3N1XC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201c mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
ATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n1xC00
3DHGC 3RNBC 1T0SC 3N1XC 3RNCC 3Q3OC 3Q14C 4P1BC 3GE3C 3RNAC 3N1YC 1T0RC 3Q3MC 3RNGC 1T0QC 3RNEC 3DHIC 3RMKC 3RN9C 3RI7C 2INDC 3DHHC 3I5JC 2RDBC 3N20C 4P1CC 3Q2AC 3GE8C 3N1ZC 3Q3NC 3RNFC 2INCC 3I63C
chains in the Genus database with same CATH superfamily
2LI5A 2BTEA 2J0MA 4FBJB 2D10A 1ESFA 3HK0A 1F2RI 2QMTA 4RH6A 2D3CA 5JXVA 4NY0A 5E6NA 3KQ4A 1WGKA 4MGIE 4TSSA 3DWMA 3TSSA 2LHEA 1RLFA 2MQJA 1I42A 4MH0E 4GDLA 4DDGD 2ZW1A 3L16A 1E8XA 5D7GA 3JYUA 1XQQA 4AOFA 2DLBA 2WXNA 4ARCA 4WURA 1T0RC 4LNNA 1LFDA 3K9PB 2G45B 1VD2A 2KVRA 3IG3A 3OJ4B 1MJDA 2UYZB 4QAYA 1VZ7A 2EELA 2LXAA 1P9DU 4XYCA 2KVZA 4HXDA 3RNAC 3PLUA 2QC8A 2FE8A 2GBRA 3NG0A 3ZLZA 3LYYA 2KMAA 3PGEA 5IO9A 1AYFA 2D3GA 4M0WA 4F7ZA 2RPVA 1WH3A 3GZNB 1XLOA 4XDDA 2B3AA 3HM6X 2FCSA 2ZEQA 2MJEA 1EUVB 4YXDB 2FAZA 3KUZA 3BYTB 1XLQA 2LUMA 4HK2A 1J19A 1MI0A 2EKIA 2IO0B 2IZVB 1WX9A 3A4RA 3P63A 1YJJA 1WE6A 1L4DB 2LUEA 5IAAC 2DAFA 1FRDA 1SSNA 3W1SA 1TT5B 3AE3B 1S3SG 5DPSA 4AUQC 2DENB 2LXCA 2IY1B 4XE0A 2N1WA 2CJNA 2GBNA 3DBHB 3P42A 4II2B 1CJEA 3BY4B 4BZAA 3A1QA 3QHTA 3NOBA 4TQ1A 1VLBA 1E9MA 3R7QA 3VAWA 1K53A 4HRSA 1JWUD 3D32A 2C7MB 1WF9A 4ZRQA 4WWMA 3RNGC 4NNJB 3PHWB 2Z0DB 3KWVA 2HE7A 2BB5A 2JYEA 1C1YB 1PGAA 4BBNF 4LK0M 4JWUC 1BXTA 4LNKA 1CQVA 1YQ4B 3V60A 1WX7A 2INDC 3VUWA 4DHZE 2JXXA 4WAAA 2KTRA 4A20A 3B1LX 1A5RA 1WY8A 1OGWA 1QF6A 3I63C 2JY6A 3FAHA 4AJYB 3NVZA 4MM3B 3BIID 2QDFA 3CSTA 3UGBB 3BZDB 1C77A 3SD5A 1P7EA 1VRAB 4BKSD 4CQNA 4HVBA 5GMVA 5DPTA 1XLNA 5CHVC 3RNFC 1RYJA 2Z0EB 4HKQA 4RMAA 2INNE 1NEKB 4W9IA 3VDZA 1F2RC 4OW0A 1C4PA 2LGSA 4PS8A 2VZKB 3DCGA 4FJZA 3H7PA 2YVCA 2AQ1B 2J4XA 2DZKA 4KDLB 2HJ1A 1MVKA 4IDIA 2NVUI 3AMZA 1UBIA 1J7BA 2KTFA 5CX3A 1DOXA 1KRHA 1EM7A 4HWIB 4MH8A 2MEKA 2L05A 4F8CB 2GBMA 1WSPA 3Q69A 3ML9A 1YJIA 2V4LA 3B9JA 3OLMD 4YTNB 2WXMA 3K9OB 2KDIA 2M1MA 3Q8FA 3NUHB 4DBGA 2WGSA 1YQBA 4JIOU 1PQSA 4OVUA 4EKUA 3DVNU 5FR6A 4CO7A 1X1MA 2BQQA 4NJ6A 4WWOA 4KDIC 2ON8A 3RD2A 3ZXVA 3E56A 1NVID 3L08A 3ZTDA 1C4AA 1HE8A 2FUG1 1BMLC 1WGDA 2AL6A 2QCZA 1OEYA 4AQ7A 3HUIA 1M94A 2WX0A 2KQ4X 2JT4B 3MFGA 4A90A 4BBNC 3IBEA 1QZEA 1QOAA 3ALBA 1N60A 2ZJDA 1UNSA 3APFA 1IGCA 5BMIA 2WXFA 5AUKA 4HJKA 3H8HA 3N3KB 4KGSA 5MPOA 1TTNA 1WMHB 3Q3FA 2V1YA 1HA5A 2JZPA 3GE8C 1ZUD2 3QK0A 3OJ3A 4HPLB 4RNAA 4WJNA 1UGMA 4OZCA 2LRUA 3TMPB 4W9CA 2ASQA 4ANXA 4TV3A 1JWAD 4Q2JA 2K3UA 2I2YA 4ICVA 4BKSA 1MG8A 3APDA 1SJED 1JALA 1JROA 1TY0A 2M8SA 4XX5A 2PMVA 1FPYA 1I35A 3WCQA 1UGJA 5IOIA 3DQVA 1L0VB 2WS3B 3IT4B 4WIPA 1WXQA 1KF6B 4DXAB 1P1AA 2ICIA 1F77A 2RDHA 1V9JA 3BYYB 1V2YA 1STEA 1ZPSA 2J7QB 3DBLI 2BS2B 5L95C 1TKGA 1WIAA 1WXMA 1MHHE 4KKIA 4W9HA 1V8CA 3VRBB 4IM3A 2K0PA 1WJ6A 3BVZA 3NZUA 3WAPA 3W5VB 2I38A 2BWES 1I4GA 1QOBA 1MHXA 4BOSC 2D3BA 5DPWA 2G9HD 2REXA 2CS4A 2BVCA 3GB1A 3P2BA 2KX0A 1ZDVA 3QWZB 3DBRI 1YQ3B 4FHKA 2V9HA 2IO2B 2N4FA 4RGNA 3PSEB 2MBEA 1XT9B 3WIMA 1TS5A 2BBCA 4RM8A 5BYRA 5EE3A 3HIZA 2PW9A 1Q0WB 5EE0A 2RR9A 1I4RA 4HKZE 3B08A 2FCMA 3Q8EA 4LNFA 1M4VA 4BAXA 3KYDD 4C80A 1NDDA 3PZ7A 2WXGA 3M63B 3N1ZC 3O65B 4RF0A 1SE4A 3V3XA 2QJLA 3ZRCA 3AEBB 2TSSA 1PFDA 1TS2A 4IWQA 1JWSD 2DYBA 3EC8A 3N1YC 2GLSA 1ZOYB 3I57A 1E90A 2MLBA 3KVFB 2M0XA 3VUYA 1GUAB 2DBYA 3AULA 4A55A 4ZRIA 1V1PA 4AJWA 1FRRA 3ONSA 1AN8A 4NQKE 1N61A 2KLCA 2KLGA 3DHIC 1JQ4A 2MSED 2K25A 4NJ7A 2KWDA 1C78A 3VTVA 2XNAC 4RFBA 3R7RA 1N6ZA 2EMSA 4WJPA 3ZQ4A 2KWVB 4M00A 2MBHA 1VZ8A 2JUOA 1GC7A 2BYFA 3GP7A 1UWXA 1ACCA 2RGFA 1V1OA 1GNUA 2QIEB 2HDEA 4IUMB 2JRHA 2YLMA 3KUDB 1WFYA 