3N1XC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201c mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
ATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n1xC00
1T0QC 3RNAC 1T0RC 3Q14C 3DHHC 2RDBC 3Q2AC 3RMKC 3I5JC 2INCC 3Q3NC 3DHIC 3RNEC 3N1YC 4P1BC 3N20C 3RNCC 3RI7C 3Q3MC 3GE3C 3RNGC 3RNFC 3I63C 3GE8C 3N1ZC 3N1XC 3Q3OC 4P1CC 1T0SC 2INDC 3RN9C 3RNBC 3DHGC
chains in the Genus database with same CATH superfamily
5BYSA 3Q14C 2ACZB 3AEDB 1ZPSA 4C7YA 1WSPA 2ONQA 2RMMA 2L83A 4IWOA 4BAXA 4MGZE 1NDDA 3RNCC 1JRUA 2KLGA 2RDHA 3NVZA 3EUB2 1R7SA 4GDKB 3SR6A 3VH3B 3L17A 1WGGA 1TS3A 2WXIA 2RSUA 4REZA 1OFFA 2PKOA 4CO7A 1VZ8A 1YN5A 1LO5D 3AMZA 5IN7A 1RAXA 4K7SA 2EMSA 2KTFA 4IWPA 1FM0D 5TSSA 3KYDD 4HDOA 5IKCM 1HZ5A 2V4LA 2MW5A 2BF8B 2D2QA 4ZRIA 1J7CA 4MGYE 1WWTA 1N5XA 1GB1A 4WAAA 1MHHE 4OVZA 1E9MA 2AX5A 2PPHA 1IGCA 2KJ6A 3X0WA 2WLBA 4K81A 3PT2B 3HHMA 4C00A 4IM3A 1FCCC 4NQKE 1V80A 3NUHB 4YWGG 1UWMA 1EU4A 1NENB 3N30A 1FFUA 1IPGA 4A8XC 2FIDA 2MSED 3Q69A 4GB9A 2INNE 4RGTA 2MWSB 3WANA 3NJTA 4GMVA 1HA5A 4B6WA 1PGBA 2BS4B 1T0SC 3NOBA 4BOZB 3L54A 2DZJA 2QCZA 2TSSA 3L0WB 3UINB 4FA6A 5EE3A 4IG7B 2ZW1A 1JWUD 1OTRB 1V1PA 4NZLB 1GUAB 2GLSA 2CJNA 5L95C 2I1JA 5GMVA 4ZRJA 1Z5SB 2LHDA 2NBWB 3WALA 4IKGA 5JZEB 2KN4A 4IM2A 4JE3B 4P6VF 1TS2A 3VTUA 1GPXA 1F9JA 1WGKA 3HIZA 3GE8C 1AYFA 5LNK1 1RRBA 4AUQC 3KUCB 3VUYA 2KC1A 1LQBA 3RFZB 2JXXA 4M01A 3KUZA 1AW7A 1UF0A 2WXOA 4OZBA 3AN1A 4YTNB 1DOXA 3FAHA 2K6DB 1YJJA 5IO9A 4EZLA 4TQ0A 2WXNA 2KDEB 2JWZA 4KDIC 2ON8A 3EC8A 1FNVA 4RFBA 1P9DU 4OW0A 1TJEA 4MM3B 1JWBD 4DHZE 3J9CA 2W54A 2KOXA 2ZJDA 2OEDA 3Q3NC 4HPLB 4E74A 3ZW3A 3ML9A 4DDID 3PLUA 3ALBA 3A33B 1VCBA 4W9DA 2J42A 4L2YA 1Z2MA 1VLBA 2KMAA 4DXGA 1N61A 1PUTA 2KWDA 3U7ZA 5DPWA 1WZ3A 4OVVA 5D7GA 1HZ6A 1V81A 1WXAA 2DX5B 2WXLA 4AWJA 4ZRQA 3SHQA 2HJ1A 3ZNZB 1J7AA 3ZTDA 1E90A 2RPVA 2PVOD 3TEWA 4HKQA 1S3SG 2KWCA 5FK9C 3OLMD 5KHQA 2HTME 4XGAB 3I63C 5IAAC 3PSEB 1E5WA 1KLGD 2MRPA 3A9JA 1YX5B 1C1YB 2H89B 2KQ4X 1FEHA 2G45B 3AE1B 3WAOA 2D3BA 3UIPB 3SEBA 1YMHE 4DHZB 3QX1A 1NBFC 3IG3A 4IUMB 1WE6A 2Q5WD 3K9OB 3V3XA 2LGYA 2BQQA 4W9IA 3DVGX 1JWMD 4AJWA 2BS3B 1PDXA 4A3OA 1FRDA 2RD0A 2WXQA 3URYA 5BYRA 5BMHA 4CQNA 1ACCA 2X38A 2XBBC 4HWIB 2FCNA 1RM6C 4II3B 2M0AA 5J2RA 2MJ3A 4KSLC 3MC0B 2JWUA 2QDFA 1ZXIA 5BO4B 2KVRA 3NVWA 2FCMA 2L0FA 1WFYA 4KGRA 4ANWA 5EE0A 5G5HA 3AEFB 4LNOA 4M0WA 5BMIA 1PYWD 1S1QB 2IO1B 4WWNA 3VRBB 3FKYA 3RN9C 4GGQA 1MG4A 3B2GA 4KKIA 2IO2B 3ZUNA 4LDTD 5AUKA 5BMGA 3IVFA 1SE9A 1L4DB 1ESFA 1EWCA 1FPYA 1WRIA 1E7PB 2MJEA 5CHVC 1D5MC 2K1FA 3R66C 1L7YA 3P4PB 2MA9B 2VZKD 1V9JA 2WXPA 3DWGC 1GNUA 2L3ZA 1B1ZA 2DZIA 3SFEB 2Z0EB 1YQ4B 2GOWA 3GZNB 1D5XC 2PLPA 4J3OD 4LK0M 4B95A 1UUPA 2V3NA 3RZFA 2JYEA 2LFIA 1XEEA 3Q3FA 1J0GA 2AQ2B 4C80A 5L83A 3CMMB 1F2RI 3VXWA 5JHAA 5TR5A 1EWYC 2N0SB 2GRIA 1F77A 1JW9D 1SB3C 4HCNB 2YEPF 3C0RB 3NRZA 3CF6E 1FXAA 1H4RA 2CKHB 4PK1A 4K7WA 1KLUD 3B1LX 4FULA 2LXCA 2KNBA 4I6LB 2XEWA 2L05A 2XK5A 1YQ3B 3PRMB 3L16A 3HM3A 1I42A 2ICIA 1UZXB 3IHPC 3KVFB 3IT6B 4M02A 3SDLC 1WJUA 1C4CA 3IFWB 1XD3B 4FJVB 2BS2B 3RNAC 2OJRA 1TKGA 1SJHD 2KYWA 2UU7A 4JLCA 1N60A 1UNSA 3O13A 3ZRCA 5D2MB 3PHWB 4KZCA 3W1YA 1K53A 1D4BA 4N58A 1WX9A 5C1ZA 1UD7A 1CQVA 4OZAA 4LTUA 4WWMA 1TKYA 4NJ7A 5IP4D 3KW5B 1TS5A 1KH0A 1YD8U 2L8JA 2M4NA 1SXTA 2J7QB 5C23A 1MJDA 1VDVA 3TEXA 5HKHA 3N1YC 4DHJD 1JMLA 1E8XA 4A90A 1EF5A 3ZQ4A 1OQYA 2D3GA 4ZDVA 2AQ3B 2FE8A 2YEPB 3V05A 3ZDTA 2MCNB 3AU4A 1WH3A 2O2VB 3RT3B 1P3QU 1IUEA 4XYCA 4W9CA 3PGEA 1FRRA 3AE9B 4MDKE 2L32A 1L6UA 3GZNI 3Q3JA 3TBLD 4FHKA 3Q3OC 2I1KA 1TT5B 1HEZE 2WDQB 1VRAB 2NPTA 3DHHC 4ASWC 1SSNA 1WR1A 3KLSX 2RDBC 3Q2AC 3AE4B 5G2NA 