1Z5SB

Crystal structure of a complex between ubc9, sumo-1, rangap1 and nup358/ranbp2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Insights into E3 ligase activity revealed by a SUMO-RanGAP1-Ubc9-Nup358 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1z5sB00
3DBSA 3PRZA 4TV3A 4B95A 1TZ1A 4HCPB 2MRPA 2A5UA 4OVVA 2M4NA 2ZVOA 2N9PC 3PT2B 3CSFA 2MP2B 3PRMB 2CHXA 1WY8A 3PGEA 1TBEA 3PVLA 2DZMA 4HCNB 4DK5A 1GNUA 4MJSB 2LUEA 1TTNA 3HHMA 4HDOA 4W9GA 3ZLZA 2XK5A 3OJ3A 1C3TA 5CHWA 4JQWC 2DAFA 2KQSA 4EZJA 3H7SA 3ZRFA 1RRBA 4G0NB 3UINB 1NBFC 3VTVA 4MSMB 1WGRA 2MP2A 1J0GA 1WF9A 3ENEA 1R4NI 2FNJB 2KDBA 2MA9B 5CHFA 4MJSA 2MWSB 3ZO5B 1LFDA 1UGMA 4KZCA 2ZPNA 1AARA 1XQQA 3AU5A 3KVFB 2MW5A 3DOWA 2G4DB 4JIOU 3ZNZB 1ZKHA 3HM3A 3X0WA 4E3CA 3P2BA 1OTRB 4AWJA 3V6EB 1Z2MA 4LDTB 4E74A 3EC8A 3VVWB 1WGGA 1K8RB 1UBIA 2BKRB 2XEWA 1ZW7A 2ASQA 4FN2A 3ZVVA 3PHXB 3ZW3A 4G3XB 3V62A 3PREA 4MGYE 1E8YA 2VRRB 2N1WA 2DENB 4HJKA 3UF8A 4BBNC 1WXVA 3H9DA 1V5TA 2I1KA 4FJZA 5E6NA 3CF6E 3TCAA 4K1RB 2JWZA 1F9JA 1LM8B 4J6IA 2NCNA 3RULA 4ANXA 5LXHA 1E7VA 2DYMA 5G55A 5CTRC 4GN1A 4IM2A 3IVFA 1UZXB 4NQKE 4FHJA 4AUQC 4ANWA 2W9NA 4ICVA 4XZ4A 2NPTB 3V60A 1WJ6A 2KMCA 3DQVA 2KX3A 3C0RB 2K39A 3R7RA 4ANVA 1WMHB 4DHJD 4FADA 2GBNA 4IWPA 3N30A 2MQJA 2GBMA 4W9DA 1Q5WB 2KKCA 3RD2A 2N9EB 3A9KB 3TBLD 2RSUA 2LRWA 2C9WB 2NPTA 4MSQB 4W9KA 3DVNU 2K6QA 1WMHA 1X1MA 1P1AA 2KWVB 3B08A 3ZIMA 4ASWC 2A4ZA 2GBJA 2KK8A 2FAZA 1WXAA 5TR5A 5KHOA 3VFKA 2MX2A 3A9KA 3L17A 1G6JA 1H8CA 4MGZE 1PQSA 4GSWA 2O2VB 1P98A 2L05A 2MBQA 2AYOB 4IUMB 4PS8A 2UWQA 1D3ZA 2PJHA 2O6VA 3NY5A 4DBGA 1WX9A 3WAMA 2V3SA 1WYWB 1WZ0A 2KO3A 4G50A 5D6JB 3TIXA 1A5RA 2BKFA 2O2VA 4M8MA 1EF5A 5AZGA 2IO1B 2KLCA 2IO2B 2LJ5A 4MM3A 2IO3B 2JZ3B 1I42A 3WANA 2LGDA 3T9LA 1E5WA 4ZYNA 1SGHA 2NBUA 3UIOB 4TKNA 3KUCB 4CO7A 1IP9A 4HVBA 5AEKB 2LASA 4FLHA 5JZEB 1M94A 3QK0A 3QJZA 4GDLA 2IZVB 1Y8RC 2DZJA 4HDQA 2AL3A 3K9OB 1ISNA 2DAJA 4WAAA 3NS8A 4MELA 5D2MB 4EZLA 3H7PB 3PPAA 2BYVE 1V81A 3W1SA 4NY0A 3S2AA 1R4MI 4AJWA 2NBWB 2DYBA 5J17A 4KDLB 1UD7A 1WFYA 2B3AA 1V2YA 4P7IA 3GZNI 3QIJA 5E6PA 2KWCA 5GMVA 2KC1A 2R2OA 2NBVB 2LVPA 2L8JA 3QQ8B 5D94A 2LGYA 3H7PA 3HM6X 3A1QB 1WE6A 1P3QU 2C7MB 2CR5A 2V4LA 5KHQA 3VH4B 4HK2A 3UQAA 3ZDMC 2G45B 4ANUA 3NHEB 1C1YB 1KM7A 2GBKA 3EHVA 2BWFA 3A33B 2ZPYA 2PEAA 4IW0A 1RAXA 3ECIA 1GG3A 3PRPB 4WJOA 3L0WB 4GMVA 2HJ8A 2JUOA 2ZZPB 4GXBA 4YL8A 2M1MA 2BGFA 3A1QA 1WM2A 2J7QB 5J18A 1E7UA 5FR6A 3VAWA 4HPMB 2JF5A 4IWQA 2UYZB 1CMXB 3IBEA 3W1SC 2KHWB 4PS7A 3QCAA 2LWPA 1L2NA 3R66C 2L00B 2ZCCA 3DDCB 4EUTA 1OEYJ 5HKHA 2FCSA 2RR9A 2OOBB 3APCA 2JVCA 2D11A 3JW0X 2JZZA 3N3KB 5AZFA 2G4SA 2RPQA 5JHAA 2N4FA 1ZGUB 3SHQA 4F1SA 2CU1A 2WYQA 3UIPB 3MJWA 3KYCD 2BWES 1H4RA 1WJNA 4FULA 4BKSA 2KFJA 1WR1A 4IM0A 3DVGX 4II3B 1WXMA 4W9CA 4F7ZA 4FHKA 1BT0A 2Z0DB 2BF8B 3QX1A 4GDKB 2MLBA 5CHVC 2JPHA 2N1VA 1WX8A 5IA7A 3ONSA 1Z5SB 4BOZB 2K6DB 1YD8U 4W9LA 4BFRA 2N9XA 1MG8A 2JT4B 3R7QA 3T8MA 2YVCA 2J0JA 3MHSD 5JHBA 3BY4B 1E8WA 4AOFA 3APDA 3KYDD 3L16A 1OEYA 2OJRA 2KDEB 2LGXA 3R3MA 1WM3A 2L76A 1SE9A 1WZ3A 2I1JA 4HLEA 3W1YA 2AL6A 4ZRKA 1NDDA 4KVGB 1S3SG 4I6PA 3B0AA 4JLCA 4RMAA 2G3QB 1GC6A 2Z59B 4HWIB 1YJ1A 2KDFB 5E6OA 3TMPB 2PE6B 2KDIA 2DX5B 3K9PB 2GBRA 2HD5B 4K81A 3TJPA 4LDTD 5LXIB 2BYFA 2WX0A 2ZNVB 1YX6B 1V86A 4JL9A 4M0WB 3ZTCA 4TQ1A 2CS4A 4JGHB 4NQLB 5DPTA 4XC2A 1EO6A 2FUHB 3U30A 5C23A 2L3ZA 2J0KA 2C7NB 5DCNA 2D2QA 2WX1A 1KLVA 3IG3A 4W9FA 4F8CB 4PYZA 3NZSA 3Q3FA 2KN5A 1U4AA 2KJ6A 1VD2A 1JRUA 3KUZA 1RFAA 3M62B 4IC7B 1VCBA 1Q1OA 3M63B 2DYOA 5G2NA 2KTFA 2C7HA 2KD0A 4EOYA 4PYUA 3VUYA 3WA0A 3ZRCA 3NZUA 2LVQA 4LCDE 3H6NA 3U8ZA 4KSLC 4WWNA 1OGWA 3PHWB 4CYEA 1L7YA 2GOWA 1WX7A 4ZRJA 1E90A 3PLUA 3M95A 3A4RA 3RZWC 3SDLC 2K8CA 3SU8X 3PV1A 1HE8A 4BKTA 2EKEC 2DZIA 3RUIB 3KW5B 2KJRA 1UBQA 3OAWA 1WJ4A 5LLIA 3NOBA 3OLMD 3QAQA 4KIKB 2ZVNA 3GOEA 2JY6A 1WIAA 2O6VD 3L08A 4BBNF 5JH5C 2ZNVC 3N32A 3IHPC 4FJVB 4N9F4 2KQ7A 2CKHB 3DVGY 1WE7A 2FIFA 2FIDA 2KLGA 1E8XA 4ZRIA 2MSED 2LD9A 3I3TB 2KVRA 2WWZA 3AULA 2ZEQA 1YIWA 4KIKA 2FCQA 2HE7A 2L7RA 4KSKC 4WJQA 4BOSC 4FBJB 4URKA 3PLVA 4IG7B 2M8SA 2IY0B 1S1QB 4NAWB 4TUUA 4E71A 3VXWA 1J19A 3HK0A 2N7EA 2KC2A 4RM8A 3PS6A 3V6CB 2IYDB 2XK5B 1XD3B 3PSEB 5BO4B 2KX0A 2GMIC 4K7UA 4DHZE 3VDZA 2LI5A 5DPSA 1V80A 2XBBC 4GIVA 2LXCA 4NAWA 2AEHA 2IBIB 2LXAA 2PE9A 3ML9A 5AZHA 4BKGA 2DHZA 4NJ7A 2AWTA 2BPSA 2N7DA 3WAPA 3WAOA 4W9JA 3A4SC 4NPNA 4FJYA 3UQBA 2K8HA 3AI5A 1WRDB 2NR2A 4DDGD 3RCZA 2MBBB 3TL5A 4DHJB 2FCMA 1Q0WB 3H1UA 3IFWB 4MDKE 2KXJA 3LDZE 2NS5A 1E8ZA 3VUWA 3L54A 2L0TA 3D32A 4MGIE 4EZKA 1V6EA 2EMSA 1YQBA 2HTHA 3DBLI 4BVUC 3VH3B 1WXSA 2CHZA 4X57B 1LXDA 2KTRB 3BINA 2KZRA 4DXAB 3L13A 4K7SA 4DDID 1WGHA 3B1LX 2BYEA 2C60A 5DPRA 5DPWA 1V9JA 3QA8A 3RT3B 4EKUA 3CMMB 3VHTC 1LQBA 1WGYA 2KFKB 3ML8A 3PZDA 3LJ3A 4DWFA 2KTRA 3Q3JA 1P0RA 3ALBA 4MH0E 3QHTA 4GDKA 2KJHB 3ZKJC 4EEWA 2LVOA 2MBEA 4WJPA 3UGBB 4MEMA 4XX5A 2WDTB 3ZUNA 3VTWA 2MBOA 1UH6A 2KFKA 1T0YA 3DPDA 2MCNB 1EUVB 4I6LB 2REXA 2J0MA 3ZTDA 4A20A 3JVZX 2Z0EB 1V49A 1NI2A 1XT9B 2K25A 1WI0A 3JYUA 1FXTB 2D3GA 2NVUI 3SD5A 4KV2A 4RM9A 4BKSD 3QARA 4WWPA 3L10B 4G11A 3HIZA 2D10A 4WQOB 4MGKE 4IM3A 1IPGA 2LZ6A 2IY1B 3QC8B 4A3PA 1I35A 4EFOA 2K1FA 1WGDA 2YLMA 4CHKA 2D07B 2PPHA 4FA6A 1TGZB 2LRUA 2KANA 3A9JB 4NNJB 3X23A 3KH0A 3OJ4B 4I6NB 4LJPB 3U7DA 3CSTA 3AXCA 4GB9A 4ICUA 2V1YA 4M8NA 2O6VB 1UELA 1GUAB 2JXXA 2ZJDA 2R2QA 5CX3A 5D7GA 3RYTA 1V5OA 4GOCA 5EDSA 4W9HA 3EECA 2JRHA 3EFUA 3A9JA 3VQIA 4AJYB 5J2RA 1KOTA 3DVNV 1SIFA 2M17A 4A3OA 2KOXA 4W9IA 1IYFA 4B9KA 3MTNB 3ZNGC 1QZEA 3APFA 3KUDB 4DHZB 3O65B 3JSVB 4AP4C 2Y5BB 2FCNA 4W9EA 2C5LC 3VUXA 5L83A 1GJZA 2DZKA 4IWOA 3ZNID 4II2B 1WR6E 1RLFA 2RGFA 3QWZB 2KMAA 2MBHA 1OQYA 3V61A 4KDIC 4GDLB 3ZDTA 1J8CA 2EMTA 2QHOA 2K8BA 2JRIB 4GGQA 3RZFA 3JSVA 3ZNHB 2L0FA 3AU4A 4HPLB 4NJ6A 1WJUA 1EF1A 1YX5B 4ZDVA 1GC7A 4KZ0A 2CHWA 2KNBA 5C1ZA 2RD0A 4TQ0A 4OVUA 4GU2A 4HXDA 4B6WA 1WH3A 1KJTA 3DBHI 4WWOA 2ZCBA 5L95C 3DBRI 4WJNA 1P9DU 2IO0B 2M0XA 4K7WA 3WALA 5IAAC 3DCGA 4PS3A 3WIMA 4LJOB 3PTFC 3M3JA 3VTUA 2KWUB
chains in the Genus database with same CATH superfamily