3VR8B 4EUTA 2O2VB 4P16A 2N9PC 1I4PA 5CHFA 2LRWA 4BFRA 3CF6E 2K8HA 4REZA 3CSFA 4HCPB 2KDFB 3PV1A 1ZW7A 2N7DA 3M62B 3WAMA 1CZPA 1V5OA 1D5ZC 2K9XA 2A4ZA 3PRMB 2C5LC 1R4NI 1T5XD 2KTRB 1IBXB 4XC2A 3VR9B 3Q3JA 4JX1C 1YNTE 4II3B 4N9F4 2Z59B 1V81A 3BWUD 3SFDB 2BWFA 2IJ0A 2PVOD 3T8MA 1SBBB 3AE7B 3MTNB 1FXTB 3IAM1 4P1BC 1WYWB 1TS4A 1YN5A 2L8JA 4S17A 4IW0A 4W9KA 1K52A 3AN1A 4NJCA 3FKYA 2JWZA 3V6EB 5FKAC 2MCNB 4WAFA 4IG7B 4C7ZA 3ZXRA 3TL5A 2KO3A 1WXAA 2ZCBA 4ZRKA 4EOYA 3X23A 1HZ6A 3ZNZB 2LFIA 3P1MA 4IM2A 2H88B 1WZ3A 2NBUA 3IT6B 2O6VD 2WDQB 2WYQA 1L7YA 2SAKA 2NS5A 3P4QB 1R4MB 1UF0A 3A9JA 3P4PB 3WAOA 1F1HA 5LNK1 3N30A 3OAWA 3OWEB 2IGGA 2MHJA 3DOWA 3GS2A 3BVGA 3KWLA 3QAQA 1HEZE 1P3QU 2LJIA 1GC6A 5G55A 4JPSA 4FULA 4JQWC 3A33B 3ZJTA 3P4RB 5D6JB 2Y5CA 3RNBC 3AEDB 1F0ZA 1FNUA 4BVUC 3DBRB 1U4AA 4LNOA 1EU3A 3ZUNA 2RSUA 5J18A 4I6LB 4PS7A 4IM0A 1EF5A 4UDUC 2X8XX 1PGBA 1FO4A 4OZAA 1KM7A 3GZNI 3NY5A 5C3JB 4MACA 3U8ZA 3SDLC 1E10A 1A70A 2QHOA 4MJSA 1RFKA 1TKEA 1Q10A 3M3JA 3I5JC 2G4SA 5AZGA 2HJ8A 4G3XB 5H92C 4C00A 4EZLA 5I4DA 4W9EA 1E5WA 3R2TA 1B1ZA 4E74A 2XK5A 3HM3A 2XBBC 4J6IA 1C4CA 1R7SA 2ZPNA 3AE6B 1EO6A 4WQOB 2D5GA 3AV8A 2K22A 4A6QA 4IKGA 5GXGB 4HDOA 4S0RA 3VRAB 2AQ2B 3UIPB 1PYWD 3AI5A 1JMLA 5E6PA 1CMXB 2KANA 1D3ZA 2PE9A 2G4DB 5KHOA 1UWMA 1CK1A 2WXHA 2KMCA 5IN7A 2FNJB 5C2TB 4HCNB 1YMHE 3AEAB 2MWSB 2WWZA 4GSWA 1E8WA 2N7EA 4X57B 3RNEC 2QSDA 4DDID 3PRPB 3O13A 2GOWA 3C19A 3ZJUA 3U7ZA 1T6BX 2AWTA 5FK9C 1UD7A 2K39A 3HHMA 1TY2A 3V6CB 3TBLD 1MG4A 1I4HA 2BYVE 1T0YA 1ZGUB 2MBOA 2RMMA 1YJ1A 2VRRB 2KNBA 1L4ZB 3RULA 1V6EA 2XK5B 2V3SA 4ICUA 3L17A 2BW2A 3AH7A 5FR3A 1EWCA 1VZ6A 4OVZA 4CYEA 1AWDA 1UELA 4M0WB 4G0NB 2B76B 3DPDA 2C7NB 4DWFA 1UH6A 2WXIA 1KH0A 3UI3A 2JZZA 1I4XA 1I7HA 1QLBB 2BKFA 3NZSA 2KFKA 1E7UA 1Q1OA 4HDQA 2AQ3B 1ROEA 2WLBA 1L6UA 4HLEA 4KIKA 1QOGA 4BKGA 3ZJVA 1D5XC 4NAWA 3J9CA 3KLSX 3NVYA 4GDKB 4MSQB 5G5HA 2L00B 5HI1A 4ANUA 4K7UA 4MSMB 4AS1A 2KFJA 3UQAA 2C7HA 1FNVA 2IDYA 4GB9A 5BO4B 2HD5B 3ZGZA 1V86A 2KDBA 2N9XA 2LZ6A 2Y3AA 4TQ0A 3Q8AA 4NPNA 3UINB 1SIFA 4EZJA 2WXLA 2OOBB 3GE3C 4OHJA 1H4RA 4FADA 2WDTB 2CU1A 3BINA 2DZIA 5LXIB 3DBSA 2N9LA 5IA7A 2IGHA 1FXIA 1WX8A 3V05A 3N20C 2L76A 3MHZA 2BYEA 2M19A 2GBKA 2PVGC 3A9KA 1D5MC 3ZDTA 1PUTA 1WRIA 2W82A 4CHKA 2KT7A 3Q3OC 3SHQA 3S2AA 1WXVA 1F52A 2A5UA 2K6DB 3ZNHB 4C4VB 1GOZA 4N58A 4K7SA 3M95A 5EE1A 3UIOB 2PJHA 2FBWB 2PEAA 1D6EC 2CHZA 3T3NA 3IVFA 1UBQA 2XEWA 3TEWA 1Z5SB 3Q3MC 4YSXB 1E8ZA 3U2SC 4GU2A 2AEHA 1TYGB 2KC1A 2KYWA 1SGHA 4WWNA 4LNIA 1SE9A 1P7FA 1WRDB 3PPAA 3U30A 4KZCA 5BMGA 2G3QB 4XWWA 1XO3A 3TJPA 1LXDA 1YX6B 1UUPA 2LWPA 3VUXA 2IYDB 1HTQA 2C60A 1TZOA 1J7CA 2D11A 3QX1A 3PLVA 3Q6BA 4K3BA 3PT2B 2E6XA 3P4SB 1WE7A 4RM9A 1RWSA 1WGGA 2JZ3B 4GXBA 2KKCA 2OJWA 3IXSA 1E6EB 2KN4A 2C9WB 2IGDA 1IPGA 3AE1B 3VTUA 2KD0A 2CKHB 4YTMB 1OFFA 3ML8A 3VQIA 3MJWA 4ZYSA 4DXGA 4PYZA 1Q5WB 4USAA 3DHGC 2GMIC 4A9AA 2JPHA 1OQQA 1T3QA 1DGJA 1DOIA 1WMHA 2LD9A 1TZ1A 3ZIMA 2IO1B 2NMQA 4B9KA 5LLIA 3HRDD 1WM2A 2MA9B 2K8BA 3R3MA 2NTTA 2GB1A 1N5WA 2JU6X 3WA0A 1FMAD 1SB3C 1PGXA 1R4NB 4KVGB 4MEMA 3PREA 1ZKHA 3PS6A 4FJYA 1KLUD 4ACFA 4W9LA 4WH4A 1FFVA 3BVMA 1VDVA 3DVGX 1Z2MA 3RN9C 4DHJB 1SJHD 2FUHB 1JRUA 3EGRA 3E9SA 2ZVOA 4KIKB 3B2GA 1KLGD 4B0MA 3SFEB 4GMVA 1H8CA 5JZEB 1BUIC 2FIDA 2YEPB 1LGRA 2NCNA 4HROA 1ZXIA 2QEJC 3ECIA 1KLVA 2L83A 4I6PA 2WXOA 2JVCA 4O1NA 1HTOA 2PPHA 2WXPA 3ZKJC 3DVNV 4NQLB 1ET9A 2WDRB 2ZVNA 1GJZA 1JWBD 3VHTC 4R3DA 4DHJD 3VFKA 2L0FA 2I1KA 3SU8X 1SE2A 1GB4A 3ZDMC 1FXAA 1FIQA 2ACZB 5EE9A 3W2DA 1P0RA 3KYCD 1RRBA 4XDCA 2L0TA 1YX5B 4YTPB 2GRIA 2W3SA 5C23A 1LO5D 2KK8A 3JSVA 3ENEA 4MDKE 3H1UA 5BMHA 2K8CA 4W9FA 4YWGG 4HJGE 