2KVZA

Structure of residues 161-235 of putative peptidoglycan binding protein lmo0835 from listeria monocytogenes: target lmr64b of the northeast structural genomics consortium
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
85
structure length
85
Chain Sequence
MDFGKPNQVTVNYLDENNTSIAPSLYLSGLFNEAYNVPMKKIKGYTLLKYDSEILGVFTESPQTINIIYQKKAPEQALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of residues 161-235 of putative peptidoglycan binding protein lmo0835 from Listeria monocytogenes: target LmR64B of the Northeast Structural Genomics Consortium
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
molecule keywords IspE
total genus 12
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06458 MucBP MucBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 2kvzA00
2KVZA 4M01A 2KYWA 2KT7A 4M02A 4M00A
chains in the Genus database with same CATH superfamily
2DZIA 2KTFA 4G11A 4HEA1 1B1ZA 3URYA 2DWQA 3DVGX 3Q69A 1LXDA 4OVZA 2RMMA 5GMVA 4IOIE 1MG8A 4A9AA 4KDLB 2AQ3B 2WGSA 1F9JA 1PQSA 4P6VF 2MJDA 2AX5A 1C78A 4GMVA 4ZRQA 3WAOA 1QOGA 2LD9A 2KFKB 4FXCA 4WWNA 3RNBC 4LNFA 1D5MC 1PDXA 2JXXA 3VFKA 3HUIA 3KLSX 1NENB 1UD7A 1E10A 3GZNB 3DVNU 4BKTA 1R4MI 4C4VA 4TSSA 3L10B 2G1EA 3D32A 5IO9A 4X57B 4XE0A 2WXOA 3AXCA 2VRRB 4S0RA 2PLPA 1UNSA 2GOWA 1WJUA 2O6VA 3AE8B 2DZMA 2QDFA 4XWWA 4FHKA 1P1AA 1KM7A 2ZPNA 3PZ7A 2I2YA 1UBQA 2KMAA 1FFUA 2KLCA 1E7UA 4PT5A 5I4DA 2JYTA 2RD0A 2LI5A 4TMAB 2Z0DB 2WXLA 3QC8B 4UDUC 1KFYB 2M8SA 3NUHB 1HTOA 2KANA 2RSUA 2LUMA 3V62A 3L17A 3ZGZA 3OJ4B 3AEGB 1XD3B 1TGZB 2D10A 4A90A 2NS5A 2AL6A 2AQ1B 3N1XC 4ZYSA 3WALA 3NG0A 4FADA 2PE9A 2KWCA 2K5PA 4JX1C 3DBRI 3TCAA 4KKJA 1EU3A 3M3JA 2L00B 3Q8CA 1L5PA 3WCQA 1Q10A 2E3TA 4KGTA 1L0YB 1KOTA 2WXMA 1T3QA 4E71A 3UIPB 3X23A 1VZ8A 1WGGA 2C7MB 4P7IA 3A1QA 1SGHA 5DCNA 5JHBA 1XCTL 1E90A 2L0FA 3H9DA 1ZE3D 4FJZA 2MEKA 4F8CB 2N0SB 5EE9A 3AE2B 1XLPA 3H7SA 1QKZA 1WY8A 2WXHA 2N4FA 4MGYE 2BB6A 4RMAA 4A3OA 2O2VB 1V86A 3ML8A 4II3B 1LGRA 3EA6A 2IGHA 5D94A 1YQ4B 3BIID 1YJ1A 2IY0B 1PGBA 3N9YC 4US9A 5IOIA 3PV1A 2KVRA 1JROA 4DDID 3CIRB 2L8JA 1WGDA 1KJTA 1UGJA 2XBBC 1F52A 1IPGA 4ZHOA 5HHDG 2JY6A 3VUXA 2NPTA 2NBUA 2MP2A 2KJRA 1EUVB 2OJWA 4ACFA 1QQRA 4BOZB 1YN3A 3LB8C 4MEMA 2SAKA 3ZQ4A 1STEA 2XNAC 1R4NB 3UIOB 2V0GA 3DWMA 3VH4B 2WLBA 3HK0A 3WAPA 3MP9A 1AN8A 2ZNVB 1BMLC 3BK1A 5FKAC 3R8BA 2PPHA 2G4SA 3P2BA 1VRAB 1C9FA 1KLUD 2LVOA 2ICIA 3SDLC 4AOFA 1Q5WB 2K6QA 3PLVA 1I7HA 1WR6E 5HKHA 1NI2A 1L2NA 2LVQA 1YJJA 2ZZPB 3SEBA 2KAJA 3NZSA 3DBLB 3RCZA 2PW9A 4AUQC 1WJ4A 2KMMA 4NQLB 4TKNA 2VZKB 2VH1A 1GG3A 2LGIA 2IGGA 3TL5A 2WXGA 2LJ5A 1TS3A 3U7DA 2QEJC 2V1YA 5G55A 4RF0A 2K39A 4DHZE 4N6EB 3AV8A 2LVPA 1WWTA 4K7UA 1SF0A 4EKUA 4EE2A 3BYYB 1TYGB 2CU1A 1VJKA 1T0RC 4MM3B 2QCZA 3A9KA 1N61A 2KMCA 4II2B 4IM2A 2MQJA 1IP9A 5E6NA 1JWMD 2BB5A 3TEXA 3H7PB 3I9V1 4BAXA 2MH7A 1FXAA 1GOZA 3R66C 4ZRKA 1P0RA 3O13A 1WSPA 3ECIA 3LYYA 3TEZA 1C76A 3IAS1 2WXQA 1DOYA 2BTEA 1SE2A 2FCSA 4BFRA 3AE9B 5AUIA 2D07B 1MG4A 3MJWA 1ZDVA 3SHQA 2N9XA 1YIWA 3VH3B 4AS1A 2NPTB 2MBEA 1RWSA 3GOEA 3DBHB 2KHWB 4KX6B 1WXMA 2IPKD 3BVMA 3AE3B 3OJ3A 1TZOA 2K22A 2N9EB 3R3MA 4QAYA 5CX3A 1J19A 1CK1A 1LFDA 4DHJB 3NVYA 1F0ZA 1ENFA 2JWUA 3V60A 4GDKA 4KZ0A 2ZCCA 2L3ZA 1VD2A 3JVZX 3SR6A 3DPDA 3GP7A 2NMQA 2WX0A 2IO0B 1FCLA 2GRIA 2RPVA 2DLBA 2BS4B 4JWSC 4FJYA 2KDEB 3U2SC 2HTME 3N20C 2WU2B 4JWUC 3SFDB 2V3PA 3PGEA 1I4PA 2WDTB 4ARCA 1FM0D 1WGYA 1YQBA 2YLMA 1RFKA 1N60A 4NAMA 4DHJD 3ZJVA 4MSMB 1YN4A 3TUOA 4ICUA 1KF6B 1HTQA 2N7JA 1WJNA 1L4DB 4NQKE 2Z8LA 2CHZA 2DYBA 2EKEC 2PVOD 1V49A 3I63C 1EM7A 2LXAA 4RM8A 3AECB 3I5JC 2DNFA 2LUEA 4AQ7A 3T3OA 