3B0AA

Crystal structure of the mouse hoil1-l-nzf in complex with linear di-ubiquitin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific recognition of linear ubiquitin chains by the Npl4 zinc finger (NZF) domain of the HOIL-1L subunit of the linear ubiquitin chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/metal binding protein
molecule keywords Polyubiquitin-C
total genus 43
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b0aA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b0aA02
4ZRKA 4W9LA 4I6PA 1YIWA 1E8WA 1E5WA 4G50A 4ASWC 1I42A 4WQOB 2KDBA 1LM8B 2KMCA 2IY0B 4URKA 2KXJA 3APDA 2N1WA 3L08A 2C9WB 1NBFC 2GBKA 3QARA 2LRUA 2NR2A 3Q3JA 2DZKA 1WM2A 2KKCA 3CF6E 2CKHB 3NHEB 3V6CB 3UGBB 3X0WA 2OOBB 4FBJB 4E71A 4A20A 2KFKB 3KUDB 2G4DB 3UF8A 4DXAB 2BWES 5KHQA 3L0WB 2GOWA 4GDKA 1R4NI 3K9PB 2MSED 3H7PB 2G3QB 1RFAA 1ISNA 1E8XA 1WR1A 2EKEC 3CSFA 2GMIC 4XX5A 2B3AA 3ML8A 3M62B 1IYFA 4IWOA 1P9DU 2KWVB 3H6NA 2WYQA 3QIJA 4JGHB 2RPQA 4J6IA 4BVUC 4YL8A 1NI2A 1ZW7A 2FIDA 3RZFA 1C1YB 4G11A 3ZNHB 1YJ1A 2MBBB 4GB9A 1LQBA 1P1AA 4TUUA 1J19A 4EZJA 3RCZA 5DCNA 4W9EA 2MWSB 2DZMA 3H1UA 1WX9A 2MQJA 4MJSB 4GDLA 3VAWA 2BKRB 4X57B 5DPSA 3UQAA 2ZCBA 3N32A 1YD8U 1V81A 2HD5B 3VUXA 5LXIB 1GUAB 1WYWB 5HKHA 3EC8A 4LJOB 3JVZX 1WX7A 4B95A 2AL6A 4I6NB 2KX0A 2KO3A 3DVNU 3PRPB 2L0TA 1WR6E 3A1QA 2J0JA 3APFA 4GN1A 4LJPB 4II2B 3ZKJC 2JWZA 2DENB 2V1YA 2O2VA 2A4ZA 2FCNA 2KQ7A 1H4RA 4IM2A 1XD3B 2D07B 2MW5A 2O6VD 4BBNC 4W9IA 5CTRC 3NOBA 4WWPA 3N3KB 5L83A 1V5OA 3NZUA 2DAFA 5JHBA 2CHZA 2Y5BB 3NY5A 1PQSA 4MSMB 3A9JB 4HK2A 4KIKB 3WA0A 3ZO5B 4AWJA 4FA6A 1WZ3A 3PHXB 3SDLC 4NQKE 4W9JA 2EMSA 3PV1A 3AULA 2JY6A 2JZZA 3L13A 3PSEB 5GMVA 2M17A 2KTRA 3KH0A 4HPMB 5DPWA 1VCBA 3KUCB 4DBGA 4NJ7A 2I1KA 4DHZB 3W1YA 5AEKB 4MGIE 2G4SA 2DYMA 3DPDA 4GIVA 2XBBC 2K8HA 4JL9A 1WGYA 3DOWA 5D7GA 3PGEA 3KVFB 2RSUA 3BY4B 1V9JA 4IW0A 3ZTDA 3A9KB 4TQ1A 2KDIA 2BPSA 2KWUB 4W9CA 2L76A 3LJ3A 4ICUA 3ECIA 2MBHA 4BBNF 2BKFA 2D2QA 4HWIB 1D3ZA 2DZIA 5J2RA 2K1FA 4FJZA 3ZDTA 3O65B 4KSLC 1UBIA 4DWFA 3JSVA 2EMTA 1SGHA 1WF9A 1MG8A 1TZ1A 4MSQB 2UWQA 3DBRI 4IG7B 2AWTA 4NJ6A 5D2MB 3WAMA 3PS6A 5J17A 2AEHA 4BKGA 3NS8A 3PLUA 2NPTA 1UH6A 2IO1B 1E8ZA 2L05A 2K25A 2LUEA 2LD9A 2MLBA 3ZNZB 2N9PC 1JRUA 1IPGA 1Q5WB 2RGFA 2ZZPB 4AP4C 2LVQA 2KC2A 3A4RA 2L0FA 2V4LA 2GBRA 2LJ5A 2M1MA 2NBWB 3DVNV 2MP2B 4AUQC 1YX6B 2W9NA 2FCQA 3PPAA 2WWZA 4F7ZA 2GBMA 5E6NA 2D11A 3PT2B 5DPRA 3IVFA 1UELA 2ASQA 4GXBA 3C0RB 4CHKA 3KYDD 5IA7A 2KZRA 3IG3A 4KV2A 1IP9A 3VHTC 4WWNA 2NVUI 2Z0EB 4ANWA 3GOEA 1LXDA 2DHZA 1AARA 5AZHA 4DHJD 1H8CA 1P3QU 3ZRFA 2KDFB 4K7SA 2Z0DB 5AZGA 1WE6A 4K7UA 3N30A 4RM8A 4FN2A 2BF8B 5CX3A 1GC7A 1SIFA 2FNJB 4GSWA 4LCDE 2RD0A 5L95C 2LGDA 4WJQA 2HE7A 2KDEB 2JPHA 3A1QB 2L7RA 4A3OA 4OVUA 2N4FA 3W1SA 2WDTB 3RD2A 3TJPA 4HCPB 4EEWA 5LXHA 1WIAA 1Q1OA 3EECA 1WGDA 4N9F4 2JRHA 2QHOA 2ZVOA 3ALBA 3L54A 3U30A 5G55A 4W9HA 4BKSA 4EZKA 2LVPA 3QC8B 1GNUA 2IO3B 4KZ0A 4K1RB 2M8SA 1WE7A 4BOSC 4W9GA 1M94A 5C1ZA 4HDQA 2M4NA 3CMMB 4BKTA 3JYUA 1WH3A 2C7HA 2PEAA 2KTFA 2KFJA 4PYUA 3UQBA 3L16A 4FJYA 4HDOA 3VTVA 3HM3A 4DDGD 4KVGB 1X1MA 4M0WB 4MH0E 2DAJA 4GOCA 2BYFA 3VFKA 4M8NA 2CHXA 3GZNI 2BGFA 2ZNVC 3PLVA 3TIXA 1WXMA 5JZEB 3PRZA 4WWOA 2PE9A 4AJYB 4FJVB 4HXDA 3L10B 4DDID 1P0RA 5JHAA 1QZEA 4E74A 4F1SA 2IO0B 2IZVB 4GMVA 1WI0A 2CHWA 2G45B 3DDCB 4I6LB 1UD7A 4FULA 1E7UA 4K7WA 1WJUA 2JZ3B 3QHTA 4EFOA 3Q3FA 3M63B 3RUIB 4LDTB 4MGKE 1HE8A 3WAOA 2LWPA 2O6VA 4FLHA 4IM3A 1J8CA 4CO7A 1WJNA 3RYTA 2C7NB 3ENEA 1V6EA 1WGRA 4NPNA 3JSVB 4ZRJA 4ZDVA 2LGXA 2KNBA 2IYDB 1V5TA 2O2VB 2K6DB 4KDLB 4KSKC 4ANXA 4EUTA 2LI5A 1I35A 3DBLI 5CHWA 4MM3A 1V49A 2UYZB 1CMXB 3U7DA 3WANA 3DVGY 2KWCA 2AL3A 3ZLZA 4GGQA 4BFRA 4XC2A 1YX5B 2L3ZA 4WAAA 1R4MI 3RZWC 2LRWA 1A5RA 1YQBA 1WJ6A 2HJ8A 2KHWB 3DQVA 1J0GA 5AZFA 1S3SG 1WX8A 4MGZE 1E7VA 4HVBA 1V80A 1WGHA 3ML9A 2KK8A 4JLCA 4FHJA 4MGYE 2WX1A 2J0KA 1XT9B 3UINB 2MBEA 2RR9A 4A3PA 3R7QA 2KJRA 3DCGA 3ZIMA 2N7EA 4LDTD 3VH3B 3ZW3A 5FR6A 2JRIB 4AOFA 1EF1A 3SHQA 3D32A 4HJKA 3V61A 4F8CB 3ZUNA 3R3MA 2GBNA 4KZCA 4HLEA 1VD2A 3LDZE 3MHSD 4TQ0A 1WXVA 1WJ4A 1EUVB 4W9FA 2I1JA 3QQ8B 3W1SC 2NBVB 5EDSA 3OJ3A 2L00B 4TKNA 3MTNB 3KYCD 3VTWA 2JUOA 3QCAA 2IO2B 3PRMB 3TL5A 3DVGX 3WALA 3A9KA 4B9KA 3KUZA 2XK5B 1Z2MA 1LFDA 3AU5A 3HK0A 3A4SC 3EFUA 3A33B 4RMAA 2DYBA 4AJWA 2KX3A 2ZCCA 2FAZA 3ZNGC 4MJSA 4MELA 5E6PA 3V6EB 2WX0A 4GDLB 1G6JA 4WJOA 4IC7B 1EO6A 4ANUA 3L17A 2JF5A 2N1VA 2N7DA 3V62A 3HHMA 4BOZB 1TBEA 1ZKHA 1C3TA 1T0YA 2MCNB 3V60A 2C60A 2D10A 4KDIC 3K9OB 2VRRB 2IBIB 1UZXB 2BYVE 2MBQA 4MDKE 3S2AA 3OAWA 2R2OA 2ZEQA 2KMAA 2BWFA 5D6JB 1WM3A 4IUMB 4JIOU 4NY0A 3ZRCA 4WJPA 2FIFA 5C23A 4RM9A 3APCA 2LGYA 1KLVA 1UGMA 2KC1A 2YLMA 2LXAA 3M3JA 1BT0A 1WFYA 1OEYA 2LXCA 3PTFC 3UIOB 3M95A 2A5UA 4ZYNA 2XK5A 3B1LX 4DHJB 3DBSA 3VQIA 4HPLB 4G0NB 3VDZA 4E3CA 4IWPA 5D94A 3QWZB 1S1QB 1V86A 1Z5SB 3H7PA 4NAWA 3VVWB 2PE6B 2C5LC 2YVCA 1OEYJ 2LASA 2DYOA 2CU1A 1E90A 3VXWA 4K81A 2MRPA 3AU4A 4M8MA 5CHVC 4EKUA 2KLGA 2L8JA 1OTRB 1E8YA 1RRBA 3VH4B 2JVCA 3IHPC 3B08A 4DK5A 4NQLB 3ZVVA 2C7MB 2N9XA 3PHWB 1GJZA 3PZDA 2REXA 3VUYA 1TTNA 2NBUA 2M0XA 3QA8A 4IM0A 2KTRB 3TMPB 2FUHB 2J7QB 3QK0A 2O6VB 3JW0X 4P7IA 2ZVNA 2ZNVB 4PS8A 1L2NA 1WRDB 5LLIA 5J18A 2K8CA 2DX5B 4IWQA 3H9DA 1F9JA 1WMHA 1KJTA 3BINA 4ICVA 5E6OA 2LVOA 2MX2A 2K39A 4MEMA 3AI5A 2BYEA 5BO4B 2PJHA 3QX1A 2OJRA 1FXTB 1WXSA 1RLFA 2FCMA 2MA9B 2KN5A 2K8BA 1WXAA 3A9JA 2LZ6A 2D3GA 2KVRA 1P98A 3TBLD 3ZDMC 3RT3B 2GBJA 2CS4A 2JT4B 2AYOB 5KHOA 2R2QA 1GC6A 1XQQA 2HTHA 2ZJDA 3T9LA 2KJ6A 2NS5A 3TCAA 1NDDA 2N9EB 3QAQA 3QJZA 1Q0WB 4EOYA 1Y8RC 4WJNA 3MJWA 4ANVA 1RAXA 4W9DA 5JH5C 1WY8A 3IFWB 2NPTB 4PS7A 4OVVA 2XEWA 3I3TB 3WAPA 3DBHI 1SE9A 3HIZA 4DHZE 3ZNID 4G3XB 4NAWB 1WGGA 4FHKA 4W9KA 3T8MA 1OGWA 4B6WA 1L7YA 3WIMA 1UBQA 3U8ZA 3KW5B 3HM6X 3VUWA 1KOTA 2ZPNA 1TGZB 2KLCA 1V2YA 1WMHB 2K6QA 4CYEA 2DZJA 2KANA 3OJ4B 2FCSA 4JQWC 3EHVA 3ZTCA 1U4AA 2KJHB 4EZLA 3AXCA 2JXXA 5CHFA 1KM7A 4II3B 3PREA 1K8RB 2J0MA 3P2BA 1ZGUB 2IY1B 4TV3A 3B0AA 3NZSA 5DPTA 2KD0A 3ONSA 2KOXA 2MP2A 3SD5A 4HCNB 3X23A 2KQSA 5IAAC 1WZ0A 3OLMD 4KIKA 1EF5A 1GG3A 3H7SA 1OQYA 2MBOA 5TR5A 3R7RA 3R66C 2PPHA 2KFKA 3IBEA 2Z59B 4GU2A 3UIPB 4ZRIA 4BKSD 3PVLA 4NNJB 2NCNA 4PS3A 3CSTA 4XZ4A 2V3SA 5G2NA 3RULA 3VTUA 4FADA 2CR5A 3SU8X 4GDKB 4PYZA 2ZPYA
chains in the Genus database with same CATH superfamily