1DYQA 4TV3A 2MRPA 3PT2B 2BB6A 3ZLZA 4HJGE 2XK5A 2MHJA 1C3TA 1N62A 1VDVA 2KQSA 3H7SA 1RRBA 4G0NB 1WGRA 3ENEA 1XF5L 1FFVA 2FNJB 2QEJC 2KDBA 3Q6BA 2MWSB 1LFDA 4KZCA 1XQQA 2INDC 1SF0A 3X0WA 2VH1A 1OTRB 1K8RB 1PGBA 2ASQA 1D5ZC 3PHXB 3ZW3A 1KLUD 3V62A 4MGYE 2R61A 1D6EC 2N1WA 3NVYA 2WDRB 4FJZA 1ET6A 1MHHE 4K1RB 2DYMA 1IGCA 4ANWA 2KMCA 4WH4A 3C0RB 3R7RA 1YJIA 4ANVA 4DHJD 3N30A 2MQJA 2X8XX 1GOZA 4W9DA 2KKCA 2N9EB 2RSUA 2LRWA 2C9WB 3NVZA 4MSQB 3E9SA 4R3DA 1VRAB 2V3NA 1DOIA 1WGKA 4ASWC 1BUIC 3GE3C 1FRDA 5KHOA 4YTPB 2MX2A 1H8CA 3MP9A 1PQSA 4MACA 2O2VB 1K50A 2MBQA 1FD6A 4IUMB 4PS8A 2UWQA 2PJHA 1WX9A 1WYWB 1WZ0A 1K52A 2BKFA 2WXRA 3T9LA 4CO7A 5AEKB 4FLHA 3QK0A 1YN5A 1C4CA 2AL3A 3NS8A 3W1SA 3S2AA 4A6QA 5IOIA 2IGDA 2BS2B 1WFYA 1GB1A 3QIJA 5E6PA 5GMVA 3DWMA 2L8JA 3ZJVA 1IGDA 2C7MB 2CR5A 4AS1A 3VH4B 3LYYA 1KM7A 1RAXA 3UI3A 1T3QA 3L0WB 4GMVA 4YL8A 2M1MA 3A1QA 2KVZA 2JF5A 2D3CA 2HJ1A 3ZQ4A 2KHWB 4P1BC 3SFDB 1YJJA 3DDCB 4EUTA 3TSSA 3JW0X 5AZFA 5JHAA 2N4FA 1ZGUB 3SHQA 3I9V1 3MJWA 5E6JA 1WJNA 4FULA 4BKSA 2KFJA 3I63C 3DVGX 1EM7A 3V05A 3ZYYX 3B9JA 3KLSX 3ONSA 1YD8U 2BYTA 1AWDA 3AE3B 2J42A 5JHBA 5G5HA 3BY4B 4AOFA 3APDA 2OJRA 4LLGM 2L76A 1SE9A 1WZ3A 5IKCM 3W1YA 4CQNA 1NDDA 1S3SG 2G3QB 1GC6A 4MH8A 1YJ1A 3NRZA 1UUPA 2DX5B 4K81A 2ZW1A 1GAQB 2X38A 3T3NA 1FEHA 2ZNVB 4JL9A 3BYTB 4M0WB 4P1CC 4US9A 4XC2A 2GLSA 1YMHE 2M19A 2FUHB 2J0KA 4OZCA 1HTOA 4HRSA 3NZSA 1FXAA 1FO4A 2EELA 2PTLA 4PK1A 1EU4A 2KD0A 4EOYA 1E7PB 2LVQA 4KSLC 1OGWA 4USAA 2GOWA 1QOFA 1C4AA 3RZWC 3SDLC 1L0VB 2K8CA 1TS4A 4BKTA 2DZIA 2KJRA 1LO5D 3OAWA 1WJ4A 3NOBA 1XO3A 2K9XA 1MG4A 4BBNF 1WIAA 2O6VD 1XEEA 2KQ7A 1TS5A 2FIFA 2KLGA 5AUIA 2MSED 2LD9A 2WWZA 3AULA 1ESFA 5H92C 4N58A 1L0YB 2JQRB 1J19A 3Q3OC 2KC2A 3V6CB 3MC8A 1VZ6A 3DWGC 4ZYSA 1ZXIA 1QKZA 1V1PA 2CJOA 4NAWA 2PE9A 3ML9A 5AZHA 2Q5WD 2N9KA 3WAPA 3GS2A 2WDQB 1ZPSA 2KT7A 1UWXA 1ZXHA 2W54A 3H8HA 1V6EA 2HTHA 4BVUC 2WU2B 3RNEC 1ZOYB 3HRDD 5DPRA 3IXSA 1OFFA 2KFKB 2KTRA 1P0RA 4EEWA 4MEMA 1JW9D 4B0EA 1JWSD 2MBOA 1EUVB 2REXA 4A20A 1NI2A 2WU5B 2G1EA 2N7JA 4WWPA 3L10B 2D10A 2LEKA 2IY1B 4H2AA 1I35A 4EFOA 2YLMA 1N61A 1WGDA 2D07B 3TUOA 3BVZA 3DBHB 5FR3A 3TEXA 3KH0A 4KX6B 3EFCA 1UELA 1GUAB 2DBYA 4W9HA 1KOTA 1NI3A 1SIFA 3U4EG 1DGJA 2KOXA 3ZNGC 4DHZB 3EGRA 2XN9C 4W9EA 3VUXA 3ZNID 4IWOA 1XLPA 1WR6E 1RLFA 1OQYA 3V61A 3C8YA 4GDLB 2L32A 3ZDTA 2QHOA 2L0FA 1EF1A 3DHIC 3AEAB 4J3OD 2SAKA 4KZ0A 1HTQA 1Y56A 4HXDA 2WNMA 1WH3A 2WXJA 3DBHI 4WJNA 2LGIA 2IO0B 2M0XA 5BYRA 4LJOB 3PTFC 3VTUA 3EUB2 4GLSC 3AMZA 1N6ZA 2A5UA 1FNVA 2MJ3A 2J53A 3IAS1 4ZOHC 1I4RA 4HKZE 2CHXA 2WXPA 3PVLA 1T6BX 1GNUA 2LUEA 1PYWD 3OJ3A 4RF1A 4EZJA 2JYTA 3ZRFA 1EU3A 2RMMA 3VTVA 2HDEA 2MP2A 2Y5CA 4MJSA 1XLOA 1UGMA 1AARA 3AU5A 3KVFB 1I4QA 2VZKD 1T0QC 2KACA 3J9CA 1B1ZA 3P2BA 3R2IA 1FFUA 4AWJA 3Q3NC 3V6EB 4LDTB 1JWBD 1WGGA 2BKRB 1F0ZA 5C3JB 1E8YA 4QAYA 2QJLA 2DENB 1L6UA 2SEBD 1L5PA 4IDIA 4DXFA 3CF6E 3TCAA 2WQYB 1F9JA 1LM8B 3MJ5A 2NCNA 3RULA 2KYWA 5CTRC 4GN1A 4NQKE 2W9NA 4JWSC 2K39A 3Q69A 1FIQA 2GBMA 1NVID 4KKIA 4B0MA 3BYYB 3TBLD 4YT0B 2NPTA 4W9KA 1WMHA 1R4MB 2KK8A 4DXGA 1WXAA 1YN3A 3A9KA 4GSWA 2L05A 2AYOB 1I7HA 3NY5A 1MVKA 4DBGA 2JSVX 4G50A 3P4SB 5D6JB 3TIXA 3Q3MC 5AZGA 1EF5A 2IO2B 3AEBB 2QC8A 1PGXA 2NBUA 3UIOB 3KUCB 1XLNA 1PUTA 1QLBB 1M94A 3Q2AC 1WYGA 3NVVA 4GDLA 2IZVB 1Y8RC 4HDQA 5FK9C 1SE3A 2DAJA 5D2MB 4EZLA 3PPAA 3AE1B 4NAMA 2MH7A 1R4MI 4LNKA 2DYBA 1BMLC 5J17A 1TIFA 3GZNI 1NEKB 2NBVB 5D94A 2LGYA 3H7PA 3HM6X 3A1QB 1WE6A 5KHQA 1GPXA 3UQAA 1PFDA 2G45B 4ANUA 1C1YB 4C80A 3EHVA 2ZPYA 2H89B 3PRPB 1GG3A 4WJOA 4GXBA 3NZ3A 2BB5A 2BGFA 5J18A 5FR6A 4IWQA 2UYZB 3AEDB 2D3AA 3QCAA 2LWPA 1GB4A 5HKHA 1OEYJ 3AE8B 2PW9A 2RR9A 2OJWA 1YN4A 2JVCA 2D11A 3N3KB 2JZZA 3RN9C 2G4SA 2CU1A 4OZAA 1N63A 1YNTE 3KYCD 1F2RC 3BVGA 1H4RA 1WR1A 2WXKA 3OG5A 4II3B 1ZDXA 4W9CA 1NYQA 2Z0DB 4GDKB 4DQOC 3CIRB 4C56C 2QILA 4BFRA 2N9XA 3TEWA 1LGRA 3R7QA 1TT5B 3AE2B 2AX5A 1FXIA 4OW0A 3P4QB 1UWMA 2LGSA 4JLCA 4WAFA 2Z59B 4HWIB 4TSSA 2PE6B 2KDIA 3V3XA 1KF6B 5TSSA 2OHFA 2BYFA 4XDDA 1TY2A 4NJCA 4JGHB 2L1AA 1EO6A 2QCZA 3U30A 3FAHA 5C23A 2L3ZA 3BZDB 3N1YC 2C7NB 1KLVA 4F8CB 4ZRPA 2KN5A 1U4AA 5BMIA 3O13A 2KJ6A 1JRUA 2M56B 1C79A 4IC7B 1UNSA 2DYOA 4LNFA 2C7HA 3VUYA 1K53A 1TJEA 3A4RA 1XCQL 2EKEC 2PVOD 3RUIB 1UBQA 5LLIA 3OLMD 3QAQA 2JY6A 3R8BA 1CZPA 2ZNVC 1E9MA 3IHPC 4FJVB 3SR6A 3NJTA 4KKJA 3N20C 3DVGY 3P42A 4JPSA 3I3TB 2G9HD 2KVRA 1TKGA 1VLBA 4KIKA 2FCQA 4KSKC 1V1PB 3PLVA 2IY0B 1S1QB 2PIAA 4NAWB 4TUUA 4RNAA 3FC4A 4ARCA 2W82A 1XD3B 2GMIC 4K7UA 3EA6A 3RMKC 1V80A 4GIVA 3KWVA 4YSXB 2AEHA 2LXAA 2BPSA 3SFEB 3BVMA 3A4SC 4NPNA 2HTME 4RCOA 1WRDB 3BK1A 1XLQA 4JE3B 4NZLB 1FCLA 3B2FA 3Q14C 1WXSA 4X57B 2KTRB 3BINA 2KZRA 4DXAB 3R2TA 3B1LX 3ZXVA 3BWUD 5DPWA 3QA8A 3RT3B 3W2DA 3VHTC 4WWMA 3ML8A 3VR8B 2WP9B 3LJ3A 3BIID 1RWSA 3QHTA 3FILA 4GDKA 1JWMD 2LVOA 2MBEA 2PVGC 3FKYA 3VTWA 1D5MC 1T0YA 3ZJUA 1V1OA 4I6LB 2Z0EB 2NVUI 3SD5A 3QARA 5EE9A 4G11A 1QT9A 2Y5PA 3AECB 1QILA 2N9LA 2LZ6A 2AQ1B 4IKGA 2PPHA 3OJ4B 4LJPB 2BVCA 3U7DA 1ZE3D 2O6VB 2ZJDA 5D7GA 3DHGC 2JRHA 3EFUA 2CU3A 2Y3AA 2M17A 2RPVA 3MTNB 4YXDB 2C5LC 1TKEA 2RGFA 2JXTA 4KDIC 3P1MA 1J8CA 3RNAC 2EMTA 1R4NB 2KMMA 3RZFA 2RDBC 1PGAA 1Q10A 1SEBD 2I2YA 1GC7A 2WXNA 1JWUD 1SE4A 4GU2A 1AW7A 1KJTA 2GB1A 2ZCBA 4L1BA 1P9DU 3DCGA 2NMQA 3M3JA 4B95A 1TZ1A 2JWUA 3AE6B 2M0AA 3NS1A 2N9PC 2MP2B 1WY8A 2Z8LA 3PGEA 1TBEA 2DZMA 4DK5A 4MJSB 1TTNA 3HHMA 1J7CA 4W9GA 1JRPA 5CHWA 4JQWC 5AUKA 1I4GA 1HA5A 3UINB 1NBFC 4MSMB 4TMAB 1J0GA 1R4NI 2QSDA 2MA9B 2QDFA 5CHFA 4KGSA 4O1NA 2ZPNA 1VJKA 4A55A 2MW5A 2NTSA 4P6VF 3BK2A 2QIEB 4E3CA 3HM3A 4M00A 1NYRA 3VVWB 1UBIA 2XEWA 5HHDG 1ZW7A 3ZVVA 4G3XB 3Q8CA 2RDHA 4RFBA 4BBNC 1VZ7A 3H9DA 1V5TA 1QQRA 2K0PA 1KRHA 4J6IA 5LXHA 1L0XB 1ZDVA 5G55A 3MHZA 1UZXB 4FHJA 4ICVA 1L4DB 4XZ4A 2NPTB 1WJ6A 3AN1A 1WMHB 4FADA 3MC9A 4IWPA 1HEZE 1Q5WB 2KQ4X 3RD2A 1RFKA 3A9KB 2WXIA 1VZ8A 3DVNU 3WCQA 3CWIA 5BMGA 2KWVB 1P1AA 3ZIMA 2UU7A 2GBJA 2H88B 5TR5A 3VFKA 2FUG1 4MGZE 5HG2A 2WXOA 3OWEB 4D2KA 2O6VA 3URYA 3B2GA 4A9AA 1IUEA 3WAMA 1JALA 2ONQA 4M8MA 4MM3A 2IO3B 2JZ3B 1I42A 5BYSA 1E5WA 2K5PA 1TY0A 3NVWA 2IGGA 4XWWA 4TKNA 2V4IB 1IP9A 2LASA 2DZJA 1TS3A 1CJEA 1V8CA 3K9OB 2WLBA 4WAAA 4MELA 5D3IB 3H7PB 3U7ZA 4JWUC 4AJWA 2V3PA 3AM9A 4P7IA 2MJDA 2KC1A 2R2OA 2VZKB 3QQ8B 1ET9A 2VH2A 2V4LA 4RGMA 3Q8EA 3ZDMC 1FPYA 4EE2A 3NHEB 2GBKA 2BWFA 3A33B 2PEAA 3ECIA 5BMHA 3VR9B 1D4BA 2HJ8A 2JUOA 2ZZPB 3AE4B 3VAWA 4HPMB 1CMXB 1VR9A 3IBEA 3W1SC 1RYJA 3Q8FA 2FCSA 2RPQA 4F1SA 4ARIA 3RNCC 3HUIA 3UIPB 2IPKD 2N0SB 4IM0A 4RF0A 1WXMA 1WRIA 4F7ZA 4FHKA 1BT0A 1OQQA 4WURA 5CHVC 3U2SC 5IA7A 1QOBA 3LXFA 3PZ7A 4W9LA 1MG8A 2JT4B 3T8MA 2BBCA 2J0JA 3MHSD 4YSYB 1BXTA 3KYDD 2KDEB 2LGXA 4ZRKA 4XE0A 2JZPA 3B0AA 1A70A 1J7AA 5FKAC 3TMPB 2INPE 2HD5B 2AQ3B 4LDTD 2WX0A 1V86A 3ZTCA 4TQ1A 3GZNB 2CS4A 4NQLB 2LMCA 2ZW0A 2D2QA 4W9FA 4PYZA 3Q3FA 1V97A 3P4PB 4P16A 1VD2A 1RFAA 1VCBA 1Q1OA 5G2NA 2KTFA 4RGNA 3N1ZC 4OVZA 4PYUA 3ZRCA 3NZUA 3H6NA 3U8ZA 3PHWB 1UGJA 2J52A 4YWGG 1HXYD 1E90A 3M95A 4UDUC 1SIJA 2FE8A 2PLPA 3SU8X 4OHJA 3PV1A 1HE8A 4ACFA 2ICIA 3KW5B 1AYFA 4KIKB 4A90A 3AB5A 2ZVNA 3L08A 1F77A 3DBLB 4LNIA 1NENB 2ZEQA 2HE7A 2L7RA 4FBJB 4BOSC 4IG7B 3ZXRA 2M8SA 4ITKA 1FNWA 3KQ4A 1C4PA 1N5WA 4RM8A 1JWAD 2PKOA 2W55A 2IYDB 3PSEB 4C00A 5BO4B 2KX0A 5IO9A 5GXGB 2W3RA 3VDZA 5DPSA 2LXCA 2IBIB 4BKGA 2DHZA 4NJ7A 3WAOA 4W9JA 2YEPF 4FXCA 1SSNA 2NR2A 3TL5A 4DHJB 3GE8C 2FCMA 3IT6B 4MDKE 3LDZE 3VUWA 1E8ZA 2L0TA 3D32A 4EZKA 3GP7A 2EMSA 1YQBA 3DBLI 3VH3B 4ZHPA 1LXDA 2INNE 2BW2A 4K7SA 1WGHA 3FILB 2BYEA 4EKUA 3CMMB 2PMVA 2WS3B 4DWFA 3Q3JA 1C9FA 2KJHB 3AV8A 4KGTA 1ENFA 1DOXA 4WJPA 4XX5A 2WDTB 3ZUNA 3DPDA 2J0MA 1V49A 2LJIA 2K25A 1WI0A 1E10A 3JYUA 1FXTB 1MI0A 4BKSD 4RM9A 3NUHB 2AQ2B 2INCC 3HIZA 1WWTA 4YTNB 1SB3C 4MGKE 4IM3A 2MEKA 2K1FA 1TGZB 3DBRB 1T0SC 1YQ4B 1I4XA 3AXCA 1L4ZB 4GB9A 4ICUA 2ON8A 4M8NA 5CX3A 2JXXA 2WGSA 2R2QA 1KFYB 4GOCA 3A9JA 3DVNV 2V9HA 5D3DA 1IYFA 4B9KA 3APFA 3KUDB 1FMAD 2J4XA 2FCNA 1GJZA 4II2B 1N5XA 2WXGA 3RNFC 5IN7A 1HZ6A 2KMAA 2MBHA 3SEBA 1SJED 2D5GA 4WQMA 3JSVA 3ZNHB 2WHIA 4NJ6A 4S17A 1WJUA 1FM0D 5JXVA 4LK0M 5LNK1 2CHWA 2KNBA 2IGHA 4Q2JA 4TQ0A 4OVUA 1F1HA 4WWOA 3DBRI 1K51A 4K7WA 5IAAC 4PS3A 5EE3A 2K3UA 2KWUB 