1JWSD

Crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDGMFNWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwsD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwsD02
3BVZA 2XNAC 3DWAA 1RD9D 1KTKA 5D3DA 1PTOH 4TSSA 3W2DA 3R2TA 1L0XB 1SBBB 1D5ZC 1JR0D 1I4HA 1LTBD 1XXGA 2ICIA 1QILA 1YN5A 1V1PB 1BCPB 1HA5A 4RH6A 5ELFA 1PRTF 1LTID 4RGMA 1I4RA 1MD2D 5FKAC 1D5XC 1FD7D 5ELDA 1GOZA 1YN4A 1CK1A 1EU3A 1B44D 1I4XA 1SJHD 1G8ZD 1LTGD 3URYA 1XTCD 1LT4D 1M4VA 1S5DD 4RHRA 1LT3D 1KLUD 1F77A 4BWGB 1CT1D 1JQYD 2CHBD 4ZYSA 1HTLD 1EWCA 1EFID 2AQ3B 1S5BD 2RDHA 2WV6D 1FNWA 2AQ1B 1LT5D 3BZDB 1HXYD 1PTOF 3V05A 1I4PA 1JWMD 4DXGA 3MC0B 4O1NA 1I4QA 1SE2A 3TSSA 3R8BA 1PZID 3EFXD 1TS4A 1S5FD 4L63B 1DYQA 1RCVD 3DWPA 1RF2D 1PRTB 1T5XD 3GP7A 2SEBD 1STEA 1BCPC 1D6EC 4OHJA 1PZKD 1V1PA 1ET6A 1RDPD 1ENFA 2TSSA 5D3IB 4RCOA 1TY2A 2R61A 2AQ2B 1EU4A 4RGOS 1LT6D 1PRTD 1BCPF 2IJ0A 1UNSA 3MFGA 1KLGD 1CHPD 1B1ZA 1DJRD 5ELCA 3DWQA 2IPKD 1TS5A 1EEID 1ET9A 3KLSX 1CQVA 3CHBD 1PTOB 1CHQD 1YN3A 1S5ED 4DXFA 1AN8A 1ESFA 2G9HD 3EA6A 2NTTA 4NZLB 2QILA 1S5CD 3BYYB 3BVGA 1PTOD 4C56C 2RDGA 1I4GA 1D5MC 4RHSA 1AW7A 4RGTA 1LTAD 1UUPA 2QEJC 3OWEB 1FNUA 2XN9C 2O2LD 1LO5D 1PRTC 1V1OA 1SJED 1L0YB 2J4XA 4K6LA 4L6TB 1JWSD 1JCKB 5TSSA 1TS3A 5ELBA 1BXTA 1SE4A 1HQRD 1SE3A 1PYWD 5FK9C 4RFBA 1FNVA 5I4DA 3O13A 1SXTA 5ELEA 2XRQD 1TY0A 1FGBD 1TS2A 3BVMA 1BCPD 1LTSD 1PZJD 1SEBD 1EEFD 3BYTB 4UDUC 2NTSA 3SEBA 1PTOC 1JWUD 4Z9CB 2Z8LA 1LTRD 3R2IA 1LLRD 2XRSD 1LTTD 4RGNA
chains in the Genus database with same CATH superfamily
4M0WB 2EYMA 4JOIC 1CKNA 1PTOH 4MTNA 4JI4L 3LJ3A 3S1NH 1EYDA 2F0HA 2JF5A 4KV6A 3I73A 2QEXA 2AWOA 1T0QC 3VYRA 3MHSD 4MJSB 1DGSA 2DY8A 2E74C 1C4AA 5A2QL 4MT5A 3A8KE 3MHZA 2LSSA 4H0LC 3I4OA 3RYTA 3J80L 4DUZQ 2PZWA 4HJ9A 3E9HA 2PJHA 2KFKB 3K9OB 1XX8A 2B63H 3HKSA 1JJGA 4PS8A 1WIAA 3UF8A 4KN7C 1I50H 1O78A 1EM7A 2UU9L 3BZDB 2IHFA 3AU7A 1WM2A 1Y1VH 3IT6B 4AUQC 2DAFA 3N30A 3KWVA 4Q2JA 5I6YA 4IO9A 1UAPA 1I4QA 1Q46A 2K33A 1WYWB 3RN2A 4DWFA 4WJQA 1SMYD 4HIMA 1V5OA 1VF5C 5I2XA 4J8QA 5DPRA 1KAAA 1UWMA 1V81A 1A3VA 3A54A 4HROA 4OVUA 3AEDB 5M9OA 3VR8B 1U4RA 1DOXA 4PZ7A 1BNZA 4A3FB 4K81A 4B3RL 2LGSA 1STEA 2UUBQ 4NPNA 5EJWA 4L23A 2DZKA 2Q8RE 3BK1A 4ME3A 2DLBA 1ENFA 1QWYA 1AH9A 2PI2E 3H3VC 1MJCA 2AQ2B 3AEGB 2QDLA 4C3JH 3V96A 4I7ZC 3HOVH 3ABVB 3H91A 3QOLA 3NK9A 1B1ZA 1HCZA 1SR3A 1YJWA 1GJXA 2X38A 1PH7A 4KDIC 2NUCA 4B9WA 4R8NA 4QUFA 3KJOA 3BS1A 3K80C 1T5EA 2MWSB 1IL2A 4QMGA 3CCJA 1W6JA 4XZ4A 3VR2A 4IUTA 1AE2A 2C35B 3EBEA 1M8AA 4EVOA 3PQIA 2IDYA 3MHBA 1BOSA 5IO9A 4W9EA 2XGTA 5DCNA 3ZIMA 4DR1L 1EFWA 4PS3A 3GTKH 3T16A 5IP9G 4JI6L 3R93A 4A3GG 2PLPA 4HIOA 2E2JH 3UDIA 4IUVA 2B76B 3E3XA 1UBIA 1I94L 1N61A 2L5TA 2BCOA 2GBKA 5HKHA 4HPMB 2F0JA 5CMDA 4B3SL 1NTGA 3NXWA 1OFFA 3A1QB 3SXHA 4HDQA 1L0YB 3QIJA 1LGRA 3EN2A 1J7AA 4QF4A 2WDTB 2F0SA 2KQSA 1F2YA 3L3OC 4NNJB 3MXPA 5LL6X 5E4XA 2NVTH 2FNJB 2V0GA 2K5DA 1PH2A 3GS2A 5I6WA 1UH6A 5H8YE 1L5PA 4NQKE 2K5QA 1XNRQ 3BVMA 3L16A 2OQKA 2KDBA 3ZDTA 4L5QA 2M00A 2IL8A 1R4MB 1LM0A 2W82A 3SEBA 1PTOC 4GZYC 1HZAA 5JXVA 2I07B 1A0IA 2K75A 3SK4A 2WINB 5IODA 1OGWA 4LF7Q 1TIFA 1XCQL 1ZDXA 1ZDVA 3EFUA 3P63A 1E1OA 3DWAA 4DK1A 4EQNA 1KTKA 2SOBA 3AI5A 3VFKA 1PXUA 2Q2HA 2R7ZH 1HNWL 5IYCG 5K36G 1R4NI 2B39A 1IZ6A 4FN2A 4C2MB 3K7AH 1SLJA 1RRBA 1CKMA 4BY7H 3IT4B 3ULPA 3ZTCA 2BF8B 5G2NA 1EIFA 3ZRCA 2CKHB 1OXVA 4AJWA 4NB3A 1PH1A 3KDFB 3GTOH 1WX7A 5KEEA 4A3JB 3PIOA 3FPUB 4MGYE 1KDAA 1I4XA 3K59A 1Y1WH 2KECA 4KJOA 1JRUA 3DDCB 1LTGD 2PPHA 1XTCD 4E71A 3CKIB 2MEKA 5LMUQ 2K6DB 3CPWA 2A5UA 4TUUA 2RA4A 4IW0A 2LRUA 4AOFA 2K1BA 3D4WA 1S72A 2N49A 3KJPA 3E56A 4JI7L 2UXDL 3V61A 5BR8Q 4W9JA 1T3QA 2E2IH 1JWMD 4OXPA 2IGGA 2N88A 1TKEA 4N8X1 1SNQA 1RODA 3MC0B 3PVLA 3GTQB 4JPBW 4JBMA 1A3TA 2ENBA 3TSSA 2O6VA 4WURA 4WJWA 1M1KC 1CA6A 4NAWB 3CWIA 2UUCL 3AE5B 1NVID 1FFUA 3GTGB 5L95C 3B2GA 4EZKA 4DA2A 3MA2B 3RCZA 1C77A 4DV3Q 1RM6C 1AE3A 5FOBB 1Q8KA 3PMFA 1V1PA 1QNKA 5D65A 1GXDC 2L3ZA 3HEJA 4LF8Q 2JE6I 1QOGA 4BBNF 4RM9A 3TL5A 1GUTA 4A3MH 1TR5A 1ZGUB 2WXQA 3IBEA 3QC8B 3GE3C 1EIHA 4ZRQA 5MPOA 2WXKA 2K1FA 4BY1G 3CSFA 1QUQA 3NJTA 2RBMA 4CBVA 3H1UA 4A3FG 1FJGL 4OX9Q 2KAJA 2SNMA 1AN8A 4QL5A 4IUUA 4XQNA 4BBSB 1MPEA 5AZGA 2JYOA 4IFDG 3VUYA 4JBJA 1Y8RC 1KAWA 1PTOD 1T9HA 2K14A 2SNSA 5M3FB 4A3BB 3E5SA 3DVNV 3NQIA 2B29A 1P9DU 1SIJA 4RHSA 3CCUA 1ZEQX 3PRMB 4FO2A 3BIID 4REZA 4XQJA 3HOUG 1PRTC 4X65Q 1F1HA 5EE1A 4C00A 5GAEC 5LLIA 4H02A 2UXBQ 1HZ6A 1F2LA 1W2BA 3A55A 1SE3A 4RKLA 5C4JB 3JAME 1JALA 1QZHA 3W3AA 1N6ZA 2GMIC 1SDFA 2ZTCA 5GROA 1EQRA 1F2ZA 1B7YB 1K3BC 4KY5A 4KI0A 3T1HQ 2HD5B 1KOTA 2ICEC 1WR6E 4MELA 1KQSA 4XX5A 4BBRB 4LFAQ 2UU7A 1CZGA 4J6HA 1HZBA 1NSNS 4LWCA 1K8MA 3Q8CA 3UGBB 1C4QA 2X6LA 3U4VA 4C1NK 4CHTB 3S14H 4ULLA 2JT4B 2KHSA 2KCNA 4XE0A 1WTHA 2MBEA 3G6JB 4GMVA 4PS7A 1I42A 1QILA 2K5NA 3APCA 4AQYL 3IXSA 3O65B 2ZCBA 4IDIA 4K3CA 1K0RA 4C3IG 3KLSA 1TTNA 2NBUA 3PZ7A 1BQQT 3EUB2 4A93H 2F0KA 4E6IA 4A3EB 5BN5A 3DBRI 1SB3C 1KXLA 1O80A 1PYBA 5FJ8H 5G5HA 4ZYSA 5JAVA 3DBSA 2DJFC 3I5JC 2B2UC 