3AE7B 3LJ3A 1YN4A 3V62A 3QK0A 5H92C 1P1AA 1WGHA 4QAYA 3N20C 5HI1A 3H6NA 1N6ZA 3EFUA 1V97A 4ARCA 2KFKA 2MQJA 4W9EA 3AEGB 2NTTA 4MT5A 3C19A 1PGXA 3P1MA 4BFRA 3W9CB 2J4XA 1L6VA 4II2B 1WRDB 2KX3A 3T9LA 2Z0DB 1B9RA 1ZDVA 2LASA 2FIFA 2X8XX 4USAA 1JRPA 2RGFA 3TSSA 1JWSD 3DVNU 3L08A 4ANVA 2KZRA 1C4PA 1TGZB 4I6PA 4XX5A 2ZVOA 1LGRA 2BYEA 2WU2B 2HD5B 3NVYA 4G3XB 4DWFA 2Z59B 2DWQA 2IO0B 1ET6A 3A1QA 1WM2A 3QQ8B 2N9PC 4LCDE 2LI5A 2CHZA 2IPKD 3QA8A 2L52A 3ZNID 4MGIE 1NYQA 2O6VA 4M0WB 4HEA1 3EFCA 3Q8AA 3IAM1 3ZLZA 2IGDA 2DYMA 3VTVA 2M56B 5E6JA 1J19A 2VRRB 4GIVA 4GDKA 3ZXVA 2BTEA 4CHKA 3RZWC 3MJWA 4WH4A 3NS1A 1CJEA 2WXKA 3ZKJC 2KHWB 4JWSC 1I4XA 1IBXA 2MEKA 3U4EG 4HLEA 2UWQA 4RGOS 2LD9A 3PS6A 1E8WA 4ZOHC 2M1MA 2DBYA 3GE3C 4KVGB 2DYOA 3GS2A 4FBJB 2MBOA 1HQRD 5AZGA 3ZDMC 3FILA 5FR6A 5HFYA 4HJGE 2K0PA 1V5OA 4P16A 3AE2B 3LXFA 3PLVA 2KDMA 2K3UA 2DZMA 3VUWA 2KLCA 3B08A 1P7FA 3QHTA 2KANA 3PZ8A 3UIOB 1L0VB 3OAWA 1OEYJ 4NJCA 4F1SA 3AEAB 2AQ1B 3AXCA 1QOAA 5D3IB 1DOYA 1E6EB 2WGSA 1I35A 1K50A 3ZJUA 1ZGUB 3I5JC 4ITKA 2G4SA 3JSVA 4BKSA 1R4MI 4D2KA 3U30A 1TY0A 2JT4B 2N9XA 5LLIA 3RNBC 1V49A 3T3NA 2DENB 1J7BA 3PVLA 1I4QA 3MC8A 3BZDB 3WIMA 4OHJA 1V8CA 3GB1A 5CTRC 1Q5WB 4A6QA 2C60A 3PREA 4P7IA 2C9WB 4PT5A 3TIXA 1FXIA 2D07B 4DK5A 1WGRA 4C4VA 2WU5B 2QMTA 1D5ZC 4RGNA 1WM3A 3TUOA 1C3TA 4PS7A 5HHDG 3R7QA 2OHFA 3U2SC 3C8YA 2QHOA 3NVVA 3NY5A 1LM8B 4IM0A 2WP9B 4ZRKA 1V86A 1X1MA 3M3JA 2KQSA 2HE7A 3TEYA 4HKZE 2MHJA 4B0MA 3N9YC 3NG0A 3RD2A 2KXJA 4XDDA 3ZNHB 1ET9A 2WHIA 1GOZA 4C56C 4XWWA 5C2TB 4URKA 3VRAB 4LNNA 4WAFA 3EECA 2IYDB 2KACA 2KMMA 1NVID 1FXTB 2G1EA 3N1XC 2M0XA 2LVPA 4DXFA 1L2NA 2REXA 2JY6A 1D3ZA 2KMCA 5AZFA 1TBEA 3NS8A 3A9KA 2ZPYA 3B9JA 3H9DA 3ZIMA 2K9XA 3V61A 2LJIA 2G3QB 3L4PA 4E71A 2AYOB 1KRHA 4EE2A 4ANXA 4HK2A 3MFGA 4W9KA 4XZ4A 1UELA 1F1HA 1XO3A 3D32A 4KX6B 3DVNV 4LJPB 4N59A 1QLBB 2FUG1 4KGSA 1Q0WB 1NEKB 2BPSA 3DQVA 3VUXA 1R4MB 2N9EB 1GJZA 1GC7A 1ZUD2 3L13A 4A55A 3CSTA 4ZHOA 3T3OA 4C4VB 2MX2A 4GSWA 3AV8A 4X57B 4BKTA 1Y56A 1GAQB 1QILA 3P4QB 3MJ5A 4BZAA 4US8A 4FJYA 4KDLB 2LGSA 3RPFC 4W9JA 4GU2A 3W5VB 3AE5B 1JCKB 4L23A 2PMVA 3U8ZA 3UF8A 3DWMA 4BVUC 4WJNA 2CU1A 2K25A 3CSFA 1NI3A 2N7DA 3UQAA 1TZOA 4MH8A 2CJOA 4M8NA 3SD5A 4MJSA 1GC6A 3RI7C 2I38A 1EUVB 1E7UA 2L0TA 3S2AA 4B0EA 2C7NB 2R2QA 4YL8A 3W5UB 1TS4A 2WXRA 4ZYNA 3ZJVA 3IAS1 4LNIA 2IO3B 4FN2A 4KIKB 3E9SA 4ICUA 4US9A 4LNFA 3O65B 5DPSA 2XN9C 2VZKB 4EEWA 4W9FA 3ZXRA 2KJHB 4HVBA 3KWLA 3DDCB 2LZ6A 1HE8A 1QT9A 4OVUA 4BOSC 1YQBA 5E6PA 2IBIB 2GBKA 2N7EA 4EFOA 3FC4A 5GXGB 3AH7A 5MPOA 1KJTA 1D6EC 1LXDA 1WMHA 4L1BA 1Q1OA 3L10B 3MP9A 1FMAD 3DPDA 4A3PA 3NZ3A 1M4VA 1SE4A 2D11A 1IP9A 2CHXA 4DQOC 1T3QA 2A5UA 1WGYA 1WYWB 1AWDA 1WZ0A 3APCA 4JWUC 3EA6A 1WXMA 1MHXA 1TY2A 2KD0A 2IGGA 3UGBB 1ENFA 4NPNA 4KSKC 1K51A 2JU6X 4P1BC 2AL6A 4RGMA 3HUIA 1WJ4A 4DXAB 3VVWB 1YX6B 1BUIC 1T0YA 1HTQA 2K22A 4A20A 2GBJA 2K8HA 2J0KA 1WJ6A 1FIQA 1C4AA 2KDBA 1AN8A 2K8CA 1EO6A 2K39A 2KVZA 1EM7A 2ZPNA 4JGHB 3R7RA 1PFDA 4XE0A 1L4ZB 3N1ZC 4MEMA 3K9PB 3BIID 3ZRFA 2OJWA 2H88B 3QJZA 2NTSA 3RMKC 1WY8A 3OG5A 4IC7B 2V9HA 3A4SC 2C5LC 4ZHPA 1DOIA 3W1SC 2XK5B 4TSSA 3MHSD 1SIJA 3VHTC 1L0XB 1C9FA 1VZ7A 1DGJA 2NR2A 4LLGM 2BWES 2WS3B 2QIEB 1SGHA 3RCZA 1WIAA 3I9V1 3P4RB 5T8IA 3VAWA 1FD6A 5DPTA 2L1AA 3PO0A 1IYFA 2KN5A 4FJZA 3LB8C 1SE3A 4O1NA 1KOTA 1MG8A 3BYTB 3M95A 2GI9A 1QQRA 3H8HA 4RM9A 1FNUA 2AL3A 4MH0E 1FFVA 3BINA 3ZYYX 2JUOA 4N6EB 2AWTA 5C3JB 2BGFA 4N9F4 3B2FA 2NMQA 1GB4A 5JXVA 4BBNC 3OJ4B 4YXDB 3B0AA 1ROEA 2NS5A 2E6XA 1T0QC 2FBWB 3Q8FA 3PPAA 1JALA 3VFKA 2K8BA 1YN3A 2KO3A 1TIFA 2DAFA 3SU8X 4MSMB 2JQRB 1GG3A 3BVMA 1OEYA 2MP2B 3H7PB 2JF5A 1RFAA 4JQWC 3A4RA 