2KVZA

Structure of residues 161-235 of putative peptidoglycan binding protein lmo0835 from listeria monocytogenes: target lmr64b of the northeast structural genomics consortium
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
85
structure length
85
Chain Sequence
MDFGKPNQVTVNYLDENNTSIAPSLYLSGLFNEAYNVPMKKIKGYTLLKYDSEILGVFTESPQTINIIYQKKAPEQALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of residues 161-235 of putative peptidoglycan binding protein lmo0835 from Listeria monocytogenes: target LmR64B of the Northeast Structural Genomics Consortium
rcsb
molecule keywords IspE
molecule tags Structural genomics, unknown function
source organism Listeria monocytogenes
total genus 12
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06458 MucBP MucBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 2kvzA00
4M01A 4M02A 2KYWA 4M00A 2KVZA 2KT7A
chains in the Genus database with same CATH superfamily
1EF1A 2J0JA 2ZCBA 3HRDD 1LXDA 2O6VB 4W9HA 4WQOB 4LLGM 1FD6A 4II3B 1PYWD 3L0WB 3DBHI 2BWES 1HZ6A 4B6WA 3S2AA 2LVPA 3Q8EA 3L10B 3MC9A 2L8JA 1WMHB 2Y3AA 3IT4B 3PS6A 1DOXA 1AW7A 3DVGY 2KN4A 3V62A 3UIPB 5C1ZA 3SDLC 2R61A 4CYEA 1XCQL 2J0KA 2RDBC 3ETRA 2M17A 5KHQA 2Z0EB 3ZYYX 2HTME 4P7IA 3Q6BA 4BVUC 2BWFA 3PO0A 1V5OA 4ANVA 2UWQA 2QC8A 2CS4A 4LNFA 3GP7A 1GJZA 4I6PA 1C4CA 5EE9A 2PMVA 4K7UA 1P98A 4AS1A 2INNE 4TKNA 3UIOB 1QOAA 3A9KA 4G3XB 4WJQA 2C7HA 4A3PA 3TEXA 4C80A 3ZO5B 1A70A 3VUYA 2IYDB 3T8MA 4NJCA 3KW5B 2AYOB 2NBWB 4IW0A 3RNBC 2WXHA 4RMAA 1Y56A 2FIFA 3N1XC 5G55A 1FMAD 3TCAA 3VHTC 3QJZA 2JY6A 2HJ8A 2KJRA 1TTNA 4LDTB 3JVZX 3RZWC 2IO2B 3HM3A 2RMMA 1ZDVA 3TEZA 1EM7A 1ZOYB 3QAQA 1FNVA 1D3ZA 2ON8A 3PSEB 2WS3B 4FJZA 1V2YA 4ZRPA 4TV3A 2VZKB 2L52A 1P1AA 5GMVA 1LO5D 3R66C 2Z59B 2B76B 1E0ZA 1I35A 4HWIB 2R2QA 4MGKE 3DOWA 4C7ZA 3BYYB 3JSVB 4W9KA 3AE8B 5IP4D 1YMHE 1P0RA 2I1KA 1WSPA 3QCAA 4NJ6A 2WHIA 4TQ0A 2W55A 3OJ3A 1H8CA 3EECA 3V6EB 1ET6A 2K3UA 4GOCA 2V0GA 2K8BA 4ICUA 4NPNA 3EGRA 5AUKA 1BXTA 1D4BA 1WX7A 2IY1B 4URKA 4DHJB 1LQBA 4L23A 1T0QC 3TJPA 1EF5A 1D5MC 3V60A 3U2SC 2ASQA 4MGIE 3ZRFA 4EZKA 3CSFA 2JXXA 3I9V1 1KFYB 4DDID 4G0NB 4HXDA 2LFIA 4NQLB 2AWTA 5I4DA 2FAZA 4GIVA 1VD2A 2L7RA 1L5PA 5JHBA 4EEWA 2QCZA 1WGRA 4LNIA 5IN7A 1CJEA 1FCCC 1Z2MA 4MGZE 3U30A 3R8BA 2KDMA 2K6QA 5CHFA 1KTKA 3V3XA 2DYMA 3UINB 1WYGA 2HD5B 2OJWA 5DPWA 3Q3MC 2C60A 4FXCA 1STEA 2AX5A 4O1NA 1BT0A 3PRMB 2JQRB 4NZLB 1WGDA 1QILA 2K6DB 1WY8A 4A6QA 3KH0A 3WANA 1T5XD 2I1JA 5CHWA 3PRZA 4D2KA 3PV1A 3T3NA 2L83A 4HKZE 2HTHA 3N1ZC 3L4PA 1B9RA 2KTRB 1K51A 2REXA 3CWIA 4RFBA 2KKCA 3BK1A 5BMHA 3P4QB 2LWPA 1P9DU 1YN3A 4M0WA 1JWSD 3LXFA 2V4IB 3DBSA 1SXTA 2KWUB 5L83A 4OVVA 1L2NA 4C4VB 1ZKHA 1E6EB 3PPAA 3Q8BA 4KDIC 1QQRA 4GDKB 4YSXB 4WQMA 4ZHOA 5CTRC 3KUDB 3LB8C 3FKYA 3X23A 2RSUA 1XO3A 4JPSA 2K8HA 4FLHA 3B08A 4JL9A 4A8XC 4W9CA 3IHPC 1V49A 2PE6B 1E7PB 1ZUD2 1YJJA 5C23A 3RFZB 1F2RI 2A4ZA 2PEAA 4MJSA 1NENB 2KVRA 2KMMA 3VR9B 3VTUA 4GLSC 4MDKE 3SU8X 4IDIA 1KLGD 1QKZA 3PHXB 1SB3C 1NBFC 1WIAA 2VH2A 1WGGA 4W9FA 1C77A 1C4AA 2IGDA 2DHZA 4NAWA 3I3TB 2OEDA 4JX1C 1ZXHA 1C79A 1V1OA 1R7SA 4DHZE 3GB1A 3EFCA 2BGFA 1YQ3B 1PGXA 1IYFA 1WJUA 3RNEC 4MJSB 3DBRB 1P3QU 1ZDXA 1L6VA 1B1ZA 3VRBB 5IA7A 1K52A 1N5XA 3CSTA 1IP9A 4KGSA 2LJ5A 2CJOA 2QIEB 4XYCA 1FO4A 2KN5A 1RFAA 5CHVC 2INPE 1UNSA 3QQ8B 2BKFA 4NAWB 2CKHB 4C56C 4RCOA 4KKJA 3DCGA 2V1YA 3MHZA 1ESFA 3AEFB 3AH7A 1TBEA 3TBLD 4A3OA 4OW0A 2O2VB 1SJED 4P16A 2N0SB 1WRDB 3TSSA 5EE1A 2LJIA 2M1MA 4IWQA 2BS2B 1LGRA 4KSKC 4PS7A 4M8MA 1TKEA 3Q14C 3M95A 3A4RA 2PE9A 2B3AA 2D11A 3B1LX 3UGBB 1R4NI 2W3RA 1XD3B 3GOEA 3ALBA 4BKSA 2G3QB 3M62B 3RNGC 4GMVA 