3N1XC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201c mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
ATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n1xC00
2RDBC 3RNFC 3RNBC 3RNCC 2INCC 3N1YC 3Q3MC 3RN9C 3GE3C 4P1BC 3N1XC 3I5JC 2INDC 3Q3NC 1T0RC 3RNEC 3N1ZC 3I63C 3Q14C 3Q3OC 3RMKC 4P1CC 3RI7C 3GE8C 3DHGC 3DHHC 3Q2AC 3RNAC 3DHIC 3RNGC 3N20C 1T0SC 1T0QC
chains in the Genus database with same CATH superfamily
3RUIB 2BB6A 2LRUA 3ENEA 2N1WA 3IAS1 1N61A 3ZTCA 5BYSA 1NENB 2V3NA 1ET6A 2K8BA 3H7SA 3GZNI 2JXTA 3H9DA 3KVFB 4US9A 1E10A 2FUHB 2FCMA 4IUMB 4ZRKA 4FXCA 2BWFA 2W55A 2JZ3B 3OLMD 2N9EB 2NBVB 4FADA 4M0WA 4WJOA 2LI5A 1E6EB 5IP4D 3U30A 4M00A 2K6DB 1SJED 4YTPB 4MSMB 4I6LB 3IHPC 4JE3B 2L0FA 3NOBA 3Q3OC 3AE4B 4BKSD 4DHJD 2IGHA 2LJIA 1PQSA 4ANWA 1J8CA 2V3PA 4K81A 2KDFB 4A6QA 3QWZB 4NAWA 3BYYB 1VZ7A 2ZPYA 5FR3A 4GMVA 4BOSC 1HZ5A 1I7HA 3R7RA 4LCDE 1YN3A 1TS4A 3ZJUA 1I4PA 3EHVA 2C5LC 3JW0X 2LXAA 1IYFA 4W9DA 1ZDXA 4LNOA 3AEGB 1XLPA 3L08A 3H8HA 4DDID 2FBWB 1DOYA 2C60A 3GS2A 3QQ8B 2KTRA 1WGKA 2AWTA 1CJEA 3MC0B 2IZVB 4KV2A 4PK1A 2PMVA 4PS7A 1BXTA 3AN1A 3TEYA 3ZDMC 1SSNA 2WXFA 3DBHB 3O65B 2ZW1A 2LUMA 2R2QA 4PT5A 4IOIE 1BUIC 2B76B 1YOVB 4LNFA 3E9SA 4B0MA 4EZKA 1I35A 1MHXA 2W3RA 3BVZA 2LHDA 1I4XA 1HTQA 4F7ZA 1ZW7A 3KYDD 2V4IB 4YT0B 3AXCA 2BS4B 5J18A 3KQ4A 1YMHE 4ZYSA 4NY0A 1RFKA 3VVWB 2KC1A 2L0TA 3EFCA 1FO4A 2NPTB 4E3CA 1QT9A 5FR6A 2YLMA 1FPYA 1TS2A 2XEWA 1JCKB 3A9KB 2IGGA 3MC8A 1TY0A 1ZP0B 2YEPB 3VTWA 2MP2A 4IM0A 1R4NB 3HUIA 3JYUA 1OEYA 1WR6E 2L00B 3L0WB 4HPMB 3KUZA 3GZNB 4WQMA 1V9JA 1C4CA 2OEDA 4NAMA 5E6NA 2C7HA 2KQ7A 2IY0B 2CU1A 2FAZA 3EUB2 1WGYA 2ZCBA 2VRRB 3AECB 4HPLB 5DPTA 1J7AA 4GOCA 5DPSA 4N6EB 1CZPA 4IWPA 3VAWA 3N20C 3GP7A 4LNKA 2LGDA 3WA0A 3RNFC 3R2IA 3VDZA 1C78A 4E74A 1UGJA 2GOWA 1QZEA 1YJ1A 3OJ4B 3M3JA 2I1KA 1FMAD 2JWZA 3A4SC 4L23A 1EM7A 1L0XB 3B0AA 2M4NA 4G3XB 4MGKE 1MFWA 2K8CA 3V3XA 3JSVA 1DOIA 2WXMA 4O1NA 5IOIA 4BAXA 2J7QB 2DZMA 4MEMA 3ZLZA 3QIJA 3RNGC 1PDXA 2H88B 2KZRA 1ZUD2 3ZNZB 1FD6A 4RF1A 3NVYA 2VH2A 3VFKA 2KN5A 1ZOYB 1XT9B 2BS3B 2O6VB 1UH6A 5BYRA 2BQQA 2IO1B 3PLVA 2G1EA 2LMCA 2J0JA 3VH3B 4FHJA 2N7EA 3DBSA 1GB4A 1RYJA 5FKAC 1RAXA 4BBNF 2QDFA 1GC6A 3MJ5A 3VQIA 1R4MI 3N1XC 3WIMA 3ZW3A 3C0RB 2C7NB 4FLHA 2K9XA 3UQAA 3J9CA 4DXGA 3PV1A 2W9NA 3SEBA 1GC7A 1KLUD 2LEKA 3H7PA 3V05A 2HJ8A 5DPWA 4C80A 1WXMA 4LLGM 3LDZE 3HM3A 2KJRA 4AOFA 2M0AA 2KO3A 3VH4B 3PT2B 3CIRB 3HVDA 2DAFA 1SEBD 2WS3B 1V1PB 3PRZA 3DBRI 4HLEA 4OVVA 4WQOB 5I4DA 3PRPB 5HFYA 4M8NA 1YQ3B 2G3QB 4US8A 1E7VA 2KX0A 2IGDA 4K7UA 4FJVB 3ABVB 3O13A 3PTFC 3GE8C 3DHGC 4DK5A 5IN7A 3VUWA 1F9JA 4P6VF 3IFWB 4NQLB 1EU3A 2KX3A 3W9CB 4DXAB 2H89B 3AEEB 2KAJA 2Y5CA 1MG8A 4EFOA 5D2MB 1T3QA 2WU5B 1SE2A 3A9JB 5D94A 2R2OA 4RM9A 4QAYA 5HI1A 3RZFA 3KLSX 3ZUNA 1TY2A 2G9HD 3LYYA 5GMVA 1L6UA 3AI5A 4EKUA 2PVOD 5L83A 3QCAA 2MW5A 1I4HA 3APFA 2N9KA 2J42A 1WJUA 1UWMA 4FHKA 1GUAB 3N3KB 5C23A 4KGSA 4GB9A 4WJNA 1XCTL 3U52E 4ARCA 5E6OA 5E6JA 4GXBA 4RNAA 1GJZA 5HKHA 2KMAA 1P0RA 2IDYA 3AH7A 3VXWA 1TZ1A 3B08A 4FN2A 1VR9A 2KC2A 3T8MA 4CO7A 5BO4B 1Q10A 4ACFA 5CHWA 2N7DA 3BINA 4PYUA 4K7SA 1R4MB 3DQVA 3P1MA 3NS1A 2MH7A 1PUTA 1WJ6A 1WX7A 4HROA 1N6ZA 2BB5A 4LDTB 1I42A 2M8SA 4ZHPA 1AWDA 1V97A 4A8XC 4AP4C 2NR2A 3P4SB 1RLFA 4KDIC 4DBGA 2JUOA 3T3NA 4MH0E 1V5TA 3ZJTA 4J3OD 1KH0A 1K52A 4IW0A 2IO3B 2CR5A 2PEAA 1EO6A 2KWDA 4CHKA 2EELA 1WJNA 2K25A 3DBRB 2KLCA 2Z0DB 3AE5B 1EU4A 3DBLI 2LHEA 4MGIE 1V8CA 2O2VB 5KHQA 4H2AA 4FBJB 1UBIA 1OQQA 5DPRA 5MPOA 1QILA 1IBXA 2LJ5A 4ZRPA 4RCOA 3V6EB 1C4PA 1ESFA 4NJCA 4GDLB 4IWOA 2Y5PA 3DCGA 4LTUA 4C4VA 3KYCD 1CQVA 1WZ3A 5IKCM 2V4LA 1L6VA 4P7IA 2ZNVC 3ONSA 