3B0AA

Crystal structure of the mouse hoil1-l-nzf in complex with linear di-ubiquitin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific recognition of linear ubiquitin chains by the Npl4 zinc finger (NZF) domain of the HOIL-1L subunit of the linear ubiquitin chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/metal binding protein
molecule keywords Polyubiquitin-C
total genus 43
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b0aA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b0aA02
2RSUA 3PZDA 1R4MI 3ECIA 3ZDTA 4ANWA 2J0JA 4RM9A 4DDID 1WZ0A 3VDZA 2BWES 4F8CB 2BKRB 4EZLA 5CHFA 1WH3A 3PSEB 2IO0B 2JF5A 4AUQC 3ZLZA 4HVBA 1LFDA 3O65B 1RRBA 2J7QB 1WE6A 3RT3B 4OVUA 2KDFB 3ZRFA 4J6IA 3OJ4B 4FA6A 1RLFA 2HJ8A 1H8CA 3ZTDA 2NBWB 3TIXA 4PS3A 4WJOA 3PRZA 3ZDMC 1WIAA 3DBRI 4PYZA 2R2OA 4HPLB 4KVGB 3D32A 1UBQA 2K8CA 3A1QB 4MDKE 2G45B 5JH5C 4DXAB 2UWQA 3RZFA 2C7MB 2ZNVB 2XK5B 4I6LB 2KDEB 4NNJB 1V81A 1C1YB 1LQBA 3QCAA 2FCQA 2ZVNA 4BKGA 3UIPB 1WX9A 2KFJA 2KLCA 3NOBA 5LXHA 2KMAA 3DCGA 3L54A 1ZGUB 4W9JA 1GC7A 4W9DA 1TGZB 3V6CB 3PLVA 1V5OA 4A3PA 2FNJB 4ZDVA 1WYWB 5DPSA 3ML9A 1KJTA 2HD5B 3GOEA 2MCNB 3QK0A 1TTNA 4ASWC 4HXDA 3OJ3A 2KC2A 1E7VA 3PREA 3X0WA 3P2BA 4NAWB 5C1ZA 4HCNB 2IY1B 3QIJA 4XC2A 1H4RA 3N30A 3TBLD 1V5TA 2L00B 3V61A 4KDLB 2FIDA 1WXMA 2HTHA 4JL9A 4ICVA 3MTNB 4G3XB 2L3ZA 3S2AA 3H6NA 2KJRA 4MSQB 4W9LA 1YQBA 5CTRC 5E6PA 2K8HA 3DOWA 3M62B 3KUZA 2G4SA 3ONSA 3QWZB 5KHQA 2MSED 4IWQA 4DDGD 4ANVA 4EZKA 2KX3A 2DENB 3HIZA 3HM3A 3AI5A 4BOSC 2IZVB 2J0KA 4LDTB 1WGGA 5CX3A 2PE6B 3DQVA 3U30A 2V3SA 4ZRIA 4CYEA 4G50A 2MWSB 4DWFA 1Z2MA 4IUMB 1D3ZA 3Q3JA 2MBQA 4CO7A 2CS4A 2I1JA 3EHVA 4HPMB 1IP9A 3VUXA 2O2VA 1WGDA 2FAZA 2KNBA 1L2NA 2LI5A 2CU1A 5LXIB 2XEWA 3VVWB 2LGYA 4RM8A 3A9KA 3VXWA 5J18A 2N9XA 2NCNA 4HK2A 2N4FA 4AOFA 4TQ0A 2BF8B 3JYUA 3R3MA 2OJRA 3OAWA 2DX5B 2JXXA 4K1RB 1RAXA 3APDA 4HDOA 2KVRA 1WGRA 1WZ3A 2LVQA 3H7PA 4W9HA 4DBGA 4GU2A 4WWOA 5E6NA 3T9LA 3QQ8B 1RFAA 2DHZA 4FN2A 2AWTA 3IBEA 2KMCA 2B3AA 2Y5BB 3K9OB 4KSKC 2GMIC 2MBBB 2DZKA 1E8XA 2KTRA 3ZW3A 3PRMB 2C7HA 2DYMA 1WJ6A 2KD0A 2M17A 4M8MA 1YJ1A 1E8YA 2GBMA 2MA9B 2RR9A 1WXSA 1X1MA 5DPTA 2LGXA 1GUAB 2ZZPB 2DYOA 3C0RB 1SGHA 1YIWA 1J8CA 2LRWA 1WM3A 2KWCA 1V80A 4EFOA 1UELA 2KOXA 2MX2A 1ISNA 1SE9A 2GOWA 4KDIC 1V86A 2LWPA 3DVGX 3QJZA 1Q5WB 3RZWC 1TBEA 4B9KA 2FCNA 3QX1A 3QA8A 2KHWB 5G55A 1XQQA 2PJHA 3CSFA 3QAQA 2FUHB 3RCZA 1WJ4A 2J0MA 2GBRA 2YLMA 1E90A 5J2RA 1WR6E 3IVFA 1G6JA 4DHZE 4NY0A 1TZ1A 4JQWC 1OTRB 2RD0A 4HLEA 4NPNA 2C7NB 2EKEC 2KANA 3KW5B 2N9EB 3NHEB 4ZRKA 4TKNA 4E3CA 5IA7A 4MGYE 1IYFA 2M0XA 4LJOB 2CR5A 2L7RA 3TL5A 3BINA 4M0WB 2IO2B 2G4DB 2C5LC 4GDKB 3R7RA 3WAMA 4MEMA 2MBOA 2KQSA 3H9DA 3PT2B 1L7YA 3ZNID 2JRHA 1KOTA 4GGQA 2N7DA 4DHJD 3DBSA 2WWZA 3UF8A 5FR6A 5CHWA 4YL8A 3RULA 2RGFA 1I35A 2ZCCA 4B6WA 4GSWA 2Z0EB 2KWVB 3SD5A 4W9FA 4WJNA 1R4NI 2BYFA 1M94A 2WDTB 4MGZE 2BWFA 4A3OA 3WANA 1NBFC 3V60A 2IYDB 4WAAA 1UD7A 3W1SA 2JRIB 3ZNHB 2W9NA 1E7UA 1V2YA 3L0WB 1OEYJ 3R66C 1I42A 3SDLC 3I3TB 4EOYA 4FJZA 4URKA 1WR1A 4AJWA 4OVVA 4BFRA 3WAOA 4DHZB 4HCPB 1NDDA 2Z59B 3ENEA 1JRUA 2KJHB 3VH4B 2WX1A 1UZXB 5AZFA 2ZNVC 2AEHA 2N1VA 4K81A 1WXVA 3WALA 4ZYNA 5E6OA 4NAWA 2MP2B 2AYOB 3EC8A 2KQ7A 2MBEA 2ZVOA 1Y8RC 2IO3B 1UH6A 1NI2A 2OOBB 1KLVA 4IC7B 4ZRJA 2JVCA 3M3JA 5HKHA 4WWNA 5L95C 4N9F4 2PPHA 2LXAA 3W1SC 2KX0A 5G2NA 3UIOB 4GB9A 4GMVA 1YD8U 3ZKJC 2M1MA 4DK5A 2NS5A 4TUUA 2KDBA 4AP4C 3RD2A 5JHAA 4MJSB 1KM7A 2MRPA 2RPQA 3APFA 3IFWB 3NZSA 3PHXB 1P1AA 3ZRCA 3VQIA 2K6QA 1EF1A 1P3QU 3QC8B 4HJKA 4MH0E 4IM2A 2IO1B 2A5UA 2K39A 3NZUA 2O2VB 4GXBA 3ALBA 4LDTD 3VUWA 5J17A 1P9DU 2BKFA 5D2MB 1UBIA 4BKSA 1WMHA 2QHOA 2C60A 4TQ1A 4WJPA 3R7QA 3U7DA 1WI0A 2DZIA 4XX5A 1GC6A 2D07B 2JZ3B 5BO4B 2LXCA 4FULA 4W9GA 5TR5A 3H1UA 2KZRA 2ZPNA 2LVPA 3L13A 2REXA 3B0AA 4LJPB 4KZ0A 2KC1A 3MJWA 3K9PB 4IM0A 4ANUA 4EUTA 2NPTB 2KKCA 4K7WA 3JW0X 1EO6A 2MQJA 1V49A 1P98A 3GZNI 3HK0A 5AZHA 3WIMA 2AL3A 1U4AA 4MELA 3ML8A 3PHWB 4M8NA 4MM3A 1WGYA 3KUCB 4AWJA 3A4RA 2L05A 4KIKA 4W9IA 3ZO5B 3ZUNA 4PYUA 5L83A 3UQBA 1GJZA 2L76A 4E74A 1XT9B 1OGWA 2D10A 1YX5B 3MHSD 4FJYA 1GNUA 2GBJA 4GDLB 3PTFC 2CHXA 4NQLB 3A9JB 2JWZA 4FLHA 4IWPA 4FHKA 4BVUC 2LUEA 2PEAA 1P0RA 2DZMA 3DVGY 1WGHA 4LCDE 5GMVA 4G11A 4EEWA 2LZ6A 4KZCA 3ZVVA 5AZGA 2FIFA 3IG3A 4NJ6A 1OEYA 4MGKE 2L8JA 1Z5SB 3HHMA 3NS8A 4KIKB 4W9EA 4X57B 3H7SA 4FADA 2DZJA 4GN1A 5EDSA 2I1KA 4FBJB 2KK8A 2LASA 2LRUA 3KUDB 4I6NB 1UGMA 4XZ4A 3TCAA 3QHTA 1E5WA 1IPGA 3SHQA 1EUVB 1S3SG 2KLGA 2M8SA 4MSMB 3N32A 3KYCD 1E8WA 2WX0A 4F7ZA 4ANXA 2PE9A 2BYVE 1WJUA 2D2QA 2CHWA 4K7SA 2V4LA 1WRDB 2K25A 2LGDA 2DAJA 3N3KB 3VTVA 4BBNC 2ASQA 1C3TA 5AEKB 3BY4B 3QARA 1V6EA 2UYZB 4II2B 2FCSA 1FXTB 2A4ZA 3L17A 1WX7A 2KDIA 3A1QA 3VAWA 2LJ5A 5JHBA 2WYQA 4KSLC 4W9CA 1WJNA 5DPWA 3AULA 1WY8A 4KV2A 2CHZA 4ICUA 3VFKA 2Z0DB 3L08A 1OQYA 1WX8A 2NBUA 4WWPA 4F1SA 1WFYA 2L0TA 4MJSA 4AJYB 2V1YA 2CKHB 1E8ZA 2KTFA 3UQAA 3PVLA 2LD9A 2ZPYA 3A33B 3RYTA 1AARA 3PGEA 4JLCA 1ZW7A 4IW0A 2FCMA 4IG7B 3PLUA 2KWUB 1V9JA 1WMHB 4E71A 3PPAA 1QZEA 2K1FA 3VUYA 2MBHA 4IM3A 2JZZA 2R2QA 1CMXB 1S1QB 3X23A 1MG8A 3DVNV 5IAAC 3WA0A 1WXAA 4PS8A 3APCA 3SU8X 3TJPA 1BT0A 1PQSA 1XD3B 2GBNA 4JIOU 4BBNF 1EF5A 4IWOA 5JZEB 4JGHB 2KFKB 2DAFA 3NY5A 3DPDA 2IY0B 2JPHA 4RMAA 3A9KB 2O6VD 2ZEQA 3TMPB 1YX6B 3L16A 4WQOB 2GBKA 1WM2A 5KHOA 3PS6A 3T8MA 1J0GA 3VTUA 5D94A 4NQKE 4BKSD 2XK5A 2MP2A 2KXJA 2EMSA 2D11A 1GG3A 3H7PB 3EFUA 2JY6A 2ZJDA 3M95A 4P7IA 4WJQA 3A9JA 1SIFA 3LDZE 4PS7A 4DHJB 3KH0A 3ZIMA 3LJ3A 4EZJA 3OLMD 3B1LX 2KTRB 3V6EB 1K8RB 5DCNA 2BYEA 2EMTA 2KJ6A 3EECA 1Q1OA 2KO3A 3VHTC 1A5RA 5LLIA 2LVOA 1F9JA 5CHVC 4B95A 2L0FA 2KFKA 1WF9A 2NBVB 2DYBA 2NVUI 4W9KA 4TV3A 4FHJA 1ZKHA 3RUIB 4NJ7A 4GOCA 2KN5A 3U8ZA 3ZTCA 2D3GA 4A20A 3CF6E 4GDLA 1WE7A 3AU5A 4BKTA 5D6JB 3IHPC 1T0YA 2AL6A 3PV1A 2K6DB 4GIVA 3UINB 3W1YA 1Q0WB 1LXDA 2O6VB 2C9WB 3DBLI 2G3QB 2BPSA 2YVCA 2N1WA 2VRRB 3WAPA 3ZNZB 4EKUA 2K8BA 2JT4B 4CHKA 3AXCA 2BGFA 2N9PC 2NPTA 3PRPB 3AU4A 2M4NA 3JSVB 2O6VA 3VH3B 3A4SC 3VTWA 4BOZB 3M63B 3UGBB 3DBHI 1VD2A 3KYDD 3HM6X 3JVZX 3L10B 3V62A 2MW5A 3JSVA 4G0NB 2N7EA 4HWIB 3B08A 4K7UA 1J19A 2NR2A 1HE8A 2HE7A 2IBIB 2ZCBA 5C23A 3ZNGC 4GDKA 3DDCB 4HDQA 5D7GA 4FJVB 4MGIE 2MLBA 3CSTA 3DVNU 1LM8B 2JUOA 3CMMB 3Q3FA 1VCBA 4I6PA 5DPRA 3KVFB 2XBBC 4II3B
chains in the Genus database with same CATH superfamily
