3RNGC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/w167e double mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rngC00
1T0SC 3DHIC 3RNFC 3DHHC 3N1XC 3RN9C 3Q2AC 3N1YC 3RNGC 1T0RC 3RMKC 3GE3C 3DHGC 3RNAC 4P1BC 2INDC 2INCC 3Q3NC 2RDBC 3Q3MC 3N20C 3RNEC 3N1ZC 3I63C 4P1CC 3RNBC 3Q14C 3RNCC 3I5JC 3RI7C 3GE8C 3Q3OC 1T0QC
chains in the Genus database with same CATH superfamily
4IM3A 2FCSA 1E10A 3BK2A 2C7HA 4NAWB 3Q2AC 5EE9A 2KNBA 2MLBA 3J9CA 3L13A 3EHVA 2RPQA 3VUYA 4ANXA 1R7SA 1ZDVA 1WM2A 3Q8EA 1Q0WB 2MBEA 1CJEA 3AMZA 5BYRA 2N4FA 4GIVA 1E9MA 2KX0A 2RSUA 3IT6B 4IUMB 4OZCA 2KZRA 1TKEA 3U30A 4BFRA 1WSPA 2LMCA 1MG4A 1SJHD 4ZYSA 4K7WA 1WZ3A 4DQOC 2BB5A 1D5XC 1EWYC 1K53A 4XZ4A 3PPAA 1K50A 4N58A 1GC7A 2QILA 3I5JC 4ZRPA 1GB4A 1V1PA 1WGKA 3R7QA 4OHJA 5JZEB 2PVGC 3HM3A 2VZKB 2HE7A 2DENB 1WM3A 3R2TA 4MELA 1XD3B 3FC4A 2R2OA 4FBJB 1TYGB 1FNVA 1WY8A 3R66C 4LTUA 3U4EG 2WWZA 1FFVA 3DBHI 3UQBA 1ZGUB 4IOIE 2GB1A 2V9HA 3IVFA 1EU3A 5AUIA 4PK1A 2WDTB 1ZE3D 2LGYA 3VDZA 2NS5A 5H92C 1R4MI 4IC7B 4EUTA 1T5XD 1YD8U 2L05A 4ACFA 2WLBA 1YQ3B 4MGKE 2WXFA 2L7RA 2WXGA 4L23A 2IPKD 3RN9C 3S2AA 4K7UA 2WGSA 1NEKB 1XLPA 3SD5A 2Y5CA 2JWZA 4JGHB 2BGFA 1XF5L 2FUG1 1E5WA 1UGJA 5D3IB 3B0AA 3P1MA 3A9KA 3MHSD 3VUXA 1N60A 1EUVB 4FADA 1JQ4A 2D3CA 2KTRA 1FXTB 4MDKE 4RCOA 5EE0A 4NQKE 2AQ3B 1EO6A 2W55A 3A33B 2X38A 1BMLC 1WJNA 1OQQA 4NJCA 1QOGA 1T6BX 2ZVNA 3PO0A 4NZLB 3AEAB 2LFIA 2WXHA 1PGXA 4QAYA 1T0QC 2L1AA 2WDQB 2MBQA 3DWGC 5LXIB 1VCBA 5IO9A 1I4XA 3AV8A 1CQVA 2KYWA 3GZNI 1XXGA 2J53A 3PRPB 3EA6A 1U4AA 4HPMB 4HLEA 2W3RA 3PT2B 4XWTA 2O6VB 1FCLA 4XDDA 1YX6B 4E74A 2DLBA 1WFYA 2N1WA 2W3SA 2WXJA 1P3QU 3GB1A 2BPSA 4FJYA 1FRDA 1I4GA 1UBQA 4KDIC 4JQWC 2K0PA 2WXKA 3EECA 3P2BA 4N9F4 1MJDA 3V05A 4TQ1A 5BMHA 4NJ7A 2L76A 2MJDA 1PQSA 3V62A 1ZPSA 4LNFA 3AE1B 3L08A 3AE9B 1VD2A 2MHJA 2ZPNA 2KQ4X 2J0KA 2KC1A 4N6EB 2I1KA 1Q5WB 4WQOB 1VR9A 4WJPA 4ZYNA 4A3PA 1QZEA 2WXQA 3RYTA 1L6VA 1FMAD 2WS3B 3A9JA 5G5HA 3P4QB 5EE1A 1XQQA 4ZRKA 4RMAA 4WJQA 3OG5A 2UWQA 1T0SC 4EZKA 3WALA 3ABVB 1EWCA 1ZOYB 1D3ZA 5BMIA 5D3DA 3KQ4A 3QAQA 1ZUD2 1D5MC 4IKGA 3K9OB 1VZ6A 2WDRB 4W9LA 3ZDMC 5L83A 3ZRCA 5E6NA 1ET9A 2VH1A 5GXGB 3TUOA 5KHQA 3NS8A 4M01A 4JLCA 3NG0A 1L0VB 3KWLA 4HKZE 1C9FA 4XYCA 3EC8A 1NENB 3KUZA 4HROA 4OVVA 3URYA 4IW0A 1UZXB 4DHZB 4C4VB 1OFFA 2JSVX 2UU7A 2FCNA 2INPE 4FHKA 4KGRA 3VXWA 2V4LA 4M8NA 3MJ5A 1UUPA 2QJLA 4LNNA 4GLSC 3ML9A 3VTUA 5JHAA 2KLGA 3OAWA 5D6JB 5IAAC 3JSVA 2GBMA 3LXFA 1UBIA 2CS4A 1V2YA 3KUDB 1YMHE 2BYEA 2ICIA 4YTPB 2JPHA 2XN9C 5BO4B 1PUTA 2RDGA 3ZNGC 5FKAC 3V60A 4WJOA 3RNEC 1IGDA 2MJEA 1UNSA 3AE5B 4AOFA 4IM0A 3PLUA 3BVMA 1ROEA 3QA8A 4NAWA 1RM6C 2MWSB 3WCQA 3LB8C 1Q10A 3ALBA 1J7BA 2IO1B 1WMHB 3E9SA 2GBKA 4BAXA 1HTQA 3AN1A 2PJHA 4UDUC 4X57B 2CHWA 1N5WA 4A6QA 3Q3NC 1UF0A 3Q8BA 2KX3A 3HM6X 1UD7A 3KH0A 5AZFA 2JZZA 1KLUD 4HCNB 1M94A 4XX5A 3AU4A 2WNMA 2DAJA 4DHJD 5DPTA 4I6LB 1I4HA 3MTNB 2OJWA 3ZXRA 2KXJA 2GLSA 4MM3B 4DDGD 2E3TA 4W9CA 4MT5A 2YEPF 4OZAA 5IKCM 2DYBA 4C80A 2LUMA 2GMIC 2SEBD 1GNUA 3BK1A 4RGNA 4BVUC 2KACA 3SU8X 2KWUB 1E90A 1T0RC 2RR9A 4RGOS 3EUB2 4MGYE 2N9XA 4MJSB 2LUEA 2LVQA 2V3SA 3TEWA 3L0WB 2OEDA 3N30A 4K3CA 4WWMA 3Q14C 2DZKA 2L52A 4CO7A 4PYZA 2JRIB 1UELA 2AX5A 3I57A 2QSDA 4RH6A 1TBEA 3IAM1 3AB5A 2JQRB 3MFGA 4ARIA 3W2DA 2IDYA 4RM9A 1XLNA 3PLVA 2QDFA 4IWQA 2G9HD 2EKEC 3ZKJC 2WX1A 3B1LX 4HKQA 1FRRA 1FIQA 1ISNA 5TSSA 4GN1A 2M8SA 1QILA 4WAAA 1P7EA 2KJHB 1LFDA 1V6EA 4L1BA 3WA0A 3R8BA 2GBRA 3RCZA 3DPDA 4JE3B 1SIFA 2E6XA 1I7HA 5CTRC 4KSLC 4WH4A 4YTMB 4IG7B 5IA7A 1XO3A 3SFEB 2JXXA 5JHBA 4C00A 4B95A 1NDDA 1OGWA 1QOFA 2GRIA 2BVCA 2IBIB 3H7SA 4JIOU 2LVPA 1Z5SB 2PMVA 4DK5A 