1JWSD

Crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
232
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDGMFNWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
total genus 72
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwsD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwsD02
2WV6D 1PRTB 2R61A 3OWEB 1JR0D 4Z9CB 1STEA 2RDGA 1S5DD 1FD7D 3DWPA 1SJHD 1EFID 1D5XC 1SJED 4DXFA 1FGBD 1EEID 1LT4D 3R2IA 1S5ED 1LTTD 3V05A 4RGMA 1MD2D 1TS2A 2Z8LA 1F77A 3DWQA 3KLSX 1TS3A 4UDUC 5TSSA 1LTBD 3TSSA 1JCKB 1SE3A 1LT6D 4RHSA 2XNAC 1B1ZA 2ICIA 2QEJC 1XXGA 2AQ3B 1PZJD 1B44D 1HQRD 2NTSA 3EA6A 4DXGA 1CQVA 1D5MC 4NZLB 1UNSA 2XN9C 1BCPB 4L6TB 1AN8A 1KLGD 1AW7A 1S5FD 3W2DA 1YN4A 1LTRD 1BXTA 1I4XA 1JQYD 5D3DA 1HA5A 1I4HA 1EEFD 1EWCA 3DWAA 1TY0A 3R8BA 1T5XD 1LTGD 1M4VA 1UUPA 2XRSD 1SEBD 2IJ0A 1D5ZC 1FNVA 2QILA 1BCPF 2NTTA 5ELCA 4RHRA 3BVMA 4OHJA 1D6EC 1V1PB 1LO5D 1HTLD 1V1PA 5D3IB 5ELEA 1CK1A 1ET9A 4O1NA 1QILA 1LT3D 2RDHA 1LTID 1ET6A 3EFXD 1ENFA 1FNUA 1PYWD 1LTSD 3CHBD 3O13A 2AQ1B 4BWGB 1I4GA 1JWMD 1CHQD 2O2LD 1I4RA 2SEBD 3MC0B 3SEBA 1PTOH 3BYTB 1GOZA 1BCPC 2TSSA 1PRTD 1S5BD 1JWUD 1HXYD 1PRTF 1TY2A 3MFGA 5ELDA 1BCPD 3BYYB 1PZID 4K6LA 1RCVD 1XTCD 4C56C 3BVZA 1SXTA 1PTOD 1PTOB 1PTOC 2CHBD 2IPKD 1FNWA 1SE4A 1KLUD 4L63B 4TSSA 3BZDB 1RD9D 4RGNA 1CT1D 1G8ZD 2XRQD 4RGOS 1EU4A 1JWSD 5FKAC 1PRTC 4RCOA 1L0XB 1LT5D 5I4DA 1S5CD 1DJRD 1L0YB 1LLRD 2AQ2B 1LTAD 1TS5A 3BVGA 5ELBA 1KTKA 3R2TA 1SBBB 5ELFA 1V1OA 4ZYSA 5FK9C 1I4QA 4RGTA 1RF2D 3GP7A 1I4PA 1ESFA 1RDPD 1TS4A 2J4XA 1YN3A 1EU3A 1PZKD 1SE2A 1DYQA 1YN5A 2G9HD 4RFBA 1PTOF 3URYA 1CHPD 4RH6A
chains in the Genus database with same CATH superfamily
4LNOA 3WDNA 2XTIA 2J0TD 4XDDA 3GTMB 4LUVA 2WP9B 3S2AA 4DNRB 5IN7A 1FD7D 2A73B 1X3GA 2C5CA 2EYPA 4K0KQ 5F2DA 3M4YA 2ZTDA 3RLFA 2LXKA 3I4NH 1EEID 4BKSD 2JN4A 2F4IA 1Y1VB 4RGMA 4K7SA 2BH8A 1F2MA 2FIDA 3C1EA 1D1IA 4BBNC 1TS3A 1PDQA 5TSSA 5KHQA 2JE6I 4IW0A 2F0DA 3KF6B 3PO3G 1NE3A 1Q0WB 1HA6A 4WJNA 4X57B 1NMFA 1XXGA 3CRLC 2M00A 2PW7A 2HUGA 4DHZB 3EROA 2MNAA 4KGTA 1NENB 2BYFA 4N58A 3ZJUA 4ID6A 2IDYA 4ZCKA 4HJKA 1UE5A 2NWGA 4X66L 1L5PA 4CDDC 1YQ4B 2NUCA 4WRDA 3NE5B 2M1MA 4IO9A 4X62Q 2KMMA 1GKHA 5DEHA 3MVVA 4ZRJA 1AZQA 1L1OB 2WINB 2A19A 3UI3A 3K9OB 3NWSA 1DOMA 3S1NH 2NCNA 1V1PA 3A54A 2WKCA 1TKWB 2B2UC 4MNOA 4QQBX 1WFYA 2NBUA 1CK1A 2NBWB 2NMQA 3NVWA 1RRBA 1ROEA 3HM3A 4HPMB 4QUCA 2ZNVB 1X54A 3VR4A 2PPBC 3V2TA 4W9KA 1E90A 3HOXH 4KV6A 5IT9L 1TBEA 1RFKA 1UD7A 1RHPA 2O6VD 3QCAA 1VQPA 1CHQD 3MP9A 1A63A 2NVUI 5EBDA 3ZNZB 3L0OA 3ND9A 2Q2IA 2C7HA 3T1HL 4B3MQ 3HVDA 1XWEA 1A0IA 3GZNI 2OTJA 4A93B 3W5UB 5FLXE 5IP7G 3IVFA 1FCCC 3PSIA 5DNFA 4DAYB 2F3IA 2KCNA 4TMAB 1A15A 1B9NA 5BMGA 1IGDA 3EN2A 1XO3A 4DNTB 3RN9C 1GHKA 5M5YH 4C7YA 2N7EA 4OX9L 3RULA 3AU5A 4DBGA 3QB3A 4BS9A 5GQOA 4ASWC 3VR6A 1HR0L 2QDFA 2FMMA 3PRMB 1ZEQX 1NDDA 1K51A 2ONQA 1WGRA 3DBRI 1AYFA 3PZ8A 3GTPB 3PRZA 1VMPA 4V0BA 3TEYA 1KOTA 4X65L 1LT5D 3M4OB 5C0XJ 4X3SA 4WWNA 4A3EB 4A3CG 1O7YA 3A1QA 1TJEA 3AE6B 4LFCQ 1QOGA 2K5HA 4PK1A 1GNUA 3KBXA 1JALA 3J80E 3DPDA 1GPXA 3KF6A 3GTLH 3APDA 1YHBA 3VVWB 1EQRA 2DZJA 1V2YA 4FHKA 3ZIMA 2G9HD 3QIAA 2RQXA 2BE5C 2F0WA 3JAME 4JK1C 3RMHA 3PO2H 4GKJL 1PGXA 2Q5WD 3ONSA 4IUQA 5IGBA 2FCMA 1XNQQ 3ZNHB 3OWEB 2K52A 4DUZL 1XNQL 4DV1Q 4DR4Q 3UIOB 4A3LG 1F2RC 2F0KA 1I50H 3DWPA 3TREA 3QA8A 1SJHD 2EY5A 2PEAA 1BBXC 4M8AA 2BDNA 4A3CH 2ASQA 1K83H 1VZ7A 3I7FA 1E7ZA 5JPMC 2JA8H 1YNJC 4JLCA 1NBFC 3J7YW 3PZ7A 3GOEA 3A9JB 2JQOA 5C4XH 5CV6A 2F0MA 1UBQA 5CR3A 3RNAC 3U4VA 2AYOB 4J8QA 5C5MA 1R4MB 1F52A 4YY3Q 3U2SC 2SNMA 3BK2A 1B1ZA 2PI2A 5IIFA 1WE7A 3GTGH 3OPOA 1PZJD 1XMOL 4DXGA 2KK8A 4CDEC 1WTXA 2HE7A 2V1YA 1T5EA 5HGQA 3AE5B 3NBHA 1KLGD 4F1SA 2LMCA 2PW5A 2UYZB 3Q3NC 5IGDA 3ULPA 1SB3C 4C4VA 1SYEA 1SNPA 3I4NG 3PUZA 3BY4B 4HJ5A 1VCIA 4MIUA 1O7ZA 3H6MA 4R4TA 4CBVA 3R8BA 1T5XD 1LTGD 1UUPA 3VYRA 1WCMB 2NPTB 1VS0A 2ON8A 4HEA1 5EE9A 3Q0AA 5C4XB 3S17H 4RA8A 2K28A 3I72A 1E0BA 1PGBA 1XLPA 2XK5B 3DVGY 4YCWA 3FILB 5BR8L 1I7HA 1BBWA 2VQEQ 5GAEC 2RF4A 3KH0A 3L7ZC 3F2CA 4JI8L 2N9XA 1KAAA 4ZUJA 4I65A 4E6IA 2MA9B 3KYCD 5EPKA 4CQNA 1ET6A 2JP1A 4QCLA 2UUCL 1FNUA 1E2VA 3OTOL 2KO3A 2M56B 1VQNA 1PYWD 3KFUA 2B2UA 2PW9A 2ZW1A 3OW7A 3T4AC 3NXWA 1FRRA 4HCPB 1C4QA 1R4MI 1BBUA 2J7ZA 2A5UA 1AEXA 2B2YA 2SEBD 2IY0B 3V6CB 2H4OA 4YTMB 2Q8RE 4LF6L 2IO2B 2BH2A 1JE5A 2Z6BA 3T1YQ 1HXYD 2WACA 4HMJA 4NKLA 1TY2A 3KUPA 4C00A 1EIHA 3RI7C 3GE3C 4A3JB 2AEHA 2KVMA 1FMAD 1N34Q 4FP5D 3S16B 3QG1A 4O0AA 1RTNA 1UE7A 4US9A 5LL6X 1GC7A 1OTRB 4DQOC 3SE0A 2BQQA 4RMFA 2M4NA 1WX8A 4X3TA 2B29A 1CZPA 2C60A 3AE4B 3IXSA 3IG3A 2G5DA 1YNJD 4JI7L 3QIJA 3DBLB 1LTAD 1YNXA 1E10A 3BS1A 3PVLA 1P3QU 1AFPA 1SBBB 1CSPA 4RNAA 3A74A 4MJSA 2N7DA 3A4SC 1PH9A 1R9TH 1V86A 2D10A 4KN4C 1KRHA 4HROA 2J4XA 3S9WA 4DR7L 2K5WA 2I1JA 1EY9A 1SR3A 1WCMH 3H0GB 2K9XA 4JIOU 3E0JA 5FLXL 1DD2A 1X3PA 2RHSB 4RFBA 1ACCA 4X3KA 1K8RB 1SIFA 5LMUQ 2L76A 3LB8C 4JBKA 4EZKA 4MH8A 1Y1VG 3Q8FA 3X23A 1R4QB 5AUKA 2KVRA 2B3AA 2QGQA 2H89B 5H8YE 4LW1A 2BS3B 4M1UB 4KY6A 2JK8A 2WGSA 3CSFA 