3B0AA

Crystal structure of the mouse hoil1-l-nzf in complex with linear di-ubiquitin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/metal binding protein
molecule keywords Polyubiquitin-C
publication title Specific recognition of linear ubiquitin chains by the Npl4 zinc finger (NZF) domain of the HOIL-1L subunit of the linear ubiquitin chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b0aA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b0aA02
4IWQA 3H1UA 5BO4B 2AL3A 2KKCA 4KVGB 2FIFA 3V62A 4N9F4 2JWZA 1E5WA 3H7PB 2MCNB 2W9NA 3UIOB 3PS6A 4GGQA 1R4MI 3QC8B 2NPTA 1V5OA 2ZCBA 4NAWA 2C7MB 2G4DB 2BGFA 2VRRB 2MA9B 3UQAA 1WGDA 5DPRA 1H8CA 2MRPA 1YD8U 3PREA 3LDZE 4EZKA 5JH5C 3ZTDA 1T0YA 1C1YB 1WF9A 2HD5B 2UYZB 3QARA 2XK5A 4IM3A 3SHQA 5FR6A 2L3ZA 3ZW3A 4BKTA 3PHWB 2LGXA 2C5LC 2D10A 1WM2A 2EMSA 3ZDTA 2KTRA 1X1MA 4TQ1A 4X57B 2KX3A 2J0KA 2KJHB 2NR2A 4WQOB 2GOWA 3W1SC 1V6EA 4E74A 2LD9A 3VTWA 2KD0A 1HE8A 3VTUA 4B6WA 3RT3B 4DDID 1XQQA 3U30A 3ZIMA 1J0GA 1C3TA 2NBVB 2V1YA 4URKA 3ZRFA 2K25A 3QAQA 2N1WA 2FAZA 3BY4B 4ICUA 2ZZPB 3NS8A 3QIJA 4ZRKA 1R4NI 3AXCA 4JIOU 1GC6A 4DHJB 2K6DB 4MELA 3NZUA 2A4ZA 2LVQA 1VD2A 2KC1A 2GBKA 3L13A 3VUYA 3WA0A 4BOSC 1S3SG 1UBQA 2IY1B 4KIKA 2M17A 4M0WB 4G3XB 2AL6A 3CMMB 3KUZA 2BYVE 4I6PA 4IM2A 3NY5A 4MGIE 4WJPA 2Z0EB 4DHZB 3CF6E 1XD3B 5E6PA 1H4RA 2FUHB 1WE6A 3N30A 4HLEA 3DOWA 2J0JA 2DHZA 2ZJDA 2MBHA 3S2AA 3QHTA 1FXTB 3VDZA 3SD5A 4B95A 4OVVA 1E7UA 4WJOA 2RPQA 2JXXA 1WM3A 4DHJD 1E90A 2I1JA 2MP2B 2KQ7A 2N4FA 4XX5A 3DDCB 2MLBA 1UZXB 3EC8A 1WJUA 2NBWB 2JRHA 2M8SA 2XBBC 1WJNA 2KN5A 1WZ3A 2G3QB 1WGGA 2LVOA 3HK0A 1EF5A 4RMAA 3AI5A 4TV3A 5L95C 2D2QA 2DENB 4HXDA 5JHBA 2MBOA 3DVGX 1L7YA 4RM8A 2K8HA 4WWOA 4TUUA 4LJOB 5E6NA 1TZ1A 3ML9A 5AZGA 2CHWA 2KLCA 4BKSD 4I6LB 2KOXA 4EEWA 4HWIB 2JZ3B 4KZ0A 1GC7A 2AYOB 3ECIA 4HPMB 3VUXA 3RCZA 3DCGA 5C23A 3KUDB 1WGHA 5IAAC 4BOZB 3O65B 4IW0A 2M0XA 2IY0B 2LRUA 3X0WA 3ZNZB 2MBQA 3AU5A 3DVGY 4XC2A 4HVBA 5KHOA 3H9DA 5AZFA 2DZIA 2CKHB 2O6VB 4DDGD 1WR6E 3VUWA 3OJ4B 2N9XA 4KSKC 4GDKB 3ENEA 4BKGA 3A1QB 2YVCA 2N7EA 4MH0E 2FNJB 3KW5B 4ZRJA 3V6CB 4FBJB 5DPWA 4W9EA 4MGZE 4W9CA 5DCNA 2O2VA 4IG7B 2C9WB 2L00B 2V4LA 5TR5A 3EECA 1WMHA 2KFKB 2L0TA 3C0RB 2MSED 5D94A 2KFJA 2JVCA 5CHWA 3Q3JA 3A4SC 2ZNVB 3SU8X 4MEMA 3PLUA 4GIVA 4FULA 1Z5SB 2CU1A 2KNBA 2LGDA 4WWPA 3UINB 2IO2B 5G55A 4MGYE 2WX0A 4ZRIA 1YIWA 2O6VD 3ZDMC 3IFWB 3SDLC 1E8YA 3PT2B 3MTNB 2FCQA 4WJQA 3VQIA 1G6JA 3JSVA 3WANA 1RRBA 1KJTA 2FCMA 4MGKE 3TBLD 3DBHI 1V80A 2DYOA 5LXIB 4FJVB 2DAFA 2MBBB 5LLIA 4K7WA 2LGYA 4AWJA 2NPTB 1ZKHA 2KZRA 1EO6A 1SGHA 4NAWB 4TKNA 2NCNA 4GOCA 1GUAB 2MBEA 4FA6A 4G0NB 2JF5A 2IZVB 4A3PA 1YJ1A 4G11A 1ZGUB 4NNJB 5E6OA 4PYUA 2XK5B 2BWFA 1P3QU 3ZNID 4HDQA 3ZNHB 3ZO5B 5HKHA 4BBNC 3AULA 2JZZA 5KHQA 3KVFB 2LUEA 3LJ3A 3RUIB 2KTRB 5D6JB 5C1ZA 2ZVNA 3L0WB 3TMPB 3ALBA 2J7QB 3D32A 4NQLB 2K1FA 5CHVC 2CHZA 3TIXA 3VTVA 3M95A 2YLMA 2UWQA 4EUTA 1LQBA 2RD0A 4CHKA 2C60A 4NY0A 1WX9A 1WIAA 4AP4C 2MW5A 2BKFA 2BYFA 2KK8A 2AEHA 1V49A 4M8NA 4BFRA 3A9KA 4JL9A 1TTNA 3NOBA 3Q3FA 4PS7A 4ZYNA 1WJ4A 2RR9A 1WX8A 1OEYJ 2A5UA 2L0FA 3IVFA 3TJPA 2KX0A 1WGRA 3DVNV 3OJ3A 5LXHA 1M94A 4ICVA 1MG8A 4W9HA 4GN1A 2RSUA 3QWZB 3N3KB 2DYMA 1UD7A 2DZKA 4LJPB 3KUCB 3MHSD 3PRZA 1TBEA 3VVWB 3A9JA 4TQ0A 1P9DU 2M4NA 4PS3A 5J17A 2IO0B 4ANVA 1UH6A 4EFOA 2LASA 2KJRA 1CMXB 3K9PB 5EDSA 3UF8A 3DBSA 4II2B 2LWPA 3RD2A 2KVRA 1J19A 4W9DA 2ASQA 1GG3A 2KDFB 2KMCA 4DK5A 4PS8A 2FCNA 3H6NA 1IPGA 2NS5A 4AJWA 2NBUA 3PZDA 4LCDE 4FJYA 2RGFA 1EF1A 4JLCA 2LJ5A 1NDDA 3BINA 4II3B 2C7HA 3DVNU 3VH3B 3ZNGC 4KV2A 2D3GA 2K39A 4EKUA 4WJNA 1WE7A 4WAAA 1L2NA 3ZKJC 1WZ0A 3OAWA 5J18A 5L83A 3QJZA 2Z59B 1ISNA 4W9LA 4I6NB 2L8JA 4JGHB 5CTRC 2ZEQA 1E7VA 4F8CB 3R7RA 1BT0A 5JZEB 4DBGA 3JYUA 2IBIB 1F9JA 3IG3A 2LVPA 4ANWA 3EFUA 2GBJA 2KLGA 3GZNI 3KH0A 3NZSA 3IBEA 2EMTA 3PVLA 2HTHA 4FN2A 2LXAA 3HM3A 3PSEB 4FLHA 2N7DA 2EKEC 4J6IA 5AEKB 2K8BA 2KMAA 3K9OB 5DPSA 2IO1B 1OTRB 3R3MA 4B9KA 2OOBB 2MWSB 3HM6X 4HCNB 5CHFA 1IP9A 4GDLB 4DXAB 2OJRA 3L08A 1YX6B 2D11A 3JVZX 1S1QB 1V81A 3L10B 3KYDD 5J2RA 4W9JA 2O6VA 4IM0A 3QX1A 4W9GA 4MSQB 1RAXA 4MDKE 4A20A 1WY8A 3P2BA 2MX2A 2ZPYA 1P98A 2DZJA 4NPNA 4E71A 4KDLB 3A1QA 2KDIA 2KO3A 4HPLB 4MJSA 1A5RA 2J0MA 3TL5A 2JUOA 3RULA 3T8MA 2KC2A 1V86A 3R66C 3B08A 1WI0A 2O2VB 5DPTA 1ZW7A 3PV1A 2G45B 3U8ZA 1V9JA 2K8CA 2CHXA 3DBRI 4W9KA 1U4AA 3M63B 1WMHB 2PEAA 3PGEA 1TGZB 2KHWB 4RM9A 3H7PA 3HHMA 3A4RA 1GNUA 3U7DA 3ZVVA 4FJZA 2JRIB 4K7UA 2BWES 2L05A 3AU4A 3QCAA 1E8XA 1OEYA 1WX7A 2FIDA 3TCAA 2BKRB 2BPSA 3M62B 1LFDA 2CS4A 2DYBA 1E8ZA 4AOFA 1WRDB 3JSVB 1Q1OA 2C7NB 3VAWA 3QA8A 2REXA 1QZEA 2PE6B 2K6QA 2D07B 2GBRA 2JT4B 3DPDA 2KWVB 2NVUI 4IWPA 2LI5A 1V2YA 3CSFA 4BVUC 2KJ6A 3DQVA 2GMIC 4ASWC 3MJWA 3PHXB 3WIMA 3WAMA 4F7ZA 3PRMB 3ZRCA 1GJZA 1EUVB 1P0RA 4IC7B 1KLVA 2WDTB 4CYEA 3H7SA 1D3ZA 1YX5B 2JPHA 5AZHA 4NJ7A 2DX5B 3T9LA 3QQ8B 1NI2A 2IYDB 3UIPB 3DBLI 2WWZA 3IHPC 1I35A 1LXDA 2IO3B 4GB9A 3ZTCA 2N9EB 3V60A 2WYQA 4FHJA 1I42A 2AWTA 3UQBA 4DWFA 2LRWA 4FADA 4WWNA 1IYFA 4AJYB 1V5TA 3EHVA 4MSMB 3OLMD 4KIKB 5CX3A 1WR1A 3KYCD 2HJ8A 1WGYA 3M3JA 1VCBA 4W9FA 1WXMA 3A9KB 4XZ4A 5GMVA 2PPHA 3N32A 2I1KA 3RZWC 5G2NA 5IA7A 2BF8B 1UELA 2KWCA 4E3CA 3V6EB 3HIZA 2V3SA 4LDTB 1WXSA 3PLVA 1KOTA 1Q5WB 4BKSA 2HE7A 2WX1A 3A9JB 1WXVA 2L76A 1KM7A 1LM8B 1UBIA 2KANA 2MP2A 3PPAA 4PYZA 2M1MA 4EZJA 3W1SA 4NJ6A 2BYEA 4OVUA 1NBFC 3ONSA 3W1YA 2R2OA 5JHAA 3WAPA 3VFKA 4DHZE 3RZFA 1AARA 1Z2MA 2B3AA 3VHTC 2G4SA 2KTFA 3B0AA 1K8RB 3A33B 3L54A 2CR5A 4K7SA 4F1SA 1XT9B 3L17A 1RLFA 1SIFA 4MM3A 2ZVOA 4EZLA 2KXJA 2KWUB 4P7IA 1E8WA 4AUQC 3APFA 3PRPB 1Y8RC 4W9IA 2ZNVC 1PQSA 4LDTD 2N1VA 2PJHA 1OGWA 1WH3A 4A3OA 2GBNA 3RYTA 3WAOA 1SE9A 4FHKA 3R7QA 1P1AA 2KQSA 4HJKA 3GOEA 1WXAA 4ZDVA 1WFYA 4GSWA 3NHEB 5D2MB 1J8CA 2JY6A 2ZCCA 2QHOA 4HCPB 3APCA 4KDIC 3V61A 4GMVA 1WJ6A 1RFAA 2Z0DB 3ML8A 4GXBA 4HDOA 3WALA 2XEWA 3VXWA 4GU2A 3X23A 4YL8A 2LXCA 1Q0WB 4CO7A 2R2QA 2N9PC 2Y5BB 1OQYA 4JQWC 4ANXA 1YQBA 2DAJA 3QK0A 3I3TB 4G50A 4GDKA 2ZPNA 3L16A 2PE9A 4GDLA 1JRUA 4KZCA 4NQKE 1WYWB 3PTFC 2DZMA 3VH4B 1UGMA 2KDBA 4HK2A 2MQJA 2KFKA 4M8MA 3B1LX 3ZLZA 3ZUNA 4MJSB 2KDEB 2FCSA 4K81A 5D7GA 4BBNF 2LZ6A 3APDA 4IUMB 4K1RB 3JW0X 4IWOA 4KSLC 4EOYA 2GBMA 3UGBB 3CSTA 2L7RA 4ANUA
chains in the Genus database with same CATH superfamily