4XE0A 4FN2A 5D7GA 1TY0A 1XLOA 2N0SB 2MQJA 4EFOA 1C79A 2Z0EB 4YXDB 2QMTA 3DVNV 4W9HA 4KDLB 1WI0A 2EKIA 3PS6A 4EOYA 2TSSA 3N3KB 5LNK1 1V97A 4WWNA 2BYTA 4US9A 5IOIA 4C7ZA 4J6IA 1JROA 4ZHPA 2O6VA 2K8CA 3LDZE 3QCAA 2Y3AA 1FPYA 1WGYA 3W5VB 1L7YA 2CJOA 1RRBA 2JYEA 4FJVB 4W9EA 4ASWC 3BIID 1TJEA 4XWWA 5FR6A 1XCQL 4O1NA 3OJ4B 4PT5A 1JMLA 3TBLD 1WXVA 4AS1A 2BYFA 5T8IA 1V1OA 1WYGA 4KSKC 4HDOA 1TZOA 2BW2A 4P7IA 2WP9B 3TJPA 5IN7A 3DBRB 3GP7A 3M63B 5EE3A 2XK5B 1Z2MA 2HTME 4GGQA 2KKCA 3NZUA 4TV3A 3Q3FA 2WXLA 2BBCA 2G45B 2IO3B 2LJ5A 3CSFA 5FR3A 1GPXA 3APDA 3P4RB 1JWUD 3Q3OC 5J2RA 3TL5A 1C3TA 2K6DB 1P9DU 3ZNID 3FAHA 3RNGC 1NVID 2L0FA 4WJNA 2CU3A 5JH5C 1I35A 1EF1A 2GBNA 1R4NB 3I9V1 3T8MA 4C56C 3U52E 4K3BA 1MFWA 3VTWA 4AP4C 1YQ4B 3FILB 1QT9A 4B0MA 1STEA 3APCA 4K7SA 2K22A 4LDTB 1MVKA 1FD6A 4ZRQA 1OEYJ 4GDKB 2J0JA 5H8YE 4HRSA 1WF9A 4GXBA 3ZLZA 3OJ3A 4HJKA 1TKYA 2DZMA 2J4XA 2DX5B 3PGEA 2K39A 3V6EB 3DBLI 2D2QA 2PEAA 1DYQA 4C4VA 2NBUA 4EE2A 1TS3A 1V8CA 5D94A 4WWOA 1DOYA 1C4AA 4YSXB 3R3MA 4G11A 3E56A 2KAJA 4M0WB 3NRZA 5HG2A 2KWDA 1L0YB 1GG3A 3W1SC 2HTHA 2NTTA 4RGMA 2WXOA 3RUIB 3BVZA 1AW7A 3DHGC 3ZVVA 2LI5A 3Q3MC 2J52A 2LD9A 4US8A 2WYQA 3ZUNA 1M4VA 3ZW3A 2KVZA 2N9EB 2MX2A 2V3PA 1AWDA 2PLPA 3VHTC 3PHWB 2M4NA 3DQVA 2NR2A 1F2RC 1IP9A 5HI1A 1D4BA 2KDEB 1HE8A 1SE9A 3KWVA 1JCKB 3SEBA 1OTRB 4MEMA 1N61A 4YTNB 3RZFA 4WQMA 1ZP0B 2AEHA 1RFAA 3H9DA 3B2GA 2R2QA 1WMHA 1Y56A 1HEZE 2WXIA 4MSMB 4USAA 3QIJA 2MBHA 1I4RA 5EDSA 5E6JA 1Y8RC 1CZPA 1EM7A 1J0GA 1V5TA 1F1HA 2IO2B 2VH2A 3VTVA 5IP4D 2WDVB 1L5PA 1P7FA 3ZTCA 3ZJUA 1NYRA 5GMVA 4LNIA 3L54A 3P42A 2K25A 3PZDA 3NVYA 4RGTA 2PTLA 4MM3A 1DOXA 4HJGE 1JWSD 1J7CA 3NS1A 1LQBA 4W9JA 1MPEA 3KVFB 1NI3A 4Q2JA 2V0GA 3SHQA 3RFZB 2V1YA 4WURA 3WAMA 1SE2A 3DBHB 3X23A 5CHWA 1WXMA 2I1JA 2QIEB 1VZ7A 3TCAA 4E3CA 3DHIC 3DBSA 2Q5WD 1TIFA 2WXMA 3ML8A 2N9PC 4MJSA 2KDBA 4BZAA 1R4MB 1WX7A 1V5OA 2M56B 2BTEA 4ICUA 2L83A 4W9IA 3PV1A 3Q69A 4K1RB 1QLBB 1FXIA 1AARA 1TS5A 3QJZA 3HIZA 2G1EA 4OZBA 2GOWA 2LRUA 4N59A 4W9KA 1B9RA 2L0TA 4KIKB 1IBXB 3QX1A 1FCCC 1MHXA 3C19A 3N20C 2LRWA 3MC9A 3NZ3A 4FA6A 4AJYB 2Z59B 3RI7C 3RD2A 3IFWB 2JZ3B 1K52A 1WGDA 1QOAA 4LLGM 1HZ5A 2BS3B 2N9KA 5G5GA 3SFDB 2LASA 4P1BC 4MGZE 2IO0B 4A8XC 2KN5A 2BQQA 3PREA 2W54A 3Q8AA 1RWSA 2DAFA 3BINA 2UYZB 3AECB 3AEEB 1LGRA 4G0NB 4A9AA 1C4CA 3GZNB 1NBFC 3BZDB 3W5UB 2RGFA 3GE3C 2IGGA 1GB1A 3ZIMA 1F9JA 4KZCA 4DDID 1SSNA 3HVZA 2C9WB 5FK9C 2INCC 1TKGA 3UIPB 2AQ2B 3IXSA 1VJKA 4HEA1 2ZW0A 2YVCA 1J8CA 3BVGA 3NJTA 1TGZB 2FIFA 3ONSA 1YN4A 1PFDA 2A4ZA 3PSEB 3U8ZA 1H4RA 3KYCD 1IGCA 1NI2A 3EFUA 3SR6A 3QHTA 1BUIC 4BOZB 2N7EA 2NBVB 5L95C 1SGHA 2KO3A 2LWPA 3MP9A 2V4IB 2JVCA 3PHXB 3T3OA 2VZKD 1JWAD 2LXCA 3HUIA 5BYSA 1VRAB 4FXCA 3VVWB 4B0EA 3PZ7A 2BB6A 1GUAB 1KLGD 3AU5A 3NOBA 1C78A 3NVVA 4S0RA 2KQSA 1KJTA 4JWUC 1QF6A 3WIMA 1KM7A 4RM8A 2KOXA 2XK5A 2MJ3A 4PYUA 1V86A 1WX8A 4NQLB 4H2AA 4A20A 2LXAA 4REZA 1KRHA 3QARA 4F8CB 4XC2A 3AI5A 3L16A 3PZ8A 4M00A 1EF5A 2LVOA 1DOIA 3ZGZA 3AM9A 1LO5D 1YOVB 2D11A 2ZCBA 1RFKA 2KQ7A 3BWUD 4AQ7A 2DYMA 1NYQA 4TSSA 5LXHA 4RNAA 2W82A 4IWOA 2JRHA 3UQAA 1WGHA 4YL8A 3FILA 1SB3C 4NPNA 3BY4B 5BMGA 4BBNF 2D3AA 3D32A 3P4SB 2KMMA 5KHOA 5C23A 1HTOA 2WX0A 2M17A 3SDLC 4GDKA 3MC0B 2LGIA 4W9FA 2JWUA 3BYTB 2B76B 5DPWA 1MI0A 4I6PA 1F77A 2N9LA 4HK2A 3AE8B 4FJZA 2N7JA 1XLQA 2D3BA 4M0WA 4TUUA 3U7DA 1L4DB 1JRPA 2V3NA 1CK1A 2D07B 1AN8A 2LGDA 2PPHA 3ZQ4A 2YLMA 5G2NA 2JF5A 2O6VD 3U7ZA 3N32A 2KDMA 1C77A 2INDC 4FULA 3UINB 1YJJA 1HZ6A 4P1CC 4HDQA 1N5XA 2JU6X 5AZGA 2DHZA 1SE3A 3I3TB 2ZNVB 2ZJDA 3A4SC 3KLSX 2JY6A 1V49A 2FIDA 2O2VB 4GDLB 1UH6A 3C8YA 2C7NB 2J42A 3ZJVA 2K5PA 1WJUA 2MCNB 4G50A 