4AQ7A 3Q69A 5GXGB 2J0JA 2BWES 2KWDA 3EGRA 2JF5A 3ZLZA 4HVBA 2QEJC 2J7QB 2JQRB 3RT3B 2KDFB 4RGOS 2WDVB 1H8CA 4EE2A 1LGRA 3U4EG 3VRAB 2L32A 4MDKE 1P7EA 2UWQA 2ZNVB 2XK5B 1V81A 1LQBA 2KLCA 3AEGB 3V6CB 4ZDVA 2HD5B 1OFFA 1TTNA 4ASWC 4HXDA 3HVZA 4YWGG 3X0WA 1ZE3D 1QQRA 3N30A 1YJIA 1V5TA 2L00B 3V61A 4JL9A 4ICVA 3MTNB 4G3XB 3S2AA 5HG2A 2KJRA 4W9LA 2V3NA 2IGDA 1I4PA 3DQVA 1UGJA 2V3SA 4ZRIA 4G50A 2MWSB 4HEA1 3Q3JA 2QJLA 4HPMB 1IP9A 1B1ZA 1WGDA 2QC8A 2KNBA 2LJIA 1L2NA 2XEWA 5J18A 2N9XA 4HK2A 4AOFA 4OW0A 4TQ0A 2BF8B 2JXXA 3ZYYX 4HDOA 1WGRA 1L0YB 2KVRA 2LVQA 3H7PA 3RN9C 4ACFA 3T9LA 2V3PA 3IBEA 3VR9B 2B3AA 3K9OB 4KSKC 1VLBA 2DZKA 4B0MA 2KTRA 2PKOA 4MM3B 2DYMA 2WXJA 4JWSC 1YJ1A 1NEKB 2LGXA 1XLPA 1SGHA 2QILA 2LRWA 4EFOA 1SE9A 2GOWA 1WGKA 1KH0A 3RZWC 1TBEA 3QX1A 3BVZA 2BBCA 2KHWB 5G55A 3CSFA 1IBXB 2IGGA 1WJ4A 1T0RC 5J2RA 3R2TA 3IVFA 1G6JA 4P16A 3TSSA 4NY0A 4RGNA 1TZ1A 4HLEA 1OTRB 2RD0A 3KW5B 1V1OA 3AM9A 3NHEB 3HVDA 4LJOB 2L7RA 3BINA 4ZHPA 4LNOA 1I7HA 4M0WB 2G4DB 4GDKB 3R7RA 1L7YA 3MHZA 3Q3MC 1R4MB 4DHJD 2WWZA 1XCQL 5FR6A 4C00A 4KKIA 3RULA 1I35A 2UU7A 3TEZA 1IBXA 5BMGA 2KWVB 3SD5A 4WJNA 1R4NI 1M94A 3MC0B 4A3OA 3V60A 1UD7A 3W1SA 3AECB 3SFEB 4LNIA 2PVOD 2W9NA 3SR6A 2LUMA 1K51A 4EOYA 4FJZA 4OZBA 4AJWA 1ZXIA 4HCPB 3FILA 2QIEB 2JYEA 1JRUA 2BYTA 2EELA 2MP2B 4IOIE 2MBEA 1Y8RC 4IDIA 5HKHA 3URYA 1JMLA 4WWNA 1C77A 4N58A 4OZAA 3E9SA 3ZKJC 1YN4A 3CWIA 5JHAA 1EM7A 2LEKA 2YEPB 1L4DB 2JSVX 1JCKB 2K39A 1ZP0B 4LDTD 1P9DU 1UBIA 5BMHA 4TQ1A 4WJPA 3R7QA 4D2KA 2D07B 4FULA 3H1UA 2ZPNA 3P4RB 4KZ0A 3ZXRA 2WS3B 4ANUA 2BTEA 2KKCA 4K7WA 3JW0X 5AZHA 3ML8A 3PHWB 1WGYA 3A4RA 5L83A 4ARIA 1VZ7A 4E74A 1GNUA 4GDLB 3DWMA 3PTFC 4IWPA 4FHKA 1F1HA 3DVGY 2WP9B 4G11A 4EEWA 4C4VA 1WRIA 3IG3A 1IUEA 4NJ6A 1JALA 2RDHA 2L8JA 4KIKB 3AH7A 2LASA 1UGMA 3I5JC 2W3RA 2RPVA 1PDXA 1C76A 1C4PA 2K25A 2LGDA 2DAJA 2ASQA 1T0SC 3QARA 1ACCA 5BYRA 1V6EA 4C4VB 2H89B 2A4ZA 4W9CA 1SBBB 1WY8A 1A70A 2CHZA 4ICUA 2Z0DB 1WXQA 1JROA 1E8ZA 3A33B 3NG0A 4IW0A 3DHIC 4KGTA 2BS2B 2MBHA 1CMXB 3DVNV 3SU8X 1BT0A 2D3CA 2GBNA 1F77A 4L1BA 5JZEB 2LGIA 3A9KB 2O6VD 3PS6A 4LNKA 3T8MA 1J0GA 4NQKE 1YOVB 1XO3A 1LO5D 4WH4A 1GG3A 2INCC 2N9LA 1N62A 3M95A 1MJDA 1SIFA 5D3IB 4EZJA 2K22A 2MJDA 1DOXA 1K8RB 5FK9C 5DCNA 2BYEA 2KN4A 1A5RA 3EECA 4US8A 4B95A 2L0FA 1NYRA 1JWBD 4YSYB 2KFKA 1WF9A 2NBVB 4RGMA 4FHJA 2WXIA 4GOCA 4A20A 1J7CA 3IHPC 2JZPA 3P1MA 3PV1A 1Q0WB 1RFKA 1C78A 2G3QB 2BPSA 2VRRB 1TJEA 4EKUA 2JT4B 2K0PA 3C19A 3HUIA 4LNFA 3AXCA 3BYTB 3RNFC 2M4NA 1XXGA 2J42A 2O6VA 3B2GA 3AB5A 3DBHI 4US9A 3JVZX 3L10B 3Q3OC 3JSVA 4HKZE 2B76B 1ZUD2 1HE8A 2HE7A 2IBIB 2ZCBA 1E0ZA 2N9KA 4ZYSA 1L5PA 2Y5CA 2Y3AA 3KVFB 2XBBC 3MFGA 2RSUA 3LYYA 1R4MI 2V0GA 3NJTA 4H2AA 1WZ0A 1GAQB 5CHFA 4XWWA 1WH3A 1RRBA 1E7PB 1WYGA 2KQ4X 1XEEA 4S0RA 4FA6A 1RLFA 2HJ8A 4PS3A 3PRZA 3ZDMC 3AN1A 3DBRI 4PYZA 2R2OA 4DXGA 3RZFA 2C7MB 4I6LB 2KDEB 4NNJB 4YTPB 3QCAA 3FAHA 3NOBA 1NI3A 4YXDB 3ML9A 4MH8A 3OJ3A 4BZAA 3P2BA 2X8XX 2IY1B 3QIJA 4XC2A 3KQ4A 3Q8AA 4LNNA 4KDLB 1B9RA 1GB1A 2HTHA 1MPEA 1YQBA 5CTRC 2K8HA 3DOWA 3KUZA 4IWQA 2KACA 4ANVA 4EZKA 1TKYA 3HIZA 1TKEA 1AW7A 1FPYA 2IZVB 4LDTB 3U30A 3Q6BA 2V9HA 4XGAB 1D3ZA 4CO7A 2CS4A 3EHVA 5HI1A 2FAZA 2PVGC 1QOAA 2LI5A 3N1ZC 2LGYA 1TS3A 1V8CA 4JWUC 1F52A 3APDA 4WWOA 4WQMA 5E6NA 4PT5A 3QQ8B 1RFAA 2DHZA 2AWTA 2KMCA 2MBBB 1SE2A 1L6VA 3TEXA 2G1EA 1WJ6A 1FMAD 1MHXA 2KD0A 1F2RI 1E8YA 2GBMA 1WXSA 2WDRB 1K53A 3C0RB 4IKGA 2NTSA 1J8CA 1V80A 3E56A 3N1XC 1Q5WB 1YQ3B 2FCNA 2PJHA 1YJJA 2FUHB 3RCZA 2CU3A 3P4PB 1E90A 1WR6E 1UWXA 3SFDB 2C7NB 2KANA 2N9EB 4ZRKA 4MGYE 4NZLB 3TL5A 2IO2B 3WAMA 4C7YA 3ZNID 2W3SA 1F0ZA 3DBSA 2IGHA 3UF8A 4ITKA 3UI3A 4YL8A 2HTME 3N1YC 2ZCCA 4GSWA 3EUB2 4W9FA 3P4QB 2BYFA 2BWFA 1FFUA 1JQ4A 1NBFC 3VR8B 1E7UA 2WXHA 2WNMA 2GRIA 5IOIA 2INDC 4UDUC 3WAOA 4DHZB 1NDDA 4WWMA 3J9CA 3VH4B 2V4IB 3DBLB 4K81A 1GB4A 1TY2A 2AYOB 4M01A 2KQ7A 2ZVOA 1NI2A 1KLVA 2JVCA 3M3JA 2PPHA 3RNGC 2LXAA 3U2SC 2KX0A 1FCLA 4LK0M 4GMVA 4LTUA 5AUIA 4DK5A 2NS5A 4AP4C 3RD2A 2ONQA 1KM7A 2RPQA 1P1AA 2K6QA 2E3TA 2O2VB 2QHOA 1HTOA 1D5MC 5C3JB 3U7DA 4XX5A 4P1CC 5BO4B 2WXFA 4HKQA 2KZRA 2AQ2B 3L13A 3B0AA 3MJWA 4IM0A 4EUTA 1CQVA 1V49A 1P98A 3GZNI 3LB8C 3AV8A 3WIMA 4MELA 4MM3A 2JX5A 3KUCB 3LXFA 4N59A 2J52A 2L05A 4KIKA 4W9IA 4P1BC 4PYUA 2L76A 2D10A 1L6UA 2GBJA 2CHXA 4FXCA 2I38A 5EE0A 4NQLB 2W82A 3A9JB 4ZOHC 4RF1A 1T3QA 3GP7A 3V3XA 3ZVVA 2BQQA 1OEYA 4MGKE 3HHMA 2VH2A 3T3OA 4FADA 1GOZA 2DZJA 5EDSA 4RFBA 3P4SB 2ON8A 2K9XA 4XZ4A 3NUHB 1E5WA 1XLOA 4ZRPA 1EUVB 2KLGA 4F7ZA 4ANXA 2W54A 3PZ8A 1FCCC 1ZXHA 2BYVE 3Q8CA 1WJUA 2INPE 2V4LA 2WXRA 2EKIA 3BY4B 1I4HA 2UYZB 5BYQA 4LLGM 3L17A 1WX7A 2KDIA 3A1QA 5JHBA 2AQ3B 2MJ3A 3DBRB 1EU3A 3W5UB 1BXTA 3VFKA 3L08A 3RI7C 1OQYA 2IDYA 2WLBA 4AJYB 2V1YA 2LD9A 2ZPYA 3RYTA 1AARA 3PLUA 1V9JA 1TZOA 3FILB 2JYTA 3R8BA 3PPAA 1QZEA 4RH6A 2R2QA 1PYWD 4PS8A 3WA0A 3TJPA 1PQSA 1T5XD 2AX5A 4BBNF 1SB3C 1ZOYB 4A8XC 4JGHB 1GPXA 1FRRA 2DAFA 2IY0B 1E6EB 3RMKC 2WU2B 3W2DA 4WQOB 2IPKD 5KHOA 2WXOA 1JWMD 4BKSD 3RNCC 2MP2A 4ZRQA 2KXJA 3AE4B 1V1PB 3GE8C 4P7IA 3A9JA 1QOBA 2CJNA 4PS7A 3KH0A 3ZIMA 3OLMD 2KTRB 1N5WA 2KJ6A 5LLIA 5C2TB 2WXMA 2LVOA 2NVUI 3B9JA 3AE1B 4TV3A 1MHHE 3ZTCA 3AU5A 3IT6B 5D6JB 3UINB 3W1YA 1LXDA 3W9CB 3Q8EA 3SEBA 4A90A 2BGFA 3PRPB 3AU4A 4BOZB 3UGBB 2MW5A 3GE3C 4HWIB 5C23A 4HDQA 4MGIE 2MLBA 3CSTA 1HXYD 1VJKA 1VCBA 5DPRA 4II3B 3PZDA 1C9FA 3ECIA 3ZDTA 4ANWA 4RM9A 4F8CB 4EZLA 4AUQC 2WHIA 1LFDA 3O65B 1WE6A 3ZRFA 3OJ4B 3ZTDA 3TIXA 4WJOA 3RNEC 1WIAA 1SF0A 3U7ZA 4HPLB 1FIQA 3D32A 1DYQA 1UBQA 2K8CA 3A1QB 4DXAB 1MG4A 1KLUD 1C1YB 2KDMA 2WU5B 2FCQA 4BKGA 2KFJA 1QOFA 2OJWA 2JU6X 3DCGA 3L54A 1K52A 1ZGUB 2INNE 4W9JA 1GC7A 4W9DA 3PLVA 1V5OA 2FNJB 4REZA 1WYWB 1OQQA 3QK0A 4J3OD 2KC2A 3PREA 4RGTA 4NAWB 5C1ZA 4HCNB 1R4NB 2FIDA 1WXMA 1HTQA 2KT7A 3AEFB 3H6NA 3GS2A 2G4SA 2DENB 3HM3A 4BOSC 4KKJA 2J0KA 1WGGA 2PE6B 3NZ3A 2AQ1B 2N7JA 4DWFA 3KWVA 4O1NA 2O2VA 4Q2JA 4YTMB 3VVWB 1D6EC 4XYCA 2WXLA 3VXWA 2N4FA 3JYUA 3R3MA 5MPOA 2DX5B 3HRDD 4K1RB 3T3NA 4GU2A 2LHDA 4FN2A 3AEAB 1VRAB 2G9HD 2WXNA 2Y5BB 2GMIC 3AE5B 1CZPA 4B0EA 4XDCA 2M17A 2RR9A 1GUAB 1RYJA 1WM3A 2BS4B 2KWCA 1DOYA 1DOIA 1UELA 2MX2A 4KDIC 1V86A 5G5GA 4QAYA 4B9KA 3QAQA 1XF5L 1K50A 2YLMA 3KWLA 2PW9A 1WSPA 1HEZE 1FD6A 2EKEC 1PGAA 4E3CA 4TKNA 2M0AA 3PO0A 5IA7A 2RDBC 3BK2A 2RMMA 2KYWA 3R2IA 5E6JA 2E6XA 1QKZA 2C5LC 2MJEA 3H9DA 3PT2B 4GGQA 2N7DA 4HJGE 4XE0A 3H8HA 2LMCA 5CHWA 4HROA 2WXKA 1N60A 2M19A 2WDTB 4MGZE 4PK1A 4WAAA 2JRIB 3ZNHB 4A6QA 4S17A 1JWSD 1V2YA 3GB1A 1I42A 2BT6A 3SDLC 1VZ8A 3Q3NC 4URKA 4OVVA 4TSSA 4WAFA 3I57A 1ENFA 2WX1A 3NVWA 5AZFA 2ZNVC 2AEHA 3N20C 1WXVA 3WALA 3BYYB 2KMMA 3NVVA 1TS5A 2I2YA 2Z8LA 1UH6A 2DBYA 4CQNA 4ZRJA 3BIID 3W1SC 3UIOB 5IKCM 4TUUA 3AE2B 3NZSA 3PHXB 2MRPA 2M56B 3IFWB 4YT0B 5H8YE 3VQIA 4M0WA 4HJKA 2QSDA 1UF0A 4GXBA 2IO1B 2A5UA 2MHJA 3ALBA 2BKFA 5D2MB 3C8YA 1WMHA 3BVGA 1UNSA 1GC6A 2LXCA 5TR5A 1PGBA 2WXGA 2LVPA 2REXA 2BVCA 1SIJA 5FKAC 2NPTB 3HK0A 2AL3A 4AWJA 3ZO5B 3ZUNA 3UQBA 1GJZA 1OGWA 5AUKA 3MHSD 4FJYA 4BAXA 4M00A 4ZHOA 3ABVB 2JWZA 4FLHA 3ZXVA 2QCZA 4WURA 2K3UA 1I4XA 3NS1A 1L4ZB 2LZ6A 2FIFA 1QILA 1J7AA 1SSNA 3P63A 4W9EA 5HHDG 4X57B 3H7SA 4FBJB 5FR3A 3FKYA 3OWEB 1KF6B 3MC8A 3TCAA 2PMVA 1RM6C 3ETRA 1IPGA 3U52E 1S3SG 1E8WA 4C56C 1HA5A 2D2QA 2CHWA 3RPFC 4K7SA 3DHGC 1YNTE 2CJOA 1C3TA 1FXTB 3VAWA 2LJ5A 2WYQA 1AWDA 1WJNA 2TSSA 4KV2A 2K5PA 1ZDXA 1XCTL 3ZQ4A 2NBUA 4WWPA 4F1SA 1WFYA 2L0TA 1SJED 1NENB 2CKHB 4M02A 3UQAA 4GLSC 4OVZA 3ZGZA 4JLCA 2FCMA 4IG7B 4E71A 3VUYA 2JZZA 1S1QB 1QT9A 3X23A 1MG8A 1WXAA 2Y5PA 3RFZB 2L1AA 1EF5A 1BUIC 3NY5A 2D5GA 4RMAA 2ZEQA 3V05A 1V97A 1PUTA 3OG5A 3I63C 2XK5A 2EMSA 3H7PB 1MFWA 2GB1A 2ZJDA 2OEDA 4WJQA 1KTKA 4DHJB 2DNFA 2KO3A 3O13A 1F9JA 1FXAA 4ARCA 2DYBA 4W9KA 2KAJA 2ZW0A 3RUIB 1SE3A 3FC4A 3U8ZA 2D3GA 4BKTA 3EFCA 2ICIA 3TEWA 2K6DB 2O6VB 3VRBB 1V1PA 2YVCA 3WAPA 4C80A 2WGSA 2K8BA 4CHKA 4WIPA 3NVYA 2N9PC 1VD2A 1NYQA 3AEEB 3KYDD 3HM6X 3V62A 3N9YC 3AE9B 3W5VB 1D4BA 3PZ7A 2QMTA 1J19A 4GDKA 4KGSA 3DDCB 1D5ZC 3DVNU 3Q8BA 