3RNGC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/w167e double mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rngC00
4P1CC 3RNGC 3RNEC 3DHHC 3I5JC 4P1BC 3RNBC 3RNCC 3RNFC 3N1ZC 3N1XC 3Q14C 1T0QC 3GE3C 3GE8C 3RI7C 3RNAC 2RDBC 2INCC 3DHGC 3RMKC 3DHIC 3N20C 3RN9C 1T0RC 3Q3OC 1T0SC 2INDC 3I63C 3Q2AC 3Q3NC 3N1YC 3Q3MC
chains in the Genus database with same CATH superfamily
3BY4B 1KJTA 1V81A 4HJGE 4PYZA 2LHDA 1OEYJ 1FNUA 4I6LB 2K6DB 3TBLD 4OVZA 1WX9A 3PO0A 1VZ7A 1MJDA 4B0EA 1FM0D 5JZEB 4E74A 4PT5A 4WH4A 2K0PA 3W1SC 1V8CA 4PS3A 2WYQA 3GS2A 2LWPA 2FNJB 2PIAA 4DXGA 1CK1A 3ZJVA 2KVRA 3ZJTA 2CS4A 3RZWC 2I38A 4YSXB 2BS3B 3U52E 1FRDA 5G55A 3HUIA 1V5TA 4BZAA 3W2DA 4NAWB 3VTVA 1YD8U 3PPAA 5J18A 2UU7A 3K9PB 2Y3AA 4B95A 1E90A 2D11A 2A5UA 3P4PB 1FO4A 5I4DA 4WIPA 5EE9A 3KYCD 4P16A 4BAXA 1HTQA 1KH0A 3NZ3A 2RSUA 2J53A 2MJEA 1WFYA 1KLGD 4MGYE 2RDGA 3JSVB 1SIFA 3WAMA 2JU6X 1LO5D 3P4QB 2N9XA 2ZCCA 2RDHA 1JWAD 2LXCA 3SFDB 2IJ0A 1PGXA 5C3JB 4XE0A 1MG4A 3IAS1 1I4RA 2IGHA 3DVGX 1ET9A 2BYTA 4P1CC 5CHVC 1ZE3D 4LTUA 4IDIA 1YQ4B 3B0AA 4M01A 4R3DA 2K5PA 3GP7A 3Q8EA 5BMHA 2V9HA 2PE6B 1PGAA 2Q5WD 3QWZB 1FCLA 2KMMA 2RPVA 2QMTA 3DOWA 1TS4A 2MH7A 2NR2A 3PZ7A 4PYUA 1WXQA 2KQ7A 4P6VF 2INDC 3KVFB 4KX6B 4MELA 3B1LX 4TQ0A 3PT2B 2LJ5A 3QHTA 4C4VA 2VRRB 2R2OA 2VH1A 3FILB 3OAWA 1QOGA 3I57A 2WWZA 2WU2B 3CSTA 1EO6A 2HDEA 1UWMA 3SHQA 4A3OA 2BS2B 5BYRA 4LJOB 2V3NA 3P1MA 4DBGA 4O1NA 3TCAA 1JMLA 4OZAA 1WY8A 3Q14C 2PVOD 3DBSA 4GDLA 2MBBB 2N1VA 1UD7A 1CQVA 4A3PA 2KK8A 2FCNA 2YEPF 3H7SA 2YEPB 3AE3B 4M02A 2BWES 1RYJA 4NAMA 2R2QA 1NYQA 3R8BA 2KTFA 1C4CA 2V3SA 1TZ1A 1BMLC 1N62A 1T3QA 2DYOA 4KV2A 2C7HA 3ALBA 3AEGB 1WGHA 2XEWA 2AWTA 3WALA 2DX5B 1WI0A 1XF5L 1G6JA 4LDTD 4TV3A 2Z0EB 4BKSD 1ZPSA 2NPTB 3RULA 1SE3A 3O13A 1I35A 1OGWA 1I4XA 1IYFA 3EGRA 5FKAC 2QCZA 3QK0A 4NJCA 2OJWA 1V97A 2LUMA 4FJYA 1WRIA 4GDLB 1S1QB 1TJEA 4N9F4 2LGIA 1AW7A 2QJLA 4MDKE 4RNAA 2GBMA 3APCA 2WXLA 3ZKJC 2JX5A 3DHIC 3RFZB 4RM9A 1UBIA 3FAHA 4MGZE 1SE2A 3Q3NC 1CZPA 4GDKA 4EZKA 3MTNB 3VAWA 1BT0A 1UELA 4HEA1 3WCQA 1OQYA 4BBNC 1L0XB 2ZVOA 4HCNB 2KHWB 1JWSD 5HHDG 3VFKA 1N60A 2DYBA 4FXCA 1AARA 1OQRA 1P1AA 3ZIMA 1D5ZC 5AUIA 3RPFC 3M95A 4WAFA 3I5JC 1JALA 1P9DU 4HPPA 3PHXB 2LASA 3GOEA 1BXTA 3B2GA 3DWGC 1HA5A 2FIDA 4JQWC 4K7SA 2WU5B 1WMHA 3LJ3A 4FULA 2WDTB 1T0RC 1WZ3A 4LLGM 4P7IA 5E6PA 2LRUA 4JPSA 2MEKA 4G11A 3Q8FA 1JCKB 5G5GA 1WXSA 2NVUI 3PS6A 3B2FA 1LGRA 4PK1A 2K25A 1A5RA 3U30A 2CHXA 3AH7A 2ZNVC 1WGKA 2IPKD 2V4IB 3NUHB 2J4XA 2FBWB 1E7PB 3QARA 2VZKD 4W9DA 3VUXA 3RYTA 3ZTCA 1SGHA 4G0NB 3TUOA 3VTUA 4XDCA 4BOZB 1VZ8A 3DVNU 4FBJB 2K8CA 3UF8A 2KDEB 2O2VB 1YN5A 1WM2A 3ZDMC 3Q69A 2BPSA 1WJ6A 3PLVA 2KJRA 3MHSD 4FA6A 1YJ1A 2WQYB 4HVBA 1WIAA 2GLSA 3VR8B 3KUZA 4DHZE 2JF5A 1TGZB 2WHIA 2N4FA 5HG2A 1JWMD 3ZGZA 1XD3B 4BFRA 3KQ4A 2JWZA 3N1YC 2LFIA 1SB3C 1TBEA 1SE4A 2KLCA 4RF1A 4W9KA 3PZ8A 4WWNA 5D94A 1BUIC 1FRRA 1C3TA 2KWVB 1YMHE 5IN7A 4HK2A 3VRAB 4WJNA 1I4GA 4A6QA 4JIOU 3RNAC 3ABVB 2FCQA 2LJIA 2AQ3B 1GUAB 3AULA 4AS1A 1J19A 3T8MA 3MJ5A 1MFWA 4BVUC 4ICVA 1WXVA 2AYOB 3LDZE 1E9MA 1QOAA 3GZNB 1D4BA 5IOIA 2BVCA 3HM6X 3SFEB 2MQJA 4YSYB 4W9CA 5BO4B 1V9JA 1ZXHA 2EMTA 1D6EC 2D07B 4MGKE 2ZZPB 5IAAC 2JZPA 4FHKA 2L7RA 2IZVB 1PYWD 2EKIA 4HPLB 1ENFA 1MG8A 1T0SC 3OG5A 3C8YA 2LMCA 5LXHA 2BKRB 2HTME 3IG3A 3NZUA 3PVLA 1V1PA 4NQLB 1SEBD 1AWDA 1T6BX 3AECB 1JWUD 5E6NA 2K9XA 2LHEA 3S2AA 2LXAA 2IBIB 1ZP0B 2KTRB 1V2YA 5HI1A 1RAXA 2N7JA 4MEMA 3PTFC 3Q3FA 4WQOB 4B9KA 2OJRA 4ARIA 4DQOC 1GNUA 4LNKA 2ASQA 4XWWA 3V3XA 1UH6A 1T0YA 3UQBA 2L0TA 3AU4A 1TY2A 5E6JA 1EUVB 2MW5A 4JE3B 4YTMB 3AM9A 5TR5A 2CR5A 1OEYA 3UIPB 4EEWA 4E3CA 1TKYA 3NZSA 