3RNGC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/w167e double mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rngC00
3Q3NC 3N20C 3RNGC 3Q14C 3RNBC 1T0QC 3DHGC 3RNEC 3RMKC 3GE3C 3I63C 3Q3MC 4P1BC 2INDC 3I5JC 1T0RC 3N1XC 3RI7C 1T0SC 3RNFC 2INCC 3RNCC 3GE8C 3N1YC 3DHIC 3RN9C 3Q2AC 3RNAC 4P1CC 3N1ZC 3DHHC 3Q3OC 2RDBC
chains in the Genus database with same CATH superfamily
2C60A 3AE2B 2KTRB 1Q1OA 1ZP0B 5KHOA 4HWIB 3LJ3A 2BS4B 3QARA 5AZHA 2INCC 1XCTL 3GE8C 1N61A 2KC1A 3PRPB 4LNOA 1IPGA 3EA6A 1S3SG 1YNTE 1C76A 4G50A 3WCQA 1RFAA 2HD5B 2ZPNA 4ZHOA 1E6EB 4P7IA 2WNMA 2LGYA 3DQVA 3GZNI 4N59A 3L13A 5GMVA 3PHXB 3R3MA 2GI9A 2PJHA 2LZ6A 2D3GA 2KJ6A 4GSWA 1AN8A 4KSKC 1ISNA 3AM9A 1WGRA 1MHXA 1BXTA 3BVZA 3MFGA 2K39A 4JX1C 3TBLD 3VR9B 2NR2A 3BIID 3QQ8B 1MFWA 2GBKA 1QOBA 3RPFC 4XYCA 3VTVA 2XK5A 3AE1B 3ML9A 4EFOA 3V05A 3T3OA 1FO4A 3B0AA 2XEWA 3P4QB 3DBHB 1Q5WB 4FA6A 3NOBA 2WDTB 2QHOA 3A9JA 2W9NA 1ZW7A 2L8JA 4MDKE 4EZJA 3SHQA 4OVZA 1UGJA 2Z0DB 3NY5A 2KXJA 2LMCA 4HJKA 4G11A 1M4VA 2CKHB 3DHIC 2R2OA 5JZEB 3AE9B 2N7JA 1JALA 1RRBA 3L08A 1ZPSA 1V49A 3AMZA 3KW5B 2IO3B 4AOFA 2MLBA 1WY8A 2KN4A 4MSMB 3R7RA 1JCKB 2G45B 4NJCA 1GC7A 2MBBB 3APDA 1WGKA 4A90A 4C00A 2K8BA 2AQ2B 3IXSA 2KANA 1TKYA 2OOBB 2FUHB 2IDYA 3NG0A 2KWVB 5FK9C 4A6QA 1PQSA 2JXXA 3ZJVA 2GRIA 5EE0A 2NS5A 3QAQA 3P63A 4IDIA 1F1HA 2JUOA 2DZJA 1PUTA 1C4AA 4AJWA 2ZNVC 2Y5CA 4O1NA 3HIZA 4RFBA 5AZGA 5JHBA 2WX1A 1WR1A 4US8A 1F52A 3R2TA 1CJEA 5G5HA 1J19A 3KWLA 1V2YA 1FMAD 1MVKA 2BB6A 3N20C 2DWQA 2FCMA 3U30A 1JROA 5HFYA 3P4RB 3MC9A 5C3JB 3Q8CA 2BS3B 3H8HA 4WWMA 4EE2A 2ZNVB 5LLIA 4B95A 1E8WA 1RM6C 2KTRA 5L83A 3AN1A 2WXLA 4M8MA 2ZCBA 5C2TB 2ICIA 2MJEA 4K7WA 1KLUD 1KLVA 2IYDB 3DVNV 5E6PA 3LYYA 1OQRA 2INDC 4WWPA 2EELA 1T0RC 2AL3A 2V4IB 5EDSA 4YSZB 4ASWC 4URKA 1WGHA 4DXGA 1YQ3B 3BYTB 5EE3A 1D3ZA 2IGDA 3KUZA 1SJED 5LXIB 2O2VB 1C4CA 1UD7A 2WYQA 3H9DA 4TMAB 5AZFA 4KGTA 1P7FA 2ZCCA 4NQLB 2V9HA 3RULA 4EKUA 1SE4A 2LI5A 2N1WA 2WXGA 1WXMA 4E74A 2KQSA 2BKFA 1FCLA 4DXFA 2BWES 4NAWB 4ANUA 2KACA 4BBNF 5HG2A 2K6DB 2AYOB 1C78A 3AH7A 4NZLB 4IWOA 3TIXA 3WAPA 2BYEA 3RNBC 4LNNA 2Q5WD 4LJPB 1HE8A 2J53A 3W1SC 4JWUC 1KF6B 2J0KA 2K22A 2LXAA 3M63B 3JYUA 4RM9A 3OWEB 4ANVA 5E6OA 3QJZA 1V5TA 2WXNA 3Q8BA 4GDLB 3BWUD 4KDIC 2PTLA 2Y3AA 3ZDMC 1KLGD 2JWZA 4W9FA 2BKRB 2G1EA 1L0VB 2PVOD 3OJ3A 4FN2A 4A3OA 2WQYB 2KFJA 4MSQB 3AEFB 3KUDB 2DYOA 3DHHC 1NYRA 1U4AA 1A70A 1WE7A 3APFA 1WWTA 3H7PB 2L76A 1FEHA 5EE9A 1WYWB 3P42A 4DQOC 4F8CB 2K25A 3VFKA 1FXTB 1GUAB 1KH0A 2WGSA 4DDGD 4PS3A 3W5VB 3GS2A 3K9OB 2K5PA 2KKCA 4MEMA 2K3UA 2QJLA 1I4PA 2KMMA 1WXAA 4WQMA 4BKGA 2ZVNA 3EECA 1SE2A 2LWPA 3NJTA 1T6BX 4DHJB 2YEPF 3ZRFA 2N0SB 3LDZE 2VZKB 3R7QA 1WIAA 2RMMA 2KVZA 5H92C 2LVOA 4WIPA 4WJPA 5JHAA 3PT2B 1EO6A 5D6JB 1ZUD2 3HVZA 3Q8EA 5BYRA 3Q3JA 3DVGY 1T0SC 1HXYD 2QIEB 2XN9C 1XF5L 4W9HA 1GC6A 4M01A 1F0ZA 4CHKA 1XD3B 3ECIA 2KDBA 3DVGX 3MHSD 1IGDA 3NZ3A 1OGWA 3OG5A 4NJ7A 1YIWA 4W9JA 4JL9A 2B3AA 1VD2A 2DNFA 3AE5B 2PPHA 2WX0A 4YSXB 1EF1A 2GBJA 4QAYA 2M0XA 4YL8A 1HTQA 2O2VA 4BFRA 2CJNA 4A9AA 2X8XX 3TSSA 1UGMA 2RPVA 4LCDE 2WU2B 3SFEB 5HKHA 2WDRB 4BBNC 2D3BA 4WH4A 4X57B 3IHPC 3WAMA 1MI0A 1YJIA 1YQ4B 1TY0A 4B0EA 4RF0A 2QEJC 3ZJTA 4NAWA 1HZ6A 1RYJA 3VAWA 1WX9A 3TEWA 4ARIA 4HXDA 1ZDVA 3BVGA 4UDUC 3WAOA 3EFUA 5HHDG 1NDDA 2C9WB 2L32A 2KO3A 3Q2AC 2C7HA 4I6NB 3AECB 3I3TB 4W9LA 2LJIA 2KDMA 1FNWA 2CS4A 1L6VA 4GXBA 1V8CA 5D3DA 4MELA 2L52A 4MT5A 4RGOS 1HA5A 4HLEA 1QT9A 3QWZB 5FR6A 2FIDA 1Z5SB 3ZVVA 4S17A 4TQ1A 3R2IA 1I42A 2MA9B 2DX5B 1WXSA 1L0YB 2BYTA 3I9V1 4PYZA 1V1OA 4GU2A 3VDZA 3AEEB 2IO2B 4C4VB 3PVLA 2LHEA 3HM3A 4KX6B 4IWQA 5T8IA 3L0WB 4GDLA 3VVWB 