3RNGC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/w167e double mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rngC00
3RNAC 3I5JC 4P1BC 1T0RC 3DHGC 1T0QC 3I63C 3DHIC 3RN9C 3RNGC 3RNCC 3GE8C 2INCC 3RMKC 3N1ZC 3N1YC 3DHHC 2RDBC 4P1CC 3Q3OC 3Q3MC 3RNEC 3N20C 3RI7C 3Q3NC 3RNFC 3GE3C 1T0SC 3N1XC 3Q2AC 3RNBC 3Q14C 2INDC
chains in the Genus database with same CATH superfamily
1VR9A 4LNIA 2D5GA 2WU2B 3W1SA 2BW2A 5BMIA 3MC0B 3RD2A 1E0ZA 2ZW1A 3KLSX 2MEKA 1PUTA 2G9HD 3I57A 1L4DB 2N9EB 2AEHA 2AQ3B 4JWUC 5BO4B 4GLSC 1FEHA 3WIMA 2V3NA 5BYRA 5BMGA 1I42A 3NJTA 1I4PA 2L0TA 4ICVA 2L83A 3O13A 4YTMB 2D3GA 2ZPYA 3MHZA 3SD5A 1H8CA 4I6PA 4A55A 3ZXRA 2WXKA 2JUOA 5HHDG 3DOWA 3A1QA 2FIFA 2KJ6A 2N9PC 4JX1C 2IY1B 2N7EA 4WWOA 4PS3A 3AM9A 3AE7B 1FO4A 2XK5A 4GXBA 2ON8A 1V1OA 2WX1A 2WXQA 4HKZE 3E56A 2AQ1B 4WAAA 3Q3JA 1V5TA 2WS3B 2LJ5A 2N7DA 3AE4B 3A9KA 1TS2A 1XLPA 4JLCA 2JY6A 1JMLA 2AQ2B 3MP9A 3MTNB 3VH4B 1YJJA 2MH7A 3AEGB 3BINA 3GOEA 1NYQA 2LASA 2HTHA 2LVQA 3ML8A 2EKIA 4M02A 2FAZA 2JYEA 3GZNB 4W9LA 2KTRA 3APCA 1JWBD 2VZKB 4LLGM 3ZJTA 4RF0A 4MGIE 5DPWA 1N62A 5H8YE 1KF6B 1JWUD 1ZXHA 1ACCA 2YLMA 4TMAB 5MPOA 1LGRA 2AL6A 2DWQA 2NS5A 4GDLA 2N7JA 1R4MB 4K3CA 3AE2B 2EMTA 1FNWA 1WFYA 4MEMA 1TZ1A 2JWUA 3Q3FA 4XE0A 1WY8A 5EE0A 1BXTA 3SEBA 4ZHOA 3RYTA 2V1YA 4K1RB 4K3BA 2HJ8A 3TSSA 3SFDB 2YEPB 3LXFA 1L0VB 4ZYNA 4KGTA 4MM3A 2E6XA 2KVRA 4HDOA 3DHIC 1F0ZA 2BYTA 1MHXA 3UQAA 4JE3B 3NY5A 2MJEA 2QCZA 3Q3MC 2FCMA 4ZRJA 1NI3A 1YOVB 3Q69A 1RLFA 3R8BA 3UF8A 4RMAA 3PZ7A 2A4ZA 2MJ3A 1WGYA 2CHWA 3ZKJC 4K7SA 4P6VF 1E8XA 1WJ6A 4C4VB 2KN5A 1Q5WB 2BQQA 1NVID 4OZAA 2W3SA 2JZ3B 4XDDA 1FCCC 1K8RB 2BF8B 3RPFC 2CKHB 4IM0A 1JCKB 3I63C 1BUIC 1E8YA 3AE3B 3DCGA 2FE8A 2N0SB 4DHJD 2K39A 1IGDA 3APDA 2RPVA 2GMIC 2DLBA 4N58A 2QIEB 4RF1A 4E74A 1WX9A 1E9MA 3V61A 2BPSA 1QZEA 2OJRA 1YNTE 1HEZE 3N32A 2OHFA 3ABVB 1H4RA 5EE3A 3H7PA 2RMMA 3A33B 5AZGA 3B2GA 4FN2A 1PGXA 1CZPA 1GOZA 2K1FA 1I35A 1C4PA 3ZJUA 1VJKA 2Y5CA 3W9CB 2UU7A 3L4PA 2O6VB 1UBQA 4MSMB 2C7NB 1E5WA 3U52E 3QJZA 2CHZA 3QIJA 1J0GA 1V80A 5AZHA 1T3QA 2KWCA 2L00B 3AEEB 3AE1B 2DZMA 4HWIB 3RFZB 3QC8B 1SE2A 3LDZE 3DDCB 3RNEC 4KIKA 3KUCB 4MACA 1JRUA 4E3CA 2DX5B 2BTEA 3DBLI 2KDFB 1WRDB 3ZNHB 2QDFA 3HM3A 4LTUA 4IDIA 2BB5A 4W9DA 2J0KA 2KQ4X 2NR2A 4LDTD 2Q5WD 1L0YB 2R2QA 4W9HA 1RM6C 2KWVB 4GN1A 3TEZA 3N3KB 4GOCA 4DXAB 2V9HA 2KC2A 4P7IA 3ONSA 5IO9A 2WDRB 2WDTB 2ZPNA 1HZ5A 4EZJA 1BT0A 4AWJA 1TBEA 1YMHE 1J7CA 1X1MA 3Q8CA 1PYWD 3RNGC 1Y56A 3CWIA 2KJRA 3GB1A 3JYUA 3AI5A 3CSFA 3P4PB 4B0EA 1YJIA 3QAQA 2RSUA 2NBVB 2DYBA 1I4QA 2KNBA 5C2TB 2O2VB 5E6NA 1PFDA 2L52A 2BWES 1HA5A 3VAWA 1J7AA 4M01A 2MP2A 3U8ZA 3CSTA 3IT6B 5IN7A 4NAMA 1C9FA 2DYOA 1I4XA 1V2YA 1N6ZA 3TEWA 3OJ3A 2QHOA 1VLBA 2JF5A 4W9JA 1WZ0A 5EDSA 1XCTL 2V4IB 3PHWB 4IC7B 1GPXA 4ZRPA 2IJ0A 3HIZA 4G0NB 1OTRB 1P98A 3ZO5B 5C1ZA 2CJNA 3EA6A 1YN3A 1QF6A 1XLOA 3EUB2 4P1CC 2KYWA 3VDZA 4TQ1A 3Q3NC 2N9XA 2LWPA 4WJPA 2Z0DB 3TBLD 1C79A 4A90A 4OZBA 2WWZA 1NDDA 4KSKC 4MDKE 2LZ6A 3DBRB 3PTFC 3U7ZA 2BT6A 4HXDA 4WURA 4PS7A 3H9DA 1WM2A 1HQRD 1JRPA 4GDKA 1E7PB 2K6QA 3B9JA 2FIDA 2WXHA 1E8WA 3AE6B 1IP9A 4BFRA 3AXCA 2L32A 2J4XA 4AQ7A 2I1JA 3GZNI 3FAHA 4URKA 1KFYB 1KTKA 2KWUB 2D3BA 2PTLA 3TL5A 1WMHB 2N4FA 1WXQA 3OWEB 2PLPA 3ETRA 3KWVA 3EHVA 4C00A 3KWLA 2LJIA 4YSZB 3I5JC 2PKOA 3JW0X 3OLMD 3BVGA 4MJSB 4W9EA 4C80A 1EWYC 3AECB 2L3ZA 3O65B 4LCDE 3VUXA 1TYGB 4MGYE 3N20C 5AUIA 3FILB 1WGDA 3B0AA 2NVUI 4BBNC 1R4MI 2MWSB 4HK2A 1V1PA 2LVOA 2N9LA 2LFIA 1T0RC 3M3JA 1LQBA 4XWTA 2M0XA 1YIWA 4DQOC 1C3TA 2NBUA 1BMLC 3HVZA 4EUTA 4ZRKA 1JQ4A 4C56C 2QEJC 2QC8A 1I4GA 2LRWA 2C9WB 3RNBC 3P63A 4LK0M 4HEA1 3B1LX 4S0RA 1RYJA 