3RNGC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/w167e double mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rngC00
3RMKC 3DHIC 1T0SC 3RNEC 3I5JC 2INDC 3N1XC 3Q14C 3RNCC 3RNAC 3Q2AC 3Q3OC 3DHGC 2INCC 3Q3MC 3GE3C 3RNFC 3N1ZC 3RN9C 3DHHC 1T0QC 4P1BC 3N1YC 3Q3NC 3RNGC 2RDBC 3RNBC 1T0RC 3I63C 4P1CC 3N20C 3RI7C 3GE8C
chains in the Genus database with same CATH superfamily
3AE3B 2MW5A 3KWLA 1EO6A 3DBRI 1UZXB 2WXOA 4NNJB 2PTLA 3VRBB 1BMLC 2PIAA 1VZ7A 2DZJA 4QAYA 4HPMB 3UINB 1LFDA 2RPQA 2GRIA 2VZKB 1WI0A 3RI7C 2L8JA 4BKGA 2JUOA 3DHIC 3VUWA 5G2NA 1WJ6A 2KWUB 1AYFA 2RR9A 4REZA 1V1OA 1SJHD 1TZOA 2FCNA 2FUG1 2NBUA 4KGTA 4N58A 4USAA 2VH2A 3L0WB 4IC7B 2LVPA 2WS3B 2IGDA 4CQNA 1FRRA 3MJ5A 4GDKA 3OJ3A 1WXAA 4J6IA 1AARA 4KKJA 1SXTA 4WAFA 1L0VB 2NPTA 2K6QA 3DQVA 5E6NA 4BVUC 3DBLI 3PGEA 1XLQA 4M02A 4EKUA 2KLGA 1GC7A 4CYEA 2LZ6A 2AYOB 4E71A 1OGWA 4HXDA 1ET9A 1YJ1A 3DBHB 2KNBA 2INCC 4MJSA 2DNFA 3U7ZA 4CHKA 4HKZE 4IWQA 1YOVB 3PRZA 3QX1A 1ZW7A 1C4AA 2MJDA 3A1QB 4KKIA 2RDHA 1L5PA 3T8MA 1WX8A 2X8XX 3IAS1 4FHKA 5DPRA 2HTHA 2V9HA 2DZMA 1ACCA 4OZCA 3VQIA 3IVFA 3GZNB 2G4DB 1T0RC 2RPVA 3RUIB 2LRUA 1RFKA 5JH5C 3ZJVA 2WHIA 4FADA 1N63A 2WDRB 1E6EB 1QOAA 1ZGUB 2FUHB 2IO1B 3B2GA 1C76A 1BUIC 2Z0EB 5D3DA 2LWPA 4NJ7A 2WNMA 1TGZB 5HKHA 1IUEA 3AV8A 4TUUA 1I7HA 1ZPSA 3WAOA 4ASWC 2E6XA 1P7FA 1VRAB 2BYEA 2CHXA 2JT4B 3ONSA 4HEA1 4MELA 3ZO5B 1NYQA 1C77A 2M19A 3B2FA 4HKQA 3Q3MC 3NVVA 3KWVA 1FCLA 5HI1A 2DAFA 4W9GA 1FRDA 5E6PA 2KWVB 4ZOHC 2G1EA 4DBGA 4JQWC 2UYZB 3ZNZB 1EWYC 4PK1A 2MRPA 2WGSA 3AE1B 5TSSA 3UGBB 1UH6A 2BQQA 4LNIA 4IW0A 3OJ4B 1J0GA 4A3OA 1WY8A 4HPPA 1K53A 4HROA 4JE3B 3DBRB 1E8YA 3PLVA 2LJIA 2BS4B 2JQRB 4OHJA 1V5TA 2FE8A 1R4MB 3UQAA 2KHWB 3RZFA 3NJTA 2AQ1B 5G5HA 2EKIA 4MACA 1YQ4B 2SEBD 2KTRB 1P1AA 1D5MC 2V0GA 1UF0A 4FJZA 2IO3B 3VAWA 2KDMA 1XF5L 5C1ZA 4KDLB 3R7QA 1NVID 4K7SA 1C9FA 2K9XA 5IKCM 2HD5B 4YSZB 1OEYJ 3V60A 1LO5D 1V2YA 4W9EA 1PQSA 2I2YA 2EMSA 3BYTB 1MHHE 4G50A 4WH4A 3AU4A 2WDVB 1E10A 4Q2JA 2DYMA 2MSED 5D3IB 4YSXB 2MBBB 3ETRA 2CS4A 1OQYA 3R8BA 1EM7A 4XC2A 1T3QA 3IBEA 2C5LC 1LGRA 2ZCCA 1VD2A 3MHSD 1CZPA 3DBLB 4WWMA 3V61A 2Q5WD 4ANVA 1D5XC 3AE4B 2PVOD 2W3SA 4MGYE 2IGHA 3BY4B 1G6JA 1WYGA 1EU3A 4ACFA 3H9DA 4ZDVA 1KTKA 1VZ8A 3AE5B 3MP9A 4RM9A 2LD9A 1YQ3B 2LRWA 4GN1A 1HTOA 1XQQA 2RMMA 1TBEA 4EEWA 2DHZA 2LGSA 1GC6A 1GB4A 3MFGA 3NS1A 1LXDA 1SIFA 2V3SA 5H8YE 1KM7A 1C3TA 3QARA 3RYTA 3SEBA 3BWUD 4HVBA 2BYVE 1E8ZA 2AQ3B 2JU6X 1RM6C 1EF5A 1PFDA 1PGAA 3EA6A 3CSTA 2PW9A 4PS3A 2N4FA 1UD7A 4XWWA 1Q0WB 2L3ZA 2MHJA 4L2YA 1UELA 1F0ZA 3ZVVA 3ZGZA 5E6JA 2QCZA 1RLFA 2BB6A 5IO9A 2ZNVC 3AI5A 2G9HD 4XDDA 2K5PA 3N32A 1NI2A 1L4ZB 5DPTA 2LHDA 2Y3AA 1TS3A 4HCPB 2KJRA 4M0WB 2XN9C 2MWSB 1L2NA 3QCAA 3NZUA 4URKA 3J9CA 4XZ4A 2JYEA 2JY6A 4II3B 1FCCC 2YVCA 3ZYYX 2BTEA 2CKHB 1CK1A 4GSWA 2IZVB 4FBJB 1IGDA 1P7EA 1WMHB 1R7SA 4YTPB 4JX1C 3P2BA 4HK2A 2LHEA 1EU4A 2K3UA 2N7EA 3IHPC 2JRHA 1FXIA 1MHXA 5BMGA 1PGXA 3H7PA 4FJYA 4JPSA 2M17A 4RM8A 3VR8B 2JXXA 2KMMA 3QAQA 2BPSA 3RNEC 4BKSD 1B1ZA 1V6EA 4LDTD 1P3QU 3R66C 2NTSA 2JWUA 3WCQA 4A8XC 1KH0A 4ZRQA 5BMIA 1K52A 2FCQA 1S1QB 2W82A 2R61A 2WP9B 2MBEA 1MPEA 1IPGA 3KVFB 4CO7A 1EUVB 2WXQA 5DCNA 4X57B 3L08A 2L0TA 1D3ZA 4ZRPA 4FJVB 2BW2A 4S17A 3ML9A 4C56C 1WJUA 1T0YA 3HM3A 2INPE 1KLUD 1NYRA 1KJTA 4RFBA 1V49A 4HJKA 4O1NA 3DWMA 1K8RB 2EELA 1QOGA 1RWSA 2I1JA 3PRMB 1HA5A 3I57A 3Q14C 1FNUA 3EFCA 4AS1A 2KKCA 1WJ4A 2HTME 3T9LA 4IKGA 2B76B 1L4DB 2WU5B 3AU5A 4A55A 1I4PA 3BVGA 3RCZA 1FNWA 2KD0A 2KVZA 3AE8B 1D6EC 3H7SA 3GS2A 3AULA 5J18A 4MT5A 3N30A 2K8BA 2D11A 1YN4A 5CHFA 3NRZA 1QOFA 1V1PA 5J2RA 2ZW0A 4G0NB 4H2AA 2C9WB 1DYQA 2KDBA 1CJEA 