2KVZA

Structure of residues 161-235 of putative peptidoglycan binding protein lmo0835 from listeria monocytogenes: target lmr64b of the northeast structural genomics consortium
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
85
structure length
85
Chain Sequence
b'MDFGKPNQVTVNYLDENNTSIAPSLYLSGLFNEAYNVPMKKIKGYTLLKYDSEILGVFTESPQTINIIYQKKAPEQALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IspE
publication title Structure of residues 161-235 of putative peptidoglycan binding protein lmo0835 from Listeria monocytogenes: target LmR64B of the Northeast Structural Genomics Consortium
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
total genus 12
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06458 MucBP MucBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 2kvzA00
4M02A 2KT7A 4M00A 2KVZA 4M01A 2KYWA
chains in the Genus database with same CATH superfamily
2L05A 2WXNA 1J7CA 1RWSA 3ECIA 3AEGB 3AULA 4BKSA 3GB1A 5BYQA 4HVBA 2K0PA 4C4VA 4DHJB 5IOIA 1YQ3B 1ZXIA 4KZCA 3H8HA 4IM2A 2JSVX 2KXJA 3N1YC 3FAHA 3NVYA 4GXBA 2BS4B 2WXFA 2DZKA 4TKNA 3VQIA 2MQJA 1YN3A 1A5RA 2KZRA 4HKZE 2VZKB 3SFEB 4G0NB 1KF6B 1L2NA 2BS3B 1UGMA 1V1PB 2V0GA 5D2MB 2GI9A 4KSKC 5C2TB 4W9DA 3RZFA 1EF5A 2EKEC 3RNAC 2V4IB 1R4MB 1K51A 2OHFA 3UIOB 1SEBD 5G5GA 3N20C 3C19A 2YLMA 1H8CA 2PKOA 3BYTB 1KFYB 3U8ZA 2KJRA 3W5VB 1R4NB 2N1VA 1E7VA 1WIAA 2V9HA 3VTWA 5JHAA 3GE8C 4P7IA 3Q8EA 2L7RA 4DXGA 3EUB2 2KDEB 1L0YB 3SHQA 2MJ3A 1OEYA 4B9KA 2LD9A 1C4PA 2WXJA 3NY5A 1UH6A 2OJWA 4YTMB 5IN7A 2LJIA 2XN9C 3WAMA 3TBLD 4E71A 4K81A 1I4QA 3RT3B 2PLPA 1D5XC 1YD8U 2MWSB 2MBOA 4J3OD 2LVQA 5GXGB 2IGHA 3ZNHB 4IUMB 3AE2B 4A90A 1FCLA 3WANA 2KN5A 2EMTA 4G11A 1C79A 1Z2MA 4K1RB 4ZRQA 3NS1A 2UYZB 1TT5B 1VRAB 5EDSA 1L4DB 1NVID 5BYSA 1M94A 3AEDB 5IA7A 3H7PB 1IBXB 2J52A 2N7JA 3MHZA 4S17A 2W9NA 1EO6A 2NPTB 1E7UA 2C9WB 4B0EA 4HPMB 3FC4A 3UF8A 3CMMB 5J17A 3RNGC 1VDVA 4WAAA 4LNKA 1WGYA 4WWMA 4MH8A 2ASQA 3N3KB 4YSYB 2MBQA 1NYQA 2XK5A 4MSQB 3TIXA 2D10A 2FAZA 1Q10A 2X8XX 3VRAB 1MJDA 2E3TA 2ZCBA 1WH3A 3B2FA 5AUKA 4AOFA 4F7ZA 4F1SA 4P1CC 4YTNB 2N9XA 1TKYA 4BKGA 4GDLA 4BKSD 2MJEA 4XDCA 2N7EA 2ZPYA 3AEEB 2RD0A 1HQRD 1ZXHA 2QMTA 3A9KA 3ZXVA 1SE3A 3ZW3A 3LB8C 3U52E 1DOIA 3QAQA 1YNTE 3ZDMC 5JH5C 3CIRB 4TQ1A 1T0RC 4KDLB 1QF6A 1L0XB 1HZ6A 3L16A 3P4RB 3KVFB 4MSMB 3AEFB 2UWQA 1V81A 4RGOS 4HCPB 2FE8A 2WS3B 2N7DA 1ACCA 2ZCCA 2HDEA 3KUZA 5AZFA 4FADA 3IT4B 3MC8A 3E9SA 1K50A 3V60A 3A9JA 3W1YA 3X0WA 4NJ6A 1YX6B 3P63A 4WJPA 5AEKB 3MJWA 4TSSA 2MBBB 1ZPSA 3APDA 1I4HA 1TS3A 4AJYB 2K3UA 3L0WB 1AN8A 5AUIA 5CHVC 3Q69A 2INPE 1GJZA 3L13A 1ENFA 2LGDA 2N9KA 2BBCA 3P4PB 4WQOB 4HPPA 1GPXA 1XLPA 2A5UA 3IBEA 5AZGA 1YN4A 1YQ4B 5JZEB 4ANUA 2FIFA 3PV1A 1PUTA 1YQBA 3HM3A 1MG8A 3KLSX 2BW2A 1L4ZB 2NMQA 1WF9A 3OJ3A 1QKZA 2JRIB 2LHDA 2QSDA 3H9DA 1T0QC 4ZYSA 2IPKD 2K5PA 5G55A 3A4SC 1P0RA 4AWJA 3M95A 4S0RA 2R61A 3T3NA 2M0AA 4GB9A 4RF1A 3AI5A 1NBFC 3DHIC 2K25A 3L10B 2WDQB 3Q2AC 2V4LA 1BUIC 3ZLZA 4WWNA 4IM3A 4RM8A 1WMHB 1WR6E 2K22A 2G3QB 1TGZB 2HJ1A 4BKTA 4MACA 4IDIA 4NQKE 1UUPA 1Q5WB 5LXIB 1WJ4A 3QC8B 2L00B 3RI7C 1D5ZC 3DWMA 2C5LC 4OVVA 2W82A 1YMHE 4LLGM 3AE5B 2EELA 3JW0X 1Y56A 2VH2A 2FCSA 4GN1A 2H88B 2J53A 1SIJA 4GGQA 3VH4B 4LDTB 2DBYA 3AB5A 4XDDA 2KDMA 3SR6A 3PHXB 2MRPA 3T9LA 1WM3A 2D11A 4XGAB 3WALA 1AW7A 3ETRA 3QK0A 2BTEA 2INNE 3MJ5A 4DXAB 2O6VA 1B9RA 2LI5A 2BYEA 2KDBA 4LCDE 2DX5B 2BKRB 1WJNA 4E3CA 5J2RA 5G2NA 5HKHA 1VD2A 1KJTA 2NR2A 4AP4C 1CJEA 2KKCA 4NNJB 3V05A 4HLEA 4RGMA 3APFA 3QWZB 3PZ8A 2RDHA 2CS4A 2WDRB 3NRZA 2K8HA 2PIAA 2GBKA 1TS5A 1V2YA 1YIWA 3P1MA 2L1AA 3ZGZA 1BT0A 1WYGA 4IWQA 4M0WA 