1JWSD

Crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDGMFNWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 72
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwsD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwsD02
1CT1D 1PZID 2XNAC 4K6LA 1PRTF 5D3IB 1LTID 1EWCA 1LT4D 4L63B 3DWPA 1JWSD 1HXYD 2J4XA 2IJ0A 1LO5D 2XRSD 5ELDA 4RCOA 4Z9CB 1PYWD 1DYQA 1YN5A 1LT5D 4OHJA 1RDPD 1HTLD 4UDUC 1S5BD 3OWEB 2Z8LA 2R61A 2RDGA 1CHQD 1S5ED 1CK1A 5ELFA 5FK9C 1ENFA 1CHPD 4RGNA 3V05A 1ET6A 2CHBD 4RGTA 2NTTA 1F77A 1MD2D 5ELCA 1LTSD 1ESFA 1PTOC 1EEFD 1SJED 1BXTA 4RHSA 1JWUD 1BCPF 1UUPA 1S5CD 4DXFA 1BCPC 1SJHD 4C56C 1YN4A 4NZLB 1V1PB 3BZDB 3GP7A 2QEJC 3BVGA 4RFBA 1GOZA 2TSSA 3W2DA 1KLGD 1KLUD 1QILA 1AN8A 2SEBD 1BCPB 1B1ZA 1DJRD 3DWAA 2AQ1B 4ZYSA 1I4RA 1I4HA 2AQ2B 1T5XD 3O13A 3KLSX 1FNVA 1D6EC 1LTAD 3SEBA 4L6TB 3TSSA 1YN3A 4RH6A 3MC0B 1RF2D 3BVMA 1FGBD 2O2LD 1D5ZC 1LTBD 1BCPD 1CQVA 1TS4A 1LTTD 4O1NA 1TS5A 1L0XB 1I4XA 1STEA 2QILA 1PZJD 1SEBD 2WV6D 5TSSA 4BWGB 5D3DA 1EFID 1S5FD 1HQRD 1JQYD 1PRTB 4RGMA 5ELBA 1TY0A 4TSSA 3CHBD 1I4QA 1PTOD 1ET9A 3EFXD 1L0YB 1XTCD 2NTSA 1I4GA 1TS2A 1XXGA 4RGOS 2XRQD 3BYTB 1HA5A 1SE2A 1FNWA 1PRTD 1LTRD 1AW7A 1RD9D 1JCKB 1EU3A 1SXTA 3MFGA 2IPKD 1D5MC 5I4DA 3BYYB 1SE3A 1UNSA 1TS3A 1SE4A 1LTGD 4RHRA 3BVZA 1FNUA 3R2IA 3R2TA 5ELEA 1SBBB 2RDHA 1V1PA 1FD7D 1TY2A 1M4VA 1B44D 1S5DD 5FKAC 1RCVD 1D5XC 1EU4A 1PZKD 1PTOB 1LT6D 1PTOF 1I4PA 3R8BA 2G9HD 1PTOH 1LT3D 1G8ZD 2AQ3B 1V1OA 1EEID 1KTKA 3DWQA 3URYA 1LLRD 2ICIA 4DXGA 2XN9C 1JR0D 1PRTC 3EA6A 1JWMD
chains in the Genus database with same CATH superfamily
3S17H 1STHA 3KYDD 1NVID 4YSZB 2JWUA 2ALYB 1HZBA 4B3MQ 2KT7A 1BBUA 1YIWA 4KV2A 1UEBA 4F7ZA 4W9CA 2KYWA 3NOBA 1L1OA 2WXFA 3DCGA 5DPTA 1YI2A 5JPMC 3K9PB 4JBWA 1F9QA 2IJ0A 4ZUIA 3E5SA 3PT2B 2HTME 1W2BA 4MZ9A 3EC8A 2GBNA 1YN5A 5JHBA 3ZJYC 1K8AC 2BTEA 3TP5A 3OPOA 3OW2A 2D11A 3QAQA 3KLWA 4I7ZC 2MJ3A 4WAAA 1CHQD 1X65A 3G6JB 3I5JC 3QIAA 1ICFB 2N9LA 3KWVA 4K2KA 3FMCA 1CHPD 1GUOA 1GKHA 2AUJD 1F9SA 3NEMA 4R4IA 1HNZQ 1G2TA 1NEKB 1QOFA 2C7NB 1LM0A 2KVZA 4WORA 3W5UB 3CCUA 5M9OA 1Z6HA 1V8CA 3FKIH 3TRZA 4TQ0A 1EUVB 3Q8AA 3AEFB 3PSEB 2CCZA 2UUBQ 2K5WA 3K7AH 2NCNA 4ZRIA 1TR5A 2UYZB 4KSLC 2N9KA 3H09A 3KDFA 4A93H 5FO9B 3NS1A 2K32A 2O5IC 1OXVA 2KC2A 4M0WA 4XGAB 3RZOB 4XZ4A 2N1VA 2VNUD 1X55A 5C5LA 3ULLA 5KIXA 3MP9A 1DGSA 1IKLA 4HPMB 2KFKB 3SEBA 1M1KC 4IFDJ 2NPTA 3SHQA 2Q2TA 4DFAA 3WA0A 3VDYA 1EY9A 1U4MA 3AE4B 4QGUA 3M62B 3N20C 1QJOA 4DDID 3E0EA 5JEAH 4DR1L 2KWVB 2V3SA 2Q2UA 1P8LA 4DV3Q 4DUZQ 1LXDA 3T8MA 3N1YC 3RT3B 2B2UA 4WWOA 4KMUC 4CDCC 4HJ9A 4W9JA 4JBJA 2VW9A 2QILA 1PGBA 1KDAA 1JJCB 1SR3A 2K5HA 2PPHA 4ARCA 4IOAA 4KHVA 1GJZA 3C19A 3K57A 1OTRB 2XSCA 2KKCA 3NRZA 4HIMA 3H0GB 3NWTA 1A8VA 2MBBB 1TWCB 2K33A 3EVQA 4LK1C 3RLFA 5JVH3 3T1YL 4B3TQ 3JVZX 3NTKA 4L1BA 1R4MB 3O65B 4DF7A 3IRBA 4KGSA 5IAAC 2IZVB 2JA8H 2B2UC 3ND9A 2M0AA 3OSOA 1Q46A 4JCVE 3PPAA 3PIOA 2H1EA 1EOVA 4S3SA 2UU7A 4FADA 4DU9A 1YIJA 4BKGA 2F0EA 1XYIA 4DK5A 4IN3A 1G6JA 1UNSA 1TZ1A 1VQBA 3AE5B 1YNNC 1WFQA 4KKSA 2NVXH 3I4MH 4IDIA 1C4AA 1MHHE 3R2TA 2JRHA 3OAWA 4A20A 2K5PA 4JPBW 3TZUA 1JE5A 2FCNA 3OJ3A 3PZ7A 3L17A 2CW0D 3TDQA 3W1BA 1PH1A 3I4NB 1P1AA 2L55A 1VDZA 2E2HH 2D07B 3UIOB 2BS3B 1LUZA 1XF5L 1CQFA 3CCQA 2AQ3B 4CKBA 1G8ZD 2V9HA 5EPJA 4DR5Q 1KTKA 5JHAA 2JYOA 3FPPA 3I4NH 2HT1A 4IUQA 2XN9C 4GKKQ 1PRTC 1IBLQ 3S1QB 1CT1D 2Z9HA 1YQ3B 3FILB 1XPUA 3IAS1 1FJGQ 2A68C 2VL6A 1AARA 2RBMA 2NVXB 1SMXA 1E10A 3I4OA 1Y1VG 2Y0SE 2ZNVB 4II2B 2RVLA 4FDBA 5IT9E 2CR5A 3NVZA 3U9SA 5CHWA 5C3EH 1D1IA 3RNUA 3UDIA 3A0JA 5ELDA 4GB9A 2NVYH 2I5HA 4J6HA 1QZHA 1IPGA 1V9JA 4PMBA 3PO2B 3J81j 1H9MA 2KVMA 2N8NA 4LUVA 2JX5A 2WDQB 2NZOA 4G11A 5BMIA 1ZGUB 2EYMA 3L0OA 2VS1A 3A5UA 4A3DH 1PGAA 4LW1A 5LMNW 1WGRA 2D2QA 2LUEA 4HPLB 1D8LA 2BCOA 2MX2A 1WJUA 2FE8A 3H0GH 1K3RA 3B1LX 3QC8B 3J7YW 4LFBL 2E5LL 1P3QU 2PYKA 1J19A 3RNAC 2O5JC 1XLNA 3IG3A 2MQHA 2ES2A 3Q3NC 2CW0C 4LCDE 4P1CC 4GNXC 3AEBB 1EQRA 2OEDA 4F88A 3PLVA 2M8SA 1QWYA 2NBFA 2RHQB 4FXDA 1YQ4B 3LJ3A 4NXNQ 3CF5A 2M17A 3BINA 4JOIC 2H89B 1D1KA 2J0TD 2CQOA 3HRDD 1AN8A 1C4PA 2FUG1 1IBKL 2J0JA 3AB5A 3B2GA 4GIVA 2A6HC 3L4PA 3TP7A 1FIQA 1TYGB 2L0TA 4JI7Q 1STBA 2M2LA 1S1QB 3PRPB 1VLBA 2KOLA 4I65A 1A70A 2N4FA 3E9SA 2ZT9C 3CPFA 4A3EG 1KNEA 4A3EB 2WACA 4REZA 2RSNA 4YHHQ 4A75A 3PO3B 3CQZB 1EZ6A 4JI5L 4JWSC 1YITA 3PUYA 4OVUA 3GTGH 1NENB 4OIJA 5TSSA 2G4SA 3M4YA 2HIVA 3W5OA 2UUAL 3U7ZA 2DYBA 3E9IA 1I4QA 2ZTEA 5C44B 1HA6A 3K80C 3RLOA 3J7ZC 1WM3A 1UE1A 3SGIA 4JI0Q 2DNCA 1QCBD 5CV7A 3UE0A 5AEKB 1OEYJ 5BMHA 5FO7B 1A63A 1UAPA 3OMGA 2WB1E 3DVNU 4ZQ3A 5D2MB 3DWMA 4ZHPA 3NZSA 1V9PA 1UD7A 2BPSA 1X3EA 3D32A 4JPSA 3KYHC 3PHXB 5AZFA 3M3YB 2KQ4X 4LNFA 1EYGA 3W1SA 1Y8PB 4C4VB 1XMOL 5C44H 2DGYA 4KN7C 5AZGA 2RKSA 4AOFA 3N52A 2RDHA 3CCSA 2HJ8A 1V1PA 1D4BA 3DXJC 1OQQA 2AHOB 4IPGA 3GTGB 2L11A 2XK5A 3VHTC 1PZKD 1PTOB 1AE3A 4A3BH 1DCZA 1LT6D 2EXDA 2BKRB 1WE6A 1FMAD 1L6UA 2NZHA 3N6RA 3CF6E 4A3EH 4IM3A 2GBJA 4YSXB 3RUZA 2PE6B 5E7NA 4JX1C 3KYCD 1B4OA 2PZTA 2Z0SA 2A73B 4TQUS 