1Z5SB

Crystal structure of a complex between ubc9, sumo-1, rangap1 and nup358/ranbp2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Insights into E3 ligase activity revealed by a SUMO-RanGAP1-Ubc9-Nup358 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 14
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1z5sB00
4FN2A 2O2VA 2R2QA 3PLVA 4MGZE 5D7GA 2KDFB 4GGQA 1WIAA 2PE9A 1R4NI 1WXVA 2KDIA 1IPGA 3ZTDA 4PS7A 3RZFA 1V86A 1G6JA 2IZVB 4BOZB 3AU5A 3DVNU 4GB9A 2LASA 1GG3A 2D2QA 3KUZA 3N30A 2L05A 2XEWA 2BF8B 4RM8A 4FJYA 4X57B 3L17A 2N7DA 5E6NA 2WDTB 3BY4B 4AJYB 4W9GA 1D3ZA 3ZVVA 2MLBA 4BFRA 4DBGA 1V9JA 2Y5BB 1UELA 2UWQA 5D2MB 3VVWB 3TIXA 2GBRA 2LRWA 4KIKB 4FULA 2L0TA 2KQ7A 5DPSA 1WY8A 2KHWB 3DVGY 4JIOU 2L76A 4B9KA 3ZTCA 2BKFA 5JHAA 4DDGD 4G50A 3RZWC 2KQSA 2D3GA 3EHVA 3B1LX 4NAWA 2KTRB 3A33B 4TUUA 2IO0B 1LFDA 1Y8RC 2J0MA 3HM6X 4JLCA 1GNUA 1WR1A 2MBEA 3NZUA 1C1YB 2K8HA 4NNJB 4HPMB 2LD9A 2ZVNA 3QX1A 3ZDMC 2WYQA 5KHOA 3UQBA 3QA8A 2ZCBA 4RM9A 2KJRA 2ZZPB 2W9NA 4EEWA 2A5UA 1SGHA 3ECIA 2FCQA 4WJQA 3GZNI 4I6PA 5DCNA 4FADA 3A9KA 4WAAA 3VTWA 1OTRB 4HVBA 3RCZA 4LDTB 5C23A 4MELA 2EMSA 1E7UA 3PRMB 3H7SA 4WQOB 2C7HA 3VH3B 4F8CB 2K6QA 2NR2A 4GDKB 4W9EA 4ANVA 1PQSA 2KN5A 2JZ3B 2LI5A 1T0YA 1E8YA 1WRDB 5LLIA 3V61A 2N9EB 2MSED 2MP2A 3DBHI 1OEYJ 1SE9A 3DCGA 1WXSA 2DZMA 4XX5A 2GBMA 4W9LA 1OGWA 5CTRC 1V49A 3MTNB 4URKA 2CS4A 3CMMB 2WWZA 1UGMA 2KDBA 2LRUA 2OOBB 1M94A 2BYEA 3PZDA 2KWUB 1I35A 2KFKB 3PSEB 3CSTA 2O6VB 2MBBB 2KTFA 2NBWB 4DHJD 2N1WA 2KVRA 4PYUA 5G55A 3PT2B 2NPTB 1WM2A 3TCAA 3X0WA 1TTNA 4GSWA 4EUTA 2QHOA 1J19A 3K9OB 3GOEA 1WZ3A 2C9WB 3T8MA 2L3ZA 4GDLB 1S1QB 4NQLB 2ZNVC 2KO3A 2KK8A 4GMVA 3M62B 3QHTA 4XC2A 3QQ8B 4BKSD 4ANUA 4K7UA 4J6IA 4DDID 1WR6E 2V4LA 1J0GA 3VH4B 3U8ZA 3NS8A 4MGIE 3LDZE 3UQAA 3A9JB 3VTVA 2J7QB 1WX9A 3APCA 2DX5B 4AOFA 4HWIB 2M0XA 4IG7B 2FCSA 3PRZA 2ASQA 2KJ6A 2NBUA 1WH3A 2HJ8A 1WX7A 2DYBA 4MJSA 4A3PA 4BKTA 2DYOA 3IVFA 1S3SG 3PTFC 2G3QB 5C1ZA 1H4RA 4W9IA 5TR5A 1OQYA 3AULA 4G3XB 1ZKHA 4XZ4A 3N32A 2KANA 2KFJA 2AL3A 2KC1A 3NZSA 5CX3A 2MBHA 3Q3JA 2YLMA 1TBEA 2MA9B 3PHWB 4ZRKA 3MHSD 4BKSA 3DBLI 1WM3A 4W9FA 3AU4A 1P98A 3HHMA 4FHKA 3SU8X 4HLEA 2RR9A 2LVPA 4FLHA 3TBLD 2KOXA 4M8MA 4WJNA 2K8BA 2G45B 3W1SA 4W9DA 4GN1A 2KLCA 4II2B 1YD8U 2KDEB 4K7SA 1WE6A 3VTUA 1KOTA 2D10A 4IWPA 3WALA 4EFOA 4BKGA 3ZUNA 4HK2A 2KMCA 3ZLZA 3NHEB 5KHQA 1FXTB 4A20A 4HDOA 4FA6A 2DENB 1E90A 3MJWA 2Z0EB 1P3QU 3WA0A 3VXWA 3VUYA 2Z0DB 1Z5SB 3DPDA 4E71A 4G11A 5JHBA 4CO7A 2LXAA 3NOBA 3OJ3A 1WGYA 4CYEA 1WZ0A 2D07B 5J2RA 2WX1A 5JH5C 5E6OA 3PVLA 2KX3A 1WX8A 1WGHA 2JPHA 3RD2A 2NVUI 1AARA 3TJPA 1V5OA 3HM3A 1WGRA 1V81A 3H9DA 4FHJA 2JVCA 1YJ1A 4OVVA 4DHZB 3K9PB 2BWFA 3WAOA 5CHFA 3M3JA 4ICUA 1TGZB 3V62A 1WGGA 2KZRA 1HE8A 3B0AA 2LVOA 2J0JA 3KH0A 4LCDE 4WWOA 4DWFA 4P7IA 2WX0A 4BBNC 3SD5A 2ZCCA 2JT4B 4I6NB 2XBBC 1IP9A 4W9KA 3WAPA 2LWPA 3QK0A 4FBJB 4WWNA 3DQVA 4IUMB 3WANA 3SHQA 1RFAA 4FJVB 4B95A 4KVGB 1WJ4A 3KUDB 4LJPB 2A4ZA 1V2YA 4ZRJA 3B08A 4GIVA 1A5RA 4YL8A 3QIJA 2Z59B 3HK0A 2PJHA 2N9XA 1WE7A 2ZJDA 2DZJA 3JVZX 2EKEC 4MSQB 1E8WA 5AZGA 4KIKA 4A3OA 3TL5A 2HE7A 3A4RA 1MG8A 2FIDA 2ZEQA 1TZ1A 3PV1A 2FCMA 4KZ0A 3L13A 3OAWA 4K1RB 2XK5A 2GMIC 3TMPB 3ZIMA 2NCNA 4FJZA 3WAMA 2KTRA 4IWOA 3ZKJC 4MM3A 2DZKA 3IHPC 1RAXA 3CSFA 2M4NA 1EUVB 2PE6B 2K8CA 3ZO5B 3L0WB 2D11A 3JSVB 3VAWA 5LXHA 2M8SA 3JW0X 1UBIA 5E6PA 2MBOA 2KD0A 1Z2MA 1UD7A 3T9LA 3VUXA 2L8JA 1YIWA 2REXA 2L0FA 4ZYNA 2ZVOA 3RT3B 2CHXA 5AEKB 4HPLB 4CHKA 4TV3A 1CMXB 2BGFA 1NDDA 4GDKA 3ML8A 4M8NA 5BO4B 4JGHB 3ZNHB 2C7MB 3EFUA 4DHJB 1XT9B 1E5WA 2FNJB 4KZCA 5DPRA 1UZXB 4ZDVA 3H7PB 3KYDD 3V6CB 1ZW7A 2LGXA 3EC8A 2RGFA 5DPWA 3L16A 3ZNID 2JRIB 4HCPB 4ANXA 1K8RB 3OLMD 3QC8B 3KYCD 1VD2A 4E3CA 5DPTA 2FAZA 1P1AA 3C0RB 3ALBA 4ASWC 3ZRCA 3QARA 4IM3A 2KFKA 1WMHB 2KWVB 1LXDA 2JXXA 2O6VA 1Q1OA 1EO6A 2BKRB 2N7EA 4DK5A 4WJPA 1P0RA 1Q0WB 3IBEA 2O2VB 2BYVE 2NPTA 1V6EA 5CHVC 1ISNA 1WGDA 1WJUA 3H6NA 2C7NB 3P2BA 3L54A 1NI2A 4MH0E 4IW0A 2IY1B 4EKUA 1JRUA 4BVUC 2N1VA 2MX2A 4LJOB 2LJ5A 2BYFA 2JUOA 3VHTC 5JZEB 5L95C 2MQJA 2IY0B 3PGEA 3H1UA 3RYTA 1GC7A 1LQBA 3ML9A 2YVCA 3A9JA 3L10B 3PPAA 4HJKA 1WXMA 1I42A 2DAJA 3I3TB 4DHZE 2FUHB 1KM7A 1YQBA 4HDQA 4MEMA 4KDLB 2BWES 3R66C 4IM0A 1R4MI 2PPHA 1E8XA 4I6LB 3UF8A 4GXBA 1GC6A 2HTHA 4KDIC 3A1QA 3QAQA 4NQKE 4WWPA 3VQIA 2DZIA 3CF6E 3U7DA 4IC7B 4TQ0A 2G4SA 3PRPB 2JWZA 5D94A 4NAWB 3DDCB 2MCNB 2I1KA 1WXAA 4TQ1A 2HD5B 4F1SA 4II3B 4ICVA 4IM2A 1XQQA 3IG3A 4GU2A 4EZJA 2MWSB 1NBFC 4NJ6A 3AXCA 1WI0A 3R7QA 2M1MA 3BINA 3VFKA 4W9CA 4ANWA 4W9JA 2L00B 2MBQA 2GBJA 2LUEA 1KLVA 5IAAC 3WIMA 1ZGUB 5J18A 1E7VA 1KJTA 3A9KB 1L2NA 2AWTA 3NY5A 4JQWC 1X1MA 3AI5A 4NY0A 3QCAA 1QZEA 2KKCA 5HKHA 2K6DB 3S2AA 1LM8B 1BT0A 2MP2B 2MRPA 2K1FA 2XK5B 2IYDB 2KX0A 1WF9A 2OJRA 2RSUA 4K81A 2CU1A 3O65B 4PS8A 1P9DU 2KNBA 3APDA 2GOWA 3RULA 4LDTD 2N4FA 1WJ6A 4EZKA 2KWCA 1EF5A 2FCNA 1C3TA 3UIPB 3R7RA 5G2NA 2AEHA 2VRRB 4KSKC 2K39A 5AZFA 1V5TA 2KXJA 4TKNA 2JZZA 2K25A 2KJHB 3A4SC 3QWZB 4BOSC 2DHZA 4AWJA 5FR6A 2JY6A 2RPQA 3PLUA 4EOYA 3D32A 5CHWA 2LGDA 3X23A 3LJ3A 2KLGA 3ZDTA 5IA7A 3QJZA 2ZPYA 1WJNA 4AP4C 1V80A 3EECA 1OEYA 4NJ7A 2CHZA 2IO3B 3ZNGC 4MGYE 3OJ4B 4PYZA 5EDSA 3VDZA 4AUQC 2V1YA 3PS6A 4E74A 1F9JA 2O6VD 4KV2A 1YX5B 1WFYA 3M95A 3DVGX 1XD3B 3HIZA 4MJSB 2LXCA 2BPSA 4IWQA 2NS5A 4AJWA 1SIFA 2JRHA 1RLFA 2CR5A 1E8ZA 2LGYA 5D6JB 3U30A 4HCNB 2B3AA 3DOWA 3ONSA 3V60A 3R3MA 4B6WA 3UINB 1H8CA 2MW5A 2M17A 4K7WA 3W1SC 4JL9A 2EMTA 1J8CA 1IYFA 2C5LC 1WYWB 3DBRI 4MDKE 2AL6A 3JSVA 3M63B 3SDLC 3ZNZB 2IO1B 4OVUA 2LZ6A 2IBIB 5AZHA 1GUAB 2I1JA 3UGBB 4G0NB 3ZRFA 5LXIB 2DYMA 3RUIB 3APFA 1GJZA 3Q3FA 2FIFA 4MSMB 4N9F4 1UBQA 5GMVA 1L7YA 2ZNVB 2KMAA 5J17A 3W1YA 4GDLA 3N3KB 1RRBA 3PHXB 2DAFA 2KC2A 4HXDA 4DXAB 3DBSA 3KUCB 4M0WB 1Q5WB 2LVQA 3A1QB 3VUWA 1UH6A 4GOCA 4KSLC 1EF1A 3ZW3A 2NBVB 4ZRIA 3V6EB 2GBNA 1U4AA 3H7PA 3KVFB 4NPNA 2RD0A 2V3SA 2GBKA 2L7RA 3PREA 2J0KA 2CHWA 5L83A 3KW5B 4WJOA 2JF5A 4PS3A 2G4DB 4EZLA 3JYUA 2ZPNA 2N9PC 4F7ZA 3IFWB 3DVNV 1WMHA 2C60A 3ENEA 3L08A 4MGKE 2R2OA 2CKHB 1YX6B 3UIOB 2PEAA 2AYOB 2UYZB 2IO2B 4W9HA 4RMAA 4BBNF 1VCBA
chains in the Genus database with same CATH superfamily