2JQRB 2KT7A 1M4VA 3QQ8B 1QT9A 3LXFA 4GOCA 1YOVB 4DDGD 1GAQB 1SJHD 1ET6A 4LNOA 2HD5B 2K8HA 3GE8C 2W55A 3BVMA 2FUHB 4KZ0A 3KWLA 2LEKA 3JVZX 1VR9A 4GN1A 2HJ1A 3APDA 3ENEA 4PS8A 4S0RA 5AZGA 4MT5A 1X1MA 2RD0A 3DVGY 3N1ZC 1WX8A 1N5XA 1V86A 4HKZE 3ZXVA 1L2NA 1ZOYB 2MJ3A 4XC2A 4L23A 1WR1A 1Z5SB 1DYQA 3TMPB 2AQ2B 4W9HA 3R3MA 2A4ZA 2NBUA 5EE1A 3P63A 4E71A 3RNGC 3L16A 2H88B 1EWCA 3PZDA 2W54A 1GG3A 2M4NA 3AEFB 4W9LA 4MACA 2L76A 4GDKB 2FUG1 3VQIA 3ZLZA 5BMGA 2Y5CA 1STEA 4BBNF 2EMSA 4MSMB 3ZW3A 3Q8AA 3V05A 2L05A 1FMAD 4MH8A 1H4RA 4II3B 4URKA 1WF9A 3RNBC 2YVCA 4FJZA 3ZNGC 2BQQA 3DBLB 4ASWC 3ZJUA 1N61A 2DZIA 1FXAA 2INCC 1N63A 3URYA 2IGDA 5JHAA 2BF8B 2JZ3B 1VLBA 2IO0B 5LXIB 4ZYSA 4PS7A 2N1WA 3MC8A 1VDVA 1YNTE 1J7CA 3CF6E 2BYVE 3OLMD 1WJNA 3IT6B 2ZNVB 3W9CB 4DXFA 4NPNA 3JW0X 4MJSB 1WJUA 4ICUA 1KTKA 4KSLC 2CJNA 4EZLA 4XDDA 1UZXB 2Z59B 2WXQA 1FNWA 4RM8A 3TIXA 4J3OD 3TEZA 3GE3C 2ZW1A 2JRHA 1WXAA 4BKTA 2KQ4X 5C1ZA 3IBEA 1GC6A 1Z2MA 3L0WB 1HZ6A 2JWUA 3AE9B 1OQQA 4HDQA 2KDIA 3DDCB 5BYQA 4NJ6A 1CMXB 3Q3MC 4FN2A 3VH3B 2KQSA 3VUYA 3SD5A 1V5OA 4AJWA 1I4HA 1TZOA 2JYEA 4MM3B 2B76B 4BKSA 3AMZA 4X57B 3QC8B 2MRPA 1FEHA 2MX2A 3H8HA 2MP2A 3ZDTA 1ZUD2 2MCNB 1K8RB 2BT6A 5EDSA 2LGDA 2J0KA 1HXYD 1SF0A 1P0RA 3A1QA 3I3TB 2O2VA 5C2TB 3HRDD 2WLBA 2AEHA 2CU3A 4M00A 3VR9B 1F1HA 2GOWA 3Q8BA 4ZHPA 1NDDA 1E6EB 1HE8A 1YN3A 2CU1A 2D3BA 2J7QB 3M62B 1K51A 3GZNI 1K50A 2FCSA 4CO7A 1VZ6A 4RF0A 1WE7A 2BB6A 2EELA 2KLGA 3RT3B 2N0SB 1I42A 1Q5WB 4F7ZA 2WXHA 3EECA 2WXNA 2LI5A 2FE8A 4KGRA 1PFDA 3QCAA 4HRSA 2ZCBA 2NTSA 3PV1A 3M63B 2DYMA 1SE9A 2IYDB 1Y56A 3E9SA 4IM2A 3U4EG 5CX3A 1EF1A 1L4DB 1C4PA 2AQ1B 2JYTA 3P4SB 2NTTA 3FILA 1F9JA 4K7WA 3MP9A 1FXIA 3UINB 4KKJA 2I1JA 1FFVA 5HKHA 4ZRJA 1C77A 3VRBB 1E7UA 3M3JA 1R4NB 1L5PA 4XZ4A 1TYGB 1E10A 3V61A 2MBQA 3ZRFA 2C7NB 3JYUA 2PKOA 3H1UA 1F52A 4IC7B 4ACFA 1WX7A 1I7HA 3FC4A 3HHMA 5FR6A 4C00A 1JROA 4F1SA 2AL6A 4CYEA 2JSVX 3BZDB 2M19A 1VCBA 3ZNHB 5BMIA 2N7DA 4K1RB 4HDOA 3H7PA 2JXTA 1P7FA 2WXKA 4C7YA 2IY0B 2CHZA 1HQRD 3Q6BA 4MH0E 1ROEA 4RGOS 2WDRB 4KIKB 5IP4D 4OVUA 2W3SA 3BYYB 2CJOA 2DZJA 4NJ7A 1T0QC 2N9KA 3IHPC 3AV8A 1FIQA 1JW9D 5AEKB 1B9RA 2LRWA 2RGFA 4XGAB 1GB1A 4WWMA 5KHQA 2KDMA 2Z8LA 3JSVA 4CHKA 3QX1A 2L1AA 2LVQA 1KRHA 2J0JA 1V6EA 4RMAA 5DPTA 1GJZA 2L0FA 3L54A 1ESFA 3AN1A 2E3TA 4K3BA 2RR9A 2SAKA 1WM3A 3IXSA 4YTPB 1Q10A 1C78A 2DWQA 2JVCA 1F0ZA 4ANVA 2BYFA 3BIID 5JHBA 1VRAB 5G5HA 4M0WA 1RLFA 4K81A 1QOFA 1AN8A 1P7EA 1GOZA 2Y5PA 2I2YA 1E5WA 5D2MB 2BBCA 3L4PA 4NZLB 3J9CA 1EF5A 1RFAA 3HM3A 1ZDVA 2MSED 1FFUA 2JXXA 2BS4B 2QEJC 3UI3A 1C79A 2WX0A 4K3CA 3AE5B 3NVYA 1C76A 4C56C 1J0GA 4AWJA 1SIJA 2PPHA 3ZRCA 4MSQB 2IO2B 4USAA 2DAJA 5GXGB 2N7EA 2MLBA 3DVNV 3OWEB 1P98A 5L83A 1SBBB 1H8CA 1RM6C 3UIOB 3RD2A 1MPEA 2QHOA 1L0YB 2L52A 5IO9A 2O6VD 4ZHOA 3ZNID 1C4AA 2M1MA 3SDLC 3RNFC 4GLSC 2R61A 3Q3JA 2WXOA 3AE8B 2KFJA 4M0WB 4GMVA 4MJSA 4HJKA 1QZEA 1YN4A 3NHEB 2INNE 3PRMB 5MPOA 4AOFA 2MHJA 4QAYA 1V49A 1IP9A 1IGCA 1V80A 2KO3A 3HVDA 1E8XA 3P42A 3AI5A 2PLPA 2KWDA 4KGSA 4WJOA 4REZA 2WDVB 1SSNA 3LYYA 1WR6E 1K53A 2MBOA 4DWFA 2RDBC 3KW5B 2IO1B 2QILA 3EA6A 3PSEB 4N58A 1L6UA 4IG7B 5D3DA 2D3CA 3PRZA 4KZCA 2JPHA 1L0VB 4ZRIA 1ZDXA 3UGBB 1TS5A 5GMVA 2LVPA 1L4ZB 2K1FA 4ZRPA 1F2RC 4XX5A 1NVID 3QA8A 2MJDA 1M94A 4W9FA 3AE7B 2KFKB 2LD9A 4W9EA 1HZ5A 2AX5A 2WNMA 3V6CB 5D6JB 1D5MC 1IPGA 2XN9C 2I1KA 3VUWA 1JWBD 3NVZA 2DZKA 5EE3A 2GBKA 1E8ZA 2M0AA 4EOYA 3VHTC 1L7YA 3DWMA 3L08A 4TMAB 3RMKC 3OJ3A 3N20C 2V4LA 2DLBA 5KHOA 3DBHI 4US8A 3WIMA 2UYZB 3C0RB 3KUDB 5D7GA 4JGHB 3A9KB 3AE4B 4WJPA 2GMIC 4JWUC 2YLMA 2JZZA 3NJTA 1FPYA 1WGYA 3IVFA 3ZNZB 1DOYA 1QKZA 2ONQA 4JL9A 2M0XA 2VZKB 