2KVZA

Structure of residues 161-235 of putative peptidoglycan binding protein lmo0835 from listeria monocytogenes: target lmr64b of the northeast structural genomics consortium
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
85
structure length
85
Chain Sequence
MDFGKPNQVTVNYLDENNTSIAPSLYLSGLFNEAYNVPMKKIKGYTLLKYDSEILGVFTESPQTINIIYQKKAPEQALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of residues 161-235 of putative peptidoglycan binding protein lmo0835 from Listeria monocytogenes: target LmR64B of the Northeast Structural Genomics Consortium
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
molecule keywords IspE
total genus 12
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06458 MucBP MucBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 2kvzA00
2KYWA 4M00A 4M02A 2KT7A 2KVZA 4M01A
chains in the Genus database with same CATH superfamily
2WHIA 2LD9A 4M02A 2KNBA 3HRDD 4US8A 2K8HA 3ML9A 2WS3B 3T9LA 1R4NB 2JYTA 2R2OA 2XNAC 3Q6BA 2KVZA 1V5TA 4RGTA 1FNVA 5J17A 1V1OA 2NS5A 1SE4A 1QOAA 2JVCA 4NJCA 3I57A 3EC8A 2AYOB 2KLGA 3EHVA 2CS4A 4MGIE 3V6EB 4BKSA 3DBLI 2J52A 4GXBA 2BT6A 3ZDTA 2DENB 3L17A 2QHOA 2KKCA 1HA5A 4ZRIA 2ACZB 5G55A 4IWPA 4USAA 4BAXA 3PGEA 4LNNA 2PE9A 1OFFA 3ZJUA 2D10A 4XGAB 2LASA 3HUIA 2N7EA 4C7ZA 2D3GA 4XC2A 4BZAA 2JRIB 5BMHA 3BVZA 1S3SG 5G2NA 2O6VD 1TKYA 4KSKC 3H7SA 3WIMA 3IXSA 4YTNB 3WA0A 1T0QC 2KMMA 2RD0A 4IKGA 2R2QA 3VH3B 2BWES 2W3RA 5DPSA 1N5XA 1XCQL 3PRZA 4G3XB 2PPHA 1I4PA 3PREA 1YQ4B 3U8ZA 2KJ6A 2QC8A 4J6IA 4NPNA 1FM0D 1P98A 4O1NA 2V4LA 4B6WA 3ZW3A 2J4XA 4BKTA 2MEKA 3UQBA 2PE6B 1CQVA 1H8CA 3SEBA 4NNJB 4K81A 1YN5A 1V80A 3PO0A 3QC8B 3PTFC 2IYDB 1UUPA 1D5XC 1WJ6A 4A55A 4B95A 3CF6E 3I63C 2EELA 1PGBA 1QOGA 2N9XA 3HK0A 2RR9A 1GOZA 1WR6E 3J9CA 1EF1A 4RFBA 4FA6A 1TBEA 3WAOA 2XN9C 3BIID 1ENFA 4HRSA 4A6QA 3OAWA 1GG3A 4JLCA 5E6OA 4IC7B 1WM3A 2L1AA 1K53A 2MSED 2IBIB 2LVQA 1IP9A 2NMQA 2FNJB 4ZYNA 3P2BA 4WH4A 1DOIA 2MBEA 2MWSB 2LUEA 1L0VB 2ZPNA 1DGJA 4ARCA 3RNBC 1IPGA 1JWMD 4ANUA 2O2VB 1VRAB 1Z2MA 2LVOA 4HJGE 2AL6A 3A9KB 3AEFB 3HM6X 4LNIA 5D7GA 3V62A 2KLCA 1DYQA 3BK1A 3W5VB 2Y5BB 1MPEA 2KTRB 2X38A 5L83A 2KWUB 1N60A 4FJZA 1UELA 1UGMA 4EUTA 1E8ZA 4AWJA 1F2RC 3EA6A 2HTME 4PYZA 4PS8A 3VUXA 1OQYA 2IPKD 3RNAC 3GZNI 1KTKA 3A1QB 3IT4B 1ZXIA 1ZPSA 4EZLA 4YSXB 3JSVB 5JHAA 2D07B 4A9AA 2EKEC 1WY8A 1RLFA 2BYTA 2DNFA 4WJOA 4OZBA 2KDIA 1IUEA 1EM7A 1MG8A 4M00A 2W3SA 2NTTA 4OVZA 2L76A 3TCAA 4AOFA 1KM7A 2KFKA 2KJRA 1SF0A 3VH4B 2N7JA 2FCSA 4EFOA 1WGYA 1TYGB 1VJKA 2PW9A 3QX1A 3Q3MC 1MJDA 2JRHA 1EUVB 4I6NB 2ZEQA 2DZMA 3CMMB 4FN2A 3FC4A 3VAWA 5L95C 3PHXB 3NG0A 4ZRPA 3Q8BA 1I35A 1LQBA 3D32A 2ZW1A 2KACA 1GC7A 3DVGX 3TIXA 5DPTA 4EKUA 4KGTA 1PQSA 4TV3A 1I4XA 4KZ0A 1J7CA 3T8MA 1RFAA 2Z8LA 1QQRA 4FHJA 2B3AA 3CIRB 3ZXRA 1UZXB 1WWTA 2NBUA 4W9IA 2VZKD 2C7HA 2QJLA 2W55A 3DOWA 4GDLB 2KDBA 3I3TB 2LI5A 2ONQA 1VR9A 1BT0A 1FFUA 2GLSA 4ICVA 2MP2A 2ZZPB 3N1ZC 1R4NI 3AEGB 3A9JB 3Q3NC 4F8CB 2CJNA 1T6BX 4XZ4A 2IGDA 2DLBA 1P7EA 3P1MA 4E3CA 3GE3C 2M19A 4OHJA 3H7PA 2GBMA 2MBHA 4WJNA 3VRBB 2ZVNA 3LB8C 1KH0A 1L6UA 4E74A 4IG7B 2FCMA 1AN8A 1E5WA 4ZHOA 4NQLB 2BB6A 2RMMA 1OTRB 1I4GA 3U7DA 1PFDA 4N59A 3ZQ4A 3TEZA 4CO7A 2RDBC 3HIZA 2KVRA 1IYFA 1F77A 1VCBA 4JE3B 1C9FA 3FILB 2J42A 1UH6A 3AI5A 4L1BA 2ZCCA 3NVWA 3H1UA 2MLBA 2XBBC 4A3PA 3N1YC 4F1SA 2LHEA 4BOSC 3RCZA 3E56A 3R3MA 3NUHB 2TSSA 1K51A 2IO2B 1SBBB 2DZKA 1WX9A 2NPTB 3MC9A 3DBLB 4QAYA 1JROA 2DZJA 2LHDA 3T3OA 3H6NA 3N20C 2N9PC 3V3XA 3WCQA 3GP7A 3Q3FA 4OVVA 2J0MA 3VTWA 3NZSA 3NS1A 1MVKA 2BS2B 3U52E 4F7ZA 2BF8B 3M3JA 2DAFA 2QILA 4NY0A 4W9EA 3L54A 1Y8RC 1WZ0A 4RF0A 