2R92H 2JWZA 1ISNA 2KN4A 4LDTD 3P63A 4EEWA 4A3KH 3PCOB 3S16B 2IYDB 5HHDG 5M5XH 3Q8EA 1ZXTA 3UQAA 4A3MH 2WKCA 4GXBA 2AKWB 3I3CA 5F2DA 2L32A 4LFCQ 1XNRL 1BUIC 2AL3A 5GMVA 4DV6Q 1LT5D 4GLAC 1VQ9A 1L7YA 5C3EG 1OGWA 1UE6A 1R4MI 1Z5SB 3I8ZA 2EOTA 4MSQB 5ELFA 2FIDA 5IY0A 2NN6I 1TWGH 1GO3E 2OQKA 3MAQA 2AMCB 4DV6L 2E2IH 2V4IB 2YTYA 1OXSC 4ZAIA 2BH2A 2K9XA 1SE9A 1RL2A 2ICEC 5FLXE 2QDLA 2X6LA 1HR0L 3H91A 1K0RA 5JJKA 3NHEB 1SNQA 1SYCA 2PCFB 1IKMA 1MG8A 1KC8C 1E90A 4EZJA 2O2VB 1V43A 2J0MA 2AWOA 1E2WA 3ER0A 1ASYA 1P7EA 2BBCA 2K3UA 3C1EA 3HOYH 4DR2L 1VDVA 1EWYC 2HD5B 4CDDC 4BAXA 4BBRH 1PFSA 4ZRKA 1EO6A 1XEEA 2EYPA 3TIXA 2A8VA 2WAQB 1B1ZA 4Y7NH 1JB3A 2AQ2B 2A68D 4JI1L 4HKQA 2JA9A 4XT1B 3BG3A 4DPGA 1LTAD 4WJPA 1RHPA 3ZO5B 2WNMA 4XE0A 1NY4A 1K73C 2O6VB 4A6QA 2FBWB 2ZJQA 4DR2Q 3GTJH 4B3SQ 1Z2MA 2MUYA 1PFBA 5CYUA 1V97A 1KHIA 3MJ5A 1L2FA 2MFIA 1J7AA 2BKFA 4XDDA 2DYMA 1WXSA 4JE3B 1KDCA 2B2TC 3AE6B 5E1FA 4XQJA 2E2HB 2WXPA 2RPQA 1NMGA 2I07B 2NMQA 2PE9A 1QB5D 4O2DA 3IAM1 1K9MC 1UWVA 3K0YA 5IE8A 2PW9A 1OQRA 3MTNB 4M01A 4FA6A 2DAJA 1PRTB 4K7SA 2L8JA 2DX5B 3I4MB 2IY5B 4X66L 1EY0A 3G4SA 2NVQH 3PREA 1B3AA 4JI2Q 2PMZE 4DV4Q 3A1QA 2EVBA 4TUUA 3TEYA 1A3TA 4DAYA 2LEKA 4MGKE 1EY5A 5IP7G 5L37A 1H8CA 4MSMB 4POGA 1W6KA 2ZCBA 1P98A 1CTMA 4P6VF 2CVRA 4QL5A 1EFWA 3WIMA 2MJ8A 2IPKD 1K8MA 2QCZA 2QCPX 2IO3B 1SNPA 4AQ7A 3R3OA 3CAMA 4GKJL 3AEAB 1M8AA 4AJYB 1OFFA 4LF5L 1LTGD 4F1SA 1HR0W 1KAAA 1FNUA 1WXMA 1JWAD 2KA7A 3ML9A 1WRDB 1M4VA 3APDA 3S15H 5GAHC 4PYUA 5CORA 4IUMB 4LF9Q 2J7ZA 4NJ7A 4P75A 1I4PA 3R8BA 5FR3A 1HE8A 4LF6Q 3C2PA 3Q24A 5BYRA 4OZCA 1F9RA 2MO0A 1VQJA 1DOMA 2I1KA 1L1OC 2PI2A 1VF7A 4TRDA 4YCUA 3HOZG 2N55A 3JAMc 1VQFA 3SDZA 4DBGA 2F0UA 1MSGA 3CSTA 3UDFA 1VZ6A 4XYQA 1K8GA 3B08A 2WXKA 4X64Q 2WB1G 3MC8A 2EY5A 2IY1B 3RUIB 2HUGA 1BKBA 4Q5VA 1X3QA 2J4XA 3ZGZA 1LO5D 4KDIC 1QT9A 1E2ZA 3GDEA 5LXHA 3I56A 1RDPD 1SYGA 3A55A 3K7AB 4IM2A 3F2UA 2MP2A 3OIQA 2Z8LA 3PQIA 2XWJB 3KWLA 1V8QA 2EYFA 3FKIG 2ZJRA 1C4QA 3FKIB 3S2DH 2Y5PA 1IBML 3Q14C 1VQHA 2BH8A 3DMUA 1X56A 1FCCC 2J7QB 1ESFA 3V3XA 3LGJA 3CU7A 5EQ0A 3HKZG 4EFOA 1UUPA 3JC66 4P74A 3FPUB 4ITKA 3UIPB 4HJAA 4HXDA 5I9OA 4G3XB 4NZLB 1ML0D 3VTVA 1T3QA 3F2DA 2BGFA 2C5CA 5BO4B 2K01A 3L08A 1V81A 4AP4C 3DM1A 1KLUD 2ID0A 3DWAA 3M7GA 2QC8A 3MHSD 1T9HA 3LYYA 1ZYRD 5DM73 3ZTDA 3HKZE 3MXNB 5E4WC 3KLSX 1O80A 1WTXA 5LL6S 1I7HA 1XD3B 1A6XA 2KMAA 1O7IA 1GHKA 1C48A 2D2CC 3CW2C 4R4OA 3S17B 3V60A 2B3AA 4K7WA 5IYCG 3RZWC 4NXMQ 1VQAA 2OHFA 4JLCA 4BOSC 2ZXRA 1R9TH 1VMPA 1N5XA 1X6OA 2F0DA 4JI8L 2B63G 4URKA 1ENAA 3AU7A 5CBEE 4C3JG 2BS4B 1XMQQ 3S2AA 1D3ZA 2PTLA 1DOYA 1FO4A 1M94A 4DNIA 2VZKD 2DN8A 4GMVA 3RNFC 1STAA 4PK1A 4H02A 3H7PB 4DK3C 2H4OA 1IXRA 2CH4A 2IBIB 5FOBB 3GE3C 3ZIMA 2KLGA 1DZ1A 3IHPC 5H8YE 2Q8RE 4YWGG 2PNRC 5COYA 3T56B 2VRRB 2IX3A 4KHZA 5IGFA 1WYGA 2GRIA 4FO2A 1IYUA 2GB1A 2G4DB 1AFPA 1PFDA 2INDC 2FNJB 3RN5A 3I72A 3RNEC 3MFGA 2JSOA 4A3MG 3SU8X 4FJYA 2NVQB 3D31A 1CZGA 4A3CG 4KKJA 5D94A 2KLCA 2L0CA 4UPAA 1WGYA 3BU2A 2Z4HA 3BVZA 5CV9A 4OX9Q 1FFVA 3MEFA 5C0XJ 3P42A 3DLLA 2WINB 2WGSA 3MFYA 3H1UA 2O2VA 2C60A 1GG3A 3VUWA 1BF4A 1PV4A 3K0XA 2O6VA 2JN4A 1E0ZA 1SNDA 1O7LA 4KV6A 3QOJA 2BYEA 1XT9B 3QWZB 2KACA 2K6QA 4XQNA 3URYA 3S2HH 2PJHA 2WDRB 3LXFA 2EDGA 3CCVA 2Z59B 3PV1A 1SB3C 2F0TA 2KFKA 2MO1A 2FJ2A 1WVLA 4G4KA 1EIYB 1CKNA 2KZRA 4YCVA 2F1MA 1NJIC 2AWTA 2V1YA 1EWCA 4APVA 4YWKA 1OXUA 4OO1G 1PDQA 1PMRA 2OEOA 2WIIB 3RZFA 4DR3L 1DOKA 3PUZA 1ZW7A 2UXDQ 1JWBD 1TT5B 4FBJB 3J9CA 5FLXL 1SIJA 3J80i 2F0QA 3F1ZA 5ELNA 3QHTA 2D3GA 2KWUB 1RFKA 5CC4A 1E7ZA 1WFYA 1JICA 4RGNA 3V05A 4C3IG 4JI8Q 1WZ3A 2JYTA 5E6NA 2R93B 2VQEQ 2R93G 1Q12A 2X8XX 1WTHA 1TWGB 2WXHA 1QE6A 2EY1A 4ANVA 4WQOB 2A69D 1E1OA 3AECB 5AZHA 1SMYC 2N0SB 1PYSB 3T13A 1YJIA 2GVBA 2C35B 3W2DA 1KLGD 3NELA 3IBEA 1QOHA 4JI6Q 1Q10A 2XEWA 3PHWB 4TQ1A 3S1RB 1QILA 2SEBD 4LJZC 2G5DA 5EKKA 1EQQA 1CA6A 4PZ8A 3CC2A 4BY1B 2AL6A 2ZVNA 4MACA 2R3ZA 4K5VA 2EXZA 3S16H 4ANWA 2ASQA 2IHFA 2WDVB 4BZAA 3PTFC 2KCTA 4PZ7A 4R4TA 1B53A 2ZPNA 2F0IA 2SNSA 3U2SC 2PQAA 4JI3Q 3STBD 3L9AX 3MC0B 1XMOQ 3BY4B 4OGQC 1Q8IA 2VQFQ 3OHXC 3CP0A 4Y52H 1XLOA 4B3TL 1GB1A 1GB4A 3E9HA 1ZE3D 4X57B 4RKBA 1H9SB 4HJKA 1YX6B 3TS0A 1SEBD 2WV6D 1VQEA 4BWGB 2AX5A 2YLMA 2A6ED 4OONA 1JQYD 3G7LA 4KLKA 4TSSA 1WI5A 2KCCA 4KIKB 2E2DC 3K81C 4HCPB 4A3CH 1HFNA 4IOIE 3QO2A 1FRDA 3M3YH 1KAWA 3D3RA 4JC0A 3HVDA 4RGOS 3J80L 2F4IA 2JXXA 4IM0A 4USAA 3BYTB 2EMSA 2R7ZH 1EZ8A 3PGEA 3CXCA 1FNWA 3VR5A 4EVOA 5K5PA 3U52E 1H4RA 4A3JG 3BK2A 4NQLB 3ZJVA 2YU9B 1GUWA 1V5TA 2PZWA 3TN2A 1RTNA 3DHHC 4L8JA 3P4RB 1L1OB 2RGFA 4RHRA 2SDFA 1RWSA 2V1CC 3QK0A 1HTQA 4BBSH 1SBBB 4MEMA 1PH2A 3M95A 4JI6L 2VUMG 4EGVA 5E6JA 2MA9B 5FKAC 1GNUA 3RD2A 4FVMA 3CQZH 1PTOF 3EN2A 1R4NB 3TZDA 1IBKQ 3PO3H 2NPTB 2W55A 4BKSD 3KBXA 4GDLB 5A2QE 2L00B 2KN5A 3ZW3A 1XTDA 4GU2A 1SROA 2QHOA 3CMMB 4FHKA 4K1RB 3MEHA 1H9JA 4LDTB 3NZUA 1KH0A 3HKSA 4NAWB 3NUCA 5D3IB 3KDFB 5HFYA 5I9PA 2VH1A 5I6WA 5LMNQ 1G6PA 1CJEA 1LT4D 3H7PA 3PVLA 4TV3A 1EY6A 4DV1Q 3WAOA 2PIAA 2K6AA 1NDDA 2JJQA 2WFWA 4LFBQ 4J6IA 