1JWSD

Crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDGMFNWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 72
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwsD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwsD02
1I4RA 1RD9D 1PZKD 4OHJA 1XTCD 3BVGA 4RGTA 1SE3A 2ICIA 4O1NA 5ELCA 2O2LD 3SEBA 1B44D 2NTTA 2TSSA 1PTOC 5D3DA 5ELFA 1B1ZA 1PZID 5ELBA 4NZLB 1JWUD 1CT1D 3R2TA 1RF2D 4C56C 1DYQA 1PRTF 1EFID 5FKAC 3R8BA 1AW7A 2XN9C 1PRTC 1EEID 1SEBD 1YN4A 1XXGA 1YN3A 4RHRA 2R61A 1M4VA 2SEBD 1BCPB 4ZYSA 4K6LA 4RHSA 3BVZA 4Z9CB 1I4HA 1CHQD 5I4DA 3KLSX 2RDHA 1PTOB 1F77A 2G9HD 2XRSD 1ET6A 1PTOD 1UNSA 1LT6D 1LTID 1LTTD 1V1PA 1ET9A 1I4GA 1I4QA 1TY2A 4BWGB 1JCKB 1HA5A 1S5ED 1KTKA 1D5ZC 1ESFA 1LT4D 1PRTB 4TSSA 1D5XC 1SBBB 4DXGA 1FNUA 1KLGD 1JR0D 1HTLD 1S5CD 3W2DA 1D5MC 1BCPF 1EEFD 1LT5D 1GOZA 3MFGA 4RGNA 1HXYD 4L6TB 4RGMA 1LTRD 3O13A 1SE4A 1TY0A 1D6EC 1TS3A 5ELEA 1LT3D 3MC0B 1EU3A 1SE2A 2RDGA 1HQRD 1S5DD 1V1OA 1FNVA 1PYWD 1TS2A 1RCVD 1TS4A 2AQ1B 2Z8LA 1FD7D 4DXFA 2NTSA 3R2IA 2WV6D 2QILA 4RGOS 1QILA 1UUPA 1RDPD 3EA6A 1ENFA 4L63B 1S5BD 1EWCA 1FGBD 3EFXD 3CHBD 3BVMA 2CHBD 1PTOF 1JWMD 2IPKD 1CHPD 3DWPA 1BXTA 1T5XD 1KLUD 1SJHD 2J4XA 3OWEB 5FK9C 1CK1A 1DJRD 1PZJD 1AN8A 3TSSA 3V05A 1G8ZD 1LTBD 2XRQD 1LLRD 1BCPC 3GP7A 1TS5A 2XNAC 1PRTD 1SXTA 3BZDB 1JWSD 2AQ3B 1V1PB 3BYYB 1L0XB 1EU4A 5ELDA 2IJ0A 3URYA 1JQYD 4UDUC 3DWAA 4RFBA 1I4XA 1PTOH 1LTGD 1LO5D 4RH6A 1I4PA 1MD2D 1S5FD 1LTAD 1CQVA 1STEA 1FNWA 2AQ2B 1LTSD 1SJED 3BYTB 5D3IB 2QEJC 4RCOA 1BCPD 5TSSA 1L0YB 1YN5A 3DWQA
chains in the Genus database with same CATH superfamily
2QW7A 1F2YA 4PMCA 3VYRA 2IGHA 3IFWB 4P16A 4BBSH 4MHEA 3WIMA 2GBRA 5IP4D 3CC2A 2MP2B 5J17A 1SE3A 5C4XH 3SEBA 4KJNA 1PH3A 5D3DA 2INPE 1BNZA 1B1ZA 1BBWA 2IGDA 2CFMA 3NUHB 3S17H 1WRDB 4JPSA 4PYUA 2NPTA 2GVAA 1W3SA 4ANXA 1YNXA 5EPJA 3JAMc 3K59A 4QCLA 3W5OA 1MG8A 4DR6Q 1KHIA 3S1MB 2B8GA 2EYLA 2OQ0A 1BUIC 4J6IA 4L5TA 2WAQE 4WJ3M 1B9NA 3TBLD 3CF5A 4FXKC 2OWOA 4H44C 2LGSA 3CSFA 1NDDA 2OEOA 4NQKE 5G3LD 2F0JA 3UIPB 4HCSA 1E5WA 3KOJA 3M4OB 4R3DA 1V97A 1ZYRC 1IW7C 3HFZB 2ID0A 2HD3A 4RCNA 4C3JH 2KLGA 1VQJA 3C1FA 4C3HH 4YY3Q 3NHEB 3ZYYX 5CMDA 1OXSC 2E2IH 4OX9L 2AUKA 4R4CA 5CHVC 4UP8A 3BDCA 1WM2A 3CQZB 4AYBG 4DXGA 1FNUA 4FO2A 1JR0D 5AJ3Q 4DHJD 3TREA 3KLSA 1HTLD 4PV1C 3GE3C 5LMUQ 2KVZA 1NR2A 5ISRA 1EEFD 2V4LA 3TEZA 4MNOA 1U4AA 4NW2A 2JSVX 2KC1A 2WHIA 4M8NA 1EY6A 1R7SA 2KDIA 3CRKC 4B3RL 3AE5B 4LF9Q 2CHZA 5IYDG 1CMXB 2JVCA 1ASYA 4TV3A 3ULPA 4DHJB 1IHZA 2ZTEA 1AE2A 3MHBA 1SIJA 1WZ3A 1EU3A 5CC4A 3IAYA 5DLQE 3AE7B 1STAA 2JUOA 3F1ZA 2PO4A 5JVH3 5FO9B 1HPCA 1PYBA 4P75A 2K8HA 2J7ZA 2L32A 1TIID 2NN6I 2CW0C 3HHMA 3VRAB 3VH4B 2K50A 3I3CA 2KCMA 1PV4A 5DM63 2ZT9C 2LI5A 3NQIA 3APDA 5CGKA 2NN6H 5LXHA 5DNFA 5IGFA 5BMHA 2BS2B 4CHKA 4DV0Q 2MJDA 3I7FA 1I94L 4LF6Q 1YQ4B 3AYHB 3CPWA 2LRWA 4K1RB 1YZ6A 5JEAG 2B2UC 4U673 2KZRA 1P1AA 5HHDG 1HQMC 2GBMA 4FJVB 2QKIC 3DVGY 2JZ3B 4YT0B 3IBEA 3GP7A 3VR3A 3RD2A 3MJWA 4NMZA 3PIP3 2JA7B 2XSCA 4LUVA 4V0BA 3BZDB 2D3GA 4FXCA 3DVNV 1O7IA 1JMLA 1C48A 2KDFB 3NOBA 3KWVA 2R2QA 3AH7A 4IFDJ 5IODA 1QKZA 2N0SB 1KAWA 2L3ZA 4L2YA 1HR0Q 3J81c 1J9OA 4A93B 4HLEA 2ZZPB 4AJYB 5LMUL 3ER0A 3QOJA 1WJJA 2VH2A 4JI4L 3QK0A 4PS7A 2JJQA 4QIWB 2ZCBA 1B7YB 1CKNB 1U4PA 4B3RQ 3PF5A 2ZXRA 3E0EA 4MM3A 4IJLA 2A73B 4C3IG 3D6CA 1FR3A 4BY7G 3CPFA 3NS8A 1ONLA 4G7HC 2DNCA 4OWWB 2B2YC 3KYDD 1NNXA 2R3ZA 4JOIC 2O2LD 3AECB 4ZKCB 4W9KA 2EY1A 4WQOB 1HNXL 1L4ZB 1J0GA 5AFWA 3FPPA 2C7HA 2KQSA 1XPRA 1SSNA 4FNFA 4BA1I 4FN2A 5E6OA 3I5JC 3EGRA 4HVBA 5JEAJ 4HKQA 1EUVB 5G3LF 3A8KE 1A70A 4RMFA 1XXGA 2QHOA 4JLCA 3OAWA 4ZYSA 3GZNI 3N20C 2YTXA 4C1NI 3NEMA 3PIOA 4ZRQA 2F0EA 3WDNA 1FIQA 1K51A 2QA4A 2LASA 1X6OA 3WAMA 2KJ6A 4S0RA 3GTLB 3A5UA 4EKUA 1QF6A 1WRIA 3ZRFA 1UNSA 2RSNA 2BS3B 1GVPA 3KBXA 3D4WA 1WYWB 4JW0A 1WJ4A 2XWBB 4BBRB 1WCMG 2B76B 3C0RB 4NXNQ 3HIZA 1VCBA 5HI1A 1AZPA 3V6EB 4OGQC 2MWSB 2KUMA 1VRAB 1J7CA 3N1YC 1V8CA 3L4PA 2LWPA 4KVGB 4PT5A 3RN9C 3SVMA 5C1ZA 2OXPA 2K14A 2M56B 3TBIB 1FXTB 3IAM1 1OEYA 1Q8KA 1JJCB 3NQTA 5LMNL 3I55A 2XK5A 5JJZA 4ZHOA 1D5MC 1KLVA 4DR2L 4RGNA 3S15B 5IYCH 2WAQB 1PFNA 1RWSA 1WGRA 1IXRA 3CRLC 1PXUA 4RGMA 4AYBB 2ZCCA 4OELB 3PHWB 1Y8PB 1N5XA 5J1ZA 1D6EC 4BY1H 1HEZE 4IPHA 2SNSA 1WMHA 1SNPA 3E5SA 1JRUA 3U58A 1ROEA 2F3VA 2Z6KA 3PO3G 4DR7L 5BO4B 1K53A 3D32A 3DBHI 1DOXA 4A3GH 1HQRD 3FP9A 3U4VA 2JRHA 1I6VC 5IYBG 2A5HA 1BO0A 4HK2A 2WXRA 3S1RB 3T51B 4A3CH 4X57B 1LXDA 4A3MG 1YNNC 2KANA 5C5LA 1EZ8A 4NPSA 3HOZH 4RF0A 3BVMA 3Q3MC 1H9RA 3SK6A 1NYQA 4OZAA 1JALA 3D8GA 3I56A 2INDC 4A3FG 3CWIA 3EJIA 2XK5B 1D1KA 2FHTA 2HT1A 2B2VA 2JA6B 1QZGA 4FHJA 2B2TC 4KX6B 4K8JA 3RZFA 2F0HA 1UBQA 5C4HA 4F7ZA 5LL6S 3BIID 3HOWH 4J6HA 4KJOA 2BGFA 5IGEA 1STHA 1XPUA 3R3MA 2XTIA 4BBRH 1JWSD 1MJEA 1YOVB 3SK8A 4MN3A 1VQDA 4CJ1B 4MJSB 4DAYA 4YTNB 2M9VA 1W6KA 3DWAA 3K5LA 2D0PA 3HOVG 5C4XB 3GOEA 1WCMH 3M3YB 3IAS1 1XWEA 1PTOH 4JQWC 5G55A 1LTLA 1WX9A 3ENEA 1A62A 4XDDA 3AFPA 1RM6C 4K7SA 5LMNQ 1P8LA 1S3OA 2NVXH 2Q8RE 2M4NA 1B3AA 2MJ3A 4DHZB 1N33Q 3BZCA 2PCFB 