4A9AA 1FO4A 3BY4B 5CX3A 1WXQA 2FUHB 1YOVB 4MSQB 2WXFA 2BT6A 4GXBA 3QC8B 1KM7A 1UBQA 1LFDA 2KDFB 2FAZA 4IWQA 1V1OA 4C7ZA 3I3TB 3UI3A 1I4RA 1E8YA 2OOBB 2Z8LA 4J6IA 1FCLA 2IY1B 4EKUA 4WWOA 3VR9B 1OGWA 2LUEA 2N4FA 4NAWB 3P4SB 2ZZPB 1PQSA 3VR8B 3AEBB 1JQ4A 1V5TA 4TQ1A 2WDTB 2W3RA 2Y5BB 3AECB 1E0ZA 3ML8A 1E8ZA 4WQOB 1JWAD 2WDVB 3PRZA 4KGTA 1XT9B 3QCAA 2BYTA 2HTHA 4HXDA 2ZNVB 1BMLC 1OQQA 4ARIA 2M17A 4GDLB 4WWPA 4F7ZA 2V0GA 2KAJA 4MM3A 2KTRB 5G5GA 5CHWA 2HDEA 5D3DA 5J18A 4IW0A 4R3DA 2GBNA 2O2VA 2JPHA 4KV2A 2EMTA 1V2YA 1XLPA 4HROA 4AP4C 2LVQA 2V3SA 3OJ3A 1WR6E 3TL5A 2MBHA 1ZDXA 4RF1A 1WXVA 2WX0A 2W82A 4LJOB 3N32A 2BB6A 1I4HA 1JROA 1CK1A 4ANUA 3ENEA 4WQMA 3ETRA 1SJED 1TKEA 2BBCA 2ZCCA 3NZUA 4YTPB 1IBXB 3JSVB 1RYJA 2WXGA 1L0YB 3TEZA 1CMXB 1KTKA 3PTFC 2KFKB 1K8RB 3A9JB 3FILB 4WJOA 3Q6BA 2LEKA 2R2OA 3VTWA 4EUTA 2QEJC 1E7VA 2CS4A 4K7UA 2CR5A 2VH2A 2KC2A 2JYTA 2BVCA 1P0RA 1MI0A 2KWVB 1R4NB 2FCSA 2NBVB 4HRSA 2R61A 2J0JA 2MP2A 1TZ1A 1XCTL 2FCQA 5BYQA 1XLNA 2Y5PA 1UBIA 1VR9A 2KDIA 1T5XD 4EOYA 4S0RA 3AE8B 3H1UA 2LJ5A 3DCGA 4RNAA 1VJKA 4GN1A 3A1QB 3ZTCA 2WX1A 4OZCA 2PIAA 3E56A 3CIRB 1VZ6A 2W3SA 3PV1A 2WWZA 3LDZE 2WNMA 4EZJA 2W55A 5E6OA 3GOEA 4YSXB 2JZ3B 1NI2A 1SIFA 1C78A 3ZJTA 2PJHA 3AEEB 1WGDA 1KFYB 2CHWA 5IOIA 3MTNB 2WXMA 4NJ6A 2IY0B 2J52A 1ZXHA 1RLFA 4NNJB 4PYZA 5D94A 5HG2A 3HVZA 3T8MA 2LHEA 3V6CB 2KWUB 1ZKHA 2EELA 3BVGA 4LNKA 1PGAA 3BVZA 2N7JA 2LRWA 2PE6B 3AE3B 4HPMB 1EF1A 2KX0A 1J8CA 2BB5A 2KKCA 1F0ZA 3HVDA 4GDLA 4DHJB 3DBRI 3DHGC 1L5PA 4FXCA 1N62A 4PYUA 3LYYA 2JXTA 5EE9A 2LRUA 3H7SA 3WAMA 1EU3A 1MVKA 4RMAA 2ASQA 3ABVB 3Q3MC 3H7PA 5KHOA 2WXHA 2BW2A 1Q10A 4DBGA 5EE1A 3M62B 3HM6X 3DBHI 4H2AA 1SEBD 3W2DA 5JH5C 3R2IA 5CHFA 1YJ1A 2IDYA 3JVZX 2NPTB 3PHXB 2N1WA 2RR9A 3ZGZA 3VH4B 2DNFA 2QC8A 1I7HA 1R4NI 1F52A 4BKGA 1VD2A 1QOGA 2L76A 5AUIA 1C79A 2GB1A 2EKIA 3KYCD 4ZRPA 1ZW7A 4PS8A 4NQLB 4UDUC 1QZEA 3MC9A 3UQBA 2DHZA 4WJPA 3DBLI 4W9GA 3IT4B 1I4GA 3Q8CA 2C7MB 3APFA 2LVOA 4Q2JA 1UGJA 1A5RA 4FADA 1WF9A 2C7HA 4BBNF 1UWXA 4K1RB 1XLOA 1QOFA 1FNWA 2CU3A 3AULA 3ECIA 4YTMB 5JHBA 1V1PB 4JPSA 5J17A 1ZE3D 1SBBB 2N1VA 2NVUI 2L7RA 4HPPA 2Y3AA 3TMPB 5D6JB 1MPEA 1ZOYB 2QJLA 3AU5A 3TJPA 2BYFA 3WA0A 2K5PA 2I2YA 3QARA 3JYUA 1G6JA 1UH6A 1YJIA 3BWUD 4MJSB 4MELA 2FNJB 2W9NA 1WE7A 2WXJA 1A70A 2BWFA 2JRIB 4RH6A 3QIJA 1NYRA 5H8YE 3DBSA 1SE2A 3DBRB 4NY0A 2KK8A 3A9KB 1RWSA 4GOCA 1E10A 4ICVA 4W9HA 1K52A 4RF0A 4KZ0A 5LXIB 2SEBD 2MH7A 3AM9A 1P98A 3DBHB 3Q8EA 1HXYD 3W1SA 4WJQA 2LWPA 2RDGA 1WMHB 4XWTA 4P1CC 1WYGA 1P7EA 2QSDA 3N3KB 2M19A 5DCNA 3DHIC 1OQRA 2BKRB 2MBQA 2ZNVC 3RNGC 1SF0A 3SFDB 4CYEA 3KH0A 1HTOA 3KWVA 1WJNA 3APDA 1QKZA 2IGHA 3DBLB 3P42A 3HRDD 4MACA 3AE6B 2YVCA 2MLBA 1UGMA 5AZHA 3P2BA 5FKAC 4GLSC 2LXAA 3EGRA 4IOIE 2D3AA 3PZ7A 5DPRA 2ZCBA 2D5GA 4S17A 1CZPA 3ZVVA 1TYGB 2MJDA 4LDTB 2ZW0A 2V3PA 3X23A 2EKEC 1XXGA 1TTNA 2GBMA 1V6EA 3ZO5B 2E3TA 3RUIB 3V60A 4AQ7A 2UYZB 2NBUA 4KIKA 5E6NA 2V4IB 2LGIA 4E3CA 1N63A 2J0MA 1QOBA 3KUDB 1F2RC 2JSVX 2B3AA 2Y5CA 3HK0A 5FR3A 3VDZA 1KF6B 1MFWA 4YT0B 2KTRA 4TMAB 2O6VB 4W9LA 4B9KA 3BK1A 2KJRA 4PS3A 2KQ7A 4ZYSA 2JX5A 3ZNGC 1Y8RC 3P63A 1BXTA 2JRHA 2N9KA 4JX1C 2L00B 1XF5L 2GMIC 3U52E 2G4DB 3RNFC 4I6NB 4AJYB 2HJ8A 2WQYB 5IA7A 2D10A 1DYQA 2M8SA 3BYYB 4TUUA 1H8CA 1WI0A 2PVGC 4JL9A 4TV3A 5EDSA 1BT0A 2DZKA 4EZKA 2IZVB 2IJ0A 2K6QA 1XCQL 3CWIA 4M00A 2INCC 4XC2A 2PW9A 3WCQA 1ISNA 3EHVA 3JW0X 3PZDA 3U7DA 2INPE 2MBEA 2V1YA 2LGDA 3R2TA 5AEKB 2KFJA 2PEAA 1WX8A 4DDGD 1AARA 1T0RC 2GBRA 3NHEB 2B76B 2O6VD 5LXHA 4AOFA 4F8CB 4JIOU 3VQIA 2SAKA 1N5WA 3AI5A 1YIWA 4K3BA 5I4DA 1XQQA 3WAPA 1ZP0B 2A4ZA 2LGXA 3M63B 4NAMA 2RPQA 2VH1A 4RM8A 4YSZB 4HDQA 2PTLA 