4FA6A 1J7AA 3MC8A 2GBJA 2JWUA 3MHSD 2DYOA 3B0AA 2KX3A 4P7IA 3TEXA 2HTHA 1HZ5A 1OQYA 3ZTCA 1ZXHA 2VH2A 3RI7C 2W55A 1L2NA 1XCQL 2RDBC 1EWYC 1IP9A 1ISNA 2CR5A 4ZYNA 5H8YE 3NVVA 1GG3A 1V80A 4KZ0A 2KACA 2VH1A 3EFCA 2INPE 2DX5B 4IC7B 4B6WA 3QARA 2ZZPB 5D2MB 2Y5PA 4DK5A 4ZHPA 3ZNID 4LJPB 1WZ0A 1ENFA 3GOEA 2N7JA 3AE2B 2KDMA 5E6JA 3KW5B 3EA6A 3L13A 3LXFA 3HVZA 1I4QA 4KX6B 2R2OA 3IFWB 3L4PA 4K81A 2PKOA 5E6OA 4RF1A 3MC9A 2YEPF 2KMMA 2V0GA 1N63A 2D07B 2LVOA 4JWSC 5D94A 3QCAA 4N59A 1KFYB 1E7VA 2L32A 3VXWA 1LQBA 3Q2AC 2K1FA 2MBQA 2X38A 5AUIA 2WNMA 2LEKA 1GB1A 3JVZX 3R2IA 2KHWB 2MW5A 3MC0B 4MT5A 4FLHA 2LMCA 4IWOA 5C1ZA 2K6QA 2NBWB 5T8IA 4ZRPA 2I1JA 4E71A 3CWIA 4GDKA 4ZOHC 4JGHB 4EFOA 4YL8A 1L6VA 3RFZB 1WGYA 1YN4A 3L54A 1P98A 4BKTA 1NI3A 5CTRC 4TKNA 1OEYJ 5D3IB 3W5UB 2JYTA 1PDXA 5IKCM 4MM3A 3BK1A 3U4EG 4PYUA 1L5PA 2NPTA 1MFWA 3DDCB 2BB6A 1K50A 5JHAA 5HKHA 4PT5A 2NBVB 2O6VA 4RGMA 4M01A 4LCDE 3TUOA 1SF0A 1NI2A 2KFKB 4US8A 1N5XA 3DBLB 1OTRB 1N62A 2BPSA 4LLGM 1XF5L 5JHBA 2CHWA 2LVPA 3FILB 3LB8C 1FM0D 2XN9C 4KGTA 5EDSA 1XD3B 2KWCA 3N32A 2JSVX 3DVGY 2MX2A 3AU4A 3TIXA 1TJEA 2KJ6A 4C7YA 4EEWA 1IYFA 3A9JB 1WJUA 1IUEA 4JLCA 4URKA 1VJKA 1FCLA 4ANVA 4L1BA 3H7PB 5AZHA 1TBEA 1OQRA 3A1QB 4A3OA 1WXSA 1SXTA 2IO3B 2ONQA 1XEEA 4G11A 2LHDA 4IOIE 3VH3B 4RCOA 3H9DA 3AM9A 1JWMD 4LDTD 3ZVVA 2IBIB 4FJVB 3ZYYX 1B9RA 3CIRB 3NRZA 2LJ5A 1BT0A 3OG5A 2K5PA 3Q8CA 2Z8LA 2EMTA 1K8RB 3NS1A 1NENB 3URYA 4DQOC 5HHDG 1FCCC 3FILA 2OJRA 3L0WB 4DXFA 1EF1A 1V5TA 4KKJA 2MH7A 1WYGA 4XGAB 3NHEB 3DWGC 4EE2A 4GGQA 2JRIB 4E3CA 1WGHA 5G5GA 2N0SB 2ZPYA 1RFAA 1IGDA 1QOFA 1T0SC 2N9KA 3KUCB 1F9JA 3NJTA 1NYRA 1C76A 4ZHOA 2QILA 1C79A 2LGYA 3QC8B 3ZRFA 3AU5A 1R4MI 3QIJA 3R66C 2FCQA 1XLPA 1WWTA 3LDZE 4BOZB 4NZLB 2KDEB 2WHIA 3N1XC 3SR6A 2NR2A 1WI0A 2W9NA 3AE8B 3APCA 2BGFA 1LM8B 4WWPA 3X0WA 2DZJA 1ET6A 1JW9D 3C0RB 2BYTA 5LXHA 4JE3B 1JCKB 3TCAA 4GOCA 2L52A 4GN1A 5J17A 4W9DA 2FIFA 2JXTA 4K1RB 3QA8A 2HTME 5J2RA 3MP9A 2RD0A 3ZW3A 4M8MA 2WP9B 1KTKA 2R61A 1ZP0B 1TGZB 2IPKD 2RDGA 2E3TA 4MJSB 2W3RA 2N9EB 2DWQA 5BYQA 4TUUA 1FNWA 2LGDA 4J3OD 3W9CB 3ZO5B 2IY0B 4I6NB 2BKRB 2WXKA 4A3PA 3RCZA 2WQYB 4JL9A 1QT9A 2PLPA 4HEA1 1UZXB 2KJHB 3QJZA 1S1QB 4AP4C 4B0EA 2M4NA 3DBHI 5G2NA 2JX5A 3WANA 2AX5A 2WX1A 3R8BA 4NAMA 2JQRB 3TEYA 1SIJA 1C3TA 3Q8BA 3NS8A 4HPMB 1V49A 2PIAA 2J0JA 2AL3A 3PO0A 5HFYA 1WM3A 1RAXA 2BS4B 2KQ7A 1GPXA 1KJTA 2G1EA 4US9A 2M17A 1TS3A 3RMKC 1C9FA 3IHPC 4LJOB 2GI9A 2D3AA 5TSSA 2CU3A 2LVQA 3ZNGC 1K51A 4NAWB 2L1AA 5JH5C 1L0XB 2L7RA 3QQ8B 4N6EB 1Y8RC 3RYTA 5AEKB 2PE6B 1WJ4A 4ASWC 3VH4B 3I9V1 1T0QC 5L83A 2WXRA 2RPQA 3EHVA 2J53A 4C56C 2MJ3A 4W9GA 2KXJA 3I3TB 1NBFC 1QQRA 3FC4A 1E0ZA 2INCC 4LDTB 1L0YB 3H6NA 4MGKE 1EU4A 4WQMA 4AWJA 2W54A 4OVVA 4M02A 3B2FA 3PHXB 2H89B 3AEFB 2BT6A 2J0KA 4ZDVA 4G50A 3NVWA 3DHHC 3A9KB 3CMMB 1E8YA 4D2KA 3AECB 2NTSA 5D3DA 4KSKC 2LASA 3EECA 2JF5A 4C4VA 1DOYA 3IAS1 1KOTA 1YN3A 1YOVB 3PZ8A 2WXJA 3ABVB 2BF8B 3NZ3A 4PS3A 3SEBA 3AXCA 3LJ3A 3UF8A 2Q5WD 1TKYA 3MJ5A 2R2QA 1ZE3D 3EFUA 1WGRA 1GAQB 1SE3A 1QKZA 4HPPA 3U7DA 1XCTL 2OEDA 4XWTA 2KQSA 5CHWA 1YIWA 5HG2A 3W1SC 3AEGB 3AE9B 1TIFA 4ARIA 3TEZA 2PTLA 4H2AA 4OZBA 1J0GA 2WU5B 4YSYB 4MGZE 1AW7A 4ITKA 1VR9A 2DYMA 2L3ZA 2N1VA 3PVLA 4GIVA 1V97A 4ANWA 4L2YA 2MRPA 1V1PB 3RZFA 2MBBB 4PK1A 2CHXA 2WDVB 3W1YA 4P1CC 3AE4B 2KOXA 4A8XC 1E7PB 2OHFA 3L10B 4FXCA 4RGTA 1G6JA 2VZKD 3N9YC 2V3PA 2NPTB 3RNCC 1YD8U 2DNFA 2UWQA 4YSZB 2KZRA 1XXGA 2DAJA 2O6VB 3RUIB 5KHQA 3A4SC 2AYOB 5IP4D 2ZW0A 4B95A 4IWPA 4DHZB 2MJDA 1HXYD 2KJRA 3VTWA 4L23A 4F1SA 5AZFA 2KN5A 4K3CA 2WXQA 4KGRA 3V62A 4ZRJA 4WJOA 1DYQA 2LGXA 3ETRA 2J52A 2KWUB 3T3OA 2KAJA 4GLSC 2ZNVB 1SEBD 