2WDTB 1DYQA 3T3OA 3ERQA 4H44C 4G50A 1X3PA 1BDOA 1WGHA 1II3A 1G2SA 3T9LA 2VY3A 2OTJA 1VRAB 3QWNA 5BN4A 4JW0A 2K5NA 1QOAA 5FK9C 1TKYA 5AJ3L 4AQYQ 5JXVA 4FHJA 3KLRA 1K53A 2VQFL 2CU1A 1SLJA 3PZ8A 5CV6A 1WMHA 2GBMA 5G5HA 3AU4A 5M3MH 1NI3A 4B6WA 1LTSD 3E6ZX 5M3FB 1WF9A 1YNTE 1F2RI 1ZKHA 1NUCA 4N59A 3S1MB 4EZLA 1XQQA 4EQOA 4A3DB 1X1MA 3APCA 3AE1B 1BCPC 1YN4A 2EKIA 3VR6A 1UGJA 3M4OH 3BZDB 2HDMA 4HIKA 4I6LB 2QEJC 2NBVB 4DAYB 1N36Q 5EE0A 4U673 3DVGX 3G6EA 4HTHA 3DPDA 4DKAC 5C3EB 1WY8A 2WXNA 2UUCL 3ZRCA 2YTXA 3D6CA 2AQ1B 1VQPA 4L5TA 1JALA 2BYTA 5IGBA 3H15A 4P1BC 1YJ1A 2MHJA 1U9RA 4PZ6A 3G71A 4YTPB 5ISRA 1VQCA 1FXAA 4NNJB 2X69A 5CBAE 4W9FA 4V0BA 3S1QH 4QQBX 4A3LG 1I3QH 4ALPA 1QF6A 5KYIA 1QOBA 1AYFA 1TKWB 1AWDA 1ACCA 3J80c 1K50A 5JPNC 3Q8CA 4HDQA 1SIFA 1WMHB 4JI3L 3K59A 2F3VA 2KDMA 4K5WA 3C1FA 2LMCB 1X32A 1BBWA 4NB3A 4OIKA 4A8XC 3A54A 1XNRQ 1D7QA 2MH7A 1N63A 1SNMA 2LWPA 5C44G 1N61A 2NS5A 1B50A 5EE9A 1M90C 4KY7A 2MPMA 1VMCA 4UP9A 2DNFA 1E9MA 5IYDH 4BKSA 3NBHA 5IGGA 3FHWA 3WOEA 2JA8B 4LNIA 1UE5A 1FFUA 2ZXPA 3AMZA 1KNAA 2IGDA 1OEYA 2LVQA 1SXTA 3G48A 5LMUQ 4YT0B 1VQMA 1TWCH 4IQZA 1FD6A 2KDBA 2QSDA 2IL8A 1WIAA 3MXUA 1TU2B 1WJ6A 3UI3A 1CM9A 2EZVA 1MG4A 3NE5B 2Z0DB 1I6HB 4XYCA 1TWFB 5C0XG 3OMCA 1UWMA 3IFTA 3HOWH 2B8FA 1WTRA 4P16A 2INNE 2CS4A 3GB1A 4R9WA 4WJQA 4C1NI 1ZXIA 3HS0C 1ZDVA 2A6EC 3QG1A 2JF5A 1HZ9A 1WJJA 5H92C 1LTID 1WZ0A 1Y1WB 1X3GA 2KFJA 3AFPA 2BVCA 2LGXA 5D6JB 2JQRB 1I50H 4L63B 3RZOH 5J39A 4EE2A 2HE7A 1ZPSA 1N32Q 4N9TA 1WD1A 5C4JH 2YTVA 2X6GA 5IP9G 2UUAQ 1WH3A 2K1FA 2EKEC 1BUVT 4X6AH 5E6PA 1UF0A 2V4LA 3HOXG 2MW5A 4JOIA 1Q8KA 3R7QA 1AEXA 5IYDG 4H2AA 4MTKA 1QVCA 1NYRA 1AP0A 1CZPA 2IO1B 1DOLA 1L5PA 1CSPA 4QIWE 4C3IB 2NBWB 3AH7A 1XWEA 4G57A 2W3RA 3HOZB 2CHWA 2D5GA 2UXCQ 5IIFA 3HOVH 1WTQA 4WJNA 3RNCC 1ZP0B 1CFMA 2M00A 2M9VA 2H5XA 4IPHA 1HNZL 5KHQA 2PEAA 4C3HB 3I73A 4GLSC 5GADC 4DDGD 3D0FA 3TBIB 4C56C 1SJHD 1MHXA 3AE2B 3KJPA 2Y0SB 5FO8B 2WXGA 4DR7L 4KTAA 4K0KQ 1CKMA 2EYOA 4M8MA 1GOZA 1RKNA 2YYZA 3CRLC 4A3LH 5JJLA 2E76C 2JVCA 2KDIA 2YEPF 5DEHA 3T1HL 1JOQA 2ZZPB 4GDLA 4C00A 4HVBA 1P9DU 4CJ2C 1Y14B 3L2PA 2LGSA 5J22A 4DV5Q 4W9EA 2WS3B 3WWVA 1PYBA 1QNUA 1F52A 2W54A 2RPVA 2KUMA 1R7SA 2AWNA 4OVVA 3ZNID 1RODA 4YCWA 3M9BA 3UF8A 2BQQA 2FAZA 1YN3A 2MP2B 3OG5A 2FFKB 5EE1A 3LWUA 5LL6X 4R3DA 5AUKA 2V4DA 4A3IH 1T0YA 1YMHE 1PH3A 1YVCA 4CHKA 3T16A 1KL9A 4P71A 2WAQE 3M3JA 4A3GH 2ZNVC 5HGQA 4RA8A 4AYBB 3W1SC 1I4XA 2QF7A 4ID6A 5JZEB 1MVKA 3IAYA 5C4XG 2WXQA 3VRBB 4LNQA 1K51A 4KN4C 4KVGB 3SK8A 5M3MG 2QJLA 1KF6B 1EOTA 2CJNA 2GBKA 2HDLA 2JPHA 3VTWA 3NP8A 3D4DA 4ZRZA 4C2MB 2PQEA 4MM3A 4BA2I 3UE1A 1N33Q 4QUCA 3KVFB 2ZTDA 1PFNA 4DAVA 3ONAB 4X64L 1VQKA 2JEAI 1K8OA 3DM3A 4HCNB 4ZK9B 3TEZA 3J80E 4J15A 3VR4A 5C6AA 2O6VD 4IOCA 2F0KA 2JYEA 4A4IA 4GN5A 4DK0A 2EYHA 2B63B 5I4DA 3H3VH 2PMVA 5DCNA 4ME3A 5D14A 3D8GA 1VR9A 2OQ0A 4BY7H 2LGYA 2JZ3B 5GAEC 3DBHB 2KJHB 2NWGA 1XNQQ 4DGZA 2RMMA 1PH4A 5IA7A 4JV5Q 4B3RL 4JYAL 2B2WC 3P20A 1OTCA 1N33L 4AIMA 3ML8A 3NQTA 2NR2A 5HI1A 5BN5A 2G9HD 5H1SE 1P0RA 3GTOB 1V1OA 1F2RC 3FRPB 3SR1A 5A2QL 1L4DB 3MVVA 4IKGA 4ANXA 3BWUD 1HR0Q 3PMFA 5JJIA 2BDNA 1E8XA 3KUZA 4H13C 4KGTA 1AE2A 2NYZD 1T0SC 1E3PA 4IUVA 2KJ6A 2BS2B 4AS1A 1PH7A 1E8YA 4P7IA 3Q69A 4JI2L 4DV3L 3RN9C 4J3OD 4JBMA 1QZEA 1Y8OB 1J9OA 4US8A 4OZBA 3CSFA 2IW3A 4HJGE 1BR9A 2KWCA 2D0PA 4YXDB 4RCOA 3PLUA 1B2TA 2R92G 1NYQA 2BYFA 3E3XA 4W9HA 2EYJA 1KIXA 1XCTL 2K1BA 4DK6C 1MHWC 5I2YA 4UDUC 3WAMA 2V0GA 4JI0L 1XJVA 2XK5B 4IW0A 3FAHA 2CJOA 3HHMA 3Q2AC 4LFAQ 3TMPB 4YIJA 3ETRA 3ZDMC 5BMGA 3L13A 1IL2A 2KAJA 2IY0B 4FJVB 3I9V1 1ET6A 4L2YA 4RCNA 3MWYW 1FXTB 3DWGC 5ELCA 5M3FG 3NY5A 1VZ8A 4C80A 1J7BA 1GUSA 2ZM6L 4GS3A 4IUTA 1YJNA 5CHFA 2K8HA 1YJJA 3SXHA 1C9OA 4R4QA 3GTPB 1TGZB 3AEVA 1STYA 1UEAB 2K75A 2JA5B 3Q3MC 4KX6B 1E22A 1HQMC 1IBXA 1DD2A 1I4RA 2MWSB 3FC4A 4LF9L 2MHVA 2N88A 4A3PA 1FNVA 3A1QB 4WH4A 2J53A 4ODGA 1VQ4A 1VD2A 4YTNB 3TP8A 4AJWA 4DK1A 2JA5H 1WGKA 5DLQE 1J7CA 3TSSA 2REXA 3U4EG 2DJFC 2B39A 2Z4IA 3GTPH 5IP7H 1SFOB 3BVMA 4WWPA 5L95C 4LMQD 2O2LD 1VQLA 3RNGC 4KSKC 4B9WA 5CGKA 1X9NA 2A69C 4KKIA 4CJ0B 1EY8A 3AN1A 1ICWA 1SMYD 2F4VQ 1SYDA 1JOOA 4A90A 3LDZE 4K2LA 3KH0A 1IW7C 2KNBA 2WXIA 3IFWB 3P4SB 4JI4Q 2ZTCA 1C0AA 3OYYA 1VQ5A 2LVPA 1FGUA 2JE6I 5IGEA 2L1AA 2GVAA 3PIP3 1H9KA 1EWHA 1EF5A 2VZAA 3LB8C 2QIEB 4QF4A 5CMDA 1I4GA 4PMWA 1L0VB 2CHZA 3ZNZB 4C7YA 1V49A 1VJKA 4E71A 1YJWA 2EE1A 2EY2A 4A3FH 4FF2A 3AEGB 4CO7A 1U0LA 3FKYA 4IPDA 3A8KE 1HPCA 4WWMA 1WCMG 1Y69U 2LXCA 4L5QA 4NKLA 2DBYA 1KQSA 5HGTA 3ONSA 1FVIA 4PT5A 3CCMA 4DNRB 4XX5A 2IGHA 1KLVA 1SSNA 1JRUA 1WR6E 2GN5A 3RD4A 3PSIA 3K5MA 5G3LD 1QZGA 4WAFA 5JEAJ 3EGRA 3A7AB 3L7ZC 1KXLA 5LHY1 3MTSA 3UI2A 3BJUA 3VR2A 1D5XC 3S1NB 1RAXA 2RF4A 4DV2Q 2F0FA 1XPOA 4HEA1 3JSVB 2QDFA 2K8CA 2JA6H 3NTHA 2ZPYA 1WCMH 5C1ZA 3VUYA 3WOFA 3I57A 4IALA 3VYSA 1XNQL 1F2ZA 4HN7A 1MJEA 1A62A 3OLMD 4A3JB 4M8AA 3QCAA 2SOBA 5M5WH 1EM7A 1J0GA 4EQNA 2FCMA 4ULLA 1XMQL 1E1TA 3PUWA 1SSOA 5BYQA 2BA0A 3NBIA 5D65A 3OTOL 3D4RA 4OWWB 1HTPA 2PMZB 3J81E 3VYTA 1Z9FA 4YY3L 