3B0AA

Crystal structure of the mouse hoil1-l-nzf in complex with linear di-ubiquitin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
b'MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyubiquitin-C
publication title Specific recognition of linear ubiquitin chains by the Npl4 zinc finger (NZF) domain of the HOIL-1L subunit of the linear ubiquitin chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/metal binding protein
total genus 43
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b0aA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b0aA02
3ZNZB 2LVPA 4MGKE 2IO1B 2K8BA 3K9OB 4W9HA 2J0JA 4W9DA 2PE6B 4MJSB 1MG8A 4KZ0A 5D7GA 1QZEA 4A20A 1P1AA 4X57B 4FBJB 2D10A 1WZ3A 3SHQA 3L0WB 1GUAB 5AZHA 3LDZE 2C7MB 3QCAA 4GSWA 4LCDE 3GZNI 2MQJA 4MM3A 5AEKB 2KMCA 3D32A 5L83A 4II3B 3UINB 3NHEB 4JLCA 1J19A 2EMTA 1Z2MA 2PE9A 4MGZE 5D94A 2IY0B 3HM3A 1G6JA 4MSQB 3SDLC 3ECIA 3HM6X 2K25A 1E8ZA 2LZ6A 1KJTA 4B9KA 3JSVB 4ANXA 3KUDB 3ONSA 4GDKA 2LGXA 2DAFA 1WZ0A 3M95A 1RLFA 4IG7B 1WE6A 2MP2A 3B1LX 3WAMA 1FXTB 2BGFA 4XX5A 1E8YA 2CS4A 3L17A 2D2QA 1EO6A 2MBQA 3DPDA 3V6CB 3VVWB 5DPRA 5JH5C 3PTFC 2JRHA 4I6PA 3ZO5B 1XQQA 1D3ZA 3NZUA 1TBEA 2M1MA 2O6VB 2LVQA 3IHPC 3AU4A 5C23A 4KDLB 4W9CA 3N3KB 3SD5A 2ZCCA 1V5OA 3X0WA 5DCNA 4W9JA 3KVFB 3WAOA 4FJVB 2RD0A 5AZFA 4A3PA 1WXMA 4NQKE 1H4RA 1V6EA 1A5RA 2KJ6A 4FHJA 5CHWA 4MEMA 5BO4B 3V60A 2XK5B 2LRUA 2R2QA 1WIAA 4KIKA 3L16A 3OAWA 5G2NA 2L76A 4BVUC 4CHKA 3ML9A 4F8CB 3RZFA 1WMHA 3Q3FA 1ZKHA 4PYUA 2KZRA 2DENB 2XEWA 3I3TB 4HWIB 3MHSD 1V2YA 3PT2B 4NAWB 2DX5B 1V5TA 2GBMA 4IWPA 1GC6A 3A9JB 5L95C 2BWES 1WR1A 2I1JA 1E5WA 1S1QB 2C60A 1ISNA 2KTRB 4W9LA 3S2AA 3VH4B 2PEAA 2YVCA 4JIOU 3HK0A 1WJUA 1UBQA 2KWVB 2NS5A 2A4ZA 3QARA 3DVNV 4ZRKA 3WAPA 2DYBA 3V61A 5CHFA 3VAWA 2OOBB 4K7WA 4FLHA 5EDSA 3VH3B 2KVRA 1WM3A 2L0FA 4PS8A 2ZJDA 2IY1B 2R2OA 4HXDA 2GMIC 4LDTD 3QHTA 1E8WA 3ZRCA 2FCMA 2KDEB 3EFUA 2GBKA 1UELA 2C7NB 3H7SA 2N9XA 1AARA 4ICVA 2JRIB 2LXCA 4EUTA 2DZJA 2IBIB 4FULA 3PPAA 3QJZA 2KKCA 2NBWB 2JXXA 4ZRIA 2C9WB 2VRRB 3TJPA 1SE9A 3WALA 2MBBB 1Z5SB 2D07B 2AWTA 2N7DA 4FN2A 4MGYE 3KYDD 3PSEB 2JT4B 4NNJB 5HKHA 3TIXA 4DHJB 3P2BA 3QA8A 4WWPA 5IA7A 1P9DU 5CHVC 4EZJA 5JHAA 3A1QA 1WX8A 4NY0A 2LVOA 3NZSA 2ZPYA 2MP2B 4AUQC 2HJ8A 2KJHB 3JW0X 4BOSC 1U4AA 1WJNA 1SGHA 3VDZA 3UF8A 4BKSA 2JF5A 3O65B 4GMVA 5C1ZA 1EF1A 1YX6B 2CHXA 2FCQA 4J6IA 3PGEA 3OJ3A 3QK0A 4DDID 2BKFA 2G45B 2J7QB 3RZWC 2KFKA 1KM7A 3A9KA 4MH0E 4AP4C 1J8CA 1WGDA 2LGDA 3IBEA 1UGMA 2BYFA 2N9EB 3M62B 2CR5A 1WE7A 4HPLB 3UQAA 1H8CA 4IM3A 1P0RA 3VUXA 1WYWB 3ZNGC 3QIJA 3ZVVA 4HVBA 1IP9A 5DPWA 4HCPB 3EECA 3KYCD 3PLVA 2K6DB 3VUYA 2IO2B 4M8NA 2KNBA 4KIKB 2FAZA 4PYZA 3ZNHB 2WWZA 2IO3B 2BKRB 1WXVA 2ZPNA 3DVGX 3ZDMC 2KC1A 1V49A 5CX3A 2LASA 2LUEA 2L7RA 1OTRB 1GG3A 2NVUI 2Y5BB 3B08A 4GDLA 2O2VA 3AULA 5D6JB 3K9PB 1WMHB 3AXCA 4G11A 1V86A 3UGBB 1WFYA 3TCAA 5J2RA 2OJRA 4NJ7A 2Z0EB 4KV2A 2PPHA 4EZLA 3OJ4B 4WAAA 4DWFA 4GU2A 1WX9A 2LRWA 2M17A 2AL6A 4ANVA 1TTNA 1GNUA 2LXAA 2O6VD 3R3MA 2IO0B 3CMMB 4GGQA 5KHQA 3H6NA 2L8JA 2FUHB 4FADA 3UIOB 2DZIA 2EKEC 1V81A 2CHZA 2KLGA 3Q3JA 1GC7A 4DHZB 2KDIA 4IM0A 2NBUA 4NQLB 4HK2A 5IAAC 2C7HA 1SIFA 4ZRJA 2ZZPB 1E7UA 1LFDA 1WGHA 3ZKJC 2W9NA 4K7SA 2N4FA 4I6LB 2FIDA 2MW5A 3LJ3A 4PS7A 1J0GA 2REXA 2Z59B 2NCNA 1Q1OA 2MCNB 4E3CA 3RT3B 1LM8B 3L13A 2FNJB 4IC7B 4G50A 1T0YA 2DAJA 2KDFB 2G4SA 3ZTCA 1WJ4A 4WJNA 4DBGA 3DOWA 3JYUA 3ZLZA 3TBLD 4LJOB 2NPTA 3ALBA 2JY6A 4XC2A 1LQBA 4IWQA 3KUCB 1CMXB 4MELA 3BINA 3PRMB 3PZDA 4WJOA 4AOFA 1WX7A 3C0RB 3H7PA 1VCBA 2WX0A 2L0TA 4WJQA 5DPSA 4EFOA 2L00B 2J0MA 3QAQA 1WGGA 2UYZB 4B95A 3A1QB 3PV1A 4FJZA 4AWJA 5LLIA 2KOXA 1R4MI 4W9FA 4WQOB 3VTUA 3TMPB 1UD7A 3MTNB 1EF5A 4W9IA 1WXSA 2ZVOA 4BKGA 4F1SA 2YLMA 4GB9A 2KX3A 4GIVA 3DQVA 2K1FA 1Y8RC 2K6QA 4K7UA 3DBRI 5CTRC 2JUOA 3VTVA 3ENEA 3M3JA 2JZZA 2KFKB 2UWQA 3A9KB 5AZGA 1K8RB 3PRZA 2B3AA 2WDTB 3KH0A 1YD8U 3APCA 1IPGA 4FHKA 2KWCA 4TUUA 2EMSA 3ZTDA 3MJWA 3ZIMA 1TZ1A 2MSED 4F7ZA 3DCGA 2GBNA 2C5LC 4DHJD 4DXAB 4HLEA 4ICUA 2LI5A 4CYEA 2KXJA 2RSUA 1EUVB 2JPHA 3OLMD 4JL9A 3IG3A 4JQWC 3DVGY 5JZEB 2KK8A 3VTWA 4BKTA 3L10B 2HTHA 2HD5B 3DDCB 4GDLB 2MBOA 2O2VB 3AI5A 4GDKB 4W9EA 3HIZA 2I1KA 4E71A 2D3GA 4HDOA 2KD0A 3IFWB 2G4DB 2KMAA 1JRUA 2KDBA 1OEYA 1WGRA 4GXBA 4TQ1A 5E6OA 1I42A 2KN5A 2DYOA 1BT0A 4BBNC 1P3QU 2KTRA 3SU8X 1WR6E 4KSKC 2BF8B 3A4SC 3KUZA 3VUWA 2KTFA 4IWOA 4KDIC 2MA9B 5KHOA 4EKUA 3X23A 2DZMA 2Z0DB 2GBRA 5JHBA 3CSTA 1XD3B 2KFJA 4BOZB 4G0NB 1ZGUB 2V3SA 2FCNA 3QC8B 2CHWA 2JZ3B 2RGFA 3BY4B 4RMAA 2NBVB 4RM9A 4HPMB 1KOTA 1WM2A 2RPQA 4ZDVA 4TQ0A 3T8MA 4AJYB 2RR9A 4DK5A 2DYMA 3EC8A 1L2NA 3EHVA 2WX1A 3NS8A 4II2B 2MX2A 3V62A 4EOYA 1E90A 3WIMA 3WA0A 3PRPB 1Q5WB 1WY8A 1Q0WB 2M0XA 3M63B 3N32A 4YL8A 2FCSA 5J17A 2PJHA 3QQ8B 2FIFA 1LXDA 1RRBA 1PQSA 2MBEA 2WYQA 3V6EB 2A5UA 2NPTB 3QWZB 2BPSA 3DBLI 2JWZA 4NJ6A 4P7IA 4JGHB 2AL3A 5TR5A 2GBJA 3H7PB 4AJWA 3QX1A 1WRDB 3U30A 2N1VA 1L7YA 3W1SA 3DBHI 3W1SC 4BBNF 1C1YB 2CKHB 2ZNVC 3PVLA 3RULA 2IYDB 4TV3A 2KLCA 2D11A 3W1YA 5LXHA 1F9JA 3U7DA 4B6WA 5G55A 3DVNU 3R7QA 2MBHA 1WGYA 3ZRFA 4XZ4A 3WANA 1NI2A 5GMVA 3R66C 1KLVA 3RYTA 4EEWA 4KVGB 3NY5A 1YIWA 4M0WB 3TL5A 2N7EA 2MRPA 1X1MA 1V80A 4K81A 2V1YA 1WH3A 3NOBA 4MJSA 2K8HA 3T9LA 1R4NI 2LJ5A 1YJ1A 2KO3A 2MWSB 4OVUA 3APDA 3RCZA 3UQBA 2CU1A 3HHMA 2AEHA 3PREA 4WWOA 3VFKA 4IM2A 4G3XB 1OEYJ 2N9PC 2KHWB 2BYVE 3L54A 2ZCBA 2JVCA 3N30A 4KZCA 4W9GA 4IW0A 4I6NB 3PS6A 1UZXB 2XBBC 1VD2A 3JSVA 5J18A 2G3QB 4K1RB 2QHOA 4M8MA 3APFA 4LJPB 1IYFA 4GN1A 2ASQA 3JVZX 3ZDTA 2L05A 1WXAA 2DHZA 2LD9A 4PS3A 1YQBA 4BKSD 3VHTC 4DDGD 1YX5B 1E7VA 2BWFA 2KANA 3B0AA 1NBFC 1UH6A 2ZVNA 4HCNB 4ZYNA 3PHXB 5E6PA 2KX0A 5E6NA 2O6VA 2KQSA 1XT9B 2M4NA 4FJYA 4A3OA 3AU5A 1P98A 2M8SA 4ANWA 3DBSA 1C3TA 5DPTA 4NPNA 4W9KA 3GOEA 4HDQA 1ZW7A 4N9F4 1WF9A 1WJ6A 1WI0A 4LDTB 2NR2A 2MLBA 3ML8A 3PLUA 2XK5A 3H1UA 2KWUB 3R7RA 1M94A 2KQ7A 3IVFA 4TKNA 2L3ZA 3VQIA 1TGZB 4IUMB 1RFAA 2K39A 1OQYA 4CO7A 3ZUNA 4DHZE 4OVVA 4RM8A 1S3SG 1RAXA 3A33B 3KW5B 4URKA 4EZKA 1GJZA 1HE8A 2DZKA 2K8CA 4NAWA 3L08A 2KJRA 3A9JA 2V4LA 4HJKA 4ASWC 3ZW3A 1I35A 3CSFA 4MSMB 1E8XA 2N1WA 2BYEA 4BFRA 2ZEQA 2AYOB 4KSLC 5FR6A 1NDDA 1OGWA 4GOCA 3ZNID 2ZNVB 3UIPB 4ANUA 1V9JA 2LGYA 2HE7A 2GOWA 2KC2A 2J0KA 2LWPA 4MGIE 3A4RA 3RD2A 3RUIB 4FA6A 3CF6E 3H9DA 4WJPA 3U8ZA 4MDKE 3VXWA 4E74A 1UBIA 2IZVB 4WWNA 5LXIB 3PHWB 5D2MB
chains in the Genus database with same CATH superfamily