4KV2A 2SEBD 3KH0A 4MGYE 4FHJA 1FFUA 1FEHA 3BK2A 1ZDXA 4YT0B 3H7SA 4EZKA 2KC2A 2WU2B 2V4IB 2Y5BB 3Q14C 2ZCCA 2DHZA 2DZMA 3AE5B 4RGOS 3RPFC 4MELA 5TR5A 2O2VA 3JSVB 2BS3B 2MP2B 3AB5A 2D2QA 4P6VF 2UU7A 3RT3B 1VCBA 3T9LA 4TMAB 1JRPA 3AEEB 2EKEC 3U52E 4W9JA 3PZDA 3UQBA 1AARA 2M0AA 3RZWC 3EUB2 2M56B 4M8NA 1WR6E 4KSLC 2J42A 5DCNA 1IBXA 1HQRD 1Y56A 4LTUA 3V61A 1MPEA 2FCNA 1RM6C 4FN2A 4GDLB 3Q3NC 2V3NA 4K7WA 3VVWB 1QILA 2LGIA 1J8CA 4WJQA 3PTFC 1WR1A 2CJOA 1FD6A 3C8YA 4XZ4A 5DPRA 5BYSA 1D4BA 3PRZA 3HVDA 2ZNVC 1WJNA 2MP2A 1NYQA 3JW0X 3WALA
chains in the Genus database with same CATH topology
3DHGC 3RNBC 1T0SC 3N1XC 3RNCC 3Q3OC 3Q14C 4P1BC 3GE3C 3RNAC 3N1YC 1T0RC 3Q3MC 3RNGC 1T0QC 3RNEC 3DHIC 3RMKC 3RN9C 3RI7C 2INDC 3DHHC 3I5JC 2RDBC 3N20C 4P1CC 3Q2AC 3GE8C 3N1ZC 3Q3NC 3RNFC 2INCC 3I63C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHG C;  3RNB C;  1T0S C;  3N1X C;  3RNC C;  3Q3O C;  3Q14 C;  4P1B C;  3GE3 C;  3RNA C;  3N1Y C;  1T0R C;  3Q3M C;  3RNG C;  1T0Q C;  3RNE C;  3DHI C;  3RMK C;  3RN9 C;  3RI7 C;  2IND C;  3DHH C;  3I5J C;  2RDB C;  3N20 C;  4P1C C;  3Q2A C;  3GE8 C;  3N1Z C;  3Q3N C;  3RNF C;  2INC C;  3I63 C; 
#chains in the Genus database with same CATH topology
 2LI5 A;  2BTE A;  2J0M A;  4FBJ B;  2D10 A;  1ESF A;  3HK0 A;  1F2R I;  2QMT A;  4RH6 A;  2D3C A;  5JXV A;  4NY0 A;  5E6N A;  3KQ4 A;  1WGK A;  4MGI E;  4TSS A;  3DWM A;  3TSS A;  2LHE A;  1RLF A;  2MQJ A;  1I42 A;  4MH0 E;  4GDL A;  4DDG D;  2ZW1 A;  3L16 A;  1E8X A;  5D7G A;  3JYU A;  1XQQ A;  4AOF A;  2DLB A;  2WXN A;  4ARC A;  4WUR A;  1T0R C;  4LNN A;  1LFD A;  3K9P B;  2G45 B;  1VD2 A;  2KVR A;  3IG3 A;  3OJ4 B;  1MJD A;  2UYZ B;  4QAY A;  1VZ7 A;  2EEL A;  2LXA A;  1P9D U;  4XYC A;  2KVZ A;  4HXD A;  3RNA C;  3PLU A;  2QC8 A;  2FE8 A;  2GBR A;  3NG0 A;  3ZLZ A;  3LYY A;  2KMA A;  3PGE A;  5IO9 A;  1AYF A;  2D3G A;  4M0W A;  4F7Z A;  2RPV A;  1WH3 A;  3GZN B;  1XLO A;  4XDD A;  2B3A A;  3HM6 X;  2FCS A;  2ZEQ A;  2MJE A;  1EUV B;  4YXD B;  2FAZ A;  3KUZ A;  3BYT B;  1XLQ A;  2LUM A;  4HK2 A;  1J19 A;  1MI0 A;  2EKI A;  2IO0 B;  2IZV B;  1WX9 A;  3A4R A;  3P63 A;  1YJJ A;  1WE6 A;  1L4D B;  2LUE A;  5IAA C;  2DAF A;  1FRD A;  1SSN A;  3W1S A;  1TT5 B;  3AE3 B;  1S3S G;  5DPS A;  4AUQ C;  2DEN B;  2LXC A;  2IY1 B;  4XE0 A;  2N1W A;  2CJN A;  2GBN A;  3DBH B;  3P42 A;  4II2 B;  1CJE A;  3BY4 B;  4BZA A;  3A1Q A;  3QHT A;  3NOB A;  4TQ1 A;  1VLB A;  1E9M A;  3R7Q A;  3VAW A;  1K53 A;  4HRS A;  1JWU D;  3D32 A;  2C7M B;  1WF9 A;  4ZRQ A;  4WWM A;  3RNG C;  4NNJ B;  3PHW B;  2Z0D B;  3KWV A;  2HE7 A;  2BB5 A;  2JYE A;  1C1Y B;  1PGA A;  4BBN F;  4LK0 M;  4JWU C;  1BXT A;  4LNK A;  1CQV A;  1YQ4 B;  3V60 A;  1WX7 A;  2IND C;  3VUW A;  4DHZ E;  2JXX A;  4WAA A;  2KTR A;  4A20 A;  3B1L X;  1A5R A;  1WY8 A;  1OGW A;  1QF6 A;  3I63 C;  2JY6 A;  3FAH A;  4AJY B;  3NVZ A;  4MM3 B;  3BII D;  2QDF A;  3CST A;  3UGB B;  3BZD B;  1C77 A;  3SD5 A;  1P7E A;  1VRA B;  4BKS D;  4CQN A;  4HVB A;  5GMV A;  5DPT A;  1XLN A;  5CHV C;  3RNF C;  1RYJ A;  2Z0E B;  4HKQ A;  4RMA A;  2INN E;  1NEK B;  4W9I A;  3VDZ A;  1F2R C;  4OW0 A;  1C4P A;  2LGS A;  4PS8 A;  2VZK B;  3DCG A;  4FJZ A;  3H7P A;  2YVC A;  2AQ1 B;  2J4X A;  2DZK A;  4KDL B;  2HJ1 A;  1MVK A;  4IDI A;  2NVU I;  3AMZ A;  1UBI A;  1J7B A;  2KTF A;  5CX3 A;  1DOX A;  1KRH A;  1EM7 A;  4HWI B;  4MH8 A;  2MEK A;  2L05 A;  4F8C B;  2GBM A;  1WSP A;  3Q69 A;  3ML9 A;  1YJI A;  2V4L A;  3B9J A;  3OLM D;  4YTN B;  2WXM A;  3K9O B;  2KDI A;  2M1M A;  3Q8F A;  3NUH B;  4DBG A;  2WGS A;  1YQB A;  4JIO U;  1PQS A;  4OVU