2ZZPB 4EKUA 4HCPB 2KD0A 2IGDA 1WRDB 3TEXA 1F2RI 3HVDA 2H88B 4WIPA 1AYFA 4HWIB 1ZXHA 1GOZA 2OOBB 1RYJA 3VH4B 4EZLA 3JYUA 1JW9D 4BKGA 3IT4B 2D10A 1WXAA 4BBNC 3H8HA 4ZRIA 3V61A 1HA5A 2K3UA 2XEWA 3IBEA 1MHHE 2KHWB 1J7AA 1TT5B 1P1AA 1PGBA 4BOSC 2XBBC 4LJPB 4A90A 5CHVC 1TS2A 4D2KA 1KFYB 1V81A 3Q8CA 3GE8C 1IYFA 2ZEQA 4JWSC 3VRBB 2MA9B 3RNFC 4BKSA 1OQYA 3U2SC 2GI9A 2BKRB 4ICVA 2IY0B 2WQYB 1UGMA 2CU1A 1WE7A 2FUHB 1EU4A 5HFYA 2M1MA 1K51A 2HD5B 2KN4A 4NJ6A 4R3DA 1GJZA 1SF0A 4IWPA 5J18A 1WGGA 2ACZB 3NZSA 2JXTA 3B2FA 2KWVB 3HK0A 1E6EB 5G55A 4KKJA 1A70A 2DWQA 1QKZA 1QOBA 3AULA 4LJOB 1V80A 3WAOA 2BT6A 3PVLA 1LXDA 3A1QB 3H1UA 2BKFA 1X1MA 1PYWD 2AWTA 3EGRA 4GMVA 5C3JB 3QWZB 1FXAA 3NY5A 4FLHA 3RPFC 4TMAB 3T9LA 4ARCA 3Q6BA 3JW0X 2KVRA 2WXNA 5C2TB 1CMXB 1ZDXA 1YJIA 2M0XA 2NMQA 3N1ZC 3RNBC 3R7RA 2AL6A 2HDEA 3AE7B 2CJNA 3ZRFA 4B9KA 2ZPYA 3N1YC 5HKHA 3PRMB 2LGSA 5E6OA 1E7VA 4HVBA 3QK0A 3VH3B 3AEDB 3QQ8B 3ZNHB 1RAXA 3B9JA 4ANWA 1L2NA 2WU5B 4G3XB 2RD0A 1HQRD 1FNWA 1WJ4A 2ASQA 2J7QB 3A4RA 4FHJA 2EELA 1JWMD 2PKOA 3OLMD 4ITKA 3ZNZB 1YN5A 2SAKA 1T0YA 4L2YA 1L4ZB 3ZXVA 2Y5BB 4KKIA 4ANVA 2MP2B 3DCGA 3RNCC 3CF6E 3AEBB 1C76A 2AYOB 5AEKB 2IYDB 3H7PB 2G4DB 2IJ0A 1XEEA 3H6NA 2VRRB 4II2B 2FCQA 4YT0B 1TZ1A 2CHXA 3DVNU 2OHFA 3UIOB 1A5RA 2JX5A 2DNFA 4OW0A 3AE3B 5TR5A 4KGTA 4JL9A 3DDCB 1LM8B 4DXAB 3KUCB 2NPTB 1D6EC 4DHJB 3L17A 1N63A 4JPSA 3TEYA 3K9PB 3M3JA 3VUWA 2IY1B 4MH0E 2L8JA 2BS2B 2Z8LA 2C60A 2BS4B 3ZTDA 1ESFA 3Q8FA 2C7MB 3ZJTA 2XNAC 2PW9A 2J0MA 2CHZA 3OWEB 4OVZA 3DBLB 1F0ZA 1WXQA 3DVGY 2PE6B 4NAMA 3AE2B 1E8XA 1VDVA 2MH7A 3I63C 1SJED 3WANA 2KFKB 3TMPB 1FM0D 1D5ZC 2QEJC 1FNUA 4GB9A 2FE8A 5CHFA 3P4PB 3VR8B 4KV2A 4LK0M 4HPLB 1I4PA 2L00B 2LJIA 4II3B 4J3OD 3CMMB 4NNJB 1E7PB 3RULA 2DZJA 3ECIA 1QQRA 2FBWB 5AUKA 3IAS1 2HJ8A 1YQBA 2M0AA 2LGXA 1ZXIA 4DHZE 3DWMA 1VZ8A 3C0RB 1IUEA 2DYOA 4E71A 1KF6B 2I38A 4ZHOA 2HJ1A 4ZOHC 1WXSA 1XCTL 5DCNA 5E6PA 1KH0A 4CQNA 3TEZA 4W9GA 2RDHA 2LEKA 3AE6B 3W9CB 2IZVB 4AWJA 4S17A 2WXPA 1WR6E 2Z0DB 1GAQB 2KJRA 4EEWA 2JT4B 3L4PA 5JXVA 2O2VA 1OEYA 4GDLA 2L3ZA 2LHEA 3M95A 4LNKA 3ZYYX 5J17A 1FEHA 3AH7A 4GOCA 4M8MA 3RZWC 4DXFA 2K9XA 4EZJA 4MACA 4M02A 2KTFA 1WIAA 2CKHB 3HHMA 3UGBB 4PS3A 3VAWA 2KLCA 1I42A 1ENFA 1Q1OA 4A55A 3VFKA 1BT0A 2LZ6A 3KYDD 4DBGA 1B1ZA 4CHKA 3APFA 1YNTE 1N6ZA 2A5UA 4ANUA 3CWIA 4KX6B 1YX5B 2IGHA 3R2IA 1V1PB 1UWXA 2ONQA 2KK8A 2RPVA 4A3OA 1ACCA 2K8HA 5AZHA 2K6QA 1MG8A 1JWBD 1S3SG 3TIXA 5LLIA 4ZRJA 3FKYA 3UF8A 4LNOA 3V3XA 5BYQA 1VLBA 4CYEA 1IPGA 3IG3A 3CIRB 4JX1C 5HHDG 4LDTD 2EMTA 2W9NA 1WYWB 1OQRA 1SE4A 3ZDTA 5DPRA 2JYTA 3VRAB 1DGJA 3BYYB 4KVGB 2D5GA 2Y5PA 4BKTA 2NCNA 2KMCA 2KMAA 3W1SA 4XGAB 1BXTA 1SIJA 4MH8A 2R61A 1KOTA 2INNE 1N62A 4RF1A 4WWPA 3X0WA 3A1QA 4HXDA 4DXGA 3NVWA 3L10B 3V6CB 4IDIA 3AXCA 3O13A 1E8WA 2RDBC 1YJ1A 3MJWA 4TQ0A 1PDXA 4AUQC 4ZDVA 5I4DA 3A9KB 3LJ3A 4PS8A 2KDIA 1ZKHA 2KTRB 1WR1A 4RFBA 4MGIE 2GBJA 2MBBB 2NBWB 4YSZB 2ZCCA 4WAFA 3AEGB 2PE9A 3KW5B 3UI3A 1ZW7A 2D3GA 4PS7A 4YSYB 1TY2A 2K8BA 1TS4A 2BYVE 2DZIA 3CSTA 2PVOD 2G4SA 2YEPB 4URKA 2JZPA 4OVUA 4W9DA 4MSQB 3RNAC 3VR9B 1H8CA 1ET6A 3IHPC 3NHEB 2MEKA 3ENEA 3DVGX 3DHHC 2REXA 2DBYA 3GS2A 3VQIA 1JALA 2EMSA 1E8YA 1WZ0A 2WHIA 1FO4A 2ON8A 3AE4B 1V9JA 3EFCA 1GC6A 2MP2A 3PTFC 4DWFA 1WX9A 3JVZX 2K1FA 2N7DA 2X8XX 2KJ6A 1P0RA 1SBBB 3O65B 1XT9B 1SXTA 4IM2A 3W1YA 3H7PA 4BKSD 3P63A 2QCZA 2WU2B 1YIWA 2WXRA 5MPOA 2L32A 2KC2A 1RLFA 3DOWA 1WWTA 2FCMA 4K81A 1WGRA 3NVZA 4I6NB 1JRUA 1WJ6A 3ETRA 3A9JB 4XDCA 1KLVA 4NY0A 4HPPA 2BF8B 2NPTA 1F52A 2OJRA 4P6VF 3DBRI 2AL3A 2PIAA 3M62B 4B6WA 3QC8B 3Q3JA 1HXYD 2B3AA 1L6UA 1E0ZA 1E8ZA 1C4PA 3PRZA 2FNJB 2RMMA 1J19A 2JUOA 4F7ZA 1TTNA 4GU2A 2H89B 4LCDE 5D2MB 4TKNA 2MW5A 1P98A 2MSED 1E7UA 2AQ1B 1FFUA 3B08A 2KANA 2KFKA 2NVUI 1R4NI 2KT7A 2ZVOA 1WE6A 2G3QB 2M19A 1UWMA 2QHOA 1WRIA 3LYYA 3N1XC 5C1ZA 4YWGG 1YN3A 3ZO5B 2ZW1A 3MC8A 1T3QA 2C5LC 1K8RB 1G6JA 1I4QA 2KDFB 4RF0A 1PGAA 2N1VA 2BWES 3MHZA 2LHDA 3T3NA 3NUHB 5CX3A 2QC8A 3JSVB 3WAPA 1WH3A 4C7YA 3AEFB 1S1QB 4KGSA 5DPSA 2MRPA 3GOEA 4P16A 4F1SA 1KTKA 3RMKC 1L0XB 4GSWA 4KIKA 2NTSA 2ZNVC 1IBXA 3HRDD 1C1YB 4AJWA 2KWCA 2MBOA 3RT3B 4KZ0A 2I2YA 3N9YC 2FAZA 3TSSA 1SEBD 2CR5A 2KFJA 2BWFA