4G50A 2ZVNA 1WXSA 3RNEC 2BYVE 4HJKA 1QF6A 1IGDA 2KT7A 1C77A 4YSYB 3AB5A 1KLVA 3I57A 2AEHA 2MBBB 4HCPB 1WX7A 4MGKE 4BKSD 2G9HD 2J53A 2JVCA 4G11A 1T6BX 3V6EB 4RCOA 3BK2A 1I4PA 4AS1A 2YLMA 3IBEA 3RULA 2PE9A 2D3CA 3TCAA 1YNTE 4NAWA 3R3MA 2ZEQA 4XDCA 2WDRB 4K3CA 3DOWA 4G0NB 4M8MA 2BKFA 3DVGY 2QILA 4WIPA 3NZSA 3IXSA 3KQ4A 4FLHA 4KKJA 1STEA 2LUMA 2NCNA 2WYQA 3MHZA 3RYTA 2DAJA 3ONSA 1M94A 1XLQA 3QAQA 5G55A 4WURA 3QWZB 3Q8BA 2DLBA 4FHJA 2JZZA 1C76A 2JZPA 3R8BA 4ACFA 3PRPB 2DYBA 2LMCA 3GP7A 1U4AA 2N9LA 3OWEB 1RFKA 4IDIA 2INDC 2XNAC 4TKNA
chains in the Genus database with same CATH topology
1T0QC 3RNAC 1T0RC 3Q14C 3DHHC 2RDBC 3Q2AC 3RMKC 3I5JC 2INCC 3Q3NC 3DHIC 3RNEC 3N1YC 4P1BC 3N20C 3RNCC 3RI7C 3Q3MC 3GE3C 3RNGC 3RNFC 3I63C 3GE8C 3N1ZC 3N1XC 3Q3OC 4P1CC 1T0SC 2INDC 3RN9C 3RNBC 3DHGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Q C;  3RNA C;  1T0R C;  3Q14 C;  3DHH C;  2RDB C;  3Q2A C;  3RMK C;  3I5J C;  2INC C;  3Q3N C;  3DHI C;  3RNE C;  3N1Y C;  4P1B C;  3N20 C;  3RNC C;  3RI7 C;  3Q3M C;  3GE3 C;  3RNG C;  3RNF C;  3I63 C;  3GE8 C;  3N1Z C;  3N1X C;  3Q3O C;  4P1C C;  1T0S C;  2IND C;  3RN9 C;  3RNB C;  3DHG C; 
#chains in the Genus database with same CATH topology
 5BYS A;  3Q14 C;  2ACZ B;  3AED B;  1ZPS A;  4C7Y A;  1WSP A;  2ONQ A;  2RMM A;  2L83 A;  4IWO A;  4BAX A;  4MGZ E;  1NDD A;  3RNC C;  1JRU A;  2KLG A;  2RDH A;  3NVZ A;  3EUB 2;  1R7S A;  4GDK B;  3SR6 A;  3VH3 B;  3L17 A;  1WGG A;  1TS3 A;  2WXI A;  2RSU A;  4REZ A;  1OFF A;  2PKO A;  4CO7 A;  1VZ8 A;  1YN5 A;  1LO5 D;  3AMZ A;  5IN7 A;  1RAX A;  4K7S A;  2EMS A;  2KTF A;  4IWP A;  1FM0 D;  5TSS A;  3KYD D;  4HDO A;  5IKC M;  1HZ5 A;  2V4L A;  2MW5 A;  2BF8 B;  2D2Q A;  4ZRI A;  1J7C A;  4MGY E;  1WWT A;  1N5X A;  1GB1 A;  4WAA A;  1MHH E;  4OVZ A;  1E9M A;  2AX5 A;  2PPH A;  1IGC A;  2KJ6 A;  3X0W A;  2WLB A;  4K81 A;  3PT2 B;  3HHM A;  4C00 A;  4IM3 A;  1FCC C;  4NQK E;  1V80 A;  3NUH B;  4YWG G;  1UWM A;  1EU4 A;  1NEN B;  3N30 A;  1FFU A;  1IPG A;  4A8X C;  2FID A;  2MSE D;  3Q69 A;  4GB9 A;  2INN E;  4RGT A;  2MWS B;  3WAN A;  3NJT A;  4GMV A;  1HA5 A;  4B6W A;  1PGB A;  2BS4 B;  1T0S C;  3NOB A;  4BOZ B;  3L54 A;  2DZJ A;  2QCZ A;  2TSS A;  3L0W B;  3UIN B;  4FA6 A;  5EE3 A;  4IG7 B;  2ZW1 A;  1JWU D;  1OTR B;  1V1P A;  4NZL B;  1GUA B;  2GLS A;  2CJN A;  5L95 C;  2I1J A;  5GMV A;  4ZRJ A;  1Z5S B;  2LHD A;  2NBW B;  3WAL A;  4IKG A;  5JZE B;  2KN4 A;  4IM2 A;  4JE3 B;  4P6V F;  1TS2 A;  3VTU A;  1GPX A;  1F9J A;  1WGK A;  3HIZ A;  3GE8 C;  1AYF A;  5LNK 1;  1RRB A;  4AUQ C;  3KUC B;  3VUY A;  2KC1 A;  1LQB A;  3RFZ B;  2JXX A;  4M01 A;  3KUZ A;  1AW7 A;  1UF0 A;  2WXO A;  4OZB A;  3AN1 A;  4YTN B;  1DOX A;  3FAH A;  2K6D B;  1YJJ A;  5IO9 A;  4EZL A;  4TQ0 A;  2WXN A;  2KDE B;  2JWZ A;  4KDI C;  2ON8 A;  3EC8 A;  1FNV A;  4RFB A;  1P9D U;  4OW0 A;  1TJE A;  4MM3 B;  1JWB D;  4DHZ E;  3J9C A;  2W54 A;  2KOX A;  2ZJD A;  2OED A;  3Q3N C;  4HPL B;  4E74 A;  3ZW3 A;  3ML9 A;  4DDI D;  3PLU A;  3ALB A;  3A33 B;  1VCB A;  4W9D A;  2J42 A;  4L2Y A;  1Z2M A;  1VLB A;  2KMA A;  4DXG A;  1N61 A;  1PUT A;  2KWD A;  3U7Z A;  5DPW A;  1WZ3 A;  4OVV A;  5D7G A;  1HZ6 A;  1V81 A;  1WXA A;  2DX5 B;  2WXL A;  4AWJ A;  4ZRQ A;  3SHQ A;  2HJ1 A;  3ZNZ B;  1J7A A;  3ZTD A;  1E90 A;  2RPV A;  2PVO D;  3TEW A;  4HKQ A;  1S3S G;  2KWC A;  5FK9 C;  3OLM D;  5KHQ A;  2HTM E;  4XGA B;  3I63 C;  5IAA C;  3PSE B;  1E5W A;  1KLG D;  2MRP A;  3A9J A;  1YX5 B;  1C1Y B;  2H89 B;  2KQ4 X;  1FEH A;  2G45 B;  3AE1 B;  3WAO A;  2D3B A;  3UIP B;  3SEB A;  1YMH E;  4DHZ B;  3QX1 