1GB1A 3NS8A 1C78A 3ML9A 4B0MA 2DAJA 2INDC 2WXOA 2NS5A 1F9JA 1TY0A 2FCNA 5BMGA 5DPRA 3RUIB 3ZJUA 2KDBA 3RD2A 2LEKA 4AUQC 2AL6A 2MJ3A 1VZ6A 4TUUA 2MWSB 3NZUA 2BB6A 3BVMA 3OWEB 1MG8A 5E6OA 4AJWA 2D07B 2WX0A 1C1YB 3HUIA 2RDHA 5AEKB 1WFYA 2JPHA 5H92C 1JW9D 1V1PA 4XDCA 1FNUA 4N9F4 4BFRA 2K5PA 4GSWA 3P2BA 3ZW3A 3VDZA 2YVCA 4E71A 4WWPA 2CU1A 4TSSA 1XLNA 3ZVVA 3W5UB 3PVLA 3Q3NC 3EHVA 4EUTA 2OOBB 3OLMD 1FXTB 1CMXB 2MEKA 1Q5WB 3SEBA 2KK8A 2LGYA 3Q3FA 1WGKA 2BYFA 1WH3A 4L1BA 1V1PB 4ANWA 1X1MA 1OQYA 1SF0A 1WF9A 3Q8CA 4YWGG 2JU6X 2LRUA 3P1MA 4HROA 1TYGB 3TEWA 3ZNHB 2KFKA 3Q8AA 1UZXB 5MPOA 1FFVA 1VZ8A 2O6VA 3MFGA 3GZNI 1AWDA 3Q2AC 4HJKA 3OAWA 1P7FA 5GXGB 1QOFA 2L1AA 4H2AA 4LJOB 5E6NA 3W1YA 2VRRB 3AE4B 2JYEA 1WMHA 3NRZA 3AE5B 4W9IA 3H1UA 3AMZA 2M19A 3DVNV 4FN2A 4ANXA 2ZPNA 4IM3A 1E90A 3AEDB 4ZDVA 2MH7A 2LGDA 3U7ZA 4WIPA 2KFKB 3PLVA 4K81A 3N32A 1I4XA 1WXVA 3LYYA 4HJGE 3U7DA 2C5LC 1TS2A 3K9PB 3AXCA 1R4MI 1SIJA 2QMTA 2ZVNA 2KNBA 1E8YA 1C3TA 5JZEB 2J42A 2D3AA 2LD9A 3NVVA 4BOSC 3TEYA 1N63A 1GG3A 2IDYA 2INCC 1EO6A 1WE6A 3ABVB 3VTWA 2KJHB 2IJ0A 2LHDA 5G5GA 4ZHPA 1JWBD 1K50A 4J6IA 3VAWA 1DYQA 3W9CB 2XN9C 3BVGA 3PTFC 4KV2A 5J17A 5C2TB 3NY5A 3DWGC 4HPMB 3DBHB 3DBLB 2QHOA 1V97A 1V81A 2DYOA 2M4NA 5E6PA 2Y5BB 2JRIB 2CU3A 3RN9C 2UYZB 1UELA 3AE7B 3J9CA 1XQQA 3ZNID 1TGZB 2WDRB 2PVGC 3WALA 4PYUA 1WR6E 4MT5A 1WJ4A 2HDEA 2KVZA 3RMKC 5HHDG 3JSVA 1VJKA 2MX2A 2WXQA 2MBEA 4RH6A 3I5JC 1ZE3D 2RDGA 1QLBB 2TSSA 3QC8B 2PPHA 4TMAB 1MPEA 4HLEA 1L0XB 4NY0A 2Z0DB 3NVZA 2AL3A 4IOIE 2GBMA 4NJ7A 2EKIA 1E8ZA 3NUHB 3ECIA 1SSNA 4L2YA 2WXJA 2GBKA 3URYA 4MH8A 4MELA 3ZTDA 1ACCA 4RNAA 4NQKE 2NMQA 1E8XA 5AZGA 3ZLZA 4HDOA 4XWWA 2KT7A 1GC6A 2L0FA 3ZXVA 4JLCA 2PLPA 3C0RB 2PW9A 3ENEA 1F2RC 2CHWA 1HTQA 2D3BA 5CX3A 1VR9A 1L7YA 2J53A 3AE9B 1XCTL 3HVDA 2KDFB 1OEYA 1SJHD 4LNKA 2ZEQA 5HI1A 2AQ2B 3HHMA 3ZNZB 3U8ZA 5BYSA 5AZFA 2G45B 2JT4B 4RGNA 1CQVA 1I42A 3A1QA 2LMCA 1JQ4A 3TL5A 4GDLA 2JRHA 3L54A 4N6EB 1E8WA 1SE9A 4CHKA 2NTTA 3DVNU 1I4QA 1V86A 2RPQA 2ZPYA 1XLPA 2N4FA 3M63B 3PZDA 2BB5A 4LCDE 4ZOHC 3UQAA 2JSVX 2WU5B 2NCNA 1FIQA 1GOZA 2KMAA 2JZZA 1I4PA 3VUXA 4PS3A 2KYWA 1Z5SB 3EA6A 5EE3A 2KQ7A 2KMCA 2K1FA 3A1QB 3DVGX 1OFFA 3E56A 1RFKA 4GDLB 4S17A 4HCNB 3UF8A 1Q0WB 1T6BX 1L0VB 5TSSA 4CO7A 3BK2A 1Y8RC 2KTRA 2KXJA 3AEGB 1AN8A 2JF5A 3P4RB 4KVGB 2D3GA 1H4RA 3NS1A 4FJYA 2BS4B 4G11A 1HXYD 4DBGA 2J7QB 3A33B 2PJHA 3WIMA 2YEPF 4WWNA 1JRPA 4C4VA 3Q3OC 4FADA 2EMTA 1KJTA 2ZNVC 1OTRB 4WWOA 3DPDA 3VFKA 1VZ7A 1I4HA 4NNJB 3NVWA 1IPGA 4GDKA 2LXCA 1IGDA 3T9LA 1KRHA 3QK0A 2N7EA 5IO9A 1QOBA 1TZOA 1N61A 4US9A 1JROA 3AE3B 4WAFA 3NOBA 4ZYSA 4DXAB 4JWSC 4MH0E 2IPKD 2MQJA 1NYQA 3X0WA 1OQRA 4DQOC 1GB4A 5EDSA 4W9LA 4KDLB 2BTEA 1L4ZB 3B2FA 3L17A 2MLBA 4C7YA 2MW5A 2IGGA 1UGMA 2KDIA 1KH0A 4XDDA 2L3ZA 4HEA1 3AM9A 2LZ6A 4KX6B 4MEMA 1MG4A 5JH5C 4RF0A 4K7SA 1MHXA 3QA8A 2DENB 4XE0A 1F52A 3RCZA 3NHEB 3RULA 2W3SA 1XXGA 4FHKA 1FXAA 2LUMA 2NPTB 4W9JA 1E5WA 2CR5A 2J4XA 4PK1A 1YN4A 2FUHB 3AE2B 2KC2A 3M3JA 2MSED 4JWUC 1FNWA 2PKOA 4DK5A 2GLSA 2KZRA 2K39A 4F7ZA 3W2DA 1ZP0B 2GOWA 2KAJA 3Q8FA 4XC2A 3ZDMC 3IT6B 1TKGA 2A5UA 3I63C 4ZYNA 3TUOA 3ZUNA 2W9NA 2ZJDA 1YJIA 3BINA 3LDZE 3SFDB 4AQ7A 3RPFC 1JWAD 5KHOA 2VH1A 3EFUA 2OHFA 2ZW1A 5LLIA 1KLUD 1CK1A 1MVKA 1TS4A 2WLBA 2K0PA 2O2VA 2LVQA 3EC8A 2WQYB 2WDTB 3H8HA 2Y5CA 3PREA 2V3SA 3L16A 1YOVB 2CHZA 5D3IB 1J0GA 4PYZA 2FUG1 3B2GA 3Q69A 3ONSA 1I4GA 2NBVB 3MJWA 4MACA 4YSYB 4MM3B 2NBUA 3U4EG 4Q2JA 2BS3B 1VCBA 4J3OD 3BZDB 1BUIC 4PS8A 2MBHA 4RGOS 2M0AA 1WM2A 3KUCB 3DDCB 4A9AA 4HCPB 2N7JA 3NZSA 4KGTA 3FILB 4K3CA 4WAAA 5BYQA 4GN1A 1PFDA 4GU2A 3W1SC 3AN1A 1Q10A 1UWMA 4E74A 