3V62A 4DHZB 3CWIA 1WE6A 4NAWA 1NI2A 3WAPA 1IBXB 4IW0A 3BVZA 3DHHC 4US9A 2XBBC 1XLNA 3NS1A 4G3XB 2C60A 3AE1B 4RGNA 1KLUD 4ANUA 1R4MI 4IUMB 2WS3B 5AUKA 1FD6A 1U4AA 1PDXA 1TKGA 2QDFA 3R2TA 2KNBA 5JH5C 2J42A 3T3OA 3FKYA 2XNAC 1XCTL 4AP4C 4F8CB 4XWTA 5LLIA 2L83A 2O6VB 2AL3A 4RH6A 2GBRA 1LQBA 4DXAB 3AEAB 2GRIA 4RGTA 1QLBB 4LNFA 4ARCA 3P4RB 1EU4A 2CHWA 3P2BA 1HTOA 2L3ZA 4KDLB 2PMVA 3U7ZA 4M8NA 1UF0A 3NG0A 1F77A 3U7DA 1XEEA 2OEDA 1NBFC 2L00B 3KYDD 1JRPA 3H7PB 1XQQA 3TEWA 5C23A 4HCPB 3N32A 2ZJDA 1DGJA 1QOBA 4RGMA 1NENB 1WYGA 2OOBB 3O65B 5DPWA 3VXWA 3MHZA 1F2RI 3DBLI 4W9GA 3QJZA 3D32A 1UGMA 5IKCM 1K52A 3QAQA 1IUEA 2KWCA 4YWGG 4WWOA 2JY6A 4MGIE 3IFWB 3A9JB 4GXBA 3X0WA 1PUTA 4ZRKA 2INPE 4I6PA 4WQMA 1KF6B 2HTHA 2WP9B 4LK0M 1WGRA 3BWUD 2QIEB 2DZMA 1XCQL 5CHWA 2J0MA 2ZEQA 3QIJA 1EU3A 1Q1OA 3RCZA 2KZRA 2DNFA 5FR3A 3EHVA 2J52A 2ICIA 3TJPA 1KOTA 2K22A 3SR6A 1TY0A 3AXCA 2D3GA 3ZVVA 2WX1A 1VJKA 3OJ4B 3DBHB 4EFOA 1YJIA 3MFGA 1FCCC 1TS3A 4N59A 1XLPA 2NBWB 4HXDA 4JWSC 1GB4A 4FJVB 1YJJA 4W9JA 2E6XA 3A9JA 1SJED 1AYFA 2KDFB 3A4RA 2PVGC 1D5XC 3NVWA 1QQRA 2BB5A 3I9V1 4FLHA 3DBRB 5AZFA 1PQSA 2KXJA 3TSSA 5AZHA 2KD0A 2OHFA 5T8IA 2D3AA 4I6NB 5J2RA 3EFUA 4RCOA 4KDIC 4EE2A 1KFYB 4IM0A 4N6EB 3L17A 2XK5B 2WXRA 2ZPYA 2MBEA 2X8XX 1J8CA 2MP2B 4LCDE 5JXVA 3ML8A 1QF6A 5G2NA 4HKQA 4WURA 1E7VA 3PHWB 4IWOA 3RN9C 2KMAA 3SEBA 3T9LA 4J6IA 2WXMA 2JT4B 3KWVA 4EZJA 2D10A 4WJQA 3VH4B 1YX5B 3ZXRA 1HEZE 1TIFA 2JRIB 4HPMB 4C4VB 4AUQC 2M8SA 2KANA 1WZ0A 4OW0A 2V3PA 1WH3A 4A8XC 1NI3A 1WRDB 3RZFA 2CKHB 3U2SC 1WYWB 1YQBA 5L95C 3H6NA 2GBJA 2WXPA 1VD2A 1WXMA 3RNEC 2KOXA 3RNCC 3EUB2 3ZTDA 1WWTA 4M8MA 5LNK1 2V1YA 5FK9C 1I4QA 3B08A 3EC8A 4AJYB 5CTRC 1YIWA 1E8WA 1IGDA 4YSZB 3R7RA 1E8YA 2N9EB 3Q2AC 1OTRB 3V6EB 1XXGA 3DBRI 3KLSX 4A55A 3CMMB 2L8JA 2ZPNA 4OHJA 3Q8CA 4JLCA 1TTNA 3H9DA 2IDYA 3AE2B 2XK5A 3MC9A 4LNNA 2D2QA 1JRUA 3WANA 4A9AA 1WGDA 3DPDA 1GPXA 3ECIA 1ZKHA 2GB1A 4L1BA 4JX1C 4GSWA 4NQKE 2LGSA 2LUEA 2G4DB 3R7QA 3X23A 3VDZA 2C5LC 3BYTB 1LFDA 2WDQB 2ACZB 2UWQA 3N9YC 4AQ7A 2KC1A 2KWUB 2G3QB 3E56A 1R4MB 1S3SG 3AE6B 1XLQA 4L2YA 2MBHA 2QC8A 3N3KB 2NMQA 2Y5BB 2RMMA 4TKNA 4H2AA 2KYWA 4KIKA 3WA0A 4BKGA 1PGBA 1B1ZA 2H89B 5CHFA 1GC7A 3U8ZA 4K7UA 1NYRA 1TT5B 1ZGUB 2G9HD 3A1QB 3NS8A 3C19A 2W82A 3A4SC 2PTLA 4KKIA 4YT0B 2FAZA 4DDID 4GGQA 2K6QA 3TL5A 1MVKA 3T3NA 3L10B 2N9LA 2X38A 2LZ6A 1DOXA 3APFA 2GBNA 2KN5A 5BYSA 1C1YB 1J7BA 3BK2A 2KX3A 1EWYC 3VVWB 4CQNA 1V1PB 1C9FA 1XT9B 2PW9A 5DPSA 4KVGB 1MHHE 2REXA 1ZXIA 2ON8A 2PE9A 2HE7A 2WGSA 4KGTA 3AEBB 5H92C 2NPTA 3V60A 1R4NI 3PREA 4OZBA 2KTRA 2MWSB 2PEAA 4ITKA 2D5GA 3K9OB 3NY5A 4TSSA 3AEDB 1A70A 4DHJB 3IAM1 1UWXA 2SEBD 4C7ZA 4ZRQA 3W5VB 1RWSA 3KH0A 3MJWA 3N1XC 3ZQ4A 1RFKA 4ANXA 1ZW7A 1JQ4A 1MHXA 2KC2A 4W9IA 4D2KA 3ZYYX 3SU8X 4IM3A 4B6WA 2M17A 3W5UB 3ZO5B 3AB5A 2LVOA 1NEKB 3NVVA 2NS5A 4IKGA 2DAFA 3RUIB 3UQAA 1TKEA 1L6VA 3L13A 2FCMA 2K8BA 3RI7C 1N5WA 3DHGC 2FIFA 4YL8A 1EM7A 3DCGA 3R66C 4HROA 2G4SA 2DHZA 4EKUA 3TEYA 2G1EA 1I4PA 2DBYA 5D3IB 1UUPA 4BOSC 2KX0A 2WXGA 4LNIA 4FHJA 1ISNA 4LJPB 2NCNA 3A33B 2QSDA 1TS2A 4ANWA 4IWPA 1ACCA 3ETRA 3CSFA 4LDTB 4IOIE 1Y8RC 1FXTB 2L32A 2BYEA 4G50A 4S17A 2BKFA 2K39A 4YTNB 5EE0A 1WJ4A 3CIRB 4OZCA 1Q0WB 1J7AA 3HIZA 2BW2A 2KJHB 2RPQA 3MC0B 2V0GA 2KFKA 1KLVA 2DENB 2KDBA 3VTWA 3NRZA 3W1YA 5IA7A 4C80A 2KN4A 2KJ6A 2ZVNA 4WWPA 1YQ3B 4RFBA 4WAAA 3KUCB 1YX6B 2LGXA 2C7MB 1XO3A 5DCNA 2EKEC 3B9JA 1E0ZA 4NNJB 3R2IA 3Q3OC 1OFFA 4UDUC 4ZYNA 1P3QU 2WXIA 3W1SA 1WGGA 3A9KA 2KVZA 2G45B 2W9NA 2WXFA 1WSPA 3HK0A 4MM3A 3IT4B 3PLUA 4B0MA 3AEEB 3N30A 2W3RA 1DOIA 1MI0A 2NBVB 3BK1A 4Q2JA 2IGGA 2HJ8A 2WXJA 1XLOA 2JUOA 3DQVA 2KAJA 1IBXA 2M56B 5J17A 3LB8C 3HVZA 4P1BC 4IWQA 3TEXA 3ML9A 1T5XD 4TUUA 3PRPB 4YXDB 4EUTA 1QILA 1RRBA 2B3AA 3ZUNA 2N9PC 4HWIB 3BVGA 5H8YE 2ZW0A 2GI9A 5DPRA 4A90A 4ZOHC 2LGYA 4GIVA 2PJHA 2BWFA 1FNVA 1R7SA 1SXTA 3GB1A 3EFCA 3PGEA 1V1OA 2Z0DB 1UGJA 2TSSA 2O6VA 2KKCA 2IY1B 2BGFA 3BINA 1D3ZA 2IO3B 1LXDA 3AU5A 1KM7A 1LM8B 4XYCA 3I63C 3ONSA 2MA9B 1N6ZA 4OVVA 1WMHB 5HFYA 4GU2A 4KSKC 4ZDVA 2KMCA 4NY0A 2C9WB 2BTEA 4TQ1A 4FADA 1UNSA 4GB9A 4HLEA 2K3UA 2KACA 4DHJD 1UBQA 5TSSA 3NOBA 2VH2A 1CJEA 4DK5A 5E6OA 4II2B 3WAOA 4A20A
