1JWSD

Crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDGMFNWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwsD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwsD02
4RHRA 1SJHD 1YN4A 1ET6A 1HXYD 1JWSD 4L63B 1BCPF 4DXGA 5ELBA 2G9HD 3BVGA 3MFGA 3V05A 1PTOH 2IJ0A 5D3IB 2SEBD 3KLSX 2QILA 4L6TB 1S5FD 1FD7D 4NZLB 1PRTC 1JWMD 1FNUA 1HA5A 1RCVD 1SJED 2AQ1B 3DWPA 1STEA 4UDUC 3EA6A 1D5XC 3BVZA 1ET9A 1LTBD 3R2IA 1L0XB 1D6EC 1YN3A 3MC0B 3EFXD 1RF2D 1TS2A 2AQ3B 2CHBD 1LTSD 3R2TA 1S5DD 2AQ2B 5D3DA 1JR0D 1TY0A 1LTAD 4K6LA 1SE2A 4RH6A 4ZYSA 1PRTB 1CHQD 1M4VA 3URYA 1D5ZC 5I4DA 1PRTD 5TSSA 1HQRD 1V1PA 4RGMA 1XXGA 2Z8LA 4RGTA 2J4XA 5FKAC 3CHBD 1TS5A 1JCKB 1QILA 4DXFA 1LT4D 1B1ZA 3O13A 1SE4A 1S5CD 1D5MC 1PTOC 1TS4A 1G8ZD 5ELFA 1T5XD 1JWUD 5ELCA 4C56C 1KTKA 1MD2D 1ESFA 1SE3A 2QEJC 1V1PB 4BWGB 5ELDA 1LT3D 3TSSA 1LT5D 1EU4A 1I4XA 4RHSA 4TSSA 3R8BA 1EWCA 1UUPA 1SXTA 1UNSA 1FNWA 1BCPC 1PRTF 3GP7A 1FNVA 1LTRD 1RDPD 1KLUD 1GOZA 2WV6D 3DWQA 1SBBB 1I4PA 1EEFD 1TY2A 2XNAC 1PTOB 2ICIA 1PYWD 1AW7A 1B44D 2XN9C 1S5ED 1LTID 2XRQD 1PZID 1I4HA 1PTOD 4RFBA 1CK1A 4RGOS 1I4QA 1DJRD 1PZKD 4RGNA 1LO5D 1RD9D 2O2LD 3BYYB 1LLRD 2NTSA 1EFID 3BZDB 1BCPB 1EU3A 3BYTB 4O1NA 1EEID 1DYQA 1CT1D 3BVMA 1CHPD 1CQVA 1BCPD 1FGBD 2NTTA 3OWEB 4OHJA 1SEBD 1JQYD 1LT6D 2IPKD 1BXTA 1S5BD 1PZJD 1I4GA 2R61A 1YN5A 3DWAA 1LTGD 4RCOA 4Z9CB 1L0YB 5FK9C 3SEBA 1LTTD 1PTOF 1AN8A 2RDGA 2TSSA 2RDHA 1HTLD 1I4RA 1TS3A 2XRSD 1F77A 3W2DA 1V1OA 1ENFA 1XTCD 1KLGD 5ELEA
chains in the Genus database with same CATH superfamily
2NB0A 4RHRA 1KDBA 1PDXA 3RZFA 4W9CA 5IO9A 2PE9A 3RPFC 2JQOA 1IBKQ 2CW0D 1JB3A 3PUYA 1R9TB 1BMLC 1V8CA 5BO4B 5J22A 3KYHC 4LF5L 1YJ9A 2M4NA 3RNCC 2JT4B 4GLVB 2PVOD 3KVFB 3NBHA 4DXGA 4L5QA 3W3AA 5ELBA 2E2JH 1GJXA 1FJGL 1TWAB 3HVZA 3ULLA 2JA5B 4E6IA 5G3LF 4QMGA 3GTQH 2I1KA 2INCC 2WDTB 3B2FA 4JBWA 2A74C 3CCRA 2PQAB 4HIMA 1SYBA 4LTUA 1VJKA 1ET9A 1LTBD 2MO0A 5I9OA 1MIUA 4BA1I 3VH4B 3LB8C 3TP8A 5M3FH 3EFXD 4FULA 1FYCA 3Q8FA 2K6QA 4AOFA 1S5DD 1UEAB 2FIDA 2KO3A 3G6EA 3VRBB 1OXXK 2ZEQA 1IZ6A 4H0LC 1WJ6A 4DV6L 2LS01 4DDID 2WXFA 3P75A 3VYRA 2DY7A 5AFWA 1Q7YC 1P7EA 1C76A 1PGAA 4G0NB 4ARIA 1G51A 1N33Q 1PYSB 3K5OA 3HOXB 1XPUA 4A3GB 1GUAB 1EWYC 3U30A 3KFUA 3CCJA 3C1FA 1KQSA 4IFDI 2I46A 2PZUA 2KMCA 3AEDB 1O7IA 3IAS1 2Z8LA 3JSVB 1HEZE 3L10B 2F0VA 1DOXA 1F2LA 1TS5A 2D2CC 2V1YA 4JCVE 1LT4D 3LYYA 3GZNB 4HSVA 2WHIA 1X1MA 1V2YA 5L83A 1Y8NB 2KJ6A 2DYMA 2AWOA 3JAMc 4MM3A 1EM7A 4Y7NH 2N9PC 3S1MB 3I73A 3T56B 2O5JC 4A3BG 4A3DB 2VUMH 3FPPA 3G6JB 5D14A 1FRDA 3W1BA 1IYVA 3MC8A 4CDDC 1F2RI 1VRAB 2XTIA 3AE7B 2UUCQ 3NVVA 4ZDVA 3M62B 5IIFA 5KIXA 2JVCA 1PDQA 2NN6G 3RN2A 4A9AA 3RZDB 3T9LA 1MKHA 2R7DA 2KLGA 2E74C 4JI7L 2WXLA 2XNAC 1PTOB 3MP9A 3F2CA 4JI0L 1B44D 4EE2A 2L52A 3HOYH 3CSTA 2NVUI 3V6CB 4C2MB 2R7ZG 4RWSC 1QOHA 2O6VA 5EE1A 2O2LD 4IWOA 2I5HA 3CU7A 2KTFA 4PZ8A 4KN7C 1DOKA 2FCSA 1BCPB 3RFZB 5IOIA 4DK3C 1Y1VH 1XLQA 1DYQA 1PH9A 2LGYA 1Y8PB 2G9DA 3PUWA 4TKOB 2R92H 3S17H 4OVUA 2JXMB 4JI6Q 1VLBA 2KHSA 4XYQA 1TT2A 2L55A 3EROA 2A8VA 2LJ5A 2N7JA 1WJJA 2Y5BB 3GTKB 5JPMC 2JA9A 1K3RA 1LYLA 1OQRA 2EJFC 2LEKA 3J9CA 5KRUA 3NVWA 4X65Q 1L2FA 2WDVB 3P1HA 3AEGB 1PLFA 1UGJA 1R4NB 1SE9A 2PMVA 2R7ZB 5M5YH 3HOWB 2F1MA 2WXQA 1Y1WB 5LMUL 2XRSD 1J7AA 2MP1A 1WX9A 4DU9A 4C3JB 5KNBA 4A93H 3QWNA 4FYDA 1AE2A 3UDIA 1IBXA 1QOFA 3APDA 3MHSD 2IW3A 2E2HH 2HQEA 2IO3B 4MGYE 3VUYA 4LFBQ 4KIKB 3A8KE 5JJLA 5I9PA 3ZKJC 5C0XJ 1Q86C 1F1HA 3K8AA 2RHQB 2CFMA 3I4MH 2OT2A 2K32A 2XWBB 2DZMA 2EOTA 1S5FD 3QOLA 2OTLA 1X6OA 3ZO5B 4YCUA 3W1YA 1K73C 4LNKA 3TP6A 3PLVA 1VMCA 1V49A 1QUQA 2YU9H 2L00B 1EYGA 1I6VC 4LF7L 2C9WB 3E9IA 2Z4HA 3OOCA 1B3AA 1DOLA 5G55A 2E2IH 2ALYB 3OSOA 3CCMA 2EYOA 4DV3Q 2DNEA 1L6UA 3ML8A 2NWGA 2KEDA 4IJLA 2EPBA 2GA4B 3I7FA 1SF0A 5HKHA 1IP9A 1QJOA 2OWOA 4OELB 1XWEA 3N1YC 1QOBA 4W9LA 4FXDA 1NSNS 5FO9B 1YIJA 3QOJA 2SAKA 4GXBA 5D2MB 4OZCA 4DXAB 4ULLA 2N4FA 5EKKA 1Q8IA 3P63A 1D5ZC 3MXGA 3FDTA 3TS2A 5IA7A 2K03A 2QW7A 3W9CB 1Q90A 3GTLB 3UDXA 1NAPA 4GMVA 1JE5A 3MXNB 5LMNL 1WZ3A 4IOIE 2A5HA 3H3VC 2UXDQ 3N20C 4GGQA 1A8VA 2C7HA 4L1BA 3VAWA 2KWVB 3U9SA 4KN4C 3KBGA 1IBLQ 4C56C 1SE8A 4P1CC 3BDLA 1E1TA 4PQXA 1EY7A 1QB5D 2BE5C 1ZXIA 3AULA 1N32Q 4NDXA 4M0WB 1V9JA 3DWGC 3T3NA 1QZEA 1NJIC 2D5GA 1OFFA 1A3TA 1PH2A 3FP9A 1H95A 4DK5A 2B63H 1PGXA 3AE5B 1FNVA 1W6JA 5CV9A 3NVZA 3PZ7A 1RIPA 1TT5B 3BK2A 2QJLA 4DV5Q 1T0QC 2BBCA 1OQYA 2PIAA 4K7WA 3WA0A 3WALA 4MN3A 2WDQB 4O2DA 3HOZB 2L4NA 1JWAD 2BGFA 2JYOA 1JOKA 3A56A 1P3QU 1I4HA 2LGXA 2PMZE 3CRKC 2VW9A 3CCVA 4QIWB 1UEBA 3AM9A 1M1KC 2ZM6L 3Q0AA 3A33B 3IKJA 2EMTA 4MJSA 3DHIC 1TKEA 1WTHA 4JQWC 4YSYB 2L0CA 3K59A 1KXLA 1WI0A 1NTGA 4DBGA 3GTGH 4NPNA 4ANUA 1TWHB 4MT5A 2ICEC 3ICEA 3EIVA 2XIWA 3CMAA 2A6HD 3UDFA 1UZXB 4WFN3 4RA8A 4N9F4 4ZAIA 2E5LL 1K0RA 1D1IA 5FK9C 2RDGA 3KYCD 4LDTB 2EXZA 2FCQA 1IW7D 4KD4A 2UXCL 4K8JA 1KLGD 3AYHB 3EBEA 4AQYL 1TYGB 3HKSA 4LUZA 1O7ZA 1OXUA 4IFDJ 2BWES 2BS2B 5EKIA 4WJNA 1WD1A 5EE3A 2YYZA 4JPBW 4AYBE 5ISRA 3N1XC 4N59A 1D4BA 1VQGA 5L95C 4KY6A 4PV1C 4UP7A 