2KVZA

Structure of residues 161-235 of putative peptidoglycan binding protein lmo0835 from listeria monocytogenes: target lmr64b of the northeast structural genomics consortium
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
85
structure length
85
Chain Sequence
MDFGKPNQVTVNYLDENNTSIAPSLYLSGLFNEAYNVPMKKIKGYTLLKYDSEILGVFTESPQTINIIYQKKAPEQALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IspE
publication title Structure of residues 161-235 of putative peptidoglycan binding protein lmo0835 from Listeria monocytogenes: target LmR64B of the Northeast Structural Genomics Consortium
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
total genus 12
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06458 MucBP MucBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 2kvzA00
4M02A 4M00A 2KT7A 2KVZA 4M01A 2KYWA
chains in the Genus database with same CATH superfamily
2L1AA 4S17A 5FR3A 1ZW7A 1HZ5A 2MJEA 3X23A 1ZP0B 1UGJA 3OWEB 3PLVA 1V81A 3M95A 2KTFA 5CHWA 3PRPB 2M17A 2LGYA 1JMLA 4K7UA 1KFYB 4YT0B 1MG4A 2C5LC 1E7VA 5AZHA 2IO3B 2OOBB 1JALA 2XK5A 4ZRPA 1XD3B 4MACA 3ZO5B 1WR1A 3RUIB 3FILA 3R8BA 2BTEA 3P1MA 1YD8U 3SEBA 2FE8A 4LJOB 4ZYSA 5C1ZA 2L0FA 1D6EC 3MC8A 2NBWB 1P3QU 1VRAB 2RD0A 2GB1A 2JRIB 3AULA 3ZUNA 3ALBA 3AE6B 4J3OD 2KD0A 1HE8A 2ZVNA 2KZRA 4JPSA 1Y8RC 2WLBA 2C9WB 3ZNHB 3HIZA 2WXPA 4FJYA 1EM7A 4YSYB 4C4VA 1SEBD 4NY0A 3ZNGC 3KLSX 5BYQA 1VZ7A 1XCTL 3W5VB 5E6OA 1R7SA 2J53A 1L0XB 1QOGA 5DPTA 2N7JA 5EE1A 1WGDA 3QJZA 4LNKA 4MH0E 5C2TB 4IDIA 3UGBB 4C56C 3PLUA 2OJRA 1E9MA 1WXQA 2ZZPB 5C3JB 4USAA 3N9YC 4GN1A 4DWFA 2J4XA 2NS5A 2WXKA 3HM6X 1WXVA 3AI5A 2WX0A 2MCNB 1YJIA 1WXAA 2VZKD 2XN9C 3N1ZC 4XGAB 3DHGC 2QHOA 2JUOA 3NZ3A 3WAPA 3U7DA 3AB5A 1WYGA 1ZE3D 1HA5A 1E10A 2KQ4X 3WA0A 2PTLA 1PDXA 1WJNA 2KMMA 3ZIMA 3RNEC 2WQYB 1L5PA 2XEWA 3AE5B 3TUOA 5H8YE 5GMVA 1J19A 3TEXA 4REZA 4KZCA 1WFYA 3M63B 3HVZA 1YNTE 2D07B 4W9KA 1ACCA 4NAMA 3W1SC 4F1SA 1L4DB 1GG3A 5CX3A 4ZYNA 1FXAA 2SEBD 4WQMA 1UF0A 5CTRC 2XNAC 3V6CB 4FHKA 1SB3C 5HKHA 5D3DA 4HDQA 1V97A 2MBHA 3RULA 4ZHOA 3DHHC 1FCLA 3RPFC 3RD2A 2L7RA 2ZW0A 3QWZB 2G4DB 3AE1B 4WWMA 2K3UA 1I4XA 2DAFA 4N58A 4M01A 1JWBD 2RPQA 3VTWA 1E7UA 2I2YA 2NPTB 1TBEA 2NBUA 3EGRA 1VZ6A 3NZUA 2VZKB 5G2NA 2BYFA 1WJ6A 2K8BA 2INCC 2GLSA 3FKYA 4A6QA 3U52E 1FD6A 2GBNA 3UIPB 1P9DU 3D32A 2ACZB 1WGHA 4W9CA 1OEYA 3A9JA 3NZSA 4AJYB 1UWMA 4WIPA 4BVUC 3Q8EA 1QOAA 4G11A 1FO4A 4XWWA 4RF0A 1V9JA 2MH7A 2KVRA 5DPWA 3IAS1 4KKJA 2N7DA 4LDTB 2WDRB 1NYQA 1RLFA 4NQKE 3A33B 2FCSA 2MBQA 2KFKA 2FUG1 4TKNA 1I4RA 4NAWA 1GJZA 3AN1A 1FXTB 2RDBC 3R7RA 3Q3FA 3VAWA 3LJ3A 4DHZE 5I4DA 3RYTA 4C7ZA 3VQIA 1XLPA 3IAM1 2CHZA 3IHPC 3A1QB 1ZDVA 3GZNI 1LXDA 3A9KB 3CF6E 2KWDA 2GOWA 4GMVA 1P1AA 3ZQ4A 3PTFC 2KDIA 4IM2A 2QCZA 2LGIA 3JSVA 2LVOA 2KMCA 3RI7C 3O13A 4BZAA 5J2RA 2C7NB 3MC0B 2MWSB 1MJDA 1F1HA 1NEKB 1VZ8A 2LUEA 2LJIA 2MA9B 1K52A 2QILA 4WJOA 3QCAA 3RT3B 2GRIA 2TSSA 4EEWA 1GNUA 1CMXB 4ICUA 1RRBA 3QAQA 2LASA 3E9SA 1WZ0A 3IXSA 3S2AA 1JROA 3ZXRA 4ZDVA 1YQ3B 2AWTA 2JRHA 4JL9A 2QSDA 3RNGC 1TZ1A 3CWIA 1JWAD 3KW5B 5JHAA 2DHZA 4RNAA 1YQBA 3NVZA 4K3BA 1QF6A 1QZEA 1FPYA 3HHMA 1BXTA 3DVGX 4YSZB 4C7YA 2R2OA 2LZ6A 2HD5B 5BO4B 2KWVB 3N32A 4ZOHC 2D10A 2CHWA 2M56B 2ZNVC 4W9JA 1YX5B 1SE9A 4RM9A 2J0KA 5HI1A 1EU4A 2CKHB 4FHJA 1IGDA 4BFRA 2KWCA 3W9CB 1MI0A 2KANA 3DBSA 1N5XA 1XO3A 3V61A 3IBEA 4KDLB 3ML9A 1YMHE 3M62B 1BT0A 3BYTB 3Q8BA 3A4RA 3RNBC 2OHFA 3PSEB 1WE7A 3UIOB 1GAQB 3U4EG 3R2IA 3AEAB 5KHOA 2KTRA 3L16A 4PS7A 3ABVB 2L32A 4A90A 2AL6A 1A5RA 4KIKB 2N9EB 1FFUA 2BS3B 1L4ZB 1L0VB 1TS2A 4BKGA 2INPE 2N9PC 4MGZE 3DBHB 3N3KB 1E6EB 4KGSA 