1JWSD

Crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDGMFNWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwsD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwsD02
2IJ0A 1SE4A 3EA6A 1LTTD 1MD2D 1FNWA 2ICIA 5FK9C 2RDHA 2G9HD 3GP7A 1S5BD 1TS5A 2XRQD 3DWQA 5FKAC 2WV6D 3TSSA 1PTOC 1PTOF 1PZID 1L0XB 4DXGA 1PRTD 3MFGA 1YN4A 1LT5D 1LTSD 3W2DA 2Z8LA 1S5FD 1DJRD 5ELBA 1PRTC 1CHQD 1PRTF 1S5CD 1BCPB 1JQYD 4RGTA 1JWMD 1I4GA 3OWEB 1SJHD 4NZLB 3BYTB 3R2IA 1FGBD 1RDPD 1XTCD 1S5ED 3V05A 4RFBA 4BWGB 1LLRD 1ET9A 3DWAA 3BVGA 2NTSA 4O1NA 1HQRD 2QEJC 1UUPA 3BVZA 1EEFD 2XRSD 1CT1D 1PZKD 1SE3A 5ELEA 1ET6A 2AQ1B 1LTBD 3MC0B 4RGMA 2AQ3B 1ENFA 1PTOB 1JR0D 1LT3D 5TSSA 2XN9C 1LTRD 1D5XC 1SXTA 1TS3A 1YN3A 4Z9CB 1HTLD 4OHJA 1CHPD 1S5DD 1TY2A 1TY0A 5I4DA 1PRTB 4RHRA 5ELFA 1EFID 1V1PB 2SEBD 2IPKD 1HXYD 4K6LA 4ZYSA 1D6EC 1QILA 1AW7A 1I4RA 1V1PA 2O2LD 2R61A 1YN5A 1TS4A 2RDGA 1PTOH 1KTKA 1UNSA 3BZDB 1D5MC 1EU3A 1I4PA 1PZJD 1SJED 5D3DA 3KLSX 1LTGD 2J4XA 1AN8A 1SBBB 4RCOA 1XXGA 1CK1A 1EEID 3DWPA 1LO5D 3SEBA 1GOZA 1KLGD 1RF2D 3R2TA 3CHBD 5ELCA 4L6TB 3EFXD 1V1OA 1F77A 1PYWD 3URYA 1LT6D 1JWSD 1RCVD 4L63B 2TSSA 1PTOD 1STEA 1B1ZA 1FNUA 4DXFA 1LT4D 1ESFA 1JWUD 3R8BA 1JCKB 1M4VA 1CQVA 1EU4A 4TSSA 1T5XD 1TS2A 4RH6A 4UDUC 1I4QA 1LTAD 1G8ZD 2QILA 1FD7D 1D5ZC 2NTTA 3BYYB 1I4XA 1BCPD 1EWCA 4RGNA 4RGOS 1KLUD 5ELDA 1I4HA 1FNVA 1LTID 2AQ2B 2XNAC 1SEBD 1BCPC 3BVMA 3O13A 5D3IB 1L0YB 1BCPF 1DYQA 4C56C 4RHSA 2CHBD 1HA5A 1RD9D 1SE2A 1BXTA 1B44D
chains in the Genus database with same CATH superfamily
3T51B 2HT1A 2WXHA 2F0FA 2IJ0A 3KK7A 3NEMA 2D3GA 1PH5A 3NG0A 3BY4B 1F9SA 5FK9C 4GB9A 2UUAQ 1FXIA 1PUTA 3VRBB 2J0KA 4DHZB 1QWYA 3L0OA 1T0SC 1R9TB 2RSNA 1DOYA 5C4ZA 5IOIA 1U4LA 3ERQA 3CC2A 2HTME 1XLNA 3NWSA 4IUVA 2NVTH 2MHVA 1ZE3D 2WX1A 4NZLB 4TRDA 2JA6G 2A6EC 3G71A 1STNA 4IOIE 4H0LC 1EYGA 1GG3A 2XRSD 1NSNS 1SE3A 2FCSA 1UH6A 3VYSA 2GN5A 5J17A 1OTCA 3QIAA 1QVFA 4HJGE 3HZXA 3HGBA 3ZJYC 1TS3A 2F0EA 1HNXQ 1N63A 4MELA 3S1MH 1VQMA 3CC4A 2IY5B 4KY5A 1RWSA 2CU1A 2WAQB 3OHXC 3SK6A 2UUAL 4GLXA 1O78A 1HRJA 4ZRJA 1VF5C 5M5YH 1PH2A 1XO3A 5GADC 3PIP3 5C3WA 2PYKA 3IFWB 2GI9A 2QSDA 1FO4A 1EY9A 3WAPA 4DKAC 4MIUA 4HN7A 5EQ0A 2QGQA 4B3RQ 1WSPA 1YIWA 4LNNA 2F0TA 4JI5Q 1B3QA 3K0XA 2RDBC 3E6ZX 3DHGC 3LDZE 3MAQA 3AB5A 1YBYA 3L13A 2VB3X 1F52A 3DQVA 2EYMA 3RNUA 4DQOC 3J81c 2Z0SA 3TBIB 3RLOA 3A7AB 3I4LA 3K57A 1G91A 2KHWB 3SEBA 5EDSA 1V8CA 2C7HA 1YHBA 5HI1A 1YHAA 3WAMA 4BBSH 4QIWB 2JP1A 2IX1A 1KAAA 3I4MB 3S9WA 1DOLA 1Z5SB 5GAGC 3QARA 1JMLA 2XGTA 2VB2X 1WH3A 3EFUA 1EYAA 1Q12A 4H44C 3G7LA 3S24A 3JAML 5H92C 4OL7A 3H8HA 1HNXL 5HKHA 2Z59B 3Q6BA 3MP9A 1CKMA 1TWGB 2O4XA 4WJQA 4GS3A 4GLAC 4UDUC 2PLPA 3I55A 1PMRA 1AZQA 1HZBA 5JZEB 2ZXPA 3NXWA 1B3AA 3HOZH 2MP2A 3OOCA 4V0BA 5CHFA 3KWVA 4BBNF 4RF1A 1ENCA 1IW7D 1BBUA 4K81A 1S40A 1EQRA 3CRKC 2JA7B 4B3RL 1GM5A 3AE9B 3CKIB 3VUYA 3G6JB 4JI5L 2SAKA 2FIDA 3U50C 1FCLA 1WYGA 5E7NA 3S1NB 1WI5A 1PHJA 1F2MA 1BXTA 1X65A 2O6VA 2H89B 4WURA 1N5WA 2EY2A 1MD2D 4EZLA 4RA8A 1WTXA 1TZOA 3TL5A 4J6HA 4ICUA 1L5PA 1SYBA 3E3XA 2B2TA 3KJPA 2LMCA 4MT5A 4FF1A 1HZ6A 1D4BA 4WQMA 2N4FA 3VR9B 1Y8OB 3VR3A 3Q3MC 3RN9C 4QJFA 1WTOA 3DBRI 2REXA 3TREA 3AQQA 3VYUA 1KH0A 1FFUA 4XQNA 4A8XC 1EY5A 5DPTA 3DHIC 3AE6B 3NQIA 3EROA 1PH1A 1SJHD 1C1YB 4B3ML 2IGHA 2LVPA 2V3NA 5AEKB 1OEYA 4LF6Q 4KX6B 2QCPX 5CX3A 1K9MC 2CH4W 4KZCA 4WWNA 1HCZA 2Z6KC 3QR8A 4CDFC 4DNIA 5IGCA 3F2UA 1TXYA 2B8GA 2CQAA 3TP7A 4BBRG 2L11A 2UUCQ 1JE4A 4NJ6A 3IAS1 3K8AA 5CHWA 5BR8Q 5M3FB 1PTOB 2K01A 3N6RA 2M4NA 1SMYC 4HWIB 2VS1A 1G6ZA 5GMVA 1JR0D 1R9TH 4PZ6A 1OQRA 4FXGC 2AWNA 1QOAA 2OJWA 2X8XX 3NVZA 1XQQA 4FP5D 3W1BA 1J6QA 2KMAA 4QAYA 4BZAA 3H94A 3H0GB 1Q81C 1DZ1A 3EC8A 4MZ9A 3AN1A 2M00A 1EFID 3HOXG 2IPKD 2ZTDA 1RAXA 5KNBA 4ZYSA 1BQQT 3KF8A 2DYOA 1D6EC 2IO3B 4P71A 4YSXB 2NN6I 2BS4B 3AEGB 2ZCBA 1YN5A 4A3KG 2JA8G 3ENEA 5LMNQ 2RHSB 1GHJA 1ZGUB 1GHKA 3OPOA 2PE6B 3UINB 5TR5A 5D3DA 2F03A 5KHOA 3SR6A 3A5ZB 3AU5A 1VQJA 5E4WC 2N7EA 3PIPA 1AN8A 4ODGA 4DDID 1XXGA 5COYA 4HRSA 4XXEA 3J80i 4LF6L 4QQBX 4I7AA 4C3JG 2J0TD 2MO1A 4C1NK 3RUIB 1J8IA 3PO2G 5C4XB 2WP8J 2UUCL 3CHBD 4OVUA 2KC2A 4N9PA 2I07B 1Y8NB 5BR8L 2BA0A 4A75A 1PGBA 2CWPA 2IY0B 2MO0A 1VLBA 1CSPA 1YNTE 2A5UA 3K59A 3OWFA 2MA9B 3D32A 4A3DB 1SE9A 4EUTA 1E2ZA 2M56B 1X1MA 2KHIA 4A3CG 1KRTA 3ZTDA 4KD4A 2Y5PA 4L8JA 3ZJTA 3K6OA 1OXXK 1KD1C 3NTHA 4QF4A 4DPGA 4HIKA 3I4MH 2F0NA 1WGKA 1XYIA 5LMNL 4RKLA 3A5UA 4BXXG 4X3KA 1CZPA 3VTUA 3RZDB 3K0YA 4TMAB 5IWAQ 1IP9A 1UE7A 3I70A 1HZ9A 2R3ZA 5KNCA 3FRPB 3WALA 1AZPA 1N5XA 2BB5A 2K03A 1A3UA 3AEBB 1L6UA 1TWGH 2MW5A 2C9OA 2E3TA 4GOPB 3IVFA 2K05A 3I3TB 2DJFC 1MI0A 1LQBA 2K32A 2K25A 1DCZA 2K4KA 1SNQA 3NJTA 4BY7B 4OEMB 3TP6A 1ACCA 1OEYJ 1C9OA 1IYUA 2JA7H 1PYBA 1TWHB 1MGSA 3FP9A 3I91A 3EVQA 3KBGA 4KTAA 1EWYC 1DJRD 1H8CA 1ICWA 3S1NH 1HJPA 1EUVB 2J0JA 5D2MB 5IP9H 3AECB 1A8VA 1SROA 1GO3E 1BCPB 1JOOA 2BE5D 4RGTA 5KYIA 1RJTA 2R93G 2VY3A 2DAJA 5AZHA 3I9V1 3VR5A 1UE1A 1F1HA 4MGIE 3OIPA 2KCCA 1CKNB 3I3CA 4R8NA 3V2TA 1L0WA 2F0MA 4DV4Q 3D6CA 