3ZNZB 1PDXA 1ESFA 3K9OB 2J0JA 4MJSB 4DXGA 1SSNA 1P1AA 4X57B 2D10A 1WZ3A 2IGHA 3SHQA 2WLBA 2CU3A 4GSWA 5AEKB 4II3B 4TMAB 4JLCA 2EMTA 4B0MA 2QDFA 1I7HA 4JX1C 4MSQB 3ECIA 3RMKC 2H89B 3Q6BA 3TEXA 2LGXA 2DAFA 1WZ0A 1K50A 3M95A 2MP2A 3B1LX 2BGFA 1XLPA 5H8YE 2D2QA 1EO6A 3DPDA 3V6CB 2JRHA 4I6PA 3ZO5B 1XQQA 1D3ZA 2LEKA 2M1MA 2LVQA 5C23A 2I38A 3VR8B 1NVID 1E9MA 3X0WA 2I2YA 5IP4D 4ARIA 4A3PA 1A5RA 1I4XA 3OWEB 4FHJA 5BMIA 4XE0A 2BW2A 2WQYB 5BO4B 2R2QA 1F0ZA 1T0RC 5G2NA 4CHKA 1WMHA 2KZRA 3T3OA 3I3TB 4HWIB 4NAWB 4IWPA 1GC6A 3A9JB 3S2AA 2C60A 4BAXA 1AN8A 1K51A 2N7JA 3N1ZC 1PGBA 1TYGB 2A4ZA 2DYBA 1E7PB 3AECB 3BK1A 4A90A 4K7WA 2ZW0A 2L0FA 2K0PA 2NMQA 4LNOA 2R2OA 3P1MA 4LDTD 3AE6B 4HKQA 1QKZA 2MJEA 1EWYC 1I4RA 1UELA 2D5GA 2N9XA 4ICVA 1YJJA 2JRIB 2DZJA 2VRRB 3WALA 4MM3B 2JT4B 3L4PA 3TIXA 3P2BA 3QA8A 1P9DU 5JHAA 4K3BA 3A1QA 2LVOA 3Q8FA 3JW0X 1U4AA 4WURA 4BKSA 4WWMA 3RZWC 4KGSA 4IDIA 4MH0E 4AP4C 2LGDA 1HXYD 2BYFA 4ARCA 3UQAA 3ZNGC 3QIJA 3NVWA 3SFEB 3RN9C 3EECA 2K3UA 3VUYA 3ZNHB 4KIKB 5HHDG 1YN5A 5CX3A 2W82A 1GG3A 1N63A 2O2VA 3AULA 3N20C 3P42A 3K9PB 1T0SC 1V86A 3UGBB 5J2RA 1IGCA 5C3JB 4WAAA 4DWFA 4US9A 4ANVA 3N1XC 2LXAA 3R3MA 3CMMB 1EWCA 5KHQA 1JW9D 2FUHB 3HVZA 2BBCA 2DZIA 2EKEC 4IM0A 1HA5A 2C7HA 3Q69A 1D5ZC 2W9NA 1ZUD2 3MP9A 2DNFA 3L13A 2FNJB 5FK9C 2JYTA 2KDFB 1SJED 3ZYYX 3ZTCA 4WJNA 4DBGA 3DOWA 3JYUA 3HVDA 3ZLZA 4LJOB 1YMHE 3ALBA 2JY6A 3IXSA 1CMXB 4WJOA 3C0RB 2JZPA 2WX0A 4CQNA 2W3SA 2L00B 3SFDB 2KOXA 4YTPB 1R4MI 4W9FA 2KACA 4WQOB 3MTNB 1BMLC 2NTTA 3Q3MC 1WXSA 2ON8A 1SXTA 4F1SA 3Q3OC 4GB9A 2K6QA 3DBRI 5CTRC 3M3JA 1FRDA 1K8RB 1C79A 4TUUA 3ZTDA 2KWCA 4F7ZA 4HLEA 4CYEA 2JPHA 4JL9A 1T6BX 1KF6B 2KK8A 2HTHA 3SR6A 1T5XD 3DDCB 1OFFA 1HTOA 2I1KA 4AS1A 4HEA1 1JRUA 2KDBA 1OEYA 4GXBA 3KQ4A 2DYOA 4BBNC 1CJEA 2KQ4X 1WSPA 2BF8B 4KDIC 2MA9B 3X23A 2DZMA 4WQMA 2GBRA 1F52A 5BYQA 4OHJA 4G0NB 2BS4B 2RGFA 3BY4B 4IKGA 3EFCA 4RM9A 1WM2A 3AE8B 3BYYB 2WX1A 3NS8A 1I4QA 2LFIA 3WA0A 3U2SC 1WY8A 3M63B 4YL8A 2HDEA 2PJHA 1RRBA 1PQSA 2MBEA 3V6EB 2A5UA 2BPSA 3NRZA 4JGHB 2AL3A 4YSYB 1IUEA 1GPXA 3NVYA 3NS1A 1WRDB 1J7BA 3U30A 3W1SA 2VZKB 2LGIA 4PT5A 1F9JA 4B6WA 4RGTA 3ZRFA 3WANA 1NI2A 3R66C 4KVGB 3NY5A 1YIWA 2MRPA 1C4PA 4K81A 1R4NI 2LJ5A 4OVUA 3AN1A 3RCZA 1TKEA 2AQ1B 2CU1A 4TSSA 3HRDD 1L0YB 3VFKA 3PREA 2BS3B 2OHFA 4IM2A 2N9PC 2Y3AA 3Q14C 4IW0A 4A6QA 1Y56A 4I6NB 3B2GA 5J18A 3JSVA 4K1RB 2QSDA 3APFA 3IAM1 3ZDTA 1WXAA 2DHZA 2LD9A 1I4PA 2BWFA 2WHIA 1NBFC 1UH6A 2TSSA 2MJDA 2KX0A 5E6NA 2O6VA 4LTUA 1J7AA 1UNSA 2LJIA 2M4NA 3LYYA 4ACFA 3AU5A 1P98A 5DPTA 1WJ6A 2D3AA 1E6EB 2RPVA 3R8BA 2NR2A 2XK5A 1WWTA 3AMZA 4P6VF 3VQIA 4IUMB 1TY0A 2WP9B 1I4HA 1OQYA 2RMMA 1YN3A 4DHZE 1RAXA 2PKOA 3PZ7A 1GJZA 1C76A 1HE8A 2WXLA 2PVOD 3EUB2 3L08A 2KJRA 4ASWC 1VLBA 2V4LA 3CSFA 3Q8AA 5FR6A 2HJ1A 3UIPB 4D2KA 2J0KA 2LWPA 1DOYA 3A4RA 3RUIB 3CF6E 3TUOA 3U8ZA 2GI9A 4C4VA 3C19A 2IZVB 4J3OD 1D5XC 4USAA 2E6XA 1KRHA 4MGKE 2IO1B 2K8BA 1V1OA 2L83A 3BK2A 1TKYA 2K9XA 1QZEA 1YNTE 1GUAB 5AZHA 3P63A 2LGSA 3QCAA 4XDDA 1N5WA 4H2AA 2INPE 2KMCA 3T3NA 1JWSD 1HZ5A 2PE9A 3HM3A 2VZKD 3SDLC 2BT6A 1KFYB 2V3PA 2PIAA 1WE6A 4XX5A 2GLSA 3SEBA 1SE4A 3N9YC 3L17A 3VVWB 1FM0D 5DPRA 3PTFC 4A55A 1TBEA 3IHPC 4KDLB 2QILA 3Q2AC 4ZRPA 1V5OA 1T3QA 2X8XX 3RFZB 2KJ6A 2J4XA 5CHWA 4MEMA 5D3DA 4A8XC 3C8YA 1MJDA 4OZBA 4BVUC 3ML9A 1L0XB 2PMVA 3RZFA 2RDHA 2IJ0A 3Q3FA 1ZKHA 2DENB 4C00A 1R4MB 3RNGC 1V5TA 5L95C 2I1JA 1YQ3B 4JIOU 3QARA 1C4AA 1HZ6A 1C4CA 3URYA 4FLHA 1IBXB 1XLNA 2DBYA 1P7FA 4R3DA 2GMIC 1E8WA 2FCMA 3VRAB 1NYQA 2N9KA 2GBKA 1SJHD 5T8IA 1AARA 2ONQA 4S17A 4RFBA 1ENFA 4P1BC 3FILB 3BYTB 5HG2A 3PPAA 5IO9A 2KKCA 2JXXA 3TJPA 1VRAB 2D07B 1AYFA 4MGYE 2N7DA 3PSEB 1L5PA 4RNAA 3V05A 2WU5B 3VRBB 2Z8LA 2INCC 4YTNB 3I9V1 4WWPA 1Q10A 2YEPB 1WX8A 1ET6A 4AUQC 1TKGA 4BOSC 2GRIA 4GMVA 1EF1A 1YX6B 4PK1A 4DDID 1KM7A 1M4VA 2CR5A 4IM3A 1P0RA 1WYWB 2KWDA 1NENB 1IP9A 2OEDA 3PLVA 4M8NA 2QMTA 1V1PA 3RNBC 3IT4B 2IO3B 2BKRB 1WXVA 3AE3B 1V49A 2LUEA 2L7RA 5TSSA 4GDLA 1I4GA 2BQQA 5D3IB 2IDYA 4NJ7A 4YSZB 4KV2A 4GU2A 2AL6A 1GNUA 1EM7A 2GB1A 4B0EA 2L8JA 1NEKB 2BTEA 1N6ZA 2KT7A 2KLGA 1R4NB 2KDIA 5IAAC 1SIFA 4ZRJA 2ZZPB 3PZ8A 3NJTA 2N4FA 4PS7A 2NCNA 1Q1OA 2PTLA 4E3CA 3RT3B 2Q5WD 4G50A 1T0YA 2DAJA 2G4SA 4IWQA 2WXHA 4MELA 1VDVA 4ZOHC 1NI3A 3R2TA 5DPSA 3QAQA 1WGGA 1FCLA 4FJZA 3PV1A 4L23A 3MHZA 4AWJA 5BYRA 3DHHC 1DYQA 1UD7A 1OQRA 2WNMA 4XYCA 3DQVA 4M0WA 1Y8RC 1L6UA 3ENEA 4ZYSA 2KFKB 2UWQA 3A9KB 1L6VA 4RCOA 1QQRA 3PRZA 4C7YA 2EMSA 3ZIMA 4JPSA 3RI7C 3DCGA 4LNFA 2C5LC 2X38A 2EKIA 4ICUA 2LI5A 2KXJA 2RSUA 1EUVB 2NTSA 3OLMD 4JQWC 2INDC 5G5HA 3VTWA 3BZDB 3L10B 2N9LA 1SF0A 2MBOA 2W54A 3AI5A 4W9EA 3HIZA 1FEHA 4HROA 2D3GA 2KMAA 4TQ1A 1I42A 2XN9C 4REZA 2KN5A 1BT0A 3SU8X 3EGRA 1WR6E 3J9CA 4KSKC 3AEEB 5BMGA 3ZQ4A 3VUWA 2KTFA 5MPOA 4IWOA 1L0VB 2BB5A 4EKUA 2E3TA 1XD3B 2KFJA 1ZGUB 2V3SA 2FCNA 1TS5A 2RPQA 4ZDVA 2WU2B 1MHXA 3MJ5A 3T8MA 2RR9A 2QJLA 4II2B 2MX2A 1JWBD 3PRPB 1PFDA 3TEZA 2FCSA 2G1EA 3QQ8B 1LXDA 4RF1A 2NPTB 3NG0A 3U7ZA 3ZJVA 2MHJA 3H7PB 4AJWA 3B2FA 1PYWD 3QX1A 2N1VA 2ZW1A 4BBNF 1C1YB 3PVLA 4OZAA 3RULA 4TV3A 2KLCA 3W1YA 1GAQB 5LXHA 3U7DA 1XF5L 3R7QA 3O13A 1P7EA 5GMVA 3AEAB 4XGAB 2V1YA 1WH3A 3NOBA 4MJSA 2KO3A 4KGTA 1E10A 3AE2B 3UQBA 4RH6A 3Q8CA 4LNKA 1CQVA 2ZCBA 2JVCA 3PS6A 2BVCA 2WGSA 2XBBC 2HTME 1VD2A 1IYFA 4GN1A 5JXVA 1DOIA 3AEFB 1AWDA 1YX5B 4NAMA 3I63C 3PHXB 4L2YA 1ZP0B 2KQSA 3GE3C 3U4EG 1XT9B 5EE0A 1JWAD 1MG4A 1VJKA 1ZW7A 4N9F4 1WI0A 1TS3A 2QEJC 3R7RA 1M94A 2KQ7A 4TKNA 1TGZB 2JXTA 1RFAA 4CO7A 4OVVA 1VZ6A 3TEYA 1FMAD 4NAWA 3A9JA 2INNE 4HJKA 1E8XA 2N1WA 2WXOA 2AYOB 1FIQA 1UF0A 1OGWA 1ZDXA 4GOCA 3ZNID 2ZNVB 2WXIA 2HE7A 2KC2A 4MGIE 3H9DA 1XCTL 3ZXRA 4E74A 1YQ4B 3MC9A 1HTQA 4MH8A 4RGNA 2WXFA 3PHWB 2DWQA 3N1YC 1TS2A 4C7ZA 2IGDA 3DWGC 3U52E 4W9HA 3P4SB 2L32A 4W9DA 2PE6B 1MG8A 4KZ0A 5D7GA 4A20A 4FBJB 4LNNA 2B76B 4GLSC 2MEKA 2MQJA 4MM3A 1MHHE 5L83A 3UINB 1J19A 3NVVA 1Z2MA 4ZHPA 1VZ8A 5D94A 1YN4A 2IY0B 1G6JA 5AUKA 2K25A 1J7CA 1KJTA 4ANXA 3KUDB 3ONSA 4IG7B 4AQ7A 4MACA 2CS4A 4RGOS 1L4DB 2MBQA 2MJ3A 2KMMA 4YXDB 4UDUC 2UU7A 1B1ZA 4W9CA 3N3KB 2ZCCA 4NZLB 4W9JA 3WAOA 4P16A 2RD0A 5AZFA 1H4RA 1V6EA 1FFVA 3V60A 1TY2A 2LRUA 4KIKA 3L16A 3GS2A 2LHEA 4PYUA 1WYGA 2XEWA 5E6JA 3MHSD 1V2YA 1RWSA 2JWUA 3PT2B 2DX5B 2GBMA 3OG5A 3VH4B 1E5WA 1S1QB 2KTRB 4W9LA 2PEAA 1XLOA 1SB3C 1NYRA 1WJUA 3HK0A 1UBQA 2KWVB 4ZRKA 3WAPA 3DVNV 5HFYA 2J42A 1WM3A 4PS8A 3QHTA 3EA6A 3V3XA 2KDEB 3BIID 3H7SA 4EE2A 3PO0A 2LXCA 2IBIB 2WXGA 4FULA 2NBWB 2L52A 1SE9A 2AWTA 3AB5A 4XDCA 5HKHA 1KLUD 2BB6A 3KLSX 4EZJA 2ICIA 1L4ZB 1XXGA 3NZSA 2SEBD 2MP2B 2KJHB 3TSSA 1FNUA 1SGHA 1DGJA 3UF8A 2CHXA 4NJCA 4J6IA 2J7QB 1J8CA 1WGDA 3IBEA 5EE1A 3M62B 2N9EB 1H8CA 2FE8A 1TT5B 4HVBA 3GZNB 4HCPB 3RNCC 2JYEA 3KYCD 2K6DB 3R2IA 2IO2B 2KNBA 2FAZA 4PYZA 2ZPNA 3ZDMC 2KC1A 1OTRB 2NVUI 2Y5BB 2D3CA 4YTMB 1HQRD 3AE5B 1WMHB 3AXCA 5IOIA 2AQ2B 1WFYA 3TCAA 4ITKA 2OJRA 2Z0EB 4HJGE 4KGRA 2PPHA 4EZLA 3OJ4B 5FKAC 1WX9A 2LRWA 2M17A 1JMLA 5I4DA 2FUG1 1GOZA 2VH2A 3H6NA 1XEEA 3UIOB 1V81A 1SE2A 1F77A 1D6EC 3NZ3A 1E7UA 1LFDA 3AH7A 3ZKJC 4I6LB 2FIDA 3LJ3A 1J0GA 2REXA 2MCNB 1LM8B 1K52A 3LB8C 3FAHA 3B9JA 1ZPSA 1WXQA 4XC2A 1LQBA 2V3NA 3KUCB 3PZDA 1WX7A 5BYSA 1VCBA 2L0TA 2WXPA 4WJQA 3P4QB 4WAFA 4B95A 3A1QB 5LLIA 1UWMA 3VTUA 3TMPB 1QLBB 1JALA 4W9IA 4RF0A 2KX3A 4GIVA 2K1FA 4K7UA 4N58A 2JZZA 1ZXIA 5AZGA 4O1NA 2B3AA 2WDTB 4FHKA 1YD8U 1IPGA 3AE1B 3MJWA 2MSED 5EE9A 3IT6B 4MT5A 1MVKA 3IG3A 1TS4A 2J52A 3BVZA 3DVGY 4BKTA 4GDKB 2HD5B 1V8CA 3CWIA 2O2VB 2KD0A 3IFWB 3LXFA 2G4DB 3DHIC 1P3QU 2KTRA 4DXFA 5JHBA 3TEWA 3NVZA 2PLPA 1T0QC 2RDBC 3QC8B 3H8HA 4RMAA 2NBVB 1DOXA 4TQ0A 5HI1A 4AJYB 4DK5A 1N5XA 1QF6A 1L2NA 3EHVA 3V62A 2WXRA 4EOYA 1E90A 3WIMA 2M0XA 2MH7A 1Q0WB 3N32A 3BVGA 2IGGA 4BZAA 3AE4B 1YOVB 3QWZB 3DBLI 2JWZA 4NJ6A 4L1BA 5BMHA 1XO3A 2D3BA 1QT9A 2ZNVC 2CKHB 3MC8A 2D11A 4YT0B 2KYWA 5G55A 1KLVA 3RYTA 4EEWA 1ET9A 2N7EA 2QC8A 3VR9B 1X1MA 1V80A 4WH4A 2WXKA 3T9LA 3MC0B 4YWGG 4C80A 3KWVA 3HHMA 1HEZE 