1GOZA 2UU7A 5D7GA 1WIAA 1WXVA 1IPGA 3RZFA 4RNAA 1V86A 2H88B 1G6JA 3AU5A 3DVNU 2LASA 3DWMA 5E6NA 2WXGA 4W9GA 2MLBA 2Y5BB 1UELA 3VVWB 2RDGA 1PFDA 1L0VB 3TIXA 3AE4B 4KIKB 1XXGA 5DPSA 1WY8A 3DVGY 1YN3A 3SEBA 4LNKA 1FCCC 4MM3B 4JLCA 1GNUA 1BUIC 2MBEA 4PK1A 1C1YB 4NNJB 2LD9A 5HFYA 3UQBA 2ZCBA 2LUMA 4RM9A 2W9NA 3ECIA 4WAAA 4HVBA 3VTWA 1KH0A 1VR9A 4WQOB 4A6QA 4GDKB 5G5GA 1CZPA 2JZ3B 1D6EC 1T0YA 2LI5A 1WRDB 2MSED 1OEYJ 1JALA 4XX5A 3IT4B 3BYTB 2IGDA 4KKIA 1V49A 4URKA 2CS4A 3AMZA 2J52A 1PDXA 4ARIA 1JROA 3PZDA 2Q5WD 3CSTA 2WXLA 2Z8LA 2O6VB 2MBBB 2KTFA 3N20C 4HRSA 5JXVA 5IN7A 1J19A 4Q2JA 1RFKA 2L3ZA 3Q8AA 4GDLB 1S1QB 4NQLB 3MC8A 4GMVA 3M62B 3QHTA 4P1CC 3R2TA 3AEBB 1BMLC 4DDID 2WDRB 5FKAC 3OG5A 1UUPA 3U8ZA 3UQAA 1P7FA 3AM9A 2DX5B 3VRAB 2FCSA 2IDYA 2ASQA 2K5PA 4YTMB 1HZ5A 1HTOA 3TUOA 3AULA 4XDDA 1PGAA 3NVWA 2PVOD 2MHJA 3NZSA 2KC1A 4ACFA 1TBEA 1YQ4B 1N5XA 4W9FA 3ETRA 1P98A 4XGAB 4HLEA 2LVPA 3Q3OC 4FLHA 3TBLD 2BVCA 4M8MA 2K8BA 3W1SA 3RNBC 1KRHA 1JRPA 4N58A 3VTUA 4IWPA 1L0YB 4HK2A 2KMCA 3ZLZA 1JMLA 4M0WA 1E90A 1I4HA 3ZJUA 1T0QC 1P3QU 3VXWA 4WURA 1ET6A 4G11A 4CO7A 5J2RA 1UF0A 1WZ0A 2D07B 5JH5C 4N59A 4A90A 2L52A 3RD2A 3TJPA 2V9HA 1V5OA 1WGRA 3H9DA 4DHZB 1YJ1A 3K9PB 2WXOA 2FE8A 5CHFA 2KZRA 4P6VF 1TS5A 4L23A 1QF6A 2J0JA 4P7IA 3NJTA 3TEXA 4I6NB 3QK0A 4FBJB 1VRAB 4IUMB 3WANA 4FJVB 1WJ4A 2GLSA 4LJPB 2A4ZA 4YL8A 2PJHA 3JVZX 4MSQB 2INNE 3A4RA 2FIDA 1A70A 2FCMA 1YQ3B 5LNK1 3ZKJC 3CSFA 3E9SA 3JSVB 5LXHA 2M8SA 3JW0X 1UBIA 1C78A 5E6PA 3P4QB 1AN8A 1YIWA 2L0FA 4ZYNA 3RT3B 1FO4A 2LMCA 1WWTA 1YJIA 1NVID 1NDDA 2WXFA 3ML8A 3Q8CA 5BO4B 1CQVA 2BS3B 2C7MB 4DHJB 1TY2A 1XT9B 5T8IA 1B1ZA 3OWEB 4ZDVA 3H7PB 2HJ1A 1SSNA 4HCPB 3FC4A 5BYRA 3OLMD 3QC8B 4E3CA 2VH1A 4ASWC 3ZRCA 3QARA 1LXDA 2NTTA 2JXXA 3AEAB 4DK5A 4WJPA 1MFWA 1ISNA 2VZKD 4ZRQA 2C7NB 3L54A 4LNNA 3Q69A 4BVUC 2BW2A 3VHTC 4FXCA 2MQJA 3H1UA 1N5WA 4C80A 3L10B 3PPAA 1WXMA 3I3TB 3RNAC 1YQBA 3DBLB 4RGTA 1FFUA 3BK1A 1E0ZA 2YEPB 1DGJA 3VQIA 4LNFA 4TQ0A 2G4SA 2WU2B 4NAWB 5HG2A 2MCNB 1WXAA 2E3TA 4II3B 4ICVA 3BWUD 3AEDB 4ITKA 2MWSB 4J3OD 3AXCA 4NAMA 2L00B 2GBJA 3WIMA 2SAKA 5J18A 3R8BA 1YOVB 3A9KB 2AWTA 1YMHE 1M4VA 4ZHOA 3O13A 4HROA 3FILA 4HJGE 3W2DA 2KKCA 3Q8BA 2K6DB 2MP2B 4A8XC 3HVZA 1ESFA 2KNBA 3U52E 4LDTD 1WJ6A 4QAYA 2V4IB 1MI0A 3V05A 1C3TA 1MPEA 1DYQA 4KKJA 4KSKC 1WXQA 4KGRA 2KXJA 5D3DA 2MEKA 2KJHB 3QWZB 5FR6A 2JY6A 2RPQA 3L4PA 2LGDA 3ZDTA 4AP4C 4NJ7A 4B0EA 4MGYE 3VDZA 2V1YA 3PS6A 3M95A 3H8HA 3HIZA 1F2RI 4AJWA 2JRHA 2CR5A 3ZXRA 1MHXA 4HCNB 2B3AA 2RDBC 2CJNA 2XN9C 4YTPB 5IKCM 1ZDVA 2C5LC 3SDLC 3TEYA 3P42A 2ON8A 4G0NB 1TT5B 4HEA1 4MSMB 1UBQA 1J7BA 5GMVA 2KMAA 5AUIA 2KYWA 2OEDA 2DAFA 2MJDA 3DBSA 4S17A 3I63C 2LVQA 4DQOC 4GOCA 4D2KA 1EF1A 1XLOA 2GBNA 3UI3A 3TSSA 3NRZA 4WJOA 4EZLA 4F7ZA 3AE9B 3P4RB 3L08A 2CKHB 3UIOB 2PEAA 2AYOB 2UYZB 2IO2B 4RMAA 4BBNF 1VCBA 4FN2A 2B76B 4MGZE 2PE9A 2KDIA 2SEBD 2HTME 2IZVB 1ZUD2 1QKZA 3N30A 1KTKA 4RM8A 4FJYA 3L17A 2WDTB 4AJYB 4BFRA 4DBGA 4MH8A 2FUG1 2UWQA 1WGKA 4FULA 3VR9B 2KHWB 1TJEA 2L76A 4OZBA 2BKFA 4DDGD 4G50A 3RZWC 2X8XX 4DXFA 3EHVA 3B1LX 2LGSA 2BS2B 4YSYB 2IO0B 1LFDA 1Y8RC 1IUEA 5AUKA 4HPMB 2ZVNA 3ZDMC 1QOFA 2ZZPB 4EEWA 4RGOS 4RH6A 2KN4A 4WJQA 5DCNA 1FM0D 2JZPA 1LGRA 1OTRB 3ZQ4A 4R3DA 5C23A 1E7UA 3H7SA 3VH3B 2K6QA 2NR2A 1PQSA 4BAXA 1C9FA 2W3RA 1NENB 4JWUC 2JX5A 1MJDA 4OZCA 1SE9A 3I9V1 1WXSA 2DZMA 1YN4A 4W9LA 5CTRC 1UGMA 2OOBB 2BYEA 2KFKB 2DLBA 1TKEA 2KVRA 5G55A 1GB1A 3PT2B 1WM2A 1TTNA 3K9OB 3GOEA 1V8CA 2JYTA 2MH7A 2ZNVC 4ANUA 4K7UA 4J6IA 1WR6E 4MGIE 3LDZE 1P7EA 2J7QB 3B2FA 1PGXA 4AOFA 4A55A 4M02A 2KJ6A 5EE9A 1WH3A 4BKTA 2DYOA 4JE3B 5TR5A 1OQYA 2Y5CA 1XO3A 3FKYA 1K53A 4GLSC 3N32A 2KFJA 5CX3A 2MBHA 3Q3JA 2YLMA 4BKSA 1J7CA 1NI3A 2DBYA 4C00A 2KOXA 4WJNA 3VRBB 2CJOA 1EM7A 2K22A 4II2B 4BZAA 1YD8U 2G1EA 4YSXB 3WALA 3NHEB 5KHQA 4HDOA 4FA6A 2KACA 5FK9C 3WA0A 1T5XD 3VUYA 2Z0DB 1Z5SB 3DPDA 3RNGC 5BMIA 1VLBA 3OJ3A 4CYEA 2JXTA 1XLQA 2WX1A 5E6OA 3PVLA 3AN1A 1IBXB 2NVUI 3W9CB 1I4RA 3RN9C 4KX6B 2BB6A 3WAOA 3M3JA 4ICUA 3V62A 1HE8A 1SF0A 1JWAD 4DWFA 3KH0A 4WWOA 2WX0A 1N62A 3SD5A 2INDC 2XBBC 5IO9A 1IP9A 4W9KA 2LWPA 1ENFA 1F0ZA 1V97A 3SHQA 2OJWA 4KVGB 3HRDD 1V2YA 3QIJA 4XE0A 2N9XA 1WE7A 2ZJDA 2EKEC 1HEZE 2HE7A 3PV1A 3L13A 4K1RB 3BIID 1C77A 3GZNB 2KTRA 1JWSD 2PE6B 3ZO5B 3NVZA 2QC8A 4WH4A 1YJJA 1YN5A 2KD0A 2D3BA 3Q8FA 2ZVOA 2X38A 4HPLB 4TV3A 1FXIA 1F52A 4JGHB 3GE3C 4WWMA 1TYGB 2FNJB 2LHDA 2PVGC 3V6CB 1ZW7A 2LGXA 3Q2AC 2JRIB 1F1HA 2WXRA 3KYCD 1VD2A 1FNVA 2FAZA 3C0RB 5D3IB 4K3CA 1EO6A 1EU3A 1QT9A 1WRIA 1SE2A 2NPTA 1HZ6A 1OFFA 2BBCA 4LJOB 2LJ5A 2BYFA 4HKQA 2KQ4X 2YVCA 3A9JA 1I42A 2DAJA 2WDVB 4MEMA 3R66C 3I57A 4IM0A 2PPHA 1E8XA 2N7JA 4LNOA 1ZOYB 3QAQA 2DZIA 3CF6E 4IC7B 4YSZB 3P4SB 4F1SA 2I1KA 1R4NB 3GS2A 2GI9A 3IG3A 2D3AA 4EZJA 2K0PA 1GB4A 4LLGM 2M1MA 2KT7A 2AQ3B 4W9CA 4ANWA 4W9JA 2MBQA 2LUEA 4L2YA 1E7VA 4RF0A 5H8YE 3SR6A 1L2NA 3NY5A 1X1MA 1RM6C 3QCAA 4HPPA 1LM8B 1BT0A 2MRPA 2IYDB 2KX0A 4XDCA 3O65B 2WXQA 4PS8A 2GOWA 1XF5L 3Q3MC 2KWCA 2L83A 2PLPA 5BYSA 5G2NA 2M0AA 3AE8B 2VRRB 1SXTA 1FNUA 3AECB 4LNIA 4TKNA 2DHZA 2WXPA 3PLUA 5E6JA 3X23A 3QJZA 5EE3A 2WNMA 2Y3AA 1V80A 1OEYA 3BYYB 3C19A 2AQ1B 3OJ4B 2W3SA 5EDSA 2O6VD 4OZAA 1XD3B 4IWQA 2NS5A 2J42A 1SIFA 2LGYA 5D6JB 3ONSA 3R3MA 4NZLB 3UINB 2IJ0A 2AQ2B 2M17A 2MW5A 3KWVA 4K7WA 3W1SC 4JL9A 4M00A 1J8CA 4MDKE 1FNWA 2AL6A 2I1JA 1SIJA 2LHEA 3ZRFA 1FEHA 1C4CA 5HI1A 3U7ZA 1V1PA 5J17A 3W1YA 5G5HA 3N3KB 5BMGA 2QSDA 1QLBB 4M0WB 3CIRB 1UH6A 1ET9A 1RWSA 4ZRIA 3KVFB 2PTLA 1ZXIA 2J0KA 3KLSX 1Y56A 3CWIA 1WMHA 4MGKE 2R2OA 1YX6B 4W9HA 2O2VA 3PLVA 4GGQA 1R4NI 5C2TB 4B0MA 4PS7A 4IDIA 3MP9A 3W5UB 1KFYB 2J4XA 4BOZB 3TEWA 1D5XC 3KUZA 2L05A 2XEWA 2N7DA 3BY4B 1V9JA 1UNSA 5D2MB 1N63A 2GBRA 1HTQA 2WXMA 4WAFA 4B9KA 2M56B 5JHAA 2KQSA 2D3GA 3MC0B 3A33B 2J0MA 1WR1A 3NZUA 2K8HA 3RNFC 2WYQA 2K3UA 2KJRA 1T3QA 1SGHA 5IOIA 3MC9A 4P16A 1EWYC 3RCZA 3BVMA 4MELA 1XCQL 3C8YA 3PRMB 4F8CB 2C7HA 1FRRA 2PKOA 2KN5A 2AX5A 3NG0A 5LLIA 3V61A 2CU3A 1Q10A 3DCGA 4ZHPA 2GBMA 3N1YC 1FD6A 3MTNB 3CMMB 2WWZA 1TS3A 2KDBA 2IPKD 2LRUA 1M94A 3MFGA 3PZ7A 4AQ7A 1I35A 3PSEB 1MG4A 2ZW0A 4DHJD 2N1WA 4PYUA 2QJLA 3TCAA 3X0WA 1UWMA 4EUTA 2Y5PA 2QHOA 2W54A 1WZ3A 2QCZA 3LYYA 2KK8A 3IT6B 3QQ8B 1J0GA 2YEPF 3VH4B 3NS8A 3VTVA 1WX9A 1NYRA 2M0XA 1STEA 1J7AA 2INCC 2NBUA 2HJ8A 4MJSA 1WX7A 2DYBA 3PTFC 5C1ZA 1TY0A 2WLBA 4W9IA 4S0RA 2KANA 2AL3A 2MA9B 3MHSD 4LTUA 3DBLI 1WM3A 1SBBB 3SU8X 3HHMA 3P63A 2RR9A 4A9AA 4GN1A 2GRIA 2KLCA 4TSSA 4C4VA 3NVYA 1T0SC 3BZDB 3BVGA 3RPFC 1KOTA 2D10A 3ABVB 4EFOA 1FRDA 4BKGA 3ZUNA 4HKZE 1FXTB 3FILB 4A20A 2BQQA 2DENB 2J53A 1JWUD 1WSPA 2FBWB 3RNCC 1C76A 3NOBA 3Q3NC 1L5PA 1D5MC 2L32A 1WGHA 2JPHA 3HM3A 1V81A 4OVVA 4RFBA 1QOBA 2BWFA 2WGSA 4JWSC 1WGGA 1KLGD 3EA6A 2LVOA 1C4AA 1HA5A 1KF6B 4YTNB 3WAPA 1E9MA 3DQVA 1UWXA 1RFAA 2N9LA 4B95A 3N9YC 3KUDB 4ZRJA 4JX1C 2XNAC 4GIVA 3HK0A 1C79A 4H2AA 2DZJA 4KIKA 4A3OA 4L1BA 3TL5A 1MG8A 2ZEQA 1TZ1A 4KZ0A 3OAWA 2GMIC 3NS1A 3ZIMA 3WAMA 4IWOA 4MM3A 2DZKA 1EUVB 3VAWA 3W5VB 5BMHA 2BYTA 1K50A 1UD7A 1XCTL 3T9LA 3VUXA 2L8JA 5MPOA 3N1XC 2DWQA 2BS4B 1B9RA 1SE4A 4GDKA 3EFCA 2WXNA 3ZNHB 3EFUA 4KZCA 5C3JB 5DPRA 1UZXB 3KYDD 3Q6BA 4LK0M 4P1BC 5DPWA 4ANXA 3GE8C 2W55A 2ACZB 1P1AA 3RMKC 2KWVB 2O6VA 1Q1OA 2BKRB 2N7EA 4OVZA 2LGIA 2WXHA 1Q0WB 1V6EA 5CHVC 5BYQA 1WGDA 3RFZB 1VZ7A 1NI2A 4MH0E 2IY1B 4EKUA 1JRUA 5L95C 2MJEA 1QOAA 3PGEA 1QOGA 3Q8EA 3B9JA 1LQBA 3PO0A 1L6VA 2IGGA 4HJKA 4DHZE 2FUHB 1KM7A 2BWES 4OHJA 1RYJA 4YWGG 3UF8A 3ZJVA 2HTHA 3A1QA 4OW0A 2RMMA 4NQKE 4WWPA 3U7DA 3PRPB 2QILA 4IM2A 1NBFC 1E10A 3AE7B 1SE3A 3P1MA 2WXKA 3ZYYX 3BINA 3VFKA 1SJED 1V1OA 3T3OA 5IAAC 1ZGUB 1T0RC 4JQWC 2L1AA 3HVDA 1QILA 4NY0A 1GPXA 4RCOA 5EE0A 2W82A 1L4ZB 2K1FA 2KAJA 3T3NA 5HHDG 2JU6X 1P9DU 1ZDXA 3SFDB 2N4FA 1EF5A 2WXJA 1D4BA 3UIPB 3ZGZA 4DXGA 2K39A 2I38A 5AZFA 2K25A 1F77A 4AWJA 4EOYA 1N61A 2QDFA 2WHIA 3D32A 2K9XA 2KLGA 5IA7A 1VJKA 1WJNA 4RGNA 3SFEB 1DOYA 2WXIA 1OQQA 3DBHB 4PYZA 1F9JA 4KV2A 5GXGB 1WFYA 3DVGX 1AW7A 4UDUC 1RLFA 1E8ZA 3KQ4A 2QMTA 1H8CA 5EE1A 1WYWB 1TKGA 3JSVA 2IO1B 3UGBB 5LXIB 2GB1A 2FIFA 2BTEA 3LXFA 1L0XB 1L7YA 1RRBA 2KC2A 4DXAB 2WDQB 1Q5WB 4US9A 2WQYB 1YNTE 3A1QB 4KSLC 