3BVGA 3CCVA 3SXHA 2OWOA 5C5MA 2D10A 4DFAA 2W54A 3S2HB 4K7WA 1Q0WB 2K28A 2XVSA 3ITPA 3TUOA 1EIYB 1ENFA 1HFNA 3ZO5B 1B50A 3PQIA 4NPNA 5IWAL 3L54A 4KGTA 2YTXA 3KLSA 3NOBA 4MNOA 4HROA 1MPEA 3I7FA 4DV6Q 4A93B 2D3CA 4A3GB 4CYEA 1E2VA 3E56A 4Z9CB 4I65A 4H13C 1K3BC 1PQSA 3K5LA 3S17B 2VZKB 4DK5A 1XLPA 3HKZE 1VDZA 2LFNA 3AI5A 3A8JE 3F1ZA 4M1UB 3R93A 4NAWB 4AYBB 5EAYA 3QC8B 3APCA 4M0WA 4F8CB 2DGYA 4ANWA 2YEPF 4S3SA 1WM2A 5I2YA 2X6GA 4W9EA 2VH1A 5C3EB 1PTOH 5M3FH 4JG2A 2EDGA 3I4NB 2HQLA 3M4YA 2L0TA 3H0GH 3N1XC 3VDZA 1QF6A 4QUFA 3KVFB 4FJVB 2KA7A 1P8LA 2MBOA 2JU6X 1Q86C 3MEFA 4MTNA 4A3FB 2MCNB 4EOYA 4DV4L 2Q2HA 1JALA 1WJNA 3W3AA 3DEPA 2DBYA 1XX8A 3R2TA 2ZZPB 4L5QA 5JJZA 3QX1A 4XGAB 2B76B 3M4QA 3GTQB 1C48A 5JXVA 1I94Q 4A3PA 2B63B 4HJ7A 4BY1B 1F2RC 2ZNVC 1IPGA 4IC7B 3PV1A 4K7SA 4XX5A 1XMOQ 1FNUA 3S15B 4DV6L 3VH4B 4P74A 1A6XA 2EJFC 1LT4D 2QIEB 1IYVA 1VQ8A 4MSQB 3I8ZA 1AE2A 4BS9A 4MHEA 4CJ0B 4M8MA 1YHQA 2K8CA 2WU5B 1HHVA 2P5ZX 2LJIA 1C4AA 4K2LA 2JZZA 2ICEC 5LXIB 1D3ZA 5C4XH 1PYSB 3H9DA 5AZFA 3MJ5A 1BCPD 2KQ3A 1HA6A 4IJHA 1WX9A 2RBMA 4BBSG 1ZXIA 1KNAA 3T3NA 1KDBA 2V4IB 5FLXE 1CMXB 3CPWA 2KDIA 2SOBA 3J80E 2K6DB 4A3DH 4F7XA 1WGYA 2WB1E 4GGQA 1ZOYB 1MJDA 1YVCA 3HOWB 4NY0A 2FUHB 4JOIA 2WFWA 3FKYA 1N62A 3HUIA 5AJ3L 1ESRA 2CHXA 3N1YC 3WCQA 4E3CA 2J0MA 1QUQA 2X6LA 3GDEA 3OSOA 2CCZA 2ZJPA 3PREA 3VR4A 1JT8A 3HOZG 4ULLA 1PZID 4PQXA 4OIJA 1ZW7A 2NPTA 3AEAB 4WQOB 3MFYA 1O7IA 5KEEA 1NMFA 2K5DA 2PQEA 3RZDH 2PQAA 1I94L 1GUTA 1JJGA 3F8TA 4CHKA 2KMCA 5J18A 1EOTA 3KF8B 3QWZB 1WX7A 1P3QU 2KLCA 1XMOL 2ATWA 1SYEA 2CFMA 4LF5Q 3BJUA 1LV9A 2KLGA 2M17A 2HDLA 4JI4Q 1PRTF 1RL2A 5BYRA 3ZRFA 1J7AA 3HOVB 3W1GA 5LL6S 3EECA 1WXVA 1YJ9A 2PJHA 4DK6C 1YNJC 5M5WB 3VR8B 2D3BA 1S5ED 1UEAB 2RQXA 4BWGB 1LLRD 1IBMQ 3CP0A 1N36Q 2UUBQ 2PEAA 5ELOA 5I9OA 1DD2A 2BYVE 4JBJA 2Q2UA 4ZUIA 3NK9A 4BY7H 3AH7A 1M90C 4IUNA 5ELEA 1Y56A 1LTBD 2XSCA 2JSVX 2AQ3B 4PMCA 1GUGA 1M94A 5CBEE 1TWHH 5CORA 2VW9A 2AEHA 3OJ3A 2MQJA 3WA0A 4NMZA 1XPRA 4D2KA 1DOIA 5DPWA 2EYFA 3S1QB 4G7ZC 3C1FA 2O6VD 1EIHA 1SXTA 4EQ5A 3IG3A 4IWPA 4M00A 5BMIA 1FM0D 1TR5A 2C9WB 1GB1A 1WIAA 1Z6HA 4M8NA 3ZXRA 4IURA 3J9CA 2WXRA 4NQKE 4ZUJA 1KABA 3ZDMC 2NUCA 2JK8A 2KNBA 2N7DA 2ZPNA 2MBQA 4N9F4 1UE6A 3S2HH 2DLBA 1K51A 2R61A 5DPSA 3GV6A 5JVG3 2E2HB 1TS4A 2F0VA 1T0YA 3ZVVA 2RDGA 2NBFA 3P4SB 3PRPB 4KN7C 1QOGA 1N9WA 1UNSA 3DWMA 2IHEA 4A93H 2EYOA 4HK2A 4LF5L 1MG8A 2KVRA 4DUYQ 2KAJA 1RTOA 4JI4L 1Q1OA 4JQWC 1ZYRC 2F0LA 3TBLD 2I5MX 3S17H 4DWFA 3BZCA 1VZ6A 1KC8C 3RFZB 1LGRA 4TKNA 4XZ4A 3GTOB 4LK1C 1CM9A 3KUPA 1IBML 3U9SA 2UUBL 5MPOA 3DOWA 4HEA1 1KLGD 3ONAB 2M2LA 2MPMA 3D31A 4RWSC 4DV1Q 2JYEA 2KFKB 1L2NA 1Y8RC 5C3EH 1YNND 1JWSD 2RCNA 1FPYA 2IYDB 3TMPB 4XT3B 3K5OA 3CCRA 1E8WA 2HTHA 2M9VA 2R92B 2KXJA 1RHPA 3QQ8B 2Y0SE 5E1FA 3RD2A 3I4NH 1QG7A 1SSNA 4DR3Q 4KY7A 3WWVA 4IFDH 1O7ZA 1K8GA 4IDIA 2OQ0A 3HS0C 3KDFB 3PMFA 4DV2Q 4OO1I 2ZW0A 2LRUA 2K33A 4ME3A 2WAQG 4A3FH 3PF5A 1QNKA 4DF7A 2CS4A 2WXOA 3P2BA 1JQ4A 1WYWB 4Q5VA 1WRIA 3A9JA 2NZHA 3L17A 3N3KB 1L6VA 1QCBD 1V49A 1WTRA 1WGGA 1EWCA 2QMTA 3AM9A 3GTQH 2IL8A 3K9PB 2WWZA 1BKBA 1JROA 3G6EA 2B63H 4BY1H 3LWUA 4A3OA 4R1JA 2XNAC 3UE1A 4HJ9A 2IO2B 3S15H 4AQ7A 3OIQA 4FF3A 2B2YC 4R3DA 1E10A 3PUXA 4DUYL 1WD0A 1TKWB 4F7ZA 1EF5A 1BDOA 3PT2B 5JHBA 5C2TB 3EA6A 2LXKA 3BDOA 1WE7A 4WJ3M 4CO7A 3B0AA 4MN3A 2K5QA 1QOBA 1S1QB 2B2VC 2H5XA 3GO5A 2Y5BB 3APDA 4YCVA 3IHPC 4XYQA 5L37A 2EYHA 3BIID 1FL0A 5C5LA 2JXTA 3OAWA 3R66C 4JGHB 3RMKC 1BBWA 2EXDA 2GBJA 2CH4A 4N8FA 1CA5A 1ENAA 4DR3L 3RUZA 3K5MA 1H9SA 2E2DC 5M9OA 3S16B 2FMCA 3ZNHB 3NSWA 3PV0A 1GUNA 4DV2L 3HOWH 3TS2A 2KTRB 2VL6A 2O2VB 2W9NA 2BDNA 1YQ3B 1DGJA 1V97A 4JBWA 5EE1A 1P9DU 5JAVA 2LKVA 4O1NA 2CJNA 1N61A 2LEKA 3KYDD 3UDGA 3L16A 4P2CB 3CCJA 2GMIC 2JT4B 3ONSA 4QL5A 4LDTD 1K83B 2F0UA 2JYTA 4YT0B 2Y5CA 2ZJDA 1EWHA 4N6EB 2JA7G 3L08A 3PVLA 2MUYA 3GTMB 5KNDA 2I1KA 4CBVA 4OZBA 4LCDE 3GTJB 3HOVH 1Y8PB 5IP9G 3VFKA 5M5WH 2N8NA 4LTUA 2L8JA 4XYOA 4FXKC 2UWQA 1SYGA 2EYLA 3BWUD 2Z0DB 5CR3A 1WJ4A 1V6EA 3I63C 4GDKA 2WXFA 1V1PA 1GUAB 2DJGC 1YJ1A 5E6OA 2WNMA 4XQQA 3DM3A 4R8IA 1C4PA 3GE8C 4EKUA 1PDQA 2KN5A 3PTFC 1I4PA 5HG2A 2KCTA 1HFGA 4ILWA 3S1QH 2L1AA 3Q2AC 4KI0A 4E6IA 3H3VH 2ACZB 5HFYA 1AP0A 1CZWA 3J7YW 1WMHA 5IGBA 1JE5A 3DHHC 3UI2A 1YNXA 3CAMA 1X9NA 3VA5A 4X6AH 2B3GA 4GNXA 5HY6A 4CJ2C 2GB1A 4HAEA 3W5OA 1C79A 3SFEB 1C7YA 4JL9A 5L83A 1CUKA 2VRRB 2DN8A 4C7ZA 2KD0A 4MJSA 1V5TA 2E2HH 1L1OB 1VQ7A 4US8A 3MZ5A 3DBRB 1X55A 1O80A 3PCOB 3TS0A 3MHSD 4FVMA 5M3FG 3H7PA 2A68C 4JWSC 2I2YA 1KIXA 3QIJA 2A69D 3BK1A 3UGBB 1RM6C 4XWWA 1ESFA 2N7JA 5GQOA 3R8BA 3CF5A 3OLMD 4C80A 1C3TA 1DM0B 3SK8A 4A3JG 3HEJA 3GTOH 3NZSA 2GLSA 1WD1A 1I4QA 1PFMA 1ROEA 4LUZA 2EOTA 4EQNA 1G2TA 4RGOS 4JI0Q 1XT9B 1V9PA 4DV5Q 2DX5B 3NQTA 3CSFA 2R92H 3ER0A 2KJRA 4FNFA 1TU2B 1SEBD 3TMEA 1HEZE 4IO9A 5D3IB 1Q1BA 4OW0A 2MFIA 3PSIA 3JYUA 1RD9D 5JH5C 5K5PA 1IBXB 3GTKB 3RN2A 4HJ5A 2ZTCA 3NHHA 4LF9Q 2ICIA 2CW0C 4LWCA 1S3SG 4FJZA 4J6IA 1R4NI 4ZCKA 2L52A 3DVNU 3K80C 2XRQD 3TDQA 1TTNA 5C4XG 3WOEA 3NENA 2PI2A 3N52A 