2VQFQ 2JZ3B 4BVUC 2F0TA 2G1EA 3STBD 2K7VA 1B53A 2ASQA 1XMQQ 3RI7C 3ZNHB 2BDNA 1WM3A 2HJ1A 3RR5A 1G291 2DJFC 4DR4L 2Y5CA 2B2WA 4JI5L 3J80i 4DR6Q 1RCVD 4QQBX 3CCUA 1YZ6A 2K25A 4JX1C 4JI5Q 4IFDG 4W9KA 1DCZA 2PEAA 2JA6H 2B2TA 5GQOA 3MJ5A 1HR0W 4D2KA 2RA4A 2E2DC 2YTYA 3K5LA 4ANXA 5LXHA 2Z1CA 1A70A 3SHQA 2KECA 2VS1A 1TWCB 3PVLA 2ZCBA 4W9EA 1YHQA 1AZQA 1DOIA 2I2YA 2ASBA 1SE2A 2RD0A 4TKNA 4NAWB 2JEAI 2J52A 5JVH3 1VQBA 4JK1C 4GDKB 1KJTA 3OWFA 4HMJA 4X62L 1IKMA 3I90A 1HHVA 3DBHI 3PUXA 3H7PA 2EYJA 2M17A 2K05A 3TEWA 4OVZA 3TCAA 5FOBB 3ZVVA 3M4OB 2NVQB 1NUCA 5M3MH 3KLRA 3KK7A 4AWJA 5A2QL 1FEHA 1J0GA 3NSWA 4IW0A 5IGEA 1WE7A 3AEBB 4CJ0B 4A3JB 1HPCA 4ANWA 1JJGA 4ICVA 4DV7Q 3DBLI 1N60A 4G7ZC 4LFAQ 3T16A 1UD7A 3OIPA 3TBIB 4BY1G 1KRHA 1VZ8A 5C3JB 3S2HH 1GUGA 1X3EA 3J7AV 2CU3A 3HOUH 2B2YC 1JE4A 3R3MA 3A9JB 4JG2A 1EF5A 1DXMA 4ZUIA 1YNNC 5FLXE 1EYDA 4LW1A 4QB4A 2KFKB 3VDZA 3W1SA 1DGSA 1VQPA 1YMHE 3I5JC 4A55A 3MEFA 3T13A 1ICWA 3MEHA 1XCQL 1STNA 2K5VA 4DNIA 2KDEB 2K33A 4K8IA 3NE5B 2DZIA 3UIPB 4BY1B 1XX8A 2ENBA 2RCFA 3CPWA 2NTSA 2AHOB 4C3IG 1SYEA 2I38A 4R4TA 3T1HL 5C44H 1EEID 2I07B 1SIJA 3AB5A 2PJHA 4M00A 4OWXB 3OHXC 2NZHA 4P1BC 2PNRC 1WXQA 4ZRPA 1HZBA 4B9KA 1RODA 4IOCA 3NQTA 2MHVA 2OXPA 3SFEB 2WINB 4C1NK 2VY3A 3DWAA 1WM2A 1YN5A 3UINB 4OO1G 4O42A 3RNUA 4NXML 5EPJA 5EPLA 3QQ8B 3IFTA 4HK2A 1AN8A 2A4ZA 2TSSA 1O7LA 4KKUA 4BBSG 1LXDA 3N1ZC 3A8JE 5JHBA 3G7LA 3J81c 4V190 1FFVA 5EJWA 2KDFB 4TSSA 2ZJDA 2KMMA 5I6YA 2MWSB 2Z6KC 4HVBA 4HLEA 2BW2A 3WCQA 3AFQA 5IGCA 1V80A 4R8IA 2NBFA 1BT0A 2Q8IB 3TN2A 5IP7G 1SMXA 2LVOA 4K2LA 1F2RC 1ZDXA 5CC4A 2KVZA 4UP8A 3SR6A 5KHQA 2ZTEA 1ILPA 4GB9A 2LKVA 4DWFA 1PRTC 1QZGA 2JZZA 1X3QA 4HEDA 1N36L 4BBSB 2KKCA 3B1LX 1IXRA 1I50H 2AQ1B 2K04A 5E6NA 1HNXQ 4FXCA 4DR5Q 1IYJB 3TIXA 3ZNZB 3U8ZA 2MBOA 1VQLA 1NEKB 1CQFA 3QAQA 1W6KA 3PT2B 4J6HA 3H6MA 3J7A5 2CU1A 3AQQA 4GS3A 3RLNA 1JR0D 1K28A 4X3TA 5JOBA 3P4QB 4YWGG 2LY7A 2J0MA 1MI2A 1GM5A 1FIQA 2OF1A 2INPE 2WB1B 2RVLA 2JXTA 3CC2A 2JA7B 4YSXB 4J3OD 2VQEQ 2WP8J 1HZCA 4GDLB 5I4DA 4DR1Q 1KAAA 1V1PA 4RGMA 1XPRA 3APFA 4US9A 3OYYA 2PYKA 5M9OA 4DV2L 1XYIA 2D5DA 4F87A 1T9HA 1NYQA 3R3OA 1RHPA 3OMCA 5A35A 2ZJRA 5FLMG 1K83B 2XVSA 4EEWA 3OAWA 1ZKOA 1TS4A 4ITKA 1G8ZD 5AZGA 3ER0A 1CMXB 2MSED 2M9VA 3KLWA 5BYSA 2M19A 3BS1A 2M1MA 3MZ5A 3V6EB 1WGKA 3RMKC 4NNJB 4MGKE 1LT3D 1KH0A 2NMQA 1ILQA 1I4XA 1U4LA 3RYTA 4C4VA 1D2BA 1SXTA 1XMOQ 2K5PA 2XK5B 1ENCA 4G4KA 1GHJA 3FKIB 2V4LA 3KOJA 3L2PA 4BA2I 1JMLA 1T3QA 1CI3M 1TWFB 3RMHA 2L12A 1C4CA 3M63B 2MCNB 1F9SA 2JY6A 2M0XA 1YEZA 2AWTA 1UE7A 3AE2B 4P75A 4UPAA 3DVNV 1EL0A 4MZ9A 1VQCA 2KXJA 2WP9B 3MHZA 5CV8A 4GLAC 2JF5A 1V9PA 2BE5D 1TU2B 2H5XA 5CR3A 1V86A 1AWDA 3GE8C 4Q0FA 4KSLC 1HTOA 2N9XA 3SD5A 1LLRD 4X64L 3M85A 1MFWA 3ZRCA 4HIDA 4MIUA 1KFYB 4F88A 1YJ1A 2NBWB 4MSQB 3CQZH 1OEYJ 5JJKA 4TQ0A 1JC7A 4CBVA 1CQVA 4YHHQ 1TIID 1WCMH 1S3SG 2C60A 2ZW0A 4APVA 4QCLA 2JE6I 4W9GA 3TMEA 1BXTA 4HJ9A 1NYRA 4WJOA 2N49A 4A3BH 1YQBA 2MJ3A 1I4GA 1E5WA 1WJ4A 5KYLA 3GTMB 3QJZA 2GBRA 4DV4Q 3V62A 5IWAQ 4Q5VA 4IQZA 2QIEB 4M1UB 3V60A 2JJQA 3UE1A 4A6QA 2X6GA 3C3LA 1UWXA 3M4PA 2WQYB 3D8GA 3SGIA 1VQAA 1T0SC 3CC7A 1ZXHA 4AJWA 5IODA 1HXYD 2EY5A 4V0BA 2F0KA 1TWGB 3E9SA 1VQ5A 1U9RA 4H13C 4NAMA 3FC4A 2NVTB 1T0RC 2HUGA 2G4DB 5D3IB 1WXSA 2B76B 2MBBB 3CAMA 3H91A 2SDFA 1A15A 3KLSX 3KJOA 5CHFA 4ZRJA 1SSNA 5EGTA 4LWCA 2AUJD 4RM8A 5L37A 1G91A 2IDYA 2NBVB 4W9IA 2NPTA 3ZGZA 1CKNA 2K6AA 3BVZA 3S14B 1G6JA 2BA1A 2LZ6A 2SNMA 4ILWA 1GUNA 2B8FA 2JP1A 3T4AC 1R4NI 4JI4L 5JEAJ 2N1VA 4KKSA 1TS2A 2EYFA 5D3DA 1VMPA 3FPUB 3ZXRA 1R7SA 2HDEA 2H4OA 4O0AA 1KL9A 3TDQA 3VA7A 2KAJA 3APCA 3PLUA 4I6NB 3U58A 1Q12A 4H7BA 3GTPB 3JYUA 4BY7H 5JEAG 2BB6A 4IC7B 4KLKA 3RZWC 2K1BA 4ZYNA 1IBML 2UUAQ 1FXTB 1Z7TA 2J4XA 3DQVA 2HD3A 2F0FA 1EY4A 1SE4A 2NVYH 1GUOA 2ZXOA 3K7AB 4ME3A 4DK6C 1ISNA 4KGRA 3QK0A 4B0MA 1GB4A 2PNHA 3GB1A 3Q8EA 1YI2A 3OLMD 1HR0L 2EXDA 4LF4Q 2BA0A 3DBLB 1D7QA 1FR3A 4TQ1A 1N34Q 3K0YA 2IHEA 4IN3A 4DNRB 1WD0A 4LF9L 1MBYA 3C19A 4KSKC 2AKWB 4GOPB 4A3MB 2L8JA 5C0XH 1PUTA 1CKOA 5FO7B 3HOVG 1FNWA 4XQNA 3K57A 2FUHB 2L11A 5KGUA 4DUZL 1KLUD 2IGGA 2M8SA 4GIVA 5LLIA 1RL2A 4EVOA 2QCPX 2KCTA 1GOZA 1PH1A 2K22A 5M5WB 1I6HB 2I5MX 3PIO3 2KD0A 2FCMA 2SOBA 2HT1A 2D11A 4KI0A 1AW7A 2LGSA 4XGAB 1R4MB 2GBJA 5M5XB 4KD3A 3TP5A 1KOTA 3S1RH 1K9MC 1FM0D 1R4QB 1H9SB 1HE8A 2RDBC 3A4SC 4EZLA 3R7RA 1WSPA 2ZZPB 4HAEA 2PQAA 4LJOB 3QA8A 1YHAA 4GN4B 2GBKA 3X3NA 3Q3MC 4CHTB 3UQAA 1CKMA 3ZIMA 3H0GB 4LF6L 3NQIA 4FJVB 1B4OA 4IUUA 3MXUA 1E9MA 2XWJB 4AUQC 1K51A 3UI3A 1UE1A 1JQYD 3S1QB 1L4ZB 1MJEA 1C77A 2EJGC 3NENA 3P7JA 1PH4A 4HPPA 2R93G 4HMIA 1HNZQ 3KF8B 1YNND 2XEWA 1RTNA 4GU2A 4X6AH 2Y0SG 1SB3C 1NE3A 4BXXG 4CYEA 4WWNA 2V3NA 1V81A 2A68C 1IW7C 2K5NA 2RBMA 4JLCA 5DM73 3HKZG 4G57A 2F0NA 3I63C 3VR2A 3T51B 1ET6A 1PFSA 2V4IB 4RF1A 1OTCA 2NVXB 4N6EB 1SNOA 4E3CA 3Q3NC 4A20A 1Z9FA 4K5XA 1RYJA 2JN4A 3DDCB 3MFGA 3V05A 4GOPC 2K0PA 3LWUA 3STBC 3RUZA 2JA8B 4XE0A 2H88B 1CM9A 2PW5A 3AEEB 2F4VQ 4OZAA 2I5LX 5IYBG 4LFCL 3BINA 3LWEA 2JA5G 3NWSA 4K0KQ 3KF6A 