2Z0EB 4ANVA 3Q14C 3UGBB 2BGFA 2CKHB 4YT0B 3U2SC 1J7BA 4KDIC 3HVZA 3QAQA 2X8XX 2KQSA 3RMKC 4BKGA 3AXCA 2UYZB 1Y56A 1Z5SB 4GDLA 1P1AA 2FCNA 1L4DB 2DWQA 2JUOA 4B0EA 1TS2A 5FK9C 2EKIA 3SDLC 3C8YA 1EWYC 1KLVA 2IDYA 1GPXA 4KVGB 1YD8U 5H8YE 1P0RA 3N1XC 2J7QB 4M8NA 4P7IA 1V97A 1QOBA 3DDCB 3UIPB 4ZRJA 2LUMA 1LGRA 2BWFA 3VUWA 2K1FA 5CHFA 1NYQA 3W5UB 2LRWA 4BOZB 2DAJA 1V81A 1ZUD2 3TL5A 2CHZA 1MG4A 2Y5CA 2CJOA 3RZWC 3AULA 2MW5A 2RGFA 4RCOA 1YMHE 4J3OD 3X23A 5J18A 3IHPC 5CTRC 1YIWA 2KTFA 3A9JA 2N9KA 4NJ7A 1EF5A 2G3QB 3B1LX 2OHFA 5IN7A 3AM9A 1FCCC 5C1ZA 2OOBB 3A1QA 5DCNA 2NPTA 3B2FA 4A8XC 2JZ3B 1V2YA 4XX5A 2GOWA 1SE3A 4DHJB 2BPSA 2AX5A 1LFDA 4JWSC 3NZUA 4ZHPA 1U4AA 3NY5A 1WR1A 2JF5A 4HCPB 2PIAA 4AJYB 3PLVA 2ZW0A 3NVVA 1L2NA 4ICUA 4G50A 1KFYB 3APFA 1WXQA 2VH2A 1BXTA 1ZOYB 1XQQA 1OEYA 1L0XB 5EE0A 4LCDE 4IWQA 2BS3B 5DPRA 4DQOC 4ASWC 2WXOA 1OQRA 1SB3C 3AE3B 1FRRA 3NRZA 3R2IA 2KWVB 3DBHB 4PS3A 1IBXB 2O6VA 3AE7B 3LDZE 3ZNZB 2SAKA 4OVUA 2WP9B 3TUOA 3S2AA 1YQ3B 1B1ZA 5HFYA 2LXAA 3Q8EA 1WGKA 3CSFA 2MP2B 2K9XA 2M1MA 3N3KB 3MJ5A 3GB1A 3UF8A 2AQ1B 3WAPA 4A3OA 4ANXA 3DBRI 5CX3A 1SXTA 3RZFA 1KRHA 1XO3A 1C4CA 4MH0E 2PMVA 1WRDB 5E6NA 4WJPA 3AE9B 3AEDB 3DBSA 1PUTA 2RDHA 2D3AA 2WXHA 3KUCB 1WFYA 1FXIA 2WXIA 4EE2A 1F0ZA 1P3QU 3QWZB 3ONSA 4PK1A 3C19A 2M17A 5C23A 4WWPA 1WJNA 1MHHE 2IGGA 4K3CA 1DOYA 4II3B 1RM6C 3P42A 3NHEB 3KYDD 4LNFA 2H89B 2WXFA 1SE9A 3DHIC 3TJPA 1TY0A 3ZNGC 3A4SC 2MJEA 5TSSA 5IKCM 4AJWA 3AH7A 3ZO5B 3OG5A 1JMLA 4DHZE 2L0FA 2QSDA 4ARIA 2K5PA 1JW9D 3EGRA 4FBJB 1TKEA 2V4IB 1VZ7A 1N62A 2C7NB 3DWMA 1C79A 3ZGZA 2REXA 2FAZA 4XWTA 4LK0M 2N9LA 2FIFA 1WZ3A 4MT5A 1SE2A 2L0TA 2GI9A 4GDKA 4MJSB 2HD5B 5G5GA 4R3DA 1OQQA 2LRUA 4FJYA 1KF6B 2K6DB 2IO0B 1GJZA 3I9V1 1GNUA 2L8JA 3NVZA 2WU2B 2MRPA 2KK8A 2K8BA 2JY6A 4IM0A 3VVWB 3A9KA 2PLPA 4TMAB 3VFKA 1NBFC 2MCNB 1F2RI 2UU7A 2WXPA 4JQWC 2KD0A 3TSSA 1KLGD 1V49A 2KC2A 2LVPA 5FR3A 3R66C 3H8HA 4DK5A 2I38A 1WRIA 3KUDB 4JPSA 1C78A 3AU4A 1OGWA 1TS3A 2QIEB 4WJQA 5DPWA 3JVZX 2K8CA 3AE5B 2JYEA 5E6JA 4IUMB 2ZNVC 3PV1A 4JX1C 2UWQA 3QQ8B 1ZP0B 3NVYA 2CU3A 2AEHA 2AQ3B 1CZPA 1M4VA 4MELA 2M0XA 1EU3A 1J19A 1L7YA 2BQQA 1WGGA 1FFVA 2RDGA 1N63A 2BYEA 2FE8A 1UWMA 3H7PB 1SGHA 4REZA 5IAAC 3M62B 2NR2A 2IGHA 4GB9A 5D6JB 1V86A 3HHMA 4ACFA 1NVID 1L5PA 2E3TA 3KUZA 3RNEC 2KN4A 4GMVA 4HDQA 2Z0DB 4TKNA 2JZZA 3ZJVA 1JWBD 3HM3A 4A20A 1WXSA 4AQ7A 1C4PA 4C7YA 3Q3OC 4ZYSA 1K50A 1TKGA 1FD6A 2AWTA 2ON8A 1I42A 1F52A 3BYTB 1ROEA 3IT6B 3BY4B 4PYUA 1D4BA 3UQAA 1XLNA 1XF5L 2JWUA 1SEBD 3O65B 3BVMA 3FKYA 1JQ4A 3O13A 2IZVB 1NEKB 2D2QA 4RGNA 1KOTA 5HI1A 5AZGA 1Q5WB 2INPE 2FCQA 3KVFB 3L16A 2B76B 2E6XA 4EOYA 3AEBB 1ZDXA 2KHWB 3UIOB 3DQVA 1J8CA 3M95A 1JCKB 1HTQA 1HZ5A 3RN9C 3WANA 3SFDB 2K0PA 5FR6A 4PS7A 2V3SA 5BMGA 3VR8B 1X1MA 1WMHA 4EZKA 4W9HA 3RNCC 5JHBA 2LWPA 1YOVB 5GMVA 2L52A 3X0WA 3ZDMC 2CHXA 3W1SC 2EMTA 4NAMA 4A90A 5GXGB 4KKJA 2MBBB 3VQIA 3LJ3A 1SSNA 2JXXA 2JPHA 1PDXA 3DPDA 4YSZB 3ZYYX 2IO1B 3AE4B 1TS5A 1FXTB 3TMPB 2FUHB 3K9OB 2M4NA 4HVBA 4C4VB 3MC0B 4M0WA 1HEZE 4LTUA 3M63B 2KZRA 4MM3B 5BO4B 4L23A 3PVLA 3BK2A 4TQ1A 3L13A 1YJIA 1OEYJ 3AE6B 3RPFC 3DVNU 4HPLB 1JWSD 1YX6B 5IP4D 4HJKA 4G0NB 4LDTD 3SR6A 1WXVA 2KWCA 1FXAA 3P4RB 2VZKB 2D11A 1QZEA 1WGDA 3R7RA 3ZTCA 1IGCA 1RYJA 1J7AA 4WWMA 2GRIA 3VRAB 1EU4A 1JWAD 3ZUNA 2KT7A 2DYOA 4N6EB 1JRPA 3AEEB 3PT2B 4HEA1 2O2VA 4YSYB 3DHHC 4RM8A 1XLQA 2IY1B 4GN1A 3P4SB 3BZDB 2JSVX 2FBWB 2KTRA 3GS2A 2H88B 2A4ZA 2HE7A 3PHWB 1RAXA 1AARA 4W9JA 1CMXB 3DVNV 1XD3B 4IDIA 4XYCA 2QEJC 4XDCA 1G6JA 1E10A 1H4RA 2K6QA 1QOFA 3E9SA 2BTEA 1T0SC 2ZJDA 4WWOA 1BUIC 2Y3AA 1YJ1A 4GIVA 3PRPB 3IG3A 3N9YC 3U30A 3VTUA 