3BYTB 3LJ3A 1AWDA 2WLBA 1E6EB 4HROA 4WWNA 1WR6E 1PGBA 1V6EA 1IBXA 1T0YA 1XT9B 5HI1A 1DYQA 3ZNGC 1MHHE 1Z2MA 1V97A 1AN8A 1P1AA 1SGHA 1K50A 4W9FA 4KDIC 4ANXA 3W1SC 2SEBD 4EFOA 3L17A 2GBRA 2JPHA 2ONQA 3VTWA 1TTNA 5I4DA 1E90A 4KX6B 2LVPA 4KSLC 3AEFB 4XX5A 1Q1OA 2WX0A 3RI7C 2KK8A 1OEYA 4NY0A 2ZEQA 4NAWB 1FD6A 1EUVB 4BVUC 3PZDA 1K52A 2K6DB 4M8MA 2INPE 2DZIA 1RWSA 3QARA 2WXMA 3AEBB 3Q6BA 1KJTA 2J0JA 3V60A 3CF6E 3N1YC 3URYA 2D11A 1YN4A 3KQ4A 4DHZE 3ZGZA 3WAMA 5C23A 2BYEA 3PGEA 3BK1A 4IKGA 1WJ4A 4RM8A 3U2SC 2WHIA 2LGDA 4A9AA 2AL3A 2KVZA 3R66C 3BVZA 5J2RA 2EMSA 3GS2A 2LGIA 3LB8C 3TJPA 3DWGC 3WAOA 3AULA 1TKGA 4KZ0A 5H92C 2KTRB 3K9OB 3PVLA 4BKGA 2KKCA 4NPNA 3DBHB 1JWSD 3C8YA 1DGJA 4RH6A 2YEPF 1SIFA 3AMZA 2TSSA 2IO1B 4N59A 1TS4A 1YN5A 4B9KA 1DOIA 1FXTB 2M19A 5IP4D 2GLSA 4GDLB 1WGGA 5GXGB 1SIJA 1AARA 4LNKA 5D94A 1WXSA 1ZKHA 2HJ1A 1PGAA 4EKUA 2HTME 4WJNA 5CX3A 1DOXA 2W82A 3H1UA 3RN9C 1FXIA 1WRIA 1IYFA 1N5XA 2LHDA 3N30A 1S3SG 4C7ZA 4DXGA 1V49A 1KOTA 1WF9A 3RNAC 2YVCA 1OQRA 1PDXA 3Q8BA 4J6IA 4CHKA 3SU8X 1SE4A 2BKFA 3FC4A 3EFUA 3RNCC 3ZDMC 2LRUA 4BZAA 5JHBA 2KT7A 4TSSA 1V81A 4ARCA 2PPHA 4FJZA 4HJGE 2I2YA 1D5ZC 2L76A 5DPRA 2HD5B 3ML9A 2W3RA 4HCNB 3HM6X 1FFVA 5D3IB 3BY4B 1TY2A 1YQ4B 4IM3A 2LXCA 2INDC 3VRAB 2UWQA 4EOYA 3U7DA 2G4DB 2CU1A 1NYRA 4WH4A 1GB1A 5KHQA 4JL9A 3DHGC 2D10A 1VDVA 3JSVA 1V86A 4OVZA 4W9CA 3MC8A 3AE8B 2KD0A 4RGTA 1E10A 2N1WA 3OG5A 4GSWA 2ACZB 4KKIA 1TGZB 2Z8LA 2KDEB 1KLVA 4RGMA 4Q2JA 3AU5A 2JRIB 4S17A 1XQQA 1F9JA 4OHJA 4MT5A 3L13A 4AOFA 5LLIA 1GG3A 4M0WB 4KGRA 3V62A 4M8NA 3NVVA 1HTQA 2MLBA 1ESFA 3NZ3A 2RR9A 1JWMD 1A70A 3EGRA 2DYMA 3ZW3A 1FRDA 1B1ZA 4KVGB 1FFUA 2WXOA 3DBRI 1GB4A 4AJWA 4XZ4A 4K7UA 2I38A 2KX3A 4RNAA 2K8HA 1TIFA 1F1HA 1L0XB 1UELA 4O1NA 4C4VA 1QT9A 2BS4B 2CS4A 5HKHA 4ASWC 4ANWA 5L95C 2N9KA 2KMCA 4AP4C 3P4SB 1WE6A 1TY0A 4KIKB 1J7BA 2KFKB 2BYVE 2LGYA 1C1YB 4KGSA 2PJHA 1EF5A 4ZHPA 1MG4A 5J18A 3W2DA 2H89B 1SJED 1XXGA 1NI2A 2K5PA 4K81A 1E7UA 1F77A 3PHXB 3VH3B 1ZP0B 2JRHA 2KOXA 5IAAC 3W5VB 2MBHA 3P1MA 1QOFA 1C78A 2BS2B 2EKEC 2INCC 4F7ZA 4GB9A 1WXAA 5G55A 1N60A 1DOYA 5IKCM 4A8XC 2INNE 3ZRCA 3PS6A 2KMAA 3RCZA 1L7YA 3P2BA 4ARIA 1WR1A 1J19A 1WIAA 3B08A 2BS3B 3H7SA 4WWMA 5E6JA 3RMKC 4L23A 4ZYSA 4JGHB 1ZUD2 4HVBA 3RNFC 3N1XC 3DPDA 4MGZE 2OJWA 2MP2B 4CO7A 2C7HA 2B76B 4YL8A 3CMMB 3WAPA 4NZLB 5DPTA 2WP9B 4ICUA 2L05A 2JZZA 2LD9A 2RDHA 4I6NB 2JU6X 3ALBA 4YWGG 2NTTA 1KLUD 4NJ7A 1PQSA 4GGQA 1GUAB 2FUG1 4KZCA 4W9GA 2MA9B 4FJVB 3AV8A 1OEYJ 1MI0A 3SDLC 4LNOA 1GNUA 3L10B 3NS8A 2NMQA 1JROA 5G5GA 2NPTB 1A5RA 3IAS1 2QMTA 1FIQA 2RDGA 2JWZA 5FKAC 3PREA 5D6JB 4LJOB 3I9V1 4PYUA 2IO3B 5L83A 4NJ6A 1TKYA 1KLGD 2AYOB 3BZDB 1QILA 2KDBA 1FRRA 1C76A 1ET6A 2JXXA 1YD8U 2HDEA 3E9SA 3ZLZA 3SFEB 4DHJB 1P9DU 2IGDA 3Q8AA 3A9JA 4JPSA 4HJKA 1CMXB 3KYCD 2ASQA 2KFJA 4HDQA 2V3PA 1EF1A 1FPYA 4GDKB 3UIOB 2E3TA 1QOBA 2MJDA 3L16A 3L08A 2IGGA 4TQ0A 2MBQA 4XWWA 2J42A 1CQVA 4EZLA 4L1BA 2KDMA 4HRSA 1Y8RC 2BKRB 1IGCA 2FCSA 3DHHC 1ZDVA 3PT2B 3IXSA 1JWAD 3T9LA 3DBSA 4MGKE 1N5WA 4W9IA 1T5XD 4IM2A 2DBYA 5J17A 2KX0A 3HHMA 2LHEA 1F52A 1NEKB 1WSPA 3A4RA 3PV1A 1ZXIA 2WDVB 1V1PB 3MFGA 2IPKD 1V9JA 2B3AA 3Q2AC 2EELA 4ACFA 5JH5C 1IPGA 1UUPA 3LYYA 2Y5PA 3NRZA 3BWUD 4FJYA 3W5UB 4JIOU 3KW5B 1UWXA 3ZVVA 3AB5A 3X0WA 3QHTA 4B95A 4GU2A 4RGOS 3ZXVA 3IG3A 2KXJA 3UI3A 2J53A 3SHQA 3MHSD 1MFWA 3PPAA 3HVDA 3AEDB 4DBGA 3PZ8A 3UINB 1ZDXA 1ZOYB 1IBXB 3IT4B 2RGFA 4LDTB 1I7HA 4BAXA 4DWFA 5DPSA 5GMVA 1WH3A 4ANUA 5LXIB 1VZ6A 2C5LC 2WXPA 4D2KA 3K9PB 3MJWA 3TEXA 1YX5B 2JQRB 1V8CA 2VZKD 1SXTA 4IWQA 4XYCA 5G5HA 4EE2A 1T0SC 1EU4A 4BKTA 1B9RA 1YX6B 4FLHA 5AZFA 4DDGD 1XEEA 3DWMA 4MH0E 2FCNA 