2K9XA 2J42A 4FO2A 4GKKQ 1MHHE 4PMWA 2K8HA 1XTDA 1A2UA 2JA5G 4FBJB 2K5VA 3QJZA 2UU7A 3VQIA 5IYBH 4LFBL 3J80L 5DNFA 1B70B 1E6EB 2E8GA 1STHA 3FPUB 3WANA 2WXNA 2EMSA 2WXIA 1SNOA 4AWJA 2X38A 4EX5A 2HJ1A 1VQLA 1RDPD 1KRHA 1TIFA 2BBCA 3A0JA 5KHQA 3K5NA 3DWAA 2BOSA 3AEDB 3Q8AA 3ZNGC 3BVZA 4P1CC 1PH6A 2YU9B 1V1QA 2PZWA 1L2FA 2GBNA 1H9KA 3LXFA 4JI0L 1PFDA 1YQBA 4DV5L 1VQPA 3DBLB 2W55A 1EWIA 2OF1A 4JI1Q 1PH3A 3ULJA 1O7YA 3KJOA 3Q8CA 2EY6A 5F2DA 2EJMA 3S16H 1NUCA 2K50A 2K5HA 3FC4A 2F0IA 3SK4A 1TY0A 1VD2A 2UYZB 2K7VA 1V9JA 1ZPSA 4LF9L 3K81C 4HMJA 4DR2Q 1HXYD 3RN5A 3NP8A 1EQQA 4G3XB 3LWEA 4MH8A 4KY6A 1MHXA 2LY7A 1VZ7A 3RZFA 2LHDA 4DHJB 1E7PB 1H95A 1K83H 1S72A 1YIJA 4BY7G 4GKKL 3ZW3A 3ZUNA 4IUTA 4KKJA 2ENBA 2VZAA 1D5MC 1EU3A 2JQRB 2AMCB 2Q8IB 1HUNA 2JWZA 1K53A 3GTMH 2KJXA 3A7LA 2J4XA 1NI2A 2FCNA 3NS8A 4AH6A 3GTJH 2H1EA 1ZDXA 3E9SA 3HM6X 5BO4B 1B4OA 1FRRA 5CBAE 1QKZA 5IO9A 1J0GA 5T8IA 3T53B 2KJHB 3P63A 1E8XA 1O7LA 1SB3C 1UD7A 3NZUA 1C0AA 2BYTA 3MXGA 4NW2A 5BYQA 2KACA 4PV1C 3U4VA 3I72A 4USAA 4P73A 1RLFA 1G51A 4JLCA 4JI1L 1F9RA 2NZ1D 5LMUQ 2WXJA 3QK0A 1LACA 2CHWA 2M1MA 5HGQA 1WR6E 1E22A 2B2WC 1STEA 2PCFB 1YJJA 1WJJA 2KWVB 1W6KA 1HTOA 4A93G 2GBRA 4B9KA 1N8RC 4A3GG 3MHZA 1EL0A 2LWPA 4AP4C 4BOSC 1NR4A 1HPCA 1UBQA 3VR2A 1RTNA 4DAPA 2O5JC 3AYHB 2EY1A 1ZP0B 4IUMB 3U2SC 2JVCA 4DR2L 1I3QB 3F2CA 2R2QA 3NELA 4AYBG 1FD7D 4EGVA 4YHHQ 1IL2A 1RKNA 4WWPA 2D62A 2DUDA 2E75C 4C4VB 1VQ4A 3PUZA 3TRZA 4IOAA 5C3EG 4K3BA 4Q2JA 1PFNA 1BVSA 4R4OA 1A63A 4WJPA 2PPHA 4W9LA 3QA8A 2C7NB 2K8BA 4FHKA 2NVUI 2R7FA 3I4NG 3AFQA 4EE2A 1JICA 4IFDG 2PZTA 1V2YA 4BOZB 4G57A 3T1HQ 2R7ZB 2N88A 1PFSA 1U0LA 2BVCA 2PO4A 4A3FG 5I6YA 1C77A 2KBNA 2K39A 4ANXA 1AARA 5C0XI 4AQYQ 5JOBA 4IKGA 1EOVA 5CHVC 4HKQA 3MFGA 5M3MB 1B53A 3MC8A 5CMDA 2QDFA 2BKRB 5LMUL 2Q5WD 1IHZA 2BGFA 2B63G 2V1YA 3RLFA 3SGIA 4KKSA 2PVOD 1Y14B 5KGUA 4DHJD 4JW0A 2I46A 4X66Q 3GTKH 4A3BG 2FIFA 2RKSA 2W82A 2L12A 1I6HB 4B9XA 1KAWA 4LMQD 3KYCD 3CCQA 4PZ7A 2NMQA 1E24A 1HQRD 1YJWA 1HH2P 4YHHL 3U30A 2N3SA 2NN6H 1UBIA 3OJ4B 4MGZE 3NUCA 4M8AA 4GNXB 3MC0B 4MEMA 4A9AA 5IY0A 3B08A 3PSEB 4ANVA 3DHQA 2K0PA 2PI2E 3JC66 4MJSB 5BYSA 4AJYB 1LABA 3P7JA 4WJ4A 4GOCA 1VQGA 1E2WA 1WOCA 1NR2A 1S5DD 5I4DA 4DR1Q 3T1HL 2KWDA 3A8IE 5CYUA 2SEBD 3HOWG 4X65Q 2JRIB 1JJ2A 2KCNA 2D07B 3SDZA 3WOFA 3S2AA 2AHOB 4HJAA 2Z1CA 1QOHA 2YU9H 2BPSA 4LNQA 3M7NA 3P75A 3ZQ4A 4A4IA 1UWMA 2ALYB 2LXAA 4KKUA 4RM8A 1NDDA 4E74A 1DOXA 1U4PA 2LXCA 1JJCB 3UIOB 2JXMB 1PZJD 4O2DA 1VQNA 4ZK9B 4DBGA 4QCLA 4OELB 2WS3B 4X66L 4DK1A 4B3SQ 2OEDA 2M19A 4C00A 2HIVA 3CPFA 2EZVA 3HOVG 5CV8A 1QNUA 2EIFA 3FKIB 4R4QA 4J3OD 3AFPA 4NXNQ 2LSSA 4XYCA 1E90A 5D65A 4ICVA 4PZ8A 2N78A 4X3TA 2X69A 5CV5A 1HNZQ 3Q3OC 4L1BA 4L23A 2I0QA 3SDLC 3E0EA 4R9WA 3URYA 3G4SA 4YCUA 3J7A5 4LFAQ 3CMMB 1TWFB 2ASBA 3T8MA 3M9BA 2F0HA 3MXNA 4XDDA 3JAMc 4DK0A 2OTJA 2LUMA 2DY8A 1KLVA 2D3AA 1JWUD 4YCWA 4DR1L 1XCTL 3L7ZC 4JYAQ 4KMUC 1A3VA 1TKEA 1Y1WB 4FULA 1SYFA 4X65L 2SNMA 1TGZB 3VHTC 4HCSA 3V6CB 3QG1A 2AWOA 1EY6A 3CCLA 4TQUS 1JRPA 1WJUA 1WXAA 1VDVA 3DVNV 1J5EQ 1JWAD 3AEEB 3ETRA 5C4JB 3NTIA 3V3XA 4G7HC 3DBLI 4GZYC 1HQMC 3L0WB 5DAUA 4B3SL 3K7UC 3PF4A 1SMYD 2R2OA 2DAFA 2QF7A 4REZA 1GD7A 5ELNA 4W9DA 1EUJA 1C76A 1NYRA 2IWHA 5KRUA 3RLNA 2I38A 1FNWA 1I3QH 4NXNL 2L7RA 3AE1B 3KLRA 4MACA 5CV4A 4PS3A 3T3OA 3V62A 3W1SC 3ZNID 4EZJA 1TS5A 1HNZL 1STBA 1PTOC 3RNAC 4LFCQ 4OWWB 2WXLA 3PZ7A 4G4KA 1V86A 4H7BA 1LTSD 4IALA 4LFAL 4DAYA 2F3VA 2ZPYA 5ELBA 5IODA 2IX3A 2ZJRA 1S5CD 3PRZA 1JQYD 1B9NA 1JWMD 3OWEB 2R6GA 2XK5A 3CCMA 4NQLB 2R7ZH 4JYAL 1FGBD 1SSOA 3KW5B 1WY8A 1ET9A 4JIOU 3A55A 3PLUA 2B2YA 2BE5C 1UUPA 4XE0A 4IFDJ 1CT1D 1PZKD 5M3MH 4A3EB 2FJ2A 1L4ZB 4ZRQA 3RNFC 5IE8A 1WX8A 3HVDA 1MJEA 3UE0A 1J5EL 3NBHA 3AE4B 3TEXA 1T3QA 3P1HA 1HZ5A 1G2SA 5IYBG 5A2QL 1TWAB 4U68A 4DR5Q 4MDKE 3SFDB 2DY7A 1M1KC 1I6HH 3Q3JA 5C3JB 4WJOA 4Y7NB 2LUEA 2ZXRA 3NVYA 4LUOA 5IGGA 4WAFA 5A35A 2KWCA 3KF6A 1VQ6A 4LFCL 4FF4A 2V4LA 3U8ZA 5C23A 3TP5A 3OYYA 2N55A 4W9FA 1KTKA 1JORA 2Z4HA 3D6WA 2PMZE 3LJ3A 1SJED 3D4DA 1NI3A 3H6MA 1C8CA 2LGYA 4IM0A 1Z9FA 2RHQB 5EKLA 1SIJA 4KLKA 2JF5A 4HPPA 2RCFA 3R3MA 5I9PA 2RMMA 4ITKA 3IFDA 3KLWA 2B2UC 1N33Q 1WYDA 3CMAA 3EUB2 1V1OA 3KYHC 1UWXA 2ZJQA 4XDCA 2YEPB 1Z47A 1WZ3A 3EFCA 1KFYB 1NE3A 4YWKA 4JPSA 5H8YE 1RFKA 1KM7A 3I2ZA 1GC6A 4GOPC 1Q1EA 3NUHB 4PYZA 4PS7A 1X3GA 3BG3A 4DR5L 1JCKB 5E3FA 1DONA 2BW2A 4RF0A 1VQCA 3FKIH 2MP2B 2K14A 2N49A 5L95C 4KSKC 2SNSA 4PK1A 1LXDA 4HDOA 2RSUA 2CJOA 1IUEA 1WZ0A 2V4DA 1NYQA 2R7DA 4IM2A 2WHIA 1AH9A 3T1YQ 3VA7A 1TWFH 1BCPC 1W3SA 3RZOB 2O6VB 3JW0X 1UELA 1L0YB 2YVCA 4Y52H 1DYQA 1ISNA 2LJ5A 2QEXA 4E71A 2B8FA 1SE2A 4P72A 4RMAA 1HUMA 4EQPA 2LMCB 3OMGA 2LASA 5EPJA 4CHTB 1Y1WH 3TJPA 5T1IA 3Q6SA 4RKBA 5IKCM 2PMVA 4ZHOA 1Q46A 2Q8RE 1N33L 3DWQA 2MNAA 4ID6A 1CTMA 2KDBA 3UIPB 4JWUC 2HUGA 1I50B 3H6NA 4BKGA 3HKZB 3UDFA 5C44B 4N9TA 1E0BA 1C9FA 5C4JH 2MJDA 1AE3A 4HSVA 4GSWA 2HDMA 1KXLA 3AE2B 2JXXA 4ZRZA 3U9OA 1P7EA 1GC7A 2FFKB 3R3OA 1PVOA 2QCZA 2V9HA 4BVUC 2VQFQ 2KTFA 3PS6A 1VQEA 2UXCQ 4XQJA 3VDYA 