3AU5A 2OJRA 4A3PA 1R4MI 4JE3B 1ZXHA 1S1QB 2FCNA 2BB5A 1JRPA 1TGZB 2JYTA 3W1SA 2WXOA 1SB3C 1VLBA 3N3KB 4C56C 3H7PA 4RH6A 5I4DA 1RFKA 1WR6E 2KWCA 3VXWA 1C4PA 4ZRJA 3AB5A 4LDTB 4ACFA 5JH5C 2MRPA 3ABVB 5E6JA 1V86A 2FE8A 1PGXA 1TZ1A 2KT7A 4MH0E 4P6VF 3UIOB 2JT4B 1RWSA 2PMVA 1BMLC 3FILB 5G55A 3NUHB 1Q0WB 3PHWB 2YEPB 3MJWA 4J6IA 2JRHA 1M94A 4JQWC 3OLMD 1K8RB 4RNAA 2DZIA 1E7PB 4DHJD 1UWXA 2VH2A 3FKYA 2VZKD 2LFIA 3W5UB 3UQAA 1K51A 2JZPA 2I1KA 3LXFA 3RUIB 4IM3A 1E0ZA 1I35A 2EKIA 2RD0A 2KFKA 2D07B 4XDDA 4GOCA 5DPWA 4BOSC 2WXQA 1I4RA 4CO7A 1NENB 2BPSA 3NVYA 5D3IB 5EE1A 1TT5B 2KJRA 3NZUA 5CX3A 4GMVA 2FCQA 4TKNA 2RGFA 4HKZE 1KOTA 1XLQA 1I4XA 2J4XA 1VR9A 3SEBA 1TS3A 3WALA 2KN5A 2V3PA 3PZ7A 1V6EA 2DAJA 3I57A 3NZSA 1N5WA 4RGTA 2N9XA 1VCBA 2N7DA 3ZNHB 3VQIA 4P1CC 2Z59B 2MCNB 4P16A 2WLBA 4WAAA 4AP4C 5G5GA 3R66C 3PLUA 1CQVA 1TY2A 1L6UA 2RDGA 1J0GA 1EWYC 4FADA 3IFWB 5IA7A 4DHZB 1F2RI 1N60A 3EHVA 1P98A 4B6WA 1I4GA 1WGYA 1D5ZC 1F77A 2WXFA 5D7GA 3TMPB 1FXIA 2HJ1A 2L0FA 2ZW1A 5CHWA 1GPXA 1OEYA 3ZNID 2L0TA 1QOFA 3QHTA 1WZ0A 2QCZA 4A20A 3PGEA 2IJ0A 1EF5A 1TBEA 3SU8X 1QQRA 2IPKD 2KLGA 1E9MA 1H8CA 1NI2A 3UINB 1ZGUB 3Q3OC 1QLBB 4OVVA 1ACCA 2W55A 1L4DB 2JSVX 1H4RA 4YXDB 4USAA 2MW5A 1P9DU 4WJOA 3KH0A 3ML8A 2OEDA 3VH4B 1WYGA 2I38A 5DPSA 2IZVB 3HRDD 2H88B 3O65B 4NAMA 1WZ3A 4C4VA 1E10A 2BGFA 1XXGA 2KDEB 3H1UA 1NBFC 1TS2A 2KNBA 4GLSC 4DWFA 4IM2A 4J3OD 1X1MA 1TS5A 3V6CB 3B2FA 1JWSD 2V1YA 1WX7A 2MBHA 3MJ5A 4HROA 3KVFB 3LB8C 4ZYNA 5AUIA 2LUEA 1V9JA 2BWFA 1OFFA 1DOYA 3RNGC 2L7RA 1T0YA 3EC8A 3EGRA 5BMIA 3ZUNA 1C1YB 4EZLA 2KTFA 4JLCA 3VHTC 4WWNA 1YN3A 5DCNA 1D6EC 2QSDA 1FRDA 3SR6A 1ZE3D 1JMLA 2M56B 4LDTD 1UWMA 1L7YA 4W9CA 2OHFA 3IBEA 4FHJA 3W9CB 1K52A 3FILA 4HPPA 3AE8B 4BOZB 3B9JA 1D4BA 2XNAC 2BQQA 4FJVB 3IT4B 3BZDB 4MH8A 2NCNA 2AWTA 1Z2MA 2W3SA 1YJJA 3N1ZC 1SJHD 2KOXA 2K1FA 1SF0A 1PGAA 3AV8A 5GXGB 3ZW3A 3TUOA 4G3XB 2RDHA 2WHIA 4IM0A 2DLBA 2KD0A 3I5JC 3ZLZA 3ZXVA 2UWQA 4FJZA 1GAQB 3WIMA 1D5MC 4HRSA 4S0RA 4KZ0A 4IKGA 5C1ZA 2WXIA 4FLHA 1FNVA 1STEA 2Y5BB 4LK0M 3Q8AA 3PRMB 2JZZA 3C19A 1JWAD 3N1YC 2BYFA 3DBHI 3RNAC 2DZKA 1GJZA 1SE3A 4IUMB 3A33B 2KDFB 2CHZA 2WXKA 1SEBD 3UI3A 3DWGC 1VZ7A 3VTUA 2LGXA 3QC8B 2TSSA 2GLSA 4F1SA 4II2B 3V61A 3RNCC 4KVGB 5AEKB 4YWGG 4II3B 3OAWA 1P0RA 4HKQA 2M19A 2KQ7A 2K6QA 2JRIB 3E9SA 2LGIA 1IYFA 3AE6B 1HEZE 2V3NA 1TKEA 1C77A 4FJYA 3VUYA 4L1BA 3RNFC 1FXAA 2BS2B 3O13A 3BY4B 2D11A 2N9PC 4KGRA 2AX5A 4RMAA 2AQ1B 1I4QA 4IW0A 1XLOA 2UU7A 2HTME 1GNUA 2IO0B 1QKZA 4CYEA 3Q69A 4MACA 2MX2A 1F9JA 3DHGC 4OHJA 2KMCA 1WI0A 3A1QA 4N58A 3KLSX 4W9KA 2LGSA 5CHFA 2NMQA 2QMTA 4WJNA 3VTWA 2E6XA 4GB9A 3GZNB 4EEWA 2JVCA 3TCAA 3NRZA 3DOWA 3NVWA 5CTRC 2MBOA 1GG3A 5BMGA 4LNKA 2Z8LA 3A4RA 3S2AA 2AEHA 4MGIE 4BVUC 2ZJDA 1QILA 2ZZPB 2LGDA 1JQ4A 1L4ZB 1SGHA 2ZVOA 4LNIA 4NPNA 3V3XA 1FPYA 3L54A 2HDEA 1HQRD 4EZKA 2KFKB 1I7HA 3ZTCA 4JWSC 4R3DA 3ZKJC 1UBQA 1T3QA 2H89B 2LASA 2OJWA 1EU3A 4GGQA 4MJSB 1UH6A 5H8YE 4HVBA 1ENFA 4MGKE 1WXQA 3DVNU 4HCNB 4B9KA 3E56A 2A5UA 2KJHB 3NS1A 3ZIMA 2NVUI 3Q8FA 1NVID 1QF6A 2D10A 4C7YA 1JRUA 1IUEA 3JSVB 2PKOA 1KRHA 3AE3B 4BKTA 3Q3MC 4ARCA 3WANA 2C7MB 4GIVA 4W9IA 1TTNA 4M0WA 4L23A 2NBUA 3DPDA 5IAAC 3DCGA 3QK0A 1CMXB 4N9F4 1FFUA 2GOWA 2JXTA 3MC0B 3NHEB 4C7ZA 1JWMD 4KZCA 4AS1A 3N9YC 3Q3NC 1GOZA 4DHZE 3UQBA 4YTMB 3KWVA 3U52E 3B08A 3A9KB 4JPSA 4XWTA 4HJGE 2SAKA 2J0MA 1WXVA 2N7EA 1XQQA 1E8YA 2WXMA 5BMHA 3P4SB 2DBYA 1TIFA 3I63C 3BVMA 1JWUD 2G3QB 1V97A 2NBVB 1Y8RC 5L95C 4N6EB 1R4NB 1MPEA 2NTSA 1WH3A 1YJ1A 2CU1A 4ITKA 1WM3A 3T9LA 2W3RA 4OZAA 3AEAB 4EUTA 1KTKA 1WRIA 1LGRA 3NS8A 2V4LA 4CQNA 4BZAA 4ZDVA 2W82A 2KVRA 4KKJA 4RCOA 2KMAA 3GOEA 3P4PB 