chains in the Genus database with same CATH topology
1T0SC 3DHIC 3RNFC 3DHHC 3N1XC 3RN9C 3Q2AC 3N1YC 3RNGC 1T0RC 3RMKC 3GE3C 3DHGC 3RNAC 4P1BC 2INDC 2INCC 3Q3NC 2RDBC 3Q3MC 3N20C 3RNEC 3N1ZC 3I63C 4P1CC 3RNBC 3Q14C 3RNCC 3I5JC 3RI7C 3GE8C 3Q3OC 1T0QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0S C;  3DHI C;  3RNF C;  3DHH C;  3N1X C;  3RN9 C;  3Q2A C;  3N1Y C;  3RNG C;  1T0R C;  3RMK C;  3GE3 C;  3DHG C;  3RNA C;  4P1B C;  2IND C;  2INC C;  3Q3N C;  2RDB C;  3Q3M C;  3N20 C;  3RNE C;  3N1Z C;  3I63 C;  4P1C C;  3RNB C;  3Q14 C;  3RNC C;  3I5J C;  3RI7 C;  3GE8 C;  3Q3O C;  1T0Q C; 
#chains in the Genus database with same CATH topology
 4IM3 A;  2FCS A;  1E10 A;  3BK2 A;  2C7H A;  4NAW B;  3Q2A C;  5EE9 A;  2KNB A;  2MLB A;  3J9C A;  3L13 A;  3EHV A;  2RPQ A;  3VUY A;  4ANX A;  1R7S A;  1ZDV A;  1WM2 A;  3Q8E A;  1Q0W B;  2MBE A;  1CJE A;  3AMZ A;  5BYR A;  2N4F A;  4GIV A;  1E9M A;  2KX0 A;  2RSU A;  3IT6 B;  4IUM B;  4OZC A;  2KZR A;  1TKE A;  3U30 A;  4BFR A;  1WSP A;  2LMC A;  1MG4 A;  1SJH D;  4ZYS A;  4K7W A;  1WZ3 A;  4DQO C;  2BB5 A;  1D5X C;  1EWY C;  1K53 A;  4XZ4 A;  3PPA A;  1K50 A;  4N58 A;  1GC7 A;  2QIL A;  3I5J C;  4ZRP A;  1GB4 A;  1V1P A;  1WGK A;  3R7Q A;  4OHJ A;  5JZE B;  2PVG C;  3HM3 A;  2VZK B;  2HE7 A;  2DEN B;  1WM3 A;  3R2T A;  4MEL A;  1XD3 B;  3FC4 A;  2R2O A;  4FBJ B;  1TYG B;  1FNV A;  1WY8 A;  3R66 C;  4LTU A;  3U4E G;  2WWZ A;  1FFV A;  3DBH I;  3UQB A;  1ZGU B;  4IOI E;  2GB1 A;  2V9H A;  3IVF A;  1EU3 A;  5AUI A;  4PK1 A;  2WDT B;  1ZE3 D;  2LGY A;  3VDZ A;  2NS5 A;  5H92 C;  1R4M I;  4IC7 B;  4EUT A;  1T5X D;  1YD8 U;  2L05 A;  4ACF A;  2WLB A;  1YQ3 B;  4MGK E;  2WXF A;  2L7R A;  2WXG A;  4L23 A;  2IPK D;  3RN9 C;  3S2A A;  4K7U A;  2WGS A;  1NEK B;  1XLP A;  3SD5 A;  2Y5C A;  2JWZ A;  4JGH B;  2BGF A;  1XF5 L;  2FUG 1;  1E5W A;  1UGJ A;  5D3I B;  3B0A A;  3P1M A;  3A9K A;  3MHS D;  3VUX A;  1N60 A;  1EUV B;  4FAD A;  1JQ4 A;  2D3C A;  2KTR A;  1FXT B;  4MDK E;  4RCO A;  5EE0 A;  4NQK E;  2AQ3 B;  1EO6 A;  2W55 A;  3A33 B;  2X38 A;  1BML C;  1WJN A;  1OQQ A;  4NJC A;  1QOG A;  1T6B X;  2ZVN A;  3PO0 A;  4NZL B;  3AEA B;  2LFI A;  2WXH A;  1PGX A;  4QAY A;  1T0Q C;  2L1A A;  2WDQ B;  2MBQ A;  3DWG C;  5LXI B;  1VCB A;  5IO9 A;  1I4X A;  3AV8 A;  1CQV A;  2KYW A;  3GZN I;  1XXG A;  2J53 A;  3PRP B;  3EA6 A;  1U4A A;  4HPM B;  4HLE A;  2W3R A;  3PT2 B;  4XWT A;  2O6V B;  1FCL A;  4XDD A;  1YX6 B;  4E74 A;  2DLB A;  1WFY A;  2N1W A;  2W3S A;  2WXJ A;  1P3Q U;  3GB1 A;  2BPS A;  4FJY A;  1FRD A;  1I4G A;  1UBQ A;  4KDI C;  4JQW C;  2K0P A;  2WXK A;  3EEC A;  3P2B A;  4N9F 4;  1MJD A;  3V05 A;  4TQ1 A;  5BMH A;  4NJ7 A;  2L76 A;  2MJD A;  1PQS A;  3V62 A;  1ZPS A;  4LNF A;  3AE1 B;  3L08 A;  3AE9 B;  1VD2 A;  2MHJ A;  2ZPN A;  2KQ4 X;  2J0K A;  2KC1 A;  4N6E B;  2I1K A;  1Q5W B;  4WQO B;  1VR9 A;  4WJP A;  4ZYN A;  4A3P A;  1QZE A;  2WXQ A;  3RYT A;  1L6V A;  1FMA D;  2WS3 B;  3A9J A;  5G5H A;  3P4Q B;  5EE1 A;  1XQQ A;  4ZRK A;  4RMA A;  4WJQ A;  3OG5 A;  2UWQ A;  1T0S C;  