5C3JB 1I4XA 3OLMD 3QJZA 1FXAA 4MJSB 3R3MA 3TCAA 3VTVA 4QAYA 4RFBA 2AYOB 3VR8B 3ZTCA 3AE3B 3N30A 4ACFA 2REXA 4WJNA 3EFCA 2ZNVC 2K6DB 4DHJD 2KDIA 4USAA 1EUVB 1OGWA 1WXVA 1PFDA 2MEKA 4WQMA 2PVOD 2Y5BB 2FCQA 3VH3B 3WIMA 2PPHA 2VZKD 1WM2A 3EA6A 1LM8B 4GDKA 4ZDVA 2ZW0A 3RNFC 5BMIA 1JWUD 1HXYD 1XQQA 4W9CA 2ON8A 1S1QB 1NI2A 4BAXA 5DPWA 2KWUB 3ZVVA 3AE8B 4AUQC 2HTHA 3ZNID 1FXTB 2IO0B 4HJGE 1FMAD 2KJHB 3PREA 3DBHI 2XBBC 3BWUD 2DAFA 4N58A 1JROA 2N9LA 1E7PB 3NHEB 1ZE3D 4ICVA 1VZ6A 2PE6B 4YSZB 2JT4B 4W9JA 2BVCA 2JPHA 1XLNA 3TSSA 1P1AA 1XT9B 1F1HA 5HI1A 5EE3A 2IZVB 3L17A 4PS8A 4RCOA 3A1QB 1HEZE 2EKIA 4FN2A 4ASWC 3L4PA 4DXFA 4JWSC 1EWCA 1TKEA 2KWVB 3DBHB 2PTLA 5CX3A 1QQRA 2L83A 2KVRA 2DZMA 3T8MA 1MFWA 4NJ7A 1UNSA 4B6WA 3EGRA 4M02A 3TUOA 4PK1A 1OQQA 2DENB 2WXIA 3ZKJC 1E8XA 1C78A 2DYBA 3AH7A 2KX3A 2W3RA 1MHXA 2FBWB 2RPVA 4KKIA 3AE7B 5BMGA 2WQYB 1WMHA 2ICIA 5HFYA 3SU8X 2L0FA 3PTFC 3HM6X 4K3CA 2M17A 3U30A 2ZEQA 3TJPA 1XCTL 4MM3A 3QCAA 3GOEA 2JYTA 2Z0DB 1ZW7A 1HTQA 2LFIA 1L0VB 2I1KA 3WAOA 3VHTC 2MHJA 2KANA 4NAWB 2KYWA 2Z59B 2KC2A 5DPRA 2JXXA 3BVZA 1V5TA 1NYRA 2G1EA 3LYYA 3KH0A 2HTME 2KX0A 2LGXA 1K8RB 2NS5A 1WR1A 4DWFA 2LEKA 1LQBA 3JSVB 2CR5A 4D2KA 1R4MI 2O2VA 2KFKA 1FRRA 2QC8A 4ARCA 4KV2A 3ZRFA 3AE6B 3OJ4B 2QIEB 2BB5A 2R2OA 3ZUNA 2AL3A 1GNUA 1BMLC 2WXRA 3TL5A 4ZHPA 2AX5A 2BYTA 3DVGY 1E10A 2GOWA 3VVWB 3Q3OC 1R4NI 1C1YB 3MHSD 1FIQA 1WXSA 5DCNA 1CMXB 3R7QA 4TQ0A 1UD7A 4HJKA 2KMMA 4WURA 2DYMA 4M00A 2N9PC 4KZ0A 2K8CA 1GG3A 1SF0A 1CZPA 1PDXA 1IGDA 1Q0WB 1I35A 4W9EA 1E8ZA 3VTUA 3P2BA 3GP7A 1B1ZA 1FM0D 2M4NA 4AJWA 2G9HD 1AWDA 1N5WA 4OZCA 1OQYA 2WYQA 4MGZE 1WX8A 3WA0A 3GS2A 4ARIA 1SE4A 2JY6A 1WGHA 2NTTA 3IHPC 2D07B 4FLHA 4W9LA 3MTNB 1ET6A 2NVUI 5TR5A 3RNEC 1RFKA 1TZOA 1QOGA 4AQ7A 1MG4A 1TYGB 1E8YA 4O1NA 3ZNZB 2ACZB 1V6EA 2ZVNA 1H4RA 2M8SA 3BIID 1L6UA 2J0KA 2NBVB 1Z5SB 3H6NA 3A33B 4JIOU 3URYA 4DDID 3AECB 2KFJA 2DAJA 4CO7A 1ZDXA 4A6QA 4M01A 1FFVA 2KTRA 3B9JA 3ZIMA 1TKGA 2MW5A 2MCNB 4HKQA 3Q14C 1F52A 2BWES 4IOIE 3P4QB 2I1JA 4GMVA 2GB1A 3UI3A 3LJ3A 2IJ0A 4II2B 4LNOA 1QZEA 2MH7A 4A3OA 1C9FA 4ZYNA 4YL8A 3WCQA 5CHWA 2LRWA 4LDTD 3LDZE 3PZ7A 4DQOC 4XX5A 4B0MA 3PRZA 4LJOB 3GE3C 4HEA1 3TEZA 1STEA 1N62A 1ROEA 2YVCA 1UGJA 1OTRB 1VLBA 2FIDA 1RFAA 2JQRB 3V62A 2QCZA 2IY1B 3ZTDA 1V1OA 1GC7A 3KUDB 1KM7A 1XCQL 1SIFA 4OZAA 2KO3A 4W9FA 2PJHA 3IAS1 3IAM1 5AZHA 3QIJA 3V3XA 2N1WA 4EZLA 4FULA 1P98A 2JU6X 5MPOA 4KSLC 4HROA 4KX6B 4YXDB 4EUTA 1HZ5A 3RNCC 1YX5B 3UQAA 4ZOHC 2IO2B 2JX5A 2IO1B 3JVZX 1KLUD 1PGBA 3BVMA 3EFUA 2M19A 1I7HA 4XYCA 1RYJA 1YJIA 2CJNA 3BY4B 1HE8A 3K9PB 1E5WA 2KT7A 2LXAA 3S2AA 2MP2B 2BT6A 1E90A 3E56A 2LGYA 2AEHA 4K7SA 2L52A 1J0GA 4WAFA 2G4DB 3CF6E 1E8WA 4NY0A 1IP9A 3K9OB 1DGJA 1WX7A 3DDCB 4Q2JA 4LNFA 4OVUA 1G6JA 1TZ1A 5FK9C 4N6EB 2DZJA 4NQLB 3PRPB 4BVUC 3T3OA 1VZ8A 5FR3A 2KMAA 3SDLC 2J4XA 4BOSC 4OZBA 1WZ0A 5L95C 3VDZA 1MHHE 3EC8A 5EE9A 1TTNA 1EU4A 3N1XC 4NAMA 2JZ3B 1YJJA 4C56C 4CYEA 2QHOA 4KVGB 1V1PA 3HVZA 4PYUA 5JXVA 5L83A 4GSWA 1WXQA 2V3NA 1FNVA 2KQSA 2QEJC 1FRDA 3ZNGC 1WYWB 2GBJA 3PZDA 3I3TB 2RDGA 1RLFA 2L32A 1XD3B 2LASA 4REZA 1SE2A 1I4PA 4I6LB 2JRHA 2ZPNA 3ZJVA 2WXOA 1JRUA 1SE9A 3EHVA 1IPGA 4K3BA 1E6EB 3KW5B 3DOWA 4JPSA 1NDDA 1Q1OA 4MEMA 1WJUA 2I2YA 1QILA 1DOYA 3MFGA 3ML8A 3VUXA 5BO4B 3RFZB 3NG0A 1UZXB 3ABVB 2SAKA 4M8NA 3UGBB 2OEDA 1NENB 4LK0M 3ZXRA 5FKAC 1SSNA 4RGNA 4XWTA 4FJZA 2WXPA 3NZUA 4I6PA 3PRMB 1E9MA 4HPLB 2WX1A 1N5XA 2SEBD 3Q8FA 4IWOA 3UINB 4KIKB 2PW9A 2Q5WD 4JGHB 4FJVB 5CTRC 2BS2B 3FILB 1DYQA 2WDTB 3N1ZC 3DVNU 4RH6A 1UELA 5D3IB 3R2TA 1WXMA 4A3PA 2TSSA 2V3SA 5G5HA 1IBXA 2BGFA 3H7PA 2KK8A 2FCNA 3CSTA 1FD6A 4C4VB 