4A9AA 4OHJA 2INPE 3H7PB 3PS6A 1EU4A 2VRRB 2MA9B 3UQAA 2WNMA 5JH5C 3ZTDA 4TMAB 1WF9A 2HD5B 3QARA 3PHWB 2BB5A 4CQNA 5D3DA 2PVOD 2NR2A 4WQOB 2GOWA 3W1SC 2LD9A 3VTWA 2KD0A 3AN1A 3RT3B 3NG0A 1J0GA 2LFIA 3ZIMA 2ZW1A 2N1WA 2FAZA 1N5WA 2RDGA 3BY4B 3EA6A 2IGGA 2ZZPB 1R7SA 2JYEA 3NS8A 4ZRKA 3MHZA 4DHJB 2K6DB 4MELA 3DWMA 3NZUA 3VUYA 1VD2A 2GBKA 3AB5A 2X38A 1MHXA 4KIKA 4M0WB 1JALA 4I6PA 4WJPA 4OVZA 1WSPA 4DHZB 5E6PA 1ET6A 5E6JA 1J7CA 1V1PB 3S2AA 1YOVB 1ZDXA 1E6EB 2IPKD 2RPQA 1FD6A 1VDVA 1E90A 2YEPF 2WDQB 2L52A 2QDFA 1C4CA 3Q8BA 1B1ZA 2XBBC 1FNWA 2KN5A 3MC0B 1WZ3A 2G3QB 3ZJVA 3I57A 1WGGA 2LVOA 3AI5A 4TV3A 4USAA 3W9CB 1TIFA 3DVGX 1GB1A 1FCCC 4LJOB 4B0EA 2QILA 2WXRA 4LLGM 3Q3NC 2KOXA 5IAAC 4BOZB 3GP7A 3X0WA 4XC2A 4A55A 1TY2A 2MEKA 2DZIA 2HTME 2CKHB 4DDGD 1IBXB 4REZA 4GDKB 2N7EA 4ZRJA 2FNJB 5DPWA 1F2RC 4FBJB 4IG7B 1WMHA 3C0RB 1R4NB 3A4SC 2RDHA 3PLUA 2CU1A 1GAQB 1XLNA 4ZRIA 2O6VD 3ZDMC 1E8YA 3WANA 1RRBA 1KJTA 2FCMA 1L4ZB 3DBHI 3OG5A 4K7WA 2LGYA 2N9KA 4JPSA 1ZKHA 3GE3C 4KKJA 4GOCA 1C76A 1SJED 4FA6A 3NVZA 4YTMB 2IZVB 5MPOA 1YJ1A 4M01A 4M02A 2H88B 4PYUA 4RGOS 3ZQ4A 2MHJA 3AULA 2JZZA 1CK1A 2H89B 1QOFA 4YTPB 3V3XA 2KACA 3L0WB 3ZYYX 2JZPA 2M56B 2K1FA 5CHVC 3AM9A 1XLQA 3VTVA 2UWQA 4NZLB 1WX9A 4AP4C 2BYFA 2AEHA 1BMLC 4M8NA 4BFRA 3A9KA 3E9SA 1C78A 1WX8A 2KX0A 1WGRA 3DVNV 3OJ3A 1D5MC 3RPFC 2N9LA 3KUCB 3MHSD 3KQ4A 4B0MA 2KJRA 1CMXB 3UF8A 4II2B 1GG3A 2KDFB 3N1XC 4ZRQA 3KWLA 2NBUA 1I4RA 1EF1A 4II3B 3R2TA 3ZNGC 2BBCA 2JYTA 4WH4A 5IP4D 3NVVA 3URYA 3OAWA 4W9LA 3U52E 3W2DA 1QKZA 1TKGA 5FK9C 1PGXA 2IBIB 1F9JA 3KH0A 2EMTA 1FXIA 1T3QA 2N7DA 3SR6A 2MWSB 3T3NA 4HCNB 5CHFA 3RMKC 2V4IB 3TSSA 1AWDA 4W9JA 4IM0A 3QX1A 4XYCA 2KYWA 3ZJUA 4A20A 1Q10A 2MX2A 3Q2AC 4E71A 4KDLB 2BW2A 2KDIA 4MJSA 2GLSA 1HA5A 2JUOA 3U8ZA 4OW0A 1F0ZA 2CHXA 1U4AA 1WMHB 2PEAA 4EE2A 4JE3B 5JXVA 2KHWB 1E10A 2PTLA 2HDEA 3HHMA 3ZGZA 4NAMA 2BWES 2MJ3A 2QJLA 4OZAA 1E9MA 2W3SA 5FR3A 1Q1OA 3VAWA 2K3UA 3QA8A 1QZEA 2D07B 3DPDA 2KWVB 3FC4A 4IWPA 1JQ4A 2WXKA 1V2YA 3CSFA 1I4PA 2KJ6A 1XO3A 2GMIC 4ASWC 3MJWA 5H92C 3ZRCA 1EUVB 2WDTB 4D2KA 5AZHA 4HROA 2DX5B 3QQ8B 3Q6BA 3ETRA 1ZDVA 2IO3B 4GB9A 3V60A 2WXLA 1I42A 3AE1B 3NS1A 4MSMB 3OLMD 3KYCD 2HJ8A 4HJGE 3A9KB 4N58A 4US9A 5FKAC 3N32A 3RZWC 5G2NA 3Q8FA 3B2GA 1UELA 1LO5D 3V6EB 2WXMA 2HE7A 1OQRA 3P4PB 3IXSA 1KM7A 1LM8B 3PPAA 1HTQA 3AE8B 5JHAA 1EU3A 3MC9A 3VFKA 2G4SA 4K7SA 3L54A 2CR5A 1XT9B 1T6BX 1FO4A 1RLFA 4EZLA 1NYRA 3DHHC 4AUQC 3APFA 2X8XX 2ZNVC 3RYTA 3WAOA 2D3BA 4FHKA 1P1AA 3P4RB 4JX1C 3GOEA 5T8IA 4ZDVA 4K3CA 2PKOA 2QHOA 4HCPB 3APCA 4KDIC 1D4BA 4GMVA 2Z0DB 4KGSA 3ML8A 4GXBA 4HDOA 1JMLA 2WU2B 3FKYA 1SIJA 1WWTA 1YMHE 4G50A 3I3TB 1EM7A 2Y3AA 3L16A 1JRUA 4MT5A 1I7HA 3VH4B 3T3OA 5BMIA 3DBLB 2L83A 2MQJA 3AEEB 1ZE3D 2DLBA 3B1LX 4MJSB 1JWMD 2FCSA 4BBNF 2WXJA 1TS2A 2PIAA 1L6VA 3JW0X 2LJIA 4IWOA 2OHFA 1ZUD2 4IWQA 3V62A 2AL3A 4N9F4 3NZ3A 2MCNB 2W9NA 3UIOB 2NPTA 2ZCBA 5BYSA 2BGFA 1WGDA 5DPRA 2MRPA 3PREA 3LDZE 4EZKA 1C1YB 2Y5CA 1V1OA 1BXTA 5FR6A 1SJHD 2L3ZA 3ZW3A 4BKTA 2LGXA 2WGSA 3ZDTA 2J53A 4X57B 1K52A 2KX3A 2KJHB 3VR9B 4E74A 4Q2JA 4B6WA 2J52A 3VRAB 4URKA 3QAQA 3HRDD 3P4SB 1R4NI 3BYTB 2DBYA 3AE4B 4BOSC 2LVQA 2ICIA 2IY1B 2MH7A 4YTNB 1QF6A 1D5XC 1PFDA 2FUHB 1WE6A 2J0JA 2ZJDA 1XCTL 1YN4A 1XLPA 1AW7A 3VDZA 1QILA 4WJOA 2JXXA 4DHJD 3TEWA 4TSSA 1UZXB 1I4XA 2JRHA 3E56A 1F2RI 4M00A 5TSSA 3TEZA 5HI1A 4RMAA 2N0SB 4WAFA 5BMHA 4XWTA 5JHBA 2MBOA 4BKSD 1YNTE 3AH7A 4EEWA 1STEA 1UF0A 3ECIA 3VUXA 3RCZA 3DCGA 5C23A 1FEHA 2M0XA 2UU7A 2RMMA 5KHOA 2QSDA 4S17A 2LUMA 5LNK1 1MVKA 4GLSC 4KSKC 3RNAC 5GXGB 2JWUA 3ENEA 3A1QB 1SBBB 4MH0E 2QMTA 3KW5B 4MGZE 2L00B 4DXAB 2MSED 2JVCA 1BUIC 4MEMA 3W5VB 5I4DA 3PO0A 2LGDA 4WWPA 1YQ4B 5IO9A 1YIWA 2K9XA 3IFWB 2HJ1A 2FCQA 1XCQL 1G6JA 3JSVA 1SEBD 3EUB2 3P63A 2MBBB 4FJVB 2I2YA 1NYQA 2W82A 2NPTB 2KZRA 2KT7A 2WDVB 1ZGUB 5E6OA 2NMQA 2LGSA 3RNCC 3RUIB 4ITKA 2KVZA 4ZYSA 5C1ZA 4C7ZA 3MC8A 3ALBA 3HVZA 1IGCA 5G5GA 1DOYA 3TIXA 3M95A 1LQBA 4KGTA 2RD0A 4P1CC 1WIAA 1PGAA 2MW5A 2BKFA 2KK8A 4ZHOA 4JL9A 3NOBA 3I5JC 1OQQA 2A5UA 1OEYJ 5LXHA 4GN1A 2RSUA 2BQQA 3N3KB 2DYMA 2WXHA 3WCQA 3A9JA 2M4NA 4PS3A 5J17A 2IO0B 4ANVA 2LASA 3BVGA 5EDSA 3DBSA 1TY0A 4XDCA 4DK5A 4PS8A 1IPGA 2NS5A 4AJWA 2RGFA 4JLCA 2C7HA 1FFVA 3VH3B 2D3GA 2K39A 1ZP0B 1WE7A 3TEYA 3AEFB 5L83A 1PDXA 1N5XA 1ISNA 3MJ5A 1BT0A 4DBGA 1FIQA 2LVPA 2GBJA 2E3TA 3ABVB 1FNUA 3IBEA 3PVLA 2HTHA 4L2YA 1NEKB 5AEKB 3PSEB 4FLHA 4J6IA 2K8BA 2IO1B 1OTRB 3HM6X 4GDLB 5AUIA 3BIID 3L10B 5J2RA 2O6VA 4W9GA 4MSQB 1RAXA 4C80A 1WY8A 1FRRA 4JWSC 1MG4A 2KC2A 1N63A 2G45B 1V9JA 2K8CA 3Q3MC 4YSXB 1QOGA 4RM9A 4C4VA 3AEGB 1GNUA 1B9RA 1PYWD 4LNOA 3AU4A 1KH0A 1E8ZA 1I4HA 3JSVB 3RNBC 4AOFA 2L1AA 4JWUC 4A6QA 3GS2A 2CJOA 2JT4B 2WXNA 4YWGG 4PT5A 4F7ZA 1P0RA 4IC7B 4RH6A 1IUEA 1D3ZA 1YX5B 4NJ7A 1VZ8A 3UIPB 3DBLI 3IHPC 1N6ZA 2WYQA 4FHJA 2AWTA 3UQBA 1IYFA 4AJYB 5H8YE 2IGDA 3GZNB 3NUHB 3EHVA 2LHDA 2PMVA 4LNKA 2Q5WD 4KIKB 1FFUA 2K0PA 3ZJTA 1WGYA 4P1BC 1KRHA 4W9FA 1WXMA 4XZ4A 4P6VF 3AEDB 2I1KA 2KN4A 3RN9C 3HIZA 3EFCA 3EGRA 2V9HA 3PLVA 1Q5WB 3A9JB 1WXVA 2L76A 2MP2A 3OWEB 4FXCA 4EZJA 4NJ6A 1HEZE 3WAPA 1FRDA 3A33B 4RCOA 4ARIA 1SIFA 4MM3A 2ZVOA 2B76B 2KXJA 2KWUB 4YSZB 4P7IA 1Y8RC 4H2AA 2QEJC 3N9YC 2GBNA 3BVMA 1ESFA 2KQSA 4GSWA 1D5ZC 4RGNA 2JXTA 2XEWA 4KKIA 4YL8A 1Y56A 1FNVA 3NJTA 2MJDA 4ANXA 2DAJA 4LK0M 3ZXVA 3QK0A 1UWMA 4NQKE 1WYWB 1QLBB 1UGMA 2LHEA 2AQ2B 4J3OD 4RNAA 4ZOHC 4HRSA 2V3NA 5D7GA 2BB6A 1I4GA 3APDA 1P7EA 4KSLC 4EOYA 2INDC 3UGBB 3CSTA 4ANUA 3H1UA 2AX5A 2FIFA 5C3JB 1N62A 1E5WA 4C4VB 4GGQA 1R4MI 3QC8B 1V5OA 1T0QC 2G4DB 1CQVA 1HTOA 3KWVA 1T0YA 2UYZB 1WRIA 2XK5A 2D3AA 2EMSA 2J0KA 5C2TB 4OZCA 1HE8A 1HZ5A 1XQQA 2NBVB 2V1YA 3ZRFA 2K25A 4YXDB 4ICUA 3QIJA 5EE0A 2A4ZA 1FXAA 2KC1A 3WA0A 1YN5A 1S3SG 1UBQA 4OZBA 4G3XB 3CMMB 1GB4A 3NY5A 4MGIE 2WXFA 2IGHA 1VLBA 1XLOA 3Q8AA 1XD3B 1H4RA 3DOWA 1MJDA 2MBHA 5BYQA 1T0SC 4BZAA 3QHTA 1FXTB 3SD5A 1E7UA 1WM3A 3IAM1 2MP2B 3LYYA 2KQ7A 2MLBA 3BWUD 1E0ZA 3Q14C 3HK0A 5L95C 1KFYB 4MM3B 4HXDA 2DENB 1L7YA 2K8HA 4TUUA 3IT6B 3R2IA 1TZ1A 5AZGA 4IDIA 2CHWA 2KLCA 5IOIA 1GC7A 2AYOB 4DXGA 4HPMB 5BMGA 3KUDB 3O65B 2LRUA 3ZNZB 2MBQA 3AU5A 3AE7B 4HVBA 3H9DA 5AZFA 1C4PA 2BTEA 1WR6E 2VZKB 4O1NA 4BKGA 3UI3A 4W9CA 2O2VA 5TR5A 1A5RA 2CU3A 2L0TA 5D94A 2KFJA 5CHWA 3Q3JA 2ZNVB 4WQMA 4GIVA 1Z5SB 2KNBA 3UINB 5G55A 1J7BA 2FE8A 2WX0A 3MTNB 4WJQA 2G1EA 1QT9A 1V80A 2V0GA 5LXIB 1F52A 1EO6A 4TKNA 2NCNA 2MBEA 1SXTA 1ROEA 4A3PA 4G11A 3BK1A 4NNJB 2VH1A 2XK5B 2BWFA 4NJCA 1P3QU 3P42A 1VJKA 3ZO5B 1XEEA 5HKHA 4BBNC 5KHQA 3KVFB 2LUEA 3LJ3A 2DWQA 1D6EC 3N20C 5D6JB 1WYGA 1ZOYB 3P4QB 2J7QB 3D32A 4NQLB 1V97A 3O13A 2CHZA 2M19A 5BYRA 2E6XA 2INCC 3P1MA 3PZ8A 4KX6B 4EUTA 4NY0A 3R8BA 4PS7A 1WJ4A 2RR9A 3BYYB 2L0FA 3TJPA 4L1BA 4M0WA 3RNGC 4RGTA 4ICVA 4W9HA 3QWZB 2DZKA 4LJPB 3PRZA 1TBEA 3AV8A 3VVWB 3Q8CA 3RI7C 4TQ0A 1TYGB 2GRIA 1JCKB 1L5PA 1TS3A 4EFOA 3K9PB 1ET9A 1J19A 4W9DA 2ASQA 2K22A 1FCLA 2FCNA 3H6NA 2VH2A 1JROA 4R3DA 4LCDE 3MFGA 1K51A 2LJ5A 1NDDA 2JQRB 1I4QA 2V3PA 1K50A 3L4PA 2WU5B 4ACFA 1F1HA 4EKUA 1C4AA 2R61A 3ZKJC 1WZ0A 1NI3A 1MPEA 3DHIC 1NENB 2WXIA 1TS4A 2Z59B 1C79A 1HZ6A 4I6NB 2L8JA 5CTRC 4HPPA 2ZEQA 1E7VA 4F8CB 3R7RA 5JZEB 3JYUA 3EFUA 3GZNI 2KLGA 3AE9B 4BAXA 3AE2B 4FN2A 2EKEC 1HQRD 2KMAA 3K9OB 5DPSA 2WQYB 1IP9A 3L08A 1YX6B 2WS3B 2D11A 3JVZX 1V81A 3KYDD 1CZPA 1JWAD 5AUKA 2FUG1 4LTUA 1P98A 2DZJA 1KF6B 4HPLB 3RULA 4HKZE 2O2VB 2ONQA 1ZW7A 3PV1A 4ARCA 3U7ZA 1E7PB 2XNAC 3M63B 1SE3A 1TGZB 2BS4B 3A4RA 1QOBA 2EELA 1VZ7A 4WURA 3C8YA 2L05A 4WWMA 1E8XA 1OEYA 3TCAA 2BPSA 3M62B 1EWCA 2CS4A 2PLPA 2REXA 3RNEC 2LI5A 3ZXRA 4BVUC 3DQVA 2ZW0A 3WIMA 3WAMA 1GJZA 1KLVA 1QQRA 3T9LA 1NI2A 3HVDA 2WWZA 2KDMA 1I35A 1LXDA 1EWYC 1TZOA 4DWFA 2LRWA 1L4DB 4WWNA 3CIRB 1V5TA 4IOIE 2I38A 1WR1A 3M3JA 5GMVA 2PPHA 3NVYA 1C77A 2BF8B 4DQOC 2KWCA 4MH8A 1NVID 4E3CA 1RM6C 1TKYA 2V3SA 4K3BA 4LDTB 1YJJA 1PGBA 1KOTA 2WX1A 1UBIA 1N60A 4PYZA 1UGJA 3U4EG 4AS1A 2BYEA 1YN3A 3DBRB 3ONSA 3FAHA 4DHZE 5IKCM 1DYQA 2N7JA 2KTFA 3B0AA 1K8RB 1M4VA 3L17A 1CJEA 1L0VB 3PRPB 1PQSA 2N1VA 2PJHA 1OGWA 