4EZK A;  3WAL A;  3ABV B;  1EWC A;  1ZOY B;  1D3Z A;  5BMI A;  5D3D A;  3KQ4 A;  3QAQ A;  1ZUD 2;  1D5M C;  4IKG A;  3K9O B;  1VZ6 A;  2WDR B;  4W9L A;  3ZDM C;  5L83 A;  3ZRC A;  5E6N A;  1ET9 A;  2VH1 A;  5GXG B;  3TUO A;  5KHQ A;  3NS8 A;  4M01 A;  4JLC A;  3NG0 A;  1L0V B;  3KWL A;  4HKZ E;  1C9F A;  4XYC A;  3EC8 A;  1NEN B;  3KUZ A;  4HRO A;  4OVV A;  3URY A;  4IW0 A;  1UZX B;  4DHZ B;  4C4V B;  1OFF A;  2JSV X;  2UU7 A;  2FCN A;  2INP E;  4FHK A;  4KGR A;  3VXW A;  2V4L A;  4M8N A;  3MJ5 A;  1UUP A;  2QJL A;  4LNN A;  4GLS C;  3ML9 A;  3VTU A;  5JHA A;  2KLG A;  3OAW A;  5D6J B;  5IAA C;  3JSV A;  2GBM A;  3LXF A;  1UBI A;  2CS4 A;  1V2Y A;  3KUD B;  1YMH E;  2BYE A;  2ICI A;  4YTP B;  2JPH A;  2XN9 C;  5BO4 B;  1PUT A;  2RDG A;  3ZNG C;  5FKA C;  3V60 A;  4WJO A;  3RNE C;  1IGD A;  2MJE A;  1UNS A;  3AE5 B;  4AOF A;  4IM0 A;  3PLU A;  3BVM A;  1ROE A;  3QA8 A;  4NAW A;  1RM6 C;  2MWS B;  3WCQ A;  3LB8 C;  1Q10 A;  3ALB A;  1J7B A;  2IO1 B;  1WMH B;  3E9S A;  2GBK A;  4BAX A;  1HTQ A;  3AN1 A;  2PJH A;  4UDU C;  4X57 B;  2CHW A;  1N5W A;  4A6Q A;  3Q3N C;  1UF0 A;  3Q8B A;  2KX3 A;  3HM6 X;  1UD7 A;  3KH0 A;  5AZF A;  2JZZ A;  1KLU D;  4HCN B;  1M94 A;  4XX5 A;  3AU4 A;  2WNM A;  2DAJ A;  4DHJ D;  5DPT A;  4I6L B;  1I4H A;  3MTN B;  2OJW A;  3ZXR A;  2KXJ A;  2GLS A;  4MM3 B;  4DDG D;  2E3T A;  4W9C A;  4MT5 A;  2YEP F;  4OZA A;  5IKC M;  2DYB A;  4C80 A;  2LUM A;  2GMI C;  2SEB D;  1GNU A;  3BK1 A;  4RGN A;  4BVU C;  2KAC A;  3SU8 X;  2KWU B;  1E90 A;  1T0R C;  2RR9 A;  4RGO S;  3EUB 2;  4MGY E;  2N9X A;  4MJS B;  2LUE A;  2LVQ A;  2V3S A;  3TEW A;  3L0W B;  2OED A;  3N30 A;  4K3C A;  4WWM A;  3Q14 C;  2DZK A;  2L52 A;  4CO7 A;  4PYZ A;  2JRI B;  1UEL A;  2AX5 A;  3I57 A;  2QSD A;  4RH6 A;  1TBE A;  3IAM 1;  3AB5 A;  2JQR B;  3MFG A;  4ARI A;  3W2D A;  2IDY A;  4RM9 A;  1XLN A;  3PLV A;  2QDF A;  4IWQ A;  2G9H D;  2EKE C;  3ZKJ C;  2WX1 A;  3B1L X;  4HKQ A;  1FRR A;  1FIQ A;  1ISN A;  5TSS A;  4GN1 A;  2M8S A;  1QIL A;  4WAA A;  1P7E A;  2KJH B;  1LFD A;  1V6E A;  4L1B A;  3WA0 A;  3R8B A;  2GBR A;  3RCZ A;  3DPD A;  4JE3 B;  1SIF A;  2E6X A;  1I7H A;  5CTR C;  4KSL C;  4WH4 A;  4YTM B;  4IG7 B;  5IA7 A;  1XO3 A;  3SFE B;  2JXX A;  5JHB A;  4C00 A;  4B95 A;  1NDD A;  1OGW A;  1QOF A;  2GRI A;  2BVC A;  2IBI B;  3H7S A;  4JIO U;  2LVP A;  1Z5S B;  2PMV A;  4DK5 A;  4XE0 A;  4FN2 A;  5D7G A;  1TY0 A;  1XLO A;  2N0S B;  2MQJ A;  4EFO A;  1C79 A;  2Z0E B;  4YXD B;  2QMT A;  3DVN V;  4W9H A;  4KDL B;  1WI0 A;  2EKI A;  3PS6 A;  4EOY A;  2TSS A;  3N3K B;  5LNK 1;  1V97 A;  4WWN A;  2BYT A;  4US9 A;  5IOI A;  4C7Z A;  4J6I A;  1JRO A;  4ZHP A;  2O6V A;  2K8C A;  3LDZ E;  3QCA A;  2Y3A A;  1FPY A;  1WGY A;  3W5V B;  1L7Y A;  2CJO A;  1RRB A;  2JYE A;  4FJV B;  4W9E A;  4ASW C;  3BII D;  1TJE A;  4XWW A;  5FR6 A;  1XCQ L;  4O1N A;  3OJ4 B;  4PT5 A;  1JML A;  3TBL D;  1WXV A;  4AS1 A;  2BYF A;  5T8I A;  1V1O A;  1WYG A;  4KSK C;  4HDO A;  1TZO A;  2BW2 A;  4P7I A;  2WP9 B;  3TJP A;  5IN7 A;  3DBR B;  3GP7 A;  3M63 B;  5EE3 A;  2XK5 B;  1Z2M A;  2HTM E;  4GGQ A;  2KKC A;  3NZU A;  4TV3 A;  3Q3F A;  2WXL A;  2BBC A;  2G45 B;  2IO3 B;  2LJ5 A;  3CSF A;  5FR3 A;  1GPX A;  3APD A;  3P4R B;  1JWU D;  3Q3O C;  5J2R A;  3TL5 A;  1C3T A;  2K6D B;  1P9D U;  3ZNI D;  3FAH A;  3RNG C;  1NVI D;  2L0F A;  4WJN A;  2CU3 A;  5JH5 C;  1I35 A;  1EF1 A;  2GBN A;  1R4N B;  3I9V 1;  3T8M A;  4C56 C;  3U52 E;  4K3B A;  1MFW A;  3VTW A;  4AP4 C;  1YQ4 B;  3FIL B;  1QT9 A;  4B0M A;  1STE A;  3APC A;  4K7S A;  2K22 A;  4LDT B;  1MVK