1WZ3A 4JX1C 4XE0A 2NPTA 4I6NB 3APCA 2H89B 1E0ZA 3X23A 5J18A 2G45B 1X1MA 4HWIB 3BK2A 3WAPA 3C0RB 2LRUA 3KUCB 1ESFA 1P3QU 2MBEA 4GU2A 2DZIA 3N32A 2WNMA 3KWLA 5LNK1 2JZZA 4FBJB 2L3ZA 3M63B 1EU3A 3W9CB 2QILA 1N6ZA 2GBNA 1ZOYB 2RGFA 4L1BA 5D3DA 1GUAB 1TJEA 4PS7A 2OOBB 5BMHA 2D2QA 3DQVA 2GBRA 4F8CB 3IFWB 4KDIC 2AQ3B 2K1FA 3RNBC 1UF0A 4HDQA 1GB4A 2N0SB 2N4FA 2PMVA 2K6QA 1GC6A 1T5XD 3DBRB 1WFYA 1WX9A 1LO5D 3D32A 1WI0A 2Z8LA 4ZRJA 4P6VF 2BB6A 3BK1A 2W55A 1TY2A 2WXQA 1DOXA 1GB1A 1JALA 1KLGD 1C3TA 4N9F4 3OAWA 5KHOA 2CHXA 2IDYA 1FNUA 3DBSA 3NOBA 2KLGA 3C8YA 1J7BA 2C60A 3QQ8B 5C23A 4MGKE 1I42A 4EFOA 2NBWB 2RMMA 1LGRA 1P7EA 1ZP0B 2IGDA 2Y5CA 4KKJA 2WP9B 2XK5B 4IG7B 2ZW1A 3VUWA 3H1UA 4C00A 2JWZA 5E6PA 2NBUA 4ICUA 2A4ZA 4C7ZA 2Y5PA 1D6EC 3Q3MC 1F0ZA 3DHGC 2VH1A 3I9V1 1SXTA 4KGTA 1T3QA 2RSUA 3U7ZA 3PHWB 4W9HA 1WGKA 3TEXA 3OWEB 3ZYYX 5LXHA 4YWGG 3GZNI 5IKCM 2JWUA 2WDVB 2YEPB 1F2RI 2N9EB 2R2QA 2WWZA 2MSED 3SD5A 1KH0A 2WX0A 2NCNA 4LJPB 1V8CA 2B3AA 1WRIA 4MGIE 5CHFA 3ENEA 1FO4A 3M62B 4DHZB 1J7AA 3UQBA 2M0XA 1YOVB 2PE9A 3I5JC 2KMCA 3ZJUA 3B08A 3DHHC 2M56B 2WU2B 3PLUA 4A55A 2CKHB 2GLSA 2WXKA 3GZNB 1U4AA 2CJOA 3P42A 1TS2A 2KWCA 1KLVA 1JW9D 2LGIA 4DK5A 4ANXA 2WU5B 1JWBD 2ONQA 5IP4D 1TBEA 1VCBA 4EE2A 4TUUA 3ONSA 1EF1A 2L0TA 1QT9A 1PGXA 1V9JA 2IY0B 1S3SG 3Q8BA 4ZHOA 4RGTA 1QOAA 4IM0A 1SB3C 1HTOA 1RRBA 4MJSA 5E6JA 4MDKE 1SJHD 1PYWD 5LLIA 4BBNF 2WLBA 1L6VA 2AL6A 1ZGUB 1VZ7A 2UU7A 4KGRA 2VRRB 1XF5L 4CHKA 4UDUC 4G3XB 4ITKA 3NJTA 3RZWC 3NVWA 3NUHB 3LXFA 4OVZA 5EE0A 4WJOA 1JWSD 4FXCA 1V5OA 1F77A 3TEWA 2LGSA 3ZRCA 3FKYA 3VXWA 1GAQB 1D5MC 2PVGC 4EOYA 3DBLI 3V6CB 2W3SA 1F2RC 3NVVA 2OJRA 4PYZA 5H92C 3U7DA 3MP9A 2JUOA 3BZDB 2LMCA 3HVDA 1GOZA 1FFUA 2IGGA 4GIVA 5D7GA 3I57A 1XEEA 3RPFC 2KAJA 2BYFA 4ZRPA 4RMAA 1ZUD2 4A9AA 1BXTA 2RR9A 1TY0A 2AWTA 3NZ3A 2V1YA 4AS1A 3KQ4A 1A70A 1QOFA 2O6VB 3QA8A 4NJCA 1UWMA 3OG5A 1JCKB 1EM7A 4LNIA 2FUG1 4WIPA 3DBLB 1T0SC 3JYUA 5E6OA 4P16A 1WE7A 4A8XC 5DPTA 2LUEA 3PT2B 1JMLA 3Q3FA 2MBHA 1Y8RC 2DYOA 4WWOA 3I63C 1YN5A 4HK2A 5FR6A 1V86A 2JYEA 2IO3B 1EWYC 3AU5A 3A1QA 1C4AA 1N63A 1CK1A 2D3CA 2XEWA 4FHKA 1WGDA 2WGSA 4BBNC 1ZDVA 4LNNA 4OW0A 2WXMA 1XXGA 3CWIA 4YT0B 4M0WB 1JQ4A 4EKUA 4E74A 1IYFA 3NZSA 2W54A 3R7RA 2BQQA 2QDFA 2HE7A 3DVNV 4W9KA 3TEYA 5DPSA 2D3AA 2KQ4X 3AV8A 3O65B 2KQ7A 2Z0EB 5D6JB 3Q3JA 1UBIA 3VFKA 2IYDB 4DBGA 2KWDA 2E6XA 2PEAA 4FJYA 1C77A 2MA9B 3PVLA 4JWUC 2LVPA 3ALBA 4IW0A 3PGEA 2C7HA 4KGSA 2FUHB 2KACA 2DWQA 2LHEA 4YTPB 4NAWA 2X38A 1KRHA 4GDKB 4WJQA 1C76A 1T0YA 1KOTA 1HA5A 2LJ5A 3PLVA 3N9YC 1C4CA 4ANWA 1WRDB 1JWAD 1RM6C 1QOBA 1VJKA 4EZKA 5GMVA 1IGCA 3MC0B 1LXDA 2D3GA 2CHZA 1N61A 2C7MB 3JSVA 3W2DA 3MC9A 3IXSA 3ZO5B 2HD5B 2FCMA 4FHJA 4R3DA 3VR9B 2ZVOA 5D94A 2WHIA 1TS4A 4HRSA 2FNJB 1CQVA 3RULA 1WWTA 2KHWB 4PT5A 2DNFA 3AE9B 1L5PA 3RD2A 2J0MA 1SGHA 2LVOA 1R7SA 2QJLA 1FXIA 2MLBA 3CSFA 1V80A 1D4BA 1WGRA 3PPAA 5T8IA 4DDGD 2GBMA 2KNBA 1WSPA 4K7WA 5KHQA 1XO3A 4RNAA 3SEBA 2JXTA 3R2IA 2KVZA 1FCCC 2CHWA 1I4RA 3ZQ4A 3IVFA 1K53A 2KD0A 1IUEA 4MM3B 3M3JA 3ZDTA 2DLBA 2V3PA 4MH0E 2BKFA 2WXHA 3IT6B 1FNWA 2J42A 2NTSA 5E6NA 3EECA 4NZLB 4CQNA 1WE6A 4J6IA 1XLQA 2KOXA 1YJ1A 2EMSA 2L8JA 2MJDA 4P1BC 2J0JA 3PS6A 3HHMA 1TIFA 1N60A 4II3B 1LFDA 2ZNVB 2G4SA 1SJED 3VRBB 3DWGC 4GLSC 3ZJTA 3W5UB 1FEHA 3HK0A 3R66C 3BINA 3L54A 4MELA 4C80A 1OQRA 3AEAB 2ZZPB 2O2VB 2KFKB 2BPSA 3DVGX 4JE3B 5C1ZA 1J19A 3KWVA 3BYYB 4B95A 3W1SC 2IBIB 5EE1A 1V97A 2KJ6A 3Q8AA 1ZKHA 1MI0A 4ZRIA 4URKA 3A4RA 5JHBA 4GOCA 3B2GA 4W9IA 2D3BA 1UWXA 3B0AA 3QARA 4XZ4A 5IO9A 3PO0A 4HCNB 2ZJDA 4C7YA 2J7QB 4X57B 3Q6BA 2GMIC 2KN4A 4OHJA 1M4VA 3P4SB 1QLBB 3H7SA 2DHZA 