1V5OA 4HXDA 4DXFA 2KQ4X 3MJWA 1T0RC 1PGXA 3QHTA 1WXMA 2GBJA 1FNUA 2PVOD 3ZXVA 1P9DU 2XK5B 1SIJA 3RI7C 2N1VA 3KH0A 1E8XA 1VZ8A 2IJ0A 1XEEA 2LGIA 2KYWA 4W9CA 4YTMB 3ZJTA 2KDEB 3IAS1 5KHQA 1KLUD 1MHXA 3ALBA 3MP9A 4URKA 1FNWA 1YX5B 2DZIA 4KKIA 1UGJA 2KX3A 1L4ZB 5CHWA 2G45B 2L00B 3EUB2 3JW0X 5C3JB 3WAMA 3RNGC 1DOXA 1EO6A 1UBQA 3L08A 1E8WA 2INCC 1WE7A 1ZW7A 4BBNF 4BKSD 5AEKB 1C4AA 4W9KA 2C60A 3K9PB 2GBRA 3KWLA 4IWOA 2LGYA 1IGDA 1NI3A 2NBVB 3C0RB 4MSMB 1YJJA 2DYBA 2BYFA 2NVUI 2W82A 3L10B 4NAWB 4NJ6A 3BVGA 3EECA 2MJ3A 3SD5A 3TBLD 4TQ0A 4WQOB 3QARA 2M0AA 2QMTA 2C5LC 4LNOA 4ZOHC 4K7SA 2INDC 2K39A 3GOEA 5AUKA 5LXHA 2FUG1 3HVDA 4P1BC 2IO3B 1T0YA 2GBKA 2ZVOA 5FKAC 4E71A 2N0SB 3B2GA 3QIJA 4K7WA 2Q5WD 2WXRA 4UDUC 1UWXA 1AWDA 1FO4A 4DDID 1WX8A 4M01A 2KXJA 1RRBA 3DBRB 2CHWA 2ASQA 2JU6X 2V9HA 1Q1OA 2WXKA 2HJ1A 3KLSX 3FILA 1WGHA 1CK1A 4MACA 1UD7A 3URYA 3VXWA 2N9EB 3ML8A 1FIQA 1I7HA 5EE9A 2BKRB 1UF0A 3ZVVA 5T8IA 2WXLA 4RMAA 1R7SA 4FADA 4L2YA 1TZ1A 2BS4B 1NI2A 1GB1A 2KDFB 4IM2A 4KSLC 1TGZB 4C4VA 1EWCA 4HPMB 5MPOA 4K7UA 4MEMA 2WWZA 2KANA 1FCLA 3Q2AC 2LMCA 2QCZA 2A5UA 1I4HA 1ET9A 2QDFA 3JSVA 3APDA 3AB5A 2W54A 5D3IB 5BYSA 1TT5B 1V1PB 2YVCA 3DCGA 3AE8B 2Z59B 3Q8AA 1FMAD 5KHOA 2O6VB 4P6VF 4OZCA 2WU5B 2IY0B 2MBQA 4KIKB 3NJTA 4DXAB 2CR5A 4HKQA 3MHZA 1RFKA 2WX0A 3R7QA 3Q8FA 1GAQB 3RUIB 2KO3A 2EMSA 2WYQA 2WQYB 4HK2A 3PZ8A 1WYWB 3KWVA 1V1PA 3EFCA 3EFUA 4DDGD 2R61A 2KAJA 4K1RB 4NZLB 2RSUA 4GGQA 3AV8A 2G1EA 4FJVB 1SJHD 1T5XD 2K3UA 4CYEA 3U4EG 1V9JA 4FLHA 4ZRKA 3A33B 4FULA 1WJUA 3PZDA 4FXCA 1V8CA 1E90A 1UBIA 4GLSC 1MFWA 3Q8CA 4HWIB 2V3NA 1TTNA 4OZAA 1WXAA 4RNAA 1E7PB 3VDZA 2NBWB 1P7FA 3L0WB 3PPAA 1K52A 3LXFA 3I5JC 4BBNC 2I1KA 1E0ZA 1K8RB 3CSTA 2MJDA 4AUQC 1WYGA 2V0GA 5LXIB 4RM9A 1N5WA 3A4RA 2K25A 1M94A 4MSQB 4ZDVA 1LO5D 2WXGA 2Y5PA 4DHJD 2PJHA 4CHKA 3KYCD 1D3ZA 1WE6A 2NTSA 4US9A 1JRUA 3TEYA 2MQJA 1S1QB 5AZHA 3Q69A 1F1HA 2DX5B 1ZXHA 1WMHB 3CWIA 4B0MA 4KIKA 5D2MB 5TR5A 3OJ3A 5IO9A 2MBOA 5JXVA 2ZPYA 2GB1A 2MX2A 3QJZA 1ACCA 4KX6B 1FEHA 2WDVB 2V3PA 1GC6A 1YN3A 2GBNA 2KWDA 3RULA 5EDSA 2KMCA 1UNSA 4C80A 4YL8A 2JXTA 2HTHA 3RT3B 3V61A 4BFRA 2MH7A 3ZNHB 2ZNVB 3V6CB 4JWUC 4RF1A 1AYFA 3MTNB 4C56C 1IBXA 3B08A 1XLPA 2N1WA 4YXDB 1QLBB 3APCA 1F9JA 4W9FA 4HDOA 2HDEA 2AL3A 2WGSA 1LM8B 2GMIC 2KX0A 4G11A 5EE3A 1QF6A 4I6LB 1TIFA 2PEAA 2BBCA 2KN5A 1SIFA 3N30A 3RYTA 4WAAA 2C7MB 3PLUA 1WGRA 4JIOU 4LJOB 2WDRB 2KQ7A 3PSEB 1VD2A 3FAHA 1ESFA 4P16A 4KGRA 1HXYD 1WSPA 1NDDA 1R4MI 2D3CA 2XEWA 4PT5A 4EEWA 4HKZE 5C2TB 1WM2A 2PKOA 2L83A 4D2KA 3V05A 2RPVA 1HE8A 3IFWB 3VUYA 1L0YB 3AEAB 1WF9A 2KC1A 1WI0A 4TSSA 2AQ2B 4N9F4 3ZNID 2BKFA 2LEKA 4MGZE 3ZKJC 2NCNA 3N32A 2DHZA 5D3DA 4EZJA 3IAM1 2MHJA 3Q3JA 3UINB 1GB4A 5HG2A 5LNK1 2XK5A 1D5MC 2BB5A 4DBGA 1NENB 3IVFA 2WDQB 4I6PA 2LGSA 2L7RA 4OW0A 1QKZA 5J2RA 3BWUD 3AMZA 3VTVA 2VRRB 2W9NA 1GUAB 3VHTC 4X57B 4LDTB 3RD2A 1Q0WB 3W1YA 4MH8A 5I4DA 3BYYB 2L05A 2RPQA 5HKHA 1B9RA 5BYQA 4MGKE 3QCAA 2OJRA 4DXGA 4NQKE 1E6EB 2D5GA 4GU2A 1STEA 3OWEB 3U7ZA 3MC8A 3P4QB 4WIPA 1E8YA 4YWGG 1ISNA 1WJ4A 3IBEA 1R4MB 2KOXA 3BINA 5LLIA 2KDMA 3NZ3A 4GDKB 4Q2JA 4II2B 3RNFC 5E6PA 2YEPF 2YLMA 3P4PB 2WXMA 4FHKA 2YEPB 2LGDA 3DHGC 4TUUA 2N7DA 1L6VA 2KFKB 4RGMA 2WX1A 3QK0A 1QILA 4HROA 3OLMD 3KQ4A 1VLBA 2OEDA 3ZLZA 3LYYA 4IW0A 1C77A 4DHZB 1LXDA 2G4DB 4W9LA 2J53A 2JWZA 3B9JA 1HZ6A 5D94A 4ZRQA 5IA7A 1CJEA 2KFJA 1XXGA 5CHVC 3H9DA 2N4FA 2M56B 1RWSA 3TEWA 3W1SA 4NAWA 1HQRD 2INNE 4BVUC 4M8MA 1Q10A 4HLEA 1WX7A 3B0AA 4MM3A 4IOIE 3T3NA 1YN4A 3DWGC 1T3QA 3AE1B 1ZDVA 2BVCA 4S0RA 2CU1A 3DBHI 5HHDG 2V1YA 5BMIA 2KMAA 4HCNB 4JGHB 2I2YA 1VZ6A 3NOBA 5AUIA 2WDTB 