3CMMB 1AN8A 3Q3FA 3DBHB 1FRDA 4DDID 1QLBB 3VDZA 2BKRB 3PSEB 2IO0B 2VZKD 1VDVA 4OVUA 4J6IA 4DXFA 2NBWB 1JWAD 4NAMA 4DQOC 5IO9A 3AEBB 4KVGB 2G45B 2LFIA 5JH5C 2SAKA 4N6EB 4NJCA 2ZVNA 1SXTA 3UIPB 1TYGB 1WX9A 5LXHA 2KMAA 1J7BA 5IP4D 3MP9A 1QF6A 1VR9A 1TGZB 4RNAA 4A3PA 4MT5A 1C4CA 5DPSA 1KJTA 5JXVA 3GOEA 2MCNB 2WXPA 1FFVA 1ESFA 1E7VA 4TMAB 3NRZA 1JWUD 4OZCA 1H4RA 4YTNB 3TBLD 1TT5B 3CIRB 3ZJUA 1N6ZA 3L4PA 1T0QC 2L3ZA 4MSQB 5E6PA 3M62B 3ONSA 3QWZB 5KHQA 2MSED 1I4QA 3EA6A 4DDGD 2KX3A 2OHFA 3AI5A 3Q8FA 2NTTA 5CX3A 1FNUA 1C4AA 4JX1C 1TIFA 4CYEA 1E10A 1OQRA 1Z2MA 4IUMB 2MBQA 2I1JA 1F2RC 3VUXA 3TEYA 2CU1A 5LXIB 2X38A 4RM8A 3A9KA 3DWGC 2NCNA 2L52A 2OJRA 3OAWA 1ET9A 4A55A 1RAXA 4USAA 1XLNA 4W9HA 1WZ3A 1HZ5A 4DBGA 1ROEA 1FO4A 1C79A 4C7ZA 1E8XA 3GZNB 3ZW3A 1SEBD 3PRMB 2BS3B 2C7HA 4M8MA 1ZDVA 1RWSA 2MA9B 4OHJA 1X1MA 3AE3B 5DPTA 2ZZPB 2DYOA 4A9AA 1YIWA 4R3DA 2KOXA 2Q5WD 1M4VA 1ISNA 3IAS1 2SEBD 2LWPA 3DVGX 2NMQA 3QJZA 2GLSA 1ET6A 2YEPF 4XDDA 3QA8A 1PFDA 1XQQA 3WCQA 2J0MA 2GBRA 3MJ5A 1Q10A 5D3DA 2BW2A 4DHZE 1R7SA 1UUPA 4JQWC 1PGXA 4NPNA 1FEHA 1KRHA 1IYFA 2M0XA 2CR5A 1XLQA 1I4GA 4RCOA 4YSXB 4MEMA 1HQRD 2KQSA 2MBOA 1KOTA 2JRHA 2BB6A 2HJ1A 2RGFA 4B6WA 1TY0A 1KFYB 2Z0EB 1DGJA 3IT4B 2DLBA 2N0SB 1JW9D 4YSZB 4AS1A 5T8IA 2BB5A 3IAM1 3WANA 1ZPSA 1FNVA 2IYDB 5EE3A 3L0WB 1OEYJ 3R66C 3I3TB 1WR1A 4BFRA 1IGDA 2Z59B 3ENEA 2KJHB 5BYSA 1UZXB 2D3AA 2N1VA 4K3BA 2IJ0A 5EE9A 4ZYNA 5E6OA 4NAWA 1Y56A 2FBWB 3IXSA 1HZ6A 3EC8A 2RDGA 2IO3B 1L0VB 1YMHE 2OOBB 2JWUA 4IC7B 3AEDB 5L95C 4N9F4 1P7FA 2GI9A 5G2NA 4GB9A 4XWTA 2ZW1A 1YD8U 2M1MA 1MI0A 2KDBA 2PLPA 4MJSB 3APFA 3ZRCA 3BWUD 1N61A 2HDEA 1EF1A 1P3QU 3QC8B 4MH0E 1QOGA 4IM2A 3NZUA 3VUWA 2WXQA 5J17A 4BKSA 1VZ6A 1FM0D 2C60A 4L2YA 1WI0A 2DZIA 2PTLA 2JZ3B 1TS4A 4W9GA 4KGRA 1FNWA 4LJPB 5EE1A 2KC1A 3K9PB 1EO6A 2MQJA 1I4RA 1U4AA 2VH1A 1N63A 4M8NA 1JRPA 2H88B 1XT9B 4RF0A 1YX5B 2JXTA 2ACZB 2WDQB 2KVZA 1SE4A 4BVUC 2LUEA 2PEAA 4L23A 1P0RA 2DZMA 3DHHC 1WGHA 5TSSA 2DWQA 4LCDE 5GMVA 1YN5A 2FUG1 4KZCA 5AZGA 3BZDB 3RNBC 1Z5SB 3NS8A 3KLSX 3P42A 4GN1A 2I1KA 1TKGA 2XN9C 2KK8A 2LRUA 1AYFA 3KUDB 4I6NB 3QHTA 3SHQA 2M8SA 1D5XC 1N5XA 4MSMB 1EWCA 3N32A 1IGCA 3KYCD 2WX0A 2PE9A 1FXIA 2VZKB 1WRDB 2FE8A 3N3KB 3VTVA 4BBNC 5AEKB 3AE6B 2QDFA 4II2B 2FCSA 2D3BA 2J4XA 3AMZA 5LNK1 3BK1A 4KSLC 5DPWA 3AULA 2LHEA 3BVMA 4K3CA 1WX8A 1SJHD 4MJSA 3Q14C 3AE8B 1T6BX 2KTFA 3PVLA 3PGEA 2L83A 1ZW7A 5I4DA 4JE3B 4P6VF 2KWUB 1E9MA 1WMHB 2K1FA 4IM3A 1UWMA 2LGSA 3RNAC 2R61A 3I9V1 2WQYB 1YN3A 5IAAC 4HRSA 3APCA 1BMLC 1XD3B 4JIOU 5H92C 4IWOA 2KFKB 2MEKA 3DPDA 2JPHA 2PIAA 3TMPB 1YX6B 3TUOA 3L16A 2GBKA 1WM2A 1CJEA 1TS2A 2W55A 1MVKA 3B2FA 3VTUA 5D94A 4HPPA 5BMIA 2D11A 3EFUA 2JY6A 1WWTA 3LDZE 1KLGD 3LJ3A 3B1LX 4KX6B 3V6EB 1CK1A 2EMTA 3VHTC 1Q1OA 4JPSA 1NVID 5CHVC 1EU4A 3AE7B 3NVZA 5HFYA 5G5HA 3Q2AC 1ZKHA 4NJ7A 2KN5A 3CF6E 4GDLA 1WE7A 3ZJVA 1T0YA 2AL6A 4GIVA 2MH7A 3MC9A 2C9WB 3DBLI 2N1WA 3ZNZB 5IN7A 2J53A 4MACA 2NPTA 3JSVB 3VH3B 3A4SC 3VTWA 3M63B 1STEA 4G0NB 2N7EA 1L0XB 4K7UA 3B08A 2NR2A 3ZNGC 5D7GA 4FJVB 1EWYC 1LM8B 2XNAC 2JUOA 3ZJTA 4I6PA 1YQ4B
chains in the Genus database with same CATH topology
2RSUA 3PZDA 1R4MI 3ECIA 3ZDTA 4ANWA 2J0JA 4RM9A 4DDID 1WZ0A 3VDZA 2BWES 4F8CB 2BKRB 4EZLA 5CHFA 1WH3A 3PSEB 2IO0B 2JF5A 4AUQC 3ZLZA 4HVBA 1LFDA 3O65B 1RRBA 2J7QB 1WE6A 3RT3B 4OVUA 2KDFB 3ZRFA 4J6IA 3OJ4B 4FA6A 1RLFA 2HJ8A 1H8CA 3ZTDA 2NBWB 3TIXA 4PS3A 4WJOA 3PRZA 3ZDMC 1WIAA 3DBRI 4PYZA 2R2OA 4HPLB 4KVGB 3D32A 1UBQA 2K8CA 3A1QB 4MDKE 2G45B 5JH5C 4DXAB 2UWQA 3RZFA 2C7MB 2ZNVB 2XK5B 4I6LB 2KDEB 4NNJB 1V81A 1C1YB 1LQBA 3QCAA 2FCQA 2ZVNA 4BKGA 3UIPB 1WX9A 2KFJA 2KLCA 3NOBA 5LXHA 2KMAA 3DCGA 3L54A 1ZGUB 4W9JA 1GC7A 4W9DA 1TGZB 3V6CB 3PLVA 1V5OA 4A3PA 2FNJB 4ZDVA 1WYWB 5DPSA 3ML9A 1KJTA 2HD5B 3GOEA 2MCNB 3QK0A 1TTNA 4ASWC 4HXDA 3OJ3A 2KC2A 1E7VA 3PREA 3X0WA 3P2BA 4NAWB 5C1ZA 4HCNB 2IY1B 3QIJA 4XC2A 1H4RA 3N30A 3TBLD 1V5TA 2L00B 3V61A 4KDLB 2FIDA 1WXMA 2HTHA 4JL9A 4ICVA 3MTNB 4G3XB 2L3ZA 3S2AA 3H6NA 2KJRA 4MSQB 4W9LA 1YQBA 5CTRC 5E6PA 2K8HA 3DOWA 3M62B 3KUZA 2G4SA 3ONSA 3QWZB 5KHQA 2MSED 4IWQA 4DDGD 4ANVA 4EZKA 2KX3A 2DENB 3HIZA 3HM3A 3AI5A 4BOSC 2IZVB 2J0KA 4LDTB 1WGGA 5CX3A 2PE6B 3DQVA 3U30A 2V3SA 4ZRIA 4CYEA 4G50A 2MWSB 4DWFA 1Z2MA 4IUMB 1D3ZA 3Q3JA 2MBQA 4CO7A 2CS4A 2I1JA 3EHVA 4HPMB 1IP9A 3VUXA 2O2VA 1WGDA 2FAZA 2KNBA 1L2NA 2LI5A 2CU1A 5LXIB 2XEWA 3VVWB 2LGYA 4RM8A 3A9KA 3VXWA 5J18A 2N9XA 2NCNA 4HK2A 2N4FA 4AOFA 4TQ0A 2BF8B 3JYUA 3R3MA 2OJRA 3OAWA 2DX5B 2JXXA 4K1RB 1RAXA 3APDA 4HDOA 2KVRA 1WGRA 1WZ3A 2LVQA 3H7PA 4W9HA 4DBGA 4GU2A 4WWOA 5E6NA 3T9LA 3QQ8B 1RFAA 2DHZA 4FN2A 2AWTA 3IBEA 2KMCA 2B3AA 2Y5BB 3K9OB 4KSKC 2GMIC 2MBBB 2DZKA 1E8XA 2KTRA 3ZW3A 3PRMB 2C7HA 2DYMA 1WJ6A 2KD0A 2M17A 4M8MA 1YJ1A 1E8YA 2GBMA 2MA9B 2RR9A 1WXSA 1X1MA 5DPTA 2LGXA 1GUAB 2ZZPB 2DYOA 3C0RB 1SGHA 1YIWA 1J8CA 2LRWA 1WM3A 2KWCA 1V80A 4EFOA 1UELA 2KOXA 2MX2A 1ISNA 1SE9A 2GOWA 4KDIC 1V86A 2LWPA 3DVGX 3QJZA 1Q5WB 3RZWC 1TBEA 4B9KA 2FCNA 3QX1A 3QA8A 2KHWB 5G55A 1XQQA 2PJHA 3CSFA 3QAQA 2FUHB 3RCZA 1WJ4A 2J0MA 2GBRA 2YLMA 1E90A 5J2RA 1WR6E 3IVFA 1G6JA 4DHZE 4NY0A 1TZ1A 4JQWC 1OTRB 2RD0A 4HLEA 4NPNA 2C7NB 2EKEC 2KANA 3KW5B 2N9EB 3NHEB 4ZRKA 4TKNA 4E3CA 5IA7A 4MGYE 1IYFA 2M0XA 4LJOB 2CR5A 2L7RA 3TL5A 3BINA 4M0WB 2IO2B 2G4DB 2C5LC 4GDKB 3R7RA 3WAMA 4MEMA 2MBOA 2KQSA 3H9DA 3PT2B 1L7YA 3ZNID 2JRHA 1KOTA 4GGQA 2N7DA 4DHJD 3DBSA 2WWZA 3UF8A 5FR6A 5CHWA 4YL8A 3RULA 2RGFA 1I35A 2ZCCA 4B6WA 4GSWA 2Z0EB 2KWVB 3SD5A 4W9FA 4WJNA 1R4NI 2BYFA 1M94A 2WDTB 4MGZE 2BWFA 4A3OA 3WANA 1NBFC 3V60A 2IYDB 4WAAA 1UD7A 3W1SA 2JRIB 3ZNHB 2W9NA 1E7UA 1V2YA 3L0WB 1OEYJ 3R66C 1I42A 3SDLC 3I3TB 4EOYA 4FJZA 4URKA 1WR1A 4AJWA 4OVVA 4BFRA 3WAOA 4DHZB 4HCPB 1NDDA 2Z59B 3ENEA 1JRUA 2KJHB 3VH4B 2WX1A 1UZXB 5AZFA 2ZNVC 2AEHA 2N1VA 4K81A 1WXVA 3WALA 4ZYNA 5E6OA 4NAWA 2MP2B 2AYOB 3EC8A 2KQ7A 2MBEA 2ZVOA 1Y8RC 2IO3B 1UH6A 1NI2A 2OOBB 1KLVA 4IC7B 4ZRJA 2JVCA 3M3JA 5HKHA 4WWNA 5L95C 4N9F4 2PPHA 2LXAA 3W1SC 2KX0A 5G2NA 3UIOB 4GB9A 4GMVA 1YD8U 3ZKJC 2M1MA 4DK5A 2NS5A 4TUUA 2KDBA 4AP4C 3RD2A 5JHAA 4MJSB 1KM7A 2MRPA 2RPQA 3APFA 3IFWB 3NZSA 3PHXB 1P1AA 3ZRCA 3VQIA 2K6QA 1EF1A 1P3QU 3QC8B 4HJKA 4MH0E 4IM2A 2IO1B 2A5UA 2K39A 3NZUA 2O2VB 4GXBA 3ALBA 4LDTD 3VUWA 5J17A 1P9DU 2BKFA 5D2MB 1UBIA 4BKSA 1WMHA 2QHOA 2C60A 4TQ1A 4WJPA 3R7QA 3U7DA 1WI0A 2DZIA 4XX5A 1GC6A 2D07B 2JZ3B 5BO4B 2LXCA 4FULA 4W9GA 5TR5A 3H1UA 2KZRA 2ZPNA 2LVPA 3L13A 2REXA 3B0AA 4LJPB 4KZ0A 2KC1A 3MJWA 3K9PB 4IM0A 4ANUA 4EUTA 2NPTB 2KKCA 4K7WA 3JW0X 1EO6A 2MQJA 1V49A 1P98A 3GZNI 3HK0A 5AZHA 3WIMA 2AL3A 1U4AA 4MELA 3ML8A 3PHWB 4M8NA 4MM3A 1WGYA 3KUCB 4AWJA 3A4RA 2L05A 4KIKA 4W9IA 3ZO5B 3ZUNA 4PYUA 5L83A 3UQBA 1GJZA 2L76A 4E74A 1XT9B 1OGWA 2D10A 1YX5B 3MHSD 4FJYA 1GNUA 2GBJA 4GDLB 3PTFC 2CHXA 4NQLB 3A9JB 2JWZA 4FLHA 4IWPA 4FHKA 4BVUC 2LUEA 2PEAA 1P0RA 2DZMA 3DVGY 1WGHA 4LCDE 5GMVA 4G11A 4EEWA 2LZ6A 4KZCA 3ZVVA 5AZGA 2FIFA 3IG3A 4NJ6A 1OEYA 4MGKE 2L8JA 1Z5SB 3HHMA 3NS8A 4KIKB 4W9EA 4X57B 3H7SA 4FADA 2DZJA 4GN1A 5EDSA 2I1KA 4FBJB 2KK8A 2LASA 2LRUA 3KUDB 4I6NB 1UGMA 4XZ4A 3TCAA 3QHTA 1E5WA 1IPGA 3SHQA 1EUVB 1S3SG 2KLGA 2M8SA 4MSMB 3N32A 3KYCD 1E8WA 2WX0A 4F7ZA 4ANXA 