2V3PA 3QHTA 3L08A 1ZPSA 2MP2B 4NJCA 1HQRD 1SE2A 1HXYD 3HRDD 2BKFA 1S1QB 2FCMA 5JHBA 4KSKC 1IBXA 4KGRA 2V4IB 2JX5A 3VR8B 3B1LX 1NBFC 2RMMA 3B0AA 4HCNB 3KUCB 1K8RB 4CQNA 4A3OA 1C77A 3DBHI 1NYRA 2KK8A 2JPHA 1V5TA 1TT5B 2LJ5A 1IGCA 2E3TA 4ANWA 4P7IA 1V86A 3PV1A 4HWIB 1DGJA 1TS3A 4FULA 3R2TA 3W5UB 1TKYA 1E8YA 4US8A 3AECB 1WGKA 2FAZA 2AL3A 2O2VA 4JE3B 1VCBA 1G6JA 1WRIA 3B9JA 3K9OB 3SD5A 1DOIA 4MDKE 2MBOA 5HHDG 3HVDA 1TS5A 2WU2B 3NJTA 5JH5C 4RMAA 5BYRA 2MLBA 4WWPA 2INNE 3ECIA 4W9EA 1D4BA 4BBNC 5IOIA 3DPDA 2PMVA 4YTMB 4XYCA 4WQOB 1TY2A 3W2DA 3DDCB 1L0YB 2LRUA 3AMZA 3ZTDA 3I63C 2LUMA 3ZJUA 1X1MA 1YN4A 3GP7A 1OTRB 3TJPA 2IO0B 4EZJA 3BZDB 3IT4B 4K3CA 2UYZB 2J42A 4WAFA 4YWGG 4P1BC 2BB6A 1WMHA 4RGNA 2NR2A 3NHEB 2MHJA 3URYA 4GXBA 4OHJA 4GDLA 2D3BA 1U4AA 1ROEA 2HJ1A 3AEEB 2K6QA 4C00A 2ON8A 1FNWA 4MSMB 2W82A 3MJWA 1F2RC 2QEJC 3C0RB 3Q8FA 1ESFA 4ZHPA 2HJ8A 1WXSA 3MFGA 2G45B 2WXQA 1FCCC 4MGIE 4ITKA 3BY4B 3NVWA 1LM8B 3WAOA 3H1UA 1KOTA 5BMGA 3AE8B 4K81A 4ANXA 2HE7A 4HPPA 2REXA 4YXDB 3WALA 3OAWA 2VH2A 4CYEA 4IG7B 1QILA 1YQ4B 3DVNV 5EE3A 2EMTA 1WRDB 1MVKA 4TSSA 5IKCM 2FNJB 4WJPA 4GDKA 4YL8A 2WXFA 2KN4A 2KMAA 4URKA 2WXMA 3MP9A 4RGMA 3VR9B 4AWJA 1C9FA 1E7PB 1HTOA 1GPXA 5HFYA 3LXFA 3KUDB 1T0RC 2FBWB 2JU6X 5FR6A 1WX8A 5G55A 3OJ3A 1RFKA 1SJED 2K39A 1ZXIA 1FNVA 2EKIA 3DHIC 1KH0A 4XE0A 3NRZA 1HEZE 4GB9A 3FC4A 1AYFA 1QOBA 2O6VA 3CMMB 2L8JA 3RZFA 1WR6E 4N6EB 4E71A 5IN7A 1FM0D 1NI3A 4ASWC 1EF1A 3DQVA 5MPOA 3P4RB 1V1PA 4W9LA 3ZDTA 2KOXA 1OQRA 2MX2A 1V2YA 2B76B 2VH1A 1WJ4A 2HDEA 5AZGA 1M94A 3RCZA 3TEZA 1F9JA 4OW0A 4MT5A 2C7MB 1I7HA 4HPLB 1GC6A 2KNBA 2V3SA 4KX6B 2ZCCA 3CSTA 1ZGUB 4H2AA 5E6NA 3APFA 3R7QA 3TEYA 4ACFA 2BWFA 3UF8A 1UH6A 5DPSA 2AQ2B 2B3AA 4HCPB 3ZTCA 2WNMA 3VXWA 4W9GA 4M8NA 3Q69A 5L95C 2R61A 2DLBA 4RH6A 1AWDA 4NQLB 4LDTD 2KDBA 3L54A 5FK9C 1XLNA 2JZPA 2CU1A 3QA8A 4WURA 4EE2A 3EA6A 1AN8A 2G3QB 2QC8A 5EE9A 1XQQA 4A55A 4NAWB 3SDLC 4JWSC 2PW9A 2K22A 4JLCA 4EKUA 2A4ZA 2WXLA 2V1YA 1WYWB 2K8HA 4YSXB 3ONSA 2FCQA 4TMAB 4BBNF 1T5XD 3TIXA 4PYZA 3QIJA 2N4FA 3AE2B 3H7PB 3M3JA 3AE7B 4KKIA 4IUMB 4JX1C 1N63A 3KVFB 4R3DA 2WHIA 2K0PA 2V9HA 1F2RI 1RYJA 2ZPNA 4DDGD 4IWOA 3BWUD 3W1YA 2K25A 1C76A 3BK2A 4HDOA 3H6NA 2JXTA 2QDFA 4HEA1 2UU7A 1TZOA 2WXIA 2KKCA 1PGAA 3BVMA 5E6PA 4DXAB 2BYVE 2ZPYA 3PZ7A 3FAHA 3GZNB 5G5GA 3DWMA 4HXDA 1A70A 1CJEA 4HKZE 2YVCA 3HK0A 4I6LB 1UNSA 4UDUC 4LNNA 2V0GA 3IT6B 3Q3NC 2IY0B 4D2KA 1JQ4A 1JWSD 5AUKA 1TKGA 1KLGD 2DZIA 4FN2A 4CHKA 5IO9A 3HM3A 2BW2A 3RFZB 4RM8A 2JF5A 3DVGY 4II3B 4LNFA 4B0EA 1M4VA 2AEHA 3U30A 2PKOA 3EFUA 5LNK1 2Z59B 2M0AA 4JWUC 1ZUD2 2BB5A 3QARA 1T0YA 2GMIC 5AUIA 3KWVA 1OGWA 1TIFA 1E0ZA 3PO0A 2KDMA 4M0WB 4HJGE 2JYTA 2L83A 4BKSD 4B95A 2MBEA 2BGFA 1TY0A 5E6JA 5AZFA 1E8ZA 2INDC 3WANA 1Z2MA 3NS1A 2WXHA 4WJNA 2JQRB 2WS3B 3H8HA 4ZRJA 2IYDB 4B9KA 2AQ3B 2M19A 2N0SB 1WE6A 2NPTA 2JZ3B 4K7SA 2M1MA 1OFFA 3AE9B 2AX5A 2DNFA 2ZCBA 1K50A 2LHDA 2WWZA 4NPNA 3RN9C 2D5GA 4W9HA 1PQSA 4KGTA 4FJZA 1K51A 4MH8A 3PT2B 2MSED 2KTRB 2FIDA 3H7SA 2K1FA 3NVVA 3VDZA 2KXJA 3TBLD 2N9LA 4XDDA 1NDDA 1SIJA 1SE3A 4MEMA 2KLGA 3ZNZB 1YJJA 2KC2A 4O1NA 4AUQC 4MJSA 4P1CC 1PYWD 1WM3A 1FXIA 3RZWC 4EZKA 2YEPF 2M0XA 3P2BA 1P7FA 1EU3A 3DOWA 2D11A 2GBRA 2KDEB 4PS3A 1WZ3A 1V80A 3AU4A 2G4SA 2KACA 3PPAA 1OEYJ 3A9KA 2I1KA 2PIAA 4MM3B 1KRHA 3V3XA 4GLSC 1KLVA 3SR6A 1XEEA 2KC1A 2DENB 3NG0A 1PGBA 2PEAA 5AEKB 2KJ6A 3PVLA 1XLOA 4IKGA 1T0SC 3P42A 4B0MA 5C23A 3CIRB 2L00B 2W3RA 1MHHE 2KHWB 1N6ZA 2Y5BB 4WAAA 4AP4C 1MFWA 1PFDA 4TQ1A 1K53A 1UUPA 4C80A 4N9F4 2UWQA 3WAMA 2LRWA 3R3MA 3GS2A 1C4AA 1C4CA 1E8XA 1D5XC 4BOSC 3LYYA 1TTNA 2LMCA 1SXTA 2N9KA 2PLPA 3WIMA 