3U8ZA 1WSPA 4B0MA 1YD8U 2CHXA 1FM0D 1I4HA 3AEBB 1JWBD 3T8MA 1RLFA 4GN1A 2MP2B 3ZYYX 2B76B 3ZJUA 1XLNA 2K9XA 2IGGA 2MJDA 4XWWA 2WXHA 3UF8A 3MP9A 4KV2A 1K53A 2KWDA 5TR5A 4OZBA 1WGGA 2E3TA 2SEBD 1FCCC 4HEA1 1E5WA 2PLPA 5IO9A 1ZKHA 4XE0A 3UGBB 3U4EG 4E71A 2V3SA 4JGHB 4OZCA 2O6VB 1SE9A 1ZDXA 3RT3B 1DGJA 1J8CA 3VUXA 1V80A 4G0NB 3RI7C 1T5XD 1UNSA 4K3CA 1ROEA 1RAXA 2M4NA 1BUIC 3PRZA 2N9LA 3VH3B 5G2NA 1MHHE 5D94A 4PS8A 3CF6E 2LVQA 4DDID 3ZRCA 1XCQL 1TKGA 4WJQA 3RZFA 2L3ZA 2M17A 3JVZX 4HDOA 5IOIA 2L00B 1E90A 1P7EA 4MJSA 4OVUA 4ZRIA 3B1LX 4KDLB 2M8SA 2JX5A 2KK8A 2C7NB 3D32A 1QOGA 2J52A 2BBCA 3PSEB 2YLMA 4FBJB 2PW9A 3FC4A 2JY6A 2MH7A 4KKIA 4WQOB 2GBMA 1AWDA 2EMSA 3KQ4A 3P1MA 2ZEQA 3RN9C 2CJOA 2KZRA 1SBBB 3JSVA 2REXA 3C8YA 3TJPA 1ZXIA 2MBQA 2XBBC 1JW9D 1WJNA 1VZ6A 1IGCA 3X0WA 3R8BA 3KUCB 1L5PA 1BT0A 2N9KA 3QIJA 3VUWA 2MEKA 2IGHA 4K81A 3PO0A 1UZXB 2FCSA 1V1PB 1N62A 3ZQ4A 2N9EB 3IG3A 1J7CA 2LXCA 4MM3A 4C80A 5IKCM 1GB1A 2BTEA 2WDVB 3A9KA 3TEXA 3PTFC 3IAS1 3AI5A 4GDKB 4A8XC 4ZHPA 4HPMB 4REZA 3DBLB 2PE6B 3VR8B 2L05A 3CSTA 1WE6A 4XDCA 2BYVE 3PZDA 1KM7A 1J7AA 2HE7A 1SXTA 4WAFA 2D3AA 2DAFA 1NYQA 5J2RA 2N4FA 3NVZA 4TSSA 2JF5A 2BW2A 2J0JA 3A1QB 1FFVA 1AW7A 2ON8A 2IO1B 4F7ZA 2LHDA 1XLPA 4ICUA 4YT0B 2WP9B 3P2BA 3IVFA 1WJUA 2M0AA 4BAXA 3PREA 4IC7B 5DPRA 4YTNB 4HK2A 3Q3FA 2MHJA 4IWPA 5BO4B 4ZRPA 1LM8B 2MSED 4ZRQA 1XEEA 3ZXRA 1R4NI 4M00A 1PDXA 4W9DA 1IBXA 3B2GA 4PYUA 2FIFA 2KHWB 1K50A 3RFZB 5HI1A 2EMTA 1G6JA 1FIQA 4Q2JA 3U7ZA 1E7VA 1UF0A 3ALBA 2MP2A 1NI3A 4TV3A 3GB1A 1AARA 4KIKA 2RSUA 1Y56A 2PIAA 3RMKC 1ET9A 1WMHA 4M02A 1C9FA 1WJ6A 1V81A 4JIOU 3AEDB 3L4PA 3PLVA 1DYQA 3NVVA 1YX6B 2EKEC 4M8NA 3CSFA 3C0RB 3RYTA 3GP7A 3L10B 1TJEA 1YN5A 2D3CA 4AJYB 1XT9B 1VDVA 2O6VA 4LJOB 4I6PA 4ZRKA 3N32A 1LQBA 1E8XA 1YMHE 5IN7A 1LO5D 3ONSA 2MWSB 3BINA 4NNJB 2FNJB 2MBEA 3AU4A 2R2QA 2O6VD 2NTTA 3V6EB 2RPQA 1EUVB 4L2YA 2LUMA 4M0WB 5E6NA 4YTPB 1AYFA 4FHKA 2RDBC 1MJDA 2GB1A 1P1AA 3MTNB 2DZMA 3MC8A 4XX5A 2M1MA 3PV1A 2HTHA 2FAZA 3PPAA 1V5OA 4HCPB 3T3NA 3EUB2 2Y5PA 5D2MB 1KJTA 4D2KA 1VRAB 4HDQA 2LJ5A 3L17A 4NJ6A 2AL6A 2INNE 1SIJA 1B9RA 2MJ3A 4WURA 3KYDD 3Q14C 2PVGC 1PYWD 2YVCA 2NPTB 4NQKE 1ET6A 1DOIA 1N6ZA 1IP9A 1FRRA 1OTRB 4DK5A 2IY1B 2BVCA 4W9GA 3RZWC 1UBIA 1WX8A 1N5XA 2JQRB 1SSNA 1XO3A 4FULA 3WA0A 3DWMA 4PS7A 1CK1A 2LEKA 4P1BC 3TL5A 5KHQA 2BF8B 3CIRB 2WXPA 2JPHA 2D5GA 1NEKB 1R4MB 2WXRA 4HPLB 1UUPA 4K1RB 2IBIB 3DBRB 1UELA 2KQ4X 1V1PA 1YOVB 2NBWB 1ZOYB 4A55A 5FR3A 1LXDA 3FAHA 2KC2A 4NY0A 2KX0A 3V62A 4ZYSA 2GBNA 3GE3C 3QCAA 3A4SC 4GDKA 4E3CA 2LD9A 3UIPB 1FNUA 2VH1A 5AUKA 3ZO5B 2K8CA 3URYA 3VRBB 3SFDB 3AE4B 3HUIA 1TYGB 4US9A 4ZOHC 1T0QC 1B1ZA 1L2NA 4RM8A 4DXAB 2VRRB 1R7SA 2LRUA 1YX5B 2QC8A 3AULA 5CHVC 3DBLI 4RGMA 2ZPYA 5TSSA 3ZTDA 4K7UA 4AWJA 4K7SA 3H6NA 2BT6A 4H2AA 2Z0EB 3U2SC 2INPE 3M3JA 1EWCA 2DENB 1CZPA 3M62B 3RNEC 4IOIE 2ONQA 3ZGZA 3QA8A 2R61A 4AQ7A 1WGDA 2ZW0A 2DYMA 4ANWA 1MG8A 5DPTA 1SIFA 1C79A 5BYQA 3TEZA 1PGBA 2WWZA 3AEGB 3HK0A 2C5LC 5FKAC 2G4DB 1PFDA 1E7UA 3IT6B 3ZNZB 1EU4A 2RR9A 2LVPA 2JU6X 2WS3B 2FUG1 2PE9A 1C3TA 1TS4A 3KYCD 3TEYA 5JXVA 4LNFA 1F2RC 3APCA 3X23A 1TZOA 1WJ4A 3IAM1 1OQYA 3W1YA 2XK5B 3K9PB 3QX1A 2L1AA 4OW0A 3V60A 3HVDA 1J7BA 1E8ZA 2A4ZA 1OQQA 3A9JB 1WRDB 2LRWA 1L0XB 4I6LB 2JZ3B 2MQJA 2WXJA 3N1XC 2GBRA 3DBSA 2G9HD 5MPOA 3ENEA 3ETRA 3PS6A 1GB4A 2JYEA 4LTUA 1WM2A 4XGAB 1QZEA 2I2YA 1KFYB 2X38A 3SD5A 4MGZE 2V0GA 2GMIC 3BYYB 2KLCA 2IY0B 1MG4A 1N63A 2KX3A 2WDQB 3Q6BA 4MM3B 1WFYA 4TQ0A 1EM7A 4W9EA 2DHZA 4LLGM 2HJ8A 2JWUA 5BYSA 1HTOA 1FD6A 3AE7B 2QDFA 4XZ4A 4FXCA 1QOAA 1VZ8A 2CHWA 2KYWA 2NPTA 4EOYA 3AXCA 1OEYJ 3PZ8A 2I1JA 2PEAA 1VJKA 1Q10A 2ACZB 4KSLC 2UYZB 2J42A 3ZNGC 4KGSA 1HZ5A 1A5RA 4RF1A 3J9CA 5IP4D 4BKSA 1ESFA 2KWUB 4PK1A 4ANXA 4AUQC 3SDLC 5LNK1 3H7SA 2G4SA 2KDIA 4DBGA 2DYBA 1DOXA 4RGNA 3N30A 3BK1A 2W54A 3JW0X 4K3BA 3RD2A 4IG7B 1P3QU 4BKSD 3RCZA 3U7DA 4TUUA 3HM6X 1IBXB 3DDCB 1WF9A 2QILA 3OJ4B 2CR5A 4WWOA 2FBWB 3CWIA 3ZDTA 2L83A 3CMMB 1LFDA 3DBRI 4KIKB 3L16A 3EFCA 2WU5B 1YN4A 1D5XC 1WMHB 2K8HA 1YQBA 5LXHA 5J18A 2N1VA 3VRAB 2J7QB 5J17A 4XC2A 3W2DA 3BK2A 2CU3A 2KAJA 3MHZA 2D2QA 4MGYE 4PT5A 3M95A 4ICVA 2K0PA 2ASQA 3HHMA 2AQ3B 4YSYB 5C23A