chains in the Genus database with same CATH topology
4P1CC 3RNGC 3RNEC 3DHHC 3I5JC 4P1BC 3RNBC 3RNCC 3RNFC 3N1ZC 3N1XC 3Q14C 1T0QC 3GE3C 3GE8C 3RI7C 3RNAC 2RDBC 2INCC 3DHGC 3RMKC 3DHIC 3N20C 3RN9C 1T0RC 3Q3OC 1T0SC 2INDC 3I63C 3Q2AC 3Q3NC 3N1YC 3Q3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1C C;  3RNG C;  3RNE C;  3DHH C;  3I5J C;  4P1B C;  3RNB C;  3RNC C;  3RNF C;  3N1Z C;  3N1X C;  3Q14 C;  1T0Q C;  3GE3 C;  3GE8 C;  3RI7 C;  3RNA C;  2RDB C;  2INC C;  3DHG C;  3RMK C;  3DHI C;  3N20 C;  3RN9 C;  1T0R C;  3Q3O C;  1T0S C;  2IND C;  3I63 C;  3Q2A C;  3Q3N C;  3N1Y C;  3Q3M C; 
#chains in the Genus database with same CATH topology
 3BY4 B;  1KJT A;  1V81 A;  4HJG E;  4PYZ A;  2LHD A;  1OEY J;  1FNU A;  4I6L B;  2K6D B;  3TBL D;  4OVZ A;  1WX9 A;  3PO0 A;  1VZ7 A;  1MJD A;  4B0E A;  1FM0 D;  5JZE B;  4E74 A;  4PT5 A;  4WH4 A;  2K0P A;  3W1S C;  1V8C A;  4PS3 A;  2WYQ A;  3GS2 A;  2LWP A;  2FNJ B;  2PIA A;  4DXG A;  1CK1 A;  3ZJV A;  2KVR A;  3ZJT A;  2CS4 A;  3RZW C;  2I38 A;  4YSX B;  2BS3 B;  3U52 E;  1FRD A;  5G55 A;  3HUI A;  1V5T A;  4BZA A;  3W2D A;  4NAW B;  3VTV A;  1YD8 U;  3PPA A;  5J18 A;  2UU7 A;  3K9P B;  2Y3A A;  4B95 A;  1E90 A;  2D11 A;  2A5U A;  3P4P B;  1FO4 A;  5I4D A;  4WIP A;  5EE9 A;  3KYC D;  4P16 A;  4BAX A;  1HTQ A;  1KH0 A;  3NZ3 A;  2RSU A;  2J53 A;  2MJE A;  1WFY A;  1KLG D;  4MGY E;  2RDG A;  3JSV B;  1SIF A;  3WAM A;  2JU6 X;  1LO5 D;  3P4Q B;  2N9X A;  2ZCC A;  2RDH A;  1JWA D;  2LXC A;  3SFD B;  2IJ0 A;  1PGX A;  5C3J B;  4XE0 A;  1MG4 A;  3IAS 1;  1I4R A;  2IGH A;  3DVG X;  1ET9 A;  2BYT A;  4P1C C;  5CHV C;  1ZE3 D;  4LTU A;  4IDI A;  1YQ4 B;  3B0A A;  4M01 A;  4R3D A;  2K5P A;  3GP7 A;  3Q8E A;  5BMH A;  2V9H A;  2PE6 B;  1PGA A;  2Q5W D;  3QWZ B;  1FCL A;  2KMM A;  2RPV A;  2QMT A;  3DOW A;  1TS4 A;  2MH7 A;  2NR2 A;  3PZ7 A;  4PYU A;  1WXQ A;  2KQ7 A;  4P6V F;  2IND C;  3KVF B;  4KX6 B;  4MEL A;  3B1L X;  4TQ0 A;  3PT2 B;  2LJ5 A;  3QHT A;  4C4V A;  2VRR B;  2R2O A;  2VH1 A;  3FIL B;  3OAW A;  1QOG A;  3I57 A;  2WWZ A;  2WU2 B;  3CST A;  1EO6 A;  2HDE A;  1UWM A;  3SHQ A;  4A3O A;  2BS2 B;  5BYR A;  4LJO B;  2V3N A;  3P1M A;  4DBG A;  4O1N A;  3TCA A;  1JML A;  4OZA A;  1WY8 A;  3Q14 C;  2PVO D;  3DBS A;  4GDL A;  2MBB B;  2N1V A;  1UD7 A;  1CQV A;  4A3P A;  2KK8 A;  2FCN A;  2YEP F;  3H7S A;  2YEP B;  3AE3 B;  4M02 A;  2BWE S;  1RYJ A;  4NAM A;  2R2Q A;  1NYQ A;  3R8B A;  2KTF A;  1C4C A;  2V3S A;  1TZ1 A;  1BML C;  1N62 A;  1T3Q A;  2DYO A;  4KV2 A;  2C7H A;  3ALB A;  3AEG B;  1WGH A;  2XEW A;  2AWT A;  3WAL A;  2DX5 B;  1WI0 A;  1XF5 L;  1G6J A;  4LDT D;  4TV3 A;  2Z0E B;  4BKS D;  1ZPS A;  2NPT B;  3RUL A;  1SE3 A;  3O13 A;  1I35 A;  1OGW A;  1I4X A;  1IYF A;  3EGR A;  5FKA C;  2QCZ A;  3QK0 A;  4NJC A;  2OJW A;  1V97 A;  2LUM A;  4FJY A;  1WRI A;  4GDL B;  1S1Q B;  1TJE A;  4N9F 4;  2LGI A;  1AW7 A;  2QJL A;  4MDK E;  4RNA A;  2GBM A;  3APC A;  2WXL A;  3ZKJ C;  2JX5 A;  3DHI C;  3RFZ B;  4RM9 A;  1UBI A;  3FAH A;  4MGZ E;  1SE2 A;  3Q3N C;  1CZP A;  4GDK A;  