A;  1NBF C;  3IG3 A;  4IUM B;  1WE6 A;  2Q5W D;  3K9O B;  3V3X A;  2LGY A;  2BQQ A;  4W9I A;  3DVG X;  1JWM D;  4AJW A;  2BS3 B;  1PDX A;  4A3O A;  1FRD A;  2RD0 A;  2WXQ A;  3URY A;  5BYR A;  5BMH A;  4CQN A;  1ACC A;  2X38 A;  2XBB C;  4HWI B;  2FCN A;  1RM6 C;  4II3 B;  2M0A A;  5J2R A;  2MJ3 A;  4KSL C;  3MC0 B;  2JWU A;  2QDF A;  1ZXI A;  5BO4 B;  2KVR A;  3NVW A;  2FCM A;  2L0F A;  1WFY A;  4KGR A;  4ANW A;  5EE0 A;  5G5H A;  3AEF B;  4LNO A;  4M0W A;  5BMI A;  1PYW D;  1S1Q B;  2IO1 B;  4WWN A;  3VRB B;  3FKY A;  3RN9 C;  4GGQ A;  1MG4 A;  3B2G A;  4KKI A;  2IO2 B;  3ZUN A;  4LDT D;  5AUK A;  5BMG A;  3IVF A;  1SE9 A;  1L4D B;  1ESF A;  1EWC A;  1FPY A;  1WRI A;  1E7P B;  2MJE A;  5CHV C;  1D5M C;  2K1F A;  3R66 C;  1L7Y A;  3P4P B;  2MA9 B;  2VZK D;  1V9J A;  2WXP A;  3DWG C;  1GNU A;  2L3Z A;  1B1Z A;  2DZI A;  3SFE B;  2Z0E B;  1YQ4 B;  2GOW A;  3GZN B;  1D5X C;  2PLP A;  4J3O D;  4LK0 M;  4B95 A;  1UUP A;  2V3N A;  3RZF A;  2JYE A;  2LFI A;  1XEE A;  3Q3F A;  1J0G A;  2AQ2 B;  4C80 A;  5L83 A;  3CMM B;  1F2R I;  3VXW A;  5JHA A;  5TR5 A;  1EWY C;  2N0S B;  2GRI A;  1F77 A;  1JW9 D;  1SB3 C;  4HCN B;  2YEP F;  3C0R B;  3NRZ A;  3CF6 E;  1FXA A;  1H4R A;  2CKH B;  4PK1 A;  4K7W A;  1KLU D;  3B1L X;  4FUL A;  2LXC A;  2KNB A;  4I6L B;  2XEW A;  2L05 A;  2XK5 A;  1YQ3 B;  3PRM B;  3L16 A;  3HM3 A;  1I42 A;  2ICI A;  1UZX B;  3IHP C;  3KVF B;  3IT6 B;  4M02 A;  3SDL C;  1WJU A;  1C4C A;  3IFW B;  1XD3 B;  4FJV B;  2BS2 B;  3RNA C;  2OJR A;  1TKG A;  1SJH D;  2KYW A;  2UU7 A;  4JLC A;  1N60 A;  1UNS A;  3O13 A;  3ZRC A;  5D2M B;  3PHW B;  4KZC A;  3W1Y A;  1K53 A;  1D4B A;  4N58 A;  1WX9 A;  5C1Z A;  1UD7 A;  1CQV A;  4OZA A;  4LTU A;  4WWM A;  1TKY A;  4NJ7 A;  5IP4 D;  3KW5 B;  1TS5 A;  1KH0 A;  1YD8 U;  2L8J A;  2M4N A;  1SXT A;  2J7Q B;  5C23 A;  1MJD A;  1VDV A;  3TEX A;  5HKH A;  3N1Y C;  4DHJ D;  1JML A;  1E8X A;  4A90 A;  1EF5 A;  3ZQ4 A;  1OQY A;  2D3G A;  4ZDV A;  2AQ3 B;  2FE8 A;  2YEP B;  3V05 A;  3ZDT A;  2MCN B;  3AU4 A;  1WH3 A;  2O2V B;  3RT3 B;  1P3Q U;  1IUE A;  4XYC A;  4W9C A;  3PGE A;  1FRR A;  3AE9 B;  4MDK E;  2L32 A;  1L6U A;  3GZN I;  3Q3J A;  3TBL D;  4FHK A;  3Q3O C;  2I1K A;  1TT5 B;  1HEZ E;  2WDQ B;  1VRA B;  2NPT A;  3DHH C;  4ASW C;  1SSN A;  1WR1 A;  3KLS X;  2RDB C;  3Q2A C;  3AE4 B;  5G2N A;  3AE7 B;  3LJ3 A;  1YN4 A;  3V62 A;  3QK0 A;  5H92 C;  1P1A A;  1WGH A;  4QAY A;  3N20 C;  5HI1 A;  3H6N A;  1N6Z A;  3EFU A;  1V97 A;  4ARC A;  2KFK A;  2MQJ A;  4W9E A;  3AEG B;  2NTT A;  4MT5 A;  3C19 A;  1PGX A;  3P1M A;  4BFR A;  3W9C B;  2J4X A;  1L6V A;  4II2 B;  1WRD B;  2KX3 A;  3T9L A;  2Z0D B;  1B9R A;  1ZDV A;  2LAS A;  2FIF A;  2X8X X;  4USA A;  1JRP A;  2RGF A;  3TSS A;  1JWS D;  3DVN U;  3L08 A;  4ANV A;  2KZR A;  1C4P A;  1TGZ B;  4I6P A;  4XX5 A;  2ZVO A;  1LGR A;  2BYE A;  2WU2 B;  2HD5 B;  3NVY A;  4G3X B;  4DWF A;  2Z59 B;  2DWQ A;  2IO0 B;  1ET6 A;  3A1Q A;  1WM2 A;  3QQ8 B;  2N9P C;  4LCD E;  2LI5 A;  2CHZ A;  2IPK D;  3QA8 A;  2L52 A;  3ZNI D;  4MGI E;  1NYQ A;  2O6V A;  4M0W B;  4HEA 1;  3EFC A;  3Q8A A;  3IAM 1;  3ZLZ A;  2IGD A;  2DYM A;  3VTV A;  2M56 B;  5E6J A;  1J19 A;  2VRR B;  4GIV A;  4GDK A;  3ZXV A;  2BTE A;  4CHK A;  3RZW C;  3MJW A;  4WH4 A;  3NS1 A;  1CJE A;  2WXK A;  3ZKJ C;  2KHW B;  4JWS C;  1I4X A;  1IBX A;  2MEK A;  3U4E G;  4HLE A;  2UWQ A;  4RGO S;  2LD9 A;  3PS6 A;  1E8W A;  4ZOH C;  2M1M A;  2DBY A;  3GE3 C;  4KVG B;  2DYO A;  3GS2 A;  4FBJ B;  2MBO A;  1HQR D;  5AZG A;  3ZDM C;  3FIL A;  5FR6 A;  5HFY A;  4HJG E;  2K0P A;  1V5O A;  4P16 