1N5WA 1AN8A 2ICIA 3I3TB 2EKIA 3VUXA 2WXQA 1YD8U 4HK2A 1JRUA 3CMMB 3PGEA 2MA9B 2DZIA 2N7JA 1V1OA 2ZVOA 5G2NA 1FM0D 2MBEA 4ZRQA 2FCNA 2PIAA 3QK0A 1KM7A 3AMZA 4DHJB 2FE8A 4W9FA 1WGDA 2ACZB 1VJKA 4N9F4 3AULA 4XWWA 1L0VB 3KW5B 1Q5WB 3QC8B 4G11A 4EZLA 2RGFA 4TMAB 2X8XX 3U8ZA 1GAQB 2RD0A 2BBCA 5LNK1 4ZRIA 1P7FA 5KHOA 2JRHA 2E3TA 3U2SC 1YNTE 3H1UA 2RDHA 2EKEC 2G4DB 1LQBA 1MG4A 3S2AA 2K0PA 1N63A 2HJ1A 2JPHA 3R8BA 4WWOA 3HVZA 3TL5A 1V81A 4USAA 1XQQA 1VDVA 2Y3AA 2MEKA 2DHZA 3LXFA 2WP9B 1YQ4B 4GGQA 4ZHOA 1D5MC 3E56A 4W9HA 3QA8A 1AYFA 3NS8A 1VRAB 1TKEA 3WAMA 4F1SA 1K53A 2TSSA 2VZKD 1WE6A 3Q8AA 5HHDG 2L1AA 4KZ0A 2AQ2B 2JWUA 3W5UB 2KFKB 3QHTA 3PPAA 4HPPA 2K22A 3IG3A 3DBLB 1IPGA 4XDCA 2KDEB 1LO5D 1KTKA 2G45B 1L0YB 2DYBA 2LVOA 3FAHA 1H8CA 3TSSA 3ZKJC 3Q8BA 4WURA 4BZAA 3A33B 3ALBA 1FCCC 1A5RA 2NBWB 2WX0A 3DHHC 4GDKA 1X1MA 2DZKA 1A70A 1UD7A 4BKTA 1FNVA 4XZ4A 3LB8C 1V2YA 3APCA 2WDQB 1IUEA 4EE2A 1ROEA 1JALA 3NVZA 2JX5A 3PZDA 4HWIB 2CS4A 2LVPA 5EE1A 2PPHA 3NZSA 3OWEB 1PGXA 3DHIC 1NDDA 3P2BA 2BT6A 2KWVB 2V1YA 1EF5A 1FCLA 4ASWC 5D3IB 2OHFA 3PZ8A 2BKRB 4EUTA 3BVMA 1WX9A 1WMHA 4NJ7A 1HA5A 2IBIB 1SE4A 1N5XA 4WAAA 5FK9C 3DDCB 1UNSA 3UQBA 2LXCA 3NUHB 5IAAC 4B6WA 1S1QB 4S17A 5G5GA 4LJOB 4IDIA 2XN9C 4KSLC 3EA6A 4KKIA 2WXHA 3CSTA 3Q8FA 4G0NB 2SAKA 2WDTB 4ICVA 2N1VA 2BW2A 4GU2A 1RFAA 1P98A 3I63C 3IT6B 1WGRA 2LZ6A 2V0GA 2FIDA 4IKGA 1L4DB 2WXJA 4IM3A 2K8HA 3U7DA 5CTRC 3SFDB 1C76A 1P7EA 4K3CA 5AZFA 1JRPA 3N32A 2LWPA 2D3CA 2JSVX 4HRSA 1XF5L 3DWMA 4WIPA 2KYWA 1V80A 2KNBA 2D3AA 1IGCA 2JU6X 4KSKC 2KK8A 1ZPSA 2KQ4X 5GXGB 3Q8EA 1SBBB 2K1FA 1FXIA 2AQ1B 1GG3A 4OHJA 3UGBB 2INDC 4A55A 4MJSA 1QOAA 1HTOA 1WI0A 4XE0A 4HCNB 1J7BA 2GI9A 5IA7A 1E8YA 2INNE 1YX5B 4G50A 1P1AA 2O6VA 4MACA 2D3GA 3AM9A 5EE0A 1WXAA 2Q5WD 2GRIA 4KVGB 1SE9A 3B9JA 2ZJDA 2QCZA 2PJHA 3RYTA 3WAPA 5JZEB 3PSEB 3BWUD 1WM3A 3ZGZA 2ZEQA 5TSSA 1WX8A 4IC7B 2RPVA 3UIPB 2ON8A 1RWSA 3MHSD 3EGRA 3GOEA 4ITKA 1NVID 1AARA 3FILA 1L4ZB 3NZ3A 1KFYB 2KANA 1HEZE 1LGRA 2MSED 2IYDB 2KN4A 2MJDA 1J0GA 4XWTA 2MBOA 3A4RA 2W82A 1F52A 2WYQA 1WJ4A 2M0XA 3DVNU 5AUIA 5BMIA 4W9CA 3Q14C 2RMMA 2VH1A 1VZ8A 2L32A 2MBHA 4KIKA 4HDQA 3Q2AC 3ECIA 2PVGC 1ACCA 3AE1B 2EMSA 4B95A 1R7SA 2REXA 2BPSA 4K1RB 3QX1A 4A9AA 1SF0A 2WXPA 3DVGY 4M02A 3W1SC 1V1PA 3N1ZC 4LNNA 4B0EA 3W1SA 2Z8LA 1NYRA 4ANVA 2L76A 4MT5A 2BGFA 2J53A 2G4SA 3KWVA 2L8JA 1JWBD 1K8RB 3AE6B 3JSVB 2W54A 2N9XA 3WALA 2KMCA 4M8MA 2MHJA 3WAOA 3W2DA 3P4QB 2MQJA 1OTRB 2WX1A 4JLCA 2Z59B 3SDLC 1PGAA 2BYFA 3ZNHB 3IXSA 4DQOC 3VTVA 3QJZA 1T6BX 4NQKE 1B9RA 4OW0A 3B2GA 3Q69A 4YSXB 3DPDA 4YSZB 2LVQA 1V5OA 2QHOA 4IWQA 2FIFA 2KHWB 2KVZA 4TV3A 1XLOA 2L83A 4WJPA 2MCNB 1RRBA 2XK5A 1MHHE 4WAFA 4OZCA 3A1QA 1MPEA 1T0SC 3Q3FA 2KMMA 3NG0A 3K9OB 2M1MA 4JPSA 2ZPNA 4MM3B 3Q3JA 2LUEA 2K6QA 4HDOA 1MI0A 2LGYA 5CX3A 2FUG1 2J52A 4TKNA 2N9PC 1JQ4A 1E8XA 2QC8A 2BYTA 2K5PA 2AL3A 2D07B 1N62A 4KDLB 2HTHA 1QF6A 5C3JB 3R66C 1HZ6A 5H8YE 3RULA 1PYWD 2IO0B 3MTNB 5JHAA 1G6JA 1M94A 1ET9A 4N59A 1E9MA 3OG5A 2CHXA 1E7UA 5L95C 2E6XA 4RGNA 1WXVA 1WXSA 2NS5A 5DCNA 4A3PA 2WXIA 3P4RB 1C77A 3Q3NC 1VCBA 2CHWA 3B1LX 1SGHA 2ZZPB 4BBNC 2BS2B 3ZVVA 5G5HA 1Y56A 2WDVB 3PHWB 1ENFA 1STEA 1Z5SB 3VR9B 4MDKE 3DVNV 2O2VA 4II2B 1MJDA 1YN5A 4AS1A 1K51A 1XCQL 4MH8A 1OEYJ 2GLSA 1LXDA 3RZWC 1WYWB 4LNIA 2QSDA 2WU2B 4GDLA 1SIFA 2BKFA 1SIJA 2KJHB 1F0ZA 4PS8A 4YTMB 2JQRB 3AE3B 3M63B 2N9LA 2DZJA 3TIXA 5JXVA 1PGBA 3URYA 1E5WA 5E6PA 1KLGD 1UBQA 1OQYA 1I4GA 2KLGA 2V3SA 4GN1A 3D32A 2QIEB 2PTLA 1E8WA 2KOXA 1UUPA 4P16A 2BVCA 3C8YA 2KT7A 2L05A 1J7CA 1ISNA 2MX2A 3ZYYX 2LFIA 3QARA 3P63A 3ZDTA 2J4XA 2GBJA 2M17A 5CHVC 1GB1A 1V49A 2GB1A 4A20A 4CYEA 3IVFA 1SE3A 