1GB1A 4ARIA 1Y56A 2N9EB 2NS5A 1WGGA 4AOFA 1BT0A 3KUCB 4JWSC 4G3XB 3NHEB 2IJ0A 5G5GA 5BO4B 2WXKA 2OJWA 3H8HA 4XDCA 3RN9C 4C80A 3PO0A 4L1BA 1MFWA 2N7JA 4P6VF 1D5ZC 3ALBA 4GXBA 1ET6A 4GDLB 4IWOA 2O2VA 5JHBA 4W9IA 1YN5A 2WWZA 5DPSA 1GJZA 2KDIA 4GDLA 1UWXA 3BK1A 1S3SG 3AN1A 3HIZA 1C78A 3H1UA 1WM3A 2KYWA 5C2TB 3U7DA 1DOYA 3NUHB 2YLMA 2KC2A 3MC8A 1YJJA 5H92C 3GB1A 3TL5A 4ANXA 3SFDB 1OQQA 2IO0B 2LJ5A 5C23A 1J8CA 2KDFB 2V3NA 3RNFC 3A9JA 5MPOA 3WALA 3ZUNA 2MBQA 3DBSA 1A5RA 2J53A 3X0WA 3ZJTA 1TS2A 5HFYA 2Y5BB 1Q5WB 1VJKA 2L52A 3TEYA 2HE7A 2KDEB 1DOIA 3NVZA 3RNAC 4L23A 3U2SC 4B9KA 1WH3A 4W9FA 1KOTA 5CTRC 3NG0A 4KSLC 2JSVX 1XT9B 2WU2B 2MP2A 4GDKB 4C4VB 1WF9A 1WGYA 3VFKA 3V6EB 2NPTB 2W55A 3VTUA 1UBQA 5DPWA 1QOBA 3PZ7A 4C4VA 4WAAA 3R3MA 3DDCB 3NOBA 3OG5A 1DGJA 1JQ4A 2W3RA 2ACZB 4P1BC 4MEMA 2N1VA 3ZKJC 4HJGE 2MBOA 4TQ0A 3C19A 4M00A 2KMAA 4LNOA 4EOYA 2TSSA 3D32A 4RH6A 3X23A 2L7RA 4MJSB 1E8XA 3W5UB 3FC4A 2NBVB 4LDTB 2JZZA 2KJ6A 4BKSA 2IBIB 2DYOA 4DWFA 3GP7A 2RGFA 2ICIA 1I42A 3ZLZA 3WAMA 4JWUC 4XGAB 5FR3A 4LLGM 2KFKA 1N60A 3GOEA 5LNK1 3VUXA 2ZNVB 4C7ZA 3CWIA 3DOWA 5IP4D 1ZXIA 2CJNA 2PPHA 1SJED 3V05A 5LXIB 3IFWB 4BAXA 3AEFB 5TR5A 1E7PB 1I4RA 1I4GA 1SE4A 1SF0A 2D10A 4ZYSA 2PE9A 3VUYA 3QA8A 3ML8A 1R4NB 3VXWA 2INDC 4WWPA 4KSKC 1WYWB 3TMPB 3BK2A 4WIPA 3E9SA 1I4XA 4AWJA 4W9HA 2Y5CA 4K7WA 2GOWA 3WA0A 5J17A 3E56A 1V8CA 1YD8U 1NI3A 1B9RA 1FO4A 1JCKB 1HXYD 2KT7A 2UU7A 2ZPNA 2FAZA 3A9KA 1T5XD 1ENFA 2L32A 4XX5A 2REXA 5CHWA 4IM3A 4MSMB 2BBCA 5T8IA 2G45B 4W9KA 1TKEA 3R7RA 4DHJD 2J7QB 3RULA 1FIQA 3ZXRA 1SE3A 2WXFA 2EMTA 1WIAA 4AJWA 5LLIA 4ANWA 5D6JB 1TS5A 2WXGA 4OVVA 2A5UA 4FULA 4MGIE 3T3NA 2KLCA 1ROEA 1WE6A 4HCNB 3DHHC 4I6PA 2AX5A 2PEAA 5KHQA 2BGFA 2KJHB 4AP4C 2MA9B 1GAQB 4F8CB 3ZJUA 2IY1B 1MG8A 1WGDA 3VHTC 3A33B 1ZP0B 2RD0A 3P4QB 4W9JA 4MM3B 1GG3A 2YEPB 4DDID 1ESFA 2WXHA 4BOZB 2AL3A 4P16A 1Z5SB 2X38A 2D07B 4MM3A 4KGSA 5D94A 2LGYA 3OWEB 3O13A 3ZW3A 3TCAA 4KVGB 2ZEQA 4US9A 3Q8BA 2PVGC 1WGRA 1TTNA 3NS8A 2D2QA 2NVUI 1OTRB 1M94A 3AM9A 1FEHA 3ZNHB 1YMHE 2J52A 5E6OA 2KQ4X 1KFYB 3DVNV 2MBHA 1WXQA 2BWES 1QT9A 2R2QA 3GE8C 2N0SB 2XNAC 4PS7A 3UF8A 2BF8B 1PGBA 1UWMA 4WJOA 3NZSA 4GMVA 1JW9D 2GBMA 1Q10A 3ZRFA 4EUTA 2L1AA 4OVZA 2M0XA 2KN5A 3P42A 1UNSA 3RPFC 3KYCD 1J19A 1V97A 3W1SA 2LGIA 3I63C 2INNE 3PPAA 3CIRB 5EE9A 2JYTA 5GMVA 1H8CA 1K50A 4HLEA 4PT5A 1V80A 4IDIA 3HM6X 4M8MA 4II2B 1ZDVA 1RFAA 4IWPA 4A3PA 5L95C 2G3QB 4TQ1A 4FA6A 4OZAA 4K7UA 2MCNB 1WWTA 3U4EG 2NBWB 3UIPB 2NCNA 3KYDD 2K8CA 2DAJA 1YIWA 1T0SC 3AEDB 3W2DA 1NEKB 2MEKA 3JYUA 1HQRD 2CR5A 4OW0A 2JVCA 3EHVA 4FXCA 3EFUA 4IOIE 4E74A 1WX9A 1FD6A 1HE8A 2LFIA 3RFZB 2FCSA 3C8YA 4N6EB 3CMMB 3KLSX 2DWQA 1AN8A 1XEEA 4M01A 5FK9C 1Z2MA 2O6VA 2M56B 2IYDB 1FFUA 1TZ1A 4NAWA 4TKNA 2GBJA 4I6LB 1E5WA 3IXSA 4BBNF 1VZ6A 4ICUA 1H4RA 5EE1A 3M3JA 4WJNA 3N20C 4IG7B 1ZUD2 2HJ1A 4A20A 1P9DU 3PSEB 1WR6E 3DVGX 2GBKA 3H7PB 1M4VA 3MTNB 2NR2A 1T6BX 5KHOA 3KH0A 3ZXVA 4RGOS 4NPNA 4N9F4 3ENEA 3L10B 5HG2A 3TEWA 2V3PA 5CHVC 2JZ3B 4KIKA 1E7VA 4D2KA 1F77A 2LASA 2WLBA 2BT6A 1FXTB 2NMQA 2K1FA 2J0MA 2XK5A 4DHJB 1GNUA 1XD3B 2DZKA 1CQVA 2IPKD 1QQRA 1UUPA 1ZOYB 4F1SA 3EGRA 1XO3A 4TMAB 1TKGA 2KQSA 2I38A 4A90A 1C1YB 4KDIC 1MJDA 4J3OD 1XCTL 1J7BA 2JPHA 2KFJA 2N9KA 5G55A 2RDBC 4N59A 3M63B 4LNFA 1N5WA 3VVWB 3AEAB 5BYSA 4ZHOA 2J0KA 4IM2A 1L6VA 1FNVA 3DWGC 3LJ3A 4F7ZA 2CU1A 1E8WA 2VH1A 1F2RC 4GOCA 4W9DA 2D3AA 3AE2B 3CSFA 5EDSA 2LXCA 3VR9B 2FBWB 2WYQA 3VTWA 3BYYB 4ZRIA 4K81A 2ZPYA 5LXHA 2DLBA 1V1PB 4DHZB 2D5GA 3S2AA 1VLBA 2FCMA 2CHZA 1IBXA 3SDLC 4PYUA 5D2MB 4B6WA 1FM0D 2OJRA 3P63A 2Z8LA 2CJOA 2DBYA 4ICVA 4RGNA 1V86A 1AW7A 1T0QC 2N9PC 4IUMB 3SFEB 