A;  4EKU A;  3DVN U;  5FR6 A;  4CO7 A;  1X1M A;  2BQQ A;  4NJ6 A;  4WWO A;  4KDI C;  2ON8 A;  3RD2 A;  3ZXV A;  3E56 A;  1NVI D;  3L08 A;  3ZTD A;  1C4A A;  1HE8 A;  2FUG 1;  1BML C;  1WGD A;  2AL6 A;  2QCZ A;  1OEY A;  4AQ7 A;  3HUI A;  1M94 A;  2WX0 A;  2KQ4 X;  2JT4 B;  3MFG A;  4A90 A;  4BBN C;  3IBE A;  1QZE A;  1QOA A;  3ALB A;  1N60 A;  2ZJD A;  1UNS A;  3APF A;  1IGC A;  5BMI A;  2WXF A;  5AUK A;  4HJK A;  3H8H A;  3N3K B;  4KGS A;  5MPO A;  1TTN A;  1WMH B;  3Q3F A;  2V1Y A;  1HA5 A;  2JZP A;  3GE8 C;  1ZUD 2;  3QK0 A;  3OJ3 A;  4HPL B;  4RNA A;  4WJN A;  1UGM A;  4OZC A;  2LRU A;  3TMP B;  4W9C A;  2ASQ A;  4ANX A;  4TV3 A;  1JWA D;  4Q2J A;  2K3U A;  2I2Y A;  4ICV A;  4BKS A;  1MG8 A;  3APD A;  1SJE D;  1JAL A;  1JRO A;  1TY0 A;  2M8S A;  4XX5 A;  2PMV A;  1FPY A;  1I35 A;  3WCQ A;  1UGJ A;  5IOI A;  3DQV A;  1L0V B;  2WS3 B;  3IT4 B;  4WIP A;  1WXQ A;  1KF6 B;  4DXA B;  1P1A A;  2ICI A;  1F77 A;  2RDH A;  1V9J A;  3BYY B;  1V2Y A;  1STE A;  1ZPS A;  2J7Q B;  3DBL I;  2BS2 B;  5L95 C;  1TKG A;  1WIA A;  1WXM A;  1MHH E;  4KKI A;  4W9H A;  1V8C A;  3VRB B;  4IM3 A;  2K0P A;  1WJ6 A;  3BVZ A;  3NZU A;  3WAP A;  3W5V B;  2I38 A;  2BWE S;  1I4G A;  1QOB A;  1MHX A;  4BOS C;  2D3B A;  5DPW A;  2G9H D;  2REX A;  2CS4 A;  2BVC A;  3GB1 A;  3P2B A;  2KX0 A;  1ZDV A;  3QWZ B;  3DBR I;  1YQ3 B;  4FHK A;  2V9H A;  2IO2 B;  2N4F A;  4RGN A;  3PSE B;  2MBE A;  1XT9 B;  3WIM A;  1TS5 A;  2BBC A;  4RM8 A;  5BYR A;  5EE3 A;  3HIZ A;  2PW9 A;  1Q0W B;  5EE0 A;  2RR9 A;  1I4R A;  4HKZ E;  3B08 A;  2FCM A;  3Q8E A;  4LNF A;  1M4V A;  4BAX A;  3KYD D;  4C80 A;  1NDD A;  3PZ7 A;  2WXG A;  3M63 B;  3N1Z C;  3O65 B;  4RF0 A;  1SE4 A;  3V3X A;  2QJL A;  3ZRC A;  3AEB B;  2TSS A;  1PFD A;  1TS2 A;  4IWQ A;  1JWS D;  2DYB A;  3EC8 A;  3N1Y C;  2GLS A;  1ZOY B;  3I57 A;  1E90 A;  2MLB A;  3KVF B;  2M0X A;  3VUY A;  1GUA B;  2DBY A;  3AUL A;  4A55 A;  4ZRI A;  1V1P A;  4AJW A;  1FRR A;  3ONS A;  1AN8 A;  4NQK E;  1N61 A;  2KLC A;  2KLG A;  3DHI C;  1JQ4 A;  2MSE D;  2K25 A;  4NJ7 A;  2KWD A;  1C78 A;  3VTV A;  2XNA C;  4RFB A;  3R7R A;  1N6Z A;  2EMS A;  4WJP A;  3ZQ4 A;  2KWV B;  4M00 A;  2MBH A;  1VZ8 A;  2JUO A;  1GC7 A;  2BYF A;  3GP7 A;  1UWX A;  1ACC A;  2RGF A;  1V1O A;  1GNU A;  2QIE B;  2HDE A;  4IUM B;  2JRH A;  2YLM A;  3KUD B;  1WFY A;  3VR8 B;  4EUT A;  2O2V B;  4P16 A;  2N9P C;  1I4P A;  5CHF A;  2LRW A;  4BFR A;  3CF6 E;  2K8H A;  4REZ A;  3CSF A;  4HCP B;  2KDF B;  3PV1 A;  1ZW7 A;  2N7D A;  3M62 B;  3WAM A;  1CZP A;  1V5O A;  1D5Z C;  2K9X A;  2A4Z A;  3PRM B;  2C5L C;  1R4N I;  1T5X D;  2KTR B;  1IBX B;  4XC2 A;  3VR9 B;  3Q3J A;  4JX1 C;  1YNT E;  4II3 B;  4N9F 4;  2Z59 B;  1V81 A;  3BWU D;  3SFD B;  2BWF A;  2IJ0 A;  2PVO D;  3T8M A;  1SBB B;  3AE7 B;  3MTN B;  1FXT B;  3IAM 1;  4P1B C;  1WYW B;  1TS4 A;  1YN5 A;  2L8J A;  4S17 A;  4IW0 A;  4W9K A;  1K52 A;  3AN1 A;  4NJC A;  3FKY A;  2JWZ A;  3V6E B;  5FKA C;  2MCN B;  4WAF A;  4IG7 B;  4C7Z A;  3ZXR A;  3TL5 A;  2KO3 A;  1WXA A;  2ZCB A;  4ZRK A;  4EOY A;  3X23 A;  1HZ6 A;  3ZNZ B;  2LFI A;  3P1M A;  4IM2 A;  2H88 B;  1WZ3 A;  2NBU A;  3IT6 B;  2O6V D;  2WDQ B;  2WYQ A;  1L7Y A;  2SAK A;  2NS5 A;  3P4Q B;  1R4M B;  1UF0 A;  3A9J A;  3P4P B;  3WAO A;  1F1H A;  5LNK 1;  3N30 A;  3OAW A;  3OWE B;  2IGG A;  2MHJ A;  3DOW A;  3GS2 A;  3BVG A;  3KWL A;  3QAQ A;  1HEZ E;  1P3Q U;  2LJI A;  1GC6 A;  5G55 A;  4JPS A;  4FUL A;  4JQW C;  3A33 B;  3ZJT A;  3P4R B;  5D6J B;  2Y5C A;  3RNB C;  3AED B;  1F0Z A;  1FNU A;  4BVU C;  3DBR B;  1U4A A;  4LNO A;  1EU3 A;  3ZUN