2A6HC 2EYPA 2K1FA 4JI2Q 3B1LX 5M5XB 4WFN3 3H09A 2WYQA 5H1SE 4BFRA 4MM3A 4YSZB 4L5RC 3T1YL 3BINA 1LT3D 1X3PA 3STBC 2KVZA 1SYCA 4KDLB 1BUVT 3M4PA 1K8AC 5IGFA 1GUOA 3CCUA 2EKIA 2DZMA 4YL8A 5IT9E 4B3TQ 2MLBA 4B6WA 1PRTB 4RHRA 1K28A 2RR9A 1WTQA 2INPE 2KENA 3MXNB 3NPPA 3H15A 1F2ZA 3ULPA 2IO1B 3VR6A 3RZWC 1I4RA 2O2LD 4A3EH 4KZ0A 4L5TA 2FNJB 2NN6G 5EE0A 1WJ6A 2RA4A 3MHBA 2K52A 1L4DB 2GBKA 4ABNA 3W9CB 3A1QA 5CV6A 1DGSA 1QLBB 1WCMB 1A15A 1LTGD 4JC0A 4TVAB 2BYFA 3A54A 2CHZA 1CFMA 3AU7A 4CKBA 1TWAH 2L0FA 3TZDA 2VQFL 4OO1H 4JI6Q 2JX5A 2FCMA 2UXCL 4C7YA 4ME5A 3LX0A 2F1MA 2BA1A 4Y7NH 2OOBB 1R4NB 2DZJA 4RAUC 1VRAB 5ELCA 2KQSA 1V5OA 1LM0A 1CKOA 2WB1B 4A3MB 5J3BA 2LVQA 4FHJA 3NBIA 1WFYA 1E7ZA 1MI2A 4CGYB 3QJYA 4WORA 1Q8KA 1EFWA 3K7AB 4EZKA 3C46A 4J15A 1VQAA 1JOKA 1QZEA 2L55A 2L15A 2MJ3A 4B3TL 4LAAA 1CQVA 3D4RA 4A3KB 2IY1B 1E3PA 2LHEA 3DBSA 4PT5A 1SNPA 2NTTA 1BT0A 2AL6A 3AE8B 4C3HB 3OW7A 4LDTB 3Q8EA 5JEAH 4DV3Q 3PUWA 3SR1A 5JPNC 1KLUD 1K0RA 1SR3A 2FHTA 1YJNA 1N36L 1MVKA 3KQ4A 2G1EA 5FLMH 2Z0EB 3ND9A 3VXWA 1CSQA 1SNCA 3IAM1 1S3OA 4US9A 4HCEA 1VZ8A 4KJOA 4JI6L 2YLMA 4JPBW 3TEHB 4OX9Q 1LTTD 3NBHB 2UXDQ 2K5PA 2B2WA 4DK3C 2G9HD 4YWLA 1VCIA 4UY8C 5FKAC 2WV6D 3TSSA 2B39A 3PHWB 3D3RA 1CA6A 2DHZA 5T1GA 4P16A 1PRTD 2SDFA 1KJTA 2OJRA 2QA4A 3UQAA 1D7QA 1LT5D 3PO3B 2WXQA 3H3VC 5G5GA 1IKLA 3W2DA 4LF8Q 2VUMB 3RZOH 2KOXA 1XNRQ 2XEWA 4KV2A 4W9KA 2MX2A 2A1AA 1U4MA 2MEKA 2J7ZA 2H88B 2F0SA 5FO9B 1PDXA 3ZKJC 3NZ3A 1N60A 3V05A 4RFBA 1XLOA 2N0SB 4H02A 1Q3LA 1ZYRD 1E7UA 4LJOB 4LNKA 2QEJC 3N20C 3DXJC 3PPAA 5IAAC 1EEFD 2MHJA 4FF2A 1T0QC 2L00B 1I50H 4DV3L 3UDXA 3PRMB 4O42A 1EY8A 5C44H 1GVPA 3NWTA 2L9HA 1P98A 2F4IA 1QZGA 4YY3Q 4DV1L 5BMHA 3KUZA 4X3UA 2IDYA 2YTYA 3QOLA 1LTRD 1D5XC 1F2RI 3I4MG 1ZXHA 1FR3A 2MH7A 2EELA 2WU2B 4CKEA 2L5TA 4DNTB 1R4QB 2BH2A 3EGRA 1OXSC 5JJKA 4M0WB 5DPRA 4OX9L 5G5HA 2KEEA 4HIMA 2R7ZG 3GD7A 3SHLA 2G9DA 3T16A 5M5XH 2UXDL 3OG5A 2Y0SB 3C1EA 3CQZB 1XNQQ 2ZEQA 4DU9A 2C5LC 2JQOA 1SIFA 4ZYNA 5M3MG 2N9EB 4FA6A 3KFUA 5C6AA 1K52A 1WF9A 2L76A 3W1YA 1XNRL 3GOEA 1WFQA 3TZUA 3SD5A 2KHJA 2L3ZA 4OWTB 4JI7Q 4N59A 4OWXB 4PYUA 1U5KA 1H9RA 1QJOA 1FEHA 2NBVB 3RYTA 2OHFA 3M85A 1ASYA 3PHXB 2A4ZA 3CWIA 3N30A 4IPDA 4KN4C 2XBBC 3V6EB 3BZKA 2PPBC 5JJIA 4RNAA 2F4VQ 1MSGA 4POGA 1PYWD 1HZAA 1LT6D 1ZEQX 4B95A 1TT5B 2GOWA 1FMAD 2XTIA 4L63B 3DBHI 4GLSC 2INDC 4YY3L 4GN1A 3PLVA 1WCMH 4DDGD 1XD3B 4DR7Q 2NVQB 2J7QB 2RD0A 3NRZA 2D5GA 5LNK1 2Z6KA 1IKMA 4KHZA 4TKOB 2M8SA 3UF8A 3FAHA 2K1BA 2Z9HA 3SK5A 3CF6E 1QB5D 1YD8U 2Z4IA 2MQHA 2G4DB 2KO3A 1XNQL 4K5XA 3I73A 1U4AA 1ZKHA 4K8IA 4LUVA 3M7GA 4B0EA 4I6LB 4A3MH 3HRDD 1I4HA 2A73B 3K7AH 3NY5A 1SDFA 4FXDA 4DUZQ 3Q0AA 5EBDA 2EY5A 2MRPA 4F1SA 4P7IA 2PVGC 1FCCC 4IM3A 1HA5A 4JI7L 4HLEA 5CTRC 4KKIA 5I2XA 4A3KH 2H4OA 1QUQB 1N6ZA 5IYCH 2L83A 2JE6I 1WXSA 3ZYYX 3FKIG 4IOCA 2NPTB 1PH8A 1D2BA 1NBFC 4II3B 2KT7A 4FADA 3CD6A 4C3HH 5AUKA 2PQAB 1LTLA 3H0GG 1QVGA 2F4VL 1UAPA 4JVZA 3GTPB 3AEVA 1YN4A 3S2DB 4F87A 2RPVA 1X6OA 3IFTA 1STGA 3QOJA 4WRDA 2E6XA 2I5LX 2QHOA 3ZLZA 3J81j 4HMIA 2GVBA 4DR7L 2KDEB 1V81A 1I4GA 2K04A 4KHPQ 2FMMA 2NWGA 3A1QB 5FO8B 3GTLB 1AWDA 1Y1WG 1AFPA 3FDTA 1P0RA 2KDMA 3I5JC 3Q24A 3DWGC 3CW2C 3FHWA 1VQOA 4RGMA 1YX6B 3H91A 2ZT9C 5E6PA 4KVGB 3PO3H 2N9LA 5AZGA 3VTWA 1FFVA 2VUMH 2GBMA 4KGSA 4DUZL 5I6WA 1TKYA 5EBCA 4NPSA 4IUQA 4F8MA 2MJEA 3NS1A 3AMZA 3W1SA 5BN4A 5DEHA 4LK0M 4UP9A 1EY7A 3F2DA 1PXUA 3SU8X 1HTLD 1RYJA 1X54A 2A68D 3D0FA 1Y1VB 4AIMA 2PTLA 5FLXL 1UEBA 4G11A 4DHZE 4IUUA 1HR0Q 2WQYB 4TQ0A 1L1OC 2NCNA 2Q8TA 2JEAI 4JOIC 2GRIA 4JI3Q 1ILQA 1TVXA 4A3DG 1P1AA 5GROA 4B9WA 4BA1I 1RODA 1ICFB 1B9MA 3T13A 3RNGC 4ANUA 2WIIB 2W3RA 4DR4Q 2MJ8A 2QKIC 5AFWA 4DXAB 1GUWA 4CQNA 5IYDH 2V1CC 4X62Q 3MWYW 4V190 4DAVA 3HOYB 2PW9A 5IT9L 3RCZA 1CK1A 1SNMA 1IYFA 5D94A 5C1ZA 4PG3A 1GJZA 2C5CA 1SGHA 5BN3A 3CQZH 2M0AA 3GV3A 1T9HA 3EJIA 1R4MB 3IBEA 3KUCB 3GZNI 2YTVA 2CW0D 4A3EG 2WAQE 5C4HA 1F0ZA 5IP7H 2F0KA 5G55A 3VUWA 2W3SA 3DPDA 4WWMA 1T6BX 2YYZA 2HE7A 1BO0A 1TWCB 1L7YA 1OXVA 3A9JB 4W9GA 4OXPA 4JBMA 4OO1G 1I42A 1SLJA 1HR0L 1XF5L 3KH0A 4II2B 3EBEA 1G8ZD 4JI3L 4FDBA 1W6JA 3B2GA 5J1ZA 3T9LA 1TBEA 5C0XH 4LF4Q 3SHQA 2NBWB 1J7CA 4BAXA 2WACA 2F52A 5ELDA 4DR6Q 3L3OC 4A3IB 1LTID 4DR4L 1A62A 3BS1A 2KC1A 5FR3A 2B2UA 4YXDB 4C56C 4GKJQ 3J7AV 4QIWE 2CWAA 1I5FA 2NVQH 4X62L 4QB4A 1K8RB 4K3CA 5HURA 2PW7A 3HIZA 2MP1A 2JEBI 1ZUD2 1SE4A 2LGXA 1UE5A 2KECA 2WX0A 1VQFA 4DN4M 1U4RA 2RDHA 3MXUA 4R4CA 2ZCCA 2CKHB 1FIQA 2KN4A 4A3LH 5HHDG 4Q0FA 3ND8A 4GOPA 2M0XA 1SF0A 1ILPA 4OZCA 1VQHA 4DA2A 5JEAG 1H9SB 2HCIA 2WP9B 3R7QA 2BS3B 1L0VB 2JWUA 3ML9A 2HDEA 2A6ED 3ABVB 5FLMG 5FO7B 4ZOHC 1KHIA 3IRBA 5FLXc 3DVGX 2ID0A 3GTGB 1AEXA 2HJ8A 3MVVA 3J80c 2E5LQ 1F9JA 1KRSA 4IG7B 2N9XA 2K6QA 4I6PA 2F0PA 1J7BA 1IW7C 3FEWX 3Q22A 1N34Q 4AUQC 1WTHA 1F2YA 4CKCA 3C19A 1KOTA 4LF4L 1CKNA 4GN5A 3GTPH 4NXMQ 5CC4A 5HGTA 1TYGB 3RNBC 4DV0Q 2RVLA 3S2DH 4WAAA 4DR6L 2BB6A 1PV4A 1TQOA 3FILA 2I5HA 1SAPA 4GKJL 5IT9c 4HCPB 4DGZA 1YN3A 1NMGA 3MEHA 3A56A 2JA9A 3DMUA 1M8AA 2F3IA 3M95A 2ZTEA 4BY1G 