1T0SC 2F52A 5FO8B 1EO6A 4DV0Q 4GU2A 3D4DA 1WRDB 5IYBH 4JVZA 4BVUC 3HOYH 2HE7A 1KNEA 2DYOA 4DKAC 5DPTA 4A3JG 3GTJH 2FCQA 3T1YQ 3ITPA 2KNBA 1HR0L 1FO4A 3S16B 1YIJA 2I0QA 1ILQA 4YIJA 3I70A 2M0AA 1IBXA 1YD8U 2RSUA 1QVFA 3UI2A 2PYKA 1RCVD 1SYGA 1XMQL 3SVMA 1SNOA 3OLMD 3B9JA 2GBJA 3QJZA 3GP7A 2JXTA 2SEBD 4H13C 2C7HA 1OTCA 4L2YA 4Q0FA 1NI2A 2XTIA 2HQEA 3NVWA 4P74A 1ROEA 4RGOS 1YMHE 1EIYB 3B2FA 1PRTD 4OIJA 1N5WA 2FE8A 4NPSA 1Q81C 2B2WA 3CSTA 3KF8A 3CCMA 2D5GA 2RCFA 1V49A 1CQVA 1ZKHA 3CMMB 5JHAA 1ASYA 2O4XA 1ICFB 4A3IH 3QHTA 3ZXVA 1CZPA 4KGSA 4L5SA 4M8AA 2JA8H 2BDNA 3DBHI 3S1QB 1TWGB 3HKZE 1OQRA 2JA6H 1S1QB 3PGEA 1NAPA 4FXDA 2BQQA 3SGIA 1STBA 1KHIA 2Z59B 3AE1B 1HHVA 3I55A 2QGQA 2N78A 3ECIA 4HIKA 3WCQA 1EOVA 1VQBA 4JI2Q 3QWZB 5AEKB 5CORA 2ZJPA 1H9SB 2AKWB 2L9HA 3U2SC 2PNHA 3RNUA 2JSVX 4EOYA 4AP4C 5DM73 3P20A 1VQNA 1FPYA 2BKFA 1RFKA 5CYUA 1Y14B 5C4HA 2FUG1 3I57A 4R8IA 1AZPA 2C9OA 1WZ3A 3S15H 2ASQA 5D7GA 3TBLD 1UEAB 5ELNA 4LF4L 1V86A 2D10A 2N1VA 2I1JA 2N9XA 2GN5A 2XVSA 1WXQA 3K9PB 1TS2A 2F3IA 1SSNA 1XMOQ 1K53A 4LJPB 2AL6A 1K52A 1Q1BA 2KBNA 1VQJA 2WB1G 3PUWA 4GDLA 2EELA 2ZEQA 4H44C 4X3KA 1LTTD 2KCCA 2CW0C 3BVZA 4GN5A 1H9KA 3D31A 3OIPA 1VQDA 4JG2A 1FMAD 2L83A 2KTFA 2IBIB 1G6JA 2V1CC 4QIWE 1TGZB 2F4VQ 3M4QA 3OWFA 1E3PA 1UEBA 1MG8A 1MHWC 3I4NG 2ACZB 3AE3B 5CHWA 1QVGA 3DVGX 4PQXA 5GAHC 3W1YA 2BDOA 2EYHA 1N33L 5FKAC 2LGDA 4KSKC 5J18A 4V0BA 4HRSA 3I91A 2E2HB 4B9KA 5FLXc 1XLPA 2DZMA 4TKNA 5NUCA 3F2DA 5EKLA 3URYA 1HZ9A 2J42A 3JYUA 2FJ2A 1NMGA 4RWSC 2L7RA 4UP8A 4IWOA 4F7ZA 1RHPA 4BWGB 3W1GA 2EKIA 1H8CA 4DR7Q 3C2PA 3HOWG 4J1MA 2NVQH 3ZNID 2EZVA 2H5XA 2BWES 1VDVA 5AFWA 3SR1A 3NWSA 3TP7A 2KT7A 3C46A 3ZQ4A 4JI4Q 1EWYC 1GUAB 3RZDB 2XEWA 3X0WA 3CQZH 2JN4A 3DUZA 3PIO3 2WU5B 2VH1A 3DHGC 3T56B 5LMNQ 3KF6B 3S2DB 2JWUA 4M0WA 3VA7A 2PIAA 4GOPC 2E3TA 1RF2D 2E5LL 3NHEB 3RT3B 3NWTA 5M5XH 4HPPA 5IA7A 2ZJDA 3PHWB 1A5RA 2KWUB 4JI8L 1ISNA 4PMWA 1BBWA 2B2TA 3BWUD 1EQQA 2MW5A 2R61A 1WJJA 3KBXA 4IFDJ 4FF1A 4OZAA 1WRIA 3VRBB 4KD3A 4YY3L 3MFYA 4JL9A 4WAAA 2CHXA 2Q8TA 1CA5A 2JZZA 4JWUC 2H1EA 1TS5A 1UELA 2LHEA 3HGBA 4ODGA 2V4DA 1JOKA 2UU9Q 1EF1A 3C0RB 4X64L 2R92B 2KFKA 3KUPA 1VQ8A 2G45B 1G6PA 1MVKA 2K25A 2KFJA 2OJWA 4FJYA 2N8NA 2R7DA 5M3MG 2A69C 1YN3A 3A4RA 3HK0A 2OHFA 1IYVA 1XEEA 2PQAB 3A7AB 3J80E 3PUXA 4TKOB 1AEXA 1OXTA 2FINB 3S9WA 5IP9H 2EY1A 4A3GH 1P0RA 2ZTEA 5KRUA 4HPLB 2MJDA 2VW9A 2MP2B 1GB1A 5ISRA 1FCCC 4ZRZA 4JCVE 2JVCA 2VUMG 2QHOA 2K0PA 4A75A 4B3RQ 3RZOB 1ENCA 1SMXA 2L4NA 2LVPA 1EY7A 3BDLA 1VJKA 1GB4A 2E8GA 2ZPYA 2KJXA 3Q0AA 5T8IA 1SJED 4GOPB 1YNJC 1CTMA 2EXZA 4ZQ3A 4YWLA 1S3SG 2O6VD 2WXMA 1CM9A 4W9KA 3AEAB 4NJCA 1R9TB 1BXTA 1GVPA 1WCMB 3BY4B 4FJVB 1YIWA 5I4DA 2PMZE 3W5UB 2ZVOA 4C3HB 1PDQA 1EWIA 3P1HA 5DM63 1VQMA 5H1SE 3X23A 3F2BA 4MHEA 2WXPA 2KHJA 2ATWA 4NP5A 3RLFA 5C44B 4C4VB 2LWPA 4DR1Q 3Q22A 1X54A 3PREA 2F0WA 4DAYA 1G91A 4GOCA 4JI6Q 3MEFA 5C3EB 5IKCM 2KANA 1WJ4A 3BINA 2ZNVC 2C7NB 5IYCH 5K36H 1EL0A 4POGA 4B3SQ 2NBFA 4KX6B 1XXGA 4KKTA 2JA5B 3G7LA 5M5YH 3FKIB 4CJ2C 5C5LA 1HA5A 2B2VC 5IP7G 4JBKA 4JI5L 2KOLA 2A73B 3FILB 3RNGC 2PQEA 4DV7L 1E7UA 3A1QA 1L1OB 2YEPF 1FCLA 3ETRA 1ZOYB 2FAZA 1LT4D 2EXDA 1XPRA 5J2RA 4FULA 4BBNC 4IJLA 4W9FA 3NOBA 2K5VA 3NBHB 5IGDA 4X62L 2HT1A 3VVWB 4YT0B 2HDLA 1M90C 1X55A 4KV2A 4HLEA 4WFN3 1K50A 2REXA 5KYIA 2G3QB 5T1IA 2YLMA 1D2BA 2F0MA 1G2TA 2KX0A 4J3OD 2Q2TA 3W1SA 1A3UA 3E9IA 4BFRA 4LJZC 1UWXA 3KUDB 4NJ7A 4P1CC 3R7RA 1IUEA 1NEKB 4YCWA 1HNWQ 1ILPA 5GXGB 3I4LA 5DLQE 4K7WA 2AHOB 4B9XA 5T1GA 2UYZB 4AJYB 3PRZA 5C23A 1YJNA 4RF0A 3HM3A 2FBWB 1WTPA 3Q69A 5C0XG 3PF5A 1EYCA 2NBWB 1T5XD 1EUVB 5LXIB 1BCPC 1YJIA 3CPFA 2WXRA 3ZUNA 1O7IA 2WDVB 5CTRC 4R4IA 1WXVA 5D3IB 3GTLH 2QIEB 1C9OA 1GUNA 1TWFB 3UQAA 3KDFA 1LT6D 5BN3A 4KZCA 3B6YA 1YNJD 5J3BA 4ANVA 3J81L 3TDQA 3QR8A 4HJ7A 4IFDI 2JK8A 1JE5A 4JW0A 1UF0A 1EEID 4JI7Q 2UXDQ 3NG0A 4F1SA 5IGBA 5C4XG 4BY1H 2Y5CA 3PUZA 1NBWA 1I6HH 3H0GG 3M3YH 2JP1A 1IBKL 1N60A 4JWSC 1C3TA 4NY0A 1LACA 5IT9L 1YEZA 4LFCL 3MEHA 4IFDH 3DVNU 3L4PA 5C6AA 2CU1A 1QG7A 4PNYA 3N1XC 3V2TA 4DV5L 2UUCQ 4R4QA 1WJUA 2KEEA 3LWUA 2RDGA 1VQ9A 4ZRJA 3VH3B 2GRIA 3SHLA 1O7ZA 3OWEB 3HOUH 1C79A 4NAWA 4G50A 4HCNB 2LVQA 3FEWX 3L9AX 1H4RA 4AWJA 4PMCA 3HOXB 4A3LG 3PTFC 3H6MA 3TEYA 1D4BA 4ZLTF 2MJ8A 3HHMA 2EIFA 2G5DA 1FNVA 1SXTA 2X6GA 1J5EL 1JROA 1QOAA 4IURA 2FMCA 1SMYC 2D0OA 4BA1I 2JEAI 1FJGQ 2LXCA 4FA6A 1EQTA 4XT1B 2NPTB 2INPE 3TUOA 4ILWA 4G7OC 4GLAC 3AB5A 2KLCA 4DR3L 4IM0A 1K9MC 2Y0SB 1PLFA 3SFDB 3R2IA 3J80c 2PZUA 5JJLA 2JA7G 5BMHA 1SN8A 3C8YA 4F88A 1IYJB 1L0VB 1R4MI 1FGUA 3SU8X 4G4KA 3B08A 3IRBA 4IUNA 2VB2X 1I4HA 2CKZB 2ZXRA 3DLLA 4B08A 4IOAA 1L4ZB 3NTKA 4F8CB 4C3IH 5CV5A 3K57A 1I4RA 1IL8A 1UD7A 3ZGZA 3OAWA 1YJJA 1PYSB 4HSPA 2KZRA 4WWMA 2L0FA 3CP0A 2IO1B 4HKQA 1S5DD 2H89B 3D3RA 3QCAA 3K5MA 2F03A 4CDFC 2K28A 2FUHB 1HNZL 1E8XA 2VY3A 2ZJQA 2RDHA 2Z6BA 2KACA 1UE5A 4EQ5A 1EYGA 3CCLA 4YL8A 3GZNI 2XBBC 1QT9A 3BDOA 4P2CB 2WGSA 4EKUA 3P75A 2HJ8A 2KKCA 3LNNA 2MJ3A 4ID6A 2DGYA 1HUMA 1H9JA 1ZXHA 2ZW1A 4B0EA 2RGFA 1H95A 4RCNA 