4W9LA 2WNMA 5BYQA 2KMCA 2D3AA 2IY0B 3ZJTA 4C4VB 1NBFC 2NR2A 3Q3JA 3P4RB 2KKCA 3NHEB 4WURA 1GOZA 4A9AA 4FBJB 1WYGA 2KFKB 3KUDB 2G4DB 4C7ZA 2BWES 5KHQA 1SJED 2GOWA 1FEHA 1R4NI 1L0YB 2G3QB 4ZRQA 5I4DA 3B9JA 3U4EG 2BS4B 2WYQA 5LNK1 1NI2A 2JWUA 3KLSX 2LHEA 2FIDA 1YJ1A 2MBBB 1P1AA 2MWSB 1WX9A 2L1AA 4X57B 3O13A 4MM3B 1YD8U 1V81A 1WYWB 2WXRA 1WX7A 4B95A 4I6NB 2KX0A 3DVNU 2L83A 1RM6C 2O2VA 4BBNC 2D07B 1MPEA 3RNGC 3N3KB 1V5OA 3NZUA 1FFVA 2CHZA 3C19A 3A9JB 4JWUC 4ZRPA 3AEFB 3HVDA 3SDLC 1F0ZA 3PV1A 3AULA 3PSEB 5DPWA 1TS5A 2D3CA 2I1KA 1L4DB 1STEA 4IKGA 5AEKB 2QJLA 4A6QA 3DPDA 3R8BA 1IGDA 3IAS1 1SB3C 5D7GA 4GLSC 2WXMA 2BPSA 1TT5B 2G1EA 4W9CA 1C76A 4TMAB 1AWDA 2D2QA 3BIID 4HWIB 4XWWA 1SEBD 4FJZA 1PYWD 1WF9A 4HKQA 3HVZA 3DBRI 5D2MB 2AEHA 4BKGA 3PLUA 2NPTA 2L05A 2IO1B 1ET9A 2MLBA 2N9PC 1Q5WB 4MACA 1L6UA 2RGFA 5GXGB 5HHDG 2NBWB 2MP2B 2ON8A 2W9NA 3P1MA 2GBMA 3PT2B 3V3XA 1UELA 1N61A 1TZOA 3EGRA 2KZRA 3T3OA 4S0RA 2L32A 1R4NB 2Z0EB 1P3QU 2M0AA 3ZRFA 2KDFB 1T3QA 2KQ4X 2WU2B 5AZGA 1YOVB 2INCC 4LCDE 5L95C 1L0XB 2LGDA 2HE7A 1DGJA 2KDEB 1FO4A 2L7RA 4OVUA 3W1SA 2WDTB 3RD2A 1WIAA 1XCQL 3OWEB 1Q1OA 2JRHA 2QHOA 2ZVOA 5G55A 4BKSA 2IO3B 2M8SA 4HDQA 3GP7A 4KVGB 4MH0E 4GOCA 4B0MA 1KFYB 4M8NA 2CHXA 2ZNVC 1WXMA 4HXDA 3L10B 4DDID 1P0RA 1QZEA 1HTOA 2IO0B 2CHWA 2N9KA 4I6LB 4FULA 1E7UA 1SSNA 2O6VA 1J8CA 3FAHA 3URYA 2XNAC 4ZRJA 2RMMA 2LGXA 2IYDB 1V5TA 2O2VB 4KSKC 2LI5A 1DOIA 1YNTE 2LGIA 2G9HD 2WXHA 3DVGY 1JWSD 3HRDD 4GGQA 1MFWA 1R4MI 1UGJA 1A5RA 4HRSA 4XDDA 1WX8A 1GPXA 1WGHA 3AE4B 4FHJA 2WX1A 2DNFA 1MI0A 1XT9B 4KGTA 3R7QA 3DCGA 3ZIMA 4AOFA 1EF1A 3D32A 4KZCA 2JQRB 3LDZE 2K3UA 1WXVA 1WJ4A 4W9FA 2I1JA 3QQ8B 3W1SC 2NBVB 3AE8B 3OJ3A 3MTNB 1K52A 1QOFA 3PRMB 1RFKA 3Q14C 3AE2B 3TL5A 3WALA 2WXFA 3A9KA 1Z2MA 3AU5A 3AM9A 4RMAA 1MVKA 3PO0A 3ZNGC 4UDUC 4MJSA 4MELA 5E6PA 2QMTA 1G6JA 4WJOA 3L17A 2JF5A 3DHIC 4BOZB 1C4CA 3S2AA 2QC8A 5HI1A 4US9A 2KMAA 1JQ4A 2BWFA 2LJIA 3BVZA 3APCA 2HDEA 2LXAA 1BT0A 4A55A 3UIOB 1R7SA 2JU6X 3DBSA 3NUHB 3VDZA 4IWPA 3QWZB 1S1QB 1ZUD2 3H7PA 3DHHC 3VVWB 3R2IA 2PE6B 3CIRB 1C4PA 2D3BA 5HFYA 2CU1A 3P4SB 2BYTA 2MRPA 3FKYA 1FNVA 2KLGA 2ACZB 2VZKB 1ROEA 5EE9A 2SAKA 3P4PB 3PHWB 3PZDA 3VUYA 2NBUA 3QK0A 4P7IA 2ZVNA 2ZNVB 4PS8A 2Y3AA 1FD6A 4RCOA 4L1BA 5J18A 2DX5B 3H9DA 1SIJA 4ICVA 5E6OA 1CZPA 2PJHA 2PMVA 1YJJA 2MA9B 1FIQA 1WXAA 2K8BA 2LZ6A 3ZDMC 1NI3A 4HPPA 2QSDA 3N1XC 2VH1A 1ET6A 2AYOB 1GC6A 1XQQA 3TCAA 2H88B 2NS5A 2WS3B 2N9EB 2MHJA 3MHZA 4N59A 3MJWA 2UU7A 1XEEA 1WY8A 4OVVA 2XEWA 4LNKA 1V1PB 4G3XB 4NAWB 1WGGA 1NYRA 3WIMA 3U8ZA 1QOAA 3KW5B 2QCZA 2MJDA 2PVGC 2DZJA 4LNIA 1XO3A 4P16A 2KJHB 3AXCA 2JXXA 4II3B 3PREA 3P2BA 2I2YA 5G5HA 5DPTA 3FC4A 4M0WA 3VRAB 1TYGB 3H7SA 2MBOA 2YEPB 5TR5A 4C00A 1CJEA 2KFKA 2Z59B 4KX6B 3IXSA 4BKSD 4NNJB 4XZ4A 2V3SA 3VTUA 5E6JA 4FADA 2CR5A 4GDKB 2ZPYA 1E8WA 1BUIC 4WQOB 2KDBA 1LM8B 5AUKA 2KXJA 2N1WA 1TY2A 2GBKA 3AE9B 1SE2A 1WM2A 3CF6E 3X0WA 3FILA 1HZ6A 4RGOS 1NVID 1TKEA 3H7PB 1RFAA 2WXGA 1FXAA 4XX5A 3M62B 1GAQB 3QIJA 4BVUC 5BYRA 1EWYC 2CJOA 3TEWA 2TSSA 3RMKC 4GB9A 3W9CB 1J19A 4EZJA 5DCNA 4JE3B 1E0ZA 3VAWA 3BK1A 1SE3A 2DWQA 3UQAA 2ZCBA 1UWMA 2VH2A 5HKHA 1D4BA 1ZPSA 3JVZX 4LJOB 2WXIA 4HEA1 1WR6E 5IO9A 2J0JA 3ZKJC 3Q8EA 2FCNA 4C56C 2AX5A 2O6VD 4W9IA 4RF1A 4MSMB 1K53A 4HK2A 4KIKB 3WA0A 2WXLA 1L4ZB 3ZO5B 4AWJA 4RF0A 3PHXB 4YTPB 2KT7A 4HJGE 4W9JA 2JY6A 1KLUD 2JZZA 3NVYA 2LUMA 3KH0A 4NJ7A 3W1YA 2IJ0A 1CQVA 2G4SA 3AN1A 2XBBC 3DOWA 4YSYB 3KVFB 3BY4B 1V9JA 1JW9D 3ZTDA 3ZJVA 4TQ1A 4YSZB 1M4VA 2L76A 1QF6A 4BBNF 2BKFA 1WGKA 2DZIA 2K1FA 3ZDTA 3O65B 2EMTA 1MG8A 2BB5A 4IG7B 2AWTA 4NJ6A 1YN4A 1UH6A 1E8ZA 2K25A 2LUEA 1IPGA 2FBWB 2ZZPB 2L0FA 2W3SA 3DVNV 1YX6B 1N60A 2ASQA 2IGDA 3C0RB 5MPOA 3VHTC 3AEEB 1H8CA 5AZHA 4K7SA 1XLNA 4YSXB 4FN2A 4KGSA 1GC7A 2MEKA 2JPHA 2N4FA 3TJPA 5LXHA 2K0PA 1WGDA 4N9F4 2OEDA 4MT5A 2OJWA 4W9HA 3QC8B 1GNUA 1SJHD 4DQOC 2M4NA 1VZ6A 2PEAA 4HDOA 4M01A 2DAJA 3N20C 3PLVA 2LMCA 5JZEB 3PRZA 4WWOA 5BMHA 1IGCA 2RDGA 4AJYB 3ETRA 4E74A 4GMVA 1J7BA 2IZVB 3MP9A 2NMQA 3DDCB 3Q2AC 1MJDA 4K7WA 1F77A 1MHHE 4EFOA 2BT6A 3M63B 3ZGZA 4LDTB 4IM3A 4ARCA 1WJNA 2C7NB 4OVZA 1VZ7A 1V6EA 3JSVB 4ZDVA 1FXIA 2BB6A 4KDLB 4ANXA 5CHWA 1FRDA 1V49A 4N6EB 2UYZB 5BMIA 1TS2A 1I4GA 3WANA 1SF0A 5EE1A 2BS3B 2E6XA 2HJ8A 3DQVA 1J0GA 2PLPA 5AZFA 1S3SG 3I57A 2JX5A 3UI3A 4LNNA 1N63A 4HVBA 1D6EC 3DBLB 3DWGC 3ZW3A 5FR6A 2JYTA 3SHQA 1EWCA 2GBNA 1R4MB 3MFGA 2LGSA 1QILA 1T0QC 5EDSA 5G5GA 4TKNA 1C4AA 3KYCD 1KF6B 1E6EB 4KKIA 4USAA 1OFFA 5JXVA 1QOGA 4B9KA 3KUZA 5H92C 2WP9B 1LFDA 3Q3NC 2WXKA 4WIPA 2IGHA 3V6EB 2V3NA 4GDLB 2DLBA 2N7DA 2C60A 4P6VF 4RFBA 2MBQA 4MDKE 4EE2A 3BVGA 2R2OA 3P63A 1WM3A 1KTKA 1IUEA 2KC1A 2YLMA 1WFYA 2LXCA 3PTFC 4ZYNA 2XK5A 3VQIA 3KWLA 4LNOA 4E3CA 1E10A 1V86A 4NAWA 1PGXA 2YVCA 4RGTA 3U7ZA 3I5JC 2DYOA 3BK2A 3VXWA 2QEJC 3ZQ4A 5FR3A 1N6ZA 1E8YA 1RRBA 1YMHE 1GB1A 3IHPC 2KAJA 2C7MB 1TTNA 4C4VA 3QA8A 2WXPA 5IOIA 1TS3A 4IWQA 2PTLA 5IN7A 4MEMA 2L52A 2BYEA 1OQRA 2OJRA 2WDVB 2W55A 1XLQA 1E9MA 1RLFA 2FCMA 2KN5A 1FM0D 1P98A 1JALA 3R2TA 2JT4B 2R2QA 3T9LA 2ZJDA 2KJ6A 1NDDA 4YTNB 1Q0WB 3T3NA 1SXTA 4W9DA 3IFWB 3BVMA 3I3TB 4DHZE 1C9FA 5FKAC 1YJIA 4B6WA 1L7YA 1UBQA 2CJNA 3HM6X 1XF5L 3NVVA 2QILA 1TGZB 1WMHB 4CYEA 1JRPA 3OJ4B 2KANA 2FCSA 2CU3A 2K22A 2NTTA 4PT5A 1KM7A 1EU4A 5FK9C 2Y5CA 2IY1B 2QDFA 4TV3A 3B0AA 2M56B 2MP2A 2KOXA 3SD5A 3AE7B 2KQSA 2INNE 5IAAC 1EF5A 1GG3A 1OQYA 3DBRB 2PPHA 3IBEA 3TEZA 3UIPB 1N62A 4WWMA 2EELA 1HQRD 4C80A 3SU8X 4ITKA 2KYWA 4ZRKA 4BZAA 4I6PA 1YIWA 3P4QB 4ASWC 1VDVA 2V9HA 3ZXRA 3APDA 3QARA 2LRUA 4AS1A 1XCTL 2DZKA 3H8HA 3V6CB 3UGBB 4E71A 1VRAB 4A20A 3UF8A 3E9SA 4DXAB 4GDKA 4OZAA 1ZDVA 1JMLA 4RH6A 3ZJUA 1N5XA 2HJ1A 3U52E 3CSFA 3RNCC 1MG4A 4IWOA 2WHIA 3H6NA 4N58A 4J6IA 2RPQA 4YL8A 2BS2B 3TSSA 2Z8LA 2W3RA 1ZW7A 3Q8AA 2K5PA 4CQNA 1LQBA 3RCZA 3H1UA 2MQJA 3RN9C 3NVZA 3VUXA 4NAMA 1GUAB 1D5XC 2AL6A 3KWVA 2KO3A 5C3JB 2L0TA 2R61A 4XDCA 4II2B 4ACFA 1VR9A 4IM2A 1XD3B 1I4XA 2MW5A 3NOBA 1F52A 2WXQA 2PKOA 2Y5BB 3NY5A 4RGMA 5TSSA 4FA6A 1IBXA 2V0GA 4NQKE 5GMVA 2M17A 2KTRA 1VCBA 3KUCB 4DXGA 1ZDXA 2DYMA 2NTSA 4GIVA 4JL9A 2KN4A 5HG2A 4H2AA 3PGEA 2WQYB 4IW0A 4D2KA 1KRHA 2KDIA 4QAYA 2KWUB 2OHFA 3LJ3A 4ICUA 3ECIA 3NZ3A 5J2RA 4KSLC 1SGHA 3RI7C 1F1HA 3PS6A 4US8A 2H89B 3NS8A 1TY0A 2LD9A 4XWTA 1RYJA 4AP4C 2LVQA 2KC2A 2GBRA 1ACCA 4AUQC 2WDQB 2FCQA 3PPAA 4XYCA 4F7ZA 5DPRA 3IVFA 1NEKB 4GXBA 1FCCC 1IP9A 1QLBB 1D5ZC 4WWNA 2NVUI 4ANWA 1LXDA 2DHZA 1AARA 2AQ2B 1AW7A 3C8YA 2JSVX 4WAFA 2ONQA 2ZW1A 2J4XA 4K7UA 4RM8A 1SIFA 4GSWA 2J52A 2RD0A 4WJQA 2RDHA 3A1QB 4A3OA 4EEWA 2SEBD 3ZYYX 3EECA 2QIEB 3L54A 3ALBA 1WRIA 2D5GA 4EZKA 2PIAA 2LVPA 4K1RB 2INPE 1WE7A 4BOSC 4W9GA 1M94A 5C1ZA 4BKTA 1WH3A 3GB1A 4PYUA 3UQBA 4DXFA 2ZW0A 3VTVA 3HM3A 4XE0A 1PFDA 2N9LA 3N1YC 4M0WB 3U2SC 1EM7A 3GZNI 4IDIA 1ZOYB 3TIXA 1XLPA 1FCLA 2PE9A 5JHAA 3AEBB 4F1SA 1WI0A 1TKYA 2G45B 2YEPF 1UD7A 1TIFA 3AH7A 3KQ4A 1WWTA 3Q3FA 4MGKE 3WAOA 1JWAD 2LWPA 4FLHA 1VJKA 1V8CA 4CO7A 3Q8BA 3V05A 2AQ3B 2MJEA 1WGRA 3ENEA 1JROA 3ZXVA 1MHXA 2K6DB 3DBLI 1ENFA 4MM3A 1UWXA 1CMXB 3U7DA 3MC8A 2AL3A 2ICIA 4YT0B 1HXYD 3Q6BA 4XC2A 1YX5B 1YQBA 2GI9A 4MGZE 1V80A 4JLCA 2KK8A 4MGYE 2J0KA 4ARIA 3UINB 2MBEA 4A3PA 2KJRA 2JRIB 4IOIE 4HJKA 1SBBB 1V1PA 3DHGC 1JWBD 3AE5B 1PDXA 3ZUNA 3R3MA 1VD2A 3MHSD 1ZE3D 3W5VB 1Q10A 3I63C 1KLGD 4O1NA 2IO2B 3MC0B 1ZXIA 3DVGX 1HTQA 3NS1A 2WU5B 1I7HA 2EKIA 3HK0A 3DBHB 2DYBA 2ZCCA 2FAZA 3TEXA 2PW9A 1D5MC 1YQ3B 2WX0A 4YTMB 3IT6B 4BAXA 2N1VA 1VLBA 1ZKHA 2MCNB 3V60A 2D10A 4KDIC 3K9OB 3RNEC 2WDRB 2IBIB 2BYVE 2KWDA 1K50A 5D6JB 4JIOU 4NY0A 3ZRCA 1IBXB 2FIFA 3AB5A 4RM9A 5C23A 2LGYA 1DYQA 2PVOD 2Y5PA 1NENB 3M95A 4WQMA 3B1LX 4OZBA 4DHJB 2KMMA 4P1BC 4G0NB 5EE3A 1KH0A 5D94A 2C5LC 1GB4A 1OQQA 1OEYJ 2BVCA 3GE3C 4JX1C 2LASA 3TUOA 1E7PB 3GE8C 1E90A 4K81A 3AU4A 2L8JA 1OTRB 1BXTA 2HTME 3VH4B 1YQ4B 3W5UB 4DK5A 2GB1A 3ZVVA 1JWUD 2WLBA 1GJZA 1WSPA 2M0XA 2KTRB 2FUHB 1HA5A 5D3DA 1T0RC 2I38A 3EFCA 5LLIA 2BBCA 3BINA 2MX2A 2K39A 5BO4B 3AI5A 2AQ1B 1XLOA 1WXSA 1F2RI 3A9JA 2D3GA 2KVRA 1C79A 