2WX1A 3MP9A 1UBQA 4WJPA 3ML8A 2IO1B 1RRBA 1IBXB 2WXKA 3N1YC 2DLBA 3IXSA 2L0TA 1EU4A 1XLQA 1KLVA 3NVYA 2MBOA 3AE6B 4AJYB 2G1EA 2WXNA 4CQNA 3KQ4A 5DCNA 3A9JB 4AOFA 4W9DA 2XBBC 4DDGD 5L95C 4DXFA 3PGEA 5HG2A 5IAAC 1ZXIA 1FM0D 1XT9B 1JRUA 4DWFA 4MGYE 2DNFA 1UBIA 3B9JA 2BVCA 1MI0A 3H7SA 1R4NB 1SEBD 2J0MA 2ZNVB 1V9JA 3BWUD 1NDDA 2SAKA 2K8CA 4M8NA 1ZPSA 4ITKA 4LNOA 3TMPB 4BBNF 5BYRA 3WAOA 2DAFA 3I57A 4HPPA 1E7VA 2KWDA 3LJ3A 1QF6A 1N62A 1WWTA 5D2MB 1SE4A 4C00A 4HVBA 4B0EA 1DOIA 1WI0A 3PZ7A 1V8CA 3FC4A 1GAQB 2JVCA 1V6EA 4YL8A 1PGAA 3R3MA 1EWYC 2AQ1B 3P4PB 4RM9A 2HE7A 2N1WA 2KANA 3CF6E 2FBWB 4LK0M 2RR9A 2EKEC 4A20A 2MJEA 5TR5A 1PQSA 1I4RA 2FCQA 3PZ8A 2KLCA 3P42A 2KHWB 2KD0A 4XGAB 1LM8B 2DZJA 3SD5A 3KLSX 2GBJA 2C9WB 2JX5A 1M4VA 2BW2A 4BKSD 2WXGA 1PDXA 3WAPA 2G9HD 1WZ3A 1P7EA 2ZVOA 1U4AA 5D94A 1UH6A 2ICIA 4K1RB 1UUPA 2PIAA 2ZZPB 4ARCA 4EFOA 2IO3B 3IFWB 4M01A 2DZMA 4ICVA 2M0XA 3AEBB 4KGRA 1E10A 2BYTA 4JQWC 2KDEB 2WXIA 1RYJA 1ENFA 5JXVA 1WXQA 3RNAC 4UDUC 2BKRB 2EMSA 3L08A 3GE3C 1J19A 4I6NB 2JWZA 3IBEA 3UI3A 1YJ1A 5G5HA 2MP2B 5FK9C 2RPVA 4OZBA 1YN5A 4PT5A 3ZTCA 3AB5A 3AI5A 3U52E 2MHJA 4KZ0A 1WR1A 2KC1A 3ZRCA 2IBIB 1VDVA 1EWCA 3AEEB 2G4DB 5C3JB 1N60A 4KKIA 4A90A 1NI2A 5EE0A 1NVID 3D32A 2C7MB 3DBLI 3ZIMA 3HIZA 2L76A 3HK0A 2RD0A 3QARA 3VH3B 4FHJA 4P1BC 5FR3A 1YD8U 1R4MB 1HTOA 4OVZA 2JUOA 3C19A 2KOXA 4DHZB 2CHXA 1EUVB 1TS5A 3JW0X 4I6LB 2X8XX 3ZKJC 3ZNGC 3A4SC 2KQ4X 4IM2A 4KZCA 3SHQA 2WNMA 2BT6A 2D3CA 2XEWA 2O6VD 3DWMA 1N5WA 4TQ1A 3AEAB 2WDQB 4IWOA 2ONQA 4FJVB 1SGHA 2LGSA 2PVOD 1FEHA 4WJOA 1XF5L 3NJTA 4YTNB 1C4PA 3BY4B 4ANUA 1TKYA 2JWUA 2FE8A 3V05A 1T0YA 4A55A 2LRWA 3MC8A 3ZJVA 2UU7A 1S1QB 3FAHA 3PRPB 3DHHC 3GS2A 2WP9B 1WX8A 2BBCA 2IY0B 1WXAA 4EE2A 4ZRQA 3IAS1 2LUEA 1SE3A 2GBRA 4P1CC 1E7UA 4IKGA 1YX6B 3A9KB 3ZQ4A 2KACA 4K7WA 5DPTA 2LGXA 4LNNA 3P4SB 3ZDTA 1MFWA 3QX1A 3IVFA 2WXMA 2DZKA 3E9SA 2KO3A 3ZXRA 2JZPA 1GC7A 4GB9A 1HQRD 2KFJA 2LI5A 5J2RA 2L05A 3UQBA 1K8RB 2X38A 2FIDA 2Q5WD 4LDTD 3KWVA 1J8CA 3VQIA 4M02A 2EELA 1S3SG 2MJDA 2E3TA 5FKAC 4JGHB 3N30A 2GBNA 1N6ZA 2VZKD 1G6JA 2GB1A 3HM6X 4B9KA 4LJPB 1OEYJ 3BYTB 1D5ZC 3VTVA 3PT2B 5BMIA 2SEBD 3VH4B 1PGBA 3GE8C 4OHJA 1RAXA 4B95A 1L6UA 2Z8LA 3APCA 4FULA 4IG7B 4OVUA 2ACZB 1WM3A 2MRPA 3C8YA 5HKHA 4KIKA 1UF0A 3VVWB 2XK5A 2NVUI 4AWJA 1HEZE 5D7GA 2L32A 4N58A 5H8YE 4K3BA 1FFUA 4JIOU 1T0RC 2N9PC 2H89B 2KWVB 2QJLA 4MSMB 3NG0A 3L13A 3QHTA 3DHIC 1QT9A 1TY2A 4DHJD 1QZEA 1UD7A 2AEHA 3MC0B 4HKQA 4HRSA 2DYBA 1T3QA 1MHHE 1WE7A 1RLFA 2D2QA 1JWMD 3N20C 4KIKB 2XK5B 3MHSD 1RWSA 2N1VA 1AARA 2LXAA 2HJ1A 3HVZA 1WJ6A 2WYQA 2QILA 4YXDB 1FPYA 1SE2A 3AU5A 2WXLA 2NPTA 4ZRKA 1ROEA 1AYFA 1WGHA 2V9HA 2KLGA 4RF1A 2WU2B 4IUMB 2MA9B 4IM0A 2LGIA 3R2TA 4FA6A 1C76A 3RZFA 4ZRJA 5BO4B 1FRDA 1TT5B 5G2NA 1YQ4B 1WX9A 2WWZA 4E3CA 4XX5A 2YEPB 1GPXA 3KYCD 4JE3B 1J7CA 4R3DA 1LFDA 3B0AA 4QAYA 2J52A 2JXTA 3AE1B 4BBNC 3Q3JA 1NEKB 1T0SC 2YLMA 1NI3A 5JHAA 2QEJC 4EOYA 2IGHA 5E6JA 1SBBB 4RGMA 2KWCA 2GI9A 5LNK1 3CIRB 2OJRA 3R7QA 1VLBA 2LASA 2KJ6A 3KYDD 3WCQA 3H7PA 2GMIC 4M0WB 5HFYA 1V80A 2MBQA 4ACFA 4MM3A 1WRIA 2I38A 3PLUA 4WJNA 2DWQA 3DBRI 4BZAA 2W54A 2WXFA 4X57B 5AUIA 1HA5A 2DZIA 1JWUD 2AQ3B 3K9OB 4IWPA 3VUWA 1MJDA 3IAM1 4YTPB 1WXMA 2K25A 3FILA 1HE8A 1KF6B 2WXPA 1WZ0A 3N3KB 1TJEA 1EU3A 2IZVB 3H7PB 1YQBA 2N7DA 4GGQA 4HK2A 2BYVE 3CMMB 3KWLA 4YSZB 2K9XA 1ZW7A 1V5TA 1IBXA 1FXIA 4F8CB 3AECB 4YT0B 4EZLA 4XZ4A 3WA0A 2I2YA 1XLOA 2NR2A 1Q1OA 2N9EB 1PUTA 1ISNA 1J7BA 1WYWB 3RNFC 1D5XC 3A9JA 2K22A 5FR6A 1NYRA 4M00A 3V6CB 3VXWA 1QOGA 1CZPA 1IGCA 2DX5B 4S0RA 5T8IA 3O13A 4ARIA 2NTSA 1UWXA 3QWZB 2R2OA 2E6XA 3BIID 1DGJA 2MCNB 2LHEA 2QDFA 1GUAB 2FCSA 2W82A 1L0YB 1C9FA 1BMLC 3H6NA 1A5RA 3P63A 4BOZB 1J7AA 2KX0A 2N9LA 4BKGA 2QSDA 3AULA 4USAA 4NAMA 2M8SA 4REZA 1YIWA 5D6JB 3QIJA 3N9YC 1KOTA 3H9DA 4OZCA 5DPSA 3SR6A 3VR8B 3MTNB 1TS3A 3RNCC 3BVZA 3TIXA 1JMLA 2WXRA 2H88B 4WWMA 2LVOA 4WH4A 3V61A 1HZ5A 1UGJA 4KSLC 2XNAC 1YNTE 3O65B 4HPLB 1WGYA 1L4DB 3SFEB 1DOYA 2V4LA 2D5GA 3AU4A 1FCLA 2IO0B 2JZ3B 1XEEA 3APFA 1OQQA 1I7HA 3DHGC 4F1SA 4N59A 4WURA 5IKCM 4MSQB 3VRAB 1ZGUB 3WAMA 4BAXA 3OG5A 1WJNA 3R2IA 2RGFA 2N9KA 1JALA 5LXIB 4ASWC 1YX5B 2DBYA 2KX3A 1E9MA 1SIFA 4II2B 3RI7C 3ZJTA 2WDVB 4IC7B 1OGWA 3OJ4B 1FRRA 4G50A 2BQQA 2C7NB 4DXGA 2V3NA 2M56B 1RM6C 2ZW0A 3PHWB 3EUB2 1TZ1A 1IUEA 4GXBA 3DQVA 1JCKB 3APDA 4HDQA 4US8A 2WGSA 4W9EA 5J18A 2V3PA 2PTLA 3MJ5A 1F77A 5AZHA 2FCMA 2MP2A 2FNJB 1D6EC 2D10A 4XWTA 4LTUA 1F1HA 4EZJA 4ZRIA 1TIFA 2Y5PA 2MBBB 3ZGZA 2G4SA 2BF8B 3RT3B 3IG3A 1ET9A 5LXHA 2N9XA 4P6VF 4FBJB 3KVFB 1F0ZA 2KTFA 4W9GA 3NZ3A 1M94A 1K53A 2BPSA 2GRIA 3RYTA 2BYEA 2CJNA 2ZCCA 4RGTA 4EKUA 4RM8A 2KQSA 3AV8A 3GZNB 5IOIA 3KUZA 1KM7A 1WXSA 4AP4C 2L00B 1GNUA 3R7RA 4BKTA 3W1SA 3T3OA 3JYUA 1VRAB 3W5VB 4OZAA 2JYTA 5D3DA 4YTMB
chains in the Genus database with same CATH topology
4M01A 4M02A 2KYWA 4M00A 2KVZA 2KT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M01 A;  4M02 A;  2KYW A;  4M00 A;  2KVZ A;  2KT7 A; 
#chains in the Genus database with same CATH topology
 1EF1 A;  2J0J A;  2ZCB A;  3HRD D;  1LXD A;  2O6V B;  4W9H A;  4WQO B;  4LLG M;  1FD6 A;  4II3 B;  1PYW D;  3L0W B;  3DBH I;  2BWE S;  1HZ6 A;  4B6W A;  3S2A A;  2LVP A;  3Q8E A;  3L10 B;  3MC9 A;  2L8J A;  1WMH B;  2Y3A A;  3IT4 B;  3PS6 A;  1DOX A;  1AW7 A;  3DVG Y;  2KN4 A;  3V62 A;  3UIP B;  5C1Z A;  3SDL C;  2R61 A;  4CYE A;  1XCQ L;  2J0K A;  2RDB C;  3ETR A;  2M17 A;  5KHQ A;  2Z0E B;  3ZYY X;  2HTM E;  4P7I A;  3Q6B A;  4BVU C;  2BWF A;  3PO0 A;  1V5O A;  4ANV A;  2UWQ A;  2QC8 A;  2CS4 A;  4LNF A;  3GP7 A;  1GJZ A;  4I6P A;  1C4C A;  5EE9 A;  2PMV A;  4K7U A;  1P98 A;  4AS1 A;  2INN E;  4TKN A;  3UIO B;  1QOA A;  3A9K A;  4G3X B;  4WJQ A;  2C7H A;  4A3P A;  3TEX A;  4C80 A;  3ZO5 B;  1A70 A;  3VUY A;  2IYD B;  3T8M A;  4NJC A;  3KW5 B;  2AYO B;  2NBW B;  4IW0 A;  3RNB C;  2WXH A;  4RMA A;  1Y56 A;  2FIF A;  3N1X C;  5G55 A;  1FMA D;  3TCA A;  3VHT C;  3QJZ A;  2JY6 A;  2HJ8 A;  2KJR A;  1TTN A;  4LDT B;  3JVZ X;  3RZW C;  2IO2 B;  3HM3 A;  2RMM A;  1ZDV A;  3TEZ A;  1EM7 A;  1ZOY B;  3QAQ A;  1FNV A;  1D3Z A;  2ON8 A;  3PSE B;  2WS3 B;  4FJZ A;  1V2Y A;  4ZRP A;  4TV3 A;  2VZK B;  2L52 A;  1P1A A;  5GMV A;  1LO5 D;  3R66 C;  2Z59 B;  2B76 B;  1E0Z A;  1I35 A;  4HWI B;  2R2Q A;  4MGK E;  3DOW A;  4C7Z A;  3BYY B;  3JSV B;  4W9K A;  3AE8 B;  5IP4 D;  1YMH E;  1P0R A;  2I1K A;  1WSP A;  3QCA A;  4NJ6 A;  2WHI A;  4TQ0 A;  2W55 A;  3OJ3 A;  1H8C A;  3EEC A;  3V6E B;  1ET6 A;  2K3U A;  4GOC A;  2V0G A;  2K8B A;  4ICU A;  4NPN A;  3EGR A;  5AUK A;  1BXT A;  1D4B A;  1WX7 A;  2IY1 B;  4URK A;  4DHJ B;  1LQB A;  4L23 A;  1T0Q C;  3TJP A;  1EF5 A;  1D5M C;  3V60 A;  3U2S C;  2ASQ A;  4MGI E;  3ZRF A;  4EZK A;  3CSF A;  2JXX A;  3I9V 1;  1KFY B;  4DDI D;  4G0N B;  4HXD A;  2LFI A;  4NQL B;  2AWT A;  5I4D A;  2FAZ A;  4GIV A;  1VD2 A;  2L7R A;  1L5P A;  5JHB A;  4EEW A;  2QCZ A;  1WGR A;  4LNI A;  5IN7 A;  1CJE A;  1FCC C;  1Z2M A;  4MGZ E;  3U30 A;  3R8B A;  2KDM A;  2K6Q A;  5CHF A;  1KTK A;  3V3X A;  2DYM A;  3UIN B;  1WYG A;  2HD5 B;  2OJW A;  5DPW A;  3Q3M C;  2C60 A;  4FXC A;  1STE A;  2AX5 A;  4O1N A;  1BT0 A;  3PRM B;  2JQR B;  4NZL B;  1WGD A;  1QIL A;  2K6D B;  1WY8 A;  4A6Q A;  3KH0 