A;  2RSU A;  5J18 A;  4I6L B;  4PS7 A;  4IM0 A;  1EF5 A;  4UDU C;  2X8X X;  1PGB A;  1FO4 A;  4OZA A;  1KM7 A;  3GZN I;  3NY5 A;  5C3J B;  4MAC A;  3U8Z A;  3SDL C;  1E10 A;  1A70 A;  2QHO A;  4MJS A;  1RFK A;  1TKE A;  1Q10 A;  3M3J A;  3I5J C;  2G4S A;  5AZG A;  2HJ8 A;  4G3X B;  5H92 C;  4C00 A;  4EZL A;  5I4D A;  4W9E A;  1E5W A;  3R2T A;  1B1Z A;  4E74 A;  2XK5 A;  3HM3 A;  2XBB C;  4J6I A;  1C4C A;  1R7S A;  2ZPN A;  3AE6 B;  1EO6 A;  4WQO B;  2D5G A;  3AV8 A;  2K22 A;  4A6Q A;  4IKG A;  5GXG B;  4HDO A;  4S0R A;  3VRA B;  2AQ2 B;  3UIP B;  1PYW D;  3AI5 A;  1JML A;  5E6P A;  1CMX B;  2KAN A;  1D3Z A;  2PE9 A;  2G4D B;  5KHO A;  1UWM A;  1CK1 A;  2WXH A;  2KMC A;  5IN7 A;  2FNJ B;  5C2T B;  4HCN B;  1YMH E;  3AEA B;  2MWS B;  2WWZ A;  4GSW A;  1E8W A;  2N7E A;  4X57 B;  3RNE C;  2QSD A;  4DDI D;  3PRP B;  3O13 A;  2GOW A;  3C19 A;  3ZJU A;  3U7Z A;  1T6B X;  2AWT A;  5FK9 C;  1UD7 A;  2K39 A;  3HHM A;  1TY2 A;  3V6C B;  3TBL D;  1MG4 A;  1I4H A;  2BYV E;  1T0Y A;  1ZGU B;  2MBO A;  2RMM A;  1YJ1 A;  2VRR B;  2KNB A;  1L4Z B;  3RUL A;  1V6E A;  2XK5 B;  2V3S A;  4ICU A;  3L17 A;  2BW2 A;  3AH7 A;  5FR3 A;  1EWC A;  1VZ6 A;  4OVZ A;  4CYE A;  1AWD A;  1UEL A;  4M0W B;  4G0N B;  2B76 B;  3DPD A;  2C7N B;  4DWF A;  1UH6 A;  2WXI A;  1KH0 A;  3UI3 A;  2JZZ A;  1I4X A;  1I7H A;  1QLB B;  2BKF A;  3NZS A;  2KFK A;  1E7U A;  1Q1O A;  4HDQ A;  2AQ3 B;  1ROE A;  2WLB A;  1L6U A;  4HLE A;  4KIK A;  1QOG A;  4BKG A;  3ZJV A;  1D5X C;  4NAW A;  3J9C A;  3KLS X;  3NVY A;  4GDK B;  4MSQ B;  5G5H A;  2L00 B;  5HI1 A;  4ANU A;  4K7U A;  4MSM B;  4AS1 A;  2KFJ A;  3UQA A;  2C7H A;  1FNV A;  2IDY A;  4GB9 A;  5BO4 B;  2HD5 B;  3ZGZ A;  1V86 A;  2KDB A;  2N9X A;  2LZ6 A;  2Y3A A;  4TQ0 A;  3Q8A A;  4NPN A;  3UIN B;  1SIF A;  4EZJ A;  2WXL A;  2OOB B;  3GE3 C;  4OHJ A;  1H4R A;  4FAD A;  2WDT B;  2CU1 A;  3BIN A;  2DZI A;  5LXI B;  3DBS A;  2N9L A;  5IA7 A;  2IGH A;  1FXI A;  1WX8 A;  3V05 A;  3N20 C;  2L76 A;  3MHZ A;  2BYE A;  2M19 A;  2GBK A;  2PVG C;  3A9K A;  1D5M C;  3ZDT A;  1PUT A;  1WRI A;  2W82 A;  4CHK A;  2KT7 A;  3Q3O C;  3SHQ A;  3S2A A;  1WXV A;  1F52 A;  2A5U A;  2K6D B;  3ZNH B;  4C4V B;  1GOZ A;  4N58 A;  4K7S A;  3M95 A;  5EE1 A;  3UIO B;  2PJH A;  2FBW B;  2PEA A;  1D6E C;  2CHZ A;  3T3N A;  3IVF A;  1UBQ A;  2XEW A;  3TEW A;  1Z5S B;  3Q3M C;  4YSX B;  1E8Z A;  3U2S C;  4GU2 A;  2AEH A;  1TYG B;  2KC1 A;  2KYW A;  1SGH A;  4WWN A;  4LNI A;  1SE9 A;  1P7F A;  1WRD B;  3PPA A;  3U30 A;  4KZC A;  5BMG A;  2G3Q B;  4XWW A;  1XO3 A;  3TJP A;  1LXD A;  1YX6 B;  1UUP A;  2LWP A;  3VUX A;  2IYD B;  1HTQ A;  2C60 A;  1TZO A;  1J7C A;  2D11 A;  3QX1 A;  3PLV A;  3Q6B A;  4K3B A;  3PT2 B;  2E6X A;  3P4S B;  1WE7 A;  4RM9 A;  1RWS A;  1WGG A;  2JZ3 B;  4GXB A;  2KKC A;  2OJW A;  3IXS A;  1E6E B;  2KN4 A;  2C9W B;  2IGD A;  1IPG A;  3AE1 B;  3VTU A;  2KD0 A;  2CKH B;  4YTM B;  1OFF A;  3ML8 A;  3VQI A;  3MJW A;  4ZYS A;  4DXG A;  4PYZ A;  1Q5W B;  4USA A;  3DHG C;  2GMI C;  4A9A A;  2JPH A;  1OQQ A;  1T3Q A;  1DGJ A;  1DOI A;  1WMH A;  2LD9 A;  1TZ1 A;  3ZIM A;  2IO1 B;  2NMQ A;  4B9K A;  5LLI A;  3HRD D;  1WM2 A;  2MA9 B;  2K8B A;  3R3M A;  2NTT A;  2GB1 A;  1N5W A;  2JU6 X;  3WA0 A;  1FMA D;  1SB3 C;  1PGX A;  1R4N B;  4KVG B;  4MEM A;  3PRE A;  1ZKH A;  3PS6 A;  4FJY A;  1KLU D;  4ACF A;  4W9L A;  4WH4 A;  1FFV A;  3BVM A;  1VDV A;  3DVG X;  1Z2M A;  3RN9 C;  4DHJ B;  1SJH D;  2FUH B;  1JRU A;  3EGR A;  3E9S A;  2ZVO A;  4KIK B;  3B2G A;  1KLG D;  4B0M A;  3SFE B;  4GMV A;  1H8C A;  5JZE B;  1BUI C;  2FID A;  2YEP