5CV4A 1Q1BA 4YSZB 2WIIB 2O5JC 3DWQA 3I73A 1PV4A 4TQ1A 4WJPA 4EQNA 4FO2A 1K50A 4H02A 1Q86C 1WGDA 1SROA 4C3HH 4BY7H 2DX5B 4DV7Q 1PH2A 4TKOB 2R7ZB 3IBEA 2BA1A 4W9CA 3OAWA 1E22A 3SGIA 4POGA 5G5HA 4A3BB 2JU6X 3GTOH 4G7ZC 2QW7A 1LABA 1BCPB 2AMCB 5CV5A 3VYSA 3A8KE 3VTWA 2Q8IB 1AW7A 1J5EQ 1FGUA 2FE8A 1LTRD 1HCZA 2K5NA 2L9HA 3IAM1 5L83A 2EVBA 2XSCA 1F9JA 1EWCA 3I9V1 4FJZA 1IL8A 1XPUA 3N6RA 1B53A 2F52A 1YEZA 3D4RA 4YCUA 2ASBA 2UXBL 4YWGG 2DNCA 2V0GA 4R4OA 4IOCA 4OHJA 2YLMA 3I5JC 5BN4A 2L8JA 3KW5B 4WH4A 5E6JA 2BYTA 1F9SA 2L00B 5COYA 4POFA 2KOXA 3DHHC 4LLGM 3ZNGC 2RKSA 4JI2Q 3CC7A 1U0LA 5I9PA 1H95A 3M4OH 1TWFB 2LFNA 2FCQA 3B2FA 4OONA 2A6HC 2CQAA 3BU2A 1YQ3B 2L0CA 4JQWC 5LMNL 5G2NA 3RNFC 1T3QA 3U4EG 3VXWA 1CFMA 1MGSA 5E7NA 1OGWA 3ZW3A 1HR0W 1I94L 3CAMA 2O6VB 3QC8B 1VR9A 3VUWA 2IY1B 2QC8A 3MC0B 1WX9A 1O7LA 2HT1A 1L7YA 2JYOA 3PLVA 2X69A 2D62A 3EHVA 4OL7A 3T16A 1RL2A 3VTVA 1L2FA 3BZCA 2ZXOA 3CPFA 2D5DA 2K33A 1M8AA 4C56C 2LI5A 1UWVA 2N9LA 2KUMA 3DCGA 4YSYB 5M3MH 2E76C 1YVCA 4XDCA 2E75C 2INPE 1GHJA 1UE6A 2J0MA 3LYYA 4PV1C 4BXXH 1L0XB 1SE9A 4IKGA 5ELBA 1W6KA 2I0QA 4GNXA 2UXDQ 2REXA 4M0WA 3EVQA 3GS2A 3W3AA 4ZYSA 2FBWB 4JI8Q 2LUMA 3B2GA 1JJCB 2QDLA 1WXSA 1V97A 3L2PA 1Q1EA 1K9MC 3TCAA 2LHDA 1FYCA 2MW5A 2LVPA 3ZYYX 4XC2A 1QF6A 3IRBA 2Q2HA 3OTOQ 5CGKA 2MSED 2KEEA 2KENA 2MJ8A 4IJHA 2QHOA 3L54A 2ZPYA 2D0OA 3K7UC 4N6EB 4WWMA 3PO0A 2L5TA 1I6HH 1F2ZA 2K5QA 3AECB 4DUZQ 2HHHQ 3QARA 3WAMA 2N4FA 2Z1CA 1E2ZA 3NSWA 4XTCS 2E74C 1FRDA 1VCBA 2CU1A 4G57A 4GKKQ 3S2HB 4FF3A 2DYBA 2F0TA 2PVOD 2ZW0A 3NUHB 3WAOA 1KLVA 2WU5B 3S24A 3V05A 3N30A 2BT6A 3IFDA 4W9LA 2VS1A 3D31A 2V3SA 4CDFC 4WJ3M 1LFDA 2IYDB 2G1EA 1V8CA 4BBRH 5IKCM 4ZK9B 3ICEA 4HKZE 2IO1B 1PVOA 2UXCL 3KF8A 3K7AB 1SE3A 4G7OC 4JYAQ 3KK7A 3S1MH 2W54A 5C1ZA 4OIKA 4YTNB 1MI2A 4M00A 4YWKA 2YU9H 4J15A 4IJLA 3N3KB 4L6TB 5AJ3L 3MHZA 5FO9B 2PIAA 2EYFA 1ASZA 1C8CA 4KI0A 5EQ0A 3GTMH 2DBYA 3IFWB 3UI2A 1IGCA 1PA6A 3T3NA 1D3ZA 4FHJA 2RPVA 1F9PA 1I4HA 1EEFD 3W1SA 2KD0A 2EJMA 2VUMH 1J0GA 1P7EA 1LV9A 2NVYH 1A8VA 4R4IA 2LGXA 5LL6S 1S40A 4I6PA 3VR9B 1QVCA 4RF0A 2PTLA 3OMGA 2F0QA 3HOWG 5FJ8H 1ZUD2 1Y8OB 3ZUNA 4K5WA 2I46A 3H7SA 1KAWA 1LO5D 1ZDXA 4A55A 2WDVB 3SD5A 1X6OA 1V5OA 1YIJA 2J0KA 1ET9A 3NHHA 4ME3A 2JZ3B 2BS4B 3TMEA 3ZXRA 2F0HA 3RNGC 5KNBA 1PUTA 4AQ7A 4XE0A 2JA7G 1HRJA 4A3IG 4UP8A 1QWYA 3WWVA 3MWYW 4C3JB 1STHA 1QKZA 3HS0C 4HMIA 2EZVA 4IG7B 5FR6A 3GTKH 1ICWA 3PUXA 3STBD 2ES2A 4LNNA 3T13A 1CM9A 2N78A 1I4RA 3CKIB 2BWFA 1WTHA 2WU2B 5IY0A 4GU2A 1JWUD 4M01A 4ZRPA 4B3ML 1M1KC 2UUAQ 1B8AA 1KNAA 2RMMA 3ZJTA 3SFDB 1VF5C 2KHSA 4B9KA 1QUQB 4U68A 1MG8A 1QLBB 3AEAB 3J81E 2KHJA 3V6EB 1KH0A 1I35A 3GV3A 3NEMA 1HR0Q 3UE1A 4IM0A 2LGYA 4PS7A 4GLAC 2E2DC 1MJEA 5CYUA 4KSKC 4A3FH 3AH7A 1GB1A 3Q23A 4JL9A 2F0OA 5DM63 2E2HH 3U52E 5LHY1 1S5CD 3QQ8B 4CHTB 2L1AA 3AQQA 2C9WB 1P8LA 2KX3A 1GUTA 4BXXG 2J7QB 2ZTCA 4HDOA 1HTQA 1P9DU 3AEFB 1E1TA 4NAMA 2BTEA 1RDPD 4DDID 4HSPA 2RSNA 4DAYA 4HJ7A 2KWCA 4FXDA 4EGVA 2LGSA 3FDTA 2QA4A 2PE6B 2KVZA 1XJVA 4A3DH 1PMRA 4BKGA 1QNUA 2RR9A 4NY0A 2R61A 4A6QA 1E1OA 2Q2UA 3NY5A 2NZHA 1X56A 5HHDG 4HJ9A 4WFN3 2GRIA 4BKSA 2PO4A 1S5DD 4BOZB 4YSXB 1A62A 2WB1E 1OXUA 2Q2TA 5T1IA 2O5IC 4GS3A 1FD6A 1NAPA 3LDZE 1C9FA 1TWHH 3C0RB 1D1KA 1STAA 4P6VF 4L5TA 2KYWA 2WHIA 1VQOA 4OWXB 4DV0L 3EGRA 2BW2A 1KD1C 5G55A 5BMHA 3RZFA 2MUYA 1DONA 4L23A 1JCKB 2MGSA 5DLQE 4DV1L 3CCUA 4RHSA 4P74A 3WOFA 1YJ1A 1ICFB 2IX1A 3NVYA 5IODA 1YX6B 2F0SA 2GVAA 1N36Q 2NS5A 1TWCH 3PUWA 4GN5A 1IBML 4DK5A 5BN5A 1N34L 4R4CA 1BMLC 1XCTL 4R1JA 4QB4A 1K8AC 1QG7A 4OWWB 2B3GA 3J81c 4YXDB 2B63H 1A2UA 4JI5L 3HOUG 3D6WA 3EIVA 5JVH3 1SYFA 1DOLA 4R4QA 1LM0A 4US8A 1SNQA 4DV4Q 4JI4Q 4MN3A 2QILA 1N63A 2J52A 5AZFA 2PZTA 3ITPA 4AQYQ 4CJ1B 1CKOA 5EDSA 1TIID 1FVIA 1X3FA 2BCOA 3ULLA 2OT2A 1SNCA 3PIP3 2PMZE 4AQYL 4B3SQ 3IAYA 4RM8A 1L6VA 3HK0A 3NUCA 5EBCA 1ISNA 2M8SA 4K5VA 1PFDA 4EUTA 1RTOA 1A3VA 2RDHA 1GUSA 2K14A 2EYHA 3NTHA 1ENFA 3HOVG 2YEPB 2YVCA 1K73C 2J0JA 4K2LA 1TKYA 5JHAA 1Q1OA 3B08A 2N1VA 1PYBA 5M5XH 3KBGA 2LVOA 4Y52H 3SEBA 1UZXB 2JA7B 3J81j 2G9DA 2ZXPA 1S5BD 2A69D 2RSOA 5IGCA 1PFBA 1V6EA 2UUAL 4KKJA 1VD2A 1WMHB 2JA8B 3J81i 4GOCA 1N61A 2MH7A 3RZDH 3NVZA 4P1BC 1C78A 2UUBQ 3A9KA 2NN6H 2NVXB 3MC8A 1MBYA 1SMYD 5M5XB 1CZGA 5K36H 3RLOA 1B3AA 1EZ8A 4GZYC 2DAJA 2O2VB 1I94Q 4JGHB 5FO7B 1SSOA 1V43A 4ZHPA 3UQAA 2EY1A 3JSVB 2SDFA 2B76B 2BE5D 4ANUA 4HCSA 3GTLB 1WM3A 4A3IB 2GBJA 3AI5A 4HDQA 4C7ZA 4RGTA 4M02A 2Z6KA 1G291 1F2YA 3J81L 2WXMA 2ZEQA 5IYCH 3S2DB 3APCA 5IA7A 1LUZA 3ZDMC 3KUZA 3NWTA 1QVGA 4XZ4A 2AUJD 5CBEE 2E2HB 2JX5A 4BBSG 4DR1Q 1JMCA 4TUUA 2QKIC 1WTVA 1STEA 2KEDA 3VDYA 3UF8A 4LDTB 3HRDD 1W6JA 4JBJA 1PFMA 5CV9A 2LHEA 1NJIC 2JSOA 3EFCA 1IZ6A 4GOPB 2QCZA 1A5RA 3NP8A 3M9BA 2ZJRA 4QF4A 1IKMA 4MJSB 1WGHA 4JG2A 4A93H 3ECIA 3U8ZA 4PG3A 1M90C 1WR6E 2QEXA 2BKRB 3D8GA 4YL8A 4LF7Q 3I4MB 1MG4A 2PQAA 2RHQB 4OEMB 4DV4L 2MQJA 2D2QA 5FJ8G 2SOBA 3CXCA 3R7QA 5ELOA 3H7PB 3W5VB 2NTSA 4IN3A 3Q6BA 5EPJA 3HOZG 4ZLTF 2JRHA 1VJKA 3MHBA 4IWQA 4PS3A 1AN8A 2VUMG 3W2DA 3J7ZC 1S72A 1R4NB 4A3KG 