A;  3AE2 B;  3LXF A;  3PLV A;  2KDM A;  2K3U A;  2DZM A;  3VUW A;  2KLC A;  3B08 A;  1P7F A;  3QHT A;  2KAN A;  3PZ8 A;  3UIO B;  1L0V B;  3OAW A;  1OEY J;  4NJC A;  4F1S A;  3AEA B;  2AQ1 B;  3AXC A;  1QOA A;  5D3I B;  1DOY A;  1E6E B;  2WGS A;  1I35 A;  1K50 A;  3ZJU A;  1ZGU B;  3I5J C;  4ITK A;  2G4S A;  3JSV A;  4BKS A;  1R4M I;  4D2K A;  3U30 A;  1TY0 A;  2JT4 B;  2N9X A;  5LLI A;  3RNB C;  1V49 A;  3T3N A;  2DEN B;  1J7B A;  3PVL A;  1I4Q A;  3MC8 A;  3BZD B;  3WIM A;  4OHJ A;  1V8C A;  3GB1 A;  5CTR C;  1Q5W B;  4A6Q A;  2C60 A;  3PRE A;  4P7I A;  2C9W B;  4PT5 A;  3TIX A;  1FXI A;  2D07 B;  4DK5 A;  1WGR A;  4C4V A;  2WU5 B;  2QMT A;  1D5Z C;  4RGN A;  1WM3 A;  3TUO A;  1C3T A;  4PS7 A;  5HHD G;  3R7Q A;  2OHF A;  3U2S C;  3C8Y A;  2QHO A;  3NVV A;  3NY5 A;  1LM8 B;  4IM0 A;  2WP9 B;  4ZRK A;  1V86 A;  1X1M A;  3M3J A;  2KQS A;  2HE7 A;  3TEY A;  4HKZ E;  2MHJ A;  4B0M A;  3N9Y C;  3NG0 A;  3RD2 A;  2KXJ A;  4XDD A;  3ZNH B;  1ET9 A;  2WHI A;  1GOZ A;  4C56 C;  4XWW A;  5C2T B;  4URK A;  3VRA B;  4LNN A;  4WAF A;  3EEC A;  2IYD B;  2KAC A;  2KMM A;  1NVI D;  1FXT B;  2G1E A;  3N1X C;  2M0X A;  2LVP A;  4DXF A;  1L2N A;  2REX A;  2JY6 A;  1D3Z A;  2KMC A;  5AZF A;  1TBE A;  3NS8 A;  3A9K A;  2ZPY A;  3B9J A;  3H9D A;  3ZIM A;  2K9X A;  3V61 A;  2LJI A;  2G3Q B;  3L4P A;  4E71 A;  2AYO B;  1KRH A;  4EE2 A;  4ANX A;  4HK2 A;  3MFG A;  4W9K A;  4XZ4 A;  1UEL A;  1F1H A;  1XO3 A;  3D32 A;  4KX6 B;  3DVN V;  4LJP B;  4N59 A;  1QLB B;  2FUG 1;  4KGS A;  1Q0W B;  1NEK B;  2BPS A;  3DQV A;  3VUX A;  1R4M B;  2N9E B;  1GJZ A;  1GC7 A;  1ZUD 2;  3L13 A;  4A55 A;  3CST A;  4ZHO A;  3T3O A;  4C4V B;  2MX2 A;  4GSW A;  3AV8 A;  4X57 B;  4BKT A;  1Y56 A;  1GAQ B;  1QIL A;  3P4Q B;  3MJ5 A;  4BZA A;  4US8 A;  4FJY A;  4KDL B;  2LGS A;  3RPF C;  4W9J A;  4GU2 A;  3W5V B;  3AE5 B;  1JCK B;  4L23 A;  2PMV A;  3U8Z A;  3UF8 A;  3DWM A;  4BVU C;  4WJN A;  2CU1 A;  2K25 A;  3CSF A;  1NI3 A;  2N7D A;  3UQA A;  1TZO A;  4MH8 A;  2CJO A;  4M8N A;  3SD5 A;  4MJS A;  1GC6 A;  3RI7 C;  2I38 A;  1EUV B;  1E7U A;  2L0T A;  3S2A A;  4B0E A;  2C7N B;  2R2Q A;  4YL8 A;  3W5U B;  1TS4 A;  2WXR A;  4ZYN A;  3ZJV A;  3IAS 1;  4LNI A;  2IO3 B;  4FN2 A;  4KIK B;  3E9S A;  4ICU A;  4US9 A;  4LNF A;  3O65 B;  5DPS A;  2XN9 C;  2VZK B;  4EEW A;  4W9F A;  3ZXR A;  2KJH B;  4HVB A;  3KWL A;  3DDC B;  2LZ6 A;  1HE8 A;  1QT9 A;  4OVU A;  4BOS C;  1YQB A;  5E6P A;  2IBI B;  2GBK A;  2N7E A;  4EFO A;  3FC4 A;  5GXG B;  3AH7 A;  5MPO A;  1KJT A;  1D6E C;  1LXD A;  1WMH A;  4L1B A;  1Q1O A;  3L10 B;  3MP9 A;  1FMA D;  3DPD A;  4A3P A;  3NZ3 A;  1M4V A;  1SE4 A;  2D11 A;  1IP9 A;  2CHX A;  4DQO C;  1T3Q A;  2A5U A;  1WGY A;  1WYW B;  1AWD A;  1WZ0 A;  3APC A;  4JWU C;  3EA6 A;  1WXM A;  1MHX A;  1TY2 A;  2KD0 A;  2IGG A;  3UGB B;  1ENF A;  4NPN A;  4KSK C;  1K51 A;  2JU6 X;  4P1B C;  2AL6 A;  4RGM A;  3HUI A;  1WJ4 A;  4DXA B;  3VVW B;  1YX6 B;  1BUI C;  1T0Y A;  1HTQ A;  2K22 A;  4A20 A;  2GBJ A;  2K8H A;  2J0K A;  1WJ6 A;  1FIQ A;  1C4A A;  2KDB A;  1AN8 A;  2K8C A;  1EO6 A;  2K39 A;  2KVZ A;  1EM7 A;  2ZPN A;  4JGH B;  3R7R A;  1PFD A;  4XE0 A;  1L4Z B;  3N1Z C;  4MEM A;  3K9P B;  3BII D;  3ZRF A;  2OJW A;  2H88 B;  3QJZ A;  2NTS A;  3RMK C;  1WY8 A;  3OG5 A;  4IC7 B;  2V9H A;  3A4S C;  2C5L C;  4ZHP A;  1DOI A;  3W1S C;  2XK5 B;  4TSS A;  3MHS D;  1SIJ A;  3VHT C;  1L0X B;  1C9F A;  1VZ7 A;  1DGJ A;  2NR2 A;  4LLG M;  2BWE S;  2WS3 B;  2QIE B;  1SGH A;  3RCZ A;  1WIA A;  3I9V 1;  3P4R B;  5T8I A;  3VAW A;  1FD6 A;  5DPT A;  2L1A A;  3PO0 A;  1IYF