4RGTA 2CJNA 3JVZX 1C79A 4Q2JA 2RSUA 3ZRFA 2KKCA 4NJ6A 1E8ZA 4XYCA 1YQBA 1OGWA 5D3DA 5LXIB 4W9GA 2N4FA 3NRZA 3L10B 3VUYA 1WH3A 2J0MA 5AZGA 2GBNA 1TJEA 4KGRA 3WCQA 4RH6A 4W9KA 1BT0A 3ZIMA 3RCZA 1FFVA 2IJ0A 2DX5B 3EFUA 2VZKB 4W9IA 4EEWA 3CSFA 3L54A 2RDGA 2MJEA 3BVGA 1UWXA 1WFYA 3HHMA 4N58A 2KD0A 1IBXB 2AEHA 4HKQA 3AE2B 2LGIA 2K39A 5BYQA 4YXDB 1T0QC 2LGXA 4L1BA 4BVUC 1U4AA 1MVKA 1XO3A 4MGYE 3WANA 4C4VB 2QJLA 3Q8CA 1YJJA 2PE6B 2KWUB 3AEFB 5EDSA 1NI2A 2RR9A 2KFKA 2NBUA 4A3OA 3IAM1 4HCPB 4XC2A 5D6JB 4C7YA 2KQSA 3SFEB 1L5PA 3RN9C 3L17A 1ZXIA 2JZPA 4ZOHC 1WF9A 1I4RA 3R2TA 1C3TA 4ICUA 4FULA 1TT5B 3TEXA 1HXYD 3B2FA 2NMQA 4ZDVA 1IGDA 3OAWA 4K3BA 1XD3B 4F8CB 1K50A 1GPXA 1D6EC 2A4ZA 5EE3A 3AE8B 1TKYA 4ARIA 3IBEA 1Z2MA 2HDEA 4XGAB 5TR5A 4ZRJA 1N60A 4NNJB 4KGTA 4DHZE 3UIOB 1EUVB 2KWCA 2RPQA 2KDMA 1GNUA 1C1YB 3NZUA 1ZGUB 4K7WA 1UF0A 4E71A 4A90A 4I6PA 4BOZB 2B3AA 3N1YC 2FCQA 1ZE3D 4W9EA 2NPTA 2CHZA 1EF1A 3A9KA 2GBMA 2NCNA 1F2RC 4M0WB 3SU8X 3UINB 1I4QA 1NBFC 1OQRA 3AU4A 4ZYNA 1WGHA 1IP9A 2RDBC 4HXDA 1TIFA 5AEKB 2INCC 2CJOA 3RT3B 2LRWA 3DVGX 1XLQA 4IG7B 1FNWA 3RFZB 2IO2B 3HIZA 1WIAA 3TMPB 3OJ3A 3UF8A 5EE9A 1L2NA 4URKA 1VLBA 1WRIA 3MHZA 1FIQA 3EECA 3VTUA 2WQYB 4WWMA 4NAWB 1WYGA 2D11A 4TQ0A 3L16A 1Y8RC 3APDA 4C00A 4EOYA 1BMLC 2BYEA 1AW7A 2DAJA 3GE3C 4YSYB 4DWFA 4DHZB 1DOXA 1E0ZA 2AL6A 3Q6BA 4TUUA 3R7QA 1ZXHA 4GDKB 2UYZB 4JQWC 2N0SB 1VD2A 3R3MA 3T3OA 3K9PB 2WXOA 2L3ZA 3RPFC 2KTRB 1YN4A 1C4AA 4HVBA 1SXTA 5H92C 4AWJA 3TJPA 2SEBD 2C7MB 5C1ZA 1UGMA 3AB5A 2I38A 4RFBA 2KJ6A 3TEZA 2HTME 3ML8A 1WMHB 3U7ZA 2DYOA 1NEKB 3P42A 5J2RA 4KX6B 2I2YA 1H4RA 4JX1C 4S0RA 3FC4A 3X0WA 2L7RA 3L13A 3N30A 2DWQA 2PW9A 1WR1A 2Z0EB 1T5XD 1KF6B 1WM2A 1QQRA 4OZAA 2JVCA 3I57A 2WXRA 2KXJA 1HE8A 5CHFA 3BK2A 2DYMA 1XLNA 4M01A 4YWGG 3AE7B 1JW9D 1WE7A 2KVRA 4REZA 2I1JA 3PVLA 1YX6B 3RNCC 2MP2B 1L7YA 2IY1B 2DNFA 5T8IA 2JF5A 1WXQA 3ZJVA 1D5XC 3M62B 2AYOB 2PLPA 2BWES 2UU7A 4RF0A 4FJZA 3ZNID 4C56C 3KWLA 2WXLA 4HKZE 3HRDD 1WY8A 3BZDB 1D3ZA 1DGJA 3PZ7A 3V6CB 3BIID 3PO0A 4YL8A 1OFFA 4OVUA 4RMAA 1FXAA 5LLIA 3T9LA 3ML9A 1XXGA 3ZNGC 4DXFA 1M4VA 3IT4B 2MBBB 2BF8B 3MFGA 3VR8B 2OJRA 3V62A 4MJSB 4HJGE 1VZ6A 1JWSD 1WZ0A 1WSPA 1Q0WB 4MGZE 3AEBB 3CF6E 1FXTB 1LM8B 5JH5C 2KDBA 4BKGA 3X23A 3LJ3A 3W5VB 2NVUI 2HE7A 3ZXRA 3U4EG 1PFDA 1YIWA 3N9YC 3QAQA 3UI3A 1QLBB 2KDIA 3PHXB 3PREA 3FKYA 1UELA 3SR6A 4XX5A 1TBEA 3FILB 2KFJA 3AU5A 2MWSB 1FRRA 2WLBA 4TQ1A 4JIOU 4MM3A 1EWYC 2YVCA 2DBYA 1D4BA 3KUDB 2MLBA 2GMIC 3RNAC 2D3BA 1ZKHA 1CK1A 1E7PB 1V86A 3DOWA 4AJWA 2X38A 3A9JA 5D7GA 2QMTA 4D2KA 2A5UA 1T0RC 4KIKB 2QEJC 2R61A 4RGOS 3TUOA 1KJTA 2J0KA 2V9HA 2PE9A 4WH4A 1SB3C 2C9WB 3RD2A 2DLBA 2O6VD 3DWGC 3MJWA 2OOBB 1FRDA 4JWSC 2M56B 2JRIB 3C19A 3RNBC 3ZRCA 2KACA 2JY6A 1JWMD 2LASA 3I5JC 2QILA 3AEDB 2BYVE 3NHEB 3L4PA 1WWTA 4TSSA 2D2QA 1ZDVA 4PS3A 3AEAB 2OJWA 4ANUA 3MP9A 2JXXA 4KZCA 1CMXB 3H7PB 2D10A 5HG2A 3SHQA 2MRPA 2W3SA 4RGMA 3H6NA 3NVVA 4OVZA 4W9LA 2JYTA 2FCSA 4LK0M 2GBRA 1S3SG 2WHIA 5AUKA 4C7ZA 4HJKA 2WWZA 5JHBA 1KRHA 1QKZA 1RM6C 2NTTA 2ASQA 1F77A 1WGGA 1TS5A 4PYZA 5LXHA 4FA6A 2WXKA 3Q3MC 2CU3A 2JYEA 5J17A 1TKGA 3AV8A 2GBKA 5BMHA 2XK5B 2WDRB 4AQ7A 2ZVNA 3A1QB 3AE9B 3RI7C 1D5ZC 3ZTDA 4R3DA 1UZXB 1TGZB 1JROA 3V61A 1FEHA 4OZBA 1TZOA 4KKJA 2D5GA 2JT4B 3ZXVA 3PS6A 1SJHD 4LJPB 1P3QU 3KUCB 4DDGD 2INPE 2MBQA 1Q1OA 3BYTB 3NVWA 2FNJB 4XDDA 3M95A 2ZCCA 4IM2A 4EZJA 4P1BC 2NTSA 1EWCA 1QOBA 1FFUA 1JWAD 1GOZA 3ZO5B 1LFDA 4AUQC 3ETRA 2AQ3B 1P9DU 1TS3A 1F1HA 4RM8A 3TEWA 2JZZA 4MSQB 4X57B 1NI3A 3TBLD 3VRBB 4WWPA 3NJTA 2XBBC 2Y5BB 2WXGA 3BY4B 3HM6X 4JL9A 1QOFA 2M19A 2AX5A 3W1YA 4GIVA 4FJYA 4BKSA 5BMGA 4NZLB 4WJQA 1XEEA 2IPKD 