1PDXA 1A70A 3W1SC 1IYFA 2JX5A 3AE6B 2PE6B 2QC8A 3AEGB 3SU8X 2C7MB 4RMAA 1TKYA 1WZ3A 5D7GA 4B0MA 4WQMA 1JMLA 3QQ8B 4EZKA 3AE9B 4DDGD 3Q3JA 2KOXA 1FMAD 3DVGY 2J0JA 3BVMA 4JLCA 1NBFC 3APFA 1TJEA 3V3XA 2O2VB 1I4QA 1L0YB 3FKYA 3M95A 4BFRA 1YQBA 4GLSC 3A4SC 4M8NA 2LI5A 3L54A 1SGHA 2K6DB 1SSNA 2RSUA 4RCOA 2V1YA 1HZ6A 2LXAA 4MH0E 3TEXA 1WM2A 3PS6A 1XCQL 2KVRA 2GBRA 3A9JB 4S0RA 3Q69A 1CMXB 2HJ8A 3RNCC 5BYRA 2V4LA 2WDTB 1JWSD 3N1ZC 3K9PB 1SE9A 1PUTA 1J7CA 1RRBA 2WX0A 3KUZA 2EKEC 3HK0A 3P1MA 2PKOA 5HHDG 3HRDD 1FPYA 3W1YA 2LUEA 4PYZA 2L00B 5EE3A 4I6NB 1IGCA 4NAMA 3Q2AC 1R4MI 4NJ6A 3ZTDA 2WXNA 3JVZX 2G4SA 2MP2B 4YWGG 1WGHA 4US8A 1F2RI 2M1MA 2WXIA 2L0FA 2BS3B 3QIJA 3Q6BA 4OVUA 3B0AA 3ECIA 2ZJDA 1HEZE 2AL6A 3LDZE 4FHJA 2JRIB 4IM0A 4K1RB 4MH8A 4LNNA 2BKFA 3VH4B 2KZRA 2MLBA 5AUIA 1XLOA 2MQJA 3R2TA 2GB1A 2WXLA 4LCDE 3DPDA 3PLUA 1HZ5A 1KLVA 1EF1A 4UDUC 1KRHA 2LVQA 2AWTA 3VTVA 5C3JB 1QLBB 1SE2A 3Q3OC 1WZ0A 4BZAA 4GB9A 1WXMA 2L76A 3HUIA 2MX2A 5CX3A 2Z59B 2KC1A 4XYCA 3NZ3A 4DQOC 2W54A 2KFKB 3EECA 4BBNC 3PZDA 2C7HA 3Q8AA 2O6VD 3FAHA 2FIDA 2N1WA 1JROA 1F52A 5I4DA 3W5VB 4ZRKA 1V5OA 5AUKA 1TYGB 2V4IB 4RGTA 3VDZA 3MC9A 4GU2A 3AECB 1P0RA 1SIJA 4ITKA 3IG3A 1NDDA 2WXMA 4ARCA 3NY5A 3O65B 3Q8EA 2DX5B 3LXFA 1ZKHA 2BYTA 1JWAD 5EE0A 1KF6B 4NJCA 1E0ZA 2QIEB 3A1QA 3PV1A 3AEEB 1JRPA 1JRUA 2KMCA 3C0RB 2CU3A 3RNBC 3OAWA 2K0PA 3ZIMA 3L16A 3A9KB 1ZDXA 4PS8A 4B95A 3T3OA 2XBBC 2B3AA 3PREA 2GI9A 4NQLB 1WX7A 2MH7A 2QSDA 3BINA 4KX6B 1UGMA 4ZRJA 4YL8A 1QZEA 2WXPA 3L17A 2YEPF 4WWNA 2IGGA 2KTFA 3SHQA 3BVZA 3SD5A 4EZJA 1N6ZA 3QHTA 3AB5A 2GMIC 5IA7A 1C4CA 2N7DA 2CHWA 1TY2A 2MJ3A 3BZDB 1NENB 1F9JA 3IAM1 3RZWC 2OOBB 4YT0B 1ZXHA 5AZGA 3PHWB 2BS2B 4YSYB 3RD2A 2VRRB 3QC8B 5FR6A 3IT6B 1MI0A 1N5XA 4HWIB 2BB5A 3TJPA 2J4XA 1XLNA 3TSSA 2BVCA 1UBIA 3UI3A 1C4PA 1F1HA 2L83A 2QILA 1V81A 4WJPA 3K9OB 3ZRCA 1L6UA 3B08A 5IOIA 1JWMD 3P4PB 1SB3C 1Q1OA 3P4SB 1EWCA 3PTFC 2ON8A 3VRAB 2LVOA 3MHZA 4BOSC 2LGDA 1N62A 4ZYNA 1VDVA 4K3CA 2NTTA 1L0XB 2KTRA 3GE3C 1C79A 4LJOB 1UGJA 4K3BA 3KQ4A 2ZZPB 2K25A 2N9XA 3PRPB 3SR6A 3QWZB 1TY0A 1Y8RC 1V9JA 3HVDA 4BKTA 2BKRB 3TUOA 4E3CA 2AEHA 4WURA 5JZEB 4WQOB 2KWCA 5AZFA 1PYWD 3H6NA 2WXRA 3RNGC 1GUAB 1GPXA 3QK0A 2KACA 3AH7A 1U4AA 1WRDB 1JWUD 1L7YA 2FNJB 3TEZA 2ONQA 1I35A 4TV3A 2D3BA 4HPLB 2D3GA 2K22A 4RF1A 2XEWA 4GGQA 3Q8CA 1HTQA 5JXVA 2QEJC 2QJLA 3EC8A 4DHZE 3Q8FA 1SBBB 2WXJA 1WR1A 4HRSA 2KX3A 4KZCA 2KQ7A 4RF0A 4RGMA 1P98A 3WANA 3MJWA 3QJZA 2KK8A 4KGRA 4AUQC 3A4RA 2KAJA 1STEA 1LM8B 3HVZA 3Q3NC 1XXGA 4P1CC 4EE2A 3HHMA 1FXAA 2OEDA 3AEBB 4EZLA 5BMHA 2LUMA 2O6VB 3AMZA 4A6QA 1YJIA 4B0EA 4DXFA 1WFYA 4NAWB 1AWDA 2H89B 3NVWA 1SEBD 1YX5B 2KANA 3UQBA 5AEKB 4G11A 3WAPA 4W9LA 1D4BA 2M0AA 2VZKD 1WXVA 3V62A 3IT4B 3N9YC 3B9JA 2C60A 2DZIA 3PT2B 3PZ8A 3KW5B 3BIID 4KZ0A 4XWTA 3ZDTA 4M0WA 4NQKE 2GLSA 2KXJA 4NZLB 3ZQ4A 2HDEA 5AZHA 4KIKB 2GBNA 2JF5A 2I1KA 4FN2A 3U52E 4WWOA 1IP9A 3MC0B 1WXSA 1WJNA 3N1XC 2A4ZA 3VH3B 1WMHA 4XE0A 3DHGC 3URYA 4MSQB 4RNAA 2WX1A 2ZCBA 5GXGB 2E3TA 2XK5B 1DOXA 3ZNGC 3N1YC 3EUB2 2PLPA 2H88B 4LJPB 4MGKE 2Z0DB 3RMKC 2D3CA 3I5JC 2IO2B 2DYBA 1WGKA 3OLMD 1MG4A 2KWDA 1QILA 3DCGA 3APCA 4LNKA 2DENB 3CF6E 1OQRA 2ASQA 2ZVOA 4LK0M 5BYQA 3L13A 1TS4A 3P4RB 2ZW1A 2M8SA 3U30A 2FIFA 3U8ZA 2QMTA 3I3TB 2PJHA 4MDKE 2R2OA 2JXTA 5L83A 1GOZA 2BWFA 3ABVB 1LQBA 4NY0A 2Y5PA 4TSSA 3JW0X 4DXGA 4JIOU 4YTNB 2AQ2B 1IBXB 1VCBA 3DBHI 1RAXA 4DXAB 4YXDB 1ISNA 2K39A 4KV2A 1I4HA 2LGXA 1YX6B 1MVKA 4HDQA 2IDYA 1RYJA 1JWBD 2J42A 2W9NA 4WJQA 3JSVB 1X1MA 2SAKA 2IY0B 3TBLD 4DK5A 2L05A 4ZHPA 4MGZE 3AXCA 3LB8C 3RT3B 1OEYA 5IN7A 1TT5B 4R3DA 3JSVA 3R2IA 1E7UA 2QDFA 2ZVNA 2OHFA 2QHOA 1J7AA 3ZNID 1WE7A 3TIXA 2UWQA 4YTMB 4JGHB 2M4NA 3UIOB 4AJYB 4AQ7A 3GZNI 2RDGA 2C7NB 1QF6A 3PHXB 2KO3A 1QKZA 3PVLA 2WDQB 3B1LX 5FKAC 2MJEA 1R4NI 3WIMA 3KUDB 3NVYA 4C7YA 3L4PA 4JL9A 2LEKA 3FILB 3AE7B 5IAAC 3ZDMC 1OFFA 3APDA 3ZTCA 4C00A 3W9CB 4EFOA 1TIFA 3FILA 4W9CA 1WRIA 3M62B 2KN4A 1E9MA 2K8HA 1E90A 2BYFA 2LMCA 4GIVA 5JHAA 3I9V1 3V6CB 3DVNU 1ZE3D 2WQYB 4A9AA 1K51A 1KLGD 1N61A 1BXTA 3N3KB 1JALA 2JWZA 4OZBA 2N9LA 1VR9A 4FLHA 4HDOA 2PMVA 4P7IA 4ANUA 3Q3FA 1FFVA 2JZPA 1YN3A 1YNTE 1XLPA 3LYYA 2KX0A 1WSPA 4LTUA