1E24A 2HCIA 3EQLC 4EX5A 1Y1WH 1EQQA 1Q46A 1RLFA 2D10A 4KV6A 5IYCG 1NJIC 1SB3C 3W1BA 1YNJD 1VQBA 1RD9D 1I3QH 2XVSA 3U50C 2E2JB 4LJPB 1PZKD 3QJYA 4OHJA 2KMAA 3N32A 3R66C 1DOLA 3SGIA 1MSHA 3VR2A 5FJ8G 5HG2A 3VUWA 2MFIA 5L95C 1ZEQX 4HCPB 2J0MA 2BTEA 2NTTA 3CCUA 3Q6BA 4JWSC 4PZ8A 3LWEA 2L0TA 5M5YB 3WOEA 1Z7TA 3B08A 1OEYJ 1HNZL 4C56C 4MM3B 1VQPA 4PK1A 5M5WB 4KMUC 1YJ1A 1QOHA 2JA9A 1WF9A 1V81A 1CA5A 4Q0FA 2EVBA 2JWUA 2IO1B 4PZ6A 1EY7A 3CP0A 3LNNA 1QOFA 1C3TA 4KY6A 2HIXA 1N8RC 5KNBA 3DM1A 3TP5A 1QJOA 3IL8A 4IUUA 4JCVE 3OG5A 1C76A 2PVOD 2Y0SE 2L15A 3D6WA 3PV1A 2Z4HA 1SN8A 1X3GA 3GO5A 4KI0A 1ZUD2 3A54A 1I4GA 4C00A 1XTDA 3U30A 4UPAA 5C44H 1D1IA 5GADC 4EUTA 4QY7A 1MPEA 1LUZA 4P71A 4LUZA 5IY0A 5J22A 2WXQA 4C7ZA 3D4RA 2MBOA 1DGSA 4FF4A 2QGQA 1O78A 3MTSA 3ETRA 5HGQA 3ZTCA 5HGTA 1F0ZA 2A69D 3HOXB 1KRTA 3VTWA 4C7YA 3J7AV 4RWSC 2JA8B 3SFDB 4YWLA 4YHHL 1IL2A 3K9OB 3T53B 3J9CA 1IKMA 2KVRA 3QIJA 2DZIA 4H2AA 3PT2B 4FULA 1JMCA 2XNAC 3I3TB 2K03A 3UE0A 3VYUA 4EE2A 1NMFA 2C9OA 2KQ7A 4AUQC 5M5XB 2KHSA 2QILA 5EE1A 1UUPA 2HDEA 1L1OA 1EUJA 3RFZB 1WTWA 1LM8B 5ELOA 5CHWA 4J3OD 2CHBD 2LXKA 1TWGB 4JI1L 3GDEA 3I4OA 4XT3B 4NJ7A 3F2CA 2EMTA 4CDEC 2L55A 3I70A 4KY5A 3RZWC 1PH2A 1T0YA 4N6EB 1KF6B 2C5LC 1UWMA 2BVCA 2ZPNA 4NAWA 4CYEA 4FA6A 2LXCA 3A7LA 1DJRD 1IBML 1AH9A 1WTPA 3ZXVA 3VTUA 4F8CB 4JBMA 3QO2A 2K05A 5LXIB 2O4XA 3PZ8A 4X3TA 4HJKA 2R92H 3RD4A 3RLOA 4W9JA 1QOBA 4US9A 4G50A 4BXXG 2DGYA 4MDKE 2GVBA 3P7JA 2NBUA 3HM6X 2UXBQ 4RFBA 3KW5B 2NVYH 2NWGA 5D65A 1EYGA 2UYZB 3WAPA 5C44G 2MGSA 4BOSC 1K73C 1CQVA 1FNWA 2K5DA 4IUNA 2FCQA 2A1AA 4JG2A 4KGSA 4IM0A 3M4PA 4KK7A 2PPHA 2O6VB 3J81j 3NVZA 4ZUJA 1A5RA 1IBXB 3NHHA 1HTPA 2ZXOA 1V43A 1WD1A 1EL0A 2L52A 1KRSA 1MHWC 2VY3A 1O7LA 4G11A 3I73A 5ELCA 2UU9L 2HIVA 1MKHA 3JAME 5T1IA 2JEBI 4CDDC 1O7ZA 2ES2A 5M3FH 5BN3A 2L0FA 3OHXC 3KWLA 3P4RB 5JJIA 1AFPA 2K8CA 4OXPA 3WANA 2J0KA 2UUBL 1ZKHA 1QVGA 2CJOA 3MP9A 1XLPA 2XN9C 1CKMA 4B9XA 3PREA 4DHZE 4HPMB 4RHRA 2VUMH 1R4QB 1M4VA 1U4RA 2EQSA 3ZJUA 1I50B 1PH5A 1V49A 1HZBA 4GU2A 4PS3A 2RDHA 2G9HD 1FXAA 2X8XX 1RFAA 1E6EB 4ID6A 1YX6B 2B63B 4RMAA 2BYTA 4YWGG 2LGXA 4DBGA 3VUYA 2VUMB 4RG1A 1PH6A 1GAQB 4DV5Q 2QCZA 1A2TA 4LNKA 1JJ2A 1S5ED 3H94A 4HDOA 3VUXA 4B0EA 4ANWA 1PRTB 3FRPB 2X6LA 1XMQQ 5C3EG 4JE3B 3NBHB 5M9OA 1MHXA 3N52A 3RMHA 2I5LX 1HTQA 2EZVA 5MPOA 1BCPF 3MFGA 1N33L 2B8FA 3TN2A 3PRZA 2B63G 3Q6SA 3H0GG 3U9SA 4G57A 4A6QA 3RR5A 4K7WA 2IDYA 2WX1A 2V4DA 3CF6E 3PCOB 1TWAH 5FLMH 2K6QA 4GKKL 2PE6B 1F9QA 4OWTB 1K8OA 2RDGA 4EQ5A 2O6VA 2KOLA 2BDNA 3PUVA 2OEDA 4D2KA 4DNTB 1FD7D 5EKIA 4Y7NH 4A3BH 1FPYA 1XLQA 2K1BA 5J3BA 2PKOA 4LFBL 1FCCC 3TEHB 2JSOA 3KLWA 3Q8EA 1TR5A 3DHHC 1PTOF 1SRUA 4JI8L 4DF7A 3ZDTA 2HJ1A 3U2SC 2NR2A 4WJNA 1H9SA 2MBBB 1AWDA 4YWKA 4X66Q 1E2VA 2HJ8A 2G45B 5FK9C 1YNJC 1A6XA 4XYOA 4YCUA 4A3EB 1E8YA 1XPOA 1BDOA 3LX0A 3I4MH 4ZRZA 4X64L 3W9CB 4ZOHC 1PRTD 3UDIA 3IRBA 3GTKH 2GBNA 1XCQL 5IGCA 1AZQA 3AU7A 2FFKB 1JRPA 1VZ8A 1JC7A 3C46A 4X62L 1VQ8A 3MC8A 4GDKA 2LD9A 1HCZA 1LTGD 4E6IA 4RH6A 2V3SA 2KAJA 2IWHA 1L1OB 1XQQA 1VQ9A 3NVWA 3RI7C 4HROA 2DZMA 1PGXA 4DK0A 2SDFA 1GNUA 1PH8A 2IX1A 3KF6B 3PF4A 3ZO5B 3PMFA 4R8IA 4I6LB 3Q3JA 4IUPA 3KLRA 1AEXA 1PFBA 5GAHC 3PO2H 2M8SA 4EOYA 1OXTA 2JE6I 3WWVA 3H0GB 2ICIA 3PO2B 4TKNA 2KXJA 1T9HA 1TWCB 2DJFC 1A3UA 2EY5A 3D0FA 5ELBA 1F9RA 2C7MB 3F2BA 3SE0A 1CT1D 3UE1A 1HA6A 1B3QA 1ZDXA 1YNND 3ZVVA 2MSED 4A3FB 1EFID 1A0IA 5CV8A 1BF4A 1KXLA 2DAJA 2LSSA 3R7QA 1IYVA 1QT9A 1YN4A 4IPDA 2DYMA 1L0VB 2I38A 4XXEA 2EJFC 3J7A5 3KQ4A 2ON8A 4IJHA 5M5XH 1KAAA 4JYAL 1I4HA 1CHQD 4KY7A 3WOFA 1SYEA 4H02A 4K8IA 4LWCA 3Q69A 3ICEA 3DBRI 2OT2A 4LFCQ 1V9PA 1V1PA 4DR2Q 5G5GA 2UUCQ 1HNWL 3V6CB 3EFCA 2N8NA 2RQXA 5IWAL 2G9DA 2NZOA 4S3SA 3L17A 2UUAL 2A6HD 4EQOA 4FJYA 4GN5A 3HKZE 2X69A 5CBEE 2OOBB 3QB3A 2WXMA 3I57A 4ZDVA 1TTNA 3F8TA 2D3CA 2X6GA 3RZDB 4LFAL 3NPPA 2IHEA 2XIWA 1V5TA 4RA8A 2VQEQ 3NS1A 2DENB 4E71A 1V86A 1FRDA 2CHXA 4BOZB 1X3PA 2B2VC 2B29A 3FC4A 5CV6A 5EAYA 2VQFL 1TWAB 5M3MB 1WM3A 3EC8A 4DR1Q 3AB9A 2CKZB 1FNVA 1DZ1A 3H3VI 5KEEA 2F03A 1EQVA 3DXJC 4A3PA 1SLJA 4GKJQ 3NZSA 3OOCA 4OO1G 3EA6A 1ENFA 2PZWA 2PZUA 1YITA 1E22A 3C3LA 1SMYD 3EFXD 3TJPA 3NJTA 3M4QA 3EROA 4DK6C 1ZXHA 3PUXA 2L9HA 2Q8TA 4ZRIA 5C4ZA 1KL9A 2VRRB 1WVLA 3RNUA 4A3DH 3MC9A 3H1UA 5C4XG 3DOWA 2MNAA 2D07B 2WU5B 1VQMA 2B3GA 2BB6A 3TSSA 3CW2C 2ZEQA 3K7UC 4J15A 3T9LA 3OSOA 1LLRD 4A3DG 2JA6H 2F0QA 1IL8A 4ME3A 2AL6A 3HRDD 2LJ5A 2PNRC 2V9HA 5JZEB 4A3IG 2BQQA 3PIPA 1XD3B 3Q0AA 2RKSA 4BBNF 4XZ4A 2ZJRA 2JQOA 4LF4Q 3WALA 1PVOA 2L0CA 4MGKE 3BU2A 1S72A 1E8XA 4AJWA 1LTAD 5FLXL 4A3KH 1G91A 1BBXC 3Q22A 4B3TL 5E1FA 2UU7A 4M00A 2QEJC 2JZPA 2PE9A 3TP8A 1EY8A 1D2BA 3PGZA 4MJSA 4A3GB 1O7YA 2HUGA 2K5QA 2KX3A 1N9WA 1VF5C 4B95A 4A55A 2A5UA 5E4XA 3AEGB 1M1KC 2HTME 4W9LA 4CJ0B 2Y0SB 4IOIE 4DUYL 1GHKA 3HZXA 5T8IA 1J8IA 2N88A 4K0KL 2A6EC 3I72A 2FCSA 2WWZA 1CJEA 3PSEB 4ITKA 4R8NA 2C60A 3A33B 3JAML 2MBHA 1STBA 4LNFA 1KM7A 5KHQA 2JWZA 4KHVA 1N32L 2ZNVC 5T1GA 1KOTA 2OJRA 4DV6L 2KOXA 3GD7A 1WTRA 3X23A 4ASWC 2W9NA 4FXDA 3NTIA 5NUCA 3I2ZA 2MP1A 3ND9A 3P75A 4DV2L 2NN6G 4DUZQ 1QWYA 1D8LA 3FDTA 4JI7Q 4RM8A 1D3ZA 1HNZQ 2K01A 3FHWA 2CS4A 1STGA 1YI2A 3AEEB 4BKSA 4BBSB 2WDTB 5BYSA 2LKVA 4KKIA 2A4ZA 4QF4A 1MIUA 2ZNVB 4YTPB 2F4VQ 2L8JA 2NBFA 1WXSA 2FAZA 1KDBA 3QJZA 3ZQ4A 2KHIA 3U4ZA 2MW5A 3D31A 1L1OC 1D5ZC 2YYZA 1K0RA 1BR9A 4TSSA 4LF4L 2LVOA 4AP4C 4HJ5A 3RZOB 2A74C 2CQAA 3SR1A 3H09A 4HTHA 2ENBA 1VQ6A 1UD7A 4HAEA 4QGUA 3PRMB 1JT8A 4QAYA 4LUOA 3DUZA 4L6TB 2HDLA 3DHQA 4K6DA 4FXGC 1IW7D 4HSVA 2CU3A 1SNMA 5C5MA 1XLOA 2CWAA 1Y8OB 5IP7H 4X3SA 1WFQA 3T1HL 1PH1A 5C3XA 1GUOA 4N9PA 5DPRA 3VTVA 1SYCA 3UDGA 1EF1A 1DXMA 1UE7A 2NVTB 2LHDA 2AQ1B 4AIMA 3KF8B 3KK7A 4HN7A 3P1HA 4DR5L 4MIUA 3QIAA 2Y0SG 5GAEC 3S1QH 1M90C 1I94Q 3HOXH 2NYZD 4DV4Q 4LF6L 2KO3A 1RTOA 3C8YA 3G7LA 5HKHA 1JB7A 2G3QB 4HKZE 4KDIC 3CC4A 2I2YA 3CAMA 1Q81C 1NR4A 3HKZB 1QVFA 3JVZX 3V62A 1Q82C 4IFDH 1NVID 1B4OA 4DR4Q 1F1HA 3Q14C 2NZHA 4DV3L 3T13A 2R7ZG 3RUIB 2LMCB 2V0GA 4PG3A 4OVVA 5JHBA 4BY7H 1VQGA 5AZGA 2KDMA 1KLUD 2B2TA 3NSWA 3E56A 1ZW7A 3M63B 3QWZB 4MEMA 4WWPA 1EFWA 1CK1A 3D4DA 3K7AB 2R7ZH 2W3SA 3MXPA 1UZXB 4A3FH 1GG3A 2DUDA 3KDFA 4W9GA 5M3FG 1TS5A 3MFYA 4DV0L 2YVCA 2DAFA 2FXQA 4JI4Q 3DBLB 2R93H 1XMOQ 1R4NB 4TQ1A 3V61A 3NZUA 1GD7A 1RRBA 2BA1A 2Q5WD 2WB1E 4K5WA 3KYHC 1WSPA 4PMBA 1Z9FA 1I4PA 2BKFA 5IGDA 4DWFA 4HJGE 1Y69U 1C4AA 3NG0A 4JBWA 2LXJA 3AB5A 3GV3A 3MWYW 3AMUA 1K83H 2WXPA 3FILA 1GJZA 3PO3B 1L0YB 3HVZA 4LLGM 1UGMA 5JXVA 3MVVA 4WFN3 3T1HQ 1MJDA 2C7NB 3PZ7A 3RZOH 2E2DC 1JROA 4HPPA 4L8JA 2CCZA 4K2LA 2ZTCA 5LL6X 5EKKA 2AEHA 1CFMA 1YQBA 4DV7Q 1Y1WB 3VQIA 1NCVA 1WOCA 3HS0C 4GKJL 4DV4L 4ZRKA 4ZRJA 3GTJB 3GTPH 1FYCA 3H9DA 1A15A 2DNFA 1JWUD 3H91A 1B70B 4PS8A 1CA6A 3KBGA 3ONAB 2NVXB 1IPGA 3MTNB 1WE7A 4IWOA 1DYQA 1TWCH 2XEWA 4GDLB 1E0BA 4NPNA 1WCMB 3M3YH 4ABNA 2LY7A 3Q23A 4C3HB 4PZ7A 1NENB 1PFMA 4KSKC 4X65Q 2C9WB 2E5LL 2CU1A 1A3VA 5D6JB 1TGZB 2EMSA 5EBCA 3U4EG 2O5IC 4A3CG 2L1BA 3J80E 2SOBA 1XEEA 4A3MH 3V96A 1PHJA 1HUNA 1ILPA 4KGTA 4NKLA 1LTTD 4N8FA 2LGIA 2PTLA 1AYFA 4IUQA 1N36L 3ZJYC 2M19A 3AU4A 3AE6B 4JI2Q 1D5XC 1SBBB 1PLFA 3PTFC 1S40A 4GOPC 4NXMQ 4KHPL 3HKSA 1SE9A 3U7DA 1LT5D 1K3RA 2LZ6A 3PGEA 5D7GA 4EZKA 4HEA1 3J80c 2H89B 4KGRA 3VR8B 1E2WA 3AULA 3V3XA 1LM0A 1UE1A 4GZYC 1BMLC 1Z5SB 3AEAB 2KEDA 5JJLA 3W5VB 3GV6A 3N9YC 3L10B 4HCNB 2KKCA 2NMQA 5ELEA 3B2FA 5CR3A 1ZP0B 1EY0A 1SAPA 2MQHA 1GUSA 3ZNHB 1RCVD 2G5DA 1HZAA 2KN4A 1WH3A 4UP7A 4A93G 1G291 3KJOA 3AQQA 1Q1BA 5M3MH 2KA7A 3J81E 3CC7A 1M94A 2HHHL 2WXGA 3APCA 3LDZE 1WTXA 4DDGD 1FGBD 3AM9A 1GJXA 2FUHB 3UI2A 3A0JA 2KEEA 2BYFA 2KCCA 4M8AA 2KC2A 1SYDA 1BVSA 3U52E 4ZHPA 1FVIA 3PO2G 2IPKD 4IUMB 3VFKA 4A3DB 2JYOA 1BXTA 1KD1C 2DBYA 1GB1A 2N9XA 2PW9A 4XX5A 2FCNA 5FOBB 1H9MA 3L16A 3GTMB 2K28A 2EY6A 1BCPC 3H7PB 2FIFA 1SNOA 1PGBA 2GI9A 3O65B 3BY4B 1V1PB 3URYA 4LF7L 2PEAA 3DDCB 3VYSA 1YMHE 3K0YA 2LFNA 4OX9Q 1YQ3B 2AL3A 1E90A 5GROA 5EJWA 5IGGA 4AS1A 2OJWA 1YJNA 4RF1A 1Q12A 2WLBA 2H88B 5IIFA 2K75A 5GMVA 4XQJA 3SDLC 1TXYA 2KHJA 1TIFA 1WR1A 3S24A 1VJKA 3ZNGC 4OONA 2FMCA 3TS2A 1MVKA 3I4NB 3MXGA 1SF0A 2Z0EB 3HOUB 1WFYA 5GAGC 2QIEB 1XNRQ 2V4IB 1VQ5A 4A3OA 4EQNA 4KIKA 3NP8A 5C4JH 2XBBC 1XJVA 2WU2B 1WJ6A 1NEKB 3Q3NC 2JK8A 4CBVA 4FADA 1J7BA 4M8MA 3A9KB 1PUTA 2H4OA 3G6EA 3L13A 1PTOC 4GN4B 4DKAC 4GMVA 3TEYA 4IOCA 3CCVA 3DEOA 2R92B 1RIPA 1QG7A 2WB1B 2QEXA 4JI3Q 3ZRCA 2OTJA 2CVRA 2MLBA 4WJOA 4JL9A 2KECA 2XWJB 4TQ0A 4B6WA 2Y5BB 3UINB 3SU8X 5E6NA 2HD5B 2K9XA 1MSGA 2UUCL 2SAKA 2EIFA 1SSOA 1RL2A 3BWUD 2BS4B 2OQKA 2ZXPA 3A74A 1ZDVA 1RAXA 4M0WA 5E3FA 3KUDB 1ESRA 2DLBA 1DOMA 3A56A 2VUMG 2NBWB 1Q0WB 4WWOA 3E6ZX 3M7GA 4M0WB 3NBIA 1EF5A 3CU7A 2IHFA 1K52A 4OO1H 4YTMB 3RNCC 1HHVA 1CSPA 1EY4A 1EIFA 4OO1I 1HR0L 1H9JA 1FMAD 1OXUA 1P7EA 4EZJA 2K5PA 4EVOA 3W2DA 2F0NA 4LNNA 2YU9H 4F1SA 2NCNA 1C4CA 2BA0A 3A9KA 5IWAQ 4JWUC 1LTRD 1WI0A 3G4SA 1VQKA 3P4PB 4NP5A 3BS1A 1EIHA 3J81i 4R4OA 5C6AA 3BDOA 3CMEA 3H3VH 3RT3B 5AEKB 2N3SA 1NBFC 1EIYB 4IM2A 3DBLI 3W5UB 1VDVA 1HJPA 1HZ9A 2ZM6L 3TP6A 3BINA 3SR6A 3DWMA 3S2DB 1J8CA 2Y5CA 1UF0A 1VLBA 3LGJA 1YHAA 2IX0A 1JJGA 4HIMA 2KHWB 3L08A 3FAHA 5JJKA 3SD5A 1N61A 2F0IA 1S5BD 2WFWA 3VR4A 3OTOL 1QVCA 1E1OA 1K9MC 4LF5L 4KTAA 2E74C 3I4MB 2ZVNA 1LYLA 2F0LA 2NZ1D 3N6RA 1JWMD 4ILWA 3TZUA 1ENCA 3MHZA 4GLSC 4O42A 5FLXc 1EOTA 3ML8A 2F3IA 3Q8CA 5C2TB 4HXDA 2JA8H 2AX5A 1HZCA 2EYHA 2E5LQ 2L76A 2KENA 1MBYA 2UXBL 1E3PA 3RNGC 5CV9A 1LTBD 1N6ZA 2LHEA 2K3UA 5LLIA 4HEDA 2ONQA 3RLFA 3W1SC 4R9WA 3K5NA 4V190 3BYYB 2YEPB 4WWNA 3PHXB 1FO4A 2N9EB 1UEBA 3I4NH 2N9LA 4DU9A 5C44B 2KFJA 2IY0B 3AEFB 3R3OA 5EE3A 4F87A 2INNE 4BKSD 1I3QB 1QNKA 4XYQA 3WAOA 4QB4A 3BYTB 3R93A 1PGAA 1UH6A 2WXFA 1ZKOA 2F0FA 3TMEA 1QUQA 1SFOH 1UBIA 3BK1A 3EECA 3RN2A 1AP0A 1PDQA 3HP3A 3GTGH 2MJEA 1P98A 3B0AA 1FM0D 3QOLA 3B1LX 2ALYB 3L3OC 3DWQA 2EYPA 3A55A 4UAIA 2N4FA 4WRDA 2UUBQ 1KNAA 2CQOA 4PNYA 3Q3FA 1ICWA 2DZJA 2ZM6Q 1VMCA 5L37A 4DXAB 4IN3A 3PO0A 2LEKA 4POGA 2CR5A 4IPGA 3UQBA 2E2HH 4MH0E 3DQVA 2F0DA 2BE5D 2Z0SA 1WTVA 3GTOH 4IG7B 4IKGA 4BKGA 4EFOA 4DNIA 3ZLZA 1TT5B 1WX7A 2SNMA 2MHVA 1V9JA 2JQRB 2VXWA 2Y3AA 