4A3OA 1SE9A 3R7QA 4XE0A 4AQ7A 3H8HA 2WXOA 1J8CA 2JY6A 2ZCCA 1JW9D 2NTSA 1WJ6A 1RFAA 4MACA 2W54A 3WALA 3X23A 1RWSA 4GU2A 1FPYA 1YQ3B 2LXCA 4CO7A 2R2QA 2N9PC 3IAS1 3MP9A 2Y5BB 1OQYA 5EE1A 1YQBA 1OFFA 2ZPNA 2M0AA 4HK2A 1VZ6A 1XF5L 2J4XA 2WDRB 3TEXA 2KFKA 4M8MA 2Y5PA 3HUIA 2KDEB 4K81A 2LZ6A 5HFYA 4K1RB 2GBMA 5BO4B 2KKCA 4KVGB 2JWZA 2W3RA 1RYJA 2LEKA 4NAWA 2C7MB 3NRZA 1JWBD 1H8CA 1YD8U 2YEPB 4QAYA 3I9V1 4IM3A 3SHQA 3C19A 1PUTA 1ENFA 2C5LC 2D10A 1WM2A 2KTRA 1X1MA 4TQ1A 1SE2A 1V6EA 4LNIA 3VTUA 4DDID 3U30A 4LNNA 4RF0A 1P7FA 1UUPA 4JIOU 1GC6A 3L13A 1AYFA 2M17A 3GE8C 1SF0A 2AL6A 3KUZA 2BYVE 2LMCA 4IM2A 3N1YC 4XDDA 2Z0EB 2DNFA 3CF6E 4C00A 1AN8A 2WHIA 3SFDB 2WXGA 3N30A 4HLEA 2DHZA 3AEBB 3RNFC 2KMMA 4B95A 4OVVA 4DXFA 1L6UA 2I1JA 1SE4A 2N4FA 4XX5A 1ZXIA 3DDCB 3EC8A 1WJUA 2NBWB 3AE5B 1TJEA 2M8SA 1WJNA 1HXYD 4WIPA 3AECB 2WLBA 3VRBB 1KLUD 1EF5A 4C7YA 2D2QA 4RM8A 4WWOA 2BT6A 5E6NA 1MFWA 3ML9A 1TS5A 2L7RA 4I6LB 1TT5B 4HWIB 2JZ3B 4KZ0A 1WGHA 1DGJA 2RPVA 1UWXA 4IW0A 2IY0B 2AQ1B 2PVGC 3AE6B 2PW9A 3DVGY 4UDUC 1DOXA 3V05A 4RGMA 2O6VB 1DOIA 1SSNA 3VUWA 3OJ4B 3U2SC 2N9XA 2RDBC 2FBWB 1UNSA 2YVCA 3V6CB 4W9EA 2ON8A 5DCNA 4YSYB 2C9WB 2V4LA 3EECA 2KFKB 3AMZA 3FILA 3SU8X 1SB3C 3B9JA 4FULA 2JSVX 2IO2B 1JWSD 1F77A 1VR9A 4MGYE 4P16A 3SEBA 2VZKD 2NTTA 3SDLC 3PT2B 3VQIA 4MGKE 3TBLD 2WXQA 3N1ZC 2DYOA 2DAFA 1ZXHA 5LLIA 4AWJA 4NAWB 1SGHA 1GUAB 4XGAB 4G0NB 2JF5A 2MJEA 3LXFA 5EE3A 5HG2A 4S0RA 3AEAB 3ZNID 1MHHE 4US8A 2LGIA 4HDQA 3ZNHB 1VRAB 2Z8LA 2KTRB 2ZVNA 3TMPB 1FMAD 2K5PA 3W5UB 4A8XC 2YLMA 4HKQA 3RFZB 2QCZA 4CHKA 2C60A 1V49A 1TTNA 3Q3FA 4ZYNA 2XN9C 3IVFA 2ACZB 3B2FA 1M94A 1T0RC 3DHGC 1MG8A 3BVZA 2BS2B 4A90A 1JRPA 5EE9A 1UD7A 1KTKA 2IJ0A 1P9DU 1UH6A 2LWPA 3RD2A 2KVRA 2KMCA 1TKEA 2D5GA 2SEBD 3DWGC 3PZDA 4FJYA 3BINA 4N59A 3DVNU 1N61A 4KV2A 1YJIA 2GI9A 4WJNA 4WAAA 1L2NA 4C56C 5J18A 3DBHB 3QJZA 1K53A 4JGHB 2OEDA 5D3IB 2GB1A 3IG3A 4ANWA 3BK2A 2BS3B 1WGKA 3NZSA 2LXAA 3HM3A 2TSSA 1ZPSA 5HHDG 3R3MA 4B9KA 2OOBB 2OJRA 1S1QB 4ZRPA 4MDKE 3P2BA 2ZPYA 4XWWA 4NPNA 2JX5A 2KO3A 3A1QA 2J0MA 3TL5A 3T8MA 1V86A 3R66C 4RFBA 3B08A 2BVCA 1WI0A 1JWUD 5DPTA 2OJWA 2SAKA 3DBRI 4W9KA 2J42A 2IDYA 3PGEA 3FILB 4RF1A 3H7PA 4KGRA 3U7DA 3Q8EA 3ZVVA 1L0XB 4FJZA 2JRIB 4K7UA 1T5XD 3QCAA 2FIDA 1WX7A 2BKRB 2CJNA 2KAJA 1GOZA 1LFDA 2DYBA 1WRDB 2C7NB 1XXGA 2PE6B 2K6QA 2GBRA 2NVUI 1IGDA 2W55A 4YT0B 1MI0A 1C9FA 3NVWA 3J9CA 3SFEB 3CWIA 3GB1A 3PHXB 3PRMB 4CYEA 2INNE 2QIEB 3H7SA 2JPHA 3LB8C 3AE3B 1FM0D 2IYDB 1RFKA 4N6EB 2WXPA 3ZTCA 2N9EB 4FADA 5G5HA 1A70A 1QOAA 2KQ4X 4ZHPA 4HEA1 5CX3A 1VCBA 5IN7A 2L32A 5IA7A 1V1PA 1WXSA 2KWDA 4BKSA 2D3CA 2KANA 2M1MA 2EKIA 3W1SA 4OVUA 1NBFC 3W1YA 2R2OA 1KLGD 3RZFA 1AARA 1Z2MA 2B3AA 3VHTC 4F1SA 2BYTA 4IKGA 3I63C 1E8WA 3TUOA 4W9IA 4LDTD 4LNFA 1WH3A 1GPXA 1R4MB 4HJKA 1WXAA 1WFYA 2QC8A 1V8CA 3IT4B 3NHEB 5D2MB 4PK1A 1J7AA 2WP9B 3V61A 3VXWA 1ACCA 1IBXA 1Q0WB 4JQWC 3Q69A 3KLSX 1C3TA 4GDKA 4GDLA 2PE9A 2G9HD 4KZCA 3PTFC 2DZMA 1LGRA 2KDBA 4L23A 3BZDB 3ZLZA 2AQ3B 3Q3OC 3ZUNA 1WXQA 4IUMB 2JU6X 3PZ7A 3VR8B 1L0YB 3AXCA
chains in the Genus database with same CATH topology
4IWQA 3H1UA 5BO4B 2AL3A 2KKCA 4KVGB 2FIFA 3V62A 4N9F4 2JWZA 1E5WA 3H7PB 2MCNB 2W9NA 3UIOB 3PS6A 4GGQA 1R4MI 3QC8B 2NPTA 1V5OA 2ZCBA 4NAWA 2C7MB 2G4DB 2BGFA 2VRRB 2MA9B 3UQAA 1WGDA 5DPRA 1H8CA 2MRPA 1YD8U 3PREA 3LDZE 4EZKA 5JH5C 3ZTDA 1T0YA 1C1YB 1WF9A 2HD5B 2UYZB 3QARA 2XK5A 4IM3A 3SHQA 5FR6A 2L3ZA 3ZW3A 4BKTA 3PHWB 2LGXA 2C5LC 2D10A 1WM2A 2EMSA 3ZDTA 2KTRA 1X1MA 4TQ1A 4X57B 2KX3A 2J0KA 2KJHB 2NR2A 4WQOB 2GOWA 3W1SC 1V6EA 4E74A 2LD9A 3VTWA 2KD0A 1HE8A 3VTUA 4B6WA 3RT3B 4DDID 1XQQA 3U30A 3ZIMA 1J0GA 1C3TA 2NBVB 2V1YA 4URKA 3ZRFA 2K25A 3QAQA 2N1WA 2FAZA 3BY4B 4ICUA 2ZZPB 3NS8A 3QIJA 4ZRKA 1R4NI 3AXCA 4JIOU 1GC6A 4DHJB 2K6DB 4MELA 3NZUA 2A4ZA 2LVQA 1VD2A 2KC1A 2GBKA 3L13A 3VUYA 3WA0A 4BOSC 1S3SG 1UBQA 2IY1B 4KIKA 2M17A 4M0WB 4G3XB 2AL6A 3CMMB 3KUZA 2BYVE 4I6PA 4IM2A 3NY5A 4MGIE 4WJPA 2Z0EB 4DHZB 3CF6E 1XD3B 5E6PA 1H4RA 2FUHB 1WE6A 3N30A 4HLEA 3DOWA 2J0JA 2DHZA 2ZJDA 2MBHA 3S2AA 3QHTA 1FXTB 3VDZA 3SD5A 4B95A 4OVVA 1E7UA 4WJOA 2RPQA 2JXXA 1WM3A 4DHJD 1E90A 2I1JA 2MP2B 2KQ7A 2N4FA 4XX5A 3DDCB 2MLBA 1UZXB 3EC8A 1WJUA 2NBWB 2JRHA 2M8SA 2XBBC 1WJNA 2KN5A 1WZ3A 2G3QB 1WGGA 2LVOA 3HK0A 1EF5A 4RMAA 3AI5A 4TV3A 5L95C 2D2QA 2DENB 4HXDA 5JHBA 2MBOA 3DVGX 1L7YA 4RM8A 2K8HA 4WWOA 4TUUA 4LJOB 5E6NA 1TZ1A 3ML9A 5AZGA 2CHWA 2KLCA 4BKSD 4I6LB 2KOXA 4EEWA 4HWIB 2JZ3B 4KZ0A 1GC7A 2AYOB 3ECIA 4HPMB 3VUXA 3RCZA 3DCGA 5C23A 3KUDB 1WGHA 5IAAC 4BOZB 3O65B 4IW0A 2M0XA 2IY0B 2LRUA 3X0WA 3ZNZB 2MBQA 3AU5A 3DVGY 4XC2A 4HVBA 5KHOA 3H9DA 5AZFA 2DZIA 2CKHB 2O6VB 4DDGD 1WR6E 3VUWA 3OJ4B 2N9XA 4KSKC 4GDKB 3ENEA 4BKGA 3A1QB 2YVCA 2N7EA 4MH0E 2FNJB 3KW5B 4ZRJA 3V6CB 4FBJB 5DPWA 4W9EA 4MGZE 4W9CA 5DCNA 2O2VA 4IG7B 2C9WB 2L00B 2V4LA 5TR5A 3EECA 1WMHA 2KFKB 2L0TA 3C0RB 2MSED 5D94A 2KFJA 2JVCA 5CHWA 3Q3JA 3A4SC 2ZNVB 3SU8X 4MEMA 3PLUA 4GIVA 4FULA 1Z5SB 2CU1A 2KNBA 2LGDA 4WWPA 3UINB 2IO2B 5G55A 4MGYE 2WX0A 4ZRIA 1YIWA 2O6VD 3ZDMC 3IFWB 3SDLC 1E8YA 3PT2B 3MTNB 2FCQA 4WJQA 3VQIA 1G6JA 3JSVA 3WANA 1RRBA 1KJTA 2FCMA 4MGKE 3TBLD 3DBHI 1V80A 2DYOA 5LXIB 4FJVB 2DAFA 2MBBB 5LLIA 4K7WA 2LGYA 4AWJA 2NPTB 1ZKHA 2KZRA 1EO6A 1SGHA 4NAWB 4TKNA 2NCNA 4GOCA 1GUAB 2MBEA 4FA6A 4G0NB 2JF5A 2IZVB 4A3PA 1YJ1A 4G11A 1ZGUB 4NNJB 5E6OA 4PYUA 2XK5B 2BWFA 1P3QU 3ZNID 4HDQA 3ZNHB 3ZO5B 5HKHA 4BBNC 3AULA 2JZZA 5KHQA 3KVFB 2LUEA 3LJ3A 3RUIB 2KTRB 5D6JB 5C1ZA 2ZVNA 3L0WB 3TMPB 3ALBA 2J7QB 3D32A 4NQLB 2K1FA 5CHVC 2CHZA 3TIXA 3VTVA 3M95A 2YLMA 2UWQA 4EUTA 1LQBA 2RD0A 4CHKA 2C60A 4NY0A 1WX9A 1WIAA 4AP4C 2MW5A 2BKFA 2BYFA 2KK8A 2AEHA 1V49A 4M8NA 4BFRA 3A9KA 4JL9A 1TTNA 3NOBA 3Q3FA 4PS7A 4ZYNA 1WJ4A 2RR9A 1WX8A 1OEYJ 2A5UA 2L0FA 3IVFA 3TJPA 2KX0A 1WGRA 3DVNV 3OJ3A 5LXHA 1M94A 4ICVA 1MG8A 4W9HA 4GN1A 2RSUA 3QWZB 3N3KB 2DYMA 1UD7A 2DZKA 4LJPB 3KUCB 3MHSD 3PRZA 1TBEA 3VVWB 3A9JA 4TQ0A 1P9DU 2M4NA 4PS3A 5J17A 2IO0B 4ANVA 1UH6A 4EFOA 2LASA 2KJRA 1CMXB 3K9PB 5EDSA 3UF8A 3DBSA 4II2B 2LWPA 3RD2A 2KVRA 1J19A 4W9DA 2ASQA 1GG3A 2KDFB 2KMCA 4DK5A 4PS8A 2FCNA 3H6NA 1IPGA 2NS5A 4AJWA 2NBUA 3PZDA 4LCDE 4FJYA 2RGFA 1EF1A 4JLCA 2LJ5A 1NDDA 3BINA 4II3B 2C7HA 3DVNU 3VH3B 3ZNGC 4KV2A 2D3GA 2K39A 4EKUA 4WJNA 1WE7A 4WAAA 1L2NA 3ZKJC 1WZ0A 3OAWA 5J18A 5L83A 3QJZA 2Z59B 1ISNA 4W9LA 4I6NB 2L8JA 4JGHB 5CTRC 2ZEQA 1E7VA 4F8CB 3R7RA 1BT0A 5JZEB 4DBGA 3JYUA 2IBIB 1F9JA 3IG3A 2LVPA 4ANWA 3EFUA 2GBJA 2KLGA 3GZNI 3KH0A 3NZSA 3IBEA 2EMTA 3PVLA 2HTHA 4FN2A 2LXAA 3HM3A 3PSEB 4FLHA 2N7DA 2EKEC 4J6IA 5AEKB 2K8BA 2KMAA 3K9OB 5DPSA 2IO1B 1OTRB 3R3MA 4B9KA 2OOBB 2MWSB 3HM6X 4HCNB 5CHFA 1IP9A 4GDLB 4DXAB 2OJRA 3L08A 1YX6B 2D11A 3JVZX 1S1QB 1V81A 3L10B 3KYDD 5J2RA 4W9JA 2O6VA 4IM0A 3QX1A 4W9GA 4MSQB 1RAXA 4MDKE 4A20A 1WY8A 3P2BA 2MX2A 2ZPYA 1P98A 2DZJA 4NPNA 4E71A 4KDLB 3A1QA 2KDIA 2KO3A 4HPLB 4MJSA 1A5RA 2J0MA 3TL5A 2JUOA 3RULA 3T8MA 2KC2A 1V86A 3R66C 3B08A 1WI0A 2O2VB 5DPTA 1ZW7A 3PV1A 2G45B 3U8ZA 1V9JA 2K8CA 2CHXA 3DBRI 4W9KA 1U4AA 3M63B 1WMHB 2PEAA 3PGEA 1TGZB 2KHWB 4RM9A 3H7PA 3HHMA 3A4RA 1GNUA 3U7DA 3ZVVA 4FJZA 2JRIB 4K7UA 2BWES 2L05A 3AU4A 3QCAA 1E8XA 1OEYA 1WX7A 2FIDA 3TCAA 2BKRB 