4EZK A;  3MTN B;  3VAW A;  1BT0 A;  1UEL A;  4HEA 1;  3WCQ A;  1OQY A;  4BBN C;  1L0X B;  2ZVO A;  4HCN B;  2KHW B;  1JWS D;  5HHD G;  3VFK A;  1N60 A;  2DYB A;  4FXC A;  1AAR A;  1OQR A;  1P1A A;  3ZIM A;  1D5Z C;  5AUI A;  3RPF C;  3M95 A;  4WAF A;  3I5J C;  1JAL A;  1P9D U;  4HPP A;  3PHX B;  2LAS A;  3GOE A;  1BXT A;  3B2G A;  3DWG C;  1HA5 A;  2FID A;  4JQW C;  4K7S A;  2WU5 B;  1WMH A;  3LJ3 A;  4FUL A;  2WDT B;  1T0R C;  1WZ3 A;  4LLG M;  4P7I A;  5E6P A;  2LRU A;  4JPS A;  2MEK A;  4G11 A;  3Q8F A;  1JCK B;  5G5G A;  1WXS A;  2NVU I;  3PS6 A;  3B2F A;  1LGR A;  4PK1 A;  2K25 A;  1A5R A;  3U30 A;  2CHX A;  3AH7 A;  2ZNV C;  1WGK A;  2IPK D;  2V4I B;  3NUH B;  2J4X A;  2FBW B;  1E7P B;  3QAR A;  2VZK D;  4W9D A;  3VUX A;  3RYT A;  3ZTC A;  1SGH A;  4G0N B;  3TUO A;  3VTU A;  4XDC A;  4BOZ B;  1VZ8 A;  3DVN U;  4FBJ B;  2K8C A;  3UF8 A;  2KDE B;  2O2V B;  1YN5 A;  1WM2 A;  3ZDM C;  3Q69 A;  2BPS A;  1WJ6 A;  3PLV A;  2KJR A;  3MHS D;  4FA6 A;  1YJ1 A;  2WQY B;  4HVB A;  1WIA A;  2GLS A;  3VR8 B;  3KUZ A;  4DHZ E;  2JF5 A;  1TGZ B;  2WHI A;  2N4F A;  5HG2 A;  1JWM D;  3ZGZ A;  1XD3 B;  4BFR A;  3KQ4 A;  2JWZ A;  3N1Y C;  2LFI A;  1SB3 C;  1TBE A;  1SE4 A;  2KLC A;  4RF1 A;  4W9K A;  3PZ8 A;  4WWN A;  5D94 A;  1BUI C;  1FRR A;  1C3T A;  2KWV B;  1YMH E;  5IN7 A;  4HK2 A;  3VRA B;  4WJN A;  1I4G A;  4A6Q A;  4JIO U;  3RNA C;  3ABV B;  2FCQ A;  2LJI A;  2AQ3 B;  1GUA B;  3AUL A;  4AS1 A;  1J19 A;  3T8M A;  3MJ5 A;  1MFW A;  4BVU C;  4ICV A;  1WXV A;  2AYO B;  3LDZ E;  1E9M A;  1QOA A;  3GZN B;  1D4B A;  5IOI A;  2BVC A;  3HM6 X;  3SFE B;  2MQJ A;  4YSY B;  4W9C A;  5BO4 B;  1V9J A;  1ZXH A;  2EMT A;  1D6E C;  2D07 B;  4MGK E;  2ZZP B;  5IAA C;  2JZP A;  4FHK A;  2L7R A;  2IZV B;  1PYW D;  2EKI A;  4HPL B;  1ENF A;  1MG8 A;  1T0S C;  3OG5 A;  3C8Y A;  2LMC A;  5LXH A;  2BKR B;  2HTM E;  3IG3 A;  3NZU A;  3PVL A;  1V1P A;  4NQL B;  1SEB D;  1AWD A;  1T6B X;  3AEC B;  1JWU D;  5E6N A;  2K9X A;  2LHE A;  3S2A A;  2LXA A;  2IBI B;  1ZP0 B;  2KTR B;  1V2Y A;  5HI1 A;  1RAX A;  2N7J A;  4MEM A;  3PTF C;  3Q3F A;  4WQO B;  4B9K A;  2OJR A;  4ARI A;  4DQO C;  1GNU A;  4LNK A;  2ASQ A;  4XWW A;  3V3X A;  1UH6 A;  1T0Y A;  3UQB A;  2L0T A;  3AU4 A;  1TY2 A;  5E6J A;  1EUV B;  2MW5 A;  4JE3 B;  4YTM B;  3AM9 A;  5TR5 A;  2CR5 A;  1OEY A;  3UIP B;  4EEW A;  4E3C A;  1TKY A;  3NZS A;  2JQR B;  2KT7 A;  1M4V A;  3QQ8 B;  1QT9 A;  3LXF A;  4GOC A;  1YOV B;  4DDG D;  1GAQ B;  1SJH D;  1ET6 A;  4LNO A;  2HD5 B;  2K8H A;  3GE8 C;  2W55 A;  3BVM A;  2FUH B;  4KZ0 A;  3KWL A;  2LEK A;  3JVZ X;  1VR9 A;  4GN1 A;  2HJ1 A;  3APD A;  3ENE A;  4PS8 A;  4S0R A;  5AZG A;  4MT5 A;  1X1M A;  2RD0 A;  3DVG Y;  3N1Z C;  1WX8 A;  1N5X A;  1V86 A;  4HKZ E;  3ZXV A;  1L2N A;  1ZOY B;  2MJ3 A;  4XC2 A;  4L23 A;  1WR1 A;  1Z5S B;  1DYQ A;  3TMP B;  2AQ2 B;  4W9H A;  3R3M A;  2A4Z A;  2NBU A;  5EE1 A;  3P63 A;  4E71 A;  3RNG C;  3L16 A;  2H88 B;  1EWC A;  3PZD A;  2W54 A;  1GG3 A;  2M4N A;  3AEF B;  4W9L A;  4MAC A;  2L76 A;  4GDK B;  2FUG 1;  3VQI A;  3ZLZ A;  5BMG A;  2Y5C A;  1STE A;  4BBN F;  2EMS A;  4MSM B;  3ZW3 A;  3Q8A A;  3V05 A;  2L05 A;  1FMA D;  4MH8 A;  1H4R A;  4II3 B;  4URK A;  1WF9 A;  3RNB C;  2YVC A;  4FJZ A;  3ZNG C;  2BQQ A;  3DBL B;  4ASW C;  3ZJU A;  1N61 A;  2DZI A;  1FXA A;  2INC C;  1N63 A;  3URY A;  2IGD A;  5JHA A;  2BF8 B;  2JZ3 B;  1VLB A;  2IO0 B;  5LXI B;  4ZYS A;  4PS7 A;  2N1W A;  3MC8 A;  1VDV A;  1YNT E;  1J7C A;  3CF6 E;  2BYV E;  3OLM D;  1WJN A;  3IT6 B;  2ZNV B;  3W9C B;  4DXF A;  4NPN A;  3JW0 X;  4MJS