3N1XC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201c mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
ATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n1xC00
3RMKC 3RNGC 3RNEC 3DHIC 3Q3OC 3RNBC 3N1ZC 1T0SC 1T0QC 3N20C 2INDC 2INCC 3RNFC 3DHHC 4P1BC 3DHGC 2RDBC 3RN9C 3N1YC 3Q3NC 3RI7C 3GE3C 3GE8C 1T0RC 4P1CC 3RNCC 3Q14C 3I63C 3Q2AC 3I5JC 3N1XC 3RNAC 3Q3MC
chains in the Genus database with same CATH superfamily
2BPSA 2MJ3A 3DHIC 1E6EB 2KMAA 5H92C 2KFKB 2KDEB 4FJYA 5JHAA 3V05A 2D10A 2KFKA 3A4SC 4MSQB 1N63A 2NTSA 2LGXA 4TUUA 4RH6A 3HHMA 3WAPA 4FJZA 3KUDB 4C4VB 3V60A 2IGDA 2Q5WD 2GBNA 3NG0A 2K8BA 4RGTA 3AE6B 4IOIE 2DZIA 2KDIA 1JWAD 4NY0A 1MJDA 3ZNHB 4PS7A 2EMTA 1LFDA 1XCTL 4M8MA 3IAM1 2BWFA 1C77A 2WXNA 4CYEA 5BMHA 2K8CA 2WDQB 2D3GA 2JU6X 4BKSD 2NCNA 4RMAA 2CKHB 3Q14C 3RCZA 1MPEA 2LVOA 3PRMB 4TMAB 3ZRCA 1F1HA 2MSED 4OZCA 2KHWB 3VRAB 3EUB2 2KWUB 2WXOA 1I4QA 2KYWA 2X38A 3VR9B 1J8CA 4FJVB 3ZTCA 5LXIB 1MFWA 4II3B 4EZKA 1KRHA 4ANUA 4KDIC 2LWPA 1V1PB 2K22A 1FCLA 4ASWC 3PGEA 4MGZE 3VTUA 1MHHE 1JWMD 1FNWA 2IDYA 3I9V1 3KYDD 4YWGG 4II2B 4NAWA 1OGWA 3AE5B 3UIPB 4F1SA 3P4PB 1C76A 4YSYB 1QILA 1UH6A 2PEAA 2PE6B 3SR6A 1I4HA 1J7BA 3PTFC 4YTNB 1S1QB 1ZW7A 4MT5A 4P16A 1N61A 5JH5C 2BKFA 2AL3A 2QMTA 1P1AA 1DOXA 1TT5B 1WJUA 4KX6B 2VH1A 3JYUA 3A9JA 1VCBA 1JW9D 1HA5A 2M0AA 1ROEA 1WM2A 4LLGM 3RZFA 1E8YA 3U7ZA 2V3NA 2WXFA 2HTHA 4XWWA 4ZOHC 4TQ1A 3BVMA 2EMSA 2MCNB 5DCNA 4RF1A 5KHOA 4B6WA 1XQQA 4KIKA 3B2GA 1VZ7A 2KJ6A 4FBJB 5E6OA 3PT2B 4RNAA 4W9IA 2QC8A 1I4XA 2IO3B 3BVZA 4GN1A 5D3DA 1D4BA 4JIOU 1KJTA 3R8BA 4G11A 5LNK1 2D5GA 3QWZB 2L0TA 2KANA 3UGBB 2KFJA 3UF8A 2KVRA 3AU5A 2MJDA 2M8SA 4HLEA 4AOFA 3AN1A 1WMHA 2LVQA 2LUMA 1EF5A 1WXMA 3AULA 1T0RC 2Z0EB 3I63C 2VZKB 3IG3A 1DYQA 1NI3A 3WALA 1JRPA 4DHZB 3EA6A 2MP2A 2HDEA 3J9CA 2J42A 2JWZA 4C80A 1YJ1A 2N9KA 2FIDA 2E6XA 5T8IA 1IBXB 2XK5A 2KWDA 2W3RA 4RM8A 4EUTA 3Q3MC 3SFDB 1VDVA 3H9DA 1V49A 4FHKA 5GMVA 2N1WA 4MSMB 3MP9A 5D3IB 2IZVB 3AEGB 3LJ3A 2NVUI 1WZ3A 3QQ8B 3A9KB 2ZCCA 3CMMB 5H8YE 1FIQA 2CHWA 3Q8EA 3PZDA 1NYRA 4TQ0A 2AYOB 1ZDVA 2DYBA 2PPHA 4BKSA 4M02A 2AQ1B 2HD5B 2KC2A 3V6CB 2NR2A 4G50A 4M8NA 4ZHOA 1NDDA 4OVUA 2WDVB 2UWQA 1K8RB 3S2AA 3KVFB 4NPNA 4US8A 2I38A 4YL8A 3AMZA 2WX0A 4IDIA 3WA0A 4I6PA 3UQBA 2NBWB 4ITKA 3LDZE 3DVGX 3NVYA 1JALA 2L7RA 2KMMA 3QK0A 2D2QA 1P7FA 1R4MI 2DBYA 3ML8A 4IUMB 4AUQC 2PVOD 1E0ZA 2LASA 1TZ1A 1R4NB 4KZCA 4K3BA 2M0XA 1EF1A 1V5OA 2QEJC 3ZJUA 1H8CA 3DHHC 4YSZB 3QHTA 4W9EA 1E5WA 1VD2A 4W9LA 4AS1A 1QOAA 1CMXB 1UUPA 3UINB 1GAQB 1PGBA 4JL9A 2K5PA 2K39A 5HI1A 3SHQA 1C1YB 4AJWA 1TJEA 3ZUNA 4ANWA 4I6LB 2DX5B 1EO6A 2DLBA 1QOBA 2MBBB 2XBBC 3EFUA 4KKIA 5L95C 2PW9A 1H4RA 2PMVA 3ZNZB 1Q0WB 2C5LC 4NQLB 5GXGB 3MHSD 3WAMA 3OJ4B 2PKOA 5E6PA 4A8XC 3VUXA 1N5XA 1CJEA 4P7IA 3BIID 3HVZA 1SE3A 2LJIA 3AEAB 2EELA 4CHKA 3GE8C 4I6NB 5IO9A 1SF0A 2BF8B 4FADA 3B08A 4GIVA 5AZFA 1ZOYB 2IY1B 1PGXA 3Q3FA 2RDGA 2JXTA 4K1RB 4DHJB 1ZE3D 2LUEA 1UBIA 2L0FA 2J0JA 2MEKA 1DOYA 1B9RA 1WRIA 2MA9B 4K7SA 4BVUC 5G2NA 2KO3A 2MX2A 5BYSA 3BY4B 2J0KA 2ZEQA 2ZVOA 1YQ4B 1T5XD 1KLVA 2BT6A 3NRZA 3KH0A 5D7GA 3ENEA 2DNFA 3H6NA 1QOGA 1E7VA 2BKRB 3N1ZC 3AE2B 4OVZA 1TS4A 1ET9A 2KJHB 2BYTA 1EWCA 1KFYB 2ZNVC 2CHXA 4XYCA 3R66C 5EDSA 3BINA 1YQBA 3VQIA 3R7QA 1WX7A 5KHQA 3PSEB 4H2AA 4HKZE 4BFRA 1SE9A 1V1OA 4XX5A 3Q3OC 3VH4B 3L10B 3U8ZA 1WXVA 3IAS1 2QJLA 1CZPA 2KJRA 2JUOA 2D3CA 2KK8A 3JSVB 4DQOC 4HPPA 5D94A 3NZUA 3TMPB 2DWQA 1ACCA 4JWUC 3AE3B 3RNGC 3TEXA 2KDMA 1WGYA 1TS2A 2AL6A 2Y3AA 4K3CA 3PHWB 3V62A 1AARA 1ESFA 3WIMA 2PJHA 2WYQA 2QCZA 4IC7B 1U4AA 4Q2JA 4BZAA 4DWFA 2IBIB 1WIAA 2QSDA 1PDXA 2YEPB 5MPOA 4XC2A 3ML9A 3CSTA 1FFUA 