A;  3WAN A;  1T5X D;  2I1J A;  5CHW A;  3PRZ A;  4D2K A;  3PV1 A;  3T3N A;  2L83 A;  4HKZ E;  2HTH A;  3N1Z C;  3L4P A;  1B9R A;  2KTR B;  1K51 A;  2REX A;  3CWI A;  4RFB A;  2KKC A;  3BK1 A;  5BMH A;  3P4Q B;  2LWP A;  1P9D U;  1YN3 A;  4M0W A;  1JWS D;  3LXF A;  2V4I B;  3DBS A;  1SXT A;  2KWU B;  5L83 A;  4OVV A;  1L2N A;  4C4V B;  1ZKH A;  1E6E B;  3PPA A;  3Q8B A;  4KDI C;  1QQR A;  4GDK B;  4YSX B;  4WQM A;  4ZHO A;  5CTR C;  3KUD B;  3LB8 C;  3FKY A;  3X23 A;  2RSU A;  1XO3 A;  4JPS A;  2K8H A;  4FLH A;  3B08 A;  4JL9 A;  4A8X C;  4W9C A;  3IHP C;  1V49 A;  2PE6 B;  1E7P B;  1ZUD 2;  1YJJ A;  5C23 A;  3RFZ B;  1F2R I;  2A4Z A;  2PEA A;  4MJS A;  1NEN B;  2KVR A;  2KMM A;  3VR9 B;  3VTU A;  4GLS C;  4MDK E;  3SU8 X;  4IDI A;  1KLG D;  1QKZ A;  3PHX B;  1SB3 C;  1NBF C;  1WIA A;  2VH2 A;  1WGG A;  4W9F A;  1C77 A;  1C4A A;  2IGD A;  2DHZ A;  4NAW A;  3I3T B;  2OED A;  4JX1 C;  1ZXH A;  1C79 A;  1V1O A;  1R7S A;  4DHZ E;  3GB1 A;  3EFC A;  2BGF A;  1YQ3 B;  1PGX A;  1IYF A;  1WJU A;  3RNE C;  4MJS B;  3DBR B;  1P3Q U;  1ZDX A;  1L6V A;  1B1Z A;  3VRB B;  5IA7 A;  1K52 A;  1N5X A;  3CST A;  1IP9 A;  4KGS A;  2LJ5 A;  2CJO A;  2QIE B;  4XYC A;  1FO4 A;  2KN5 A;  1RFA A;  5CHV C;  2INP E;  1UNS A;  3QQ8 B;  2BKF A;  4NAW B;  2CKH B;  4C56 C;  4RCO A;  4KKJ A;  3DCG A;  2V1Y A;  3MHZ A;  1ESF A;  3AEF B;  3AH7 A;  1TBE A;  3TBL D;  4A3O A;  4OW0 A;  2O2V B;  1SJE D;  4P16 A;  2N0S B;  1WRD B;  3TSS A;  5EE1 A;  2LJI A;  2M1M A;  4IWQ A;  2BS2 B;  1LGR A;  4KSK C;  4PS7 A;  4M8M A;  1TKE A;  3Q14 C;  3M95 A;  3A4R A;  2PE9 A;  2B3A A;  2D11 A;  3B1L X;  3UGB B;  1R4N I;  2W3R A;  1XD3 B;  3GOE A;  3ALB A;  4BKS A;  2G3Q B;  3M62 B;  3RNG C;  4GMV A;  1GB1 A;  3NS8 A;  1C78 A;  3ML9 A;  4B0M A;  2DAJ A;  2IND C;  2WXO A;  2NS5 A;  1F9J A;  1TY0 A;  2FCN A;  5BMG A;  5DPR A;  3RUI B;  3ZJU A;  2KDB A;  3RD2 A;  2LEK A;  4AUQ C;  2AL6 A;  2MJ3 A;  1VZ6 A;  4TUU A;  2MWS B;  3NZU A;  2BB6 A;  3BVM A;  3OWE B;  1MG8 A;  5E6O A;  4AJW A;  2D07 B;  2WX0 A;  1C1Y B;  3HUI A;  2RDH A;  5AEK B;  1WFY A;  2JPH A;  5H92 C;  1JW9 D;  1V1P A;  4XDC A;  1FNU A;  4N9F 4;  4BFR A;  2K5P A;  4GSW A;  3P2B A;  3ZW3 A;  3VDZ A;  2YVC A;  4E71 A;  4WWP A;  2CU1 A;  4TSS A;  1XLN A;  3ZVV A;  3W5U B;  3PVL A;  3Q3N C;  3EHV A;  4EUT A;  2OOB B;  3OLM D;  1FXT B;  1CMX B;  2MEK A;  1Q5W B;  3SEB A;  2KK8 A;  2LGY A;  3Q3F A;  1WGK A;  2BYF A;  1WH3 A;  4L1B A;  1V1P B;  4ANW A;  1X1M A;  1OQY A;  1SF0 A;  1WF9 A;  3Q8C A;  4YWG G;  2JU6 X;  2LRU A;  3P1M A;  4HRO A;  1TYG B;  3TEW A;  3ZNH B;  2KFK A;  3Q8A A;  1UZX B;  5MPO A;  1FFV A;  1VZ8 A;  2O6V A;  3MFG A;  3GZN I;  1AWD A;  3Q2A C;  4HJK A;  3OAW A;  1P7F A;  5GXG B;  1QOF A;  2L1A A;  4H2A A;  4LJO B;  5E6N A;  3W1Y A;  2VRR B;  3AE4 B;  2JYE A;  1WMH A;  3NRZ A;  3AE5 B;  4W9I A;  3H1U A;  3AMZ A;  2M19 A;  3DVN V;  4FN2 A;  4ANX A;  2ZPN A;  4IM3 A;  1E90 A;  3AED B;  4ZDV A;  2MH7 A;  2LGD A;  3U7Z A;  4WIP A;  2KFK B;  3PLV A;  4K81 A;  3N32 A;  1I4X A;  1WXV A;  3LYY A;  4HJG E;  3U7D A;  2C5L C;  1TS2 A;  3K9P B;  3AXC A;  1R4M I;  1SIJ A;  2QMT A;  2ZVN A;  2KNB A;  1E8Y A;  1C3T A;  5JZE B;  2J42 A;  2D3A A;  2LD9 A;  3NVV A;  4BOS C;  3TEY A;  1N63 A;  1GG3 A;  2IDY A;  2INC C;  1EO6 A;  1WE6 A;  3ABV B;  3VTW A;  2KJH B;  2IJ0 A;  2LHD A;  5G5G A;  4ZHP A;  1JWB D;  1K50 A;  4J6I A;  3VAW A;  1DYQ A;  3W9C B;  2XN9 C;  3BVG A;  3PTF C;  4KV2 A;  5J17 A;  5C2T B;  3NY5 A;  3DWG C;  4HPM B;  3DBH B;  3DBL B;  2QHO A;  1V97 A;  1V81 A;  2DYO A;  