3W9CB 3W5UB 3DBSA 3PRZA 4WIPA 4HCPB 1J7BA 4RGTA 4OVVA 1IBXB 2M4NA 2ZVOA 3CSFA 3PRMB 4HCNB 2WXQA 4HDOA 3NG0A 2DAFA 3W5VB 1WF9A 4C4VB 3ZO5B 1D5XC 1WSPA 2WXMA 5HI1A 3DOWA 3RNGC 2G4DB 3N1XC 4JIOU 3ZNZB 1ZKHA 2WXLA 2IDYA 1SBBB 1Z2MA 4E74A 2L83A 3EC8A 2YEPB 4FN2A 1L6VA 3PREA 2VRRB 1F2RI 4HJKA 1UF0A 3UF8A 1WXVA 4S0RA 2I1KA 1M4VA 5E6NA 2JWZA 1P7FA 2K22A 4ANXA 1E7VA 5C2TB 3RNBC 2QMTA 3AEGB 4IM2A 3IVFA 1ZP0B 1KH0A 4AUQC 3V60A 1XXGA 1N60A 3DQVA 2KX3A 3HVDA 1C76A 2JU6X 2GBNA 5EE0A 3L4PA 2K6QA 1X1MA 4AQ7A 3B08A 2BS3B 2A4ZA 2FAZA 1FNUA 4XWTA 3ZGZA 3L17A 1G6JA 2L52A 1P98A 3RFZB 4MM3B 1D3ZA 4PT5A 4US8A 2OEDA 2V3SA 3AE9B 2KO3A 2JX5A 4LNOA 1A5RA 2O2VA 2KAJA 2IO1B 2KLCA 2LJ5A 3WANA 2LGDA 1CK1A 4ZYNA 5BYQA 1SGHA 1PDXA 3LB8C 4IOIE 4HVBA 5JZEB 3QJZA 2IJ0A 4MT5A 1ISNA 3RI7C 3TEZA 3PO0A 2BYVE 1V81A 2KN4A 4NY0A 2GI9A 2NBWB 4YSZB 4L2YA 4KDLB 1UD7A 2B3AA 1V2YA 3VRAB 2KWCA 2LVPA 5IP4D 1P3QU 4HK2A 4N6EB 4K3BA 4IW0A 2LHEA 1IBXA 1WM2A 2J7QB 1E7UA 1ZUD2 2V0GA 2D3BA 1CQVA 2KDMA 1TYGB 2LHDA 1MHXA 4PS7A 1L2NA 1HZ5A 3R66C 2L00B 2ZCCA 2LFIA 2OOBB 3APCA 4OZBA 4C4VA 4REZA 1WXQA 3T3OA 4LTUA 3TEYA 2WYQA 2BWES 3I57A 1SXTA 1YOVB 2BF8B 3QX1A 2MLBA 3I5JC 2JPHA 1SE2A 1WX8A 2N1VA 1T5XD 1Z5SB 1E6EB 4BOZB 2BTEA 2K6DB 5MPOA 1T0RC 1TZOA 1ACCA 2YVCA 3AE5B 3DHHC 1E8WA 3L16A 1OEYA 3R3MA 1WM3A 1DOYA 2I1JA 4HLEA 2AL6A 3PZ8A 4KVGB 2TSSA 4I6PA 2W3SA 4RMAA 3MC0B 5E6OA 2KDFB 3IAM1 3K9PB 2GBRA 3TJPA 2BT6A 2LUMA 4ZRQA 5LXIB 1YX6B 4RGOS 5DPTA 1ROEA 2RDGA 3AEEB 2WXHA 5DCNA 2WX1A 3IG3A 4ZHOA 4M0WA 4RH6A 3ABVB 2FBWB 2E3TA 3KUZA 3M62B 3M63B 4L23A 3WA0A 1KLGD 4LCDE 4WWNA 4CYEA 3Q8BA 1L7YA 1OQRA 1WX7A 4ZRJA 3PLUA 2DLBA 4BAXA 4HPPA 1C78A 1I4PA 1EWYC 3GOEA 4YTMB 4HKQA 2JYEA 5JH5C 2GRIA 3N32A 4N9F4 1MFWA 2XNAC 2ACZB 2CKHB 1WE7A 2FIDA 4HROA 2BS4B 1E8XA 4ZRIA 1AN8A 1YIWA 4WJQA 4URKA 4LNNA 2CJNA 4E71A 3VXWA 3AE7B 3AH7A 4JX1C 3HK0A 2N7EA 3PS6A 4BZAA 4C7YA 3U52E 2XK5B 2WXFA 4DHZE 2LI5A 3N9YC 2XBBC 1TKYA 1XCTL 2AWTA 2N7DA 1KTKA 4HEA1 3KWLA 3C19A 4FJYA 4KGRA 3UQBA 2BQQA 2K8HA 3AI5A 4DDGD 3RCZA 1YQ3B 2MBBB 2KWDA 1Q0WB 3H1UA 3IFWB 2KXJA 2NS5A 3L54A 4MGIE 5I4DA 5H8YE 2EKIA 2CHZA 4K3CA 3L13A 4DDID 2E6XA 2B76B 2C60A 4M01A 1FRRA 2MJEA 1V9JA 1LQBA 2WDVB 1WGYA 3PZDA 4M02A 3VRBB 3ALBA 4MH0E 1SJHD 1HQRD 3ZKJC 1JCKB 3UGBB 2DWQA 1JROA 2I38A 3P63A 1UH6A 2KFKA 2MCNB 3P4RB 3ZTDA 3JVZX 1XT9B 2D3GA 4KV2A 3AEFB 3E56A 4WQOB 1IPGA 1MPEA 3QC8B 4A3PA 1E0ZA 5G5GA 4CHKA 3RPFC 3GB1A 2NTTA 4FA6A 2LRUA 2KANA 3A9JB 1QOAA 4NNJB 3IT4B 1QOGA 3X23A 4I6NB 1RM6C 3CSTA 2V1YA 3RYTA 3ZJTA 1V5OA 1JMLA 4XDCA 1EWCA 5EDSA 1MJDA 3EECA 3VQIA 5J2RA 1FCCC 4AJYB 5T8IA 5HFYA 4A3OA 1F52A 4W9IA 1QZEA 1JQ4A 1P7EA 3JSVB 1I4HA 2Y5BB 3O65B 4AP4C 5L83A 2DZKA 1B9RA 3QWZB 1R7SA 4N59A 1QF6A 2K8BA 2JRIB 4GGQA 1TS2A 4C7ZA 3AU4A 4HPLB 4XYCA 1C77A 5EE1A 1YX5B 4XGAB 3HVZA 4ZDVA 5C1ZA 2DNFA 2RD0A 3MFGA 4B6WA 4A8XC 5L95C 3Q8AA 3WALA 3WIMA 3ETRA 1STEA
chains in the Genus database with same CATH topology
3DBSA 3PRZA 4TV3A 4B95A 1TZ1A 4HCPB 2MRPA 2A5UA 4OVVA 2M4NA 2ZVOA 2N9PC 3PT2B 3CSFA 2MP2B 3PRMB 2CHXA 1WY8A 3PGEA 1TBEA 3PVLA 2DZMA 4HCNB 4DK5A 1GNUA 4MJSB 2LUEA 1TTNA 3HHMA 4HDOA 4W9GA 3ZLZA 2XK5A 3OJ3A 1C3TA 5CHWA 4JQWC 2DAFA 2KQSA 4EZJA 3H7SA 3ZRFA 1RRBA 4G0NB 3UINB 1NBFC 3VTVA 4MSMB 1WGRA 2MP2A 1J0GA 1WF9A 3ENEA 1R4NI 2FNJB 2KDBA 2MA9B 5CHFA 4MJSA 2MWSB 3ZO5B 1LFDA 1UGMA 4KZCA 2ZPNA 1AARA 1XQQA 3AU5A 3KVFB 2MW5A 3DOWA 2G4DB 4JIOU 3ZNZB 1ZKHA 3HM3A 3X0WA 4E3CA 3P2BA 1OTRB 4AWJA 3V6EB 1Z2MA 4LDTB 4E74A 3EC8A 3VVWB 1WGGA 1K8RB 1UBIA 2BKRB 2XEWA 1ZW7A 2ASQA 4FN2A 3ZVVA 3PHXB 3ZW3A 4G3XB 3V62A 3PREA 4MGYE 1E8YA 2VRRB 2N1WA 2DENB 4HJKA 3UF8A 4BBNC 1WXVA 3H9DA 1V5TA 2I1KA 4FJZA 5E6NA 3CF6E 3TCAA 4K1RB 2JWZA 1F9JA 1LM8B 4J6IA 2NCNA 3RULA 4ANXA 5LXHA 1E7VA 2DYMA 5G55A 5CTRC 4GN1A 4IM2A 3IVFA 1UZXB 4NQKE 4FHJA 4AUQC 4ANWA 2W9NA 4ICVA 4XZ4A 2NPTB 3V60A 1WJ6A 2KMCA 3DQVA 2KX3A 3C0RB 2K39A 3R7RA 4ANVA 1WMHB 4DHJD 4FADA 2GBNA 4IWPA 3N30A 2MQJA 2GBMA 4W9DA 1Q5WB 2KKCA 3RD2A 2N9EB 3A9KB 3TBLD 2RSUA 2LRWA 2C9WB 2NPTA 4MSQB 4W9KA 3DVNU 2K6QA 1WMHA 1X1MA 1P1AA 2KWVB 3B08A 3ZIMA 4ASWC 2A4ZA 2GBJA 2KK8A 2FAZA 1WXAA 5TR5A 5KHOA 3VFKA 2MX2A 3A9KA 3L17A 1G6JA 1H8CA 4MGZE 1PQSA 4GSWA 2O2VB 1P98A 2L05A 2MBQA 2AYOB 4IUMB 4PS8A 2UWQA 1D3ZA 2PJHA 2O6VA 3NY5A 4DBGA 1WX9A 3WAMA 2V3SA 1WYWB 1WZ0A 2KO3A 4G50A 5D6JB 3TIXA 1A5RA 2BKFA 2O2VA 4M8MA 1EF5A 5AZGA 2IO1B 2KLCA 2IO2B 2LJ5A 4MM3A 2IO3B 2JZ3B 1I42A 3WANA 2LGDA 3T9LA 1E5WA 4ZYNA 1SGHA 2NBUA 3UIOB 4TKNA 3KUCB 4CO7A 1IP9A 4HVBA 5AEKB 2LASA 4FLHA 5JZEB 1M94A 3QK0A 3QJZA 4GDLA 2IZVB 1Y8RC 2DZJA 4HDQA 2AL3A 3K9OB 1ISNA 2DAJA 4WAAA 3NS8A 4MELA 5D2MB 4EZLA 3H7PB 3PPAA 2BYVE 1V81A 3W1SA 4NY0A 3S2AA 1R4MI 4AJWA 2NBWB 2DYBA 5J17A 4KDLB 1UD7A 1WFYA 2B3AA 1V2YA 4P7IA 3GZNI 3QIJA 5E6PA 2KWCA 5GMVA 2KC1A 2R2OA 2NBVB 2LVPA 2L8JA 3QQ8B 5D94A 2LGYA 3H7PA 3HM6X 3A1QB 1WE6A 1P3QU 2C7MB 2CR5A 2V4LA 5KHQA 3VH4B 4HK2A 3UQAA 3ZDMC 2G45B 4ANUA 3NHEB 1C1YB 1KM7A 2GBKA 3EHVA 2BWFA 3A33B 2ZPYA 2PEAA 4IW0A 1RAXA 3ECIA 1GG3A 3PRPB 4WJOA 3L0WB 4GMVA 2HJ8A 2JUOA 2ZZPB 4GXBA 4YL8A 2M1MA 2BGFA 3A1QA 1WM2A 2J7QB 5J18A 1E7UA 5FR6A 3VAWA 4HPMB 2JF5A 4IWQA 2UYZB 1CMXB 3IBEA 3W1SC 2KHWB 4PS7A 3QCAA 2LWPA 1L2NA 3R66C 2L00B 2ZCCA 3DDCB 4EUTA 1OEYJ 5HKHA 2FCSA 2RR9A 2OOBB 3APCA 2JVCA 2D11A 3JW0X 2JZZA 3N3KB 5AZFA 2G4SA 2RPQA 5JHAA 2N4FA 1ZGUB 3SHQA 4F1SA 2CU1A 2WYQA 3UIPB 3MJWA 3KYCD 2BWES 1H4RA 1WJNA 4FULA 4BKSA 2KFJA 1WR1A 4IM0A 3DVGX 4II3B 1WXMA 4W9CA 4F7ZA 4FHKA 1BT0A 2Z0DB 2BF8B 3QX1A 4GDKB 2MLBA 5CHVC 2JPHA 2N1VA 1WX8A 5IA7A 3ONSA 1Z5SB 4BOZB 2K6DB 1YD8U 4W9LA 4BFRA 2N9XA 1MG8A 2JT4B 3R7QA 3T8MA 2YVCA 2J0JA 3MHSD 5JHBA 3BY4B 1E8WA 4AOFA 3APDA 3KYDD 3L16A 1OEYA 2OJRA 2KDEB 2LGXA 3R3MA 1WM3A 2L76A 1SE9A 1WZ3A 2I1JA 4HLEA 3W1YA 2AL6A 4ZRKA 1NDDA 4KVGB 1S3SG 4I6PA 3B0AA 4JLCA 4RMAA 2G3QB 1GC6A 2Z59B 4HWIB 1YJ1A 2KDFB 5E6OA 3TMPB 2PE6B 2KDIA 2DX5B 3K9PB 2GBRA 2HD5B 4K81A 3TJPA 4LDTD 5LXIB 2BYFA 2WX0A 2ZNVB 1YX6B 1V86A 4JL9A 4M0WB 3ZTCA 4TQ1A 2CS4A 4JGHB 4NQLB 5DPTA 4XC2A 1EO6A 2FUHB 3U30A 5C23A 2L3ZA 2J0KA 2C7NB 5DCNA 2D2QA 2WX1A 1KLVA 3IG3A 4W9FA 4F8CB 4PYZA 3NZSA 3Q3FA 2KN5A 1U4AA 2KJ6A 1VD2A 1JRUA 3KUZA 1RFAA 3M62B 4IC7B 1VCBA 1Q1OA 3M63B 2DYOA 5G2NA 2KTFA 2C7HA 2KD0A 4EOYA 4PYUA 3VUYA 3WA0A 3ZRCA 3NZUA 2LVQA 4LCDE 3H6NA 3U8ZA 4KSLC 4WWNA 1OGWA 3PHWB 4CYEA 1L7YA 2GOWA 1WX7A 4ZRJA 1E90A 3PLUA 3M95A 3A4RA 3RZWC 3SDLC 2K8CA 3SU8X 3PV1A 1HE8A 4BKTA 2EKEC 2DZIA 3RUIB 3KW5B 2KJRA 1UBQA 3OAWA 1WJ4A 5LLIA 3NOBA 3OLMD 3QAQA 4KIKB 2ZVNA 3GOEA 2JY6A 1WIAA 2O6VD 3L08A 4BBNF 5JH5C 2ZNVC 3N32A 3IHPC 4FJVB 4N9F4 2KQ7A 2CKHB 3DVGY 1WE7A 2FIFA 2FIDA 2KLGA 1E8XA 4ZRIA 2MSED 2LD9A 3I3TB 2KVRA 2WWZA 3AULA 2ZEQA 1YIWA 4KIKA 2FCQA 2HE7A 2L7RA 4KSKC 4WJQA 4BOSC 4FBJB 4URKA 3PLVA 4IG7B 2M8SA 2IY0B 1S1QB 4NAWB 4TUUA 4E71A 3VXWA 1J19A 3HK0A 2N7EA 2KC2A 4RM8A 3PS6A 3V6CB 2IYDB 2XK5B 1XD3B 3PSEB 5BO4B 2KX0A 2GMIC 4K7UA 4DHZE 3VDZA 2LI5A 5DPSA 1V80A 2XBBC 4GIVA 2LXCA 4NAWA 2AEHA 2IBIB 2LXAA 2PE9A 3ML9A 5AZHA 4BKGA 2DHZA 4NJ7A 2AWTA 2BPSA 2N7DA 3WAPA 3WAOA 4W9JA 3A4SC 4NPNA 4FJYA 3UQBA 2K8HA 3AI5A 1WRDB 2NR2A 4DDGD 3RCZA 2MBBB 