4A3JG 4LFBL 3STBC 4FA6A 1Q7YC 5J3BA 1IPGA 5IT9c 4DV3L 1P0RA 4H44C 3ZQ4A 3P63A 2NVYB 4GIVA 4GDLB 2NTTA 1KFYB 2R6GA 3QAQA 4JI1L 3JAMi 1WXQA 3BVMA 4KDIC 1HJPA 1QUQA 4QMGA 1YI2A 1Y1WB 3H3VC 1E8WA 1UF0A 4HJGE 4IUNA 1HE8A 2PLPA 2CS4A 5IWAL 1QILA 3U30A 2E5LL 2KQSA 2HCIA 4ZRQA 1OXXK 1N60A 1V5TA 1WRIA 4KKTA 2KXJA 1SMYC 1MJCA 4GKJQ 3AV8A 2ZT9C 3K8AA 4DFAA 2BB5A 4B08A 1E0ZA 1UGJA 5LMUL 1IP9A 3I4OA 4A9AA 3FAHA 1BUIC 1NI2A 1PTOH 3CCLA 2N7JA 4A3LH 1V8QA 3HKSA 2AWTA 1PRTF 5HURA 1M94A 3VAWA 1EYCA 2JZZA 4ULLA 1K0SA 4N8X1 4EX5A 2OEOA 3K5MA 4F8MA 2YEPF 5EE3A 4K6LA 2VL6A 4P71A 3I4NB 2EYMA 1VQIA 4K1RB 1PTOC 2NYZD 2ZTEA 1KRTA 2AHOB 2MBEA 1KC8C 4AJYB 4FXCA 5IP4D 1F2LA 3L0WB 1D4BA 4F7ZA 2XRQD 2R93B 2M17A 2LJIA 2Z9HA 1A6XA 3ML8A 2N8NA 5KNCA 2A4ZA 5FLMH 1LLRD 2BYVE 3RD4A 1KTKA 3RCZA 4ANXA 1OXTA 1QZGA 3AFQA 5ELFA 1S1QB 4FADA 2KWVB 3BDLA 2YTYA 3ER0A 4A3GB 4JPSA 4C1NI 3JW0X 3AE9B 3D4DA 4P73A 1CKMA 1I4PA 1VQBA 1XPRA 3RNCC 2WQYB 2KOLA 1XLQA 3L08A 2K04A 1AH9A 3E3XA 2IX0A 1B4OA 4LJZC 3F2BA 3T1HQ 4AYBE 1VQJA 2CR5A 4UPAA 4DV7L 1J9OA 1JR0D 4BY1B 2IO3B 1E9MA 2NN6I 2RDGA 5BR8Q 2KJRA 3H3VI 4N9PA 4ANWA 1IUEA 4P1CC 3H1UA 2F0FA 4IWOA 4BBSB 4MEMA 3R2IA 4GDLA 1UELA 3R93A 2OQKA 3HP3A 3S1MB 4APVA 3C46A 5FO8B 3VQIA 1FR3A 2CU3A 3NZSA 2WXLA 3SR6A 3MXNB 1WSPA 3EC8A 2EPBA 4FXKC 4IQZA 5GROA 4A3EG 3AYHB 4WQOB 3Q8BA 2ACZB 5J39A 3OG5A 2WXKA 2I5HA 2HHHL 4KHPQ 1B70B 2JSVX 3RYTA 3PTFC 4H0LC 3H3VH 4M8MA 2SNSA 1D5MC 2ZCCA 4KZ0A 1BUVT 1HFNA 2V3NA 1XX8A 2YYZA 5JZEB 4JVZA 1ILQA 2WXRA 1IBMQ 3L10B 3HM6X 3AU7A 3TQYA 2RPQA 4LF4Q 1GC6A 1JROA 2LXCA 2V3PA 3I8ZA 3ZJVA 1Y69U 1TKEA 1VQ5A 3KQ4A 3N9YC 3NTKA 3MFYA 4AS1A 1BCPF 4TVAB 2F0UA 1JB3A 1IBKQ 3EECA 1D6EC 4DPGA 2JA5H 1KQSA 4NXML 1EO6A 2K4KA 5D3IB 4OO1H 5CHFA 5EE0A 4LWCA 4O2DA 3J7AF 5JPNC 2F0JA 2PE9A 3X0WA 4L5QA 3A9KB 4RKBA 3HEJA 3EFXD 2D0PA 3CD6A 2FJ2A 2G3QB 5LMNQ 2W9NA 3AMUA 2HQLA 4MSQB 4P16A 1TT2A 2IX3A 2FCSA 1IYVA 3K6OA 4KGRA 3VR8B 4KTAA 5IYDG 3UDXA 1WYGA 4NJCA 1RYJA 1QE6A 2D3BA 2G45B 2L0FA 2CQOA 4ILWA 4G7HC 4NXNQ 1LTLA 4K3BA 5M3MB 5M3FH 5C3JB 4A3BG 4MGYE 1BCPC 2CWPA 2OJRA 2EQSA 4QY7A 1UAPA 1JRUA 3E0EA 3FVQA 4TKNA 2KWDA 5E3FA 2EKIA 4JOIA 4PZ8A 3J9CA 3C1FA 3VRAB 2L11A 4C3IG 4GSWA 4DR3Q 3FKIB 3MJWA 4ARCA 4JI0L 4ZUIA 3T3OA 2DZKA 4LFBQ 3M95A 5AUIA 2VXWA 1E2WA 1N9WA 1E6EB 2ZJQA 2GBKA 3N1YC 3VR5A 5M5WB 3RZOB 4DR6L 2ID0A 3KLRA 1ZXTA 4RGOS 2KACA 1PRTC 5EE1A 3ZGZA 2WDTB 4URKA 2MHJA 3GE8C 3BVGA 1OFFA 3E6ZX 1WJ6A 1N32Q 4DAVA 1DZ1A 2X38A 1Q46A 4PZ6A 5IYDH 2WXJA 4PYZA 4W9FA 1K28A 2K01A 3C3LA 2N9PC 1HZCA 3W9CB 4QAYA 3A8IE 4MT5A 1ZW7A 1YD8U 2BF8B 2K22A 2D2CC 2VW9A 2D07B 3H9DA 4NAWA 1YN5A 2VH1A 3PGZA 2HIVA 3SFEB 2RD0A 2KN5A 1MFWA 1Y8PB 3R7RA 2QDBA 4OO1G 1O80A 2NZOA 3L17A 1QOBA 1VDVA 3ZVVA 1PRTB 3KOJA 2HD5B 4EEWA 2ZNVC 4Z9CB 3ZTCA 1L0VB 4HRSA 4C2MB 1IYJB 3FEWX 1K3RA 3PGEA 4G50A 1EFID 3S1QB 3GTOB 1U4MA 3H91A 5C44G 3I90A 1FGBD 3KJPA 1SFOB 3S16H 4U673 3TBIB 2LRUA 1S5ED 3Q8AA 1GUOA 2JA9A 1QOAA 1YHAA 3KLSX 1AZPA 4TRDA 1WJNA 4PMWA 2JA7H 1ML0D 2WXHA 4JI7Q 2IO0B 1K3BC 1CZWA 3DXJC 3I55A 3H15A 1RWSA 4EKUA 3KDFB 4OGQC 2ZJDA 5D7GA 4C3IH 1F9RA 2MLBA 5H1SE 2Y0SG 2WB1B 3F2UA 4N9F4 2JRIB 1YJJA 5E1FA 1B50A 3QJYA 3EA6A 4R8NA 1PFSA 3CCVA 3NELA 2L0TA 5GXGB 4K8IA 2NVXH 1HEZE 3R3OA 3KLWA 2JF5A 5GMVA 3IKJA 4KV2A 3H94A 4C80A 3RFZB 4KVGB 1BXTA 3MZ5A 3S15H 3I3TB 4HTHA 3NVVA 2F0VA 3FRPB 3M85A 4E74A 1YJNA 1GVPA 1UEBA 5C3EH 4LF5L 1C79A 5FLXc 5JJZA 3JYUA 3L4PA 2XRSD 4K81A 3A55A 1BVSA 3BZKA 4DR2Q 1TQOA 1D5ZC 1ENCA 2C9OA 2A6EC 4IPHA 4KD4A 5ELCA 4DR2L 3HOZH 3NQIA 1MJDA 5A2QE 5C44B 1KABA 2WDQB 1SAPA 4KHZA 1V1PB 5J1ZA 4GOPC 1WF9A 4WJWA 1W3SA 3OOCA 1PDXA 2AUKA 2BKFA 2LUEA 1WCMG 2MPMA 4XYOA 5LMNW 5CORA 5IGFA 2M19A 4P7IA 3C2PA 4CJ0B 2GBNA 1B2TA 2E5LQ 4JBMA 4BBRG 4PT5A 1CI3M 1U5KA 3V96A 1E5WA 1ENAA 1FPYA 2UUCQ 3NHEB 1I3QH 3B6YA 1JWAD 2QSDA 4HKQA 2KQ3A 4NPSA 3F2DA 3HOYH 3N1XC 3V3XA 4EE2A 4GN3B 1D8LA 2LASA 5C4ZA 5CHVC 3VFKA 1GOZA 4B3SL 5D6JB 4KZCA 3AEDB 1L0WA 5BYQA 3RPFC 3GTJB 5EAYA 1DOYA 3IT6B 3GTQB 3DOWA 4KJNA 2DYMA 1J8CA 4FBJB 2F3VA 1EY6A 4H7BA 4OWTB 2CW0C 1PH7A 1OEYA 4JOIC 2CJOA 3BK1A 4WWPA 2Z4HA 1ZXIA 3PCOB 4RGNA 4LF8L 4II3B 2B2VC 4BVUC 2ZM6L 1G8ZD 4C3IB 1Z6HA 4CHKA 5FKAC 3RNUA 1DJRD 2K6AA 1EWYC 4FVMA 5KYIA 1P98A 4Y7NB 2VB2X 3H0GG 4YWLA 4LF9L 3MJ5A 2K1FA 4IDIA 2P5ZX 1LGRA 2YTXA 2LD9A 3HKZG 4C4VB 4DA2A 3G6JB 1RF2D 1HNZQ 1TWHB 3GTJH 4XQQA 1YN3A 3TN2A 1HFGA 1JMLA 1QQRA 3DQVA 1EY4A 2CFMA 3QK0A 2EYOA 3K81C 1I42A 1NR2A 2WFWA 2KMAA 1SE8A 2JA6B 4DAPA 3WALA 3KDFA 4NXNL 1Y56A 1C3TA 4LNKA 1ZXHA 3CPWA 3U58A 4DR4L 3D32A 4MACA 4W9JA 3ND8A 1QZHA 2OOBB 2X6GA 3LX0A 1KDAA 2F1MA 3CRKC 3L3OC 5C2TB 1P1AA 2A6ED 2RDFA 2Z8LA 4JI5Q 4USAA 1VQAA 1K8OA 1JW9D 2PMZB 1HZ5A 2CHZA 2W55A 1STNA 1XT9B 2JXMB 1XQQA 3Q3OC 4LF5Q 4GN1A 1LT6D 3FPPA 2WLBA 2D9UA 3DUZA 3AEGB 1VQDA 1N6ZA 3KUDB 4HJAA 5HKHA 4E71A 4RWSC 5JJIA 4IM2A 4A3MB 1YNND 3A8JE 1JOKA 4B9WA 1WTPA 4FLHA 2DNFA 1TWCB 4LNQA 2VZKD 2KFJA 3NJTA 2Y5PA 3PV1A 4XT1B 1HNXQ 2JA6H 2K32A 2IW3A 5M9OA 2B2TA 3RN2A 2JA6G 1HUNA 2VQFL 2L32A 4X64L 3ABVB 3K9PB 4GLSC 3RZWC 