1ET6A 3L4PA 3ZRCA 2DBYA 5IOIA 2JX5A 4DWFA 2J0KA 3NS8A 3GE8C 2WXNA 4XWWA 4H2AA 4AP4C 2WXQA 4RH6A 3W9CB 4WQMA 3R2TA 4K3BA 3ETRA 3MHSD 1N6ZA 3ENEA 3SU8X 2D3BA 1AW7A 2LJ5A 1BMLC 1ZE3D 1XLOA 2G4SA 2PVGC 4IM3A 2LGXA 4W9GA 1I4QA 1HTOA 5JH5C 2C9WB 4P1CC 3P63A 2LZ6A 1SJED 4MGYE 5JZEB 3TEXA 1I4RA 2G9HD 4HPPA 2ICIA 2LJIA 4KZCA 3SHQA 2WXJA 4KGSA 2WLBA 3W2DA 2DYMA 1MI0A 4M0WB 1YNTE 3V60A 4LJPB 3QA8A 3ZRFA 1D5ZC 1PYWD 4RGOS 3SFEB 4LLGM 1XCTL 2LXCA 1E7VA 1E9MA 1ZKHA 1WH3A 4S17A 1E7UA 2BW2A 2BYVE 1TJEA 3MFGA 1TZOA 1J0GA 4YTPB 3AU5A 4AS1A 1C76A 2M8SA 4WWNA 3PS6A 4B9KA 2I1JA 4LNKA 3VR9B 1D6EC 3DVGY 4N58A 2OJWA 3R8BA 1C3TA 3AE2B 1A70A 1VDVA 2KJHB 3ABVB 5AZFA 1KJTA 1C1YB 2L32A 3OJ4B 3ZIMA 3KW5B 4ITKA 3RFZB 3AN1A 2K22A 3WALA 3GZNB 2J0JA 3ZTDA 5G5HA 1NYRA 2WNMA 3JYUA 4JL9A 1ZGUB 1V6EA 2FIDA 4KDLB 5EE1A 1QT9A 1N61A 4KV2A 1XT9B 2JQRB 4GSWA 1A5RA 1TY2A 4WURA 1PGAA 4MDKE 5H92C 1WIAA 3PRMB 1TS4A 4ANWA 2PTLA 4C00A 2LFIA 4CQNA 2JT4B 2JZPA 3UI3A 2HJ8A 1JWUD 4MJSA 2MA9B 3ECIA 2SEBD 2ZCBA 2VH1A 4GOCA 4WAFA 1JALA 1YQBA 3PZ7A 3AECB 1FRDA 4W9DA 2L3ZA 4XDDA 4XE0A 5BYRA 1FPYA
chains in the Genus database with same CATH topology
2KYWA 4M00A 4M02A 2KT7A 2KVZA 4M01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYW A;  4M00 A;  4M02 A;  2KT7 A;  2KVZ A;  4M01 A; 
#chains in the Genus database with same CATH topology
 2WHI A;  2LD9 A;  4M02 A;  2KNB A;  3HRD D;  4US8 A;  2K8H A;  3ML9 A;  2WS3 B;  3T9L A;  1R4N B;  2JYT A;  2R2O A;  2XNA C;  3Q6B A;  2KVZ A;  1V5T A;  4RGT A;  1FNV A;  5J17 A;  1V1O A;  2NS5 A;  1SE4 A;  1QOA A;  2JVC A;  4NJC A;  3I57 A;  3EC8 A;  2AYO B;  2KLG A;  3EHV A;  2CS4 A;  4MGI E;  3V6E B;  4BKS A;  3DBL I;  2J52 A;  4GXB A;  2BT6 A;  3ZDT A;  2DEN B;  3L17 A;  2QHO A;  2KKC A;  1HA5 A;  4ZRI A;  2ACZ B;  5G55 A;  4IWP A;  4USA A;  4BAX A;  3PGE A;  4LNN A;  2PE9 A;  1OFF A;  3ZJU A;  2D10 A;  4XGA B;  2LAS A;  3HUI A;  2N7E A;  4C7Z A;  2D3G A;  4XC2 A;  4BZA A;  2JRI B;  5BMH A;  3BVZ A;  1S3S G;  5G2N A;  2O6V D;  1TKY A;  4KSK C;  3H7S A;  3WIM A;  3IXS A;  4YTN B;  3WA0 A;  1T0Q C;  2KMM A;  2RD0 A;  4IKG A;  2R2Q A;  3VH3 B;  2BWE S;  2W3R A;  5DPS A;  1N5X A;  1XCQ L;  3PRZ A;  4G3X B;  2PPH A;  1I4P A;  3PRE A;  1YQ4 B;  3U8Z A;  2KJ6 A;  2QC8 A;  4J6I A;  4NPN A;  1FM0 D;  1P98 A;  4O1N A;  2V4L A;  4B6W A;  3ZW3 A;  2J4X A;  4BKT A;  2MEK A;  3UQB A;  2PE6 B;  1CQV A;  1H8C A;  3SEB A;  4NNJ B;  4K81 A;  1YN5 A;  1V80 A;  3PO0 A;  3QC8 B;  3PTF C;  2IYD B;  1UUP A;  1D5X C;  1WJ6 A;  4A55 A;  4B95 A;  3CF6 E;  3I63 C;  2EEL A;  1PGB A;  1QOG A;  2N9X A;  3HK0 A;  2RR9 A;  1GOZ A;  1WR6 E;  3J9C A;  1EF1 A;  4RFB A;  4FA6 A;  1TBE A;  3WAO A;  2XN9 C;  3BII D;  1ENF A;  4HRS A;  4A6Q A;  3OAW A;  1GG3 A;  4JLC A;  5E6O A;  4IC7 B;  1WM3 A;  2L1A A;  1K53 A;  2MSE D;  2IBI B;  2LVQ A;  1IP9 A;  2NMQ A;  2FNJ B;  4ZYN A;  3P2B A;  4WH4 A;  1DOI A;  2MBE A;  2MWS B;  2LUE A;  1L0V B;  2ZPN A;  1DGJ A;  4ARC A;  3RNB C;  1IPG A;  1JWM D;  4ANU A;  2O2V B;  1VRA B;  1Z2M A;  2LVO A;  4HJG E;  2AL6 A;  3A9K B;  3AEF B;  3HM6 X;  4LNI A;  5D7G A;  3V62 A;  2KLC A;  1DYQ A;  3BK1 A;  3W5V B;  2Y5B B;  1MPE A;  2KTR B;  2X38 A;  5L83 A;  2KWU B;  1N60 A;  4FJZ A;  1UEL A;  1UGM A;  4EUT A;  1E8Z A;  4AWJ A;  1F2R C;  3EA6 A;  2HTM E;  4PYZ A;  4PS8 A;  3VUX A;  1OQY A;  2IPK D;  3RNA C;  3GZN I;  1KTK A;  3A1Q B;  3IT4 B;  1ZXI A;  1ZPS A;  4EZL A;  4YSX B;  3JSV B;  5JHA A;  2D07 B;  4A9A A;  2EKE C;  1WY8 A;  1RLF A;  2BYT A;  2DNF A;  4WJO A;  4OZB A;  2KDI A;  1IUE A;  1EM7 A;  1MG8 A;  4M00 