3TN2A 1Q12A 4KKSA 4L63B 4DNIA 4DUYQ 4AQYQ 1C8CA 2C5LC 2UUAL 1YI2A 1QF6A 5F2DA 2JX5A 2TMPA 1N34L 3M85A 3LXFA 1A63A 3MAQA 1VQ6A 3S2HB 3N3KB 1RYJA 2VQEL 2H4OA 1YNND 2HTHA 4HJ5A 1XLOA 3RD4A 2RCNA 4AYBG 2F0UA 2E6XA 2KUMA 3U30A 1Q8IA 2F0VA 3FVQA 2K03A 4U68A 1VQOA 3GTPB 1FEHA 3TCAA 3VRAB 4ME5A 1W6KA 3VDYA 4N8FA 4WJOA 3M4PA 2FCMA 3R66C 1NE3A 4CDEC 1Q0WB 1YQBA 4YSZB 4ZHPA 1SFOH 4LLGM 2L11A 1CHQD 1DONA 2I5MX 3C1FA 3APDA 4DXFA 1I35A 4II3B 4MM3B 1E6EB 2KD0A 5BYSA 3AU4A 2NTTA 1HR0Q 3L10B 3B0AA 1X3GA 4A3DB 1NI3A 2LZ6A 3J81j 1WF9A 1YX6B 3L0WB 3MP9A 3RNCC 4YWKA 1WE7A 1XMQQ 3TMPB 1NBFC 1IKMA 5HGQA 1VCIA 1P3QU 2F0LA 4A4IA 3ZLZA 3NVYA 4DV4L 2AMCB 1ZUD2 3HOZG 4NXML 1SNMA 1V9PA 2CQOA 1LQBA 4L6TB 4XYOA 1A2UA 3DOWA 2C60A 4M00A 2D3CA 4L8JA 3CCRA 2RHQB 2D0PA 3EROA 2PCFB 4DAVA 2NZHA 4LW1A 1PYWD 5KYLA 2FHTA 1X32A 4A3CG 2VQFL 1LXDA 3QX1A 4DK6C 3UE1A 1VQ5A 1WM3A 1X1MA 4A6QA 1PZJD 2PW5A 1N36Q 2R93B 1JMLA 3C19A 2WXNA 4HWIB 1YJ1A 2CH4W 3OW7A 3Q2AC 3RN5A 1QNUA 2ZVNA 3BZCA 1EY4A 1EY9A 3A8JE 4Y52H 2WNMA 4BKGA 4ZDVA 4A3KG 3R2TA 1L0XB 2OQ0A 2JSOA 4UHVA 4WIPA 1GJZA 4XDXA 3I4NH 5D94A 3SHQA 2R3ZA 1YN5A 1PH6A 3G6EA 3FRPB 4QJFA 3GV6A 3PV1A 1UWVA 3RNFC 2BKRB 1MD2D 4KDLB 3K0YA 2BYFA 1J8CA 1H9SA 1PGXA 1GUSA 3I3CA 4EE2A 2ZXOA 4BOSC 3A5UA 3A0JA 3KFUA 2HCCA 2ZJRA 1GG3A 3KYCD 5D6JB 1MKHA 4K0KL 1MHXA 3ZRFA 3DM1A 1OXSC 3QAQA 3U52E 2K7VA 1RAXA 2J7QB 2A74C 4AQ7A 2Z0SA 4ZUIA 3R3OA 4EQPA 2YU9B 3HOWH 2CJNA 4IOIE 2RQXA 1A8VA 2Y0SE 1LT5D 2F0NA 2WAQG 3A56A 1TVXA 4KMUC 4DU9A 3SK5A 2JZPA 3VYTA 1ENAA 1E8YA 1E2WA 5IP4D 1B3AA 1TKGA 2J7ZA 2BTEA 3NVVA 1CMXB 5AJ3L 1WX8A 2MA9B 3DEPA 3R8BA 3P42A 4OIKA 3S1RH 4RMFA 4L1BA 5IWAL 2L8JA 4MGKE 1N33Q 2WP9B 5EBCA 3G48A 4JBWA 4LFBL 3NZ3A 2WX0A 5E3FA 4DAPA 1UE7A 3U9SA 2L1AA 1DOKA 4AS1A 1RTOA 5KHQA 4NW2A 2NZOA 3WWVA 1TY2A 3NHHA 2JJQA 4FJZA 4HR7B 1VQLA 4R4TA 4HIDA 2KCMA 1MGSA 3PUYA 3TS2A 4BKSD 1CZWA 3GB1A 4OEMB 4IUQA 3LDZE 2JWZA 2CFMA 5M3MH 2K05A 1DOLA 3CF5A 1CJEA 1PTOB 3P4SB 4KKJA 2B2YC 3HKZB 5IGEA 3S1NB 4KHPL 1J7CA 4GIVA 3UIOB 2G1EA 2K8CA 4KGTA 3K7UC 1J19A 1P16A 4PYUA 1JJCB 2BH2A 3KWLA 2KDIA 4LF5L 3UINB 4DHJD 2K5WA 3NY5A 1ZPSA 2QKIC 1HR0W 2VUMH 1WXMA 2E5LQ 2IY1B 5KHOA 4XGAB 4J6IA 4Y7NH 5BO4B 3QO2A 1LTAD 4JI3L 4JI8Q 2L12A 1PHJA 4TMAB 2WXLA 3KF6A 1U4LA 2A6ED 3VTVA 1BMLC 4I6LB 1XPUA 2B63B 5C3WA 2GOWA 2DX5B 2LGXA 2J52A 1SYDA 3A9KB 1GO3E 1I50B 1DOYA 1HQRD 4A3DG 1Y1VB 2LUMA 2WHIA 2NVYH 4X64Q 1WI5A 4GNXC 3QOJA 1MSGA 2CHWA 2ZZPB 1GPXA 2YTYA 5CV9A 1L4DB 4HJAA 1C0AA 2OF1A 3V6CB 4HEA1 2VXWA 3ONSA 2NTSA 3PIPA 1JWUD 4IPCA 3ZVVA 4I65A 2SDFA 1BVSA 2CJOA 1ASZA 4FDBA 4NXNL 4QIWB 4LNKA 4JI1Q 2PQAA 1RD9D 2LD9A 3FAHA 1EY6A 1IBLL 3ZNHB 3X3NA 5JJIA 3CF6E 2D5DA 4X66L 1J0GA 4K3BA 1ZW7A 3TMEA 2N9EB 4S3SA 2MP2A 4C3JB 5IP7H 2WQYB 3QQ8B 4ANXA 1GUGA 4IWPA 1V97A 3HOVB 4WAFA 2VZKB 2J0JA 5C4ZA 4RH6A 1WFYA 5ELFA 4R4OA 3RUIB 2KENA 4DFAA 4G7ZC 1HZCA 3AMUA 1XWEA 2EY2A 4M8MA 4YWMA 1OQQA 3ER0A 2GBMA 1B53A 1TWHH 2JQOA 1NY4A 3AYHB 3PO2H 2WXJA 3UI3A 1SJHD 2IHEA 3AQQA 2DNEA 4QQBX 3PO3H 3VTUA 1ICWA 1VDZA 4W9IA 3VHTC 2BT6A 1WWTA 4H7BA 2KJHB 1HTLD 3NP8A 3V6EB 4JI0L 2HD3A 2DYBA 3GTKB 5KGUA 4UAIA 3AB9A 3RZFA 2CS4A 2EE1A 2PEAA 3TEWA 1MBYA 3K58A 2E2JB 2KHWB 3OYYA 1EY8A 1Q1EA 1U4PA 4OL7A 3NEMA 5C0XI 2BVCA 5A35A 1AFPA 1JC7A 4C4VA 1HTOA 1GUOA 5IY0A 1N5XA 4LUOA 1X6OA 1G51A 3A9JA 1X3QA 5IE8A 1SYEA 4M8NA 5C1ZA 3F2UA 4ZK9B 4DBGA 4DDID 2I5LX 5G3LF 3PT2B 2RD0A 1HQMC 1PRTB 2NVTB 3S1MH 2KDMA 4LJOB 1HA6A 4DV7Q 5TR5A 2JY6A 4ALPA 2LGIA 2NB0A 4EZLA 3L13A 3Q8EA 4XXEA 3NS8A 2NN6G 1ZXTA 2JQRB 1B9RA 1SYBA 4YCUA 1KD1C 1V2YA 2LFIA 3DBLB 3FILA 4X62Q 1IYUA 5ELCA 2AL3A 1C4PA 1DJRD 1L1OA 3FMCA 3ML9A 3J80i 5C4XH 1B8AA 3H0GH 3BK2A 1CSQA 4H2AA 2R7ZB 2MX2A 3NBHA 1U9RA 1WXAA 2MCNB 2KCTA 1II3A 1MSHA 3K7AB 3NQTA 2LI5A 4BY7B 2DJGC 2AWNA 4BXXG 2UWQA 3Q8FA 3ND8A 2JRIB 3RNAC 2L0CA 2WP8J 5I9PA 3T51B 2HDEA 2BPSA 4K14A 4C56C 3GTOB 1F2RI 1SAPA 1VQAA 1R4NB 3AEBB 3QWNA 1AW7A 2AUJD 4LK1C 3L0OA 1Y1WB 4N6EB 1UUPA 4MEMA 1YZ6A 4G3XB 1N32Q 1CSPA 4A3LH 4LNFA 3IFTA 2L0TA 3M4OH 2B8GA 1K83H 3OIQA 1LTLA 5KNBA 2IO2B 2MLBA 3L54A 4WQMA 1BO0A 4KK7A 1I7HA 2PI2A 1C48A 3ULLA 2BYTA 1P98A 1TS3A 1V8CA 2PMZB 4RAUC 5ELBA 2I5HA 1WR1A 4LF9L 4G0NB 3I56A 3SD5A 4CHKA 2E2IB 1C76A 2KWVB 2RHSB 1ONLA 3GQBA 3I8ZA 3IG3A 2UUBL 2EJFC 1IBKQ 5C2TB 1E0ZA 1YITA 2JEBI 4KY7A 3RZWC 2K22A 4LFCQ 3U7DA 1EEFD 4UDUC 1WXSA 1V1QA 4ICUA 5FO7B 4DV5Q 1HNXL 4YTNB 1ESRA 2B63G 1WX9A 3CAMA 2IX0A 5COYA 3K6OA 3N1YC 2ZXPA 1JWBD 1PFNA 1Z9FA 3J81E 2I2YA 1PFSA 4KY6A 3CD6A 5D2MB 1R4PB 2ICIA 2VRRB 4BBSG 3I4MH 1KF6B 2JYEA 4OVZA 4FF4A 2OEOA 1DOIA 5IT9E 3VTWA 1D5XC 2QSDA 5CV7A 1EYAA 3GDEA 4PYZA 4A3MB 2Z9HA 5M3FG 4A3BG 2EMTA 1F9RA 4RG1A 2PMVA 1G8ZD 4DR6L 1J5EQ 1SNDA 1NDDA 1LT3D 1SE8A 3T13A 4DK0A 1TWAH 1KJTA 1E0BA 4FNFA 4N59A 3HM6X 4DR3Q 3P7JA 3S17H 5BN4A 3HOVG 1K0SA 2F0PA 2UXCQ 1PH4A 1PFDA 2NPTA 1BUVT 2OWOA 4KTAA 4K1RB 5ELOA 1STHA 1STGA 1R7SA 1SGHA 3MC8A 4MSQB 1HH2P 1WYGA 4BBRG 4BOZB 4PV1C 3E6ZX 2Z6KA 3X3MA 3HP3A 2BS2B 1JMCA 2N55A 2PNRC 2K4KA 4B95A 5FR3A 5HFYA 1Q5WB 3D8GA 