1Q10A 3C8YA 2DHZA 2AQ3B 2MBHA 1NEKB 3A1QA 1UWMA 2BS3B 2RDBC 1HZ6A 2DYOA 2N1VA 3H8HA 5BYQA 2LFIA 3BK1A 1JQ4A 1N60A 2DZKA 2L05A 2FNJB 2IJ0A 2W55A 3D32A 4WQOB 3RMKC 3BYYB 3K9OB 3UIOB 4XWTA 5G5HA 5D2MB 2LRWA 4HCNB 4E74A 2INPE 2JSVX 2MBOA 2MHJA 2WLBA 3B9JA 4WWNA 4MJSA 1X1MA 4W9CA 1NBFC 5J18A 3E56A 3L54A 5HHDG 4PT5A 1C4CA 2Y5CA 1ZXIA 3U30A 5AUKA 3KUCB 2XN9C 4GDKA 3P4QB 2L76A 2WHIA 4OZBA 1WGDA 1KH0A 4JWSC 4ANXA 2XEWA 3B1LX 3MC8A 3NOBA 2I1JA 3TEZA 1VRAB 2K3UA 4PS8A 1JWSD 3PRPB 3WAOA 3P2BA 3ZIMA 2HE7A 3VXWA 3ZDMC 1C78A 4M0WA 4LDTD 1GB1A 1L6UA 1P7EA 4ZDVA 1D5ZC 2A4ZA 2KZRA 3APCA 2DZJA 4MGIE 1V80A 3M3JA 3DVGY 3RN9C 4N6EB 4CO7A 3W1SC 2JWUA 1FMAD 4X57B 3QX1A 4ICVA 3UI3A 4IWPA 3URYA 3M95A 4IM2A 1E7UA 4C00A 3VVWB 1GPXA 2KLGA 3GZNB 4HRSA 4KSLC 4GSWA 1WJ4A 2QILA 4NJCA 3RI7C 2RGFA 2AQ2B 4RGNA 4W9DA 2ZNVB 3KQ4A 4RF0A 4MEMA 3LXFA 4L1BA 1YJJA 3AI5A 3RFZB 2JYEA 2GBMA 4JQWC 2KTRA 1L0VB 2AX5A 2BS4B 4B9KA 4US9A 4EOYA 2X8XX 1WXQA 2VRRB 4N58A 4IM0A 3ZNID 1WFYA 5EE9A 3PLUA 4W9KA 3DBLI 2YLMA 2IO1B 1FFVA 1WYGA 4CQNA 4EEWA 4D2KA 2EKIA 2JRHA 4ANVA 2O6VD 4RM9A 2KQ4X 1L7YA 3U52E 4NAWB 3NHEB 2WXLA 3RNFC 1YN5A 3L4PA 1F0ZA 2EKEC 1FD6A 3BYTB 2J7QB 1YN4A 3MTNB 3SD5A 3A33B 4YTMB 4PYZA 3Q8FA 2DAJA 1C4AA 3ABVB 3T9LA 1T0QC 2V1YA 1YJIA 2FBWB 1R4NI 3AU4A 3A9JB 5J2RA 3ZQ4A 1TS3A 1XLQA 4P1CC 1JMLA 4PYUA 4BKGA 1AWDA 2KACA 4FA6A 2K6QA 3PPAA 4GB9A 1AN8A 5LLIA 1KM7A 2OOBB 2BB5A 1ENFA 3NY5A 2J52A 2WNMA 5IA7A 5AZHA 1K50A 4KIKB 1V97A 2ZVNA 3P4SB 1WF9A 3IHPC 2C7HA 3VDZA 1FNVA 4LTUA 1WJNA 4B0MA 2R61A 3TEWA 1WGKA 3QC8B 4GU2A 3SFEB 4HK2A 1GC7A 3AB5A 1JRUA 3AE9B 1K51A 1SE2A 2N7JA 4RGOS 1WMHB 2O2VA 1PGAA 1UF0A 2N4FA 2KMCA 2L83A 1AYFA 2L8JA 4WWMA 3N9YC 4YT0B 1GUAB 1TBEA 4XGAB 2MP2B 4F7ZA 4N9F4 5JXVA 3JVZX 3VHTC 3QAQA 4LNOA 3Q6BA 1I42A 4P6VF 4REZA 4YSXB 2REXA 2WDRB 1WZ0A 1C4PA 4MGYE 4WIPA 2XK5B 3W1YA 2PLPA 2FIFA 4ZYNA 4W9GA 3I5JC 4J6IA 2RD0A 2DZMA 2R2OA 1MG8A 2CS4A 2JVCA 4YTPB 4WQMA 3U4EG 2Z0DB 1I4GA 3NZ3A 3L13A 1Y56A 2KWCA 1FXTB 1L5PA 5IN7A 1I4RA 2DYMA 3PHXB 4KZ0A 4EFOA 5TSSA 2KQSA 2YVCA 3EECA 3UQAA 1L2NA 2WXPA 2WGSA 2K0PA 5DPWA 3Q3NC 2D3AA 3VR8B 1TYGB 1A5RA 2D07B 2HJ8A 1V2YA 1C9FA 4NZLB 3PO0A 4AP4C 2OJWA 3NS1A 3DBSA 1IYFA 3WCQA 2G1EA 1LM8B 3NJTA 4K7WA 1D5XC 1XF5L 1SB3C 2JYTA 1HTOA 3KWLA 2D3BA 4HEA1 2O6VA 4O1NA 2KN5A 1I4PA 2IPKD 1UBQA 4RFBA 1FRDA 5DPRA 3HM3A 4FULA 2Z59B 3ZYYX 1Q5WB 4FXCA 3L17A 2JT4B 5IOIA 1NI2A 4FLHA 1TS5A 5EE3A 1VZ6A 4MM3A 2G4SA 3E9SA 5JHBA 1YX5B 3RPFC 1LQBA 1ZPSA 4EZJA 3QIJA 3DBRB 2BS2B 2K8HA 3AXCA 3GP7A 1D5MC 2WU5B 2LD9A 1EM7A 1OEYJ 1V8CA 5JZEB 3TUOA 3K9PB 3BZDB 3VAWA 2W3SA 3ETRA 2V3SA 3ZDTA 1L4ZB 1WYWB 5CHVC 2L52A 3AEBB 4ZRJA 4KSKC 2H88B 3BVGA 1E90A 2Y5PA 1D3ZA 1N62A 4KGTA 4C7YA 1ET6A 4DHZE 1LO5D 1Q1OA 3W9CB 4MACA 3MHZA 3ECIA 3MJWA 3KLSX 3N1XC 1QLBB 3HRDD 2M4NA 4B0EA 3H7SA 2AWTA 1HEZE 3ZTDA 1YD8U 3KYCD 3AM9A 3AE4B 2G45B 2UU7A 2WXGA 3BWUD 5BYRA 4A20A 4K7UA 1L4DB 2FUHB 4OW0A 3V61A 2N9EB 3EGRA 2PVGC 5G55A 1STEA 3W5UB 4UDUC 3LYYA 3N30A 4A55A 2M1MA 1R7SA 1IPGA 1Z5SB 1SSNA 3FILA 2MLBA 2MRPA 2WS3B 2NTTA 3IXSA 5TR5A 3EC8A 3RUIB 1J19A 2RDHA 4GDLA 2GMIC 5EE1A 1YNTE 2WXRA 2KAJA 1BUIC 2K25A 3NVZA 2WP9B 4N59A 2BYFA 2J4XA 3RZWC 1V6EA 3DHGC 2LHEA 4WAFA 1XLNA 2LEKA 2H89B 3Q3JA 4EZLA 3GZNI 3KW5B 1E8ZA 2KN4A 3OG5A 4M00A 1UNSA 2N9LA 1EUVB 3P63A 1QZEA 2KWVB 3OJ3A 3I3TB 1YX6B 3PV1A 4DDID 3HIZA 1QOFA 3X0WA 1SE4A 1WGRA 4KGSA 4MELA 2LMCA 1IP9A 1PQSA 5CX3A 4ZHPA 5DPSA 4HDQA 4ARCA 1F77A 2BWES 1TTNA 4KGRA 4M01A 3R7RA 4LNNA 3ZNGC 1WX8A 2FUG1 1IGCA 2OJRA 4PS3A 2LXAA 5BO4B 1RLFA 1JCKB 1TKYA 3IVFA 4OZAA 1UWXA 3LB8C 4WJPA 2LGDA 4HCPB 3AEEB 2ON8A 2LGSA 4LCDE 1M4VA 3ALBA 1QQRA 3NZSA 