2BPSA 3M62B 1LFDA 2CS4A 2DYBA 1E8ZA 4AOFA 1WRDB 3JSVB 1Q1OA 2C7NB 3VAWA 3QA8A 2REXA 1QZEA 2PE6B 2K6QA 2D07B 2GBRA 2JT4B 3DPDA 2KWVB 2NVUI 4IWPA 2LI5A 1V2YA 3CSFA 4BVUC 2KJ6A 3DQVA 2GMIC 4ASWC 3MJWA 3PHXB 3WIMA 3WAMA 4F7ZA 3PRMB 3ZRCA 1GJZA 1EUVB 1P0RA 4IC7B 1KLVA 2WDTB 4CYEA 3H7SA 1D3ZA 1YX5B 2JPHA 5AZHA 4NJ7A 2DX5B 3T9LA 3QQ8B 1NI2A 2IYDB 3UIPB 3DBLI 2WWZA 3IHPC 1I35A 1LXDA 2IO3B 4GB9A 3ZTCA 2N9EB 3V60A 2WYQA 4FHJA 1I42A 2AWTA 3UQBA 4DWFA 2LRWA 4FADA 4WWNA 1IYFA 4AJYB 1V5TA 3EHVA 4MSMB 3OLMD 4KIKB 5CX3A 1WR1A 3KYCD 2HJ8A 1WGYA 3M3JA 1VCBA 4W9FA 1WXMA 3A9KB 4XZ4A 5GMVA 2PPHA 3N32A 2I1KA 3RZWC 5G2NA 5IA7A 2BF8B 1UELA 2KWCA 4E3CA 3V6EB 3HIZA 2V3SA 4LDTB 1WXSA 3PLVA 1KOTA 1Q5WB 4BKSA 2HE7A 2WX1A 3A9JB 1WXVA 2L76A 1KM7A 1LM8B 1UBIA 2KANA 2MP2A 3PPAA 4PYZA 2M1MA 4EZJA 3W1SA 4NJ6A 2BYEA 4OVUA 1NBFC 3ONSA 3W1YA 2R2OA 5JHAA 3WAPA 3VFKA 4DHZE 3RZFA 1AARA 1Z2MA 2B3AA 3VHTC 2G4SA 2KTFA 3B0AA 1K8RB 3A33B 3L54A 2CR5A 4K7SA 4F1SA 1XT9B 3L17A 1RLFA 1SIFA 4MM3A 2ZVOA 4EZLA 2KXJA 2KWUB 4P7IA 1E8WA 4AUQC 3APFA 3PRPB 1Y8RC 4W9IA 2ZNVC 1PQSA 4LDTD 2N1VA 2PJHA 1OGWA 1WH3A 4A3OA 2GBNA 3RYTA 3WAOA 1SE9A 4FHKA 3R7QA 1P1AA 2KQSA 4HJKA 3GOEA 1WXAA 4ZDVA 1WFYA 4GSWA 3NHEB 5D2MB 1J8CA 2JY6A 2ZCCA 2QHOA 4HCPB 3APCA 4KDIC 3V61A 4GMVA 1WJ6A 1RFAA 2Z0DB 3ML8A 4GXBA 4HDOA 3WALA 2XEWA 3VXWA 4GU2A 3X23A 4YL8A 2LXCA 1Q0WB 4CO7A 2R2QA 2N9PC 2Y5BB 1OQYA 4JQWC 4ANXA 1YQBA 2DAJA 3QK0A 3I3TB 4G50A 4GDKA 2ZPNA 3L16A 2PE9A 4GDLA 1JRUA 4KZCA 4NQKE 1WYWB 3PTFC 2DZMA 3VH4B 1UGMA 2KDBA 4HK2A 2MQJA 2KFKA 4M8MA 3B1LX 3ZLZA 3ZUNA 4MJSB 2KDEB 2FCSA 4K81A 5D7GA 4BBNF 2LZ6A 3APDA 4IUMB 4K1RB 3JW0X 4IWOA 4KSLC 4EOYA 2GBMA 3UGBB 3CSTA 2L7RA 4ANUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IWQ A;  3H1U A;  5BO4 B;  2AL3 A;  2KKC A;  4KVG B;  2FIF A;  3V62 A;  4N9F 4;  2JWZ A;  1E5W A;  3H7P B;  2MCN B;  2W9N A;  3UIO B;  3PS6 A;  4GGQ A;  1R4M I;  3QC8 B;  2NPT A;  1V5O A;  2ZCB A;  4NAW A;  2C7M B;  2G4D B;  2BGF A;  2VRR B;  2MA9 B;  3UQA A;  1WGD A;  5DPR A;  1H8C A;  2MRP A;  1YD8 U;  3PRE A;  3LDZ E;  4EZK A;  5JH5 C;  3ZTD A;  1T0Y A;  1C1Y B;  1WF9 A;  2HD5 B;  2UYZ B;  3QAR A;  2XK5 A;  4IM3 A;  3SHQ A;  5FR6 A;  2L3Z A;  3ZW3 A;  4BKT A;  3PHW B;  2LGX A;  2C5L C;  2D10 A;  1WM2 A;  2EMS A;  3ZDT A;  2KTR A;  1X1M A;  4TQ1 A;  4X57 B;  2KX3 A;  2J0K A;  2KJH B;  2NR2 A;  4WQO B;  2GOW A;  3W1S C;  1V6E A;  4E74 A;  2LD9 A;  3VTW A;  2KD0 A;  1HE8 A;  3VTU A;  4B6W A;  3RT3 B;  4DDI D;  1XQQ A;  3U30 A;  3ZIM A;  1J0G A;  1C3T A;  2NBV B;  2V1Y A;  4URK A;  3ZRF A;  2K25 A;  3QAQ A;  2N1W A;  2FAZ A;  3BY4 B;  4ICU A;  2ZZP B;  3NS8 A;  3QIJ A;  4ZRK A;  1R4N I;  3AXC A;  4JIO U;  1GC6 A;  4DHJ B;  2K6D B;  4MEL A;  3NZU A;  2A4Z A;  2LVQ A;  1VD2 A;  2KC1 A;  2GBK A;  3L13 A;  3VUY A;  3WA0 A;  4BOS C;  1S3S G;  1UBQ A;  2IY1 B;  4KIK A;  2M17 A;  4M0W B;  4G3X B;  2AL6 A;  3CMM B;  3KUZ A;  2BYV E;  4I6P A;  4IM2 A;  3NY5 A;  4MGI E;  4WJP A;  2Z0E B;  4DHZ B;  3CF6 E;  1XD3 B;  5E6P A;  1H4R A;  2FUH B;  1WE6 A;  3N30 A;  4HLE A;  3DOW A;  2J0J A;  2DHZ A;  2ZJD A;  2MBH A;  3S2A A;  3QHT A;  1FXT B;  3VDZ A;  3SD5 A;  4B95 A;  4OVV A;  1E7U A;  4WJO A;  2RPQ A;  2JXX A;  1WM3 A;  4DHJ D;  1E90 A;  2I1J A;  2MP2 B;  2KQ7 A;  2N4F A;  4XX5 A;  3DDC B;  2MLB A;  1UZX B;  3EC8 A;  1WJU A;  2NBW B;  2JRH A;  2M8S A;  2XBB C;  1WJN A;  2KN5 A;  1WZ3 A;  2G3Q B;  1WGG A;  2LVO A;  3HK0 A;  1EF5 A;  4RMA A;  3AI5 A;  4TV3 A;  5L95 C;  2D2Q A;  2DEN B;  4HXD A;  5JHB A;  2MBO A;  3DVG X;  1L7Y A;  4RM8 A;  2K8H A;  4WWO A;  4TUU A;  4LJO B;  5E6N A;  1TZ1 A;  3ML9 A;  5AZG A;  2CHW A;  2KLC A;  4BKS D;  4I6L B;  2KOX A;  4EEW A;  4HWI B;  2JZ3 B;  4KZ0 A;  1GC7 A;  2AYO B;  3ECI A;  4HPM B;  3VUX A;  3RCZ A;  3DCG A;  5C23 A;  3KUD B;  1WGH A;  5IAA C;  4BOZ B;  3O65 B;  4IW0 A;  2M0X A;  2IY0 B;  2LRU A;  3X0W A;  3ZNZ B;  2MBQ A;  3AU5 A;  3DVG Y;  4XC2 A;  4HVB A;  5KHO A;  3H9D A;  5AZF A;  2DZI A;  2CKH B;  2O6V B;  4DDG D;  1WR6 E;  3VUW A;  3OJ4 B;  2N9X A;  4KSK C;  4GDK B;  3ENE A;  4BKG A;  3A1Q B;  2YVC A;  2N7E A;  4MH0 E;  2FNJ B;  3KW5 B;  4ZRJ A;  3V6C B;  4FBJ B;  5DPW A;  4W9E A;  4MGZ E;  4W9C A;  5DCN A;  2O2V A;  4IG7 B;  2C9W B;  2L00 B;  2V4L A;  5TR5 A;  3EEC A;  1WMH A;  2KFK B;  2L0T A;  3C0R B;  2MSE D;  5D94 A;  2KFJ A;  2JVC A;  5CHW A;  3Q3J A;  3A4S C;  2ZNV B;  3SU8 X;  4MEM A;  3PLU A;  4GIV A;  4FUL A;  1Z5S B;  2CU1 A;  2KNB A;  2LGD A;  4WWP A;  3UIN B;  2IO2 B;  5G55 A;  4MGY E;  2WX0 A;  4ZRI A;  1YIW A;  2O6V D;  3ZDM C;  3IFW B;  3SDL C;  1E8Y A;  3PT2 B;  3MTN B;  2FCQ A;  4WJQ A;  3VQI A;  1G6J A;  3JSV A;  3WAN A;  1RRB A;  1KJT A;  2FCM A;  4MGK E;  3TBL D;  3DBH I;  1V80 A;  2DYO A;  5LXI B;  4FJV B;  2DAF A;  2MBB B;  5LLI A;  4K7W A;  2LGY A;  4AWJ A;  2NPT B;  1ZKH A;  2KZR A;  1EO6 A;  1SGH A;  4NAW B;  4TKN A;  2NCN A;  4GOC A;  1GUA B;  2MBE A;  4FA6 A;  4G0N B;  2JF5 A;  2IZV B;  4A3P A;  1YJ1 A;  4G11 A;  1ZGU B;  4NNJ B;  5E6O A;  4PYU A;  2XK5 B;  2BWF A;  1P3Q U;  3ZNI D;  4HDQ A;  3ZNH B;  3ZO5 B;  5HKH A;  4BBN C;  3AUL A;  2JZZ A;  5KHQ A;  3KVF B;  2LUE A;  3LJ3 A;  3RUI B;  2KTR B;  5D6J B;  5C1Z A;  2ZVN A;  3L0W B;  3TMP B;  3ALB A;  2J7Q B;  3D32 A;  4NQL B;  2K1F A;  5CHV C;  2CHZ A;  3TIX A;  3VTV A;  3M95 A;  2YLM A;  2UWQ A;  4EUT A;  1LQB A;  2RD0 A;  4CHK A;  2C60 A;  4NY0 A;  1WX9 A;  1WIA A;  4AP4 C;  2MW5 A;  2BKF A;  2BYF A;  2KK8 A;  2AEH A;  1V49 A;  4M8N A;  4BFR A;  3A9K A;  4JL9 A;  1TTN A;  3NOB A;  3Q3F A;  4PS7 A;  4ZYN A;  1WJ4 A;  2RR9 A;  1WX8 A;  1OEY J;  2A5U A;  2L0F A;  3IVF A;  3TJP A;  2KX0 A;  1WGR A;  3DVN V;  3OJ3 A;  5LXH A;  1M94 A;  4ICV A;  1MG8 A;  4W9H A;  4GN1 A;  2RSU A;  3QWZ B;  3N3K B;  2DYM A;  1UD7 A;  2DZK A;  4LJP B;  3KUC B;  3MHS D;  3PRZ A;  1TBE A;  3VVW B;  3A9J A;  4TQ0 A;  1P9D U;  2M4N A;  4PS3 A;  5J17 A;  2IO0 B;  4ANV A;  1UH6 A;  4EFO A;  2LAS A;  2KJR A;  1CMX B;  3K9P B;  5EDS A;  3UF8 A;  3DBS A;  4II2 B;  2LWP A;  3RD2 A;  2KVR A;  1J19 A;  4W9D A;  2ASQ A;  1GG3 A;  2KDF B;  2KMC A;  4DK5 A;  4PS8 A;  2FCN A;  3H6N A;  1IPG A;  2NS5 A;  4AJW A;  2NBU A;  3PZD A;  4LCD E;  4FJY A;  2RGF A;  1EF1 A;  4JLC A;  2LJ5 A;  1NDD A;  3BIN A;  4II3 B;  2C7H A;  3DVN U;  3VH3 B;  3ZNG C;  4KV2 A;  2D3G A;  2K39 A;  4EKU A;  4WJN A;  1WE7 A;  4WAA A;  1L2N A;  3ZKJ C;  1WZ0 A;  3OAW A;  5J18 A;  5L83 A;  3QJZ A;  2Z59 B;  1ISN A;  4W9L A;  4I6N B;  2L8J A;  4JGH B;  5CTR C;  2ZEQ A;  1E7V A;  4F8C B;  3R7R A;  1BT0 A;  5JZE B;  4DBG A;  3JYU A;  2IBI B;  1F9J A;  3IG3 A;  2LVP A;  4ANW A;  3EFU A;  2GBJ A;  2KLG A;  3GZN I;  3KH0 A;  3NZS A;  3IBE A;  2EMT A;  3PVL A;  2HTH A;  4FN2 A;  2LXA A;  3HM3 A;  3PSE B;  4FLH A;  2N7D A;  2EKE C;  4J6I A;  5AEK B;  2K8B A;  2KMA A;  3K9O B;  5DPS A;  2IO1 B;  1OTR B;  3R3M A;  4B9K A;  2OOB B;  2MWS B;  3HM6 X;  4HCN B;  5CHF A;  1IP9 A;  4GDL B;  4DXA B;  2OJR A;  3L08 A;  1YX6 B;  2D11 A;  3JVZ X;  1S1Q B;  1V81 A;  3L10 B;  3KYD D;  5J2R A;  4W9J A;  2O6V A;  