B;  1WJU A;  4ICU A;  1KTK A;  4KSL C;  2CJN A;  4EZL A;  4XDD A;  1UZX B;  2Z59 B;  2WXQ A;  1FNW A;  4RM8 A;  3TIX A;  4J3O D;  3TEZ A;  3GE3 C;  2ZW1 A;  2JRH A;  1WXA A;  4BKT A;  2KQ4 X;  5C1Z A;  3IBE A;  1GC6 A;  1Z2M A;  3L0W B;  1HZ6 A;  2JWU A;  3AE9 B;  1OQQ A;  4HDQ A;  2KDI A;  3DDC B;  5BYQ A;  4NJ6 A;  1CMX B;  3Q3M C;  4FN2 A;  3VH3 B;  2KQS A;  3VUY A;  3SD5 A;  1V5O A;  4AJW A;  1I4H A;  1TZO A;  2JYE A;  4MM3 B;  2B76 B;  4BKS A;  3AMZ A;  4X57 B;  3QC8 B;  2MRP A;  1FEH A;  2MX2 A;  3H8H A;  2MP2 A;  3ZDT A;  1ZUD 2;  2MCN B;  1K8R B;  2BT6 A;  5EDS A;  2LGD A;  2J0K A;  1HXY D;  1SF0 A;  1P0R A;  3A1Q A;  3I3T B;  2O2V A;  5C2T B;  3HRD D;  2WLB A;  2AEH A;  2CU3 A;  4M00 A;  3VR9 B;  1F1H A;  2GOW A;  3Q8B A;  4ZHP A;  1NDD A;  1E6E B;  1HE8 A;  1YN3 A;  2CU1 A;  2D3B A;  2J7Q B;  3M62 B;  1K51 A;  3GZN I;  1K50 A;  2FCS A;  4CO7 A;  1VZ6 A;  4RF0 A;  1WE7 A;  2BB6 A;  2EEL A;  2KLG A;  3RT3 B;  2N0S B;  1I42 A;  1Q5W B;  4F7Z A;  2WXH A;  3EEC A;  2WXN A;  2LI5 A;  2FE8 A;  4KGR A;  1PFD A;  3QCA A;  4HRS A;  2ZCB A;  2NTS A;  3PV1 A;  3M63 B;  2DYM A;  1SE9 A;  2IYD B;  1Y56 A;  3E9S A;  4IM2 A;  3U4E G;  5CX3 A;  1EF1 A;  1L4D B;  1C4P A;  2AQ1 B;  2JYT A;  3P4S B;  2NTT A;  3FIL A;  1F9J A;  4K7W A;  3MP9 A;  1FXI A;  3UIN B;  4KKJ A;  2I1J A;  1FFV A;  5HKH A;  4ZRJ A;  1C77 A;  3VRB B;  1E7U A;  3M3J A;  1R4N B;  1L5P A;  4XZ4 A;  1TYG B;  1E10 A;  3V61 A;  2MBQ A;  3ZRF A;  2C7N B;  3JYU A;  2PKO A;  3H1U A;  1F52 A;  4IC7 B;  4ACF A;  1WX7 A;  1I7H A;  3FC4 A;  3HHM A;  5FR6 A;  4C00 A;  1JRO A;  4F1S A;  2AL6 A;  4CYE A;  2JSV X;  3BZD B;  2M19 A;  1VCB A;  3ZNH B;  5BMI A;  2N7D A;  4K1R B;  4HDO A;  3H7P A;  2JXT A;  1P7F A;  2WXK A;  4C7Y A;  2IY0 B;  2CHZ A;  1HQR D;  3Q6B A;  4MH0 E;  1ROE A;  4RGO S;  2WDR B;  4KIK B;  5IP4 D;  4OVU A;  2W3S A;  3BYY B;  2CJO A;  2DZJ A;  4NJ7 A;  1T0Q C;  2N9K A;  3IHP C;  3AV8 A;  1FIQ A;  1JW9 D;  5AEK B;  1B9R A;  2LRW A;  2RGF A;  4XGA B;  1GB1 A;  4WWM A;  5KHQ A;  2KDM A;  2Z8L A;  3JSV A;  4CHK A;  3QX1 A;  2L1A A;  2LVQ A;  1KRH A;  2J0J A;  1V6E A;  4RMA A;  5DPT A;  1GJZ A;  2L0F A;  3L54 A;  1ESF A;  3AN1 A;  2E3T A;  4K3B A;  2RR9 A;  2SAK A;  1WM3 A;  3IXS A;  4YTP B;  1Q10 A;  1C78 A;  2DWQ A;  2JVC A;  1F0Z A;  4ANV A;  2BYF A;  3BII D;  5JHB A;  1VRA B;  5G5H A;  4M0W A;  1RLF A;  4K81 A;  1QOF A;  1AN8 A;  1P7E A;  1GOZ A;  2Y5P A;  2I2Y A;  1E5W A;  5D2M B;  2BBC A;  3L4P A;  4NZL B;  3J9C A;  1EF5 A;  1RFA A;  3HM3 A;  1ZDV A;  2MSE D;  1FFU A;  2JXX A;  2BS4 B;  2QEJ C;  3UI3 A;  1C79 A;  2WX0 A;  4K3C A;  3AE5 B;  3NVY A;  1C76 A;  4C56 C;  1J0G A;  4AWJ A;  1SIJ A;  2PPH A;  3ZRC A;  4MSQ B;  2IO2 B;  4USA A;  2DAJ A;  5GXG B;  2N7E A;  2MLB A;  3DVN V;  3OWE B;  1P98 A;  5L83 A;  1SBB B;  1H8C A;  1RM6 C;  3UIO B;  3RD2 A;  1MPE A;  2QHO A;  1L0Y B;  2L52 A;  5IO9 A;  2O6V D;  4ZHO A;  3ZNI D;  1C4A A;  2M1M A;  3SDL C;  3RNF C;  4GLS C;  2R61 A;  3Q3J A;  2WXO A;  3AE8 B;  2KFJ A;  4M0W B;  4GMV A;  4MJS A;  4HJK A;  1QZE A;  1YN4 A;  3NHE B;  2INN E;  3PRM B;  5MPO A;  4AOF A;  2MHJ A;  4QAY A;  1V49 A;  1IP9 A;  1IGC A;  1V80 A;  2KO3 A;  3HVD A;  1E8X A;  3P42 A;  3AI5 A;  2PLP A;  2KWD A;  4KGS A;  4WJO A;  4REZ A;  2WDV B;  1SSN A;  3LYY A;  1WR6 E;  1K53 A;  2MBO A;  4DWF A;  2RDB C;  3KW5 B;  2IO1 B;  2QIL A;  3EA6 A;  3PSE B;  4N58 A;  1L6U A;  4IG7 B;  5D3D A;  2D3C A;  3PRZ A;  4KZC A;  2JPH A;  1L0V B;  4ZRI A;  1ZDX A;  3UGB B;  1TS5 A;  5GMV A;  2LVP A;  1L4Z B;  2K1F A;  4ZRP A;  1F2R C;  4XX5 A;  