3A1QB 2R2QA 2N0SB 2V3PA 5E6JA 4KVGB 1SGHA 2N9PC 3VUYA 4S17A 3ZGZA 3ZJTA 1RFKA 5D6JB 2C7MB 4XDDA 4BBNC 3CSFA 3ZLZA 2QHOA 2B76B 5FK9C 1YMHE 3RD2A 2J53A 3P1MA 2TSSA 3RT3B 3R2TA 4MJSB 4K81A 1PUTA 2M19A 1J7CA 1E9MA 5C1ZA 1GB4A 5HG2A 5HFYA 1C79A 2ZW1A 2M56B 1KLGD 1ZXHA 4GDKB 4RCOA 2N9XA 5L83A 3DCGA 1HE8A 3I57A 3TIXA 2CR5A 2LJ5A 1RFAA 3GS2A 2WXHA 4EE2A 2V9HA 3MJ5A 1WR6E 1WE6A 2NMQA 2JPHA 2WXMA 2QDFA 4OHJA 3ZXRA 3FAHA 5AUIA 4LNIA 4A3PA 4M0WB 4WJQA 2GBKA 2W82A 1C3TA 2KX0A 3DQVA 3TL5A 1ZUD2 4IKGA 2ASQA 4ZRPA 3FKYA 2NPTA 3P42A 2VZKD 3H7PA 1TKGA 4P1BC 3QCAA 1HZ5A 3R3MA 3GE3C 2BW2A 2MBQA 5BMIA 2WDTB 3T3NA 5DPTA 4R3DA 5EE0A 3RNAC 1KOTA 2KD0A 3CWIA 3PVLA 1MG4A 1NVID 1WJ6A 2ZCBA 2V4LA 3VH3B 4FHJA 3AECB 2INCC 1RRBA 4L23A 1PYWD 3ZKJC 3W5VB 4AWJA 1RYJA 4DBGA 4C4VA 1WR1A 5FKAC 2Y5BB 3P4RB 4W9HA 2CU1A 4HJGE 1BMLC 1FEHA 3APDA 1IGDA 2D11A 1YQ3B 1K52A 2BVCA 1RWSA 1SIFA 3H1UA 1VLBA 2KTRB 1S3SG 1GOZA 1T0SC 1WSPA 4NNJB 2WXJA 3SU8X 4ARIA 2IYDB 1P98A 2LGYA 2PIAA 2JY6A 2INNE 1L0YB 4E3CA 3IT4B 3L16A 2J0MA 3WANA 1JROA 1XCQL 1EU3A 2K6DB 1TGZB 5CHFA 4GLSC 3M62B 2LZ6A 1MVKA 3TJPA 1EWYC 2KVZA 2W54A 5C2TB 1TZOA 3ZXVA 1ZDXA 1EU4A 4GOCA 1WI0A 1Y8RC 1BXTA 3L08A 1PFDA 2LGIA 2MBEA 4OVVA 1FRRA 4C7ZA 1V1PA 4WJNA 3N32A 3QA8A 4DXAB 1WGHA 2B3AA 2N7DA 4ACFA 3B0AA 2MH7A 1XLOA 2KX3A 1MI0A 4BOSC 1JWBD 1FNUA 1L6VA 4WJOA 3MC9A 2SEBD 2L1AA 4QAYA 3HUIA 4ZRQA 3AEDB 4ZYSA 3DBHB 2W9NA 2CJOA 1OQQA 3IBEA 2ZPNA 3N3KB 2C60A 1KLUD 4WAAA 1XD3B 4PK1A 2SAKA 3DBRI 1G6JA 2LHDA 1XXGA 4C56C 2I1KA 5AEKB 2ZZPB 4NJ6A 4IM3A 3SEBA 1I7HA 4WH4A 1QKZA 3PREA 3NVWA 3M63B 3ZO5B 1IUEA 2O2VB 2BYEA 3MFGA 3AV8A 4A90A 1P3QU 2GRIA 4FN2A 3JW0X 1FM0D 1OTRB 1KF6B 3ZRFA 5AZGA 2NBVB 2FCSA 1OFFA 2FCMA 1WM3A 3N20C 2AEHA 3O65B 3CIRB 1V86A 1CK1A 4LDTB 2GBJA 4ZRIA 2BGFA 4DHJD 4TV3A 3C19A 2IGGA 2WWZA 3ZJVA 4HVBA 3RNEC 3NUHB 3PZ8A 2CU3A 1F2RC 4A3OA 2GLSA 1WX9A 2YEPF 3PZ7A 1Z2MA 1T0YA 3BK2A 2MW5A 2FCNA 2OHFA 1IBXA 1T6BX 1WE7A 4JGHB 3RNCC 4B95A 1CQVA 2RMMA 4DXFA 2ONQA 3W1SA 2M17A 1F2RI 1YOVB 4JLCA 3DVNV 4HWIB 2KNBA 2KDBA 4KV2A 2IY0B 2HJ1A 4JX1C 2VH2A 2WQYB 1WRDB 4URKA 3A9KA 3HVDA 4TKNA 3DOWA 3AEFB 3OWEB 2V4IB 1VZ8A 1BT0A 5CTRC 4DK5A 4LNFA 2MJEA 1QF6A 3DBLB 1TY2A 4GGQA 3PLVA 2C9WB 1TIFA 1TY0A 5IP4D 3X23A 1JWUD 2KC1A 1L0XB 1WXAA 2O6VB 3V3XA 3HM6X 2BYVE 2QIEB 2PTLA 4HDOA 5J17A 1GC6A 1NYQA 1SIJA 4MDKE 4MGKE 4DDGD 3RULA 1YN3A 3ONSA 1XO3A 4IWQA 4LK0M 3T8MA 3PS6A 4XE0A 3IT6B 3GB1A 4HPMB 4ZRKA 2G4DB 2HTME 4MM3B 1E8XA 1FXAA 4LNKA 2BTEA 4KKJA 3U2SC 3TCAA 5IKCM 1UGJA 1V81A 4G0NB 5C23A 1RM6C 3DDCB 2E3TA 2OEDA 2K1FA 1TKEA 3AE1B 3V6EB 4AJYB 3AH7A 1GG3A 2INDC 3ZW3A 3Q69A 1V5TA 1AW7A 3O13A 2JQRB 2UYZB 4GMVA 5HKHA 1YIWA 3U7DA 4A9AA 1M94A 5E6NA 2RPQA 5IAAC 1HTQA 2K9XA 4W9JA 5CHWA 2JX5A 1ZKHA 2G3QB 2N7EA 3VRBB 2LI5A 3R2IA 4WWPA 2DAFA 2IGHA 3VTWA 4WWOA 4W9FA 1HXYD 1UGMA 2KOXA 2ZW0A 4NAMA 3KWVA 1P0RA 4IWOA 4JE3B 3C0RB 2RR9A 1KTKA 2ACZB 2WX1A 2ZPYA 1ZGUB 4IG7B 2L00B 3FILB 1UELA 2V0GA 1FXIA 1LXDA 4A6QA 2KXJA 2ZJDA 1E10A 3SDLC 2KDFB 2FCQA 4IW0A 3FC4A 4GDLB 2G9HD 2GBRA 1GNUA 2BBCA 4LJPB 3APFA 5FR6A 2KQ7A 2ICIA 4E71A 4DXGA 1SBBB 2GB1A 2WXKA 3DVNU 1SXTA 3NVVA 4HROA 3HK0A 1VJKA 1F52A 1XLPA 4JPSA 5LXHA 2GOWA 1FO4A 2RPVA 1MHXA 3VUWA 2NS5A 3VTVA 4LJOB 1FCCC 3TBLD 5FR3A 4XZ4A 3DWGC 2XNAC 3N1YC 5I4DA 4BBNF 2KTFA 2Z8LA 3PRZA 1HQRD 1QT9A 4BAXA 3AE8B 2GI9A 4NQKE 4GXBA 4L2YA 2PE9A 1N6ZA 2WXIA 1GJZA 1SJHD 2WU2B 3OAWA 4BKTA 3MC0B 1XT9B 3Q2AC 2BB6A 3JSVA 2KLCA 1SJED 4G3XB 4S0RA 4WURA 1R4MB 5C3JB 2IO0B 4HPLB 1D6EC 1E8WA 3CF6E 3Q8AA 2CJNA 1OQYA 1OEYA 2C7NB 4MH0E 2KKCA 3Q8CA 2IO2B 3Q8BA 1K53A 1XEEA 1P9DU 2MQJA 1OQRA 3L0WB 2JZPA 4F8CB 1VR9A 2DENB 1FPYA 