4GKKL 1V8QA 3ND9A 1GUWA 2B8GA 2NYZD 3OG5A 1XQQA 2VZKB 2CHBD 3WAPA 3HEJA 4A76A 4JBMA 4JV5L 5IKCM 4QUCA 2DAJA 3AE1B 1HCZA 1WR1A 1TY0A 3ERQA 3Q23A 1Q5WB 2BCOA 1I3QB 2IHFA 4A3FB 1JROA 2KVRA 4LF5Q 1WRIA 1N61A 3Q3OC 1C0AA 3NHHA 3NTIA 1Y8RC 3KDFA 3F8TA 1R4PB 2KJHB 3D3RA 1TKYA 2BPSA 2KDMA 1PRTD 2RCNA 1FJGQ 4X66L 3K80C 5BYQA 2Q5WD 3HRDD 2PCFB 1UGMA 1VQMA 2IBIB 1NBWA 1I94L 1OQQA 1P7FA 3HOXG 2KCMA 1JB7A 4A3GG 3PO3H 3PREA 4IWQA 4C3HG 3NY5A 4CKBA 5AJ3L 3ULPA 1CZWA 3LNNA 5IGFA 4H2AA 3W5VB 4P7IA 5AJ3Q 1QE6A 5D94A 4IFDH 2KTRB 3H1UA 4KVGB 3V3XA 2L83A 2F4IA 4B3TL 1XTDA 2DN8A 4FF4A 4WQOB 4YT0B 1CZGA 2EYLA 4RHSA 1OXVA 2MH7A 1PHJA 4YTNB 2O2VA 2DJGC 1H9MA 4DV6Q 2KCNA 1SNQA 2E6XA 1JALA 4A3DG 3ZLZA 2H1EA 4REZA 4X57B 4F8CB 1TQOA 1YQ3B 4C3HB 3N9YC 3CPFA 1I4PA 5AUIA 5CV7A 2BKFA 3D31A 4OIJA 2QMTA 3AMZA 3S2DB 3Q8BA 2HHHL 4CO7A 2F0EA 3BJUA 3HFZB 1OXTA 5I6WA 1Y56A 2HHHQ 2LVPA 1TXYA 1VQ4A 4XYOA 1QVGA 1WWTA 3CCSA 3OW2A 1J5EL 2MUYA 3A9KA 4XQQA 1TJEA 4XWWA 4S3SA 1B8AA 1ENAA 1HZ9A 2FAZA 1FD6A 1O80A 2B39A 5H1SE 4WAFA 4O1NA 4GOCA 2OTJA 4GNXB 3RULA 2WXOA 5CBAE 3M3YB 1HFNA 4L8JA 1IKLA 1HQMC 3S2AA 3RD2A 4WAAA 3VYSA 4BS9A 1WX8A 1RLFA 1VCBA 3KUCB 1LTGD 1EQVA 1JT8A 1L0YB 2JX5A 3JC66 1YOVB 1WXVA 2BKRB 1E2ZA 4JI7Q 3MFYA 2E76C 3LX0A 3W2DA 4JI0Q 1YNTE 1HZ6A 2JSVX 1XTCD 1SJHD 2K5HA 3RZOB 3J80E 3HOWG 1S40A 1Y1WG 4DR7L 4DQOC 1UBIA 1H4RA 1WFYA 3GQBA 1JWSD 3PO2H 2DLBA 4R3DA 1L1OB 4R9WA 4KY5A 2HIVA 4C3JG 2WX1A 2HIXA 3N30A 1WX7A 3N32A 1E8WA 4GN5A 1CSQA 1J19A 1B2TA 2MQHA 2KQ3A 5IT9E 1EIYB 3I55A 5C4XH 4IKGA 4C3IH 1NR4A 4MNOA 3H7SA 1HA5A 1F2ZA 1Q1BA 3BWUD 3KW5B 4M0WA 1N5WA 2ES2A 4A3EG 4UP9A 2D3GA 4KK7A 3ULJA 1PFNA 1KAWA 1MHHE 4NW2A 3MHBA 3VYUA 4JYAL 3NBHB 1YN3A 1E22A 2NZ1D 5IYCG 3S16B 1V5OA 5LMUQ 2EE1A 1G2SA 2VXWA 4YIJA 4OO1H 3I9V1 5FO8B 4NB3A 3EVQA 1QCBD 2N8NA 2YTXA 3UQBA 3VRAB 2HTHA 1J8CA 1YX5B 4G7HC 2MGSA 5C4JB 2CHXA 1GVPA 4B3SL 5IY0A 1HFGA 3HRZC 2IY5B 3ZTCA 2IT1A 3PIPA 4A3EB 4IALA 1X65A 5TSSA 3NHEB 4WJPA 5FR6A 3AE6B 3HM3A 3Q3FA 1WTQA 2AYOB 3CHBD 3CMEA 5IP7H 2KQ7A 3TEZA 4DN4M 2IX0A 3SK5A 2ZPNA 4LUVA 3SDZA 1PTOC 3F2BA 4L2YA 1C7YA 4LF7Q 5LNK1 1QZHA 3I70A 2ZJPA 1PQSA 1EQTA 1FCLA 5DEHA 1M94A 4PNYA 1ESRA 1LT5D 4OIKA 5KNDA 1UE6A 3I4NB 3DWMA 4K3CA 3GTJH 1G6PA 1YNXA 3HVDA 3TUOA 3OIQA 4PMWA 5JHAA 1BCPC 3D6CA 3PIP3 3Q2AC 4F7XA 2Q8TA 3D4DA 4MM3B 5IGGA 2GOWA 2K8HA 2WU5B 4JL9A 2B2YA 3GTOB 2MJEA 2VRRB 3ONSA 2XN9C 5BMIA 2QGQA 5LMNQ 1SDFA 4FF2A 1P98A 4PS3A 2MRPA 1Y8OB 4A90A 3GOEA 3HOZG 4IURA 3V61A 3L9AX 4N8FA 3SE0A 2EYPA 1SNDA 3BYYB 2BTEA 4JI8L 1TWFH 5FJ8G 3AI5A 4U673 3U52E 4ZRZA 3ECIA 3T1YL 5CHVC 2LXAA 1NMGA 1WOCA 4DPGA 4A3KH 4NQLB 2GVAA 3E0EA 2MHJA 1VCIA 2F3WA 3LXFA 5NUCA 4QAYA 2O6VB 2A6EC 1C48A 4ZKCB 2BF8B 2HQLA 5JH5C 1ZP0B 4KHZA 4NAWA 3QG1A 5DLQE 1K8MA 4XZ4A 2EY6A 1LTTD 5EKLA 2ZXPA 3VR3A 2G3QB 3FILA 2CHWA 4M02A 4HJ5A 4OW0A 4IUQA 1EZ8A 5D65A 2DENB 5I2YA 1SIFA 2BYEA 2WAQE 2BYVE 1RM6C 5C5MA 1Z2MA 4B95A 5ELEA 1VQ8A 2X38A 3DHQA 2ZM6Q 1WXMA 4R4QA 2LMCA 4RF0A 2Z6KA 4EGVA 1O7YA 3GTMH 3QB3A 5E6JA 2FMMA 3EHVA 3A5UA 2PI2E 2R6GA 4IUNA 3MJWA 4GLSC 4OGQC 3Q6BA 2DUDA 1EY0A 1VZ6A 4DNTB 1XLOA 4KKTA 3ZJVA 1RRBA 1SJED 1FMAD 1WI5A 1VQIA 1IBXB 3FKYA 3EA6A 4RMAA 1ZOYB 5HG2A 1TWGH 2E5LQ 2MP2A 2WACA 4FDBA 1L0XB 3FVQA 4CJ2C 1SFOH 3U4VA 2A68D 2A73B 3ALBA 3PRMB 2YEPB 5TR5A 1LTSD 5DPTA 1KDAA 2UXCQ 3I91A 1GD7A 3QWZB 2WKDA 4AQYQ 2M56B 2EKEC 2N78A 3TEHB 1QUQB 1D3ZA 1NDDA 4HKZE 2J42A 1WMHA 3PS6A 2AL3A 1M4VA 3S1NB 2BYTA 3K5MA 4PYUA 4C7YA 1DD2A 4TV3A 2IX1A 1PFBA 2WLBA 1EIFA 3AECB 1UE5A 5BYRA 4I65A 2BT6A 2K8CA 1YNJC 5LL6X 4FXGC 4LMQD 5FLXL 4DR4Q 4WJ3M 3R7QA 4N9TA 3GV3A 3PV0A 2N1WA 2ZXRA 3U4EG 3EFUA 4A3CG 3Q14C 1S5CD 2KZRA 1WGHA 4DV0L 4K7SA 1T5XD 3BDCA 5G5GA 1SE3A 1LQBA 2DHZA 2EKIA 4ZCKA 2QC8A 1TTNA 2RR9A 3KUZA 1B9MA 4X3UA 3PV1A 3ETRA 2ZNVB 1ZE3D 4PK1A 3RNFC 3VH3B 1L6VA 2N7DA 2VB2X 2Y0SE 4K6DA 4IO9A 2JZPA 2J0JA 1W3SA 4A3JG 4FJZA 1G2TA 4LF8L 2PO4A 2UUBL 3GP7A 2ATWA 4KV2A 3HZXA 3VFKA 1EZ6A 3KWVA 1WZ0A 1EO6A 4X62Q 4EKUA 4B6WA 3DWQA 1P9DU 3NBIA 2E2JB 2VB3X 5HURA 3VDYA 3CKIB 1F9QA 5GROA 4EQPA 5IOCA 1EF1A 1WYWB 2WXRA 3AU4A 3CSFA 4RAUC 1WGDA 1YJIA 1QG7A 1VF5C 3GTQB 2G45B 5JEAH 3ZNID 1DJRD 2BYFA 1VQ6A 4DAYA 4UY8C 3PPAA 1QNKA 2EELA 5J2RA 4L5TA 4R4IA 1N62A 2W82A 4DF7A 1N5XA 2KC2A 1GXDC 3AV8A 5C3EH 2IO1B 2LHEA 2NR2A 3AE9B 1EU3A 5M3FB 2OJWA 5GMVA 4KTAA 4CHKA 5ELOA 1B9RA 4BBRG 2Y3AA 2NTTA 4HROA 4EUTA 3VR4A 1WGGA 3UF8A 1BVSA 4XYCA 3D32A 4EZJA 5CV5A 2N7EA 2WXKA 1SR3A 1A2TA 3WAOA 2LRWA 4ACFA 1Y14B 1WTWA 3AEAB 3ZJTA 1WTXA 3HOVH 5DCNA 3TEXA 2V1CC 2VUMG 2PQEA 3VA5A 4WJ4A 4FXKC 5CGKA 3NTHA 2J0TD 4IPDA 2JXXA 2WU2B 1R4MI 1STYA 2MBQA 3AFPA 5G2NA 3TL5A 2ACZB 1SYDA 2FMCA 4MTNA 1V5TA 4BBRB 4NXNL 3GO5A 2LXCA 4L63B 3S15H 1PMRA 4MACA 4W9HA 4MSMB 4M8AA 3A54A 5FLXc 1XJVA 4PS8A 1A0IA 4Y7NB 3AEFB 4JVZA 2MBEA 3T1HQ 2WKCA 1C4QA 1LM0A 1U0LA 2SEBD 4X3SA 4DAPA 1TBEA 4IUVA 1TZOA 5C2TB 2PKOA 2VUMB 1FNUA 4RM9A 2WYQA 2ONQA 1JOOA 1STEA 3NZSA 1U5KA 4JOIC 5E7NA 3QO2A 2NVXH 3J7ZC 2PZWA 4NXMQ 2KWDA 5AEKB 4BKSD 5BR8L 4KZCA 3Q3JA 3UI2A 