chains in the Genus database with same CATH topology
3Q3NC 3N20C 3RNGC 3Q14C 3RNBC 1T0QC 3DHGC 3RNEC 3RMKC 3GE3C 3I63C 3Q3MC 4P1BC 2INDC 3I5JC 1T0RC 3N1XC 3RI7C 1T0SC 3RNFC 2INCC 3RNCC 3GE8C 3N1YC 3DHIC 3RN9C 3Q2AC 3RNAC 4P1CC 3N1ZC 3DHHC 3Q3OC 2RDBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3N C;  3N20 C;  3RNG C;  3Q14 C;  3RNB C;  1T0Q C;  3DHG C;  3RNE C;  3RMK C;  3GE3 C;  3I63 C;  3Q3M C;  4P1B C;  2IND C;  3I5J C;  1T0R C;  3N1X C;  3RI7 C;  1T0S C;  3RNF C;  2INC C;  3RNC C;  3GE8 C;  3N1Y C;  3DHI C;  3RN9 C;  3Q2A C;  3RNA C;  4P1C C;  3N1Z C;  3DHH C;  3Q3O C;  2RDB C; 
#chains in the Genus database with same CATH topology
 2C60 A;  3AE2 B;  2KTR B;  1Q1O A;  1ZP0 B;  5KHO A;  4HWI B;  3LJ3 A;  2BS4 B;  3QAR A;  5AZH A;  2INC C;  1XCT L;  3GE8 C;  1N61 A;  2KC1 A;  3PRP B;  4LNO A;  1IPG A;  3EA6 A;  1S3S G;  1YNT E;  1C76 A;  4G50 A;  3WCQ A;  1RFA A;  2HD5 B;  2ZPN A;  4ZHO A;  1E6E B;  4P7I A;  2WNM A;  2LGY A;  3DQV A;  3GZN I;  4N59 A;  3L13 A;  5GMV A;  3PHX B;  3R3M A;  2GI9 A;  2PJH A;  2LZ6 A;  2D3G A;  2KJ6 A;  4GSW A;  1AN8 A;  4KSK C;  1ISN A;  3AM9 A;  1WGR A;  1MHX A;  1BXT A;  3BVZ A;  3MFG A;  2K39 A;  4JX1 C;  3TBL D;  3VR9 B;  2NR2 A;  3BII D;  3QQ8 B;  1MFW A;  2GBK A;  1QOB A;  3RPF C;  4XYC A;  3VTV A;  2XK5 A;  3AE1 B;  3ML9 A;  4EFO A;  3V05 A;  3T3O A;  1FO4 A;  3B0A A;  2XEW A;  3P4Q B;  3DBH B;  1Q5W B;  4FA6 A;  3NOB A;  2WDT B;  2QHO A;  3A9J A;  2W9N A;  1ZW7 A;  2L8J A;  4MDK E;  4EZJ A;  3SHQ A;  4OVZ A;  1UGJ A;  2Z0D B;  3NY5 A;  2KXJ A;  2LMC A;  4HJK A;  4G11 A;  1M4V A;  2CKH B;  3DHI C;  2R2O A;  5JZE B;  3AE9 B;  2N7J A;  1JAL A;  1RRB A;  3L08 A;  1ZPS A;  1V49 A;  3AMZ A;  3KW5 B;  2IO3 B;  4AOF A;  2MLB A;  1WY8 A;  2KN4 A;  4MSM B;  3R7R A;  1JCK B;  2G45 B;  4NJC A;  1GC7 A;  2MBB B;  3APD A;  1WGK A;  4A90 A;  4C00 A;  2K8B A;  2AQ2 B;  3IXS A;  2KAN A;  1TKY A;  2OOB B;  2FUH B;  2IDY A;  3NG0 A;  2KWV B;  5FK9 C;  4A6Q A;  1PQS A;  2JXX A;  3ZJV A;  2GRI A;  5EE0 A;  2NS5 A;  3QAQ A;  3P63 A;  4IDI A;  1F1H A;  2JUO A;  2DZJ A;  1PUT A;  1C4A A;  4AJW A;  2ZNV C;  2Y5C A;  4O1N A;  3HIZ A;  4RFB A;  5AZG A;  5JHB A;  2WX1 A;  1WR1 A;  4US8 A;  1F52 A;  3R2T A;  1CJE A;  5G5H A;  1J19 A;  3KWL A;  1V2Y A;  1FMA D;  1MVK A;  2BB6 A;  3N20 C;  2DWQ A;  2FCM A;  3U30 A;  1JRO A;  5HFY A;  3P4R B;  3MC9 A;  5C3J B;  3Q8C A;  2BS3 B;  3H8H A;  4WWM A;  4EE2 A;  2ZNV B;  5LLI A;  4B95 A;  1E8W A;  1RM6 C;  2KTR A;  5L83 A;  3AN1 A;  2WXL A;  4M8M A;  2ZCB A;  5C2T B;  2ICI A;  2MJE A;  4K7W A;  1KLU D;  1KLV A;  2IYD B;  3DVN V;  5E6P A;  3LYY A;  1OQR A;  2IND C;  4WWP A;  2EEL A;  1T0R C;  2AL3 A;  2V4I B;  5EDS A;  4YSZ B;  4ASW C;  4URK A;  1WGH A;  4DXG A;  1YQ3 B;  3BYT B;  5EE3 A;  1D3Z A;  2IGD A;  3KUZ A;  1SJE D;  5LXI B;  2O2V B;  1C4C A;  1UD7 A;  2WYQ A;  3H9D A;  4TMA B;  5AZF A;  4KGT A;  1P7F A;  2ZCC A;  4NQL B;  2V9H A;  3RUL A;  4EKU A;  1SE4 A;  2LI5 A;  2N1W A;  2WXG A;  1WXM A;  4E74 A;  2KQS A;  2BKF A;  1FCL A;  4DXF A;  2BWE S;  