3W9CB 1HA5A 4OHJA 3P1MA 3Q3MC 3NRZA 2OOBB 1TS2A 1LQBA 3GE8C 4ANUA 3DVGY 1XCQL 4HKZE 3EFUA 3ZNZB 2J0MA 1HEZE 4XDCA 1T0YA 1KLGD 2JUOA 3AMZA 3ZVVA 1YJIA 2BYFA 2JRIB 4IC7B 3EC8A 4HJGE 2LHEA 3PSEB 3VHTC 2M0AA 4EZKA 2WXFA 3DVNV 3ENEA 3LDZE 1VR9A 2NCNA 5EDSA 4KIKA 4M8MA 1UF0A 1P3QU 3T3NA 1UZXB 3GZNI 4W9KA 2HDEA 4TUUA 5AUKA 1E7VA 2Y5CA 1R4MB 4S17A 1L4ZB 5C3JB 3NOBA 1M4VA 3CF6E 2WXNA 3WA0A 3ZXVA 3MC8A 3DBSA 1PGAA 4HCNB 2XK5B 4N58A 2PMVA 4C7ZA 3RN9C 1RYJA 1V1PA 3TJPA 2INDC 1C4AA 1WYGA 3Q3JA 2N9PC 3NVWA 2O6VD 1EF5A 2NBVB 3APDA 4HPMB 2KX0A 1K53A 2W54A 2WDQB 3RNAC 4IM3A 1FCCC 2FIDA 2K8CA 2IYDB 4YL8A 3BVGA 2K9XA 3VRBB 2IGDA 2KN5A 2RR9A 2J42A 3A9KB 3ZNGC 4O1NA 3ZIMA 1WMHA 5E6OA 1R7SA 5AZFA 1GB4A 1QOAA 3PRPB 1GNUA 1WRIA 1FXIA 2JQRB 4BBNF 3IG3A 1CMXB 4IDIA 3ML9A 3AULA 3GS2A 2BKFA 4LK0M 1I42A 4KDIC 4RNAA 2G3QB 2KFJA 1HZ5A 2BVCA 2Y5BB 1TKEA 5D3DA 3EHVA 3BWUD 1WF9A 2KQ7A 3AU5A 2CHXA 4JQWC 3KWVA 5IAAC 3JW0X 1GB1A 1WGRA 3NZ3A 2B76B 4XZ4A 2REXA 2RPQA 2DYOA 1E0ZA 1YQ3B 2D2QA 1N63A 1NYQA 3U30A 1MHXA 4DXFA 1J0GA 4W9EA 4XWTA 1OGWA 2KWDA 4D2KA 2VH2A 4YTPB 1OFFA 4A3PA 2KVZA 2PVGC 2MBBB 2PJHA 1UWXA 1XEEA 2LXCA 4W9FA 1ACCA 3Q3FA 3PZ8A 2J4XA 5AEKB 3IT4B 1ZPSA 3EGRA 4DXGA 1XO3A 2BGFA 2K25A 2GB1A 2KD0A 3P63A 4K3CA 4HXDA 3KW5B 2KXJA 2E6XA 2PIAA 4MSQB 1V2YA 3A1QB 3W5VB 4N9F4 2FCMA 4C80A 3AEBB 3DHIC 2K6DB 5JHAA 3NS8A 1WXVA 5FR3A 4FLHA 4WAFA 1EO6A 3IBEA 3SD5A 2C7HA 3J9CA 1AWDA 2XN9C 2G45B 2ZVNA 4GIVA 4M02A 3QWZB 5LNK1 1GPXA 1FXTB 4B0EA 4URKA 1VZ6A 2J0JA 3DCGA 4RGTA 2UU7A 3ZDMC 1V81A 3OG5A 2KQ4X 2C9WB 1FMAD 1SE4A 1NI3A 5CHWA 1YMHE 2LRUA 1NVID 1MFWA 4MH0E 4GN1A 5BO4B 4WWMA 3A33B 4WURA 4K1RB 2K8HA 3RPFC 1I4RA 1SB3C 3HM3A 4DHZB 2AQ2B 4ARIA 4F7ZA 1WM3A 5G5HA 2KDBA 1T6BX 1EU4A 4YSYB 4EFOA 1WYWB 2FE8A 3NS1A 2FIFA 2HJ8A 4GXBA 2V9HA 4J3OD 1XLNA 4YXDB 5D6JB 3R7QA 3KYCD 3QCAA 5L83A 4GGQA 2PTLA 3DHGC 1YOVB 4KSLC 3ZNHB 3HVDA 3PREA 3ABVB 4MT5A 4ZRPA 1OQQA 4DDGD 1HXYD 2BS3B 1PYWD 3QJZA 4G3XB 4RGOS 3HRDD 3MJ5A 1ZP0B 3T9LA 5BYSA 2W55A 3ZJTA 3DWGC 4WJQA 1LM8B 2WYQA 4W9GA 1K51A 2PKOA 2QJLA 4HDOA 1FNVA 4XC2A 1SEBD 3PHXB 4PYZA 3A9JB 3VTWA 2QC8A 1FRDA 4FHJA 4PS8A 3TSSA 2D3AA 3T8MA 3QAQA 4HRSA 1OTRB 4W9LA 1B9RA 3P4PB 4B6WA 2M19A 1KTKA 1S3SG 1RLFA 4C4VB 4E74A 2WX1A 1ET6A 3U4EG 2EKIA 3OAWA 3BYTB 3NY5A 1AYFA 3APCA 1WGHA 2NTSA 4K3BA 1E8YA 2XEWA 2LASA 1ESFA 2OJRA 4BKSD 3AEAB 1AARA 3BINA 4EZLA 3MHZA 1NBFC 3A9JA 1XLOA 3NJTA 4A55A 2K8BA 2GI9A 1V1PB 1FO4A 3VRAB 1JALA 3C0RB 1SIJA 1PUTA 4CHKA 4HK2A 3UQAA 2HD5B 4EUTA 2FAZA 2ZW1A 2QSDA 3A4RA 3Q8BA 4EZJA 4AWJA 3N1ZC 4NZLB 4MJSA 4IWPA 2MSED 2MX2A 3IXSA 3Q6BA 2L1AA 2INNE 2N7DA 2V4IB 3UF8A 2JXTA 4DQOC 2N9LA 1HZ6A 1J8CA 3O65B 4FBJB 1FPYA 1K52A 2H89B 1HQRD 2V3NA 3Q8EA 1WX8A 3ZUNA 2L0TA 3UGBB 3JYUA 1PGXA 3VTUA 2JRHA 3P4RB 4W9DA 2IJ0A 3W5UB 1C1YB 2I1KA 1WXAA 2UWQA 3KH0A 2L32A 2W82A 1D6EC 4HCPB 4GDLB 1M94A 3PVLA 2KYWA 4XX5A 5DPRA 1OQRA 4LNIA 2JPHA 4P1BC 2DBYA 4LLGM 1JMLA 1TY0A 1N62A 2BWFA 3PZDA 3QX1A 2JVCA 2RDHA 3R7RA 1FFVA 5TR5A 2K1FA 4RGMA 1WRDB 4FA6A 1TZ1A 4EOYA 3VTVA 3WAMA 1D4BA 1E9MA 3ONSA 1P7EA 1I4XA 1ROEA 1V9JA 3E9SA 4FULA 1ZOYB 2ON8A 2FNJB 2YEPF 1WI0A 1RM6C 4JLCA 1DYQA 4C00A 3PRZA 2DYMA 2CJOA 2LHDA 1F1HA 3TBLD 2KZRA 5HG2A 3PRMB 1A5RA 4MDKE 1UGMA 3RD2A 4YSXB 3QA8A 3AE6B 3Q3OC 2N1VA 2C5LC 3PT2B 3FC4A 3PLUA 3ALBA 4DXAB 2C60A 4RFBA 4K7WA 1GC6A 3IFWB 2IBIB 1X1MA 3LJ3A 3S2AA 3ZDTA 2Y5PA 3MFGA 1V5OA 4E3CA 1WX9A 1D5ZC 5CTRC 2KNBA 3U7ZA 3QARA 2KJHB 5H8YE 3AH7A 3Q3NC 4MGZE 2H88B 1L0XB 4PK1A 1CZPA 1QLBB 2CU3A 3AEFB 2NBWB 4OZAA 3W1SC 4A6QA 4DBGA 3BK2A 5BMGA 4LNOA 1E6EB 1L7YA 5TSSA 4XYCA 2PEAA 3TEYA 2NTTA 1QOBA 1OEYJ 3KYDD 