2PE9A 2BYVE 1WJUA 2D2QA 2CHWA 4K7SA 2V4LA 1WRDB 2K25A 2LGDA 2DAJA 3N3KB 3VTVA 4BBNC 2ASQA 1C3TA 5AEKB 3BY4B 3QARA 1V6EA 2UYZB 4II2B 2FCSA 1FXTB 2A4ZA 3L17A 1WX7A 2KDIA 3A1QA 3VAWA 2LJ5A 5JHBA 2WYQA 4KSLC 4W9CA 1WJNA 5DPWA 3AULA 1WY8A 4KV2A 2CHZA 4ICUA 3VFKA 2Z0DB 3L08A 1OQYA 1WX8A 2NBUA 4WWPA 4F1SA 1WFYA 2L0TA 4MJSA 4AJYB 2V1YA 2CKHB 1E8ZA 2KTFA 3UQAA 3PVLA 2LD9A 2ZPYA 3A33B 3RYTA 1AARA 3PGEA 4JLCA 1ZW7A 4IW0A 2FCMA 4IG7B 3PLUA 2KWUB 1V9JA 1WMHB 4E71A 3PPAA 1QZEA 2K1FA 3VUYA 2MBHA 4IM3A 2JZZA 2R2QA 1CMXB 1S1QB 3X23A 1MG8A 3DVNV 5IAAC 3WA0A 1WXAA 4PS8A 3APCA 3SU8X 3TJPA 1BT0A 1PQSA 1XD3B 2GBNA 4JIOU 4BBNF 1EF5A 4IWOA 5JZEB 4JGHB 2KFKB 2DAFA 3NY5A 3DPDA 2IY0B 2JPHA 4RMAA 3A9KB 2O6VD 2ZEQA 3TMPB 1YX6B 3L16A 4WQOB 2GBKA 1WM2A 5KHOA 3PS6A 3T8MA 1J0GA 3VTUA 5D94A 4NQKE 4BKSD 2XK5A 2MP2A 2KXJA 2EMSA 2D11A 1GG3A 3H7PB 3EFUA 2JY6A 2ZJDA 3M95A 4P7IA 4WJQA 3A9JA 1SIFA 3LDZE 4PS7A 4DHJB 3KH0A 3ZIMA 3LJ3A 4EZJA 3OLMD 3B1LX 2KTRB 3V6EB 1K8RB 5DCNA 2BYEA 2EMTA 2KJ6A 3EECA 1Q1OA 2KO3A 3VHTC 1A5RA 5LLIA 2LVOA 1F9JA 5CHVC 4B95A 2L0FA 2KFKA 1WF9A 2NBVB 2DYBA 2NVUI 4W9KA 4TV3A 4FHJA 1ZKHA 3RUIB 4NJ7A 4GOCA 2KN5A 3U8ZA 3ZTCA 2D3GA 4A20A 3CF6E 4GDLA 1WE7A 3AU5A 4BKTA 5D6JB 3IHPC 1T0YA 2AL6A 3PV1A 2K6DB 4GIVA 3UINB 3W1YA 1Q0WB 1LXDA 2O6VB 2C9WB 3DBLI 2G3QB 2BPSA 2YVCA 2N1WA 2VRRB 3WAPA 3ZNZB 4EKUA 2K8BA 2JT4B 4CHKA 3AXCA 2BGFA 2N9PC 2NPTA 3PRPB 3AU4A 2M4NA 3JSVB 2O6VA 3VH3B 3A4SC 3VTWA 4BOZB 3M63B 3UGBB 3DBHI 1VD2A 3KYDD 3HM6X 3JVZX 3L10B 3V62A 2MW5A 3JSVA 4G0NB 2N7EA 4HWIB 3B08A 4K7UA 1J19A 2NR2A 1HE8A 2HE7A 2IBIB 2ZCBA 5C23A 3ZNGC 4GDKA 3DDCB 4HDQA 5D7GA 4FJVB 4MGIE 2MLBA 3CSTA 3DVNU 1LM8B 2JUOA 3CMMB 3Q3FA 1VCBA 4I6PA 5DPRA 3KVFB 2XBBC 4II3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSU A;  3PZD A;  1R4M I;  3ECI A;  3ZDT A;  4ANW A;  2J0J A;  4RM9 A;  4DDI D;  1WZ0 A;  3VDZ A;  2BWE S;  4F8C B;  2BKR B;  4EZL A;  5CHF A;  1WH3 A;  3PSE B;  2IO0 B;  2JF5 A;  4AUQ C;  3ZLZ A;  4HVB A;  1LFD A;  3O65 B;  1RRB A;  2J7Q B;  1WE6 A;  3RT3 B;  4OVU A;  2KDF B;  3ZRF A;  4J6I A;  3OJ4 B;  4FA6 A;  1RLF A;  2HJ8 A;  1H8C A;  3ZTD A;  2NBW B;  3TIX A;  4PS3 A;  4WJO A;  3PRZ A;  3ZDM C;  1WIA A;  3DBR I;  4PYZ A;  2R2O A;  4HPL B;  4KVG B;  3D32 A;  1UBQ A;  2K8C A;  3A1Q B;  4MDK E;  2G45 B;  5JH5 C;  4DXA B;  2UWQ A;  3RZF A;  2C7M B;  2ZNV B;  2XK5 B;  4I6L B;  2KDE B;  4NNJ B;  1V81 A;  1C1Y B;  1LQB A;  3QCA A;  2FCQ A;  2ZVN A;  4BKG A;  3UIP B;  1WX9 A;  2KFJ A;  2KLC A;  3NOB A;  5LXH A;  2KMA A;  3DCG A;  3L54 A;  1ZGU B;  4W9J A;  1GC7 A;  4W9D A;  1TGZ B;  3V6C B;  3PLV A;  1V5O A;  4A3P A;  2FNJ B;  4ZDV A;  1WYW B;  5DPS A;  3ML9 A;  1KJT A;  2HD5 B;  3GOE A;  2MCN B;  3QK0 A;  1TTN A;  4ASW C;  4HXD A;  3OJ3 A;  2KC2 A;  1E7V A;  3PRE A;  3X0W A;  3P2B A;  4NAW B;  5C1Z A;  4HCN B;  2IY1 B;  3QIJ A;  4XC2 A;  1H4R A;  3N30 A;  3TBL D;  1V5T A;  2L00 B;  3V61 A;  4KDL B;  2FID A;  1WXM A;  2HTH A;  4JL9 A;  4ICV A;  3MTN B;  4G3X B;  2L3Z A;  3S2A A;  3H6N A;  2KJR A;  4MSQ B;  4W9L A;  1YQB A;  5CTR C;  5E6P A;  2K8H A;  3DOW A;  3M62 B;  3KUZ A;  2G4S A;  3ONS A;  3QWZ B;  5KHQ A;  2MSE D;  4IWQ A;  4DDG D;  4ANV A;  4EZK A;  2KX3 A;  2DEN B;  3HIZ A;  3HM3 A;  3AI5 A;  4BOS C;  2IZV B;  2J0K A;  4LDT B;  1WGG A;  5CX3 A;  2PE6 B;  3DQV A;  3U30 A;  2V3S A;  4ZRI A;  4CYE A;  4G50 A;  2MWS B;  4DWF A;  1Z2M A;  4IUM B;  1D3Z A;  3Q3J A;  2MBQ A;  4CO7 A;  2CS4 A;  2I1J A;  3EHV A;  4HPM B;  1IP9 A;  3VUX A;  2O2V A;  1WGD A;  2FAZ A;  2KNB A;  1L2N A;  2LI5 A;  2CU1 A;  5LXI B;  2XEW A;  3VVW B;  2LGY A;  4RM8 A;  3A9K A;  3VXW A;  5J18 A;  2N9X A;  2NCN A;  4HK2 A;  2N4F A;  4AOF A;  4TQ0 A;  2BF8 B;  3JYU A;  3R3M A;  2OJR A;  3OAW A;  2DX5 B;  2JXX A;  4K1R B;  1RAX A;  3APD A;  4HDO A;  2KVR A;  1WGR A;  1WZ3 A;  2LVQ A;  3H7P A;  4W9H A;  4DBG A;  4GU2 A;  4WWO A;  5E6N A;  3T9L A;  3QQ8 B;  1RFA A;  2DHZ A;  4FN2 A;  2AWT A;  3IBE A;  2KMC A;  2B3A A;  2Y5B B;  3K9O B;  4KSK C;  2GMI C;  2MBB B;  2DZK A;  1E8X A;  2KTR A;  3ZW3 A;  3PRM B;  2C7H A;  2DYM A;  1WJ6 A;  2KD0 A;  2M17 A;  4M8M A;  1YJ1 A;  1E8Y A;  2GBM A;  2MA9 B;  2RR9 A;  1WXS A;  1X1M A;  5DPT A;  2LGX A;  1GUA B;  2ZZP B;  2DYO A;  3C0R B;  1SGH A;  1YIW A;  1J8C A;  2LRW A;  1WM3 A;  2KWC A;  1V80 A;  4EFO A;  1UEL A;  2KOX A;  2MX2 A;  1ISN A;  1SE9 A;  2GOW A;  4KDI C;  1V86 A;  2LWP A;  3DVG X;  3QJZ A;  1Q5W B;  3RZW C;  1TBE A;  4B9K A;  2FCN A;  3QX1 A;  3QA8 A;  2KHW B;  5G55 A;  1XQQ A;  2PJH A;  3CSF A;  3QAQ A;  2FUH B;  3RCZ A;  1WJ4 A;  2J0M A;  2GBR A;  2YLM A;  1E90 A;  5J2R A;  1WR6 E;  3IVF A;  1G6J A;  4DHZ E;  4NY0 A;  1TZ1 A;  4JQW C;  1OTR B;  2RD0 A;  4HLE A;  4NPN A;  2C7N B;  2EKE C;  2KAN A;  3KW5 B;  2N9E B;  3NHE B;  4ZRK A;  4TKN A;  4E3C A;  5IA7 A;  4MGY E;  1IYF A;  2M0X A;  4LJO B;  2CR5 A;  2L7R A;  3TL5 A;  3BIN A;  4M0W B;  2IO2 B;  2G4D B;  2C5L C;  4GDK B;  3R7R A;  3WAM A;  4MEM A;  2MBO A;  2KQS A;  3H9D A;  3PT2 B;  1L7Y A;  3ZNI D;  2JRH A;  1KOT A;  4GGQ A;  2N7D A;  4DHJ D;  3DBS A;  2WWZ A;  3UF8 A;  5FR6 A;  5CHW A;  4YL8 A;  3RUL A;  2RGF A;  1I35 A;  2ZCC A;  4B6W A;  4GSW A;  2Z0E B;  2KWV B;  3SD5 A;  4W9F A;  4WJN A;  1R4N I;  2BYF A;  1M94 A;  2WDT B;  4MGZ E;  2BWF A;  4A3O A;  3WAN A;  1NBF C;  3V60 A;  2IYD B;  4WAA A;  1UD7 A;  3W1S A;  2JRI B;  3ZNH B;  2W9N A;  1E7U A;  1V2Y A;  3L0W B;  1OEY J;  3R66 C;  1I42 A;  3SDL C;  3I3T B;  4EOY A;  4FJZ A;  4URK A;  1WR1 A;  4AJW A;  4OVV A;  4BFR A;  3WAO A;  4DHZ B;  4HCP B;  1NDD A;  2Z59 B;  3ENE A;  1JRU A;  2KJH B;  3VH4 B;  2WX1 A;  1UZX B;  5AZF A;  2ZNV C;  2AEH A;  2N1V A;  4K81 A;  1WXV A;  3WAL A;  4ZYN A;  5E6O A;  4NAW A;  2MP2 B;  2AYO B;  3EC8 A;  2KQ7 A;  2MBE A;  2ZVO A;  1Y8R C;  2IO3 B;  1UH6 A;  1NI2 A;  2OOB B;  1KLV A;  4IC7 B;  4ZRJ A;  2JVC A;  3M3J A;  5HKH A;  4WWN A;  5L95 C;  4N9F 4;  2PPH A;  2LXA A;  3W1S C;  2KX0 A;  5G2N A;  3UIO B;  4GB9 A;  4GMV A;  1YD8 U;  3ZKJ C;  2M1M A;  4DK5 A;  2NS5 A;  4TUU A;  2KDB A;  4AP4 C;  3RD2 A;  5JHA A;  4MJS B;  1KM7 A;  2MRP A;  2RPQ A;  3APF A;  3IFW B;  3NZS A;  3PHX B;  1P1A A;  3ZRC A;  3VQI A;  2K6Q A;  1EF1 A;  1P3Q U;  3QC8 B;  4HJK A;  4MH0 E;  4IM2 A;  2IO1 B;  2A5U A;  2K39 A;  3NZU A;  2O2V B;  4GXB A;  3ALB A;  4LDT D;  3VUW A;  5J17 A;  1P9D U;  2BKF A;  5D2M B;  1UBI A;  4BKS A;  1WMH A;  2QHO A;  2C60 A;  4TQ1 A;  4WJP A;  3R7Q A;  3U7D A;  1WI0 A;  2DZI A;  4XX5 A;  1GC6 A;  2D07 B;  2JZ3 B;  5BO4 B;  2LXC A;  4FUL A;  4W9G A;  5TR5 A;  3H1U A;  2KZR A;  2ZPN A;  2LVP A;  3L13 A;  2REX A;  3B0A A;  4LJP B;  4KZ0 A;  2KC1 A;  3MJW A;  3K9P B;  4IM0 A;  4ANU A;  4EUT A;  2NPT B;  2KKC A;  4K7W A;  3JW0 X;  1EO6 A;  2MQJ A;  1V49 A;  1P98 A;  3GZN I;  3HK0 A;  5AZH A;  3WIM A;  2AL3 A;  1U4A A;  4MEL A;  3ML8 A;  3PHW B;  4M8N A;  4MM3 A;  1WGY A;  3KUC B;  4AWJ A;  3A4R A;  2L05 A;  4KIK A;  4W9I A;  3ZO5 B;  3ZUN A;  4PYU A;  5L83 A;  3UQB A;  1GJZ A;  2L76 A;  4E74 A;  1XT9 B;  1OGW A;  2D10 A;  1YX5 B;  3MHS D;  4FJY A;  1GNU