4NAW B;  4ANU A;  2KAC A;  4BBN F;  5HG2 A;  2K6D B;  2AYO B;  1C78 A;  3AH7 A;  4NZL B;  4IWO A;  3TIX A;  3WAP A;  2BYE A;  3RNB C;  4LNN A;  2Q5W D;  4LJP B;  1HE8 A;  2J53 A;  3W1S C;  4JWU C;  1KF6 B;  2J0K A;  2K22 A;  2LXA A;  3M63 B;  3JYU A;  4RM9 A;  3OWE B;  4ANV A;  5E6O A;  3QJZ A;  1V5T A;  2WXN A;  3Q8B A;  4GDL B;  3BWU D;  4KDI C;  2PTL A;  2Y3A A;  3ZDM C;  1KLG D;  2JWZ A;  4W9F A;  2BKR B;  2G1E A;  1L0V B;  2PVO D;  3OJ3 A;  4FN2 A;  4A3O A;  2WQY B;  2KFJ A;  4MSQ B;  3AEF B;  3KUD B;  2DYO A;  3DHH C;  1NYR A;  1U4A A;  1A70 A;  1WE7 A;  3APF A;  1WWT A;  3H7P B;  2L76 A;  1FEH A;  5EE9 A;  1WYW B;  3P42 A;  4DQO C;  4F8C B;  2K25 A;  3VFK A;  1FXT B;  1GUA B;  1KH0 A;  2WGS A;  4DDG D;  4PS3 A;  3W5V B;  3GS2 A;  3K9O B;  2K5P A;  2KKC A;  4MEM A;  2K3U A;  2QJL A;  1I4P A;  2KMM A;  1WXA A;  4WQM A;  4BKG A;  2ZVN A;  3EEC A;  1SE2 A;  2LWP A;  3NJT A;  1T6B X;  4DHJ B;  2YEP F;  3ZRF A;  2N0S B;  3LDZ E;  2VZK B;  3R7Q A;  1WIA A;  2RMM A;  2KVZ A;  5H92 C;  2LVO A;  4WIP A;  4WJP A;  5JHA A;  3PT2 B;  1EO6 A;  5D6J B;  1ZUD 2;  3HVZ A;  3Q8E A;  5BYR A;  3Q3J A;  3DVG Y;  1T0S C;  1HXY D;  2QIE B;  2XN9 C;  1XF5 L;  4W9H A;  1GC6 A;  4M01 A;  1F0Z A;  4CHK A;  1XD3 B;  3ECI A;  2KDB A;  3DVG X;  3MHS D;  1IGD A;  3NZ3 A;  1OGW A;  3OG5 A;  4NJ7 A;  1YIW A;  4W9J A;  4JL9 A;  2B3A A;  1VD2 A;  2DNF A;  3AE5 B;  2PPH A;  2WX0 A;  4YSX B;  1EF1 A;  2GBJ A;  4QAY A;  2M0X A;  4YL8 A;  1HTQ A;  2O2V A;  4BFR A;  2CJN A;  4A9A A;  2X8X X;  3TSS A;  1UGM A;  2RPV A;  4LCD E;  2WU2 B;  3SFE B;  5HKH A;  2WDR B;  4BBN C;  2D3B A;  4WH4 A;  4X57 B;  3IHP C;  3WAM A;  1MI0 A;  1YJI A;  1YQ4 B;  1TY0 A;  4B0E A;  4RF0 A;  2QEJ C;  3ZJT A;  4NAW A;  1HZ6 A;  1RYJ A;  3VAW A;  1WX9 A;  3TEW A;  4ARI A;  4HXD A;  1ZDV A;  3BVG A;  4UDU C;  3WAO A;  3EFU A;  5HHD G;  1NDD A;  2C9W B;  2L32 A;  2KO3 A;  3Q2A C;  2C7H A;  4I6N B;  3AEC B;  3I3T B;  4W9L A;  2LJI A;  2KDM A;  1FNW A;  2CS4 A;  1L6V A;  4GXB A;  1V8C A;  5D3D A;  4MEL A;  2L52 A;  4MT5 A;  4RGO S;  1HA5 A;  4HLE A;  1QT9 A;  3QWZ B;  5FR6 A;  2FID A;  1Z5S B;  3ZVV A;  4S17 A;  4TQ1 A;  3R2I A;  1I42 A;  2MA9 B;  2DX5 B;  1WXS A;  1L0Y B;  2BYT A;  3I9V 1;  4PYZ A;  1V1O A;  4GU2 A;  3VDZ A;  3AEE B;  2IO2 B;  4C4V B;  3PVL A;  2LHE A;  3HM3 A;  4KX6 B;  4IWQ A;  5T8I A;  3L0W B;  4GDL A;  3VVW B;  3AU5 A;  2OJR A;  4A3P A;  1R4M I;  4JE3 B;  1ZXH A;  1S1Q B;  2FCN A;  2BB5 A;  1JRP A;  1TGZ B;  2JYT A;  3W1S A;  2WXO A;  1SB3 C;  1VLB A;  3N3K B;  4C56 C;  3H7P A;  4RH6 A;  5I4D A;  1RFK A;  1WR6 E;  2KWC A;  3VXW A;  1C4P A;  4ZRJ A;  3AB5 A;  4LDT B;  4ACF A;  5JH5 C;  2MRP A;  3ABV B;  5E6J A;  1V86 A;  2FE8 A;  1PGX A;  1TZ1 A;  2KT7 A;  4MH0 E;  4P6V F;  3UIO B;  2JT4 B;  1RWS A;  2PMV A;  1BML C;  3FIL B;  5G55 A;  3NUH B;  1Q0W B;  3PHW B;  2YEP B;  3MJW A;  4J6I A;  2JRH A;  1M94 A;  4JQW C;  3OLM D;  1K8R B;  4RNA A;  2DZI A;  1E7P B;  4DHJ D;  1UWX A;  2VH2 A;  3FKY A;  2VZK D;  2LFI A;  3W5U B;  3UQA A;  1K51 A;  2JZP A;  2I1K A;  3LXF A;  3RUI B;  4IM3 A;  1E0Z A;  1I35 A;  2EKI A;  2RD0 A;  2KFK A;  2D07 B;  4XDD A;  4GOC A;  5DPW A;  4BOS C;  2WXQ A;  1I4R A;  4CO7 A;  1NEN B;  2BPS A;  3NVY A;  5D3I B;  5EE1 A;  1TT5 B;  2KJR A;  3NZU A;  5CX3 A;  4GMV A;  2FCQ A;  4TKN A;  2RGF A;  4HKZ E;  1KOT A;  1XLQ A;  1I4X A;  2J4X A;  1VR9 A;  3SEB A;  1TS3 A;  3WAL A;  2KN5 A;  2V3P A;  3PZ7 A;  1V6E A;  2DAJ A;  3I57 A;  3NZS A;  1N5W A;  4RGT A;  2N9X A;  1VCB A;  2N7D A;  3ZNH B;  3VQI A;  4P1C C;  2Z59 B;  2MCN B;  4P16 