2BCOA 3QCAA 3RPFC 4GDKB 3GTLH 3N1ZC 3V96A 3U7ZA 1G6JA 1JRUA 1V1PB 3ZDTA 3B6YA 2KOLA 1OGWA 2E74C 2DZIA 2AKWB 2AUKA 2AYOB 2Q2IA 1OQYA 4NAWA 1LYLA 3OTOQ 4ZRIA 2ZXOA 1WMHB 3HKZG 5C44G 5LMNW 4B3MQ 1YOVB 3KLSX 5EPKA 4U673 1VQKA 4XWTA 3FVQA 2F0OA 1S4ZA 3Q69A 3N32A 2KYWA 4BKTA 1XJVA 3MTSA 1Y1VH 2DNCA 2E5LL 2ES2A 3HOUB 2C7MB 2CR5A 1GAQB 2EKEC 1EEID 3DM1A 1BOSA 4NKLA 3Q3FA 4K1RB 1SYDA 1N34L 3H7PB 4NXML 2KFJA 4DV0L 2N1WA 4O0AA 2D9UA 4OONA 3H7SA 5KIXA 1Q82C 5CGKA 3ERSX 4AQYL 3GB1A 3D4WA 1B1ZA 4FLHA 1V8QA 3IL8A 4OVZA 3HOYH 4YTNB 4ARIA 2YV5A 3ULLA 3GE3C 1GPXA 2JUOA 1SRUA 3Q8FA 1GNUA 1P16A 4W9CA 4MGKE 2QILA 4S17A 1D5ZC 1W2BA 2LGIA 1HZCA 4BBNC 1YZ6A 4XDXA 1YQ4B 4KGRA 3OTOL 1STAA 4A76A 2BWES 1A0IA 3PZ8A 1FNVA 2HQEA 2AQ2B 2IX0A 1VMPA 2MSED 4AOFA 1NTGA 1TWCH 1WCMG 3P1MA 1GKHA 3DUZA 3GS2A 1Q7YC 4IW0A 4P75A 4WIPA 3RMHA 3RNEC 4MSMB 3PUVA 4GNXC 2IGGA 1R4PB 1SN8A 2KJ6A 4CDEC 2NS5A 1PTOF 2J53A 2DYBA 2WB1G 4A3MG 4A3IH 4J1MA 2FUG1 2HD5B 1GJXA 4A3JB 3HM3A 1TZ1A 1A2TA 3AB9A 4C3IB 4LW1A 4IWOA 1BMLC 1KQSA 3BK2A 1PH4A 1J19A 2FBWB 3UDIA 2KDFB 2EPBA 3DEOA 3FMCA 2VH2A 2C35B 2HIXA 1V80A 5IYCG 3JVZX 3EIVA 2KHSA 4LF7Q 4C3HG 3MTNB 4JX1C 3L10B 3J81i 1QZHA 3TN2A 3I90A 2QW7A 1R4MI 4FXCA 3AU4A 4A6QA 1E8ZA 1ZDVA 1NAPA 2XWBB 4XIGS 3LYYA 4HJKA 4B0MA 4HSPA 3GTGH 1QOFA 1G291 5JEAJ 4DV7Q 1RFAA 1MIUA 2IZVB 3N9YC 2R92G 3KOJA 3WAOA 4APVA 3VUXA 1EM7A 1WTVA 3TEYA 3G48A 1WM3A 2Y3AA 1EYDA 1K50A 2JA5B 4I6NB 1AW7A 1Q8IA 4HIDA 2IHFA 3APFA 2WXKA 1J9OA 2LI5A 3W5VB 4UPAA 2DNFA 4N58A 1KNEA 3PO3G 3BDCA 2F0JA 1IBLQ 2VUMG 2D0PA 3QO2A 1UF0A 2LXJA 2IBIB 1NVID 3MJWA 3J7AF 3P42A 1EZ6A 3AULA 2O5IC 1KDAA 4IZ8A 5CV7A 1PFBA 1SBBB 2INCC 5IP4D 2NVYB 4IJLA 3ICEA 2B2VA 2NYZD 3CU7A 3WDNA 1ZXTA 1ASZA 4FN2A 3D8GA 3P4RB 2KX3A 3E0JA 2F3WA 3U7DA 1XWEA 1IGDA 4LF7L 2BWFA 1BF4A 3Q8DA 2WDRB 2JZPA 2VQEQ 2C60A 1MG4A 2TSSA 2KFKA 1YMHE 2IGDA 2XWJB 1PTOD 4AYBE 4NB3A 3NVWA 4F88A 1KL9A 2WDQB 5IN7A 4DV7L 2CQOA 3HOUH 4ZKCB 5IYDG 4UHVA 2JA6B 1OFFA 1JMCA 4EEWA 4ZDVA 1CZGA 1MBYA 3AE5B 3KDFA 3K9OB 4KSLC 2KEDA 1FXTB 5LLIA 2Y0SG 1I4XA 4RGNA 2EYJA 2TMPA 1HTQA 2JZ3B 1Z7TA 1D8LA 2ZVNA 1MSHA 1WGHA 1WRDB 1BUIC 1RRBA 1T0RC 3V61A 3O13A 3UQBA 1IBLL 3A4SC 1LM8B 4G50A 1BCPF 5IP7G 1ONLA 2EXZA 1IL8A 2UXBQ 2ZNVB 4PS8A 2CHBD 1V43A 2VXWA 4C2MB 3SVMA 1NEKB 1TKGA 3Q14C 3RD4A 1GUSA 1OXUA 3ZJVA 2BH8A 5K36H 3FILB 5EJWA 4RCNA 1LUZA 5BN5A 2K6AA 2EQSA 3GP7A 1S5BD 4DNRB 1SFOB 3IT6B 4KDIC 5EE3A 3X0WA 1FVIA 1BR9A 1PH7A 5D7GA 4DXGA 1H9JA 5C0XG 2D11A 2LGDA 2A19A 5EGTA 3GQBA 5FOBB 2VQEL 3QHTA 2KQ4X 3A4RA 2Z8LA 1X56A 2E76C 4HR7B 2AL3A 3E5SA 1CHQD 2G45B 2ONQA 3JAMi 2DWQA 4UP7A 4C1NI 1WXMA 3HFZB 2RPQA 4HXDA 1EYCA 1QQRA 3C2PA 3EN2A 3R2IA 4GMVA 1C4QA 2BT6A 2PNHA 1TT2A 4FYDA 1XTCD 4S0RA 2PMZB 3E9HA 4K5WA 2GA4B 2KTRA 2O2VA 4XTCS 5IGDA 5ISRA 1K0SA 1GXDC 4ZHPA 3VH3B 1E9MA 3AE7B 4A3LG 2KZRA 2AQ1B 2FE8A 1II3A 4BKSA 4X64Q 2ZVOA 1XMQQ 4HCNB 2UU9Q 4A3JH 3E9IA 3DBHB 2MGSA 2JN4A 4C3IH 2WXMA 3H1UA 2JSOA 2BKFA 1MHWC 2UXBL 2QC8A 1WI0A 2LFIA 5AJ3Q 4JV5Q 3I4OA 5IIFA 2OTLA 2HHHQ 2JRHA 4CJ1B 3A33B 3X23A 5E6NA 2K22A 5ELFA 1UZXB 3A9KA 3TIXA 1VQIA 2BS2B 1WXQA 4HTHA 2E2IB 4N8X1 1WGRA 2WXGA 1P7FA 3MA2B 2DZKA 4ACFA 4ZQ3A 4A3BB 2KKCA 4GN4B 5FJ8H 4HEDA 4YTPB 4X57B 4RM9A 1EQTA 4TUUA 3MC9A 4NP5A 4RMFA 1XEEA 3PUYA 1XCQL 4DAMA 2ASQA 1A5RA 1QT9A 4JI8Q 5JHAA 3M3JA 4EVOA 4ZKBB 2L05A 3CRLC 2OCEA 2WDTB 3Q8BA 3TEWA 2BYEA 3LNNA 1D1IA 1VQ9A 1NNXA 4YTMB 3J81E 1WTWA 1OO9B 3AE3B 4OZAA 2JA5H 5DM73 2L32A 2BDOA 1K8OA 4KIKA 2EVBA 4YSYB 5D14A 1UGJA 4X64L 4OGQC 1XMQL 4ZRPA 5G2NA 2UU9L 3HVZA 4GDLA 3ZIMA 1L1OA 3LGJA 5C3XA 2KX0A 2EJGC 1WGDA 5JPMC 5IA7A 1EY4A 2NVXB 2B2TC 3MXPA 3PZDA 4LNFA 1SE8A 2L1BA 4PMBA 5G3LF 4DXFA 1UGMA 4JV5L 2WDVB 2NVYH 2CVRA 2HHHL 1NCVA 1Y1VG 2VZKD 1EU4A 4QGUA 1XPUA 2CU3A 1TS2A 2FINB 1PA6A 4JE3B 1PLFA 3KUDB 2DNEA 3CCEA 4BBRB 3M3YB 4OIKA 1WE6A 4KKTA 4B08A 3DCGA 1JW9D 1B2TA 1TIID 5AUIA 1J8CA 2F0DA 2A6HD 3KBXA 2FXQA 4JI2L 3C8YA 2FAZA 1STYA 1TJEA 1EO6A 2HD3A 1CQFA 3M63B 1X3EA 3UI3A 1G6PA 1EY0A 1OTRB 1U9RA 4IWQA 3PIO3 1A70A 2G4SA 3IT4B 4JI8L 2ZW1A 2JA6H 1YI2A 3HOYG 3STBD 4NNJB 3HOXB 1IBKQ 3EQLC 1PGAA 2LVOA 3P4PB 1YNNC 3CSTA 1IBXA 2HCCA 3A8KE 2KWUB 2PW5A 1WVLA 1JB7A 2NB0A 3JSVA 4P6VF 3PGZA 3NTKA 4KHVA 1B7YB 1F9PA 4DAYB 2JA8B 2PIAA 2N9KA 4HKZE 3SE0A 5DLQE 2EMTA 2KCMA 4FJYA 3ZJUA 1S5FD 4J8QA 2XK5B 3VAWA 4IPGA 1YNJD 4HPLB 2AUJD 1PH9A 3ALBA 1PRTC 2G5DA 1Q90A 4C2MH 4ZAIA 1VJKA 1C78A 4GU2A 3Q23A 2VNUD 2AX5A 3C0RB 4K7UA 2CKZB 4XT1B 3ZTCA 3BYTB 4UAIA 1NBWA 4C3JB 1JOQA 1CI3M 1E1TA 2PZUA 4KJNA 2PE9A 1VS0A 2L4NA 4IN3A 1SFOH 2GVAA 3PO2B 2NTSA 1OXTA 4QUCA 2KK8A 1E0ZA 1JWBD 3K58A 1Z2MA 5J2RA 3RNCC 4A3GH 3GZNB 1XPOA 2E2JB 3M4OB 4G7OC 1Q10A 3L9AX 3AXCA 4TQ1A 4A3IG 4MH0E 3FPPA 3U58A 3CIRB 3WIMA 1T5EA 4MTKA 1HE8A 4GXBA 1HTPA 5C0XJ 1F2LA 2MWSB 3M62B 2QJLA 1HNWQ 2K5WA 1TY2A 3CMEA 4K0KQ 3P20A 3KF6B 3X3MA 1IBKL 2IW3A 4RG1A 5G3LD 5FR6A 4EQOA 4WWOA 3OMCA 4K6LA 4BA2I 3QAQA 1EIFA 5E6JA 5LXHA 1X3FA 1K73C 4ALPA 3ZNZB 1KDCA 1QILA 5LHY1 3RT3B 2V3PA 4IUPA 2NR2A 4W9HA 4M02A 4L5SA 