4DK3C 1I50H 5FLMG 1F2RC 1A2UA 4DV5L 3ZDMC 4A3MB 2YTYA 4FF3A 1WXAA 4WAFA 3I4LA 4NDXA 3BK2A 2JA8G 4JI6L 1VQNA 1WJUA 2KWVB 3HOXG 1CZWA 2MRPA 2D3BA 4F8MA 4YCWA 1GUWA 2PW5A 1IYUA 5CBAE 5C0XH 2L1AA 3K81C 4H13C 4DUZL 1L5PA 3CCRA 4WIPA 4URKA 4C3IH 1I42A 4A75A 5EE9A 4B3SL 4YL8A 3ZJTA 3A7AB 1ESFA 2RA4A 1GHJA 5CTRC 2WB1G 3T8MA 4I7AA 3STBD 1AARA 4LJOB 3QHTA 1Z2MA 5GQOA 1YJ9A 1Q1OA 1DOIA 2F4IA 1QZEA 5J18A 1GOZA 2WINB 3HG9A 1VQFA 4DR5Q 4CKEA 1G6JA 3S16H 1TWGH 2ZTDA 5AZFA 3S2DH 5EPKA 5IT9L 3AE8B 5IO9A 2L05A 1TVXA 3M4YA 4BBRG 2LVQA 4ANVA 2MEKA 3MC0B 2R93G 2BB5A 1LV9A 4JI8Q 3DVGX 5DPSA 2QDFA 4UY8C 2PPBC 4IUVA 2VZKD 1WTOA 2MO1A 4FJZA 4KZ0A 1F9SA 1N34L 1LFDA 3DBHB 4WJQA 3OLMD 1WGYA 2FBWB 4EGVA 5TR5A 4LNQA 3PUYA 2B2WC 1WGGA 1ISNA 1HUMA 2Z9HA 3GTLH 3CCEA 1ZE3D 3V60A 4DR3Q 4L5QA 4KKUA 1B9RA 2MPMA 3IHPC 1Z6HA 3PQIA 3GTJH 1XMOL 1T5XD 3GTPB 4H0LC 4X62Q 2FJ2A 3OIQA 2K33A 5H92C 1NY4A 1WYGA 1AN8A 4B0MA 3V05A 1XLNA 1G8ZD 2WDQB 4Q5VA 4DR4L 2O2VA 4W9HA 1Y1VH 2RPQA 1SXTA 1C9OA 5JOBA 3T4AC 1G51A 1UWVA 3PO3H 2JA6G 3J7AF 4GS3A 2EJMA 4ZLTF 3RZDH 2UXCQ 3FEWX 2ZJDA 1MG4A 2KJHB 4MACA 2LXAA 2F0VA 3AXCA 4HJAA 5CORA 1HFGA 2J0JA 1EWIA 3AE2B 1JOQA 1IUEA 3HOYG 1FGUA 5C23A 1TWFB 1KH0A 5EGTA 1EYAA 4A76A 4DAMA 3P2BA 1T3QA 2IZVB 1ZGUB 3NE5B 3KDFB 2HTHA 3BVGA 1T5EA 2F0OA 5M5YH 3HOYH 3OPOA 3RYTA 2FMMA 1SYFA 4QQBX 5IKCM 3E9IA 2R7ZB 3JSVA 3DCGA 4WQMA 3PUZA 4ICUA 2EXDA 1Y1VB 2LGDA 3CCLA 1Q10A 3R2TA 1I5FA 2PMZE 1X56A 1P7FA 3M95A 3QC8B 4UP9A 3TEXA 1VCIA 1VD2A 1AW7A 5C3JB 2K8BA 4KIKB 1EEID 1SEBD 2L5TA 3CCSA 3T56B 1J5EQ 2CKHB 2LFIA 3ZNZB 3G6JB 2KTRA 4ICVA 5L83A 1NI2A 1TWHH 4YSYB 4G0NB 1OFFA 2KQ4X 1PTOB 2XRSD 3KYCD 2M2LA 2C5CA 2RR9A 1B8AA 2I07B 4U68A 4XQNA 2EYJA 1YIWA 4AQYQ 2F0UA 5M3MG 1LTID 1ZOYB 2WNMA 5EKLA 1ET9A 2JXXA 3JYUA 2VB2X 2D5DA 4BWGB 5IN7A 1JCKB 4X65L 1IBLQ 5LMNW 2L12A 1XO3A 2BH2A 2FUG1 3IXSA 1TZOA 2AUJD 3TUOA 4CHTB 1P3QU 2ASQA 2V1YA 3MA2B 3QR8A 2ZJQA 3CCQA 1S5CD 1GKHA 1VQ4A 4GDKB 5IAAC 1L4DB 1HNWQ 2N9KA 1Y56A 2I0QA 1OTRB 2R6GA 2WP8J 3M9BA 2MX2A 3OMGA 1YEZA 2PNHA 2JP1A 2FINB 1TJEA 4ZRPA 2GN5A 1DOYA 5C0XJ 2KDEB 3SK5A 1LT3D 4M02A 4A3EH 3EVQA 4CKBA 5I6WA 4KHPQ 2D3AA 3AN1A 1SE2A 4BXXH 3VRBB 1RFKA 1SNQA 4LJZC 3LB8C 2VQEL 3VDYA 2WV6D 2JA5G 3PPAA 4DAYB 4ODGA 4A3KG 1QILA 3D3RA 1Y14B 4C3JG 1F2LA 1N60A 1NI3A 4JBJA 4RAUC 3VAWA 2WP9B 2L7RA 2KWUB 4DDID 4X6AH 3DBSA 3RNAC 2DX5B 3RLNA 2ATWA 3NWSA 4BY1B 1KJTA 1YVCA 4EZLA 1GB4A 5IA7A 1I35A 1Z47A 2BBCA 4QL5A 2BDOA 4IW0A 4HRSA 1J5EL 3DWPA 4LF7Q 3DEPA 1EYCA 3CCMA 5FR6A 4X3KA 1SIFA 3Q8AA 1X3EA 2J4XA 1STYA 2R2OA 2H5XA 1GC6A 3KVFB 3U9OA 4JI5L 1I7HA 3SHLA 2JA7G 3MXNA 1SR3A 2CH4W 2E2HB 1SNDA 2RD0A 1D4BA 2E2IB 3HKZG 4C4VB 2A19A 1KDCA 2ZJPA 1I4XA 1PFDA 2E3TA 4IDIA 5KHOA 4YSZB 3J80L 5AJ3L 5CHFA 4BBNC 2WIIB 1XMQL 4A3KB 2EXZA 3I8ZA 1NYRA 4JI0L 1OGWA 1T6BX 2BYVE 1HZ6A 1QCBD 5I2YA 4GLXA 1WX8A 2Q8IB 3VXWA 4MGYE 1G2SA 1VMPA 1PQSA 5TSSA 1GUTA 3T16A 1HE8A 4IUTA 2GOWA 5JH5C 1N32Q 4NB3A 1K28A 2RSUA 3AE3B 2K39A 3VR9B 1H9KA 3AEDB 4JOIA 3AEBB 4B9KA 5IP7G 3J7YW 3LXFA 3MAQA 1K83B 2O5JC 3VA5A 1KABA 4HJ8A 4S17A 4TUUA 4LFBQ 1PRTF 4MELA 2P5ZX 5E6JA 2JN4A 3F2DA 5JVG3 3LJ3A 2OTLA 3J81L 2F4VL 2R61A 2R93B 2SEBD 1WY8A 2KQ3A 3K9PB 5G2NA 2HCCA 3T3NA 2MO0A 4DAVA 3NTHA 4YIJA 1U4MA 2YV5A 5I4DA 4HR7B 3ERSX 2F0PA 5IYBH 1F77A 3JW0X 1ET6A 2R7DA 3K5OA 2MJ8A 4JI5Q 2W54A 1EOVA 1TT2A 2I46A 4ZUIA 1OQRA 1K3BC 1IBXA 1MI2A 5IE8A 4DV2Q 3UF8A 3SXHA 2WS3B 1NTGA 2K5WA 2G1EA 1HA5A 4JI7L 2HQLA 2PMZB 5IP9H 1GUGA 2BW2A 4KLKA 4E3CA 3P4SB 3GTQB 3HM3A 2NVYB 4OL7A 1L6UA 3NXWA 5C3EB 2DY7A 3J80i 3EIVA 4L1BA 3OWFA 4LW1A 1FL0A 1CM9A 1TY0A 4O2DA 1L2NA 4BVUC 1E7ZA 3TQYA 1VQEA 4G7ZC 3M3JA 4P1CC 4K5VA 3Q2AC 1OXXK 2KYWA 1TS3A 2FNJB 2I5HA 1PFSA 1TKWB 2IY5B 4P1BC 2WXJA 1S5DD 1V1OA 3GQBA 4OVUA 1TS4A 4WAAA 2Z8LA 3ULLA 1QZHA 5DPTA 2YEPF 1ZXTA 4B3ML 3OIPA 5FO7B 4J8QA 2FIDA 4XGAB 4LK0M 1MHHE 2F0SA 2QDLA 3AI5A 3W1YA 2EYOA 2WXHA 2RVLA 2RMMA 1V6EA 3UDXA 2M00A 3KFUA 4TMAB 3AU5A 2ASBA 3NRZA 4IFDI 4P72A 4POFA 2N78A 5FJ8H 2NS5A 4NQLB 5BMIA 5CV5A 3CQZH 1G6PA 3S2AA 2PW7A 3ZXRA 2EYFA 2XRQD 5EDSA 2J0TD 4FYDA 4HMJA 5JPNC 1D7QA 1XNQQ 2JU6X 2J53A 2WXLA 3HGBA 1E8WA 3A1QA 4K3CA 2K25A 5BMGA 2B2WA 2MHJA 4PYZA 4UDUC 4IURA 4QUFA 3X0WA 1WTHA 4W9CA 3OYYA 3BDLA 5C4JB 3PZDA 1H8CA 2V3PA 4K81A 4IQZA 1X32A 1T0QC 2HQEA 2H1EA 2RHSB 1DGJA 2KN5A 4Y7NB 1SMYC 4A3BB 3RULA 2VZAA 3E9SA 3K5MA 2GBKA 2KLCA 5C0XG 4DR7Q 3H6MA 4BZAA 4KD3A 4GKKQ 3V2TA 1V5OA 5DPWA 4DR6L 3NELA 4DR1L 3A4SC 1PMRA 3ZUNA 2Z4IA 1Q5WB 1VQAA 4TRDA 2W82A 3NVYA 2QC8A 1J6QA 4PMWA 2B39A 5ELFA 4NZLB 4B3MQ 1TQOA 1QB5D 3N1ZC 1RF2D 3FPUB 4NJ6A 3H7SA 2E6XA 3TZDA 4DQOC 1K8AC 3APFA 3ZNID 3HOVH 4M1UB 1QLBB 4KHZA 1C4QA 3GTGB 2CHWA 1LQBA 2RDFA 1W2BA 1ILQA 1OXVA 2GBJA 2GLSA 3KUZA 2IO0B 3STBC 4DV7L 3ITPA 3B6YA 4DV1L 3F2UA 2B3AA 4WJWA 1C4PA 4OZBA 3K8AA 2EOTA 1YNTE 3M85A 5EQ0A 3P42A 1GC7A 5FLXE 2JYTA 1X54A 4NAMA 1PTOD 2EE1A 1NMGA 3CIRB 4BKTA 2IGGA 3ABVB 4CDFC 3U8ZA 2AWNA 5HURA 1YJWA 1JWBD 4MSMB 1ZYRD 2BF8B 2IX3A 1QE6A 3DMUA 3WA0A 3I90A 1JE5A 1EZ6A 3W3AA 1I4QA 1TY2A 2IW3A 