2D3GA 1J7BA 2DYBA 2BVCA 2K9XA 3PRZA 5GXGB 3L10B 3EUB2 1NENB 3KUZA 5T8IA 1MG8A 2JY6A 4S0RA 1EO6A 3QQ8B 1C3TA 3KYCD 2KAJA 4FBJB 3U8ZA 3NS8A 4GU2A 1RWSA 1ET6A 4KDIC 4ZRKA 2XBBC 3ZRFA 4LK0M 5JXVA 5CHFA 4F8CB 1V8CA 1CQVA 1WMHB 3X0WA 3BK1A 2JWUA 4US9A 3C8YA 1L6UA 1F0ZA 3B08A 3P4SB 4WWNA 4ANUA 1FRRA 2L76A 4EZLA 4AOFA 4A20A 3LB8C 5D94A 3N30A 1F77A 3KQ4A 3N20C 4RGOS 4TUUA 4HRSA 2MJ3A 2W54A 3T9LA 3DBRB 2IDYA 5J17A 3Q14C 3BVZA 3ZNID 3Q3MC 1LGRA 2O6VD 3DCGA 3T8MA 3PZ8A 4MELA 4GGQA 2PJHA 2NBVB 2DYOA 3QX1A 1SBBB 5D7GA 2PE9A 1FFVA 1NVID 1ZKHA 4LLGM 4CO7A 2LXAA 4OVZA 3A4SC 3I9V1 4KIKA 4EUTA 3ZRCA 3ZKJC 1J7CA 2WXNA 4AQ7A 2Y5CA 2L05A 3TCAA 1P7EA 2NTTA 2FIFA 1SIFA 2MW5A 4KSLC 3DBRI 2WXGA 1ISNA 3AEDB 2LGXA 2MEKA 2MP2A 1WXMA 4A9AA 1KM7A 3EFCA 2XK5B 1VDVA 4FADA 4GDKB 3CSFA 2JSVX 4JGHB 2N1WA 3FILB 3DVNU 1Q10A 1VD2A 2W3SA 2D2QA 3RNAC 4P16A 3L13A 3VUXA 1V5OA 1RFAA 3VTUA 2OEDA 2LVQA 1KTKA 2ONQA 2ZNVB 4I6NB 4NNJB 3VUWA 3RMKC 3OLMD 2WDTB 1YN3A 3MTNB 4E74A 2RR9A 1C1YB 1JWUD 1VJKA 4II2B 3NY5A 1TJEA 4B6WA 4C4VB 3I3TB 1H8CA 2KFJA 2IBIB 1XCQL 2O6VB 2JYEA 4BOZB 2RDGA 2X38A 1N60A 3E56A 2CR5A 3ZJVA 1WF9A 3V6EB 3I57A 2RSUA 1XT9B 1CK1A 2H89B 2J0MA 3AU5A 2VRRB 2KWUB 3VHTC 4E3CA 1Q0WB 4FA6A 3VVWB 2AQ1B 4HROA 2AYOB 2EKEC 1XXGA 2C60A 2IGDA 3N1XC 2I1JA 4OVUA 2DWQA 2MQJA 2BQQA 2Y3AA 1N5WA 4IM0A 4MSQB 1T3QA 1MHXA 2LI5A 2MRPA 1IPGA 1JRUA 3VRAB 2Y5PA 2LGSA 2LFIA 1KJTA 4W9FA 4LNIA 2LD9A 3APDA 2CU3A 1R4MI 4F7ZA 1JRPA 2L0TA 1EWCA 5DPRA 4FJVB 3ZJTA 3N1YC 3PHWB 3KYDD 4DXFA 4EOYA 2Z0DB 2LGDA 4W9IA 2EELA 3EHVA 2KT7A 2BS2B 2RGFA 3ZW3A 5CHVC 2C7HA 4L23A 2YLMA 4EFOA 2ICIA 4N59A 2WDVB 1SE4A 1H4RA 1WGYA 4AS1A 3GE8C 4DHZB 4GIVA 3HUIA 4RFBA 3GB1A 5KHQA 2NCNA 1TYGB 2DZJA 2PPHA 4GOCA 3SHQA 1WSPA 2L3ZA 4DDID 4FLHA 3AH7A 1Z5SB 1JW9D 3U7ZA 4IC7B 5LXHA 2KJHB 4OVVA 3VH4B 3AE3B 2IZVB 4L2YA 5D3IB 1N61A 1AARA 1YX6B 4ZRQA 1HZ6A 3NOBA 1OQYA 1ENFA 2ZW1A 3EC8A 1WM2A 2M4NA 2DZMA 4ARCA 3DBLB 4ARIA 3PS6A 1SJHD 1AW7A 4FXCA 1P0RA 3R66C 2KQSA 3BINA 5J18A 1C4PA 4RCOA 1FMAD 1J7AA 2GBMA 2K8CA 3VTVA 1I4PA 3A9JB 4P6VF 1RAXA 4LTUA 2V4LA 3V60A 2KJRA 2PE6B 3ZLZA 5G5HA 2NMQA 3QC8B 1WI0A 1WY8A 2PVOD 3DBLI 2CJNA 3K9PB 2KFKB 3V05A 4OZCA 2E6XA 5JZEB 2J0JA 2MBBB 2DYMA 2R2QA 2RPVA 5H92C 2IPKD 3Q8CA 4HLEA 3UQBA 1HTQA 3I5JC 3AEGB 5EDSA 3Q8AA 1YJ1A 3VUYA 2D3CA 4ANVA 1TS4A 1UZXB 1I4QA 3IFWB 1DOXA 4LNOA 3O65B 1T0QC 1KLUD 2KLCA 1SF0A 2I38A 2KN5A 3T3OA 1Q5WB 1BMLC 3JSVB 2WP9B 3B2GA 1N62A 3SFDB 3IG3A 1VLBA 1P98A 2Z8LA 3APCA 3V62A 4IM3A 5LLIA 5IA7A 3P4QB 3AE4B 2G1EA 3PGEA 3TMPB 3OJ4B 1WJUA 2K6DB 2JVCA 1FNUA 4DHJD 2IY1B 2N7EA 4HK2A 3BYYB 2WGSA 1J0GA 3Q3OC 1CZPA 1WGGA 4DK5A 3OG5A 4DQOC 1UWXA 2L52A 2IO2B 2LHEA 1ET9A 4IWPA 2WXOA 4I6PA 1R4NB 3SU8X 1ZXHA 3MHZA 2IO1B 2KQ7A 4L1BA 3ML8A 1LFDA 1UBIA 1D5ZC 2JT4B 3P63A 1C78A 4W9DA 2FUHB 1UELA 2PVGC 4GSWA 2WX1A 2ZJDA 4MJSB 2YEPB 4LCDE 3JVZX 3ZYYX 5D6JB 2RDHA 3PRMB 1NI2A 2KX0A 1D3ZA 1GB1A 1Q1OA 1R4NI 2JXXA 4RF1A 2WU5B 2DX5B 2J52A 3DWGC 4QAYA 2IGGA 3H7PA 2IGHA 2JZZA 2H88B 2W9NA 5IP4D 3PREA 4MGKE 1Y56A 2D3AA 5L83A 1TKEA 1ZDXA 1YIWA 1JCKB 4K7WA 4XX5A 1B1ZA 1T6BX 4DHJB 1WX7A 2NTSA 2SAKA 4G0NB 1PUTA 5TSSA 3GE3C 2DZKA 3P4PB 2M8SA 3RNCC 4PK1A 3T3NA 2BPSA 3H9DA 4XDCA 3RNFC 2BF8B 2CJOA 3BIID 4TV3A 1JWMD 4G3XB 4J6IA 2WXRA 3L0WB 1XF5L 2LEKA 4G50A 3AXCA 1I4GA 3JYUA 5DCNA 2MJDA 4DBGA 2KVZA 4K1RB 1TGZB 4WJQA 3A1QA 1QOFA 1OQQA 3J9CA 2BYTA 1IBXB 1STEA 1MPEA 4BKTA 2QMTA 3MHSD 2KO3A 4M0WA 3NUHB 2NVUI 4TQ0A 1QQRA 2JWZA 4YTPB 1C79A 2CS4A 5HG2A 3AEBB 1ZOYB 4ZRIA 3VRBB 1I42A 4IW0A 1L7YA 3AV8A 3SFEB 4HPMB 4HVBA 3PHXB 2W55A 1WIAA 1PGXA 1V1OA 1S3SG 1KF6B 3JW0X 2O2VB 2X8XX 2V3NA 