1KDCA 1WGGA 2MEKA 2MO0A 2CJNA 3CCQA 1C48A 5C3WA 2IJ0A 1FNVA 2KNBA 1EF5A 3AE3B 1RFAA 3IFTA 4PMCA 3PZDA 4GKKL 3DBSA 1KF6B 1ZYRC 4B0MA 1XYIA 1RJTA 1OQYA 4F88A 4ICVA 2DUDA 4JPBW 1JJGA 2MHVA 1WXMA 1TU2B 1U4PA 4ALPA 3CSTA 3AEBB 2YU9B 4WJ4A 1EIGA 3AE7B 4GNXC 3GTPH 1Q5WB 3OJ3A 2CKZB 2OCEA 2UXCQ 2K1BA 3QWZB 2CW0D 4WAFA 4KKSA 3U50C 4DK6C 4BWGB 2K39A 2K5VA 5C0XH 2INNE 3NZUA 1I4GA 5CX3A 1EYAA 4DHZE 3E9IA 3Q6SA 4WORA 2KDEB 2PKOA 1G6PA 2WXPA 1GUWA 1MKHA 1NI3A 5C23A 4BBRB 4IWPA 5EKKA 2DZIA 2F0NA 2E2JB 3GB1A 4HN7A 5T8IA 2LXJA 3MFGA 2LWPA 2MFIA 1IYUA 1YIWA 5A2QL 2CWAA 2R93G 2KQ4X 1XTCD 3Q69A 3Q3MC 2NN6G 4XWTA 3UIPB 1OXVA 2A68C 3W1BA 1EZ6A 1WH3A 1ZP0B 4LUZA 2CH4W 4L63B 4TSSA 1VQ7A 2IGDA 3FC4A 3NRZA 4D2KA 3HOYB 4BBNF 5IO9A 2JPHA 3N1ZC 3VTUA 1WYDA 4CDCC 5IP7H 3RZOH 1QVFA 4NQLB 4BKTA 3G6EA 1DM0B 2H1EA 5C4HA 1V81A 1LACA 1UH6A 3K7AH 4HAEA 5AEKB 1LM8B 2QCPX 4GLVB 3CC2A 1T0SC 3WOEA 2B2VA 3AE2B 1E8ZA 1DOKA 4ICUA 4IFDH 1NTGA 3P1HA 4K5XA 2J53A 2AWNA 3A1QB 2DAFA 4A3FG 1ESFA 3CP0A 2R2QA 3BWUD 4BBSH 5MPOA 3JC66 3CMEA 4V190 3S2HH 4MELA 3U7DA 1H9KA 4J1MA 2LEKA 1OXSC 4WWOA 4W9IA 2WNMA 3I56A 3URYA 3HKZB 4RH6A 5CBAE 1FM0D 4BY1H 3V61A 4AIMA 4B3TQ 1I6HB 3QOLA 3ALBA 4C3JH 4II2B 5BO4B 4DDGD 4B3TL 3HOXB 1SDFA 3DLLA 5J17A 1UEAB 3QX1A 3DBHI 3W1SC 2OHFA 3WA0A 5CHWA 1CJEA 4IFDI 3MTSA 2CVRA 5IE8A 2F4VL 5IGGA 3HOYG 1KL9A 1T0QC 2SAKA 3AE8B 4DU9A 1C4AA 2I38A 1F77A 4REZA 3ZRCA 4Q2JA 4FF2A 3SR1A 2R7ZG 1KJTA 2VNUD 1VQ9A 3NTIA 1G91A 2EMTA 2ICEC 2KDBA 1SLJA 4LMQD 3P20A 1N5WA 1EM7A 2XNAC 1VZ8A 5EKLA 1YJ9A 1KRSA 2R93H 4XYCA 3TBLD 4BOSC 4KN7C 1GG3A 3KUCB 4KHPL 1KNEA 3HOWH 2R92B 4WJOA 4IUPA 5C3EG 2EYLA 5M3FG 4X66Q 1A70A 1WJ4A 1N5XA 4IOIE 4ME5A 3NQTA 1RIPA 5D3DA 3VDZA 2Z0EB 5CV8A 3DWAA 2HJ1A 1TZ1A 1II3A 3HOXG 4LNFA 5EGTA 4A3MG 2IGGA 3ZNID 3BDOA 4JI1Q 2I1KA 4K3CA 3DVNU 4LNIA 3AE1B 3MXNA 1X3EA 3P4PB 1DGSA 1FXIA 2C5LC 3HOUB 1L4DB 2KJ6A 4O1NA 2FCNA 1LXDA 1C7YA 4JI0Q 1Z9FA 2XWJB 3KWVA 2R92H 3HOWB 1AWDA 1AP0A 1B3QA 2K7VA 1QOFA 3SDLC 2ZVOA 1P7FA 1RAXA 1KIXA 4DXAB 1KDBA 2KFKA 2UU9Q 4LFAQ 5JJLA 2JWUA 3K80C 4IURA 3TP6A 1WI0A 3BYTB 4F7XA 3M3YH 4LAAA 1PRTD 5NUCA 4DR1L 2UXDL 2DWQA 4P72A 1MI0A 2FNJB 2X8XX 2XBBC 4C3JG 2KCCA 5ELNA 1J7CA 3NBIA 4NB3A 1WZ3A 4OXPA 4N59A 4PQXA 1YJIA 1RCVD 2ENBA 3BVZA 1K8GA 4MM3B 2KQ7A 2K75A 1FNWA 4G3XB 1IYFA 2MP2B 1PH5A 4DK3C 2KLGA 1IBXB 4B9XA 3M7NA 1FXTB 5DPWA 3M63B 2EYJA 2JUOA 4DN4M 4HJ8A 1HNWQ 1EQTA 1UBIA 5JEAJ 4RCOA 2ZJPA 1PHJA 1IBLQ 3DHGC 1JE4A 3MXPA 4ZRIA 4A8XC 2INCC 3PT2B 2MQHA 3Q8DA 5KRUA 4J6IA 3ERSX 1V1OA 1QJOA 2Z0DB 4KSLC 4QUFA 1Q8KA 1P16A 3I4LA 2JA5B 4LK1C 3S1RB 1OTCA 5DPRA 5HY6A 5K36G 1F9QA 2IWHA 2EKEC 2IZVB 4RAUC 3A0JA 1AARA 1Q12A 1DYQA 1MHXA 3J80i 1NMGA 3A56A 4IOAA 2IGHA 2B2WA 1VZ6A 1ZKOA 4XGAB 1SYBA 1C0AA 3P7JA 4W9EA 3TZUA 2DYOA 2DN8A 2N9KA 1BOSA 1L1OC 3K5NA 3APFA 5K5PA 3A33B 3H0GH 5L37A 2RBMA 5BN3A 2XWBB 3PF5A 1LYLA 5C0XG 2PMVA 1VLBA 4ZRZA 2KX0A 5C4JB 1BF4A 4HCNB 4Q5VA 2KA7A 1N33L 1TT5B 4DV6Q 1FJGL 2HTHA 2WB1G 3T53B 3IL8A 3P4QB 1YNNC 1GXDC 3T8MA 1BQQT 3HFZB 3MEFA 5ISRA 3HOVH 4MTNA 2WXNA 3TSSA 1HUMA 2DHZA 3DBLI 2RA4A 3ERQA 1WJJA 2HD3A 2K8CA 1OO9B 2V1CC 2GMIC 2L1BA 5TR5A 4DV5L 3R66C 2B8FA 2GVBA 3ZDTA 3G71A 1GB4A 2ICIA 3DHQA 1H4RA 3K5OA 5FOBB 1HQRD 1ZPSA 5BMIA 2ALYB 3PIO3 3R3MA 1N36L 1UNSA 1E8XA 5HFYA 4MHEA 3FKYA 4IPDA 1JOQA 5C6AA 3NBHB 1VQ6A 2K6QA 2LMCB 2WAQB 1NY4A 1I4XA 1JQYD 3RLNA 1HZAA 2NVQB 1U9RA 4YTPB 3SK8A 1Q8IA 2R3ZA 3U7ZA 4EQOA 4KKUA 3PMFA 4DV0Q 3TIXA 4KD3A 1TWAB 3C19A 2KFKB 2H88B 4H2AA 4MM3A 2K6DB 2FAZA 4JI4L 3NS8A 3NENA 3T1YL 2RGFA 2C7NB 4A3GH 1XD3B 5ELEA 2WXGA 3A7LA 3NZ3A 2I07B 5KYLA 1D2BA 4MGKE 3KYDD 2F0IA 1TKGA 2MWSB 3PRPB 1YHQA 1A3TA 5E6NA 3OSOA 4FN2A 2JT4B 1SIJA 2WX1A 3CHBD 2WP8J 3GD7A 2HTME 1XPOA 3O13A 3GTGB 2M0XA 1ZKHA 3DMUA 1CMXB 1WZ0A 3N32A 2UU7A 1VQLA 3QHTA 1JWMD 3K58A 2Z6KC 1QZEA 5IYBG 2O2LD 2UWQA 1EY0A 4G0NB 3Q3FA 1EOTA 3AULA 2O6VA 3ML9A 4S17A 2EXDA 5CMDA 4ANVA 2NVQH 1PFNA 3AXCA 5AZGA 1GUNA 2IY5B 3ZLZA 5JEAG 3RR5A 1UWXA 1PTOB 3FP9A 3TZDA 5LLIA 4DKAC 1ILPA 2K5PA 2IPKD 4ZKBB 4HXDA 1I50B 1XNRL 4YT0B 2KJXA 4QIWE 3U9OA 1ZYRD 4EVOA 1CKNA 5C4XG 1C4CA 1F2RI 2DZMA 3V60A 2HCCA 4KY7A 4LF8Q 1V1QA 1JWSD 4UP9A 4NP5A 3CW2C 3AU4A 1K0RA 3RD2A 1WTQA 2EE1A 1DXMA 1E7VA 1G2TA 3DVNV 4P2CB 3VHTC 3R2TA 2C35B 2KCTA 3MXGA 3SK5A 1JC7A 1XMQL 2K05A 4K7WA 2H5XA 1S3OA 2Z59B 4LCDE 5D65A 1VQEA 3GP7A 2ATWA 4FULA 1WFQA 3D0FA 1BR9A 3I2ZA 2RVLA 1K83B 2GOWA 1SE2A 1EY7A 4YIJA 2LFIA 3JVZX 3P42A 2NVTB 2G4SA 4AYBG 2C7MB 2OQ0A 4A3GG 1CHPD 4CO7A 2K25A 1I3QB 5E6OA 1SYGA 3NS1A 1OQRA 4QL5A 4IFDG 2BVCA 3PLUA 1WJUA 4PNYA 2L12A 5C3XA 2B2WC 4J3OD 4NQKE 1SRUA 1ZOYB 4W9HA 3AEEB 2F0LA 4OZAA 4OVZA 1GD7A 1SJED 3P2BA 1PH1A 3DWMA 4M8NA 2VY3A 1VQCA 1EYGA 1LTTD 1MSHA 2WXOA 5FR3A 5D94A 1BKBA 5IP9H 4L5SA 1QCBD 4DV2L 2OEDA 3ETRA 4CKBA 1QOHA 2PQEA 1XLNA 3CCJA 2MBBB 3M4PA 3A5ZB 1WD0A 3BJUA 3PV0A 4P75A 5C3EB 1IW7D 1R4PB 4CJ2C 2DJGC 3RUIB 1Q82C 3PO3H 1VQKA 3OIPA 2JYTA 4ZRKA 1WTRA 3D4WA 4HIOA 2R7DA 3HRZC 2EY2A 4CKCA 4DNIA 4JI2L 3PIPA 1MVKA 4HIMA 4IUUA 1SGHA 2PNRC 1HQMC 1PH6A 