chains in the Genus database with same CATH topology
3RMKC 3DHIC 1T0SC 3RNEC 3I5JC 2INDC 3N1XC 3Q14C 3RNCC 3RNAC 3Q2AC 3Q3OC 3DHGC 2INCC 3Q3MC 3GE3C 3RNFC 3N1ZC 3RN9C 3DHHC 1T0QC 4P1BC 3N1YC 3Q3NC 3RNGC 2RDBC 3RNBC 1T0RC 3I63C 4P1CC 3N20C 3RI7C 3GE8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMK C;  3DHI C;  1T0S C;  3RNE C;  3I5J C;  2IND C;  3N1X C;  3Q14 C;  3RNC C;  3RNA C;  3Q2A C;  3Q3O C;  3DHG C;  2INC C;  3Q3M C;  3GE3 C;  3RNF C;  3N1Z C;  3RN9 C;  3DHH C;  1T0Q C;  4P1B C;  3N1Y C;  3Q3N C;  3RNG C;  2RDB C;  3RNB C;  1T0R C;  3I63 C;  4P1C C;  3N20 C;  3RI7 C;  3GE8 C; 
#chains in the Genus database with same CATH topology
 3AE3 B;  2MW5 A;  3KWL A;  1EO6 A;  3DBR I;  1UZX B;  2WXO A;  4NNJ B;  2PTL A;  3VRB B;  1BML C;  2PIA A;  1VZ7 A;  2DZJ A;  4QAY A;  4HPM B;  3UIN B;  1LFD A;  2RPQ A;  2GRI A;  2VZK B;  1WI0 A;  3RI7 C;  2L8J A;  4BKG A;  2JUO A;  3DHI C;  3VUW A;  5G2N A;  1WJ6 A;  2KWU B;  1AYF A;  2RR9 A;  4REZ A;  1V1O A;  1SJH D;  1TZO A;  2FCN A;  2FUG 1;  2NBU A;  4KGT A;  4N58 A;  4USA A;  2VH2 A;  3L0W B;  4IC7 B;  2LVP A;  2WS3 B;  2IGD A;  4CQN A;  1FRR A;  3MJ5 A;  4GDK A;  3OJ3 A;  1WXA A;  4J6I A;  1AAR A;  4KKJ A;  1SXT A;  4WAF A;  1L0V B;  2NPT A;  2K6Q A;  3DQV A;  5E6N A;  4BVU C;  3DBL I;  3PGE A;  1XLQ A;  4M02 A;  4EKU A;  2KLG A;  1GC7 A;  4CYE A;  2LZ6 A;  2AYO B;  4E71 A;  1OGW A;  4HXD A;  1ET9 A;  1YJ1 A;  3DBH B;  2KNB A;  2INC C;  4MJS A;  2DNF A;  3U7Z A;  4CHK A;  4HKZ E;  4IWQ A;  1YOV B;  3PRZ A;  3QX1 A;  1ZW7 A;  1C4A A;  2MJD A;  3A1Q B;  4KKI A;  2RDH A;  1L5P A;  3T8M A;  1WX8 A;  2X8X X;  3IAS 1;  4FHK A;  5DPR A;  2HTH A;  2V9H A;  2DZM A;  1ACC A;  4OZC A;  3VQI A;  3IVF A;  3GZN B;  2G4D B;  1T0R C;  2RPV A;  3RUI B;  2LRU A;  1RFK A;  5JH5 C;  3ZJV A;  2WHI A;  4FAD A;  1N63 A;  2WDR B;  1E6E B;  1QOA A;  1ZGU B;  2FUH B;  2IO1 B;  3B2G A;  1C76 A;  1BUI C;  2Z0E B;  5D3D A;  2LWP A;  4NJ7 A;  2WNM A;  1TGZ B;  5HKH A;  1IUE A;  3AV8 A;  4TUU A;  1I7H A;  1ZPS A;  3WAO A;  4ASW C;  2E6X A;  1P7F A;  1VRA B;  2BYE A;  2CHX A;  2JT4 B;  3ONS A;  4HEA 1;  4MEL A;  3ZO5 B;  1NYQ A;  1C77 A;  2M19 A;  3B2F A;  4HKQ A;  3Q3M C;  3NVV A;  3KWV A;  1FCL A;  5HI1 A;  2DAF A;  4W9G A;  1FRD A;  5E6P A;  2KWV B;  4ZOH C;  2G1E A;  4DBG A;  4JQW C;  2UYZ B;  3ZNZ B;  1EWY C;  4PK1 A;  2MRP A;  2WGS A;  3AE1 B;  5TSS A;  3UGB B;  1UH6 A;  2BQQ A;  4LNI A;  4IW0 A;  3OJ4 B;  1J0G A;  4A3O A;  1WY8 A;  4HPP A;  1K53 A;  4HRO A;  4JE3 B;  3DBR B;  1E8Y A;  3PLV A;  2LJI A;  2BS4 B;  2JQR B;  4OHJ A;  1V5T A;  2FE8 A;  1R4M B;  3UQA A;  2KHW B;  3RZF A;  3NJT A;  2AQ1 B;  5G5H A;  2EKI A;  4MAC A;  1YQ4 B;  2SEB D;  2KTR B;  1P1A A;  1D5M C;  2V0G A;  1UF0 A;  4FJZ A;  2IO3 B;  3VAW A;  2KDM A;  1XF5 L;  5C1Z A;  4KDL B;  3R7Q A;  1NVI D;  4K7S A;  1C9F A;  2K9X A;  5IKC M;  2HD5 B;  4YSZ B;  1OEY J;  3V60 A;  1LO5 D;  1V2Y A;  4W9E A;  1PQS A;  2I2Y A;  2EMS A;  3BYT B;  1MHH E;  4G50 A;  4WH4 A;  3AU4 A;  2WDV B;  1E10 A;  4Q2J A;  2DYM A;  2MSE D;  5D3I B;  