A;  1FD6 A;  4ZRQ A;  1OEY J;  4GDK B;  2J0J A;  5H8Y E;  4HRS A;  1WF9 A;  4GXB A;  3ZLZ A;  3OJ3 A;  4HJK A;  1TKY A;  2DZM A;  2J4X A;  2DX5 B;  3PGE A;  2K39 A;  3V6E B;  3DBL I;  2D2Q A;  2PEA A;  1DYQ A;  4C4V A;  2NBU A;  4EE2 A;  1TS3 A;  1V8C A;  5D94 A;  4WWO A;  1DOY A;  1C4A A;  4YSX B;  3R3M A;  4G11 A;  3E56 A;  2KAJ A;  4M0W B;  3NRZ A;  5HG2 A;  2KWD A;  1L0Y B;  1GG3 A;  3W1S C;  2HTH A;  2NTT A;  4RGM A;  2WXO A;  3RUI B;  3BVZ A;  1AW7 A;  3DHG C;  3ZVV A;  2LI5 A;  3Q3M C;  2J52 A;  2LD9 A;  4US8 A;  2WYQ A;  3ZUN A;  1M4V A;  3ZW3 A;  2KVZ A;  2N9E B;  2MX2 A;  2V3P A;  1AWD A;  2PLP A;  3VHT C;  3PHW B;  2M4N A;  3DQV A;  2NR2 A;  1F2R C;  1IP9 A;  5HI1 A;  1D4B A;  2KDE B;  1HE8 A;  1SE9 A;  3KWV A;  1JCK B;  3SEB A;  1OTR B;  4MEM A;  1N61 A;  4YTN B;  3RZF A;  4WQM A;  1ZP0 B;  2AEH A;  1RFA A;  3H9D A;  3B2G A;  2R2Q A;  1WMH A;  1Y56 A;  1HEZ E;  2WXI A;  4MSM B;  4USA A;  3QIJ A;  2MBH A;  1I4R A;  5EDS A;  5E6J A;  1Y8R C;  1CZP A;  1EM7 A;  1J0G A;  1V5T A;  1F1H A;  2IO2 B;  2VH2 A;  3VTV A;  5IP4 D;  2WDV B;  1L5P A;  1P7F A;  3ZTC A;  3ZJU A;  1NYR A;  5GMV A;  4LNI A;  3L54 A;  3P42 A;  2K25 A;  3PZD A;  3NVY A;  4RGT A;  2PTL A;  4MM3 A;  1DOX A;  4HJG E;  1JWS D;  1J7C A;  3NS1 A;  1LQB A;  4W9J A;  1MPE A;  3KVF B;  1NI3 A;  4Q2J A;  2V0G A;  3SHQ A;  3RFZ B;  2V1Y A;  4WUR A;  3WAM A;  1SE2 A;  3DBH B;  3X23 A;  5CHW A;  1WXM A;  2I1J A;  2QIE B;  1VZ7 A;  3TCA A;  4E3C A;  3DHI C;  3DBS A;  2Q5W D;  1TIF A;  2WXM A;  3ML8 A;  2N9P C;  4MJS A;  2KDB A;  4BZA A;  1R4M B;  1WX7 A;  1V5O A;  2M56 B;  2BTE A;  4ICU A;  2L83 A;  4W9I A;  3PV1 A;  3Q69 A;  4K1R B;  1QLB B;  1FXI A;  1AAR A;  1TS5 A;  3QJZ A;  3HIZ A;  2G1E A;  4OZB A;  2GOW A;  2LRU A;  4N59 A;  4W9K A;  1B9R A;  2L0T A;  4KIK B;  1IBX B;  3QX1 A;  1FCC C;  1MHX A;  3C19 A;  3N20 C;  2LRW A;  3MC9 A;  3NZ3 A;  4FA6 A;  4AJY B;  2Z59 B;  3RI7 C;  3RD2 A;  3IFW B;  2JZ3 B;  1K52 A;  1WGD A;  1QOA A;  4LLG M;  1HZ5 A;  2BS3 B;  2N9K A;  5G5G A;  3SFD B;  2LAS A;  4P1B C;  4MGZ E;  2IO0 B;  4A8X C;  2KN5 A;  2BQQ A;  3PRE A;  2W54 A;  3Q8A A;  1RWS A;  2DAF A;  3BIN A;  2UYZ B;  3AEC B;  3AEE B;  1LGR A;  4G0N B;  4A9A A;  1C4C A;  3GZN B;  1NBF C;  3BZD B;  3W5U B;  2RGF A;  3GE3 C;  2IGG A;  1GB1 A;  3ZIM A;  1F9J A;  4KZC A;  4DDI D;  1SSN A;  3HVZ A;  2C9W B;  5FK9 C;  2INC C;  1TKG A;  3UIP B;  2AQ2 B;  3IXS A;  1VJK A;  4HEA 1;  2ZW0 A;  2YVC A;  1J8C A;  3BVG A;  3NJT A;  1TGZ B;  2FIF A;  3ONS A;  1YN4 A;  1PFD A;  2A4Z A;  3PSE B;  3U8Z A;  1H4R A;  3KYC D;  1IGC A;  1NI2 A;  3EFU A;  3SR6 A;  3QHT A;  1BUI C;  4BOZ B;  2N7E A;  2NBV B;  5L95 C;  1SGH A;  2KO3 A;  2LWP A;  3MP9 A;  2V4I B;  2JVC A;  3PHX B;  3T3O A;  2VZK D;  1JWA D;  2LXC A;  3HUI A;  5BYS A;  1VRA B;  4FXC A;  3VVW B;  4B0E A;  3PZ7 A;  2BB6 A;  1GUA B;  1KLG D;  3AU5 A;  3NOB A;  1C78 A;  3NVV A;  4S0R A;  2KQS A;  1KJT A;  4JWU C;  1QF6 A;  3WIM A;  1KM7 A;  4RM8 A;  2KOX A;  2XK5 A;  2MJ3 A;  4PYU A;  1V86 A;  1WX8 A;  4NQL B;  4H2A A;  4A20 A;  2LXA A;  4REZ A;  1KRH A;  3QAR A;  4F8C B;  4XC2 A;  3AI5 A;  3L16 A;  3PZ8 A;  4M00 A;  1EF5 A;  2LVO A;  1DOI A;  3ZGZ A;  3AM9 A;  1LO5 D;  1YOV B;  2D11 A;  2ZCB A;  1RFK A;  2KQ7 A;  3BWU D;  4AQ7 A;  2DYM A;  1NYQ A;  4TSS A;  5LXH A;  4RNA A;  2W82 A;  4IWO A;  2JRH A;  3UQA A;  1WGH A;  4YL8 A;  3FIL A;  1SB3 C;  4NPN A;  3BY4 B;  5BMG A;  4BBN F;  2D3A A;  3D32 A;  3P4S B;  2KMM A;  5KHO A;  5C23 A;  1HTO A;  2WX0 A;  2M17 A;  3SDL C;  4GDK A;  3MC0 B;  2LGI A;  4W9F A;  2JWU A;  