1T0YA 4W9JA 4WWNA 3CWIA 2DENB 4AJYB 1FNUA 4CQNA 1KOTA 3BK1A 2CKHB 2WGSA 4JWUC 5AZHA 4BFRA 3MC9A 2HD5B 4NPNA 3NY5A 3RNEC 3ZQ4A 2KTFA 2LD9A 4MELA 4L2YA 3RMKC 4P1CC 4GSWA 2ONQA 4YTNB 2MJ3A 5G55A 2PKOA 4LDTD 1TTNA 1J19A 2YEPF 3VHTC 3VRAB 2ZW0A 3DBHI 1YJIA 3GB1A 4GLSC 4B9KA 3KH0A 3PLUA 4HEA1 1B1ZA 4I6NB 1C9FA 5C2TB 3EC8A 2K3UA 4ANXA 1WRDB 2LGSA 2UWQA 1E90A 3P4PB 2BTEA 1KLVA 1QOGA 2L52A 3I9V1 1DYQA 1V6EA 1JWUD 2WXNA 4JGHB 2EMTA 3HK0A 4J6IA 5IO9A 1JMLA 2WNMA 1HQRD 3SD5A 1F2RI 3TCAA 2ZNVB 4UDUC 1TYGB 4II3B 1NYQA 3V60A 3PRMB 2XNAC 1R4NI
chains in the Genus database with same CATH topology
2RDBC 3RNFC 3RNBC 3RNCC 2INCC 3N1YC 3Q3MC 3RN9C 3GE3C 4P1BC 3N1XC 3I5JC 2INDC 3Q3NC 1T0RC 3RNEC 3N1ZC 3I63C 3Q14C 3Q3OC 3RMKC 4P1CC 3RI7C 3GE8C 3DHGC 3DHHC 3Q2AC 3RNAC 3DHIC 3RNGC 3N20C 1T0SC 1T0QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDB C;  3RNF C;  3RNB C;  3RNC C;  2INC C;  3N1Y C;  3Q3M C;  3RN9 C;  3GE3 C;  4P1B C;  3N1X C;  3I5J C;  2IND C;  3Q3N C;  1T0R C;  3RNE C;  3N1Z C;  3I63 C;  3Q14 C;  3Q3O C;  3RMK C;  4P1C C;  3RI7 C;  3GE8 C;  3DHG C;  3DHH C;  3Q2A C;  3RNA C;  3DHI C;  3RNG C;  3N20 C;  1T0S C;  1T0Q C; 
#chains in the Genus database with same CATH topology
 3RUI B;  2BB6 A;  2LRU A;  3ENE A;  2N1W A;  3IAS 1;  1N61 A;  3ZTC A;  5BYS A;  1NEN B;  2V3N A;  1ET6 A;  2K8B A;  3H7S A;  3GZN I;  2JXT A;  3H9D A;  3KVF B;  4US9 A;  1E10 A;  2FUH B;  2FCM A;  4IUM B;  4ZRK A;  4FXC A;  2BWF A;  2W55 A;  2JZ3 B;  3OLM D;  2N9E B;  2NBV B;  4FAD A;  4M0W A;  4WJO A;  2LI5 A;  1E6E B;  5IP4 D;  3U30 A;  4M00 A;  2K6D B;  1SJE D;  4YTP B;  4MSM B;  4I6L B;  3IHP C;  4JE3 B;  2L0F A;  3NOB A;  3Q3O C;  3AE4 B;  4BKS D;  4DHJ D;  2IGH A;  2LJI A;  1PQS A;  4ANW A;  1J8C A;  2V3P A;  4K81 A;  2KDF B;  4A6Q A;  3QWZ B;  4NAW A;  3BYY B;  1VZ7 A;  2ZPY A;  5FR3 A;  4GMV A;  4BOS C;  1HZ5 A;  1I7H A;  3R7R A;  4LCD E;  1YN3 A;  1TS4 A;  3ZJU A;  1I4P A;  3EHV A;  2C5L C;  3JW0 X;  2LXA A;  1IYF A;  4W9D A;  1ZDX A;  4LNO A;  3AEG B;  1XLP A;  3L08 A;  3H8H A;  4DDI D;  2FBW B;  1DOY A;  2C60 A;  3GS2 A;  3QQ8 B;  2KTR A;  1WGK A;  2AWT A;  1CJE A;  3MC0 B;  2IZV B;  4KV2 A;  4PK1 A;  2PMV A;  4PS7 A;  1BXT A;  3AN1 A;  3TEY A;  3ZDM C;  1SSN A;  2WXF A;  3DBH B;  3O65 B;  2ZW1 A;  2LUM A;  2R2Q A;  4PT5 A;  4IOI E;  1BUI C;  2B76 B;  1YOV B;  4LNF A;  3E9S A;  4B0M A;  4EZK A;  1I35 A;  1MHX A;  2W3R A;  3BVZ A;  2LHD A;  1I4X A;  1HTQ A;  4F7Z A;  1ZW7 A;  3KYD D;  2V4I B;  4YT0 B;  3AXC A;  2BS4 B;  5J18 A;  3KQ4 A;  1YMH E;  4ZYS A;  4NY0 A;  1RFK A;  3VVW B;  2KC1 A;  2L0T A;  3EFC A;  1FO4 A;  2NPT B;  4E3C A;  1QT9 A;  5FR6 A;  2YLM A;  1FPY A;  1TS2 A;  2XEW A;  1JCK B;  3A9K B;  2IGG A;  3MC8 A;  1TY0 A;  1ZP0 B;  2YEP B;  3VTW A;  2MP2 A;  4IM0 A;  1R4N B;  3HUI A;  3JYU A;  1OEY A;  1WR6 E;  2L00 B;  3L0W B;  4HPM B;  3KUZ A;  3GZN B;  4WQM A;  1V9J A;  1C4C A;  2OED A;  4NAM A;  5E6N A;  2C7H A;  2KQ7 A;  2IY0 B;  2CU1 A;  2FAZ A;  3EUB 2;  1WGY A;  2ZCB A;  2VRR B;  3AEC B;  4HPL B;  5DPT A;  1J7A A;  4GOC A;  5DPS A;  4N6E B;  1CZP A;  4IWP A;  3VAW A;  3N20 C;  3GP7 A;  4LNK A;  2LGD A;  3WA0 A;  3RNF C;  3R2I A;  3VDZ A;  1C78 A;  4E74 A;  1UGJ A;  2GOW A;  1QZE A;  1YJ1 A;  3OJ4 B;  3M3J A;  2I1K A;  1FMA D;  2JWZ A;  3A4S C;  4L23 A;  1EM7 A;  1L0X B;  3B0A A;  2M4N A;  4G3X B;  4MGK E;  1MFW A;  2K8C A;  3V3X A;  3JSV A;  1DOI A;  2WXM A;  4O1N A;  5IOI A;  4BAX A;  2J7Q B;  2DZM A;  4MEM A;  3ZLZ A;  3QIJ A;  3RNG C;  1PDX A;  2H88 B;  2KZR A;  1ZUD 2;  3ZNZ B;  1FD6 A;  4RF1 A;  3NVY A;  2VH2 A;  3VFK