4IM0 A;  3QX1 A;  4W9G A;  4MSQ B;  1RAX A;  4MDK E;  4A20 A;  1WY8 A;  3P2B A;  2MX2 A;  2ZPY A;  1P98 A;  2DZJ A;  4NPN A;  4E71 A;  4KDL B;  3A1Q A;  2KDI A;  2KO3 A;  4HPL B;  4MJS A;  1A5R A;  2J0M A;  3TL5 A;  2JUO A;  3RUL A;  3T8M A;  2KC2 A;  1V86 A;  3R66 C;  3B08 A;  1WI0 A;  2O2V B;  5DPT A;  1ZW7 A;  3PV1 A;  2G45 B;  3U8Z A;  1V9J A;  2K8C A;  2CHX A;  3DBR I;  4W9K A;  1U4A A;  3M63 B;  1WMH B;  2PEA A;  3PGE A;  1TGZ B;  2KHW B;  4RM9 A;  3H7P A;  3HHM A;  3A4R A;  1GNU A;  3U7D A;  3ZVV A;  4FJZ A;  2JRI B;  4K7U A;  2BWE S;  2L05 A;  3AU4 A;  3QCA A;  1E8X A;  1OEY A;  1WX7 A;  2FID A;  3TCA A;  2BKR B;  2BPS A;  3M62 B;  1LFD A;  2CS4 A;  2DYB A;  1E8Z A;  4AOF A;  1WRD B;  3JSV B;  1Q1O A;  2C7N B;  3VAW A;  3QA8 A;  2REX A;  1QZE A;  2PE6 B;  2K6Q A;  2D07 B;  2GBR A;  2JT4 B;  3DPD A;  2KWV B;  2NVU I;  4IWP A;  2LI5 A;  1V2Y A;  3CSF A;  4BVU C;  2KJ6 A;  3DQV A;  2GMI C;  4ASW C;  3MJW A;  3PHX B;  3WIM A;  3WAM A;  4F7Z A;  3PRM B;  3ZRC A;  1GJZ A;  1EUV B;  1P0R A;  4IC7 B;  1KLV A;  2WDT B;  4CYE A;  3H7S A;  1D3Z A;  1YX5 B;  2JPH A;  5AZH A;  4NJ7 A;  2DX5 B;  3T9L A;  3QQ8 B;  1NI2 A;  2IYD B;  3UIP B;  3DBL I;  2WWZ A;  3IHP C;  1I35 A;  1LXD A;  2IO3 B;  4GB9 A;  3ZTC A;  2N9E B;  3V60 A;  2WYQ A;  4FHJ A;  1I42 A;  2AWT A;  3UQB A;  4DWF A;  2LRW A;  4FAD A;  4WWN A;  1IYF A;  4AJY B;  1V5T A;  3EHV A;  4MSM B;  3OLM D;  4KIK B;  5CX3 A;  1WR1 A;  3KYC D;  2HJ8 A;  1WGY A;  3M3J A;  1VCB A;  4W9F A;  1WXM A;  3A9K B;  4XZ4 A;  5GMV A;  2PPH A;  3N32 A;  2I1K A;  3RZW C;  5G2N A;  5IA7 A;  2BF8 B;  1UEL A;  2KWC A;  4E3C A;  3V6E B;  3HIZ A;  2V3S A;  4LDT B;  1WXS A;  3PLV A;  1KOT A;  1Q5W B;  4BKS A;  2HE7 A;  2WX1 A;  3A9J B;  1WXV A;  2L76 A;  1KM7 A;  1LM8 B;  1UBI A;  2KAN A;  2MP2 A;  3PPA A;  4PYZ A;  2M1M A;  4EZJ A;  3W1S A;  4NJ6 A;  2BYE A;  4OVU A;  1NBF C;  3ONS A;  3W1Y A;  2R2O A;  5JHA A;  3WAP A;  3VFK A;  4DHZ E;  3RZF A;  1AAR A;  1Z2M A;  2B3A A;  3VHT C;  2G4S A;  2KTF A;  3B0A A;  1K8R B;  3A33 B;  3L54 A;  2CR5 A;  4K7S A;  4F1S A;  1XT9 B;  3L17 A;  1RLF A;  1SIF A;  4MM3 A;  2ZVO A;  4EZL A;  2KXJ A;  2KWU B;  4P7I A;  1E8W A;  4AUQ C;  3APF A;  3PRP B;  1Y8R C;  4W9I A;  2ZNV C;  1PQS A;  4LDT D;  2N1V A;  2PJH A;  1OGW A;  1WH3 A;  4A3O A;  2GBN A;  3RYT A;  3WAO A;  1SE9 A;  4FHK A;  3R7Q A;  1P1A A;  2KQS A;  4HJK A;  3GOE A;  1WXA A;  4ZDV A;  1WFY A;  4GSW A;  3NHE B;  5D2M B;  1J8C A;  2JY6 A;  2ZCC A;  2QHO A;  4HCP B;  3APC A;  4KDI C;  3V61 A;  4GMV A;  1WJ6 A;  1RFA A;  2Z0D B;  3ML8 A;  4GXB A;  4HDO A;  3WAL A;  2XEW A;  3VXW A;  4GU2 A;  3X23 A;  4YL8 A;  2LXC A;  1Q0W B;  4CO7 A;  2R2Q A;  2N9P C;  2Y5B B;  1OQY A;  4JQW C;  4ANX A;  1YQB A;  2DAJ A;  3QK0 A;  3I3T B;  4G50 A;  4GDK A;  2ZPN A;  3L16 A;  2PE9 A;  4GDL A;  1JRU A;  4KZC A;  4NQK E;  1WYW B;  3PTF C;  2DZM A;  3VH4 B;  1UGM A;  2KDB A;  4HK2 A;  2MQJ A;  2KFK A;  4M8M A;  3B1L X;  3ZLZ A;  3ZUN A;  4MJS B;  2KDE B;  2FCS A;  4K81 A;  5D7G A;  4BBN F;  2LZ6 A;  3APD A;  4IUM B;  4K1R B;  3JW0 X;  4IWO A;  4KSL C;  4EOY A;  2GBM A;  3UGB B;  3CST A;  2L7R A;  4ANU A; 
#chains in the Genus database with same CATH topology
 4A9A A;  4OHJ A;  2INP E;  3H7P B;  3PS6 A;  1EU4 A;  2VRR B;  2MA9 B;  3UQA A;  2WNM A;  5JH5 C;  3ZTD A;  4TMA B;  1WF9 A;  2HD5 B;  3QAR A;  3PHW B;  2BB5 A;  4CQN A;  5D3D A;  2PVO D;  2NR2 A;  4WQO B;  2GOW A;  3W1S C;  2LD9 A;  3VTW A;  2KD0 A;  3AN1 A;  3RT3 B;  3NG0 A;  1J0G A;  2LFI A;  3ZIM A;  2ZW1 A;  2N1W A;  2FAZ A;  1N5W A;  2RDG A;  3BY4 B;  3EA6 A;  2IGG A;  2ZZP B;  1R7S A;  2JYE A;  3NS8 A;  4ZRK A;  3MHZ A;  4DHJ B;  2K6D B;  4MEL A;  3DWM A;  3NZU A;  3VUY A;  1VD2 A;  2GBK A;  3AB5 A;  2X38 A;  1MHX A;  4KIK A;  4M0W B;  1JAL A;  4I6P A;  4WJP A;  4OVZ A;  1WSP A;  4DHZ B;  5E6P A;  1ET6 A;  5E6J A;  1J7C A;  1V1P B;  3S2A A;  1YOV B;  1ZDX A;  1E6E B;  2IPK D;  2RPQ A;  1FD6 A;  1VDV A;  1E90 A;  2YEP F;  2WDQ B;  2L52 A;  2QDF A;  1C4C A;  3Q8B A;  1B1Z A;  2XBB C;  1FNW A;  2KN5 A;  3MC0 B;  1WZ3 A;  2G3Q B;  3ZJV A;  3I57 A;  1WGG A;  2LVO A;  3AI5 A;  4TV3 A;  4USA A;  3W9C B;  1TIF A;  3DVG X;  1GB1 A;  1FCC C;  4LJO B;  4B0E A;  2QIL A;  2WXR A;  4LLG M;  3Q3N C;  2KOX A;  5IAA C;  4BOZ B;  3GP7 A;  3X0W A;  4XC2 A;  4A55 A;  1TY2 A;  2MEK A;  2DZI A;  2HTM E;  2CKH B;  4DDG D;  1IBX B;  4REZ A;  4GDK B;  2N7E A;  4ZRJ A;  2FNJ B;  5DPW A;  1F2R C;  4FBJ B;  4IG7 B;  1WMH A;  3C0R B;  1R4N B;  3A4S C;  2RDH A;  3PLU A;  2CU1 A;  1GAQ B;  1XLN A;  4ZRI A;  2O6V D;  3ZDM C;  1E8Y A;  3WAN A;  1RRB A;  1KJT A;  2FCM A;  1L4Z B;  3DBH I;  3OG5 A;  4K7W A;  2LGY A;  2N9K A;  4JPS A;  1ZKH A;  3GE3 C;  4KKJ A;  4GOC A;  1C76 A;  1SJE D;  4FA6 A;  3NVZ A;  4YTM B;  2IZV B;  5MPO A;  1YJ1 A;  4M01 A;  4M02 A;  2H88 B;  4PYU A;  4RGO S;  3ZQ4 A;  2MHJ A;  3AUL A;  2JZZ A;  1CK1 A;  2H89 B;  1QOF A;  4YTP B;  3V3X A;  2KAC A;  3L0W B;  3ZYY X;  2JZP A;  2M56 B;  2K1F A;  5CHV C;  3AM9 A;  1XLQ A;  3VTV A;  2UWQ A;  4NZL B;  1WX9 A;  4AP4 C;  2BYF A;  2AEH A;  1BML C;  4M8N A;  4BFR A;  3A9K A;  3E9S A;  1C78 A;  1WX8 A;  2KX0 A;  1WGR A;  3DVN V;  3OJ3 A;  1D5M C;  3RPF C;  2N9L A;  3KUC B;  3MHS D;  3KQ4 A;  4B0M A;  2KJR A;  1CMX B;  3UF8 A;  4II2 B;  1GG3 A;  2KDF B;  3N1X C;  4ZRQ A;  3KWL A;  2NBU A;  1I4R A;  1EF1 A;  4II3 B;  3R2T A;  3ZNG C;  2BBC A;  2JYT A;  4WH4 A;  5IP4 D;  3NVV A;  3URY A;  3OAW A;  4W9L A;  3U52 E;  3W2D A;  1QKZ A;  1TKG A;  5FK9 C;  1PGX A;  2IBI B;  1F9J A;  3KH0 A;  2EMT A;  1FXI A;  1T3Q A;  2N7D A;  3SR6 A;  2MWS B;  3T3N A;  4HCN B;  5CHF A;  3RMK C;  2V4I B;  3TSS A;  1AWD A;  4W9J A;  4IM0 A;  3QX1 A;  4XYC A;  2KYW A;  3ZJU A;  4A20 A;  1Q10 A;  2MX2 A;  3Q2A C;  4E71 A;  4KDL B;  2BW2 A;  2KDI A;  4MJS A;  2GLS A;  1HA5 A;  2JUO A;  3U8Z A;  4OW0 A;  1F0Z A;  2CHX A;  1U4A A;  1WMH B;  2PEA A;  4EE2 A;  4JE3 B;  5JXV A;  2KHW B;  1E10 A;  2PTL A;  2HDE A;  3HHM A;  3ZGZ A;  4NAM A;  2BWE S;  2MJ3 A;  2QJL A;  4OZA A;  1E9M A;  2W3S A;  5FR3 A;  1Q1O A;  3VAW A;  2K3U A;  3QA8 A;  1QZE A;  2D07 B;  3DPD A;  2KWV B;  3FC4 A;  4IWP A;  1JQ4 A;  2WXK A;  1V2Y A;  3CSF A;  1I4P A;  2KJ6 A;  1XO3 A;  2GMI C;  4ASW C;  3MJW A;  5H92 C;  3ZRC A;  1EUV B;  2WDT B;  4D2K A;  5AZH A;  4HRO A;  2DX5 B;  3QQ8 B;  3Q6B A;  3ETR A;  1ZDV A;  2IO3 B;  4GB9 A;  3V60 A;  2WXL A;  1I42 A;  3AE1 B;  3NS1 A;  4MSM B;  3OLM D;  3KYC D;  2HJ8 A;  4HJG E;  3A9K B;  4N58 A;  4US9 A;  5FKA C;  3N32 A;  3RZW C;  5G2N A;  3Q8F A;  3B2G A;  1UEL A;  1LO5 D;  3V6E B;  2WXM A;  2HE7 A;  1OQR A;  3P4P B;  3IXS A;  1KM7 A;  1LM8 B;  3PPA A;  1HTQ A;  3AE8 B;  5JHA A;  1EU3 A;  3MC9 A;  3VFK A;  2G4S A;  4K7S A;  3L54 A;  2CR5 A;  1XT9 B;  1T6B X;  1FO4 A;  1RLF A;  4EZL A;  1NYR A;  3DHH C;  4AUQ C;  3APF A;  2X8X X;  2ZNV C;  3RYT A;  3WAO A;  2D3B A;  4FHK A;  1P1A A;  3P4R B;  4JX1 C;  3GOE A;  5T8I A;  4ZDV A;  4K3C A;  2PKO A;  2QHO A;  4HCP B;  3APC A;  4KDI C;  1D4B A;  4GMV A;  2Z0D