4W9GA 2C7NB 1FPYA 5HG2A 2XNAC 1PQSA 4FA6A 4XWWA 4YSXB 1ISNA 2BF8B 1MPEA 3ML9A 4L2YA 3DBRI 4MGYE 3IG3A 1WJ6A 4HDOA 1ET9A 3U4EG 4EZJA 1L7YA 1JWMD 3RYTA 2Y3AA 3HUIA 3Q3NC 2CU1A 1WGGA 1PGAA 2K39A 5I4DA 1KTKA 1WY8A 2JF5A 4XC2A 3TMPB 2RPQA 2CU3A 1D3ZA 1SBBB 2LXCA 3NVZA 3U2SC 3QX1A 4IKGA 1J8CA 2AQ1B 2INCC 3O13A 4EEWA 4US8A 1V49A 3RUIB 2MP2A 4K7UA 4G50A 1K52A 1P7FA 2LZ6A 2I38A 1XLOA 4N59A 4RF0A 3AM9A 4A20A 4M8MA 2JZPA 2KTRB 3SFDB 2INDC 2M1MA 2BWFA 3PSEB 3R8BA 2K9XA 3RN9C 3L08A 4WWPA 3RCZA 4BZAA 1OFFA 1AARA 3QHTA 5TSSA 2K8BA 3B1LX 3AXCA 3DCGA 4NPNA 3VUYA 3AN1A 2BYVE 4ANVA 5BYRA 3AE1B 2JVCA 1NI3A 3AMZA 4DHZE 4JQWC 2LUMA 3AU4A 2HJ8A 2KDFB 4LTUA 4TV3A 3KYDD 4MT5A 2AQ2B 4GDLB 1P9DU 2WXLA 2B76B 4ZRKA 2O6VD 2D5GA 4IC7B 4IWPA 2YEPF 3A9KB 3W1SA 4L23A 3RMKC 3J9CA 1I4GA 1UBQA 3Q8CA 2L76A 2RDBC 3BVGA 1JRPA 4RM9A 3AEBB 4BOZB 1OEYJ 2GRIA 1MVKA 1NEKB 1RAXA 3DPDA 4US9A 4JLCA 2KLCA 4HXDA 1F9JA 4JL9A 3AE4B 3HIZA 1WXAA 4H2AA 3A9JB 2LWPA 4BFRA 1T6BX 3HRDD 3V61A 2WXGA 4PS3A 3KYCD 4KIKA 3V6EB 4TMAB 3UIPB 3VAWA 3NS8A 1AYFA 2KTFA 1VR9A 5H8YE 3FILA 2KC1A 4WH4A 5HHDG 2MX2A 5IAAC
chains in the Genus database with same CATH topology
4M02A 2KT7A 4M00A 2KVZA 4M01A 2KYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M02 A;  2KT7 A;  4M00 A;  2KVZ A;  4M01 A;  2KYW A; 
#chains in the Genus database with same CATH topology
 2L05 A;  2WXN A;  1J7C A;  1RWS A;  3ECI A;  3AEG B;  3AUL A;  4BKS A;  3GB1 A;  5BYQ A;  4HVB A;  2K0P A;  4C4V A;  4DHJ B;  5IOI A;  1YQ3 B;  1ZXI A;  4KZC A;  3H8H A;  4IM2 A;  2JSV X;  2KXJ A;  3N1Y C;  3FAH A;  3NVY A;  4GXB A;  2BS4 B;  2WXF A;  2DZK A;  4TKN A;  3VQI A;  2MQJ A;  1YN3 A;  1A5R A;  2KZR A;  4HKZ E;  2VZK B;  3SFE B;  4G0N B;  1KF6 B;  1L2N A;  2BS3 B;  1UGM A;  1V1P B;  2V0G A;  5D2M B;  2GI9 A;  4KSK C;  5C2T B;  4W9D A;  3RZF A;  1EF5 A;  2EKE C;  3RNA C;  2V4I B;  1R4M B;  1K51 A;  2OHF A;  3UIO B;  1SEB D;  5G5G A;  3N20 C;  3C19 A;  2YLM A;  1H8C A;  2PKO A;  3BYT B;  1KFY B;  3U8Z A;  2KJR A;  3W5V B;  1R4N B;  2N1V A;  1E7V A;  1WIA A;  2V9H A;  3VTW A;  5JHA A;  3GE8 C;  4P7I A;  3Q8E A;  2L7R A;  4DXG A;  3EUB 2;  2KDE B;  1L0Y B;  3SHQ A;  2MJ3 A;  1OEY A;  4B9K A;  2LD9 A;  1C4P A;  2WXJ A;  3NY5 A;  1UH6 A;  2OJW A;  4YTM B;  5IN7 A;  2LJI A;  2XN9 C;  3WAM A;  3TBL D;  4E71 A;  4K81 A;  1I4Q A;  3RT3 B;  2PLP A;  1D5X C;  1YD8 U;  2MWS B;  2MBO A;  4J3O D;  2LVQ A;  5GXG B;  2IGH A;  3ZNH B;  4IUM B;  3AE2 B;  4A90 A;  1FCL A;  3WAN A;  2KN5 A;  2EMT A;  4G11 A;  1C79 A;  1Z2M A;  4K1R B;  4ZRQ A;  3NS1 A;  2UYZ B;  1TT5 B;  1VRA B;  5EDS A;  1L4D B;  1NVI D;  5BYS A;  1M94 A;  3AED B;  5IA7 A;  3H7P B;  1IBX B;  2J52 A;  2N7J A;  3MHZ A;  4S17 A;  2W9N A;  1EO6 A;  2NPT B;  1E7U A;  2C9W B;  4B0E A;  4HPM B;  3FC4 A;  3UF8 A;  3CMM B;  5J17 A;  3RNG C;  1VDV A;  4WAA A;  4LNK A;  1WGY A;  4WWM A;  4MH8 A;  2ASQ A;  3N3K B;  4YSY B;  2MBQ A;  1NYQ A;  2XK5 A;  4MSQ B;  3TIX A;  2D10 A;  2FAZ A;  1Q10 A;  2X8X X;  3VRA B;  1MJD A;  2E3T A;  2ZCB A;  1WH3 A;  3B2F A;  5AUK A;  4AOF A;  4F7Z A;  4F1S A;  4P1C C;  4YTN B;  2N9X A;  1TKY A;  4BKG A;  4GDL A;  4BKS D;  2MJE A;  4XDC A;  2N7E A;  2ZPY A;  3AEE B;  2RD0 A;  1HQR D;  1ZXH A;  2QMT A;  3A9K A;  3ZXV A;  1SE3 A;  3ZW3 A;  3LB8 C;  3U52 E;  1DOI A;  3QAQ A;  1YNT E;  3ZDM C;  5JH5 C;  3CIR B;  4TQ1 A;  1T0R C;  4KDL B;  1QF6 A;  1L0X B;  1HZ6 A;  3L16 A;  3P4R B;  3KVF B;  4MSM B;  3AEF B;  2UWQ A;  1V81 A;  4RGO S;  4HCP B;  2FE8 A;  2WS3 B;  2N7D A;  1ACC A;  2ZCC A;  2HDE A;  3KUZ A;  5AZF A;  4FAD A;  3IT4 B;  