A;  2KN5 A;  1ZOY B;  1XT9 B;  2BS3 B;  2O6V B;  1UH6 A;  5BYR A;  2BQQ A;  2IO1 B;  3PLV A;  2G1E A;  2LMC A;  2J0J A;  3VH3 B;  4FHJ A;  2N7E A;  3DBS A;  1GB4 A;  1RYJ A;  5FKA C;  1RAX A;  4BBN F;  2QDF A;  1GC6 A;  3MJ5 A;  3VQI A;  1R4M I;  3N1X C;  3WIM A;  3ZW3 A;  3C0R B;  2C7N B;  4FLH A;  2K9X A;  3UQA A;  3J9C A;  4DXG A;  3PV1 A;  2W9N A;  3SEB A;  1GC7 A;  1KLU D;  2LEK A;  3H7P A;  3V05 A;  2HJ8 A;  5DPW A;  4C80 A;  1WXM A;  4LLG M;  3LDZ E;  3HM3 A;  2KJR A;  4AOF A;  2M0A A;  2KO3 A;  3VH4 B;  3PT2 B;  3CIR B;  3HVD A;  2DAF A;  1SEB D;  2WS3 B;  1V1P B;  3PRZ A;  3DBR I;  4HLE A;  4OVV A;  4WQO B;  5I4D A;  3PRP B;  5HFY A;  4M8N A;  1YQ3 B;  2G3Q B;  4US8 A;  1E7V A;  2KX0 A;  2IGD A;  4K7U A;  4FJV B;  3ABV B;  3O13 A;  3PTF C;  3GE8 C;  3DHG C;  4DK5 A;  5IN7 A;  3VUW A;  1F9J A;  4P6V F;  3IFW B;  4NQL B;  1EU3 A;  2KX3 A;  3W9C B;  4DXA B;  2H89 B;  3AEE B;  2KAJ A;  2Y5C A;  1MG8 A;  4EFO A;  5D2M B;  1T3Q A;  2WU5 B;  1SE2 A;  3A9J B;  5D94 A;  2R2O A;  4RM9 A;  4QAY A;  5HI1 A;  3RZF A;  3KLS X;  3ZUN A;  1TY2 A;  2G9H D;  3LYY A;  5GMV A;  1L6U A;  3AI5 A;  4EKU A;  2PVO D;  5L83 A;  3QCA A;  2MW5 A;  1I4H A;  3APF A;  2N9K A;  2J42 A;  1WJU A;  1UWM A;  4FHK A;  1GUA B;  3N3K B;  5C23 A;  4KGS A;  4GB9 A;  4WJN A;  1XCT L;  3U52 E;  4ARC A;  5E6O A;  5E6J A;  4GXB A;  4RNA A;  1GJZ A;  5HKH A;  2KMA A;  1P0R A;  2IDY A;  3AH7 A;  3VXW A;  1TZ1 A;  3B08 A;  4FN2 A;  1VR9 A;  2KC2 A;  3T8M A;  4CO7 A;  5BO4 B;  1Q10 A;  4ACF A;  5CHW A;  2N7D A;  3BIN A;  4PYU A;  4K7S A;  1R4M B;  3DQV A;  3P1M A;  3NS1 A;  2MH7 A;  1PUT A;  1WJ6 A;  1WX7 A;  4HRO A;  1N6Z A;  2BB5 A;  4LDT B;  1I42 A;  2M8S A;  4ZHP A;  1AWD A;  1V97 A;  4A8X C;  4AP4 C;  2NR2 A;  3P4S B;  1RLF A;  4KDI C;  4DBG A;  2JUO A;  3T3N A;  4MH0 E;  1V5T A;  3ZJT A;  4J3O D;  1KH0 A;  1K52 A;  4IW0 A;  2IO3 B;  2CR5 A;  2PEA A;  1EO6 A;  2KWD A;  4CHK A;  2EEL A;  1WJN A;  2K25 A;  3DBR B;  2KLC A;  2Z0D B;  3AE5 B;  1EU4 A;  3DBL I;  2LHE A;  4MGI E;  1V8C A;  2O2V B;  5KHQ A;  4H2A A;  4FBJ B;  1UBI A;  1OQQ A;  5DPR A;  5MPO A;  1QIL A;  1IBX A;  2LJ5 A;  4ZRP A;  4RCO A;  3V6E B;  1C4P A;  1ESF A;  4NJC A;  4GDL B;  4IWO A;  2Y5P A;  3DCG A;  4LTU A;  4C4V A;  3KYC D;  1CQV A;  1WZ3 A;  5IKC M;  2V4L A;  1L6V A;  4P7I A;  2ZNV C;  3ONS A;  1N5W A;  1AN8 A;  2ICI A;  3I3T B;  2EKI A;  3VUX A;  2WXQ A;  1YD8 U;  4HK2 A;  1JRU A;  3CMM B;  3PGE A;  2MA9 B;  2DZI A;  2N7J A;  1V1O A;  2ZVO A;  5G2N A;  1FM0 D;  2MBE A;  4ZRQ A;  2FCN A;  2PIA A;  3QK0 A;  1KM7 A;  3AMZ A;  4DHJ B;  2FE8 A;  4W9F A;  1WGD A;  2ACZ B;  1VJK A;  4N9F 4;  3AUL A;  4XWW A;  1L0V B;  3KW5 B;  1Q5W B;  3QC8 B;  4G11 A;  4EZL A;  2RGF A;  4TMA B;  2X8X X;  3U8Z A;  1GAQ B;  2RD0 A;  2BBC A;  5LNK 1;  4ZRI A;  1P7F A;  5KHO A;  2JRH A;  2E3T A;  3U2S C;  1YNT E;  3H1U A;  2RDH A;  2EKE C;  2G4D B;  1LQB A;  1MG4 A;  3S2A A;  2K0P A;  1N63 A;  2HJ1 A;  2JPH A;  3R8B A;  4WWO A;  3HVZ A;  3TL5 A;  1V81 A;  4USA A;  1XQQ A;  1VDV A;  2Y3A A;  2MEK A;  2DHZ A;  3LXF A;  2WP9 B;  1YQ4 B;  4GGQ A;  4ZHO A;  1D5M C;  3E56 A;  4W9H A;  3QA8 A;  1AYF A;  3NS8 A;  1VRA B;  1TKE A;  3WAM A;  4F1S A;  1K53 A;  2TSS A;  2VZK D;  1WE6 A;  3Q8A A;  5HHD G;  2L1A A;  4KZ0 A;  2AQ2 B;  2JWU A;  3W5U B;  2KFK B;  3QHT A;  3PPA A;  4HPP A;  2K22 A;  3IG3 A;  3DBL B;  1IPG A;  4XDC A;  2KDE B;  1LO5 D;  1KTK A;  2G45 B;  1L0Y B;  2DYB A;  2LVO A;  3FAH A;  1H8C A;  3TSS A;  3ZKJ C;  3Q8B A;  4WUR A;  4BZA A;  3A33 B;  3ALB A;  1FCC C;  1A5R A;  2NBW B;  2WX0 A;  3DHH