3TL5A 4DHJB 2FCMA 1Q0WB 3H1UA 3IFWB 4MDKE 2KXJA 3LDZE 2NS5A 1E8ZA 3VUWA 3L54A 2L0TA 3D32A 4MGIE 4EZKA 1V6EA 2EMSA 1YQBA 2HTHA 3DBLI 4BVUC 3VH3B 1WXSA 2CHZA 4X57B 1LXDA 2KTRB 3BINA 2KZRA 4DXAB 3L13A 4K7SA 4DDID 1WGHA 3B1LX 2BYEA 2C60A 5DPRA 5DPWA 1V9JA 3QA8A 3RT3B 4EKUA 3CMMB 3VHTC 1LQBA 1WGYA 2KFKB 3ML8A 3PZDA 3LJ3A 4DWFA 2KTRA 3Q3JA 1P0RA 3ALBA 4MH0E 3QHTA 4GDKA 2KJHB 3ZKJC 4EEWA 2LVOA 2MBEA 4WJPA 3UGBB 4MEMA 4XX5A 2WDTB 3ZUNA 3VTWA 2MBOA 1UH6A 2KFKA 1T0YA 3DPDA 2MCNB 1EUVB 4I6LB 2REXA 2J0MA 3ZTDA 4A20A 3JVZX 2Z0EB 1V49A 1NI2A 1XT9B 2K25A 1WI0A 3JYUA 1FXTB 2D3GA 2NVUI 3SD5A 4KV2A 4RM9A 4BKSD 3QARA 4WWPA 3L10B 4G11A 3HIZA 2D10A 4WQOB 4MGKE 4IM3A 1IPGA 2LZ6A 2IY1B 3QC8B 4A3PA 1I35A 4EFOA 2K1FA 1WGDA 2YLMA 4CHKA 2D07B 2PPHA 4FA6A 1TGZB 2LRUA 2KANA 3A9JB 4NNJB 3X23A 3KH0A 3OJ4B 4I6NB 4LJPB 3U7DA 3CSTA 3AXCA 4GB9A 4ICUA 2V1YA 4M8NA 2O6VB 1UELA 1GUAB 2JXXA 2ZJDA 2R2QA 5CX3A 5D7GA 3RYTA 1V5OA 4GOCA 5EDSA 4W9HA 3EECA 2JRHA 3EFUA 3A9JA 3VQIA 4AJYB 5J2RA 1KOTA 3DVNV 1SIFA 2M17A 4A3OA 2KOXA 4W9IA 1IYFA 4B9KA 3MTNB 3ZNGC 1QZEA 3APFA 3KUDB 4DHZB 3O65B 3JSVB 4AP4C 2Y5BB 2FCNA 4W9EA 2C5LC 3VUXA 5L83A 1GJZA 2DZKA 4IWOA 3ZNID 4II2B 1WR6E 1RLFA 2RGFA 3QWZB 2KMAA 2MBHA 1OQYA 3V61A 4KDIC 4GDLB 3ZDTA 1J8CA 2EMTA 2QHOA 2K8BA 2JRIB 4GGQA 3RZFA 3JSVA 3ZNHB 2L0FA 3AU4A 4HPLB 4NJ6A 1WJUA 1EF1A 1YX5B 4ZDVA 1GC7A 4KZ0A 2CHWA 2KNBA 5C1ZA 2RD0A 4TQ0A 4OVUA 4GU2A 4HXDA 4B6WA 1WH3A 1KJTA 3DBHI 4WWOA 2ZCBA 5L95C 3DBRI 4WJNA 1P9DU 2IO0B 2M0XA 4K7WA 3WALA 5IAAC 3DCGA 4PS3A 3WIMA 4LJOB 3PTFC 3M3JA 3VTUA 2KWUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBS A;  3PRZ A;  4TV3 A;  4B95 A;  1TZ1 A;  4HCP B;  2MRP A;  2A5U A;  4OVV A;  2M4N A;  2ZVO A;  2N9P C;  3PT2 B;  3CSF A;  2MP2 B;  3PRM B;  2CHX A;  1WY8 A;  3PGE A;  1TBE A;  3PVL A;  2DZM A;  4HCN B;  4DK5 A;  1GNU A;  4MJS B;  2LUE A;  1TTN A;  3HHM A;  4HDO A;  4W9G A;  3ZLZ A;  2XK5 A;  3OJ3 A;  1C3T A;  5CHW A;  4JQW C;  2DAF A;  2KQS A;  4EZJ A;  3H7S A;  3ZRF A;  1RRB A;  4G0N B;  3UIN B;  1NBF C;  3VTV A;  4MSM B;  1WGR A;  2MP2 A;  1J0G A;  1WF9 A;  3ENE A;  1R4N I;  2FNJ B;  2KDB A;  2MA9 B;  5CHF A;  4MJS A;  2MWS B;  3ZO5 B;  1LFD A;  1UGM A;  4KZC A;  2ZPN A;  1AAR A;  1XQQ A;  3AU5 A;  3KVF B;  2MW5 A;  3DOW A;  2G4D B;  4JIO U;  3ZNZ B;  1ZKH A;  3HM3 A;  3X0W A;  4E3C A;  3P2B A;  1OTR B;  4AWJ A;  3V6E B;  1Z2M A;  4LDT B;  4E74 A;  3EC8 A;  3VVW B;  1WGG A;  1K8R B;  1UBI A;  2BKR B;  2XEW A;  1ZW7 A;  2ASQ A;  4FN2 A;  3ZVV A;  3PHX B;  3ZW3 A;  4G3X B;  3V62 A;  3PRE A;  4MGY E;  1E8Y A;  2VRR B;  2N1W A;  2DEN B;  4HJK A;  3UF8 A;  4BBN C;  1WXV A;  3H9D A;  1V5T A;  2I1K A;  4FJZ A;  5E6N A;  3CF6 E;  3TCA A;  4K1R B;  2JWZ A;  1F9J A;  1LM8 B;  4J6I A;  2NCN A;  3RUL A;  4ANX A;  5LXH A;  1E7V A;  2DYM A;  5G55 A;  5CTR C;  4GN1 A;  4IM2 A;  3IVF A;  1UZX B;  4NQK E;  4FHJ A;  4AUQ C;  4ANW A;  2W9N A;  4ICV A;  4XZ4 A;  2NPT B;  3V60 A;  1WJ6 A;  2KMC A;  3DQV A;  2KX3 A;  3C0R B;  2K39 A;  3R7R A;  4ANV A;  1WMH B;  4DHJ D;  4FAD A;  2GBN A;  4IWP A;  3N30 A;  2MQJ A;  2GBM A;  4W9D A;  1Q5W B;  2KKC A;  3RD2 A;  2N9E B;  3A9K B;  3TBL D;  2RSU A;  2LRW A;  2C9W B;  2NPT A;  4MSQ B;  4W9K A;  3DVN U;  2K6Q A;  1WMH A;  1X1M A;  1P1A A;  2KWV B;  3B08 A;  3ZIM A;  4ASW C;  2A4Z A;  2GBJ A;  2KK8 A;  2FAZ A;  1WXA A;  5TR5 A;  5KHO A;  3VFK A;  2MX2 A;  3A9K A;  3L17 A;  1G6J A;  1H8C A;  4MGZ E;  1PQS A;  4GSW A;  2O2V B;  1P98 A;  2L05 A;  2MBQ A;  2AYO B;  4IUM B;  4PS8 A;  2UWQ A;  1D3Z A;  2PJH A;  2O6V A;  3NY5 A;  4DBG A;  1WX9 A;  3WAM A;  2V3S A;  1WYW B;  1WZ0 A;  2KO3 A;  4G50 A;  5D6J B;  3TIX A;  1A5R A;  2BKF A;  2O2V A;  4M8M A;  1EF5 A;  5AZG A;  2IO1 B;  2KLC A;  2IO2 B;  2LJ5 A;  4MM3 A;  2IO3 B;  2JZ3 B;  1I42 A;  3WAN A;  2LGD A;  3T9L A;  1E5W A;  4ZYN A;  1SGH A;  2NBU A;  3UIO B;  4TKN A;  3KUC B;  4CO7 A;  1IP9 A;  4HVB A;  5AEK B;  2LAS A;  4FLH A;  5JZE B;  1M94 A;  3QK0 A;  3QJZ A;  4GDL A;  2IZV B;  1Y8R C;  2DZJ A;  4HDQ A;  2AL3 A;  3K9O B;  1ISN A;  2DAJ A;  4WAA A;  3NS8 A;  4MEL A;  5D2M B;  4EZL A;  3H7P B;  3PPA A;  2BYV E;  1V81 A;  3W1S A;  4NY0 A;  3S2A A;  1R4M I;  4AJW A;  2NBW B;  2DYB A;  5J17 A;  4KDL B;  1UD7 A;  1WFY A;  2B3A A;  1V2Y A;  4P7I A;  3GZN I;  3QIJ A;  5E6P A;  2KWC A;  5GMV A;  2KC1 A;  2R2O A;  2NBV B;  2LVP A;  2L8J A;  3QQ8 B;  5D94 A;  2LGY A;  3H7P A;  3HM6 X;  3A1Q B;  1WE6 A;  1P3Q U;  2C7M B;  2CR5 A;  2V4L A;  5KHQ A;  3VH4 B;  4HK2 A;  3UQA A;  3ZDM C;  2G45 B;  4ANU A;  3NHE B;  1C1Y B;  1KM7 A;  2GBK A;  3EHV A;  2BWF A;  3A33 B;  2ZPY A;  2PEA A;  4IW0 A;  1RAX A;  3ECI A;  1GG3 A;  3PRP B;  4WJO A;  3L0W B;  4GMV A;  2HJ8 A;  2JUO A;  2ZZP B;  4GXB A;  4YL8 A;  2M1M A;  2BGF A;  3A1Q A;  1WM2 A;  2J7Q B;  5J18 A;  1E7U A;  5FR6 A;  3VAW A;  4HPM B;  2JF5 A;  4IWQ A;  2UYZ B;  1CMX B;  3IBE A;  3W1S C;  2KHW B;  4PS7 A;  3QCA A;  2LWP A;  1L2N A;  3R66 C;  2L00 B;  2ZCC A;  3DDC B;  4EUT A;  1OEY J;  5HKH A;  2FCS A;  2RR9 A;  2OOB B;  3APC A;  2JVC A;  2D11 A;  3JW0 X;  2JZZ A;  3N3K B;  5AZF A;  2G4S A;  2RPQ A;  5JHA A;  2N4F A;  1ZGU B;  3SHQ A;  4F1S A;  2CU1 A;  2WYQ A;  3UIP B;  3MJW A;  3KYC D;  2BWE S;  1H4R A;  1WJN A;  4FUL A;  4BKS A;  2KFJ A;  1WR1 A;  4IM0 A;  3DVG X;  4II3 B;  1WXM A;  4W9C A;  4F7Z A;  4FHK A;  1BT0 A;  2Z0D B;  2BF8 B;  3QX1 A;  4GDK B;  2MLB A;  5CHV C;  2JPH A;  2N1V A;  1WX8 A;  5IA7 A;  3ONS A;  1Z5S B;  4BOZ B;  2K6D B;  1YD8 U;  4W9L A;  4BFR A;  2N9X A;  1MG8 A;  2JT4 B;  3R7Q A;  3T8M A;  2YVC A;  2J0J A;  3MHS D;  5JHB A;  3BY4 B;  1E8W A;  4AOF A;  3APD A;  3KYD D;  3L16 A;  1OEY A;  2OJR A;  2KDE B;  2LGX A;  3R3M A;  1WM3 A;  2L76 A;  1SE9 A;  1WZ3 A;  2I1J A;  4HLE A;  3W1Y A;  2AL6 A;  4ZRK A;  1NDD A;  4KVG B;  1S3S G;  4I6P A;  3B0A A;  4JLC A;  4RMA A;  2G3Q B;  1GC6 A;  2Z59 B;  4HWI B;  1YJ1 A;  2KDF B;  5E6O A;  3TMP B;  2PE6 B;  2KDI A;  2DX5 B;  3K9P B;  2GBR A;  2HD5 B;  4K81 A;  3TJP A;  4LDT D;  5LXI B;  2BYF A;  2WX0 A;  2ZNV B;  1YX6 B;  1V86 A;  4JL9 A;  4M0W B;  3ZTC A;  4TQ1 A;  2CS4 A;  4JGH B;  4NQL B;  5DPT A;  4XC2 A;  1EO6 A;  2FUH B;  3U30 A;  5C23 A;  2L3Z A;  2J0K A;  2C7N B;  5DCN A;  2D2Q A;  2WX1 A;  1KLV A;  3IG3 A;  4W9F A;  4F8C B;  4PYZ A;  3NZS A;  3Q3F A;  2KN5 A;  1U4A A;  2KJ6 A;  1VD2 A;  1JRU A;  3KUZ A;  1RFA A;  3M62 B;  4IC7 B;  1VCB A;  1Q1O A;  3M63 B;  2DYO A;  5G2N A;  2KTF A;  2C7H A;  2KD0 A;  4EOY A;  4PYU A;  3VUY A;  3WA0 A;  3ZRC A;  3NZU A;  2LVQ A;  4LCD E;  3H6N A;  3U8Z A;  4KSL C;  4WWN A;  1OGW A;  3PHW B;  4CYE A;  1L7Y A;  2GOW A;  1WX7 A;  4ZRJ A;  1E90 A;  3PLU A;  3M95 A;  3A4R A;  3RZW C;  3SDL C;  2K8C A;  3SU8 X;  3PV1 A;  1HE8 A;  4BKT A;  2EKE C;  2DZI A;  3RUI B;  3KW5 B;  2KJR A;  1UBQ A;  3OAW A;  1WJ4 A;  5LLI A;  3NOB A;  3OLM D;  3QAQ A;  4KIK B;  2ZVN A;  3GOE A;  2JY6 A;  1WIA A;  2O6V D;  3L08 A;  4BBN F;  5JH5 C;  2ZNV C;  3N32 A;  3IHP C;  4FJV B;  4N9F 4;  2KQ7 A;  2CKH B;  3DVG Y;  1WE7 A;  2FIF A;  2FID