2LGSA 2NBUA 3KWLA 3V60A 4CDDC 3JAME 2WGSA 3U52E 2JPHA 2PKOA 3PGEA 2L0CA 3RULA 4IPHA 2KMMA 2V3SA 4P1BC 2D5DA 4X3SA 4WJNA 3ZGZA 1DXMA 4NAMA 1NJIC 5GXGB 2Z6BA 4ASWC 4RCOA 2Q2TA 3S14B 2XIWA 3DWPA 3CC7A 1EZ8A 1LO5D 1NY4A 2E2IH 1FJGQ 4GIVA 1QVCA 1GOZA 1X3QA 2RSOA 1RF2D 3L4PA 3U4EG 1VMCA 3B9JA 3EFXD 3QB3A 4A3BH 1H9MA 1BBXC 2B29A 5LL6X 1K8MA 3HG9A 4W9JA 1I6VC 2MBHA 3HRZC 3IXSA 3CXCA 3RR5A 2QDLA 4K14A 1Y69U 1B9RA 3HP3A 2RGFA 4H2AA 2R93B 5J22A 3S1RB 1CJEA 4L2YA 5DM63 4CDCC 4LF8L 4QMGA 1HNWL 4ZRKA 1M4VA 4IPCA 3B2FA 4K0KL 2KQ7A 4TSSA 1T5XD 4RH6A 2AWTA 4K5VA 1GB4A 2FCQA 1YEZA 2PNRC 4KD3A 4EFOA 3DLLA 4HPMB 2RF4A 4NDXA 1B8AA 1QE6A 4W9IA 4QY7A 2KANA 2RDFA 1WR1A 1IGCA 3BVMA 4C4VA 2QDBA 4ARCA 2NVXH 3EHVA 1MJCA 4I7ZC 4RHSA 4IFDI 1ZKOA 4NJCA 1N32Q 4TV3A 1FXAA 1B44D 2DENB 4JCVE 5J39A 1A3TA 2NVTB 3PO0A 3HOUG 3HK0A 3NVVA 2IO0B 4BBRH 1FJGL 3M3YH 2WXPA 1MFWA 2G3QB 2MBEA 3PIOA 2K75A 1X32A 1L0XB 2A69C 4HDQA 5EKKA 3QWNA 2J52A 3A9KB 4HJ8A 2LZ6A 5EPLA 4KV6A 2EE1A 4HVBA 1VF7A 2ON8A 4JK1C 3VYRA 1FD6A 3T4AC 1E5WA 4GLVB 1WTPA 3ECIA 3I57A 3HKSA 4AJWA 2OQKA 3TEZA 3RI7C 3VTVA 2F0WA 1LFDA 3S1MB 1C4CA 2K3UA 3F2BA 4MGYE 3HOXH 1HR0W 4LNIA 2D2CC 4M01A 3BU2A 1RIPA 2NZOA 4GN3B 4URKA 1E1OA 4MM3B 5K36G 4LJPB 2F0GA 2JA8H 3BDLA 2KVMA 3AV8A 5M5YB 2WINB 1ET6A 1BNZA 2B3AA 5GAHC 2BF8B 1SMXA 3VYTA 5IOCA 3IAYA 3W5UB 4LNOA 3I56A 4K2KA 5TSSA 3C3LA 3A74A 2XN9C 4KIKB 3CCSA 1N32L 1VCBA 5DCNA 4OHJA 2WKDA 1CHPD 4WH4A 4C3JH 5EE9A 4YIJA 4GDLB 1UWVA 1WWTA 1EF1A 3PO2H 3ML8A 1IYJB 2A5HA 5NUCA 1H4RA 3T56B 4AS1A 4BBSB 2OXPA 2ZM6Q 1PGXA 2E2JH 2INNE 1IXRA 4LFBQ 3M4OH 2F0QA 5E4XA 3AEFB 2WKCA 2OEOA 3VVWB 3BZDB 5KYLA 2BTEA 3J7ZC 4WJWA 3OW2A 4R4TA 5EKIA 3L2PA 1E7VA 2JJQA 1YJIA 2N1VA 2N9PC 2LS01 2OT2A 1DOMA 1YITA 2IT1A 4C3IG 1VR9A 4NJ7A 3R7RA 1D1KA 2LD9A 1OQQA 4G0NB 1Q5WB 5CV9A 4A3CH 5GAEC 1NENB 1YX5B 2MBBB 1VQDA 1ML0D 1KF6B 3TCAA 1VQ5A 3HHMA 1XLQA 3LB8C 4LLGM 5D6JB 3TQYA 4IQZA 2LRWA 3DDCB 4ZLTF 3ZXVA 3TP8A 3HOZB 4BXXH 4BKSD 4L6TB 5JVH3 1F9QA 1F77A 5JJLA 4LJZC 4KK7A 4PNYA 3Q3NC 4POFA 1RCVD 1I7HA 2D2QA 2JYOA 2K5NA 3NE5B 1EIGA 3JSVB 5FJ8G 2DYMA 4K8JA 3VRAB 3H3VI 2BQQA 4UP8A 1FRDA 1FGUA 2KUMA 1I35A 2D0OA 1EQVA 1R7SA 1DOKA 4A90A 3S14H 1IZ6A 2JY6A 4JBKA 1JB3A 1FYCA 2A8VA 3O65B 1VQBA 5IGEA 4XC2A 4OVVA 1LTAD 2V0GA 3J81L 3NHEB 5BMGA 1JC7A 3BYYB 4R4IA 4KHPL 1E8YA 4A20A 4YWGG 2WLBA 2ZM6L 1SNDA 3U4ZA 4K6DA 5A2QE 1K3RA 3AMUA 4A55A 3DVGY 3ZRCA 1MKHA 3P4QB 2R93H 2A74C 3S1RH 2I1JA 4YWMA 3IKJA 4HIOA 3X3NA 1AYFA
chains in the Genus database with same CATH topology
3T51B 2WXHA 2F0FA 2IJ0A 3KK7A 1F9SA 5FK9C 1FXIA 1PUTA 3VRBB 1QWYA 1R9TB 2RSNA 1DOYA 5C4ZA 1U4LA 3ERQA 2HTME 1XLNA 3NWSA 4IUVA 4NZLB 2MHVA 1ZE3D 4TRDA 2A6EC 1STNA 4IOIE 4H0LC 2XRSD 1NSNS 1SE3A 3VYSA 3QIAA 4HJGE 3HZXA 3HGBA 1TS3A 2F0EA 1N63A 4KY5A 1RWSA 2WAQB 3OHXC 3SK6A 1O78A 1HRJA 1VF5C 1XO3A 3PIP3 5C3WA 2PYKA 2GI9A 2QSDA 1FO4A 1EY9A 4MIUA 4HN7A 5EQ0A 1WSPA 2F0TA 3E6ZX 3MAQA 3AB5A 2VB3X 2EYMA 4DQOC 3TBIB 3A7AB 3I4LA 3K57A 1G91A 3SEBA 1V8CA 5HI1A 4QIWB 2JP1A 2IX1A 1KAAA 3I4MB 3S9WA 1DOLA 1JMLA 2VB2X 1EYAA 1Q12A 4H44C 3G7LA 3JAML 5H92C 4OL7A 3H8HA 3MP9A 1TWGB 2O4XA 4UDUC 2PLPA 1PMRA 1AZQA 2ZXPA 3NXWA 1B3AA 3OOCA 4V0BA 3KWVA 4RF1A 1ENCA 1IW7D 3CRKC 2JA7B 3AE9B 3CKIB 3G6JB 1FCLA 2SAKA 1WYGA 3S1NB 1F2MA 1BXTA 2H89B 4WURA 1N5WA 2EY2A 1MD2D 4RA8A 1WTXA 1TZOA 4J6HA 1L5PA 1SYBA 2B2TA 2LMCA 4MT5A 4FF1A 1HZ6A 1D4BA 4WQMA 3VR9B 1Y8OB 3VR3A 1WTOA 3VYUA 1KH0A 1FFUA 4XQNA 4A8XC 1EY5A 3AE6B 3NQIA 3EROA 1SJHD 2IGHA 2V3NA 4KX6B 2QCPX 1HCZA 5IGCA 3F2UA 2B8GA 2CQAA 3TP7A 2L11A 1JE4A 3IAS1 5M3FB 1PTOB 2K01A 3N6RA 1SMYC 1G6ZA 1JR0D 1OQRA 4FXGC 2AWNA 1QOAA 3NVZA 4FP5D 3H94A 3H0GB 1DZ1A 3AN1A 2M00A 1EFID 2IPKD 5KNBA 4ZYSA 1BQQT 3KF8A 2DYOA 1D6EC 4YSXB 2NN6I 2BS4B 3AEGB 1YN5A 1GHJA 1GHKA 3OPOA 5D3DA 2F03A 3SR6A 5E4WC 1AN8A 4ODGA 1XXGA 5COYA 4HRSA 4XXEA 4C3JG 2J0TD 4C1NK 1J8IA 5C4XB 2WP8J 3CHBD 4N9PA 2I07B 1Y8NB 2BA0A 1PGBA 1VLBA 1YNTE 3K59A 3OWFA 4A3DB 1E2ZA 2M56B 4KD4A 2Y5PA 4L8JA 3ZJTA 3K6OA 1OXXK 3NTHA 4QF4A 1WGKA 2F0NA 1XYIA 4RKLA 4X3KA 1CZPA 3RZDB 3K0YA 4TMAB 3I70A 2R3ZA 5KNCA 3FRPB 1AZPA 1N5XA 2BB5A 2K03A 1A3UA 3AEBB 1L6UA 2C9OA 2E3TA 2K05A 1MI0A 2K32A 1DCZA 1SNQA 4BY7B 3TP6A 1ACCA 1IYUA 1TWHB 1MGSA 4KTAA 3I91A 3EVQA 3KBGA 1EWYC 1DJRD 1ICWA 3AECB 1BCPB 1JOOA 2BE5D 4RGTA 5KYIA 1RJTA 3I9V1 3VR5A 3OIPA 2KCCA 3I3CA 4R8NA 3V2TA 2F0MA 3D6CA 3BVGA 3SXHA 5C5MA 2W54A 4DFAA 3S2HB 3TUOA 2K28A 2XVSA 3ITPA 1ENFA 1HFNA 1B50A 4KGTA 3KLSA 4HROA 1MPEA 4A93B 4A3GB 1E2VA 3E56A 4Z9CB 4I65A 4H13C 3K5LA 3S17B 2VZKB 1XLPA 1VDZA 2LFNA 3A8JE 4M1UB 3R93A 4NAWB 4AYBB 4M0WA 2YEPF 4S3SA 5I2YA 2X6GA 5C3EB 1PTOH 2EDGA 3I4NB 3M4YA 1QF6A 4QUFA 2KA7A 2JU6X 4A3FB 1JALA 3W3AA 3DEPA 2DBYA 1XX8A 3R2TA 5JJZA 2B76B 3GTQB 1C48A 5JXVA 2B63B 1F2RC 4BY1B 1FNUA 3S15B 1A6XA 2EJFC 1LT4D 2QIEB 1IYVA 3I8ZA 4BS9A 4CJ0B 4MHEA 2WU5B 1HHVA 2LJIA 1C4AA 4K2LA 2ICEC 3MJ5A 1BCPD 2KQ3A 1HA6A 2RBMA 1ZXIA 1KNAA 3T3NA 1KDBA 2V4IB 5FLXE 2SOBA 3J80E 4F7XA 1ZOYB 3HOWB 3HUIA 1N62A 1ESRA 3WCQA 2X6LA 