B;  4KGS A;  3ML8 A;  4GXB A;  4HDO A;  1JML A;  2WU2 B;  3FKY A;  1SIJ A;  1WWT A;  1YMH E;  4G50 A;  3I3T B;  1EM7 A;  2Y3A A;  3L16 A;  1JRU A;  4MT5 A;  1I7H A;  3VH4 B;  3T3O A;  5BMI A;  3DBL B;  2L83 A;  2MQJ A;  3AEE B;  1ZE3 D;  2DLB A;  3B1L X;  4MJS B;  1JWM D;  2FCS A;  4BBN F;  2WXJ A;  1TS2 A;  2PIA A;  1L6V A;  3JW0 X;  2LJI A;  4IWO A;  2OHF A;  1ZUD 2;  4IWQ A;  3V62 A;  2AL3 A;  4N9F 4;  3NZ3 A;  2MCN B;  2W9N A;  3UIO B;  2NPT A;  2ZCB A;  5BYS A;  2BGF A;  1WGD A;  5DPR A;  2MRP A;  3PRE A;  3LDZ E;  4EZK A;  1C1Y B;  2Y5C A;  1V1O A;  1BXT A;  5FR6 A;  1SJH D;  2L3Z A;  3ZW3 A;  4BKT A;  2LGX A;  2WGS A;  3ZDT A;  2J53 A;  4X57 B;  1K52 A;  2KX3 A;  2KJH B;  3VR9 B;  4E74 A;  4Q2J A;  4B6W A;  2J52 A;  3VRA B;  4URK A;  3QAQ A;  3HRD D;  3P4S B;  1R4N I;  3BYT B;  2DBY A;  3AE4 B;  4BOS C;  2LVQ A;  2ICI A;  2IY1 B;  2MH7 A;  4YTN B;  1QF6 A;  1D5X C;  1PFD A;  2FUH B;  1WE6 A;  2J0J A;  2ZJD A;  1XCT L;  1YN4 A;  1XLP A;  1AW7 A;  3VDZ A;  1QIL A;  4WJO A;  2JXX A;  4DHJ D;  3TEW A;  4TSS A;  1UZX B;  1I4X A;  2JRH A;  3E56 A;  1F2R I;  4M00 A;  5TSS A;  3TEZ A;  5HI1 A;  4RMA A;  2N0S B;  4WAF A;  5BMH A;  4XWT A;  5JHB A;  2MBO A;  4BKS D;  1YNT E;  3AH7 A;  4EEW A;  1STE A;  1UF0 A;  3ECI A;  3VUX A;  3RCZ A;  3DCG A;  5C23 A;  1FEH A;  2M0X A;  2UU7 A;  2RMM A;  5KHO A;  2QSD A;  4S17 A;  2LUM A;  5LNK 1;  1MVK A;  4GLS C;  4KSK C;  3RNA C;  5GXG B;  2JWU A;  3ENE A;  3A1Q B;  1SBB B;  4MH0 E;  2QMT A;  3KW5 B;  4MGZ E;  2L00 B;  4DXA B;  2MSE D;  2JVC A;  1BUI C;  4MEM A;  3W5V B;  5I4D A;  3PO0 A;  2LGD A;  4WWP A;  1YQ4 B;  5IO9 A;  1YIW A;  2K9X A;  3IFW B;  2HJ1 A;  2FCQ A;  1XCQ L;  1G6J A;  3JSV A;  1SEB D;  3EUB 2;  3P63 A;  2MBB B;  4FJV B;  2I2Y A;  1NYQ A;  2W82 A;  2NPT B;  2KZR A;  2KT7 A;  2WDV B;  1ZGU B;  5E6O A;  2NMQ A;  2LGS A;  3RNC C;  3RUI B;  4ITK A;  2KVZ A;  4ZYS A;  5C1Z A;  4C7Z A;  3MC8 A;  3ALB A;  3HVZ A;  1IGC A;  5G5G A;  1DOY A;  3TIX A;  3M95 A;  1LQB A;  4KGT A;  2RD0 A;  4P1C C;  1WIA A;  1PGA A;  2MW5 A;  2BKF A;  2KK8 A;  4ZHO A;  4JL9 A;  3NOB A;  3I5J C;  1OQQ A;  2A5U A;  1OEY J;  5LXH A;  4GN1 A;  2RSU A;  2BQQ A;  3N3K B;  2DYM A;  2WXH A;  3WCQ A;  3A9J A;  2M4N A;  4PS3 A;  5J17 A;  2IO0 B;  4ANV A;  2LAS A;  3BVG A;  5EDS A;  3DBS A;  1TY0 A;  4XDC A;  4DK5 A;  4PS8 A;  1IPG A;  2NS5 A;  4AJW A;  2RGF A;  4JLC A;  2C7H A;  1FFV A;  3VH3 B;  2D3G A;  2K39 A;  1ZP0 B;  1WE7 A;  3TEY A;  3AEF B;  5L83 A;  1PDX A;  1N5X A;  1ISN A;  3MJ5 A;  1BT0 A;  4DBG A;  1FIQ A;  2LVP A;  2GBJ A;  2E3T A;  3ABV B;  1FNU A;  3IBE A;  3PVL A;  2HTH A;  4L2Y A;  1NEK B;  5AEK B;  3PSE B;  4FLH A;  4J6I A;  2K8B A;  2IO1 B;  1OTR B;  3HM6 X;  4GDL B;  5AUI A;  3BII D;  3L10 B;  5J2R A;  2O6V A;  4W9G A;  4MSQ B;  1RAX A;  4C80 A;  1WY8 A;  1FRR A;  4JWS C;  1MG4 A;  2KC2 A;  1N63 A;  2G45 B;  1V9J A;  2K8C A;  3Q3M C;  4YSX B;  1QOG A;  4RM9 A;  4C4V A;  3AEG B;  1GNU A;  1B9R A;  1PYW D;  4LNO A;  3AU4 A;  1KH0 A;  1E8Z A;  1I4H A;  3JSV B;  3RNB C;  4AOF A;  2L1A A;  4JWU C;  4A6Q A;  3GS2 A;  2CJO A;  2JT4 B;  2WXN A;  4YWG G;  4PT5 A;  4F7Z A;  1P0R A;  4IC7 B;  4RH6 A;  1IUE A;  1D3Z A;  1YX5 B;  4NJ7 A;  1VZ8 A;  3UIP B;  3DBL I;  3IHP C;  1N6Z A;  2WYQ A;  4FHJ A;  2AWT A;  3UQB A;  1IYF A;  4AJY B;  5H8Y E;  2IGD A;  3GZN B;  3NUH B;  3EHV A;  2LHD A;  2PMV A;  4LNK A;  2Q5W D;  4KIK B;  1FFU A;  2K0P A;  3ZJT A;  1WGY A;  4P1B C;  1KRH A;  4W9F A;  1WXM A;  4XZ4 A;  4P6V F;  3AED B;  2I1K A;  2KN4 A;  3RN9 C;  3HIZ A;  3EFC A;  3EGR A;  2V9H A;  3PLV A;  1Q5W B;  3A9J B;  1WXV A;  2L76 A;  2MP2 A;  3OWE B;  4FXC A;  4EZJ A;  4NJ6 A;  1HEZ E;  3WAP A;  1FRD A;  3A33 B;  4RCO A;  4ARI A;  1SIF A;  4MM3 A;  2ZVO A;  2B76 B;  2KXJ A;  2KWU B;  4YSZ B;  4P7I A;  1Y8R C;  4H2A A;  2QEJ C;  3N9Y C;  2GBN A;  3BVM A;  1ESF A;  2KQS A;  4GSW A;  1D5Z C;  4RGN A;  2JXT A;  2XEW A;  4KKI A;  4YL8 A;  1Y56 A;  1FNV A;  3NJT A;  2MJD A;  4ANX A;  2DAJ A;  4LK0 M;  3ZXV A;  3QK0 A;  1UWM A;  4NQK E;  1WYW B;  1QLB B;  1UGM A;  2LHE A;  2AQ2 B;  4J3O D;  4RNA A;  4ZOH C;  4HRS A;  2V3N A;  5D7G A;  2BB6 A;  1I4G A;  3APD A;  1P7E A;  4KSL C;  4EOY A;  2IND C;  3UGB B;  3CST A;  4ANU A;  3H1U A;  2AX5 A;  2FIF A;  5C3J B;  1N62 A;  1E5W A;  4C4V B;  4GGQ A;  1R4M I;  3QC8 B;  1V5O A;  1T0Q C;  2G4D B;  1CQV A;  1HTO A;  3KWV A;  1T0Y A;  2UYZ B;  1WRI A;  2XK5 A;  2D3A A;  2EMS A;  2J0K A;  5C2T B;  4OZC A;  1HE8 A;  1HZ5 A;  1XQQ A;  2NBV B;  2V1Y A;  3ZRF A;  2K25 A;  4YXD B;  4ICU A;  3QIJ A;  5EE0 A;  2A4Z A;  1FXA A;  2KC1 A;  3WA0 A;  1YN5 A;  1S3S G;  1UBQ A;  4OZB A;  4G3X B;  3CMM B;  1GB4 A;  3NY5 A;  4MGI E;  2WXF A;  2IGH A;  1VLB A;  1XLO A;  3Q8A A;  1XD3 B;  1H4R A;  3DOW A;  1MJD A;  2MBH A;  5BYQ A;  1T0S C;  4BZA A;  3QHT A;  1FXT B;  3SD5 A;  1E7U A;  1WM3 A;  3IAM 1;  2MP2 B;  3LYY A;  2KQ7 A;  2MLB A;  3BWU D;  1E0Z A;  3Q14 C;  3HK0 A;  5L95 C;  1KFY B;  4MM3 B;  4HXD A;  2DEN B;  1L7Y A;  2K8H A;  4TUU A;  3IT6 B;  3R2I A;  1TZ1 A;  5AZG A;  4IDI A;  2CHW A;  2KLC A;  5IOI A;  1GC7 A;  2AYO B;  4DXG A;  4HPM B;  5BMG A;  3KUD B;  3O65 B;  2LRU A;  3ZNZ B;  2MBQ A;  3AU5 A;  3AE7 B;  4HVB A;  3H9D A;  5AZF A;  1C4P A;  2BTE A;  1WR6 E;  2VZK B;  4O1N A;  4BKG A;  3UI3 A;  4W9C A;  2O2V A;  5TR5 A;  1A5R A;  2CU3 A;  2L0T A;  5D94 A;  2KFJ A;  5CHW A;  3Q3J A;  2ZNV B;  4WQM A;  4GIV A;  1Z5S B;  2KNB A;  3UIN B;  5G55 A;  1J7B A;  2FE8 A;  2WX0 A;  3MTN B;  4WJQ A;  2G1E A;  1QT9 A;  1V80 A;  2V0G A;  5LXI B;  1F52 A;  1EO6 A;  4TKN A;  2NCN A;  2MBE A;  1SXT A;  1ROE A;  4A3P A;  4G11 A;  3BK1 A;  4NNJ B;  2VH1 A;  2XK5 B;  2BWF A;  4NJC A;  1P3Q U;  3P42 A;  1VJK A;  3ZO5 B;  1XEE A;  5HKH A;  4BBN C;  5KHQ A;  3KVF B;  2LUE A;  3LJ3 A;  2DWQ A;  1D6E C;  3N20 C;  5D6J B;  1WYG A;  1ZOY B;  3P4Q B;  2J7Q B;  3D32 A;  4NQL B;  1V97 A;  3O13 A;  2CHZ A;  2M19 A;  5BYR A;  2E6X A;  2INC C;  3P1M A;  3PZ8 A;  4KX6 B;  4EUT A;  4NY0 A;  3R8B A;  4PS7 A;  1WJ4 A;  2RR9 A;  3BYY B;  2L0F A;  3TJP A;  4L1B A;  4M0W A;  3RNG C;  4RGT A;  4ICV A;  4W9H A;  3QWZ B;  2DZK A;  4LJP B;  3PRZ A;  1TBE A;  3AV8 A;  3VVW B;  3Q8C A;  3RI7 C;  4TQ0 A;  1TYG B;  2GRI A;  1JCK B;  1L5P A;  1TS3 A;  4EFO A;  3K9P B;  1ET9 A;  1J19 A;  4W9D A;  2ASQ A;  2K22 A;  1FCL A;  2FCN A;  3H6N A;  2VH2 A;  1JRO A;  4R3D A;  4LCD E;  3MFG A;  1K51 A;  2LJ5 A;  1NDD A;  2JQR B;  1I4Q A;  2V3P A;  1K50 A;  3L4P A;  2WU5 B;  4ACF A;  1F1H A;  4EKU A;  1C4A A;  2R61 A;  3ZKJ C;  1WZ0 A;  1NI3 A;  1MPE A;  3DHI C;  1NEN B;  2WXI A;  1TS4 A;  2Z59 B;  1C79 A;  1HZ6 A;  4I6N B;  2L8J A;  5CTR C;  4HPP A;  2ZEQ A;  1E7V A;  4F8C B;  3R7R A;  5JZE B;  3JYU A;  3EFU A;  3GZN I;  2KLG A;  3AE9 B;  4BAX A;  3AE2 B;  4FN2 A;  2EKE C;  1HQR D;  2KMA A;  3K9O B;  5DPS A;  2WQY B;  1IP9 A;  3L08 A;  1YX6 B;  2WS3 B;  2D11 A;  3JVZ X;  1V81 A;  3KYD D;  1CZP A;  1JWA D;  5AUK A;  2FUG 1;  4LTU A;  1P98 A;  2DZJ A;  1KF6 B;  4HPL B;  3RUL A;  4HKZ E;  