C;  4GDK A;  1X1M A;  2DZK A;  1A70 A;  1UD7 A;  4BKT A;  1FNV A;  4XZ4 A;  3LB8 C;  1V2Y A;  3APC A;  2WDQ B;  1IUE A;  4EE2 A;  1ROE A;  1JAL A;  3NVZ A;  2JX5 A;  3PZD A;  4HWI B;  2CS4 A;  2LVP A;  5EE1 A;  2PPH A;  3NZS A;  3OWE B;  1PGX A;  3DHI C;  1NDD A;  3P2B A;  2BT6 A;  2KWV B;  2V1Y A;  1EF5 A;  1FCL A;  4ASW C;  5D3I B;  2OHF A;  3PZ8 A;  2BKR B;  4EUT A;  3BVM A;  1WX9 A;  1WMH A;  4NJ7 A;  1HA5 A;  2IBI B;  1SE4 A;  1N5X A;  4WAA A;  5FK9 C;  3DDC B;  1UNS A;  3UQB A;  2LXC A;  3NUH B;  5IAA C;  4B6W A;  1S1Q B;  4S17 A;  5G5G A;  4LJO B;  4IDI A;  2XN9 C;  4KSL C;  3EA6 A;  4KKI A;  2WXH A;  3CST A;  3Q8F A;  4G0N B;  2SAK A;  2WDT B;  4ICV A;  2N1V A;  2BW2 A;  4GU2 A;  1RFA A;  1P98 A;  3I63 C;  3IT6 B;  1WGR A;  2LZ6 A;  2V0G A;  2FID A;  4IKG A;  1L4D B;  2WXJ A;  4IM3 A;  2K8H A;  3U7D A;  5CTR C;  3SFD B;  1C76 A;  1P7E A;  4K3C A;  5AZF A;  1JRP A;  3N32 A;  2LWP A;  2D3C A;  2JSV X;  4HRS A;  1XF5 L;  3DWM A;  4WIP A;  2KYW A;  1V80 A;  2KNB A;  2D3A A;  1IGC A;  2JU6 X;  4KSK C;  2KK8 A;  1ZPS A;  2KQ4 X;  5GXG B;  3Q8E A;  1SBB B;  2K1F A;  1FXI A;  2AQ1 B;  1GG3 A;  4OHJ A;  3UGB B;  2IND C;  4A55 A;  4MJS A;  1QOA A;  1HTO A;  1WI0 A;  4XE0 A;  4HCN B;  1J7B A;  2GI9 A;  5IA7 A;  1E8Y A;  2INN E;  1YX5 B;  4G50 A;  1P1A A;  2O6V A;  4MAC A;  2D3G A;  3AM9 A;  5EE0 A;  1WXA A;  2Q5W D;  2GRI A;  4KVG B;  1SE9 A;  3B9J A;  2ZJD A;  2QCZ A;  2PJH A;  3RYT A;  3WAP A;  5JZE B;  3PSE B;  3BWU D;  1WM3 A;  3ZGZ A;  2ZEQ A;  5TSS A;  1WX8 A;  4IC7 B;  2RPV A;  3UIP B;  2ON8 A;  1RWS A;  3MHS D;  3EGR A;  3GOE A;  4ITK A;  1NVI D;  1AAR A;  3FIL A;  1L4Z B;  3NZ3 A;  1KFY B;  2KAN A;  1HEZ E;  1LGR A;  2MSE D;  2IYD B;  2KN4 A;  2MJD A;  1J0G A;  4XWT A;  2MBO A;  3A4R A;  2W82 A;  1F52 A;  2WYQ A;  1WJ4 A;  2M0X A;  3DVN U;  5AUI A;  5BMI A;  4W9C A;  3Q14 C;  2RMM A;  2VH1 A;  1VZ8 A;  2L32 A;  2MBH A;  4KIK A;  4HDQ A;  3Q2A C;  3ECI A;  2PVG C;  1ACC A;  3AE1 B;  2EMS A;  4B95 A;  1R7S A;  2REX A;  2BPS A;  4K1R B;  3QX1 A;  4A9A A;  1SF0 A;  2WXP A;  3DVG Y;  4M02 A;  3W1S C;  1V1P A;  3N1Z C;  4LNN A;  4B0E A;  3W1S A;  2Z8L A;  1NYR A;  4ANV A;  2L76 A;  4MT5 A;  2BGF A;  2J53 A;  2G4S A;  3KWV A;  2L8J A;  1JWB D;  1K8R B;  3AE6 B;  3JSV B;  2W54 A;  2N9X A;  3WAL A;  2KMC A;  4M8M A;  2MHJ A;  3WAO A;  3W2D A;  3P4Q B;  2MQJ A;  1OTR B;  2WX1 A;  4JLC A;  2Z59 B;  3SDL C;  1PGA A;  2BYF A;  3ZNH B;  3IXS A;  4DQO C;  3VTV A;  3QJZ A;  1T6B X;  4NQK E;  1B9R A;  4OW0 A;  3B2G A;  3Q69 A;  4YSX B;  3DPD A;  4YSZ B;  2LVQ A;  1V5O A;  2QHO A;  4IWQ A;  2FIF A;  2KHW B;  2KVZ A;  4TV3 A;  1XLO A;  2L83 A;  4WJP A;  2MCN B;  1RRB A;  2XK5 A;  1MHH E;  4WAF A;  4OZC A;  3A1Q A;  1MPE A;  1T0S C;  3Q3F A;  2KMM A;  3NG0 A;  3K9O B;  2M1M A;  4JPS A;  2ZPN A;  4MM3 B;  3Q3J A;  2LUE A;  2K6Q A;  4HDO A;  1MI0 A;  2LGY A;  5CX3 A;  2FUG 1;  2J52 A;  4TKN A;  2N9P C;  1JQ4 A;  1E8X A;  2QC8 A;  2BYT A;  2K5P A;  2AL3 A;  2D07 B;  1N62 A;  4KDL B;  2HTH A;  1QF6 A;  5C3J B;  3R66 C;  1HZ6 A;  5H8Y E;  3RUL A;  1PYW D;  2IO0 B;  3MTN B;  5JHA A;  1G6J A;  1M94 A;  1ET9 A;  4N59 A;  1E9M A;  3OG5 A;  2CHX A;  1E7U A;  5L95 C;  2E6X A;  4RGN A;  1WXV A;  1WXS A;  2NS5 A;  5DCN A;  4A3P A;  2WXI A;  3P4R B;  1C77 A;  3Q3N C;  1VCB A;  2CHW A;  3B1L X;  1SGH A;  2ZZP B;  4BBN C;  2BS2 B;  3ZVV A;  5G5H A;  1Y56 A;  2WDV B;  3PHW B;  1ENF A;  1STE A;  1Z5S B;  3VR9 B;  4MDK E;  3DVN V;  2O2V A;  4II2 B;  1MJD A;  1YN5 A;  4AS1 A;  1K51 A;  1XCQ L;  4MH8 A;  1OEY J;  2GLS A;  1LXD A;  3RZW C;  1WYW