3TEWA 1OEYA 1TKGA 2GBRA 1IUEA 2SEBD 4C7YA 1FD6A 2WHIA 5G5GA 4MM3A 1VZ7A 1TY2A 4B95A 2G4DB 1WMHB 1WM2A 5C1ZA 4OZCA 2KK8A 1V8CA 3VUWA 2B3AA 3AE1B 4G50A 2MBQA 5EE3A 2LGDA 1BT0A 3N1YC 1SIFA 5KHOA 1DOIA 2KQSA 4WIPA 1I4QA 3CMMB 3RNEC 1YD8U 1E8XA 2KJ6A 4LJOB 1C77A 4HLEA 3DBHI 5H92C 3I3TB 2WXPA 3KUCB 4IW0A 2AEHA 1E8WA 3AE4B 3KUDB 2WDRB 2A5UA 1Y56A 3VXWA 4K81A 4WAAA 2PE6B 1GC7A 2RDBC 4KV2A 2MBHA 2NVUI 1V6EA 4DWFA 1V5TA 2DZKA 2KC1A 3BY4B 1ZXIA 3ZLZA 5DPTA 1RFAA 1FRRA 1TS4A 4RH6A 2MRPA 4LDTB 3K9OB 1XLQA 1UWMA 2M17A 4YTNB 1NDDA 4MGIE 2EMSA 2JZ3B 5JH5C 4GB9A 5HI1A 3X0WA 3QHTA 1WXSA 3NVZA 4DK5A 2KDMA 2LEKA 4TQ0A 2OHFA 3NVVA 1C79A 1KLVA 2RGFA 4NY0A 2JF5A 2J7QB 2LGYA 4WQMA 2ZVOA 4FN2A 2YEPB 1XXGA 1L6UA 1D5XC 4JIOU 1WZ0A 5CHVC 3DQVA 3WANA 3BVZA 2ZNVC 1ET9A 4BKSA 4ZOHC 4KVGB 4ITKA 1EWCA 1HE8A 2LMCA 2CR5A 1NYRA 2GBNA 4HPLB 3V61A 5G2NA 2K0PA 1Q1OA 2MP2B 1FEHA 4RF1A 4PS7A 4BOSC 2WWZA 2M0XA 3B2FA 4YTMB 2MCNB 3U8ZA 2I1JA 2BBCA 4KGSA 2WXJA 2JZPA 2KO3A 1T5XD 3GE3C 2BYTA 2WXKA 2ZCBA 4AP4C 4WWPA 3B2GA 4JE3B 3HHMA 2GBKA 1IBXA 5L95C 1R4NI 4C56C 1A70A 1UH6A 2L83A 4M01A 3FILA 2ZPYA 3ZYYX 3VR8B 3HIZA 4RGNA 5BMHA 2JZZA 1YX6B 1KRHA 1WGKA 2J52A 5JXVA 3L0WB 2Q5WD 5CHFA 4WJNA 2XK5A 4RCOA 3AEDB 4MGKE 4PS3A 1SJHD 4KZCA 1L6VA 4GLSC 5D3IB 3ZW3A 2GBMA 4ANWA 2MLBA 1SE9A 5JZEB 4CQNA 4B0MA 1E8ZA 1JWBD 3PO0A 3AE7B 3Q14C 3PS6A 3PTFC 5D7GA 3RYTA 3SU8X 2MHJA 2N9KA 3UQBA 5IA7A 5LXHA 4TV3A 3NHEB 1XF5L 5MPOA 1LO5D 4ANVA 1BUIC 4ICVA 4I6PA 2WDVB 1K8RB 3R2IA 3W1SA 3DBLI 3ZXRA 4ANXA 4OVUA 1JWSD 4HROA 2MWSB 3RMKC 2W3SA 1P98A 3Q2AC 4BBNC 2UYZB 3E56A 3VUYA 2ZW0A 2JT4B 2K3UA 3CWIA 2BW2A 3I57A 3AI5A 1ZUD2 4M0WB 1WFYA 2M56B 3M62B 3B0AA 1Z2MA 5DPWA 1CQVA 3EFCA 1MVKA 1IGCA 2N7EA 4NJ7A 3LXFA 2IO1B 3RULA 2Y3AA 1ISNA 4WJPA 1QILA 2L05A 1SJED 2QIEB 4LNKA 2CKHB 4KGRA 4OZBA 1V80A 2DZJA 1YN5A 1S1QB 2CS4A 1I35A 3KUZA 1H4RA 2HJ1A 1DGJA 2BT6A 5BYQA 2INPE 3B1LX 2DENB 3PPAA 2FCQA 4RM9A 2WS3B 2VZKD 5KHQA 1RAXA 1JQ4A 2N1WA 5IN7A 1T0SC 2EMTA 5J17A 4MH8A 4M0WA 1C4PA 1UBIA 2KDFB 3TIXA 3RNGC 1MJDA 2BPSA 4JGHB 3W1YA 5GXGB 2W9NA 1N6ZA 2JYEA 1DOXA 2KX3A 1MI0A 1WR1A 4I6NB 3H1UA 5BYRA 3V6CB 5C2TB 3GB1A 2Z0EB 4LCDE 4PYUA 4IG7B 3VR9B 2WU5B 2JU6X 4CYEA 3OLMD 3RNFC 4IWOA 2V4LA 2TSSA 3PHWB 4MACA 1VLBA 2L52A 2AWTA 4NAWB 1TJEA 3FILB 3IHPC 1TTNA 2MBOA 3L4PA 1IBXB 1WE7A 4W9HA 4K7SA 2KN4A 1GUAB 3QIJA 3HM6X 4N59A 3AEEB 4ZRIA 1ZXHA 1MPEA 2D11A 4HJKA 3H8HA 1F2RC 2BS2B 5J2RA 2INCC 2DHZA 2O2VA 4IKGA 3M95A 5E6JA 3Q8AA 1N5WA 2KOXA 3MHSD 4HDQA 1FNUA 5IKCM 3W2DA 1SSNA 2FUHB 2JX5A 1V1OA 4B9KA 3RT3B 2KWUB 5AZHA 3TMPB 4AJYB 1MHHE 1AW7A 3N30A 3HVZA 2OEDA 3ZRFA 3EUB2 1K50A 3MTNB 3AU4A 3UI3A 2L76A 1E7PB 2CJNA 2KACA 3VQIA 1JRPA 5DPSA 1GAQB 4IUMB 2AL3A 2DX5B 2LZ6A 2ZJDA 2GBJA 3BZDB 4US8A 5EE0A 4GSWA 4BZAA 2QHOA 2DAJA 4JL9A 4W9IA 1C4CA 2FBWB 2FUG1 4KSKC 5AZGA 5D2MB 1XQQA 2LJIA 1CJEA 1WXQA 3NZUA 3AB5A 5T8IA 4FJVB 4USAA 1PFDA 4GU2A 1KH0A 4HKQA 1J7CA 3ZO5B 1J7BA 1EF1A 4P1CC 2J0KA 3JSVB 4I6LB 3B9JA 1FIQA 3DDCB 4YT0B 1JWAD 4GOCA 2MJEA 3H6NA 4J6IA 4REZA 5E6PA 1QOFA 3M63B 4GDLA 4BKGA 3N3KB 3DBRB 2KFKA 3JSVA 2IO3B 3R2TA 3U52E 1TT5B 1U4AA 1ZW7A 1QF6A 2BYVE 4KIKB 2FCNA 4Q2JA 1GJZA 3UINB 2MW5A 2L7RA 2C7NB 1WX7A 1YX5B 4XDDA 3ZRCA 5FK9C 1P7FA 2I38A 1JW9D 1Q0WB 3RZWC 4P16A 4M8NA 1I4GA 2MJ3A 4A20A 3B08A 4ZDVA 1IGDA 3APFA 1JRUA 2R2QA 2A4ZA 2BYEA 3ZTDA 1EWYC 1Z5SB 2M1MA 5EE1A 4EEWA 1WE6A 1UUPA 1N5XA 3ZJUA 2WQYB 2IY1B 2IZVB 4LNNA 1D3ZA 5FR6A 3VDZA 2X38A 1QT9A 2GLSA 4G0NB 3IVFA 2LGSA 3Q8FA 3ZKJC 5LXIB 1ZGUB 4WQOB 4ZYNA 3OWEB 4KKIA 1VDVA 3AE5B 1IYFA 4W9CA 3CSTA 2BKRB 3ZTCA 2D5GA 3MC0B 1JWUD 5HFYA 5BMIA 4LTUA 4YWGG 