5IWAL 3GTLB 1G91A 4F8MA 1L2NA 1NR4A 3JAMi 1PYWD 2YEPB 1WD0A 3X3NA 3HOXB 1WJ4A 1E5WA 1Z7TA 5G3LF 4A3FG 3U30A 2L5TA 4HIDA 5EPLA 3ENEA 3SFDB 2KQ7A 2R2QA 2CWPA 3ZDTA 4HEDA 4YSYB 1Q1BA 4C2MH 2BOSA 3PV0A 1PH5A 3ZNGC 2C9OA 4R8IA 3S14B 3TEWA 4DA2A 1BMLC 4JK1C 3Q23A 1PTOC 1SJED 4LF7Q 2K14A 2XTIA 1BCPF 4PQXA 4IZ8A 4D2KA 4N8FA 2RA4A 2K8BA 5T1GA 4LNOA 3A9JB 3I7FA 4ICVA 4XYOA 5KRUA 3F2BA 2KCMA 3Q0AA 2MP1A 3DEPA 3K58A 1V1PB 3HOUH 1J6QA 2NVTB 2KOXA 2JSVX 4RFBA 3CC4A 4OO1I 1OXXK 2MBHA 2V3NA 4OL7A 4MTNA 4G0NB 1N34Q 3L10B 4BKTA 4JIOU 4C4VA 1VQNA 2F0OA 2M4NA 4BVUC 4FLHA 3R7RA 4HIOA 4NJCA 1SYFA 1GUGA 4JGHB 3ZJUA 1WGDA 3IT6B 4CQNA 3X3MA 1K83B 3GTMH 1QLBB 3PUXA 2MSED 3HEJA 2EY6A 4OWXB 4BXXH 4IFDI 1JW9D 2Y3AA 1DONA 1GUAB 2JA8G 3OWFA 3DBSA 3W5VB 2KD0A 2CWAA 3CPWA 1MKHA 2HTHA 4HAEA 1LTTD 4LUZA 3UDGA 1KRTA 1JB7A 2JA7G 2JA7B 4GDKB 3T1YQ 1ESRA 1J8IA 2INCC 4K3CA 1JT8A 5C4XB 3NENA 2KQSA 2R7DA 3HOVB 4IG7B 2WQYB 1EFID 1HQRD 1LABA 4FNFA 4YWLA 2L05A 3VR9B 3CHBD 4DR7Q 4K0KL 1SE8A 2LJ5A 4ZLTF 3V62A 2K5DA 1TWAH 2JEBI 2QGQA 3V61A 4WJWA 1XO3A 5KNBA 5IOCA 2HCIA 1UELA 1A5RA 3F2CA 4POFA 2F3IA 4LF5Q 4HMJA 5C4JB 4QCLA 1LYLA 4KKTA 3AU5A 5EAYA 3AXCA 3KW5B 2LY7A 1X3FA 4XIGS 3AEEB 1I50B 3BYYB 4YHHL 2LUMA 3N1ZC 4DUYQ 1GUTA 3OW7A 1KDBA 4H7BA 3DVNV 1FR3A 1TS3A 4K6DA 1Y1WH 4CJ1B 4H0LC 2C9WB 2INPE 3RI7C 3X23A 1MI0A 1YBYA 3MHBA 1PA6A 4M8NA 4ZYNA 2M56B 1IBMQ 5TR5A 1B44D 4A3GG 2K6DB 2LS01 4R1JA 1FL0A 3DWQA 1ZOYB 2ZW1A 2RDBC 3J7A5 3VAWA 1A2TA 1Q5WB 1VCIA 2IDYA 3VYRA 1A0IA 3KUPA 3HM6X 1C77A 3SR6A 1TXYA 4K6LA 3WANA 2NZ1D 5CV5A 4M00A 3H6MA 2L15A 2WB1B 2KC1A 3DOWA 1IBXB 1H9SA 2ZCCA 1JORA 4WWNA 3E0JA 4TKOB 1BO0A 1TQOA 2ZW0A 3P1MA 4OELB 4MGYE 4M02A 2PNHA 5LLIA 2AUKA 4OHJA 4NW2A 4AH6A 4MGIE 1S5BD 4KKUA 2GI9A 4FXKC 2R61A 3GZNI 3T53B 4DHZB 2WAQG 4KIKA 4OO1H 1NCVA 4UHVA 4XQQA 3GE8C 4JYAQ 5IP4D 1OO9B 3MHZA 5IGCA 4JV5L 1YQBA 2KBNA 1N8RC 2MJEA 3B2FA 4HK2A 2F0JA 3WAPA 3K5OA 3TMEA 1F77A 1B9NA 3N30A 2VXWA 2N3SA 1EEFD 1Y1WG 4L5RC 5C4XH 3M7NA 1DOXA 3HOYG 1S5CD 2F52A 1EUJA 3X0WA 1RM6C 3K8AA 1BOSA 2Q5WD 4RM9A 1CKOA 2Z6KA 3UQBA 1QQRA 4L5SA 2L4NA 4ILWA 1GC6A 2RHSB 2OCEA 1NMFA 1NI2A 2GBRA 2K52A 3BVGA 2KO3A 1R4QB 5FLXc 3AFQA 3U9OA 3J7AF 1Y56A 4IC7B 2K5VA 3H0GG 2UUBL 4AUQC 1T5XD 3KOJA 3O13A 3A56A 5CR3A 2N7EA 2FCQA 3NUHB 4IUUA 5I6YA 1YOVB 1OQYA 1B9RA 3RZDB 3C0RB 1TJEA 4NJ6A 2EYLA 1U5KA 3BDCA 4RWSC 3BS1A 2JP1A 4HJ5A 5KYLA 2ZXOA 3KF8B 3OTOQ 3HOUB 4C3HG 4C3JB 2EJMA 2F03A 1TS4A 4IURA 4QJFA 3TREA 3DDCB 4QIWB 1TS5A 3J7AV 2DLBA 4K3BA 4F8CB 3S1MH 4HSPA 2EMTA 1STEA 5M3FH 1TIID 5DPWA 3TS2A 3KK7A 1SYBA 1IHZA 3GTQB 1KRSA 3M85A 5GAGC 4OW0A 3NG0A 1I6VC 4FXCA 3EFXD 3V96A 2NTSA 5FJ8H 3EHVA 1V2YA 1HZCA 4Q0FA 3GTKH 1TS2A 4GKJQ 1WRIA 2A4ZA 2KECA 1JMLA 2E74C 2WYQA 1SNOA 4A3BG 2N49A 4K8IA 5GQOA 1KABA 4ZCKA 4I6PA 2LHDA 1PHJA 1JROA 1AW7A 3HGBA 1A2UA 1AZQA 3GTLH 5EKIA 1Q3LA 5EKLA 5IODA 2BB5A 3DBLB 1F9PA 2IWHA 3OOCA 1UE7A 1ZDXA 1Q0WB 3DVGY 4DR1Q 3GTQH 5ELEA 1P16A 3A8IE 2MQJA 3ZUNA 1GUNA 1F9JA 4BBNF 3U4ZA 1Q90A 5J2RA 3I4MG 3PO2G 1GXDC 2A74C 2OJRA 3C8YA 4WIPA 4ASWC 2Q8TA 2JA6B 4MJSB 1PXUA 2BYVE 3T3NA 1U4AA 4DV5L 4J1MA 5C3WA 1QOGA 3WCQA 3PF5A 4PS8A 2IX1A 1NR2A 4IUNA 2UXBL 3QX1A 2I5LX 5AFWA 3QOLA 1TZOA 4FJZA 1PLFA 4GDKA 1E0BA 2XNAC 3Q6SA 1N32L 1WI0A 3L0WB 4B9KA 3VFKA 3AE8B 1O7ZA 4DR5L 3J81i 2SAKA 4N6EB 4IJLA 3CMEA 3U4VA 2A5UA 4IWQA 4RG1A 4DR6Q 1N60A 1HXYD 4W9GA 1FCLA 3S9WA 2PW5A 3I3TB 2N9PC 4ZRQA 1E6EB 1F2MA 2HIXA 4A3FB 3VH3B 4F7XA 2JA5G 4HDOA 2ZEQA 1IP9A 2RDGA 3MZ5A 3NQIA 4UP8A 1Q81C 3A8JE 4RAUC 5KGUA 3ZRFA 1EIGA 4HCSA 4B9XA 1TT2A 1V1QA 2KHSA 4EQPA 2L76A 4RF1A 2MNAA 1HZAA 2I5MX 1QVGA 2CU3A 5M5YH 5C4ZA 1W3SA 1CI3M 1HH2P 3DBLI 1NTGA 3CC7A 4FULA 2FINB 1H95A 3IXSA 2LRUA 2JZZA 1DM0B 4LJPB 2KK8A 2PZUA 2EPBA 2X38A 1PGXA 1UH6A 4LJOB 4LUOA 1I94L 4MELA 3RMKC 5DNFA 2FCSA 1SFOH 3H9DA 5BYSA 3WALA 4LF8L 2TSSA 2G3QB 4KDLB 4CYEA 1DOIA 2JXTA 2Y5BB 2N9XA 2PLPA 5C23A 1FEHA 1HNWL 2MEKA 1RFAA 1C1YB 4O42A 3KUCB 5J18A 5JH5C 2RSOA 3CCJA 3HKZB 4IWPA 1G51A 2WWZA 1Q1OA 1FGBD 1EIFA 5KNCA 1D5ZC 3JAML 2K7VA 4EOYA 1YNXA 1RJTA 4LF7L 3H8HA 5DPSA 4PG3A 1N62A 3VQIA 1LQBA 3IT4B 3SVMA 4WURA 4G7ZC 5HG2A 4FYDA 1CUKA 1EY4A 1IZ6A 2KHIA 2LFNA 2EELA 3TP6A 3PIO3 4B0MA 1MJDA 1WR1A 2E2JH 1G291 2CQAA 3Q8FA 1ET9A 1YD8U 4MGZE 4YL8A 3LWEA 2YVCA 1A3VA 1K28A 2O4XA 1P7FA 2R6GA 1SRUA 3GS2A 1PRTD 4J8QA 4CKCA 2VQEL 4DR6L 3EUB2 4YTMB 1CA5A 3DHGC 1EU3A 1TWAB 4LF6L 4B0EA 4R8NA 4CBVA 2OTLA 5I2XA 2Q8IB 1HHVA 4GZYC 2KTRA 2VUMH 2KXJA 2N7JA 3HIZA 1FD7D 4N8X1 2KVRA 2KJRA 5AJ3Q 4AQYL 1EYCA 3S2HB 3ABVB 3DBRB 1WTPA 2JA7H 2K22A 2LHEA 3A4SC 2QW7A 4OZAA 2D3BA 3GV3A 4DXGA 2HDEA 1KFYB 3LX0A 2D10A 4JG2A 4W9KA 3TL5A 4BY7B 2MBOA 2B2TA 1C7YA 2DJGC 4XXEA 3UGBB 2PVOD 3ZLZA 4BOZB 4DXAB 5T1IA 5E6OA 1Y1VB 1GVPA 3CCEA 2ON8A 2DAFA 3TBLD 2UUCQ 1V80A 3I63C 1FM0D 3V6CB 4GOPA 1B3QA 2NVTH 3I2ZA 3OWEB 4OX9L 5BN3A 1V5OA 3HVZA 4LWCA 1O7YA 3SDLC 4BY1G 3AQQA 2NN6H 4XC2A 2L52A 4QUFA 1R4PB 1CMXB 1NBFC 2WX1A 4KY5A 3B9JA 2OF1A 4C1NK 4B3SL 1B8AA 4A93G 3S14H 4DHJB 1JWUD 2MBQA 4OEMB 5IKCM 2R7FA 4YWMA 