2F0DA 1VQJA 2R93H 4ZRQA 1ASYA 5CYUA 5ELNA 4J6IA 3PO0A 3N52A 3SFDB 1RJTA 3HOYB 1K0SA 3J81E 3A0JA 4BXXH 1A5RA 1GO3E 2D10A 2AEHA 2JU6X 1SNMA 4AP4C 3NELA 3QCAA 3A7LA 4FO2A 4LCDE 3A1QA 2F0HA 2PTLA 4N8X1 2WB1G 1L5PA 5JPNC 3W5UB 2N55A 4DA2A 2JA7G 1Y1VB 4G11A 2LWPA 3K58A 3S17B 2R92B 4B0EA 1N36Q 5EE0A 3RNBC 1B1ZA 4IUPA 1R9TH 2OJRA 2GBMA 1EIHA 1Z5SB 2DWQA 2D9UA 2KX0A 1ZKHA 1Z47A 1KTKA 2F3IA 1E8YA 4WWMA 1TWAH 5IYBH 5M5YB 2CR5A 1EQRA 1RFKA 5JZEB 2JA5H 3CIRB 4DR2L 3TSSA 1RAXA 2KQ4X 3ITPA 2JRHA 3EJIA 2WGSA 4A93B 3WIMA 5IYDH 1QOAA 1N6ZA 3A5ZB 3SR1A 3J7AF 3CF6E 5DPRA 4KX6B 1MPEA 1E0ZA 3E0JA 4ZLTF 5IP9G 4LAAA 3CWIA 1TY2A 1VS0A 4MH8A 3FKIG 3VXWA 3I4MB 1JQ4A 4GZYC 1S5ED 4DV2Q 1PZID 3J81j 4KMUC 4UAIA 4B3ML 4DUYL 1PTOD 2GBNA 3G4SA 5CTRC 1BBXC 3BZKA 1O78A 4FHJA 1OEYA 2K1FA 4JE3B 1B70B 1LO5D 2C35B 2YU9B 2JQRB 4ZRIA 1FFUA 2MPMA 4JI3L 3HOXH 3Q69A 3I2ZA 4A3GH 4C3HH 1FVIA 4JI3Q 4OZBA 1D1KA 1SNCA 1VQHA 2IL8A 4AIMA 2E2IB 3AN1A 1EYAA 4JI1L 1EUVB 3U2SC 4LNNA 2TMPA 4PG3A 4N9PA 1BCPD 3PSEB 2VH2A 3H6NA 3BZCA 1OXSC 1GG3A 3U7DA 3ZW3A 4YCWA 1BDOA 1TKWB 2WWZA 1WTPA 2R61A 3DM3A 4GKJL 1JW9D 3QARA 3NWTA 4Z9CB 2AX5A 1PA6A 1BR9A 2RSOA 3QIAA 3S1MH 1ZGUB 4DDGD 3SK4A 1NY4A 2K50A 2CQOA 1QLBB 3I3TB 2UU9L 1G6ZA 3P2BA 4A3DH 1F0ZA 3MC9A 2CQAA 3HGBA 3EC8A 1IL2A 2IYDB 2LHDA 4OVVA 4DFAA 3M3YH 2ON8A 5IN7A 3N6RA 4JI2L 4H44C 3QIJA 1V43A 5G5HA 2HE7A 2GVBA 1LUZA 1T0YA 3AE3B 2HDLA 3B6YA 2LI5A 1CA6A 4XTCS 5DPSA 4X64Q 1QT9A 1UF0A 3DEOA 3RZDH 2N0SB 2PVGC 2OCEA 2L32A 4HDOA 1PTOH 5EDSA 3SU8X 4L5RC 4NZLB 3DBSA 2JYEA 2MEKA 2NBUA 2A6ED 3TS0A 1M90C 4GOPA 1IYUA 4C2MH 1GC7A 1D5XC 2B63B 2DBYA 4HEA1 5JVG3 1TIFA 2L76A 3IT6B 1J8IA 5EE9A 3LGJA 1DOMA 4DGZA 2JSOA 2LVQA 2Q2UA 3BU2A 3NEMA 2V9HA 2UYZB 1VQKA 2NN6H 4HJ7A 2PI2A 1YD8U 1QVFA 1KM7A 3CC4A 5C23A 1TZ1A 3NRZA 4K1RB 3GTKH 2DX5B 1B3QA 3HM6X 1LTAD 1VF7A 5KEEA 3MWYW 3H3VH 2EMSA 4P16A 4RCNA 1B9NA 2X6LA 1M8AA 3EFCA 3HG9A 3UIOB 2R7ZH 2DZJA 3P4RB 3MTNB 3HOWH 2QDBA 1Y1WH 2EYHA 1PH8A 2R3ZA 4OX9L 1K8OA 2HTME 3ZDTA 3VVWB 1VQFA 3GTGB 2F3VA 3ERSX 4QIWE 4C3JH 2H89B 3LJ3A 1QILA 2MJDA 3DOWA 4DHZE 3SHLA 3U9OA 2UWQA 4WWOA 1ZYRC 2MLBA 1X9NA 1D5MC 4HR7B 4IM2A 1XCTL 2X69A 5ELCA 3K9OB 4LNFA 4A3EH 4JI4Q 3T53B 2F52A 1V1PB 5ELDA 2G5DA 1XPOA 3KWLA 2EJMA 1C78A 2DZKA 4LNQA 1IL8A 3R8BA 4I7ZC 4DR3L 2QCZA 3B08A 3FRPB 4RKBA 5IYCH 4OWWB 1SAPA 2FE8A 2WS3B 1PRTF 4RKLA 2IWHA 1I7HA 2ZVNA 1JJ2A 2XSCA 3I4LA 4L5SA 3IAM1 1HRJA 4A3MG 3TREA 1NENB 1VZ7A 3IHPC 1YJJA 4M8MA 1YNJD 2WV6D 1XF5L 1ICFB 2C5CA 3VYTA 2FXQA 3RLOA 3J7YW 2O6VD 3PIOA 3PHXB 1PYWD 1IBMQ 1Q82C 4ME5A 5IP4D 3J81i 1C9FA 2WXGA 4II3B 4MH0E 2LRUA 1F2MA 4C4VB 1GPXA 4YTPB 1EFWA 2KA7A 3C8YA 3DVGX 1QQRA 2IZVB 1WGRA 1S72A 4YCVA 1VQOA 3AU7A 1HR0Q 2JA6B 1L0VB 4PYZA 4EFOA 3DPDA 3GTLH 1MSGA 2L05A 2KVMA 3UDGA 2FJ2A 1E2VA 2A1AA 4LF9Q 2Z6BA 1WRDB 4HWIB 3QR8A 2LUEA 4MGIE 3PF5A 2M2LA 3OMGA 3X23A 3AE4B 2N88A 2BB5A 3DBRI 1MJCA 4TUUA 3H0GG 4HJ8A 2F0PA 3ZXVA 4DUZQ 2OEOA 5DNFA 4HCNB 2UXBL 4FN2A 4NP5A 4OONA 2RDHA 2K6DB 4XDXA 4DV1L 4XT1B 1WYDA 3NK9A 2ZVOA 1FXIA 4LDTD 2ZPYA 3PSIA 5J17A 5M3MB 1UWMA 4J1MA 4X3KA 2BH8A 3N3KB 2WAQB 2QKIC 2L9HA 2PMZB 1C4PA 5C6AA 2QHOA 3FHWA 1HZAA 2VL6A 1VDVA 3HK0A 3IVFA 2LFNA 1SGHA 3HOZH 1F2YA 4HSPA 4LF6Q 3H15A 2FNJB 4US8A 1WE6A 5FJ8H 2J7QB 3K0XA 4BKGA 3CW2C 3PF4A 2J53A 4NPSA 1HNWL 2Z9HA 4AYBG 1EIGA 5KNCA 1KD1C 3KUPA 5C0XI 3S2HB 2V3SA 3CMMB 3ONAB 3HOUB 3P4PB 1XNRL 2BH2A 2JA8G 3IAYA 2LGDA 1U4MA 3IRBA 2B2UC 1TWHH 3DEPA 3K9PB 5JAVA 3AU5A 3R2TA 2KN4A 3JSVA 3A4RA 2AQ2B 2BS3B 3NJTA 4DHJB 5LL6S 3M7NA 1J9OA 4HRSA 1WFQA 4PMBA 3L54A 4LUOA 4A3PA 1NCVA 2NPTB 4IPGA 1CKNB 4RH6A 2DNCA 2WFWA 1BUVT 4DAMA 1X3GA 2KFJA 1E8ZA 4AYBB 2KANA 1Q10A 4A3FG 5GADC 2IO0B 5C44B 4RGTA 4B3RL 1K52A 1NI2A 1SRUA 3DCGA 1T6BX 4TMAB 1CFMA 2RHSB 1RTOA 4P73A 3U50C 3CCEA 4LFCQ 1E7VA 5EQ0A 4HTHA 1E8XA 1WTVA 4LLGM 4GKKQ 3VTUA 3EECA 1MD2D 3OTOL 2C5LC 1L7YA 1KABA 1ZUD2 4CDCC 4JV5Q 4CKEA 5HGQA 3F1ZA 3K7UC 2Y5PA 2MFIA 2MX2A 1YQ4B 3AH7A 4IM0A 3NS1A 3EQLC 3M7GA 1WTOA 2DAFA 4HCEA 4X66Q 4ANVA 3T3OA 1TWCH 1XNQL 4R1JA 5J18A 2OQKA 1XNQQ 1I94Q 4KY7A 4W9DA 2JYTA 4GN3B 4K2KA 1I50B 5BN4A 1IBKL 1BNZA 1WH3A 3I8ZA 3J80L 1XEEA 1A3UA 2M00A 2Q2TA 3C1EA 4A3CH 1MG4A 1WY8A 1C9OA 1GAQB 4B3TQ 1AE3A 3BVMA 5T1IA 4BAXA 3M4OH 2NVQH 1Q1OA 5IT9L 1SEBD 3E3XA 2GB1A 3T8MA 4YTMB 3WDNA 3CXCA 5C3XA 2Z0EB 2V4DA 1E7PB 4KIKA 4JWUC 4U68A 2EDGA 4A3JH 1E2WA 5BN5A 1SYCA 3HP3A 2JPHA 3W1GA 3WANA 1KRSA 5D7GA 4ZHOA 1WF9A 1YJWA 3ZYYX 2NUCA 3PTFC 2V0GA 2GRIA 1STHA 5E1FA 4USAA 2WB1E 1XD3B 1ZW7A 1V1QA 4EOYA 3UE0A 2K5QA 1J5EQ 2N9LA 3VR8B 3G71A 2LFIA 2K14A 1WYGA 3NPPA 1N33L 5CMDA 1ASZA 2HJ8A 1WVLA 1MGSA 3JAME 4LNOA 3TP7A 3RT3B 3VTWA 1LACA 2D0PA 4L6TB 2WXHA 3FEWX 4ASWC 2D0OA 4ZKBB 4H02A 2MW5A 3JVZX 5BMHA 3GD7A 1U4RA 3S9WA 1HUNA 1JRPA 3L13A 4PS7A 4BOSC 5H8YE 4BY1H 4BBRH 1BF4A 3HS0C 3KLSA 1E90A 3GDEA 1MHWC 2KWUB 1D6EC 1GUTA 3L16A 1WCMG 4XQJA 4AJYB 2F0JA 4K81A 1E10A 3MXNA 3AMUA 2FHTA 4CDEC 2M0AA 2VNUD 3TZUA 3NP8A 4DR7Q 2UUCL 2R7FA 2B2VC 2K5WA 3URYA 1YX6B 3KF6B 4ABNA 4ODGA 2D3AA 3BK1A 1XXGA 3CQZB 4BZAA 5FKAC 3J80c 2RKSA 1H9KA 2K3UA 1WCMB 1TGZB 5CBEE 5C1ZA 1B50A 4W9JA 1STAA 4FF3A 2IO2B 4A3BB 4C1NI 4G50A 4A3OA 3KDFB 4GSWA 4JYAQ 5LHY1 5IT9c 2WXIA 3K81C 2F0MA 3SK6A 1FXAA 5FR3A 4RMFA 1LTLA 1QVCA 3NXWA 1P16A 3TJPA 4JI6L 4BBSH 4F1SA 5D6JB 1B7YB 1KIXA 1NR2A 2CJNA 3FAHA 2B3AA 3NZUA 4IM3A 4X65L 1LTRD 4GNXC 4B3SQ 5GAGC 1K50A 3I4NG 3NUCA 4I6LB 4KGSA 3PUZA 2DYBA 4JWSC 3AXCA 2PLPA 3SXHA 2GLSA 4J15A 2K75A 3PGEA 1J6QA 4QY7A 2LD9A 2WXNA 4POGA 2ICIA 4FF1A 5K36G 1WJNA 4QUFA 1ZYRD 1Q0WB 4HXDA 1LTID 4S17A 1A3VA 1PXUA 5E4WC 3HUIA 3IT4B 2P5ZX 2O2VB 2RGFA 2JA7H 1A2UA 4LFBL 2CS4A 4BY7G 4BOZB 3E56A 3EGRA 3I72A 1EUJA 2RSNA 3BZDB 4HIOA 2I1JA 1SN8A 2ZTDA 2ZW1A 3CCLA 2W9NA 1JRUA 1CT1D 1PGBA 4NJCA 1X54A 5J3BA 3DBRB 2EYMA 5C3WA 2WXJA 1DZ1A 4YWLA 3ZUNA 1L1OC 3OWEB 1PH7A 5CV4A 1K83H 3L08A 1BOSA 1JJCB 2IPKD 2SNSA 3IFDA 3L7ZC 4OO1I 2L0TA 3A9KB 4WJQA 2YV5A 5G3LD 2K28A 5HGTA 1P1AA 3SEBA 2D3CA 1GC6A 2FBWB 2A69D 3E6ZX 4CGYB 4DV3L 4JBJA 4A3IG 4A3LG 5C0XG 4BY7B 1AARA 1V1OA 4MHEA 2PPBC 3TRZA 5IP9H 1PH6A 2ZT9C 3FKIH 3Q8DA 4TVAB 1N63A 2DY8A 2NVYB 5EBDA 1PH5A 4IWPA 4B08A 5FLMH 3KJPA 3CD6A 1ZPSA 2JRIB 2WNMA 3RN9C 4JI8Q 4KV6A 3DVNU 4E71A 2AWNA 1V97A 2JWZA 5JJZA 1VQDA 1GUSA 4FP5D 1FD7D 3T1YQ 3D0FA 3Q8AA 5IAAC 4K5VA 2UXDL 4HIKA 4A3IB 3B9JA 1E0BA 2PW7A 2L1BA 4OL7A 1F52A 1IBLL 4GDKA 3R2IA 4S0RA 3K6OA 2RMMA 3R66C 1N8RC 4JOIA 1Q8KA 5C4HA 3SVMA 1PV4A 1HH2P 2AL6A 2RQXA 1N32L 2L1AA 2K39A 4ZK9B 1EY5A 2JK8A 1OTRB 1IGDA 3HIZA 2A19A 3S1RB 2NCNA 2C7NB 2KUMA 1GHKA 1STBA 3IG3A 3H94A 1AFPA 5EPKA 3PRZA 5E6PA 4LNIA 3ZTDA 4DV5L 4I6PA 3PGZA 3R93A 4C80A 1HTQA 1PVOA 1KF6B 1I5FA 2L0FA 1SMYC 4DKAC 3ZDMC 3A55A 1STGA 5F2DA 4B9XA 4IPCA 3C0RB 4IOAA 1XT9B 2N9EB 1YVCA 4QF4A 1JWUD 3BG3A 4Y52H 3A7AB 3ZJUA 4DHZB 1CTMA 3JAMi 2NVTH 1C4AA 2D07B 2K8BA 3A9JA 1WIAA 1XLPA 2LJIA 1UBQA 3W5OA 2EY2A 2IGHA 4JIOU 2DGYA 3VUWA 4P71A 2KFKA 4NY0A 5HI1A 1EU4A 4A75A 4G3XB 4B9WA 3S14H 4PMCA 1EQQA 1BQQT 3NS8A 4Q2JA 2LXKA 2FFKB 1SBBB 3JW0X 4DK1A 4MTKA 2HCCA 1ONLA 3ND8A 2AUKA 2CKZB 3CF5A 1S3OA 4RGOS 1VR9A 1QOGA 2W55A 4ZUJA 3Q22A 3M3JA 1GB1A 1PZKD 4F8MA 1IHZA 4W9FA 2D2QA 4DV0Q 4ID6A 5AZFA 3A74A 2LUMA 2QEXA 1I42A 2KQSA 2VQFL 3GTPH 1KNAA 3RCZA 3SDLC 4XT3B 4ARCA 2KHJA 2IY1B 1XMQL 3Q6SA 2Z0SA 4K14A 1YIWA 2KK8A 4ZOHC 3NTKA 5GAEC 3S24A 3PO3G 3E5SA 4KKJA 5LXIB 4OHJA 2QDFA 4DR6L 2KHWB 1LT6D 3TEYA 3K7AH 4KJNA 4LF8Q 3HKZE 5DM63 5M3FG 2C9OA 1S5BD 2UUBQ 1KRTA 3OJ4B 2LGIA 1QF6A 5CV6A 4XXEA 2XGTA 4RCOA 2EY1A 3V96A 2AMCB 2O5IC 2UU7A 3H8HA 4K7UA 2INDC 2MA9B 3U7ZA 1PTOF 1SYFA 2KYWA 1F77A 3DMUA 4KKIA 4A3MH 2KCCA 1ENFA 4HJAA 2OEDA 3QHTA 5EBCA 4AH6A 1PFDA 4OEMB 1ZEQX 4AS1A 4QL5A 1YN4A 3PCOB 4ZHPA 3PO3B 1MI0A 1JMCA 4J8QA 3DVGY 4DHJD 3CCQA 1EYCA 1CSPA 3J81L 2KT7A 4NMZA 1A6XA 5M5WH 1BCPF 1P8LA 2B3GA 1I6HH 2DYOA 2G9HD 3BVGA 3FILB 2IJ0A 2Z4IA 3MAQA 2QILA 4YWMA 2I0QA 1K53A 5M5XH 3M4YA 1JWMD 3GV6A 4WURA 4KDLB 2XBBC 3DHHC 2E75C 3DWPA 1ZDVA 2LMCB 3B0AA 5KYIA 3PZ8A 4MJSB 3TBLD 4P6VF 4JGHB 1JOQA 4GDLA 2CH4A 2K52A 1U4PA 3MC0B 3H0GH 5J1ZA 2Q2HA 2VH1A 4DV7L 3C46A 3D6WA 1SLJA 4LFAL 5HFYA 2VZKD 1EOVA 3PQIA 3S1QH 1DM0B 1AZPA 3QC8B 2VZAA 5E4XA 2F0OA 1L0WA 5DPWA 4NXNQ 1K8AC 1NI3A 1PRTB 1WGYA 2ZNVC 2MP2B 4K3BA 3HOYG 2KLCA 1HQRD 3K5NA 2CCZA 2BWFA 1D8LA 2KDBA 2LASA 1WTRA 2JWUA 2XK5A 1KHIA 1QNUA 3O13A 2BDOA 2F0WA 2KOLA 3PO2G 2WX0A 2RPVA 4FLHA 3RUIB 2Z0DB 4IUTA 1Y1VG 2ID0A 3WOEA 1WMHB 1VQNA 2R92G 1Q3LA 4I7AA 1W2BA 4FADA 2CH4W 4M01A 1ESFA 5BR8Q 4DK0A 5C4XG 4BWGB 1BO0A 3TZDA 3MXPA 1HZ5A 2OOBB 2JA8H 2REXA 1YHBA 1L2NA 2ZTCA 5KHOA 3DXJC 1ACCA 1IUEA 1S1QB 2K4KA 3Q8CA 1MSHA 2MBHA 1NNXA 1UNSA 1GNUA 1VDZA 5H92C 2BOSA 3O65B 4BFRA 2RDFA 1HTPA 1U4AA 4MELA 2V3PA 3PO2B 4XDDA 3B2GA 3PRPB 1BKBA 1MG8A 4A93G 2KN5A 2E3TA 1EEFD 1HJPA 1C79A 3MVVA 4XWTA 1H9RA 3M95A 1OGWA 3L4PA 2XRQD 2YTVA 5A2QE 3AEVA 5C4XB 4URKA 1OO9B 1K3BC 4C3IB 2BQQA 1I3QH 4A3FH 1I4QA 3NG0A 1E3PA 2FINB 3DUZA 3I4MG 4P74A 4YY3L 1CZPA 4HN7A 3L17A 2E8GA 5GXGB 5IE8A 2EIFA 4YY3Q 2CW0C 2F0LA 4POFA 2F0SA 2KWCA 3H7PB 4N58A 3MA2B 4TRDA 1II3A 4DR2Q 4BBNC 2HD5B 2R2QA 1P0RA 3AE8B 4OWTB 1KDCA 1EY6A 1SYGA 2QA4A 1HNXL 4DR5L 4DAYB 2E2HB 3OJ3A 3ABVB 1XLNA 4HJKA 2KBNA 3PZDA 4XIGS 5K5PA 1BBWA 4L23A 1I4RA 5CX3A 5AUKA 4A8XC 2NZOA 3NZ3A 4B3MQ 5E3FA 2KJXA 4DUYQ 1RKNA 1LABA 4XX5A 4M8NA 1E7ZA 4K5WA 1E6EB 2L7RA 2YLMA 2YVCA 2VQEL 2CWPA 1FRRA 4P2CB 2WXPA 4EQNA 4WH4A 3F2UA 4DR1L 1F9RA 2B2WC 3IBEA 1SNPA 3S2DH 4FHKA 2F0UA 4JI1Q 1RWSA 2IGDA 3EN2A 2B2TC 2ZCCA 5GAHC 3X0WA 2G4SA 3GTJB 2Z59B 3EUB2 1X3FA 2O4XA 4UDUC 1Y69U 4HDQA 4GKJQ 5HHDG 1Z6HA 2R2OA 4KZ0A 2CVRA 3F2DA 3BDOA 2UU9Q 4A3KG 1DOYA 2YEPF 2AQ3B 1J7BA 2B63G 1WR6E 3VHTC 1KLVA 1UWVA 2PPHA 3X3MA 1X32A 2B2UA 1XMOL 3IXSA 1I35A 1FGUA 4JI2Q 1K8GA 1RFAA 2MQJA 1ROEA 2CHZA 4LK1C 1AP0A 1Q81C 4ZYSA 1PFMA 2KACA 4OXPA 4EQ5A 3M4QA 2MJ8A 5BN3A 3ZQ4A 2C7MB 3PHWB 4UHVA 1MJDA 2ZJQA 3RZOH 2DNFA 3AB9A 3RN5A 4A3KB 1C8CA 1H9JA 2KMAA 2PW9A 5AZHA 4TQUS 2CJOA 3D4RA 1A62A 3VR5A 4YWKA 5ELFA 3GZNI 4AQ7A 2F0IA 1BUIC 3VUXA 3RNAC 3A1QB 2CWAA 3ZNGC 4EX5A 4YHHL 1MVKA 3QJYA 2LXJA 2W3RA 