4DK1A 4QJFA 2O2VA 2B8GA 4DR5L 3S1NB 3ZRFA 1V9JA 3TL5A 2AKWB 3OJ4B 3HOZB 1V9PA 1T0YA 3TJPA 5JJKA 1SYDA 1NBWA 3M3YB 1J8IA 4B3RQ 5M3FB 1TWAH 4JYAL 4B3RL 2R7FA 3KYHC 2JVCA 4HR7B 1PH3A 3Q22A 1NR4A 3NOBA 1CKNB 4ABNA 3AN1A 4ACFA 4X3UA 2OF1A 4Y7NH 4IC7B 5IWAQ 1ASYA 1H9SA 1H9MA 4C2MH 1GJZA 4ITKA 1FCLA 1GO3E 4GDKA 4FXGC 5KIXA 3PUYA 3DBRB 4QIWB 4A4IA 5IT9E 4HWIB 1ESRA 3TUOA 3PO2B 1NYRA 5C5LA 2QIEB 1WI5A 1IBKL 3BG3A 3B1LX 3EJIA 3QWNA 3L9AX 4LFAL 2D5GA 4LDTD 2EXZA 5DPSA 2L7RA 1HH2P 5LXIB 2WAQG 1J5EL 4ZOHC 1WMHA 1BCPD 4JX1C 1XF5L 3DVGX 3BYYB 3OIQA 4C3HG 1SXTA 4BY7G 1EUJA 3SDZA 4A3EH 2WDRB 2EMSA 3PHWB 1VQFA 4C1NK 4XX5A 5IYCG 4I7AA 2HJ8A 2VH2A 3ONAB 3CCSA 2AX5A 5JOBA 3M7GA 1RM6C 2PNHA 1C76A 4PS8A 1T9HA 4UP7A 1CT1D 1JWBD 2GBMA 4PYUA 4W9DA 5BYSA 1O7IA 4F87A 1QT9A 1IHZA 2AQ2B 2DY8A 3QR8A 1LQBA 4IUVA 3DHIC 4A3OA 2CKHB 2NBVB 1L2NA 4DK0A 1F1HA 2BWES 3FKIH 4EZLA 2G4DB 1XMQQ 2OXPA 1SN8A 2RDBC 4HK2A 4IZ8A 3L13A 5JXVA 1JJ2A 2GI9A 4R3DA 3L16A 4JCVE 3I63C 4PMBA 1EIYB 1Y1VH 2B2YC 3MA2B 2MBOA 2OJWA 2VZKB 1TS4A 2Y0SE 2L4NA 2XK5A 3FILA 3VUXA 3A7AB 4B6WA 1L4ZB 2DENB 3VYTA 1CSQA 5JEAH 4JI6L 1TWGB 1TGZB 4DAMA 2QJLA 2B63B 1R7SA 4EQ5A 1WTOA 3K5LA 4WIPA 1G6JA 1JRPA 1ONLA 1X32A 2BPSA 2JWZA 4TQ0A 3J80c 1U4LA 4FYDA 4KX6B 4JBWA 2V4DA 4AYBB 2W3RA 1BNZA 1TVXA 2PI2E 1YJWA 1JICA 2E8GA 2YV5A 3LXFA 5DCNA 2XVSA 3A5UA 1L6UA 3TEWA 2UUBL 4NMZA 2FUHB 1NUCA 2WWZA 4UDUC 4LK0M 3HOVB 3DWGC 5EKIA 2V4IB 2UU9L 2ZZPB 2F3WA 5EPLA 5A35A 1JOOA 2GA4B 3OW2A 5KHOA 1X65A 4DUYL 1H9SB 2RSUA 2D3AA 4E3CA 3LWEA 4A3KB 2FUG1 1H8CA 4KJOA 1E7UA 1HTPA 4KMUC 3TEXA 3X3NA 4LF6Q 3S14H 1WYWB 1XEEA 1ZE3D 2A69C 4NZLB 2HQEA 5AJ3Q 3K57A 4GNXB 2LZ6A 1NCVA 4A93G 1NYQA 2GB1A 1H9JA 4JI3Q 2PPHA 5HGTA 2F0EA 1IW7C 2LXAA 1QNKA 2IL8A 4TQUS 1C1YB 2B63G 3G48A 3HOUH 1EY5A 1MHHE 2BBCA 1IL2A 3U4ZA 3N20C 3HG9A 2N0SB 1EL0A 4KK7A 5JAVA 3KVFB 3OHXC 1C4PA 2Y5BB 2JYEA 3EBEA 1RLFA 4DGZA 1ZGUB 2EELA 2K0PA 4JC0A 4HCEA 2L83A 4K2KA 4O42A 5I6YA 1OQQA 2FINB 1HTLD 4K6DA 5I9OA 4BA2I 2MJDA 1Q90A 3HHMA 2YTVA 2KHIA 5DAUA 1WWTA 4L2YA 3GQBA 1LTID 4AJWA 3VUYA 3HUIA 4G11A 1EF1A 1FO4A 2KMCA 1LTSD 2I5MX 3OYYA 3TS2A 4A3FB 3SVMA 1CA6A 4JWUC 3SXHA 3A4RA 3BIID 4DHJB 4MZ9A 1NNXA 4B0EA 2L15A 2R2OA 4EFOA 2BA0A 3J7A5 2NR2A 4DWFA 4OO1I 2KAJA 5HG2A 2PCFB 5ELDA 1K53A 2FMCA 3P75A 1GUGA 2OWOA 1PTOD 1FL0A 2CHXA 2LY7A 4MDKE 1J19A 1XTDA 2LS01 1VF7A 3W1GA 1VQ8A 2XGTA 3BZDB 2EOTA 5BYRA 1VMCA 3OWFA 2R7ZH 2B39A 2DGYA 3FKIG 1EU4A 4HPLB 4C3HB 4BY7B 3Q8EA 4I7ZC 4A76A 1ZDVA 2INDC 3C8YA 4YHHQ 3DEPA 1QB5D 4DUYQ 2M9VA 4UHVA 5FLMG 5JHBA 2JEBI 4HPPA 4GLXA 4IFDJ 2V4LA 3B9JA 1X3QA 3CMMB 3MAQA 2JZPA 2MP1A 4GMVA 1UWMA 1FIQA 5KGUA 1GUAB 1VQGA 1BO0A 1EU3A 1PZKD 3VYUA 1STBA 2A1AA 3PO2G 2HDEA 4JI3L 2N9EB 4RM9A 1NSNS 4MGZE 4NNJB 5CTRC 2KDIA 1EFWA 3T56B 4WAAA 4ZKCB 1IBLL 3E9SA 3AEVA 3F1ZA 4KIKA 2O4XA 2WYQA 2IT1A 3W5OA 4HEDA 1G2SA 4AH6A 2MCNB 3QOJA 3N52A 2N49A 1FFVA 3HGBA 4NXMQ 1SNDA 2N1WA 2KLCA 3M4QA 3S2DH 4NJ7A 4WJQA 2FHTA 4G4KA 3K0XA 2MBQA 1Y1WH 2JY6A 1X1MA 4FF1A 4YCVA 4A3IH 1X55A 4GOPA 4NDXA 2E2JH 4KHVA 2PQAB 4OW0A 1NVID 2JJQA 3D3RA 2XEWA 5CC4A 3H7PA 3KLSA 2Z4IA 4LUOA 1N62A 4GGQA 4F8CB 5GAHC 2BGFA 2AQ3B 3DDCB 4HSVA 4BZAA 1AE3A 1B44D 3E56A 1EOVA 4EZJA 4I6LB 3AM9A 2WS3B 1E24A 1J7BA 2L52A 4MTKA 2LJ5A 3PHXB 4GDKB 1S5FD 4K14A 4UY8C 3RN5A 4A3JH 4A3KH 1N8RC 1K52A 2BB6A 2GLSA 2KT7A 2A8VA 4FJYA 3RUZA 2WX0A 1TY0A 1SNOA 4ODGA 2JQRB 5KEEA 3VR3A 1Z47A 1V49A 1WD1A 4N8FA 1Q10A 1B9RA 1YMHE 2LGIA 3VR2A 3I57A 2D11A 3LNNA 4IUMB 1TXYA 1Y8RC 4ZHOA 1JQ4A 4XT3B 5EJWA 4HIDA 3VH3B 1V80A 5HI1A 4ZQ3A 4BA1I 4MH0E 2FIFA 4OVVA 3CCRA 1EQQA 2GBRA 3IAS1 3UINB 1TIFA 3SHQA 1TTNA 3BDCA 5IP9G 2BYEA 5CV7A 5IOIA 5L95C 1HNWL 5C44H 3DM1A 1I6VC 3PUVA 1PQSA 3S17B 3I4MH 1YQBA 3G7LA 1TR5A 4H13C 4AUQC 2TSSA 4ZAIA 4XQJA 1W2BA 2PVGC 1N32L 3UDFA 2TMPA 2F0GA 4EQPA 3J7AV 3BINA 4BY1G 2QMTA 2K8HA 4XQNA 3S15B 3P1MA 2AL6A 3AMZA 1HZ9A 4KIKB 1KXLA 3VH4B 2DJFC 3I3CA 2KHWB 4A20A 4XYQA 1GM5A 4LJPB 2I5LX 3P4RB 3UE0A 3TS0A 4A90A 1WM2A 2A74C 3WCQA 3EUB2 2MRPA 1RD9D 3K0YA 2Z0SA 2LVQA 4JWSC 3RT3B 1DOXA 1EY8A 3VA7A 1HZBA 1TWFH 2K03A 1WX7A 4JW0A 4OIJA 1L0YB 2KC2A 5D2MB 1RODA 2GN5A 3WIMA 3RZDB 1X9NA 5G3LD 3EQLC 3EFUA 1WOCA 3I91A 2KANA 1PYSB 1KM7A 1YNTE 3GV6A 4OX9Q 3TP8A 2LSSA 3RNBC 1SFOH 2E2IB 3M3JA 4DR5Q 2F03A 2RCFA 4LF4L 5AFWA 1TZOA 1YITA 2PJHA 3H8HA 2BOSA 1XLOA 5E6PA 3WANA 3ENEA 1PTOF 1TYGB 4ARIA 2KBNA 3M62B 1Y8NB 4R9WA 3CF5A 3KWLA 1B7YB 4X65Q 3ULJA 4KDLB 3DBHB 4A75A 2HIXA 1A3UA 2DY7A 1WXAA 2B2TC 1MIUA 4A3MH 4X6AH 5G5GA 1DGJA 1BDOA 3X3MA 1D5XC 3KJOA 3CQZH 3TRZA 4A3BH 2KWUB 5E4WC 3GTQH 1LT4D 5IYBH 4DV6L 1G6ZA 4HIKA 1CTMA 4IALA 1MD2D 1TS2A 3PO3B 2J42A 1SMXA 2JXXA 2Y0SB 2LGDA 2NPTA 4S3SA 4WQMA 4AWJA 2PYKA 4DV2Q 4OZCA 4TV3A 4B95A 1CA5A 3PS6A 3JAML 1VRAB 1HZ6A 1Q81C 5LXHA 1HTOA 2MJEA 4GN4B 1WXVA 2MBHA 5M5WH 1B9MA 1HPCA 2PZUA 4BAXA 1CQVA 2V9HA 1E7PB 3NG0A 3JSVA 1Q3LA 5I6WA 4FJVB 4S0RA 3TMPB 5M5YB 1YN4A 1STYA 1EWIA 4RKLA 4L5RC 2LRWA 4AOFA 3AFPA 3LWUA 1SSNA 4DV3Q 5GADC 3VRBB 3AB9A 4YY3L 1WVLA 4K7UA 2EY6A 1S4ZA 2IHEA 4RHRA 1U4AA 1YBYA 