5CTRC 2PW9A 5E6PA 4MELA 4CYEA 2BGFA 4OW0A 1ROEA 3NZUA 1AW7A 1EM7A 2ZCCA 3NG0A 2PE6B 3HUIA 2WXIA 3T3NA 3NZSA 1R4NB 1YQ3B 2MQJA 2MSED 3Q8FA 2GBNA 4HPPA 3ZNZB 4HPLB 2IGHA 1EO6A 1LXDA 4PT5A 1OGWA 2KANA 4K7WA 3A1QB 1D5MC 3ZIMA 3EFCA 1VZ7A 2L0FA 1UD7A 2XK5B 1D6EC 3PO0A 4F8CB 5LXHA 4G11A 3VFKA 1P3QU 2G4SA 3J9CA 2KAJA 1RFAA 4WJQA 5IOIA 2Y5BB 4CQNA 4BKSD 1M4VA 3H6NA 3RUIB 1K53A 2WXFA 3GE8C 1UWMA 2GB1A 1VRAB 1JALA 3RZFA 2R61A 2M56B 3A9KB 3ENEA 3Q8EA 2C60A 1SJHD 2G45B 4B6WA 3IHPC 2KTFA 2W9NA 1HE8A 2WYQA 1KRHA 3WANA 3PRPB 4YTPB 4HLEA 5CHVC 2KDIA 1HZ6A 4US8A 2DAFA 1Z5SB 3AE9B 2MCNB 1WX7A 1L6UA 4WQMA 2VRRB 1EU3A 4XC2A 1N63A 2QJLA 4JQWC 2XBBC 3I3TB 2PE9A 2BB6A 2KQ7A 4IW0A 1YQBA 3GE3C 1ET9A 1WGHA 3WCQA 2JX5A 4YSYB 3T8MA 3R2TA 4OZCA 3VR9B 5JZEB 3IFWB 2ICIA 3U4EG 4AJYB 3V6CB 2NBWB 4NAWA 4RGNA 4YT0B 2XN9C 1WI0A 1MVKA 2ZNVB 3NVWA 3IAM1 1C4CA 3AEAB 3V6EB 3EECA 1GC7A 3V05A 2IO0B 1KM7A 2WDQB 1SE9A 2GI9A 1WZ3A 4HPMB 3P42A 3M63B 2VH2A 2KC1A 2I1KA 5LNK1 1TS3A 3U30A 2CHXA 2D3CA 1XLQA 2LGSA 4USAA 3N1ZC 2K0PA 1WJNA 2IBIB 2Z59B 2O6VD 2BVCA 1F2RC 4TV3A 2ZNVC 1QQRA 5IA7A 4MM3B 4XDCA 5KHOA 1HXYD 3TEYA 3QWZB 3R3MA 3ECIA 1TT5B 1WJUA 4I6LB 4WJOA 4KDLB 1GC6A 2MBBB 2JT4B 3ZQ4A 3QX1A 2J0MA 1P7FA 4B0MA 1XCQL 2AX5A 1P7EA 2M17A 2WXNA 3MJ5A 1TS5A 2BYFA 2K3UA 4PK1A 2LXAA 3JSVB 3RT3B 2LMCA 3AE5B 4C7YA 3L54A 3KVFB 1WYWB 3DQVA 3ZDTA 2KZRA 2WNMA 1MPEA 4W9KA 2DZJA 2KWDA 4WAFA 3ZUNA 3P4QB 1VCBA 2V4LA 3BVMA 2LUEA 5TSSA 4RM9A 5FR6A 4TUUA 3VTVA 4XGAB 2KHWB 2WQYB 4AUQC 4DXFA 1AYFA 4FXCA 1WYGA 3DVGX 1UGMA 3AH7A 2OOBB 4DDID 1EWCA 1LFDA 1Q0WB 1WXVA 5AUKA 4HCPB 1GAQB 4PS8A 2DAJA 3MC9A 1STEA 2MX2A 2L8JA 1RAXA 2V0GA 2UYZB 3S2AA 4REZA 2PEAA 1CJEA 1SE3A 4FA6A 2XEWA 3BK2A 3VHTC 2AWTA 4LNFA 3H7PB 3IBEA 1UBIA 3TIXA 2JYTA 3DVGY 1LM8B 1L2NA 4A20A 2SAKA 1N61A 3NHEB 2MHJA 3RULA 5BYSA 3TUOA 3R7QA 3EC8A 2QSDA 3VVWB 2K25A 4IOIE 3PLVA 1WX8A 1JW9D 1V5OA 1Q10A 3TMPB 3KUZA 3QA8A 4BKSA 1IUEA 2MRPA 5HG2A 4KV2A 3VUWA 3APFA 4WWPA 2L1AA 3ZTDA 1MG8A 3WA0A 4RCOA 2JZPA 1ISNA 3SR6A 4ZRIA 1FCLA 3UGBB 2BBCA 1OQQA 3KH0A 1WGRA 5FR3A 1WWTA 1C77A 1E7VA 1ENFA 2BWFA 1R7SA 2JSVX 4HKQA 2K8CA 1VD2A 1ZW7A 4P16A 1FXAA 4BOZB 3NVZA 1E8ZA 4M0WA 3RZWC 2D07B 1CK1A 3BYYB 4ANVA 1WGKA 1U4AA 1SF0A 3VQIA 4EEWA 4QAYA 1I4RA 2DENB 2WXRA 5FK9C 2LEKA 5JXVA 3CIRB 2W54A 5EE9A 5BMHA 4NQLB 3PRZA 4OVUA 4FHKA 4PYZA 4LNNA 4YXDB 5E6OA 3TCAA 2KMMA 4IG7B 3VUYA 2CJOA 3NVYA 1L6VA 2KQSA 3NS1A 1WXMA 1NBFC 3WALA 3X23A 2OEDA 1KH0A 2LGXA 2DNFA 2O6VA 1XD3B 4IWPA 2KFKA 3VTUA 3KUDB 3VRBB 3DVNV 2J7QB 3C0RB 4P1BC 1R4NI 2CU3A 2RD0A 4BOSC 2DHZA 3IVFA 3FKYA 2V3SA 3B2FA 2C7MB 4FHJA 4M00A 3QK0A 2IO2B 2RDBC 3H8HA 4A3OA 4RFBA 4IUMB 5JHAA 2FBWB 4II2B 2IZVB 4ZRQA 2M4NA 1GJZA 2D2QA 2K22A 1ZPSA 3A9JB 2H88B 2JXTA 2KN4A 2JVCA 3W1YA 3NOBA 1I4HA 3PLUA 1D4BA 2K9XA 2KJHB 4OVVA 2CR5A 4BBNF 1XLNA 4ZOHC 1P0RA 2WXLA 1J8CA 1UGJA 2GRIA 4H2AA 2M8SA 1LO5D 2GOWA 4MSQB 4WQOB 1G6JA 1XF5L 3HK0A 3VXWA 1HTOA 1T6BX 1SB3C 4N9F4 1D5XC 1FMAD 4G3XB 4F1SA 2KLCA 2LI5A 2IDYA 1M94A 2FNJB 1ZGUB 3C19A 4NNJB 2G3QB 4WIPA 4AS1A 5DCNA 1MJDA 2KLGA 3D32A 3Q14C 4II3B 1C4AA 2Y3AA 1VZ8A 2A5UA 3UIPB 4NJCA 3UQBA 1ZE3D 1SSNA 5G2NA 1TKEA 4IWOA 2MBOA 4ZDVA 5CHFA 2KACA 3JVZX 1WM3A 1FNVA 2O2VA 1SEBD 4LJPB 3KYDD 3R7RA 1K51A 3DBHI 4J3OD 4ITKA 1UF0A 2IY0B 2MBEA 4TKNA 4DK5A 1FM0D 2QILA 2R2OA 5AEKB 1RRBA 4X57B 2NPTA 2M1MA 2Z0EB 1F2RI 3N9YC 3ZJVA 5TR5A 4NQKE 2D3AA 1RFKA 4YTNB 1T0QC 1UNSA 3PRMB 4A3PA 3ZTCA 1UH6A 3OAWA 1OQYA 4R3DA 4FBJB 2GBJA 5EE1A 3P4RB 2G1EA 3Q3OC 3R2IA 2K8BA 2NTSA 3L0WB 2WU5B 2ZVNA 5HFYA 2X38A 1YJ1A 5D3DA 2VH1A 4YSXB 2J52A 2ZCBA 5T8IA 2ZJDA 3M95A 3QCAA 3ZYYX 1FNUA 5D2MB 2ZZPB 4A6QA 4DHZB 4US9A 1WE7A 2DZKA 1S1QB 2PVOD 2ZVOA 4FULA 5C3JB 2WGSA 3A4SC 2GBMA 3PSEB 1TZOA 5CHWA 5BYQA 3ZRFA 4E71A 4GIVA 2KO3A 3QQ8B 3HRDD 2GBKA 1TJEA 3T3OA 1QOGA 2L7RA 2RPQA 2WXGA 1OFFA 3NUHB 2WXJA 4N6EB 4UDUC 1QOAA 4FADA 1D3ZA 1L4ZB 3AN1A 4EZKA 4G50A 1WMHA 2W55A 4L2YA 2MW5A 4KKJA 2FUHB 1QLBB 3DBLB 2M0AA 4GMVA 2REXA 1NENB 4MJSA 3M62B 2PIAA 2X8XX 3V3XA 2N1VA 3GP7A 4MH8A 2PMVA 2XNAC 3DVNU 2LUMA 3FILA 3OJ4B 4JWSC 2FCQA 2HE7A 1L5PA 2IYDB 2NCNA 2PVGC 3BIID 1QKZA 3VR8B 2ZW0A 1SBBB 5D7GA 1UZXB 3AU4A 1XO3A 3ZNID