1JQ4A 4REZA 3V6EB 2VZKB 3H7PA 2WP9B 4NPNA 1GAQB 2RD0A 1FPYA 5L83A 2JF5A 4PS3A 3RI7C 3JYUA 3TEZA 4YT0B 2N9PC 4AS1A 3IFWB 3U4EG 4WIPA 2C60A 2ICIA 1TZOA 1PGBA 2INPE 2R2QA 2KDFB 3ZTDA 1L6UA 2V0GA 3MHZA 1NEKB 4GB9A 1GG3A 2D2QA 1TS2A 1HXYD 2BF8B 4YXDB 4X57B 1D3ZA 3ZVVA 1KLUD 4TMAB 1PYWD 3WCQA 2LRWA 1AYFA 3IAM1 2L0TA 1ACCA 2KQ7A 4JIOU 3ZTCA 1PUTA 1ZE3D 3AEEB 1MVKA 3DHGC 4NAWA 2KTRB 4TUUA 3HM6X 1FXAA 2LEKA 3QX1A 5KHOA 3QA8A 3DWGC 1D5ZC 2A5UA 2FCQA 2PMVA 3GZNI 4I6PA 4FADA 4PT5A 1BXTA 2R61A 1VZ6A 3A9KA 3IAS1 3J9CA 2JYEA 4LDTB 2LFIA 2EMSA 4W9EA 4ANVA 1E8YA 2N9EB 3DBHI 2MP2A 2HDEA 3AE6B 1OGWA 3DHHC 1SJHD 3E56A 2G9HD 3DHIC 1EU4A 2KWUB 2OHFA 3KWLA 1F2RC 2NBWB 4K3BA 4XWTA 2M19A 2KDMA 2NPTB 4M01A 4GSWA 1JW9D 1ZXHA 3T8MA 2C9WB 2KO3A 4BKSD 4XC2A 3ZJTA 2V4LA 4ARCA 3A9JB 1AWDA 1IGCA 3APCA 4HWIB 5TSSA 4IG7B 3PRZA 4KGSA 4A3PA 1N60A 2IGHA 1S3SG 3IVFA 2G3QB 1H4RA 4US8A 3AE5B 4G3XB 1ZKHA 4XZ4A 1NYQA 3MJ5A 1ZPSA 3PHWB 4ZRKA 3AU4A 4FHKA 3BVZA 1FMAD 3NVVA 2N0SB 2G45B 1L4DB 4W9DA 1CK1A 1R7SA 2KDEB 4K7SA 1WE6A 1I7HA 4ZOHC 1R4MB 3MJWA 2Z0EB 4E71A 5JHBA 2V3NA 2LXAA 1WGYA 1E7PB 3AB5A 2KWDA 2KX3A 1WX8A 1AARA 1IGDA 4FHJA 1MHHE 2ONQA 2JVCA 1TGZB 2ZW1A 3B0AA 3V3XA 4LCDE 2JWUA 4BBNC 2ZCCA 2JT4B 4MT5A 4WWNA 2JQRB 2WU5B 1VDVA 1C4PA 2WS3B 3AH7A 3R2IA 4N6EB 2VH2A 3B08A 1A5RA 2Z59B 1E8WA 3AEFB 5AZGA 1E6EB 3EUB2 1CJEA 2XK5A 2D3CA 4RGMA 3TMPB 4XWWA 2NCNA 4XYCA 4FJZA 2PIAA 1N6ZA 3IHPC 1RAXA 2M4NA 2K8CA 3L0WB 1WYGA 2D11A 3LB8C 1I4QA 3RNEC 3ZXVA 2MBOA 1XLPA 1Z2MA 1FCLA 2REXA 1V1PB 2BT6A 2CHXA 5AEKB 3FAHA 4CHKA 2NTSA 1CMXB 2BGFA 4M8NA 2QEJC 2RPVA 1E5WA 1TKYA 1ZP0B 3HUIA 3EC8A 2RGFA 2N9KA 3L16A 3ZNID 3DBRB 5H92C 1K8RB 4C56C 3URYA 5DPTA 3ALBA 4IM3A 2KFKA 1WMHB 1SB3C 4EE2A 5I4DA 1FIQA 1P0RA 3IBEA 2O2VB 2BYVE 1WJUA 3H6NA 3P2BA 4IW0A 2N1VA 2MX2A 3AV8A 3NZ3A 2JUOA 5JZEB 1TIFA 3EGRA 4JPSA 2IY0B 3RYTA 3GP7A 4O1NA 1GC7A 1OQRA 3ML9A 1JWBD 3P4PB 4HDQA 4IKGA 2TSSA 4KDLB 1R4MI 4I6LB 4GXBA 1GC6A 1LO5D 4KDIC 1I4XA 1TS4A 3BK2A 2JWZA 5D94A 1EWCA 1DOXA 3DDCB 3AEGB 4TQ1A 2HD5B 2NMQA 3AE1B 1I4GA 1XQQA 4GU2A 1VZ8A 4NJ6A 1WI0A 2BB5A 2KVZA 1QQRA 3R7QA 3U2SC 1KLVA 1KJTA 2PW9A 1JCKB 2I2YA 3AI5A 4RF1A 1QZEA 5HKHA 2JSVX 3S2AA 2H89B 2D5GA 2XK5B 1WF9A 2OJRA 2RSUA 1XEEA 4K81A 2CU1A 1IBXA 2E6XA 3APDA 3RULA 3PZ8A 4EZKA 2FCNA 3R7RA 2AEHA 1V5TA 4C7ZA 2JZZA 4BOSC 1ROEA 3A4SC 2LJIA 1I4PA 3B2GA 1DOIA 5CHWA 3LJ3A 2ZPYA 3Q14C 4IOIE 3EECA 1XLNA 2CHZA 2IO3B 3ZNGC 1FFVA 1SEBD 4AUQC 4ZYSA 4E74A 4NJCA 1UGJA 3GB1A 1YX5B 4MJSB 2LXCA 2BPSA 3N1ZC 4C7YA 3U30A 3DOWA 3V60A 3AE2B 4B6WA 2EMTA 4KGTA 1IYFA 3ZNZB 3DBRI 2DNFA 3M63B 1K52A 4OVUA 2LZ6A 2IBIB 5AZHA 1GUAB 2KMMA 3VR8B 2DYMA 4USAA 3RUIB 3APFA 1GJZA 3Q3FA 4WQMA 1JWMD 4N9F4 4C4VB 2ZNVB 4GDLA 2EKIA 2RDHA 5IP4D 3PHXB 1HQRD 4HXDA 3KUCB 2V3PA 2QIEB 2MJ3A 3VUWA 3ZW3A 2NBVB 1U4AA 4ZRPA 2V3SA 2GBKA 2L7RA 3PREA 2CHWA 3IXSA 3KW5B 3I5JC 5FR3A 2G4DB 2EELA 2ZPNA 3AE3B 1T6BX 3DVNV 4CQNA 3ENEA 1K51A 4MACA 3NUHB
chains in the Genus database with same CATH topology
4FN2A 2O2VA 2R2QA 3PLVA 4MGZE 5D7GA 2KDFB 4GGQA 1WIAA 2PE9A 1R4NI 1WXVA 2KDIA 1IPGA 3ZTDA 4PS7A 3RZFA 1V86A 1G6JA 2IZVB 4BOZB 3AU5A 3DVNU 4GB9A 2LASA 1GG3A 2D2QA 3KUZA 3N30A 2L05A 2XEWA 2BF8B 4RM8A 4FJYA 4X57B 3L17A 2N7DA 5E6NA 2WDTB 3BY4B 4AJYB 4W9GA 1D3ZA 3ZVVA 2MLBA 4BFRA 4DBGA 1V9JA 2Y5BB 1UELA 2UWQA 5D2MB 3VVWB 3TIXA 2GBRA 2LRWA 4KIKB 4FULA 2L0TA 2KQ7A 5DPSA 1WY8A 2KHWB 3DVGY 4JIOU 2L76A 4B9KA 3ZTCA 2BKFA 5JHAA 4DDGD 4G50A 3RZWC 2KQSA 2D3GA 3EHVA 3B1LX 4NAWA 2KTRB 3A33B 4TUUA 2IO0B 1LFDA 1Y8RC 2J0MA 3HM6X 4JLCA 1GNUA 1WR1A 2MBEA 3NZUA 1C1YB 2K8HA 4NNJB 4HPMB 2LD9A 2ZVNA 3QX1A 3ZDMC 2WYQA 5KHOA 3UQBA 3QA8A 2ZCBA 4RM9A 2KJRA 2ZZPB 2W9NA 4EEWA 2A5UA 1SGHA 3ECIA 2FCQA 4WJQA 3GZNI 4I6PA 5DCNA 4FADA 3A9KA 4WAAA 3VTWA 1OTRB 4HVBA 3RCZA 4LDTB 5C23A 4MELA 2EMSA 1E7UA 3PRMB 3H7SA 4WQOB 2C7HA 3VH3B 4F8CB 2K6QA 2NR2A 4GDKB 4W9EA 4ANVA 1PQSA 2KN5A 2JZ3B 2LI5A 1T0YA 1E8YA 1WRDB 5LLIA 3V61A 2N9EB 2MSED 2MP2A 3DBHI 1OEYJ 1SE9A 3DCGA 1WXSA 2DZMA 4XX5A 2GBMA 4W9LA 1OGWA 5CTRC 1V49A 3MTNB 4URKA 2CS4A 3CMMB 2WWZA 1UGMA 2KDBA 2LRUA 2OOBB 1M94A 2BYEA 3PZDA 2KWUB 1I35A 2KFKB 3PSEB 3CSTA 2O6VB 2MBBB 2KTFA 2NBWB 4DHJD 2N1WA 2KVRA 4PYUA 5G55A 3PT2B 2NPTB 1WM2A 3TCAA 3X0WA 1TTNA 4GSWA 4EUTA 2QHOA 1J19A 3K9OB 3GOEA 1WZ3A 2C9WB 3T8MA 2L3ZA 4GDLB 1S1QB 4NQLB 2ZNVC 2KO3A 2KK8A 4GMVA 3M62B 3QHTA 4XC2A 3QQ8B 4BKSD 4ANUA 4K7UA 4J6IA 4DDID 1WR6E 2V4LA 1J0GA 3VH4B 3U8ZA 3NS8A 4MGIE 3LDZE 3UQAA 3A9JB 3VTVA 2J7QB 1WX9A 3APCA 2DX5B 4AOFA 4HWIB 2M0XA 4IG7B 2FCSA 3PRZA 2ASQA 2KJ6A 2NBUA 1WH3A 2HJ8A 1WX7A 2DYBA 4MJSA 4A3PA 4BKTA 2DYOA 3IVFA 1S3SG 3PTFC 2G3QB 5C1ZA 1H4RA 4W9IA 5TR5A 1OQYA 3AULA 4G3XB 1ZKHA 4XZ4A 3N32A 2KANA 2KFJA 2AL3A 2KC1A 3NZSA 5CX3A 2MBHA 3Q3JA 2YLMA 1TBEA 2MA9B 3PHWB 4ZRKA 3MHSD 4BKSA 3DBLI 1WM3A 4W9FA 3AU4A 1P98A 3HHMA 4FHKA 3SU8X 4HLEA 2RR9A 2LVPA 4FLHA 3TBLD 2KOXA 4M8MA 4WJNA 2K8BA 2G45B 3W1SA 4W9DA 4GN1A 2KLCA 4II2B 1YD8U 2KDEB 4K7SA 1WE6A 3VTUA 1KOTA 2D10A 4IWPA 3WALA 4EFOA 4BKGA 3ZUNA 4HK2A 2KMCA 3ZLZA 3NHEB 5KHQA 1FXTB 4A20A 4HDOA 4FA6A 2DENB 1E90A 3MJWA 2Z0EB 1P3QU 3WA0A 3VXWA 3VUYA 2Z0DB 1Z5SB 3DPDA 4E71A 4G11A 5JHBA 4CO7A 2LXAA 3NOBA 3OJ3A 1WGYA 4CYEA 1WZ0A 2D07B 5J2RA 2WX1A 5JH5C 5E6OA 3PVLA 2KX3A 1WX8A 1WGHA 2JPHA 3RD2A 2NVUI 1AARA 3TJPA 1V5OA 3HM3A 1WGRA 1V81A 3H9DA 4FHJA 2JVCA 1YJ1A 4OVVA 4DHZB 3K9PB 2BWFA 3WAOA 5CHFA 3M3JA 4ICUA 1TGZB 3V62A 1WGGA 2KZRA 1HE8A 3B0AA 2LVOA 2J0JA 3KH0A 4LCDE 4WWOA 4DWFA 4P7IA 2WX0A 4BBNC 3SD5A 2ZCCA 2JT4B 4I6NB 2XBBC 1IP9A 4W9KA 3WAPA 2LWPA 3QK0A 4FBJB 4WWNA 3DQVA 4IUMB 3WANA 3SHQA 1RFAA 4FJVB 4B95A 4KVGB 1WJ4A 3KUDB 4LJPB 2A4ZA 1V2YA 4ZRJA 3B08A 4GIVA 1A5RA 4YL8A 3QIJA 2Z59B 3HK0A 2PJHA 2N9XA 1WE7A 2ZJDA 2DZJA 3JVZX 2EKEC 4MSQB 1E8WA 5AZGA 4KIKA 4A3OA 3TL5A 2HE7A 3A4RA 1MG8A 2FIDA 2ZEQA 1TZ1A 3PV1A 2FCMA 4KZ0A 3L13A 3OAWA 4K1RB 2XK5A 2GMIC 3TMPB 3ZIMA 2NCNA 4FJZA 3WAMA 2KTRA 4IWOA 3ZKJC 4MM3A 2DZKA 3IHPC 1RAXA 3CSFA 2M4NA 1EUVB 2PE6B 2K8CA 3ZO5B 3L0WB 2D11A 3JSVB 3VAWA 5LXHA 2M8SA 3JW0X 1UBIA 5E6PA 2MBOA 2KD0A 1Z2MA 1UD7A 3T9LA 3VUXA 2L8JA 1YIWA 2REXA 2L0FA 4ZYNA 2ZVOA 3RT3B 2CHXA 5AEKB 4HPLB 4CHKA 4TV3A 1CMXB 2BGFA 1NDDA 4GDKA 3ML8A 4M8NA 5BO4B 4JGHB 3ZNHB 2C7MB 3EFUA 4DHJB 1XT9B 1E5WA 2FNJB 4KZCA 5DPRA 1UZXB 4ZDVA 3H7PB 3KYDD 3V6CB 1ZW7A 2LGXA 3EC8A 2RGFA 5DPWA 3L16A 3ZNID 2JRIB 4HCPB 4ANXA 1K8RB 3OLMD 3QC8B 3KYCD 1VD2A 4E3CA 5DPTA 2FAZA 1P1AA 3C0RB 3ALBA 4ASWC 3ZRCA 3QARA 4IM3A 2KFKA 1WMHB 2KWVB 1LXDA 2JXXA 2O6VA 1Q1OA 1EO6A 2BKRB 2N7EA 4DK5A 4WJPA 1P0RA 1Q0WB 3IBEA 2O2VB 2BYVE 2NPTA 1V6EA 5CHVC 1ISNA 1WGDA 1WJUA 3H6NA 2C7NB 3P2BA 3L54A 1NI2A 4MH0E 4IW0A 2IY1B 4EKUA 1JRUA 4BVUC 2N1VA 2MX2A 4LJOB 2LJ5A 2BYFA 2JUOA 3VHTC 5JZEB 5L95C 2MQJA 2IY0B 3PGEA 3H1UA 3RYTA 1GC7A 1LQBA 3ML9A 2YVCA 3A9JA 3L10B 3PPAA 4HJKA 1WXMA 1I42A 2DAJA 3I3TB 4DHZE 2FUHB 1KM7A 1YQBA 4HDQA 4MEMA 4KDLB 2BWES 3R66C 4IM0A 1R4MI 2PPHA 1E8XA 4I6LB 3UF8A 4GXBA 1GC6A 2HTHA 4KDIC 3A1QA 3QAQA 4NQKE 4WWPA 3VQIA 2DZIA 3CF6E 3U7DA 4IC7B 4TQ0A 2G4SA 3PRPB 2JWZA 5D94A 4NAWB 3DDCB 2MCNB 2I1KA 1WXAA 4TQ1A 2HD5B 4F1SA 4II3B 4ICVA 4IM2A 1XQQA 3IG3A 4GU2A 4EZJA 2MWSB 