2M4N A;  5E6P A;  2Y5B B;  2JRI B;  2CU3 A;  3RN9 C;  2UYZ B;  1UEL A;  3AE7 B;  3J9C A;  1XQQ A;  3ZNI D;  1TGZ B;  2WDR B;  2PVG C;  3WAL A;  4PYU A;  1WR6 E;  4MT5 A;  1WJ4 A;  2HDE A;  2KVZ A;  3RMK C;  5HHD G;  3JSV A;  1VJK A;  2MX2 A;  2WXQ A;  2MBE A;  4RH6 A;  3I5J C;  1ZE3 D;  2RDG A;  1QLB B;  2TSS A;  3QC8 B;  2PPH A;  4TMA B;  1MPE A;  4HLE A;  1L0X B;  4NY0 A;  2Z0D B;  3NVZ A;  2AL3 A;  4IOI E;  2GBM A;  4NJ7 A;  2EKI A;  1E8Z A;  3NUH B;  3ECI A;  1SSN A;  4L2Y A;  2WXJ A;  2GBK A;  3URY A;  4MH8 A;  4MEL A;  3ZTD A;  1ACC A;  4RNA A;  4NQK E;  2NMQ A;  1E8X A;  5AZG A;  3ZLZ A;  4HDO A;  4XWW A;  2KT7 A;  1GC6 A;  2L0F A;  3ZXV A;  4JLC A;  2PLP A;  3C0R B;  2PW9 A;  3ENE A;  1F2R C;  2CHW A;  1HTQ A;  2D3B A;  5CX3 A;  1VR9 A;  1L7Y A;  2J53 A;  3AE9 B;  1XCT L;  3HVD A;  2KDF B;  1OEY A;  1SJH D;  4LNK A;  2ZEQ A;  5HI1 A;  2AQ2 B;  3HHM A;  3ZNZ B;  3U8Z A;  5BYS A;  5AZF A;  2G45 B;  2JT4 B;  4RGN A;  1CQV A;  1I42 A;  3A1Q A;  2LMC A;  1JQ4 A;  3TL5 A;  4GDL A;  2JRH A;  3L54 A;  4N6E B;  1E8W A;  1SE9 A;  4CHK A;  2NTT A;  3DVN U;  1I4Q A;  1V86 A;  2RPQ A;  2ZPY A;  1XLP A;  2N4F A;  3M63 B;  3PZD A;  2BB5 A;  4LCD E;  4ZOH C;  3UQA A;  2JSV X;  2WU5 B;  2NCN A;  1FIQ A;  1GOZ A;  2KMA A;  2JZZ A;  1I4P A;  3VUX A;  4PS3 A;  2KYW A;  1Z5S B;  3EA6 A;  5EE3 A;  2KQ7 A;  2KMC A;  2K1F A;  3A1Q B;  3DVG X;  1OFF A;  3E56 A;  1RFK A;  4GDL B;  4S17 A;  4HCN B;  3UF8 A;  1Q0W B;  1T6B X;  1L0V B;  5TSS A;  4CO7 A;  3BK2 A;  1Y8R C;  2KTR A;  2KXJ A;  3AEG B;  1AN8 A;  2JF5 A;  3P4R B;  4KVG B;  2D3G A;  1H4R A;  3NS1 A;  4FJY A;  2BS4 B;  4G11 A;  1HXY D;  4DBG A;  2J7Q B;  3A33 B;  2PJH A;  3WIM A;  2YEP F;  4WWN A;  1JRP A;  4C4V A;  3Q3O C;  4FAD A;  2EMT A;  1KJT A;  2ZNV C;  1OTR B;  4WWO A;  3DPD A;  3VFK A;  1VZ7 A;  1I4H A;  4NNJ B;  3NVW A;  1IPG A;  4GDK A;  2LXC A;  1IGD A;  3T9L A;  1KRH A;  3QK0 A;  2N7E A;  5IO9 A;  1QOB A;  1TZO A;  1N61 A;  4US9 A;  1JRO A;  3AE3 B;  4WAF A;  3NOB A;  4ZYS A;  4DXA B;  4JWS C;  4MH0 E;  2IPK D;  2MQJ A;  1NYQ A;  3X0W A;  1OQR A;  4DQO C;  1GB4 A;  5EDS A;  4W9L A;  4KDL B;  2BTE A;  1L4Z B;  3B2F A;  3L17 A;  2MLB A;  4C7Y A;  2MW5 A;  2IGG A;  1UGM A;  2KDI A;  1KH0 A;  4XDD A;  2L3Z A;  4HEA 1;  3AM9 A;  2LZ6 A;  4KX6 B;  4MEM A;  1MG4 A;  5JH5 C;  4RF0 A;  4K7S A;  1MHX A;  3QA8 A;  2DEN B;  4XE0 A;  1F52 A;  3RCZ A;  3NHE B;  3RUL A;  2W3S A;  1XXG A;  4FHK A;  1FXA A;  2LUM A;  2NPT B;  4W9J A;  1E5W A;  2CR5 A;  2J4X A;  4PK1 A;  1YN4 A;  2FUH B;  3AE2 B;  2KC2 A;  3M3J A;  2MSE D;  4JWU C;  1FNW A;  2PKO A;  4DK5 A;  2GLS A;  2KZR A;  2K39 A;  4F7Z A;  3W2D A;  1ZP0 B;  2GOW A;  2KAJ A;  3Q8F A;  4XC2 A;  3ZDM C;  3IT6 B;  1TKG A;  2A5U A;  3I63 C;  4ZYN A;  3TUO A;  3ZUN A;  2W9N A;  2ZJD A;  1YJI A;  3BIN A;  3LDZ E;  3SFD B;  4AQ7 A;  3RPF C;  1JWA D;  5KHO A;  2VH1 A;  3EFU A;  2OHF A;  2ZW1 A;  5LLI A;  1KLU D;  1CK1 A;  1MVK A;  1TS4 A;  2WLB A;  2K0P A;  2O2V A;  2LVQ A;  3EC8 A;  2WQY B;  2WDT B;  3H8H A;  2Y5C A;  3PRE A;  2V3S A;  3L16 A;  1YOV B;  2CHZ A;  5D3I B;  1J0G A;  4PYZ A;  2FUG 1;  3B2G A;  3Q69 A;  3ONS A;  1I4G A;  2NBV B;  3MJW A;  4MAC A;  4YSY B;  4MM3 B;  2NBU A;  3U4E G;  4Q2J A;  2BS3 B;  1VCB A;  4J3O D;  3BZD B;  1BUI C;  4PS8 A;  2MBH A;  4RGO S;  2M0A A;  1WM2 A;  3KUC B;  3DDC B;  4A9A A;  4HCP B;  2N7J A;  3NZS A;  4KGT A;  3FIL B;  4K3C A;  4WAA A;  5BYQ A;  4GN1 A;  1PFD A;  4GU2 A;  3W1S C;  3AN1 A;  1Q10 A;  1UWM A;  4E74 A;  2WX1 A;  3MP9 A;  1UBQ A;  4WJP A;  3ML8 A;  2IO1 B;  