A;  2W3S A;  2NTT A;  4OVZ A;  2L76 A;  3TCA A;  4AOF A;  1KM7 A;  2KFK A;  2KJR A;  1SF0 A;  3VH4 B;  2N7J A;  2FCS A;  4EFO A;  1WGY A;  1TYG B;  1VJK A;  2PW9 A;  3QX1 A;  3Q3M C;  1MJD A;  2JRH A;  1EUV B;  4I6N B;  2ZEQ A;  2DZM A;  3CMM B;  4FN2 A;  3FC4 A;  3VAW A;  5L95 C;  3PHX B;  3NG0 A;  4ZRP A;  3Q8B A;  1I35 A;  1LQB A;  3D32 A;  2ZW1 A;  2KAC A;  1GC7 A;  3DVG X;  3TIX A;  5DPT A;  4EKU A;  4KGT A;  1PQS A;  4TV3 A;  1I4X A;  4KZ0 A;  1J7C A;  3T8M A;  1RFA A;  2Z8L A;  1QQR A;  4FHJ A;  2B3A A;  3CIR B;  3ZXR A;  1UZX B;  1WWT A;  2NBU A;  4W9I A;  2VZK D;  2C7H A;  2QJL A;  2W55 A;  3DOW A;  4GDL B;  2KDB A;  3I3T B;  2LI5 A;  2ONQ A;  1VR9 A;  1BT0 A;  1FFU A;  2GLS A;  4ICV A;  2MP2 A;  2ZZP B;  3N1Z C;  1R4N I;  3AEG B;  3A9J B;  3Q3N C;  4F8C B;  2CJN A;  1T6B X;  4XZ4 A;  2IGD A;  2DLB A;  1P7E A;  3P1M A;  4E3C A;  3GE3 C;  2M19 A;  4OHJ A;  3H7P A;  2GBM A;  2MBH A;  4WJN A;  3VRB B;  2ZVN A;  3LB8 C;  1KH0 A;  1L6U A;  4E74 A;  4IG7 B;  2FCM A;  1AN8 A;  1E5W A;  4ZHO A;  4NQL B;  2BB6 A;  2RMM A;  1OTR B;  1I4G A;  3U7D A;  1PFD A;  4N59 A;  3ZQ4 A;  3TEZ A;  4CO7 A;  2RDB C;  3HIZ A;  2KVR A;  1IYF A;  1F77 A;  1VCB A;  4JE3 B;  1C9F A;  3FIL B;  2J42 A;  1UH6 A;  3AI5 A;  4L1B A;  2ZCC A;  3NVW A;  3H1U A;  2MLB A;  2XBB C;  4A3P A;  3N1Y C;  4F1S A;  2LHE A;  4BOS C;  3RCZ A;  3E56 A;  3R3M A;  3NUH B;  2TSS A;  1K51 A;  2IO2 B;  1SBB B;  2DZK A;  1WX9 A;  2NPT B;  3MC9 A;  3DBL B;  4QAY A;  1JRO A;  2DZJ A;  2LHD A;  3T3O A;  3H6N A;  3N20 C;  2N9P C;  3V3X A;  3WCQ A;  3GP7 A;  3Q3F A;  4OVV A;  2J0M A;  3VTW A;  3NZS A;  3NS1 A;  1MVK A;  2BS2 B;  3U52 E;  4F7Z A;  2BF8 B;  3M3J A;  2DAF A;  2QIL A;  4NY0 A;  4W9E A;  3L54 A;  1Y8R C;  1WZ0 A;  4RF0 A;  2Z0E B;  4ANV A;  3Q14 C;  3UGB B;  2BGF A;  2CKH B;  4YT0 B;  3U2S C;  1J7B A;  4KDI C;  3HVZ A;  3QAQ A;  2X8X X;  2KQS A;  3RMK C;  4BKG A;  3AXC A;  2UYZ B;  1Y56 A;  1Z5S B;  4GDL A;  1P1A A;  2FCN A;  1L4D B;  2DWQ A;  2JUO A;  4B0E A;  1TS2 A;  5FK9 C;  2EKI A;  3SDL C;  3C8Y A;  1EWY C;  1KLV A;  2IDY A;  1GPX A;  4KVG B;  1YD8 U;  5H8Y E;  1P0R A;  3N1X C;  2J7Q B;  4M8N A;  4P7I A;  1V97 A;  1QOB A;  3DDC B;  3UIP B;  4ZRJ A;  2LUM A;  1LGR A;  2BWF A;  3VUW A;  2K1F A;  5CHF A;  1NYQ A;  3W5U B;  2LRW A;  4BOZ B;  2DAJ A;  1V81 A;  1ZUD 2;  3TL5 A;  2CHZ A;  1MG4 A;  2Y5C A;  2CJO A;  3RZW C;  3AUL A;  2MW5 A;  2RGF A;  4RCO A;  1YMH E;  4J3O D;  3X23 A;  5J18 A;  3IHP C;  5CTR C;  1YIW A;  2KTF A;  3A9J A;  2N9K A;  4NJ7 A;  1EF5 A;  2G3Q B;  3B1L X;  2OHF A;  5IN7 A;  3AM9 A;  1FCC C;  5C1Z A;  2OOB B;  3A1Q A;  5DCN A;  2NPT A;  3B2F A;  4A8X C;  2JZ3 B;  1V2Y A;  4XX5 A;  2GOW A;  1SE3 A;  4DHJ B;  2BPS A;  2AX5 A;  1LFD A;  4JWS C;  3NZU A;  4ZHP A;  1U4A A;  3NY5 A;  1WR1 A;  2JF5 A;  4HCP B;  2PIA A;  4AJY B;  3PLV A;  2ZW0 A;  3NVV A;  1L2N A;  4ICU A;  4G50 A;  1KFY B;  3APF A;  1WXQ A;  2VH2 A;  1BXT A;  1ZOY B;  1XQQ A;  1OEY A;  1L0X B;  5EE0 A;  4LCD E;  4IWQ A;  2BS3 B;  5DPR A;  4DQO C;  4ASW C;  2WXO A;  1OQR A;  1SB3 C;  3AE3 B;  1FRR A;  3NRZ A;  3R2I A;  2KWV B;  3DBH B;  4PS3 A;  1IBX B;  2O6V A;  3AE7 B;  3LDZ E;  3ZNZ B;  2SAK A;  4OVU A;  2WP9 B;  3TUO A;  3S2A A;  1YQ3 B;  1B1Z A;  5HFY A;  2LXA A;  3Q8E A;  1WGK A;  3CSF A;  2MP2 B;  2K9X A;  2M1M A;  3N3K B;  3MJ5 A;  3GB1 A;  3UF8 A;  2AQ1 B;  3WAP A;  4A3O A;  4ANX A;  3DBR I;  5CX3 A;  1SXT A;  3RZF A;  1KRH A;  1XO3 A;  1C4C A;  4MH0 E;  2PMV A;  1WRD B;  5E6N A;  4WJP A;  3AE9 B;  3AED B;  3DBS A;  1PUT A;  2RDH A;  