4G3XB 2KHWB 2BYVE 4YSXB 3N30A 4KZCA 2IPKD 1EU4A 4M02A 3DWMA 2QHOA 2WDQB 4LJPB 2L05A 1C77A 1YQBA 3GB1A 4BKSD 3VHTC 4DDGD 3I57A 1E7VA 1ZOYB 3B0AA 4HCNB 1TIFA 5E6PA 3ZXVA 2QIEB 4FJYA 3I5JC 2M8SA 4ANWA 3DBSA 1C3TA 4W9KA 3GOEA 1WF9A 2MLBA 3H1UA 1PGAA 2KWUB 3IVFA 2G9HD 3MFGA 2K39A 3ZUNA 1E0ZA 1PGXA 3KW5B 4URKA 4EZKA 2K8CA 2DZKA 1FFUA 2W55A 5IKCM 2ZEQA 2V9HA 2XNAC 1NDDA 4ANUA 1V9JA 1FXIA 3FC4A 4OZCA 2GOWA 1IBXA 4FA6A 4M00A 2RDGA 4MDKE 2EELA 5LXIB 1C78A 5FR3A 5D2MB 2LVPA 1MFWA 1MI0A 3FILA 2LUMA 3L0WB 3LDZE 2C7MB 4LCDE 3GZNI 3D32A 3NHEB 2WXQA 5LNK1 5H92C 4A9AA 4MGZE 3HM6X 4M01A 1E8ZA 2LZ6A 3GP7A 2VH1A 4B9KA 1UGJA 3JSVB 3DBHB 4GDKA 1RLFA 3WAMA 1FXTB 1E8YA 2JX5A 3WCQA 5JH5C 3DHGC 1TZOA 1K53A 1KTKA 3NZUA 2O6VB 3AU4A 1ZE3D 3SD5A 5DCNA 1QILA 2KVZA 3KVFB 1D4BA 4FJVB 1STEA 1WXMA 4NQKE 3ZJTA 1A70A 3RNAC 4IOIE 3CIRB 2XK5B 1WIAA 3OAWA 2CJOA 2L76A 1BUIC 2OJWA 4F8CB 1JCKB 2DLBA 2WS3B 2YEPF 2BYTA 3RPFC 2BWES 1WR1A 1ISNA 2YVCA 2NS5A 3V61A 5CHFA 3VAWA 2OOBB 1N62A 3VH3B 2KVRA 1RFKA 2ZJDA 2IY1B 4HXDA 4KX6B 2M56B 4C4VB 3ZRCA 2JSVX 3EFUA 2C7NB 5IN7A 1KH0A 4EUTA 1IGDA 3QJZA 4ZRIA 2C9WB 2MBBB 1Z5SB 4FN2A 3KYDD 4LNIA 4NNJB 4DHJB 1ZDVA 3E56A 5IA7A 5CHVC 3RNEC 2WDRB 4NY0A 4Q2JA 3AEDB 2ZPYA 3RNFC 2HJ8A 3ABVB 1WJNA 2M0AA 4KKJA 3NUHB 2PVGC 4S0RA 3VDZA 2JF5A 3O65B 5C1ZA 2FCQA 3PGEA 3OJ3A 3QK0A 3W2DA 2BKFA 2G45B 5EE3A 2KFKA 3A9KA 1RYJA 1UGMA 1WE7A 4HPLB 1SEBD 3VUXA 3ZVVA 1QOAA 4WIPA 4JWUC 3DBLB 5DPWA 3AV8A 1CZPA 2WWZA 4LLGM 3DVGX 1SBBB 3AE9B 2LASA 3B08A 5D6JB 1SE3A 4G11A 4RGMA 1VR9A 2N0SB 2AX5A 3FKYA 3KWLA 1JWUD 1TTNA 2O6VD 2IO0B 1UWXA 4GGQA 4FADA 1F1HA 2CHZA 3Q3JA 1GC7A 4DHZB 2WXNA 1JROA 2NBUA 4NQLB 4HK2A 4XWTA 1WGHA 4K7SA 1GB1A 1FD6A 2MW5A 4JE3B 2Z59B 4IC7B 2JU6X 1F2RI 1WJ4A 1FCCC 2WDVB 3TBLD 2NPTA 4XWWA 4KKIA 2JQRB 1D5MC 4JWSC 3BINA 3PRMB 4AOFA 3H7PA 4EFOA 2J0MA 3ZGZA 2UYZB 3P4PB 1EF5A 2L1AA 1BXTA 2ZVOA 4BKGA 2YLMA 2JUOA 2Y5PA 3VTVA 1F2RC 1VZ7A 3KH0A 5EDSA 1ZXHA 3APCA 3BWUD 1TZ1A 3HUIA 2GBNA 3P4RB 4DHJD 4DXAB 1ROEA 1TJEA 1LO5D 2LHDA 4C56C 1V1PB 4HRSA 5JZEB 2W3RA 4GDLB 4FXCA 1WGKA 2J53A 4N6EB 2FBWB 4E71A 4HDOA 3BVMA 5E6OA 1WGRA 4LK0M 1QOBA 3AM9A 3A4SC 4DQOC 3KUZA 2ACZB 2KDMA 5KHOA 2Y5CA 2Z0DB 1FRRA 3CSTA 1B9RA 3W9CB 4BOZB 2H88B 2CHWA 2JZ3B 1R7SA 1KOTA 4HPMB 2DYMA 4ZHOA 3EC8A 4HKZE 3AE7B 4K3CA 5G5GA 1Q5WB 3AEBB 1LGRA 5J17A 2FIFA 2WYQA 3Q3NC 1XLQA 1ACCA 4P7IA 1CK1A 5TR5A 2GBJA 1L7YA 3DBHI 3W1SC 1JRPA 2IYDB 4P1CC 1OQQA 1FPYA 3DVNU 1EU3A 2MBHA 1WGYA 3ETRA 4XZ4A 2CJNA 1QOFA 4HPPA 3AEGB 2SAKA 1RM6C 4M0WB 3TL5A 2KAJA 2PW9A 2K8HA 1YJ1A 2MWSB 3APDA 4ZRQA 1FNWA 2QCZA 2AEHA 2R61A 4WWOA 1OEYJ 3L54A 4W9GA 4OVZA 1KLGD 1UZXB 3Q8EA 5C2TB 5AUIA 3W5UB 2G3QB 4M8MA 2ASQA 1GB4A 2K22A 3JVZX 2LMCA 4N59A 4PS3A 1FXAA 3UI3A 1JWMD 2KANA 2ZVNA 2V0GA 3IAS1 4ZYNA 5GXGB 3DBRB 4A3OA 4NPNA 1QOGA 4OW0A 4HDQA 4LDTB 1XCQL 4US8A 3ML8A 3PLUA 2L3ZA 1PUTA 1V97A 3ZJUA 2WXJA 1UUPA 1WRIA 2K5PA 4RM8A 1S3SG 3W5VB 3A33B 4QAYA 1C9FA 1N60A 1I35A 1FNVA 3ZW3A 1AW7A 3Q8BA 4MSMB 4BFRA 2BYEA 1FO4A 3E9SA 1YJIA 4KSLC 2AQ3B 1JQ4A 1N61A 3GE8C 2LGYA 3RD2A 4WJPA 3VXWA 2KN4A 2WXMA 1UBIA 2BS2B 2V4IB 4WWNA 2M19A 1MPEA 1SIJA
chains in the Genus database with same CATH topology
3ZNZB 2LVPA 4MGKE 2IO1B 2K8BA 3K9OB 4W9HA 2J0JA 4W9DA 2PE6B 4MJSB 1MG8A 4KZ0A 5D7GA 1QZEA 4A20A 1P1AA 4X57B 4FBJB 2D10A 1WZ3A 3SHQA 3L0WB 1GUAB 5AZHA 3LDZE 2C7MB 3QCAA 4GSWA 4LCDE 3GZNI 2MQJA 4MM3A 5AEKB 2KMCA 3D32A 5L83A 4II3B 3UINB 3NHEB 4JLCA 1J19A 2EMTA 1Z2MA 2PE9A 4MGZE 5D94A 2IY0B 3HM3A 1G6JA 4MSQB 3SDLC 3ECIA 3HM6X 2K25A 1E8ZA 2LZ6A 1KJTA 4B9KA 3JSVB 4ANXA 3KUDB 3ONSA 4GDKA 2LGXA 2DAFA 1WZ0A 3M95A 1RLFA 4IG7B 1WE6A 2MP2A 3B1LX 3WAMA 1FXTB 2BGFA 4XX5A 1E8YA 2CS4A 3L17A 2D2QA 1EO6A 2MBQA 3DPDA 3V6CB 3VVWB 5DPRA 5JH5C 3PTFC 2JRHA 4I6PA 3ZO5B 1XQQA 1D3ZA 3NZUA 1TBEA 2M1MA 2O6VB 2LVQA 3IHPC 3AU4A 5C23A 4KDLB 4W9CA 3N3KB 3SD5A 2ZCCA 1V5OA 3X0WA 5DCNA 4W9JA 3KVFB 3WAOA 4FJVB 2RD0A 5AZFA 4A3PA 1WXMA 4NQKE 1H4RA 1V6EA 1A5RA 2KJ6A 4FHJA 5CHWA 4MEMA 5BO4B 3V60A 2XK5B 2LRUA 2R2QA 1WIAA 4KIKA 3L16A 3OAWA 5G2NA 2L76A 4BVUC 4CHKA 3ML9A 4F8CB 3RZFA 1WMHA 3Q3FA 1ZKHA 4PYUA 2KZRA 2DENB 2XEWA 3I3TB 4HWIB 3MHSD 1V2YA 3PT2B 4NAWB 2DX5B 1V5TA 2GBMA 4IWPA 1GC6A 3A9JB 5L95C 2BWES 1WR1A 2I1JA 1E5WA 1S1QB 2C60A 1ISNA 2KTRB 4W9LA 3S2AA 3VH4B 2PEAA 2YVCA 4JIOU 3HK0A 1WJUA 1UBQA 2KWVB 2NS5A 2A4ZA 3QARA 3DVNV 4ZRKA 3WAPA 2DYBA 3V61A 5CHFA 3VAWA 2OOBB 4K7WA 4FLHA 5EDSA 3VH3B 2KVRA 1WM3A 2L0FA 4PS8A 2ZJDA 2IY1B 2R2OA 4HXDA 2GMIC 4LDTD 3QHTA 1E8WA 3ZRCA 2FCMA 2KDEB 3EFUA 2GBKA 1UELA 2C7NB 3H7SA 2N9XA 1AARA 4ICVA 2JRIB 2LXCA 4EUTA 2DZJA 2IBIB 4FULA 3PPAA 3QJZA 2KKCA 2NBWB 2JXXA 4ZRIA 2C9WB 2VRRB 3TJPA 1SE9A 3WALA 2MBBB 1Z5SB 2D07B 2AWTA 2N7DA 4FN2A 4MGYE 3KYDD 3PSEB 2JT4B 4NNJB 5HKHA 3TIXA 4DHJB 3P2BA 3QA8A 4WWPA 5IA7A 1P9DU 5CHVC 4EZJA 5JHAA 3A1QA 1WX8A 4NY0A 2LVOA 3NZSA 2ZPYA 2MP2B 4AUQC 2HJ8A 2KJHB 3JW0X 4BOSC 1U4AA 1WJNA 1SGHA 3VDZA 3UF8A 4BKSA 2JF5A 3O65B 4GMVA 5C1ZA 1EF1A 1YX6B 2CHXA 2FCQA 4J6IA 3PGEA 3OJ3A 3QK0A 4DDID 2BKFA 2G45B 2J7QB 3RZWC 2KFKA 1KM7A 3A9KA 4MH0E 4AP4C 1J8CA 1WGDA 2LGDA 3IBEA 1UGMA 2BYFA 2N9EB 3M62B 2CR5A 1WE7A 4HPLB 3UQAA 1H8CA 4IM3A 1P0RA 3VUXA 1WYWB 3ZNGC 3QIJA 3ZVVA 4HVBA 1IP9A 5DPWA 4HCPB 3EECA 3KYCD 3PLVA 2K6DB 3VUYA 2IO2B 4M8NA 2KNBA 4KIKB 2FAZA 4PYZA 3ZNHB 2WWZA 2IO3B 2BKRB 1WXVA 2ZPNA 3DVGX 3ZDMC 2KC1A 1V49A 5CX3A 2LASA 2LUEA 2L7RA 1OTRB 1GG3A 2NVUI 2Y5BB 3B08A 4GDLA 2O2VA 3AULA 5D6JB 3K9PB 1WMHB 3AXCA 4G11A 1V86A 3UGBB 1WFYA 3TCAA 5J2RA 2OJRA 4NJ7A 2Z0EB 4KV2A 2PPHA 4EZLA 3OJ4B 4WAAA 4DWFA 4GU2A 1WX9A 2LRWA 2M17A 2AL6A 4ANVA 1TTNA 1GNUA 2LXAA 2O6VD 3R3MA 2IO0B 3CMMB 4GGQA 5KHQA 3H6NA 2L8JA 2FUHB 4FADA 3UIOB 2DZIA 2EKEC 1V81A 2CHZA 2KLGA 3Q3JA 1GC7A 4DHZB 2KDIA 4IM0A 2NBUA 4NQLB 4HK2A 5IAAC 2C7HA 1SIFA 4ZRJA 2ZZPB 1E7UA 1LFDA 1WGHA 3ZKJC 2W9NA 4K7SA 2N4FA 4I6LB 2FIDA 2MW5A 3LJ3A 4PS7A 1J0GA 2REXA 2Z59B 2NCNA 1Q1OA 2MCNB 4E3CA 3RT3B 1LM8B 3L13A 2FNJB 4IC7B 4G50A 1T0YA 2DAJA 2KDFB 2G4SA 3ZTCA 1WJ4A 4WJNA 4DBGA 3DOWA 3JYUA 3ZLZA 3TBLD 4LJOB 2NPTA 3ALBA 2JY6A 4XC2A 1LQBA 4IWQA 3KUCB 1CMXB 4MELA 3BINA 3PRMB 3PZDA 4WJOA 4AOFA 1WX7A 3C0RB 3H7PA 1VCBA 2WX0A 2L0TA 4WJQA 5DPSA 4EFOA 2L00B 2J0MA 3QAQA 1WGGA 2UYZB 4B95A 3A1QB 3PV1A 4FJZA 4AWJA 5LLIA 2KOXA 1R4MI 4W9FA 4WQOB 3VTUA 3TMPB 1UD7A 3MTNB 1EF5A 4W9IA 1WXSA 2ZVOA 4BKGA 4F1SA 2YLMA 4GB9A 2KX3A 4GIVA 3DQVA 2K1FA 1Y8RC 2K6QA 4K7UA 3DBRI 5CTRC 2JUOA 3VTVA 3ENEA 3M3JA 2JZZA 2KFKB 2UWQA 3A9KB 5AZGA 1K8RB 3PRZA 2B3AA 2WDTB 3KH0A 1YD8U 3APCA 1IPGA 4FHKA 2KWCA 4TUUA 2EMSA 3ZTDA 3MJWA 3ZIMA 1TZ1A 2MSED 4F7ZA 3DCGA 2GBNA 2C5LC 4DHJD 4DXAB 4HLEA 4ICUA 2LI5A 4CYEA 2KXJA 2RSUA 1EUVB 2JPHA 3OLMD 4JL9A 3IG3A 4JQWC 3DVGY 5JZEB 2KK8A 3VTWA 4BKTA 3L10B 2HTHA 2HD5B 3DDCB 4GDLB 2MBOA 2O2VB 3AI5A 4GDKB 4W9EA 3HIZA 2I1KA 4E71A 2D3GA 4HDOA 2KD0A 3IFWB 2G4DB 2KMAA 1JRUA 2KDBA 1OEYA 1WGRA 4GXBA 4TQ1A 5E6OA 1I42A 2KN5A 2DYOA 1BT0A 4BBNC 1P3QU 2KTRA 3SU8X 1WR6E 4KSKC 2BF8B 3A4SC 3KUZA 3VUWA 2KTFA 4IWOA 4KDIC 2MA9B 5KHOA 4EKUA 3X23A 2DZMA 2Z0DB 2GBRA 5JHBA 3CSTA 1XD3B 2KFJA 4BOZB 4G0NB 1ZGUB 2V3SA 2FCNA 3QC8B 2CHWA 2JZ3B 2RGFA 3BY4B 4RMAA 2NBVB 4RM9A 4HPMB 1KOTA 1WM2A 2RPQA 4ZDVA 