3KVFB 3ETRA 3FKYA 3RFZB 2O6VB 3V3XA 3QQ8B 2IDYA 1UELA 4NJ6A 3RUIB 3DHHC 2MA9B 5J18A 2RDGA 1TKYA 4XGAB 4L2YA 2M4NA 1FNWA 4JPSA 4IM0A 2WXRA 1F77A 2KWVB 2V3SA 1SXTA 3K9PB 1TBEA 4MELA 4F1SA 2D3BA 3P4QB 4HPPA 2G9HD 1Y8RC 2YVCA 3AM9A 3N32A 1WIAA 1QZEA 3WIMA 3RZFA 4NNJB 1V97A 4AJWA 4GDKB 4M00A 1TS5A 2ACZB 4NJCA 1T0QC 2NR2A 3L16A 4L1BA 1ZKHA 2J53A 2DAFA 2ZEQA 2JWZA 3C19A 1VCBA 3QK0A 3SFEB 2BWES 2D3CA 5LLIA 3V6EB 2KKCA 4ZRJA 2X8XX 3C8YA 1I4HA 3H7PA 2D3GA 1OQYA 2AYOB 3RNCC 2BF8B 2LGXA 1WZ3A 1F2RI 1E5WA 3ZNID 3L54A 4TQ1A 2GMIC 1H8CA 2KT7A 1YNTE 2R2OA 4LDTD 3IT6B 3VVWB 4HVBA 4WWOA 3KQ4A 2LFIA 2EELA 4W9JA 5C23A 3EECA 4WH4A 3AN1A 4ZHPA 4H2AA 1P9DU 3P4SB 2JSVX 4NAWA 2QMTA 4ASWC 2HTHA 2LRWA 1RRBA 2KTRB 3KWLA 4L23A 1TIFA 2Z59B 1XT9B 1WH3A 2ONQA 3P42A 5IP4D 4CO7A 2HE7A 3L13A 2IO2B 4BVUC 2KTRA 1WJ6A 2KLGA 3CSFA 2KC2A 1G6JA 4A8XC 2ASQA 3IAM1 4YSZB 3FAHA 2WNMA 3RI7C 1NEKB 1SE3A 1BXTA 1J7AA 1ZDXA 2CHWA 2BQQA 2LWPA 4LJPB 3V05A 3VAWA 1SBBB 4MJSB 4IWQA 2QILA 2WP9B 4HWIB 4NPNA 2KDIA 1C3TA 3L08A 1JCKB 3MC9A 4WJOA 4OVVA 4R3DA 2WXIA 1L0VB 2R61A 3DOWA 2W3RA 3A4SC 4OW0A
chains in the Genus database with same CATH topology
2KVZA 4M01A 2KYWA 2KT7A 4M02A 4M00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVZ A;  4M01 A;  2KYW A;  2KT7 A;  4M02 A;  4M00 A; 
#chains in the Genus database with same CATH topology
 2DZI A;  2KTF A;  4G11 A;  4HEA 1;  1B1Z A;  3URY A;  2DWQ A;  3DVG X;  3Q69 A;  1LXD A;  4OVZ A;  2RMM A;  5GMV A;  4IOI E;  1MG8 A;  4A9A A;  4KDL B;  2AQ3 B;  2WGS A;  1F9J A;  1PQS A;  4P6V F;  2MJD A;  2AX5 A;  1C78 A;  4GMV A;  4ZRQ A;  3WAO A;  1QOG A;  2LD9 A;  2KFK B;  4FXC A;  4WWN A;  3RNB C;  4LNF A;  1D5M C;  1PDX A;  2JXX A;  3VFK A;  3HUI A;  3KLS X;  1NEN B;  1UD7 A;  1E10 A;  3GZN B;  3DVN U;  4BKT A;  1R4M I;  4C4V A;  4TSS A;  3L10 B;  2G1E A;  3D32 A;  5IO9 A;  4X57 B;  4XE0 A;  2WXO A;  3AXC A;  2VRR B;  4S0R A;  2PLP A;  1UNS A;  2GOW A;  1WJU A;  2O6V A;  3AE8 B;  2DZM A;  2QDF A;  4XWW A;  4FHK A;  1P1A A;  1KM7 A;  2ZPN A;  3PZ7 A;  2I2Y A;  1UBQ A;  2KMA A;  1FFU A;  2KLC A;  1E7U A;  4PT5 A;  5I4D A;  2JYT A;  2RD0 A;  2LI5 A;  4TMA B;  2Z0D B;  2WXL A;  3QC8 B;  4UDU C;  1KFY B;  2M8S A;  3NUH B;  1HTO A;  2KAN A;  2RSU A;  2LUM A;  3V62 A;  3L17 A;  3ZGZ A;  3OJ4 B;  3AEG B;  1XD3 B;  1TGZ B;  2D10 A;  4A90 A;  2NS5 A;  2AL6 A;  2AQ1 B;  3N1X C;  4ZYS A;  3WAL A;  3NG0 A;  4FAD A;  2PE9 A;  2KWC A;  2K5P A;  4JX1 C;  3DBR I;  3TCA A;  4KKJ A;  1EU3 A;  3M3J A;  2L00 B;  3Q8C A;  1L5P A;  3WCQ A;  1Q10 A;  2E3T A;  4KGT A;  1L0Y B;  1KOT A;  2WXM A;  1T3Q A;  4E71 A;  3UIP B;  3X23 A;  1VZ8 A;  1WGG A;  2C7M B;  4P7I A;  3A1Q A;  1SGH A;  5DCN A;  5JHB A;  1XCT L;  1E90 A;  2L0F A;  3H9D A;  1ZE3 D;  4FJZ A;  2MEK A;  4F8C B;  2N0S B;  5EE9 A;  3AE2 B;  1XLP A;  3H7S A;  1QKZ A;  1WY8 A;  2WXH A;  2N4F A;  4MGY E;  2BB6 A;  4RMA A;  4A3O A;  2O2V B;  1V86 A;  3ML8 A;  4II3 B;  1LGR A;  3EA6 A;  2IGH A;  5D94 A;  1YQ4 B;  3BII D;  1YJ1 A;  2IY0 B;  1PGB A;  3N9Y C;  4US9 A;  5IOI A;  3PV1 A;  2KVR A;  1JRO A;  4DDI D;  3CIR B;  2L8J A;  1WGD A;  1KJT A;  1UGJ A;  2XBB C;  1F52 A;  1IPG A;  4ZHO A;  5HHD G;  2JY6 A;  3VUX A;  2NPT A;  2NBU A;  2MP2 A;  2KJR A;  1EUV B;  2OJW A;  4ACF A;  1QQR A;  4BOZ B;  1YN3 A;  3LB8 C;  4MEM A;  2SAK A;  3ZQ4 A;  1STE A;  2XNA C;  1R4N B;  3UIO B;  2V0G A;  3DWM A;  3VH4 B;  2WLB A;  3HK0 A;  3WAP A;  3MP9 A;  1AN8 A;  2ZNV B;  1BML C;  3BK1 A;  5FKA C;  3R8B A;  2PPH A;  2G4S A;  3P2B A;  1VRA B;  1C9F A;  1KLU D;  2LVO A;  2ICI A;  3SDL C;  4AOF