B;  4LNI A;  2QSD A;  2WU2 B;  4GDL A;  1SIF A;  2BKF A;  1SIJ A;  2KJH B;  1F0Z A;  4PS8 A;  4YTM B;  2JQR B;  3AE3 B;  3M63 B;  2N9L A;  2DZJ A;  3TIX A;  5JXV A;  1PGB A;  3URY A;  1E5W A;  5E6P A;  1KLG D;  1UBQ A;  1OQY A;  1I4G A;  2KLG A;  2V3S A;  4GN1 A;  3D32 A;  2QIE B;  2PTL A;  1E8W A;  2KOX A;  1UUP A;  4P16 A;  2BVC A;  3C8Y A;  2KT7 A;  2L05 A;  1J7C A;  1ISN A;  2MX2 A;  3ZYY X;  2LFI A;  3QAR A;  3P63 A;  3ZDT A;  2J4X A;  2GBJ A;  2M17 A;  5CHV C;  1GB1 A;  1V49 A;  2GB1 A;  4A20 A;  4CYE A;  3IVF A;  1SE3 A;  4RGT A;  2CJN A;  3JVZ X;  1C79 A;  4Q2J A;  2RSU A;  3ZRF A;  2KKC A;  4NJ6 A;  1E8Z A;  4XYC A;  1YQB A;  1OGW A;  5D3D A;  5LXI B;  4W9G A;  2N4F A;  3NRZ A;  3L10 B;  3VUY A;  1WH3 A;  2J0M A;  5AZG A;  2GBN A;  1TJE A;  4KGR A;  3WCQ A;  4RH6 A;  4W9K A;  1BT0 A;  3ZIM A;  3RCZ A;  1FFV A;  2IJ0 A;  2DX5 B;  3EFU A;  2VZK B;  4W9I A;  4EEW A;  3CSF A;  3L54 A;  2RDG A;  2MJE A;  3BVG A;  1UWX A;  1WFY A;  3HHM A;  4N58 A;  2KD0 A;  1IBX B;  2AEH A;  4HKQ A;  3AE2 B;  2LGI A;  2K39 A;  5BYQ A;  4YXD B;  1T0Q C;  2LGX A;  4L1B A;  4BVU C;  1U4A A;  1MVK A;  1XO3 A;  4MGY E;  3WAN A;  4C4V B;  2QJL A;  3Q8C A;  1YJJ A;  2PE6 B;  2KWU B;  3AEF B;  5EDS A;  1NI2 A;  2RR9 A;  2KFK A;  2NBU A;  4A3O A;  3IAM 1;  4HCP B;  4XC2 A;  5D6J B;  4C7Y A;  2KQS A;  3SFE B;  1L5P A;  3RN9 C;  3L17 A;  1ZXI A;  2JZP A;  4ZOH C;  1WF9 A;  1I4R A;  3R2T A;  1C3T A;  4ICU A;  4FUL A;  1TT5 B;  3TEX A;  1HXY D;  3B2F A;  2NMQ A;  4ZDV A;  1IGD A;  3OAW A;  4K3B A;  1XD3 B;  4F8C B;  1K50 A;  1GPX A;  1D6E C;  2A4Z A;  5EE3 A;  3AE8 B;  1TKY A;  4ARI A;  3IBE A;  1Z2M A;  2HDE A;  4XGA B;  5TR5 A;  4ZRJ A;  1N60 A;  4NNJ B;  4KGT A;  4DHZ E;  3UIO B;  1EUV B;  2KWC A;  2RPQ A;  2KDM A;  1GNU A;  1C1Y B;  3NZU A;  1ZGU B;  4K7W A;  1UF0 A;  4E71 A;  4A90 A;  4I6P A;  4BOZ B;  2B3A A;  3N1Y C;  2FCQ A;  1ZE3 D;  4W9E A;  2NPT A;  2CHZ A;  1EF1 A;  3A9K A;  2GBM A;  2NCN A;  1F2R C;  4M0W B;  3SU8 X;  3UIN B;  1I4Q A;  1NBF C;  1OQR A;  3AU4 A;  4ZYN A;  1WGH A;  1IP9 A;  2RDB C;  4HXD A;  1TIF A;  5AEK B;  2INC C;  2CJO A;  3RT3 B;  2LRW A;  3DVG X;  1XLQ A;  4IG7 B;  1FNW A;  3RFZ B;  2IO2 B;  3HIZ A;  1WIA A;  3TMP B;  3OJ3 A;  3UF8 A;  5EE9 A;  1L2N A;  4URK A;  1VLB A;  1WRI A;  3MHZ A;  1FIQ A;  3EEC A;  3VTU A;  2WQY B;  4WWM A;  4NAW B;  1WYG A;  2D11 A;  4TQ0 A;  3L16 A;  1Y8R C;  3APD A;  4C00 A;  4EOY A;  1BML C;  2BYE A;  1AW7 A;  2DAJ A;  3GE3 C;  4YSY B;  4DWF A;  4DHZ B;  1DOX A;  1E0Z A;  2AL6 A;  3Q6B A;  4TUU A;  3R7Q A;  1ZXH A;  4GDK B;  2UYZ B;  4JQW C;  2N0S B;  1VD2 A;  3R3M A;  3T3O A;  3K9P B;  2WXO A;  2L3Z A;  3RPF C;  2KTR B;  1YN4 A;  1C4A A;  4HVB A;  1SXT A;  5H92 C;  4AWJ A;  3TJP A;  2SEB D;  2C7M B;  5C1Z A;  1UGM A;  3AB5 A;  2I38 A;  4RFB A;  2KJ6 A;  3TEZ A;  2HTM E;  3ML8 A;  1WMH B;  3U7Z A;  2DYO A;  1NEK B;  3P42 A;  5J2R A;  4KX6 B;  2I2Y A;  1H4R A;  4JX1 C;  4S0R A;  3FC4 A;  3X0W A;  2L7R A;  3L13 A;  3N30 A;  2DWQ A;  2PW9 A;  1WR1 A;  2Z0E B;  1T5X D;  1KF6 B;  1WM2 A;  1QQR A;  4OZA A;  2JVC A;  3I57 A;  2WXR A;  2KXJ A;  1HE8 A;  5CHF A;  3BK2 A;  2DYM A;  1XLN A;  4M01 A;  4YWG G;  3AE7 B;  1JW9 D;  1WE7 A;  2KVR A;  4REZ A;  2I1J A;  3PVL A;  1YX6 B;  3RNC C;  2MP2 B;  1L7Y A;  2IY1 B;  2DNF A;  5T8I A;  2JF5 A;  1WXQ A;  3ZJV A;  1D5X C;  3M62 B;  2AYO B;  2PLP A;  2BWE S;  2UU7 A;  4RF0 A;  4FJZ A;  3ZNI D;  4C56 C;  3KWL A;  2WXL A;  4HKZ E;  3HRD D;  1WY8 A;  3BZD B;  1D3Z A;  1DGJ A;  3PZ7 A;  3V6C B;  3BII D;  3PO0 A;  4YL8 A;  1OFF A;  4OVU A;  4RMA