3P20A 1UAPA 2Q2IA 4IZ8A 4FBJB 1AYFA 1S4ZA 3H09A 1H9SA 3NUHB 4FVMA 3MTSA 1XO3A 4ZQ3A 3TMPB 2GI9A 2PZTA 1RDPD 1LV9A 1FCCC 4MDKE 3W1SC 2J0KA 4WRDA 4DV4L 1KNEA 5IWAL 4KGTA 4MGZE 1SMYD 3Q24A 1ML0D 3S16H 1QWYA 1AH9A 4OX9Q 4R4CA 5T1GA 5BMGA 3P1MA 1H8CA 3P4SB 4IG7B 1T5EA 4GLXA 1X55A 5CORA 2A5UA 4NKLA 4P72A 3KBXA 2W3SA 5C4JH 3IL8A 2IY0B 4NJ7A 4E74A 2L5TA 5EAYA 2FUG1 1FL0A 1E1OA 3KF8A 3SK8A 3RLFA 1X56A 4XC2A 2J7ZA 1SFOB 1GKHA 1VD2A 2KOXA 2EQSA 2FCNA 2KNBA 2W54A 3IFWB 3I56A 4JW0A 4WIPA 1CHPD 1YBYA 2JA6G 4DR3Q 3TQYA 2MNAA 2NN6I 4FA6A 2IX3A 2PE6B 4C7ZA 1PZJD 1X3PA 4WORA 4CDFC 4HPMB 2KC1A 5T8IA 3PMFA 2F0QA 1Q46A 3H3VI 3P42A 2K5DA 3I3CA 3WOFA 1MHXA 5C4ZA 1VQ7A 3OPOA 3RNEC 3ML9A 1IYFA 3ENEA 4LK0M 1HTLD 4PZ7A 2A69C 3G48A 3I4NH 4IJHA 1IPGA 1HUMA 1PYBA 1ZXTA 5CHWA 1VQ9A 1TR5A 2K01A 5K36H 2KX3A 1FPYA 2WXMA 3V2TA 3BIID 4BBNF 5HY6A 1WXAA 4HJGE 3D4WA 2Q8RE 1SSOA 3L0OA 1CA5A 2KEEA 2OQ0A 2OHFA 3DBHB 3WAMA 5M3MG 3GTOH 4HCSA 4II2B 1QKZA 3PUVA 4DAVA 2WAQG 1UH6A 4LJPB 1WJUA 1VQEA 5C5LA 2UUAL 1DGJA 1TKGA 3GS2A 3KH0A 1BBUA 5LMNW 2GMIC 2NS5A 4LJZC 1LFDA 1UELA 5MPOA 1Q1EA 2WDRB 1F9PA 3OW7A 5C3EG 2L3ZA 3KQ4A 5J39A 4EZKA 2UXBQ 1E24A 2QF7A 4RNAA 4LF4L 4FNFA 1EWHA 4R4OA 1RF2D 4IUMB 4DV1Q 1N34L 4A4IA 4PZ6A 3HOUG 1DONA 4YL8A 2QDLA 4MEMA 4A3IH 1C1YB 1N9WA 4CJ1B 4KHVA 4A3LH 2HCIA 4EQOA 3HHMA 3DM1A 4BKSA 4K6LA 4WJWA 1SROA 4KJOA 5DAUA 1PH3A 4HCPB 5JXVA 2N3SA 1IGCA 4F7ZA 3A8IE 1CHQD 1NBFC 2KTRA 4GN1A 2FIFA 3RNGC 4HKQA 2KDIA 1CJEA 5JJIA 5C3EB 4KHPL 2RF4A 2EZVA 3I57A 2B2VA 3FMCA 1EY8A 4KHPQ 4G7OC 2X8XX 4PT5A 1GJZA 4FJYA 3ZJYC 4DXFA 1JCKB 1LM8B 4CKCA 3VQIA 3VR6A 3DLLA 4NQKE 1HNWQ 5IGBA 4JPSA 1YJNA 5C44G 1XNRQ 2WIIB 1KC8C 1JORA 4XDCA 1FO4A 4BKTA 2HDMA 3HOVB 3L0WB 2QEJC 2INNE 4QGUA 3C2PA 4R8NA 1HA6A 4ICUA 4C00A 4NJ6A 1JWBD 1A63A 1J7CA 1YITA 2KJRA 3E9HA 3DHGC 1EWCA 1UUPA 4KDIC 3UGBB 4WQMA 1TVXA 4JC0A 2GN5A 1JICA 1HNZL 1AEXA 3LDZE 1EWIA 3S15B 5IGDA 2A6HC 3VTVA 4YXDB 4QJFA 4WWPA 2LSSA 3M9BA 2F0GA 1C3TA 4GNXA 2K9XA 2KENA 3I4OA 5COYA 4HPLB 4YSZB 4B3RQ 3H9DA 3NVYA 3RD4A 4CQNA 4RFBA 2BVCA 2CKHB 1CK1A 4IDIA 4JBKA 4RGNA 2N9KA 2QSDA 2RSUA 1RD9D 1L4DB 1EY9A 3S1NH 3GE3C 4ZRKA 1K8RB 1CUKA 1EFID 1NVID 3OTOQ 2F03A 3BYTB 3L3OC 2R93B 3QX1A 4IPHA 3JAML 2D62A 4ALPA 2JUOA 5E6OA 1FGBD 3ZRFA 3NOBA 1F9JA 3KUDB 1EOTA 2EVBA 3WWVA 3U4ZA 2MO1A 2F4VL 2Y0SB 1V6EA 2BS4B 3BY4B 1LGRA 2JEBI 5I2XA 1L1OA 4K0KL 2RPQA 3CP0A 3CRLC 3KYDD 3HKZB 3VR9B 1NMFA 1TS3A 2L15A 2D3BA 1E7UA 5IYDG 4RG1A 2KHIA 2B29A
chains in the Genus database with same CATH topology
2NB0A 4RHRA 1KDBA 1PDXA 3RPFC 2CW0D 1JB3A 3PUYA 1R9TB 1BMLC 1V8CA 5J22A 2PVOD 3NBHA 4DXGA 5ELBA 3W3AA 1GJXA 1TWAB 3HVZA 2JA5B 4E6IA 5G3LF 4QMGA 3B2FA 4JBWA 2A74C 4LTUA 1SYBA 1VJKA 1ET9A 1LTBD 5I9OA 4BA1I 3LB8C 3TP8A 3EFXD 1FYCA 3Q8FA 1S5DD 1UEAB 3VRBB 1OXXK 4H0LC 2LS01 2WXFA 3P75A 3VYRA 2DY7A 5AFWA 1PGAA 1P7EA 1C76A 4ARIA 3K5OA 3HOXB 4A3GB 1EWYC 3C1FA 4IFDI 3AEDB 2I46A 2PZUA 3IAS1 2Z8LA 1DOXA 1HEZE 2F0VA 1F2LA 1TS5A 2D2CC 1LT4D 3LYYA 4HSVA 1Y8NB 2DYMA 2AWOA 1EM7A 3S1MB 3I73A 3T56B 2O5JC 4A3DB 3FPPA 3G6JB 5D14A 1FRDA 1IYVA 1F2RI 1VRAB 3NVVA 3AE7B 5IIFA 5KIXA 1PDQA 2NN6G 4A9AA 3RZDB 2WXLA 2E74C 2XNAC 1PTOB 3MP9A 1B44D 4EE2A 2L52A 4C2MB 4RWSC 1QOHA 5EE1A 2O2LD 3CU7A 4KN7C 1DOKA 1BCPB 3RFZB 1XLQA 1DYQA 1Y8PB 2G9DA 3PUWA 4TKOB 2JXMB 1VLBA 2KHSA 4XYQA 1TT2A 2L55A 3EROA 2N7JA 3GTKB 5JPMC 1OQRA 2LEKA 3J9CA 2EJFC 5KRUA 3NVWA 2WDVB 3P1HA 3AEGB 1PLFA 1UGJA 2PMVA 2R7ZB 3HOWB 2F1MA 2WXQA 1Y1WB 2XRSD 1J7AA 2MP1A 4DU9A 4C3JB 5KNBA 3QWNA 4FYDA 1IBXA 1QOFA 2IW3A 2HQEA 3A8KE 5I9PA 5C0XJ 2OT2A 2K32A 2XWBB 2EOTA 1S5FD 3QOLA 3TP6A 1VMCA 1I6VC 3OOCA 2Z4HA 1B3AA 1DOLA 3OSOA 2EYOA 2DNEA 1L6UA 2NWGA 2KEDA 2EPBA 2GA4B 1SF0A 1QJOA 1XWEA 1QOBA 4FXDA 1NSNS 5FO9B 3QOJA 2SAKA 4OZCA 4ULLA 5EKKA 1Q8IA 3P63A 1D5ZC 3MXGA 3FDTA 2K03A 3W9CB 1Q90A 3GTLB 1NAPA 4IOIE 2A5HA 3H3VC 4L1BA 3U9SA 4KN4C 3KBGA 4C56C 3BDLA 4PQXA 1EY7A 1QB5D 2BE5C 1ZXIA 4NDXA 3DWGC 3T3NA 2D5GA 1OFFA 1A3TA 1PGXA 3AE5B 1FNVA 1W6JA 5CV9A 3NVZA 3PZ7A 3BK2A 2QJLA 2PIAA 2BBCA 4MN3A 2WDQB 3HOZB 2L4NA 1JWAD 2JYOA 1JOKA 3A56A 1I4HA 3CRKC 4QIWB 3AM9A 3Q0AA 3IKJA 1TKEA 4YSYB 2L0CA 3K59A 1TWHB 4MT5A 2ICEC 2XIWA 2A6HD 4WFN3 4RA8A 4ZAIA 1D1IA 5FK9C 2RDGA 2EXZA 1IW7D 4KD4A 4K8JA 1KLGD 1TYGB 1O7ZA 1OXUA 4IFDJ 2BS2B 5EKIA 1WD1A 5EE3A 2YYZA 5ISRA 4N59A 1D4BA 4KY6A 4PV1C 2F0TA 2G1EA 2K7VA 1B53A 2BDNA 1G291 2Y5CA 2B2WA 1RCVD 4JX1C 4IFDG 1DCZA 2B2TA 3MJ5A 4D2KA 2RA4A 2E2DC 3K5LA 2Z1CA 1A70A 2KECA 1TWCB 1AZQA 1DOIA 2I2YA 1SE2A 4NAWB 2JEAI 2J52A 5JVH3 4JK1C 4GDKB 3OWFA 4HMJA 1IKMA 3I90A 1HHVA 3PUXA 2EYJA 3TEWA 2K05A 4OVZA 5FOBB 3M4OB 2NVQB 1NUCA 3KLRA 3KK7A 5A2QL 1FEHA 3NSWA 5IGEA 3AEBB 4CJ0B 4A3JB 1HPCA 1N60A 4G7ZC 3T16A 3OIPA 3TBIB 1KRHA 1VZ8A 5C3JB 1GUGA 3J7AV 2CU3A 2B2YC 1JE4A 1DXMA 4ZUIA 1YNNC 5FLXE 1EYDA 4QB4A 3W1SA 4A55A 1YMHE 3T13A 1ICWA 3MEHA 1XCQL 1STNA 2K33A 4K8IA 3NE5B 4BY1B 1XX8A 2ENBA 2NTSA 4C3IG 1SYEA 2I38A 5H8YE 1EEID 2I07B 1SIJA 3AB5A 3OHXC 2PNRC 1WXQA 4ZRPA 1RODA 2MHVA 2OXPA 3NQTA 3SFEB 4C1NK 