2D3A A;  2WXH A;  3KUC B;  1WFY A;  1FXI A;  2WXI A;  4EE2 A;  1F0Z A;  1P3Q U;  3QWZ B;  3ONS A;  4PK1 A;  3C19 A;  2M17 A;  5C23 A;  4WWP A;  1WJN A;  1MHH E;  2IGG A;  4K3C A;  1DOY A;  4II3 B;  1RM6 C;  3P42 A;  3NHE B;  3KYD D;  4LNF A;  2H89 B;  2WXF A;  1SE9 A;  3DHI C;  3TJP A;  1TY0 A;  3ZNG C;  3A4S C;  2MJE A;  5TSS A;  5IKC M;  4AJW A;  3AH7 A;  3ZO5 B;  3OG5 A;  1JML A;  4DHZ E;  2L0F A;  2QSD A;  4ARI A;  2K5P A;  1JW9 D;  3EGR A;  4FBJ B;  1TKE A;  2V4I B;  1VZ7 A;  1N62 A;  2C7N B;  3DWM A;  1C79 A;  3ZGZ A;  2REX A;  2FAZ A;  4XWT A;  4LK0 M;  2N9L A;  2FIF A;  1WZ3 A;  4MT5 A;  1SE2 A;  2L0T A;  2GI9 A;  4GDK A;  4MJS B;  2HD5 B;  5G5G A;  4R3D A;  1OQQ A;  2LRU A;  4FJY A;  1KF6 B;  2K6D B;  2IO0 B;  1GJZ A;  3I9V 1;  1GNU A;  2L8J A;  3NVZ A;  2WU2 B;  2MRP A;  2KK8 A;  2K8B A;  2JY6 A;  4IM0 A;  3VVW B;  3A9K A;  2PLP A;  4TMA B;  3VFK A;  1NBF C;  2MCN B;  1F2R I;  2UU7 A;  2WXP A;  4JQW C;  2KD0 A;  3TSS A;  1KLG D;  1V49 A;  2KC2 A;  2LVP A;  5FR3 A;  3R66 C;  3H8H A;  4DK5 A;  2I38 A;  1WRI A;  3KUD B;  4JPS A;  1C78 A;  3AU4 A;  1OGW A;  1TS3 A;  2QIE B;  4WJQ A;  5DPW A;  3JVZ X;  2K8C A;  3AE5 B;  2JYE A;  5E6J A;  4IUM B;  2ZNV C;  3PV1 A;  4JX1 C;  2UWQ A;  3QQ8 B;  1ZP0 B;  3NVY A;  2CU3 A;  2AEH A;  2AQ3 B;  1CZP A;  1M4V A;  4MEL A;  2M0X A;  1EU3 A;  1J19 A;  1L7Y A;  2BQQ A;  1WGG A;  1FFV A;  2RDG A;  1N63 A;  2BYE A;  2FE8 A;  1UWM A;  3H7P B;  1SGH A;  4REZ A;  5IAA C;  3M62 B;  2NR2 A;  2IGH A;  4GB9 A;  5D6J B;  1V86 A;  3HHM A;  4ACF A;  1NVI D;  1L5P A;  2E3T A;  3KUZ A;  3RNE C;  2KN4 A;  4GMV A;  4HDQ A;  2Z0D B;  4TKN A;  2JZZ A;  3ZJV A;  1JWB D;  3HM3 A;  4A20 A;  1WXS A;  4AQ7 A;  1C4P A;  4C7Y A;  3Q3O C;  4ZYS A;  1K50 A;  1TKG A;  1FD6 A;  2AWT A;  2ON8 A;  1I42 A;  1F52 A;  3BYT B;  1ROE A;  3IT6 B;  3BY4 B;  4PYU A;  1D4B A;  3UQA A;  1XLN A;  1XF5 L;  2JWU A;  1SEB D;  3O65 B;  3BVM A;  3FKY A;  1JQ4 A;  3O13 A;  2IZV B;  1NEK B;  2D2Q A;  4RGN A;  1KOT A;  5HI1 A;  5AZG A;  1Q5W B;  2INP E;  2FCQ A;  3KVF B;  3L16 A;  2B76 B;  2E6X A;  4EOY A;  3AEB B;  1ZDX A;  2KHW B;  3UIO B;  3DQV A;  1J8C A;  3M95 A;  1JCK B;  1HTQ A;  1HZ5 A;  3RN9 C;  3WAN A;  3SFD B;  2K0P A;  5FR6 A;  4PS7 A;  2V3S A;  5BMG A;  3VR8 B;  1X1M A;  1WMH A;  4EZK A;  4W9H A;  3RNC C;  5JHB A;  2LWP A;  1YOV B;  5GMV A;  2L52 A;  3X0W A;  3ZDM C;  2CHX A;  3W1S C;  2EMT A;  4NAM A;  4A90 A;  5GXG B;  4KKJ A;  2MBB B;  3VQI A;  3LJ3 A;  1SSN A;  2JXX A;  2JPH A;  1PDX A;  3DPD A;  4YSZ B;  3ZYY X;  2IO1 B;  3AE4 B;  1TS5 A;  1FXT B;  3TMP B;  2FUH B;  3K9O B;  2M4N A;  4HVB A;  4C4V B;  3MC0 B;  4M0W A;  1HEZ E;  4LTU A;  3M63 B;  2KZR A;  4MM3 B;  5BO4 B;  4L23 A;  3PVL A;  3BK2 A;  4TQ1 A;  3L13 A;  1YJI A;  1OEY J;  3AE6 B;  3RPF C;  3DVN U;  4HPL B;  1JWS D;  1YX6 B;  5IP4 D;  4HJK A;  4G0N B;  4LDT D;  3SR6 A;  1WXV A;  2KWC A;  1FXA A;  3P4R B;  2VZK B;  2D11 A;  1QZE A;  1WGD A;  3R7R A;  3ZTC A;  1IGC A;  1RYJ A;  1J7A A;  4WWM A;  2GRI A;  3VRA B;  1EU4 A;  1JWA D;  3ZUN A;  2KT7 A;  2DYO A;  4N6E B;  1JRP A;  3AEE B;  3PT2 B;  4HEA 1;  2O2V A;  4YSY B;  3DHH C;  4RM8 A;  1XLQ A;  2IY1 B;  4GN1 A;  3P4S B;  3BZD B;  2JSV X;  2FBW B;  2KTR A;  3GS2 A;  2H88 B;  2A4Z A;  2HE7 A;  3PHW B;  1RAX A;  1AAR A;  4W9J A;  1CMX B;  3DVN V;  1XD3 B;  4IDI A;  4XYC A;  2QEJ C;  4XDC A;  1G6J A;  1E10 A;  1H4R A;  2K6Q A;  1QOF A;  3E9S A;  2BTE A;  1T0S C;  2ZJD A;  4WWO A;  1BUI C;  2Y3A A;  1YJ1 A;  4GIV A;  3PRP B;  3IG3 A;  3N9Y C;  3U30 A;  3VTU A;  1V5O A;  