3BYT B;  2B76 B;  5DPW A;  1MI0 A;  4I6P A;  1F77 A;  2N9L A;  4HK2 A;  3AE8 B;  4FJZ A;  2N7J A;  1XLQ A;  2D3B A;  4M0W A;  4TUU A;  3U7D A;  1L4D B;  1JRP A;  2V3N A;  1CK1 A;  2D07 B;  1AN8 A;  2LGD A;  2PPH A;  3ZQ4 A;  2YLM A;  5G2N A;  2JF5 A;  2O6V D;  3U7Z A;  3N32 A;  2KDM A;  1C77 A;  2IND C;  4FUL A;  3UIN B;  1YJJ A;  1HZ6 A;  4P1C C;  4HDQ A;  1N5X A;  2JU6 X;  5AZG A;  2DHZ A;  1SE3 A;  3I3T B;  2ZNV B;  2ZJD A;  3A4S C;  3KLS X;  2JY6 A;  1V49 A;  2FID A;  2O2V B;  4GDL B;  1UH6 A;  3C8Y A;  2C7N B;  2J42 A;  3ZJV A;  2K5P A;  1WJU A;  2MCN B;  4G50 A;  2ZZP B;  4EKU A;  4HCP B;  2KD0 A;  2IGD A;  1WRD B;  3TEX A;  1F2R I;  3HVD A;  2H88 B;  4WIP A;  1AYF A;  4HWI B;  1ZXH A;  1GOZ A;  2OOB B;  1RYJ A;  3VH4 B;  4EZL A;  3JYU A;  1JW9 D;  4BKG A;  3IT4 B;  2D10 A;  1WXA A;  4BBN C;  3H8H A;  4ZRI A;  3V61 A;  1HA5 A;  2K3U A;  2XEW A;  3IBE A;  1MHH E;  2KHW B;  1J7A A;  1TT5 B;  1P1A A;  1PGB A;  4BOS C;  2XBB C;  4LJP B;  4A90 A;  5CHV C;  1TS2 A;  4D2K A;  1KFY B;  1V81 A;  3Q8C A;  3GE8 C;  1IYF A;  2ZEQ A;  4JWS C;  3VRB B;  2MA9 B;  3RNF C;  4BKS A;  1OQY A;  3U2S C;  2GI9 A;  2BKR B;  4ICV A;  2IY0 B;  2WQY B;  1UGM A;  2CU1 A;  1WE7 A;  2FUH B;  1EU4 A;  5HFY A;  2M1M A;  1K51 A;  2HD5 B;  2KN4 A;  4NJ6 A;  4R3D A;  1GJZ A;  1SF0 A;  4IWP A;  5J18 A;  1WGG A;  2ACZ B;  3NZS A;  2JXT A;  3B2F A;  2KWV B;  3HK0 A;  1E6E B;  5G55 A;  4KKJ A;  1A70 A;  2DWQ A;  1QKZ A;  1QOB A;  3AUL A;  4LJO B;  1V80 A;  3WAO A;  2BT6 A;  3PVL A;  1LXD A;  3A1Q B;  3H1U A;  2BKF A;  1X1M A;  1PYW D;  2AWT A;  3EGR A;  4GMV A;  5C3J B;  3QWZ B;  1FXA A;  3NY5 A;  4FLH A;  3RPF C;  4TMA B;  3T9L A;  4ARC A;  3Q6B A;  3JW0 X;  2KVR A;  2WXN A;  5C2T B;  1CMX B;  1ZDX A;  1YJI A;  2M0X A;  2NMQ A;  3N1Z C;  3RNB C;  3R7R A;  2AL6 A;  2HDE A;  3AE7 B;  2CJN A;  3ZRF A;  4B9K A;  2ZPY A;  3N1Y C;  5HKH A;  3PRM B;  2LGS A;  5E6O A;  1E7V A;  4HVB A;  3QK0 A;  3VH3 B;  3AED B;  3QQ8 B;  3ZNH B;  1RAX A;  3B9J A;  4ANW A;  1L2N A;  2WU5 B;  4G3X B;  2RD0 A;  1HQR D;  1FNW A;  1WJ4 A;  2ASQ A;  2J7Q B;  3A4R A;  4FHJ A;  2EEL A;  1JWM D;  2PKO A;  3OLM D;  4ITK A;  3ZNZ B;  1YN5 A;  2SAK A;  1T0Y A;  4L2Y A;  1L4Z B;  3ZXV A;  2Y5B B;  4KKI A;  4ANV A;  2MP2 B;  3DCG A;  3RNC C;  3CF6 E;  3AEB B;  1C76 A;  2AYO B;  5AEK B;  2IYD B;  3H7P B;  2G4D B;  2IJ0 A;  1XEE A;  3H6N A;  2VRR B;  4II2 B;  2FCQ A;  4YT0 B;  1TZ1 A;  2CHX A;  3DVN U;  2OHF A;  3UIO B;  1A5R A;  2JX5 A;  2DNF A;  4OW0 A;  3AE3 B;  5TR5 A;  4KGT A;  4JL9 A;  3DDC B;  1LM8 B;  4DXA B;  3KUC B;  2NPT B;  1D6E C;  4DHJ B;  3L17 A;  1N63 A;  4JPS A;  3TEY A;  3K9P B;  3M3J A;  3VUW A;  2IY1 B;  4MH0 E;  2L8J A;  2BS2 B;  2Z8L A;  2C60 A;  2BS4 B;  3ZTD A;  1ESF A;  3Q8F A;  2C7M B;  3ZJT A;  2XNA C;  2PW9 A;  2J0M A;  2CHZ A;  3OWE B;  4OVZ A;  3DBL B;  1F0Z A;  1WXQ A;  3DVG Y;  2PE6 B;  4NAM A;  3AE2 B;  1E8X A;  1VDV A;  2MH7 A;  3I63 C;  1SJE D;  3WAN A;  2KFK B;  3TMP B;  1FM0 D;  1D5Z C;  2QEJ C;  1FNU A;  4GB9 A;  2FE8 A;  5CHF A;  3P4P B;  3VR8 B;  4KV2 A;  4LK0 M;  4HPL B;  1I4P A;  2L00 B;  2LJI A;  4II3 B;  4J3O D;  3CMM B;  4NNJ B;  1E7P B;  3RUL A;  2DZJ A;  3ECI A;  1QQR A;  2FBW B;  5AUK A;  3IAS 1;  2HJ8 A;  1YQB A;  2M0A A;  2LGX A;  1ZXI A;  4DHZ E;  3DWM A;  1VZ8 A;  3C0R B;  1IUE A;  2DYO A;  4E71 A;  1KF6 B;  2I38 A;  4ZHO A;  2HJ1 A;  4ZOH C;  1WXS A;  1XCT L;  5DCN A;  5E6P A;  1KH0 A;  4CQN A;  3TEZ A;  4W9G A;  2RDH A;  2LEK A;  3AE6 B;  3W9C B;  2IZV B;  4AWJ A;  4S17 A;  2WXP A;  1WR6 E;  2Z0D B;  1GAQ B;  2KJR A;  