A;  2WLB A;  4WAA A;  4AP4 C;  5G5G A;  3R66 C;  3PLU A;  1CQV A;  1TY2 A;  1L6U A;  2RDG A;  1J0G A;  1EWY C;  4FAD A;  3IFW B;  5IA7 A;  4DHZ B;  1F2R I;  1N60 A;  3EHV A;  1P98 A;  4B6W A;  1I4G A;  1WGY A;  1D5Z C;  1F77 A;  2WXF A;  5D7G A;  3TMP B;  1FXI A;  2HJ1 A;  2L0F A;  2ZW1 A;  5CHW A;  1GPX A;  1OEY A;  3ZNI D;  2L0T A;  1QOF A;  3QHT A;  1WZ0 A;  2QCZ A;  4A20 A;  3PGE A;  2IJ0 A;  1EF5 A;  1TBE A;  3SU8 X;  1QQR A;  2IPK D;  2KLG A;  1E9M A;  1H8C A;  1NI2 A;  3UIN B;  1ZGU B;  3Q3O C;  1QLB B;  4OVV A;  1ACC A;  2W55 A;  1L4D B;  2JSV X;  1H4R A;  4YXD B;  4USA A;  2MW5 A;  1P9D U;  4WJO A;  3KH0 A;  3ML8 A;  2OED A;  3VH4 B;  1WYG A;  2I38 A;  5DPS A;  2IZV B;  3HRD D;  2H88 B;  3O65 B;  4NAM A;  1WZ3 A;  4C4V A;  1E10 A;  2BGF A;  1XXG A;  2KDE B;  3H1U A;  1NBF C;  1TS2 A;  2KNB A;  4GLS C;  4DWF A;  4IM2 A;  4J3O D;  1X1M A;  1TS5 A;  3V6C B;  3B2F A;  1JWS D;  2V1Y A;  1WX7 A;  2MBH A;  3MJ5 A;  4HRO A;  3KVF B;  3LB8 C;  4ZYN A;  5AUI A;  2LUE A;  1V9J A;  2BWF A;  1OFF A;  1DOY A;  3RNG C;  2L7R A;  1T0Y A;  3EC8 A;  3EGR A;  5BMI A;  3ZUN A;  1C1Y B;  4EZL A;  2KTF A;  4JLC A;  3VHT C;  4WWN A;  1YN3 A;  5DCN A;  1D6E C;  2QSD A;  1FRD A;  3SR6 A;  1ZE3 D;  1JML A;  2M56 B;  4LDT D;  1UWM A;  1L7Y A;  4W9C A;  2OHF A;  3IBE A;  4FHJ A;  3W9C B;  1K52 A;  3FIL A;  4HPP A;  3AE8 B;  4BOZ B;  3B9J A;  1D4B A;  2XNA C;  2BQQ A;  4FJV B;  3IT4 B;  3BZD B;  4MH8 A;  2NCN A;  2AWT A;  1Z2M A;  2W3S A;  1YJJ A;  3N1Z C;  1SJH D;  2KOX A;  2K1F A;  1SF0 A;  1PGA A;  3AV8 A;  5GXG B;  3ZW3 A;  3TUO A;  4G3X B;  2RDH A;  2WHI A;  4IM0 A;  2DLB A;  2KD0 A;  3I5J C;  3ZLZ A;  3ZXV A;  2UWQ A;  4FJZ A;  1GAQ B;  3WIM A;  1D5M C;  4HRS A;  4S0R A;  4KZ0 A;  4IKG A;  5C1Z A;  2WXI A;  4FLH A;  1FNV A;  1STE A;  2Y5B B;  4LK0 M;  3Q8A A;  3PRM B;  2JZZ A;  3C19 A;  1JWA D;  3N1Y C;  2BYF A;  3DBH I;  3RNA C;  2DZK A;  1GJZ A;  1SE3 A;  4IUM B;  3A33 B;  2KDF B;  2CHZ A;  2WXK A;  1SEB D;  3UI3 A;  3DWG C;  1VZ7 A;  3VTU A;  2LGX A;  3QC8 B;  2TSS A;  2GLS A;  4F1S A;  4II2 B;  3V61 A;  3RNC C;  4KVG B;  5AEK B;  4YWG G;  4II3 B;  3OAW A;  1P0R A;  4HKQ A;  2M19 A;  2KQ7 A;  2K6Q A;  2JRI B;  3E9S A;  2LGI A;  1IYF A;  3AE6 B;  1HEZ E;  2V3N A;  1TKE A;  1C77 A;  4FJY A;  3VUY A;  4L1B A;  3RNF C;  1FXA A;  2BS2 B;  3O13 A;  3BY4 B;  2D11 A;  2N9P C;  4KGR A;  2AX5 A;  4RMA A;  2AQ1 B;  1I4Q A;  4IW0 A;  1XLO A;  2UU7 A;  2HTM E;  1GNU A;  2IO0 B;  1QKZ A;  4CYE A;  3Q69 A;  4MAC A;  2MX2 A;  1F9J A;  3DHG C;  4OHJ A;  2KMC A;  1WI0 A;  3A1Q A;  4N58 A;  3KLS X;  4W9K A;  2LGS A;  5CHF A;  2NMQ A;  2QMT A;  4WJN A;  3VTW A;  2E6X A;  4GB9 A;  3GZN B;  4EEW A;  2JVC A;  3TCA A;  3NRZ A;  3DOW A;  3NVW A;  5CTR C;  2MBO A;  1GG3 A;  5BMG A;  4LNK A;  2Z8L A;  3A4R A;  3S2A A;  2AEH A;  4MGI E;  4BVU C;  2ZJD A;  1QIL A;  2ZZP B;  2LGD A;  1JQ4 A;  1L4Z B;  1SGH A;  2ZVO A;  4LNI A;  4NPN A;  3V3X A;  1FPY A;  3L54 A;  2HDE A;  1HQR D;  4EZK A;  2KFK B;  1I7H A;  3ZTC A;  4JWS C;  4R3D A;  3ZKJ C;  1UBQ A;  1T3Q A;  2H89 B;  2LAS A;  2OJW A;  1EU3 A;  4GGQ A;  4MJS B;  1UH6 A;  5H8Y E;  4HVB A;  1ENF A;  4MGK E;  1WXQ A;  3DVN U;  4HCN B;  4B9K A;  3E56 A;  2A5U A;  2KJH B;  3NS1 A;  3ZIM A;  2NVU I;  3Q8F A;  1NVI D;  1QF6 A;  2D10 A;  4C7Y A;  1JRU A;  1IUE A;  3JSV B;  2PKO A;  1KRH A;  3AE3 B;  4BKT A;  3Q3M C;  4ARC A;  3WAN A;  2C7M B;  4GIV A;  4W9I A;  1TTN A;  4M0W A;  4L23 A;  2NBU A;  3DPD A;  5IAA C;  3DCG A;  3QK0 A;  1CMX B;  4N9F 4;  1FFU A;  2GOW A;  2JXT A;  3MC0 B;  3NHE B;  4C7Z A;  