4TQ0A 3T8MA 4AJYB 2RR9A 4DK5A 2DYMA 3EC8A 1L2NA 3EHVA 2WX1A 3NS8A 4II2B 2MX2A 3V62A 4EOYA 1E90A 3WIMA 3WA0A 3PRPB 1Q5WB 1WY8A 1Q0WB 2M0XA 3M63B 3N32A 4YL8A 2FCSA 5J17A 2PJHA 3QQ8B 2FIFA 1LXDA 1RRBA 1PQSA 2MBEA 2WYQA 3V6EB 2A5UA 2NPTB 3QWZB 2BPSA 3DBLI 2JWZA 4NJ6A 4P7IA 4JGHB 2AL3A 5TR5A 2GBJA 3H7PB 4AJWA 3QX1A 1WRDB 3U30A 2N1VA 1L7YA 3W1SA 3DBHI 3W1SC 4BBNF 1C1YB 2CKHB 2ZNVC 3PVLA 3RULA 2IYDB 4TV3A 2KLCA 2D11A 3W1YA 5LXHA 1F9JA 3U7DA 4B6WA 5G55A 3DVNU 3R7QA 2MBHA 1WGYA 3ZRFA 4XZ4A 3WANA 1NI2A 5GMVA 3R66C 1KLVA 3RYTA 4EEWA 4KVGB 3NY5A 1YIWA 4M0WB 3TL5A 2N7EA 2MRPA 1X1MA 1V80A 4K81A 2V1YA 1WH3A 3NOBA 4MJSA 2K8HA 3T9LA 1R4NI 2LJ5A 1YJ1A 2KO3A 2MWSB 4OVUA 3APDA 3RCZA 3UQBA 2CU1A 3HHMA 2AEHA 3PREA 4WWOA 3VFKA 4IM2A 4G3XB 1OEYJ 2N9PC 2KHWB 2BYVE 3L54A 2ZCBA 2JVCA 3N30A 4KZCA 4W9GA 4IW0A 4I6NB 3PS6A 1UZXB 2XBBC 1VD2A 3JSVA 5J18A 2G3QB 4K1RB 2QHOA 4M8MA 3APFA 4LJPB 1IYFA 4GN1A 2ASQA 3JVZX 3ZDTA 2L05A 1WXAA 2DHZA 2LD9A 4PS3A 1YQBA 4BKSD 3VHTC 4DDGD 1YX5B 1E7VA 2BWFA 2KANA 3B0AA 1NBFC 1UH6A 2ZVNA 4HCNB 4ZYNA 3PHXB 5E6PA 2KX0A 5E6NA 2O6VA 2KQSA 1XT9B 2M4NA 4FJYA 4A3OA 3AU5A 1P98A 2M8SA 4ANWA 3DBSA 1C3TA 5DPTA 4NPNA 4W9KA 3GOEA 4HDQA 1ZW7A 4N9F4 1WF9A 1WJ6A 1WI0A 4LDTB 2NR2A 2MLBA 3ML8A 3PLUA 2XK5A 3H1UA 2KWUB 3R7RA 1M94A 2KQ7A 3IVFA 4TKNA 2L3ZA 3VQIA 1TGZB 4IUMB 1RFAA 2K39A 1OQYA 4CO7A 3ZUNA 4DHZE 4OVVA 4RM8A 1S3SG 1RAXA 3A33B 3KW5B 4URKA 4EZKA 1GJZA 1HE8A 2DZKA 2K8CA 4NAWA 3L08A 2KJRA 3A9JA 2V4LA 4HJKA 4ASWC 3ZW3A 1I35A 3CSFA 4MSMB 1E8XA 2N1WA 2BYEA 4BFRA 2ZEQA 2AYOB 4KSLC 5FR6A 1NDDA 1OGWA 4GOCA 3ZNID 2ZNVB 3UIPB 4ANUA 1V9JA 2LGYA 2HE7A 2GOWA 2KC2A 2J0KA 2LWPA 4MGIE 3A4RA 3RD2A 3RUIB 4FA6A 3CF6E 3H9DA 4WJPA 3U8ZA 4MDKE 3VXWA 4E74A 1UBIA 2IZVB 4WWNA 5LXIB 3PHWB 5D2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNZ B;  2LVP A;  4MGK E;  2IO1 B;  2K8B A;  3K9O B;  4W9H A;  2J0J A;  4W9D A;  2PE6 B;  4MJS B;  1MG8 A;  4KZ0 A;  5D7G A;  1QZE A;  4A20 A;  1P1A A;  4X57 B;  4FBJ B;  2D10 A;  1WZ3 A;  3SHQ A;  3L0W B;  1GUA B;  5AZH A;  3LDZ E;  2C7M B;  3QCA A;  4GSW A;  4LCD E;  3GZN I;  2MQJ A;  4MM3 A;  5AEK B;  2KMC A;  3D32 A;  5L83 A;  4II3 B;  3UIN B;  3NHE B;  4JLC A;  1J19 A;  2EMT A;  1Z2M A;  2PE9 A;  4MGZ E;  5D94 A;  2IY0 B;  3HM3 A;  1G6J A;  4MSQ B;  3SDL C;  3ECI A;  3HM6 X;  2K25 A;  1E8Z A;  2LZ6 A;  1KJT A;  4B9K A;  3JSV B;  4ANX A;  3KUD B;  3ONS A;  4GDK A;  2LGX A;  2DAF A;  1WZ0 A;  3M95 A;  1RLF A;  4IG7 B;  1WE6 A;  2MP2 A;  3B1L X;  3WAM A;  1FXT B;  2BGF A;  4XX5 A;  1E8Y A;  2CS4 A;  3L17 A;  2D2Q A;  1EO6 A;  2MBQ A;  3DPD A;  3V6C B;  3VVW B;  5DPR A;  5JH5 C;  3PTF C;  2JRH A;  4I6P A;  3ZO5 B;  1XQQ A;  1D3Z A;  3NZU A;  1TBE A;  2M1M A;  2O6V B;  2LVQ A;  3IHP C;  3AU4 A;  5C23 A;  4KDL B;  4W9C A;  3N3K B;  3SD5 A;  2ZCC A;  1V5O A;  3X0W A;  5DCN A;  4W9J A;  3KVF B;  3WAO A;  4FJV B;  2RD0 A;  5AZF A;  4A3P A;  1WXM A;  4NQK E;  1H4R A;  1V6E A;  1A5R A;  2KJ6 A;  4FHJ A;  5CHW A;  4MEM A;  5BO4 B;  3V60 A;  2XK5 B;  2LRU A;  2R2Q A;  1WIA A;  4KIK A;  3L16 A;  3OAW A;  5G2N A;  2L76 A;  4BVU C;  4CHK A;  3ML9 A;  4F8C B;  3RZF A;  1WMH A;  3Q3F A;  1ZKH A;  4PYU A;  2KZR A;  2DEN B;  2XEW A;  3I3T B;  4HWI B;  3MHS D;  1V2Y A;  3PT2 B;  4NAW B;  2DX5 B;  1V5T A;  2GBM A;  4IWP A;  1GC6 A;  3A9J B;  5L95 C;  2BWE S;  1WR1 A;  2I1J A;  1E5W A;  1S1Q B;  2C60 A;  1ISN A;  2KTR B;  4W9L A;  3S2A A;  3VH4 B;  2PEA A;  2YVC A;  4JIO U;  3HK0 A;  1WJU A;  1UBQ A;  2KWV B;  2NS5 A;  2A4Z A;  3QAR A;  3DVN V;  4ZRK A;  3WAP A;  2DYB A;  3V61 A;  5CHF A;  3VAW A;  2OOB B;  4K7W A;  4FLH A;  5EDS A;  3VH3 B;  2KVR A;  1WM3 A;  2L0F A;  4PS8 A;  2ZJD A;  2IY1 B;  2R2O A;  4HXD A;  2GMI C;  4LDT D;  3QHT A;  1E8W A;  3ZRC A;  2FCM A;  2KDE B;  3EFU A;  2GBK A;  1UEL A;  2C7N B;  3H7S A;  2N9X A;  1AAR A;  4ICV A;  2JRI B;  2LXC A;  4EUT A;  2DZJ A;  2IBI B;  4FUL A;  3PPA A;  3QJZ A;  2KKC A;  2NBW B;  2JXX A;  4ZRI A;  2C9W B;  2VRR B;  3TJP A;  1SE9 A;  3WAL A;  2MBB B;  1Z5S B;  2D07 B;  2AWT A;  2N7D A;  4FN2 A;  4MGY E;  3KYD D;  3PSE B;  2JT4 B;  4NNJ B;  5HKH A;  3TIX A;  4DHJ B;  3P2B A;  3QA8 A;  4WWP A;  5IA7 A;  1P9D U;  5CHV C;  4EZJ A;  5JHA A;  3A1Q A;  1WX8 A;  4NY0 A;  2LVO A;  3NZS A;  2ZPY A;  2MP2 B;  4AUQ C;  2HJ8 A;  2KJH B;  3JW0 X;  4BOS C;  1U4A A;  1WJN A;  1SGH A;  3VDZ A;  3UF8 A;  4BKS A;  2JF5 A;  3O65 B;  4GMV A;  5C1Z A;  1EF1 A;  1YX6 B;  2CHX A;  2FCQ A;  4J6I A;  3PGE A;  3OJ3 A;  3QK0 A;  4DDI D;  2BKF A;  2G45 B;  2J7Q B;  3RZW C;  2KFK A;  1KM7 A;  3A9K A;  4MH0 E;  4AP4 C;  1J8C A;  1WGD A;  2LGD A;  3IBE A;  1UGM A;  2BYF A;  2N9E B;  3M62 B;  2CR5 A;  1WE7 A;  4HPL B;  3UQA A;  1H8C A;  4IM3 A;  1P0R A;  3VUX A;  1WYW B;  3ZNG C;  3QIJ A;  3ZVV A;  4HVB A;  1IP9 A;  5DPW A;  4HCP B;  3EEC A;  3KYC D;  3PLV A;  2K6D B;  3VUY A;  2IO2 B;  4M8N A;  2KNB A;  4KIK B;  2FAZ A;  4PYZ A;  3ZNH B;  2WWZ A;  2IO3 B;  2BKR B;  1WXV A;  2ZPN A;  3DVG X;  3ZDM C;  2KC1 A;  1V49 A;  5CX3 A;  2LAS A;  2LUE A;  2L7R A;  1OTR B;  1GG3 A;  2NVU I;  2Y5B B;  3B08 A;  4GDL A;  2O2V A;  3AUL A;  5D6J B;  3K9P B;  1WMH B;  3AXC A;  4G11 A;  1V86 A;  3UGB B;  1WFY A;  3TCA A;  5J2R A;  2OJR A;  4NJ7 A;  2Z0E B;  4KV2 A;  2PPH A;  4EZL A;  3OJ4 B;  4WAA A;  4DWF A;  4GU2 A;  1WX9 A;  2LRW A;  2M17 A;  2AL6 A;  4ANV A;  1TTN A;  1GNU A;  2LXA A;  2O6V D;  3R3M A;  2IO0 B;  3CMM B;  4GGQ A;  5KHQ A;  3H6N A;  2L8J A;  2FUH B;  4FAD A;  3UIO B;  2DZI A;  2EKE C;  1V81 A;  2CHZ A;  2KLG A;  3Q3J A;  1GC7 A;  4DHZ B;  2KDI A;  4IM0 A;  2NBU A;  4NQL B;  4HK2 A;  5IAA C;  2C7H A;  1SIF A;  4ZRJ A;  2ZZP B;  1E7U A;  1LFD A;  1WGH A;  3ZKJ C;  2W9N A;  4K7S A;  2N4F A;  4I6L B;  2FID A;  2MW5 A;  3LJ3 A;  4PS7 A;  1J0G A;  2REX A;  2Z59 B;  2NCN A;  1Q1O A;  2MCN B;  4E3C A;  3RT3 B;  1LM8 B;  3L13 A;  2FNJ B;  4IC7 B;  4G50 A;  1T0Y A;  2DAJ A;  2KDF B;  2G4S A;  3ZTC A;  1WJ4 A;  4WJN A;  4DBG A;  3DOW A;  3JYU A;  3ZLZ A;  3TBL D;  4LJO B;  2NPT A;  3ALB A;  2JY6 A;  4XC2 A;  1LQB A;  4IWQ A;  3KUC B;  1CMX B;  4MEL A;  3BIN A;  3PRM B;  3PZD A;  4WJO A;  4AOF A;  1WX7 A;  3C0R B;  3H7P A;  1VCB A;  2WX0 A;  2L0T A;  4WJQ A;  5DPS A;  4EFO A;  2L00 B;  2J0M A;  3QAQ A;  1WGG A;  2UYZ B;  4B95 A;  3A1Q B;  3PV1 A;  4FJZ A;  4AWJ A;  5LLI A;  2KOX A;  1R4M I;  4W9F A;  4WQO B;  3VTU A;  3TMP B;  1UD7 A;  3MTN B;  1EF5 A;  4W9I A;  1WXS A;  2ZVO A;  4BKG A;  4F1S A;  2YLM A;  4GB9 A;  2KX3 A;  4GIV A;  3DQV A;  2K1F A;  1Y8R C;  2K6Q A;  4K7U A;  3DBR I;  5CTR C;  2JUO A;  3VTV A;  3ENE A;  3M3J A;  2JZZ A;  2KFK B;  2UWQ A;  3A9K B;  5AZG A;  1K8R B;  3PRZ A;  2B3A A;  2WDT B;  3KH0 A;  1YD8 U;  3APC A;  1IPG A;  4FHK A;  2KWC A;  4TUU A;  2EMS A;  3ZTD A;  3MJW A;  3ZIM A;  1TZ1 A;  2MSE D;  4F7Z A;  3DCG A;  2GBN A;  2C5L C;  4DHJ D;  4DXA B;  4HLE A;  4ICU A;  2LI5 A;  4CYE A;  2KXJ A;  2RSU A;  1EUV B;  2JPH A;  3OLM D;  4JL9 A;  3IG3 A;  4JQW C;  3DVG Y;  5JZE B;  2KK8 A;  3VTW A;  4BKT A;  3L10 B;  2HTH A;  2HD5 B;  3DDC B;  4GDL B;  2MBO A;  2O2V B;  