A;  2GBJ A;  4GDL B;  3PTF C;  2CHX A;  4NQL B;  3A9J B;  2JWZ A;  4FLH A;  4IWP A;  4FHK A;  4BVU C;  2LUE A;  2PEA A;  1P0R A;  2DZM A;  3DVG Y;  1WGH A;  4LCD E;  5GMV A;  4G11 A;  4EEW A;  2LZ6 A;  4KZC A;  3ZVV A;  5AZG A;  2FIF A;  3IG3 A;  4NJ6 A;  1OEY A;  4MGK E;  2L8J A;  1Z5S B;  3HHM A;  3NS8 A;  4KIK B;  4W9E A;  4X57 B;  3H7S A;  4FAD A;  2DZJ A;  4GN1 A;  5EDS A;  2I1K A;  4FBJ B;  2KK8 A;  2LAS A;  2LRU A;  3KUD B;  4I6N B;  1UGM A;  4XZ4 A;  3TCA A;  3QHT A;  1E5W A;  1IPG A;  3SHQ A;  1EUV B;  1S3S G;  2KLG A;  2M8S A;  4MSM B;  3N32 A;  3KYC D;  1E8W A;  2WX0 A;  4F7Z A;  4ANX A;  2PE9 A;  2BYV E;  1WJU A;  2D2Q A;  2CHW A;  4K7S A;  2V4L A;  1WRD B;  2K25 A;  2LGD A;  2DAJ A;  3N3K B;  3VTV A;  4BBN C;  2ASQ A;  1C3T A;  5AEK B;  3BY4 B;  3QAR A;  1V6E A;  2UYZ B;  4II2 B;  2FCS A;  1FXT B;  2A4Z A;  3L17 A;  1WX7 A;  2KDI A;  3A1Q A;  3VAW A;  2LJ5 A;  5JHB A;  2WYQ A;  4KSL C;  4W9C A;  1WJN A;  5DPW A;  3AUL A;  1WY8 A;  4KV2 A;  2CHZ A;  4ICU A;  3VFK A;  2Z0D B;  3L08 A;  1OQY A;  1WX8 A;  2NBU A;  4WWP A;  4F1S A;  1WFY A;  2L0T A;  4MJS A;  4AJY B;  2V1Y A;  2CKH B;  1E8Z A;  2KTF A;  3UQA A;  3PVL A;  2LD9 A;  2ZPY A;  3A33 B;  3RYT A;  1AAR A;  3PGE A;  4JLC A;  1ZW7 A;  4IW0 A;  2FCM A;  4IG7 B;  3PLU A;  2KWU B;  1V9J A;  1WMH B;  4E71 A;  3PPA A;  1QZE A;  2K1F A;  3VUY A;  2MBH A;  4IM3 A;  2JZZ A;  2R2Q A;  1CMX B;  1S1Q B;  3X23 A;  1MG8 A;  3DVN V;  5IAA C;  3WA0 A;  1WXA A;  4PS8 A;  3APC A;  3SU8 X;  3TJP A;  1BT0 A;  1PQS A;  1XD3 B;  2GBN A;  4JIO U;  4BBN F;  1EF5 A;  4IWO A;  5JZE B;  4JGH B;  2KFK B;  2DAF A;  3NY5 A;  3DPD A;  2IY0 B;  2JPH A;  4RMA A;  3A9K B;  2O6V D;  2ZEQ A;  3TMP B;  1YX6 B;  3L16 A;  4WQO B;  2GBK A;  1WM2 A;  5KHO A;  3PS6 A;  3T8M A;  1J0G A;  3VTU A;  5D94 A;  4NQK E;  4BKS D;  2XK5 A;  2MP2 A;  2KXJ A;  2EMS A;  2D11 A;  1GG3 A;  3H7P B;  3EFU A;  2JY6 A;  2ZJD A;  3M95 A;  4P7I A;  4WJQ A;  3A9J A;  1SIF A;  3LDZ E;  4PS7 A;  4DHJ B;  3KH0 A;  3ZIM A;  3LJ3 A;  4EZJ A;  3OLM D;  3B1L X;  2KTR B;  3V6E B;  1K8R B;  5DCN A;  2BYE A;  2EMT A;  2KJ6 A;  3EEC A;  1Q1O A;  2KO3 A;  3VHT C;  1A5R A;  5LLI A;  2LVO A;  1F9J A;  5CHV C;  4B95 A;  2L0F A;  2KFK A;  1WF9 A;  2NBV B;  2DYB A;  2NVU I;  4W9K A;  4TV3 A;  4FHJ A;  1ZKH A;  3RUI B;  4NJ7 A;  4GOC A;  2KN5 A;  3U8Z A;  3ZTC A;  2D3G A;  4A20 A;  3CF6 E;  4GDL A;  1WE7 A;  3AU5 A;  4BKT A;  5D6J B;  3IHP C;  1T0Y A;  2AL6 A;  3PV1 A;  2K6D B;  4GIV A;  3UIN B;  3W1Y A;  1Q0W B;  1LXD A;  2O6V B;  2C9W B;  3DBL I;  2G3Q B;  2BPS A;  2YVC A;  2N1W A;  2VRR B;  3WAP A;  3ZNZ B;  4EKU A;  2K8B A;  2JT4 B;  4CHK A;  3AXC A;  2BGF A;  2N9P C;  2NPT A;  3PRP B;  3AU4 A;  2M4N A;  3JSV B;  2O6V A;  3VH3 B;  3A4S C;  3VTW A;  4BOZ B;  3M63 B;  3UGB B;  3DBH I;  1VD2 A;  3KYD D;  3HM6 X;  3JVZ X;  3L10 B;  3V62 A;  2MW5 A;  3JSV A;  4G0N B;  2N7E A;  4HWI B;  3B08 A;  4K7U A;  1J19 A;  2NR2 A;  1HE8 A;  2HE7 A;  2IBI B;  2ZCB A;  5C23 A;  3ZNG C;  4GDK A;  3DDC B;  4HDQ A;  5D7G A;  4FJV B;  4MGI E;  2MLB A;  3CST A;  3DVN U;  1LM8 B;  2JUO A;  3CMM B;  3Q3F A;  1VCB A;  4I6P A;  5DPR A;  3KVF B;  2XBB C;  4II3 B; 
#chains in the Genus database with same CATH topology
 4AQ7 A;  3Q69 A;  5GXG B;  2J0J A;  2BWE S;  2KWD A;  3EGR A;  2JF5 A;  3ZLZ A;  4HVB A;  2QEJ C;  2J7Q B;  2JQR B;  3RT3 B;  2KDF B;  4RGO S;  2WDV B;  1H8C A;  4EE2 A;  1LGR A;  3U4E G;  3VRA B;  2L32 A;  4MDK E;  1P7E A;  2UWQ A;  2ZNV B;  2XK5 B;  1V81 A;  1LQB A;  2KLC A;  3AEG B;  3V6C B;  4ZDV A;  2HD5 B;  1OFF A;  1TTN A;  4ASW C;  4HXD A;  3HVZ A;  4YWG G;  3X0W A;  1ZE3 D;  1QQR A;  3N30 A;  1YJI A;  1V5T A;  2L00 B;  3V61 A;  4JL9 A;  4ICV A;  3MTN B;  4G3X B;  3S2A A;  5HG2 A;  2KJR A;  4W9L A;  2V3N A;  2IGD A;  1I4P A;  3DQV A;  1UGJ A;  2V3S A;  4ZRI A;  4G50 A;  2MWS B;  4HEA 1;  3Q3J A;  2QJL A;  4HPM B;  1IP9 A;  1B1Z A;  1WGD A;  2QC8 A;  2KNB A;  2LJI A;  1L2N A;  2XEW A;  5J18 A;  2N9X A;  4HK2 A;  4AOF A;  4OW0 A;  4TQ0 A;  2BF8 B;  2JXX A;  3ZYY X;  4HDO A;  1WGR A;  1L0Y B;  2KVR A;  2LVQ A;  3H7P A;  3RN9 C;  4ACF A;  3T9L A;  2V3P A;  3IBE A;  3VR9 B;  2B3A A;  3K9O B;  4KSK C;  1VLB A;  2DZK A;  4B0M A;  2KTR A;  2PKO A;  4MM3 B;  2DYM A;  2WXJ A;  4JWS C;  1YJ1 A;  1NEK B;  2LGX A;  1XLP A;  1SGH A;  2QIL A;  2LRW A;  4EFO A;  1SE9 A;  2GOW A;  1WGK A;  1KH0 A;  3RZW C;  1TBE A;  3QX1 A;  3BVZ A;  2BBC A;  2KHW B;  5G55 A;  3CSF A;  1IBX B;  2IGG A;  1WJ4 A;  1T0R C;  5J2R A;  3R2T A;  3IVF A;  1G6J A;  4P16 A;  3TSS A;  4NY0 A;  4RGN A;  1TZ1 A;  4HLE A;  1OTR B;  2RD0 A;  3KW5 B;  1V1O A;  3AM9 A;  3NHE B;  3HVD A;  4LJO B;  2L7R A;  3BIN A;  4ZHP A;  4LNO A;  1I7H A;  4M0W B;  2G4D B;  4GDK B;  3R7R A;  1L7Y A;  3MHZ A;  3Q3M C;  1R4M B;  4DHJ D;  2WWZ A;  1XCQ L;  5FR6 A;  4C00 A;  4KKI A;  3RUL A;  1I35 A;  2UU7 A;  3TEZ A;  1IBX A;  5BMG A;  2KWV B;  3SD5 A;  4WJN A;  1R4N I;  1M94 A;  3MC0 B;  4A3O A;  3V60 A;  1UD7 A;  3W1S A;  3AEC B;  3SFE B;  4LNI A;  2PVO D;  2W9N A;  3SR6 A;  2LUM A;  1K51 A;  4EOY A;  4FJZ A;  4OZB A;  4AJW A;  1ZXI A;  4HCP B;  3FIL A;  2QIE B;  2JYE A;  1JRU A;  2BYT A;  2EEL A;  2MP2 B;  4IOI E;  2MBE A;  1Y8R C;  4IDI A;  5HKH A;  3URY A;  1JML A;  4WWN A;  1C77 A;  4N58 A;  4OZA A;  3E9S A;  3ZKJ C;  1YN4 A;  3CWI A;  5JHA A;  1EM7 A;  2LEK A;  2YEP B;  1L4D B;  2JSV X;  1JCK B;  2K39 A;  1ZP0 B;  4LDT D;  1P9D U;  1UBI A;  5BMH A;  4TQ1 A;  4WJP A;  3R7Q A;  4D2K A;  2D07 B;  4FUL A;  3H1U A;  2ZPN A;  3P4R B;  4KZ0 A;  3ZXR A;  2WS3 B;  4ANU A;  2BTE A;  2KKC A;  4K7W A;  3JW0 X;  5AZH A;  3ML8 A;  3PHW B;  1WGY A;  3A4R A;  5L83 A;  4ARI A;  1VZ7 A;  4E74 A;  1GNU A;  4GDL B;  3DWM A;  3PTF C;  4IWP A;  4FHK A;  1F1H A;  3DVG Y;  2WP9 B;  4G11 A;  4EEW A;  4C4V A;  1WRI A;  3IG3 A;  1IUE A;  4NJ6 A;  1JAL A;  2RDH A;  2L8J A;  4KIK B;  3AH7 A;  2LAS A;  1UGM A;  3I5J C;  2W3R A;  2RPV A;  1PDX A;  1C76 A;  1C4P A;  2K25 A;  2LGD A;  2DAJ A;  2ASQ A;  1T0S C;  3QAR A;  1ACC A;  5BYR A;  1V6E A;  4C4V B;  2H89 B;  2A4Z A;  4W9C A;  1SBB B;  1WY8 A;  1A70 A;  2CHZ A;  4ICU A;  2Z0D B;  1WXQ A;  1JRO A;  1E8Z A;  3A33 B;  3NG0 A;  4IW0 A;  3DHI C;  4KGT A;  2BS2 B;  2MBH A;  1CMX B;  3DVN V;  3SU8 X;  1BT0 A;  2D3C A;  2GBN A;  1F77 A;  4L1B A;  5JZE B;  2LGI A;  3A9K B;  2O6V D;  3PS6 A;  4LNK A;  3T8M A;  1J0G A;  4NQK E;  1YOV B;  1XO3 A;  1LO5 D;  4WH4 A;  1GG3 A;  2INC C;  2N9L A;  1N62 A;  3M95 A;  1MJD A;  1SIF A;  5D3I B;  4EZJ A;  2K22 A;  2MJD A;  1DOX A;  1K8R B;  5FK9 C;  5DCN A;  2BYE A;  2KN4 A;  1A5R A;  3EEC A;  4US8 A;  4B95 A;  2L0F A;  1NYR A;  1JWB D;  4YSY B;  2KFK A;  1WF9 A;  2NBV B;  4RGM A;  4FHJ A;  2WXI A;  4GOC A;  4A20 A;  1J7C A;  3IHP C;  2JZP A;  3P1M A;  3PV1 A;  1Q0W B;  1RFK A;  1C78 A;  2G3Q B;  2BPS A;  2VRR B;  1TJE A;  4EKU A;  2JT4 B;  2K0P A;  3C19 A;  3HUI A;  4LNF A;  3AXC A;  3BYT B;  3RNF C;  2M4N A;  1XXG A;  2J42 A;  2O6V A;  3B2G A;  3AB5 A;  3DBH I;  4US9 A;  3JVZ X;  3L10 B;  3Q3O C;  3JSV A;  4HKZ E;  2B76 B;  1ZUD 2;  1HE8 A;  2HE7 A;  2IBI B;  2ZCB A;  1E0Z A;  2N9K A;  4ZYS A;  1L5P A;  2Y5C A;  2Y3A A;  3KVF B;  2XBB C;  3MFG A;  2RSU A;  3LYY A;  1R4M I;  2V0G A;  3NJT A;  4H2A A;  1WZ0 A;  1GAQ B;  5CHF A;  4XWW A;  1WH3 A;  1RRB A;  1E7P B;  1WYG A;  2KQ4 X;  1XEE A;  4S0R A;  4FA6 A;  1RLF A;  2HJ8 A;  4PS3 A;  3PRZ A;  3ZDM C;  3AN1 A;  3DBR I;  4PYZ A;  2R2O A;  4DXG A;  3RZF A;  2C7M B;  4I6L B;  2KDE B;  4NNJ B;  4YTP B;  3QCA A;  3FAH A;  3NOB A;  1NI3 A;  4YXD B;  3ML9 A;  4MH8 A;  3OJ3 A;  4BZA A;  3P2B A;  2X8X X;  2IY1 B;  3QIJ A;  4XC2 A;  3KQ4 A;  3Q8A A;  4LNN A;  4KDL B;  1B9R A;  1GB1 A;  2HTH A;  1MPE A;  1YQB A;  5CTR C;  2K8H A;  3DOW A;  3KUZ A;  4IWQ A;  2KAC A;  4ANV A;  4EZK A;  1TKY A;  3HIZ A;  1TKE A;  1AW7 A;  1FPY A;  2IZV B;  4LDT B;  3U30 A;  3Q6B A;  2V9H A;  4XGA B;  1D3Z A;  4CO7 A;  2CS4 A;  3EHV A;  5HI1 A;  2FAZ A;  2PVG C;  1QOA A;  2LI5 A;  3N1Z C;  2LGY A;  1TS3 A;  1V8C A;  4JWU C;  1F52 A;  3APD A;  4WWO A;  4WQM A;  5E6N A;  4PT5 A;  3QQ8 B;  1RFA A;  2DHZ A;  2AWT A;  2KMC A;  2MBB B;  1SE2 A;  1L6V A;  3TEX A;  2G1E A;  1WJ6 A;  1FMA D;  1MHX A;  2KD0 A;  1F2R I;  1E8Y A;  2GBM A;  1WXS A;  2WDR B;  1K53 A;  3C0R B;  4IKG A;  2NTS A;  1J8C A;  1V80 A;  3E56 A;  3N1X C;  1Q5W B;  1YQ3 B;  2FCN A;  2PJH A;  1YJJ A;  2FUH B;  3RCZ A;  2CU3 A;  3P4P B;  1E90 A;  1WR6 E;  1UWX A;  3SFD B;  2C7N B;  2KAN A;  2N9E B;  4ZRK A;  4MGY E;  4NZL B;  3TL5 A;  2IO2 B;  3WAM A;  4C7Y A;  3ZNI D;  2W3S A;  1F0Z A;  3DBS A;  2IGH A;  3UF8 A;  4ITK A;  3UI3 A;  4YL8 A;  2HTM E;  3N1Y C;  2ZCC A;  4GSW A;  3EUB 2;  4W9F A;  3P4Q B;  2BYF A;  2BWF A;  1FFU A;  1JQ4 A;  1NBF C;  3VR8 B;  1E7U A;  2WXH A;  2WNM A;  2GRI A;  5IOI A;  2IND C;  4UDU C;  3WAO A;  4DHZ B;  1NDD A;  4WWM A;  3J9C A;  3VH4 B;  2V4I B;  3DBL B;  4K81 A;  1GB4 A;  1TY2 A;  2AYO B;  4M01 A;  2KQ7 A;  2ZVO A;  1NI2 A;  1KLV A;  2JVC A;  3M3J A;  2PPH A;  3RNG C;  2LXA A;  3U2S C;  2KX0 A;  1FCL A;  4LK0 M;  4GMV A;  4LTU A;  5AUI A;  4DK5 A;  2NS5 A;  4AP4 C;  3RD2 A;  2ONQ A;  1KM7 A;  2RPQ A;  1P1A A;  2K6Q A;  2E3T A;  2O2V B;  2QHO A;  1HTO A;  1D5M C;  5C3J B;  3U7D A;  4XX5 A;  4P1C C;  5BO4 B;  2WXF A;  4HKQ A;  2KZR A;  2AQ2 B;  3L13 A;  3B0A A;  3MJW A;  4IM0 A;  4EUT A;  1CQV A;  1V49 A;  1P98 A;  3GZN I;  3LB8 C;  3AV8 A;  3WIM A;  4MEL A;  4MM3 A;  2JX5 A;  3KUC B;  3LXF A;  4N59 A;  2J52 A;  2L05 A;  4KIK A;  4W9I A;  4P1B C;  4PYU A;  2L76 A;  2D10 A;  1L6U A;  2GBJ A;  2CHX A;  4FXC A;  2I38 A;  5EE0 A;  4NQL B;  2W82 A;  3A9J B;  4ZOH C;  4RF1 A;  1T3Q A;  3GP7 A;  3V3X A;  3ZVV A;  2BQQ A;  1OEY A;  4MGK E;  3HHM A;  2VH2 A;  3T3O A;  4FAD A;  1GOZ A;  2DZJ A;  5EDS A;  4RFB A;  3P4S B;  2ON8 A;  2K9X A;  4XZ4 A;  3NUH B;  1E5W A;  1XLO A;  4ZRP A;  1EUV B;  2KLG A;  4F7Z A;  4ANX A;  2W54 A;  3PZ8 A;  1FCC C;  1ZXH A;  2BYV E;  3Q8C A;  1WJU A;  2INP E;  2V4L A;  2WXR A;  2EKI A;  3BY4 B;  1I4H A;  2UYZ B;  5BYQ A;  4LLG M;  3L17 A;  1WX7 A;  2KDI A;  3A1Q A;  5JHB A;  2AQ3 B;  2MJ3 A;  3DBR B;  1EU3 A;  3W5U B;  1BXT A;  3VFK A;  3L08 A;  3RI7 C;  1OQY A;  2IDY A;  2WLB A;  4AJY B;  2V1Y A;  2LD9 A;  2ZPY A;  3RYT A;  1AAR A;  3PLU A;  1V9J A;  1TZO A;  3FIL B;  2JYT A;  3R8B A;  3PPA A;  1QZE A;  4RH6 A;  2R2Q A;  1PYW D;  4PS8 A;  3WA0 A;  3TJP A;  1PQS A;  1T5X D;  2AX5 A;  4BBN F;  1SB3 C;  1ZOY B;  4A8X C;  4JGH B;  1GPX A;  1FRR A;  2DAF A;  2IY0 B;  1E6E B;  3RMK C;  2WU2 B;  3W2D A;  4WQO B;  2IPK D;  5KHO A;  2WXO A;  1JWM D;  4BKS D;  3RNC C;  2MP2 A;  4ZRQ A;  2KXJ A;  3AE4 B;  1V1P B;  3GE8 C;  4P7I A;  3A9J A;  1QOB A;  2CJN A;  4PS7 A;  3KH0 A;  3ZIM A;  3OLM D;  2KTR B;  1N5W A;  2KJ6 A;  5LLI A;  5C2T B;  2WXM A;  2LVO A;  2NVU I;  3B9J A;  3AE1 B;  4TV3 A;  1MHH E;  3ZTC A;  3AU5 A;  3IT6 B;  5D6J B;  3UIN B;  3W1Y A;  1LXD A;  3W9C B;  3Q8E A;  3SEB A;  4A90 A;  2BGF A;  3PRP B;  3AU4 A;  4BOZ B;  3UGB B;  2MW5 A;  3GE3 C;  4HWI B;  5C23 A;  4HDQ A;  4MGI E;  2MLB A;  3CST A;  1HXY D;  1VJK A;  1VCB A;  5DPR A;  4II3 B;  3PZD A;  1C9F A;  3ECI A;  3ZDT A;  4ANW A;  4RM9 A;  4F8C B;  4EZL A;  4AUQ C;  2WHI A;  1LFD A;  3O65 B;  1WE6 A;  3ZRF A;  3OJ4 B;  3ZTD A;  3TIX A;  4WJO A;  3RNE C;  1WIA A;  1SF0 A;  3U7Z A;  4HPL B;  1FIQ A;  3D32 A;  1DYQ A;  1UBQ A;  2K8C A;  3A1Q B;  4DXA B;  1MG4 A;  1KLU D;  1C1Y B;  2KDM A;  2WU5 B;  2FCQ A;  4BKG A;  2KFJ A;  1QOF A;  2OJW A;  2JU6 X;  3DCG A;  3L54 A;  1K52 A;  1ZGU B;  2INN E;  4W9J A;  1GC7 A;  4W9D A;  3PLV A;  1V5O A;  2FNJ B;  4REZ A;  1WYW B;  1OQQ A;  3QK0 A;  4J3O D;  2KC2 A;  3PRE A;  4RGT A;  4NAW B;  5C1Z A;  4HCN B;  1R4N B;  2FID A;  1WXM A;  1HTQ A;  2KT7 A;  3AEF B;  3H6N A;  3GS2 A;  2G4S A;  2DEN B;  3HM3 A;  4BOS C;  4KKJ A;  2J0K A;  1WGG A;  2PE6 B;  3NZ3 A;  2AQ1 B;  2N7J A;  4DWF A;  3KWV A;  4O1N A;  2O2V A;  4Q2J A;  4YTM B;  3VVW B;  1D6E C;  4XYC A;  2WXL A;  3VXW A;  2N4F A;  3JYU A;  3R3M A;  5MPO A;  2DX5 B;  3HRD D;  4K1R B;  3T3N A;  4GU2 A;  2LHD A;  4FN2 A;  3AEA B;  1VRA B;  2G9H D;  2WXN A;  2Y5B B;  2GMI C;  3AE5 B;  1CZP A;  4B0E A;  4XDC A;  2M17 A;  2RR9 A;  1GUA B;  1RYJ A;  1WM3 A;  2BS4 B;  2KWC A;  1DOY A;  1DOI A;  1UEL A;  2MX2 A;  4KDI C;  1V86 A;  5G5G A;  4QAY A;  4B9K A;  3QAQ A;  1XF5 L;  1K50 A;  2YLM A;  3KWL A;  2PW9 A;  1WSP A;  1HEZ E;  1FD6 A;  2EKE C;  1PGA A;  4E3C A;  4TKN A;  2M0A A;  3PO0 A;  5IA7 A;  2RDB C;  3BK2 A;  2RMM A;  2KYW A;  3R2I A;  5E6J A;  2E6X A;  1QKZ A;  2C5L C;  2MJE A;  3H9D A;  3PT2 B;  4GGQ A;  2N7D A;  4HJG E;  4XE0 A;  3H8H A;  2LMC A;  5CHW A;  4HRO A;  2WXK A;  1N60 A;  2M19 A;  2WDT B;  4MGZ E;  4PK1 A;  4WAA A;  2JRI B;  3ZNH B;  4A6Q A;  4S17 A;  1JWS D;  1V2Y A;  3GB1 A;  1I42 A;  2BT6 A;  3SDL C;  1VZ8 A;  3Q3N C;  4URK A;  4OVV A;  4TSS A;  4WAF A;  3I57 A;  1ENF A;  2WX1 A;  3NVW A;  5AZF A;  2ZNV C;  2AEH A;  3N20 C;  1WXV A;  3WAL A;  3BYY B;  2KMM A;  3NVV A;  1TS5 A;  2I2Y A;  2Z8L A;  1UH6 A;  2DBY A;  4CQN A;  4ZRJ A;  3BII D;  3W1S C;  3UIO B;  5IKC M;  4TUU A;  3AE2 B;  3NZS A;  3PHX B;  2MRP A;  2M56 B;  3IFW B;  4YT0 B;  5H8Y E;  3VQI A;  4M0W A;  4HJK A;  2QSD A;  1UF0 A;  4GXB A;  2IO1 B;  2A5U A;  2MHJ A;  3ALB A;  2BKF A;  5D2M B;  3C8Y A;  1WMH A;  3BVG A;  1UNS A;  1GC6 A;  2LXC A;  5TR5 A;  1PGB A;  2WXG A;  2LVP A;  2REX A;  2BVC A;  1SIJ A;  5FKA C;  2NPT B;  3HK0 A;  2AL3 A;  4AWJ A;  3ZO5 B;  3ZUN A;  3UQB A;  1GJZ A;  1OGW A;  5AUK A;  3MHS D;  4FJY A;  4BAX A;  4M00 A;  4ZHO A;  3ABV B;  2JWZ A;  4FLH A;  3ZXV A;  2QCZ A;  4WUR A;  2K3U A;  1I4X A;  3NS1 A;  1L4Z B;  2LZ6 A;  2FIF A;  1QIL A;  1J7A A;  1SSN A;  3P63 A;  4W9E A;  5HHD G;  4X57 B;  3H7S A;  4FBJ B;  5FR3 A;  3FKY A;  3OWE B;  1KF6 B;  3MC8 A;  3TCA A;  2PMV A;  1RM6 C;  3ETR A;  1IPG A;  3U52 E;  1S3S G;  1E8W A;  4C56 C;  1HA5 A;  2D2Q A;  2CHW A;  3RPF C;  4K7S A;  3DHG C;  1YNT E;  2CJO A;  1C3T A;  1FXT B;  3VAW A;  2LJ5 A;  2WYQ A;  1AWD A;  1WJN A;  2TSS A;  4KV2 A;  2K5P A;  1ZDX A;  1XCT