chains in the Genus database with same CATH topology
3RNAC 3I5JC 4P1BC 1T0RC 3DHGC 1T0QC 3I63C 3DHIC 3RN9C 3RNGC 3RNCC 3GE8C 2INCC 3RMKC 3N1ZC 3N1YC 3DHHC 2RDBC 4P1CC 3Q3OC 3Q3MC 3RNEC 3N20C 3RI7C 3Q3NC 3RNFC 3GE3C 1T0SC 3N1XC 3Q2AC 3RNBC 3Q14C 2INDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNA C;  3I5J C;  4P1B C;  1T0R C;  3DHG C;  1T0Q C;  3I63 C;  3DHI C;  3RN9 C;  3RNG C;  3RNC C;  3GE8 C;  2INC C;  3RMK C;  3N1Z C;  3N1Y C;  3DHH C;  2RDB C;  4P1C C;  3Q3O C;  3Q3M C;  3RNE C;  3N20 C;  3RI7 C;  3Q3N C;  3RNF C;  3GE3 C;  1T0S C;  3N1X C;  3Q2A C;  3RNB C;  3Q14 C;  2IND C; 
#chains in the Genus database with same CATH topology
 1VR9 A;  4LNI A;  2D5G A;  2WU2 B;  3W1S A;  2BW2 A;  5BMI A;  3MC0 B;  3RD2 A;  1E0Z A;  2ZW1 A;  3KLS X;  2MEK A;  1PUT A;  2G9H D;  3I57 A;  1L4D B;  2N9E B;  2AEH A;  2AQ3 B;  4JWU C;  5BO4 B;  4GLS C;  1FEH A;  3WIM A;  2V3N A;  5BYR A;  5BMG A;  1I42 A;  3NJT A;  1I4P A;  2L0T A;  4ICV A;  2L83 A;  3O13 A;  4YTM B;  2D3G A;  2ZPY A;  3MHZ A;  3SD5 A;  1H8C A;  4I6P A;  4A55 A;  3ZXR A;  2WXK A;  2JUO A;  5HHD G;  3DOW A;  3A1Q A;  2FIF A;  2KJ6 A;  2N9P C;  4JX1 C;  2IY1 B;  2N7E A;  4WWO A;  4PS3 A;  3AM9 A;  3AE7 B;  1FO4 A;  2XK5 A;  4GXB A;  2ON8 A;  1V1O A;  2WX1 A;  2WXQ A;  4HKZ E;  3E56 A;  2AQ1 B;  4WAA A;  3Q3J A;  1V5T A;  2WS3 B;  2LJ5 A;  2N7D A;  3AE4 B;  3A9K A;  1TS2 A;  1XLP A;  4JLC A;  2JY6 A;  1JML A;  2AQ2 B;  3MP9 A;  3MTN B;  3VH4 B;  1YJJ A;  2MH7 A;  3AEG B;  3BIN A;  3GOE A;  1NYQ A;  2LAS A;  2HTH A;  2LVQ A;  3ML8 A;  2EKI A;  4M02 A;  2FAZ A;  2JYE A;  3GZN B;  4W9L A;  2KTR A;  3APC A;  1JWB D;  2VZK B;  4LLG M;  3ZJT A;  4RF0 A;  4MGI E;  5DPW A;  1N62 A;  5H8Y E;  1KF6 B;  1JWU D;  1ZXH A;  1ACC A;  2YLM A;  4TMA B;  5MPO A;  1LGR A;  2AL6 A;  2DWQ A;  2NS5 A;  4GDL A;  2N7J A;  1R4M B;  4K3C A;  3AE2 B;  2EMT A;  1FNW A;  1WFY A;  4MEM A;  1TZ1 A;  2JWU A;  3Q3F A;  4XE0 A;  1WY8 A;  5EE0 A;  1BXT A;  3SEB A;  4ZHO A;  3RYT A;  2V1Y A;  4K1R B;  4K3B A;  2HJ8 A;  3TSS A;  3SFD B;  2YEP B;  3LXF A;  1L0V B;  4ZYN A;  4KGT A;  4MM3 A;  2E6X A;  2KVR A;  4HDO A;  3DHI C;  1F0Z A;  2BYT A;  1MHX A;  3UQA A;  4JE3 B;  3NY5 A;  2MJE A;  2QCZ A;  3Q3M C;  2FCM A;  4ZRJ A;  1NI3 A;  1YOV B;  3Q69 A;  1RLF A;  3R8B A;  3UF8 A;  4RMA A;  3PZ7 A;  2A4Z A;  2MJ3 A;  1WGY A;  2CHW A;  3ZKJ C;  4K7S A;  4P6V F;  1E8X A;  1WJ6 A;  4C4V B;  2KN5 A;  1Q5W B;  2BQQ A;  1NVI D;  4OZA A;  2W3S A;  2JZ3 B;  4XDD A;  1FCC C;  1K8R B;  2BF8 B;  3RPF C;  2CKH B;  4IM0 A;  1JCK B;  3I63 C;  1BUI C;  1E8Y A;  3AE3 B;  3DCG A;  2FE8 A;  2N0S B;  4DHJ D;  2K39 A;  1IGD A;  3APD A;  2RPV A;  2GMI C;  2DLB A;  4N58 A;  2QIE B;  4RF1 A;  4E74 A;  1WX9 A;  1E9M A;  3V61 A;  2BPS A;  1QZE A;  2OJR A;  1YNT E;  1HEZ E;  3N32 A;  2OHF A;  3ABV B;  1H4R A;  5EE3 A;  3H7P A;  2RMM A;  3A33 B;  5AZG A;  3B2G A;  4FN2 A;  1PGX A;  1CZP A;  1GOZ A;  2K1F A;  1I35 A;  1C4P A;  3ZJU A;  1VJK A;  2Y5C A;  3W9C B;  2UU7 A;  3L4P A;  2O6V B;  1UBQ A;  4MSM B;  2C7N B;  1E5W A;  