4HXD A;  4DXF A;  2KQ4 X;  3MJW A;  1T0R C;  1PGX A;  3QHT A;  1WXM A;  2GBJ A;  1FNU A;  2PVO D;  3ZXV A;  1P9D U;  2XK5 B;  1SIJ A;  3RI7 C;  2N1V A;  3KH0 A;  1E8X A;  1VZ8 A;  2IJ0 A;  1XEE A;  2LGI A;  2KYW A;  4W9C A;  4YTM B;  3ZJT A;  2KDE B;  3IAS 1;  5KHQ A;  1KLU D;  1MHX A;  3ALB A;  3MP9 A;  4URK A;  1FNW A;  1YX5 B;  2DZI A;  4KKI A;  1UGJ A;  2KX3 A;  1L4Z B;  5CHW A;  2G45 B;  2L00 B;  3EUB 2;  3JW0 X;  5C3J B;  3WAM A;  3RNG C;  1DOX A;  1EO6 A;  1UBQ A;  3L08 A;  1E8W A;  2INC C;  1WE7 A;  1ZW7 A;  4BBN F;  4BKS D;  5AEK B;  1C4A A;  4W9K A;  2C60 A;  3K9P B;  2GBR A;  3KWL A;  4IWO A;  2LGY A;  1IGD A;  1NI3 A;  2NBV B;  3C0R B;  4MSM B;  1YJJ A;  2DYB A;  2BYF A;  2NVU I;  2W82 A;  3L10 B;  4NAW B;  4NJ6 A;  3BVG A;  3EEC A;  2MJ3 A;  3SD5 A;  3TBL D;  4TQ0 A;  4WQO B;  3QAR A;  2M0A A;  2QMT A;  2C5L C;  4LNO A;  4ZOH C;  4K7S A;  2IND C;  2K39 A;  3GOE A;  5AUK A;  5LXH A;  2FUG 1;  3HVD A;  4P1B C;  2IO3 B;  1T0Y A;  2GBK A;  2ZVO A;  5FKA C;  4E71 A;  2N0S B;  3B2G A;  3QIJ A;  4K7W A;  2Q5W D;  2WXR A;  4UDU C;  1UWX A;  1AWD A;  1FO4 A;  4DDI D;  1WX8 A;  4M01 A;  2KXJ A;  1RRB A;  3DBR B;  2CHW A;  2ASQ A;  2JU6 X;  2V9H A;  1Q1O A;  2WXK A;  2HJ1 A;  3KLS X;  3FIL A;  1WGH A;  1CK1 A;  4MAC A;  1UD7 A;  3URY A;  3VXW A;  2N9E B;  3ML8 A;  1FIQ A;  1I7H A;  5EE9 A;  2BKR B;  1UF0 A;  3ZVV A;  5T8I A;  2WXL A;  4RMA A;  1R7S A;  4FAD A;  4L2Y A;  1TZ1 A;  2BS4 B;  1NI2 A;  1GB1 A;  2KDF B;  4IM2 A;  4KSL C;  1TGZ B;  4C4V A;  1EWC A;  4HPM B;  5MPO A;  4K7U A;  4MEM A;  2WWZ A;  2KAN A;  1FCL A;  3Q2A C;  2LMC A;  2QCZ A;  2A5U A;  1I4H A;  1ET9 A;  2QDF A;  3JSV A;  3APD A;  3AB5 A;  2W54 A;  5D3I B;  5BYS A;  1TT5 B;  1V1P B;  2YVC A;  3DCG A;  3AE8 B;  2Z59 B;  3Q8A A;  1FMA D;  5KHO A;  2O6V B;  4P6V F;  4OZC A;  2WU5 B;  2IY0 B;  2MBQ A;  4KIK B;  3NJT A;  4DXA B;  2CR5 A;  4HKQ A;  3MHZ A;  1RFK A;  2WX0 A;  3R7Q A;  3Q8F A;  1GAQ B;  3RUI B;  2KO3 A;  2EMS A;  2WYQ A;  2WQY B;  4HK2 A;  3PZ8 A;  1WYW B;  3KWV A;  1V1P A;  3EFC A;  3EFU A;  4DDG D;  2R61 A;  2KAJ A;  4K1R B;  4NZL B;  2RSU A;  4GGQ A;  3AV8 A;  2G1E A;  4FJV B;  1SJH D;  1T5X D;  2K3U A;  4CYE A;  3U4E G;  1V9J A;  4FLH A;  4ZRK A;  3A33 B;  4FUL A;  1WJU A;  3PZD A;  4FXC A;  1V8C A;  1E90 A;  1UBI A;  4GLS C;  1MFW A;  3Q8C A;  4HWI B;  2V3N A;  1TTN A;  4OZA A;  1WXA A;  4RNA A;  1E7P B;  3VDZ A;  2NBW B;  1P7F A;  3L0W B;  3PPA A;  1K52 A;  3LXF A;  3I5J C;  4BBN C;  2I1K A;  1E0Z A;  1K8R B;  3CST A;  2MJD A;  4AUQ C;  1WYG A;  2V0G A;  5LXI B;  4RM9 A;  1N5W A;  3A4R A;  2K25 A;  1M94 A;  4MSQ B;  4ZDV A;  1LO5 D;  2WXG A;  2Y5P A;  4DHJ D;  2PJH A;  4CHK A;  3KYC D;  1D3Z A;  1WE6 A;  2NTS A;  4US9 A;  1JRU A;  3TEY A;  2MQJ A;  1S1Q B;  5AZH A;  3Q69 A;  1F1H A;  2DX5 B;  1ZXH A;  1WMH B;  3CWI A;  4B0M A;  4KIK A;  5D2M B;  5TR5 A;  3OJ3 A;  5IO9 A;  2MBO A;  5JXV A;  2ZPY A;  2GB1 A;  2MX2 A;  3QJZ A;  1ACC A;  4KX6 B;  1FEH A;  2WDV B;  2V3P A;  1GC6 A;  1YN3 A;  2GBN A;  2KWD A;  3RUL A;  5EDS A;  2KMC A;  1UNS A;  4C80 A;  4YL8 A;  2JXT A;  2HTH A;  3RT3 B;  3V61 A;  4BFR A;  2MH7 A;  3ZNH B;  2ZNV B;  3V6C B;  4JWU C;  4RF1 A;  1AYF A;  3MTN B;  4C56 C;  1IBX A;  3B08 A;  1XLP A;  2N1W A;  4YXD B;  1QLB B;  3APC A;  1F9J A;  4W9F A;  4HDO A;  2HDE A;  2AL3 A;  2WGS A;  1LM8 B;  2GMI C;  2KX0 A;  4G11 A;  5EE3 A;  1QF6 A;  4I6L B;  1TIF A;  2PEA A;  2BBC A;  2KN5 A;  1SIF A;  3N30 A;  3RYT A;  4WAA A;  2C7M B;  3PLU A;  1WGR A;  4JIO U;  4LJO B;  2WDR B;  2KQ7 A;  3PSE B;  1VD2 