3M9BA 4KKUA 1E22A 3JAMc 4TQ1A 1NR4A 2EPBA 4J15A 3EIVA 4RKBA 3U58A 1MIUA 5L83A 1JWAD 2IJ0A 2BWFA 1HNZQ 1OEYA 2Z4IA 3GTMH 3MFGA 1SROA 2FCSA 3PSIA 2WB1E 3RFZB 1S40A 1G2SA 3GO5A 4GN3B 2XWJB 2WDQB 3TEHB 1VQCA 1KIXA 2C9WB 3S14B 1KLVA 4EX5A 3NTHA 1AYFA 1IW7D 5JPMC 1D7QA 3P4QB 2EYJA 4JQWC 2MQHA 3WA0A 2BB5A 4P75A 4A3EG 2G9HD 2KC1A 2QILA 1F9SA 3G4SA 2GLSA 3Q3MC 3M3JA 4GXBA 3WDNA 2VNUD 3L17A 4C1NI 2UUAQ 2O6VB 1QVCA 4WJNA 2PPBC 2G4SA 1D5MC 1F2RC 3U4EG 3RUZA 4RGTA 3TP6A 1Q7YC 1N34Q 3HOZH 2WYQA 1VQPA 2A8VA 4A93B 5C5MA 4MJSA 4XC2A 1HTPA 1W3SA 5CC4A 4DHZE 3F8TA 4GLSC 2O2LD 1LO5D 1TWCH 2VQEQ 2J4XA 5IIFA 3J9CA 4IOCA 4JIOU 3E9SA 4KHZA 4OZBA 4FHKA 5JOBA 4KSLC 1K3RA 3ML8A 1BKBA 1SE4A 1CQFA 1PH5A 4IUMB 3OG5A 3DBRB 3RD2A 4M1UB 4JX1C 1I5FA 1I3QH 3HOYB 3AEFB 2B3GA 2EYFA 3KVFB 2K5PA 2M4NA 1FGBD 3GTJB 3C1EA 1PMRA 1IYFA 4DR2L 1Y1WG 4QAYA 1QE6A 5M5WH 3Q3FA 3BYTB 3IFDA 4XDDA 1P1AA 3N52A 3VA5A 4HVBA 4QGUA 2WS3B 3ZKJC 3PF4A 1TT2A 2MJEA 4KZ0A 4LNQA 4XT3B 1Y8OB 2WXGA 2Z0DB 4MM3A 4HMIA 5D3DA 4ABNA 4A3KH 4DV4Q 1J8IA 2X8XX 1IBML 1X56A 2LKVA 2OTLA 4JOIA 4C7YA 2G9DA 2MBOA 3AE6B 1SBBB 3ERQA 2FFKB 2N3SA 5IGCA 1PH3A 4YHHL 1J6QA 1AARA 1UZXB 4I7AA 1LM8B 1WTOA 5BMGA 4QCLA 3T4AC 4PT5A 2JRHA 1OQYA 2W9NA 1EWHA 4DK5A 4A3IB 2FXQA 3PIP3 3HVZA 3Q6BA 3RNBC 3AEVA 4W9GA 4RHRA 2R7FA 2Z4HA 2JA8B 2JYTA 5BMIA 2RSOA 3TZUA 4QUCA 3J7ZC 2JA6B 1N62A 3ALBA 1YHQA 4LDTB 2MBQA 3PLVA 1C7YA 1FD6A 2AQ3B 2J0MA 3ZNGC 3KH0A 4DQOC 3CCEA 4MZ9A 1YNXA 1XLNA 2LS01 1F9QA 1I94Q 4MACA 1PFBA 5CGKA 2CU3A 3DVGY 3NS1A 5DNFA 4L5TA 2FIFA 2PW7A 1VQ7A 3GE8C 2LXKA 3VDZA 1HFGA 2NBVB 4ZYNA 2NVXH 3J81c 4LF6L 1Q3LA 3UDXA 3NBIA 1NENB 3LB8C 4YXDB 1E2ZA 4OWXB 4LFAL 1E24A 1S5FD 2ZCCA 3PLUA 3I4MB 1D8LA 3N1ZC 1PH9A 3DWPA 3J7AF 1A70A 4DN4M 2XK5B 4U673 3KUCB 3U4ZA 5IT9c 2VB3X 3S15B 3HIZA 4CO7A 5CR3A 1RDPD 4ZCKA 2TSSA 4K0KQ 2MO0A 1B9NA 5KNDA 1WGYA 3VYSA 2PZTA 2K39A 1F0ZA 3I2ZA 1V6EA 2B2WC 1KM7A 3VR3A 1PH8A 2MFIA 3I7FA 4AH6A 2R2OA 3NZUA 1A15A 3VUXA 5FO9B 4TV3A 2ZM6L 1E5WA 3KUZA 1AWDA 2GBRA 1JB7A 2KK8A 1RL2A 3NRZA 1ZYRC 3HS0C 1FM0D 2L76A 4LNOA 4S0RA 5EBDA 4DV2L 4ZOHC 5AUIA 4K6DA 2M17A 3LX0A 4N9TA 5AJ3Q 3WALA 3EFCA 2KMAA 2ZNVB 2IO3B 3EA6A 1FXTB 4FHJA 1WGGA 2QDFA 1PDXA 4ANWA 5AZFA 4F87A 3IVFA 2CWAA 5IWAQ 1C78A 1SRUA 1RFAA 4QY7A 4RA8A 3PZDA 4DV0L 3U8ZA 1PQSA 3ONAB 1WSPA 3R7QA 3D6WA 2QEJC 1GHKA 1JOQA 3HFZB 3LYYA 4IWQA 1OO9B 3UQBA 2GVBA 2L55A 4X3SA 5JZEB 1WI0A 4HKZE 1STYA 2MBBB 4GSWA 3T3OA 1H9MA 4UP7A 2IO0B 4DPGA 2ASBA 3PSEB 5GQOA 5TSSA 1E9MA 2NVQB 4JPSA 3TZDA 3L08A 2OEDA 4A3FH 2KVMA 2GB1A 5CV4A 5GMVA 3B1LX 2XRQD 2VZAA 4JLCA 4KHPQ 2A1AA 5HHDG 5J17A 2L32A 1LYLA 2BW2A 2KVZA 1SEBD 3CQZB 2LRWA 4WWNA 4UPAA 1HTQA 4K7UA 4P6VF 4LF5Q 2IT1A 4LNNA 5E6OA 1J9OA 2K52A 3R3MA 4EZJA 4USAA 5M5XB 1Z7TA 2B3AA 2M0XA 1YNNC 4DV1L 1QZGA 2Q2UA 3Q23A 2R92G 3ZO5B 4JI3Q 1VQIA 4ZRKA 2OOBB 1X3PA 1JW9D 4OWWB 1XNQL 5IOIA 4FVMA 4CQNA 1BCPB 1KL9A 1E7ZA 5E6JA 1VZ6A 3OTOL 3TBIB 4FYDA 2NCNA 3H8HA 3VH4B 4RGMA 1WGHA 1TZ1A 4OONA 1UE6A 1QOBA 2F3WA 1EU3A 3EC8A 1TQOA 5HGTA 2W54A 4GDKB 3RI7C 2V4LA 3ZJTA 2N9PC 4KD4A 1T0YA 4ZUJA 3H3VI 3MTNB 1KLUD 4B3TL 3A9KA 3HVDA 1PA6A 1MG4A 3K8AA 4A3GB 1ZP0B 2BB6A 2CR5A 2IX3A 3AE4B 3WAPA 4WJ4A 3AMZA 4B3ML 2Q2IA 2RDFA 4X3UA 4TRDA 2BA1A 1CFMA 1VR9A 2KX3A 3IAS1 3H3VH 4NXNQ 3I72A 1WCMG 4QB4A 1Q90A 2EY6A 1MJEA 1HFNA 2LJ5A 1IBLQ 1X65A 4TVAB 3G71A 1ZYRD 3CC7A 4X66Q 4C3HG 3SE0A 3TEXA 4GKJL 3Q6SA 5LHY1 4GLXA 1K8RB 4RM8A 1SE9A 4LUZA 1UGMA 2NN6I 5C44G 4TQ0A 1STAA 4IPHA 4K8IA 3A33B 3FPPA 2F0GA 3AFPA 5C3EG 3KQ4A 1EQVA 2B2TC 4V190 4URKA 1FXAA 4OHJA 4GKKL 2LMCB 2KN5A 1ET6A 4WWPA 3WOEA 4C2MH 1TIID 3A74A 4IQZA 1V80A 3UIPB 2YVCA 2QF7A 2JA5G 3K5OA 2DBYA 1UNSA 1GUWA 3FKIG 1CHPD 4JI0Q 4OO1I 3AE9B 2E76C 4W9LA 2KC2A 2IW3A 2IPKD 1WE6A 4MTKA 2RF4A 2GI9A 1JQ4A 1WY8A 4A3JH 4DXAB 5EE3A 3CCQA 2Q8IB 3E0EA 1FXIA 3NPPA 4BXXH 2E2DC 1T0RC 3M95A 4FXCA 5M5YB 4NZLB 2WXOA 5EDSA 3K0XA 1Q86C 4GS3A 1WTWA 2NZ1D 4K2KA 3P4RB 3H15A 1Z47A 3VYUA 1FNUA 3IAYA 3GTQH 4WJ3M 4ZRIA 4C80A 4K6LA 2V9HA 1ZXIA 2EMSA 5G3LD 2KMCA 2N7EA 1GNUA 1MI0A 3GTGH 2PKOA 4M02A 4XWWA 4BZAA 5LMNL 3NELA 3OHXC 5EPKA 1VLBA 4ACFA 2L00B 1V5TA 2KDFB 1B70B 1S3OA 2VS1A 5ELEA 4DGZA 4DR5L 1WVLA 1XCTL 3N20C 3T9LA 3I90A 4N9F4 5G55A 5DPSA 4MSMB 1ML0D 2INNE 1D1IA 3AN1A 1LTRD 1FNWA 3OJ3A 2D2QA 1Z5SB 4K5XA 2KDEB 5EE9A 3TQYA 4FADA 2BH8A 1SIFA 1TKWB 3NSWA 1B3QA 1L0WA 4A3PA 4CGYB 3JAMi 2QCPX 2KYWA 2PW9A 2Q5WD 4LCDE 4EFOA 4DNTB 3GTLB 4BKTA 4FP5D 1TU2B 2Z1CA 1AZQA 4BBSH 2KWDA 2HHHL 4AYBE 2A68C 4DK3C 4CKBA 2LGYA 3TIXA 3UDGA 1FD7D 5FLMG 2JA9A 2F0TA 1GOZA 5M3FH 4A3BH 4MGZE 4LF9Q 3DHHC 4BY1B 2LVOA 1I6HB 5HY6A 1FRRA 3M3YB 2INDC 3PHXB 1N8RC 3VR4A 1VQHA 2L05A 2BE5D 2EOTA 4NAMA 1KNAA 2DHZA 1YX5B 3Q3JA 2K8BA 3IAM1 1IHZA 5JEAG 3HOXG 1KDCA 2HCIA 1HNXQ 1NYRA 3W1SC 1G291 2B2UA 2DUDA 3BU2A 5C4JH 3MJ5A 2WACA 2D62A 1U4MA 1I6VC 1EIGA 1C1YB 2A6EC 3V05A 2KVRA 3ZDMC 4C7ZA 1WOCA 4DAYB 1YBYA 3HOUB 1T6BX 1NR2A 4IUPA 2A4ZA 3S24A 3A4SC 1EZ8A 3D6CA 1GC7A 5JVG3 4BBRH 2ON8A 2Y5PA 4OGQC 3BJUA 5L37A 2V3SA 3J7YW 2Y0SG 3KYHC 1VQKA 