2O2V B;  2ONQ A;  1ZW7 A;  3PV1 A;  4ARC A;  3U7Z A;  1E7P B;  2XNA C;  3M63 B;  1SE3 A;  1TGZ B;  2BS4 B;  3A4R A;  1QOB A;  2EEL A;  1VZ7 A;  4WUR A;  3C8Y A;  2L05 A;  4WWM A;  1E8X A;  1OEY A;  3TCA A;  2BPS A;  3M62 B;  1EWC A;  2CS4 A;  2PLP A;  2REX A;  3RNE C;  2LI5 A;  3ZXR A;  4BVU C;  3DQV A;  2ZW0 A;  3WIM A;  3WAM A;  1GJZ A;  1KLV A;  1QQR A;  3T9L A;  1NI2 A;  3HVD A;  2WWZ A;  2KDM A;  1I35 A;  1LXD A;  1EWY C;  1TZO A;  4DWF A;  2LRW A;  1L4D B;  4WWN A;  3CIR B;  1V5T A;  4IOI E;  2I38 A;  1WR1 A;  3M3J A;  5GMV A;  2PPH A;  3NVY A;  1C77 A;  2BF8 B;  4DQO C;  2KWC A;  4MH8 A;  1NVI D;  4E3C A;  1RM6 C;  1TKY A;  2V3S A;  4K3B A;  4LDT B;  1YJJ A;  1PGB A;  1KOT A;  2WX1 A;  1UBI A;  1N60 A;  4PYZ A;  1UGJ A;  3U4E G;  4AS1 A;  2BYE A;  1YN3 A;  3DBR B;  3ONS A;  3FAH A;  4DHZ E;  5IKC M;  1DYQ A;  2N7J A;  2KTF A;  3B0A A;  1K8R B;  1M4V A;  3L17 A;  1CJE A;  1L0V B;  3PRP B;  1PQS A;  2N1V A;  2PJH A;  1OGW A;  4A3O A;  1SE9 A;  3R7Q A;  4XE0 A;  4AQ7 A;  3H8H A;  2WXO A;  1J8C A;  2JY6 A;  2ZCC A;  1JW9 D;  2NTS A;  1WJ6 A;  1RFA A;  4MAC A;  2W54 A;  3WAL A;  3X23 A;  1RWS A;  4GU2 A;  1FPY A;  1YQ3 B;  2LXC A;  4CO7 A;  2R2Q A;  2N9P C;  3IAS 1;  3MP9 A;  2Y5B B;  1OQY A;  5EE1 A;  1YQB A;  1OFF A;  2ZPN A;  2M0A A;  4HK2 A;  1VZ6 A;  1XF5 L;  2J4X A;  2WDR B;  3TEX A;  2KFK A;  4M8M A;  2Y5P A;  3HUI A;  2KDE B;  4K81 A;  2LZ6 A;  5HFY A;  4K1R B;  2GBM A;  5BO4 B;  2KKC A;  4KVG B;  2JWZ A;  2W3R A;  1RYJ A;  2LEK A;  4NAW A;  2C7M B;  3NRZ A;  1JWB D;  1H8C A;  1YD8 U;  2YEP B;  4QAY A;  3I9V 1;  4IM3 A;  3SHQ A;  3C19 A;  1PUT A;  1ENF A;  2C5L C;  2D10 A;  1WM2 A;  2KTR A;  1X1M A;  4TQ1 A;  1SE2 A;  1V6E A;  4LNI A;  3VTU A;  4DDI D;  3U30 A;  4LNN A;  4RF0 A;  1P7F A;  1UUP A;  4JIO U;  1GC6 A;  3L13 A;  1AYF A;  2M17 A;  3GE8 C;  1SF0 A;  2AL6 A;  3KUZ A;  2BYV E;  2LMC A;  4IM2 A;  3N1Y C;  4XDD A;  2Z0E B;  2DNF A;  3CF6 E;  4C00 A;  1AN8 A;  2WHI A;  3SFD B;  2WXG A;  3N30 A;  4HLE A;  2DHZ A;  3AEB B;  3RNF C;  2KMM A;  4B95 A;  4OVV A;  4DXF A;  1L6U A;  2I1J A;  1SE4 A;  2N4F A;  4XX5 A;  1ZXI A;  3DDC B;  3EC8 A;  1WJU A;  2NBW B;  3AE5 B;  1TJE A;  2M8S A;  1WJN A;  1HXY D;  4WIP A;  3AEC B;  2WLB A;  3VRB B;  1KLU D;  1EF5 A;  4C7Y A;  2D2Q A;  4RM8 A;  4WWO A;  2BT6 A;  5E6N A;  1MFW A;  3ML9 A;  1TS5 A;  2L7R A;  4I6L B;  1TT5 B;  4HWI B;  2JZ3 B;  4KZ0 A;  1WGH A;  1DGJ A;  2RPV A;  1UWX A;  4IW0 A;  2IY0 B;  2AQ1 B;  2PVG C;  3AE6 B;  2PW9 A;  3DVG Y;  4UDU C;  1DOX A;  3V05 A;  4RGM A;  2O6V B;  1DOI A;  1SSN A;  3VUW A;  3OJ4 B;  3U2S C;  2N9X A;  2RDB C;  2FBW B;  1UNS A;  2YVC A;  3V6C B;  4W9E A;  2ON8 A;  5DCN A;  4YSY B;  2C9W B;  2V4L A;  3EEC A;  2KFK B;  3AMZ A;  3FIL A;  3SU8 X;  1SB3 C;  3B9J A;  4FUL A;  2JSV X;  2IO2 B;  1JWS D;  1F77 A;  1VR9 A;  4MGY E;  4P16 A;  3SEB A;  2VZK D;  2NTT A;  3SDL C;  3PT2 B;  3VQI A;  4MGK E;  3TBL D;  2WXQ A;  3N1Z C;  2DYO A;  2DAF A;  1ZXH A;  5LLI A;  4AWJ A;  4NAW B;  1SGH A;  1GUA B;  4XGA B;  4G0N B;  2JF5 A;  2MJE A;  3LXF A;  5EE3 A;  5HG2 A;  4S0R A;  3AEA B;  3ZNI D;  1MHH E;  4US8 A;  2LGI A;  4HDQ A;  3ZNH B;  1VRA B;  2Z8L A;  2KTR B;  2ZVN A;  3TMP B;  1FMA D;  2K5P A;  3W5U B;  4A8X C;  2YLM A;  4HKQ A;  3RFZ B;  2QCZ A;  4CHK A;  2C60 A;  1V49 A;  1TTN A;  3Q3F A;  4ZYN A;  2XN9 C;  3IVF A;  2ACZ B;  3B2F A;  1M94 A;  1T0R C;  3DHG C;  1MG8 A;  3BVZ A;  2BS2 B;  4A90 A;  1JRP A;  5EE9 A;  1UD7 A;  1KTK A;  2IJ0 A;  1P9D U;  1UH6 A;  2LWP A;  3RD2 A;  2KVR A;  2KMC A;  1TKE A;  2D5G A;  2SEB D;  3DWG C;  3PZD A;  4FJY A;  3BIN A;  4N59 A;  3DVN U;  1N61 A;  4KV2 A;  1YJI A;  2GI9 A;  4WJN A;  4WAA A;  1L2N A;  4C56 C;  5J18 A;  3DBH B;  3QJZ A;  1K53 A;  4JGH B;  2OED A;  5D3I B;  2GB1 A;  3IG3 A;  4ANW A;  3BK2 A;  2BS3 B;  1WGK A;  3NZS A;  2LXA A;  3HM3 A;  2TSS A;  1ZPS A;  5HHD G;  3R3M A;  4B9K A;  2OOB B;  2OJR A;  1S1Q B;  4ZRP A;  4MDK E;  3P2B A;  2ZPY A;  4XWW A;  4NPN A;  2JX5 A;  2KO3 A;  3A1Q A;  2J0M A;  3TL5 A;  3T8M A;  1V86 A;  3R66 C;  4RFB A;  3B08 A;  2BVC A;  1WI0 A;  1JWU D;  5DPT A;  2OJW A;  2SAK A;  3DBR I;  4W9K A;  2J42 A;  2IDY A;  3PGE A;  3FIL B;  4RF1 A;  3H7P A;  4KGR A;  3U7D A;  3Q8E A;  3ZVV A;  1L0X B;  4FJZ A;  2JRI B;  4K7U A;  1T5X D;  3QCA A;  2FID A;  1WX7 A;  2BKR B;  2CJN A;  2KAJ A;  1GOZ A;  1LFD A;  2DYB A;  1WRD B;  2C7N B;  1XXG A;  2PE6 B;  2K6Q A;  2GBR A;  2NVU I;  1IGD A;  2W55 A;  4YT0 B;  1MI0 A;  1C9F A;  3NVW A;  3J9C A;  3SFE B;  3CWI A;  3GB1 A;  3PHX B;  3PRM B;  4CYE A;  2INN E;  2QIE B;  3H7S A;  2JPH A;  3LB8 C;  3AE3 B;  1FM0 D;  2IYD B;  1RFK A;  4N6E B;  2WXP A;  3ZTC A;  2N9E B;  4FAD A;  5G5H A;  1A70 A;  1QOA A;  2KQ4 X;  4ZHP A;  4HEA 1;  5CX3 A;  1VCB A;  5IN7 A;  2L32 A;  5IA7 A;  1V1P A;  1WXS A;  2KWD A;  4BKS A;  2D3C A;  2KAN A;  2M1M A;  2EKI A;  3W1S A;  4OVU A;  1NBF C;  3W1Y A;  2R2O A;  1KLG D;  3RZF A;  1AAR A;  1Z2M A;  2B3A A;  3VHT C;  4F1S A;  2BYT A;  4IKG A;  3I63 C;  1E8W A;  3TUO A;  4W9I A;  4LDT D;  4LNF A;  1WH3 A;  1GPX A;  1R4M B;  4HJK A;  1WXA A;  1WFY A;  2QC8 A;  1V8C A;  3IT4 B;  3NHE B;  5D2M B;  4PK1 A;  1J7A A;  2WP9 B;  3V61 A;  3VXW A;  1ACC A;  1IBX A;  1Q0W B;  4JQW C;  3Q69 A;  3KLS X;  1C3T A;  4GDK A;  4GDL A;  2PE9 A;  2G9H D;  4KZC A;  3PTF C;  2DZM A;  1LGR A;  2KDB A;  4L23 A;  3BZD B;  3ZLZ A;  2AQ3 B;  3Q3O C;  3ZUN A;  1WXQ A;  4IUM B;  2JU6 X;  3PZ7 A;  3VR8 B;  1L0Y B;  3AXC A; 
#chains in the Genus database with same CATH homology
 4IWQ A;  3H1U A;  5BO4 B;  2AL3 A;  2KKC A;  4KVG B;  2FIF A;  3V62 A;  4N9F 4;  2JWZ A;  1E5W A;  3H7P B;  2MCN B;  2W9N A;  3UIO B;  3PS6 A;  4GGQ A;  1R4M I;  3QC8 B;  2NPT A;  1V5O A;  2ZCB A;  4NAW A;  2C7M B;  2G4D B;  2BGF A;  2VRR B;  2MA9 B;  3UQA A;  1WGD A;  5DPR A;  1H8C A;  2MRP A;  1YD8 U;  3PRE A;  3LDZ E;  4EZK A;  5JH5 C;  3ZTD A;  1T0Y A;  1C1Y B;  1WF9 A;  2HD5 B;  2UYZ B;  3QAR A;  2XK5 A;  4IM3 A;  3SHQ A;  5FR6 A;  2L3Z A;  3ZW3 A;  4BKT A;  3PHW B;  2LGX A;  2C5L C;  2D10 A;  1WM2 A;  2EMS A;  3ZDT A;  2KTR A;  1X1M A;  4TQ1 A;  4X57 B;  2KX3 A;  2J0K A;  2KJH B;  2NR2 A;  4WQO B;  2GOW A;  3W1S C;  1V6E A;  4E74 A;  2LD9 A;  3VTW A;  2KD0 A;  1HE8 A;  3VTU A;  4B6W A;  3RT3 B;  4DDI D;  1XQQ A;  3U30 A;  3ZIM A;  1J0G A;  1C3T A;  2NBV B;  2V1Y A;  4URK A;  3ZRF A;  2K25 A;  3QAQ A;  2N1W A;  2FAZ A;  3BY4 B;  4ICU A;  2ZZP B;  3NS8 A;  3QIJ A;  4ZRK A;  1R4N I;  3AXC A;  4JIO U;  1GC6 A;  4DHJ B;  2K6D B;  4MEL A;  3NZU A;  2A4Z A;  2LVQ A;  1VD2 A;  2KC1 A;  2GBK A;  3L13 A;  3VUY A;  3WA0 A;  4BOS C;  1S3S G;  1UBQ A;  2IY1 B;  4KIK A;  2M17 A;  4M0W B;  4G3X B;  2AL6 A;  3CMM B;  3KUZ A;  2BYV E;  4I6P A;  4IM2 A;  3NY5 A;  4MGI E;  4WJP A;  2Z0E B;  4DHZ B;  3CF6 E;  1XD3 B;  5E6P A;  1H4R A;  2FUH B;  1WE6 A;  3N30 A;  4HLE A;  3DOW A;  2J0J A;  2DHZ A;  2ZJD A;  2MBH A;  3S2A A;  3QHT A;  1FXT B;  3VDZ A;  3SD5 A;  4B95 A;  4OVV A;  1E7U A;  4WJO A;  2RPQ A;  2JXX A;  1WM3 A;  4DHJ D;  