B;  1LGR A;  2NCN A;  4HRO A;  1ZXI A;  2QEJ C;  3ECI A;  1KLV A;  2L83 A;  4I6P A;  2WXO A;  2JVC A;  4O1N A;  1HTO A;  2PPH A;  2WXP A;  3ZKJ C;  3DVN V;  4NQL B;  1ET9 A;  2WDR B;  2ZVN A;  1GJZ A;  1JWB D;  3VHT C;  4R3D A;  4DHJ D;  3VFK A;  2L0F A;  2I1K A;  3SU8 X;  1SE2 A;  1GB4 A;  3ZDM C;  1FXA A;  1FIQ A;  2ACZ B;  5EE9 A;  3W2D A;  1P0R A;  3KYC D;  1RRB A;  4XDC A;  2L0T A;  1YX5 B;  4YTP B;  2GRI A;  2W3S A;  5C23 A;  1LO5 D;  2KK8 A;  3JSV A;  3ENE A;  4MDK E;  3H1U A;  5BMH A;  2K8C A;  4W9F A;  4YWG G;  4HJG E;  4FA6 A;  1J7A A;  3MC8 A;  2GBJ A;  2JWU A;  3MHS D;  2DYO A;  3B0A A;  2KX3 A;  4P7I A;  3TEX A;  2HTH A;  1HZ5 A;  1OQY A;  3ZTC A;  1ZXH A;  2VH2 A;  3RI7 C;  2W55 A;  1L2N A;  1XCQ L;  2RDB C;  1EWY C;  1IP9 A;  1ISN A;  2CR5 A;  4ZYN A;  5H8Y E;  3NVV A;  1GG3 A;  1V80 A;  4KZ0 A;  2KAC A;  2VH1 A;  3EFC A;  2INP E;  2DX5 B;  4IC7 B;  4B6W A;  3QAR A;  2ZZP B;  5D2M B;  2Y5P A;  4DK5 A;  4ZHP A;  3ZNI D;  4LJP B;  1WZ0 A;  1ENF A;  3GOE A;  2N7J A;  3AE2 B;  2KDM A;  5E6J A;  3KW5 B;  3EA6 A;  3L13 A;  3LXF A;  3HVZ A;  1I4Q A;  4KX6 B;  2R2O A;  3IFW B;  3L4P A;  4K81 A;  2PKO A;  5E6O A;  4RF1 A;  3MC9 A;  2YEP F;  2KMM A;  2V0G A;  1N63 A;  2D07 B;  2LVO A;  4JWS C;  5D94 A;  3QCA A;  4N59 A;  1KFY B;  1E7V A;  2L32 A;  3VXW A;  1LQB A;  3Q2A C;  2K1F A;  2MBQ A;  2X38 A;  5AUI A;  2WNM A;  2LEK A;  1GB1 A;  3JVZ X;  3R2I A;  2KHW B;  2MW5 A;  3MC0 B;  4MT5 A;  4FLH A;  2LMC A;  4IWO A;  5C1Z A;  2K6Q A;  2NBW B;  5T8I A;  4ZRP A;  2I1J A;  4E71 A;  3CWI A;  4GDK A;  4ZOH C;  4JGH B;  4EFO A;  4YL8 A;  1L6V A;  3RFZ B;  1WGY A;  1YN4 A;  3L54 A;  1P98 A;  4BKT A;  1NI3 A;  5CTR C;  4TKN A;  1OEY J;  5D3I B;  3W5U B;  2JYT A;  1PDX A;  5IKC M;  4MM3 A;  3BK1 A;  3U4E G;  4PYU A;  1L5P A;  2NPT A;  1MFW A;  3DDC B;  2BB6 A;  1K50 A;  5JHA A;  5HKH A;  4PT5 A;  2NBV B;  2O6V A;  4RGM A;  4M01 A;  4LCD E;  3TUO A;  1SF0 A;  1NI2 A;  2KFK B;  4US8 A;  1N5X A;  3DBL B;  1OTR B;  1N62 A;  2BPS A;  4LLG M;  1XF5 L;  5JHB A;  2CHW A;  2LVP A;  3FIL B;  3LB8 C;  1FM0 D;  2XN9 C;  4KGT A;  5EDS A;  1XD3 B;  2KWC A;  3N32 A;  2JSV X;  3DVG Y;  2MX2 A;  3AU4 A;  3TIX A;  1TJE A;  2KJ6 A;  4C7Y A;  4EEW A;  1IYF A;  3A9J B;  1WJU A;  1IUE A;  4JLC A;  4URK A;  1VJK A;  1FCL A;  4ANV A;  4L1B A;  3H7P B;  5AZH A;  1TBE A;  1OQR A;  3A1Q B;  4A3O A;  1WXS A;  1SXT A;  2IO3 B;  2ONQ A;  1XEE A;  4G11 A;  2LHD A;  4IOI E;  3VH3 B;  4RCO A;  3H9D A;  3AM9 A;  1JWM D;  4LDT D;  3ZVV A;  2IBI B;  4FJV B;  3ZYY X;  1B9R A;  3CIR B;  3NRZ A;  2LJ5 A;  1BT0 A;  3OG5 A;  2K5P A;  3Q8C A;  2Z8L A;  2EMT A;  1K8R B;  3NS1 A;  1NEN B;  3URY A;  4DQO C;  5HHD G;  1FCC C;  3FIL A;  2OJR A;  3L0W B;  4DXF A;  1EF1 A;  1V5T A;  4KKJ A;  2MH7 A;  1WYG A;  4XGA B;  3NHE B;  3DWG C;  4EE2 A;  4GGQ A;  2JRI B;  4E3C A;  1WGH A;  5G5G A;  2N0S B;  2ZPY A;  1RFA A;  1IGD A;  1QOF A;  1T0S C;  2N9K A;  3KUC B;  1F9J A;  3NJT A;  1NYR A;  1C76 A;  4ZHO A;  2QIL A;  1C79 A;  2LGY A;  3QC8 B;  3ZRF A;  3AU5 A;  1R4M I;  3QIJ A;  3R66 C;  2FCQ A;  1XLP A;  1WWT A;  3LDZ E;  4BOZ B;  4NZL B;  2KDE B;  2WHI A;  3N1X C;  3SR6 A;  2NR2 A;  1WI0 A;  2W9N A;  3AE8 B;  3APC A;  2BGF A;  1LM8 B;  4WWP A;  3X0W A;  2DZJ A;  1ET6 A;  1JW9 D;  3C0R B;  2BYT A;  5LXH A;  4JE3 B;  1JCK B;  3TCA A;  4GOC A;  2L52 A;  4GN1 A;  5J17 A;  4W9D A;  2FIF A;  2JXT A;  4K1R B;  3QA8 A;  2HTM E;  5J2R A;  3MP9 A;  2RD0 A;  3ZW3 A;  4M8M A;  2WP9 B;  1KTK A;  2R61 A;  1ZP0 B;  1TGZ B;  2IPK D;  2RDG A;  2E3T A;  4MJS B;  2W3R A;  2N9E B;  2DWQ A;  5BYQ A;  4TUU A;  1FNW A;  2LGD A;  4J3O D;  3W9C B;  3ZO5 B;  2IY0 B;  4I6N B;  2BKR B;  2WXK A;  4A3P A;  3RCZ A;  2WQY B;  4JL9 A;  1QT9 A;  2PLP A;  4HEA 1;  1UZX B;  2KJH B;  3QJZ A;  1S1Q B;  4AP4 C;  4B0E A;  2M4N A;  3DBH I;  5G2N A;  2JX5 A;  3WAN A;  2AX5 A;  2WX1 A;  3R8B A;  4NAM A;  2JQR B;  3TEY A;  1SIJ A;  1C3T A;  3Q8B A;  3NS8 A;  4HPM B;  1V49 A;  2PIA A;  2J0J A;  2AL3 A;  3PO0 A;  5HFY A;  1WM3 A;  1RAX A;  2BS4 B;  2KQ7 A;  1GPX A;  1KJT A;  2G1E A;  4US9 A;  2M17 A;  1TS3 A;  3RMK C;  1C9F A;  3IHP C;  4LJO B;  2GI9 A;  2D3A A;  5TSS A;  2CU3 A;  2LVQ A;  3ZNG C;  1K51 A;  4NAW B;  2L1A A;  5JH5 C;  1L0X B;  2L7R A;  3QQ8 B;  4N6E B;  1Y8R C;  3RYT A;  5AEK B;  2PE6 B;  1WJ4 A;  4ASW C;  3VH4 B;  3I9V 1;  1T0Q C;  5L83 A;  2WXR A;  2RPQ A;  3EHV A;  2J53 A;  4C56 C;  2MJ3 A;  4W9G A;  2KXJ A;  3I3T B;  1NBF C;  1QQR A;  3FC4 A;  1E0Z A;  2INC C;  4LDT B;  1L0Y B;  3H6N A;  4MGK E;  1EU4 A;  4WQM A;  4AWJ A;  2W54 A;  4OVV A;  4M02 A;  3B2F A;  3PHX B;  2H89 B;  3AEF B;  2BT6 A;  2J0K A;  4ZDV A;  4G50 A;  3NVW A;  3DHH C;  3A9K B;  3CMM B;  1E8Y A;  4D2K A;  3AEC B;  2NTS A;  5D3D A;  4KSK C;  2LAS A;  3EEC A;  2JF5 A;  4C4V A;  1DOY A;  3IAS 1;  1KOT A;  1YN3 A;  1YOV B;  3PZ8 A;  2WXJ A;  3ABV B;  2BF8 B;  3NZ3 A;  4PS3 A;  3SEB A;  3AXC A;  3LJ3 A;  3UF8 A;  2Q5W D;  1TKY A;  3MJ5 A;  2R2Q A;  1ZE3 D;  3EFU A;  1WGR A;  1GAQ B;  1SE3 A;  1QKZ A;  4HPP A;  3U7D A;  1XCT L;  2OED A;  4XWT A;  2KQS A;  5CHW A;  1YIW A;  5HG2 A;  3W1S C;  3AEG B;  3AE9 B;  1TIF A;  4ARI A;  3TEZ A;  2PTL A;  4H2A A;  4OZB A;  1J0G A;  2WU5 B;  4YSY B;  4MGZ E;  1AW7 A;  4ITK A;  1VR9 A;  2DYM A;  2L3Z A;  2N1V A;  3PVL A;  4GIV A;  1V97 A;  4ANW A;  4L2Y A;  2MRP A;  1V1P B;  3RZF A;  2MBB B;  4PK1 A;  2CHX A;  2WDV B;  3W1Y A;  4P1C C;  3AE4 B;  2KOX A;  4A8X C;  1E7P B;  2OHF A;  3L10 B;  4FXC A;  4RGT A;  1G6J A;  2VZK D;  3N9Y C;  2V3P A;  2NPT B;  3RNC C;  1YD8 U;  2DNF A;  2UWQ A;  4YSZ B;  2KZR A;  1XXG A;  2DAJ A;  2O6V B;  3RUI B;  5KHQ A;  3A4S C;  2AYO B;  5IP4 D;  2ZW0 A;  4B95 A;  4IWP A;  4DHZ B;  2MJD A;  1HXY D;  2KJR A;  3VTW A;  4L23 A;  4F1S A;  5AZF A;  2KN5 A;  4K3C A;  2WXQ A;  4KGR A;  3V62 A;  4ZRJ A;  4WJO A;  1DYQ A;  2LGX A;  3ETR A;  2J52 A;  2KWU B;  3T3O A;  2KAJ A;  4GLS C;  2ZNV B;  1SEB D;  4KV2 A;  2SEB D;  3KH0 A;  4MGY E;  4FHJ A;  1FFU A;  1FEH A;  3BK2 A;  1ZDX A;  4YT0 B;  3H7S A;  4EZK A;  2KC2 A;  2WU2 B;  2V4I B;  2Y5B B;  3Q14 C;  2ZCC A;  2DHZ A;  2DZM A;  3AE5 B;  4RGO S;  3RPF C;  4MEL A;  5TR5 A;  2O2V A;  3JSV B;  2BS3 B;  2MP2 B;  3AB5 A;  2D2Q A;  4P6V F;  2UU7 A;  3RT3 B;  1VCB A;  3T9L A;  4TMA B;  1JRP A;  3AEE B;  2EKE C;  3U52 E;  4W9J A;  3PZD A;  3UQB A;  1AAR A;  2M0A A;  3RZW C;  3EUB 2;  2M56 B;  4M8N A;  1WR6 E;  4KSL C;  2J42 A;  5DCN A;  1IBX A;  1HQR D;  1Y56 A;  4LTU A;  3V61 A;  1MPE A;  2FCN A;  1RM6 C;  4FN2 A;  4GDL B;  3Q3N C;  2V3N A;  4K7W A;  3VVW B;  1QIL A;  2LGI A;  1J8C A;  4WJQ A;  3PTF C;  1WR1 A;  2CJO A;  1FD6 A;  3C8Y A;  4XZ4 A;  5DPR A;  5BYS A;  1D4B A;  3PRZ A;  3HVD A;  2ZNV C;  1WJN A;  2MP2 A;  1NYQ A;  3JW0 X;  3WAL A; 
#chains in the Genus database with same CATH homology
 3DHG C;  3RNB C;  1T0S C;  3N1X C;  3RNC C;  3Q3O C;  3Q14 C;  4P1B C;  3GE3 C;  3RNA C;  3N1Y C;  1T0R C;  3Q3M C;  3RNG C;  1T0Q C;  3RNE C;  3DHI C;  3RMK C;  3RN9 C;  3RI7 C;  2IND C;  3DHH C;  3I5J C;  2RDB C;  3N20 C;  4P1C C;  3Q2A C;  3GE8 C;  3N1Z C;  3Q3N C;  3RNF C;  2INC C;  3I63 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...