3RT3B 3CWIA 2CS4A 5KHOA 1AN8A 3AE1B 3QJZA 4EOYA 1Y8RC 4WJNA 4ANVA 3SFDB 5JH5C 2NPTB 4PS7A 3WAPA 1SE9A 4FHKA 4W9KA 3T8MA 4ZYSA 1P7EA 1I4HA 4RNAA 1QOBA 3VUWA 1KOTA 1V2YA 2WXOA 2K6QA 3EHVA 3ZTCA 1U4AA 3BWUD 3RNBC 4EZLA 1JWMD 5CHFA 4L23A 2MJ3A 1QKZA 1K8RB 2IGGA 2KD0A 3ONSA 4HCNB 3Q3OC 3X23A 4KIKA 3R66C 3IAM1 4GU2A 3CSTA 5G2NA 4PYZA 1E5WA 1SE4A 4G50A 5T8IA 1I42A 4C7YA 2BQQA 3E56A 4URKA 4HKZE 3L08A 2C9WB 3IT4B 1F2RC 4J3OD 2CKHB 2RDBC 1I4RA 2OOBB 2M19A 3AECB 4NZLB 3RNFC 1PUTA 3L0WB 3K9PB 2MSED 1ISNA 1E8XA 1WR1A 2EKEC 2GMIC 2B3AA 3ML8A 3SFEB 1IYFA 1P9DU 2KWVB 1FNUA 4JGHB 3RZFA 1C1YB 4G11A 3ZNHB 3TEYA 3EA6A 3LXFA 4TUUA 3B2FA 4W9EA 2KDMA 2DZMA 1T0SC 4MJSB 2JZPA 4LLGM 4GDLA 2BKRB 3NG0A 5DPSA 3FILB 3N32A 2X38A 2HD5B 4B0EA 2WGSA 5LXIB 1HEZE 3EC8A 4R3DA 1Y56A 3PRPB 3A1QA 3APFA 4GN1A 4LJPB 4XGAB 2JWZA 2DENB 2RPVA 2V1YA 3NRZA 2A4ZA 2KQ7A 1H4RA 5CTRC 4MH8A 4WWPA 5L83A 2J42A 2DAFA 5JHBA 2JYEA 5H8YE 2Q5WD 1PQSA 2WXJA 2BW2A 2DBYA 4FXCA 1WZ3A 3OG5A 3AEDB 2EMSA 3L13A 4HPMB 3RFZB 4DBGA 4DHZB 1TJEA 4MGIE 2K8HA 1WGYA 1FFUA 2RSUA 3A9KB 2IDYA 2MBHA 5IP4D 5AUIA 1D3ZA 1C77A 1UBIA 4DWFA 3JSVA 1TZ1A 4MSQB 4HROA 2UWQA 4REZA 3AEGB 3WAMA 2KACA 5J17A 4A8XC 3AEAB 1TS4A 2FE8A 3ZNZB 1JRUA 3A4RA 2V4LA 2LJ5A 2M1MA 2LFIA 1L6VA 3NVWA 4TSSA 1LGRA 2WWZA 5E6NA 1L5PA 2D11A 1DOYA 4CHKA 3KYDD 5IA7A 1AYFA 1VZ8A 3IG3A 4KV2A 3GOEA 4DHJD 5D3IB 3WCQA 4K3BA 3RNAC 4Q2JA 4ZOHC 2Z0DB 1WE6A 2N7JA 3N30A 2BF8B 1WXQA 5CX3A 2FNJB 2JXTA 4WH4A 4HCPB 3U30A 3RPFC 1YN5A 4JWSC 3LB8C 4KZ0A 3CMMB 3JYUA 3P42A 2C7HA 2KTFA 2KFJA 3L16A 4FJYA 4DDGD 1X1MA 1HZ5A 2BYFA 3VFKA 1QQRA 2BGFA 4FJVB 5C2TB 3MC9A 1DOXA 1WJUA 3NJTA 2JZ3B 3QHTA 3RUIB 2N0SB 1HE8A 1CK1A 1PGAA 3I9V1 1T5XD 1B9RA 1ZP0B 3RYTA 4NPNA 1P7FA 2KNBA 3Q3MC 4M02A 4EUTA 1I35A 1XXGA 3AV8A 4KGRA 3EUB2 4ZHOA 2KWCA 3VR9B 3ZLZA 4BFRA 3VR8B 2L3ZA 4WAAA 3VRBB 3RZWC 2LRWA 2KHWB 1WJ6A 4YXDB 2GLSA 1E7VA 3BZDB 3ML9A 3Q8CA 4LNFA 2RR9A 2N7EA 4LDTD 3L4PA 3VH3B 3PZ8A 2KVZA 2GRIA 1N5WA 3V61A 4F8CB 4HLEA 1J7AA 4TQ0A 4JPSA 1EUVB 1PGBA 1UNSA 4PK1A 2L00B 1I4QA 2LEKA 5BMGA 1FMAD 3VTWA 2JUOA 3QCAA 2W82A 2V4IB 2XK5B 1V1OA 3J9CA 3A4SC 3EFUA 3A33B 4OZCA 1JCKB 4AJWA 2KX3A 4RGNA 4LK0M 4IC7B 1EO6A 3B2GA 4P1CC 4ANUA 4S17A 3V62A 3HUIA 3HHMA 1TBEA 2XN9C 1C3TA 1T0YA 2K9XA 3Q8FA 2VZKD 1ZXHA 2VRRB 4A90A 1UZXB 4L2YA 3AE3B 1FPYA 3GZNB 3OAWA 2ZEQA 4IUMB 1FNWA 4WJPA 1V97A 2LHDA 1KLVA 1UGMA 1UF0A 3M3JA 1OEYA 1I4PA 4ZHPA 2J53A 2A5UA 4HPLB 3ABVB 4K3CA 1LO5D 5BYSA 2FUG1 1Z5SB 4NJCA 3GS2A 3BYTB 4LTUA 4M00A 4M8MA 5CHVC 4EKUA 2JVCA 3B08A 3LYYA 4NQLB 2N9XA 4OHJA 2WXNA 1UUPA 2REXA 3TMPB 4IM0A 2J7QB 2O6VB 3JW0X 1T6BX 1TKGA 4KKJA 1EU3A 1L2NA 1WRDB 1BMLC 2B76B 2K8CA 3PZ7A 3DWMA 1C78A 1F9JA 1KJTA 1WMHA 2LVOA 3SR6A 3QX1A 1FXTB 5IKCM 1J7CA 4OW0A 3TBLD 1QT9A 2GBJA 3AE6B 3N1ZC 2HTHA 3W2DA 2E3TA 3AMZA 3QAQA 1ESFA 1RAXA 1B1ZA 3SEBA 3DBHI 3HIZA 3ZNID 2W54A 2X8XX 1OGWA 2IPKD 1RWSA 5EE0A 4AQ7A 2MH7A 1K51A 2ZPNA 3N9YC 1FRRA 2KLCA 4YWGG 4JQWC 2V3PA 1L0VB 3Q69A 1YN3A 2BTEA 2J0MA 3BYYB 1ZGUB 3NZSA 1WZ0A 3OLMD 1A70A 3R7RA 4ZRIA 3MJ5A 3PVLA 2NCNA 4PS3A 2INDC 3RULA 1NYQA
chains in the Genus database with same CATH topology
4ZRKA 4W9LA 4I6PA 1YIWA 1E8WA 1E5WA 4G50A 4ASWC 1I42A 4WQOB 2KDBA 1LM8B 2KMCA 2IY0B 4URKA 2KXJA 3APDA 2N1WA 3L08A 2C9WB 1NBFC 2GBKA 3QARA 2LRUA 2NR2A 3Q3JA 2DZKA 1WM2A 2KKCA 3CF6E 2CKHB 3NHEB 3V6CB 3UGBB 3X0WA 2OOBB 4FBJB 4E71A 4A20A 2KFKB 3KUDB 2G4DB 3UF8A 4DXAB 2BWES 5KHQA 3L0WB 2GOWA 4GDKA 1R4NI 3K9PB 2MSED 3H7PB 2G3QB 1RFAA 1ISNA 1E8XA 1WR1A 2EKEC 3CSFA 2GMIC 4XX5A 2B3AA 3ML8A 3M62B 1IYFA 4IWOA 1P9DU 2KWVB 3H6NA 2WYQA 3QIJA 4JGHB 2RPQA 4J6IA 4BVUC 4YL8A 1NI2A 1ZW7A 2FIDA 3RZFA 1C1YB 4G11A 3ZNHB 1YJ1A 2MBBB 4GB9A 1LQBA 1P1AA 4TUUA 1J19A 4EZJA 3RCZA 5DCNA 4W9EA 2MWSB 2DZMA 3H1UA 1WX9A 2MQJA 4MJSB 4GDLA 3VAWA 2BKRB 4X57B 5DPSA 3UQAA 2ZCBA 3N32A 1YD8U 1V81A 2HD5B 3VUXA 5LXIB 1GUAB 1WYWB 5HKHA 3EC8A 4LJOB 3JVZX 1WX7A 4B95A 2AL6A 4I6NB 2KX0A 2KO3A 3DVNU 3PRPB 2L0TA 1WR6E 3A1QA 2J0JA 3APFA 4GN1A 4LJPB 4II2B 3ZKJC 2JWZA 2DENB 2V1YA 2O2VA 2A4ZA 2FCNA 2KQ7A 1H4RA 4IM2A 1XD3B 2D07B 2MW5A 2O6VD 4BBNC 4W9IA 5CTRC 3NOBA 4WWPA 3N3KB 5L83A 1V5OA 3NZUA 2DAFA 5JHBA 2CHZA 2Y5BB 3NY5A 1PQSA 4MSMB 3A9JB 4HK2A 4KIKB 3WA0A 3ZO5B 4AWJA 4FA6A 1WZ3A 3PHXB 3SDLC 4NQKE 4W9JA 2EMSA 3PV1A 3AULA 2JY6A 2JZZA 3L13A 3PSEB 5GMVA 2M17A 2KTRA 3KH0A 4HPMB 5DPWA 1VCBA 3KUCB 4DBGA 4NJ7A 2I1KA 4DHZB 3W1YA 5AEKB 4MGIE 2G4SA 2DYMA 3DPDA 4GIVA 2XBBC 2K8HA 4JL9A 1WGYA 3DOWA 5D7GA 3PGEA 3KVFB 2RSUA 3BY4B 1V9JA 4IW0A 3ZTDA 3A9KB 4TQ1A 2KDIA 2BPSA 2KWUB 4W9CA 2L76A 3LJ3A 4ICUA 3ECIA 2MBHA 4BBNF 2BKFA 2D2QA 4HWIB 1D3ZA 2DZIA 5J2RA 2K1FA 4FJZA 3ZDTA 3O65B 4KSLC 1UBIA 4DWFA 3JSVA 2EMTA 1SGHA 1WF9A 1MG8A 1TZ1A 4MSQB 2UWQA 3DBRI 4IG7B 2AWTA 4NJ6A 5D2MB 3WAMA 3PS6A 5J17A 2AEHA 4BKGA 3NS8A 3PLUA 2NPTA 1UH6A 2IO1B 1E8ZA 2L05A 2K25A 2LUEA 2LD9A 2MLBA 3ZNZB 2N9PC 1JRUA 1IPGA 1Q5WB 2RGFA 2ZZPB 4AP4C 2LVQA 2KC2A 3A4RA 2L0FA 2V4LA 2GBRA 2LJ5A 2M1MA 2NBWB 3DVNV 2MP2B 4AUQC 1YX6B 2W9NA 2FCQA 3PPAA 2WWZA 4F7ZA 2GBMA 5E6NA 2D11A 3PT2B 5DPRA 3IVFA 1UELA 2ASQA 4GXBA 3C0RB 4CHKA 3KYDD 5IA7A 2KZRA 3IG3A 4KV2A 1IP9A 3VHTC 4WWNA 2NVUI 2Z0EB 4ANWA 3GOEA 1LXDA 2DHZA 1AARA 5AZHA 4DHJD 1H8CA 1P3QU 3ZRFA 2KDFB 4K7SA 2Z0DB 5AZGA 1WE6A 4K7UA 3N30A 4RM8A 4FN2A 2BF8B 5CX3A 1GC7A 1SIFA 2FNJB 4GSWA 4LCDE 2RD0A 5L95C 2LGDA 4WJQA 2HE7A 2KDEB 2JPHA 3A1QB 2L7RA 4A3OA 4OVUA 2N4FA 3W1SA 2WDTB 3RD2A 3TJPA 4HCPB 4EEWA 5LXHA 1WIAA 1Q1OA 3EECA 1WGDA 4N9F4 2JRHA 2QHOA 2ZVOA 3ALBA 3L54A 3U30A 5G55A 4W9HA 4BKSA 4EZKA 2LVPA 3QC8B 1GNUA 2IO3B 4KZ0A 4K1RB 2M8SA 1WE7A 4BOSC 4W9GA 1M94A 5C1ZA 4HDQA 2M4NA 3CMMB 4BKTA 3JYUA 1WH3A 2C7HA 2PEAA 2KTFA 2KFJA 4PYUA 3UQBA 3L16A 4FJYA 4HDOA 3VTVA 3HM3A 4DDGD 4KVGB 1X1MA 4M0WB 4MH0E 2DAJA 4GOCA 2BYFA 3VFKA 4M8NA 2CHXA 3GZNI 2BGFA 2ZNVC 3PLVA 3TIXA 1WXMA 5JZEB 3PRZA 4WWOA 2PE9A 4AJYB 4FJVB 4HXDA 3L10B 4DDID 1P0RA 5JHAA 1QZEA 4E74A 4F1SA 2IO0B 2IZVB 4GMVA 1WI0A 2CHWA 2G45B 3DDCB 4I6LB 1UD7A 4FULA 1E7UA 4K7WA 1WJUA 2JZ3B 3QHTA 4EFOA 3Q3FA 3M63B 3RUIB 4LDTB 4MGKE 1HE8A 3WAOA 2LWPA 2O6VA 4FLHA 4IM3A 1J8CA 4CO7A 1WJNA 3RYTA 2C7NB 3ENEA 1V6EA 1WGRA 4NPNA 3JSVB 4ZRJA 4ZDVA 2LGXA 2KNBA 2IYDB 1V5TA 2O2VB 2K6DB 4KDLB 4KSKC 4ANXA 4EUTA 2LI5A 1I35A 3DBLI 5CHWA 4MM3A 1V49A 2UYZB 1CMXB 3U7DA 3WANA 3DVGY 2KWCA 2AL3A 3ZLZA 4GGQA 4BFRA 4XC2A 1YX5B 2L3ZA 4WAAA 1R4MI 3RZWC 2LRWA 1A5RA 1YQBA 1WJ6A 2HJ8A 2KHWB 3DQVA 1J0GA 5AZFA 1S3SG 1WX8A 4MGZE 1E7VA 4HVBA 1V80A 1WGHA 3ML9A 2KK8A 4JLCA 4FHJA 4MGYE 2WX1A 2J0KA 1XT9B 3UINB 2MBEA 2RR9A 4A3PA 3R7QA 2KJRA 3DCGA 3ZIMA 2N7EA 4LDTD 3VH3B 3ZW3A 5FR6A 2JRIB 4AOFA 1EF1A 3SHQA 3D32A 4HJKA 3V61A 4F8CB 3ZUNA 3R3MA 2GBNA 4KZCA 4HLEA 1VD2A 3LDZE 3MHSD 4TQ0A 1WXVA 1WJ4A 1EUVB 4W9FA 2I1JA 3QQ8B 3W1SC 2NBVB 5EDSA 3OJ3A 2L00B 4TKNA 3MTNB 3KYCD 3VTWA 2JUOA 3QCAA 2IO2B 3PRMB 3TL5A 3DVGX 3WALA 3A9KA 4B9KA 3KUZA 2XK5B 1Z2MA 1LFDA 3AU5A 3HK0A 3A4SC 3EFUA 3A33B 4RMAA 2DYBA 4AJWA 2KX3A 2ZCCA 2FAZA 3ZNGC 4MJSA 4MELA 5E6PA 3V6EB 2WX0A 4GDLB 1G6JA 4WJOA 4IC7B 1EO6A 4ANUA 3L17A 2JF5A 2N1VA 2N7DA 3V62A 3HHMA 4BOZB 1TBEA 1ZKHA 1C3TA 1T0YA 2MCNB 3V60A 2C60A 2D10A 4KDIC 3K9OB 2VRRB 2IBIB 1UZXB 2BYVE 