2L32A 1WWTA 5BMGA 4ICUA 2LRUA 1I35A 1LGRA 4EKUA 1J7AA 2JRIB 2FAZA 3EHVA 2I2YA 4YXDB 3OLMD 2WXQA 1B1ZA 3QARA 1WGGA 1F9JA 1WH3A 2L3ZA 4TSSA 3VFKA 2NBUA 1RAXA 3DBHI 3TEYA 3T3OA 3KUZA 3W2DA 2FE8A 4AQ7A 1V9JA 3RNBC 3IFWB 4NJ7A 4RGMA 4HXDA 1A70A 3QJZA 4BOZB 4J3OD 2JZ3B 1ISNA 1DOIA 2A5UA 1ZP0B 1SEBD 2JZZA 2LXCA 1T3QA 1UZXB 5G5GA 2LVPA 3ZVVA 3AE7B 1WXSA 3GOEA 2KT7A 3DWMA 2NPTB 3H7PB 2CHZA 1E7PB 3TSSA 4KDLB 2JXXA 2JF5A 1WY8A 3NS8A 3B2FA 2MWSB 3RYTA 4MH8A 1UD7A 1NENB 2RSUA 1DGJA 4HJKA 3A4RA 3DPDA 3EFCA 1J0GA 4HKQA 4XDCA 4USAA 1N5WA 2BQQA
chains in the Genus database with same CATH topology
3RMKC 3RNGC 3RNEC 3DHIC 3Q3OC 3RNBC 3N1ZC 1T0SC 1T0QC 3N20C 2INDC 2INCC 3RNFC 3DHHC 4P1BC 3DHGC 2RDBC 3RN9C 3N1YC 3Q3NC 3RI7C 3GE3C 3GE8C 1T0RC 4P1CC 3RNCC 3Q14C 3I63C 3Q2AC 3I5JC 3N1XC 3RNAC 3Q3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMK C;  3RNG C;  3RNE C;  3DHI C;  3Q3O C;  3RNB C;  3N1Z C;  1T0S C;  1T0Q C;  3N20 C;  2IND C;  2INC C;  3RNF C;  3DHH C;  4P1B C;  3DHG C;  2RDB C;  3RN9 C;  3N1Y C;  3Q3N C;  3RI7 C;  3GE3 C;  3GE8 C;  1T0R C;  4P1C C;  3RNC C;  3Q14 C;  3I63 C;  3Q2A C;  3I5J C;  3N1X C;  3RNA C;  3Q3M C; 
#chains in the Genus database with same CATH topology
 2BPS A;  2MJ3 A;  3DHI C;  1E6E B;  2KMA A;  5H92 C;  2KFK B;  2KDE B;  4FJY A;  5JHA A;  3V05 A;  2D10 A;  2KFK A;  3A4S C;  4MSQ B;  1N63 A;  2NTS A;  2LGX A;  4TUU A;  4RH6 A;  3HHM A;  3WAP A;  4FJZ A;  3KUD B;  4C4V B;  3V60 A;  2IGD A;  2Q5W D;  2GBN A;  3NG0 A;  2K8B A;  4RGT A;  3AE6 B;  4IOI E;  2DZI A;  2KDI A;  1JWA D;  4NY0 A;  1MJD A;  3ZNH B;  4PS7 A;  2EMT A;  1LFD A;  1XCT L;  4M8M A;  3IAM 1;  2BWF A;  1C77 A;  2WXN A;  4CYE A;  5BMH A;  2K8C A;  2WDQ B;  2D3G A;  2JU6 X;  4BKS D;  2NCN A;  4RMA A;  2CKH B;  3Q14 C;  3RCZ A;  1MPE A;  2LVO A;  3PRM B;  4TMA B;  3ZRC A;  1F1H A;  2MSE D;  4OZC A;  2KHW B;  3VRA B;  3EUB 2;  2KWU B;  2WXO A;  1I4Q A;  2KYW A;  2X38 A;  3VR9 B;  1J8C A;  4FJV B;  3ZTC A;  5LXI B;  1MFW A;  4II3 B;  4EZK A;  1KRH A;  4ANU A;  4KDI C;  2LWP A;  1V1P B;  2K22 A;  1FCL A;  4ASW C;  3PGE A;  4MGZ E;  3VTU A;  1MHH E;  1JWM D;  1FNW A;  2IDY A;  3I9V 1;  3KYD D;  4YWG G;  4II2 B;  4NAW A;  1OGW A;  3AE5 B;  3UIP B;  4F1S A;  3P4P B;  1C76 A;  4YSY B;  1QIL A;  1UH6 A;  2PEA A;  2PE6 B;  3SR6 A;  1I4H A;  1J7B A;  3PTF C;  4YTN B;  1S1Q B;  1ZW7 A;  4MT5 A;  4P16 A;  1N61 A;  5JH5 C;  2BKF A;  2AL3 A;  2QMT A;  1P1A A;  1DOX A;  1TT5 B;  1WJU A;  4KX6 B;  2VH1 A;  3JYU A;  3A9J A;  1VCB A;  1JW9 D;  1HA5 A;  2M0A A;  1ROE A;  1WM2 A;  4LLG M;  3RZF A;  1E8Y A;  3U7Z A;  2V3N A;  2WXF A;  2HTH A;  4XWW A;  4ZOH C;  4TQ1 A;  3BVM A;  2EMS A;  2MCN B;  5DCN A;  4RF1 A;  5KHO A;  4B6W A;  1XQQ A;  4KIK A;  3B2G A;  1VZ7 A;  2KJ6 A;  4FBJ B;  5E6O A;  3PT2 B;  4RNA A;  4W9I A;  2QC8 A;  1I4X A;  2IO3 B;  3BVZ A;  4GN1 A;  5D3D A;  1D4B A;  4JIO U;  1KJT A;  3R8B A;  4G11 A;  5LNK 1;  2D5G A;  3QWZ B;  2L0T A;  2KAN A;  3UGB B;  2KFJ A;  3UF8 A;  2KVR A;  3AU5 A;  2MJD A;  2M8S A;  4HLE A;  4AOF A;  3AN1 A;  1WMH A;  2LVQ A;  2LUM A;  1EF5 A;  1WXM A;  3AUL A;  1T0R C;  2Z0E B;  3I63 C;  2VZK B;  3IG3 A;  1DYQ A;  1NI3 A;  3WAL A;  1JRP A;  4DHZ B;  3EA6 A;  2MP2 A;  2HDE A;  3J9C A;  2J42 A;  2JWZ A;  4C80 A;  1YJ1 A;  2N9K A;  2FID A;  2E6X A;  5T8I A;  1IBX B;  2XK5 A;  2KWD A;  2W3R A;  4RM8 A;  4EUT A;  3Q3M C;  3SFD B;  1VDV A;  3H9D A;  1V49 A;  4FHK A;  5GMV A;  2N1W A;  4MSM B;  3MP9 A;  5D3I B;  2IZV B;  3AEG B;  3LJ3 A;  2NVU I;  1WZ3 A;  3QQ8 B;  3A9K B;  2ZCC A;  3CMM B;  5H8Y E;  1FIQ A;  2CHW A;  3Q8E