1RRB A;  1IBX B;  2WXK A;  3N1Y C;  2DLB A;  3IXS A;  2L0T A;  1EU4 A;  1XLQ A;  1KLV A;  3NVY A;  2MBO A;  3AE6 B;  4AJY B;  2G1E A;  2WXN A;  4CQN A;  3KQ4 A;  5DCN A;  3A9J B;  4AOF A;  4W9D A;  2XBB C;  4DDG D;  5L95 C;  4DXF A;  3PGE A;  5HG2 A;  5IAA C;  1ZXI A;  1FM0 D;  1XT9 B;  1JRU A;  4DWF A;  4MGY E;  2DNF A;  1UBI A;  3B9J A;  2BVC A;  1MI0 A;  3H7S A;  1R4N B;  1SEB D;  2J0M A;  2ZNV B;  1V9J A;  3BWU D;  1NDD A;  2SAK A;  2K8C A;  4M8N A;  1ZPS A;  4ITK A;  4LNO A;  3TMP B;  4BBN F;  5BYR A;  3WAO A;  2DAF A;  3I57 A;  4HPP A;  1E7V A;  2KWD A;  3LJ3 A;  1QF6 A;  1N62 A;  1WWT A;  5D2M B;  1SE4 A;  4C00 A;  4HVB A;  4B0E A;  1DOI A;  1WI0 A;  3PZ7 A;  1V8C A;  3FC4 A;  1GAQ B;  2JVC A;  1V6E A;  4YL8 A;  1PGA A;  3R3M A;  1EWY C;  2AQ1 B;  3P4P B;  4RM9 A;  2HE7 A;  2N1W A;  2KAN A;  3CF6 E;  2FBW B;  4LK0 M;  2RR9 A;  2EKE C;  4A20 A;  2MJE A;  5TR5 A;  1PQS A;  1I4R A;  2FCQ A;  3PZ8 A;  2KLC A;  3P42 A;  2KHW B;  2KD0 A;  4XGA B;  1LM8 B;  2DZJ A;  3SD5 A;  3KLS X;  2GBJ A;  2C9W B;  2JX5 A;  1M4V A;  2BW2 A;  4BKS D;  2WXG A;  1PDX A;  3WAP A;  2G9H D;  1WZ3 A;  1P7E A;  2ZVO A;  1U4A A;  5D94 A;  1UH6 A;  2ICI A;  4K1R B;  1UUP A;  2PIA A;  2ZZP B;  4ARC A;  4EFO A;  2IO3 B;  3IFW B;  4M01 A;  2DZM A;  4ICV A;  2M0X A;  3AEB B;  4KGR A;  1E10 A;  2BYT A;  4JQW C;  2KDE B;  2WXI A;  1RYJ A;  1ENF A;  5JXV A;  1WXQ A;  3RNA C;  4UDU C;  2BKR B;  2EMS A;  3L08 A;  3GE3 C;  1J19 A;  4I6N B;  2JWZ A;  3IBE A;  3UI3 A;  1YJ1 A;  5G5H A;  2MP2 B;  5FK9 C;  2RPV A;  4OZB A;  1YN5 A;  4PT5 A;  3ZTC A;  3AB5 A;  3AI5 A;  3U52 E;  2MHJ A;  4KZ0 A;  1WR1 A;  2KC1 A;  3ZRC A;  2IBI B;  1VDV A;  1EWC A;  3AEE B;  2G4D B;  5C3J B;  1N60 A;  4KKI A;  4A90 A;  1NI2 A;  5EE0 A;  1NVI D;  3D32 A;  2C7M B;  3DBL I;  3ZIM A;  3HIZ A;  2L76 A;  3HK0 A;  2RD0 A;  3QAR A;  3VH3 B;  4FHJ A;  4P1B C;  5FR3 A;  1YD8 U;  1R4M B;  1HTO A;  4OVZ A;  2JUO A;  3C19 A;  2KOX A;  4DHZ B;  2CHX A;  1EUV B;  1TS5 A;  3JW0 X;  4I6L B;  2X8X X;  3ZKJ C;  3ZNG C;  3A4S C;  2KQ4 X;  4IM2 A;  4KZC A;  3SHQ A;  2WNM A;  2BT6 A;  2D3C A;  2XEW A;  2O6V D;  3DWM A;  1N5W A;  4TQ1 A;  3AEA B;  2WDQ B;  4IWO A;  2ONQ A;  4FJV B;  1SGH A;  2LGS A;  2PVO D;  1FEH A;  4WJO A;  1XF5 L;  3NJT A;  4YTN B;  1C4P A;  3BY4 B;  4ANU A;  1TKY A;  2JWU A;  2FE8 A;  3V05 A;  1T0Y A;  4A55 A;  2LRW A;  3MC8 A;  3ZJV A;  2UU7 A;  1S1Q B;  3FAH A;  3PRP B;  3DHH C;  3GS2 A;  2WP9 B;  1WX8 A;  2BBC A;  2IY0 B;  1WXA A;  4EE2 A;  4ZRQ A;  3IAS 1;  2LUE A;  1SE3 A;  2GBR A;  4P1C C;  1E7U A;  4IKG A;  1YX6 B;  3A9K B;  3ZQ4 A;  2KAC A;  4K7W A;  5DPT A;  2LGX A;  4LNN A;  3P4S B;  3ZDT A;  1MFW A;  3QX1 A;  3IVF A;  2WXM A;  2DZK A;  3E9S A;  2KO3 A;  3ZXR A;  2JZP A;  1GC7 A;  4GB9 A;  1HQR D;  2KFJ A;  2LI5 A;  5J2R A;  2L05 A;  3UQB A;  1K8R B;  2X38 A;  2FID A;  2Q5W D;  4LDT D;  3KWV A;  1J8C A;  3VQI A;  4M02 A;  2EEL A;  1S3S G;  2MJD A;  2E3T A;  5FKA C;  4JGH B;  3N30 A;  2GBN A;  1N6Z A;  2VZK D;  1G6J A;  2GB1 A;  3HM6 X;  4B9K A;  4LJP B;  1OEY J;  3BYT B;  1D5Z C;  3VTV A;  3PT2 B;  5BMI A;  2SEB D;  3VH4 B;  1PGB A;  3GE8 C;  4OHJ A;  1RAX A;  4B95 A;  1L6U A;  2Z8L A;  3APC A;  4FUL A;  4IG7 B;  4OVU A;  2ACZ B;  1WM3 A;  2MRP A;  3C8Y A;  5HKH A;  4KIK A;  1UF0 A;  3VVW B;  2XK5 A;  2NVU I;  4AWJ A;  1HEZ E;  5D7G A;  2L32 A;  4N58 A;  5H8Y E;  4K3B A;  1FFU A;  4JIO U;  1T0R C;  2N9P C;  2H89 B;  2KWV B;  2QJL A;  4MSM B;  3NG0 A;  3L13 A;  3QHT A;  3DHI C;  1QT9 A;  1TY2 A;  4DHJ D;  1QZE A;  1UD7 A;  2AEH A;  3MC0 B;  