2G9DA 2BE5D 3P1HA 2PO4A 1GD7A 4LAAA 2XIWA 5CV4A 4IFDH 3CIRB 5FLMG 2L7RA 1STNA 2UXCL 3NPPA 1R9TB 4A3IB 1C78A 3H6NA 4HRSA 3HOVG 2KX0A 1JQ4A 2YV5A 3FVQA 2G1EA 2PPBC 4FP5D 5L83A 3HM3A 2ZVOA 1Y1VH 1SYEA 4DV1L 2G45B 3PRZA 3EIVA 3J81c 4EKUA 2BB6A 5K36G 1NBWA 1TKGA 2ZJDA 4X3SA 5AUIA 4QB4A 1D6EC 2E8GA 4GNXA 1LACA 2DYOA 1J5EQ 2DHZA 1KD1C 4MJSA 4EX5A 1FXIA 1F0ZA 1SGHA 2WKDA 3FDTA 3I4LA 3SK6A 4X65L 4JBKA 2J42A 3AM9A 4GSWA 4EUTA 2WXLA 3DUZA 1UGMA 3HOUG 1RF2D 2KEEA 3D6WA 2E6XA 1BCPD 4PMCA 1CQVA 3PO3G 4BS9A 5EGTA 2E75C 4C3HH 1U4LA 2F0GA 3K5NA 4KHPQ 4JL9A 2HJ1A 1L0XB 5CHVC 4HMIA 4KI0A 5GROA 5A35A 2N78A 2ZJPA 1VQGA 4B3RQ 1C9FA 2L3ZA 5D3DA 2VUMB 5HURA 2LVOA 4WFN3 1WM2A 3A9JA 4NY0A 1GC7A 1O78A 1W6JA 3I91A 2D0OA 5J3BA 1GAQB 3NXWA 3LNNA 4MNOA 1DXMA 2KQ3A 4K14A 3VXWA 2CKZB 3HP3A 1VQ6A 5BR8Q 5C3XA 3TCAA 3N9YC 5EDSA 4NXML 5IP9H 2QEXA 1XLPA 4IWOA 1N9WA 1VZ7A 4MN3A 3ULJA 3K7UC 1HZ5A 2BT6A 1YNJC 1B9MA 1STGA 1D5MC 1BT0A 1Z47A 1GHJA 2JY6A 3CRKC 2KENA 4M1UB 4GLXA 2E2JB 2KHJA 3D4WA 4R4CA 1NSNS 4E74A 2D9UA 1C76A 1MJCA 2HHHQ 3A74A 2B76B 2BF8B 1S5DD 5LNK1 3KJOA 1RCVD 1IGDA 1S3OA 1MPEA 2BWES 3AE7B 4MM3B 2M1MA 4DHJD 4A55A 2L12A 3HOWB 2RR9A 3P4QB 1TWFH 1YZ6A 4IUPA 4DN4M 4ZDVA 1K0SA 2UXDL 3HZXA 4AWJA 2R7ZG 1JWMD 3NWSA 4AYBE 4DR3Q 4W9DA 3DQVA 1U4PA 1LM8B 2OT2A 3RCZA 5HY6A 5C5MA 1YNND 4A3DG 4C7ZA 4DNTB 1JMCA 2K04A 3CCLA 1LGRA 4LTUA 3ZTCA 3STBC 3T1HQ 4WQMA 3MA2B 3AEDB 2DZJA 3MXPA 2KMCA 2QKIC 3QJYA 2WXOA 3DHIC 2F3WA 4BA1I 1UBIA 2ASBA 2WP9B 3SFEB 5FLMH 1JC7A 4DV7L 3HK0A 1ENFA 5EE3A 3KLSA 4HPPA 1VS0A 4FF1A 2KCNA 4PNYA 3BDOA 2I0QA 1WX8A 2K05A 2NTTA 3PS6A 3VH4B 3H3VI 4X65Q 2R2OA 3ZQ4A 1GM5A 3FILA 5M5YB 1CKNB 2B2YA 2C7HA 4WJ3M 4LK0M 1XX8A 3EFCA 2J52A 4LNKA 1FRRA 3VR8B 3DEOA 4GOCA 3A4RA 2PW7A 2Y0SG 2K28A 2FMMA 4A9AA 4X66Q 4X62L 4G7OC 3VRAB 1WXVA 4PYZA 1BVSA 3RNBC 2JRIB 4ICUA 3FEWX 3GOEA 1BCPB 1I4HA 2F0PA 4DV0L 2B2YC 2XGTA 1ILQA 4MHEA 4DV2L 1PQSA 3PGZA 1WSPA 3BDLA 4DUYL 4NQKE 2LSSA 2EQSA 4Y7NB 4IO9A 1MI2A 2QDBA 2RCNA 4KJNA 1HUMA 3HOYB 1C3TA 3ZXRA 2I2YA 5C0XH 4G7HC 5DAUA 3HFZB 1H9RA 1PVOA 4K8JA 2WX0A 1EQVA 5G55A 2DY8A 3VDZA 1MIUA 2PVGC 2BA1A 2LXKA 2WXRA 3P75A 2QA4A 1WYWB 3IKJA 1IBLL 5M3MB 1WX7A 1QG7A 2L1BA 1F1HA 1HCZA 3DBHI 3I70A 5JAVA 2KTFA 4BBSG 3RULA 2A6HD 4JWUC 3FP9A 3SK4A 4CHTB 1L0YB 3ERSX 1ROEA 3RFZB 3NS8A 2HQEA 1ONLA 4DQOC 5LMUL 4JI4L 1GPXA 4BBRG 4OWTB 3T4AC 4W9IA 1EWIA 1SE2A 3AE3B 3N32A 2JK8A 2H88B 2NUCA 2JT4B 5J1ZA 1ILPA 3L54A 1JCKB 3QJZA 1T5EA 4OXPA 3GTKB 3H7SA 1HFGA 5M5XB 4B95A 3RN2A 5GXGB 1WTOA 1MFWA 1HZ6A 4A3KB 1XPRA 1T6BX 4X3KA 1ZUD2 3NHHA 3ND8A 4EZKA 5IGDA 2LZ6A 2BDOA 4NP5A 2EIFA 3ULPA 4KZCA 3C3LA 1TBEA 2NN6G 1UZXB 3MC9A 3BIID 3NVVA 4A3GB 2F0SA 1JJ2A 1MGSA 1SAPA 1Y8NB 4C3JH 1PTOH 1LT3D 3IFDA 1Q7YC 2VB3X 3I90A 4A3BB 2JUOA 1WYDA 2M0XA 3A33B 2NVUI 4W9LA 1WJNA 2IX0A 4KK7A 2E3TA 5E4XA 5JEAG 3RZDH 2UU9Q 3KF8A 1G6ZA 3VR3A 3MXNA 4KD4A 5C3JB 3VA7A 4B08A 3A9KA 2F0VA 3VYUA 2DWQA 4K81A 2BE5C 2YU9H 2CH4W 2FMCA 1JWSD 5FR6A 4TKNA 2UU9L 2XRSD 2WXJA 3K9OB 3OIPA 1SDFA 4NDXA 2P5ZX 1I5FA 1N36L 4KGRA 4ACFA 3IVFA 1HTLD 1HUNA 4S17A 1HNWQ 3DHQA 2N9EB 4HKZE 4YY3Q 5IWAQ 4KZ0A 1PH9A 4ZKBB 1IL8A 1CZWA 1OXTA 1CK1A 2HD3A 2JQOA 1C8CA 2LXJA 1V86A 1ZYRC 1V6EA 3GV6A 1TVXA 1ASZA 2V3PA 3DBRI 1WXAA 1F2YA 2JZPA 4HLEA 4N9F4 2KJXA 3S24A 3HOZH 2IHEA 2AEHA 3Q8BA 5JJZA 2F4VL 4HROA 2K4KA 3GO5A 2KMMA 4C3IH 2CHXA 4OVZA 1WE7A 4E3CA 4DXFA 1XCQL 2FUHB 2LKVA 3W9CB 1BNZA 1VF5C 3APFA 4HWIB 2DZKA 4RKLA 4AYBG 1JE4A 3TEXA 3V2TA 4II3B 2RQXA 3AV8A 2DNEA 1ZXHA 2BW2A 2F0WA 3A5ZB 3AYHB 3NSWA 4RMFA 4JI7L 2W3SA 3ZVVA 4DV4L 2TMPA 5JOBA 4ZKCB 1DJRD 1VQIA 4ZYSA 4QAYA 3VTUA 4QMGA 1N6ZA 4BY1H 4JI5Q 2NBUA 1KRHA 2FHTA 1I94Q 4NAWA 1WTVA 1GJXA 2B2VC 1HTOA 3S1RH 4IJHA 1NE3A 3EROA 1SNCA 1YJ9A 4NXNL 4L6TB 3Q8DA 3Q3OC 4XDCA 5J17A 2ATWA 2F0LA 3M4PA 4U68A 3H94A 1BBXC 4HJ7A 1RRBA 4WJOA 4KY6A 3EECA 2RDFA 2MCNB 4O1NA 3JYUA 2ACZB 1I6HH 3KF6A 4BXXG 1PH6A 1A3UA 1IYFA 1S5FD 2R93H 3R66C 1E8WA 4RGMA 2A1AA 5ELBA 1L6VA 4XWTA 1PTOD 3I4NG 3RYTA 2I46A 5K36H 2L9HA 1PDXA 4X3UA 1HNXL 3PRMB 2LGIA 1EYDA 3UDXA 2LXAA 1L4ZB 4B3ML 4PS3A 3PO2H 1J8CA 2KDFB 3WDNA 1T0RC 1LFDA 4O0AA 1LTRD 1RD9D 5ELOA 3PIPA 1TIFA 2NVYB 2KX3A 2D3CA 1EYAA 4ABNA 3CD6A 3V6EB 2KEDA 1YNJD 2Z1CA 1KOTA 3Q6BA 4RNAA 1QUQB 1SE3A 3BK1A 4CKEA 4XWWA 4EQ5A 4BFRA 4UY8C 1IW7D 4CDFC 1S3SG 2LI5A 3QIJA 1ZEQX 3NK9A 3K6OA 3NVWA 4PV1C 2Z0EB 1JJGA 1E7UA 4GOPB 4P73A 4DV7Q 1Q82C 4US9A 4MH8A 2Y5CA 4JI1Q 2MRPA 2MGSA 2JA6G 2Z6BA 5IYBG 3H3VC 2M19A 3NJTA 3KQ4A 3U8ZA 4TMAB 1I3QB 1F2LA 1LLRD 1JR0D 1ZKOA 4LFCL 1VQDA 2GLSA 3EA6A 3PO0A 3L3OC 4DR4Q 2B2WA 1K83H 3GTMB 4I6NB 4UP7A 1PRTF 4ARIA 3B6YA 3OJ4B 4TVAB 1RLFA 2N1WA 1CSQA 3TJPA 1RTOA 1IGCA 2LJIA 4GN1A 4UAIA 4A76A 3K5LA 2LASA 2L83A 4LFAL 5CX3A 2UWQA 1KJTA 4DR4L 2FXQA 1IYJB 4NPNA 4Z9CB 3EBEA 3ITPA 5NUCA 1R4NI 1N34L 5T8IA 1TKEA 3KFUA 1C79A 3M4OB 4FF4A 1Q1EA 2MLBA 2D62A 1E8ZA 2KTRB 2BWFA 3MJWA 4MT5A 2KHWB 5IT9c 2WXMA 4RM8A 4LF4L 5KHOA 3NZ3A 2A5HA 4DHZE 2CHBD 3P4PB 2F0HA 2GA4B 2DUDA 3VUXA 3JW0X 1RYJA 4P72A 4WRDA 1BXTA 3JSVA 4RHSA 4GKKL 