A;  3PZD A;  1NYR A;  4TQ0 A;  2AYO B;  1ZDV A;  2DYB A;  2PPH A;  4BKS A;  4M02 A;  2AQ1 B;  2HD5 B;  2KC2 A;  3V6C B;  2NR2 A;  4G50 A;  4M8N A;  4ZHO A;  1NDD A;  4OVU A;  2WDV B;  2UWQ A;  1K8R B;  3S2A A;  3KVF B;  4NPN A;  4US8 A;  2I38 A;  4YL8 A;  3AMZ A;  2WX0 A;  4IDI A;  3WA0 A;  4I6P A;  3UQB A;  2NBW B;  4ITK A;  3LDZ E;  3DVG X;  3NVY A;  1JAL A;  2L7R A;  2KMM A;  3QK0 A;  2D2Q A;  1P7F A;  1R4M I;  2DBY A;  3ML8 A;  4IUM B;  4AUQ C;  2PVO D;  1E0Z A;  2LAS A;  1TZ1 A;  1R4N B;  4KZC A;  4K3B A;  2M0X A;  1EF1 A;  1V5O A;  2QEJ C;  3ZJU A;  1H8C A;  3DHH C;  4YSZ B;  3QHT A;  4W9E A;  1E5W A;  1VD2 A;  4W9L A;  4AS1 A;  1QOA A;  1CMX B;  1UUP A;  3UIN B;  1GAQ B;  1PGB A;  4JL9 A;  2K5P A;  2K39 A;  5HI1 A;  3SHQ A;  1C1Y B;  4AJW A;  1TJE A;  3ZUN A;  4ANW A;  4I6L B;  2DX5 B;  1EO6 A;  2DLB A;  1QOB A;  2MBB B;  2XBB C;  3EFU A;  4KKI A;  5L95 C;  2PW9 A;  1H4R A;  2PMV A;  3ZNZ B;  1Q0W B;  2C5L C;  4NQL B;  5GXG B;  3MHS D;  3WAM A;  3OJ4 B;  2PKO A;  5E6P A;  4A8X C;  3VUX A;  1N5X A;  1CJE A;  4P7I A;  3BII D;  3HVZ A;  1SE3 A;  2LJI A;  3AEA B;  2EEL A;  4CHK A;  3GE8 C;  4I6N B;  5IO9 A;  1SF0 A;  2BF8 B;  4FAD A;  3B08 A;  4GIV A;  5AZF A;  1ZOY B;  2IY1 B;  1PGX A;  3Q3F A;  2RDG A;  2JXT A;  4K1R B;  4DHJ B;  1ZE3 D;  2LUE A;  1UBI A;  2L0F A;  2J0J A;  2MEK A;  1DOY A;  1B9R A;  1WRI A;  2MA9 B;  4K7S A;  4BVU C;  5G2N A;  2KO3 A;  2MX2 A;  5BYS A;  3BY4 B;  2J0K A;  2ZEQ A;  2ZVO A;  1YQ4 B;  1T5X D;  1KLV A;  2BT6 A;  3NRZ A;  3KH0 A;  5D7G A;  3ENE A;  2DNF A;  3H6N A;  1QOG A;  1E7V A;  2BKR B;  3N1Z C;  3AE2 B;  4OVZ A;  1TS4 A;  1ET9 A;  2KJH B;  2BYT A;  1EWC A;  1KFY B;  2ZNV C;  2CHX A;  4XYC A;  3R66 C;  5EDS A;  3BIN A;  1YQB A;  3VQI A;  3R7Q A;  1WX7 A;  5KHQ A;  3PSE B;  4H2A A;  4HKZ E;  4BFR A;  1SE9 A;  1V1O A;  4XX5 A;  3Q3O C;  3VH4 B;  3L10 B;  3U8Z A;  1WXV A;  3IAS 1;  2QJL A;  1CZP A;  2KJR A;  2JUO A;  2D3C A;  2KK8 A;  3JSV B;  4DQO C;  4HPP A;  5D94 A;  3NZU A;  3TMP B;  2DWQ A;  1ACC A;  4JWU C;  3AE3 B;  3RNG C;  3TEX A;  2KDM A;  1WGY A;  1TS2 A;  2AL6 A;  2Y3A A;  4K3C A;  3PHW B;  3V62 A;  1AAR A;  1ESF A;  3WIM A;  2PJH A;  2WYQ A;  2QCZ A;  4IC7 B;  1U4A A;  4Q2J A;  4BZA A;  4DWF A;  2IBI B;  1WIA A;  2QSD A;  1PDX A;  2YEP B;  5MPO A;  4XC2 A;  3ML9 A;  3CST A;  1FFU A;  1Q10 A;  3C8Y A;  2DHZ A;  2AQ3 B;  2MBH A;  1NEK B;  3A1Q A;  1UWM A;  2BS3 B;  2RDB C;  1HZ6 A;  2DYO A;  2N1V A;  3H8H A;  5BYQ A;  2LFI A;  3BK1 A;  1JQ4 A;  1N60 A;  2DZK A;  2L05 A;  2FNJ B;  2IJ0 A;  2W55 A;  3D32 A;  4WQO B;  3RMK C;  3BYY B;  3K9O B;  3UIO B;  4XWT A;  5G5H A;  5D2M B;  2LRW A;  4HCN B;  4E74 A;  2INP E;  2JSV X;  2MBO A;  2MHJ A;  2WLB A;  3B9J A;  4WWN A;  4MJS A;  1X1M A;  4W9C A;  1NBF C;  5J18 A;  3E56 A;  3L54 A;  5HHD G;  4PT5 A;  1C4C A;  2Y5C A;  1ZXI A;  3U30 A;  5AUK A;  3KUC B;  2XN9 C;  4GDK A;  3P4Q B;  2L76 A;  2WHI A;  4OZB A;  1WGD A;  1KH0 A;  4JWS C;  4ANX A;  2XEW A;  3B1L X;  3MC8 A;  3NOB A;  2I1J A;  3TEZ A;  1VRA B;  2K3U A;  4PS8 A;  1JWS D;  3PRP B;  3WAO A;  3P2B A;  3ZIM A;  2HE7 A;  3VXW A;  3ZDM C;  1C78 A;  4M0W A;  4LDT D;  1GB1 A;  1L6U A;  1P7E A;  4ZDV A;  1D5Z C;  2A4Z A;  2KZR A;  3APC A;  2DZJ A;  4MGI E;  1V80 A;  3M3J A;  3DVG Y;  3RN9 C;  4N6E B;  4CO7 A;  3W1S C;  2JWU A;  1FMA D;  4X57 B;  3QX1 A;  4ICV A;  3UI3 A;  4IWP A;  3URY A;  3M95 A;  4IM2 A;  1E7U A;  4C00 A;  3VVW B;  1GPX A;  2KLG A;  3GZN B;  4HRS A;  4KSL C;  4GSW A;  1WJ4 A;  2QIL A;  4NJC A;  3RI7 C;  2RGF A;  2AQ2 B;  4RGN A;  4W9D A;  2ZNV B;  3KQ4 