A;  1Q5W B;  2K6Q A;  3PLV A;  1I7H A;  1WR6 E;  5HKH A;  1NI2 A;  1L2N A;  2LVQ A;  1YJJ A;  2ZZP B;  3SEB A;  2KAJ A;  3NZS A;  3DBL B;  3RCZ A;  2PW9 A;  4AUQ C;  1WJ4 A;  2KMM A;  4NQL B;  4TKN A;  2VZK B;  2VH1 A;  1GG3 A;  2LGI A;  2IGG A;  3TL5 A;  2WXG A;  2LJ5 A;  1TS3 A;  3U7D A;  2QEJ C;  2V1Y A;  5G55 A;  4RF0 A;  2K39 A;  4DHZ E;  4N6E B;  3AV8 A;  2LVP A;  1WWT A;  4K7U A;  1SF0 A;  4EKU A;  4EE2 A;  3BYY B;  1TYG B;  2CU1 A;  1VJK A;  1T0R C;  4MM3 B;  2QCZ A;  3A9K A;  1N61 A;  2KMC A;  4II2 B;  4IM2 A;  2MQJ A;  1IP9 A;  5E6N A;  1JWM D;  2BB5 A;  3TEX A;  3H7P B;  3I9V 1;  4BAX A;  2MH7 A;  1FXA A;  1GOZ A;  3R66 C;  4ZRK A;  1P0R A;  3O13 A;  1WSP A;  3ECI A;  3LYY A;  3TEZ A;  1C76 A;  3IAS 1;  2WXQ A;  1DOY A;  2BTE A;  1SE2 A;  2FCS A;  4BFR A;  3AE9 B;  5AUI A;  2D07 B;  1MG4 A;  3MJW A;  1ZDV A;  3SHQ A;  2N9X A;  1YIW A;  3VH3 B;  4AS1 A;  2NPT B;  2MBE A;  1RWS A;  3GOE A;  3DBH B;  2KHW B;  4KX6 B;  1WXM A;  2IPK D;  3BVM A;  3AE3 B;  3OJ3 A;  1TZO A;  2K22 A;  2N9E B;  3R3M A;  4QAY A;  5CX3 A;  1J19 A;  1CK1 A;  1LFD A;  4DHJ B;  3NVY A;  1F0Z A;  1ENF A;  2JWU A;  3V60 A;  4GDK A;  4KZ0 A;  2ZCC A;  2L3Z A;  1VD2 A;  3JVZ X;  3SR6 A;  3DPD A;  3GP7 A;  2NMQ A;  2WX0 A;  2IO0 B;  1FCL A;  2GRI A;  2RPV A;  2DLB A;  2BS4 B;  4JWS C;  4FJY A;  2KDE B;  3U2S C;  2HTM E;  3N20 C;  2WU2 B;  4JWU C;  3SFD B;  2V3P A;  3PGE A;  1I4P A;  2WDT B;  4ARC A;  1FM0 D;  1WGY A;  1YQB A;  2YLM A;  1RFK A;  1N60 A;  4NAM A;  4DHJ D;  3ZJV A;  4MSM B;  1YN4 A;  3TUO A;  4ICU A;  1KF6 B;  1HTQ A;  2N7J A;  1WJN A;  1L4D B;  4NQK E;  2Z8L A;  2CHZ A;  2DYB A;  2EKE C;  2PVO D;  1V49 A;  3I63 C;  1EM7 A;  2LXA A;  4RM8 A;  3AEC B;  3I5J C;  2DNF A;  2LUE A;  4AQ7 A;  3T3O A;  3W9C B;  1HA5 A;  4OHJ A;  3P1M A;  3Q3M C;  3NRZ A;  2OOB B;  1TS2 A;  1LQB A;  3GE8 C;  4ANU A;  3DVG Y;  1XCQ L;  4HKZ E;  3EFU A;  3ZNZ B;  2J0M A;  1HEZ E;  4XDC A;  1T0Y A;  1KLG D;  2JUO A;  3AMZ A;  3ZVV A;  1YJI A;  2BYF A;  2JRI B;  4IC7 B;  3EC8 A;  4HJG E;  2LHE A;  3PSE B;  3VHT C;  2M0A A;  4EZK A;  2WXF A;  3DVN V;  3ENE A;  3LDZ E;  1VR9 A;  2NCN A;  5EDS A;  4KIK A;  4M8M A;  1UF0 A;  1P3Q U;  3T3N A;  1UZX B;  3GZN I;  4W9K A;  2HDE A;  4TUU A;  5AUK A;  1E7V A;  2Y5C A;  1R4M B;  4S17 A;  1L4Z B;  5C3J B;  3NOB A;  1M4V A;  3CF6 E;  2WXN A;  3WA0 A;  3ZXV A;  3MC8 A;  3DBS A;  1PGA A;  4HCN B;  2XK5 B;  4N58 A;  2PMV A;  4C7Z A;  3RN9 C;  1RYJ A;  1V1P A;  3TJP A;  2IND C;  1C4A A;  1WYG A;  3Q3J A;  2N9P C;  3NVW A;  2O6V D;  1EF5 A;  2NBV B;  3APD A;  4HPM B;  2KX0 A;  1K53 A;  2W54 A;  2WDQ B;  3RNA C;  4IM3 A;  1FCC C;  2FID A;  2K8C A;  2IYD B;  4YL8 A;  3BVG A;  2K9X A;  3VRB B;  2IGD A;  2KN5 A;  2RR9 A;  2J42 A;  3A9K B;  3ZNG C;  4O1N A;  3ZIM A;  1WMH A;  5E6O A;  1R7S A;  5AZF A;  1GB4 A;  1QOA A;  3PRP B;  1GNU A;  1WRI A;  1FXI A;  2JQR B;  4BBN F;  3IG3 A;  1CMX B;  4IDI A;  3ML9 A;  3AUL A;  3GS2 A;  2BKF A;  4LK0 M;  1I42 A;  4KDI C;  4RNA A;  2G3Q B;  2KFJ A;  1HZ5 A;  2BVC A;  2Y5B B;  1TKE A;  5D3D A;  3EHV A;  3BWU D;  1WF9 A;  2KQ7 A;  3AU5 A;  2CHX A;  4JQW C;  3KWV A;  5IAA C;  3JW0 X;  1GB1 A;  1WGR A;  3NZ3 A;  2B76 B;  4XZ4 A;  2REX A;  2RPQ A;  2DYO A;  1E0Z A;  1YQ3 B;  2D2Q A;  1N63 A;  1NYQ A;  3U30 A;  1MHX A;  4DXF A;  1J0G A;  4W9E A;  4XWT A;  1OGW A;  2KWD A;  4D2K A;  2VH2 A;  4YTP B;  1OFF A;  4A3P A;  2KVZ A;  2PVG C;  2MBB B;  2PJH A;  1UWX A;  1XEE A;  2LXC A;  4W9F A;  1ACC A;  3Q3F A;  3PZ8 A;  2J4X A;  5AEK B;  3IT4 B;  1ZPS A;  3EGR A;  4DXG A;  