1NVI D;  3QA8 A;  2MJD A;  1M94 A;  4W9F A;  3AE7 B;  2KFK B;  2LD9 A;  4W9E A;  1HZ5 A;  2AX5 A;  2WNM A;  3V6C B;  5D6J B;  1D5M C;  1IPG A;  2XN9 C;  2I1K A;  3VUW A;  1JWB D;  3NVZ A;  2DZK A;  5EE3 A;  2GBK A;  1E8Z A;  2M0A A;  4EOY A;  3VHT C;  1L7Y A;  3DWM A;  3L08 A;  4TMA B;  3RMK C;  3OJ3 A;  3N20 C;  2V4L A;  2DLB A;  5KHO A;  3DBH I;  4US8 A;  3WIM A;  2UYZ B;  3C0R B;  3KUD B;  5D7G A;  4JGH B;  3A9K B;  3AE4 B;  4WJP A;  2GMI C;  4JWU C;  2YLM A;  2JZZ A;  3NJT A;  1FPY A;  1WGY A;  3IVF A;  3ZNZ B;  1DOY A;  1QKZ A;  2ONQ A;  4JL9 A;  2M0X A;  2VZK B;  3V62 A;  4DHZ B;  3CWI A;  1WE6 A;  4NAW A;  1NI2 A;  3WAP A;  1IBX B;  4IW0 A;  3BVZ A;  3DHH C;  4US9 A;  2XBB C;  1XLN A;  3NS1 A;  4G3X B;  2C60 A;  3AE1 B;  4RGN A;  1KLU D;  4ANU A;  1R4M I;  4IUM B;  2WS3 B;  5AUK A;  1FD6 A;  1U4A A;  1PDX A;  1TKG A;  2QDF A;  3R2T A;  2KNB A;  5JH5 C;  2J42 A;  3T3O A;  3FKY A;  2XNA C;  1XCT L;  4AP4 C;  4F8C B;  4XWT A;  5LLI A;  2L83 A;  2O6V B;  2AL3 A;  4RH6 A;  2GBR A;  1LQB A;  4DXA B;  3AEA B;  2GRI A;  4RGT A;  1QLB B;  4LNF A;  4ARC A;  3P4R B;  1EU4 A;  2CHW A;  3P2B A;  1HTO A;  2L3Z A;  4KDL B;  2PMV A;  3U7Z A;  4M8N A;  1UF0 A;  3NG0 A;  1F77 A;  3U7D A;  1XEE A;  2OED A;  1NBF C;  2L00 B;  3KYD D;  1JRP A;  3H7P B;  1XQQ A;  3TEW A;  5C23 A;  4HCP B;  3N32 A;  2ZJD A;  1DGJ A;  1QOB A;  4RGM A;  1NEN B;  1WYG A;  2OOB B;  3O65 B;  5DPW A;  3VXW A;  3MHZ A;  1F2R I;  3DBL I;  4W9G A;  3QJZ A;  3D32 A;  1UGM A;  5IKC M;  1K52 A;  3QAQ A;  1IUE A;  2KWC A;  4YWG G;  4WWO A;  2JY6 A;  4MGI E;  3IFW B;  3A9J B;  4GXB A;  3X0W A;  1PUT A;  4ZRK A;  2INP E;  4I6P A;  4WQM A;  1KF6 B;  2HTH A;  2WP9 B;  4LK0 M;  1WGR A;  3BWU D;  2QIE B;  2DZM A;  1XCQ L;  5CHW A;  2J0M A;  2ZEQ A;  3QIJ A;  1EU3 A;  1Q1O A;  3RCZ A;  2KZR A;  2DNF A;  5FR3 A;  3EHV A;  2J52 A;  2ICI A;  3TJP A;  1KOT A;  2K22 A;  3SR6 A;  1TY0 A;  3AXC A;  2D3G A;  3ZVV A;  2WX1 A;  1VJK A;  3OJ4 B;  3DBH B;  4EFO A;  1YJI A;  3MFG A;  1FCC C;  1TS3 A;  4N59 A;  1XLP A;  2NBW B;  4HXD A;  4JWS C;  1GB4 A;  4FJV B;  1YJJ A;  4W9J A;  2E6X A;  3A9J A;  1SJE D;  1AYF A;  2KDF B;  3A4R A;  2PVG C;  1D5X C;  3NVW A;  1QQR A;  2BB5 A;  3I9V 1;  4FLH A;  3DBR B;  5AZF A;  1PQS A;  2KXJ A;  3TSS A;  5AZH A;  2KD0 A;  2OHF A;  5T8I A;  2D3A A;  4I6N B;  5J2R A;  3EFU A;  4RCO A;  4KDI C;  4EE2 A;  1KFY B;  4IM0 A;  4N6E B;  3L17 A;  2XK5 B;  2WXR A;  2ZPY A;  2MBE A;  2X8X X;  1J8C A;  2MP2 B;  4LCD E;  5JXV A;  3ML8 A;  1QF6 A;  5G2N A;  4HKQ A;  4WUR A;  1E7V A;  3PHW B;  4IWO A;  3RN9 C;  2KMA A;  3SEB A;  3T9L A;  4J6I A;  2WXM A;  2JT4 B;  3KWV A;  4EZJ A;  2D10 A;  4WJQ A;  3VH4 B;  1YX5 B;  3ZXR A;  1HEZ E;  1TIF A;  2JRI B;  4HPM B;  4C4V B;  4AUQ C;  2M8S A;  2KAN A;  1WZ0 A;  4OW0 A;  2V3P A;  1WH3 A;  4A8X C;  1NI3 A;  1WRD B;  3RZF A;  2CKH B;  3U2S C;  1WYW B;  1YQB A;  5L95 C;  3H6N A;  2GBJ A;  2WXP A;  1VD2 A;  1WXM A;  3RNE C;  2KOX A;  3RNC C;  3EUB 2;  3ZTD A;  1WWT A;  4M8M A;  5LNK 1;  2V1Y A;  5FK9 C;  1I4Q A;  3B08 A;  3EC8 A;  4AJY B;  5CTR C;  1YIW A;  1E8W A;  1IGD A;  4YSZ B;  3R7R A;  1E8Y A;  2N9E B;  3Q2A C;  1OTR B;  3V6E B;  1XXG A;  3DBR I;  3KLS X;  4A55 A;  3CMM B;  2L8J A;  2ZPN A;  4OHJ A;  3Q8C A;  4JLC A;  1TTN A;  3H9D A;  2IDY A;  3AE2 B;  2XK5 A;  3MC9 A;  4LNN A;  2D2Q A;  1JRU A;  3WAN A;  4A9A A;  1WGD A;  3DPD A;  1GPX A;  3ECI A;  1ZKH A;  2GB1 A;  4L1B A;  4JX1 C;  4GSW A;  4NQK E;  2LGS A;  2LUE A;  2G4D B;  3R7Q A;  3X23 A;  3VDZ A;  2C5L C;  3BYT B;  1LFD A;  2WDQ B;  2ACZ B;  