2INCC 3MJWA 4RMAA 2O2VB 1HZ5A 4ZAIA 1K8GA 3H7PB 4LF4Q 3MWYW 5JVH3 1KFYB 4DR6Q 4RCOA 2MBHA 4KIKB 2BA0A 1DCZA 1IP9A 3P4PB 1GHJA 5I2YA 5C0XJ 1DM0B 4XTCS 2LASA 3AECB 4BS9A 3QARA 3UDFA 3BDCA 2WFWA 3ZW3A 5EGTA 4PMBA 4LTUA 4DHJB 3A5ZB 2WWZA 1STNA 2EDGA 3DBLI 3HRZC 3EVQA 1CKOA 1VMCA 4CDCC 1HPCA 1XD3B 4IG7B 4A3EH 1WFQA 2LJIA 3FKYA 3M7NA 2JZ3B 1Q1OA 1VZ7A 3MXUA 3RMKC 3CMEA 4JV5L 2MH7A 1PUTA 1HRJA 4C3IB 5EAYA 1WH3A 3HUIA 1YOVB 1VQEA 4HJ8A 4OVVA 4B0MA 5IN7A 4EQOA 4JK1C 2EVBA 3K5LA 2D9UA 4KKIA 4CYEA 3MXNB 3U50C 1F9JA 2DN8A 2OTJA 5E6NA 1QB5D 1VZ8A 4WQOB 1V1OA 2LXAA 2X69A 3M4YA 3EECA 4NQLB 1MHHE 3S16H 4US9A 4P16A 1GAQB 3DHIC 4RNAA 4KVGB 2GBNA 3K5NA 2K3UA 4EUTA 3Q3NC 3ICEA 2GA4B 5J1ZA 2A68D 2RR9A 2GVAA 2WAQE 2HDMA 4IALA 3QB3A 4CKCA 1JICA 1QQRA 1E8WA 2FCNA 3VXWA 1XTDA 4ZKBB 5JJKA 1E2VA 4A90A 4I6NB 1TT5B 1OXXK 1TY0A 4L5RC 4M01A 3RULA 1PGAA 4IC7B 3J81i 2KHIA 4NJ6A 2E75C 2KMMA 2M2LA 4CDDC 2KWCA 3EHVA 3WAMA 3CU7A 1WMHB 1QJOA 3GZNB 4Z9CB 3E0JA 1WD1A 2KQ7A 4ANUA 3NE5B 4RGNA 2IGHA 1XT9B 1O7YA 1F52A 4TSSA 1KDBA 1A62A 3QG1A 5CV6A 4JYAL 3AXCA 2WDRB 2I38A 1D5ZC 4YY3Q 3S1QH 1KABA 1TWGH 4PG3A 4MGIE 3AE2B 3L2PA 1SF0A 1XPOA 2ALYB 1P8LA 1WYDA 4MNOA 2EJMA 1YN4A 1RLFA 2RMMA 1JB3A 1B44D 1SFOB 2AX5A 1B4OA 1M4VA 4LNIA 3N32A 4DR2Q 2KQ3A 4HJKA 3APFA 1JQYD 2SAKA 4DV6L 5IYDG 2L1BA 2R2QA 4YSXB 1XLQA 1V8QA 2AQ1B 2MGSA 4WJPA 3FDTA 4EGVA 4WORA 3STBC 2F4IA 1I4PA 1P7FA 4K7SA 1OTRB 3RLNA 1IBMQ 2JU6X 2KTRB 2RSNA 4HDOA 1TYGB 1TS4A 1TJEA 4HN7A 2R93G 4YHHQ 1KH0A 5JH5C 1DYQA 4HTHA 4XQQA 4WWOA 4TQUS 4GOPA 3S2AA 4S17A 1N63A 2CH4A 1D6EC 4LK0M 1O7LA 2YEPB 1FL0A 1K28A 1LV9A 2DNFA 2F0FA 3T53B 2JUOA 4HXDA 5EQ0A 2WB1B 3SDZA 1BCPF 2EYPA 2BS4B 1A2TA 2D07B 1KLGD 4GNXB 3JSVB 4E3CA 1B50A 2D3AA 4DR4L 2D3BA 3V3XA 1NYQA 1ET9A 1KRHA 5FLXE 1E8ZA 2E2HH 5LNK1 4FBJB 4B6WA 2ZPNA 5LXHA 1V43A 3J7AV 1E10A 3DCGA 2MUYA 2NWGA 3I4NB 3NTIA 3TS0A 4LF6Q 1CKNB 2A5HA 5EPLA 3RMHA 4CJ0B 3ZJUA 4JI5Q 5C0XH 4XYQA 5DPWA 3SK6A 4P71A 5E6PA 4DHZB 2BS3B 2M8SA 3Q14C 3WAOA 4II2B 2QCZA 1OXUA 4ZKCB 3T8MA 2N9LA 4G7HC 3RNEC 2KQ4X 3TREA 2NMQA 3RZDH 1D1KA 4LAAA 5K5PA 1Z6HA 2XK5A 1NCVA 2XIWA 3HOWB 2OCEA 2W3SA 1JCKB 3S2DH 1FVIA 2QDBA 2G4DB 2ZTDA 4DUYL 1GM5A 2H88B 3CW2C 4OWTB 4XYCA 4ZRPA 2ZM6Q 4DUZL 4X3TA 2O5IC 2KJ6A 2KXJA 3D4RA 4MN3A 2YTVA 1V9JA 4DV2Q 4O0AA 4K5VA 4R4CA 3TRZA 4OO1G 2O5JC 3D32A 3PPAA 1LTSD 2K50A 1MI2A 1RKNA 1IGCA 2VZKD 2HUGA 1JRPA 3S1RB 4OZCA 4ZHOA 3WANA 3ZJVA 2F0IA 4FLHA 4ICVA 3U7ZA 1DD2A 5AZHA 4MIUA 1SNCA 2R92H 2NVUI 2KOXA 1KRTA 2KJRA 3MC9A 4IN3A 2IGDA 4EEWA 3STBD 4GB9A 3HKZG 2OXPA 2KO3A 1LTBD 3PV0A 2WXFA 3P2BA 5JEAJ 2F0EA 3L7ZC 4FXGC 4MH8A 4W9CA 1YVCA 3H9DA 4RF1A 1EZ6A 3DXJC 2B2VA 1B9MA 5KNCA 3MZ5A 1IW7C 5DAUA 3WIMA 5M3MB 4F8MA 2AYOB 1K8AC 3RZOH 3DWGC 3VQIA 3NENA 2VL6A 5I9OA 4HMJA 2PE6B 3PS6A 1MFWA 4IJHA 3FHWA 4IPDA 2N1WA 2CHBD 2J0TD 4DAMA 2JA7H 2QC8A 5CBAE 3BZKA 2M19A 4P72A 1CI3M 2Z0EB 2W55A 1R9TH 2VUMB 1FRDA 5EPJA 5LL6S 5HURA 1WCMH 1HXYD 2EKEC 4JE3B 4X57B 1Y1VG 4Y7NB 3I9V1 4DV1Q 3Q8BA 2HJ1A 4C3HH 2P5ZX 3W1BA 3RPFC 5JHBA 2OT2A 3AU5A 3NVZA 1XNQQ 2ONQA 2WKDA 1CUKA 1N36L 1BT0A 3K81C 5AUKA 5C44H 2WXHA 3OTOQ 2D11A 5C3EH 1OEYJ 5CHVC 1WZ0A 1LUZA 3OMGA 2NVYB 3IHPC 2CVRA 4XDCA 3CRLC 2HQLA 3PCOB 1HUNA 1VRAB 3PRPB 2LY7A 2JXMB 4FF2A 2XSCA 1EU4A 2FMMA 2JA5H 4B3TQ 1HE8A 3FKIH 2PE9A 3CCVA 2I1KA 4C3JG 3HRDD 5KIXA 2QJLA 2KN4A 3DWQA 3MVVA 1WTRA 3KLSX 5CBEE 1N9WA 1YHBA 4B3MQ 4GDKA 1L6VA 3CHBD 2DAJA 1U4AA 3CMAA 3T3NA 1WTVA 1XNRL 4ASWC 2JXXA 4HAEA 2ZW0A 5EKIA 4POFA 4UY8C 4GKJQ 3LWEA 5J22A 1UBQA 4OW0A 5G5GA 4LF7L 1X3FA 2K01A 1AP0A 3I63C 4N58A 1Q10A 1FYCA 4K2LA 1I4GA 2QMTA 4HK2A 2FIDA 3M63B 4WH4A 4NDXA 1TWHB 3KLWA 3PO2B 1QKZA 1A6XA 2IX1A 4GKKQ 3A7LA 5H92C 3PO3B 2A19A 2I46A 3AFQA 1WGRA 4O2DA 1FR3A 2A6HC 3DQVA 2DY7A 4PK1A 3NUCA 1DOMA 1JWSD 2B8FA 1BF4A 4X6AH 3GOEA 2QA4A 2PVOD 3EQLC 2LMCA 1ZE3D 1VS0A 2HIVA 1D3ZA 3PGZA 3C3LA 3FC4A 4IM3A 2J53A 2BYVE 3O13A 2MNAA 3KW5B 3VR6A 2WKCA 1VCBA 1WTXA 1C9FA 3ZJYC 3H6NA 5E4WC 5LMUL 2NR2A 1BBUA 1TWFH 1QOHA 2Y3AA 4FXKC 1TXYA 2KEDA 5J39A 3RLOA 2Z8LA 3VUWA 3OW2A 1LLRD 5BR8L 3Q24A 2AWTA 3S1MB 1YJ9A 2N4FA 4KN4C 1L7YA 3CC2A 4HCEA 3HG9A 1MJDA 4A20A 5IOCA 4IKGA 4BA2I 2ES2A 3F1ZA 2R7ZG 2PVGC 2VH2A 3AM9A 2IY5B 4BY7G 4F7XA 1V1PB 4A3CH 1XYIA 3GD7A 5FLMH 1LTID 4R1JA 4A8XC 2EY5A 3TP8A 1K51A 3TJPA 5C4XB 2K04A 2MPMA 4DV3L 3H0GB 4UP9A 1HEZE 2MQJA 2LFNA 2ZT9C 2MP1A 4GN4B 3P1MA 2HIXA 5FR6A 2IWHA 2K6AA 5EKKA 4IZ8A 4W9HA 2L15A 4DR5Q 5HI1A 1YQ3B 4GGQA 1F77A 2IYDB 1QUQB 1CT1D 2RVLA 4LF8L 5JEAH 3HOXH 2JPHA 1EWCA 2V1YA 2W3RA 1X9NA 1S5BD 1WGDA 1BDOA 2EQSA 1TBEA 4XWTA 1Y56A 1JE4A 3CXCA 1TZOA 2HTME 4LMQD 5HG2A 3V60A 1PTOF 2J0KA 2BGFA 3J7A5 3N9YC 1QCBD 4NXMQ 3AE8B 4P7IA 4OX9L 3OSOA 5A2QE 4D2KA 5FLXL 3JW0X 1WGKA 1PZID 2L52A 3EFXD 3M4OB 3RN9C 1K83B 3JAML 2BYEA 1SNPA 3MTSA 4JC0A 2HHHQ 4YSYB 4LUVA 1SYFA 2F0OA 4PZ8A 4HCPB 3IKJA 1KC8C 4IM2A 2WX1A 4FF3A 4BAXA 5IGGA 2VQFQ 4CJ1B 4HCSA 3OMCA 3U9OA 3AULA 4APVA 4JI1L 3KBGA 1PZKD 1VQ4A 2CW0D 3WOFA 3GV3A 4X65L 2DYMA 2F0DA 2R6GA 1S4ZA 3RR5A 1C4CA 2A6HD 1L1OC 