A;  1FXA A;  5LLI A;  3T9L A;  3ML9 A;  1XXG A;  3ZNG C;  4DXF A;  1M4V A;  3IT4 B;  2MBB B;  2BF8 B;  3MFG A;  3VR8 B;  2OJR A;  3V62 A;  4MJS B;  4HJG E;  1VZ6 A;  1JWS D;  1WZ0 A;  1WSP A;  1Q0W B;  4MGZ E;  3AEB B;  3CF6 E;  1FXT B;  1LM8 B;  5JH5 C;  2KDB A;  4BKG A;  3X23 A;  3LJ3 A;  3W5V B;  2NVU I;  2HE7 A;  3ZXR A;  3U4E G;  1PFD A;  1YIW A;  3N9Y C;  3QAQ A;  3UI3 A;  1QLB B;  2KDI A;  3PHX B;  3PRE A;  3FKY A;  1UEL A;  3SR6 A;  4XX5 A;  1TBE A;  3FIL B;  2KFJ A;  3AU5 A;  2MWS B;  1FRR A;  2WLB A;  4TQ1 A;  4JIO U;  4MM3 A;  1EWY C;  2YVC A;  2DBY A;  1D4B A;  3KUD B;  2MLB A;  2GMI C;  3RNA C;  2D3B A;  1ZKH A;  1CK1 A;  1E7P B;  1V86 A;  3DOW A;  4AJW A;  2X38 A;  3A9J A;  5D7G A;  2QMT A;  4D2K A;  2A5U A;  1T0R C;  4KIK B;  2QEJ C;  2R61 A;  4RGO S;  3TUO A;  1KJT A;  2J0K A;  2V9H A;  2PE9 A;  4WH4 A;  1SB3 C;  2C9W B;  3RD2 A;  2DLB A;  2O6V D;  3DWG C;  3MJW A;  2OOB B;  1FRD A;  4JWS C;  2M56 B;  2JRI B;  3C19 A;  3RNB C;  3ZRC A;  2KAC A;  2JY6 A;  1JWM D;  2LAS A;  3I5J C;  2QIL A;  3AED B;  2BYV E;  3NHE B;  3L4P A;  1WWT A;  4TSS A;  2D2Q A;  1ZDV A;  4PS3 A;  3AEA B;  2OJW A;  4ANU A;  3MP9 A;  2JXX A;  4KZC A;  1CMX B;  3H7P B;  2D10 A;  5HG2 A;  3SHQ A;  2MRP A;  2W3S A;  4RGM A;  3H6N A;  3NVV A;  4OVZ A;  4W9L A;  2JYT A;  2FCS A;  4LK0 M;  2GBR A;  1S3S G;  2WHI A;  5AUK A;  4C7Z A;  4HJK A;  2WWZ A;  5JHB A;  1KRH A;  1QKZ A;  1RM6 C;  2NTT A;  2ASQ A;  1F77 A;  1WGG A;  1TS5 A;  4PYZ A;  5LXH A;  4FA6 A;  2WXK A;  3Q3M C;  2CU3 A;  2JYE A;  5J17 A;  1TKG A;  3AV8 A;  2GBK A;  5BMH A;  2XK5 B;  2WDR B;  4AQ7 A;  2ZVN A;  3A1Q B;  3AE9 B;  3RI7 C;  1D5Z C;  3ZTD A;  4R3D A;  1UZX B;  1TGZ B;  1JRO A;  3V61 A;  1FEH A;  4OZB A;  1TZO A;  4KKJ A;  2D5G A;  2JT4 B;  3ZXV A;  3PS6 A;  1SJH D;  4LJP B;  1P3Q U;  3KUC B;  4DDG D;  2INP E;  2MBQ A;  1Q1O A;  3BYT B;  3NVW A;  2FNJ B;  4XDD A;  3M95 A;  2ZCC A;  4IM2 A;  4EZJ A;  4P1B C;  2NTS A;  1EWC A;  1QOB A;  1FFU A;  1JWA D;  1GOZ A;  3ZO5 B;  1LFD A;  4AUQ C;  3ETR A;  2AQ3 B;  1P9D U;  1TS3 A;  1F1H A;  4RM8 A;  3TEW A;  2JZZ A;  4MSQ B;  4X57 B;  1NI3 A;  3TBL D;  3VRB B;  4WWP A;  3NJT A;  2XBB C;  2Y5B B;  2WXG A;  3BY4 B;  3HM6 X;  4JL9 A;  1QOF A;  2M19 A;  2AX5 A;  3W1Y A;  4GIV A;  4FJY A;  4BKS A;  5BMG A;  4NZL B;  4WJQ A;  1XEE A;  2IPK D;  1T0Y A;  4W9J A;  4WWN A;  3CWI A;  2DEN B;  4AJY B;  1FNU A;  4CQN A;  1KOT A;  3BK1 A;  2CKH B;  2WGS A;  4JWU C;  5AZH A;  4BFR A;  3MC9 A;  2HD5 B;  4NPN A;  3NY5 A;  3RNE C;  3ZQ4 A;  2KTF A;  2LD9 A;  4MEL A;  4L2Y A;  3RMK C;  4P1C C;  4GSW A;  2ONQ A;  4YTN B;  2MJ3 A;  5G55 A;  2PKO A;  4LDT D;  1TTN A;  1J19 A;  2YEP F;  3VHT C;  3VRA B;  2ZW0 A;  3DBH I;  1YJI A;  3GB1 A;  4GLS C;  4B9K A;  3KH0 A;  3PLU A;  4HEA 1;  1B1Z A;  4I6N B;  1C9F A;  5C2T B;  3EC8 A;  2K3U A;  4ANX A;  1WRD B;  2LGS A;  2UWQ A;  1E90 A;  3P4P B;  2BTE A;  1KLV A;  1QOG A;  2L52 A;  3I9V 1;  1DYQ A;  1V6E A;  1JWU D;  2WXN A;  4JGH B;  2EMT A;  3HK0 A;  4J6I A;  5IO9 A;  1JML A;  2WNM A;  1HQR D;  3SD5 A;  1F2R I;  3TCA A;  2ZNV B;  4UDU C;  1TYG B;  4II3 B;  1NYQ A;  3V60 A;  3PRM B;  2XNA C;  1R4N I; 
#chains in the Genus database with same CATH homology
 2RDB C;  3RNF C;  3RNB C;  3RNC C;  2INC C;  3N1Y C;  3Q3M C;  3RN9 C;  3GE3 C;  4P1B C;  3N1X C;  3I5J C;  2IND C;  3Q3N C;  1T0R C;  3RNE C;  3N1Z C;  3I63 C;  3Q14 C;  3Q3O C;  3RMK C;  4P1C C;  3RI7 C;  3GE8 C;  3DHG C;  3DHH C;  3Q2A C;  3RNA C;  3DHI C;  3RNG C;  3N20 C;  1T0S C;  1T0Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...