2PQEA 2Z1CA 4F88A 4MGZE 2WDVB 4ZCKA 3MXUA 2IY1B 4KN4C 2NVQB 1KLGD 4L23A 3NBHA 1GUAB 4JI0Q 2BOSA 4ACFA 3ULJA 2CJNA 2PQAA 4ZKBB 1WYDA 2O6VD 4XQQA 3I91A 4GOCA 2PVGC 1SGHA 2R92G 2B2UA 3ERQA 2I1JA 2BPSA 1P16A 1SNCA 1F2ZA 4KKSA 2KJRA 1XX8A 4XTCS 2IT1A 4JK1C 4DUYQ 1KQSA 3VH3B 4K0KQ 4N58A 4DXFA 5JPMC 1U9RA 3L7ZC 1QOGA 1FEHA 2D2CC 3PSIA 3K58A 3ZW3A 4BAXA 1EWHA 1K0SA 2NVUI 4GN1A 1PH4A 1EYDA 4G3XB 4GIVA 5HFYA 4CGYB 4C3HG 3CHBD 3NK9A 1R9TH 5FR3A 3T3OA 3SDZA 1FRRA 5IOIA 3FKIB 2DWQA 4OIJA 3A1QB 3UQAA 1EQRA 1G6ZA 1IGCA 3IFTA 2UXDL 2Z6KC 2HHHQ 4LDTB 3IFDA 3FKYA 4EQPA 1TKEA 1YJIA 3QA8A 3QCAA 1TBEA 4GDLA 1F2MA 3VA7A 1YIJA 2K6AA 3OMCA 1K8GA 3DPDA 4L5SA 4GLAC 1EQTA 1U0LA 4LAAA 2BT6A 2KWCA 3IT6B 4RKBA 3W1SA 1L0XB 1FJGL 5ELDA 3A8JE 2B2YA 3I9V1 1X3FA 1BBUA 3RUZA 4IWQA 2KCNA 3QG1A 4R4TA 3C2PA 4JGHB 2CH4A 5H8YE 5C0XI 1QNUA 2NUCA 4K14A 2EJGC 3RMKC 1S1QB 1JQ4A 1S5FD 4K5XA 2KFKA 2A69C 1C8CA 1JICA 3S1NH 1IYFA 3PV0A 5D3IB 1BUVT 4C1NK 4WH4A 5K5PA 2MUYA 1VZ7A 2LUMA 1HNXQ 4RCOA 1V80A 2JF5A 3VR6A 2PLPA 3TL5A 1CKOA 4MTNA 2KT7A 1Y8NB 2YU9B 3HRZC 2OF1A 1KC8C 2UXCL 2LS01 2JYEA 2VQFQ 2YTVA 5AUIA 1DONA 1IGDA 4KKTA 4LMQD 4O1NA 1OQYA 2WXNA 2F1MA 2N9PC 5BYRA 5C3EH 5H1SE 2N49A 5FO8B 3VYTA 1T0RC 1LABA 2M0AA 3VR5A 4FHKA 2K4KA 1H4RA 4A3IH 4JX1C 1RJTA 3R8BA 2REXA 4JI1Q 3RCZA 5JEAH 4DV3Q 3S14B 1X9NA 4A3LH 5IOCA 4NXNL 1VZ6A 1JB3A 1CUKA 4JPBW 4JI3L 1VQLA 1IBMQ 1EWYC 3UGBB 2A68C 4Q2JA 3S2HH 4NJCA 3GZNB 4WORA 4W9FA 2JA5H 1S4ZA 4FVMA 3CMMB 4DK1A 4ARIA 2F0WA 1FJGQ 3IT4B 4GSWA 2K5NA 3K6OA 3FKIH 4IFDG 2NVTH 4YWMA 1JWAD 4KDLB 3P20A 4DN4M 3L9AX 5M5WH 4ALPA 2D5GA 3ECIA 3UDFA 1KFYB 1MGSA 1WI5A 1WE6A 2QCPX 5IYDH 2E75C 4LDTD 4EEWA 3AE4B 4HSPA 4FBJB 1PA6A 2Q2HA 4REZA 4A90A 2MA9B 2XGTA 1IBLL 1JOOA 2JA7H 1F52A 1VS0A 2LMCA 2KD0A 3I4NG 4ZQ3A 2KX0A 4FDBA 2K6DB 1IKLA 1VF7A 2ZW0A 2N1VA 3WCQA 5I9OA 1H95A 1B53A 3P1MA 3QARA 1L0WA 3H6NA 5GXGB 4I6NB 4JBKA 3ONSA 4L63B 3CKIB 3N1XC 3QAQA 3CXCA 3CD6A 2PMVA 2D62A 2Y5PA 3DM3A 5IT9E 1V8QA 2RCNA 1PH9A 3E0JA 5E4WC 1ICFB 2RPVA 2A6ED 3NZ3A 4JIOU 1RKNA 2F0TA 4DV1Q 2JZZA 3W1GA 3E3XA 1MI0A 5D2MB 3E9HA 2D0OA 2VW9A 1UAPA 3HOWB 2WXKA 2ZPYA 4GNXB 3OWEB 3H3VC 1XCTL 2W3RA 5KNCA 4A3LG 3ZJVA 2RSOA 3PUWA 1IZ6A 4XT1B 1I6HB 1GPXA 2FCMA 5EE0A 1HFNA 4AQ7A 4OVZA 5DEHA 2R7FA 4CDCC 4XWWA 2MCNB 5EBDA 3PRPB 5LHY1 4C80A 2A8VA 2JT4B 3S16B 2M1MA 2OHFA 4KV2A 4GOPA 4HWIB 4LK1C 4MSQB 3NTKA 4A3GG 2RBMA 4KKJA 1ML0D 5K36H 5DM73 2G4DB 1LO5D 4NY0A 1CI3M 5A2QE 2K0PA 2ICEC 1CQFA 1C1YB 1MD2D 4TVAB 2GRIA 2YLMA 3AV8A 2KWDA 3I63C 4IWPA 3JAMi 4NNJB 3HK0A 4BY1G 1EY5A 1X3QA 2NBVB 3A9JA 2L83A 5M3FB 1R4MI 3N30A 3VHTC 3ALBA 1TKGA 2BWES 4C3JB 2RCFA 1C78A 4JV5L 1V1QA 1XTCD 4HMIA 5C3WA 2IL8A 3AFQA 3Q24A 4DGZA 1O80A 2EYMA 4GLVB 1KIXA 4N8X1 1K8RB 1KDAA 1JORA 2TSSA 5BN4A 3OW2A 1VQ7A 1Q7YC 3HOZG 4KZCA 1ENAA 1E10A 4OW0A 3HOWG 1EY9A 2K5VA 3P4QB 4QUCA 1I6HH 1X55A 2QJLA 1IYJB 1C79A 4HPLB 4R1JA 4GNXA 3S17B 2Z6BA 4PQXA 3GTOB 4ANUA 2VNUD 5CX3A 1OO9B 1HR0W 3S1RH 4X66L 1SE8A 2KJXA 2RF4A 3TRZA 3A9JB 4CKCA 1RODA 1M8AA 2BH8A 4X64Q 4A4IA 1TWHB 2KK8A 5KIXA 1V2YA 2N1WA 4NAWB 4BBSG 4GN3B 1S3SG 5D94A 3OJ4B 2BYEA 1BKBA 2EDGA 1E7UA 2LVPA 1OTCA 3G71A 1JOKA 4I65A 5ELNA 1EIGA 3S15H 3LYYA 4ME5A 3QX1A 1FD6A 3TMPB 3A8IE 5KNDA 4FLHA 4W9IA 4GNXC 3CCJA 1Y1WG 4B3TQ 2MQJA 2KACA 3MEFA 2DNEA 3JSVB 3P63A 3SK4A 4GXBA 3FILB 4P2CB 3O13A 2WXIA 2EPBA 4B3SQ 1C7YA 1N34Q 2HE7A 1Y1VG 1B9MA 1XNRL 4JV5Q 1RHPA 3T1YL 2WXOA 4IOAA 4IO9A 1TZ1A 2N7EA 2D2QA 1PYWD 2IO3B 4OWXB 3A5ZB 4WWMA 3S1QB 1CTMA 4IPCA 3KF8A 3PIO3 2W55A 5BR8L 2ZVOA 1W6JA 4RGOS 3K0XA 3B9JA 1A8VA 4J1MA 4ARCA 2V1CC 1ZPSA 4TKOB 1GM5A 1E9MA 1SDFA 4A9AA 2FE8A 4DV6Q 3MJ5A 3EN2A 2KCTA 3AE9B 4MT5A 3CSTA 3K7AH 1RTNA 4DAPA 2RGFA 1CSQA 3PLUA 4LNOA 2AKWB 4BY7B 2O2VB 3PVLA 4WURA 2E8GA 1QQRA 1PZJD 1WR6E 2CW0D 4YCVA 4WJ4A 4A3IB 2K32A 3NVVA 3HOYB 2WKDA 5KYIA 4GGQA 3RNFC 3DBRB 4AWJA 2I5MX 4W9EA 3DWGC 1G2TA 3MEHA 3GE8C 2AQ3B 5HY6A 1DD2A 1RYJA 2N7DA 3H15A 1E0ZA 3J7ZC 1JQYD 4MZ9A 1CKNA 4LF8L 3HEJA 4P6VF 3TIXA 4WJPA 1NSNS 2DYOA 3RNEC 1TU2B 3OW7A 1UELA 4NXML 1UE5A 1STEA 4A93H 2JEAI 3KJPA 2JA5B 2EY2A 4HIDA 2ACZB 2AQ2B 2M17A 4KN7C 1X65A 4US8A 4G7OC 3GB1A 2KMMA 1UEAB 4DPGA 1C0AA 3B2GA 1Q1EA 1NUCA 4M01A 1YN5A 5E7NA 3M7NA 4OEMB 2F3WA 5I9PA 1FFUA 3T1YQ 2BKRB 2DZKA 1IBKL 3A4RA 4RGTA 1SYGA 3EUB2 2ZW1A 2K7VA 1GO3E 2WAQG 2Q2TA 1B2TA 4A3EG 1VDZA 3BZKA 4IM3A 2L00B 1Y8RC 5BR8Q 1PZID 3C19A 1NAPA 2EKEC 2A68D 2DN8A 5IGBA 2LJIA 1Q8IA 2PI2A 4LCDE 4QMGA 2INCC 3OTOQ 1L7YA 1WJNA 3LWUA 4C4VA 1WGKA 1ZXIA 2C35B 1C9FA 1YN3A 2AYOB 3L2PA 1LGRA 3ML9A 1KNEA 3DLLA 4QIWE 1BCPB 1SROA 2DY8A 2F0KA 2LUEA 4KD4A 4K6LA 4Z9CB 4N9F4 3MXNB 2KDBA 2J7QB 1YHBA 3KLSX 4LTUA 1R9TB 4G4KA 3M4OH 2JY6A 3EHVA 2BCOA 3S1NB 2M0XA 4HDQA 2Q2UA 2JXTA 1LT6D 1LACA 4HCEA 3L0WB 2EKIA 1Q86C 1UWXA 1YJJA 1L6VA 2K04A 3S1MH 1P9DU 1E7VA 1LT4D 1L2FA 4QJFA 5KGUA 5JHAA 3ZGZA 4APVA 3AMZA 3HOZB 1PYSB 2KTFA 4HJ7A 4II2B 4USAA 3K80C 3Q3OC 1GXDC 1CZGA 2QF7A 4HJ9A 5IP9G 3X3NA 1WTQA 1HZ5A 4C3IB 1UGJA 4DK5A 4R4IA 2MP2A 4FF2A 2DHZA 2I1KA 2VL6A 5I6YA 3MHSD 1SYBA 