A;  2KLG A;  1E8X A;  4ZRI A;  2MSE D;  2LD9 A;  3I3T B;  2KVR A;  2WWZ A;  3AUL A;  2ZEQ A;  1YIW A;  4KIK A;  2FCQ A;  2HE7 A;  2L7R A;  4KSK C;  4WJQ A;  4BOS C;  4FBJ B;  4URK A;  3PLV A;  4IG7 B;  2M8S A;  2IY0 B;  1S1Q B;  4NAW B;  4TUU A;  4E71 A;  3VXW A;  1J19 A;  3HK0 A;  2N7E A;  2KC2 A;  4RM8 A;  3PS6 A;  3V6C B;  2IYD B;  2XK5 B;  1XD3 B;  3PSE B;  5BO4 B;  2KX0 A;  2GMI C;  4K7U A;  4DHZ E;  3VDZ A;  2LI5 A;  5DPS A;  1V80 A;  2XBB C;  4GIV A;  2LXC A;  4NAW A;  2AEH A;  2IBI B;  2LXA A;  2PE9 A;  3ML9 A;  5AZH A;  4BKG A;  2DHZ A;  4NJ7 A;  2AWT A;  2BPS A;  2N7D A;  3WAP A;  3WAO A;  4W9J A;  3A4S C;  4NPN A;  4FJY A;  3UQB A;  2K8H A;  3AI5 A;  1WRD B;  2NR2 A;  4DDG D;  3RCZ A;  2MBB B;  3TL5 A;  4DHJ B;  2FCM A;  1Q0W B;  3H1U A;  3IFW B;  4MDK E;  2KXJ A;  3LDZ E;  2NS5 A;  1E8Z A;  3VUW A;  3L54 A;  2L0T A;  3D32 A;  4MGI E;  4EZK A;  1V6E A;  2EMS A;  1YQB A;  2HTH A;  3DBL I;  4BVU C;  3VH3 B;  1WXS A;  2CHZ A;  4X57 B;  1LXD A;  2KTR B;  3BIN A;  2KZR A;  4DXA B;  3L13 A;  4K7S A;  4DDI D;  1WGH A;  3B1L X;  2BYE A;  2C60 A;  5DPR A;  5DPW A;  1V9J A;  3QA8 A;  3RT3 B;  4EKU A;  3CMM B;  3VHT C;  1LQB A;  1WGY A;  2KFK B;  3ML8 A;  3PZD A;  3LJ3 A;  4DWF A;  2KTR A;  3Q3J A;  1P0R A;  3ALB A;  4MH0 E;  3QHT A;  4GDK A;  2KJH B;  3ZKJ C;  4EEW A;  2LVO A;  2MBE A;  4WJP A;  3UGB B;  4MEM A;  4XX5 A;  2WDT B;  3ZUN A;  3VTW A;  2MBO A;  1UH6 A;  2KFK A;  1T0Y A;  3DPD A;  2MCN B;  1EUV B;  4I6L B;  2REX A;  2J0M A;  3ZTD A;  4A20 A;  3JVZ X;  2Z0E B;  1V49 A;  1NI2 A;  1XT9 B;  2K25 A;  1WI0 A;  3JYU A;  1FXT B;  2D3G A;  2NVU I;  3SD5 A;  4KV2 A;  4RM9 A;  4BKS D;  3QAR A;  4WWP A;  3L10 B;  4G11 A;  3HIZ A;  2D10 A;  4WQO B;  4MGK E;  4IM3 A;  1IPG A;  2LZ6 A;  2IY1 B;  3QC8 B;  4A3P A;  1I35 A;  4EFO A;  2K1F A;  1WGD A;  2YLM A;  4CHK A;  2D07 B;  2PPH A;  4FA6 A;  1TGZ B;  2LRU A;  2KAN A;  3A9J B;  4NNJ B;  3X23 A;  3KH0 A;  3OJ4 B;  4I6N B;  4LJP B;  3U7D A;  3CST A;  3AXC A;  4GB9 A;  4ICU A;  2V1Y A;  4M8N A;  2O6V B;  1UEL A;  1GUA B;  2JXX A;  2ZJD A;  2R2Q A;  5CX3 A;  5D7G A;  3RYT A;  1V5O A;  4GOC A;  5EDS A;  4W9H A;  3EEC A;  2JRH A;  3EFU A;  3A9J A;  3VQI A;  4AJY B;  5J2R A;  1KOT A;  3DVN V;  1SIF A;  2M17 A;  4A3O A;  2KOX A;  4W9I A;  1IYF A;  4B9K A;  3MTN B;  3ZNG C;  1QZE A;  3APF A;  3KUD B;  4DHZ B;  3O65 B;  3JSV B;  4AP4 C;  2Y5B B;  2FCN A;  4W9E A;  2C5L C;  3VUX A;  5L83 A;  1GJZ A;  2DZK A;  4IWO A;  3ZNI D;  4II2 B;  1WR6 E;  1RLF A;  2RGF A;  3QWZ B;  2KMA A;  2MBH A;  1OQY A;  3V61 A;  4KDI C;  4GDL B;  3ZDT A;  1J8C A;  2EMT A;  2QHO A;  2K8B A;  2JRI B;  4GGQ A;  3RZF A;  3JSV A;  3ZNH B;  2L0F A;  3AU4 A;  4HPL B;  4NJ6 A;  1WJU A;  1EF1 A;  1YX5 B;  4ZDV A;  1GC7 A;  4KZ0 A;  2CHW A;  2KNB A;  5C1Z A;  2RD0 A;  4TQ0 A;  4OVU A;  4GU2 A;  4HXD A;  4B6W A;  1WH3 A;  1KJT A;  3DBH I;  4WWO A;  2ZCB A;  5L95 C;  3DBR I;  4WJN A;  1P9D U;  2IO0 B;  2M0X A;  4K7W A;  3WAL A;  5IAA C;  3DCG A;  4PS3 A;  3WIM A;  4LJO B;  3PTF C;  3M3J A;  3VTU A;  2KWU B; 
#chains in the Genus database with same CATH topology
 1DYQ A;  4TV3 A;  2MRP A;  3PT2 B;  2BB6 A;  3ZLZ A;  4HJG E;  2XK5 A;  2MHJ A;  1C3T A;  1N62 A;  1VDV A;  2KQS A;  3H7S A;  1RRB A;  4G0N B;  1WGR A;  3ENE A;  1XF5 L;  1FFV A;  2FNJ B;  2QEJ C;  2KDB A;  3Q6B A;  2MWS B;  1LFD A;  4KZC A;  1XQQ A;  2IND C;  1SF0 A;  3X0W A;  2VH1 A;  1OTR B;  1K8R B;  1PGB A;  2ASQ A;  1D5Z C;  3PHX B;  3ZW3 A;  1KLU D;  3V62 A;  4MGY E;  2R61 A;  1D6E C;  2N1W A;  3NVY A;  2WDR B;  4FJZ A;  1ET6 A;  1MHH E;  4K1R B;  2DYM A;  1IGC A;  4ANW A;  2KMC A;  4WH4 A;  3C0R B;  3R7R A;  1YJI A;  4ANV A;  4DHJ D;  3N30 A;  2MQJ A;  2X8X X;  1GOZ A;  4W9D A;  2KKC A;  2N9E B;  2RSU A;  2LRW A;  2C9W B;  3NVZ A;  4MSQ B;  3E9S A;  4R3D A;  1VRA B;  2V3N A;  1DOI A;  1WGK A;  4ASW C;  1BUI C;  3GE3 C;  1FRD A;  5KHO A;  4YTP B;  2MX2 A;  1H8C A;  3MP9 A;  1PQS A;  4MAC A;  2O2V B;  1K50 A;  2MBQ A;  1FD6 A;  4IUM B;  4PS8 A;  2UWQ A;  2PJH A;  1WX9 A;  1WYW B;  1WZ0 A;  1K52 A;  2BKF A;  2WXR A;  3T9L A;  4CO7 A;  5AEK B;  4FLH A;  3QK0 A;  1YN5 A;  1C4C A;  2AL3 A;  3NS8 A;  3W1S A;  3S2A A;  4A6Q A;  5IOI A;  2IGD A;  2BS2 B;  1WFY A;  1GB1 A;  3QIJ A;  5E6P A;  5GMV A;  3DWM A;  2L8J A;  3ZJV A;  1IGD A;  2C7M B;  2CR5 A;  4AS1 A;  3VH4 B;  3LYY A;  1KM7 A;  1RAX A;  3UI3 A;  1T3Q A;  3L0W B;  4GMV A;  4YL8 A;  2M1M A;  3A1Q A;  2KVZ A;  2JF5 A;  2D3C A;  2HJ1 A;  3ZQ4 A;  2KHW B;  4P1B C;  3SFD B;  1YJJ A;  3DDC B;  4EUT A;  3TSS A;  3JW0 X;  5AZF A;  5JHA A;  2N4F A;  1ZGU B;  3SHQ A;  3I9V 1;  3MJW A;  5E6J A;  1WJN A;  4FUL A;  4BKS A;  2KFJ A;  3I63 C;  3DVG X;  1EM7 A;  3V05 A;  3ZYY X;  3B9J A;  3KLS X;  3ONS A;  1YD8 U;  2BYT A;  1AWD A;  3AE3 B;  2J42 A;  5JHB A;  5G5H A;  3BY4 B;  4AOF A;  3APD A;  2OJR A;  4LLG M;  2L76 A;  1SE9 A;  1WZ3 A;  5IKC M;  3W1Y A;  4CQN A;  1NDD A;  1S3S G;  2G3Q B;  1GC6 A;  4MH8 A;  1YJ1 A;  3NRZ A;  1UUP A;  2DX5 B;  4K81 A;  2ZW1 A;  1GAQ B;  2X38 A;  3T3N A;  1FEH A;  2ZNV B;  4JL9 A;  3BYT B;  4M0W B;  4P1C C;  4US9 A;  4XC2 A;  2GLS A;  1YMH E;  2M19 A;  2FUH B;  2J0K A;  4OZC A;  1HTO A;  4HRS A;  3NZS A;  1FXA A;  1FO4 A;  2EEL A;  2PTL A;  4PK1 A;  1EU4 A;  2KD0 A;  4EOY A;  1E7P B;  2LVQ A;  4KSL C;  1OGW A;  4USA A;  2GOW A;  1QOF A;  1C4A A;  3RZW C;  3SDL C;  1L0V B;  2K8C A;  1TS4 A;  4BKT A;  2DZI A;  2KJR A;  1LO5 D;  3OAW A;  1WJ4 A;  3NOB A;  1XO3 A;  2K9X A;  1MG4 A;  4BBN F;  1WIA A;  2O6V D;  1XEE A;  2KQ7 A;  1TS5 A;  2FIF A;  2KLG A;  5AUI A;  2MSE D;  2LD9 A;  2WWZ A;  3AUL A;  1ESF A;  5H92 C;  4N58 A;  1L0Y B;  2JQR B;  1J19 A;  3Q3O C;  2KC2 A;  3V6C B;  3MC8 A;  1VZ6 A;  3DWG C;  4ZYS A;  1ZXI A;  1QKZ A;  1V1P A;  2CJO A;  4NAW A;  2PE9 A;  3ML9 A;  5AZH A;  2Q5W D;  2N9K A;  3WAP A;  3GS2 A;  2WDQ B;  1ZPS A;  2KT7 A;  1UWX A;  1ZXH A;  2W54 A;  3H8H A;  1V6E A;  2HTH A;  4BVU C;  2WU2 B;  3RNE C;  1ZOY B;  3HRD D;  5DPR A;  3IXS A;  1OFF A;  2KFK B;  2KTR A;  1P0R A;  4EEW A;  4MEM A;  1JW9 D;  4B0E A;  1JWS D;  2MBO A;  1EUV B;  2REX A;  4A20 A;  1NI2 A;  2WU5 B;  2G1E A;  2N7J A;  4WWP A;  3L10 B;  2D10 A;  2LEK A;  2IY1 B;  4H2A A;  1I35 A;  4EFO A;  2YLM A;  1N61 A;  1WGD A;  2D07 B;  3TUO A;  3BVZ A;  3DBH B;  5FR3 A;  3TEX A;  3KH0 A;  4KX6 B;  3EFC A;  1UEL A;  1GUA B;  2DBY A;  4W9H A;  1KOT A;  1NI3 A;  1SIF A;  3U4E G;  1DGJ A;  2KOX A;  3ZNG C;  4DHZ B;  3EGR A;  2XN9 C;  4W9E A;  3VUX A;  3ZNI D;  4IWO A;  1XLP A;  1WR6 E;  1RLF A;  1OQY A;  3V61 A;  3C8Y A;  4GDL B;  2L32 A;  3ZDT A;  2QHO A;  2L0F A;  1EF1 A;  3DHI C;  3AEA B;  4J3O D;  2SAK A;  4KZ0 A;  1HTQ A;  1Y56 A;  4HXD A;  2WNM A;  1WH3 A;  2WXJ A;  3DBH I;  4WJN A;  2LGI A;  2IO0 B;  2M0X A;  5BYR A;  4LJO B;  3PTF C;  3VTU A;  3EUB 2;  4GLS C;  3AMZ A;  1N6Z A;  2A5U A;  1FNV A;  2MJ3 A;  2J53 A;  3IAS 1;  4ZOH C;  1I4R A;  4HKZ E;  2CHX A;  2WXP A;  3PVL A;  1T6B X;  1GNU A;  2LUE A;  1PYW D;  3OJ3 A;  4RF1 A;  4EZJ A;  2JYT A;  3ZRF A;  1EU3 A;  2RMM A;  3VTV A;  2HDE A;  2MP2 A;  2Y5C A;  4MJS A;  1XLO A;  1UGM A;  1AAR A;  3AU5 A;  3KVF B;  1I4Q A;  2VZK D;  1T0Q C;  2KAC A;  3J9C A;  1B1Z A;  3P2B A;  3R2I A;  1FFU A;  4AWJ A;  3Q3N C;  3V6E B;  4LDT B;  1JWB D;  1WGG A;  2BKR B;  1F0Z A;  5C3J B;  1E8Y A;  4QAY A;  2QJL A;  2DEN B;  1L6U A;  2SEB D;  1L5P A;  4IDI A;  4DXF A;  3CF6 E;  3TCA A;  2WQY B;  1F9J A;  1LM8 B;  3MJ5 A;  2NCN A;  3RUL A;  2KYW A;  5CTR C;  4GN1 A;  4NQK E;  2W9N A;  4JWS C;  2K39 A;  3Q69 A;  1FIQ A;  2GBM A;  1NVI D;  4KKI A;  4B0M A;  3BYY B;  3TBL D;  4YT0 B;  2NPT A;  4W9K A;  1WMH A;  1R4M B;  2KK8 A;  4DXG A;  1WXA A;  1YN3 A;  3A9K A;  4GSW A;  2L05 A;  2AYO B;  1I7H A;  3NY5 A;  1MVK A;  4DBG A;  2JSV X;  4G50 A;  3P4S B;  5D6J B;  3TIX A;  3Q3M C;  5AZG A;  1EF5 A;  2IO2 B;  3AEB B;  2QC8 A;  1PGX A;  2NBU A;  3UIO B;  3KUC B;  1XLN A;  1PUT A;  1QLB B;  1M94 A;  3Q2A C;  1WYG A;  3NVV A;  4GDL A;  2IZV B;  1Y8R C;  4HDQ A;  5FK9 C;  1SE3 A;  2DAJ A;  5D2M B;  4EZL A;  3PPA A;  3AE1 B;  4NAM A;  2MH7 A;  1R4M I;  4LNK A;  2DYB A;  1BML C;  5J17 A;  1TIF A;  3GZN I;  1NEK B;  2NBV B;  5D94 A;  2LGY A;  3H7P A;  3HM6 X;  3A1Q B;  1WE6 A;  5KHQ A;  1GPX A;  3UQA A;  1PFD A;  2G45 B;  4ANU A;  1C1Y B;  4C80 A;  3EHV A;  2ZPY A;  2H89 B;  3PRP B;  1GG3 A;  4WJO A;  4GXB A;  3NZ3 A;  2BB5 A;  2BGF A;  5J18 A;  5FR6 A;  4IWQ A;  2UYZ B;  3AED B;  2D3A A;  3QCA A;  2LWP A;  1GB4 A;  5HKH A;  1OEY J;  3AE8 B;  2PW9 A;  2RR9 A;  2OJW A;  1YN4 A;  2JVC A;  2D11 A;  3N3K B;  2JZZ A;  3RN9 C;  2G4S A;  2CU1 A;  4OZA A;  1N63 A;  1YNT E;  3KYC D;  1F2R C;  3BVG A;  1H4R A;  1WR1 A;  2WXK A;  3OG5 A;  4II3 B;  1ZDX A;  4W9C A;  1NYQ A;  2Z0D B;  4GDK B;  4DQO C;  3CIR B;  4C56 C;  2QIL A;  4BFR A;  2N9X A;  3TEW A;  1LGR A;  3R7Q A;  1TT5 B;  3AE2 B;  2AX5 A;  1FXI A;  4OW0 A;  3P4Q B;  1UWM A;  2LGS A;  4JLC A;  4WAF A;  2Z59 B;  4HWI B;  4TSS A;  2PE6 B;  2KDI A;  3V3X A;  1KF6 B;  5TSS A;  2OHF A;  2BYF A;  4XDD A;  1TY2 A;  4NJC A;  4JGH B;  2L1A A;  1EO6 A;  2QCZ A;  3U30 A;  3FAH A;  5C23 A;  2L3Z A;  3BZD B;  3N1Y C;  2C7N B;  1KLV A;  4F8C B;  4ZRP A;  2KN5 A;  1U4A A;  5BMI A;  3O13 A;  2KJ6 A;  1JRU A;  2M56 B;  1C79 A;  4IC7 B;  1UNS A;  2DYO A;  4LNF A;  2C7H A;  3VUY A;  1K53 A;  1TJE A;  3A4R A;  1XCQ L;  2EKE C;  2PVO D;  3RUI B;  1UBQ A;  5LLI A;  3OLM D;  3QAQ A;  2JY6 A;  3R8B A;  1CZP A;  2ZNV C;  1E9M A;  3IHP C;  4FJV B;  3SR6 A;  3NJT A;  4KKJ A;  3N20 C;  3DVG Y;  3P42 A;  4JPS A;  3I3T B;  2G9H D;  2KVR A;  1TKG A;  1VLB A;  4KIK A;  2FCQ A;  4KSK C;  1V1P B;  3PLV A;  2IY0 B;  1S1Q B;  2PIA A;  4NAW B;  4TUU A;  4RNA A;  3FC4 A;  4ARC A;  2W82 A;  1XD3 B;  2GMI C;  4K7U A;  3EA6 A;  3RMK C;  1V80 A;  4GIV A;  3KWV A;  4YSX B;  2AEH A;  2LXA A;  2BPS A;  3SFE B;  3BVM A;  3A4S C;  4NPN A;  2HTM E;  4RCO A;  1WRD B;  3BK1 A;  1XLQ A;  4JE3 B;  4NZL B;  1FCL A;  3B2F A;  3Q14 C;  1WXS A;  4X57 B;  2KTR B;  3BIN A;  2KZR A;  4DXA B;  3R2T A;  3B1L X;  3ZXV A;  3BWU D;  5DPW A;  3QA8 A;  3RT3 B;  3W2D A;  3VHT C;  4WWM A;  3ML8 A;  3VR8 B;  2WP9 B;  3LJ3 A;  3BII D;  1RWS A;  3QHT A;  3FIL A;  4GDK A;  1JWM D;  2LVO A;  2MBE A;  2PVG C;  3FKY A;  3VTW A;  1D5M C;  1T0Y A;  3ZJU A;  1V1O A;  4I6L B;  2Z0E B;  2NVU I;  3SD5 A;  3QAR A;  5EE9 A;  4G11 A;  1QT9 A;  2Y5P A;  3AEC B;  1QIL A;  2N9L A;  2LZ6 A;  2AQ1 B;  4IKG A;  2PPH A;  3OJ4 B;  4LJP B;  2BVC A;  3U7D A;  1ZE3 D;  2O6V B;  2ZJD A;  5D7G A;  3DHG C;  2JRH A;  3EFU A;  2CU3 A;  2Y3A A;  2M17 A;  2RPV A;  3MTN B;  4YXD B;  2C5L C;  1TKE A;  2RGF A;  2JXT A;  4KDI C;  3P1M A;  1J8C A;  3RNA C;  2EMT A;  1R4N B;  2KMM A;  3RZF A;  2RDB C;  1PGA A;  1Q10 A;  1SEB D;  2I2Y A;  1GC7 A;  2WXN A;  1JWU D;  1SE4 A;  4GU2 A;  1AW7 A;  1KJT A;  2GB1 A;  2ZCB A;  4L1B A;  1P9D U;  3DCG A;  2NMQ A;  3M3J A;  4B95 A;  1TZ1 A;  2JWU A;  3AE6 B;  2M0A A;  3NS1 A;  2N9P C;  2MP2 B;  1WY8 A;  2Z8L A;  3PGE A;  1TBE A;  2DZM A;  4DK5 A;  4MJS B;  1TTN A;  3HHM A;  1J7C A;  4W9G A;  1JRP A;  5CHW A;  4JQW C;  5AUK A;  1I4G A;  1HA5 A;  3UIN B;  1NBF C;  4MSM B;  4TMA B;  1J0G A;  1R4N I;  2QSD A;  2MA9 B;  2QDF A;  5CHF A;  4KGS A;  4O1N A;  2ZPN A;  1VJK A;  4A55 A;  2MW5 A;  2NTS A;  4P6V F;  3BK2 A;  2QIE B;  4E3C A;  3HM3 A;  4M00 A;  1NYR A;  3VVW B;  1UBI A;  2XEW A;  5HHD G;  1ZW7 A;  3ZVV A;  4G3X B;  3Q8C A;  2RDH A;  4RFB A;  4BBN C;  1VZ7 A;  3H9D A;  1V5T A;  1QQR A;  2K0P A;  1KRH A;  4J6I A;  5LXH A;  1L0X B;  1ZDV A;  5G55 A;  3MHZ A;  1UZX B;  4FHJ A;  4ICV A;  1L4D B;  4XZ4 A;  2NPT B;  1WJ6 A;  3AN1 A;  1WMH B;  4FAD A;  3MC9 A;  4IWP A;  1HEZ E;  1Q5W B;  2KQ4 X;  3RD2 A;  1RFK A;  3A9K B;  2WXI A;  1VZ8 A;  3DVN U;  3WCQ A;  3CWI A;  5BMG A;  2KWV B;  1P1A A;  3ZIM A;  2UU7 A;  2GBJ A;  2H88 B;  5TR5 A;  3VFK A;  2FUG 1;  4MGZ E;  5HG2 A;  2WXO A;  3OWE B;  4D2K A;  2O6V A;  3URY A;  3B2G A;  4A9A A;  1IUE A;  3WAM A;  1JAL A;  2ONQ A;  4M8M A;  4MM3 A;  2IO3 B;  2JZ3 B;  1I42 A;  5BYS A;  1E5W A;  2K5P A;  1TY0 A;  3NVW A;  2IGG A;  4XWW A;  4TKN A;  2V4I B;  1IP9 A;  2LAS A;  2DZJ A;  1TS3 A;  1CJE A;  1V8C A;  3K9O B;  2WLB A;  4WAA A;  4MEL A;  5D3I B;  3H7P B;  3U7Z A;  4JWU C;  4AJW A;  2V3P A;  3AM9 A;  4P7I A;  2MJD A;  2KC1 A;  2R2O A;  2VZK B;  3QQ8 B;  1ET9 A;  2VH2 A;  2V4L A;  4RGM A;  3Q8E A;  3ZDM C;  1FPY A;  4EE2 A;  3NHE B;  2GBK A;  2BWF A;  3A33 B;  2PEA A;  3ECI A;  5BMH A;  3VR9 B;  1D4B A;  2HJ8 A;  2JUO A;  2ZZP B;  3AE4 B;  3VAW A;  4HPM B;  1CMX B;  1VR9 A;  3IBE A;  3W1S C;  1RYJ A;  3Q8F A;  2FCS A;  2RPQ A;  4F1S A;  4ARI A;  3RNC C;  3HUI A;  3UIP B;  2IPK D;  2N0S B;  4IM0 A;  4RF0 A;  1WXM A;  1WRI A;  4F7Z A;  4FHK A;  1BT0 A;  1OQQ A;  4WUR A;  5CHV C;  3U2S C;  5IA7 A;  1QOB A;  3LXF A;  3PZ7 A;  4W9L A;  1MG8 A;  2JT4 B;  3T8M A;  2BBC A;  2J0J A;  3MHS D;  4YSY B;  1BXT A;  3KYD D;  2KDE B;  2LGX A;  4ZRK A;  4XE0 A;  2JZP A;  3B0A A;  1A70 A;  1J7A A;  5FKA C;  3TMP B;  2INP E;  2HD5 B;  2AQ3 B;  4LDT D;  2WX0 A;  1V86 A;  3ZTC A;  4TQ1 A;  3GZN B;  2CS4 A;  4NQL B;  2LMC A;  2ZW0 A;  2D2Q A;  4W9F A;  4PYZ A;  3Q3F A;  1V97 A;  3P4P B;  4P16 A;  1VD2 A;  1RFA A;  1VCB A;  1Q1O A;  5G2N A;  2KTF A;  4RGN A;  3N1Z C;  4OVZ A;  4PYU A;  3ZRC A;  3NZU A;  3H6N A;  3U8Z A;  3PHW B;  1UGJ A;  2J52 A;  4YWG G;  1HXY D;  1E90 A;  3M95 A;  4UDU C;  1SIJ A;  2FE8 A;  2PLP A;  3SU8 X;  4OHJ A;  3PV1 A;  1HE8 A;  4ACF A;  2ICI A;  3KW5 B;  1AYF A;  4KIK B;  4A90 A;  3AB5 A;  2ZVN A;  3L08 A;  1F77 A;  3DBL B;  4LNI A;  1NEN B;  2ZEQ A;  2HE7 A;  2L7R A;  4FBJ B;  4BOS C;  4IG7 B;  3ZXR A;  2M8S A;  4ITK A;  1FNW A;  3KQ4 A;  1C4P A;  1N5W A;  4RM8 A;  1JWA D;  2PKO A;  2W55 A;  2IYD B;  3PSE B;  4C00 A;  5BO4 B;  2KX0 A;  5IO9 A;  5GXG B;  2W3R A;  3VDZ A;  5DPS A;  2LXC A;  2IBI B;  4BKG A;  2DHZ A;  4NJ7 A;  3WAO A;  4W9J A;  2YEP F;  4FXC A;  1SSN A;  2NR2 A;  3TL5 A;  4DHJ B;  3GE8 C;  2FCM A;  3IT6 B;  4MDK E;  3LDZ E;  