2MBQA 4MDKE 3S2AA 3OAWA 2R2OA 2ZEQA 2KMAA 2BWFA 5D6JB 1WM3A 4IUMB 4JIOU 4NY0A 3ZRCA 4WJPA 2FIFA 5C23A 4RM9A 3APCA 2LGYA 1KLVA 1UGMA 2KC1A 2YLMA 2LXAA 3M3JA 1BT0A 1WFYA 1OEYA 2LXCA 3PTFC 3UIOB 3M95A 2A5UA 4ZYNA 2XK5A 3B1LX 4DHJB 3DBSA 3VQIA 4HPLB 4G0NB 3VDZA 4E3CA 4IWPA 5D94A 3QWZB 1S1QB 1V86A 1Z5SB 3H7PA 4NAWA 3VVWB 2PE6B 2C5LC 2YVCA 1OEYJ 2LASA 2DYOA 2CU1A 1E90A 3VXWA 4K81A 2MRPA 3AU4A 4M8MA 5CHVC 4EKUA 2KLGA 2L8JA 1OTRB 1E8YA 1RRBA 3VH4B 2JVCA 3IHPC 3B08A 4DK5A 4NQLB 3ZVVA 2C7MB 2N9XA 3PHWB 1GJZA 3PZDA 2REXA 3VUYA 1TTNA 2NBUA 2M0XA 3QA8A 4IM0A 2KTRB 3TMPB 2FUHB 2J7QB 3QK0A 2O6VB 3JW0X 4P7IA 2ZVNA 2ZNVB 4PS8A 1L2NA 1WRDB 5LLIA 5J18A 2K8CA 2DX5B 4IWQA 3H9DA 1F9JA 1WMHA 1KJTA 3BINA 4ICVA 5E6OA 2LVOA 2MX2A 2K39A 4MEMA 3AI5A 2BYEA 5BO4B 2PJHA 3QX1A 2OJRA 1FXTB 1WXSA 1RLFA 2FCMA 2MA9B 2KN5A 2K8BA 1WXAA 3A9JA 2LZ6A 2D3GA 2KVRA 1P98A 3TBLD 3ZDMC 3RT3B 2GBJA 2CS4A 2JT4B 2AYOB 5KHOA 2R2QA 1GC6A 1XQQA 2HTHA 2ZJDA 3T9LA 2KJ6A 2NS5A 3TCAA 1NDDA 2N9EB 3QAQA 3QJZA 1Q0WB 4EOYA 1Y8RC 4WJNA 3MJWA 4ANVA 1RAXA 4W9DA 5JH5C 1WY8A 3IFWB 2NPTB 4PS7A 4OVVA 2XEWA 3I3TB 3WAPA 3DBHI 1SE9A 3HIZA 4DHZE 3ZNID 4G3XB 4NAWB 1WGGA 4FHKA 4W9KA 3T8MA 1OGWA 4B6WA 1L7YA 3WIMA 1UBQA 3U8ZA 3KW5B 3HM6X 3VUWA 1KOTA 2ZPNA 1TGZB 2KLCA 1V2YA 1WMHB 2K6QA 4CYEA 2DZJA 2KANA 3OJ4B 2FCSA 4JQWC 3EHVA 3ZTCA 1U4AA 2KJHB 4EZLA 3AXCA 2JXXA 5CHFA 1KM7A 4II3B 3PREA 1K8RB 2J0MA 3P2BA 1ZGUB 2IY1B 4TV3A 3B0AA 3NZSA 5DPTA 2KD0A 3ONSA 2KOXA 2MP2A 3SD5A 4HCNB 3X23A 2KQSA 5IAAC 1WZ0A 3OLMD 4KIKA 1EF5A 1GG3A 3H7SA 1OQYA 2MBOA 5TR5A 3R7RA 3R66C 2PPHA 2KFKA 3IBEA 2Z59B 4GU2A 3UIPB 4ZRIA 4BKSD 3PVLA 4NNJB 2NCNA 4PS3A 3CSTA 4XZ4A 2V3SA 5G2NA 3RULA 3VTUA 4FADA 2CR5A 3SU8X 4GDKB 4PYZA 2ZPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRK A;  4W9L A;  4I6P A;  1YIW A;  1E8W A;  1E5W A;  4G50 A;  4ASW C;  1I42 A;  4WQO B;  2KDB A;  1LM8 B;  2KMC A;  2IY0 B;  4URK A;  2KXJ A;  3APD A;  2N1W A;  3L08 A;  2C9W B;  1NBF C;  2GBK A;  3QAR A;  2LRU A;  2NR2 A;  3Q3J A;  2DZK A;  1WM2 A;  2KKC A;  3CF6 E;  2CKH B;  3NHE B;  3V6C B;  3UGB B;  3X0W A;  2OOB B;  4FBJ B;  4E71 A;  4A20 A;  2KFK B;  3KUD B;  2G4D B;  3UF8 A;  4DXA B;  2BWE S;  5KHQ A;  3L0W B;  2GOW A;  4GDK A;  1R4N I;  3K9P B;  2MSE D;  3H7P B;  2G3Q B;  1RFA A;  1ISN A;  1E8X A;  1WR1 A;  2EKE C;  3CSF A;  2GMI C;  4XX5 A;  2B3A A;  3ML8 A;  3M62 B;  1IYF A;  4IWO A;  1P9D U;  2KWV B;  3H6N A;  2WYQ A;  3QIJ A;  4JGH B;  2RPQ A;  4J6I A;  4BVU C;  4YL8 A;  1NI2 A;  1ZW7 A;  2FID A;  3RZF A;  1C1Y B;  4G11 A;  3ZNH B;  1YJ1 A;  2MBB B;  4GB9 A;  1LQB A;  1P1A A;  4TUU A;  1J19 A;  4EZJ A;  3RCZ A;  5DCN A;  4W9E A;  2MWS B;  2DZM A;  3H1U A;  1WX9 A;  2MQJ A;  4MJS B;  4GDL A;  3VAW A;  2BKR B;  4X57 B;  5DPS A;  3UQA A;  2ZCB A;  3N32 A;  1YD8 U;  1V81 A;  2HD5 B;  3VUX A;  5LXI B;  1GUA B;  1WYW B;  5HKH A;  3EC8 A;  4LJO B;  3JVZ X;  1WX7 A;  4B95 A;  2AL6 A;  4I6N B;  2KX0 A;  2KO3 A;  3DVN U;  3PRP B;  2L0T A;  1WR6 E;  3A1Q A;  2J0J A;  3APF A;  4GN1 A;  4LJP B;  4II2 B;  3ZKJ C;  2JWZ A;  2DEN B;  2V1Y A;  2O2V A;  2A4Z A;  2FCN A;  2KQ7 A;  1H4R A;  4IM2 A;  1XD3 B;  2D07 B;  2MW5 A;  2O6V D;  4BBN C;  4W9I A;  5CTR C;  3NOB A;  4WWP A;  3N3K B;  5L83 A;  1V5O A;  3NZU A;  2DAF A;  5JHB A;  2CHZ A;  2Y5B B;  3NY5 A;  1PQS A;  4MSM B;  3A9J B;  4HK2 A;  4KIK B;  3WA0 A;  3ZO5 B;  4AWJ A;  4FA6 A;  1WZ3 A;  3PHX B;  3SDL C;  4NQK E;  4W9J A;  2EMS A;  3PV1 A;  3AUL A;  2JY6 A;  2JZZ A;  3L13 A;  3PSE B;  5GMV A;  2M17 A;  2KTR A;  3KH0 A;  4HPM B;  5DPW A;  1VCB A;  3KUC B;  4DBG A;  4NJ7 A;  2I1K A;  4DHZ B;  3W1Y A;  5AEK B;  4MGI E;  2G4S A;  2DYM A;  3DPD A;  4GIV A;  2XBB C;  2K8H A;  4JL9 A;  1WGY A;  3DOW A;  5D7G A;  3PGE A;  3KVF B;  2RSU A;  3BY4 B;  1V9J A;  4IW0 A;  3ZTD A;  3A9K B;  4TQ1 A;  2KDI A;  2BPS A;  2KWU B;  4W9C A;  2L76 A;  3LJ3 A;  4ICU A;  3ECI A;  2MBH A;  4BBN F;  2BKF A;  2D2Q A;  4HWI B;  1D3Z A;  2DZI A;  5J2R A;  2K1F A;  4FJZ A;  3ZDT A;  3O65 B;  4KSL C;  1UBI A;  4DWF A;  3JSV A;  2EMT A;  1SGH A;  1WF9 A;  1MG8 A;  1TZ1 A;  4MSQ B;  2UWQ A;  3DBR I;  4IG7 B;  2AWT A;  4NJ6 A;  5D2M B;  3WAM A;  3PS6 A;  5J17 A;  2AEH A;  4BKG A;  3NS8 A;  3PLU A;  2NPT A;  1UH6 A;  2IO1 B;  1E8Z A;  2L05 A;  2K25 A;  2LUE A;  2LD9 A;  2MLB A;  3ZNZ B;  2N9P C;  1JRU A;  1IPG A;  1Q5W B;  2RGF A;  2ZZP B;  4AP4 C;  2LVQ A;  2KC2 A;  3A4R A;  2L0F A;  2V4L A;  2GBR A;  2LJ5 A;  2M1M A;  2NBW B;  3DVN V;  2MP2 B;  4AUQ C;  1YX6 B;  2W9N A;  2FCQ A;  3PPA A;  2WWZ A;  4F7Z A;  2GBM A;  5E6N A;  2D11 A;  3PT2 B;  5DPR A;  3IVF A;  1UEL A;  2ASQ A;  4GXB A;  3C0R B;  4CHK A;  3KYD D;  5IA7 A;  2KZR A;  3IG3 A;  4KV2 A;  1IP9 A;  3VHT C;  4WWN A;  2NVU I;  2Z0E B;  4ANW A;  3GOE A;  1LXD A;  2DHZ A;  1AAR A;  5AZH A;  4DHJ D;  1H8C A;  1P3Q U;  3ZRF A;  2KDF B;  4K7S A;  2Z0D B;  5AZG A;  1WE6 A;  4K7U A;  3N30 A;  4RM8 A;  4FN2 A;  2BF8 B;  5CX3 A;  1GC7 A;  1SIF A;  2FNJ B;  4GSW A;  4LCD E;  2RD0 A;  5L95 C;  2LGD A;  4WJQ A;  2HE7 A;  2KDE B;  2JPH A;  3A1Q B;  2L7R A;  4A3O A;  4OVU A;  2N4F A;  3W1S A;  2WDT B;  3RD2 A;  3TJP A;  4HCP B;  4EEW A;  5LXH A;  1WIA A;  1Q1O A;  3EEC A;  1WGD A;  4N9F 4;  2JRH A;  2QHO A;  2ZVO A;  3ALB A;  3L54 A;  3U30 A;  5G55 A;  4W9H A;  4BKS A;  4EZK A;  2LVP A;  3QC8 B;  1GNU A;  2IO3 B;  4KZ0 A;  4K1R B;  2M8S A;  1WE7 A;  4BOS C;  4W9G A;  1M94 A;  5C1Z A;  4HDQ A;  2M4N A;  3CMM B;  4BKT A;  3JYU A;  1WH3 A;  2C7H A;  2PEA A;  2KTF A;  2KFJ A;  4PYU A;  3UQB A;  3L16 A;  4FJY A;  4HDO A;  3VTV A;  3HM3 A;  4DDG D;  4KVG B;  1X1M A;  4M0W B;  4MH0 E;  2DAJ A;  4GOC A;  2BYF A;  3VFK A;  4M8N A;  2CHX A;  3GZN I;  2BGF A;  2ZNV C;  3PLV A;  3TIX A;  1WXM A;  5JZE B;  3PRZ A;  4WWO A;  2PE9 A;  4AJY B;  4FJV B;  4HXD A;  3L10 B;  4DDI D;  1P0R A;  5JHA A;  1QZE A;  4E74 A;  4F1S A;  2IO0 B;  2IZV B;  4GMV A;  1WI0 A;  2CHW A;  2G45 B;  3DDC B;  4I6L B;  1UD7 A;  4FUL A;  1E7U A;  4K7W A;  1WJU A;  2JZ3 B;  3QHT A;  4EFO A;  3Q3F A;  3M63 B;  3RUI B;  4LDT B;  4MGK E;  1HE8 A;  3WAO A;  2LWP A;  2O6V A;  4FLH A;  4IM3 A;  1J8C A;  4CO7 A;  1WJN A;  3RYT A;  2C7N B;  3ENE A;  1V6E A;  1WGR A;  4NPN A;  3JSV B;  4ZRJ A;  4ZDV A;  2LGX A;  2KNB A;  2IYD B;  1V5T A;  2O2V B;  2K6D B;  4KDL B;  4KSK C;  4ANX A;  4EUT A;  2LI5 A;  1I35 A;  3DBL I;  5CHW A;  4MM3 A;  1V49 A;  2UYZ B;  1CMX B;  3U7D A;  3WAN A;  3DVG Y;  2KWC A;  2AL3 A;  3ZLZ A;  4GGQ A;  4BFR A;  4XC2 A;  1YX5 B;  2L3Z A;  4WAA A;  1R4M I;  3RZW C;  2LRW A;  1A5R A;  1YQB A;  1WJ6 A;  2HJ8 A;  2KHW B;  3DQV A;  1J0G A;  5AZF A;  1S3S G;  1WX8 A;  4MGZ E;  1E7V A;  4HVB A;  1V80 A;  1WGH A;  3ML9 A;  2KK8 A;  4JLC A;  4FHJ A;  4MGY E;  2WX1 A;  2J0K A;  1XT9 B;  3UIN B;  2MBE A;  2RR9 A;  4A3P A;  3R7Q A;  2KJR A;  3DCG A;  3ZIM A;  2N7E A;  4LDT D;  3VH3 B;  3ZW3 A;  5FR6 A;  2JRI B;  4AOF A;  1EF1 A;  3SHQ A;  3D32 A;  4HJK A;  3V61 A;  4F8C B;  3ZUN A;  3R3M A;  2GBN A;  4KZC A;  4HLE A;  1VD2 A;  3LDZ E;  3MHS D;  4TQ0 A;  1WXV A;  1WJ4 A;  1EUV B;  4W9F A;  2I1J