4HKQ A;  4HRS A;  2DYB A;  1T3Q A;  1MHH E;  1WE7 A;  1RLF A;  2D2Q A;  1JWM D;  3N20 C;  4KIK B;  2XK5 B;  3MHS D;  1RWS A;  2N1V A;  1AAR A;  2LXA A;  2HJ1 A;  3HVZ A;  1WJ6 A;  2WYQ A;  2QIL A;  4YXD B;  1FPY A;  1SE2 A;  3AU5 A;  2WXL A;  2NPT A;  4ZRK A;  1ROE A;  1AYF A;  1WGH A;  2V9H A;  2KLG A;  4RF1 A;  2WU2 B;  4IUM B;  2MA9 B;  4IM0 A;  2LGI A;  3R2T A;  4FA6 A;  1C76 A;  3RZF A;  4ZRJ A;  5BO4 B;  1FRD A;  1TT5 B;  5G2N A;  1YQ4 B;  1WX9 A;  2WWZ A;  4E3C A;  4XX5 A;  2YEP B;  1GPX A;  3KYC D;  4JE3 B;  1J7C A;  4R3D A;  1LFD A;  3B0A A;  4QAY A;  2J52 A;  2JXT A;  3AE1 B;  4BBN C;  3Q3J A;  1NEK B;  1T0S C;  2YLM A;  1NI3 A;  5JHA A;  2QEJ C;  4EOY A;  2IGH A;  5E6J A;  1SBB B;  4RGM A;  2KWC A;  2GI9 A;  5LNK 1;  3CIR B;  2OJR A;  3R7Q A;  1VLB A;  2LAS A;  2KJ6 A;  3KYD D;  3WCQ A;  3H7P A;  2GMI C;  4M0W B;  5HFY A;  1V80 A;  2MBQ A;  4ACF A;  4MM3 A;  1WRI A;  2I38 A;  3PLU A;  4WJN A;  2DWQ A;  3DBR I;  4BZA A;  2W54 A;  2WXF A;  4X57 B;  5AUI A;  1HA5 A;  2DZI A;  1JWU D;  2AQ3 B;  3K9O B;  4IWP A;  3VUW A;  1MJD A;  3IAM 1;  4YTP B;  1WXM A;  2K25 A;  3FIL A;  1HE8 A;  1KF6 B;  2WXP A;  1WZ0 A;  3N3K B;  1TJE A;  1EU3 A;  2IZV B;  3H7P B;  1YQB A;  2N7D A;  4GGQ A;  4HK2 A;  2BYV E;  3CMM B;  3KWL A;  4YSZ B;  2K9X A;  1ZW7 A;  1V5T A;  1IBX A;  1FXI A;  4F8C B;  3AEC B;  4YT0 B;  4EZL A;  4XZ4 A;  3WA0 A;  2I2Y A;  1XLO A;  2NR2 A;  1Q1O A;  2N9E B;  1PUT A;  1ISN A;  1J7B A;  1WYW B;  3RNF C;  1D5X C;  3A9J A;  2K22 A;  5FR6 A;  1NYR A;  4M00 A;  3V6C B;  3VXW A;  1QOG A;  1CZP A;  1IGC A;  2DX5 B;  4S0R A;  5T8I A;  3O13 A;  4ARI A;  2NTS A;  1UWX A;  3QWZ B;  2R2O A;  2E6X A;  3BII D;  1DGJ A;  2MCN B;  2LHE A;  2QDF A;  1GUA B;  2FCS A;  2W82 A;  1L0Y B;  1C9F A;  1BML C;  3H6N A;  1A5R A;  3P63 A;  4BOZ B;  1J7A A;  2KX0 A;  2N9L A;  4BKG A;  2QSD A;  3AUL A;  4USA A;  4NAM A;  2M8S A;  4REZ A;  1YIW A;  5D6J B;  3QIJ A;  3N9Y C;  1KOT A;  3H9D A;  4OZC A;  5DPS A;  3SR6 A;  3VR8 B;  3MTN B;  1TS3 A;  3RNC C;  3BVZ A;  3TIX A;  1JML A;  2WXR A;  2H88 B;  4WWM A;  2LVO A;  4WH4 A;  3V61 A;  1HZ5 A;  1UGJ A;  4KSL C;  2XNA C;  1YNT E;  3O65 B;  4HPL B;  1WGY A;  1L4D B;  3SFE B;  1DOY A;  2V4L A;  2D5G A;  3AU4 A;  1FCL A;  2IO0 B;  2JZ3 B;  1XEE A;  3APF A;  1OQQ A;  1I7H A;  3DHG C;  4F1S A;  4N59 A;  4WUR A;  5IKC M;  4MSQ B;  3VRA B;  1ZGU B;  3WAM A;  4BAX A;  3OG5 A;  1WJN A;  3R2I A;  2RGF A;  2N9K A;  1JAL A;  5LXI B;  4ASW C;  1YX5 B;  2DBY A;  2KX3 A;  1E9M A;  1SIF A;  4II2 B;  3RI7 C;  3ZJT A;  2WDV B;  4IC7 B;  1OGW A;  3OJ4 B;  1FRR A;  4G50 A;  2BQQ A;  2C7N B;  4DXG A;  2V3N A;  2M56 B;  1RM6 C;  2ZW0 A;  3PHW B;  3EUB 2;  1TZ1 A;  1IUE A;  4GXB A;  3DQV A;  1JCK B;  3APD A;  4HDQ A;  4US8 A;  2WGS A;  4W9E A;  5J18 A;  2V3P A;  2PTL A;  3MJ5 A;  1F77 A;  5AZH A;  2FCM A;  2MP2 A;  2FNJ B;  1D6E C;  2D10 A;  4XWT A;  4LTU A;  1F1H A;  4EZJ A;  4ZRI A;  1TIF A;  2Y5P A;  2MBB B;  3ZGZ A;  2G4S A;  2BF8 B;  3RT3 B;  3IG3 A;  1ET9 A;  5LXH A;  2N9X A;  4P6V F;  4FBJ B;  3KVF B;  1F0Z A;  2KTF A;  4W9G A;  3NZ3 A;  1M94 A;  1K53 A;  2BPS A;  2GRI A;  3RYT A;  2BYE A;  2CJN A;  2ZCC A;  4RGT A;  4EKU A;  4RM8 A;  2KQS A;  3AV8 A;  3GZN B;  5IOI A;  3KUZ A;  1KM7 A;  1WXS A;  4AP4 C;  2L00 B;  1GNU A;  3R7R A;  4BKT A;  3W1S A;  3T3O A;  3JYU A;  1VRA B;  3W5V B;  4OZA A;  2JYT A;  5D3D A;  4YTM B; 
#chains in the Genus database with same CATH homology
 4M01 A;  4M02 A;  2KYW A;  4M00 A;  2KVZ A;  2KT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...