1NBFC 4NJ6A 3AXCA 1WI0A 3R7QA 2M1MA 3BINA 3VFKA 4W9CA 4ANWA 4W9JA 2L00B 2MBQA 2GBJA 2LUEA 1KLVA 5IAAC 3WIMA 1ZGUB 5J18A 1E7VA 1KJTA 3A9KB 1L2NA 2AWTA 3NY5A 4JQWC 1X1MA 3AI5A 4NY0A 3QCAA 1QZEA 2KKCA 5HKHA 2K6DB 3S2AA 1LM8B 1BT0A 2MP2B 2MRPA 2K1FA 2XK5B 2IYDB 2KX0A 1WF9A 2OJRA 2RSUA 4K81A 2CU1A 3O65B 4PS8A 1P9DU 2KNBA 3APDA 2GOWA 3RULA 4LDTD 2N4FA 1WJ6A 4EZKA 2KWCA 1EF5A 2FCNA 1C3TA 3UIPB 3R7RA 5G2NA 2AEHA 2VRRB 4KSKC 2K39A 5AZFA 1V5TA 2KXJA 4TKNA 2JZZA 2K25A 2KJHB 3A4SC 3QWZB 4BOSC 2DHZA 4AWJA 5FR6A 2JY6A 2RPQA 3PLUA 4EOYA 3D32A 5CHWA 2LGDA 3X23A 3LJ3A 2KLGA 3ZDTA 5IA7A 3QJZA 2ZPYA 1WJNA 4AP4C 1V80A 3EECA 1OEYA 4NJ7A 2CHZA 2IO3B 3ZNGC 4MGYE 3OJ4B 4PYZA 5EDSA 3VDZA 4AUQC 2V1YA 3PS6A 4E74A 1F9JA 2O6VD 4KV2A 1YX5B 1WFYA 3M95A 3DVGX 1XD3B 3HIZA 4MJSB 2LXCA 2BPSA 4IWQA 2NS5A 4AJWA 1SIFA 2JRHA 1RLFA 2CR5A 1E8ZA 2LGYA 5D6JB 3U30A 4HCNB 2B3AA 3DOWA 3ONSA 3V60A 3R3MA 4B6WA 3UINB 1H8CA 2MW5A 2M17A 4K7WA 3W1SC 4JL9A 2EMTA 1J8CA 1IYFA 2C5LC 1WYWB 3DBRI 4MDKE 2AL6A 3JSVA 3M63B 3SDLC 3ZNZB 2IO1B 4OVUA 2LZ6A 2IBIB 5AZHA 1GUAB 2I1JA 3UGBB 4G0NB 3ZRFA 5LXIB 2DYMA 3RUIB 3APFA 1GJZA 3Q3FA 2FIFA 4MSMB 4N9F4 1UBQA 5GMVA 1L7YA 2ZNVB 2KMAA 5J17A 3W1YA 4GDLA 3N3KB 1RRBA 3PHXB 2DAFA 2KC2A 4HXDA 4DXAB 3DBSA 3KUCB 4M0WB 1Q5WB 2LVQA 3A1QB 3VUWA 1UH6A 4GOCA 4KSLC 1EF1A 3ZW3A 2NBVB 4ZRIA 3V6EB 2GBNA 1U4AA 3H7PA 3KVFB 4NPNA 2RD0A 2V3SA 2GBKA 2L7RA 3PREA 2J0KA 2CHWA 5L83A 3KW5B 4WJOA 2JF5A 4PS3A 2G4DB 4EZLA 3JYUA 2ZPNA 2N9PC 4F7ZA 3IFWB 3DVNV 1WMHA 2C60A 3ENEA 3L08A 4MGKE 2R2OA 2CKHB 1YX6B 3UIOB 2PEAA 2AYOB 2UYZB 2IO2B 4W9HA 4RMAA 4BBNF 1VCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FN2 A;  2O2V A;  2R2Q A;  3PLV A;  4MGZ E;  5D7G A;  2KDF B;  4GGQ A;  1WIA A;  2PE9 A;  1R4N I;  1WXV A;  2KDI A;  1IPG A;  3ZTD A;  4PS7 A;  3RZF A;  1V86 A;  1G6J A;  2IZV B;  4BOZ B;  3AU5 A;  3DVN U;  4GB9 A;  2LAS A;  1GG3 A;  2D2Q A;  3KUZ A;  3N30 A;  2L05 A;  2XEW A;  2BF8 B;  4RM8 A;  4FJY A;  4X57 B;  3L17 A;  2N7D A;  5E6N A;  2WDT B;  3BY4 B;  4AJY B;  4W9G A;  1D3Z A;  3ZVV A;  2MLB A;  4BFR A;  4DBG A;  1V9J A;  2Y5B B;  1UEL A;  2UWQ A;  5D2M B;  3VVW B;  3TIX A;  2GBR A;  2LRW A;  4KIK B;  4FUL A;  2L0T A;  2KQ7 A;  5DPS A;  1WY8 A;  2KHW B;  3DVG Y;  4JIO U;  2L76 A;  4B9K A;  3ZTC A;  2BKF A;  5JHA A;  4DDG D;  4G50 A;  3RZW C;  2KQS A;  2D3G A;  3EHV A;  3B1L X;  4NAW A;  2KTR B;  3A33 B;  4TUU A;  2IO0 B;  1LFD A;  1Y8R C;  2J0M A;  3HM6 X;  4JLC A;  1GNU A;  1WR1 A;  2MBE A;  3NZU A;  1C1Y B;  2K8H A;  4NNJ B;  4HPM B;  2LD9 A;  2ZVN A;  3QX1 A;  3ZDM C;  2WYQ A;  5KHO A;  3UQB A;  3QA8 A;  2ZCB A;  4RM9 A;  2KJR A;  2ZZP B;  2W9N A;  4EEW A;  2A5U A;  1SGH A;  3ECI A;  2FCQ A;  4WJQ A;  3GZN I;  4I6P A;  5DCN A;  4FAD A;  3A9K A;  4WAA A;  3VTW A;  1OTR B;  4HVB A;  3RCZ A;  4LDT B;  5C23 A;  4MEL A;  2EMS A;  1E7U A;  3PRM B;  3H7S A;  4WQO B;  2C7H A;  3VH3 B;  4F8C B;  2K6Q A;  2NR2 A;  4GDK B;  4W9E A;  4ANV A;  1PQS A;  2KN5 A;  2JZ3 B;  2LI5 A;  1T0Y A;  1E8Y A;  1WRD B;  5LLI A;  3V61 A;  2N9E B;  2MSE D;  2MP2 A;  3DBH I;  1OEY J;  1SE9 A;  3DCG A;  1WXS A;  2DZM A;  4XX5 A;  2GBM A;  4W9L A;  1OGW A;  5CTR C;  1V49 A;  3MTN B;  4URK A;  2CS4 A;  3CMM B;  2WWZ A;  1UGM A;  2KDB A;  2LRU A;  2OOB B;  1M94 A;  2BYE A;  3PZD A;  2KWU B;  1I35 A;  2KFK B;  3PSE B;  3CST A;  2O6V B;  2MBB B;  2KTF A;  2NBW B;  4DHJ D;  2N1W A;  2KVR A;  4PYU A;  5G55 A;  3PT2 B;  2NPT B;  1WM2 A;  3TCA A;  3X0W A;  1TTN A;  4GSW A;  4EUT A;  2QHO A;  1J19 A;  3K9O B;  3GOE A;  1WZ3 A;  2C9W B;  3T8M A;  2L3Z A;  4GDL B;  1S1Q B;  4NQL B;  2ZNV C;  2KO3 A;  2KK8 A;  4GMV A;  3M62 B;  3QHT A;  4XC2 A;  3QQ8 B;  4BKS D;  4ANU A;  4K7U A;  4J6I A;  4DDI D;  1WR6 E;  2V4L A;  1J0G A;  3VH4 B;  3U8Z A;  3NS8 A;  4MGI E;  3LDZ E;  3UQA A;  3A9J B;  3VTV A;  2J7Q B;  1WX9 A;  3APC A;  2DX5 B;  4AOF A;  4HWI B;  2M0X A;  4IG7 B;  2FCS A;  3PRZ A;  2ASQ A;  2KJ6 A;  2NBU A;  1WH3 A;  2HJ8 A;  1WX7 A;  2DYB A;  4MJS A;  4A3P A;  4BKT A;  2DYO A;  3IVF A;  1S3S G;  3PTF C;  2G3Q B;  5C1Z A;  1H4R A;  4W9I A;  5TR5 A;  1OQY A;  3AUL A;  4G3X B;  1ZKH A;  4XZ4 A;  3N32 A;  2KAN A;  2KFJ A;  2AL3 A;  2KC1 A;  3NZS A;  5CX3 A;  2MBH A;  3Q3J A;  2YLM A;  1TBE A;  2MA9 B;  3PHW B;  4ZRK A;  3MHS D;  4BKS A;  3DBL I;  1WM3 A;  4W9F A;  3AU4 A;  1P98 A;  3HHM A;  4FHK A;  3SU8 X;  4HLE A;  2RR9 A;  2LVP A;  4FLH A;  3TBL D;  2KOX A;  4M8M A;  4WJN A;  2K8B A;  2G45 B;  3W1S A;  4W9D A;  4GN1 A;  2KLC A;  4II2 B;  1YD8 U;  2KDE B;  4K7S A;  1WE6 A;  3VTU A;  1KOT A;  2D10 A;  4IWP A;  3WAL A;  4EFO A;  4BKG A;  3ZUN A;  4HK2 A;  2KMC A;  3ZLZ A;  3NHE B;  5KHQ A;  1FXT B;  4A20 A;  4HDO A;  4FA6 A;  2DEN B;  1E90 A;  3MJW A;  2Z0E B;  1P3Q U;  3WA0 A;  3VXW A;  3VUY A;  2Z0D B;  1Z5S B;  3DPD A;  4E71 A;  4G11 A;  5JHB A;  4CO7 A;  2LXA A;  3NOB A;  3OJ3 A;  1WGY A;  4CYE A;  1WZ0 A;  2D07 B;  5J2R A;  2WX1 A;  5JH5 C;  5E6O A;  3PVL A;  2KX3 A;  1WX8 A;  1WGH A;  2JPH A;  3RD2 A;  2NVU I;  1AAR A;  3TJP A;  1V5O A;  3HM3 A;  1WGR A;  1V81 A;  3H9D A;  4FHJ A;  2JVC A;  1YJ1 A;  4OVV A;  4DHZ B;  3K9P B;  2BWF A;  3WAO A;  5CHF A;  3M3J A;  4ICU A;  1TGZ B;  3V62 A;  1WGG A;  2KZR A;  1HE8 A;  3B0A A;  2LVO A;  2J0J A;  3KH0 A;  4LCD E;  4WWO A;  4DWF A;  4P7I A;  2WX0 A;  4BBN C;  3SD5 A;  2ZCC A;  2JT4 B;  4I6N B;  2XBB C;  1IP9 A;  4W9K A;  3WAP A;  2LWP A;  3QK0 A;  4FBJ B;  4WWN A;  3DQV A;  4IUM B;  3WAN A;  3SHQ A;  1RFA A;  4FJV B;  4B95 A;  4KVG B;  1WJ4 A;  3KUD B;  4LJP B;  2A4Z A;  1V2Y A;  4ZRJ A;  3B08 A;  4GIV A;  1A5R A;  4YL8 A;  3QIJ A;  2Z59 B;  3HK0 A;  2PJH A;  2N9X A;  1WE7 A;  2ZJD A;  2DZJ A;  3JVZ X;  2EKE C;  4MSQ B;  1E8W A;  5AZG A;  4KIK A;  4A3O A;  3TL5 A;  2HE7 A;  3A4R A;  1MG8 A;  2FID A;  2ZEQ A;  1TZ1 A;  3PV1 A;  2FCM A;  4KZ0 A;  3L13 A;  3OAW A;  4K1R B;  2XK5 A;  2GMI C;  3TMP B;  3ZIM A;  2NCN A;  4FJZ A;  3WAM A;  2KTR A;  4IWO A;  3ZKJ C;  4MM3 A;  2DZK A;  3IHP C;  1RAX A;  3CSF A;  2M4N A;  1EUV B;  2PE6 B;  2K8C A;  3ZO5 B;  3L0W B;  2D11 A;  3JSV B;  3VAW A;  5LXH A;  2M8S A;  3JW0 X;  1UBI A;  5E6P A;  2MBO A;  2KD0 A;  1Z2M A;  1UD7 A;  3T9L A;  3VUX A;  2L8J A;  1YIW A;  2REX A;  2L0F A;  4ZYN A;  2ZVO A;  3RT3 B;  2CHX A;  5AEK B;  4HPL B;  4CHK A;  4TV3 A;  1CMX B;  2BGF A;  1NDD A;  4GDK A;  3ML8 A;  4M8N A;  5BO4 B;  4JGH B;  3ZNH B;  2C7M B;  3EFU A;  4DHJ B;  1XT9 B;  1E5W A;  2FNJ B;  4KZC A;  5DPR A;  1UZX B;  4ZDV A;  3H7P B;  3KYD D;  3V6C B;  1ZW7 A;  2LGX A;  3EC8 A;  2RGF A;  5DPW A;  3L16 A;  3ZNI D;  2JRI B;  4HCP B;  4ANX A;  1K8R B;  3OLM D;  3QC8 B;  3KYC D;  1VD2 A;  4E3C A;  5DPT A;  2FAZ A;  1P1A A;  3C0R B;  3ALB A;  4ASW C;  3ZRC A;  3QAR A;  4IM3 A;  2KFK A;  1WMH B;  2KWV B;  1LXD A;  2JXX A;  2O6V A;  1Q1O A;  1EO6 A;  2BKR B;  2N7E A;  4DK5 A;  4WJP A;  1P0R A;  1Q0W B;  3IBE A;  2O2V B;  2BYV E;  2NPT A;  1V6E A;  5CHV C;  1ISN A;  1WGD A;  1WJU A;  3H6N A;  2C7N B;  3P2B A;  3L54 A;  1NI2 A;  4MH0 E;  4IW0 A;  2IY1 B;  4EKU A;  1JRU