3OSOA 3VR4A 3AEAB 4ULLA 1PZID 4PQXA 4OIJA 3MFYA 5KEEA 2K5DA 2PQEA 1GUTA 1EOTA 1SYEA 1LV9A 5BYRA 2HDLA 1PRTF 1J7AA 3HOVB 5LL6S 3VR8B 5M5WB 1YNJC 1S5ED 1UEAB 2RQXA 4BWGB 1LLRD 5I9OA 1DD2A 4ZUIA 3NK9A 3AH7A 4IUNA 5ELEA 1Y56A 1LTBD 2XSCA 2JSVX 2AQ3B 4PMCA 1GUGA 5CBEE 5CORA 4NMZA 4D2KA 1DOIA 2EYFA 3S1QB 4G7ZC 3C1FA 1EIHA 1SXTA 5BMIA 1FM0D 1TR5A 1GB1A 1Z6HA 4IURA 3J9CA 2WXRA 4ZUJA 1KABA 2NUCA 2DLBA 1K51A 2R61A 3GV6A 5JVG3 2E2HB 1TS4A 2F0VA 2RDGA 2NBFA 3P4SB 4KN7C 1QOGA 1UNSA 3DWMA 2EYOA 2KAJA 1RTOA 1ZYRC 2F0LA 1VZ6A 3RFZB 3GTOB 4LK1C 1CM9A 3KUPA 3U9SA 5MPOA 4HEA1 1KLGD 3ONAB 2M2LA 2MPMA 3D31A 4RWSC 2JYEA 1YNND 1JWSD 4XT3B 3K5OA 2M9VA 2R92B 1RHPA 5E1FA 1QG7A 1SSNA 4KY7A 4IFDH 1O7ZA 4IDIA 3HS0C 3PMFA 4OO1I 2ZW0A 2K33A 2WXOA 1JQ4A 1QNKA 4DF7A 4Q5VA 1WRIA 1L6VA 1QCBD 2QMTA 1WTRA 3AM9A 1EWCA 2IL8A 1JROA 3LWUA 2XNAC 4AQ7A 3OIQA 4FF3A 2B2YC 4R3DA 1E10A 3PUXA 1WD0A 1TKWB 1BDOA 5C2TB 3EA6A 3BDOA 4MN3A 2K5QA 1QOBA 2B2VC 3GO5A 4XYQA 2EYHA 3BIID 5C5LA 2JXTA 1CA5A 1ENAA 3RUZA 3K5MA 1H9SA 2E2DC 5M9OA 3S16B 2FMCA 3NSWA 3PV0A 1GUNA 2BDNA 1YQ3B 1DGJA 1V97A 4JBWA 5EE1A 5JAVA 2LKVA 4O1NA 2CJNA 1N61A 2LEKA 4P2CB 1K83B 2F0UA 2JYTA 2Y5CA 4N6EB 1EWHA 2MUYA 3GTMB 5KNDA 4CBVA 4OZBA 3GTJB 1Y8PB 4LTUA 4XYOA 4FXKC 1SYGA 2EYLA 3BWUD 5CR3A 2WXFA 1V1PA 2WNMA 4XQQA 4R8IA 1C4PA 1PDQA 1I4PA 5HG2A 1HFGA 4ILWA 2L1AA 4KI0A 4E6IA 2ACZB 1AP0A 1CZWA 3J7YW 5IGBA 3UI2A 3VA5A 2GB1A 4CJ2C 4HAEA 1C79A 3SFEB 4C7ZA 2DN8A 4US8A 3MZ5A 1O80A 4JWSC 4FVMA 2I2YA 2A68C 2A69D 3BK1A 1RM6C 4XWWA 1ESFA 2N7JA 4C80A 3R8BA 1DM0B 3SK8A 3HEJA 1WD1A 1I4QA 1PFMA 1ROEA 2EOTA 4EQNA 1G2TA 4RGOS 3NQTA 4FNFA 1TU2B 1SEBD 3TMEA 1HEZE 5D3IB 1Q1BA 4OW0A 1RD9D 5K5PA 1IBXB 3GTKB 3NHHA 2ICIA 2CW0C 2L52A 2XRQD 3TDQA 3WOEA 3N52A 2K9XA 2J42A 4FO2A 1MHHE 4PMWA 1A2UA 3VQIA 3J80L 5DNFA 1E6EB 3FPUB 1STHA 2WXNA 2WXIA 1SNOA 2X38A 1RDPD 1KRHA 2BBCA 3K5NA 3DWAA 2BOSA 3AEDB 3Q8AA 3BVZA 2YU9B 2PZWA 3LXFA 1H9KA 1PFDA 2W55A 2OF1A 1O7YA 3Q8CA 2EY6A 5F2DA 2EJMA 1NUCA 3FC4A 2F0IA 3SK4A 1TY0A 2K7VA 1ZPSA 4YT0B 4HMJA 4MH8A 1HXYD 3NP8A 3LWEA 4KY6A 1MHXA 2LY7A 1VZ7A 2LHDA 1E7PB 4IUTA 4KKJA 2ENBA 1D5MC 1EU3A 2JQRB 1HUNA 2Q8IB 1K53A 2KJXA 3A7LA 2J4XA 3E9SA 2H1EA 1ZDXA 1B4OA 1FRRA 5CBAE 1QKZA 5T8IA 3T53B 3P63A 1O7LA 1SB3C 2BYTA 3MXGA 4NW2A 5BYQA 2KACA 4PV1C 3I72A 4USAA 1F9RA 2NZ1D 2WXJA 1LACA 2B2WC 2PCFB 1STEA 1YJJA 1W6KA 3MHZA 1EL0A 1NR4A 1HPCA 3VR2A 1RTNA 4DAPA 2O5JC 1ZP0B 2EY1A 3U2SC 1I3QB 1FD7D 4EGVA 1RKNA 2D62A 2E75C 3PUZA 4Q2JA 1PFNA 4EE2A 1JICA 4IFDG 2PZTA 4G57A 2R7ZB 2N88A 2PO4A 5I6YA 1C77A 5C0XI 4IKGA 5JOBA 4HKQA 3MFGA 5M3MB 1B53A 5CMDA 2Q5WD 1IHZA 3RLFA 4KKSA 5KGUA 2I46A 2RKSA 2W82A 2L12A 1I6HB 4B9XA 4LMQD 2NMQA 1HQRD 2NN6H 3NUCA 4M8AA 3MC0B 4A9AA 3DHQA 2K0PA 5BYSA 1LABA 3P7JA 1E2WA 1NR2A 1S5DD 5I4DA 2KWDA 3A8IE 5CYUA 2SEBD 2KCNA 3SDZA 3WOFA 2Z1CA 1QOHA 3M7NA 3P75A 3ZQ4A 1UWMA 4KKUA 1DOXA 1U4PA 2JXMB 1PZJD 4ZK9B 4QCLA 2WS3B 4DK1A 2OEDA 2M19A 2EZVA 5CV8A 1QNUA 3FKIB 4J3OD 5D65A 4L1BA 4X3TA 5CV5A 2X69A 4L23A 4R9WA 3URYA 1TWFB 3MXNA 2F0HA 4XDDA 4DK0A 2LUMA 2DY8A 1JWUD 1XCTL 3L7ZC 4KMUC 1A3VA 1TKEA 1Y1WB 1SYFA 2SNMA 4HCSA 3QG1A 2AWOA 1EY6A 1JRPA 4TQUS 1VDVA 3ETRA 1JWAD 3AEEB 5C4JB 3NTIA 3V3XA 4G7HC 4GZYC 1HQMC 5DAUA 1SMYD 2QF7A 4REZA 1C76A 1NYRA 2I38A 2IWHA 5KRUA 1FNWA 4MACA 3AE1B 3T3OA 3KLRA 5CV4A 1TS5A 1STBA 1PTOC 2WXLA 3PZ7A 4G4KA 4H7BA 1LTSD 4IALA 4DAYA 2F3VA 5ELBA 5IODA 2IX3A 1S5CD 1JQYD 1B9NA 1JWMD 3OWEB 2R6GA 1FGBD 1SSOA 1ET9A 3A55A 2B2YA 2BE5C 1UUPA 4XE0A 4IFDJ 1CT1D 1PZKD 4A3EB 2FJ2A 1L4ZB 4ZRQA 3HVDA 3NBHA 3AE4B 3TEXA 1T3QA 3P1HA 1HZ5A 1G2SA 5A2QL 1TWAB 4U68A 3SFDB 2DY7A 5C3JB 4Y7NB 2ZXRA 3NVYA 5IGGA 4WAFA 5A35A 4FF4A 3TP5A 2N55A 1KTKA 1JORA 2Z4HA 3D6WA 1SJED 3D4DA 1NI3A 3H6MA 1C8CA 1SIJA 5EKLA 5I9PA 2RMMA 4ITKA 3IFDA 2B2UC 3EUB2 1V1OA 1UWXA 4XDCA 2YEPB 1Z47A 1KFYB 4JPSA 5H8YE 1RFKA 1Q1EA 3NUHB 3BG3A 1DONA 1JCKB 5E3FA 2BW2A 4RF0A 2SNSA 2CJOA 1IUEA 2V4DA 1NYQA 3VA7A 1BCPC 3RZOB 1L0YB 1DYQA 2B8FA 1SE2A 1HUMA 4EQPA 2LMCB 3OMGA 5EPJA 4CHTB 5T1IA 3Q6SA 4RKBA 2PMVA 4ZHOA 2Q8RE 3DWQA 4ID6A 1CTMA 4JWUC 2HUGA 1I50B 3HKZB 5C44B 4N9TA 1E0BA 1C9FA 2MJDA 4HSVA 2HDMA 3AE2B 4ZRZA 3U9OA 1P7EA 2FFKB 3R3OA 4XQJA 2A6HC 2EYPA 5M5XB 4WFN3 3H09A 4YSZB 1LT3D 1X3PA 1SYCA 1BUVT 5IGFA 1GUOA 2EKIA 5IT9E 1PRTB 4RHRA 1WTQA 2INPE 3NPPA 1F2ZA 3VR6A 1I4RA 2O2LD 2NN6G 5EE0A 2RA4A 3MHBA 1L4DB 4ABNA 3W9CB 5CV6A 1QLBB 1WCMB 1A15A 1LTGD 3A54A 1CFMA 3AU7A 4CKBA 3TZDA 4OO1H 2JX5A 4C7YA 4ME5A 3LX0A 2F1MA 2BA1A 4RAUC 1VRAB 5ELCA 2WB1B 4A3MB 3NBIA 1MI2A 4CGYB 3QJYA 4WORA 3K7AB 3C46A 1JOKA 2L55A 2MJ3A 4LAAA 1CQVA 3D4RA 4A3KB 2LHEA 4PT5A 1SNPA 2NTTA 3AE8B 4C3HB 3OW7A 3Q8EA 5JEAH 3PUWA 3SR1A 5JPNC 1KLUD 2FHTA 1MVKA 3KQ4A 2G1EA 3ND9A 1SNCA 3IAM1 4US9A 4HCEA 1VZ8A 4KJOA 1LTTD 2K5PA 2B2WA 2G9HD 1VCIA 5FKAC 2WV6D 3TSSA 2B39A 3D3RA 1CA6A 5T1GA 4P16A 1PRTD 2SDFA 1LT5D 3PO3B 2WXQA 3H3VC 5G5GA 1IKLA 3W2DA 2VUMB 2MEKA 1U4MA 2J7ZA 2H88B 2F0SA 5FO9B 1PDXA 3NZ3A 1N60A 3V05A 4RFBA 1XLOA 2N0SB 1Q3LA 1ZYRD 2QEJC 3DXJC 1EEFD 4FF2A 4O42A 