1FFUA 1R9TB 4BFRA 5LNK1 2L55A 4DF7A 2F4VQ 1WRDB 4OZBA 1VDZA 3CQZB 1LT3D 2VZAA 1WE6A 3PIOA 1K8MA 2MO1A 2WAQE 3UQBA 1VQHA 1XNRQ 5T1GA 4IPCA 1PH4A 1Y14B 4LF7L 2JXTA 2KKCA 3CC4A 1D7QA 4L8JA 3W1YA 4HLEA 1G51A 4DHJD 4A3DB 1E8YA 1EUVB 2KTRA 1JORA 2NVTH 3GDEA 4W9GA 2E2IH 4OVUA 2BS2B 3PSEB 2EJGC 3ZTDA 2A5HA 2VQEL 3Q8CA 2WXFA 3GO5A 4LF9Q 5E4XA 3DM3A 5C4JH 2OTLA 1PZID 1YZ6A 3WAPA 5IGEA 3UGBB 2ZXRA 4FF4A 2CHBD 3S1QH 1C77A 1SE4A 1KLUD 3TDQA 2M0AA 3RNEC 1I5FA 3MTNB 1N33Q 1H9RA 1F0ZA 2DNEA 4Q0FA 3SK6A 3TEHB 5C0XI 2FFKB 1IXRA 1IKLA 2Y3AA 3Q14C 5I4DA 4AP4C 4J6HA 5J2RA 2MJ3A 3E5SA 3IHPC 1FXAA 4DV5Q 2RCNA 2MX2A 1AE2A 1WR1A 5KNDA 2KDMA 1U4RA 2AWOA 4NJ6A 5JH5C 4JV5Q 3FPUB 4ZYNA 3Q3JA 5IAAC 1E3PA 4RCNA 1HNZL 1SNMA 2N88A 2ZPNA 2K50A 4LJOB 5G3LF 5GAGC 2IHFA 3PF4A 3H09A 4NW2A 3TEZA 3CU7A 1VQ4A 2CH4A 2JA5G 1JT8A 2WV6D 4X64Q 2EIFA 5AZHA 2Q8TA 1PGAA 4KY5A 2E6XA 1GAQB 4R8IA 2LKVA 1JB7A 5DPTA 5IOCA 4KLKA 4DXFA 3I4MG 2KC1A 5J18A 3MC9A 4OELB 2NB0A 1Z7TA 3PQIA 2EDGA 2HDLA 3FMCA 3CMAA 3T9LA 3IT4B 1HNXL 2KTFA 2D3CA 4IM3A 4CYEA 1WY8A 1LTBD 1PXUA 3U9SA 1PH8A 1T6BX 4DR6Q 2QF7A 5I2XA 3NK9A 1OEYJ 3HVZA 3HIZA 4ZDVA 3GTKB 1J7AA 1XCQL 3CCEA 2XIWA 2CHWA 2QEJC 1KHIA 3MXUA 2MP2A 1MSGA 3AB5A 1IBXA 1CQFA 2W3SA 4LFCL 1Z5SB 4FNFA 3HKZE 2XN9C 4DR3L 1C9OA 5J22A 2KN4A 4L1BA 1RKNA 2L05A 4YWMA 1R4NI 3CWIA 3QJZA 3F8TA 3D6CA 1DCZA 3MEHA 1YOVB 4WURA 3HZXA 2D3GA 1SF0A 3V62A 4DR7Q 1EWHA 1EYDA 2VRRB 3ZXVA 1HA5A 2KDFB 5D14A 3A9JA 1M4VA 4UAIA 3T51B 5I2YA 1MHWC 1SEBD 2KTRB 4MSMB 2KZRA 4IPGA 4K8JA 1GJXA 3ZKJC 4K0KL 2NBFA 4CGYB 3CF6E 3VA5A 1NEKB 3Q2AC 2K5DA 2N3SA 2JEAI 5H92C 4LTUA 4XXEA 1FJGQ 1YX5B 2WXQA 4IUTA 4FDBA 4KKIA 3UDGA 4EOYA 3FHWA 1EIFA 2L3ZA 1T0RC 3H6NA 4A3PA 1FEHA 4GXBA 1Y1WG 2FXQA 3E9HA 2AQ1B 3QO2A 5DM73 2X6LA 2I2YA 2ZM6Q 3I70A 1SYCA 2JA8G 3MHSD 2A68D 2F0PA 3O65B 4M0WB 4RMAA 2A6HD 3CCMA 1S3SG 3B0AA 1WTWA 3TP5A 2UXBQ 2KJHB 4MGIE 3J80L 3LGJA 3K59A 4YHHL 1UGMA 3SHLA 1Z2MA 2M2LA 1PLFA 3TP7A 2K8BA 2WXIA 4GB9A 4KGSA 4NPNA 1A2TA 3S1RH 4JE3B 1MPEA 3GZNB 2NZ1D 2PZWA 3P4SB 3SK4A 2BDOA 4QGUA 3LJ3A 1L1OA 1HHVA 4JV5L 1J6QA 2ZCBA 4CKEA 4I6NB 3OLMD 2IBIB 4X62L 4XIGS 2CCZA 2DLBA 2K3UA 4JI6Q 2WKDA 3S14B 1WGYA 2KECA 1O78A 4PZ7A 4XDXA 2HDMA 1TWGH 1VQMA 3NPPA 2KCMA 3UDIA 4HVBA 4RF1A 1TS5A 1XMOQ 1CUKA 5JVG3 3DEOA 2VB3X 2N55A 2Y5CA 4RG1A 3CIRB 3Q24A 1BT0A 1UE1A 1WIAA 3SU8X 5FK9C 1I4QA 1STGA 3PREA 1EQVA 2W82A 2R92G 1WGKA 3KF8B 4A3DG 2AL3A 3ZJYC 4N9TA 3OMCA 4NAWB 2VUMB 4XWWA 5M3MG 2VQFQ 3ZO5B 2EJFC 3JAMc 2ZVNA 2E3TA 3G4SA 3PPAA 1DOIA 3RMKC
chains in the Genus database with same CATH topology
3WDNA 4XDDA 2J0TD 3GTMB 2WP9B 4DNRB 1FD7D 2A73B 2C5CA 2EYPA 5F2DA 3M4YA 3RLFA 1EEID 2F4IA 1Y1VB 4RGMA 1F2MA 3C1EA 1D1IA 1TS3A 1PDQA 5TSSA 2JE6I 2F0DA 1HA6A 1XXGA 3CRLC 2M00A 2PW7A 2HUGA 3EROA 4KGTA 1NENB 4N58A 3ZJUA 4ID6A 2IDYA 2NWGA 1L5PA 1YQ4B 2NUCA 4WRDA 3NE5B 2KMMA 5DEHA 3MVVA 1AZQA 2WINB 3UI3A 3NWSA 1DOMA 1V1PA 3A54A 2WKCA 1TKWB 2B2UC 2NMQA 3NVWA 1CK1A 1ROEA 4QUCA 3VR4A 2PPBC 3V2TA 4KV6A 5IT9L 1RFKA 1RHPA 1CHQD 3MP9A 5EBDA 3ND9A 3HVDA 1XWEA 4A93B 3W5UB 5FLXE 1FCCC 5DNFA 2KCNA 4TMAB 5BMGA 1A15A 1B9NA 1IGDA 1XO3A 4DNTB 4C7YA 1GHKA 3QB3A 4BS9A 3VR6A 2FMMA 1ZEQX 1K51A 2ONQA 3TEYA 1AYFA 3PZ8A 3GTPB 1VMPA 4V0BA 1LT5D 3M4OB 5C0XJ 4X3SA 4A3EB 1O7YA 1TJEA 3AE6B 1QOGA 3KBXA 1JALA 3J80E 1GPXA 2G9HD 3QIAA 2RQXA 2BE5C 2F0WA 3JAME 4JK1C 3RMHA 1PGXA 2Q5WD 4IUQA 5IGBA 3OWEB 1F2RC 2F0KA 3DWPA 1SJHD 2EY5A 1BBXC 4M8AA 2BDNA 1VZ7A 5JPMC 1YNJC 3PZ7A 3J7YW 5CV6A 2F0MA 5CR3A 4J8QA 5C5MA 3U2SC 2SNMA 3BK2A 1B1ZA 5IIFA 3OPOA 1PZJD 4DXGA 1WTXA 1T5EA 3AE5B 3NBHA 1KLGD 2LMCA 2PW5A 5IGDA 1SB3C 1SYEA 1SNPA 3PUZA 1VCIA 4MIUA 1O7ZA 3H6MA 4CBVA 3R8BA 1T5XD 1LTGD 1UUPA 3VYRA 1WCMB 2ON8A 4HEA1 5EE9A 3Q0AA 5C4XB 4RA8A 2K28A 3I72A 1E0BA 1PGBA 1XLPA 3FILB 1I7HA 3L7ZC 1KAAA 4ZUJA 4I65A 4E6IA 5EPKA 4CQNA 1ET6A 2JP1A 4QCLA 1FNUA 1E2VA 2M56B 2PW9A 1PYWD 2B2UA 2ZW1A 3OW7A 3T4AC 3NXWA 1FRRA 1C4QA 2J7ZA 1AEXA 2B2YA 2SEBD 2H4OA 4YTMB 2Q8RE 1HXYD 2WACA 4HMJA 4NKLA 1TY2A 3KUPA 1EIHA 4A3JB 2KVMA 1FMAD 3S16B 4FP5D 3QG1A 1RTNA 4US9A 5LL6X 4DQOC 3SE0A 4X3TA 1CZPA 3AE4B 3IXSA 1YNJD 1LTAD 1E10A 3BS1A 1AFPA 1SBBB 4RNAA 4KN4C 1KRHA 4HROA 2J4XA 3S9WA 2K5WA 1EY9A 3H0GB 2K9XA 3E0JA 5FLXL 1DD2A 1X3PA 1ACCA 4RFBA 3LB8C 4X3KA 4MH8A 3Q8FA 1R4QB 5AUKA 2H89B 5H8YE 2BS3B 4M1UB 4KY6A 5CV4A 1Q1BA 4YSZB 2WIIB 2O5JC 3DWQA 3I73A 4TQ1A 4EQNA 4FO2A 1K50A 4TKOB 2R7ZB 2BA1A 5G5HA 4A3BB 2JU6X 4G7ZC 1LABA 1BCPB 5CV5A 3VYSA 3A8KE 2Q8IB 1AW7A 2FE8A 1LTRD 1HCZA 2L9HA 3IAM1 2EVBA 2XSCA 1EWCA 3I9V1 1IL8A 3N6RA 1B53A 3D4RA 4YWGG 2V0GA 2DNCA 4OHJA 5BN4A 4WH4A 5E6JA 2BYTA 1F9SA 5COYA 4LLGM 2RKSA 5I9PA 1TWFB 2LFNA 3B2FA 2A6HC 2CQAA 1YQ3B 2L0CA 1T3QA 3U4EG 1CFMA 1MGSA 1VR9A 3MC0B 1O7LA 2JYOA 2X69A 2D62A 4OL7A 3T16A 2ZXOA 2D5DA 2K33A 1M8AA 4C56C 2N9LA 2KUMA 4YSYB 2E76C 4XDCA 2E75C 2INPE 1GHJA 3LYYA 4PV1C 1L0XB 4IKGA 5ELBA 1W6KA 4M0WA 3EVQA 3GS2A 3W3AA 4ZYSA 2FBWB 2LUMA 3B2GA 1V97A 1Q1EA 2LHDA 1FYCA 3ZYYX 1QF6A 5CGKA 2KEEA 2MJ8A 4N6EB 4WWMA 3PO0A 2L5TA 1F2ZA 2K5QA 3AECB 2Z1CA 