1GD7A 4K8JA 2UXBL 1Y8NB 1RWSA 2LUEA 4JGHB 2JA7B 2EYLA 4G57A 1NNXA 1L6UA 2KLGA 1SSOA 3DBHB 4WRDA 2EYOA 2OJRA 3FP9A 2N7JA 1K8OA 3ZNZB 3T1HL 4A3MG 3DM3A 1FIQA 3H09A 3SDLC 2AEHA 1SYCA 2MSED 1ESFA 3ULJA 2CHZA 3PO0A 2NYZD 2MRPA 4YCVA 1IKLA 5GADC 3QA8A 2NS5A 4E74A 1XF5L 3BVGA 4P73A 4YTPB 3NZSA 4ARCA 1IPGA 2BBCA 4R9WA 3CCSA 3A9JB 1E90A 1F9PA 3OOCA 1WD0A 2DZIA 1EOTA 4A55A 1L2NA 3JC66 4KGRA 1TKYA 3MXGA 2YYZA 3SFEB 1TWAB 1BR9A 3W5OA 1YHAA 2O2VA 2WXIA 4IPGA 3H7PA 1IGDA 1L2FA 3AEEB 5E7NA 4DNRB 4BKSA 2MHVA 3S17B 5FK9C 3SK8A 1BUIC 2K8HA 1NUCA 2MO1A 4KIKA 4RFBA 2AUKA 4I6PA 1EUJA 1UE1A 2D2CC 3S2HH 3AH7A 3PO2G 3ERSX 3QK0A 2F1MA 4HJGE 4YTMB 2DNCA 1XQQA 3ZTDA 4G11A 3PUVA 1DXMA 5EE0A 3PO3G 4JV5Q 2IY0B 1WJNA 3N6RA 4MH0E 4A3OA 2CQAA 4Q5VA 1PFMA 1Y8PB 2F3VA 3ND9A 3GTPH 3W9CB 2XRSD 4LFBQ 1WTQA 2CCZA 4R3DA 2N9KA 3ZYYX 1HJPA 1YNTE 2LEKA 1IBXB 2XNAC 4US8A 2YTXA 2V3NA 4KHVA 3D0FA 5C3XA 2XWBB 3W2DA 3HZXA 3M7GA 3T1YL 1Y69U 2N7DA 4AYBB 1K73C 4LDTD 1JR0D 3VR9B 4DDGD 1DZ1A 3DEOA 2RPQA 4PZ6A 2V3PA 4W9DA 2A69D 2PO4A 3A8IE 5GAGC 4A3DH 4N9PA 1ACCA 3GTMB 3MXNA 4HSVA 1PRTF 2RDBC 1PV4A 1VQFA 3VR5A 5ELDA 1EY5A 1CK1A 5BYQA 3AE7B 5LMNW 1M94A 3KF8B 2Y5BB 1JT8A 4A93G 3TEZA 1ZKOA 1N32L 3CIRB 2ID0A 1H9RA 5IYDH 1EFID 2YV5A 5FJ8G 1GKHA 1VF7A 1Q82C 2LHDA 2WV6D 3H7SA 1QZEA 4MDKE 1FFVA 2C5CA 2K6QA 3BG3A 3NUHB 3VAWA 1J7BA 3HOZB 2BOSA 3W5VB 2K5HA 5E1FA 4DXGA 5IYBG 2K9XA 3TP5A 1R4QB 4O1NA 3HOYG 2D3GA 4JYAQ 5BYRA 3KLRA 1WMHA 1SE2A 1PGBA 1TWCB 2R93H 3CRKC 3QJYA 4GN1A 2Z6KC 4DF7A 5CHFA 3I3TB 4KJNA 2EJGC 1NMFA 2K32A 3KK7A 5D14A 3KYDD 5IAAC 1JOOA 1YQ4B 3F2CA 1LFDA 5C3JB 2RPVA 4OELB 1I3QB 4GLVB 4JI2L 1GC6A 1Z2MA 3PZ8A 3M62B 4A9AA 1RIPA 3DMUA 3Q8DA 4ITKA 1P7EA 1RJTA 5M5WB 2IZVB 4HEDA 4P1BC 1QOFA 4NKLA 2KA7A 2F0QA 4DV6Q 1WJ6A 1NJIC 1G6ZA 2MHJA 4O42A 1QLBB 1LABA 4GDLB 3SR6A 4A3KB 2C7MB 1JJ2A 1E1TA 4A3IG 1S5ED 2B2YA 1XMOL 5CV8A 2JA8G 1PVOA 1IXRA 1S5CD 2YU9H 2JA6G 1VD2A 2DENB 3IFWB 3BYYB 1F2MA 2QW7A 3UE0A 5IGFA 3EGRA 1E7VA 3Q8AA 3Q3OC 5CX3A 1VMPA 3DHQA 4A76A 1EF5A 2BE5C 2KTRA 5DEHA 2UXCL 3DPDA 2NN6H 4CKEA 2DWQA 2XN9C 2F4VL 2LXJA 3OPOA 3OJ4B 3H94A 1UGJA 2WIIB 1X3EA 2M1MA 4ARIA 1EY0A 2WAQB 3LGJA 1E7PB 1XJVA 2M56B 2CWPA 3I4MG 2WU2B 1XO3A 4DR4Q 4NMZA 4K5WA 3V62A 1U5KA 4AIMA 5JJZA 3CC4A 1DGJA 2DZJA 4OO1H 2PTLA 4KLKA 4YWGG 2M9VA 1B2TA 1RTNA 3ENEA 1VQGA 3KOJA 4GNXA 2NVXB 2V4IB 1BCPD 3JSVA 1BBXC 3AV8A 1JORA 3QIAA 4DR7L 1U0LA 3IL8A 1KRSA 3EJIA 2N0SB 2WLBA 5JPNC 3JVZX 4XIGS 2RKSA 3ZXRA 3DWMA
chains in the Genus database with same CATH topology
2EYMA 1PTOH 1EYDA 2F0HA 4KV6A 3I73A 2AWOA 3VYRA 2E74C 2DY8A 1C4AA 5A2QL 4MT5A 3A8KE 3MHZA 4H0LC 3J80L 2PZWA 1XX8A 4KN7C 1EM7A 1O78A 3BZDB 3AU7A 3IT6B 3KWVA 4Q2JA 5I6YA 1UAPA 1I4QA 2K33A 1SMYD 1VF5C 5I2XA 4J8QA 1KAAA 1UWMA 1A3VA 3A54A 4HROA 3VR8B 3AEDB 5M9OA 1DOXA 1U4RA 1BNZA 4A3FB 1STEA 4L23A 5EJWA 2Q8RE 3BK1A 2DLBA 1ENFA 1QWYA 3H3VC 2AQ2B 3AEGB 3V96A 4I7ZC 3ABVB 3H91A 3QOLA 3NK9A 1B1ZA 1HCZA 2X38A 1GJXA 2NUCA 4B9WA 4R8NA 4QUFA 3BS1A 1T5EA 4QMGA 1W6JA 3VR2A 4IUTA 1M8AA 4EVOA 2IDYA 3MHBA 1BOSA 3T16A 3R93A 2PLPA 4IUVA 2B76B 1N61A 2L5TA 2BCOA 2F0JA 5CMDA 3NXWA 1OFFA 3SXHA 1L0YB 1J7AA 4QF4A 2F0SA 1F2YA 3L3OC 3MXPA 5LL6X 5E4XA 2V0GA 2K5DA 3GS2A 5I6WA 5H8YE 1L5PA 2K5QA 3BVMA 2M00A 2IL8A 2W82A 3SEBA 1PTOC 4GZYC 5JXVA 2I07B 5IODA 3SK4A 2WINB 1XCQL 1ZDXA 1ZDVA 3P63A 3DWAA 4DK1A 4EQNA 1KTKA 2SOBA 1PXUA 5K36G 2B39A 4C2MB 3IT4B 1OXVA 5KEEA 4A3JB 3FPUB 1KDAA 1I4XA 3K59A 2KECA 4KJOA 1LTGD 1XTCD 3CKIB 2MEKA 2RA4A 2K1BA 3D4WA 3E56A 1T3QA 1JWMD 2IGGA 2N88A 1TKEA 1SNQA 1RODA 3MC0B 3GTQB 1A3TA 2ENBA 3TSSA 4WURA 4WJWA 1CA6A 4NAWB 3CWIA 3AE5B 1NVID 1FFUA 3GTGB 3B2GA 4DA2A 3MA2B 1C77A 1RM6C 5FOBB 3PMFA 1V1PA 1QNKA 5D65A 1GXDC 3HEJA 2JE6I 1QOGA 1GUTA 1TR5A 2WXQA 4ZRQA 1EIHA 5MPOA 2WXKA 2RBMA 4CBVA 2KAJA 2SNMA 1AN8A 4XQNA 4IUUA 4BBSB 1MPEA 2JYOA 4IFDG 1PTOD 2SNSA 5M3FB 4A3BB 3E5SA 3NQIA 1SIJA 4RHSA 1ZEQX 4FO2A 3BIID 4REZA 4XQJA 1PRTC 5EE1A 1HZ6A 1F2LA 3A55A 1SE3A 4RKLA 5C4JB 3JAME 1JALA 3W3AA 1SDFA 1F2ZA 4KY5A 4KI0A 2ICEC 4BBRB 1CZGA 4J6HA 1NSNS 1K8MA 3Q8CA 1C4QA 2X6LA 4C1NK 4CHTB 4ULLA 2KHSA 2KCNA 4XE0A 3G6JB 1QILA 3IXSA 4IDIA 4C3IG 3KLSA 3PZ7A 1BQQT 3EUB2 2F0KA 4E6IA 4A3EB 5BN5A 1SB3C 1O80A 5G5HA 4ZYSA 5JAVA 2B2UC 5FO8B 3D4DA 1KNEA 2DYOA 3ITPA 1FO4A 3S16B 1ILQA 4YIJA 3I70A 2M0AA 1IBXA 3UI2A 2PYKA 1RCVD 1SYGA 3SVMA 1SNOA 3B9JA 3GP7A 2JXTA 2SEBD 4H13C 4L2YA 4Q0FA 2HQEA 3NVWA 1ROEA 4RGOS 1YMHE 3B2FA 1PRTD 4OIJA 1N5WA 2FE8A 2B2WA 3KF8A 2D5GA 1CQVA 2O4XA 1CZPA 4KGSA 4M8AA 2BDNA 3S1QB 1TWGB 1OQRA 1NAPA 4FXDA 1STBA 3AE1B 1HHVA 3WCQA 5CORA 1H9SB 2L9HA 3U2SC 2JSVX 5DM73 3P20A 1RFKA 5CYUA 5C4HA 2FUG1 3I57A 4R8IA 1AZPA 2C9OA 5D7GA 1UEAB 2XVSA 1WXQA 1TS2A 1SSNA 1K53A 1K52A 1Q1BA 3PUWA 2EELA 4H44C 4X3KA 1LTTD 2KCCA 2CW0C 3BVZA 1FMAD 1H9KA 3D31A 3OIPA 2L83A 3OWFA 2ACZB 3AE3B 4PQXA 2BDOA 2EYHA 5FKAC 4V0BA 4HRSA 3I91A 2E2HB 1XLPA 5NUCA 5EKLA 3URYA 2J42A 2FJ2A 4RWSC 1RHPA 4BWGB 2EKIA 3C2PA 4J1MA 2EZVA 1VDVA 5AFWA 3SR1A 3NWSA 3TP7A 3C46A 3ZQ4A 1EWYC 3RZDB 3DUZA 