2CFMA 2EJFC 1ENCA 1PUTA 4LF4Q 4HJ8A 4A3OA 3IL8A 3GP7A 3HOXH 3P2BA 1YHQA 2D3AA 3ECIA 1N5WA 2OOBB 2QMTA 2B8GA 3M4QA 3VA5A 1EL0A 1IUEA 1LTLA 3ZYYX 1YX5B 4ME5A 4FF3A 3A7LA 2C5LC 2GMIC 5G5GA 5M5WB 1MSHA 3CWIA 4A3JH 1JOKA 3KUDB 4LF8Q 3CMAA 1WTWA 4A93B 3EFUA 2XVSA 1WX9A 3W1YA 1WCMB 4KHPL 3SD5A 2Q2IA 3QB3A 2I38A 4ZRJA 3ZKJC 1LTBD 5G2NA 1I35A 3S1NH 1EF1A 4N58A 1E24A 4N9PA 1T0QC 4IPCA 3AMUA 2VB2X 4NPSA 1K3BC 1J5EL 2LD9A 4BBSB 1VQOA 1TY0A 3W1GA 4ZUJA 2SNMA 1D2BA 3SHLA 1X54A 3S2DB 2LFIA 3ZXVA 2K03A 3HOWG 3QQ8B 5IO9A 3W3AA 4RMAA 4GNXB 1XXGA 1SF0A 2W82A 1EIHA 1K52A 3VVWB 1HA5A 4KJOA 3MXGA 2R7ZB 5LXIB 1WWTA 4S0RA 2OXPA 3AB9A 1S72A 4FN2A 1WXQA 4XT3B 4JVZA 3BZCA 5IYBH 1HEZE 5KEEA 1AH9A 2IT1A 2B2VA 1UBQA 1HNXQ 1WOCA 2ZM6Q 3J81L 4A3KG 4GGQA 3U50C 1YHBA 3R2IA 2WLBA 4E6IA 2VH2A 3M63B 1S4ZA 2B29A 3NTIA 1XLQA 4ANUA 5EPKA 3Q22A 3SE0A 4HR7B 3RMHA 2XWBB 4X62Q 5CV8A 3PF4A 3AE9B 1E2VA 4M0WB 3GZNB 2DZIA 1EEID 2WHIA 1VCBA 2ICIA 1EQTA 1MBYA 2LRWA 3S15B 4XDXA 4L23A 3L16A 4PS7A 3EJIA 1PZID 1WGGA 3N1XC 3GQBA 2A19A 3RR5A 1TWHB 2K25A 1VQ8A 4ZHOA 1VQ7A 2OWOA 1PFMA 3CCRA 4BY7G 5C2TB 4ZOHC 2K0PA 3KF6B 4LNNA 4ZRPA 2IO2B 3DWPA 2IGGA 4KD3A 3I55A 2KANA 2KDEB 5D7GA 1TTNA 3RPFC 2F0MA 2CKHB 3NBHB 1LV9A 1S5ED 1I42A 2WP8J 4K5XA 2FIFA 2PKOA 4RGTA 4GN4B 3TQYA 2JU6X 1S40A 1MD2D 3R93A 3ALBA 3HG9A 5BR8L 3T51B 3UINB 5IOIA 2UXBQ 2LMCA 4DAPA 3A9KB 4K7UA 4F87A 3P7JA 3NVYA 3ZNHB 5LMNL 4JQWC 5JVG3 2NB0A 2WU5B 1E7PB 2Z6KC 2VZKB 2DY7A 5EJWA 5EBDA 5IT9L 2DENB 4X3TA 4CGYB 4A3IG 1Q86C 2HHHL 3GTJB 1KM7A 5MPOA 1HRJA 3BZKA 2IO0B 1JRPA 5CTRC 2AYOB 1NNXA 1EY7A 4DAMA 1L0WA 3AI5A 1BQQT 5KNDA 5FJ8G 1AZPA 2RSUA 2RD0A 2WU2B 3ZJTA 2K5QA 3QR8A 3ICEA 4MH0E 1QUQA 2DZMA 2C7MB 1B7YB 1QNKA 4BBRB 1RIPA 4LLGM 4RF0A 1IYVA 4RH6A 3E56A 1C4CA 3B0AA 4FXGC 4V190 1A15A 3GTOH 1QKZA 2MJDA 4CDEC 1FYCA 2ONQA 2HQLA 1YHAA 2LGDA 2W9NA 2N7DA 3TUOA 3F8TA 1PZJD 2HCCA 2MBEA 4GLVB 3AULA 3N3KB 2D5DA 1B70B 3Q3JA 2E2IB 5C4HA 5IN7A 1HJPA 5DM63 4DV0Q 1XTCD 5HKHA 4NAMA 1SN8A 4WJ4A 4MDKE 2B63H 1NAPA 2XRQD 5E3FA 4MIUA 5C0XI 3HRZC 4GN3B 2OJWA 3PZDA 4HSVA 2J0KA 3RLNA 1Y8RC 3TEHB 2B3GA 2E5LQ 1K8RB 2JXMB 4BBNC 4A3MB 3QARA 4IFDG 4QY7A 4DUZL 1UWXA 3HUIA 1U4RA 1DGJA 2I1JA 4I7AA 3R3MA 1SE4A 3GD7A 1YEZA 1TWHH 2GOWA 3U7DA 1E7VA 4HCEA 2KWDA 3QA8A 1TY2A 3SK5A 2R92B 1QVFA 2XBBC 3JAME 2K50A 4NMZA 5DPRA 4P2CB 2RCFA 1PH8A 3U58A 1EU4A 4GOPC 3C46A 2PI2E 2Q2HA 3PUVA 3KBGA 3EQLC 5EBCA 2PQAB 2L0FA 1FPYA 2ENBA 1FJGL 2K39A 3Q3FA 4XTCS 5IYCH 2EJGC 3CKIB 2F0NA 4Q2JA 4DWFA
chains in the Genus database with same CATH topology
1STHA 4YSZB 1NVID 2JWUA 2WXFA 5JPMC 4JBWA 1F9QA 2IJ0A 4ZUIA 3E5SA 2HTME 1YN5A 2BTEA 3TP5A 3OPOA 4I7ZC 2MJ3A 1CHQD 3G6JB 3KWVA 3QIAA 2N9LA 4K2KA 3FMCA 1CHPD 1GUOA 2AUJD 1NEKB 1F9SA 1QOFA 1G2TA 4WORA 3W5UB 5M9OA 1Z6HA 1V8CA 4TQ0A 3Q8AA 3AEFB 2K5WA 1TR5A 2N9KA 3H09A 5FO9B 3NS1A 2K32A 2O5IC 1OXVA 4M0WA 3RZOB 2VNUD 5C5LA 5KIXA 3MP9A 1IKLA 3SEBA 4IFDJ 4DFAA 1EY9A 1U4MA 3AE4B 1QJOA 5JEAH 2B2UA 4KMUC 2QILA 1PGBA 1KDAA 4ARCA 4KHVA 3K57A 2XSCA 3NRZA 3H0GB 3NWTA 1TWCB 2K33A 3EVQA 4LK1C 3RLFA 5JVH3 4L1BA 3NTKA 4DF7A 4KGSA 2B2UC 3ND9A 2M0AA 3OSOA 2H1EA 4S3SA 4DU9A 2F0EA 1XYIA 4IN3A 1UNSA 3AE5B 1YNNC 4KKSA 4IDIA 1C4AA 1MHHE 3R2TA 2K5PA 3TZUA 3PZ7A 2CW0D 3TDQA 3I4NB 2L55A 1VDZA 2BS3B 1XF5L 1CQFA 2AQ3B 4CKBA 1G8ZD 5EPJA 1KTKA 2JYOA 3FPPA 4IUQA 2XN9C 1PRTC 3S1QB 1CT1D 1YQ3B 3FILB 3IAS1 2A68C 2RBMA 2NVXB 1E10A 2RVLA 5IT9E 3NVZA 3U9SA 1D1IA 5ELDA 4J6HA 4PMBA 3PO2B 2JX5A 1H9MA 2KVMA 2WDQB 5BMIA 2EYMA 1PGAA 2BCOA 2FE8A 3J7YW 2PYKA 2O5JC 1XLNA 2CW0C 3AEBB 2OEDA 4F88A 1QWYA 2NBFA 4FXDA 1YQ4B 2H89B 1D1KA 2J0TD 3HRDD 1AN8A 1C4PA 2FUG1 3AB5A 3B2GA 2A6HC 3L4PA 3TP7A 1FIQA 1TYGB 1STBA 2M2LA 1VLBA 2KOLA 4I65A 1A70A 3E9SA 2ZT9C 1KNEA 4A3EB 2WACA 4REZA 2RSNA 3PO3B 3CQZB 1EZ6A 4JWSC 3PUYA 1NENB 4OIJA 5TSSA 3M4YA 3U7ZA 1I4QA 5C44B 1HA6A 2DNCA 1QCBD 5CV7A 5BMHA 5FO7B 1UAPA 3OMGA 4ZHPA 4ZQ3A 3DWMA 4JPSA 3M3YB 2KQ4X 3W1SA 1Y8PB 4KN7C 2RKSA 3N52A 2RDHA 1V1PA 1D4BA 3DXJC 1OQQA 3GTGB 2L11A 1PZKD 1PTOB 1DCZA 1LT6D 1FMAD 1L6UA 3N6RA 4YSXB 3RUZA 4JX1C 1B4OA 2PZTA 2A73B 4TQUS 2KN4A 3P63A 3S16B 5HHDG 3Q8EA 1ZXTA 2WKCA 3I3CA 5F2DA 2L32A 1BUIC 1LT5D 3I8ZA 2EOTA 5ELFA 2NN6I 3MAQA 2V4IB 1OXSC 4ZAIA 2K9XA 2ICEC 5FLXE 2X6LA 3H91A 1SNQA 1SYCA 2PCFB 1IKMA 1V43A 2AWOA 1E2WA 2BBCA 1P7EA 2K3UA 3C1EA 1VDVA 1EWYC 1XEEA 2EYPA 2WAQB 1B1ZA 1JB3A 2AQ2B 2A68D 4HKQA 4XT1B 3BG3A 1LTAD 1RHPA 2WNMA 4XE0A 4A6QA 2FBWB 2MUYA 1PFBA 5CYUA 1V97A 3MJ5A 1J7AA 4XDDA 2DYMA 4JE3B 1KDCA 2B2TC 3AE6B 5E1FA 4XQJA 2E2HB 2WXPA 2I07B 2NMQA 1QB5D 3IAM1 3K0YA 2PW9A 1OQRA 1PRTB 3I4MB 1EY0A 1B3AA 3TEYA 2EVBA 1A3TA 4DAYA 2LEKA 1EY5A 1W6KA 1CTMA 4P6VF 2CVRA 2MJ8A 2IPKD 1K8MA 2QCPX 1SNPA 4AQ7A 3R3OA 3AEAB 1M8AA 1OFFA 1LTGD 1KAAA 1FNUA 1JWAD 2KA7A 1M4VA 5CORA 2J7ZA 1I4PA 3R8BA 5FR3A 3C2PA 3Q24A 5BYRA 4OZCA 1F9RA 1DOMA 4TRDA 1VF7A 2N55A 3SDZA 2F0UA 1MSGA 1VZ6A 4XYQA 2WXKA 2EY5A 2HUGA 4Q5VA 1X3QA 2J4XA 3ZGZA 1LO5D 1QT9A 1E2ZA 1RDPD 1SYGA 3A55A 3K7AB 3F2UA 3OIQA 2Z8LA 2XWJB 3KWLA 1V8QA 2EYFA 1C4QA 3FKIB 