3MC8 A;  3E9S A;  1K50 A;  3V60 A;  3A9J A;  3W1Y A;  3X0W A;  4NJ6 A;  1YX6 B;  3P63 A;  4WJP A;  5AEK B;  3MJW A;  4TSS A;  2MBB B;  1ZPS A;  3APD A;  1I4H A;  1TS3 A;  4AJY B;  2K3U A;  3L0W B;  1AN8 A;  5AUI A;  5CHV C;  3Q69 A;  2INP E;  1GJZ A;  3L13 A;  1ENF A;  2LGD A;  2N9K A;  2BBC A;  3P4P B;  4WQO B;  4HPP A;  1GPX A;  1XLP A;  2A5U A;  3IBE A;  5AZG A;  1YN4 A;  1YQ4 B;  5JZE B;  4ANU A;  2FIF A;  3PV1 A;  1PUT A;  1YQB A;  3HM3 A;  1MG8 A;  3KLS X;  2BW2 A;  1L4Z B;  2NMQ A;  1WF9 A;  3OJ3 A;  1QKZ A;  2JRI B;  2LHD A;  2QSD A;  3H9D A;  1T0Q C;  4ZYS A;  2IPK D;  2K5P A;  5G55 A;  3A4S C;  1P0R A;  4AWJ A;  3M95 A;  4S0R A;  2R61 A;  3T3N A;  2M0A A;  4GB9 A;  4RF1 A;  3AI5 A;  1NBF C;  3DHI C;  2K25 A;  3L10 B;  2WDQ B;  3Q2A C;  2V4L A;  1BUI C;  3ZLZ A;  4WWN A;  4IM3 A;  4RM8 A;  1WMH B;  1WR6 E;  2K22 A;  2G3Q B;  1TGZ B;  2HJ1 A;  4BKT A;  4MAC A;  4IDI A;  4NQK E;  1UUP A;  1Q5W B;  5LXI B;  1WJ4 A;  3QC8 B;  2L00 B;  3RI7 C;  1D5Z C;  3DWM A;  2C5L C;  4OVV A;  2W82 A;  1YMH E;  4LLG M;  3AE5 B;  2EEL A;  3JW0 X;  1Y56 A;  2VH2 A;  2FCS A;  4GN1 A;  2H88 B;  2J53 A;  1SIJ A;  4GGQ A;  3VH4 B;  4LDT B;  2DBY A;  3AB5 A;  4XDD A;  2KDM A;  3SR6 A;  3PHX B;  2MRP A;  3T9L A;  1WM3 A;  2D11 A;  4XGA B;  3WAL A;  1AW7 A;  3ETR A;  3QK0 A;  2BTE A;  2INN E;  3MJ5 A;  4DXA B;  2O6V A;  1B9R A;  2LI5 A;  2BYE A;  2KDB A;  4LCD E;  2DX5 B;  2BKR B;  1WJN A;  4E3C A;  5J2R A;  5G2N A;  5HKH A;  1VD2 A;  1KJT A;  2NR2 A;  4AP4 C;  1CJE A;  2KKC A;  4NNJ B;  3V05 A;  4HLE A;  4RGM A;  3APF A;  3QWZ B;  3PZ8 A;  2RDH A;  2CS4 A;  2WDR B;  3NRZ A;  2K8H A;  2PIA A;  2GBK A;  1TS5 A;  1V2Y A;  1YIW A;  3P1M A;  2L1A A;  3ZGZ A;  1BT0 A;  1WYG A;  4IWQ A;  4M0W A;  5C3J B;  1I4X A;  3OLM D;  3QJZ A;  1FXA A;  4MJS B;  3R3M A;  3TCA A;  3VTV A;  4QAY A;  4RFB A;  2AYO B;  3VR8 B;  3ZTC A;  3AE3 B;  3N30 A;  4ACF A;  2REX A;  4WJN A;  3EFC A;  2ZNV C;  2K6D B;  4DHJ D;  2KDI A;  4USA A;  1EUV B;  1OGW A;  1WXV A;  1PFD A;  2MEK A;  4WQM A;  2PVO D;  2Y5B B;  2FCQ A;  3VH3 B;  3WIM A;  2PPH A;  2VZK D;  1WM2 A;  3EA6 A;  1LM8 B;  4GDK A;  4ZDV A;  2ZW0 A;  3RNF C;  5BMI A;  1JWU D;  1HXY D;  1XQQ A;  4W9C A;  2ON8 A;  1S1Q B;  1NI2 A;  4BAX A;  5DPW A;  2KWU B;  3ZVV A;  3AE8 B;  4AUQ C;  2HTH A;  3ZNI D;  1FXT B;  2IO0 B;  4HJG E;  1FMA D;  2KJH B;  3PRE A;  3DBH I;  2XBB C;  3BWU D;  2DAF A;  4N58 A;  1JRO A;  2N9L A;  1E7P B;  3NHE B;  1ZE3 D;  4ICV A;  1VZ6 A;  2PE6 B;  4YSZ B;  2JT4 B;  4W9J A;  2BVC A;  2JPH A;  1XLN A;  3TSS A;  1P1A A;  1XT9 B;  1F1H A;  5HI1 A;  5EE3 A;  2IZV B;  3L17 A;  4PS8 A;  4RCO A;  3A1Q B;  1HEZ E;  2EKI A;  4FN2 A;  4ASW C;  3L4P A;  4DXF A;  4JWS C;  1EWC A;  1TKE A;  2KWV B;  3DBH B;  2PTL A;  5CX3 A;  1QQR A;  2L83 A;  2KVR A;  2DZM A;  3T8M A;  1MFW A;  4NJ7 A;  1UNS A;  4B6W A;  3EGR A;  4M02 A;  3TUO A;  4PK1 A;  1OQQ A;  2DEN B;  2WXI A;  3ZKJ C;  1E8X A;  1C78 A;  2DYB A;  3AH7 A;  2KX3 A;  2W3R A;  1MHX A;  2FBW B;  2RPV A;  4KKI A;  3AE7 B;  5BMG A;  2WQY B;  1WMH A;  2ICI A;  5HFY A;  3SU8 X;  2L0F A;  3PTF C;  3HM6 X;  4K3C A;  2M17 A;  3U30 A;  2ZEQ A;  3TJP A;  1XCT L;  4MM3 A;  3QCA A;  3GOE A;  2JYT A;  2Z0D B;  1ZW7 A;  1HTQ A;  2LFI A;  1L0V B;  2I1K A;  3WAO A;  3VHT C;  2MHJ A;  2KAN A;  4NAW B;  2KYW A;  2Z59 B;  2KC2 A;  5DPR A;  2JXX A;  3BVZ A;  1V5T A;  1NYR A;  2G1E A;  3LYY A;  3KH0 A;  2HTM E;  2KX0 A;  2LGX A;  1K8R B;  2NS5 A;  1WR1 A;  4DWF A;  2LEK A;  1LQB A;  3JSV B;  2CR5 A;  4D2K A;  1R4M I;  2O2V A;  2KFK A;  1FRR