A;  4BVU C;  2N1V A;  2MX2 A;  4LJO B;  2LJ5 A;  2BYF A;  2JUO A;  3VHT C;  5JZE B;  5L95 C;  2MQJ A;  2IY0 B;  3PGE A;  3H1U A;  3RYT A;  1GC7 A;  1LQB A;  3ML9 A;  2YVC A;  3A9J A;  3L10 B;  3PPA A;  4HJK A;  1WXM A;  1I42 A;  2DAJ A;  3I3T B;  4DHZ E;  2FUH B;  1KM7 A;  1YQB A;  4HDQ A;  4MEM A;  4KDL B;  2BWE S;  3R66 C;  4IM0 A;  1R4M I;  2PPH A;  1E8X A;  4I6L B;  3UF8 A;  4GXB A;  1GC6 A;  2HTH A;  4KDI C;  3A1Q A;  3QAQ A;  4NQK E;  4WWP A;  3VQI A;  2DZI A;  3CF6 E;  3U7D A;  4IC7 B;  4TQ0 A;  2G4S A;  3PRP B;  2JWZ A;  5D94 A;  4NAW B;  3DDC B;  2MCN B;  2I1K A;  1WXA A;  4TQ1 A;  2HD5 B;  4F1S A;  4II3 B;  4ICV A;  4IM2 A;  1XQQ A;  3IG3 A;  4GU2 A;  4EZJ A;  2MWS B;  1NBF C;  4NJ6 A;  3AXC A;  1WI0 A;  3R7Q A;  2M1M A;  3BIN A;  3VFK A;  4W9C A;  4ANW A;  4W9J A;  2L00 B;  2MBQ A;  2GBJ A;  2LUE A;  1KLV A;  5IAA C;  3WIM A;  1ZGU B;  5J18 A;  1E7V A;  1KJT A;  3A9K B;  1L2N A;  2AWT A;  3NY5 A;  4JQW C;  1X1M A;  3AI5 A;  4NY0 A;  3QCA A;  1QZE A;  2KKC A;  5HKH A;  2K6D B;  3S2A A;  1LM8 B;  1BT0 A;  2MP2 B;  2MRP A;  2K1F A;  2XK5 B;  2IYD B;  2KX0 A;  1WF9 A;  2OJR A;  2RSU A;  4K81 A;  2CU1 A;  3O65 B;  4PS8 A;  1P9D U;  2KNB A;  3APD A;  2GOW A;  3RUL A;  4LDT D;  2N4F A;  1WJ6 A;  4EZK A;  2KWC A;  1EF5 A;  2FCN A;  1C3T A;  3UIP B;  3R7R A;  5G2N A;  2AEH A;  2VRR B;  4KSK C;  2K39 A;  5AZF A;  1V5T A;  2KXJ A;  4TKN A;  2JZZ A;  2K25 A;  2KJH B;  3A4S C;  3QWZ B;  4BOS C;  2DHZ A;  4AWJ A;  5FR6 A;  2JY6 A;  2RPQ A;  3PLU A;  4EOY A;  3D32 A;  5CHW A;  2LGD A;  3X23 A;  3LJ3 A;  2KLG A;  3ZDT A;  5IA7 A;  3QJZ A;  2ZPY A;  1WJN A;  4AP4 C;  1V80 A;  3EEC A;  1OEY A;  4NJ7 A;  2CHZ A;  2IO3 B;  3ZNG C;  4MGY E;  3OJ4 B;  4PYZ A;  5EDS A;  3VDZ A;  4AUQ C;  2V1Y A;  3PS6 A;  4E74 A;  1F9J A;  2O6V D;  4KV2 A;  1YX5 B;  1WFY A;  3M95 A;  3DVG X;  1XD3 B;  3HIZ A;  4MJS B;  2LXC A;  2BPS A;  4IWQ A;  2NS5 A;  4AJW A;  1SIF A;  2JRH A;  1RLF A;  2CR5 A;  1E8Z A;  2LGY A;  5D6J B;  3U30 A;  4HCN B;  2B3A A;  3DOW A;  3ONS A;  3V60 A;  3R3M A;  4B6W A;  3UIN B;  1H8C A;  2MW5 A;  2M17 A;  4K7W A;  3W1S C;  4JL9 A;  2EMT A;  1J8C A;  1IYF A;  2C5L C;  1WYW B;  3DBR I;  4MDK E;  2AL6 A;  3JSV A;  3M63 B;  3SDL C;  3ZNZ B;  2IO1 B;  4OVU A;  2LZ6 A;  2IBI B;  5AZH A;  1GUA B;  2I1J A;  3UGB B;  4G0N B;  3ZRF A;  5LXI B;  2DYM A;  3RUI B;  3APF A;  1GJZ A;  3Q3F A;  2FIF A;  4MSM B;  4N9F 4;  1UBQ A;  5GMV A;  1L7Y A;  2ZNV B;  2KMA A;  5J17 A;  3W1Y A;  4GDL A;  3N3K B;  1RRB A;  3PHX B;  2DAF A;  2KC2 A;  4HXD A;  4DXA B;  3DBS A;  3KUC B;  4M0W B;  1Q5W B;  2LVQ A;  3A1Q B;  3VUW A;  1UH6 A;  4GOC A;  4KSL C;  1EF1 A;  3ZW3 A;  2NBV B;  4ZRI A;  3V6E B;  2GBN A;  1U4A A;  3H7P A;  3KVF B;  4NPN A;  2RD0 A;  2V3S A;  2GBK A;  2L7R A;  3PRE A;  2J0K A;  2CHW A;  5L83 A;  3KW5 B;  4WJO A;  2JF5 A;  4PS3 A;  2G4D B;  4EZL A;  3JYU A;  2ZPN A;  2N9P C;  4F7Z A;  3IFW B;  3DVN V;  1WMH A;  2C60 A;  3ENE A;  3L08 A;  4MGK E;  2R2O A;  2CKH B;  1YX6 B;  3UIO B;  2PEA A;  2AYO B;  2UYZ B;  2IO2 B;  4W9H A;  4RMA A;  4BBN F;  1VCB A; 
#chains in the Genus database with same CATH topology
 1GOZ A;  2UU7 A;  5D7G A;  1WIA A;  1WXV A;  1IPG A;  3RZF A;  4RNA A;  1V86 A;  2H88 B;  1G6J A;  3AU5 A;  3DVN U;  2LAS A;  3DWM A;  5E6N A;  2WXG A;  4W9G A;  2MLB A;  2Y5B B;  1UEL A;  3VVW B;  2RDG A;  1PFD A;  1L0V B;  3TIX A;  3AE4 B;  4KIK B;  1XXG A;  5DPS A;  1WY8 A;  3DVG Y;  1YN3 A;  3SEB A;  4LNK A;  1FCC C;  4MM3 B;  4JLC A;  1GNU A;  1BUI C;  2MBE A;  4PK1 A;  1C1Y B;  4NNJ B;  2LD9 A;  5HFY A;  3UQB A;  2ZCB A;  2LUM A;  4RM9 A;  2W9N A;  3ECI A;  4WAA A;  4HVB A;  3VTW A;  1KH0 A;  1VR9 A;  4WQO B;  4A6Q A;  4GDK B;  5G5G A;  1CZP A;  2JZ3 B;  1D6E C;  1T0Y A;  2LI5 A;  1WRD B;  2MSE D;  1OEY J;  1JAL A;  4XX5 A;  3IT4 B;  3BYT B;  2IGD A;  4KKI A;  1V49 A;  4URK A;  2CS4 A;  3AMZ A;  2J52 A;  1PDX A;  4ARI A;  1JRO A;  3PZD A;  2Q5W D;  3CST A;  2WXL A;  2Z8L A;  2O6V B;  2MBB B;  2KTF A;  3N20 C;  4HRS A;  5JXV A;  5IN7 A;  1J19 A;  4Q2J A;  1RFK A;  2L3Z A;  3Q8A A;  4GDL B;  1S1Q B;  4NQL B;  3MC8 A;  4GMV A;  3M62 B;  3QHT A;  4P1C C;  3R2T A;  3AEB B;  1BML C;  4DDI D;  2WDR B;  5FKA C;  3OG5 A;  1UUP A;  3U8Z A;  3UQA A;  1P7F A;  3AM9 A;  2DX5 B;  3VRA B;  2FCS A;  2IDY A;  2ASQ A;  2K5P A;  4YTM B;  1HZ5 A;  1HTO A;  3TUO A;  3AUL A;  4XDD A;  1PGA A;  3NVW A;  2PVO D;  2MHJ A;  3NZS A;  2KC1 A;  4ACF A;  1TBE A;  1YQ4 B;  1N5X A;  4W9F A;  3ETR A;  1P98 A;  4XGA B;  4HLE A;  2LVP A;  3Q3O C;  4FLH A;  3TBL D;  2BVC A;  4M8M A;  2K8B A;  3W1S A;  3RNB C;  1KRH A;  1JRP A;  4N58 A;  3VTU A;  4IWP A;  1L0Y B;  4HK2 A;  2KMC A;  3ZLZ A;  1JML A;  4M0W A;  1E90 A;  1I4H A;  3ZJU A;  1T0Q C;  1P3Q U;  3VXW A;  4WUR A;  1ET6 A;  4G11 A;  4CO7 A;  5J2R A;  1UF0 A;  1WZ0 A;  2D07 B;  5JH5 C;  4N59 A;  4A90 A;  2L52 A;  3RD2 A;  3TJP A;  2V9H A;  1V5O A;  1WGR A;  3H9D A;  4DHZ B;  1YJ1 A;  3K9P B;  2WXO A;  2FE8 A;  5CHF A;  2KZR A;  4P6V F;  1TS5 A;  4L23 A;  1QF6 A;  2J0J A;  4P7I A;  3NJT A;  3TEX A;  4I6N B;  3QK0 A;  4FBJ B;  1VRA B;  4IUM B;  3WAN A;  4FJV B;  1WJ4 A;  2GLS A;  4LJP B;  2A4Z A;  4YL8 A;  2PJH A;  3JVZ X;  4MSQ B;  2INN E;  3A4R A;  2FID A;  1A70 A;  2FCM A;  1YQ3 B;  5LNK 1;  3ZKJ C;  3CSF A;  3E9S A;  3JSV B;  5LXH A;  2M8S A;  3JW0 X;  1UBI A;  1C78 A;  5E6P A;  3P4Q B;  1AN8 A;  1YIW A;  2L0F A;  4ZYN A;  3RT3 B;  1FO4 A;  2LMC A;  1WWT A;  1YJI A;  1NVI D;  1NDD A;  2WXF A;  3ML8 A;  3Q8C A;  5BO4 B;  1CQV A;  2BS3 B;  2C7M B;  4DHJ B;  1TY2 A;  1XT9 B;  5T8I A;  1B1Z A;  3OWE B;  4ZDV A;  3H7P B;  2HJ1 A;  1SSN A;  4HCP B;  3FC4 A;  5BYR A;  3OLM D;  3QC8 B;  4E3C A;  2VH1 A;  4ASW C;  3ZRC A;  3QAR A;  1LXD A;  2NTT A;  2JXX A;  3AEA B;  4DK5 A;  4WJP A;  1MFW A;  1ISN A;  2VZK D;  4ZRQ A;  2C7N B;  3L54 A;  4LNN A;  3Q69 A;  4BVU C;  2BW2 A;  3VHT C;  4FXC A;  2MQJ A;  3H1U A;  1N5W A;  4C80 A;  3L10 B;  3PPA A;  1WXM A;  3I3T B;  3RNA C;  1YQB A;  3DBL B;  4RGT A;  1FFU A;  3BK1 A;  1E0Z A;  2YEP B;  1DGJ A;  3VQI A;  4LNF A;  4TQ0 A;  2G4S A;  2WU2 B;  4NAW B;  5HG2 A;  2MCN B;  1WXA A;  2E3T A;  4II3 B;  4ICV A;  3BWU D;  3AED B;  4ITK A;  2MWS B;  4J3O D;  3AXC A;  4NAM A;  2L00 B;  2GBJ A;  3WIM A;  2SAK A;  5J18 A;  3R8B A;  1YOV B;  3A9K B;  2AWT A;  1YMH E;  1M4V A;  4ZHO A;  3O13 A;  4HRO A;  3FIL A;  4HJG E;  3W2D A;  2KKC A;  3Q8B A;  2K6D B;  2MP2 B;  4A8X C;  3HVZ A;  1ESF A;  2KNB A;  3U52 E;  4LDT D;  1WJ6 A;  4QAY A;  2V4I B;  1MI0 A;  3V05 A;  1C3T A;  1MPE A;  1DYQ A;  4KKJ A;  4KSK C;  1WXQ A;  4KGR A;  2KXJ A;  5D3D A;  2MEK A;  2KJH B;  3QWZ B;  5FR6 A;  2JY6 A;  2RPQ A;  3L4P A;  2LGD A;  3ZDT A;  4AP4 C;  4NJ7 A;  4B0E A;  4MGY E;  3VDZ A;  2V1Y A;  3PS6 A;  3M95 A;  3H8H A;  3HIZ A;  1F2R I;  4AJW A;  2JRH A;  2CR5 A;  3ZXR A;  1MHX A;  4HCN B;  2B3A A;  2RDB C;  2CJN A;  2XN9 C;  4YTP B;  5IKC M;  1ZDV A;  2C5L C;  3SDL C;  3TEY A;  3P42 A;  2ON8 A;  4G0N B;  1TT5 B;  4HEA 1;  4MSM B;  1UBQ A;  