1E2ZA 3NSWA 4XTCS 2E74C 1FRDA 4G57A 3S2HB 4FF3A 2PVOD 2F0TA 2ZW0A 3NUHB 2WU5B 3V05A 2BT6A 3IFDA 3D31A 2G1EA 1V8CA 4ZK9B 4HKZE 3KF8A 3K7AB 1SE3A 4G7OC 3KK7A 2W54A 4OIKA 4YTNB 1MI2A 4L6TB 3MHZA 5FO9B 2PIAA 2EYFA 2DBYA 1C8CA 4KI0A 5EQ0A 3UI2A 1IGCA 3T3NA 2RPVA 1F9PA 1I4HA 1EEFD 3W1SA 2EJMA 1P7EA 1LV9A 5LL6S 3VR9B 4RF0A 2PTLA 3OMGA 2F0QA 1ZUD2 1Y8OB 4K5WA 2I46A 1LO5D 1ZDXA 4A55A 2WDVB 1ET9A 3NHHA 2BS4B 3TMEA 2F0HA 5KNBA 1PUTA 4AQ7A 4XE0A 1HRJA 1QWYA 3MWYW 4C3JB 1STHA 1QKZA 3HS0C 2EZVA 4HMIA 1ICWA 3PUXA 3T13A 1CM9A 1I4RA 3CKIB 2WU2B 1JWUD 4ZRPA 1KNAA 2RMMA 3ZJTA 3SFDB 1VF5C 2KHSA 4U68A 1QLBB 3AEAB 3J81E 1KH0A 3GV3A 2E2DC 5CYUA 3AH7A 1GB1A 3Q23A 2F0OA 5DM63 3U52E 5LHY1 1S5CD 4CHTB 2L1AA 1GUTA 3AEFB 2BTEA 4NAMA 1RDPD 4HSPA 2RSNA 4DAYA 4FXDA 4EGVA 3FDTA 1PMRA 1QNUA 2R61A 4A6QA 5HHDG 2GRIA 4WFN3 2PO4A 1S5DD 4YSXB 1OXUA 5T1IA 2O5IC 1FD6A 1NAPA 1C9FA 1D1KA 1STAA 4P6VF 3EGRA 2BW2A 5BMHA 2MUYA 1DONA 4L23A 1JCKB 2MGSA 4RHSA 3WOFA 2IX1A 3NVYA 5IODA 2F0SA 3PUWA 5BN5A 1XCTL 1BMLC 4QB4A 4YXDB 1QG7A 1A2UA 3D6WA 5JVH3 1SYFA 1DOLA 4US8A 1SNQA 2J52A 4MN3A 2QILA 1N63A 2PZTA 3ITPA 4CJ1B 1TIID 2BCOA 3IAYA 3PIP3 2OT2A 1SNCA 1L6VA 3NUCA 5EBCA 4K5VA 1PFDA 1RTOA 1A3VA 2RDHA 1GUSA 3NTHA 2EYHA 3VRAB 1ENFA 2YEPB 4K2LA 1TKYA 3KBGA 3SEBA 2JA7B 2G9DA 2ZXPA 1S5BD 2A69D 2RSOA 5IGCA 1PFBA 4KKJA 2JA8B 1N61A 2MH7A 3NVZA 1C78A 2NN6H 2NVXB 1MBYA 1SMYD 5M5XB 1CZGA 5K36H 1B3AA 1EZ8A 4GZYC 5FO7B 1SSOA 1V43A 4ZHPA 2EY1A 2SDFA 2B76B 2BE5D 4HCSA 3GTLB 4A3IB 4C7ZA 4RGTA 1G291 1F2YA 3J81L 2WXMA 3S2DB 3NWTA 2AUJD 5CBEE 2E2HB 2JX5A 2QKIC 1WTVA 1STEA 2KEDA 3HRDD 1W6JA 1PFMA 5CV9A 2LHEA 2JSOA 3NP8A 4QF4A 1IKMA 3D8GA 3I4MB 2SOBA 3W5VB 2NTSA 4IN3A 5EPJA 4ZLTF 1VJKA 3MHBA 1AN8A 3W2DA 4H44C 3ZQ4A 3P63A 2NVYB 4GDLB 2NTTA 1KFYB 2R6GA 1WXQA 3BVMA 4QMGA 1Y1WB 3H3VC 4HJGE 4IUNA 2PLPA 1QILA 2HCIA 4ZRQA 1OXXK 1N60A 1WRIA 4KKTA 1SMYC 3AV8A 2ZT9C 4DFAA 2BB5A 4B08A 1E0ZA 1UGJA 4A9AA 3FAHA 1BUIC 1PTOH 2N7JA 1V8QA 1PRTF 5HURA 1EYCA 4ULLA 2OEOA 3K5MA 4F8MA 2YEPF 5EE3A 4K6LA 3I4NB 2EYMA 1PTOC 2NYZD 4FXCA 1F2LA 1D4BA 2XRQD 2R93B 2LJIA 1A6XA 5KNCA 1LLRD 3RD4A 1KTKA 1OXTA 5ELFA 3BDLA 4A3GB 4JPSA 4C1NI 3AE9B 3D4DA 1I4PA 2WQYB 2KOLA 1XLQA 2K04A 2IX0A 1B4OA 4LJZC 1J9OA 1JR0D 4BY1B 1E9MA 2NN6I 2RDGA 4N9PA 1IUEA 2F0FA 4BBSB 3R2IA 3R93A 3HP3A 3S1MB 3C46A 5FO8B 3VQIA 1FR3A 2CU3A 3SR6A 2WXLA 1WSPA 2EPBA 4FXKC 4IQZA 3Q8BA 2ACZB 5J39A 2WXKA 2JSVX 4H0LC 2SNSA 1D5MC 1BUVT 1HFNA 2V3NA 1XX8A 2YYZA 1ILQA 2WXRA 3AU7A 1JROA 2V3PA 3ZJVA 3I8ZA 1Y69U 1TKEA 3KQ4A 3N9YC 3NTKA 3MFYA 4AS1A 1BCPF 2F0UA 1JB3A 1D6EC 5D3IB 4OO1H 5EE0A 3J7AF 5JPNC 2F0JA 4RKBA 3HEJA 3EFXD 2FJ2A 3AMUA 4P16A 1TT2A 2IX3A 1IYVA 3K6OA 4KGRA 3VR8B 4KTAA 1WYGA 4NJCA 1RYJA 1QE6A 4OZCA 4ILWA 4G7HC 5M3MB 5C3JB 1BCPC 1UAPA 3FVQA 2KWDA 5E3FA 2EKIA 3J9CA 3C1FA 2L11A 4C3IG 3FKIB 4ARCA 4ZUIA 3T3OA 5AUIA 2VXWA 1E2WA 1E6EB 3VR5A 5M5WB 3RZOB 2ID0A 3KLRA 1ZXTA 4RGOS 2KACA 1PRTC 5EE1A 3ZGZA 3BVGA 1OFFA 3E6ZX 4DAVA 1DZ1A 2X38A 2WXJA 2K01A 3C3LA 3W9CB 3A8IE 4MT5A 2K22A 2D2CC 1YN5A 3SFEB 1Y8PB 2QDBA 4OO1G 1O80A 1QOBA 1VDVA 1PRTB 4Z9CB 1L0VB 4HRSA 4C2MB 3FEWX 1EFID 3S1QB 3GTOB 1U4MA 3H91A 3RPFC 3I90A 1FGBD 1SFOB 4U673 3TBIB 1S5ED 3Q8AA 1GUOA 1QOAA 3KLSX 1AZPA 4TRDA 4PMWA 2WXHA 1ML0D 3DXJC 1CZWA 1RWSA 4OGQC 5D7GA 1F9RA 2WB1B 3F2UA 1YJJA 5E1FA 1B50A 3QJYA 3EA6A 4R8NA 5GXGB 4K8IA 1HEZE 3R3OA 3IKJA 4C80A 3H94A 3RFZB 1BXTA 3MZ5A 4HTHA 3NVVA 2F0VA 3FRPB 3M85A 1C79A 3L4PA 5JJZA 2XRSD 3A55A 1TQOA 1D5ZC 1ENCA 2C9OA 2A6EC 5ELCA 4KD4A 3NQIA 2WDQB 5A2QE 5C44B 1KABA 1SAPA 1V1PB 4KHZA 5J1ZA 4WJWA 3OOCA 1PDXA 2AUKA 2MPMA 4XYOA 2M19A 5CORA 5IGFA 3C2PA 4CJ0B 1B2TA 4PT5A 1CI3M 3V96A 1ENAA 1JWAD 2QSDA 4HKQA 2KQ3A 3V3XA 4EE2A 5C4ZA 1GOZA 3AEDB 5BYQA 3GTJB 1DOYA 3IT6B 3GTQB 4KJNA 2DYMA 2F3VA 1EY6A 4H7BA 2CW0C 2CJOA 3BK1A 2Z4HA 1ZXIA 4RGNA 2B2VC 1G8ZD 4C3IB 1Z6HA 5FKAC 1DJRD 2K6AA 1EWYC 4FVMA 5KYIA 4Y7NB 2VB2X 3MJ5A 4IDIA 4DA2A 3G6JB 1RF2D 1TWHB 4XQQA 1YN3A 3TN2A 1HFGA 1JMLA 1QQRA 1EY4A 2EYOA 1NR2A 2JA6B 4DAPA 1Y56A 1ZXHA 4MACA 3ND8A 2X6GA 3LX0A 1KDAA 2F1MA 3CRKC 3L3OC 5C2TB 2A6ED 2RDFA 2Z8LA 4USAA 1K8OA 1JW9D 2PMZB 1HZ5A 2W55A 1STNA 2JXMB 1LT6D 3FPPA 2WLBA 2D9UA 3DUZA 3AEGB 4RWSC 4A3MB 1YNND 3A8JE 1JOKA 4B9WA 1WTPA 1TWCB 2VZKD 2Y5PA 4XT1B 2K32A 2IW3A 5M9OA 2B2TA 1HUNA 2L32A 4GLSC 3ABVB 1KDCA 2MEKA 2CJNA 1C48A 5C3WA 2IJ0A 1FNVA 3AE3B 3IFTA 4PMCA 1KF6B 1ZYRC 4B0MA 1XYIA 1RJTA 4F88A 2MHVA 1TU2B 1U4PA 3AEBB 2YU9B 1EIGA 3AE7B 2K1BA 2CW0D 4WAFA 4KKSA 4BWGB 5C0XH 2INNE 1I4GA 1EYAA 3Q6SA 4WORA 2PKOA 2WXPA 1GUWA 1NI3A 4BBRB 5EKKA 2F0NA 2E2JB 3GB1A 4HN7A 5T8IA 3MFGA 1IYUA 5A2QL 2KQ4X 1XTCD 3Q69A 4XWTA 2NN6G 1OXVA 2A68C 1EZ6A 1ZP0B 3NRZA 4L63B 4TSSA 2IGDA 4D2KA 3FC4A 3HOYB 1DM0B 2H1EA 5C4HA 1LACA 4HAEA 2QCPX 3WOEA 2B2VA 3AE2B 1DOKA 4IFDH 3P1HA 4K5XA 2J53A 2AWNA 5MPOA 1ESFA 3BWUD 4V190 1H9KA 4J1MA 2LEKA 1OXSC 2WNMA 3URYA 3HKZB 4RH6A 5CBAE 1FM0D 1I6HB 3QOLA 3HOXB 1SDFA 1UEAB 2OHFA 1CJEA 4IFDI 3MTSA 2CVRA 5IGGA 2SAKA 3AE8B 4REZA 4DU9A 1C4AA 2I38A 1F77A 4Q2JA 4FF2A 3SR1A 2VNUD 