1EY8A 3NWTA 2L9HA 2F4IA 5BMHA 4X3UA 2IDYA 3QOLA 1LTRD 1D5XC 1F2RI 1ZXHA 1FR3A 2MH7A 2EELA 2WU2B 4CKEA 2L5TA 4DNTB 1R4QB 3EGRA 1OXSC 5G5HA 2KEEA 3GD7A 3SHLA 2G9DA 3T16A 2Y0SB 3C1EA 3CQZB 4DU9A 5C6AA 1K52A 3TZUA 4N59A 1H9RA 1QJOA 1FEHA 2OHFA 3M85A 3CWIA 4KN4C 2PPBC 4RNAA 1MSGA 1PYWD 1LT6D 1ZEQX 1FMAD 4L63B 4GLSC 2NVQB 3NRZA 5LNK1 2D5GA 1IKMA 4KHZA 4TKOB 3FAHA 2K1BA 3SK5A 1QB5D 2Z4IA 4K5XA 3I73A 4K8IA 4B0EA 3M7GA 3HRDD 1I4HA 2A73B 1SDFA 4FXDA 3Q0AA 5EBDA 2EY5A 2PVGC 1FCCC 1HA5A 4KKIA 5I2XA 2H4OA 2L83A 2JE6I 3ZYYX 1D2BA 5AUKA 1UAPA 3GTPB 1YN4A 3S2DB 4F87A 2RPVA 3IFTA 1STGA 3QOJA 4WRDA 2E6XA 4HMIA 1I4GA 2K04A 2FMMA 2NWGA 5FO8B 3GTLB 1AWDA 1AFPA 3FDTA 2KDMA 3Q24A 3DWGC 4RGMA 3H91A 2ZT9C 2N9LA 1FFVA 4KGSA 5I6WA 1TKYA 5EBCA 4F8MA 4IUQA 3W1SA 2MJEA 3NS1A 3AMZA 5BN4A 5DEHA 4LK0M 1EY7A 1PXUA 1HTLD 1RYJA 2A68D 2PTLA 1Y1VB 5FLXL 4IUUA 2WQYB 4TQ0A 2Q8TA 2JEAI 2GRIA 1ILQA 1TVXA 4B9WA 4BA1I 1RODA 1B9MA 3T13A 2WIIB 2W3RA 2MJ8A 2QKIC 5AFWA 1GUWA 4CQNA 4V190 3MWYW 3HOYB 4DAVA 2PW9A 5IT9L 1CK1A 1SNMA 2C5CA 5BN3A 3GV3A 3EJIA 2CW0D 5C4HA 1F0ZA 2F0KA 2W3SA 4WWMA 1T6BX 2YYZA 1BO0A 1TWCB 1OXVA 4OO1G 1XF5L 1G8ZD 3B2GA 1W6JA 5J1ZA 5C0XH 1J7CA 2WACA 5ELDA 3L3OC 4A3IB 1LTID 3BS1A 5FR3A 2B2UA 4YXDB 4C56C 3J7AV 4QB4A 5HURA 2PW7A 2MP1A 2JEBI 1ZUD2 1SE4A 2KECA 4DN4M 1U4RA 2RDHA 3MXUA 2KN4A 1FIQA 5HHDG 4Q0FA 3ND8A 1SF0A 1ILPA 4OZCA 4DA2A 5JEAG 1H9SB 2HCIA 2WP9B 2BS3B 1L0VB 2JWUA 2HDEA 2A6ED 3ABVB 5FO7B 4ZOHC 2ID0A 3GTGB 1AEXA 3MVVA 2F0PA 1J7BA 1IW7C 3FEWX 3Q22A 4CKCA 1F2YA 5HGTA 5CC4A 1TYGB 2RVLA 2BB6A 1TQOA 3FILA 1SAPA 4DGZA 1YN3A 3MEHA 3A56A 3DMUA 1M8AA 2BCOA 3RPFC 4GDKB 3U7ZA 3V96A 1V1PB 2KOLA 2E74C 2AUKA 2ZXOA 4XWTA 3KLSX 5EPKA 4U673 3FVQA 2F0OA 1S4ZA 3Q69A 3MTSA 2DNCA 3HOUB 1GAQB 1EEID 3DM1A 1BOSA 4NKLA 1SYDA 2D9UA 5KIXA 5CGKA 3GB1A 3D4WA 1B1ZA 1V8QA 3IL8A 4OVZA 4YTNB 4ARIA 1GPXA 3Q8FA 2QILA 1D5ZC 2LGIA 4XDXA 1YQ4B 4KGRA 1STAA 3PZ8A 1FNVA 2HQEA 2AQ2B 2IX0A 1VMPA 3P1MA 3DUZA 3GS2A 4WIPA 3RMHA 3PUVA 2IGGA 1R4PB 1PTOF 2J53A 4J1MA 2FUG1 1GJXA 4A3JB 1A2TA 3AB9A 4C3IB 1BMLC 3BK2A 2FBWB 2EPBA 3DEOA 3FMCA 2KHSA 4C3HG 4JX1C 3TN2A 3I90A 4FXCA 4A6QA 1ZDVA 1NAPA 2XWBB 4XIGS 3LYYA 4B0MA 4HSPA 1QOFA 1G291 5JEAJ 3N9YC 1EM7A 1WTVA 3TEYA 2Y3AA 1EYDA 1K50A 2JA5B 1AW7A 1Q8IA 2WXKA 1J9OA 3W5VB 4N58A 1KNEA 3BDCA 2F0JA 3QO2A 1NVID 3J7AF 3P42A 1EZ6A 2O5IC 1KDAA 4IZ8A 5CV7A 1PFBA 1SBBB 2NVYB 2B2VA 2NYZD 3CU7A 3WDNA 1ZXTA 3D8GA 3P4RB 3E0JA 2F3WA 1XWEA 1IGDA 2WDRB 1BF4A 2JZPA 2TSSA 1YMHE 2IGDA 2XWJB 1PTOD 3NVWA 4F88A 2WDQB 4ZKCB 2JA6B 1OFFA 1CZGA 1MBYA 3AE5B 2KEDA 1I4XA 4RGNA 2EYJA 2TMPA 1Z7TA 1MSHA 1BUIC 3O13A 1BCPF 1ONLA 2EXZA 1IL8A 2CHBD 1V43A 2VXWA 4C2MB 3SVMA 1NEKB 1TKGA 3RD4A 1GUSA 1OXUA 3ZJVA 5K36H 3FILB 5EJWA 4RCNA 5BN5A 2K6AA 3GP7A 4DNRB 1S5BD 1SFOB 3IT6B 5EE3A 1BR9A 5D7GA 4DXGA 1H9JA 5C0XG 5EGTA 3GQBA 5FOBB 2KQ4X 2Z8LA 2E76C 4HR7B 3E5SA 1CHQD 2ONQA 2DWQA 4C1NI 1EYCA 1QQRA 3C2PA 3R2IA 1C4QA 2BT6A 1TT2A 4FYDA 1XTCD 2PMZB 4K5WA 2GA4B 4XTCS 5IGDA 5ISRA 1GXDC 4ZHPA 1E9MA 3AE7B 2AQ1B 2FE8A 1II3A 2MGSA 2WXMA 2JSOA 2LFIA 5IIFA 4CJ1B 2K22A 5ELFA 2BS2B 1WXQA 4HTHA 2E2IB 2WXGA 1P7FA 3MA2B 4ZQ3A 4A3BB 4HEDA 4YTPB 1EQTA 4NP5A 1XEEA 3PUYA 1XCQL 1QT9A 4EVOA 4ZKBB 3CRLC 3Q8BA 3TEWA 3LNNA 1D1IA 4YTMB 3J81E 1WTWA 1OO9B 3AE3B 4OZAA 5DM73 2L32A 2BDOA 1K8OA 2EVBA 4YSYB 5D14A 1UGJA 4OGQC 4ZRPA 3HVZA 5C3XA 2EJGC 5JPMC 1EY4A 2NVXB 2B2TC 3MXPA 5G3LF 2L1BA 4PMBA 4DXFA 2WDVB 2CVRA 1NCVA 2VZKD 1EU4A 2CU3A 4JE3B 1TS2A 2FINB 1PLFA 2DNEA 4BBRB 3M3YB 4OIKA 4KKTA 4B08A 1JW9D 1B2TA 1TIID 5AUIA 2F0DA 2A6HD 3KBXA 3C8YA 1STYA 1TJEA 1CQFA 3UI3A 1EY0A 1U9RA 3PIO3 1A70A 3IT4B 2ZW1A 3HOXB 3EQLC 1PGAA 3P4PB 1YNNC 1IBXA 2HCCA 3A8KE 2PW5A 1WVLA 2NB0A 4P6VF 4KHVA 3NTKA 1F9PA 2PIAA 2JA8B 2N9KA 4HKZE 3SE0A 3ZJUA 1S5FD 4J8QA 1YNJD 2AUJD 1PRTC 1Q90A 4ZAIA 1VJKA 1C78A 3Q23A 2VNUD 2AX5A 4XT1B 3BYTB 4UAIA 4C3JB 1JOQA 1CI3M 2PZUA 4KJNA 2PVOD 4IN3A 2L4NA 3PO2B 2M0AA 2NTSA 1OXTA 4QUCA 1E0ZA 1JWBD 3K58A 2E2JB 3M4OB 4G7OC 1Q10A 3L9AX 4TQ1A 3FPPA 3CIRB 1T5EA 1HTPA 5C0XJ 1F2LA 2QJLA 2K5WA 1TY2A 3P20A 3X3MA 2IW3A 5G3LD 5HFYA 4EQOA 5E6JA 3OMCA 4K6LA 4BA2I 1KDCA 1QILA 5LHY1 2V3PA 4IUPA 3KWLA 3JAME 3U52E 2PKOA 2L0CA 2KMMA 2D5DA 4X3SA 3ZGZA 1DXMA 4NAMA 5GXGB 4RCOA 3S14B 2XIWA 3DWPA 1EZ8A 1LO5D 1GOZA 1X3QA 2RSOA 1RF2D 3L4PA 3U4EG 1VMCA 3B9JA 3EFXD 3QB3A 1H9MA 1BBXC 5LL6X 1K8MA 3HG9A 1I6VC 3HRZC 3IXSA 1Y69U 4K14A 1B9RA 3HP3A 4H2AA 2R93B 5J22A 3S1RB 1CJEA 4L2YA 5DM63 4QMGA 1M4VA 3B2FA 4TSSA 1T5XD 4RH6A 4K5VA 1GB4A 2PNRC 4KD3A 4NDXA 1QE6A 2RDFA 1IGCA 3BVMA 2QDBA 4ARCA 4I7ZC 4RHSA 4IFDI 1ZKOA 4NJCA 1FXAA 1B44D 5J39A 1A3TA 2NVTB 3PO0A 3NVVA 2WXPA 1X32A 1L0XB 2A69C 5EKKA 3QWNA 2J52A 5EPLA 4KV6A 2EE1A 1VF7A 2ON8A 4JK1C 3VYRA 1FD6A 3T4AC 1WTPA 3I57A 3TEZA 2F0WA 2K3UA 3S1MB 1C4CA 2D2CC 4MM3B 5K36G 2F0GA 3BDLA 2KVMA 3AV8A 5M5YB 2WINB 1ET6A 1BNZA 3VYTA 5IOCA 3IAYA 3W5UB 4K2KA 5TSSA 3C3LA 2XN9C 4OHJA 2WKDA 1CHPD 4WH4A 5EE9A 4YIJA 4GDLB 1WWTA 2A5HA 5NUCA 3T56B 4AS1A 4BBSB 2OXPA 1PGXA 2INNE 2F0QA 5E4XA 3AEFB 2