2K52A 2WDRB 2GA4B 3DHIC 4MH8A 2AWTA 3GTMH 5A35A 2VB3X 1WXQA 1IBKQ 2J52A 2JXMB 3TEWA 1WMHB 1MJCA 2IO2B 1QUQB 1SFOB 2NTSA 3R2IA 1WGHA 4AOFA 4GOPB 1WGDA 1J7AA 4IZ8A 2GB1A 4Y52H 3C1EA 1EO6A 4C2MB 2KMCA 3HUIA 1JW9D 4II3B 2F0GA 4DFAA 1PDXA 1VR9A 3PLVA 1R4MB 2CWPA 1AE3A 4BS9A 4C2MH 5G5HA 3FVQA 2NPTB 5DAUA 2AWOA 3UIOB 5E6PA 1CHPD 4AYBE 2EELA 3NY5A 1E7PB 1HTOA 4UHVA 2PYKA 2AMCB 2KVMA 2PJHA 2QSDA 5KYLA 2KNBA 4HIOA 2AHOB 4JVZA 4OZCA 1XT9B 4BA2I 1U4LA 4ZYNA 1N63A 2K1FA 4IC7B 3H8HA 4P73A 2HDMA 2D11A 2NVQH 1EU4A 2KTRB 4YY3L 5DCNA 2UXDQ 5BYQA 2WKCA 4KSLC 2IBIB 2QMTA 2Z59B 4LNIA 1NE3A 2BE5C 2OCEA 3FMCA 1WWTA 3S2HB 2BWFA 3TDQA 3BG3A 3K57A 4ZK9B 4JI2L 4A3BG 4FF1A 1KRHA 3Q8DA 2JX5A 2MBQA 1BOSA 1OQQA 3HVDA 2B63H 4MTKA 4I7ZC 5CYUA 1T0SC 5CV4A 4CJ2C 3TCAA 1F9PA 1LTSD 1SJED 1STNA 5IT9c 2E76C 4P74A 1XF5L 4I6PA 1P0RA 1BCPD 3KUCB 4LF9L 4B08A 1I4RA 4K3BA 4P7IA 3CMAA 4YXDB 3JC66 1C77A 2WYQA 2Z0DB 1A3TA 3MZ5A 4K7UA 4XDCA 4GB9A 1TWFH 3AEVA 1SMXA 1DOKA 4TQUS 1B44D 3FKIG 4DA2A 1BT0A 1ACCA 4XYCA 3ND8A 1VQHA 3I4MG 2RHQB 4O0AA 1QOAA 4HIKA 1YD8U 2PZTA 2VH1A 4XWTA 1N5WA 1N62A 4LF5Q 1FCLA 1CZPA 2DJGC 5FKAC 1WD0A 1HRJA 2G4SA 3SFEB 4CO7A 2QDBA 4F7XA 4A3JB 1TYGB 1PRTC 4DR3L 2LGYA 4W9DA 1DCZA 3TP7A 4B9WA 2JPHA 1A63A 3IVFA 1WIAA 3G48A 4A8XC 2A6HC 3R7RA 3L54A 4RHSA 2KFKB 3BVZA 3M62B 3TS0A 3SHQA 4FP5D 3S14H 1II3A 4DNRB 2LRUA 3DHGC 4A20A 3BJUA 2V3NA 3OJ3A 1YBYA 5A2QL 3NENA 3VVWB 3NUCA 4MGIE 3GTKB 2K5HA 4LF8Q 2JRIB 1U5KA 4XDXA 4JYAQ 1TKYA 1KTKA 1R4PB 4N59A 4CQNA 1K8MA 5LNK1 5CV7A 3NWTA 3H0GH 3DVNU 1Q90A 1NBWA 4LFCL 1GUNA 1BQQT 4RKLA 1EM7A 4H7BA 1F2RI 4R4QA 2PIAA 1HXYD 2Q2IA 1E2ZA 1UE6A 2WGSA 2WX0A 4ZAIA 3RNBC 3KF6A 1PH7A 1SE4A 2VZKB 2D9UA 2IYDB 2UUAQ 1E1TA 1E8ZA 3Q8BA 1YX5B 2MBEA 3KH0A 1R4NI 3HOUH 2F0MA 2F52A 1XYIA 5COYA 1TS2A 4LFAQ 4RNAA 3N3KB 3KUPA 3EBEA 5J39A 5K36G 3Q8FA 4A3JG 3RN5A 1FXIA 5KRUA 4YHHQ 3HOUG 1RDPD 3VDZA 4N9TA 2RDBC 3GS2A 3ZIMA 1EWCA 1K50A 1B50A 5J2RA 3S9WA 2DYBA 3QQ8B 2WACA 4A3JH 4L5RC 3ZTDA 2J42A 5D14A 1XNQL 1HH2P 1Q3LA 1JE4A 1H9SB 3L0OA 1YHQA 3IG3A 1VQCA 2L11A 1SJHD 3H7PA 4BFRA 2UWQA 1FFVA 3X3MA 1DM0B 2WQYB 2NB0A 2N55A 2PI2E 2TMPA 5EPLA 1F9JA 4JI6Q 2X38A 3AE1B 4XE0A 5AZHA 2K22A 3GTQH 1WXMA 1WZ0A 4K2KA 4JC0A 3IKJA 5F2DA 4AQYL 3QWNA 2VS1A 4OIKA 4AH6A 2IJ0A 1N36Q 4E74A 4ULLA 4XIGS 2N7JA 4X3UA 4RM9A 3EFUA 1ASZA 1VQOA 2KBNA 1IP9A 2L4NA 2E2JH 1J19A 3RPFC 5AUKA 1VQIA 4IALA 2GMIC 1WXVA 3UI3A 5BN5A 2UU9Q 3U7ZA 5JAVA 3PS6A 1MFWA 1X1MA 4XC2A 3HOVB 3ZKJC 4YSXB 2PQAB 5I2XA 2MH7A
chains in the Genus database with same CATH topology
1F2YA 4PMCA 3VYRA 2IGHA 4P16A 4MHEA 1SE3A 3SEBA 4KJNA 5D3DA 2INPE 1BNZA 1B1ZA 2IGDA 3NUHB 4JPSA 5EPJA 3K59A 4QCLA 3S1MB 2B8GA 2EYLA 1BUIC 1B9NA 4FXKC 4H44C 2OEOA 5G3LD 2F0JA 4HCSA 3M4OB 4R3DA 1V97A 1ZYRC 1IW7C 2ID0A 4RCNA 3C1FA 3ZYYX 5CMDA 1OXSC 2AUKA 3BDCA 3CQZB 4DXGA 1FNUA 4FO2A 1JR0D 3KLSA 1HTLD 4PV1C 1NR2A 5ISRA 1EEFD 3TEZA 2JSVX 4NW2A 1EY6A 1R7SA 3CRKC 3AE5B 1IHZA 3MHBA 1SIJA 1EU3A 5CC4A 3IAYA 3AE7B 1STAA 2PO4A 5JVH3 5FO9B 1HPCA 2L32A 2J7ZA 1TIID 2NN6I 2CW0C 3VRAB 3I3CA 5DM63 2ZT9C 3NQIA 5CGKA 2NN6H 5DNFA 5IGFA 5BMHA 2BS2B 2MJDA 1YQ4B 5JEAG 2B2UC 4U673 5HHDG 1HQMC 4YT0B 2QKIC 3GP7A 3VR3A 4NMZA 3PIP3 2JA7B 2XSCA 4V0BA 3BZDB 4FXCA 1JMLA 1C48A 3KWVA 3AH7A 4IFDJ 5IODA 1QKZA 2N0SB 4L2YA 1J9OA 4A93B 3QOJA 4QIWB 1U4PA 2ZXRA 2A73B 4C3IG 3D6CA 1FR3A 5E6JA 1ONLA 4G7HC 2DNCA 2B2YC 2R3ZA 2O2LD 3AECB 4ZKCB 2EY1A 1L4ZB 5AFWA 3FPPA 1SSNA 4FNFA 4BA1I 3EGRA 5JEAJ 4HKQA 5G3LF 3A8KE 1A70A 1XXGA 4ZYSA 4C1NI 2F0EA 3WDNA 1FIQA 1K51A 3GTLB 1QF6A 1WRIA 1UNSA 2RSNA 2BS3B 3KBXA 3D4WA 2XWBB 4BBRB 2B76B 5HI1A 1AZPA 4OGQC 2KUMA 1VRAB 1J7CA 1V8CA 3L4PA 4PT5A 3SVMA 2OXPA 2M56B 3TBIB 3IAM1 3NQTA 4ZHOA 5JJZA 1D5MC 3S15B 4RGNA 2WAQB 1PFNA 1RWSA 3CRLC 1PXUA 4RGMA 4AYBB 1Y8PB 1N5XA 5J1ZA 1D6EC 1HEZE 2SNSA 1SNPA 3E5SA 1ROEA 2F3VA 1K53A 1DOXA 1HQRD 1I6VC 2A5HA 1BO0A 2WXRA 3S1RB 3T51B 1YNNC 5C5LA 1EZ8A 4RF0A 3BVMA 1H9RA 3SK6A 1NYQA 4OZAA 1JALA 3D8GA 3CWIA 3EJIA 1D1KA 2FHTA 2B2VA 2JA6B 2B2TC 4KX6B 4K8JA 2F0HA 5C4HA 5LL6S 3BIID 4J6HA 4KJOA 5IGEA 1STHA 1JWSD 3SK8A 4MN3A 4CJ1B 4DAYA 4YTNB 2M9VA 1W6KA 3DWAA 3K5LA 5C4XB 3IAS1 3M3YB 1XWEA 1PTOH 4XDDA 1RM6C 2Q8RE 1B3AA 2MJ3A 2PCFB 2HCIA 3EQLC 4KV6A 1SB3C 1YNJD 1RD9D 2XVSA 2E2JB 1PZKD 3QJYA 4OHJA 1DOLA 1MSHA 3VR2A 5HG2A 1ZEQX 2BTEA 2NTTA 4JWSC 3LWEA 5M5YB 3WOEA 1Z7TA 4C56C 4MM3B 5M5WB 4KMUC 1QOHA 1CA5A 4Q0FA 2EVBA 2JWUA 1EY7A 1QOFA 3LNNA 4KY6A 5KNBA 3DM1A 3TP5A 1QJOA 3IL8A 4IUUA 1C76A 2PVOD 3D6WA 2Z4HA 3GO5A 4KI0A 1ZUD2 3A54A 1I4GA 1D1IA 1MPEA 5J22A 2WXQA 4C7ZA 3D4RA 4FF4A 1O78A 3MTSA 3ETRA 5HGTA 1F0ZA 2A69D 3HOXB 4C7YA 3J7AV 4RWSC 2JA8B 3SFDB 3T53B 3J9CA 1IKMA 4H2AA 2XNAC 2K03A 3VYUA 4EE2A 2C9OA 5M5XB 2KHSA 2QILA 5EE1A 1UUPA 2HDEA 3RFZB 1WTWA 4J3OD 2CHBD 1TWGB 4XT3B 2L55A 3I70A 4KY5A 4N6EB 1KF6B 1UWMA 3A7LA 1DJRD 1WTPA 3QO2A 2K05A 2O4XA 3PZ8A 4X3TA 3RD4A 1QOBA 4US9A 3P7JA 4RFBA 2NWGA 5D65A 2MGSA 1CQVA 1FNWA 2K5DA 4IUNA 4KGSA 4KK7A 3NVZA 4ZUJA 1IBXB 3NHHA 1HTPA 2ZXOA 1V43A 1WD1A 1EL0A 2L52A 1O7LA 3I73A 