A;  4RF0 A;  4MEM A;  3LXF A;  4L1B A;  1YJJ A;  3AI5 A;  3RFZ B;  2JYE A;  2GBM A;  4JQW C;  2KTR A;  1L0V B;  2AX5 A;  2BS4 B;  4B9K A;  4US9 A;  4EOY A;  2X8X X;  1WXQ A;  2VRR B;  4N58 A;  4IM0 A;  3ZNI D;  1WFY A;  5EE9 A;  3PLU A;  4W9K A;  3DBL I;  2YLM A;  2IO1 B;  1FFV A;  1WYG A;  4CQN A;  4EEW A;  4D2K A;  2EKI A;  2JRH A;  4ANV A;  2O6V D;  4RM9 A;  2KQ4 X;  1L7Y A;  3U52 E;  4NAW B;  3NHE B;  2WXL A;  3RNF C;  1YN5 A;  3L4P A;  1F0Z A;  2EKE C;  1FD6 A;  3BYT B;  2J7Q B;  1YN4 A;  3MTN B;  3SD5 A;  3A33 B;  4YTM B;  4PYZ A;  3Q8F A;  2DAJ A;  1C4A A;  3ABV B;  3T9L A;  1T0Q C;  2V1Y A;  1YJI A;  2FBW B;  1R4N I;  3AU4 A;  3A9J B;  5J2R A;  3ZQ4 A;  1TS3 A;  1XLQ A;  4P1C C;  1JML A;  4PYU A;  4BKG A;  1AWD A;  2KAC A;  4FA6 A;  2K6Q A;  3PPA A;  4GB9 A;  1AN8 A;  5LLI A;  1KM7 A;  2OOB B;  2BB5 A;  1ENF A;  3NY5 A;  2J52 A;  2WNM A;  5IA7 A;  5AZH A;  1K50 A;  4KIK B;  1V97 A;  2ZVN A;  3P4S B;  1WF9 A;  3IHP C;  2C7H A;  3VDZ A;  1FNV A;  4LTU A;  1WJN A;  4B0M A;  2R61 A;  3TEW A;  1WGK A;  3QC8 B;  4GU2 A;  3SFE B;  4HK2 A;  1GC7 A;  3AB5 A;  1JRU A;  3AE9 B;  1K51 A;  1SE2 A;  2N7J A;  4RGO S;  1WMH B;  2O2V A;  1PGA A;  1UF0 A;  2N4F A;  2KMC A;  2L83 A;  1AYF A;  2L8J A;  4WWM A;  3N9Y C;  4YT0 B;  1GUA B;  1TBE A;  4XGA B;  2MP2 B;  4F7Z A;  4N9F 4;  5JXV A;  3JVZ X;  3VHT C;  3QAQ A;  4LNO A;  3Q6B A;  1I42 A;  4P6V F;  4REZ A;  4YSX B;  2REX A;  2WDR B;  1WZ0 A;  1C4P A;  4MGY E;  4WIP A;  2XK5 B;  3W1Y A;  2PLP A;  2FIF A;  4ZYN A;  4W9G A;  3I5J C;  4J6I A;  2RD0 A;  2DZM A;  2R2O A;  1MG8 A;  2CS4 A;  2JVC A;  4YTP B;  4WQM A;  3U4E G;  2Z0D B;  1I4G A;  3NZ3 A;  3L13 A;  1Y56 A;  2KWC A;  1FXT B;  1L5P A;  5IN7 A;  1I4R A;  2DYM A;  3PHX B;  4KZ0 A;  4EFO A;  5TSS A;  2KQS A;  2YVC A;  3EEC A;  3UQA A;  1L2N A;  2WXP A;  2WGS A;  2K0P A;  5DPW A;  3Q3N C;  2D3A A;  3VR8 B;  1TYG B;  1A5R A;  2D07 B;  2HJ8 A;  1V2Y A;  1C9F A;  4NZL B;  3PO0 A;  4AP4 C;  2OJW A;  3NS1 A;  3DBS A;  1IYF A;  3WCQ A;  2G1E A;  1LM8 B;  3NJT A;  4K7W A;  1D5X C;  1XF5 L;  1SB3 C;  2JYT A;  1HTO A;  3KWL A;  2D3B A;  4HEA 1;  2O6V A;  4O1N A;  2KN5 A;  1I4P A;  2IPK D;  1UBQ A;  4RFB A;  1FRD A;  5DPR A;  3HM3 A;  4FUL A;  2Z59 B;  3ZYY X;  1Q5W B;  4FXC A;  3L17 A;  2JT4 B;  5IOI A;  1NI2 A;  4FLH A;  1TS5 A;  5EE3 A;  1VZ6 A;  4MM3 A;  2G4S A;  3E9S A;  5JHB A;  1YX5 B;  3RPF C;  1LQB A;  1ZPS A;  4EZJ A;  3QIJ A;  3DBR B;  2BS2 B;  2K8H A;  3AXC A;  3GP7 A;  1D5M C;  2WU5 B;  2LD9 A;  1EM7 A;  1OEY J;  1V8C A;  5JZE B;  3TUO A;  3K9P B;  3BZD B;  3VAW A;  2W3S A;  3ETR A;  2V3S A;  3ZDT A;  1L4Z B;  1WYW B;  5CHV C;  2L52 A;  3AEB B;  4ZRJ A;  4KSK C;  2H88 B;  3BVG A;  1E90 A;  2Y5P A;  1D3Z A;  1N62 A;  4KGT A;  4C7Y A;  1ET6 A;  4DHZ E;  1LO5 D;  1Q1O A;  3W9C B;  4MAC A;  3MHZ A;  3ECI A;  3MJW A;  3KLS X;  3N1X C;  1QLB B;  3HRD D;  2M4N A;  4B0E A;  3H7S A;  2AWT A;  1HEZ E;  3ZTD A;  1YD8 U;  3KYC D;  3AM9 A;  3AE4 B;  2G45 B;  2UU7 A;  2WXG A;  3BWU D;  5BYR A;  4A20 A;  4K7U A;  1L4D B;  2FUH B;  4OW0 A;  3V61 A;  2N9E B;  3EGR A;  2PVG C;  5G55 A;  1STE A;  3W5U B;  4UDU C;  3LYY A;  3N30 A;  4A55 A;  2M1M A;  1R7S A;  1IPG A;  1Z5S B;  1SSN A;  3FIL A;  2MLB A;  2MRP A;  2WS3 B;  2NTT A;  3IXS A;  5TR5 A;  3EC8 A;  3RUI B;  1J19 A;  2RDH A;  4GDL A;  2GMI C;  5EE1 A;  1YNT E;  2WXR A;  2KAJ A;  1BUI C;  2K25 A;  3NVZ A;  2WP9 B;  4N59 A;  2BYF A;  2J4X A;  3RZW C;  1V6E A;  3DHG C;  2LHE A;  4WAF A;  1XLN A;  2LEK A;  2H89 B;  3Q3J A;  4EZL A;  3GZN I;  3KW5 B;  1E8Z A;  2KN4 A;  3OG5 A;  4M00 