2WINB 1YN5A 3DWAA 4OO1G 4O42A 5EPJA 5EPLA 3IFTA 1AN8A 2TSSA 1O7LA 4KKUA 3A8JE 3G7LA 4V190 1FFVA 5EJWA 4TSSA 2KMMA 5I6YA 2BW2A 3WCQA 5IGCA 4R8IA 2NBFA 2Q8IB 3TN2A 4K2LA 1F2RC 1ZDXA 5CC4A 3SR6A 1ILPA 2LKVA 1PRTC 1X3QA 4HEDA 4BBSB 2AQ1B 2K04A 4FXCA 1NEKB 1CQFA 1W6KA 4J6HA 3H6MA 1JR0D 4X3TA 5JOBA 3P4QB 4YWGG 2LY7A 1MI2A 1FIQA 2OF1A 2INPE 2WB1B 2RVLA 2JXTA 2JA7B 4YSXB 4J3OD 2WP8J 4GDLB 5I4DA 1KAAA 1V1PA 4RGMA 4US9A 2PYKA 5M9OA 1XYIA 2D5DA 4F87A 1NYQA 3R3OA 1RHPA 3OMCA 5A35A 1K83B 2XVSA 1ZKOA 1TS4A 4ITKA 1G8ZD 2M9VA 5BYSA 2M19A 3BS1A 3MZ5A 1WGKA 1LT3D 1KH0A 2NMQA 1ILQA 1I4XA 1U4LA 1D2BA 1SXTA 2K5PA 1ENCA 4G4KA 1GHJA 3FKIB 4BA2I 1JMLA 1T3QA 1CI3M 1TWFB 3RMHA 2L12A 1C4CA 1F9SA 3AE2B 1EL0A 3MHZA 2WP9B 5CV8A 2BE5D 1TU2B 5CR3A 1AWDA 4Q0FA 1LLRD 3M85A 4MIUA 1KFYB 4F88A 4TQ0A 1JC7A 4CBVA 1CQVA 1TIID 2ZW0A 4QCLA 2JE6I 3TMEA 1BXTA 1NYRA 2MJ3A 1I4GA 5KYLA 3GTMB 4Q5VA 4IQZA 2QIEB 4M1UB 4A6QA 2X6GA 3C3LA 1UWXA 2WQYB 3D8GA 1ZXHA 5IODA 1HXYD 2EY5A 4V0BA 2F0KA 1TWGB 3E9SA 1U9RA 4H13C 4NAMA 3FC4A 2NVTB 2HUGA 5D3IB 2B76B 3H91A 2SDFA 1A15A 3KLSX 1SSNA 5EGTA 2AUJD 2IDYA 1G91A 3ZGZA 2K6AA 3BVZA 3S14B 2BA1A 2SNMA 4ILWA 1GUNA 2B8FA 2JP1A 3T4AC 5JEAJ 4KKSA 1TS2A 2EYFA 5D3DA 1VMPA 3FPUB 1R7SA 2HDEA 2H4OA 3TDQA 3VA7A 2KAJA 1Q12A 4H7BA 3GTPB 5JEAG 2BB6A 2K1BA 1Z7TA 2J4XA 2F0FA 1EY4A 1SE4A 2ZXOA 1GUOA 3K7AB 1GB4A 4KGRA 4B0MA 3GB1A 3Q8EA 2BA0A 1FR3A 4TQ1A 3K0YA 4IN3A 4DNRB 1WD0A 1MBYA 4A3MB 5C0XH 1PUTA 5FO7B 1FNWA 4XQNA 3K57A 2L11A 5KGUA 1KLUD 2IGGA 4EVOA 2QCPX 2K22A 1GOZA 5M5WB 1I6HB 3PIO3 2SOBA 4KI0A 1AW7A 5M5XB 4KD3A 3TP5A 1FM0D 1R4QB 1H9SB 1WSPA 4HAEA 3X3NA 4CHTB 3H0GB 3NQIA 4IUUA 1B4OA 3MXUA 1E9MA 2XWJB 1K51A 3UI3A 3S1QB 1JQYD 1L4ZB 1C77A 2EJGC 3P7JA 4HMIA 1YNND 1RTNA 1SB3C 2V3NA 2A68C 1IW7C 2RBMA 5DM73 4G57A 2F0NA 3VR2A 3T51B 1ET6A 2V4IB 4RF1A 2NVXB 4N6EB 1SNOA 4K5XA 1RYJA 3MFGA 3V05A 2K0PA 3LWUA 3RUZA 2JA8B 4XE0A 2H88B 1CM9A 2PW5A 3AEEB 4OZAA 3LWEA 3NWSA 1V8QA 3ND9A 1GUWA 2B8GA 2NYZD 2VZKB 2CHBD 3HEJA 4QUCA 3AE1B 1HCZA 1TY0A 3ERQA 3Q23A 2BCOA 1I3QB 4A3FB 1JROA 1WRIA 1N61A 3NHHA 3NTIA 1R4PB 3D3RA 1TKYA 2KDMA 1PRTD 5BYQA 2Q5WD 3HRDD 2PCFB 1OQQA 1P7FA 4C3HG 4CKBA 1CZWA 3LNNA 5IGFA 4H2AA 3W5VB 1QE6A 4IFDH 3V3XA 2L83A 2F4IA 2DN8A 4FF4A 4YT0B 1CZGA 2EYLA 4RHSA 1OXVA 2MH7A 4YTNB 1H9MA 2KCNA 1SNQA 2E6XA 1JALA 2H1EA 4REZA 1TQOA 1YQ3B 4C3HB 3N9YC 1I4PA 5AUIA 5CV7A 3D31A 4OIJA 2QMTA 3AMZA 3S2DB 3Q8BA 2F0EA 1OXTA 5I6WA 1Y56A 4XYOA 1WWTA 2MUYA 4XQQA 1TJEA 4XWWA 4S3SA 1ENAA 1FD6A 1O80A 2B39A 4WAFA 4O1NA 2WXOA 5CBAE 3M3YB 1HFNA 4L8JA 1IKLA 1HQMC 3VYSA 4BS9A 1LTGD 1EQVA 1L0YB 2JX5A 1E2ZA 3MFYA 2E76C 3LX0A 3W2DA 1YNTE 1HZ6A 2JSVX 1XTCD 1SJHD 3RZOB 3J80E 4DQOC 3GQBA 1JWSD 2DLBA 4R3DA 4R9WA 4KY5A 4C3JG 1B2TA 2KQ3A 5IT9E 4IKGA 1NR4A 4M0WA 1HA5A 1F2ZA 1Q1BA 3BWUD 1N5WA 4KK7A 1PFNA 1MHHE 4NW2A 3MHBA 3VYUA 1YN3A 2NZ1D 3S16B 2EE1A 1G2SA 2VXWA 4YIJA 4OO1H 3I9V1 5FO8B 3EVQA 1QCBD 3VRAB 4G7HC 2MGSA 5C4JB 1HFGA 3HRZC 2IT1A 4A3EB 4IALA 5TSSA 3AE6B 1WTQA 3CHBD 3TEZA 4DN4M 2IX0A 3SK5A 4L2YA 3SDZA 1PTOC 3I70A 1EQTA 1FCLA 5DEHA 4PNYA 1ESRA 1LT5D 4OIKA 5KNDA 3I4NB 3DWMA 3HVDA 3TUOA 3OIQA 4PMWA 1BCPC 3D6CA 3PIP3 4F7XA 2Q8TA 3D4DA 4MM3B 5IGGA 2WU5B 2B2YA 3GTOB 2MJEA 2XN9C 5BMIA 1SDFA 4FF2A 1Y8OB 4A90A 4IURA 3L9AX 3SE0A 2EYPA 1SNDA 3BYYB 2BTEA 4U673 3U52E 4ZRZA 1VCIA 2F3WA 3LXFA 5NUCA 4ZKCB 2A6EC 1C48A 1ZP0B 4KHZA 3QG1A 1K8MA 2EY6A 1LTTD 5EKLA 2ZXPA 3VR3A 3FILA 4OW0A 3U7ZA 4IUQA 1EZ8A 5D65A 5I2YA 1RM6C 5C5MA 5ELEA 2X38A 3DHQA 2LMCA 4RF0A 4EGVA 1O7YA 5E6JA 3QB3A 2FMMA 2R6GA 4IUNA 4GLSC 4OGQC 1EY0A 1VZ6A 4DNTB 1XLOA 4KKTA 3ZJVA 1SJED 1FMAD 1IBXB 3EA6A 1ZOYB 5HG2A 2WACA 1L0XB 3FVQA 4CJ2C 2A68D 2A73B 2YEPB 1LTSD 1KDAA 3I91A 2WKDA 2M56B 4HKZE 2J42A 1M4VA 3S1NB 2BYTA 3K5MA 4C7YA 1DD2A 2IX1A 1PFBA 2WLBA 3AECB 5BYRA 4I65A 2BT6A 1YNJC 5LL6X 4FXGC 4LMQD 5FLXL 4N9TA 3GV3A 3PV0A 3U4EG 2ZXRA 1S5CD 1T5XD 3BDCA 5G5GA 1SE3A 2EKIA 1B9MA 4X3UA 3ETRA 1ZE3D 1L6VA 2VB2X 4K6DA 2JZPA 1G2TA 2PO4A 3GP7A 3HZXA 1EZ6A 3KWVA 3DWQA 3NBIA 2E2JB 2VB3X 5HURA 3CKIB 1F9QA 4EQPA 5IOCA 2WXRA 4RAUC 1YJIA 1QG7A 1VF5C 3GTQB 5JEAH 1DJRD 4DAYA 1QNKA 2EELA 2W82A 1N62A 4DF7A 1N5XA 1GXDC 3AV8A 2LHEA 3AE9B 1EU3A 5M3FB 4KTAA 1B9RA 2Y3AA 2NTTA 4HROA 3VR4A 5CV5A 2WXKA 1A2TA 1WTWA 3AEAB 3ZJTA 1WTXA 3TEXA 2PQEA 3VA5A 4FXKC 5CGKA 3NTHA 2J0TD 3T3OA 2WU2B 1STYA 2ACZB 1SYDA 2FMCA 4BBRB 3GO5A 4L63B 4MACA 1PMRA 4M8AA 3A54A 4Y7NB 3AEFB 2WKCA 1C4QA 2SEBD 4DAPA 4X3SA 1TZOA 4IUVA 5C2TB 2PKOA 2VUMB 1FNUA 2ONQA 1JOOA 1STEA 3QO2A 2PZWA 2KWDA 3UI2A 2F0DA 4ZRQA 5CYUA 3PO0A 3N52A 3SFDB 1RJTA 3HOYB 3J81E 2JU6X 1SNMA 3A7LA 4FO2A 2F0HA 2PTLA 1L5PA 5JPNC 3W5UB 2N55A 4DA2A 1Y1VB 3K58A 3S17B 2R92B 4B0EA 5EE0A 1B1ZA 4IUPA 1EIHA 2DWQA 2D9UA 1Z47A 1KTKA 4WWMA 5M5YB 1RFKA 3CIRB 3TSSA 2KQ4X 3ITPA 3EJIA 4A93B 1QOAA 3J7AF 3SR1A 4KX6B 1MPEA 1E0ZA 3E0JA 4ZLTF 4LAAA 3CWIA 1TY2A 4MH8A 3I4MB 1JQ4A 4GZYC 1S5ED 1PZID 4KMUC 4UAIA 1PTOD 1BBXC 1O78A 4JE3B 1LO5D 2YU9B 2JQRB 1FFUA 2MPMA 3Q69A 4OZBA 1D1KA 1SNCA 2IL8A 2E2IB 3AN1A 1EYAA 3U2SC 