1E90A 5IAAC 2ZEQA 2DBYA 3IVFA 2A5UA 3B2FA 3MC9A 2KYWA 3UINB 5BYSA 2GBJA 2BKRB 2FCNA 2KX3A 2HTME 1FIQA 1YN5A 3Q2AC 1EWYC 1F52A 3L17A 5TR5A 1XLQA 3QK0A 3PZDA 1LO5D 2BBCA 1IUEA 2Q5WD 1SSNA 1BUIC 4RGTA 4HJKA 1WH3A 4XZ4A 3W1SA 4HKQA 3L4PA 2BYEA 4JQWC 4X57B 4ICVA 1SGHA 4A8XC 3AM9A 4PS8A 2LVPA 3U2SC 1UGMA 4MGYE 5BMHA 3VFKA 1LQBA 4BKSA 4NJ7A 1I35A 4GDLB 2ASQA 1FRDA 4WH4A 3ENEA 1E8WA 3ETRA 4MM3A 1V6EA 2OJWA 3TSSA 3MJ5A 4PT5A 3ZDMC 4OZBA 2J7QB 2EMSA 5LXIB 4YTNB 4WWOA 1L6VA 4IWQA 4Q2JA 2LXCA 5FKAC 2CHXA 3Q6BA 4PYUA 1WGRA 3GOEA 3KH0A 3TEWA 3KWLA 1B9RA 4A3PA 1FEHA 2GI9A 3BVGA 3WCQA 3VH3B 2N1VA 2WXJA 5EE0A 1E5WA 2BT6A 4NJ6A 1EF5A 2ZVOA 1QLBB 4OZAA 5D2MB 2Z0EB 3C19A 4BAXA 1WWTA 1J8CA 2WYQA 1UD7A 4M02A 2BWES 4M8MA 4IOIE 5BMIA 4KZ0A 1EUVB 1GB4A 1QT9A 1GOZA 3Q3JA 2IJ0A 1D5MC 4KV2A 2LWPA 3TL5A 1DOYA 3AEFB 1GUAB 2GBKA 3NVYA 3ZXVA 2N9XA 1GC7A 1UBQA 2BS4B 3ZVVA 1IP9A 4M00A 1DYQA 1RM6C 4KVGB 4NZLB 2QJLA 1V49A 4LJPB 4JIOU 3UI3A 1QKZA 3LDZE 1IYFA 2QIEB 4XC2A 1WX9A 2DAJA 4DXGA 2WDQB 4AJWA 3ZGZA 1L2NA 4XWTA 3EECA 1V1PB 3UQAA 1R4MB 2K5PA 2G9HD 1YOVB 2KDFB 1I4HA 1VR9A 2HTHA
chains in the Genus database with same CATH topology
4M02A 4M00A 2KT7A 2KVZA 4M01A 2KYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M02 A;  4M00 A;  2KT7 A;  2KVZ A;  4M01 A;  2KYW A; 
#chains in the Genus database with same CATH topology
 2L1A A;  4S17 A;  5FR3 A;  1ZW7 A;  1HZ5 A;  2MJE A;  3X23 A;  1ZP0 B;  1UGJ A;  3OWE B;  3PLV A;  1V81 A;  3M95 A;  2KTF A;  5CHW A;  3PRP B;  2M17 A;  2LGY A;  1JML A;  4K7U A;  1KFY B;  4YT0 B;  1MG4 A;  2C5L C;  1E7V A;  5AZH A;  2IO3 B;  2OOB B;  1JAL A;  2XK5 A;  4ZRP A;  1XD3 B;  4MAC A;  3ZO5 B;  1WR1 A;  3RUI B;  3FIL A;  3R8B A;  2BTE A;  3P1M A;  1YD8 U;  3SEB A;  2FE8 A;  4LJO B;  4ZYS A;  5C1Z A;  2L0F A;  1D6E C;  3MC8 A;  2NBW B;  1P3Q U;  1VRA B;  2RD0 A;  2GB1 A;  2JRI B;  3AUL A;  3ZUN A;  3ALB A;  3AE6 B;  4J3O D;  2KD0 A;  1HE8 A;  2ZVN A;  2KZR A;  4JPS A;  1Y8R C;  2WLB A;  2C9W B;  3ZNH B;  3HIZ A;  2WXP A;  4FJY A;  1EM7 A;  4YSY B;  4C4V A;  1SEB D;  4NY0 A;  3ZNG C;  3KLS X;  5BYQ A;  1VZ7 A;  1XCT L;  3W5V B;  5E6O A;  1R7S A;  2J53 A;  1L0X B;  1QOG A;  5DPT A;  2N7J A;  5EE1 A;  1WGD A;  3QJZ A;  4LNK A;  4MH0 E;  5C2T B;  4IDI A;  3UGB B;  4C56 C;  3PLU A;  2OJR A;  1E9M A;  1WXQ A;  2ZZP B;  5C3J B;  4USA A;  3N9Y C;  4GN1 A;  4DWF A;  2J4X A;  2NS5 A;  2WXK A;  3HM6 X;  1WXV A;  3AI5 A;  2WX0 A;  2MCN B;  1YJI A;  1WXA A;  2VZK D;  2XN9 C;  3N1Z C;  4XGA B;  3DHG C;  2QHO A;  2JUO A;  3NZ3 A;  3WAP A;  3U7D A;  3AB5 A;  1WYG A;  1ZE3 D;  1HA5 A;  1E10 A;  2KQ4 X;  3WA0 A;  2PTL A;  1PDX A;  1WJN A;  2KMM A;  3ZIM A;  3RNE C;  2WQY B;  1L5P A;  2XEW A;  3AE5 B;  3TUO A;  5H8Y E;  5GMV A;  1J19 A;  3TEX A;  4REZ A;  4KZC A;  1WFY A;  3M63 B;  3HVZ A;  1YNT E;  2D07 B;  4W9K A;  1ACC A;  4NAM A;  3W1S C;  4F1S A;  1L4D B;  1GG3 A;  5CX3 A;  4ZYN A;  1FXA A;  2SEB D;  4WQM A;  1UF0 A;  5CTR C;  2XNA C;  3V6C B;  4FHK A;  1SB3 C;  5HKH A;  5D3D A;  4HDQ A;  1V97 A;  2MBH A;  3RUL A;  4ZHO A;  3DHH C;  1FCL A;  3RPF C;  3RD2 A;  2L7R A;  2ZW0 A;  3QWZ B;  2G4D B;  3AE1 B;  4WWM A;  2K3U A;  1I4X A;  2DAF A;  4N58 A;  4M01 A;  1JWB D;  2RPQ A;  3VTW A;  1E7U A;  2I2Y A;  2NPT B;  1TBE A;  2NBU A;  3EGR A;  1VZ6 A;  3NZU A;  2VZK B;  5G2N A;  2BYF A;  1WJ6 A;  2K8B A;  2INC C;  2GLS A;  3FKY A;  4A6Q A;  3U52 E;  1FD6 A;  2GBN A;  3UIP B;  1P9D U;  3D32 A;  2ACZ B;  1WGH A;  4W9C A;  1OEY A;  3A9J A;  3NZS A;  4AJY B;  1UWM A;  4WIP A;  4BVU C;  3Q8E A;  1QOA A;  4G11 A;  1FO4 A;  