4YSX B;  2MBB B;  3ETR A;  2CS4 A;  1OQY A;  3R8B A;  1EM7 A;  4XC2 A;  1T3Q A;  3IBE A;  2C5L C;  1LGR A;  2ZCC A;  1VD2 A;  3MHS D;  1CZP A;  3DBL B;  4WWM A;  3V61 A;  2Q5W D;  4ANV A;  1D5X C;  3AE4 B;  2PVO D;  2W3S A;  4MGY E;  2IGH A;  3BY4 B;  1G6J A;  1WYG A;  1EU3 A;  4ACF A;  3H9D A;  4ZDV A;  1KTK A;  1VZ8 A;  3AE5 B;  3MP9 A;  4RM9 A;  2LD9 A;  1YQ3 B;  2LRW A;  4GN1 A;  1HTO A;  1XQQ A;  2RMM A;  1TBE A;  4EEW A;  2DHZ A;  2LGS A;  1GC6 A;  1GB4 A;  3MFG A;  3NS1 A;  1LXD A;  1SIF A;  2V3S A;  5H8Y E;  1KM7 A;  1C3T A;  3QAR A;  3RYT A;  3SEB A;  3BWU D;  4HVB A;  2BYV E;  1E8Z A;  2AQ3 B;  2JU6 X;  1RM6 C;  1EF5 A;  1PFD A;  1PGA A;  3EA6 A;  3CST A;  2PW9 A;  4PS3 A;  2N4F A;  1UD7 A;  4XWW A;  1Q0W B;  2L3Z A;  2MHJ A;  4L2Y A;  1UEL A;  1F0Z A;  3ZVV A;  3ZGZ A;  5E6J A;  2QCZ A;  1RLF A;  2BB6 A;  5IO9 A;  2ZNV C;  3AI5 A;  2G9H D;  4XDD A;  2K5P A;  3N32 A;  1NI2 A;  1L4Z B;  5DPT A;  2LHD A;  2Y3A A;  1TS3 A;  4HCP B;  2KJR A;  4M0W B;  2XN9 C;  2MWS B;  1L2N A;  3QCA A;  3NZU A;  4URK A;  3J9C A;  4XZ4 A;  2JYE A;  2JY6 A;  4II3 B;  1FCC C;  2YVC A;  3ZYY X;  2BTE A;  2CKH B;  1CK1 A;  4GSW A;  2IZV B;  4FBJ B;  1IGD A;  1P7E A;  1WMH B;  1R7S A;  4YTP B;  4JX1 C;  3P2B A;  4HK2 A;  2LHE A;  1EU4 A;  2K3U A;  2N7E A;  3IHP C;  2JRH A;  1FXI A;  1MHX A;  5BMG A;  1PGX A;  3H7P A;  4FJY A;  4JPS A;  2M17 A;  4RM8 A;  3VR8 B;  2JXX A;  2KMM A;  3QAQ A;  2BPS A;  3RNE C;  4BKS D;  1B1Z A;  1V6E A;  4LDT D;  1P3Q U;  3R66 C;  2NTS A;  2JWU A;  3WCQ A;  4A8X C;  1KH0 A;  4ZRQ A;  5BMI A;  1K52 A;  2FCQ A;  1S1Q B;  2W82 A;  2R61 A;  2WP9 B;  2MBE A;  1MPE A;  1IPG A;  3KVF B;  4CO7 A;  1EUV B;  2WXQ A;  5DCN A;  4X57 B;  3L08 A;  2L0T A;  1D3Z A;  4ZRP A;  4FJV B;  2BW2 A;  4S17 A;  3ML9 A;  4C56 C;  1WJU A;  1T0Y A;  3HM3 A;  2INP E;  1KLU D;  1NYR A;  1KJT A;  4RFB A;  1V49 A;  4HJK A;  4O1N A;  3DWM A;  1K8R B;  2EEL A;  1QOG A;  1RWS A;  2I1J A;  3PRM B;  1HA5 A;  3I57 A;  3Q14 C;  1FNU A;  3EFC A;  4AS1 A;  2KKC A;  1WJ4 A;  2HTM E;  3T9L A;  4IKG A;  2B76 B;  1L4D B;  2WU5 B;  3AU5 A;  4A55 A;  1I4P A;  3BVG A;  3RCZ A;  1FNW A;  2KD0 A;  2KVZ A;  3AE8 B;  1D6E C;  3H7S A;  3GS2 A;  3AUL A;  5J18 A;  4MT5 A;  3N30 A;  2K8B A;  2D11 A;  1YN4 A;  5CHF A;  3NRZ A;  1QOF A;  1V1P A;  5J2R A;  2ZW0 A;  4G0N B;  4H2A A;  2C9W B;  1DYQ A;  2KDB A;  1CJE A;  1GB1 A;  4ARI A;  1Y56 A;  2N9E B;  2NS5 A;  1WGG A;  4AOF A;  1BT0 A;  3KUC B;  4JWS C;  4G3X B;  3NHE B;  2IJ0 A;  5G5G A;  5BO4 B;  2WXK A;  2OJW A;  3H8H A;  4XDC A;  3RN9 C;  4C80 A;  3PO0 A;  4L1B A;  1MFW A;  2N7J A;  4P6V F;  1D5Z C;  3ALB A;  4GXB A;  1ET6 A;  4GDL B;  4IWO A;  2O2V A;  5JHB A;  4W9I A;  1YN5 A;  2WWZ A;  5DPS A;  1GJZ A;  2KDI A;  4GDL A;  1UWX A;  3BK1 A;  1S3S G;  3AN1 A;  3HIZ A;  1C78 A;  3H1U A;  1WM3 A;  2KYW A;  5C2T B;  3U7D A;  1DOY A;  3NUH B;  2YLM A;  2KC2 A;  3MC8 A;  1YJJ A;  5H92 C;  3GB1 A;  3TL5 A;  4ANX A;  3SFD B;  1OQQ A;  2IO0 B;  2LJ5 A;  5C23 A;  1J8C A;  2KDF B;  2V3N A;  3RNF C;  3A9J A;  5MPO A;  3WAL A;  3ZUN A;  2MBQ A;  3DBS A;  1A5R A;  2J53 A;  3X0W A;  3ZJT A;  1TS2 A;  5HFY A;  2Y5B B;  1Q5W B;  1VJK A;  2L52 A;  3TEY A;  2HE7 A;  2KDE B;  1DOI A;  3NVZ A;  3RNA C;  4L23 A;  3U2S C;  4B9K A;  1WH3 A;  4W9F A;  1KOT A;  5CTR C;  3NG0 A;  4KSL C;  2JSV X;  1XT9 B;  2WU2 B;  2MP2 A;  4GDK B;  4C4V B;  1WF9 A;  1WGY A;  3VFK A;  3V6E B;  2NPT B;  2W55 A;  3VTU A;  1UBQ A;  5DPW A;  1QOB A;  3PZ7 A;  4C4V A;  4WAA A;  3R3M A;  3DDC B;  3NOB A;  3OG5 A;  1DGJ A;  1JQ4 A;  2W3R A;  2ACZ B;  4P1B C;  4MEM A;  2N1V A;  3ZKJ C;  4HJG E;  2MBO A;  4TQ0 A;  3C19 A;  4M00 A;  2KMA A;  4LNO A;  4EOY A;  2TSS A;  3D32 A;  4RH6 A;  3X23 A;  2L7R A;  4MJS B;  1E8X A;  3W5U B;  3FC4 A;  2NBV B;  4LDT B;  2JZZ A;  2KJ6 A;  4BKS A;  2IBI B;  2DYO A;  4DWF A;  3GP7 A;  2RGF A;  2ICI A;  1I42 A;  3ZLZ A;  3WAM A;  4JWU C;  4XGA B;  5FR3 A;  4LLG M;  2KFK A;  1N60 A;  3GOE A;  5LNK 1;  3VUX A;  2ZNV B;  4C7Z A;  3CWI A;  3DOW A;  5IP4 D;  1ZXI A;  2CJN A;  2PPH A;  1SJE D;  3V05 A;  5LXI B;  3IFW B;  4BAX A;  3AEF B;  5TR5 A;  1E7P B;  1I4R A;  1I4G A;  1SE4 A;  1SF0 A;  2D10 A;  4ZYS A;  2PE9 A;  3VUY A;  3QA8 A;  3ML8 A;  1R4N B;  3VXW A;  2IND C;  4WWP A;  4KSK C;  1WYW B;  3TMP B;  3BK2 A;  4WIP A;  3E9S A;  1I4X A;  4AWJ A;  4W9H A;  2Y5C A;  4K7W A;  2GOW A;  3WA0 A;  5J17 A;  3E56 A;  1V8C A;  1YD8 U;  1NI3 A;  1B9R A;  1FO4 A;  1JCK B;  1HXY D;  2KT7 A;  2UU7 A;  2ZPN A;  2FAZ A;  3A9K A;  1T5X D;  1ENF A;  2L32 A;  4XX5 A;  2REX A;  5CHW A;  4IM3 A;  4MSM B;  2BBC A;  5T8I A;  2G45 B;  4W9K A;  1TKE A;  3R7R A;  4DHJ D;  2J7Q B;  3RUL A;  1FIQ A;  3ZXR A;  1SE3 A;  2WXF A;  2EMT A;  1WIA A;  4AJW A;  5LLI A;  4ANW A;  5D6J B;  1TS5 A;  2WXG A;  4OVV A;  2A5U A;  4FUL A;  4MGI E;  3T3N A;  2KLC A;  1ROE A;  1WE6 A;  4HCN B;  3DHH C;  4I6P A;  2AX5 A;  2PEA A;  5KHQ A;  2BGF A;  2KJH B;  4AP4 C;  2MA9 B;  1GAQ B;  4F8C B;  3ZJU A;  2IY1 B;  1MG8 A;  1WGD A;  3VHT C;  3A33 B;  1ZP0 B;  2RD0 A;  3P4Q B;  4W9J A;  4MM3 B;  1GG3 A;  2YEP B;  4DDI D;  1ESF A;  2WXH A;  4BOZ B;  2AL3 A;  4P16 A;  1Z5S B;  2X38 A;  2D07 B;  4MM3 A;  4KGS A;  5D94 A;  2LGY A;  3OWE B;  3O13 A;  3ZW3 A;  3TCA A;  4KVG B;  2ZEQ A;  4US9 A;  3Q8B A;  2PVG C;  1WGR A;  1TTN A;  3NS8 A;  2D2Q A;  2NVU I;  1OTR B;  1M94 A;  3AM9 A;  1FEH A;  3ZNH B;  1YMH E;  2J52 A;  5E6O A;  2KQ4 X;  1KFY B;  3DVN V;  2MBH A;  1WXQ A;  2BWE S;  1QT9 A;  2R2Q A;  3GE8 C;  2N0S B;  2XNA C;  4PS7 A;  3UF8 A;  2BF8 B;  1PGB A;  1UWM A;  4WJO A;  3NZS A;  4GMV A;  1JW9 D;  2GBM A;  1Q10 A;  3ZRF A;  4EUT A;  2L1A A;  4OVZ A;  2M0X A;  2KN5 A;  3P42 A;  1UNS A;  3RPF C;  3KYC D;  1J19 A;  1V97 A;  3W1S A;  2LGI A;  3I63 C;  2INN E;  3PPA A;  3CIR B;  5EE9 A;  2JYT A;  5GMV A;  1H8C A;  1K50 A;  4HLE A;  4PT5 A;  1V80 A;  4IDI A;  3HM6 X;  4M8M A;  4II2 B;  1ZDV A;  1RFA A;  4IWP A;  4A3P A;  5L95 C;  2G3Q B;  4TQ1 A;  4FA6 A;  4OZA A;  4K7U A;  2MCN B;  1WWT A;  3U4E G;  2NBW B;  3UIP B;  2NCN A;  3KYD D;  2K8C A;  2DAJ A;  1YIW A;  1T0S C;  3AED B;  3W2D A;  1NEK B;  2MEK A;  3JYU A;  1HQR D;  2CR5 A;  4OW0 A;  2JVC A;  3EHV A;  4FXC A;  3EFU A;  4IOI E;  4E74 A;  1WX9 A;  1FD6 A;  1HE8 A;  2LFI A;  3RFZ B;  2FCS A;  3C8Y A;  4N6E B;  3CMM B;  3KLS X;  2DWQ A;  1AN8 A;  1XEE A;  4M01 A;  5FK9 C;  1Z2M A;  2O6V A;  2M56 B;  2IYD B;  1FFU A;  1TZ1 A;  4NAW A;  4TKN A;  2GBJ A;  4I6L B;  1E5W A;  3IXS A;  4BBN F;  1VZ6 A;  4ICU A;  1H4R A;  5EE1 A;  3M3J A;  4WJN A;  3N20 C;  4IG7 B;  1ZUD 2;  2HJ1 A;  4A20 A;  1P9D U;  3PSE B;  1WR6 E;  3DVG X;  2GBK A;  3H7P B;  1M4V A;  3MTN B;  2NR2 A;  1T6B X;  5KHO A;  3KH0 A;  3ZXV A;  4RGO S;  4NPN A;  4N9F 4;  3ENE A;  3L10 B;  5HG2 A;  3TEW A;  2V3P A;  5CHV C;  2JZ3 B;  4KIK A;  1E7V A;  4D2K A;  1F77 A;  2LAS A;  2WLB A;  2BT6 A;  1FXT B;  2NMQ A;  2K1F A;  2J0M A;  2XK5 A;  4DHJ B;  1GNU A;  1XD3 B;  2DZK A;  1CQV A;  2IPK D;  1QQR A;  1UUP A;  1ZOY B;  4F1S A;  3EGR A;  1XO3 A;  4TMA B;  1TKG A;  2KQS A;  2I38 A;  4A90 A;  1C1Y B;  4KDI C;  1MJD A;  4J3O D;  1XCT L;  1J7B A;  2JPH A;  2KFJ A;  2N9K A;  