A;  3QQ8 B;  3W1S C;  2NBV B;  5EDS A;  3OJ3 A;  2L00 B;  4TKN A;  3MTN B;  3KYC D;  3VTW A;  2JUO A;  3QCA A;  2IO2 B;  3PRM B;  3TL5 A;  3DVG X;  3WAL A;  3A9K A;  4B9K A;  3KUZ A;  2XK5 B;  1Z2M A;  1LFD A;  3AU5 A;  3HK0 A;  3A4S C;  3EFU A;  3A33 B;  4RMA A;  2DYB A;  4AJW A;  2KX3 A;  2ZCC A;  2FAZ A;  3ZNG C;  4MJS A;  4MEL A;  5E6P A;  3V6E B;  2WX0 A;  4GDL B;  1G6J A;  4WJO A;  4IC7 B;  1EO6 A;  4ANU A;  3L17 A;  2JF5 A;  2N1V A;  2N7D A;  3V62 A;  3HHM A;  4BOZ B;  1TBE A;  1ZKH A;  1C3T A;  1T0Y A;  2MCN B;  3V60 A;  2C60 A;  2D10 A;  4KDI C;  3K9O B;  2VRR B;  2IBI B;  1UZX B;  2BYV E;  2MBQ A;  4MDK E;  3S2A A;  3OAW A;  2R2O A;  2ZEQ A;  2KMA A;  2BWF A;  5D6J B;  1WM3 A;  4IUM B;  4JIO U;  4NY0 A;  3ZRC A;  4WJP A;  2FIF A;  5C23 A;  4RM9 A;  3APC A;  2LGY A;  1KLV A;  1UGM A;  2KC1 A;  2YLM A;  2LXA A;  3M3J A;  1BT0 A;  1WFY A;  1OEY A;  2LXC A;  3PTF C;  3UIO B;  3M95 A;  2A5U A;  4ZYN A;  2XK5 A;  3B1L X;  4DHJ B;  3DBS A;  3VQI A;  4HPL B;  4G0N B;  3VDZ A;  4E3C A;  4IWP A;  5D94 A;  3QWZ B;  1S1Q B;  1V86 A;  1Z5S B;  3H7P A;  4NAW A;  3VVW B;  2PE6 B;  2C5L C;  2YVC A;  1OEY J;  2LAS A;  2DYO A;  2CU1 A;  1E90 A;  3VXW A;  4K81 A;  2MRP A;  3AU4 A;  4M8M A;  5CHV C;  4EKU A;  2KLG A;  2L8J A;  1OTR B;  1E8Y A;  1RRB A;  3VH4 B;  2JVC A;  3IHP C;  3B08 A;  4DK5 A;  4NQL B;  3ZVV A;  2C7M B;  2N9X A;  3PHW B;  1GJZ A;  3PZD A;  2REX A;  3VUY A;  1TTN A;  2NBU A;  2M0X A;  3QA8 A;  4IM0 A;  2KTR B;  3TMP B;  2FUH B;  2J7Q B;  3QK0 A;  2O6V B;  3JW0 X;  4P7I A;  2ZVN A;  2ZNV B;  4PS8 A;  1L2N A;  1WRD B;  5LLI A;  5J18 A;  2K8C A;  2DX5 B;  4IWQ A;  3H9D A;  1F9J A;  1WMH A;  1KJT A;  3BIN A;  4ICV A;  5E6O A;  2LVO A;  2MX2 A;  2K39 A;  4MEM A;  3AI5 A;  2BYE A;  5BO4 B;  2PJH A;  3QX1 A;  2OJR A;  1FXT B;  1WXS A;  1RLF A;  2FCM A;  2MA9 B;  2KN5 A;  2K8B A;  1WXA A;  3A9J A;  2LZ6 A;  2D3G A;  2KVR A;  1P98 A;  3TBL D;  3ZDM C;  3RT3 B;  2GBJ A;  2CS4 A;  2JT4 B;  2AYO B;  5KHO A;  2R2Q A;  1GC6 A;  1XQQ A;  2HTH A;  2ZJD A;  3T9L A;  2KJ6 A;  2NS5 A;  3TCA A;  1NDD A;  2N9E B;  3QAQ A;  3QJZ A;  1Q0W B;  4EOY A;  1Y8R C;  4WJN A;  3MJW A;  4ANV A;  1RAX A;  4W9D A;  5JH5 C;  1WY8 A;  3IFW B;  2NPT B;  4PS7 A;  4OVV A;  2XEW A;  3I3T B;  3WAP A;  3DBH I;  1SE9 A;  3HIZ A;  4DHZ E;  3ZNI D;  4G3X B;  4NAW B;  1WGG A;  4FHK A;  4W9K A;  3T8M A;  1OGW A;  4B6W A;  1L7Y A;  3WIM A;  1UBQ A;  3U8Z A;  3KW5 B;  3HM6 X;  3VUW A;  1KOT A;  2ZPN A;  1TGZ B;  2KLC A;  1V2Y A;  1WMH B;  2K6Q A;  4CYE A;  2DZJ A;  2KAN A;  3OJ4 B;  2FCS A;  4JQW C;  3EHV A;  3ZTC A;  1U4A A;  2KJH B;  4EZL A;  3AXC A;  2JXX A;  5CHF A;  1KM7 A;  4II3 B;  3PRE A;  1K8R B;  2J0M A;  3P2B A;  1ZGU B;  2IY1 B;  4TV3 A;  3B0A A;  3NZS A;  5DPT A;  2KD0 A;  3ONS A;  2KOX A;  2MP2 A;  3SD5 A;  4HCN B;  3X23 A;  2KQS A;  5IAA C;  1WZ0 A;  3OLM D;  4KIK A;  1EF5 A;  1GG3 A;  3H7S A;  1OQY A;  2MBO A;  5TR5 A;  3R7R A;  3R66 C;  2PPH A;  2KFK A;  3IBE A;  2Z59 B;  4GU2 A;  3UIP B;  4ZRI A;  4BKS D;  3PVL A;  4NNJ B;  2NCN A;  4PS3 A;  3CST A;  4XZ4 A;  2V3S A;  5G2N A;  3RUL A;  3VTU A;  4FAD A;  2CR5 A;  3SU8 X;  4GDK B;  4PYZ A;  2ZPY A; 
#chains in the Genus database with same CATH topology
 4W9L A;  2WNM A;  5BYQ A;  2KMC A;  2D3A A;  2IY0 B;  3ZJT A;  4C4V B;  1NBF C;  2NR2 A;  3Q3J A;  3P4R B;  2KKC A;  3NHE B;  4WUR A;  1GOZ A;  4A9A A;  4FBJ B;  1WYG A;  2KFK B;  3KUD B;  2G4D B;  4C7Z A;  2BWE S;  5KHQ A;  1SJE D;  2GOW A;  1FEH A;  1R4N I;  1L0Y B;  2G3Q B;  4ZRQ A;  5I4D A;  3B9J A;  3U4E G;  2BS4 B;  2WYQ A;  5LNK 1;  1NI2 A;  2JWU A;  3KLS X;  2LHE A;  2FID A;  1YJ1 A;  2MBB B;  1P1A A;  2MWS B;  1WX9 A;  2L1A A;  4X57 B;  3O13 A;  4MM3 B;  1YD8 U;  1V81 A;  1WYW B;  2WXR A;  1WX7 A;  4B95 A;  4I6N B;  2KX0 A;  3DVN U;  2L83 A;  1RM6 C;  2O2V A;  4BBN C;  2D07 B;  1MPE A;  3RNG C;  3N3K B;  1V5O A;  3NZU A;  1FFV A;  2CHZ A;  3C19 A;  3A9J B;  4JWU C;  4ZRP A;  3AEF B;  3HVD A;  3SDL C;  1F0Z A;  3PV1 A;  3AUL A;  3PSE B;  5DPW A;  1TS5 A;  2D3C A;  2I1K A;  1L4D B;  1STE A;  4IKG A;  5AEK B;  2QJL A;  4A6Q A;  3DPD A;  3R8B A;  1IGD A;  3IAS 1;  1SB3 C;  5D7G A;  4GLS C;  2WXM A;  2BPS A;  1TT5 B;  2G1E A;  4W9C A;  1C76 A;  4TMA B;  1AWD A;  2D2Q A;  3BII D;  4HWI B;  4XWW A;  1SEB D;  4FJZ A;  1PYW D;  1WF9 A;  4HKQ A;  3HVZ A;  3DBR I;  5D2M B;  2AEH A;  4BKG A;  3PLU A;  2NPT A;  2L05 A;  2IO1 B;  1ET9 A;  2MLB A;  2N9P C;  1Q5W B;  4MAC A;  1L6U A;  2RGF A;  5GXG B;  5HHD G;  2NBW B;  2MP2 B;  2ON8 A;  2W9N A;  3P1M A;  2GBM A;  3PT2 B;  3V3X A;  1UEL A;  1N61 A;  1TZO A;  3EGR A;  2KZR A;  3T3O A;  4S0R A;  2L32 A;  1R4N B;  2Z0E B;  1P3Q U;  2M0A A;  3ZRF A;  2KDF B;  1T3Q A;  2KQ4 X;  2WU2 B;  5AZG A;  1YOV B;  2INC C;  4LCD E;  5L95 C;  1L0X B;  2LGD A;  2HE7 A;  1DGJ A;  2KDE B;  1FO4 A;  2L7R A;  4OVU A;  3W1S A;  2WDT B;  3RD2 A;  1WIA A;  1XCQ L;  3OWE B;  1Q1O A;  2JRH A;  2QHO A;  2ZVO A;  5G55 A;  4BKS A;  2IO3 B;  2M8S A;  4HDQ A;  3GP7 A;  4KVG B;  4MH0 E;  4GOC A;  4B0M A;  1KFY B;  4M8N A;  2CHX A;  2ZNV C;  1WXM A;  4HXD A;  3L10 B;  4DDI D;  1P0R A;  1QZE A;  1HTO A;  2IO0 B;  2CHW A;  2N9K A;  4I6L B;  4FUL A;  1E7U A;  1SSN A;  2O6V A;  1J8C A;  3FAH A;  3URY A;  2XNA C;  4ZRJ A;  2RMM A;  2LGX A;  2IYD B;  1V5T A;  2O2V B;  4KSK C;  2LI5 A;  1DOI A;  1YNT E;  2LGI A;  2G9H D;  2WXH A;  3DVG Y;  1JWS D;  3HRD D;  4GGQ A;  1MFW A;  1R4M I;  1UGJ A;  1A5R A;  4HRS A;  4XDD A;  1WX8 A;  1GPX A;  1WGH A;  3AE4 B;  4FHJ A;  2WX1 A;  2DNF A;  1MI0 A;  1XT9 B;  4KGT A;  3R7Q A;  3DCG A;  3ZIM A;  4AOF A;  1EF1 A;  3D32 A;  4KZC A;  2JQR B;  3LDZ E;  2K3U A;  1WXV A;  1WJ4 A;  4W9F A;  2I1J A;  3QQ8 B;  3W1S C;  2NBV B;  3AE8 B;  3OJ3 A;  3MTN B;  1K52 A;  1QOF A;  3PRM B;  1RFK A;  3Q14 C;  3AE2 B;  3TL5 A;  3WAL A;  2WXF A;  3A9K A;  1Z2M A;  3AU5 A;  3AM9 A;  4RMA A;  1MVK A;  3PO0 A;  3ZNG C;  4UDU C;  4MJS A;  4MEL A;  5E6P A;  2QMT A;  1G6J A;  4WJO A;  3L17 A;  2JF5 A;  3DHI C;  4BOZ B;  1C4C A;  3S2A A;  2QC8 A;  5HI1 A;  4US9 A;  2KMA A;  1JQ4 A;  2BWF A;  2LJI A;  3BVZ A;  3APC A;  2HDE A;  2LXA A;  1BT0 A;  4A55 A;  3UIO B;  1R7S A;  2JU6 X;  3DBS A;  3NUH B;  3VDZ A;  4IWP A;  3QWZ B;  1S1Q B;  1ZUD 2;  3H7P A;  3DHH C;  3VVW B;  3R2I A;  2PE6 B;  3CIR B;  1C4P A;  2D3B A;  5HFY A;  2CU1 A;  3P4S B;  2BYT A;  2MRP A;  3FKY A;  1FNV A;  2KLG A;  2ACZ B;  2VZK B;  1ROE A;  5EE9 A;  2SAK A;  3P4P B;  3PHW B;  3PZD A;  3VUY A;  2NBU A;  3QK0 A;  4P7I A;  2ZVN A;  2ZNV B;  4PS8 A;  2Y3A A;  1FD6 A;  4RCO A;  4L1B A;  5J18 A;  2DX5 B;  3H9D A;  1SIJ A;  4ICV A;  5E6O A;  1CZP A;  2PJH A;  2PMV A;  1YJJ A;  2MA9 B;  1FIQ A;  1WXA A;  2K8B A;  2LZ6 A;  3ZDM C;  1NI3 A;  4HPP A;  2QSD A;  3N1X C;  2VH1 A;  1ET6 A;  2AYO B;  1GC6 A;  1XQQ A;  3TCA A;  2H88 B;  2NS5 A;  2WS3 B;  2N9E B;  2MHJ A;  3MHZ A;  4N59 A;  3MJW A;  2UU7 A;  1XEE A;  1WY8 A;  4OVV A;  2XEW A;  4LNK A;  1V1P B;  4G3X B;  4NAW B;  1WGG A;  1NYR A;  3WIM A;  3U8Z A;  1QOA A;  3KW5 B;  2QCZ A;  2MJD A;  2PVG C;  2DZJ A;  4LNI A;  1XO3 A;  4P16 A;  2KJH B;  3AXC A;  2JXX A;  4II3 B;  3PRE A;  3P2B A;  2I2Y A;  5G5H A;  5DPT A;  3FC4 A;  4M0W A;  3VRA B;  1TYG B;  3H7S A;  2MBO A;  2YEP B;  5TR5 A;  4C00 A;  1CJE A;  2KFK A;  2Z59 B;  4KX6 B;  3IXS A;  4BKS D;  4NNJ B;  4XZ4 A;  2V3S A;  3VTU A;  5E6J A;  4FAD A;  2CR5 A;  4GDK B;  2ZPY A;  1E8W A;  1BUI C;  4WQO B;  2KDB A;  1LM8 B;  5AUK A;  2KXJ A;  2N1W A;  1TY2 A;  2GBK A;  3AE9 B;  1SE2 A;  1WM2 A;  3CF6 E;  3X0W A;  3FIL A;  1HZ6 A;  4RGO S;  1NVI D;  1TKE A;  3H7P B;  1RFA A;  2WXG A;  1FXA A;  4XX5 A;  3M62 B;  1GAQ B;  3QIJ A;  4BVU C;  5BYR A;  1EWY C;  2CJO A;  3TEW A;  2TSS A;  3RMK C;  4GB9 A;  3W9C B;  1J19 A;  4EZJ A;  5DCN A;  4JE3 B;  1E0Z A;  3VAW A;  3BK1 A;  1SE3 A;  2DWQ A;  3UQA A;  2ZCB A;  1UWM A;  2VH2 A;  5HKH A;  1D4B A;  1ZPS A;  3JVZ X;  4LJO B;  2WXI A;  4HEA 1;  1WR6 E;  5IO9 A;  2J0J A;  3ZKJ C;  3Q8E A;  2FCN A;  4C56 C;  2AX5 A;  2O6V D;  4W9I A;  4RF1 A;  4MSM B;  1K53 A;  4HK2 A;  4KIK B;  3WA0 A;  2WXL A;  1L4Z B;  3ZO5 B;  4AWJ A;  4RF0 A;  3PHX B;  4YTP B;  2KT7 A;  4HJG E;  4W9J A;  2JY6 A;  1KLU D;  2JZZ A;  3NVY A;  2LUM A;  3KH0 A;  4NJ7 A;  3W1Y A;  2IJ0 A;  1CQV A;  2G4S A;  3AN1 A;  2XBB C;  3DOW A;  4YSY B;  3KVF B;  3BY4 B;  1V9J A;  1JW9 D;  3ZTD A;  3ZJV A;  4TQ1 A;  4YSZ B;  1M4V A;  2L76 A;  1QF6 A;  4BBN F;  2BKF A;  1WGK A;  2DZI A;  2K1F A;  3ZDT A;  3O65 B;  2EMT A;  1MG8 A;  2BB5 A;  4IG7 B;  2AWT A;  4NJ6 A;  1YN4 A;  1UH6 A;  1E8Z A;  2K25 A;  2LUE A;  1IPG A;  2FBW B;  2ZZP B;  2L0F A;  2W3S A;  3DVN V;  1YX6 B;  1N60 A;  2ASQ A;  2IGD A;  3C0R B;  5MPO A;  3VHT C;  3AEE B;  1H8C A;  5AZH A;  4K7S A;  1XLN A;  4YSX B;  4FN2 A;  4KGS A;  1GC7 A;  2MEK A;  2JPH A;  2N4F A;  3TJP A;  5LXH A;  2K0P A;  1WGD A;  4N9F 4;  2OED A;  4MT5 A;  2OJW A;  4W9H A;  3QC8 B;  1GNU A;  1SJH D;  4DQO C;  2M4N A;  1VZ6 A;  2PEA A;  4HDO A;  4M01 A;  2DAJ A;  3N20 C;  3PLV A;  2LMC A;  5JZE B;  3PRZ A;  4WWO A;  5BMH A;  1IGC A;  2RDG A;  4AJY B;  3ETR A;  4E74 A;  4GMV A;  1J7B A;  2IZV B;  3MP9 A;  2NMQ A;  3DDC B;  3Q2A C;  1MJD A;  4K7W A;  1F77 A;  1MHH E;  4EFO A;  2BT6 A;  3M63 B;  3ZGZ A;  4LDT B;  4IM3 A;  4ARC A;  1WJN A;  2C7N B;  4OVZ A;  1VZ7 A;  1V6E A;  3JSV B;  4ZDV A;  1FXI A;  2BB6 A;  4KDL B;  4ANX A;  5CHW A;  1FRD A;  1V49 A;  4N6E B;  2UYZ B;  5BMI A;  1TS2 A;  1I4G A;  3WAN A;  1SF0 A;  5EE1 A;  2BS3 B;  2E6X A;  2HJ8 A;  3DQV A;  1J0G A;  2PLP A;  5AZF A;  1S3S G;  3I57 A;  2JX5 A;  3UI3 A;  4LNN A;  1N63 A;  4HVB A;  1D6E C;  3DBL B;  3DWG C;  3ZW3 A;  5FR6 A;  2JYT A;  3SHQ A;  1EWC A;  2GBN A;  1R4M B;  3MFG A;  2LGS A;  1QIL A;  1T0Q C;  5EDS A;  5G5G A;  4TKN A;  1C4A A;  3KYC D;  1KF6 B;  1E6E B;  4KKI A;  4USA A;  1OFF A;  5JXV A;  1QOG A;  4B9K A;  3KUZ A;  5H92 C;  2WP9 B;  1LFD A;  3Q3N C;  2WXK A;  4WIP A;  2IGH A;  3V6E B;  2V3N A;  4GDL B;  2DLB A;  2N7D A;  2C60 A;  4P6V F;  4RFB A;  2MBQ A;  4MDK E;  4EE2 A;  3BVG A;  2R2O A;  3P63 A;  1WM3 A;  1KTK A;  1IUE A;  2KC1 A;  2YLM A;  1WFY A;  2LXC A;  3PTF C;  4ZYN A;  2XK5 A;  3VQI A;  3KWL A;  4LNO A;  4E3C A;  1E10 A;  1V86 A;  4NAW A;  1PGX A;  2YVC A;  4RGT A;  3U7Z A;  3I5J C;  2DYO A;  3BK2 A;  3VXW A;  2QEJ C;  3ZQ4 A;  5FR3 A;  1N6Z A;  1E8Y A;  1RRB A;  1YMH E;  1GB1 A;  3IHP C;  2KAJ A;  2C7M B;  1TTN A;  4C4V A;  3QA8 A;  2WXP A;  5IOI A;  1TS3 A;  4IWQ A;  2PTL A;  5IN7 A;  4MEM A;  2L52 A;  2BYE A;  1OQR A;  2OJR A;  2WDV B;  2W55 A;  1XLQ A;  1E9M A;  1RLF A;  2FCM A;  2KN5 A;  1FM0 D;  1P98 A;  1JAL A;  3R2T A;  2JT4 B;  2R2Q A;  3T9L A;  2ZJD A;  2KJ6 A;  1NDD A;  4YTN B;  1Q0W B;  3T3N A;  1SXT A;  4W9D A;  3IFW B;  3BVM A;  3I3T B;  4DHZ E;  1C9F A;  5FKA C;  1YJI A;  4B6W A;  1L7Y A;  1UBQ A;  2CJN A;  3HM6 X;  1XF5 L;  3NVV A;  2QIL A;  1TGZ B;  1WMH B;  4CYE A;  1JRP A;  3OJ4 B;  2KAN A;  2FCS A;  2CU3 A;  2K22 A;  2NTT A;  4PT5 A;  1KM7 A;  1EU4 A;  5FK9 C;  2Y5C A;  2IY1 B;  2QDF A;  4TV3 A;  3B0A A;  2M56 B;  2MP2 A;  2KOX A;  3SD5 A;  3AE7 B;  2KQS A;  2INN E;  5IAA C;  1EF5 A;  1GG3 A;  1OQY A;  3DBR B;  2PPH A;  3IBE A;  3TEZ A;  3UIP B;  1N62 A;  4WWM A;  2EEL A;  1HQR D;  4C80 A;  3SU8 X;  4ITK A;  2KYW A;  4ZRK A;  4BZA A;  4I6P A;  1YIW A;  3P4Q B;  4ASW C;  1VDV A;  2V9H A;  3ZXR A;  3APD A;  3QAR A;  2LRU A;  4AS1 A;  1XCT L;  2DZK A;  3H8H A;  3V6C B;  3UGB B;  4E71 A;  1VRA B;  4A20 A;  3UF8 A;  3E9S A;  4DXA B;  4GDK A;  4OZA A;  1ZDV A;  1JML A;  4RH6 A;  3ZJU A;  1N5X A;  2HJ1 A;  3U52 E;  3CSF A;  3RNC C;  1MG4 A;  4IWO A;  2WHI A;  3H6N A;  4N58 A;  4J6I A;  2RPQ A;  4YL8 A;  2BS2 B;  3TSS A;  2Z8L A;  2W3R A;  1ZW7 A;  3Q8A A;  2K5P A;  4CQN A;  1LQB A;  3RCZ A;  3H1U A;  2MQJ A;  3RN9 C;  3NVZ A;  3VUX A;  4NAM A;  1GUA B;  1D5X C;  2AL6 A;  3KWV A;  2KO3 A;  5C3J B;  2L0T A;  2R61 A;  4XDC A;  4II2 B;  4ACF A;  1VR9 A;  4IM2 A;  1XD3 B;  1I4X A;  2MW5 A;  3NOB A;  1F52 A;  2WXQ A;  2PKO A;  2Y5B B;  3NY5 A;  4RGM A;  5TSS A;  4FA6 A;  1IBX A;  2V0G A;  4NQK E;  5GMV A;  2M17 A;  2KTR A;  1VCB A;  3KUC B;  4DXG A;  1ZDX A;  2DYM A;  2NTS A;  4GIV A;  4JL9 A;  2KN4 A;  5HG2 A;  4H2A A;  3PGE A;  2WQY B;  4IW0 A;  4D2K A;  1KRH A;  2KDI A;  4QAY A;  2KWU B;  2OHF A;  3LJ3 A;  4ICU A;  3ECI A;  3NZ3 A;  5J2R A;  4KSL C;  1SGH A;  3RI7 C;  1F1H A;  3PS6 A;  4US8 A;  2H89 B;  3NS8 A;  1TY0 A;  2LD9 A;  4XWT A;  1RYJ A;  4AP4 C;  2LVQ A;  2KC2 A;  2GBR A;  1ACC A;  4AUQ C;  2WDQ B;  2FCQ A;  3PPA A;  4XYC A;  4F7Z A;  5DPR A;  3IVF A;  1NEK B;  4GXB A;  1FCC C;  1IP9 A;  1QLB B;  1D5Z C;  4WWN A;  2NVU I;  4ANW A;  1LXD A;  2DHZ A;  1AAR A;  2AQ2 B;  1AW7 A;  3C8Y A;  2JSV X;  4WAF A;  2ONQ A;  2ZW1 A;  2J4X A;  4K7U A;  4RM8 A;  1SIF A;  4GSW A;  2J52 A;  2RD0 A;  4WJQ A;  2RDH A;  3A1Q B;  4A3O A;  4EEW A;  2SEB D;  3ZYY X;  3EEC A;  2QIE B;  3L54 A;  3ALB A;  1WRI A;  2D5G A;  4EZK A;  2PIA A;  2LVP A;  4K1R B;  2INP E;  1WE7 A;  4BOS C;  4W9G A;  1M94 A;  5C1Z A;  4BKT A;  1WH3 A;  3GB1 A;  4PYU A;  3UQB A;  4DXF A;  2ZW0 A;  3VTV A;  3HM3 A;  4XE0 A;  1PFD A;  2N9L A;  3N1Y C;  4M0W B;  3U2S C;  1EM7 A;  3GZN I;  4IDI A;  1ZOY B;  3TIX A;  1XLP A;  1FCL A;  2PE9 A;  5JHA A;  3AEB B;  4F1S A;  1WI0 A;  1TKY A;  2G45 B;  2YEP F;  1UD7 A;  1TIF A;  3AH7 A;  3KQ4 A;  1WWT A;  3Q3F A;  4MGK E;  3WAO A;  1JWA D;  2LWP A;  4FLH A;  1VJK A;  1V8C A;  4CO7 A;  3Q8B A;  3V05 A;  2AQ3 B;  2MJE A;  1WGR A;  3ENE A;  1JRO A;  3ZXV A;  1MHX A;  2K6D B;  3DBL I;  1ENF A;  4MM3 A;  1UWX A;  1CMX B;  3U7D A;  3MC8 A;  2AL3 A;  2ICI A;  4YT0 B;  1HXY D;  3Q6B A;  4XC2 A;  1YX5 B;  1YQB A;  2GI9 A;  4MGZ E;  1V80 A;  4JLC A;  2KK8 A;  4MGY E;  2J0K A;  4ARI A;  3UIN B;  2MBE A;  4A3P A;  2KJR A;  2JRI B;  4IOI E;  4HJK A;  1SBB B;  1V1P A;  3DHG C;  1JWB D;  3AE5 B;  1PDX A;  3ZUN A;  3R3M A;  1VD2 A;  3MHS D;  1ZE3 D;  3W5V B;  1Q10 A;  3I63 C;  1KLG D;  4O1N A;  2IO2 B;  3MC0 B;  1ZXI A;  3DVG X;  1HTQ A;  3NS1 A;  2WU5 B;  1I7H A;  2EKI A;  3HK0 A;  3DBH B;  2DYB