2UWQ A;  3N9Y C;  4AQ7 A;  2KC1 A;  2KWU B;  2G3Q B;  3E56 A;  1R4M B;  1S3S G;  3AE6 B;  1XLQ A;  4L2Y A;  2MBH A;  2QC8 A;  3N3K B;  2NMQ A;  2Y5B B;  2RMM A;  4TKN A;  4H2A A;  2KYW A;  4KIK A;  3WA0 A;  4BKG A;  1PGB A;  1B1Z A;  2H89 B;  5CHF A;  1GC7 A;  3U8Z A;  4K7U A;  1NYR A;  1TT5 B;  1ZGU B;  2G9H D;  3A1Q B;  3NS8 A;  3C19 A;  2W82 A;  3A4S C;  2PTL A;  4KKI A;  4YT0 B;  2FAZ A;  4DDI D;  4GGQ A;  2K6Q A;  3TL5 A;  1MVK A;  3T3N A;  3L10 B;  2N9L A;  2X38 A;  2LZ6 A;  1DOX A;  3APF A;  2GBN A;  2KN5 A;  5BYS A;  1C1Y B;  1J7B A;  3BK2 A;  2KX3 A;  1EWY C;  3VVW B;  4CQN A;  1V1P B;  1C9F A;  1XT9 B;  2PW9 A;  5DPS A;  4KVG B;  1MHH E;  2REX A;  1ZXI A;  2ON8 A;  2PE9 A;  2HE7 A;  2WGS A;  4KGT A;  3AEB B;  5H92 C;  2NPT A;  3V60 A;  1R4N I;  3PRE A;  4OZB A;  2KTR A;  2MWS B;  2PEA A;  4ITK A;  2D5G A;  3K9O B;  3NY5 A;  4TSS A;  3AED B;  1A70 A;  4DHJ B;  3IAM 1;  1UWX A;  2SEB D;  4C7Z A;  4ZRQ A;  3W5V B;  1RWS A;  3KH0 A;  3MJW A;  3N1X C;  3ZQ4 A;  1RFK A;  4ANX A;  1ZW7 A;  1JQ4 A;  1MHX A;  2KC2 A;  4W9I A;  4D2K A;  3ZYY X;  3SU8 X;  4IM3 A;  4B6W A;  2M17 A;  3W5U B;  3ZO5 B;  3AB5 A;  2LVO A;  1NEK B;  3NVV A;  2NS5 A;  4IKG A;  2DAF A;  3RUI B;  3UQA A;  1TKE A;  1L6V A;  3L13 A;  2FCM A;  2K8B A;  3RI7 C;  1N5W A;  3DHG C;  2FIF A;  4YL8 A;  1EM7 A;  3DCG A;  3R66 C;  4HRO A;  2G4S A;  2DHZ A;  4EKU A;  3TEY A;  2G1E A;  1I4P A;  2DBY A;  5D3I B;  1UUP A;  4BOS C;  2KX0 A;  2WXG A;  4LNI A;  4FHJ A;  1ISN A;  4LJP B;  2NCN A;  3A33 B;  2QSD A;  1TS2 A;  4ANW A;  4IWP A;  1ACC A;  3ETR A;  3CSF A;  4LDT B;  4IOI E;  1Y8R C;  1FXT B;  2L32 A;  2BYE A;  4G50 A;  4S17 A;  2BKF A;  2K39 A;  4YTN B;  5EE0 A;  1WJ4 A;  3CIR B;  4OZC A;  1Q0W B;  1J7A A;  3HIZ A;  2BW2 A;  2KJH B;  2RPQ A;  3MC0 B;  2V0G A;  2KFK A;  1KLV A;  2DEN B;  2KDB A;  3VTW A;  3NRZ A;  3W1Y A;  5IA7 A;  4C80 A;  2KN4 A;  2KJ6 A;  2ZVN A;  4WWP A;  1YQ3 B;  4RFB A;  4WAA A;  3KUC B;  1YX6 B;  2LGX A;  2C7M B;  1XO3 A;  5DCN A;  2EKE C;  3B9J A;  1E0Z A;  4NNJ B;  3R2I A;  3Q3O C;  1OFF A;  4UDU C;  4ZYN A;  1P3Q U;  2WXI A;  3W1S A;  1WGG A;  3A9K A;  2KVZ A;  2G45 B;  2W9N A;  2WXF A;  1WSP A;  3HK0 A;  4MM3 A;  3IT4 B;  3PLU A;  4B0M A;  3AEE B;  3N30 A;  2W3R A;  1DOI A;  1MI0 A;  2NBV B;  3BK1 A;  4Q2J A;  2IGG A;  2HJ8 A;  2WXJ A;  1XLO A;  2JUO A;  3DQV A;  2KAJ A;  1IBX A;  2M56 B;  5J17 A;  3LB8 C;  3HVZ A;  4P1B C;  4IWQ A;  3TEX A;  3ML9 A;  1T5X D;  4TUU A;  3PRP B;  4YXD B;  4EUT A;  1QIL A;  1RRB A;  2B3A A;  3ZUN A;  2N9P C;  4HWI B;  3BVG A;  5H8Y E;  2ZW0 A;  2GI9 A;  5DPR A;  4A90 A;  4ZOH C;  2LGY A;  4GIV A;  2PJH A;  2BWF A;  1FNV A;  1R7S A;  1SXT A;  3GB1 A;  3EFC A;  3PGE A;  1V1O A;  2Z0D B;  1UGJ A;  2TSS A;  2O6V A;  2KKC A;  2IY1 B;  2BGF A;  3BIN A;  1D3Z A;  2IO3 B;  1LXD A;  3AU5 A;  1KM7 A;  1LM8 B;  4XYC A;  3I63 C;  3ONS A;  2MA9 B;  1N6Z A;  4OVV A;  1WMH B;  5HFY A;  4GU2 A;  4KSK C;  4ZDV A;  2KMC A;  4NY0 A;  2C9W B;  2BTE A;  4TQ1 A;  4FAD A;  1UNS A;  4GB9 A;  4HLE A;  2K3U A;  2KAC A;  4DHJ D;  1UBQ A;  5TSS A;  3NOB A;  2VH2 A;  1CJE A;  4DK5 A;  5E6O A;  4II2 B;  3WAO A;  4A20 A; 
#chains in the Genus database with same CATH homology
 4P1C C;  3RNG C;  3RNE C;  3DHH C;  3I5J C;  4P1B C;  3RNB C;  3RNC C;  3RNF C;  3N1Z C;  3N1X C;  3Q14 C;  1T0Q C;  3GE3 C;  3GE8 C;  3RI7 C;  3RNA C;  2RDB C;  2INC C;  3DHG C;  3RMK C;  3DHI C;  3N20 C;  3RN9 C;  1T0R C;  3Q3O C;  1T0S C;  2IND C;  3I63 C;  3Q2A C;  3Q3N C;  3N1Y C;  3Q3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...