V61 A;  1J8C A;  4OZB A;  2L52 A;  2PIA A;  2CJO A;  2NVU I;  1CJE A;  5HHD G;  4ZRP A;  3ONS A;  4YWG G;  3GB1 A;  3VR8 B;  5DPW A;  2DZK A;  3LDZ E;  2IYD B;  2MW5 A;  3A9K A;  5KHQ A;  2BYV E;  2NBW B;  3IT4 B;  3V62 A;  3T3O A;  3ZNH B;  3VFK A;  3RN9 C;  3ZTD A;  2LXC A;  5IN7 A;  4PS7 A;  2KMM A;  2KX3 A;  1CZP A;  1WGR A;  2KK8 A;  2N9K A;  2K6Q A;  4MJS B;  2PVG C;  4DQO C;  1WGK A;  1N5X A;  3BWU D;  3N32 A;  2KDB A;  3VQI A;  4RNA A;  2BYF A;  4RFB A;  2QEJ C;  4K3C A;  4EE2 A;  2REX A;  5G55 A;  2NR2 A;  3ZXV A;  4YSX B;  2ON8 A;  1ET9 A;  4EUT A;  3NVZ A;  3DBR B;  3P42 A; 
#chains in the Genus database with same CATH homology
 2W3S A;  2M56 B;  1GB4 A;  1JRO A;  1IBX B;  3AEB B;  2WU2 B;  1FEH A;  2LUM A;  1Q10 A;  4KGR A;  2AQ3 B;  4GDK B;  1SIJ A;  4IDI A;  3CIR B;  1UUP A;  3AEG B;  1AW7 A;  3AB5 A;  5D3I B;  1FFU A;  1IGD A;  1J7C A;  1SJE D;  5T8I A;  1L4Z B;  3B9J A;  2SEB D;  3WCQ A;  2K0P A;  5LNK 1;  1RFK A;  1WRI A;  1XLP A;  3TEX A;  3V3X A;  1FD6 A;  1IBX A;  3CWI A;  1KH0 A;  5E6J A;  3BII D;  1FCC C;  1L0X B;  1VLB A;  3NVV A;  2IJ0 A;  2QSD A;  4HRO A;  4RGN A;  1K50 A;  2LFI A;  4NZL B;  3Q69 A;  5I4D A;  1WXQ A;  1FNW A;  1JWS D;  1QIL A;  1SE4 A;  1EU4 A;  3IT6 B;  1MHH E;  3BVZ A;  1KLU D;  4HKZ E;  4D2K A;  2GI9 A;  3GS2 A;  3R8B A;  3AM9 A;  2IPK D;  1XCQ L;  3PZ7 A;  2K3U A;  1JCK B;  2DYO A;  4MAC A;  3GP7 A;  4LTU A;  4TQ0 A;  4YTN B;  3W5U B;  2HTM E;  2ONQ A;  2RMM A;  3NVW A;  5BMI A;  1DOX A;  3MFG A;  2NTT A;  5TSS A;  2LHD A;  2RDH A;  3AE2 B;  2WXO A;  1JWB D;  1XLN A;  4LK0 M;  4TSS A;  1ZDX A;  1JML A;  1TKE A;  4L1B A;  4TQ1 A;  1NVI D;  1PGX A;  2WDV B;  1CQV A;  3P4P B;  1TS5 A;  2KDM A;  1FFV A;  2WDQ B;  1N60 A;  1I4H A;  1ZDV A;  1LO5 D;  5EE0 A;  2WXQ A;  2JXT A;  2N0S B;  4JWS C;  1ACC A;  1ZP0 B;  2NTS A;  1BUI C;  1VDV A;  4RCO A;  4M0W A;  3VRA B;  1SE3 A;  1UWX A;  2GB1 A;  1IGC A;  3MC0 B;  2PMV A;  4YSY B;  2HDE A;  4B0M A;  3P4Q B;  3LB8 C;  4A8X C;  2GRI A;  2SAK A;  2OED A;  2WXR A;  3NVY A;  3NS1 A;  1FRD A;  4WUR A;  1MVK A;  3OWE B;  3Q8A A;  2RDG A;  1I4Q A;  4ARC A;  1P7F A;  3LYY A;  2IDY A;  1AN8 A;  2KQ4 X;  1YN4 A;  2INN E;  3N9Y C;  3AV8 A;  1SE2 A;  1BML C;  2PVO D;  1EWC A;  3EA6 A;  2PTL A;  3EGR A;  3LXF A;  5C3J B;  1YQ3 B;  1TZO A;  1UWM A;  2WP9 B;  1V1P B;  1QKZ A;  2E3T A;  4A9A A;  1V8C A;  1STE A;  1TKY A;  2EEL A;  2G1E A;  1QOB A;  1JRP A;  4IKG A;  1SXT A;  2X38 A;  1P7E A;  3AE5 B;  1FNU A;  2VZK B;  1VZ7 A;  1FXA A;  