L;  3ZQ4 A;  2NBU A;  4WWP A;  4F1S A;  1WFY A;  2L0T A;  1SJE D;  1NEN B;  2CKH B;  4M02 A;  3UQA A;  4GLS C;  4OVZ A;  3ZGZ A;  4JLC A;  2FCM A;  4IG7 B;  4E71 A;  3VUY A;  2JZZ A;  1S1Q B;  1QT9 A;  3X23 A;  1MG8 A;  1WXA A;  2Y5P A;  3RFZ B;  2L1A A;  1EF5 A;  1BUI C;  3NY5 A;  2D5G A;  4RMA A;  2ZEQ A;  3V05 A;  1V97 A;  1PUT A;  3OG5 A;  3I63 C;  2XK5 A;  2EMS A;  3H7P B;  1MFW A;  2GB1 A;  2ZJD A;  2OED A;  4WJQ A;  1KTK A;  4DHJ B;  2DNF A;  2KO3 A;  3O13 A;  1F9J A;  1FXA A;  4ARC A;  2DYB A;  4W9K A;  2KAJ A;  2ZW0 A;  3RUI B;  1SE3 A;  3FC4 A;  3U8Z A;  2D3G A;  4BKT A;  3EFC A;  2ICI A;  3TEW A;  2K6D B;  2O6V B;  3VRB B;  1V1P A;  2YVC A;  3WAP A;  4C80 A;  2WGS A;  2K8B A;  4CHK A;  4WIP A;  3NVY A;  2N9P C;  1VD2 A;  1NYQ A;  3AEE B;  3KYD D;  3HM6 X;  3V62 A;  3N9Y C;  3AE9 B;  3W5V B;  1D4B A;  3PZ7 A;  2QMT A;  1J19 A;  4GDK A;  4KGS A;  3DDC B;  1D5Z C;  3DVN U;  3Q8B A;  3CMM B;  1AN8 A;  3Q3F A;  3DBH B;  1FRD A;  4DDI D;  1QLB B;  3VDZ A;  2BKR B;  3PSE B;  2IO0 B;  2VZK D;  1VDV A;  4OVU A;  4J6I A;  4DXF A;  2NBW B;  1JWA D;  4NAM A;  4DQO C;  5IO9 A;  3AEB B;  4KVG B;  2G45 B;  2LFI A;  5JH5 C;  2SAK A;  4N6E B;  4NJC A;  2ZVN A;  1SXT A;  3UIP B;  1TYG B;  1WX9 A;  5LXH A;  2KMA A;  1J7B A;  5IP4 D;  3MP9 A;  1QF6 A;  1VR9 A;  1TGZ B;  4RNA A;  4A3P A;  4MT5 A;  1C4C A;  5DPS A;  1KJT A;  5JXV A;  3GOE A;  2MCN B;  2WXP A;  1FFV A;  1ESF A;  1E7V A;  4TMA B;  3NRZ A;  1JWU D;  4OZC A;  1H4R A;  4YTN B;  3TBL D;  1TT5 B;  3CIR B;  3ZJU A;  1N6Z A;  3L4P A;  1T0Q C;  2L3Z A;  4MSQ B;  5E6P A;  3M62 B;  3ONS A;  3QWZ B;  5KHQ A;  2MSE D;  1I4Q A;  3EA6 A;  4DDG D;  2KX3 A;  2OHF A;  3AI5 A;  3Q8F A;  2NTT A;  5CX3 A;  1FNU A;  1C4A A;  4JX1 C;  1TIF A;  4CYE A;  1E10 A;  1OQR A;  1Z2M A;  4IUM B;  2MBQ A;  2I1J A;  1F2R C;  3VUX A;  3TEY A;  2CU1 A;  5LXI B;  2X38 A;  4RM8 A;  3A9K A;  3DWG C;  2NCN A;  2L52 A;  2OJR A;  3OAW A;  1ET9 A;  4A55 A;  1RAX A;  4USA A;  1XLN A;  4W9H A;  1WZ3 A;  1HZ5 A;  4DBG A;  1ROE A;  1FO4 A;  1C79 A;  4C7Z A;  1E8X A;  3GZN B;  3ZW3 A;  1SEB D;  3PRM B;  2BS3 B;  2C7H A;  4M8M A;  1ZDV A;  1RWS A;  2MA9 B;  4OHJ A;  1X1M A;  3AE3 B;  5DPT A;  2ZZP B;  2DYO A;  4A9A A;  1YIW A;  4R3D A;  2KOX A;  2Q5W D;  1M4V A;  1ISN A;  3IAS 1;  2SEB D;  2LWP A;  3DVG X;  2NMQ A;  3QJZ A;  2GLS A;  1ET6 A;  2YEP F;  4XDD A;  3QA8 A;  1PFD A;  1XQQ A;  3WCQ A;  2J0M A;  2GBR A;  3MJ5 A;  1Q10 A;  5D3D A;  2BW2 A;  4DHZ E;  1R7S A;  1UUP A;  4JQW C;  1PGX A;  4NPN A;  1FEH A;  1KRH A;  1IYF A;  2M0X A;  2CR5 A;  1XLQ A;  1I4G A;  4RCO A;  4YSX B;  4MEM A;  1HQR D;  2KQS A;  2MBO A;  1KOT A;  2JRH A;  2BB6 A;  2HJ1 A;  2RGF A;  4B6W A;  1TY0 A;  1KFY B;  2Z0E B;  1DGJ A;  3IT4 B;  2DLB A;  2N0S B;  1JW9 D;  4YSZ B;  4AS1 A;  5T8I A;  2BB5 A;  3IAM 1;  3WAN A;  1ZPS A;  1FNV A;  2IYD B;  5EE3 A;  3L0W B;  1OEY J;  3R66 C;  3I3T B;  1WR1 A;  4BFR A;  1IGD A;  2Z59 B;  3ENE A;  2KJH B;  5BYS A;  1UZX B;  2D3A A;  2N1V A;  4K3B A;  2IJ0 A;  5EE9 A;  4ZYN A;  5E6O A;  4NAW A;  1Y56 A;  2FBW B;  3IXS A;  1HZ6 A;  3EC8 A;  2RDG A;  2IO3 B;  1L0V B;  1YMH E;  2OOB B;  2JWU A;  4IC7 B;  3AED B;  5L95 C;  4N9F 4;  1P7F A;  2GI9 A;  5G2N A;  4GB9 A;  4XWT A;  2ZW1 A;  1YD8 U;  2M1M A;  1MI0 A;  2KDB A;  2PLP A;  4MJS B;  3APF A;  3ZRC A;  3BWU D;  1N61 A;  2HDE A;  1EF1 A;  1P3Q U;  3QC8 B;  4MH0 E;  1QOG A;  4IM2 A;  3NZU A;  3VUW A;  2WXQ A;  5J17 A;  4BKS A;  1VZ6 A;  1FM0 D;  2C60 A;  4L2Y A;  1WI0 A;  2DZI A;  2PTL A;  2JZ3 B;  1TS4 A;  4W9G A;  4KGR A;  1FNW A;  4LJP B;  5EE1 A;  2KC1 A;  3K9P B;  1EO6 A;  2MQJ A;  1I4R A;  1U4A A;  2VH1 A;  1N63 A;  4M8N A;  1JRP A;  2H88 B;  1XT9 B;  4RF0 A;  1YX5 B;  2JXT A;  2ACZ B;  2WDQ B;  2KVZ A;  1SE4 A;  4BVU C;  2LUE A;  2PEA A;  4L23 A;  1P0R A;  2DZM A;  3DHH C;  1WGH A;  5TSS A;  2DWQ A;  4LCD E;  5GMV A;  1YN5 A;  2FUG 1;  4KZC A;  5AZG A;  3BZD B;  3RNB C;  1Z5S B;  3NS8 A;  3KLS X;  3P42 A;  4GN1 A;  2I1K A;  1TKG A;  2XN9 C;  2KK8 A;  2LRU A;  1AYF A;  3KUD B;  4I6N B;  3QHT A;  3SHQ A;  2M8S A;  1D5X C;  1N5X A;  4MSM B;  1EWC A;  3N32 A;  1IGC A;  3KYC D;  2WX0 A;  2PE9 A;  1FXI A;  2VZK B;  1WRD B;  2FE8 A;  3N3K B;  3VTV A;  4BBN C;  5AEK B;  3AE6 B;  2QDF A;  4II2 B;  2FCS A;  2D3B A;  2J4X A;  3AMZ A;  5LNK 1;  3BK1 A;  4KSL C;  5DPW A;  3AUL A;  2LHE A;  3BVM A;  4K3C A;  1WX8 A;  1SJH D;  4MJS A;  3Q14 C;  3AE8 B;  1T6B X;  2KTF A;  3PVL A;  3PGE A;  2L83 A;  1ZW7 A;  5I4D A;  4JE3 B;  4P6V F;  2KWU B;  1E9M A;  1WMH B;  2K1F A;  4IM3 A;  1UWM A;  2LGS A;  3RNA C;  2R61 A;  3I9V 1;  2WQY B;  1YN3 A;  5IAA C;  4HRS A;  3APC A;  1BML C;  1XD3 B;  4JIO U;  5H92 C;  4IWO A;  2KFK B;  2MEK A;  3DPD A;  2JPH A;  2PIA A;  3TMP B;  1YX6 B;  3TUO A;  3L16 A;  2GBK A;  1WM2 A;  1CJE A;  1TS2 A;  2W55 A;  1MVK A;  3B2F A;  3VTU A;  5D94 A;  4HPP A;  5BMI A;  2D11 A;  3EFU A;  2JY6 A;  1WWT A;  3LDZ E;  1KLG D;  3LJ3 A;  3B1L X;  4KX6 B;  3V6E B;  1CK1 A;  2EMT A;  3VHT C;  1Q1O A;  4JPS A;  1NVI D;  5CHV C;  1EU4 A;  3AE7 B;  3NVZ A;  5HFY A;  5G5H A;  3Q2A C;  1ZKH A;  4NJ7 A;  2KN5 A;  3CF6 E;  4GDL A;  1WE7 A;  3ZJV A;  1T0Y A;  2AL6 A;  4GIV A;  2MH7 A;  3MC9 A;  2C9W B;  3DBL I;  2N1W A;  3ZNZ B;  5IN7 A;  2J53 A;  4MAC A;  2NPT A;  3JSV B;  3VH3 B;  3A4S C;  3VTW A;  3M63 B;  1STE A;  4G0N B;  2N7E A;  1L0X B;  4K7U A;  3B08 A;  2NR2 A;  3ZNG C;  5D7G A;  4FJV B;  1EWY C;  1LM8 B;  2XNA C;  2JUO A;  3ZJT A;  4I6P A;  1YQ4 B; 
#chains in the Genus database with same CATH homology
 2RSU A;  3PZD A;  1R4M I;  3ECI A;  3ZDT A;  4ANW A;  2J0J A;  4RM9 A;  4DDI D;  1WZ0 A;  3VDZ A;  2BWE S;  4F8C B;  2BKR B;  4EZL A;  5CHF A;  1WH3 A;  3PSE B;  2IO0 B;  2JF5 A;  4AUQ C;  3ZLZ A;  4HVB A;  1LFD A;  3O65 B;  1RRB A;  2J7Q B;  1WE6 A;  3RT3 B;  4OVU A;  2KDF B;  3ZRF A;  4J6I A;  3OJ4 B;  4FA6 A;  1RLF A;  2HJ8 A;  1H8C A;  3ZTD A;  2NBW B;  3TIX A;  4PS3 A;  4WJO A;  3PRZ A;  3ZDM C;  1WIA A;  3DBR I;  4PYZ A;  2R2O A;  4HPL B;  4KVG B;  3D32 A;  1UBQ A;  2K8C A;  3A1Q B;  4MDK E;  2G45 B;  5JH5 C;  4DXA B;  2UWQ A;  3RZF A;  2C7M B;  2ZNV B;  2XK5 B;  4I6L B;  2KDE B;  4NNJ B;  1V81 A;  1C1Y B;  1LQB A;  3QCA A;  2FCQ A;  2ZVN A;  4BKG A;  3UIP B;  1WX9 A;  2KFJ A;  2KLC A;  3NOB A;  5LXH A;  2KMA A;  3DCG A;  3L54 A;  1ZGU B;  4W9J A;  1GC7 A;  4W9D A;  1TGZ B;  3V6C B;  3PLV A;  1V5O A;  4A3P A;  2FNJ B;  4ZDV A;  1WYW B;  5DPS A;  3ML9 A;  1KJT A;  2HD5 B;  3GOE A;  2MCN B;  3QK0 A;  1TTN A;  4ASW C;  4HXD A;  3OJ3 A;  2KC2 A;  1E7V A;  3PRE A;  3X0W A;  3P2B A;  4NAW B;  5C1Z A;  4HCN B;  2IY1 B;  3QIJ A;  4XC2 A;  1H4R A;  3N30 A;  3TBL D;  1V5T A;  2L00 B;  3V61 A;  4KDL B;  2FID A;  1WXM A;  2HTH A;  4JL9 A;  4ICV A;  3MTN B;  4G3X B;  2L3Z A;  3S2A A;  3H6N A;  2KJR A;  4MSQ B;  4W9L A;  1YQB A;  5CTR C;  5E6P A;  2K8H A;  3DOW A;  3M62 B;  3KUZ A;  2G4S A;  3ONS A;  3QWZ B;  5KHQ A;  2MSE D;  4IWQ A;  4DDG D;  4ANV A;  4EZK A;  2KX3 A;  2DEN B;  3HIZ A;  3HM3 A;  3AI5 A;  4BOS C;  2IZV