5G55 A;  2RDB C;  4N59 A;  3M63 B;  4LNF A;  1N5W A;  3VVW B;  3AEA B;  5BYS A;  4ZHO A;  2J0K A;  4IM2 A;  1L6V A;  1FNV A;  3DWG C;  3LJ3 A;  4F7Z A;  2CU1 A;  1E8W A;  2VH1 A;  1F2R C;  4GOC A;  4W9D A;  2D3A A;  3AE2 B;  3CSF A;  5EDS A;  2LXC A;  3VR9 B;  2FBW B;  2WYQ A;  3VTW A;  3BYY B;  4ZRI A;  4K81 A;  2ZPY A;  5LXH A;  2DLB A;  1V1P B;  4DHZ B;  2D5G A;  3S2A A;  1VLB A;  2FCM A;  2CHZ A;  1IBX A;  3SDL C;  4PYU A;  5D2M B;  4B6W A;  1FM0 D;  2OJR A;  3P63 A;  2Z8L A;  2CJO A;  2DBY A;  4ICV A;  4RGN A;  1V86 A;  1AW7 A;  1T0Q C;  2N9P C;  4IUM B;  3SFE B;  1PDX A;  1A70 A;  3W1S C;  1IYF A;  2JX5 A;  3AE6 B;  2PE6 B;  2QC8 A;  3AEG B;  3SU8 X;  2C7M B;  4RMA A;  1TKY A;  1WZ3 A;  5D7G A;  4B0M A;  4WQM A;  1JML A;  3QQ8 B;  4EZK A;  3AE9 B;  4DDG D;  3Q3J A;  2KOX A;  1FMA D;  3DVG Y;  2J0J A;  3BVM A;  4JLC A;  1NBF C;  3APF A;  1TJE A;  3V3X A;  2O2V B;  1I4Q A;  1L0Y B;  3FKY A;  3M95 A;  4BFR A;  1YQB A;  4GLS C;  3A4S C;  4M8N A;  2LI5 A;  3L54 A;  1SGH A;  2K6D B;  1SSN A;  2RSU A;  4RCO A;  2V1Y A;  1HZ6 A;  2LXA A;  4MH0 E;  3TEX A;  1WM2 A;  3PS6 A;  1XCQ L;  2KVR A;  2GBR A;  3A9J B;  4S0R A;  3Q69 A;  1CMX B;  2HJ8 A;  3RNC C;  5BYR A;  2V4L A;  2WDT B;  1JWS D;  3N1Z C;  3K9P B;  1SE9 A;  1PUT A;  1J7C A;  1RRB A;  2WX0 A;  3KUZ A;  2EKE C;  3HK0 A;  3P1M A;  2PKO A;  5HHD G;  3HRD D;  1FPY A;  3W1Y A;  2LUE A;  4PYZ A;  2L00 B;  5EE3 A;  4I6N B;  1IGC A;  4NAM A;  3Q2A C;  1R4M I;  4NJ6 A;  3ZTD A;  2WXN A;  3JVZ X;  2G4S A;  2MP2 B;  4YWG G;  1WGH A;  4US8 A;  1F2R I;  2M1M A;  2WXI A;  2L0F A;  2BS3 B;  3QIJ A;  3Q6B A;  4OVU A;  3B0A A;  3ECI A;  2ZJD A;  1HEZ E;  2AL6 A;  3LDZ E;  4FHJ A;  2JRI B;  4IM0 A;  4K1R B;  4MH8 A;  4LNN A;  2BKF A;  3VH4 B;  2KZR A;  2MLB A;  5AUI A;  1XLO A;  2MQJ A;  3R2T A;  2GB1 A;  2WXL A;  4LCD E;  3DPD A;  3PLU A;  1HZ5 A;  1KLV A;  1EF1 A;  4UDU C;  1KRH A;  2LVQ A;  2AWT A;  3VTV A;  5C3J B;  1QLB B;  1SE2 A;  3Q3O C;  1WZ0 A;  4BZA A;  4GB9 A;  1WXM A;  2L76 A;  3HUI A;  2MX2 A;  5CX3 A;  2Z59 B;  2KC1 A;  4XYC A;  3NZ3 A;  4DQO C;  2W54 A;  2KFK B;  3EEC A;  4BBN C;  3PZD A;  2C7H A;  3Q8A A;  2O6V D;  3FAH A;  2FID A;  2N1W A;  1JRO A;  1F52 A;  5I4D A;  3W5V B;  4ZRK A;  1V5O A;  5AUK A;  1TYG B;  2V4I B;  4RGT A;  3VDZ A;  3MC9 A;  4GU2 A;  3AEC B;  1P0R A;  1SIJ A;  4ITK A;  3IG3 A;  1NDD A;  2WXM A;  4ARC A;  3NY5 A;  3O65 B;  3Q8E A;  2DX5 B;  3LXF A;  1ZKH A;  2BYT A;  1JWA D;  5EE0 A;  1KF6 B;  4NJC A;  1E0Z A;  2QIE B;  3A1Q A;  3PV1 A;  3AEE B;  1JRP A;  1JRU A;  2KMC A;  3C0R B;  2CU3 A;  3RNB C;  3OAW A;  2K0P A;  3ZIM A;  3L16 A;  3A9K B;  1ZDX A;  4PS8 A;  4B95 A;  3T3O A;  2XBB C;  2B3A A;  3PRE A;  2GI9 A;  4NQL B;  1WX7 A;  2MH7 A;  2QSD A;  3BIN A;  4KX6 B;  1UGM A;  4ZRJ A;  4YL8 A;  1QZE A;  2WXP A;  3L17 A;  2YEP F;  4WWN A;  2IGG A;  2KTF A;  3SHQ A;  3BVZ A;  3SD5 A;  4EZJ A;  1N6Z A;  3QHT A;  3AB5 A;  2GMI C;  5IA7 A;  1C4C A;  2N7D A;  2CHW A;  1TY2 A;  2MJ3 A;  3BZD B;  1NEN B;  1F9J A;  3IAM 1;  3RZW C;  2OOB B;  4YT0 B;  1ZXH A;  5AZG A;  3PHW B;  2BS2 B;  4YSY B;  3RD2 A;  2VRR B;  3QC8 B;  5FR6 A;  3IT6 B;  1MI0 A;  1N5X A;  4HWI B;  2BB5 A;  3TJP A;  2J4X A;  1XLN A;  3TSS A;  2BVC A;  1UBI A;  3UI3 A;  1C4P A;  1F1H A;  2L83 A;  2QIL A;  1V81 A;  4WJP A;  3K9O B;  3ZRC A;  1L6U A;  3B08 A;  5IOI A;  1JWM D;  3P4P B;  1SB3 C;  1Q1O A;  3P4S B;  1EWC A;  3PTF C;  2ON8 A;  3VRA B;  2LVO A;  3MHZ A;  4BOS C;  2LGD A;  1N62 A;  4ZYN A;  1VDV A;  4K3C A;  2NTT A;  1L0X B;  2KTR A;  3GE3 C;  1C79 A;  4LJO B;  1UGJ A;  4K3B A;  3KQ4 A;  2ZZP B;  2K25 A;  2N9X A;  3PRP B;  3SR6 A;  3QWZ B;  1TY0 A;  1Y8R C;  1V9J A;  3HVD A;  4BKT A;  2BKR B;  3TUO A;  4E3C A;  2AEH A;  4WUR A;  5JZE B;  4WQO B;  2KWC A;  5AZF A;  1PYW D;  3H6N A;  2WXR A;  3RNG C;  1GUA B;  1GPX A;  3QK0 A;  2KAC A;  3AH7 A;  1U4A A;  1WRD B;  1JWU D;  1L7Y A;  2FNJ B;  3TEZ A;  2ONQ A;  1I35 A;  4TV3 A;  2D3B A;  4HPL B;  2D3G A;  2K22 A;  4RF1 A;  2XEW A;  4GGQ A;  3Q8C A;  1HTQ A;  5JXV A;  2QEJ C;  2QJL A;  3EC8 A;  4DHZ E;  3Q8F A;  1SBB B;  2WXJ A;  1WR1 A;  4HRS A;  2KX3 A;  4KZC A;  2KQ7 A;  4RF0 A;  4RGM A;  1P98 A;  3WAN A;  3MJW A;  3QJZ A;  2KK8 A;  4KGR A;  4AUQ C;  3A4R A;  2KAJ A;  1STE A;  1LM8 B;  3HVZ A;  3Q3N C;  1XXG A;  4P1C C;  4EE2 A;  3HHM A;  1FXA A;  2OED A;  3AEB B;  4EZL A;  5BMH A;  2LUM A;  2O6V B;  3AMZ A;  4A6Q A;  1YJI A;  4B0E A;  4DXF A;  1WFY A;  4NAW B;  1AWD A;  2H89 B;  3NVW A;  1SEB D;  1YX5 B;  2KAN A;  3UQB A;  5AEK B;  4G11 A;  3WAP A;  4W9L A;  1D4B A;  2M0A A;  2VZK D;  1WXV A;  3V62 A;  3IT4 B;  3N9Y C;  3B9J A;  2C60 A;  2DZI A;  3PT2 B;  3PZ8 A;  3KW5 B;  3BII D;  4KZ0 A;  4XWT A;  3ZDT A;  4M0W A;  4NQK E;  2GLS A;  2KXJ A;  4NZL B;  3ZQ4 A;  2HDE A;  5AZH A;  4KIK B;  2GBN A;  2JF5 A;  2I1K A;  4FN2 A;  3U52 E;  4WWO A;  1IP9 A;  3MC0 B;  1WXS A;  1WJN A;  3N1X C;  2A4Z A;  3VH3 B;  1WMH A;  4XE0 A;  3DHG C;  3URY A;  4MSQ B;  4RNA A;  2WX1 A;  2ZCB A;  5GXG B;  2E3T A;  2XK5 B;  1DOX A;  3ZNG C;  3N1Y C;  3EUB 2;  2PLP A;  2H88 B;  4LJP B;  4MGK E;  2Z0D B;  3RMK C;  2D3C A;  3I5J C;  2IO2 B;  2DYB A;  1WGK A;  3OLM D;  1MG4 A;  2KWD A;  1QIL A;  3DCG A;  3APC A;  4LNK A;  2DEN B;  3CF6 E;  1OQR A;  2ASQ A;  2ZVO A;  4LK0 M;  5BYQ A;  3L13 A;  1TS4 A;  3P4R B;  2ZW1 A;  2M8S A;  3U30 A;  2FIF A;  3U8Z A;  2QMT A;  3I3T B;  2PJH A;  4MDK E;  2R2O A;  2JXT A;  5L83 A;  1GOZ A;  2BWF A;  3ABV B;  1LQB A;  4NY0 A;  2Y5P A;  4TSS A;  3JW0 X;  4DXG A;  4JIO U;  4YTN B;  2AQ2 B;  1IBX B;  1VCB A;  3DBH I;  1RAX A;  4DXA B;  4YXD B;  1ISN A;  2K39 A;  4KV2 A;  1I4H A;  2LGX A;  1YX6 B;  1MVK A;  4HDQ A;  2IDY A;  1RYJ A;  1JWB D;  2J42 A;  2W9N A;  4WJQ A;  3JSV B;  1X1M A;  2SAK A;  2IY0 B;  3TBL D;  4DK5 A;  2L05 A;  4ZHP A;  4MGZ E;  3AXC A;  3LB8 C;  3RT3 B;  1OEY A;  5IN7 A;  1TT5 B;  4R3D A;  3JSV A;  3R2I A;  1E7U A;  2QDF A;  2ZVN A;  2OHF A;  2QHO A;  1J7A A;  3ZNI D;  1WE7 A;  3TIX A;  2UWQ A;  4YTM B;  4JGH B;  2M4N A;  3UIO B;  4AJY B;  4AQ7 A;  3GZN I;  2RDG A;  2C7N B;  1QF6 A;  3PHX B;  2KO3 A;  1QKZ A;  3PVL A;  2WDQ B;  3B1L X;  5FKA C;  2MJE A;  1R4N I;  3WIM A;  3KUD B;  3NVY A;  4C7Y A;  3L4P A;  4JL9 A;  2LEK A;  3FIL B;  3AE7 B;  5IAA C;  3ZDM C;  1OFF A;  3APD A;  3ZTC A;  4C00 A;  3W9C B;  4EFO A;  1TIF A;  3FIL A;  4W9C A;  1WRI A;  3M62 B;  2KN4 A;  1E9M A;  2K8H A;  1E90 A;  2BYF A;  2LMC A;  4GIV A;  5JHA A;  3I9V 1;  3V6C B;  3DVN U;  1ZE3 D;  2WQY B;  4A9A A;  1K51 A;  1KLG D;  1N61 A;  1BXT A;  3N3K B;  1JAL A;  2JWZ A;  4OZB A;  2N9L A;  1VR9 A;  4FLH A;  4HDO A;  2PMV A;  4P7I A;  4ANU A;  3Q3F A;  1FFV A;  2JZP A;  1YN3 A;  1YNT E;  1XLP A;  3LYY A;  2KX0 A;  1WSP A;  4LTU A; 
#chains in the Genus database with same CATH homology
 3RMK C;  3DHI C;  1T0S C;  3RNE C;  3I5J C;  2IND C;  3N1X C;  3Q14 C;  3RNC C;  3RNA C;  3Q2A C;  3Q3O C;  3DHG C;  2INC C;  3Q3M C;  3GE3 C;  3RNF C;  3N1Z C;  3RN9 C;  3DHH C;  1T0Q C;  4P1B C;  3N1Y C;  3Q3N C;  3RNG C;  2RDB C;  3RNB C;  1T0R C;  3I63 C;  4P1C C;  3N20 C;  3RI7 C;  3GE8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...