1JWM D;  4KZC A;  4AS1 A;  3N9Y C;  3Q3N C;  1GOZ A;  4DHZ E;  3UQB A;  4YTM B;  3KWV A;  3U52 E;  3B08 A;  3A9K B;  4JPS A;  4XWT A;  4HJG E;  2SAK A;  2J0M A;  1WXV A;  2N7E A;  1XQQ A;  1E8Y A;  2WXM A;  5BMH A;  3P4S B;  2DBY A;  1TIF A;  3I63 C;  3BVM A;  1JWU D;  2G3Q B;  1V97 A;  2NBV B;  1Y8R C;  5L95 C;  4N6E B;  1R4N B;  1MPE A;  2NTS A;  1WH3 A;  1YJ1 A;  2CU1 A;  4ITK A;  1WM3 A;  3T9L A;  2W3R A;  4OZA A;  3AEA B;  4EUT A;  1KTK A;  1WRI A;  1LGR A;  3NS8 A;  2V4L A;  4CQN A;  4BZA A;  4ZDV A;  2W82 A;  2KVR A;  4KKJ A;  4RCO A;  2KMA A;  3GOE A;  3P4P B;  3U8Z A;  1WSP A;  4B0M A;  1YD8 U;  2CHX A;  1FM0 D;  1I4H A;  3AEB B;  1JWB D;  3T8M A;  1RLF A;  4GN1 A;  2MP2 B;  3ZYY X;  2B76 B;  3ZJU A;  1XLN A;  2K9X A;  2IGG A;  2MJD A;  4XWW A;  2WXH A;  3UF8 A;  3MP9 A;  4KV2 A;  1K53 A;  2KWD A;  5TR5 A;  4OZB A;  1WGG A;  2E3T A;  2SEB D;  1FCC C;  4HEA 1;  1E5W A;  2PLP A;  5IO9 A;  1ZKH A;  4XE0 A;  3UGB B;  3U4E G;  4E71 A;  2V3S A;  4JGH B;  4OZC A;  2O6V B;  1SE9 A;  1ZDX A;  3RT3 B;  1DGJ A;  1J8C A;  3VUX A;  1V80 A;  4G0N B;  3RI7 C;  1T5X D;  1UNS A;  4K3C A;  1ROE A;  1RAX A;  2M4N A;  1BUI C;  3PRZ A;  2N9L A;  3VH3 B;  5G2N A;  1MHH E;  5D94 A;  4PS8 A;  3CF6 E;  2LVQ A;  4DDI D;  3ZRC A;  1XCQ L;  1TKG A;  4WJQ A;  3RZF A;  2L3Z A;  2M17 A;  3JVZ X;  4HDO A;  5IOI A;  2L00 B;  1E90 A;  1P7E A;  4MJS A;  4OVU A;  4ZRI A;  3B1L X;  4KDL B;  2M8S A;  2JX5 A;  2KK8 A;  2C7N B;  3D32 A;  1QOG A;  2J52 A;  2BBC A;  3PSE B;  2YLM A;  4FBJ B;  2PW9 A;  3FC4 A;  2JY6 A;  2MH7 A;  4KKI A;  4WQO B;  2GBM A;  1AWD A;  2EMS A;  3KQ4 A;  3P1M A;  2ZEQ A;  3RN9 C;  2CJO A;  2KZR A;  1SBB B;  3JSV A;  2REX A;  3C8Y A;  3TJP A;  1ZXI A;  2MBQ A;  2XBB C;  1JW9 D;  1WJN A;  1VZ6 A;  1IGC A;  3X0W A;  3R8B A;  3KUC B;  1L5P A;  1BT0 A;  2N9K A;  3QIJ A;  3VUW A;  2MEK A;  2IGH A;  4K81 A;  3PO0 A;  1UZX B;  2FCS A;  1V1P B;  1N62 A;  3ZQ4 A;  2N9E B;  3IG3 A;  1J7C A;  2LXC A;  4MM3 A;  4C80 A;  5IKC M;  1GB1 A;  2BTE A;  2WDV B;  3A9K A;  3TEX A;  3PTF C;  3IAS 1;  3AI5 A;  4GDK B;  4A8X C;  4ZHP A;  4HPM B;  4REZ A;  3DBL B;  2PE6 B;  3VR8 B;  2L05 A;  3CST A;  1WE6 A;  4XDC A;  2BYV E;  3PZD A;  1KM7 A;  1J7A A;  2HE7 A;  1SXT A;  4WAF A;  2D3A A;  2DAF A;  1NYQ A;  5J2R A;  2N4F A;  3NVZ A;  4TSS A;  2JF5 A;  2BW2 A;  2J0J A;  3A1Q B;  1FFV A;  1AW7 A;  2ON8 A;  2IO1 B;  4F7Z A;  2LHD A;  1XLP A;  4ICU A;  4YT0 B;  2WP9 B;  3P2B A;  3IVF A;  1WJU A;  2M0A A;  4BAX A;  3PRE A;  4IC7 B;  5DPR A;  4YTN B;  4HK2 A;  3Q3F A;  2MHJ A;  4IWP A;  5BO4 B;  4ZRP A;  1LM8 B;  2MSE D;  4ZRQ A;  1XEE A;  3ZXR A;  1R4N I;  4M00 A;  1PDX A;  4W9D A;  1IBX A;  3B2G A;  4PYU A;  2FIF A;  2KHW B;  1K50 A;  3RFZ B;  5HI1 A;  2EMT A;  1G6J A;  1FIQ A;  4Q2J A;  3U7Z A;  1E7V A;  1UF0 A;  3ALB A;  2MP2 A;  1NI3 A;  4TV3 A;  3GB1 A;  1AAR A;  4KIK A;  2RSU A;  1Y56 A;  2PIA A;  3RMK C;  1ET9 A;  1WMH A;  4M02 A;  1C9F A;  1WJ6 A;  1V81 A;  4JIO U;  3AED B;  3L4P A;  3PLV A;  1DYQ A;  3NVV A;  1YX6 B;  2EKE C;  4M8N A;  3CSF A;  3C0R B;  3RYT A;  3GP7 A;  3L10 B;  1TJE A;  1YN5 A;  2D3C A;  4AJY B;  1XT9 B;  1VDV A;  2O6V A;  4LJO B;  4I6P A;  4ZRK A;  3N32 A;  1LQB A;  1E8X A;  1YMH E;  5IN7 A;  1LO5 D;  3ONS A;  2MWS B;  3BIN A;  4NNJ B;  2FNJ B;  2MBE A;  3AU4 A;  2R2Q A;  2O6V D;  2NTT A;  3V6E B;  2RPQ A;  1EUV B;  4L2Y A;  2LUM A;  4M0W B;  5E6N A;  4YTP B;  1AYF A;  4FHK A;  2RDB C;  1MJD A;  2GB1 A;  1P1A A;  3MTN B;  2DZM A;  3MC8 A;  4XX5 A;  2M1M A;  3PV1 A;  2HTH A;  2FAZ A;  3PPA A;  1V5O A;  4HCP B;  3T3N