B;  2J0K A;  4LDT B;  1WGG A;  5CX3 A;  2PE6 B;  3DQV A;  3U30 A;  2V3S A;  4ZRI A;  4CYE A;  4G50 A;  2MWS B;  4DWF A;  1Z2M A;  4IUM B;  1D3Z A;  3Q3J A;  2MBQ A;  4CO7 A;  2CS4 A;  2I1J A;  3EHV A;  4HPM B;  1IP9 A;  3VUX A;  2O2V A;  1WGD A;  2FAZ A;  2KNB A;  1L2N A;  2LI5 A;  2CU1 A;  5LXI B;  2XEW A;  3VVW B;  2LGY A;  4RM8 A;  3A9K A;  3VXW A;  5J18 A;  2N9X A;  2NCN A;  4HK2 A;  2N4F A;  4AOF A;  4TQ0 A;  2BF8 B;  3JYU A;  3R3M A;  2OJR A;  3OAW A;  2DX5 B;  2JXX A;  4K1R B;  1RAX A;  3APD A;  4HDO A;  2KVR A;  1WGR A;  1WZ3 A;  2LVQ A;  3H7P A;  4W9H A;  4DBG A;  4GU2 A;  4WWO A;  5E6N A;  3T9L A;  3QQ8 B;  1RFA A;  2DHZ A;  4FN2 A;  2AWT A;  3IBE A;  2KMC A;  2B3A A;  2Y5B B;  3K9O B;  4KSK C;  2GMI C;  2MBB B;  2DZK A;  1E8X A;  2KTR A;  3ZW3 A;  3PRM B;  2C7H A;  2DYM A;  1WJ6 A;  2KD0 A;  2M17 A;  4M8M A;  1YJ1 A;  1E8Y A;  2GBM A;  2MA9 B;  2RR9 A;  1WXS A;  1X1M A;  5DPT A;  2LGX A;  1GUA B;  2ZZP B;  2DYO A;  3C0R B;  1SGH A;  1YIW A;  1J8C A;  2LRW A;  1WM3 A;  2KWC A;  1V80 A;  4EFO A;  1UEL A;  2KOX A;  2MX2 A;  1ISN A;  1SE9 A;  2GOW A;  4KDI C;  1V86 A;  2LWP A;  3DVG X;  3QJZ A;  1Q5W B;  3RZW C;  1TBE A;  4B9K A;  2FCN A;  3QX1 A;  3QA8 A;  2KHW B;  5G55 A;  1XQQ A;  2PJH A;  3CSF A;  3QAQ A;  2FUH B;  3RCZ A;  1WJ4 A;  2J0M A;  2GBR A;  2YLM A;  1E90 A;  5J2R A;  1WR6 E;  3IVF A;  1G6J A;  4DHZ E;  4NY0 A;  1TZ1 A;  4JQW C;  1OTR B;  2RD0 A;  4HLE A;  4NPN A;  2C7N B;  2EKE C;  2KAN A;  3KW5 B;  2N9E B;  3NHE B;  4ZRK A;  4TKN A;  4E3C A;  5IA7 A;  4MGY E;  1IYF A;  2M0X A;  4LJO B;  2CR5 A;  2L7R A;  3TL5 A;  3BIN A;  4M0W B;  2IO2 B;  2G4D B;  2C5L C;  4GDK B;  3R7R A;  3WAM A;  4MEM A;  2MBO A;  2KQS A;  3H9D A;  3PT2 B;  1L7Y A;  3ZNI D;  2JRH A;  1KOT A;  4GGQ A;  2N7D A;  4DHJ D;  3DBS A;  2WWZ A;  3UF8 A;  5FR6 A;  5CHW A;  4YL8 A;  3RUL A;  2RGF A;  1I35 A;  2ZCC A;  4B6W A;  4GSW A;  2Z0E B;  2KWV B;  3SD5 A;  4W9F A;  4WJN A;  1R4N I;  2BYF A;  1M94 A;  2WDT B;  4MGZ E;  2BWF A;  4A3O A;  3WAN A;  1NBF C;  3V60 A;  2IYD B;  4WAA A;  1UD7 A;  3W1S A;  2JRI B;  3ZNH B;  2W9N A;  1E7U A;  1V2Y A;  3L0W B;  1OEY J;  3R66 C;  1I42 A;  3SDL C;  3I3T B;  4EOY A;  4FJZ A;  4URK A;  1WR1 A;  4AJW A;  4OVV A;  4BFR A;  3WAO A;  4DHZ B;  4HCP B;  1NDD A;  2Z59 B;  3ENE A;  1JRU A;  2KJH B;  3VH4 B;  2WX1 A;  1UZX B;  5AZF A;  2ZNV C;  2AEH A;  2N1V A;  4K81 A;  1WXV A;  3WAL A;  4ZYN A;  5E6O A;  4NAW A;  2MP2 B;  2AYO B;  3EC8 A;  2KQ7 A;  2MBE A;  2ZVO A;  1Y8R C;  2IO3 B;  1UH6 A;  1NI2 A;  2OOB B;  1KLV A;  4IC7 B;  4ZRJ A;  2JVC A;  3M3J A;  5HKH A;  4WWN A;  5L95 C;  4N9F 4;  2PPH A;  2LXA A;  3W1S C;  2KX0 A;  5G2N A;  3UIO B;  4GB9 A;  4GMV A;  1YD8 U;  3ZKJ C;  2M1M A;  4DK5 A;  2NS5 A;  4TUU A;  2KDB A;  4AP4 C;  3RD2 A;  5JHA A;  4MJS B;  1KM7 A;  2MRP A;  2RPQ A;  3APF A;  3IFW B;  3NZS A;  3PHX B;  1P1A A;  3ZRC A;  3VQI A;  2K6Q A;  1EF1 A;  1P3Q U;  3QC8 B;  4HJK A;  4MH0 E;  4IM2 A;  2IO1 B;  2A5U A;  2K39 A;  3NZU A;  2O2V B;  4GXB A;  3ALB A;  4LDT D;  3VUW A;  5J17 A;  1P9D U;  2BKF A;  5D2M B;  1UBI A;  4BKS A;  1WMH A;  2QHO A;  2C60 A;  4TQ1 A;  4WJP A;  3R7Q A;  3U7D A;  1WI0 A;  2DZI A;  4XX5 A;  1GC6 A;  2D07 B;  2JZ3 B;  5BO4 B;  2LXC A;  4FUL A;  4W9G A;  5TR5 A;  3H1U A;  2KZR A;  2ZPN A;  2LVP A;  3L13 A;  2REX A;  3B0A A;  4LJP B;  4KZ0 A;  2KC1 A;  3MJW A;  3K9P B;  4IM0 A;  4ANU A;  4EUT A;  2NPT B;  2KKC A;  4K7W A;  3JW0 X;  1EO6 A;  2MQJ A;  1V49 A;  1P98 A;  3GZN I;  3HK0 A;  5AZH A;  3WIM A;  2AL3 A;  1U4A A;  4MEL A;  3ML8 A;  3PHW B;  4M8N A;  4MM3 A;  1WGY A;  3KUC B;  4AWJ A;  3A4R A;  2L05 A;  4KIK A;  4W9I A;  3ZO5 B;  3ZUN A;  4PYU A;  5L83 A;  3UQB A;  1GJZ A;  2L76 A;  4E74 A;  1XT9 B;  1OGW A;  2D10 A;  1YX5 B;  3MHS D;  4FJY A;  1GNU A;  2GBJ A;  4GDL B;  3PTF C;  2CHX A;  4NQL B;  3A9J B;  2JWZ A;  4FLH A;  4IWP A;  4FHK A;  4BVU C;  2LUE A;  2PEA A;  1P0R A;  2DZM A;  3DVG Y;  1WGH A;  4LCD E;  5GMV A;  4G11 A;  4EEW A;  2LZ6 A;  4KZC A;  3ZVV A;  5AZG A;  2FIF A;  3IG3 A;  4NJ6 A;  1OEY A;  4MGK E;  2L8J A;  1Z5S B;  3HHM A;  3NS8 A;  4KIK B;  4W9E A;  4X57 B;  3H7S A;  4FAD A;  2DZJ A;  4GN1 A;  5EDS A;  2I1K A;  4FBJ B;  2KK8 A;  2LAS A;  2LRU A;  3KUD B;  4I6N B;  1UGM A;  4XZ4 A;  3TCA A;  3QHT A;  1E5W A;  1IPG A;  3SHQ A;  1EUV B;  1S3S G;  2KLG A;  2M8S A;  4MSM B;  3N32 A;  3KYC D;  1E8W A;  2WX0 A;  4F7Z A;  4ANX A;  2PE9 A;  2BYV E;  1WJU A;  2D2Q A;  2CHW A;  4K7S A;  2V4L A;  1WRD B;  2K25 A;  2LGD A;  2DAJ A;  3N3K B;  3VTV A;  4BBN C;  2ASQ A;  1C3T A;  5AEK B;  3BY4 B;  3QAR A;  1V6E A;  2UYZ B;  4II2 B;  2FCS A;  1FXT B;  2A4Z A;  3L17 A;  1WX7 A;  2KDI A;  3A1Q A;  3VAW A;  2LJ5 A;  5JHB A;  2WYQ A;  4KSL C;  4W9C A;  1WJN A;  5DPW A;  3AUL A;  1WY8 A;  4KV2 A;  2CHZ A;  4ICU A;  3VFK A;  2Z0D B;  3L08 A;  1OQY A;  1WX8 A;  2NBU A;  4WWP A;  4F1S A;  1WFY A;  2L0T A;  4MJS A;  4AJY B;  2V1Y A;  2CKH B;  1E8Z A;  2KTF A;  3UQA A;  3PVL A;  2LD9 A;  2ZPY A;  3A33 B;  3RYT A;  1AAR A;  3PGE A;  4JLC A;  1ZW7 A;  4IW0 A;  2FCM A;  4IG7 B;  3PLU A;  2KWU B;  1V9J A;  1WMH B;  4E71 A;  3PPA A;  1QZE A;  2K1F A;  3VUY A;  2MBH A;  4IM3 A;  2JZZ A;  2R2Q A;  1CMX B;  1S1Q B;  3X23 A;  1MG8 A;  3DVN V;  5IAA C;  3WA0 A;  1WXA A;  4PS8 A;  3APC A;  3SU8 X;  3TJP A;  1BT0 A;  1PQS A;  1XD3 B;  2GBN A;  4JIO U;  4BBN F;  1EF5 A;  4IWO A;  5JZE B;  4JGH B;  2KFK B;  2DAF A;  3NY5 A;  3DPD A;  2IY0 B;  2JPH A;  4RMA A;  3A9K B;  2O6V D;  2ZEQ A;  3TMP B;  1YX6 B;  3L16 A;  4WQO B;  2GBK A;  1WM2 A;  5KHO A;  3PS6 A;  3T8M A;  1J0G A;  3VTU A;  5D94 A;  4NQK E;  4BKS D;  2XK5 A;  2MP2 A;  2KXJ A;  2EMS A;  2D11 A;  1GG3 A;  3H7P B;  3EFU A;  2JY6 A;  2ZJD A;  3M95 A;  4P7I A;  4WJQ A;  3A9J A;  1SIF A;  3LDZ E;  4PS7 A;  4DHJ B;  3KH0 A;  3ZIM A;  3LJ3 A;  4EZJ A;  3OLM D;  3B1L X;  2KTR B;  3V6E B;  1K8R B;  5DCN A;  2BYE A;  2EMT A;  2KJ6 A;  3EEC A;  1Q1O A;  2KO3 A;  3VHT C;  1A5R A;  5LLI A;  2LVO A;  1F9J A;  5CHV C;  4B95 A;  2L0F A;  2KFK A;  1WF9 A;  2NBV B;  2DYB A;  2NVU I;  4W9K A;  4TV3 A;  4FHJ A;  1ZKH A;  3RUI B;  4NJ7 A;  4GOC A;  2KN5 A;  3U8Z A;  3ZTC A;  2D3G A;  4A20 A;  3CF6 E;  4GDL A;  1WE7 A;  3AU5 A;  4BKT A;  5D6J B;  3IHP C;  1T0Y A;  2AL6 A;  3PV1 A;  2K6D B;  4GIV A;  3UIN B;  3W1Y A;  1Q0W B;  1LXD A;  2O6V B;  2C9W B;  3DBL I;  2G3Q B;  2BPS A;  2YVC A;  2N1W A;  2VRR B;  3WAP A;  3ZNZ B;  4EKU A;  2K8B A;  2JT4 B;  4CHK A;  3AXC A;  2BGF A;  2N9P C;  2NPT A;  3PRP B;  3AU4 A;  2M4N A;  3JSV B;  2O6V A;  3VH3 B;  3A4S C;  3VTW A;  4BOZ B;  3M63 B;  3UGB B;  3DBH I;  1VD2 A;  3KYD D;  3HM6 X;  3JVZ X;  3L10 B;  3V62 A;  2MW5 A;  3JSV A;  4G0N B;  2N7E A;  4HWI B;  3B08 A;  4K7U A;  1J19 A;  2NR2 A;  1HE8 A;  2HE7 A;  2IBI B;  2ZCB A;  5C23 A;  3ZNG C;  4GDK A;  3DDC B;  4HDQ A;  5D7G A;  4FJV B;  4MGI E;  2MLB A;  3CST A;  3DVN U;  1LM8 B;  2JUO A;  3CMM B;  3Q3F A;  1VCB A;  4I6P A;  5DPR A;  3KVF B;  2XBB C;  4II3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...