1J7B A;  5GMV A;  2KMA A;  5AUI A;  2KYW A;  2OED A;  2DAF A;  2MJD A;  3DBS A;  4S17 A;  3I63 C;  2LVQ A;  4DQO C;  4GOC A;  4D2K A;  1EF1 A;  1XLO A;  2GBN A;  3UI3 A;  3TSS A;  3NRZ A;  4WJO A;  4EZL A;  4F7Z A;  3AE9 B;  3P4R B;  3L08 A;  2CKH B;  3UIO B;  2PEA A;  2AYO B;  2UYZ B;  2IO2 B;  4RMA A;  4BBN F;  1VCB A;  4FN2 A;  2B76 B;  4MGZ E;  2PE9 A;  2KDI A;  2SEB D;  2HTM E;  2IZV B;  1ZUD 2;  1QKZ A;  3N30 A;  1KTK A;  4RM8 A;  4FJY A;  3L17 A;  2WDT B;  4AJY B;  4BFR A;  4DBG A;  4MH8 A;  2FUG 1;  2UWQ A;  1WGK A;  4FUL A;  3VR9 B;  2KHW B;  1TJE A;  2L76 A;  4OZB A;  2BKF A;  4DDG D;  4G50 A;  3RZW C;  2X8X X;  4DXF A;  3EHV A;  3B1L X;  2LGS A;  2BS2 B;  4YSY B;  2IO0 B;  1LFD A;  1Y8R C;  1IUE A;  5AUK A;  4HPM B;  2ZVN A;  3ZDM C;  1QOF A;  2ZZP B;  4EEW A;  4RGO S;  4RH6 A;  2KN4 A;  4WJQ A;  5DCN A;  1FM0 D;  2JZP A;  1LGR A;  1OTR B;  3ZQ4 A;  4R3D A;  5C23 A;  1E7U A;  3H7S A;  3VH3 B;  2K6Q A;  2NR2 A;  1PQS A;  4BAX A;  1C9F A;  2W3R A;  1NEN B;  4JWU C;  2JX5 A;  1MJD A;  4OZC A;  1SE9 A;  3I9V 1;  1WXS A;  2DZM A;  1YN4 A;  4W9L A;  5CTR C;  1UGM A;  2OOB B;  2BYE A;  2KFK B;  2DLB A;  1TKE A;  2KVR A;  5G55 A;  1GB1 A;  3PT2 B;  1WM2 A;  1TTN A;  3K9O B;  3GOE A;  1V8C A;  2JYT A;  2MH7 A;  2ZNV C;  4ANU A;  4K7U A;  4J6I A;  1WR6 E;  4MGI E;  3LDZ E;  1P7E A;  2J7Q B;  3B2F A;  1PGX A;  4AOF A;  4A55 A;  4M02 A;  2KJ6 A;  5EE9 A;  1WH3 A;  4BKT A;  2DYO A;  4JE3 B;  5TR5 A;  1OQY A;  2Y5C A;  1XO3 A;  3FKY A;  1K53 A;  4GLS C;  3N32 A;  2KFJ A;  5CX3 A;  2MBH A;  3Q3J A;  2YLM A;  4BKS A;  1J7C A;  1NI3 A;  2DBY A;  4C00 A;  2KOX A;  4WJN A;  3VRB B;  2CJO A;  1EM7 A;  2K22 A;  4II2 B;  4BZA A;  1YD8 U;  2G1E A;  4YSX B;  3WAL A;  3NHE B;  5KHQ A;  4HDO A;  4FA6 A;  2KAC A;  5FK9 C;  3WA0 A;  1T5X D;  3VUY A;  2Z0D B;  1Z5S B;  3DPD A;  3RNG C;  5BMI A;  1VLB A;  3OJ3 A;  4CYE A;  2JXT A;  1XLQ A;  2WX1 A;  5E6O A;  3PVL A;  3AN1 A;  1IBX B;  2NVU I;  3W9C B;  1I4R A;  3RN9 C;  4KX6 B;  2BB6 A;  3WAO A;  3M3J A;  4ICU A;  3V62 A;  1HE8 A;  1SF0 A;  1JWA D;  4DWF A;  3KH0 A;  4WWO A;  2WX0 A;  1N62 A;  3SD5 A;  2IND C;  2XBB C;  5IO9 A;  1IP9 A;  4W9K A;  2LWP A;  1ENF A;  1F0Z A;  1V97 A;  3SHQ A;  2OJW A;  4KVG B;  3HRD D;  1V2Y A;  3QIJ A;  4XE0 A;  2N9X A;  1WE7 A;  2ZJD A;  2EKE C;  1HEZ E;  2HE7 A;  3PV1 A;  3L13 A;  4K1R B;  3BII D;  1C77 A;  3GZN B;  2KTR A;  1JWS D;  2PE6 B;  3ZO5 B;  3NVZ A;  2QC8 A;  4WH4 A;  1YJJ A;  1YN5 A;  2KD0 A;  2D3B A;  3Q8F A;  2ZVO A;  2X38 A;  4HPL B;  4TV3 A;  1FXI A;  1F52 A;  4JGH B;  3GE3 C;  4WWM A;  1TYG B;  2FNJ B;  2LHD A;  2PVG C;  3V6C B;  1ZW7 A;  2LGX A;  3Q2A C;  2JRI B;  1F1H A;  2WXR A;  3KYC D;  1VD2 A;  1FNV A;  2FAZ A;  3C0R B;  5D3I B;  4K3C A;  1EO6 A;  1EU3 A;  1QT9 A;  1WRI A;  1SE2 A;  2NPT A;  1HZ6 A;  1OFF A;  2BBC A;  4LJO B;  2LJ5 A;  2BYF A;  4HKQ A;  2KQ4 X;  2YVC A;  3A9J A;  1I42 A;  2DAJ A;  2WDV B;  4MEM A;  3R66 C;  3I57 A;  4IM0 A;  2PPH A;  1E8X A;  2N7J A;  4LNO A;  1ZOY B;  3QAQ A;  2DZI A;  3CF6 E;  4IC7 B;  4YSZ B;  3P4S B;  4F1S A;  2I1K A;  1R4N B;  3GS2 A;  2GI9 A;  3IG3 A;  2D3A A;  4EZJ A;  2K0P A;  1GB4 A;  4LLG M;  2M1M A;  2KT7 A;  2AQ3 B;  4W9C A;  4ANW A;  4W9J A;  2MBQ A;  2LUE A;  4L2Y A;  1E7V A;  4RF0 A;  5H8Y E;  3SR6 A;  1L2N A;  3NY5 A;  1X1M A;  1RM6 C;  3QCA A;  4HPP A;  1LM8 B;  1BT0 A;  2MRP A;  2IYD B;  2KX0 A;  4XDC A;  3O65 B;  2WXQ A;  4PS8 A;  2GOW A;  1XF5 L;  3Q3M C;  2KWC A;  2L83 A;  2PLP A;  5BYS A;  5G2N A;  2M0A A;  3AE8 B;  2VRR B;  1SXT A;  1FNU A;  3AEC B;  4LNI A;  4TKN A;  2DHZ A;  2WXP A;  3PLU A;  5E6J A;  3X23 A;  3QJZ A;  5EE3 A;  2WNM A;  2Y3A A;  1V80 A;  1OEY A;  3BYY B;  3C19 A;  2AQ1 B;  3OJ4 B;  2W3S A;  5EDS A;  2O6V D;  4OZA A;  1XD3 B;  4IWQ A;  2NS5 A;  2J42 A;  1SIF A;  2LGY A;  5D6J B;  3ONS A;  3R3M A;  4NZL B;  3UIN B;  2IJ0 A;  2AQ2 B;  2M17 A;  2MW5 A;  3KWV A;  4K7W A;  3W1S C;  4JL9 A;  4M00 A;  1J8C A;  4MDK E;  1FNW A;  2AL6 A;  2I1J A;  1SIJ A;  2LHE A;  3ZRF A;  1FEH A;  1C4C A;  5HI1 A;  3U7Z A;  1V1P A;  5J17 A;  3W1Y A;  5G5H A;  3N3K B;  5BMG A;  2QSD A;  1QLB B;  4M0W B;  3CIR B;  1UH6 A;  1ET9 A;  1RWS A;  4ZRI A;  3KVF B;  2PTL A;  1ZXI A;  2J0K A;  3KLS X;  1Y56 A;  3CWI A;  1WMH A;  4MGK E;  2R2O A;  1YX6 B;  4W9H A;  2O2V A;  3PLV A;  4GGQ A;  1R4N I;  5C2T B;  4B0M A;  4PS7 A;  4IDI A;  3MP9 A;  3W5U B;  1KFY B;  2J4X A;  4BOZ B;  3TEW A;  1D5X C;  3KUZ A;  2L05 A;  2XEW A;  2N7D A;  3BY4 B;  1V9J A;  1UNS A;  5D2M B;  1N63 A;  2GBR A;  1HTQ A;  2WXM A;  4WAF A;  4B9K A;  2M56 B;  5JHA A;  2KQS A;  2D3G A;  3MC0 B;  3A33 B;  2J0M A;  1WR1 A;  3NZU A;  2K8H A;  3RNF C;  2WYQ A;  2K3U A;  2KJR A;  1T3Q A;  1SGH A;  5IOI A;  3MC9 A;  4P16 A;  1EWY C;  3RCZ A;  3BVM A;  4MEL A;  1XCQ L;  3C8Y A;  3PRM B;  4F8C B;  2C7H A;  1FRR A;  2PKO A;  2KN5 A;  2AX5 A;  3NG0 A;  5LLI A;  3V61 A;  2CU3 A;  1Q10 A;  3DCG A;  4ZHP A;  2GBM A;  3N1Y C;  1FD6 A;  3MTN B;  3CMM B;  2WWZ A;  1TS3 A;  2KDB A;  2IPK D;  2LRU A;  1M94 A;  3MFG A;  3PZ7 A;  4AQ7 A;  1I35 A;  3PSE B;  1MG4 A;  2ZW0 A;  4DHJ D;  2N1W A;  4PYU A;  2QJL A;  3TCA A;  3X0W A;  1UWM A;  4EUT A;  2Y5P A;  2QHO A;  2W54 A;  1WZ3 A;  2QCZ A;  3LYY A;  2KK8 A;  3IT6 B;  3QQ8 B;  1J0G A;  2YEP F;  3VH4 B;  3NS8 A;  3VTV A;  1WX9 A;  1NYR A;  2M0X A;  1STE A;  1J7A A;  2INC C;  2NBU A;  2HJ8 A;  4MJS A;  1WX7 A;  2DYB A;  3PTF C;  5C1Z A;  1TY0 A;  2WLB A;  4W9I A;  4S0R A;  2KAN A;  2AL3 A;  2MA9 B;  3MHS D;  4LTU A;  3DBL I;  1WM3 A;  1SBB B;  3SU8 X;  3HHM A;  3P63 A;  2RR9 A;  4A9A A;  4GN1 A;  2GRI A;  2KLC A;  4TSS A;  4C4V A;  3NVY A;  1T0S C;  3BZD B;  3BVG A;  3RPF C;  1KOT A;  2D10 A;  3ABV B;  4EFO A;  1FRD A;  4BKG A;  3ZUN A;  4HKZ E;  1FXT B;  3FIL B;  4A20 A;  2BQQ A;  2DEN B;  2J53 A;  1JWU D;  1WSP A;  2FBW B;  3RNC C;  1C76 A;  3NOB A;  3Q3N C;  1L5P A;  1D5M C;  2L32 A;  1WGH A;  2JPH A;  3HM3 A;  1V81 A;  4OVV A;  4RFB A;  1QOB A;  2BWF A;  2WGS A;  4JWS C;  1WGG A;  1KLG D;  3EA6 A;  2LVO A;  1C4A A;  1HA5 A;  1KF6 B;  4YTN B;  3WAP A;  1E9M A;  3DQV A;  1UWX A;  1RFA A;  2N9L A;  4B95 A;  3N9Y C;  3KUD B;  4ZRJ A;  4JX1 C;  2XNA C;  4GIV A;  3HK0 A;  1C79 A;  4H2A A;  2DZJ A;  4KIK A;  4A3O A;  4L1B A;  3TL5 A;  1MG8 A;  2ZEQ A;  1TZ1 A;  4KZ0 A;  3OAW A;  2GMI C;  3NS1 A;  3ZIM A;  3WAM A;  4IWO A;  4MM3 A;  2DZK A;  1EUV B;  3VAW A;  3W5V B;  5BMH A;  2BYT A;  1K50 A;  1UD7 A;  1XCT L;  3T9L A;  3VUX A;  2L8J A;  5MPO A;  3N1X C;  2DWQ A;  2BS4 B;  1B9R A;  1SE4 A;  4GDK A;  3EFC A;  2WXN A;  3ZNH B;  3EFU A;  4KZC A;  5C3J B;  5DPR A;  1UZX B;  3KYD D;  3Q6B A;  4LK0 M;  4P1B C;  5DPW A;  4ANX A;  3GE8 C;  2W55 A;  2ACZ B;  1P1A A;  3RMK C;  2KWV B;  2O6V A;  1Q1O A;  2BKR B;  2N7E A;  4OVZ A;  2LGI A;  2WXH A;  1Q0W B;  1V6E A;  5CHV C;  5BYQ A;  1WGD A;  3RFZ B;  1VZ7 A;  1NI2 A;  4MH0 E;  2IY1 B;  4EKU A;  1JRU A;  5L95 C;  2MJE A;  1QOA A;  3PGE A;  1QOG A;  3Q8E A;  3B9J A;  1LQB A;  3PO0 A;  1L6V A;  2IGG