3AI5 A;  4GDK B;  4W9E A;  3HIZ A;  2I1K A;  4E71 A;  2D3G A;  4HDO A;  2KD0 A;  3IFW B;  2G4D B;  2KMA A;  1JRU A;  2KDB A;  1OEY A;  1WGR A;  4GXB A;  4TQ1 A;  5E6O A;  1I42 A;  2KN5 A;  2DYO A;  1BT0 A;  4BBN C;  1P3Q U;  2KTR A;  3SU8 X;  1WR6 E;  4KSK C;  2BF8 B;  3A4S C;  3KUZ A;  3VUW A;  2KTF A;  4IWO A;  4KDI C;  2MA9 B;  5KHO A;  4EKU A;  3X23 A;  2DZM A;  2Z0D B;  2GBR A;  5JHB A;  3CST A;  1XD3 B;  2KFJ A;  4BOZ B;  4G0N B;  1ZGU B;  2V3S A;  2FCN A;  3QC8 B;  2CHW A;  2JZ3 B;  2RGF A;  3BY4 B;  4RMA A;  2NBV B;  4RM9 A;  4HPM B;  1KOT A;  1WM2 A;  2RPQ A;  4ZDV A;  4TQ0 A;  3T8M A;  4AJY B;  2RR9 A;  4DK5 A;  2DYM A;  3EC8 A;  1L2N A;  3EHV A;  2WX1 A;  3NS8 A;  4II2 B;  2MX2 A;  3V62 A;  4EOY A;  1E90 A;  3WIM A;  3WA0 A;  3PRP B;  1Q5W B;  1WY8 A;  1Q0W B;  2M0X A;  3M63 B;  3N32 A;  4YL8 A;  2FCS A;  5J17 A;  2PJH A;  3QQ8 B;  2FIF A;  1LXD A;  1RRB A;  1PQS A;  2MBE A;  2WYQ A;  3V6E B;  2A5U A;  2NPT B;  3QWZ B;  2BPS A;  3DBL I;  2JWZ A;  4NJ6 A;  4P7I A;  4JGH B;  2AL3 A;  5TR5 A;  2GBJ A;  3H7P B;  4AJW A;  3QX1 A;  1WRD B;  3U30 A;  2N1V A;  1L7Y A;  3W1S A;  3DBH I;  3W1S C;  4BBN F;  1C1Y B;  2CKH B;  2ZNV C;  3PVL A;  3RUL A;  2IYD B;  4TV3 A;  2KLC A;  2D11 A;  3W1Y A;  5LXH A;  1F9J A;  3U7D A;  4B6W A;  5G55 A;  3DVN U;  3R7Q A;  2MBH A;  1WGY A;  3ZRF A;  4XZ4 A;  3WAN A;  1NI2 A;  5GMV A;  3R66 C;  1KLV A;  3RYT A;  4EEW A;  4KVG B;  3NY5 A;  1YIW A;  4M0W B;  3TL5 A;  2N7E A;  2MRP A;  1X1M A;  1V80 A;  4K81 A;  2V1Y A;  1WH3 A;  3NOB A;  4MJS A;  2K8H A;  3T9L A;  1R4N I;  2LJ5 A;  1YJ1 A;  2KO3 A;  2MWS B;  4OVU A;  3APD A;  3RCZ A;  3UQB A;  2CU1 A;  3HHM A;  2AEH A;  3PRE A;  4WWO A;  3VFK A;  4IM2 A;  4G3X B;  1OEY J;  2N9P C;  2KHW B;  2BYV E;  3L54 A;  2ZCB A;  2JVC A;  3N30 A;  4KZC A;  4W9G A;  4IW0 A;  4I6N B;  3PS6 A;  1UZX B;  2XBB C;  1VD2 A;  3JSV A;  5J18 A;  2G3Q B;  4K1R B;  2QHO A;  4M8M A;  3APF A;  4LJP B;  1IYF A;  4GN1 A;  2ASQ A;  3JVZ X;  3ZDT A;  2L05 A;  1WXA A;  2DHZ A;  2LD9 A;  4PS3 A;  1YQB A;  4BKS D;  3VHT C;  4DDG D;  1YX5 B;  1E7V A;  2BWF A;  2KAN A;  3B0A A;  1NBF C;  1UH6 A;  2ZVN A;  4HCN B;  4ZYN A;  3PHX B;  5E6P A;  2KX0 A;  5E6N A;  2O6V A;  2KQS A;  1XT9 B;  2M4N A;  4FJY A;  4A3O A;  3AU5 A;  1P98 A;  2M8S A;  4ANW A;  3DBS A;  1C3T A;  5DPT A;  4NPN A;  4W9K A;  3GOE A;  4HDQ A;  1ZW7 A;  4N9F 4;  1WF9 A;  1WJ6 A;  1WI0 A;  4LDT B;  2NR2 A;  2MLB A;  3ML8 A;  3PLU A;  2XK5 A;  3H1U A;  2KWU B;  3R7R A;  1M94 A;  2KQ7 A;  3IVF A;  4TKN A;  2L3Z A;  3VQI A;  1TGZ B;  4IUM B;  1RFA A;  2K39 A;  1OQY A;  4CO7 A;  3ZUN A;  4DHZ E;  4OVV A;  4RM8 A;  1S3S G;  1RAX A;  3A33 B;  3KW5 B;  4URK A;  4EZK A;  1GJZ A;  1HE8 A;  2DZK A;  2K8C A;  4NAW A;  3L08 A;  2KJR A;  3A9J A;  2V4L A;  4HJK A;  4ASW C;  3ZW3 A;  1I35 A;  3CSF A;  4MSM B;  1E8X A;  2N1W A;  2BYE A;  4BFR A;  2ZEQ A;  2AYO B;  4KSL C;  5FR6 A;  1NDD A;  1OGW A;  4GOC A;  3ZNI D;  2ZNV B;  3UIP B;  4ANU A;  1V9J A;  2LGY A;  2HE7 A;  2GOW A;  2KC2 A;  2J0K A;  2LWP A;  4MGI E;  3A4R A;  3RD2 A;  3RUI B;  4FA6 A;  3CF6 E;  3H9D A;  4WJP A;  3U8Z A;  4MDK E;  3VXW A;  4E74 A;  1UBI A;  2IZV B;  4WWN A;  5LXI B;  3PHW B;  5D2M B; 
#chains in the Genus database with same CATH topology
 3ZNZ B;  1PDX A;  1ESF A;  3K9O B;  2J0J A;  4MJS B;  4DXG A;  1SSN A;  1P1A A;  4X57 B;  2D10 A;  1WZ3 A;  2IGH A;  3SHQ A;  2WLB A;  2CU3 A;  4GSW A;  5AEK B;  4II3 B;  4TMA B;  4JLC A;  2EMT A;  4B0M A;  2QDF A;  1I7H A;  4JX1 C;  4MSQ B;  3ECI A;  3RMK C;  2H89 B;  3Q6B A;  3TEX A;  2LGX A;  2DAF A;  1WZ0 A;  1K50 A;  3M95 A;  2MP2 A;  3B1L X;  2BGF A;  1XLP A;  5H8Y E;  2D2Q A;  1EO6 A;  3DPD A;  3V6C B;  2JRH A;  4I6P A;  3ZO5 B;  1XQQ A;  1D3Z A;  2LEK A;  2M1M A;  2LVQ A;  5C23 A;  2I38 A;  3VR8 B;  1NVI D;  1E9M A;  3X0W A;  2I2Y A;  5IP4 D;  4ARI A;  4A3P A;  1A5R A;  1I4X A;  3OWE B;  4FHJ A;  5BMI A;  4XE0 A;  2BW2 A;  2WQY B;  5BO4 B;  2R2Q A;  1F0Z A;  1T0R C;  5G2N A;  4CHK A;  1WMH A;  2KZR A;  3T3O A;  3I3T B;  4HWI B;  4NAW B;  4IWP A;  1GC6 A;  3A9J B;  3S2A A;  2C60 A;  4BAX A;  1AN8 A;  1K51 A;  2N7J A;  3N1Z C;  1PGB A;  1TYG B;  2A4Z A;  2DYB A;  1E7P B;  3AEC B;  3BK1 A;  4A90 A;  4K7W A;  2ZW0 A;  2L0F A;  2K0P A;  2NMQ A;  4LNO A;  2R2O A;  3P1M A;  4LDT D;  3AE6 B;  4HKQ A;  1QKZ A;  2MJE A;  1EWY C;  1I4R A;  1UEL A;  2D5G A;  2N9X A;  4ICV A;  1YJJ A;  2JRI B;  2DZJ A;  2VRR B;  3WAL A;  4MM3 B;  2JT4 B;  3L4P A;  3TIX A;  3P2B A;  3QA8 A;  1P9D U;  5JHA A;  4K3B A;  3A1Q A;  2LVO A;  3Q8F A;  3JW0 X;  1U4A A;  4WUR A;  4BKS A;  4WWM A;  3RZW C;  4KGS A;  4IDI A;  4MH0 E;  4AP4 C;  2LGD A;  1HXY D;  2BYF A;  4ARC A;  3UQA A;  3ZNG C;  3QIJ A;  3NVW A;  3SFE B;  3RN9 C;  3EEC A;  2K3U A;  3VUY A;  3ZNH B;  4KIK B;  5HHD G;  1YN5 A;  5CX3 A;  2W82 A;  1GG3 A;  1N63 A;  2O2V A;  3AUL A;  3N20 C;  3P42 A;  3K9P B;  1T0S C;  1V86 A;  3UGB B;  5J2R A;  1IGC A;  5C3J B;  4WAA A;  4DWF A;  4US9 A;  4ANV A;  3N1X C;  2LXA A;  3R3M A;  3CMM B;  1EWC A;  5KHQ A;  1JW9 D;  2FUH B;  3HVZ A;  2BBC A;  2DZI A;  2EKE C;  4IM0 A;  1HA5 A;  2C7H A;  3Q69 A;  1D5Z C;  2W9N A;  1ZUD 2;  3MP9 A;  2DNF A;  3L13 A;  2FNJ B;  5FK9 C;  2JYT A;  2KDF B;  1SJE D;  3ZYY X;  3ZTC A;  4WJN A;  4DBG A;  3DOW A;  3JYU A;  3HVD A;  3ZLZ A;  4LJO B;  1YMH E;  3ALB A;  2JY6 A;  3IXS A;  1CMX B;  4WJO A;  3C0R B;  2JZP A;  2WX0 A;  4CQN A;  2W3S A;  2L00 B;  3SFD B;  2KOX A;  4YTP B;  1R4M I;  4W9F A;  2KAC A;  4WQO B;  3MTN B;  1BML C;  2NTT A;  3Q3M C;  1WXS A;  2ON8 A;  1SXT A;  4F1S A;  3Q3O C;  4GB9 A;  2K6Q A;  3DBR I;  5CTR C;  3M3J A;  1FRD A;  1K8R B;  1C79 A;  4TUU A;  3ZTD A;  2KWC A;  4F7Z A;  4HLE A;  4CYE A;  2JPH A;  4JL9 A;  1T6B X;  1KF6 B;  2KK8 A;  2HTH A;  3SR6 A;  1T5X D;  3DDC B;  1OFF A;  1HTO A;  2I1K A;  4AS1 A;  4HEA 1;  1JRU A;  2KDB A;  1OEY A;  4GXB A;  3KQ4 A;  2DYO A;  4BBN C;  1CJE A;  2KQ4 X;  1WSP A;  2BF8 B;  4KDI C;  2MA9 B;  3X23 A;  2DZM A;  4WQM A;  2GBR A;  1F52 A;  5BYQ A;  4OHJ A;  4G0N B;  2BS4 B;  2RGF A;  3BY4 B;  4IKG A;  3EFC A;  4RM9 A;  1WM2 A;  3AE8 B;  3BYY B;  2WX1 A;  3NS8 A;  1I4Q A;  2LFI A;  3WA0 A;  3U2S C;  1WY8 A;  3M63 B;  4YL8 A;  2HDE A;  2PJH A;  1RRB A;  1PQS A;  2MBE A;  3V6E B;  2A5U A;  2BPS A;  3NRZ A;  4JGH B;  2AL3 A;  4YSY B;  1IUE A;  1GPX A;  3NVY A;  3NS1 A;  1WRD B;  1J7B A;  3U30 A;  3W1S A;  2VZK B;  2LGI A;  4PT5 A;  1F9J A;  4B6W A;  4RGT A;  3ZRF A;  3WAN A;  1NI2 A;  3R66 C;  4KVG B;  3NY5 A;  1YIW A;  2MRP A;  1C4P A;  4K81 A;  1R4N I;  2LJ5 A;  4OVU A;  3AN1 A;  3RCZ A;  1TKE A;  2AQ1 B;  2CU1 A;  4TSS A;  3HRD D;  1L0Y B;  3VFK A;  3PRE A;  2BS3 B;  2OHF A;  4IM2 A;  2N9P C;  2Y3A A;  3Q14 C;  4IW0 A;  4A6Q A;  1Y56 A;  4I6N B;  3B2G A;  5J18 A;  3JSV A;  4K1R B;  2QSD A;  3APF A;  3IAM 1;  3ZDT A;  1WXA A;  2DHZ A;  2LD9 A;  1I4P A;  2BWF A;  2WHI A;  1NBF C;  1UH6 A;  2TSS A;  2MJD A;  2KX0 A;  5E6N A;  2O6V A;  4LTU A;  1J7A A;  1UNS A;  2LJI A;  2M4N A;  3LYY A;  4ACF A;  3AU5 A;  1P98 A;  5DPT A;  