A;  2KN5 A;  4FJZ A;  3LB8 C;  1SE3 A;  4O1N A;  1KOT A;  1MG8 A;  3BYT B;  3M95 A;  2GI9 A;  1QQR A;  3H8H A;  4RM9 A;  1FNU A;  2AL3 A;  4MH0 E;  1FFV A;  3BIN A;  3ZYY X;  2JUO A;  4N6E B;  2AWT A;  5C3J B;  2BGF A;  4N9F 4;  3B2F A;  2NMQ A;  1GB4 A;  5JXV A;  4BBN C;  3OJ4 B;  4YXD B;  3B0A A;  1ROE A;  2NS5 A;  2E6X A;  1T0Q C;  2FBW B;  3Q8F A;  3PPA A;  1JAL A;  3VFK A;  2K8B A;  1YN3 A;  2KO3 A;  1TIF A;  2DAF A;  3SU8 X;  4MSM B;  2JQR B;  1GG3 A;  3BVM A;  1OEY A;  2MP2 B;  3H7P B;  2JF5 A;  1RFA A;  4JQW C;  3A4R A;  4A9A A;  1FO4 A;  3BY4 B;  5CX3 A;  1WXQ A;  2FUH B;  1YOV B;  4MSQ B;  2WXF A;  2BT6 A;  4GXB A;  3QC8 B;  1KM7 A;  1UBQ A;  1LFD A;  2KDF B;  2FAZ A;  4IWQ A;  1V1O A;  4C7Z A;  3I3T B;  3UI3 A;  1I4R A;  1E8Y A;  2OOB B;  2Z8L A;  4J6I A;  1FCL A;  2IY1 B;  4EKU A;  4WWO A;  3VR9 B;  1OGW A;  2LUE A;  2N4F A;  4NAW B;  3P4S B;  2ZZP B;  1PQS A;  3VR8 B;  3AEB B;  1JQ4 A;  1V5T A;  4TQ1 A;  2WDT B;  2W3R A;  2Y5B B;  3AEC B;  1E0Z A;  3ML8 A;  1E8Z A;  4WQO B;  1JWA D;  2WDV B;  3PRZ A;  4KGT A;  1XT9 B;  3QCA A;  2BYT A;  2HTH A;  4HXD A;  2ZNV B;  1BML C;  1OQQ A;  4ARI A;  2M17 A;  4GDL B;  4WWP A;  4F7Z A;  2V0G A;  2KAJ A;  4MM3 A;  2KTR B;  5G5G A;  5CHW A;  2HDE A;  5D3D A;  5J18 A;  4IW0 A;  4R3D A;  2GBN A;  2O2V A;  2JPH A;  4KV2 A;  2EMT A;  1V2Y A;  1XLP A;  4HRO A;  4AP4 C;  2LVQ A;  2V3S A;  3OJ3 A;  1WR6 E;  3TL5 A;  2MBH A;  1ZDX A;  4RF1 A;  1WXV A;  2WX0 A;  2W82 A;  4LJO B;  3N32 A;  2BB6 A;  1I4H A;  1JRO A;  1CK1 A;  4ANU A;  3ENE A;  4WQM A;  3ETR A;  1SJE D;  1TKE A;  2BBC A;  2ZCC A;  3NZU A;  4YTP B;  1IBX B;  3JSV B;  1RYJ A;  2WXG A;  1L0Y B;  3TEZ A;  1CMX B;  1KTK A;  3PTF C;  2KFK B;  1K8R B;  3A9J B;  3FIL B;  4WJO A;  3Q6B A;  2LEK A;  2R2O A;  3VTW A;  4EUT A;  2QEJ C;  1E7V A;  2CS4 A;  4K7U A;  2CR5 A;  2VH2 A;  2KC2 A;  2JYT A;  2BVC A;  1P0R A;  1MI0 A;  2KWV B;  1R4N B;  2FCS A;  2NBV B;  4HRS A;  2R61 A;  2J0J A;  2MP2 A;  1TZ1 A;  1XCT L;  2FCQ A;  5BYQ A;  1XLN A;  2Y5P A;  1UBI A;  1VR9 A;  2KDI A;  1T5X D;  4EOY A;  4S0R A;  3AE8 B;  3H1U A;  2LJ5 A;  3DCG A;  4RNA A;  1VJK A;  4GN1 A;  3A1Q B;  3ZTC A;  2WX1 A;  4OZC A;  2PIA A;  3E56 A;  3CIR B;  1VZ6 A;  2W3S A;  3PV1 A;  2WWZ A;  3LDZ E;  2WNM A;  4EZJ A;  2W55 A;  5E6O A;  3GOE A;  4YSX B;  2JZ3 B;  1NI2 A;  1SIF A;  1C78 A;  3ZJT A;  2PJH A;  3AEE B;  1WGD A;  1KFY B;  2CHW A;  5IOI A;  3MTN B;  2WXM A;  4NJ6 A;  2IY0 B;  2J52 A;  1ZXH A;  1RLF A;  4NNJ B;  4PYZ A;  5D94 A;  5HG2 A;  3HVZ A;  3T8M A;  2LHE A;  3V6C B;  2KWU B;  1ZKH A;  2EEL A;  3BVG A;  4LNK A;  1PGA A;  3BVZ A;  2N7J A;  2LRW A;  2PE6 B;  3AE3 B;  4HPM B;  1EF1 A;  2KX0 A;  1J8C A;  2BB5 A;  2KKC A;  1F0Z A;  3HVD A;  4GDL A;  4DHJ B;  3DBR I;  3DHG C;  1L5P A;  4FXC A;  1N62 A;  4PYU A;  3LYY A;  2JXT A;  5EE9 A;  2LRU A;  3H7S A;  3WAM A;  1EU3 A;  1MVK A;  4RMA A;  2ASQ A;  3ABV B;  3Q3M C;  3H7P A;  5KHO A;  2WXH A;  2BW2 A;  1Q10 A;  4DBG A;  5EE1 A;  3M62 B;  3HM6 X;  3DBH I;  4H2A A;  1SEB D;  3W2D A;  5JH5 C;  3R2I A;  5CHF A;  1YJ1 A;  2IDY A;  3JVZ X;  2NPT B;  3PHX B;  2N1W A;  2RR9 A;  3ZGZ A;  3VH4 B;  2DNF A;  2QC8 A;  1I7H A;  1R4N I;  1F52 A;  4BKG A;  1VD2 A;  1QOG A;  2L76 A;  5AUI A;  1C79 A;  2GB1 A;  2EKI A;  3KYC D;  4ZRP A;  1ZW7 A;  4PS8 A;  4NQL B;  4UDU C;  1QZE A;  3MC9 A;  3UQB A;  2DHZ A;  4WJP A;  3DBL I;  4W9G A;  3IT4 B;  1I4G A;  3Q8C A;  2C7M B;  3APF A;  2LVO A;  4Q2J A;  1UGJ A;  1A5R A;  4FAD A;  1WF9 A;  2C7H A;  4BBN F;  1UWX A;  4K1R B;  1XLO A;  1QOF A;  1FNW A;  2CU3 A;  3AUL