4LLG M;  3I57 A;  2V0G A;  1F0Z A;  1RYJ A;  2BYT A;  1N63 A;  2JZP A;  2WXN A;  1QT9 A;  4IOI E;  1YQ4 B;  3AE8 B;  3P4R B;  5EE9 A;  5AUK A;  2J4X A;  1OFF A;  4JX1 C;  2QIL A;  1QOF A;  2J53 A;  1FCL A;  1KRH A;  3NZ3 A;  3FIL A;  1FNV A;  2I2Y A;  1MPE A;  1WWT A;  2BB5 A;  2WS3 B;  1XO3 A;  1EM7 A;  1HEZ E;  4RH6 A;  3BYT B;  4N58 A;  4WQM A;  4WH4 A;  1JQ4 A;  4OHJ A;  4MM3 B;  4YSZ B;  4KX6 B;  3B2F A;  5EE1 A;  5JXV A;  4J3O D;  3AMZ A;  4REZ A;  5EE3 A;  1F77 A;  4WAF A;  1DYQ A;  1FXI A;  1C77 A;  4ITK A;  2FUG 1;  3RFZ B;  2XNA C;  1VRA B;  4XDC A;  1ZOY B;  1WYG A;  1TJE A;  1K53 A;  2ZW0 A;  3MP9 A;  2LJI A;  3P63 A;  2NMQ A;  2BB6 A;  1TS4 A;  2EKI A;  3I9V 1;  3AE3 B;  2MJE A;  2PW9 A;  1FMA D;  4N6E B;  1TKG A;  2D5G A;  2V3N A;  2VZK D;  4C7Y A;  4HEA 1;  3W5V B;  5BMH A;  2JYT A;  1L0Y B;  3E9S A;  4H2A A;  4XE0 A;  3ZYY X;  2BW2 A;  4XWT A;  1F2R I;  2L1A A;  2JQR B;  2CJN A;  1V1P A;  1PGA A;  5FK9 C;  2QIE B;  1YN5 A;  1VZ8 A;  2JU6 X;  5GXG B;  5H8Y E;  2YEP F;  1M4V A;  5HI1 A;  5G5H A;  4OVZ A;  3IXS A;  3AE7 B;  1D4B A;  4R3D A;  1XCT L;  1YNT E;  3ZGZ A;  3J9C A;  5D7G A;  3RPF C;  1F2R C;  4YXD B;  4P6V F;  3SFD B;  3PO0 A;  3SFE B;  1T5X D;  1YMH E;  4P16 A;  1ZXH A;  2MH7 A;  2TSS A;  3ETR A;  4USA A;  4AS1 A;  2I38 A;  2DWQ A;  1GOZ A;  2K9X A;  3PZ8 A;  1SB3 C;  2Y5P A;  3Q8F A;  1XF5 L;  1TS2 A;  3ABV B;  4HJG E;  5BYS A;  1BXT A;  1C4A A;  2QJL A;  1ET6 A;  2MEK A;  4Q2J A;  1I4R A;  3DWG C;  3TSS A;  4GDL B;  4JE3 B;  1EU3 A;  2IGD A;  2L83 A;  4NAW B;  1C4P A;  2INP E;  1KLG D;  4OZA A;  1E10 A;  1E0Z A;  2WLB A;  4JWU C;  1E6E B;  3R2I A;  1ZPS A;  1N61 A;  4XDD A;  2WU5 B;  3HRD D;  2PKO A;  2LMC A;  1YN3 A;  4A6Q A;  3TEZ A;  2WXJ A;  3IAS 1;  1AYF A;  2N9L A;  4KKI A;  4JPS A;  1FM0 D;  3AED B;  3KLS X;  1K52 A;  3B2G A;  2WXI A;  1ESF A;  3O13 A;  2AX5 A;  1B9R A;  1D6E C;  4B0E A;  2KAC A;  2WXP A;  5G5G A;  5D3D A;  2BTE A;  1KF6 B;  1GAQ B;  1TS3 A;  3E56 A;  2FBW B;  2JX5 A;  2DYM A;  3BK1 A;  1V1O A;  4C7Z A;  4YTM B;  1RWS A;  1I7H A;  1N62 A;  1HZ5 A;  2WNM A;  4US9 A;  3P1M A;  1K51 A;  3L4P A;  4KGT A;  1L6V A;  4ZRQ A;  2JYE A;  2N7J A;  1SEB D;  3TEY A;  4ZHP A;  1I4X A;  5BMG A;  1T3Q A;  3V05 A;  1JW9 D;  1A70 A;  1VR9 A;  4L2Y A;  3AN1 A;  1PFD A;  1VZ6 A;  3MHZ A;  2WXF A;  1ZE3 D;  4NJC A;  4RF1 A;  3BZD B;  3URY A;  3ZJT A;  1HA5 A;  1SBB B;  3R2T A;  3KWL A;  1ENF A;  1AWD A;  4PT5 A;  1XLQ A;  4XWW A;  1V97 A;  3H8H A;  2M0A A;  1YJI A;  3HVZ A;  1QOG A;  3W1S A;  1XLO A;  1JWM D;  1QQR A;  3C8Y A;  2OHF A;  3AE6 B;  2K22 A;  4GLS C;  1PYW D;  3AEF B;  1PUT A;  1HQR D;  2BT6 A;  1JAL A;  3NUH B;  4ZHO A;  1D5M C;  5HG2 A;  2WXK A;  1WSP A;  1QOA A;  3TUO A;  3DWM A;  1PDX A;  2BBC A;  3BVG A;  2WXL A;  3AE1 B;  2H88 B;  1DOY A;  1MHX A;  4MH8 A;  1E7P B;  1GB1 A;  4C80 A;  1Y56 A;  3SR6 A;  1KTK A;  3TEW A;  2W82 A;  1R7S A;  2WXG A;  2R61 A;  1L5P A;  3T3N A;  2FE8 A;  2WXH A;  1J7B A;  1OQQ A;  1ZUD 2;  3U52 E;  2E6X A;  3Q8E A;  4ARI A;  3MJ5 A;  1B1Z A;  1NYQ A;  3SEB A;  5FKA C;  2DBY A;  2DLB A;  2Y5C A;  3Q8B A;  3BK2 A;  1NEK B;  4DXG A;  4RGM A;  3HVD A;  1L0V B;  1I4P A;  3U4E G;  4MT5 A;  2LGI A;  3VRB B;  3AE9 B;  1EWY C;  2LHE A;  1XXG A;  2L32 A;  2QMT A;  2V3P A;  2AQ2 B;  1C78 A;  3EUB 2;  2Q5W D;  1IUE A;  3FC4 A;  1C79 A;  1UNS A;  3FIL B;  4KGS A;  4YT0 B;  1FRR A;  2AQ1 B;  3ZJU A;  3W2D A;  3AH7 A;  1NEN B;  1FIQ A;  2H89 B;  3VR9 B;  1FO4 A;  4WIP A;  2Z8L A;  5C2T B;  1C76 A;  1D5Z C;  1JWA D;  1TY2 A;  2WXM A;  2MJ3 A;  3KQ4 A;  3FAH A;  2JSV X;  2V4I B;  1I4G A;  1ROE A;  2W3R A;  1ZXI A;  4C56 C;  1SF0 A;  1QF6 A;  3KWV A;  4A90 A;  2K5P A;  1T6B X;  2M19 A;  3AE4 B;  2BS2 B;  1SSN A;  3HUI A;  2B76 B;  3AEA B;  1N5W A;  2W54 A;  5AUI A;  2YEP B;  5BYQ A;  4L23 A;  2XN9 C;  2ZW1 A;  2JWU A;  1DOI A;  1J7A A;  1TY0 A;  4ZOH C;  4KKJ A;  2W55 A;  1NYR A;  4US8 A;  4OZB A;  2L52 A;  4OW0 A;  4TMA B;  2PIA A;  2CJO A;  2RPV A;  3AEC B;  1GPX A;  4HRS A;  4CQN A;  1XEE A;  1CJE A;  2LEK A;  5HHD G;  1MI0 A;  5FR3 A;  3UI3 A;  4WWM A;  4ZRP A;  4YWG G;  1L6U A;  3GB1 A;  3U2S C;  3VR8 B;  1TYG B;  2KAJ A;  4NAM A;  4DXF A;  4AQ7 A;  3P4S B;  5HFY A;  3IT4 B;  3T3O A;  1PGB A;  1VJK A;  3ZJV A;  1DGJ A;  2Y3A A;  4ZYS A;  2J52 A;  1HZ6 A;  2IGG A;  1OQR A;  2J42 A;  2KMM A;  3BVM A;  2BS3 B;  5BYR A;  1C9F A;  1YJJ A;  1CZP A;  1CK1 A;  2N9K A;  4N59 A;  4FXC A;  2PVG C;  3ZQ4 A;  1KFY B;  3W9C B;  4HKQ A;  2G9H D;  5H92 C;  4OZC A;  4DQO C;  1D5X C;  1RM6 C;  1WGK A;  2BS4 B;  2WQY B;  2WDR B;  2KN4 A;  1N5X A;  3AEE B;  1SJH D;  3BWU D;  2MJD A;  3BYY B;  3VQI A;  4RNA A;  4A55 A;  4RFB A;  2QEJ C;  4UDU C;  4YTP B;  4EE2 A;  3IAM 1;  3NRZ A;  1HXY D;  3U7Z A;  1E9M A;  1JWU D;  1QLB B;  2IGH A;  1C4C A;  4RF0 A;  2ICI A;  5MPO A;  1UGJ A;  2KWD A;  4YSX B;  2ON8 A;  1ET9 A;  4RGT A;  2ACZ B;  4RGO S;  1L4D B;  3NVZ A;  2PLP A;  3P42 A;  3Q8C A;  1NI3 A;  2CU3 A;  4O1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...