1E90 A;  2I1J A;  2MP2 B;  2KQ7 A;  2N4F A;  4XX5 A;  3DDC B;  2MLB A;  1UZX B;  3EC8 A;  1WJU A;  2NBW B;  2JRH A;  2M8S A;  2XBB C;  1WJN A;  2KN5 A;  1WZ3 A;  2G3Q B;  1WGG A;  2LVO A;  3HK0 A;  1EF5 A;  4RMA A;  3AI5 A;  4TV3 A;  5L95 C;  2D2Q A;  2DEN B;  4HXD A;  5JHB A;  2MBO A;  3DVG X;  1L7Y A;  4RM8 A;  2K8H A;  4WWO A;  4TUU A;  4LJO B;  5E6N A;  1TZ1 A;  3ML9 A;  5AZG A;  2CHW A;  2KLC A;  4BKS D;  4I6L B;  2KOX A;  4EEW A;  4HWI B;  2JZ3 B;  4KZ0 A;  1GC7 A;  2AYO B;  3ECI A;  4HPM B;  3VUX A;  3RCZ A;  3DCG A;  5C23 A;  3KUD B;  1WGH A;  5IAA C;  4BOZ B;  3O65 B;  4IW0 A;  2M0X A;  2IY0 B;  2LRU A;  3X0W A;  3ZNZ B;  2MBQ A;  3AU5 A;  3DVG Y;  4XC2 A;  4HVB A;  5KHO A;  3H9D A;  5AZF A;  2DZI A;  2CKH B;  2O6V B;  4DDG D;  1WR6 E;  3VUW A;  3OJ4 B;  2N9X A;  4KSK C;  4GDK B;  3ENE A;  4BKG A;  3A1Q B;  2YVC A;  2N7E A;  4MH0 E;  2FNJ B;  3KW5 B;  4ZRJ A;  3V6C B;  4FBJ B;  5DPW A;  4W9E A;  4MGZ E;  4W9C A;  5DCN A;  2O2V A;  4IG7 B;  2C9W B;  2L00 B;  2V4L A;  5TR5 A;  3EEC A;  1WMH A;  2KFK B;  2L0T A;  3C0R B;  2MSE D;  5D94 A;  2KFJ A;  2JVC A;  5CHW A;  3Q3J A;  3A4S C;  2ZNV B;  3SU8 X;  4MEM A;  3PLU A;  4GIV A;  4FUL A;  1Z5S B;  2CU1 A;  2KNB A;  2LGD A;  4WWP A;  3UIN B;  2IO2 B;  5G55 A;  4MGY E;  2WX0 A;  4ZRI A;  1YIW A;  2O6V D;  3ZDM C;  3IFW B;  3SDL C;  1E8Y A;  3PT2 B;  3MTN B;  2FCQ A;  4WJQ A;  3VQI A;  1G6J A;  3JSV A;  3WAN A;  1RRB A;  1KJT A;  2FCM A;  4MGK E;  3TBL D;  3DBH I;  1V80 A;  2DYO A;  5LXI B;  4FJV B;  2DAF A;  2MBB B;  5LLI A;  4K7W A;  2LGY A;  4AWJ A;  2NPT B;  1ZKH A;  2KZR A;  1EO6 A;  1SGH A;  4NAW B;  4TKN A;  2NCN A;  4GOC A;  1GUA B;  2MBE A;  4FA6 A;  4G0N B;  2JF5 A;  2IZV B;  4A3P A;  1YJ1 A;  4G11 A;  1ZGU B;  4NNJ B;  5E6O A;  4PYU A;  2XK5 B;  2BWF A;  1P3Q U;  3ZNI D;  4HDQ A;  3ZNH B;  3ZO5 B;  5HKH A;  4BBN C;  3AUL A;  2JZZ A;  5KHQ A;  3KVF B;  2LUE A;  3LJ3 A;  3RUI B;  2KTR B;  5D6J B;  5C1Z A;  2ZVN A;  3L0W B;  3TMP B;  3ALB A;  2J7Q B;  3D32 A;  4NQL B;  2K1F A;  5CHV C;  2CHZ A;  3TIX A;  3VTV A;  3M95 A;  2YLM A;  2UWQ A;  4EUT A;  1LQB A;  2RD0 A;  4CHK A;  2C60 A;  4NY0 A;  1WX9 A;  1WIA A;  4AP4 C;  2MW5 A;  2BKF A;  2BYF A;  2KK8 A;  2AEH A;  1V49 A;  4M8N A;  4BFR A;  3A9K A;  4JL9 A;  1TTN A;  3NOB A;  3Q3F A;  4PS7 A;  4ZYN A;  1WJ4 A;  2RR9 A;  1WX8 A;  1OEY J;  2A5U A;  2L0F A;  3IVF A;  3TJP A;  2KX0 A;  1WGR A;  3DVN V;  3OJ3 A;  5LXH A;  1M94 A;  4ICV A;  1MG8 A;  4W9H A;  4GN1 A;  2RSU A;  3QWZ B;  3N3K B;  2DYM A;  1UD7 A;  2DZK A;  4LJP B;  3KUC B;  3MHS D;  3PRZ A;  1TBE A;  3VVW B;  3A9J A;  4TQ0 A;  1P9D U;  2M4N A;  4PS3 A;  5J17 A;  2IO0 B;  4ANV A;  1UH6 A;  4EFO A;  2LAS A;  2KJR A;  1CMX B;  3K9P B;  5EDS A;  3UF8 A;  3DBS A;  4II2 B;  2LWP A;  3RD2 A;  2KVR A;  1J19 A;  4W9D A;  2ASQ A;  1GG3 A;  2KDF B;  2KMC A;  4DK5 A;  4PS8 A;  2FCN A;  3H6N A;  1IPG A;  2NS5 A;  4AJW A;  2NBU A;  3PZD A;  4LCD E;  4FJY A;  2RGF A;  1EF1 A;  4JLC A;  2LJ5 A;  1NDD A;  3BIN A;  4II3 B;  2C7H A;  3DVN U;  3VH3 B;  3ZNG C;  4KV2 A;  2D3G A;  2K39 A;  4EKU A;  4WJN A;  1WE7 A;  4WAA A;  1L2N A;  3ZKJ C;  1WZ0 A;  3OAW A;  5J18 A;  5L83 A;  3QJZ A;  2Z59 B;  1ISN A;  4W9L A;  4I6N B;  2L8J A;  4JGH B;  5CTR C;  2ZEQ A;  1E7V A;  4F8C B;  3R7R A;  1BT0 A;  5JZE B;  4DBG A;  3JYU A;  2IBI B;  1F9J A;  3IG3 A;  2LVP A;  4ANW A;  3EFU A;  2GBJ A;  2KLG A;  3GZN I;  3KH0 A;  3NZS A;  3IBE A;  2EMT A;  3PVL A;  2HTH A;  4FN2 A;  2LXA A;  3HM3 A;  3PSE B;  4FLH A;  2N7D A;  2EKE C;  4J6I A;  5AEK B;  2K8B A;  2KMA A;  3K9O B;  5DPS A;  2IO1 B;  1OTR B;  3R3M A;  4B9K A;  2OOB B;  2MWS B;  3HM6 X;  4HCN B;  5CHF A;  1IP9 A;  4GDL B;  4DXA B;  2OJR A;  3L08 A;  1YX6 B;  2D11 A;  3JVZ X;  1S1Q B;  1V81 A;  3L10 B;  3KYD D;  5J2R A;  4W9J A;  2O6V A;  4IM0 A;  3QX1 A;  4W9G A;  4MSQ B;  1RAX A;  4MDK E;  4A20 A;  1WY8 A;  3P2B A;  2MX2 A;  2ZPY A;  1P98 A;  2DZJ A;  4NPN A;  4E71 A;  4KDL B;  3A1Q A;  2KDI A;  2KO3 A;  4HPL B;  4MJS A;  1A5R A;  2J0M A;  3TL5 A;  2JUO A;  3RUL A;  3T8M A;  2KC2 A;  1V86 A;  3R66 C;  3B08 A;  1WI0 A;  2O2V B;  5DPT A;  1ZW7 A;  3PV1 A;  2G45 B;  3U8Z A;  1V9J A;  2K8C A;  2CHX A;  3DBR I;  4W9K A;  1U4A A;  3M63 B;  1WMH B;  2PEA A;  3PGE A;  1TGZ B;  2KHW B;  4RM9 A;  3H7P A;  3HHM A;  3A4R A;  1GNU A;  3U7D A;  3ZVV A;  4FJZ A;  2JRI B;  4K7U A;  2BWE S;  2L05 A;  3AU4 A;  3QCA A;  1E8X A;  1OEY A;  1WX7 A;  2FID A;  3TCA A;  2BKR B;  2BPS A;  3M62 B;  1LFD A;  2CS4 A;  2DYB A;  1E8Z A;  4AOF A;  1WRD B;  3JSV B;  1Q1O A;  2C7N B;  3VAW A;  3QA8 A;  2REX A;  1QZE A;  2PE6 B;  2K6Q A;  2D07 B;  2GBR A;  2JT4 B;  3DPD A;  2KWV B;  2NVU I;  4IWP A;  2LI5 A;  1V2Y A;  3CSF A;  4BVU C;  2KJ6 A;  3DQV A;  2GMI C;  4ASW C;  3MJW A;  3PHX B;  3WIM A;  3WAM A;  4F7Z A;  3PRM B;  3ZRC A;  1GJZ A;  1EUV B;  1P0R A;  4IC7 B;  1KLV A;  2WDT B;  4CYE A;  3H7S A;  1D3Z A;  1YX5 B;  2JPH A;  5AZH A;  4NJ7 A;  2DX5 B;  3T9L A;  3QQ8 B;  1NI2 A;  2IYD B;  3UIP B;  3DBL I;  2WWZ A;  3IHP C;  1I35 A;  1LXD A;  2IO3 B;  4GB9 A;  3ZTC A;  2N9E B;  3V60 A;  2WYQ A;  4FHJ A;  1I42 A;  2AWT A;  3UQB A;  4DWF A;  2LRW A;  4FAD A;  4WWN A;  1IYF A;  4AJY B;  1V5T A;  3EHV A;  4MSM B;  3OLM D;  4KIK B;  5CX3 A;  1WR1 A;  3KYC D;  2HJ8 A;  1WGY A;  3M3J A;  1VCB A;  4W9F A;  1WXM A;  3A9K B;  4XZ4 A;  5GMV A;  2PPH A;  3N32 A;  2I1K A;  3RZW C;  5G2N A;  5IA7 A;  2BF8 B;  1UEL A;  2KWC A;  4E3C A;  3V6E B;  3HIZ A;  2V3S A;  4LDT B;  1WXS A;  3PLV A;  1KOT A;  1Q5W B;  4BKS A;  2HE7 A;  2WX1 A;  3A9J B;  1WXV A;  2L76 A;  1KM7 A;  1LM8 B;  1UBI A;  2KAN A;  2MP2 A;  3PPA A;  4PYZ A;  2M1M A;  4EZJ A;  3W1S A;  4NJ6 A;  2BYE A;  4OVU A;  1NBF C;  3ONS A;  3W1Y A;  2R2O A;  5JHA A;  3WAP A;  3VFK A;  4DHZ E;  3RZF A;  1AAR A;  1Z2M A;  2B3A A;  3VHT C;  2G4S A;  2KTF A;  3B0A A;  1K8R B;  3A33 B;  3L54 A;  2CR5 A;  4K7S A;  4F1S A;  1XT9 B;  3L17 A;  1RLF A;  1SIF A;  4MM3 A;  2ZVO A;  4EZL A;  2KXJ A;  2KWU B;  4P7I A;  1E8W A;  4AUQ C;  3APF A;  3PRP B;  1Y8R C;  4W9I A;  2ZNV C;  1PQS A;  4LDT D;  2N1V A;  2PJH A;  1OGW A;  1WH3 A;  4A3O A;  2GBN A;  3RYT A;  3WAO A;  1SE9 A;  4FHK A;  3R7Q A;  1P1A A;  2KQS A;  4HJK A;  3GOE A;  1WXA A;  4ZDV A;  1WFY A;  4GSW A;  3NHE B;  5D2M B;  1J8C A;  2JY6 A;  2ZCC A;  2QHO A;  4HCP B;  3APC A;  4KDI C;  3V61 A;  4GMV A;  1WJ6 A;  1RFA A;  2Z0D B;  3ML8 A;  4GXB A;  4HDO A;  3WAL A;  2XEW A;  3VXW A;  4GU2 A;  3X23 A;  4YL8 A;  2LXC A;  1Q0W B;  4CO7 A;  2R2Q A;  2N9P C;  2Y5B B;  1OQY A;  4JQW C;  4ANX A;  1YQB A;  2DAJ A;  3QK0 A;  3I3T B;  4G50 A;  4GDK A;  2ZPN A;  3L16 A;  2PE9 A;  4GDL A;  1JRU A;  4KZC A;  4NQK E;  1WYW B;  3PTF C;  2DZM A;  3VH4 B;  1UGM A;  2KDB A;  4HK2 A;  2MQJ A;  2KFK A;  4M8M A;  3B1L X;  3ZLZ A;  3ZUN A;  4MJS B;  2KDE B;  2FCS A;  4K81 A;  5D7G A;  4BBN F;  2LZ6 A;  3APD A;  4IUM B;  4K1R B;  3JW0 X;  4IWO A;  4KSL C;  4EOY A;  2GBM A;  3UGB B;  3CST A;  2L7R A;  4ANU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...