A;  2QC8 A;  4ARC A;  4KV2 A;  3ZRF A;  3AE6 B;  3OJ4 B;  2QIE B;  2BB5 A;  2R2O A;  3ZUN A;  2AL3 A;  1GNU A;  1BML C;  2WXR A;  3TL5 A;  4ZHP A;  2AX5 A;  2BYT A;  3DVG Y;  1E10 A;  2GOW A;  3VVW B;  3Q3O C;  1R4N I;  1C1Y B;  3MHS D;  1FIQ A;  1WXS A;  5DCN A;  1CMX B;  3R7Q A;  4TQ0 A;  1UD7 A;  4HJK A;  2KMM A;  4WUR A;  2DYM A;  4M00 A;  2N9P C;  4KZ0 A;  2K8C A;  1GG3 A;  1SF0 A;  1CZP A;  1PDX A;  1IGD A;  1Q0W B;  1I35 A;  4W9E A;  1E8Z A;  3VTU A;  3P2B A;  3GP7 A;  1B1Z A;  1FM0 D;  2M4N A;  4AJW A;  2G9H D;  1AWD A;  1N5W A;  4OZC A;  1OQY A;  2WYQ A;  4MGZ E;  1WX8 A;  3WA0 A;  3GS2 A;  4ARI A;  1SE4 A;  2JY6 A;  1WGH A;  2NTT A;  3IHP C;  2D07 B;  4FLH A;  4W9L A;  3MTN B;  1ET6 A;  2NVU I;  5TR5 A;  3RNE C;  1RFK A;  1TZO A;  1QOG A;  4AQ7 A;  1MG4 A;  1TYG B;  1E8Y A;  4O1N A;  3ZNZ B;  2ACZ B;  1V6E A;  2ZVN A;  1H4R A;  2M8S A;  3BII D;  1L6U A;  2J0K A;  2NBV B;  1Z5S B;  3H6N A;  3A33 B;  4JIO U;  3URY A;  4DDI D;  3AEC B;  2KFJ A;  2DAJ A;  4CO7 A;  1ZDX A;  4A6Q A;  4M01 A;  1FFV A;  2KTR A;  3B9J A;  3ZIM A;  1TKG A;  2MW5 A;  2MCN B;  4HKQ A;  3Q14 C;  1F52 A;  2BWE S;  4IOI E;  3P4Q B;  2I1J A;  4GMV A;  2GB1 A;  3UI3 A;  3LJ3 A;  2IJ0 A;  4II2 B;  4LNO A;  1QZE A;  2MH7 A;  4A3O A;  1C9F A;  4ZYN A;  4YL8 A;  3WCQ A;  5CHW A;  2LRW A;  4LDT D;  3LDZ E;  3PZ7 A;  4DQO C;  4XX5 A;  4B0M A;  3PRZ A;  4LJO B;  3GE3 C;  4HEA 1;  3TEZ A;  1STE A;  1N62 A;  1ROE A;  2YVC A;  1UGJ A;  1OTR B;  1VLB A;  2FID A;  1RFA A;  2JQR B;  3V62 A;  2QCZ A;  2IY1 B;  3ZTD A;  1V1O A;  1GC7 A;  3KUD B;  1KM7 A;  1XCQ L;  1SIF A;  4OZA A;  2KO3 A;  4W9F A;  2PJH A;  3IAS 1;  3IAM 1;  5AZH A;  3QIJ A;  3V3X A;  2N1W A;  4EZL A;  4FUL A;  1P98 A;  2JU6 X;  5MPO A;  4KSL C;  4HRO A;  4KX6 B;  4YXD B;  4EUT A;  1HZ5 A;  3RNC C;  1YX5 B;  3UQA A;  4ZOH C;  2IO2 B;  2JX5 A;  2IO1 B;  3JVZ X;  1KLU D;  1PGB A;  3BVM A;  3EFU A;  2M19 A;  1I7H A;  4XYC A;  1RYJ A;  1YJI A;  2CJN A;  3BY4 B;  1HE8 A;  3K9P B;  1E5W A;  2KT7 A;  2LXA A;  3S2A A;  2MP2 B;  2BT6 A;  1E90 A;  3E56 A;  2LGY A;  2AEH A;  4K7S A;  2L52 A;  1J0G A;  4WAF A;  2G4D B;  3CF6 E;  1E8W A;  4NY0 A;  1IP9 A;  3K9O B;  1DGJ A;  1WX7 A;  3DDC B;  4Q2J A;  4LNF A;  4OVU A;  1G6J A;  1TZ1 A;  5FK9 C;  4N6E B;  2DZJ A;  4NQL B;  3PRP B;  4BVU C;  3T3O A;  1VZ8 A;  5FR3 A;  2KMA A;  3SDL C;  2J4X A;  4BOS C;  4OZB A;  1WZ0 A;  5L95 C;  3VDZ A;  1MHH E;  3EC8 A;  5EE9 A;  1TTN A;  1EU4 A;  3N1X C;  4NAM A;  2JZ3 B;  1YJJ A;  4C56 C;  4CYE A;  2QHO A;  4KVG B;  1V1P A;  3HVZ A;  4PYU A;  5JXV A;  5L83 A;  4GSW A;  1WXQ A;  2V3N A;  1FNV A;  2KQS A;  2QEJ C;  1FRD A;  3ZNG C;  1WYW B;  2GBJ A;  3PZD A;  3I3T B;  2RDG A;  1RLF A;  2L32 A;  1XD3 B;  2LAS A;  4REZ A;  1SE2 A;  1I4P A;  4I6L B;  2JRH A;  2ZPN A;  3ZJV A;  2WXO A;  1JRU A;  1SE9 A;  3EHV A;  1IPG A;  4K3B A;  1E6E B;  3KW5 B;  3DOW A;  4JPS A;  1NDD A;  1Q1O A;  4MEM A;  1WJU A;  2I2Y A;  1QIL A;  1DOY A;  3MFG A;  3ML8 A;  3VUX A;  5BO4 B;  3RFZ B;  3NG0 A;  1UZX B;  3ABV B;  2SAK A;  4M8N A;  3UGB B;  2OED A;  1NEN B;  4LK0 M;  3ZXR A;  5FKA C;  1SSN A;  4RGN A;  4XWT A;  4FJZ A;  2WXP A;  3NZU A;  4I6P A;  3PRM B;  1E9M A;  4HPL B;  2WX1 A;  1N5X A;  2SEB D;  3Q8F A;  4IWO A;  3UIN B;  4KIK B;  2PW9 A;  2Q5W D;  4JGH B;  4FJV B;  5CTR C;  2BS2 B;  3FIL B;  1DYQ A;  2WDT B;  3N1Z C;  3DVN U;  4RH6 A;  1UEL A;  5D3I B;  3R2T A;  1WXM A;  4A3P A;  2TSS A;  2V3S A;  5G5H A;  1IBX A;  2BGF A;  3H7P A;  2KK8 A;  2FCN A;  3CST A;  1FD6 A;  4C4V B;  1WZ3 A;  4JX1 C;  4XE0 A;  