3U52 E;  3QJZ A;  2CHZ A;  3QIJ A;  1J0G A;  1V80 A;  5AZH A;  1T3Q A;  2KWC A;  2L00 B;  3AEE B;  3AE1 B;  2DZM A;  4HWI B;  3RFZ B;  3QC8 B;  1SE2 A;  3LDZ E;  3DDC B;  3RNE C;  4KIK A;  3KUC B;  4MAC A;  1JRU A;  4E3C A;  2DX5 B;  2BTE A;  3DBL I;  2KDF B;  1WRD B;  3ZNH B;  2QDF A;  3HM3 A;  4LTU A;  4IDI A;  2BB5 A;  4W9D A;  2J0K A;  2KQ4 X;  2NR2 A;  4LDT D;  2Q5W D;  1L0Y B;  2R2Q A;  4W9H A;  1RM6 C;  2KWV B;  4GN1 A;  3TEZ A;  3N3K B;  4GOC A;  4DXA B;  2V9H A;  2KC2 A;  4P7I A;  3ONS A;  5IO9 A;  2WDR B;  2WDT B;  2ZPN A;  1HZ5 A;  4EZJ A;  1BT0 A;  4AWJ A;  1TBE A;  1YMH E;  1J7C A;  1X1M A;  3Q8C A;  1PYW D;  3RNG C;  1Y56 A;  3CWI A;  2KJR A;  3GB1 A;  3JYU A;  3AI5 A;  3CSF A;  3P4P B;  4B0E A;  1YJI A;  3QAQ A;  2RSU A;  2NBV B;  2DYB A;  1I4Q A;  2KNB A;  5C2T B;  2O2V B;  5E6N A;  1PFD A;  2L52 A;  2BWE S;  1HA5 A;  3VAW A;  1J7A A;  4M01 A;  2MP2 A;  3U8Z A;  3CST A;  3IT6 B;  5IN7 A;  4NAM A;  1C9F A;  2DYO A;  1I4X A;  1V2Y A;  1N6Z A;  3TEW A;  3OJ3 A;  2QHO A;  1VLB A;  2JF5 A;  4W9J A;  1WZ0 A;  5EDS A;  1XCT L;  2V4I B;  3PHW B;  4IC7 B;  1GPX A;  4ZRP A;  2IJ0 A;  3HIZ A;  4G0N B;  1OTR B;  1P98 A;  3ZO5 B;  5C1Z A;  2CJN A;  3EA6 A;  1YN3 A;  1QF6 A;  1XLO A;  3EUB 2;  4P1C C;  2KYW A;  3VDZ A;  4TQ1 A;  3Q3N C;  2N9X A;  2LWP A;  4WJP A;  2Z0D B;  3TBL D;  1C79 A;  4A90 A;  4OZB A;  2WWZ A;  1NDD A;  4KSK C;  4MDK E;  2LZ6 A;  3DBR B;  3PTF C;  3U7Z A;  2BT6 A;  4HXD A;  4WUR A;  4PS7 A;  3H9D A;  1WM2 A;  1HQR D;  1JRP A;  4GDK A;  1E7P B;  2K6Q A;  3B9J A;  2FID A;  2WXH A;  1E8W A;  3AE6 B;  1IP9 A;  4BFR A;  3AXC A;  2L32 A;  2J4X A;  4AQ7 A;  2I1J A;  3GZN I;  3FAH A;  4URK A;  1KFY B;  1KTK A;  2KWU B;  2D3B A;  2PTL A;  3TL5 A;  1WMH B;  2N4F A;  1WXQ A;  3OWE B;  2PLP A;  3ETR A;  3KWV A;  3EHV A;  4C00 A;  3KWL A;  2LJI A;  4YSZ B;  3I5J C;  2PKO A;  3JW0 X;  3OLM D;  3BVG A;  4MJS B;  4W9E A;  4C80 A;  1EWY C;  3AEC B;  2L3Z A;  3O65 B;  4LCD E;  3VUX A;  1TYG B;  4MGY E;  3N20 C;  5AUI A;  3FIL B;  1WGD A;  3B0A A;  2NVU I;  4BBN C;  1R4M I;  2MWS B;  4HK2 A;  1V1P A;  2LVO A;  2N9L A;  2LFI A;  1T0R C;  3M3J A;  1LQB A;  4XWT A;  2M0X A;  1YIW A;  4DQO C;  1C3T A;  2NBU A;  1BML C;  3HVZ A;  4EUT A;  4ZRK A;  1JQ4 A;  4C56 C;  2QEJ C;  2QC8 A;  1I4G A;  2LRW A;  2C9W B;  3RNB C;  3P63 A;  4LK0 M;  4HEA 1;  3B1L X;  4S0R A;  1RYJ A;  3BYT B;  3LJ3 A;  1AWD A;  2WLB A;  1E6E B;  4HRO A;  4WWN A;  1WR6 E;  1PGB A;  1V6E A;  1IBX A;  1T0Y A;  1XT9 B;  5HI1 A;  1DYQ A;  3ZNG C;  1MHH E;  1Z2M A;  1V97 A;  1AN8 A;  1P1A A;  1SGH A;  1K50 A;  4W9F A;  4KDI C;  4ANX A;  3W1S C;  2SEB D;  4EFO A;  3L17 A;  2GBR A;  2JPH A;  2ONQ A;  3VTW A;  1TTN A;  5I4D A;  1E90 A;  4KX6 B;  2LVP A;  4KSL C;  3AEF B;  4XX5 A;  1Q1O A;  2WX0 A;  3RI7 C;  2KK8 A;  1OEY A;  4NY0 A;  2ZEQ A;  4NAW B;  1FD6 A;  1EUV B;  4BVU C;  3PZD A;  1K52 A;  2K6D B;  4M8M A;  2INP E;  2DZI A;  1RWS A;  3QAR A;  2WXM A;  3AEB B;  3Q6B A;  1KJT A;  2J0J A;  3V60 A;  3CF6 E;  3N1Y C;  3URY A;  2D11 A;  1YN4 A;  3KQ4 A;  4DHZ E;  3ZGZ A;  3WAM A;  5C23 A;  2BYE A;  3PGE A;  3BK1 A;  4IKG A;  1WJ4 A;  4RM8 A;  3U2S C;  2WHI A;  2LGD A;  4A9A A;  2AL3 A;  2KVZ A;  3R66 C;  3BVZ A;  5J2R A;  2EMS A;  3GS2 A;  2LGI A;  3LB8 C;  3TJP A;  3DWG C;  3WAO A;  3AUL A;  1TKG A;  4KZ0 A;  5H92 C;  2KTR B;  3K9O B;  3PVL A;  4BKG A;  2KKC A;  4NPN A;  3DBH B;  1JWS D;  3C8Y A;  1DGJ A;  4RH6 A;  2YEP F;  1SIF A;  3AMZ A;  2TSS A;  2IO1 B;  4N59 A;  1TS4 A;  1YN5 A;  4B9K A;  1DOI A;  1FXT B;  2M19 A;  5IP4 D;  2GLS A;  4GDL