3PIO3 2WU5B 3T56B 3S2DB 2JWUA 4M0WA 3VA7A 2PIAA 2E3TA 1RF2D 3NWTA 4PMWA 2B2TA 3BWUD 2R61A 4IFDJ 3KBXA 4FF1A 4OZAA 1WRIA 3VRBB 4KD3A 3MFYA 2Q8TA 1CA5A 4JWUC 2H1EA 1TS5A 2LHEA 3HGBA 4ODGA 2V4DA 1JOKA 2R92B 3KUPA 1MVKA 2A69C 1YN3A 2OHFA 1IYVA 1XEEA 3A7AB 3J80E 3PUXA 4TKOB 1AEXA 1OXTA 2FINB 3S9WA 2EY1A 5KRUA 2MJDA 1GB1A 5ISRA 1FCCC 4ZRZA 2K0PA 3RZOB 1ENCA 2L4NA 1EY7A 3BDLA 1VJKA 1GB4A 2KJXA 3Q0AA 5T8IA 1SJED 1YNJC 1CTMA 2EXZA 4ZQ3A 2WXMA 1CM9A 3AEAB 4NJCA 1R9TB 1BXTA 1WCMB 5I4DA 3W5UB 4C3HB 1PDQA 3P1HA 5DM63 4MHEA 2WXPA 4NP5A 3RLFA 5C44B 3Q22A 2F0WA 4DAYA 1G91A 5C3EB 5K36H 1EL0A 2NBFA 4KX6B 1XXGA 4KKTA 2JA5B 3G7LA 3FKIB 4CJ2C 5C5LA 1HA5A 2B2VC 2KOLA 2A73B 3FILB 2PQEA 2YEPF 1FCLA 3ETRA 1ZOYB 1LT4D 5IGDA 4YT0B 2HDLA 4WFN3 1K50A 5KYIA 5T1IA 1D2BA 2F0MA 1G2TA 4J3OD 3W1SA 1A3UA 4LJZC 1UWXA 1IUEA 1NEKB 1ILPA 5GXGB 3I4LA 4B9XA 5T1GA 4RF0A 2FBWB 1WTPA 3Q69A 5C0XG 1EYCA 1T5XD 1BCPC 1YJIA 2WXRA 2WDVB 5D3IB 2QIEB 1GUNA 1TWFB 1LT6D 5BN3A 1YNJD 3J81L 3TDQA 4IFDI 1EEID 5IGBA 2Y5CA 3PUZA 1N60A 2JP1A 4JWSC 1LACA 5IT9L 3MEHA 4IFDH 3L4PA 5C6AA 1QG7A 4PNYA 3V2TA 2KEEA 3LWUA 2RDGA 2GRIA 3SHLA 1O7ZA 3OWEB 1C79A 3FEWX 3L9AX 4PMCA 3HOXB 3H6MA 3TEYA 1D4BA 4ZLTF 2MJ8A 1FNVA 1SXTA 2X6GA 1JROA 1QOAA 4IURA 2FMCA 1SMYC 4BA1I 2JEAI 1EQTA 4XT1B 2INPE 3TUOA 4ILWA 4G7OC 3AB5A 3SFDB 2Y0SB 1PLFA 3R2IA 2PZUA 5BMHA 3C8YA 4F88A 1L0VB 4G4KA 4IUNA 2VB2X 1I4HA 2ZXRA 4B08A 1L4ZB 3NTKA 5CV5A 3K57A 1I4RA 1IL8A 3ZGZA 1YJJA 4HSPA 4WWMA 4HKQA 1S5DD 2H89B 3D3RA 3K5MA 2F03A 2K28A 2RDHA 2KACA 1QT9A 3BDOA 4P2CB 3P75A 3LNNA 2MJ3A 4ID6A 1ZXHA 1HUMA 1H9JA 2ZW1A 4B0EA 4RCNA 3TN2A 1Q12A 4KKSA 4L63B 1C8CA 1QF6A 5F2DA 2JX5A 2TMPA 3M85A 3LXFA 3MAQA 3S2HB 1RYJA 2H4OA 1YNND 1XLOA 3RD4A 2F0UA 2E6XA 2KUMA 1Q8IA 2F0VA 3FVQA 2K03A 4U68A 3GTPB 1FEHA 3VRAB 4ME5A 1W6KA 4ZHPA 4YSZB 4LLGM 2L11A 1CHQD 1DONA 3C1FA 4DXFA 4MM3B 1E6EB 5BYSA 2NTTA 4A3DB 1NI3A 3MP9A 1IKMA 1VCIA 2F0LA 3NVYA 1ZUD2 1SNMA 4L6TB 4XYOA 1A2UA 4L8JA 3EROA 2PCFB 4DAVA 5KYLA 1PYWD 2FHTA 1X32A 4A6QA 1PZJD 2PW5A 2R93B 1JMLA 2WXNA 3OW7A 1QNUA 1EY4A 1EY9A 3A8JE 2WNMA 3R2TA 1L0XB 4WIPA 2JSOA 4XDXA 2R3ZA 1YN5A 3FRPB 3GV6A 1MD2D 3K0YA 1H9SA 1PGXA 1GUSA 3I3CA 4EE2A 2ZXOA 2HCCA 1MHXA 3DM1A 1OXSC 3U52E 2K7VA 2A74C 4AQ7A 4ZUIA 3R3OA 4EQPA 2YU9B 2CJNA 4IOIE 2RQXA 1LT5D 2F0NA 3A56A 1TVXA 4KMUC 4DU9A 3SK5A 2JZPA 3VYTA 1ENAA 1E2WA 1B3AA 1TKGA 2J7ZA 2BTEA 3NVVA 3DEPA 3R8BA 3P42A 4OIKA 4L1BA 2WP9B 5EBCA 4JBWA 3NZ3A 5E3FA 4DAPA 3U9SA 2L1AA 1DOKA 4AS1A 1RTOA 4NW2A 1TY2A 3NHHA 4HR7B 1MGSA 3PUYA 1CZWA 3GB1A 4IUQA 3P4SB 2K05A 1DOLA 1CJEA 4KKJA 1PTOB 2B2YC 3HKZB 5IGEA 3S1NB 1J7CA 2G1EA 4KGTA 3KWLA 2K5WA 1ZPSA 2QKIC 3QO2A 1LTAD 2L12A 4TMAB 2WXLA 1U4LA 2A6ED 1BMLC 2B63B 5C3WA 2J52A 1SYDA 1I50B 1DOYA 1HQRD 1Y1VB 2LUMA 3QOJA 1MSGA 1GPXA 5CV9A 1L4DB 2OF1A 4HEA1 2VXWA 2NTSA 1JWUD 4I65A 2SDFA 2CJOA 4QIWB 1RD9D 3FAHA 1EY6A 3X3NA 2D5DA 3TMEA 4S3SA 4C3JB 2WQYB 1GUGA 1V97A 3HOVB 4WAFA 2VZKB 5C4ZA 4RH6A 5ELFA 4DFAA 4G7ZC 3AMUA 1XWEA 2EY2A 1OQQA 3UI3A 1B53A 2WXJA 1SJHD 2DNEA 1ICWA 1VDZA 2BT6A 1WWTA 4H7BA 1HTLD 3NP8A 3GTKB 5KGUA 4UAIA 3AB9A 3TEWA 2EE1A 1MBYA 3K58A 2E2JB 1EY8A 1Q1EA 1U4PA 4OL7A 5C0XI 5A35A 1AFPA 1JC7A 1GUOA 1N5XA 1X3QA 1SYEA 3F2UA 4ZK9B 5G3LF 1HQMC 1PRTB 2NVTB 2KDMA 1HA6A 2LGIA 2NB0A 3Q8EA 4XXEA 2NN6G 1ZXTA 2JQRB 1B9RA 1SYBA 3FILA 2LFIA 1IYUA 5ELCA 1C4PA 1DJRD 3FMCA 3BK2A 4H2AA 2R7ZB 3NBHA 1U9RA 1II3A 1MSHA 3K7AB 3NQTA 4BY7B 2AWNA 3Q8FA 3ND8A 2L0CA 2WP8J 5I9PA 3T51B 2HDEA 4K14A 4C56C 3GTOB 1F2RI 1SAPA 3AEBB 3QWNA 1AW7A 2AUJD 4LK1C 1Y1WB 4N6EB 1UUPA 3IFTA 2B8GA 3OIQA 5KNBA 4WQMA 1BO0A 4KK7A 1I7HA 2BYTA 1C48A 1TS3A 1V8CA 2PMZB 4RAUC 5ELBA 2E2IB 1C76A 1ONLA 3GQBA 3I8ZA 1E0ZA 2EJFC 5C2TB 2JEBI 4KY7A 2K22A 1EEFD 4UDUC 5FO7B 4YTNB 1ESRA 2IX0A 5COYA 3K6OA 2ZXPA 1JWBD 1PFNA 3J81E 2I2YA 4KY6A 1R4PB 2ICIA 1KF6B 4OVZA 2JYEA 4FF4A 2OEOA 1DOIA 5IT9E 1D5XC 2QSDA 5CV7A 1EYAA 4A3MB 1F9RA 2PMVA 1G8ZD 1SNDA 1LT3D 3T13A 4DK0A 1E0BA 4FNFA 4N59A 3P7JA 5BN4A 2F0PA 1PFDA 1BUVT 4KTAA 1STHA 1STGA 1R7SA 1WYGA 4PV1C 3E6ZX 2BS2B 3X3MA 3HP3A 2N55A 2PNRC 5FR3A 5HFYA 3D8GA 4KKUA 4TQ1A 1NR4A 2EPBA 4RKBA 1JWAD 2IJ0A 2Z4IA 3MFGA 3RFZB 1G2SA 3GO5A 2XWJB 2WDQB 3S14B 3NTHA 1AYFA 1IW7D 5JPMC 3P4QB 2EYJA 2BB5A 2G9HD 2QILA 1F9SA 3WDNA 2VNUD 4C1NI 2PPBC 1D5MC 1F2RC 3U4EG 3RUZA 4RGTA 3TP6A 4A93B 5C5MA 1HTPA 5CC4A 4GLSC 2O2LD 1LO5D 2J4XA 5IIFA 3J9CA 4OZBA 3E9SA 4KHZA 5JOBA 1SE4A 1CQFA 4M1UB 4JX1C 3HOYB 3AEFB 2EYFA 2K5PA 1FGBD 3GTJB 3C1EA 1PMRA 1QE6A 3BYTB 3IFDA 4XDDA 3N52A 3VA5A 2WS3B 1TT2A 2MJEA 4XT3B 1Y8OB 2WXGA 4HMIA 5D3DA 4ABNA 1J8IA 4C7YA 2LKVA 2G9DA 3AE6B 1SBBB 3ERQA 2FFKB 5IGCA 5BMGA 1WTOA 4QCLA 3T4AC 4PT5A 1EWHA 4A3IB 3PIP3 3HVZA 4RHRA 2Z4HA 2JYTA 2JA8B 5BMIA 2RSOA 3TZUA 4QUCA 1N62A 2JA6B 1FD6A 2AQ3B 4DQOC 1XLNA 2LS01 1F9QA 4MACA 1PFBA 5CGKA 2CU3A 3NS1A 5DNFA 2PW7A 1HFGA 1Q3LA 3NBIA 1NENB 3LB8C 4YXDB 1E2ZA 1S5FD 3I4MB 3DWPA 3J7AF 1A70A 4DN4M 4U673 3S15B 2VB3X 5CR3A 1RDPD 2TSSA 1B9NA 5KNDA 3VYSA 2PZTA 1F0ZA 2B2WC 3VR3A 1A15A 5FO9B 1AWDA 3NRZA 1ZYRC 