1WJ6 A;  2D3A A;  1E6E B;  2RPV A;  3R8B A;  2NR2 A;  2XK5 A;  1WWT A;  3AMZ A;  4P6V F;  3VQI A;  4IUM B;  1TY0 A;  2WP9 B;  1I4H A;  1OQY A;  2RMM A;  1YN3 A;  4DHZ E;  1RAX A;  2PKO A;  3PZ7 A;  1GJZ A;  1C76 A;  1HE8 A;  2WXL A;  2PVO D;  3EUB 2;  3L08 A;  2KJR A;  4ASW C;  1VLB A;  2V4L A;  3CSF A;  3Q8A A;  5FR6 A;  2HJ1 A;  3UIP B;  4D2K A;  2J0K A;  2LWP A;  1DOY A;  3A4R A;  3RUI B;  3CF6 E;  3TUO A;  3U8Z A;  2GI9 A;  4C4V A;  3C19 A;  2IZV B;  4J3O D;  1D5X C;  4USA A;  2E6X A;  1KRH A;  4MGK E;  2IO1 B;  2K8B A;  1V1O A;  2L83 A;  3BK2 A;  1TKY A;  2K9X A;  1QZE A;  1YNT E;  1GUA B;  5AZH A;  3P63 A;  2LGS A;  3QCA A;  4XDD A;  1N5W A;  4H2A A;  2INP E;  2KMC A;  3T3N A;  1JWS D;  1HZ5 A;  2PE9 A;  3HM3 A;  2VZK D;  3SDL C;  2BT6 A;  1KFY B;  2V3P A;  2PIA A;  1WE6 A;  4XX5 A;  2GLS A;  3SEB A;  1SE4 A;  3N9Y C;  3L17 A;  3VVW B;  1FM0 D;  5DPR A;  3PTF C;  4A55 A;  1TBE A;  3IHP C;  4KDL B;  2QIL A;  3Q2A C;  4ZRP A;  1V5O A;  1T3Q A;  2X8X X;  3RFZ B;  2KJ6 A;  2J4X A;  5CHW A;  4MEM A;  5D3D A;  4A8X C;  3C8Y A;  1MJD A;  4OZB A;  4BVU C;  3ML9 A;  1L0X B;  2PMV A;  3RZF A;  2RDH A;  2IJ0 A;  3Q3F A;  1ZKH A;  2DEN B;  4C00 A;  1R4M B;  3RNG C;  1V5T A;  5L95 C;  2I1J A;  1YQ3 B;  4JIO U;  3QAR A;  1C4A A;  1HZ6 A;  1C4C A;  3URY A;  4FLH A;  1IBX B;  1XLN A;  2DBY A;  1P7F A;  4R3D A;  2GMI C;  1E8W A;  2FCM A;  3VRA B;  1NYQ A;  2N9K A;  2GBK A;  1SJH D;  5T8I A;  1AAR A;  2ONQ A;  4S17 A;  4RFB A;  1ENF A;  4P1B C;  3FIL B;  3BYT B;  5HG2 A;  3PPA A;  5IO9 A;  2KKC A;  2JXX A;  3TJP A;  1VRA B;  2D07 B;  1AYF A;  4MGY E;  2N7D A;  3PSE B;  1L5P A;  4RNA A;  3V05 A;  2WU5 B;  3VRB B;  2Z8L A;  2INC C;  4YTN B;  3I9V 1;  4WWP A;  1Q10 A;  2YEP B;  1WX8 A;  1ET6 A;  4AUQ C;  1TKG A;  4BOS C;  2GRI A;  4GMV A;  1EF1 A;  1YX6 B;  4PK1 A;  4DDI D;  1KM7 A;  1M4V A;  2CR5 A;  4IM3 A;  1P0R A;  1WYW B;  2KWD A;  1NEN B;  1IP9 A;  2OED A;  3PLV A;  4M8N A;  2QMT A;  1V1P A;  3RNB C;  3IT4 B;  2IO3 B;  2BKR B;  1WXV A;  3AE3 B;  1V49 A;  2LUE A;  2L7R A;  5TSS A;  4GDL A;  1I4G A;  2BQQ A;  5D3I B;  2IDY A;  4NJ7 A;  4YSZ B;  4KV2 A;  4GU2 A;  2AL6 A;  1GNU A;  1EM7 A;  2GB1 A;  4B0E A;  2L8J A;  1NEK B;  2BTE A;  1N6Z A;  2KT7 A;  2KLG A;  1R4N B;  2KDI A;  5IAA C;  1SIF A;  4ZRJ A;  2ZZP B;  3PZ8 A;  3NJT A;  2N4F A;  4PS7 A;  2NCN A;  1Q1O A;  2PTL A;  4E3C A;  3RT3 B;  2Q5W D;  4G50 A;  1T0Y A;  2DAJ A;  2G4S A;  4IWQ A;  2WXH A;  4MEL A;  1VDV A;  4ZOH C;  1NI3 A;  3R2T A;  5DPS A;  3QAQ A;  1WGG A;  1FCL A;  4FJZ A;  3PV1 A;  4L23 A;  3MHZ A;  4AWJ A;  5BYR A;  3DHH C;  1DYQ A;  1UD7 A;  1OQR A;  2WNM A;  4XYC A;  3DQV A;  4M0W A;  1Y8R C;  1L6U A;  3ENE A;  4ZYS A;  2KFK B;  2UWQ A;  3A9K B;  1L6V A;  4RCO A;  1QQR A;  3PRZ A;  4C7Y A;  2EMS A;  3ZIM A;  4JPS A;  3RI7 C;  3DCG A;  4LNF A;  2C5L C;  2X38 A;  2EKI A;  4ICU A;  2LI5 A;  2KXJ A;  2RSU A;  1EUV B;  2NTS A;  3OLM D;  4JQW C;  2IND C;  5G5H A;  3VTW A;  3BZD B;  3L10 B;  2N9L A;  1SF0 A;  2MBO A;  2W54 A;  3AI5 A;  4W9E A;  3HIZ A;  1FEH A;  4HRO A;  2D3G A;  2KMA A;  4TQ1 A;  1I42 A;  2XN9 C;  4REZ A;  2KN5 A;  1BT0 A;  3SU8 X;  3EGR A;  1WR6 E;  3J9C A;  4KSK C;  3AEE B;  5BMG A;  3ZQ4 A;  3VUW A;  2KTF A;  5MPO A;  4IWO A;  1L0V B;  2BB5 A;  4EKU A;  2E3T A;  1XD3 B;  2KFJ A;  1ZGU B;  2V3S A;  2FCN A;  1TS5 A;  2RPQ A;  4ZDV A;  2WU2 B;  1MHX A;  3MJ5 A;  3T8M A;  2RR9 A;  2QJL A;  4II2 B;  2MX2 A;  1JWB D;  3PRP B;  1PFD A;  3TEZ A;  2FCS A;  2G1E A;  3QQ8 B;  1LXD A;  4RF1 A;  2NPT B;  3NG0 A;  3U7Z A;  3ZJV A;  2MHJ A;  3H7P B;  4AJW A;  3B2F A;  1PYW D;  3QX1 A;  2N1V A;  2ZW1 A;  4BBN F;  1C1Y B;  3PVL A;  4OZA A;  3RUL A;  4TV3 A;  2KLC A;  3W1Y A;  1GAQ B;  5LXH A;  3U7D A;  1XF5 L;  3R7Q A;  3O13 A;  1P7E A;  5GMV A;  3AEA B;  4XGA B;  2V1Y A;  1WH3 A;  3NOB A;  4MJS A;  2KO3 A;  4KGT A;  1E10 A;  3AE2 B;  3UQB A;  4RH6 A;  3Q8C A;  4LNK A;  1CQV A;  2ZCB A;  2JVC A;  3PS6 A;  2BVC A;  2WGS A;  2XBB C;  2HTM E;  1VD2 A;  1IYF A;  4GN1 A;  5JXV A;  1DOI A;  3AEF B;  1AWD A;  1YX5 B;  4NAM A;  3I63 C;  3PHX B;  4L2Y A;  1ZP0 B;  2KQS A;  3GE3 C;  3U4E G;  1XT9 B;  5EE0 A;  1JWA D;  1MG4 A;  1VJK A;  1ZW7 A;  4N9F 4;  1WI0 A;  1TS3 A;  2QEJ C;  3R7R A;  1M94 A;  2KQ7 A;  4TKN A;  1TGZ B;  2JXT A;  1RFA A;  4CO7 A;  4OVV A;  1VZ6 A;  3TEY A;  1FMA D;  4NAW A;  3A9J A;  2INN E;  4HJK A;  1E8X A;  2N1W A;  2WXO A;  2AYO B;  1FIQ A;  1UF0 A;  1OGW A;  1ZDX A;  4GOC A;  3ZNI D;  2ZNV B;  2WXI A;  2HE7 A;  2KC2 A;  4MGI E;  3H9D A;  1XCT L;  3ZXR A;  4E74 A;  1YQ4 B;  3MC9 A;  1HTQ A;  4MH8 A;  4RGN A;  2WXF A;  3PHW B;  2DWQ A;  3N1Y C;  1TS2 A;  4C7Z A;  2IGD A;  3DWG C;  3U52 E;  4W9H A;  3P4S B;  2L32 A;  4W9D A;  2PE6 B;  1MG8 A;  4KZ0 A;  5D7G A;  4A20 A;  4FBJ B;  4LNN A;  2B76 B;  4GLS C;  2MEK A;  2MQJ A;  4MM3 A;  1MHH E;  5L83 A;  3UIN B;  1J19 A;  3NVV A;  1Z2M A;  4ZHP A;  1VZ8 A;  5D94 A;  1YN4 A;  2IY0 B;  1G6J A;  5AUK A;  2K25 A;  1J7C A;  1KJT A;  4ANX A;  3KUD B;  3ONS A;  4IG7 B;  4AQ7 A;  4MAC A;  2CS4 A;  4RGO S;  1L4D B;  2MBQ A;  2MJ3 A;  2KMM A;  4YXD B;  4UDU C;  2UU7 A;  1B1Z A;  4W9C A;  3N3K B;  2ZCC A;  4NZL B;  4W9J A;  3WAO A;  4P16 A;  2RD0 A;  5AZF A;  1H4R A;  1V6E A;  1FFV A;  3V60 A;  1TY2 A;  2LRU A;  4KIK A;  3L16 A;  3GS2 A;  2LHE A;  4PYU A;  1WYG A;  2XEW A;  5E6J A;  3MHS D;  1V2Y A;  1RWS A;  2JWU A;  3PT2 B;  2DX5 B;  2GBM A;  3OG5 A;  3VH4 B;  1E5W A;  1S1Q B;  2KTR B;  4W9L A;  2PEA A;  1XLO A;  1SB3 C;  1NYR A;  1WJU A;  3HK0 A;  1UBQ A;  2KWV B;  4ZRK A;  3WAP A;  3DVN V;  5HFY A;  2J42 A;  1WM3 A;  4PS8 A;  3QHT A;  3EA6 A;  3V3X A;  2KDE B;  3BII D;  3H7S A;  4EE2 A;  3PO0 A;  2LXC A;  2IBI B;  2WXG A;  4FUL A;  2NBW B;  2L52 A;  1SE9 A;  2AWT A;  3AB5 A;  4XDC A;  5HKH A;  1KLU D;  2BB6 A;  3KLS X;  4EZJ A;  2ICI A;  1L4Z B;  1XXG A;  3NZS A;  2SEB D;  2MP2 B;  2KJH B;  3TSS A;  1FNU A;  1SGH A;  1DGJ A;  3UF8 A;  2CHX A;  4NJC A;  4J6I A;  2J7Q B;  1J8C A;  1WGD A;  3IBE A;  5EE1 A;  3M62 B;  2N9E B;  1H8C A;  2FE8 A;  1TT5 B;  4HVB A;  3GZN B;  4HCP B;  3RNC C;  2JYE A;  3KYC D;  2K6D B;  3R2I A;  2IO2 B;  2KNB A;  2FAZ A;  4PYZ A;  2ZPN A;  3ZDM C;  2KC1 A;  1OTR B;  2NVU I;  2Y5B B;  2D3C A;  4YTM B;  1HQR D;  3AE5 B;  1WMH B;  3AXC A;  5IOI A;  2AQ2 B;  1WFY A;  3TCA A;  4ITK A;  2OJR A;  2Z0E B;  4HJG E;  4KGR A;  2PPH A;  4EZL A;  3OJ4 B;  5FKA C;  1WX9 A;  2LRW A;  2M17 A;  1JML A;  5I4D A;  2FUG 1;  1GOZ A;  2VH2 A;  3H6N A;  1XEE A;  3UIO B;  1V81 A;  1SE2 A;  1F77 A;  1D6E C;  3NZ3 A;  1E7U A;  1LFD A;  3AH7 A;  3ZKJ C;  4I6L B;  2FID A;  3LJ3 A;  1J0G A;  2REX A;  2MCN B;  1LM8 B;  1K52 A;  3LB8 C;  3FAH A;  3B9J A;  1ZPS A;  1WXQ A;  4XC2 A;  1LQB A;  2V3N A;  3KUC B;  3PZD A;  1WX7 A;  5BYS A;  1VCB A;  2L0T A;  2WXP A;  4WJQ A;  3P4Q B;  4WAF A;  4B95 A;  3A1Q B;  5LLI A;  1UWM A;  3VTU A;  3TMP B;  1QLB B;  1JAL A;  4W9I A;  4RF0 A;  2KX3 A;  4GIV A;  2K1F A;  4K7U A;  4N58 A;  2JZZ A;  1ZXI A;  5AZG A;  4O1N A;  2B3A A;  2WDT B;  4FHK A;  1YD8 U;  1IPG A;  3AE1 B;  3MJW A;  2MSE D;  5EE9 A;  3IT6 B;  4MT5 A;  1MVK A;  3IG3 A;  1TS4 A;  2J52 A;  3BVZ A;  3DVG Y;  4BKT A;  4GDK B;  2HD5 B;  1V8C A;  3CWI A;  2O2V B;  2KD0 A;  3IFW B;  3LXF A;  2G4D B;  3DHI C;  1P3Q U;  2KTR A;  4DXF A;  5JHB A;  3TEW A;  3NVZ A;  2PLP A;  1T0Q C;  2RDB C;  3QC8 B;  3H8H A;  4RMA A;  2NBV B;  1DOX A;  4TQ0 A;  5HI1 A;  4AJY B;  4DK5 A;  1N5X A;  1QF6 A;  1L2N A;  3EHV A;  3V62 A;  2WXR A;  4EOY A;  1E90 A;  3WIM A;  2M0X A;  2MH7 A;  1Q0W B;  3N32 A;  3BVG A;  2IGG A;  4BZA A;  3AE4 B;  1YOV B;  3QWZ B;  3DBL I;  2JWZ A;  4NJ6 A;  4L1B A;  5BMH A;  1XO3 A;  2D3B A;  1QT9 A;  2ZNV C;  2CKH B;  3MC8 A;  2D11 A;  4YT0 B;  2KYW A;  5G55 A;  1KLV A;  3RYT A;  4EEW A;  1ET9 A;  2N7E A;  2QC8 A;  3VR9 B;  1X1M A;  1V80 A;  4WH4 A;  2WXK A;  3T9L A;  3MC0 B;  4YWG G;  4C80 A;  3KWV A;  3HHM A;  1HEZ E;  4G3X B;  2KHW B;  2BYV E;  4YSX B;  3N30 A;  4KZC A;  2IPK D;  1EU4 A;  4M02 A;  3DWM A;  2QHO A;  2WDQ B;  4LJP B;  2L05 A;  1C77 A;  1YQB A;  3GB1 A;  4BKS D;  3VHT C;  4DDG D;  3I57 A;  1E7V A;  1ZOY B;  3B0A A;  4HCN B;  1TIF A;  5E6P A;  3ZXV A;  2QIE B;  4FJY A;  3I5J C;  2M8S A;  4ANW A;  3DBS A;  1C3T A;  4W9K A;  3GOE A;  1WF9 A;  2MLB A;  3H1U A;  1PGA A;  2KWU B;  3IVF A;  2G9H D;  3MFG A;  2K39 A;  3ZUN A;  1E0Z A;  1PGX A;  3KW5 B;  4URK A;  4EZK A;  2K8C A;  2DZK A;  1FFU A;  2W55 A;  5IKC M;  2ZEQ A;  2V9H A;  2XNA C;  1NDD A;  4ANU A;  1V9J A;  1FXI A;  3FC4 A;  4OZC A;  2GOW A;  1IBX A;  4FA6 A;  4M00 A;  2RDG A;  4MDK E;  2EEL A;  5LXI B;  1C78 A;  5FR3 A;  5D2M B;  2LVP A;  1MFW A;  1MI0 A;  3FIL A;  2LUM A;  3L0W B;  3LDZ E;  2C7M B;  4LCD E;  3GZN I;  3D32 A;  3NHE B;  2WXQ A;  5LNK 1;  5H92 C;  4A9A A;  4MGZ E;  3HM6 X;  4M01 A;  1E8Z A;  2LZ6 A;  3GP7 A;  2VH1 A;  4B9K A;  1UGJ A;  3JSV B;  3DBH B;  4GDK A;  1RLF A;  3WAM A;  1FXT B;  1E8Y A;  2JX5 A;  3WCQ A;  5JH5 C;  3DHG C;  1TZO A;  1K53 A;  1KTK A;  3NZU A;  2O6V B;  3AU4 A;  1ZE3 D;  3SD5 A;  5DCN A;  1QIL A;  2KVZ A;  3KVF B;  1D4B A;  4FJV B;  1STE A;  1WXM A;  4NQK E;  3ZJT A;  1A70 A;  3RNA C;  4IOI E;  3CIR B;  2XK5 B;  1WIA A;  3OAW A;  2CJO A;  2L76 A;  1BUI C;  2OJW A;  4F8C B;  1JCK B;  2DLB A;  2WS3 B;  2YEP F;  2BYT A;  3RPF C;  2BWE S;  1WR1 A;  1ISN A;  2YVC A;  2NS5 A;  3V61 A;  5CHF A;  3VAW A;  2OOB B;  1N62 A;  3VH3 B;  2KVR A;  1RFK A;  2ZJD A;  2IY1 B;  4HXD A;  4KX6 B;  2M56 B;  4C4V B;  3ZRC A;  2JSV X;  3EFU A;  2C7N B;  5IN7 A;  1KH0 A;  4EUT A;  1IGD A;  3QJZ A;  4ZRI A;  2C9W B;  2MBB B;  1Z5S B;  4FN2 A;  3KYD D;  4LNI A;  4NNJ B;  4DHJ B;  1ZDV A;  3E56 A;  5IA7 A;  5CHV C;  3RNE C;  2WDR B;  4NY0 A;  4Q2J A;  3AED B;  2ZPY A;  3RNF C;  2HJ8 A;  3ABV B;  1WJN A;  2M0A A;  4KKJ A;  3NUH B;  2PVG C;  4S0R A;  3VDZ A;  2JF5 A;  3O65 B;  5C1Z A;  2FCQ A;  3PGE A;  3OJ3 A;  3QK0 A;  3W2D A;  2BKF A;  2G45 B;  5EE3 A;  2KFK A;  3A9K A;  1RYJ A;  1UGM A;  1WE7 A;  4HPL B;  1SEB D;  3VUX A;  3ZVV A;  1QOA A;  4WIP A;  4JWU C;  3DBL B;  5DPW A;  3AV8 A;  1CZP A;  2WWZ A;  4LLG M;  3DVG X;  1SBB B;  3AE9 B;  2LAS A;  3B08 A;  5D6J B;  1SE3 A;  4G11 A;  4RGM A;  1VR9 A;  2N0S B;  2AX5 A;  3FKY A;  3KWL A;  1JWU D;  1TTN A;  2O6V D;  2IO0 B;  1UWX A;  4GGQ A;  4FAD A;  1F1H A;  2CHZ A;  3Q3J A;  1GC7 A;  4DHZ B;  2WXN A;  1JRO A;  2NBU A;  4NQL B;  4HK2 A;  4XWT A;  1WGH A;  4K7S A;  1GB1 A;  1FD6 A;  2MW5 A;  4JE3 B;  2Z59 B;  4IC7 B;  2JU6 X;  1F2R I;  1WJ4 A;  1FCC C;  2WDV B;  3TBL D;  2NPT A;  4XWW A;  4KKI A;  2JQR B;  1D5M C;  4JWS C;  3BIN A;  3PRM B;  4AOF A;  3H7P A;  4EFO A;  2J0M A;  3ZGZ A;  2UYZ B;  3P4P B;  1EF5 A;  2L1A A;  1BXT A;  2ZVO A;  4BKG A;  2YLM A;  2JUO A;  2Y5P A;  3VTV A;  1F2R C;  1VZ7 A;  3KH0 A;  5EDS A;  1ZXH A;  3APC A;  3BWU D;  1TZ1 A;  3HUI A;  2GBN A;  3P4R B;  4DHJ D;  4DXA B;  1ROE A;  1TJE A;  1LO5 D;  2LHD A;  4C56 C;  1V1P B;  4HRS A;  5JZE B;  2W3R A;  4GDL B;  4FXC A;  1WGK A;  2J53 A;  4N6E B;  2FBW B;  4E71 A;  4HDO A;  3BVM A;  5E6O A;  1WGR A;  4LK0 M;  1QOB A;  3AM9 A;  3A4S C;  4DQO C;  3KUZ A;  2ACZ B;  2KDM A;  5KHO A;  2Y5C A;  2Z0D B;  1FRR A;  3CST A;  1B9R A;  3W9C B;  4BOZ B;  2H88 B;  2CHW A;  2JZ3 B;  1R7S A;  1KOT A;  4HPM B;  2DYM A;  4ZHO A;  3EC8 A;  4HKZ E;  3AE7 B;  4K3C A;  5G5G A;  1Q5W B;  3AEB B;  1LGR A;  5J17 A;  2FIF A;  2WYQ A;  3Q3N C;  1XLQ A;  1ACC A;  4P7I A;  1CK1 A;  5TR5 A;  2GBJ A;  1L7Y A;  3DBH I;  3W1S C;  1JRP A;  2IYD B;  4P1C C;  1OQQ A;  1FPY A;  3DVN U;  1EU3 A;  2MBH A;  1WGY A;  3ETR A;  4XZ4 A;  2CJN A;  1QOF A;  4HPP A;  3AEG B;  2SAK A;  1RM6 C;  4M0W B;  3TL5 A;  2KAJ A;  2PW9 A;  2K8H A;  1YJ1 A;  2MWS B;  3APD A;  4ZRQ A;  1FNW A;  2QCZ A;  2AEH A;  2R61 A;  4WWO A;  1OEY J;  3L54 A;  4W9G A;  4OVZ A;  1KLG D;  1UZX B;  3Q8E A;  5C2T B;  5AUI A;  3W5U B;  2G3Q B;  4M8M A;  2ASQ A;  1GB4 A;  2K22 A;  3JVZ X;  2LMC A;  4N59 A;  4PS3 A;  1FXA A;  3UI3 A;  1JWM D;  2KAN A;  2ZVN A;  2V0G A;  3IAS 1;  4ZYN A;  5GXG B;  3DBR B;  4A3O A;  4NPN A;  1QOG A;  4OW0 A;  4HDQ A;  4LDT B;  1XCQ L;  4US8 A;  3ML8 A;  3PLU A;  2L3Z A;  1PUT A;  1V97 A;  3ZJU A;  2WXJ A;  1UUP A;  1WRI A;  2K5P A;  4RM8 A;  1S3S G;  3W5V B;  3A33 B;  4QAY A;  1C9F A;  1N60 A;  1I35 A;  1FNV A;  3ZW3 A;  1AW7 A;  3Q8B A;  4MSM B;  4BFR A;  2BYE A;  1FO4 A;  3E9S A;  1YJI A;  4KSL C;  2AQ3 B;  1JQ4 A;  1N61 A;  3GE8 C;  2LGY A;  3RD2 A;  4WJP A;  3VXW A;  2KN4 A;  2WXM A;  1UBI A;  2BS2 B;  2V4I B;  4WWN A;  2M19 A;  1MPE A;  1SIJ A; 
#chains in the Genus database with same CATH homology
 3ZNZ B;  2LVP A;  4MGK E;  2IO1 B;  2K8B A;  3K9O B;  4W9H A;  2J0J A;  4W9D A;  2PE6 B;  4MJS B;  1MG8 A;  4KZ0 A;  5D7G A;  1QZE A;  4A20 A;  1P1A A;  4X57 B;  4FBJ B;  2D10 A;  1WZ3 A;  3SHQ A;  3L0W B;  1GUA B;  5AZH A;  3LDZ E;  2C7M B;  3QCA A;  4GSW A;  4LCD E;  3GZN I;  2MQJ A;  4MM3 A;  5AEK B;  2KMC A;  3D32 A;  5L83 A;  4II3 B;  3UIN B;  3NHE B;  4JLC A;  1J19 A;  2EMT A;  1Z2M A;  2PE9 A;  4MGZ E;  5D94 A;  2IY0 B;  3HM3 A;  1G6J A;  4MSQ B;  3SDL C;  3ECI A;  3HM6 X;  2K25 A;  1E8Z A;  2LZ6 A;  1KJT A;  4B9K A;  3JSV B;  4ANX A;  3KUD B;  3ONS A;  4GDK A;  2LGX A;  2DAF A;  1WZ0 A;  3M95 A;  1RLF A;  4IG7 B;  1WE6 A;  2MP2 A;  3B1L X;  3WAM A;  1FXT B;  2BGF A;  4XX5 A;  1E8Y A;  2CS4 A;  3L17 A;  2D2Q A;  1EO6 A;  2MBQ A;  3DPD A;  3V6C B;  3VVW B;  5DPR A;  5JH5 C;  3PTF C;  2JRH A;  4I6P A;  3ZO5 B;  1XQQ A;  1D3Z A;  3NZU A;  1TBE A;  2M1M A;  2O6V B;  2LVQ A;  3IHP C;  3AU4 A;  5C23 A;  4KDL B;  4W9C A;  3N3K B;  3SD5 A;  2ZCC A;  1V5O A;  3X0W A;  5DCN A;  4W9J A;  3KVF B;  3WAO A;  4FJV B;  2RD0 A;  5AZF A;  4A3P A;  1WXM A;  4NQK E;  1H4R A;  1V6E A;  1A5R A;  2KJ6 A;  4FHJ A;  5CHW A;  4MEM A;  5BO4 B;  3V60 A;  2XK5 B;  2LRU A;  2R2Q A;  1WIA A;  4KIK A;  3L16 A;  3OAW A;  5G2N A;  2L76 A;  4BVU C;  4CHK A;  3ML9 A;  4F8C B;  3RZF A;  1WMH A;  3Q3F A;  1ZKH A;  4PYU A;  2KZR A;  2DEN B;  2XEW A;  3I3T B;  4HWI B;  3MHS D;  1V2Y A;  3PT2 B;  4NAW B;  2DX5 B;  1V5T A;  2GBM A;  4IWP