A;  2ZCC A;  2FAZ A;  3TEX A;  2PW9 A;  1D5M C;  1YQ3 B;  2WX0 A;  4YTM B;  3IT6 B;  4BAX A;  2N1V A;  1VLB A;  1ZKH A;  2MCN B;  3V60 A;  2D10 A;  4KDI C;  3K9O B;  3RNE C;  2WDR B;  2IBI B;  2BYV E;  2KWD A;  1K50 A;  5D6J B;  4JIO U;  4NY0 A;  3ZRC A;  1IBX B;  2FIF A;  3AB5 A;  4RM9 A;  5C23 A;  2LGY A;  1DYQ A;  2PVO D;  2Y5P A;  1NEN B;  3M95 A;  4WQM A;  3B1L X;  4OZB A;  4DHJ B;  2KMM A;  4P1B C;  4G0N B;  5EE3 A;  1KH0 A;  5D94 A;  2C5L C;  1GB4 A;  1OQQ A;  1OEY J;  2BVC A;  3GE3 C;  4JX1 C;  2LAS A;  3TUO A;  1E7P B;  3GE8 C;  1E90 A;  4K81 A;  3AU4 A;  2L8J A;  1OTR B;  1BXT A;  2HTM E;  3VH4 B;  1YQ4 B;  3W5U B;  4DK5 A;  2GB1 A;  3ZVV A;  1JWU D;  2WLB A;  1GJZ A;  1WSP A;  2M0X A;  2KTR B;  2FUH B;  1HA5 A;  5D3D A;  1T0R C;  2I38 A;  3EFC A;  5LLI A;  2BBC A;  3BIN A;  2MX2 A;  2K39 A;  5BO4 B;  3AI5 A;  2AQ1 B;  1XLO A;  1WXS A;  1F2R I;  3A9J A;  2D3G A;  2KVR A;  1C79 A;  3RT3 B;  3CWI A;  2CS4 A;  5KHO A;  1AN8 A;  3AE1 B;  3QJZ A;  4EOY A;  1Y8R C;  4WJN A;  4ANV A;  3SFD B;  5JH5 C;  2NPT B;  4PS7 A;  3WAP A;  1SE9 A;  4FHK A;  4W9K A;  3T8M A;  4ZYS A;  1P7E A;  1I4H A;  4RNA A;  1QOB A;  3VUW A;  1KOT A;  1V2Y A;  2WXO A;  2K6Q A;  3EHV A;  3ZTC A;  1U4A A;  3BWU D;  3RNB C;  4EZL A;  1JWM D;  5CHF A;  4L23 A;  2MJ3 A;  1QKZ A;  1K8R B;  2IGG A;  2KD0 A;  3ONS A;  4HCN B;  3Q3O C;  3X23 A;  4KIK A;  3R66 C;  3IAM 1;  4GU2 A;  3CST A;  5G2N A;  4PYZ A;  1E5W A;  1SE4 A;  4G50 A;  5T8I A;  1I42 A;  4C7Y A;  2BQQ A;  3E56 A;  4URK A;  4HKZ E;  3L08 A;  2C9W B;  3IT4 B;  1F2R C;  4J3O D;  2CKH B;  2RDB C;  1I4R A;  2OOB B;  2M19 A;  3AEC B;  4NZL B;  3RNF C;  1PUT A;  3L0W B;  3K9P B;  2MSE D;  1ISN A;  1E8X A;  1WR1 A;  2EKE C;  2GMI C;  2B3A A;  3ML8 A;  3SFE B;  1IYF A;  1P9D U;  2KWV B;  1FNU A;  4JGH B;  3RZF A;  1C1Y B;  4G11 A;  3ZNH B;  3TEY A;  3EA6 A;  3LXF A;  4TUU A;  3B2F A;  4W9E A;  2KDM A;  2DZM A;  1T0S C;  4MJS B;  2JZP A;  4LLG M;  4GDL A;  2BKR B;  3NG0 A;  5DPS A;  3FIL B;  3N32 A;  2X38 A;  2HD5 B;  4B0E A;  2WGS A;  5LXI B;  1HEZ E;  3EC8 A;  4R3D A;  1Y56 A;  3PRP B;  3A1Q A;  3APF A;  4GN1 A;  4LJP B;  4XGA B;  2JWZ A;  2DEN B;  2RPV A;  2V1Y A;  3NRZ A;  2A4Z A;  2KQ7 A;  1H4R A;  5CTR C;  4MH8 A;  4WWP A;  5L83 A;  2J42 A;  2DAF A;  5JHB A;  2JYE A;  5H8Y E;  2Q5W D;  1PQS A;  2WXJ A;  2BW2 A;  2DBY A;  4FXC A;  1WZ3 A;  3OG5 A;  3AED B;  2EMS A;  3L13 A;  4HPM B;  3RFZ B;  4DBG A;  4DHZ B;  1TJE A;  4MGI E;  2K8H A;  1WGY A;  1FFU A;  2RSU A;  3A9K B;  2IDY A;  2MBH A;  5IP4 D;  5AUI A;  1D3Z A;  1C77 A;  1UBI A;  4DWF A;  3JSV A;  1TZ1 A;  4MSQ B;  4HRO A;  2UWQ A;  4REZ A;  3AEG B;  3WAM A;  2KAC A;  5J17 A;  4A8X C;  3AEA B;  1TS4 A;  2FE8 A;  3ZNZ B;  1JRU A;  3A4R A;  2V4L A;  2LJ5 A;  2M1M A;  2LFI A;  1L6V A;  3NVW A;  4TSS A;  1LGR A;  2WWZ A;  5E6N A;  1L5P A;  2D11 A;  1DOY A;  4CHK A;  3KYD D;  5IA7 A;  1AYF A;  1VZ8 A;  3IG3 A;  4KV2 A;  3GOE A;  4DHJ D;  5D3I B;  3WCQ A;  4K3B A;  3RNA C;  4Q2J A;  4ZOH C;  2Z0D B;  1WE6 A;  2N7J A;  3N30 A;  2BF8 B;  1WXQ A;  5CX3 A;  2FNJ B;  2JXT A;  4WH4 A;  4HCP B;  3U30 A;  3RPF C;  1YN5 A;  4JWS C;  3LB8 C;  4KZ0 A;  3CMM B;  3JYU A;  3P42 A;  2C7H A;  2KTF A;  2KFJ A;  3L16 A;  4FJY A;  4DDG D;  1X1M A;  1HZ5 A;  2BYF A;  3VFK A;  1QQR A;  2BGF A;  4FJV B;  5C2T B;  3MC9 A;  1DOX A;  1WJU A;  3NJT A;  2JZ3 B;  3QHT A;  3RUI B;  2N0S B;  1HE8 A;  1CK1 A;  1PGA A;  3I9V 1;  1T5X D;  1B9R A;  1ZP0 B;  3RYT A;  4NPN A;  1P7F A;  2KNB A;  3Q3M C;  4M02 A;  4EUT A;  1I35 A;  1XXG A;  3AV8 A;  4KGR A;  3EUB 2;  4ZHO A;  2KWC A;  3VR9 B;  3ZLZ A;  4BFR A;  3VR8 B;  2L3Z A;  4WAA A;  3VRB B;  3RZW C;  2LRW A;  2KHW B;  1WJ6 A;  4YXD B;  2GLS A;  1E7V A;  3BZD B;  3ML9 A;  3Q8C A;  4LNF A;  2RR9 A;  2N7E A;  4LDT D;  3L4P A;  3VH3 B;  3PZ8 A;  2KVZ A;  2GRI A;  1N5W A;  3V61 A;  4F8C B;  4HLE A;  1J7A A;  4TQ0 A;  4JPS A;  1EUV B;  1PGB A;  1UNS A;  4PK1 A;  2L00 B;  1I4Q A;  2LEK A;  5BMG A;  1FMA D;  3VTW A;  2JUO A;  3QCA A;  2W82 A;  2V4I B;  2XK5 B;  1V1O A;  3J9C A;  3A4S C;  3EFU A;  3A33 B;  4OZC A;  1JCK B;  4AJW A;  2KX3 A;  4RGN A;  4LK0 M;  4IC7 B;  1EO6 A;  3B2G A;  4P1C C;  4ANU A;  4S17 A;  3V62 A;  3HUI A;  3HHM A;  1TBE A;  2XN9 C;  1C3T A;  1T0Y A;  2K9X A;  3Q8F A;  2VZK D;  1ZXH A;  2VRR B;  4A90 A;  1UZX B;  4L2Y A;  3AE3 B;  1FPY A;  3GZN B;  3OAW A;  2ZEQ A;  4IUM B;  1FNW A;  4WJP A;  1V97 A;  2LHD A;  1KLV A;  1UGM A;  1UF0 A;  3M3J A;  1OEY A;  1I4P A;  4ZHP A;  2J53 A;  2A5U A;  4HPL B;  3ABV B;  4K3C A;  1LO5 D;  5BYS A;  2FUG 1;  1Z5S B;  4NJC A;  3GS2 A;  3BYT B;  4LTU A;  4M00 A;  4M8M A;  5CHV C;  4EKU A;  2JVC A;  3B08 A;  3LYY A;  4NQL B;  2N9X A;  4OHJ A;  2WXN A;  1UUP A;  2REX A;  3TMP B;  4IM0 A;  2J7Q B;  2O6V B;  3JW0 X;  1T6B X;  1TKG A;  4KKJ A;  1EU3 A;  1L2N A;  1WRD B;  1BML C;  2B76 B;  2K8C A;  3PZ7 A;  3DWM A;  1C78 A;  1F9J A;  1KJT A;  1WMH A;  2LVO A;  3SR6 A;  3QX1 A;  1FXT B;  5IKC M;  1J7C A;  4OW0 A;  3TBL D;  1QT9 A;  2GBJ A;  3AE6 B;  3N1Z C;  2HTH A;  3W2D A;  2E3T A;  3AMZ A;  3QAQ A;  1ESF A;  1RAX A;  1B1Z A;  3SEB A;  3DBH I;  3HIZ A;  3ZNI D;  2W54 A;  2X8X X;  1OGW A;  2IPK D;  1RWS A;  5EE0 A;  4AQ7 A;  2MH7 A;  1K51 A;  2ZPN A;  3N9Y C;  1FRR A;  2KLC A;  4YWG G;  4JQW C;  2V3P A;  1L0V B;  3Q69 A;  1YN3 A;  2BTE A;  2J0M A;  3BYY B;  1ZGU B;  3NZS A;  1WZ0 A;  3OLM D;  1A70 A;  3R7R A;  4ZRI A;  3MJ5 A;  3PVL A;  2NCN A;  4PS3 A;  2IND C;  3RUL A;  1NYQ A; 
#chains in the Genus database with same CATH homology
 4ZRK A;  4W9L A;  4I6P A;  1YIW A;  1E8W A;  1E5W A;  4G50 A;  4ASW C;  1I42 A;  4WQO B;  2KDB A;  1LM8 B;  2KMC A;  2IY0 B;  4URK A;  2KXJ A;  3APD A;  2N1W A;  3L08 A;  2C9W B;  1NBF C;  2GBK A;  3QAR A;  2LRU A;  2NR2 A;  3Q3J A;  2DZK A;  1WM2 A;  2KKC A;  3CF6 E;  2CKH B;  3NHE B;  3V6C B;  3UGB B;  3X0W A;  2OOB B;  4FBJ B;  4E71 A;  4A20 A;  2KFK B;  3KUD B;  2G4D B;  3UF8 A;  4DXA B;  2BWE S;  5KHQ A;  3L0W B;  2GOW A;  4GDK A;  1R4N I;  3K9P B;  2MSE D;  3H7P B;  2G3Q B;  1RFA A;  1ISN A;  1E8X A;  1WR1 A;  2EKE C;  3CSF A;  2GMI C;  4XX5 A;  2B3A A;  3ML8 A;  3M62 B;  1IYF A;  4IWO A;  1P9D U;  2KWV B;  3H6N A;  2WYQ A;  3QIJ A;  4JGH B;  2RPQ A;  4J6I A;  4BVU C;  4YL8 A;  1NI2 A;  1ZW7 A;  2FID A;  3RZF A;  1C1Y B;  4G11 A;  3ZNH B;  1YJ1 A;  2MBB B;  4GB9 A;  1LQB A;  1P1A A;  4TUU A;  1J19 A;  4EZJ A;  3RCZ A;  5DCN A;  4W9E A;  2MWS B;  2DZM A;  3H1U A;  1WX9 A;  2MQJ A;  4MJS B;  4GDL A;  3VAW A;  2BKR B;  4X57 B;  5DPS A;  3UQA A;  2ZCB A;  3N32 A;  1YD8 U;  1V81 A;  2HD5 B;  3VUX A;  5LXI B;  1GUA B;  1WYW B;  5HKH A;  3EC8 A;  4LJO B;  3JVZ X;  1WX7 A;  4B95 A;  2AL6 A;  4I6N B;  2KX0 A;  2KO3 A;  3DVN U;  3PRP B;  2L0T A;  1WR6 E;  3A1Q A;  2J0J A;  3APF A;  4GN1 A;  4LJP B;  4II2 B;  3ZKJ C;  2JWZ A;  2DEN B;  2V1Y A;  2O2V A;  2A4Z A;  2FCN A;  2KQ7 A;  1H4R A;  4IM2 A;  1XD3 B;  2D07 B;  2MW5 A;  2O6V D;  4BBN C;  4W9I A;  5CTR C;  3NOB A;  4WWP A;  3N3K B;  5L83 A;  1V5O A;  3NZU A;  2DAF