B;  1WGG A;  5GXG B;  1SIJ A;  1AAR A;  4LNK A;  5D94 A;  1WXS A;  1ZKH A;  2HJ1 A;  1PGA A;  4EKU A;  2HTM E;  4WJN A;  5CX3 A;  1DOX A;  2W82 A;  3H1U A;  3RN9 C;  1FXI A;  1WRI A;  1IYF A;  1N5X A;  2LHD A;  3N30 A;  1S3S G;  4C7Z A;  4DXG A;  1V49 A;  1KOT A;  1WF9 A;  3RNA C;  2YVC A;  1OQR A;  1PDX A;  3Q8B A;  4J6I A;  4CHK A;  3SU8 X;  1SE4 A;  2BKF A;  3FC4 A;  3EFU A;  3RNC C;  3ZDM C;  2LRU A;  4BZA A;  5JHB A;  2KT7 A;  4TSS A;  1V81 A;  4ARC A;  2PPH A;  4FJZ A;  4HJG E;  2I2Y A;  1D5Z C;  2L76 A;  5DPR A;  2HD5 B;  3ML9 A;  2W3R A;  4HCN B;  3HM6 X;  1FFV A;  5D3I B;  3BY4 B;  1TY2 A;  1YQ4 B;  4IM3 A;  2LXC A;  2IND C;  3VRA B;  2UWQ A;  4EOY A;  3U7D A;  2G4D B;  2CU1 A;  1NYR A;  4WH4 A;  1GB1 A;  5KHQ A;  4JL9 A;  3DHG C;  2D10 A;  1VDV A;  3JSV A;  1V86 A;  4OVZ A;  4W9C A;  3MC8 A;  3AE8 B;  2KD0 A;  4RGT A;  1E10 A;  2N1W A;  3OG5 A;  4GSW A;  2ACZ B;  4KKI A;  1TGZ B;  2Z8L A;  2KDE B;  1KLV A;  4RGM A;  4Q2J A;  3AU5 A;  2JRI B;  4S17 A;  1XQQ A;  1F9J A;  4OHJ A;  4MT5 A;  3L13 A;  4AOF A;  5LLI A;  1GG3 A;  4M0W B;  4KGR A;  3V62 A;  4M8N A;  3NVV A;  1HTQ A;  2MLB A;  1ESF A;  3NZ3 A;  2RR9 A;  1JWM D;  1A70 A;  3EGR A;  2DYM A;  3ZW3 A;  1FRD A;  1B1Z A;  4KVG B;  1FFU A;  2WXO A;  3DBR I;  1GB4 A;  4AJW A;  4XZ4 A;  4K7U A;  2I38 A;  2KX3 A;  4RNA A;  2K8H A;  1TIF A;  1F1H A;  1L0X B;  1UEL A;  4O1N A;  4C4V A;  1QT9 A;  2BS4 B;  2CS4 A;  5HKH A;  4ASW C;  4ANW A;  5L95 C;  2N9K A;  2KMC A;  4AP4 C;  3P4S B;  1WE6 A;  1TY0 A;  4KIK B;  1J7B A;  2KFK B;  2BYV E;  2LGY A;  1C1Y B;  4KGS A;  2PJH A;  1EF5 A;  4ZHP A;  1MG4 A;  5J18 A;  3W2D A;  2H89 B;  1SJE D;  1XXG A;  1NI2 A;  2K5P A;  4K81 A;  1E7U A;  1F77 A;  3PHX B;  3VH3 B;  1ZP0 B;  2JRH A;  2KOX A;  5IAA C;  3W5V B;  2MBH A;  3P1M A;  1QOF A;  1C78 A;  2BS2 B;  2EKE C;  2INC C;  4F7Z A;  4GB9 A;  1WXA A;  5G55 A;  1N60 A;  1DOY A;  5IKC M;  4A8X C;  2INN E;  3ZRC A;  3PS6 A;  2KMA A;  3RCZ A;  1L7Y A;  3P2B A;  4ARI A;  1WR1 A;  1J19 A;  1WIA A;  3B08 A;  2BS3 B;  3H7S A;  4WWM A;  5E6J A;  3RMK C;  4L23 A;  4ZYS A;  4JGH B;  1ZUD 2;  4HVB A;  3RNF C;  3N1X C;  3DPD A;  4MGZ E;  2OJW A;  2MP2 B;  4CO7 A;  2C7H A;  2B76 B;  4YL8 A;  3CMM B;  3WAP A;  4NZL B;  5DPT A;  2WP9 B;  4ICU A;  2L05 A;  2JZZ A;  2LD9 A;  2RDH A;  4I6N B;  2JU6 X;  3ALB A;  4YWG G;  2NTT A;  1KLU D;  4NJ7 A;  1PQS A;  4GGQ A;  1GUA B;  2FUG 1;  4KZC A;  4W9G A;  2MA9 B;  4FJV B;  3AV8 A;  1OEY J;  1MI0 A;  3SDL C;  4LNO A;  1GNU A;  3L10 B;  3NS8 A;  2NMQ A;  1JRO A;  5G5G A;  2NPT B;  1A5R A;  3IAS 1;  2QMT A;  1FIQ A;  2RDG A;  2JWZ A;  5FKA C;  3PRE A;  5D6J B;  4LJO B;  3I9V 1;  4PYU A;  2IO3 B;  5L83 A;  4NJ6 A;  1TKY A;  1KLG D;  2AYO B;  3BZD B;  1QIL A;  2KDB A;  1FRR A;  1C76 A;  1ET6 A;  2JXX A;  1YD8 U;  2HDE A;  3E9S A;  3ZLZ A;  3SFE B;  4DHJ B;  1P9D U;  2IGD A;  3Q8A A;  3A9J A;  4JPS A;  4HJK A;  1CMX B;  3KYC D;  2ASQ A;  2KFJ A;  4HDQ A;  2V3P A;  1EF1 A;  1FPY A;  4GDK B;  3UIO B;  2E3T A;  1QOB A;  2MJD A;  3L16 A;  3L08 A;  2IGG A;  4TQ0 A;  2MBQ A;  4XWW A;  2J42 A;  1CQV A;  4EZL A;  4L1B A;  2KDM A;  4HRS A;  1Y8R C;  2BKR B;  1IGC A;  2FCS A;  3DHH C;  1ZDV A;  3PT2 B;  3IXS A;  1JWA D;  3T9L A;  3DBS A;  4MGK E;  1N5W A;  4W9I A;  1T5X D;  4IM2 A;  2DBY A;  5J17 A;  2KX0 A;  3HHM A;  2LHE A;  1F52 A;  1NEK B;  1WSP A;  3A4R A;  3PV1 A;  1ZXI A;  2WDV B;  1V1P B;  3MFG A;  2IPK D;  1V9J A;  2B3A A;  3Q2A C;  2EEL A;  4ACF A;  5JH5 C;  1IPG A;  1UUP A;  3LYY A;  2Y5P A;  3NRZ A;  3BWU D;  4FJY A;  3W5U B;  4JIO U;  3KW5 B;  