3NTIA 1G91A 2ICEC 4LMQD 3P20A 1N5WA 1EM7A 2XNAC 1VZ8A 5EKLA 4KN7C 1KNEA 2R92B 4IUPA 2EYLA 1A70A 1N5XA 4IOIE 4ME5A 3NQTA 5D3DA 5CV8A 3DWAA 1II3A 5EGTA 2IGGA 3BDOA 3AE1B 3MXNA 3P4PB 1FXIA 3HOUB 1L4DB 4O1NA 3KWVA 2XWJB 3HOWB 1AWDA 1AP0A 2K7VA 1QOFA 1P7FA 1KDBA 2JWUA 4IURA 3TP6A 3BYTB 4F7XA 4LAAA 1PRTD 5NUCA 2DWQA 3E9SA 1MI0A 4C3JG 2KCCA 1J7CA 3NBIA 4N59A 4PQXA 1YJIA 1RCVD 2ENBA 3BVZA 4MM3B 1FNWA 1IBXB 4B9XA 3M7NA 2EYJA 4DN4M 1EQTA 5JEAJ 4RCOA 1JE4A 3MXPA 4A8XC 5KRUA 1V1OA 1QJOA 4QUFA 3I4LA 2JA5B 4LK1C 3S1RB 5K36G 1F9QA 2IWHA 4RAUC 1Q12A 1DYQA 1MHXA 3A56A 2IGHA 2B2WA 1VZ6A 1ZKOA 1SYBA 3P7JA 3TZUA 2DYOA 2DN8A 2N9KA 1BOSA 3K5NA 5K5PA 2RBMA 5BN3A 2XWBB 5C0XG 2PMVA 1VLBA 4ZRZA 5C4JB 1BF4A 4Q5VA 2KA7A 3T53B 3IL8A 3P4QB 1YNNC 1GXDC 1BQQT 2WXNA 5ISRA 3TSSA 1HUMA 2RA4A 3ERQA 1OO9B 2L1BA 2B8FA 1GB4A 2ICIA 3DHQA 3K5OA 5FOBB 1HQRD 1ZPSA 5BMIA 3PIO3 1UNSA 5HFYA 4MHEA 1JOQA 5C6AA 2LMCB 2WAQB 1I4XA 1JQYD 2NVQB 1U9RA 4YTPB 3SK8A 1Q8IA 2R3ZA 3U7ZA 4EQOA 4KKUA 3PMFA 4KD3A 1TWAB 2H88B 4H2AA 5ELEA 2WXGA 3A7LA 3NZ3A 2I07B 5KYLA 1D2BA 2F0IA 1TKGA 1A3TA 3OSOA 1SIJA 3CHBD 2WP8J 3GD7A 2HTME 3GTGB 3O13A 3DMUA 1JWMD 3K58A 2O2LD 1EY0A 1EOTA 5CMDA 1PFNA 1GUNA 5JEAG 1UWXA 1PTOB 3TZDA 1ILPA 2K5PA 2IPKD 4ZKBB 1I50B 4YT0B 2KJXA 3U9OA 1ZYRD 4EVOA 1F2RI 1C4CA 2HCCA 4KY7A 1JWSD 4NP5A 1WTQA 2EE1A 1DXMA 1G2TA 4P2CB 3R2TA 3MXGA 3SK5A 1JC7A 2K05A 5D65A 3GP7A 1BR9A 2RVLA 1K83B 1SE2A 1EY7A 4YIJA 2LFIA 3P42A 2NVTB 1CHPD 1I3QB 1SYGA 3NS1A 1OQRA 4IFDG 4PNYA 2L12A 5C3XA 2B2WC 4J3OD 1ZOYB 3AEEB 2F0LA 4OZAA 4OVZA 1SJED 3DWMA 1LTTD 1MSHA 2WXOA 5FR3A 2OEDA 1QCBD 3ETRA 4CKBA 1QOHA 2PQEA 1XLNA 1WD0A 3PV0A 5C3EB 1IW7D 1R4PB 4CJ2C 3OIPA 2JYTA 1WTRA 3D4WA 3HRZC 2EY2A 4CKCA 1MVKA 4IUUA 2PNRC 1HQMC 4DK1A 2B8GA 3S1NB 3HOZB 1SYDA 3M3YB 1J8IA 5M3FB 4HR7B 3Q22A 1NR4A 4ABNA 3AN1A 4X3UA 2OF1A 1H9SA 1H9MA 4ITKA 1FCLA 4FXGC 5KIXA 3PUYA 4QIWB 5IT9E 3TUOA 1ESRA 3PO2B 1NYRA 5C5LA 2QIEB 3BG3A 3EJIA 3QWNA 3L9AX 2D5GA 2EXZA 4ZOHC 1BCPD 4JX1C 1XF5L 3BYYB 3OIQA 4C3HG 1SXTA 3SDZA 2WDRB 4C1NK 3ONAB 2AX5A 5JOBA 3M7GA 1RM6C 1C76A 1JWBD 1CT1D 5BYSA 4F87A 1QT9A 1IHZA 2AQ2B 2DY8A 4IUVA 4DK0A 2OXPA 5JXVA 4IZ8A 2GI9A 4R3DA 4PMBA 2B2YC 3MA2B 2VZKB 1TS4A 2L4NA 3FILA 3A7AB 1L4ZB 3VYTA 5JEAH 1TWGB 2QJLA 2B63B 1R7SA 1WTOA 3K5LA 4WIPA 1JRPA 1ONLA 1X32A 4TQ0A 1U4LA 4FYDA 4KX6B 4JBWA 2V4DA 4AYBB 2W3RA 1BNZA 1TVXA 1JICA 3LXFA 2XVSA 1L6UA 3TEWA 4NMZA 1NUCA 4UDUC 4LK0M 3HOVB 3DWGC 5EKIA 2V4IB 2F3WA 5EPLA 5A35A 1JOOA 2GA4B 1H9SB 3LWEA 4A3KB 2FUG1 4KJOA 1HTPA 4KMUC 3TEXA 3X3NA 1ZE3D 1XEEA 2A69C 4NZLB 2HQEA 3K57A 1NCVA 1NYQA 2GB1A 1H9JA 5HGTA 2F0EA 1IW7C 3IAS1 1QNKA 2IL8A 4TQUS 1MHHE 1EY5A 2BBCA 3HG9A 2N0SB 1EL0A 4KK7A 5JAVA 3OHXC 1C4PA 2JYEA 4DGZA 2EELA 2K0PA 4HCEA 2L83A 4K2KA 4O42A 5I6YA 1OQQA 2FINB 1HTLD 4K6DA 5I9OA 4BA2I 2MJDA 1Q90A 1WWTA 5DAUA 4L2YA 3GQBA 1LTID 3HUIA 1FO4A 1LTSD 4A3FB 3SVMA 1CA6A 4JWUC 3SXHA 3BIID 4B0EA 2BA0A 4OO1I 2KAJA 5HG2A 2PCFB 5ELDA 1K53A 2FMCA 3P75A 1GUGA 1PTOD 2LY7A 2LS01 1VF7A 5BYRA 3BZDB 2EOTA 1VMCA 3OWFA 2B39A 1EU4A 4C3HB 4BY7B 3Q8EA 4I7ZC 1ZDVA 3C8YA 3DEPA 1QB5D 2M9VA 2JEBI 4IFDJ 3B9JA 1X3QA 3MAQA 2JZPA 2MP1A 1UWMA 1FIQA 5KGUA 1BO0A 1EU3A 1PZKD 3VYUA 1STBA 2HDEA 1NSNS 3T56B 4ZKCB 2O4XA 2IT1A 4HEDA 1G2SA 3QOJA 3N52A 1FFVA 3HGBA 1SNDA 2FHTA 4G4KA 4FF1A 4NDXA 4KHVA 4OW0A 1NVID 3D3RA 5CC4A 3KLSA 2Z4IA 1N62A 2AQ3B 4HSVA 1B44D 3E56A 3AM9A 2WS3B 1J7BA 2L52A 4GDKB 1S5FD 4K14A 2BB6A 1K52A 3RUZA 1TY0A 1SNOA 4ODGA 2JQRB 5KEEA 3VR3A 1Z47A 1WD1A 1Q10A 1B9RA 1YMHE 2LGIA 3VR2A 3I57A 3LNNA 4ZHOA 1JQ4A 4XT3B 5EJWA 5HI1A 4ZQ3A 4BA1I 3BDCA 5CV7A 3DM1A 1I6VC 3PUVA 3S17B 3G7LA 1TR5A 4H13C 2TSSA 4ZAIA 4XQJA 2PVGC 2TMPA 3J7AV 2F0GA 4EQPA 2QMTA 4XQNA 3S15B 3P1MA 3AMZA 3I3CA 4XYQA 3P4RB 4A90A 2A74C 3WCQA 3EUB2 1RD9D 3K0YA 4JWSC 1DOXA 1EY8A 3VA7A 2K03A 4OIJA 1L0YB 1RODA 3RZDB 5G3LD 3EQLC 3I91A 1YNTE 3GV6A 3TP8A 2E2IB 2F03A 5AFWA 1TZOA 3H8HA 2BOSA 1XLOA 1PTOF 1TYGB 4ARIA 1Y8NB 4R9WA 3KWLA 1A3UA 2DY7A 2B2TC 5G5GA 1DGJA 1BDOA 3X3MA 1D5XC 5E4WC 1LT4D 1G6ZA 1CTMA 1MD2D 4IALA 1TS2A 3PO3B 2J42A 4WQMA 2Y0SB 4S3SA 2PYKA 1CA5A 3JAML 1VRAB 1HZ6A 2MJEA 1B9MA 1HPCA 2PZUA 1CQVA 1E7PB 1Q3LA 5I6WA 5M5YB 1YN4A 1STYA 4RKLA 3LWUA 1SSNA 3VRBB 3AB9A 1WVLA 2EY6A 1S4ZA 4RHRA 1FFUA 1R9TB 5LNK1 2L55A 4DF7A 4OZBA 1VDZA 3CQZB 1LT3D 1K8MA 5T1GA 2JXTA 4L8JA 4A3DB 1JORA 2BS2B 2EJGC 2A5HA 3Q8CA 2WXFA 3GO5A 5E4XA 1PZID 5IGEA 2ZXRA 4FF4A 2CHBD 1C77A 1SE4A 1KLUD 3TDQA 2M0AA 1F0ZA 1H9RA 2DNEA 4Q0FA 3SK6A 5C0XI 2FFKB 1IKLA 2Y3AA 5I4DA 4J6HA 2MJ3A 3E5SA 1FXAA 5KNDA 2KDMA 1U4RA 2AWOA 3FPUB 4RCNA 1SNMA 2N88A 5G3LF 3H09A 4NW2A 3TEZA 3CU7A 2WV6D 2Q8TA 1PGAA 4KY5A 2E6XA 1GAQB 4R8IA 2LKVA 5IOCA 4DXFA 2NB0A 1Z7TA 2EDGA 2HDLA 3FMCA 3IT4B 1LTBD 1PXUA 3U9SA 1T6BX 2QF7A 5I2XA 3NK9A 3HVZA 3GTKB 1J7AA 1XCQL 2XIWA 2QEJC 3MXUA 3AB5A 1MSGA 1IBXA 1CQFA 2W3SA 4FNFA 2XN9C 5J22A 2KN4A 4L1BA 1RKNA 3CWIA 3D6CA 1DCZA 3MEHA 4WURA 3HZXA 1SF0A 1EWHA 1EYDA 1HA5A 5D14A 1M4VA 5I2YA 4UAIA 3T51B 1SEBD 4K8JA 1GJXA 2NBFA 4CGYB 3VA5A 1NEKB 2K5DA 2JEAI 5H92C 4LTU