2NPT A;  4I6N B;  3APC A;  2H89 B;  1E0Z A;  3X23 A;  5J18 A;  2G45 B;  1X1M A;  4HWI B;  3BK2 A;  3WAP A;  3C0R B;  2LRU A;  3KUC B;  1ESF A;  1P3Q U;  2MBE A;  4GU2 A;  2DZI A;  3N32 A;  2WNM A;  3KWL A;  5LNK 1;  2JZZ A;  4FBJ B;  2L3Z A;  3M63 B;  1EU3 A;  3W9C B;  2QIL A;  1N6Z A;  2GBN A;  1ZOY B;  2RGF A;  4L1B A;  5D3D A;  1GUA B;  1TJE A;  4PS7 A;  2OOB B;  5BMH A;  2D2Q A;  3DQV A;  2GBR A;  4F8C B;  3IFW B;  4KDI C;  2AQ3 B;  2K1F A;  3RNB C;  1UF0 A;  4HDQ A;  1GB4 A;  2N0S B;  2N4F A;  2PMV A;  2K6Q A;  1GC6 A;  1T5X D;  3DBR B;  1WFY A;  1WX9 A;  1LO5 D;  3D32 A;  1WI0 A;  2Z8L A;  4ZRJ A;  4P6V F;  2BB6 A;  3BK1 A;  2W55 A;  1TY2 A;  2WXQ A;  1DOX A;  1GB1 A;  1JAL A;  1KLG D;  1C3T A;  4N9F 4;  3OAW A;  5KHO A;  2CHX A;  2IDY A;  1FNU A;  3DBS A;  3NOB A;  2KLG A;  3C8Y A;  1J7B A;  2C60 A;  3QQ8 B;  5C23 A;  4MGK E;  1I42 A;  4EFO A;  2NBW B;  2RMM A;  1LGR A;  1P7E A;  1ZP0 B;  2IGD A;  2Y5C A;  4KKJ A;  2WP9 B;  2XK5 B;  4IG7 B;  2ZW1 A;  3VUW A;  3H1U A;  4C00 A;  2JWZ A;  5E6P A;  2NBU A;  4ICU A;  2A4Z A;  4C7Z A;  2Y5P A;  1D6E C;  3Q3M C;  1F0Z A;  3DHG C;  2VH1 A;  3I9V 1;  1SXT A;  4KGT A;  1T3Q A;  2RSU A;  3U7Z A;  3PHW B;  4W9H A;  1WGK A;  3TEX A;  3OWE B;  3ZYY X;  5LXH A;  4YWG G;  3GZN I;  5IKC M;  2JWU A;  2WDV B;  2YEP B;  1F2R I;  2N9E B;  2R2Q A;  2WWZ A;  2MSE D;  3SD5 A;  1KH0 A;  2WX0 A;  2NCN A;  4LJP B;  1V8C A;  2B3A A;  1WRI A;  4MGI E;  5CHF A;  3ENE A;  1FO4 A;  3M62 B;  4DHZ B;  1J7A A;  3UQB A;  2M0X A;  1YOV B;  2PE9 A;  3I5J C;  2KMC A;  3ZJU A;  3B08 A;  3DHH C;  2M56 B;  2WU2 B;  3PLU A;  4A55 A;  2CKH B;  2GLS A;  2WXK A;  3GZN B;  1U4A A;  2CJO A;  3P42 A;  1TS2 A;  2KWC A;  1KLV A;  1JW9 D;  2LGI A;  4DK5 A;  4ANX A;  2WU5 B;  1JWB D;  2ONQ A;  5IP4 D;  1TBE A;  1VCB A;  4EE2 A;  4TUU A;  3ONS A;  1EF1 A;  2L0T A;  1QT9 A;  1PGX A;  1V9J A;  2IY0 B;  1S3S G;  3Q8B A;  4ZHO A;  4RGT A;  1QOA A;  4IM0 A;  1SB3 C;  1HTO A;  1RRB A;  4MJS A;  5E6J A;  4MDK E;  1SJH D;  1PYW D;  5LLI A;  4BBN F;  2WLB A;  1L6V A;  2AL6 A;  1ZGU B;  1VZ7 A;  2UU7 A;  4KGR A;  2VRR B;  1XF5 L;  4CHK A;  4UDU C;  4G3X B;  4ITK A;  3NJT A;  3RZW C;  3NVW A;  3NUH B;  3LXF A;  4OVZ A;  5EE0 A;  4WJO A;  1JWS D;  4FXC A;  1V5O A;  1F77 A;  3TEW A;  2LGS A;  3ZRC A;  3FKY A;  3VXW A;  1GAQ B;  1D5M C;  2PVG C;  4EOY A;  3DBL I;  3V6C B;  2W3S A;  1F2R C;  3NVV A;  2OJR A;  4PYZ A;  5H92 C;  3U7D A;  3MP9 A;  2JUO A;  3BZD B;  2LMC A;  3HVD A;  1GOZ A;  1FFU A;  2IGG A;  4GIV A;  5D7G A;  3I57 A;  1XEE A;  3RPF C;  2KAJ A;  2BYF A;  4ZRP A;  4RMA A;  1ZUD 2;  4A9A A;  1BXT A;  2RR9 A;  1TY0 A;  2AWT A;  3NZ3 A;  2V1Y A;  4AS1 A;  3KQ4 A;  1A70 A;  1QOF A;  2O6V B;  3QA8 A;  4NJC A;  1UWM A;  3OG5 A;  1JCK B;  1EM7 A;  4LNI A;  2FUG 1;  4WIP A;  3DBL B;  1T0S C;  3JYU A;  5E6O A;  4P16 A;  1WE7 A;  4A8X C;  5DPT A;  2LUE A;  3PT2 B;  1JML A;  3Q3F A;  2MBH A;  1Y8R C;  2DYO A;  4WWO A;  3I63 C;  1YN5 A;  4HK2 A;  5FR6 A;  1V86 A;  2JYE A;  2IO3 B;  1EWY C;  3AU5 A;  3A1Q A;  1C4A A;  1N63 A;  1CK1 A;  2D3C A;  2XEW A;  4FHK A;  1WGD A;  2WGS A;  4BBN C;  1ZDV A;  4LNN A;  4OW0 A;  2WXM A;  1XXG A;  3CWI A;  4YT0 B;  4M0W B;  1JQ4 A;  4EKU A;  4E74 A;  1IYF A;  3NZS A;  2W54 A;  3R7R A;  2BQQ A;  2QDF A;  2HE7 A;  3DVN V;  4W9K A;  3TEY A;  5DPS A;  2D3A A;  2KQ4 X;  3AV8 A;  3O65 B;  2KQ7 A;  2Z0E B;  5D6J B;  3Q3J A;  1UBI A;  3VFK A;  2IYD B;  4DBG A;  2KWD A;  2E6X A;  2PEA A;  4FJY A;  1C77 A;  2MA9 B;  3PVL A;  4JWU C;  2LVP A;  3ALB A;  4IW0 A;  3PGE A;  