1UWX A;  3ZVV A;  3AB5 A;  3X0W A;  3QHT A;  4B95 A;  4GU2 A;  4RGO S;  3ZXV A;  3IG3 A;  2KXJ A;  3UI3 A;  2J53 A;  3SHQ A;  3MHS D;  1MFW A;  3PPA A;  3HVD A;  3AED B;  4DBG A;  3PZ8 A;  3UIN B;  1ZDX A;  1ZOY B;  1IBX B;  3IT4 B;  2RGF A;  4LDT B;  1I7H A;  4BAX A;  4DWF A;  5DPS A;  5GMV A;  1WH3 A;  4ANU A;  5LXI B;  1VZ6 A;  2C5L C;  2WXP A;  4D2K A;  3K9P B;  3MJW A;  3TEX A;  1YX5 B;  2JQR B;  1V8C A;  2VZK D;  1SXT A;  4IWQ A;  4XYC A;  5G5H A;  4EE2 A;  1T0S C;  1EU4 A;  4BKT A;  1B9R A;  1YX6 B;  4FLH A;  5AZF A;  4DDG D;  1XEE A;  3DWM A;  4MH0 E;  2FCN A;  5CTR C;  2PW9 A;  5E6P A;  4MEL A;  4CYE A;  2BGF A;  4OW0 A;  1ROE A;  3NZU A;  1AW7 A;  1EM7 A;  2ZCC A;  3NG0 A;  2PE6 B;  3HUI A;  2WXI A;  3T3N A;  3NZS A;  1R4N B;  1YQ3 B;  2MQJ A;  2MSE D;  3Q8F A;  2GBN A;  4HPP A;  3ZNZ B;  4HPL B;  2IGH A;  1EO6 A;  1LXD A;  4PT5 A;  1OGW A;  2KAN A;  4K7W A;  3A1Q B;  1D5M C;  3ZIM A;  3EFC A;  1VZ7 A;  2L0F A;  1UD7 A;  2XK5 B;  1D6E C;  3PO0 A;  4F8C B;  5LXH A;  4G11 A;  3VFK A;  1P3Q U;  2G4S A;  3J9C A;  2KAJ A;  1RFA A;  4WJQ A;  5IOI A;  2Y5B B;  4CQN A;  4BKS D;  1M4V A;  3H6N A;  3RUI B;  1K53 A;  2WXF A;  3GE8 C;  1UWM A;  2GB1 A;  1VRA B;  1JAL A;  3RZF A;  2R61 A;  2M56 B;  3A9K B;  3ENE A;  3Q8E A;  2C60 A;  1SJH D;  2G45 B;  4B6W A;  3IHP C;  2KTF A;  2W9N A;  1HE8 A;  2WYQ A;  1KRH A;  3WAN A;  3PRP B;  4YTP B;  4HLE A;  5CHV C;  2KDI A;  1HZ6 A;  4US8 A;  2DAF A;  1Z5S B;  3AE9 B;  2MCN B;  1WX7 A;  1L6U A;  4WQM A;  2VRR B;  1EU3 A;  4XC2 A;  1N63 A;  2QJL A;  4JQW C;  2XBB C;  3I3T B;  2PE9 A;  2BB6 A;  2KQ7 A;  4IW0 A;  1YQB A;  3GE3 C;  1ET9 A;  1WGH A;  3WCQ A;  2JX5 A;  4YSY B;  3T8M A;  3R2T A;  4OZC A;  3VR9 B;  5JZE B;  3IFW B;  2ICI A;  3U4E G;  4AJY B;  3V6C B;  2NBW B;  4NAW A;  4RGN A;  4YT0 B;  2XN9 C;  1WI0 A;  1MVK A;  2ZNV B;  3NVW A;  3IAM 1;  1C4C A;  3AEA B;  3V6E B;  3EEC A;  1GC7 A;  3V05 A;  2IO0 B;  1KM7 A;  2WDQ B;  1SE9 A;  2GI9 A;  1WZ3 A;  4HPM B;  3P42 A;  3M63 B;  2VH2 A;  2KC1 A;  2I1K A;  5LNK 1;  1TS3 A;  3U30 A;  2CHX A;  2D3C A;  1XLQ A;  2LGS A;  4USA A;  3N1Z C;  2K0P A;  1WJN A;  2IBI B;  2Z59 B;  2O6V D;  2BVC A;  1F2R C;  4TV3 A;  2ZNV C;  1QQR A;  5IA7 A;  4MM3 B;  4XDC A;  5KHO A;  1HXY D;  3TEY A;  3QWZ B;  3R3M A;  3ECI A;  1TT5 B;  1WJU A;  4I6L B;  4WJO A;  4KDL B;  1GC6 A;  2MBB B;  2JT4 B;  3ZQ4 A;  3QX1 A;  2J0M A;  1P7F A;  4B0M A;  1XCQ L;  2AX5 A;  1P7E A;  2M17 A;  2WXN A;  3MJ5 A;  1TS5 A;  2BYF A;  2K3U A;  4PK1 A;  2LXA A;  3JSV B;  3RT3 B;  2LMC A;  3AE5 B;  4C7Y A;  3L54 A;  3KVF B;  1WYW B;  3DQV A;  3ZDT A;  2KZR A;  2WNM A;  1MPE A;  4W9K A;  2DZJ A;  2KWD A;  4WAF A;  3ZUN A;  3P4Q B;  1VCB A;  2V4L A;  3BVM A;  2LUE A;  5TSS A;  4RM9 A;  5FR6 A;  4TUU A;  3VTV A;  4XGA B;  2KHW B;  2WQY B;  4AUQ C;  4DXF A;  1AYF A;  4FXC A;  1WYG A;  3DVG X;  1UGM A;  3AH7 A;  2OOB B;  4DDI D;  1EWC A;  1LFD A;  1Q0W B;  1WXV A;  5AUK A;  4HCP B;  1GAQ B;  4PS8 A;  2DAJ A;  3MC9 A;  1STE A;  2MX2 A;  2L8J A;  1RAX A;  2V0G A;  2UYZ B;  3S2A A;  4REZ A;  2PEA A;  1CJE A;  1SE3 A;  4FA6 A;  2XEW A;  3BK2 A;  3VHT C;  2AWT A;  4LNF A;  3H7P B;  3IBE A;  1UBI A;  3TIX A;  2JYT A;  3DVG Y;  1LM8 B;  1L2N A;  4A20 A;  2SAK A;  1N61 A;  3NHE B;  2MHJ A;  3RUL A;  5BYS A;  3TUO A;  3R7Q A;  3EC8 A;  2QSD A;  3VVW B;  2K25 A;  4IOI E;  3PLV A;  1WX8 A;  1JW9 D;  1V5O A;  1Q10 A;  3TMP B;  3KUZ A;  3QA8 A;  4BKS A;  1IUE A;  2MRP A;  5HG2 A;  4KV2 A;  3VUW A;  3APF A;  4WWP A;  2L1A A;  3ZTD A;  1MG8 A;  3WA0 A;  4RCO A;  2JZP A;  1ISN A;  3SR6 