3VUW A;  1E8Z A;  2L0T A;  3D32 A;  4EZK A;  3GP7 A;  2EMS A;  1YQB A;  3DBL I;  3VH3 B;  4ZHP A;  1LXD A;  2INN E;  2BW2 A;  4K7S A;  1WGH A;  3FIL B;  2BYE A;  4EKU A;  3CMM B;  2PMV A;  2WS3 B;  4DWF A;  3Q3J A;  1C9F A;  2KJH B;  3AV8 A;  4KGT A;  1ENF A;  1DOX A;  4WJP A;  4XX5 A;  2WDT B;  3ZUN A;  3DPD A;  2J0M A;  1V49 A;  2LJI A;  2K25 A;  1WI0 A;  1E10 A;  3JYU A;  1FXT B;  1MI0 A;  4BKS D;  4RM9 A;  3NUH B;  2AQ2 B;  2INC C;  3HIZ A;  1WWT A;  4YTN B;  1SB3 C;  4MGK E;  4IM3 A;  2MEK A;  2K1F A;  1TGZ B;  3DBR B;  1T0S C;  1YQ4 B;  1I4X A;  3AXC A;  1L4Z B;  4GB9 A;  4ICU A;  2ON8 A;  4M8N A;  5CX3 A;  2JXX A;  2WGS A;  2R2Q A;  1KFY B;  4GOC A;  3A9J A;  3DVN V;  2V9H A;  5D3D A;  1IYF A;  4B9K A;  3APF A;  3KUD B;  1FMA D;  2J4X A;  2FCN A;  1GJZ A;  4II2 B;  1N5X A;  2WXG A;  3RNF C;  5IN7 A;  1HZ6 A;  2KMA A;  2MBH A;  3SEB A;  1SJE D;  2D5G A;  4WQM A;  3JSV A;  3ZNH B;  2WHI A;  4NJ6 A;  4S17 A;  1WJU A;  1FM0 D;  5JXV A;  4LK0 M;  5LNK 1;  2CHW A;  2KNB A;  2IGH A;  4Q2J A;  4TQ0 A;  4OVU A;  1F1H A;  4WWO A;  3DBR I;  1K51 A;  4K7W A;  5IAA C;  4PS3 A;  5EE3 A;  2K3U A;  2KWU B;  3W9C B;  3W5U B;  3DBS A;  3PRZ A;  4WIP A;  4HCP B;  1J7B A;  4RGT A;  4OVV A;  1IBX B;  2M4N A;  2ZVO A;  3CSF A;  3PRM B;  4HCN B;  2WXQ A;  4HDO A;  3NG0 A;  2DAF A;  3W5V B;  1WF9 A;  4C4V B;  3ZO5 B;  1D5X C;  1WSP A;  2WXM A;  5HI1 A;  3DOW A;  3RNG C;  2G4D B;  3N1X C;  4JIO U;  3ZNZ B;  1ZKH A;  2WXL A;  2IDY A;  1SBB B;  1Z2M A;  4E74 A;  2L83 A;  3EC8 A;  2YEP B;  4FN2 A;  1L6V A;  3PRE A;  2VRR B;  1F2R I;  4HJK A;  1UF0 A;  3UF8 A;  1WXV A;  4S0R A;  2I1K A;  1M4V A;  5E6N A;  2JWZ A;  1P7F A;  2K22 A;  4ANX A;  1E7V A;  5C2T B;  3RNB C;  2QMT A;  3AEG B;  4IM2 A;  3IVF A;  1ZP0 B;  1KH0 A;  4AUQ C;  3V60 A;  1XXG A;  1N60 A;  3DQV A;  2KX3 A;  3HVD A;  1C76 A;  2JU6 X;  2GBN A;  5EE0 A;  3L4P A;  2K6Q A;  1X1M A;  4AQ7 A;  3B08 A;  2BS3 B;  2A4Z A;  2FAZ A;  1FNU A;  4XWT A;  3ZGZ A;  3L17 A;  1G6J A;  2L52 A;  1P98 A;  3RFZ B;  4MM3 B;  1D3Z A;  4PT5 A;  4US8 A;  2OED A;  2V3S A;  3AE9 B;  2KO3 A;  2JX5 A;  4LNO A;  1A5R A;  2O2V A;  2KAJ A;  2IO1 B;  2KLC A;  2LJ5 A;  3WAN A;  2LGD A;  1CK1 A;  4ZYN A;  5BYQ A;  1SGH A;  1PDX A;  3LB8 C;  4IOI E;  4HVB A;  5JZE B;  3QJZ A;  2IJ0 A;  4MT5 A;  1ISN A;  3RI7 C;  3TEZ A;  3PO0 A;  2BYV E;  1V81 A;  2KN4 A;  4NY0 A;  2GI9 A;  2NBW B;  4YSZ B;  4L2Y A;  4KDL B;  1UD7 A;  2B3A A;  1V2Y A;  3VRA B;  2KWC A;  2LVP A;  5IP4 D;  1P3Q U;  4HK2 A;  4N6E B;  4K3B A;  4IW0 A;  2LHE A;  1IBX A;  1WM2 A;  2J7Q B;  1E7U A;  1ZUD 2;  2V0G A;  2D3B A;  1CQV A;  2KDM A;  1TYG B;  2LHD A;  1MHX A;  4PS7 A;  1L2N A;  1HZ5 A;  3R66 C;  2L00 B;  2ZCC A;  2LFI A;  2OOB B;  3APC A;  4OZB A;  4C4V A;  4REZ A;  1WXQ A;  3T3O A;  4LTU A;  3TEY A;  2WYQ A;  2BWE S;  3I57 A;  1SXT A;  1YOV B;  2BF8 B;  3QX1 A;  2MLB A;  3I5J C;  2JPH A;  1SE2 A;  1WX8 A;  2N1V A;  1T5X D;  1Z5S B;  1E6E B;  4BOZ B;  2BTE A;  2K6D B;  5MPO A;  1T0R C;  1TZO A;  1ACC A;  2YVC A;  3AE5 B;  3DHH C;  1E8W A;  3L16 A;  1OEY A;  3R3M A;  1WM3 A;  1DOY A;  2I1J A;  4HLE A;  2AL6 A;  3PZ8 A;  4KVG B;  2TSS A;  4I6P A;  2W3S A;  4RMA A;  3MC0 B;  5E6O A;  2KDF B;  3IAM 1;  3K9P B;  2GBR A;  3TJP A;  2BT6 A;  2LUM A;  4ZRQ A;  5LXI B;  1YX6 B;  4RGO S;  5DPT A;  1ROE A;  2RDG A;  3AEE B;  2WXH A;  5DCN A;  2WX1 A;  3IG3 A;  4ZHO A;  4M0W A;  4RH6 A;  3ABV B;  2FBW B;  2E3T A;  3KUZ A;  3M62 B;  3M63 B;  4L23 A;  3WA0 A;  1KLG D;  4LCD E;  4WWN A;  4CYE A;  3Q8B A;  1L7Y A;  1OQR A;  1WX7 A;  4ZRJ A;  3PLU A;  2DLB A;  4BAX A;  4HPP A;  1C78 A;  1I4P A;  1EWY C;  3GOE A;  4YTM B;  4HKQ A;  2JYE A;  5JH5 C;  2GRI A;  3N32 A;  4N9F 4;  1MFW A;  2XNA C;  2ACZ B;  2CKH B;  1WE7 A;  2FID A;  4HRO A;  2BS4 B;  1E8X A;  4ZRI A;  1AN8 A;  1YIW A;  4WJQ A;  4URK A;  4LNN A;  2CJN A;  4E71 A;  3VXW A;  3AE7 B;  3AH7 A;  4JX1 C;  3HK0 A;  2N7E A;  3PS6 A;  4BZA A;  4C7Y A;  3U52 E;  2XK5 B;  2WXF A;  4DHZ E;  2LI5 A;  3N9Y C;  2XBB C;  1TKY A;  1XCT L;  2AWT A;  2N7D A;  1KTK A;  4HEA 1;  3KWL A;  3C19 A;  4FJY A;  4KGR A;  3UQB A;  2BQQ A;  2K8H A;  3AI5 A;  4DDG D;  3RCZ A;  1YQ3 B;  2MBB B;  2KWD A;  1Q0W B;  3H1U A;  3IFW B;  2KXJ A;  2NS5 A;  3L54 A;  4MGI E;  5I4D A;  5H8Y E;  2EKI A;  2CHZ A;  4K3C A;  3L13 A;  4DDI D;  2E6X A;  2B76 B;  2C60 A;  4M01 A;  1FRR A;  2MJE A;  1V9J A;  1LQB A;  2WDV B;  1WGY A;  3PZD A;  4M02 A;  3VRB B;  3ALB A;  4MH0 E;  1SJH D;  1HQR D;  3ZKJ C;  1JCK B;  3UGB B;  2DWQ A;  1JRO A;  2I38 A;  3P63 A;  1UH6 A;  2KFK A;  2MCN B;  3P4R B;  3ZTD A;  3JVZ X;  1XT9 B;  2D3G A;  4KV2 A;  3AEF B;  3E56 A;  4WQO B;  1IPG A;  1MPE A;  3QC8 B;  4A3P A;  1E0Z A;  5G5G A;  4CHK A;  3RPF C;  3GB1 A;  2NTT A;  4FA6 A;  2LRU A;  2KAN A;  3A9J B;  1QOA A;  4NNJ B;  3IT4 B;  1QOG A;  3X23 A;  4I6N B;  1RM6 C;  3CST A;  2V1Y A;  3RYT A;  3ZJT A;  1V5O A;  1JML A;  4XDC A;  1EWC A;  5EDS A;  1MJD A;  3EEC A;  3VQI A;  5J2R A;  1FCC C;  4AJY B;  5T8I A;  5HFY A;  4A3O A;  1F52 A;  4W9I A;  1QZE A;  1JQ4 A;  1P7E A;  3JSV B;  1I4H A;  2Y5B B;  3O65 B;  4AP4 C;  5L83 A;  2DZK A;  1B9R A;  3QWZ B;  1R7S A;  4N59 A;  1QF6 A;  2K8B A;  2JRI B;  4GGQ A;  1TS2 A;  4C7Z A;  3AU4 A;  4HPL B;  4XYC A;  1C77 A;  5EE1 A;  1YX5 B;  4XGA B;  3HVZ A;  4ZDV A;  5C1Z A;  2DNF A;  2RD0 A;  3MFG A;  4B6W A;  4A8X C;  5L95 C;  3Q8A A;  3WAL A;  3WIM A;  3ETR A;  1STE A; 
#chains in the Genus database with same CATH homology
 3DBS A;  3PRZ A;  4TV3 A;  4B95 A;  1TZ1 A;  4HCP B;  2MRP A;  2A5U A;  4OVV A;  2M4N A;  2ZVO A;  2N9P C;  3PT2 B;  3CSF A;  2MP2 B;  3PRM B;  2CHX A;  1WY8 A;  3PGE A;  1TBE A;  3PVL A;  2DZM A;  4HCN B;  4DK5 A;  1GNU A;  4MJS B;  2LUE A;  1TTN A;  3HHM A;  4HDO A;  4W9G A;  3ZLZ A;  2XK5 A;  3OJ3 A;  1C3T A;  5CHW A;  4JQW C;  2DAF A;  2KQS A;  4EZJ A;  3H7S A;  3ZRF A;  1RRB A;  4G0N B;  3UIN B;  1NBF C;  3VTV A;  4MSM B;  1WGR A;  2MP2 A;  1J0G A;  1WF9 A;  3ENE A;  1R4N I;  2FNJ B;  2KDB A;  2MA9 B;  5CHF A;  4MJS A;  2MWS B;  3ZO5 B;  1LFD A;  1UGM A;  4KZC A;  2ZPN A;  1AAR A;  1XQQ A;  3AU5 A;  3KVF B;  2MW5 A;  3DOW A;  2G4D B;  4JIO U;  3ZNZ B;  1ZKH A;  3HM3 A;  3X0W A;  4E3C A;  3P2B A;  1OTR B;  4AWJ A;  3V6E B;  1Z2M A;  4LDT B;  4E74 A;  3EC8 A;  3VVW B;  1WGG A;  1K8R B;  1UBI A;  2BKR B;  2XEW A;  1ZW7 A;  2ASQ A;  4FN2 A;  3ZVV A;  3PHX B;  3ZW3 A;  4G3X B;  3V62 A;  3PRE A;  4MGY E;  1E8Y A;  2VRR B;  2N1W A;  2DEN B;  4HJK A;  3UF8 A;  4BBN C;  1WXV A;  3H9D A;  1V5T A;  2I1K A;  4FJZ A;  5E6N A;  3CF6 E;  3TCA A;  4K1R B;  2JWZ A;  1F9J A;  1LM8 B;  4J6I A;  2NCN A;  3RUL A;  4ANX A;  5LXH A;  1E7V A;  2DYM A;  5G55 A;  5CTR C;  4GN1 A;  4IM2 A;  3IVF A;  1UZX B;  4NQK E;  4FHJ A;  4AUQ C;  4ANW A;  2W9N A;  4ICV A;  4XZ4 A;  2NPT B;  3V60 A;  1WJ6 A;  2KMC A;  3DQV A;  2KX3 A;  3C0R B;  2K39 A;  3R7R A;  4ANV A;  1WMH B;  4DHJ D;  4FAD A;  2GBN A;  4IWP A;  3N30 A;  2MQJ A;  2GBM A;  4W9D A;  1Q5W B;  2KKC A;  3RD2 A;  