A;  3FAH A;  1ESF A;  4P16 A;  4KGR A;  1HXY D;  1WSP A;  1NDD A;  1R4M I;  2D3C A;  2XEW A;  4PT5 A;  4EEW A;  4HKZ E;  5C2T B;  1WM2 A;  2PKO A;  2L83 A;  4D2K A;  3V05 A;  2RPV A;  1HE8 A;  3IFW B;  3VUY A;  1L0Y B;  3AEA B;  1WF9 A;  2KC1 A;  1WI0 A;  4TSS A;  2AQ2 B;  4N9F 4;  3ZNI D;  2BKF A;  2LEK A;  4MGZ E;  3ZKJ C;  2NCN A;  3N32 A;  2DHZ A;  5D3D A;  4EZJ A;  3IAM 1;  2MHJ A;  3Q3J A;  3UIN B;  1GB4 A;  5HG2 A;  5LNK 1;  2XK5 A;  1D5M C;  2BB5 A;  4DBG A;  1NEN B;  3IVF A;  2WDQ B;  4I6P A;  2LGS A;  2L7R A;  4OW0 A;  1QKZ A;  5J2R A;  3BWU D;  3AMZ A;  3VTV A;  2VRR B;  2W9N A;  1GUA B;  3VHT C;  4X57 B;  4LDT B;  3RD2 A;  1Q0W B;  3W1Y A;  4MH8 A;  5I4D A;  3BYY B;  2L05 A;  2RPQ A;  5HKH A;  1B9R A;  5BYQ A;  4MGK E;  3QCA A;  2OJR A;  4DXG A;  4NQK E;  1E6E B;  2D5G A;  4GU2 A;  1STE A;  3OWE B;  3U7Z A;  3MC8 A;  3P4Q B;  4WIP A;  1E8Y A;  4YWG G;  1ISN A;  1WJ4 A;  3IBE A;  1R4M B;  2KOX A;  3BIN A;  5LLI A;  2KDM A;  3NZ3 A;  4GDK B;  4Q2J A;  4II2 B;  3RNF C;  5E6P A;  2YEP F;  2YLM A;  3P4P B;  2WXM A;  4FHK A;  2YEP B;  2LGD A;  3DHG C;  4TUU A;  2N7D A;  1L6V A;  2KFK B;  4RGM A;  2WX1 A;  3QK0 A;  1QIL A;  4HRO A;  3OLM D;  3KQ4 A;  1VLB A;  2OED A;  3ZLZ A;  3LYY A;  4IW0 A;  1C77 A;  4DHZ B;  1LXD A;  2G4D B;  4W9L A;  2J53 A;  2JWZ A;  3B9J A;  1HZ6 A;  5D94 A;  4ZRQ A;  5IA7 A;  1CJE A;  2KFJ A;  1XXG A;  5CHV C;  3H9D A;  2N4F A;  2M56 B;  1RWS A;  3TEW A;  3W1S A;  4NAW A;  1HQR D;  2INN E;  4BVU C;  4M8M A;  1Q10 A;  4HLE A;  1WX7 A;  3B0A A;  4MM3 A;  4IOI E;  3T3N A;  1YN4 A;  3DWG C;  1T3Q A;  3AE1 B;  1ZDV A;  2BVC A;  4S0R A;  2CU1 A;  3DBH I;  5HHD G;  2V1Y A;  5BMI A;  2KMA A;  4HCN B;  4JGH B;  2I2Y A;  1VZ6 A;  3NOB A;  5AUI A;  2WDT B;  1ET6 A;  3L4P A;  3ZRC A;  2DBY A;  5IOI A;  2JX5 A;  4DWF A;  2J0K A;  3NS8 A;  3GE8 C;  2WXN A;  4XWW A;  4H2A A;  4AP4 C;  2WXQ A;  4RH6 A;  3W9C B;  4WQM A;  3R2T A;  4K3B A;  3ETR A;  3MHS D;  1N6Z A;  3ENE A;  3SU8 X;  2D3B A;  1AW7 A;  2LJ5 A;  1BML C;  1ZE3 D;  1XLO A;  2G4S A;  2PVG C;  4IM3 A;  2LGX A;  4W9G A;  1I4Q A;  1HTO A;  5JH5 C;  2C9W B;  4P1C C;  3P63 A;  2LZ6 A;  1SJE D;  4MGY E;  5JZE B;  3TEX A;  1I4R A;  2G9H D;  4HPP A;  2ICI A;  2LJI A;  4KZC A;  3SHQ A;  2WXJ A;  4KGS A;  2WLB A;  3W2D A;  2DYM A;  1MI0 A;  4M0W B;  1YNT E;  3V60 A;  4LJP B;  3QA8 A;  3ZRF A;  1D5Z C;  1PYW D;  4RGO S;  3SFE B;  4LLG M;  1XCT L;  2LXC A;  1E7V A;  1E9M A;  1ZKH A;  1WH3 A;  4S17 A;  1E7U A;  2BW2 A;  2BYV E;  1TJE A;  3MFG A;  1TZO A;  1J0G A;  4YTP B;  3AU5 A;  4AS1 A;  1C76 A;  2M8S A;  4WWN A;  3PS6 A;  4B9K A;  2I1J A;  4LNK A;  3VR9 B;  1D6E C;  3DVG Y;  4N58 A;  2OJW A;  3R8B A;  1C3T A;  3AE2 B;  1A70 A;  1VDV A;  2KJH B;  3ABV B;  5AZF A;  1KJT A;  1C1Y B;  2L32 A;  3OJ4 B;  3ZIM A;  3KW5 B;  4ITK A;  3RFZ B;  3AN1 A;  2K22 A;  3WAL A;  3GZN B;  2J0J A;  3ZTD A;  5G5H A;  1NYR A;  2WNM A;  3JYU A;  4JL9 A;  1ZGU B;  1V6E A;  2FID A;  4KDL B;  5EE1 A;  1QT9 A;  1N61 A;  4KV2 A;  1XT9 B;  2JQR B;  4GSW A;  1A5R A;  1TY2 A;  4WUR A;  1PGA A;  4MDK E;  5H92 C;  1WIA A;  3PRM B;  1TS4 A;  4ANW A;  2PTL A;  4C00 A;  2LFI A;  4CQN A;  2JT4 B;  2JZP A;  3UI3 A;  2HJ8 A;  1JWU D;  4MJS A;  2MA9 B;  3ECI A;  2SEB D;  2ZCB A;  2VH1 A;  4GOC A;  4WAF A;  1JAL A;  1YQB A;  3PZ7 A;  3AEC B;  1FRD A;  4W9D A;  2L3Z A;  4XDD A;  4XE0 A;  5BYR A;  1FPY A; 
#chains in the Genus database with same CATH homology
 2KYW A;  4M00 A;  4M02 A;  2KT7 A;  2KVZ A;  4M01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...