5ELCA 3JAME 5T1IA 2JEBI 1O7ZA 5BN3A 3OHXC 3KWLA 3P4RB 1AFPA 2CJOA 3MP9A 1XLPA 2XN9C 4B9XA 4RHRA 1R4QB 1M4VA 1U4RA 3ZJUA 1I50B 2RDHA 2G9HD 1FXAA 1E6EB 4ID6A 2BYTA 2B63B 4YWGG 2VUMB 1GAQB 1A2TA 1S5ED 3H94A 4B0EA 1PRTB 3FRPB 2X6LA 4JE3B 5M9OA 1MHXA 3N52A 3RMHA 2EZVA 5MPOA 1BCPF 3MFGA 2B8FA 3TN2A 3Q6SA 3U9SA 4A6QA 4G57A 2IDYA 2V4DA 1F9QA 1K8OA 2RDGA 2OEDA 2KOLA 2BDNA 3PUVA 4D2KA 4DNTB 1FD7D 5EKIA 1XLQA 2K1BA 2PKOA 1FCCC 2JSOA 3Q8EA 1TR5A 1PTOF 4DF7A 3U2SC 1H9SA 1AWDA 1E2VA 5FK9C 1YNJC 1A6XA 4XYOA 4A3EB 1BDOA 3LX0A 3W9CB 4ZRZA 4ZOHC 1PRTD 1XCQL 5IGCA 1AZQA 3AU7A 2FFKB 1JRPA 1VZ8A 1JC7A 3C46A 1HCZA 1LTGD 4E6IA 4RH6A 2KAJA 2IWHA 3NVWA 4HROA 1PGXA 4DK0A 2SDFA 2IX1A 3PMFA 4R8IA 4IUPA 3KLRA 1AEXA 1PFBA 1OXTA 2JE6I 3H0GB 2ICIA 3PO2B 1TWCB 1A3UA 2EY5A 5ELBA 1F9RA 3SE0A 1CT1D 1HA6A 1ZDXA 1YNND 4A3FB 1EFID 1BF4A 5CV8A 1IYVA 1QT9A 1YN4A 2DYMA 1L0VB 2I38A 4XXEA 2EJFC 3KQ4A 2ON8A 1KAAA 1I4HA 1CHQD 4KY7A 3WOFA 1SYEA 4K8IA 3Q69A 2OT2A 1V1PA 5G5GA 2RQXA 2G9DA 4S3SA 2A6HD 4EQOA 2X69A 5CBEE 3I57A 3QB3A 2WXMA 2X6GA 3RZDB 3NPPA 2XIWA 4RA8A 3NS1A 1FRDA 1X3PA 2B2VC 3FC4A 5CV6A 1TWAB 5M3MB 3AB9A 1FNVA 1DZ1A 5KEEA 2F03A 1EQVA 3DXJC 3OOCA 4OO1G 3EA6A 1ENFA 2PZWA 2PZUA 3C3LA 1SMYD 3EFXD 3EROA 1ZXHA 3PUXA 2L9HA 2Q8TA 5C4ZA 1WVLA 2WU5B 2BB6A 3TSSA 3OSOA 1LLRD 2F0QA 1IL8A 3HRDD 2PNRC 3Q0AA 2RKSA 2L0CA 1LTAD 5FLXL 1G91A 1BBXC 3Q22A 5E1FA 2QEJC 2JZPA 3TP8A 1EY8A 1D2BA 4A3GB 1O7YA 2HUGA 2K5QA 1VF5C 4A55A 5E4XA 3AEGB 2HTME 4CJ0B 2Y0SB 4IOIE 1GHKA 3HZXA 5T8IA 1J8IA 2N88A 2A6EC 3I72A 1CJEA 4ITKA 4R8NA 3JAML 1STBA 4KHVA 5T1GA 3GD7A 1WTRA 4FXDA 3NTIA 5NUCA 2MP1A 3ND9A 3P75A 2NN6G 1QWYA 3FDTA 2K01A 1STGA 3AEEB 4BBSB 5BYSA 2LKVA 4KKIA 4QF4A 4YTPB 2NBFA 3ZQ4A 1KDBA 3D31A 1D5ZC 2YYZA 1BR9A 4TSSA 3RZOB 2A74C 2CQAA 3SR1A 3H09A 4HTHA 2ENBA 4HAEA 3DUZA 4L6TB 2HDLA 3DHQA 4K6DA 4FXGC 1IW7D 4HSVA 2CU3A 1SNMA 5C5MA 1XLOA 1Y8OB 4X3SA 5C3XA 1GUOA 4N9PA 1SYCA 1DXMA 2NVTB 2LHDA 2AQ1B 3KK7A 4HN7A 3P1HA 4MIUA 3QIAA 3NVYA 2NYZD 1RTOA 3C8YA 3G7LA 4HKZE 2I2YA 1NR4A 3HKZB 4IFDH 1NVID 1B4OA 3T13A 2LMCB 2V0GA 2KDMA 1KLUD 2B2TA 3NSWA 3E56A 1CK1A 3D4DA 3K7AB 2W3SA 3MXPA 1TS5A 3MFYA 4TQ1A 2BA1A 2Q5WD 4K5WA 1WSPA 4PMBA 1I4PA 5IGDA 4HJGE 1Y69U 1C4AA 4JBWA 3AB5A 3GV3A 3MWYW 3AMUA 2WXPA 3FILA 3PO3B 1L0YB 3HVZA 4LLGM 5JXVA 3MVVA 4WFN3 3PZ7A 2E2DC 1JROA 4L8JA 4K2LA 5LL6X 5EKKA 1CFMA 3VQIA 1Y1WB 1NCVA 3HS0C 3GTJB 1FYCA 1A15A 1JWUD 3H91A 1CA6A 3KBGA 3ONAB 2NVXB 1DYQA 4GDLB 1E0BA 1WCMB 4ABNA 2LY7A 3Q23A 4C3HB 1NENB 1PFMA 1A3VA 5EBCA 3U4EG 2O5IC 2L1BA 3J80E 2SOBA 1XEEA 1HUNA 3V96A 4KGTA 1ILPA 4NKLA 1LTTD 2LGIA 2PTLA 1AYFA 4IUQA 2M19A 3AE6B 1D5XC 1SBBB 1PLFA 1LT5D 5D7GA 4HEA1 2H89B 3VR8B 4KGRA 1E2WA 3V3XA 4GZYC 1BMLC 3AEAB 2KEDA 3W5VB 3GV6A 3N9YC 2NMQA 5ELEA 3B2FA 5CR3A 1ZP0B 1EY0A 1SAPA 1GUSA 1RCVD 2KN4A 1G291 2WXGA 1Q1BA 4ZRQA 2KA7A 3J81E 1WTXA 1FGBD 3AM9A 1GJXA 3UI2A 4ZHPA 2KEEA 3U52E 2KCCA 4M8AA 1SYDA 2IPKD 4A3DB 2JYOA 1BXTA 2DBYA 1GB1A 2PW9A 5FOBB 1H9MA 3GTMB 2K28A 2EY6A 1BCPC 1SNOA 1PGBA 2GI9A 1V1PB 3URYA 3VYSA 1YMHE 3K0YA 2LFNA 1YQ3B 5EJWA 5IGGA 4AS1A 4RF1A 1Q12A 2WLBA 2H88B 5IIFA 4XQJA 1VJKA 2FMCA 1MVKA 1SF0A 3I4NB 3MXGA 3HOUB 2QIEB 2V4IB 4EQNA 3NP8A 2WU2B 1NEKB 4CBVA 1J7BA 1PUTA 2H4OA 1PTOC 3TEYA 3DEOA 2R92B 1QG7A 2WB1B 2CVRA 2KECA 2XWJB 4TQ0A 2K9XA 1MSGA 2SAKA 1SSOA 3BWUD 2BS4B 2ZXPA 1ZDVA 4M0WA 5E3FA 1ESRA 2DLBA 1DOMA 3A56A 3E6ZX 3M7GA 3NBIA 3CU7A 1K52A 4OO1H 4YTMB 1HHVA 1EY4A 4OO1I 1H9JA 1FMAD 1OXUA 1P7EA 2K5PA 4EVOA 3W2DA 2F0NA 1C4CA 2BA0A 4JWUC 1LTRD 3P4PB 4NP5A 3BS1A 1EIHA 5C6AA 3BDOA 3W5UB 1VDVA 3SR6A 3TP6A 3DWMA 3S2DB 2Y5CA 1VLBA 2IX0A 3FAHA 1N61A 2F0IA 1S5BD 3VR4A 4KTAA 2E74C 3I4MB 2F0LA 2NZ1D 3N6RA 1JWMD 4ILWA 3TZUA 1ENCA 3MHZA 4GLSC 4O42A 1EOTA 3Q8CA 5C2TB 2AX5A 2EYHA 1MBYA 5CV9A 1LTBD 2LHEA 2K3UA 4HEDA 2ONQA 3RLFA 4R9WA 3K5NA 4V190 3BYYB 2YEPB 1FO4A 2N9LA 4DU9A 5C44B 3AEFB 3R3OA 5EE3A 4F87A 2INNE 1I3QB 1QNKA 4XYQA 4QB4A 3BYTB 3R93A 1PGAA 2WXFA 1ZKOA 2F0FA 3TMEA 3BK1A 1AP0A 1PDQA 3HP3A 2MJEA 1FM0D 3QOLA 3L3OC 3DWQA 2EYPA 3A55A 4UAIA 4WRDA 1KNAA 4PNYA 1ICWA 1VMCA 4IN3A 3PO0A 2LEKA 2F0DA 2BE5D 1WTVA 4IKGA 2SNMA 2MHVA 2JQRB 2VXWA 2Y3AA 1F2RC 1A2UA 4A3MB 4FF3A 4WAFA 3I4LA 4NDXA 3BK2A 1CZWA 4F8MA 1GUWA 2PW5A 1IYUA 5CBAE 5C0XH 2L1AA 4H13C 1L5PA 4WIPA 5EE9A 3ZJTA 3A7AB 1ESFA 2RA4A 1GHJA 1DOIA 2F4IA 1GOZA 2WINB 3HG9A 4CKEA 5EPKA 5IT9L 3AE8B 1TVXA 3M4YA 2MEKA 3MC0B 2BB5A 1LV9A 2PPBC 4IUVA 2VZKD 1WTOA 1F9SA 2FBWB 4EGVA 3PUYA 2B2WC 1HUMA 1ZE3D 4KKUA 1B9RA 2MPMA 1Z6HA 3GTPB 1T5XD 4H0LC 2FJ2A 3OIQA 2K33A 5H92C 1WYGA 4B0MA 1AN8A 3V05A 1XLNA 1G8ZD 2WDQB 4Q5VA 1SXTA 5JOBA 3T4AC 3J7AF 2EJMA 4ZLTF 3FEWX 4MACA 2F0VA 5CORA 1HFGA 3AE2B 1JOQA 1IUEA 1TWFB 1KH0A 5EGTA 1EYAA 1T3QA 3NE5B 3BVGA 1T5EA 2F0OA 3OPOA 2FMMA 1SYFA 2R7ZB 4WQMA 3PUZA 1Y1VB 1Q10A 3R2TA 1P7FA 3TEXA 1VCIA 1AW7A 5C3JB 1EEID 1SEBD 2L5TA 3T56B 2LFIA 3G6JB 4YSYB 1OFFA 2KQ4X 1PTOB 2XRSD 2M2LA 2C5CA 2I07B 4U68A 4XQNA 2EYJA 2F0UA 1LTID 1ZOYB 2WNMA 5EKLA 1ET9A 2VB2X 2D5DA 4BWGB 1JCKB 2L12A 1XO3A 2FUG1 3IXSA 1TZOA 