2N9E B;  3A9K B;  3TBL D;  2RSU A;  2LRW A;  2C9W B;  2NPT A;  4MSQ B;  4W9K A;  3DVN U;  2K6Q A;  1WMH A;  1X1M A;  1P1A A;  2KWV B;  3B08 A;  3ZIM A;  4ASW C;  2A4Z A;  2GBJ A;  2KK8 A;  2FAZ A;  1WXA A;  5TR5 A;  5KHO A;  3VFK A;  2MX2 A;  3A9K A;  3L17 A;  1G6J A;  1H8C A;  4MGZ E;  1PQS A;  4GSW A;  2O2V B;  1P98 A;  2L05 A;  2MBQ A;  2AYO B;  4IUM B;  4PS8 A;  2UWQ A;  1D3Z A;  2PJH A;  2O6V A;  3NY5 A;  4DBG A;  1WX9 A;  3WAM A;  2V3S A;  1WYW B;  1WZ0 A;  2KO3 A;  4G50 A;  5D6J B;  3TIX A;  1A5R A;  2BKF A;  2O2V A;  4M8M A;  1EF5 A;  5AZG A;  2IO1 B;  2KLC A;  2IO2 B;  2LJ5 A;  4MM3 A;  2IO3 B;  2JZ3 B;  1I42 A;  3WAN A;  2LGD A;  3T9L A;  1E5W A;  4ZYN A;  1SGH A;  2NBU A;  3UIO B;  4TKN A;  3KUC B;  4CO7 A;  1IP9 A;  4HVB A;  5AEK B;  2LAS A;  4FLH A;  5JZE B;  1M94 A;  3QK0 A;  3QJZ A;  4GDL A;  2IZV B;  1Y8R C;  2DZJ A;  4HDQ A;  2AL3 A;  3K9O B;  1ISN A;  2DAJ A;  4WAA A;  3NS8 A;  4MEL A;  5D2M B;  4EZL A;  3H7P B;  3PPA A;  2BYV E;  1V81 A;  3W1S A;  4NY0 A;  3S2A A;  1R4M I;  4AJW A;  2NBW B;  2DYB A;  5J17 A;  4KDL B;  1UD7 A;  1WFY A;  2B3A A;  1V2Y A;  4P7I A;  3GZN I;  3QIJ A;  5E6P A;  2KWC A;  5GMV A;  2KC1 A;  2R2O A;  2NBV B;  2LVP A;  2L8J A;  3QQ8 B;  5D94 A;  2LGY A;  3H7P A;  3HM6 X;  3A1Q B;  1WE6 A;  1P3Q U;  2C7M B;  2CR5 A;  2V4L A;  5KHQ A;  3VH4 B;  4HK2 A;  3UQA A;  3ZDM C;  2G45 B;  4ANU A;  3NHE B;  1C1Y B;  1KM7 A;  2GBK A;  3EHV A;  2BWF A;  3A33 B;  2ZPY A;  2PEA A;  4IW0 A;  1RAX A;  3ECI A;  1GG3 A;  3PRP B;  4WJO A;  3L0W B;  4GMV A;  2HJ8 A;  2JUO A;  2ZZP B;  4GXB A;  4YL8 A;  2M1M A;  2BGF A;  3A1Q A;  1WM2 A;  2J7Q B;  5J18 A;  1E7U A;  5FR6 A;  3VAW A;  4HPM B;  2JF5 A;  4IWQ A;  2UYZ B;  1CMX B;  3IBE A;  3W1S C;  2KHW B;  4PS7 A;  3QCA A;  2LWP A;  1L2N A;  3R66 C;  2L00 B;  2ZCC A;  3DDC B;  4EUT A;  1OEY J;  5HKH A;  2FCS A;  2RR9 A;  2OOB B;  3APC A;  2JVC A;  2D11 A;  3JW0 X;  2JZZ A;  3N3K B;  5AZF A;  2G4S A;  2RPQ A;  5JHA A;  2N4F A;  1ZGU B;  3SHQ A;  4F1S A;  2CU1 A;  2WYQ A;  3UIP B;  3MJW A;  3KYC D;  2BWE S;  1H4R A;  1WJN A;  4FUL A;  4BKS A;  2KFJ A;  1WR1 A;  4IM0 A;  3DVG X;  4II3 B;  1WXM A;  4W9C A;  4F7Z A;  4FHK A;  1BT0 A;  2Z0D B;  2BF8 B;  3QX1 A;  4GDK B;  2MLB A;  5CHV C;  2JPH A;  2N1V A;  1WX8 A;  5IA7 A;  3ONS A;  1Z5S B;  4BOZ B;  2K6D B;  1YD8 U;  4W9L A;  4BFR A;  2N9X A;  1MG8 A;  2JT4 B;  3R7Q A;  3T8M A;  2YVC A;  2J0J A;  3MHS D;  5JHB A;  3BY4 B;  1E8W A;  4AOF A;  3APD A;  3KYD D;  3L16 A;  1OEY A;  2OJR A;  2KDE B;  2LGX A;  3R3M A;  1WM3 A;  2L76 A;  1SE9 A;  1WZ3 A;  2I1J A;  4HLE A;  3W1Y A;  2AL6 A;  4ZRK A;  1NDD A;  4KVG B;  1S3S G;  4I6P A;  3B0A A;  4JLC A;  4RMA A;  2G3Q B;  1GC6 A;  2Z59 B;  4HWI B;  1YJ1 A;  2KDF B;  5E6O A;  3TMP B;  2PE6 B;  2KDI A;  2DX5 B;  3K9P B;  2GBR A;  2HD5 B;  4K81 A;  3TJP A;  4LDT D;  5LXI B;  2BYF A;  2WX0 A;  2ZNV B;  1YX6 B;  1V86 A;  4JL9 A;  4M0W B;  3ZTC A;  4TQ1 A;  2CS4 A;  4JGH B;  4NQL B;  5DPT A;  4XC2 A;  1EO6 A;  2FUH B;  3U30 A;  5C23 A;  2L3Z A;  2J0K A;  2C7N B;  5DCN A;  2D2Q A;  2WX1 A;  1KLV A;  3IG3 A;  4W9F A;  4F8C B;  4PYZ A;  3NZS A;  3Q3F A;  2KN5 A;  1U4A A;  2KJ6 A;  1VD2 A;  1JRU A;  3KUZ A;  1RFA A;  3M62 B;  4IC7 B;  1VCB A;  1Q1O A;  3M63 B;  2DYO A;  5G2N A;  2KTF A;  2C7H A;  2KD0 A;  4EOY A;  4PYU A;  3VUY A;  3WA0 A;  3ZRC A;  3NZU A;  2LVQ A;  4LCD E;  3H6N A;  3U8Z A;  4KSL C;  4WWN A;  1OGW A;  3PHW B;  4CYE A;  1L7Y A;  2GOW A;  1WX7 A;  4ZRJ A;  1E90 A;  3PLU A;  3M95 A;  3A4R A;  3RZW C;  3SDL C;  2K8C A;  3SU8 X;  3PV1 A;  1HE8 A;  4BKT A;  2EKE C;  2DZI A;  3RUI B;  3KW5 B;  2KJR A;  1UBQ A;  3OAW A;  1WJ4 A;  5LLI A;  3NOB A;  3OLM D;  3QAQ A;  4KIK B;  2ZVN A;  3GOE A;  2JY6 A;  1WIA A;  2O6V D;  3L08 A;  4BBN F;  5JH5 C;  2ZNV C;  3N32 A;  3IHP C;  4FJV B;  4N9F 4;  2KQ7 A;  2CKH B;  3DVG Y;  1WE7 A;  2FIF A;  2FID A;  2KLG A;  1E8X A;  4ZRI A;  2MSE D;  2LD9 A;  3I3T B;  2KVR A;  2WWZ A;  3AUL A;  2ZEQ A;  1YIW A;  4KIK A;  2FCQ A;  2HE7 A;  2L7R A;  4KSK C;  4WJQ A;  4BOS C;  4FBJ B;  4URK A;  3PLV A;  4IG7 B;  2M8S A;  2IY0 B;  1S1Q B;  4NAW B;  4TUU A;  4E71 A;  3VXW A;  1J19 A;  3HK0 A;  2N7E A;  2KC2 A;  4RM8 A;  3PS6 A;  3V6C B;  2IYD B;  2XK5 B;  1XD3 B;  3PSE B;  5BO4 B;  2KX0 A;  2GMI C;  4K7U A;  4DHZ E;  3VDZ A;  2LI5 A;  5DPS A;  1V80 A;  2XBB C;  4GIV A;  2LXC A;  4NAW A;  2AEH A;  2IBI B;  2LXA A;  2PE9 A;  3ML9 A;  5AZH A;  4BKG A;  2DHZ A;  4NJ7 A;  2AWT A;  2BPS A;  2N7D A;  3WAP A;  3WAO A;  4W9J A;  3A4S C;  4NPN A;  4FJY A;  3UQB A;  2K8H A;  3AI5 A;  1WRD B;  2NR2 A;  4DDG D;  3RCZ A;  2MBB B;  3TL5 A;  4DHJ B;  2FCM A;  1Q0W B;  3H1U A;  3IFW B;  4MDK E;  2KXJ A;  3LDZ E;  2NS5 A;  1E8Z A;  3VUW A;  3L54 A;  2L0T A;  3D32 A;  4MGI E;  4EZK A;  1V6E A;  2EMS A;  1YQB A;  2HTH A;  3DBL I;  4BVU C;  3VH3 B;  1WXS A;  2CHZ A;  4X57 B;  1LXD A;  2KTR B;  3BIN A;  2KZR A;  4DXA B;  3L13 A;  4K7S A;  4DDI D;  1WGH A;  3B1L X;  2BYE A;  2C60 A;  5DPR A;  5DPW A;  1V9J A;  3QA8 A;  3RT3 B;  4EKU A;  3CMM B;  3VHT C;  1LQB A;  1WGY A;  2KFK B;  3ML8 A;  3PZD A;  3LJ3 A;  4DWF A;  2KTR A;  3Q3J A;  1P0R A;  3ALB A;  4MH0 E;  3QHT A;  4GDK A;  2KJH B;  3ZKJ C;  4EEW A;  2LVO A;  2MBE A;  4WJP A;  3UGB B;  4MEM A;  4XX5 A;  2WDT B;  3ZUN A;  3VTW A;  2MBO A;  1UH6 A;  2KFK A;  1T0Y A;  3DPD A;  2MCN B;  1EUV B;  4I6L B;  2REX A;  2J0M A;  3ZTD A;  4A20 A;  3JVZ X;  2Z0E B;  1V49 A;  1NI2 A;  1XT9 B;  2K25 A;  1WI0 A;  3JYU A;  1FXT B;  2D3G A;  2NVU I;  3SD5 A;  4KV2 A;  4RM9 A;  4BKS D;  3QAR A;  4WWP A;  3L10 B;  4G11 A;  3HIZ A;  2D10 A;  4WQO B;  4MGK E;  4IM3 A;  1IPG A;  2LZ6 A;  2IY1 B;  3QC8 B;  4A3P A;  1I35 A;  4EFO A;  2K1F A;  1WGD A;  2YLM A;  4CHK A;  2D07 B;  2PPH A;  4FA6 A;  1TGZ B;  2LRU A;  2KAN A;  3A9J B;  4NNJ B;  3X23 A;  3KH0 A;  3OJ4 B;  4I6N B;  4LJP B;  3U7D A;  3CST A;  3AXC A;  4GB9 A;  4ICU A;  2V1Y A;  4M8N A;  2O6V B;  1UEL A;  1GUA B;  2JXX A;  2ZJD A;  2R2Q A;  5CX3 A;  5D7G A;  3RYT A;  1V5O A;  4GOC A;  5EDS A;  4W9H A;  3EEC A;  2JRH A;  3EFU A;  3A9J A;  3VQI A;  4AJY B;  5J2R A;  1KOT A;  3DVN V;  1SIF A;  2M17 A;  4A3O A;  2KOX A;  4W9I A;  1IYF A;  4B9K A;  3MTN B;  3ZNG C;  1QZE A;  3APF A;  3KUD B;  4DHZ B;  3O65 B;  3JSV B;  4AP4 C;  2Y5B B;  2FCN A;  4W9E A;  2C5L C;  3VUX A;  5L83 A;  1GJZ A;  2DZK A;  4IWO A;  3ZNI D;  4II2 B;  1WR6 E;  1RLF A;  2RGF A;  3QWZ B;  2KMA A;  2MBH A;  1OQY A;  3V61 A;  4KDI C;  4GDL B;  3ZDT A;  1J8C A;  2EMT A;  2QHO A;  2K8B A;  2JRI B;  4GGQ A;  3RZF A;  3JSV A;  3ZNH B;  2L0F A;  3AU4 A;  4HPL B;  4NJ6 A;  1WJU A;  1EF1 A;  1YX5 B;  4ZDV A;  1GC7 A;  4KZ0 A;  2CHW A;  2KNB A;  5C1Z A;  2RD0 A;  4TQ0 A;  4OVU A;  4GU2 A;  4HXD A;  4B6W A;  1WH3 A;  1KJT A;  3DBH I;  4WWO A;  2ZCB A;  5L95 C;  3DBR I;  4WJN A;  1P9D U;  2IO0 B;  2M0X A;  4K7W A;  3WAL A;  5IAA C;  3DCG A;  4PS3 A;  3WIM A;  4LJO B;  3PTF C;  3M3J A;  3VTU A;  2KWU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...