A;  4HJK A;  4DHZ E;  2FUH B;  1KM7 A;  2BWE S;  4OHJ A;  1RYJ A;  4YWG G;  3UF8 A;  3ZJV A;  2HTH A;  3A1Q A;  4OW0 A;  2RMM A;  4NQK E;  4WWP A;  3U7D A;  3PRP B;  2QIL A;  4IM2 A;  1NBF C;  1E10 A;  3AE7 B;  1SE3 A;  3P1M A;  2WXK A;  3ZYY X;  3BIN A;  3VFK A;  1SJE D;  1V1O A;  3T3O A;  5IAA C;  1ZGU B;  1T0R C;  4JQW C;  2L1A A;  3HVD A;  1QIL A;  4NY0 A;  1GPX A;  4RCO A;  5EE0 A;  2W82 A;  1L4Z B;  2K1F A;  2KAJ A;  3T3N A;  5HHD G;  2JU6 X;  1P9D U;  1ZDX A;  3SFD B;  2N4F A;  1EF5 A;  2WXJ A;  1D4B A;  3UIP B;  3ZGZ A;  4DXG A;  2K39 A;  2I38 A;  5AZF A;  2K25 A;  1F77 A;  4AWJ A;  4EOY A;  1N61 A;  2QDF A;  2WHI A;  3D32 A;  2K9X A;  2KLG A;  5IA7 A;  1VJK A;  1WJN A;  4RGN A;  3SFE B;  1DOY A;  2WXI A;  1OQQ A;  3DBH B;  4PYZ A;  1F9J A;  4KV2 A;  5GXG B;  1WFY A;  3DVG X;  1AW7 A;  4UDU C;  1RLF A;  1E8Z A;  3KQ4 A;  2QMT A;  1H8C A;  5EE1 A;  1WYW B;  1TKG A;  3JSV A;  2IO1 B;  3UGB B;  5LXI B;  2GB1 A;  2FIF A;  2BTE A;  3LXF A;  1L0X B;  1L7Y A;  1RRB A;  2KC2 A;  4DXA B;  2WDQ B;  1Q5W B;  4US9 A;  2WQY B;  1YNT E;  3A1Q B;  4KSL C;  1JQ4 A;  4REZ A;  3V6E B;  2VZK B;  3H7P A;  2WP9 B;  4NPN A;  1GAQ B;  2RD0 A;  1FPY A;  5L83 A;  2JF5 A;  4PS3 A;  3RI7 C;  3JYU A;  3TEZ A;  4YT0 B;  2N9P C;  4AS1 A;  3IFW B;  3U4E G;  4WIP A;  2C60 A;  2ICI A;  1TZO A;  1PGB A;  2INP E;  2R2Q A;  2KDF B;  3ZTD A;  1L6U A;  2V0G A;  3MHZ A;  1NEK B;  4GB9 A;  1GG3 A;  2D2Q A;  1TS2 A;  1HXY D;  2BF8 B;  4YXD B;  4X57 B;  1D3Z A;  3ZVV A;  1KLU D;  4TMA B;  1PYW D;  3WCQ A;  2LRW A;  1AYF A;  3IAM 1;  2L0T A;  1ACC A;  2KQ7 A;  4JIO U;  3ZTC A;  1PUT A;  1ZE3 D;  3AEE B;  1MVK A;  3DHG C;  4NAW A;  2KTR B;  4TUU A;  3HM6 X;  1FXA A;  2LEK A;  3QX1 A;  5KHO A;  3QA8 A;  3DWG C;  1D5Z C;  2A5U A;  2FCQ A;  2PMV A;  3GZN I;  4I6P A;  4FAD A;  4PT5 A;  1BXT A;  2R61 A;  1VZ6 A;  3A9K A;  3IAS 1;  3J9C A;  2JYE A;  4LDT B;  2LFI A;  2EMS A;  4W9E A;  4ANV A;  1E8Y A;  2N9E B;  3DBH I;  2MP2 A;  2HDE A;  3AE6 B;  1OGW A;  3DHH C;  1SJH D;  3E56 A;  2G9H D;  3DHI C;  1EU4 A;  2KWU B;  2OHF A;  3KWL A;  1F2R C;  2NBW B;  4K3B A;  4XWT A;  2M19 A;  2KDM A;  2NPT B;  4M01 A;  4GSW A;  1JW9 D;  1ZXH A;  3T8M A;  2C9W B;  2KO3 A;  4BKS D;  4XC2 A;  3ZJT A;  2V4L A;  4ARC A;  3A9J B;  1AWD A;  1IGC A;  3APC A;  4HWI B;  5TSS A;  4IG7 B;  3PRZ A;  4KGS A;  4A3P A;  1N60 A;  2IGH A;  1S3S G;  3IVF A;  2G3Q B;  1H4R A;  4US8 A;  3AE5 B;  4G3X B;  1ZKH A;  4XZ4 A;  1NYQ A;  3MJ5 A;  1ZPS A;  3PHW B;  4ZRK A;  3AU4 A;  4FHK A;  3BVZ A;  1FMA D;  3NVV A;  2N0S B;  2G45 B;  1L4D B;  4W9D A;  1CK1 A;  1R7S A;  2KDE B;  4K7S A;  1WE6 A;  1I7H A;  4ZOH C;  1R4M B;  3MJW A;  2Z0E B;  4E71 A;  5JHB A;  2V3N A;  2LXA A;  1WGY A;  1E7P B;  3AB5 A;  2KWD A;  2KX3 A;  1WX8 A;  1AAR A;  1IGD A;  4FHJ A;  1MHH E;  2ONQ A;  2JVC A;  1TGZ B;  2ZW1 A;  3B0A A;  3V3X A;  4LCD E;  2JWU A;  4BBN C;  2ZCC A;  2JT4 B;  4MT5 A;  4WWN A;  2JQR B;  2WU5 B;  1VDV A;  1C4P A;  2WS3 B;  3AH7 A;  3R2I A;  4N6E B;  2VH2 A;  3B08 A;  1A5R A;  2Z59 B;  1E8W A;  3AEF B;  5AZG A;  1E6E B;  3EUB 2;  1CJE A;  2XK5 A;  2D3C A;  4RGM A;  3TMP B;  4XWW A;  2NCN A;  4XYC A;  4FJZ A;  2PIA A;  1N6Z A;  3IHP C;  1RAX A;  2M4N A;  2K8C A;  3L0W B;  1WYG A;  2D11 A;  3LB8 C;  1I4Q A;  3RNE C;  3ZXV A;  2MBO A;  1XLP A;  1Z2M A;  1FCL A;  2REX A;  1V1P B;  2BT6 A;  2CHX A;  5AEK B;  3FAH A;  4CHK A;  2NTS A;  1CMX B;  2BGF A;  4M8N A;  2QEJ C;  2RPV A;  1E5W A;  1TKY A;  1ZP0 B;  3HUI A;  3EC8 A;  2RGF A;  2N9K A;  3L16 A;  3ZNI D;  3DBR B;  5H92 C;  1K8R B;  4C56 C;  3URY A;  5DPT A;  3ALB A;  4IM3 A;  2KFK A;  1WMH B;  1SB3 C;  4EE2 A;  5I4D A;  1FIQ A;  1P0R A;  3IBE A;  2O2V B;  2BYV E;  1WJU A;  3H6N A;  3P2B A;  4IW0 A;  2N1V A;  2MX2 A;  3AV8 A;  3NZ3 A;  2JUO A;  5JZE B;  1TIF A;  3EGR A;  4JPS A;  2IY0 B;  3RYT A;  3GP7 A;  4O1N A;  1GC7 A;  1OQR A;  3ML9 A;  1JWB D;  3P4P B;  4HDQ A;  4IKG A;  2TSS A;  4KDL B;  1R4M I;  4I6L B;  4GXB A;  1GC6 A;  1LO5 D;  4KDI C;  1I4X A;  1TS4 A;  3BK2 A;  2JWZ A;  5D94 A;  1EWC A;  1DOX A;  3DDC B;  3AEG B;  4TQ1 A;  2HD5 B;  2NMQ A;  3AE1 B;  1I4G A;  1XQQ A;  4GU2 A;  1VZ8 A;  4NJ6 A;  1WI0 A;  2BB5 A;  2KVZ A;  1QQR A;  3R7Q A;  3U2S C;  1KLV A;  1KJT A;  2PW9 A;  1JCK B;  2I2Y A;  3AI5 A;  4RF1 A;  1QZE A;  5HKH A;  2JSV X;  3S2A A;  2H89 B;  2D5G A;  2XK5 B;  1WF9 A;  2OJR A;  2RSU A;  1XEE A;  4K81 A;  2CU1 A;  1IBX A;  2E6X A;  3APD A;  3RUL A;  3PZ8 A;  4EZK A;  2FCN A;  3R7R A;  2AEH A;  1V5T A;  4C7Z A;  2JZZ A;  4BOS C;  1ROE A;  3A4S C;  2LJI A;  1I4P A;  3B2G A;  1DOI A;  5CHW A;  3LJ3 A;  2ZPY A;  3Q14 C;  4IOI E;  3EEC A;  1XLN A;  2CHZ A;  2IO3 B;  3ZNG C;  1FFV A;  1SEB D;  4AUQ C;  4ZYS A;  4E74 A;  4NJC A;  1UGJ A;  3GB1 A;  1YX5 B;  4MJS B;  2LXC A;  2BPS A;  3N1Z C;  4C7Y A;  3U30 A;  3DOW A;  3V60 A;  3AE2 B;  4B6W A;  2EMT A;  4KGT A;  1IYF A;  3ZNZ B;  3DBR I;  2DNF A;  3M63 B;  1K52 A;  4OVU A;  2LZ6 A;  2IBI B;  5AZH A;  1GUA B;  2KMM A;  3VR8 B;  2DYM A;  4USA A;  3RUI B;  3APF A;  1GJZ A;  3Q3F A;  4WQM A;  1JWM D;  4N9F 4;  4C4V B;  2ZNV B;  4GDL A;  2EKI A;  2RDH A;  5IP4 D;  3PHX B;  1HQR D;  4HXD A;  3KUC B;  2V3P A;  2QIE B;  2MJ3 A;  3VUW A;  3ZW3 A;  2NBV B;  1U4A A;  4ZRP A;  2V3S A;  2GBK A;  2L7R A;  3PRE A;  2CHW A;  3IXS A;  3KW5 B;  3I5J C;  5FR3 A;  2G4D B;  2EEL A;  2ZPN A;  3AE3 B;  1T6B X;  3DVN V;  4CQN A;  3ENE A;  1K51 A;  4MAC A;  3NUH B; 
#chains in the Genus database with same CATH homology
 4FN2 A;  2O2V A;  2R2Q A;  3PLV A;  4MGZ E;  5D7G A;  2KDF B;  4GGQ A;  1WIA A;  2PE9 A;  1R4N I;  1WXV A;  2KDI A;  1IPG A;  3ZTD A;  4PS7 A;  3RZF A;  1V86 A;  1G6J A;  2IZV B;  4BOZ B;  3AU5 A;  3DVN U;  4GB9 A;  2LAS A;  1GG3 A;  2D2Q A;  3KUZ A;  3N30 A;  2L05 A;  2XEW A;  2BF8 B;  4RM8 A;  4FJY A;  4X57 B;  3L17 A;  2N7D A;  5E6N A;  2WDT B;  3BY4 B;  4AJY B;  4W9G A;  1D3Z A;  3ZVV A;  2MLB A;  4BFR A;  4DBG A;  1V9J A;  2Y5B B;  1UEL A;  2UWQ A;  5D2M B;  3VVW B;  3TIX A;  2GBR A;  2LRW A;  4KIK B;  4FUL A;  2L0T A;  2KQ7 A;  5DPS A;  1WY8 A;  2KHW B;  3DVG Y;  4JIO U;  2L76 A;  4B9K A;  3ZTC A;  2BKF A;  5JHA A;  4DDG D;  4G50 A;  3RZW C;  2KQS A;  2D3G A;  3EHV A;  3B1L X;  4NAW A;  2KTR B;  3A33 B;  4TUU A;  2IO0 B;  1LFD A;  1Y8R C;  2J0M A;  3HM6 X;  4JLC A;  1GNU A;  1WR1 A;  2MBE A;  3NZU A;  1C1Y B;  2K8H A;  4NNJ B;  4HPM B;  2LD9 A;  2ZVN A;  3QX1 A;  3ZDM C;  2WYQ A;  5KHO A;  3UQB A;  3QA8 A;  2ZCB A;  4RM9 A;  2KJR A;  2ZZP B;  2W9N A;  4EEW A;  2A5U A;  1SGH A;  3ECI A;  2FCQ A;  4WJQ A;  3GZN I;  4I6P A;  5DCN A;  4FAD A;  3A9K A;  4WAA A;  3VTW A;  1OTR B;  4HVB A;  3RCZ A;  4LDT B;  5C23 A;  4MEL A;  2EMS A;  1E7U A;  3PRM B;  3H7S A;  4WQO B;  2C7H A;  3VH3 B;  4F8C B;  2K6Q A;  2NR2 A;  4GDK B;  4W9E A;  4ANV A;  1PQS A;  2KN5 A;  2JZ3 B;  2LI5 A;  1T0Y A;  1E8Y A;  1WRD B;  5LLI A;  3V61 A;  2N9E B;  2MSE D;  2MP2 A;  3DBH I;  1OEY J;  1SE9 A;  3DCG A;  1WXS A;  2DZM A;  4XX5 A;  2GBM A;  4W9L A;  1OGW A;  