1XO3 A;  2BGF A;  2K25 A;  2GB1 A;  2KD0 A;  3P63 A;  4K3C A;  4HXD A;  3KW5 B;  2KXJ A;  2E6X A;  2PIA A;  4MSQ B;  1V2Y A;  3A1Q B;  3W5V B;  4N9F 4;  2FCM A;  4C80 A;  3AEB B;  3DHI C;  2K6D B;  5JHA A;  3NS8 A;  1WXV A;  5FR3 A;  4FLH A;  4WAF A;  1EO6 A;  3IBE A;  3SD5 A;  2C7H A;  3J9C A;  1AWD A;  2XN9 C;  2G45 B;  2ZVN A;  4GIV A;  4M02 A;  3QWZ B;  5LNK 1;  1GPX A;  1FXT B;  4B0E A;  4URK A;  1VZ6 A;  2J0J A;  3DCG A;  4RGT A;  2UU7 A;  3ZDM C;  1V81 A;  3OG5 A;  2KQ4 X;  2C9W B;  1FMA D;  1SE4 A;  1NI3 A;  5CHW A;  1YMH E;  2LRU A;  1NVI D;  1MFW A;  4MH0 E;  4GN1 A;  5BO4 B;  4WWM A;  3A33 B;  4WUR A;  4K1R B;  2K8H A;  3RPF C;  1I4R A;  1SB3 C;  3HM3 A;  4DHZ B;  2AQ2 B;  4ARI A;  4F7Z A;  1WM3 A;  5G5H A;  2KDB A;  1T6B X;  1EU4 A;  4YSY B;  4EFO A;  1WYW B;  2FE8 A;  3NS1 A;  2FIF A;  2HJ8 A;  4GXB A;  2V9H A;  4J3O D;  1XLN A;  4YXD B;  5D6J B;  3R7Q A;  3KYC D;  3QCA A;  5L83 A;  4GGQ A;  2PTL A;  3DHG C;  1YOV B;  4KSL C;  3ZNH B;  3HVD A;  3PRE A;  3ABV B;  4MT5 A;  4ZRP A;  1OQQ A;  4DDG D;  1HXY D;  2BS3 B;  1PYW D;  3QJZ A;  4G3X B;  4RGO S;  3HRD D;  3MJ5 A;  1ZP0 B;  3T9L A;  5BYS A;  2W55 A;  3ZJT A;  3DWG C;  4WJQ A;  1LM8 B;  2WYQ A;  4W9G A;  1K51 A;  2PKO A;  2QJL A;  4HDO A;  1FNV A;  4XC2 A;  1SEB D;  3PHX B;  4PYZ A;  3A9J B;  3VTW A;  2QC8 A;  1FRD A;  4FHJ A;  4PS8 A;  3TSS A;  2D3A A;  3T8M A;  3QAQ A;  4HRS A;  1OTR B;  4W9L A;  1B9R A;  3P4P B;  4B6W A;  2M19 A;  1KTK A;  1S3S G;  1RLF A;  4C4V B;  4E74 A;  2WX1 A;  1ET6 A;  3U4E G;  2EKI A;  3OAW A;  3BYT B;  3NY5 A;  1AYF A;  3APC A;  1WGH A;  2NTS A;  4K3B A;  1E8Y A;  2XEW A;  2LAS A;  1ESF A;  2OJR A;  4BKS D;  3AEA B;  1AAR A;  3BIN A;  4EZL A;  3MHZ A;  1NBF C;  3A9J A;  1XLO A;  3NJT A;  4A55 A;  2K8B A;  2GI9 A;  1V1P B;  1FO4 A;  3VRA B;  1JAL A;  3C0R B;  1SIJ A;  1PUT A;  4CHK A;  4HK2 A;  3UQA A;  2HD5 B;  4EUT A;  2FAZ A;  2ZW1 A;  2QSD A;  3A4R A;  3Q8B A;  4EZJ A;  4AWJ A;  3N1Z C;  4NZL B;  4MJS A;  4IWP A;  2MSE D;  2MX2 A;  3IXS A;  3Q6B A;  2L1A A;  2INN E;  2N7D A;  2V4I B;  3UF8 A;  2JXT A;  4DQO C;  2N9L A;  1HZ6 A;  1J8C A;  3O65 B;  4FBJ B;  1FPY A;  1K52 A;  2H89 B;  1HQR D;  2V3N A;  3Q8E A;  1WX8 A;  3ZUN A;  2L0T A;  3UGB B;  3JYU A;  1PGX A;  3VTU A;  2JRH A;  3P4R B;  4W9D A;  2IJ0 A;  3W5U B;  1C1Y B;  2I1K A;  1WXA A;  2UWQ A;  3KH0 A;  2L32 A;  2W82 A;  1D6E C;  4HCP B;  4GDL B;  1M94 A;  3PVL A;  2KYW A;  4XX5 A;  5DPR A;  1OQR A;  4LNI A;  2JPH A;  4P1B C;  2DBY A;  4LLG M;  1JML A;  1TY0 A;  1N62 A;  2BWF A;  3PZD A;  3QX1 A;  2JVC A;  2RDH A;  3R7R A;  1FFV A;  5TR5 A;  2K1F A;  4RGM A;  1WRD B;  4FA6 A;  1TZ1 A;  4EOY A;  3VTV A;  3WAM A;  1D4B A;  1E9M A;  3ONS A;  1P7E A;  1I4X A;  1ROE A;  1V9J A;  3E9S A;  4FUL A;  1ZOY B;  2ON8 A;  2FNJ B;  2YEP F;  1WI0 A;  1RM6 C;  4JLC A;  1DYQ A;  4C00 A;  3PRZ A;  2DYM A;  2CJO A;  2LHD A;  1F1H A;  3TBL D;  2KZR A;  5HG2 A;  3PRM B;  1A5R A;  4MDK E;  1UGM A;  3RD2 A;  4YSX B;  3QA8 A;  3AE6 B;  3Q3O C;  2N1V A;  2C5L C;  3PT2 B;  3FC4 A;  3PLU A;  3ALB A;  4DXA B;  2C60 A;  4RFB A;  4K7W A;  1GC6 A;  3IFW B;  2IBI B;  1X1M A;  3LJ3 A;  3S2A A;  3ZDT A;  2Y5P A;  3MFG A;  1V5O A;  4E3C A;  1WX9 A;  1D5Z C;  5CTR C;  2KNB A;  3U7Z A;  3QAR A;  2KJH B;  5H8Y E;  3AH7 A;  3Q3N C;  4MGZ E;  2H88 B;  1L0X B;  4PK1 A;  1CZP A;  1QLB B;  2CU3 A;  3AEF B;  2NBW B;  4OZA A;  3W1S C;  4A6Q A;  4DBG A;  3BK2 A;  5BMG A;  4LNO A;  1E6E B;  1L7Y A;  5TSS A;  4XYC A;  2PEA A;  3TEY A;  2NTT A;  1QOB A;  1OEY J;  3KYD D;  3TEW A;  1OEY A;  1TKG A;  2GBR A;  1IUE A;  2SEB D;  4C7Y A;  1FD6 A;  2WHI A;  5G5G A;  4MM3 A;  1VZ7 A;  1TY2 A;  4B95 A;  2G4D B;  1WMH B;  1WM2 A;  5C1Z A;  4OZC A;  2KK8 A;  1V8C A;  3VUW A;  2B3A A;  3AE1 B;  4G50 A;  2MBQ A;  5EE3 A;  2LGD A;  1BT0 A;  3N1Y C;  1SIF A;  5KHO A;  1DOI A;  2KQS A;  4WIP A;  1I4Q A;  3CMM B;  3RNE C;  1YD8 U;  1E8X A;  2KJ6 A;  4LJO B;  1C77 A;  4HLE A;  3DBH I;  5H92 C;  3I3T B;  2WXP A;  3KUC B;  4IW0 A;  2AEH A;  1E8W A;  3AE4 B;  3KUD B;  2WDR B;  2A5U A;  1Y56 A;  3VXW A;  4K81 A;  4WAA A;  2PE6 B;  1GC7 A;  2RDB C;  4KV2 A;  2MBH A;  2NVU I;  1V6E A;  4DWF A;  1V5T A;  2DZK A;  2KC1 A;  3BY4 B;  1ZXI A;  3ZLZ A;  5DPT A;  1RFA A;  1FRR A;  1TS4 A;  4RH6 A;  2MRP A;  4LDT B;  3K9O B;  1XLQ A;  1UWM A;  2M17 A;  4YTN B;  1NDD A;  4MGI E;  2EMS A;  2JZ3 B;  5JH5 C;  4GB9 A;  5HI1 A;  3X0W A;  3QHT A;  1WXS A;  3NVZ A;  4DK5 A;  2KDM A;  2LEK A;  4TQ0 A;  2OHF A;  3NVV A;  1C79 A;  1KLV A;  2RGF A;  4NY0 A;  2JF5 A;  2J7Q B;  2LGY A;  4WQM A;  2ZVO A;  4FN2 A;  2YEP B;  1XXG A;  1L6U A;  1D5X C;  4JIO U;  1WZ0 A;  5CHV C;  3DQV A;  3WAN A;  3BVZ A;  2ZNV C;  1ET9 A;  4BKS A;  4ZOH C;  4KVG B;  4ITK A;  1EWC A;  1HE8 A;  2LMC A;  2CR5 A;  1NYR A;  2GBN A;  4HPL B;  3V61 A;  5G2N A;  2K0P A;  1Q1O A;  2MP2 B;  1FEH A;  4RF1 A;  4PS7 A;  4BOS C;  2WWZ A;  2M0X A;  3B2F A;  4YTM B;  2MCN B;  3U8Z A;  2I1J A;  2BBC A;  4KGS A;  2WXJ A;  2JZP A;  2KO3 A;  1T5X D;  3GE3 C;  2BYT A;  2WXK A;  2ZCB A;  4AP4 C;  4WWP A;  3B2G A;  4JE3 B;  3HHM A;  2GBK A;  1IBX A;  5L95 C;  1R4N I;  4C56 C;  1A70 A;  1UH6 A;  2L83 A;  4M01 A;  3FIL A;  2ZPY A;  3ZYY X;  3VR8 B;  3HIZ A;  4RGN A;  5BMH A;  2JZZ A;  1YX6 B;  1KRH A;  1WGK A;  2J52 A;  5JXV A;  3L0W B;  2Q5W D;  5CHF A;  4WJN A;  2XK5 A;  4RCO A;  3AED B;  4MGK E;  4PS3 A;  1SJH D;  4KZC A;  1L6V A;  4GLS C;  5D3I B;  3ZW3 A;  2GBM A;  4ANW A;  2MLB A;  1SE9 A;  5JZE B;  4CQN A;  4B0M A;  1E8Z A;  1JWB D;  3PO0 A;  3AE7 B;  3Q14 C;  3PS6 A;  3PTF C;  5D7G A;  3RYT A;  3SU8 X;  2MHJ A;  2N9K A;  3UQB A;  5IA7 A;  5LXH A;  4TV3 A;  3NHE B;  1XF5 L;  5MPO A;  1LO5 D;  4ANV A;  1BUI C;  4ICV A;  4I6P A;  2WDV B;  1K8R B;  3R2I A;  3W1S A;  3DBL I;  3ZXR A;  4ANX A;  4OVU A;  1JWS D;  4HRO A;  2MWS B;  3RMK C;  2W3S A;  1P98 A;  3Q2A C;  4BBN C;  2UYZ B;  3E56 A;  3VUY A;  2ZW0 A;  2JT4 B;  2K3U A;  3CWI A;  2BW2 A;  3I57 A;  3AI5 A;  1ZUD 2;  4M0W B;  1WFY A;  2M56 B;  3M62 B;  3B0A A;  1Z2M A;  5DPW A;  1CQV A;  3EFC A;  1MVK A;  1IGC A;  2N7E A;  4NJ7 A;  3LXF A;  2IO1 B;  3RUL A;  2Y3A A;  1ISN A;  4WJP A;  1QIL A;  2L05 A;  1SJE D;  2QIE B;  4LNK A;  2CKH B;  4KGR A;  4OZB A;  1V80 A;  2DZJ A;  1YN5 A;  1S1Q B;  2CS4 A;  1I35 A;  3KUZ A;  1H4R A;  2HJ1 A;  1DGJ A;  2BT6 A;  5BYQ A;  2INP E;  3B1L X;  2DEN B;  3PPA A;  2FCQ A;  4RM9 A;  2WS3 B;  2VZK D;  5KHQ A;  1RAX A;  1JQ4 A;  2N1W A;  5IN7 A;  1T0S C;  2EMT A;  5J17 A;  4MH8 A;  4M0W A;  1C4P A;  1UBI A;  2KDF B;  3TIX A;  3RNG C;  1MJD A;  2BPS A;  4JGH B;  3W1Y A;  5GXG B;  2W9N A;  1N6Z A;  2JYE A;  1DOX A;  2KX3 A;  1MI0 A;  1WR1 A;  4I6N B;  3H1U A;  5BYR A;  3V6C B;  5C2T B;  3GB1 A;  2Z0E B;  4LCD E;  4PYU A;  4IG7 B;  3VR9 B;  2WU5 B;  2JU6 X;  4CYE A;  3OLM D;  3RNF C;  4IWO A;  2V4L A;  2TSS A;  3PHW B;  4MAC A;  1VLB A;  2L52 A;  2AWT A;  4NAW B;  1TJE A;  3FIL B;  3IHP C;  1TTN A;  2MBO A;  3L4P A;  1IBX B;  1WE7 A;  4W9H A;  4K7S A;  2KN4 A;  1GUA B;  3QIJ A;  3HM6 X;  4N59 A;  3AEE B;  4ZRI A;  1ZXH A;  1MPE A;  2D11 A;  4HJK A;  3H8H A;  1F2R C;  2BS2 