A;  5JHB A;  2CHZ A;  2Y5B B;  3NY5 A;  1PQS A;  4MSM B;  3A9J B;  4HK2 A;  4KIK B;  3WA0 A;  3ZO5 B;  4AWJ A;  4FA6 A;  1WZ3 A;  3PHX B;  3SDL C;  4NQK E;  4W9J A;  2EMS A;  3PV1 A;  3AUL A;  2JY6 A;  2JZZ A;  3L13 A;  3PSE B;  5GMV A;  2M17 A;  2KTR A;  3KH0 A;  4HPM B;  5DPW A;  1VCB A;  3KUC B;  4DBG A;  4NJ7 A;  2I1K A;  4DHZ B;  3W1Y A;  5AEK B;  4MGI E;  2G4S A;  2DYM A;  3DPD A;  4GIV A;  2XBB C;  2K8H A;  4JL9 A;  1WGY A;  3DOW A;  5D7G A;  3PGE A;  3KVF B;  2RSU A;  3BY4 B;  1V9J A;  4IW0 A;  3ZTD A;  3A9K B;  4TQ1 A;  2KDI A;  2BPS A;  2KWU B;  4W9C A;  2L76 A;  3LJ3 A;  4ICU A;  3ECI A;  2MBH A;  4BBN F;  2BKF A;  2D2Q A;  4HWI B;  1D3Z A;  2DZI A;  5J2R A;  2K1F A;  4FJZ A;  3ZDT A;  3O65 B;  4KSL C;  1UBI A;  4DWF A;  3JSV A;  2EMT A;  1SGH A;  1WF9 A;  1MG8 A;  1TZ1 A;  4MSQ B;  2UWQ A;  3DBR I;  4IG7 B;  2AWT A;  4NJ6 A;  5D2M B;  3WAM A;  3PS6 A;  5J17 A;  2AEH A;  4BKG A;  3NS8 A;  3PLU A;  2NPT A;  1UH6 A;  2IO1 B;  1E8Z A;  2L05 A;  2K25 A;  2LUE A;  2LD9 A;  2MLB A;  3ZNZ B;  2N9P C;  1JRU A;  1IPG A;  1Q5W B;  2RGF A;  2ZZP B;  4AP4 C;  2LVQ A;  2KC2 A;  3A4R A;  2L0F A;  2V4L A;  2GBR A;  2LJ5 A;  2M1M A;  2NBW B;  3DVN V;  2MP2 B;  4AUQ C;  1YX6 B;  2W9N A;  2FCQ A;  3PPA A;  2WWZ A;  4F7Z A;  2GBM A;  5E6N A;  2D11 A;  3PT2 B;  5DPR A;  3IVF A;  1UEL A;  2ASQ A;  4GXB A;  3C0R B;  4CHK A;  3KYD D;  5IA7 A;  2KZR A;  3IG3 A;  4KV2 A;  1IP9 A;  3VHT C;  4WWN A;  2NVU I;  2Z0E B;  4ANW A;  3GOE A;  1LXD A;  2DHZ A;  1AAR A;  5AZH A;  4DHJ D;  1H8C A;  1P3Q U;  3ZRF A;  2KDF B;  4K7S A;  2Z0D B;  5AZG A;  1WE6 A;  4K7U A;  3N30 A;  4RM8 A;  4FN2 A;  2BF8 B;  5CX3 A;  1GC7 A;  1SIF A;  2FNJ B;  4GSW A;  4LCD E;  2RD0 A;  5L95 C;  2LGD A;  4WJQ A;  2HE7 A;  2KDE B;  2JPH A;  3A1Q B;  2L7R A;  4A3O A;  4OVU A;  2N4F A;  3W1S A;  2WDT B;  3RD2 A;  3TJP A;  4HCP B;  4EEW A;  5LXH A;  1WIA A;  1Q1O A;  3EEC A;  1WGD A;  4N9F 4;  2JRH A;  2QHO A;  2ZVO A;  3ALB A;  3L54 A;  3U30 A;  5G55 A;  4W9H A;  4BKS A;  4EZK A;  2LVP A;  3QC8 B;  1GNU A;  2IO3 B;  4KZ0 A;  4K1R B;  2M8S A;  1WE7 A;  4BOS C;  4W9G A;  1M94 A;  5C1Z A;  4HDQ A;  2M4N A;  3CMM B;  4BKT A;  3JYU A;  1WH3 A;  2C7H A;  2PEA A;  2KTF A;  2KFJ A;  4PYU A;  3UQB A;  3L16 A;  4FJY A;  4HDO A;  3VTV A;  3HM3 A;  4DDG D;  4KVG B;  1X1M A;  4M0W B;  4MH0 E;  2DAJ A;  4GOC A;  2BYF A;  3VFK A;  4M8N A;  2CHX A;  3GZN I;  2BGF A;  2ZNV C;  3PLV A;  3TIX A;  1WXM A;  5JZE B;  3PRZ A;  4WWO A;  2PE9 A;  4AJY B;  4FJV B;  4HXD A;  3L10 B;  4DDI D;  1P0R A;  5JHA A;  1QZE A;  4E74 A;  4F1S A;  2IO0 B;  2IZV B;  4GMV A;  1WI0 A;  2CHW A;  2G45 B;  3DDC B;  4I6L B;  1UD7 A;  4FUL A;  1E7U A;  4K7W A;  1WJU A;  2JZ3 B;  3QHT A;  4EFO A;  3Q3F A;  3M63 B;  3RUI B;  4LDT B;  4MGK E;  1HE8 A;  3WAO A;  2LWP A;  2O6V A;  4FLH A;  4IM3 A;  1J8C A;  4CO7 A;  1WJN A;  3RYT A;  2C7N B;  3ENE A;  1V6E A;  1WGR A;  4NPN A;  3JSV B;  4ZRJ A;  4ZDV A;  2LGX A;  2KNB A;  2IYD B;  1V5T A;  2O2V B;  2K6D B;  4KDL B;  4KSK C;  4ANX A;  4EUT A;  2LI5 A;  1I35 A;  3DBL I;  5CHW A;  4MM3 A;  1V49 A;  2UYZ B;  1CMX B;  3U7D A;  3WAN A;  3DVG Y;  2KWC A;  2AL3 A;  3ZLZ A;  4GGQ A;  4BFR A;  4XC2 A;  1YX5 B;  2L3Z A;  4WAA A;  1R4M I;  3RZW C;  2LRW A;  1A5R A;  1YQB A;  1WJ6 A;  2HJ8 A;  2KHW B;  3DQV A;  1J0G A;  5AZF A;  1S3S G;  1WX8 A;  4MGZ E;  1E7V A;  4HVB A;  1V80 A;  1WGH A;  3ML9 A;  2KK8 A;  4JLC A;  4FHJ A;  4MGY E;  2WX1 A;  2J0K A;  1XT9 B;  3UIN B;  2MBE A;  2RR9 A;  4A3P A;  3R7Q A;  2KJR A;  3DCG A;  3ZIM A;  2N7E A;  4LDT D;  3VH3 B;  3ZW3 A;  5FR6 A;  2JRI B;  4AOF A;  1EF1 A;  3SHQ A;  3D32 A;  4HJK A;  3V61 A;  4F8C B;  3ZUN A;  3R3M A;  2GBN A;  4KZC A;  4HLE A;  1VD2 A;  3LDZ E;  3MHS D;  4TQ0 A;  1WXV A;  1WJ4 A;  1EUV B;  4W9F A;  2I1J A;  3QQ8 B;  3W1S C;  2NBV B;  5EDS A;  3OJ3 A;  2L00 B;  4TKN A;  3MTN B;  3KYC D;  3VTW A;  2JUO A;  3QCA A;  2IO2 B;  3PRM B;  3TL5 A;  3DVG X;  3WAL A;  3A9K A;  4B9K A;  3KUZ A;  2XK5 B;  1Z2M A;  1LFD A;  3AU5 A;  3HK0 A;  3A4S C;  3EFU A;  3A33 B;  4RMA A;  2DYB A;  4AJW A;  2KX3 A;  2ZCC A;  2FAZ A;  3ZNG C;  4MJS A;  4MEL A;  5E6P A;  3V6E B;  2WX0 A;  4GDL B;  1G6J A;  4WJO A;  4IC7 B;  1EO6 A;  4ANU A;  3L17 A;  2JF5 A;  2N1V A;  2N7D A;  3V62 A;  3HHM A;  4BOZ B;  1TBE A;  1ZKH A;  1C3T A;  1T0Y A;  2MCN B;  3V60 A;  2C60 A;  2D10 A;  4KDI C;  3K9O B;  2VRR B;  2IBI B;  1UZX B;  2BYV E;  2MBQ A;  4MDK E;  3S2A A;  3OAW A;  2R2O A;  2ZEQ A;  2KMA A;  2BWF A;  5D6J B;  1WM3 A;  4IUM B;  4JIO U;  4NY0 A;  3ZRC A;  4WJP A;  2FIF A;  5C23 A;  4RM9 A;  3APC A;  2LGY A;  1KLV A;  1UGM A;  2KC1 A;  2YLM A;  2LXA A;  3M3J A;  1BT0 A;  1WFY A;  1OEY A;  2LXC A;  3PTF C;  3UIO B;  3M95 A;  2A5U A;  4ZYN A;  2XK5 A;  3B1L X;  4DHJ B;  3DBS A;  3VQI A;  4HPL B;  4G0N B;  3VDZ A;  4E3C A;  4IWP A;  5D94 A;  3QWZ B;  1S1Q B;  1V86 A;  1Z5S B;  3H7P A;  4NAW A;  3VVW B;  2PE6 B;  2C5L C;  2YVC A;  1OEY J;  2LAS A;  2DYO A;  2CU1 A;  1E90 A;  3VXW A;  4K81 A;  2MRP A;  3AU4 A;  4M8M A;  5CHV C;  4EKU A;  2KLG A;  2L8J A;  1OTR B;  1E8Y A;  1RRB A;  3VH4 B;  2JVC A;  3IHP C;  3B08 A;  4DK5 A;  4NQL B;  3ZVV A;  2C7M B;  2N9X A;  3PHW B;  1GJZ A;  3PZD A;  2REX A;  3VUY A;  1TTN A;  2NBU A;  2M0X A;  3QA8 A;  4IM0 A;  2KTR B;  3TMP B;  2FUH B;  2J7Q B;  3QK0 A;  2O6V B;  3JW0 X;  4P7I A;  2ZVN A;  2ZNV B;  4PS8 A;  1L2N A;  1WRD B;  5LLI A;  5J18 A;  2K8C A;  2DX5 B;  4IWQ A;  3H9D A;  1F9J A;  1WMH A;  1KJT A;  3BIN A;  4ICV A;  5E6O A;  2LVO A;  2MX2 A;  2K39 A;  4MEM A;  3AI5 A;  2BYE A;  5BO4 B;  2PJH A;  3QX1 A;  2OJR A;  1FXT B;  1WXS A;  1RLF A;  2FCM A;  2MA9 B;  2KN5 A;  2K8B A;  1WXA A;  3A9J A;  2LZ6 A;  2D3G A;  2KVR A;  1P98 A;  3TBL D;  3ZDM C;  3RT3 B;  2GBJ A;  2CS4 A;  2JT4 B;  2AYO B;  5KHO A;  2R2Q A;  1GC6 A;  1XQQ A;  2HTH A;  2ZJD A;  3T9L A;  2KJ6 A;  2NS5 A;  3TCA A;  1NDD A;  2N9E B;  3QAQ A;  3QJZ A;  1Q0W B;  4EOY A;  1Y8R C;  4WJN A;  3MJW A;  4ANV A;  1RAX A;  4W9D A;  5JH5 C;  1WY8 A;  3IFW B;  2NPT B;  4PS7 A;  4OVV A;  2XEW A;  3I3T B;  3WAP A;  3DBH I;  1SE9 A;  3HIZ A;  4DHZ E;  3ZNI D;  4G3X B;  4NAW B;  1WGG A;  4FHK A;  4W9K A;  3T8M A;  1OGW A;  4B6W A;  1L7Y A;  3WIM A;  1UBQ A;  3U8Z A;  3KW5 B;  3HM6 X;  3VUW A;  1KOT A;  2ZPN A;  1TGZ B;  2KLC A;  1V2Y A;  1WMH B;  2K6Q A;  4CYE A;  2DZJ A;  2KAN A;  3OJ4 B;  2FCS A;  4JQW C;  3EHV A;  3ZTC A;  1U4A A;  2KJH B;  4EZL A;  3AXC A;  2JXX A;  5CHF A;  1KM7 A;  4II3 B;  3PRE A;  1K8R B;  2J0M A;  3P2B A;  1ZGU B;  2IY1 B;  4TV3 A;  3B0A A;  3NZS A;  5DPT A;  2KD0 A;  3ONS A;  2KOX A;  2MP2 A;  3SD5 A;  4HCN B;  3X23 A;  2KQS A;  5IAA C;  1WZ0 A;  3OLM D;  4KIK A;  1EF5 A;  1GG3 A;  3H7S A;  1OQY A;  2MBO A;  5TR5 A;  3R7R A;  3R66 C;  2PPH A;  2KFK A;  3IBE A;  2Z59 B;  4GU2 A;  3UIP B;  4ZRI A;  4BKS D;  3PVL A;  4NNJ B;  2NCN A;  4PS3 A;  3CST A;  4XZ4 A;  2V3S A;  5G2N A;  3RUL A;  3VTU A;  4FAD A;  2CR5 A;  3SU8 X;  4GDK B;  4PYZ A;  2ZPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...