2Y5PA 3DMUA 1FCCC 1ESFA 3V3XA 3CU7A 5EQ0A 1UUPA 3FPUB 4ITKA 5I9OA 4NZLB 1ML0D 1T3QA 2C5CA 2K01A 3DM1A 1KLUD 2ID0A 3DWAA 3M7GA 3LYYA 1ZYRD 5DM73 5E4WC 3KLSX 1O80A 1WTXA 5LL6S 1I7HA 1A6XA 1GHKA 1C48A 2D2CC 3S17B 2OHFA 2ZXRA 1VMPA 1N5XA 2F0DA 1ENAA 5CBEE 3AU7A 4C3JG 2BS4B 2PTLA 1DOYA 1FO4A 2VZKD 2DN8A 1STAA 2H4OA 5FOBB 1DZ1A 5H8YE 2Q8RE 4YWGG 2PNRC 5COYA 3T56B 2IX3A 4KHZA 5IGFA 1WYGA 2GRIA 4FO2A 1IYUA 2GB1A 1AFPA 1PFDA 3I72A 3MFGA 2JSOA 2NVQB 3D31A 1CZGA 4KKJA 2L0CA 2Z4HA 3BVZA 5CV9A 1FFVA 5C0XJ 3P42A 2WINB 3MFYA 1BF4A 1E0ZA 1SNDA 1O7LA 4KV6A 3QOJA 2KACA 2WDRB 4XQNA 3URYA 3LXFA 2EDGA 1SB3C 2F0TA 2FJ2A 1WVLA 4G4KA 2F1MA 1EWCA 4OO1G 1OXUA 1PDQA 1PMRA 2OEOA 2WIIB 1DOKA 3PUZA 1JWBD 3J9CA 5FLXL 1SIJA 2F0QA 1RFKA 5CC4A 1JICA 4RGNA 3V05A 4C3IG 2JYTA 2R93B 1Q12A 1TWGB 2WXHA 1QE6A 2EY1A 2A69D 3AECB 1SMYC 2N0SB 3T13A 1YJIA 3W2DA 1KLGD 1QOHA 1Q10A 4TQ1A 3S1RB 1QILA 2SEBD 4LJZC 5EKKA 1CA6A 4MACA 4BY1B 2R3ZA 4K5VA 2EXZA 2WDVB 1B53A 2F0IA 2SNSA 3U2SC 3L9AX 3MC0B 4OGQC 1Q8IA 3OHXC 1GB1A 1XLOA 1GB4A 1ZE3D 4RKBA 1H9SB 1SEBD 2WV6D 4BWGB 2AX5A 2A6ED 1JQYD 3G7LA 4TSSA 2KCCA 2E2DC 1HFNA 4IOIE 3QO2A 1FRDA 3HVDA 3D3RA 4USAA 4RGOS 3J80L 2F4IA 3BYTB 1EZ8A 1FNWA 3VR5A 4EVOA 5K5PA 3U52E 3BK2A 3ZJVA 2YU9B 1GUWA 2PZWA 3TN2A 1RTNA 4L8JA 3P4RB 4RHRA 2SDFA 1RWSA 1SBBB 4EGVA 5E6JA 5FKAC 4FVMA 1PTOF 2W55A 3TZDA 3KBXA 4GDLB 5A2QE 3MEHA 1H9JA 1KH0A 4NAWB 3NUCA 5D3IB 5HFYA 5I9PA 5I6WA 1CJEA 1LT4D 1EY6A 2PIAA 2K6AA 1DYQA 3T3OA 3ERQA 4H44C 1X3PA 1BDOA 1II3A 1G2SA 1VRAB 3QWNA 5BN4A 1QOAA 5FK9C 1TKYA 5JXVA 3KLRA 1K53A 3PZ8A 5CV6A 5G5HA 1NI3A 1LTSD 3E6ZX 5M3FB 1YNTE 1F2RI 1NUCA 4N59A 3S1MB 4EQOA 4A3DB 3AE1B 1BCPC 1YN4A 2EKIA 3VR6A 1UGJA 3BZDB 2HDMA 2QEJC 5EE0A 4U673 4HTHA 5C3EB 2WXNA 3D6CA 2AQ1B 1JALA 2BYTA 5IGBA 1U9RA 4YTPB 5ISRA 1FXAA 2X69A 5CBAE 4V0BA 1QF6A 5KYIA 1QOBA 1AYFA 1TKWB 1AWDA 1ACCA 1K50A 5JPNC 3Q8CA 3K59A 2F3VA 2KDMA 4K5WA 3C1FA 2LMCB 1X32A 4OIKA 4A8XC 3A54A 2MH7A 1N63A 1SNMA 1N61A 5EE9A 1B50A 4KY7A 2MPMA 1VMCA 1E9MA 3NBHA 5IGGA 3WOEA 2JA8B 1FFUA 2ZXPA 3AMZA 1KNAA 2IGDA 1SXTA 4YT0B 4IQZA 1FD6A 2QSDA 2IL8A 3MXUA 1TU2B 3UI3A 1CM9A 2EZVA 3NE5B 1I6HB 1TWFB 5C0XG 3OMCA 1UWMA 3IFTA 4P16A 2B8FA 1WTRA 2INNE 3GB1A 4R9WA 4C1NI 1ZXIA 3HS0C 1ZDVA 2A6EC 3QG1A 5H92C 1LTID 1Y1WB 2JQRB 4L63B 5J39A 4EE2A 1ZPSA 4N9TA 1WD1A 2X6GA 1BUVT 1AEXA 4H2AA 1NYRA 1AP0A 1CZPA 1DOLA 1L5PA 4C3IB 3AH7A 1XWEA 4G57A 2W3RA 3HOZB 2D5GA 5IIFA 1WTQA 1ZP0B 1CFMA 2M00A 2M9VA 4C3HB 3I73A 4GLSC 3TBIB 4C56C 1SJHD 1MHXA 3AE2B 2Y0SB 5FO8B 2WXGA 4KTAA 2EYOA 1GOZA 1RKNA 2YYZA 3CRLC 2E76C 2YEPF 5DEHA 1JOQA 4CJ2C 5J22A 2WS3B 1QNUA 2W54A 2RPVA 2KUMA 1R7SA 2AWNA 1RODA 1YN3A 5EE1A 2FFKB 5AUKA 3LWUA 5LL6X 4R3DA 2V4DA 1YMHE 3T16A 4RA8A 4AYBB 1I4XA 2QF7A 4ID6A 1MVKA 3IAYA 2WXQA 3VRBB 1K51A 4KN4C 3SK8A 2QJLA 1KF6B 1EOTA 2CJNA 2HDLA 3NP8A 3D4DA 4ZRZA 4C2MB 2PQEA 4BA2I 4QUCA 1PFNA 4DAVA 3ONAB 1K8OA 2JEAI 4ZK9B 3TEZA 3J80E 3VR4A 5C6AA 2F0KA 2JYEA 4DK0A 2EYHA 2B63B 5I4DA 2PMVA 5D14A 3D8GA 1VR9A 2NWGA 4DGZA 2RMMA 2B2WC 3P20A 5HI1A 3NQTA 5BN5A 2G9HD 3GTOB 1V1OA 1F2RC 3FRPB 3SR1A 5A2QL 1L4DB 3MVVA 4IKGA 3BWUD 3PMFA 2BDNA 4H13C 4KGTA 2NYZD 4IUVA 4AS1A 2BS2B 3Q69A 4US8A 4J3OD 1Y8OB 1J9OA 4OZBA 2IW3A 4HJGE 1BR9A 4YXDB 4RCOA 1B2TA 1NYQA 2EYJA 1XCTL 2K1BA 5I2YA 2V0GA 4UDUC 3FAHA 2CJOA 4YIJA 3ETRA 5BMGA 2KAJA 3I9V1 1ET6A 4L2YA 4RCNA 3MWYW 3DWGC 5ELCA 4C80A 1VZ8A 1J7BA 1GUSA 4IUTA 1YJJA 3SXHA 3GTPB 1STYA 1UEAB 2JA5B 4KX6B 1HQMC 1IBXA 1DD2A 1I4RA 3FC4A 2MHVA 2N88A 1FNVA 4WH4A 2J53A 4ODGA 4YTNB 3TP8A 4DK1A 1WGKA 1J7CA 3TSSA 3U4EG 2B39A 2Z4IA 1SFOB 3BVMA 4LMQD 2O2LD 4B9WA 5CGKA 2A69C 4KKIA 4CJ0B 1EY8A 3AN1A 1SMYD 1ICWA 1SYDA 1JOOA 4A90A 4K2LA 1IW7C 2WXIA 3P4SB 5IGEA 2JE6I 2L1AA 3PIP3 1H9KA 1EWHA 3LB8C 2QIEB 4QF4A 5CMDA 1I4GA 4PMWA 1L0VB 4C7YA 1VJKA 2EE1A 2EY2A 4FF2A 3AEGB 3A8KE 1HPCA 4WWMA 1Y69U 4NKLA 2DBYA 5HGTA 4PT5A 4DNRB 2IGHA 1SSNA 3RD4A 3K5MA 5G3LD 4WAFA 5JEAJ 3EGRA 3A7AB 3L7ZC 5LHY1 3MTSA 3UI2A 3VR2A 3S1NB 1D5XC 2F0FA 4HEA1 3NTHA 3WOFA 3I57A 3VYSA 4IALA 1F2ZA 4HN7A 4A3JB 4M8AA 2SOBA 1EM7A 4EQNA 4ULLA 3PUWA 1SSOA 5BYQA 2BA0A 3NBIA 5D65A 3D4RA 1HTPA 2PMZB 3J81E 3VYTA 3GTLB 1G91A 4F8MA 1NR4A 1PYWD 2YEPB 1WD0A 3X3NA 3HOXB 1Z7TA 5G3LF 2L5TA 5EPLA 3SFDB 4HEDA 4YSYB 1Q1BA 2BOSA 3PV0A 2C9OA 4R8IA 3S14B 3TEWA 4DA2A 1BMLC 4JK1C 3Q23A 1PTOC 1SJED 4PQXA 1BCPF 4IZ8A 4D2KA 2RA4A 5T1GA 4XYOA 5KRUA 3Q0AA 2MP1A 3DEPA 3K58A 1V1PB 2NVTB 2JSVX 4RFBA 4OO1I 2V3NA 1OXXK 4OL7A 2F0OA 4NJCA 1SYFA 1GUGA 3ZJUA 3IT6B 4CQNA 3X3MA 1K83B 1QLBB 3PUXA 3HEJA 2EY6A 4IFDI 1JW9D 2Y3AA 1DONA 3OWFA 3W5VB 4HAEA 1LTTD 2JA7B 4GDKB 1ESRA 1J8IA 5C4XB 3HOVB 2WQYB 1EFID 1HQRD 1LABA 4FNFA 3VR9B 3CHBD 4ZLTF 2K5DA 2JEBI 4WJWA 1XO3A 5KNBA 5IOCA 2HCIA 4HMJA 5C4JB 4QCLA 4KKTA 2LY7A 4XIGS 3AEEB 1I50B 3BYYB 2LUMA 1GUTA 3OW7A 1KDBA 4H7BA 1FR3A 1TS3A 4K6DA 2INPE 4CJ1B 4H0LC 1MI0A 3MHBA 2M56B 1B44D 2LS01 3DWQA 1ZOYB 2ZW1A 1A2TA 1VCIA 2IDYA 3VYRA 3KUPA 1C77A 3SR6A 4K6LA 2NZ1D 5CV5A 3H6MA 2WB1B 1IBXB 1H9SA 1JORA 3E0JA 4TKOB 1BO0A 1TQOA 2ZW0A 3P1MA 