4XWW A;  4RF0 A;  1V9J A;  2MH7 A;  2KVR A;  5DPW A;  3IAS 1;  4KKJ A;  2N7D A;  4LDT B;  2WDR B;  1NYQ A;  1RLF A;  4NQK E;  3A33 B;  2FCS A;  2MBQ A;  2KFK A;  2FUG 1;  4TKN A;  1I4R A;  4NAW A;  1GJZ A;  3AN1 A;  1FXT B;  2RDB C;  3R7R A;  3Q3F A;  3VAW A;  3LJ3 A;  4DHZ E;  5I4D A;  3RYT A;  4C7Z A;  3VQI A;  1XLP A;  3IAM 1;  2CHZ A;  3IHP C;  3A1Q B;  1ZDV A;  3GZN I;  1LXD A;  3A9K B;  3CF6 E;  2KWD A;  2GOW A;  4GMV A;  1P1A A;  3ZQ4 A;  3PTF C;  2KDI A;  4IM2 A;  2QCZ A;  2LGI A;  3JSV A;  2LVO A;  2KMC A;  3RI7 C;  3O13 A;  4BZA A;  5J2R A;  2C7N B;  3MC0 B;  2MWS B;  1MJD A;  1F1H A;  1NEK B;  1VZ8 A;  2LUE A;  2LJI A;  2MA9 B;  1K52 A;  2QIL A;  4WJO A;  3QCA A;  3RT3 B;  2GRI A;  2TSS A;  4EEW A;  1GNU A;  1CMX B;  4ICU A;  1RRB A;  3QAQ A;  2LAS A;  3E9S A;  1WZ0 A;  3IXS A;  3S2A A;  1JRO A;  3ZXR A;  4ZDV A;  1YQ3 B;  2AWT A;  2JRH A;  4JL9 A;  2QSD A;  3RNG C;  1TZ1 A;  3CWI A;  1JWA D;  3KW5 B;  5JHA A;  2DHZ A;  4RNA A;  1YQB A;  3NVZ A;  4K3B A;  1QF6 A;  1QZE A;  1FPY A;  3HHM A;  1BXT A;  3DVG X;  4YSZ B;  4C7Y A;  2R2O A;  2LZ6 A;  2HD5 B;  5BO4 B;  2KWV B;  3N32 A;  4ZOH C;  2D10 A;  2CHW A;  2M56 B;  2ZNV C;  4W9J A;  1YX5 B;  1SE9 A;  4RM9 A;  2J0K A;  5HI1 A;  1EU4 A;  2CKH B;  4FHJ A;  1IGD A;  4BFR A;  2KWC A;  3W9C B;  1MI0 A;  2KAN A;  3DBS A;  1N5X A;  1XO3 A;  3V61 A;  3IBE A;  4KDL B;  3ML9 A;  1YMH E;  3M62 B;  1BT0 A;  3BYT B;  3Q8B A;  3A4R A;  3RNB C;  2OHF A;  3PSE B;  1WE7 A;  3UIO B;  1GAQ B;  3U4E G;  3R2I A;  3AEA B;  5KHO A;  2KTR A;  3L16 A;  4PS7 A;  3ABV B;  2L32 A;  4A90 A;  2AL6 A;  1A5R A;  4KIK B;  2N9E B;  1FFU A;  2BS3 B;  1L4Z B;  1L0V B;  1TS2 A;  4BKG A;  2INP E;  2N9P C;  4MGZ E;  3DBH B;  3N3K B;  1E6E B;  4KGS A;  2V3P A;  3QHT A;  3L08 A;  1ZPS A;  2MP2 B;  4NJC A;  1HQR D;  1SE2 A;  1HXY D;  3HRD D;  2BKF A;  1S1Q B;  2FCM A;  5JHB A;  4KSK C;  1IBX A;  4KGR A;  2V4I B;  2JX5 A;  3VR8 B;  3B1L X;  1NBF C;  2RMM A;  3B0A A;  4HCN B;  3KUC B;  1K8R B;  4CQN A;  4A3O A;  1C77 A;  3DBH I;  1NYR A;  2KK8 A;  2JPH A;  1V5T A;  1TT5 B;  2LJ5 A;  1IGC A;  2E3T A;  4ANW A;  4P7I A;  1V86 A;  3PV1 A;  4HWI B;  1DGJ A;  1TS3 A;  4FUL A;  3R2T A;  3W5U B;  1TKY A;  1E8Y A;  4US8 A;  3AEC B;  1WGK A;  2FAZ A;  2AL3 A;  2O2V A;  4JE3 B;  1VCB A;  1G6J A;  1WRI A;  3B9J A;  3K9O B;  3SD5 A;  1DOI A;  4MDK E;  2MBO A;  5HHD G;  3HVD A;  1TS5 A;  2WU2 B;  3NJT A;  5JH5 C;  4RMA A;  5BYR A;  2MLB A;  4WWP A;  2INN E;  3ECI A;  4W9E A;  1D4B A;  4BBN C;  5IOI A;  3DPD A;  2PMV A;  4YTM B;  4XYC A;  4WQO B;  1TY2 A;  3W2D A;  3DDC B;  1L0Y B;  2LRU A;  3AMZ A;  3ZTD A;  3I63 C;  2LUM A;  3ZJU A;  1X1M A;  1YN4 A;  3GP7 A;  1OTR B;  3TJP A;  2IO0 B;  4EZJ A;  3BZD B;  3IT4 B;  4K3C A;  2UYZ B;  2J42 A;  4WAF A;  4YWG G;  4P1B C;  2BB6 A;  1WMH A;  4RGN A;  2NR2 A;  3NHE B;  2MHJ A;  3URY A;  4GXB A;  4OHJ A;  4GDL A;  2D3B A;  1U4A A;  1ROE A;  2HJ1 A;  3AEE B;  2K6Q A;  4C00 A;  2ON8 A;  1FNW A;  4MSM B;  2W82 A;  3MJW A;  1F2R C;  2QEJ C;  3C0R B;  3Q8F A;  1ESF A;  4ZHP A;  2HJ8 A;  1WXS A;  3MFG A;  2G45 B;  2WXQ A;  1FCC C;  4MGI E;  4ITK A;  3BY4 B;  3NVW A;  1LM8 B;  3WAO A;  3H1U A;  1KOT A;  5BMG A;  3AE8 B;  4K81 A;  4ANX A;  2HE7 A;  4HPP A;  2REX A;  4YXD B;  3WAL A;  3OAW A;  2VH2 A;  4CYE A;  4IG7 B;  1QIL A;  1YQ4 B;  3DVN V;  5EE3 A;  2EMT A;  1WRD B;  1MVK A;  4TSS A;  5IKC M;  2FNJ B;  4WJP A;  4GDK A;  4YL8 A;  2WXF A;  2KN4 A;  2KMA A;  4URK A;  2WXM A;  3MP9 A;  4RGM A;  3VR9 B;  4AWJ A;  1C9F A;  1E7P B;  1HTO A;  1GPX A;  5HFY