2TMPA 4N9PA 1BCPD 1OXSC 1BDOA 1TKWB 1WTPA 2R61A 1JW9D 3NWTA 4Z9CB 2AX5A 1BR9A 2RSOA 3QIAA 3SK4A 1QLBB 1G6ZA 1F0ZA 2CQAA 3HGBA 2LHDA 4DFAA 2ON8A 3N6RA 4H44C 1V43A 5G5HA 3AE3B 2HDLA 1CA6A 4XTCS 1QT9A 2PVGC 3DEOA 2N0SB 2L32A 1PTOH 4NZLB 2JYEA 2MEKA 2A6ED 1IYUA 1D5XC 2B63B 2DBYA 4HEA1 5JVG3 3IT6B 1J8IA 5EE9A 1DOMA 4DGZA 2JSOA 2NN6H 3NRZA 1LTAD 1VF7A 5KEEA 3MWYW 4P16A 4RCNA 1B9NA 2X6LA 1M8AA 3HG9A 3P4RB 2QDBA 2EYHA 2HTME 2R3ZA 1K8OA 3GTGB 2F3VA 2H89B 1QILA 3SHLA 3U9OA 1ZYRC 1D5MC 4HR7B 1XCTL 2X69A 5ELCA 3T53B 1V1PB 5ELDA 3KWLA 2EJMA 1C78A 1IL8A 3R8BA 4I7ZC 3FRPB 4RKBA 1SAPA 2FE8A 2WS3B 1PRTF 4RKLA 2IWHA 1I7HA 3IAM1 2XSCA 3I4LA 1HRJA 1NENB 1VZ7A 1YJJA 1YNJD 2WV6D 1XF5L 2C5CA 3VYTA 3J7YW 1PYWD 4ME5A 1C9FA 2WXGA 1GPXA 1F2MA 4YTPB 2KA7A 3C8YA 1QQRA 2JA6B 3AU7A 1L0VB 1MSGA 2KVMA 2FJ2A 1E2VA 2M2LA 3OMGA 3AE4B 2N88A 2BB5A 2F0PA 2OEOA 5DNFA 4NP5A 2RDHA 4XDXA 4XT1B 3NK9A 1FXIA 5M3MB 1UWMA 4J1MA 4X3KA 2WAQB 2QKIC 2L9HA 2PMZB 1C4PA 5C6AA 1VDVA 2LFNA 1F2YA 4HSPA 4US8A 2J53A 5KNCA 3S2HB 1EIGA 3KUPA 5C0XI 3P4PB 3ONAB 3HOUB 3IAYA 1U4MA 2B2UC 3DEPA 5JAVA 3R2TA 2KN4A 2AQ2B 2BS3B 5LL6S 3M7NA 1J9OA 4HRSA 4PMBA 1NCVA 4RH6A 2DNCA 1BUVT 4AYBB 1Q10A 5C44B 4RGTA 1K52A 4TMAB 1T6BX 1CFMA 1RTOA 4LLGM 5EQ0A 4HTHA 1WTVA 1MD2D 1KABA 1ZUD2 4CKEA 2Y5PA 1YQ4B 3AH7A 3NS1A 3EQLC 3M7GA 1WTOA 4HCEA 4KY7A 2JYTA 4K2KA 1I50B 5BN4A 1BNZA 3I8ZA 3J80L 1XEEA 1A3UA 2M00A 3C1EA 1GAQB 3BVMA 5T1IA 5IT9L 1SEBD 2GB1A 4YTMB 3WDNA 5C3XA 2V4DA 1E7PB 4JWUC 4U68A 2EDGA 1E2WA 5BN5A 1SYCA 3HP3A 5D7GA 4ZHOA 3ZYYX 2NUCA 2V0GA 2GRIA 1STHA 5E1FA 4USAA 2N9LA 2K5QA 3VR8B 2LFIA 1WYGA 3NPPA 5CMDA 1WVLA 1MGSA 3JAME 3TP7A 1LACA 4L6TB 2WXHA 3FEWX 4ZKBB 5BMHA 3GD7A 1U4RA 3S9WA 1HUNA 1JRPA 1BF4A 3HS0C 3KLSA 1D6EC 1GUTA 4XQJA 2F0JA 1E10A 3MXNA 3AMUA 2FHTA 2M0AA 2VNUD 3TZUA 3NP8A 2B2VC 2K5WA 3URYA 4ABNA 4ODGA 3BK1A 1XXGA 3CQZB 5FKAC 2RKSA 1H9KA 2K3UA 1WCMB 5CBEE 1B50A 1STAA 4FF3A 4A3BB 4C1NI 5LHY1 2WXIA 1FXAA 2F0MA 3SK6A 5FR3A 3NXWA 1NR2A 2CJNA 3FAHA 1LTRD 1K50A 3NUCA 4KGSA 3PUZA 4JWSC 2PLPA 3SXHA 2WXNA 4FF1A 2ICIA 5K36G 4QUFA 1ZYRD 1LTID 1A3VA 1PXUA 5E4WC 3HUIA 3IT4B 1A2UA 3E56A 3EGRA 3I72A 3BZDB 2RSNA 2ZW1A 1CT1D 1PGBA 4NJCA 2EYMA 5C3WA 2WXJA 1DZ1A 3OWEB 5CV4A 1BOSA 2SNSA 2IPKD 3L7ZC 3IFDA 4OO1I 5G3LD 2K28A 5HGTA 3SEBA 2FBWB 2A69D 3E6ZX 4CGYB 5C0XG 4BY7B 1V1OA 4MHEA 2PPBC 2ZT9C 1N63A 2DY8A 2NVYB 5EBDA 4B08A 1ZPSA 2WNMA 4KV6A 2AWNA 1V97A 5JJZA 1GUSA 4FP5D 1FD7D 3Q8AA 4K5VA 4A3IB 3B9JA 1E0BA 2PW7A 2L1BA 4OL7A 3R2IA 3K6OA 2RMMA 5C4HA 3SVMA 2RQXA 2L1AA 4ZK9B 1EY5A 1IGDA 3S1RB 2KUMA 1GHKA 1STBA 3H94A 1AFPA 5EPKA 4C80A 3R93A 1KF6B 1SMYC 3A55A 1STGA 5F2DA 4B9XA 4QF4A 3ZJUA 1JWUD 3BG3A 3A7AB 1CTMA 1C4AA 1XLPA 2LJIA 2EY2A 2IGHA 5HI1A 1EU4A 4B9WA 4PMCA 1BQQT 4Q2JA 2FFKB 1SBBB 4DK1A 2HCCA 1ONLA 3ND8A 2AUKA 4RGOS 1VR9A 1QOGA 2W55A 4ZUJA 3Q22A 1GB1A 1PZKD 4F8MA 1IHZA 4ID6A 2LUMA 1KNAA 4XT3B 4ARCA 3Q6SA 4K14A 4ZOHC 3NTKA 3E5SA 4KKJA 4OHJA 1LT6D 3TEYA 4KJNA 5DM63 2C9OA 1S5BD 2LGIA 1QF6A 5CV6A 4XXEA 4RCOA 3V96A 2EY1A 2O5IC 3H8HA 1PTOF 1SYFA 1F77A 3DMUA 4KKIA 2KCCA 1ENFA 2OEDA 5EBCA 1PFDA 1ZEQX 4AS1A 1YN4A 4ZHPA 3PO3B 1MI0A 4J8QA 1EYCA 3J81L 4NMZA 1A6XA 1BCPF 2DYOA 2G9HD 3BVGA 3FILB 2IJ0A 2Z4IA 3MAQA 2QILA 1K53A 3M4YA 1JWMD 3GV6A 4WURA 2E75C 3DWPA 1ZDVA 2LMCB 3PZ8A 5KYIA 4P6VF 1JOQA 1U4PA 3MC0B 5J1ZA 3C46A 3D6WA 5HFYA 2VZKD 1DM0B 1AZPA 5E4XA 2F0OA 1NI3A 1PRTB 1HQRD 3K5NA 1WTRA 2JWUA 3O13A 1QNUA 2BDOA 2F0WA 2KOLA 2RPVA 4IUTA 2ID0A 3WOEA 1Q3LA 1ESFA 4DK0A 4BWGB 1BO0A 3TZDA 3MXPA 1HZ5A 3DXJC 1ACCA 1IUEA 3Q8CA 1MSHA 1UNSA 1VDZA 5H92C 2BOSA 2RDFA 1HTPA 2V3PA 3PO2B 4XDDA 3B2GA 2E3TA 1EEFD 1C79A 3MVVA 4XWTA 1H9RA 3L4PA 2XRQD 5A2QE 5C4XB 1OO9B 4C3IB 1I4QA 2FINB 3DUZA 1CZPA 4HN7A 5GXGB 2CW0C 2F0LA 2F0SA 4N58A 3MA2B 4TRDA 1II3A 3AE8B 1KDCA 1EY6A 1SYGA 2E2HB 3ABVB 1XLNA 4XIGS 5K5PA 4L23A 1I4RA 5AUKA 4A8XC 3NZ3A 5E3FA 2KJXA 1RKNA 1LABA 4K5WA 1E6EB 1FRRA 4P2CB 2WXPA 4EQNA 4WH4A 3F2UA 1F9RA 2B2WC 1SNPA 2F0UA 1RWSA 2IGDA 2B2TC 3GTJB 3EUB2 2O4XA 4UDUC 1Y69U 5HHDG 1Z6HA 2CVRA 3BDOA 1DOYA 2YEPF 2AQ3B 1J7BA 3X3MA 1X32A 2B2UA 3IXSA 1ROEA 4LK1C 1AP0A 4ZYSA 1PFMA 2KACA 3ZQ4A 2MJ8A 5BN3A 2PW9A 3AB9A 4A3KB 1C8CA 1H9JA 4TQUS 2CJOA 3D4RA 3VR5A 5ELFA 4AQ7A 2F0IA 1BUIC 1MVKA 3QJYA 2W3RA 3P20A 1UAPA 4IZ8A 1AYFA 1S4ZA 3H09A 1H9SA 3NUHB 4FVMA 3MTSA 1XO3A 4ZQ3A 2GI9A 2PZTA 1RDPD 1LV9A 1FCCC 4WRDA 1KNEA 4KGTA 1SMYD 3Q24A 1ML0D 1QWYA 5BMGA 5T1GA 3P1MA 3P4SB 1T5EA 5CORA 4NKLA 3KBXA 2W3SA 3IL8A 2L5TA 2FUG1 3SK8A 3KF8A 3RLFA 2J7ZA 1SFOB 2W54A 4WIPA 1CHPD 2NN6I 2IX3A 4C7ZA 1PZJD 1X3PA 4WORA 5T8IA 3PMFA 2F0QA 3P42A 2K5DA 3I3CA 3WOFA 1MHXA 5C4ZA 3OPOA 4LK0M 1HTLD 2A69C 1HUMA 1ZXTA 1TR5A 2K01A 5K36H 2WXMA 3V2TA 3BIID 4HJGE 3D4WA 2Q8RE 1SSOA 1CA5A 2KEEA 2OHFA 4HCSA 1QKZA 3PUVA 4DAVA 5C5LA 1DGJA 1TKGA 3GS2A 4LJZC 5MPOA 1Q1EA 2WDRB 1F9PA 3OW7A 3KQ4A 5J39A 2QF7A 4RNAA 4FNFA 1EWHA 1RF2D 1DONA 5LNK1 4CJ1B 4KHVA 2HCIA 4EQOA 3DM1A 4K6LA 4WJWA 4KJOA 5DAUA 5JXVA 1IGCA 3A8IE 1CHQD 4HKQA 3I57A 1CJEA 5C3EB 2EZVA 2B2VA 3FMCA 1EY8A