2AUJD 4CHTB 3MA2B 1S5CD 4GDKB 1L4DB 2N9KA 1Y56A 2R6GA 2WP8J 3OMGA 2JP1A 2FINB 1TJEA 4ZRPA 1DOYA 5C0XJ 3SK5A 1LT3D 3EVQA 4CKBA 5I6WA 3AN1A 1SE2A 3VRBB 1RFKA 1SNQA 4LJZC 3LB8C 2WV6D 4ODGA 1QILA 3D3RA 4C3JG 1N60A 1F2LA 1NI3A 4RAUC 2WP9B 3NWSA 4BY1B 1GB4A 1Z47A 2BBCA 2BDOA 4HRSA 3DWPA 3DEPA 1EYCA 4X3KA 3Q8AA 2J4XA 1STYA 3U9OA 1I7HA 3SHLA 3MXNA 2E2HB 1SNDA 1D4BA 2E2IB 1KDCA 1PFDA 1I4XA 2E3TA 4IDIA 4YSZB 3J80L 2WIIB 4A3KB 2EXZA 3I8ZA 1NYRA 1T6BX 1HZ6A 1QCBD 5I2YA 2Q8IB 1G2SA 1VMPA 5TSSA 1GUTA 3T16A 4IUTA 3AE3B 3VR9B 1H9KA 3AEDB 3AEBB 3J7YW 3LXFA 3MAQA 1K83B 2O5JC 3VA5A 1KABA 1PRTF 5JVG3 3J81L 2R61A 2R93B 2SEBD 2KQ3A 2HCCA 3T3NA 4DAVA 5I4DA 3NTHA 4YIJA 1U4MA 4HR7B 2F0PA 1F77A 1ET6A 3K5OA 2MJ8A 2W54A 1TT2A 4ZUIA 2I46A 1OQRA 1IBXA 1MI2A 3SXHA 2WS3B 2K5WA 2G1EA 1HA5A 2PMZB 1GUGA 2BW2A 3P4SB 3GTQB 2NVYB 4OL7A 1L6UA 3NXWA 5C3EB 2DY7A 4L1BA 3OWFA 1CM9A 1TY0A 4G7ZC 4K5VA 1OXXK 1TS3A 1TKWB 2WXJA 1S5DD 1V1OA 3GQBA 1TS4A 2Z8LA 2YEPF 1ZXTA 3OIPA 5FO7B 4J8QA 4LK0M 1MHHE 2F0SA 2EYOA 2WXHA 2RVLA 2RMMA 2M00A 4TMAB 3NRZA 4IFDI 5BMIA 5CV5A 2PW7A 2EYFA 2XRQD 2J0TD 4FYDA 4HMJA 5JPNC 2JU6X 2WXLA 2J53A 3HGBA 5BMGA 2B2WA 4UDUC 4IURA 4QUFA 5C4JB 3BDLA 2V3PA 4IQZA 1X32A 2HQEA 2H1EA 1DGJA 4Y7NB 1SMYC 4A3BB 3E9SA 3K5MA 5C0XG 3H6MA 4KD3A 3V2TA 1PMRA 2Z4IA 4TRDA 2W82A 4PMWA 2B39A 5ELFA 4NZLB 1TQOA 1QB5D 1RF2D 3FPUB 2E6XA 3TZDA 4DQOC 4M1UB 1QLBB 4KHZA 1C4QA 3GTGB 2RDFA 1ILQA 1OXVA 3ITPA 3F2UA 4WJWA 1C4PA 4OZBA 2EOTA 1YNTE 3M85A 5EQ0A 3P42A 5FLXE 2JYTA 4NAMA 1PTOD 2EE1A 3CIRB 2IGGA 3ABVB 2AWNA 5HURA 1JWBD 1ZYRD 2IX3A 1QE6A 3DMUA 3I90A 1EZ6A 1I4QA 1TY2A 2IW3A 2PQEA 3W3AA 2Z1CA 4F88A 2WDVB 3MXUA 4KN4C 2NVQB 1KLGD 4L23A 3NBHA 2BOSA 2CJNA 4ZKBB 4XQQA 3I91A 2PVGC 2B2UA 3ERQA 1SNCA 4KKSA 1F2ZA 1XX8A 4XTCS 2IT1A 4JK1C 4N58A 4DXFA 5JPMC 1U9RA 3L7ZC 1QOGA 1FEHA 2D2CC 3K58A 1EWHA 1EYDA 5HFYA 4CGYB 4C3HG 3CHBD 3NK9A 5FR3A 3T3OA 3SDZA 1FRRA 3FKIB 2DWQA 4OIJA 1G6ZA 1IGCA 3IFTA 3IFDA 4EQPA 1TKEA 1YJIA 3VA7A 1F2MA 2K6AA 3OMCA 1EQTA 4LAAA 2BT6A 3IT6B 4RKBA 3W1SA 1L0XB 5ELDA 3A8JE 2B2YA 3I9V1 3RUZA 2KCNA 3QG1A 3C2PA 5H8YE 5C0XI 1QNUA 2NUCA 4K14A 2EJGC 1JQ4A 1S5FD 4K5XA 2A69C 1C8CA 1JICA 3PV0A 5D3IB 1BUVT 4C1NK 4WH4A 5K5PA 2MUYA 1VZ7A 2LUMA 4RCOA 2PLPA 3VR6A 1Y8NB 2YU9B 3HRZC 2OF1A 2LS01 2JYEA 5AUIA 1DONA 1IGDA 4KKTA 4LMQD 4O1NA 2WXNA 2F1MA 5BYRA 5FO8B 3VYTA 1LABA 2M0AA 3VR5A 4JX1C 1RJTA 3R8BA 5JEAH 3S14B 5IOCA 1VZ6A 1JB3A 1EWYC 2A68C 4Q2JA 4NJCA 4WORA 1S4ZA 4FVMA 4DK1A 4ARIA 2F0WA 3IT4B 3K6OA 1JWAD 4IFDG 3P20A 4DN4M 3L9AX 2D5GA 1KFYB 1MGSA 2QCPX 2E75C 3AE4B 4HSPA 4REZA 4A90A 1JOOA 2LMCA 4ZQ3A 1IKLA 1VF7A 2ZW0A 3WCQA 5I9OA 1B53A 3P1MA 5GXGB 4L63B 3CKIB 2PMVA 2D62A 2Y5PA 5IT9E 1V8QA 3E0JA 5E4WC 2RPVA 3NZ3A 2A6ED 1RKNA 2F0TA 1MI0A 3HOWB 4RNAA 1UAPA 2WXKA 2W3RA 3OWEB 3H3VC 1XCTL 5KNCA 3ZJVA 2RSOA 3PUWA 4XT1B 1GPXA 1I6HB 5EE0A 1HFNA 4AQ7A 4OVZA 5DEHA 4XWWA 5EBDA 5LHY1 4C80A 3S16B 2OHFA 4LK1C 3NTKA 2RBMA 4KKJA 1ML0D 5K36H 5DM73 1LO5D 1CI3M 5A2QE 2K0PA 2ICEC 1CQFA 2GRIA 1MD2D 3AV8A 3TUOA 2KWDA 1EY5A 1X3QA 2L83A 5M3FB 1TKGA 4C3JB 1C78A 1XTCD 4HMIA 5C3WA 2IL8A 3Q24A 4DGZA 1O80A 2EYMA 1KDAA 1JORA 2TSSA 5BN4A 1ENAA 1E10A 4OW0A 1EY9A 3P4QB 4QUCA 2QJLA 1C79A 3S17B 4PQXA 3GTOB 2VNUD 1OO9B 2KJXA 4CKCA 1RODA 1M8AA 1TWHB 5KIXA 4NAWB 2EDGA 1JOKA 4I65A 1EIGA 3LYYA 4ME5A 1FD6A 3A8IE 5KNDA 2KACA 3P63A 2DNEA 3SK4A 3FILB 4P2CB 3O13A 2WXIA 2EPBA 1B9MA 1RHPA 2WXOA 1PYWD 4WWMA 3S1QB 1CTMA 3PIO3 3KF8A 2W55A 1W6JA 4RGOS 3B9JA 4J1MA 4ARCA 1ZPSA 4TKOB 1E9MA 1SDFA 4A9AA 2FE8A 3MJ5A 3AE9B 4MT5A 1RTNA 4DAPA 4BY7B 4WURA 1QQRA 1PZJD 2CW0D 3NVVA 4A3IB 2K32A 3HOYB 2WKDA 5KYIA 3DWGC 1G2TA 3MEHA 2AQ3B 1DD2A 1RYJA 1E0ZA 1JQYD 3HEJA 4P6VF 1NSNS 2DYOA 1TU2B 3OW7A 1STEA 2JEAI 2JA5B 2EY2A 2ACZB 2AQ2B 4KN7C 4US8A 4G7OC 3GB1A 2KMMA 1UEAB 3B2GA 1Q1EA 1NUCA 1YN5A 3M7NA 5I9PA 2F3WA 1FFUA 4RGTA 1SYGA 3EUB2 2ZW1A 2K7VA 1B2TA 1VDZA 1PZID 1NAPA 2A68D 2DN8A 5IGBA 2LJIA 1Q8IA 4QMGA 3LWUA 1WGKA 1ZXIA 1C9FA 1YN3A 1KNEA 1BCPB 2DY8A 2F0KA 4KD4A 4K6LA 4Z9CB 4LTUA 3KLSX 1R9TB 4G4KA 2BCOA 3S1NB 2JXTA 1LT6D 1LACA 4HCEA 2EKIA 1UWXA 1YJJA 1L6VA 2K04A 1LT4D 5KGUA 3ZGZA 3AMZA 3HOZB 4USAA 1GXDC 1CZGA 2QF7A 3X3NA 1WTQA 1HZ5A 4C3IB 1UGJA 4FF2A 5I6YA 1SYBA 2WDRB 4MH8A 2GA4B 5A35A 2VB3X 1WXQA 2J52A 2JXMB 3TEWA 1SFOB 2NTSA 3R2IA 1J7AA 4IZ8A 2GB1A 3C1EA 3HUIA 4C2MB 1JW9D 2F0GA 4DFAA 1PDXA 1VR9A 4BS9A 5G5HA 3FVQA 5DAUA 2AWOA 1CHPD 2EELA 1E7PB 2PYKA 2KVMA 2QSDA 5KYLA 4OZCA 4BA2I 1U4LA 1N63A 3H8HA 2HDMA 1EU4A 5BYQA 2WKCA 2QMTA 2BE5C 3FMCA 1WWTA 3S2HB 3TDQA 3BG3A 3K57A 4ZK9B 1KRHA 2JX5A 4FF1A 3HVDA 1BOSA 1OQQA 5CYUA 4I7ZC 5CV4A 4CJ2C 1F9PA 1LTSD 1SJED 1STNA 2E76C 1XF5L 1BCPD 4B08A 1I4RA 4YXDB 1C77A 4XDCA 1A3TA 3MZ5A 4TQUS 1DOKA 1B44D 4DA2A 1ACCA 3ND8A 1QOAA 4XWTA 2PZTA 1FCLA 1N5WA 1N62A 1CZPA 5FKAC 1WD0A 1HRJA 3SFEB 2QDBA 4F7XA 4A3JB 1TYGB 1PRTC 1DCZA 3TP7A 4B9WA 4A8XC 2A6HC 4RHSA 3BVZA 4FP5D 1II3A 4DNRB 2V3NA 5A2QL 3NUCA 3GTKB 4XDXA 1TKYA 1KTKA 1R4PB 4N59A 4CQNA 1K8MA 5LNK1 5CV7A 3NWTA 1Q90A 1GUNA 1BQQT 4RKLA 1EM7A 4H7BA