A;  3LXF A;  3KUD B;  1T0R C;  2FBW B;  2JU6 X;  5FR6 A;  1WX8 A;  5G55 A;  3OJ3 A;  1RFK A;  1SJE D;  2K39 A;  1ZXI A;  1FNV A;  2EKI A;  3DHI C;  1KH0 A;  4XE0 A;  3NRZ A;  1HEZ E;  4GB9 A;  3FC4 A;  1AYF A;  1QOB A;  2O6V A;  3CMM B;  2L8J A;  3RZF A;  1WR6 E;  4N6E B;  4E71 A;  5IN7 A;  1FM0 D;  1NI3 A;  4ASW C;  1EF1 A;  3DQV A;  5MPO A;  3P4R B;  1V1P A;  4W9L A;  3ZDT A;  2KOX A;  1OQR A;  2MX2 A;  1V2Y A;  2B76 B;  2VH1 A;  1WJ4 A;  2HDE A;  5AZG A;  1M94 A;  3RCZ A;  3TEZ A;  1F9J A;  4OW0 A;  4MT5 A;  2C7M B;  1I7H A;  4HPL B;  1GC6 A;  2KNB A;  2V3S A;  4KX6 B;  2ZCC A;  3CST A;  1ZGU B;  4H2A A;  5E6N A;  3APF A;  3R7Q A;  3TEY A;  4ACF A;  2BWF A;  3UF8 A;  1UH6 A;  5DPS A;  2AQ2 B;  2B3A A;  4HCP B;  3ZTC A;  2WNM A;  3VXW A;  4W9G A;  4M8N A;  3Q69 A;  5L95 C;  2R61 A;  2DLB A;  4RH6 A;  1AWD A;  4NQL B;  4LDT D;  2KDB A;  3L54 A;  5FK9 C;  1XLN A;  2JZP A;  2CU1 A;  3QA8 A;  4WUR A;  4EE2 A;  3EA6 A;  1AN8 A;  2G3Q B;  2QC8 A;  5EE9 A;  1XQQ A;  4A55 A;  4NAW B;  3SDL C;  4JWS C;  2PW9 A;  2K22 A;  4JLC A;  4EKU A;  2A4Z A;  2WXL A;  2V1Y A;  1WYW B;  2K8H A;  4YSX B;  3ONS A;  2FCQ A;  4TMA B;  4BBN F;  1T5X D;  3TIX A;  4PYZ A;  3QIJ A;  2N4F A;  3AE2 B;  3H7P B;  3M3J A;  3AE7 B;  4KKI A;  4IUM B;  4JX1 C;  1N63 A;  3KVF B;  4R3D A;  2WHI A;  2K0P A;  2V9H A;  1F2R I;  1RYJ A;  2ZPN A;  4DDG D;  4IWO A;  3BWU D;  3W1Y A;  2K25 A;  1C76 A;  3BK2 A;  4HDO A;  3H6N A;  2JXT A;  2QDF A;  4HEA 1;  2UU7 A;  1TZO A;  2WXI A;  2KKC A;  1PGA A;  3BVM A;  5E6P A;  4DXA B;  2BYV E;  2ZPY A;  3PZ7 A;  3FAH A;  3GZN B;  5G5G A;  3DWM A;  4HXD A;  1A70 A;  1CJE A;  4HKZ E;  2YVC A;  3HK0 A;  4I6L B;  1UNS A;  4UDU C;  4LNN A;  2V0G A;  3IT6 B;  3Q3N C;  2IY0 B;  4D2K A;  1JQ4 A;  1JWS D;  5AUK A;  1TKG A;  1KLG D;  2DZI A;  4FN2 A;  4CHK A;  5IO9 A;  3HM3 A;  2BW2 A;  3RFZ B;  4RM8 A;  2JF5 A;  3DVG Y;  4II3 B;  4LNF A;  4B0E A;  1M4V A;  2AEH A;  3U30 A;  2PKO A;  3EFU A;  5LNK 1;  2Z59 B;  2M0A A;  4JWU C;  1ZUD 2;  2BB5 A;  3QAR A;  1T0Y A;  2GMI C;  5AUI A;  3KWV A;  1OGW A;  1TIF A;  1E0Z A;  3PO0 A;  2KDM A;  4M0W B;  4HJG E;  2JYT A;  2L83 A;  4BKS D;  4B95 A;  2MBE A;  2BGF A;  1TY0 A;  5E6J A;  5AZF A;  1E8Z A;  2IND C;  3WAN A;  1Z2M A;  3NS1 A;  2WXH A;  4WJN A;  2JQR B;  2WS3 B;  3H8H A;  4ZRJ A;  2IYD B;  4B9K A;  2AQ3 B;  2M19 A;  2N0S B;  1WE6 A;  2NPT A;  2JZ3 B;  4K7S A;  2M1M A;  1OFF A;  3AE9 B;  2AX5 A;  2DNF A;  2ZCB A;  1K50 A;  2LHD A;  2WWZ A;  4NPN A;  3RN9 C;  2D5G A;  4W9H A;  1PQS A;  4KGT A;  4FJZ A;  1K51 A;  4MH8 A;  3PT2 B;  2MSE D;  2KTR B;  2FID A;  3H7S A;  2K1F A;  3NVV A;  3VDZ A;  2KXJ A;  3TBL D;  2N9L A;  4XDD A;  1NDD A;  1SIJ A;  1SE3 A;  4MEM A;  2KLG A;  3ZNZ B;  1YJJ A;  2KC2 A;  4O1N A;  4AUQ C;  4MJS A;  4P1C C;  1PYW D;  1WM3 A;  1FXI A;  3RZW C;  4EZK A;  2YEP F;  2M0X A;  3P2B A;  1P7F A;  1EU3 A;  3DOW A;  2D11 A;  2GBR A;  2KDE B;  4PS3 A;  1WZ3 A;  1V80 A;  3AU4 A;  2G4S A;  2KAC A;  3PPA A;  1OEY J;  3A9K A;  2I1K A;  2PIA A;  4MM3 B;  1KRH A;  3V3X A;  4GLS C;  1KLV A;  3SR6 A;  1XEE A;  2KC1 A;  2DEN B;  3NG0 A;  1PGB A;  2PEA A;  5AEK B;  2KJ6 A;  3PVL A;  1XLO A;  4IKG A;  1T0S C;  3P42 A;  4B0M A;  5C23 A;  3CIR B;  2L00 B;  2W3R A;  1MHH E;  2KHW B;  1N6Z A;  2Y5B B;  4WAA A;  4AP4 C;  1MFW A;  1PFD A;  4TQ1 A;  1K53 A;  1UUP A;  4C80 A;  4N9F 4;  2UWQ A;  3WAM A;  2LRW A;  3R3M A;  3GS2 A;  1C4A A;  1C4C A;  1E8X A;  1D5X C;  4BOS C;  3LYY A;  1TTN A;  2LMC A;  1SXT A;  2N9K A;  2PLP A;  3WIM A;  2D3G A;  1J7B A;  2DYB A;  