2AUKA 4OHJA 4NW2A 1S5BD 4KKUA 2GI9A 4FXKC 2R61A 3T53B 4OO1H 1NCVA 4XQQA 1OO9B 3MHZA 5IGCA 3B2FA 2MJEA 2F0JA 3K5OA 3TMEA 1F77A 1B9NA 2VXWA 1EEFD 1DOXA 3M7NA 1S5CD 1RM6C 2Q5WD 1BOSA 1QQRA 2L4NA 4ILWA 3BVGA 1R4QB 3U9OA 3J7AF 1Y56A 1T5XD 3O13A 3A56A 5CR3A 3NUHB 4IUUA 5I6YA 1B9RA 3RZDB 1TJEA 2EYLA 3BDCA 4RWSC 3BS1A 2JP1A 5KYLA 2ZXOA 3HOUB 4C3HG 4C3JB 2EJMA 2F03A 1TS4A 4IURA 4QIWB 1TS5A 3J7AV 2DLBA 4HSPA 1STEA 1TIID 3KK7A 1SYBA 1IHZA 3GTQB 3M85A 4OW0A 1I6VC 4FXCA 3EFXD 3V96A 2NTSA 1WRIA 4Q0FA 1TS2A 2KECA 1JMLA 2E74C 1SNOA 4K8IA 1KABA 2LHDA 1JROA 1AW7A 3HGBA 1A2UA 1AZQA 5EKIA 1Q3LA 5EKLA 5IODA 2BB5A 1F9PA 2IWHA 3OOCA 1ZDXA 5ELEA 3A8IE 1GUNA 1Q90A 1GXDC 2A74C 3C8YA 4WIPA 2Q8TA 2JA6B 1PXUA 3T3NA 4J1MA 5C3WA 1QOGA 3WCQA 2IX1A 1NR2A 4IUNA 1TZOA 5AFWA 3QOLA 1PLFA 1E0BA 2XNAC 3Q6SA 3AE8B 1O7ZA 2SAKA 4N6EB 1N60A 1HXYD 1FCLA 3S9WA 2PW5A 4ZRQA 1E6EB 1F2MA 4A3FB 4F7XA 2RDGA 3MZ5A 3NQIA 3A8JE 4RAUC 5KGUA 1EIGA 4HCSA 4B9XA 1TT2A 2KHSA 4EQPA 4RF1A 2CU3A 5C4ZA 1CI3M 2FINB 3IXSA 1DM0B 2PZUA 2EPBA 2X38A 1PGXA 5DNFA 5BYSA 2TSSA 1DOIA 2JXTA 2PLPA 1FEHA 2MEKA 4O42A 2RSOA 3HKZB 1FGBD 5KNCA 1D5ZC 3JAML 2K7VA 1RJTA 3H8HA 1N62A 3VQIA 3IT4B 3SVMA 4WURA 4G7ZC 5HG2A 4FYDA 1EY4A 2LFNA 2EELA 3TP6A 3PIO3 4B0MA 1G291 2CQAA 3Q8FA 1ET9A 3LWEA 1A3VA 2O4XA 1P7FA 2R6GA 3GS2A 1PRTD 4J8QA 4CKCA 3EUB2 4YTMB 1CA5A 1EU3A 1TWAB 4B0EA 4R8NA 4CBVA 5I2XA 2Q8IB 1HHVA 4GZYC 2N7JA 1FD7D 1EYCA 3S2HB 3ABVB 1WTPA 2K22A 2LHEA 4OZAA 3GV3A 4DXGA 2HDEA 1KFYB 3LX0A 4BY7B 2B2TA 4XXEA 2PVOD 5T1IA 1Y1VB 2ON8A 1FM0D 3OWEB 5BN3A 3HVZA 1O7YA 2NN6H 2L52A 4QUFA 1R4PB 4KY5A 3B9JA 2OF1A 4C1NK 1JWUD 2G9DA 2BE5D 3P1HA 2PO4A 5CV4A 4LAAA 2XIWA 4IFDH 3CIRB 1STNA 3NPPA 1R9TB 4A3IB 1C78A 4HRSA 1JQ4A 2G1EA 3FVQA 2PPBC 4FP5D 1SYEA 2BB6A 5K36G 1TKGA 4X3SA 5AUIA 4QB4A 1D6EC 1LACA 2DYOA 1F0ZA 1FXIA 2J42A 2WKDA 3FDTA 3I4LA 3SK6A 3AM9A 2WXLA 3DUZA 1RF2D 2KEEA 3D6WA 2E6XA 1BCPD 4PMCA 1CQVA 4BS9A 5EGTA 2E75C 1U4LA 2F0GA 3K5NA 1L0XB 4HMIA 4KI0A 5A35A 1C9FA 5D3DA 2VUMB 5HURA 4WFN3 1O78A 1W6JA 3I91A 1GAQB 3NXWA 3LNNA 1DXMA 2KQ3A 4K14A 3HP3A 5C3XA 3N9YC 1XLPA 1VZ7A 4MN3A 1HZ5A 2BT6A 1YNJC 1B9MA 1STGA 1D5MC 1Z47A 1GHJA 3CRKC 4M1UB 2E2JB 3D4WA 1NSNS 2D9UA 1C76A 2B76B 1S5DD 5LNK1 1RCVD 1IGDA 1MPEA 3AE7B 4MM3B 4A55A 2L12A 3HOWB 3P4QB 4IUPA 4DN4M 3HZXA 1JWMD 3NWSA 1U4PA 2OT2A 5C5MA 1YNND 4C7ZA 4DNTB 2K04A 4LTUA 4WQMA 3MA2B 3AEDB 3MXPA 2QKIC 3QJYA 2WXOA 2F3WA 4BA1I 3SFEB 2WP9B 1JC7A 5EE3A 1ENFA 3KLSA 4FF1A 2KCNA 4PNYA 3BDOA 2K05A 2NTTA 3ZQ4A 3FILA 5M5YB 2B2YA 4LK0M 1XX8A 2J52A 3VR8B 1FRRA 3DEOA 2PW7A 2K28A 2FMMA 4A9AA 4G7OC 3VRAB 3FEWX 1BCPB 1I4HA 2F0PA 2B2YC 4MHEA 1ILQA 1WSPA 3BDLA 4Y7NB 1MI2A 2QDBA 4KJNA 1HUMA 3HOYB 2I2YA 5C0XH 4G7HC 5DAUA 1H9RA 4K8JA 1EQVA 2DY8A 2PVGC 2BA1A 2WXRA 3P75A 3IKJA 5M3MB 1QG7A 2L1BA 1HCZA 3I70A 5JAVA 2A6HD 4JWUC 3SK4A 4CHTB 1L0YB 1ROEA 3RFZB 2HQEA 1ONLA 4DQOC 1GPXA 3T4AC 1SE2A 3AE3B 2H88B 2NUCA 5J1ZA 1ILPA 1JCKB 1T5EA 3GTKB 1HFGA 5M5XB 5GXGB 1WTOA 1HZ6A 4A3KB 1T6BX 1ZUD2 4X3KA 3NHHA 3ND8A 5IGDA 2BDOA 4NP5A 3C3LA 2NN6G 3BIID 3NVVA 4A3GB 2F0SA 1MGSA 1SAPA 1Y8NB 1PTOH 1LT3D 3IFDA 4A3BB 2VB3X 3I90A 2IX0A 4KK7A 2E3TA 5E4XA 5JEAG 3KF8A 1G6ZA 3VR3A 3MXNA 4KD4A 5C3JB 3VA7A 4B08A 2F0VA 3VYUA 2DWQA 2BE5C 2FMCA 1JWSD 2WXJA 2XRSD 3OIPA 1SDFA 4NDXA 4KGRA 1HTLD 1HUNA 4HKZE 3DHQA 4ZKBB 1IL8A 1CZWA 1OXTA 1CK1A 1C8CA 1ZYRC 3GV6A 1TVXA 2V3PA 1F2YA 2JZPA 2KJXA 3Q8BA 5JJZA 4HROA 3GO5A 2KMMA 4OVZA 4DXFA 1XCQL 2LKVA 3W9CB 1BNZA 1VF5C 3TEXA 4RKLA 1JE4A 3V2TA 2RQXA 3AV8A 2DNEA 1ZXHA 2BW2A 2F0WA 3NSWA 2W3SA 2TMPA 5JOBA 4ZKCB 1DJRD 4ZYSA 4QMGA 1KRHA 2FHTA 1WTVA 1GJXA 2B2VC 3EROA 1SNCA 4L6TB 4XDCA 2F0LA 4U68A 1BBXC 3H94A 4KY6A 2RDFA 4O1NA 2ACZB 1A3UA 1S5FD 1L6VA 4RGMA 4XWTA 5ELBA 1PTOD 2I46A 5K36H 2L9HA 1PDXA 4X3UA 2LGIA 1EYDA 1L4ZB 3WDNA 1LTRD 1RD9D 2NVYB 1EYAA 4ABNA 2KEDA 1YNJD 2Z1CA 4RNAA 1SE3A 3BK1A 4CKEA 4XWWA 1IW7D 1ZEQX 3NK9A 3K6OA 3NVWA 4PV1C 4US9A 4MH8A 2Y5CA 2MGSA 3H3VC 2M19A 3KQ4A 4TMAB 1I3QB 1F2LA 1LLRD 1JR0D 1ZKOA 3EA6A 3PO0A 3L3OC 2B2WA 3GTMB 1PRTF 4ARIA 1RTOA 1IGCA 2LJIA 4UAIA 3K5LA 2L83A 4Z9CB 3ITPA 5NUCA 5T8IA 1TKEA 1C79A 3M4OB 4FF4A 1Q1EA 2D62A 4MT5A 2WXMA 3NZ3A 2A5HA 2CHBD 3P4PB 2F0HA 2GA4B 1RYJA 4WRDA 1BXTA 4RHSA 2EJFC 1ENCA 1PUTA 3IL8A 3GP7A 1N5WA 2QMTA 2B8GA 3VA5A 1EL0A 1IUEA 3ZYYX 4ME5A 4FF3A 3A7LA 5G5GA 5M5WB 1MSHA 3CWIA 1JOKA 1WTWA 4A93B 2XVSA 1WCMB 2I38A 3QB3A 1LTBD 4N58A 4N9PA 3AMUA 2VB2X 4BBSB 1TY0A 4ZUJA 2SNMA 1D2BA 3SHLA 3S2DB 2LFIA 2K03A 3W3AA 1XXGA 1SF0A 2W82A 1EIHA 1K52A 1HA5A 4KJOA 3MXGA 2R7ZB 1WWTA 2OXPA 3AB9A 1WXQA 4XT3B 1HEZE 5KEEA 2IT1A 2B2VA 3J81L 3R2IA 2WLBA 4E6IA 1S4ZA 3NTIA 1XLQA 5EPKA 3Q22A 3SE0A 4HR7B 3RMHA 2XWBB 5CV8A 3AE9B 1E2VA 1EEID 2ICIA 1EQTA 1MBYA 3S15B 4XDXA 4L23A 3EJIA 1PZID 3GQBA 4ZHOA 1TWHB 1PFMA 5C2TB 4ZOHC 2K0PA 4ZRPA 3DWPA 2IGGA 4KD3A 5D7GA 3RPFC 2F0MA 1LV9A 1S5ED 2WP8J 4K5XA 2PKOA 4RGTA 2JU6X 1MD2D 3R93A 3HG9A 3T51B 2LMCA 4DAPA 4F87A 3P7JA 3NVYA 5JVG3 2NB0A 2WU5B 1E7PB 2VZKB 2DY7A 5EJWA 5EBDA 5IT9L 4X3TA 4CGYB 3GTJB 5MPOA 1HRJA