A;  3ECI A;  4YTM B;  5JHB A;  1V1P B;  4JPS A;  5J17 A;  1ZE3 D;  1SBB B;  2N1V A;  2NVU I;  2L7R A;  4HPP A;  2Y3A A;  3TMP B;  5D6J B;  1MPE A;  1ZOY B;  2QJL A;  3AU5 A;  3TJP A;  2BYF A;  3WA0 A;  2K5P A;  2I2Y A;  3QAR A;  3JYU A;  1G6J A;  1UH6 A;  1YJI A;  3BWU D;  4MJS B;  4MEL A;  2FNJ B;  2W9N A;  1WE7 A;  2WXJ A;  1A70 A;  2BWF A;  2JRI B;  4RH6 A;  3QIJ A;  1NYR A;  5H8Y E;  3DBS A;  1SE2 A;  3DBR B;  4NY0 A;  2KK8 A;  3A9K B;  1RWS A;  4GOC A;  1E10 A;  4ICV A;  4W9H A;  1K52 A;  4RF0 A;  4KZ0 A;  5LXI B;  2SEB D;  2MH7 A;  3AM9 A;  1P98 A;  3DBH B;  3Q8E A;  1HXY D;  3W1S A;  4WJQ A;  2LWP A;  2RDG A;  1WMH B;  4XWT A;  4P1C C;  1WYG A;  1P7E A;  2QSD A;  3N3K B;  2M19 A;  5DCN A;  3DHI C;  1OQR A;  2BKR B;  2MBQ A;  2ZNV C;  3RNG C;  1SF0 A;  3SFD B;  4CYE A;  3KH0 A;  1HTO A;  3KWV A;  1WJN A;  3APD A;  1QKZ A;  2IGH A;  3DBL B;  3P42 A;  3HRD D;  4MAC A;  3AE6 B;  2YVC A;  2MLB A;  1UGM A;  5AZH A;  3P2B A;  5FKA C;  4GLS C;  2LXA A;  3EGR A;  4IOI E;  2D3A A;  3PZ7 A;  5DPR A;  2ZCB A;  2D5G A;  4S17 A;  1CZP A;  3ZVV A;  1TYG B;  2MJD A;  4LDT B;  2ZW0 A;  2V3P A;  3X23 A;  2EKE C;  1XXG A;  1TTN A;  2GBM A;  1V6E A;  3ZO5 B;  2E3T A;  3RUI B;  3V60 A;  4AQ7 A;  2UYZ B;  2NBU A;  4KIK A;  5E6N A;  2V4I B;  2LGI A;  4E3C A;  1N63 A;  2J0M A;  1QOB A;  3KUD B;  1F2R C;  2JSV X;  2B3A A;  2Y5C A;  3HK0 A;  5FR3 A;  3VDZ A;  1KF6 B;  1MFW A;  4YT0 B;  2KTR A;  4TMA B;  2O6V B;  4W9L A;  4B9K A;  3BK1 A;  2KJR A;  4PS3 A;  2KQ7 A;  4ZYS A;  2JX5 A;  3ZNG C;  1Y8R C;  3P63 A;  1BXT A;  2JRH A;  2N9K A;  4JX1 C;  2L00 B;  1XF5 L;  2GMI C;  3U52 E;  2G4D B;  3RNF C;  4I6N B;  4AJY B;  2HJ8 A;  2WQY B;  5IA7 A;  2D10 A;  1DYQ A;  2M8S A;  3BYY B;  4TUU A;  1H8C A;  1WI0 A;  2PVG C;  4JL9 A;  4TV3 A;  5EDS A;  1BT0 A;  2DZK A;  4EZK A;  2IZV B;  2IJ0 A;  2K6Q A;  1XCQ L;  3CWI A;  4M00 A;  2INC C;  4XC2 A;  2PW9 A;  3WCQ A;  1ISN A;  3EHV A;  3JW0 X;  3PZD A;  3U7D A;  2INP E;  2MBE A;  2V1Y A;  2LGD A;  3R2T A;  5AEK B;  2KFJ A;  2PEA A;  1WX8 A;  4DDG D;  1AAR A;  1T0R C;  2GBR A;  3NHE B;  2B76 B;  2O6V D;  5LXH A;  4AOF A;  4F8C B;  4JIO U;  3VQI A;  2SAK A;  1N5W A;  3AI5 A;  1YIW A;  4K3B A;  5I4D A;  1XQQ A;  3WAP A;  1ZP0 B;  2A4Z A;  2LGX A;  3M63 B;  4NAM A;  2RPQ A;  2VH1 A;  4RM8 A;  4YSZ B;  4HDQ A;  2PTL A;  4G50 A;  2ZVN A;  1WXS A;  3RNE C;  2BYV E;  4HJK A;  1QF6 A;  1IGD A;  2KT7 A;  1C77 A;  4YSY B;  3AB5 A;  1KLV A;  3I57 A;  2AEH A;  2MBB B;  4HCP B;  1WX7 A;  4MGK E;  4BKS D;  2G9H D;  2J53 A;  2JVC A;  4G11 A;  1T6B X;  3V6E B;  4RCO A;  3BK2 A;  1I4P A;  4AS1 A;  2YLM A;  3IBE A;  3RUL A;  2PE9 A;  2D3C A;  3TCA A;  1YNT E;  4NAW A;  3R3M A;  2ZEQ A;  4XDC A;  2WDR B;  4K3C A;  3DOW A;  4G0N B;  4M8M A;  2BKF A;  3DVG Y;  2QIL A;  4WIP A;  3NZS A;  3IXS A;  3KQ4 A;  4FLH A;  4KKJ A;  1STE A;  2LUM A;  2NCN A;  2WYQ A;  3MHZ A;  3RYT A;  2DAJ A;  3ONS A;  1M94 A;  1XLQ A;  3QAQ A;  5G55 A;  4WUR A;  3QWZ B;  3Q8B A;  2DLB A;  4FHJ A;  2JZZ A;  1C76 A;  2JZP A;  3R8B A;  4ACF A;  3PRP B;  2DYB A;  2LMC A;  3GP7 A;  1U4A A;  2N9L A;  3OWE B;  1RFK A;  4IDI A;  2IND C;  2XNA C;  4TKN A; 
#chains in the Genus database with same CATH homology
 1T0Q C;  3RNA C;  1T0R C;  3Q14 C;  3DHH C;  2RDB C;  3Q2A C;  3RMK C;  3I5J C;  2INC C;  3Q3N C;  3DHI C;  3RNE C;  3N1Y C;  4P1B C;  3N20 C;  3RNC C;  3RI7 C;  3Q3M C;  3GE3 C;  3RNG C;  3RNF C;  3I63 C;  3GE8 C;  3N1Z C;  3N1X C;  3Q3O C;  4P1C C;  1T0S C;  2IND C;  3RN9 C;  3RNB C;  3DHG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...