2BVC A;  2K9X A;  3PRZ A;  5GXG B;  3L10 B;  3EUB 2;  1NEN B;  3KUZ A;  5T8I A;  1MG8 A;  2JY6 A;  4S0R A;  1EO6 A;  3QQ8 B;  1C3T A;  3KYC D;  2KAJ A;  4FBJ B;  3U8Z A;  3NS8 A;  4GU2 A;  1RWS A;  1ET6 A;  4KDI C;  4ZRK A;  2XBB C;  3ZRF A;  4LK0 M;  5JXV A;  5CHF A;  4F8C B;  1V8C A;  1CQV A;  1WMH B;  3X0W A;  3BK1 A;  2JWU A;  4US9 A;  3C8Y A;  1L6U A;  1F0Z A;  3B08 A;  3P4S B;  4WWN A;  4ANU A;  1FRR A;  2L76 A;  4EZL A;  4AOF A;  4A20 A;  3LB8 C;  5D94 A;  3N30 A;  1F77 A;  3KQ4 A;  3N20 C;  4RGO S;  4TUU A;  4HRS A;  2MJ3 A;  2W54 A;  3T9L A;  3DBR B;  2IDY A;  5J17 A;  3Q14 C;  3BVZ A;  3ZNI D;  3Q3M C;  1LGR A;  2O6V D;  3DCG A;  3T8M A;  3PZ8 A;  4MEL A;  4GGQ A;  2PJH A;  2NBV B;  2DYO A;  3QX1 A;  1SBB B;  5D7G A;  2PE9 A;  1FFV A;  1NVI D;  1ZKH A;  4LLG M;  4CO7 A;  2LXA A;  4OVZ A;  3A4S C;  3I9V 1;  4KIK A;  4EUT A;  3ZRC A;  3ZKJ C;  1J7C A;  2WXN A;  4AQ7 A;  2Y5C A;  2L05 A;  3TCA A;  1P7E A;  2NTT A;  2FIF A;  1SIF A;  2MW5 A;  4KSL C;  3DBR I;  2WXG A;  1ISN A;  3AED B;  2LGX A;  2MEK A;  2MP2 A;  1WXM A;  4A9A A;  1KM7 A;  3EFC A;  2XK5 B;  1VDV A;  4FAD A;  4GDK B;  3CSF A;  2JSV X;  4JGH B;  2N1W A;  3FIL B;  3DVN U;  1Q10 A;  1VD2 A;  2W3S A;  2D2Q A;  3RNA C;  4P16 A;  3L13 A;  3VUX A;  1V5O A;  1RFA A;  3VTU A;  2OED A;  2LVQ A;  1KTK A;  2ONQ A;  2ZNV B;  4I6N B;  4NNJ B;  3VUW A;  3RMK C;  3OLM D;  2WDT B;  1YN3 A;  3MTN B;  4E74 A;  2RR9 A;  1C1Y B;  1JWU D;  1VJK A;  4II2 B;  3NY5 A;  1TJE A;  4B6W A;  4C4V B;  3I3T B;  1H8C A;  2KFJ A;  2IBI B;  1XCQ L;  2O6V B;  2JYE A;  4BOZ B;  2RDG A;  2X38 A;  1N60 A;  3E56 A;  2CR5 A;  3ZJV A;  1WF9 A;  3V6E B;  3I57 A;  2RSU A;  1XT9 B;  1CK1 A;  2H89 B;  2J0M A;  3AU5 A;  2VRR B;  2KWU B;  3VHT C;  4E3C A;  1Q0W B;  4FA6 A;  3VVW B;  2AQ1 B;  4HRO A;  2AYO B;  2EKE C;  1XXG A;  2C60 A;  2IGD A;  3N1X C;  2I1J A;  4OVU A;  2DWQ A;  2MQJ A;  2BQQ A;  2Y3A A;  1N5W A;  4IM0 A;  4MSQ B;  1T3Q A;  1MHX A;  2LI5 A;  2MRP A;  1IPG A;  1JRU A;  3VRA B;  2Y5P A;  2LGS A;  2LFI A;  1KJT A;  4W9F A;  4LNI A;  2LD9 A;  3APD A;  2CU3 A;  1R4M I;  4F7Z A;  1JRP A;  2L0T A;  1EWC A;  5DPR A;  4FJV B;  3ZJT A;  3N1Y C;  3PHW B;  3KYD D;  4DXF A;  4EOY A;  2Z0D B;  2LGD A;  4W9I A;  2EEL A;  3EHV A;  2KT7 A;  2BS2 B;  2RGF A;  3ZW3 A;  5CHV C;  2C7H A;  4L23 A;  2YLM A;  4EFO A;  2ICI A;  4N59 A;  2WDV B;  1SE4 A;  1H4R A;  1WGY A;  4AS1 A;  3GE8 C;  4DHZ B;  4GIV A;  3HUI A;  4RFB A;  3GB1 A;  5KHQ A;  2NCN A;  1TYG B;  2DZJ A;  2PPH A;  4GOC A;  3SHQ A;  1WSP A;  2L3Z A;  4DDI D;  4FLH A;  3AH7 A;  1Z5S B;  1JW9 D;  3U7Z A;  4IC7 B;  5LXH A;  2KJH B;  4OVV A;  3VH4 B;  3AE3 B;  2IZV B;  4L2Y A;  5D3I B;  1N61 A;  1AAR A;  1YX6 B;  4ZRQ A;  1HZ6 A;  3NOB A;  1OQY A;  1ENF A;  2ZW1 A;  3EC8 A;  1WM2 A;  2M4N A;  2DZM A;  4ARC A;  3DBL B;  4ARI A;  3PS6 A;  1SJH D;  1AW7 A;  4FXC A;  1P0R A;  3R66 C;  2KQS A;  3BIN A;  5J18 A;  1C4P A;  4RCO A;  1FMA D;  1J7A A;  2GBM A;  2K8C A;  3VTV A;  1I4P A;  3A9J B;  4P6V F;  1RAX A;  4LTU A;  2V4L A;  3V60 A;  2KJR A;  2PE6 B;  3ZLZ A;  5G5H A;  2NMQ A;  3QC8 B;  1WI0 A;  1WY8 A;  2PVO D;  3DBL I;  2CJN A;  3K9P B;  2KFK B;  3V05 A;  4OZC A;  2E6X A;  5JZE B;  2J0J A;  2MBB B;  2DYM A;  2R2Q A;  2RPV A;  5H92 C;  2IPK D;  3Q8C A;  4HLE A;  3UQB A;  1HTQ A;  3I5J C;  3AEG B;  5EDS A;  3Q8A A;  1YJ1 A;  3VUY A;  2D3C A;  4ANV A;  1TS4 A;  1UZX B;  1I4Q A;  3IFW B;  1DOX A;  4LNO A;  3O65 B;  1T0Q C;  1KLU D;  2KLC A;  1SF0 A;  2I38 A;  2KN5 A;  3T3O A;  1Q5W B;  1BML C;  3JSV B;  2WP9 B;  3B2G