A;  1UNS A;  2N9L A;  1EUV B;  3P63 A;  1QZE A;  2KWV B;  3OJ3 A;  3I3T B;  1YX6 B;  3PV1 A;  4DDI D;  3HIZ A;  1QOF A;  3X0W A;  1SE4 A;  1WGR A;  4KGS A;  4MEL A;  2LMC A;  1IP9 A;  1PQS A;  5CX3 A;  4ZHP A;  5DPS A;  4HDQ A;  4ARC A;  1F77 A;  2BWE S;  1TTN A;  4KGR A;  4M01 A;  3R7R A;  4LNN A;  3ZNG C;  1WX8 A;  2FUG 1;  1IGC A;  2OJR A;  4PS3 A;  2LXA A;  5BO4 B;  1RLF A;  1JCK B;  1TKY A;  3IVF A;  4OZA A;  1UWX A;  3LB8 C;  4WJP A;  2LGD A;  4HCP B;  3AEE B;  2ON8 A;  2LGS A;  4LCD E;  1M4V A;  3ALB A;  1QQR A;  3NZS A;  3A1Q B;  2R2Q A;  2N0S B;  2V3P A;  5E6J A;  4KVG B;  1SGH A;  2N9P C;  3VUY A;  4S17 A;  3ZGZ A;  3ZJT A;  1RFK A;  5D6J B;  2C7M B;  4XDD A;  4BBN C;  3CSF A;  3ZLZ A;  2QHO A;  2B76 B;  5FK9 C;  1YMH E;  3RD2 A;  2J53 A;  3P1M A;  2TSS A;  3RT3 B;  3R2T A;  4MJS B;  4K81 A;  1PUT A;  2M19 A;  1J7C A;  1E9M A;  5C1Z A;  1GB4 A;  5HG2 A;  5HFY A;  1C79 A;  2ZW1 A;  2M56 B;  1KLG D;  1ZXH A;  4GDK B;  4RCO A;  2N9X A;  5L83 A;  3DCG A;  1HE8 A;  3I57 A;  3TIX A;  2CR5 A;  2LJ5 A;  1RFA A;  3GS2 A;  2WXH A;  4EE2 A;  2V9H A;  3MJ5 A;  1WR6 E;  1WE6 A;  2NMQ A;  2JPH A;  2WXM A;  2QDF A;  4OHJ A;  3ZXR A;  3FAH A;  5AUI A;  4LNI A;  4A3P A;  4M0W B;  4WJQ A;  2GBK A;  2W82 A;  1C3T A;  2KX0 A;  3DQV A;  3TL5 A;  1ZUD 2;  4IKG A;  2ASQ A;  4ZRP A;  3FKY A;  2NPT A;  3P42 A;  2VZK D;  3H7P A;  1TKG A;  4P1B C;  3QCA A;  1HZ5 A;  3R3M A;  3GE3 C;  2BW2 A;  2MBQ A;  5BMI A;  2WDT B;  3T3N A;  5DPT A;  4R3D A;  5EE0 A;  3RNA C;  1KOT A;  2KD0 A;  3CWI A;  3PVL A;  1MG4 A;  1NVI D;  1WJ6 A;  2ZCB A;  2V4L A;  3VH3 B;  4FHJ A;  3AEC B;  2INC C;  1RRB A;  4L23 A;  1PYW D;  3ZKJ C;  3W5V B;  4AWJ A;  1RYJ A;  4DBG A;  4C4V A;  1WR1 A;  5FKA C;  2Y5B B;  3P4R B;  4W9H A;  2CU1 A;  4HJG E;  1BML C;  1FEH A;  3APD A;  1IGD A;  2D11 A;  1YQ3 B;  1K52 A;  2BVC A;  1RWS A;  1SIF A;  3H1U A;  1VLB A;  2KTR B;  1S3S G;  1GOZ A;  1T0S C;  1WSP A;  4NNJ B;  2WXJ A;  3SU8 X;  4ARI A;  2IYD B;  1P98 A;  2LGY A;  2PIA A;  2JY6 A;  2INN E;  1L0Y B;  4E3C A;  3IT4 B;  3L16 A;  2J0M A;  3WAN A;  1JRO A;  1XCQ L;  1EU3 A;  2K6D B;  1TGZ B;  5CHF A;  4GLS C;  3M62 B;  2LZ6 A;  1MVK A;  3TJP A;  1EWY C;  2KVZ A;  2W54 A;  5C2T B;  1TZO A;  3ZXV A;  1ZDX A;  1EU4 A;  4GOC A;  1WI0 A;  1Y8R C;  1BXT A;  3L08 A;  1PFD A;  2LGI A;  2MBE A;  4OVV A;  1FRR A;  4C7Z A;  1V1P A;  4WJN A;  3N32 A;  3QA8 A;  4DXA B;  1WGH A;  2B3A A;  2N7D A;  4ACF A;  3B0A A;  2MH7 A;  1XLO A;  2KX3 A;  1MI0 A;  4BOS C;  1JWB D;  1FNU A;  1L6V A;  4WJO A;  3MC9 A;  2SEB D;  2L1A A;  4QAY A;  3HUI A;  4ZRQ A;  3AED B;  4ZYS A;  3DBH B;  2W9N A;  2CJO A;  1OQQ A;  3IBE A;  2ZPN A;  3N3K B;  2C60 A;  1KLU D;  4WAA A;  1XD3 B;  4PK1 A;  2SAK A;  3DBR I;  1G6J A;  2LHD A;  1XXG A;  4C56 C;  2I1K A;  5AEK B;  2ZZP B;  4NJ6 A;  4IM3 A;  3SEB A;  1I7H A;  4WH4 A;  1QKZ A;  3PRE A;  3NVW A;  3M63 B;  3ZO5 B;  1IUE A;  2O2V B;  2BYE A;  3MFG A;  3AV8 A;  4A90 A;  1P3Q U;  2GRI A;  4FN2 A;  3JW0 X;  1FM0 D;  1OTR B;  1KF6 B;  3ZRF A;  5AZG A;  2NBV B;  2FCS A;  1OFF A;  2FCM A;  1WM3 A;  3N20 C;  2AEH A;  3O65 B;  3CIR B;  1V86 A;  1CK1 A;  4LDT B;  2GBJ A;  4ZRI A;  2BGF A;  4DHJ D;  4TV3 A;  3C19 A;  2IGG A;  2WWZ A;  3ZJV A;  4HVB A;  3RNE C;  3NUH B;  3PZ8 A;  2CU3 A;  1F2R C;  4A3O A;  2GLS A;  1WX9 A;  2YEP F;  3PZ7 A;  1Z2M A;  1T0Y A;  3BK2 A;  2MW5 A;  2FCN A;  2OHF A;  1IBX A;  1T6B X;  1WE7 A;  4JGH B;  3RNC C;  4B95 A;  1CQV A;  2RMM A;  4DXF A;  2ONQ A;  3W1S A;  2M17 A;  1F2R I;  1YOV B;  4JLC A;  3DVN V;  4HWI B;  2KNB A;  2KDB A;  4KV2 