5CTR C;  1V49 A;  3MTN B;  4URK A;  2CS4 A;  3CMM B;  2WWZ A;  1UGM A;  2KDB A;  2LRU A;  2OOB B;  1M94 A;  2BYE A;  3PZD A;  2KWU B;  1I35 A;  2KFK B;  3PSE B;  3CST A;  2O6V B;  2MBB B;  2KTF A;  2NBW B;  4DHJ D;  2N1W A;  2KVR A;  4PYU A;  5G55 A;  3PT2 B;  2NPT B;  1WM2 A;  3TCA A;  3X0W A;  1TTN A;  4GSW A;  4EUT A;  2QHO A;  1J19 A;  3K9O B;  3GOE A;  1WZ3 A;  2C9W B;  3T8M A;  2L3Z A;  4GDL B;  1S1Q B;  4NQL B;  2ZNV C;  2KO3 A;  2KK8 A;  4GMV A;  3M62 B;  3QHT A;  4XC2 A;  3QQ8 B;  4BKS D;  4ANU A;  4K7U A;  4J6I A;  4DDI D;  1WR6 E;  2V4L A;  1J0G A;  3VH4 B;  3U8Z A;  3NS8 A;  4MGI E;  3LDZ E;  3UQA A;  3A9J B;  3VTV A;  2J7Q B;  1WX9 A;  3APC A;  2DX5 B;  4AOF A;  4HWI B;  2M0X A;  4IG7 B;  2FCS A;  3PRZ A;  2ASQ A;  2KJ6 A;  2NBU A;  1WH3 A;  2HJ8 A;  1WX7 A;  2DYB A;  4MJS A;  4A3P A;  4BKT A;  2DYO A;  3IVF A;  1S3S G;  3PTF C;  2G3Q B;  5C1Z A;  1H4R A;  4W9I A;  5TR5 A;  1OQY A;  3AUL A;  4G3X B;  1ZKH A;  4XZ4 A;  3N32 A;  2KAN A;  2KFJ A;  2AL3 A;  2KC1 A;  3NZS A;  5CX3 A;  2MBH A;  3Q3J A;  2YLM A;  1TBE A;  2MA9 B;  3PHW B;  4ZRK A;  3MHS D;  4BKS A;  3DBL I;  1WM3 A;  4W9F A;  3AU4 A;  1P98 A;  3HHM A;  4FHK A;  3SU8 X;  4HLE A;  2RR9 A;  2LVP A;  4FLH A;  3TBL D;  2KOX A;  4M8M A;  4WJN A;  2K8B A;  2G45 B;  3W1S A;  4W9D A;  4GN1 A;  2KLC A;  4II2 B;  1YD8 U;  2KDE B;  4K7S A;  1WE6 A;  3VTU A;  1KOT A;  2D10 A;  4IWP A;  3WAL A;  4EFO A;  4BKG A;  3ZUN A;  4HK2 A;  2KMC A;  3ZLZ A;  3NHE B;  5KHQ A;  1FXT B;  4A20 A;  4HDO A;  4FA6 A;  2DEN B;  1E90 A;  3MJW A;  2Z0E B;  1P3Q U;  3WA0 A;  3VXW A;  3VUY A;  2Z0D B;  1Z5S B;  3DPD A;  4E71 A;  4G11 A;  5JHB A;  4CO7 A;  2LXA A;  3NOB A;  3OJ3 A;  1WGY A;  4CYE A;  1WZ0 A;  2D07 B;  5J2R A;  2WX1 A;  5JH5 C;  5E6O A;  3PVL A;  2KX3 A;  1WX8 A;  1WGH A;  2JPH A;  3RD2 A;  2NVU I;  1AAR A;  3TJP A;  1V5O A;  3HM3 A;  1WGR A;  1V81 A;  3H9D A;  4FHJ A;  2JVC A;  1YJ1 A;  4OVV A;  4DHZ B;  3K9P B;  2BWF A;  3WAO A;  5CHF A;  3M3J A;  4ICU A;  1TGZ B;  3V62 A;  1WGG A;  2KZR A;  1HE8 A;  3B0A A;  2LVO A;  2J0J A;  3KH0 A;  4LCD E;  4WWO A;  4DWF A;  4P7I A;  2WX0 A;  4BBN C;  3SD5 A;  2ZCC A;  2JT4 B;  4I6N B;  2XBB C;  1IP9 A;  4W9K A;  3WAP A;  2LWP A;  3QK0 A;  4FBJ B;  4WWN A;  3DQV A;  4IUM B;  3WAN A;  3SHQ A;  1RFA A;  4FJV B;  4B95 A;  4KVG B;  1WJ4 A;  3KUD B;  4LJP B;  2A4Z A;  1V2Y A;  4ZRJ A;  3B08 A;  4GIV A;  1A5R A;  4YL8 A;  3QIJ A;  2Z59 B;  3HK0 A;  2PJH A;  2N9X A;  1WE7 A;  2ZJD A;  2DZJ A;  3JVZ X;  2EKE C;  4MSQ B;  1E8W A;  5AZG A;  4KIK A;  4A3O A;  3TL5 A;  2HE7 A;  3A4R A;  1MG8 A;  2FID A;  2ZEQ A;  1TZ1 A;  3PV1 A;  2FCM A;  4KZ0 A;  3L13 A;  3OAW A;  4K1R B;  2XK5 A;  2GMI C;  3TMP B;  3ZIM A;  2NCN A;  4FJZ A;  3WAM A;  2KTR A;  4IWO A;  3ZKJ C;  4MM3 A;  2DZK A;  3IHP C;  1RAX A;  3CSF A;  2M4N A;  1EUV B;  2PE6 B;  2K8C A;  3ZO5 B;  3L0W B;  2D11 A;  3JSV B;  3VAW A;  5LXH A;  2M8S A;  3JW0 X;  1UBI A;  5E6P A;  2MBO A;  2KD0 A;  1Z2M A;  1UD7 A;  3T9L A;  3VUX A;  2L8J A;  1YIW A;  2REX A;  2L0F A;  4ZYN A;  2ZVO A;  3RT3 B;  2CHX A;  5AEK B;  4HPL B;  4CHK A;  4TV3 A;  1CMX B;  2BGF A;  1NDD A;  4GDK A;  3ML8 A;  4M8N A;  5BO4 B;  4JGH B;  3ZNH B;  2C7M B;  3EFU A;  4DHJ B;  1XT9 B;  1E5W A;  2FNJ B;  4KZC A;  5DPR A;  1UZX B;  4ZDV A;  3H7P B;  3KYD D;  3V6C B;  1ZW7 A;  2LGX A;  3EC8 A;  2RGF A;  5DPW A;  3L16 A;  3ZNI D;  2JRI B;  4HCP B;  4ANX A;  1K8R B;  3OLM D;  3QC8 B;  3KYC D;  1VD2 A;  4E3C A;  5DPT A;  2FAZ A;  1P1A A;  3C0R B;  3ALB A;  4ASW C;  3ZRC A;  3QAR A;  4IM3 A;  2KFK A;  1WMH B;  2KWV B;  1LXD A;  2JXX A;  2O6V A;  1Q1O A;  1EO6 A;  2BKR B;  2N7E A;  4DK5 A;  4WJP A;  1P0R A;  1Q0W B;  3IBE A;  2O2V B;  2BYV E;  2NPT A;  1V6E A;  5CHV C;  1ISN A;  1WGD A;  1WJU A;  3H6N A;  2C7N B;  3P2B A;  3L54 A;  1NI2 A;  4MH0 E;  4IW0 A;  2IY1 B;  4EKU A;  1JRU A;  4BVU C;  2N1V A;  2MX2 A;  4LJO B;  2LJ5 A;  2BYF A;  2JUO A;  3VHT C;  5JZE B;  5L95 C;  2MQJ A;  2IY0 B;  3PGE A;  3H1U A;  3RYT A;  1GC7 A;  1LQB A;  3ML9 A;  2YVC A;  3A9J A;  3L10 B;  3PPA A;  4HJK A;  1WXM A;  1I42 A;  2DAJ A;  3I3T B;  4DHZ E;  2FUH B;  1KM7 A;  1YQB A;  4HDQ A;  4MEM A;  4KDL B;  2BWE S;  3R66 C;  4IM0 A;  1R4M I;  2PPH A;  1E8X A;  4I6L B;  3UF8 A;  4GXB A;  1GC6 A;  2HTH A;  4KDI C;  3A1Q A;  3QAQ A;  4NQK E;  4WWP A;  3VQI A;  2DZI A;  3CF6 E;  3U7D A;  4IC7 B;  4TQ0 A;  2G4S A;  3PRP B;  2JWZ A;  5D94 A;  4NAW B;  3DDC B;  2MCN B;  2I1K A;  1WXA A;  4TQ1 A;  2HD5 B;  4F1S A;  4II3 B;  4ICV A;  4IM2 A;  1XQQ A;  3IG3 A;  4GU2 A;  4EZJ A;  2MWS B;  1NBF C;  4NJ6 A;  3AXC A;  1WI0 A;  3R7Q A;  2M1M A;  3BIN A;  3VFK A;  4W9C A;  4ANW A;  4W9J A;  2L00 B;  2MBQ A;  2GBJ A;  2LUE A;  1KLV A;  5IAA C;  3WIM A;  1ZGU B;  5J18 A;  1E7V A;  1KJT A;  3A9K B;  1L2N A;  2AWT A;  3NY5 A;  4JQW C;  1X1M A;  3AI5 A;  4NY0 A;  3QCA A;  1QZE A;  2KKC A;  5HKH A;  2K6D B;  3S2A A;  1LM8 B;  1BT0 A;  2MP2 B;  2MRP A;  2K1F A;  2XK5 B;  2IYD B;  2KX0 A;  1WF9 A;  2OJR A;  2RSU A;  4K81 A;  2CU1 A;  3O65 B;  4PS8 A;  1P9D U;  2KNB A;  3APD A;  2GOW A;  3RUL A;  4LDT D;  2N4F A;  1WJ6 A;  4EZK A;  2KWC A;  1EF5 A;  2FCN A;  1C3T A;  3UIP B;  3R7R A;  5G2N A;  2AEH A;  2VRR B;  4KSK C;  2K39 A;  5AZF A;  1V5T A;  2KXJ A;  4TKN A;  2JZZ A;  2K25 A;  2KJH B;  3A4S C;  3QWZ B;  4BOS C;  2DHZ A;  4AWJ A;  5FR6 A;  2JY6 A;  2RPQ A;  3PLU A;  4EOY A;  3D32 A;  5CHW A;  2LGD A;  3X23 A;  3LJ3 A;  2KLG A;  3ZDT A;  5IA7 A;  3QJZ A;  2ZPY A;  1WJN A;  4AP4 C;  1V80 A;  3EEC A;  1OEY A;  4NJ7 A;  2CHZ A;  2IO3 B;  3ZNG C;  4MGY E;  3OJ4 B;  4PYZ A;  5EDS A;  3VDZ A;  4AUQ C;  2V1Y A;  3PS6 A;  4E74 A;  1F9J A;  2O6V D;  4KV2 A;  1YX5 B;  1WFY A;  3M95 A;  3DVG X;  1XD3 B;  3HIZ A;  4MJS B;  2LXC A;  2BPS A;  4IWQ A;  2NS5 A;  4AJW A;  1SIF A;  2JRH A;  1RLF A;  2CR5 A;  1E8Z A;  2LGY A;  5D6J B;  3U30 A;  4HCN B;  2B3A A;  3DOW A;  3ONS A;  3V60 A;  3R3M A;  4B6W A;  3UIN B;  1H8C A;  2MW5 A;  2M17 A;  4K7W A;  3W1S C;  4JL9 A;  2EMT A;  1J8C A;  1IYF A;  2C5L C;  1WYW B;  3DBR I;  4MDK E;  2AL6 A;  3JSV A;  3M63 B;  3SDL C;  3ZNZ B;  2IO1 B;  4OVU A;  2LZ6 A;  2IBI B;  5AZH A;  1GUA B;  2I1J A;  3UGB B;  4G0N B;  3ZRF A;  5LXI B;  2DYM A;  3RUI B;  3APF A;  1GJZ A;  3Q3F A;  2FIF A;  4MSM B;  4N9F 4;  1UBQ A;  5GMV A;  1L7Y A;  2ZNV B;  2KMA A;  5J17 A;  3W1Y A;  4GDL A;  3N3K B;  1RRB A;  3PHX B;  2DAF A;  2KC2 A;  4HXD A;  4DXA B;  3DBS A;  3KUC B;  4M0W B;  1Q5W B;  2LVQ A;  3A1Q B;  3VUW A;  1UH6 A;  4GOC A;  4KSL C;  1EF1 A;  3ZW3 A;  2NBV B;  4ZRI A;  3V6E B;  2GBN A;  1U4A A;  3H7P A;  3KVF B;  4NPN A;  2RD0 A;  2V3S A;  2GBK A;  2L7R A;  3PRE A;  2J0K A;  2CHW A;  5L83 A;  3KW5 B;  4WJO A;  2JF5 A;  4PS3 A;  2G4D B;  4EZL A;  3JYU A;  2ZPN A;  2N9P C;  4F7Z A;  3IFW B;  3DVN V;  1WMH A;  2C60 A;  3ENE A;  3L08 A;  4MGK E;  2R2O A;  2CKH B;  1YX6 B;  3UIO B;  2PEA A;  2AYO B;  2UYZ B;  2IO2 B;  4W9H A;  4RMA A;  4BBN F;  1VCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...