3HS0C 1FM0D 4ZOHC 5AUIA 5EBDA 4K6DA 3LX0A 4N9TA 3EA6A 1PDXA 4F87A 1C78A 4RA8A 3ONAB 1WSPA 3D6WA 2QEJC 1GHKA 1JOQA 3LYYA 1OO9B 2L55A 4X3SA 4HKZE 1STYA 3T3OA 1H9MA 5TSSA 1E9MA 2NVQB 4JPSA 3TZDA 2OEDA 2KVMA 2GB1A 5CV4A 2XRQD 5HHDG 2L32A 2BW2A 1SEBD 3CQZB 4P6VF 2IT1A 1J9OA 4USAA 5M5XB 1Z7TA 1YNNC 3Q23A 1X3PA 1JW9D 4FVMA 4CQNA 1BCPB 5E6JA 1VZ6A 4FYDA 3TBIB 3H8HA 4RGMA 1QOBA 2F3WA 1EU3A 1TQOA 5HGTA 2W54A 4GDKB 3ZJTA 4KD4A 4ZUJA 1KLUD 3HVDA 4A3GB 1ZP0B 2BB6A 2IX3A 3AE4B 3AMZA 2RDFA 4X3UA 4TRDA 2BA1A 1CFMA 1VR9A 3IAS1 3I72A 4QB4A 1Q90A 2EY6A 1HFNA 1ZYRD 4C3HG 3SE0A 3TEXA 3Q6SA 5LHY1 2NN6I 4TQ0A 1STAA 4K8IA 3FPPA 2F0GA 3KQ4A 1EQVA 2B2TC 4V190 1FXAA 4OHJA 2LMCB 1ET6A 3WOEA 1TIID 4IQZA 2QF7A 3K5OA 2DBYA 1UNSA 1GUWA 1CHPD 4OO1I 3AE9B 2E76C 2IW3A 2IPKD 1JQ4A 2GI9A 5EE3A 2Q8IB 1FXIA 3NPPA 2E2DC 4FXCA 4NZLB 5M5YB 2WXOA 1WTWA 2NZ1D 4K2KA 3P4RB 1Z47A 3VYUA 1FNUA 3IAYA 4C80A 4K6LA 1ZXIA 5G3LD 1MI0A 2PKOA 4XWWA 3OHXC 5EPKA 1VLBA 5ELEA 4DGZA 1WVLA 1XCTL 3I90A 1ML0D 2INNE 1D1IA 3AN1A 1LTRD 1FNWA 4K5XA 5EE9A 1TKWB 3NSWA 4CGYB 2PW9A 2QCPX 2Q5WD 4DNTB 3GTLB 4FP5D 1TU2B 2Z1CA 1AZQA 2KWDA 2A68C 4CKBA 1FD7D 2F0TA 1GOZA 4BY1B 1I6HB 1FRRA 3M3YB 3VR4A 2BE5D 2EOTA 4NAMA 1KNAA 3IAM1 1IHZA 5JEAG 1KDCA 2HCIA 1NYRA 1G291 2B2UA 3MJ5A 2WACA 2D62A 1U4MA 1I6VC 1EIGA 2A6EC 3V05A 4C7ZA 3HOUB 1T6BX 1NR2A 4IUPA 1EZ8A 3D6CA 5JVG3 2ON8A 2Y5PA 4OGQC 3J7YW 1HZ5A 4ZAIA 3MWYW 5JVH3 1KFYB 4RCOA 2BA0A 1DCZA 3P4PB 1GHJA 5I2YA 5C0XJ 1DM0B 4XTCS 3AECB 4BS9A 3BDCA 5EGTA 4PMBA 4LTUA 1STNA 2EDGA 3HRZC 3EVQA 1VMCA 1HPCA 2LJIA 3M7NA 1VZ7A 3MXUA 2MH7A 1PUTA 1HRJA 4C3IB 3HUIA 4B0MA 4EQOA 4JK1C 2EVBA 3K5LA 2D9UA 4KKIA 2DN8A 1QB5D 1VZ8A 1V1OA 2X69A 3M4YA 1MHHE 4US9A 4P16A 1GAQB 4RNAA 2K3UA 3K5NA 2GA4B 5J1ZA 2A68D 4IALA 2HDMA 1QQRA 3QB3A 4CKCA 1JICA 4ZKBB 4A90A 1E2VA 1OXXK 1TY0A 1PGAA 2E75C 2KMMA 2M2LA 3CU7A 1QJOA 4Z9CB 3E0JA 1WD1A 3NE5B 4RGNA 2IGHA 1O7YA 4TSSA 1KDBA 3QG1A 5CV6A 2WDRB 2I38A 1D5ZC 1KABA 3AE2B 1SF0A 2EJMA 1YN4A 2RMMA 1JB3A 1B44D 1SFOB 2AX5A 1B4OA 1M4VA 2KQ3A 1JQYD 2SAKA 2L1BA 4YSXB 1XLQA 1V8QA 2AQ1B 2MGSA 3FDTA 4EGVA 4WORA 2F4IA 1I4PA 1P7FA 2JU6X 2RSNA 1TYGB 1TS4A 1TJEA 4HN7A 1KH0A 1DYQA 4HTHA 4XQQA 4TQUS 1N63A 1D6EC 4LK0M 1O7LA 2YEPB 1LV9A 2F0FA 3T53B 5EQ0A 2WB1B 3SDZA 1BCPF 2EYPA 2BS4B 1A2TA 1KLGD 1B50A 3V3XA 1NYQA 1ET9A 1KRHA 5FLXE 5LNK1 1V43A 3J7AV 1E10A 2MUYA 2NWGA 3I4NB 3NTIA 2A5HA 5EPLA 4CJ0B 3RMHA 3ZJUA 5C0XH 4XYQA 3SK6A 2BS3B 1OXUA 4ZKCB 2N9LA 4G7HC 2KQ4X 2NMQA 1D1KA 4LAAA 5K5PA 1Z6HA 1NCVA 2XIWA 3HOWB 2W3SA 1JCKB 2QDBA 2H88B 4ZRPA 2O5IC 4X3TA 3D4RA 4MN3A 4K5VA 2O5JC 4OO1G 1LTSD 1MI2A 1RKNA 1IGCA 2VZKD 2HUGA 1JRPA 3S1RB 4OZCA 4ZHOA 3ZJVA 2F0IA 3U7ZA 1DD2A 4MIUA 1SNCA 4IN3A 2IGDA 2OXPA 1LTBD 3PV0A 2WXFA 5JEAJ 2F0EA 3L7ZC 4FXGC 4MH8A 4RF1A 1EZ6A 3DXJC 2B2VA 1B9MA 5KNCA 3MZ5A 1IW7C 5DAUA 5M3MB 4F8MA 3DWGC 3VQIA 5I9OA 4HMJA 2CHBD 2J0TD 5CBAE 2M19A 1CI3M 2W55A 2VUMB 1FRDA 5EPJA 5LL6S 5HURA 4JE3B 1HXYD 4Y7NB 3I9V1 3Q8BA 3RPFC 2OT2A 3NVZA 2ONQA 2WKDA 5AUKA 2WXHA 3OMGA 2NVYB 2CVRA 4XDCA 3CRLC 1VRAB 1HUNA 2LY7A 2JXMB 4FF2A 2XSCA 1EU4A 2FMMA 4C3JG 3HRDD 5KIXA 2QJLA 2KN4A 3DWQA 3MVVA 1WTRA 3KLSX 5CBEE 1L6VA 3CHBD 3T3NA 1WTVA 4HAEA 2ZW0A 5EKIA 3LWEA 5J22A 5G5GA 4OW0A 1AP0A 2K01A 4N58A 1Q10A 1FYCA 4K2LA 1I4GA 2QMTA 4WH4A 4NDXA 1TWHB 3PO2B 1QKZA 1A6XA 2IX1A 3A7LA 5H92C 3PO3B 2I46A 1FR3A 2A6HC 2DY7A 3NUCA 1DOMA 1JWSD 2B8FA 1BF4A 2PVOD 3EQLC 2LMCA 1ZE3D 3FC4A 3C3LA 2J53A 3O13A 1C9FA 3VR6A 2WKCA 1WTXA 5E4WC 1QOHA 2Y3AA 4FXKC 2KEDA 5J39A 2Z8LA 1LLRD 3Q24A 3S1MB 4KN4C 4HCEA 3HG9A 5IOCA 4IKGA 4BA2I 2PVGC 3AM9A 4F7XA 1V1PB 1XYIA 3GD7A 1LTID 4A8XC 2EY5A 3TP8A 1K51A 5C4XB 2K04A 2MPMA 3H0GB 1HEZE 2LFNA 2ZT9C 2MP1A 3P1MA 2IWHA 2K6AA 5EKKA 4IZ8A 5HI1A 1YQ3B 1F77A 2RVLA 1CT1D 2W3RA 5JEAH 1EWCA 1S5BD 1BDOA 4XWTA 1Y56A 1JE4A 1TZOA 2HTME 4LMQD 5HG2A 1PTOF 3N9YC 1QCBD 3AE8B 3OSOA 5A2QE 4D2KA 5FLXL 1WGKA 1PZID 2L52A 3EFXD 3M4OB 1K83B 3JAML 1SNPA 3MTSA 4YSYB 1SYFA 2F0OA 3IKJA 4FF3A 5IGGA 4CJ1B 4HCSA 3OMCA 3U9OA 3KBGA 1PZKD 2CW0D 3WOFA 3GV3A 2DYMA 2F0DA 2R6GA 1S4ZA 1C4CA 2A6HD 4K8JA 1RWSA 1Y8NB 2JA7B 2EYLA 4G57A 1L6UA 1SSOA 4WRDA 2EYOA 2N7JA 1K8OA 1FIQA 3H09A 1SYCA 1ESFA 3PO0A 2NYZD 1IKLA 1XF5L 3BVGA 4YTPB 4ARCA 2BBCA 4R9WA 1F9PA 3OOCA 1WD0A 1EOTA 4A55A 4KGRA 1TKYA 3MXGA 2YYZA 3SFEB 1TWAB 1BR9A 2WXIA 1IGDA 3AEEB 4DNRB 2MHVA 3S17B 5FK9C 3SK8A 1BUIC 1NUCA 4RFBA 2AUKA 2D2CC 3AH7A 4HJGE 2F1MA 4YTMB 2DNCA 3PUVA 1DXMA 5EE0A 3N6RA 2CQAA 4Q5VA 1PFMA 1Y8PB 2F3VA 3ND9A 3W9CB 2XRSD 1WTQA 4R3DA 2N9KA 3ZYYX 1YNTE 2LEKA 1IBXB 2XNAC 4US8A 2V3NA 4KHVA 5C3XA 2XWBB 3W2DA 3HZXA 3M7GA 1Y69U 3VR9B 4AYBB 1JR0D 1DZ1A 3DEOA 2V3PA 2A69D 2PO4A 3A8IE 1ACCA 4N9PA 3GTMB 3MXNA 4HSVA 1PRTF 3VR5A 5ELDA 1EY5A 1CK1A 5BYQA 3AE7B 3TEZA 1ZKOA 3CIRB 2ID0A 1H9RA 1EFID 1VF7A 2LHDA 2WV6D 1FFVA 2C5CA 3BG3A 3NUHB 1J7BA 3HOZB 2BOSA 3W5VB 5E1FA 4DXGA 2K9XA 3TP5A 1R4QB 4O1NA 5BYRA 3KLRA 1SE2A 1PGBA 1TWCB 3CRKC 3QJYA 4DF7A 4KJNA 2EJGC 2K32A 3KK7A 5D14A 1JOOA 1YQ4B 5C3JB 2RPVA 1I3QB 3PZ8A 4A9AA 3DMUA 4ITKA