A;  2IY0 B;  2HJ1 A;  4JX1 C;  2VH2 A;  2WQY B;  1WRD B;  4URK A;  3A9K A;  3HVD A;  4TKN A;  3DOW A;  3AEF B;  3OWE B;  2V4I B;  1VZ8 A;  1BT0 A;  5CTR C;  4DK5 A;  4LNF A;  2MJE A;  1QF6 A;  3DBL B;  1TY2 A;  4GGQ A;  3PLV A;  2C9W B;  1TIF A;  1TY0 A;  5IP4 D;  3X23 A;  1JWU D;  2KC1 A;  1L0X B;  1WXA A;  2O6V B;  3V3X A;  3HM6 X;  2BYV E;  2QIE B;  2PTL A;  4HDO A;  5J17 A;  1GC6 A;  1NYQ A;  1SIJ A;  4MDK E;  4MGK E;  4DDG D;  3RUL A;  1YN3 A;  3ONS A;  1XO3 A;  4IWQ A;  4LK0 M;  3T8M A;  3PS6 A;  4XE0 A;  3IT6 B;  3GB1 A;  4HPM B;  4ZRK A;  2G4D B;  2HTM E;  4MM3 B;  1E8X A;  1FXA A;  4LNK A;  2BTE A;  4KKJ A;  3U2S C;  3TCA A;  5IKC M;  1UGJ A;  1V81 A;  4G0N B;  5C23 A;  1RM6 C;  3DDC B;  2E3T A;  2OED A;  2K1F A;  1TKE A;  3AE1 B;  3V6E B;  4AJY B;  3AH7 A;  1GG3 A;  2IND C;  3ZW3 A;  3Q69 A;  1V5T A;  1AW7 A;  3O13 A;  2JQR B;  2UYZ B;  4GMV A;  5HKH A;  1YIW A;  3U7D A;  4A9A A;  1M94 A;  5E6N A;  2RPQ A;  5IAA C;  1HTQ A;  2K9X A;  4W9J A;  5CHW A;  2JX5 A;  1ZKH A;  2G3Q B;  2N7E A;  3VRB B;  2LI5 A;  3R2I A;  4WWP A;  2DAF A;  2IGH A;  3VTW A;  4WWO A;  4W9F A;  1HXY D;  1UGM A;  2KOX A;  2ZW0 A;  4NAM A;  3KWV A;  1P0R A;  4IWO A;  4JE3 B;  3C0R B;  2RR9 A;  1KTK A;  2ACZ B;  2WX1 A;  2ZPY A;  1ZGU B;  4IG7 B;  2L00 B;  3FIL B;  1UEL A;  2V0G A;  1FXI A;  1LXD A;  4A6Q A;  2KXJ A;  2ZJD A;  1E10 A;  3SDL C;  2KDF B;  2FCQ A;  4IW0 A;  3FC4 A;  4GDL B;  2G9H D;  2GBR A;  1GNU A;  2BBC A;  4LJP B;  3APF A;  5FR6 A;  2KQ7 A;  2ICI A;  4E71 A;  4DXG A;  1SBB B;  2GB1 A;  2WXK A;  3DVN U;  1SXT A;  3NVV A;  4HRO A;  3HK0 A;  1VJK A;  1F52 A;  1XLP A;  4JPS A;  5LXH A;  2GOW A;  1FO4 A;  2RPV A;  1MHX A;  3VUW A;  2NS5 A;  3VTV A;  4LJO B;  1FCC C;  3TBL D;  5FR3 A;  4XZ4 A;  3DWG C;  2XNA C;  3N1Y C;  5I4D A;  4BBN F;  2KTF A;  2Z8L A;  3PRZ A;  1HQR D;  1QT9 A;  4BAX A;  3AE8 B;  2GI9 A;  4NQK E;  4GXB A;  4L2Y A;  2PE9 A;  1N6Z A;  2WXI A;  1GJZ A;  1SJH D;  2WU2 B;  3OAW A;  4BKT A;  3MC0 B;  1XT9 B;  3Q2A C;  2BB6 A;  3JSV A;  2KLC A;  1SJE D;  4G3X B;  4S0R A;  4WUR A;  1R4M B;  5C3J B;  2IO0 B;  4HPL B;  1D6E C;  1E8W A;  3CF6 E;  3Q8A A;  2CJN A;  1OQY A;  1OEY A;  2C7N B;  4MH0 E;  2KKC A;  3Q8C A;  2IO2 B;  3Q8B A;  1K53 A;  1XEE A;  1P9D U;  2MQJ A;  1OQR A;  3L0W B;  2JZP A;  4F8C B;  1VR9 A;  2DEN B;  1FPY A;  2L32 A;  1WWT A;  5BMG A;  4ICU A;  2LRU A;  1I35 A;  1LGR A;  4EKU A;  1J7A A;  2JRI B;  2FAZ A;  3EHV A;  2I2Y A;  4YXD B;  3OLM D;  2WXQ A;  1B1Z A;  3QAR A;  1WGG A;  1F9J A;  1WH3 A;  2L3Z A;  4TSS A;  3VFK A;  2NBU A;  1RAX A;  3DBH I;  3TEY A;  3T3O A;  3KUZ A;  3W2D A;  2FE8 A;  4AQ7 A;  1V9J A;  3RNB C;  3IFW B;  4NJ7 A;  4RGM A;  4HXD A;  1A70 A;  3QJZ A;  4BOZ B;  4J3O D;  2JZ3 B;  1ISN A;  1DOI A;  2A5U A;  1ZP0 B;  1SEB D;  2JZZ A;  2LXC A;  1T3Q A;  1UZX B;  5G5G A;  2LVP A;  3ZVV A;  3AE7 B;  1WXS A;  3GOE A;  2KT7 A;  3DWM A;  2NPT B;  3H7P B;  2CHZ A;  1E7P B;  3TSS A;  4KDL B;  2JXX A;  2JF5 A;  1WY8 A;  3NS8 A;  3B2F A;  2MWS B;  3RYT A;  4MH8 A;  1UD7 A;  1NEN B;  2RSU A;  1DGJ A;  4HJK A;  3A4R A;  3DPD A;  3EFC A;  1J0G A;  4HKQ A;  4XDC A;  4USA A;  1N5W A;  2BQQ A; 
#chains in the Genus database with same CATH homology
 3RMK C;  3RNG C;  3RNE C;  3DHI C;  3Q3O C;  3RNB C;  3N1Z C;  1T0S C;  1T0Q C;  3N20 C;  2IND C;  2INC C;  3RNF C;  3DHH C;  4P1B C;  3DHG C;  2RDB C;  3RN9 C;  3N1Y C;  3Q3N C;  3RI7 C;  3GE3 C;  3GE8 C;  1T0R C;  4P1C C;  3RNC C;  3Q14 C;  3I63 C;  3Q2A C;  3I5J C;  3N1X C;  3RNA C;  3Q3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...