A;  4ZRI A;  1FCL A;  3UGB B;  2BBC A;  1OQQ A;  3KH0 A;  1WGR A;  5FR3 A;  1WWT A;  1C77 A;  1E7V A;  1ENF A;  2BWF A;  1R7S A;  2JSV X;  4HKQ A;  2K8C A;  1VD2 A;  1ZW7 A;  4P16 A;  1FXA A;  4BOZ B;  3NVZ A;  1E8Z A;  4M0W A;  3RZW C;  2D07 B;  1CK1 A;  3BYY B;  4ANV A;  1WGK A;  1U4A A;  1SF0 A;  3VQI A;  4EEW A;  4QAY A;  1I4R A;  2DEN B;  2WXR A;  5FK9 C;  2LEK A;  5JXV A;  3CIR B;  2W54 A;  5EE9 A;  5BMH A;  4NQL B;  3PRZ A;  4OVU A;  4FHK A;  4PYZ A;  4LNN A;  4YXD B;  5E6O A;  3TCA A;  2KMM A;  4IG7 B;  3VUY A;  2CJO A;  3NVY A;  1L6V A;  2KQS A;  3NS1 A;  1WXM A;  1NBF C;  3WAL A;  3X23 A;  2OED A;  1KH0 A;  2LGX A;  2DNF A;  2O6V A;  1XD3 B;  4IWP A;  2KFK A;  3VTU A;  3KUD B;  3VRB B;  3DVN V;  2J7Q B;  3C0R B;  4P1B C;  1R4N I;  2CU3 A;  2RD0 A;  4BOS C;  2DHZ A;  3IVF A;  3FKY A;  2V3S A;  3B2F A;  2C7M B;  4FHJ A;  4M00 A;  3QK0 A;  2IO2 B;  2RDB C;  3H8H A;  4A3O A;  4RFB A;  4IUM B;  5JHA A;  2FBW B;  4II2 B;  2IZV B;  4ZRQ A;  2M4N A;  1GJZ A;  2D2Q A;  2K22 A;  1ZPS A;  3A9J B;  2H88 B;  2JXT A;  2KN4 A;  2JVC A;  3W1Y A;  3NOB A;  1I4H A;  3PLU A;  1D4B A;  2K9X A;  2KJH B;  4OVV A;  2CR5 A;  4BBN F;  1XLN A;  4ZOH C;  1P0R A;  2WXL A;  1J8C A;  1UGJ A;  2GRI A;  4H2A A;  2M8S A;  1LO5 D;  2GOW A;  4MSQ B;  4WQO B;  1G6J A;  1XF5 L;  3HK0 A;  3VXW A;  1HTO A;  1T6B X;  1SB3 C;  4N9F 4;  1D5X C;  1FMA D;  4G3X B;  4F1S A;  2KLC A;  2LI5 A;  2IDY A;  1M94 A;  2FNJ B;  1ZGU B;  3C19 A;  4NNJ B;  2G3Q B;  4WIP A;  4AS1 A;  5DCN A;  1MJD A;  2KLG A;  3D32 A;  3Q14 C;  4II3 B;  1C4A A;  2Y3A A;  1VZ8 A;  2A5U A;  3UIP B;  4NJC A;  3UQB A;  1ZE3 D;  1SSN A;  5G2N A;  1TKE A;  4IWO A;  2MBO A;  4ZDV A;  5CHF A;  2KAC A;  3JVZ X;  1WM3 A;  1FNV A;  2O2V A;  1SEB D;  4LJP B;  3KYD D;  3R7R A;  1K51 A;  3DBH I;  4J3O D;  4ITK A;  1UF0 A;  2IY0 B;  2MBE A;  4TKN A;  4DK5 A;  1FM0 D;  2QIL A;  2R2O A;  5AEK B;  1RRB A;  4X57 B;  2NPT A;  2M1M A;  2Z0E B;  1F2R I;  3N9Y C;  3ZJV A;  5TR5 A;  4NQK E;  2D3A A;  1RFK A;  4YTN B;  1T0Q C;  1UNS A;  3PRM B;  4A3P A;  3ZTC A;  1UH6 A;  3OAW A;  1OQY A;  4R3D A;  4FBJ B;  2GBJ A;  5EE1 A;  3P4R B;  2G1E A;  3Q3O C;  3R2I A;  2K8B A;  2NTS A;  3L0W B;  2WU5 B;  2ZVN A;  5HFY A;  2X38 A;  1YJ1 A;  5D3D A;  2VH1 A;  4YSX B;  2J52 A;  2ZCB A;  5T8I A;  2ZJD A;  3M95 A;  3QCA A;  3ZYY X;  1FNU A;  5D2M B;  2ZZP B;  4A6Q A;  4DHZ B;  4US9 A;  1WE7 A;  2DZK A;  1S1Q B;  2PVO D;  2ZVO A;  4FUL A;  5C3J B;  2WGS A;  3A4S C;  2GBM A;  3PSE B;  1TZO A;  5CHW A;  5BYQ A;  3ZRF A;  4E71 A;  4GIV A;  2KO3 A;  3QQ8 B;  3HRD D;  2GBK A;  1TJE A;  3T3O A;  1QOG A;  2L7R A;  2RPQ A;  2WXG A;  1OFF A;  3NUH B;  2WXJ A;  4N6E B;  4UDU C;  1QOA A;  4FAD A;  1D3Z A;  1L4Z B;  3AN1 A;  4EZK A;  4G50 A;  1WMH A;  2W55 A;  4L2Y A;  2MW5 A;  4KKJ A;  2FUH B;  1QLB B;  3DBL B;  2M0A A;  4GMV A;  2REX A;  1NEN B;  4MJS A;  3M62 B;  2PIA A;  2X8X X;  3V3X A;  2N1V A;  3GP7 A;  4MH8 A;  2PMV A;  2XNA C;  3DVN U;  2LUM A;  3FIL A;  3OJ4 B;  4JWS C;  2FCQ A;  2HE7 A;  1L5P A;  2IYD B;  2NCN A;  2PVG C;  3BII D;  1QKZ A;  3VR8 B;  2ZW0 A;  1SBB B;  5D7G A;  1UZX B;  3AU4 A;  1XO3 A;  3ZNI D; 
#chains in the Genus database with same CATH homology
 3RNA C;  3I5J C;  4P1B C;  1T0R C;  3DHG C;  1T0Q C;  3I63 C;  3DHI C;  3RN9 C;  3RNG C;  3RNC C;  3GE8 C;  2INC C;  3RMK C;  3N1Z C;  3N1Y C;  3DHH C;  2RDB C;  4P1C C;  3Q3O C;  3Q3M C;  3RNE C;  3N20 C;  3RI7 C;  3Q3N C;  3RNF C;  3GE3 C;  1T0S C;  3N1X C;  3Q2A C;  3RNB C;  3Q14 C;  2IND C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...