A;  1GC6 A;  3A9J B;  5L95 C;  2BWE S;  1WR1 A;  2I1J A;  1E5W A;  1S1Q B;  2C60 A;  1ISN A;  2KTR B;  4W9L A;  3S2A A;  3VH4 B;  2PEA A;  2YVC A;  4JIO U;  3HK0 A;  1WJU A;  1UBQ A;  2KWV B;  2NS5 A;  2A4Z A;  3QAR A;  3DVN V;  4ZRK A;  3WAP A;  2DYB A;  3V61 A;  5CHF A;  3VAW A;  2OOB B;  4K7W A;  4FLH A;  5EDS A;  3VH3 B;  2KVR A;  1WM3 A;  2L0F A;  4PS8 A;  2ZJD A;  2IY1 B;  2R2O A;  4HXD A;  2GMI C;  4LDT D;  3QHT A;  1E8W A;  3ZRC A;  2FCM A;  2KDE B;  3EFU A;  2GBK A;  1UEL A;  2C7N B;  3H7S A;  2N9X A;  1AAR A;  4ICV A;  2JRI B;  2LXC A;  4EUT A;  2DZJ A;  2IBI B;  4FUL A;  3PPA A;  3QJZ A;  2KKC A;  2NBW B;  2JXX A;  4ZRI A;  2C9W B;  2VRR B;  3TJP A;  1SE9 A;  3WAL A;  2MBB B;  1Z5S B;  2D07 B;  2AWT A;  2N7D A;  4FN2 A;  4MGY E;  3KYD D;  3PSE B;  2JT4 B;  4NNJ B;  5HKH A;  3TIX A;  4DHJ B;  3P2B A;  3QA8 A;  4WWP A;  5IA7 A;  1P9D U;  5CHV C;  4EZJ A;  5JHA A;  3A1Q A;  1WX8 A;  4NY0 A;  2LVO A;  3NZS A;  2ZPY A;  2MP2 B;  4AUQ C;  2HJ8 A;  2KJH B;  3JW0 X;  4BOS C;  1U4A A;  1WJN A;  1SGH A;  3VDZ A;  3UF8 A;  4BKS A;  2JF5 A;  3O65 B;  4GMV A;  5C1Z A;  1EF1 A;  1YX6 B;  2CHX A;  2FCQ A;  4J6I A;  3PGE A;  3OJ3 A;  3QK0 A;  4DDI D;  2BKF A;  2G45 B;  2J7Q B;  3RZW C;  2KFK A;  1KM7 A;  3A9K A;  4MH0 E;  4AP4 C;  1J8C A;  1WGD A;  2LGD A;  3IBE A;  1UGM A;  2BYF A;  2N9E B;  3M62 B;  2CR5 A;  1WE7 A;  4HPL B;  3UQA A;  1H8C A;  4IM3 A;  1P0R A;  3VUX A;  1WYW B;  3ZNG C;  3QIJ A;  3ZVV A;  4HVB A;  1IP9 A;  5DPW A;  4HCP B;  3EEC A;  3KYC D;  3PLV A;  2K6D B;  3VUY A;  2IO2 B;  4M8N A;  2KNB A;  4KIK B;  2FAZ A;  4PYZ A;  3ZNH B;  2WWZ A;  2IO3 B;  2BKR B;  1WXV A;  2ZPN A;  3DVG X;  3ZDM C;  2KC1 A;  1V49 A;  5CX3 A;  2LAS A;  2LUE A;  2L7R A;  1OTR B;  1GG3 A;  2NVU I;  2Y5B B;  3B08 A;  4GDL A;  2O2V A;  3AUL A;  5D6J B;  3K9P B;  1WMH B;  3AXC A;  4G11 A;  1V86 A;  3UGB B;  1WFY A;  3TCA A;  5J2R A;  2OJR A;  4NJ7 A;  2Z0E B;  4KV2 A;  2PPH A;  4EZL A;  3OJ4 B;  4WAA A;  4DWF A;  4GU2 A;  1WX9 A;  2LRW A;  2M17 A;  2AL6 A;  4ANV A;  1TTN A;  1GNU A;  2LXA A;  2O6V D;  3R3M A;  2IO0 B;  3CMM B;  4GGQ A;  5KHQ A;  3H6N A;  2L8J A;  2FUH B;  4FAD A;  3UIO B;  2DZI A;  2EKE C;  1V81 A;  2CHZ A;  2KLG A;  3Q3J A;  1GC7 A;  4DHZ B;  2KDI A;  4IM0 A;  2NBU A;  4NQL B;  4HK2 A;  5IAA C;  2C7H A;  1SIF A;  4ZRJ A;  2ZZP B;  1E7U A;  1LFD A;  1WGH A;  3ZKJ C;  2W9N A;  4K7S A;  2N4F A;  4I6L B;  2FID A;  2MW5 A;  3LJ3 A;  4PS7 A;  1J0G A;  2REX A;  2Z59 B;  2NCN A;  1Q1O A;  2MCN B;  4E3C A;  3RT3 B;  1LM8 B;  3L13 A;  2FNJ B;  4IC7 B;  4G50 A;  1T0Y A;  2DAJ A;  2KDF B;  2G4S A;  3ZTC A;  1WJ4 A;  4WJN A;  4DBG A;  3DOW A;  3JYU A;  3ZLZ A;  3TBL D;  4LJO B;  2NPT A;  3ALB A;  2JY6 A;  4XC2 A;  1LQB A;  4IWQ A;  3KUC B;  1CMX B;  4MEL A;  3BIN A;  3PRM B;  3PZD A;  4WJO A;  4AOF A;  1WX7 A;  3C0R B;  3H7P A;  1VCB A;  2WX0 A;  2L0T A;  4WJQ A;  5DPS A;  4EFO A;  2L00 B;  2J0M A;  3QAQ A;  1WGG A;  2UYZ B;  4B95 A;  3A1Q B;  3PV1 A;  4FJZ A;  4AWJ A;  5LLI A;  2KOX A;  1R4M I;  4W9F A;  4WQO B;  3VTU A;  3TMP B;  1UD7 A;  3MTN B;  1EF5 A;  4W9I A;  1WXS A;  2ZVO A;  4BKG A;  4F1S A;  2YLM A;  4GB9 A;  2KX3 A;  4GIV A;  3DQV A;  2K1F A;  1Y8R C;  2K6Q A;  4K7U A;  3DBR I;  5CTR C;  2JUO A;  3VTV A;  3ENE A;  3M3J A;  2JZZ A;  2KFK B;  2UWQ A;  3A9K B;  5AZG A;  1K8R B;  3PRZ A;  2B3A A;  2WDT B;  3KH0 A;  1YD8 U;  3APC A;  1IPG A;  4FHK A;  2KWC A;  4TUU A;  2EMS A;  3ZTD A;  3MJW A;  3ZIM A;  1TZ1 A;  2MSE D;  4F7Z A;  3DCG A;  2GBN A;  2C5L C;  4DHJ D;  4DXA B;  4HLE A;  4ICU A;  2LI5 A;  4CYE A;  2KXJ A;  2RSU A;  1EUV B;  2JPH A;  3OLM D;  4JL9 A;  3IG3 A;  4JQW C;  3DVG Y;  5JZE B;  2KK8 A;  3VTW A;  4BKT A;  3L10 B;  2HTH A;  2HD5 B;  3DDC B;  4GDL B;  2MBO A;  2O2V B;  3AI5 A;  4GDK B;  4W9E A;  3HIZ A;  2I1K A;  4E71 A;  2D3G A;  4HDO A;  2KD0 A;  3IFW B;  2G4D B;  2KMA A;  1JRU A;  2KDB A;  1OEY A;  1WGR A;  4GXB A;  4TQ1 A;  5E6O A;  1I42 A;  2KN5 A;  2DYO A;  1BT0 A;  4BBN C;  1P3Q U;  2KTR A;  3SU8 X;  1WR6 E;  4KSK C;  2BF8 B;  3A4S C;  3KUZ A;  3VUW A;  2KTF A;  4IWO A;  4KDI C;  2MA9 B;  5KHO A;  4EKU A;  3X23 A;  2DZM A;  2Z0D B;  2GBR A;  5JHB A;  3CST A;  1XD3 B;  2KFJ A;  4BOZ B;  4G0N B;  1ZGU B;  2V3S A;  2FCN A;  3QC8 B;  2CHW A;  2JZ3 B;  2RGF A;  3BY4 B;  4RMA A;  2NBV B;  4RM9 A;  4HPM B;  1KOT A;  1WM2 A;  2RPQ A;  4ZDV A;  4TQ0 A;  3T8M A;  4AJY B;  2RR9 A;  4DK5 A;  2DYM A;  3EC8 A;  1L2N A;  3EHV A;  2WX1 A;  3NS8 A;  4II2 B;  2MX2 A;  3V62 A;  4EOY A;  1E90 A;  3WIM A;  3WA0 A;  3PRP B;  1Q5W B;  1WY8 A;  1Q0W B;  2M0X A;  3M63 B;  3N32 A;  4YL8 A;  2FCS A;  5J17 A;  2PJH A;  3QQ8 B;  2FIF A;  1LXD A;  1RRB A;  1PQS A;  2MBE A;  2WYQ A;  3V6E B;  2A5U A;  2NPT B;  3QWZ B;  2BPS A;  3DBL I;  2JWZ A;  4NJ6 A;  4P7I A;  4JGH B;  2AL3 A;  5TR5 A;  2GBJ A;  3H7P B;  4AJW A;  3QX1 A;  1WRD B;  3U30 A;  2N1V A;  1L7Y A;  3W1S A;  3DBH I;  3W1S C;  4BBN F;  1C1Y B;  2CKH B;  2ZNV C;  3PVL A;  3RUL A;  2IYD B;  4TV3 A;  2KLC A;  2D11 A;  3W1Y A;  5LXH A;  1F9J A;  3U7D A;  4B6W A;  5G55 A;  3DVN U;  3R7Q A;  2MBH A;  1WGY A;  3ZRF A;  4XZ4 A;  3WAN A;  1NI2 A;  5GMV A;  3R66 C;  1KLV A;  3RYT A;  4EEW A;  4KVG B;  3NY5 A;  1YIW A;  4M0W B;  3TL5 A;  2N7E A;  2MRP A;  1X1M A;  1V80 A;  4K81 A;  2V1Y A;  1WH3 A;  3NOB A;  4MJS A;  2K8H A;  3T9L A;  1R4N I;  2LJ5 A;  1YJ1 A;  2KO3 A;  2MWS B;  4OVU A;  3APD A;  3RCZ A;  3UQB A;  2CU1 A;  3HHM A;  2AEH A;  3PRE A;  4WWO A;  3VFK A;  4IM2 A;  4G3X B;  1OEY J;  2N9P C;  2KHW B;  2BYV E;  3L54 A;  2ZCB A;  2JVC A;  3N30 A;  4KZC A;  4W9G A;  4IW0 A;  4I6N B;  3PS6 A;  1UZX B;  2XBB C;  1VD2 A;  3JSV A;  5J18 A;  2G3Q B;  4K1R B;  2QHO A;  4M8M A;  3APF A;  4LJP B;  1IYF A;  4GN1 A;  2ASQ A;  3JVZ X;  3ZDT A;  2L05 A;  1WXA A;  2DHZ A;  2LD9 A;  4PS3 A;  1YQB A;  4BKS D;  3VHT C;  4DDG D;  1YX5 B;  1E7V A;  2BWF A;  2KAN A;  3B0A A;  1NBF C;  1UH6 A;  2ZVN A;  4HCN B;  4ZYN A;  3PHX B;  5E6P A;  2KX0 A;  5E6N A;  2O6V A;  2KQS A;  1XT9 B;  2M4N A;  4FJY A;  4A3O A;  3AU5 A;  1P98 A;  2M8S A;  4ANW A;  3DBS A;  1C3T A;  5DPT A;  4NPN A;  4W9K A;  3GOE A;  4HDQ A;  1ZW7 A;  4N9F 4;  1WF9 A;  1WJ6 A;  1WI0 A;  4LDT B;  2NR2 A;  2MLB A;  3ML8 A;  3PLU A;  2XK5 A;  3H1U A;  2KWU B;  3R7R A;  1M94 A;  2KQ7 A;  3IVF A;  4TKN A;  2L3Z A;  3VQI A;  1TGZ B;  4IUM B;  1RFA A;  2K39 A;  1OQY A;  4CO7 A;  3ZUN A;  4DHZ E;  4OVV A;  4RM8 A;  1S3S G;  1RAX A;  3A33 B;  3KW5 B;  4URK A;  4EZK A;  1GJZ A;  1HE8 A;  2DZK A;  2K8C A;  4NAW A;  3L08 A;  2KJR A;  3A9J A;  2V4L A;  4HJK A;  4ASW C;  3ZW3 A;  1I35 A;  3CSF A;  4MSM B;  1E8X A;  2N1W A;  2BYE A;  4BFR A;  2ZEQ A;  2AYO B;  4KSL C;  5FR6 A;  1NDD A;  1OGW A;  4GOC A;  3ZNI D;  2ZNV B;  3UIP B;  4ANU A;  1V9J A;  2LGY A;  2HE7 A;  2GOW A;  2KC2 A;  2J0K A;  2LWP A;  4MGI E;  3A4R A;  3RD2 A;  3RUI B;  4FA6 A;  3CF6 E;  3H9D A;  4WJP A;  3U8Z A;  4MDK E;  3VXW A;  4E74 A;  1UBI A;  2IZV B;  4WWN A;  5LXI B;  3PHW B;  5D2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...