B;  5J2R A;  2INC C;  2DHZ A;  2O2V A;  4IKG A;  3M95 A;  5E6J A;  3Q8A A;  1N5W A;  2KOX A;  3MHS D;  4HDQ A;  1FNU A;  5IKC M;  3W2D A;  1SSN A;  2FUH B;  2JX5 A;  1V1O A;  4B9K A;  3RT3 B;  2KWU B;  5AZH A;  3TMP B;  4AJY B;  1MHH E;  1AW7 A;  3N30 A;  3HVZ A;  2OED A;  3ZRF A;  3EUB 2;  1K50 A;  3MTN B;  3AU4 A;  3UI3 A;  2L76 A;  1E7P B;  2CJN A;  2KAC A;  3VQI A;  1JRP A;  5DPS A;  1GAQ B;  4IUM B;  2AL3 A;  2DX5 B;  2LZ6 A;  2ZJD A;  2GBJ A;  3BZD B;  4US8 A;  5EE0 A;  4GSW A;  4BZA A;  2QHO A;  2DAJ A;  4JL9 A;  4W9I A;  1C4C A;  2FBW B;  2FUG 1;  4KSK C;  5AZG A;  5D2M B;  1XQQ A;  2LJI A;  1CJE A;  1WXQ A;  3NZU A;  3AB5 A;  5T8I A;  4FJV B;  4USA A;  1PFD A;  4GU2 A;  1KH0 A;  4HKQ A;  1J7C A;  3ZO5 B;  1J7B A;  1EF1 A;  4P1C C;  2J0K A;  3JSV B;  4I6L B;  3B9J A;  1FIQ A;  3DDC B;  4YT0 B;  1JWA D;  4GOC A;  2MJE A;  3H6N A;  4J6I A;  4REZ A;  5E6P A;  1QOF A;  3M63 B;  4GDL A;  4BKG A;  3N3K B;  3DBR B;  2KFK A;  3JSV A;  2IO3 B;  3R2T A;  3U52 E;  1TT5 B;  1U4A A;  1ZW7 A;  1QF6 A;  2BYV E;  4KIK B;  2FCN A;  4Q2J A;  1GJZ A;  3UIN B;  2MW5 A;  2L7R A;  2C7N B;  1WX7 A;  1YX5 B;  4XDD A;  3ZRC A;  5FK9 C;  1P7F A;  2I38 A;  1JW9 D;  1Q0W B;  3RZW C;  4P16 A;  4M8N A;  1I4G A;  2MJ3 A;  4A20 A;  3B08 A;  4ZDV A;  1IGD A;  3APF A;  1JRU A;  2R2Q A;  2A4Z A;  2BYE A;  3ZTD A;  1EWY C;  1Z5S B;  2M1M A;  5EE1 A;  4EEW A;  1WE6 A;  1UUP A;  1N5X A;  3ZJU A;  2WQY B;  2IY1 B;  2IZV B;  4LNN A;  1D3Z A;  5FR6 A;  3VDZ A;  2X38 A;  1QT9 A;  2GLS A;  4G0N B;  3IVF A;  2LGS A;  3Q8F A;  3ZKJ C;  5LXI B;  1ZGU B;  4WQO B;  4ZYN A;  3OWE B;  4KKI A;  1VDV A;  3AE5 B;  1IYF A;  4W9C A;  3CST A;  2BKR B;  3ZTC A;  2D5G A;  3MC0 B;  1JWU D;  5HFY A;  5BMI A;  4LTU A;  4YWG G;  3KVF B;  3ETR A;  3FKY A;  3RFZ B;  2O6V B;  3V3X A;  3QQ8 B;  2IDY A;  1UEL A;  4NJ6 A;  3RUI B;  3DHH C;  2MA9 B;  5J18 A;  2RDG A;  1TKY A;  4XGA B;  4L2Y A;  2M4N A;  1FNW A;  4JPS A;  4IM0 A;  2WXR A;  1F77 A;  2KWV B;  2V3S A;  1SXT A;  3K9P B;  1TBE A;  4MEL A;  4F1S A;  2D3B A;  3P4Q B;  4HPP A;  2G9H D;  1Y8R C;  2YVC A;  3AM9 A;  3N32 A;  1WIA A;  1QZE A;  3WIM A;  3RZF A;  4NNJ B;  1V97 A;  4AJW A;  4GDK B;  4M00 A;  1TS5 A;  2ACZ B;  4NJC A;  1T0Q C;  2NR2 A;  3L16 A;  4L1B A;  1ZKH A;  2J53 A;  2DAF A;  2ZEQ A;  2JWZ A;  3C19 A;  1VCB A;  3QK0 A;  3SFE B;  2BWE S;  2D3C A;  5LLI A;  3V6E B;  2KKC A;  4ZRJ A;  2X8X X;  3C8Y A;  1I4H A;  3H7P A;  2D3G A;  1OQY A;  2AYO B;  3RNC C;  2BF8 B;  2LGX A;  1WZ3 A;  1F2R I;  1E5W A;  3ZNI D;  3L54 A;  4TQ1 A;  2GMI C;  1H8C A;  2KT7 A;  1YNT E;  2R2O A;  4LDT D;  3IT6 B;  3VVW B;  4HVB A;  4WWO A;  3KQ4 A;  2LFI A;  2EEL A;  4W9J A;  5C23 A;  3EEC A;  4WH4 A;  3AN1 A;  4ZHP A;  4H2A A;  1P9D U;  3P4S B;  2JSV X;  4NAW A;  2QMT A;  4ASW C;  2HTH A;  2LRW A;  1RRB A;  2KTR B;  3KWL A;  4L23 A;  1TIF A;  2Z59 B;  1XT9 B;  1WH3 A;  2ONQ A;  3P42 A;  5IP4 D;  4CO7 A;  2HE7 A;  3L13 A;  2IO2 B;  4BVU C;  2KTR A;  1WJ6 A;  2KLG A;  3CSF A;  2KC2 A;  1G6J A;  4A8X C;  2ASQ A;  3IAM 1;  4YSZ B;  3FAH A;  2WNM A;  3RI7 C;  1NEK B;  1SE3 A;  1BXT A;  1J7A A;  1ZDX A;  2CHW A;  2BQQ A;  2LWP A;  4LJP B;  3V05 A;  3VAW A;  1SBB B;  4MJS B;  4IWQ A;  2QIL A;  2WP9 B;  4HWI B;  4NPN A;  2KDI A;  1C3T A;  3L08 A;  1JCK B;  3MC9 A;  4WJO A;  4OVV A;  4R3D A;  2WXI A;  1L0V B;  2R61 A;  3DOW A;  2W3R A;  3A4S C;  4OW0 A; 
#chains in the Genus database with same CATH homology
 2KVZ A;  4M01 A;  2KYW A;  2KT7 A;  4M02 A;  4M00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...