A;  1N62 A;  3SFD B;  3IG3 A;  1VLB A;  1P98 A;  2Z8L A;  3APC A;  3V62 A;  4IM3 A;  5LLI A;  5IA7 A;  3P4Q B;  3AE4 B;  2G1E A;  3PGE A;  3TMP B;  3OJ4 B;  1WJU A;  2K6D B;  2JVC A;  1FNU A;  4DHJ D;  2IY1 B;  2N7E A;  4HK2 A;  3BYY B;  2WGS A;  1J0G A;  3Q3O C;  1CZP A;  1WGG A;  4DK5 A;  3OG5 A;  4DQO C;  1UWX A;  2L52 A;  2IO2 B;  2LHE A;  1ET9 A;  4IWP A;  2WXO A;  4I6P A;  1R4N B;  3SU8 X;  1ZXH A;  3MHZ A;  2IO1 B;  2KQ7 A;  4L1B A;  3ML8 A;  1LFD A;  1UBI A;  1D5Z C;  2JT4 B;  3P63 A;  1C78 A;  4W9D A;  2FUH B;  1UEL A;  2PVG C;  4GSW A;  2WX1 A;  2ZJD A;  4MJS B;  2YEP B;  4LCD E;  3JVZ X;  3ZYY X;  5D6J B;  2RDH A;  3PRM B;  1NI2 A;  2KX0 A;  1D3Z A;  1GB1 A;  1Q1O A;  1R4N I;  2JXX A;  4RF1 A;  2WU5 B;  2DX5 B;  2J52 A;  3DWG C;  4QAY A;  2IGG A;  3H7P A;  2IGH A;  2JZZ A;  2H88 B;  2W9N A;  5IP4 D;  3PRE A;  4MGK E;  1Y56 A;  2D3A A;  5L83 A;  1TKE A;  1ZDX A;  1YIW A;  1JCK B;  4K7W A;  4XX5 A;  1B1Z A;  1T6B X;  4DHJ B;  1WX7 A;  2NTS A;  2SAK A;  4G0N B;  1PUT A;  5TSS A;  3GE3 C;  2DZK A;  3P4P B;  2M8S A;  3RNC C;  4PK1 A;  3T3N A;  2BPS A;  3H9D A;  4XDC A;  3RNF C;  2BF8 B;  2CJO A;  3BII D;  4TV3 A;  1JWM D;  4G3X B;  4J6I A;  2WXR A;  3L0W B;  1XF5 L;  2LEK A;  4G50 A;  3AXC A;  1I4G A;  3JYU A;  5DCN A;  2MJD A;  4DBG A;  2KVZ A;  4K1R B;  1TGZ B;  4WJQ A;  3A1Q A;  1QOF A;  1OQQ A;  3J9C A;  2BYT A;  1IBX B;  1STE A;  1MPE A;  4BKT A;  2QMT A;  3MHS D;  2KO3 A;  4M0W A;  3NUH B;  2NVU I;  4TQ0 A;  1QQR A;  2JWZ A;  4YTP B;  1C79 A;  2CS4 A;  5HG2 A;  3AEB B;  1ZOY B;  4ZRI A;  3VRB B;  1I42 A;  4IW0 A;  1L7Y A;  3AV8 A;  3SFE B;  4HPM B;  4HVB A;  3PHX B;  2W55 A;  1WIA A;  1PGX A;  1V1O A;  1S3S G;  1KF6 B;  3JW0 X;  2O2V B;  2X8X X;  2V3N A;  1E90 A;  5IAA C;  2ZEQ A;  2DBY A;  3IVF A;  2A5U A;  3B2F A;  3MC9 A;  2KYW A;  3UIN B;  5BYS A;  2GBJ A;  2BKR B;  2FCN A;  2KX3 A;  2HTM E;  1FIQ A;  1YN5 A;  3Q2A C;  1EWY C;  1F52 A;  3L17 A;  5TR5 A;  1XLQ A;  3QK0 A;  3PZD A;  1LO5 D;  2BBC A;  1IUE A;  2Q5W D;  1SSN A;  1BUI C;  4RGT A;  4HJK A;  1WH3 A;  4XZ4 A;  3W1S A;  4HKQ A;  3L4P A;  2BYE A;  4JQW C;  4X57 B;  4ICV A;  1SGH A;  4A8X C;  3AM9 A;  4PS8 A;  2LVP A;  3U2S C;  1UGM A;  4MGY E;  5BMH A;  3VFK A;  1LQB A;  4BKS A;  4NJ7 A;  1I35 A;  4GDL B;  2ASQ A;  1FRD A;  4WH4 A;  3ENE A;  1E8W A;  3ETR A;  4MM3 A;  1V6E A;  2OJW A;  3TSS A;  3MJ5 A;  4PT5 A;  3ZDM C;  4OZB A;  2J7Q B;  2EMS A;  5LXI B;  4YTN B;  4WWO A;  1L6V A;  4IWQ A;  4Q2J A;  2LXC A;  5FKA C;  2CHX A;  3Q6B A;  4PYU A;  1WGR A;  3GOE A;  3KH0 A;  3TEW A;  3KWL A;  1B9R A;  4A3P A;  1FEH A;  2GI9 A;  3BVG A;  3WCQ A;  3VH3 B;  2N1V A;  2WXJ A;  5EE0 A;  1E5W A;  2BT6 A;  4NJ6 A;  1EF5 A;  2ZVO A;  1QLB B;  4OZA A;  5D2M B;  2Z0E B;  3C19 A;  4BAX A;  1WWT A;  1J8C A;  2WYQ A;  1UD7 A;  4M02 A;  2BWE S;  4M8M A;  4IOI E;  5BMI A;  4KZ0 A;  1EUV B;  1GB4 A;  1QT9 A;  1GOZ A;  3Q3J A;  2IJ0 A;  1D5M C;  4KV2 A;  2LWP A;  3TL5 A;  1DOY A;  3AEF B;  1GUA B;  2GBK A;  3NVY A;  3ZXV A;  2N9X A;  1GC7 A;  1UBQ A;  2BS4 B;  3ZVV A;  1IP9 A;  4M00 A;  1DYQ A;  1RM6 C;  4KVG B;  4NZL B;  2QJL A;  1V49 A;  4LJP B;  4JIO U;  3UI3 A;  1QKZ A;  3LDZ E;  1IYF A;  2QIE B;  4XC2 A;  1WX9 A;  2DAJ A;  4DXG A;  2WDQ B;  4AJW A;  3ZGZ A;  1L2N A;  4XWT A;  3EEC A;  1V1P B;  3UQA A;  1R4M B;  2K5P A;  2G9H D;  1YOV B;  2KDF B;  1I4H A;  1VR9 A;  2HTH A; 
#chains in the Genus database with same CATH homology
 4M02 A;  4M00 A;  2KT7 A;  2KVZ A;  4M01 A;  2KYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...