A;  3EUB 2;  2Y5P A;  5D2M B;  1KJT A;  4D2K A;  1VRA B;  4HDQ A;  2LJ5 A;  3L17 A;  4NJ6 A;  2AL6 A;  2INN E;  1SIJ A;  1B9R A;  2MJ3 A;  4WUR A;  3KYD D;  3Q14 C;  2PVG C;  1PYW D;  2YVC A;  2NPT B;  4NQK E;  1ET6 A;  1DOI A;  1N6Z A;  1IP9 A;  1FRR A;  1OTR B;  4DK5 A;  2IY1 B;  2BVC A;  4W9G A;  3RZW C;  1UBI A;  1WX8 A;  1N5X A;  2JQR B;  1SSN A;  1XO3 A;  4FUL A;  3WA0 A;  3DWM A;  4PS7 A;  1CK1 A;  2LEK A;  4P1B C;  3TL5 A;  5KHQ A;  2BF8 B;  3CIR B;  2WXP A;  2JPH A;  2D5G A;  1NEK B;  1R4M B;  2WXR A;  4HPL B;  1UUP A;  4K1R B;  2IBI B;  3DBR B;  1UEL A;  2KQ4 X;  1V1P A;  1YOV B;  2NBW B;  1ZOY B;  4A55 A;  5FR3 A;  1LXD A;  3FAH A;  2KC2 A;  4NY0 A;  2KX0 A;  3V62 A;  4ZYS A;  2GBN A;  3GE3 C;  3QCA A;  3A4S C;  4GDK A;  4E3C A;  2LD9 A;  3UIP B;  1FNU A;  2VH1 A;  5AUK A;  3ZO5 B;  2K8C A;  3URY A;  3VRB B;  3SFD B;  3AE4 B;  3HUI A;  1TYG B;  4US9 A;  4ZOH C;  1T0Q C;  1B1Z A;  1L2N A;  4RM8 A;  4DXA B;  2VRR B;  1R7S A;  2LRU A;  1YX5 B;  2QC8 A;  3AUL A;  5CHV C;  3DBL I;  4RGM A;  2ZPY A;  5TSS A;  3ZTD A;  4K7U A;  4AWJ A;  4K7S A;  3H6N A;  2BT6 A;  4H2A A;  2Z0E B;  3U2S C;  2INP E;  3M3J A;  1EWC A;  2DEN B;  1CZP A;  3M62 B;  3RNE C;  4IOI E;  2ONQ A;  3ZGZ A;  3QA8 A;  2R61 A;  4AQ7 A;  1WGD A;  2ZW0 A;  2DYM A;  4ANW A;  1MG8 A;  5DPT A;  1SIF A;  1C79 A;  5BYQ A;  3TEZ A;  1PGB A;  2WWZ A;  3AEG B;  3HK0 A;  2C5L C;  5FKA C;  2G4D B;  1PFD A;  1E7U A;  3IT6 B;  3ZNZ B;  1EU4 A;  2RR9 A;  2LVP A;  2JU6 X;  2WS3 B;  2FUG 1;  2PE9 A;  1C3T A;  1TS4 A;  3KYC D;  3TEY A;  5JXV A;  4LNF A;  1F2R C;  3APC A;  3X23 A;  1TZO A;  1WJ4 A;  3IAM 1;  1OQY A;  3W1Y A;  2XK5 B;  3K9P B;  3QX1 A;  2L1A A;  4OW0 A;  3V60 A;  3HVD A;  1J7B A;  1E8Z A;  2A4Z A;  1OQQ A;  3A9J B;  1WRD B;  2LRW A;  1L0X B;  4I6L B;  2JZ3 B;  2MQJ A;  2WXJ A;  3N1X C;  2GBR A;  3DBS A;  2G9H D;  5MPO A;  3ENE A;  3ETR A;  3PS6 A;  1GB4 A;  2JYE A;  4LTU A;  1WM2 A;  4XGA B;  1QZE A;  2I2Y A;  1KFY B;  2X38 A;  3SD5 A;  4MGZ E;  2V0G A;  2GMI C;  3BYY B;  2KLC A;  2IY0 B;  1MG4 A;  1N63 A;  2KX3 A;  2WDQ B;  3Q6B A;  4MM3 B;  1WFY A;  4TQ0 A;  1EM7 A;  4W9E A;  2DHZ A;  4LLG M;  2HJ8 A;  2JWU A;  5BYS A;  1HTO A;  1FD6 A;  3AE7 B;  2QDF A;  4XZ4 A;  4FXC A;  1QOA A;  1VZ8 A;  2CHW A;  2KYW A;  2NPT A;  4EOY A;  3AXC A;  1OEY J;  3PZ8 A;  2I1J A;  2PEA A;  1VJK A;  1Q10 A;  2ACZ B;  4KSL C;  2UYZ B;  2J42 A;  3ZNG C;  4KGS A;  1HZ5 A;  1A5R A;  4RF1 A;  3J9C A;  5IP4 D;  4BKS A;  1ESF A;  2KWU B;  4PK1 A;  4ANX A;  4AUQ C;  3SDL C;  5LNK 1;  3H7S A;  2G4S A;  2KDI A;  4DBG A;  2DYB A;  1DOX A;  4RGN A;  3N30 A;  3BK1 A;  2W54 A;  3JW0 X;  4K3B A;  3RD2 A;  4IG7 B;  1P3Q U;  4BKS D;  3RCZ A;  3U7D A;  4TUU A;  3HM6 X;  1IBX B;  3DDC B;  1WF9 A;  2QIL A;  3OJ4 B;  2CR5 A;  4WWO A;  2FBW B;  3CWI A;  3ZDT A;  2L83 A;  3CMM B;  1LFD A;  3DBR I;  4KIK B;  3L16 A;  3EFC A;  2WU5 B;  1YN4 A;  1D5X C;  1WMH B;  2K8H A;  1YQB A;  5LXH A;  5J18 A;  2N1V A;  3VRA B;  2J7Q B;  5J17 A;  4XC2 A;  3W2D A;  3BK2 A;  2CU3 A;  2KAJ A;  3MHZ A;  2D2Q A;  4MGY E;  4PT5 A;  3M95 A;  4ICV A;  2K0P A;  2ASQ A;  3HHM A;  2AQ3 B;  4YSY B;  5C23 A; 
#chains in the Genus database with same CATH homology
 3Q3N C;  3N20 C;  3RNG C;  3Q14 C;  3RNB C;  1T0Q C;  3DHG C;  3RNE C;  3RMK C;  3GE3 C;  3I63 C;  3Q3M C;  4P1B C;  2IND C;  3I5J C;  1T0R C;  3N1X C;  3RI7 C;  1T0S C;  3RNF C;  2INC C;  3RNC C;  3GE8 C;  3N1Y C;  3DHI C;  3RN9 C;  3Q2A C;  3RNA C;  4P1C C;  3N1Z C;  3DHH C;  3Q3O C;  2RDB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...