2C7H A;  4KGS A;  2FUH B;  2KAC A;  2DWQ A;  2LHE A;  4YTP B;  4NAW A;  2X38 A;  1KRH A;  4GDK B;  4WJQ A;  1C76 A;  1T0Y A;  1KOT A;  1HA5 A;  2LJ5 A;  3PLV A;  3N9Y C;  1C4C A;  4ANW A;  1WRD B;  1JWA D;  1RM6 C;  1QOB A;  1VJK A;  4EZK A;  5GMV A;  1IGC A;  3MC0 B;  1LXD A;  2D3G A;  2CHZ A;  1N61 A;  2C7M B;  3JSV A;  3W2D A;  3MC9 A;  3IXS A;  3ZO5 B;  2HD5 B;  2FCM A;  4FHJ A;  4R3D A;  3VR9 B;  2ZVO A;  5D94 A;  2WHI A;  1TS4 A;  4HRS A;  2FNJ B;  1CQV A;  3RUL A;  1WWT A;  2KHW B;  4PT5 A;  2DNF A;  3AE9 B;  1L5P A;  3RD2 A;  2J0M A;  1SGH A;  2LVO A;  1R7S A;  2QJL A;  1FXI A;  2MLB A;  3CSF A;  1V80 A;  1D4B A;  1WGR A;  3PPA A;  5T8I A;  4DDG D;  2GBM A;  2KNB A;  1WSP A;  4K7W A;  5KHQ A;  1XO3 A;  4RNA A;  3SEB A;  2JXT A;  3R2I A;  2KVZ A;  1FCC C;  2CHW A;  1I4R A;  3ZQ4 A;  3IVF A;  1K53 A;  2KD0 A;  1IUE A;  4MM3 B;  3M3J A;  3ZDT A;  2DLB A;  2V3P A;  4MH0 E;  2BKF A;  2WXH A;  3IT6 B;  1FNW A;  2J42 A;  2NTS A;  5E6N A;  3EEC A;  4NZL B;  4CQN A;  1WE6 A;  4J6I A;  1XLQ A;  2KOX A;  1YJ1 A;  2EMS A;  2L8J A;  2MJD A;  4P1B C;  2J0J A;  3PS6 A;  3HHM A;  1TIF A;  1N60 A;  4II3 B;  1LFD A;  2ZNV B;  2G4S A;  1SJE D;  3VRB B;  3DWG C;  4GLS C;  3ZJT A;  3W5U B;  1FEH A;  3HK0 A;  3R66 C;  3BIN A;  3L54 A;  4MEL A;  4C80 A;  1OQR A;  3AEA B;  2ZZP B;  2O2V B;  2KFK B;  2BPS A;  3DVG X;  4JE3 B;  5C1Z A;  1J19 A;  3KWV A;  3BYY B;  4B95 A;  3W1S C;  2IBI B;  5EE1 A;  1V97 A;  2KJ6 A;  3Q8A A;  1ZKH A;  1MI0 A;  4ZRI A;  4URK A;  3A4R A;  5JHB A;  4GOC A;  3B2G A;  4W9I A;  2D3B A;  1UWX A;  3B0A A;  3QAR A;  4XZ4 A;  5IO9 A;  3PO0 A;  4HCN B;  2ZJD A;  4C7Y A;  2J7Q B;  4X57 B;  3Q6B A;  2GMI C;  2KN4 A;  4OHJ A;  1M4V A;  3P4S B;  1QLB B;  3H7S A;  2DHZ A;  4W9G A;  2C7N B;  1FPY A;  5HG2 A;  2XNA C;  1PQS A;  4FA6 A;  4XWW A;  4YSX B;  1ISN A;  2BF8 B;  1MPE A;  3ML9 A;  4L2Y A;  3DBR I;  4MGY E;  3IG3 A;  1WJ6 A;  4HDO A;  1ET9 A;  3U4E G;  4EZJ A;  1L7Y A;  1JWM D;  3RYT A;  2Y3A A;  3HUI A;  3Q3N C;  2CU1 A;  1WGG A;  1PGA A;  2K39 A;  5I4D A;  1KTK A;  1WY8 A;  2JF5 A;  4XC2 A;  3TMP B;  2RPQ A;  2CU3 A;  1D3Z A;  1SBB B;  2LXC A;  3NVZ A;  3U2S C;  3QX1 A;  4IKG A;  1J8C A;  2AQ1 B;  2INC C;  3O13 A;  4EEW A;  4US8 A;  1V49 A;  3RUI B;  2MP2 A;  4K7U A;  4G50 A;  1K52 A;  1P7F A;  2LZ6 A;  2I38 A;  1XLO A;  4N59 A;  4RF0 A;  3AM9 A;  4A20 A;  4M8M A;  2JZP A;  2KTR B;  3SFD B;  2IND C;  2M1M A;  2BWF A;  3PSE B;  3R8B A;  2K9X A;  3RN9 C;  3L08 A;  4WWP A;  3RCZ A;  4BZA A;  1OFF A;  1AAR A;  3QHT A;  5TSS A;  2K8B A;  3B1L X;  3AXC A;  3DCG A;  4NPN A;  3VUY A;  3AN1 A;  2BYV E;  4ANV A;  5BYR A;  3AE1 B;  2JVC A;  1NI3 A;  3AMZ A;  4DHZ E;  4JQW C;  2LUM A;  3AU4 A;  2HJ8 A;  2KDF B;  4LTU A;  4TV3 A;  3KYD D;  4MT5 A;  2AQ2 B;  4GDL B;  1P9D U;  2WXL A;  2B76 B;  4ZRK A;  2O6V D;  2D5G A;  4IC7 B;  4IWP A;  2YEP F;  3A9K B;  3W1S A;  4L23 A;  3RMK C;  3J9C A;  1I4G A;  1UBQ A;  3Q8C A;  2L76 A;  2RDB C;  3BVG A;  1JRP A;  4RM9 A;  3AEB B;  4BOZ B;  1OEY J;  2GRI A;  1MVK A;  1NEK B;  1RAX A;  3DPD A;  4US9 A;  4JLC A;  2KLC A;  4HXD A;  1F9J A;  4JL9 A;  3AE4 B;  3HIZ A;  1WXA A;  4H2A A;  3A9J B;  2LWP A;  4BFR A;  1T6B X;  3HRD D;  3V61 A;  2WXG A;  4PS3 A;  3KYC D;  4KIK A;  3V6E B;  4TMA B;  3UIP B;  3VAW A;  3NS8 A;  1AYF A;  2KTF A;  1VR9 A;  5H8Y E;  3FIL A;  2KC1 A;  4WH4 A;  5HHD G;  2MX2 A;  5IAA C; 
#chains in the Genus database with same CATH homology
 4M02 A;  2KT7 A;  4M00 A;  2KVZ A;  4M01 A;  2KYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...