4EEW A;  2JT4 B;  3L4P A;  5JXV A;  2O2V A;  1OEY A;  4GDL A;  2L3Z A;  2LHE A;  3M95 A;  4LNK A;  3ZYY X;  5J17 A;  1FEH A;  3AH7 A;  4GOC A;  4M8M A;  3RZW C;  4DXF A;  2K9X A;  4EZJ A;  4MAC A;  4M02 A;  2KTF A;  1WIA A;  2CKH B;  3HHM A;  3UGB B;  4PS3 A;  3VAW A;  2KLC A;  1I42 A;  1ENF A;  1Q1O A;  4A55 A;  3VFK A;  1BT0 A;  2LZ6 A;  3KYD D;  4DBG A;  1B1Z A;  4CHK A;  3APF A;  1YNT E;  1N6Z A;  2A5U A;  4ANU A;  3CWI A;  4KX6 B;  1YX5 B;  2IGH A;  3R2I A;  1V1P B;  1UWX A;  2ONQ A;  2KK8 A;  2RPV A;  4A3O A;  1ACC A;  2K8H A;  5AZH A;  2K6Q A;  1MG8 A;  1JWB D;  1S3S G;  3TIX A;  5LLI A;  4ZRJ A;  3FKY A;  3UF8 A;  4LNO A;  3V3X A;  5BYQ A;  1VLB A;  4CYE A;  1IPG A;  3IG3 A;  3CIR B;  4JX1 C;  5HHD G;  4LDT D;  2EMT A;  2W9N A;  1WYW B;  1OQR A;  1SE4 A;  3ZDT A;  5DPR A;  2JYT A;  3VRA B;  1DGJ A;  3BYY B;  4KVG B;  2D5G A;  2Y5P A;  4BKT A;  2NCN A;  2KMC A;  2KMA A;  3W1S A;  4XGA B;  1BXT A;  1SIJ A;  4MH8 A;  2R61 A;  1KOT A;  2INN E;  1N62 A;  4RF1 A;  4WWP A;  3X0W A;  3A1Q A;  4HXD A;  4DXG A;  3NVW A;  3L10 B;  3V6C B;  4IDI A;  3AXC A;  3O13 A;  1E8W A;  2RDB C;  1YJ1 A;  3MJW A;  4TQ0 A;  1PDX A;  4AUQ C;  4ZDV A;  5I4D A;  3A9K B;  3LJ3 A;  4PS8 A;  2KDI A;  1ZKH A;  2KTR B;  1WR1 A;  4RFB A;  4MGI E;  2GBJ A;  2MBB B;  2NBW B;  4YSZ B;  2ZCC A;  4WAF A;  3AEG B;  2PE9 A;  3KW5 B;  3UI3 A;  1ZW7 A;  2D3G A;  4PS7 A;  4YSY B;  1TY2 A;  2K8B A;  1TS4 A;  2BYV E;  2DZI A;  3CST A;  2PVO D;  2G4S A;  2YEP B;  4URK A;  2JZP A;  4OVU A;  4W9D A;  4MSQ B;  3RNA C;  3VR9 B;  1H8C A;  1ET6 A;  3IHP C;  3NHE B;  2MEK A;  3ENE A;  3DVG X;  3DHH C;  2REX A;  2DBY A;  3GS2 A;  3VQI A;  1JAL A;  2EMS A;  1E8Y A;  1WZ0 A;  2WHI A;  1FO4 A;  2ON8 A;  3AE4 B;  1V9J A;  3EFC A;  1GC6 A;  2MP2 A;  3PTF C;  4DWF A;  1WX9 A;  3JVZ X;  2K1F A;  2N7D A;  2X8X X;  2KJ6 A;  1P0R A;  1SBB B;  3O65 B;  1XT9 B;  1SXT A;  4IM2 A;  3W1Y A;  3H7P A;  4BKS D;  3P63 A;  2QCZ A;  2WU2 B;  1YIW A;  2WXR A;  5MPO A;  2L32 A;  2KC2 A;  1RLF A;  3DOW A;  1WWT A;  2FCM A;  4K81 A;  1WGR A;  3NVZ A;  4I6N B;  1JRU A;  1WJ6 A;  3ETR A;  3A9J B;  4XDC A;  1KLV A;  4NY0 A;  4HPP A;  2BF8 B;  2NPT A;  1F52 A;  2OJR A;  4P6V F;  3DBR I;  2AL3 A;  2PIA A;  3M62 B;  4B6W A;  3QC8 B;  3Q3J A;  1HXY D;  2B3A A;  1L6U A;  1E0Z A;  1E8Z A;  1C4P A;  3PRZ A;  2FNJ B;  2RMM A;  1J19 A;  2JUO A;  4F7Z A;  1TTN A;  4GU2 A;  2H89 B;  4LCD E;  5D2M B;  4TKN A;  2MW5 A;  1P98 A;  2MSE D;  1E7U A;  2AQ1 B;  1FFU A;  3B08 A;  2KAN A;  2KFK A;  2NVU I;  1R4N I;  2KT7 A;  2ZVO A;  1WE6 A;  2G3Q B;  2M19 A;  1UWM A;  2QHO A;  1WRI A;  3LYY A;  3N1X C;  5C1Z A;  4YWG G;  1YN3 A;  3ZO5 B;  2ZW1 A;  3MC8 A;  1T3Q A;  2C5L C;  1K8R B;  1G6J A;  1I4Q A;  2KDF B;  4RF0 A;  1PGA A;  2N1V A;  2BWE S;  3MHZ A;  2LHD A;  3T3N A;  3NUH B;  5CX3 A;  2QC8 A;  3JSV B;  3WAP A;  1WH3 A;  4C7Y A;  3AEF B;  1S1Q B;  4KGS A;  5DPS A;  2MRP A;  3GOE A;  4P16 A;  4F1S A;  1KTK A;  3RMK C;  1L0X B;  4GSW A;  4KIK A;  2NTS A;  2ZNV C;  1IBX A;  3HRD D;  1C1Y B;  4AJW A;  2KWC A;  2MBO A;  3RT3 B;  4KZ0 A;  2I2Y A;  3N9Y C;  2FAZ A;  3TSS A;  1SEB D;  2CR5 A;  2KFJ A;  2BWF A; 
#chains in the Genus database with same CATH homology
 1T0S C;  3DHI C;  3RNF C;  3DHH C;  3N1X C;  3RN9 C;  3Q2A C;  3N1Y C;  3RNG C;  1T0R C;  3RMK C;  3GE3 C;  3DHG C;  3RNA C;  4P1B C;  2IND C;  2INC C;  3Q3N C;  2RDB C;  3Q3M C;  3N20 C;  3RNE C;  3N1Z C;  3I63 C;  4P1C C;  3RNB C;  3Q14 C;  3RNC C;  3I5J C;  3RI7 C;  3GE8 C;  3Q3O C;  1T0Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...